2Y2KA

Penicillin-binding protein 1b (pbp-1b) in complex with an alkyl boronate (za5)
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
488
structure length
469
Chain Sequence
SEITYSDGTVIASIRDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTGQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PENICILLIN-BINDING PROTEIN 1B
publication title Structure-Guided Design of Cell Wall Biosynthesis Inhibitors that Overcome Beta-Lactam Resistance in Staphylococcus Aureus (Mrsa).
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
total genus 163
structure length 469
sequence length 488
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2y2kA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2y2kA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2y2kA02
5A91A 3A3IA 1GHMA 5EUAA 1DJBA 3IXDA 1NY0A 2ZJ9A 3V3SA 5EVIA 1HD8A 2VGKA 4LENA 5E43A 1LL5A 3RXWA 1SDNA 1YT4A 1I2SA 2Y59A 1K38A 3BYDA 4RYEA 4OP8A 2Z2MB 3UN7A 3CJMA 4PM6A 3C7UA 3N6IA 5GHYA 4UAAA 4JXVA 2WKHA 3Q82A 4OQIA 4WZ5A 1ZC2A 3Q07A 5HAIA 3WS5A 2X02A 3MKEA 4N1XA 1YMSA 3UE3A 3IXGA 3ITAA 4KZ8A 4KZ5A 4X6TA 3CMZA 3AGEA 3HLFA 4RA7A 4GOGA 4X53A 2IWDA 4QU3A 3FKVA 1CEFA 4X56A 3UE0A 2VGJA 3GV9A 1PIOA 1WYCA 1AXBA 1HTZA 3IT9A 3MKFA 4OPRA 4QY6A 4JXWA 5GL9A 4JF6A 4JXSA 4EUZA 2UWXA 2Y2MA 4LV1A 4BENA 5EVIB 1CEGA 1NRFA 3FYZA 1NYMA 2WKIA 3N8SA 4OVDA 1JTDA 3HUOA 2J8YA 2A49A 1SHVA 1ONGA 1WE4A 5FA7A 3VP2A 4HEFA 4PM5A 4OPYA 4KZ7A 5IHVA 4EQIA 1JVJA 4KQRA 1VQQA 2XFSA 2Y55A 2Y2LA 3ZGAB 3UNWA 5GLCA 3O3VA 3HUMA 3M2JA 2WYXA 5I94A 3MBZA 1I2WA 4R3JA 4MLLA 4U0XA 2WGVA 3MZFA 1LI0A 3M6BA 1E3UD 3DWZA 4X55A 5BOHA 2Y2QA 4PPRA 2RCXA 3P98A 4E3JA 4Z9QA 4WYYA 5E2FA 3ZG0A 1BUEA 1K4FA 2R9XA 4WBGA 2ZQAA 5CERA 2XDMA 4CPKA 5HW3A 2QMIA 5GHZA 1C3BA 3IXHA 1IKGA 3IF6B 1IYSA 1LHYA 4GD8A 3OPPA 4S2JA 1BT5A 1CI9A 2V20A 1BLPA 3IHAA 1QMEA 4GKUA 3PBSA 4OP5A 4KZBA 4E6XA 1YLWA 1IYQA 1W8YA 4OH0A 3A3JA 3OPLA 5CHMA 5HFOA 4BQMA 2XGNA 3QNCA 1M6KA 2CC1A 1DY6A 1TEMA 2ZC3B 4E6WA 2JC7A 4OLGA 2OLVA 1MBLA 3S1YA 1XGJA 4EBLA 5CEDA 4WZ5C 5DTSA 3W8KA 3NC8A 4LCMA 3BFDA 4JPMA 4XUXA 4JF5A 1IELA 3VP0A 3V5MA 3HLBA 1BLSA 1MY8A 3ZDJA 5FATA 2C5WB 4WELA 3C7VA 5KSHA 5HX9A 2OV5A 3PAGA 3OPRA 4FCFA 2XFTA 4EWFA 2ZM0A 3VP1A 3PAEA 4DKIA 3ZHHA 2EXAA 1IEMA 1L0DA 3A3DA 4LV3A 3UDFA 5F1GA 2Y2IA 1N9BA 3BLSA 5EPHA 3VOZA 1WYBA 3IXBA 3HLCA 4N92A 2RL3A 1LL9A 4S2NA 3SH8A 3ZG7B 2WKEA 3PBOA 2H0YA 2ZQCA 3HBRA 4NK3A 4OLDA 4EBPA 4WMCA 1NJ4A 2XQZA 1YLTA 1GA0A 1MKIA 2Q9MA 4GN2A 1ESUA 3ZG5A 5JYOA 2WUQA 3OZHA 4E3MA 3NDEA 3QNBA 5HL1A 3FWLA 1TDGA 3S22A 2QZ6A 1LLBA 5EVID 3VP4A 1MWSA 4WM9A 3ZVWA 1IKIA 5AQBA 2B5RA 5FQIA 3BRMA 4L0LA 2WAFA 3MZEA 4Y0UA 5FQJA 1MWTA 3RJUA 5GLBA 1ZKJA 1TVFA 3Q81A 5DF7A 4HBUA 3LEZA 1RP5A 1KGFA 3HLDA 3PBRA 4DDYA 5DVAA 3FV7A 3OCLA 3WRTA 1XA1A 4OONA 3C4PA 1CK3A 1FCNA 1SDEA 1XA7A 5HARA 2IWBA 2J7VA 1NZOA 3W4OA 5GLAA 5AQAA 4K91A 1KE4A 4E3KA 5D3OA 5EOEA 5DTTA 4KZ3A 4LV0A 3G31A 3ISGA 4K0XA 4NETA 4ID4A 2PU4A 3E2LA 3S4XA 1PW8A 4BLMA 3WS2A 4DDSA 4DF6A 2ZM8A 2X01A 1FCOA 2OSUA 4R3BA 1JWVA 3GMWA 2QPNA 2R9WA 4ZAMA 5KSCA 2V1ZA 5A90A 3HVFA 1K54C 3DTMA 3VFHA 1ES5A 1L0GA 1SKFA 3BM6A 1NYYA 3UO9A 4EBNA 4BD0A 1BSGA 3VMAA 1ERQA 3GR2A 4OKPA 3BFFA 1L0FA 3EQVA 3JYIA 5EOOA 3E2KA 1DJAA 2XK1A 1XPBA 3LO7A 2Y2NA 1EWZA 3NI9A 3WWXA 4H8RA 1K56A 2JBFA 3ZG9B 5M19A 1L2SA 3BECA 1GA9A 3V50A 2Y2GA 1KE0A 3BEBA 4S2NC 2XR0A 4ZDXA 2HP5A 3G34A 1W5DA 5KZHA 4MEZA 5DF8A 4KZ6A 2XF3A 1W7FA 3D4FA 3IWIA 3HLWA 2G2UA 1K25A 1E4DA 2G2WA 3I7JA 4GNUA 3G2YA 1ES4A 1PZOA 1Q2PA 4N1HA 3GTCA 3B3XA 1K6SA 2ZC7A 4U3TA 3SH9A 1SCWA 3Q1FA 3RXXA 1BULA 4KENB 2C6WB 4GDNA 4MBKA 4KG6A 4PM9A 2DRWA 2XEPA 1Z6FA 2J9PA 3EQUA 4X69A 5CXWA 3IF5A 5CHJA 1GHIA 5TGFA 3TSGA 2HDUA 2IWCA 2WZXA 4QY5A 3AGDA 4DRTA 2X71A 1YQSA 4OPZA 3Q7VA 2P9VA 3HLEA 1GHPA 1W8QA 2P74A 3BLMA 1H8ZA 1KE3A 4ZBEA 5F1FA 3Q7ZA 3HLGA 3G35A 1FOFA 4JBFA 1E3UA 4QB8A 5EE8A 5FSRA 2XLNA 2ZQ9A 2ZC5B 5FAOA 1N4OA 2ZC6B 3GQZA 4IVIA 1K54A 4S2IA 2JE5A 1K57A 4X68A 1JTGA 5DTKA 1PWGA 1H5XA 5FI7A 3VFFA 4Y0OA 4B4XA 1FCMA 1KGEA 2ZD8A 1KVMA 4MBHA 3C5AA 1JWZA 1W79A 5DF9A 3UDIA 1NXYA 3ZFZA 2H5SA 3NY4A 4ZJ3A 2WGWA 4WMCD 3UY6A 2Y2HA 2GDNA 4E3IA 4WEKA 2Z2LB 2EX8A 4N9LA 4S2KA 1K4EA 4OOYA 1RCJA 3HL9A 3NBLA 3Q7VB 2Y91A 4IBXA 1BTLA 3WS1A 1PW1A 2EFUA 5EVLA 3O87A 4HBTA 3W4QA 1MXOA 1ZG6A 4UA9A 1G68A 3A3EA 4DXBA 2HP9A 1YLPA 4KQOA 1VM1A 4UA6A 1K6RA 5FQMA 1RGZA 1EROA 3M2KA 3MFDA 3LCEA 4HESA 1TDLA 1ONHA 5JYPA 1KDSA 2EX9A 4YFMA 1FR6A 3G32A 5CTNA 3QHYA 4E3LA 5FI6A 4B88A 1GCEA 1S0WA 2JCHA 3A3FA 3FZCA 5CTMA 5G18A 4OPQA 5CEBA 1HZOA 3DWKA 4GDBA 4IVKA 1G6AA 1ZG4A 3SS5A 3VP3A 2ZQDA 2E8IA 1KVLA 4BD1A 5GHXA 1O7EA 4JF4A 3GVBA 1MPLA 1IYOA 4OOMA 1YMXA 2DNSA 3WRZA 4KG5A 4WZ4A 5M1AA 4E3OA 4JXGA 1FSYA 5FAQA 4EV4A 4MNRA 4R4SA 3TOIA 4O7DA 5A92A 5E2HA 1U60A 1ESIA 3IH9A 3OCNA 1XX2A 1J9MA 1LI9A 4F94A 4C3QA 4YINA 1ERMA 4DE2A 5U47A 2J9OA 4E3NA 2EX2A 3N7WA 5CECA 4KZAA 1PWDA 4U0TA 5AQ7A 5FQ9A 1K57C 3BFGA 3UPNA 1M40A 4RX2A 4DE3A 4OQGA 4BL3A 5M18A 3P09A 1K56D 3ZNTA 3SH7A 4GD6A 1KDWA 4KG2A 3LY3A 5FQQA 4OQ0A 4PM7A 3C4OA 2HDSA 2FFYA 4ZJ1A 5FDHA 1HVBA 3PBTA 2BG1A 1EI5A 4FH4A 4R23A 1E25A 3GSGA 4RX3A 5FAPA 2OLUA 3MXSA 4BL2A 5TR7A 4DE1A 2Y2PA 1QMFA 4XXRA 2BLSA 4P85A 2WADA 4N9KA 1MWRA 3FKWA 3TG9A 1K55A 4S2PA 5CHUA 5CRFA 1NZUA 4Q8IA 3IF6A 2I72A 3N8LA 2ZQ8A 3VSLA 3SS3A 2HDRA 3W4PA 2A3UA 4A5RA 2PU2A 2WZZA 5E2EA 3NCKA 3HUNA 4D2OA 1FQGA 1KGGA 4ZTKA 1XGIA 5E2GA 5FASA 5L2FA 5CGWA 3G2ZA 2ZLYA 4QJGA 1ES3A 4UA7A 4IEDA 3IH8A 2Y2JA 1H8YA 3DW0A 2XD5A 4KZ9A 3NIAA 3MXRA 1PZPA 3M6HA 4CJNA 5GLDA 2WGIA 2V2FF 4QHCA 1YM1A 1ES2A 5EECA 4LCLA 4P0MA 1XP4A 1RGYA 3VOYA 1PI4A 4R1GA 2EX6A 3V39A 4FSFA 2WK0A 3CG5A 3ITBA 1MWUA 1BLCA 2H0TA 2ZM2A 4QD4A 4UHUA 3SS4A 4DXCA 3O88A 3UPOA 1DJCA 2ZC4B 1YLZA 5HAPA 4KQQA 5EVIC 5FQKA 4OOLA 1XKZA 4Y0TA 2H10A 3MZDA 3UE1A 3OPHA 4WEJA 3VSKA 2EXBA 2Q9NA 3O86A 4B4ZA 3UDXA 1I5QA 4S2OA 2HPBA 1Y54A 5CGXA 1FR1A 3AGFA 1PWCA 4P6BA 1PYYA 1JWPA 4FH2A 4GZBA 1CI8A 2P9VB 2ZQ7A 4RVAA 1O07A 3G4PA 3CZDA 4XUZA 1PI5A 1YLJA 4GB7A 4R4RA 2DCFA 3WS4A 5TFQA 1L0EA 3HREA 3ZCZA 5J8XA 2HP6A 2ZMAA 5HAQA 2Y2OA 4S2MA 2XD1A 4R0QA 3WS0A 1Q2QA 3BFEA 3UPPA 3ZG8B 1BZAA 4PMAA 2FFFB 5A93A 1ALQA 3IHBA 1K55C 3IQAA 3OC2A 2WAEA 4BJPA 3IF6C 3ZVTA 1BLHA 4LV2A 4FD8A 1S6RA 3PTEA 3G30A 4Y7PA 5F82A 5F83A 4P87A 2WGWB 3N8RA 4S2LA 1IYPA 3GRJA 1XXMA 2XH9A 3ZNYA 3V3RA 2Y2KA 4K0WA 4DE0A 4IBRA 5FI2A 1OMEA 3N4IA 2EFXA 4OQHA 5CGSA 3SOIA 1FSWA 1YLYA 4KZ4A 3IWOA 4C6YA 4JKTA 3LY4A 3PBNA 4C75A 5AQ9A 2Y4AA 4ZJ2A 2PBYA 4M3KA 5KMWA 3IWQA 4PM8A 3NDGA 2HDQA 3PBQA 4JLFA 4MBFA 3BFCA
chains in the Genus database with same CATH superfamily
2Q0OA 5FEGA 2W1TA 2AROB 3IXDA 2ZJ9A 5GT3A 5EVIA 3PR6A 4Y15A 2ZMFA 3RXWA 3O62C 4E45A 1ED7A 1S1YA 3BYDA 3ICYA 3IX8A 1JFIB 4XZQB 4G92B 3AYWD 3CJMA 1E15A 5GHYA 2VK3A 2WKHA 5HAIA 5B1LD 3V67A 3C1BC 1G5UA 3AZLC 3MGQC 1YMSA 4G3KA 3ITAA 4X6TA 3AGEA 1HLUP 3B6FB 1PIOA 1WYCA 1AXBA 1L6JA 4OPRA 3FPVA 5CPKA 4LG2A 3PYPA 4EUZA 2UWXA 2V0WA 1TS6A 3U4LP 5EVIB 1NRFA 5G4YA 3N8SA 3T12B 2A49A 4NZ3A 1DP6A 5FA7A 4OPYA 4KUDA 4KZ7A 1JVJA 4KQRA 1VQQA 5FEFA 3ZYTA 3W98D 1P9RA 5GLCA 4J8WC 5B2JC 2EWVA 2KDKA 3B0BA 4MLLA 3MVDC 5B33C 1E3UD 3DWZA 4X55A 3VH5A 3WA9A 4J8XB 5E2FA 4LD9C 2ZQAA 4CPKA 1U35C 2QMIA 1C3BA 1IKGA 3OPPA 4NE3A 5CX7A 1BT5A 1QMEA 4OP5A 3LJAA 3KX0X 1OTBA 5GSUB 4UUZA 3NQUB 3QNCA 4MCWA 5B31B 3B6GC 1P3BD 5B2IA 3WTPC 5AV9D 3REJA 3LIAA 4OLGA 2OLVA 3WA9B 3AZHB 4PAUA 3UTBD 4JGRA 1IELA 3VP0A 2DF4C 1MY8A 4MDZA 4X1LA 1WA9A 2C5WB 3LFVA 4WELA 5KSHA 2OV5A 3PAGA 3OPRA 5KDMA 4EWFA 3ZHHA 1EQZD 2MJ6A 4ME4A 2BYMB 2M1CA 4LV3A 3A3DA 3LJAB 4ESPA 1N9BA 5EM0A 5EPHA 3VOZA 3IXBA 3X1UA 2CV5D 2WKEA 3KFUG 5B1MC 2LY8A 4GCZA 4OLDA 4EBPA 4WMCA 1NJ4A 5B2IB 1YLTA 3R4KA 3LIBA 4E3MA 5HL1A 3FWLA 1S32C 1IKIA 2CWEA 5FQIA 3BRMA 5KDMB 4L0LA 4G91C 3AZMA 5GLBA 4HBUA 4HI4A 1KGFA 3HLDA 3PBRA 3FV7A 4OONA 1ZHHB 1CK3A 4XUJD 2NQBD 1XA7A 3W4OA 1TS8A 4K91A 2QJ5A 4Y3IA 4E3KA 3LR0A 4J8UA 3AN2D 3LZ1C 3K2NA 5DTTA 3S7PA 3VH5W 3NQJB 4KZ3A 2QKPA 3BY9A 3ISGA 3F1PB 3S4XA 4DRAA 4IJEA 2X01A 1FCOA 1FILA 2OSUA 4R3BA 3GMWA 2R9WA 4HJ4A 1N9NA 5KSCA 5A90A 3HVFA 1ZLAA 3IBJA 3VFHA 3AZMB 1L0GA 3BM6A 5BNXB 3WKJA 3AZED 4EBNA 2HJ9C 3MMHA 2M7UA 3ULFA 2ZM5A 4OKPA 3E2KA 3B0CW 3KSIA 3T1QB 3ZG9B 4GJ4A 2JBFA 4Q0JA 2V5OA 3UTAB 3UT9D 3L29A 1P3IC 5KZHA 4X1MA 3LYXA 4G3VA 3WAAD 5HDCA 4KZ6A 4QLCB 1W7FA 1P3LA 3REIB 1ES4A 3REHD 4U3TA 4I39A 3Q1FA 4GHIB 4KENB 1KX5D 2PR5A 2XEPA 4X69A 2W3EA 3IF5A 1GHIA 3AZKA 3AGDA 4DRTA 4Z5TA 3MQOA 3HLEA 1GHPA 1W8QA 3RELC 1TAFA 4GS9A 3TU4C 3QP8A 5GXQB 5EE8A 5FSRA 2XLNA 4H6JA 3MNND 5DKLA 1K54A 5B0ZD 1JTGA 1Z2CB 3REKC 1XJ3A 5HWVA 1W1VA 5B32D 5B24A 1JWZA 3X1TD 1NXYA 4Z66A 2Y2HA 3AZKB 2GDNA 4WEKA 4N9LA 4S2KA 5AV5B 1R4VA 3P5JB 4OOYA 2HIOD 3HL9A 4I5SA 5JRGD 3KSFA 1BTLA 4OJ5A 5EVLA 3O87A 3E4OA 1MXOA 4NZ5A 4I3IA 2O99A 3A3EA 4YM6A 1T3UA 4H6JB 3W99A 3LI8A 5B31G 3A6NB 1P3AA 4KQOA 2XSSA 4EESA 4MN5A 4KGCD 5GT3D 1GXDA 3MFDA 3LCEA 5JYPA 4LRZE 2EX9A 4YFMA 3BY8A 1FR6A 3E4QA 1J7MA 3QHYA 3WD1A 1OTIA 3L26A 3A3FA 4Z66B 5AVCD 5CPJA 1STZA 1P3FC 5CEBA 1YU2A 3AFAA 3W96C 1HZOA 3DWKA 1ZG4A 4GDBA 4IVKA 5HWTA 2ZQDA 3AV1B 3BQAA 4WF0A 1P3PA 3FDDA 1E6NA 3VE3A 4EETB 1F66A 2JKRM 2PAVP 1YMXA 4YM6B 3WRZA 4E3OA 4EV4A 3W99B 3TOIA 4HMCA 1P3AB 5B40C 2PT7A 4O7DA 1GPFA 5E2HA 5CPKD 1U60A 3R7WA 1ESIA 3N3FA 4R8PA 1XX2A 4F94A 4IBDA 3OLOA 1BH8A 2ZL1A 1ID3D 3N7WA 2R78A 4KHAB 1KX4D 4U0TA 5FQ9A 4KUDD 4DE3A 4NG2A 3AFAB 3P09A 3VV4A 1K56D 2J80A 1P3OA 5IT5A 1KDWA 5F5YA 4PM7A 3C4OA 4ZJ1A 1M19C 1P3PB 3AYWA 1HVBA 4HMDA 4J8VD 1F66B 4P6ZS 4FH4A 3QP2A 2DQNC 2IOUA 5FAPA 5FDSA 1QMFA 4XXRA 5B1LA 3LICA 3LZ0C 1F5MA 3AZFA 3H7WB 2HF6A 5MC7A 2YKHA 3FKWA 1F98A 1NZUA 3IF6A 2ZL1B 3N8LA 3T4LA 3SS3A 2A3UA 4A5RA 1KOUA 2WZZA 3UB9A 1F1EA 1ACFA 4WU9C 3RH8B 2ZLYA 3AYWB 3IBRA 4UA7A 2Y2JA 4X23C 3REJD 1F9IA 3EG5B 5HWWA 3W98A 3MXRA 5B1LB 4YS3C 4NKPA 5EECA 4LCLA 4LRXC 1OGBA 3SZTA 2VGLS 3CG5A 3ITBA 1MWUA 1M19D 2H0TA 3KWQD 1P34D 4QD4A 3SS4A 2PYOC 4KQQA 1YPRA 5FQKA 1XKZA 4Y0TA 3MZDA 3X1UD 2YKFA 3AZLA 2W27A 3MGQA 3VSKA 3WD0A 4HGAB 5CHLB 4S2OA 4WU8D 1PWCA 4P6BA 3W98B 4RVAA 3AZJD 1P3BA 3KYZA 2QJ7A 3WS4A 5TFQA 1L0EA 2O9BA 4EERA 2ZY2A 2Y2OA 3UB7A 2XD1A 1Q2QA 2VGLM 3BFEA 3UE6A 5HDDA 5B0YD 4PMAA 1IOUA 1E6RA 3OC2A 3IQAA 3VH6T 1YU0A 1YU1A 2F8ND 1IYPA 4DE0A 4IBRA 3N4IA 4EEPA 2EFXA 4J8UD 4JJNC 5DNND 3QP6A 1A7WA 4EO5B 3C1CC 1P3BB 4KZ4A 4JKTA 5GT0D 1U35A 3PBNA 1HQ3C 5AV9B 3X1VC 4C75A 3A0SA 5KMWA 3NDGA 3KXBC 3UTBB 3A3IA 1GHMA 1DJBA 3MGRC 3LEQA 3V3SA 1HD8A 2VGKA 3WKJD 1LL5A 4RQ9A 3L28A 2YFWA 1YT4A 1I2SA 3B6GA 2VZWA 3F1OB 4G3WA 4ZUXC 1EQZB 3LIEA 3N6IA 3Q82A 4OQIA 3Q07A 2CV5B 4XUJA 1YKDA 3MKEA 4H9QB 3IXGA 4DJ2A 4X53A 4GOGA 5G49A 1FIKA 3AN2A 4QU3A 1P3LD 1CEFA 3MKFA 4QY6A 2IO5C 3KUYB 2Y2MA 5F99C 5BS7A 3KS8A 4X25A 1DP9A 2WKIA 3H0RC 1JTDA 3EPHA 2NZDC 2J8YA 1ONGA 4WNNA 4PKYA 3VP2A 1KX3B 3NJAA 3UMEA 2Y55A 3KXBD 4Z5TD 4XUJB 2NQBB 3M2JA 1I2WA 5E5AC 4R3JA 3KS4A 5CPID 1LI0A 3M6BA 3AN2B 1F2KA 1LSXA 5DNMC 3UT9A 4E3JA 5AVBB 1AIWA 4WYYA 1LL8A 5F6AA 3L2AA 5CERA 2XDMA 1N1JB 5TBMA 2FJ7C 5B24D 1IYSA 1LHYA 5L10A 3T4OA 2FZ0A 1CI9A 3W97C 3PBSA 4KZBA 1IYQA 2Y8HA 3A3JA 3AZEB 4KQDA 2J3TC 3LZ1A 1KX5A 2ZY5A 1M6KA 1K0KA 1TEMA 3TW8A 5F99D 1MBLA 4EBLA 4IUHA 5DTSA 3W8KA 3BFDA 3UT9B 4JPMA 4Z1WA 1DP8A 1T1CA 3EEAA 4XUXA 4JF5A 1KS0A 3T4QA 3WAAB 5HSQA 5FATA 5DJUA 4CLCC 2HGVA 3H0LC 1XFQA 4NXEA 5HX9A 3KYQA 4FCFA 3REHB 1UR8A 5CPJD 2Y2IA 5B32A 3X1TA 3HLCA 1KX5B 1LL9A 2HV1A 3KYEA 2ZQCA 3CPTA 2RVQD 2XQZA 5JA4B 1MKIA 2K7SA 5JRGA 1ESUA 3OZHA 2L5AA 4B93A 4R8PD 2QZ6A 1LLBA 4CSRB 3VP4A 4WM9A 3MNNB 5AQBA 2B5RA 5B0ZB 4Y0UA 1OJ5A 1MWTA 3RJUA 5AY8C 4KGCA 3Q81A 5KIZA 5DF7A 1RP5A 5B32B 4DDYA 3X1TB 1P3OD 3D9YA 2OAP1 4OJ6A 1SDEA 3TU4A 5HL6A 5J4EA 2J7VA 3MQ0A 3CPTB 5AVCA 1NZOA 1B67A 3MGPD 2HIOB 5JRGB 2JN7A 3AZFD 1P3KC 4K0XA 3REKA 1IFQA 5BO0A 2ZM8A 2XA7M 3GDIA 1G28A 3A0RA 4NXGA 2QPNA 2E8JA 4ZAMA 1YUEA 3CUEC 2W1TB 1ES5A 1SKFA 4KGCB 5GT3B 1NYYA 3CITA 4D60A 1ID3A 1P3GD 3EWKA 2LB9A 1L0FA 3JYIA 2OOLA 1KX4A 3MGSD 5AVCB 2XK1A 5C5KA 3L7HA 2Y2NA 1EWZA 2AVXA 4H8RA 1K56A 4HP9A 4ETXA 1L2SA 3S7QA 1N9OA 1GA9A 3BECA 4S2NC 1M18C 2HP5A 4H9PA 5L07A 4J8VA 1NLYA 1W5DA 3G34A 1V9YA 2VV6A 3K3CA 5BO0B 1W63M 3O62D 3HLWA 2G2WA 1AOIC 4ZBJC 1PZOA 4EW7A 5CPKB 1K6SA 2W3HA 1SCWA 3BWLA 3W96A 5TJJA 1BULA 4O0PA 2C6WB 5IS1A 3P01A 1ID3B 5AV8C 2DRWA 3C1BD 3AZLD 1Z6FA 3EQUA 3MGQD 1KX4B 1YAXA 4KUDB 4H9NA 2HDUA 4QY5A 3AZGC 2ACGA 5CP6C 2P9VA 5B40A 3AZIC 4J8VB 3G35A 1M1AC 3LELC 4QB8A 2JKTM 3U2AA 4OUIA 3GQZA 3KSHA 1PNEA 4Y5FA 3VFFA 5BT1C 4B4XA 1H5XA 2G7UA 4FUWA 1OTEA 2ZD8A 3AV2C 1W79A 4J8WD 5B2JD 1M19A 1QO6A 3KWQA 1P34A 3ZFZA 3CAXA 3EGDC 4ZJ3A 3MVDD 2WGWA 4H9NB 5B33D 1OT9A 4UUZB 2Z2LB 1K4EA 4GLQA 3JPUA 1RCJA 2Y91A 4IBXA 4LD9D 1U35D 4UA9A 3REJB 4WU8A 3X1SC 2HP9A 3AZJA 1A0KA 2PYRA 1H8PA 3LIDA 4UA6A 3D72A 1K6RA 2FH5A 3M2KA 3AZNC 3G32A 5CTNA 2B18A 4CQHA 4HOIA 4E3LA 3B6GD 1M19B 4HP4A 5FI6A 3KWQB 1P34B 1S0WA 2JCHA 5C3IC 5B0YA 3WTPD 4X23A 2GZAA 2PD8A 3X1UB 1N9LA 5AV6C 1ODVA 1O7EA 4YS3A 5EV0A 4ARZA 2F8NA 1IYOA 1S4RA 4WU8B 4KG5A 5DNNA 1P3MC 3AZJB 2VV8A 3TJZC 5GT0A 4NE5A 4H9SA 4DE2A 2J9OA 3IP4C 4KZAA 5B1MD 4Z2HA 3B0DC 5B0YB 1M40A 1MZUA 4RX2A 5M18A 4LLOB 4GD6A 2P08A 1GSWA 2FFYA 1TZYC 5FDHA 3PBTA 2F8NB 2VX8A 1S32D 5B32G 1E25A 4DJ3A 2OLUA 3MXSA 4J8UB 5DNNB 4N9KA 5GT0B 3TG9A 5CHUA 5CRFA 3VH5T 3H9WA 2I72A 1OJGA 2HDRA 1ZLAB 4BBUA 2AROC 2PU2A 3NCKA 2EWWA 3WKJB 2DMWA 1FQGA 2D49A 4ZTKA 3LZ1D 4JJNA 1NWZA 5L2FA 3FG8A 4IBBA 4QJGA 3X1VA 4XZQC 4G92C 1V9ZA 4BMWA 3KXBA 3HJKA 2O9CA 4KZ9A 4F3LA 3NIAA 3B0CT 1PZPA 2WGIA 2ZMVA 4I3JA 4CAYA 1ES2A 1ZTUA 5CPIA 1RGYA 3VOYA 1PI4A 1P3LB 1W1PA 3B6FC 1UWNX 3C38A 4JGPA 4ZUXA 3DAVA 1DJCA 2ZC4B 5AJGA 5EVIC 2H10A 3UE1A 4WEJA 2Z6DA 1VB6A 4NE6A 1P3ID 3UDXA 1I5QA 1FR1A 4Z5TB 1PYYA 4F3LB 4IJFA 3CZDA 1TAFB 4GS9B 2BYKA 1EAKA 4CAYB 5F99A 2AROD 5CPIB 2DCFA 1TS7A 3ZCZA 4NYYA 5J8XA 2HUEB 2NZDA 4J8XC 2WKPA 4Z2JA 4WJ3C 1MC0A 4R0QA 3NULA 4HJ3A 2VEAA 2V8CA 2FFFB 3IHBA 5B24B 4UQIS 3RELD 4L9GA 3PXPA 3ZVTA 1BLHA 5BNVA 4FD8A 3TU4D 3PTEA 3G30A 5HDSA 4S2LA 1J3WA 5G4ZA 1GSVA 5GSUC 5HPFA 5DNMA 2KOIA 4HH2A 3SOIA 5B31C 1S1ZA 4C6YA 2BYKB 3LY4A 3REKD 3T4TA 3S7NA 2Y4AA 5L09A 4ZJ2A 2FJ7A 2PBYA 3PBQA 1BH9A 3WA9C 4M6BA 3AZHC 3W97A 5A91A 3FKEA 4IBJA 2F8NK 1S4SA 1SDNA 1TF1A 2PRFA 4LGWA 4RYEA 5BNVB 2Z2MB 3UN7A 3C7UA 4UAAA 4JXVA 5CPJB 3LJAC 4J8XD 3WS5A 2ZOIA 4N1XA 3UE3A 4KZ5A 4CLCA 3CMZA 3MGPA 2W1RA 2LB5A 3HLFA 4RA7A 2IWDA 5DKKA 4LFUA 4AWLB 2VGJA 1BH9B 2KX6A 4JXWA 5EM1A 3MJQA 3R7WB 5GL9A 4JXSA 1P3FD 4R8PB 1S67L 3W96D 3FYZA 1BH8B 3UB5P 1SHVA 1WE4A 2A24A 4HEFA 2OWJA 4EQIA 2XFSA 3T4JA 3T1SA 1P3GA 1P3OB 1L3LA 5B40D 3CHWP 4M4XA 3HUMA 4WL9A 3MGSA 4JGQA 3MBZA 3MZFA 2I9VA 4P6ZM 3MGPB 3KO6A 1TD5A 2RCXA 3P98A 4Z9QA 3AZFB 3FPWA 2F8NG 1BUEA 1K4FA 2R9XA 3TRCA 4WBGA 3DBAA 3O62A 2Z6CA 3IF6B 4GD8A 4S2JA 1BLPA 4GKUA 4E6XA 3AZMC 1YLWA 1W8YA 2PD7A 3OPLA 5CHMA 2IA2A 1P3GB 3LZ0D 3C1BA 3VE4A 3MGSB 1DY6A 2ZC3B 4II7A 4E6WA 3IS2A 3S1YA 3C30A 3K3DA 4WZ5C 3NC8A 3UTAC 1GOIA 3HLBA 1BLSA 2PYPA 4KUKA 2XROA 5EFWA 3O62B 4QLCC 4ZRRA 2ZBBA 4FOFA 4WU9D 3REIC 2W8SA 2XFTA 3VP1A 4DKIA 4X23D 2EXAA 1IEMA 5F1GA 3WX7A 3DTIA 5IU1A 4MB5A 1WYBA 4N92A 4J8WA 5B2JA 2RL3A 3SH8A 4S2NA 3ZG7B 3C1BB 3AZLB 2D01A 3MGQB 2INWA 4NK3A 4YS3D 3MVDA 2G5IC 5B33A 1GA0A 2Q9MA 5HPIA 4GN2A 5JYOA 5FUGA 2WUQA 4HY8A 3QNBA 5F68A 4LD9A 2PYOD 3S22A 1W1YA 5GXQC 3ZVWA 1MWSA 5AV8A 1PDCA 2WAFA 2J8PA 1ZKJA 3MQLA 1TVFA 3LEZA 4E44A 5DVAA 4J8WB 5B2JB 4O8GA 1XA1A 3C4PA 1M1AA 3WTPA 3MVDB 2RIQA 3LELA 5B33B 5AQAA 1SZVA 3AZKC 1KE4A 4L9EA 1DRMA 5D3OA 5EOEA 5J3WA 5AV5C 4WLAA 4LD9B 4ID4A 2PU4A 1U35B 3E2LA 1PW8A 4DDSA 3AV2A 2EA9A 3CWFA 3A6NC 2V1ZA 1XJ6A 1K54C 4OJLA 4MN6A 3A0VA 5A8BA 1T19A 5HD3A 2YFWB 4BD0A 4JJND 4K08A 3B6GB 5B1MA 3GR2A 2L1MA 3GECA 3C1CD 3EQVA 5EOOA 2UV0E 4YNRA 3WTPB 1HQ3D 3X1VD 1DJAA 5J7EA 3NOTC 1XPBA 3LO7A 3X1SA 4Z66C 2VJWA 2JKRI 3B47A 3AV1C 3V50A 1KE0A 2XR0A 4ZDXA 3MGRD 1UGUA 1S32A 5DF8A 3AZNA 1E88A 4XT2A 5G49B 2WKQA 1K25A 4YM6C 1JNUA 3G2YA 1Q2PA 3W99C 4ZUXD 1P3AC 3B3XA 4IJGA 3RXXA 1XJ2A 4MBKA 4KG6A 3RTYA 4FTXA 5B1MB 3EPLA 2J9PA 4WNNB 4LRYC 5CXWA 1CK7A 3AFAC 2F2AC 1YQSA 4OPZA 5DFXA 1H8ZA 4ZBEA 1EW0A 3Q7ZA 1P3PC 4JBFA 1S32B 1F66C 3T1XA 4NFTA 2ZC5B 2NZDD 5FAOA 1N4OA 4G91B 2ZC6B 4IVIA 4X68A 2JE5A 5FI7A 3KSYA 4Y0OA 4EU0A 4O01A 4WV4B 1KGEA 5TBMB 3C5AA 5DF9A 1BFMA 2H5SA 5E5AD 2EX8A 3LZ1B 5DNMD 3CI6A 3LR3A 3NBLA 3WS1A 1P3IA 3UMDA 2BASA 3AYWC 1Y4OA 4HBTA 2FJ7D 5B1LC 1VETA 3W97D 2AROA 1VM1A 1EROA 2J3TD 1TDLA 1WWSA 2JKFA 3BJNA 1GCEA 1JFIA 4XZQA 2P04A 3CLOA 5F69A 3FZCA 5CTMA 5G18A 3SS5A 1G6AA 4IBCA 1T1BA 3RELA 1KVLA 4BD1A 5GHXA 1P3IB 4JF4A 3GVBA 1MPLA 4HGAC 2ZY3A 3LR4A 4OOMA 4CLCD 2FN2A 2W3DA 2DNSA 5M1AA 4JXGA 5FAQA 3W98C 4MNRA 1VETB 5A92A 5LBRA 1X0OA 3IH9A 1D06A 1J9MA 4YINA 1ERMA 5DFYA 1PWDA 3KSGA 5AQ7A 1K57C 1ULYA 1PFLA 3LUQA 2V0UA 2O9AA 3ZNTA 1YU4A 3RELB 4BWIA 4HJ6A 3JVUA 3TU4B 4CLCE 3MSHA 3VOLA 4DE1A 4RX3A 4BL2A 4J8XA 2Y2PA 2BLSA 2OWHA 4TX8A 2WADA 1OTDA 4EO5C 1H3OA 5AY8D 4HQAA 4JGOA 3REKB 1MWRA 1P3BC 5AV9C 2PR6A 3WD4A 3VSLA 3UTBC 3WD2A 3W4PA 1P3FA 3NECA 5E2EA 3HUNA 1VHMA 5GSUA 4H9OA 3NQUA 1XGIA 1Y28A 5B31A 4HNBA 5FASA 1P3KD 3TE8A 1EQZC 4IEDA 3IH8A 1H8YA 2XD5A 1LSVA 1W2EA 3AZHA 3M6HA 2PDRA 2CV5C 4CJNA 3H82A 2V2FF 4H9PB 2H28A 4OJPA 1H3OB 4EXOA 4FSFA 2WK0A 1W63Q 1BLCA 1S66L 2ZM2A 3H0MC 4DXCA 1P3FB 2BYMA 3M7PA 2W3FA 3O88A 3UPOA 3W96B 3KUYC 1T18A 3C2WA 4H9OB 4OOLA 4R3AA 1PZRA 4I3AA 1M18D 4Z2MG 2Q9NA 3O86A 1KX3C 3AGFA 1AOID 3LZ0A 1JWPA 3RFBA 4GZBA 1CI8A 2P9VB 5B40B 2O0YA 1O07A 3G4PA 3F6TA 3E98A 2K2NA 3H82B 4PKYG 4XUJC 2NQBC 4GB7A 1B6WA 4R4RA 3D3OA 5AV8D 2VKSA 3AN2C 5HAQA 4S2MA 5AVBC 3UPPA 5AVFA 3ZG8B 1BZAA 1OT6A 5A93A 3AZGD 1K55C 5BS7C 2WAEA 5CP6D 4WU9A 4BJPA 1CJFA 3AZID 1S6RA 4Y7PA 5F83A 1M1AD 2WGWB 3B33A 3NHQA 3GRJA 3LELD 2XH9A 3ZNYA 3V3RA 4K0WA 3AZEC 5FI2A 1OMEA 4OQHA 3LZ0B 4GHLA 3NQJA 5BT1D 2BTFP 2K31A 3F1PA 3MFXA 3T4KA 3KUYD 3AV2D 3IWQA 4PM8A 2HDQA 4JLFA 4MBFA 3BFCA 3UT9C 2PYOA 5DJTA 5EUAA 1NY0A 1KX3D 5BNXA 3WAAC 4LENA 4WZSB 5E43A 1OPXA 2Y59A 4WU9B 1K38A 3WTPE 4OP8A 3REHC 4PM6A 4X23B 1OGGA 1H8MA 3X1SD 4WZ5A 1ZC2A 3NOUC 2X02A 1KX5C 3UTAA 5AVBD 4YS3B 4ARZB 3LIFA 4KZ8A 3LGOA 2VQRA 2F8NH 3AZND 4QLCA 3FKVA 3REIA 4X56A 3L25A 3UE0A 3GV9A 3IT9A 1HTZA 3L27A 4GW9A 3EOIA 2PYOB 4JF6A 1TS0A 4LV1A 4BENA 4GHIA 1CEGA 1NYMA 4OVDA 5AV6D 3MNNC 2HZ5A 3HUOA 4QPRA 2V1BA 4PM5A 5B0ZC 4QNLA 5IHVA 3UB8A 5BPVA 2Y2LA 3ZGAB 5B32C 3UNWA 1P3MD 3X1TC 3O3VA 3C1CA 2WYXA 1HQ3A 5I94A 3ZQ5A 1HTAA 4U0XA 2WGVA 5GXQA 1BYWA 5BOHA 2Y2QA 4PPRA 2HIOC 5JRGC 3MGRA 3EPKA 3ZG0A 5HW3A 5GHZA 3IXHA 3DTEA 1TZYD 4Z2LA 2V20A 3IHAA 5I5LA 5HFOA 4OH0A 4KGCC 3BW6A 5GT3C 3NOPC 4BQMA 4JJNB 5AV5A 2XGNA 3FC7A 3C1CB 4NY2A 2VA0A 2CC1A 4PHTA 1HQ3B 3X1VB 4NYUA 1XFNA 5AVCC 1D1JA 2JC7A 4HHDA 3KXBB 2KLIA 1XGJA 5CEDA 1PRQA 4MN7A 4LCMA 3A6NA 2L4RA 3MGRB 2PBDP 3V5MA 3ZDJA 3C7VA 3PHYA 4ZUXB 2ZM0A 2NUPC 3LR5A 3PAEA 4XZQD 1LSWA 5CPKC 1L0DA 3UDFA 3BLSA 3AV1A 1ID3C 3PBOA 2H0YA 3HBRA 5E5AA 1KX4C 4KUDC 2B95A 3B6FD 3ZG5A 3AL0C 3NDEA 2JKTI 1TDGA 2IO5B 5F99B 4J8VC 4IBGA 5EVID 4MB4A 4L9FA 3VH6A 2NZDB 3QP5A 3MZEA 5FQJA 4KHAA 1MKMA 3MXQA 4IBKA 3OCLA 1T1AA 3WRTA 4UQIM 5HARA 1FCNA 2IWBA 5E5AB 4IUKA 2J3WA 5GLAA 2YFVA 5DNMB 5HZHA 4DQYB 2Y79A 1YSQA 3G31A 4LV0A 3H7WA 2W3GA 4NETA 4BLMA 5B2IC 2FJ7B 3WS2A 3REJC 4DF6A 1JWVA 3OBFA 5K5BA 3W97B 5AVEA 3DTMA 4Z2GA 4EQ1A 1CF0A 3UO9A 5GSUD 1BSGA 3VMAA 3EPJA 1ERQA 3BFFA 5B31D 3KWQC 1P34C 4IHQA 3UB6A 3NI9A 3WWXA 3B42A 5M19A 3QP1A 1OTAA 2YFVB 4E04A 1KU5A 3WA9D 3AZHD 2GX5A 2Y2GA 1P97A 3BEBA 3X1UC 1UWPX 1UR9A 4MEZA 4CLCB 2ZY4A 4R38A 2XF3A 3D4FA 3IWIA 4WU8C 2G2UA 3I7JA 1E4DA 4GNUA 1WWIA 2JKGA 4N1HA 2QWSA 5AY8A 3AZJC 3GTCA 1O6IA 2ZC7A 4I38A 3SH9A 1W1TA 3LJAD 4GDNA 2V9AA 1XJ4A 4PM9A 4KUOA 4MB3A 2A24B 5CHJA 5TGFA 3TSGA 5B0YC 5B2ID 2IWCA 2GJ3A 2WZXA 2X71A 3Q7VA 1P3KA 3BLMA 2P74A 3C8CA 1KE3A 5F1FA 3HLGA 3V9RA 1FOFA 1E3UA 3G6OA 3A1IA 2ZQ9A 4J8UC 4WUJA 5DNNC 3CUEA 5DTKA 3VH6W 4S2IA 1K57A 5AY8B 1PWGA 3T1RA 3MF0A 4NXFA 4DRBA 5GT0C 3L9KA 1FCMA 2W0NA 4H9SC 1KVMA 4MBHA 2PHYA 3UDIA 1E6ZA 3NY4A 5FL3A 1ZLAC 4WMCD 3UY6A 4AFIA 4UEYA 4E3IA 3WKJC 1CXWA 2XRNA 3E4PA 3Q7VB 1M18A 1P3KB 4EUVA 4NXBA 1PW1A 2EFUA 3V9RB 2VV7A 3W4QA 5AV9A 1ZG6A 1G68A 4DXBA 3IS2B 1AOIA 2RTSA 3UTBA 1H0MA 1YLPA 1E8BA 1H0IA 3AZMD 2D02A 5FQMA 1RGZA 4HESA 1ONHA 3F1NA 1KDSA 2JSSA 3OOVA 4IBFA 1P3LC 3HCYA 3F1OA 4B88A 3EEHA 5L8MA 2WKRA 2G5HC 1EQZA 4UPKA 4OPQA 3W2ZA 3AZGA 3VP3A 3A1KA 1H0GA 5CP6A 4HMEA 2E8IA 2CV5A 3AZIA 1M18B 3UTAD 2HJEA 4H9QA 3T50A 4Y13A 4QLCD 3DTKA 1AOIB 4WZ4A 4ZBJB 3REID 4Z5TC 1FSYA 5FUGB 3BQ8A 3S7OA 4R4SA 4Y2FA 5EVEA 4NEED 2NUTC 1ZLAD 3P7NA 3OCNA 3KUYA 3QP4A 1LI9A 5CPIC 4C3QA 3F1NB 5AV8B 5CECA 5U47A 4E3NA 2EX2A 1Q9CA 2HUEC 4B9OA 1KX3A 3BFGA 3UPNA 1P0ZA 4OQGA 3AZGB 4BL3A 4WN5A 5CP6B 3HONA 3SH7A 5B24C 4KG2A 3LY3A 4HIAA 5FQQA 3AZIB 4OQ0A 2HDSA 2NQBA 3O5YA 2M7VA 1M1AB 1LT0A 3LELB 2BG1A 1EI5A 5GXQD 4R23A 3GSGA 5TR7A 4YWZA 3HJIA 4R6LA 4P85A 5AVBA 4YOFA 4QWOA 4Q0IA 1N1JA 1K55A 4S2PA 3AV2B 4Q8IA 4NZ1A 2ZQ8A 4H9RA 3E0YA 4Z2MH 3AZKD 3AZEA 2VLGA 4D2OA 1KGGA 1H3QA 5AV6A 5AV5D 1E6PA 5E2GA 5CGWA 3G2ZA 1ES3A 3DW0A 3X1SB 2P7JA 5CPJC 4ETZA 1P3MA 4Y17A 1G6OA 5GLDA 3A6ND 4EEUA 4QHCA 1YM1A 1P9WA 3JVVA 3WD3A 3WAAA 4P0MA 2RVQC 1XP4A 3AZNB 1SKOA 4R1GA 4Z2KA 2EX6A 4XT2B 5HD5A 3V39A 1NLZA 4AWLC 1GSXA 4LPZA 3REHA 5C3IB 4H9RB 1D7EA 4UHUA 2OAQ1 1CQAA 2A2LA 4Z66D 3LI9A 1YLZA 5HAPA 4R8PC 2QYBA 5AV6B 3AV1D 4IBEA 4DMZA 3IX3A 1TZYA 3OPHA 2ZOHA 3IX4A 2EXBA 4B4ZA 2V1AA 4GH9A 5JA4A 1Y54A 2HPBA 5CGXA 4YM6D 1P3MB 4FH2A 3R45A 1P3OC 1VEUA 3W99D 2L0WA 2ZQ7A 4XUZA 1P3AD 1PI5A 1YLJA 1YSPA 3T4SA 4CSRA 1SKOB 4BBVA 3SW1A 3HREA 3MGPC 3MNNA 4OJOA 2HP6A 2ZMAA 3B0DB 1YU3A 5B0ZA 2GNXA 3WS0A 3AZFC 4NZ4A 2JHEA 2V8FA 2CMNA 1NRJA 4R70A 1ALQA 3AFAD 4BBTA 3IF6C 1TZYB 4LV2A 4Z2IA 1P3PD 5F82A 4DN0A 4P87A 4GHAA 1F66D 3HSHA 3N8RA 1XXMA 2B02A 3MQQA 4IBIA 2Y2KA 1Z09A 2HIOA 5CGSA 4MMNA 4Q0HA 3R45B 1P3GC 2QHKA 1VEUB 3EGXC 1FSWA 1YLYA 3MR0A 3IWOA 3MGSC 3MS6A 5AQ9A 2XA7S 4M3KA 3B6FA 1AWIA 4HH3A
chains in the Genus database with same CATH topology
2AROB 3IXDA 2ZJ9A 5GT3A 5EVIA 3RXWA 3O62C 4E45A 3BYDA 1JFIB 4XZQB 4G92B 3AYWD 3CJMA 5GHYA 2WKHA 5HAIA 5B1LD 3C1BC 3AZLC 3MGQC 1YMSA 3ITAA 4X6TA 3AGEA 3B6FB 1PIOA 1WYCA 1AXBA 4OPRA 5CPKA 4LG2A 4EUZA 2UWXA 5EVIB 1NRFA 3N8SA 2A49A 4NZ3A 5FA7A 4OPYA 4KUDA 4KZ7A 1JVJA 4KQRA 1VQQA 3W98D 5GLCA 4J8WC 5B2JC 3B0BA 4MLLA 3MVDC 5B33C 1E3UD 3DWZA 4X55A 3VH5A 3WA9A 4J8XB 5E2FA 4LD9C 2ZQAA 4CPKA 1U35C 2QMIA 1C3BA 1IKGA 3OPPA 4NE3A 1BT5A 1QMEA 4OP5A 3LJAA 5GSUB 4UUZA 3NQUB 3QNCA 5B31B 3B6GC 1P3BD 5B2IA 3WTPC 5AV9D 3REJA 4OLGA 2OLVA 3WA9B 3AZHB 3UTBD 1IELA 3VP0A 2DF4C 1MY8A 2C5WB 4WELA 5KSHA 2OV5A 3PAGA 3OPRA 5KDMA 4EWFA 3ZHHA 1EQZD 2BYMB 4LV3A 3A3DA 3LJAB 1N9BA 5EPHA 3VOZA 3IXBA 3X1UA 2CV5D 2WKEA 3KFUG 5B1MC 2LY8A 4OLDA 4EBPA 4WMCA 1NJ4A 5B2IB 1YLTA 4E3MA 5HL1A 3FWLA 1S32C 1IKIA 2CWEA 5FQIA 3BRMA 5KDMB 4L0LA 4G91C 3AZMA 5GLBA 4HBUA 1KGFA 3HLDA 3PBRA 3FV7A 4OONA 1CK3A 4XUJD 2NQBD 1XA7A 3W4OA 4K91A 4E3KA 4J8UA 3AN2D 3LZ1C 5DTTA 3VH5W 3NQJB 4KZ3A 3ISGA 3S4XA 4DRAA 4IJEA 2X01A 1FCOA 2OSUA 4R3BA 3GMWA 2R9WA 5KSCA 5A90A 3HVFA 1ZLAA 3VFHA 3AZMB 1L0GA 3BM6A 5BNXB 3WKJA 3AZED 4EBNA 2ZM5A 4OKPA 3E2KA 3B0CW 3ZG9B 2JBFA 3UTAB 3UT9D 3L29A 1P3IC 5KZHA 3WAAD 4KZ6A 4QLCB 1W7FA 1P3LA 3REIB 1ES4A 3REHD 4U3TA 3Q1FA 4KENB 1KX5D 2XEPA 4X69A 3IF5A 1GHIA 3AZKA 3AGDA 4DRTA 4Z5TA 3HLEA 1GHPA 1W8QA 3RELC 1TAFA 3TU4C 5GXQB 5EE8A 5FSRA 2XLNA 3MNND 1K54A 5B0ZD 1JTGA 1Z2CB 3REKC 5B32D 5B24A 1JWZA 3X1TD 1NXYA 4Z66A 2Y2HA 3AZKB 2GDNA 4WEKA 4N9LA 4S2KA 5AV5B 1R4VA 3P5JB 4OOYA 2HIOD 3HL9A 5JRGD 1BTLA 4OJ5A 5EVLA 3O87A 1MXOA 4NZ5A 3A3EA 4YM6A 1T3UA 3W99A 5B31G 3A6NB 1P3AA 4KQOA 4KGCD 5GT3D 3MFDA 5JYPA 3LCEA 2EX9A 4YFMA 1FR6A 3QHYA 3L26A 3A3FA 4Z66B 5AVCD 5CPJA 1P3FC 5CEBA 1YU2A 3AFAA 3W96C 1HZOA 3DWKA 1ZG4A 4GDBA 4IVKA 2ZQDA 3AV1B 1P3PA 3FDDA 1F66A 1YMXA 4YM6B 3WRZA 4E3OA 4EV4A 3W99B 3TOIA 1P3AB 5B40C 4O7DA 5E2HA 5CPKD 1U60A 1ESIA 3N3FA 4R8PA 1XX2A 4F94A 4IBDA 1BH8A 1ID3D 3N7WA 4KHAB 1KX4D 4U0TA 5FQ9A 4KUDD 4DE3A 3AFAB 3P09A 1K56D 1P3OA 1KDWA 4PM7A 3C4OA 4ZJ1A 1M19C 1P3PB 3AYWA 1HVBA 4J8VD 1F66B 4FH4A 2DQNC 2IOUA 5FAPA 1QMFA 4XXRA 5B1LA 3LZ0C 3AZFA 3FKWA 1NZUA 3IF6A 3N8LA 3SS3A 2A3UA 4A5RA 2WZZA 1F1EA 4WU9C 2ZLYA 3AYWB 4UA7A 2Y2JA 4X23C 3REJD 3EG5B 3W98A 3MXRA 5B1LB 4YS3C 5EECA 4LCLA 3CG5A 3ITBA 1MWUA 1M19D 2H0TA 3KWQD 1P34D 4QD4A 3SS4A 2PYOC 4KQQA 5FQKA 1XKZA 4Y0TA 3MZDA 3X1UD 3AZLA 3MGQA 3VSKA 4HGAB 5CHLB 4S2OA 4WU8D 1PWCA 4P6BA 3W98B 4RVAA 3AZJD 1P3BA 3WS4A 5TFQA 1L0EA 2ZY2A 2Y2OA 2XD1A 1Q2QA 3BFEA 5B0YD 4PMAA 3OC2A 3IQAA 3VH6T 1YU0A 1YU1A 2F8ND 1IYPA 4DE0A 4IBRA 3N4IA 2EFXA 4J8UD 4JJNC 5DNND 1A7WA 4EO5B 3C1CC 1P3BB 4KZ4A 4JKTA 5GT0D 1U35A 3PBNA 1HQ3C 5AV9B 3X1VC 4C75A 5KMWA 3NDGA 3KXBC 3UTBB 3A3IA 1GHMA 1DJBA 3MGRC 3V3SA 1HD8A 2VGKA 3WKJD 1LL5A 3L28A 2YFWA 1YT4A 1I2SA 3B6GA 4ZUXC 1EQZB 3N6IA 3Q82A 4OQIA 3Q07A 2CV5B 4XUJA 3MKEA 4H9QB 3IXGA 4X53A 4GOGA 5G49A 3AN2A 4QU3A 1P3LD 1CEFA 3MKFA 4QY6A 2IO5C 3KUYB 2Y2MA 5F99C 5BS7A 3KS8A 2WKIA 3H0RC 1JTDA 3EPHA 2NZDC 2J8YA 1ONGA 4WNNA 3VP2A 1KX3B 2Y55A 3KXBD 4Z5TD 4XUJB 2NQBB 3M2JA 1I2WA 5E5AC 4R3JA 3KS4A 5CPID 1LI0A 3M6BA 3AN2B 5DNMC 3UT9A 4E3JA 5AVBB 4WYYA 3L2AA 5CERA 2XDMA 1N1JB 2FJ7C 5B24D 1IYSA 1LHYA 1CI9A 3W97C 3PBSA 4KZBA 1IYQA 3A3JA 3AZEB 3LZ1A 1KX5A 2ZY5A 1M6KA 1TEMA 5F99D 1MBLA 4EBLA 5DTSA 3W8KA 3BFDA 3UT9B 4JPMA 4XUXA 4JF5A 3WAAB 5FATA 3H0LC 5HX9A 4FCFA 3REHB 5CPJD 2Y2IA 5B32A 3X1TA 3HLCA 1KX5B 1LL9A 2ZQCA 2RVQD 2XQZA 5JA4B 1MKIA 5JRGA 1ESUA 3OZHA 2L5AA 4R8PD 2QZ6A 1LLBA 4CSRB 3VP4A 4WM9A 3MNNB 5AQBA 2B5RA 5B0ZB 4Y0UA 1MWTA 3RJUA 5AY8C 4KGCA 3Q81A 5DF7A 1RP5A 5B32B 4DDYA 3X1TB 1P3OD 4OJ6A 1SDEA 3TU4A 2J7VA 5AVCA 1NZOA 1B67A 3MGPD 2HIOB 5JRGB 3AZFD 1P3KC 4K0XA 3REKA 5BO0A 2ZM8A 2QPNA 4ZAMA 1YUEA 1ES5A 1SKFA 4KGCB 5GT3B 1NYYA 1ID3A 1P3GD 1L0FA 3JYIA 1KX4A 3MGSD 5AVCB 2XK1A 2Y2NA 1EWZA 4H8RA 1K56A 1L2SA 3BECA 1GA9A 4S2NC 1M18C 2HP5A 4H9PA 4J8VA 3G34A 1W5DA 5BO0B 3O62D 3HLWA 2G2WA 1AOIC 4ZBJC 1PZOA 5CPKB 1K6SA 1SCWA 3W96A 1BULA 2C6WB 1ID3B 5AV8C 2DRWA 3C1BD 3AZLD 1Z6FA 3EQUA 3MGQD 1KX4B 4KUDB 4H9NA 2HDUA 4QY5A 3AZGC 5CP6C 2P9VA 5B40A 3AZIC 4J8VB 3G35A 1M1AC 3LELC 4QB8A 4OUIA 3GQZA 3VFFA 5BT1C 4B4XA 1H5XA 2ZD8A 3AV2C 1W79A 4J8WD 5B2JD 1M19A 3KWQA 1P34A 3ZFZA 4ZJ3A 3MVDD 2WGWA 4H9NB 5B33D 4UUZB 2Z2LB 1K4EA 1RCJA 2Y91A 4IBXA 4LD9D 1U35D 4UA9A 3REJB 4WU8A 3X1SC 2HP9A 3AZJA 4UA6A 1K6RA 3M2KA 3AZNC 3G32A 5CTNA 4E3LA 3B6GD 1M19B 5FI6A 3KWQB 1P34B 1S0WA 2JCHA 5C3IC 5B0YA 3WTPD 4X23A 3X1UB 5AV6C 1O7EA 4YS3A 2F8NA 1IYOA 4WU8B 4KG5A 5DNNA 1P3MC 3AZJB 5GT0A 4NE5A 4H9SA 4DE2A 2J9OA 3IP4C 4KZAA 5B1MD 3B0DC 5B0YB 1M40A 4RX2A 5M18A 4GD6A 2FFYA 1TZYC 5FDHA 3PBTA 2F8NB 1S32D 5B32G 1E25A 2OLUA 3MXSA 4J8UB 5DNNB 4N9KA 5GT0B 3TG9A 5CHUA 5CRFA 3VH5T 2I72A 2HDRA 1ZLAB 2AROC 2PU2A 3NCKA 3WKJB 1FQGA 4ZTKA 3LZ1D 4JJNA 5L2FA 4IBBA 4QJGA 3X1VA 4XZQC 4G92C 3KXBA 4KZ9A 3NIAA 3B0CT 1PZPA 2WGIA 4CAYA 1ES2A 5CPIA 1RGYA 3VOYA 1PI4A 1P3LB 3B6FC 4ZUXA 1DJCA 2ZC4B 5EVIC 2H10A 3UE1A 4WEJA 4NE6A 1P3ID 3UDXA 1I5QA 1FR1A 4Z5TB 1PYYA 4IJFA 3CZDA 1TAFB 2BYKA 4CAYB 5F99A 2AROD 5CPIB 2DCFA 3ZCZA 4NYYA 5J8XA 2HUEB 2NZDA 4J8XC 4WJ3C 4R0QA 2FFFB 3IHBA 5B24B 3RELD 3ZVTA 1BLHA 5BNVA 4FD8A 3TU4D 3PTEA 3G30A 4S2LA 5GSUC 5DNMA 3SOIA 5B31C 4C6YA 2BYKB 3LY4A 3REKD 2Y4AA 4ZJ2A 2FJ7A 2PBYA 3PBQA 1BH9A 3WA9C 4M6BA 3AZHC 3W97A 5A91A 3FKEA 4IBJA 2F8NK 1SDNA 4RYEA 5BNVB 2Z2MB 3UN7A 3C7UA 4UAAA 4JXVA 5CPJB 3LJAC 4J8XD 3WS5A 4N1XA 3UE3A 4KZ5A 3CMZA 3MGPA 3HLFA 4RA7A 2IWDA 4AWLB 2VGJA 1BH9B 4JXWA 5GL9A 4JXSA 1P3FD 4R8PB 3W96D 3FYZA 1BH8B 1SHVA 1WE4A 4HEFA 4EQIA 2XFSA 1P3GA 1P3OB 5B40D 3HUMA 3MGSA 3MBZA 3MZFA 3MGPB 2RCXA 3P98A 4Z9QA 3AZFB 2F8NG 1BUEA 1K4FA 2R9XA 4WBGA 3O62A 3IF6B 4GD8A 4S2JA 1BLPA 4GKUA 4E6XA 3AZMC 1YLWA 1W8YA 5CHMA 3OPLA 1P3GB 3LZ0D 3C1BA 3MGSB 1DY6A 2ZC3B 4E6WA 3S1YA 4WZ5C 3NC8A 3UTAC 3HLBA 1BLSA 3O62B 4QLCC 4WU9D 3REIC 2W8SA 2XFTA 3VP1A 4DKIA 4X23D 2EXAA 1IEMA 5F1GA 3WX7A 1WYBA 4N92A 4J8WA 5B2JA 2RL3A 3SH8A 4S2NA 3ZG7B 3C1BB 3AZLB 3MGQB 4NK3A 4YS3D 3MVDA 2G5IC 5B33A 1GA0A 2Q9MA 4GN2A 5JYOA 5FUGA 2WUQA 3QNBA 4LD9A 2PYOD 3S22A 5GXQC 3ZVWA 1MWSA 5AV8A 2WAFA 2J8PA 1ZKJA 1TVFA 3LEZA 4E44A 5DVAA 4J8WB 5B2JB 1XA1A 3C4PA 1M1AA 3WTPA 3MVDB 2RIQA 3LELA 5B33B 5AQAA 3AZKC 1KE4A 5D3OA 5EOEA 5AV5C 4LD9B 4ID4A 2PU4A 1U35B 3E2LA 1PW8A 4DDSA 3AV2A 3A6NC 2V1ZA 1K54C 4OJLA 2YFWB 4BD0A 4JJND 3B6GB 5B1MA 3GR2A 3C1CD 3EQVA 5EOOA 3WTPB 1HQ3D 3X1VD 1DJAA 1XPBA 3LO7A 3X1SA 4Z66C 3AV1C 3V50A 1KE0A 2XR0A 4ZDXA 3MGRD 1S32A 5DF8A 3AZNA 5G49B 1K25A 4YM6C 3G2YA 1Q2PA 3W99C 4ZUXD 1P3AC 3B3XA 3RXXA 4MBKA 4KG6A 5B1MB 3EPLA 2J9PA 4WNNB 5CXWA 3AFAC 2F2AC 1YQSA 4OPZA 1H8ZA 4ZBEA 3Q7ZA 1P3PC 4JBFA 1S32B 1F66C 4NFTA 2ZC5B 2NZDD 5FAOA 1N4OA 4G91B 2ZC6B 4IVIA 4X68A 2JE5A 5FI7A 3KSYA 4Y0OA 4WV4B 1KGEA 3C5AA 5DF9A 1BFMA 2H5SA 5E5AD 2EX8A 3LZ1B 5DNMD 3NBLA 3WS1A 1P3IA 3AYWC 4HBTA 2FJ7D 5B1LC 3W97D 2AROA 1VM1A 1EROA 1TDLA 1WWSA 1GCEA 1JFIA 4XZQA 3FZCA 5CTMA 5G18A 3SS5A 1G6AA 4IBCA 3RELA 1KVLA 4BD1A 5GHXA 1P3IB 4JF4A 3GVBA 1MPLA 4HGAC 2ZY3A 4OOMA 2DNSA 5M1AA 4JXGA 5FAQA 3W98C 4MNRA 5A92A 3IH9A 1J9MA 4YINA 1ERMA 1PWDA 5AQ7A 1K57C 1ULYA 3ZNTA 1YU4A 3RELB 3TU4B 4DE1A 4RX3A 4BL2A 4J8XA 2Y2PA 2BLSA 2WADA 4EO5C 1H3OA 5AY8D 3REKB 1MWRA 1P3BC 5AV9C 3VSLA 3UTBC 3W4PA 1P3FA 5E2EA 3HUNA 5GSUA 4H9OA 3NQUA 1XGIA 5FASA 5B31A 1P3KD 1EQZC 4IEDA 3IH8A 1H8YA 2XD5A 1W2EA 3AZHA 3M6HA 2CV5C 4CJNA 2V2FF 4H9PB 4OJPA 1H3OB 4FSFA 2WK0A 1BLCA 2ZM2A 3H0MC 4DXCA 1P3FB 2BYMA 3O88A 3UPOA 3W96B 3KUYC 4H9OB 4OOLA 1PZRA 1M18D 4Z2MG 2Q9NA 3O86A 1KX3C 3AGFA 1AOID 3LZ0A 1JWPA 4GZBA 1CI8A 2P9VB 5B40B 1O07A 3G4PA 3F6TA 4XUJC 2NQBC 4GB7A 1B6WA 4R4RA 5AV8D 3AN2C 5HAQA 4S2MA 5AVBC 3UPPA 3ZG8B 1BZAA 5A93A 3AZGD 1K55C 5BS7C 2WAEA 5CP6D 4WU9A 4BJPA 3AZID 1S6RA 4Y7PA 5F83A 1M1AD 2WGWB 3GRJA 3LELD 2XH9A 3ZNYA 3V3RA 4K0WA 3AZEC 5FI2A 1OMEA 4OQHA 3LZ0B 4GHLA 3NQJA 5BT1D 3KUYD 3AV2D 3IWQA 4PM8A 2HDQA 4JLFA 4MBFA 3BFCA 3UT9C 2PYOA 5EUAA 1NY0A 1KX3D 5BNXA 3WAAC 4LENA 4WZSB 5E43A 2Y59A 4WU9B 1K38A 3WTPE 4OP8A 3REHC 4PM6A 4X23B 3X1SD 4WZ5A 1ZC2A 2X02A 1KX5C 3UTAA 5AVBD 4YS3B 4KZ8A 2VQRA 2F8NH 3AZND 4QLCA 3FKVA 3REIA 4X56A 3L25A 3UE0A 3GV9A 3IT9A 1HTZA 3L27A 2PYOB 4JF6A 4LV1A 4BENA 1CEGA 1NYMA 4OVDA 5AV6D 3MNNC 3HUOA 4PM5A 5B0ZC 4QNLA 5IHVA 5BPVA 2Y2LA 3ZGAB 5B32C 3UNWA 1P3MD 3X1TC 3O3VA 3C1CA 2WYXA 1HQ3A 5I94A 1HTAA 4U0XA 2WGVA 5GXQA 5BOHA 2Y2QA 4PPRA 2HIOC 5JRGC 3MGRA 3EPKA 3ZG0A 5HW3A 5GHZA 3IXHA 1TZYD 2V20A 3IHAA 5HFOA 4OH0A 4KGCC 4BQMA 5GT3C 4JJNB 5AV5A 2XGNA 3C1CB 4NY2A 2CC1A 1HQ3B 3X1VB 4NYUA 5AVCC 2JC7A 3KXBB 1XGJA 5CEDA 4LCMA 3A6NA 3MGRB 3V5MA 3ZDJA 3C7VA 4ZUXB 2ZM0A 3PAEA 4XZQD 5CPKC 1L0DA 3UDFA 3BLSA 3AV1A 1ID3C 3PBOA 2H0YA 3HBRA 5E5AA 1KX4C 4KUDC 3B6FD 3ZG5A 3AL0C 3NDEA 1TDGA 2IO5B 5F99B 4J8VC 4IBGA 5EVID 3VH6A 2NZDB 3MZEA 5FQJA 4KHAA 4IBKA 3OCLA 3WRTA 5HARA 1FCNA 2IWBA 5E5AB 5GLAA 2YFVA 5DNMB 4DQYB 4LV0A 3G31A 4NETA 4BLMA 5B2IC 2FJ7B 3WS2A 3REJC 4DF6A 1JWVA 3W97B 3DTMA 3UO9A 5GSUD 1BSGA 3VMAA 3EPJA 1ERQA 3BFFA 5B31D 3KWQC 1P34C 3NI9A 3WWXA 5M19A 2YFVB 1KU5A 3WA9D 3AZHD 2Y2GA 3BEBA 3X1UC 4MEZA 2ZY4A 2XF3A 3D4FA 3IWIA 4WU8C 2G2UA 3I7JA 1E4DA 4GNUA 1WWIA 4N1HA 5AY8A 3AZJC 3GTCA 2ZC7A 3SH9A 3LJAD 4GDNA 4PM9A 5CHJA 5TGFA 3TSGA 5B0YC 5B2ID 2IWCA 2WZXA 2X71A 3Q7VA 1P3KA 3BLMA 2P74A 1KE3A 5F1FA 3HLGA 3V9RA 1FOFA 1E3UA 3A1IA 2ZQ9A 4J8UC 5DNNC 5DTKA 3VH6W 4S2IA 1K57A 5AY8B 1PWGA 4DRBA 5GT0C 1FCMA 4H9SC 1KVMA 4MBHA 3UDIA 3NY4A 1ZLAC 4WMCD 3UY6A 4E3IA 3WKJC 3Q7VB 1M18A 1P3KB 1PW1A 2EFUA 3V9RB 3W4QA 5AV9A 1ZG6A 1G68A 4DXBA 1AOIA 3UTBA 1YLPA 3AZMD 5FQMA 1RGZA 4HESA 1ONHA 1KDSA 2JSSA 4IBFA 1P3LC 4B88A 2G5HC 1EQZA 4UPKA 4OPQA 3AZGA 3VP3A 3A1KA 5CP6A 2E8IA 2CV5A 3AZIA 1M18B 3UTAD 4H9QA 4QLCD 1AOIB 4WZ4A 4ZBJB 3REID 4Z5TC 1FSYA 5FUGB 4R4SA 1ZLAD 3OCNA 3KUYA 1LI9A 5CPIC 4C3QA 5AV8B 5CECA 5U47A 4E3NA 2EX2A 1Q9CA 2HUEC 1KX3A 3BFGA 3UPNA 4OQGA 4BL3A 3AZGB 5CP6B 3HONA 3SH7A 5B24C 4KG2A 3LY3A 5FQQA 3AZIB 4OQ0A 2HDSA 2NQBA 1M1AB 3LELB 2BG1A 1EI5A 5GXQD 4R23A 3GSGA 5TR7A 4P85A 5AVBA 1N1JA 1K55A 4S2PA 3AV2B 4Q8IA 4NZ1A 2ZQ8A 4H9RA 4Z2MH 3AZKD 3AZEA 4D2OA 1KGGA 5AV6A 5AV5D 5E2GA 5CGWA 3G2ZA 1ES3A 3DW0A 3X1SB 5CPJC 1P3MA 5GLDA 3A6ND 4QHCA 1YM1A 3WAAA 4P0MA 2RVQC 1XP4A 3AZNB 4R1GA 2EX6A 3V39A 4AWLC 3REHA 5C3IB 4H9RB 4UHUA 4Z66D 1YLZA 5HAPA 4R8PC 5AV6B 3AV1D 4IBEA 1TZYA 3OPHA 2EXBA 4B4ZA 4GH9A 5JA4A 1Y54A 2HPBA 5CGXA 4YM6D 1P3MB 4FH2A 3R45A 1P3OC 2ZQ7A 3W99D 4XUZA 1P3AD 1PI5A 1YLJA 4CSRA 3HREA 3MGPC 3MNNA 4OJOA 2HP6A 2ZMAA 3B0DB 1YU3A 5B0ZA 3WS0A 3AZFC 4NZ4A 1ALQA 3AFAD 3IF6C 1TZYB 4LV2A 1P3PD 5F82A 4P87A 4GHAA 1F66D 3HSHA 3N8RA 1XXMA 4IBIA 2Y2KA 5CGSA 2HIOA 3R45B 1P3GC 1FSWA 1YLYA 3IWOA 3MGSC 5AQ9A 4M3KA 3B6FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A91 A;  3A3I A;  1GHM A;  5EUA A;  1DJB A;  3IXD A;  1NY0 A;  2ZJ9 A;  3V3S A;  5EVI A;  1HD8 A;  2VGK A;  4LEN A;  5E43 A;  1LL5 A;  3RXW A;  1SDN A;  1YT4 A;  1I2S A;  2Y59 A;  1K38 A;  3BYD A;  4RYE A;  4OP8 A;  2Z2M B;  3UN7 A;  3CJM A;  4PM6 A;  3C7U A;  3N6I A;  5GHY A;  4UAA A;  4JXV A;  2WKH A;  3Q82 A;  4OQI A;  4WZ5 A;  1ZC2 A;  3Q07 A;  5HAI A;  3WS5 A;  2X02 A;  3MKE A;  4N1X A;  1YMS A;  3UE3 A;  3IXG A;  3ITA A;  4KZ8 A;  4KZ5 A;  4X6T A;  3CMZ A;  3AGE A;  3HLF A;  4RA7 A;  4GOG A;  4X53 A;  2IWD A;  4QU3 A;  3FKV A;  1CEF A;  4X56 A;  3UE0 A;  2VGJ A;  3GV9 A;  1PIO A;  1WYC A;  1AXB A;  1HTZ A;  3IT9 A;  3MKF A;  4OPR A;  4QY6 A;  4JXW A;  5GL9 A;  4JF6 A;  4JXS A;  4EUZ A;  2UWX A;  2Y2M A;  4LV1 A;  4BEN A;  5EVI B;  1CEG A;  1NRF A;  3FYZ A;  1NYM A;  2WKI A;  3N8S A;  4OVD A;  1JTD A;  3HUO A;  2J8Y A;  2A49 A;  1SHV A;  1ONG A;  1WE4 A;  5FA7 A;  3VP2 A;  4HEF A;  4PM5 A;  4OPY A;  4KZ7 A;  5IHV A;  4EQI A;  1JVJ A;  4KQR A;  1VQQ A;  2XFS A;  2Y55 A;  2Y2L A;  3ZGA B;  3UNW A;  5GLC A;  3O3V A;  3HUM A;  3M2J A;  2WYX A;  5I94 A;  3MBZ A;  1I2W A;  4R3J A;  4MLL A;  4U0X A;  2WGV A;  3MZF A;  1LI0 A;  3M6B A;  1E3U D;  3DWZ A;  4X55 A;  5BOH A;  2Y2Q A;  4PPR A;  2RCX A;  3P98 A;  4E3J A;  4Z9Q A;  4WYY A;  5E2F A;  3ZG0 A;  1BUE A;  1K4F A;  2R9X A;  4WBG A;  2ZQA A;  5CER A;  2XDM A;  4CPK A;  5HW3 A;  2QMI A;  5GHZ A;  1C3B A;  3IXH A;  1IKG A;  3IF6 B;  1IYS A;  1LHY A;  4GD8 A;  3OPP A;  4S2J A;  1BT5 A;  1CI9 A;  2V20 A;  1BLP A;  3IHA A;  1QME A;  4GKU A;  3PBS A;  4OP5 A;  4KZB A;  4E6X A;  1YLW A;  1IYQ A;  1W8Y A;  4OH0 A;  3A3J A;  3OPL A;  5CHM A;  5HFO A;  4BQM A;  2XGN A;  3QNC A;  1M6K A;  2CC1 A;  1DY6 A;  1TEM A;  2ZC3 B;  4E6W A;  2JC7 A;  4OLG A;  2OLV A;  1MBL A;  3S1Y A;  1XGJ A;  4EBL A;  5CED A;  4WZ5 C;  5DTS A;  3W8K A;  3NC8 A;  4LCM A;  3BFD A;  4JPM A;  4XUX A;  4JF5 A;  1IEL A;  3VP0 A;  3V5M A;  3HLB A;  1BLS A;  1MY8 A;  3ZDJ A;  5FAT A;  2C5W B;  4WEL A;  3C7V A;  5KSH A;  5HX9 A;  2OV5 A;  3PAG A;  3OPR A;  4FCF A;  2XFT A;  4EWF A;  2ZM0 A;  3VP1 A;  3PAE A;  4DKI A;  3ZHH A;  2EXA A;  1IEM A;  1L0D A;  3A3D A;  4LV3 A;  3UDF A;  5F1G A;  2Y2I A;  1N9B A;  3BLS A;  5EPH A;  3VOZ A;  1WYB A;  3IXB A;  3HLC A;  4N92 A;  2RL3 A;  1LL9 A;  4S2N A;  3SH8 A;  3ZG7 B;  2WKE A;  3PBO A;  2H0Y A;  2ZQC A;  3HBR A;  4NK3 A;  4OLD A;  4EBP A;  4WMC A;  1NJ4 A;  2XQZ A;  1YLT A;  1GA0 A;  1MKI A;  2Q9M A;  4GN2 A;  1ESU A;  3ZG5 A;  5JYO A;  2WUQ A;  3OZH A;  4E3M A;  3NDE A;  3QNB A;  5HL1 A;  3FWL A;  1TDG A;  3S22 A;  2QZ6 A;  1LLB A;  5EVI D;  3VP4 A;  1MWS A;  4WM9 A;  3ZVW A;  1IKI A;  5AQB A;  2B5R A;  5FQI A;  3BRM A;  4L0L A;  2WAF A;  3MZE A;  4Y0U A;  5FQJ A;  1MWT A;  3RJU A;  5GLB A;  1ZKJ A;  1TVF A;  3Q81 A;  5DF7 A;  4HBU A;  3LEZ A;  1RP5 A;  1KGF A;  3HLD A;  3PBR A;  4DDY A;  5DVA A;  3FV7 A;  3OCL A;  3WRT A;  1XA1 A;  4OON A;  3C4P A;  1CK3 A;  1FCN A;  1SDE A;  1XA7 A;  5HAR A;  2IWB A;  2J7V A;  1NZO A;  3W4O A;  5GLA A;  5AQA A;  4K91 A;  1KE4 A;  4E3K A;  5D3O A;  5EOE A;  5DTT A;  4KZ3 A;  4LV0 A;  3G31 A;  3ISG A;  4K0X A;  4NET A;  4ID4 A;  2PU4 A;  3E2L A;  3S4X A;  1PW8 A;  4BLM A;  3WS2 A;  4DDS A;  4DF6 A;  2ZM8 A;  2X01 A;  1FCO A;  2OSU A;  4R3B A;  1JWV A;  3GMW A;  2QPN A;  2R9W A;  4ZAM A;  5KSC A;  2V1Z A;  5A90 A;  3HVF A;  1K54 C;  3DTM A;  3VFH A;  1ES5 A;  1L0G A;  1SKF A;  3BM6 A;  1NYY A;  3UO9 A;  4EBN A;  4BD0 A;  1BSG A;  3VMA A;  1ERQ A;  3GR2 A;  4OKP A;  3BFF A;  1L0F A;  3EQV A;  3JYI A;  5EOO A;  3E2K A;  1DJA A;  2XK1 A;  1XPB A;  3LO7 A;  2Y2N A;  1EWZ A;  3NI9 A;  3WWX A;  4H8R A;  1K56 A;  2JBF A;  3ZG9 B;  5M19 A;  1L2S A;  3BEC A;  1GA9 A;  3V50 A;  2Y2G A;  1KE0 A;  3BEB A;  4S2N C;  2XR0 A;  4ZDX A;  2HP5 A;  3G34 A;  1W5D A;  5KZH A;  4MEZ A;  5DF8 A;  4KZ6 A;  2XF3 A;  1W7F A;  3D4F A;  3IWI A;  3HLW A;  2G2U A;  1K25 A;  1E4D A;  2G2W A;  3I7J A;  4GNU A;  3G2Y A;  1ES4 A;  1PZO A;  1Q2P A;  4N1H A;  3GTC A;  3B3X A;  1K6S A;  2ZC7 A;  4U3T A;  3SH9 A;  1SCW A;  3Q1F A;  3RXX A;  1BUL A;  4KEN B;  2C6W B;  4GDN A;  4MBK A;  4KG6 A;  4PM9 A;  2DRW A;  2XEP A;  1Z6F A;  2J9P A;  3EQU A;  4X69 A;  5CXW A;  3IF5 A;  5CHJ A;  1GHI A;  5TGF A;  3TSG A;  2HDU A;  2IWC A;  2WZX A;  4QY5 A;  3AGD A;  4DRT A;  2X71 A;  1YQS A;  4OPZ A;  3Q7V A;  2P9V A;  3HLE A;  1GHP A;  1W8Q A;  2P74 A;  3BLM A;  1H8Z A;  1KE3 A;  4ZBE A;  5F1F A;  3Q7Z A;  3HLG A;  3G35 A;  1FOF A;  4JBF A;  1E3U A;  4QB8 A;  5EE8 A;  5FSR A;  2XLN A;  2ZQ9 A;  2ZC5 B;  5FAO A;  1N4O A;  2ZC6 B;  3GQZ A;  4IVI A;  1K54 A;  4S2I A;  2JE5 A;  1K57 A;  4X68 A;  1JTG A;  5DTK A;  1PWG A;  1H5X A;  5FI7 A;  3VFF A;  4Y0O A;  4B4X A;  1FCM A;  1KGE A;  2ZD8 A;  1KVM A;  4MBH A;  3C5A A;  1JWZ A;  1W79 A;  5DF9 A;  3UDI A;  1NXY A;  3ZFZ A;  2H5S A;  3NY4 A;  4ZJ3 A;  2WGW A;  4WMC D;  3UY6 A;  2Y2H A;  2GDN A;  4E3I A;  4WEK A;  2Z2L B;  2EX8 A;  4N9L A;  4S2K A;  1K4E A;  4OOY A;  1RCJ A;  3HL9 A;  3NBL A;  3Q7V B;  2Y91 A;  4IBX A;  1BTL A;  3WS1 A;  1PW1 A;  2EFU A;  5EVL A;  3O87 A;  4HBT A;  3W4Q A;  1MXO A;  1ZG6 A;  4UA9 A;  1G68 A;  3A3E A;  4DXB A;  2HP9 A;  1YLP A;  4KQO A;  1VM1 A;  4UA6 A;  1K6R A;  5FQM A;  1RGZ A;  1ERO A;  3M2K A;  3MFD A;  3LCE A;  4HES A;  1TDL A;  1ONH A;  5JYP A;  1KDS A;  2EX9 A;  4YFM A;  1FR6 A;  3G32 A;  5CTN A;  3QHY A;  4E3L A;  5FI6 A;  4B88 A;  1GCE A;  1S0W A;  2JCH A;  3A3F A;  3FZC A;  5CTM A;  5G18 A;  4OPQ A;  5CEB A;  1HZO A;  3DWK A;  4GDB A;  4IVK A;  1G6A A;  1ZG4 A;  3SS5 A;  3VP3 A;  2ZQD A;  2E8I A;  1KVL A;  4BD1 A;  5GHX A;  1O7E A;  4JF4 A;  3GVB A;  1MPL A;  1IYO A;  4OOM A;  1YMX A;  2DNS A;  3WRZ A;  4KG5 A;  4WZ4 A;  5M1A A;  4E3O A;  4JXG A;  1FSY A;  5FAQ A;  4EV4 A;  4MNR A;  4R4S A;  3TOI A;  4O7D A;  5A92 A;  5E2H A;  1U60 A;  1ESI A;  3IH9 A;  3OCN A;  1XX2 A;  1J9M A;  1LI9 A;  4F94 A;  4C3Q A;  4YIN A;  1ERM A;  4DE2 A;  5U47 A;  2J9O A;  4E3N A;  2EX2 A;  3N7W A;  5CEC A;  4KZA A;  1PWD A;  4U0T A;  5AQ7 A;  5FQ9 A;  1K57 C;  3BFG A;  3UPN A;  1M40 A;  4RX2 A;  4DE3 A;  4OQG A;  4BL3 A;  5M18 A;  3P09 A;  1K56 D;  3ZNT A;  3SH7 A;  4GD6 A;  1KDW A;  4KG2 A;  3LY3 A;  5FQQ A;  4OQ0 A;  4PM7 A;  3C4O A;  2HDS A;  2FFY A;  4ZJ1 A;  5FDH A;  1HVB A;  3PBT A;  2BG1 A;  1EI5 A;  4FH4 A;  4R23 A;  1E25 A;  3GSG A;  4RX3 A;  5FAP A;  2OLU A;  3MXS A;  4BL2 A;  5TR7 A;  4DE1 A;  2Y2P A;  1QMF A;  4XXR A;  2BLS A;  4P85 A;  2WAD A;  4N9K A;  1MWR A;  3FKW A;  3TG9 A;  1K55 A;  4S2P A;  5CHU A;  5CRF A;  1NZU A;  4Q8I A;  3IF6 A;  2I72 A;  3N8L A;  2ZQ8 A;  3VSL A;  3SS3 A;  2HDR A;  3W4P A;  2A3U A;  4A5R A;  2PU2 A;  2WZZ A;  5E2E A;  3NCK A;  3HUN A;  4D2O A;  1FQG A;  1KGG A;  4ZTK A;  1XGI A;  5E2G A;  5FAS A;  5L2F A;  5CGW A;  3G2Z A;  2ZLY A;  4QJG A;  1ES3 A;  4UA7 A;  4IED A;  3IH8 A;  2Y2J A;  1H8Y A;  3DW0 A;  2XD5 A;  4KZ9 A;  3NIA A;  3MXR A;  1PZP A;  3M6H A;  4CJN A;  5GLD A;  2WGI A;  2V2F F;  4QHC A;  1YM1 A;  1ES2 A;  5EEC A;  4LCL A;  4P0M A;  1XP4 A;  1RGY A;  3VOY A;  1PI4 A;  4R1G A;  2EX6 A;  3V39 A;  4FSF A;  2WK0 A;  3CG5 A;  3ITB A;  1MWU A;  1BLC A;  2H0T A;  2ZM2 A;  4QD4 A;  4UHU A;  3SS4 A;  4DXC A;  3O88 A;  3UPO A;  1DJC A;  2ZC4 B;  1YLZ A;  5HAP A;  4KQQ A;  5EVI C;  5FQK A;  4OOL A;  1XKZ A;  4Y0T A;  2H10 A;  3MZD A;  3UE1 A;  3OPH A;  4WEJ A;  3VSK A;  2EXB A;  2Q9N A;  3O86 A;  4B4Z A;  3UDX A;  1I5Q A;  4S2O A;  2HPB A;  1Y54 A;  5CGX A;  1FR1 A;  3AGF A;  1PWC A;  4P6B A;  1PYY A;  1JWP A;  4FH2 A;  4GZB A;  1CI8 A;  2P9V B;  2ZQ7 A;  4RVA A;  1O07 A;  3G4P A;  3CZD A;  4XUZ A;  1PI5 A;  1YLJ A;  4GB7 A;  4R4R A;  2DCF A;  3WS4 A;  5TFQ A;  1L0E A;  3HRE A;  3ZCZ A;  5J8X A;  2HP6 A;  2ZMA A;  5HAQ A;  2Y2O A;  4S2M A;  2XD1 A;  4R0Q A;  3WS0 A;  1Q2Q A;  3BFE A;  3UPP A;  3ZG8 B;  1BZA A;  4PMA A;  2FFF B;  5A93 A;  1ALQ A;  3IHB A;  1K55 C;  3IQA A;  3OC2 A;  2WAE A;  4BJP A;  3IF6 C;  3ZVT A;  1BLH A;  4LV2 A;  4FD8 A;  1S6R A;  3PTE A;  3G30 A;  4Y7P A;  5F82 A;  5F83 A;  4P87 A;  2WGW B;  3N8R A;  4S2L A;  1IYP A;  3GRJ A;  1XXM A;  2XH9 A;  3ZNY A;  3V3R A;  2Y2K A;  4K0W A;  4DE0 A;  4IBR A;  5FI2 A;  1OME A;  3N4I A;  2EFX A;  4OQH A;  5CGS A;  3SOI A;  1FSW A;  1YLY A;  4KZ4 A;  3IWO A;  4C6Y A;  4JKT A;  3LY4 A;  3PBN A;  4C75 A;  5AQ9 A;  2Y4A A;  4ZJ2 A;  2PBY A;  4M3K A;  5KMW A;  3IWQ A;  4PM8 A;  3NDG A;  2HDQ A;  3PBQ A;  4JLF A;  4MBF A;  3BFC A; 
#chains in the Genus database with same CATH topology
 2Q0O A;  5FEG A;  2W1T A;  2ARO B;  3IXD A;  2ZJ9 A;  5GT3 A;  5EVI A;  3PR6 A;  4Y15 A;  2ZMF A;  3RXW A;  3O62 C;  4E45 A;  1ED7 A;  1S1Y A;  3BYD A;  3ICY A;  3IX8 A;  1JFI B;  4XZQ B;  4G92 B;  3AYW D;  3CJM A;  1E15 A;  5GHY A;  2VK3 A;  2WKH A;  5HAI A;  5B1L D;  3V67 A;  3C1B C;  1G5U A;  3AZL C;  3MGQ C;  1YMS A;  4G3K A;  3ITA A;  4X6T A;  3AGE A;  1HLU P;  3B6F B;  1PIO A;  1WYC A;  1AXB A;  1L6J A;  4OPR A;  3FPV A;  5CPK A;  4LG2 A;  3PYP A;  4EUZ A;  2UWX A;  2V0W A;  1TS6 A;  3U4L P;  5EVI B;  1NRF A;  5G4Y A;  3N8S A;  3T12 B;  2A49 A;  4NZ3 A;  1DP6 A;  5FA7 A;  4OPY A;  4KUD A;  4KZ7 A;  1JVJ A;  4KQR A;  1VQQ A;  5FEF A;  3ZYT A;  3W98 D;  1P9R A;  5GLC A;  4J8W C;  5B2J C;  2EWV A;  2KDK A;  3B0B A;  4MLL A;  3MVD C;  5B33 C;  1E3U D;  3DWZ A;  4X55 A;  3VH5 A;  3WA9 A;  4J8X B;  5E2F A;  4LD9 C;  2ZQA A;  4CPK A;  1U35 C;  2QMI A;  1C3B A;  1IKG A;  3OPP A;  4NE3 A;  5CX7 A;  1BT5 A;  1QME A;  4OP5 A;  3LJA A;  3KX0 X;  1OTB A;  5GSU B;  4UUZ A;  3NQU B;  3QNC A;  4MCW A;  5B31 B;  3B6G C;  1P3B D;  5B2I A;  3WTP C;  5AV9 D;  3REJ A;  3LIA A;  4OLG A;  2OLV A;  3WA9 B;  3AZH B;  4PAU A;  3UTB D;  4JGR A;  1IEL A;  3VP0 A;  2DF4 C;  1MY8 A;  4MDZ A;  4X1L A;  1WA9 A;  2C5W B;  3LFV A;  4WEL A;  5KSH A;  2OV5 A;  3PAG A;  3OPR A;  5KDM A;  4EWF A;  3ZHH A;  1EQZ D;  2MJ6 A;  4ME4 A;  2BYM B;  2M1C A;  4LV3 A;  3A3D A;  3LJA B;  4ESP A;  1N9B A;  5EM0 A;  5EPH A;  3VOZ A;  3IXB A;  3X1U A;  2CV5 D;  2WKE A;  3KFU G;  5B1M C;  2LY8 A;  4GCZ A;  4OLD A;  4EBP A;  4WMC A;  1NJ4 A;  5B2I B;  1YLT A;  3R4K A;  3LIB A;  4E3M A;  5HL1 A;  3FWL A;  1S32 C;  1IKI A;  2CWE A;  5FQI A;  3BRM A;  5KDM B;  4L0L A;  4G91 C;  3AZM A;  5GLB A;  4HBU A;  4HI4 A;  1KGF A;  3HLD A;  3PBR A;  3FV7 A;  4OON A;  1ZHH B;  1CK3 A;  4XUJ D;  2NQB D;  1XA7 A;  3W4O A;  1TS8 A;  4K91 A;  2QJ5 A;  4Y3I A;  4E3K A;  3LR0 A;  4J8U A;  3AN2 D;  3LZ1 C;  3K2N A;  5DTT A;  3S7P A;  3VH5 W;  3NQJ B;  4KZ3 A;  2QKP A;  3BY9 A;  3ISG A;  3F1P B;  3S4X A;  4DRA A;  4IJE A;  2X01 A;  1FCO A;  1FIL A;  2OSU A;  4R3B A;  3GMW A;  2R9W A;  4HJ4 A;  1N9N A;  5KSC A;  5A90 A;  3HVF A;  1ZLA A;  3IBJ A;  3VFH A;  3AZM B;  1L0G A;  3BM6 A;  5BNX B;  3WKJ A;  3AZE D;  4EBN A;  2HJ9 C;  3MMH A;  2M7U A;  3ULF A;  2ZM5 A;  4OKP A;  3E2K A;  3B0C W;  3KSI A;  3T1Q B;  3ZG9 B;  4GJ4 A;  2JBF A;  4Q0J A;  2V5O A;  3UTA B;  3UT9 D;  3L29 A;  1P3I C;  5KZH A;  4X1M A;  3LYX A;  4G3V A;  3WAA D;  5HDC A;  4KZ6 A;  4QLC B;  1W7F A;  1P3L A;  3REI B;  1ES4 A;  3REH D;  4U3T A;  4I39 A;  3Q1F A;  4GHI B;  4KEN B;  1KX5 D;  2PR5 A;  2XEP A;  4X69 A;  2W3E A;  3IF5 A;  1GHI A;  3AZK A;  3AGD A;  4DRT A;  4Z5T A;  3MQO A;  3HLE A;  1GHP A;  1W8Q A;  3REL C;  1TAF A;  4GS9 A;  3TU4 C;  3QP8 A;  5GXQ B;  5EE8 A;  5FSR A;  2XLN A;  4H6J A;  3MNN D;  5DKL A;  1K54 A;  5B0Z D;  1JTG A;  1Z2C B;  3REK C;  1XJ3 A;  5HWV A;  1W1V A;  5B32 D;  5B24 A;  1JWZ A;  3X1T D;  1NXY A;  4Z66 A;  2Y2H A;  3AZK B;  2GDN A;  4WEK A;  4N9L A;  4S2K A;  5AV5 B;  1R4V A;  3P5J B;  4OOY A;  2HIO D;  3HL9 A;  4I5S A;  5JRG D;  3KSF A;  1BTL A;  4OJ5 A;  5EVL A;  3O87 A;  3E4O A;  1MXO A;  4NZ5 A;  4I3I A;  2O99 A;  3A3E A;  4YM6 A;  1T3U A;  4H6J B;  3W99 A;  3LI8 A;  5B31 G;  3A6N B;  1P3A A;  4KQO A;  2XSS A;  4EES A;  4MN5 A;  4KGC D;  5GT3 D;  1GXD A;  3MFD A;  3LCE A;  5JYP A;  4LRZ E;  2EX9 A;  4YFM A;  3BY8 A;  1FR6 A;  3E4Q A;  1J7M A;  3QHY A;  3WD1 A;  1OTI A;  3L26 A;  3A3F A;  4Z66 B;  5AVC D;  5CPJ A;  1STZ A;  1P3F C;  5CEB A;  1YU2 A;  3AFA A;  3W96 C;  1HZO A;  3DWK A;  1ZG4 A;  4GDB A;  4IVK A;  5HWT A;  2ZQD A;  3AV1 B;  3BQA A;  4WF0 A;  1P3P A;  3FDD A;  1E6N A;  3VE3 A;  4EET B;  1F66 A;  2JKR M;  2PAV P;  1YMX A;  4YM6 B;  3WRZ A;  4E3O A;  4EV4 A;  3W99 B;  3TOI A;  4HMC A;  1P3A B;  5B40 C;  2PT7 A;  4O7D A;  1GPF A;  5E2H A;  5CPK D;  1U60 A;  3R7W A;  1ESI A;  3N3F A;  4R8P A;  1XX2 A;  4F94 A;  4IBD A;  3OLO A;  1BH8 A;  2ZL1 A;  1ID3 D;  3N7W A;  2R78 A;  4KHA B;  1KX4 D;  4U0T A;  5FQ9 A;  4KUD D;  4DE3 A;  4NG2 A;  3AFA B;  3P09 A;  3VV4 A;  1K56 D;  2J80 A;  1P3O A;  5IT5 A;  1KDW A;  5F5Y A;  4PM7 A;  3C4O A;  4ZJ1 A;  1M19 C;  1P3P B;  3AYW A;  1HVB A;  4HMD A;  4J8V D;  1F66 B;  4P6Z S;  4FH4 A;  3QP2 A;  2DQN C;  2IOU A;  5FAP A;  5FDS A;  1QMF A;  4XXR A;  5B1L A;  3LIC A;  3LZ0 C;  1F5M A;  3AZF A;  3H7W B;  2HF6 A;  5MC7 A;  2YKH A;  3FKW A;  1F98 A;  1NZU A;  3IF6 A;  2ZL1 B;  3N8L A;  3T4L A;  3SS3 A;  2A3U A;  4A5R A;  1KOU A;  2WZZ A;  3UB9 A;  1F1E A;  1ACF A;  4WU9 C;  3RH8 B;  2ZLY A;  3AYW B;  3IBR A;  4UA7 A;  2Y2J A;  4X23 C;  3REJ D;  1F9I A;  3EG5 B;  5HWW A;  3W98 A;  3MXR A;  5B1L B;  4YS3 C;  4NKP A;  5EEC A;  4LCL A;  4LRX C;  1OGB A;  3SZT A;  2VGL S;  3CG5 A;  3ITB A;  1MWU A;  1M19 D;  2H0T A;  3KWQ D;  1P34 D;  4QD4 A;  3SS4 A;  2PYO C;  4KQQ A;  1YPR A;  5FQK A;  1XKZ A;  4Y0T A;  3MZD A;  3X1U D;  2YKF A;  3AZL A;  2W27 A;  3MGQ A;  3VSK A;  3WD0 A;  4HGA B;  5CHL B;  4S2O A;  4WU8 D;  1PWC A;  4P6B A;  3W98 B;  4RVA A;  3AZJ D;  1P3B A;  3KYZ A;  2QJ7 A;  3WS4 A;  5TFQ A;  1L0E A;  2O9B A;  4EER A;  2ZY2 A;  2Y2O A;  3UB7 A;  2XD1 A;  1Q2Q A;  2VGL M;  3BFE A;  3UE6 A;  5HDD A;  5B0Y D;  4PMA A;  1IOU A;  1E6R A;  3OC2 A;  3IQA A;  3VH6 T;  1YU0 A;  1YU1 A;  2F8N D;  1IYP A;  4DE0 A;  4IBR A;  3N4I A;  4EEP A;  2EFX A;  4J8U D;  4JJN C;  5DNN D;  3QP6 A;  1A7W A;  4EO5 B;  3C1C C;  1P3B B;  4KZ4 A;  4JKT A;  5GT0 D;  1U35 A;  3PBN A;  1HQ3 C;  5AV9 B;  3X1V C;  4C75 A;  3A0S A;  5KMW A;  3NDG A;  3KXB C;  3UTB B;  3A3I A;  1GHM A;  1DJB A;  3MGR C;  3LEQ A;  3V3S A;  1HD8 A;  2VGK A;  3WKJ D;  1LL5 A;  4RQ9 A;  3L28 A;  2YFW A;  1YT4 A;  1I2S A;  3B6G A;  2VZW A;  3F1O B;  4G3W A;  4ZUX C;  1EQZ B;  3LIE A;  3N6I A;  3Q82 A;  4OQI A;  3Q07 A;  2CV5 B;  4XUJ A;  1YKD A;  3MKE A;  4H9Q B;  3IXG A;  4DJ2 A;  4X53 A;  4GOG A;  5G49 A;  1FIK A;  3AN2 A;  4QU3 A;  1P3L D;  1CEF A;  3MKF A;  4QY6 A;  2IO5 C;  3KUY B;  2Y2M A;  5F99 C;  5BS7 A;  3KS8 A;  4X25 A;  1DP9 A;  2WKI A;  3H0R C;  1JTD A;  3EPH A;  2NZD C;  2J8Y A;  1ONG A;  4WNN A;  4PKY A;  3VP2 A;  1KX3 B;  3NJA A;  3UME A;  2Y55 A;  3KXB D;  4Z5T D;  4XUJ B;  2NQB B;  3M2J A;  1I2W A;  5E5A C;  4R3J A;  3KS4 A;  5CPI D;  1LI0 A;  3M6B A;  3AN2 B;  1F2K A;  1LSX A;  5DNM C;  3UT9 A;  4E3J A;  5AVB B;  1AIW A;  4WYY A;  1LL8 A;  5F6A A;  3L2A A;  5CER A;  2XDM A;  1N1J B;  5TBM A;  2FJ7 C;  5B24 D;  1IYS A;  1LHY A;  5L10 A;  3T4O A;  2FZ0 A;  1CI9 A;  3W97 C;  3PBS A;  4KZB A;  1IYQ A;  2Y8H A;  3A3J A;  3AZE B;  4KQD A;  2J3T C;  3LZ1 A;  1KX5 A;  2ZY5 A;  1M6K A;  1K0K A;  1TEM A;  3TW8 A;  5F99 D;  1MBL A;  4EBL A;  4IUH A;  5DTS A;  3W8K A;  3BFD A;  3UT9 B;  4JPM A;  4Z1W A;  1DP8 A;  1T1C A;  3EEA A;  4XUX A;  4JF5 A;  1KS0 A;  3T4Q A;  3WAA B;  5HSQ A;  5FAT A;  5DJU A;  4CLC C;  2HGV A;  3H0L C;  1XFQ A;  4NXE A;  5HX9 A;  3KYQ A;  4FCF A;  3REH B;  1UR8 A;  5CPJ D;  2Y2I A;  5B32 A;  3X1T A;  3HLC A;  1KX5 B;  1LL9 A;  2HV1 A;  3KYE A;  2ZQC A;  3CPT A;  2RVQ D;  2XQZ A;  5JA4 B;  1MKI A;  2K7S A;  5JRG A;  1ESU A;  3OZH A;  2L5A A;  4B93 A;  4R8P D;  2QZ6 A;  1LLB A;  4CSR B;  3VP4 A;  4WM9 A;  3MNN B;  5AQB A;  2B5R A;  5B0Z B;  4Y0U A;  1OJ5 A;  1MWT A;  3RJU A;  5AY8 C;  4KGC A;  3Q81 A;  5KIZ A;  5DF7 A;  1RP5 A;  5B32 B;  4DDY A;  3X1T B;  1P3O D;  3D9Y A;  2OAP 1;  4OJ6 A;  1SDE A;  3TU4 A;  5HL6 A;  5J4E A;  2J7V A;  3MQ0 A;  3CPT B;  5AVC A;  1NZO A;  1B67 A;  3MGP D;  2HIO B;  5JRG B;  2JN7 A;  3AZF D;  1P3K C;  4K0X A;  3REK A;  1IFQ A;  5BO0 A;  2ZM8 A;  2XA7 M;  3GDI A;  1G28 A;  3A0R A;  4NXG A;  2QPN A;  2E8J A;  4ZAM A;  1YUE A;  3CUE C;  2W1T B;  1ES5 A;  1SKF A;  4KGC B;  5GT3 B;  1NYY A;  3CIT A;  4D60 A;  1ID3 A;  1P3G D;  3EWK A;  2LB9 A;  1L0F A;  3JYI A;  2OOL A;  1KX4 A;  3MGS D;  5AVC B;  2XK1 A;  5C5K A;  3L7H A;  2Y2N A;  1EWZ A;  2AVX A;  4H8R A;  1K56 A;  4HP9 A;  4ETX A;  1L2S A;  3S7Q A;  1N9O A;  1GA9 A;  3BEC A;  4S2N C;  1M18 C;  2HP5 A;  4H9P A;  5L07 A;  4J8V A;  1NLY A;  1W5D A;  3G34 A;  1V9Y A;  2VV6 A;  3K3C A;  5BO0 B;  1W63 M;  3O62 D;  3HLW A;  2G2W A;  1AOI C;  4ZBJ C;  1PZO A;  4EW7 A;  5CPK B;  1K6S A;  2W3H A;  1SCW A;  3BWL A;  3W96 A;  5TJJ A;  1BUL A;  4O0P A;  2C6W B;  5IS1 A;  3P01 A;  1ID3 B;  5AV8 C;  2DRW A;  3C1B D;  3AZL D;  1Z6F A;  3EQU A;  3MGQ D;  1KX4 B;  1YAX A;  4KUD B;  4H9N A;  2HDU A;  4QY5 A;  3AZG C;  2ACG A;  5CP6 C;  2P9V A;  5B40 A;  3AZI C;  4J8V B;  3G35 A;  1M1A C;  3LEL C;  4QB8 A;  2JKT M;  3U2A A;  4OUI A;  3GQZ A;  3KSH A;  1PNE A;  4Y5F A;  3VFF A;  5BT1 C;  4B4X A;  1H5X A;  2G7U A;  4FUW A;  1OTE A;  2ZD8 A;  3AV2 C;  1W79 A;  4J8W D;  5B2J D;  1M19 A;  1QO6 A;  3KWQ A;  1P34 A;  3ZFZ A;  3CAX A;  3EGD C;  4ZJ3 A;  3MVD D;  2WGW A;  4H9N B;  5B33 D;  1OT9 A;  4UUZ B;  2Z2L B;  1K4E A;  4GLQ A;  3JPU A;  1RCJ A;  2Y91 A;  4IBX A;  4LD9 D;  1U35 D;  4UA9 A;  3REJ B;  4WU8 A;  3X1S C;  2HP9 A;  3AZJ A;  1A0K A;  2PYR A;  1H8P A;  3LID A;  4UA6 A;  3D72 A;  1K6R A;  2FH5 A;  3M2K A;  3AZN C;  3G32 A;  5CTN A;  2B18 A;  4CQH A;  4HOI A;  4E3L A;  3B6G D;  1M19 B;  4HP4 A;  5FI6 A;  3KWQ B;  1P34 B;  1S0W A;  2JCH A;  5C3I C;  5B0Y A;  3WTP D;  4X23 A;  2GZA A;  2PD8 A;  3X1U B;  1N9L A;  5AV6 C;  1ODV A;  1O7E A;  4YS3 A;  5EV0 A;  4ARZ A;  2F8N A;  1IYO A;  1S4R A;  4WU8 B;  4KG5 A;  5DNN A;  1P3M C;  3AZJ B;  2VV8 A;  3TJZ C;  5GT0 A;  4NE5 A;  4H9S A;  4DE2 A;  2J9O A;  3IP4 C;  4KZA A;  5B1M D;  4Z2H A;  3B0D C;  5B0Y B;  1M40 A;  1MZU A;  4RX2 A;  5M18 A;  4LLO B;  4GD6 A;  2P08 A;  1GSW A;  2FFY A;  1TZY C;  5FDH A;  3PBT A;  2F8N B;  2VX8 A;  1S32 D;  5B32 G;  1E25 A;  4DJ3 A;  2OLU A;  3MXS A;  4J8U B;  5DNN B;  4N9K A;  5GT0 B;  3TG9 A;  5CHU A;  5CRF A;  3VH5 T;  3H9W A;  2I72 A;  1OJG A;  2HDR A;  1ZLA B;  4BBU A;  2ARO C;  2PU2 A;  3NCK A;  2EWW A;  3WKJ B;  2DMW A;  1FQG A;  2D49 A;  4ZTK A;  3LZ1 D;  4JJN A;  1NWZ A;  5L2F A;  3FG8 A;  4IBB A;  4QJG A;  3X1V A;  4XZQ C;  4G92 C;  1V9Z A;  4BMW A;  3KXB A;  3HJK A;  2O9C A;  4KZ9 A;  4F3L A;  3NIA A;  3B0C T;  1PZP A;  2WGI A;  2ZMV A;  4I3J A;  4CAY A;  1ES2 A;  1ZTU A;  5CPI A;  1RGY A;  3VOY A;  1PI4 A;  1P3L B;  1W1P A;  3B6F C;  1UWN X;  3C38 A;  4JGP A;  4ZUX A;  3DAV A;  1DJC A;  2ZC4 B;  5AJG A;  5EVI C;  2H10 A;  3UE1 A;  4WEJ A;  2Z6D A;  1VB6 A;  4NE6 A;  1P3I D;  3UDX A;  1I5Q A;  1FR1 A;  4Z5T B;  1PYY A;  4F3L B;  4IJF A;  3CZD A;  1TAF B;  4GS9 B;  2BYK A;  1EAK A;  4CAY B;  5F99 A;  2ARO D;  5CPI B;  2DCF A;  1TS7 A;  3ZCZ A;  4NYY A;  5J8X A;  2HUE B;  2NZD A;  4J8X C;  2WKP A;  4Z2J A;  4WJ3 C;  1MC0 A;  4R0Q A;  3NUL A;  4HJ3 A;  2VEA A;  2V8C A;  2FFF B;  3IHB A;  5B24 B;  4UQI S;  3REL D;  4L9G A;  3PXP A;  3ZVT A;  1BLH A;  5BNV A;  4FD8 A;  3TU4 D;  3PTE A;  3G30 A;  5HDS A;  4S2L A;  1J3W A;  5G4Z A;  1GSV A;  5GSU C;  5HPF A;  5DNM A;  2KOI A;  4HH2 A;  3SOI A;  5B31 C;  1S1Z A;  4C6Y A;  2BYK B;  3LY4 A;  3REK D;  3T4T A;  3S7N A;  2Y4A A;  5L09 A;  4ZJ2 A;  2FJ7 A;  2PBY A;  3PBQ A;  1BH9 A;  3WA9 C;  4M6B A;  3AZH C;  3W97 A;  5A91 A;  3FKE A;  4IBJ A;  2F8N K;  1S4S A;  1SDN A;  1TF1 A;  2PRF A;  4LGW A;  4RYE A;  5BNV B;  2Z2M B;  3UN7 A;  3C7U A;  4UAA A;  4JXV A;  5CPJ B;  3LJA C;  4J8X D;  3WS5 A;  2ZOI A;  4N1X A;  3UE3 A;  4KZ5 A;  4CLC A;  3CMZ A;  3MGP A;  2W1R A;  2LB5 A;  3HLF A;  4RA7 A;  2IWD A;  5DKK A;  4LFU A;  4AWL B;  2VGJ A;  1BH9 B;  2KX6 A;  4JXW A;  5EM1 A;  3MJQ A;  3R7W B;  5GL9 A;  4JXS A;  1P3F D;  4R8P B;  1S67 L;  3W96 D;  3FYZ A;  1BH8 B;  3UB5 P;  1SHV A;  1WE4 A;  2A24 A;  4HEF A;  2OWJ A;  4EQI A;  2XFS A;  3T4J A;  3T1S A;  1P3G A;  1P3O B;  1L3L A;  5B40 D;  3CHW P;  4M4X A;  3HUM A;  4WL9 A;  3MGS A;  4JGQ A;  3MBZ A;  3MZF A;  2I9V A;  4P6Z M;  3MGP B;  3KO6 A;  1TD5 A;  2RCX A;  3P98 A;  4Z9Q A;  3AZF B;  3FPW A;  2F8N G;  1BUE A;  1K4F A;  2R9X A;  3TRC A;  4WBG A;  3DBA A;  3O62 A;  2Z6C A;  3IF6 B;  4GD8 A;  4S2J A;  1BLP A;  4GKU A;  4E6X A;  3AZM C;  1YLW A;  1W8Y A;  2PD7 A;  3OPL A;  5CHM A;  2IA2 A;  1P3G B;  3LZ0 D;  3C1B A;  3VE4 A;  3MGS B;  1DY6 A;  2ZC3 B;  4II7 A;  4E6W A;  3IS2 A;  3S1Y A;  3C30 A;  3K3D A;  4WZ5 C;  3NC8 A;  3UTA C;  1GOI A;  3HLB A;  1BLS A;  2PYP A;  4KUK A;  2XRO A;  5EFW A;  3O62 B;  4QLC C;  4ZRR A;  2ZBB A;  4FOF A;  4WU9 D;  3REI C;  2W8S A;  2XFT A;  3VP1 A;  4DKI A;  4X23 D;  2EXA A;  1IEM A;  5F1G A;  3WX7 A;  3DTI A;  5IU1 A;  4MB5 A;  1WYB A;  4N92 A;  4J8W A;  5B2J A;  2RL3 A;  3SH8 A;  4S2N A;  3ZG7 B;  3C1B B;  3AZL B;  2D01 A;  3MGQ B;  2INW A;  4NK3 A;  4YS3 D;  3MVD A;  2G5I C;  5B33 A;  1GA0 A;  2Q9M A;  5HPI A;  4GN2 A;  5JYO A;  5FUG A;  2WUQ A;  4HY8 A;  3QNB A;  5F68 A;  4LD9 A;  2PYO D;  3S22 A;  1W1Y A;  5GXQ C;  3ZVW A;  1MWS A;  5AV8 A;  1PDC A;  2WAF A;  2J8P A;  1ZKJ A;  3MQL A;  1TVF A;  3LEZ A;  4E44 A;  5DVA A;  4J8W B;  5B2J B;  4O8G A;  1XA1 A;  3C4P A;  1M1A A;  3WTP A;  3MVD B;  2RIQ A;  3LEL A;  5B33 B;  5AQA A;  1SZV A;  3AZK C;  1KE4 A;  4L9E A;  1DRM A;  5D3O A;  5EOE A;  5J3W A;  5AV5 C;  4WLA A;  4LD9 B;  4ID4 A;  2PU4 A;  1U35 B;  3E2L A;  1PW8 A;  4DDS A;  3AV2 A;  2EA9 A;  3CWF A;  3A6N C;  2V1Z A;  1XJ6 A;  1K54 C;  4OJL A;  4MN6 A;  3A0V A;  5A8B A;  1T19 A;  5HD3 A;  2YFW B;  4BD0 A;  4JJN D;  4K08 A;  3B6G B;  5B1M A;  3GR2 A;  2L1M A;  3GEC A;  3C1C D;  3EQV A;  5EOO A;  2UV0 E;  4YNR A;  3WTP B;  1HQ3 D;  3X1V D;  1DJA A;  5J7E A;  3NOT C;  1XPB A;  3LO7 A;  3X1S A;  4Z66 C;  2VJW A;  2JKR I;  3B47 A;  3AV1 C;  3V50 A;  1KE0 A;  2XR0 A;  4ZDX A;  3MGR D;  1UGU A;  1S32 A;  5DF8 A;  3AZN A;  1E88 A;  4XT2 A;  5G49 B;  2WKQ A;  1K25 A;  4YM6 C;  1JNU A;  3G2Y A;  1Q2P A;  3W99 C;  4ZUX D;  1P3A C;  3B3X A;  4IJG A;  3RXX A;  1XJ2 A;  4MBK A;  4KG6 A;  3RTY A;  4FTX A;  5B1M B;  3EPL A;  2J9P A;  4WNN B;  4LRY C;  5CXW A;  1CK7 A;  3AFA C;  2F2A C;  1YQS A;  4OPZ A;  5DFX A;  1H8Z A;  4ZBE A;  1EW0 A;  3Q7Z A;  1P3P C;  4JBF A;  1S32 B;  1F66 C;  3T1X A;  4NFT A;  2ZC5 B;  2NZD D;  5FAO A;  1N4O A;  4G91 B;  2ZC6 B;  4IVI A;  4X68 A;  2JE5 A;  5FI7 A;  3KSY A;  4Y0O A;  4EU0 A;  4O01 A;  4WV4 B;  1KGE A;  5TBM B;  3C5A A;  5DF9 A;  1BFM A;  2H5S A;  5E5A D;  2EX8 A;  3LZ1 B;  5DNM D;  3CI6 A;  3LR3 A;  3NBL A;  3WS1 A;  1P3I A;  3UMD A;  2BAS A;  3AYW C;  1Y4O A;  4HBT A;  2FJ7 D;  5B1L C;  1VET A;  3W97 D;  2ARO A;  1VM1 A;  1ERO A;  2J3T D;  1TDL A;  1WWS A;  2JKF A;  3BJN A;  1GCE A;  1JFI A;  4XZQ A;  2P04 A;  3CLO A;  5F69 A;  3FZC A;  5CTM A;  5G18 A;  3SS5 A;  1G6A A;  4IBC A;  1T1B A;  3REL A;  1KVL A;  4BD1 A;  5GHX A;  1P3I B;  4JF4 A;  3GVB A;  1MPL A;  4HGA C;  2ZY3 A;  3LR4 A;  4OOM A;  4CLC D;  2FN2 A;  2W3D A;  2DNS A;  5M1A A;  4JXG A;  5FAQ A;  3W98 C;  4MNR A;  1VET B;  5A92 A;  5LBR A;  1X0O A;  3IH9 A;  1D06 A;  1J9M A;  4YIN A;  1ERM A;  5DFY A;  1PWD A;  3KSG A;  5AQ7 A;  1K57 C;  1ULY A;  1PFL A;  3LUQ A;  2V0U A;  2O9A A;  3ZNT A;  1YU4 A;  3REL B;  4BWI A;  4HJ6 A;  3JVU A;  3TU4 B;  4CLC E;  3MSH A;  3VOL A;  4DE1 A;  4RX3 A;  4BL2 A;  4J8X A;  2Y2P A;  2BLS A;  2OWH A;  4TX8 A;  2WAD A;  1OTD A;  4EO5 C;  1H3O A;  5AY8 D;  4HQA A;  4JGO A;  3REK B;  1MWR A;  1P3B C;  5AV9 C;  2PR6 A;  3WD4 A;  3VSL A;  3UTB C;  3WD2 A;  3W4P A;  1P3F A;  3NEC A;  5E2E A;  3HUN A;  1VHM A;  5GSU A;  4H9O A;  3NQU A;  1XGI A;  1Y28 A;  5B31 A;  4HNB A;  5FAS A;  1P3K D;  3TE8 A;  1EQZ C;  4IED A;  3IH8 A;  1H8Y A;  2XD5 A;  1LSV A;  1W2E A;  3AZH A;  3M6H A;  2PDR A;  2CV5 C;  4CJN A;  3H82 A;  2V2F F;  4H9P B;  2H28 A;  4OJP A;  1H3O B;  4EXO A;  4FSF A;  2WK0 A;  1W63 Q;  1BLC A;  1S66 L;  2ZM2 A;  3H0M C;  4DXC A;  1P3F B;  2BYM A;  3M7P A;  2W3F A;  3O88 A;  3UPO A;  3W96 B;  3KUY C;  1T18 A;  3C2W A;  4H9O B;  4OOL A;  4R3A A;  1PZR A;  4I3A A;  1M18 D;  4Z2M G;  2Q9N A;  3O86 A;  1KX3 C;  3AGF A;  1AOI D;  3LZ0 A;  1JWP A;  3RFB A;  4GZB A;  1CI8 A;  2P9V B;  5B40 B;  2O0Y A;  1O07 A;  3G4P A;  3F6T A;  3E98 A;  2K2N A;  3H82 B;  4PKY G;  4XUJ C;  2NQB C;  4GB7 A;  1B6W A;  4R4R A;  3D3O A;  5AV8 D;  2VKS A;  3AN2 C;  5HAQ A;  4S2M A;  5AVB C;  3UPP A;  5AVF A;  3ZG8 B;  1BZA A;  1OT6 A;  5A93 A;  3AZG D;  1K55 C;  5BS7 C;  2WAE A;  5CP6 D;  4WU9 A;  4BJP A;  1CJF A;  3AZI D;  1S6R A;  4Y7P A;  5F83 A;  1M1A D;  2WGW B;  3B33 A;  3NHQ A;  3GRJ A;  3LEL D;  2XH9 A;  3ZNY A;  3V3R A;  4K0W A;  3AZE C;  5FI2 A;  1OME A;  4OQH A;  3LZ0 B;  4GHL A;  3NQJ A;  5BT1 D;  2BTF P;  2K31 A;  3F1P A;  3MFX A;  3T4K A;  3KUY D;  3AV2 D;  3IWQ A;  4PM8 A;  2HDQ A;  4JLF A;  4MBF A;  3BFC A;  3UT9 C;  2PYO A;  5DJT A;  5EUA A;  1NY0 A;  1KX3 D;  5BNX A;  3WAA C;  4LEN A;  4WZS B;  5E43 A;  1OPX A;  2Y59 A;  4WU9 B;  1K38 A;  3WTP E;  4OP8 A;  3REH C;  4PM6 A;  4X23 B;  1OGG A;  1H8M A;  3X1S D;  4WZ5 A;  1ZC2 A;  3NOU C;  2X02 A;  1KX5 C;  3UTA A;  5AVB D;  4YS3 B;  4ARZ B;  3LIF A;  4KZ8 A;  3LGO A;  2VQR A;  2F8N H;  3AZN D;  4QLC A;  3FKV A;  3REI A;  4X56 A;  3L25 A;  3UE0 A;  3GV9 A;  3IT9 A;  1HTZ A;  3L27 A;  4GW9 A;  3EOI A;  2PYO B;  4JF6 A;  1TS0 A;  4LV1 A;  4BEN A;  4GHI A;  1CEG A;  1NYM A;  4OVD A;  5AV6 D;  3MNN C;  2HZ5 A;  3HUO A;  4QPR A;  2V1B A;  4PM5 A;  5B0Z C;  4QNL A;  5IHV A;  3UB8 A;  5BPV A;  2Y2L A;  3ZGA B;  5B32 C;  3UNW A;  1P3M D;  3X1T C;  3O3V A;  3C1C A;  2WYX A;  1HQ3 A;  5I94 A;  3ZQ5 A;  1HTA A;  4U0X A;  2WGV A;  5GXQ A;  1BYW A;  5BOH A;  2Y2Q A;  4PPR A;  2HIO C;  5JRG C;  3MGR A;  3EPK A;  3ZG0 A;  5HW3 A;  5GHZ A;  3IXH A;  3DTE A;  1TZY D;  4Z2L A;  2V20 A;  3IHA A;  5I5L A;  5HFO A;  4OH0 A;  4KGC C;  3BW6 A;  5GT3 C;  3NOP C;  4BQM A;  4JJN B;  5AV5 A;  2XGN A;  3FC7 A;  3C1C B;  4NY2 A;  2VA0 A;  2CC1 A;  4PHT A;  1HQ3 B;  3X1V B;  4NYU A;  1XFN A;  5AVC C;  1D1J A;  2JC7 A;  4HHD A;  3KXB B;  2KLI A;  1XGJ A;  5CED A;  1PRQ A;  4MN7 A;  4LCM A;  3A6N A;  2L4R A;  3MGR B;  2PBD P;  3V5M A;  3ZDJ A;  3C7V A;  3PHY A;  4ZUX B;  2ZM0 A;  2NUP C;  3LR5 A;  3PAE A;  4XZQ D;  1LSW A;  5CPK C;  1L0D A;  3UDF A;  3BLS A;  3AV1 A;  1ID3 C;  3PBO A;  2H0Y A;  3HBR A;  5E5A A;  1KX4 C;  4KUD C;  2B95 A;  3B6F D;  3ZG5 A;  3AL0 C;  3NDE A;  2JKT I;  1TDG A;  2IO5 B;  5F99 B;  4J8V C;  4IBG A;  5EVI D;  4MB4 A;  4L9F A;  3VH6 A;  2NZD B;  3QP5 A;  3MZE A;  5FQJ A;  4KHA A;  1MKM A;  3MXQ A;  4IBK A;  3OCL A;  1T1A A;  3WRT A;  4UQI M;  5HAR A;  1FCN A;  2IWB A;  5E5A B;  4IUK A;  2J3W A;  5GLA A;  2YFV A;  5DNM B;  5HZH A;  4DQY B;  2Y79 A;  1YSQ A;  3G31 A;  4LV0 A;  3H7W A;  2W3G A;  4NET A;  4BLM A;  5B2I C;  2FJ7 B;  3WS2 A;  3REJ C;  4DF6 A;  1JWV A;  3OBF A;  5K5B A;  3W97 B;  5AVE A;  3DTM A;  4Z2G A;  4EQ1 A;  1CF0 A;  3UO9 A;  5GSU D;  1BSG A;  3VMA A;  3EPJ A;  1ERQ A;  3BFF A;  5B31 D;  3KWQ C;  1P34 C;  4IHQ A;  3UB6 A;  3NI9 A;  3WWX A;  3B42 A;  5M19 A;  3QP1 A;  1OTA A;  2YFV B;  4E04 A;  1KU5 A;  3WA9 D;  3AZH D;  2GX5 A;  2Y2G A;  1P97 A;  3BEB A;  3X1U C;  1UWP X;  1UR9 A;  4MEZ A;  4CLC B;  2ZY4 A;  4R38 A;  2XF3 A;  3D4F A;  3IWI A;  4WU8 C;  2G2U A;  3I7J A;  1E4D A;  4GNU A;  1WWI A;  2JKG A;  4N1H A;  2QWS A;  5AY8 A;  3AZJ C;  3GTC A;  1O6I A;  2ZC7 A;  4I38 A;  3SH9 A;  1W1T A;  3LJA D;  4GDN A;  2V9A A;  1XJ4 A;  4PM9 A;  4KUO A;  4MB3 A;  2A24 B;  5CHJ A;  5TGF A;  3TSG A;  5B0Y C;  5B2I D;  2IWC A;  2GJ3 A;  2WZX A;  2X71 A;  3Q7V A;  1P3K A;  3BLM A;  2P74 A;  3C8C A;  1KE3 A;  5F1F A;  3HLG A;  3V9R A;  1FOF A;  1E3U A;  3G6O A;  3A1I A;  2ZQ9 A;  4J8U C;  4WUJ A;  5DNN C;  3CUE A;  5DTK A;  3VH6 W;  4S2I A;  1K57 A;  5AY8 B;  1PWG A;  3T1R A;  3MF0 A;  4NXF A;  4DRB A;  5GT0 C;  3L9K A;  1FCM A;  2W0N A;  4H9S C;  1KVM A;  4MBH A;  2PHY A;  3UDI A;  1E6Z A;  3NY4 A;  5FL3 A;  1ZLA C;  4WMC D;  3UY6 A;  4AFI A;  4UEY A;  4E3I A;  3WKJ C;  1CXW A;  2XRN A;  3E4P A;  3Q7V B;  1M18 A;  1P3K B;  4EUV A;  4NXB A;  1PW1 A;  2EFU A;  3V9R B;  2VV7 A;  3W4Q A;  5AV9 A;  1ZG6 A;  1G68 A;  4DXB A;  3IS2 B;  1AOI A;  2RTS A;  3UTB A;  1H0M A;  1YLP A;  1E8B A;  1H0I A;  3AZM D;  2D02 A;  5FQM A;  1RGZ A;  4HES A;  1ONH A;  3F1N A;  1KDS A;  2JSS A;  3OOV A;  4IBF A;  1P3L C;  3HCY A;  3F1O A;  4B88 A;  3EEH A;  5L8M A;  2WKR A;  2G5H C;  1EQZ A;  4UPK A;  4OPQ A;  3W2Z A;  3AZG A;  3VP3 A;  3A1K A;  1H0G A;  5CP6 A;  4HME A;  2E8I A;  2CV5 A;  3AZI A;  1M18 B;  3UTA D;  2HJE A;  4H9Q A;  3T50 A;  4Y13 A;  4QLC D;  3DTK A;  1AOI B;  4WZ4 A;  4ZBJ B;  3REI D;  4Z5T C;  1FSY A;  5FUG B;  3BQ8 A;  3S7O A;  4R4S A;  4Y2F A;  5EVE A;  4NEE D;  2NUT C;  1ZLA D;  3P7N A;  3OCN A;  3KUY A;  3QP4 A;  1LI9 A;  5CPI C;  4C3Q A;  3F1N B;  5AV8 B;  5CEC A;  5U47 A;  4E3N A;  2EX2 A;  1Q9C A;  2HUE C;  4B9O A;  1KX3 A;  3BFG A;  3UPN A;  1P0Z A;  4OQG A;  3AZG B;  4BL3 A;  4WN5 A;  5CP6 B;  3HON A;  3SH7 A;  5B24 C;  4KG2 A;  3LY3 A;  4HIA A;  5FQQ A;  3AZI B;  4OQ0 A;  2HDS A;  2NQB A;  3O5Y A;  2M7V A;  1M1A B;  1LT0 A;  3LEL B;  2BG1 A;  1EI5 A;  5GXQ D;  4R23 A;  3GSG A;  5TR7 A;  4YWZ A;  3HJI A;  4R6L A;  4P85 A;  5AVB A;  4YOF A;  4QWO A;  4Q0I A;  1N1J A;  1K55 A;  4S2P A;  3AV2 B;  4Q8I A;  4NZ1 A;  2ZQ8 A;  4H9R A;  3E0Y A;  4Z2M H;  3AZK D;  3AZE A;  2VLG A;  4D2O A;  1KGG A;  1H3Q A;  5AV6 A;  5AV5 D;  1E6P A;  5E2G A;  5CGW A;  3G2Z A;  1ES3 A;  3DW0 A;  3X1S B;  2P7J A;  5CPJ C;  4ETZ A;  1P3M A;  4Y17 A;  1G6O A;  5GLD A;  3A6N D;  4EEU A;  4QHC A;  1YM1 A;  1P9W A;  3JVV A;  3WD3 A;  3WAA A;  4P0M A;  2RVQ C;  1XP4 A;  3AZN B;  1SKO A;  4R1G A;  4Z2K A;  2EX6 A;  4XT2 B;  5HD5 A;  3V39 A;  1NLZ A;  4AWL C;  1GSX A;  4LPZ A;  3REH A;  5C3I B;  4H9R B;  1D7E A;  4UHU A;  2OAQ 1;  1CQA A;  2A2L A;  4Z66 D;  3LI9 A;  1YLZ A;  5HAP A;  4R8P C;  2QYB A;  5AV6 B;  3AV1 D;  4IBE A;  4DMZ A;  3IX3 A;  1TZY A;  3OPH A;  2ZOH A;  3IX4 A;  2EXB A;  4B4Z A;  2V1A A;  4GH9 A;  5JA4 A;  1Y54 A;  2HPB A;  5CGX A;  4YM6 D;  1P3M B;  4FH2 A;  3R45 A;  1P3O C;  1VEU A;  3W99 D;  2L0W A;  2ZQ7 A;  4XUZ A;  1P3A D;  1PI5 A;  1YLJ A;  1YSP A;  3T4S A;  4CSR A;  1SKO B;  4BBV A;  3SW1 A;  3HRE A;  3MGP C;  3MNN A;  4OJO A;  2HP6 A;  2ZMA A;  3B0D B;  1YU3 A;  5B0Z A;  2GNX A;  3WS0 A;  3AZF C;  4NZ4 A;  2JHE A;  2V8F A;  2CMN A;  1NRJ A;  4R70 A;  1ALQ A;  3AFA D;  4BBT A;  3IF6 C;  1TZY B;  4LV2 A;  4Z2I A;  1P3P D;  5F82 A;  4DN0 A;  4P87 A;  4GHA A;  1F66 D;  3HSH A;  3N8R A;  1XXM A;  2B02 A;  3MQQ A;  4IBI A;  2Y2K A;  1Z09 A;  2HIO A;  5CGS A;  4MMN A;  4Q0H A;  3R45 B;  1P3G C;  2QHK A;  1VEU B;  3EGX C;  1FSW A;  1YLY A;  3MR0 A;  3IWO A;  3MGS C;  3MS6 A;  5AQ9 A;  2XA7 S;  4M3K A;  3B6F A;  1AWI A;  4HH3 A; 
#chains in the Genus database with same CATH homology
 2ARO B;  3IXD A;  2ZJ9 A;  5GT3 A;  5EVI A;  3RXW A;  3O62 C;  4E45 A;  3BYD A;  1JFI B;  4XZQ B;  4G92 B;  3AYW D;  3CJM A;  5GHY A;  2WKH A;  5HAI A;  5B1L D;  3C1B C;  3AZL C;  3MGQ C;  1YMS A;  3ITA A;  4X6T A;  3AGE A;  3B6F B;  1PIO A;  1WYC A;  1AXB A;  4OPR A;  5CPK A;  4LG2 A;  4EUZ A;  2UWX A;  5EVI B;  1NRF A;  3N8S A;  2A49 A;  4NZ3 A;  5FA7 A;  4OPY A;  4KUD A;  4KZ7 A;  1JVJ A;  4KQR A;  1VQQ A;  3W98 D;  5GLC A;  4J8W C;  5B2J C;  3B0B A;  4MLL A;  3MVD C;  5B33 C;  1E3U D;  3DWZ A;  4X55 A;  3VH5 A;  3WA9 A;  4J8X B;  5E2F A;  4LD9 C;  2ZQA A;  4CPK A;  1U35 C;  2QMI A;  1C3B A;  1IKG A;  3OPP A;  4NE3 A;  1BT5 A;  1QME A;  4OP5 A;  3LJA A;  5GSU B;  4UUZ A;  3NQU B;  3QNC A;  5B31 B;  3B6G C;  1P3B D;  5B2I A;  3WTP C;  5AV9 D;  3REJ A;  4OLG A;  2OLV A;  3WA9 B;  3AZH B;  3UTB D;  1IEL A;  3VP0 A;  2DF4 C;  1MY8 A;  2C5W B;  4WEL A;  5KSH A;  2OV5 A;  3PAG A;  3OPR A;  5KDM A;  4EWF A;  3ZHH A;  1EQZ D;  2BYM B;  4LV3 A;  3A3D A;  3LJA B;  1N9B A;  5EPH A;  3VOZ A;  3IXB A;  3X1U A;  2CV5 D;  2WKE A;  3KFU G;  5B1M C;  2LY8 A;  4OLD A;  4EBP A;  4WMC A;  1NJ4 A;  5B2I B;  1YLT A;  4E3M A;  5HL1 A;  3FWL A;  1S32 C;  1IKI A;  2CWE A;  5FQI A;  3BRM A;  5KDM B;  4L0L A;  4G91 C;  3AZM A;  5GLB A;  4HBU A;  1KGF A;  3HLD A;  3PBR A;  3FV7 A;  4OON A;  1CK3 A;  4XUJ D;  2NQB D;  1XA7 A;  3W4O A;  4K91 A;  4E3K A;  4J8U A;  3AN2 D;  3LZ1 C;  5DTT A;  3VH5 W;  3NQJ B;  4KZ3 A;  3ISG A;  3S4X A;  4DRA A;  4IJE A;  2X01 A;  1FCO A;  2OSU A;  4R3B A;  3GMW A;  2R9W A;  5KSC A;  5A90 A;  3HVF A;  1ZLA A;  3VFH A;  3AZM B;  1L0G A;  3BM6 A;  5BNX B;  3WKJ A;  3AZE D;  4EBN A;  2ZM5 A;  4OKP A;  3E2K A;  3B0C W;  3ZG9 B;  2JBF A;  3UTA B;  3UT9 D;  3L29 A;  1P3I C;  5KZH A;  3WAA D;  4KZ6 A;  4QLC B;  1W7F A;  1P3L A;  3REI B;  1ES4 A;  3REH D;  4U3T A;  3Q1F A;  4KEN B;  1KX5 D;  2XEP A;  4X69 A;  3IF5 A;  1GHI A;  3AZK A;  3AGD A;  4DRT A;  4Z5T A;  3HLE A;  1GHP A;  1W8Q A;  3REL C;  1TAF A;  3TU4 C;  5GXQ B;  5EE8 A;  5FSR A;  2XLN A;  3MNN D;  1K54 A;  5B0Z D;  1JTG A;  1Z2C B;  3REK C;  5B32 D;  5B24 A;  1JWZ A;  3X1T D;  1NXY A;  4Z66 A;  2Y2H A;  3AZK B;  2GDN A;  4WEK A;  4N9L A;  4S2K A;  5AV5 B;  1R4V A;  3P5J B;  4OOY A;  2HIO D;  3HL9 A;  5JRG D;  1BTL A;  4OJ5 A;  5EVL A;  3O87 A;  1MXO A;  4NZ5 A;  3A3E A;  4YM6 A;  1T3U A;  3W99 A;  5B31 G;  3A6N B;  1P3A A;  4KQO A;  4KGC D;  5GT3 D;  3MFD A;  5JYP A;  3LCE A;  2EX9 A;  4YFM A;  1FR6 A;  3QHY A;  3L26 A;  3A3F A;  4Z66 B;  5AVC D;  5CPJ A;  1P3F C;  5CEB A;  1YU2 A;  3AFA A;  3W96 C;  1HZO A;  3DWK A;  1ZG4 A;  4GDB A;  4IVK A;  2ZQD A;  3AV1 B;  1P3P A;  3FDD A;  1F66 A;  1YMX A;  4YM6 B;  3WRZ A;  4E3O A;  4EV4 A;  3W99 B;  3TOI A;  1P3A B;  5B40 C;  4O7D A;  5E2H A;  5CPK D;  1U60 A;  1ESI A;  3N3F A;  4R8P A;  1XX2 A;  4F94 A;  4IBD A;  1BH8 A;  1ID3 D;  3N7W A;  4KHA B;  1KX4 D;  4U0T A;  5FQ9 A;  4KUD D;  4DE3 A;  3AFA B;  3P09 A;  1K56 D;  1P3O A;  1KDW A;  4PM7 A;  3C4O A;  4ZJ1 A;  1M19 C;  1P3P B;  3AYW A;  1HVB A;  4J8V D;  1F66 B;  4FH4 A;  2DQN C;  2IOU A;  5FAP A;  1QMF A;  4XXR A;  5B1L A;  3LZ0 C;  3AZF A;  3FKW A;  1NZU A;  3IF6 A;  3N8L A;  3SS3 A;  2A3U A;  4A5R A;  2WZZ A;  1F1E A;  4WU9 C;  2ZLY A;  3AYW B;  4UA7 A;  2Y2J A;  4X23 C;  3REJ D;  3EG5 B;  3W98 A;  3MXR A;  5B1L B;  4YS3 C;  5EEC A;  4LCL A;  3CG5 A;  3ITB A;  1MWU A;  1M19 D;  2H0T A;  3KWQ D;  1P34 D;  4QD4 A;  3SS4 A;  2PYO C;  4KQQ A;  5FQK A;  1XKZ A;  4Y0T A;  3MZD A;  3X1U D;  3AZL A;  3MGQ A;  3VSK A;  4HGA B;  5CHL B;  4S2O A;  4WU8 D;  1PWC A;  4P6B A;  3W98 B;  4RVA A;  3AZJ D;  1P3B A;  3WS4 A;  5TFQ A;  1L0E A;  2ZY2 A;  2Y2O A;  2XD1 A;  1Q2Q A;  3BFE A;  5B0Y D;  4PMA A;  3OC2 A;  3IQA A;  3VH6 T;  1YU0 A;  1YU1 A;  2F8N D;  1IYP A;  4DE0 A;  4IBR A;  3N4I A;  2EFX A;  4J8U D;  4JJN C;  5DNN D;  1A7W A;  4EO5 B;  3C1C C;  1P3B B;  4KZ4 A;  4JKT A;  5GT0 D;  1U35 A;  3PBN A;  1HQ3 C;  5AV9 B;  3X1V C;  4C75 A;  5KMW A;  3NDG A;  3KXB C;  3UTB B;  3A3I A;  1GHM A;  1DJB A;  3MGR C;  3V3S A;  1HD8 A;  2VGK A;  3WKJ D;  1LL5 A;  3L28 A;  2YFW A;  1YT4 A;  1I2S A;  3B6G A;  4ZUX C;  1EQZ B;  3N6I A;  3Q82 A;  4OQI A;  3Q07 A;  2CV5 B;  4XUJ A;  3MKE A;  4H9Q B;  3IXG A;  4X53 A;  4GOG A;  5G49 A;  3AN2 A;  4QU3 A;  1P3L D;  1CEF A;  3MKF A;  4QY6 A;  2IO5 C;  3KUY B;  2Y2M A;  5F99 C;  5BS7 A;  3KS8 A;  2WKI A;  3H0R C;  1JTD A;  3EPH A;  2NZD C;  2J8Y A;  1ONG A;  4WNN A;  3VP2 A;  1KX3 B;  2Y55 A;  3KXB D;  4Z5T D;  4XUJ B;  2NQB B;  3M2J A;  1I2W A;  5E5A C;  4R3J A;  3KS4 A;  5CPI D;  1LI0 A;  3M6B A;  3AN2 B;  5DNM C;  3UT9 A;  4E3J A;  5AVB B;  4WYY A;  3L2A A;  5CER A;  2XDM A;  1N1J B;  2FJ7 C;  5B24 D;  1IYS A;  1LHY A;  1CI9 A;  3W97 C;  3PBS A;  4KZB A;  1IYQ A;  3A3J A;  3AZE B;  3LZ1 A;  1KX5 A;  2ZY5 A;  1M6K A;  1TEM A;  5F99 D;  1MBL A;  4EBL A;  5DTS A;  3W8K A;  3BFD A;  3UT9 B;  4JPM A;  4XUX A;  4JF5 A;  3WAA B;  5FAT A;  3H0L C;  5HX9 A;  4FCF A;  3REH B;  5CPJ D;  2Y2I A;  5B32 A;  3X1T A;  3HLC A;  1KX5 B;  1LL9 A;  2ZQC A;  2RVQ D;  2XQZ A;  5JA4 B;  1MKI A;  5JRG A;  1ESU A;  3OZH A;  2L5A A;  4R8P D;  2QZ6 A;  1LLB A;  4CSR B;  3VP4 A;  4WM9 A;  3MNN B;  5AQB A;  2B5R A;  5B0Z B;  4Y0U A;  1MWT A;  3RJU A;  5AY8 C;  4KGC A;  3Q81 A;  5DF7 A;  1RP5 A;  5B32 B;  4DDY A;  3X1T B;  1P3O D;  4OJ6 A;  1SDE A;  3TU4 A;  2J7V A;  5AVC A;  1NZO A;  1B67 A;  3MGP D;  2HIO B;  5JRG B;  3AZF D;  1P3K C;  4K0X A;  3REK A;  5BO0 A;  2ZM8 A;  2QPN A;  4ZAM A;  1YUE A;  1ES5 A;  1SKF A;  4KGC B;  5GT3 B;  1NYY A;  1ID3 A;  1P3G D;  1L0F A;  3JYI A;  1KX4 A;  3MGS D;  5AVC B;  2XK1 A;  2Y2N A;  1EWZ A;  4H8R A;  1K56 A;  1L2S A;  3BEC A;  1GA9 A;  4S2N C;  1M18 C;  2HP5 A;  4H9P A;  4J8V A;  3G34 A;  1W5D A;  5BO0 B;  3O62 D;  3HLW A;  2G2W A;  1AOI C;  4ZBJ C;  1PZO A;  5CPK B;  1K6S A;  1SCW A;  3W96 A;  1BUL A;  2C6W B;  1ID3 B;  5AV8 C;  2DRW A;  3C1B D;  3AZL D;  1Z6F A;  3EQU A;  3MGQ D;  1KX4 B;  4KUD B;  4H9N A;  2HDU A;  4QY5 A;  3AZG C;  5CP6 C;  2P9V A;  5B40 A;  3AZI C;  4J8V B;  3G35 A;  1M1A C;  3LEL C;  4QB8 A;  4OUI A;  3GQZ A;  3VFF A;  5BT1 C;  4B4X A;  1H5X A;  2ZD8 A;  3AV2 C;  1W79 A;  4J8W D;  5B2J D;  1M19 A;  3KWQ A;  1P34 A;  3ZFZ A;  4ZJ3 A;  3MVD D;  2WGW A;  4H9N B;  5B33 D;  4UUZ B;  2Z2L B;  1K4E A;  1RCJ A;  2Y91 A;  4IBX A;  4LD9 D;  1U35 D;  4UA9 A;  3REJ B;  4WU8 A;  3X1S C;  2HP9 A;  3AZJ A;  4UA6 A;  1K6R A;  3M2K A;  3AZN C;  3G32 A;  5CTN A;  4E3L A;  3B6G D;  1M19 B;  5FI6 A;  3KWQ B;  1P34 B;  1S0W A;  2JCH A;  5C3I C;  5B0Y A;  3WTP D;  4X23 A;  3X1U B;  5AV6 C;  1O7E A;  4YS3 A;  2F8N A;  1IYO A;  4WU8 B;  4KG5 A;  5DNN A;  1P3M C;  3AZJ B;  5GT0 A;  4NE5 A;  4H9S A;  4DE2 A;  2J9O A;  3IP4 C;  4KZA A;  5B1M D;  3B0D C;  5B0Y B;  1M40 A;  4RX2 A;  5M18 A;  4GD6 A;  2FFY A;  1TZY C;  5FDH A;  3PBT A;  2F8N B;  1S32 D;  5B32 G;  1E25 A;  2OLU A;  3MXS A;  4J8U B;  5DNN B;  4N9K A;  5GT0 B;  3TG9 A;  5CHU A;  5CRF A;  3VH5 T;  2I72 A;  2HDR A;  1ZLA B;  2ARO C;  2PU2 A;  3NCK A;  3WKJ B;  1FQG A;  4ZTK A;  3LZ1 D;  4JJN A;  5L2F A;  4IBB A;  4QJG A;  3X1V A;  4XZQ C;  4G92 C;  3KXB A;  4KZ9 A;  3NIA A;  3B0C T;  1PZP A;  2WGI A;  4CAY A;  1ES2 A;  5CPI A;  1RGY A;  3VOY A;  1PI4 A;  1P3L B;  3B6F C;  4ZUX A;  1DJC A;  2ZC4 B;  5EVI C;  2H10 A;  3UE1 A;  4WEJ A;  4NE6 A;  1P3I D;  3UDX A;  1I5Q A;  1FR1 A;  4Z5T B;  1PYY A;  4IJF A;  3CZD A;  1TAF B;  2BYK A;  4CAY B;  5F99 A;  2ARO D;  5CPI B;  2DCF A;  3ZCZ A;  4NYY A;  5J8X A;  2HUE B;  2NZD A;  4J8X C;  4WJ3 C;  4R0Q A;  2FFF B;  3IHB A;  5B24 B;  3REL D;  3ZVT A;  1BLH A;  5BNV A;  4FD8 A;  3TU4 D;  3PTE A;  3G30 A;  4S2L A;  5GSU C;  5DNM A;  3SOI A;  5B31 C;  4C6Y A;  2BYK B;  3LY4 A;  3REK D;  2Y4A A;  4ZJ2 A;  2FJ7 A;  2PBY A;  3PBQ A;  1BH9 A;  3WA9 C;  4M6B A;  3AZH C;  3W97 A;  5A91 A;  3FKE A;  4IBJ A;  2F8N K;  1SDN A;  4RYE A;  5BNV B;  2Z2M B;  3UN7 A;  3C7U A;  4UAA A;  4JXV A;  5CPJ B;  3LJA C;  4J8X D;  3WS5 A;  4N1X A;  3UE3 A;  4KZ5 A;  3CMZ A;  3MGP A;  3HLF A;  4RA7 A;  2IWD A;  4AWL B;  2VGJ A;  1BH9 B;  4JXW A;  5GL9 A;  4JXS A;  1P3F D;  4R8P B;  3W96 D;  3FYZ A;  1BH8 B;  1SHV A;  1WE4 A;  4HEF A;  4EQI A;  2XFS A;  1P3G A;  1P3O B;  5B40 D;  3HUM A;  3MGS A;  3MBZ A;  3MZF A;  3MGP B;  2RCX A;  3P98 A;  4Z9Q A;  3AZF B;  2F8N G;  1BUE A;  1K4F A;  2R9X A;  4WBG A;  3O62 A;  3IF6 B;  4GD8 A;  4S2J A;  1BLP A;  4GKU A;  4E6X A;  3AZM C;  1YLW A;  1W8Y A;  5CHM A;  3OPL A;  1P3G B;  3LZ0 D;  3C1B A;  3MGS B;  1DY6 A;  2ZC3 B;  4E6W A;  3S1Y A;  4WZ5 C;  3NC8 A;  3UTA C;  3HLB A;  1BLS A;  3O62 B;  4QLC C;  4WU9 D;  3REI C;  2W8S A;  2XFT A;  3VP1 A;  4DKI A;  4X23 D;  2EXA A;  1IEM A;  5F1G A;  3WX7 A;  1WYB A;  4N92 A;  4J8W A;  5B2J A;  2RL3 A;  3SH8 A;  4S2N A;  3ZG7 B;  3C1B B;  3AZL B;  3MGQ B;  4NK3 A;  4YS3 D;  3MVD A;  2G5I C;  5B33 A;  1GA0 A;  2Q9M A;  4GN2 A;  5JYO A;  5FUG A;  2WUQ A;  3QNB A;  4LD9 A;  2PYO D;  3S22 A;  5GXQ C;  3ZVW A;  1MWS A;  5AV8 A;  2WAF A;  2J8P A;  1ZKJ A;  1TVF A;  3LEZ A;  4E44 A;  5DVA A;  4J8W B;  5B2J B;  1XA1 A;  3C4P A;  1M1A A;  3WTP A;  3MVD B;  2RIQ A;  3LEL A;  5B33 B;  5AQA A;  3AZK C;  1KE4 A;  5D3O A;  5EOE A;  5AV5 C;  4LD9 B;  4ID4 A;  2PU4 A;  1U35 B;  3E2L A;  1PW8 A;  4DDS A;  3AV2 A;  3A6N C;  2V1Z A;  1K54 C;  4OJL A;  2YFW B;  4BD0 A;  4JJN D;  3B6G B;  5B1M A;  3GR2 A;  3C1C D;  3EQV A;  5EOO A;  3WTP B;  1HQ3 D;  3X1V D;  1DJA A;  1XPB A;  3LO7 A;  3X1S A;  4Z66 C;  3AV1 C;  3V50 A;  1KE0 A;  2XR0 A;  4ZDX A;  3MGR D;  1S32 A;  5DF8 A;  3AZN A;  5G49 B;  1K25 A;  4YM6 C;  3G2Y A;  1Q2P A;  3W99 C;  4ZUX D;  1P3A C;  3B3X A;  3RXX A;  4MBK A;  4KG6 A;  5B1M B;  3EPL A;  2J9P A;  4WNN B;  5CXW A;  3AFA C;  2F2A C;  1YQS A;  4OPZ A;  1H8Z A;  4ZBE A;  3Q7Z A;  1P3P C;  4JBF A;  1S32 B;  1F66 C;  4NFT A;  2ZC5 B;  2NZD D;  5FAO A;  1N4O A;  4G91 B;  2ZC6 B;  4IVI A;  4X68 A;  2JE5 A;  5FI7 A;  3KSY A;  4Y0O A;  4WV4 B;  1KGE A;  3C5A A;  5DF9 A;  1BFM A;  2H5S A;  5E5A D;  2EX8 A;  3LZ1 B;  5DNM D;  3NBL A;  3WS1 A;  1P3I A;  3AYW C;  4HBT A;  2FJ7 D;  5B1L C;  3W97 D;  2ARO A;  1VM1 A;  1ERO A;  1TDL A;  1WWS A;  1GCE A;  1JFI A;  4XZQ A;  3FZC A;  5CTM A;  5G18 A;  3SS5 A;  1G6A A;  4IBC A;  3REL A;  1KVL A;  4BD1 A;  5GHX A;  1P3I B;  4JF4 A;  3GVB A;  1MPL A;  4HGA C;  2ZY3 A;  4OOM A;  2DNS A;  5M1A A;  4JXG A;  5FAQ A;  3W98 C;  4MNR A;  5A92 A;  3IH9 A;  1J9M A;  4YIN A;  1ERM A;  1PWD A;  5AQ7 A;  1K57 C;  1ULY A;  3ZNT A;  1YU4 A;  3REL B;  3TU4 B;  4DE1 A;  4RX3 A;  4BL2 A;  4J8X A;  2Y2P A;  2BLS A;  2WAD A;  4EO5 C;  1H3O A;  5AY8 D;  3REK B;  1MWR A;  1P3B C;  5AV9 C;  3VSL A;  3UTB C;  3W4P A;  1P3F A;  5E2E A;  3HUN A;  5GSU A;  4H9O A;  3NQU A;  1XGI A;  5FAS A;  5B31 A;  1P3K D;  1EQZ C;  4IED A;  3IH8 A;  1H8Y A;  2XD5 A;  1W2E A;  3AZH A;  3M6H A;  2CV5 C;  4CJN A;  2V2F F;  4H9P B;  4OJP A;  1H3O B;  4FSF A;  2WK0 A;  1BLC A;  2ZM2 A;  3H0M C;  4DXC A;  1P3F B;  2BYM A;  3O88 A;  3UPO A;  3W96 B;  3KUY C;  4H9O B;  4OOL A;  1PZR A;  1M18 D;  4Z2M G;  2Q9N A;  3O86 A;  1KX3 C;  3AGF A;  1AOI D;  3LZ0 A;  1JWP A;  4GZB A;  1CI8 A;  2P9V B;  5B40 B;  1O07 A;  3G4P A;  3F6T A;  4XUJ C;  2NQB C;  4GB7 A;  1B6W A;  4R4R A;  5AV8 D;  3AN2 C;  5HAQ A;  4S2M A;  5AVB C;  3UPP A;  3ZG8 B;  1BZA A;  5A93 A;  3AZG D;  1K55 C;  5BS7 C;  2WAE A;  5CP6 D;  4WU9 A;  4BJP A;  3AZI D;  1S6R A;  4Y7P A;  5F83 A;  1M1A D;  2WGW B;  3GRJ A;  3LEL D;  2XH9 A;  3ZNY A;  3V3R A;  4K0W A;  3AZE C;  5FI2 A;  1OME A;  4OQH A;  3LZ0 B;  4GHL A;  3NQJ A;  5BT1 D;  3KUY D;  3AV2 D;  3IWQ A;  4PM8 A;  2HDQ A;  4JLF A;  4MBF A;  3BFC A;  3UT9 C;  2PYO A;  5EUA A;  1NY0 A;  1KX3 D;  5BNX A;  3WAA C;  4LEN A;  4WZS B;  5E43 A;  2Y59 A;  4WU9 B;  1K38 A;  3WTP E;  4OP8 A;  3REH C;  4PM6 A;  4X23 B;  3X1S D;  4WZ5 A;  1ZC2 A;  2X02 A;  1KX5 C;  3UTA A;  5AVB D;  4YS3 B;  4KZ8 A;  2VQR A;  2F8N H;  3AZN D;  4QLC A;  3FKV A;  3REI A;  4X56 A;  3L25 A;  3UE0 A;  3GV9 A;  3IT9 A;  1HTZ A;  3L27 A;  2PYO B;  4JF6 A;  4LV1 A;  4BEN A;  1CEG A;  1NYM A;  4OVD A;  5AV6 D;  3MNN C;  3HUO A;  4PM5 A;  5B0Z C;  4QNL A;  5IHV A;  5BPV A;  2Y2L A;  3ZGA B;  5B32 C;  3UNW A;  1P3M D;  3X1T C;  3O3V A;  3C1C A;  2WYX A;  1HQ3 A;  5I94 A;  1HTA A;  4U0X A;  2WGV A;  5GXQ A;  5BOH A;  2Y2Q A;  4PPR A;  2HIO C;  5JRG C;  3MGR A;  3EPK A;  3ZG0 A;  5HW3 A;  5GHZ A;  3IXH A;  1TZY D;  2V20 A;  3IHA A;  5HFO A;  4OH0 A;  4KGC C;  4BQM A;  5GT3 C;  4JJN B;  5AV5 A;  2XGN A;  3C1C B;  4NY2 A;  2CC1 A;  1HQ3 B;  3X1V B;  4NYU A;  5AVC C;  2JC7 A;  3KXB B;  1XGJ A;  5CED A;  4LCM A;  3A6N A;  3MGR B;  3V5M A;  3ZDJ A;  3C7V A;  4ZUX B;  2ZM0 A;  3PAE A;  4XZQ D;  5CPK C;  1L0D A;  3UDF A;  3BLS A;  3AV1 A;  1ID3 C;  3PBO A;  2H0Y A;  3HBR A;  5E5A A;  1KX4 C;  4KUD C;  3B6F D;  3ZG5 A;  3AL0 C;  3NDE A;  1TDG A;  2IO5 B;  5F99 B;  4J8V C;  4IBG A;  5EVI D;  3VH6 A;  2NZD B;  3MZE A;  5FQJ A;  4KHA A;  4IBK A;  3OCL A;  3WRT A;  5HAR A;  1FCN A;  2IWB A;  5E5A B;  5GLA A;  2YFV A;  5DNM B;  4DQY B;  4LV0 A;  3G31 A;  4NET A;  4BLM A;  5B2I C;  2FJ7 B;  3WS2 A;  3REJ C;  4DF6 A;  1JWV A;  3W97 B;  3DTM A;  3UO9 A;  5GSU D;  1BSG A;  3VMA A;  3EPJ A;  1ERQ A;  3BFF A;  5B31 D;  3KWQ C;  1P34 C;  3NI9 A;  3WWX A;  5M19 A;  2YFV B;  1KU5 A;  3WA9 D;  3AZH D;  2Y2G A;  3BEB A;  3X1U C;  4MEZ A;  2ZY4 A;  2XF3 A;  3D4F A;  3IWI A;  4WU8 C;  2G2U A;  3I7J A;  1E4D A;  4GNU A;  1WWI A;  4N1H A;  5AY8 A;  3AZJ C;  3GTC A;  2ZC7 A;  3SH9 A;  3LJA D;  4GDN A;  4PM9 A;  5CHJ A;  5TGF A;  3TSG A;  5B0Y C;  5B2I D;  2IWC A;  2WZX A;  2X71 A;  3Q7V A;  1P3K A;  3BLM A;  2P74 A;  1KE3 A;  5F1F A;  3HLG A;  3V9R A;  1FOF A;  1E3U A;  3A1I A;  2ZQ9 A;  4J8U C;  5DNN C;  5DTK A;  3VH6 W;  4S2I A;  1K57 A;  5AY8 B;  1PWG A;  4DRB A;  5GT0 C;  1FCM A;  4H9S C;  1KVM A;  4MBH A;  3UDI A;  3NY4 A;  1ZLA C;  4WMC D;  3UY6 A;  4E3I A;  3WKJ C;  3Q7V B;  1M18 A;  1P3K B;  1PW1 A;  2EFU A;  3V9R B;  3W4Q A;  5AV9 A;  1ZG6 A;  1G68 A;  4DXB A;  1AOI A;  3UTB A;  1YLP A;  3AZM D;  5FQM A;  1RGZ A;  4HES A;  1ONH A;  1KDS A;  2JSS A;  4IBF A;  1P3L C;  4B88 A;  2G5H C;  1EQZ A;  4UPK A;  4OPQ A;  3AZG A;  3VP3 A;  3A1K A;  5CP6 A;  2E8I A;  2CV5 A;  3AZI A;  1M18 B;  3UTA D;  4H9Q A;  4QLC D;  1AOI B;  4WZ4 A;  4ZBJ B;  3REI D;  4Z5T C;  1FSY A;  5FUG B;  4R4S A;  1ZLA D;  3OCN A;  3KUY A;  1LI9 A;  5CPI C;  4C3Q A;  5AV8 B;  5CEC A;  5U47 A;  4E3N A;  2EX2 A;  1Q9C A;  2HUE C;  1KX3 A;  3BFG A;  3UPN A;  4OQG A;  4BL3 A;  3AZG B;  5CP6 B;  3HON A;  3SH7 A;  5B24 C;  4KG2 A;  3LY3 A;  5FQQ A;  3AZI B;  4OQ0 A;  2HDS A;  2NQB A;  1M1A B;  3LEL B;  2BG1 A;  1EI5 A;  5GXQ D;  4R23 A;  3GSG A;  5TR7 A;  4P85 A;  5AVB A;  1N1J A;  1K55 A;  4S2P A;  3AV2 B;  4Q8I A;  4NZ1 A;  2ZQ8 A;  4H9R A;  4Z2M H;  3AZK D;  3AZE A;  4D2O A;  1KGG A;  5AV6 A;  5AV5 D;  5E2G A;  5CGW A;  3G2Z A;  1ES3 A;  3DW0 A;  3X1S B;  5CPJ C;  1P3M A;  5GLD A;  3A6N D;  4QHC A;  1YM1 A;  3WAA A;  4P0M A;  2RVQ C;  1XP4 A;  3AZN B;  4R1G A;  2EX6 A;  3V39 A;  4AWL C;  3REH A;  5C3I B;  4H9R B;  4UHU A;  4Z66 D;  1YLZ A;  5HAP A;  4R8P C;  5AV6 B;  3AV1 D;  4IBE A;  1TZY A;  3OPH A;  2EXB A;  4B4Z A;  4GH9 A;  5JA4 A;  1Y54 A;  2HPB A;  5CGX A;  4YM6 D;  1P3M B;  4FH2 A;  3R45 A;  1P3O C;  2ZQ7 A;  3W99 D;  4XUZ A;  1P3A D;  1PI5 A;  1YLJ A;  4CSR A;  3HRE A;  3MGP C;  3MNN A;  4OJO A;  2HP6 A;  2ZMA A;  3B0D B;  1YU3 A;  5B0Z A;  3WS0 A;  3AZF C;  4NZ4 A;  1ALQ A;  3AFA D;  3IF6 C;  1TZY B;  4LV2 A;  1P3P D;  5F82 A;  4P87 A;  4GHA A;  1F66 D;  3HSH A;  3N8R A;  1XXM A;  4IBI A;  2Y2K A;  5CGS A;  2HIO A;  3R45 B;  1P3G C;  1FSW A;  1YLY A;  3IWO A;  3MGS C;  5AQ9 A;  4M3K A;  3B6F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...