2Y2KA

Penicillin-binding protein 1b (pbp-1b) in complex with an alkyl boronate (za5)
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
488
structure length
469
Chain Sequence
SEITYSDGTVIASIRDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTGQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Guided Design of Cell Wall Biosynthesis Inhibitors that Overcome Beta-Lactam Resistance in Staphylococcus Aureus (Mrsa).
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
molecule keywords PENICILLIN-BINDING PROTEIN 1B
total genus 163
structure length 469
sequence length 488
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2y2kA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2y2kA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2y2kA02
4EQIA 1LI9A 1W8YA 2WZZA 3CMZA 1YLWA 2EX9A 4KG5A 1I2SA 3NDGA 1G68A 1K38A 4JF5A 4EBNA 1K57A 1NYMA 2Y2HA 3LY4A 4ZTKA 3ZG0A 4JXWA 5FSRA 1BULA 2XH9A 5F82A 2R9WA 2ZQAA 4LENA 1ZG6A 4UA9A 5EPHA 5GLAA 5DF7A 4QHCA 4B88A 4DRTA 1FCOA 2ZM2A 5HAPA 3HUNA 2C6WB 4GNUA 1NYYA 3N6IA 4KG6A 1W5DA 4S2JA 4OPZA 3W4OA 3ZG9B 5FI7A 3NDEA 3CG5A 4LCLA 3OPHA 1IKGA 3AGFA 3V3SA 3BLSA 4NK3A 3HLEA 4RX3A 5FAQA 3PTEA 4MLLA 3SS5A 5G18A 5AQ7A 3GQZA 5EVLA 1KE3A 3MKFA 4N1HA 1XXMA 5A93A 3G32A 1BLHA 3ZGAB 3FKVA 1PZOA 4OP5A 5EOEA 4R4SA 4HEFA 2FFFB 2WUQA 3TSGA 5EUAA 5EECA 3O88A 1J9MA 5CTMA 4K91A 3G30A 3VP3A 1Q2QA 1PWDA 5DTTA 3I7JA 5EVIC 4N92A 3IF6C 3Q07A 4RVAA 5IHVA 1K56D 4E3LA 3IHBA 1XPBA 2UWXA 2XQZA 2WADA 5FAPA 4GN2A 1N9BA 3NIAA 5JYOA 3BFFA 3BFEA 4MNRA 1K54C 2X01A 1E3UD 1W7FA 3AGDA 3IXHA 4YINA 2Y91A 2Z2MB 4S2IA 4KZ3A 2Y4AA 1M40A 5HARA 1PWCA 3GR2A 1K6RA 5DF9A 5FA7A 2HP5A 1Q2PA 3VP2A 1YMXA 4Y0UA 4XXRA 3VP4A 1K54A 4JKTA 2ZQCA 5AQ9A 1PW8A 4Y0OA 3BYDA 3G4PA 1LL5A 3NC8A 5FQMA 3IXDA 4U3TA 2HP6A 2JCHA 1MWRA 3A3EA 3OZHA 4LV0A 2J8YA 1FSYA 4WEJA 4K0WA 1IYOA 1ES2A 1SDEA 5EE8A 4A5RA 5A90A 3V50A 5M1AA 2DRWA 3PAGA 2Y2GA 2ZM8A 2IWCA 4C75A 1W79A 1FQGA 3NCKA 4S2OA 3WS2A 4FCFA 5HAIA 2QMIA 1YLPA 2H0TA 2EX2A 1AXBA 4GDBA 3N8SA 4DE3A 3TOIA 4JXSA 2HP9A 5KSHA 2EXAA 4OQ0A 1TVFA 2XFTA 4JLFA 4WBGA 3UPNA 3GRJA 5CECA 3EQVA 5BOHA 3UY6A 1BSGA 3LO7A 3FV7A 2Y2KA 1RGYA 3Q81A 3G2YA 4XUZA 1E4DA 1JWVA 4E6XA 1Z6FA 4JPMA 4KENB 5DVAA 1SCWA 3ZDJA 4DXCA 4BD1A 4B4ZA 4P6BA 5GLDA 4OKPA 3UPOA 5D3OA 4IEDA 5GHXA 3FYZA 5EOOA 4EBPA 4B4XA 4GZBA 2WKHA 1L0GA 3OC2A 4KZ7A 1XKZA 3IXGA 4KZ9A 1RP5A 3ZG7B 1L0FA 5HL1A 4KZ8A 2Q9NA 4OVDA 5CXWA 5FATA 5FAOA 2XR0A 4ZAMA 4EUZA 5AQBA 1SDNA 3ZG5A 5EVIA 3MFDA 3HLBA 1BLCA 1ESIA 4C6YA 3JYIA 2ZC7A 1ERMA 3N7WA 4XUXA 4GDNA 1XX2A 2J9PA 2Y2JA 4KZ5A 5KMWA 3HLWA 2BLSA 5HX9A 1CEFA 3UN7A 2QZ6A 5DF8A 1EWZA 2ZD8A 3FZCA 4M3KA 3PBOA 4EBLA 2Q9MA 3RJUA 2EFXA 3Q7VA 3A3FA 1GA9A 4X53A 3SOIA 4IVKA 2XD5A 3MZDA 5TGFA 2V20A 2XK1A 3C5AA 2QPNA 3D4FA 1HD8A 1KVMA 2P74A 3M2KA 3PBTA 1BLSA 1QMFA 1YLTA 1FR6A 2IWBA 4BL3A 5EVIB 1FSWA 3LEZA 5FDHA 3VFFA 1W8QA 1NY0A 3NY4A 3MXSA 5HW3A 1WYBA 4PM8A 4OP8A 4X6TA 4UAAA 4DF6A 5E43A 3C4PA 3DW0A 3IHAA 1PI5A 5KZHA 1QMEA 1NJ4A 2EX8A 3BECA 3FWLA 5E2GA 4FD8A 4DKIA 2JE5A 3VOZA 1MWTA 2HDQA 4PM9A 4Y0TA 1K55A 4S2KA 4U0XA 5CGXA 2ZJ9A 3WWXA 4ZBEA 5FASA 1E3UA 1ESUA 5EVID 3O3VA 3SH9A 2ZLYA 2JBFA 3FKWA 3BRMA 1C3BA 3P09A 4JF6A 4EV4A 1KGGA 1WYCA 5HAQA 1LLBA 1TDGA 2CC1A 3IWQA 3O86A 3PAEA 3DWZA 4OPRA 4BD0A 4ZJ3A 4JXVA 3LY3A 2WKIA 3C7VA 4OLGA 4WYYA 4QJGA 1YM1A 1HZOA 1S6RA 3MZEA 4BENA 3DWKA 1HTZA 4GKUA 5FI2A 1ONGA 3HLFA 4BJPA 2XDMA 4PMAA 2VGJA 4FSFA 3IWIA 4P0MA 1S0WA 1IYPA 4OOLA 1XP4A 1TEMA 2Y2OA 4QD4A 4DXBA 1SKFA 4L0LA 1KVLA 3IH9A 5FQ9A 1PWGA 3AGEA 4R1GA 1PZPA 3HVFA 3N8RA 5HFOA 5A92A 3RXWA 2E8IA 1IELA 1CEGA 3BFDA 5CEBA 3HLCA 4S2LA 4WM9A 5E2FA 2ZQ8A 5KSCA 1KDSA 4OQIA 3E2LA 3UDFA 2V1ZA 3BEBA 3E2KA 1FCNA 2WYXA 4PM7A 3QHYA 5TR7A 3TG9A 1BZAA 4DDSA 2Y2NA 4OPQA 3C4OA 5FQQA 2ZQDA 4E6WA 3ITBA 4QY6A 1G6AA 3C7UA 5M19A 2WGWA 4GD8A 3ISGA 2DCFA 3WS4A 2Y2QA 2ZC5B 1K25A 1L0DA 2ZMAA 4LV1A 1RCJA 4OLDA 4OQGA 2WGWB 4KZAA 4RA7A 4BL2A 3A3JA 1ALQA 2PBYA 3SH8A 3W8KA 5FI6A 1EROA 2H0YA 4S2NC 3UE1A 4UA7A 4CPKA 1JWPA 4OH0A 5FQIA 2C5WB 2R9XA 3MKEA 2H10A 4KZBA 5U47A 4X55A 1XGJA 2Y59A 1O7EA 1XGIA 4FH2A 4HESA 3BLMA 4OOYA 4X68A 3VP1A 2Y55A 3HUOA 3A3IA 3V3RA 2OV5A 2ZC4B 2GDNA 2HDRA 3BFCA 4BLMA 3HUMA 3UO9A 4E3JA 1NXYA 4WMCA 3ZVWA 5CHUA 1O07A 3IWOA 4Z9QA 3GTCA 1JWZA 2B5RA 2ZM0A 1L0EA 3BM6A 1ERQA 3ZHHA 4QB8A 2WGIA 5TFQA 3OCLA 1I5QA 3ITAA 4C3QA 3UDXA 1Y54A 3WRZA 5I94A 1PI4A 4D2OA 1K57C 3UDIA 2XLNA 4MBFA 1L2SA 4GD6A 4Q8IA 2XD1A 1H5XA 1ZKJA 4R4RA 4Y7PA 5CTNA 1ES5A 3HLGA 1JTDA 3HL9A 1GCEA 1KDWA 3QNCA 4PM5A 1YQSA 5A91A 3IF5A 2PU2A 4R3BA 4MBHA 2IWDA 3Q7VB 4R23A 2Y2PA 2VGKA 4N9KA 3CJMA 3IT9A 1CI8A 3A3DA 4IBRA 2RCXA 1YLZA 2XEPA 3GSGA 2V2FF 1NRFA 3DTMA 4KZ4A 3LCEA 3S4XA 4EWFA 2WAEA 1VM1A 3VMAA 1DJAA 3N4IA 4WMCD 4LCMA 2FFYA 3V5MA 1LHYA 3OCNA 3S1YA 1U60A 2OLUA 1LI0A 3W4QA 2PU4A 1BLPA 2X71A 3IH8A 3MZFA 4S2MA 4X69A 3ZG8B 1JTGA 4JXGA 3V39A 2Y2MA 3EQUA 4FH4A 1ZC2A 3ZNTA 4KQRA 3PBQA 5GHZA 2A49A 3IF6A 1YLYA 2EFUA 2ZQ7A 1HVBA 1LL9A 1PYYA 3OPLA 4N9LA 4U0TA 2I72A 4X56A 2ZC6B 1KE0A 4DE0A 1BUEA 4S2PA 4KQQA 2X02A 4GB7A 4NETA 4F94A 4S2NA 4ZDXA 1K6SA 3RXXA 1MKIA 1BTLA 4P85A 2ZQ9A 1MY8A 4LV3A 4JBFA 2OSUA 1ES4A 2WZXA 3PBNA 1IYQA 3WS1A 1YT4A 1MXOA 5DTKA 3SS3A 3GMWA 4ID4A 3BFGA 1OMEA 5FQKA 2EX6A 3N8LA 3VP0A 2HDSA 1CK3A 2HDUA 1KE4A 3IQAA 3HBRA 3UNWA 1EI5A 5F1FA 3SH7A 1JVJA 3SS4A 1FCMA 4KZ6A 1IKIA 4DE1A 3GV9A 3GVBA 5DTSA 3CZDA 2BG1A 4QU3A 3IF6B 5FQJA 2J7VA 2XFSA 3VFHA 4E3KA 5JYPA 1ZG4A 3HLDA 1MWSA 1MBLA 1FOFA 4WEKA 4E3NA 3M2JA 1CI9A 4OPYA 5CHMA 1MPLA 4DE2A 2RL3A 3WS0A 4O7DA 3ZCZA 5GL9A 3G2ZA 3Q82A 1K4FA 4MEZA 3ZNYA 3VSLA 1WE4A 1PIOA 1GHMA 3OPRA 5AQAA 2WKEA 1YLJA 4E3IA 2JC7A 2Y2LA 1IEMA 1ONHA 3M6BA 1GHIA 4HBUA 5GHYA 4DDYA 1DJCA 5L2FA 3NBLA 4RYEA 2EXBA 5CHJA 1TDLA 4E3MA 3B3XA 3G34A 4IVIA 1NZOA 4GOGA 2XGNA 4IBXA 4WELA 2H5SA 1NZUA 1RGZA 3P98A 3WS5A 4JF4A 3HREA 1K56A 3OPPA 4P87A 4CJNA 1H8ZA 4PM6A 1KGEA 4ZJ1A 5CEDA 1VQQA 2G2UA 2ZC3B 1DJBA 4UHUA 3Q7ZA 1IYSA 2WGVA 4OQHA 2DNSA 2XF3A 4KG2A 3IXBA 1XA1A 3M6HA 2WK0A 3Q1FA 5CRFA 4BQMA 2HPBA 4OONA 3QNBA 3UE0A 4OOMA 4PPRA 1ES3A 4ZJ2A 3O87A 3PBSA 1GHPA 4UA6A 3ZFZA 4R0QA 3VSKA 2P9VA 3ZVTA 4WZ5A 1E25A 1N4OA 4HBTA 4R3JA 1M6KA 3UPPA 1XA7A 3G35A 3PBRA 1H8YA 4RX2A 4WZ4A 2P9VB 3NI9A 1I2WA 4KQOA 3UE3A 4YFMA 1FR1A 5E2HA 5GLBA 5CGWA 4WZ5C 2Z2LB 2OLVA 3G31A 3VOYA 5E2EA 4N1XA 1KGFA 3W4PA 4LV2A 3WRTA 4MBKA 4K0XA 1PW1A 1BT5A 1YMSA 1K55C 1SHVA 4H8RA 4QY5A 2WAFA 1GA0A 3MBZA 1MWUA 2Y2IA 2G2WA 5F1GA 5J8XA 2A3UA 3MXRA 1DY6A 5CGSA 1K4EA 2J9OA 5M18A 4E3OA 5GLCA 5CERA 5F83A 3S22A
chains in the Genus database with same CATH superfamily
4EQIA 4YM6A 4KUDD 2WZZA 5TBMA 5CPJA 5AV9B 4R8PD 1K57A 3WTPE 3KXBA 3OBFA 3QP2A 3LY4A 2HJ9C 4ZTKA 3HJIA 5B0YD 3X1VB 3W99B 3SW1A 5B32G 4QHCA 4DRTA 2YKHA 2KLIA 3NOPC 4GNUA 3RELA 1NYYA 1S4RA 4OPZA 5DKKA 3ZG9B 3CG5A 4LCLA 4ARZA 2LB9A 1P34C 5AV8A 3V3SA 3AZNC 3AZFB 5G18A 2JKRI 5AQ7A 5BPVA 2A24B 3F1NA 3MKFA 2HGVA 3G32A 2QWSA 3T4SA 1OTEA 2FFFB 2WUQA 1OTAA 1XJ2A 5CTMA 4K91A 3G30A 3VP3A 3C1CD 1M19B 1PFLA 2CWEA 4M6BA 4RVAA 1P3AA 1M18B 1Z2CB 3REJA 2FJ7D 2UWXA 4GCZA 2XQZA 5B1MC 2INWA 3BFEA 2X01A 1E3UD 2Y91A 2Z2MB 4EERA 4KZ3A 3MGSA 4GS9B 1OTIA 5HARA 1M18C 4J8VA 1UR8A 3L7HA 5B31B 3VP2A 1YMXA 3AZJA 2ZQCA 1UGUA 5AQ9A 1PW8A 5FQMA 5AVEA 2O99A 2HP6A 3OZHA 1MWRA 3X1UD 1T18A 2J8YA 4HMDA 3H7WB 1SDEA 4P6ZM 1YSQA 3B6FB 5M1AA 1FQGA 3NCKA 4XUJC 3P7NA 3WS2A 2QMIA 1UWPX 4GDBA 5DNMA 2VK3A 3VH5T 4BWIA 4WU8B 3AZMA 3W97D 1TVFA 2XFTA 4JLFA 5CECA 3C8CA 4NKPA 1P3OB 1BSGA 3B47A 4DJ2A 2ZOHA 2ZM5A 1N1JA 5BNVA 4KENB 1SCWA 1Z09A 3KSHA 4R6LA 4J8WD 2BTFP 4OKPA 3JVUA 3H7WA 2D49A 2PDRA 3FYZA 2WKHA 3AZID 1L0GA 3OC2A 4JGPA 1RP5A 2VX8A 4KZ8A 2B95A 4OVDA 2HZ5A 4J8UD 4HH3A 2NZDD 5KDMB 5CPIB 3N7WA 2J9PA 5KMWA 4KZ5A 2OWJA 2F8ND 3HLWA 2BLSA 3CLOA 1HTAA 5DF8A 3LI9A 2ZD8A 3FZCA 1E6PA 2VLGA 4M3KA 4PKYA 5G49A 3UB9A 4XUJB 2Q9MA 3RJUA 4Y13A 1KX4B 3LR5A 4J8XD 2BYKA 4KHAB 1BH8A 1M18A 1FSWA 5FDHA 2F8NA 1W8QA 4YS3C 4Z2HA 1P0ZA 3NY4A 1WYBA 4PM8A 4OP8A 2DF4C 1W1VA 3B42A 3D3OA 3W97B 4UAAA 4WNNB 3LR4A 1XJ3A 3F1NB 3VOZA 1MWTA 5AY8A 3MGSD 3W98B 2NUTC 1F66D 1K55A 5CGXA 4U0XA 4IBJA 3R4KA 4ZBEA 1E3UA 1ESUA 1AOIC 4MCWA 3KWQB 4JF6A 3P09A 2NZDB 2IO5B 1WYCA 2CC1A 1TDGA 3MF0A 3O86A 5I5LA 3LIAA 3B6GB 3NHQA 3H82A 3C7VA 2AROC 2W3FA 4QJGA 3MZEA 1S6RA 1OTDA 1Y28A 1H0IA 3DWKA 5B2ID 1AOIB 1ONGA 3HLFA 1JFIB 1P3LD 3T1XA 3KXBC 2VV7A 2VGJA 2FZ0A 1GSWA 1IYPA 4JJNC 2ZY5A 1F9IA 2V9AA 3KS8A 3IH9A 3KX0X 5CPKC 3PXPA 5A92A 1TF1A 2E8IA 5JRGA 1CEGA 1S1YA 2GNXA 2ZQ8A 4OQIA 3NOUC 4QNLA 3QHYA 2Y2NA 1TS0A 3T50A 3FG8A 4GD8A 3ISGA 2Y2QA 2ZMAA 1K25A 4LV1A 5F69A 4OLDA 3A3JA 5EVEA 4JGOA 3W8KA 3L28A 3WKJB 4S2NC 3TU4A 2XRNA 1JWPA 4CPKA 2P04A 4Z5TA 3AN2C 3KS4A 4KZBA 2Y59A 1O7EA 1XGIA 1P97A 1AOID 3BLMA 1P34B 2Y55A 3A3IA 2ZC4B 4WU9A 3UTBB 4BLMA 3HUMA 4IBBA 4E3JA 3L25A 3HSHA 1F5MA 1YAXA 2IA2A 3GTCA 1JWZA 5HD3A 2ZM0A 3KSGA 1L0EA 3UE6A 4QB8A 4P6ZS 5TFQA 3UDXA 1AOIA 1Y54A 3WRZA 5I94A 4D2OA 3UDIA 2VA0A 4GD6A 1ES5A 5AV8D 1KS0A 4UEYA 2CMNA 3X1TA 3FC7A 1SZVA 4PM5A 1YQSA 3IF5A 2PU2A 2J3TD 2W0NA 1ED7A 1YSPA 4R23A 5HZHA 5AV6C 3B6FA 1T1AA 5CP6A 3IT9A 1KX3C 3A3DA 3B6FD 3O5YA 5C3IB 3O62B 5B31C 1YU0A 3VMAA 3A0SA 4WMCD 2FFYA 3LIEA 3KSIA 3CUEC 1U60A 1LI0A 1BLPA 1M1AC 2X71A 1E6NA 2LB5A 4J8WC 4E44A 3LZ1B 1EQZC 3ZNTA 2YFVB 3AZLA 2CV5C 3K3CA 2Q0OA 2A49A 5CP6B 3UMDA 4N9LA 4LLOB 3REKC 4H9PA 5BNVB 3IX4A 4KQQA 2X02A 4XZQB 4HH2A 2W3EA 5JA4A 5HDSA 1K6SA 3RXXA 4H9RB 2KX6A 1MXOA 5DTKA 3MGQB 3VP0A 2HDSA 1CK3A 2ACGA 3IQAA 1E6RA 5AY8B 2JN7A 3W98A 4WLAA 5G4YA 1P3FC 1FCMA 1IKIA 4DE1A 5CPJB 2PYOA 3CHWP 5DTSA 4HMCA 5FQJA 2Z6DA 2PYRA 3IF6B 2J7VA 2XFSA 2F8NH 3NQUA 5JYPA 1ZG4A 3HLDA 4R38A 1OJ5A 4WEKA 2VGLM 2QJ7A 5BO0B 3C1BC 4WF0A 4EUVA 5F99C 4H9SC 2CV5B 1K4FA 3AZKB 4MEZA 3R7WA 4NE3A 4XT2A 5B24B 5CHJA 4E3MA 3PYPA 3G34A 4IBXA 1F66B 2JKTM 4HJ6A 3ICYA 3WS5A 5AJGA 3LJAD 1G6OA 3AZJB 4PM6A 5DNNB 2MJ6A 3IX3A 1DJBA 4CAYB 3Q7ZA 3AZNA 5DKLA 1P3FB 5BT1C 4HIAA 3QP4A 1M18D 3S7PA 3REKA 2WK0A 5GXQC 4BQMA 1LSVA 4OONA 3QNBA 5B31G 3MS6A 3C1CB 1M19D 3UE0A 1XFNA 3ZFZA 3UT9D 4UA6A 4X23B 1P3LC 4R0QA 4H9QA 4IHQA 4WZ5A 4AWLC 1N4OA 2F8NG 1ZLAB 1M6KA 4IBGA 4MMNA 2P9VB 3MGRB 1D1JA 1F2KA 3C1CC 3LIDA 1YKDA 4WZ5C 3R45A 1P9WA 3VOYA 3AZGD 5E2EA 1OPXA 3W4PA 4K0XA 3L26A 3D9YA 3LICA 4H8RA 2L4RA 4LGWA 4QY5A 2WAFA 3MBZA 5F1GA 1MWUA 1E15A 1VEUA 3IX8A 1TAFB 3MGRD 3AZJC 1K4EA 2J9OA 5M18A 1P3MA 4IUHA 2O0YA 5CERA 4ETXA 3AYWD 3UB6A 3K3DA 1P3PD 1YU2A 1I2SA 3LZ0C 1G68A 5FUGA 4EBNA 4GJ4A 3VE4A 1MC0A 4WV4B 5LBRA 2RVQC 1LSXA 3KYQA 5GLAA 1P3AB 4B88A 1LSWA 2C6WB 2XA7S 3X1SA 4WU9D 3P01A 3TJZC 3BLSA 4NK3A 4RX3A 3LI8A 4MLLA 4GH9A 1KE3A 4N1HA 1M1AB 4OP5A 3UB5P 4L9GA 4R8PC 4CLCD 1Q2QA 1PWDA 5DTTA 3I7JA 2HF6A 2CV5D 3IF6C 5IHVA 3MGSC 3REJD 2FJ7A 3MR0A 4HGAB 3REHA 5CPKA 4XZQC 4IUKA 3NIAA 5JYOA 1P3BB 4MNRA 4CLCA 4EXOA 3MQ0A 3GDIA 3AZKC 2Y4AA 1K6RA 1HQ3C 1O6IA 5AV5C 1OJGA 3KFUG 3VH5W 3B33A 5B2IB 1Q2PA 3VP4A 1K54A 4JKTA 3LFVA 1MKMA 4Z66A 4HHDA 4PAUA 5FEGA 3NC8A 4U3TA 2JCHA 4WEJA 3X1UA 3BQAA 2W1TB 5EFWA 4NZ3A 3V50A 3AZFC 3UTBD 2DRWA 2ZM8A 4C75A 4ETZA 4R8PB 4S2OA 3DBAA 5HAIA 1YLPA 2H0TA 2EX2A 2V0UA 3N8SA 1X0OA 4O01A 4DE3A 2HP9A 3AZHA 5GSUD 5KSHA 3H9WA 1MZUA 4WBGA 3GRJA 1S67L 4AFIA 2D01A 3AV1D 1VETB 2VZWA 3LO7A 1WA9A 1EAKA 5JA4B 4Z2JA 1YU3A 2BYMB 3C1BD 1CF0A 2A24A 4H9PB 4NZ5A 4GHLA 3UPOA 5D3OA 4IEDA 2W1TA 5GHXA 2XA7M 3FPWA 4GZBA 2IO5C 1T1CA 3IXGA 4KZ9A 2O9AA 3MGPD 5HL1A 5L10A 1GOIA 1P3MB 4ZAMA 5AQBA 1SDNA 3ZG5A 5EVIA 4NY2A 3MFDA 1P3ID 3WAAD 3JYIA 1XJ6A 4ZUXB 4XUXA 4FOFA 2Y2JA 5HX9A 3UN7A 1CEFA 2ZL1B 1EWZA 3HJKA 3R45B 3MNNC 1P3KC 4LFUA 2EFXA 4E45A 1TZYA 3A3FA 1GA9A 5GT3B 1PNEA 2ZL1A 4NZ1A 4IBIA 3SZTA 3MVDD 4YOFA 2XK1A 2QPNA 1HQ3A 1QMFA 1FR6A 5L09A 1U35D 3CITA 5EVIB 3LEZA 1HQ3D 3KUYA 3BWLA 4Z66C 3AV2C 1S4SA 1ZLAD 5B1MB 3BJNA 1PI5A 3BECA 2H28A 3FWLA 4KUDB 4LRYC 3BY8A 4FD8A 4DKIA 2HDQA 3S7OA 4O0PA 3PHYA 3AL0C 4S2KA 5EVID 5HPFA 2OAP1 2ZLYA 3BQ8A 3FKWA 1C3BA 4G3KA 1KGGA 2B18A 5HAQA 1LLBA 3AZGA 3IWQA 3PAEA 1EQZD 3DWZA 4OPRA 2JHEA 3LY3A 4WYYA 4R70A 5AVFA 4J8XB 3AZGB 4BENA 1OGBA 5JRGC 2I9VA 5BNXB 4ZRRA 2D02A 4P0MA 4Z5TD 4OOLA 1XP4A 5FUGB 1TEMA 5FQ9A 3AGEA 1PZPA 2BASA 3AZIA 2RTSA 5CEBA 4S2LA 4WM9A 1XFQA 3LEQA 2J3WA 1KDSA 5B33A 2O9BA 4PM7A 5AV5A 4DDSA 5GT3A 3C4OA 5FQQA 2PRFA 4E6WA 3LJAA 4BMWA 2YFWB 5M19A 3S7NA 1H0MA 2WGWA 2DCFA 3WS4A 1L0DA 3EWKA 1RCJA 4OQGA 4KZAA 3LJAB 4Z2LA 1ALQA 5GSUB 5FI6A 2H0YA 4I3AA 5B0ZA 4OH0A 2C5WB 3W99C 4G3WA 4PHTA 2H10A 5U47A 1XGJA 4CSRB 1W2EA 3VP1A 5HL6A 2NZDA 2OV5A 3QP8A 4MN7A 2PAVP 3BFCA 3UO9A 2ZBBA 4WMCA 5EM1A 3AFAB 1BFMA 1P3FA 3IWOA 1KX4C 3X1VD 1OGGA 5GT0B 5B0YA 4JJNB 4WJ3C 1ERQA 1G5UA 2WGIA 3ZHHA 1I5QA 3ITAA 4F3LA 1W1TA 2QJ5A 2XLNA 2ZMVA 2VV6A 4Y5FA 3KXBD 2JKFA 1F98A 2XD1A 1H5XA 5CTNA 3ZYTA 3X1UC 1ZLAA 4L9FA 4HOIA 4Z5TB 5EV0A 2PHYA 3T4JA 1CJFA 1BYWA 3IS2A 3F1PA 1GXDA 3AZMD 3A1IA 4MBHA 1S32B 4Y3IA 4XUJA 3IP4C 2VGKA 5AV8C 1CI8A 2R78A 5AVBD 2RCXA 4KZ4A 3LCEA 3S4XA 1EQZA 3N4IA 1S32D 3MNNB 1P3KB 1LHYA 5DNND 3OCNA 4NEED 4NXEA 3S1YA 3W4QA 1VEUB 2PU4A 1KX4D 4S2MA 2GX5A 1M1AD 4X69A 4LD9A 3G6OA 3T4LA 5CX7A 4DN0A 4FH4A 4LRXC 2JKRM 5GHZA 3REHC 2JKTI 3IF6A 1YLYA 2ZQ7A 4U0TA 4J8UA 4OJOA 3OPLA 3U2AA 4LPZA 4DE0A 4S2PA 4GHIA 1TS7A 4ZDXA 2WKRA 2J80A 2ZQ9A 3AZND 4JBFA 1YUEA 4KGCC 1ES4A 5F5YA 3B6GA 2WZXA 4JGRA 3O62D 4J8VC 3UTAC 2A2LA 5B32B 4ID4A 1OMEA 5J4EA 3C1CA 5EM0A 1H0GA 3MQOA 4NYUA 4J8XC 3SS4A 1JVJA 4L9EA 1DP8A 3GV9A 3GVBA 3AYWB 4GHAA 5TJJA 1MWSA 1MBLA 1FOFA 5BS7C 3M2JA 5HSQA 1CI9A 3WS0A 4I3IA 1W1PA 1BH9B 5GL9A 3REKD 1WWIA 1BH8B 5GT3D 3Q82A 5AQAA 3REHD 5BS7A 1GHMA 3OPRA 3MQLA 4G92B 2JC7A 1IEMA 3M6BA 4HBUA 5GHYA 4DDYA 1T3UA 4QPRA 1T19A 2V1BA 5F68A 1A7WA 2H5SA 1H8MA 4H9SA 1RGZA 1J7MA 5CPID 4Y17A 3HREA 3MVDC 1E6ZA 4I3JA 4UQIS 2QYBA 5AVCC 2JKGA 3VH6W 5CEDA 1M1AA 2IOUA 4LD9C 4HGAC 2WGVA 2XF3A 4NE5A 4WZSB 1KX3B 5B1LC 5B2JC 4EO5B 3TRCA 2XROA 1P3BA 2HPBA 3NULA 4WNNA 2NQBC 2F8NK 3O87A 3X1SB 4ARZB 2P9VA 2ZOIA 3VH6A 2K7SA 1E25A 5B33C 5B24D 4HBTA 3UPPA 3L29A 3N3FA 2VGLS 4WU8A 3AZMB 3WKJA 3REJC 4RX2A 4WZ4A 1I2WA 4Y2FA 2G7UA 3EPKA 4YWZA 3UE3A 4YFMA 3LJAC 3KWQA 1FR1A 5GLBA 3REID 5CGWA 3WA9D 3H0LC 2F2AC 5AV5D 4QLCD 4N1XA 1KGFA 3WD3A 4MBKA 3AN2A 1PW1A 4Z2MH 1YMSA 3AN2D 3VH6T 1GA0A 5J8XA 2G2WA 2Y2IA 3P5JB 2A3UA 3QP6A 5GLCA 5E5AB 3S22A 3TU4B 3CMZA 5F99A 3W96D 2EX9A 4MB4A 2VKSA 4KG5A 1TZYB 5B24A 3NDGA 1GSXA 1LL8A 4Z2IA 1K38A 1UR9A 5B0YC 1NYMA 2Y2HA 1TS8A 2V8FA 3ZG0A 4JXWA 5FSRA 4YM6C 5IU1A 3MGPA 4BBUA 5F82A 3DTKA 2ZQAA 1ZG6A 5EPHA 4Z1WA 1FCOA 2ZM2A 5HAPA 3HUNA 4IJGA 1DRMA 1ID3A 4KG6A 1W5DA 2HUEC 5CP6D 5AV6A 5FI7A 1V9ZA 5B1LD 5B2JD 3AGFA 3NQUB 3MGRC 3AZJD 3HLEA 3MGPC 3PTEA 4NXBA 5DFYA 3GQZA 3X1TD 3WD0A 4KUOA 1PRQA 3AZLB 5A93A 1BLHA 3FKVA 2ZY2A 5EOEA 1VETA 4R4SA 4HEFA 3TSGA 5EECA 1P3OA 1J9MA 2UV0E 3O88A 3AYWC 5EVIC 4WU8C 3M7PA 3Q07A 3WKJC 4GN2A 3BFFA 3AGDA 1ACFA 4S2IA 4QLCC 1PWCA 3GR2A 5DF9A 5FA7A 3LZ1A 4AWLB 3KUYC 5CPIA 4Y0UA 3G4PA 4EETB 3AZHC 3IXDA 3NECA 3A3EA 3O62A 4LV0A 3MFXA 2PYOC 1FSYA 3F1OB 4K0WA 4KQDA 1ES2A 3TE8A 4Y15A 4HJ3A 4A5RA 3NQJB 3AV1A 3LELB 3PAGA 3UTAD 1W63M 1Q9CA 4J8VD 4FCFA 3X1TB 1AXBA 4JXSA 5KDMA 4H9OB 1NLZA 4EO5C 4OQ0A 3UPNA 4EESA 3WKJD 2YKFA 3UY6A 3X1SC 3HCYA 4NE6A 3PR6A 4B9OA 2Y2KA 4X23D 1RGYA 3DAVA 4XUZA 1E4DA 2M1CA 1JWVA 1Z6FA 3LELA 1GPFA 5DVAA 2M7UA 3ZDJA 4BD1A 4B4ZA 2HIOD 4UUZB 5GLDA 4HI4A 2PR6A 4EBPA 2L1MA 4KZ7A 5GSUC 3MGQA 3ZG7B 2V1AA 5AVBB 2VQRA 3EEAA 5F6AA 2Q9NA 1P3OD 5CXWA 5FATA 2NQBD 4EUZA 5JRGB 4G3VA 1BLCA 3B6GC 1ESIA 1F66A 2ZC7A 4C6YA 5B31A 3T1SA 1ERMA 2L5AA 1XX2A 4XZQA 2DQNC 2NQBB 2QZ6A 4MB3A 3AZHD 3OOVA 4H6JB 3KXBB 3PBOA 1G28A 3Q7VA 3T12B 4X53A 3SOIA 2NQBA 5AV9A 2V8CA 4IVKA 5TGFA 2V20A 3F1OA 5GT0C 1V9YA 4OJ5A 3REJB 3C5AA 3M2KA 1HD8A 3PBTA 2P74A 5CPIC 1E88A 1BLSA 1YLTA 4BL3A 2W3HA 3LZ1C 5J3WA 1KX5C 4I5SA 3MJQA 1NY0A 3MXSA 4CLCE 3C4PA 3DW0A 5KZHA 1UWNX 2KOIA 1TS6A 3DTEA 1NJ4A 2EX8A 5E2GA 3AZLD 1P3PB 1FIKA 3V67A 3WWXA 5HPIA 2V0WA 2ZJ9A 4ZUXD 3AZFA 2J8PA 3O3VA 5AVBC 3SH9A 3WA9C 4EV4A 2VJWA 2FN2A 4BD0A 4FUWA 3AZMC 1P3GD 4ZJ3A 4JXVA 2WKIA 3T1QB 1ZLAC 4HQAA 4DRBA 1HZOA 1IFQA 1YM1A 3X1VA 5B33D 4GKUA 5FI2A 5AVCA 4IBCA 4BJPA 4WN5A 4PMAA 3AV1B 3TU4D 1P3PA 5L8MA 3IWIA 3AZEC 4HP9A 2Y2OA 3CWFA 3IBRA 4IBDA 1PWGA 5TBMB 3OLOA 3W97A 3HVFA 3EPHA 2K2NA 5C5KA 1P34A 3BFDA 1D06A 4FTXA 5E2FA 4EW7A 3E2LA 2V1ZA 1ID3D 1FCNA 1P3LA 4JJND 3W99A 1BZAA 3QP1A 3A6ND 5L07A 4DMZA 2ZQDA 3ITBA 3C7UA 1KOUA 4XT2B 2EWWA 4RA7A 3KWQC 3B0CW 3QP5A 3SH8A 5HWWA 2NUPC 2PD7A 1EROA 2VEAA 3WX7A 3LIBA 3UE1A 5CHLB 2R9XA 4OJPA 3MKEA 3H0MC 3UB8A 5GT3C 4X55A 4HESA 4X68A 1WWSA 1N9NA 3UTAA 3F6TA 1FILA 2HDRA 3B0DB 4NXGA 1NXYA 4UUZA 5CHUA 4Q0HA 2B5RA 1N1JB 4EQ1A 3OCLA 1JFIA 4C3QA 4GW9A 1TZYD 3WA9A 1PI4A 5B32A 1K57C 3LR3A 1LT0A 1XJ4A 3LUQA 1L2SA 4Q8IA 1ZKJA 3ZQ5A 3B6FC 3EEHA 3HLGA 1JTDA 3RELC 4NFTA 3HL9A 5DNMB 1KDWA 4ZBJC 4RQ9A 1KX4A 4R3BA 2GZAA 4GHIB 3LGOA 1S1ZA 4N9KA 4D60A 5B1LB 5B2JB 3EPJA 3GSGA 1NRFA 3DTMA 4J8UC 2WAEA 3LELD 5KIZA 3TW8A 1BH9A 3V9RA 1S66L 4LD9B 2DMWA 3T4OA 4DRAA 3MZFA 4JXGA 3V39A 4TX8A 3EQUA 3REIA 4YS3D 3AYWA 3VV4A 2EFUA 1HVBA 1LL9A 1PYYA 3KSFA 3S7QA 1P3AC 3A6NC 2ZC6B 1H8PA 2W3GA 4H6JA 5GXQA 5FL3A 4HP4A 3KYEA 2ZMFA 4J8WA 1W63Q 4F94A 4S2NA 5B40B 1MKIA 2W27A 4CSRA 3H82B 1MY8A 3FPVA 3RELB 2ZY3A 1EW0A 2V5OA 4IBKA 1YT4A 2OOLA 3WA9B 5AVBA 3GMWA 3BFGA 4UPKA 5FQKA 1U35C 5GT0A 3HBRA 3UNWA 3C1BA 1F1EA 1TZYC 3NQJA 1EI5A 5AV9C 3O62C 3KSYA 4J8UB 3CZDA 4QU3A 5AV8B 4H9NA 3VFHA 4E3KA 2LY8A 4YM6B 1ZHHB 3KYZA 4E3NA 2L0WA 3WTPB 1H3QA 3MMHA 4DE2A 2RL3A 1NWZA 4O7DA 2HV1A 3W98C 3ZCZA 1EQZB 3T4QA 3G2ZA 2BYKB 5CPJC 3VSLA 4KUKA 3IBJA 1PIOA 2WKEA 1YLJA 4E3IA 2Y2LA 1GHIA 4XZQD 1OTBA 1NRJA 1L3LA 4WU8D 2AROB 4IVIA 2XGNA 1STZA 4X1MA 4ZUXA 5F99B 5E5AA 3AZFD 2M7VA 3LZ1D 3P98A 4NG2A 3E4OA 5GT0D 3AV1C 1H8ZA 3MGQC 2XSSA 2JSSA 4OUIA 4ZJ1A 1VQQA 4J8VB 3AZLC 2ZC3B 3AN2B 1IYSA 4KG2A 1D7EA 2HJEA 3M6HA 1B6WA 1M19C 3Q1FA 5CRFA 1TD5A 3UTBC 2NZDC 3WTPC 4PPRA 1ES3A 3PBSA 4NZ4A 3ZVTA 3H0RC 1N9LA 3KUYB 4R3JA 1QO6A 1XA7A 2FH5A 3PBRA 4H9OA 1H8YA 4YS3A 5B0ZB 2WKPA 3L2AA 5DJUA 3KUYD 3AV2A 2B02A 1H3OB 2OLVA 1U35A 2Z2LB 3AFAA 3WRTA 4ME4A 4QLCA 1P3GA 1F66C 1SHVA 3T4TA 5AV6B 1ULYA 2F8NB 1CXWA 4E3OA 3CAXA 5HWVA 5F83A 4WU9C 1YU4A 1LI9A 1W8YA 1YLWA 4MDZA 4ESPA 3MGSB 4GS9A 2EA9A 3E4PA 4JF5A 4PKYG 1DP9A 1S32A 1T1BA 3VH5A 3FKEA 3F1PB 1BULA 3MNND 1P3KD 2XH9A 2R9WA 5DNMC 4LENA 4UA9A 3MGRA 5DF7A 2FJ7B 5CPKD 3CPTB 3LZ0D 4Z2GA 3N6IA 5HDDA 3AZHB 4S2JA 3W4OA 2O9CA 3NDEA 3OPHA 1IKGA 1AIWA 2W1RA 4R8PA 5FAQA 4HJ4A 3SS5A 5B1MD 4MN5A 5JRGD 2FJ7C 5EVLA 4YM6D 4KUDA 1XXMA 3W96B 1E8BA 4IJEA 3ZGAB 1PZOA 1P3BC 5EUAA 4JGQA 3C30A 3REIC 1ID3B 4CLCC 2EWVA 5FEFA 4N92A 3AZKD 3A6NB 3MXQA 2HIOA 4IBEA 3CPTA 1K56D 4E3LA 3IHBA 1XPBA 3W97C 5FAPA 2WADA 1N9BA 1K54C 1OT9A 1W7FA 1P3IB 3IXHA 4YINA 5F99D 5A8BA 1M40A 3UT9A 5GXQD 2HP5A 4NXFA 5B1MA 3U4LP 5B33B 4XXRA 3WAAB 4Y0OA 4I38A 2KDKA 3BYDA 1P3MD 1LL5A 2AVXA 3LZ0A 1IYOA 3EGDC 3UT9C 1YU1A 1P3GB 5EE8A 5A90A 4X1LA 1AWIA 3C1BB 2Y2GA 2W3DA 2IWCA 1SKOB 1W79A 3NJAA 1A0KA 5BT1D 3E98A 4HMEA 3KO6A 5BNXA 4WL9A 3TOIA 2EXAA 3L9KA 5DNMD 1PDCA 5B0ZD 5MC7A 4NYYA 3EQVA 5BOHA 4II7A 3HONA 3AZEB 1W1YA 4H9QB 2QHKA 3FV7A 3Q81A 3G2YA 4E6XA 1P3PC 3W99D 5B0YB 4JJNA 4JPMA 4B93A 1SKOA 4DXCA 4I39A 1HLUP 2VV8A 4P6BA 4KUDC 1JNUA 3X1UB 5EOOA 4LG2A 4OJLA 4B4XA 3AZNB 5AV9D 5DNNC 1XKZA 1L0FA 4EU0A 3MVDA 3C2WA 3RTYA 5FAOA 2XR0A 3W98D 3HLBA 1J3WA 4IJFA 2PD8A 3MGPB 5GSUA 4GDNA 5B1LA 5B2JA 1VB6A 4MN6A 2OWHA 3BY9A 4LD9D 3AV2B 1P9RA 1P3MC 3RFBA 4EBLA 1VHMA 3EGXC 2YFWA 3E4QA 3MGQD 1P3FD 2XD5A 5CPKB 3MZDA 3LZ0B 3D4FA 1KVMA 2IWBA 4J8XA 2HIOB 3VFFA 3UMEA 3A6NA 5HW3A 4X6TA 3MVDB 4DF6A 5E43A 3IHAA 4ZBJB 1QMEA 4F3LB 2GJ3A 2JE5A 4PM9A 1H3OA 4Y0TA 5FASA 4DQYB 2PT7A 2BYMA 2JBFA 3IS2B 3UTAB 3BRMA 3AZEA 3C38A 5B32C 2G5HC 3AFAD 3CI6A 4GLQA 4Q0JA 1GSVA 4OLGA 3X1TC 2W8SA 1HTZA 3A1KA 3EOIA 1KX5D 3NOTC 2XDMA 3LELC 1KU5A 4FSFA 3WTPD 1KX3A 1S0WA 5CP6C 4QD4A 4DXBA 4M4XA 1SKFA 4L0LA 1KVLA 3GECA 4R1GA 5J7EA 3N8RA 5HFOA 4YNRA 5DNNA 3RXWA 1IELA 3MQQA 4Z66B 3HLCA 4G91C 4K08A 4G92C 5KSCA 3DTIA 2OAQ1 3UDFA 5B2IA 1KX5B 3BEBA 3E2KA 1HQ3B 3T1RA 2WYXA 4Q0IA 4R3AA 3UB7A 4Z5TC 5TR7A 3TG9A 4OPQA 3TU4C 2PR5A 4QY6A 1G6AA 3JVVA 1U35B 2PBDP 2ZC5B 3AZIC 5B40D 3EPLA 4G91B 2WGWB 5IT5A 4BL2A 2PBYA 2RIQA 1P3GC 3WD1A 3FDDA 4KGCA 5AY8D 4UA7A 3AFAC 5FQIA 1KX5A 5CPJD 4FH2A 5B31D 4OOYA 5BO0A 4H9RA 4HNBA 3AZIB 3HUOA 3V3RA 5AV6D 2GDNA 5HD5A 3LIFA 3WD4A 3ZVWA 5G4ZA 1O07A 4Z9QA 1N9OA 2E8JA 3BM6A 5B40C 3EG5B 5B24C 4Z66D 5DJTA 4DJ3A 1S32C 4YS3B 3BW6A 4MBFA 1Y4OA 4EEPA 1PZRA 4R4RA 4WUJA 4Y7PA 3WAAA 4KGCB 1GCEA 3QNCA 3X1VC 2AROA 3B0CT 1B67A 5A91A 2J3TC 3K2NA 5B32D 2IWDA 3CUEA 3Q7VB 2Y2PA 3RELD 2WKQA 3CJMA 4IBRA 3B6GD 2XEPA 1YLZA 3R7WB 5AV5B 2V2FF 5DFXA 3REHB 4EWFA 5E5AC 1VM1A 1DJAA 2CV5A 4LCMA 3V5MA 2P08A 2OLUA 3MNNA 1P3KA 3IH8A 3B0BA 3KWQD 3ZG8B 1JTGA 2Y2MA 3E0YA 3UT9B 2HIOC 1ZC2A 4KQRA 3PBQA 3A0RA 2PYOB 2I72A 3B0DC 4X56A 4X23C 4O8GA 1KE0A 1P3IA 3LYXA 4X25A 1BUEA 3UTBA 4GB7A 4NETA 4EEUA 2HUEB 3LR0A 5B0ZC 1BTLA 4P85A 2PYPA 2K31A 1IOUA 4LV3A 2OSUA 5IS1A 3PBNA 1IYQA 3WS1A 4XUJD 4LRZE 4X23A 1K0KA 3SS3A 4OJ6A 2EX6A 3D72A 3N8LA 3W96A 2HDUA 1KE4A 3JPUA 5GXQB 5F1FA 3SH7A 4KZ6A 1ZTUA 2BG1A 4CAYA 4KGCD 1P3LB 4CQHA 2ZY4A 4WU9B 1ODVA 1L6JA 4OPYA 3MSHA 5CHMA 1MPLA 5HDCA 4ZUXC 3V9RB 1CQAA 1P3AD 4KHAA 3ZNYA 4QLCB 2G5IC 1WE4A 4J8WB 1NLYA 5K5BA 1ONHA 1DP6A 4Z2MG 2Y8HA 1DJCA 5L2FA 3NBLA 4RYEA 3L27A 2EXBA 1TDLA 4MB5A 3B3XA 2P7JA 1NZOA 4GOGA 2YFVA 3AZGC 4WELA 1NZUA 5HWTA 5E5AD 4IBFA 1P3BD 3WD2A 4JF4A 2PYOD 3X1SD 1K56A 1ID3C 3WTPA 1KX3D 1M19A 3OPPA 4P87A 4CJNA 1KGEA 1R4VA 2G2UA 4UHUA 4OQHA 4H9NB 2QKPA 2DNSA 3IXBA 1XA1A 4E04A 5C3IC 1P34D 3VE3A 4CLCB 1P3IC 1YPRA 3AZED 4OOMA 4BBVA 5AVCB 4ZJ2A 1P3OC 5FDSA 3W2ZA 1GHPA 3VSKA 4UQIM 5B2IC 3G35A 2RVQD 3A0VA 3RH8B 2AROD 2Y79A 3NI9A 5B40A 5AVCD 4KQOA 3VOLA 3ULFA 5E2HA 3REKB 5G49B 4Z2KA 3G31A 3W96C 3WAAC 4LV2A 4BBTA 3AZKA 1CK7A 1BT5A 1K55C 1OT6A 4HY8A 3REIB 3T4KA 5AY8C 3MXRA 1DY6A 5CGSA 2Z6CA 4QWOA 1TAFA 3AV2D
chains in the Genus database with same CATH topology
4EQIA 4YM6A 4KUDD 2WZZA 5CPJA 5AV9B 4R8PD 1K57A 3WTPE 3KXBA 3LY4A 4ZTKA 5B0YD 3X1VB 3W99B 5B32G 4QHCA 4DRTA 4GNUA 3RELA 1NYYA 4OPZA 3ZG9B 3CG5A 4LCLA 1P34C 5AV8A 3V3SA 3AZNC 3AZFB 5G18A 5AQ7A 5BPVA 3MKFA 3G32A 2FFFB 2WUQA 5CTMA 4K91A 3G30A 3VP3A 3C1CD 1M19B 2CWEA 4M6BA 4RVAA 1P3AA 1M18B 1Z2CB 3REJA 2FJ7D 2UWXA 2XQZA 5B1MC 3BFEA 2X01A 1E3UD 2Y91A 2Z2MB 4KZ3A 3MGSA 5HARA 1M18C 4J8VA 5B31B 3VP2A 1YMXA 3AZJA 2ZQCA 5AQ9A 1PW8A 5FQMA 2HP6A 3OZHA 1MWRA 3X1UD 2J8YA 1SDEA 3B6FB 5M1AA 1FQGA 3NCKA 4XUJC 3WS2A 2QMIA 4GDBA 5DNMA 3VH5T 4WU8B 3AZMA 3W97D 1TVFA 2XFTA 4JLFA 5CECA 1P3OB 1BSGA 2ZM5A 1N1JA 5BNVA 4KENB 1SCWA 4J8WD 4OKPA 3FYZA 2WKHA 3AZID 1L0GA 3OC2A 1RP5A 4KZ8A 4OVDA 4J8UD 2NZDD 5KDMB 5CPIB 3N7WA 2J9PA 5KMWA 4KZ5A 2F8ND 3HLWA 2BLSA 1HTAA 5DF8A 2ZD8A 3FZCA 4M3KA 5G49A 4XUJB 2Q9MA 3RJUA 1KX4B 4J8XD 2BYKA 4KHAB 1BH8A 1M18A 1FSWA 5FDHA 2F8NA 1W8QA 4YS3C 3NY4A 1WYBA 4PM8A 4OP8A 2DF4C 3W97B 4UAAA 4WNNB 3VOZA 1MWTA 5AY8A 3MGSD 3W98B 1F66D 1K55A 5CGXA 4U0XA 4IBJA 4ZBEA 1E3UA 1ESUA 1AOIC 3KWQB 4JF6A 3P09A 2NZDB 2IO5B 1WYCA 2CC1A 1TDGA 3O86A 3B6GB 3C7VA 2AROC 4QJGA 3MZEA 1S6RA 3DWKA 5B2ID 1AOIB 1ONGA 3HLFA 1JFIB 1P3LD 3KXBC 2VGJA 1IYPA 4JJNC 2ZY5A 3KS8A 3IH9A 5CPKC 5A92A 5JRGA 2E8IA 1CEGA 2ZQ8A 4OQIA 4QNLA 3QHYA 2Y2NA 4GD8A 3ISGA 2Y2QA 2ZMAA 1K25A 4LV1A 4OLDA 3A3JA 3W8KA 3L28A 3WKJB 4S2NC 3TU4A 4CPKA 1JWPA 4Z5TA 3AN2C 3KS4A 4KZBA 2Y59A 1O7EA 1XGIA 1AOID 3BLMA 1P34B 2Y55A 3A3IA 2ZC4B 4WU9A 3UTBB 4BLMA 3HUMA 4IBBA 4E3JA 3L25A 3HSHA 3GTCA 1JWZA 2ZM0A 1L0EA 4QB8A 5TFQA 3UDXA 1AOIA 1Y54A 3WRZA 5I94A 4D2OA 3UDIA 4GD6A 1ES5A 5AV8D 3X1TA 4PM5A 1YQSA 3IF5A 2PU2A 4R23A 5AV6C 3B6FA 5CP6A 3IT9A 3A3DA 1KX3C 3B6FD 5C3IB 3O62B 5B31C 1YU0A 3VMAA 4WMCD 2FFYA 1U60A 1LI0A 1BLPA 1M1AC 2X71A 4J8WC 4E44A 3LZ1B 1EQZC 3ZNTA 2YFVB 3AZLA 2CV5C 2A49A 5CP6B 4N9LA 3REKC 4H9PA 5BNVB 4KQQA 2X02A 4XZQB 5JA4A 1K6SA 3RXXA 4H9RB 1MXOA 5DTKA 3MGQB 3VP0A 2HDSA 1CK3A 3IQAA 5AY8B 3W98A 1P3FC 1FCMA 1IKIA 4DE1A 5CPJB 2PYOA 5DTSA 5FQJA 3IF6B 2J7VA 2XFSA 2F8NH 3NQUA 5JYPA 1ZG4A 3HLDA 4WEKA 5BO0B 3C1BC 5F99C 4H9SC 2CV5B 1K4FA 3AZKB 4MEZA 4NE3A 5B24B 5CHJA 4E3MA 3G34A 4IBXA 1F66B 3WS5A 3LJAD 3AZJB 4PM6A 5DNNB 1DJBA 4CAYB 3Q7ZA 3AZNA 1P3FB 5BT1C 1M18D 3REKA 2WK0A 5GXQC 4BQMA 4OONA 3QNBA 5B31G 3C1CB 1M19D 3UE0A 3ZFZA 3UT9D 4UA6A 4X23B 1P3LC 4R0QA 4H9QA 4WZ5A 4AWLC 1N4OA 2F8NG 1ZLAB 1M6KA 4IBGA 2P9VB 3MGRB 3C1CC 4WZ5C 3R45A 3VOYA 3AZGD 5E2EA 3W4PA 4K0XA 3L26A 4H8RA 4QY5A 2WAFA 3MBZA 5F1GA 1MWUA 1TAFB 3MGRD 3AZJC 1K4EA 2J9OA 5M18A 1P3MA 5CERA 3AYWD 1P3PD 1YU2A 1I2SA 3LZ0C 1G68A 5FUGA 4EBNA 4WV4B 2RVQC 5GLAA 1P3AB 4B88A 2C6WB 3X1SA 4WU9D 3BLSA 4NK3A 4RX3A 4MLLA 4GH9A 1KE3A 4N1HA 1M1AB 4OP5A 4R8PC 1Q2QA 1PWDA 5DTTA 3I7JA 2CV5D 3IF6C 5IHVA 3MGSC 3REJD 2FJ7A 4HGAB 3REHA 5CPKA 4XZQC 3NIAA 5JYOA 1P3BB 4MNRA 3AZKC 2Y4AA 1K6RA 1HQ3C 5AV5C 3KFUG 3VH5W 5B2IB 1Q2PA 3VP4A 1K54A 4JKTA 4Z66A 3NC8A 4U3TA 2JCHA 4WEJA 3X1UA 4NZ3A 3V50A 3AZFC 3UTBD 2DRWA 2ZM8A 4C75A 4R8PB 4S2OA 5HAIA 1YLPA 2H0TA 2EX2A 3N8SA 4DE3A 2HP9A 3AZHA 5GSUD 5KSHA 4WBGA 3GRJA 3AV1D 3LO7A 5JA4B 1YU3A 2BYMB 3C1BD 4H9PB 4NZ5A 4GHLA 3UPOA 5D3OA 4IEDA 5GHXA 4GZBA 2IO5C 3IXGA 4KZ9A 3MGPD 5HL1A 1P3MB 4ZAMA 5AQBA 1SDNA 3ZG5A 5EVIA 4NY2A 3MFDA 1P3ID 3WAAD 3JYIA 4ZUXB 4XUXA 2Y2JA 5HX9A 3UN7A 1CEFA 1EWZA 3R45B 3MNNC 1P3KC 2EFXA 4E45A 1TZYA 3A3FA 1GA9A 5GT3B 4NZ1A 4IBIA 3MVDD 2XK1A 2QPNA 1HQ3A 1QMFA 1FR6A 1U35D 5EVIB 3LEZA 1HQ3D 3KUYA 4Z66C 3AV2C 1ZLAD 5B1MB 1PI5A 3BECA 3FWLA 4KUDB 4FD8A 4DKIA 2HDQA 3AL0C 4S2KA 5EVID 2ZLYA 3FKWA 1C3BA 1KGGA 5HAQA 1LLBA 3AZGA 3IWQA 3PAEA 1EQZD 3DWZA 4OPRA 3LY3A 4WYYA 4J8XB 3AZGB 4BENA 5JRGC 5BNXB 4P0MA 4Z5TD 4OOLA 1XP4A 5FUGB 1TEMA 5FQ9A 3AGEA 1PZPA 3AZIA 5CEBA 4S2LA 4WM9A 1KDSA 5B33A 4PM7A 5AV5A 4DDSA 5GT3A 3C4OA 5FQQA 4E6WA 3LJAA 2YFWB 5M19A 2WGWA 2DCFA 3WS4A 1L0DA 1RCJA 4OQGA 4KZAA 3LJAB 1ALQA 5GSUB 5FI6A 2H0YA 5B0ZA 4OH0A 2C5WB 3W99C 2H10A 5U47A 1XGJA 4CSRB 1W2EA 3VP1A 2NZDA 2OV5A 3BFCA 3UO9A 4WMCA 3AFAB 1BFMA 1P3FA 3IWOA 1KX4C 3X1VD 5GT0B 5B0YA 4JJNB 4WJ3C 1ERQA 2WGIA 3ZHHA 1I5QA 3ITAA 2XLNA 3KXBD 2XD1A 1H5XA 5CTNA 3X1UC 1ZLAA 4Z5TB 3AZMD 3A1IA 4MBHA 1S32B 4XUJA 3IP4C 2VGKA 5AV8C 1CI8A 5AVBD 2RCXA 4KZ4A 3LCEA 3S4XA 1EQZA 3N4IA 1S32D 3MNNB 1P3KB 1LHYA 5DNND 3OCNA 3S1YA 3W4QA 2PU4A 1KX4D 4S2MA 1M1AD 4X69A 4LD9A 4FH4A 5GHZA 3REHC 3IF6A 1YLYA 2ZQ7A 4U0TA 4J8UA 4OJOA 3OPLA 4DE0A 4S2PA 4ZDXA 2ZQ9A 3AZND 4JBFA 1YUEA 4KGCC 1ES4A 3B6GA 2WZXA 3O62D 4J8VC 3UTAC 5B32B 4ID4A 1OMEA 3C1CA 4NYUA 4J8XC 3SS4A 1JVJA 3GV9A 3GVBA 3AYWB 4GHAA 1MWSA 1MBLA 1FOFA 5BS7C 3M2JA 1CI9A 3WS0A 1BH9B 5GL9A 3REKD 1WWIA 1BH8B 5GT3D 3Q82A 5AQAA 3REHD 5BS7A 1GHMA 3OPRA 4G92B 2JC7A 1IEMA 3M6BA 4HBUA 5GHYA 4DDYA 1T3UA 1A7WA 2H5SA 4H9SA 1RGZA 5CPID 3HREA 3MVDC 5AVCC 3VH6W 5CEDA 1M1AA 2IOUA 4LD9C 4HGAC 2WGVA 2XF3A 4NE5A 4WZSB 1KX3B 5B1LC 5B2JC 4EO5B 1P3BA 2HPBA 4WNNA 2NQBC 2F8NK 3O87A 3X1SB 2P9VA 3VH6A 1E25A 5B33C 5B24D 4HBTA 3UPPA 3L29A 3N3FA 4WU8A 3AZMB 4RX2A 3WKJA 3REJC 4WZ4A 1I2WA 3EPKA 3UE3A 4YFMA 3LJAC 3KWQA 1FR1A 5GLBA 3REID 5CGWA 3WA9D 3H0LC 2F2AC 5AV5D 4QLCD 4N1XA 1KGFA 4MBKA 3AN2A 1PW1A 4Z2MH 1YMSA 3AN2D 3VH6T 1GA0A 5J8XA 2G2WA 2Y2IA 3P5JB 2A3UA 5GLCA 5E5AB 3S22A 3TU4B 3CMZA 5F99A 3W96D 2EX9A 4KG5A 1TZYB 5B24A 3NDGA 1K38A 5B0YC 1NYMA 2Y2HA 3ZG0A 4JXWA 5FSRA 4YM6C 3MGPA 5F82A 2ZQAA 1ZG6A 5EPHA 1FCOA 2ZM2A 5HAPA 3HUNA 1ID3A 4KG6A 1W5DA 2HUEC 5CP6D 5AV6A 5FI7A 5B1LD 5B2JD 3AGFA 3NQUB 3MGRC 3AZJD 3HLEA 3MGPC 3PTEA 3GQZA 3X1TD 3AZLB 5A93A 1BLHA 3FKVA 2ZY2A 5EOEA 4R4SA 4HEFA 3TSGA 5EECA 1P3OA 1J9MA 3O88A 3AYWC 5EVIC 4WU8C 3Q07A 3WKJC 4GN2A 3BFFA 3AGDA 4S2IA 4QLCC 1PWCA 3GR2A 5DF9A 5FA7A 3LZ1A 4AWLB 3KUYC 5CPIA 4Y0UA 3G4PA 3AZHC 3IXDA 3A3EA 3O62A 4LV0A 2PYOC 1FSYA 4K0WA 1ES2A 4A5RA 3NQJB 3AV1A 3PAGA 3LELB 3UTAD 1Q9CA 4J8VD 4FCFA 3X1TB 1AXBA 4JXSA 5KDMA 4H9OB 4EO5C 4OQ0A 3UPNA 3WKJD 3UY6A 3X1SC 4NE6A 2Y2KA 4X23D 1RGYA 4XUZA 1E4DA 1JWVA 1Z6FA 3LELA 5DVAA 3ZDJA 4BD1A 4B4ZA 2HIOD 4UUZB 5GLDA 4EBPA 4KZ7A 5GSUC 3MGQA 3ZG7B 5AVBB 2VQRA 2Q9NA 1P3OD 5CXWA 5FATA 2NQBD 4EUZA 5JRGB 1BLCA 3B6GC 1ESIA 1F66A 2ZC7A 4C6YA 5B31A 1ERMA 2L5AA 1XX2A 4XZQA 2DQNC 2NQBB 2QZ6A 3AZHD 3KXBB 3PBOA 3Q7VA 4X53A 3SOIA 2NQBA 5AV9A 4IVKA 5TGFA 2V20A 5GT0C 4OJ5A 3REJB 3M2KA 3C5AA 3PBTA 1HD8A 2P74A 5CPIC 1BLSA 1YLTA 4BL3A 3LZ1C 1KX5C 1NY0A 3MXSA 3C4PA 3DW0A 5KZHA 1NJ4A 2EX8A 5E2GA 3AZLD 1P3PB 3WWXA 2ZJ9A 4ZUXD 3AZFA 2J8PA 3O3VA 5AVBC 3SH9A 3WA9C 4EV4A 4BD0A 4ZJ3A 3AZMC 1P3GD 4JXVA 2WKIA 1ZLAC 4DRBA 1HZOA 1YM1A 3X1VA 5B33D 4GKUA 5FI2A 5AVCA 4IBCA 4BJPA 4PMAA 3AV1B 3TU4D 1P3PA 3IWIA 3AZEC 2Y2OA 4IBDA 1PWGA 3W97A 3HVFA 3EPHA 1P34A 3BFDA 5E2FA 3E2LA 2V1ZA 1ID3D 1FCNA 1P3LA 4JJND 3W99A 1BZAA 3A6ND 2ZQDA 3ITBA 3C7UA 4RA7A 3KWQC 3B0CW 3SH8A 1EROA 3WX7A 3UE1A 5CHLB 2R9XA 4OJPA 3MKEA 3H0MC 5GT3C 4X55A 4HESA 4X68A 1WWSA 3UTAA 3F6TA 2HDRA 3B0DB 1NXYA 4UUZA 5CHUA 2B5RA 1N1JB 3OCLA 1JFIA 4C3QA 1TZYD 3WA9A 1PI4A 5B32A 1K57C 1L2SA 4Q8IA 1ZKJA 3B6FC 3HLGA 1JTDA 3RELC 4NFTA 3HL9A 5DNMB 1KDWA 4ZBJC 1KX4A 4R3BA 4N9KA 5B1LB 5B2JB 3EPJA 3GSGA 1NRFA 3DTMA 4J8UC 2WAEA 3LELD 1BH9A 3V9RA 4LD9B 4DRAA 3MZFA 4JXGA 3V39A 3EQUA 3REIA 4YS3D 3AYWA 2EFUA 1HVBA 1LL9A 1PYYA 1P3AC 3A6NC 2ZC6B 5GXQA 4J8WA 4F94A 4S2NA 5B40B 1MKIA 4CSRA 1MY8A 3RELB 2ZY3A 4IBKA 1YT4A 3WA9B 5AVBA 3GMWA 3BFGA 4UPKA 5FQKA 1U35C 5GT0A 3HBRA 3UNWA 3C1BA 1F1EA 1TZYC 3NQJA 1EI5A 5AV9C 3O62C 3KSYA 4J8UB 3CZDA 4QU3A 5AV8B 4H9NA 3VFHA 4E3KA 2LY8A 4YM6B 4E3NA 3WTPB 4DE2A 2RL3A 4O7DA 3W98C 3ZCZA 1EQZB 3G2ZA 2BYKB 5CPJC 3VSLA 1PIOA 2WKEA 1YLJA 4E3IA 2Y2LA 1GHIA 4XZQD 4IVIA 4WU8D 2AROB 2XGNA 4ZUXA 5F99B 5E5AA 3AZFD 3LZ1D 3P98A 5GT0D 3AV1C 1H8ZA 3MGQC 2JSSA 4OUIA 4ZJ1A 1VQQA 4J8VB 3AZLC 2ZC3B 3AN2B 1IYSA 4KG2A 3M6HA 1B6WA 1M19C 3Q1FA 5CRFA 3UTBC 2NZDC 3WTPC 4PPRA 1ES3A 3PBSA 4NZ4A 3ZVTA 3H0RC 3KUYB 4R3JA 1XA7A 3PBRA 4H9OA 1H8YA 4YS3A 5B0ZB 3L2AA 3KUYD 3AV2A 2Z2LB 1H3OB 2OLVA 1U35A 3AFAA 3WRTA 4QLCA 1P3GA 1F66C 1SHVA 5AV6B 1ULYA 2F8NB 4E3OA 5F83A 4WU9C 1YU4A 1LI9A 1W8YA 1YLWA 3MGSB 4JF5A 1S32A 3VH5A 3FKEA 1BULA 3MNND 1P3KD 2XH9A 2R9WA 5DNMC 4LENA 4UA9A 3MGRA 5DF7A 2FJ7B 5CPKD 3LZ0D 3N6IA 3AZHB 4S2JA 3W4OA 3NDEA 3OPHA 1IKGA 4R8PA 5FAQA 3SS5A 5B1MD 5JRGD 2FJ7C 5EVLA 4YM6D 4KUDA 1XXMA 3W96B 4IJEA 3ZGAB 1PZOA 1P3BC 5EUAA 3REIC 1ID3B 4N92A 3AZKD 3A6NB 2HIOA 4IBEA 1K56D 4E3LA 3IHBA 1XPBA 3W97C 5FAPA 2WADA 1N9BA 1K54C 1W7FA 1P3IB 3IXHA 4YINA 5F99D 1M40A 3UT9A 5GXQD 2HP5A 5B1MA 5B33B 4XXRA 3WAAB 4Y0OA 3BYDA 1P3MD 1LL5A 3LZ0A 1IYOA 3UT9C 1YU1A 1P3GB 5EE8A 5A90A 3C1BB 2Y2GA 2IWCA 1W79A 5BT1D 5BNXA 3TOIA 2EXAA 5DNMD 5B0ZD 4NYYA 3EQVA 5BOHA 3HONA 3AZEB 4H9QB 3FV7A 3Q81A 3G2YA 4E6XA 1P3PC 3W99D 5B0YB 4JJNA 4JPMA 4DXCA 4P6BA 4KUDC 3X1UB 5EOOA 4LG2A 4OJLA 4B4XA 3AZNB 5AV9D 5DNNC 1XKZA 1L0FA 3MVDA 5FAOA 2XR0A 3W98D 3HLBA 4IJFA 3MGPB 5GSUA 4GDNA 5B1LA 5B2JA 4LD9D 3AV2B 1P3MC 4EBLA 2YFWA 3MGQD 1P3FD 2XD5A 5CPKB 3MZDA 3LZ0B 3D4FA 1KVMA 2IWBA 4J8XA 2HIOB 3VFFA 3A6NA 5HW3A 4X6TA 3MVDB 4DF6A 5E43A 3IHAA 4ZBJB 1QMEA 2JE5A 4PM9A 1H3OA 4Y0TA 5FASA 4DQYB 2BYMA 2JBFA 3UTAB 3BRMA 3AZEA 5B32C 2G5HC 3AFAD 4OLGA 3X1TC 2W8SA 1HTZA 3A1KA 1KX5D 2XDMA 3LELC 1KU5A 4FSFA 3WTPD 1KX3A 1S0WA 5CP6C 4QD4A 4DXBA 1SKFA 4L0LA 1KVLA 4R1GA 3N8RA 5HFOA 5DNNA 3RXWA 1IELA 4Z66B 3HLCA 4G91C 4G92C 5KSCA 3UDFA 5B2IA 1KX5B 3BEBA 3E2KA 1HQ3B 2WYXA 4Z5TC 5TR7A 3TG9A 4OPQA 3TU4C 4QY6A 1G6AA 1U35B 2ZC5B 3AZIC 5B40D 3EPLA 4G91B 2WGWB 4BL2A 2PBYA 2RIQA 1P3GC 3FDDA 4KGCA 5AY8D 4UA7A 3AFAC 5FQIA 1KX5A 5CPJD 4FH2A 5B31D 4OOYA 5BO0A 4H9RA 3AZIB 3HUOA 3V3RA 5AV6D 2GDNA 3ZVWA 1O07A 4Z9QA 3BM6A 5B40C 3EG5B 5B24C 4Z66D 1S32C 4YS3B 4MBFA 1PZRA 4R4RA 4Y7PA 3WAAA 4KGCB 1GCEA 3QNCA 3X1VC 2AROA 3B0CT 1B67A 5A91A 5B32D 2IWDA 3Q7VB 2Y2PA 3RELD 3CJMA 4IBRA 3B6GD 2XEPA 1YLZA 5AV5B 2V2FF 3REHB 4EWFA 5E5AC 1VM1A 1DJAA 2CV5A 4LCMA 3V5MA 2OLUA 3MNNA 1P3KA 3IH8A 3B0BA 3KWQD 3ZG8B 1JTGA 2Y2MA 3UT9B 2HIOC 1ZC2A 4KQRA 3PBQA 2PYOB 2I72A 3B0DC 4X56A 4X23C 1KE0A 1P3IA 1BUEA 3UTBA 4GB7A 4NETA 2HUEB 5B0ZC 1BTLA 4P85A 4LV3A 2OSUA 3PBNA 1IYQA 3WS1A 4XUJD 4X23A 3SS3A 4OJ6A 2EX6A 3N8LA 3W96A 2HDUA 1KE4A 5GXQB 5F1FA 3SH7A 4KZ6A 2BG1A 4CAYA 4KGCD 1P3LB 2ZY4A 4WU9B 4OPYA 5CHMA 1MPLA 4ZUXC 3V9RB 1P3AD 4KHAA 3ZNYA 4QLCB 2G5IC 1WE4A 4J8WB 1ONHA 4Z2MG 1DJCA 5L2FA 3NBLA 4RYEA 3L27A 2EXBA 1TDLA 3B3XA 1NZOA 4GOGA 2YFVA 3AZGC 4WELA 1NZUA 5E5AD 4IBFA 1P3BD 4JF4A 2PYOD 3X1SD 1K56A 1ID3C 3WTPA 1KX3D 1M19A 3OPPA 4P87A 4CJNA 1KGEA 1R4VA 2G2UA 4UHUA 4OQHA 4H9NB 2DNSA 3IXBA 1XA1A 5C3IC 1P34D 1P3IC 3AZED 4OOMA 5AVCB 4ZJ2A 1P3OC 1GHPA 3VSKA 5B2IC 3G35A 2RVQD 2AROD 3NI9A 5B40A 5AVCD 4KQOA 5E2HA 3REKB 5G49B 3G31A 3W96C 3WAAC 4LV2A 3AZKA 1BT5A 1K55C 3REIB 5AY8C 3MXRA 1DY6A 5CGSA 1TAFA 3AV2D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EQI A;  1LI9 A;  1W8Y A;  2WZZ A;  3CMZ A;  1YLW A;  2EX9 A;  4KG5 A;  1I2S A;  3NDG A;  1G68 A;  1K38 A;  4JF5 A;  4EBN A;  1K57 A;  1NYM A;  2Y2H A;  3LY4 A;  4ZTK A;  3ZG0 A;  4JXW A;  5FSR A;  1BUL A;  2XH9 A;  5F82 A;  2R9W A;  2ZQA A;  4LEN A;  1ZG6 A;  4UA9 A;  5EPH A;  5GLA A;  5DF7 A;  4QHC A;  4B88 A;  4DRT A;  1FCO A;  2ZM2 A;  5HAP A;  3HUN A;  2C6W B;  4GNU A;  1NYY A;  3N6I A;  4KG6 A;  1W5D A;  4S2J A;  4OPZ A;  3W4O A;  3ZG9 B;  5FI7 A;  3NDE A;  3CG5 A;  4LCL A;  3OPH A;  1IKG A;  3AGF A;  3V3S A;  3BLS A;  4NK3 A;  3HLE A;  4RX3 A;  5FAQ A;  3PTE A;  4MLL A;  3SS5 A;  5G18 A;  5AQ7 A;  3GQZ A;  5EVL A;  1KE3 A;  3MKF A;  4N1H A;  1XXM A;  5A93 A;  3G32 A;  1BLH A;  3ZGA B;  3FKV A;  1PZO A;  4OP5 A;  5EOE A;  4R4S A;  4HEF A;  2FFF B;  2WUQ A;  3TSG A;  5EUA A;  5EEC A;  3O88 A;  1J9M A;  5CTM A;  4K91 A;  3G30 A;  3VP3 A;  1Q2Q A;  1PWD A;  5DTT A;  3I7J A;  5EVI C;  4N92 A;  3IF6 C;  3Q07 A;  4RVA A;  5IHV A;  1K56 D;  4E3L A;  3IHB A;  1XPB A;  2UWX A;  2XQZ A;  2WAD A;  5FAP A;  4GN2 A;  1N9B A;  3NIA A;  5JYO A;  3BFF A;  3BFE A;  4MNR A;  1K54 C;  2X01 A;  1E3U D;  1W7F A;  3AGD A;  3IXH A;  4YIN A;  2Y91 A;  2Z2M B;  4S2I A;  4KZ3 A;  2Y4A A;  1M40 A;  5HAR A;  1PWC A;  3GR2 A;  1K6R A;  5DF9 A;  5FA7 A;  2HP5 A;  1Q2P A;  3VP2 A;  1YMX A;  4Y0U A;  4XXR A;  3VP4 A;  1K54 A;  4JKT A;  2ZQC A;  5AQ9 A;  1PW8 A;  4Y0O A;  3BYD A;  3G4P A;  1LL5 A;  3NC8 A;  5FQM A;  3IXD A;  4U3T A;  2HP6 A;  2JCH A;  1MWR A;  3A3E A;  3OZH A;  4LV0 A;  2J8Y A;  1FSY A;  4WEJ A;  4K0W A;  1IYO A;  1ES2 A;  1SDE A;  5EE8 A;  4A5R A;  5A90 A;  3V50 A;  5M1A A;  2DRW A;  3PAG A;  2Y2G A;  2ZM8 A;  2IWC A;  4C75 A;  1W79 A;  1FQG A;  3NCK A;  4S2O A;  3WS2 A;  4FCF A;  5HAI A;  2QMI A;  1YLP A;  2H0T A;  2EX2 A;  1AXB A;  4GDB A;  3N8S A;  4DE3 A;  3TOI A;  4JXS A;  2HP9 A;  5KSH A;  2EXA A;  4OQ0 A;  1TVF A;  2XFT A;  4JLF A;  4WBG A;  3UPN A;  3GRJ A;  5CEC A;  3EQV A;  5BOH A;  3UY6 A;  1BSG A;  3LO7 A;  3FV7 A;  2Y2K A;  1RGY A;  3Q81 A;  3G2Y A;  4XUZ A;  1E4D A;  1JWV A;  4E6X A;  1Z6F A;  4JPM A;  4KEN B;  5DVA A;  1SCW A;  3ZDJ A;  4DXC A;  4BD1 A;  4B4Z A;  4P6B A;  5GLD A;  4OKP A;  3UPO A;  5D3O A;  4IED A;  5GHX A;  3FYZ A;  5EOO A;  4EBP A;  4B4X A;  4GZB A;  2WKH A;  1L0G A;  3OC2 A;  4KZ7 A;  1XKZ A;  3IXG A;  4KZ9 A;  1RP5 A;  3ZG7 B;  1L0F A;  5HL1 A;  4KZ8 A;  2Q9N A;  4OVD A;  5CXW A;  5FAT A;  5FAO A;  2XR0 A;  4ZAM A;  4EUZ A;  5AQB A;  1SDN A;  3ZG5 A;  5EVI A;  3MFD A;  3HLB A;  1BLC A;  1ESI A;  4C6Y A;  3JYI A;  2ZC7 A;  1ERM A;  3N7W A;  4XUX A;  4GDN A;  1XX2 A;  2J9P A;  2Y2J A;  4KZ5 A;  5KMW A;  3HLW A;  2BLS A;  5HX9 A;  1CEF A;  3UN7 A;  2QZ6 A;  5DF8 A;  1EWZ A;  2ZD8 A;  3FZC A;  4M3K A;  3PBO A;  4EBL A;  2Q9M A;  3RJU A;  2EFX A;  3Q7V A;  3A3F A;  1GA9 A;  4X53 A;  3SOI A;  4IVK A;  2XD5 A;  3MZD A;  5TGF A;  2V20 A;  2XK1 A;  3C5A A;  2QPN A;  3D4F A;  1HD8 A;  1KVM A;  2P74 A;  3M2K A;  3PBT A;  1BLS A;  1QMF A;  1YLT A;  1FR6 A;  2IWB A;  4BL3 A;  5EVI B;  1FSW A;  3LEZ A;  5FDH A;  3VFF A;  1W8Q A;  1NY0 A;  3NY4 A;  3MXS A;  5HW3 A;  1WYB A;  4PM8 A;  4OP8 A;  4X6T A;  4UAA A;  4DF6 A;  5E43 A;  3C4P A;  3DW0 A;  3IHA A;  1PI5 A;  5KZH A;  1QME A;  1NJ4 A;  2EX8 A;  3BEC A;  3FWL A;  5E2G A;  4FD8 A;  4DKI A;  2JE5 A;  3VOZ A;  1MWT A;  2HDQ A;  4PM9 A;  4Y0T A;  1K55 A;  4S2K A;  4U0X A;  5CGX A;  2ZJ9 A;  3WWX A;  4ZBE A;  5FAS A;  1E3U A;  1ESU A;  5EVI D;  3O3V A;  3SH9 A;  2ZLY A;  2JBF A;  3FKW A;  3BRM A;  1C3B A;  3P09 A;  4JF6 A;  4EV4 A;  1KGG A;  1WYC A;  5HAQ A;  1LLB A;  1TDG A;  2CC1 A;  3IWQ A;  3O86 A;  3PAE A;  3DWZ A;  4OPR A;  4BD0 A;  4ZJ3 A;  4JXV A;  3LY3 A;  2WKI A;  3C7V A;  4OLG A;  4WYY A;  4QJG A;  1YM1 A;  1HZO A;  1S6R A;  3MZE A;  4BEN A;  3DWK A;  1HTZ A;  4GKU A;  5FI2 A;  1ONG A;  3HLF A;  4BJP A;  2XDM A;  4PMA A;  2VGJ A;  4FSF A;  3IWI A;  4P0M A;  1S0W A;  1IYP A;  4OOL A;  1XP4 A;  1TEM A;  2Y2O A;  4QD4 A;  4DXB A;  1SKF A;  4L0L A;  1KVL A;  3IH9 A;  5FQ9 A;  1PWG A;  3AGE A;  4R1G A;  1PZP A;  3HVF A;  3N8R A;  5HFO A;  5A92 A;  3RXW A;  2E8I A;  1IEL A;  1CEG A;  3BFD A;  5CEB A;  3HLC A;  4S2L A;  4WM9 A;  5E2F A;  2ZQ8 A;  5KSC A;  1KDS A;  4OQI A;  3E2L A;  3UDF A;  2V1Z A;  3BEB A;  3E2K A;  1FCN A;  2WYX A;  4PM7 A;  3QHY A;  5TR7 A;  3TG9 A;  1BZA A;  4DDS A;  2Y2N A;  4OPQ A;  3C4O A;  5FQQ A;  2ZQD A;  4E6W A;  3ITB A;  4QY6 A;  1G6A A;  3C7U A;  5M19 A;  2WGW A;  4GD8 A;  3ISG A;  2DCF A;  3WS4 A;  2Y2Q A;  2ZC5 B;  1K25 A;  1L0D A;  2ZMA A;  4LV1 A;  1RCJ A;  4OLD A;  4OQG A;  2WGW B;  4KZA A;  4RA7 A;  4BL2 A;  3A3J A;  1ALQ A;  2PBY A;  3SH8 A;  3W8K A;  5FI6 A;  1ERO A;  2H0Y A;  4S2N C;  3UE1 A;  4UA7 A;  4CPK A;  1JWP A;  4OH0 A;  5FQI A;  2C5W B;  2R9X A;  3MKE A;  2H10 A;  4KZB A;  5U47 A;  4X55 A;  1XGJ A;  2Y59 A;  1O7E A;  1XGI A;  4FH2 A;  4HES A;  3BLM A;  4OOY A;  4X68 A;  3VP1 A;  2Y55 A;  3HUO A;  3A3I A;  3V3R A;  2OV5 A;  2ZC4 B;  2GDN A;  2HDR A;  3BFC A;  4BLM A;  3HUM A;  3UO9 A;  4E3J A;  1NXY A;  4WMC A;  3ZVW A;  5CHU A;  1O07 A;  3IWO A;  4Z9Q A;  3GTC A;  1JWZ A;  2B5R A;  2ZM0 A;  1L0E A;  3BM6 A;  1ERQ A;  3ZHH A;  4QB8 A;  2WGI A;  5TFQ A;  3OCL A;  1I5Q A;  3ITA A;  4C3Q A;  3UDX A;  1Y54 A;  3WRZ A;  5I94 A;  1PI4 A;  4D2O A;  1K57 C;  3UDI A;  2XLN A;  4MBF A;  1L2S A;  4GD6 A;  4Q8I A;  2XD1 A;  1H5X A;  1ZKJ A;  4R4R A;  4Y7P A;  5CTN A;  1ES5 A;  3HLG A;  1JTD A;  3HL9 A;  1GCE A;  1KDW A;  3QNC A;  4PM5 A;  1YQS A;  5A91 A;  3IF5 A;  2PU2 A;  4R3B A;  4MBH A;  2IWD A;  3Q7V B;  4R23 A;  2Y2P A;  2VGK A;  4N9K A;  3CJM A;  3IT9 A;  1CI8 A;  3A3D A;  4IBR A;  2RCX A;  1YLZ A;  2XEP A;  3GSG A;  2V2F F;  1NRF A;  3DTM A;  4KZ4 A;  3LCE A;  3S4X A;  4EWF A;  2WAE A;  1VM1 A;  3VMA A;  1DJA A;  3N4I A;  4WMC D;  4LCM A;  2FFY A;  3V5M A;  1LHY A;  3OCN A;  3S1Y A;  1U60 A;  2OLU A;  1LI0 A;  3W4Q A;  2PU4 A;  1BLP A;  2X71 A;  3IH8 A;  3MZF A;  4S2M A;  4X69 A;  3ZG8 B;  1JTG A;  4JXG A;  3V39 A;  2Y2M A;  3EQU A;  4FH4 A;  1ZC2 A;  3ZNT A;  4KQR A;  3PBQ A;  5GHZ A;  2A49 A;  3IF6 A;  1YLY A;  2EFU A;  2ZQ7 A;  1HVB A;  1LL9 A;  1PYY A;  3OPL A;  4N9L A;  4U0T A;  2I72 A;  4X56 A;  2ZC6 B;  1KE0 A;  4DE0 A;  1BUE A;  4S2P A;  4KQQ A;  2X02 A;  4GB7 A;  4NET A;  4F94 A;  4S2N A;  4ZDX A;  1K6S A;  3RXX A;  1MKI A;  1BTL A;  4P85 A;  2ZQ9 A;  1MY8 A;  4LV3 A;  4JBF A;  2OSU A;  1ES4 A;  2WZX A;  3PBN A;  1IYQ A;  3WS1 A;  1YT4 A;  1MXO A;  5DTK A;  3SS3 A;  3GMW A;  4ID4 A;  3BFG A;  1OME A;  5FQK A;  2EX6 A;  3N8L A;  3VP0 A;  2HDS A;  1CK3 A;  2HDU A;  1KE4 A;  3IQA A;  3HBR A;  3UNW A;  1EI5 A;  5F1F A;  3SH7 A;  1JVJ A;  3SS4 A;  1FCM A;  4KZ6 A;  1IKI A;  4DE1 A;  3GV9 A;  3GVB A;  5DTS A;  3CZD A;  2BG1 A;  4QU3 A;  3IF6 B;  5FQJ A;  2J7V A;  2XFS A;  3VFH A;  4E3K A;  5JYP A;  1ZG4 A;  3HLD A;  1MWS A;  1MBL A;  1FOF A;  4WEK A;  4E3N A;  3M2J A;  1CI9 A;  4OPY A;  5CHM A;  1MPL A;  4DE2 A;  2RL3 A;  3WS0 A;  4O7D A;  3ZCZ A;  5GL9 A;  3G2Z A;  3Q82 A;  1K4F A;  4MEZ A;  3ZNY A;  3VSL A;  1WE4 A;  1PIO A;  1GHM A;  3OPR A;  5AQA A;  2WKE A;  1YLJ A;  4E3I A;  2JC7 A;  2Y2L A;  1IEM A;  1ONH A;  3M6B A;  1GHI A;  4HBU A;  5GHY A;  4DDY A;  1DJC A;  5L2F A;  3NBL A;  4RYE A;  2EXB A;  5CHJ A;  1TDL A;  4E3M A;  3B3X A;  3G34 A;  4IVI A;  1NZO A;  4GOG A;  2XGN A;  4IBX A;  4WEL A;  2H5S A;  1NZU A;  1RGZ A;  3P98 A;  3WS5 A;  4JF4 A;  3HRE A;  1K56 A;  3OPP A;  4P87 A;  4CJN A;  1H8Z A;  4PM6 A;  1KGE A;  4ZJ1 A;  5CED A;  1VQQ A;  2G2U A;  2ZC3 B;  1DJB A;  4UHU A;  3Q7Z A;  1IYS A;  2WGV A;  4OQH A;  2DNS A;  2XF3 A;  4KG2 A;  3IXB A;  1XA1 A;  3M6H A;  2WK0 A;  3Q1F A;  5CRF A;  4BQM A;  2HPB A;  4OON A;  3QNB A;  3UE0 A;  4OOM A;  4PPR A;  1ES3 A;  4ZJ2 A;  3O87 A;  3PBS A;  1GHP A;  4UA6 A;  3ZFZ A;  4R0Q A;  3VSK A;  2P9V A;  3ZVT A;  4WZ5 A;  1E25 A;  1N4O A;  4HBT A;  4R3J A;  1M6K A;  3UPP A;  1XA7 A;  3G35 A;  3PBR A;  1H8Y A;  4RX2 A;  4WZ4 A;  2P9V B;  3NI9 A;  1I2W A;  4KQO A;  3UE3 A;  4YFM A;  1FR1 A;  5E2H A;  5GLB A;  5CGW A;  4WZ5 C;  2Z2L B;  2OLV A;  3G31 A;  3VOY A;  5E2E A;  4N1X A;  1KGF A;  3W4P A;  4LV2 A;  3WRT A;  4MBK A;  4K0X A;  1PW1 A;  1BT5 A;  1YMS A;  1K55 C;  1SHV A;  4H8R A;  4QY5 A;  2WAF A;  1GA0 A;  3MBZ A;  1MWU A;  2Y2I A;  2G2W A;  5F1G A;  5J8X A;  2A3U A;  3MXR A;  1DY6 A;  5CGS A;  1K4E A;  2J9O A;  5M18 A;  4E3O A;  5GLC A;  5CER A;  5F83 A;  3S22 A; 
#chains in the Genus database with same CATH topology
 4EQI A;  4YM6 A;  4KUD D;  2WZZ A;  5TBM A;  5CPJ A;  5AV9 B;  4R8P D;  1K57 A;  3WTP E;  3KXB A;  3OBF A;  3QP2 A;  3LY4 A;  2HJ9 C;  4ZTK A;  3HJI A;  5B0Y D;  3X1V B;  3W99 B;  3SW1 A;  5B32 G;  4QHC A;  4DRT A;  2YKH A;  2KLI A;  3NOP C;  4GNU A;  3REL A;  1NYY A;  1S4R A;  4OPZ A;  5DKK A;  3ZG9 B;  3CG5 A;  4LCL A;  4ARZ A;  2LB9 A;  1P34 C;  5AV8 A;  3V3S A;  3AZN C;  3AZF B;  5G18 A;  2JKR I;  5AQ7 A;  5BPV A;  2A24 B;  3F1N A;  3MKF A;  2HGV A;  3G32 A;  2QWS A;  3T4S A;  1OTE A;  2FFF B;  2WUQ A;  1OTA A;  1XJ2 A;  5CTM A;  4K91 A;  3G30 A;  3VP3 A;  3C1C D;  1M19 B;  1PFL A;  2CWE A;  4M6B A;  4RVA A;  1P3A A;  1M18 B;  1Z2C B;  3REJ A;  2FJ7 D;  2UWX A;  4GCZ A;  2XQZ A;  5B1M C;  2INW A;  3BFE A;  2X01 A;  1E3U D;  2Y91 A;  2Z2M B;  4EER A;  4KZ3 A;  3MGS A;  4GS9 B;  1OTI A;  5HAR A;  1M18 C;  4J8V A;  1UR8 A;  3L7H A;  5B31 B;  3VP2 A;  1YMX A;  3AZJ A;  2ZQC A;  1UGU A;  5AQ9 A;  1PW8 A;  5FQM A;  5AVE A;  2O99 A;  2HP6 A;  3OZH A;  1MWR A;  3X1U D;  1T18 A;  2J8Y A;  4HMD A;  3H7W B;  1SDE A;  4P6Z M;  1YSQ A;  3B6F B;  5M1A A;  1FQG A;  3NCK A;  4XUJ C;  3P7N A;  3WS2 A;  2QMI A;  1UWP X;  4GDB A;  5DNM A;  2VK3 A;  3VH5 T;  4BWI A;  4WU8 B;  3AZM A;  3W97 D;  1TVF A;  2XFT A;  4JLF A;  5CEC A;  3C8C A;  4NKP A;  1P3O B;  1BSG A;  3B47 A;  4DJ2 A;  2ZOH A;  2ZM5 A;  1N1J A;  5BNV A;  4KEN B;  1SCW A;  1Z09 A;  3KSH A;  4R6L A;  4J8W D;  2BTF P;  4OKP A;  3JVU A;  3H7W A;  2D49 A;  2PDR A;  3FYZ A;  2WKH A;  3AZI D;  1L0G A;  3OC2 A;  4JGP A;  1RP5 A;  2VX8 A;  4KZ8 A;  2B95 A;  4OVD A;  2HZ5 A;  4J8U D;  4HH3 A;  2NZD D;  5KDM B;  5CPI B;  3N7W A;  2J9P A;  5KMW A;  4KZ5 A;  2OWJ A;  2F8N D;  3HLW A;  2BLS A;  3CLO A;  1HTA A;  5DF8 A;  3LI9 A;  2ZD8 A;  3FZC A;  1E6P A;  2VLG A;  4M3K A;  4PKY A;  5G49 A;  3UB9 A;  4XUJ B;  2Q9M A;  3RJU A;  4Y13 A;  1KX4 B;  3LR5 A;  4J8X D;  2BYK A;  4KHA B;  1BH8 A;  1M18 A;  1FSW A;  5FDH A;  2F8N A;  1W8Q A;  4YS3 C;  4Z2H A;  1P0Z A;  3NY4 A;  1WYB A;  4PM8 A;  4OP8 A;  2DF4 C;  1W1V A;  3B42 A;  3D3O A;  3W97 B;  4UAA A;  4WNN B;  3LR4 A;  1XJ3 A;  3F1N B;  3VOZ A;  1MWT A;  5AY8 A;  3MGS D;  3W98 B;  2NUT C;  1F66 D;  1K55 A;  5CGX A;  4U0X A;  4IBJ A;  3R4K A;  4ZBE A;  1E3U A;  1ESU A;  1AOI C;  4MCW A;  3KWQ B;  4JF6 A;  3P09 A;  2NZD B;  2IO5 B;  1WYC A;  2CC1 A;  1TDG A;  3MF0 A;  3O86 A;  5I5L A;  3LIA A;  3B6G B;  3NHQ A;  3H82 A;  3C7V A;  2ARO C;  2W3F A;  4QJG A;  3MZE A;  1S6R A;  1OTD A;  1Y28 A;  1H0I A;  3DWK A;  5B2I D;  1AOI B;  1ONG A;  3HLF A;  1JFI B;  1P3L D;  3T1X A;  3KXB C;  2VV7 A;  2VGJ A;  2FZ0 A;  1GSW A;  1IYP A;  4JJN C;  2ZY5 A;  1F9I A;  2V9A A;  3KS8 A;  3IH9 A;  3KX0 X;  5CPK C;  3PXP A;  5A92 A;  1TF1 A;  2E8I A;  5JRG A;  1CEG A;  1S1Y A;  2GNX A;  2ZQ8 A;  4OQI A;  3NOU C;  4QNL A;  3QHY A;  2Y2N A;  1TS0 A;  3T50 A;  3FG8 A;  4GD8 A;  3ISG A;  2Y2Q A;  2ZMA A;  1K25 A;  4LV1 A;  5F69 A;  4OLD A;  3A3J A;  5EVE A;  4JGO A;  3W8K A;  3L28 A;  3WKJ B;  4S2N C;  3TU4 A;  2XRN A;  1JWP A;  4CPK A;  2P04 A;  4Z5T A;  3AN2 C;  3KS4 A;  4KZB A;  2Y59 A;  1O7E A;  1XGI A;  1P97 A;  1AOI D;  3BLM A;  1P34 B;  2Y55 A;  3A3I A;  2ZC4 B;  4WU9 A;  3UTB B;  4BLM A;  3HUM A;  4IBB A;  4E3J A;  3L25 A;  3HSH A;  1F5M A;  1YAX A;  2IA2 A;  3GTC A;  1JWZ A;  5HD3 A;  2ZM0 A;  3KSG A;  1L0E A;  3UE6 A;  4QB8 A;  4P6Z S;  5TFQ A;  3UDX A;  1AOI A;  1Y54 A;  3WRZ A;  5I94 A;  4D2O A;  3UDI A;  2VA0 A;  4GD6 A;  1ES5 A;  5AV8 D;  1KS0 A;  4UEY A;  2CMN A;  3X1T A;  3FC7 A;  1SZV A;  4PM5 A;  1YQS A;  3IF5 A;  2PU2 A;  2J3T D;  2W0N A;  1ED7 A;  1YSP A;  4R23 A;  5HZH A;  5AV6 C;  3B6F A;  1T1A A;  5CP6 A;  3IT9 A;  1KX3 C;  3A3D A;  3B6F D;  3O5Y A;  5C3I B;  3O62 B;  5B31 C;  1YU0 A;  3VMA A;  3A0S A;  4WMC D;  2FFY A;  3LIE A;  3KSI A;  3CUE C;  1U60 A;  1LI0 A;  1BLP A;  1M1A C;  2X71 A;  1E6N A;  2LB5 A;  4J8W C;  4E44 A;  3LZ1 B;  1EQZ C;  3ZNT A;  2YFV B;  3AZL A;  2CV5 C;  3K3C A;  2Q0O A;  2A49 A;  5CP6 B;  3UMD A;  4N9L A;  4LLO B;  3REK C;  4H9P A;  5BNV B;  3IX4 A;  4KQQ A;  2X02 A;  4XZQ B;  4HH2 A;  2W3E A;  5JA4 A;  5HDS A;  1K6S A;  3RXX A;  4H9R B;  2KX6 A;  1MXO A;  5DTK A;  3MGQ B;  3VP0 A;  2HDS A;  1CK3 A;  2ACG A;  3IQA A;  1E6R A;  5AY8 B;  2JN7 A;  3W98 A;  4WLA A;  5G4Y A;  1P3F C;  1FCM A;  1IKI A;  4DE1 A;  5CPJ B;  2PYO A;  3CHW P;  5DTS A;  4HMC A;  5FQJ A;  2Z6D A;  2PYR A;  3IF6 B;  2J7V A;  2XFS A;  2F8N H;  3NQU A;  5JYP A;  1ZG4 A;  3HLD A;  4R38 A;  1OJ5 A;  4WEK A;  2VGL M;  2QJ7 A;  5BO0 B;  3C1B C;  4WF0 A;  4EUV A;  5F99 C;  4H9S C;  2CV5 B;  1K4F A;  3AZK B;  4MEZ A;  3R7W A;  4NE3 A;  4XT2 A;  5B24 B;  5CHJ A;  4E3M A;  3PYP A;  3G34 A;  4IBX A;  1F66 B;  2JKT M;  4HJ6 A;  3ICY A;  3WS5 A;  5AJG A;  3LJA D;  1G6O A;  3AZJ B;  4PM6 A;  5DNN B;  2MJ6 A;  3IX3 A;  1DJB A;  4CAY B;  3Q7Z A;  3AZN A;  5DKL A;  1P3F B;  5BT1 C;  4HIA A;  3QP4 A;  1M18 D;  3S7P A;  3REK A;  2WK0 A;  5GXQ C;  4BQM A;  1LSV A;  4OON A;  3QNB A;  5B31 G;  3MS6 A;  3C1C B;  1M19 D;  3UE0 A;  1XFN A;  3ZFZ A;  3UT9 D;  4UA6 A;  4X23 B;  1P3L C;  4R0Q A;  4H9Q A;  4IHQ A;  4WZ5 A;  4AWL C;  1N4O A;  2F8N G;  1ZLA B;  1M6K A;  4IBG A;  4MMN A;  2P9V B;  3MGR B;  1D1J A;  1F2K A;  3C1C C;  3LID A;  1YKD A;  4WZ5 C;  3R45 A;  1P9W A;  3VOY A;  3AZG D;  5E2E A;  1OPX A;  3W4P A;  4K0X A;  3L26 A;  3D9Y A;  3LIC A;  4H8R A;  2L4R A;  4LGW A;  4QY5 A;  2WAF A;  3MBZ A;  5F1G A;  1MWU A;  1E15 A;  1VEU A;  3IX8 A;  1TAF B;  3MGR D;  3AZJ C;  1K4E A;  2J9O A;  5M18 A;  1P3M A;  4IUH A;  2O0Y A;  5CER A;  4ETX A;  3AYW D;  3UB6 A;  3K3D A;  1P3P D;  1YU2 A;  1I2S A;  3LZ0 C;  1G68 A;  5FUG A;  4EBN A;  4GJ4 A;  3VE4 A;  1MC0 A;  4WV4 B;  5LBR A;  2RVQ C;  1LSX A;  3KYQ A;  5GLA A;  1P3A B;  4B88 A;  1LSW A;  2C6W B;  2XA7 S;  3X1S A;  4WU9 D;  3P01 A;  3TJZ C;  3BLS A;  4NK3 A;  4RX3 A;  3LI8 A;  4MLL A;  4GH9 A;  1KE3 A;  4N1H A;  1M1A B;  4OP5 A;  3UB5 P;  4L9G A;  4R8P C;  4CLC D;  1Q2Q A;  1PWD A;  5DTT A;  3I7J A;  2HF6 A;  2CV5 D;  3IF6 C;  5IHV A;  3MGS C;  3REJ D;  2FJ7 A;  3MR0 A;  4HGA B;  3REH A;  5CPK A;  4XZQ C;  4IUK A;  3NIA A;  5JYO A;  1P3B B;  4MNR A;  4CLC A;  4EXO A;  3MQ0 A;  3GDI A;  3AZK C;  2Y4A A;  1K6R A;  1HQ3 C;  1O6I A;  5AV5 C;  1OJG A;  3KFU G;  3VH5 W;  3B33 A;  5B2I B;  1Q2P A;  3VP4 A;  1K54 A;  4JKT A;  3LFV A;  1MKM A;  4Z66 A;  4HHD A;  4PAU A;  5FEG A;  3NC8 A;  4U3T A;  2JCH A;  4WEJ A;  3X1U A;  3BQA A;  2W1T B;  5EFW A;  4NZ3 A;  3V50 A;  3AZF C;  3UTB D;  2DRW A;  2ZM8 A;  4C75 A;  4ETZ A;  4R8P B;  4S2O A;  3DBA A;  5HAI A;  1YLP A;  2H0T A;  2EX2 A;  2V0U A;  3N8S A;  1X0O A;  4O01 A;  4DE3 A;  2HP9 A;  3AZH A;  5GSU D;  5KSH A;  3H9W A;  1MZU A;  4WBG A;  3GRJ A;  1S67 L;  4AFI A;  2D01 A;  3AV1 D;  1VET B;  2VZW A;  3LO7 A;  1WA9 A;  1EAK A;  5JA4 B;  4Z2J A;  1YU3 A;  2BYM B;  3C1B D;  1CF0 A;  2A24 A;  4H9P B;  4NZ5 A;  4GHL A;  3UPO A;  5D3O A;  4IED A;  2W1T A;  5GHX A;  2XA7 M;  3FPW A;  4GZB A;  2IO5 C;  1T1C A;  3IXG A;  4KZ9 A;  2O9A A;  3MGP D;  5HL1 A;  5L10 A;  1GOI A;  1P3M B;  4ZAM A;  5AQB A;  1SDN A;  3ZG5 A;  5EVI A;  4NY2 A;  3MFD A;  1P3I D;  3WAA D;  3JYI A;  1XJ6 A;  4ZUX B;  4XUX A;  4FOF A;  2Y2J A;  5HX9 A;  3UN7 A;  1CEF A;  2ZL1 B;  1EWZ A;  3HJK A;  3R45 B;  3MNN C;  1P3K C;  4LFU A;  2EFX A;  4E45 A;  1TZY A;  3A3F A;  1GA9 A;  5GT3 B;  1PNE A;  2ZL1 A;  4NZ1 A;  4IBI A;  3SZT A;  3MVD D;  4YOF A;  2XK1 A;  2QPN A;  1HQ3 A;  1QMF A;  1FR6 A;  5L09 A;  1U35 D;  3CIT A;  5EVI B;  3LEZ A;  1HQ3 D;  3KUY A;  3BWL A;  4Z66 C;  3AV2 C;  1S4S A;  1ZLA D;  5B1M B;  3BJN A;  1PI5 A;  3BEC A;  2H28 A;  3FWL A;  4KUD B;  4LRY C;  3BY8 A;  4FD8 A;  4DKI A;  2HDQ A;  3S7O A;  4O0P A;  3PHY A;  3AL0 C;  4S2K A;  5EVI D;  5HPF A;  2OAP 1;  2ZLY A;  3BQ8 A;  3FKW A;  1C3B A;  4G3K A;  1KGG A;  2B18 A;  5HAQ A;  1LLB A;  3AZG A;  3IWQ A;  3PAE A;  1EQZ D;  3DWZ A;  4OPR A;  2JHE A;  3LY3 A;  4WYY A;  4R70 A;  5AVF A;  4J8X B;  3AZG B;  4BEN A;  1OGB A;  5JRG C;  2I9V A;  5BNX B;  4ZRR A;  2D02 A;  4P0M A;  4Z5T D;  4OOL A;  1XP4 A;  5FUG B;  1TEM A;  5FQ9 A;  3AGE A;  1PZP A;  2BAS A;  3AZI A;  2RTS A;  5CEB A;  4S2L A;  4WM9 A;  1XFQ A;  3LEQ A;  2J3W A;  1KDS A;  5B33 A;  2O9B A;  4PM7 A;  5AV5 A;  4DDS A;  5GT3 A;  3C4O A;  5FQQ A;  2PRF A;  4E6W A;  3LJA A;  4BMW A;  2YFW B;  5M19 A;  3S7N A;  1H0M A;  2WGW A;  2DCF A;  3WS4 A;  1L0D A;  3EWK A;  1RCJ A;  4OQG A;  4KZA A;  3LJA B;  4Z2L A;  1ALQ A;  5GSU B;  5FI6 A;  2H0Y A;  4I3A A;  5B0Z A;  4OH0 A;  2C5W B;  3W99 C;  4G3W A;  4PHT A;  2H10 A;  5U47 A;  1XGJ A;  4CSR B;  1W2E A;  3VP1 A;  5HL6 A;  2NZD A;  2OV5 A;  3QP8 A;  4MN7 A;  2PAV P;  3BFC A;  3UO9 A;  2ZBB A;  4WMC A;  5EM1 A;  3AFA B;  1BFM A;  1P3F A;  3IWO A;  1KX4 C;  3X1V D;  1OGG A;  5GT0 B;  5B0Y A;  4JJN B;  4WJ3 C;  1ERQ A;  1G5U A;  2WGI A;  3ZHH A;  1I5Q A;  3ITA A;  4F3L A;  1W1T A;  2QJ5 A;  2XLN A;  2ZMV A;  2VV6 A;  4Y5F A;  3KXB D;  2JKF A;  1F98 A;  2XD1 A;  1H5X A;  5CTN A;  3ZYT A;  3X1U C;  1ZLA A;  4L9F A;  4HOI A;  4Z5T B;  5EV0 A;  2PHY A;  3T4J A;  1CJF A;  1BYW A;  3IS2 A;  3F1P A;  1GXD A;  3AZM D;  3A1I A;  4MBH A;  1S32 B;  4Y3I A;  4XUJ A;  3IP4 C;  2VGK A;  5AV8 C;  1CI8 A;  2R78 A;  5AVB D;  2RCX A;  4KZ4 A;  3LCE A;  3S4X A;  1EQZ A;  3N4I A;  1S32 D;  3MNN B;  1P3K B;  1LHY A;  5DNN D;  3OCN A;  4NEE D;  4NXE A;  3S1Y A;  3W4Q A;  1VEU B;  2PU4 A;  1KX4 D;  4S2M A;  2GX5 A;  1M1A D;  4X69 A;  4LD9 A;  3G6O A;  3T4L A;  5CX7 A;  4DN0 A;  4FH4 A;  4LRX C;  2JKR M;  5GHZ A;  3REH C;  2JKT I;  3IF6 A;  1YLY A;  2ZQ7 A;  4U0T A;  4J8U A;  4OJO A;  3OPL A;  3U2A A;  4LPZ A;  4DE0 A;  4S2P A;  4GHI A;  1TS7 A;  4ZDX A;  2WKR A;  2J80 A;  2ZQ9 A;  3AZN D;  4JBF A;  1YUE A;  4KGC C;  1ES4 A;  5F5Y A;  3B6G A;  2WZX A;  4JGR A;  3O62 D;  4J8V C;  3UTA C;  2A2L A;  5B32 B;  4ID4 A;  1OME A;  5J4E A;  3C1C A;  5EM0 A;  1H0G A;  3MQO A;  4NYU A;  4J8X C;  3SS4 A;  1JVJ A;  4L9E A;  1DP8 A;  3GV9 A;  3GVB A;  3AYW B;  4GHA A;  5TJJ A;  1MWS A;  1MBL A;  1FOF A;  5BS7 C;  3M2J A;  5HSQ A;  1CI9 A;  3WS0 A;  4I3I A;  1W1P A;  1BH9 B;  5GL9 A;  3REK D;  1WWI A;  1BH8 B;  5GT3 D;  3Q82 A;  5AQA A;  3REH D;  5BS7 A;  1GHM A;  3OPR A;  3MQL A;  4G92 B;  2JC7 A;  1IEM A;  3M6B A;  4HBU A;  5GHY A;  4DDY A;  1T3U A;  4QPR A;  1T19 A;  2V1B A;  5F68 A;  1A7W A;  2H5S A;  1H8M A;  4H9S A;  1RGZ A;  1J7M A;  5CPI D;  4Y17 A;  3HRE A;  3MVD C;  1E6Z A;  4I3J A;  4UQI S;  2QYB A;  5AVC C;  2JKG A;  3VH6 W;  5CED A;  1M1A A;  2IOU A;  4LD9 C;  4HGA C;  2WGV A;  2XF3 A;  4NE5 A;  4WZS B;  1KX3 B;  5B1L C;  5B2J C;  4EO5 B;  3TRC A;  2XRO A;  1P3B A;  2HPB A;  3NUL A;  4WNN A;  2NQB C;  2F8N K;  3O87 A;  3X1S B;  4ARZ B;  2P9V A;  2ZOI A;  3VH6 A;  2K7S A;  1E25 A;  5B33 C;  5B24 D;  4HBT A;  3UPP A;  3L29 A;  3N3F A;  2VGL S;  4WU8 A;  3AZM B;  3WKJ A;  3REJ C;  4RX2 A;  4WZ4 A;  1I2W A;  4Y2F A;  2G7U A;  3EPK A;  4YWZ A;  3UE3 A;  4YFM A;  3LJA C;  3KWQ A;  1FR1 A;  5GLB A;  3REI D;  5CGW A;  3WA9 D;  3H0L C;  2F2A C;  5AV5 D;  4QLC D;  4N1X A;  1KGF A;  3WD3 A;  4MBK A;  3AN2 A;  1PW1 A;  4Z2M H;  1YMS A;  3AN2 D;  3VH6 T;  1GA0 A;  5J8X A;  2G2W A;  2Y2I A;  3P5J B;  2A3U A;  3QP6 A;  5GLC A;  5E5A B;  3S22 A;  3TU4 B;  3CMZ A;  5F99 A;  3W96 D;  2EX9 A;  4MB4 A;  2VKS A;  4KG5 A;  1TZY B;  5B24 A;  3NDG A;  1GSX A;  1LL8 A;  4Z2I A;  1K38 A;  1UR9 A;  5B0Y C;  1NYM A;  2Y2H A;  1TS8 A;  2V8F A;  3ZG0 A;  4JXW A;  5FSR A;  4YM6 C;  5IU1 A;  3MGP A;  4BBU A;  5F82 A;  3DTK A;  2ZQA A;  1ZG6 A;  5EPH A;  4Z1W A;  1FCO A;  2ZM2 A;  5HAP A;  3HUN A;  4IJG A;  1DRM A;  1ID3 A;  4KG6 A;  1W5D A;  2HUE C;  5CP6 D;  5AV6 A;  5FI7 A;  1V9Z A;  5B1L D;  5B2J D;  3AGF A;  3NQU B;  3MGR C;  3AZJ D;  3HLE A;  3MGP C;  3PTE A;  4NXB A;  5DFY A;  3GQZ A;  3X1T D;  3WD0 A;  4KUO A;  1PRQ A;  3AZL B;  5A93 A;  1BLH A;  3FKV A;  2ZY2 A;  5EOE A;  1VET A;  4R4S A;  4HEF A;  3TSG A;  5EEC A;  1P3O A;  1J9M A;  2UV0 E;  3O88 A;  3AYW C;  5EVI C;  4WU8 C;  3M7P A;  3Q07 A;  3WKJ C;  4GN2 A;  3BFF A;  3AGD A;  1ACF A;  4S2I A;  4QLC C;  1PWC A;  3GR2 A;  5DF9 A;  5FA7 A;  3LZ1 A;  4AWL B;  3KUY C;  5CPI A;  4Y0U A;  3G4P A;  4EET B;  3AZH C;  3IXD A;  3NEC A;  3A3E A;  3O62 A;  4LV0 A;  3MFX A;  2PYO C;  1FSY A;  3F1O B;  4K0W A;  4KQD A;  1ES2 A;  3TE8 A;  4Y15 A;  4HJ3 A;  4A5R A;  3NQJ B;  3AV1 A;  3LEL B;  3PAG A;  3UTA D;  1W63 M;  1Q9C A;  4J8V D;  4FCF A;  3X1T B;  1AXB A;  4JXS A;  5KDM A;  4H9O B;  1NLZ A;  4EO5 C;  4OQ0 A;  3UPN A;  4EES A;  3WKJ D;  2YKF A;  3UY6 A;  3X1S C;  3HCY A;  4NE6 A;  3PR6 A;  4B9O A;  2Y2K A;  4X23 D;  1RGY A;  3DAV A;  4XUZ A;  1E4D A;  2M1C A;  1JWV A;  1Z6F A;  3LEL A;  1GPF A;  5DVA A;  2M7U A;  3ZDJ A;  4BD1 A;  4B4Z A;  2HIO D;  4UUZ B;  5GLD A;  4HI4 A;  2PR6 A;  4EBP A;  2L1M A;  4KZ7 A;  5GSU C;  3MGQ A;  3ZG7 B;  2V1A A;  5AVB B;  2VQR A;  3EEA A;  5F6A A;  2Q9N A;  1P3O D;  5CXW A;  5FAT A;  2NQB D;  4EUZ A;  5JRG B;  4G3V A;  1BLC A;  3B6G C;  1ESI A;  1F66 A;  2ZC7 A;  4C6Y A;  5B31 A;  3T1S A;  1ERM A;  2L5A A;  1XX2 A;  4XZQ A;  2DQN C;  2NQB B;  2QZ6 A;  4MB3 A;  3AZH D;  3OOV A;  4H6J B;  3KXB B;  3PBO A;  1G28 A;  3Q7V A;  3T12 B;  4X53 A;  3SOI A;  2NQB A;  5AV9 A;  2V8C A;  4IVK A;  5TGF A;  2V20 A;  3F1O A;  5GT0 C;  1V9Y A;  4OJ5 A;  3REJ B;  3C5A A;  3M2K A;  1HD8 A;  3PBT A;  2P74 A;  5CPI C;  1E88 A;  1BLS A;  1YLT A;  4BL3 A;  2W3H A;  3LZ1 C;  5J3W A;  1KX5 C;  4I5S A;  3MJQ A;  1NY0 A;  3MXS A;  4CLC E;  3C4P A;  3DW0 A;  5KZH A;  1UWN X;  2KOI A;  1TS6 A;  3DTE A;  1NJ4 A;  2EX8 A;  5E2G A;  3AZL D;  1P3P B;  1FIK A;  3V67 A;  3WWX A;  5HPI A;  2V0W A;  2ZJ9 A;  4ZUX D;  3AZF A;  2J8P A;  3O3V A;  5AVB C;  3SH9 A;  3WA9 C;  4EV4 A;  2VJW A;  2FN2 A;  4BD0 A;  4FUW A;  3AZM C;  1P3G D;  4ZJ3 A;  4JXV A;  2WKI A;  3T1Q B;  1ZLA C;  4HQA A;  4DRB A;  1HZO A;  1IFQ A;  1YM1 A;  3X1V A;  5B33 D;  4GKU A;  5FI2 A;  5AVC A;  4IBC A;  4BJP A;  4WN5 A;  4PMA A;  3AV1 B;  3TU4 D;  1P3P A;  5L8M A;  3IWI A;  3AZE C;  4HP9 A;  2Y2O A;  3CWF A;  3IBR A;  4IBD A;  1PWG A;  5TBM B;  3OLO A;  3W97 A;  3HVF A;  3EPH A;  2K2N A;  5C5K A;  1P34 A;  3BFD A;  1D06 A;  4FTX A;  5E2F A;  4EW7 A;  3E2L A;  2V1Z A;  1ID3 D;  1FCN A;  1P3L A;  4JJN D;  3W99 A;  1BZA A;  3QP1 A;  3A6N D;  5L07 A;  4DMZ A;  2ZQD A;  3ITB A;  3C7U A;  1KOU A;  4XT2 B;  2EWW A;  4RA7 A;  3KWQ C;  3B0C W;  3QP5 A;  3SH8 A;  5HWW A;  2NUP C;  2PD7 A;  1ERO A;  2VEA A;  3WX7 A;  3LIB A;  3UE1 A;  5CHL B;  2R9X A;  4OJP A;  3MKE A;  3H0M C;  3UB8 A;  5GT3 C;  4X55 A;  4HES A;  4X68 A;  1WWS A;  1N9N A;  3UTA A;  3F6T A;  1FIL A;  2HDR A;  3B0D B;  4NXG A;  1NXY A;  4UUZ A;  5CHU A;  4Q0H A;  2B5R A;  1N1J B;  4EQ1 A;  3OCL A;  1JFI A;  4C3Q A;  4GW9 A;  1TZY D;  3WA9 A;  1PI4 A;  5B32 A;  1K57 C;  3LR3 A;  1LT0 A;  1XJ4 A;  3LUQ A;  1L2S A;  4Q8I A;  1ZKJ A;  3ZQ5 A;  3B6F C;  3EEH A;  3HLG A;  1JTD A;  3REL C;  4NFT A;  3HL9 A;  5DNM B;  1KDW A;  4ZBJ C;  4RQ9 A;  1KX4 A;  4R3B A;  2GZA A;  4GHI B;  3LGO A;  1S1Z A;  4N9K A;  4D60 A;  5B1L B;  5B2J B;  3EPJ A;  3GSG A;  1NRF A;  3DTM A;  4J8U C;  2WAE A;  3LEL D;  5KIZ A;  3TW8 A;  1BH9 A;  3V9R A;  1S66 L;  4LD9 B;  2DMW A;  3T4O A;  4DRA A;  3MZF A;  4JXG A;  3V39 A;  4TX8 A;  3EQU A;  3REI A;  4YS3 D;  3AYW A;  3VV4 A;  2EFU A;  1HVB A;  1LL9 A;  1PYY A;  3KSF A;  3S7Q A;  1P3A C;  3A6N C;  2ZC6 B;  1H8P A;  2W3G A;  4H6J A;  5GXQ A;  5FL3 A;  4HP4 A;  3KYE A;  2ZMF A;  4J8W A;  1W63 Q;  4F94 A;  4S2N A;  5B40 B;  1MKI A;  2W27 A;  4CSR A;  3H82 B;  1MY8 A;  3FPV A;  3REL B;  2ZY3 A;  1EW0 A;  2V5O A;  4IBK A;  1YT4 A;  2OOL A;  3WA9 B;  5AVB A;  3GMW A;  3BFG A;  4UPK A;  5FQK A;  1U35 C;  5GT0 A;  3HBR A;  3UNW A;  3C1B A;  1F1E A;  1TZY C;  3NQJ A;  1EI5 A;  5AV9 C;  3O62 C;  3KSY A;  4J8U B;  3CZD A;  4QU3 A;  5AV8 B;  4H9N A;  3VFH A;  4E3K A;  2LY8 A;  4YM6 B;  1ZHH B;  3KYZ A;  4E3N A;  2L0W A;  3WTP B;  1H3Q A;  3MMH A;  4DE2 A;  2RL3 A;  1NWZ A;  4O7D A;  2HV1 A;  3W98 C;  3ZCZ A;  1EQZ B;  3T4Q A;  3G2Z A;  2BYK B;  5CPJ C;  3VSL A;  4KUK A;  3IBJ A;  1PIO A;  2WKE A;  1YLJ A;  4E3I A;  2Y2L A;  1GHI A;  4XZQ D;  1OTB A;  1NRJ A;  1L3L A;  4WU8 D;  2ARO B;  4IVI A;  2XGN A;  1STZ A;  4X1M A;  4ZUX A;  5F99 B;  5E5A A;  3AZF D;  2M7V A;  3LZ1 D;  3P98 A;  4NG2 A;  3E4O A;  5GT0 D;  3AV1 C;  1H8Z A;  3MGQ C;  2XSS A;  2JSS A;  4OUI A;  4ZJ1 A;  1VQQ A;  4J8V B;  3AZL C;  2ZC3 B;  3AN2 B;  1IYS A;  4KG2 A;  1D7E A;  2HJE A;  3M6H A;  1B6W A;  1M19 C;  3Q1F A;  5CRF A;  1TD5 A;  3UTB C;  2NZD C;  3WTP C;  4PPR A;  1ES3 A;  3PBS A;  4NZ4 A;  3ZVT A;  3H0R C;  1N9L A;  3KUY B;  4R3J A;  1QO6 A;  1XA7 A;  2FH5 A;  3PBR A;  4H9O A;  1H8Y A;  4YS3 A;  5B0Z B;  2WKP A;  3L2A A;  5DJU A;  3KUY D;  3AV2 A;  2B02 A;  1H3O B;  2OLV A;  1U35 A;  2Z2L B;  3AFA A;  3WRT A;  4ME4 A;  4QLC A;  1P3G A;  1F66 C;  1SHV A;  3T4T A;  5AV6 B;  1ULY A;  2F8N B;  1CXW A;  4E3O A;  3CAX A;  5HWV A;  5F83 A;  4WU9 C;  1YU4 A;  1LI9 A;  1W8Y A;  1YLW A;  4MDZ A;  4ESP A;  3MGS B;  4GS9 A;  2EA9 A;  3E4P A;  4JF5 A;  4PKY G;  1DP9 A;  1S32 A;  1T1B A;  3VH5 A;  3FKE A;  3F1P B;  1BUL A;  3MNN D;  1P3K D;  2XH9 A;  2R9W A;  5DNM C;  4LEN A;  4UA9 A;  3MGR A;  5DF7 A;  2FJ7 B;  5CPK D;  3CPT B;  3LZ0 D;  4Z2G A;  3N6I A;  5HDD A;  3AZH B;  4S2J A;  3W4O A;  2O9C A;  3NDE A;  3OPH A;  1IKG A;  1AIW A;  2W1R A;  4R8P A;  5FAQ A;  4HJ4 A;  3SS5 A;  5B1M D;  4MN5 A;  5JRG D;  2FJ7 C;  5EVL A;  4YM6 D;  4KUD A;  1XXM A;  3W96 B;  1E8B A;  4IJE A;  3ZGA B;  1PZO A;  1P3B C;  5EUA A;  4JGQ A;  3C30 A;  3REI C;  1ID3 B;  4CLC C;  2EWV A;  5FEF A;  4N92 A;  3AZK D;  3A6N B;  3MXQ A;  2HIO A;  4IBE A;  3CPT A;  1K56 D;  4E3L A;  3IHB A;  1XPB A;  3W97 C;  5FAP A;  2WAD A;  1N9B A;  1K54 C;  1OT9 A;  1W7F A;  1P3I B;  3IXH A;  4YIN A;  5F99 D;  5A8B A;  1M40 A;  3UT9 A;  5GXQ D;  2HP5 A;  4NXF A;  5B1M A;  3U4L P;  5B33 B;  4XXR A;  3WAA B;  4Y0O A;  4I38 A;  2KDK A;  3BYD A;  1P3M D;  1LL5 A;  2AVX A;  3LZ0 A;  1IYO A;  3EGD C;  3UT9 C;  1YU1 A;  1P3G B;  5EE8 A;  5A90 A;  4X1L A;  1AWI A;  3C1B B;  2Y2G A;  2W3D A;  2IWC A;  1SKO B;  1W79 A;  3NJA A;  1A0K A;  5BT1 D;  3E98 A;  4HME A;  3KO6 A;  5BNX A;  4WL9 A;  3TOI A;  2EXA A;  3L9K A;  5DNM D;  1PDC A;  5B0Z D;  5MC7 A;  4NYY A;  3EQV A;  5BOH A;  4II7 A;  3HON A;  3AZE B;  1W1Y A;  4H9Q B;  2QHK A;  3FV7 A;  3Q81 A;  3G2Y A;  4E6X A;  1P3P C;  3W99 D;  5B0Y B;  4JJN A;  4JPM A;  4B93 A;  1SKO A;  4DXC A;  4I39 A;  1HLU P;  2VV8 A;  4P6B A;  4KUD C;  1JNU A;  3X1U B;  5EOO A;  4LG2 A;  4OJL A;  4B4X A;  3AZN B;  5AV9 D;  5DNN C;  1XKZ A;  1L0F A;  4EU0 A;  3MVD A;  3C2W A;  3RTY A;  5FAO A;  2XR0 A;  3W98 D;  3HLB A;  1J3W A;  4IJF A;  2PD8 A;  3MGP B;  5GSU A;  4GDN A;  5B1L A;  5B2J A;  1VB6 A;  4MN6 A;  2OWH A;  3BY9 A;  4LD9 D;  3AV2 B;  1P9R A;  1P3M C;  3RFB A;  4EBL A;  1VHM A;  3EGX C;  2YFW A;  3E4Q A;  3MGQ D;  1P3F D;  2XD5 A;  5CPK B;  3MZD A;  3LZ0 B;  3D4F A;  1KVM A;  2IWB A;  4J8X A;  2HIO B;  3VFF A;  3UME A;  3A6N A;  5HW3 A;  4X6T A;  3MVD B;  4DF6 A;  5E43 A;  3IHA A;  4ZBJ B;  1QME A;  4F3L B;  2GJ3 A;  2JE5 A;  4PM9 A;  1H3O A;  4Y0T A;  5FAS A;  4DQY B;  2PT7 A;  2BYM A;  2JBF A;  3IS2 B;  3UTA B;  3BRM A;  3AZE A;  3C38 A;  5B32 C;  2G5H C;  3AFA D;  3CI6 A;  4GLQ A;  4Q0J A;  1GSV A;  4OLG A;  3X1T C;  2W8S A;  1HTZ A;  3A1K A;  3EOI A;  1KX5 D;  3NOT C;  2XDM A;  3LEL C;  1KU5 A;  4FSF A;  3WTP D;  1KX3 A;  1S0W A;  5CP6 C;  4QD4 A;  4DXB A;  4M4X A;  1SKF A;  4L0L A;  1KVL A;  3GEC A;  4R1G A;  5J7E A;  3N8R A;  5HFO A;  4YNR A;  5DNN A;  3RXW A;  1IEL A;  3MQQ A;  4Z66 B;  3HLC A;  4G91 C;  4K08 A;  4G92 C;  5KSC A;  3DTI A;  2OAQ 1;  3UDF A;  5B2I A;  1KX5 B;  3BEB A;  3E2K A;  1HQ3 B;  3T1R A;  2WYX A;  4Q0I A;  4R3A A;  3UB7 A;  4Z5T C;  5TR7 A;  3TG9 A;  4OPQ A;  3TU4 C;  2PR5 A;  4QY6 A;  1G6A A;  3JVV A;  1U35 B;  2PBD P;  2ZC5 B;  3AZI C;  5B40 D;  3EPL A;  4G91 B;  2WGW B;  5IT5 A;  4BL2 A;  2PBY A;  2RIQ A;  1P3G C;  3WD1 A;  3FDD A;  4KGC A;  5AY8 D;  4UA7 A;  3AFA C;  5FQI A;  1KX5 A;  5CPJ D;  4FH2 A;  5B31 D;  4OOY A;  5BO0 A;  4H9R A;  4HNB A;  3AZI B;  3HUO A;  3V3R A;  5AV6 D;  2GDN A;  5HD5 A;  3LIF A;  3WD4 A;  3ZVW A;  5G4Z A;  1O07 A;  4Z9Q A;  1N9O A;  2E8J A;  3BM6 A;  5B40 C;  3EG5 B;  5B24 C;  4Z66 D;  5DJT A;  4DJ3 A;  1S32 C;  4YS3 B;  3BW6 A;  4MBF A;  1Y4O A;  4EEP A;  1PZR A;  4R4R A;  4WUJ A;  4Y7P A;  3WAA A;  4KGC B;  1GCE A;  3QNC A;  3X1V C;  2ARO A;  3B0C T;  1B67 A;  5A91 A;  2J3T C;  3K2N A;  5B32 D;  2IWD A;  3CUE A;  3Q7V B;  2Y2P A;  3REL D;  2WKQ A;  3CJM A;  4IBR A;  3B6G D;  2XEP A;  1YLZ A;  3R7W B;  5AV5 B;  2V2F F;  5DFX A;  3REH B;  4EWF A;  5E5A C;  1VM1 A;  1DJA A;  2CV5 A;  4LCM A;  3V5M A;  2P08 A;  2OLU A;  3MNN A;  1P3K A;  3IH8 A;  3B0B A;  3KWQ D;  3ZG8 B;  1JTG A;  2Y2M A;  3E0Y A;  3UT9 B;  2HIO C;  1ZC2 A;  4KQR A;  3PBQ A;  3A0R A;  2PYO B;  2I72 A;  3B0D C;  4X56 A;  4X23 C;  4O8G A;  1KE0 A;  1P3I A;  3LYX A;  4X25 A;  1BUE A;  3UTB A;  4GB7 A;  4NET A;  4EEU A;  2HUE B;  3LR0 A;  5B0Z C;  1BTL A;  4P85 A;  2PYP A;  2K31 A;  1IOU A;  4LV3 A;  2OSU A;  5IS1 A;  3PBN A;  1IYQ A;  3WS1 A;  4XUJ D;  4LRZ E;  4X23 A;  1K0K A;  3SS3 A;  4OJ6 A;  2EX6 A;  3D72 A;  3N8L A;  3W96 A;  2HDU A;  1KE4 A;  3JPU A;  5GXQ B;  5F1F A;  3SH7 A;  4KZ6 A;  1ZTU A;  2BG1 A;  4CAY A;  4KGC D;  1P3L B;  4CQH A;  2ZY4 A;  4WU9 B;  1ODV A;  1L6J A;  4OPY A;  3MSH A;  5CHM A;  1MPL A;  5HDC A;  4ZUX C;  3V9R B;  1CQA A;  1P3A D;  4KHA A;  3ZNY A;  4QLC B;  2G5I C;  1WE4 A;  4J8W B;  1NLY A;  5K5B A;  1ONH A;  1DP6 A;  4Z2M G;  2Y8H A;  1DJC A;  5L2F A;  3NBL A;  4RYE A;  3L27 A;  2EXB A;  1TDL A;  4MB5 A;  3B3X A;  2P7J A;  1NZO A;  4GOG A;  2YFV A;  3AZG C;  4WEL A;  1NZU A;  5HWT A;  5E5A D;  4IBF A;  1P3B D;  3WD2 A;  4JF4 A;  2PYO D;  3X1S D;  1K56 A;  1ID3 C;  3WTP A;  1KX3 D;  1M19 A;  3OPP A;  4P87 A;  4CJN A;  1KGE A;  1R4V A;  2G2U A;  4UHU A;  4OQH A;  4H9N B;  2QKP A;  2DNS A;  3IXB A;  1XA1 A;  4E04 A;  5C3I C;  1P34 D;  3VE3 A;  4CLC B;  1P3I C;  1YPR A;  3AZE D;  4OOM A;  4BBV A;  5AVC B;  4ZJ2 A;  1P3O C;  5FDS A;  3W2Z A;  1GHP A;  3VSK A;  4UQI M;  5B2I C;  3G35 A;  2RVQ D;  3A0V A;  3RH8 B;  2ARO D;  2Y79 A;  3NI9 A;  5B40 A;  5AVC D;  4KQO A;  3VOL A;  3ULF A;  5E2H A;  3REK B;  5G49 B;  4Z2K A;  3G31 A;  3W96 C;  3WAA C;  4LV2 A;  4BBT A;  3AZK A;  1CK7 A;  1BT5 A;  1K55 C;  1OT6 A;  4HY8 A;  3REI B;  3T4K A;  5AY8 C;  3MXR A;  1DY6 A;  5CGS A;  2Z6C A;  4QWO A;  1TAF A;  3AV2 D; 
#chains in the Genus database with same CATH homology
 4EQI A;  4YM6 A;  4KUD D;  2WZZ A;  5CPJ A;  5AV9 B;  4R8P D;  1K57 A;  3WTP E;  3KXB A;  3LY4 A;  4ZTK A;  5B0Y D;  3X1V B;  3W99 B;  5B32 G;  4QHC A;  4DRT A;  4GNU A;  3REL A;  1NYY A;  4OPZ A;  3ZG9 B;  3CG5 A;  4LCL A;  1P34 C;  5AV8 A;  3V3S A;  3AZN C;  3AZF B;  5G18 A;  5AQ7 A;  5BPV A;  3MKF A;  3G32 A;  2FFF B;  2WUQ A;  5CTM A;  4K91 A;  3G30 A;  3VP3 A;  3C1C D;  1M19 B;  2CWE A;  4M6B A;  4RVA A;  1P3A A;  1M18 B;  1Z2C B;  3REJ A;  2FJ7 D;  2UWX A;  2XQZ A;  5B1M C;  3BFE A;  2X01 A;  1E3U D;  2Y91 A;  2Z2M B;  4KZ3 A;  3MGS A;  5HAR A;  1M18 C;  4J8V A;  5B31 B;  3VP2 A;  1YMX A;  3AZJ A;  2ZQC A;  5AQ9 A;  1PW8 A;  5FQM A;  2HP6 A;  3OZH A;  1MWR A;  3X1U D;  2J8Y A;  1SDE A;  3B6F B;  5M1A A;  1FQG A;  3NCK A;  4XUJ C;  3WS2 A;  2QMI A;  4GDB A;  5DNM A;  3VH5 T;  4WU8 B;  3AZM A;  3W97 D;  1TVF A;  2XFT A;  4JLF A;  5CEC A;  1P3O B;  1BSG A;  2ZM5 A;  1N1J A;  5BNV A;  4KEN B;  1SCW A;  4J8W D;  4OKP A;  3FYZ A;  2WKH A;  3AZI D;  1L0G A;  3OC2 A;  1RP5 A;  4KZ8 A;  4OVD A;  4J8U D;  2NZD D;  5KDM B;  5CPI B;  3N7W A;  2J9P A;  5KMW A;  4KZ5 A;  2F8N D;  3HLW A;  2BLS A;  1HTA A;  5DF8 A;  2ZD8 A;  3FZC A;  4M3K A;  5G49 A;  4XUJ B;  2Q9M A;  3RJU A;  1KX4 B;  4J8X D;  2BYK A;  4KHA B;  1BH8 A;  1M18 A;  1FSW A;  5FDH A;  2F8N A;  1W8Q A;  4YS3 C;  3NY4 A;  1WYB A;  4PM8 A;  4OP8 A;  2DF4 C;  3W97 B;  4UAA A;  4WNN B;  3VOZ A;  1MWT A;  5AY8 A;  3MGS D;  3W98 B;  1F66 D;  1K55 A;  5CGX A;  4U0X A;  4IBJ A;  4ZBE A;  1E3U A;  1ESU A;  1AOI C;  3KWQ B;  4JF6 A;  3P09 A;  2NZD B;  2IO5 B;  1WYC A;  2CC1 A;  1TDG A;  3O86 A;  3B6G B;  3C7V A;  2ARO C;  4QJG A;  3MZE A;  1S6R A;  3DWK A;  5B2I D;  1AOI B;  1ONG A;  3HLF A;  1JFI B;  1P3L D;  3KXB C;  2VGJ A;  1IYP A;  4JJN C;  2ZY5 A;  3KS8 A;  3IH9 A;  5CPK C;  5A92 A;  5JRG A;  2E8I A;  1CEG A;  2ZQ8 A;  4OQI A;  4QNL A;  3QHY A;  2Y2N A;  4GD8 A;  3ISG A;  2Y2Q A;  2ZMA A;  1K25 A;  4LV1 A;  4OLD A;  3A3J A;  3W8K A;  3L28 A;  3WKJ B;  4S2N C;  3TU4 A;  4CPK A;  1JWP A;  4Z5T A;  3AN2 C;  3KS4 A;  4KZB A;  2Y59 A;  1O7E A;  1XGI A;  1AOI D;  3BLM A;  1P34 B;  2Y55 A;  3A3I A;  2ZC4 B;  4WU9 A;  3UTB B;  4BLM A;  3HUM A;  4IBB A;  4E3J A;  3L25 A;  3HSH A;  3GTC A;  1JWZ A;  2ZM0 A;  1L0E A;  4QB8 A;  5TFQ A;  3UDX A;  1AOI A;  1Y54 A;  3WRZ A;  5I94 A;  4D2O A;  3UDI A;  4GD6 A;  1ES5 A;  5AV8 D;  3X1T A;  4PM5 A;  1YQS A;  3IF5 A;  2PU2 A;  4R23 A;  5AV6 C;  3B6F A;  5CP6 A;  3IT9 A;  3A3D A;  1KX3 C;  3B6F D;  5C3I B;  3O62 B;  5B31 C;  1YU0 A;  3VMA A;  4WMC D;  2FFY A;  1U60 A;  1LI0 A;  1BLP A;  1M1A C;  2X71 A;  4J8W C;  4E44 A;  3LZ1 B;  1EQZ C;  3ZNT A;  2YFV B;  3AZL A;  2CV5 C;  2A49 A;  5CP6 B;  4N9L A;  3REK C;  4H9P A;  5BNV B;  4KQQ A;  2X02 A;  4XZQ B;  5JA4 A;  1K6S A;  3RXX A;  4H9R B;  1MXO A;  5DTK A;  3MGQ B;  3VP0 A;  2HDS A;  1CK3 A;  3IQA A;  5AY8 B;  3W98 A;  1P3F C;  1FCM A;  1IKI A;  4DE1 A;  5CPJ B;  2PYO A;  5DTS A;  5FQJ A;  3IF6 B;  2J7V A;  2XFS A;  2F8N H;  3NQU A;  5JYP A;  1ZG4 A;  3HLD A;  4WEK A;  5BO0 B;  3C1B C;  5F99 C;  4H9S C;  2CV5 B;  1K4F A;  3AZK B;  4MEZ A;  4NE3 A;  5B24 B;  5CHJ A;  4E3M A;  3G34 A;  4IBX A;  1F66 B;  3WS5 A;  3LJA D;  3AZJ B;  4PM6 A;  5DNN B;  1DJB A;  4CAY B;  3Q7Z A;  3AZN A;  1P3F B;  5BT1 C;  1M18 D;  3REK A;  2WK0 A;  5GXQ C;  4BQM A;  4OON A;  3QNB A;  5B31 G;  3C1C B;  1M19 D;  3UE0 A;  3ZFZ A;  3UT9 D;  4UA6 A;  4X23 B;  1P3L C;  4R0Q A;  4H9Q A;  4WZ5 A;  4AWL C;  1N4O A;  2F8N G;  1ZLA B;  1M6K A;  4IBG A;  2P9V B;  3MGR B;  3C1C C;  4WZ5 C;  3R45 A;  3VOY A;  3AZG D;  5E2E A;  3W4P A;  4K0X A;  3L26 A;  4H8R A;  4QY5 A;  2WAF A;  3MBZ A;  5F1G A;  1MWU A;  1TAF B;  3MGR D;  3AZJ C;  1K4E A;  2J9O A;  5M18 A;  1P3M A;  5CER A;  3AYW D;  1P3P D;  1YU2 A;  1I2S A;  3LZ0 C;  1G68 A;  5FUG A;  4EBN A;  4WV4 B;  2RVQ C;  5GLA A;  1P3A B;  4B88 A;  2C6W B;  3X1S A;  4WU9 D;  3BLS A;  4NK3 A;  4RX3 A;  4MLL A;  4GH9 A;  1KE3 A;  4N1H A;  1M1A B;  4OP5 A;  4R8P C;  1Q2Q A;  1PWD A;  5DTT A;  3I7J A;  2CV5 D;  3IF6 C;  5IHV A;  3MGS C;  3REJ D;  2FJ7 A;  4HGA B;  3REH A;  5CPK A;  4XZQ C;  3NIA A;  5JYO A;  1P3B B;  4MNR A;  3AZK C;  2Y4A A;  1K6R A;  1HQ3 C;  5AV5 C;  3KFU G;  3VH5 W;  5B2I B;  1Q2P A;  3VP4 A;  1K54 A;  4JKT A;  4Z66 A;  3NC8 A;  4U3T A;  2JCH A;  4WEJ A;  3X1U A;  4NZ3 A;  3V50 A;  3AZF C;  3UTB D;  2DRW A;  2ZM8 A;  4C75 A;  4R8P B;  4S2O A;  5HAI A;  1YLP A;  2H0T A;  2EX2 A;  3N8S A;  4DE3 A;  2HP9 A;  3AZH A;  5GSU D;  5KSH A;  4WBG A;  3GRJ A;  3AV1 D;  3LO7 A;  5JA4 B;  1YU3 A;  2BYM B;  3C1B D;  4H9P B;  4NZ5 A;  4GHL A;  3UPO A;  5D3O A;  4IED A;  5GHX A;  4GZB A;  2IO5 C;  3IXG A;  4KZ9 A;  3MGP D;  5HL1 A;  1P3M B;  4ZAM A;  5AQB A;  1SDN A;  3ZG5 A;  5EVI A;  4NY2 A;  3MFD A;  1P3I D;  3WAA D;  3JYI A;  4ZUX B;  4XUX A;  2Y2J A;  5HX9 A;  3UN7 A;  1CEF A;  1EWZ A;  3R45 B;  3MNN C;  1P3K C;  2EFX A;  4E45 A;  1TZY A;  3A3F A;  1GA9 A;  5GT3 B;  4NZ1 A;  4IBI A;  3MVD D;  2XK1 A;  2QPN A;  1HQ3 A;  1QMF A;  1FR6 A;  1U35 D;  5EVI B;  3LEZ A;  1HQ3 D;  3KUY A;  4Z66 C;  3AV2 C;  1ZLA D;  5B1M B;  1PI5 A;  3BEC A;  3FWL A;  4KUD B;  4FD8 A;  4DKI A;  2HDQ A;  3AL0 C;  4S2K A;  5EVI D;  2ZLY A;  3FKW A;  1C3B A;  1KGG A;  5HAQ A;  1LLB A;  3AZG A;  3IWQ A;  3PAE A;  1EQZ D;  3DWZ A;  4OPR A;  3LY3 A;  4WYY A;  4J8X B;  3AZG B;  4BEN A;  5JRG C;  5BNX B;  4P0M A;  4Z5T D;  4OOL A;  1XP4 A;  5FUG B;  1TEM A;  5FQ9 A;  3AGE A;  1PZP A;  3AZI A;  5CEB A;  4S2L A;  4WM9 A;  1KDS A;  5B33 A;  4PM7 A;  5AV5 A;  4DDS A;  5GT3 A;  3C4O A;  5FQQ A;  4E6W A;  3LJA A;  2YFW B;  5M19 A;  2WGW A;  2DCF A;  3WS4 A;  1L0D A;  1RCJ A;  4OQG A;  4KZA A;  3LJA B;  1ALQ A;  5GSU B;  5FI6 A;  2H0Y A;  5B0Z A;  4OH0 A;  2C5W B;  3W99 C;  2H10 A;  5U47 A;  1XGJ A;  4CSR B;  1W2E A;  3VP1 A;  2NZD A;  2OV5 A;  3BFC A;  3UO9 A;  4WMC A;  3AFA B;  1BFM A;  1P3F A;  3IWO A;  1KX4 C;  3X1V D;  5GT0 B;  5B0Y A;  4JJN B;  4WJ3 C;  1ERQ A;  2WGI A;  3ZHH A;  1I5Q A;  3ITA A;  2XLN A;  3KXB D;  2XD1 A;  1H5X A;  5CTN A;  3X1U C;  1ZLA A;  4Z5T B;  3AZM D;  3A1I A;  4MBH A;  1S32 B;  4XUJ A;  3IP4 C;  2VGK A;  5AV8 C;  1CI8 A;  5AVB D;  2RCX A;  4KZ4 A;  3LCE A;  3S4X A;  1EQZ A;  3N4I A;  1S32 D;  3MNN B;  1P3K B;  1LHY A;  5DNN D;  3OCN A;  3S1Y A;  3W4Q A;  2PU4 A;  1KX4 D;  4S2M A;  1M1A D;  4X69 A;  4LD9 A;  4FH4 A;  5GHZ A;  3REH C;  3IF6 A;  1YLY A;  2ZQ7 A;  4U0T A;  4J8U A;  4OJO A;  3OPL A;  4DE0 A;  4S2P A;  4ZDX A;  2ZQ9 A;  3AZN D;  4JBF A;  1YUE A;  4KGC C;  1ES4 A;  3B6G A;  2WZX A;  3O62 D;  4J8V C;  3UTA C;  5B32 B;  4ID4 A;  1OME A;  3C1C A;  4NYU A;  4J8X C;  3SS4 A;  1JVJ A;  3GV9 A;  3GVB A;  3AYW B;  4GHA A;  1MWS A;  1MBL A;  1FOF A;  5BS7 C;  3M2J A;  1CI9 A;  3WS0 A;  1BH9 B;  5GL9 A;  3REK D;  1WWI A;  1BH8 B;  5GT3 D;  3Q82 A;  5AQA A;  3REH D;  5BS7 A;  1GHM A;  3OPR A;  4G92 B;  2JC7 A;  1IEM A;  3M6B A;  4HBU A;  5GHY A;  4DDY A;  1T3U A;  1A7W A;  2H5S A;  4H9S A;  1RGZ A;  5CPI D;  3HRE A;  3MVD C;  5AVC C;  3VH6 W;  5CED A;  1M1A A;  2IOU A;  4LD9 C;  4HGA C;  2WGV A;  2XF3 A;  4NE5 A;  4WZS B;  1KX3 B;  5B1L C;  5B2J C;  4EO5 B;  1P3B A;  2HPB A;  4WNN A;  2NQB C;  2F8N K;  3O87 A;  3X1S B;  2P9V A;  3VH6 A;  1E25 A;  5B33 C;  5B24 D;  4HBT A;  3UPP A;  3L29 A;  3N3F A;  4WU8 A;  3AZM B;  4RX2 A;  3WKJ A;  3REJ C;  4WZ4 A;  1I2W A;  3EPK A;  3UE3 A;  4YFM A;  3LJA C;  3KWQ A;  1FR1 A;  5GLB A;  3REI D;  5CGW A;  3WA9 D;  3H0L C;  2F2A C;  5AV5 D;  4QLC D;  4N1X A;  1KGF A;  4MBK A;  3AN2 A;  1PW1 A;  4Z2M H;  1YMS A;  3AN2 D;  3VH6 T;  1GA0 A;  5J8X A;  2G2W A;  2Y2I A;  3P5J B;  2A3U A;  5GLC A;  5E5A B;  3S22 A;  3TU4 B;  3CMZ A;  5F99 A;  3W96 D;  2EX9 A;  4KG5 A;  1TZY B;  5B24 A;  3NDG A;  1K38 A;  5B0Y C;  1NYM A;  2Y2H A;  3ZG0 A;  4JXW A;  5FSR A;  4YM6 C;  3MGP A;  5F82 A;  2ZQA A;  1ZG6 A;  5EPH A;  1FCO A;  2ZM2 A;  5HAP A;  3HUN A;  1ID3 A;  4KG6 A;  1W5D A;  2HUE C;  5CP6 D;  5AV6 A;  5FI7 A;  5B1L D;  5B2J D;  3AGF A;  3NQU B;  3MGR C;  3AZJ D;  3HLE A;  3MGP C;  3PTE A;  3GQZ A;  3X1T D;  3AZL B;  5A93 A;  1BLH A;  3FKV A;  2ZY2 A;  5EOE A;  4R4S A;  4HEF A;  3TSG A;  5EEC A;  1P3O A;  1J9M A;  3O88 A;  3AYW C;  5EVI C;  4WU8 C;  3Q07 A;  3WKJ C;  4GN2 A;  3BFF A;  3AGD A;  4S2I A;  4QLC C;  1PWC A;  3GR2 A;  5DF9 A;  5FA7 A;  3LZ1 A;  4AWL B;  3KUY C;  5CPI A;  4Y0U A;  3G4P A;  3AZH C;  3IXD A;  3A3E A;  3O62 A;  4LV0 A;  2PYO C;  1FSY A;  4K0W A;  1ES2 A;  4A5R A;  3NQJ B;  3AV1 A;  3PAG A;  3LEL B;  3UTA D;  1Q9C A;  4J8V D;  4FCF A;  3X1T B;  1AXB A;  4JXS A;  5KDM A;  4H9O B;  4EO5 C;  4OQ0 A;  3UPN A;  3WKJ D;  3UY6 A;  3X1S C;  4NE6 A;  2Y2K A;  4X23 D;  1RGY A;  4XUZ A;  1E4D A;  1JWV A;  1Z6F A;  3LEL A;  5DVA A;  3ZDJ A;  4BD1 A;  4B4Z A;  2HIO D;  4UUZ B;  5GLD A;  4EBP A;  4KZ7 A;  5GSU C;  3MGQ A;  3ZG7 B;  5AVB B;  2VQR A;  2Q9N A;  1P3O D;  5CXW A;  5FAT A;  2NQB D;  4EUZ A;  5JRG B;  1BLC A;  3B6G C;  1ESI A;  1F66 A;  2ZC7 A;  4C6Y A;  5B31 A;  1ERM A;  2L5A A;  1XX2 A;  4XZQ A;  2DQN C;  2NQB B;  2QZ6 A;  3AZH D;  3KXB B;  3PBO A;  3Q7V A;  4X53 A;  3SOI A;  2NQB A;  5AV9 A;  4IVK A;  5TGF A;  2V20 A;  5GT0 C;  4OJ5 A;  3REJ B;  3M2K A;  3C5A A;  3PBT A;  1HD8 A;  2P74 A;  5CPI C;  1BLS A;  1YLT A;  4BL3 A;  3LZ1 C;  1KX5 C;  1NY0 A;  3MXS A;  3C4P A;  3DW0 A;  5KZH A;  1NJ4 A;  2EX8 A;  5E2G A;  3AZL D;  1P3P B;  3WWX A;  2ZJ9 A;  4ZUX D;  3AZF A;  2J8P A;  3O3V A;  5AVB C;  3SH9 A;  3WA9 C;  4EV4 A;  4BD0 A;  4ZJ3 A;  3AZM C;  1P3G D;  4JXV A;  2WKI A;  1ZLA C;  4DRB A;  1HZO A;  1YM1 A;  3X1V A;  5B33 D;  4GKU A;  5FI2 A;  5AVC A;  4IBC A;  4BJP A;  4PMA A;  3AV1 B;  3TU4 D;  1P3P A;  3IWI A;  3AZE C;  2Y2O A;  4IBD A;  1PWG A;  3W97 A;  3HVF A;  3EPH A;  1P34 A;  3BFD A;  5E2F A;  3E2L A;  2V1Z A;  1ID3 D;  1FCN A;  1P3L A;  4JJN D;  3W99 A;  1BZA A;  3A6N D;  2ZQD A;  3ITB A;  3C7U A;  4RA7 A;  3KWQ C;  3B0C W;  3SH8 A;  1ERO A;  3WX7 A;  3UE1 A;  5CHL B;  2R9X A;  4OJP A;  3MKE A;  3H0M C;  5GT3 C;  4X55 A;  4HES A;  4X68 A;  1WWS A;  3UTA A;  3F6T A;  2HDR A;  3B0D B;  1NXY A;  4UUZ A;  5CHU A;  2B5R A;  1N1J B;  3OCL A;  1JFI A;  4C3Q A;  1TZY D;  3WA9 A;  1PI4 A;  5B32 A;  1K57 C;  1L2S A;  4Q8I A;  1ZKJ A;  3B6F C;  3HLG A;  1JTD A;  3REL C;  4NFT A;  3HL9 A;  5DNM B;  1KDW A;  4ZBJ C;  1KX4 A;  4R3B A;  4N9K A;  5B1L B;  5B2J B;  3EPJ A;  3GSG A;  1NRF A;  3DTM A;  4J8U C;  2WAE A;  3LEL D;  1BH9 A;  3V9R A;  4LD9 B;  4DRA A;  3MZF A;  4JXG A;  3V39 A;  3EQU A;  3REI A;  4YS3 D;  3AYW A;  2EFU A;  1HVB A;  1LL9 A;  1PYY A;  1P3A C;  3A6N C;  2ZC6 B;  5GXQ A;  4J8W A;  4F94 A;  4S2N A;  5B40 B;  1MKI A;  4CSR A;  1MY8 A;  3REL B;  2ZY3 A;  4IBK A;  1YT4 A;  3WA9 B;  5AVB A;  3GMW A;  3BFG A;  4UPK A;  5FQK A;  1U35 C;  5GT0 A;  3HBR A;  3UNW A;  3C1B A;  1F1E A;  1TZY C;  3NQJ A;  1EI5 A;  5AV9 C;  3O62 C;  3KSY A;  4J8U B;  3CZD A;  4QU3 A;  5AV8 B;  4H9N A;  3VFH A;  4E3K A;  2LY8 A;  4YM6 B;  4E3N A;  3WTP B;  4DE2 A;  2RL3 A;  4O7D A;  3W98 C;  3ZCZ A;  1EQZ B;  3G2Z A;  2BYK B;  5CPJ C;  3VSL A;  1PIO A;  2WKE A;  1YLJ A;  4E3I A;  2Y2L A;  1GHI A;  4XZQ D;  4IVI A;  4WU8 D;  2ARO B;  2XGN A;  4ZUX A;  5F99 B;  5E5A A;  3AZF D;  3LZ1 D;  3P98 A;  5GT0 D;  3AV1 C;  1H8Z A;  3MGQ C;  2JSS A;  4OUI A;  4ZJ1 A;  1VQQ A;  4J8V B;  3AZL C;  2ZC3 B;  3AN2 B;  1IYS A;  4KG2 A;  3M6H A;  1B6W A;  1M19 C;  3Q1F A;  5CRF A;  3UTB C;  2NZD C;  3WTP C;  4PPR A;  1ES3 A;  3PBS A;  4NZ4 A;  3ZVT A;  3H0R C;  3KUY B;  4R3J A;  1XA7 A;  3PBR A;  4H9O A;  1H8Y A;  4YS3 A;  5B0Z B;  3L2A A;  3KUY D;  3AV2 A;  2Z2L B;  1H3O B;  2OLV A;  1U35 A;  3AFA A;  3WRT A;  4QLC A;  1P3G A;  1F66 C;  1SHV A;  5AV6 B;  1ULY A;  2F8N B;  4E3O A;  5F83 A;  4WU9 C;  1YU4 A;  1LI9 A;  1W8Y A;  1YLW A;  3MGS B;  4JF5 A;  1S32 A;  3VH5 A;  3FKE A;  1BUL A;  3MNN D;  1P3K D;  2XH9 A;  2R9W A;  5DNM C;  4LEN A;  4UA9 A;  3MGR A;  5DF7 A;  2FJ7 B;  5CPK D;  3LZ0 D;  3N6I A;  3AZH B;  4S2J A;  3W4O A;  3NDE A;  3OPH A;  1IKG A;  4R8P A;  5FAQ A;  3SS5 A;  5B1M D;  5JRG D;  2FJ7 C;  5EVL A;  4YM6 D;  4KUD A;  1XXM A;  3W96 B;  4IJE A;  3ZGA B;  1PZO A;  1P3B C;  5EUA A;  3REI C;  1ID3 B;  4N92 A;  3AZK D;  3A6N B;  2HIO A;  4IBE A;  1K56 D;  4E3L A;  3IHB A;  1XPB A;  3W97 C;  5FAP A;  2WAD A;  1N9B A;  1K54 C;  1W7F A;  1P3I B;  3IXH A;  4YIN A;  5F99 D;  1M40 A;  3UT9 A;  5GXQ D;  2HP5 A;  5B1M A;  5B33 B;  4XXR A;  3WAA B;  4Y0O A;  3BYD A;  1P3M D;  1LL5 A;  3LZ0 A;  1IYO A;  3UT9 C;  1YU1 A;  1P3G B;  5EE8 A;  5A90 A;  3C1B B;  2Y2G A;  2IWC A;  1W79 A;  5BT1 D;  5BNX A;  3TOI A;  2EXA A;  5DNM D;  5B0Z D;  4NYY A;  3EQV A;  5BOH A;  3HON A;  3AZE B;  4H9Q B;  3FV7 A;  3Q81 A;  3G2Y A;  4E6X A;  1P3P C;  3W99 D;  5B0Y B;  4JJN A;  4JPM A;  4DXC A;  4P6B A;  4KUD C;  3X1U B;  5EOO A;  4LG2 A;  4OJL A;  4B4X A;  3AZN B;  5AV9 D;  5DNN C;  1XKZ A;  1L0F A;  3MVD A;  5FAO A;  2XR0 A;  3W98 D;  3HLB A;  4IJF A;  3MGP B;  5GSU A;  4GDN A;  5B1L A;  5B2J A;  4LD9 D;  3AV2 B;  1P3M C;  4EBL A;  2YFW A;  3MGQ D;  1P3F D;  2XD5 A;  5CPK B;  3MZD A;  3LZ0 B;  3D4F A;  1KVM A;  2IWB A;  4J8X A;  2HIO B;  3VFF A;  3A6N A;  5HW3 A;  4X6T A;  3MVD B;  4DF6 A;  5E43 A;  3IHA A;  4ZBJ B;  1QME A;  2JE5 A;  4PM9 A;  1H3O A;  4Y0T A;  5FAS A;  4DQY B;  2BYM A;  2JBF A;  3UTA B;  3BRM A;  3AZE A;  5B32 C;  2G5H C;  3AFA D;  4OLG A;  3X1T C;  2W8S A;  1HTZ A;  3A1K A;  1KX5 D;  2XDM A;  3LEL C;  1KU5 A;  4FSF A;  3WTP D;  1KX3 A;  1S0W A;  5CP6 C;  4QD4 A;  4DXB A;  1SKF A;  4L0L A;  1KVL A;  4R1G A;  3N8R A;  5HFO A;  5DNN A;  3RXW A;  1IEL A;  4Z66 B;  3HLC A;  4G91 C;  4G92 C;  5KSC A;  3UDF A;  5B2I A;  1KX5 B;  3BEB A;  3E2K A;  1HQ3 B;  2WYX A;  4Z5T C;  5TR7 A;  3TG9 A;  4OPQ A;  3TU4 C;  4QY6 A;  1G6A A;  1U35 B;  2ZC5 B;  3AZI C;  5B40 D;  3EPL A;  4G91 B;  2WGW B;  4BL2 A;  2PBY A;  2RIQ A;  1P3G C;  3FDD A;  4KGC A;  5AY8 D;  4UA7 A;  3AFA C;  5FQI A;  1KX5 A;  5CPJ D;  4FH2 A;  5B31 D;  4OOY A;  5BO0 A;  4H9R A;  3AZI B;  3HUO A;  3V3R A;  5AV6 D;  2GDN A;  3ZVW A;  1O07 A;  4Z9Q A;  3BM6 A;  5B40 C;  3EG5 B;  5B24 C;  4Z66 D;  1S32 C;  4YS3 B;  4MBF A;  1PZR A;  4R4R A;  4Y7P A;  3WAA A;  4KGC B;  1GCE A;  3QNC A;  3X1V C;  2ARO A;  3B0C T;  1B67 A;  5A91 A;  5B32 D;  2IWD A;  3Q7V B;  2Y2P A;  3REL D;  3CJM A;  4IBR A;  3B6G D;  2XEP A;  1YLZ A;  5AV5 B;  2V2F F;  3REH B;  4EWF A;  5E5A C;  1VM1 A;  1DJA A;  2CV5 A;  4LCM A;  3V5M A;  2OLU A;  3MNN A;  1P3K A;  3IH8 A;  3B0B A;  3KWQ D;  3ZG8 B;  1JTG A;  2Y2M A;  3UT9 B;  2HIO C;  1ZC2 A;  4KQR A;  3PBQ A;  2PYO B;  2I72 A;  3B0D C;  4X56 A;  4X23 C;  1KE0 A;  1P3I A;  1BUE A;  3UTB A;  4GB7 A;  4NET A;  2HUE B;  5B0Z C;  1BTL A;  4P85 A;  4LV3 A;  2OSU A;  3PBN A;  1IYQ A;  3WS1 A;  4XUJ D;  4X23 A;  3SS3 A;  4OJ6 A;  2EX6 A;  3N8L A;  3W96 A;  2HDU A;  1KE4 A;  5GXQ B;  5F1F A;  3SH7 A;  4KZ6 A;  2BG1 A;  4CAY A;  4KGC D;  1P3L B;  2ZY4 A;  4WU9 B;  4OPY A;  5CHM A;  1MPL A;  4ZUX C;  3V9R B;  1P3A D;  4KHA A;  3ZNY A;  4QLC B;  2G5I C;  1WE4 A;  4J8W B;  1ONH A;  4Z2M G;  1DJC A;  5L2F A;  3NBL A;  4RYE A;  3L27 A;  2EXB A;  1TDL A;  3B3X A;  1NZO A;  4GOG A;  2YFV A;  3AZG C;  4WEL A;  1NZU A;  5E5A D;  4IBF A;  1P3B D;  4JF4 A;  2PYO D;  3X1S D;  1K56 A;  1ID3 C;  3WTP A;  1KX3 D;  1M19 A;  3OPP A;  4P87 A;  4CJN A;  1KGE A;  1R4V A;  2G2U A;  4UHU A;  4OQH A;  4H9N B;  2DNS A;  3IXB A;  1XA1 A;  5C3I C;  1P34 D;  1P3I C;  3AZE D;  4OOM A;  5AVC B;  4ZJ2 A;  1P3O C;  1GHP A;  3VSK A;  5B2I C;  3G35 A;  2RVQ D;  2ARO D;  3NI9 A;  5B40 A;  5AVC D;  4KQO A;  5E2H A;  3REK B;  5G49 B;  3G31 A;  3W96 C;  3WAA C;  4LV2 A;  3AZK A;  1BT5 A;  1K55 C;  3REI B;  5AY8 C;  3MXR A;  1DY6 A;  5CGS A;  1TAF A;  3AV2 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...