2Y2KA

Penicillin-binding protein 1b (pbp-1b) in complex with an alkyl boronate (za5)
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
488
structure length
469
Chain Sequence
SEITYSDGTVIASIRDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTGQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PENICILLIN-BINDING PROTEIN 1B
publication title Structure-Guided Design of Cell Wall Biosynthesis Inhibitors that Overcome Beta-Lactam Resistance in Staphylococcus Aureus (Mrsa).
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 163
structure length 469
sequence length 488
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2y2kA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2y2kA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2y2kA02
5GHZA 1SDNA 2FFFB 4KQOA 3PBRA 4BL2A 3IXBA 1SCWA 3M6HA 3DTMA 5CHJA 3IH9A 4P0MA 1TEMA 3E2KA 2ZM2A 4ZJ2A 1W8YA 3V3SA 4S2NC 4OH0A 5A92A 1MWRA 4BD1A 2Y2LA 1YLPA 2J9OA 2ZM0A 4UA9A 5CHMA 1ERQA 1BLSA 1Q2PA 2WGWB 5FQ9A 3HUNA 5GL9A 1FCNA 3BFEA 4R23A 1N9BA 1K25A 4JXGA 4OPZA 3JYIA 4WBGA 5GLAA 4EQIA 5CEBA 3WS4A 1RGYA 2XD5A 1S0WA 3IXGA 2R9WA 4IEDA 2Y2HA 5FDHA 3NCKA 1KVLA 3HREA 3C7UA 1H8YA 2ZQ7A 3CJMA 4LCLA 5EVID 5FAOA 4ZJ3A 4GDNA 1EWZA 3HLWA 1I2WA 1GA0A 3G2YA 1K57C 1YT4A 2XFSA 3ZDJA 1ES2A 4RX3A 1XA7A 1MPLA 1O07A 4Z9QA 2FFYA 4OQ0A 4Y7PA 3EQUA 1BLCA 1PWCA 3ZCZA 4R3JA 4OP8A 4X69A 4WZ5C 4FD8A 5M1AA 3Q1FA 4S2IA 1MWUA 3GSGA 2WKEA 2XFTA 2HDUA 2Z2LB 5KSCA 4E3KA 4EV4A 4M3KA 1K38A 3UDFA 1XX2A 1OMEA 4C6YA 4KZBA 5EVLA 1G68A 2ZC6B 3I7JA 1FQGA 5HL1A 3D4FA 3IHAA 5FASA 3HL9A 1ZG4A 3VOYA 3AGFA 2Y2MA 3OPHA 3M2JA 1NZUA 4UAAA 1TDLA 4KZAA 2XK1A 2WAEA 5CECA 3SOIA 4XUXA 5EPHA 5E2EA 4DE1A 2ZJ9A 5CGXA 4UHUA 3WS5A 3VP4A 1ZKJA 4OLGA 3IH8A 3DW0A 4Q8IA 1PZPA 1PWGA 3G4PA 3MBZA 5HW3A 3NC8A 3P98A 4MLLA 3Q7ZA 1K56D 5D3OA 1DJAA 1KGEA 3G32A 3IF6A 2WZZA 3MFDA 2WAFA 3P09A 5CGWA 1G6AA 3OCNA 1BLHA 2QPNA 5EVIA 2ZQDA 2H5SA 4OOMA 4BLMA 2XR0A 3Q07A 4OPQA 5KSHA 5GLDA 5FSRA 5CTMA 3FZCA 4XXRA 3SS4A 5FQJA 3V3RA 3G35A 2V20A 4OVDA 3MKEA 5IHVA 2X71A 1LL9A 2E8IA 5F1FA 2BLSA 4PM5A 2HP9A 3MZEA 5HAQA 5F83A 3N6IA 4KZ8A 4JBFA 3HUMA 4WMCD 5EECA 1SHVA 5HARA 4UA7A 3N8LA 1E25A 4EUZA 4OONA 2H10A 3HLBA 2JCHA 1XPBA 1GHPA 4NK3A 1VM1A 1M6KA 4MBKA 4JF5A 2HDQA 1BLPA 1ONGA 3A3DA 3GRJA 5CXWA 3UPNA 4GOGA 3Q7VB 1NRFA 4OP5A 4KENB 1KGFA 1W79A 2Y2QA 2J9PA 3IWOA 4PM7A 2R9XA 1BULA 1WYBA 1VQQA 3CZDA 3G34A 4BJPA 4E3NA 1DJBA 3FWLA 3IXHA 5M18A 3MZFA 1M40A 4YFMA 3SS3A 4B88A 4OOLA 2WKIA 1CEGA 4HBUA 5HFOA 3VP1A 2EX6A 2ZQ9A 3Q81A 1HTZA 2ZD8A 1WYCA 2Y2IA 3IF6B 3QNCA 2Z2MB 3IT9A 4P85A 4EBLA 5A90A 3A3JA 4JXSA 5CRFA 2PBYA 3IXDA 4R4RA 1PI5A 4S2KA 5EVIB 5EE8A 1MY8A 2J7VA 4QHCA 3WS1A 3M2KA 3PBNA 3O88A 3C5AA 4N1XA 4E3IA 1W8QA 2IWCA 1JWZA 1PZOA 1ZC2A 2ZM8A 5DTSA 2OLVA 1QMFA 4WYYA 3A3FA 2A49A 1NYYA 2Y59A 4N92A 1YLZA 3N8RA 4GDBA 4O7DA 2WK0A 3IF6C 3O86A 4Y0UA 1GCEA 5EVIC 1XKZA 3WWXA 5F82A 3VP3A 1GHIA 5L2FA 4YINA 1KDWA 2ZQ8A 4K0WA 2HP5A 4LV3A 4HESA 3HLGA 2PU2A 1LHYA 2Y2PA 1BUEA 3LY4A 3OC2A 3W4OA 4F94A 3OCLA 3DWKA 1QMEA 3OPLA 3PAGA 5U47A 3O87A 4L0LA 5AQBA 1ES5A 1S6RA 3C4PA 1K4EA 3RXXA 2Q9MA 3HLDA 1NXYA 4GZBA 5HX9A 4C3QA 4ZDXA 2XQZA 1U60A 2GDNA 3A3IA 1XA1A 4KZ9A 4WEJA 3PBOA 1ES4A 2A3UA 4QJGA 1YM1A 1TDGA 1LLBA 1LI0A 4GD6A 4RX2A 3S1YA 4KG5A 5F1GA 4S2MA 4R0QA 2EXAA 3UY6A 1PI4A 4D2OA 4QY5A 4MBFA 4QY6A 4FH4A 1KE0A 3AGEA 5FQIA 4DF6A 2EX9A 2EFUA 5JYOA 1YLJA 3IWIA 3ZVTA 2VGJA 2XH9A 3OPRA 4FCFA 2XGNA 3PAEA 1ESIA 1BTLA 5BOHA 1NYMA 5GHYA 1PW1A 3G30A 4IBRA 3LO7A 1IYPA 1YLWA 2JC7A 1XGJA 1J9MA 2ZLYA 3S4XA 4LCMA 2ZC3B 1ERMA 3B3XA 1YMXA 1FR6A 2BG1A 1NJ4A 4P6BA 4DDSA 1N4OA 1K6SA 3Q7VA 2EX8A 5DF8A 3S22A 1CEFA 1HD8A 1I2SA 2EXBA 3UDIA 1IYQA 4B4ZA 2CC1A 2RL3A 4HEFA 4ID4A 3PBSA 4S2JA 4S2OA 2P9VB 1L0FA 5GLCA 3OPPA 3UE1A 1XXMA 1H5XA 3BFDA 3NY4A 2XF3A 2Y55A 3O3VA 5A91A 3G2ZA 1GHMA 3FKWA 3BFGA 2C6WB 1K54A 5EOOA 4Y0TA 5DTKA 1H8ZA 5JYPA 5CGSA 1HVBA 3CMZA 4WELA 3CG5A 5FAQA 4KG6A 3ZFZA 4BENA 4JF6A 1YQSA 1PYYA 3M6BA 4DE0A 1SDEA 1RGZA 1JTDA 2WYXA 1IKGA 3IWQA 3IQAA 3VP0A 4UA6A 4KZ7A 4BD0A 5A93A 3WS2A 1JWVA 1XP4A 2JE5A 2X01A 4WZ4A 3GVBA 3OZHA 1MXOA 2I72A 4EBNA 2V1ZA 2IWDA 3ITAA 4JXWA 2IWBA 3ZG0A 4OOYA 4BL3A 4DE3A 3NDGA 3UPOA 1MWTA 3HLEA 1W5DA 2QZ6A 4S2NA 4N9KA 3LEZA 4GD8A 1RCJA 3AGDA 2Y2OA 1I5QA 1K6RA 3UO9A 4R1GA 4P87A 3VMAA 4KZ3A 1E4DA 4MEZA 4JXVA 1BT5A 4GN2A 5E2GA 1BZAA 4ZTKA 1YLTA 4BQMA 4KQRA 4RVAA 4NETA 3FV7A 4DKIA 3UPPA 3DWZA 4RYEA 4MNRA 4CJNA 4N1HA 1IYOA 3LY3A 2Y2NA 4H8RA 3BECA 1K55A 3HUOA 1MWSA 3VSKA 4X55A 3QHYA 1CI8A 1KE4A 3E2LA 3PTEA 1ONHA 4WZ5A 1K56A 3MZDA 2UWXA 1PWDA 3ZG8B 3BEBA 1MBLA 4JKTA 4LV0A 3NI9A 5E2FA 5CEDA 2QMIA 1KGGA 3PBTA 5FATA 1K54C 1NY0A 4E6XA 3SH9A 1LI9A 1JWPA 5HAPA 4X6TA 3C7VA 4HBTA 4X56A 4PPRA 3ISGA 1IELA 1DJCA 3UE0A 2C5WB 3UNWA 4KG2A 1IEMA 5TGFA 5FA7A 4DRTA 4X68A 4E3OA 4QU3A 2H0YA 4WMCA 2P9VA 1Z6FA 2DCFA 5AQAA 3GV9A 4K91A 4OQIA 3ZHHA 2ZQAA 3VFFA 3A3EA 4KZ6A 3ZG7B 2B5RA 4IVKA 4OQHA 2ZC7A 3TSGA 4E3MA 5TR7A 2WADA 2XEPA 3W8KA 5FQKA 5HAIA 5J8XA 1FCMA 4OPYA 4A5RA 3ZGAB 1YLYA 4DXBA 2H0TA 4U0XA 4K0XA 3VP2A 3GQZA 1FOFA 4EBPA 3IHBA 2EFXA 2WGIA 3LCEA 1CK3A 4PM6A 5EOEA 3BM6A 2Y2JA 4QB8A 2ZC5B 3VSLA 5AQ9A 3FYZA 1SKFA 4EWFA 3C4OA 1AXBA 1K55C 4XUZA 3UE3A 3TOIA 2J8YA 1BSGA 4DDYA 2DRWA 3GR2A 2XLNA 5G18A 3VFHA 3BRMA 4PM9A 1E3UD 1FCOA 2HPBA 3TG9A 1L0DA 3UDXA 5DTTA 3N4IA 3V39A 1NZOA 3WRTA 1DY6A 1FR1A 2Y91A 3GTCA 4FSFA 4S2PA 1LL5A 1L2SA 4DE2A 1XGIA 1PW8A 4R4SA 4JLFA 4LENA 4KQQA 1WE4A 1ZG6A 4Y0OA 1CI9A 5FI6A 3ZNTA 4FH2A 5FQMA 5EUAA 2ZQCA 4KZ5A 4U3TA 1TVFA 4U0TA 4WM9A 2V2FF 3FKVA 3G31A 3NBLA 2HDSA 2WZXA 2HDRA 3SS5A 3ZNYA 1GA9A 1KDSA 4E3LA 5E2HA 5KZHA 1MKIA 1C3BA 3MXSA 2HP6A 2WKHA 4LV1A 3W4PA 4OQGA 4C75A 3ZG5A 3UN7A 4N9LA 5TFQA 3HLFA 4RA7A 3IF5A 5I94A 1JVJA 2ZMAA 3EQVA 4ZBEA 3RJUA 1FSWA 2VGKA 2OSUA 1W7FA 5E43A 1K4FA 4B4XA 4IVIA 4S2LA 5DF7A 3Q82A 3BFFA 1EROA 2G2WA 3NDEA 4DXCA 2X02A 3ITBA 1KVMA 2OV5A 4GKUA 2EX2A 3ZVWA 1RP5A 5M19A 5FI7A 5CTNA 1O7EA 2OLUA 3BFCA 3HLCA 5CHUA 4CPKA 4GB7A 3NIAA 4PM8A 1IKIA 1L0EA 2RCXA 3PBQA 4GNUA 3SH7A 4E3JA 1Q2QA 3GMWA 4ZAMA 3QNBA 1E3UA 1PIOA 2WGVA 1IYSA 1K57A 5CERA 4ZJ1A 2WGWA 4JF4A 4MBHA 4WEKA 1ESUA 2ZC4B 2DNSA 4OPRA 3ZG9B 3HVFA 2Y4AA 2Q9NA 4QD4A 3MKFA 2Y2GA 3N7WA 1YMSA 3BLMA 4OLDA 3BYDA 1JTGA 1EI5A 3SH8A 1HZOA 2PU4A 3HBRA 5FAPA 5FQQA 3V5MA 5KMWA 1KE3A 3VOZA 2Y2KA 1FSYA 2WUQA 2P74A 2G2UA 3RXWA 3N8SA 4LV2A 5DVAA 3WRZA 2XD1A 5GLBA 3W4QA 2XDMA 1ES3A 4KZ4A 5DF9A 4E6WA 4X53A 4IBXA 4PMAA 2JBFA 3BLSA 1L0GA 1Y54A 5AQ7A 3MXRA 3V50A 4JPMA 1ALQA 5FI2A 5GHXA 3WS0A 4OKPA 4R3BA
chains in the Genus database with same CATH superfamily
1H0IA 3NJAA 3EOIA 2EA9A 1SCWA 3M6HA 4IBEA 3X1VD 3O62D 4ZJ2A 3KYQA 2H28A 3DAVA 4OH0A 5A92A 5F99B 3X1TD 1YLPA 4UA9A 2YFVB 1Q2PA 1P3FD 3HUNA 5AV9A 4R23A 2Y8HA 2L5AA 1BH9A 3WTPC 2ZY3A 4F3LA 3WS4A 3SW1A 3AZIA 4IEDA 5FDHA 1H8YA 3CJMA 5EVID 5B31G 2Q0OA 4ZJ3A 3AV1A 4GDNA 1EWZA 3H7WA 1P3OD 5DNNC 1KX4C 3AZFC 3G2YA 4R70A 1YT4A 2AROB 1MPLA 1O07A 3B6GB 1E6NA 2FFYA 2KOIA 2QWSA 2GX5A 5AV8D 4G91C 3A6NA 3GSGA 2HDUA 2OAQ1 3WS0A 1P3BA 3UTAD 1B6WA 3HSHA 3LR3A 3C2WA 1T1CA 3IHAA 3HL9A 4NXEA 5LBRA 2Y2MA 2VGLM 2FJ7D 1NZUA 2HJEA 1IOUA 4KZAA 3REIA 3SOIA 4NXFA 3C1CB 4DE1A 5CGXA 5TBMB 3WS5A 4HJ6A 1IFQA 4Q8IA 4WU8D 3VH5T 3B6FA 2K7SA 3NC8A 1VEUA 2F8NH 1HQ3D 3REKA 3MFDA 5CGWA 2WAFA 2QPNA 4DJ2A 3T50A 2XR0A 5FSRA 4HY8A 3SS4A 2PHYA 4ZRRA 1M1AC 4Q0HA 5DNMA 3N6IA 1G6OA 2HZ5A 3LZ1D 1SHVA 5HDCA 2YFVA 1E25A 1FIKA 5B0ZC 4Z1WA 3HLBA 3LELB 2JCHA 5E5AC 4J8WC 4WU9A 1BLPA 1ONGA 4J8XB 3A3DA 4HHDA 3Q7VB 1NRFA 4OP5A 1W79A 4PM7A 2R9XA 3G34A 2BTFP 5B2JB 3SZTA 4J8UA 3V9RB 3MZFA 3MMHA 1JFIB 3R7WA 4OOLA 3KUYC 3B6GA 5HFOA 3LJAA 3VP1A 3CUEC 2ZQ9A 4I3JA 5EV0A 4EESA 2ZD8A 4XZQB 2Z2MB 2LB9A 3IT9A 3KWQD 3AZNA 5A90A 5CRFA 2EWWA 4R4RA 1PI5A 4S2KA 4HIAA 3WX7A 4Z2HA 1MY8A 1BYWA 3VH6A 4QHCA 1F9IA 3C5AA 4N1XA 1U35A 2D01A 4E3IA 5CPID 1W8QA 1JWZA 2IO5C 4I3AA 5DTSA 4WYYA 3A3FA 4WNNB 1NYYA 4N92A 1OT6A 1F1EA 3IF6C 3MNND 4Y0UA 4M6BA 4G92B 3C1CA 3AZHB 5F82A 3AZMA 5F6AA 1M19C 5JA4B 3OC2A 3W4OA 5KIZA 2M1CA 2ZBBA 1QMEA 3DWKA 3P01A 1KX3A 1KX5A 3MGPD 2JHEA 5F68A 5JYOA 5B32D 3AZKA 4WEJA 1XA1A 4Y2FA 4X1LA 1BH8B 2A3UA 4RX2A 5A8BA 4KG5A 5B2IB 2EXAA 1OPXA 3UY6A 1M18C 4H9SA 2VLGA 1S1YA 4MBFA 1P3LB 4Z66D 4RQ9A 4DF6A 3AFAB 3IWIA 5CPJA 3ZVTA 3AL0C 2XGNA 4Z2JA 3TU4D 2HIOD 3WA9B 1PW1A 4EQ1A 3F1NA 4QLCC 4YS3D 4IBRA 1IYPA 5B40D 4YM6C 3LELA 3AYWA 2OAP1 1CXWA 3KS4A 4CQHA 3B3XA 1ERMA 1FR6A 4HJ3A 4DDSA 5GT3D 3Q7VA 5HWTA 1CEFA 5F99D 4XUJB 3U2AA 2CC1A 5B2JA 4ID4A 4LRXC 5GLCA 1H3QA 2NQBC 4IBJA 2D02A 4O01A 4Z5TB 4NE6A 5CGSA 1PZRA 5FAQA 5BS7A 1YQSA 3DBAA 1TD5A 1YU1A 3VE4A 2AROD 1UR9A 3IWQA 3UMEA 3C38A 3MFXA 3VP0A 4BD0A 2YFWA 5AVBB 1XP4A 1KU5A 4NKPA 5AVCC 3W96D 4KHAB 3REJD 2V1ZA 4JXWA 2IWBA 3UE6A 4OOYA 4DE3A 3AZEB 4IBCA 3UPOA 1MWTA 4Z2LA 3HLEA 4NE5A 1W5DA 4GD8A 1I5QA 3IP4C 3UO9A 4R1GA 1T19A 1E4DA 3FPWA 3W98D 4GN2A 3AZGA 1YLTA 4BQMA 4RVAA 4Y15A 3KXBD 4CLCE 3FV7A 4DKIA 3UPPA 4R8PD 3LR5A 4WN5A 3AV2B 1S4RA 4NFTA 3LY3A 4ETXA 5B2IA 3BECA 1K55A 4NZ4A 1JNUA 3HUOA 4Y17A 3X1SB 4X55A 2A2LA 5KDMB 1F2KA 1KE4A 3PR6A 3X1VC 3O62C 2PD8A 5HD3A 4LD9B 3TW8A 5GT0B 3MZDA 2UWXA 2NZDB 1L3LA 3WA9A 4R6LA 1P3MB 3WKJA 1P3FC 5GXQD 1GSWA 1X0OA 3NI9A 1OT9A 3LICA 3VH5W 5B0YD 3E4QA 2ZOIA 2VJWA 4JJNA 1STZA 3C7VA 4HBTA 5B24B 2PDRA 2W3FA 4X56A 1P3OC 3MGSA 5TGFA 2ZY4A 3LIDA 4E3OA 4QU3A 2H0YA 4WMCA 1Z6FA 3A0SA 4K91A 3B0CT 2KX6A 3VFFA 2W3EA 4Z5TA 1P3KB 3TSGA 2VV7A 5TR7A 5AY8A 5CPKA 2XEPA 4ESPA 2W1TA 1P3GB 3UTAC 5HAIA 1FCMA 3NQUB 2O99A 3C30A 3DTEA 4U0XA 4K0XA 2EFXA 2FJ7C 4KGCA 5B1MA 3TE8A 3V67A 2JN7A 3FYZA 5HPIA 4XUZA 4HI4A 5AV6C 4WU8C 5G18A 1P3PB 1D1JA 4IUKA 5E5AA 1E3UD 1E15A 3D3OA 3T1RA 1HQ3C 3AZHD 4IJGA 3V39A 2EWVA 1NZOA 3E4OA 4MN6A 3GTCA 3QP2A 4FSFA 4S2PA 3AV2A 1LL5A 3E98A 4NEED 4OJPA 1H8MA 1OTBA 3W99A 4NZ5A 4WLAA 1CI9A 1ZLAB 5FI6A 5KDMA 5EFWA 4KZ5A 4MMNA 3IS2B 1KS0A 1YKDA 4WM9A 4LD9A 2V2FF 4UQIM 3G31A 3LZ1C 2WZXA 1S32D 4ARZB 1GA9A 4E3LA 1MKIA 4LV1A 2LB5A 4HP9A 4C75A 1P3LD 3AFAD 1JVJA 3EQVA 4ZBEA 4FTXA 1FSWA 1TS6A 1P3AB 2VGKA 1W7FA 2RVQD 4B4XA 4S2LA 3BFFA 4B9OA 3DTKA 2QHKA 4E44A 3HLCA 4CPKA 4QNLA 1IKIA 3NULA 5L09A 1P3KA 4L9GA 3X1UA 3KWQC 2B02A 3T1QB 1P9RA 4E3JA 4ZAMA 2WGVA 1PIOA 3B0BA 1IYSA 3EEHA 1K57A 5CERA 1P3GA 4ZJ1A 4WEKA 1ESUA 5CPIC 3K3DA 4OPRA 3ZG9B 2F8NB 1JTGA 1VETA 3P7NA 1EI5A 3MNNC 5DFYA 2I9VA 5FQQA 1KE3A 3FDDA 2WUQA 4JGRA 1EAKA 5DVAA 3WRZA 2V8FA 5AVBD 1ES3A 4KZ4A 5JRGB 4E6WA 4IBXA 1P3PA 5AQ7A 3MGPC 5B32C 1YSQA 4H6JA 5AV5B 4GHIB 5CP6D 4NZ3A 5GHZA 5B1LA 4BL2A 4WV4B 5IU1A 1AOID 4Z66C 2ZM2A 4CSRB 2FH5A 2CMNA 4S2NC 4UEYA 4BWIA 3BW6A 5MC7A 1MWRA 2DMWA 3IS2A 4LFUA 2G5HC 4BD1A 2ZM0A 2O9BA 3KX0X 3TU4C 1BLSA 2WGWB 2HIOC 3LIBA 4ARZA 4JXGA 4YS3C 3JYIA 4WBGA 3T4OA 3UTBA 5B40C 1RGYA 2XD5A 3H82B 3X1SD 3IXGA 4EUVA 3C1BD 2Y2HA 1KVLA 5BPVA 4X23D 5FAOA 5G49B 3L27A 1I2WA 1MZUA 2B18A 5GT3C 4EO5B 1ID3D 5TJJA 5F99C 2V9AA 3MQ0A 1ES2A 1S66L 3T4LA 1TZYB 1BLCA 1PWCA 2W3DA 4R3JA 2VK3A 4OP8A 4S2IA 3REHB 2VV6A 3MVDB 2XFTA 5KSCA 4E3KA 3MJQA 4EV4A 4M3KA 1K38A 1OMEA 4KZBA 1NRJA 1F66D 3MXQA 2AROC 5FASA 2GNXA 3VOYA 3AGFA 3OPHA 4ZBJB 3W96C 3REJC 3X1VA 4UHUA 1BH9B 1V9ZA 1ZKJA 3IBRA 3KYEA 3X1TA 5HW3A 4Y3IA 3B0CW 3W98C 2W0NA 3Q7ZA 5CHLB 5D3OA 1DJAA 3G32A 4PKYA 2VQRA 1OGBA 4GH9A 5F69A 3KXBC 1BLHA 3UT9D 5EVIA 5AV5A 4BLMA 4R8PC 5G4ZA 5BT1D 1P3OA 4XXRA 2JKTM 3V3RA 3G35A 2V20A 4OVDA 4HGAB 5IHVA 1LL9A 4MCWA 3A6NB 3EG5B 5B33D 2BLSA 3LYXA 4PM5A 5F1FA 3WD0A 2P7JA 3T4KA 5HAQA 1P3BB 4CSRA 4KZ8A 5AV8A 4G3KA 3QP1A 4UA7A 4Y5FA 5B31B 5GXQC 1VM1A 1M6KA 4MBKA 1ZLAD 2PYOD 3REIB 3CPTA 5B0YC 3UPNA 1XJ4A 1KGFA 2J9PA 2Y2QA 4BJPA 1BULA 4M4XA 1VQQA 4H9PB 4E3NA 3NOUC 3B6FB 4YFMA 3NECA 1VEUB 1TZYA 3MGQD 2EX6A 3L9KA 1HTZA 3LI9A 3REKB 2B95A 1WYCA 3QNCA 1P3AD 4P85A 4B93A 4EBLA 1AWIA 2PBYA 3REHA 5EE8A 3QP6A 2ZL1B 3VH6W 3WS1A 3M2KA 3PBNA 1HQ3A 3O88A 2M7UA 3W2ZA 2ZM8A 1PZOA 2OLVA 2Y59A 5DNMB 4MB3A 4GJ4A 4R3AA 2D49A 3GECA 2WK0A 4O7DA 3O86A 4O8GA 1GCEA 1NLZA 3O5YA 1EQZD 3WWXA 1MC0A 1GHIA 4YINA 3EPKA 4K0WA 4HESA 2Y2PA 1BUEA 5F5YA 4WU9B 2KLIA 2ZY2A 2JKTI 3OCLA 3OPLA 3UB6A 3VE3A 3CI6A 3O87A 3RXXA 1S6RA 3C4PA 2Q9MA 3HLDA 2JKGA 3A3IA 1U60A 4KZ9A 4J8UB 3PBOA 1YM1A 1TDGA 3AZHC 4AWLB 1LLBA 3R7WB 3S1YA 4IHQA 4KQDA 3LJAB 4IBFA 5JRGD 4FH4A 5FQIA 4H9RA 3AZNB 2EX9A 2M7VA 4ZUXB 3RELB 2RTSA 2VGJA 4PAUA 3PAEA 3CWFA 4QWOA 5BOHA 1U35B 5GHYA 4GLQA 3KWQA 3G30A 1DP9A 4HH2A 4KUDD 3WD3A 2W8SA 3H0RC 1S32C 5B31A 4EERA 2JC7A 5B32G 4J8VD 3S4XA 1YU3A 1P3LC 4LCMA 2ZOHA 3AZLB 5CPIA 3AFAC 1UGUA 5FUGB 1NJ4A 3W97A 4P6BA 5FEFA 1T1BA 3AZMB 2EXBA 4B4ZA 2RVQC 1IYQA 2PD7A 3E4PA 4H9PA 4HEFA 4S2JA 5AV6D 4S2OA 2P9VB 3OPPA 3UE1A 1H5XA 5I5LA 1KX3B 1KX5B 3AZJD 1WWSA 2Y55A 3O3VA 2JKRM 3AZKB 2C6WB 4Y0TA 1HVBA 3UB9A 4XUJC 2XRNA 2ZL1A 4DE0A 2UV0E 2FN2A 3IQAA 5HWVA 3MGRD 5A93A 5GSUD 4NYYA 1JWVA 5CPJB 2R78A 2PRFA 2JE5A 3BQ8A 1LSVA 3GVBA 4D60A 2HGVA 4BL3A 4CLCB 5DJUA 3F1NB 4WF0A 3QP5A 3NDGA 4S2NA 1GXDA 3LEZA 4MN7A 3AYWB 1K6RA 3CAXA 1BT5A 5AVBC 5E2GA 3AN2A 4WL9A 5AV9D 3DWZA 3LZ0D 1EW0A 4BBUA 5CP6C 1OTEA 4N1HA 2O9CA 3AZID 2Y2NA 3WD2A 2DF4C 3AV1D 1MWSA 1AOIC 4ZUXA 4DRAA 3RELA 2CV5B 1ONHA 4IJEA 1K56A 1PWDA 1D7EA 3BEBA 4H9NA 3C8CA 2YFWB 3PXPA 3DTIA 5FATA 1K54C 4FOFA 3X1SC 4QPRA 3C1BC 1LI9A 2JKRI 1W63M 3AZLA 5HAPA 4X23C 5FUGA 3ISGA 3UE0A 2C5WB 5GT0C 4DRTA 5FA7A 1ID3C 1G28A 3W96A 2P9VA 1BFMA 1A7WA 3GV9A 3AZGB 3A3EA 3WAAA 3REID 2B5RA 5J3WA 3LIFA 1Z2CB 5B24C 3W98A 5EM0A 1KX4B 3AZFB 4EEUA 3B6FD 3L28A 1F66C 4OPYA 2HUEC 4R8PA 3GQZA 4UUZA 5DKKA 4G91B 5G4YA 3BM6A 4CLCA 2Y2JA 3WKJB 2DQNC 2LY8A 1ED7A 4GS9A 3CITA 3TOIA 1BSGA 5DNMD 4X25A 4JJNB 3K3CA 1ZTUA 5GXQA 3TG9A 4JGOA 3MGSB 1L0DA 4LRYC 3B42A 3UT9C 1DY6A 2Y91A 1B67A 4P6ZS 3WD4A 5BT1C 4DE2A 1XGIA 4KQQA 2PBDP 1ZG6A 1P3IA 5AY8B 5CPKB 4FH2A 5B33C 2FZ0A 1TVFA 2W1TB 2CV5A 1ZHHB 4EU0A 5HPFA 3B6GD 1XJ2A 1H8PA 1KDSA 4IBBA 1P34A 1C3BA 3AZND 4I5SA 5TFQA 4KGCB 4HNBA 4RA7A 1ZLAC 1LSWA 5B1MB 2PYOC 4NYUA 2W27A 2ZMAA 5L8MA 5E43A 5DF7A 1U35D 1J7MA 3R4KA 3MQOA 3ITBA 4GKUA 5M19A 5FI7A 5CTNA 3F1PA 1XFQA 2OLUA 1TS8A 4GB7A 5E5AB 4PM8A 3WTPA 4J8WB 1OGGA 3MGQC 4HOIA 3PBQA 1CQAA 4GNUA 3SH7A 1XJ3A 3C1CD 1P3AC 3QNBA 1E3UA 5DNNA 4Y13A 3UB8A 1KX4A 3AZFA 2K2NA 1KX3D 3W99B 4JF4A 4OJOA 3AZKD 3HONA 2Y2GA 3N7WA 1YMSA 2PU4A 4HP4A 5FAPA 3V5MA 5KMWA 3VOZA 1FSYA 1EQZC 4L9FA 3IX4A 2P74A 5HL6A 3S7OA 2IO5B 5CPJD 2HF6A 1CJFA 1S32A 4Z2GA 2PYPA 2GJ3A 3V50A 3N3FA 5GHXA 3S7PA 3LELD 4OKPA 4R3BA 3CHWP 1SDNA 1XFNA 2FFFB 3PBRA 4J8XD 3IXBA 3IBJA 5JRGC 4L9EA 5CHJA 3FC7A 3IH9A 4P0MA 3X1UB 1P0ZA 5B2JD 1W8YA 3H0MC 5CHMA 4O0PA 5C3IB 1ERQA 1FCNA 3BFEA 2J3TD 1N9BA 2E8JA 4OPZA 4KUDC 4EQIA 1M18B 3WTPE 3CLOA 2RIQA 4XZQD 1S0WA 1VETB 2R9WA 4J8VC 3NCKA 3C7UA 1T1AA 2ZQ7A 4LCLA 1M1AA 3HLWA 3EPJA 3S7QA 4IBDA 4QLCB 2ZM5A 4RX3A 1XA7A 2V1AA 4UPKA 5B0ZA 3EQUA 3AZJC 3P5JB 1GSVA 4J8WA 5HDSA 4WZ5C 3EEAA 4FD8A 3Q1FA 4H6JB 1LL8A 5M1AA 1MWUA 3A1IA 2VGLS 4II7A 1J3WA 4EO5C 5B1LB 4C6YA 4OJ5A 1G68A 2ZC6B 5HL1A 3D4FA 3T12B 3AZGD 3BWLA 3KUYA 1ZG4A 3MGRC 3KSHA 5GSUC 3L29A 3LR4A 3CUEA 2XK1A 2WAEA 5CECA 4XUXA 2WKQA 3MVDC 1Y4OA 2J80A 1AOIA 5B2ID 4NZ1A 3UTBB 3IH8A 5DJTA 2AVXA 1PZPA 1PWGA 3EGXC 3G4PA 3MBZA 3P98A 3EPLA 3P09A 5AVCB 3IF6A 1OTDA 5CX7A 3WA9D 2QKPA 4JGQA 1G6AA 3WKJD 4X23A 4H9QB 5AV9C 4G3VA 4OOMA 3Q07A 1SZVA 3LZ0C 3FZCA 4XT2B 1M19A 5FQJA 1ID3A 1YAXA 3AZIC 3MKEA 3BY9A 2E8IA 3AV1C 3MGSD 4XUJD 1DRMA 3MZEA 3HUMA 4WMCD 5EECA 1V9YA 5HARA 4G3WA 1TAFA 2O9AA 4Z5TD 4NK3A 1M18A 5BO0B 1OJGA 2HDQA 2W3HA 5AY8D 5CPKD 5EM1A 3A6NC 3GRJA 5CXWA 4GOGA 2JKFA 3X1VB 3IWOA 3A0RA 1P9WA 3F6TA 3CZDA 3IXHA 3X1TB 4WUJA 4QLCA 1M40A 4B88A 1P3FB 2WKIA 4KGCD 4YM6A 3REIC 2Y2IA 4MDZA 4MN5A 4JXSA 3AZED 3IXDA 5EVIB 1P3OB 3B6FC 3UT9A 4E04A 4E45A 3HCYA 2NQBA 1YLZA 4LLOB 3N8RA 1MKMA 4BBTA 5AV8B 4H9OA 5B33A 3AV2D 1KDWA 2ZQ8A 2HP5A 3W99D 2PU2A 3LY4A 4EEPA 4F94A 1TF1A 3CPTB 5DNMC 3LGOA 5U47A 1WWIA 4L0LA 1K4EA 4IBKA 1A0KA 1NXYA 4GZBA 4C3QA 4LD9D 2GDNA 5GT0D 2PYOA 2NZDD 5AVCA 1ES4A 4QJGA 1DP8A 5L07A 1P3MD 1W63Q 2VX8A 2L1MA 4TX8A 1N1JA 4H9QA 4GD6A 5EVEA 2V0UA 4R0QA 3T4TA 4XT2A 5IT5A 2V5OA 4QY5A 4QY6A 4HMDA 4WU8B 1KE0A 5B24D 1YLJA 2XH9A 2WKPA 3QP4A 1UWNX 1ESIA 1HQ3B 4I3IA 3B6GC 1P97A 1YLWA 4YWZA 1P3KD 5BO0A 3X1UD 3AZNC 1YMXA 2BG1A 1N4OA 1K6SA 2EX8A 4YNRA 1I2SA 3O62A 1P3GD 4MB4A 3QP8A 1U35C 1L0FA 1XXMA 3BFDA 1P3FA 3H9WA 3K2NA 3G2ZA 1GHMA 4WZSB 3T1XA 2XROA 4NG2A 5DTKA 5JYPA 3CMZA 4WELA 3C1CC 1ACFA 5BNVA 1Z09A 4BENA 4OJLA 4GHAA 1PNEA 4JF6A 3M6BA 1RGZA 1IKGA 4H9RB 1KX3C 1P3PD 4KZ7A 2MJ6A 4UA6A 3WS2A 2VA0A 3B47A 3AZKC 2V8CA 2X01A 4WZ4A 3ITAA 1K0KA 3A1KA 3ZG0A 3KWQB 2VV8A 5B1LD 1E8BA 4N9KA 4H9SC 1RCJA 3AGDA 3UTAA 4KZ3A 4MEZA 5CPIB 1KOUA 2Y79A 4KUDA 3W97B 5CPJC 3LIAA 1BZAA 4ZTKA 4KQRA 4I39A 2FJ7A 3L7HA 3MNNB 1XJ6A 3UTBD 4RYEA 4YOFA 3EGDC 4CJNA 3LELC 4HQAA 4MB5A 5AV6A 4J8XC 4WU8A 2PR5A 4Z2KA 3AZJA 3E2LA 5B2JC 4WZ5A 3ZG8B 1F5MA 4JKTA 4LV0A 5E2FA 5CEDA 2J3TC 3JVUA 2QMIA 1ULYA 3PBTA 1W2EA 2XA7M 1NY0A 4XZQC 3SH9A 1JWPA 4X6TA 4Z66B 2QYBA 4PPRA 2XSSA 5BS7C 1DJCA 2INWA 1IEMA 4DQYB 3TU4B 2V0WA 2HIOB 3D72A 5BNXB 3LZ1A 1T18A 4YS3B 2F8ND 2ZQAA 1OJ5A 5B40B 3AN2B 4KZ6A 4IVKA 3B0DB 1CF0A 4E3MA 4G92C 2L4RA 2WADA 5GT3B 2JSSA 5FQKA 3S7NA 3LI8A 1YLYA 4KUKA 3LZ0A 2H0TA 3VP2A 3AZGC 1H3OA 2VKSA 3IHBA 2WGIA 1CK3A 1TS0A 4PM6A 4HH3A 4X1MA 5AV5D 3MSHA 5EOEA 4QB8A 4H9NB 5L10A 3VSLA 5B2IC 1SKFA 3C4OA 1AXBA 1K55C 2BASA 2XLNA 3VFHA 3BRMA 4PM9A 1FCOA 2HPBA 2ZY5A 3UDXA 3MNNA 3W96B 3WA9C 3REJB 4IUHA 3WKJC 3IX3A 2QJ5A 2BYKA 4CAYB 3WAAB 4R4SA 4JLFA 4LENA 4UQIS 3NQJA 5C5KA 1WE4A 1S4SA 4JJNC 4K08A 3ZNTA 3W98B 1E6RA 5EUAA 2ZQCA 3MGSC 3KS8A 4U0TA 3MGPA 5B32A 3KXBB 3NBLA 3SS5A 2HDSA 3ULFA 1TZYD 4R8PB 4ME4A 2HP6A 4UUZB 3ZG5A 3HLFA 4Z5TC 2K31A 3REHD 5I94A 3VV4A 3RJUA 5AY8C 3MVDD 5CPKC 4Z66A 1K4FA 4IVIA 1EROA 2G2WA 4GS9B 4DXCA 3ZVWA 1KVMA 3HJIA 1RP5A 1CK7A 3TU4A 2HIOA 5BNXA 1LT0A 4AFIA 4YS3A 1OTIA 3NIAA 5GXQB 3EPHA 4EW7A 1GPFA 5B40A 4KGCC 4GHLA 5B1MC 2OWJA 3MQLA 5B0YB 4HJ4A 1Q2QA 2NUPC 3AZEC 5J7EA 5GT3A 4HMCA 5F99A 4MBHA 1P3IB 3HVFA 2Q9NA 3FKEA 4Z2MH 3SH8A 1HZOA 2P08A 2ZMVA 1P34B 3NOPC 3AV2C 4Q0JA 3N8SA 3W99C 1S67L 4LV2A 2P04A 3A6ND 2AROA 2W1RA 2XDMA 1WA9A 5DF9A 4PMAA 1P3BD 3T4SA 1L0GA 3BLSA 3MXRA 1HLUP 4LD9C 1H0MA 2NZDC 3MR0A 2O0YA 5B31D 3F1PB 3REJA 4GCZA 3MS6A 1P3MC 4DRBA 3WTPB 4CAYA 1E6PA 1OTAA 4KQOA 3R45B 2F2AC 3W97D 3DTMA 1TEMA 2BYMB 1TS7A 2PT7A 3E2KA 4Z2IA 3V3SA 5DNNB 1O6IA 4BMWA 2Y2LA 2J9OA 5FQ9A 2NUTC 3KXBA 4LGWA 2YKFA 2J8PA 5GL9A 3FG8A 1K25A 5CEBA 5GLAA 5TBMA 2G5IC 3REKD 1W1TA 1P3KC 3HREA 2L0WA 3X1UC 1NWZA 1GA0A 1K57C 3RTYA 1P3GC 3LUQA 5C3IC 2XFSA 3ZDJA 4IJFA 4Z9QA 1S32B 4OQ0A 4Y7PA 1PDCA 3ZCZA 4X69A 1YPRA 2HV1A 5B0YA 2WKEA 4DJ3A 2Z2LB 4I38A 3UDFA 1XX2A 5EVLA 4WU9D 3I7JA 1FQGA 1SKOB 3OLOA 3AN2D 1P3PC 3M2JA 4UAAA 1TDLA 4J8UD 4J8XA 3EWKA 5EPHA 5E2EA 2ZJ9A 5B1LC 3LJAD 3VP4A 4OLGA 2IOUA 3DW0A 3V9RA 3ZYTA 1JFIA 4ZUXD 3RELD 3VOLA 5FEGA 1M1AB 4MLLA 1K56D 2GZAA 4XZQA 1KGEA 2WZZA 3FPVA 3OCNA 5HZHA 2ZQDA 2H5SA 5KSHA 4OPQA 3UTBC 5GLDA 5B0ZB 5CTMA 3T4JA 4OUIA 4ETZA 3R45A 3AZLD 2X71A 4Q0IA 4WNNA 3AZMD 3LIEA 2BYMA 2HP9A 5F83A 4JBFA 4IBGA 3A0VA 3N8LA 1YUEA 5AJGA 2V1BA 3AZHA 1KX5D 4EUZA 5CP6B 3WAAD 4OONA 2H10A 3KUYB 1XPBA 1GHPA 2PAVP 5JA4A 3KO6A 4JF5A 2WKRA 2ZMFA 3LFVA 4LRZE 1AOIB 4KENB 3WRTA 1PRQA 1WYBA 4NE3A 2Z6DA 1DJBA 3FWLA 5M18A 1AIWA 1BH8A 3L26A 1E6ZA 5DFXA 3SS3A 3OBFA 2VEAA 1CEGA 2A24B 4HBUA 3Q81A 3RH8B 3IF6B 1P3LA 3UMDA 4CLCD 3C1BB 3A3JA 4EETB 3AFAA 4X23B 5HSQA 1GSXA 2XA7S 2J7VA 3AYWD 3U4LP 1H0GA 1M19B 1Y28A 1ID3B 3X1TC 2ACGA 1Q9CA 2IWCA 1ZC2A 1QMFA 1SKOA 2YKHA 2A49A 3MQQA 4GDBA 3E0YA 3GDIA 5HDDA 5EVIC 5AV5C 1XKZA 3VP3A 5L2FA 2IA2A 4XUJA 4LV3A 1TAFB 3HLGA 1LHYA 1P3ID 1F66B 2HUEB 4OJ6A 1N9NA 3PAGA 2OOLA 3KYZA 1ES5A 2CV5D 3PYPA 5AQBA 3RFBA 4ZDXA 4LPZA 5HX9A 2XQZA 5AV8C 3F1OB 4JGPA 1P34D 1LI0A 2QJ7A 5F1GA 4S2MA 4YM6B 1PI4A 4D2OA 3AGEA 2PR6A 3LEQA 2EFUA 2HJ9C 5AVBA 3OPRA 4FCFA 3JPUA 3D9YA 1BTLA 1ODVA 4KHAA 1NYMA 1D06A 3AZEA 3UT9B 3LO7A 3G6OA 3NOTC 3WTPD 5CP6A 1TZYC 2NQBB 3PHYA 1XGJA 1J9MA 2ZLYA 2ZC3B 4H9OB 3REHC 5DNND 5B33B 4IBIA 5DF8A 1KX4D 3AZFD 3S22A 1HD8A 4DN0A 3UDIA 3T1SA 2RL3A 3PBSA 5FL3A 3NY4A 2XF3A 2A24A 5A91A 3FKWA 1UWPX 5K5BA 2OWHA 5AVFA 4ZBJC 3BFGA 3KSFA 1K54A 2PYOB 1FILA 5EOOA 1UR8A 3X1SA 1H8ZA 3C1BA 3CG5A 1N1JB 4KG6A 3ZFZA 3VH6T 1PYYA 5GT0A 3JVVA 1SDEA 2W3GA 2NZDA 2F8NK 1W1YA 1JTDA 2WYXA 4NXBA 4JJND 1P3MA 4KUOA 3MGQB 3OZHA 4LG2A 1MXOA 2I72A 4EBNA 2IWDA 4DMZA 1VB6A 5B24A 4NY2A 2QZ6A 2Y2OA 4HGAC 1F66A 4P87A 3VMAA 4JXVA 4FUWA 3O62B 1P3BC 4NETA 3F1OA 1EQZB 5B31C 4MNRA 1YU4A 1IYOA 2PYRA 4H8RA 4WJ3C 4BBVA 5B1MD 1M1AD 3NQUA 3VSKA 3W97C 1CI8A 3QHYA 5FDSA 5BNVB 3PTEA 2Z6CA 3IX8A 3UB5P 5B0ZD 1N9LA 1MBLA 3UB7A 5E5AD 4J8WD 1E88A 1KGGA 3TJZC 5IS1A 3VH5A 4E6XA 3REKC 2KDKA 5DKLA 1IELA 5HWWA 3UNWA 4KG2A 5J4EA 3UTAB 4X68A 3KUYD 3KFUG 4KUDB 2DCFA 1YSPA 5AQAA 4OQIA 3ZHHA 1R4VA 3ZG7B 4J8VB 2FJ7B 2ZC7A 4OQHA 4R38A 1ZLAA 1DP6A 4GW9A 3W8KA 1LSXA 3LR0A 3OOVA 5J8XA 4PHTA 5AV6B 4WU9C 4A5RA 3ZGAB 1S1ZA 4DXBA 2G7UA 3AN2C 3AZJB 1FOFA 4EBPA 1HTAA 3LCEA 3B0DC 3MGQA 2CWEA 4J8UC 1P3AA 4AWLC 2F8NG 2ZC5B 1M19D 5AQ9A 4EWFA 3LJAC 3UE3A 2J8YA 4DDYA 2DRWA 3GR2A 1W1PA 4ZUXC 3MGRB 3RELC 5GSUB 3KSYA 1L6JA 5DTTA 3N4IA 3B33A 1YU2A 4EXOA 3LZ1B 1M18D 1EQZA 1FR1A 4PKYG 1GOIA 1L2SA 1PW8A 4Y0OA 3AZLC 5FQMA 2F8NA 3AZMC 4P6ZM 4U3TA 4Z2MG 5HD5A 4QLCD 3FKVA 5AVEA 3ZNYA 5AV9B 5KZHA 2HDRA 5E2HA 3KSIA 3LZ0B 4YM6D 1KX5C 4HMEA 3MXSA 2WKHA 3W4PA 3WAAC 1H3OB 4F3LB 3H0LC 4OQGA 1QO6A 3UN7A 4N9LA 3AZIB 3L25A 3IF5A 1F98A 1W1VA 3AV1B 3H7WB 5JRGA 2OSUA 2J3WA 3L2AA 3KSGA 3Q82A 3TRCA 1N9OA 3ICYA 3NDEA 2X02A 2OV5A 2EX2A 4GHIA 1O7EA 2NQBD 3BFCA 5CHUA 1L0EA 2RCXA 4J8VA 3M7PA 3T4QA 4CLCC 3GMWA 2BYKB 3BQAA 3AYWC 3NQJB 2WGWA 1YU0A 2ZC4B 2DNSA 3MF0A 2Y4AA 4QD4A 3ZQ5A 3MKFA 1T3UA 3NHQA 3H82A 3BLMA 5AVCD 3BYDA 3HJKA 3WD1A 4OLDA 1PFLA 3MGPB 3HBRA 3BJNA 1G5UA 5B32B 5G49A 2Y2KA 2G2UA 3RXWA 3BY8A 2XD1A 1P3IC 5GLBA 2VZWA 3W4QA 1VHMA 4X53A 3MGRA 2JBFA 5GSUA 1Y54A 2CV5C 1NLYA 4JPMA 3MVDA 1ALQA 5FI2A 1P34C 4NXGA
chains in the Genus database with same CATH topology
1SCWA 3M6HA 4IBEA 3X1VD 3O62D 4ZJ2A 4OH0A 5A92A 5F99B 3X1TD 1YLPA 4UA9A 2YFVB 1Q2PA 1P3FD 3HUNA 5AV9A 4R23A 2L5AA 1BH9A 3WTPC 2ZY3A 3WS4A 3AZIA 4IEDA 5FDHA 1H8YA 3CJMA 5EVID 5B31G 4ZJ3A 3AV1A 4GDNA 1EWZA 1P3OD 5DNNC 1KX4C 3AZFC 3G2YA 1YT4A 2AROB 1MPLA 1O07A 3B6GB 2FFYA 5AV8D 4G91C 3A6NA 3GSGA 2HDUA 3WS0A 1P3BA 3UTAD 1B6WA 3HSHA 3IHAA 3HL9A 2Y2MA 2FJ7D 1NZUA 4KZAA 3REIA 3SOIA 3C1CB 4DE1A 5CGXA 3WS5A 4Q8IA 4WU8D 3VH5T 3B6FA 3NC8A 2F8NH 1HQ3D 3REKA 3MFDA 5CGWA 2WAFA 2QPNA 2XR0A 5FSRA 3SS4A 1M1AC 5DNMA 3N6IA 3LZ1D 1SHVA 2YFVA 1E25A 5B0ZC 3HLBA 3LELB 2JCHA 5E5AC 4J8WC 4WU9A 1BLPA 1ONGA 4J8XB 3A3DA 3Q7VB 1NRFA 4OP5A 1W79A 4PM7A 2R9XA 3G34A 5B2JB 4J8UA 3V9RB 3MZFA 1JFIB 4OOLA 3KUYC 3B6GA 5HFOA 3LJAA 3VP1A 2ZQ9A 2ZD8A 4XZQB 2Z2MB 3IT9A 3KWQD 3AZNA 5A90A 5CRFA 4R4RA 1PI5A 4S2KA 3WX7A 1MY8A 4QHCA 3VH6A 3C5AA 4N1XA 1U35A 4E3IA 5CPID 1W8QA 1JWZA 2IO5C 5DTSA 4WYYA 3A3FA 4WNNB 1NYYA 4N92A 1F1EA 3IF6C 3MNND 4Y0UA 4M6BA 4G92B 3C1CA 3AZHB 5F82A 3AZMA 1M19C 5JA4B 3OC2A 3W4OA 3DWKA 1QMEA 1KX3A 1KX5A 3MGPD 5JYOA 5B32D 3AZKA 4WEJA 1XA1A 1BH8B 2A3UA 4RX2A 4KG5A 5B2IB 2EXAA 3UY6A 1M18C 4H9SA 4MBFA 1P3LB 4Z66D 4DF6A 3AFAB 3IWIA 5CPJA 3ZVTA 3AL0C 2XGNA 3TU4D 2HIOD 3WA9B 1PW1A 4QLCC 4YS3D 4IBRA 1IYPA 5B40D 4YM6C 3LELA 3AYWA 3KS4A 3B3XA 1ERMA 1FR6A 4DDSA 5GT3D 3Q7VA 1CEFA 5F99D 4XUJB 2CC1A 5B2JA 4ID4A 5GLCA 2NQBC 4IBJA 4Z5TB 4NE6A 5CGSA 1PZRA 5FAQA 5BS7A 1YQSA 1YU1A 2AROD 3IWQA 3VP0A 4BD0A 2YFWA 5AVBB 1XP4A 1KU5A 5AVCC 3W96D 4KHAB 3REJD 2V1ZA 4JXWA 2IWBA 4OOYA 4DE3A 3AZEB 4IBCA 3UPOA 1MWTA 3HLEA 4NE5A 1W5DA 4GD8A 1I5QA 3IP4C 3UO9A 4R1GA 1E4DA 3W98D 4GN2A 3AZGA 1YLTA 4BQMA 4RVAA 3KXBD 3FV7A 4DKIA 3UPPA 4R8PD 3AV2B 4NFTA 3LY3A 5B2IA 3BECA 1K55A 4NZ4A 3HUOA 3X1SB 4X55A 5KDMB 1KE4A 3X1VC 3O62C 4LD9B 5GT0B 3MZDA 2UWXA 2NZDB 3WA9A 1P3MB 3WKJA 1P3FC 5GXQD 3NI9A 3VH5W 5B0YD 4JJNA 3C7VA 4HBTA 5B24B 4X56A 1P3OC 3MGSA 5TGFA 2ZY4A 4E3OA 4QU3A 2H0YA 4WMCA 1Z6FA 4K91A 3B0CT 3VFFA 4Z5TA 1P3KB 3TSGA 5TR7A 5AY8A 5CPKA 2XEPA 1P3GB 3UTAC 5HAIA 1FCMA 3NQUB 4U0XA 4K0XA 2EFXA 2FJ7C 4KGCA 5B1MA 3FYZA 4XUZA 5AV6C 4WU8C 5G18A 1P3PB 5E5AA 1E3UD 1HQ3C 3AZHD 3V39A 1NZOA 3GTCA 4FSFA 4S2PA 3AV2A 1LL5A 4OJPA 3W99A 4NZ5A 1CI9A 1ZLAB 5FI6A 5KDMA 4KZ5A 4WM9A 4LD9A 2V2FF 3G31A 2WZXA 3LZ1C 1S32D 1GA9A 4E3LA 1MKIA 4LV1A 4C75A 1P3LD 3AFAD 1JVJA 3EQVA 4ZBEA 1FSWA 2VGKA 1P3AB 1W7FA 2RVQD 4B4XA 4S2LA 3BFFA 4E44A 3HLCA 4CPKA 4QNLA 1IKIA 1P3KA 3X1UA 3KWQC 4E3JA 4ZAMA 2WGVA 1PIOA 3B0BA 1IYSA 1K57A 5CERA 1P3GA 4ZJ1A 4WEKA 1ESUA 5CPIC 4OPRA 3ZG9B 2F8NB 1JTGA 1EI5A 3MNNC 5FQQA 1KE3A 3FDDA 2WUQA 5DVAA 3WRZA 5AVBD 1ES3A 4KZ4A 5JRGB 4E6WA 4IBXA 1P3PA 5AQ7A 3MGPC 5B32C 5AV5B 5CP6D 4NZ3A 5GHZA 5B1LA 4BL2A 4WV4B 1AOID 4Z66C 2ZM2A 4CSRB 4S2NC 1MWRA 4BD1A 2G5HC 2ZM0A 3TU4C 1BLSA 2WGWB 2HIOC 4JXGA 4YS3C 3JYIA 4WBGA 3UTBA 5B40C 1RGYA 2XD5A 3X1SD 3IXGA 3C1BD 2Y2HA 1KVLA 5BPVA 4X23D 5FAOA 5G49B 3L27A 1I2WA 5GT3C 4EO5B 1ID3D 5F99C 1ES2A 1TZYB 1BLCA 1PWCA 4R3JA 4OP8A 4S2IA 3REHB 3MVDB 2XFTA 5KSCA 4E3KA 4EV4A 4M3KA 1K38A 1OMEA 4KZBA 1F66D 2AROC 5FASA 3VOYA 3AGFA 3OPHA 4ZBJB 3W96C 3REJC 3X1VA 4UHUA 1BH9B 1ZKJA 3X1TA 5HW3A 3B0CW 3W98C 3Q7ZA 5CHLB 5D3OA 1DJAA 3G32A 2VQRA 4GH9A 3KXBC 1BLHA 3UT9D 5EVIA 5AV5A 4BLMA 4R8PC 5BT1D 1P3OA 4XXRA 3V3RA 3G35A 2V20A 4OVDA 4HGAB 5IHVA 1LL9A 3A6NB 3EG5B 5B33D 2BLSA 4PM5A 5F1FA 5HAQA 1P3BB 4CSRA 4KZ8A 5AV8A 4UA7A 5B31B 5GXQC 1VM1A 1M6KA 4MBKA 1ZLAD 2PYOD 3REIB 5B0YC 3UPNA 1KGFA 2J9PA 2Y2QA 4BJPA 1BULA 1VQQA 4H9PB 4E3NA 3B6FB 4YFMA 1TZYA 3MGQD 2EX6A 1HTZA 3REKB 1WYCA 3QNCA 1P3AD 4P85A 4EBLA 2PBYA 3REHA 5EE8A 3VH6W 3WS1A 3M2KA 3PBNA 1HQ3A 3O88A 2ZM8A 1PZOA 2OLVA 2Y59A 5DNMB 4O7DA 2WK0A 3O86A 1GCEA 1EQZD 3WWXA 1GHIA 4YINA 3EPKA 4K0WA 4HESA 2Y2PA 1BUEA 4WU9B 2ZY2A 3OCLA 3OPLA 3O87A 3RXXA 1S6RA 3C4PA 2Q9MA 3HLDA 3A3IA 1U60A 4KZ9A 4J8UB 3PBOA 1YM1A 1TDGA 3AZHC 4AWLB 1LLBA 3S1YA 3LJAB 4IBFA 5JRGD 4FH4A 5FQIA 4H9RA 3AZNB 2EX9A 4ZUXB 3RELB 2VGJA 3PAEA 5BOHA 1U35B 5GHYA 3KWQA 3G30A 4KUDD 2W8SA 3H0RC 1S32C 5B31A 2JC7A 5B32G 4J8VD 3S4XA 1YU3A 1P3LC 4LCMA 3AZLB 5CPIA 3AFAC 5FUGB 1NJ4A 3W97A 4P6BA 3AZMB 2EXBA 4B4ZA 2RVQC 1IYQA 4H9PA 4HEFA 4S2JA 5AV6D 4S2OA 2P9VB 3OPPA 3UE1A 1H5XA 1KX3B 1KX5B 3AZJD 1WWSA 2Y55A 3O3VA 3AZKB 2C6WB 4Y0TA 1HVBA 4XUJC 4DE0A 3IQAA 3MGRD 5A93A 5GSUD 4NYYA 1JWVA 5CPJB 2JE5A 3GVBA 4BL3A 3NDGA 4S2NA 3LEZA 3AYWB 1K6RA 1BT5A 5AVBC 5E2GA 3AN2A 5AV9D 3DWZA 3LZ0D 5CP6C 4N1HA 3AZID 2Y2NA 2DF4C 3AV1D 1MWSA 1AOIC 4ZUXA 4DRAA 3RELA 2CV5B 1ONHA 4IJEA 1K56A 1PWDA 3BEBA 4H9NA 2YFWB 5FATA 1K54C 3X1SC 3C1BC 1LI9A 5HAPA 3AZLA 4X23C 5FUGA 3ISGA 3UE0A 2C5WB 5GT0C 4DRTA 5FA7A 1ID3C 3W96A 2P9VA 1BFMA 1A7WA 3GV9A 3AZGB 3A3EA 3WAAA 3REID 2B5RA 1Z2CB 5B24C 3W98A 1KX4B 3AZFB 3B6FD 3L28A 1F66C 4OPYA 2HUEC 4R8PA 3GQZA 4UUZA 4G91B 3BM6A 2Y2JA 3WKJB 2DQNC 2LY8A 3TOIA 1BSGA 5DNMD 4JJNB 5GXQA 3TG9A 3MGSB 1L0DA 3UT9C 1DY6A 2Y91A 1B67A 5BT1C 4DE2A 1XGIA 4KQQA 1ZG6A 1P3IA 5AY8B 5CPKB 4FH2A 5B33C 1TVFA 2CV5A 3B6GD 1KDSA 4IBBA 1P34A 1C3BA 3AZND 5TFQA 4KGCB 4RA7A 2ZMAA 1ZLAC 5B1MB 2PYOC 4NYUA 5E43A 5DF7A 1U35D 3ITBA 4GKUA 5M19A 5FI7A 5CTNA 2OLUA 4GB7A 5E5AB 4PM8A 3WTPA 4J8WB 3MGQC 3PBQA 4GNUA 3SH7A 3C1CD 1P3AC 3QNBA 1E3UA 5DNNA 1KX4A 3AZFA 1KX3D 3W99B 4JF4A 4OJOA 3AZKD 3HONA 2Y2GA 3N7WA 1YMSA 2PU4A 5FAPA 3V5MA 5KMWA 3VOZA 1FSYA 1EQZC 2P74A 2IO5B 5CPJD 1S32A 3V50A 3N3FA 5GHXA 3LELD 4OKPA 4R3BA 1SDNA 2FFFB 3PBRA 4J8XD 3IXBA 5JRGC 5CHJA 3IH9A 4P0MA 3X1UB 5B2JD 1W8YA 3H0MC 5CHMA 5C3IB 1ERQA 1FCNA 3BFEA 1N9BA 4OPZA 4KUDC 4EQIA 1M18B 3WTPE 2RIQA 4XZQD 1S0WA 2R9WA 4J8VC 3NCKA 3C7UA 2ZQ7A 4LCLA 1M1AA 3HLWA 3EPJA 4IBDA 4QLCB 2ZM5A 4RX3A 1XA7A 4UPKA 5B0ZA 3EQUA 3AZJC 3P5JB 4J8WA 4WZ5C 4FD8A 5M1AA 3Q1FA 1MWUA 3A1IA 4EO5C 5B1LB 4C6YA 4OJ5A 1G68A 2ZC6B 5HL1A 3D4FA 3AZGD 3KUYA 1ZG4A 3MGRC 5GSUC 3L29A 2XK1A 2WAEA 5CECA 4XUXA 3MVDC 1AOIA 5B2ID 4NZ1A 3UTBB 3IH8A 1PZPA 1PWGA 3G4PA 3MBZA 3P98A 3EPLA 3P09A 5AVCB 3IF6A 3WA9D 1G6AA 3WKJD 4X23A 4H9QB 5AV9C 4OOMA 3Q07A 3LZ0C 3FZCA 1M19A 5FQJA 1ID3A 3AZIC 3MKEA 2E8IA 3AV1C 3MGSD 4XUJD 3MZEA 3HUMA 4WMCD 5EECA 5HARA 1TAFA 4Z5TD 4NK3A 1M18A 5BO0B 2HDQA 5AY8D 5CPKD 3A6NC 3GRJA 5CXWA 4GOGA 3X1VB 3IWOA 3F6TA 3CZDA 3IXHA 3X1TB 4QLCA 1M40A 4B88A 1P3FB 2WKIA 4KGCD 4YM6A 3REIC 2Y2IA 4JXSA 3AZED 3IXDA 5EVIB 1P3OB 3B6FC 3UT9A 4E45A 2NQBA 1YLZA 3N8RA 5AV8B 4H9OA 5B33A 3AV2D 1KDWA 2ZQ8A 2HP5A 3W99D 2PU2A 3LY4A 4F94A 5DNMC 5U47A 1WWIA 4L0LA 1K4EA 4IBKA 1NXYA 4GZBA 4C3QA 4LD9D 2GDNA 5GT0D 2PYOA 2NZDD 5AVCA 1ES4A 4QJGA 1P3MD 1N1JA 4H9QA 4GD6A 4R0QA 4QY5A 4QY6A 4WU8B 1KE0A 5B24D 1YLJA 2XH9A 1ESIA 1HQ3B 3B6GC 1YLWA 1P3KD 5BO0A 3X1UD 3AZNC 1YMXA 2BG1A 1N4OA 1K6SA 2EX8A 1I2SA 3O62A 1P3GD 1U35C 1L0FA 1XXMA 3BFDA 1P3FA 3G2ZA 1GHMA 4WZSB 5DTKA 5JYPA 3CMZA 4WELA 3C1CC 5BNVA 4BENA 4OJLA 4GHAA 4JF6A 3M6BA 1RGZA 1IKGA 4H9RB 1KX3C 1P3PD 4KZ7A 4UA6A 3WS2A 3AZKC 2X01A 4WZ4A 3ITAA 3A1KA 3ZG0A 3KWQB 5B1LD 4N9KA 4H9SC 1RCJA 3AGDA 3UTAA 4KZ3A 4MEZA 5CPIB 4KUDA 3W97B 5CPJC 1BZAA 4ZTKA 4KQRA 2FJ7A 3MNNB 3UTBD 4RYEA 4CJNA 3LELC 5AV6A 4J8XC 4WU8A 3AZJA 3E2LA 5B2JC 4WZ5A 3ZG8B 4JKTA 4LV0A 5E2FA 5CEDA 2QMIA 1ULYA 3PBTA 1W2EA 1NY0A 4XZQC 3SH9A 1JWPA 4X6TA 4Z66B 4PPRA 5BS7C 1DJCA 1IEMA 4DQYB 3TU4B 2HIOB 5BNXB 3LZ1A 4YS3B 2F8ND 2ZQAA 5B40B 3AN2B 4KZ6A 4IVKA 3B0DB 4E3MA 4G92C 2WADA 5GT3B 2JSSA 5FQKA 1YLYA 3LZ0A 2H0TA 3VP2A 3AZGC 1H3OA 3IHBA 2WGIA 1CK3A 4PM6A 5AV5D 5EOEA 4QB8A 4H9NB 3VSLA 5B2IC 1SKFA 3C4OA 1AXBA 1K55C 2XLNA 3VFHA 3BRMA 4PM9A 1FCOA 2HPBA 2ZY5A 3UDXA 3MNNA 3W96B 3WA9C 3REJB 3WKJC 2BYKA 4CAYB 3WAAB 4R4SA 4JLFA 4LENA 3NQJA 1WE4A 4JJNC 3ZNTA 3W98B 5EUAA 2ZQCA 3MGSC 3KS8A 4U0TA 3MGPA 5B32A 3KXBB 3NBLA 3SS5A 2HDSA 1TZYD 4R8PB 2HP6A 4UUZB 3ZG5A 3HLFA 4Z5TC 3REHD 5I94A 3RJUA 5AY8C 3MVDD 5CPKC 4Z66A 1K4FA 4IVIA 1EROA 2G2WA 4DXCA 3ZVWA 1KVMA 1RP5A 3TU4A 2HIOA 5BNXA 4YS3A 3NIAA 5GXQB 3EPHA 5B40A 4KGCC 4GHLA 5B1MC 5B0YB 1Q2QA 3AZEC 5GT3A 5F99A 4MBHA 1P3IB 3HVFA 2Q9NA 3FKEA 4Z2MH 3SH8A 1HZOA 1P34B 3AV2C 3N8SA 3W99C 4LV2A 3A6ND 2AROA 2XDMA 5DF9A 4PMAA 1P3BD 1L0GA 3BLSA 3MXRA 4LD9C 2NZDC 5B31D 3REJA 1P3MC 4DRBA 3WTPB 4CAYA 4KQOA 3R45B 2F2AC 3W97D 3DTMA 1TEMA 2BYMB 3E2KA 3V3SA 5DNNB 2Y2LA 2J9OA 5FQ9A 3KXBA 5GL9A 2J8PA 1K25A 5CEBA 5GLAA 2G5IC 3REKD 1P3KC 3HREA 3X1UC 1GA0A 1K57C 1P3GC 5C3IC 2XFSA 3ZDJA 4IJFA 4Z9QA 1S32B 4OQ0A 4Y7PA 3ZCZA 4X69A 5B0YA 2WKEA 2Z2LB 3UDFA 1XX2A 5EVLA 4WU9D 3I7JA 1FQGA 3AN2D 1P3PC 3M2JA 4UAAA 1TDLA 4J8UD 4J8XA 5EPHA 5E2EA 2ZJ9A 5B1LC 3LJAD 3VP4A 4OLGA 2IOUA 3DW0A 3V9RA 1JFIA 4ZUXD 3RELD 1M1AB 4MLLA 1K56D 4XZQA 1KGEA 2WZZA 3OCNA 2ZQDA 2H5SA 5KSHA 4OPQA 3UTBC 5GLDA 5B0ZB 5CTMA 4OUIA 3R45A 3AZLD 2X71A 4WNNA 3AZMD 2BYMA 2HP9A 5F83A 4JBFA 4IBGA 3N8LA 1YUEA 3AZHA 1KX5D 4EUZA 5CP6B 3WAAD 4OONA 2H10A 3KUYB 1XPBA 1GHPA 5JA4A 4JF5A 1AOIB 4KENB 3WRTA 1WYBA 4NE3A 1DJBA 3FWLA 5M18A 1BH8A 3L26A 3SS3A 1CEGA 4HBUA 3Q81A 3IF6B 1P3LA 3C1BB 3A3JA 3AFAA 4X23B 2J7VA 3AYWD 1M19B 1ID3B 3X1TC 1Q9CA 2IWCA 1ZC2A 1QMFA 2A49A 4GDBA 5EVIC 5AV5C 1XKZA 3VP3A 5L2FA 4XUJA 4LV3A 1TAFB 3HLGA 1LHYA 1P3ID 1F66B 2HUEB 4OJ6A 3PAGA 5AQBA 1ES5A 2CV5D 4ZDXA 5HX9A 2XQZA 5AV8C 1P34D 1LI0A 5F1GA 4S2MA 4YM6B 1PI4A 4D2OA 3AGEA 2EFUA 5AVBA 3OPRA 4FCFA 1BTLA 4KHAA 1NYMA 3AZEA 3UT9B 3LO7A 3WTPD 5CP6A 1TZYC 2NQBB 1XGJA 1J9MA 2ZLYA 2ZC3B 4H9OB 3REHC 5DNND 5B33B 4IBIA 5DF8A 1KX4D 3AZFD 3S22A 1HD8A 3UDIA 2RL3A 3PBSA 3NY4A 2XF3A 5A91A 3FKWA 4ZBJC 3BFGA 1K54A 2PYOB 5EOOA 1H8ZA 3X1SA 3C1BA 3CG5A 1N1JB 4KG6A 3ZFZA 3VH6T 1PYYA 5GT0A 1SDEA 2NZDA 2F8NK 1JTDA 2WYXA 4JJND 1P3MA 3MGQB 3OZHA 4LG2A 1MXOA 2I72A 4EBNA 2IWDA 5B24A 4NY2A 2QZ6A 2Y2OA 4HGAC 1F66A 4P87A 3VMAA 4JXVA 3O62B 1P3BC 4NETA 1EQZB 5B31C 4MNRA 1YU4A 1IYOA 4H8RA 4WJ3C 5B1MD 1M1AD 3NQUA 3VSKA 3W97C 1CI8A 3QHYA 5BNVB 3PTEA 5B0ZD 1MBLA 5E5AD 4J8WD 1KGGA 3VH5A 4E6XA 3REKC 1IELA 3UNWA 4KG2A 3UTAB 4X68A 3KUYD 3KFUG 4KUDB 2DCFA 5AQAA 4OQIA 3ZHHA 1R4VA 3ZG7B 4J8VB 2FJ7B 2ZC7A 4OQHA 1ZLAA 3W8KA 5J8XA 5AV6B 4WU9C 4A5RA 3ZGAB 4DXBA 3AN2C 3AZJB 1FOFA 4EBPA 1HTAA 3LCEA 3B0DC 3MGQA 2CWEA 4J8UC 1P3AA 4AWLC 2F8NG 2ZC5B 1M19D 5AQ9A 4EWFA 3LJAC 3UE3A 2J8YA 4DDYA 2DRWA 3GR2A 4ZUXC 3MGRB 3RELC 5GSUB 3KSYA 5DTTA 3N4IA 1YU2A 3LZ1B 1M18D 1EQZA 1FR1A 1L2SA 1PW8A 4Y0OA 3AZLC 5FQMA 2F8NA 3AZMC 4U3TA 4Z2MG 4QLCD 3FKVA 3ZNYA 5AV9B 5KZHA 2HDRA 5E2HA 3LZ0B 4YM6D 1KX5C 3MXSA 3W4PA 2WKHA 3WAAC 1H3OB 3H0LC 4OQGA 3UN7A 4N9LA 3AZIB 3L25A 3IF5A 3AV1B 5JRGA 2OSUA 3L2AA 3Q82A 3NDEA 2X02A 2OV5A 2EX2A 1O7EA 2NQBD 3BFCA 5CHUA 1L0EA 2RCXA 4J8VA 3GMWA 2BYKB 3AYWC 3NQJB 2WGWA 1YU0A 2ZC4B 2DNSA 2Y4AA 4QD4A 3MKFA 1T3UA 3BLMA 5AVCD 3BYDA 4OLDA 3MGPB 3HBRA 5B32B 5G49A 2Y2KA 2G2UA 3RXWA 2XD1A 1P3IC 5GLBA 3W4QA 4X53A 3MGRA 2JBFA 5GSUA 1Y54A 2CV5C 4JPMA 3MVDA 1ALQA 5FI2A 1P34C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GHZ A;  1SDN A;  2FFF B;  4KQO A;  3PBR A;  4BL2 A;  3IXB A;  1SCW A;  3M6H A;  3DTM A;  5CHJ A;  3IH9 A;  4P0M A;  1TEM A;  3E2K A;  2ZM2 A;  4ZJ2 A;  1W8Y A;  3V3S A;  4S2N C;  4OH0 A;  5A92 A;  1MWR A;  4BD1 A;  2Y2L A;  1YLP A;  2J9O A;  2ZM0 A;  4UA9 A;  5CHM A;  1ERQ A;  1BLS A;  1Q2P A;  2WGW B;  5FQ9 A;  3HUN A;  5GL9 A;  1FCN A;  3BFE A;  4R23 A;  1N9B A;  1K25 A;  4JXG A;  4OPZ A;  3JYI A;  4WBG A;  5GLA A;  4EQI A;  5CEB A;  3WS4 A;  1RGY A;  2XD5 A;  1S0W A;  3IXG A;  2R9W A;  4IED A;  2Y2H A;  5FDH A;  3NCK A;  1KVL A;  3HRE A;  3C7U A;  1H8Y A;  2ZQ7 A;  3CJM A;  4LCL A;  5EVI D;  5FAO A;  4ZJ3 A;  4GDN A;  1EWZ A;  3HLW A;  1I2W A;  1GA0 A;  3G2Y A;  1K57 C;  1YT4 A;  2XFS A;  3ZDJ A;  1ES2 A;  4RX3 A;  1XA7 A;  1MPL A;  1O07 A;  4Z9Q A;  2FFY A;  4OQ0 A;  4Y7P A;  3EQU A;  1BLC A;  1PWC A;  3ZCZ A;  4R3J A;  4OP8 A;  4X69 A;  4WZ5 C;  4FD8 A;  5M1A A;  3Q1F A;  4S2I A;  1MWU A;  3GSG A;  2WKE A;  2XFT A;  2HDU A;  2Z2L B;  5KSC A;  4E3K A;  4EV4 A;  4M3K A;  1K38 A;  3UDF A;  1XX2 A;  1OME A;  4C6Y A;  4KZB A;  5EVL A;  1G68 A;  2ZC6 B;  3I7J A;  1FQG A;  5HL1 A;  3D4F A;  3IHA A;  5FAS A;  3HL9 A;  1ZG4 A;  3VOY A;  3AGF A;  2Y2M A;  3OPH A;  3M2J A;  1NZU A;  4UAA A;  1TDL A;  4KZA A;  2XK1 A;  2WAE A;  5CEC A;  3SOI A;  4XUX A;  5EPH A;  5E2E A;  4DE1 A;  2ZJ9 A;  5CGX A;  4UHU A;  3WS5 A;  3VP4 A;  1ZKJ A;  4OLG A;  3IH8 A;  3DW0 A;  4Q8I A;  1PZP A;  1PWG A;  3G4P A;  3MBZ A;  5HW3 A;  3NC8 A;  3P98 A;  4MLL A;  3Q7Z A;  1K56 D;  5D3O A;  1DJA A;  1KGE A;  3G32 A;  3IF6 A;  2WZZ A;  3MFD A;  2WAF A;  3P09 A;  5CGW A;  1G6A A;  3OCN A;  1BLH A;  2QPN A;  5EVI A;  2ZQD A;  2H5S A;  4OOM A;  4BLM A;  2XR0 A;  3Q07 A;  4OPQ A;  5KSH A;  5GLD A;  5FSR A;  5CTM A;  3FZC A;  4XXR A;  3SS4 A;  5FQJ A;  3V3R A;  3G35 A;  2V20 A;  4OVD A;  3MKE A;  5IHV A;  2X71 A;  1LL9 A;  2E8I A;  5F1F A;  2BLS A;  4PM5 A;  2HP9 A;  3MZE A;  5HAQ A;  5F83 A;  3N6I A;  4KZ8 A;  4JBF A;  3HUM A;  4WMC D;  5EEC A;  1SHV A;  5HAR A;  4UA7 A;  3N8L A;  1E25 A;  4EUZ A;  4OON A;  2H10 A;  3HLB A;  2JCH A;  1XPB A;  1GHP A;  4NK3 A;  1VM1 A;  1M6K A;  4MBK A;  4JF5 A;  2HDQ A;  1BLP A;  1ONG A;  3A3D A;  3GRJ A;  5CXW A;  3UPN A;  4GOG A;  3Q7V B;  1NRF A;  4OP5 A;  4KEN B;  1KGF A;  1W79 A;  2Y2Q A;  2J9P A;  3IWO A;  4PM7 A;  2R9X A;  1BUL A;  1WYB A;  1VQQ A;  3CZD A;  3G34 A;  4BJP A;  4E3N A;  1DJB A;  3FWL A;  3IXH A;  5M18 A;  3MZF A;  1M40 A;  4YFM A;  3SS3 A;  4B88 A;  4OOL A;  2WKI A;  1CEG A;  4HBU A;  5HFO A;  3VP1 A;  2EX6 A;  2ZQ9 A;  3Q81 A;  1HTZ A;  2ZD8 A;  1WYC A;  2Y2I A;  3IF6 B;  3QNC A;  2Z2M B;  3IT9 A;  4P85 A;  4EBL A;  5A90 A;  3A3J A;  4JXS A;  5CRF A;  2PBY A;  3IXD A;  4R4R A;  1PI5 A;  4S2K A;  5EVI B;  5EE8 A;  1MY8 A;  2J7V A;  4QHC A;  3WS1 A;  3M2K A;  3PBN A;  3O88 A;  3C5A A;  4N1X A;  4E3I A;  1W8Q A;  2IWC A;  1JWZ A;  1PZO A;  1ZC2 A;  2ZM8 A;  5DTS A;  2OLV A;  1QMF A;  4WYY A;  3A3F A;  2A49 A;  1NYY A;  2Y59 A;  4N92 A;  1YLZ A;  3N8R A;  4GDB A;  4O7D A;  2WK0 A;  3IF6 C;  3O86 A;  4Y0U A;  1GCE A;  5EVI C;  1XKZ A;  3WWX A;  5F82 A;  3VP3 A;  1GHI A;  5L2F A;  4YIN A;  1KDW A;  2ZQ8 A;  4K0W A;  2HP5 A;  4LV3 A;  4HES A;  3HLG A;  2PU2 A;  1LHY A;  2Y2P A;  1BUE A;  3LY4 A;  3OC2 A;  3W4O A;  4F94 A;  3OCL A;  3DWK A;  1QME A;  3OPL A;  3PAG A;  5U47 A;  3O87 A;  4L0L A;  5AQB A;  1ES5 A;  1S6R A;  3C4P A;  1K4E A;  3RXX A;  2Q9M A;  3HLD A;  1NXY A;  4GZB A;  5HX9 A;  4C3Q A;  4ZDX A;  2XQZ A;  1U60 A;  2GDN A;  3A3I A;  1XA1 A;  4KZ9 A;  4WEJ A;  3PBO A;  1ES4 A;  2A3U A;  4QJG A;  1YM1 A;  1TDG A;  1LLB A;  1LI0 A;  4GD6 A;  4RX2 A;  3S1Y A;  4KG5 A;  5F1G A;  4S2M A;  4R0Q A;  2EXA A;  3UY6 A;  1PI4 A;  4D2O A;  4QY5 A;  4MBF A;  4QY6 A;  4FH4 A;  1KE0 A;  3AGE A;  5FQI A;  4DF6 A;  2EX9 A;  2EFU A;  5JYO A;  1YLJ A;  3IWI A;  3ZVT A;  2VGJ A;  2XH9 A;  3OPR A;  4FCF A;  2XGN A;  3PAE A;  1ESI A;  1BTL A;  5BOH A;  1NYM A;  5GHY A;  1PW1 A;  3G30 A;  4IBR A;  3LO7 A;  1IYP A;  1YLW A;  2JC7 A;  1XGJ A;  1J9M A;  2ZLY A;  3S4X A;  4LCM A;  2ZC3 B;  1ERM A;  3B3X A;  1YMX A;  1FR6 A;  2BG1 A;  1NJ4 A;  4P6B A;  4DDS A;  1N4O A;  1K6S A;  3Q7V A;  2EX8 A;  5DF8 A;  3S22 A;  1CEF A;  1HD8 A;  1I2S A;  2EXB A;  3UDI A;  1IYQ A;  4B4Z A;  2CC1 A;  2RL3 A;  4HEF A;  4ID4 A;  3PBS A;  4S2J A;  4S2O A;  2P9V B;  1L0F A;  5GLC A;  3OPP A;  3UE1 A;  1XXM A;  1H5X A;  3BFD A;  3NY4 A;  2XF3 A;  2Y55 A;  3O3V A;  5A91 A;  3G2Z A;  1GHM A;  3FKW A;  3BFG A;  2C6W B;  1K54 A;  5EOO A;  4Y0T A;  5DTK A;  1H8Z A;  5JYP A;  5CGS A;  1HVB A;  3CMZ A;  4WEL A;  3CG5 A;  5FAQ A;  4KG6 A;  3ZFZ A;  4BEN A;  4JF6 A;  1YQS A;  1PYY A;  3M6B A;  4DE0 A;  1SDE A;  1RGZ A;  1JTD A;  2WYX A;  1IKG A;  3IWQ A;  3IQA A;  3VP0 A;  4UA6 A;  4KZ7 A;  4BD0 A;  5A93 A;  3WS2 A;  1JWV A;  1XP4 A;  2JE5 A;  2X01 A;  4WZ4 A;  3GVB A;  3OZH A;  1MXO A;  2I72 A;  4EBN A;  2V1Z A;  2IWD A;  3ITA A;  4JXW A;  2IWB A;  3ZG0 A;  4OOY A;  4BL3 A;  4DE3 A;  3NDG A;  3UPO A;  1MWT A;  3HLE A;  1W5D A;  2QZ6 A;  4S2N A;  4N9K A;  3LEZ A;  4GD8 A;  1RCJ A;  3AGD A;  2Y2O A;  1I5Q A;  1K6R A;  3UO9 A;  4R1G A;  4P87 A;  3VMA A;  4KZ3 A;  1E4D A;  4MEZ A;  4JXV A;  1BT5 A;  4GN2 A;  5E2G A;  1BZA A;  4ZTK A;  1YLT A;  4BQM A;  4KQR A;  4RVA A;  4NET A;  3FV7 A;  4DKI A;  3UPP A;  3DWZ A;  4RYE A;  4MNR A;  4CJN A;  4N1H A;  1IYO A;  3LY3 A;  2Y2N A;  4H8R A;  3BEC A;  1K55 A;  3HUO A;  1MWS A;  3VSK A;  4X55 A;  3QHY A;  1CI8 A;  1KE4 A;  3E2L A;  3PTE A;  1ONH A;  4WZ5 A;  1K56 A;  3MZD A;  2UWX A;  1PWD A;  3ZG8 B;  3BEB A;  1MBL A;  4JKT A;  4LV0 A;  3NI9 A;  5E2F A;  5CED A;  2QMI A;  1KGG A;  3PBT A;  5FAT A;  1K54 C;  1NY0 A;  4E6X A;  3SH9 A;  1LI9 A;  1JWP A;  5HAP A;  4X6T A;  3C7V A;  4HBT A;  4X56 A;  4PPR A;  3ISG A;  1IEL A;  1DJC A;  3UE0 A;  2C5W B;  3UNW A;  4KG2 A;  1IEM A;  5TGF A;  5FA7 A;  4DRT A;  4X68 A;  4E3O A;  4QU3 A;  2H0Y A;  4WMC A;  2P9V A;  1Z6F A;  2DCF A;  5AQA A;  3GV9 A;  4K91 A;  4OQI A;  3ZHH A;  2ZQA A;  3VFF A;  3A3E A;  4KZ6 A;  3ZG7 B;  2B5R A;  4IVK A;  4OQH A;  2ZC7 A;  3TSG A;  4E3M A;  5TR7 A;  2WAD A;  2XEP A;  3W8K A;  5FQK A;  5HAI A;  5J8X A;  1FCM A;  4OPY A;  4A5R A;  3ZGA B;  1YLY A;  4DXB A;  2H0T A;  4U0X A;  4K0X A;  3VP2 A;  3GQZ A;  1FOF A;  4EBP A;  3IHB A;  2EFX A;  2WGI A;  3LCE A;  1CK3 A;  4PM6 A;  5EOE A;  3BM6 A;  2Y2J A;  4QB8 A;  2ZC5 B;  3VSL A;  5AQ9 A;  3FYZ A;  1SKF A;  4EWF A;  3C4O A;  1AXB A;  1K55 C;  4XUZ A;  3UE3 A;  3TOI A;  2J8Y A;  1BSG A;  4DDY A;  2DRW A;  3GR2 A;  2XLN A;  5G18 A;  3VFH A;  3BRM A;  4PM9 A;  1E3U D;  1FCO A;  2HPB A;  3TG9 A;  1L0D A;  3UDX A;  5DTT A;  3N4I A;  3V39 A;  1NZO A;  3WRT A;  1DY6 A;  1FR1 A;  2Y91 A;  3GTC A;  4FSF A;  4S2P A;  1LL5 A;  1L2S A;  4DE2 A;  1XGI A;  1PW8 A;  4R4S A;  4JLF A;  4LEN A;  4KQQ A;  1WE4 A;  1ZG6 A;  4Y0O A;  1CI9 A;  5FI6 A;  3ZNT A;  4FH2 A;  5FQM A;  5EUA A;  2ZQC A;  4KZ5 A;  4U3T A;  1TVF A;  4U0T A;  4WM9 A;  2V2F F;  3FKV A;  3G31 A;  3NBL A;  2HDS A;  2WZX A;  2HDR A;  3SS5 A;  3ZNY A;  1GA9 A;  1KDS A;  4E3L A;  5E2H A;  5KZH A;  1MKI A;  1C3B A;  3MXS A;  2HP6 A;  2WKH A;  4LV1 A;  3W4P A;  4OQG A;  4C75 A;  3ZG5 A;  3UN7 A;  4N9L A;  5TFQ A;  3HLF A;  4RA7 A;  3IF5 A;  5I94 A;  1JVJ A;  2ZMA A;  3EQV A;  4ZBE A;  3RJU A;  1FSW A;  2VGK A;  2OSU A;  1W7F A;  5E43 A;  1K4F A;  4B4X A;  4IVI A;  4S2L A;  5DF7 A;  3Q82 A;  3BFF A;  1ERO A;  2G2W A;  3NDE A;  4DXC A;  2X02 A;  3ITB A;  1KVM A;  2OV5 A;  4GKU A;  2EX2 A;  3ZVW A;  1RP5 A;  5M19 A;  5FI7 A;  5CTN A;  1O7E A;  2OLU A;  3BFC A;  3HLC A;  5CHU A;  4CPK A;  4GB7 A;  3NIA A;  4PM8 A;  1IKI A;  1L0E A;  2RCX A;  3PBQ A;  4GNU A;  3SH7 A;  4E3J A;  1Q2Q A;  3GMW A;  4ZAM A;  3QNB A;  1E3U A;  1PIO A;  2WGV A;  1IYS A;  1K57 A;  5CER A;  4ZJ1 A;  2WGW A;  4JF4 A;  4MBH A;  4WEK A;  1ESU A;  2ZC4 B;  2DNS A;  4OPR A;  3ZG9 B;  3HVF A;  2Y4A A;  2Q9N A;  4QD4 A;  3MKF A;  2Y2G A;  3N7W A;  1YMS A;  3BLM A;  4OLD A;  3BYD A;  1JTG A;  1EI5 A;  3SH8 A;  1HZO A;  2PU4 A;  3HBR A;  5FAP A;  5FQQ A;  3V5M A;  5KMW A;  1KE3 A;  3VOZ A;  2Y2K A;  1FSY A;  2WUQ A;  2P74 A;  2G2U A;  3RXW A;  3N8S A;  4LV2 A;  5DVA A;  3WRZ A;  2XD1 A;  5GLB A;  3W4Q A;  2XDM A;  1ES3 A;  4KZ4 A;  5DF9 A;  4E6W A;  4X53 A;  4IBX A;  4PMA A;  2JBF A;  3BLS A;  1L0G A;  1Y54 A;  5AQ7 A;  3MXR A;  3V50 A;  4JPM A;  1ALQ A;  5FI2 A;  5GHX A;  3WS0 A;  4OKP A;  4R3B A; 
#chains in the Genus database with same CATH topology
 1H0I A;  3NJA A;  3EOI A;  2EA9 A;  1SCW A;  3M6H A;  4IBE A;  3X1V D;  3O62 D;  4ZJ2 A;  3KYQ A;  2H28 A;  3DAV A;  4OH0 A;  5A92 A;  5F99 B;  3X1T D;  1YLP A;  4UA9 A;  2YFV B;  1Q2P A;  1P3F D;  3HUN A;  5AV9 A;  4R23 A;  2Y8H A;  2L5A A;  1BH9 A;  3WTP C;  2ZY3 A;  4F3L A;  3WS4 A;  3SW1 A;  3AZI A;  4IED A;  5FDH A;  1H8Y A;  3CJM A;  5EVI D;  5B31 G;  2Q0O A;  4ZJ3 A;  3AV1 A;  4GDN A;  1EWZ A;  3H7W A;  1P3O D;  5DNN C;  1KX4 C;  3AZF C;  3G2Y A;  4R70 A;  1YT4 A;  2ARO B;  1MPL A;  1O07 A;  3B6G B;  1E6N A;  2FFY A;  2KOI A;  2QWS A;  2GX5 A;  5AV8 D;  4G91 C;  3A6N A;  3GSG A;  2HDU A;  2OAQ 1;  3WS0 A;  1P3B A;  3UTA D;  1B6W A;  3HSH A;  3LR3 A;  3C2W A;  1T1C A;  3IHA A;  3HL9 A;  4NXE A;  5LBR A;  2Y2M A;  2VGL M;  2FJ7 D;  1NZU A;  2HJE A;  1IOU A;  4KZA A;  3REI A;  3SOI A;  4NXF A;  3C1C B;  4DE1 A;  5CGX A;  5TBM B;  3WS5 A;  4HJ6 A;  1IFQ A;  4Q8I A;  4WU8 D;  3VH5 T;  3B6F A;  2K7S A;  3NC8 A;  1VEU A;  2F8N H;  1HQ3 D;  3REK A;  3MFD A;  5CGW A;  2WAF A;  2QPN A;  4DJ2 A;  3T50 A;  2XR0 A;  5FSR A;  4HY8 A;  3SS4 A;  2PHY A;  4ZRR A;  1M1A C;  4Q0H A;  5DNM A;  3N6I A;  1G6O A;  2HZ5 A;  3LZ1 D;  1SHV A;  5HDC A;  2YFV A;  1E25 A;  1FIK A;  5B0Z C;  4Z1W A;  3HLB A;  3LEL B;  2JCH A;  5E5A C;  4J8W C;  4WU9 A;  1BLP A;  1ONG A;  4J8X B;  3A3D A;  4HHD A;  3Q7V B;  1NRF A;  4OP5 A;  1W79 A;  4PM7 A;  2R9X A;  3G34 A;  2BTF P;  5B2J B;  3SZT A;  4J8U A;  3V9R B;  3MZF A;  3MMH A;  1JFI B;  3R7W A;  4OOL A;  3KUY C;  3B6G A;  5HFO A;  3LJA A;  3VP1 A;  3CUE C;  2ZQ9 A;  4I3J A;  5EV0 A;  4EES A;  2ZD8 A;  4XZQ B;  2Z2M B;  2LB9 A;  3IT9 A;  3KWQ D;  3AZN A;  5A90 A;  5CRF A;  2EWW A;  4R4R A;  1PI5 A;  4S2K A;  4HIA A;  3WX7 A;  4Z2H A;  1MY8 A;  1BYW A;  3VH6 A;  4QHC A;  1F9I A;  3C5A A;  4N1X A;  1U35 A;  2D01 A;  4E3I A;  5CPI D;  1W8Q A;  1JWZ A;  2IO5 C;  4I3A A;  5DTS A;  4WYY A;  3A3F A;  4WNN B;  1NYY A;  4N92 A;  1OT6 A;  1F1E A;  3IF6 C;  3MNN D;  4Y0U A;  4M6B A;  4G92 B;  3C1C A;  3AZH B;  5F82 A;  3AZM A;  5F6A A;  1M19 C;  5JA4 B;  3OC2 A;  3W4O A;  5KIZ A;  2M1C A;  2ZBB A;  1QME A;  3DWK A;  3P01 A;  1KX3 A;  1KX5 A;  3MGP D;  2JHE A;  5F68 A;  5JYO A;  5B32 D;  3AZK A;  4WEJ A;  1XA1 A;  4Y2F A;  4X1L A;  1BH8 B;  2A3U A;  4RX2 A;  5A8B A;  4KG5 A;  5B2I B;  2EXA A;  1OPX A;  3UY6 A;  1M18 C;  4H9S A;  2VLG A;  1S1Y A;  4MBF A;  1P3L B;  4Z66 D;  4RQ9 A;  4DF6 A;  3AFA B;  3IWI A;  5CPJ A;  3ZVT A;  3AL0 C;  2XGN A;  4Z2J A;  3TU4 D;  2HIO D;  3WA9 B;  1PW1 A;  4EQ1 A;  3F1N A;  4QLC C;  4YS3 D;  4IBR A;  1IYP A;  5B40 D;  4YM6 C;  3LEL A;  3AYW A;  2OAP 1;  1CXW A;  3KS4 A;  4CQH A;  3B3X A;  1ERM A;  1FR6 A;  4HJ3 A;  4DDS A;  5GT3 D;  3Q7V A;  5HWT A;  1CEF A;  5F99 D;  4XUJ B;  3U2A A;  2CC1 A;  5B2J A;  4ID4 A;  4LRX C;  5GLC A;  1H3Q A;  2NQB C;  4IBJ A;  2D02 A;  4O01 A;  4Z5T B;  4NE6 A;  5CGS A;  1PZR A;  5FAQ A;  5BS7 A;  1YQS A;  3DBA A;  1TD5 A;  1YU1 A;  3VE4 A;  2ARO D;  1UR9 A;  3IWQ A;  3UME A;  3C38 A;  3MFX A;  3VP0 A;  4BD0 A;  2YFW A;  5AVB B;  1XP4 A;  1KU5 A;  4NKP A;  5AVC C;  3W96 D;  4KHA B;  3REJ D;  2V1Z A;  4JXW A;  2IWB A;  3UE6 A;  4OOY A;  4DE3 A;  3AZE B;  4IBC A;  3UPO A;  1MWT A;  4Z2L A;  3HLE A;  4NE5 A;  1W5D A;  4GD8 A;  1I5Q A;  3IP4 C;  3UO9 A;  4R1G A;  1T19 A;  1E4D A;  3FPW A;  3W98 D;  4GN2 A;  3AZG A;  1YLT A;  4BQM A;  4RVA A;  4Y15 A;  3KXB D;  4CLC E;  3FV7 A;  4DKI A;  3UPP A;  4R8P D;  3LR5 A;  4WN5 A;  3AV2 B;  1S4R A;  4NFT A;  3LY3 A;  4ETX A;  5B2I A;  3BEC A;  1K55 A;  4NZ4 A;  1JNU A;  3HUO A;  4Y17 A;  3X1S B;  4X55 A;  2A2L A;  5KDM B;  1F2K A;  1KE4 A;  3PR6 A;  3X1V C;  3O62 C;  2PD8 A;  5HD3 A;  4LD9 B;  3TW8 A;  5GT0 B;  3MZD A;  2UWX A;  2NZD B;  1L3L A;  3WA9 A;  4R6L A;  1P3M B;  3WKJ A;  1P3F C;  5GXQ D;  1GSW A;  1X0O A;  3NI9 A;  1OT9 A;  3LIC A;  3VH5 W;  5B0Y D;  3E4Q A;  2ZOI A;  2VJW A;  4JJN A;  1STZ A;  3C7V A;  4HBT A;  5B24 B;  2PDR A;  2W3F A;  4X56 A;  1P3O C;  3MGS A;  5TGF A;  2ZY4 A;  3LID A;  4E3O A;  4QU3 A;  2H0Y A;  4WMC A;  1Z6F A;  3A0S A;  4K91 A;  3B0C T;  2KX6 A;  3VFF A;  2W3E A;  4Z5T A;  1P3K B;  3TSG A;  2VV7 A;  5TR7 A;  5AY8 A;  5CPK A;  2XEP A;  4ESP A;  2W1T A;  1P3G B;  3UTA C;  5HAI A;  1FCM A;  3NQU B;  2O99 A;  3C30 A;  3DTE A;  4U0X A;  4K0X A;  2EFX A;  2FJ7 C;  4KGC A;  5B1M A;  3TE8 A;  3V67 A;  2JN7 A;  3FYZ A;  5HPI A;  4XUZ A;  4HI4 A;  5AV6 C;  4WU8 C;  5G18 A;  1P3P B;  1D1J A;  4IUK A;  5E5A A;  1E3U D;  1E15 A;  3D3O A;  3T1R A;  1HQ3 C;  3AZH D;  4IJG A;  3V39 A;  2EWV A;  1NZO A;  3E4O A;  4MN6 A;  3GTC A;  3QP2 A;  4FSF A;  4S2P A;  3AV2 A;  1LL5 A;  3E98 A;  4NEE D;  4OJP A;  1H8M A;  1OTB A;  3W99 A;  4NZ5 A;  4WLA A;  1CI9 A;  1ZLA B;  5FI6 A;  5KDM A;  5EFW A;  4KZ5 A;  4MMN A;  3IS2 B;  1KS0 A;  1YKD A;  4WM9 A;  4LD9 A;  2V2F F;  4UQI M;  3G31 A;  3LZ1 C;  2WZX A;  1S32 D;  4ARZ B;  1GA9 A;  4E3L A;  1MKI A;  4LV1 A;  2LB5 A;  4HP9 A;  4C75 A;  1P3L D;  3AFA D;  1JVJ A;  3EQV A;  4ZBE A;  4FTX A;  1FSW A;  1TS6 A;  1P3A B;  2VGK A;  1W7F A;  2RVQ D;  4B4X A;  4S2L A;  3BFF A;  4B9O A;  3DTK A;  2QHK A;  4E44 A;  3HLC A;  4CPK A;  4QNL A;  1IKI A;  3NUL A;  5L09 A;  1P3K A;  4L9G A;  3X1U A;  3KWQ C;  2B02 A;  3T1Q B;  1P9R A;  4E3J A;  4ZAM A;  2WGV A;  1PIO A;  3B0B A;  1IYS A;  3EEH A;  1K57 A;  5CER A;  1P3G A;  4ZJ1 A;  4WEK A;  1ESU A;  5CPI C;  3K3D A;  4OPR A;  3ZG9 B;  2F8N B;  1JTG A;  1VET A;  3P7N A;  1EI5 A;  3MNN C;  5DFY A;  2I9V A;  5FQQ A;  1KE3 A;  3FDD A;  2WUQ A;  4JGR A;  1EAK A;  5DVA A;  3WRZ A;  2V8F A;  5AVB D;  1ES3 A;  4KZ4 A;  5JRG B;  4E6W A;  4IBX A;  1P3P A;  5AQ7 A;  3MGP C;  5B32 C;  1YSQ A;  4H6J A;  5AV5 B;  4GHI B;  5CP6 D;  4NZ3 A;  5GHZ A;  5B1L A;  4BL2 A;  4WV4 B;  5IU1 A;  1AOI D;  4Z66 C;  2ZM2 A;  4CSR B;  2FH5 A;  2CMN A;  4S2N C;  4UEY A;  4BWI A;  3BW6 A;  5MC7 A;  1MWR A;  2DMW A;  3IS2 A;  4LFU A;  2G5H C;  4BD1 A;  2ZM0 A;  2O9B A;  3KX0 X;  3TU4 C;  1BLS A;  2WGW B;  2HIO C;  3LIB A;  4ARZ A;  4JXG A;  4YS3 C;  3JYI A;  4WBG A;  3T4O A;  3UTB A;  5B40 C;  1RGY A;  2XD5 A;  3H82 B;  3X1S D;  3IXG A;  4EUV A;  3C1B D;  2Y2H A;  1KVL A;  5BPV A;  4X23 D;  5FAO A;  5G49 B;  3L27 A;  1I2W A;  1MZU A;  2B18 A;  5GT3 C;  4EO5 B;  1ID3 D;  5TJJ A;  5F99 C;  2V9A A;  3MQ0 A;  1ES2 A;  1S66 L;  3T4L A;  1TZY B;  1BLC A;  1PWC A;  2W3D A;  4R3J A;  2VK3 A;  4OP8 A;  4S2I A;  3REH B;  2VV6 A;  3MVD B;  2XFT A;  5KSC A;  4E3K A;  3MJQ A;  4EV4 A;  4M3K A;  1K38 A;  1OME A;  4KZB A;  1NRJ A;  1F66 D;  3MXQ A;  2ARO C;  5FAS A;  2GNX A;  3VOY A;  3AGF A;  3OPH A;  4ZBJ B;  3W96 C;  3REJ C;  3X1V A;  4UHU A;  1BH9 B;  1V9Z A;  1ZKJ A;  3IBR A;  3KYE A;  3X1T A;  5HW3 A;  4Y3I A;  3B0C W;  3W98 C;  2W0N A;  3Q7Z A;  5CHL B;  5D3O A;  1DJA A;  3G32 A;  4PKY A;  2VQR A;  1OGB A;  4GH9 A;  5F69 A;  3KXB C;  1BLH A;  3UT9 D;  5EVI A;  5AV5 A;  4BLM A;  4R8P C;  5G4Z A;  5BT1 D;  1P3O A;  4XXR A;  2JKT M;  3V3R A;  3G35 A;  2V20 A;  4OVD A;  4HGA B;  5IHV A;  1LL9 A;  4MCW A;  3A6N B;  3EG5 B;  5B33 D;  2BLS A;  3LYX A;  4PM5 A;  5F1F A;  3WD0 A;  2P7J A;  3T4K A;  5HAQ A;  1P3B B;  4CSR A;  4KZ8 A;  5AV8 A;  4G3K A;  3QP1 A;  4UA7 A;  4Y5F A;  5B31 B;  5GXQ C;  1VM1 A;  1M6K A;  4MBK A;  1ZLA D;  2PYO D;  3REI B;  3CPT A;  5B0Y C;  3UPN A;  1XJ4 A;  1KGF A;  2J9P A;  2Y2Q A;  4BJP A;  1BUL A;  4M4X A;  1VQQ A;  4H9P B;  4E3N A;  3NOU C;  3B6F B;  4YFM A;  3NEC A;  1VEU B;  1TZY A;  3MGQ D;  2EX6 A;  3L9K A;  1HTZ A;  3LI9 A;  3REK B;  2B95 A;  1WYC A;  3QNC A;  1P3A D;  4P85 A;  4B93 A;  4EBL A;  1AWI A;  2PBY A;  3REH A;  5EE8 A;  3QP6 A;  2ZL1 B;  3VH6 W;  3WS1 A;  3M2K A;  3PBN A;  1HQ3 A;  3O88 A;  2M7U A;  3W2Z A;  2ZM8 A;  1PZO A;  2OLV A;  2Y59 A;  5DNM B;  4MB3 A;  4GJ4 A;  4R3A A;  2D49 A;  3GEC A;  2WK0 A;  4O7D A;  3O86 A;  4O8G A;  1GCE A;  1NLZ A;  3O5Y A;  1EQZ D;  3WWX A;  1MC0 A;  1GHI A;  4YIN A;  3EPK A;  4K0W A;  4HES A;  2Y2P A;  1BUE A;  5F5Y A;  4WU9 B;  2KLI A;  2ZY2 A;  2JKT I;  3OCL A;  3OPL A;  3UB6 A;  3VE3 A;  3CI6 A;  3O87 A;  3RXX A;  1S6R A;  3C4P A;  2Q9M A;  3HLD A;  2JKG A;  3A3I A;  1U60 A;  4KZ9 A;  4J8U B;  3PBO A;  1YM1 A;  1TDG A;  3AZH C;  4AWL B;  1LLB A;  3R7W B;  3S1Y A;  4IHQ A;  4KQD A;  3LJA B;  4IBF A;  5JRG D;  4FH4 A;  5FQI A;  4H9R A;  3AZN B;  2EX9 A;  2M7V A;  4ZUX B;  3REL B;  2RTS A;  2VGJ A;  4PAU A;  3PAE A;  3CWF A;  4QWO A;  5BOH A;  1U35 B;  5GHY A;  4GLQ A;  3KWQ A;  3G30 A;  1DP9 A;  4HH2 A;  4KUD D;  3WD3 A;  2W8S A;  3H0R C;  1S32 C;  5B31 A;  4EER A;  2JC7 A;  5B32 G;  4J8V D;  3S4X A;  1YU3 A;  1P3L C;  4LCM A;  2ZOH A;  3AZL B;  5CPI A;  3AFA C;  1UGU A;  5FUG B;  1NJ4 A;  3W97 A;  4P6B A;  5FEF A;  1T1B A;  3AZM B;  2EXB A;  4B4Z A;  2RVQ C;  1IYQ A;  2PD7 A;  3E4P A;  4H9P A;  4HEF A;  4S2J A;  5AV6 D;  4S2O A;  2P9V B;  3OPP A;  3UE1 A;  1H5X A;  5I5L A;  1KX3 B;  1KX5 B;  3AZJ D;  1WWS A;  2Y55 A;  3O3V A;  2JKR M;  3AZK B;  2C6W B;  4Y0T A;  1HVB A;  3UB9 A;  4XUJ C;  2XRN A;  2ZL1 A;  4DE0 A;  2UV0 E;  2FN2 A;  3IQA A;  5HWV A;  3MGR D;  5A93 A;  5GSU D;  4NYY A;  1JWV A;  5CPJ B;  2R78 A;  2PRF A;  2JE5 A;  3BQ8 A;  1LSV A;  3GVB A;  4D60 A;  2HGV A;  4BL3 A;  4CLC B;  5DJU A;  3F1N B;  4WF0 A;  3QP5 A;  3NDG A;  4S2N A;  1GXD A;  3LEZ A;  4MN7 A;  3AYW B;  1K6R A;  3CAX A;  1BT5 A;  5AVB C;  5E2G A;  3AN2 A;  4WL9 A;  5AV9 D;  3DWZ A;  3LZ0 D;  1EW0 A;  4BBU A;  5CP6 C;  1OTE A;  4N1H A;  2O9C A;  3AZI D;  2Y2N A;  3WD2 A;  2DF4 C;  3AV1 D;  1MWS A;  1AOI C;  4ZUX A;  4DRA A;  3REL A;  2CV5 B;  1ONH A;  4IJE A;  1K56 A;  1PWD A;  1D7E A;  3BEB A;  4H9N A;  3C8C A;  2YFW B;  3PXP A;  3DTI A;  5FAT A;  1K54 C;  4FOF A;  3X1S C;  4QPR A;  3C1B C;  1LI9 A;  2JKR I;  1W63 M;  3AZL A;  5HAP A;  4X23 C;  5FUG A;  3ISG A;  3UE0 A;  2C5W B;  5GT0 C;  4DRT A;  5FA7 A;  1ID3 C;  1G28 A;  3W96 A;  2P9V A;  1BFM A;  1A7W A;  3GV9 A;  3AZG B;  3A3E A;  3WAA A;  3REI D;  2B5R A;  5J3W A;  3LIF A;  1Z2C B;  5B24 C;  3W98 A;  5EM0 A;  1KX4 B;  3AZF B;  4EEU A;  3B6F D;  3L28 A;  1F66 C;  4OPY A;  2HUE C;  4R8P A;  3GQZ A;  4UUZ A;  5DKK A;  4G91 B;  5G4Y A;  3BM6 A;  4CLC A;  2Y2J A;  3WKJ B;  2DQN C;  2LY8 A;  1ED7 A;  4GS9 A;  3CIT A;  3TOI A;  1BSG A;  5DNM D;  4X25 A;  4JJN B;  3K3C A;  1ZTU A;  5GXQ A;  3TG9 A;  4JGO A;  3MGS B;  1L0D A;  4LRY C;  3B42 A;  3UT9 C;  1DY6 A;  2Y91 A;  1B67 A;  4P6Z S;  3WD4 A;  5BT1 C;  4DE2 A;  1XGI A;  4KQQ A;  2PBD P;  1ZG6 A;  1P3I A;  5AY8 B;  5CPK B;  4FH2 A;  5B33 C;  2FZ0 A;  1TVF A;  2W1T B;  2CV5 A;  1ZHH B;  4EU0 A;  5HPF A;  3B6G D;  1XJ2 A;  1H8P A;  1KDS A;  4IBB A;  1P34 A;  1C3B A;  3AZN D;  4I5S A;  5TFQ A;  4KGC B;  4HNB A;  4RA7 A;  1ZLA C;  1LSW A;  5B1M B;  2PYO C;  4NYU A;  2W27 A;  2ZMA A;  5L8M A;  5E43 A;  5DF7 A;  1U35 D;  1J7M A;  3R4K A;  3MQO A;  3ITB A;  4GKU A;  5M19 A;  5FI7 A;  5CTN A;  3F1P A;  1XFQ A;  2OLU A;  1TS8 A;  4GB7 A;  5E5A B;  4PM8 A;  3WTP A;  4J8W B;  1OGG A;  3MGQ C;  4HOI A;  3PBQ A;  1CQA A;  4GNU A;  3SH7 A;  1XJ3 A;  3C1C D;  1P3A C;  3QNB A;  1E3U A;  5DNN A;  4Y13 A;  3UB8 A;  1KX4 A;  3AZF A;  2K2N A;  1KX3 D;  3W99 B;  4JF4 A;  4OJO A;  3AZK D;  3HON A;  2Y2G A;  3N7W A;  1YMS A;  2PU4 A;  4HP4 A;  5FAP A;  3V5M A;  5KMW A;  3VOZ A;  1FSY A;  1EQZ C;  4L9F A;  3IX4 A;  2P74 A;  5HL6 A;  3S7O A;  2IO5 B;  5CPJ D;  2HF6 A;  1CJF A;  1S32 A;  4Z2G A;  2PYP A;  2GJ3 A;  3V50 A;  3N3F A;  5GHX A;  3S7P A;  3LEL D;  4OKP A;  4R3B A;  3CHW P;  1SDN A;  1XFN A;  2FFF B;  3PBR A;  4J8X D;  3IXB A;  3IBJ A;  5JRG C;  4L9E A;  5CHJ A;  3FC7 A;  3IH9 A;  4P0M A;  3X1U B;  1P0Z A;  5B2J D;  1W8Y A;  3H0M C;  5CHM A;  4O0P A;  5C3I B;  1ERQ A;  1FCN A;  3BFE A;  2J3T D;  1N9B A;  2E8J A;  4OPZ A;  4KUD C;  4EQI A;  1M18 B;  3WTP E;  3CLO A;  2RIQ A;  4XZQ D;  1S0W A;  1VET B;  2R9W A;  4J8V C;  3NCK A;  3C7U A;  1T1A A;  2ZQ7 A;  4LCL A;  1M1A A;  3HLW A;  3EPJ A;  3S7Q A;  4IBD A;  4QLC B;  2ZM5 A;  4RX3 A;  1XA7 A;  2V1A A;  4UPK A;  5B0Z A;  3EQU A;  3AZJ C;  3P5J B;  1GSV A;  4J8W A;  5HDS A;  4WZ5 C;  3EEA A;  4FD8 A;  3Q1F A;  4H6J B;  1LL8 A;  5M1A A;  1MWU A;  3A1I A;  2VGL S;  4II7 A;  1J3W A;  4EO5 C;  5B1L B;  4C6Y A;  4OJ5 A;  1G68 A;  2ZC6 B;  5HL1 A;  3D4F A;  3T12 B;  3AZG D;  3BWL A;  3KUY A;  1ZG4 A;  3MGR C;  3KSH A;  5GSU C;  3L29 A;  3LR4 A;  3CUE A;  2XK1 A;  2WAE A;  5CEC A;  4XUX A;  2WKQ A;  3MVD C;  1Y4O A;  2J80 A;  1AOI A;  5B2I D;  4NZ1 A;  3UTB B;  3IH8 A;  5DJT A;  2AVX A;  1PZP A;  1PWG A;  3EGX C;  3G4P A;  3MBZ A;  3P98 A;  3EPL A;  3P09 A;  5AVC B;  3IF6 A;  1OTD A;  5CX7 A;  3WA9 D;  2QKP A;  4JGQ A;  1G6A A;  3WKJ D;  4X23 A;  4H9Q B;  5AV9 C;  4G3V A;  4OOM A;  3Q07 A;  1SZV A;  3LZ0 C;  3FZC A;  4XT2 B;  1M19 A;  5FQJ A;  1ID3 A;  1YAX A;  3AZI C;  3MKE A;  3BY9 A;  2E8I A;  3AV1 C;  3MGS D;  4XUJ D;  1DRM A;  3MZE A;  3HUM A;  4WMC D;  5EEC A;  1V9Y A;  5HAR A;  4G3W A;  1TAF A;  2O9A A;  4Z5T D;  4NK3 A;  1M18 A;  5BO0 B;  1OJG A;  2HDQ A;  2W3H A;  5AY8 D;  5CPK D;  5EM1 A;  3A6N C;  3GRJ A;  5CXW A;  4GOG A;  2JKF A;  3X1V B;  3IWO A;  3A0R A;  1P9W A;  3F6T A;  3CZD A;  3IXH A;  3X1T B;  4WUJ A;  4QLC A;  1M40 A;  4B88 A;  1P3F B;  2WKI A;  4KGC D;  4YM6 A;  3REI C;  2Y2I A;  4MDZ A;  4MN5 A;  4JXS A;  3AZE D;  3IXD A;  5EVI B;  1P3O B;  3B6F C;  3UT9 A;  4E04 A;  4E45 A;  3HCY A;  2NQB A;  1YLZ A;  4LLO B;  3N8R A;  1MKM A;  4BBT A;  5AV8 B;  4H9O A;  5B33 A;  3AV2 D;  1KDW A;  2ZQ8 A;  2HP5 A;  3W99 D;  2PU2 A;  3LY4 A;  4EEP A;  4F94 A;  1TF1 A;  3CPT B;  5DNM C;  3LGO A;  5U47 A;  1WWI A;  4L0L A;  1K4E A;  4IBK A;  1A0K A;  1NXY A;  4GZB A;  4C3Q A;  4LD9 D;  2GDN A;  5GT0 D;  2PYO A;  2NZD D;  5AVC A;  1ES4 A;  4QJG A;  1DP8 A;  5L07 A;  1P3M D;  1W63 Q;  2VX8 A;  2L1M A;  4TX8 A;  1N1J A;  4H9Q A;  4GD6 A;  5EVE A;  2V0U A;  4R0Q A;  3T4T A;  4XT2 A;  5IT5 A;  2V5O A;  4QY5 A;  4QY6 A;  4HMD A;  4WU8 B;  1KE0 A;  5B24 D;  1YLJ A;  2XH9 A;  2WKP A;  3QP4 A;  1UWN X;  1ESI A;  1HQ3 B;  4I3I A;  3B6G C;  1P97 A;  1YLW A;  4YWZ A;  1P3K D;  5BO0 A;  3X1U D;  3AZN C;  1YMX A;  2BG1 A;  1N4O A;  1K6S A;  2EX8 A;  4YNR A;  1I2S A;  3O62 A;  1P3G D;  4MB4 A;  3QP8 A;  1U35 C;  1L0F A;  1XXM A;  3BFD A;  1P3F A;  3H9W A;  3K2N A;  3G2Z A;  1GHM A;  4WZS B;  3T1X A;  2XRO A;  4NG2 A;  5DTK A;  5JYP A;  3CMZ A;  4WEL A;  3C1C C;  1ACF A;  5BNV A;  1Z09 A;  4BEN A;  4OJL A;  4GHA A;  1PNE A;  4JF6 A;  3M6B A;  1RGZ A;  1IKG A;  4H9R B;  1KX3 C;  1P3P D;  4KZ7 A;  2MJ6 A;  4UA6 A;  3WS2 A;  2VA0 A;  3B47 A;  3AZK C;  2V8C A;  2X01 A;  4WZ4 A;  3ITA A;  1K0K A;  3A1K A;  3ZG0 A;  3KWQ B;  2VV8 A;  5B1L D;  1E8B A;  4N9K A;  4H9S C;  1RCJ A;  3AGD A;  3UTA A;  4KZ3 A;  4MEZ A;  5CPI B;  1KOU A;  2Y79 A;  4KUD A;  3W97 B;  5CPJ C;  3LIA A;  1BZA A;  4ZTK A;  4KQR A;  4I39 A;  2FJ7 A;  3L7H A;  3MNN B;  1XJ6 A;  3UTB D;  4RYE A;  4YOF A;  3EGD C;  4CJN A;  3LEL C;  4HQA A;  4MB5 A;  5AV6 A;  4J8X C;  4WU8 A;  2PR5 A;  4Z2K A;  3AZJ A;  3E2L A;  5B2J C;  4WZ5 A;  3ZG8 B;  1F5M A;  4JKT A;  4LV0 A;  5E2F A;  5CED A;  2J3T C;  3JVU A;  2QMI A;  1ULY A;  3PBT A;  1W2E A;  2XA7 M;  1NY0 A;  4XZQ C;  3SH9 A;  1JWP A;  4X6T A;  4Z66 B;  2QYB A;  4PPR A;  2XSS A;  5BS7 C;  1DJC A;  2INW A;  1IEM A;  4DQY B;  3TU4 B;  2V0W A;  2HIO B;  3D72 A;  5BNX B;  3LZ1 A;  1T18 A;  4YS3 B;  2F8N D;  2ZQA A;  1OJ5 A;  5B40 B;  3AN2 B;  4KZ6 A;  4IVK A;  3B0D B;  1CF0 A;  4E3M A;  4G92 C;  2L4R A;  2WAD A;  5GT3 B;  2JSS A;  5FQK A;  3S7N A;  3LI8 A;  1YLY A;  4KUK A;  3LZ0 A;  2H0T A;  3VP2 A;  3AZG C;  1H3O A;  2VKS A;  3IHB A;  2WGI A;  1CK3 A;  1TS0 A;  4PM6 A;  4HH3 A;  4X1M A;  5AV5 D;  3MSH A;  5EOE A;  4QB8 A;  4H9N B;  5L10 A;  3VSL A;  5B2I C;  1SKF A;  3C4O A;  1AXB A;  1K55 C;  2BAS A;  2XLN A;  3VFH A;  3BRM A;  4PM9 A;  1FCO A;  2HPB A;  2ZY5 A;  3UDX A;  3MNN A;  3W96 B;  3WA9 C;  3REJ B;  4IUH A;  3WKJ C;  3IX3 A;  2QJ5 A;  2BYK A;  4CAY B;  3WAA B;  4R4S A;  4JLF A;  4LEN A;  4UQI S;  3NQJ A;  5C5K A;  1WE4 A;  1S4S A;  4JJN C;  4K08 A;  3ZNT A;  3W98 B;  1E6R A;  5EUA A;  2ZQC A;  3MGS C;  3KS8 A;  4U0T A;  3MGP A;  5B32 A;  3KXB B;  3NBL A;  3SS5 A;  2HDS A;  3ULF A;  1TZY D;  4R8P B;  4ME4 A;  2HP6 A;  4UUZ B;  3ZG5 A;  3HLF A;  4Z5T C;  2K31 A;  3REH D;  5I94 A;  3VV4 A;  3RJU A;  5AY8 C;  3MVD D;  5CPK C;  4Z66 A;  1K4F A;  4IVI A;  1ERO A;  2G2W A;  4GS9 B;  4DXC A;  3ZVW A;  1KVM A;  3HJI A;  1RP5 A;  1CK7 A;  3TU4 A;  2HIO A;  5BNX A;  1LT0 A;  4AFI A;  4YS3 A;  1OTI A;  3NIA A;  5GXQ B;  3EPH A;  4EW7 A;  1GPF A;  5B40 A;  4KGC C;  4GHL A;  5B1M C;  2OWJ A;  3MQL A;  5B0Y B;  4HJ4 A;  1Q2Q A;  2NUP C;  3AZE C;  5J7E A;  5GT3 A;  4HMC A;  5F99 A;  4MBH A;  1P3I B;  3HVF A;  2Q9N A;  3FKE A;  4Z2M H;  3SH8 A;  1HZO A;  2P08 A;  2ZMV A;  1P34 B;  3NOP C;  3AV2 C;  4Q0J A;  3N8S A;  3W99 C;  1S67 L;  4LV2 A;  2P04 A;  3A6N D;  2ARO A;  2W1R A;  2XDM A;  1WA9 A;  5DF9 A;  4PMA A;  1P3B D;  3T4S A;  1L0G A;  3BLS A;  3MXR A;  1HLU P;  4LD9 C;  1H0M A;  2NZD C;  3MR0 A;  2O0Y A;  5B31 D;  3F1P B;  3REJ A;  4GCZ A;  3MS6 A;  1P3M C;  4DRB A;  3WTP B;  4CAY A;  1E6P A;  1OTA A;  4KQO A;  3R45 B;  2F2A C;  3W97 D;  3DTM A;  1TEM A;  2BYM B;  1TS7 A;  2PT7 A;  3E2K A;  4Z2I A;  3V3S A;  5DNN B;  1O6I A;  4BMW A;  2Y2L A;  2J9O A;  5FQ9 A;  2NUT C;  3KXB A;  4LGW A;  2YKF A;  2J8P A;  5GL9 A;  3FG8 A;  1K25 A;  5CEB A;  5GLA A;  5TBM A;  2G5I C;  3REK D;  1W1T A;  1P3K C;  3HRE A;  2L0W A;  3X1U C;  1NWZ A;  1GA0 A;  1K57 C;  3RTY A;  1P3G C;  3LUQ A;  5C3I C;  2XFS A;  3ZDJ A;  4IJF A;  4Z9Q A;  1S32 B;  4OQ0 A;  4Y7P A;  1PDC A;  3ZCZ A;  4X69 A;  1YPR A;  2HV1 A;  5B0Y A;  2WKE A;  4DJ3 A;  2Z2L B;  4I38 A;  3UDF A;  1XX2 A;  5EVL A;  4WU9 D;  3I7J A;  1FQG A;  1SKO B;  3OLO A;  3AN2 D;  1P3P C;  3M2J A;  4UAA A;  1TDL A;  4J8U D;  4J8X A;  3EWK A;  5EPH A;  5E2E A;  2ZJ9 A;  5B1L C;  3LJA D;  3VP4 A;  4OLG A;  2IOU A;  3DW0 A;  3V9R A;  3ZYT A;  1JFI A;  4ZUX D;  3REL D;  3VOL A;  5FEG A;  1M1A B;  4MLL A;  1K56 D;  2GZA A;  4XZQ A;  1KGE A;  2WZZ A;  3FPV A;  3OCN A;  5HZH A;  2ZQD A;  2H5S A;  5KSH A;  4OPQ A;  3UTB C;  5GLD A;  5B0Z B;  5CTM A;  3T4J A;  4OUI A;  4ETZ A;  3R45 A;  3AZL D;  2X71 A;  4Q0I A;  4WNN A;  3AZM D;  3LIE A;  2BYM A;  2HP9 A;  5F83 A;  4JBF A;  4IBG A;  3A0V A;  3N8L A;  1YUE A;  5AJG A;  2V1B A;  3AZH A;  1KX5 D;  4EUZ A;  5CP6 B;  3WAA D;  4OON A;  2H10 A;  3KUY B;  1XPB A;  1GHP A;  2PAV P;  5JA4 A;  3KO6 A;  4JF5 A;  2WKR A;  2ZMF A;  3LFV A;  4LRZ E;  1AOI B;  4KEN B;  3WRT A;  1PRQ A;  1WYB A;  4NE3 A;  2Z6D A;  1DJB A;  3FWL A;  5M18 A;  1AIW A;  1BH8 A;  3L26 A;  1E6Z A;  5DFX A;  3SS3 A;  3OBF A;  2VEA A;  1CEG A;  2A24 B;  4HBU A;  3Q81 A;  3RH8 B;  3IF6 B;  1P3L A;  3UMD A;  4CLC D;  3C1B B;  3A3J A;  4EET B;  3AFA A;  4X23 B;  5HSQ A;  1GSX A;  2XA7 S;  2J7V A;  3AYW D;  3U4L P;  1H0G A;  1M19 B;  1Y28 A;  1ID3 B;  3X1T C;  2ACG A;  1Q9C A;  2IWC A;  1ZC2 A;  1QMF A;  1SKO A;  2YKH A;  2A49 A;  3MQQ A;  4GDB A;  3E0Y A;  3GDI A;  5HDD A;  5EVI C;  5AV5 C;  1XKZ A;  3VP3 A;  5L2F A;  2IA2 A;  4XUJ A;  4LV3 A;  1TAF B;  3HLG A;  1LHY A;  1P3I D;  1F66 B;  2HUE B;  4OJ6 A;  1N9N A;  3PAG A;  2OOL A;  3KYZ A;  1ES5 A;  2CV5 D;  3PYP A;  5AQB A;  3RFB A;  4ZDX A;  4LPZ A;  5HX9 A;  2XQZ A;  5AV8 C;  3F1O B;  4JGP A;  1P34 D;  1LI0 A;  2QJ7 A;  5F1G A;  4S2M A;  4YM6 B;  1PI4 A;  4D2O A;  3AGE A;  2PR6 A;  3LEQ A;  2EFU A;  2HJ9 C;  5AVB A;  3OPR A;  4FCF A;  3JPU A;  3D9Y A;  1BTL A;  1ODV A;  4KHA A;  1NYM A;  1D06 A;  3AZE A;  3UT9 B;  3LO7 A;  3G6O A;  3NOT C;  3WTP D;  5CP6 A;  1TZY C;  2NQB B;  3PHY A;  1XGJ A;  1J9M A;  2ZLY A;  2ZC3 B;  4H9O B;  3REH C;  5DNN D;  5B33 B;  4IBI A;  5DF8 A;  1KX4 D;  3AZF D;  3S22 A;  1HD8 A;  4DN0 A;  3UDI A;  3T1S A;  2RL3 A;  3PBS A;  5FL3 A;  3NY4 A;  2XF3 A;  2A24 A;  5A91 A;  3FKW A;  1UWP X;  5K5B A;  2OWH A;  5AVF A;  4ZBJ C;  3BFG A;  3KSF A;  1K54 A;  2PYO B;  1FIL A;  5EOO A;  1UR8 A;  3X1S A;  1H8Z A;  3C1B A;  3CG5 A;  1N1J B;  4KG6 A;  3ZFZ A;  3VH6 T;  1PYY A;  5GT0 A;  3JVV A;  1SDE A;  2W3G A;  2NZD A;  2F8N K;  1W1Y A;  1JTD A;  2WYX A;  4NXB A;  4JJN D;  1P3M A;  4KUO A;  3MGQ B;  3OZH A;  4LG2 A;  1MXO A;  2I72 A;  4EBN A;  2IWD A;  4DMZ A;  1VB6 A;  5B24 A;  4NY2 A;  2QZ6 A;  2Y2O A;  4HGA C;  1F66 A;  4P87 A;  3VMA A;  4JXV A;  4FUW A;  3O62 B;  1P3B C;  4NET A;  3F1O A;  1EQZ B;  5B31 C;  4MNR A;  1YU4 A;  1IYO A;  2PYR A;  4H8R A;  4WJ3 C;  4BBV A;  5B1M D;  1M1A D;  3NQU A;  3VSK A;  3W97 C;  1CI8 A;  3QHY A;  5FDS A;  5BNV B;  3PTE A;  2Z6C A;  3IX8 A;  3UB5 P;  5B0Z D;  1N9L A;  1MBL A;  3UB7 A;  5E5A D;  4J8W D;  1E88 A;  1KGG A;  3TJZ C;  5IS1 A;  3VH5 A;  4E6X A;  3REK C;  2KDK A;  5DKL A;  1IEL A;  5HWW A;  3UNW A;  4KG2 A;  5J4E A;  3UTA B;  4X68 A;  3KUY D;  3KFU G;  4KUD B;  2DCF A;  1YSP A;  5AQA A;  4OQI A;  3ZHH A;  1R4V A;  3ZG7 B;  4J8V B;  2FJ7 B;  2ZC7 A;  4OQH A;  4R38 A;  1ZLA A;  1DP6 A;  4GW9 A;  3W8K A;  1LSX A;  3LR0 A;  3OOV A;  5J8X A;  4PHT A;  5AV6 B;  4WU9 C;  4A5R A;  3ZGA B;  1S1Z A;  4DXB A;  2G7U A;  3AN2 C;  3AZJ B;  1FOF A;  4EBP A;  1HTA A;  3LCE A;  3B0D C;  3MGQ A;  2CWE A;  4J8U C;  1P3A A;  4AWL C;  2F8N G;  2ZC5 B;  1M19 D;  5AQ9 A;  4EWF A;  3LJA C;  3UE3 A;  2J8Y A;  4DDY A;  2DRW A;  3GR2 A;  1W1P A;  4ZUX C;  3MGR B;  3REL C;  5GSU B;  3KSY A;  1L6J A;  5DTT A;  3N4I A;  3B33 A;  1YU2 A;  4EXO A;  3LZ1 B;  1M18 D;  1EQZ A;  1FR1 A;  4PKY G;  1GOI A;  1L2S A;  1PW8 A;  4Y0O A;  3AZL C;  5FQM A;  2F8N A;  3AZM C;  4P6Z M;  4U3T A;  4Z2M G;  5HD5 A;  4QLC D;  3FKV A;  5AVE A;  3ZNY A;  5AV9 B;  5KZH A;  2HDR A;  5E2H A;  3KSI A;  3LZ0 B;  4YM6 D;  1KX5 C;  4HME A;  3MXS A;  2WKH A;  3W4P A;  3WAA C;  1H3O B;  4F3L B;  3H0L C;  4OQG A;  1QO6 A;  3UN7 A;  4N9L A;  3AZI B;  3L25 A;  3IF5 A;  1F98 A;  1W1V A;  3AV1 B;  3H7W B;  5JRG A;  2OSU A;  2J3W A;  3L2A A;  3KSG A;  3Q82 A;  3TRC A;  1N9O A;  3ICY A;  3NDE A;  2X02 A;  2OV5 A;  2EX2 A;  4GHI A;  1O7E A;  2NQB D;  3BFC A;  5CHU A;  1L0E A;  2RCX A;  4J8V A;  3M7P A;  3T4Q A;  4CLC C;  3GMW A;  2BYK B;  3BQA A;  3AYW C;  3NQJ B;  2WGW A;  1YU0 A;  2ZC4 B;  2DNS A;  3MF0 A;  2Y4A A;  4QD4 A;  3ZQ5 A;  3MKF A;  1T3U A;  3NHQ A;  3H82 A;  3BLM A;  5AVC D;  3BYD A;  3HJK A;  3WD1 A;  4OLD A;  1PFL A;  3MGP B;  3HBR A;  3BJN A;  1G5U A;  5B32 B;  5G49 A;  2Y2K A;  2G2U A;  3RXW A;  3BY8 A;  2XD1 A;  1P3I C;  5GLB A;  2VZW A;  3W4Q A;  1VHM A;  4X53 A;  3MGR A;  2JBF A;  5GSU A;  1Y54 A;  2CV5 C;  1NLY A;  4JPM A;  3MVD A;  1ALQ A;  5FI2 A;  1P34 C;  4NXG A; 
#chains in the Genus database with same CATH homology
 1SCW A;  3M6H A;  4IBE A;  3X1V D;  3O62 D;  4ZJ2 A;  4OH0 A;  5A92 A;  5F99 B;  3X1T D;  1YLP A;  4UA9 A;  2YFV B;  1Q2P A;  1P3F D;  3HUN A;  5AV9 A;  4R23 A;  2L5A A;  1BH9 A;  3WTP C;  2ZY3 A;  3WS4 A;  3AZI A;  4IED A;  5FDH A;  1H8Y A;  3CJM A;  5EVI D;  5B31 G;  4ZJ3 A;  3AV1 A;  4GDN A;  1EWZ A;  1P3O D;  5DNN C;  1KX4 C;  3AZF C;  3G2Y A;  1YT4 A;  2ARO B;  1MPL A;  1O07 A;  3B6G B;  2FFY A;  5AV8 D;  4G91 C;  3A6N A;  3GSG A;  2HDU A;  3WS0 A;  1P3B A;  3UTA D;  1B6W A;  3HSH A;  3IHA A;  3HL9 A;  2Y2M A;  2FJ7 D;  1NZU A;  4KZA A;  3REI A;  3SOI A;  3C1C B;  4DE1 A;  5CGX A;  3WS5 A;  4Q8I A;  4WU8 D;  3VH5 T;  3B6F A;  3NC8 A;  2F8N H;  1HQ3 D;  3REK A;  3MFD A;  5CGW A;  2WAF A;  2QPN A;  2XR0 A;  5FSR A;  3SS4 A;  1M1A C;  5DNM A;  3N6I A;  3LZ1 D;  1SHV A;  2YFV A;  1E25 A;  5B0Z C;  3HLB A;  3LEL B;  2JCH A;  5E5A C;  4J8W C;  4WU9 A;  1BLP A;  1ONG A;  4J8X B;  3A3D A;  3Q7V B;  1NRF A;  4OP5 A;  1W79 A;  4PM7 A;  2R9X A;  3G34 A;  5B2J B;  4J8U A;  3V9R B;  3MZF A;  1JFI B;  4OOL A;  3KUY C;  3B6G A;  5HFO A;  3LJA A;  3VP1 A;  2ZQ9 A;  2ZD8 A;  4XZQ B;  2Z2M B;  3IT9 A;  3KWQ D;  3AZN A;  5A90 A;  5CRF A;  4R4R A;  1PI5 A;  4S2K A;  3WX7 A;  1MY8 A;  4QHC A;  3VH6 A;  3C5A A;  4N1X A;  1U35 A;  4E3I A;  5CPI D;  1W8Q A;  1JWZ A;  2IO5 C;  5DTS A;  4WYY A;  3A3F A;  4WNN B;  1NYY A;  4N92 A;  1F1E A;  3IF6 C;  3MNN D;  4Y0U A;  4M6B A;  4G92 B;  3C1C A;  3AZH B;  5F82 A;  3AZM A;  1M19 C;  5JA4 B;  3OC2 A;  3W4O A;  3DWK A;  1QME A;  1KX3 A;  1KX5 A;  3MGP D;  5JYO A;  5B32 D;  3AZK A;  4WEJ A;  1XA1 A;  1BH8 B;  2A3U A;  4RX2 A;  4KG5 A;  5B2I B;  2EXA A;  3UY6 A;  1M18 C;  4H9S A;  4MBF A;  1P3L B;  4Z66 D;  4DF6 A;  3AFA B;  3IWI A;  5CPJ A;  3ZVT A;  3AL0 C;  2XGN A;  3TU4 D;  2HIO D;  3WA9 B;  1PW1 A;  4QLC C;  4YS3 D;  4IBR A;  1IYP A;  5B40 D;  4YM6 C;  3LEL A;  3AYW A;  3KS4 A;  3B3X A;  1ERM A;  1FR6 A;  4DDS A;  5GT3 D;  3Q7V A;  1CEF A;  5F99 D;  4XUJ B;  2CC1 A;  5B2J A;  4ID4 A;  5GLC A;  2NQB C;  4IBJ A;  4Z5T B;  4NE6 A;  5CGS A;  1PZR A;  5FAQ A;  5BS7 A;  1YQS A;  1YU1 A;  2ARO D;  3IWQ A;  3VP0 A;  4BD0 A;  2YFW A;  5AVB B;  1XP4 A;  1KU5 A;  5AVC C;  3W96 D;  4KHA B;  3REJ D;  2V1Z A;  4JXW A;  2IWB A;  4OOY A;  4DE3 A;  3AZE B;  4IBC A;  3UPO A;  1MWT A;  3HLE A;  4NE5 A;  1W5D A;  4GD8 A;  1I5Q A;  3IP4 C;  3UO9 A;  4R1G A;  1E4D A;  3W98 D;  4GN2 A;  3AZG A;  1YLT A;  4BQM A;  4RVA A;  3KXB D;  3FV7 A;  4DKI A;  3UPP A;  4R8P D;  3AV2 B;  4NFT A;  3LY3 A;  5B2I A;  3BEC A;  1K55 A;  4NZ4 A;  3HUO A;  3X1S B;  4X55 A;  5KDM B;  1KE4 A;  3X1V C;  3O62 C;  4LD9 B;  5GT0 B;  3MZD A;  2UWX A;  2NZD B;  3WA9 A;  1P3M B;  3WKJ A;  1P3F C;  5GXQ D;  3NI9 A;  3VH5 W;  5B0Y D;  4JJN A;  3C7V A;  4HBT A;  5B24 B;  4X56 A;  1P3O C;  3MGS A;  5TGF A;  2ZY4 A;  4E3O A;  4QU3 A;  2H0Y A;  4WMC A;  1Z6F A;  4K91 A;  3B0C T;  3VFF A;  4Z5T A;  1P3K B;  3TSG A;  5TR7 A;  5AY8 A;  5CPK A;  2XEP A;  1P3G B;  3UTA C;  5HAI A;  1FCM A;  3NQU B;  4U0X A;  4K0X A;  2EFX A;  2FJ7 C;  4KGC A;  5B1M A;  3FYZ A;  4XUZ A;  5AV6 C;  4WU8 C;  5G18 A;  1P3P B;  5E5A A;  1E3U D;  1HQ3 C;  3AZH D;  3V39 A;  1NZO A;  3GTC A;  4FSF A;  4S2P A;  3AV2 A;  1LL5 A;  4OJP A;  3W99 A;  4NZ5 A;  1CI9 A;  1ZLA B;  5FI6 A;  5KDM A;  4KZ5 A;  4WM9 A;  4LD9 A;  2V2F F;  3G31 A;  2WZX A;  3LZ1 C;  1S32 D;  1GA9 A;  4E3L A;  1MKI A;  4LV1 A;  4C75 A;  1P3L D;  3AFA D;  1JVJ A;  3EQV A;  4ZBE A;  1FSW A;  2VGK A;  1P3A B;  1W7F A;  2RVQ D;  4B4X A;  4S2L A;  3BFF A;  4E44 A;  3HLC A;  4CPK A;  4QNL A;  1IKI A;  1P3K A;  3X1U A;  3KWQ C;  4E3J A;  4ZAM A;  2WGV A;  1PIO A;  3B0B A;  1IYS A;  1K57 A;  5CER A;  1P3G A;  4ZJ1 A;  4WEK A;  1ESU A;  5CPI C;  4OPR A;  3ZG9 B;  2F8N B;  1JTG A;  1EI5 A;  3MNN C;  5FQQ A;  1KE3 A;  3FDD A;  2WUQ A;  5DVA A;  3WRZ A;  5AVB D;  1ES3 A;  4KZ4 A;  5JRG B;  4E6W A;  4IBX A;  1P3P A;  5AQ7 A;  3MGP C;  5B32 C;  5AV5 B;  5CP6 D;  4NZ3 A;  5GHZ A;  5B1L A;  4BL2 A;  4WV4 B;  1AOI D;  4Z66 C;  2ZM2 A;  4CSR B;  4S2N C;  1MWR A;  4BD1 A;  2G5H C;  2ZM0 A;  3TU4 C;  1BLS A;  2WGW B;  2HIO C;  4JXG A;  4YS3 C;  3JYI A;  4WBG A;  3UTB A;  5B40 C;  1RGY A;  2XD5 A;  3X1S D;  3IXG A;  3C1B D;  2Y2H A;  1KVL A;  5BPV A;  4X23 D;  5FAO A;  5G49 B;  3L27 A;  1I2W A;  5GT3 C;  4EO5 B;  1ID3 D;  5F99 C;  1ES2 A;  1TZY B;  1BLC A;  1PWC A;  4R3J A;  4OP8 A;  4S2I A;  3REH B;  3MVD B;  2XFT A;  5KSC A;  4E3K A;  4EV4 A;  4M3K A;  1K38 A;  1OME A;  4KZB A;  1F66 D;  2ARO C;  5FAS A;  3VOY A;  3AGF A;  3OPH A;  4ZBJ B;  3W96 C;  3REJ C;  3X1V A;  4UHU A;  1BH9 B;  1ZKJ A;  3X1T A;  5HW3 A;  3B0C W;  3W98 C;  3Q7Z A;  5CHL B;  5D3O A;  1DJA A;  3G32 A;  2VQR A;  4GH9 A;  3KXB C;  1BLH A;  3UT9 D;  5EVI A;  5AV5 A;  4BLM A;  4R8P C;  5BT1 D;  1P3O A;  4XXR A;  3V3R A;  3G35 A;  2V20 A;  4OVD A;  4HGA B;  5IHV A;  1LL9 A;  3A6N B;  3EG5 B;  5B33 D;  2BLS A;  4PM5 A;  5F1F A;  5HAQ A;  1P3B B;  4CSR A;  4KZ8 A;  5AV8 A;  4UA7 A;  5B31 B;  5GXQ C;  1VM1 A;  1M6K A;  4MBK A;  1ZLA D;  2PYO D;  3REI B;  5B0Y C;  3UPN A;  1KGF A;  2J9P A;  2Y2Q A;  4BJP A;  1BUL A;  1VQQ A;  4H9P B;  4E3N A;  3B6F B;  4YFM A;  1TZY A;  3MGQ D;  2EX6 A;  1HTZ A;  3REK B;  1WYC A;  3QNC A;  1P3A D;  4P85 A;  4EBL A;  2PBY A;  3REH A;  5EE8 A;  3VH6 W;  3WS1 A;  3M2K A;  3PBN A;  1HQ3 A;  3O88 A;  2ZM8 A;  1PZO A;  2OLV A;  2Y59 A;  5DNM B;  4O7D A;  2WK0 A;  3O86 A;  1GCE A;  1EQZ D;  3WWX A;  1GHI A;  4YIN A;  3EPK A;  4K0W A;  4HES A;  2Y2P A;  1BUE A;  4WU9 B;  2ZY2 A;  3OCL A;  3OPL A;  3O87 A;  3RXX A;  1S6R A;  3C4P A;  2Q9M A;  3HLD A;  3A3I A;  1U60 A;  4KZ9 A;  4J8U B;  3PBO A;  1YM1 A;  1TDG A;  3AZH C;  4AWL B;  1LLB A;  3S1Y A;  3LJA B;  4IBF A;  5JRG D;  4FH4 A;  5FQI A;  4H9R A;  3AZN B;  2EX9 A;  4ZUX B;  3REL B;  2VGJ A;  3PAE A;  5BOH A;  1U35 B;  5GHY A;  3KWQ A;  3G30 A;  4KUD D;  2W8S A;  3H0R C;  1S32 C;  5B31 A;  2JC7 A;  5B32 G;  4J8V D;  3S4X A;  1YU3 A;  1P3L C;  4LCM A;  3AZL B;  5CPI A;  3AFA C;  5FUG B;  1NJ4 A;  3W97 A;  4P6B A;  3AZM B;  2EXB A;  4B4Z A;  2RVQ C;  1IYQ A;  4H9P A;  4HEF A;  4S2J A;  5AV6 D;  4S2O A;  2P9V B;  3OPP A;  3UE1 A;  1H5X A;  1KX3 B;  1KX5 B;  3AZJ D;  1WWS A;  2Y55 A;  3O3V A;  3AZK B;  2C6W B;  4Y0T A;  1HVB A;  4XUJ C;  4DE0 A;  3IQA A;  3MGR D;  5A93 A;  5GSU D;  4NYY A;  1JWV A;  5CPJ B;  2JE5 A;  3GVB A;  4BL3 A;  3NDG A;  4S2N A;  3LEZ A;  3AYW B;  1K6R A;  1BT5 A;  5AVB C;  5E2G A;  3AN2 A;  5AV9 D;  3DWZ A;  3LZ0 D;  5CP6 C;  4N1H A;  3AZI D;  2Y2N A;  2DF4 C;  3AV1 D;  1MWS A;  1AOI C;  4ZUX A;  4DRA A;  3REL A;  2CV5 B;  1ONH A;  4IJE A;  1K56 A;  1PWD A;  3BEB A;  4H9N A;  2YFW B;  5FAT A;  1K54 C;  3X1S C;  3C1B C;  1LI9 A;  5HAP A;  3AZL A;  4X23 C;  5FUG A;  3ISG A;  3UE0 A;  2C5W B;  5GT0 C;  4DRT A;  5FA7 A;  1ID3 C;  3W96 A;  2P9V A;  1BFM A;  1A7W A;  3GV9 A;  3AZG B;  3A3E A;  3WAA A;  3REI D;  2B5R A;  1Z2C B;  5B24 C;  3W98 A;  1KX4 B;  3AZF B;  3B6F D;  3L28 A;  1F66 C;  4OPY A;  2HUE C;  4R8P A;  3GQZ A;  4UUZ A;  4G91 B;  3BM6 A;  2Y2J A;  3WKJ B;  2DQN C;  2LY8 A;  3TOI A;  1BSG A;  5DNM D;  4JJN B;  5GXQ A;  3TG9 A;  3MGS B;  1L0D A;  3UT9 C;  1DY6 A;  2Y91 A;  1B67 A;  5BT1 C;  4DE2 A;  1XGI A;  4KQQ A;  1ZG6 A;  1P3I A;  5AY8 B;  5CPK B;  4FH2 A;  5B33 C;  1TVF A;  2CV5 A;  3B6G D;  1KDS A;  4IBB A;  1P34 A;  1C3B A;  3AZN D;  5TFQ A;  4KGC B;  4RA7 A;  2ZMA A;  1ZLA C;  5B1M B;  2PYO C;  4NYU A;  5E43 A;  5DF7 A;  1U35 D;  3ITB A;  4GKU A;  5M19 A;  5FI7 A;  5CTN A;  2OLU A;  4GB7 A;  5E5A B;  4PM8 A;  3WTP A;  4J8W B;  3MGQ C;  3PBQ A;  4GNU A;  3SH7 A;  3C1C D;  1P3A C;  3QNB A;  1E3U A;  5DNN A;  1KX4 A;  3AZF A;  1KX3 D;  3W99 B;  4JF4 A;  4OJO A;  3AZK D;  3HON A;  2Y2G A;  3N7W A;  1YMS A;  2PU4 A;  5FAP A;  3V5M A;  5KMW A;  3VOZ A;  1FSY A;  1EQZ C;  2P74 A;  2IO5 B;  5CPJ D;  1S32 A;  3V50 A;  3N3F A;  5GHX A;  3LEL D;  4OKP A;  4R3B A;  1SDN A;  2FFF B;  3PBR A;  4J8X D;  3IXB A;  5JRG C;  5CHJ A;  3IH9 A;  4P0M A;  3X1U B;  5B2J D;  1W8Y A;  3H0M C;  5CHM A;  5C3I B;  1ERQ A;  1FCN A;  3BFE A;  1N9B A;  4OPZ A;  4KUD C;  4EQI A;  1M18 B;  3WTP E;  2RIQ A;  4XZQ D;  1S0W A;  2R9W A;  4J8V C;  3NCK A;  3C7U A;  2ZQ7 A;  4LCL A;  1M1A A;  3HLW A;  3EPJ A;  4IBD A;  4QLC B;  2ZM5 A;  4RX3 A;  1XA7 A;  4UPK A;  5B0Z A;  3EQU A;  3AZJ C;  3P5J B;  4J8W A;  4WZ5 C;  4FD8 A;  5M1A A;  3Q1F A;  1MWU A;  3A1I A;  4EO5 C;  5B1L B;  4C6Y A;  4OJ5 A;  1G68 A;  2ZC6 B;  5HL1 A;  3D4F A;  3AZG D;  3KUY A;  1ZG4 A;  3MGR C;  5GSU C;  3L29 A;  2XK1 A;  2WAE A;  5CEC A;  4XUX A;  3MVD C;  1AOI A;  5B2I D;  4NZ1 A;  3UTB B;  3IH8 A;  1PZP A;  1PWG A;  3G4P A;  3MBZ A;  3P98 A;  3EPL A;  3P09 A;  5AVC B;  3IF6 A;  3WA9 D;  1G6A A;  3WKJ D;  4X23 A;  4H9Q B;  5AV9 C;  4OOM A;  3Q07 A;  3LZ0 C;  3FZC A;  1M19 A;  5FQJ A;  1ID3 A;  3AZI C;  3MKE A;  2E8I A;  3AV1 C;  3MGS D;  4XUJ D;  3MZE A;  3HUM A;  4WMC D;  5EEC A;  5HAR A;  1TAF A;  4Z5T D;  4NK3 A;  1M18 A;  5BO0 B;  2HDQ A;  5AY8 D;  5CPK D;  3A6N C;  3GRJ A;  5CXW A;  4GOG A;  3X1V B;  3IWO A;  3F6T A;  3CZD A;  3IXH A;  3X1T B;  4QLC A;  1M40 A;  4B88 A;  1P3F B;  2WKI A;  4KGC D;  4YM6 A;  3REI C;  2Y2I A;  4JXS A;  3AZE D;  3IXD A;  5EVI B;  1P3O B;  3B6F C;  3UT9 A;  4E45 A;  2NQB A;  1YLZ A;  3N8R A;  5AV8 B;  4H9O A;  5B33 A;  3AV2 D;  1KDW A;  2ZQ8 A;  2HP5 A;  3W99 D;  2PU2 A;  3LY4 A;  4F94 A;  5DNM C;  5U47 A;  1WWI A;  4L0L A;  1K4E A;  4IBK A;  1NXY A;  4GZB A;  4C3Q A;  4LD9 D;  2GDN A;  5GT0 D;  2PYO A;  2NZD D;  5AVC A;  1ES4 A;  4QJG A;  1P3M D;  1N1J A;  4H9Q A;  4GD6 A;  4R0Q A;  4QY5 A;  4QY6 A;  4WU8 B;  1KE0 A;  5B24 D;  1YLJ A;  2XH9 A;  1ESI A;  1HQ3 B;  3B6G C;  1YLW A;  1P3K D;  5BO0 A;  3X1U D;  3AZN C;  1YMX A;  2BG1 A;  1N4O A;  1K6S A;  2EX8 A;  1I2S A;  3O62 A;  1P3G D;  1U35 C;  1L0F A;  1XXM A;  3BFD A;  1P3F A;  3G2Z A;  1GHM A;  4WZS B;  5DTK A;  5JYP A;  3CMZ A;  4WEL A;  3C1C C;  5BNV A;  4BEN A;  4OJL A;  4GHA A;  4JF6 A;  3M6B A;  1RGZ A;  1IKG A;  4H9R B;  1KX3 C;  1P3P D;  4KZ7 A;  4UA6 A;  3WS2 A;  3AZK C;  2X01 A;  4WZ4 A;  3ITA A;  3A1K A;  3ZG0 A;  3KWQ B;  5B1L D;  4N9K A;  4H9S C;  1RCJ A;  3AGD A;  3UTA A;  4KZ3 A;  4MEZ A;  5CPI B;  4KUD A;  3W97 B;  5CPJ C;  1BZA A;  4ZTK A;  4KQR A;  2FJ7 A;  3MNN B;  3UTB D;  4RYE A;  4CJN A;  3LEL C;  5AV6 A;  4J8X C;  4WU8 A;  3AZJ A;  3E2L A;  5B2J C;  4WZ5 A;  3ZG8 B;  4JKT A;  4LV0 A;  5E2F A;  5CED A;  2QMI A;  1ULY A;  3PBT A;  1W2E A;  1NY0 A;  4XZQ C;  3SH9 A;  1JWP A;  4X6T A;  4Z66 B;  4PPR A;  5BS7 C;  1DJC A;  1IEM A;  4DQY B;  3TU4 B;  2HIO B;  5BNX B;  3LZ1 A;  4YS3 B;  2F8N D;  2ZQA A;  5B40 B;  3AN2 B;  4KZ6 A;  4IVK A;  3B0D B;  4E3M A;  4G92 C;  2WAD A;  5GT3 B;  2JSS A;  5FQK A;  1YLY A;  3LZ0 A;  2H0T A;  3VP2 A;  3AZG C;  1H3O A;  3IHB A;  2WGI A;  1CK3 A;  4PM6 A;  5AV5 D;  5EOE A;  4QB8 A;  4H9N B;  3VSL A;  5B2I C;  1SKF A;  3C4O A;  1AXB A;  1K55 C;  2XLN A;  3VFH A;  3BRM A;  4PM9 A;  1FCO A;  2HPB A;  2ZY5 A;  3UDX A;  3MNN A;  3W96 B;  3WA9 C;  3REJ B;  3WKJ C;  2BYK A;  4CAY B;  3WAA B;  4R4S A;  4JLF A;  4LEN A;  3NQJ A;  1WE4 A;  4JJN C;  3ZNT A;  3W98 B;  5EUA A;  2ZQC A;  3MGS C;  3KS8 A;  4U0T A;  3MGP A;  5B32 A;  3KXB B;  3NBL A;  3SS5 A;  2HDS A;  1TZY D;  4R8P B;  2HP6 A;  4UUZ B;  3ZG5 A;  3HLF A;  4Z5T C;  3REH D;  5I94 A;  3RJU A;  5AY8 C;  3MVD D;  5CPK C;  4Z66 A;  1K4F A;  4IVI A;  1ERO A;  2G2W A;  4DXC A;  3ZVW A;  1KVM A;  1RP5 A;  3TU4 A;  2HIO A;  5BNX A;  4YS3 A;  3NIA A;  5GXQ B;  3EPH A;  5B40 A;  4KGC C;  4GHL A;  5B1M C;  5B0Y B;  1Q2Q A;  3AZE C;  5GT3 A;  5F99 A;  4MBH A;  1P3I B;  3HVF A;  2Q9N A;  3FKE A;  4Z2M H;  3SH8 A;  1HZO A;  1P34 B;  3AV2 C;  3N8S A;  3W99 C;  4LV2 A;  3A6N D;  2ARO A;  2XDM A;  5DF9 A;  4PMA A;  1P3B D;  1L0G A;  3BLS A;  3MXR A;  4LD9 C;  2NZD C;  5B31 D;  3REJ A;  1P3M C;  4DRB A;  3WTP B;  4CAY A;  4KQO A;  3R45 B;  2F2A C;  3W97 D;  3DTM A;  1TEM A;  2BYM B;  3E2K A;  3V3S A;  5DNN B;  2Y2L A;  2J9O A;  5FQ9 A;  3KXB A;  5GL9 A;  2J8P A;  1K25 A;  5CEB A;  5GLA A;  2G5I C;  3REK D;  1P3K C;  3HRE A;  3X1U C;  1GA0 A;  1K57 C;  1P3G C;  5C3I C;  2XFS A;  3ZDJ A;  4IJF A;  4Z9Q A;  1S32 B;  4OQ0 A;  4Y7P A;  3ZCZ A;  4X69 A;  5B0Y A;  2WKE A;  2Z2L B;  3UDF A;  1XX2 A;  5EVL A;  4WU9 D;  3I7J A;  1FQG A;  3AN2 D;  1P3P C;  3M2J A;  4UAA A;  1TDL A;  4J8U D;  4J8X A;  5EPH A;  5E2E A;  2ZJ9 A;  5B1L C;  3LJA D;  3VP4 A;  4OLG A;  2IOU A;  3DW0 A;  3V9R A;  1JFI A;  4ZUX D;  3REL D;  1M1A B;  4MLL A;  1K56 D;  4XZQ A;  1KGE A;  2WZZ A;  3OCN A;  2ZQD A;  2H5S A;  5KSH A;  4OPQ A;  3UTB C;  5GLD A;  5B0Z B;  5CTM A;  4OUI A;  3R45 A;  3AZL D;  2X71 A;  4WNN A;  3AZM D;  2BYM A;  2HP9 A;  5F83 A;  4JBF A;  4IBG A;  3N8L A;  1YUE A;  3AZH A;  1KX5 D;  4EUZ A;  5CP6 B;  3WAA D;  4OON A;  2H10 A;  3KUY B;  1XPB A;  1GHP A;  5JA4 A;  4JF5 A;  1AOI B;  4KEN B;  3WRT A;  1WYB A;  4NE3 A;  1DJB A;  3FWL A;  5M18 A;  1BH8 A;  3L26 A;  3SS3 A;  1CEG A;  4HBU A;  3Q81 A;  3IF6 B;  1P3L A;  3C1B B;  3A3J A;  3AFA A;  4X23 B;  2J7V A;  3AYW D;  1M19 B;  1ID3 B;  3X1T C;  1Q9C A;  2IWC A;  1ZC2 A;  1QMF A;  2A49 A;  4GDB A;  5EVI C;  5AV5 C;  1XKZ A;  3VP3 A;  5L2F A;  4XUJ A;  4LV3 A;  1TAF B;  3HLG A;  1LHY A;  1P3I D;  1F66 B;  2HUE B;  4OJ6 A;  3PAG A;  5AQB A;  1ES5 A;  2CV5 D;  4ZDX A;  5HX9 A;  2XQZ A;  5AV8 C;  1P34 D;  1LI0 A;  5F1G A;  4S2M A;  4YM6 B;  1PI4 A;  4D2O A;  3AGE A;  2EFU A;  5AVB A;  3OPR A;  4FCF A;  1BTL A;  4KHA A;  1NYM A;  3AZE A;  3UT9 B;  3LO7 A;  3WTP D;  5CP6 A;  1TZY C;  2NQB B;  1XGJ A;  1J9M A;  2ZLY A;  2ZC3 B;  4H9O B;  3REH C;  5DNN D;  5B33 B;  4IBI A;  5DF8 A;  1KX4 D;  3AZF D;  3S22 A;  1HD8 A;  3UDI A;  2RL3 A;  3PBS A;  3NY4 A;  2XF3 A;  5A91 A;  3FKW A;  4ZBJ C;  3BFG A;  1K54 A;  2PYO B;  5EOO A;  1H8Z A;  3X1S A;  3C1B A;  3CG5 A;  1N1J B;  4KG6 A;  3ZFZ A;  3VH6 T;  1PYY A;  5GT0 A;  1SDE A;  2NZD A;  2F8N K;  1JTD A;  2WYX A;  4JJN D;  1P3M A;  3MGQ B;  3OZH A;  4LG2 A;  1MXO A;  2I72 A;  4EBN A;  2IWD A;  5B24 A;  4NY2 A;  2QZ6 A;  2Y2O A;  4HGA C;  1F66 A;  4P87 A;  3VMA A;  4JXV A;  3O62 B;  1P3B C;  4NET A;  1EQZ B;  5B31 C;  4MNR A;  1YU4 A;  1IYO A;  4H8R A;  4WJ3 C;  5B1M D;  1M1A D;  3NQU A;  3VSK A;  3W97 C;  1CI8 A;  3QHY A;  5BNV B;  3PTE A;  5B0Z D;  1MBL A;  5E5A D;  4J8W D;  1KGG A;  3VH5 A;  4E6X A;  3REK C;  1IEL A;  3UNW A;  4KG2 A;  3UTA B;  4X68 A;  3KUY D;  3KFU G;  4KUD B;  2DCF A;  5AQA A;  4OQI A;  3ZHH A;  1R4V A;  3ZG7 B;  4J8V B;  2FJ7 B;  2ZC7 A;  4OQH A;  1ZLA A;  3W8K A;  5J8X A;  5AV6 B;  4WU9 C;  4A5R A;  3ZGA B;  4DXB A;  3AN2 C;  3AZJ B;  1FOF A;  4EBP A;  1HTA A;  3LCE A;  3B0D C;  3MGQ A;  2CWE A;  4J8U C;  1P3A A;  4AWL C;  2F8N G;  2ZC5 B;  1M19 D;  5AQ9 A;  4EWF A;  3LJA C;  3UE3 A;  2J8Y A;  4DDY A;  2DRW A;  3GR2 A;  4ZUX C;  3MGR B;  3REL C;  5GSU B;  3KSY A;  5DTT A;  3N4I A;  1YU2 A;  3LZ1 B;  1M18 D;  1EQZ A;  1FR1 A;  1L2S A;  1PW8 A;  4Y0O A;  3AZL C;  5FQM A;  2F8N A;  3AZM C;  4U3T A;  4Z2M G;  4QLC D;  3FKV A;  3ZNY A;  5AV9 B;  5KZH A;  2HDR A;  5E2H A;  3LZ0 B;  4YM6 D;  1KX5 C;  3MXS A;  3W4P A;  2WKH A;  3WAA C;  1H3O B;  3H0L C;  4OQG A;  3UN7 A;  4N9L A;  3AZI B;  3L25 A;  3IF5 A;  3AV1 B;  5JRG A;  2OSU A;  3L2A A;  3Q82 A;  3NDE A;  2X02 A;  2OV5 A;  2EX2 A;  1O7E A;  2NQB D;  3BFC A;  5CHU A;  1L0E A;  2RCX A;  4J8V A;  3GMW A;  2BYK B;  3AYW C;  3NQJ B;  2WGW A;  1YU0 A;  2ZC4 B;  2DNS A;  2Y4A A;  4QD4 A;  3MKF A;  1T3U A;  3BLM A;  5AVC D;  3BYD A;  4OLD A;  3MGP B;  3HBR A;  5B32 B;  5G49 A;  2Y2K A;  2G2U A;  3RXW A;  2XD1 A;  1P3I C;  5GLB A;  3W4Q A;  4X53 A;  3MGR A;  2JBF A;  5GSU A;  1Y54 A;  2CV5 C;  4JPM A;  3MVD A;  1ALQ A;  5FI2 A;  1P34 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...