2Y2KA

Penicillin-binding protein 1b (pbp-1b) in complex with an alkyl boronate (za5)
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
488
structure length
469
Chain Sequence
b'SEITYSDGTVIASIRDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTGQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PENICILLIN-BINDING PROTEIN 1B
publication title Structure-Guided Design of Cell Wall Biosynthesis Inhibitors that Overcome Beta-Lactam Resistance in Staphylococcus Aureus (Mrsa).
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
total genus 163
structure length 469
sequence length 488
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2y2kA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2y2kA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2y2kA02
4S2IA 4GN2A 5FQKA 4Y0OA 1ERMA 3OCLA 4E3OA 4Q8IA 4DXBA 3IXHA 4KZ6A 2OV5A 3MKEA 2HDRA 3IXDA 2JBFA 4U0XA 5FQJA 1PI4A 5GLCA 3WS4A 5M19A 1J9MA 2PBYA 4GKUA 4LENA 3PAGA 2XD5A 1LHYA 1XA7A 3A3DA 2B5RA 2HPBA 5F1FA 4KZ9A 3QHYA 4RX2A 4UA9A 1TDLA 3ZVWA 3SH7A 5CHUA 3IWIA 3C7UA 1QMEA 3IF6C 4OOMA 3ZNYA 3N7WA 1FSYA 3BECA 3PAEA 4LCMA 4D2OA 4S2NC 4E6XA 3BFGA 5F82A 2HDSA 5EVLA 5CGWA 3N8SA 2Q9NA 1H5XA 4N92A 4KG6A 3MBZA 2XH9A 1ALQA 1W79A 1XKZA 4YFMA 3EQVA 4RX3A 3IWQA 4HESA 4OP5A 3FV7A 2ZC3B 1ZG4A 2VGKA 3A3IA 3HLEA 3OZHA 5FI6A 1U60A 3G31A 5CEBA 3UDXA 1E3UD 4Y7PA 3UPOA 3MZDA 1NZUA 4S2OA 1SHVA 1ZKJA 3BLSA 2Y2HA 4P6BA 5F1GA 4Z9QA 2X71A 4CPKA 5AQAA 3LY3A 1TEMA 5HAIA 2JCHA 5E2HA 4E3NA 5A92A 3HLCA 3WS0A 3O88A 3ZHHA 3CZDA 3BLMA 2ZQ8A 4OPRA 1S6RA 2XD1A 3GQZA 1S0WA 3BYDA 5AQ7A 4DXCA 1BT5A 4QY5A 1KGEA 3UE3A 4N9KA 3G35A 3HLWA 3NI9A 4JXVA 1E3UA 3DWKA 3VP3A 3M6BA 2DCFA 1AXBA 4WMCD 4BD0A 3LEZA 3SS4A 1I2SA 3O86A 1XGJA 3Q1FA 1BLCA 3QNBA 2EFXA 1NRFA 3OPRA 3TSGA 4H8RA 4MEZA 4PM8A 3V39A 4F94A 1DJAA 5E2EA 5FSRA 1MWUA 1YLWA 4KZ3A 3ZCZA 4LV0A 2HP5A 1KE4A 4BQMA 4P87A 4ZJ3A 1QMFA 1XXMA 2WADA 3IF5A 1MY8A 4KZ4A 4OVDA 3PBRA 5AQ9A 5CERA 1CI8A 1VM1A 2G2UA 5GHYA 1IYOA 2C6WB 4LV2A 3IF6A 3MFDA 4BL2A 5CHJA 1SCWA 3Q82A 3WRTA 3IHBA 1K38A 1ES2A 1YLPA 4S2PA 3G2ZA 4WMCA 4S2NA 4JBFA 1BZAA 2Q9MA 4KZBA 3MXSA 4WYYA 5HARA 3WS5A 4UAAA 1KGGA 3N8LA 1PWDA 1RCJA 2RCXA 1I2WA 4FSFA 2WZXA 3GRJA 4JLFA 4C75A 4R1GA 4JKTA 1NYYA 4GOGA 1YLZA 2UWXA 3AGDA 2Y59A 5FQQA 5M18A 4KQOA 4LCLA 5CECA 1GHIA 1YLTA 2VGJA 4KZAA 1NY0A 2R9WA 3CMZA 4A5RA 1IKGA 3UE0A 3RXXA 1PWCA 4X55A 4BL3A 2WGIA 4DDYA 4Y0TA 2ZM8A 2Y2JA 5FI2A 1G6AA 2J8YA 1NYMA 3FKVA 3VP0A 5EOEA 5HFOA 2V1ZA 3A3JA 1YMSA 4ZTKA 4QJGA 2H5SA 4ZBEA 1VQQA 2XDMA 4XUZA 1TVFA 1XA1A 3C4PA 2E8IA 2H0YA 1BUEA 2ZLYA 3VP1A 2P9VA 1PW8A 4KQRA 4QHCA 4NETA 5EVIB 4EBNA 1C3BA 3W4OA 3E2LA 3LY4A 4R4SA 2R9XA 4RVAA 5GLAA 1MWTA 1TDGA 1FR1A 3P09A 2ZC6B 4DE1A 1L0EA 2FFFB 2XFSA 1MXOA 1SDNA 2HDUA 4E3LA 5CGXA 1YQSA 3C5AA 2HDQA 2WKIA 3PBQA 3ZG7B 3G30A 4DE0A 4IBXA 3UN7A 5FQIA 1E25A 3BEBA 2J9PA 2QPNA 4LV1A 5A91A 1DJCA 1SKFA 1L0FA 2JC7A 4S2LA 1SDEA 4PPRA 4E3KA 5GLBA 5KMWA 1K6SA 2X02A 4QY6A 3MZFA 3NIAA 1GA9A 4GDBA 1K54C 1YLYA 4X53A 5G18A 5JYPA 1ES3A 3BM6A 4S2MA 1RP5A 1JWVA 1W8YA 3W8KA 1Q2PA 2J9OA 3HUOA 2ZQ9A 4FCFA 4MLLA 1PYYA 1K56D 4PM6A 2ZQ7A 4IVKA 3NCKA 3SS3A 3V5MA 3S4XA 2DNSA 1N4OA 4P85A 3NC8A 3G4PA 4BENA 5FAPA 5F83A 5DTKA 3GR2A 2ZC5B 3UY6A 1NXYA 1L0GA 3VFHA 5FAQA 1M6KA 3Q7ZA 3HLDA 5EPHA 4WEKA 5FAOA 4X68A 3AGEA 5TGFA 4MBHA 3UE1A 1FCMA 4KG5A 4ZDXA 1ONGA 4X56A 2WKEA 3BFCA 2Y2MA 5HX9A 3NBLA 5TFQA 4S2JA 4S2KA 1K56A 1HD8A 5FATA 5GHXA 4EWFA 2WGWA 1EI5A 4E3IA 3C7VA 4YINA 2FFYA 5EVIC 1N9BA 4HEFA 1BTLA 1KDSA 4FD8A 2DRWA 1CK3A 5E2GA 3E2KA 4CJNA 5L2FA 1BULA 1EWZA 1MWRA 4GZBA 4Y0UA 5EECA 5TR7A 4IVIA 3JYIA 4OH0A 4EBLA 2G2WA 3BRMA 2WKHA 3NY4A 3S22A 5DTSA 1YLJA 2PU2A 3UPNA 1HZOA 3D4FA 1MKIA 1XP4A 1NZOA 2Y2KA 1O7EA 3IT9A 4OQGA 1DY6A 1WYCA 4OQ0A 3ZVTA 1PIOA 1KE0A 5CEDA 5EUAA 4DRTA 1GHPA 3M6HA 4IEDA 2Y2PA 2Z2LB 5FI7A 4UHUA 2HP6A 2ZD8A 3C4OA 4OPZA 3TOIA 3DW0A 3ZDJA 1YT4A 2ZC4B 4OP8A 1K54A 3MKFA 4QB8A 4R0QA 3IHAA 1ES5A 2ZMAA 3IH9A 2XR0A 5EOOA 4NK3A 5BOHA 2Y91A 4XXRA 5HL1A 5GLDA 3Q7VB 4C6YA 3UNWA 4ZAMA 4E3MA 3MZEA 3WRZA 3GTCA 3VP2A 1CEFA 2Y2LA 2ZJ9A 1ESUA 2I72A 2OLUA 3BFFA 2WYXA 4OONA 2Y55A 1ONHA 5FDHA 3VOZA 4WEJA 3P98A 1YM1A 4UA7A 1W7FA 5IHVA 1LLBA 2EX2A 1HVBA 1L0DA 4ID4A 4R3JA 2EXAA 4ZJ1A 3V3RA 2WZZA 3VP4A 5A90A 4MBFA 2XQZA 2WAEA 3UDFA 1O07A 4XUXA 5KZHA 4WZ5C 1LI9A 1RGZA 4JPMA 4FH4A 2A3UA 1ES4A 3HLGA 4K91A 2EX9A 4N1HA 3OPPA 4ZJ2A 1ZC2A 4BD1A 4FH2A 5EVIA 3PTEA 4OOLA 4JF4A 4WELA 1LL5A 2ZQDA 4KZ8A 2Y2NA 3CG5A 3IXGA 1H8YA 1GCEA 2WAFA 3HL9A 1MPLA 2QMIA 3GMWA 3N6IA 3NDGA 5CRFA 5DVAA 1IELA 1KGFA 4O7DA 4OLDA 3QNCA 3N4IA 3O87A 1JTGA 1MBLA 2V20A 2H0TA 1LL9A 1WE4A 2PU4A 1CI9A 3HBRA 2Y2OA 5FASA 1G68A 2Y2IA 4GD8A 4OLGA 1Y54A 2XK1A 5KSHA 1K4EA 3GV9A 4PMAA 4OQIA 1BLPA 2OLVA 3M2KA 4EBPA 2IWDA 3ZG9B 1JVJA 2ZQCA 1IYSA 3LO7A 3IXBA 1FCNA 1JWPA 1KVLA 2WUQA 1FCOA 2CC1A 2QZ6A 4B4XA 3IWOA 4GDNA 4QD4A 3N8RA 3ZFZA 2XF3A 3Q81A 1MWSA 2P9VB 4MNRA 2GDNA 5CHMA 2WK0A 5CTNA 3ZG8B 3PBTA 4OKPA 1L2SA 1PWGA 4RYEA 5GL9A 2BLSA 5DF7A 5DF8A 1K55C 1DJBA 4DF6A 1LI0A 1K25A 4JXWA 3M2JA 1PI5A 3EQUA 4B88A 3ITAA 3ZG5A 4WBGA 4HBUA 3FZCA 4GNUA 4IBRA 4OOYA 4KENB 2XEPA 4KZ7A 4BLMA 5FQ9A 3V50A 1NJ4A 4OPYA 2IWBA 4U3TA 3PBOA 1PZPA 4WZ5A 2XLNA 3O3VA 2X01A 1W8QA 3VOYA 4UA6A 1FOFA 1BLSA 5M1AA 3AGFA 5CXWA 1GA0A 1K6RA 3WS2A 5AQBA 4B4ZA 1PW1A 2ZM2A 2Y2QA 1YMXA 2V2FF 5HAPA 4MBKA 3FYZA 1W5DA 3W4QA 2H10A 2XFTA 1KDWA 4QU3A 3V3SA 5JYOA 2ZM0A 1K57C 3HREA 3RXWA 2P74A 1FQGA 3WS1A 1H8ZA 4OPQA 3SH9A 3DWZA 4DDSA 4DE2A 3OPHA 3UPPA 2ZC7A 4JF6A 2EFUA 2RL3A 4GD6A 4L0LA 4P0MA 5CTMA 5FA7A 3BFDA 3SS5A 2Z2MB 4JXGA 5GHZA 3B3XA 1RGYA 4E3JA 1ESIA 4PM9A 3ZGAB 4E6WA 1IYPA 5CGSA 1CEGA 3SH8A 4KZ5A 2WGWB 3HLFA 4X6TA 2OSUA 5DF9A 3A3FA 3FKWA 3Q7VA 3VSLA 3Q07A 5D3OA 2IWCA 3UDIA 1FSWA 3OPLA 4DE3A 2C5WB 3IH8A 3IQAA 4JF5A 3PBNA 5I94A 4LV3A 2EX8A 4GB7A 5KSCA 5E2FA 1HTZA 1Z6FA 4K0WA 5J8XA 1FR6A 4N9LA 2Y4AA 3ZG0A 3VMAA 3ZNTA 5E43A 5U47A 4M3KA 3HUMA 5EE8A 2WGVA 2J7VA 1JWZA 3HUNA 5EVID 4KG2A 4JXSA 1BLHA 1ZG6A 3CJMA 1K55A 3FWLA 3SOIA 3OC2A 5FQMA 3G2YA 1BSGA 4PM7A 4R3BA 2ZQAA 2HP9A 3LCEA 4R4RA 1ERQA 2JE5A 1IKIA 1JTDA 3NDEA 1KVMA 1XGIA 1XX2A 4N1XA 4RA7A 1IEMA 3GVBA 1XPBA 3HLBA 3ITBA 4WM9A 4WZ4A 4EQIA 5HW3A 1Q2QA 3IF6B 1K4FA 3RJUA 3WWXA 1WYBA 3BFEA 3GSGA 3UO9A 4KQQA 2EX6A 4OQHA 4C3QA 1OMEA 4PM5A 1I5QA 1PZOA 2XGNA 2Y2GA 2EXBA 3VSKA 3OCNA 5DTTA 3S1YA 1GHMA 1IYQA 3I7JA 3G34A 3A3EA 4X69A 4U0TA 1E4DA 3W4PA 1K57A 4DKIA 3HVFA 4K0XA 1EROA 3ISGA 3MXRA 1KE3A 3G32A 4EUZA 2A49A 3VFFA 3PBSA 3TG9A 2BG1A 4HBTA 4EV4A 5A93A 4BJPA 1M40A 4R23A 5HAQA 3DTMA
chains in the Genus database with same CATH superfamily
4S2IA 4Y0OA 3OCLA 3X1VC 3AFAC 3IXHA 4KZ6A 4DXBA 2VGLS 4J8XB 2HDRA 3UTAD 3MQLA 1S32D 3W96A 2XD5A 1P3MA 3LR3A 3X1UC 2L4RA 1J3WA 4DQYB 5G49A 3MGSA 1TDLA 5CPIA 3H9WA 2VX8A 1QMEA 3L29A 3IF6C 4OOMA 1P3KD 4DRBA 3KS4A 2Q9NA 1N1JB 4FTXA 3MBZA 3AZEC 1ALQA 1XKZA 1WA9A 3KYZA 4RX3A 3FV7A 3IP4C 5TBMB 2M7VA 3KXBB 4MB3A 4L9FA 2FJ7A 2R78A 3AYWA 3X1VD 1BH9A 3REIA 3AFAD 1VEUB 4I39A 5F1GA 2ACGA 1U35B 4CPKA 5B24B 1W1YA 5EVEA 3EPKA 3O88A 2ZQ8A 3W98C 1S6RA 1T1CA 3GQZA 2YFVB 3O62D 2M1CA 2JKTI 2W3HA 2W3GA 4I38A 1SZVA 4N9KA 4Z66B 3HLWA 3NI9A 1AOIA 3MJQA 4KHAA 2V0UA 4Y17A 3SS4A 3AZIA 1I2SA 2HF6A 1XGJA 3QNBA 3TSGA 4MEZA 3MGPC 4PM8A 2J3WA 5E2EA 4F94A 3E4PA 4AWLB 1YLWA 1KX4C 2HP5A 2JHEA 3B6FC 3WAAB 1XXMA 5CERA 1VM1A 5GHYA 1IYOA 3MFDA 3WRTA 3LEQA 3UT9C 4WMCA 3MXSA 3VH6A 3KWQA 1IOUA 3C1BD 1IFQA 4FSFA 2XRNA 4JLFA 3WTPA 3MNNB 3X1TB 3GDIA 3W98D 4GOGA 1YLZA 2NZDB 2Y59A 1M19C 4EESA 1YLTA 2VGJA 4KZAA 2W27A 4A5RA 4R8PC 1IKGA 1ULYA 1P3PC 3L26A 1PWCA 4X55A 3D3OA 5AV6C 5FI2A 1TZYB 2W3DA 3FKVA 5JRGB 5B1LC 1P3MD 2PYRA 2QWSA 3MGPD 5EOEA 5HFOA 2CMNA 4ZTKA 4QJGA 2QYBA 4ZBEA 2XDMA 4X23C 4XUZA 5F99C 1KX4D 1XA1A 2NUTC 2ZLYA 4H9OB 1ID3C 1TS6A 5CPID 4KQRA 1X0OA 4QHCA 1UGUA 3LY4A 4R4SA 5AY8B 3UT9D 2A2LA 1MWTA 3R7WA 2GNXA 3SW1A 1L0EA 2XFSA 5B2JB 3UB6A 4J8WB 3C5AA 1NLYA 4IJEA 3OOVA 4IBXA 2V0WA 4DE0A 1E25A 2QPNA 3AV2A 1L0FA 1SDEA 3H82A 2FJ7D 4WU8C 4JGOA 2JKRI 1K6SA 4R8PD 4IJFA 1P3PD 3PYPA 1YLYA 1ES3A 3MQQA 2WKQA 5EM0A 3C1CA 1E15A 2DF4C 3AZFA 3NCKA 3FPVA 5AVEA 3SS3A 4P85A 3G4PA 4BENA 5FAPA 4HQAA 5F83A 4ARZA 5GXQB 2ZC5B 3W96B 1NXYA 1L0GA 1VETA 1M6KA 5FAQA 1BH8A 3HLDA 2HJ9C 1ID3D 4NZ4A 3E98A 4PHTA 5TGFA 1LSVA 3AZLB 3MGSB 2WKEA 3BFCA 2FH5A 3NBLA 4BBTA 5TFQA 4S2JA 1K56A 3L27A 2QJ7A 4H9SC 4LFUA 1H8PA 2FFYA 5CPKC 4OJPA 3WKJC 3FKEA 1BTLA 2PAVP 1MKMA 4FD8A 1CK3A 3E2KA 3HJKA 1W1PA 3BY9A 2YFWA 1EWZA 4GZBA 3NECA 4IVIA 4HHDA 4H9RA 4EBLA 5MC7A 2G2WA 2F8NK 1YSQA 3BRMA 3HCYA 3KSFA 3AL0C 5AV5B 2PU2A 2O99A 1KU5A 2JSSA 2Y2KA 3REIB 3IT9A 4B93A 4OQGA 3OBFA 1WYCA 3ZVTA 2RIQA 5CEDA 3X1SA 4DRTA 1GHPA 2CV5C 2DQNC 1SKOB 3M6HA 3W97A 4E45A 2Z2LB 1M1AB 5FI7A 1P3BB 4UHUA 2V9AA 3LIFA 3TOIA 1YT4A 2WKPA 4BWIA 5KMWA 3IHAA 5B40A 2XR0A 4R6LA 5BOHA 3AZKA 3TU4A 3UTBC 1AOIB 3UNWA 2G5IC 3MZEA 3REKC 4HGAC 3AZIB 3VP2A 5CPKD 4GW9A 5HWVA 2ZJ9A 5B1MA 4XZQA 4OJ6A 4H9NA 2D49A 4OONA 1ONHA 4KUOA 2ZY4A 4WEJA 5AVBC 4UA7A 5IHVA 3UB7A 4J8VB 1L0DA 3AN2C 5I5LA 2WZZA 3WD2A 4NXBA 1NRJA 5KZHA 4DRAA 1PRQA 1W1TA 1ES4A 3HLGA 4O01A 3KWQB 3PTEA 3GECA 2CV5D 3LJAA 5CPJA 4DN0A 5B31A 3CG5A 5BS7A 4WU9C 3NDGA 5CRFA 2NQBC 4NE6A 1IELA 1P3IA 4LGWA 2J8PA 3A6NA 1P3FA 5AV8A 2PU4A 3UTBD 3HBRA 5FASA 4ETZA 1G68A 4GD8A 5KSHA 4HIAA 3REKD 1K4EA 5L10A 3GV9A 4PMAA 3AZJC 2OLVA 3K3DA 3F1PA 3B6GC 3MSHA 3ZFZA 2XF3A 5CTNA 1CK7A 4E44A 1H8MA 3PBTA 1MZUA 4ZUXC 4OKPA 1PWGA 2O9AA 1YKDA 5DF8A 1K25A 5CX7A 4JXWA 3SZTA 1DP8A 3H0LC 5GSUA 4WU9D 3ZG5A 2NQBD 2HUEC 2W3EA 3FZCA 4OOYA 3H82B 3IX8A 4KENB 3E4OA 5FQ9A 3V50A 2IWBA 4WNNA 1PZPA 4YWZA 2OAQ1 3X1SD 4E04A 4QLCB 3C1CB 3KUYC 3AZJD 1GA0A 4IBGA 3AZFB 2QHKA 3AGFA 5AQBA 4CLCB 1PW1A 3S7OA 2ZM2A 3AZNA 4Z2IA 2YKFA 5HAPA 4IJGA 3AZGC 3W4QA 4ARZB 2H10A 2XFTA 3PXPA 5JYOA 2ZM0A 1BH8B 5F68A 4KGCC 1N9LA 3RXWA 2P74A 1FQGA 3AZKD 4H6JA 3A1IA 3LELA 1E6RA 3LUQA 3OPHA 3UPPA 3VOLA 2W0NA 2EFUA 2RL3A 5B33B 4GD6A 4JF6A 4L0LA 4P0MA 5FA7A 3T4LA 4LD9A 4EEUA 3B3XA 5TJJA 2HIOB 5B1MD 1ZLAB 3VH6T 3T1SA 3SH8A 4KZ5A 5AVFA 4OJLA 3HLFA 5B32A 5DF9A 1Q9CA 1S1ZA 3Q07A 5AVCA 2IWCA 4DE3A 3IQAA 1M18C 5I94A 4GB7A 1P34C 1FR6A 3VMAA 5E43A 1P3OA 2J3TC 5U47A 4M3KA 4P6ZM 2J7VA 3HUNA 4KG2A 1HQ3A 1CJFA 4PM7A 5B31D 3BQAA 2HP9A 1XJ4A 3RELA 3LCEA 4R4RA 3UB5P 1IKIA 1XX2A 4NE3A 4N1XA 4UQIS 4KGCD 3W97B 3MGRA 3CWFA 1YUEA 3AZMA 1Q2QA 4IUHA 4H9QB 5C3IC 1K4FA 3UO9A 2QJ5A 5B40B 1OMEA 4C3QA 3TU4B 4EU0A 5F69A 3KFUG 2XGNA 3VSKA 4HP4A 1D06A 4JJNA 4JGQA 1GHMA 2AROC 4XZQB 4Z5TC 3A3EA 4DKIA 1M18D 3HVFA 4K0XA 1O6IA 1EROA 3ISGA 1P34D 3G32A 2J3TD 3TG9A 2BG1A 2VK3A 2INWA 5HAQA 1W63Q 3UE6A 4PKYA 4OUIA 2ZY5A 4HJ6A 3LZ1C 3LJAB 4R38A 2JBFA 4U0XA 2LB5A 1PI4A 5FQJA 5L09A 3WS4A 5M19A 1KX3B 2V8FA 3LGOA 3MR0A 3AV1B 4XUJA 2HV1A 2P7JA 3LYXA 1P3IB 3A3DA 2B5RA 2HPBA 1OJGA 1P3FB 1WWIA 3A0VA 3NOPC 3QHYA 4RX2A 4UA9A 3SH7A 3G6OA 4ZRRA 3C7UA 3M7PA 4EXOA 4MN7A 3PAEA 2JN7A 3BECA 4Z5TD 4D2OA 1KOUA 3MF0A 3BFGA 1EQZC 3NQJA 5F82A 2EWWA 3UTAA 2HDSA 4Y15A 3N8SA 3F1PB 4N92A 4KG6A 1V9YA 4KUDB 2EWVA 1KX5C 1P3LA 3LZ0C 1ZG4A 2VGKA 2ZC3B 3OZHA 4CQHA 3HSHA 4HH3A 1GOIA 2ZY3A 3MZDA 4S2OA 1SHVA 5AVCD 1ZKJA 3QP5A 3LZ1D 4WJ3C 2X71A 1P3KA 4O0PA 3EGXC 4E3NA 1WWSA 5GT3A 3FC7A 5CP6A 3MGQB 4CLCE 3QP4A 3K2NA 4J8XC 3WA9B 4NEED 4F3LA 4DXCA 1BT5A 5CHLB 3MS6A 4JGRA 4IHQA 3X1VA 1XJ2A 3VP3A 3AFAA 3M6BA 1AXBA 3CAXA 3LEZA 3AZNB 3RTYA 1LL8A 2PYOB 1A0KA 4H8RA 1DJAA 5FSRA 3X1UA 1KX5D 4Z2KA 3ZCZA 3LELB 1KE4A 4BQMA 3O62A 4ZJ3A 5AQ9A 2WADA 3LIDA 1CI8A 4LD9B 4OJOA 4EETB 2BYKA 3IF6A 4GHAA 4LG2A 5CHJA 1SCWA 1OTBA 1STZA 3C8CA 3IHBA 4HH2A 4Y3IA 1ES2A 3V39A 3G2ZA 1ACFA 4JBFA 4KZBA 5HARA 2VZWA 5B32B 3N8LA 5L8MA 2RCXA 2WZXA 5HSQA 4C75A 4R1GA 2UWXA 4PAUA 1GSWA 4WZSB 5FQQA 4EQ1A 4KQOA 5AV9C 2VEAA 3T1RA 5CECA 5GT0C 2BASA 2R9WA 3C38A 3CMZA 1HQ3B 3RXXA 4I5SA 3N3FA 2WGIA 2Y2JA 4Z2HA 5LBRA 4QNLA 4GLQA 4XUJD 3RELB 3A3JA 3IX4A 3BJNA 3W98A 1JFIA 3MGRB 1TVFA 5DNMB 3AZMB 2E8IA 5DFYA 3KSYA 4NETA 5EVIB 3E2LA 4RVAA 5GLAA 4JJNB 4LLOB 4NZ3A 1FR1A 3P09A 3IS2B 4DE1A 5E5AB 3WAAC 3MGPA 4Q0HA 1TAFB 1SDNA 2HDUA 4E3LA 3ZG7B 3LIBA 2HDQA 3G30A 5FQIA 4EO5C 1P3LD 1KX4A 3BEBA 3F1OB 4LV1A 1P3GB 3B6FA 1P0ZA 3IBRA 5AV9D 2D01A 5GLBA 4QY6A 5GT0D 4WLAA 4LRZE 4HNBA 3NIAA 1GA9A 4GDBA 4IBJA 5G18A 5JYPA 3UT9A 1RP5A 1Q2PA 4FCFA 5B2IC 5C5KA 1PYYA 3V5MA 1YU1A 3WD4A 2F8NG 2L1MA 3LFVA 3S4XA 5GT3D 1N4OA 5CP6D 3NC8A 3GR2A 4HOIA 3VFHA 1M19A 4WEKA 4X68A 3R45B 3AGEA 5JRGC 4R8PA 5DNNB 1P3PA 3NOUC 1ONGA 4X56A 3MXQA 5AV6A 1HLUP 5BNXB 5JA4A 1HD8A 4EWFA 2WGWA 1EI5A 3X1UD 4H9PA 3B33A 3NQJB 4X23A 1N9BA 5F99A 3UTAB 1VB6A 3QP2A 3REJC 1S32B 1KDSA 4MDZA 5AY8C 5E2GA 1E8BA 1ID3A 1BULA 4MN6A 1MWRA 4D60A 5B2JC 3T50A 3T1QB 5FEGA 1DRMA 3S22A 3JPUA 1YLJA 4NE5A 1HZOA 1MKIA 5B2ID 1XP4A 1NZOA 4QWOA 3AZED 1DY6A 4CSRB 3VV4A 3H0RC 1P3KB 3EOIA 4IEDA 5BT1C 1OTEA 4WU8A 3V67A 3F6TA 4OPZA 5HDDA 4F3LB 2ZC4B 3W99C 3MKFA 5DFXA 2ZMAA 1AWIA 5GXQC 4XXRA 4Y13A 5HL1A 3X1VB 3AFAB 5L07A 3WRZA 3KYQA 3GTCA 1YU0A 2PR5A 2Y2LA 3AZLC 3D72A 3REJD 2YKHA 1ESUA 2I72A 5AY8D 3S7QA 3P98A 1YM1A 2O9BA 4HI4A 1W7FA 1HVBA 3O62B 4ZJ1A 1O07A 1S66L 1B6WA 4H9SA 1RGZA 4K91A 5CPKA 1ZC2A 3WKJA 1LL5A 3B6FD 3A0SA 5AV5C 2ZQDA 4KZ8A 2Y2NA 3IXGA 3REIC 1H8YA 1GCEA 2WAFA 1MPLA 3GMWA 3W99D 5B0YC 2VGLM 1F1EA 1WE4A 1M1AC 1PFLA 1P3BC 3REHC 2XK1A 3BWLA 3DBAA 1BLPA 1T3UA 3F1NB 2CV5A 4G91B 3C1BB 1M19D 1DP6A 3ZG9B 4IUKA 2ZQCA 1IYSA 1R4VA 3LO7A 3W98B 1JFIB 3H0MC 2WUQA 1KVLA 1FCOA 1FILA 2QZ6A 5KDMA 3B0DC 5A8BA 4J8UC 3Q81A 3AZIC 5AV6D 1E6NA 2WK0A 3TJZC 3UTBA 2B02A 5B1LD 2KOIA 4WL9A 1L2SA 3ZYTA 2LB9A 3REKA 4X23D 5F99D 4J8VC 1T18A 1K55C 3CHWP 5DF7A 2O0YA 1P3MB 3MGPB 1T1AA 4HMCA 1KX4B 4WBGA 5B0ZC 5G49B 4B9OA 3AN2A 2XEPA 5CPIB 5B0YD 4KZ7A 4OPYA 1D1JA 3AZHC 1W8QA 1P3BD 4UA6A 3UT9B 3REHD 1FOFA 3CPTA 5M1AA 1GSXA 2PYPA 4QPRA 4B4ZA 1YMXA 4WU8D 4MBKA 1H0MA 4WU9A 4HMEA 3TE8A 2NQBA 1KDWA 3EPJA 4YS3C 1BYWA 5J7EA 2Y79A 3HREA 4J8UD 3LR5A 4OJ5A 2VV6A 2FJ7B 5BNVA 2P04A 3AYWB 3DWZA 4DDSA 1BH9B 4R8PB 2ZC7A 1P3PB 3SS5A 3FDDA 1GSVA 1F66C 1RGYA 4E3JA 2E8JA 3AZJA 5JA4B 1TD5A 5CGSA 1CQAA 2WGWB 4H9PB 5J3WA 4MB5A 3Q7VA 3VSLA 1MC0A 3UDIA 5B0ZD 1Y4OA 3B6GA 1ID3B 2EX8A 1D7EA 4K0WA 1Z6FA 2QKPA 2Y4AA 3AZHD 2VLGA 4ZUXA 4KHAB 5HD3A 3IBJA 4LRYC 4JXSA 3WKJD 1LSWA 1XJ3A 1BSGA 3G2YA 3VH5W 4NYUA 2Z6DA 1ERQA 1JTDA 4YS3D 4RA7A 1IEMA 3GVBA 4WZ4A 3P01A 5HWTA 4QLCC 3WX7A 5HW3A 5DKLA 4CLCC 3WWXA 3BFEA 4Q0IA 3NOTC 4OQHA 1I5QA 1F66D 4YM6C 3KUYA 2Y2GA 4Q0JA 5DTTA 3S1YA 3WTPB 1E88A 3AZGA 5DKKA 3I7JA 5B33C 3T4SA 3W4PA 4KGCA 2HIOC 1ZLAC 3MXRA 3B0CW 3CLOA 3O5YA 1M40A 3JVVA 1NWZA 4NG2A 3DTMA 3EPLA 5FQKA 4E3OA 3K3CA 5CPKB 5AVBD 3MKEA 2RVQC 3AN2D 1M18A 4MMNA 4ZBJB 1J9MA 2PBYA 4GKUA 4LENA 3BW6A 3PAGA 1P34A 1LHYA 4DJ2A 1XA7A 2K2NA 1GPFA 3R7WB 3W2ZA 4YM6D 3L28A 5HZHA 3ZVWA 1DP9A 3ZQ5A 1S1YA 2F8NH 1GXDA 4G92B 3AV2B 5IT5A 4S2NC 1F5MA 2UV0E 1QO6A 2HIOD 5CGWA 2GX5A 1H5XA 2CWEA 2XH9A 5KDMB 2PRFA 3EQVA 2KLIA 3A3IA 3UTBB 3HLEA 1AIWA 1YSPA 5FI6A 5EFWA 3NHQA 5CEBA 2V5OA 4HGAB 1E3UD 4Y7PA 3RH8B 4P6BA 1VETB 3B6GD 4Z5TA 2RVQD 5AQAA 1A7WA 3LIEA 3LY3A 3T12B 1Y28A 2JCHA 5A92A 3ULFA 3WS0A 1YAXA 4ZUXD 1S4RA 2XA7S 3PHYA 4OPRA 3IX3A 1S0WA 3BYDA 5AQ7A 1KX3C 1J7MA 1KGEA 3G35A 3AV1C 3CPTB 4UUZA 2DCFA 2HGVA 3LZ1A 4BD0A 2YFWB 1P3AC 1E6ZA 1YU4A 3O86A 2BYMA 4WU9B 4H9RB 4UEYA 2NQBB 3T1XA 3NQUA 4I3AA 4Z2LA 4KZ3A 3KUYD 4P87A 3C2WA 4KZ4A 1MY8A 4XT2A 4M4XA 3AZGD 3X1SB 3BY8A 3AZJB 3Q82A 4KUDC 4S2PA 1BZAA 2Q9MA 2ZL1A 3FG8A 4UAAA 1KGGA 1YU3A 2IO5C 3GRJA 2G5HC 4HJ3A 3AZKB 1KX5A 3LZ0A 5M18A 4NYYA 2MJ6A 1NY0A 5BO0A 2JKFA 5B1MB 3MGQC 4BL3A 4H9NB 2ZM8A 1G6AA 2B18A 1P3AD 3WA9C 1NYMA 2WKRA 5G4YA 2HUEB 2H5SA 3WTPE 1VQQA 3C4PA 4HMDA 4J8XA 2H0YA 1BUEA 1H0GA 3VP1A 2PD8A 2PYOC 4NXGA 3KSGA 4EBNA 1K0KA 2R9XA 5CPJB 4X25A 1TDGA 5B31B 4EERA 4IBIA 5AJGA 3L9KA 2FFFB 2A24A 4EEPA 1MXOA 3UB8A 2P08A 5DJTA 3T4KA 1YQSA 4KGCB 3PBQA 3MVDC 3A6NB 5AV8B 3UN7A 4S2LA 1ED7A 3ICYA 4PPRA 3WD1A 3EEHA 2NUPC 1N1JA 2AROD 1K54C 4ETXA 4X53A 4AFIA 4S2MA 1JWVA 1W8YA 4EQIA 4MLLA 4IBEA 2Q0OA 4PM6A 2ZQ7A 4Z2MG 5TBMA 4G3WA 2DNSA 1M18B 4MN5A 3UB9A 5DTKA 3UY6A 1P34B 2XROA 5EPHA 5AV9A 5GT0A 4GCZA 4MBHA 3UE1A 2F8ND 4KG5A 4ZDXA 1UWPX 5HX9A 5FUGA 5DNMC 4EW7A 5GSUB 3MQOA 5FDSA 2GZAA 4E3IA 3C7VA 3MVDD 5EVIC 4WNNB 4CJNA 5C3IB 4Y0UA 5E5AC 4OH0A 2WKHA 1EQZD 3D4FA 1P3GC 1O7EA 3WAAA 1XFNA 4Z5TB 4OQ0A 3DTEA 5EUAA 4H6JB 3LZ0D 2W3FA 2HP6A 2ZD8A 4NXEA 2V1BA 4OP8A 4QB8A 4E3MA 3BQ8A 5EOOA 2ZOIA 4NK3A 5DNMD 5B2IA 3EEAA 1P97A 1XJ6A 4UQIM 4C6YA 3KXBC 5AVCB 4UUZB 2JKTM 3AZEA 4ZAMA 3LZ1B 5FEFA 5DNNC 4J8XD 1U35C 3U4LP 2OLUA 3BFFA 1P3OB 2WYXA 5FDHA 3VOZA 5F5YA 5B24C 3NQUB 3T4OA 5E5AD 4LPZA 5JRGA 4ID4A 4R3JA 3V3RA 3VP4A 1B67A 4MBFA 5A90A 2XQZA 3UDFA 4XT2B 4XUXA 1S32C 1E6PA 1ODVA 3T4JA 4WZ5C 3HJIA 1LI9A 3KS8A 4Z66C 4FH4A 4N1HA 4BD1A 3OPPA 4FH2A 3CI6A 4JF4A 4WELA 3REJA 1TS7A 5AY8A 4DJ3A 3HL9A 1KX5B 5DVAA 5B2JA 3EGDC 4IBFA 2L5AA 1P3KC 4AWLC 3QNCA 3VE4A 1JTGA 2H0TA 1LL9A 5BO0B 5IS1A 1CI9A 2ZM5A 3KXBD 2Y2IA 1UR8A 4I3JA 1Y54A 2G7UA 2ZMVA 3M2KA 1U35D 4EBPA 1JVJA 3JVUA 3QP1A 5B24D 3IXBA 1FCNA 1JWPA 3C30A 3S7NA 4B4XA 4WUJA 3IWOA 1OJ5A 3N8RA 3MNNC 3X1TC 3W99A 2VJWA 1MWSA 2NZDC 5GXQA 3ZG8B 2PDRA 4M6BA 4Z66D 5GL9A 4GHLA 3LI9A 2BLSA 3AZLA 4XUJB 3O62C 1DJBA 2A24B 4DF6A 1LI0A 3DTIA 1TZYC 3V9RA 3TRCA 3EQUA 3ITAA 4LRXC 4O8GA 2M7UA 4GNUA 1CXWA 4IBRA 5B32G 3KYEA 1UWNX 3WAAD 4U3TA 5B1LA 2XLNA 3O3VA 3VOYA 2JKRM 1XFQA 1BLSA 5CXWA 1S67L 3CUEC 3WS2A 5HD5A 5AV5A 4L9EA 2Y2QA 1LT0A 2V2FF 3FYZA 1NLZA 1P3LB 4QU3A 4NFTA 3MNND 4J8WC 3X1TD 1K57C 5AV9B 3MQ0A 5B0YA 4BBVA 2NZDD 1SKOA 3QP6A 4G91C 5GT0B 3C1BC 4DE2A 4EUVA 4GHIA 1M1AA 3BFDA 4JXGA 1P3BA 4NY2A 5FUGB 3REHA 4Z2JA 4PM9A 3ZGAB 4E6WA 3VH6W 1CEGA 5K5BA 4IBKA 5GT3B 5CP6B 1TZYD 3B0BA 2FN2A 2OSUA 3A3FA 3FKWA 5JRGD 5D3OA 1T1BA 1UR9A 1FSWA 3EG5B 2C5WB 3IH8A 4J8UA 2XSSA 3W96C 1HTZA 3S7PA 1P3MC 2V8CA 3ZG0A 3ZNTA 3L2AA 2Z6CA 1Z2CB 1OTIA 1TS0A 5EE8A 2WGVA 1JWZA 3EWKA 5DJUA 1ZG6A 4J8VA 1OGGA 1K55A 3MGSC 3OC2A 2ZBBA 4R70A 1OPXA 5CPIC 4YNRA 1FIKA 3X1UB 2ZQAA 4Y5FA 2JE5A 4EO5B 5B2JD 1KVMA 5B0ZA 4J8WD 4X1MA 4PKYG 4WM9A 3ITBA 1PNEA 2BYKB 3IF6B 3UMDA 3RJUA 3GSGA 3AZHA 2EX6A 4PM5A 5HL6A 5B2IB 5BT1D 3AZEB 2FJ7C 4FUWA 4KUKA 3AYWC 5HPIA 1IYQA 5HDCA 1N9NA 4YS3A 4U0TA 5GXQD 3B42A 3W96D 1EW0A 3A0RA 1KE3A 4EUZA 2K31A 2JKGA 1F66A 3AZLD 4R23A 4X69A 3MGSD 1H0IA 4GN2A 1ERMA 4Q8IA 1P9WA 1AOIC 4YOFA 2OV5A 3REJB 3IXDA 5G4ZA 5GLCA 4ME4A 4L9GA 3T4QA 2LY8A 3KO6A 5F1FA 4KZ9A 1W63M 2PHYA 3VE3A 5AV5D 2PR6A 5CHUA 3L7HA 3IWIA 4Z2MH 3AYWD 3REID 5AVBA 3ZNYA 3N7WA 2B95A 1FSYA 4LCMA 3B6FB 4E6XA 3KWQC 5EVLA 4QLCA 1YPRA 4CLCA 3WTPC 1W79A 4YFMA 1M1AD 4K08A 3W99B 1TS8A 3WD3A 3IWQA 4YM6A 3P7NA 4HESA 4OP5A 2F2AC 1U60A 3G31A 4Z2GA 3E4QA 3UDXA 3UPOA 1AOID 3LIAA 2OOLA 1NZUA 3BLSA 2Y2HA 5B33A 4Z9QA 1M19B 3P5JB 3AZID 1TEMA 5HAIA 5E2HA 2HIOA 3V9RB 1ZLAA 3HLCA 3ZHHA 4R3AA 3CZDA 3BLMA 5AV6B 1KS0A 1H3QA 2XD1A 4J8VD 4UPKA 4QY5A 5B1LB 2DMWA 4ZBJC 4IBCA 3UE3A 3HONA 4JXVA 1E3UA 4X23B 1T19A 5F99B 3DWKA 3RFBA 1G6OA 4WMCD 4WV4B 3KWQD 4Y2FA 3Q1FA 1BLCA 2EFXA 1NRFA 3OPRA 4TX8A 3WTPD 4NZ1A 1MWUA 5B0YB 4G92C 4LV0A 3AV2C 4BMWA 2VA0A 4GHIB 1QMFA 3IF5A 4OVDA 2EA9A 2PT7A 3PBRA 5F6AA 3UMEA 2G2UA 3REHB 2C6WB 3CITA 4LV2A 4H9QA 4NKPA 1K38A 1YLPA 1YU2A 4S2NA 4WYYA 4WU8B 3C1CC 5IU1A 3WS5A 4HJ4A 3AZFC 4P6ZS 1PWDA 1RCJA 1I2WA 3B0DB 4J8UB 4JKTA 1NYYA 3B47A 3AGDA 4LCLA 1GHIA 3PR6A 2H28A 3LR4A 1G28A 4KQDA 3UE0A 4WF0A 4Z1WA 4DDYA 4CAYA 4GS9A 2HZ5A 4Y0TA 2J8YA 4BL2A 1JNUA 3VP0A 2V1ZA 1YMSA 3VH5A 5B0ZB 4ESPA 1TF1A 3MFXA 3R4KA 3AV2D 3DAVA 5HPFA 3AZHB 2HJEA 3FPWA 2P9VA 1KX3A 1HTAA 2VKSA 1PW8A 3AV1A 1C3BA 3W4OA 3WKJB 3KSHA 2FZ0A 1P3AA 4QLCD 3C1CD 2ZC6B 3AZFD 4CLCD 4YS3B 5CGXA 2WKIA 3X1SC 2J9PA 5A91A 1VHMA 3U2AA 1DJCA 1SKFA 2JC7A 3W97C 4MB4A 2W1RA 4E3KA 2X02A 3WD0A 3MZFA 1OTAA 1F66B 5B33D 2CV5B 4KUDA 3BM6A 5B40C 3AZKC 3TU4C 3W8KA 2J9OA 3HUOA 2ZQ9A 1ZLAD 1K56D 4IVKA 3KSIA 4BBUA 1ZTUA 1PDCA 2RTSA 3H7WA 5B1MC 4XZQC 3Q7ZA 2OAP1 1OGBA 2PD7A 5FAOA 2OWHA 3REKB 3EPHA 2AROA 1FCMA 3MGQA 2Y2MA 2W1TA 3WA9A 3L25A 4S2KA 2ZMFA 5AVBB 5FATA 5GHXA 3LICA 4YINA 3AN2B 4JGPA 4HEFA 3LJAC 5CPJC 2DRWA 5L2FA 3W97D 5B31C 5HWWA 5BS7C 5EECA 2PYOA 5TR7A 3JYIA 4YM6B 1P3IC 2F8NA 3NY4A 5DTSA 3A6NC 5B40D 1P3FC 5AV8C 3NULA 3UPNA 3TU4D 5EM1A 1LSXA 1PIOA 1KE0A 3MVDA 1OTDA 5BNVB 4XZQD 5BPVA 2GJ3A 2Y2PA 2AVXA 2KX6A 3C4OA 1F98A 3DW0A 3ZDJA 1K54A 4R0QA 1ES5A 3IH9A 2Y91A 1EQZA 5GLDA 2V1AA 3Q7VB 2PBDP 4RQ9A 2VQRA 3B6GB 1H3OA 1CEFA 3LJAD 5CPJD 2Y55A 4ZUXB 1KX3D 5GSUC 3AV1D 1LLBA 2EX2A 1P3ID 2IA2A 2EXAA 2L0WA 4HY8A 3A6ND 1P3FD 2WAEA 5AV8D 3LI8A 1L3LA 5DNMA 4II7A 1EAKA 4JPMA 2VV7A 2A3UA 2EX9A 4ZJ2A 5EVIA 4IBDA 4OOLA 3AZNC 1OT9A 3IS2A 5E5AA 2QMIA 3N6IA 1TAFA 3KUYB 1KGFA 4O7DA 4OLDA 4KUDD 3N4IA 3O87A 1MBLA 2V20A 3LELC 3AZGB 3F1OA 3D9YA 1P3GA 3TW8A 2Y2OA 2VV8A 3A1KA 4CAYB 4GS9B 4LD9C 4OLGA 4OQIA 1PZRA 2IWDA 4I3IA 5B32C 5GSUD 3MMHA 1S4SA 2D02A 5AVCC 2CC1A 4GDNA 3QP8A 3MGQD 4QD4A 3T4TA 4HP9A 2P9VB 4MNRA 2GDNA 4GJ4A 5CHMA 3WA9D 2Y8HA 1P3OC 5HDSA 3KXBA 3R45A 4MCWA 4RYEA 1HQ3C 1P3AB 1VEUA 5DNNA 1G5UA 1U35A 3AZND 3M2JA 2PYOD 5B24A 1PI5A 3RELC 5BNXA 2ZOHA 4HBUA 3MGRC 4BLMA 3LELD 3AZMC 1NJ4A 5J4EA 1S32A 2YFVA 3PBOA 4WZ5A 2X01A 1F2KA 4Z66A 4LD9D 3NJAA 1K6RA 2XA7M 4JJNC 2IO5B 4G3VA 5B32D 1W5DA 3H7WB 4NXFA 3V3SA 4CSRA 3WS1A 1H8ZA 4OPQA 3SH9A 5EV0A 2AROB 5FL3A 2K7SA 1P3OD 5CTMA 4B88A 2Z2MB 5GHZA 2W1TB 1HQ3D 1ESIA 1IYPA 4GH9A 1BFMA 4X6TA 4NZ5A 1ZHHB 3RELD 3OLOA 3OPLA 4JF5A 2ZY2A 3MNNA 3X1TA 3PBNA 5B31G 1V9ZA 4LV3A 5KSCA 3MGRD 5E2FA 4XUJC 3AZMD 2NZDA 5J8XA 4IBBA 4N9LA 2F8NB 3DTKA 3HUMA 2O9CA 5EVID 1BLHA 2BYMB 3CJMA 3FWLA 3SOIA 5FQMA 1F9IA 4JJND 4R3BA 1TZYA 3VH5T 1CF0A 1Z09A 3MVDB 3NDEA 3KX0X 3E0YA 1XGIA 1XPBA 3HLBA 3UTAC 1OT6A 1P3GD 2IOUA 5KIZA 4H9OA 1WYBA 1W1VA 4G3KA 4KQQA 4X1LA 2ZL1B 1N9OA 1P3LC 1EQZB 2BTFP 1PZOA 3CUEA 1P9RA 2EXBA 3OCNA 1H3OB 2J80A 2KDKA 3G34A 1L6JA 3LZ0B 1E4DA 4WN5A 4J8WA 1K57A 2I9VA 3F1NA 3C1BA 4DMZA 3B0CT 5GT3C 5CP6C 4FOFA 2A49A 3VFFA 2W8SA 3PBSA 3LR0A 2OWJA 4HBTA 4EV4A 5A93A 4BJPA 1W2EA 5DNND
chains in the Genus database with same CATH topology
4S2IA 4Y0OA 3OCLA 3X1VC 3AFAC 3IXHA 4KZ6A 4DXBA 4J8XB 2HDRA 3UTAD 1S32D 3W96A 2XD5A 1P3MA 3X1UC 4DQYB 5G49A 3MGSA 1TDLA 5CPIA 1QMEA 3L29A 3IF6C 4OOMA 1P3KD 4DRBA 3KS4A 2Q9NA 1N1JB 3MBZA 3AZEC 1ALQA 1XKZA 4RX3A 3FV7A 3IP4C 3KXBB 2FJ7A 3AYWA 3X1VD 1BH9A 3REIA 3AFAD 5F1GA 1U35B 4CPKA 5B24B 3EPKA 3O88A 2ZQ8A 3W98C 1S6RA 3GQZA 2YFVB 3O62D 4N9KA 4Z66B 3HLWA 3NI9A 1AOIA 4KHAA 3SS4A 3AZIA 1I2SA 1XGJA 3QNBA 3TSGA 4MEZA 3MGPC 4PM8A 4F94A 5E2EA 4AWLB 1YLWA 1KX4C 2HP5A 3B6FC 3WAAB 1XXMA 5CERA 1VM1A 5GHYA 1IYOA 3MFDA 3WRTA 3UT9C 4WMCA 3MXSA 3VH6A 3KWQA 3C1BD 4FSFA 4JLFA 3WTPA 3MNNB 3X1TB 3W98D 4GOGA 1YLZA 2NZDB 2Y59A 1M19C 1YLTA 2VGJA 4KZAA 4A5RA 4R8PC 1IKGA 1ULYA 1P3PC 3L26A 1PWCA 4X55A 5AV6C 5FI2A 1TZYB 3FKVA 5JRGB 5B1LC 1P3MD 5EOEA 5HFOA 3MGPD 4ZTKA 4QJGA 4ZBEA 2XDMA 4X23C 4XUZA 5F99C 1KX4D 1XA1A 2ZLYA 4H9OB 1ID3C 5CPID 4KQRA 4QHCA 3LY4A 4R4SA 5AY8B 3UT9D 1MWTA 1L0EA 2XFSA 5B2JB 4J8WB 3C5AA 4IJEA 4DE0A 4IBXA 1E25A 2QPNA 3AV2A 1L0FA 1SDEA 2FJ7D 4WU8C 1K6SA 4R8PD 4IJFA 1P3PD 1YLYA 1ES3A 3C1CA 2DF4C 3AZFA 3NCKA 3SS3A 4P85A 3G4PA 4BENA 5FAPA 5F83A 5GXQB 2ZC5B 3W96B 1NXYA 1L0GA 5FAQA 1M6KA 1BH8A 3HLDA 1ID3D 4NZ4A 5TGFA 3AZLB 3MGSB 2WKEA 3BFCA 3NBLA 5TFQA 4S2JA 1K56A 3L27A 4H9SC 2FFYA 5CPKC 4OJPA 3WKJC 3FKEA 1BTLA 4FD8A 1CK3A 3E2KA 2YFWA 1EWZA 4GZBA 4IVIA 4H9RA 4EBLA 2G2WA 2F8NK 3BRMA 3AL0C 5AV5B 2PU2A 1KU5A 2JSSA 2Y2KA 3REIB 3IT9A 4OQGA 1WYCA 3ZVTA 2RIQA 5CEDA 3X1SA 4DRTA 1GHPA 2CV5C 2DQNC 3M6HA 3W97A 4E45A 2Z2LB 1M1AB 5FI7A 1P3BB 4UHUA 3TOIA 1YT4A 5KMWA 3IHAA 5B40A 2XR0A 5BOHA 3AZKA 3TU4A 3UTBC 1AOIB 3UNWA 2G5IC 3MZEA 3REKC 4HGAC 3AZIB 3VP2A 5CPKD 2ZJ9A 5B1MA 4XZQA 4OJ6A 4H9NA 4OONA 1ONHA 2ZY4A 4WEJA 5AVBC 4UA7A 5IHVA 4J8VB 1L0DA 3AN2C 2WZZA 5KZHA 4DRAA 1ES4A 3HLGA 3KWQB 3PTEA 2CV5D 3LJAA 5CPJA 5B31A 3CG5A 5BS7A 4WU9C 3NDGA 5CRFA 2NQBC 4NE6A 1IELA 1P3IA 2J8PA 3A6NA 1P3FA 5AV8A 2PU4A 3UTBD 3HBRA 5FASA 1G68A 4GD8A 5KSHA 3REKD 1K4EA 3GV9A 4PMAA 3AZJC 2OLVA 3B6GC 3ZFZA 2XF3A 5CTNA 4E44A 3PBTA 4ZUXC 4OKPA 1PWGA 5DF8A 1K25A 4JXWA 3H0LC 5GSUA 4WU9D 3ZG5A 2NQBD 2HUEC 3FZCA 4OOYA 4KENB 5FQ9A 3V50A 2IWBA 4WNNA 1PZPA 3X1SD 4QLCB 3C1CB 3KUYC 3AZJD 1GA0A 4IBGA 3AZFB 3AGFA 5AQBA 1PW1A 2ZM2A 3AZNA 5HAPA 3AZGC 3W4QA 2H10A 2XFTA 5JYOA 2ZM0A 1BH8B 4KGCC 3RXWA 2P74A 1FQGA 3AZKD 3A1IA 3LELA 3OPHA 3UPPA 4JF6A 2EFUA 2RL3A 5B33B 4GD6A 4L0LA 4P0MA 5FA7A 4LD9A 3B3XA 2HIOB 5B1MD 1ZLAB 3VH6T 3SH8A 4KZ5A 4OJLA 3HLFA 5B32A 5DF9A 1Q9CA 3Q07A 5AVCA 2IWCA 4DE3A 3IQAA 1M18C 5I94A 4GB7A 1P34C 1FR6A 3VMAA 5E43A 1P3OA 5U47A 4M3KA 2J7VA 3HUNA 4KG2A 1HQ3A 4PM7A 5B31D 2HP9A 3LCEA 3RELA 4R4RA 1IKIA 1XX2A 4NE3A 4N1XA 4KGCD 3W97B 3MGRA 1YUEA 3AZMA 1Q2QA 4H9QB 5C3IC 1K4FA 3UO9A 5B40B 1OMEA 4C3QA 3TU4B 3KFUG 2XGNA 3VSKA 4JJNA 1GHMA 2AROC 4XZQB 4Z5TC 3A3EA 4DKIA 1M18D 3HVFA 4K0XA 1EROA 3ISGA 1P34D 3G32A 3TG9A 2BG1A 5HAQA 4OUIA 2ZY5A 3LZ1C 3LJAB 2JBFA 4U0XA 5FQJA 1PI4A 3WS4A 5M19A 1KX3B 3AV1B 4XUJA 1P3IB 3A3DA 2B5RA 2HPBA 1P3FB 1WWIA 3QHYA 4RX2A 4UA9A 3SH7A 3C7UA 3PAEA 3BECA 4Z5TD 4D2OA 3BFGA 1EQZC 3NQJA 5F82A 3UTAA 2HDSA 3N8SA 4N92A 4KG6A 4KUDB 1KX5C 1P3LA 3LZ0C 1ZG4A 2VGKA 2ZC3B 3OZHA 3HSHA 2ZY3A 3MZDA 4S2OA 1SHVA 5AVCD 1ZKJA 3LZ1D 4WJ3C 2X71A 1P3KA 4E3NA 1WWSA 5GT3A 5CP6A 3MGQB 4J8XC 3WA9B 4DXCA 1BT5A 5CHLB 3X1VA 3VP3A 3AFAA 3M6BA 1AXBA 3LEZA 3AZNB 2PYOB 4H8RA 1DJAA 5FSRA 3X1UA 1KX5D 3ZCZA 3LELB 1KE4A 4BQMA 3O62A 4ZJ3A 5AQ9A 2WADA 1CI8A 4LD9B 4OJOA 2BYKA 3IF6A 4GHAA 4LG2A 5CHJA 1SCWA 4BL2A 3IHBA 1ES2A 3V39A 3G2ZA 4JBFA 4KZBA 5HARA 5B32B 3N8LA 2RCXA 2WZXA 4C75A 4R1GA 2UWXA 4WZSB 5FQQA 4KQOA 5AV9C 5CECA 5GT0C 3CMZA 2R9WA 1HQ3B 3RXXA 3N3FA 2WGIA 2Y2JA 4QNLA 4XUJD 3RELB 3A3JA 3W98A 1JFIA 3MGRB 1TVFA 5DNMB 3AZMB 2E8IA 3KSYA 4NETA 5EVIB 3E2LA 4RVAA 5GLAA 4JJNB 4NZ3A 1FR1A 3P09A 4DE1A 5E5AB 3WAAC 3MGPA 1TAFB 1SDNA 2HDUA 4E3LA 3ZG7B 2HDQA 3G30A 5FQIA 4EO5C 1P3LD 1KX4A 3BEBA 4LV1A 1P3GB 3B6FA 5AV9D 5GLBA 4QY6A 5GT0D 3NIAA 1GA9A 4GDBA 4IBJA 5G18A 5JYPA 3UT9A 1RP5A 1Q2PA 4FCFA 5B2IC 1PYYA 3V5MA 1YU1A 2F8NG 3S4XA 5GT3D 1N4OA 5CP6D 3NC8A 3GR2A 3VFHA 1M19A 4WEKA 4X68A 3R45B 3AGEA 5JRGC 4R8PA 5DNNB 1P3PA 1ONGA 4X56A 5AV6A 5BNXB 5JA4A 1HD8A 4EWFA 2WGWA 1EI5A 3X1UD 4H9PA 3NQJB 4X23A 1N9BA 5F99A 3UTAB 3REJC 1S32B 1KDSA 5AY8C 5E2GA 1ID3A 1BULA 1MWRA 5B2JC 3S22A 1YLJA 4NE5A 1HZOA 1MKIA 5B2ID 1XP4A 1NZOA 3AZED 1DY6A 4CSRB 3H0RC 1P3KB 4IEDA 5BT1C 4WU8A 3F6TA 4OPZA 2ZC4B 3W99C 3MKFA 2ZMAA 5GXQC 4XXRA 5HL1A 3X1VB 3AFAB 3WRZA 3GTCA 1YU0A 2Y2LA 3AZLC 3REJD 1ESUA 2I72A 5AY8D 3P98A 1YM1A 1W7FA 1HVBA 3O62B 4ZJ1A 1O07A 1B6WA 4H9SA 1RGZA 4K91A 5CPKA 1ZC2A 3WKJA 1LL5A 3B6FD 5AV5C 2ZQDA 4KZ8A 2Y2NA 3IXGA 3REIC 1H8YA 1GCEA 2WAFA 1MPLA 3GMWA 3W99D 5B0YC 1F1EA 1WE4A 1M1AC 1P3BC 3REHC 2XK1A 1BLPA 1T3UA 2CV5A 4G91B 3C1BB 1M19D 3ZG9B 2ZQCA 1IYSA 1R4VA 3LO7A 3W98B 1JFIB 3H0MC 2WUQA 1KVLA 1FCOA 2QZ6A 5KDMA 3B0DC 4J8UC 3Q81A 3AZIC 5AV6D 2WK0A 3UTBA 5B1LD 1L2SA 3REKA 4X23D 5F99D 4J8VC 5DF7A 1K55C 1P3MB 3MGPB 1KX4B 4WBGA 5B0ZC 5G49B 3AN2A 2XEPA 5CPIB 5B0YD 4KZ7A 4OPYA 3AZHC 1W8QA 1P3BD 4UA6A 3UT9B 3REHD 1FOFA 5M1AA 4B4ZA 1YMXA 4WU8D 4MBKA 4WU9A 2NQBA 1KDWA 3EPJA 4YS3C 3HREA 4J8UD 4OJ5A 2FJ7B 5BNVA 3AYWB 3DWZA 4DDSA 1BH9B 4R8PB 2ZC7A 1P3PB 3SS5A 3FDDA 1F66C 1RGYA 4E3JA 3AZJA 5JA4B 5CGSA 2WGWB 4H9PB 3Q7VA 3VSLA 3UDIA 5B0ZD 3B6GA 1ID3B 2EX8A 4K0WA 1Z6FA 2Y4AA 3AZHD 4ZUXA 4KHAB 4JXSA 3WKJD 3G2YA 1BSGA 3VH5W 4NYUA 1ERQA 1JTDA 4YS3D 4RA7A 1IEMA 3GVBA 4WZ4A 4QLCC 3WX7A 5HW3A 3WWXA 3BFEA 4OQHA 1I5QA 1F66D 4YM6C 3KUYA 2Y2GA 5DTTA 3S1YA 3WTPB 3AZGA 3I7JA 5B33C 3W4PA 4KGCA 2HIOC 1ZLAC 3MXRA 3B0CW 1M40A 3DTMA 3EPLA 5FQKA 4E3OA 5CPKB 5AVBD 3MKEA 2RVQC 3AN2D 1M18A 4ZBJB 1J9MA 2PBYA 4GKUA 4LENA 3PAGA 1P34A 1LHYA 1XA7A 4YM6D 3L28A 3ZVWA 2F8NH 4G92B 3AV2B 4S2NC 2HIOD 5CGWA 1H5XA 2CWEA 2XH9A 5KDMB 3EQVA 3A3IA 3UTBB 3HLEA 5FI6A 5CEBA 4HGAB 1E3UD 4Y7PA 4P6BA 3B6GD 4Z5TA 2RVQD 5AQAA 1A7WA 3LY3A 2JCHA 5A92A 3WS0A 4ZUXD 4OPRA 1S0WA 3BYDA 5AQ7A 1KX3C 1KGEA 3G35A 3AV1C 4UUZA 2DCFA 3LZ1A 4BD0A 2YFWB 1P3AC 1YU4A 3O86A 2BYMA 4WU9B 4H9RB 2NQBB 3NQUA 4KZ3A 3KUYD 4P87A 4KZ4A 1MY8A 3AZGD 3X1SB 3AZJB 3Q82A 4KUDC 4S2PA 1BZAA 2Q9MA 4UAAA 1KGGA 1YU3A 2IO5C 3GRJA 2G5HC 3AZKB 1KX5A 3LZ0A 5M18A 4NYYA 1NY0A 5BO0A 5B1MB 3MGQC 4BL3A 4H9NB 2ZM8A 1G6AA 1P3AD 3WA9C 1NYMA 2HUEB 2H5SA 3WTPE 1VQQA 3C4PA 4J8XA 2H0YA 1BUEA 3VP1A 2PYOC 4EBNA 2R9XA 5CPJB 1TDGA 5B31B 4IBIA 2FFFB 1MXOA 1YQSA 4KGCB 3PBQA 3MVDC 3A6NB 5AV8B 3UN7A 4S2LA 4PPRA 1N1JA 2AROD 1K54C 4X53A 4S2MA 1JWVA 1W8YA 4EQIA 4MLLA 4IBEA 4PM6A 2ZQ7A 4Z2MG 2DNSA 1M18B 5DTKA 3UY6A 1P34B 5EPHA 5AV9A 5GT0A 4MBHA 3UE1A 2F8ND 4KG5A 4ZDXA 5HX9A 5FUGA 5DNMC 5GSUB 4E3IA 3C7VA 3MVDD 5EVIC 4WNNB 4CJNA 5C3IB 4Y0UA 5E5AC 4OH0A 2WKHA 1EQZD 3D4FA 1P3GC 1O7EA 3WAAA 4Z5TB 4OQ0A 5EUAA 3LZ0D 2HP6A 2ZD8A 4OP8A 4QB8A 4E3MA 5EOOA 4NK3A 5DNMD 5B2IA 4C6YA 3KXBC 5AVCB 4UUZB 3AZEA 4ZAMA 3LZ1B 5DNNC 4J8XD 1U35C 2OLUA 3BFFA 1P3OB 2WYXA 5FDHA 3VOZA 5B24C 3NQUB 5E5AD 5JRGA 4ID4A 4R3JA 3V3RA 3VP4A 1B67A 4MBFA 5A90A 2XQZA 3UDFA 4XUXA 1S32C 4WZ5C 1LI9A 3KS8A 4Z66C 4FH4A 4N1HA 4BD1A 3OPPA 4FH2A 4JF4A 4WELA 3REJA 5AY8A 3HL9A 1KX5B 5DVAA 5B2JA 4IBFA 2L5AA 1P3KC 4AWLC 3QNCA 1JTGA 2H0TA 1LL9A 5BO0B 1CI9A 2ZM5A 3KXBD 2Y2IA 1Y54A 3M2KA 1U35D 4EBPA 1JVJA 5B24D 3IXBA 1FCNA 1JWPA 4B4XA 3IWOA 3N8RA 3MNNC 3X1TC 3W99A 1MWSA 2NZDC 5GXQA 3ZG8B 4M6BA 4Z66D 5GL9A 4GHLA 2BLSA 3AZLA 4XUJB 3O62C 1DJBA 4DF6A 1LI0A 1TZYC 3V9RA 3EQUA 3ITAA 4GNUA 4IBRA 5B32G 3WAAD 4U3TA 5B1LA 2XLNA 3O3VA 3VOYA 1BLSA 5CXWA 3WS2A 5AV5A 2Y2QA 2V2FF 3FYZA 1P3LB 4QU3A 4NFTA 3MNND 4J8WC 3X1TD 1K57C 5AV9B 5B0YA 2NZDD 4G91C 5GT0B 3C1BC 4DE2A 1M1AA 3BFDA 4JXGA 1P3BA 4NY2A 5FUGB 3REHA 4PM9A 3ZGAB 4E6WA 3VH6W 1CEGA 4IBKA 5GT3B 5CP6B 1TZYD 3B0BA 2OSUA 3A3FA 3FKWA 5JRGD 5D3OA 1FSWA 3EG5B 2C5WB 3IH8A 4J8UA 3W96C 1HTZA 1P3MC 3ZG0A 3ZNTA 3L2AA 1Z2CB 5EE8A 2WGVA 1JWZA 1ZG6A 4J8VA 1K55A 3MGSC 3OC2A 5CPIC 3X1UB 2ZQAA 2JE5A 4EO5B 5B2JD 1KVMA 5B0ZA 4J8WD 4WM9A 3ITBA 2BYKB 3IF6B 3RJUA 3GSGA 3AZHA 2EX6A 4PM5A 5B2IB 5BT1D 3AZEB 2FJ7C 3AYWC 1IYQA 4YS3A 4U0TA 5GXQD 3W96D 1KE3A 4EUZA 1F66A 3AZLD 4R23A 4X69A 3MGSD 4GN2A 1ERMA 4Q8IA 1AOIC 2OV5A 3REJB 3IXDA 5GLCA 2LY8A 5F1FA 4KZ9A 5AV5D 5CHUA 3IWIA 4Z2MH 3AYWD 3REID 5AVBA 3ZNYA 3N7WA 1FSYA 4LCMA 3B6FB 4E6XA 3KWQC 5EVLA 4QLCA 3WTPC 1W79A 4YFMA 1M1AD 3W99B 3IWQA 4YM6A 4HESA 4OP5A 2F2AC 1U60A 3G31A 3UDXA 3UPOA 1AOID 1NZUA 3BLSA 2Y2HA 5B33A 4Z9QA 1M19B 3P5JB 3AZID 1TEMA 5HAIA 5E2HA 2HIOA 3V9RB 1ZLAA 3HLCA 3ZHHA 3CZDA 3BLMA 5AV6B 2XD1A 4J8VD 4UPKA 4QY5A 5B1LB 4ZBJC 4IBCA 3UE3A 3HONA 4JXVA 1E3UA 4X23B 3DWKA 5F99B 4WMCD 4WV4B 3KWQD 3Q1FA 1BLCA 2EFXA 1NRFA 3OPRA 3WTPD 4NZ1A 1MWUA 5B0YB 4G92C 4LV0A 3AV2C 1QMFA 3IF5A 4OVDA 3PBRA 2G2UA 3REHB 2C6WB 4LV2A 4H9QA 1K38A 1YLPA 1YU2A 4S2NA 4WYYA 4WU8B 3C1CC 3WS5A 3AZFC 1PWDA 1RCJA 1I2WA 3B0DB 4J8UB 4JKTA 1NYYA 3AGDA 4LCLA 1GHIA 3UE0A 4DDYA 4CAYA 4Y0TA 2J8YA 3VP0A 2V1ZA 1YMSA 3VH5A 5B0ZB 3AV2D 3AZHB 2P9VA 1KX3A 1HTAA 1PW8A 3AV1A 1C3BA 3W4OA 3WKJB 1P3AA 4QLCD 3C1CD 2ZC6B 3AZFD 4YS3B 5CGXA 2WKIA 3X1SC 2J9PA 5A91A 1DJCA 1SKFA 2JC7A 3W97C 4E3KA 2X02A 3MZFA 1F66B 5B33D 2CV5B 4KUDA 3BM6A 5B40C 3AZKC 3TU4C 3W8KA 2J9OA 3HUOA 2ZQ9A 1ZLAD 1K56D 4IVKA 5B1MC 4XZQC 3Q7ZA 5FAOA 3REKB 3EPHA 2AROA 1FCMA 3MGQA 2Y2MA 3WA9A 3L25A 4S2KA 5AVBB 5FATA 5GHXA 4YINA 3AN2B 4HEFA 3LJAC 5CPJC 2DRWA 5L2FA 3W97D 5B31C 5BS7C 5EECA 2PYOA 5TR7A 3JYIA 4YM6B 1P3IC 2F8NA 3NY4A 5DTSA 3A6NC 5B40D 1P3FC 5AV8C 3UPNA 3TU4D 1PIOA 1KE0A 3MVDA 5BNVB 4XZQD 5BPVA 2Y2PA 3C4OA 3DW0A 3ZDJA 1K54A 4R0QA 1ES5A 3IH9A 2Y91A 1EQZA 5GLDA 3Q7VB 2VQRA 3B6GB 1H3OA 1CEFA 3LJAD 5CPJD 2Y55A 4ZUXB 1KX3D 5GSUC 3AV1D 1LLBA 2EX2A 1P3ID 2EXAA 3A6ND 1P3FD 2WAEA 5AV8D 5DNMA 4JPMA 2A3UA 2EX9A 4ZJ2A 5EVIA 4IBDA 4OOLA 3AZNC 5E5AA 2QMIA 3N6IA 1TAFA 3KUYB 1KGFA 4O7DA 4OLDA 4KUDD 3N4IA 3O87A 2V20A 1MBLA 3LELC 3AZGB 1P3GA 2Y2OA 3A1KA 4CAYB 4LD9C 4OLGA 4OQIA 1PZRA 2IWDA 5B32C 5GSUD 5AVCC 2CC1A 4GDNA 4QD4A 3MGQD 2P9VB 4MNRA 2GDNA 5CHMA 3WA9D 1P3OC 3KXBA 3R45A 4RYEA 1HQ3C 1P3AB 5DNNA 1U35A 3AZND 3M2JA 2PYOD 5B24A 1PI5A 3RELC 5BNXA 4HBUA 3MGRC 4BLMA 3LELD 3AZMC 1NJ4A 1S32A 2YFVA 3PBOA 4WZ5A 2X01A 4Z66A 4LD9D 1K6RA 4JJNC 2IO5B 5B32D 1W5DA 3V3SA 4CSRA 3WS1A 1H8ZA 4OPQA 3SH9A 2AROB 1P3OD 5CTMA 4B88A 2Z2MB 5GHZA 1HQ3D 1ESIA 1IYPA 4GH9A 1BFMA 4X6TA 4NZ5A 3RELD 3OPLA 4JF5A 2ZY2A 3MNNA 3X1TA 3PBNA 5B31G 4LV3A 5KSCA 3MGRD 5E2FA 4XUJC 3AZMD 2NZDA 5J8XA 4IBBA 4N9LA 2F8NB 3HUMA 5EVID 1BLHA 2BYMB 3CJMA 3FWLA 3SOIA 5FQMA 4JJND 4R3BA 1TZYA 3VH5T 3MVDB 3NDEA 1XGIA 1XPBA 3HLBA 3UTAC 1P3GD 2IOUA 4H9OA 1WYBA 4KQQA 1P3LC 1EQZB 1PZOA 2EXBA 3OCNA 1H3OB 3G34A 3LZ0B 1E4DA 4J8WA 1K57A 3C1BA 3B0CT 5GT3C 5CP6C 2A49A 3VFFA 2W8SA 3PBSA 4HBTA 4EV4A 5A93A 4BJPA 1W2EA 5DNND
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4S2I A;  4GN2 A;  5FQK A;  4Y0O A;  1ERM A;  3OCL A;  4E3O A;  4Q8I A;  4DXB A;  3IXH A;  4KZ6 A;  2OV5 A;  3MKE A;  2HDR A;  3IXD A;  2JBF A;  4U0X A;  5FQJ A;  1PI4 A;  5GLC A;  3WS4 A;  5M19 A;  1J9M A;  2PBY A;  4GKU A;  4LEN A;  3PAG A;  2XD5 A;  1LHY A;  1XA7 A;  3A3D A;  2B5R A;  2HPB A;  5F1F A;  4KZ9 A;  3QHY A;  4RX2 A;  4UA9 A;  1TDL A;  3ZVW A;  3SH7 A;  5CHU A;  3IWI A;  3C7U A;  1QME A;  3IF6 C;  4OOM A;  3ZNY A;  3N7W A;  1FSY A;  3BEC A;  3PAE A;  4LCM A;  4D2O A;  4S2N C;  4E6X A;  3BFG A;  5F82 A;  2HDS A;  5EVL A;  5CGW A;  3N8S A;  2Q9N A;  1H5X A;  4N92 A;  4KG6 A;  3MBZ A;  2XH9 A;  1ALQ A;  1W79 A;  1XKZ A;  4YFM A;  3EQV A;  4RX3 A;  3IWQ A;  4HES A;  4OP5 A;  3FV7 A;  2ZC3 B;  1ZG4 A;  2VGK A;  3A3I A;  3HLE A;  3OZH A;  5FI6 A;  1U60 A;  3G31 A;  5CEB A;  3UDX A;  1E3U D;  4Y7P A;  3UPO A;  3MZD A;  1NZU A;  4S2O A;  1SHV A;  1ZKJ A;  3BLS A;  2Y2H A;  4P6B A;  5F1G A;  4Z9Q A;  2X71 A;  4CPK A;  5AQA A;  3LY3 A;  1TEM A;  5HAI A;  2JCH A;  5E2H A;  4E3N A;  5A92 A;  3HLC A;  3WS0 A;  3O88 A;  3ZHH A;  3CZD A;  3BLM A;  2ZQ8 A;  4OPR A;  1S6R A;  2XD1 A;  3GQZ A;  1S0W A;  3BYD A;  5AQ7 A;  4DXC A;  1BT5 A;  4QY5 A;  1KGE A;  3UE3 A;  4N9K A;  3G35 A;  3HLW A;  3NI9 A;  4JXV A;  1E3U A;  3DWK A;  3VP3 A;  3M6B A;  2DCF A;  1AXB A;  4WMC D;  4BD0 A;  3LEZ A;  3SS4 A;  1I2S A;  3O86 A;  1XGJ A;  3Q1F A;  1BLC A;  3QNB A;  2EFX A;  1NRF A;  3OPR A;  3TSG A;  4H8R A;  4MEZ A;  4PM8 A;  3V39 A;  4F94 A;  1DJA A;  5E2E A;  5FSR A;  1MWU A;  1YLW A;  4KZ3 A;  3ZCZ A;  4LV0 A;  2HP5 A;  1KE4 A;  4BQM A;  4P87 A;  4ZJ3 A;  1QMF A;  1XXM A;  2WAD A;  3IF5 A;  1MY8 A;  4KZ4 A;  4OVD A;  3PBR A;  5AQ9 A;  5CER A;  1CI8 A;  1VM1 A;  2G2U A;  5GHY A;  1IYO A;  2C6W B;  4LV2 A;  3IF6 A;  3MFD A;  4BL2 A;  5CHJ A;  1SCW A;  3Q82 A;  3WRT A;  3IHB A;  1K38 A;  1ES2 A;  1YLP A;  4S2P A;  3G2Z A;  4WMC A;  4S2N A;  4JBF A;  1BZA A;  2Q9M A;  4KZB A;  3MXS A;  4WYY A;  5HAR A;  3WS5 A;  4UAA A;  1KGG A;  3N8L A;  1PWD A;  1RCJ A;  2RCX A;  1I2W A;  4FSF A;  2WZX A;  3GRJ A;  4JLF A;  4C75 A;  4R1G A;  4JKT A;  1NYY A;  4GOG A;  1YLZ A;  2UWX A;  3AGD A;  2Y59 A;  5FQQ A;  5M18 A;  4KQO A;  4LCL A;  5CEC A;  1GHI A;  1YLT A;  2VGJ A;  4KZA A;  1NY0 A;  2R9W A;  3CMZ A;  4A5R A;  1IKG A;  3UE0 A;  3RXX A;  1PWC A;  4X55 A;  4BL3 A;  2WGI A;  4DDY A;  4Y0T A;  2ZM8 A;  2Y2J A;  5FI2 A;  1G6A A;  2J8Y A;  1NYM A;  3FKV A;  3VP0 A;  5EOE A;  5HFO A;  2V1Z A;  3A3J A;  1YMS A;  4ZTK A;  4QJG A;  2H5S A;  4ZBE A;  1VQQ A;  2XDM A;  4XUZ A;  1TVF A;  1XA1 A;  3C4P A;  2E8I A;  2H0Y A;  1BUE A;  2ZLY A;  3VP1 A;  2P9V A;  1PW8 A;  4KQR A;  4QHC A;  4NET A;  5EVI B;  4EBN A;  1C3B A;  3W4O A;  3E2L A;  3LY4 A;  4R4S A;  2R9X A;  4RVA A;  5GLA A;  1MWT A;  1TDG A;  1FR1 A;  3P09 A;  2ZC6 B;  4DE1 A;  1L0E A;  2FFF B;  2XFS A;  1MXO A;  1SDN A;  2HDU A;  4E3L A;  5CGX A;  1YQS A;  3C5A A;  2HDQ A;  2WKI A;  3PBQ A;  3ZG7 B;  3G30 A;  4DE0 A;  4IBX A;  3UN7 A;  5FQI A;  1E25 A;  3BEB A;  2J9P A;  2QPN A;  4LV1 A;  5A91 A;  1DJC A;  1SKF A;  1L0F A;  2JC7 A;  4S2L A;  1SDE A;  4PPR A;  4E3K A;  5GLB A;  5KMW A;  1K6S A;  2X02 A;  4QY6 A;  3MZF A;  3NIA A;  1GA9 A;  4GDB A;  1K54 C;  1YLY A;  4X53 A;  5G18 A;  5JYP A;  1ES3 A;  3BM6 A;  4S2M A;  1RP5 A;  1JWV A;  1W8Y A;  3W8K A;  1Q2P A;  2J9O A;  3HUO A;  2ZQ9 A;  4FCF A;  4MLL A;  1PYY A;  1K56 D;  4PM6 A;  2ZQ7 A;  4IVK A;  3NCK A;  3SS3 A;  3V5M A;  3S4X A;  2DNS A;  1N4O A;  4P85 A;  3NC8 A;  3G4P A;  4BEN A;  5FAP A;  5F83 A;  5DTK A;  3GR2 A;  2ZC5 B;  3UY6 A;  1NXY A;  1L0G A;  3VFH A;  5FAQ A;  1M6K A;  3Q7Z A;  3HLD A;  5EPH A;  4WEK A;  5FAO A;  4X68 A;  3AGE A;  5TGF A;  4MBH A;  3UE1 A;  1FCM A;  4KG5 A;  4ZDX A;  1ONG A;  4X56 A;  2WKE A;  3BFC A;  2Y2M A;  5HX9 A;  3NBL A;  5TFQ A;  4S2J A;  4S2K A;  1K56 A;  1HD8 A;  5FAT A;  5GHX A;  4EWF A;  2WGW A;  1EI5 A;  4E3I A;  3C7V A;  4YIN A;  2FFY A;  5EVI C;  1N9B A;  4HEF A;  1BTL A;  1KDS A;  4FD8 A;  2DRW A;  1CK3 A;  5E2G A;  3E2K A;  4CJN A;  5L2F A;  1BUL A;  1EWZ A;  1MWR A;  4GZB A;  4Y0U A;  5EEC A;  5TR7 A;  4IVI A;  3JYI A;  4OH0 A;  4EBL A;  2G2W A;  3BRM A;  2WKH A;  3NY4 A;  3S22 A;  5DTS A;  1YLJ A;  2PU2 A;  3UPN A;  1HZO A;  3D4F A;  1MKI A;  1XP4 A;  1NZO A;  2Y2K A;  1O7E A;  3IT9 A;  4OQG A;  1DY6 A;  1WYC A;  4OQ0 A;  3ZVT A;  1PIO A;  1KE0 A;  5CED A;  5EUA A;  4DRT A;  1GHP A;  3M6H A;  4IED A;  2Y2P A;  2Z2L B;  5FI7 A;  4UHU A;  2HP6 A;  2ZD8 A;  3C4O A;  4OPZ A;  3TOI A;  3DW0 A;  3ZDJ A;  1YT4 A;  2ZC4 B;  4OP8 A;  1K54 A;  3MKF A;  4QB8 A;  4R0Q A;  3IHA A;  1ES5 A;  2ZMA A;  3IH9 A;  2XR0 A;  5EOO A;  4NK3 A;  5BOH A;  2Y91 A;  4XXR A;  5HL1 A;  5GLD A;  3Q7V B;  4C6Y A;  3UNW A;  4ZAM A;  4E3M A;  3MZE A;  3WRZ A;  3GTC A;  3VP2 A;  1CEF A;  2Y2L A;  2ZJ9 A;  1ESU A;  2I72 A;  2OLU A;  3BFF A;  2WYX A;  4OON A;  2Y55 A;  1ONH A;  5FDH A;  3VOZ A;  4WEJ A;  3P98 A;  1YM1 A;  4UA7 A;  1W7F A;  5IHV A;  1LLB A;  2EX2 A;  1HVB A;  1L0D A;  4ID4 A;  4R3J A;  2EXA A;  4ZJ1 A;  3V3R A;  2WZZ A;  3VP4 A;  5A90 A;  4MBF A;  2XQZ A;  2WAE A;  3UDF A;  1O07 A;  4XUX A;  5KZH A;  4WZ5 C;  1LI9 A;  1RGZ A;  4JPM A;  4FH4 A;  2A3U A;  1ES4 A;  3HLG A;  4K91 A;  2EX9 A;  4N1H A;  3OPP A;  4ZJ2 A;  1ZC2 A;  4BD1 A;  4FH2 A;  5EVI A;  3PTE A;  4OOL A;  4JF4 A;  4WEL A;  1LL5 A;  2ZQD A;  4KZ8 A;  2Y2N A;  3CG5 A;  3IXG A;  1H8Y A;  1GCE A;  2WAF A;  3HL9 A;  1MPL A;  2QMI A;  3GMW A;  3N6I A;  3NDG A;  5CRF A;  5DVA A;  1IEL A;  1KGF A;  4O7D A;  4OLD A;  3QNC A;  3N4I A;  3O87 A;  1JTG A;  1MBL A;  2V20 A;  2H0T A;  1LL9 A;  1WE4 A;  2PU4 A;  1CI9 A;  3HBR A;  2Y2O A;  5FAS A;  1G68 A;  2Y2I A;  4GD8 A;  4OLG A;  1Y54 A;  2XK1 A;  5KSH A;  1K4E A;  3GV9 A;  4PMA A;  4OQI A;  1BLP A;  2OLV A;  3M2K A;  4EBP A;  2IWD A;  3ZG9 B;  1JVJ A;  2ZQC A;  1IYS A;  3LO7 A;  3IXB A;  1FCN A;  1JWP A;  1KVL A;  2WUQ A;  1FCO A;  2CC1 A;  2QZ6 A;  4B4X A;  3IWO A;  4GDN A;  4QD4 A;  3N8R A;  3ZFZ A;  2XF3 A;  3Q81 A;  1MWS A;  2P9V B;  4MNR A;  2GDN A;  5CHM A;  2WK0 A;  5CTN A;  3ZG8 B;  3PBT A;  4OKP A;  1L2S A;  1PWG A;  4RYE A;  5GL9 A;  2BLS A;  5DF7 A;  5DF8 A;  1K55 C;  1DJB A;  4DF6 A;  1LI0 A;  1K25 A;  4JXW A;  3M2J A;  1PI5 A;  3EQU A;  4B88 A;  3ITA A;  3ZG5 A;  4WBG A;  4HBU A;  3FZC A;  4GNU A;  4IBR A;  4OOY A;  4KEN B;  2XEP A;  4KZ7 A;  4BLM A;  5FQ9 A;  3V50 A;  1NJ4 A;  4OPY A;  2IWB A;  4U3T A;  3PBO A;  1PZP A;  4WZ5 A;  2XLN A;  3O3V A;  2X01 A;  1W8Q A;  3VOY A;  4UA6 A;  1FOF A;  1BLS A;  5M1A A;  3AGF A;  5CXW A;  1GA0 A;  1K6R A;  3WS2 A;  5AQB A;  4B4Z A;  1PW1 A;  2ZM2 A;  2Y2Q A;  1YMX A;  2V2F F;  5HAP A;  4MBK A;  3FYZ A;  1W5D A;  3W4Q A;  2H10 A;  2XFT A;  1KDW A;  4QU3 A;  3V3S A;  5JYO A;  2ZM0 A;  1K57 C;  3HRE A;  3RXW A;  2P74 A;  1FQG A;  3WS1 A;  1H8Z A;  4OPQ A;  3SH9 A;  3DWZ A;  4DDS A;  4DE2 A;  3OPH A;  3UPP A;  2ZC7 A;  4JF6 A;  2EFU A;  2RL3 A;  4GD6 A;  4L0L A;  4P0M A;  5CTM A;  5FA7 A;  3BFD A;  3SS5 A;  2Z2M B;  4JXG A;  5GHZ A;  3B3X A;  1RGY A;  4E3J A;  1ESI A;  4PM9 A;  3ZGA B;  4E6W A;  1IYP A;  5CGS A;  1CEG A;  3SH8 A;  4KZ5 A;  2WGW B;  3HLF A;  4X6T A;  2OSU A;  5DF9 A;  3A3F A;  3FKW A;  3Q7V A;  3VSL A;  3Q07 A;  5D3O A;  2IWC A;  3UDI A;  1FSW A;  3OPL A;  4DE3 A;  2C5W B;  3IH8 A;  3IQA A;  4JF5 A;  3PBN A;  5I94 A;  4LV3 A;  2EX8 A;  4GB7 A;  5KSC A;  5E2F A;  1HTZ A;  1Z6F A;  4K0W A;  5J8X A;  1FR6 A;  4N9L A;  2Y4A A;  3ZG0 A;  3VMA A;  3ZNT A;  5E43 A;  5U47 A;  4M3K A;  3HUM A;  5EE8 A;  2WGV A;  2J7V A;  1JWZ A;  3HUN A;  5EVI D;  4KG2 A;  4JXS A;  1BLH A;  1ZG6 A;  3CJM A;  1K55 A;  3FWL A;  3SOI A;  3OC2 A;  5FQM A;  3G2Y A;  1BSG A;  4PM7 A;  4R3B A;  2ZQA A;  2HP9 A;  3LCE A;  4R4R A;  1ERQ A;  2JE5 A;  1IKI A;  1JTD A;  3NDE A;  1KVM A;  1XGI A;  1XX2 A;  4N1X A;  4RA7 A;  1IEM A;  3GVB A;  1XPB A;  3HLB A;  3ITB A;  4WM9 A;  4WZ4 A;  4EQI A;  5HW3 A;  1Q2Q A;  3IF6 B;  1K4F A;  3RJU A;  3WWX A;  1WYB A;  3BFE A;  3GSG A;  3UO9 A;  4KQQ A;  2EX6 A;  4OQH A;  4C3Q A;  1OME A;  4PM5 A;  1I5Q A;  1PZO A;  2XGN A;  2Y2G A;  2EXB A;  3VSK A;  3OCN A;  5DTT A;  3S1Y A;  1GHM A;  1IYQ A;  3I7J A;  3G34 A;  3A3E A;  4X69 A;  4U0T A;  1E4D A;  3W4P A;  1K57 A;  4DKI A;  3HVF A;  4K0X A;  1ERO A;  3ISG A;  3MXR A;  1KE3 A;  3G32 A;  4EUZ A;  2A49 A;  3VFF A;  3PBS A;  3TG9 A;  2BG1 A;  4HBT A;  4EV4 A;  5A93 A;  4BJP A;  1M40 A;  4R23 A;  5HAQ A;  3DTM A; 
#chains in the Genus database with same CATH topology
 4S2I A;  4Y0O A;  3OCL A;  3X1V C;  3AFA C;  3IXH A;  4KZ6 A;  4DXB A;  2VGL S;  4J8X B;  2HDR A;  3UTA D;  3MQL A;  1S32 D;  3W96 A;  2XD5 A;  1P3M A;  3LR3 A;  3X1U C;  2L4R A;  1J3W A;  4DQY B;  5G49 A;  3MGS A;  1TDL A;  5CPI A;  3H9W A;  2VX8 A;  1QME A;  3L29 A;  3IF6 C;  4OOM A;  1P3K D;  4DRB A;  3KS4 A;  2Q9N A;  1N1J B;  4FTX A;  3MBZ A;  3AZE C;  1ALQ A;  1XKZ A;  1WA9 A;  3KYZ A;  4RX3 A;  3FV7 A;  3IP4 C;  5TBM B;  2M7V A;  3KXB B;  4MB3 A;  4L9F A;  2FJ7 A;  2R78 A;  3AYW A;  3X1V D;  1BH9 A;  3REI A;  3AFA D;  1VEU B;  4I39 A;  5F1G A;  2ACG A;  1U35 B;  4CPK A;  5B24 B;  1W1Y A;  5EVE A;  3EPK A;  3O88 A;  2ZQ8 A;  3W98 C;  1S6R A;  1T1C A;  3GQZ A;  2YFV B;  3O62 D;  2M1C A;  2JKT I;  2W3H A;  2W3G A;  4I38 A;  1SZV A;  4N9K A;  4Z66 B;  3HLW A;  3NI9 A;  1AOI A;  3MJQ A;  4KHA A;  2V0U A;  4Y17 A;  3SS4 A;  3AZI A;  1I2S A;  2HF6 A;  1XGJ A;  3QNB A;  3TSG A;  4MEZ A;  3MGP C;  4PM8 A;  2J3W A;  5E2E A;  4F94 A;  3E4P A;  4AWL B;  1YLW A;  1KX4 C;  2HP5 A;  2JHE A;  3B6F C;  3WAA B;  1XXM A;  5CER A;  1VM1 A;  5GHY A;  1IYO A;  3MFD A;  3WRT A;  3LEQ A;  3UT9 C;  4WMC A;  3MXS A;  3VH6 A;  3KWQ A;  1IOU A;  3C1B D;  1IFQ A;  4FSF A;  2XRN A;  4JLF A;  3WTP A;  3MNN B;  3X1T B;  3GDI A;  3W98 D;  4GOG A;  1YLZ A;  2NZD B;  2Y59 A;  1M19 C;  4EES A;  1YLT A;  2VGJ A;  4KZA A;  2W27 A;  4A5R A;  4R8P C;  1IKG A;  1ULY A;  1P3P C;  3L26 A;  1PWC A;  4X55 A;  3D3O A;  5AV6 C;  5FI2 A;  1TZY B;  2W3D A;  3FKV A;  5JRG B;  5B1L C;  1P3M D;  2PYR A;  2QWS A;  3MGP D;  5EOE A;  5HFO A;  2CMN A;  4ZTK A;  4QJG A;  2QYB A;  4ZBE A;  2XDM A;  4X23 C;  4XUZ A;  5F99 C;  1KX4 D;  1XA1 A;  2NUT C;  2ZLY A;  4H9O B;  1ID3 C;  1TS6 A;  5CPI D;  4KQR A;  1X0O A;  4QHC A;  1UGU A;  3LY4 A;  4R4S A;  5AY8 B;  3UT9 D;  2A2L A;  1MWT A;  3R7W A;  2GNX A;  3SW1 A;  1L0E A;  2XFS A;  5B2J B;  3UB6 A;  4J8W B;  3C5A A;  1NLY A;  4IJE A;  3OOV A;  4IBX A;  2V0W A;  4DE0 A;  1E25 A;  2QPN A;  3AV2 A;  1L0F A;  1SDE A;  3H82 A;  2FJ7 D;  4WU8 C;  4JGO A;  2JKR I;  1K6S A;  4R8P D;  4IJF A;  1P3P D;  3PYP A;  1YLY A;  1ES3 A;  3MQQ A;  2WKQ A;  5EM0 A;  3C1C A;  1E15 A;  2DF4 C;  3AZF A;  3NCK A;  3FPV A;  5AVE A;  3SS3 A;  4P85 A;  3G4P A;  4BEN A;  5FAP A;  4HQA A;  5F83 A;  4ARZ A;  5GXQ B;  2ZC5 B;  3W96 B;  1NXY A;  1L0G A;  1VET A;  1M6K A;  5FAQ A;  1BH8 A;  3HLD A;  2HJ9 C;  1ID3 D;  4NZ4 A;  3E98 A;  4PHT A;  5TGF A;  1LSV A;  3AZL B;  3MGS B;  2WKE A;  3BFC A;  2FH5 A;  3NBL A;  4BBT A;  5TFQ A;  4S2J A;  1K56 A;  3L27 A;  2QJ7 A;  4H9S C;  4LFU A;  1H8P A;  2FFY A;  5CPK C;  4OJP A;  3WKJ C;  3FKE A;  1BTL A;  2PAV P;  1MKM A;  4FD8 A;  1CK3 A;  3E2K A;  3HJK A;  1W1P A;  3BY9 A;  2YFW A;  1EWZ A;  4GZB A;  3NEC A;  4IVI A;  4HHD A;  4H9R A;  4EBL A;  5MC7 A;  2G2W A;  2F8N K;  1YSQ A;  3BRM A;  3HCY A;  3KSF A;  3AL0 C;  5AV5 B;  2PU2 A;  2O99 A;  1KU5 A;  2JSS A;  2Y2K A;  3REI B;  3IT9 A;  4B93 A;  4OQG A;  3OBF A;  1WYC A;  3ZVT A;  2RIQ A;  5CED A;  3X1S A;  4DRT A;  1GHP A;  2CV5 C;  2DQN C;  1SKO B;  3M6H A;  3W97 A;  4E45 A;  2Z2L B;  1M1A B;  5FI7 A;  1P3B B;  4UHU A;  2V9A A;  3LIF A;  3TOI A;  1YT4 A;  2WKP A;  4BWI A;  5KMW A;  3IHA A;  5B40 A;  2XR0 A;  4R6L A;  5BOH A;  3AZK A;  3TU4 A;  3UTB C;  1AOI B;  3UNW A;  2G5I C;  3MZE A;  3REK C;  4HGA C;  3AZI B;  3VP2 A;  5CPK D;  4GW9 A;  5HWV A;  2ZJ9 A;  5B1M A;  4XZQ A;  4OJ6 A;  4H9N A;  2D49 A;  4OON A;  1ONH A;  4KUO A;  2ZY4 A;  4WEJ A;  5AVB C;  4UA7 A;  5IHV A;  3UB7 A;  4J8V B;  1L0D A;  3AN2 C;  5I5L A;  2WZZ A;  3WD2 A;  4NXB A;  1NRJ A;  5KZH A;  4DRA A;  1PRQ A;  1W1T A;  1ES4 A;  3HLG A;  4O01 A;  3KWQ B;  3PTE A;  3GEC A;  2CV5 D;  3LJA A;  5CPJ A;  4DN0 A;  5B31 A;  3CG5 A;  5BS7 A;  4WU9 C;  3NDG A;  5CRF A;  2NQB C;  4NE6 A;  1IEL A;  1P3I A;  4LGW A;  2J8P A;  3A6N A;  1P3F A;  5AV8 A;  2PU4 A;  3UTB D;  3HBR A;  5FAS A;  4ETZ A;  1G68 A;  4GD8 A;  5KSH A;  4HIA A;  3REK D;  1K4E A;  5L10 A;  3GV9 A;  4PMA A;  3AZJ C;  2OLV A;  3K3D A;  3F1P A;  3B6G C;  3MSH A;  3ZFZ A;  2XF3 A;  5CTN A;  1CK7 A;  4E44 A;  1H8M A;  3PBT A;  1MZU A;  4ZUX C;  4OKP A;  1PWG A;  2O9A A;  1YKD A;  5DF8 A;  1K25 A;  5CX7 A;  4JXW A;  3SZT A;  1DP8 A;  3H0L C;  5GSU A;  4WU9 D;  3ZG5 A;  2NQB D;  2HUE C;  2W3E A;  3FZC A;  4OOY A;  3H82 B;  3IX8 A;  4KEN B;  3E4O A;  5FQ9 A;  3V50 A;  2IWB A;  4WNN A;  1PZP A;  4YWZ A;  2OAQ 1;  3X1S D;  4E04 A;  4QLC B;  3C1C B;  3KUY C;  3AZJ D;  1GA0 A;  4IBG A;  3AZF B;  2QHK A;  3AGF A;  5AQB A;  4CLC B;  1PW1 A;  3S7O A;  2ZM2 A;  3AZN A;  4Z2I A;  2YKF A;  5HAP A;  4IJG A;  3AZG C;  3W4Q A;  4ARZ B;  2H10 A;  2XFT A;  3PXP A;  5JYO A;  2ZM0 A;  1BH8 B;  5F68 A;  4KGC C;  1N9L A;  3RXW A;  2P74 A;  1FQG A;  3AZK D;  4H6J A;  3A1I A;  3LEL A;  1E6R A;  3LUQ A;  3OPH A;  3UPP A;  3VOL A;  2W0N A;  2EFU A;  2RL3 A;  5B33 B;  4GD6 A;  4JF6 A;  4L0L A;  4P0M A;  5FA7 A;  3T4L A;  4LD9 A;  4EEU A;  3B3X A;  5TJJ A;  2HIO B;  5B1M D;  1ZLA B;  3VH6 T;  3T1S A;  3SH8 A;  4KZ5 A;  5AVF A;  4OJL A;  3HLF A;  5B32 A;  5DF9 A;  1Q9C A;  1S1Z A;  3Q07 A;  5AVC A;  2IWC A;  4DE3 A;  3IQA A;  1M18 C;  5I94 A;  4GB7 A;  1P34 C;  1FR6 A;  3VMA A;  5E43 A;  1P3O A;  2J3T C;  5U47 A;  4M3K A;  4P6Z M;  2J7V A;  3HUN A;  4KG2 A;  1HQ3 A;  1CJF A;  4PM7 A;  5B31 D;  3BQA A;  2HP9 A;  1XJ4 A;  3REL A;  3LCE A;  4R4R A;  3UB5 P;  1IKI A;  1XX2 A;  4NE3 A;  4N1X A;  4UQI S;  4KGC D;  3W97 B;  3MGR A;  3CWF A;  1YUE A;  3AZM A;  1Q2Q A;  4IUH A;  4H9Q B;  5C3I C;  1K4F A;  3UO9 A;  2QJ5 A;  5B40 B;  1OME A;  4C3Q A;  3TU4 B;  4EU0 A;  5F69 A;  3KFU G;  2XGN A;  3VSK A;  4HP4 A;  1D06 A;  4JJN A;  4JGQ A;  1GHM A;  2ARO C;  4XZQ B;  4Z5T C;  3A3E A;  4DKI A;  1M18 D;  3HVF A;  4K0X A;  1O6I A;  1ERO A;  3ISG A;  1P34 D;  3G32 A;  2J3T D;  3TG9 A;  2BG1 A;  2VK3 A;  2INW A;  5HAQ A;  1W63 Q;  3UE6 A;  4PKY A;  4OUI A;  2ZY5 A;  4HJ6 A;  3LZ1 C;  3LJA B;  4R38 A;  2JBF A;  4U0X A;  2LB5 A;  1PI4 A;  5FQJ A;  5L09 A;  3WS4 A;  5M19 A;  1KX3 B;  2V8F A;  3LGO A;  3MR0 A;  3AV1 B;  4XUJ A;  2HV1 A;  2P7J A;  3LYX A;  1P3I B;  3A3D A;  2B5R A;  2HPB A;  1OJG A;  1P3F B;  1WWI A;  3A0V A;  3NOP C;  3QHY A;  4RX2 A;  4UA9 A;  3SH7 A;  3G6O A;  4ZRR A;  3C7U A;  3M7P A;  4EXO A;  4MN7 A;  3PAE A;  2JN7 A;  3BEC A;  4Z5T D;  4D2O A;  1KOU A;  3MF0 A;  3BFG A;  1EQZ C;  3NQJ A;  5F82 A;  2EWW A;  3UTA A;  2HDS A;  4Y15 A;  3N8S A;  3F1P B;  4N92 A;  4KG6 A;  1V9Y A;  4KUD B;  2EWV A;  1KX5 C;  1P3L A;  3LZ0 C;  1ZG4 A;  2VGK A;  2ZC3 B;  3OZH A;  4CQH A;  3HSH A;  4HH3 A;  1GOI A;  2ZY3 A;  3MZD A;  4S2O A;  1SHV A;  5AVC D;  1ZKJ A;  3QP5 A;  3LZ1 D;  4WJ3 C;  2X71 A;  1P3K A;  4O0P A;  3EGX C;  4E3N A;  1WWS A;  5GT3 A;  3FC7 A;  5CP6 A;  3MGQ B;  4CLC E;  3QP4 A;  3K2N A;  4J8X C;  3WA9 B;  4NEE D;  4F3L A;  4DXC A;  1BT5 A;  5CHL B;  3MS6 A;  4JGR A;  4IHQ A;  3X1V A;  1XJ2 A;  3VP3 A;  3AFA A;  3M6B A;  1AXB A;  3CAX A;  3LEZ A;  3AZN B;  3RTY A;  1LL8 A;  2PYO B;  1A0K A;  4H8R A;  1DJA A;  5FSR A;  3X1U A;  1KX5 D;  4Z2K A;  3ZCZ A;  3LEL B;  1KE4 A;  4BQM A;  3O62 A;  4ZJ3 A;  5AQ9 A;  2WAD A;  3LID A;  1CI8 A;  4LD9 B;  4OJO A;  4EET B;  2BYK A;  3IF6 A;  4GHA A;  4LG2 A;  5CHJ A;  1SCW A;  1OTB A;  1STZ A;  3C8C A;  3IHB A;  4HH2 A;  4Y3I A;  1ES2 A;  3V39 A;  3G2Z A;  1ACF A;  4JBF A;  4KZB A;  5HAR A;  2VZW A;  5B32 B;  3N8L A;  5L8M A;  2RCX A;  2WZX A;  5HSQ A;  4C75 A;  4R1G A;  2UWX A;  4PAU A;  1GSW A;  4WZS B;  5FQQ A;  4EQ1 A;  4KQO A;  5AV9 C;  2VEA A;  3T1R A;  5CEC A;  5GT0 C;  2BAS A;  2R9W A;  3C38 A;  3CMZ A;  1HQ3 B;  3RXX A;  4I5S A;  3N3F A;  2WGI A;  2Y2J A;  4Z2H A;  5LBR A;  4QNL A;  4GLQ A;  4XUJ D;  3REL B;  3A3J A;  3IX4 A;  3BJN A;  3W98 A;  1JFI A;  3MGR B;  1TVF A;  5DNM B;  3AZM B;  2E8I A;  5DFY A;  3KSY A;  4NET A;  5EVI B;  3E2L A;  4RVA A;  5GLA A;  4JJN B;  4LLO B;  4NZ3 A;  1FR1 A;  3P09 A;  3IS2 B;  4DE1 A;  5E5A B;  3WAA C;  3MGP A;  4Q0H A;  1TAF B;  1SDN A;  2HDU A;  4E3L A;  3ZG7 B;  3LIB A;  2HDQ A;  3G30 A;  5FQI A;  4EO5 C;  1P3L D;  1KX4 A;  3BEB A;  3F1O B;  4LV1 A;  1P3G B;  3B6F A;  1P0Z A;  3IBR A;  5AV9 D;  2D01 A;  5GLB A;  4QY6 A;  5GT0 D;  4WLA A;  4LRZ E;  4HNB A;  3NIA A;  1GA9 A;  4GDB A;  4IBJ A;  5G18 A;  5JYP A;  3UT9 A;  1RP5 A;  1Q2P A;  4FCF A;  5B2I C;  5C5K A;  1PYY A;  3V5M A;  1YU1 A;  3WD4 A;  2F8N G;  2L1M A;  3LFV A;  3S4X A;  5GT3 D;  1N4O A;  5CP6 D;  3NC8 A;  3GR2 A;  4HOI A;  3VFH A;  1M19 A;  4WEK A;  4X68 A;  3R45 B;  3AGE A;  5JRG C;  4R8P A;  5DNN B;  1P3P A;  3NOU C;  1ONG A;  4X56 A;  3MXQ A;  5AV6 A;  1HLU P;  5BNX B;  5JA4 A;  1HD8 A;  4EWF A;  2WGW A;  1EI5 A;  3X1U D;  4H9P A;  3B33 A;  3NQJ B;  4X23 A;  1N9B A;  5F99 A;  3UTA B;  1VB6 A;  3QP2 A;  3REJ C;  1S32 B;  1KDS A;  4MDZ A;  5AY8 C;  5E2G A;  1E8B A;  1ID3 A;  1BUL A;  4MN6 A;  1MWR A;  4D60 A;  5B2J C;  3T50 A;  3T1Q B;  5FEG A;  1DRM A;  3S22 A;  3JPU A;  1YLJ A;  4NE5 A;  1HZO A;  1MKI A;  5B2I D;  1XP4 A;  1NZO A;  4QWO A;  3AZE D;  1DY6 A;  4CSR B;  3VV4 A;  3H0R C;  1P3K B;  3EOI A;  4IED A;  5BT1 C;  1OTE A;  4WU8 A;  3V67 A;  3F6T A;  4OPZ A;  5HDD A;  4F3L B;  2ZC4 B;  3W99 C;  3MKF A;  5DFX A;  2ZMA A;  1AWI A;  5GXQ C;  4XXR A;  4Y13 A;  5HL1 A;  3X1V B;  3AFA B;  5L07 A;  3WRZ A;  3KYQ A;  3GTC A;  1YU0 A;  2PR5 A;  2Y2L A;  3AZL C;  3D72 A;  3REJ D;  2YKH A;  1ESU A;  2I72 A;  5AY8 D;  3S7Q A;  3P98 A;  1YM1 A;  2O9B A;  4HI4 A;  1W7F A;  1HVB A;  3O62 B;  4ZJ1 A;  1O07 A;  1S66 L;  1B6W A;  4H9S A;  1RGZ A;  4K91 A;  5CPK A;  1ZC2 A;  3WKJ A;  1LL5 A;  3B6F D;  3A0S A;  5AV5 C;  2ZQD A;  4KZ8 A;  2Y2N A;  3IXG A;  3REI C;  1H8Y A;  1GCE A;  2WAF A;  1MPL A;  3GMW A;  3W99 D;  5B0Y C;  2VGL M;  1F1E A;  1WE4 A;  1M1A C;  1PFL A;  1P3B C;  3REH C;  2XK1 A;  3BWL A;  3DBA A;  1BLP A;  1T3U A;  3F1N B;  2CV5 A;  4G91 B;  3C1B B;  1M19 D;  1DP6 A;  3ZG9 B;  4IUK A;  2ZQC A;  1IYS A;  1R4V A;  3LO7 A;  3W98 B;  1JFI B;  3H0M C;  2WUQ A;  1KVL A;  1FCO A;  1FIL A;  2QZ6 A;  5KDM A;  3B0D C;  5A8B A;  4J8U C;  3Q81 A;  3AZI C;  5AV6 D;  1E6N A;  2WK0 A;  3TJZ C;  3UTB A;  2B02 A;  5B1L D;  2KOI A;  4WL9 A;  1L2S A;  3ZYT A;  2LB9 A;  3REK A;  4X23 D;  5F99 D;  4J8V C;  1T18 A;  1K55 C;  3CHW P;  5DF7 A;  2O0Y A;  1P3M B;  3MGP B;  1T1A A;  4HMC A;  1KX4 B;  4WBG A;  5B0Z C;  5G49 B;  4B9O A;  3AN2 A;  2XEP A;  5CPI B;  5B0Y D;  4KZ7 A;  4OPY A;  1D1J A;  3AZH C;  1W8Q A;  1P3B D;  4UA6 A;  3UT9 B;  3REH D;  1FOF A;  3CPT A;  5M1A A;  1GSX A;  2PYP A;  4QPR A;  4B4Z A;  1YMX A;  4WU8 D;  4MBK A;  1H0M A;  4WU9 A;  4HME A;  3TE8 A;  2NQB A;  1KDW A;  3EPJ A;  4YS3 C;  1BYW A;  5J7E A;  2Y79 A;  3HRE A;  4J8U D;  3LR5 A;  4OJ5 A;  2VV6 A;  2FJ7 B;  5BNV A;  2P04 A;  3AYW B;  3DWZ A;  4DDS A;  1BH9 B;  4R8P B;  2ZC7 A;  1P3P B;  3SS5 A;  3FDD A;  1GSV A;  1F66 C;  1RGY A;  4E3J A;  2E8J A;  3AZJ A;  5JA4 B;  1TD5 A;  5CGS A;  1CQA A;  2WGW B;  4H9P B;  5J3W A;  4MB5 A;  3Q7V A;  3VSL A;  1MC0 A;  3UDI A;  5B0Z D;  1Y4O A;  3B6G A;  1ID3 B;  2EX8 A;  1D7E A;  4K0W A;  1Z6F A;  2QKP A;  2Y4A A;  3AZH D;  2VLG A;  4ZUX A;  4KHA B;  5HD3 A;  3IBJ A;  4LRY C;  4JXS A;  3WKJ D;  1LSW A;  1XJ3 A;  1BSG A;  3G2Y A;  3VH5 W;  4NYU A;  2Z6D A;  1ERQ A;  1JTD A;  4YS3 D;  4RA7 A;  1IEM A;  3GVB A;  4WZ4 A;  3P01 A;  5HWT A;  4QLC C;  3WX7 A;  5HW3 A;  5DKL A;  4CLC C;  3WWX A;  3BFE A;  4Q0I A;  3NOT C;  4OQH A;  1I5Q A;  1F66 D;  4YM6 C;  3KUY A;  2Y2G A;  4Q0J A;  5DTT A;  3S1Y A;  3WTP B;  1E88 A;  3AZG A;  5DKK A;  3I7J A;  5B33 C;  3T4S A;  3W4P A;  4KGC A;  2HIO C;  1ZLA C;  3MXR A;  3B0C W;  3CLO A;  3O5Y A;  1M40 A;  3JVV A;  1NWZ A;  4NG2 A;  3DTM A;  3EPL A;  5FQK A;  4E3O A;  3K3C A;  5CPK B;  5AVB D;  3MKE A;  2RVQ C;  3AN2 D;  1M18 A;  4MMN A;  4ZBJ B;  1J9M A;  2PBY A;  4GKU A;  4LEN A;  3BW6 A;  3PAG A;  1P34 A;  1LHY A;  4DJ2 A;  1XA7 A;  2K2N A;  1GPF A;  3R7W B;  3W2Z A;  4YM6 D;  3L28 A;  5HZH A;  3ZVW A;  1DP9 A;  3ZQ5 A;  1S1Y A;  2F8N H;  1GXD A;  4G92 B;  3AV2 B;  5IT5 A;  4S2N C;  1F5M A;  2UV0 E;  1QO6 A;  2HIO D;  5CGW A;  2GX5 A;  1H5X A;  2CWE A;  2XH9 A;  5KDM B;  2PRF A;  3EQV A;  2KLI A;  3A3I A;  3UTB B;  3HLE A;  1AIW A;  1YSP A;  5FI6 A;  5EFW A;  3NHQ A;  5CEB A;  2V5O A;  4HGA B;  1E3U D;  4Y7P A;  3RH8 B;  4P6B A;  1VET B;  3B6G D;  4Z5T A;  2RVQ D;  5AQA A;  1A7W A;  3LIE A;  3LY3 A;  3T12 B;  1Y28 A;  2JCH A;  5A92 A;  3ULF A;  3WS0 A;  1YAX A;  4ZUX D;  1S4R A;  2XA7 S;  3PHY A;  4OPR A;  3IX3 A;  1S0W A;  3BYD A;  5AQ7 A;  1KX3 C;  1J7M A;  1KGE A;  3G35 A;  3AV1 C;  3CPT B;  4UUZ A;  2DCF A;  2HGV A;  3LZ1 A;  4BD0 A;  2YFW B;  1P3A C;  1E6Z A;  1YU4 A;  3O86 A;  2BYM A;  4WU9 B;  4H9R B;  4UEY A;  2NQB B;  3T1X A;  3NQU A;  4I3A A;  4Z2L A;  4KZ3 A;  3KUY D;  4P87 A;  3C2W A;  4KZ4 A;  1MY8 A;  4XT2 A;  4M4X A;  3AZG D;  3X1S B;  3BY8 A;  3AZJ B;  3Q82 A;  4KUD C;  4S2P A;  1BZA A;  2Q9M A;  2ZL1 A;  3FG8 A;  4UAA A;  1KGG A;  1YU3 A;  2IO5 C;  3GRJ A;  2G5H C;  4HJ3 A;  3AZK B;  1KX5 A;  3LZ0 A;  5M18 A;  4NYY A;  2MJ6 A;  1NY0 A;  5BO0 A;  2JKF A;  5B1M B;  3MGQ C;  4BL3 A;  4H9N B;  2ZM8 A;  1G6A A;  2B18 A;  1P3A D;  3WA9 C;  1NYM A;  2WKR A;  5G4Y A;  2HUE B;  2H5S A;  3WTP E;  1VQQ A;  3C4P A;  4HMD A;  4J8X A;  2H0Y A;  1BUE A;  1H0G A;  3VP1 A;  2PD8 A;  2PYO C;  4NXG A;  3KSG A;  4EBN A;  1K0K A;  2R9X A;  5CPJ B;  4X25 A;  1TDG A;  5B31 B;  4EER A;  4IBI A;  5AJG A;  3L9K A;  2FFF B;  2A24 A;  4EEP A;  1MXO A;  3UB8 A;  2P08 A;  5DJT A;  3T4K A;  1YQS A;  4KGC B;  3PBQ A;  3MVD C;  3A6N B;  5AV8 B;  3UN7 A;  4S2L A;  1ED7 A;  3ICY A;  4PPR A;  3WD1 A;  3EEH A;  2NUP C;  1N1J A;  2ARO D;  1K54 C;  4ETX A;  4X53 A;  4AFI A;  4S2M A;  1JWV A;  1W8Y A;  4EQI A;  4MLL A;  4IBE A;  2Q0O A;  4PM6 A;  2ZQ7 A;  4Z2M G;  5TBM A;  4G3W A;  2DNS A;  1M18 B;  4MN5 A;  3UB9 A;  5DTK A;  3UY6 A;  1P34 B;  2XRO A;  5EPH A;  5AV9 A;  5GT0 A;  4GCZ A;  4MBH A;  3UE1 A;  2F8N D;  4KG5 A;  4ZDX A;  1UWP X;  5HX9 A;  5FUG A;  5DNM C;  4EW7 A;  5GSU B;  3MQO A;  5FDS A;  2GZA A;  4E3I A;  3C7V A;  3MVD D;  5EVI C;  4WNN B;  4CJN A;  5C3I B;  4Y0U A;  5E5A C;  4OH0 A;  2WKH A;  1EQZ D;  3D4F A;  1P3G C;  1O7E A;  3WAA A;  1XFN A;  4Z5T B;  4OQ0 A;  3DTE A;  5EUA A;  4H6J B;  3LZ0 D;  2W3F A;  2HP6 A;  2ZD8 A;  4NXE A;  2V1B A;  4OP8 A;  4QB8 A;  4E3M A;  3BQ8 A;  5EOO A;  2ZOI A;  4NK3 A;  5DNM D;  5B2I A;  3EEA A;  1P97 A;  1XJ6 A;  4UQI M;  4C6Y A;  3KXB C;  5AVC B;  4UUZ B;  2JKT M;  3AZE A;  4ZAM A;  3LZ1 B;  5FEF A;  5DNN C;  4J8X D;  1U35 C;  3U4L P;  2OLU A;  3BFF A;  1P3O B;  2WYX A;  5FDH A;  3VOZ A;  5F5Y A;  5B24 C;  3NQU B;  3T4O A;  5E5A D;  4LPZ A;  5JRG A;  4ID4 A;  4R3J A;  3V3R A;  3VP4 A;  1B67 A;  4MBF A;  5A90 A;  2XQZ A;  3UDF A;  4XT2 B;  4XUX A;  1S32 C;  1E6P A;  1ODV A;  3T4J A;  4WZ5 C;  3HJI A;  1LI9 A;  3KS8 A;  4Z66 C;  4FH4 A;  4N1H A;  4BD1 A;  3OPP A;  4FH2 A;  3CI6 A;  4JF4 A;  4WEL A;  3REJ A;  1TS7 A;  5AY8 A;  4DJ3 A;  3HL9 A;  1KX5 B;  5DVA A;  5B2J A;  3EGD C;  4IBF A;  2L5A A;  1P3K C;  4AWL C;  3QNC A;  3VE4 A;  1JTG A;  2H0T A;  1LL9 A;  5BO0 B;  5IS1 A;  1CI9 A;  2ZM5 A;  3KXB D;  2Y2I A;  1UR8 A;  4I3J A;  1Y54 A;  2G7U A;  2ZMV A;  3M2K A;  1U35 D;  4EBP A;  1JVJ A;  3JVU A;  3QP1 A;  5B24 D;  3IXB A;  1FCN A;  1JWP A;  3C30 A;  3S7N A;  4B4X A;  4WUJ A;  3IWO A;  1OJ5 A;  3N8R A;  3MNN C;  3X1T C;  3W99 A;  2VJW A;  1MWS A;  2NZD C;  5GXQ A;  3ZG8 B;  2PDR A;  4M6B A;  4Z66 D;  5GL9 A;  4GHL A;  3LI9 A;  2BLS A;  3AZL A;  4XUJ B;  3O62 C;  1DJB A;  2A24 B;  4DF6 A;  1LI0 A;  3DTI A;  1TZY C;  3V9R A;  3TRC A;  3EQU A;  3ITA A;  4LRX C;  4O8G A;  2M7U A;  4GNU A;  1CXW A;  4IBR A;  5B32 G;  3KYE A;  1UWN X;  3WAA D;  4U3T A;  5B1L A;  2XLN A;  3O3V A;  3VOY A;  2JKR M;  1XFQ A;  1BLS A;  5CXW A;  1S67 L;  3CUE C;  3WS2 A;  5HD5 A;  5AV5 A;  4L9E A;  2Y2Q A;  1LT0 A;  2V2F F;  3FYZ A;  1NLZ A;  1P3L B;  4QU3 A;  4NFT A;  3MNN D;  4J8W C;  3X1T D;  1K57 C;  5AV9 B;  3MQ0 A;  5B0Y A;  4BBV A;  2NZD D;  1SKO A;  3QP6 A;  4G91 C;  5GT0 B;  3C1B C;  4DE2 A;  4EUV A;  4GHI A;  1M1A A;  3BFD A;  4JXG A;  1P3B A;  4NY2 A;  5FUG B;  3REH A;  4Z2J A;  4PM9 A;  3ZGA B;  4E6W A;  3VH6 W;  1CEG A;  5K5B A;  4IBK A;  5GT3 B;  5CP6 B;  1TZY D;  3B0B A;  2FN2 A;  2OSU A;  3A3F A;  3FKW A;  5JRG D;  5D3O A;  1T1B A;  1UR9 A;  1FSW A;  3EG5 B;  2C5W B;  3IH8 A;  4J8U A;  2XSS A;  3W96 C;  1HTZ A;  3S7P A;  1P3M C;  2V8C A;  3ZG0 A;  3ZNT A;  3L2A A;  2Z6C A;  1Z2C B;  1OTI A;  1TS0 A;  5EE8 A;  2WGV A;  1JWZ A;  3EWK A;  5DJU A;  1ZG6 A;  4J8V A;  1OGG A;  1K55 A;  3MGS C;  3OC2 A;  2ZBB A;  4R70 A;  1OPX A;  5CPI C;  4YNR A;  1FIK A;  3X1U B;  2ZQA A;  4Y5F A;  2JE5 A;  4EO5 B;  5B2J D;  1KVM A;  5B0Z A;  4J8W D;  4X1M A;  4PKY G;  4WM9 A;  3ITB A;  1PNE A;  2BYK B;  3IF6 B;  3UMD A;  3RJU A;  3GSG A;  3AZH A;  2EX6 A;  4PM5 A;  5HL6 A;  5B2I B;  5BT1 D;  3AZE B;  2FJ7 C;  4FUW A;  4KUK A;  3AYW C;  5HPI A;  1IYQ A;  5HDC A;  1N9N A;  4YS3 A;  4U0T A;  5GXQ D;  3B42 A;  3W96 D;  1EW0 A;  3A0R A;  1KE3 A;  4EUZ A;  2K31 A;  2JKG A;  1F66 A;  3AZL D;  4R23 A;  4X69 A;  3MGS D;  1H0I A;  4GN2 A;  1ERM A;  4Q8I A;  1P9W A;  1AOI C;  4YOF A;  2OV5 A;  3REJ B;  3IXD A;  5G4Z A;  5GLC A;  4ME4 A;  4L9G A;  3T4Q A;  2LY8 A;  3KO6 A;  5F1F A;  4KZ9 A;  1W63 M;  2PHY A;  3VE3 A;  5AV5 D;  2PR6 A;  5CHU A;  3L7H A;  3IWI A;  4Z2M H;  3AYW D;  3REI D;  5AVB A;  3ZNY A;  3N7W A;  2B95 A;  1FSY A;  4LCM A;  3B6F B;  4E6X A;  3KWQ C;  5EVL A;  4QLC A;  1YPR A;  4CLC A;  3WTP C;  1W79 A;  4YFM A;  1M1A D;  4K08 A;  3W99 B;  1TS8 A;  3WD3 A;  3IWQ A;  4YM6 A;  3P7N A;  4HES A;  4OP5 A;  2F2A C;  1U60 A;  3G31 A;  4Z2G A;  3E4Q A;  3UDX A;  3UPO A;  1AOI D;  3LIA A;  2OOL A;  1NZU A;  3BLS A;  2Y2H A;  5B33 A;  4Z9Q A;  1M19 B;  3P5J B;  3AZI D;  1TEM A;  5HAI A;  5E2H A;  2HIO A;  3V9R B;  1ZLA A;  3HLC A;  3ZHH A;  4R3A A;  3CZD A;  3BLM A;  5AV6 B;  1KS0 A;  1H3Q A;  2XD1 A;  4J8V D;  4UPK A;  4QY5 A;  5B1L B;  2DMW A;  4ZBJ C;  4IBC A;  3UE3 A;  3HON A;  4JXV A;  1E3U A;  4X23 B;  1T19 A;  5F99 B;  3DWK A;  3RFB A;  1G6O A;  4WMC D;  4WV4 B;  3KWQ D;  4Y2F A;  3Q1F A;  1BLC A;  2EFX A;  1NRF A;  3OPR A;  4TX8 A;  3WTP D;  4NZ1 A;  1MWU A;  5B0Y B;  4G92 C;  4LV0 A;  3AV2 C;  4BMW A;  2VA0 A;  4GHI B;  1QMF A;  3IF5 A;  4OVD A;  2EA9 A;  2PT7 A;  3PBR A;  5F6A A;  3UME A;  2G2U A;  3REH B;  2C6W B;  3CIT A;  4LV2 A;  4H9Q A;  4NKP A;  1K38 A;  1YLP A;  1YU2 A;  4S2N A;  4WYY A;  4WU8 B;  3C1C C;  5IU1 A;  3WS5 A;  4HJ4 A;  3AZF C;  4P6Z S;  1PWD A;  1RCJ A;  1I2W A;  3B0D B;  4J8U B;  4JKT A;  1NYY A;  3B47 A;  3AGD A;  4LCL A;  1GHI A;  3PR6 A;  2H28 A;  3LR4 A;  1G28 A;  4KQD A;  3UE0 A;  4WF0 A;  4Z1W A;  4DDY A;  4CAY A;  4GS9 A;  2HZ5 A;  4Y0T A;  2J8Y A;  4BL2 A;  1JNU A;  3VP0 A;  2V1Z A;  1YMS A;  3VH5 A;  5B0Z B;  4ESP A;  1TF1 A;  3MFX A;  3R4K A;  3AV2 D;  3DAV A;  5HPF A;  3AZH B;  2HJE A;  3FPW A;  2P9V A;  1KX3 A;  1HTA A;  2VKS A;  1PW8 A;  3AV1 A;  1C3B A;  3W4O A;  3WKJ B;  3KSH A;  2FZ0 A;  1P3A A;  4QLC D;  3C1C D;  2ZC6 B;  3AZF D;  4CLC D;  4YS3 B;  5CGX A;  2WKI A;  3X1S C;  2J9P A;  5A91 A;  1VHM A;  3U2A A;  1DJC A;  1SKF A;  2JC7 A;  3W97 C;  4MB4 A;  2W1R A;  4E3K A;  2X02 A;  3WD0 A;  3MZF A;  1OTA A;  1F66 B;  5B33 D;  2CV5 B;  4KUD A;  3BM6 A;  5B40 C;  3AZK C;  3TU4 C;  3W8K A;  2J9O A;  3HUO A;  2ZQ9 A;  1ZLA D;  1K56 D;  4IVK A;  3KSI A;  4BBU A;  1ZTU A;  1PDC A;  2RTS A;  3H7W A;  5B1M C;  4XZQ C;  3Q7Z A;  2OAP 1;  1OGB A;  2PD7 A;  5FAO A;  2OWH A;  3REK B;  3EPH A;  2ARO A;  1FCM A;  3MGQ A;  2Y2M A;  2W1T A;  3WA9 A;  3L25 A;  4S2K A;  2ZMF A;  5AVB B;  5FAT A;  5GHX A;  3LIC A;  4YIN A;  3AN2 B;  4JGP A;  4HEF A;  3LJA C;  5CPJ C;  2DRW A;  5L2F A;  3W97 D;  5B31 C;  5HWW A;  5BS7 C;  5EEC A;  2PYO A;  5TR7 A;  3JYI A;  4YM6 B;  1P3I C;  2F8N A;  3NY4 A;  5DTS A;  3A6N C;  5B40 D;  1P3F C;  5AV8 C;  3NUL A;  3UPN A;  3TU4 D;  5EM1 A;  1LSX A;  1PIO A;  1KE0 A;  3MVD A;  1OTD A;  5BNV B;  4XZQ D;  5BPV A;  2GJ3 A;  2Y2P A;  2AVX A;  2KX6 A;  3C4O A;  1F98 A;  3DW0 A;  3ZDJ A;  1K54 A;  4R0Q A;  1ES5 A;  3IH9 A;  2Y91 A;  1EQZ A;  5GLD A;  2V1A A;  3Q7V B;  2PBD P;  4RQ9 A;  2VQR A;  3B6G B;  1H3O A;  1CEF A;  3LJA D;  5CPJ D;  2Y55 A;  4ZUX B;  1KX3 D;  5GSU C;  3AV1 D;  1LLB A;  2EX2 A;  1P3I D;  2IA2 A;  2EXA A;  2L0W A;  4HY8 A;  3A6N D;  1P3F D;  2WAE A;  5AV8 D;  3LI8 A;  1L3L A;  5DNM A;  4II7 A;  1EAK A;  4JPM A;  2VV7 A;  2A3U A;  2EX9 A;  4ZJ2 A;  5EVI A;  4IBD A;  4OOL A;  3AZN C;  1OT9 A;  3IS2 A;  5E5A A;  2QMI A;  3N6I A;  1TAF A;  3KUY B;  1KGF A;  4O7D A;  4OLD A;  4KUD D;  3N4I A;  3O87 A;  1MBL A;  2V20 A;  3LEL C;  3AZG B;  3F1O A;  3D9Y A;  1P3G A;  3TW8 A;  2Y2O A;  2VV8 A;  3A1K A;  4CAY B;  4GS9 B;  4LD9 C;  4OLG A;  4OQI A;  1PZR A;  2IWD A;  4I3I A;  5B32 C;  5GSU D;  3MMH A;  1S4S A;  2D02 A;  5AVC C;  2CC1 A;  4GDN A;  3QP8 A;  3MGQ D;  4QD4 A;  3T4T A;  4HP9 A;  2P9V B;  4MNR A;  2GDN A;  4GJ4 A;  5CHM A;  3WA9 D;  2Y8H A;  1P3O C;  5HDS A;  3KXB A;  3R45 A;  4MCW A;  4RYE A;  1HQ3 C;  1P3A B;  1VEU A;  5DNN A;  1G5U A;  1U35 A;  3AZN D;  3M2J A;  2PYO D;  5B24 A;  1PI5 A;  3REL C;  5BNX A;  2ZOH A;  4HBU A;  3MGR C;  4BLM A;  3LEL D;  3AZM C;  1NJ4 A;  5J4E A;  1S32 A;  2YFV A;  3PBO A;  4WZ5 A;  2X01 A;  1F2K A;  4Z66 A;  4LD9 D;  3NJA A;  1K6R A;  2XA7 M;  4JJN C;  2IO5 B;  4G3V A;  5B32 D;  1W5D A;  3H7W B;  4NXF A;  3V3S A;  4CSR A;  3WS1 A;  1H8Z A;  4OPQ A;  3SH9 A;  5EV0 A;  2ARO B;  5FL3 A;  2K7S A;  1P3O D;  5CTM A;  4B88 A;  2Z2M B;  5GHZ A;  2W1T B;  1HQ3 D;  1ESI A;  1IYP A;  4GH9 A;  1BFM A;  4X6T A;  4NZ5 A;  1ZHH B;  3REL D;  3OLO A;  3OPL A;  4JF5 A;  2ZY2 A;  3MNN A;  3X1T A;  3PBN A;  5B31 G;  1V9Z A;  4LV3 A;  5KSC A;  3MGR D;  5E2F A;  4XUJ C;  3AZM D;  2NZD A;  5J8X A;  4IBB A;  4N9L A;  2F8N B;  3DTK A;  3HUM A;  2O9C A;  5EVI D;  1BLH A;  2BYM B;  3CJM A;  3FWL A;  3SOI A;  5FQM A;  1F9I A;  4JJN D;  4R3B A;  1TZY A;  3VH5 T;  1CF0 A;  1Z09 A;  3MVD B;  3NDE A;  3KX0 X;  3E0Y A;  1XGI A;  1XPB A;  3HLB A;  3UTA C;  1OT6 A;  1P3G D;  2IOU A;  5KIZ A;  4H9O A;  1WYB A;  1W1V A;  4G3K A;  4KQQ A;  4X1L A;  2ZL1 B;  1N9O A;  1P3L C;  1EQZ B;  2BTF P;  1PZO A;  3CUE A;  1P9R A;  2EXB A;  3OCN A;  1H3O B;  2J80 A;  2KDK A;  3G34 A;  1L6J A;  3LZ0 B;  1E4D A;  4WN5 A;  4J8W A;  1K57 A;  2I9V A;  3F1N A;  3C1B A;  4DMZ A;  3B0C T;  5GT3 C;  5CP6 C;  4FOF A;  2A49 A;  3VFF A;  2W8S A;  3PBS A;  3LR0 A;  2OWJ A;  4HBT A;  4EV4 A;  5A93 A;  4BJP A;  1W2E A;  5DNN D; 
#chains in the Genus database with same CATH homology
 4S2I A;  4Y0O A;  3OCL A;  3X1V C;  3AFA C;  3IXH A;  4KZ6 A;  4DXB A;  4J8X B;  2HDR A;  3UTA D;  1S32 D;  3W96 A;  2XD5 A;  1P3M A;  3X1U C;  4DQY B;  5G49 A;  3MGS A;  1TDL A;  5CPI A;  1QME A;  3L29 A;  3IF6 C;  4OOM A;  1P3K D;  4DRB A;  3KS4 A;  2Q9N A;  1N1J B;  3MBZ A;  3AZE C;  1ALQ A;  1XKZ A;  4RX3 A;  3FV7 A;  3IP4 C;  3KXB B;  2FJ7 A;  3AYW A;  3X1V D;  1BH9 A;  3REI A;  3AFA D;  5F1G A;  1U35 B;  4CPK A;  5B24 B;  3EPK A;  3O88 A;  2ZQ8 A;  3W98 C;  1S6R A;  3GQZ A;  2YFV B;  3O62 D;  4N9K A;  4Z66 B;  3HLW A;  3NI9 A;  1AOI A;  4KHA A;  3SS4 A;  3AZI A;  1I2S A;  1XGJ A;  3QNB A;  3TSG A;  4MEZ A;  3MGP C;  4PM8 A;  4F94 A;  5E2E A;  4AWL B;  1YLW A;  1KX4 C;  2HP5 A;  3B6F C;  3WAA B;  1XXM A;  5CER A;  1VM1 A;  5GHY A;  1IYO A;  3MFD A;  3WRT A;  3UT9 C;  4WMC A;  3MXS A;  3VH6 A;  3KWQ A;  3C1B D;  4FSF A;  4JLF A;  3WTP A;  3MNN B;  3X1T B;  3W98 D;  4GOG A;  1YLZ A;  2NZD B;  2Y59 A;  1M19 C;  1YLT A;  2VGJ A;  4KZA A;  4A5R A;  4R8P C;  1IKG A;  1ULY A;  1P3P C;  3L26 A;  1PWC A;  4X55 A;  5AV6 C;  5FI2 A;  1TZY B;  3FKV A;  5JRG B;  5B1L C;  1P3M D;  5EOE A;  5HFO A;  3MGP D;  4ZTK A;  4QJG A;  4ZBE A;  2XDM A;  4X23 C;  4XUZ A;  5F99 C;  1KX4 D;  1XA1 A;  2ZLY A;  4H9O B;  1ID3 C;  5CPI D;  4KQR A;  4QHC A;  3LY4 A;  4R4S A;  5AY8 B;  3UT9 D;  1MWT A;  1L0E A;  2XFS A;  5B2J B;  4J8W B;  3C5A A;  4IJE A;  4DE0 A;  4IBX A;  1E25 A;  2QPN A;  3AV2 A;  1L0F A;  1SDE A;  2FJ7 D;  4WU8 C;  1K6S A;  4R8P D;  4IJF A;  1P3P D;  1YLY A;  1ES3 A;  3C1C A;  2DF4 C;  3AZF A;  3NCK A;  3SS3 A;  4P85 A;  3G4P A;  4BEN A;  5FAP A;  5F83 A;  5GXQ B;  2ZC5 B;  3W96 B;  1NXY A;  1L0G A;  5FAQ A;  1M6K A;  1BH8 A;  3HLD A;  1ID3 D;  4NZ4 A;  5TGF A;  3AZL B;  3MGS B;  2WKE A;  3BFC A;  3NBL A;  5TFQ A;  4S2J A;  1K56 A;  3L27 A;  4H9S C;  2FFY A;  5CPK C;  4OJP A;  3WKJ C;  3FKE A;  1BTL A;  4FD8 A;  1CK3 A;  3E2K A;  2YFW A;  1EWZ A;  4GZB A;  4IVI A;  4H9R A;  4EBL A;  2G2W A;  2F8N K;  3BRM A;  3AL0 C;  5AV5 B;  2PU2 A;  1KU5 A;  2JSS A;  2Y2K A;  3REI B;  3IT9 A;  4OQG A;  1WYC A;  3ZVT A;  2RIQ A;  5CED A;  3X1S A;  4DRT A;  1GHP A;  2CV5 C;  2DQN C;  3M6H A;  3W97 A;  4E45 A;  2Z2L B;  1M1A B;  5FI7 A;  1P3B B;  4UHU A;  3TOI A;  1YT4 A;  5KMW A;  3IHA A;  5B40 A;  2XR0 A;  5BOH A;  3AZK A;  3TU4 A;  3UTB C;  1AOI B;  3UNW A;  2G5I C;  3MZE A;  3REK C;  4HGA C;  3AZI B;  3VP2 A;  5CPK D;  2ZJ9 A;  5B1M A;  4XZQ A;  4OJ6 A;  4H9N A;  4OON A;  1ONH A;  2ZY4 A;  4WEJ A;  5AVB C;  4UA7 A;  5IHV A;  4J8V B;  1L0D A;  3AN2 C;  2WZZ A;  5KZH A;  4DRA A;  1ES4 A;  3HLG A;  3KWQ B;  3PTE A;  2CV5 D;  3LJA A;  5CPJ A;  5B31 A;  3CG5 A;  5BS7 A;  4WU9 C;  3NDG A;  5CRF A;  2NQB C;  4NE6 A;  1IEL A;  1P3I A;  2J8P A;  3A6N A;  1P3F A;  5AV8 A;  2PU4 A;  3UTB D;  3HBR A;  5FAS A;  1G68 A;  4GD8 A;  5KSH A;  3REK D;  1K4E A;  3GV9 A;  4PMA A;  3AZJ C;  2OLV A;  3B6G C;  3ZFZ A;  2XF3 A;  5CTN A;  4E44 A;  3PBT A;  4ZUX C;  4OKP A;  1PWG A;  5DF8 A;  1K25 A;  4JXW A;  3H0L C;  5GSU A;  4WU9 D;  3ZG5 A;  2NQB D;  2HUE C;  3FZC A;  4OOY A;  4KEN B;  5FQ9 A;  3V50 A;  2IWB A;  4WNN A;  1PZP A;  3X1S D;  4QLC B;  3C1C B;  3KUY C;  3AZJ D;  1GA0 A;  4IBG A;  3AZF B;  3AGF A;  5AQB A;  1PW1 A;  2ZM2 A;  3AZN A;  5HAP A;  3AZG C;  3W4Q A;  2H10 A;  2XFT A;  5JYO A;  2ZM0 A;  1BH8 B;  4KGC C;  3RXW A;  2P74 A;  1FQG A;  3AZK D;  3A1I A;  3LEL A;  3OPH A;  3UPP A;  4JF6 A;  2EFU A;  2RL3 A;  5B33 B;  4GD6 A;  4L0L A;  4P0M A;  5FA7 A;  4LD9 A;  3B3X A;  2HIO B;  5B1M D;  1ZLA B;  3VH6 T;  3SH8 A;  4KZ5 A;  4OJL A;  3HLF A;  5B32 A;  5DF9 A;  1Q9C A;  3Q07 A;  5AVC A;  2IWC A;  4DE3 A;  3IQA A;  1M18 C;  5I94 A;  4GB7 A;  1P34 C;  1FR6 A;  3VMA A;  5E43 A;  1P3O A;  5U47 A;  4M3K A;  2J7V A;  3HUN A;  4KG2 A;  1HQ3 A;  4PM7 A;  5B31 D;  2HP9 A;  3LCE A;  3REL A;  4R4R A;  1IKI A;  1XX2 A;  4NE3 A;  4N1X A;  4KGC D;  3W97 B;  3MGR A;  1YUE A;  3AZM A;  1Q2Q A;  4H9Q B;  5C3I C;  1K4F A;  3UO9 A;  5B40 B;  1OME A;  4C3Q A;  3TU4 B;  3KFU G;  2XGN A;  3VSK A;  4JJN A;  1GHM A;  2ARO C;  4XZQ B;  4Z5T C;  3A3E A;  4DKI A;  1M18 D;  3HVF A;  4K0X A;  1ERO A;  3ISG A;  1P34 D;  3G32 A;  3TG9 A;  2BG1 A;  5HAQ A;  4OUI A;  2ZY5 A;  3LZ1 C;  3LJA B;  2JBF A;  4U0X A;  5FQJ A;  1PI4 A;  3WS4 A;  5M19 A;  1KX3 B;  3AV1 B;  4XUJ A;  1P3I B;  3A3D A;  2B5R A;  2HPB A;  1P3F B;  1WWI A;  3QHY A;  4RX2 A;  4UA9 A;  3SH7 A;  3C7U A;  3PAE A;  3BEC A;  4Z5T D;  4D2O A;  3BFG A;  1EQZ C;  3NQJ A;  5F82 A;  3UTA A;  2HDS A;  3N8S A;  4N92 A;  4KG6 A;  4KUD B;  1KX5 C;  1P3L A;  3LZ0 C;  1ZG4 A;  2VGK A;  2ZC3 B;  3OZH A;  3HSH A;  2ZY3 A;  3MZD A;  4S2O A;  1SHV A;  5AVC D;  1ZKJ A;  3LZ1 D;  4WJ3 C;  2X71 A;  1P3K A;  4E3N A;  1WWS A;  5GT3 A;  5CP6 A;  3MGQ B;  4J8X C;  3WA9 B;  4DXC A;  1BT5 A;  5CHL B;  3X1V A;  3VP3 A;  3AFA A;  3M6B A;  1AXB A;  3LEZ A;  3AZN B;  2PYO B;  4H8R A;  1DJA A;  5FSR A;  3X1U A;  1KX5 D;  3ZCZ A;  3LEL B;  1KE4 A;  4BQM A;  3O62 A;  4ZJ3 A;  5AQ9 A;  2WAD A;  1CI8 A;  4LD9 B;  4OJO A;  2BYK A;  3IF6 A;  4GHA A;  4LG2 A;  5CHJ A;  1SCW A;  4BL2 A;  3IHB A;  1ES2 A;  3V39 A;  3G2Z A;  4JBF A;  4KZB A;  5HAR A;  5B32 B;  3N8L A;  2RCX A;  2WZX A;  4C75 A;  4R1G A;  2UWX A;  4WZS B;  5FQQ A;  4KQO A;  5AV9 C;  5CEC A;  5GT0 C;  3CMZ A;  2R9W A;  1HQ3 B;  3RXX A;  3N3F A;  2WGI A;  2Y2J A;  4QNL A;  4XUJ D;  3REL B;  3A3J A;  3W98 A;  1JFI A;  3MGR B;  1TVF A;  5DNM B;  3AZM B;  2E8I A;  3KSY A;  4NET A;  5EVI B;  3E2L A;  4RVA A;  5GLA A;  4JJN B;  4NZ3 A;  1FR1 A;  3P09 A;  4DE1 A;  5E5A B;  3WAA C;  3MGP A;  1TAF B;  1SDN A;  2HDU A;  4E3L A;  3ZG7 B;  2HDQ A;  3G30 A;  5FQI A;  4EO5 C;  1P3L D;  1KX4 A;  3BEB A;  4LV1 A;  1P3G B;  3B6F A;  5AV9 D;  5GLB A;  4QY6 A;  5GT0 D;  3NIA A;  1GA9 A;  4GDB A;  4IBJ A;  5G18 A;  5JYP A;  3UT9 A;  1RP5 A;  1Q2P A;  4FCF A;  5B2I C;  1PYY A;  3V5M A;  1YU1 A;  2F8N G;  3S4X A;  5GT3 D;  1N4O A;  5CP6 D;  3NC8 A;  3GR2 A;  3VFH A;  1M19 A;  4WEK A;  4X68 A;  3R45 B;  3AGE A;  5JRG C;  4R8P A;  5DNN B;  1P3P A;  1ONG A;  4X56 A;  5AV6 A;  5BNX B;  5JA4 A;  1HD8 A;  4EWF A;  2WGW A;  1EI5 A;  3X1U D;  4H9P A;  3NQJ B;  4X23 A;  1N9B A;  5F99 A;  3UTA B;  3REJ C;  1S32 B;  1KDS A;  5AY8 C;  5E2G A;  1ID3 A;  1BUL A;  1MWR A;  5B2J C;  3S22 A;  1YLJ A;  4NE5 A;  1HZO A;  1MKI A;  5B2I D;  1XP4 A;  1NZO A;  3AZE D;  1DY6 A;  4CSR B;  3H0R C;  1P3K B;  4IED A;  5BT1 C;  4WU8 A;  3F6T A;  4OPZ A;  2ZC4 B;  3W99 C;  3MKF A;  2ZMA A;  5GXQ C;  4XXR A;  5HL1 A;  3X1V B;  3AFA B;  3WRZ A;  3GTC A;  1YU0 A;  2Y2L A;  3AZL C;  3REJ D;  1ESU A;  2I72 A;  5AY8 D;  3P98 A;  1YM1 A;  1W7F A;  1HVB A;  3O62 B;  4ZJ1 A;  1O07 A;  1B6W A;  4H9S A;  1RGZ A;  4K91 A;  5CPK A;  1ZC2 A;  3WKJ A;  1LL5 A;  3B6F D;  5AV5 C;  2ZQD A;  4KZ8 A;  2Y2N A;  3IXG A;  3REI C;  1H8Y A;  1GCE A;  2WAF A;  1MPL A;  3GMW A;  3W99 D;  5B0Y C;  1F1E A;  1WE4 A;  1M1A C;  1P3B C;  3REH C;  2XK1 A;  1BLP A;  1T3U A;  2CV5 A;  4G91 B;  3C1B B;  1M19 D;  3ZG9 B;  2ZQC A;  1IYS A;  1R4V A;  3LO7 A;  3W98 B;  1JFI B;  3H0M C;  2WUQ A;  1KVL A;  1FCO A;  2QZ6 A;  5KDM A;  3B0D C;  4J8U C;  3Q81 A;  3AZI C;  5AV6 D;  2WK0 A;  3UTB A;  5B1L D;  1L2S A;  3REK A;  4X23 D;  5F99 D;  4J8V C;  5DF7 A;  1K55 C;  1P3M B;  3MGP B;  1KX4 B;  4WBG A;  5B0Z C;  5G49 B;  3AN2 A;  2XEP A;  5CPI B;  5B0Y D;  4KZ7 A;  4OPY A;  3AZH C;  1W8Q A;  1P3B D;  4UA6 A;  3UT9 B;  3REH D;  1FOF A;  5M1A A;  4B4Z A;  1YMX A;  4WU8 D;  4MBK A;  4WU9 A;  2NQB A;  1KDW A;  3EPJ A;  4YS3 C;  3HRE A;  4J8U D;  4OJ5 A;  2FJ7 B;  5BNV A;  3AYW B;  3DWZ A;  4DDS A;  1BH9 B;  4R8P B;  2ZC7 A;  1P3P B;  3SS5 A;  3FDD A;  1F66 C;  1RGY A;  4E3J A;  3AZJ A;  5JA4 B;  5CGS A;  2WGW B;  4H9P B;  3Q7V A;  3VSL A;  3UDI A;  5B0Z D;  3B6G A;  1ID3 B;  2EX8 A;  4K0W A;  1Z6F A;  2Y4A A;  3AZH D;  4ZUX A;  4KHA B;  4JXS A;  3WKJ D;  3G2Y A;  1BSG A;  3VH5 W;  4NYU A;  1ERQ A;  1JTD A;  4YS3 D;  4RA7 A;  1IEM A;  3GVB A;  4WZ4 A;  4QLC C;  3WX7 A;  5HW3 A;  3WWX A;  3BFE A;  4OQH A;  1I5Q A;  1F66 D;  4YM6 C;  3KUY A;  2Y2G A;  5DTT A;  3S1Y A;  3WTP B;  3AZG A;  3I7J A;  5B33 C;  3W4P A;  4KGC A;  2HIO C;  1ZLA C;  3MXR A;  3B0C W;  1M40 A;  3DTM A;  3EPL A;  5FQK A;  4E3O A;  5CPK B;  5AVB D;  3MKE A;  2RVQ C;  3AN2 D;  1M18 A;  4ZBJ B;  1J9M A;  2PBY A;  4GKU A;  4LEN A;  3PAG A;  1P34 A;  1LHY A;  1XA7 A;  4YM6 D;  3L28 A;  3ZVW A;  2F8N H;  4G92 B;  3AV2 B;  4S2N C;  2HIO D;  5CGW A;  1H5X A;  2CWE A;  2XH9 A;  5KDM B;  3EQV A;  3A3I A;  3UTB B;  3HLE A;  5FI6 A;  5CEB A;  4HGA B;  1E3U D;  4Y7P A;  4P6B A;  3B6G D;  4Z5T A;  2RVQ D;  5AQA A;  1A7W A;  3LY3 A;  2JCH A;  5A92 A;  3WS0 A;  4ZUX D;  4OPR A;  1S0W A;  3BYD A;  5AQ7 A;  1KX3 C;  1KGE A;  3G35 A;  3AV1 C;  4UUZ A;  2DCF A;  3LZ1 A;  4BD0 A;  2YFW B;  1P3A C;  1YU4 A;  3O86 A;  2BYM A;  4WU9 B;  4H9R B;  2NQB B;  3NQU A;  4KZ3 A;  3KUY D;  4P87 A;  4KZ4 A;  1MY8 A;  3AZG D;  3X1S B;  3AZJ B;  3Q82 A;  4KUD C;  4S2P A;  1BZA A;  2Q9M A;  4UAA A;  1KGG A;  1YU3 A;  2IO5 C;  3GRJ A;  2G5H C;  3AZK B;  1KX5 A;  3LZ0 A;  5M18 A;  4NYY A;  1NY0 A;  5BO0 A;  5B1M B;  3MGQ C;  4BL3 A;  4H9N B;  2ZM8 A;  1G6A A;  1P3A D;  3WA9 C;  1NYM A;  2HUE B;  2H5S A;  3WTP E;  1VQQ A;  3C4P A;  4J8X A;  2H0Y A;  1BUE A;  3VP1 A;  2PYO C;  4EBN A;  2R9X A;  5CPJ B;  1TDG A;  5B31 B;  4IBI A;  2FFF B;  1MXO A;  1YQS A;  4KGC B;  3PBQ A;  3MVD C;  3A6N B;  5AV8 B;  3UN7 A;  4S2L A;  4PPR A;  1N1J A;  2ARO D;  1K54 C;  4X53 A;  4S2M A;  1JWV A;  1W8Y A;  4EQI A;  4MLL A;  4IBE A;  4PM6 A;  2ZQ7 A;  4Z2M G;  2DNS A;  1M18 B;  5DTK A;  3UY6 A;  1P34 B;  5EPH A;  5AV9 A;  5GT0 A;  4MBH A;  3UE1 A;  2F8N D;  4KG5 A;  4ZDX A;  5HX9 A;  5FUG A;  5DNM C;  5GSU B;  4E3I A;  3C7V A;  3MVD D;  5EVI C;  4WNN B;  4CJN A;  5C3I B;  4Y0U A;  5E5A C;  4OH0 A;  2WKH A;  1EQZ D;  3D4F A;  1P3G C;  1O7E A;  3WAA A;  4Z5T B;  4OQ0 A;  5EUA A;  3LZ0 D;  2HP6 A;  2ZD8 A;  4OP8 A;  4QB8 A;  4E3M A;  5EOO A;  4NK3 A;  5DNM D;  5B2I A;  4C6Y A;  3KXB C;  5AVC B;  4UUZ B;  3AZE A;  4ZAM A;  3LZ1 B;  5DNN C;  4J8X D;  1U35 C;  2OLU A;  3BFF A;  1P3O B;  2WYX A;  5FDH A;  3VOZ A;  5B24 C;  3NQU B;  5E5A D;  5JRG A;  4ID4 A;  4R3J A;  3V3R A;  3VP4 A;  1B67 A;  4MBF A;  5A90 A;  2XQZ A;  3UDF A;  4XUX A;  1S32 C;  4WZ5 C;  1LI9 A;  3KS8 A;  4Z66 C;  4FH4 A;  4N1H A;  4BD1 A;  3OPP A;  4FH2 A;  4JF4 A;  4WEL A;  3REJ A;  5AY8 A;  3HL9 A;  1KX5 B;  5DVA A;  5B2J A;  4IBF A;  2L5A A;  1P3K C;  4AWL C;  3QNC A;  1JTG A;  2H0T A;  1LL9 A;  5BO0 B;  1CI9 A;  2ZM5 A;  3KXB D;  2Y2I A;  1Y54 A;  3M2K A;  1U35 D;  4EBP A;  1JVJ A;  5B24 D;  3IXB A;  1FCN A;  1JWP A;  4B4X A;  3IWO A;  3N8R A;  3MNN C;  3X1T C;  3W99 A;  1MWS A;  2NZD C;  5GXQ A;  3ZG8 B;  4M6B A;  4Z66 D;  5GL9 A;  4GHL A;  2BLS A;  3AZL A;  4XUJ B;  3O62 C;  1DJB A;  4DF6 A;  1LI0 A;  1TZY C;  3V9R A;  3EQU A;  3ITA A;  4GNU A;  4IBR A;  5B32 G;  3WAA D;  4U3T A;  5B1L A;  2XLN A;  3O3V A;  3VOY A;  1BLS A;  5CXW A;  3WS2 A;  5AV5 A;  2Y2Q A;  2V2F F;  3FYZ A;  1P3L B;  4QU3 A;  4NFT A;  3MNN D;  4J8W C;  3X1T D;  1K57 C;  5AV9 B;  5B0Y A;  2NZD D;  4G91 C;  5GT0 B;  3C1B C;  4DE2 A;  1M1A A;  3BFD A;  4JXG A;  1P3B A;  4NY2 A;  5FUG B;  3REH A;  4PM9 A;  3ZGA B;  4E6W A;  3VH6 W;  1CEG A;  4IBK A;  5GT3 B;  5CP6 B;  1TZY D;  3B0B A;  2OSU A;  3A3F A;  3FKW A;  5JRG D;  5D3O A;  1FSW A;  3EG5 B;  2C5W B;  3IH8 A;  4J8U A;  3W96 C;  1HTZ A;  1P3M C;  3ZG0 A;  3ZNT A;  3L2A A;  1Z2C B;  5EE8 A;  2WGV A;  1JWZ A;  1ZG6 A;  4J8V A;  1K55 A;  3MGS C;  3OC2 A;  5CPI C;  3X1U B;  2ZQA A;  2JE5 A;  4EO5 B;  5B2J D;  1KVM A;  5B0Z A;  4J8W D;  4WM9 A;  3ITB A;  2BYK B;  3IF6 B;  3RJU A;  3GSG A;  3AZH A;  2EX6 A;  4PM5 A;  5B2I B;  5BT1 D;  3AZE B;  2FJ7 C;  3AYW C;  1IYQ A;  4YS3 A;  4U0T A;  5GXQ D;  3W96 D;  1KE3 A;  4EUZ A;  1F66 A;  3AZL D;  4R23 A;  4X69 A;  3MGS D;  4GN2 A;  1ERM A;  4Q8I A;  1AOI C;  2OV5 A;  3REJ B;  3IXD A;  5GLC A;  2LY8 A;  5F1F A;  4KZ9 A;  5AV5 D;  5CHU A;  3IWI A;  4Z2M H;  3AYW D;  3REI D;  5AVB A;  3ZNY A;  3N7W A;  1FSY A;  4LCM A;  3B6F B;  4E6X A;  3KWQ C;  5EVL A;  4QLC A;  3WTP C;  1W79 A;  4YFM A;  1M1A D;  3W99 B;  3IWQ A;  4YM6 A;  4HES A;  4OP5 A;  2F2A C;  1U60 A;  3G31 A;  3UDX A;  3UPO A;  1AOI D;  1NZU A;  3BLS A;  2Y2H A;  5B33 A;  4Z9Q A;  1M19 B;  3P5J B;  3AZI D;  1TEM A;  5HAI A;  5E2H A;  2HIO A;  3V9R B;  1ZLA A;  3HLC A;  3ZHH A;  3CZD A;  3BLM A;  5AV6 B;  2XD1 A;  4J8V D;  4UPK A;  4QY5 A;  5B1L B;  4ZBJ C;  4IBC A;  3UE3 A;  3HON A;  4JXV A;  1E3U A;  4X23 B;  3DWK A;  5F99 B;  4WMC D;  4WV4 B;  3KWQ D;  3Q1F A;  1BLC A;  2EFX A;  1NRF A;  3OPR A;  3WTP D;  4NZ1 A;  1MWU A;  5B0Y B;  4G92 C;  4LV0 A;  3AV2 C;  1QMF A;  3IF5 A;  4OVD A;  3PBR A;  2G2U A;  3REH B;  2C6W B;  4LV2 A;  4H9Q A;  1K38 A;  1YLP A;  1YU2 A;  4S2N A;  4WYY A;  4WU8 B;  3C1C C;  3WS5 A;  3AZF C;  1PWD A;  1RCJ A;  1I2W A;  3B0D B;  4J8U B;  4JKT A;  1NYY A;  3AGD A;  4LCL A;  1GHI A;  3UE0 A;  4DDY A;  4CAY A;  4Y0T A;  2J8Y A;  3VP0 A;  2V1Z A;  1YMS A;  3VH5 A;  5B0Z B;  3AV2 D;  3AZH B;  2P9V A;  1KX3 A;  1HTA A;  1PW8 A;  3AV1 A;  1C3B A;  3W4O A;  3WKJ B;  1P3A A;  4QLC D;  3C1C D;  2ZC6 B;  3AZF D;  4YS3 B;  5CGX A;  2WKI A;  3X1S C;  2J9P A;  5A91 A;  1DJC A;  1SKF A;  2JC7 A;  3W97 C;  4E3K A;  2X02 A;  3MZF A;  1F66 B;  5B33 D;  2CV5 B;  4KUD A;  3BM6 A;  5B40 C;  3AZK C;  3TU4 C;  3W8K A;  2J9O A;  3HUO A;  2ZQ9 A;  1ZLA D;  1K56 D;  4IVK A;  5B1M C;  4XZQ C;  3Q7Z A;  5FAO A;  3REK B;  3EPH A;  2ARO A;  1FCM A;  3MGQ A;  2Y2M A;  3WA9 A;  3L25 A;  4S2K A;  5AVB B;  5FAT A;  5GHX A;  4YIN A;  3AN2 B;  4HEF A;  3LJA C;  5CPJ C;  2DRW A;  5L2F A;  3W97 D;  5B31 C;  5BS7 C;  5EEC A;  2PYO A;  5TR7 A;  3JYI A;  4YM6 B;  1P3I C;  2F8N A;  3NY4 A;  5DTS A;  3A6N C;  5B40 D;  1P3F C;  5AV8 C;  3UPN A;  3TU4 D;  1PIO A;  1KE0 A;  3MVD A;  5BNV B;  4XZQ D;  5BPV A;  2Y2P A;  3C4O A;  3DW0 A;  3ZDJ A;  1K54 A;  4R0Q A;  1ES5 A;  3IH9 A;  2Y91 A;  1EQZ A;  5GLD A;  3Q7V B;  2VQR A;  3B6G B;  1H3O A;  1CEF A;  3LJA D;  5CPJ D;  2Y55 A;  4ZUX B;  1KX3 D;  5GSU C;  3AV1 D;  1LLB A;  2EX2 A;  1P3I D;  2EXA A;  3A6N D;  1P3F D;  2WAE A;  5AV8 D;  5DNM A;  4JPM A;  2A3U A;  2EX9 A;  4ZJ2 A;  5EVI A;  4IBD A;  4OOL A;  3AZN C;  5E5A A;  2QMI A;  3N6I A;  1TAF A;  3KUY B;  1KGF A;  4O7D A;  4OLD A;  4KUD D;  3N4I A;  3O87 A;  2V20 A;  1MBL A;  3LEL C;  3AZG B;  1P3G A;  2Y2O A;  3A1K A;  4CAY B;  4LD9 C;  4OLG A;  4OQI A;  1PZR A;  2IWD A;  5B32 C;  5GSU D;  5AVC C;  2CC1 A;  4GDN A;  4QD4 A;  3MGQ D;  2P9V B;  4MNR A;  2GDN A;  5CHM A;  3WA9 D;  1P3O C;  3KXB A;  3R45 A;  4RYE A;  1HQ3 C;  1P3A B;  5DNN A;  1U35 A;  3AZN D;  3M2J A;  2PYO D;  5B24 A;  1PI5 A;  3REL C;  5BNX A;  4HBU A;  3MGR C;  4BLM A;  3LEL D;  3AZM C;  1NJ4 A;  1S32 A;  2YFV A;  3PBO A;  4WZ5 A;  2X01 A;  4Z66 A;  4LD9 D;  1K6R A;  4JJN C;  2IO5 B;  5B32 D;  1W5D A;  3V3S A;  4CSR A;  3WS1 A;  1H8Z A;  4OPQ A;  3SH9 A;  2ARO B;  1P3O D;  5CTM A;  4B88 A;  2Z2M B;  5GHZ A;  1HQ3 D;  1ESI A;  1IYP A;  4GH9 A;  1BFM A;  4X6T A;  4NZ5 A;  3REL D;  3OPL A;  4JF5 A;  2ZY2 A;  3MNN A;  3X1T A;  3PBN A;  5B31 G;  4LV3 A;  5KSC A;  3MGR D;  5E2F A;  4XUJ C;  3AZM D;  2NZD A;  5J8X A;  4IBB A;  4N9L A;  2F8N B;  3HUM A;  5EVI D;  1BLH A;  2BYM B;  3CJM A;  3FWL A;  3SOI A;  5FQM A;  4JJN D;  4R3B A;  1TZY A;  3VH5 T;  3MVD B;  3NDE A;  1XGI A;  1XPB A;  3HLB A;  3UTA C;  1P3G D;  2IOU A;  4H9O A;  1WYB A;  4KQQ A;  1P3L C;  1EQZ B;  1PZO A;  2EXB A;  3OCN A;  1H3O B;  3G34 A;  3LZ0 B;  1E4D A;  4J8W A;  1K57 A;  3C1B A;  3B0C T;  5GT3 C;  5CP6 C;  2A49 A;  3VFF A;  2W8S A;  3PBS A;  4HBT A;  4EV4 A;  5A93 A;  4BJP A;  1W2E A;  5DNN D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...