2Y2KA

Penicillin-binding protein 1b (pbp-1b) in complex with an alkyl boronate (za5)
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
488
structure length
469
Chain Sequence
SEITYSDGTVIASIRDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTGQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Guided Design of Cell Wall Biosynthesis Inhibitors that Overcome Beta-Lactam Resistance in Staphylococcus Aureus (Mrsa).
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
molecule keywords PENICILLIN-BINDING PROTEIN 1B
total genus 163
structure length 469
sequence length 488
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2y2kA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2y2kA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2y2kA02
1DJAA 1JWVA 5FAPA 4Y0TA 3HL9A 2WGVA 1I2SA 3ZGAB 1PWGA 3BECA 1XXMA 5E2HA 1ESUA 1LI9A 4QY5A 3W4PA 1NY0A 2ZM0A 3BEBA 2IWDA 3Q7VA 4MBFA 3P09A 1E3UD 4M3KA 1ES2A 3G4PA 3JYIA 4P6BA 4S2OA 5CTNA 1LI0A 1MWTA 2EFUA 3G35A 5E2FA 4OOLA 1ZC2A 4FH2A 3CG5A 5EVIA 2XQZA 3GRJA 1K25A 1BLCA 2JC7A 2V20A 3MKFA 3N6IA 4WELA 4P85A 1XKZA 2Y2MA 3HLWA 1YLPA 4FD8A 1YLWA 1YMXA 5EPHA 3ZFZA 4CJNA 3RJUA 5CEBA 3PAEA 3WS0A 1JWPA 2XGNA 1ESIA 1PZPA 4OLDA 4XUZA 3VP2A 1C3BA 3VSLA 3SS3A 4LENA 4S2JA 3A3FA 3HUNA 1I5QA 5FI7A 5D3OA 3M6HA 3LCEA 3NY4A 4EV4A 2OLUA 1MXOA 1KGGA 1YM1A 4JXGA 2XF3A 5CTMA 1SCWA 1IYPA 2FFYA 3PTEA 3ITBA 3LY4A 3NC8A 3G32A 4DDYA 3HLBA 4NK3A 3HLFA 2Y2IA 2Y2PA 3M2KA 1GHIA 3PBNA 2EX9A 2J9PA 3VOYA 3GSGA 3VP4A 1Q2QA 1W8QA 2CC1A 4DXCA 2QMIA 5CGSA 1PW8A 2I72A 4R3JA 3DWKA 1RP5A 5KMWA 2WZZA 4O7DA 3UE3A 1YQSA 1KE0A 4DE0A 4KG6A 2ZQCA 3Q81A 4MNRA 1FSYA 1EI5A 3OPHA 5KZHA 4U0TA 3TG9A 1MWSA 3UE0A 2ZMAA 1Z6FA 3C7UA 2WZXA 2OV5A 2IWCA 4GB7A 5EUAA 2A49A 2EXAA 2JBFA 4ZJ3A 4RX2A 5CHMA 4JPMA 4DXBA 4PM6A 4XUXA 4S2NA 5DTTA 1FCMA 3AGEA 4L0LA 1IKIA 5HARA 4A5RA 5HAQA 2RL3A 1S6RA 4E3NA 1PWCA 1KVMA 2DCFA 5E2EA 4C6YA 2Q9NA 1K56A 2R9XA 3WS5A 3A3EA 4OPQA 4F94A 4KQQA 1DY6A 1GHMA 4EBNA 3UO9A 1EWZA 3EQUA 3QNCA 4JF6A 2DNSA 2ZC6B 2ZQ7A 3ZVWA 4K0WA 4R4RA 4DRTA 3SS5A 2J8YA 1IYQA 3BFDA 1L0DA 4EUZA 2A3UA 1HTZA 3VOZA 5FI6A 3Q82A 4GNUA 3C7VA 3DW0A 4KZ6A 5E2GA 1BTLA 5IHVA 3V5MA 4KZ4A 5HL1A 4WYYA 2ZQAA 4KZ7A 2P74A 1N9BA 3OCLA 3MZDA 5TFQA 2ZC3B 4S2IA 1LL5A 1PI4A 3DTMA 2HP5A 1NRFA 4WMCA 4E3KA 5FQ9A 2X71A 4GZBA 2X01A 3Q1FA 4PM8A 2EXBA 4XXRA 5DF9A 4N1XA 3IQAA 3ZG8B 1IYSA 1BZAA 1W79A 2HDUA 4N92A 4Q8IA 2HDQA 4K91A 3WS2A 5M19A 3V3SA 1WYBA 2Y4AA 3ZG7B 1K54C 3SH8A 4ZDXA 1BULA 1ERQA 1IEMA 2J7VA 3NIAA 4X55A 4OKPA 1XGIA 2ZM8A 4RVAA 3LY3A 3UDIA 3HREA 4LV0A 5A90A 1M6KA 2BG1A 5DVAA 4QJGA 1SDEA 4KQOA 1IYOA 1YLZA 3E2KA 4KZ5A 4KG2A 2OLVA 4DE3A 1ONGA 1GCEA 3N8RA 1L2SA 5FAQA 4KQRA 3ZG9B 5FQMA 1K4FA 1ZKJA 1LHYA 4HESA 1RGZA 4GDNA 3IF6B 3FZCA 2XEPA 4WBGA 3FKWA 5FI2A 3HUOA 3P98A 4GOGA 1HD8A 4WZ5A 5U47A 3SH7A 3OPLA 2WUQA 2WGWA 5FASA 3HBRA 3NCKA 3PBOA 4KZAA 3A3DA 5HFOA 5E43A 2ZQ8A 4ZAMA 1ES3A 4QD4A 1SKFA 4QB8A 3WS4A 4DE1A 4R4SA 1NXYA 1NYMA 4WM9A 4UA6A 4PM5A 1RCJA 3OZHA 2ZLYA 4OH0A 1QMFA 5DTKA 1PW1A 4UAAA 1W8YA 2QZ6A 5KSCA 4NETA 5FQQA 2XDMA 3UY6A 1K55C 5GLDA 3A3JA 4E3LA 4WEJA 3RXWA 3BFEA 4OPYA 3TOIA 1TDGA 3UDXA 4OQIA 3IF6A 3PBTA 3IT9A 4WZ4A 3GV9A 4R3BA 2Y91A 2EX6A 4ZJ1A 1U60A 4BL2A 5CECA 3MXRA 3IWIA 4YINA 3MZEA 2WGIA 1CI8A 4KZ9A 3OPRA 3S22A 3UN7A 1DJCA 3NI9A 1Q2PA 4E3OA 1PWDA 1L0EA 2ZC7A 3PBSA 1JVJA 4JXVA 3N8SA 1G68A 3WWXA 4X56A 5J8XA 3UPOA 4JKTA 4GD8A 1MPLA 4KZ3A 5GLAA 2XD1A 4IBXA 3VP0A 3LO7A 3NDEA 1XX2A 2UWXA 5EOOA 1MKIA 1TEMA 3GQZA 2ZC4B 5GHYA 3G2YA 3OC2A 4UHUA 5HAPA 2ZQ9A 3IH9A 4BD1A 3CJMA 3BYDA 3BLSA 1MY8A 1PZOA 5DF8A 1PYYA 1XA1A 3AGFA 3PBQA 2BLSA 3BFFA 3Q7ZA 4DE2A 1K55A 5FA7A 2HP9A 3OPPA 1GHPA 3S1YA 3V39A 4LV2A 4BD0A 5F1FA 5FQIA 3VMAA 1FSWA 1NZOA 2Y2OA 4RYEA 4N1HA 5CHUA 3HLEA 5CERA 3UPNA 3IHBA 4X69A 3SOIA 2Q9MA 3O88A 1CEFA 2Y59A 4OQGA 3B3XA 4S2PA 4FH4A 5AQ7A 1XP4A 3LEZA 5AQBA 1Y54A 1H8ZA 1O07A 2XLNA 3ZVTA 3BFCA 4OLGA 1BT5A 3IF5A 1KGEA 3W8KA 2EX8A 4BENA 3O3VA 2Y55A 4N9KA 3SS4A 1N4OA 1JTGA 4OP8A 3ZHHA 5AQ9A 5CHJA 2QPNA 4LV3A 3IH8A 1NJ4A 4Y0UA 1E4DA 5FQJA 3ZG5A 1K57A 5FATA 1ES4A 2WAEA 3HUMA 4JLFA 4KZBA 4EBPA 3GR2A 3ZNTA 1AXBA 2WKHA 1ES5A 2J9OA 4OONA 3GVBA 1GA9A 2XFSA 2X02A 1JTDA 3MFDA 4S2NC 1ZG4A 4WEKA 4Y7PA 4S2MA 3O87A 1XPBA 3EQVA 3WS1A 4C75A 2HDSA 2Y2JA 3IXBA 4RA7A 1KDWA 3BLMA 1TVFA 3MBZA 4KG5A 3HLDA 4S2LA 3G31A 4QHCA 5F82A 2Y2NA 1IKGA 1VQQA 2VGKA 3ZDJA 3RXXA 1OMEA 4EBLA 3D4FA 5EVIB 3FYZA 3C4PA 3IWOA 3MKEA 5EVID 2ZQDA 3C5AA 4FSFA 4ZTKA 4PM7A 1CEGA 3IXDA 1LL9A 1GA0A 2ZD8A 1G6AA 4JXSA 4DF6A 3G2ZA 4GD6A 2C6WB 3FKVA 2WGWB 5F1GA 4EWFA 3W4QA 2WAFA 5CGWA 3BRMA 3V3RA 4R1GA 1O7EA 3QNBA 2WKIA 4K0XA 3Q07A 2WYXA 1PI5A 4P87A 1WE4A 1HVBA 1K38A 3IWQA 3N8LA 5HX9A 3FV7A 2B5RA 5GLCA 3WRTA 4BL3A 4GN2A 1K57C 3IXHA 1BLSA 2WKEA 3SH9A 5I94A 5EECA 3IHAA 3M2JA 1ZG6A 2EFXA 4E6WA 1ALQA 5G18A 1H5XA 1EROA 1K4EA 4ZBEA 5GLBA 1CI9A 5JYPA 5JYOA 3MZFA 5AQAA 1ERMA 4X68A 1L0FA 4JBFA 5BOHA 1MWUA 2PU4A 3VFHA 1S0WA 2XH9A 3NDGA 4U3TA 2G2WA 4IVKA 3C4OA 4N9LA 4OPZA 1YMSA 3ZNYA 2RCXA 4ID4A 4OP5A 5EE8A 1E25A 2E8IA 3TSGA 2WK0A 3BFGA 3UNWA 1I2WA 2XR0A 1K6RA 3NBLA 1ONHA 2H0YA 2ZJ9A 2Z2MB 1NYYA 1KGFA 3DWZA 2P9VA 3ISGA 4MBKA 4B4XA 4IEDA 1K6SA 3AGDA 2HP6A 5FQKA 4DKIA 2WADA 3I7JA 1QMEA 4PMAA 4IBRA 4WZ5C 4E3JA 5CXWA 4GKUA 1J9MA 1W7FA 5A92A 3VP1A 1FCOA 5EVLA 1YLJA 5DF7A 4D2OA 4KZ8A 3VP3A 5FAOA 4JXWA 4OQ0A 4WMCD 4OQHA 1KDSA 2JCHA 2DRWA 5HAIA 1L0GA 4DDSA 3ZCZA 2R9WA 5A93A 2Y2KA 3HLCA 5CEDA 2HDRA 4JF4A 1XGJA 1MBLA 1SDNA 1YT4A 2Z2LB 3E2LA 3HLGA 3IF6C 4QU3A 5GHZA 5CRFA 5L2FA 1M40A 2JE5A 4UA7A 3VSKA 4BJPA 1H8YA 4MEZA 5FSRA 3IXGA 4Y0OA 5GHXA 3CZDA 4OOYA 4OPRA 4X6TA 2EX2A 4BLMA 3FWLA 4B4ZA 2V2FF 4EQIA 1NZUA 3GTCA 1XA7A 4R0QA 2P9VB 2Y2HA 4E6XA 2IWBA 1DJBA 3PAGA 1K54A 4C3QA 2ZM2A 3GMWA 4E3MA 2Y2LA 1BLPA 3CMZA 3N7WA 4UA9A 4HEFA 2PBYA 2XK1A 3G30A 5EOEA 1VM1A 4IVIA 1E3UA 2XFTA 4CPKA 3ITAA 4H8RA 2XD5A 4KENB 4S2KA 2VGJA 4PM9A 5CGXA 1K56D 1LLBA 4HBTA 1FOFA 1WYCA 5DTSA 1BUEA 4E3IA 3VFFA 4MBHA 3WRZA 3ZG0A 3UE1A 5TGFA 3BM6A 4PPRA 5M1AA 1FQGA 4Z9QA 1KE4A 4FCFA 1SHVA 2Y2GA 4YFMA 5FDHA 1FR1A 1W5DA 2HPBA 1KVLA 2PU2A 3A3IA 3N4IA 4JF5A 4BQMA 1FR6A 1IELA 1HZOA 2H0TA 2FFFB 1RGYA 3UPPA 2Y2QA 4LV1A 1FCNA 2OSUA 1TDLA 1YLYA 4X53A 3QHYA 4RX3A 4QY6A 4U0XA 2V1ZA 2G2UA 2H10A 4GDBA 4HBUA 3HVFA 3S4XA 3V50A 5GL9A 3O86A 4OOMA 5TR7A 4MLLA 2H5SA 3W4OA 4ZJ2A 1BSGA 3Q7VB 4LCLA 4OVDA 4B88A 2GDNA 5EVIC 3UDFA 3M6BA 4P0MA 1KE3A 3MXSA 5M18A 2ZC5B 3OCNA 3PBRA 1PIOA 5A91A 5HW3A 3G34A 4LCMA 5F83A 2C5WB 1CK3A 1BLHA 1MWRA 1YLTA 4R23A 1JWZA 5KSHA
chains in the Genus database with same CATH superfamily
3LZ0D 2XA7S 3B42A 4Y3IA 3HL9A 2VGLS 3PXPA 5GT3B 2DMWA 4I38A 4LD9A 4K08A 5BO0B 2CMNA 3B6GB 1ESUA 3W4PA 3O62C 1NY0A 1OPXA 2NUPC 3LELA 2IWDA 1ID3C 2JKTM 1KX5A 3CITA 1ES2A 3UTBD 3G4PA 4P6BA 5CTNA 5J4EA 1LI0A 2EFUA 1ZC2A 5CPKA 4P85A 5B31G 5GSUC 4XUJC 1LL8A 3LJAD 1YMXA 3REID 2M7UA 5CEBA 3WS0A 1JWPA 1PZPA 2O9CA 4OLDA 4G91C 3DTKA 4ZUXB 4G91B 3HUNA 4IBFA 4HMCA 4EV4A 1N1JB 1MXOA 1KGGA 4FTXA 1Z2CB 4Y2FA 2FFYA 3PTEA 4EXOA 3W98B 4DDYA 4B9OA 3M7PA 3M2KA 3A0VA 3VOYA 1P3GA 3VP4A 2NZDC 5B40D 4R3JA 2BTFP 5B32A 1RP5A 3UTBB 5KMWA 2WZZA 4YOFA 3UE3A 3LI9A 1KE0A 3MGQB 2ZQCA 4MNRA 4GS9A 1FSYA 3OPHA 4PHTA 2ZY5A 3MGPB 1W63M 2ZMAA 1OJ5A 5HL6A 2B95A 4GB7A 5HD3A 4ZJ3A 4WU8B 3LZ1D 1YAXA 4PKYA 4PM6A 5HARA 5HAQA 3UT9C 1G6OA 1OGGA 4HY8A 1Y4OA 5F69A 1S6RA 1J7MA 3WKJD 5KIZA 1KVMA 5E2EA 4YWZA 5JRGC 2R9XA 3CUEA 4G3WA 4OPQA 2PR5A 2ZQ7A 3HJIA 3AZJA 1P3PD 2J8YA 3MXQA 1F1EA 3BFDA 4EUZA 2A3UA 3REKD 5GXQD 2I9VA 5DNND 2VLGA 2GNXA 3LR0A 5B2JB 3C7VA 4X23A 4Z1WA 3V5MA 5HL1A 4KZ7A 4LD9C 3LICA 4JGQA 1N9BA 4UPKA 3OCLA 4X1LA 1IFQA 5TFQA 4S2IA 3CHWP 3W97B 1CF0A 1P3IA 3MNND 4GZBA 2PD8A 4IBIA 2JSSA 4G92C 4XXRA 5DF9A 1ID3A 3ZG8B 5B31C 2HDUA 3UE6A 1YU4A 4Q8IA 3QP1A 4X23B 2HDQA 3RELB 5B1LD 2Y4AA 1H8PA 4WU8C 3NIAA 1HQ3A 3X1UB 1P3FD 1M6KA 2JKTI 4LGWA 2JKRM 3KYEA 2HJ9C 1YLZA 3AZIA 3PHYA 2AROA 3JPUA 2PBDP 3N8RA 2O0YA 4J8UA 2VX8A 5FQMA 1YSPA 3IF6B 1P3BB 2XEPA 4JGPA 3LIAA 3FKWA 1TAFA 4WZ5A 3SH7A 1S1YA 1KS0A 2WGWA 3PBOA 3MGQA 3A3DA 1ES3A 4QD4A 1SKFA 5GT3A 4KUKA 4DE1A 1NYMA 4UA6A 2Z6DA 1STZA 4HP4A 1PW1A 1W8YA 5KSCA 4EQ1A 3F1PB 4H9RB 5AV5A 3IF6A 3PBTA 3IT9A 1OGBA 4R3BA 4JJNC 2HIOC 2Y91A 5TBMA 5B1LA 5AV6C 4KQDA 4QLCA 3JVVA 3IWIA 4YINA 1FIKA 3MZEA 5AV8C 2WGIA 4UEYA 3S22A 3UN7A 1KX4C 1B6WA 3FC7A 2ZC7A 3JVUA 3T1XA 3WWXA 5GSUA 4WNNA 1MKIA 1TEMA 4FUWA 3MMHA 2FJ7D 3R7WB 4WU9A 2R78A 1BH8B 3IH9A 4BD1A 3AZHC 3B6GC 5B0YA 1PZOA 5DF8A 1PYYA 1XA1A 3AZLA 1K55A 5FA7A 2K31A 3LJAA 4BD0A 5FQIA 1WWIA 3CAXA 3VMAA 5K5BA 5BNXB 5BS7A 3KUYD 3QP8A 3VV4A 3W99B 5CHUA 5CERA 3AZFD 1KX4D 2Q9MA 2JKFA 1CEFA 3B3XA 4S2PA 2IO5B 1XP4A 3AZGA 1P34A 3AZNC 1LSVA 1Y54A 1O07A 2HJEA 3LFVA 3BFCA 3KWQC 3UB5P 2NZDD 3IF5A 3R4KA 2AROB 4YS3D 4OP8A 5CHJA 4LV3A 2PYRA 3AYWB 3FPVA 1K57A 5EM0A 4BBUA 4JLFA 2JKGA 1P3FA 3E98A 4I3AA 3U4LP 2WKHA 1AOIA 1ES5A 4OONA 3GVBA 1JTDA 1SZVA 4Y7PA 4PAUA 5CPJC 1EQZA 4H9OB 3EQVA 5F5YA 3LJAC 3MBZA 2VQRA 3LZ1B 3VH5T 1KOUA 2W3HA 3HLDA 1L3LA 3X1TA 1LT0A 1HLUP 3AZIB 1VETB 1VHMA 3CPTA 4ME4A 3ZDJA 3C4PA 2ZQDA 5AV5B 3EEHA 3MGQD 1WWSA 3AYWA 3IXDA 3H0RC 1G6AA 2ZD8A 1P3PA 3UT9B 3C30A 4GD6A 3FKVA 1GXDA 4LG2A 2WGWB 3VOLA 3RELA 3NOPC 2WAFA 4TX8A 3PYPA 5CGWA 4R1GA 3QNBA 2WKIA 5DFXA 3WD0A 2HIOA 4R3AA 1HVBA 3IWQA 3D72A 1ZLAA 3FV7A 4QLCC 4BL3A 4EEPA 3H82B 4EU0A 1NLYA 1ALQA 1H5XA 1K4EA 5JYPA 4WU9C 2LB9A 3LUQA 3NHQA 3LIBA 3V67A 2EWVA 5DFYA 4JBFA 1MWUA 3VFHA 4U3TA 5EV0A 3EPHA 4CLCA 3REJB 2G2WA 4NZ3A 4IVKA 2PRFA 5AVBC 2RCXA 5GT0D 4WUJA 3KSGA 4OP5A 1U35A 5EE8A 3TSGA 1PFLA 3C1BD 2WK0A 3UNWA 1Q9CA 2CV5C 2Z2MB 1NYYA 4J8XC 1K6SA 4HI4A 3AGDA 5FQKA 4KUDB 3I7JA 4IBRA 4Z2MG 4O01A 5B0YD 3V9RB 1H3QA 3VP3A 3A6NC 4WMCD 4XT2A 2DRWA 1L0GA 2R9WA 2Y2KA 1PNEA 2HDRA 3AZJC 4JF4A 1MBLA 1SDNA 1YT4A 3HLGA 4WL9A 4LPZA 3AZNA 5CRFA 5L2FA 3RELD 2JE5A 4NXBA 3IXGA 3KS4A 2EX2A 1P3BD 4X23C 2P04A 3R45B 3K3DA 2F8NB 1XJ2A 2P08A 3X1UC 2Y2LA 5AV8D 3FKEA 4H9NB 2XK1A 1VM1A 3F1OB 1VEUA 3KSIA 4S2KA 2HIOD 3X1TC 5AV9D 5B40B 1K56D 2A24A 5AV5D 5DTSA 1BUEA 5AVCB 4E3IA 4MBHA 3TE8A 1H8MA 5TGFA 5B0YB 4PPRA 4J8UC 4II7A 5FDHA 1KVLA 3A3IA 3O62A 4WLAA 4BQMA 3MGSB 4J8WA 2FFFB 3AV2C 3WA9B 5G4YA 4LV1A 1FCNA 3F6TA 2VJWA 1E88A 2OWHA 3S4XA 3W96C 5GSUD 4OOMA 4P6ZS 4MLLA 1MKMA 2H5SA 3CWFA 3W4OA 1BSGA 3ZYTA 3N3FA 3C2WA 3UDFA 2AROD 3M6BA 5M18A 2FJ7B 2J3TD 3PBRA 4HP9A 1PIOA 4XZQD 5A91A 1L6JA 4JJNB 5HW3A 3QP5A 1TAFB 1P9RA 2PYOD 1YLTA 5KSHA 5GT3C 3FDDA 5AV8A 5FAPA 5LBRA 1CXWA 3B0BA 1YU0A 3BECA 5E2HA 3LEQA 3BEBA 1M1AC 3E4OA 3KWQB 1P3AB 1GSWA 3W2ZA 4S2OA 5AVCC 3W98A 2ZMFA 3WAAD 1SKOB 3G35A 4QPRA 5E2FA 3WAAB 4G3VA 4JJNA 3BWLA 2XRNA 1K25A 1TS0A 4IUKA 3L28A 4M4XA 1XKZA 3HLWA 1P3PB 2EA9A 1BYWA 4Y13A 4XUZA 3VSLA 5A8BA 1I5QA 1ULYA 5FI7A 5B2JC 3LCEA 3M6HA 4MB3A 3PR6A 2RVQC 3REKC 5GXQB 3KXBA 1IYPA 1DP9A 5L10A 1TF1A 1P3PC 3ITBA 2OAP1 3LY4A 3G32A 3HLBA 3L7HA 4NK3A 4H6JB 2Y2IA 3B6GD 4B93A 3KFUG 3PBNA 3S7NA 2EX9A 4F3LB 3H7WB 5I5LA 4EERA 1W8QA 1P3BA 2QMIA 5AV9C 5CGSA 1P3AD 4YM6B 3AZMC 3DWKA 1ED7A 4O7DA 1YQSA 3AZIC 3VH5W 1S66L 3Q81A 5AY8C 3LZ1C 3WTPD 4Y5FA 3TG9A 1P0ZA 1Z6FA 2OV5A 2WZXA 5B0ZD 4DN0A 4HOIA 1AOIC 3WA9A 5GXQA 2JBFA 3B0CT 2YKFA 5EFWA 4RX2A 4X23D 1KX3C 4XUXA 5DJUA 4DXBA 3AZGD 1P34D 1FCMA 3AGEA 5AJGA 1IKIA 1W1YA 2ACGA 2DCFA 4EESA 1TZYB 3LR3A 4YNRA 2F8NG 2VGLM 3A3EA 1XJ6A 4KQQA 1GHMA 4MN5A 4JF6A 5CP6C 4K0WA 4R4RA 2YFWB 5KDMB 3LI8A 4CLCD 4G3KA 1HTZA 1M1AB 1P3FB 1XFQA 4HJ3A 5E2GA 1BTLA 4WU8A 2CV5D 2ZBBA 3MQQA 2UV0E 5B24C 3L9KA 5AVEA 3BY8A 3RH8B 4BMWA 2ZC3B 1LL5A 3TJZC 1JFIB 3B33A 3LYXA 4WMCA 5FQ9A 2A24B 3MNNB 4MCWA 3WTPE 2X01A 3UTBC 2INWA 3Q1FA 4Y15A 1P3MC 3LJAB 2EXBA 2ZL1B 4UQIS 3D3OA 3IQAA 3L25A 1IYSA 1W79A 1T1CA 5M19A 4K91A 3G6OA 1P3LA 1WYBA 3ZG7B 3WD2A 3SH8A 1XJ3A 1ERQA 3MQLA 2J7VA 3LZ0C 4X55A 1LSWA 4RVAA 5BO0A 2O99A 2FZ0A 1GSXA 1OTEA 4YM6C 3C1CC 1GPFA 5DVAA 1SDEA 4Z5TD 1IYOA 3E2KA 1UWPX 2W1RA 1P3OB 4NKPA 4DE3A 3K2NA 4HQAA 1GCEA 5CPKB 3BQAA 1V9ZA 1RGZA 4GDNA 1E6ZA 1X0OA 3A1KA 1EAKA 1BH9A 4EETB 4GOGA 1HD8A 3W96A 4GW9A 5AY8A 4LD9D 4HMEA 4CSRA 1HQ3B 4ZAMA 1H3OB 5BNVA 4QB8A 3W99C 4WM9A 1J3WA 3X1VD 3B6GA 1QMFA 2G5HC 3OLOA 4NETA 2K7SA 4ARZB 1K55C 3T4KA 1OTDA 3GDIA 5GLDA 1P3AA 1D1JA 4WEJA 1OT6A 3UTAA 1TDGA 5L07A 4WZ4A 3H0LC 2EX6A 1P3LD 3REKB 3EOIA 1E8BA 4BL2A 5L09A 2L0WA 3WX7A 4L9EA 2F8NK 2W0NA 1YSQA 3OPRA 1DJCA 3H0MC 4OJ5A 3AN2C 3NI9A 4EEUA 4E3OA 1PWDA 3IX8A 1ZLAB 3PBSA 5F68A 3KUYC 3MQOA 2OAQ1 5J8XA 3MVDD 2RTSA 1MPLA 3MVDB 4IBXA 4MDZA 3LO7A 3NDEA 1XX2A 5EOOA 4HJ4A 4YS3B 3AZKD 4I39A 3OC2A 1TZYC 2ZQ9A 2IA2A 3KYQA 5J3WA 4NE3A 3A6ND 3BLSA 1MY8A 2NZDA 2PYOB 5B32B 2BLSA 3Q7ZA 4DE2A 1GOIA 2IO5C 3E4PA 4GHIA 1GHPA 4IUHA 3S1YA 1F66B 3UT9D 1M19C 3MJQA 4ZUXC 2L4RA 4RYEA 4N1HA 1K0KA 3UPNA 3KSHA 1QO6A 5E5AC 3O88A 3WTPC 4OQGA 4DJ2A 5AY8D 4FH4A 4ESPA 2Z6CA 3AYWC 2K2NA 3LEZA 1P3LC 5AQBA 2V8FA 1EQZD 1BT5A 5JRGA 1KGEA 5AVCA 4R8PC 2QWSA 1S4RA 4N9KA 3BQ8A 1N4OA 1JTGA 4J8UB 2QPNA 4Z2IA 3IH8A 5B2IA 2Q0OA 3AZLD 1E4DA 2ZOHA 5FATA 1ES4A 5C3IC 4EBPA 2RVQD 1AXBA 3AV2B 5B0ZA 3K3CA 1H3OA 4Z5TA 2BYKA 3O87A 1XPBA 5CP6A 1N9LA 2Y2JA 1UGUA 2HDSA 3IXBA 3T50A 4RA7A 1TVFA 2F8NH 5B32D 3W98C 5F82A 3MGQC 1IKGA 2VGKA 3QP6A 1OTIA 3AZHB 3FYZA 3IWOA 1P3IC 1F2KA 4PM7A 1M18C 1GA0A 1ID3B 5F99D 4EW7A 4WV4B 3G2ZA 5CPJD 5F1GA 5AY8B 3W4QA 5EM1A 1EW0A 4Z2MH 3BRMA 3V3RA 1MZUA 1O7EA 5BNVB 4K0XA 2WYXA 4H9OA 3C1BA 2V0WA 4KHAA 2B5RA 5GLCA 3WRTA 5AV6A 3IXHA 5I94A 4J8WC 5EECA 4J8UD 3M2JA 1ZG6A 3AN2A 5G18A 2WKQA 2NUTC 4XZQB 2KX6A 2J3TC 1SKOA 3MNNC 1YUEA 3MZFA 1Z09A 3EGXC 1ERMA 4NXEA 3KS8A 1S0WA 3B6FD 1W63Q 3AYWD 4OPZA 1YMSA 3ZNYA 4H9PB 4DJ3A 2M7VA 1E25A 2E8IA 5AV8B 4ZUXA 3BFGA 3L27A 1F66A 2VEAA 1K6RA 4WN5A 1ONHA 2H0YA 3MQ0A 3LIFA 3AZFC 3ISGA 2P9VA 2BYMB 4IEDA 1M19D 1F9IA 5B31B 2DF4C 4I5SA 1QMEA 4Q0JA 3TU4B 3MGRC 1J9MA 1W7FA 5A92A 3UMEA 5EVLA 3AZEC 5B33A 1YLJA 4D2OA 3AZHD 3DBAA 3ZCZA 1P3OD 1T19A 3E2LA 3AZKC 2HUEC 4QU3A 5GHZA 3MGRD 3EPKA 4NYUA 1BFMA 4OPRA 4OOYA 4B4ZA 2V2FF 3GTCA 4HH3A 1XA7A 2P9VB 2ZY3A 2Y2HA 4AFIA 3PAGA 2ZOIA 3TU4A 4Q0IA 4Z66B 3N7WA 5GT0C 1M18B 3G30A 4NZ1A 3ICYA 1S1ZA 4CPKA 2XD5A 4KENB 2YFVA 1TS8A 1UR9A 1LLBA 5CPKD 4HBTA 5JRGB 4AWLB 4JGRA 3UE1A 4R6LA 5M1AA 1N9OA 3REIA 1ACFA 1FQGA 4Z9QA 5F99B 2V8CA 2FJ7A 4FCFA 5HWWA 2Y2GA 4YFMA 2HPBA 4NG2A 3MGSC 4PKYG 3N4IA 1P3LB 3X1VC 1HZOA 2OSUA 3WA9D 3CLOA 1TDLA 4X53A 3QHYA 2V1ZA 5BT1D 3AZMB 3REHB 2G2UA 2H10A 3HVFA 5GL9A 5TR7A 3B6FC 3P5JB 1P3GD 1P3OA 1P3ID 2W3DA 4EO5C 2L5AA 3MXSA 2ZC5B 1D06A 1ZLAC 3W98D 4ETXA 5B2IB 4R23A 2KLIA 1DJAA 3KSYA 4Y0TA 2WGVA 3S7PA 5B0ZB 2W8SA 1ZTUA 5AVFA 3HCYA 1LI9A 4XUJB 2PYOC 5AVBA 2D02A 2HGVA 2ZM0A 2XROA 3KXBD 4OJPA 3Q7VA 3UB7A 1E3UD 1VETA 3JYIA 4RQ9A 4OOLA 4H9SC 3CG5A 3W97D 2ZY2A 2AROC 2XQZA 1VB6A 2JC7A 3MKFA 3N6IA 3H7WA 4HIAA 4WELA 5B32C 3AFAD 5J7EA 1YLPA 4FD8A 1UR8A 1YLWA 5EPHA 3UB8A 5JA4A 3RJUA 3PAEA 5B24D 1P97A 1C3BA 3SS3A 3IS2B 4LENA 4S2JA 5D3OA 4J8XB 4MMNA 4JXGA 1H0IA 3T1SA 3AZLC 2YKHA 5FEGA 1KX5C 3NC8A 5B33B 3IP4C 2D49A 3AN2B 3HLFA 1OJGA 2Y2PA 1VEUB 1GHIA 4XT2B 1T3UA 3GSGA 4X25A 5AV5C 1T1BA 3MS6A 1U35D 2I72A 3KWQD 3F1NB 5TBMB 1P9WA 3LIDA 5B1MA 4DE0A 4KG6A 3IS2A 3AZGC 1P34C 2YFWA 5KDMA 5KZHA 4M6BA 4U0TA 3UE0A 1MWSA 2EWWA 3AV1D 2IWCA 5E5AA 5EUAA 5DNMA 3EPLA 2W27A 4JPMA 2Y8HA 3NQJA 3BY9A 1W1PA 3AZID 5AV6D 3ZQ5A 3AZMD 1PWCA 4C6YA 5B40C 5L8MA 2Q9NA 3DTIA 1DP8A 2FN2A 3WS5A 4ETZA 2M1CA 1DY6A 3UTBA 3UO9A 3EQUA 3QNCA 3B0DC 4GJ4A 2DNSA 3ZVWA 5B2ID 4OJOA 3AZED 4DRTA 3B6FA 3SS5A 3S7OA 4IBGA 5MC7A 3VOZA 2H28A 4J8WB 4WJ3C 5DNMB 5IHVA 4GHLA 4O0PA 1CQAA 4LD9B 2AVXA 3AFAC 2GZAA 1NRFA 3A6NB 3AZHA 4NXFA 3KWQA 4GHAA 3W97C 2X71A 3MGPD 4PM8A 3OOVA 1P3MB 1S67L 4J8VC 1BZAA 4QLCD 3WS2A 4R70A 3V3SA 5HPIA 3MR0A 3AV2A 4ZDXA 1BULA 3W99D 1IEMA 4L9GA 5FDSA 4OKPA 2ZM8A 3LY3A 3UDIA 3HREA 4J8VD 2QYBA 5HWVA 2BG1A 4J8VB 4QJGA 4Z66D 4KQOA 4KG2A 3MGPC 3B47A 5HDDA 2OLVA 1ONGA 2V9AA 3X1SB 1L2SA 3UTAD 1D7EA 5FAQA 3UTAB 1K4FA 1ZKJA 1P3GC 4R38A 3EPJA 1LHYA 4HGAB 4HESA 3AZKB 3FZCA 2FH5A 3A0SA 4BBTA 4WBGA 3KUYA 5FI2A 2IOUA 5U47A 3OBFA 5CPID 4YM6D 3NCKA 4KZAA 4IBKA 4UUZB 5E43A 2BASA 2ZQ8A 3AZFA 1HQ3C 4NY2A 5AV9A 5DNNC 2PD7A 3OZHA 5B1LC 4OH0A 5DTKA 3KO6A 5HWTA 4UAAA 1G5UA 5B31D 5FQQA 2XDMA 3A3JA 1P3MD 4EO5B 4YS3A 4LFUA 3UDXA 3AZKA 4L9FA 4AWLC 3KUYB 5CPJB 4UUZA 5CECA 4CSRB 3MXRA 1N9NA 3MGPA 3T12B 1AOID 1OT9A 4MB5A 4DMZA 5B2JA 2F8ND 1JVJA 3N8SA 4Z66A 1G68A 4X56A 2J80A 3UPOA 2NQBB 4JKTA 4KZ3A 5GLAA 3VP0A 4XZQA 1NWZA 5FL3A 5B2IC 3C8CA 2YFVB 1TD5A 2ZC4B 3G2YA 3GQZA 4JGOA 5GHYA 4UHUA 4LRYC 4Z2KA 3W97A 4F3LA 4R8PA 5JRGD 3CJMA 3HSHA 2FJ7C 3BYDA 5CPIA 3AGFA 1KX5D 3PBQA 3AFAA 3E4QA 3KYZA 5B1MB 3MVDC 5F1FA 4WZSB 2QJ5A 1FSWA 3UB9A 3R45A 2Y2OA 3WD1A 2PAVP 3IHBA 3SOIA 3H9WA 2Y59A 3VE3A 3X1UA 3B0DB 4Z2LA 1E6RA 5BPVA 5B1MC 1H8ZA 3ZVTA 2VV8A 2EX8A 2XA7M 2V1BA 3ZHHA 3MGRA 5AQ9A 2ZY4A 2VA0A 2DQNC 4Y0UA 2A2LA 5BS7C 3L29A 2W3FA 5G4ZA 4KZBA 1M1AA 3NQUA 4KGCB 3GR2A 4KGCC 2J9OA 4MN6A 2XFSA 2X02A 3MFDA 4CQHA 2KOIA 4S2NC 4NZ4A 2HIOB 1KDWA 3BLMA 4KG5A 4XUJD 2O9AA 3GECA 4S2LA 4QHCA 1VQQA 5HZHA 3RXXA 4LLOB 3DTEA 3C5AA 4H9RA 4FSFA 3EG5B 4NYYA 5AVCD 2D01A 5FUGA 3NECA 1BH9B 3KXBC 2V5OA 3NOUC 2C6WB 1P3FC 4H9PA 1YPRA 1ZHHB 3IBJA 3T4QA 1EQZB 3Q07A 3C38A 1PI5A 1KX4A 4P87A 5CP6B 3A1IA 4IJEA 1K38A 2VZWA 4GN2A 2QKPA 4IJFA 1BLSA 3LIEA 4ARZA 2LY8A 3LELB 2WKEA 3SH9A 4CAYA 3IHAA 4H6JA 2EFXA 2P7JA 1EROA 1CI9A 4WNNB 5AQAA 3LGOA 4X68A 1L0FA 5BOHA 2PU4A 5B1MD 3T4SA 3T1RA 2HF6A 4IBEA 2WKPA 4N9LA 1P3KD 2ZMVA 2CV5B 5E5AD 3CI6A 4ZBJB 2XR0A 3NBLA 3NULA 5DNMC 3W99A 4MBKA 4B4XA 4Z2HA 4G92B 3SZTA 4DKIA 4WZ5C 4E3JA 4KUDD 5CXWA 3VP1A 4CLCC 4GCZA 4E44A 5DF7A 4KZ8A 3AZJD 3R7WA 4OQ0A 3CUEC 4OQHA 1KDSA 3MF0A 2JCHA 5A93A 4DDSA 3HLCA 5HD5A 5G49B 5TJJA 5DKKA 1YU2A 3P01A 2PYOA 1Y28A 4IJGA 1W2EA 1M40A 4KUDC 3VSKA 4UA7A 4MEZA 5FSRA 3MGRB 3CZDA 4HNBA 3T4LA 3FWLA 1NZUA 4J8XD 1S32B 3X1UD 1T1AA 3T4OA 4E6XA 2IWBA 1DJBA 4C3QA 2ZM2A 3GMWA 4UA9A 4HEFA 1XJ4A 2BYKB 4HGAC 2XFTA 1YU1A 2XSSA 3ITAA 4H8RA 5EVEA 1LSXA 3P7NA 3A6NA 4JJND 2VGJA 4PM9A 5CGXA 4I3JA 1TZYA 1WYCA 3VFFA 4R8PB 3WRZA 3ZG0A 5HDCA 5CPIB 5DKLA 1FR1A 1W5DA 4LRZE 2PU2A 4JF5A 1DP6A 2B02A 1IELA 5B32G 2RIQA 2Y2QA 1NLZA 3T4TA 4U0XA 4X1MA 2G5IC 5B24B 1P3KA 5CPIC 4HBUA 5F99C 2JKRI 4KHAB 3AZGB 1P34B 5AV6B 1JFIA 3Q7VB 4OVDA 4B88A 4H9SA 4P0MA 1KE3A 1P3IB 1S32D 5HPFA 3HJKA 3O62B 5F83A 3LR4A 5JA4B 2F2AC 1U35B 1JWVA 1I2SA 3ZGAB 1PWGA 5B24A 1P3KB 2J8PA 1XXMA 3LR5A 4QY5A 4J8XA 1W1VA 2L1MA 1NRJA 5B31A 4BBVA 4MBFA 3KXBB 3P09A 4YS3C 1E6PA 4M3KA 1F66C 4XZQC 2GX5A 1S32C 4IBCA 1MWTA 2E8JA 5EVIA 4FH2A 3TRCA 2JHEA 2ZL1A 4D60A 3GRJA 5CPJA 1EQZC 1BLCA 1P3GB 2V20A 2Y2MA 3W96D 2B18A 3UMDA 3ZFZA 4CJNA 4IBDA 5B33C 2XGNA 1ESIA 1PZRA 3VP2A 3NJAA 2CV5A 2O9BA 4GS9B 3A3FA 3VE4A 4KGCD 3NY4A 2OLUA 3C1CA 1YM1A 5CTMA 5GXQC 2XF3A 4J8VA 1SCWA 3LELD 3A0RA 5GSUB 1PRQA 3U2AA 4UQIM 3V9RA 5IT5A 1XFNA 4R8PD 1F98A 3IBRA 1BH8A 2J9PA 5IS1A 1Q2QA 3ULFA 2CC1A 3B0CW 4DXCA 1PW8A 3X1TD 4E45A 3AZND 3REKA 3IX4A 5BNXA 1EI5A 1S32A 2PDRA 1N1JA 3C7UA 2A49A 2EXAA 5CHMA 4ZUXD 1P3BC 3O5YA 4S2NA 5DTTA 4L0LA 4A5RA 2HUEB 3WKJB 2RL3A 4E3NA 3FPWA 2W3GA 1R4VA 4Z2JA 1K56A 1TS6A 4F94A 3DAVA 4EBNA 1EWZA 5G49A 1AWIA 5B1LB 2ZC6B 1B67A 4NEED 3NOTC 1IYQA 4KUOA 1L0DA 5FI6A 3REJD 3Q82A 3NQUB 4KGCA 1G28A 4GNUA 3DW0A 1DRMA 1HQ3D 4KZ6A 5B2JD 2F8NA 3AV1A 4KZ4A 1H0MA 3AN2D 4WYYA 2ZQAA 1KX3A 2VV6A 2P74A 3WTPB 2PYPA 3L2AA 3MZDA 4LRXC 4XUJA 1PI4A 3DTMA 2HP5A 3SW1A 3TU4D 4IHQA 4E3KA 4I3IA 3AZJB 1F66D 4HJ6A 5DNNA 2W1TA 4P6ZM 4N1XA 3REHC 4N92A 3KSFA 1AOIB 1K54C 2OOLA 3WTPA 3AZFB 2J3WA 1XGIA 4LV0A 5A90A 4DRBA 1M18D 4KZ5A 3AZEB 1ZLAD 2QHKA 5C5KA 3X1SD 4NFTA 3UTAC 3WAAA 4Y17A 4KQRA 5DNNB 2W1TB 3X1SC 3ZG9B 1P3MA 2QJ7A 1AIWA 3KX0X 4Z66C 1GSVA 3HUOA 3P98A 1S4SA 3UT9A 3OPLA 2WUQA 1TS7A 3C1CD 2HV1A 5FASA 3HBRA 3VH6T 5HFOA 3WS4A 4WU8D 3LZ0A 4IBBA 4R4SA 1NXYA 3AV2D 1JNUA 3L26A 4PM5A 1RCJA 3REJC 2ZLYA 4OUIA 3CPTB 2QZ6A 3H82A 3REHD 3UY6A 2PHYA 4E3LA 3RXWA 3BFEA 4OPYA 3TOIA 4WF0A 3AL0C 4OQIA 5FUGB 3GV9A 3TU4C 3W96B 4ZJ1A 3FG8A 1U60A 3HONA 3AZLB 4Z2GA 1HTAA 1CI8A 4KZ9A 2VK3A 3MFXA 1Q2PA 1E15A 2LB5A 1CK7A 1O6IA 1L0EA 3AV1C 5FEFA 4JXVA 3C1CB 4H9NA 3F1PA 4GD8A 1H0GA 2XD1A 2UWXA 3VH5A 1P3AC 1U35C 2HZ5A 5HAPA 4QWOA 3VH6A 1ODVA 4H9QB 5GT0B 3REJA 4QLCB 3BFFA 1V9YA 2HP9A 3OPPA 3V39A 4LV2A 4NXGA 3D9YA 1NZOA 1KX3D 3WD3A 3UB6A 3HLEA 3EGDC 5E5AB 4X69A 5B0ZC 2W3EA 3MSHA 2NQBA 1A7WA 3AZMA 3REHA 5AQ7A 4Q0HA 1IOUA 3WKJA 1FILA 3T4JA 2XLNA 4OLGA 5F6AA 3W8KA 3WAAC 4GHIB 4GLQA 4BENA 4NE5A 3O3VA 2Y55A 3SS4A 3REIB 4HH2A 3B6FB 1T18A 1NJ4A 5FQJA 3ZG5A 2WAEA 3HUMA 3MGSA 3ZNTA 1OTBA 1PDCA 1KU5A 1GA9A 5GT3D 1M18A 1ZG4A 4WEKA 1KX3B 2PR6A 4S2MA 1YU3A 3C1BB 3WS1A 5AV9B 5B33D 4C75A 4HHDA 3WD4A 3G31A 1KX5B 2Y2NA 1OMEA 4EBLA 3D4FA 5EVIB 3MNNA 1YKDA 3MKEA 5EVID 2JN7A 4BWIA 4ZTKA 1MC0A 1CEGA 2V1AA 1LL9A 4Z5TC 1ID3D 3EWKA 4JXSA 4DF6A 4EWFA 5BT1C 3VH6W 4NZ5A 3RTYA 4FOFA 1UWNX 1WE4A 3N8LA 5HX9A 2BYMA 1K57C 5AVBB 4KUDA 3AZEA 4E6WA 4ZBJC 2NQBD 4ZBEA 4DQYB 5GLBA 5JYOA 4WU9B 2CWEA 4YM6A 4CLCE 2XH9A 3NDGA 4OJLA 3E0YA 3C4OA 3AZNB 4ID4A 1I2WA 1KX4B 2ZJ9A 5DJTA 1KGFA 3WA9C 3LZ0B 4HMDA 3DWZA 3RFBA 2V0UA 5HSQA 2HP6A 2WADA 3MGSD 4PMAA 3MVDA 3RELC 4GKUA 4EUVA 1FCOA 5CP6D 1W1TA 1WA9A 5C3IB 5FAOA 4JXWA 3QP4A 3QP2A 5HAIA 1TZYD 4MB4A 5CPKC 5CEDA 4H9QA 5GT0A 1XGJA 2NZDB 2Z2LB 3IF6C 3S7QA 3WKJC 4BJPA 1H8YA 5GHXA 4Y0OA 5F99A 2VV7A 2WKRA 4X6TA 4BLMA 4DRAA 4EQIA 2OWJA 4R0QA 2G7UA 5DNMD 1F5MA 1K54A 1A0KA 4E3MA 1BLPA 1P3KC 3CMZA 2PBYA 4Z5TB 4QNLA 5EOEA 5AVBD 4IVIA 1E3UA 5CHLB 2PT7A 3LZ1A 3T1QB 1M19B 2Y79A 3X1TB 1P3OC 1FOFA 4E04A 1OTAA 4WU9D 3F1NA 3BM6A 4OJ6A 3BJNA 1KE4A 2VKSA 5B0YC 1SHVA 3BW6A 3AFAB 3LELC 4NE6A 3TW8A 4GH9A 1FR6A 4ZRRA 2H0TA 1RGYA 3UPPA 3X1VB 1E6NA 1YLYA 3IX3A 3AV1B 3EEAA 3NQJB 4RX3A 4QY6A 3C1BC 3F1OA 4GDBA 3V50A 3REIC 3O86A 5B40A 1M19A 4MN7A 4IBJA 5CX7A 4ZJ2A 4CAYB 4LCLA 2GDNA 1CJFA 5EVIC 3X1SA 2MJ6A 3OCNA 2ZM5A 2KDKA 2NQBC 1M1AD 3G34A 4LCMA 4J8WD 5HDSA 5IU1A 2C5WB 1CK3A 4O8GA 3O62D 1BLHA 1MWRA 4CLCB 3X1VA 1JWZA 2GJ3A
chains in the Genus database with same CATH topology
3LZ0D 3HL9A 5GT3B 4LD9A 5BO0B 3B6GB 1ESUA 3W4PA 3O62C 1NY0A 3LELA 2IWDA 1ID3C 1KX5A 1ES2A 3UTBD 3G4PA 4P6BA 5CTNA 1LI0A 2EFUA 1ZC2A 5CPKA 4P85A 5B31G 5GSUC 4XUJC 3LJAD 1YMXA 3REID 5CEBA 3WS0A 1JWPA 1PZPA 4OLDA 4G91C 4ZUXB 4G91B 3HUNA 4IBFA 4EV4A 1N1JB 1MXOA 1KGGA 1Z2CB 2FFYA 3PTEA 3W98B 4DDYA 3M2KA 3VOYA 1P3GA 3VP4A 2NZDC 5B40D 4R3JA 5B32A 1RP5A 3UTBB 5KMWA 2WZZA 3UE3A 1KE0A 3MGQB 2ZQCA 4MNRA 1FSYA 3OPHA 2ZY5A 3MGPB 2ZMAA 4GB7A 4ZJ3A 4WU8B 3LZ1D 4PM6A 5HARA 5HAQA 3UT9C 1S6RA 3WKJD 1KVMA 5E2EA 5JRGC 2R9XA 4OPQA 2ZQ7A 3AZJA 1P3PD 2J8YA 1F1EA 3BFDA 4EUZA 2A3UA 3REKD 5GXQD 5DNND 5B2JB 3C7VA 4X23A 3V5MA 5HL1A 4KZ7A 4LD9C 1N9BA 4UPKA 3OCLA 5TFQA 4S2IA 3W97B 1P3IA 3MNND 4GZBA 4IBIA 2JSSA 4G92C 4XXRA 5DF9A 1ID3A 3ZG8B 5B31C 2HDUA 4Q8IA 1YU4A 4X23B 2HDQA 3RELB 5B1LD 2Y4AA 4WU8C 3NIAA 1HQ3A 3X1UB 1P3FD 1M6KA 1YLZA 3AZIA 2AROA 3N8RA 4J8UA 5FQMA 3IF6B 1P3BB 2XEPA 3FKWA 1TAFA 4WZ5A 3SH7A 2WGWA 3PBOA 3MGQA 3A3DA 1ES3A 4QD4A 1SKFA 5GT3A 4DE1A 1NYMA 4UA6A 1PW1A 1W8YA 5KSCA 4H9RB 5AV5A 3IF6A 3PBTA 3IT9A 4R3BA 4JJNC 2HIOC 2Y91A 5B1LA 5AV6C 4QLCA 3IWIA 4YINA 3MZEA 5AV8C 2WGIA 3S22A 3UN7A 1KX4C 1B6WA 2ZC7A 3WWXA 5GSUA 4WNNA 1MKIA 1TEMA 2FJ7D 4WU9A 1BH8B 3IH9A 4BD1A 3AZHC 3B6GC 5B0YA 1PZOA 5DF8A 1PYYA 1XA1A 3AZLA 1K55A 5FA7A 3LJAA 4BD0A 5FQIA 1WWIA 3VMAA 5BNXB 5BS7A 3KUYD 3W99B 5CHUA 5CERA 3AZFD 1KX4D 2Q9MA 1CEFA 3B3XA 4S2PA 2IO5B 1XP4A 3AZGA 1P34A 3AZNC 1Y54A 1O07A 3BFCA 3KWQC 2NZDD 3IF5A 2AROB 4YS3D 4OP8A 5CHJA 4LV3A 3AYWB 1K57A 4JLFA 1P3FA 2WKHA 1AOIA 1ES5A 4OONA 3GVBA 1JTDA 4Y7PA 5CPJC 1EQZA 4H9OB 3EQVA 3LJAC 3MBZA 2VQRA 3LZ1B 3VH5T 3HLDA 3X1TA 3AZIB 3ZDJA 3C4PA 2ZQDA 5AV5B 3MGQD 1WWSA 3AYWA 3IXDA 3H0RC 1G6AA 2ZD8A 1P3PA 3UT9B 4GD6A 3FKVA 4LG2A 2WGWB 3RELA 2WAFA 5CGWA 4R1GA 3QNBA 2WKIA 2HIOA 1HVBA 3IWQA 1ZLAA 3FV7A 4QLCC 4BL3A 1ALQA 1H5XA 1K4EA 5JYPA 4WU9C 4JBFA 1MWUA 3VFHA 4U3TA 3EPHA 3REJB 2G2WA 4NZ3A 4IVKA 5AVBC 2RCXA 5GT0D 4OP5A 1U35A 5EE8A 3TSGA 3C1BD 2WK0A 3UNWA 1Q9CA 2CV5C 2Z2MB 1NYYA 4J8XC 1K6SA 3AGDA 5FQKA 4KUDB 3I7JA 4IBRA 4Z2MG 5B0YD 3V9RB 3VP3A 3A6NC 4WMCD 2DRWA 1L0GA 2R9WA 2Y2KA 2HDRA 4JF4A 3AZJC 1MBLA 1SDNA 1YT4A 3HLGA 3AZNA 5CRFA 5L2FA 3RELD 2JE5A 3IXGA 3KS4A 2EX2A 1P3BD 4X23C 3R45B 2F8NB 3X1UC 2Y2LA 5AV8D 3FKEA 4H9NB 2XK1A 1VM1A 4S2KA 2HIOD 3X1TC 5AV9D 5B40B 1K56D 5AV5D 5DTSA 1BUEA 5AVCB 4E3IA 4MBHA 5TGFA 5B0YB 4PPRA 4J8UC 5FDHA 1KVLA 3A3IA 3O62A 4BQMA 3MGSB 4J8WA 2FFFB 3AV2C 3WA9B 4LV1A 1FCNA 3F6TA 3S4XA 3W96C 5GSUD 4OOMA 4MLLA 2H5SA 3W4OA 1BSGA 3N3FA 3UDFA 2AROD 3M6BA 5M18A 2FJ7B 3PBRA 1PIOA 4XZQD 5A91A 4JJNB 5HW3A 1TAFB 2PYOD 1YLTA 5KSHA 5GT3C 3FDDA 5AV8A 5FAPA 3B0BA 1YU0A 3BECA 5E2HA 3BEBA 1M1AC 3KWQB 1P3AB 4S2OA 5AVCC 3W98A 3WAAD 3G35A 5E2FA 3WAAB 4JJNA 1K25A 3L28A 1XKZA 3HLWA 1P3PB 4XUZA 3VSLA 1I5QA 1ULYA 5FI7A 5B2JC 3LCEA 3M6HA 2RVQC 3REKC 5GXQB 3KXBA 1IYPA 1P3PC 3ITBA 3LY4A 3G32A 3HLBA 4NK3A 2Y2IA 3B6GD 3KFUG 3PBNA 2EX9A 1W8QA 1P3BA 2QMIA 5AV9C 5CGSA 1P3AD 4YM6B 3AZMC 3DWKA 4O7DA 1YQSA 3AZIC 3VH5W 3Q81A 5AY8C 3LZ1C 3WTPD 3TG9A 1Z6FA 2OV5A 2WZXA 5B0ZD 1AOIC 3WA9A 5GXQA 2JBFA 3B0CT 4RX2A 4X23D 1KX3C 4XUXA 4DXBA 3AZGD 1P34D 1FCMA 3AGEA 1IKIA 2DCFA 1TZYB 2F8NG 3A3EA 4KQQA 1GHMA 4JF6A 5CP6C 4K0WA 4R4RA 2YFWB 5KDMB 1HTZA 1M1AB 1P3FB 5E2GA 1BTLA 4WU8A 2CV5D 5B24C 2ZC3B 1LL5A 1JFIB 4WMCA 5FQ9A 3MNNB 3WTPE 2X01A 3UTBC 3Q1FA 1P3MC 3LJAB 2EXBA 3IQAA 3L25A 1IYSA 1W79A 5M19A 4K91A 1P3LA 1WYBA 3ZG7B 3SH8A 1ERQA 2J7VA 3LZ0C 4X55A 4RVAA 5BO0A 4YM6C 3C1CC 5DVAA 1SDEA 4Z5TD 1IYOA 3E2KA 1P3OB 4DE3A 1GCEA 5CPKB 1RGZA 4GDNA 3A1KA 1BH9A 4GOGA 1HD8A 3W96A 5AY8A 4LD9D 4CSRA 1HQ3B 4ZAMA 1H3OB 5BNVA 4QB8A 3W99C 4WM9A 3X1VD 3B6GA 1QMFA 2G5HC 4NETA 1K55C 5GLDA 1P3AA 4WEJA 3UTAA 1TDGA 4WZ4A 3H0LC 2EX6A 1P3LD 3REKB 4BL2A 3WX7A 2F8NK 3OPRA 1DJCA 3H0MC 4OJ5A 3AN2C 3NI9A 4E3OA 1PWDA 1ZLAB 3PBSA 3KUYC 5J8XA 3MVDD 1MPLA 3MVDB 4IBXA 3LO7A 3NDEA 1XX2A 5EOOA 4YS3B 3AZKD 3OC2A 1TZYC 2ZQ9A 4NE3A 3A6ND 3BLSA 1MY8A 2NZDA 2PYOB 5B32B 2BLSA 3Q7ZA 4DE2A 2IO5C 1GHPA 3S1YA 1F66B 3UT9D 1M19C 4ZUXC 4RYEA 4N1HA 3UPNA 5E5AC 3O88A 3WTPC 4OQGA 5AY8D 4FH4A 3AYWC 3LEZA 1P3LC 5AQBA 1EQZD 1BT5A 5JRGA 1KGEA 5AVCA 4R8PC 4N9KA 1N4OA 1JTGA 4J8UB 2QPNA 3IH8A 5B2IA 3AZLD 1E4DA 5FATA 1ES4A 5C3IC 4EBPA 2RVQD 1AXBA 3AV2B 5B0ZA 1H3OA 4Z5TA 2BYKA 3O87A 1XPBA 5CP6A 2Y2JA 2HDSA 3IXBA 4RA7A 1TVFA 2F8NH 5B32D 3W98C 5F82A 3MGQC 1IKGA 2VGKA 3AZHB 3FYZA 3IWOA 1P3IC 4PM7A 1M18C 1GA0A 1ID3B 5F99D 4WV4B 3G2ZA 5CPJD 5F1GA 5AY8B 3W4QA 4Z2MH 3BRMA 3V3RA 1O7EA 5BNVB 4K0XA 2WYXA 4H9OA 3C1BA 4KHAA 2B5RA 5GLCA 3WRTA 5AV6A 3IXHA 5I94A 4J8WC 5EECA 4J8UD 3M2JA 3AN2A 1ZG6A 5G18A 4XZQB 3MNNC 1YUEA 3MZFA 1ERMA 3KS8A 1S0WA 3B6FD 3AYWD 4OPZA 1YMSA 3ZNYA 4H9PB 1E25A 2E8IA 5AV8B 3BFGA 4ZUXA 3L27A 1F66A 1K6RA 1ONHA 2H0YA 3AZFC 3ISGA 2P9VA 2BYMB 4IEDA 1M19D 5B31B 2DF4C 1QMEA 3TU4B 3MGRC 1J9MA 1W7FA 5A92A 5EVLA 3AZEC 5B33A 1YLJA 4D2OA 3AZHD 3ZCZA 1P3OD 3E2LA 3AZKC 2HUEC 4QU3A 5GHZA 3MGRD 3EPKA 4NYUA 1BFMA 4OPRA 4OOYA 4B4ZA 2V2FF 3GTCA 1XA7A 2P9VB 2ZY3A 2Y2HA 3PAGA 3TU4A 4Z66B 3N7WA 5GT0C 1M18B 3G30A 4NZ1A 4CPKA 2XD5A 4KENB 2YFVA 1LLBA 5CPKD 4HBTA 5JRGB 4AWLB 3UE1A 5M1AA 3REIA 1FQGA 4Z9QA 5F99B 2FJ7A 4FCFA 2Y2GA 4YFMA 2HPBA 3MGSC 3N4IA 1P3LB 3X1VC 1HZOA 2OSUA 3WA9D 1TDLA 4X53A 3QHYA 2V1ZA 5BT1D 3AZMB 3REHB 2G2UA 2H10A 3HVFA 5GL9A 5TR7A 3B6FC 3P5JB 1P3GD 1P3OA 1P3ID 4EO5C 2L5AA 3MXSA 2ZC5B 1ZLAC 3W98D 5B2IB 4R23A 1DJAA 3KSYA 4Y0TA 2WGVA 5B0ZB 2W8SA 1LI9A 4XUJB 2PYOC 5AVBA 2ZM0A 3KXBD 4OJPA 3Q7VA 1E3UD 3JYIA 4OOLA 4H9SC 3CG5A 3W97D 2ZY2A 2AROC 2XQZA 2JC7A 3MKFA 3N6IA 4WELA 5B32C 3AFAD 1YLPA 4FD8A 1YLWA 5EPHA 5JA4A 3RJUA 3PAEA 5B24D 1C3BA 3SS3A 4LENA 4S2JA 5D3OA 4J8XB 4JXGA 3AZLC 1KX5C 3NC8A 5B33B 3IP4C 3AN2B 3HLFA 2Y2PA 1GHIA 1T3UA 3GSGA 5AV5C 1U35D 2I72A 3KWQD 5B1MA 4DE0A 4KG6A 3AZGC 1P34C 2YFWA 5KDMA 5KZHA 4M6BA 4U0TA 3UE0A 1MWSA 3AV1D 2IWCA 5E5AA 5EUAA 5DNMA 3EPLA 4JPMA 3NQJA 3AZID 5AV6D 3AZMD 1PWCA 4C6YA 5B40C 2Q9NA 3WS5A 1DY6A 3UTBA 3UO9A 3EQUA 3QNCA 3B0DC 2DNSA 3ZVWA 5B2ID 4OJOA 3AZED 4DRTA 3B6FA 3SS5A 4IBGA 3VOZA 4J8WB 4WJ3C 5DNMB 5IHVA 4GHLA 4LD9B 3AFAC 1NRFA 3A6NB 3AZHA 3KWQA 4GHAA 3W97C 2X71A 3MGPD 4PM8A 1P3MB 4J8VC 1BZAA 4QLCD 3WS2A 3V3SA 3AV2A 4ZDXA 1BULA 3W99D 1IEMA 4OKPA 2ZM8A 3LY3A 3UDIA 3HREA 4J8VD 2BG1A 4J8VB 4QJGA 4Z66D 4KQOA 4KG2A 3MGPC 2OLVA 1ONGA 3X1SB 1L2SA 3UTAD 5FAQA 3UTAB 1K4FA 1ZKJA 1P3GC 3EPJA 1LHYA 4HGAB 4HESA 3AZKB 3FZCA 4WBGA 3KUYA 5FI2A 2IOUA 5U47A 5CPID 4YM6D 3NCKA 4KZAA 4IBKA 4UUZB 5E43A 2ZQ8A 3AZFA 1HQ3C 4NY2A 5AV9A 5DNNC 3OZHA 5B1LC 4OH0A 5DTKA 4UAAA 5B31D 5FQQA 2XDMA 3A3JA 1P3MD 4EO5B 4YS3A 3UDXA 3AZKA 4AWLC 3KUYB 5CPJB 4UUZA 5CECA 4CSRB 3MXRA 3MGPA 1AOID 5B2JA 2F8ND 1JVJA 3N8SA 4Z66A 1G68A 4X56A 3UPOA 2NQBB 4JKTA 4KZ3A 5GLAA 3VP0A 4XZQA 5B2IC 3GQZA 2YFVB 2ZC4B 5GHYA 3G2YA 4UHUA 3W97A 4R8PA 5JRGD 3CJMA 3HSHA 2FJ7C 3BYDA 5CPIA 3AGFA 1KX5D 3PBQA 3AFAA 5B1MB 3MVDC 5F1FA 4WZSB 1FSWA 3R45A 2Y2OA 3IHBA 3SOIA 2Y59A 3X1UA 3B0DB 5BPVA 5B1MC 1H8ZA 3ZVTA 2EX8A 3ZHHA 3MGRA 5AQ9A 2ZY4A 2DQNC 4Y0UA 5BS7C 3L29A 4KZBA 1M1AA 3NQUA 4KGCB 3GR2A 4KGCC 2J9OA 2XFSA 2X02A 3MFDA 4S2NC 4NZ4A 2HIOB 1KDWA 3BLMA 4KG5A 4XUJD 4S2LA 4QHCA 1VQQA 3RXXA 3C5AA 4H9RA 4FSFA 3EG5B 4NYYA 5AVCD 5FUGA 1BH9B 3KXBC 2C6WB 1P3FC 4H9PA 1EQZB 3Q07A 1PI5A 1KX4A 4P87A 5CP6B 3A1IA 4IJEA 1K38A 4GN2A 4IJFA 1BLSA 2LY8A 3LELB 2WKEA 3SH9A 4CAYA 3IHAA 2EFXA 1EROA 1CI9A 4WNNB 5AQAA 4X68A 1L0FA 5BOHA 2PU4A 5B1MD 4IBEA 4N9LA 1P3KD 2CV5B 5E5AD 4ZBJB 3NBLA 2XR0A 5DNMC 3W99A 4MBKA 4B4XA 4G92B 4DKIA 4WZ5C 4E3JA 4KUDD 5CXWA 3VP1A 4E44A 5DF7A 4KZ8A 3AZJD 4OQ0A 4OQHA 1KDSA 2JCHA 5A93A 4DDSA 3HLCA 5G49B 1YU2A 2PYOA 1W2EA 1M40A 4KUDC 3VSKA 4UA7A 4MEZA 5FSRA 3MGRB 3CZDA 3FWLA 1NZUA 4J8XD 1S32B 3X1UD 4E6XA 2IWBA 1DJBA 4C3QA 2ZM2A 3GMWA 4UA9A 4HEFA 2BYKB 4HGAC 2XFTA 1YU1A 3ITAA 4H8RA 3A6NA 4JJND 2VGJA 4PM9A 5CGXA 1TZYA 1WYCA 3VFFA 4R8PB 3WRZA 3ZG0A 5CPIB 1FR1A 1W5DA 2PU2A 4JF5A 1IELA 5B32G 2RIQA 2Y2QA 4U0XA 2G5IC 5B24B 1P3KA 5CPIC 4HBUA 5F99C 4KHAB 3AZGB 1P34B 5AV6B 1JFIA 3Q7VB 4OVDA 4B88A 4H9SA 4P0MA 1KE3A 1P3IB 1S32D 3O62B 5F83A 5JA4B 2F2AC 1U35B 1JWVA 1I2SA 3ZGAB 1PWGA 5B24A 1P3KB 2J8PA 1XXMA 4QY5A 4J8XA 5B31A 4MBFA 3KXBB 3P09A 4YS3C 4M3KA 1F66C 4XZQC 1S32C 4IBCA 1MWTA 5EVIA 4FH2A 3GRJA 5CPJA 1EQZC 1BLCA 1P3GB 2V20A 2Y2MA 3W96D 3ZFZA 4CJNA 4IBDA 5B33C 2XGNA 1ESIA 1PZRA 3VP2A 2CV5A 3A3FA 4KGCD 3NY4A 2OLUA 3C1CA 1YM1A 5CTMA 5GXQC 2XF3A 4J8VA 1SCWA 3LELD 5GSUB 3V9RA 4R8PD 1BH8A 2J9PA 1Q2QA 4DXCA 2CC1A 3B0CW 1PW8A 3X1TD 4E45A 3AZND 3REKA 5BNXA 1EI5A 1S32A 1N1JA 3C7UA 2A49A 2EXAA 5CHMA 4ZUXD 1P3BC 4S2NA 5DTTA 4L0LA 4A5RA 2HUEB 3WKJB 2RL3A 4E3NA 1R4VA 1K56A 4F94A 4EBNA 1EWZA 5G49A 5B1LB 2ZC6B 1B67A 1IYQA 1L0DA 5FI6A 3REJD 3Q82A 3NQUB 4KGCA 4GNUA 3DW0A 4KZ6A 1HQ3D 5B2JD 2F8NA 3AV1A 4KZ4A 3AN2D 4WYYA 2ZQAA 1KX3A 2P74A 3WTPB 3L2AA 3MZDA 4XUJA 1PI4A 3DTMA 2HP5A 3TU4D 4E3KA 3AZJB 1F66D 5DNNA 4N1XA 3REHC 4N92A 1AOIB 1K54C 3WTPA 3AZFB 1XGIA 4LV0A 5A90A 4DRBA 1M18D 4KZ5A 3AZEB 1ZLAD 3X1SD 4NFTA 3UTAC 3WAAA 4KQRA 5DNNB 3ZG9B 3X1SC 1P3MA 4Z66C 3HUOA 3P98A 3UT9A 3OPLA 2WUQA 3C1CD 5FASA 3HBRA 3VH6T 5HFOA 3WS4A 4WU8D 3LZ0A 4IBBA 4R4SA 1NXYA 3AV2D 3L26A 4PM5A 1RCJA 3REJC 2ZLYA 4OUIA 2QZ6A 3REHD 3UY6A 4E3LA 3RXWA 3BFEA 4OPYA 3TOIA 3AL0C 4OQIA 5FUGB 3GV9A 3TU4C 3W96B 4ZJ1A 1U60A 3HONA 3AZLB 1HTAA 1CI8A 4KZ9A 1Q2PA 1L0EA 3AV1C 4JXVA 3C1CB 4H9NA 4GD8A 2XD1A 2UWXA 3VH5A 1P3AC 1U35C 5HAPA 3VH6A 4H9QB 5GT0B 3REJA 4QLCB 3BFFA 2HP9A 3OPPA 3V39A 4LV2A 1NZOA 1KX3D 3HLEA 5E5AB 4X69A 5B0ZC 2NQBA 1A7WA 3AZMA 3REHA 5AQ7A 3WKJA 2XLNA 4OLGA 3W8KA 3WAAC 4BENA 4NE5A 3O3VA 2Y55A 3SS4A 3REIB 3B6FB 1NJ4A 5FQJA 3ZG5A 2WAEA 3HUMA 3MGSA 3ZNTA 1KU5A 1GA9A 5GT3D 1M18A 1ZG4A 4WEKA 1KX3B 4S2MA 1YU3A 3C1BB 3WS1A 5AV9B 5B33D 4C75A 3G31A 1KX5B 2Y2NA 1OMEA 4EBLA 3D4FA 5EVIB 3MNNA 3MKEA 5EVID 4ZTKA 1CEGA 1LL9A 4Z5TC 1ID3D 4JXSA 4DF6A 4EWFA 5BT1C 3VH6W 4NZ5A 1WE4A 3N8LA 5HX9A 2BYMA 1K57C 5AVBB 4KUDA 3AZEA 4E6WA 4ZBJC 2NQBD 4ZBEA 4DQYB 5GLBA 5JYOA 4WU9B 2CWEA 4YM6A 2XH9A 3NDGA 4OJLA 3C4OA 3AZNB 4ID4A 1I2WA 1KX4B 2ZJ9A 1KGFA 3WA9C 3LZ0B 3DWZA 2HP6A 2WADA 3MGSD 4PMAA 3MVDA 3RELC 4GKUA 1FCOA 5CP6D 5C3IB 5FAOA 4JXWA 5HAIA 1TZYD 5CPKC 5CEDA 4H9QA 5GT0A 1XGJA 2NZDB 2Z2LB 3IF6C 3WKJC 4BJPA 1H8YA 5GHXA 4Y0OA 5F99A 4X6TA 4BLMA 4DRAA 4EQIA 4R0QA 5DNMD 1K54A 4E3MA 1BLPA 1P3KC 3CMZA 2PBYA 4Z5TB 4QNLA 5EOEA 5AVBD 4IVIA 1E3UA 5CHLB 3LZ1A 1M19B 3X1TB 1P3OC 1FOFA 4WU9D 3BM6A 4OJ6A 1KE4A 5B0YC 1SHVA 3AFAB 3LELC 4NE6A 4GH9A 1FR6A 2H0TA 1RGYA 3UPPA 3X1VB 1YLYA 3AV1B 3NQJB 4RX3A 4QY6A 3C1BC 4GDBA 3V50A 3REIC 3O86A 5B40A 1M19A 4IBJA 4ZJ2A 4CAYB 4LCLA 2GDNA 5EVIC 3X1SA 3OCNA 2ZM5A 2NQBC 1M1AD 3G34A 4LCMA 4J8WD 2C5WB 1CK3A 3O62D 1BLHA 1MWRA 3X1VA 1JWZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DJA A;  1JWV A;  5FAP A;  4Y0T A;  3HL9 A;  2WGV A;  1I2S A;  3ZGA B;  1PWG A;  3BEC A;  1XXM A;  5E2H A;  1ESU A;  1LI9 A;  4QY5 A;  3W4P A;  1NY0 A;  2ZM0 A;  3BEB A;  2IWD A;  3Q7V A;  4MBF A;  3P09 A;  1E3U D;  4M3K A;  1ES2 A;  3G4P A;  3JYI A;  4P6B A;  4S2O A;  5CTN A;  1LI0 A;  1MWT A;  2EFU A;  3G35 A;  5E2F A;  4OOL A;  1ZC2 A;  4FH2 A;  3CG5 A;  5EVI A;  2XQZ A;  3GRJ A;  1K25 A;  1BLC A;  2JC7 A;  2V20 A;  3MKF A;  3N6I A;  4WEL A;  4P85 A;  1XKZ A;  2Y2M A;  3HLW A;  1YLP A;  4FD8 A;  1YLW A;  1YMX A;  5EPH A;  3ZFZ A;  4CJN A;  3RJU A;  5CEB A;  3PAE A;  3WS0 A;  1JWP A;  2XGN A;  1ESI A;  1PZP A;  4OLD A;  4XUZ A;  3VP2 A;  1C3B A;  3VSL A;  3SS3 A;  4LEN A;  4S2J A;  3A3F A;  3HUN A;  1I5Q A;  5FI7 A;  5D3O A;  3M6H A;  3LCE A;  3NY4 A;  4EV4 A;  2OLU A;  1MXO A;  1KGG A;  1YM1 A;  4JXG A;  2XF3 A;  5CTM A;  1SCW A;  1IYP A;  2FFY A;  3PTE A;  3ITB A;  3LY4 A;  3NC8 A;  3G32 A;  4DDY A;  3HLB A;  4NK3 A;  3HLF A;  2Y2I A;  2Y2P A;  3M2K A;  1GHI A;  3PBN A;  2EX9 A;  2J9P A;  3VOY A;  3GSG A;  3VP4 A;  1Q2Q A;  1W8Q A;  2CC1 A;  4DXC A;  2QMI A;  5CGS A;  1PW8 A;  2I72 A;  4R3J A;  3DWK A;  1RP5 A;  5KMW A;  2WZZ A;  4O7D A;  3UE3 A;  1YQS A;  1KE0 A;  4DE0 A;  4KG6 A;  2ZQC A;  3Q81 A;  4MNR A;  1FSY A;  1EI5 A;  3OPH A;  5KZH A;  4U0T A;  3TG9 A;  1MWS A;  3UE0 A;  2ZMA A;  1Z6F A;  3C7U A;  2WZX A;  2OV5 A;  2IWC A;  4GB7 A;  5EUA A;  2A49 A;  2EXA A;  2JBF A;  4ZJ3 A;  4RX2 A;  5CHM A;  4JPM A;  4DXB A;  4PM6 A;  4XUX A;  4S2N A;  5DTT A;  1FCM A;  3AGE A;  4L0L A;  1IKI A;  5HAR A;  4A5R A;  5HAQ A;  2RL3 A;  1S6R A;  4E3N A;  1PWC A;  1KVM A;  2DCF A;  5E2E A;  4C6Y A;  2Q9N A;  1K56 A;  2R9X A;  3WS5 A;  3A3E A;  4OPQ A;  4F94 A;  4KQQ A;  1DY6 A;  1GHM A;  4EBN A;  3UO9 A;  1EWZ A;  3EQU A;  3QNC A;  4JF6 A;  2DNS A;  2ZC6 B;  2ZQ7 A;  3ZVW A;  4K0W A;  4R4R A;  4DRT A;  3SS5 A;  2J8Y A;  1IYQ A;  3BFD A;  1L0D A;  4EUZ A;  2A3U A;  1HTZ A;  3VOZ A;  5FI6 A;  3Q82 A;  4GNU A;  3C7V A;  3DW0 A;  4KZ6 A;  5E2G A;  1BTL A;  5IHV A;  3V5M A;  4KZ4 A;  5HL1 A;  4WYY A;  2ZQA A;  4KZ7 A;  2P74 A;  1N9B A;  3OCL A;  3MZD A;  5TFQ A;  2ZC3 B;  4S2I A;  1LL5 A;  1PI4 A;  3DTM A;  2HP5 A;  1NRF A;  4WMC A;  4E3K A;  5FQ9 A;  2X71 A;  4GZB A;  2X01 A;  3Q1F A;  4PM8 A;  2EXB A;  4XXR A;  5DF9 A;  4N1X A;  3IQA A;  3ZG8 B;  1IYS A;  1BZA A;  1W79 A;  2HDU A;  4N92 A;  4Q8I A;  2HDQ A;  4K91 A;  3WS2 A;  5M19 A;  3V3S A;  1WYB A;  2Y4A A;  3ZG7 B;  1K54 C;  3SH8 A;  4ZDX A;  1BUL A;  1ERQ A;  1IEM A;  2J7V A;  3NIA A;  4X55 A;  4OKP A;  1XGI A;  2ZM8 A;  4RVA A;  3LY3 A;  3UDI A;  3HRE A;  4LV0 A;  5A90 A;  1M6K A;  2BG1 A;  5DVA A;  4QJG A;  1SDE A;  4KQO A;  1IYO A;  1YLZ A;  3E2K A;  4KZ5 A;  4KG2 A;  2OLV A;  4DE3 A;  1ONG A;  1GCE A;  3N8R A;  1L2S A;  5FAQ A;  4KQR A;  3ZG9 B;  5FQM A;  1K4F A;  1ZKJ A;  1LHY A;  4HES A;  1RGZ A;  4GDN A;  3IF6 B;  3FZC A;  2XEP A;  4WBG A;  3FKW A;  5FI2 A;  3HUO A;  3P98 A;  4GOG A;  1HD8 A;  4WZ5 A;  5U47 A;  3SH7 A;  3OPL A;  2WUQ A;  2WGW A;  5FAS A;  3HBR A;  3NCK A;  3PBO A;  4KZA A;  3A3D A;  5HFO A;  5E43 A;  2ZQ8 A;  4ZAM A;  1ES3 A;  4QD4 A;  1SKF A;  4QB8 A;  3WS4 A;  4DE1 A;  4R4S A;  1NXY A;  1NYM A;  4WM9 A;  4UA6 A;  4PM5 A;  1RCJ A;  3OZH A;  2ZLY A;  4OH0 A;  1QMF A;  5DTK A;  1PW1 A;  4UAA A;  1W8Y A;  2QZ6 A;  5KSC A;  4NET A;  5FQQ A;  2XDM A;  3UY6 A;  1K55 C;  5GLD A;  3A3J A;  4E3L A;  4WEJ A;  3RXW A;  3BFE A;  4OPY A;  3TOI A;  1TDG A;  3UDX A;  4OQI A;  3IF6 A;  3PBT A;  3IT9 A;  4WZ4 A;  3GV9 A;  4R3B A;  2Y91 A;  2EX6 A;  4ZJ1 A;  1U60 A;  4BL2 A;  5CEC A;  3MXR A;  3IWI A;  4YIN A;  3MZE A;  2WGI A;  1CI8 A;  4KZ9 A;  3OPR A;  3S22 A;  3UN7 A;  1DJC A;  3NI9 A;  1Q2P A;  4E3O A;  1PWD A;  1L0E A;  2ZC7 A;  3PBS A;  1JVJ A;  4JXV A;  3N8S A;  1G68 A;  3WWX A;  4X56 A;  5J8X A;  3UPO A;  4JKT A;  4GD8 A;  1MPL A;  4KZ3 A;  5GLA A;  2XD1 A;  4IBX A;  3VP0 A;  3LO7 A;  3NDE A;  1XX2 A;  2UWX A;  5EOO A;  1MKI A;  1TEM A;  3GQZ A;  2ZC4 B;  5GHY A;  3G2Y A;  3OC2 A;  4UHU A;  5HAP A;  2ZQ9 A;  3IH9 A;  4BD1 A;  3CJM A;  3BYD A;  3BLS A;  1MY8 A;  1PZO A;  5DF8 A;  1PYY A;  1XA1 A;  3AGF A;  3PBQ A;  2BLS A;  3BFF A;  3Q7Z A;  4DE2 A;  1K55 A;  5FA7 A;  2HP9 A;  3OPP A;  1GHP A;  3S1Y A;  3V39 A;  4LV2 A;  4BD0 A;  5F1F A;  5FQI A;  3VMA A;  1FSW A;  1NZO A;  2Y2O A;  4RYE A;  4N1H A;  5CHU A;  3HLE A;  5CER A;  3UPN A;  3IHB A;  4X69 A;  3SOI A;  2Q9M A;  3O88 A;  1CEF A;  2Y59 A;  4OQG A;  3B3X A;  4S2P A;  4FH4 A;  5AQ7 A;  1XP4 A;  3LEZ A;  5AQB A;  1Y54 A;  1H8Z A;  1O07 A;  2XLN A;  3ZVT A;  3BFC A;  4OLG A;  1BT5 A;  3IF5 A;  1KGE A;  3W8K A;  2EX8 A;  4BEN A;  3O3V A;  2Y55 A;  4N9K A;  3SS4 A;  1N4O A;  1JTG A;  4OP8 A;  3ZHH A;  5AQ9 A;  5CHJ A;  2QPN A;  4LV3 A;  3IH8 A;  1NJ4 A;  4Y0U A;  1E4D A;  5FQJ A;  3ZG5 A;  1K57 A;  5FAT A;  1ES4 A;  2WAE A;  3HUM A;  4JLF A;  4KZB A;  4EBP A;  3GR2 A;  3ZNT A;  1AXB A;  2WKH A;  1ES5 A;  2J9O A;  4OON A;  3GVB A;  1GA9 A;  2XFS A;  2X02 A;  1JTD A;  3MFD A;  4S2N C;  1ZG4 A;  4WEK A;  4Y7P A;  4S2M A;  3O87 A;  1XPB A;  3EQV A;  3WS1 A;  4C75 A;  2HDS A;  2Y2J A;  3IXB A;  4RA7 A;  1KDW A;  3BLM A;  1TVF A;  3MBZ A;  4KG5 A;  3HLD A;  4S2L A;  3G31 A;  4QHC A;  5F82 A;  2Y2N A;  1IKG A;  1VQQ A;  2VGK A;  3ZDJ A;  3RXX A;  1OME A;  4EBL A;  3D4F A;  5EVI B;  3FYZ A;  3C4P A;  3IWO A;  3MKE A;  5EVI D;  2ZQD A;  3C5A A;  4FSF A;  4ZTK A;  4PM7 A;  1CEG A;  3IXD A;  1LL9 A;  1GA0 A;  2ZD8 A;  1G6A A;  4JXS A;  4DF6 A;  3G2Z A;  4GD6 A;  2C6W B;  3FKV A;  2WGW B;  5F1G A;  4EWF A;  3W4Q A;  2WAF A;  5CGW A;  3BRM A;  3V3R A;  4R1G A;  1O7E A;  3QNB A;  2WKI A;  4K0X A;  3Q07 A;  2WYX A;  1PI5 A;  4P87 A;  1WE4 A;  1HVB A;  1K38 A;  3IWQ A;  3N8L A;  5HX9 A;  3FV7 A;  2B5R A;  5GLC A;  3WRT A;  4BL3 A;  4GN2 A;  1K57 C;  3IXH A;  1BLS A;  2WKE A;  3SH9 A;  5I94 A;  5EEC A;  3IHA A;  3M2J A;  1ZG6 A;  2EFX A;  4E6W A;  1ALQ A;  5G18 A;  1H5X A;  1ERO A;  1K4E A;  4ZBE A;  5GLB A;  1CI9 A;  5JYP A;  5JYO A;  3MZF A;  5AQA A;  1ERM A;  4X68 A;  1L0F A;  4JBF A;  5BOH A;  1MWU A;  2PU4 A;  3VFH A;  1S0W A;  2XH9 A;  3NDG A;  4U3T A;  2G2W A;  4IVK A;  3C4O A;  4N9L A;  4OPZ A;  1YMS A;  3ZNY A;  2RCX A;  4ID4 A;  4OP5 A;  5EE8 A;  1E25 A;  2E8I A;  3TSG A;  2WK0 A;  3BFG A;  3UNW A;  1I2W A;  2XR0 A;  1K6R A;  3NBL A;  1ONH A;  2H0Y A;  2ZJ9 A;  2Z2M B;  1NYY A;  1KGF A;  3DWZ A;  2P9V A;  3ISG A;  4MBK A;  4B4X A;  4IED A;  1K6S A;  3AGD A;  2HP6 A;  5FQK A;  4DKI A;  2WAD A;  3I7J A;  1QME A;  4PMA A;  4IBR A;  4WZ5 C;  4E3J A;  5CXW A;  4GKU A;  1J9M A;  1W7F A;  5A92 A;  3VP1 A;  1FCO A;  5EVL A;  1YLJ A;  5DF7 A;  4D2O A;  4KZ8 A;  3VP3 A;  5FAO A;  4JXW A;  4OQ0 A;  4WMC D;  4OQH A;  1KDS A;  2JCH A;  2DRW A;  5HAI A;  1L0G A;  4DDS A;  3ZCZ A;  2R9W A;  5A93 A;  2Y2K A;  3HLC A;  5CED A;  2HDR A;  4JF4 A;  1XGJ A;  1MBL A;  1SDN A;  1YT4 A;  2Z2L B;  3E2L A;  3HLG A;  3IF6 C;  4QU3 A;  5GHZ A;  5CRF A;  5L2F A;  1M40 A;  2JE5 A;  4UA7 A;  3VSK A;  4BJP A;  1H8Y A;  4MEZ A;  5FSR A;  3IXG A;  4Y0O A;  5GHX A;  3CZD A;  4OOY A;  4OPR A;  4X6T A;  2EX2 A;  4BLM A;  3FWL A;  4B4Z A;  2V2F F;  4EQI A;  1NZU A;  3GTC A;  1XA7 A;  4R0Q A;  2P9V B;  2Y2H A;  4E6X A;  2IWB A;  1DJB A;  3PAG A;  1K54 A;  4C3Q A;  2ZM2 A;  3GMW A;  4E3M A;  2Y2L A;  1BLP A;  3CMZ A;  3N7W A;  4UA9 A;  4HEF A;  2PBY A;  2XK1 A;  3G30 A;  5EOE A;  1VM1 A;  4IVI A;  1E3U A;  2XFT A;  4CPK A;  3ITA A;  4H8R A;  2XD5 A;  4KEN B;  4S2K A;  2VGJ A;  4PM9 A;  5CGX A;  1K56 D;  1LLB A;  4HBT A;  1FOF A;  1WYC A;  5DTS A;  1BUE A;  4E3I A;  3VFF A;  4MBH A;  3WRZ A;  3ZG0 A;  3UE1 A;  5TGF A;  3BM6 A;  4PPR A;  5M1A A;  1FQG A;  4Z9Q A;  1KE4 A;  4FCF A;  1SHV A;  2Y2G A;  4YFM A;  5FDH A;  1FR1 A;  1W5D A;  2HPB A;  1KVL A;  2PU2 A;  3A3I A;  3N4I A;  4JF5 A;  4BQM A;  1FR6 A;  1IEL A;  1HZO A;  2H0T A;  2FFF B;  1RGY A;  3UPP A;  2Y2Q A;  4LV1 A;  1FCN A;  2OSU A;  1TDL A;  1YLY A;  4X53 A;  3QHY A;  4RX3 A;  4QY6 A;  4U0X A;  2V1Z A;  2G2U A;  2H10 A;  4GDB A;  4HBU A;  3HVF A;  3S4X A;  3V50 A;  5GL9 A;  3O86 A;  4OOM A;  5TR7 A;  4MLL A;  2H5S A;  3W4O A;  4ZJ2 A;  1BSG A;  3Q7V B;  4LCL A;  4OVD A;  4B88 A;  2GDN A;  5EVI C;  3UDF A;  3M6B A;  4P0M A;  1KE3 A;  3MXS A;  5M18 A;  2ZC5 B;  3OCN A;  3PBR A;  1PIO A;  5A91 A;  5HW3 A;  3G34 A;  4LCM A;  5F83 A;  2C5W B;  1CK3 A;  1BLH A;  1MWR A;  1YLT A;  4R23 A;  1JWZ A;  5KSH A; 
#chains in the Genus database with same CATH topology
 3LZ0 D;  2XA7 S;  3B42 A;  4Y3I A;  3HL9 A;  2VGL S;  3PXP A;  5GT3 B;  2DMW A;  4I38 A;  4LD9 A;  4K08 A;  5BO0 B;  2CMN A;  3B6G B;  1ESU A;  3W4P A;  3O62 C;  1NY0 A;  1OPX A;  2NUP C;  3LEL A;  2IWD A;  1ID3 C;  2JKT M;  1KX5 A;  3CIT A;  1ES2 A;  3UTB D;  3G4P A;  4P6B A;  5CTN A;  5J4E A;  1LI0 A;  2EFU A;  1ZC2 A;  5CPK A;  4P85 A;  5B31 G;  5GSU C;  4XUJ C;  1LL8 A;  3LJA D;  1YMX A;  3REI D;  2M7U A;  5CEB A;  3WS0 A;  1JWP A;  1PZP A;  2O9C A;  4OLD A;  4G91 C;  3DTK A;  4ZUX B;  4G91 B;  3HUN A;  4IBF A;  4HMC A;  4EV4 A;  1N1J B;  1MXO A;  1KGG A;  4FTX A;  1Z2C B;  4Y2F A;  2FFY A;  3PTE A;  4EXO A;  3W98 B;  4DDY A;  4B9O A;  3M7P A;  3M2K A;  3A0V A;  3VOY A;  1P3G A;  3VP4 A;  2NZD C;  5B40 D;  4R3J A;  2BTF P;  5B32 A;  1RP5 A;  3UTB B;  5KMW A;  2WZZ A;  4YOF A;  3UE3 A;  3LI9 A;  1KE0 A;  3MGQ B;  2ZQC A;  4MNR A;  4GS9 A;  1FSY A;  3OPH A;  4PHT A;  2ZY5 A;  3MGP B;  1W63 M;  2ZMA A;  1OJ5 A;  5HL6 A;  2B95 A;  4GB7 A;  5HD3 A;  4ZJ3 A;  4WU8 B;  3LZ1 D;  1YAX A;  4PKY A;  4PM6 A;  5HAR A;  5HAQ A;  3UT9 C;  1G6O A;  1OGG A;  4HY8 A;  1Y4O A;  5F69 A;  1S6R A;  1J7M A;  3WKJ D;  5KIZ A;  1KVM A;  5E2E A;  4YWZ A;  5JRG C;  2R9X A;  3CUE A;  4G3W A;  4OPQ A;  2PR5 A;  2ZQ7 A;  3HJI A;  3AZJ A;  1P3P D;  2J8Y A;  3MXQ A;  1F1E A;  3BFD A;  4EUZ A;  2A3U A;  3REK D;  5GXQ D;  2I9V A;  5DNN D;  2VLG A;  2GNX A;  3LR0 A;  5B2J B;  3C7V A;  4X23 A;  4Z1W A;  3V5M A;  5HL1 A;  4KZ7 A;  4LD9 C;  3LIC A;  4JGQ A;  1N9B A;  4UPK A;  3OCL A;  4X1L A;  1IFQ A;  5TFQ A;  4S2I A;  3CHW P;  3W97 B;  1CF0 A;  1P3I A;  3MNN D;  4GZB A;  2PD8 A;  4IBI A;  2JSS A;  4G92 C;  4XXR A;  5DF9 A;  1ID3 A;  3ZG8 B;  5B31 C;  2HDU A;  3UE6 A;  1YU4 A;  4Q8I A;  3QP1 A;  4X23 B;  2HDQ A;  3REL B;  5B1L D;  2Y4A A;  1H8P A;  4WU8 C;  3NIA A;  1HQ3 A;  3X1U B;  1P3F D;  1M6K A;  2JKT I;  4LGW A;  2JKR M;  3KYE A;  2HJ9 C;  1YLZ A;  3AZI A;  3PHY A;  2ARO A;  3JPU A;  2PBD P;  3N8R A;  2O0Y A;  4J8U A;  2VX8 A;  5FQM A;  1YSP A;  3IF6 B;  1P3B B;  2XEP A;  4JGP A;  3LIA A;  3FKW A;  1TAF A;  4WZ5 A;  3SH7 A;  1S1Y A;  1KS0 A;  2WGW A;  3PBO A;  3MGQ A;  3A3D A;  1ES3 A;  4QD4 A;  1SKF A;  5GT3 A;  4KUK A;  4DE1 A;  1NYM A;  4UA6 A;  2Z6D A;  1STZ A;  4HP4 A;  1PW1 A;  1W8Y A;  5KSC A;  4EQ1 A;  3F1P B;  4H9R B;  5AV5 A;  3IF6 A;  3PBT A;  3IT9 A;  1OGB A;  4R3B A;  4JJN C;  2HIO C;  2Y91 A;  5TBM A;  5B1L A;  5AV6 C;  4KQD A;  4QLC A;  3JVV A;  3IWI A;  4YIN A;  1FIK A;  3MZE A;  5AV8 C;  2WGI A;  4UEY A;  3S22 A;  3UN7 A;  1KX4 C;  1B6W A;  3FC7 A;  2ZC7 A;  3JVU A;  3T1X A;  3WWX A;  5GSU A;  4WNN A;  1MKI A;  1TEM A;  4FUW A;  3MMH A;  2FJ7 D;  3R7W B;  4WU9 A;  2R78 A;  1BH8 B;  3IH9 A;  4BD1 A;  3AZH C;  3B6G C;  5B0Y A;  1PZO A;  5DF8 A;  1PYY A;  1XA1 A;  3AZL A;  1K55 A;  5FA7 A;  2K31 A;  3LJA A;  4BD0 A;  5FQI A;  1WWI A;  3CAX A;  3VMA A;  5K5B A;  5BNX B;  5BS7 A;  3KUY D;  3QP8 A;  3VV4 A;  3W99 B;  5CHU A;  5CER A;  3AZF D;  1KX4 D;  2Q9M A;  2JKF A;  1CEF A;  3B3X A;  4S2P A;  2IO5 B;  1XP4 A;  3AZG A;  1P34 A;  3AZN C;  1LSV A;  1Y54 A;  1O07 A;  2HJE A;  3LFV A;  3BFC A;  3KWQ C;  3UB5 P;  2NZD D;  3IF5 A;  3R4K A;  2ARO B;  4YS3 D;  4OP8 A;  5CHJ A;  4LV3 A;  2PYR A;  3AYW B;  3FPV A;  1K57 A;  5EM0 A;  4BBU A;  4JLF A;  2JKG A;  1P3F A;  3E98 A;  4I3A A;  3U4L P;  2WKH A;  1AOI A;  1ES5 A;  4OON A;  3GVB A;  1JTD A;  1SZV A;  4Y7P A;  4PAU A;  5CPJ C;  1EQZ A;  4H9O B;  3EQV A;  5F5Y A;  3LJA C;  3MBZ A;  2VQR A;  3LZ1 B;  3VH5 T;  1KOU A;  2W3H A;  3HLD A;  1L3L A;  3X1T A;  1LT0 A;  1HLU P;  3AZI B;  1VET B;  1VHM A;  3CPT A;  4ME4 A;  3ZDJ A;  3C4P A;  2ZQD A;  5AV5 B;  3EEH A;  3MGQ D;  1WWS A;  3AYW A;  3IXD A;  3H0R C;  1G6A A;  2ZD8 A;  1P3P A;  3UT9 B;  3C30 A;  4GD6 A;  3FKV A;  1GXD A;  4LG2 A;  2WGW B;  3VOL A;  3REL A;  3NOP C;  2WAF A;  4TX8 A;  3PYP A;  5CGW A;  4R1G A;  3QNB A;  2WKI A;  5DFX A;  3WD0 A;  2HIO A;  4R3A A;  1HVB A;  3IWQ A;  3D72 A;  1ZLA A;  3FV7 A;  4QLC C;  4BL3 A;  4EEP A;  3H82 B;  4EU0 A;  1NLY A;  1ALQ A;  1H5X A;  1K4E A;  5JYP A;  4WU9 C;  2LB9 A;  3LUQ A;  3NHQ A;  3LIB A;  3V67 A;  2EWV A;  5DFY A;  4JBF A;  1MWU A;  3VFH A;  4U3T A;  5EV0 A;  3EPH A;  4CLC A;  3REJ B;  2G2W A;  4NZ3 A;  4IVK A;  2PRF A;  5AVB C;  2RCX A;  5GT0 D;  4WUJ A;  3KSG A;  4OP5 A;  1U35 A;  5EE8 A;  3TSG A;  1PFL A;  3C1B D;  2WK0 A;  3UNW A;  1Q9C A;  2CV5 C;  2Z2M B;  1NYY A;  4J8X C;  1K6S A;  4HI4 A;  3AGD A;  5FQK A;  4KUD B;  3I7J A;  4IBR A;  4Z2M G;  4O01 A;  5B0Y D;  3V9R B;  1H3Q A;  3VP3 A;  3A6N C;  4WMC D;  4XT2 A;  2DRW A;  1L0G A;  2R9W A;  2Y2K A;  1PNE A;  2HDR A;  3AZJ C;  4JF4 A;  1MBL A;  1SDN A;  1YT4 A;  3HLG A;  4WL9 A;  4LPZ A;  3AZN A;  5CRF A;  5L2F A;  3REL D;  2JE5 A;  4NXB A;  3IXG A;  3KS4 A;  2EX2 A;  1P3B D;  4X23 C;  2P04 A;  3R45 B;  3K3D A;  2F8N B;  1XJ2 A;  2P08 A;  3X1U C;  2Y2L A;  5AV8 D;  3FKE A;  4H9N B;  2XK1 A;  1VM1 A;  3F1O B;  1VEU A;  3KSI A;  4S2K A;  2HIO D;  3X1T C;  5AV9 D;  5B40 B;  1K56 D;  2A24 A;  5AV5 D;  5DTS A;  1BUE A;  5AVC B;  4E3I A;  4MBH A;  3TE8 A;  1H8M A;  5TGF A;  5B0Y B;  4PPR A;  4J8U C;  4II7 A;  5FDH A;  1KVL A;  3A3I A;  3O62 A;  4WLA A;  4BQM A;  3MGS B;  4J8W A;  2FFF B;  3AV2 C;  3WA9 B;  5G4Y A;  4LV1 A;  1FCN A;  3F6T A;  2VJW A;  1E88 A;  2OWH A;  3S4X A;  3W96 C;  5GSU D;  4OOM A;  4P6Z S;  4MLL A;  1MKM A;  2H5S A;  3CWF A;  3W4O A;  1BSG A;  3ZYT A;  3N3F A;  3C2W A;  3UDF A;  2ARO D;  3M6B A;  5M18 A;  2FJ7 B;  2J3T D;  3PBR A;  4HP9 A;  1PIO A;  4XZQ D;  5A91 A;  1L6J A;  4JJN B;  5HW3 A;  3QP5 A;  1TAF B;  1P9R A;  2PYO D;  1YLT A;  5KSH A;  5GT3 C;  3FDD A;  5AV8 A;  5FAP A;  5LBR A;  1CXW A;  3B0B A;  1YU0 A;  3BEC A;  5E2H A;  3LEQ A;  3BEB A;  1M1A C;  3E4O A;  3KWQ B;  1P3A B;  1GSW A;  3W2Z A;  4S2O A;  5AVC C;  3W98 A;  2ZMF A;  3WAA D;  1SKO B;  3G35 A;  4QPR A;  5E2F A;  3WAA B;  4G3V A;  4JJN A;  3BWL A;  2XRN A;  1K25 A;  1TS0 A;  4IUK A;  3L28 A;  4M4X A;  1XKZ A;  3HLW A;  1P3P B;  2EA9 A;  1BYW A;  4Y13 A;  4XUZ A;  3VSL A;  5A8B A;  1I5Q A;  1ULY A;  5FI7 A;  5B2J C;  3LCE A;  3M6H A;  4MB3 A;  3PR6 A;  2RVQ C;  3REK C;  5GXQ B;  3KXB A;  1IYP A;  1DP9 A;  5L10 A;  1TF1 A;  1P3P C;  3ITB A;  2OAP 1;  3LY4 A;  3G32 A;  3HLB A;  3L7H A;  4NK3 A;  4H6J B;  2Y2I A;  3B6G D;  4B93 A;  3KFU G;  3PBN A;  3S7N A;  2EX9 A;  4F3L B;  3H7W B;  5I5L A;  4EER A;  1W8Q A;  1P3B A;  2QMI A;  5AV9 C;  5CGS A;  1P3A D;  4YM6 B;  3AZM C;  3DWK A;  1ED7 A;  4O7D A;  1YQS A;  3AZI C;  3VH5 W;  1S66 L;  3Q81 A;  5AY8 C;  3LZ1 C;  3WTP D;  4Y5F A;  3TG9 A;  1P0Z A;  1Z6F A;  2OV5 A;  2WZX A;  5B0Z D;  4DN0 A;  4HOI A;  1AOI C;  3WA9 A;  5GXQ A;  2JBF A;  3B0C T;  2YKF A;  5EFW A;  4RX2 A;  4X23 D;  1KX3 C;  4XUX A;  5DJU A;  4DXB A;  3AZG D;  1P34 D;  1FCM A;  3AGE A;  5AJG A;  1IKI A;  1W1Y A;  2ACG A;  2DCF A;  4EES A;  1TZY B;  3LR3 A;  4YNR A;  2F8N G;  2VGL M;  3A3E A;  1XJ6 A;  4KQQ A;  1GHM A;  4MN5 A;  4JF6 A;  5CP6 C;  4K0W A;  4R4R A;  2YFW B;  5KDM B;  3LI8 A;  4CLC D;  4G3K A;  1HTZ A;  1M1A B;  1P3F B;  1XFQ A;  4HJ3 A;  5E2G A;  1BTL A;  4WU8 A;  2CV5 D;  2ZBB A;  3MQQ A;  2UV0 E;  5B24 C;  3L9K A;  5AVE A;  3BY8 A;  3RH8 B;  4BMW A;  2ZC3 B;  1LL5 A;  3TJZ C;  1JFI B;  3B33 A;  3LYX A;  4WMC A;  5FQ9 A;  2A24 B;  3MNN B;  4MCW A;  3WTP E;  2X01 A;  3UTB C;  2INW A;  3Q1F A;  4Y15 A;  1P3M C;  3LJA B;  2EXB A;  2ZL1 B;  4UQI S;  3D3O A;  3IQA A;  3L25 A;  1IYS A;  1W79 A;  1T1C A;  5M19 A;  4K91 A;  3G6O A;  1P3L A;  1WYB A;  3ZG7 B;  3WD2 A;  3SH8 A;  1XJ3 A;  1ERQ A;  3MQL A;  2J7V A;  3LZ0 C;  4X55 A;  1LSW A;  4RVA A;  5BO0 A;  2O99 A;  2FZ0 A;  1GSX A;  1OTE A;  4YM6 C;  3C1C C;  1GPF A;  5DVA A;  1SDE A;  4Z5T D;  1IYO A;  3E2K A;  1UWP X;  2W1R A;  1P3O B;  4NKP A;  4DE3 A;  3K2N A;  4HQA A;  1GCE A;  5CPK B;  3BQA A;  1V9Z A;  1RGZ A;  4GDN A;  1E6Z A;  1X0O A;  3A1K A;  1EAK A;  1BH9 A;  4EET B;  4GOG A;  1HD8 A;  3W96 A;  4GW9 A;  5AY8 A;  4LD9 D;  4HME A;  4CSR A;  1HQ3 B;  4ZAM A;  1H3O B;  5BNV A;  4QB8 A;  3W99 C;  4WM9 A;  1J3W A;  3X1V D;  3B6G A;  1QMF A;  2G5H C;  3OLO A;  4NET A;  2K7S A;  4ARZ B;  1K55 C;  3T4K A;  1OTD A;  3GDI A;  5GLD A;  1P3A A;  1D1J A;  4WEJ A;  1OT6 A;  3UTA A;  1TDG A;  5L07 A;  4WZ4 A;  3H0L C;  2EX6 A;  1P3L D;  3REK B;  3EOI A;  1E8B A;  4BL2 A;  5L09 A;  2L0W A;  3WX7 A;  4L9E A;  2F8N K;  2W0N A;  1YSQ A;  3OPR A;  1DJC A;  3H0M C;  4OJ5 A;  3AN2 C;  3NI9 A;  4EEU A;  4E3O A;  1PWD A;  3IX8 A;  1ZLA B;  3PBS A;  5F68 A;  3KUY C;  3MQO A;  2OAQ 1;  5J8X A;  3MVD D;  2RTS A;  1MPL A;  3MVD B;  4IBX A;  4MDZ A;  3LO7 A;  3NDE A;  1XX2 A;  5EOO A;  4HJ4 A;  4YS3 B;  3AZK D;  4I39 A;  3OC2 A;  1TZY C;  2ZQ9 A;  2IA2 A;  3KYQ A;  5J3W A;  4NE3 A;  3A6N D;  3BLS A;  1MY8 A;  2NZD A;  2PYO B;  5B32 B;  2BLS A;  3Q7Z A;  4DE2 A;  1GOI A;  2IO5 C;  3E4P A;  4GHI A;  1GHP A;  4IUH A;  3S1Y A;  1F66 B;  3UT9 D;  1M19 C;  3MJQ A;  4ZUX C;  2L4R A;  4RYE A;  4N1H A;  1K0K A;  3UPN A;  3KSH A;  1QO6 A;  5E5A C;  3O88 A;  3WTP C;  4OQG A;  4DJ2 A;  5AY8 D;  4FH4 A;  4ESP A;  2Z6C A;  3AYW C;  2K2N A;  3LEZ A;  1P3L C;  5AQB A;  2V8F A;  1EQZ D;  1BT5 A;  5JRG A;  1KGE A;  5AVC A;  4R8P C;  2QWS A;  1S4R A;  4N9K A;  3BQ8 A;  1N4O A;  1JTG A;  4J8U B;  2QPN A;  4Z2I A;  3IH8 A;  5B2I A;  2Q0O A;  3AZL D;  1E4D A;  2ZOH A;  5FAT A;  1ES4 A;  5C3I C;  4EBP A;  2RVQ D;  1AXB A;  3AV2 B;  5B0Z A;  3K3C A;  1H3O A;  4Z5T A;  2BYK A;  3O87 A;  1XPB A;  5CP6 A;  1N9L A;  2Y2J A;  1UGU A;  2HDS A;  3IXB A;  3T50 A;  4RA7 A;  1TVF A;  2F8N H;  5B32 D;  3W98 C;  5F82 A;  3MGQ C;  1IKG A;  2VGK A;  3QP6 A;  1OTI A;  3AZH B;  3FYZ A;  3IWO A;  1P3I C;  1F2K A;  4PM7 A;  1M18 C;  1GA0 A;  1ID3 B;  5F99 D;  4EW7 A;  4WV4 B;  3G2Z A;  5CPJ D;  5F1G A;  5AY8 B;  3W4Q A;  5EM1 A;  1EW0 A;  4Z2M H;  3BRM A;  3V3R A;  1MZU A;  1O7E A;  5BNV B;  4K0X A;  2WYX A;  4H9O A;  3C1B A;  2V0W A;  4KHA A;  2B5R A;  5GLC A;  3WRT A;  5AV6 A;  3IXH A;  5I94 A;  4J8W C;  5EEC A;  4J8U D;  3M2J A;  1ZG6 A;  3AN2 A;  5G18 A;  2WKQ A;  2NUT C;  4XZQ B;  2KX6 A;  2J3T C;  1SKO A;  3MNN C;  1YUE A;  3MZF A;  1Z09 A;  3EGX C;  1ERM A;  4NXE A;  3KS8 A;  1S0W A;  3B6F D;  1W63 Q;  3AYW D;  4OPZ A;  1YMS A;  3ZNY A;  4H9P B;  4DJ3 A;  2M7V A;  1E25 A;  2E8I A;  5AV8 B;  4ZUX A;  3BFG A;  3L27 A;  1F66 A;  2VEA A;  1K6R A;  4WN5 A;  1ONH A;  2H0Y A;  3MQ0 A;  3LIF A;  3AZF C;  3ISG A;  2P9V A;  2BYM B;  4IED A;  1M19 D;  1F9I A;  5B31 B;  2DF4 C;  4I5S A;  1QME A;  4Q0J A;  3TU4 B;  3MGR C;  1J9M A;  1W7F A;  5A92 A;  3UME A;  5EVL A;  3AZE C;  5B33 A;  1YLJ A;  4D2O A;  3AZH D;  3DBA A;  3ZCZ A;  1P3O D;  1T19 A;  3E2L A;  3AZK C;  2HUE C;  4QU3 A;  5GHZ A;  3MGR D;  3EPK A;  4NYU A;  1BFM A;  4OPR A;  4OOY A;  4B4Z A;  2V2F F;  3GTC A;  4HH3 A;  1XA7 A;  2P9V B;  2ZY3 A;  2Y2H A;  4AFI A;  3PAG A;  2ZOI A;  3TU4 A;  4Q0I A;  4Z66 B;  3N7W A;  5GT0 C;  1M18 B;  3G30 A;  4NZ1 A;  3ICY A;  1S1Z A;  4CPK A;  2XD5 A;  4KEN B;  2YFV A;  1TS8 A;  1UR9 A;  1LLB A;  5CPK D;  4HBT A;  5JRG B;  4AWL B;  4JGR A;  3UE1 A;  4R6L A;  5M1A A;  1N9O A;  3REI A;  1ACF A;  1FQG A;  4Z9Q A;  5F99 B;  2V8C A;  2FJ7 A;  4FCF A;  5HWW A;  2Y2G A;  4YFM A;  2HPB A;  4NG2 A;  3MGS C;  4PKY G;  3N4I A;  1P3L B;  3X1V C;  1HZO A;  2OSU A;  3WA9 D;  3CLO A;  1TDL A;  4X53 A;  3QHY A;  2V1Z A;  5BT1 D;  3AZM B;  3REH B;  2G2U A;  2H10 A;  3HVF A;  5GL9 A;  5TR7 A;  3B6F C;  3P5J B;  1P3G D;  1P3O A;  1P3I D;  2W3D A;  4EO5 C;  2L5A A;  3MXS A;  2ZC5 B;  1D06 A;  1ZLA C;  3W98 D;  4ETX A;  5B2I B;  4R23 A;  2KLI A;  1DJA A;  3KSY A;  4Y0T A;  2WGV A;  3S7P A;  5B0Z B;  2W8S A;  1ZTU A;  5AVF A;  3HCY A;  1LI9 A;  4XUJ B;  2PYO C;  5AVB A;  2D02 A;  2HGV A;  2ZM0 A;  2XRO A;  3KXB D;  4OJP A;  3Q7V A;  3UB7 A;  1E3U D;  1VET A;  3JYI A;  4RQ9 A;  4OOL A;  4H9S C;  3CG5 A;  3W97 D;  2ZY2 A;  2ARO C;  2XQZ A;  1VB6 A;  2JC7 A;  3MKF A;  3N6I A;  3H7W A;  4HIA A;  4WEL A;  5B32 C;  3AFA D;  5J7E A;  1YLP A;  4FD8 A;  1UR8 A;  1YLW A;  5EPH A;  3UB8 A;  5JA4 A;  3RJU A;  3PAE A;  5B24 D;  1P97 A;  1C3B A;  3SS3 A;  3IS2 B;  4LEN A;  4S2J A;  5D3O A;  4J8X B;  4MMN A;  4JXG A;  1H0I A;  3T1S A;  3AZL C;  2YKH A;  5FEG A;  1KX5 C;  3NC8 A;  5B33 B;  3IP4 C;  2D49 A;  3AN2 B;  3HLF A;  1OJG A;  2Y2P A;  1VEU B;  1GHI A;  4XT2 B;  1T3U A;  3GSG A;  4X25 A;  5AV5 C;  1T1B A;  3MS6 A;  1U35 D;  2I72 A;  3KWQ D;  3F1N B;  5TBM B;  1P9W A;  3LID A;  5B1M A;  4DE0 A;  4KG6 A;  3IS2 A;  3AZG C;  1P34 C;  2YFW A;  5KDM A;  5KZH A;  4M6B A;  4U0T A;  3UE0 A;  1MWS A;  2EWW A;  3AV1 D;  2IWC A;  5E5A A;  5EUA A;  5DNM A;  3EPL A;  2W27 A;  4JPM A;  2Y8H A;  3NQJ A;  3BY9 A;  1W1P A;  3AZI D;  5AV6 D;  3ZQ5 A;  3AZM D;  1PWC A;  4C6Y A;  5B40 C;  5L8M A;  2Q9N A;  3DTI A;  1DP8 A;  2FN2 A;  3WS5 A;  4ETZ A;  2M1C A;  1DY6 A;  3UTB A;  3UO9 A;  3EQU A;  3QNC A;  3B0D C;  4GJ4 A;  2DNS A;  3ZVW A;  5B2I D;  4OJO A;  3AZE D;  4DRT A;  3B6F A;  3SS5 A;  3S7O A;  4IBG A;  5MC7 A;  3VOZ A;  2H28 A;  4J8W B;  4WJ3 C;  5DNM B;  5IHV A;  4GHL A;  4O0P A;  1CQA A;  4LD9 B;  2AVX A;  3AFA C;  2GZA A;  1NRF A;  3A6N B;  3AZH A;  4NXF A;  3KWQ A;  4GHA A;  3W97 C;  2X71 A;  3MGP D;  4PM8 A;  3OOV A;  1P3M B;  1S67 L;  4J8V C;  1BZA A;  4QLC D;  3WS2 A;  4R70 A;  3V3S A;  5HPI A;  3MR0 A;  3AV2 A;  4ZDX A;  1BUL A;  3W99 D;  1IEM A;  4L9G A;  5FDS A;  4OKP A;  2ZM8 A;  3LY3 A;  3UDI A;  3HRE A;  4J8V D;  2QYB A;  5HWV A;  2BG1 A;  4J8V B;  4QJG A;  4Z66 D;  4KQO A;  4KG2 A;  3MGP C;  3B47 A;  5HDD A;  2OLV A;  1ONG A;  2V9A A;  3X1S B;  1L2S A;  3UTA D;  1D7E A;  5FAQ A;  3UTA B;  1K4F A;  1ZKJ A;  1P3G C;  4R38 A;  3EPJ A;  1LHY A;  4HGA B;  4HES A;  3AZK B;  3FZC A;  2FH5 A;  3A0S A;  4BBT A;  4WBG A;  3KUY A;  5FI2 A;  2IOU A;  5U47 A;  3OBF A;  5CPI D;  4YM6 D;  3NCK A;  4KZA A;  4IBK A;  4UUZ B;  5E43 A;  2BAS A;  2ZQ8 A;  3AZF A;  1HQ3 C;  4NY2 A;  5AV9 A;  5DNN C;  2PD7 A;  3OZH A;  5B1L C;  4OH0 A;  5DTK A;  3KO6 A;  5HWT A;  4UAA A;  1G5U A;  5B31 D;  5FQQ A;  2XDM A;  3A3J A;  1P3M D;  4EO5 B;  4YS3 A;  4LFU A;  3UDX A;  3AZK A;  4L9F A;  4AWL C;  3KUY B;  5CPJ B;  4UUZ A;  5CEC A;  4CSR B;  3MXR A;  1N9N A;  3MGP A;  3T12 B;  1AOI D;  1OT9 A;  4MB5 A;  4DMZ A;  5B2J A;  2F8N D;  1JVJ A;  3N8S A;  4Z66 A;  1G68 A;  4X56 A;  2J80 A;  3UPO A;  2NQB B;  4JKT A;  4KZ3 A;  5GLA A;  3VP0 A;  4XZQ A;  1NWZ A;  5FL3 A;  5B2I C;  3C8C A;  2YFV B;  1TD5 A;  2ZC4 B;  3G2Y A;  3GQZ A;  4JGO A;  5GHY A;  4UHU A;  4LRY C;  4Z2K A;  3W97 A;  4F3L A;  4R8P A;  5JRG D;  3CJM A;  3HSH A;  2FJ7 C;  3BYD A;  5CPI A;  3AGF A;  1KX5 D;  3PBQ A;  3AFA A;  3E4Q A;  3KYZ A;  5B1M B;  3MVD C;  5F1F A;  4WZS B;  2QJ5 A;  1FSW A;  3UB9 A;  3R45 A;  2Y2O A;  3WD1 A;  2PAV P;  3IHB A;  3SOI A;  3H9W A;  2Y59 A;  3VE3 A;  3X1U A;  3B0D B;  4Z2L A;  1E6R A;  5BPV A;  5B1M C;  1H8Z A;  3ZVT A;  2VV8 A;  2EX8 A;  2XA7 M;  2V1B A;  3ZHH A;  3MGR A;  5AQ9 A;  2ZY4 A;  2VA0 A;  2DQN C;  4Y0U A;  2A2L A;  5BS7 C;  3L29 A;  2W3F A;  5G4Z A;  4KZB A;  1M1A A;  3NQU A;  4KGC B;  3GR2 A;  4KGC C;  2J9O A;  4MN6 A;  2XFS A;  2X02 A;  3MFD A;  4CQH A;  2KOI A;  4S2N C;  4NZ4 A;  2HIO B;  1KDW A;  3BLM A;  4KG5 A;  4XUJ D;  2O9A A;  3GEC A;  4S2L A;  4QHC A;  1VQQ A;  5HZH A;  3RXX A;  4LLO B;  3DTE A;  3C5A A;  4H9R A;  4FSF A;  3EG5 B;  4NYY A;  5AVC D;  2D01 A;  5FUG A;  3NEC A;  1BH9 B;  3KXB C;  2V5O A;  3NOU C;  2C6W B;  1P3F C;  4H9P A;  1YPR A;  1ZHH B;  3IBJ A;  3T4Q A;  1EQZ B;  3Q07 A;  3C38 A;  1PI5 A;  1KX4 A;  4P87 A;  5CP6 B;  3A1I A;  4IJE A;  1K38 A;  2VZW A;  4GN2 A;  2QKP A;  4IJF A;  1BLS A;  3LIE A;  4ARZ A;  2LY8 A;  3LEL B;  2WKE A;  3SH9 A;  4CAY A;  3IHA A;  4H6J A;  2EFX A;  2P7J A;  1ERO A;  1CI9 A;  4WNN B;  5AQA A;  3LGO A;  4X68 A;  1L0F A;  5BOH A;  2PU4 A;  5B1M D;  3T4S A;  3T1R A;  2HF6 A;  4IBE A;  2WKP A;  4N9L A;  1P3K D;  2ZMV A;  2CV5 B;  5E5A D;  3CI6 A;  4ZBJ B;  2XR0 A;  3NBL A;  3NUL A;  5DNM C;  3W99 A;  4MBK A;  4B4X A;  4Z2H A;  4G92 B;  3SZT A;  4DKI A;  4WZ5 C;  4E3J A;  4KUD D;  5CXW A;  3VP1 A;  4CLC C;  4GCZ A;  4E44 A;  5DF7 A;  4KZ8 A;  3AZJ D;  3R7W A;  4OQ0 A;  3CUE C;  4OQH A;  1KDS A;  3MF0 A;  2JCH A;  5A93 A;  4DDS A;  3HLC A;  5HD5 A;  5G49 B;  5TJJ A;  5DKK A;  1YU2 A;  3P01 A;  2PYO A;  1Y28 A;  4IJG A;  1W2E A;  1M40 A;  4KUD C;  3VSK A;  4UA7 A;  4MEZ A;  5FSR A;  3MGR B;  3CZD A;  4HNB A;  3T4L A;  3FWL A;  1NZU A;  4J8X D;  1S32 B;  3X1U D;  1T1A A;  3T4O A;  4E6X A;  2IWB A;  1DJB A;  4C3Q A;  2ZM2 A;  3GMW A;  4UA9 A;  4HEF A;  1XJ4 A;  2BYK B;  4HGA C;  2XFT A;  1YU1 A;  2XSS A;  3ITA A;  4H8R A;  5EVE A;  1LSX A;  3P7N A;  3A6N A;  4JJN D;  2VGJ A;  4PM9 A;  5CGX A;  4I3J A;  1TZY A;  1WYC A;  3VFF A;  4R8P B;  3WRZ A;  3ZG0 A;  5HDC A;  5CPI B;  5DKL A;  1FR1 A;  1W5D A;  4LRZ E;  2PU2 A;  4JF5 A;  1DP6 A;  2B02 A;  1IEL A;  5B32 G;  2RIQ A;  2Y2Q A;  1NLZ A;  3T4T A;  4U0X A;  4X1M A;  2G5I C;  5B24 B;  1P3K A;  5CPI C;  4HBU A;  5F99 C;  2JKR I;  4KHA B;  3AZG B;  1P34 B;  5AV6 B;  1JFI A;  3Q7V B;  4OVD A;  4B88 A;  4H9S A;  4P0M A;  1KE3 A;  1P3I B;  1S32 D;  5HPF A;  3HJK A;  3O62 B;  5F83 A;  3LR4 A;  5JA4 B;  2F2A C;  1U35 B;  1JWV A;  1I2S A;  3ZGA B;  1PWG A;  5B24 A;  1P3K B;  2J8P A;  1XXM A;  3LR5 A;  4QY5 A;  4J8X A;  1W1V A;  2L1M A;  1NRJ A;  5B31 A;  4BBV A;  4MBF A;  3KXB B;  3P09 A;  4YS3 C;  1E6P A;  4M3K A;  1F66 C;  4XZQ C;  2GX5 A;  1S32 C;  4IBC A;  1MWT A;  2E8J A;  5EVI A;  4FH2 A;  3TRC A;  2JHE A;  2ZL1 A;  4D60 A;  3GRJ A;  5CPJ A;  1EQZ C;  1BLC A;  1P3G B;  2V20 A;  2Y2M A;  3W96 D;  2B18 A;  3UMD A;  3ZFZ A;  4CJN A;  4IBD A;  5B33 C;  2XGN A;  1ESI A;  1PZR A;  3VP2 A;  3NJA A;  2CV5 A;  2O9B A;  4GS9 B;  3A3F A;  3VE4 A;  4KGC D;  3NY4 A;  2OLU A;  3C1C A;  1YM1 A;  5CTM A;  5GXQ C;  2XF3 A;  4J8V A;  1SCW A;  3LEL D;  3A0R A;  5GSU B;  1PRQ A;  3U2A A;  4UQI M;  3V9R A;  5IT5 A;  1XFN A;  4R8P D;  1F98 A;  3IBR A;  1BH8 A;  2J9P A;  5IS1 A;  1Q2Q A;  3ULF A;  2CC1 A;  3B0C W;  4DXC A;  1PW8 A;  3X1T D;  4E45 A;  3AZN D;  3REK A;  3IX4 A;  5BNX A;  1EI5 A;  1S32 A;  2PDR A;  1N1J A;  3C7U A;  2A49 A;  2EXA A;  5CHM A;  4ZUX D;  1P3B C;  3O5Y A;  4S2N A;  5DTT A;  4L0L A;  4A5R A;  2HUE B;  3WKJ B;  2RL3 A;  4E3N A;  3FPW A;  2W3G A;  1R4V A;  4Z2J A;  1K56 A;  1TS6 A;  4F94 A;  3DAV A;  4EBN A;  1EWZ A;  5G49 A;  1AWI A;  5B1L B;  2ZC6 B;  1B67 A;  4NEE D;  3NOT C;  1IYQ A;  4KUO A;  1L0D A;  5FI6 A;  3REJ D;  3Q82 A;  3NQU B;  4KGC A;  1G28 A;  4GNU A;  3DW0 A;  1DRM A;  1HQ3 D;  4KZ6 A;  5B2J D;  2F8N A;  3AV1 A;  4KZ4 A;  1H0M A;  3AN2 D;  4WYY A;  2ZQA A;  1KX3 A;  2VV6 A;  2P74 A;  3WTP B;  2PYP A;  3L2A A;  3MZD A;  4LRX C;  4XUJ A;  1PI4 A;  3DTM A;  2HP5 A;  3SW1 A;  3TU4 D;  4IHQ A;  4E3K A;  4I3I A;  3AZJ B;  1F66 D;  4HJ6 A;  5DNN A;  2W1T A;  4P6Z M;  4N1X A;  3REH C;  4N92 A;  3KSF A;  1AOI B;  1K54 C;  2OOL A;  3WTP A;  3AZF B;  2J3W A;  1XGI A;  4LV0 A;  5A90 A;  4DRB A;  1M18 D;  4KZ5 A;  3AZE B;  1ZLA D;  2QHK A;  5C5K A;  3X1S D;  4NFT A;  3UTA C;  3WAA A;  4Y17 A;  4KQR A;  5DNN B;  2W1T B;  3X1S C;  3ZG9 B;  1P3M A;  2QJ7 A;  1AIW A;  3KX0 X;  4Z66 C;  1GSV A;  3HUO A;  3P98 A;  1S4S A;  3UT9 A;  3OPL A;  2WUQ A;  1TS7 A;  3C1C D;  2HV1 A;  5FAS A;  3HBR A;  3VH6 T;  5HFO A;  3WS4 A;  4WU8 D;  3LZ0 A;  4IBB A;  4R4S A;  1NXY A;  3AV2 D;  1JNU A;  3L26 A;  4PM5 A;  1RCJ A;  3REJ C;  2ZLY A;  4OUI A;  3CPT B;  2QZ6 A;  3H82 A;  3REH D;  3UY6 A;  2PHY A;  4E3L A;  3RXW A;  3BFE A;  4OPY A;  3TOI A;  4WF0 A;  3AL0 C;  4OQI A;  5FUG B;  3GV9 A;  3TU4 C;  3W96 B;  4ZJ1 A;  3FG8 A;  1U60 A;  3HON A;  3AZL B;  4Z2G A;  1HTA A;  1CI8 A;  4KZ9 A;  2VK3 A;  3MFX A;  1Q2P A;  1E15 A;  2LB5 A;  1CK7 A;  1O6I A;  1L0E A;  3AV1 C;  5FEF A;  4JXV A;  3C1C B;  4H9N A;  3F1P A;  4GD8 A;  1H0G A;  2XD1 A;  2UWX A;  3VH5 A;  1P3A C;  1U35 C;  2HZ5 A;  5HAP A;  4QWO A;  3VH6 A;  1ODV A;  4H9Q B;  5GT0 B;  3REJ A;  4QLC B;  3BFF A;  1V9Y A;  2HP9 A;  3OPP A;  3V39 A;  4LV2 A;  4NXG A;  3D9Y A;  1NZO A;  1KX3 D;  3WD3 A;  3UB6 A;  3HLE A;  3EGD C;  5E5A B;  4X69 A;  5B0Z C;  2W3E A;  3MSH A;  2NQB A;  1A7W A;  3AZM A;  3REH A;  5AQ7 A;  4Q0H A;  1IOU A;  3WKJ A;  1FIL A;  3T4J A;  2XLN A;  4OLG A;  5F6A A;  3W8K A;  3WAA C;  4GHI B;  4GLQ A;  4BEN A;  4NE5 A;  3O3V A;  2Y55 A;  3SS4 A;  3REI B;  4HH2 A;  3B6F B;  1T18 A;  1NJ4 A;  5FQJ A;  3ZG5 A;  2WAE A;  3HUM A;  3MGS A;  3ZNT A;  1OTB A;  1PDC A;  1KU5 A;  1GA9 A;  5GT3 D;  1M18 A;  1ZG4 A;  4WEK A;  1KX3 B;  2PR6 A;  4S2M A;  1YU3 A;  3C1B B;  3WS1 A;  5AV9 B;  5B33 D;  4C75 A;  4HHD A;  3WD4 A;  3G31 A;  1KX5 B;  2Y2N A;  1OME A;  4EBL A;  3D4F A;  5EVI B;  3MNN A;  1YKD A;  3MKE A;  5EVI D;  2JN7 A;  4BWI A;  4ZTK A;  1MC0 A;  1CEG A;  2V1A A;  1LL9 A;  4Z5T C;  1ID3 D;  3EWK A;  4JXS A;  4DF6 A;  4EWF A;  5BT1 C;  3VH6 W;  4NZ5 A;  3RTY A;  4FOF A;  1UWN X;  1WE4 A;  3N8L A;  5HX9 A;  2BYM A;  1K57 C;  5AVB B;  4KUD A;  3AZE A;  4E6W A;  4ZBJ C;  2NQB D;  4ZBE A;  4DQY B;  5GLB A;  5JYO A;  4WU9 B;  2CWE A;  4YM6 A;  4CLC E;  2XH9 A;  3NDG A;  4OJL A;  3E0Y A;  3C4O A;  3AZN B;  4ID4 A;  1I2W A;  1KX4 B;  2ZJ9 A;  5DJT A;  1KGF A;  3WA9 C;  3LZ0 B;  4HMD A;  3DWZ A;  3RFB A;  2V0U A;  5HSQ A;  2HP6 A;  2WAD A;  3MGS D;  4PMA A;  3MVD A;  3REL C;  4GKU A;  4EUV A;  1FCO A;  5CP6 D;  1W1T A;  1WA9 A;  5C3I B;  5FAO A;  4JXW A;  3QP4 A;  3QP2 A;  5HAI A;  1TZY D;  4MB4 A;  5CPK C;  5CED A;  4H9Q A;  5GT0 A;  1XGJ A;  2NZD B;  2Z2L B;  3IF6 C;  3S7Q A;  3WKJ C;  4BJP A;  1H8Y A;  5GHX A;  4Y0O A;  5F99 A;  2VV7 A;  2WKR A;  4X6T A;  4BLM A;  4DRA A;  4EQI A;  2OWJ A;  4R0Q A;  2G7U A;  5DNM D;  1F5M A;  1K54 A;  1A0K A;  4E3M A;  1BLP A;  1P3K C;  3CMZ A;  2PBY A;  4Z5T B;  4QNL A;  5EOE A;  5AVB D;  4IVI A;  1E3U A;  5CHL B;  2PT7 A;  3LZ1 A;  3T1Q B;  1M19 B;  2Y79 A;  3X1T B;  1P3O C;  1FOF A;  4E04 A;  1OTA A;  4WU9 D;  3F1N A;  3BM6 A;  4OJ6 A;  3BJN A;  1KE4 A;  2VKS A;  5B0Y C;  1SHV A;  3BW6 A;  3AFA B;  3LEL C;  4NE6 A;  3TW8 A;  4GH9 A;  1FR6 A;  4ZRR A;  2H0T A;  1RGY A;  3UPP A;  3X1V B;  1E6N A;  1YLY A;  3IX3 A;  3AV1 B;  3EEA A;  3NQJ B;  4RX3 A;  4QY6 A;  3C1B C;  3F1O A;  4GDB A;  3V50 A;  3REI C;  3O86 A;  5B40 A;  1M19 A;  4MN7 A;  4IBJ A;  5CX7 A;  4ZJ2 A;  4CAY B;  4LCL A;  2GDN A;  1CJF A;  5EVI C;  3X1S A;  2MJ6 A;  3OCN A;  2ZM5 A;  2KDK A;  2NQB C;  1M1A D;  3G34 A;  4LCM A;  4J8W D;  5HDS A;  5IU1 A;  2C5W B;  1CK3 A;  4O8G A;  3O62 D;  1BLH A;  1MWR A;  4CLC B;  3X1V A;  1JWZ A;  2GJ3 A; 
#chains in the Genus database with same CATH homology
 3LZ0 D;  3HL9 A;  5GT3 B;  4LD9 A;  5BO0 B;  3B6G B;  1ESU A;  3W4P A;  3O62 C;  1NY0 A;  3LEL A;  2IWD A;  1ID3 C;  1KX5 A;  1ES2 A;  3UTB D;  3G4P A;  4P6B A;  5CTN A;  1LI0 A;  2EFU A;  1ZC2 A;  5CPK A;  4P85 A;  5B31 G;  5GSU C;  4XUJ C;  3LJA D;  1YMX A;  3REI D;  5CEB A;  3WS0 A;  1JWP A;  1PZP A;  4OLD A;  4G91 C;  4ZUX B;  4G91 B;  3HUN A;  4IBF A;  4EV4 A;  1N1J B;  1MXO A;  1KGG A;  1Z2C B;  2FFY A;  3PTE A;  3W98 B;  4DDY A;  3M2K A;  3VOY A;  1P3G A;  3VP4 A;  2NZD C;  5B40 D;  4R3J A;  5B32 A;  1RP5 A;  3UTB B;  5KMW A;  2WZZ A;  3UE3 A;  1KE0 A;  3MGQ B;  2ZQC A;  4MNR A;  1FSY A;  3OPH A;  2ZY5 A;  3MGP B;  2ZMA A;  4GB7 A;  4ZJ3 A;  4WU8 B;  3LZ1 D;  4PM6 A;  5HAR A;  5HAQ A;  3UT9 C;  1S6R A;  3WKJ D;  1KVM A;  5E2E A;  5JRG C;  2R9X A;  4OPQ A;  2ZQ7 A;  3AZJ A;  1P3P D;  2J8Y A;  1F1E A;  3BFD A;  4EUZ A;  2A3U A;  3REK D;  5GXQ D;  5DNN D;  5B2J B;  3C7V A;  4X23 A;  3V5M A;  5HL1 A;  4KZ7 A;  4LD9 C;  1N9B A;  4UPK A;  3OCL A;  5TFQ A;  4S2I A;  3W97 B;  1P3I A;  3MNN D;  4GZB A;  4IBI A;  2JSS A;  4G92 C;  4XXR A;  5DF9 A;  1ID3 A;  3ZG8 B;  5B31 C;  2HDU A;  4Q8I A;  1YU4 A;  4X23 B;  2HDQ A;  3REL B;  5B1L D;  2Y4A A;  4WU8 C;  3NIA A;  1HQ3 A;  3X1U B;  1P3F D;  1M6K A;  1YLZ A;  3AZI A;  2ARO A;  3N8R A;  4J8U A;  5FQM A;  3IF6 B;  1P3B B;  2XEP A;  3FKW A;  1TAF A;  4WZ5 A;  3SH7 A;  2WGW A;  3PBO A;  3MGQ A;  3A3D A;  1ES3 A;  4QD4 A;  1SKF A;  5GT3 A;  4DE1 A;  1NYM A;  4UA6 A;  1PW1 A;  1W8Y A;  5KSC A;  4H9R B;  5AV5 A;  3IF6 A;  3PBT A;  3IT9 A;  4R3B A;  4JJN C;  2HIO C;  2Y91 A;  5B1L A;  5AV6 C;  4QLC A;  3IWI A;  4YIN A;  3MZE A;  5AV8 C;  2WGI A;  3S22 A;  3UN7 A;  1KX4 C;  1B6W A;  2ZC7 A;  3WWX A;  5GSU A;  4WNN A;  1MKI A;  1TEM A;  2FJ7 D;  4WU9 A;  1BH8 B;  3IH9 A;  4BD1 A;  3AZH C;  3B6G C;  5B0Y A;  1PZO A;  5DF8 A;  1PYY A;  1XA1 A;  3AZL A;  1K55 A;  5FA7 A;  3LJA A;  4BD0 A;  5FQI A;  1WWI A;  3VMA A;  5BNX B;  5BS7 A;  3KUY D;  3W99 B;  5CHU A;  5CER A;  3AZF D;  1KX4 D;  2Q9M A;  1CEF A;  3B3X A;  4S2P A;  2IO5 B;  1XP4 A;  3AZG A;  1P34 A;  3AZN C;  1Y54 A;  1O07 A;  3BFC A;  3KWQ C;  2NZD D;  3IF5 A;  2ARO B;  4YS3 D;  4OP8 A;  5CHJ A;  4LV3 A;  3AYW B;  1K57 A;  4JLF A;  1P3F A;  2WKH A;  1AOI A;  1ES5 A;  4OON A;  3GVB A;  1JTD A;  4Y7P A;  5CPJ C;  1EQZ A;  4H9O B;  3EQV A;  3LJA C;  3MBZ A;  2VQR A;  3LZ1 B;  3VH5 T;  3HLD A;  3X1T A;  3AZI B;  3ZDJ A;  3C4P A;  2ZQD A;  5AV5 B;  3MGQ D;  1WWS A;  3AYW A;  3IXD A;  3H0R C;  1G6A A;  2ZD8 A;  1P3P A;  3UT9 B;  4GD6 A;  3FKV A;  4LG2 A;  2WGW B;  3REL A;  2WAF A;  5CGW A;  4R1G A;  3QNB A;  2WKI A;  2HIO A;  1HVB A;  3IWQ A;  1ZLA A;  3FV7 A;  4QLC C;  4BL3 A;  1ALQ A;  1H5X A;  1K4E A;  5JYP A;  4WU9 C;  4JBF A;  1MWU A;  3VFH A;  4U3T A;  3EPH A;  3REJ B;  2G2W A;  4NZ3 A;  4IVK A;  5AVB C;  2RCX A;  5GT0 D;  4OP5 A;  1U35 A;  5EE8 A;  3TSG A;  3C1B D;  2WK0 A;  3UNW A;  1Q9C A;  2CV5 C;  2Z2M B;  1NYY A;  4J8X C;  1K6S A;  3AGD A;  5FQK A;  4KUD B;  3I7J A;  4IBR A;  4Z2M G;  5B0Y D;  3V9R B;  3VP3 A;  3A6N C;  4WMC D;  2DRW A;  1L0G A;  2R9W A;  2Y2K A;  2HDR A;  4JF4 A;  3AZJ C;  1MBL A;  1SDN A;  1YT4 A;  3HLG A;  3AZN A;  5CRF A;  5L2F A;  3REL D;  2JE5 A;  3IXG A;  3KS4 A;  2EX2 A;  1P3B D;  4X23 C;  3R45 B;  2F8N B;  3X1U C;  2Y2L A;  5AV8 D;  3FKE A;  4H9N B;  2XK1 A;  1VM1 A;  4S2K A;  2HIO D;  3X1T C;  5AV9 D;  5B40 B;  1K56 D;  5AV5 D;  5DTS A;  1BUE A;  5AVC B;  4E3I A;  4MBH A;  5TGF A;  5B0Y B;  4PPR A;  4J8U C;  5FDH A;  1KVL A;  3A3I A;  3O62 A;  4BQM A;  3MGS B;  4J8W A;  2FFF B;  3AV2 C;  3WA9 B;  4LV1 A;  1FCN A;  3F6T A;  3S4X A;  3W96 C;  5GSU D;  4OOM A;  4MLL A;  2H5S A;  3W4O A;  1BSG A;  3N3F A;  3UDF A;  2ARO D;  3M6B A;  5M18 A;  2FJ7 B;  3PBR A;  1PIO A;  4XZQ D;  5A91 A;  4JJN B;  5HW3 A;  1TAF B;  2PYO D;  1YLT A;  5KSH A;  5GT3 C;  3FDD A;  5AV8 A;  5FAP A;  3B0B A;  1YU0 A;  3BEC A;  5E2H A;  3BEB A;  1M1A C;  3KWQ B;  1P3A B;  4S2O A;  5AVC C;  3W98 A;  3WAA D;  3G35 A;  5E2F A;  3WAA B;  4JJN A;  1K25 A;  3L28 A;  1XKZ A;  3HLW A;  1P3P B;  4XUZ A;  3VSL A;  1I5Q A;  1ULY A;  5FI7 A;  5B2J C;  3LCE A;  3M6H A;  2RVQ C;  3REK C;  5GXQ B;  3KXB A;  1IYP A;  1P3P C;  3ITB A;  3LY4 A;  3G32 A;  3HLB A;  4NK3 A;  2Y2I A;  3B6G D;  3KFU G;  3PBN A;  2EX9 A;  1W8Q A;  1P3B A;  2QMI A;  5AV9 C;  5CGS A;  1P3A D;  4YM6 B;  3AZM C;  3DWK A;  4O7D A;  1YQS A;  3AZI C;  3VH5 W;  3Q81 A;  5AY8 C;  3LZ1 C;  3WTP D;  3TG9 A;  1Z6F A;  2OV5 A;  2WZX A;  5B0Z D;  1AOI C;  3WA9 A;  5GXQ A;  2JBF A;  3B0C T;  4RX2 A;  4X23 D;  1KX3 C;  4XUX A;  4DXB A;  3AZG D;  1P34 D;  1FCM A;  3AGE A;  1IKI A;  2DCF A;  1TZY B;  2F8N G;  3A3E A;  4KQQ A;  1GHM A;  4JF6 A;  5CP6 C;  4K0W A;  4R4R A;  2YFW B;  5KDM B;  1HTZ A;  1M1A B;  1P3F B;  5E2G A;  1BTL A;  4WU8 A;  2CV5 D;  5B24 C;  2ZC3 B;  1LL5 A;  1JFI B;  4WMC A;  5FQ9 A;  3MNN B;  3WTP E;  2X01 A;  3UTB C;  3Q1F A;  1P3M C;  3LJA B;  2EXB A;  3IQA A;  3L25 A;  1IYS A;  1W79 A;  5M19 A;  4K91 A;  1P3L A;  1WYB A;  3ZG7 B;  3SH8 A;  1ERQ A;  2J7V A;  3LZ0 C;  4X55 A;  4RVA A;  5BO0 A;  4YM6 C;  3C1C C;  5DVA A;  1SDE A;  4Z5T D;  1IYO A;  3E2K A;  1P3O B;  4DE3 A;  1GCE A;  5CPK B;  1RGZ A;  4GDN A;  3A1K A;  1BH9 A;  4GOG A;  1HD8 A;  3W96 A;  5AY8 A;  4LD9 D;  4CSR A;  1HQ3 B;  4ZAM A;  1H3O B;  5BNV A;  4QB8 A;  3W99 C;  4WM9 A;  3X1V D;  3B6G A;  1QMF A;  2G5H C;  4NET A;  1K55 C;  5GLD A;  1P3A A;  4WEJ A;  3UTA A;  1TDG A;  4WZ4 A;  3H0L C;  2EX6 A;  1P3L D;  3REK B;  4BL2 A;  3WX7 A;  2F8N K;  3OPR A;  1DJC A;  3H0M C;  4OJ5 A;  3AN2 C;  3NI9 A;  4E3O A;  1PWD A;  1ZLA B;  3PBS A;  3KUY C;  5J8X A;  3MVD D;  1MPL A;  3MVD B;  4IBX A;  3LO7 A;  3NDE A;  1XX2 A;  5EOO A;  4YS3 B;  3AZK D;  3OC2 A;  1TZY C;  2ZQ9 A;  4NE3 A;  3A6N D;  3BLS A;  1MY8 A;  2NZD A;  2PYO B;  5B32 B;  2BLS A;  3Q7Z A;  4DE2 A;  2IO5 C;  1GHP A;  3S1Y A;  1F66 B;  3UT9 D;  1M19 C;  4ZUX C;  4RYE A;  4N1H A;  3UPN A;  5E5A C;  3O88 A;  3WTP C;  4OQG A;  5AY8 D;  4FH4 A;  3AYW C;  3LEZ A;  1P3L C;  5AQB A;  1EQZ D;  1BT5 A;  5JRG A;  1KGE A;  5AVC A;  4R8P C;  4N9K A;  1N4O A;  1JTG A;  4J8U B;  2QPN A;  3IH8 A;  5B2I A;  3AZL D;  1E4D A;  5FAT A;  1ES4 A;  5C3I C;  4EBP A;  2RVQ D;  1AXB A;  3AV2 B;  5B0Z A;  1H3O A;  4Z5T A;  2BYK A;  3O87 A;  1XPB A;  5CP6 A;  2Y2J A;  2HDS A;  3IXB A;  4RA7 A;  1TVF A;  2F8N H;  5B32 D;  3W98 C;  5F82 A;  3MGQ C;  1IKG A;  2VGK A;  3AZH B;  3FYZ A;  3IWO A;  1P3I C;  4PM7 A;  1M18 C;  1GA0 A;  1ID3 B;  5F99 D;  4WV4 B;  3G2Z A;  5CPJ D;  5F1G A;  5AY8 B;  3W4Q A;  4Z2M H;  3BRM A;  3V3R A;  1O7E A;  5BNV B;  4K0X A;  2WYX A;  4H9O A;  3C1B A;  4KHA A;  2B5R A;  5GLC A;  3WRT A;  5AV6 A;  3IXH A;  5I94 A;  4J8W C;  5EEC A;  4J8U D;  3M2J A;  3AN2 A;  1ZG6 A;  5G18 A;  4XZQ B;  3MNN C;  1YUE A;  3MZF A;  1ERM A;  3KS8 A;  1S0W A;  3B6F D;  3AYW D;  4OPZ A;  1YMS A;  3ZNY A;  4H9P B;  1E25 A;  2E8I A;  5AV8 B;  3BFG A;  4ZUX A;  3L27 A;  1F66 A;  1K6R A;  1ONH A;  2H0Y A;  3AZF C;  3ISG A;  2P9V A;  2BYM B;  4IED A;  1M19 D;  5B31 B;  2DF4 C;  1QME A;  3TU4 B;  3MGR C;  1J9M A;  1W7F A;  5A92 A;  5EVL A;  3AZE C;  5B33 A;  1YLJ A;  4D2O A;  3AZH D;  3ZCZ A;  1P3O D;  3E2L A;  3AZK C;  2HUE C;  4QU3 A;  5GHZ A;  3MGR D;  3EPK A;  4NYU A;  1BFM A;  4OPR A;  4OOY A;  4B4Z A;  2V2F F;  3GTC A;  1XA7 A;  2P9V B;  2ZY3 A;  2Y2H A;  3PAG A;  3TU4 A;  4Z66 B;  3N7W A;  5GT0 C;  1M18 B;  3G30 A;  4NZ1 A;  4CPK A;  2XD5 A;  4KEN B;  2YFV A;  1LLB A;  5CPK D;  4HBT A;  5JRG B;  4AWL B;  3UE1 A;  5M1A A;  3REI A;  1FQG A;  4Z9Q A;  5F99 B;  2FJ7 A;  4FCF A;  2Y2G A;  4YFM A;  2HPB A;  3MGS C;  3N4I A;  1P3L B;  3X1V C;  1HZO A;  2OSU A;  3WA9 D;  1TDL A;  4X53 A;  3QHY A;  2V1Z A;  5BT1 D;  3AZM B;  3REH B;  2G2U A;  2H10 A;  3HVF A;  5GL9 A;  5TR7 A;  3B6F C;  3P5J B;  1P3G D;  1P3O A;  1P3I D;  4EO5 C;  2L5A A;  3MXS A;  2ZC5 B;  1ZLA C;  3W98 D;  5B2I B;  4R23 A;  1DJA A;  3KSY A;  4Y0T A;  2WGV A;  5B0Z B;  2W8S A;  1LI9 A;  4XUJ B;  2PYO C;  5AVB A;  2ZM0 A;  3KXB D;  4OJP A;  3Q7V A;  1E3U D;  3JYI A;  4OOL A;  4H9S C;  3CG5 A;  3W97 D;  2ZY2 A;  2ARO C;  2XQZ A;  2JC7 A;  3MKF A;  3N6I A;  4WEL A;  5B32 C;  3AFA D;  1YLP A;  4FD8 A;  1YLW A;  5EPH A;  5JA4 A;  3RJU A;  3PAE A;  5B24 D;  1C3B A;  3SS3 A;  4LEN A;  4S2J A;  5D3O A;  4J8X B;  4JXG A;  3AZL C;  1KX5 C;  3NC8 A;  5B33 B;  3IP4 C;  3AN2 B;  3HLF A;  2Y2P A;  1GHI A;  1T3U A;  3GSG A;  5AV5 C;  1U35 D;  2I72 A;  3KWQ D;  5B1M A;  4DE0 A;  4KG6 A;  3AZG C;  1P34 C;  2YFW A;  5KDM A;  5KZH A;  4M6B A;  4U0T A;  3UE0 A;  1MWS A;  3AV1 D;  2IWC A;  5E5A A;  5EUA A;  5DNM A;  3EPL A;  4JPM A;  3NQJ A;  3AZI D;  5AV6 D;  3AZM D;  1PWC A;  4C6Y A;  5B40 C;  2Q9N A;  3WS5 A;  1DY6 A;  3UTB A;  3UO9 A;  3EQU A;  3QNC A;  3B0D C;  2DNS A;  3ZVW A;  5B2I D;  4OJO A;  3AZE D;  4DRT A;  3B6F A;  3SS5 A;  4IBG A;  3VOZ A;  4J8W B;  4WJ3 C;  5DNM B;  5IHV A;  4GHL A;  4LD9 B;  3AFA C;  1NRF A;  3A6N B;  3AZH A;  3KWQ A;  4GHA A;  3W97 C;  2X71 A;  3MGP D;  4PM8 A;  1P3M B;  4J8V C;  1BZA A;  4QLC D;  3WS2 A;  3V3S A;  3AV2 A;  4ZDX A;  1BUL A;  3W99 D;  1IEM A;  4OKP A;  2ZM8 A;  3LY3 A;  3UDI A;  3HRE A;  4J8V D;  2BG1 A;  4J8V B;  4QJG A;  4Z66 D;  4KQO A;  4KG2 A;  3MGP C;  2OLV A;  1ONG A;  3X1S B;  1L2S A;  3UTA D;  5FAQ A;  3UTA B;  1K4F A;  1ZKJ A;  1P3G C;  3EPJ A;  1LHY A;  4HGA B;  4HES A;  3AZK B;  3FZC A;  4WBG A;  3KUY A;  5FI2 A;  2IOU A;  5U47 A;  5CPI D;  4YM6 D;  3NCK A;  4KZA A;  4IBK A;  4UUZ B;  5E43 A;  2ZQ8 A;  3AZF A;  1HQ3 C;  4NY2 A;  5AV9 A;  5DNN C;  3OZH A;  5B1L C;  4OH0 A;  5DTK A;  4UAA A;  5B31 D;  5FQQ A;  2XDM A;  3A3J A;  1P3M D;  4EO5 B;  4YS3 A;  3UDX A;  3AZK A;  4AWL C;  3KUY B;  5CPJ B;  4UUZ A;  5CEC A;  4CSR B;  3MXR A;  3MGP A;  1AOI D;  5B2J A;  2F8N D;  1JVJ A;  3N8S A;  4Z66 A;  1G68 A;  4X56 A;  3UPO A;  2NQB B;  4JKT A;  4KZ3 A;  5GLA A;  3VP0 A;  4XZQ A;  5B2I C;  3GQZ A;  2YFV B;  2ZC4 B;  5GHY A;  3G2Y A;  4UHU A;  3W97 A;  4R8P A;  5JRG D;  3CJM A;  3HSH A;  2FJ7 C;  3BYD A;  5CPI A;  3AGF A;  1KX5 D;  3PBQ A;  3AFA A;  5B1M B;  3MVD C;  5F1F A;  4WZS B;  1FSW A;  3R45 A;  2Y2O A;  3IHB A;  3SOI A;  2Y59 A;  3X1U A;  3B0D B;  5BPV A;  5B1M C;  1H8Z A;  3ZVT A;  2EX8 A;  3ZHH A;  3MGR A;  5AQ9 A;  2ZY4 A;  2DQN C;  4Y0U A;  5BS7 C;  3L29 A;  4KZB A;  1M1A A;  3NQU A;  4KGC B;  3GR2 A;  4KGC C;  2J9O A;  2XFS A;  2X02 A;  3MFD A;  4S2N C;  4NZ4 A;  2HIO B;  1KDW A;  3BLM A;  4KG5 A;  4XUJ D;  4S2L A;  4QHC A;  1VQQ A;  3RXX A;  3C5A A;  4H9R A;  4FSF A;  3EG5 B;  4NYY A;  5AVC D;  5FUG A;  1BH9 B;  3KXB C;  2C6W B;  1P3F C;  4H9P A;  1EQZ B;  3Q07 A;  1PI5 A;  1KX4 A;  4P87 A;  5CP6 B;  3A1I A;  4IJE A;  1K38 A;  4GN2 A;  4IJF A;  1BLS A;  2LY8 A;  3LEL B;  2WKE A;  3SH9 A;  4CAY A;  3IHA A;  2EFX A;  1ERO A;  1CI9 A;  4WNN B;  5AQA A;  4X68 A;  1L0F A;  5BOH A;  2PU4 A;  5B1M D;  4IBE A;  4N9L A;  1P3K D;  2CV5 B;  5E5A D;  4ZBJ B;  3NBL A;  2XR0 A;  5DNM C;  3W99 A;  4MBK A;  4B4X A;  4G92 B;  4DKI A;  4WZ5 C;  4E3J A;  4KUD D;  5CXW A;  3VP1 A;  4E44 A;  5DF7 A;  4KZ8 A;  3AZJ D;  4OQ0 A;  4OQH A;  1KDS A;  2JCH A;  5A93 A;  4DDS A;  3HLC A;  5G49 B;  1YU2 A;  2PYO A;  1W2E A;  1M40 A;  4KUD C;  3VSK A;  4UA7 A;  4MEZ A;  5FSR A;  3MGR B;  3CZD A;  3FWL A;  1NZU A;  4J8X D;  1S32 B;  3X1U D;  4E6X A;  2IWB A;  1DJB A;  4C3Q A;  2ZM2 A;  3GMW A;  4UA9 A;  4HEF A;  2BYK B;  4HGA C;  2XFT A;  1YU1 A;  3ITA A;  4H8R A;  3A6N A;  4JJN D;  2VGJ A;  4PM9 A;  5CGX A;  1TZY A;  1WYC A;  3VFF A;  4R8P B;  3WRZ A;  3ZG0 A;  5CPI B;  1FR1 A;  1W5D A;  2PU2 A;  4JF5 A;  1IEL A;  5B32 G;  2RIQ A;  2Y2Q A;  4U0X A;  2G5I C;  5B24 B;  1P3K A;  5CPI C;  4HBU A;  5F99 C;  4KHA B;  3AZG B;  1P34 B;  5AV6 B;  1JFI A;  3Q7V B;  4OVD A;  4B88 A;  4H9S A;  4P0M A;  1KE3 A;  1P3I B;  1S32 D;  3O62 B;  5F83 A;  5JA4 B;  2F2A C;  1U35 B;  1JWV A;  1I2S A;  3ZGA B;  1PWG A;  5B24 A;  1P3K B;  2J8P A;  1XXM A;  4QY5 A;  4J8X A;  5B31 A;  4MBF A;  3KXB B;  3P09 A;  4YS3 C;  4M3K A;  1F66 C;  4XZQ C;  1S32 C;  4IBC A;  1MWT A;  5EVI A;  4FH2 A;  3GRJ A;  5CPJ A;  1EQZ C;  1BLC A;  1P3G B;  2V20 A;  2Y2M A;  3W96 D;  3ZFZ A;  4CJN A;  4IBD A;  5B33 C;  2XGN A;  1ESI A;  1PZR A;  3VP2 A;  2CV5 A;  3A3F A;  4KGC D;  3NY4 A;  2OLU A;  3C1C A;  1YM1 A;  5CTM A;  5GXQ C;  2XF3 A;  4J8V A;  1SCW A;  3LEL D;  5GSU B;  3V9R A;  4R8P D;  1BH8 A;  2J9P A;  1Q2Q A;  4DXC A;  2CC1 A;  3B0C W;  1PW8 A;  3X1T D;  4E45 A;  3AZN D;  3REK A;  5BNX A;  1EI5 A;  1S32 A;  1N1J A;  3C7U A;  2A49 A;  2EXA A;  5CHM A;  4ZUX D;  1P3B C;  4S2N A;  5DTT A;  4L0L A;  4A5R A;  2HUE B;  3WKJ B;  2RL3 A;  4E3N A;  1R4V A;  1K56 A;  4F94 A;  4EBN A;  1EWZ A;  5G49 A;  5B1L B;  2ZC6 B;  1B67 A;  1IYQ A;  1L0D A;  5FI6 A;  3REJ D;  3Q82 A;  3NQU B;  4KGC A;  4GNU A;  3DW0 A;  4KZ6 A;  1HQ3 D;  5B2J D;  2F8N A;  3AV1 A;  4KZ4 A;  3AN2 D;  4WYY A;  2ZQA A;  1KX3 A;  2P74 A;  3WTP B;  3L2A A;  3MZD A;  4XUJ A;  1PI4 A;  3DTM A;  2HP5 A;  3TU4 D;  4E3K A;  3AZJ B;  1F66 D;  5DNN A;  4N1X A;  3REH C;  4N92 A;  1AOI B;  1K54 C;  3WTP A;  3AZF B;  1XGI A;  4LV0 A;  5A90 A;  4DRB A;  1M18 D;  4KZ5 A;  3AZE B;  1ZLA D;  3X1S D;  4NFT A;  3UTA C;  3WAA A;  4KQR A;  5DNN B;  3ZG9 B;  3X1S C;  1P3M A;  4Z66 C;  3HUO A;  3P98 A;  3UT9 A;  3OPL A;  2WUQ A;  3C1C D;  5FAS A;  3HBR A;  3VH6 T;  5HFO A;  3WS4 A;  4WU8 D;  3LZ0 A;  4IBB A;  4R4S A;  1NXY A;  3AV2 D;  3L26 A;  4PM5 A;  1RCJ A;  3REJ C;  2ZLY A;  4OUI A;  2QZ6 A;  3REH D;  3UY6 A;  4E3L A;  3RXW A;  3BFE A;  4OPY A;  3TOI A;  3AL0 C;  4OQI A;  5FUG B;  3GV9 A;  3TU4 C;  3W96 B;  4ZJ1 A;  1U60 A;  3HON A;  3AZL B;  1HTA A;  1CI8 A;  4KZ9 A;  1Q2P A;  1L0E A;  3AV1 C;  4JXV A;  3C1C B;  4H9N A;  4GD8 A;  2XD1 A;  2UWX A;  3VH5 A;  1P3A C;  1U35 C;  5HAP A;  3VH6 A;  4H9Q B;  5GT0 B;  3REJ A;  4QLC B;  3BFF A;  2HP9 A;  3OPP A;  3V39 A;  4LV2 A;  1NZO A;  1KX3 D;  3HLE A;  5E5A B;  4X69 A;  5B0Z C;  2NQB A;  1A7W A;  3AZM A;  3REH A;  5AQ7 A;  3WKJ A;  2XLN A;  4OLG A;  3W8K A;  3WAA C;  4BEN A;  4NE5 A;  3O3V A;  2Y55 A;  3SS4 A;  3REI B;  3B6F B;  1NJ4 A;  5FQJ A;  3ZG5 A;  2WAE A;  3HUM A;  3MGS A;  3ZNT A;  1KU5 A;  1GA9 A;  5GT3 D;  1M18 A;  1ZG4 A;  4WEK A;  1KX3 B;  4S2M A;  1YU3 A;  3C1B B;  3WS1 A;  5AV9 B;  5B33 D;  4C75 A;  3G31 A;  1KX5 B;  2Y2N A;  1OME A;  4EBL A;  3D4F A;  5EVI B;  3MNN A;  3MKE A;  5EVI D;  4ZTK A;  1CEG A;  1LL9 A;  4Z5T C;  1ID3 D;  4JXS A;  4DF6 A;  4EWF A;  5BT1 C;  3VH6 W;  4NZ5 A;  1WE4 A;  3N8L A;  5HX9 A;  2BYM A;  1K57 C;  5AVB B;  4KUD A;  3AZE A;  4E6W A;  4ZBJ C;  2NQB D;  4ZBE A;  4DQY B;  5GLB A;  5JYO A;  4WU9 B;  2CWE A;  4YM6 A;  2XH9 A;  3NDG A;  4OJL A;  3C4O A;  3AZN B;  4ID4 A;  1I2W A;  1KX4 B;  2ZJ9 A;  1KGF A;  3WA9 C;  3LZ0 B;  3DWZ A;  2HP6 A;  2WAD A;  3MGS D;  4PMA A;  3MVD A;  3REL C;  4GKU A;  1FCO A;  5CP6 D;  5C3I B;  5FAO A;  4JXW A;  5HAI A;  1TZY D;  5CPK C;  5CED A;  4H9Q A;  5GT0 A;  1XGJ A;  2NZD B;  2Z2L B;  3IF6 C;  3WKJ C;  4BJP A;  1H8Y A;  5GHX A;  4Y0O A;  5F99 A;  4X6T A;  4BLM A;  4DRA A;  4EQI A;  4R0Q A;  5DNM D;  1K54 A;  4E3M A;  1BLP A;  1P3K C;  3CMZ A;  2PBY A;  4Z5T B;  4QNL A;  5EOE A;  5AVB D;  4IVI A;  1E3U A;  5CHL B;  3LZ1 A;  1M19 B;  3X1T B;  1P3O C;  1FOF A;  4WU9 D;  3BM6 A;  4OJ6 A;  1KE4 A;  5B0Y C;  1SHV A;  3AFA B;  3LEL C;  4NE6 A;  4GH9 A;  1FR6 A;  2H0T A;  1RGY A;  3UPP A;  3X1V B;  1YLY A;  3AV1 B;  3NQJ B;  4RX3 A;  4QY6 A;  3C1B C;  4GDB A;  3V50 A;  3REI C;  3O86 A;  5B40 A;  1M19 A;  4IBJ A;  4ZJ2 A;  4CAY B;  4LCL A;  2GDN A;  5EVI C;  3X1S A;  3OCN A;  2ZM5 A;  2NQB C;  1M1A D;  3G34 A;  4LCM A;  4J8W D;  2C5W B;  1CK3 A;  3O62 D;  1BLH A;  1MWR A;  3X1V A;  1JWZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...