2Y2JA

Penicillin-binding protein 1b (pbp-1b) in complex with an alkyl boronate (za4)
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
488
structure length
470
Chain Sequence
ISEITYSDGTVIASISRDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTGQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PENICILLIN-BINDING PROTEIN 1B
publication title Structure-Guided Design of Cell Wall Biosynthesis Inhibitors that Overcome Beta-Lactam Resistance in Staphylococcus Aureus (Mrsa).
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
total genus 159
structure length 470
sequence length 488
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2y2jA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2y2jA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2y2jA02
1PI5A 2P9VB 5AQ7A 1ALQA 1ES4A 2EX6A 3N8RA 5CHUA 4DE1A 1MWSA 4DDSA 1QMFA 3HUNA 1ERQA 1Q2PA 2JCHA 2WADA 4N1XA 3V3SA 2QPNA 3BFDA 5JYOA 2Z2MB 4DE2A 3IXDA 1TDGA 1BT5A 5GLCA 2OSUA 4IEDA 3VP3A 3WRTA 4KZ4A 5DF9A 3ZVTA 1PW1A 2HDQA 3LY3A 5EVIB 1QMEA 3OC2A 2WKHA 3ZNYA 5DTSA 1XA1A 1PWCA 4OQHA 3BRMA 4OPQA 4E6XA 4P87A 3BFCA 3TOIA 4KZBA 4QY5A 5A92A 4JXGA 4MBHA 5EPHA 1FCNA 1L0GA 4MBFA 5JYPA 1AXBA 2FFYA 4D2OA 2A49A 5CGSA 4R1GA 3GTCA 3SH7A 4S2NC 4Q8IA 1U60A 4FH4A 1YLTA 3WRZA 2H10A 4WMCD 2WAEA 3WWXA 4FSFA 2C6WB 1IYQA 5GL9A 2WK0A 1LI0A 4WBGA 4GKUA 4DE3A 3HVFA 5I94A 3C7UA 1J9MA 4KZ5A 1K57A 2CC1A 2XD5A 4BD0A 1LHYA 1L0FA 4EWFA 1K4FA 5FI7A 4U0XA 5E43A 4KZ6A 1K4EA 4X6TA 4DDYA 4HEFA 1CK3A 5CRFA 4WZ4A 3O88A 2XR0A 2Y55A 2JE5A 2EXAA 2XFSA 1EI5A 1G6AA 1SHVA 3G30A 1IYSA 3ZCZA 4RA7A 1E3UA 4S2PA 4DF6A 1NYMA 2HDRA 3N4IA 3I7JA 1HD8A 1TEMA 1W8YA 2R9XA 3ZG9B 4E3NA 2Y2KA 5FQKA 3BFEA 4CJNA 3Q7VB 1C3BA 3VP4A 3SS3A 1WE4A 3MZDA 3NDEA 3SS4A 3VOYA 3OCLA 3OCNA 4KG2A 4R0QA 1L2SA 1YQSA 4U0TA 1Z6FA 1JTGA 1H8YA 1PI4A 3IF6C 2C5WB 1YT4A 2DRWA 3N6IA 4QY6A 1XPBA 5CHJA 2ZLYA 2Y2IA 5GLDA 1BLSA 3G32A 5HL1A 1K54C 5G18A 1IELA 3QHYA 3LCEA 4WEKA 5EVLA 1LL5A 2ZJ9A 4WZ5C 4DKIA 3HREA 3FZCA 4Y0UA 4PM7A 3ZG0A 3ZVWA 4GD6A 4FCFA 3IQAA 3RXXA 3NI9A 5HARA 3RXWA 4PM5A 3EQVA 1RGYA 3GSGA 3B3XA 2ZMAA 4HESA 5FAQA 4MNRA 4C3QA 4F94A 2Y59A 3NC8A 4Y0TA 3P98A 1Y54A 4H8RA 2PU4A 4OVDA 3LEZA 3UDIA 4KG5A 4IVIA 4X56A 3UE1A 5DTKA 2XGNA 4HBTA 3WS1A 4A5RA 4KENB 3O87A 4KZAA 4FH2A 2HP5A 1XA7A 1FSWA 4JF6A 1K55A 3G35A 4PM6A 3S1YA 2B5RA 1ES3A 2PU2A 1K6SA 1MWUA 3O3VA 4GOGA 1W8QA 3GQZA 1BZAA 1NYYA 3ZFZA 2Y2GA 3M2JA 4E3JA 1KVMA 1DJBA 1K54A 1XP4A 3PTEA 4PM8A 4UA6A 2RL3A 4GDNA 3GMWA 4OONA 4QJGA 3M2KA 3MKFA 3MBZA 3QNBA 3V39A 5EVID 4P6BA 2ZM2A 1EWZA 4PPRA 1YMSA 3EQUA 1MPLA 2EX2A 1K56A 1SKFA 3C5AA 4LCMA 4NETA 1NJ4A 1EROA 4Z9QA 1LI9A 3BLSA 4OP8A 4KZ7A 2Y4AA 3HUMA 3ZG8B 4KZ8A 5FAOA 2WKIA 3V5MA 3N8LA 1ZG6A 1VQQA 2DNSA 5FATA 5M18A 5FASA 3ZNTA 4OOLA 5DTTA 1JWPA 4S2JA 4XUZA 3PBNA 3UPOA 1KGFA 1BLCA 1YM1A 2ZM8A 3W8KA 5F1GA 1KGEA 4KQOA 4JKTA 3PAEA 5HAQA 3IXGA 2WZZA 4UA7A 5TGFA 4S2LA 4OPYA 1SDNA 3UDFA 1GA0A 2Y2NA 3WS5A 2A3UA 5AQ9A 1XGIA 2QMIA 4QD4A 1BLPA 5E2EA 4JBFA 5GLBA 3UO9A 2RCXA 1E4DA 1YMXA 3HLDA 3OPPA 2EFXA 5EOOA 5F82A 5HFOA 4RX2A 2Y2MA 5AQBA 3S4XA 2XFTA 3ISGA 1YLZA 3AGFA 4Y0OA 3CJMA 1CEGA 4WELA 1ESIA 5CEDA 4E3OA 2XLNA 3BYDA 3IH8A 4OQIA 4S2KA 1W7FA 4R4RA 2WGWA 3CMZA 4RVAA 4JPMA 2BLSA 4YINA 1ERMA 5TFQA 1FR1A 1OMEA 4O7DA 4IBRA 5FAPA 1ZG4A 1WYBA 3IWOA 4N9LA 4GZBA 4OLDA 4WM9A 2EXBA 3G34A 4X69A 4U3TA 1M6KA 1NXYA 2OLUA 4GNUA 3A3DA 3MXSA 5A91A 1PWDA 2Y2HA 4HBUA 1I5QA 5E2FA 3PBTA 1KE3A 3VOZA 2VGJA 1BULA 3SH8A 1DY6A 3HUOA 3Q1FA 4S2MA 4ZJ1A 2OV5A 2R9WA 3IH9A 4S2NA 2XQZA 4LV0A 5M1AA 2HP9A 1LLBA 3FV7A 1NY0A 3PBSA 4LV3A 1LL9A 1G68A 4JXSA 2ZC4B 3BEBA 4BJPA 2E8IA 1PZPA 1K38A 3MFDA 2V2FF 1L0DA 2HDUA 4IBXA 2WYXA 3FWLA 5CXWA 2V1ZA 1TVFA 3SH9A 3GR2A 4OOYA 3W4QA 2X01A 5IHVA 2HP6A 5EE8A 2Y2JA 3Q7ZA 4Y7PA 4JXWA 4R3JA 1I2WA 2H0YA 2J9OA 2XH9A 4K0WA 3NCKA 4NK3A 3CG5A 3HLCA 2J9PA 3W4PA 4OQGA 4OLGA 3VFHA 4EQIA 3BFFA 2Y2OA 5CERA 5CTNA 1PWGA 4GB7A 5A90A 1ES2A 5DF7A 3RJUA 1XKZA 3AGEA 1JTDA 5U47A 4GDBA 1JVJA 4DXBA 3M6BA 5DVAA 4LCLA 5KSCA 3G2ZA 3HLEA 4JF5A 4RYEA 3HLFA 3TG9A 2XD1A 2Y2LA 4XXRA 1IYOA 3ZG7B 1ESUA 2QZ6A 1NRFA 3DTMA 2PBYA 3NIAA 1JWZA 5HW3A 3Q07A 3FYZA 4B4XA 2WGIA 2XDMA 5EVIC 4ZDXA 3IF6A 1K25A 4ZJ2A 5AQAA 3DWKA 1IEMA 4DE0A 3G2YA 1W79A 1MWTA 5CTMA 3WS4A 3E2KA 4R23A 5GLAA 1IKIA 3C4OA 3A3FA 1SDEA 3MZFA 4OPZA 4BD1A 3FKVA 4QB8A 1FR6A 1K6RA 3W4OA 1PW8A 1BTLA 1ZC2A 5DF8A 4WZ5A 5CGWA 1MWRA 1YLYA 2OLVA 5FA7A 1MY8A 3MXRA 4ID4A 2ZC7A 2ZQCA 4OKPA 2P9VA 4IVKA 5F1FA 1GA9A 1K56D 3OPRA 4OP5A 1CI8A 4OQ0A 5GHYA 3A3EA 1FCMA 2JBFA 3AGDA 1I2SA 3VSKA 4EBPA 1FQGA 1ONGA 4DXCA 4ZBEA 4OPRA 5FDHA 1DJCA 3LY4A 2ZC6B 4UA9A 5CHMA 3UNWA 2VGKA 4E3KA 4LV1A 2IWBA 5A93A 5CEBA 1YLJA 1S0WA 2EFUA 3A3IA 1KVLA 2P74A 3VP1A 4ZJ3A 2Q9MA 4KZ9A 2J7VA 3O86A 5EOEA 5F83A 3ITAA 2FFFB 5J8XA 1BUEA 5HAIA 3VMAA 4KQQA 3FKWA 3G4PA 3LO7A 3G31A 3PBQA 5HX9A 5FQ9A 1W5DA 2XK1A 2ZQAA 3NY4A 1FCOA 1K57C 2BG1A 3MZEA 1MBLA 4E3LA 3ITBA 4FD8A 5KMWA 4MEZA 1XXMA 4X53A 2G2WA 3PBOA 4N9KA 5FSRA 4B88A 5M19A 5FQMA 3WS2A 2J8YA 4KZ3A 3IWQA 1MKIA 5FI6A 1N9BA 5E2GA 5GHXA 2XF3A 1MXOA 1Q2QA 1PZOA 4UHUA 3UN7A 1SCWA 3IHAA 3VP0A 2WGVA 3S22A 2WAFA 3V3RA 1XGJA 3IWIA 2JC7A 2I72A 1BLHA 1RGZA 2Y91A 3GVBA 4CPKA 1HVBA 4WMCA 4R3BA 3SS5A 4S2OA 4LV2A 3WS0A 3NBLA 1GHIA 1JWVA 1E3UD 3IHBA 5FI2A 1ES5A 3NDGA 2X02A 3TSGA 4BENA 3PAGA 3Q7VA 1E25A 4R4SA 3IXBA 4PM9A 2EX9A 3N7WA 1NZOA 5GHZA 2WGWB 4UAAA 4OH0A 3UDXA 5L2FA 2ZQDA 2V20A 1N4OA 3IF5A 4X55A 4S2IA 3E2LA 5KZHA 1IYPA 1H8ZA 3M6HA 3HLBA 3OPHA 5CGXA 2IWDA 3QNCA 3VSLA 2WZXA 4K91A 4ZAMA 2ZQ7A 1KGGA 3BECA 1ONHA 4PMAA 3VFFA 3BFGA 4EUZA 3IT9A 1PIOA 1RP5A 2ZD8A 2WUQA 4L0LA 4RX3A 3C4PA 3DWZA 5D3OA 3UE0A 2DCFA 1DJAA 5FQIA 4YFMA 3HLWA 3SOIA 5EUAA 1L0EA 4GN2A 3VP2A 2UWXA 4QHCA 3P09A 4KQRA 2Y2PA 3Q82A 1NZUA 1K55C 5FQJA 5E2HA 3GRJA 1M40A 1GHPA 1RCJA 1BSGA 2ZQ8A 3UE3A 2ZC5B 3GV9A 1TDLA 4DRTA 2GDNA 4JXVA 4P85A 5FQQA 2IWCA 5HAPA 3OPLA 2XEPA 3V50A 2H5SA 4XUXA 4K0XA 4OOMA 3MKEA 4E6WA 2Y2QA 1ZKJA 4C6YA 3HLGA 4B4ZA 3BM6A 3C7VA 1YLPA 2X71A 3PBRA 1GCEA 2ZM0A 1CI9A 1FSYA 2Q9NA 4JF4A 3UY6A 4BQMA 4ZTKA 2EX8A 1KDSA 3Q81A 5BOHA 4E3MA 2ZC3B 1KE0A 3ZGAB 5KSHA 1O07A 3N8SA 4N92A 4WEJA 4E3IA 1S6RA 4GD8A 3HBRA 1HTZA 3OZHA 1XX2A 3HL9A 4BL3A 4BL2A 1H5XA 2G2UA 1FOFA 2Z2LB 4P0MA 1WYCA 1HZOA 4JLFA 3ZHHA 3UPPA 5EECA 3UPNA 3IF6B 1CEFA 3D4FA 3IXHA 4EV4A 3A3JA 4EBNA 4LENA 4MBKA 1GHMA 2WKEA 4WYYA 1PYYA 4QU3A 4BLMA 4KG6A 4C75A 5TR7A 2H0TA 4N1HA 1KDWA 5EVIA 3ZDJA 2HPBA 3BLMA 2ZQ9A 1O7EA 1KE4A 3JYIA 5CECA 2HDSA 4MLLA 1YLWA 1IKGA 4EBLA 4X68A 3DW0A 3CZDA 4M3KA 3ZG5A 1VM1A
chains in the Genus database with same CATH superfamily
4HP4A 5AQ7A 1ALQA 1MWSA 4LD9C 4Z2MH 1VEUA 1Q2PA 2WADA 3X1UB 3JVUA 2Z2MB 1P3KA 3MVDC 3A0VA 3RELC 2W3DA 4H6JA 4UQIS 1TDGA 4WJ3C 4IEDA 3VP3A 5DF9A 1PW1A 5EVIB 1NRJA 4JJNB 3ZNYA 2WKHA 1JNUA 3QP1A 3BFCA 4M4XA 4OJPA 1FCNA 1L0GA 5B0ZA 4IBJA 2HV1A 4R70A 3NQJB 4EW7A 3T12B 1EQZD 1P3OD 3GTCA 3SH7A 2ZY4A 5F6AA 3AZFC 4DQYB 1P3IB 1S66L 3H0RC 1IYQA 5DFXA 1LI0A 1DRMA 4GKUA 4DE3A 2EWWA 4KZ5A 3WD0A 1LHYA 5HD5A 4KZ6A 4WZ4A 3U2AA 2Y55A 1JFIA 2JE5A 4YS3C 1SHVA 1P3OB 3G30A 1IYSA 3N3FA 1E3UA 4S2PA 3F1OA 3REHD 3N4IA 1TEMA 4HQAA 3RH8B 2R9XA 2Y2KA 5FQKA 3BFEA 4CJNA 3TU4A 3LZ1A 4LFUA 2BYMA 3AZFA 1L2SA 1YQSA 1P3FD 1S4SA 3BJNA 3W97A 1PI4A 1YAXA 4H9RA 5IT5A 3X1VA 5GLDA 2CMNA 1BLSA 3REHB 3UB8A 3L7HA 2VGLS 3REKC 5AV5D 1IELA 5EVLA 4Z5TA 4WZ5C 5B31C 4Y0UA 4EEUA 3LZ0D 3MMHA 5BO0A 4FCFA 5HARA 4PM5A 4KUDA 3EQVA 3LJAA 4Z66D 3GSGA 4QLCA 1KS0A 5FAQA 3X1UC 4MNRA 3WA9B 3NC8A 4Y0TA 4GCZA 2CV5D 2V5OA 2PU4A 3UDIA 5DTKA 2ZY5A 2FJ7C 5AV5B 4KENB 4JJNC 4GW9A 1S1ZA 3UT9A 3G35A 3MFXA 4PM6A 3IX4A 1ES3A 3T4QA 4I5SA 1LSXA 3O3VA 4GOGA 4WU9D 3K3DA 4Z2HA 4E3JA 4Z66B 1UWNX 2ZMFA 3C1CB 3MBZA 3MKFA 3QNBA 1P3IC 1EWZA 4WU8B 3O62D 2EX2A 1K56A 1SKFA 4WF0A 5DKLA 1YU3A 1TS0A 3KXBA 4KZ8A 4O01A 3EOIA 1P3OC 3T4TA 1YM1A 1BLCA 3B33A 2KX6A 1KGEA 4CQHA 2WKPA 4KQOA 1HQ3B 4JKTA 3AZMB 2WZZA 1R4VA 4OPYA 3UDFA 3R7WB 1GA0A 2A3UA 4GHIB 1P3MD 4RX2A 2Y2MA 3X1TD 2XFTA 3ZYTA 1YLZA 5B2ID 4Y0OA 4LGWA 1GPFA 4WELA 2PAVP 4J8XB 5CP6B 3L27A 4OQIA 3REHC 4R4RA 4RVAA 2BLSA 1T3UA 3QP8A 4FTXA 5E5AD 1EQZA 5DJTA 1F9IA 4X69A 1UR8A 2EXBA 1P3FC 1NXYA 2OLUA 5FUGB 2W8SA 2L0WA 3A3DA 3MXSA 3EEHA 4HBUA 5EV0A 5B32D 5B2IB 3VOZA 4Q0IA 3L2AA 4B9OA 3WA9C 2PYOA 2PYRA 4GH9A 1F2KA 4G3VA 1VB6A 3LIEA 5AV5C 4LV0A 5AV6D 4UEYA 1LL9A 4JXSA 2HZ5A 2ZC4B 2E8IA 1K38A 3VH6T 1S67L 3VH5A 3FWLA 2QJ7A 4O8GA 2V1ZA 3VH5T 3VE3A 1TVFA 3SH9A 4Z66C 3UTBD 4DRAA 5EE8A 3Q7ZA 4JXWA 1GOIA 1I2WA 3LELA 3AZNB 4K0WA 4NK3A 2QJ5A 3V9RA 4WU8C 3CI6A 3HLCA 1P3FA 4OQGA 4MMNA 5CERA 5A90A 1PWGA 5AV6B 5CPIB 3NOPC 1JTDA 5U47A 4J8WD 4L9FA 4NYUA 4MB3A 5KSCA 3HLEA 4P6ZM 4WU9C 4RYEA 3MGQD 5BNXB 2XA7M 5DJUA 5DNNA 1E6RA 5HW3A 4Z2IA 3Q07A 3LI9A 2QWSA 5B24B 4GHLA 4QNLA 3LZ0A 4MN5A 1OT6A 3O62C 1HQ3C 3AZMC 4R23A 1P97A 3A3FA 4KGCA 1FR6A 2RIQA 4KHAB 1W1VA 5DF8A 5CGWA 2OLVA 2CV5A 3IBJA 1MY8A 1WA9A 4MCWA 3EPHA 1VHMA 1N9LA 5J7EA 2O99A 3OPRA 2ZY2A 4OQ0A 4J8XC 4EU0A 3VSKA 2K2NA 4WU9A 4DXCA 4UQIM 5HWWA 3LY4A 5CHMA 3RTYA 4E3KA 1P0ZA 4LV1A 1S0WA 3KWQB 1P3MC 1IOUA 1DP8A 4KZ9A 1KOUA 2J7VA 2JKTM 3O86A 1HLUP 5EOEA 4IBEA 3ITAA 3KS8A 5B2IC 1BUEA 4Y17A 3F1NB 4KQQA 1HTAA 5HX9A 3G31A 3X1SB 1W5DA 3CITA 4WN5A 2XK1A 3LFVA 1MBLA 2XSSA 1E8BA 5E5AC 2G2WA 3PBOA 2AVXA 1F98A 4LPZA 5IU1A 3B0CW 4HMEA 1PZOA 3UN7A 3AZNC 3IHAA 3OLOA 5AV8D 3S22A 2WAFA 1XGJA 3MQQA 3X1TA 4CPKA 4XZQD 1GSWA 5CPIC 5AV6C 4R3BA 4S2OA 3MGRD 3IHBA 2X02A 3TSGA 4IBIA 3Q7VA 5FL3A 4NXGA 5JA4A 3IXBA 4PM9A 2EX9A 4Y13A 3N7WA 3UTBC 1NZOA 4G91B 5KIZA 5E5AA 4CSRA 1PRQA 5B24C 3K2NA 5B1LB 1T1CA 2AROA 4X55A 3IF5A 3T4KA 1IYPA 1P3GD 5AV9D 3KYZA 3M6HA 4XT2A 5CGXA 4GLQA 3AZID 5B32A 2VGLM 4NYYA 1KGGA 1OJGA 3BECA 4J8WC 3BFGA 2ZOIA 1PIOA 4RX3A 5GT0D 4MN6A 3DWZA 3MGQC 2DCFA 4YM6A 4NXFA 4I3AA 4IBKA 2W3FA 3SOIA 2NZDD 5EUAA 2B02A 3BY9A 4H9QA 3AFAD 3WX7A 4JGPA 1BH8A 1K55C 5FQJA 4BBTA 3W96D 5G4YA 3UTBA 3AZIB 4DRTA 4P85A 5HAPA 5FQQA 2XEPA 2H5SA 3A6NB 4OOMA 3LI8A 4HP9A 2K31A 1TF1A 2X71A 3PBRA 2NZDB 1GCEA 2ZM0A 2Q9NA 5AVCD 1W1TA 3CWFA 3X1SC 1MC0A 1KU5A 3Q81A 3MGQA 3ZGAB 3W96B 1M18A 4KQDA 5JRGB 1XX2A 4BL3A 1M1AD 3O5YA 5AVBD 1HZOA 3W98A 2A24A 3EGDC 3IF6B 2ZMVA 3D4FA 4EBNA 5DNMB 5B1MD 1J7MA 3MJQA 2NQBD 5AVCB 2PRFA 5TR7A 4N1HA 3ZDJA 4CLCB 2ZQ9A 1KE4A 1H0IA 3JYIA 5CECA 5BPVA 4EBLA 3DW0A 5AQBA 2HIOA 4Y2FA 1ES4A 5KDMB 5CHUA 1V9ZA 4DDSA 1B67A 3V3SA 4ETXA 2JCHA 2PYPA 4FUWA 5JYOA 2QPNA 3BFDA 3KFUG 4G91C 5GLCA 3ZQ5A 2O9BA 1T19A 1GXDA 2GNXA 3IS2A 2LB5A 4XZQC 1OJ5A 4OQHA 4LD9D 4E6XA 3MGRC 1H8PA 3HSHA 4KZBA 5A92A 4MBHA 2PR5A 1NLYA 2PD7A 4D2OA 4Y5FA 5B33B 1OTIA 1T1BA 5B2JB 4WLAA 1YLTA 4WMCD 2WKQA 3AN2D 4FSFA 5HWVA 5GL9A 5BT1C 4MB4A 3HVFA 5GXQB 3REJD 3AZIC 1K57A 2CC1A 2HGVA 2L1MA 1L0FA 5E43A 3NQUA 4M6BA 5AV8A 5CPKA 2YFWA 5GT0C 2XR0A 5FEGA 3WTPA 2XFSA 1EW0A 2NZDC 4DF6A 3AZKD 1HD8A 1KX4D 3W99D 2DF4C 4E3NA 3W96C 4IUKA 4CAYB 3REJB 3MZDA 1SKOA 3NDEA 4YS3D 3UMEA 3VOYA 3L29A 4R0QA 3MGSD 1JTGA 3A1KA 1D1JA 1P3GA 5AV9A 3IF6C 4G92B 5DNMC 3N6IA 3EPLA 1XPBA 1W1YA 1YPRA 2ZLYA 2Y2IA 5MC7A 3AZKB 5AVCC 1AOID 3H9WA 1OPXA 4CLCC 3QHYA 3LCEA 1KX4B 2L4RA 1E6PA 4UUZA 2ZJ9A 2ZBBA 4HH2A 1TZYD 3FZCA 4PM7A 3FPWA 3C38A 1YU4A 4MN7A 5AY8A 3MGSB 3RXXA 3RXWA 3AFAA 3C1BD 5AVBC 1TS6A 4PKYA 4D60A 2ZMAA 4F94A 1CXWA 4C3QA 3P98A 4AWLB 3QP6A 5B0YA 4HI4A 3AZJA 2NQBC 4HJ3A 4IVIA 4KG5A 4X56A 5HPIA 1VETA 2GJ3A 5BNVA 2W3HA 4FH2A 2HP5A 1FSWA 3SW1A 2OWJA 2PU2A 3X1UD 1BZAA 3ZFZA 4ZUXB 1DJBA 3C1BB 1WWSA 3PTEA 2XROA 4KUDB 2JKGA 4QJGA 1OTDA 4H9PB 1QO6A 4NE5A 5B33C 1S32D 5EVID 5B2JC 3UE6A 1L6JA 1IFQA 4I3JA 4Q0JA 1M1AA 2PR6A 3A0SA 3D9YA 4DMZA 2NUTC 3H7WA 4Z9QA 3UT9B 1U35B 3BLSA 5B1MA 3R45A 4KZ7A 4J8VA 3LGOA 3PXPA 3ZG8B 3H0LC 2VJWA 4FOFA 3V5MA 1P3ID 5I5LA 1VQQA 5FATA 5M18A 3ZNTA 1KX5B 4XUZA 1S32B 1BYWA 3UPOA 1KGFA 2ZM8A 3W8KA 4EO5B 2YFVA 3AN2C 1F66D 4RQ9A 4UA7A 5TGFA 4LG2A 1W1PA 5TJJA 3REJC 2QMIA 3WKJA 4QD4A 5E2EA 1DP9A 3HLDA 5EOOA 5HFOA 3S4XA 4NZ3A 2V8CA 4O0PA 3ISGA 3CJMA 4JGOA 2V0UA 5CEDA 4LD9A 4H9NA 4E3OA 1H3QA 1CF0A 2V1BA 3NOUC 4S2KA 3AZKC 3MVDA 4YINA 2JHEA 3RELA 1F66B 4JPMA 1P3BD 1FR1A 1OMEA 1KX4C 3W99C 3F1PB 3AYWD 3P7NA 5LBRA 4N9LA 2VV7A 3FDDA 4J8UD 4GZBA 1UWPX 3MGSC 4AFIA 3AN2A 1M6KA 4GNUA 3WD4A 3SH8A 4AWLC 3HUOA 2DQNC 1AOIC 1P3BB 2P08A 2XQZA 5M1AA 2VLGA 5G49B 3FV7A 4LV3A 3T1XA 1TZYC 3AYWB 4BJPA 1L0DA 4J8UB 3WA9D 4ZUXC 2WYXA 3C1BC 2W1RA 1BH9B 2QHKA 3W4QA 5IHVA 4Y7PA 1YU2A 3LR5A 2PYOB 2XH9A 4YS3A 3NCKA 1N9NA 2JSSA 4OLGA 4EQIA 2Y2OA 2VA0A 4IUHA 4GDBA 1U35C 5GSUB 3C1CD 3HLFA 3W2ZA 4X23B 1IYOA 2QZ6A 4WU8D 3DTMA 2YKFA 1E88A 1JWZA 3NIAA 4NKPA 1KX5C 4B4XA 1S32C 5EVIC 4ZJ2A 5AQAA 3LELB 4EO5C 1NWZA 4DE0A 4XUJD 3REID 1ZLAD 1SDEA 3REKA 4OPZA 4GJ4A 1BTLA 3MQOA 4WZ5A 1MWRA 1YLYA 5B31A 2CWEA 1SZVA 2ZC7A 1GSVA 2ZQCA 4OKPA 1P3PB 1HQ3D 3AZMD 5F99B 2IO5B 3X1UA 3AGDA 2BASA 2JN7A 2V8FA 1F66C 2KDKA 4XUJB 1DJCA 3KUYD 1V9YA 4UA9A 3REIB 1ZLAB 2FJ7A 1TS8A 5CEBA 2G5HC 3A3IA 4JJNA 4KGCB 1YUEA 1P34D 2Q9MA 4J8XD 5CP6D 4LLOB 1K0KA 2Z6DA 5F83A 2FFFB 1Y4OA 5HAIA 3VMAA 3BY8A 3NQJA 5FQ9A 2JKRM 1FCOA 3WAAD 1P3BC 1P3IA 3ITBA 3KUYB 2IA2A 3T50A 4X53A 3AYWC 2HUEB 1P34B 4J8UC 1H3OB 1M19B 4B88A 4IHQA 4JGRA 4I39A 2LB9A 2V0WA 5FI6A 1N9BA 5E2GA 2XF3A 3E4QA 4UHUA 2BYKB 1YU1A 1Q2QA 1SCWA 1W63M 1P3OA 3V3RA 3UTAD 4BWIA 3WAAB 3KSGA 1RGZA 3AZHD 3NBLA 4Z1WA 5GSUC 1N1JB 3U4LP 3AZEB 3AZND 4R4SA 4X23C 3MQLA 4ZRRA 2WGWB 5CPID 4OH0A 2ZQDA 3E2LA 3UTAB 3VH6A 1D06A 3HLBA 3REHA 4R38A 4K91A 3AZHB 3C1CC 4EUZA 1AIWA 4L0LA 5B24D 3C4PA 3TRCA 2WKRA 2F2AC 5FQIA 4YFMA 3PHYA 1P3PC 3MSHA 1P3AD 2F8NB 3GDIA 5F99C 1Y28A 2LY8A 3WA9A 4R8PD 5E2HA 4XUJC 5CPJB 3REIC 1ZLAC 1GHPA 1BSGA 2ZQ8A 3UE3A 2H28A 2F8NH 5AV5A 2GDNA 4JXVA 2R78A 1E6ZA 4C6YA 5HSQA 3HLGA 3ULFA 3AZLD 3C7VA 1YLPA 3KYEA 4Z66A 1P3AB 4JF4A 4ZTKA 3AV2B 4R8PB 3KWQD 1BH8B 1KE0A 5KSHA 4EQ1A 3KUYC 4WU8A 1O07A 4WEJA 1S6RA 1HTZA 1PFLA 2HF6A 2G2UA 1P34C 1FOFA 4P0MA 3CUEC 1M19C 2M7UA 5CP6C 5EECA 3UPNA 3X1SD 3AZLB 2A2LA 4WYYA 2ZM5A 4QU3A 2JKTI 1O6IA 4BLMA 2GX5A 3EGXC 3A0RA 3FC7A 1OT9A 3WAAC 4ARZA 3O62A 1HQ3A 2HDSA 3WD1A 2YKHA 3AZMA 1IKGA 3LIBA 3M2KA 3CPTB 4M3KA 3ZG5A 1VM1A 2P9VB 3N8RA 4DE1A 3LUQA 3AZEC 3T4OA 3DTKA 3HUNA 2VQRA 4N1XA 5EFWA 1FILA 3VH6W 2QYBA 4EEPA 2ZL1A 3VH5W 3T1SA 4KZ4A 4J8XA 3UTAC 5CP6A 2HDQA 2P7JA 3LY3A 1QMEA 1XA1A 3R4KA 4CLCE 3AZHC 4P87A 3TOIA 4QY5A 3B0BA 3UB9A 3VE4A 4MBFA 2W1TB 5B1LD 1AXBA 2FFYA 1P3MA 3QP5A 4R1GA 3E0YA 5FUGA 4S2NC 4Q8IA 4FH4A 5B2IA 2H10A 2WAEA 3WWXA 2C6WB 1H0MA 2WK0A 2ZY3A 5CPJC 5I94A 1J9MA 3IS2B 3B6FD 4BBUA 5TBMB 1K4FA 4IBFA 5FI7A 1K4EA 4DDYA 1P3LB 4HEFA 1CK3A 3MR0A 5BT1D 1EI5A 1G6AA 2OAQ1 4RA7A 1F5MA 3BWLA 1P3AC 4H9OB 3AZGB 3I7JA 4WNNA 4NZ4A 1W8YA 4R8PC 2J80A 3A6ND 3AZNA 1OGBA 3LR4A 4G3WA 3B6FB 1WE4A 4HHDA 3SS3A 4YOFA 1ID3B 2EA9A 3OCLA 3WD3A 3OCNA 5AV6A 5CPIA 3AV1D 5HDCA 4B93A 1AWIA 2PD8A 1H8YA 5CPKB 2C5WB 3V67A 3AZLC 4H9SC 1KX3B 5BNXA 3PR6A 3MS6A 5CHJA 5JRGD 5AJGA 4LRYC 5B40B 5A8BA 3G32A 5HL1A 1TAFB 5B24A 3KWQC 4WEKA 3HREA 5GT3D 3ZVWA 5DNMD 5HL6A 3MNND 5HPFA 3IQAA 3AV1B 1RGYA 4J8WA 3HJIA 4KHAA 1MKMA 4GHAA 4HESA 4CLCD 3B6GB 2Q0OA 4OVDA 3LEZA 3CHWP 3UE1A 3NJAA 4HBTA 3MGPD 3O87A 4KZAA 3S1YA 4JF6A 1K55A 3LR3A 2B5RA 5GT3B 1ZHHB 3GQZA 3MNNB 2RTSA 5G4ZA 5AY8B 1XP4A 4PM8A 4UA6A 2RL3A 3KWQA 4OONA 1G28A 3DTIA 4R3AA 4P6BA 4LRXC 2ZM2A 1YMSA 5K5BA 3C5AA 3BQAA 3F1NA 4NETA 4WV4B 4MB5A 3MGPB 3EWKA 4Y3IA 3X1SA 2KOIA 4IBGA 3L9KA 4OP8A 3KSYA 2Y4AA 2VV6A 5B33D 5B2JD 5FAOA 1ACFA 2WKIA 1P3LC 4QPRA 5B1LC 2DNSA 3BQ8A 4OOLA 5DTTA 1JWPA 3H82B 1Z2CB 4NXEA 3PBNA 2J3WA 3T1QB 5GXQD 2PBDP 3AZGC 5HAQA 1D7EA 1SDNA 3WS5A 2Y2NA 2W3EA 4DN0A 3LYXA 5B0ZD 1XGIA 3B6FC 1BLPA 4JBFA 5GLBA 2RCXA 1VEUB 2EFXA 2DMWA 1P3KB 4H6JB 5EM0A 1F1EA 3AGFA 2XLNA 1W7FA 5L10A 5B40C 5TFQA 3JPUA 4O7DA 3A6NC 1ZG4A 5B0ZB 3C2WA 4I38A 2OAP1 4XZQA 4OLDA 1MZUA 3AV1C 3MGRA 4NFTA 1I5QA 4WL9A 1BULA 3NHQA 3B6GC 4X25A 2OV5A 3Q1FA 2VEAA 4H9NB 4ZJ1A 5EVEA 5JRGC 3IH9A 4Q0HA 3MVDB 1T1AA 1LLBA 2ACGA 1NY0A 5CHLB 3W97D 3BEBA 5GT3C 1PZPA 3MFDA 2V2FF 3AZIA 1JFIB 4IBXA 3MNNC 3X1VD 5CXWA 1GSXA 3F1OB 4TX8A 3GR2A 3A6NA 4F3LA 2X01A 2HP6A 5GT0A 4K08A 4R3JA 2H0YA 4Z5TD 3TU4B 3CG5A 2NZDA 3VFHA 3LZ1B 5BS7C 2UV0E 3KSHA 3MGPC 3H0MC 4GB7A 2BYMB 4ZUXD 3AZFB 5DF7A 3RJUA 1XKZA 4KUDD 3W97B 1JVJA 3W96A 3M6BA 2Z6CA 4QLCD 4H9RB 1G6OA 3X1VB 1ESUA 1PNEA 5DFYA 2VZWA 2WGIA 2XDMA 1OTAA 3IF6A 1K25A 1H8MA 3UT9D 1U35D 4Z5TB 5DNMA 3T4LA 1IEMA 2K7SA 5CTMA 3OBFA 3E2KA 5GLAA 3FPVA 5AVCA 3C4OA 5BO0B 3T1RA 3MZFA 4CLCA 3FKVA 1K6RA 3LJAB 3W4OA 3B0DB 3FKEA 1ZC2A 1KX5D 4OJLA 4DJ2A 4QLCB 4E45A 5FA7A 4P6ZS 1P3KC 3S7NA 4ID4A 4IVKA 5F1FA 4GS9A 5KDMA 1K56D 5AVBA 4OP5A 1CI8A 2IOUA 5GXQC 1FCMA 4EBPA 1ONGA 4ZBEA 3KXBD 2NQBA 2VGKA 3EPKA 5A93A 3MXQA 5B0ZC 3REKB 3TW8A 4BBVA 1KVLA 4ZJ3A 1E6NA 5B31B 4L9GA 3DBAA 3PBQA 2PHYA 5B33A 2ZQAA 5B2JA 3MZEA 2BG1A 5FDSA 1PZRA 3KXBB 1B6WA 5C5KA 3UB7A 2FJ7B 4G92C 5GXQA 1PDCA 5FSRA 5M19A 5FQMA 1J3WA 1T18A 2J8YA 4KZ3A 3WS2A 4IJFA 1CJFA 4HMDA 1MKIA 2OWHA 5GHXA 1MXOA 4X1LA 4II7A 2FZ0A 3VP0A 2WGVA 3TU4C 3IWIA 2JC7A 3LZ1C 1BLHA 3M7PA 1HVBA 4WMCA 3SS5A 4LV2A 1GHIA 5AVFA 5FI2A 3W97C 2B18A 1ED7A 3NDGA 4BENA 1E25A 4CAYA 3REJA 1XFQA 3X1VC 2PYOD 3GECA 1OGGA 5GHZA 2F8NG 5L2FA 4Z5TC 4S2IA 5KZHA 5GSUD 1EQZB 3TE8A 4HY8A 3OPHA 5B32G 2IWDA 3AZKA 3QNCA 4X23D 4ME4A 4KUDC 3LJAC 1KX4A 3B0DC 3W99A 4PMAA 4EETB 4QWOA 3IT9A 4QLCC 2ZD8A 3UE0A 5D3OA 3LELD 2INWA 2PDRA 3MGSA 3IBRA 1L0EA 3QP2A 4GN2A 4QHCA 3P09A 2Y2PA 4NE6A 1Q9CA 3UT9C 3E98A 1AOIA 1RCJA 4R6LA 3GV9A 1TDLA 2JKFA 3L25A 1P3PD 2IWCA 3V50A 3IX8A 5DNND 1TZYA 1ZTUA 3MKEA 5F99D 2Y2QA 1XJ3A 3BM6A 4ZUXA 3V9RB 3C1BA 1EAKA 1P3FB 1UR9A 1CI9A 4H9PA 4BQMA 2O0YA 2EX8A 3TJZC 1KDSA 4KGCD 5BOHA 5F68A 3KXBC 3N8SA 2PT7A 3HONA 4GD8A 3HBRA 4KUOA 4MDZA 4PHTA 3OZHA 4BL2A 5DNNB 3CAXA 1ODVA 3C30A 1U35A 2J8PA 3IXHA 3LZ0B 4LENA 1XJ6A 1GHMA 2WKEA 5F5YA 3NULA 4HGAB 1KX5A 4C75A 3G6OA 1S32A 1KDWA 4HOIA 5EVIA 2HPBA 3BLMA 1O7EA 1M19D 3CLOA 3MQ0A 2CV5B 4IJEA 3FG8A 2JKRI 3KSIA 3FYZA 5EM1A 2FN2A 1PI5A 2EX6A 1QMFA 1ERQA 3D72A 4DE2A 4WU9B 3IXDA 2W27A 1BT5A 4HNBA 2OSUA 3DAVA 3WRTA 3ZVTA 1EQZC 2O9CA 2VX8A 3OC2A 5DTSA 1PWCA 3AZED 3BRMA 2V1AA 1F66A 4OPQA 3O62B 4ARZB 1YU0A 4JXGA 5EPHA 5JYPA 4Y15A 3F1PA 2PYOC 3VOLA 3L26A 2A49A 5CGSA 2I9VA 1U60A 3WRZA 2ZL1B 3EPJA 1XFNA 4WBGA 3LIFA 3C7UA 1OTBA 1P3BA 2XD5A 4BD0A 2Y8HA 4EWFA 5G49A 4KUKA 4U0XA 4X6TA 3AYWA 1DP6A 2F8ND 4Z2JA 5CRFA 4EUVA 5J4EA 3O88A 4J8UA 3LELC 2B95A 2AROD 1P3MB 1WWIA 2EXAA 3ZCZA 5CPJD 5HZHA 1NYMA 1BH9A 1W63Q 3X1TB 1YSPA 2HDRA 5F69A 3UMDA 3ZG9B 2OOLA 3Q7VB 1C3BA 3VP4A 5L09A 5JA4B 3SS4A 2F8NK 4YM6D 4KG2A 4U0TA 4NZ5A 5DNNC 1FIKA 1Z6FA 5GSUA 5E5AB 4CSRB 2IO5C 4E44A 3AV2D 2AROB 3LZ0C 1YT4A 2DRWA 4QY6A 4X23A 4XT2B 4HGAC 3LICA 5B32B 1K54C 5G18A 4KGCC 4WNNB 1LL5A 4WUJA 4DKIA 2CV5C 3B0CT 3ZG0A 3WD2A 3AL0C 1XJ4A 4GD6A 4YM6B 4PKYG 3NI9A 5HDDA 2D49A 2G7UA 3B3XA 3C1CA 2G5IC 1X0OA 4H9QB 2Y59A 3KYQA 4HJ6A 4ZBJB 1Y54A 1P3PA 3WTPE 4H8RA 1M18D 3UTBB 1CK7A 2XGNA 1E15A 3WS1A 4A5RA 2HUEC 5F99A 1TD5A 2XRNA 1XA7A 4E04A 3W98D 4XUJA 1K6SA 1MWUA 3REIA 1ZLAA 1W8QA 1NYYA 2Y2GA 3M2JA 1KVMA 1K54A 1A0KA 4GDNA 3GMWA 4J8WB 3V39A 3MGQB 3DTEA 3L28A 4PPRA 1M18B 3EQUA 1MPLA 4LCMA 3ICYA 1NJ4A 3R7WA 3JVVA 1EROA 4IJGA 2HIOD 4GHIA 4OUIA 1LI9A 3OOVA 3W98B 2A24B 3HUMA 3KUYA 3IP4C 4OJ5A 3SZTA 3N8LA 4DRBA 1ZG6A 4G3KA 5FASA 1P34A 1H3OA 3CUEA 1M19A 4NY2A 4S2JA 4LRZE 1LL8A 2P04A 2VKSA 3X1TC 5F1GA 3B47A 3NOTC 3PAEA 2M7VA 3IXGA 2BYKA 4S2LA 3KX0X 2HIOB 3PYPA 1P3LD 5AQ9A 2D02A 3RFBA 3WAAA 3UB5P 3UO9A 5IS1A 1E4DA 1YMXA 3OPPA 5F82A 2EWVA 3EG5B 3D3OA 4NE3A 3AZGD 1CEGA 1N1JA 2AROC 1Z09A 4DJ3A 1ESIA 3S7QA 3AZEA 3BYDA 3IH8A 2WGWA 3CMZA 1ID3D 5B32C 1ERMA 4IBRA 5FAPA 1WYBA 5CPKD 3UTAA 3S7PA 3IWOA 3MF0A 3VV4A 4YM6C 3G34A 3WTPD 4WM9A 4ETZA 3AZHA 1KX3D 4U3TA 4YNRA 5CX7A 5A91A 1PWDA 2Y2HA 5B40D 2VV8A 5E2FA 3PBTA 1KE3A 3AV2C 2VGJA 4ZBJC 1DY6A 4S2MA 3P5JB 2R9WA 2ZOHA 4S2NA 4Z2LA 3T4SA 2HP9A 2F8NA 3PBSA 2W3GA 3NQUB 5AV8B 1G68A 3S7OA 2YFWB 5CPJA 2HDUA 3WTPB 3B6GD 4XZQB 3KO6A 4WZSB 3MGRB 4HH3A 4OOYA 2Y2JA 1P9RA 2J9OA 2HJ9C 3BW6A 1M18C 2J9PA 3W4PA 3BFFA 1SKOB 5CTNA 1P3AA 5AY8D 1ES2A 2RVQD 3AV2A 3AGEA 3LEQA 5DKKA 4R8PA 1G5UA 3W98C 1P3GB 4DXBA 5DVAA 5AV9B 4LCLA 3G2ZA 4JF5A 3TG9A 1LT0A 2XD1A 2Y2LA 3IX3A 4XXRA 3ZG7B 1NRFA 2PBYA 5B0YD 3AZJD 4F3LB 5GT0B 4ZDXA 1N9OA 4UUZB 3AZLA 1W2EA 4H9SA 3DWKA 5L8MA 3G2YA 1W79A 1MWTA 3WS4A 4PAUA 1IKIA 2HIOC 4BD1A 3AFAB 4QB8A 1PW8A 4Z2MG 5B31G 1LSVA 3MXRA 3CPTA 2P9VA 4YWZA 5B0YB 1GA9A 3AZJB 3E4PA 3K3CA 1UGUA 1VETB 2D01A 2GZAA 5BNVB 1STZA 5GHYA 3A1IA 3A3EA 2JBFA 4EESA 1I2SA 5AVEA 1FQGA 4HIAA 2J3TD 3NECA 3C8CA 4OPRA 5FDHA 4J8VD 2ZC6B 3UNWA 1P3KD 2M1CA 2IWBA 1YLJA 2EFUA 3VP1A 2P74A 4EXOA 4HMCA 3LIAA 4NXBA 5J8XA 2BTFP 2VK3A 4NEED 2W1TA 1M1AB 4GS9B 5AVBB 3FKWA 3G4PA 3LO7A 3H7WB 3NY4A 1ID3C 3QP4A 3WKJD 5B1MB 1K57C 3R45B 4J8VB 4E3LA 3UB6A 1ULYA 4FD8A 5KMWA 4MEZA 2NQBB 5AV8C 5CPKC 1CQAA 1XXMA 3KSFA 5HWTA 1S1YA 5J3WA 4N9KA 3WTPC 1KX3C 5TBMA 3IWQA 4EERA 3MVDD 2YFVB 3RELD 1P3LA 5B1LA 2E8JA 4OJ6A 1LSWA 3WKJB 2I72A 2Y91A 3GVBA 4NZ1A 4H9OA 3AZGA 3KS4A 3WS0A 1JWVA 1E3UD 5C3IB 2Y79A 3T4JA 1ES5A 2HJEA 1P3GC 3PAGA 1BFMA 5AV9C 3B6FA 1ID3A 4LD9B 3HJKA 3TU4D 4OJOA 3LZ1D 4UAAA 3RELB 3AZFD 3UDXA 2V20A 1N4OA 4L9EA 3E4OA 3LIDA 1KX3A 1H8ZA 1TS7A 2KLIA 5B40A 5AY8C 4IBDA 2WZXA 4ZAMA 3VSLA 2RVQC 1TAFA 3AN2B 2ZQ7A 1YKDA 3AFAC 4Z2GA 1XJ2A 1ONHA 3VFFA 1RP5A 2WUQA 5HD3A 1DJAA 4IBCA 3HLWA 1NLZA 3AV1A 5B0YC 3AZJC 1H0GA 3VP2A 2UWXA 4KQRA 3Q82A 4BMWA 1NZUA 3LJAD 5L07A 3B6GA 1YSQA 3GRJA 5JRGA 1OTEA 1P9WA 1M40A 1S4RA 4I3IA 2ZC5B 2L5AA 1L3LA 4IBBA 3OPLA 4HJ4A 3W99B 3P01A 4XUXA 4K0XA 4NG2A 5GT3A 4E6WA 1ZKJA 4YS3B 3MNNA 5HDSA 4B4ZA 3F6TA 2V9AA 1M1AC 2QKPA 1FSYA 3UY6A 3EEAA 3REKD 2J3TC 4JGQA 2ZC3B 5B1MC 4E3MA 4J8VC 2FH5A 2MJ6A 4N92A 2W0NA 5B31D 1AOIB 3B42A 5BS7A 4E3IA 3HCYA 3MGPA 2XA7S 3HL9A 1H5XA 2Z2LB 1WYCA 2O9AA 4JLFA 3ZHHA 3UPPA 1TZYB 1CEFA 4EV4A 3A3JA 4UPKA 4MBKA 1PYYA 4ESPA 3LR0A 4KG6A 2NUPC 3H82A 2FJ7D 4Z2KA 2H0TA 1A7WA 4X1MA 3WKJC 4JJND 4MLLA 1YLWA 5C3IC 4X68A 3CZDA 5FEFA
chains in the Genus database with same CATH topology
5AQ7A 1ALQA 1MWSA 4LD9C 4Z2MH 1Q2PA 2WADA 3X1UB 2Z2MB 1P3KA 3MVDC 3RELC 1TDGA 4WJ3C 4IEDA 3VP3A 5DF9A 1PW1A 5EVIB 4JJNB 3ZNYA 2WKHA 3BFCA 4OJPA 1FCNA 1L0GA 5B0ZA 4IBJA 3NQJB 1EQZD 1P3OD 3GTCA 3SH7A 2ZY4A 3AZFC 4DQYB 1P3IB 3H0RC 1IYQA 1LI0A 4GKUA 4DE3A 4KZ5A 1LHYA 4KZ6A 4WZ4A 2Y55A 1JFIA 2JE5A 4YS3C 1SHVA 1P3OB 3G30A 1IYSA 3N3FA 1E3UA 4S2PA 3REHD 3N4IA 1TEMA 2R9XA 2Y2KA 5FQKA 3BFEA 4CJNA 3TU4A 3LZ1A 2BYMA 3AZFA 1L2SA 1YQSA 1P3FD 3W97A 1PI4A 4H9RA 3X1VA 5GLDA 1BLSA 3REHB 3REKC 5AV5D 1IELA 5EVLA 4Z5TA 4WZ5C 5B31C 4Y0UA 3LZ0D 5BO0A 4FCFA 5HARA 4PM5A 4KUDA 3EQVA 3LJAA 4Z66D 3GSGA 4QLCA 5FAQA 3X1UC 4MNRA 3WA9B 3NC8A 4Y0TA 2CV5D 2PU4A 3UDIA 5DTKA 2ZY5A 2FJ7C 5AV5B 4KENB 4JJNC 3UT9A 3G35A 4PM6A 1ES3A 3O3VA 4GOGA 4WU9D 4E3JA 4Z66B 3C1CB 3MBZA 3MKFA 3QNBA 1P3IC 1EWZA 4WU8B 3O62D 2EX2A 1K56A 1SKFA 1YU3A 3KXBA 4KZ8A 1P3OC 1YM1A 1BLCA 1KGEA 4KQOA 1HQ3B 4JKTA 3AZMB 2WZZA 1R4VA 4OPYA 3UDFA 1GA0A 2A3UA 1P3MD 4RX2A 2Y2MA 3X1TD 2XFTA 1YLZA 5B2ID 4Y0OA 4WELA 4J8XB 5CP6B 3L27A 4OQIA 3REHC 4R4RA 4RVAA 2BLSA 1T3UA 5E5AD 1EQZA 4X69A 2EXBA 1P3FC 1NXYA 2OLUA 5FUGB 2W8SA 3A3DA 3MXSA 4HBUA 5B32D 5B2IB 3VOZA 3L2AA 3WA9C 2PYOA 4GH9A 4LV0A 5AV5C 5AV6D 1LL9A 4JXSA 2ZC4B 2E8IA 1K38A 3VH6T 3VH5A 3FWLA 2V1ZA 3VH5T 1TVFA 3SH9A 4Z66C 3UTBD 4DRAA 5EE8A 3Q7ZA 4JXWA 1I2WA 3LELA 3AZNB 4K0WA 4NK3A 3V9RA 4WU8C 3HLCA 1P3FA 4OQGA 5CERA 5A90A 1PWGA 5AV6B 5CPIB 1JTDA 5U47A 4J8WD 4NYUA 5KSCA 3HLEA 4RYEA 4WU9C 3MGQD 5BNXB 5DNNA 5HW3A 3Q07A 5B24B 4GHLA 4QNLA 3LZ0A 3O62C 1HQ3C 3AZMC 4R23A 3A3FA 4KGCA 1FR6A 2RIQA 4KHAB 5DF8A 5CGWA 2OLVA 2CV5A 1MY8A 3EPHA 3OPRA 2ZY2A 4OQ0A 4J8XC 3VSKA 4WU9A 4DXCA 3LY4A 5CHMA 4E3KA 4LV1A 1S0WA 3KWQB 1P3MC 4KZ9A 2J7VA 3O86A 5EOEA 4IBEA 3ITAA 3KS8A 5B2IC 1BUEA 4KQQA 1HTAA 5HX9A 3G31A 3X1SB 1W5DA 2XK1A 1MBLA 5E5AC 2G2WA 3PBOA 3B0CW 1PZOA 3UN7A 3AZNC 3IHAA 5AV8D 3S22A 2WAFA 1XGJA 3X1TA 4CPKA 4XZQD 4R3BA 5CPIC 5AV6C 4S2OA 3MGRD 3IHBA 2X02A 3TSGA 4IBIA 3Q7VA 5JA4A 3IXBA 4PM9A 2EX9A 3N7WA 3UTBC 1NZOA 4G91B 5E5AA 4CSRA 5B24C 5B1LB 2AROA 4X55A 3IF5A 1IYPA 1P3GD 5AV9D 3M6HA 5CGXA 3AZID 5B32A 4NYYA 1KGGA 3BECA 4J8WC 3BFGA 1PIOA 4RX3A 5GT0D 3DWZA 3MGQC 2DCFA 4YM6A 4IBKA 3SOIA 2NZDD 5EUAA 4H9QA 3AFAD 3WX7A 1BH8A 1K55C 5FQJA 3W96D 3UTBA 3AZIB 4DRTA 4P85A 5HAPA 5FQQA 2XEPA 2H5SA 3A6NB 4OOMA 2X71A 3PBRA 2NZDB 1GCEA 2ZM0A 2Q9NA 5AVCD 3X1SC 1KU5A 3Q81A 3MGQA 3ZGAB 3W96B 1M18A 5JRGB 1XX2A 4BL3A 1M1AD 5AVBD 1HZOA 3W98A 3IF6B 3D4FA 4EBNA 5DNMB 5B1MD 2NQBD 5AVCB 5TR7A 4N1HA 3ZDJA 2ZQ9A 1KE4A 3JYIA 5CECA 5BPVA 4EBLA 3DW0A 5AQBA 2HIOA 1ES4A 5KDMB 5CHUA 4DDSA 1B67A 3V3SA 2JCHA 5JYOA 2QPNA 3BFDA 3KFUG 4G91C 5GLCA 4XZQC 4OQHA 4LD9D 4E6XA 3MGRC 3HSHA 4KZBA 5A92A 4MBHA 4D2OA 5B33B 5B2JB 1YLTA 4WMCD 3AN2D 4FSFA 5GL9A 5BT1C 3HVFA 5GXQB 3REJD 3AZIC 1K57A 2CC1A 1L0FA 5E43A 3NQUA 4M6BA 5AV8A 5CPKA 2YFWA 5GT0C 2XR0A 3WTPA 2XFSA 2NZDC 4DF6A 3AZKD 1HD8A 1KX4D 3W99D 2DF4C 4E3NA 3W96C 4CAYB 3REJB 3MZDA 3NDEA 4YS3D 3VOYA 3L29A 4R0QA 3MGSD 1JTGA 3A1KA 1P3GA 5AV9A 3IF6C 4G92B 5DNMC 3N6IA 3EPLA 1XPBA 2ZLYA 2Y2IA 3AZKB 5AVCC 1AOID 3QHYA 3LCEA 1KX4B 4UUZA 2ZJ9A 1TZYD 3FZCA 4PM7A 1YU4A 5AY8A 3MGSB 3RXXA 3RXWA 3AFAA 3C1BD 5AVBC 2ZMAA 4F94A 4C3QA 3P98A 4AWLB 5B0YA 3AZJA 2NQBC 4KG5A 4IVIA 4X56A 5BNVA 4FH2A 2HP5A 1FSWA 2PU2A 3X1UD 1BZAA 3ZFZA 4ZUXB 1DJBA 3C1BB 1WWSA 3PTEA 4KUDB 4QJGA 4H9PB 4NE5A 5B33C 1S32D 5EVID 5B2JC 1M1AA 4Z9QA 3UT9B 1U35B 3BLSA 5B1MA 3R45A 4KZ7A 4J8VA 3ZG8B 3H0LC 3V5MA 1P3ID 1VQQA 5FATA 5M18A 3ZNTA 1KX5B 4XUZA 1S32B 3UPOA 1KGFA 2ZM8A 3W8KA 4EO5B 2YFVA 3AN2C 1F66D 4UA7A 5TGFA 4LG2A 3REJC 2QMIA 3WKJA 4QD4A 5E2EA 3HLDA 5EOOA 5HFOA 3S4XA 4NZ3A 3ISGA 3CJMA 5CEDA 4LD9A 4H9NA 4E3OA 4S2KA 3AZKC 3MVDA 4YINA 3RELA 1F66B 4JPMA 1P3BD 1FR1A 1OMEA 1KX4C 3W99C 3AYWD 4N9LA 3FDDA 4J8UD 4GZBA 3MGSC 3AN2A 1M6KA 4GNUA 3SH8A 4AWLC 3HUOA 2DQNC 1AOIC 1P3BB 2XQZA 5M1AA 5G49B 3FV7A 4LV3A 1TZYC 3AYWB 4BJPA 1L0DA 4J8UB 3WA9D 4ZUXC 2WYXA 3C1BC 1BH9B 3W4QA 5IHVA 4Y7PA 1YU2A 2PYOB 2XH9A 4YS3A 3NCKA 2JSSA 4OLGA 4EQIA 2Y2OA 4GDBA 1U35C 5GSUB 3C1CD 3HLFA 4X23B 1IYOA 2QZ6A 4WU8D 3DTMA 3NIAA 1JWZA 1KX5C 4B4XA 1S32C 5EVIC 4ZJ2A 5AQAA 3LELB 4EO5C 4DE0A 4XUJD 3REID 1ZLAD 1SDEA 3REKA 4OPZA 1BTLA 4WZ5A 1MWRA 1YLYA 5B31A 2CWEA 2ZC7A 2ZQCA 4OKPA 1P3PB 1HQ3D 3AZMD 5F99B 2IO5B 3X1UA 3AGDA 1F66C 4XUJB 1DJCA 3KUYD 4UA9A 3REIB 1ZLAB 2FJ7A 5CEBA 2G5HC 3A3IA 4JJNA 4KGCB 1YUEA 1P34D 2Q9MA 4J8XD 5CP6D 5F83A 2FFFB 5HAIA 3VMAA 3NQJA 5FQ9A 1FCOA 3WAAD 1P3BC 1P3IA 3ITBA 3KUYB 4X53A 3AYWC 2HUEB 1P34B 4J8UC 1H3OB 1M19B 4B88A 5FI6A 1N9BA 5E2GA 2XF3A 4UHUA 2BYKB 1YU1A 1Q2QA 1SCWA 1P3OA 3V3RA 3UTAD 3WAAB 1RGZA 3AZHD 3NBLA 5GSUC 1N1JB 3AZEB 3AZND 4R4SA 4X23C 2WGWB 5CPID 4OH0A 2ZQDA 3E2LA 3UTAB 3VH6A 3HLBA 3REHA 4K91A 3AZHB 3C1CC 4EUZA 4L0LA 5B24D 3C4PA 2F2AC 5FQIA 4YFMA 1P3PC 1P3AD 2F8NB 5F99C 2LY8A 3WA9A 4R8PD 5E2HA 4XUJC 5CPJB 3REIC 1ZLAC 1GHPA 1BSGA 2ZQ8A 3UE3A 2F8NH 5AV5A 2GDNA 4JXVA 4C6YA 3HLGA 3AZLD 3C7VA 1YLPA 4Z66A 1P3AB 4JF4A 4ZTKA 3AV2B 4R8PB 3KWQD 1BH8B 1KE0A 5KSHA 3KUYC 4WU8A 1O07A 4WEJA 1S6RA 1HTZA 2G2UA 1P34C 1FOFA 4P0MA 1M19C 5CP6C 5EECA 3UPNA 3X1SD 3AZLB 4WYYA 2ZM5A 4QU3A 4BLMA 3WAAC 3O62A 1HQ3A 2HDSA 3AZMA 1IKGA 3M2KA 4M3KA 3ZG5A 1VM1A 2P9VB 3N8RA 4DE1A 3AZEC 3HUNA 2VQRA 4N1XA 3VH6W 3VH5W 4KZ4A 4J8XA 3UTAC 5CP6A 2HDQA 3LY3A 1QMEA 1XA1A 3AZHC 4P87A 3TOIA 4QY5A 3B0BA 4MBFA 5B1LD 1AXBA 2FFYA 1P3MA 4R1GA 5FUGA 4S2NC 4Q8IA 4FH4A 5B2IA 2H10A 2WAEA 3WWXA 2C6WB 2WK0A 2ZY3A 5CPJC 5I94A 1J9MA 3B6FD 1K4FA 4IBFA 5FI7A 1K4EA 4DDYA 1P3LB 4HEFA 1CK3A 5BT1D 1EI5A 1G6AA 4RA7A 1P3AC 4H9OB 3AZGB 3I7JA 4WNNA 4NZ4A 1W8YA 4R8PC 3A6ND 3AZNA 3SS3A 3B6FB 1WE4A 1ID3B 3OCLA 3OCNA 5AV6A 5CPIA 3AV1D 1H8YA 5CPKB 2C5WB 3AZLC 4H9SC 1KX3B 5BNXA 5CHJA 5JRGD 5B40B 3G32A 5HL1A 1TAFB 5B24A 3KWQC 4WEKA 3HREA 5GT3D 3ZVWA 5DNMD 3MNND 3IQAA 3AV1B 1RGYA 4J8WA 4KHAA 4GHAA 4HESA 3B6GB 4OVDA 3LEZA 3UE1A 4HBTA 3MGPD 3O87A 4KZAA 3S1YA 4JF6A 1K55A 2B5RA 5GT3B 3GQZA 3MNNB 5AY8B 1XP4A 4PM8A 4UA6A 2RL3A 3KWQA 4OONA 4P6BA 2ZM2A 1YMSA 3C5AA 4NETA 4WV4B 3MGPB 3X1SA 4IBGA 4OP8A 3KSYA 2Y4AA 5B33D 5B2JD 5FAOA 2WKIA 1P3LC 5B1LC 2DNSA 4OOLA 5DTTA 1JWPA 1Z2CB 3PBNA 5GXQD 3AZGC 5HAQA 1SDNA 3WS5A 2Y2NA 5B0ZD 1XGIA 3B6FC 1BLPA 4JBFA 5GLBA 2RCXA 2EFXA 1P3KB 1F1EA 3AGFA 2XLNA 1W7FA 5B40C 5TFQA 4O7DA 3A6NC 1ZG4A 5B0ZB 4XZQA 4OLDA 3AV1C 3MGRA 4NFTA 1I5QA 1BULA 3B6GC 2OV5A 3Q1FA 4ZJ1A 4H9NB 5JRGC 3IH9A 3MVDB 1LLBA 1NY0A 5CHLB 3W97D 3BEBA 5GT3C 1PZPA 3MFDA 2V2FF 3AZIA 1JFIB 4IBXA 3MNNC 3X1VD 5CXWA 3GR2A 3A6NA 2X01A 2HP6A 5GT0A 4R3JA 2H0YA 4Z5TD 3TU4B 3CG5A 2NZDA 3VFHA 3LZ1B 5BS7C 3MGPC 3H0MC 4GB7A 2BYMB 4ZUXD 3AZFB 5DF7A 3RJUA 1XKZA 4KUDD 3W97B 1JVJA 3W96A 3M6BA 4QLCD 4H9RB 3X1VB 1ESUA 2WGIA 2XDMA 3IF6A 1K25A 3UT9D 1U35D 4Z5TB 5DNMA 1IEMA 5CTMA 3E2KA 5GLAA 5AVCA 3C4OA 5BO0B 3MZFA 3FKVA 1K6RA 3LJAB 3W4OA 3B0DB 3FKEA 1ZC2A 1KX5D 4OJLA 4QLCB 4E45A 5FA7A 1P3KC 4ID4A 4IVKA 5F1FA 5KDMA 1K56D 5AVBA 4OP5A 1CI8A 2IOUA 5GXQC 1FCMA 4EBPA 1ONGA 4ZBEA 3KXBD 2NQBA 2VGKA 3EPKA 5A93A 5B0ZC 3REKB 1KVLA 4ZJ3A 5B31B 3PBQA 5B33A 2ZQAA 5B2JA 3MZEA 2BG1A 1PZRA 3KXBB 1B6WA 2FJ7B 4G92C 5GXQA 5FSRA 5M19A 5FQMA 3WS2A 2J8YA 4KZ3A 4IJFA 1MKIA 5GHXA 1MXOA 3VP0A 2WGVA 3TU4C 3IWIA 2JC7A 3LZ1C 1BLHA 1HVBA 4WMCA 3SS5A 4LV2A 1GHIA 5FI2A 3W97C 3NDGA 4BENA 1E25A 4CAYA 3REJA 3X1VC 2PYOD 5GHZA 2F8NG 5L2FA 4Z5TC 4S2IA 5KZHA 5GSUD 1EQZB 3OPHA 5B32G 2IWDA 3AZKA 3QNCA 4X23D 4KUDC 3LJAC 1KX4A 3B0DC 3W99A 4PMAA 3IT9A 4QLCC 2ZD8A 3UE0A 5D3OA 3LELD 3MGSA 1L0EA 4GN2A 4QHCA 3P09A 2Y2PA 4NE6A 1Q9CA 3UT9C 1AOIA 1RCJA 3GV9A 1TDLA 3L25A 1P3PD 2IWCA 3V50A 5DNND 1TZYA 3MKEA 5F99D 2Y2QA 3BM6A 4ZUXA 3V9RB 3C1BA 1P3FB 1CI9A 4H9PA 4BQMA 2EX8A 1KDSA 4KGCD 5BOHA 3KXBC 3N8SA 3HONA 4GD8A 3HBRA 3OZHA 4BL2A 5DNNB 1U35A 2J8PA 3IXHA 3LZ0B 4LENA 1GHMA 2WKEA 4HGAB 1KX5A 4C75A 1S32A 1KDWA 5EVIA 2HPBA 3BLMA 1O7EA 1M19D 2CV5B 4IJEA 3FYZA 1PI5A 2EX6A 1QMFA 1ERQA 4DE2A 4WU9B 3IXDA 1BT5A 2OSUA 3WRTA 3ZVTA 1EQZC 3OC2A 5DTSA 1PWCA 3AZED 3BRMA 4OPQA 1F66A 3O62B 1YU0A 4JXGA 5EPHA 5JYPA 2PYOC 3L26A 2A49A 5CGSA 1U60A 3WRZA 3EPJA 4WBGA 3C7UA 1P3BA 2XD5A 4BD0A 4EWFA 5G49A 4U0XA 4X6TA 3AYWA 2F8ND 5CRFA 3O88A 4J8UA 3LELC 2AROD 1P3MB 1WWIA 2EXAA 3ZCZA 5CPJD 1NYMA 1BH9A 2HDRA 3X1TB 3ZG9B 3Q7VB 1C3BA 3VP4A 5JA4B 3SS4A 2F8NK 4YM6D 4KG2A 4U0TA 4NZ5A 5DNNC 1Z6FA 5GSUA 5E5AB 4CSRB 2IO5C 4E44A 3AV2D 2AROB 3LZ0C 1YT4A 2DRWA 4QY6A 4X23A 4HGAC 5B32B 1K54C 5G18A 4KGCC 4WNNB 1LL5A 4DKIA 2CV5C 3B0CT 3ZG0A 3AL0C 4GD6A 4YM6B 3NI9A 3B3XA 3C1CA 2G5IC 4H9QB 2Y59A 4ZBJB 1Y54A 1P3PA 3WTPE 4H8RA 1M18D 3UTBB 2XGNA 3WS1A 4A5RA 2HUEC 5F99A 1XA7A 3W98D 4XUJA 1K6SA 1MWUA 3REIA 1ZLAA 1W8QA 1NYYA 2Y2GA 3M2JA 1KVMA 1K54A 4GDNA 3GMWA 4J8WB 3V39A 3MGQB 3L28A 4PPRA 1M18B 3EQUA 1MPLA 4LCMA 1NJ4A 1EROA 2HIOD 4OUIA 1LI9A 3W98B 3HUMA 3KUYA 3IP4C 4OJ5A 3N8LA 4DRBA 1ZG6A 5FASA 1P34A 1H3OA 1M19A 4NY2A 4S2JA 3X1TC 5F1GA 3PAEA 3IXGA 2BYKA 4S2LA 2HIOB 1P3LD 5AQ9A 3WAAA 3UO9A 1E4DA 1YMXA 3OPPA 5F82A 3EG5B 4NE3A 3AZGD 1CEGA 1N1JA 2AROC 1ESIA 3AZEA 3BYDA 3IH8A 2WGWA 3CMZA 1ID3D 5B32C 1ERMA 4IBRA 5FAPA 1WYBA 5CPKD 3UTAA 3IWOA 4YM6C 3G34A 3WTPD 4WM9A 3AZHA 1KX3D 4U3TA 5A91A 1PWDA 2Y2HA 5B40D 5E2FA 3PBTA 1KE3A 3AV2C 2VGJA 4ZBJC 1DY6A 4S2MA 3P5JB 2R9WA 4S2NA 2HP9A 2F8NA 3PBSA 3NQUB 5AV8B 1G68A 2YFWB 5CPJA 2HDUA 3WTPB 3B6GD 4XZQB 4WZSB 3MGRB 4OOYA 2Y2JA 2J9OA 1M18C 2J9PA 3W4PA 3BFFA 5CTNA 1P3AA 5AY8D 1ES2A 2RVQD 3AV2A 3AGEA 4R8PA 3W98C 1P3GB 4DXBA 5DVAA 5AV9B 4LCLA 3G2ZA 4JF5A 3TG9A 2XD1A 2Y2LA 4XXRA 3ZG7B 1NRFA 2PBYA 5B0YD 3AZJD 5GT0B 4ZDXA 4UUZB 3AZLA 1W2EA 4H9SA 3DWKA 3G2YA 1W79A 1MWTA 3WS4A 1IKIA 2HIOC 4BD1A 3AFAB 4QB8A 1PW8A 4Z2MG 5B31G 3MXRA 2P9VA 5B0YB 1GA9A 3AZJB 5BNVB 5GHYA 3A1IA 3A3EA 2JBFA 1I2SA 1FQGA 4OPRA 5FDHA 4J8VD 2ZC6B 3UNWA 1P3KD 2IWBA 1YLJA 2EFUA 3VP1A 2P74A 5J8XA 1M1AB 5AVBB 3FKWA 3G4PA 3LO7A 3NY4A 1ID3C 3WKJD 5B1MB 1K57C 3R45B 4J8VB 4E3LA 1ULYA 4FD8A 5KMWA 4MEZA 2NQBB 5AV8C 5CPKC 1XXMA 4N9KA 3WTPC 1KX3C 3IWQA 3MVDD 2YFVB 3RELD 1P3LA 5B1LA 4OJ6A 3WKJB 2I72A 2Y91A 3GVBA 4NZ1A 4H9OA 3AZGA 3KS4A 3WS0A 1JWVA 1E3UD 5C3IB 1ES5A 1P3GC 3PAGA 1BFMA 5AV9C 3B6FA 1ID3A 4LD9B 3TU4D 4OJOA 3LZ1D 4UAAA 3RELB 3AZFD 3UDXA 2V20A 1N4OA 1KX3A 1H8ZA 5B40A 5AY8C 4IBDA 2WZXA 4ZAMA 3VSLA 2RVQC 1TAFA 3AN2B 2ZQ7A 3AFAC 1ONHA 3VFFA 1RP5A 2WUQA 1DJAA 4IBCA 3HLWA 3AV1A 5B0YC 3AZJC 3VP2A 2UWXA 4KQRA 3Q82A 1NZUA 3LJAD 3B6GA 3GRJA 5JRGA 1M40A 2ZC5B 2L5AA 4IBBA 3OPLA 3W99B 4XUXA 4K0XA 5GT3A 4E6WA 1ZKJA 4YS3B 3MNNA 4B4ZA 3F6TA 1M1AC 1FSYA 3UY6A 3REKD 4E3MA 2ZC3B 5B1MC 4J8VC 4N92A 5B31D 1AOIB 4E3IA 5BS7A 3MGPA 3HL9A 1H5XA 2Z2LB 1WYCA 4JLFA 3ZHHA 3UPPA 1TZYB 1CEFA 4EV4A 3A3JA 4UPKA 4MBKA 1PYYA 4KG6A 2FJ7D 2H0TA 1A7WA 3WKJC 4JJND 4MLLA 1YLWA 5C3IC 4X68A 3CZDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PI5 A;  2P9V B;  5AQ7 A;  1ALQ A;  1ES4 A;  2EX6 A;  3N8R A;  5CHU A;  4DE1 A;  1MWS A;  4DDS A;  1QMF A;  3HUN A;  1ERQ A;  1Q2P A;  2JCH A;  2WAD A;  4N1X A;  3V3S A;  2QPN A;  3BFD A;  5JYO A;  2Z2M B;  4DE2 A;  3IXD A;  1TDG A;  1BT5 A;  5GLC A;  2OSU A;  4IED A;  3VP3 A;  3WRT A;  4KZ4 A;  5DF9 A;  3ZVT A;  1PW1 A;  2HDQ A;  3LY3 A;  5EVI B;  1QME A;  3OC2 A;  2WKH A;  3ZNY A;  5DTS A;  1XA1 A;  1PWC A;  4OQH A;  3BRM A;  4OPQ A;  4E6X A;  4P87 A;  3BFC A;  3TOI A;  4KZB A;  4QY5 A;  5A92 A;  4JXG A;  4MBH A;  5EPH A;  1FCN A;  1L0G A;  4MBF A;  5JYP A;  1AXB A;  2FFY A;  4D2O A;  2A49 A;  5CGS A;  4R1G A;  3GTC A;  3SH7 A;  4S2N C;  4Q8I A;  1U60 A;  4FH4 A;  1YLT A;  3WRZ A;  2H10 A;  4WMC D;  2WAE A;  3WWX A;  4FSF A;  2C6W B;  1IYQ A;  5GL9 A;  2WK0 A;  1LI0 A;  4WBG A;  4GKU A;  4DE3 A;  3HVF A;  5I94 A;  3C7U A;  1J9M A;  4KZ5 A;  1K57 A;  2CC1 A;  2XD5 A;  4BD0 A;  1LHY A;  1L0F A;  4EWF A;  1K4F A;  5FI7 A;  4U0X A;  5E43 A;  4KZ6 A;  1K4E A;  4X6T A;  4DDY A;  4HEF A;  1CK3 A;  5CRF A;  4WZ4 A;  3O88 A;  2XR0 A;  2Y55 A;  2JE5 A;  2EXA A;  2XFS A;  1EI5 A;  1G6A A;  1SHV A;  3G30 A;  1IYS A;  3ZCZ A;  4RA7 A;  1E3U A;  4S2P A;  4DF6 A;  1NYM A;  2HDR A;  3N4I A;  3I7J A;  1HD8 A;  1TEM A;  1W8Y A;  2R9X A;  3ZG9 B;  4E3N A;  2Y2K A;  5FQK A;  3BFE A;  4CJN A;  3Q7V B;  1C3B A;  3VP4 A;  3SS3 A;  1WE4 A;  3MZD A;  3NDE A;  3SS4 A;  3VOY A;  3OCL A;  3OCN A;  4KG2 A;  4R0Q A;  1L2S A;  1YQS A;  4U0T A;  1Z6F A;  1JTG A;  1H8Y A;  1PI4 A;  3IF6 C;  2C5W B;  1YT4 A;  2DRW A;  3N6I A;  4QY6 A;  1XPB A;  5CHJ A;  2ZLY A;  2Y2I A;  5GLD A;  1BLS A;  3G32 A;  5HL1 A;  1K54 C;  5G18 A;  1IEL A;  3QHY A;  3LCE A;  4WEK A;  5EVL A;  1LL5 A;  2ZJ9 A;  4WZ5 C;  4DKI A;  3HRE A;  3FZC A;  4Y0U A;  4PM7 A;  3ZG0 A;  3ZVW A;  4GD6 A;  4FCF A;  3IQA A;  3RXX A;  3NI9 A;  5HAR A;  3RXW A;  4PM5 A;  3EQV A;  1RGY A;  3GSG A;  3B3X A;  2ZMA A;  4HES A;  5FAQ A;  4MNR A;  4C3Q A;  4F94 A;  2Y59 A;  3NC8 A;  4Y0T A;  3P98 A;  1Y54 A;  4H8R A;  2PU4 A;  4OVD A;  3LEZ A;  3UDI A;  4KG5 A;  4IVI A;  4X56 A;  3UE1 A;  5DTK A;  2XGN A;  4HBT A;  3WS1 A;  4A5R A;  4KEN B;  3O87 A;  4KZA A;  4FH2 A;  2HP5 A;  1XA7 A;  1FSW A;  4JF6 A;  1K55 A;  3G35 A;  4PM6 A;  3S1Y A;  2B5R A;  1ES3 A;  2PU2 A;  1K6S A;  1MWU A;  3O3V A;  4GOG A;  1W8Q A;  3GQZ A;  1BZA A;  1NYY A;  3ZFZ A;  2Y2G A;  3M2J A;  4E3J A;  1KVM A;  1DJB A;  1K54 A;  1XP4 A;  3PTE A;  4PM8 A;  4UA6 A;  2RL3 A;  4GDN A;  3GMW A;  4OON A;  4QJG A;  3M2K A;  3MKF A;  3MBZ A;  3QNB A;  3V39 A;  5EVI D;  4P6B A;  2ZM2 A;  1EWZ A;  4PPR A;  1YMS A;  3EQU A;  1MPL A;  2EX2 A;  1K56 A;  1SKF A;  3C5A A;  4LCM A;  4NET A;  1NJ4 A;  1ERO A;  4Z9Q A;  1LI9 A;  3BLS A;  4OP8 A;  4KZ7 A;  2Y4A A;  3HUM A;  3ZG8 B;  4KZ8 A;  5FAO A;  2WKI A;  3V5M A;  3N8L A;  1ZG6 A;  1VQQ A;  2DNS A;  5FAT A;  5M18 A;  5FAS A;  3ZNT A;  4OOL A;  5DTT A;  1JWP A;  4S2J A;  4XUZ A;  3PBN A;  3UPO A;  1KGF A;  1BLC A;  1YM1 A;  2ZM8 A;  3W8K A;  5F1G A;  1KGE A;  4KQO A;  4JKT A;  3PAE A;  5HAQ A;  3IXG A;  2WZZ A;  4UA7 A;  5TGF A;  4S2L A;  4OPY A;  1SDN A;  3UDF A;  1GA0 A;  2Y2N A;  3WS5 A;  2A3U A;  5AQ9 A;  1XGI A;  2QMI A;  4QD4 A;  1BLP A;  5E2E A;  4JBF A;  5GLB A;  3UO9 A;  2RCX A;  1E4D A;  1YMX A;  3HLD A;  3OPP A;  2EFX A;  5EOO A;  5F82 A;  5HFO A;  4RX2 A;  2Y2M A;  5AQB A;  3S4X A;  2XFT A;  3ISG A;  1YLZ A;  3AGF A;  4Y0O A;  3CJM A;  1CEG A;  4WEL A;  1ESI A;  5CED A;  4E3O A;  2XLN A;  3BYD A;  3IH8 A;  4OQI A;  4S2K A;  1W7F A;  4R4R A;  2WGW A;  3CMZ A;  4RVA A;  4JPM A;  2BLS A;  4YIN A;  1ERM A;  5TFQ A;  1FR1 A;  1OME A;  4O7D A;  4IBR A;  5FAP A;  1ZG4 A;  1WYB A;  3IWO A;  4N9L A;  4GZB A;  4OLD A;  4WM9 A;  2EXB A;  3G34 A;  4X69 A;  4U3T A;  1M6K A;  1NXY A;  2OLU A;  4GNU A;  3A3D A;  3MXS A;  5A91 A;  1PWD A;  2Y2H A;  4HBU A;  1I5Q A;  5E2F A;  3PBT A;  1KE3 A;  3VOZ A;  2VGJ A;  1BUL A;  3SH8 A;  1DY6 A;  3HUO A;  3Q1F A;  4S2M A;  4ZJ1 A;  2OV5 A;  2R9W A;  3IH9 A;  4S2N A;  2XQZ A;  4LV0 A;  5M1A A;  2HP9 A;  1LLB A;  3FV7 A;  1NY0 A;  3PBS A;  4LV3 A;  1LL9 A;  1G68 A;  4JXS A;  2ZC4 B;  3BEB A;  4BJP A;  2E8I A;  1PZP A;  1K38 A;  3MFD A;  2V2F F;  1L0D A;  2HDU A;  4IBX A;  2WYX A;  3FWL A;  5CXW A;  2V1Z A;  1TVF A;  3SH9 A;  3GR2 A;  4OOY A;  3W4Q A;  2X01 A;  5IHV A;  2HP6 A;  5EE8 A;  2Y2J A;  3Q7Z A;  4Y7P A;  4JXW A;  4R3J A;  1I2W A;  2H0Y A;  2J9O A;  2XH9 A;  4K0W A;  3NCK A;  4NK3 A;  3CG5 A;  3HLC A;  2J9P A;  3W4P A;  4OQG A;  4OLG A;  3VFH A;  4EQI A;  3BFF A;  2Y2O A;  5CER A;  5CTN A;  1PWG A;  4GB7 A;  5A90 A;  1ES2 A;  5DF7 A;  3RJU A;  1XKZ A;  3AGE A;  1JTD A;  5U47 A;  4GDB A;  1JVJ A;  4DXB A;  3M6B A;  5DVA A;  4LCL A;  5KSC A;  3G2Z A;  3HLE A;  4JF5 A;  4RYE A;  3HLF A;  3TG9 A;  2XD1 A;  2Y2L A;  4XXR A;  1IYO A;  3ZG7 B;  1ESU A;  2QZ6 A;  1NRF A;  3DTM A;  2PBY A;  3NIA A;  1JWZ A;  5HW3 A;  3Q07 A;  3FYZ A;  4B4X A;  2WGI A;  2XDM A;  5EVI C;  4ZDX A;  3IF6 A;  1K25 A;  4ZJ2 A;  5AQA A;  3DWK A;  1IEM A;  4DE0 A;  3G2Y A;  1W79 A;  1MWT A;  5CTM A;  3WS4 A;  3E2K A;  4R23 A;  5GLA A;  1IKI A;  3C4O A;  3A3F A;  1SDE A;  3MZF A;  4OPZ A;  4BD1 A;  3FKV A;  4QB8 A;  1FR6 A;  1K6R A;  3W4O A;  1PW8 A;  1BTL A;  1ZC2 A;  5DF8 A;  4WZ5 A;  5CGW A;  1MWR A;  1YLY A;  2OLV A;  5FA7 A;  1MY8 A;  3MXR A;  4ID4 A;  2ZC7 A;  2ZQC A;  4OKP A;  2P9V A;  4IVK A;  5F1F A;  1GA9 A;  1K56 D;  3OPR A;  4OP5 A;  1CI8 A;  4OQ0 A;  5GHY A;  3A3E A;  1FCM A;  2JBF A;  3AGD A;  1I2S A;  3VSK A;  4EBP A;  1FQG A;  1ONG A;  4DXC A;  4ZBE A;  4OPR A;  5FDH A;  1DJC A;  3LY4 A;  2ZC6 B;  4UA9 A;  5CHM A;  3UNW A;  2VGK A;  4E3K A;  4LV1 A;  2IWB A;  5A93 A;  5CEB A;  1YLJ A;  1S0W A;  2EFU A;  3A3I A;  1KVL A;  2P74 A;  3VP1 A;  4ZJ3 A;  2Q9M A;  4KZ9 A;  2J7V A;  3O86 A;  5EOE A;  5F83 A;  3ITA A;  2FFF B;  5J8X A;  1BUE A;  5HAI A;  3VMA A;  4KQQ A;  3FKW A;  3G4P A;  3LO7 A;  3G31 A;  3PBQ A;  5HX9 A;  5FQ9 A;  1W5D A;  2XK1 A;  2ZQA A;  3NY4 A;  1FCO A;  1K57 C;  2BG1 A;  3MZE A;  1MBL A;  4E3L A;  3ITB A;  4FD8 A;  5KMW A;  4MEZ A;  1XXM A;  4X53 A;  2G2W A;  3PBO A;  4N9K A;  5FSR A;  4B88 A;  5M19 A;  5FQM A;  3WS2 A;  2J8Y A;  4KZ3 A;  3IWQ A;  1MKI A;  5FI6 A;  1N9B A;  5E2G A;  5GHX A;  2XF3 A;  1MXO A;  1Q2Q A;  1PZO A;  4UHU A;  3UN7 A;  1SCW A;  3IHA A;  3VP0 A;  2WGV A;  3S22 A;  2WAF A;  3V3R A;  1XGJ A;  3IWI A;  2JC7 A;  2I72 A;  1BLH A;  1RGZ A;  2Y91 A;  3GVB A;  4CPK A;  1HVB A;  4WMC A;  4R3B A;  3SS5 A;  4S2O A;  4LV2 A;  3WS0 A;  3NBL A;  1GHI A;  1JWV A;  1E3U D;  3IHB A;  5FI2 A;  1ES5 A;  3NDG A;  2X02 A;  3TSG A;  4BEN A;  3PAG A;  3Q7V A;  1E25 A;  4R4S A;  3IXB A;  4PM9 A;  2EX9 A;  3N7W A;  1NZO A;  5GHZ A;  2WGW B;  4UAA A;  4OH0 A;  3UDX A;  5L2F A;  2ZQD A;  2V20 A;  1N4O A;  3IF5 A;  4X55 A;  4S2I A;  3E2L A;  5KZH A;  1IYP A;  1H8Z A;  3M6H A;  3HLB A;  3OPH A;  5CGX A;  2IWD A;  3QNC A;  3VSL A;  2WZX A;  4K91 A;  4ZAM A;  2ZQ7 A;  1KGG A;  3BEC A;  1ONH A;  4PMA A;  3VFF A;  3BFG A;  4EUZ A;  3IT9 A;  1PIO A;  1RP5 A;  2ZD8 A;  2WUQ A;  4L0L A;  4RX3 A;  3C4P A;  3DWZ A;  5D3O A;  3UE0 A;  2DCF A;  1DJA A;  5FQI A;  4YFM A;  3HLW A;  3SOI A;  5EUA A;  1L0E A;  4GN2 A;  3VP2 A;  2UWX A;  4QHC A;  3P09 A;  4KQR A;  2Y2P A;  3Q82 A;  1NZU A;  1K55 C;  5FQJ A;  5E2H A;  3GRJ A;  1M40 A;  1GHP A;  1RCJ A;  1BSG A;  2ZQ8 A;  3UE3 A;  2ZC5 B;  3GV9 A;  1TDL A;  4DRT A;  2GDN A;  4JXV A;  4P85 A;  5FQQ A;  2IWC A;  5HAP A;  3OPL A;  2XEP A;  3V50 A;  2H5S A;  4XUX A;  4K0X A;  4OOM A;  3MKE A;  4E6W A;  2Y2Q A;  1ZKJ A;  4C6Y A;  3HLG A;  4B4Z A;  3BM6 A;  3C7V A;  1YLP A;  2X71 A;  3PBR A;  1GCE A;  2ZM0 A;  1CI9 A;  1FSY A;  2Q9N A;  4JF4 A;  3UY6 A;  4BQM A;  4ZTK A;  2EX8 A;  1KDS A;  3Q81 A;  5BOH A;  4E3M A;  2ZC3 B;  1KE0 A;  3ZGA B;  5KSH A;  1O07 A;  3N8S A;  4N92 A;  4WEJ A;  4E3I A;  1S6R A;  4GD8 A;  3HBR A;  1HTZ A;  3OZH A;  1XX2 A;  3HL9 A;  4BL3 A;  4BL2 A;  1H5X A;  2G2U A;  1FOF A;  2Z2L B;  4P0M A;  1WYC A;  1HZO A;  4JLF A;  3ZHH A;  3UPP A;  5EEC A;  3UPN A;  3IF6 B;  1CEF A;  3D4F A;  3IXH A;  4EV4 A;  3A3J A;  4EBN A;  4LEN A;  4MBK A;  1GHM A;  2WKE A;  4WYY A;  1PYY A;  4QU3 A;  4BLM A;  4KG6 A;  4C75 A;  5TR7 A;  2H0T A;  4N1H A;  1KDW A;  5EVI A;  3ZDJ A;  2HPB A;  3BLM A;  2ZQ9 A;  1O7E A;  1KE4 A;  3JYI A;  5CEC A;  2HDS A;  4MLL A;  1YLW A;  1IKG A;  4EBL A;  4X68 A;  3DW0 A;  3CZD A;  4M3K A;  3ZG5 A;  1VM1 A; 
#chains in the Genus database with same CATH topology
 4HP4 A;  5AQ7 A;  1ALQ A;  1MWS A;  4LD9 C;  4Z2M H;  1VEU A;  1Q2P A;  2WAD A;  3X1U B;  3JVU A;  2Z2M B;  1P3K A;  3MVD C;  3A0V A;  3REL C;  2W3D A;  4H6J A;  4UQI S;  1TDG A;  4WJ3 C;  4IED A;  3VP3 A;  5DF9 A;  1PW1 A;  5EVI B;  1NRJ A;  4JJN B;  3ZNY A;  2WKH A;  1JNU A;  3QP1 A;  3BFC A;  4M4X A;  4OJP A;  1FCN A;  1L0G A;  5B0Z A;  4IBJ A;  2HV1 A;  4R70 A;  3NQJ B;  4EW7 A;  3T12 B;  1EQZ D;  1P3O D;  3GTC A;  3SH7 A;  2ZY4 A;  5F6A A;  3AZF C;  4DQY B;  1P3I B;  1S66 L;  3H0R C;  1IYQ A;  5DFX A;  1LI0 A;  1DRM A;  4GKU A;  4DE3 A;  2EWW A;  4KZ5 A;  3WD0 A;  1LHY A;  5HD5 A;  4KZ6 A;  4WZ4 A;  3U2A A;  2Y55 A;  1JFI A;  2JE5 A;  4YS3 C;  1SHV A;  1P3O B;  3G30 A;  1IYS A;  3N3F A;  1E3U A;  4S2P A;  3F1O A;  3REH D;  3N4I A;  1TEM A;  4HQA A;  3RH8 B;  2R9X A;  2Y2K A;  5FQK A;  3BFE A;  4CJN A;  3TU4 A;  3LZ1 A;  4LFU A;  2BYM A;  3AZF A;  1L2S A;  1YQS A;  1P3F D;  1S4S A;  3BJN A;  3W97 A;  1PI4 A;  1YAX A;  4H9R A;  5IT5 A;  3X1V A;  5GLD A;  2CMN A;  1BLS A;  3REH B;  3UB8 A;  3L7H A;  2VGL S;  3REK C;  5AV5 D;  1IEL A;  5EVL A;  4Z5T A;  4WZ5 C;  5B31 C;  4Y0U A;  4EEU A;  3LZ0 D;  3MMH A;  5BO0 A;  4FCF A;  5HAR A;  4PM5 A;  4KUD A;  3EQV A;  3LJA A;  4Z66 D;  3GSG A;  4QLC A;  1KS0 A;  5FAQ A;  3X1U C;  4MNR A;  3WA9 B;  3NC8 A;  4Y0T A;  4GCZ A;  2CV5 D;  2V5O A;  2PU4 A;  3UDI A;  5DTK A;  2ZY5 A;  2FJ7 C;  5AV5 B;  4KEN B;  4JJN C;  4GW9 A;  1S1Z A;  3UT9 A;  3G35 A;  3MFX A;  4PM6 A;  3IX4 A;  1ES3 A;  3T4Q A;  4I5S A;  1LSX A;  3O3V A;  4GOG A;  4WU9 D;  3K3D A;  4Z2H A;  4E3J A;  4Z66 B;  1UWN X;  2ZMF A;  3C1C B;  3MBZ A;  3MKF A;  3QNB A;  1P3I C;  1EWZ A;  4WU8 B;  3O62 D;  2EX2 A;  1K56 A;  1SKF A;  4WF0 A;  5DKL A;  1YU3 A;  1TS0 A;  3KXB A;  4KZ8 A;  4O01 A;  3EOI A;  1P3O C;  3T4T A;  1YM1 A;  1BLC A;  3B33 A;  2KX6 A;  1KGE A;  4CQH A;  2WKP A;  4KQO A;  1HQ3 B;  4JKT A;  3AZM B;  2WZZ A;  1R4V A;  4OPY A;  3UDF A;  3R7W B;  1GA0 A;  2A3U A;  4GHI B;  1P3M D;  4RX2 A;  2Y2M A;  3X1T D;  2XFT A;  3ZYT A;  1YLZ A;  5B2I D;  4Y0O A;  4LGW A;  1GPF A;  4WEL A;  2PAV P;  4J8X B;  5CP6 B;  3L27 A;  4OQI A;  3REH C;  4R4R A;  4RVA A;  2BLS A;  1T3U A;  3QP8 A;  4FTX A;  5E5A D;  1EQZ A;  5DJT A;  1F9I A;  4X69 A;  1UR8 A;  2EXB A;  1P3F C;  1NXY A;  2OLU A;  5FUG B;  2W8S A;  2L0W A;  3A3D A;  3MXS A;  3EEH A;  4HBU A;  5EV0 A;  5B32 D;  5B2I B;  3VOZ A;  4Q0I A;  3L2A A;  4B9O A;  3WA9 C;  2PYO A;  2PYR A;  4GH9 A;  1F2K A;  4G3V A;  1VB6 A;  3LIE A;  5AV5 C;  4LV0 A;  5AV6 D;  4UEY A;  1LL9 A;  4JXS A;  2HZ5 A;  2ZC4 B;  2E8I A;  1K38 A;  3VH6 T;  1S67 L;  3VH5 A;  3FWL A;  2QJ7 A;  4O8G A;  2V1Z A;  3VH5 T;  3VE3 A;  1TVF A;  3SH9 A;  4Z66 C;  3UTB D;  4DRA A;  5EE8 A;  3Q7Z A;  4JXW A;  1GOI A;  1I2W A;  3LEL A;  3AZN B;  4K0W A;  4NK3 A;  2QJ5 A;  3V9R A;  4WU8 C;  3CI6 A;  3HLC A;  1P3F A;  4OQG A;  4MMN A;  5CER A;  5A90 A;  1PWG A;  5AV6 B;  5CPI B;  3NOP C;  1JTD A;  5U47 A;  4J8W D;  4L9F A;  4NYU A;  4MB3 A;  5KSC A;  3HLE A;  4P6Z M;  4WU9 C;  4RYE A;  3MGQ D;  5BNX B;  2XA7 M;  5DJU A;  5DNN A;  1E6R A;  5HW3 A;  4Z2I A;  3Q07 A;  3LI9 A;  2QWS A;  5B24 B;  4GHL A;  4QNL A;  3LZ0 A;  4MN5 A;  1OT6 A;  3O62 C;  1HQ3 C;  3AZM C;  4R23 A;  1P97 A;  3A3F A;  4KGC A;  1FR6 A;  2RIQ A;  4KHA B;  1W1V A;  5DF8 A;  5CGW A;  2OLV A;  2CV5 A;  3IBJ A;  1MY8 A;  1WA9 A;  4MCW A;  3EPH A;  1VHM A;  1N9L A;  5J7E A;  2O99 A;  3OPR A;  2ZY2 A;  4OQ0 A;  4J8X C;  4EU0 A;  3VSK A;  2K2N A;  4WU9 A;  4DXC A;  4UQI M;  5HWW A;  3LY4 A;  5CHM A;  3RTY A;  4E3K A;  1P0Z A;  4LV1 A;  1S0W A;  3KWQ B;  1P3M C;  1IOU A;  1DP8 A;  4KZ9 A;  1KOU A;  2J7V A;  2JKT M;  3O86 A;  1HLU P;  5EOE A;  4IBE A;  3ITA A;  3KS8 A;  5B2I C;  1BUE A;  4Y17 A;  3F1N B;  4KQQ A;  1HTA A;  5HX9 A;  3G31 A;  3X1S B;  1W5D A;  3CIT A;  4WN5 A;  2XK1 A;  3LFV A;  1MBL A;  2XSS A;  1E8B A;  5E5A C;  2G2W A;  3PBO A;  2AVX A;  1F98 A;  4LPZ A;  5IU1 A;  3B0C W;  4HME A;  1PZO A;  3UN7 A;  3AZN C;  3IHA A;  3OLO A;  5AV8 D;  3S22 A;  2WAF A;  1XGJ A;  3MQQ A;  3X1T A;  4CPK A;  4XZQ D;  1GSW A;  5CPI C;  5AV6 C;  4R3B A;  4S2O A;  3MGR D;  3IHB A;  2X02 A;  3TSG A;  4IBI A;  3Q7V A;  5FL3 A;  4NXG A;  5JA4 A;  3IXB A;  4PM9 A;  2EX9 A;  4Y13 A;  3N7W A;  3UTB C;  1NZO A;  4G91 B;  5KIZ A;  5E5A A;  4CSR A;  1PRQ A;  5B24 C;  3K2N A;  5B1L B;  1T1C A;  2ARO A;  4X55 A;  3IF5 A;  3T4K A;  1IYP A;  1P3G D;  5AV9 D;  3KYZ A;  3M6H A;  4XT2 A;  5CGX A;  4GLQ A;  3AZI D;  5B32 A;  2VGL M;  4NYY A;  1KGG A;  1OJG A;  3BEC A;  4J8W C;  3BFG A;  2ZOI A;  1PIO A;  4RX3 A;  5GT0 D;  4MN6 A;  3DWZ A;  3MGQ C;  2DCF A;  4YM6 A;  4NXF A;  4I3A A;  4IBK A;  2W3F A;  3SOI A;  2NZD D;  5EUA A;  2B02 A;  3BY9 A;  4H9Q A;  3AFA D;  3WX7 A;  4JGP A;  1BH8 A;  1K55 C;  5FQJ A;  4BBT A;  3W96 D;  5G4Y A;  3UTB A;  3AZI B;  4DRT A;  4P85 A;  5HAP A;  5FQQ A;  2XEP A;  2H5S A;  3A6N B;  4OOM A;  3LI8 A;  4HP9 A;  2K31 A;  1TF1 A;  2X71 A;  3PBR A;  2NZD B;  1GCE A;  2ZM0 A;  2Q9N A;  5AVC D;  1W1T A;  3CWF A;  3X1S C;  1MC0 A;  1KU5 A;  3Q81 A;  3MGQ A;  3ZGA B;  3W96 B;  1M18 A;  4KQD A;  5JRG B;  1XX2 A;  4BL3 A;  1M1A D;  3O5Y A;  5AVB D;  1HZO A;  3W98 A;  2A24 A;  3EGD C;  3IF6 B;  2ZMV A;  3D4F A;  4EBN A;  5DNM B;  5B1M D;  1J7M A;  3MJQ A;  2NQB D;  5AVC B;  2PRF A;  5TR7 A;  4N1H A;  3ZDJ A;  4CLC B;  2ZQ9 A;  1KE4 A;  1H0I A;  3JYI A;  5CEC A;  5BPV A;  4EBL A;  3DW0 A;  5AQB A;  2HIO A;  4Y2F A;  1ES4 A;  5KDM B;  5CHU A;  1V9Z A;  4DDS A;  1B67 A;  3V3S A;  4ETX A;  2JCH A;  2PYP A;  4FUW A;  5JYO A;  2QPN A;  3BFD A;  3KFU G;  4G91 C;  5GLC A;  3ZQ5 A;  2O9B A;  1T19 A;  1GXD A;  2GNX A;  3IS2 A;  2LB5 A;  4XZQ C;  1OJ5 A;  4OQH A;  4LD9 D;  4E6X A;  3MGR C;  1H8P A;  3HSH A;  4KZB A;  5A92 A;  4MBH A;  2PR5 A;  1NLY A;  2PD7 A;  4D2O A;  4Y5F A;  5B33 B;  1OTI A;  1T1B A;  5B2J B;  4WLA A;  1YLT A;  4WMC D;  2WKQ A;  3AN2 D;  4FSF A;  5HWV A;  5GL9 A;  5BT1 C;  4MB4 A;  3HVF A;  5GXQ B;  3REJ D;  3AZI C;  1K57 A;  2CC1 A;  2HGV A;  2L1M A;  1L0F A;  5E43 A;  3NQU A;  4M6B A;  5AV8 A;  5CPK A;  2YFW A;  5GT0 C;  2XR0 A;  5FEG A;  3WTP A;  2XFS A;  1EW0 A;  2NZD C;  4DF6 A;  3AZK D;  1HD8 A;  1KX4 D;  3W99 D;  2DF4 C;  4E3N A;  3W96 C;  4IUK A;  4CAY B;  3REJ B;  3MZD A;  1SKO A;  3NDE A;  4YS3 D;  3UME A;  3VOY A;  3L29 A;  4R0Q A;  3MGS D;  1JTG A;  3A1K A;  1D1J A;  1P3G A;  5AV9 A;  3IF6 C;  4G92 B;  5DNM C;  3N6I A;  3EPL A;  1XPB A;  1W1Y A;  1YPR A;  2ZLY A;  2Y2I A;  5MC7 A;  3AZK B;  5AVC C;  1AOI D;  3H9W A;  1OPX A;  4CLC C;  3QHY A;  3LCE A;  1KX4 B;  2L4R A;  1E6P A;  4UUZ A;  2ZJ9 A;  2ZBB A;  4HH2 A;  1TZY D;  3FZC A;  4PM7 A;  3FPW A;  3C38 A;  1YU4 A;  4MN7 A;  5AY8 A;  3MGS B;  3RXX A;  3RXW A;  3AFA A;  3C1B D;  5AVB C;  1TS6 A;  4PKY A;  4D60 A;  2ZMA A;  4F94 A;  1CXW A;  4C3Q A;  3P98 A;  4AWL B;  3QP6 A;  5B0Y A;  4HI4 A;  3AZJ A;  2NQB C;  4HJ3 A;  4IVI A;  4KG5 A;  4X56 A;  5HPI A;  1VET A;  2GJ3 A;  5BNV A;  2W3H A;  4FH2 A;  2HP5 A;  1FSW A;  3SW1 A;  2OWJ A;  2PU2 A;  3X1U D;  1BZA A;  3ZFZ A;  4ZUX B;  1DJB A;  3C1B B;  1WWS A;  3PTE A;  2XRO A;  4KUD B;  2JKG A;  4QJG A;  1OTD A;  4H9P B;  1QO6 A;  4NE5 A;  5B33 C;  1S32 D;  5EVI D;  5B2J C;  3UE6 A;  1L6J A;  1IFQ A;  4I3J A;  4Q0J A;  1M1A A;  2PR6 A;  3A0S A;  3D9Y A;  4DMZ A;  2NUT C;  3H7W A;  4Z9Q A;  3UT9 B;  1U35 B;  3BLS A;  5B1M A;  3R45 A;  4KZ7 A;  4J8V A;  3LGO A;  3PXP A;  3ZG8 B;  3H0L C;  2VJW A;  4FOF A;  3V5M A;  1P3I D;  5I5L A;  1VQQ A;  5FAT A;  5M18 A;  3ZNT A;  1KX5 B;  4XUZ A;  1S32 B;  1BYW A;  3UPO A;  1KGF A;  2ZM8 A;  3W8K A;  4EO5 B;  2YFV A;  3AN2 C;  1F66 D;  4RQ9 A;  4UA7 A;  5TGF A;  4LG2 A;  1W1P A;  5TJJ A;  3REJ C;  2QMI A;  3WKJ A;  4QD4 A;  5E2E A;  1DP9 A;  3HLD A;  5EOO A;  5HFO A;  3S4X A;  4NZ3 A;  2V8C A;  4O0P A;  3ISG A;  3CJM A;  4JGO A;  2V0U A;  5CED A;  4LD9 A;  4H9N A;  4E3O A;  1H3Q A;  1CF0 A;  2V1B A;  3NOU C;  4S2K A;  3AZK C;  3MVD A;  4YIN A;  2JHE A;  3REL A;  1F66 B;  4JPM A;  1P3B D;  1FR1 A;  1OME A;  1KX4 C;  3W99 C;  3F1P B;  3AYW D;  3P7N A;  5LBR A;  4N9L A;  2VV7 A;  3FDD A;  4J8U D;  4GZB A;  1UWP X;  3MGS C;  4AFI A;  3AN2 A;  1M6K A;  4GNU A;  3WD4 A;  3SH8 A;  4AWL C;  3HUO A;  2DQN C;  1AOI C;  1P3B B;  2P08 A;  2XQZ A;  5M1A A;  2VLG A;  5G49 B;  3FV7 A;  4LV3 A;  3T1X A;  1TZY C;  3AYW B;  4BJP A;  1L0D A;  4J8U B;  3WA9 D;  4ZUX C;  2WYX A;  3C1B C;  2W1R A;  1BH9 B;  2QHK A;  3W4Q A;  5IHV A;  4Y7P A;  1YU2 A;  3LR5 A;  2PYO B;  2XH9 A;  4YS3 A;  3NCK A;  1N9N A;  2JSS A;  4OLG A;  4EQI A;  2Y2O A;  2VA0 A;  4IUH A;  4GDB A;  1U35 C;  5GSU B;  3C1C D;  3HLF A;  3W2Z A;  4X23 B;  1IYO A;  2QZ6 A;  4WU8 D;  3DTM A;  2YKF A;  1E88 A;  1JWZ A;  3NIA A;  4NKP A;  1KX5 C;  4B4X A;  1S32 C;  5EVI C;  4ZJ2 A;  5AQA A;  3LEL B;  4EO5 C;  1NWZ A;  4DE0 A;  4XUJ D;  3REI D;  1ZLA D;  1SDE A;  3REK A;  4OPZ A;  4GJ4 A;  1BTL A;  3MQO A;  4WZ5 A;  1MWR A;  1YLY A;  5B31 A;  2CWE A;  1SZV A;  2ZC7 A;  1GSV A;  2ZQC A;  4OKP A;  1P3P B;  1HQ3 D;  3AZM D;  5F99 B;  2IO5 B;  3X1U A;  3AGD A;  2BAS A;  2JN7 A;  2V8F A;  1F66 C;  2KDK A;  4XUJ B;  1DJC A;  3KUY D;  1V9Y A;  4UA9 A;  3REI B;  1ZLA B;  2FJ7 A;  1TS8 A;  5CEB A;  2G5H C;  3A3I A;  4JJN A;  4KGC B;  1YUE A;  1P34 D;  2Q9M A;  4J8X D;  5CP6 D;  4LLO B;  1K0K A;  2Z6D A;  5F83 A;  2FFF B;  1Y4O A;  5HAI A;  3VMA A;  3BY8 A;  3NQJ A;  5FQ9 A;  2JKR M;  1FCO A;  3WAA D;  1P3B C;  1P3I A;  3ITB A;  3KUY B;  2IA2 A;  3T50 A;  4X53 A;  3AYW C;  2HUE B;  1P34 B;  4J8U C;  1H3O B;  1M19 B;  4B88 A;  4IHQ A;  4JGR A;  4I39 A;  2LB9 A;  2V0W A;  5FI6 A;  1N9B A;  5E2G A;  2XF3 A;  3E4Q A;  4UHU A;  2BYK B;  1YU1 A;  1Q2Q A;  1SCW A;  1W63 M;  1P3O A;  3V3R A;  3UTA D;  4BWI A;  3WAA B;  3KSG A;  1RGZ A;  3AZH D;  3NBL A;  4Z1W A;  5GSU C;  1N1J B;  3U4L P;  3AZE B;  3AZN D;  4R4S A;  4X23 C;  3MQL A;  4ZRR A;  2WGW B;  5CPI D;  4OH0 A;  2ZQD A;  3E2L A;  3UTA B;  3VH6 A;  1D06 A;  3HLB A;  3REH A;  4R38 A;  4K91 A;  3AZH B;  3C1C C;  4EUZ A;  1AIW A;  4L0L A;  5B24 D;  3C4P A;  3TRC A;  2WKR A;  2F2A C;  5FQI A;  4YFM A;  3PHY A;  1P3P C;  3MSH A;  1P3A D;  2F8N B;  3GDI A;  5F99 C;  1Y28 A;  2LY8 A;  3WA9 A;  4R8P D;  5E2H A;  4XUJ C;  5CPJ B;  3REI C;  1ZLA C;  1GHP A;  1BSG A;  2ZQ8 A;  3UE3 A;  2H28 A;  2F8N H;  5AV5 A;  2GDN A;  4JXV A;  2R78 A;  1E6Z A;  4C6Y A;  5HSQ A;  3HLG A;  3ULF A;  3AZL D;  3C7V A;  1YLP A;  3KYE A;  4Z66 A;  1P3A B;  4JF4 A;  4ZTK A;  3AV2 B;  4R8P B;  3KWQ D;  1BH8 B;  1KE0 A;  5KSH A;  4EQ1 A;  3KUY C;  4WU8 A;  1O07 A;  4WEJ A;  1S6R A;  1HTZ A;  1PFL A;  2HF6 A;  2G2U A;  1P34 C;  1FOF A;  4P0M A;  3CUE C;  1M19 C;  2M7U A;  5CP6 C;  5EEC A;  3UPN A;  3X1S D;  3AZL B;  2A2L A;  4WYY A;  2ZM5 A;  4QU3 A;  2JKT I;  1O6I A;  4BLM A;  2GX5 A;  3EGX C;  3A0R A;  3FC7 A;  1OT9 A;  3WAA C;  4ARZ A;  3O62 A;  1HQ3 A;  2HDS A;  3WD1 A;  2YKH A;  3AZM A;  1IKG A;  3LIB A;  3M2K A;  3CPT B;  4M3K A;  3ZG5 A;  1VM1 A;  2P9V B;  3N8R A;  4DE1 A;  3LUQ A;  3AZE C;  3T4O A;  3DTK A;  3HUN A;  2VQR A;  4N1X A;  5EFW A;  1FIL A;  3VH6 W;  2QYB A;  4EEP A;  2ZL1 A;  3VH5 W;  3T1S A;  4KZ4 A;  4J8X A;  3UTA C;  5CP6 A;  2HDQ A;  2P7J A;  3LY3 A;  1QME A;  1XA1 A;  3R4K A;  4CLC E;  3AZH C;  4P87 A;  3TOI A;  4QY5 A;  3B0B A;  3UB9 A;  3VE4 A;  4MBF A;  2W1T B;  5B1L D;  1AXB A;  2FFY A;  1P3M A;  3QP5 A;  4R1G A;  3E0Y A;  5FUG A;  4S2N C;  4Q8I A;  4FH4 A;  5B2I A;  2H10 A;  2WAE A;  3WWX A;  2C6W B;  1H0M A;  2WK0 A;  2ZY3 A;  5CPJ C;  5I94 A;  1J9M A;  3IS2 B;  3B6F D;  4BBU A;  5TBM B;  1K4F A;  4IBF A;  5FI7 A;  1K4E A;  4DDY A;  1P3L B;  4HEF A;  1CK3 A;  3MR0 A;  5BT1 D;  1EI5 A;  1G6A A;  2OAQ 1;  4RA7 A;  1F5M A;  3BWL A;  1P3A C;  4H9O B;  3AZG B;  3I7J A;  4WNN A;  4NZ4 A;  1W8Y A;  4R8P C;  2J80 A;  3A6N D;  3AZN A;  1OGB A;  3LR4 A;  4G3W A;  3B6F B;  1WE4 A;  4HHD A;  3SS3 A;  4YOF A;  1ID3 B;  2EA9 A;  3OCL A;  3WD3 A;  3OCN A;  5AV6 A;  5CPI A;  3AV1 D;  5HDC A;  4B93 A;  1AWI A;  2PD8 A;  1H8Y A;  5CPK B;  2C5W B;  3V67 A;  3AZL C;  4H9S C;  1KX3 B;  5BNX A;  3PR6 A;  3MS6 A;  5CHJ A;  5JRG D;  5AJG A;  4LRY C;  5B40 B;  5A8B A;  3G32 A;  5HL1 A;  1TAF B;  5B24 A;  3KWQ C;  4WEK A;  3HRE A;  5GT3 D;  3ZVW A;  5DNM D;  5HL6 A;  3MNN D;  5HPF A;  3IQA A;  3AV1 B;  1RGY A;  4J8W A;  3HJI A;  4KHA A;  1MKM A;  4GHA A;  4HES A;  4CLC D;  3B6G B;  2Q0O A;  4OVD A;  3LEZ A;  3CHW P;  3UE1 A;  3NJA A;  4HBT A;  3MGP D;  3O87 A;  4KZA A;  3S1Y A;  4JF6 A;  1K55 A;  3LR3 A;  2B5R A;  5GT3 B;  1ZHH B;  3GQZ A;  3MNN B;  2RTS A;  5G4Z A;  5AY8 B;  1XP4 A;  4PM8 A;  4UA6 A;  2RL3 A;  3KWQ A;  4OON A;  1G28 A;  3DTI A;  4R3A A;  4P6B A;  4LRX C;  2ZM2 A;  1YMS A;  5K5B A;  3C5A A;  3BQA A;  3F1N A;  4NET A;  4WV4 B;  4MB5 A;  3MGP B;  3EWK A;  4Y3I A;  3X1S A;  2KOI A;  4IBG A;  3L9K A;  4OP8 A;  3KSY A;  2Y4A A;  2VV6 A;  5B33 D;  5B2J D;  5FAO A;  1ACF A;  2WKI A;  1P3L C;  4QPR A;  5B1L C;  2DNS A;  3BQ8 A;  4OOL A;  5DTT A;  1JWP A;  3H82 B;  1Z2C B;  4NXE A;  3PBN A;  2J3W A;  3T1Q B;  5GXQ D;  2PBD P;  3AZG C;  5HAQ A;  1D7E A;  1SDN A;  3WS5 A;  2Y2N A;  2W3E A;  4DN0 A;  3LYX A;  5B0Z D;  1XGI A;  3B6F C;  1BLP A;  4JBF A;  5GLB A;  2RCX A;  1VEU B;  2EFX A;  2DMW A;  1P3K B;  4H6J B;  5EM0 A;  1F1E A;  3AGF A;  2XLN A;  1W7F A;  5L10 A;  5B40 C;  5TFQ A;  3JPU A;  4O7D A;  3A6N C;  1ZG4 A;  5B0Z B;  3C2W A;  4I38 A;  2OAP 1;  4XZQ A;  4OLD A;  1MZU A;  3AV1 C;  3MGR A;  4NFT A;  1I5Q A;  4WL9 A;  1BUL A;  3NHQ A;  3B6G C;  4X25 A;  2OV5 A;  3Q1F A;  2VEA A;  4H9N B;  4ZJ1 A;  5EVE A;  5JRG C;  3IH9 A;  4Q0H A;  3MVD B;  1T1A A;  1LLB A;  2ACG A;  1NY0 A;  5CHL B;  3W97 D;  3BEB A;  5GT3 C;  1PZP A;  3MFD A;  2V2F F;  3AZI A;  1JFI B;  4IBX A;  3MNN C;  3X1V D;  5CXW A;  1GSX A;  3F1O B;  4TX8 A;  3GR2 A;  3A6N A;  4F3L A;  2X01 A;  2HP6 A;  5GT0 A;  4K08 A;  4R3J A;  2H0Y A;  4Z5T D;  3TU4 B;  3CG5 A;  2NZD A;  3VFH A;  3LZ1 B;  5BS7 C;  2UV0 E;  3KSH A;  3MGP C;  3H0M C;  4GB7 A;  2BYM B;  4ZUX D;  3AZF B;  5DF7 A;  3RJU A;  1XKZ A;  4KUD D;  3W97 B;  1JVJ A;  3W96 A;  3M6B A;  2Z6C A;  4QLC D;  4H9R B;  1G6O A;  3X1V B;  1ESU A;  1PNE A;  5DFY A;  2VZW A;  2WGI A;  2XDM A;  1OTA A;  3IF6 A;  1K25 A;  1H8M A;  3UT9 D;  1U35 D;  4Z5T B;  5DNM A;  3T4L A;  1IEM A;  2K7S A;  5CTM A;  3OBF A;  3E2K A;  5GLA A;  3FPV A;  5AVC A;  3C4O A;  5BO0 B;  3T1R A;  3MZF A;  4CLC A;  3FKV A;  1K6R A;  3LJA B;  3W4O A;  3B0D B;  3FKE A;  1ZC2 A;  1KX5 D;  4OJL A;  4DJ2 A;  4QLC B;  4E45 A;  5FA7 A;  4P6Z S;  1P3K C;  3S7N A;  4ID4 A;  4IVK A;  5F1F A;  4GS9 A;  5KDM A;  1K56 D;  5AVB A;  4OP5 A;  1CI8 A;  2IOU A;  5GXQ C;  1FCM A;  4EBP A;  1ONG A;  4ZBE A;  3KXB D;  2NQB A;  2VGK A;  3EPK A;  5A93 A;  3MXQ A;  5B0Z C;  3REK B;  3TW8 A;  4BBV A;  1KVL A;  4ZJ3 A;  1E6N A;  5B31 B;  4L9G A;  3DBA A;  3PBQ A;  2PHY A;  5B33 A;  2ZQA A;  5B2J A;  3MZE A;  2BG1 A;  5FDS A;  1PZR A;  3KXB B;  1B6W A;  5C5K A;  3UB7 A;  2FJ7 B;  4G92 C;  5GXQ A;  1PDC A;  5FSR A;  5M19 A;  5FQM A;  1J3W A;  1T18 A;  2J8Y A;  4KZ3 A;  3WS2 A;  4IJF A;  1CJF A;  4HMD A;  1MKI A;  2OWH A;  5GHX A;  1MXO A;  4X1L A;  4II7 A;  2FZ0 A;  3VP0 A;  2WGV A;  3TU4 C;  3IWI A;  2JC7 A;  3LZ1 C;  1BLH A;  3M7P A;  1HVB A;  4WMC A;  3SS5 A;  4LV2 A;  1GHI A;  5AVF A;  5FI2 A;  3W97 C;  2B18 A;  1ED7 A;  3NDG A;  4BEN A;  1E25 A;  4CAY A;  3REJ A;  1XFQ A;  3X1V C;  2PYO D;  3GEC A;  1OGG A;  5GHZ A;  2F8N G;  5L2F A;  4Z5T C;  4S2I A;  5KZH A;  5GSU D;  1EQZ B;  3TE8 A;  4HY8 A;  3OPH A;  5B32 G;  2IWD A;  3AZK A;  3QNC A;  4X23 D;  4ME4 A;  4KUD C;  3LJA C;  1KX4 A;  3B0D C;  3W99 A;  4PMA A;  4EET B;  4QWO A;  3IT9 A;  4QLC C;  2ZD8 A;  3UE0 A;  5D3O A;  3LEL D;  2INW A;  2PDR A;  3MGS A;  3IBR A;  1L0E A;  3QP2 A;  4GN2 A;  4QHC A;  3P09 A;  2Y2P A;  4NE6 A;  1Q9C A;  3UT9 C;  3E98 A;  1AOI A;  1RCJ A;  4R6L A;  3GV9 A;  1TDL A;  2JKF A;  3L25 A;  1P3P D;  2IWC A;  3V50 A;  3IX8 A;  5DNN D;  1TZY A;  1ZTU A;  3MKE A;  5F99 D;  2Y2Q A;  1XJ3 A;  3BM6 A;  4ZUX A;  3V9R B;  3C1B A;  1EAK A;  1P3F B;  1UR9 A;  1CI9 A;  4H9P A;  4BQM A;  2O0Y A;  2EX8 A;  3TJZ C;  1KDS A;  4KGC D;  5BOH A;  5F68 A;  3KXB C;  3N8S A;  2PT7 A;  3HON A;  4GD8 A;  3HBR A;  4KUO A;  4MDZ A;  4PHT A;  3OZH A;  4BL2 A;  5DNN B;  3CAX A;  1ODV A;  3C30 A;  1U35 A;  2J8P A;  3IXH A;  3LZ0 B;  4LEN A;  1XJ6 A;  1GHM A;  2WKE A;  5F5Y A;  3NUL A;  4HGA B;  1KX5 A;  4C75 A;  3G6O A;  1S32 A;  1KDW A;  4HOI A;  5EVI A;  2HPB A;  3BLM A;  1O7E A;  1M19 D;  3CLO A;  3MQ0 A;  2CV5 B;  4IJE A;  3FG8 A;  2JKR I;  3KSI A;  3FYZ A;  5EM1 A;  2FN2 A;  1PI5 A;  2EX6 A;  1QMF A;  1ERQ A;  3D72 A;  4DE2 A;  4WU9 B;  3IXD A;  2W27 A;  1BT5 A;  4HNB A;  2OSU A;  3DAV A;  3WRT A;  3ZVT A;  1EQZ C;  2O9C A;  2VX8 A;  3OC2 A;  5DTS A;  1PWC A;  3AZE D;  3BRM A;  2V1A A;  1F66 A;  4OPQ A;  3O62 B;  4ARZ B;  1YU0 A;  4JXG A;  5EPH A;  5JYP A;  4Y15 A;  3F1P A;  2PYO C;  3VOL A;  3L26 A;  2A49 A;  5CGS A;  2I9V A;  1U60 A;  3WRZ A;  2ZL1 B;  3EPJ A;  1XFN A;  4WBG A;  3LIF A;  3C7U A;  1OTB A;  1P3B A;  2XD5 A;  4BD0 A;  2Y8H A;  4EWF A;  5G49 A;  4KUK A;  4U0X A;  4X6T A;  3AYW A;  1DP6 A;  2F8N D;  4Z2J A;  5CRF A;  4EUV A;  5J4E A;  3O88 A;  4J8U A;  3LEL C;  2B95 A;  2ARO D;  1P3M B;  1WWI A;  2EXA A;  3ZCZ A;  5CPJ D;  5HZH A;  1NYM A;  1BH9 A;  1W63 Q;  3X1T B;  1YSP A;  2HDR A;  5F69 A;  3UMD A;  3ZG9 B;  2OOL A;  3Q7V B;  1C3B A;  3VP4 A;  5L09 A;  5JA4 B;  3SS4 A;  2F8N K;  4YM6 D;  4KG2 A;  4U0T A;  4NZ5 A;  5DNN C;  1FIK A;  1Z6F A;  5GSU A;  5E5A B;  4CSR B;  2IO5 C;  4E44 A;  3AV2 D;  2ARO B;  3LZ0 C;  1YT4 A;  2DRW A;  4QY6 A;  4X23 A;  4XT2 B;  4HGA C;  3LIC A;  5B32 B;  1K54 C;  5G18 A;  4KGC C;  4WNN B;  1LL5 A;  4WUJ A;  4DKI A;  2CV5 C;  3B0C T;  3ZG0 A;  3WD2 A;  3AL0 C;  1XJ4 A;  4GD6 A;  4YM6 B;  4PKY G;  3NI9 A;  5HDD A;  2D49 A;  2G7U A;  3B3X A;  3C1C A;  2G5I C;  1X0O A;  4H9Q B;  2Y59 A;  3KYQ A;  4HJ6 A;  4ZBJ B;  1Y54 A;  1P3P A;  3WTP E;  4H8R A;  1M18 D;  3UTB B;  1CK7 A;  2XGN A;  1E15 A;  3WS1 A;  4A5R A;  2HUE C;  5F99 A;  1TD5 A;  2XRN A;  1XA7 A;  4E04 A;  3W98 D;  4XUJ A;  1K6S A;  1MWU A;  3REI A;  1ZLA A;  1W8Q A;  1NYY A;  2Y2G A;  3M2J A;  1KVM A;  1K54 A;  1A0K A;  4GDN A;  3GMW A;  4J8W B;  3V39 A;  3MGQ B;  3DTE A;  3L28 A;  4PPR A;  1M18 B;  3EQU A;  1MPL A;  4LCM A;  3ICY A;  1NJ4 A;  3R7W A;  3JVV A;  1ERO A;  4IJG A;  2HIO D;  4GHI A;  4OUI A;  1LI9 A;  3OOV A;  3W98 B;  2A24 B;  3HUM A;  3KUY A;  3IP4 C;  4OJ5 A;  3SZT A;  3N8L A;  4DRB A;  1ZG6 A;  4G3K A;  5FAS A;  1P34 A;  1H3O A;  3CUE A;  1M19 A;  4NY2 A;  4S2J A;  4LRZ E;  1LL8 A;  2P04 A;  2VKS A;  3X1T C;  5F1G A;  3B47 A;  3NOT C;  3PAE A;  2M7V A;  3IXG A;  2BYK A;  4S2L A;  3KX0 X;  2HIO B;  3PYP A;  1P3L D;  5AQ9 A;  2D02 A;  3RFB A;  3WAA A;  3UB5 P;  3UO9 A;  5IS1 A;  1E4D A;  1YMX A;  3OPP A;  5F82 A;  2EWV A;  3EG5 B;  3D3O A;  4NE3 A;  3AZG D;  1CEG A;  1N1J A;  2ARO C;  1Z09 A;  4DJ3 A;  1ESI A;  3S7Q A;  3AZE A;  3BYD A;  3IH8 A;  2WGW A;  3CMZ A;  1ID3 D;  5B32 C;  1ERM A;  4IBR A;  5FAP A;  1WYB A;  5CPK D;  3UTA A;  3S7P A;  3IWO A;  3MF0 A;  3VV4 A;  4YM6 C;  3G34 A;  3WTP D;  4WM9 A;  4ETZ A;  3AZH A;  1KX3 D;  4U3T A;  4YNR A;  5CX7 A;  5A91 A;  1PWD A;  2Y2H A;  5B40 D;  2VV8 A;  5E2F A;  3PBT A;  1KE3 A;  3AV2 C;  2VGJ A;  4ZBJ C;  1DY6 A;  4S2M A;  3P5J B;  2R9W A;  2ZOH A;  4S2N A;  4Z2L A;  3T4S A;  2HP9 A;  2F8N A;  3PBS A;  2W3G A;  3NQU B;  5AV8 B;  1G68 A;  3S7O A;  2YFW B;  5CPJ A;  2HDU A;  3WTP B;  3B6G D;  4XZQ B;  3KO6 A;  4WZS B;  3MGR B;  4HH3 A;  4OOY A;  2Y2J A;  1P9R A;  2J9O A;  2HJ9 C;  3BW6 A;  1M18 C;  2J9P A;  3W4P A;  3BFF A;  1SKO B;  5CTN A;  1P3A A;  5AY8 D;  1ES2 A;  2RVQ D;  3AV2 A;  3AGE A;  3LEQ A;  5DKK A;  4R8P A;  1G5U A;  3W98 C;  1P3G B;  4DXB A;  5DVA A;  5AV9 B;  4LCL A;  3G2Z A;  4JF5 A;  3TG9 A;  1LT0 A;  2XD1 A;  2Y2L A;  3IX3 A;  4XXR A;  3ZG7 B;  1NRF A;  2PBY A;  5B0Y D;  3AZJ D;  4F3L B;  5GT0 B;  4ZDX A;  1N9O A;  4UUZ B;  3AZL A;  1W2E A;  4H9S A;  3DWK A;  5L8M A;  3G2Y A;  1W79 A;  1MWT A;  3WS4 A;  4PAU A;  1IKI A;  2HIO C;  4BD1 A;  3AFA B;  4QB8 A;  1PW8 A;  4Z2M G;  5B31 G;  1LSV A;  3MXR A;  3CPT A;  2P9V A;  4YWZ A;  5B0Y B;  1GA9 A;  3AZJ B;  3E4P A;  3K3C A;  1UGU A;  1VET B;  2D01 A;  2GZA A;  5BNV B;  1STZ A;  5GHY A;  3A1I A;  3A3E A;  2JBF A;  4EES A;  1I2S A;  5AVE A;  1FQG A;  4HIA A;  2J3T D;  3NEC A;  3C8C A;  4OPR A;  5FDH A;  4J8V D;  2ZC6 B;  3UNW A;  1P3K D;  2M1C A;  2IWB A;  1YLJ A;  2EFU A;  3VP1 A;  2P74 A;  4EXO A;  4HMC A;  3LIA A;  4NXB A;  5J8X A;  2BTF P;  2VK3 A;  4NEE D;  2W1T A;  1M1A B;  4GS9 B;  5AVB B;  3FKW A;  3G4P A;  3LO7 A;  3H7W B;  3NY4 A;  1ID3 C;  3QP4 A;  3WKJ D;  5B1M B;  1K57 C;  3R45 B;  4J8V B;  4E3L A;  3UB6 A;  1ULY A;  4FD8 A;  5KMW A;  4MEZ A;  2NQB B;  5AV8 C;  5CPK C;  1CQA A;  1XXM A;  3KSF A;  5HWT A;  1S1Y A;  5J3W A;  4N9K A;  3WTP C;  1KX3 C;  5TBM A;  3IWQ A;  4EER A;  3MVD D;  2YFV B;  3REL D;  1P3L A;  5B1L A;  2E8J A;  4OJ6 A;  1LSW A;  3WKJ B;  2I72 A;  2Y91 A;  3GVB A;  4NZ1 A;  4H9O A;  3AZG A;  3KS4 A;  3WS0 A;  1JWV A;  1E3U D;  5C3I B;  2Y79 A;  3T4J A;  1ES5 A;  2HJE A;  1P3G C;  3PAG A;  1BFM A;  5AV9 C;  3B6F A;  1ID3 A;  4LD9 B;  3HJK A;  3TU4 D;  4OJO A;  3LZ1 D;  4UAA A;  3REL B;  3AZF D;  3UDX A;  2V20 A;  1N4O A;  4L9E A;  3E4O A;  3LID A;  1KX3 A;  1H8Z A;  1TS7 A;  2KLI A;  5B40 A;  5AY8 C;  4IBD A;  2WZX A;  4ZAM A;  3VSL A;  2RVQ C;  1TAF A;  3AN2 B;  2ZQ7 A;  1YKD A;  3AFA C;  4Z2G A;  1XJ2 A;  1ONH A;  3VFF A;  1RP5 A;  2WUQ A;  5HD3 A;  1DJA A;  4IBC A;  3HLW A;  1NLZ A;  3AV1 A;  5B0Y C;  3AZJ C;  1H0G A;  3VP2 A;  2UWX A;  4KQR A;  3Q82 A;  4BMW A;  1NZU A;  3LJA D;  5L07 A;  3B6G A;  1YSQ A;  3GRJ A;  5JRG A;  1OTE A;  1P9W A;  1M40 A;  1S4R A;  4I3I A;  2ZC5 B;  2L5A A;  1L3L A;  4IBB A;  3OPL A;  4HJ4 A;  3W99 B;  3P01 A;  4XUX A;  4K0X A;  4NG2 A;  5GT3 A;  4E6W A;  1ZKJ A;  4YS3 B;  3MNN A;  5HDS A;  4B4Z A;  3F6T A;  2V9A A;  1M1A C;  2QKP A;  1FSY A;  3UY6 A;  3EEA A;  3REK D;  2J3T C;  4JGQ A;  2ZC3 B;  5B1M C;  4E3M A;  4J8V C;  2FH5 A;  2MJ6 A;  4N92 A;  2W0N A;  5B31 D;  1AOI B;  3B42 A;  5BS7 A;  4E3I A;  3HCY A;  3MGP A;  2XA7 S;  3HL9 A;  1H5X A;  2Z2L B;  1WYC A;  2O9A A;  4JLF A;  3ZHH A;  3UPP A;  1TZY B;  1CEF A;  4EV4 A;  3A3J A;  4UPK A;  4MBK A;  1PYY A;  4ESP A;  3LR0 A;  4KG6 A;  2NUP C;  3H82 A;  2FJ7 D;  4Z2K A;  2H0T A;  1A7W A;  4X1M A;  3WKJ C;  4JJN D;  4MLL A;  1YLW A;  5C3I C;  4X68 A;  3CZD A;  5FEF A; 
#chains in the Genus database with same CATH homology
 5AQ7 A;  1ALQ A;  1MWS A;  4LD9 C;  4Z2M H;  1Q2P A;  2WAD A;  3X1U B;  2Z2M B;  1P3K A;  3MVD C;  3REL C;  1TDG A;  4WJ3 C;  4IED A;  3VP3 A;  5DF9 A;  1PW1 A;  5EVI B;  4JJN B;  3ZNY A;  2WKH A;  3BFC A;  4OJP A;  1FCN A;  1L0G A;  5B0Z A;  4IBJ A;  3NQJ B;  1EQZ D;  1P3O D;  3GTC A;  3SH7 A;  2ZY4 A;  3AZF C;  4DQY B;  1P3I B;  3H0R C;  1IYQ A;  1LI0 A;  4GKU A;  4DE3 A;  4KZ5 A;  1LHY A;  4KZ6 A;  4WZ4 A;  2Y55 A;  1JFI A;  2JE5 A;  4YS3 C;  1SHV A;  1P3O B;  3G30 A;  1IYS A;  3N3F A;  1E3U A;  4S2P A;  3REH D;  3N4I A;  1TEM A;  2R9X A;  2Y2K A;  5FQK A;  3BFE A;  4CJN A;  3TU4 A;  3LZ1 A;  2BYM A;  3AZF A;  1L2S A;  1YQS A;  1P3F D;  3W97 A;  1PI4 A;  4H9R A;  3X1V A;  5GLD A;  1BLS A;  3REH B;  3REK C;  5AV5 D;  1IEL A;  5EVL A;  4Z5T A;  4WZ5 C;  5B31 C;  4Y0U A;  3LZ0 D;  5BO0 A;  4FCF A;  5HAR A;  4PM5 A;  4KUD A;  3EQV A;  3LJA A;  4Z66 D;  3GSG A;  4QLC A;  5FAQ A;  3X1U C;  4MNR A;  3WA9 B;  3NC8 A;  4Y0T A;  2CV5 D;  2PU4 A;  3UDI A;  5DTK A;  2ZY5 A;  2FJ7 C;  5AV5 B;  4KEN B;  4JJN C;  3UT9 A;  3G35 A;  4PM6 A;  1ES3 A;  3O3V A;  4GOG A;  4WU9 D;  4E3J A;  4Z66 B;  3C1C B;  3MBZ A;  3MKF A;  3QNB A;  1P3I C;  1EWZ A;  4WU8 B;  3O62 D;  2EX2 A;  1K56 A;  1SKF A;  1YU3 A;  3KXB A;  4KZ8 A;  1P3O C;  1YM1 A;  1BLC A;  1KGE A;  4KQO A;  1HQ3 B;  4JKT A;  3AZM B;  2WZZ A;  1R4V A;  4OPY A;  3UDF A;  1GA0 A;  2A3U A;  1P3M D;  4RX2 A;  2Y2M A;  3X1T D;  2XFT A;  1YLZ A;  5B2I D;  4Y0O A;  4WEL A;  4J8X B;  5CP6 B;  3L27 A;  4OQI A;  3REH C;  4R4R A;  4RVA A;  2BLS A;  1T3U A;  5E5A D;  1EQZ A;  4X69 A;  2EXB A;  1P3F C;  1NXY A;  2OLU A;  5FUG B;  2W8S A;  3A3D A;  3MXS A;  4HBU A;  5B32 D;  5B2I B;  3VOZ A;  3L2A A;  3WA9 C;  2PYO A;  4GH9 A;  4LV0 A;  5AV5 C;  5AV6 D;  1LL9 A;  4JXS A;  2ZC4 B;  2E8I A;  1K38 A;  3VH6 T;  3VH5 A;  3FWL A;  2V1Z A;  3VH5 T;  1TVF A;  3SH9 A;  4Z66 C;  3UTB D;  4DRA A;  5EE8 A;  3Q7Z A;  4JXW A;  1I2W A;  3LEL A;  3AZN B;  4K0W A;  4NK3 A;  3V9R A;  4WU8 C;  3HLC A;  1P3F A;  4OQG A;  5CER A;  5A90 A;  1PWG A;  5AV6 B;  5CPI B;  1JTD A;  5U47 A;  4J8W D;  4NYU A;  5KSC A;  3HLE A;  4RYE A;  4WU9 C;  3MGQ D;  5BNX B;  5DNN A;  5HW3 A;  3Q07 A;  5B24 B;  4GHL A;  4QNL A;  3LZ0 A;  3O62 C;  1HQ3 C;  3AZM C;  4R23 A;  3A3F A;  4KGC A;  1FR6 A;  2RIQ A;  4KHA B;  5DF8 A;  5CGW A;  2OLV A;  2CV5 A;  1MY8 A;  3EPH A;  3OPR A;  2ZY2 A;  4OQ0 A;  4J8X C;  3VSK A;  4WU9 A;  4DXC A;  3LY4 A;  5CHM A;  4E3K A;  4LV1 A;  1S0W A;  3KWQ B;  1P3M C;  4KZ9 A;  2J7V A;  3O86 A;  5EOE A;  4IBE A;  3ITA A;  3KS8 A;  5B2I C;  1BUE A;  4KQQ A;  1HTA A;  5HX9 A;  3G31 A;  3X1S B;  1W5D A;  2XK1 A;  1MBL A;  5E5A C;  2G2W A;  3PBO A;  3B0C W;  1PZO A;  3UN7 A;  3AZN C;  3IHA A;  5AV8 D;  3S22 A;  2WAF A;  1XGJ A;  3X1T A;  4CPK A;  4XZQ D;  4R3B A;  5CPI C;  5AV6 C;  4S2O A;  3MGR D;  3IHB A;  2X02 A;  3TSG A;  4IBI A;  3Q7V A;  5JA4 A;  3IXB A;  4PM9 A;  2EX9 A;  3N7W A;  3UTB C;  1NZO A;  4G91 B;  5E5A A;  4CSR A;  5B24 C;  5B1L B;  2ARO A;  4X55 A;  3IF5 A;  1IYP A;  1P3G D;  5AV9 D;  3M6H A;  5CGX A;  3AZI D;  5B32 A;  4NYY A;  1KGG A;  3BEC A;  4J8W C;  3BFG A;  1PIO A;  4RX3 A;  5GT0 D;  3DWZ A;  3MGQ C;  2DCF A;  4YM6 A;  4IBK A;  3SOI A;  2NZD D;  5EUA A;  4H9Q A;  3AFA D;  3WX7 A;  1BH8 A;  1K55 C;  5FQJ A;  3W96 D;  3UTB A;  3AZI B;  4DRT A;  4P85 A;  5HAP A;  5FQQ A;  2XEP A;  2H5S A;  3A6N B;  4OOM A;  2X71 A;  3PBR A;  2NZD B;  1GCE A;  2ZM0 A;  2Q9N A;  5AVC D;  3X1S C;  1KU5 A;  3Q81 A;  3MGQ A;  3ZGA B;  3W96 B;  1M18 A;  5JRG B;  1XX2 A;  4BL3 A;  1M1A D;  5AVB D;  1HZO A;  3W98 A;  3IF6 B;  3D4F A;  4EBN A;  5DNM B;  5B1M D;  2NQB D;  5AVC B;  5TR7 A;  4N1H A;  3ZDJ A;  2ZQ9 A;  1KE4 A;  3JYI A;  5CEC A;  5BPV A;  4EBL A;  3DW0 A;  5AQB A;  2HIO A;  1ES4 A;  5KDM B;  5CHU A;  4DDS A;  1B67 A;  3V3S A;  2JCH A;  5JYO A;  2QPN A;  3BFD A;  3KFU G;  4G91 C;  5GLC A;  4XZQ C;  4OQH A;  4LD9 D;  4E6X A;  3MGR C;  3HSH A;  4KZB A;  5A92 A;  4MBH A;  4D2O A;  5B33 B;  5B2J B;  1YLT A;  4WMC D;  3AN2 D;  4FSF A;  5GL9 A;  5BT1 C;  3HVF A;  5GXQ B;  3REJ D;  3AZI C;  1K57 A;  2CC1 A;  1L0F A;  5E43 A;  3NQU A;  4M6B A;  5AV8 A;  5CPK A;  2YFW A;  5GT0 C;  2XR0 A;  3WTP A;  2XFS A;  2NZD C;  4DF6 A;  3AZK D;  1HD8 A;  1KX4 D;  3W99 D;  2DF4 C;  4E3N A;  3W96 C;  4CAY B;  3REJ B;  3MZD A;  3NDE A;  4YS3 D;  3VOY A;  3L29 A;  4R0Q A;  3MGS D;  1JTG A;  3A1K A;  1P3G A;  5AV9 A;  3IF6 C;  4G92 B;  5DNM C;  3N6I A;  3EPL A;  1XPB A;  2ZLY A;  2Y2I A;  3AZK B;  5AVC C;  1AOI D;  3QHY A;  3LCE A;  1KX4 B;  4UUZ A;  2ZJ9 A;  1TZY D;  3FZC A;  4PM7 A;  1YU4 A;  5AY8 A;  3MGS B;  3RXX A;  3RXW A;  3AFA A;  3C1B D;  5AVB C;  2ZMA A;  4F94 A;  4C3Q A;  3P98 A;  4AWL B;  5B0Y A;  3AZJ A;  2NQB C;  4KG5 A;  4IVI A;  4X56 A;  5BNV A;  4FH2 A;  2HP5 A;  1FSW A;  2PU2 A;  3X1U D;  1BZA A;  3ZFZ A;  4ZUX B;  1DJB A;  3C1B B;  1WWS A;  3PTE A;  4KUD B;  4QJG A;  4H9P B;  4NE5 A;  5B33 C;  1S32 D;  5EVI D;  5B2J C;  1M1A A;  4Z9Q A;  3UT9 B;  1U35 B;  3BLS A;  5B1M A;  3R45 A;  4KZ7 A;  4J8V A;  3ZG8 B;  3H0L C;  3V5M A;  1P3I D;  1VQQ A;  5FAT A;  5M18 A;  3ZNT A;  1KX5 B;  4XUZ A;  1S32 B;  3UPO A;  1KGF A;  2ZM8 A;  3W8K A;  4EO5 B;  2YFV A;  3AN2 C;  1F66 D;  4UA7 A;  5TGF A;  4LG2 A;  3REJ C;  2QMI A;  3WKJ A;  4QD4 A;  5E2E A;  3HLD A;  5EOO A;  5HFO A;  3S4X A;  4NZ3 A;  3ISG A;  3CJM A;  5CED A;  4LD9 A;  4H9N A;  4E3O A;  4S2K A;  3AZK C;  3MVD A;  4YIN A;  3REL A;  1F66 B;  4JPM A;  1P3B D;  1FR1 A;  1OME A;  1KX4 C;  3W99 C;  3AYW D;  4N9L A;  3FDD A;  4J8U D;  4GZB A;  3MGS C;  3AN2 A;  1M6K A;  4GNU A;  3SH8 A;  4AWL C;  3HUO A;  2DQN C;  1AOI C;  1P3B B;  2XQZ A;  5M1A A;  5G49 B;  3FV7 A;  4LV3 A;  1TZY C;  3AYW B;  4BJP A;  1L0D A;  4J8U B;  3WA9 D;  4ZUX C;  2WYX A;  3C1B C;  1BH9 B;  3W4Q A;  5IHV A;  4Y7P A;  1YU2 A;  2PYO B;  2XH9 A;  4YS3 A;  3NCK A;  2JSS A;  4OLG A;  4EQI A;  2Y2O A;  4GDB A;  1U35 C;  5GSU B;  3C1C D;  3HLF A;  4X23 B;  1IYO A;  2QZ6 A;  4WU8 D;  3DTM A;  3NIA A;  1JWZ A;  1KX5 C;  4B4X A;  1S32 C;  5EVI C;  4ZJ2 A;  5AQA A;  3LEL B;  4EO5 C;  4DE0 A;  4XUJ D;  3REI D;  1ZLA D;  1SDE A;  3REK A;  4OPZ A;  1BTL A;  4WZ5 A;  1MWR A;  1YLY A;  5B31 A;  2CWE A;  2ZC7 A;  2ZQC A;  4OKP A;  1P3P B;  1HQ3 D;  3AZM D;  5F99 B;  2IO5 B;  3X1U A;  3AGD A;  1F66 C;  4XUJ B;  1DJC A;  3KUY D;  4UA9 A;  3REI B;  1ZLA B;  2FJ7 A;  5CEB A;  2G5H C;  3A3I A;  4JJN A;  4KGC B;  1YUE A;  1P34 D;  2Q9M A;  4J8X D;  5CP6 D;  5F83 A;  2FFF B;  5HAI A;  3VMA A;  3NQJ A;  5FQ9 A;  1FCO A;  3WAA D;  1P3B C;  1P3I A;  3ITB A;  3KUY B;  4X53 A;  3AYW C;  2HUE B;  1P34 B;  4J8U C;  1H3O B;  1M19 B;  4B88 A;  5FI6 A;  1N9B A;  5E2G A;  2XF3 A;  4UHU A;  2BYK B;  1YU1 A;  1Q2Q A;  1SCW A;  1P3O A;  3V3R A;  3UTA D;  3WAA B;  1RGZ A;  3AZH D;  3NBL A;  5GSU C;  1N1J B;  3AZE B;  3AZN D;  4R4S A;  4X23 C;  2WGW B;  5CPI D;  4OH0 A;  2ZQD A;  3E2L A;  3UTA B;  3VH6 A;  3HLB A;  3REH A;  4K91 A;  3AZH B;  3C1C C;  4EUZ A;  4L0L A;  5B24 D;  3C4P A;  2F2A C;  5FQI A;  4YFM A;  1P3P C;  1P3A D;  2F8N B;  5F99 C;  2LY8 A;  3WA9 A;  4R8P D;  5E2H A;  4XUJ C;  5CPJ B;  3REI C;  1ZLA C;  1GHP A;  1BSG A;  2ZQ8 A;  3UE3 A;  2F8N H;  5AV5 A;  2GDN A;  4JXV A;  4C6Y A;  3HLG A;  3AZL D;  3C7V A;  1YLP A;  4Z66 A;  1P3A B;  4JF4 A;  4ZTK A;  3AV2 B;  4R8P B;  3KWQ D;  1BH8 B;  1KE0 A;  5KSH A;  3KUY C;  4WU8 A;  1O07 A;  4WEJ A;  1S6R A;  1HTZ A;  2G2U A;  1P34 C;  1FOF A;  4P0M A;  1M19 C;  5CP6 C;  5EEC A;  3UPN A;  3X1S D;  3AZL B;  4WYY A;  2ZM5 A;  4QU3 A;  4BLM A;  3WAA C;  3O62 A;  1HQ3 A;  2HDS A;  3AZM A;  1IKG A;  3M2K A;  4M3K A;  3ZG5 A;  1VM1 A;  2P9V B;  3N8R A;  4DE1 A;  3AZE C;  3HUN A;  2VQR A;  4N1X A;  3VH6 W;  3VH5 W;  4KZ4 A;  4J8X A;  3UTA C;  5CP6 A;  2HDQ A;  3LY3 A;  1QME A;  1XA1 A;  3AZH C;  4P87 A;  3TOI A;  4QY5 A;  3B0B A;  4MBF A;  5B1L D;  1AXB A;  2FFY A;  1P3M A;  4R1G A;  5FUG A;  4S2N C;  4Q8I A;  4FH4 A;  5B2I A;  2H10 A;  2WAE A;  3WWX A;  2C6W B;  2WK0 A;  2ZY3 A;  5CPJ C;  5I94 A;  1J9M A;  3B6F D;  1K4F A;  4IBF A;  5FI7 A;  1K4E A;  4DDY A;  1P3L B;  4HEF A;  1CK3 A;  5BT1 D;  1EI5 A;  1G6A A;  4RA7 A;  1P3A C;  4H9O B;  3AZG B;  3I7J A;  4WNN A;  4NZ4 A;  1W8Y A;  4R8P C;  3A6N D;  3AZN A;  3SS3 A;  3B6F B;  1WE4 A;  1ID3 B;  3OCL A;  3OCN A;  5AV6 A;  5CPI A;  3AV1 D;  1H8Y A;  5CPK B;  2C5W B;  3AZL C;  4H9S C;  1KX3 B;  5BNX A;  5CHJ A;  5JRG D;  5B40 B;  3G32 A;  5HL1 A;  1TAF B;  5B24 A;  3KWQ C;  4WEK A;  3HRE A;  5GT3 D;  3ZVW A;  5DNM D;  3MNN D;  3IQA A;  3AV1 B;  1RGY A;  4J8W A;  4KHA A;  4GHA A;  4HES A;  3B6G B;  4OVD A;  3LEZ A;  3UE1 A;  4HBT A;  3MGP D;  3O87 A;  4KZA A;  3S1Y A;  4JF6 A;  1K55 A;  2B5R A;  5GT3 B;  3GQZ A;  3MNN B;  5AY8 B;  1XP4 A;  4PM8 A;  4UA6 A;  2RL3 A;  3KWQ A;  4OON A;  4P6B A;  2ZM2 A;  1YMS A;  3C5A A;  4NET A;  4WV4 B;  3MGP B;  3X1S A;  4IBG A;  4OP8 A;  3KSY A;  2Y4A A;  5B33 D;  5B2J D;  5FAO A;  2WKI A;  1P3L C;  5B1L C;  2DNS A;  4OOL A;  5DTT A;  1JWP A;  1Z2C B;  3PBN A;  5GXQ D;  3AZG C;  5HAQ A;  1SDN A;  3WS5 A;  2Y2N A;  5B0Z D;  1XGI A;  3B6F C;  1BLP A;  4JBF A;  5GLB A;  2RCX A;  2EFX A;  1P3K B;  1F1E A;  3AGF A;  2XLN A;  1W7F A;  5B40 C;  5TFQ A;  4O7D A;  3A6N C;  1ZG4 A;  5B0Z B;  4XZQ A;  4OLD A;  3AV1 C;  3MGR A;  4NFT A;  1I5Q A;  1BUL A;  3B6G C;  2OV5 A;  3Q1F A;  4ZJ1 A;  4H9N B;  5JRG C;  3IH9 A;  3MVD B;  1LLB A;  1NY0 A;  5CHL B;  3W97 D;  3BEB A;  5GT3 C;  1PZP A;  3MFD A;  2V2F F;  3AZI A;  1JFI B;  4IBX A;  3MNN C;  3X1V D;  5CXW A;  3GR2 A;  3A6N A;  2X01 A;  2HP6 A;  5GT0 A;  4R3J A;  2H0Y A;  4Z5T D;  3TU4 B;  3CG5 A;  2NZD A;  3VFH A;  3LZ1 B;  5BS7 C;  3MGP C;  3H0M C;  4GB7 A;  2BYM B;  4ZUX D;  3AZF B;  5DF7 A;  3RJU A;  1XKZ A;  4KUD D;  3W97 B;  1JVJ A;  3W96 A;  3M6B A;  4QLC D;  4H9R B;  3X1V B;  1ESU A;  2WGI A;  2XDM A;  3IF6 A;  1K25 A;  3UT9 D;  1U35 D;  4Z5T B;  5DNM A;  1IEM A;  5CTM A;  3E2K A;  5GLA A;  5AVC A;  3C4O A;  5BO0 B;  3MZF A;  3FKV A;  1K6R A;  3LJA B;  3W4O A;  3B0D B;  3FKE A;  1ZC2 A;  1KX5 D;  4OJL A;  4QLC B;  4E45 A;  5FA7 A;  1P3K C;  4ID4 A;  4IVK A;  5F1F A;  5KDM A;  1K56 D;  5AVB A;  4OP5 A;  1CI8 A;  2IOU A;  5GXQ C;  1FCM A;  4EBP A;  1ONG A;  4ZBE A;  3KXB D;  2NQB A;  2VGK A;  3EPK A;  5A93 A;  5B0Z C;  3REK B;  1KVL A;  4ZJ3 A;  5B31 B;  3PBQ A;  5B33 A;  2ZQA A;  5B2J A;  3MZE A;  2BG1 A;  1PZR A;  3KXB B;  1B6W A;  2FJ7 B;  4G92 C;  5GXQ A;  5FSR A;  5M19 A;  5FQM A;  3WS2 A;  2J8Y A;  4KZ3 A;  4IJF A;  1MKI A;  5GHX A;  1MXO A;  3VP0 A;  2WGV A;  3TU4 C;  3IWI A;  2JC7 A;  3LZ1 C;  1BLH A;  1HVB A;  4WMC A;  3SS5 A;  4LV2 A;  1GHI A;  5FI2 A;  3W97 C;  3NDG A;  4BEN A;  1E25 A;  4CAY A;  3REJ A;  3X1V C;  2PYO D;  5GHZ A;  2F8N G;  5L2F A;  4Z5T C;  4S2I A;  5KZH A;  5GSU D;  1EQZ B;  3OPH A;  5B32 G;  2IWD A;  3AZK A;  3QNC A;  4X23 D;  4KUD C;  3LJA C;  1KX4 A;  3B0D C;  3W99 A;  4PMA A;  3IT9 A;  4QLC C;  2ZD8 A;  3UE0 A;  5D3O A;  3LEL D;  3MGS A;  1L0E A;  4GN2 A;  4QHC A;  3P09 A;  2Y2P A;  4NE6 A;  1Q9C A;  3UT9 C;  1AOI A;  1RCJ A;  3GV9 A;  1TDL A;  3L25 A;  1P3P D;  2IWC A;  3V50 A;  5DNN D;  1TZY A;  3MKE A;  5F99 D;  2Y2Q A;  3BM6 A;  4ZUX A;  3V9R B;  3C1B A;  1P3F B;  1CI9 A;  4H9P A;  4BQM A;  2EX8 A;  1KDS A;  4KGC D;  5BOH A;  3KXB C;  3N8S A;  3HON A;  4GD8 A;  3HBR A;  3OZH A;  4BL2 A;  5DNN B;  1U35 A;  2J8P A;  3IXH A;  3LZ0 B;  4LEN A;  1GHM A;  2WKE A;  4HGA B;  1KX5 A;  4C75 A;  1S32 A;  1KDW A;  5EVI A;  2HPB A;  3BLM A;  1O7E A;  1M19 D;  2CV5 B;  4IJE A;  3FYZ A;  1PI5 A;  2EX6 A;  1QMF A;  1ERQ A;  4DE2 A;  4WU9 B;  3IXD A;  1BT5 A;  2OSU A;  3WRT A;  3ZVT A;  1EQZ C;  3OC2 A;  5DTS A;  1PWC A;  3AZE D;  3BRM A;  4OPQ A;  1F66 A;  3O62 B;  1YU0 A;  4JXG A;  5EPH A;  5JYP A;  2PYO C;  3L26 A;  2A49 A;  5CGS A;  1U60 A;  3WRZ A;  3EPJ A;  4WBG A;  3C7U A;  1P3B A;  2XD5 A;  4BD0 A;  4EWF A;  5G49 A;  4U0X A;  4X6T A;  3AYW A;  2F8N D;  5CRF A;  3O88 A;  4J8U A;  3LEL C;  2ARO D;  1P3M B;  1WWI A;  2EXA A;  3ZCZ A;  5CPJ D;  1NYM A;  1BH9 A;  2HDR A;  3X1T B;  3ZG9 B;  3Q7V B;  1C3B A;  3VP4 A;  5JA4 B;  3SS4 A;  2F8N K;  4YM6 D;  4KG2 A;  4U0T A;  4NZ5 A;  5DNN C;  1Z6F A;  5GSU A;  5E5A B;  4CSR B;  2IO5 C;  4E44 A;  3AV2 D;  2ARO B;  3LZ0 C;  1YT4 A;  2DRW A;  4QY6 A;  4X23 A;  4HGA C;  5B32 B;  1K54 C;  5G18 A;  4KGC C;  4WNN B;  1LL5 A;  4DKI A;  2CV5 C;  3B0C T;  3ZG0 A;  3AL0 C;  4GD6 A;  4YM6 B;  3NI9 A;  3B3X A;  3C1C A;  2G5I C;  4H9Q B;  2Y59 A;  4ZBJ B;  1Y54 A;  1P3P A;  3WTP E;  4H8R A;  1M18 D;  3UTB B;  2XGN A;  3WS1 A;  4A5R A;  2HUE C;  5F99 A;  1XA7 A;  3W98 D;  4XUJ A;  1K6S A;  1MWU A;  3REI A;  1ZLA A;  1W8Q A;  1NYY A;  2Y2G A;  3M2J A;  1KVM A;  1K54 A;  4GDN A;  3GMW A;  4J8W B;  3V39 A;  3MGQ B;  3L28 A;  4PPR A;  1M18 B;  3EQU A;  1MPL A;  4LCM A;  1NJ4 A;  1ERO A;  2HIO D;  4OUI A;  1LI9 A;  3W98 B;  3HUM A;  3KUY A;  3IP4 C;  4OJ5 A;  3N8L A;  4DRB A;  1ZG6 A;  5FAS A;  1P34 A;  1H3O A;  1M19 A;  4NY2 A;  4S2J A;  3X1T C;  5F1G A;  3PAE A;  3IXG A;  2BYK A;  4S2L A;  2HIO B;  1P3L D;  5AQ9 A;  3WAA A;  3UO9 A;  1E4D A;  1YMX A;  3OPP A;  5F82 A;  3EG5 B;  4NE3 A;  3AZG D;  1CEG A;  1N1J A;  2ARO C;  1ESI A;  3AZE A;  3BYD A;  3IH8 A;  2WGW A;  3CMZ A;  1ID3 D;  5B32 C;  1ERM A;  4IBR A;  5FAP A;  1WYB A;  5CPK D;  3UTA A;  3IWO A;  4YM6 C;  3G34 A;  3WTP D;  4WM9 A;  3AZH A;  1KX3 D;  4U3T A;  5A91 A;  1PWD A;  2Y2H A;  5B40 D;  5E2F A;  3PBT A;  1KE3 A;  3AV2 C;  2VGJ A;  4ZBJ C;  1DY6 A;  4S2M A;  3P5J B;  2R9W A;  4S2N A;  2HP9 A;  2F8N A;  3PBS A;  3NQU B;  5AV8 B;  1G68 A;  2YFW B;  5CPJ A;  2HDU A;  3WTP B;  3B6G D;  4XZQ B;  4WZS B;  3MGR B;  4OOY A;  2Y2J A;  2J9O A;  1M18 C;  2J9P A;  3W4P A;  3BFF A;  5CTN A;  1P3A A;  5AY8 D;  1ES2 A;  2RVQ D;  3AV2 A;  3AGE A;  4R8P A;  3W98 C;  1P3G B;  4DXB A;  5DVA A;  5AV9 B;  4LCL A;  3G2Z A;  4JF5 A;  3TG9 A;  2XD1 A;  2Y2L A;  4XXR A;  3ZG7 B;  1NRF A;  2PBY A;  5B0Y D;  3AZJ D;  5GT0 B;  4ZDX A;  4UUZ B;  3AZL A;  1W2E A;  4H9S A;  3DWK A;  3G2Y A;  1W79 A;  1MWT A;  3WS4 A;  1IKI A;  2HIO C;  4BD1 A;  3AFA B;  4QB8 A;  1PW8 A;  4Z2M G;  5B31 G;  3MXR A;  2P9V A;  5B0Y B;  1GA9 A;  3AZJ B;  5BNV B;  5GHY A;  3A1I A;  3A3E A;  2JBF A;  1I2S A;  1FQG A;  4OPR A;  5FDH A;  4J8V D;  2ZC6 B;  3UNW A;  1P3K D;  2IWB A;  1YLJ A;  2EFU A;  3VP1 A;  2P74 A;  5J8X A;  1M1A B;  5AVB B;  3FKW A;  3G4P A;  3LO7 A;  3NY4 A;  1ID3 C;  3WKJ D;  5B1M B;  1K57 C;  3R45 B;  4J8V B;  4E3L A;  1ULY A;  4FD8 A;  5KMW A;  4MEZ A;  2NQB B;  5AV8 C;  5CPK C;  1XXM A;  4N9K A;  3WTP C;  1KX3 C;  3IWQ A;  3MVD D;  2YFV B;  3REL D;  1P3L A;  5B1L A;  4OJ6 A;  3WKJ B;  2I72 A;  2Y91 A;  3GVB A;  4NZ1 A;  4H9O A;  3AZG A;  3KS4 A;  3WS0 A;  1JWV A;  1E3U D;  5C3I B;  1ES5 A;  1P3G C;  3PAG A;  1BFM A;  5AV9 C;  3B6F A;  1ID3 A;  4LD9 B;  3TU4 D;  4OJO A;  3LZ1 D;  4UAA A;  3REL B;  3AZF D;  3UDX A;  2V20 A;  1N4O A;  1KX3 A;  1H8Z A;  5B40 A;  5AY8 C;  4IBD A;  2WZX A;  4ZAM A;  3VSL A;  2RVQ C;  1TAF A;  3AN2 B;  2ZQ7 A;  3AFA C;  1ONH A;  3VFF A;  1RP5 A;  2WUQ A;  1DJA A;  4IBC A;  3HLW A;  3AV1 A;  5B0Y C;  3AZJ C;  3VP2 A;  2UWX A;  4KQR A;  3Q82 A;  1NZU A;  3LJA D;  3B6G A;  3GRJ A;  5JRG A;  1M40 A;  2ZC5 B;  2L5A A;  4IBB A;  3OPL A;  3W99 B;  4XUX A;  4K0X A;  5GT3 A;  4E6W A;  1ZKJ A;  4YS3 B;  3MNN A;  4B4Z A;  3F6T A;  1M1A C;  1FSY A;  3UY6 A;  3REK D;  4E3M A;  2ZC3 B;  5B1M C;  4J8V C;  4N92 A;  5B31 D;  1AOI B;  4E3I A;  5BS7 A;  3MGP A;  3HL9 A;  1H5X A;  2Z2L B;  1WYC A;  4JLF A;  3ZHH A;  3UPP A;  1TZY B;  1CEF A;  4EV4 A;  3A3J A;  4UPK A;  4MBK A;  1PYY A;  4KG6 A;  2FJ7 D;  2H0T A;  1A7W A;  3WKJ C;  4JJN D;  4MLL A;  1YLW A;  5C3I C;  4X68 A;  3CZD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...