2Y2JA

Penicillin-binding protein 1b (pbp-1b) in complex with an alkyl boronate (za4)
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
488
structure length
470
Chain Sequence
b'ISEITYSDGTVIASISRDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTGQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PENICILLIN-BINDING PROTEIN 1B
publication title Structure-Guided Design of Cell Wall Biosynthesis Inhibitors that Overcome Beta-Lactam Resistance in Staphylococcus Aureus (Mrsa).
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
total genus 159
structure length 470
sequence length 488
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2y2jA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2y2jA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2y2jA02
5FQKA 2BLSA 4S2KA 5FATA 4LCMA 5E2FA 3OCNA 3UE3A 5EOEA 5IHVA 1I2SA 1VM1A 4H8RA 3VSLA 4E3IA 4WEKA 3LY4A 4GZBA 1FQGA 1JWPA 5GL9A 1MWTA 3NBLA 4KG5A 3RXXA 3V39A 3VSKA 1ERQA 1JTGA 2Y2KA 3P09A 1JTDA 2G2WA 1PW1A 4R1GA 2ZM2A 1CK3A 4U0TA 2DRWA 5CEDA 4R4SA 2HPBA 2XK1A 3E2KA 3BEBA 3OPRA 1XA1A 5A93A 2OV5A 4EBNA 1TEMA 4NK3A 2A3UA 1G6AA 2EXBA 4MBHA 4P87A 4E3OA 2WGIA 4OP5A 4CPKA 5TFQA 1LL9A 4BENA 4MBFA 2P74A 3VP1A 4QU3A 3G2ZA 4DDYA 4X69A 1BULA 2RCXA 3I7JA 4C6YA 3C4PA 4IVIA 4WBGA 3SS3A 1KE4A 1FCMA 5FAPA 4RA7A 5FI6A 3C7UA 3P98A 4U0XA 5CTMA 4NETA 5KSCA 4OOMA 4ZJ3A 3SS5A 2WKHA 1KGGA 5DTKA 4LV3A 3WS1A 5FQ9A 4OVDA 4S2OA 4B88A 3HLEA 5E2EA 1TVFA 2HDSA 3Q7VA 4S2JA 1IYOA 2WUQA 4U3TA 5E2GA 4PMAA 2V2FF 3ZVWA 5E43A 3WS2A 3ZNTA 1IELA 4JKTA 4QB8A 2XD1A 3NCKA 3WS5A 4E3KA 3NI9A 5CGXA 4EUZA 1IEMA 2C6WB 3CJMA 4DXCA 4N1XA 3GV9A 4KZ6A 5FASA 5JYPA 1K4FA 3O86A 1PWGA 3W8KA 4A5RA 4MNRA 1ES3A 1ESIA 3IF6B 1OMEA 1PIOA 3IHAA 3GMWA 5FA7A 2HP5A 2Q9NA 3IH9A 4KZ9A 3VOYA 1TDLA 1KGFA 3V3RA 3B3XA 3ZG8B 5CRFA 5GLDA 2ZD8A 4IBRA 4X68A 1ES4A 1AXBA 1WYBA 3IXDA 3A3FA 4P6BA 4GDBA 4P0MA 2ZMAA 1JVJA 1FOFA 1SCWA 2ZC5B 1LHYA 4BJPA 4S2PA 2ZQDA 2XEPA 1XP4A 4KZAA 3AGDA 1O07A 4YINA 4DDSA 1K38A 3N8RA 4R4RA 4BL3A 3BFFA 4WM9A 5FQMA 4DE3A 3OZHA 5CHMA 2PU4A 2Y2PA 3O87A 2WADA 3BLSA 5FQIA 1ZC2A 4OQHA 5GHYA 4IVKA 1KVLA 4FD8A 4JF5A 4WZ4A 4E6XA 2C5WB 1TDGA 3AGFA 3IH8A 4X55A 4R3JA 1EROA 1PZPA 1Y54A 4GN2A 3A3EA 3BM6A 5EPHA 4PM9A 3SH9A 1JWZA 4S2MA 3N4IA 3FKWA 4Y0UA 4N92A 2WZZA 1LL5A 5D3OA 1K6SA 2GDNA 5FAQA 1YT4A 2HP9A 3UY6A 4FH4A 3CMZA 5FSRA 3VP0A 3N8LA 4EWFA 3N8SA 2XDMA 3BRMA 5CECA 1FCNA 2QZ6A 2UWXA 2J7VA 4PM6A 2DNSA 2EXAA 3TOIA 2R9XA 2Y2OA 3ZG7B 1CEFA 3MXRA 4WMCA 3AGEA 3FV7A 1L0FA 3G32A 4FSFA 1QMEA 4LV0A 4OPZA 3SH8A 2EFXA 3ZDJA 3OC2A 1MWUA 3WS4A 2J9PA 3G30A 1ES2A 1YLTA 1SKFA 1XA7A 2EX2A 1BSGA 2ZC7A 3BYDA 4KQRA 4LV1A 3DWKA 1LI9A 3GR2A 1Q2PA 3BFCA 3IT9A 3E2LA 1BLHA 1RCJA 2Y55A 4PPRA 1Q2QA 4M3KA 3M2JA 3GSGA 5HARA 2WZXA 3IXBA 4JXWA 5FQQA 3OPLA 5TGFA 4OP8A 1ZG6A 4K0XA 1HZOA 3IWIA 2WAFA 1FR6A 3LCEA 5EVIC 3NC8A 1BUEA 1YLJA 3G4PA 4OQGA 4OLGA 4B4XA 1YLZA 2HDRA 2V20A 3LO7A 2Y2JA 5F83A 1BTLA 3HUMA 1MPLA 2HP6A 3PTEA 1NJ4A 4BLMA 1M6KA 1I5QA 4JXGA 4OQIA 4OQ0A 4E6WA 1J9MA 2Y2NA 4WZ5C 1GHMA 5F82A 2WGVA 5F1FA 3HBRA 1IKIA 4WEJA 3DTMA 1O7EA 2RL3A 2PBYA 2QMIA 1K56D 4HEFA 1MXOA 1NRFA 3VP2A 1GA0A 5CGWA 2X02A 3UPNA 5CEBA 2ZC3B 4ZBEA 4KG2A 4LENA 2H10A 1NYYA 3JYIA 5GHXA 3ITAA 3O3VA 3QNCA 5EE8A 1HVBA 1L0EA 4DE0A 3VMAA 5AQBA 3ZG0A 3HLGA 3A3DA 1LLBA 4K0WA 1K54C 2JBFA 4JF6A 2J9OA 3BECA 5CTNA 1FCOA 3DW0A 2R9WA 3UNWA 5KZHA 2V1ZA 1K4EA 1W8YA 3N6IA 1PI5A 2WGWA 5DF9A 2JC7A 3C5AA 4N9LA 4P85A 4KG6A 5HX9A 3BFGA 4R3BA 4HBTA 3PAEA 1IYQA 4WYYA 2B5RA 1SHVA 3GTCA 5GLCA 4E3JA 3Q7VB 3IXHA 4PM8A 2X01A 3PBRA 3UO9A 3A3IA 4GDNA 4Y0TA 5L2FA 5KSHA 1C3BA 1MKIA 2HDQA 4K91A 4E3MA 1KGEA 4GKUA 1W79A 2P9VA 3Q82A 1ES5A 1E3UA 3PBSA 2X71A 2WGWB 4KZ5A 4R0QA 3N7WA 2VGJA 1ZKJA 4UA6A 1M40A 3DWZA 4RVAA 5HFOA 2XF3A 2OLUA 4S2NC 5EVIA 4PM5A 1N9BA 3EQUA 4JBFA 3IF5A 3FWLA 3ZGAB 3HLCA 4C3QA 3WS0A 5E2HA 3IWQA 1K25A 3HL9A 1NXYA 1PZOA 2IWCA 5A90A 1IYPA 3S22A 4E3NA 3S4XA 2XGNA 3O88A 4OH0A 2G2UA 3QNBA 4ZJ1A 5I94A 4ZTKA 3SH7A 4MBKA 4LCLA 2XFTA 3PBOA 1PI4A 2ZC4B 4KZBA 4OPRA 3BFDA 3MZDA 2P9VB 2XLNA 2XH9A 1FSWA 3RXWA 4JXVA 3UDXA 1YLPA 3MXSA 4IBXA 3IHBA 1LI0A 1MBLA 3IXGA 4RX2A 4F94A 4KZ3A 1HD8A 1NZOA 5CHJA 4BL2A 1DJBA 2OSUA 4ZDXA 5DTTA 4QY5A 5M18A 2ZQCA 4UAAA 2XD5A 3IF6C 4Y7PA 2ZLYA 3NIAA 3OPPA 3UDIA 4OOYA 3LEZA 5CERA 4EQIA 2Y91A 2WK0A 1CEGA 1K54A 1PWDA 3FZCA 3M6HA 5EECA 1YQSA 2EX9A 5AQ7A 4EBPA 3G31A 2WAEA 2ZQ8A 4KZ8A 1W8QA 1XGJA 2HDUA 4OOLA 1XXMA 3HLFA 1ESUA 4EV4A 2XQZA 3MZEA 4UA9A 3ZVTA 2EX6A 3BFEA 4E3LA 3HLWA 5A91A 1NY0A 1MWRA 3G35A 2Y2IA 2Y59A 4EBLA 1WE4A 1W5DA 1BLSA 4S2IA 1QMFA 4UHUA 1DJCA 4IEDA 3VFHA 3GRJA 3CZDA 1EWZA 3SOIA 3WWXA 4LV2A 4XXRA 5DF8A 4FCFA 4ZJ2A 1RGZA 5FAOA 1H8YA 1S0WA 5DTSA 4DKIA 3ZCZA 4JF4A 3ZFZA 5F1GA 5TR7A 3TG9A 3W4OA 4DE2A 3UN7A 4KQQA 2JCHA 2JE5A 2WKIA 1I2WA 3PBQA 3EQVA 4JLFA 2H0TA 1KDSA 3MBZA 4S2NA 3C7VA 4X53A 5CHUA 1EI5A 3V5MA 2EX8A 3SS4A 4RYEA 2OLVA 3HVFA 4OPYA 4JXSA 1YLWA 4HBUA 4QD4A 3UE1A 4QY6A 1KE0A 2I72A 2ZJ9A 4MLLA 5AQAA 5DVAA 1K55C 3HUNA 5FQJA 4ZAMA 3UDFA 1CI8A 2CC1A 3GQZA 5DF7A 2FFFB 5HAQA 4KQOA 2ZQ7A 3PAGA 5CGSA 4WMCD 1YMSA 2VGKA 4X6TA 4XUZA 1GHIA 5GHZA 3IWOA 1K57C 4DRTA 4Y0OA 1L2SA 3ZNYA 3D4FA 2Y2LA 4BD0A 3BLMA 3FYZA 1ONGA 3VOZA 2QPNA 4OPQA 1NZUA 1L0DA 1DY6A 1YLYA 4XUXA 1WYCA 3PBTA 1N4OA 4O7DA 1BZAA 4FH2A 2ZM0A 1BLCA 3IF6A 1Z6FA 1BT5A 3UE0A 4BD1A 4DE1A 1IYSA 1W7FA 2FFYA 5G18A 4PM7A 1ALQA 3TSGA 3ISGA 4HESA 5EUAA 3ZHHA 3A3JA 2XFSA 4OONA 1KVMA 5M1AA 3W4PA 3OCLA 3MFDA 3FKVA 4GNUA 4N9KA 1BLPA 4L0LA 1VQQA 3NY4A 3NDGA 4B4ZA 1ZG4A 1G68A 3MKFA 3NDEA 3Q81A 2Z2MB 1H5XA 4BQMA 3GVBA 5EVLA 1KDWA 2Y2QA 5M19A 3PBNA 2BG1A 1PW8A 4DF6A 3M6BA 2ZQ9A 4OKPA 3WRZA 1ONHA 1SDNA 4QHCA 2IWDA 5GLAA 4N1HA 1KE3A 3Q07A 3WRTA 3QHYA 2ZQAA 2WYXA 3M2KA 5FDHA 5U47A 2Z2LB 5A92A 1L0GA 2E8IA 2Y2GA 1XKZA 2H0YA 3W4QA 4X56A 1U60A 1GHPA 2EFUA 4DXBA 4WZ5A 1SDEA 4S2LA 1HTZA 3VFFA 3MZFA 3VP3A 3S1YA 3ITBA 2ZC6B 1YM1A 5BOHA 4RX3A 3LY3A 2WKEA 1E25A 1K55A 5KMWA 4GD6A 3UPPA 3ZG9B 3HLDA 4KZ4A 4C75A 5CXWA 4Q8IA 5EVIB 2DCFA 3HLBA 3V3SA 4MEZA 1ERMA 5HL1A 5EOOA 1E4DA 4KZ7A 3RJUA 4YFMA 1NYMA 3MKEA 1K57A 2XR0A 3V50A 1MWSA 1CI9A 5FI7A 2Y2HA 5FI2A 1RGYA 5AQ9A 3Q1FA 1FSYA 1IKGA 1XPBA 3C4OA 4OLDA 3VP4A 1GA9A 2Q9MA 3IQAA 3G2YA 2Y4AA 1K6RA 3HREA 4KENB 3UPOA 1H8ZA 1XX2A 1K56A 5HAPA 2Y2MA 1XGIA 2A49A 2ZM8A 4JPMA 4WELA 3Q7ZA 4GB7A 3ZG5A 1MY8A 5JYOA 1FR1A 1JWVA 1E3UD 1PWCA 1RP5A 4CJNA 1S6RA 4GOGA 2IWBA 4GD8A 4R23A 5EVID 3CG5A 2H5SA 4ID4A 5J8XA 1YMXA 3OPHA 1GCEA 1DJAA 4UA7A 2J8YA 5GLBA 5HW3A 3G34A 4QJGA 4D2OA 5HAIA 2PU2A 3HUOA 4Z9QA 1PYYA
chains in the Genus database with same CATH superfamily
4IBIA 3KXBB 2HIOB 1E6RA 3FKEA 5E2FA 5EOEA 2VV7A 3WKJB 3U2AA 4H8RA 3LELB 1F66C 4WEKA 4GZBA 1FQGA 1JWPA 5CX7A 3NBLA 5GL9A 3VSKA 4JGQA 4KGCC 1ERQA 3T4OA 1CJFA 2HUEC 4H6JA 2NQBC 3AZMD 5C3IC 3MNNC 1DP9A 1Q9CA 5AVCA 2G2WA 1VETA 4R4SA 2HPBA 4EBNA 2A3UA 1G6AA 2EXBA 4G3WA 3LIAA 3CHWP 1PRQA 3LZ0B 5DFXA 5KDMA 1LL9A 2W3FA 4MBFA 3QP2A 5B2JA 1TD5A 2V9AA 1L3LA 1P3MD 3AZEC 3W99A 4DDYA 3I7JA 1P3LD 3MVDA 3EPHA 1FCMA 5FI6A 2FJ7D 3WA9A 4Z5TD 1UGUA 2ZOHA 4J8WA 4CLCA 3HLEA 5E2EA 3Q7VA 5GT0A 3D72A 1IYOA 2WUQA 1H3QA 4GJ4A 5E43A 3WS2A 3ZNTA 4ARZA 1P3IC 4QB8A 2XD1A 1PFLA 3FPWA 5CGXA 1IEMA 5FASA 3AL0C 3E4PA 1PWGA 3N3FA 1ESIA 3VOYA 4J8UD 2HV1A 1TDLA 1TAFA 3MQLA 3AZLD 2ZD8A 3LICA 1AXBA 1WYBA 3T1SA 4GDBA 5B40A 5B0YB 1P3KD 5B1MB 3T4LA 3X1TB 4OJ5A 4KZAA 2BASA 1OGGA 2M1CA 2CV5D 4DE3A 3CI6A 3OZHA 1EAKA 2Y2PA 2WADA 3BLSA 5GHYA 4JF5A 1SZVA 4WZ4A 1H8MA 4Z2LA 4YWZA 4E6XA 1TDGA 3AZJC 3MGPA 5GSUC 1PZPA 1Y54A 3BM6A 4OUIA 1YAXA 4WZSB 2NZDB 3FKWA 1F66B 2VGLS 1P3AB 3WTPE 4HH2A 4G91C 2GDNA 2W3HA 2HP9A 3CMZA 2VV8A 2XDMA 5CECA 1XJ4A 2O99A 1FCNA 2QZ6A 5DJUA 3W96A 4M4XA 2G5HC 2EXAA 5HWTA 2R9XA 3FV7A 1L0FA 3G32A 2V5OA 3AZEB 1KX4B 4H9SC 3GECA 3CUEC 4WL9A 1LI9A 3FPVA 1J7MA 3BFCA 4WU9B 1RCJA 3NOUC 3M2JA 4P6ZM 4JXWA 4CQHA 4H9NB 5TGFA 3TW8A 4K0XA 2WAFA 3LCEA 4K08A 1H0MA 2V20A 3LO7A 3HUMA 2HP6A 5J7EA 5B33A 1M6KA 4JXGA 1J9MA 3AZKA 2Y2NA 5F1FA 3IX4A 1IKIA 4WEJA 1O7EA 2PBYA 2QMIA 1K56D 3AZFD 3KXBD 2HIOD 4P6ZS 4O01A 5CEBA 3W96D 3WKJD 4KG2A 3LELD 4ESPA 2V1AA 3AZGC 3JYIA 5F69A 3O3VA 2JKTI 3IX3A 1L0EA 5BNVA 3KUYB 1P3OA 4K0WA 3SZTA 4IBDA 1AOIB 3DW0A 4R38A 3UNWA 5KZHA 3F1NA 3REJC 2RVQD 4M6BA 3UTAC 2V1ZA 4WU8A 1K4EA 1W2EA 2BYMB 4WV4B 1PI5A 4HP4A 2WGWA 3VE4A 3ZQ5A 4QWOA 5HX9A 1P97A 2XRNA 4NZ3A 4R3AA 1IYQA 3NECA 5GLCA 3UMEA 4JGPA 3PHYA 3UT9C 3LJAD 4HP9A 3PBRA 2CWEA 3X1VC 3DTKA 1C3BA 5EM0A 5BO0A 2HDQA 3NULA 4HGAB 1P34D 3KSYA 1KGEA 4UPKA 1ES5A 4R0QA 4XZQB 5B0ZB 1MKMA 5CP6C 2FN2A 3EQUA 3AFAA 3B6FB 3HLCA 4C3QA 3IWQA 1K25A 1PZOA 5A90A 2V0UA 2XGNA 3O88A 1S32C 4OH0A 3QNBA 3P5JB 3B6GC 3REHB 3BFDA 3WTPA 5B24C 2P9VB 2XLNA 3MZDA 5E5AD 1BFMA 2AROC 4IBXA 3AYWA 3AN2C 1LI0A 2IO5C 5DNMD 1MBLA 3BWLA 3IXGA 4RX2A 4F94A 1HD8A 3B0DC 5B1LA 3IBRA 4ZDXA 5BT1D 4QY5A 4H9QB 3TU4C 1Y28A 4X23D 3EPKA 2XD5A 1XFNA 5B31B 1KX3A 3WAAA 3KSHA 3LEZA 5CERA 2F8NK 4NE5A 1HQ3A 1P3IA 5EECA 5AQ7A 3S7OA 3G31A 4E04A 2KLIA 2HDUA 2D01A 2XSSA 1P0ZA 2HF6A 1GSXA 2ZM5A 2XQZA 5B32C 1HLUP 2VK3A 2EX6A 4DJ3A 1F66D 1N9NA 5A91A 1YU3A 3G35A 2Y59A 3T4KA 4KGCD 4YM6B 1P3FC 4H9OA 2NQBD 1QMFA 2Y79A 4WF0A 3MNND 4LD9B 1EWZA 3NHQA 3LIEA 3LYXA 1P3GB 3AZHC 2I9VA 3R45A 2YFWA 3NQJA 4H9PB 3AZIC 4KQDA 3ZCZA 4MN6A 5TR7A 3TG9A 3W4OA 3UTAB 4KQQA 2JCHA 4J8VB 3AZED 2WKIA 2W1TB 1M19A 1KDSA 3MBZA 1EI5A 3V5MA 4CSRA 3PR6A 5AVBB 3REIA 3WX7A 3L26A 4RYEA 3HVFA 3MGRB 4QD4A 1YLWA 3AZJA 4UUZA 3HUNA 4ZAMA 3UDFA 1CI8A 5JA4B 3GQZA 2FFFB 5HAQA 2YKHA 1BYWA 4X6TA 3SW1A 3IWOA 3AV2C 4LRYC 1P3ID 2Y2LA 4GH9A 3F1PA 4R6LA 5CP6B 3R4KA 2QPNA 4EO5C 5F99B 2W3GA 3NOTC 4J8XA 1NZUA 1L0DA 1W1YA 4NFTA 1N4OA 3LR4A 4O7DA 3IF6A 1BLCA 1Z6FA 3UE0A 3O62A 2BYKA 5BS7A 3B6GB 3EEAA 4NXEA 5AV9C 3WD3A 5GT3A 3A3JA 5HL6A 2AROB 5B32G 3OCLA 3FKVA 1BLPA 3B0DB 3MF0A 1DRMA 3TU4B 5I5LA 1OJ5A 1P3BB 3NDEA 4YS3C 1Z09A 3A6NB 2Y2QA 1M18A 3PBNA 4HMCA 2JKRM 1P9WA 1OPXA 5AVFA 4DF6A 2XROA 1B67A 3B33A 1SDNA 3AZJD 2ZQAA 2WYXA 5GSUD 3EGXC 3M2KA 5AVCC 1L0GA 2ZOIA 3UTBC 1GHPA 4DXBA 3LGOA 3A0SA 3MZFA 3VFFA 3H7WA 3S1YA 3ITBA 1YM1A 4PKYG 4IUKA 3LY3A 5B2JC 3OOVA 3AZHB 5KMWA 3ZG9B 3HLDA 3W99C 5CXWA 1SKOA 1U35A 3B0CW 2DCFA 5AV5A 3MVDC 4WJ3C 1ERMA 5HL1A 1UWPX 1E4DA 3WA9C 1E6NA 2XR0A 3EG5B 2Y2HA 5AQ9A 5MC7A 5F6AA 4J8WC 1S1YA 4CLCC 3V9RA 5GT0C 3AV1A 3IQAA 3B0CT 1K6RA 4KUKA 3UPOA 5HAPA 4JPMA 4WELA 3AZMB 4GB7A 3ZG5A 4GLQA 1JWVA 1PWCA 4GHIA 5AV6A 4CJNA 2E8JA 1S6RA 4GOGA 5GXQA 4IJGA 4B93A 1WA9A 3FG8A 3MGQA 4OJOA 1P3MB 1FILA 2GZAA 1PYYA 5B40C 2BLSA 4S2KA 4LCMA 2FJ7B 1N1JB 4TX8A 4Z5TB 3UE3A 5IHVA 1I2SA 5AV9B 4E3IA 3RXXA 4R70A 4KG5A 3A1IA 4D60A 4JJNA 1PW1A 4QLCC 3AZGD 5CEDA 2XK1A 4EQ1A 2OV5A 1TEMA 4NK3A 2A24B 5HD5A 4CPKA 3KWQA 3MGPC 2F8NA 2P74A 5IS1A 4I5SA 4J8UB 3REJD 1JNUA 4WBGA 3UTAD 5FAPA 3AZLB 3P98A 4L9GA 4U0XA 5CTMA 4OOMA 4ZJ3A 4I3IA 3X1UA 3C38A 1TZYA 4G92C 1DP6A 4LV3A 5DFYA 5FQ9A 3W98A 2M7VA 4OVDA 1P3KB 3K2NA 3IS2B 1H8PA 2MJ6A 3UT9D 4S2OA 2WKQA 4B88A 1TVFA 2HDSA 3U4LP 3KSGA 1UWNX 4S2JA 3X1VD 5KDMB 4Y17A 5B2JB 5L07A 1IELA 3V67A 2RTSA 4EUZA 1Y4OA 3C1CA 4KZ6A 2W0NA 3WA9B 3W8KA 4MNRA 5CPIA 5CP6D 1PIOA 1XJ3A 1VEUA 3GMWA 2HP5A 4KZ9A 3LR3A 1KGFA 3V3RA 5AV8A 5CRFA 5GLDA 5J3WA 2B95A 1S32D 3A3FA 3DBAA 1R4VA 2J8PA 2ZMAA 3A0RA 4HJ6A 3B6GD 1SCWA 4ARZB 1E15A 4MB4A 2JN7A 5B24D 1LHYA 3C2WA 2AROD 1W1PA 5K5BA 3RFBA 3AN2D 2K31A 5B33C 4YINA 4L9FA 4R4RA 4WM9A 3AZKC 3TU4D 5CHMA 4QPRA 4Z1WA 1E6PA 3UE6A 5FQIA 5FEFA 1KVLA 3K3DA 4LLOB 5B40B 4NKPA 1EROA 4CAYA 4GN2A 4PM9A 4S2MA 3N4IA 3MGSA 4N92A 1W1TA 5CPKA 1LL5A 4HMDA 5B32D 1K6SA 5D3OA 4FH4A 1P3OC 4EWFA 4Z2JA 3BRMA 4HQAA 1P3FD 4IBBA 3DTEA 4NYYA 1MC0A 4FOFA 4IBGA 4Y3IA 5EV0A 4WU8C 3MXRA 3AZHD 4WMCA 3AGEA 4OPZA 3F1OB 3AZID 1NRJA 1S66L 1E6ZA 2OAQ1 3AZFB 2PYPA 1W63M 1Q2PA 1YUEA 2Y55A 1Q2QA 3W96B 2F8NH 4KUDA 3D9YA 5DKLA 3CITA 3H9WA 1ZG6A 1FR6A 1LT0A 3T4SA 4NXBA 5AVEA 3AFAC 3UTBA 1YLJA 4B4XA 1YLZA 2HDRA 2V0WA 3AV2D 2Y2JA 1ULYA 2ZMFA 1I5QA 4OQ0A 3WTPC 2J3TC 4ZUXA 1NRFA 3VP2A 4Z66A 3UB5P 2X02A 3AYWC 3UPNA 2ZC3B 4R8PA 4LENA 5HPFA 5AV9D 3A1KA 5B1LC 3LJAB 2H10A 4ETZA 1O6IA 4KUOA 1KU5A 4EXOA 1P34B 1KX3C 3WAAC 5AQBA 4ZBJC 1LLBA 1HQ3C 4GW9A 4H9RB 1G6OA 3QP4A 1T18A 4YS3D 4Z2HA 3MQ0A 1FCOA 1N9OA 4NG2A 2OOLA 5FUGA 1YU0A 1W8YA 3N6IA 5DF9A 4N9LA 4P85A 4R3BA 1X0OA 4PHTA 3PAEA 2B5RA 3BJNA 3W97A 4E3JA 3IXHA 5BNXB 2O9AA 5AVCD 2CMNA 1UR9A 3UTBD 2VZWA 5E5AB 4GDNA 4Y0TA 3VH5W 3RELA 5DNMB 4NZ4A 4E3MA 2PDRA 5B2JD 5FEGA 3L25A 3W99D 2WGWB 4X23B 4UA6A 3JVVA 1M19C 1M40A 3MVDD 4QLCA 2XF3A 2ZL1A 5EVIA 4PM5A 3WA9D 3REIC 3HL9A 2IWCA 1LSXA 4E44A 1G28A 4E3NA 5DNNC 5I94A 4J8WD 4ZTKA 3SH7A 4CLCD 4LCLA 5GT0D 3PBOA 5C5KA 3JVUA 1FSWA 4JGOA 3KX0X 3UMDA 4KGCB 5TBMA 3UDXA 2HUEB 2NQBB 3IHBA 5C3IB 3MNNB 1TS8A 4KZ3A 1DJBA 3LR5A 4J8XC 4NEED 4G3VA 1PNEA 2ZQCA 1OJGA 1OTBA 5B2IA 4GS9A 3IF6C 4EW7A 3O62C 3LZ1A 3NIAA 3OPPA 4IHQA 3AZNA 4EUVA 2Y91A 2WK0A 1CEGA 4I3JA 5BS7C 1PWDA 3FZCA 3M6HA 3MXQA 2EX9A 1BH9A 4EBPA 5GT3C 3C1BA 2ZQ8A 5B40D 1XGJA 4OOLA 3AYWB 1XXMA 4EV4A 3MZEA 3BFEA 3H0MC 1NY0A 1MWRA 2Y2IA 2KDKA 2PYRA 1WE4A 4QLCD 1KX3B 1M18C 4MDZA 1F2KA 2JKFA 4XXRA 5DF8A 1P3IB 2PBDP 2VA0A 5FAOA 1H8YA 4AWLC 5DTSA 5KIZA 4JF4A 2NUPC 3RH8B 5F5YA 3MGPD 4DE2A 3LZ0A 1F5MA 3PBQA 4I38A 2PYOA 2L5AA 4S2NA 1E88A 1W1VA 4X1MA 4H9OB 3BW6A 3SS4A 3T4QA 4OPYA 4JXSA 3UE1A 4QY6A 2ZJ9A 2I72A 5DVAA 5FQJA 3W2ZA 3R45B 2YFWB 2CC1A 1U35C 4OJLA 2V1BA 5AV5C 2DQNC 2ZQ7A 3LI8A 1KS0A 3C30A 2OWJA 5HWVA 4DRTA 3NQUA 2WKRA 4DRAA 4Y0OA 3ZNYA 1KX5A 1WWIA 4BD0A 4BBTA 3BLMA 3FYZA 3JPUA 1ONGA 1D7EA 2B02A 3AV1C 1DY6A 2DF4C 1WYCA 4NZ1A 4FH2A 2ZM0A 1UR8A 3LIDA 4BD1A 3AZJB 4DE1A 1W7FA 5GSUB 3KSIA 4GCZA 1S67L 4F3LB 3TSGA 3ISGA 5AV6C 5GXQC 5G49B 4OONA 2PAVP 4G91B 1KVMA 5M1AA 3F1PB 4ETXA 3QP1A 4LRXC 5B0YA 3EPJA 3MGQC 2PD7A 5B33D 3X1TA 4B4ZA 3MJQA 3Q81A 2Z2MB 1H5XA 4UQIM 5EVLA 3AZKD 3LFVA 5M19A 1PW8A 1W63Q 1VB6A 3WRZA 1ONHA 5GLAA 1XJ6A 3WRTA 5U47A 4JJNC 1YSPA 2E8IA 3TE8A 2H0YA 4X56A 1U60A 3E98A 2EFUA 1KX5D 3H82B 1P3AA 3VP3A 1P3OD 2ZC6B 1M18B 3KWQC 4HHDA 4RX3A 4UQIS 3BY8A 2WKEA 1E25A 1MZUA 4Q8IA 4AWLB 4WU8D 3RJUA 4KZ7A 4WUJA 1NYMA 2VQRA 3X1UC 1MWSA 1TZYC 2ZY3A 1RGYA 1ZTUA 3W98C 3DAVA 4XUJA 1G5UA 1XPBA 3C4OA 2K7SA 1KX4A 4OLDA 1GA9A 3HJIA 4Z2MH 3T50A 3CPTB 3K3CA 1XX2A 1XGIA 2A49A 2ZM8A 4IUHA 3UB8A 1SKOB 1U35B 3C1CC 4WU9A 5JYOA 1FR1A 3AZGB 1RP5A 4KHAB 3TRCA 2W3EA 5CPIC 2IWBA 2EA9A 4R23A 2NUTC 3AFAD 3CG5A 2H5SA 3MFXA 5J8XA 5AV8C 3OPHA 4MB3A 4BWIA 1DJAA 5GLBA 3V9RB 2O9CA 4D2OA 3REJB 3HUOA 4Z9QA 5FQKA 5FATA 4BBUA 3WTPD 3ICYA 2J3TD 3OCNA 2YFVB 1EQZC 2IOUA 3AYWD 3LY4A 3V39A 1MWTA 1NWZA 3OBFA 4MN7A 4DN0A 1JTGA 3UT9B 5B1LD 1JTDA 3MSHA 1M1AC 1P3PA 4R1GA 2ZM2A 3X1VB 5DNNA 3OPRA 1XA1A 1KX3D 3WAAD 2W27A 4P87A 2F8NG 4E3OA 4OP5A 1HQ3D 3KUYA 3VP1A 2K2NA 3E4QA 4QU3A 3G2ZA 1PDCA 2VV6A 3MGSC 1BULA 4X69A 4C6YA 4MN5A 4IVIA 3SS3A 5CPKC 1AOIA 1OTIA 1KE4A 4RA7A 3C7UA 1IFQA 4NETA 5KSCA 2WKHA 3PYPA 1S32B 4IBKA 1KGGA 3WS1A 4GHLA 5B24B 3X1SA 3KWQB 2F8NB 4U3TA 2JKRI 3ZVWA 4PMAA 2V2FF 3AN2B 2IO5B 3NI9A 2HJEA 4N1XA 3GV9A 1D1JA 5JYPA 4A5RA 1M19D 3X1UB 1ES3A 1OMEA 3IHAA 3C8CA 5FA7A 2Q9NA 2W1RA 4XZQA 5B0ZA 3IH9A 1CXWA 3REID 3B3XA 1DP8A 5J4EA 3B6FA 4X68A 4XT2B 4WNNB 4KUDC 1ES4A 4EERA 3IXDA 4P6BA 4G3KA 5DNND 1JVJA 1FOFA 5B32B 4BJPA 3C1CB 3REHA 4S2PA 2ZQDA 2XEPA 1XP4A 1P3FB 1PZRA 3AGDA 4LG2A 4DDSA 3N8RA 4BL3A 3BFFA 5CPJA 4J8XD 5FQMA 1H3OA 2PU4A 3O87A 5CHLB 4ZUXC 3AZIB 4Z2IA 4H9QA 3O62D 4OQHA 4Z66C 4IVKA 4FD8A 5B31A 2C5WB 3LI9A 4EU0A 3IH8A 4R8PC 4R3JA 5GT3D 3SH9A 1JWZA 2Y8HA 4Y0UA 2WZZA 3R7WB 1JFIB 5FAQA 1A0KA 1YT4A 3UY6A 5FSRA 3VP0A 3N8LA 3N8SA 3T1XA 2J7VA 4YM6A 1M18D 2VKSA 3TOIA 2Y2OA 4Q0IA 1CEFA 4LD9A 3AV2B 4FSFA 1QMEA 4CAYB 4LV0A 1J3WA 2Q0OA 3SH8A 3ZDJA 1HTAA 4H9PA 4EO5B 3W97C 3WS4A 3ZYTA 1YLTA 1XA7A 2EX2A 1BSGA 2ZC7A 3WD4A 2OAP1 4J8VA 2W1TA 3RELC 4Q0JA 3IT9A 3E2LA 1ID3A 5AVBA 3GSGA 3IXBA 3MGRA 3OPLA 1U35D 1HZOA 5AV5D 3IWIA 1YSQA 4MMNA 1D06A 5EVIC 5JA4A 3NC8A 4OQGA 2INWA 4EESA 1VHMA 1BTLA 2HGVA 4YS3B 3KYEA 3PTEA 1AIWA 4BLMA 4NXFA 4OQIA 3AV1D 2GNXA 1GHMA 1ZLAA 5F82A 4EEUA 1B6WA 3DTMA 2RL3A 1MXOA 1GA0A 2B18A 1CK7A 4H6JB 3VH6W 5AVCB 1VETB 5AV6D 3UTBB 1NYYA 5GXQD 5GHXA 1TS0A 2P08A 3ITAA 5B2IC 2VJWA 4Y5FA 1HVBA 5EE8A 2L1MA 3LZ1C 4DE0A 5IT5A 3AZNC 3VMAA 3MGQD 3A3DA 3W99B 2JBFA 4JF6A 4ZUXB 3C1BC 4HI4A 5JRGA 3MVDB 1P3BA 2WKPA 3EPLA 3A6NA 2JC7A 3HJKA 3EWKA 4J8WB 4CLCB 1SHVA 3GTCA 3D3OA 4JJND 5GT0B 3Q7VB 4PM8A 3UO9A 5KSHA 3RTYA 4L9EA 3T1RA 1EQZA 5HD3A 4GKUA 3KWQD 2F8ND 3Q82A 2BTFP 1OT9A 1E3UA 3LZ0C 3PBSA 4KZ5A 4FUWA 2VGJA 1ZKJA 1M1AA 1TAFB 3DWZA 5G4ZA 2PYOC 3REKA 4IBCA 2OLUA 4S2NC 3VV4A 4JBFA 5AY8A 2A2LA 3X1UD 1LSVA 3WS0A 1TZYD 1IYPA 3NJAA 3S4XA 3W98D 2G2UA 4EEPA 4ZJ1A 2G5IC 4HMEA 2XFTA 1PI4A 2ZC4B 4KZBA 4OPRA 1KX5C 4IBEA 3C1CD 4PKYA 4QLCB 2KX6A 1NZOA 5CHJA 3AZMA 2JSSA 5DTTA 2ZBBA 5CPID 5M18A 3M7PA 3B47A 4Y7PA 5AV8D 3WD1A 2XA7M 1KOUA 4EQIA 2L0WA 3MGPB 3P01A 1GOIA 1K54A 4HJ3A 1YQSA 2WAEA 1P3MA 3QP8A 4KZ8A 2VLGA 1P3LA 1ESUA 3ZVTA 1EQZD 5B0YC 1N1JA 4G92B 2FJ7A 4E3LA 4Z5TA 3HLWA 5B1MC 3X1TC 2PHYA 1W5DA 3KS4A 3UB9A 5B2IB 4GS9B 4UHUA 1M1AD 3GRJA 3CZDA 3H0RC 4Z2MG 3SOIA 3WWXA 4LV2A 2XA7S 4UEYA 4FCFA 4ZJ2A 1S0WA 4DKIA 3VH5A 4OJPA 5FL3A 3ZFZA 5F1GA 2A24A 3UN7A 4IBJA 2JE5A 1I2WA 4DMZA 3MGSD 2PR6A 3EQVA 4JLFA 2H0TA 3OLOA 3EOIA 5CPKD 2NZDC 4J8UA 3C7VA 4X53A 5CHUA 2EX8A 1P3AC 2OLVA 3AZLA 4HBUA 4FTXA 1YKDA 3LIBA 5DF7A 2G7UA 3PAGA 1P3KA 4WMCD 3IS2A 2VGKA 4XUZA 4X25A 5B33B 5TJJA 1L2SA 3D4FA 3F6TA 1N9LA 3AZKB 2PYOB 4Y15A 3VOZA 4XUJC 2CV5A 1KX4C 2ZMVA 3PBTA 1BZAA 3VOLA 1BT5A 2JHEA 3TJZC 2W8SA 1GPFA 1T1AA 1Z2CB 5F68A 4PM7A 4WU9C 5G18A 4KUDD 4BMWA 1ALQA 1OTDA 3NQUB 2XFSA 5BNVB 1KX5B 3W4PA 4IJFA 3IP4C 4N9KA 1P3OB 4L0LA 4YNRA 1WWSA 1BH8A 3NDGA 3F1NB 1ZG4A 1G68A 3MKFA 4BQMA 4WU8B 3GVBA 1KDWA 4NYUA 3DTIA 4ZUXD 3M6BA 2ZQ9A 1S1ZA 1A7WA 4Z66D 1ACFA 2LB5A 4QHCA 2IWDA 4N1HA 3VH5T 3Q07A 4R8PD 3QHYA 5FDHA 3E4OA 2Z2LB 1P3PC 5A92A 1F98A 2Y2GA 1XKZA 5BO0B 1S4RA 2VGLM 4Y2FA 3KSFA 1SDEA 1V9YA 5BOHA 3KUYC 2ACGA 5DJTA 1K55A 4GD6A 3UB7A 3AFAB 1AOIC 5HPIA 2FH5A 3KYQA 3MKEA 1YU2A 1K57A 3V50A 5FDSA 5L09A 5FI7A 3F1OA 5FI2A 3Q1FA 3W97D 1LL8A 1IKGA 3WTPB 5A8BA 3LEQA 3VP4A 3X1SC 3FC7A 4KENB 3RELD 1H8ZA 1K56A 2Y2MA 3AZFA 3KXBA 2HIOA 3Q7ZA 5B1LB 2H28A 4HGAC 3WKJA 3LELA 3LUQA 3WAAB 4QNLA 3L9KA 5EVID 4XZQC 5B0ZC 1E8BA 4ZBJB 1YMXA 3CWFA 1GCEA 1HQ3B 3BY9A 4XUJB 3B6FC 5HW3A 3G34A 4QJGA 2PU2A 3MQQA 3REHC 5HSQA 1VM1A 3VSLA 2Y2KA 3P09A 5CPJC 2Z6DA 1CK3A 4U0TA 2DRWA 3LJAA 3E2KA 3NQJB 3BEBA 5B2ID 5EM1A 5A93A 5HDDA 3S7NA 3LZ1D 3AZND 4MBHA 1P34A 5B31C 2WGIA 3CLOA 5TFQA 4BENA 1M19B 3MMHA 3C1BD 2VEAA 3E0YA 4H9RA 3A0VA 2RCXA 4NE3A 3C4PA 4X1LA 4CSRB 1CQAA 3REIB 2FZ0A 4ME4A 3SS5A 1P3PB 4UUZB 5DNNB 5DTKA 4Z2KA 4EETB 4YM6C 5BNXA 5EFWA 4YOFA 4LD9C 4II7A 3LR0A 5E2GA 5E5AA 1P3GC 2QJ7A 4ZRRA 4JKTA 4E3KA 3WS5A 3NCKA 5B1MA 2C6WB 5DNMA 4J8XB 3CJMA 4DXCA 1OTAA 3LZ0D 1K4FA 3O86A 3VE3A 1STZA 3IF6B 2JKTM 4J8VC 3O62B 2PYOD 4X23A 4NY2A 2D49A 1H0GA 1ED7A 2BYKB 1ID3C 3ZG8B 4IBRA 5AVBC 5GT3B 3X1SB 1AWIA 3MGRC 4P0MA 3PXPA 4JGRA 4WLAA 2ZC5B 3L29A 3T1QB 2W3DA 2NZDA 2LB9A 1V9ZA 3HONA 4PAUA 1F66A 4KGCA 1O07A 1K38A 2NQBA 3MNNA 1F1EA 1ZLAC 4IJEA 5F99C 2O9BA 1ZC2A 5B31G 3AGFA 4X55A 3IBJA 4GHAA 3A3EA 5EPHA 3AZEA 4BBVA 1ODVA 3H7WB 5B0YD 5CPJB 5B1MD 4E45A 5AJGA 3X1TD 1H3OB 4NXGA 5AV5B 2UWXA 5JRGC 4PM6A 2DNSA 1P3BC 4MB5A 3ZG7B 1NLZA 3A6NC 4H9NA 3NOPC 3S7QA 2EFXA 2ZY4A 3OC2A 1MWUA 3MS6A 2J9PA 3AV1B 3HSHA 3G30A 1ES2A 2GJ3A 1SKFA 3BYDA 3QP5A 4KQRA 4LV1A 3DWKA 4MCWA 1K0KA 2NZDD 3GR2A 2DMWA 2ZY2A 1BLHA 1P3AD 2YKFA 4PPRA 4M3KA 4GHIB 5AV6B 5HARA 2WZXA 5GXQB 5FQQA 4OP8A 4DRBA 3P7NA 3REKC 2O0YA 2ZY5A 5AY8C 1BUEA 3G4PA 3MGQB 4OLGA 2PT7A 5F83A 1MPLA 1NJ4A 1YU4A 1TS6A 1ZHHB 4XUJD 4E6WA 1KX4D 1ID3B 3LIFA 4WZ5C 2WGVA 5DKKA 3HBRA 4HEFA 5CGWA 3L7HA 4JJNB 4WU9D 2BYMA 3WD2A 4ZBEA 5GSUA 3AZMC 1EW0A 2PR5A 4I39A 4F3LA 3QNCA 2J3WA 5G49A 2QWSA 3CAXA 3ZG0A 3HLGA 3UB6A 2AVXA 4HNBA 1K54C 1ZLAB 2J9OA 2PRFA 3BECA 1P3MC 5CTNA 2R9WA 1S4SA 1P3LC 4HY8A 1TZYB 2FJ7C 2OWHA 3C5AA 4Z5TC 4NZ5A 2QJ5A 1T1BA 4KG6A 3W98B 1FIKA 3BFGA 5BPVA 4HBTA 4WYYA 3L27A 3B0BA 3L28A 1P3PD 2D02A 4H9SA 3CUEA 4I3AA 2X01A 2EWWA 1GSVA 3A3IA 5L2FA 5IU1A 1MKIA 1H0IA 5JRGB 4K91A 1W79A 2P9VA 2V8FA 3H82A 3KUYD 5CPIB 1VEUB 2X71A 3N7WA 1AOID 4RVAA 5AV8B 5HFOA 4J8UC 1N9BA 3IF5A 3FWLA 3ZGAB 5E2HA 3AZLC 4OJ6A 1NXYA 1XFQA 3S22A 5HWWA 2M7UA 5EVEA 4MBKA 3X1SD 1EQZB 1P3KC 2XH9A 4WN5A 3ULFA 3RXWA 4JXVA 3T4TA 1YLPA 3MXSA 4NE6A 3CPTA 3EEHA 3HCYA 4O0PA 1M1AB 3REKB 4BL2A 1L6JA 2OSUA 5AY8B 2CV5C 2QKPA 3VH6A 1QO6A 3AZGA 4KHAA 4AFIA 4UAAA 4XZQD 5B0ZD 2ZLYA 3UDIA 4OOYA 3KS8A 3B6FD 1P3GA 2KOIA 2EWVA 2V8CA 3MGSB 4Q0HA 2GX5A 2HZ5A 5CPKB 1W8QA 2JKGA 3REJA 3HLFA 3UTAA 3REHD 4UA9A 2YFVA 4EBLA 3B42A 1BLSA 5LBRA 4S2IA 4Y13A 5CPJD 1DJCA 4IEDA 3VFHA 3UT9A 3GDIA 3X1VA 1RGZA 3O5YA 3KFUG 5B31D 4HH3A 5HDSA 1P3LB 3FDDA 4B9OA 4IBFA 5CP6A 2LY8A 2QHKA 2HJ9C 3L2AA 5F99A 4KUDB 1IOUA 3BQ8A 5L10A 4RQ9A 2P7JA 1KE0A 4MLLA 5AQAA 1S32A 1K55C 4YM6D 3KYZA 3B6GA 1F9IA 4KQOA 5CGSA 4LPZA 4LD9D 5B24A 2PD8A 1YMSA 3T4JA 5GHZA 1GHIA 1P3GD 1K57C 2AROA 1GXDA 3AN2A 4DQYB 1CF0A 1TS7A 1LSWA 3H0LC 3VH6T 4OPQA 1YLYA 3TU4A 4XUXA 4J8VD 4DJ2A 2L4RA 4Z66B 1OT6A 4LRZE 4HIAA 3AZFC 1ID3D 3KXBC 2HIOC 4R8PB 1IYSA 2FFYA 5AVBD 2QYBA 2F2AC 3W96C 3MGRD 3WKJC 3LELC 2P04A 4HESA 4XT2A 4WNNA 5EUAA 3ZHHA 1T3UA 4CLCE 3T12B 2RIQA 1YU1A 2IA2A 3MFDA 5B32A 4GNUA 1VQQA 2CV5B 2R78A 3NY4A 3MR0A 1P3FA 3BQAA 5FUGB 3MQOA 1ZLAD 2RVQC 2BG1A 5F99D 1T19A 3AZHA 5G4YA 4OKPA 4Z2GA 1OTEA 3AZIA 3W97B 1KE3A 5HZHA 1NLYA 3LJAC 3RELB 3QP6A 3W4QA 1BH8B 4WZ5A 4LFUA 4S2LA 1HTZA 3KO6A 3R7WA 1P34C 1JFIA 1TF1A 3S7PA 4HOIA 3UPPA 4C75A 5JRGD 4KZ4A 3WD0A 2ZL1B 5EVIB 1P3BD 3HLBA 3V3SA 1YPRA 4MEZA 3A6ND 5EOOA 3EGDC 4YFMA 5HDCA 1CI9A 3AV2A 2J80A 3G6OA 2Z6CA 1FSYA 1XJ2A 5L8MA 2Q9MA 4LGWA 5TBMB 3G2YA 2UV0E 2Y4AA 3HREA 1T1CA 5E5AC 3IX8A 2VX8A 1MY8A 5DNMC 5AV9A 1E3UD 1P9RA 4O8GA 5BT1C 4GD8A 3LZ1B 3REKD 4X23C 3AZNB 5AY8D 4ID4A 4UA7A 4HJ4A 1BH9B 2J8YA 3C1BB 1OGBA 5HAIA 4YS3A 1GSWA
chains in the Genus database with same CATH topology
4IBIA 3KXBB 2HIOB 3FKEA 5E2FA 5EOEA 3WKJB 4H8RA 3LELB 1F66C 4WEKA 4GZBA 1FQGA 1JWPA 5GL9A 3NBLA 3VSKA 4KGCC 1ERQA 2HUEC 2NQBC 3AZMD 5C3IC 3MNNC 2G2WA 1Q9CA 5AVCA 4R4SA 2HPBA 4EBNA 2A3UA 1G6AA 2EXBA 3LZ0B 5KDMA 1LL9A 4MBFA 5B2JA 1P3MD 3AZEC 3W99A 4DDYA 3I7JA 1P3LD 3MVDA 3EPHA 1FCMA 5FI6A 2FJ7D 3WA9A 4Z5TD 4J8WA 3HLEA 5E2EA 3Q7VA 5GT0A 1IYOA 2WUQA 5E43A 3WS2A 3ZNTA 1P3IC 4QB8A 2XD1A 5CGXA 1IEMA 5FASA 3AL0C 1PWGA 3N3FA 1ESIA 3VOYA 4J8UD 1TDLA 1TAFA 3AZLD 2ZD8A 1AXBA 1WYBA 4GDBA 5B40A 5B0YB 1P3KD 5B1MB 3X1TB 4OJ5A 4KZAA 2CV5D 4DE3A 3OZHA 2Y2PA 2WADA 3BLSA 5GHYA 4JF5A 4WZ4A 4E6XA 1TDGA 3AZJC 3MGPA 5GSUC 1PZPA 1Y54A 3BM6A 4OUIA 4WZSB 2NZDB 3FKWA 1F66B 1P3AB 3WTPE 4G91C 2GDNA 2HP9A 3CMZA 2XDMA 5CECA 1FCNA 2QZ6A 3W96A 2G5HC 2EXAA 2R9XA 3FV7A 1L0FA 3G32A 3AZEB 1KX4B 4H9SC 1LI9A 3BFCA 4WU9B 1RCJA 3M2JA 4JXWA 4H9NB 5TGFA 4K0XA 2WAFA 3LCEA 2V20A 3LO7A 3HUMA 2HP6A 5B33A 1M6KA 4JXGA 1J9MA 3AZKA 2Y2NA 5F1FA 1IKIA 4WEJA 1O7EA 2PBYA 2QMIA 1K56D 3AZFD 3KXBD 2HIOD 5CEBA 3W96D 3WKJD 4KG2A 3LELD 3AZGC 3JYIA 3O3VA 1L0EA 5BNVA 3KUYB 1P3OA 4K0WA 4IBDA 1AOIB 3DW0A 3UNWA 5KZHA 3REJC 2RVQD 4M6BA 3UTAC 2V1ZA 4WU8A 1K4EA 1W2EA 2BYMB 4WV4B 1PI5A 2WGWA 5HX9A 4NZ3A 1IYQA 5GLCA 3UT9C 3LJAD 3PBRA 2CWEA 3X1VC 1C3BA 5BO0A 2HDQA 4HGAB 1P34D 3KSYA 1KGEA 4UPKA 1ES5A 4R0QA 4XZQB 5B0ZB 5CP6C 3EQUA 3AFAA 3B6FB 3HLCA 4C3QA 3IWQA 1K25A 1PZOA 5A90A 2XGNA 3O88A 1S32C 4OH0A 3QNBA 3P5JB 3B6GC 3REHB 3BFDA 3WTPA 5B24C 2P9VB 2XLNA 3MZDA 5E5AD 1BFMA 2AROC 4IBXA 3AYWA 3AN2C 1LI0A 2IO5C 5DNMD 1MBLA 3IXGA 4RX2A 4F94A 1HD8A 3B0DC 5B1LA 4ZDXA 5BT1D 4QY5A 4H9QB 3TU4C 4X23D 3EPKA 2XD5A 5B31B 1KX3A 3WAAA 3LEZA 5CERA 2F8NK 4NE5A 1HQ3A 1P3IA 5EECA 5AQ7A 3G31A 2HDUA 2ZM5A 2XQZA 5B32C 2EX6A 1F66D 5A91A 1YU3A 3G35A 2Y59A 4KGCD 4YM6B 1P3FC 4H9OA 2NQBD 1QMFA 3MNND 4LD9B 1EWZA 1P3GB 3AZHC 3R45A 2YFWA 3NQJA 4H9PB 3AZIC 3ZCZA 5TR7A 3TG9A 3W4OA 3UTAB 4KQQA 2JCHA 4J8VB 3AZED 2WKIA 1M19A 1KDSA 3MBZA 1EI5A 3V5MA 4CSRA 5AVBB 3REIA 3WX7A 3L26A 4RYEA 3HVFA 3MGRB 4QD4A 1YLWA 3AZJA 4UUZA 3HUNA 4ZAMA 3UDFA 1CI8A 5JA4B 3GQZA 2FFFB 5HAQA 4X6TA 3IWOA 3AV2C 1P3ID 2Y2LA 4GH9A 5CP6B 2QPNA 4EO5C 5F99B 4J8XA 1NZUA 1L0DA 4NFTA 1N4OA 4O7DA 3IF6A 1BLCA 1Z6FA 3UE0A 3O62A 2BYKA 5BS7A 3B6GB 5AV9C 5GT3A 3A3JA 2AROB 5B32G 3OCLA 3FKVA 1BLPA 3B0DB 3TU4B 1P3BB 3NDEA 4YS3C 3A6NB 2Y2QA 1M18A 3PBNA 4DF6A 1B67A 1SDNA 3AZJD 2ZQAA 2WYXA 5GSUD 3M2KA 5AVCC 1L0GA 3UTBC 1GHPA 4DXBA 3VFFA 3MZFA 3S1YA 3ITBA 1YM1A 3LY3A 5B2JC 3AZHB 5KMWA 3ZG9B 3HLDA 3W99C 5CXWA 1U35A 3B0CW 2DCFA 5AV5A 3MVDC 4WJ3C 1ERMA 5HL1A 1E4DA 3WA9C 2XR0A 3EG5B 2Y2HA 5AQ9A 4J8WC 3V9RA 5GT0C 3AV1A 3IQAA 3B0CT 1K6RA 3UPOA 5HAPA 4JPMA 4WELA 3AZMB 4GB7A 3ZG5A 1JWVA 1PWCA 5AV6A 4CJNA 1S6RA 4GOGA 5GXQA 3MGQA 4OJOA 1P3MB 1PYYA 5B40C 2BLSA 4S2KA 4LCMA 2FJ7B 1N1JB 4Z5TB 3UE3A 5IHVA 1I2SA 5AV9B 4E3IA 3RXXA 4KG5A 3A1IA 4JJNA 1PW1A 4QLCC 3AZGD 5CEDA 2XK1A 2OV5A 1TEMA 4NK3A 4CPKA 3KWQA 3MGPC 2F8NA 2P74A 4J8UB 3REJD 4WBGA 3UTAD 5FAPA 3AZLB 3P98A 4U0XA 5CTMA 4OOMA 4ZJ3A 3X1UA 1TZYA 4G92C 4LV3A 5FQ9A 3W98A 4OVDA 1P3KB 4S2OA 3UT9D 4B88A 1TVFA 2HDSA 4S2JA 3X1VD 5KDMB 5B2JB 1IELA 4EUZA 3C1CA 4KZ6A 3WA9B 3W8KA 4MNRA 5CPIA 5CP6D 1PIOA 3GMWA 2HP5A 4KZ9A 1KGFA 3V3RA 5AV8A 5CRFA 5GLDA 1S32D 3A3FA 1R4VA 2J8PA 2ZMAA 3B6GD 1SCWA 5B24D 1LHYA 2AROD 3AN2D 5B33C 4YINA 4R4RA 4WM9A 3AZKC 3TU4D 5CHMA 5FQIA 1KVLA 5B40B 1EROA 4CAYA 4GN2A 4PM9A 4S2MA 3N4IA 3MGSA 4N92A 5CPKA 1LL5A 5D3OA 5B32D 1K6SA 4FH4A 1P3OC 4EWFA 3BRMA 1P3FD 4IBBA 4NYYA 4IBGA 4WU8C 3MXRA 3AZHD 4WMCA 3AGEA 4OPZA 3AZID 3AZFB 1Q2PA 1YUEA 2Y55A 1Q2QA 3W96B 2F8NH 4KUDA 1ZG6A 1FR6A 3AFAC 3UTBA 1YLJA 4B4XA 1YLZA 2HDRA 3AV2D 2Y2JA 1ULYA 1I5QA 4OQ0A 3WTPC 4ZUXA 1NRFA 3VP2A 4Z66A 2X02A 3AYWC 3UPNA 2ZC3B 4R8PA 4LENA 5AV9D 3A1KA 5B1LC 3LJAB 2H10A 1KU5A 1P34B 1KX3C 3WAAC 5AQBA 4ZBJC 1LLBA 1HQ3C 4H9RB 4YS3D 1FCOA 5FUGA 1YU0A 1W8YA 3N6IA 5DF9A 4N9LA 4P85A 4R3BA 3PAEA 2B5RA 3W97A 4E3JA 3IXHA 5BNXB 5AVCD 3UTBD 5E5AB 4GDNA 4Y0TA 3VH5W 3RELA 5DNMB 4NZ4A 4E3MA 5B2JD 3L25A 3W99D 2WGWB 4X23B 4UA6A 1M19C 1M40A 3MVDD 4QLCA 2XF3A 5EVIA 4PM5A 3WA9D 3REIC 3HL9A 2IWCA 4E44A 4E3NA 5DNNC 5I94A 4J8WD 4ZTKA 3SH7A 4LCLA 5GT0D 3PBOA 1FSWA 4KGCB 3UDXA 2HUEB 2NQBB 3IHBA 5C3IB 3MNNB 4KZ3A 1DJBA 4J8XC 2ZQCA 5B2IA 3IF6C 3O62C 3LZ1A 3NIAA 3OPPA 3AZNA 2Y91A 2WK0A 1CEGA 5BS7C 1PWDA 3FZCA 3M6HA 2EX9A 1BH9A 4EBPA 5GT3C 3C1BA 2ZQ8A 5B40D 1XGJA 4OOLA 3AYWB 1XXMA 4EV4A 3MZEA 3BFEA 3H0MC 1NY0A 1MWRA 2Y2IA 1WE4A 4QLCD 1KX3B 1M18C 4XXRA 5DF8A 1P3IB 5FAOA 1H8YA 4AWLC 5DTSA 4JF4A 3MGPD 4DE2A 3LZ0A 3PBQA 2PYOA 2L5AA 4S2NA 4H9OB 3SS4A 4OPYA 4JXSA 3UE1A 4QY6A 2ZJ9A 2I72A 5DVAA 5FQJA 3R45B 2YFWB 2CC1A 1U35C 4OJLA 5AV5C 2DQNC 2ZQ7A 4DRTA 3NQUA 4DRAA 4Y0OA 3ZNYA 1KX5A 1WWIA 4BD0A 3BLMA 3FYZA 1ONGA 3AV1C 1DY6A 2DF4C 1WYCA 4NZ1A 4FH2A 2ZM0A 4BD1A 3AZJB 4DE1A 1W7FA 5GSUB 3TSGA 3ISGA 5AV6C 5GXQC 5G49B 4OONA 4G91B 1KVMA 5M1AA 5B0YA 3EPJA 3MGQC 5B33D 3X1TA 4B4ZA 3Q81A 2Z2MB 1H5XA 5EVLA 3AZKD 5M19A 1PW8A 3WRZA 1ONHA 5GLAA 3WRTA 5U47A 4JJNC 2E8IA 2H0YA 4X56A 1U60A 2EFUA 1KX5D 1P3AA 3VP3A 1P3OD 2ZC6B 1M18B 3KWQC 4RX3A 2WKEA 1E25A 4Q8IA 4AWLB 4WU8D 3RJUA 4KZ7A 1NYMA 2VQRA 3X1UC 1MWSA 1TZYC 2ZY3A 1RGYA 3W98C 4XUJA 1XPBA 3C4OA 1KX4A 4OLDA 1GA9A 4Z2MH 1XX2A 1XGIA 2A49A 2ZM8A 1U35B 3C1CC 4WU9A 5JYOA 1FR1A 3AZGB 1RP5A 4KHAB 5CPIC 2IWBA 4R23A 3AFAD 3CG5A 2H5SA 5J8XA 5AV8C 3OPHA 1DJAA 5GLBA 3V9RB 4D2OA 3REJB 3HUOA 4Z9QA 5FQKA 5FATA 3WTPD 3OCNA 2YFVB 1EQZC 2IOUA 3AYWD 3LY4A 3V39A 1MWTA 1JTGA 3UT9B 5B1LD 1JTDA 1M1AC 1P3PA 4R1GA 2ZM2A 3X1VB 5DNNA 3OPRA 1XA1A 1KX3D 3WAAD 4P87A 2F8NG 4E3OA 4OP5A 1HQ3D 3KUYA 3VP1A 4QU3A 3G2ZA 4X69A 3MGSC 1BULA 4C6YA 4IVIA 3SS3A 5CPKC 1AOIA 1KE4A 4RA7A 3C7UA 4NETA 5KSCA 2WKHA 1S32B 4IBKA 1KGGA 3WS1A 4GHLA 5B24B 3X1SA 3KWQB 2F8NB 4U3TA 3ZVWA 4PMAA 2V2FF 3AN2B 2IO5B 3NI9A 4N1XA 3GV9A 5JYPA 4A5RA 1M19D 3X1UB 1ES3A 1OMEA 3IHAA 5FA7A 2Q9NA 3IH9A 4XZQA 5B0ZA 3REID 3B3XA 3B6FA 4X68A 4WNNB 4KUDC 1ES4A 3IXDA 4P6BA 5DNND 1JVJA 1FOFA 5B32B 4BJPA 3C1CB 3REHA 4S2PA 2ZQDA 2XEPA 1XP4A 1P3FB 1PZRA 3AGDA 4LG2A 4DDSA 3N8RA 4BL3A 3BFFA 5CPJA 4J8XD 5FQMA 1H3OA 2PU4A 3O87A 5CHLB 4ZUXC 3AZIB 4H9QA 3O62D 4OQHA 4Z66C 4IVKA 4FD8A 5B31A 2C5WB 3IH8A 4R8PC 4R3JA 5GT3D 3SH9A 1JWZA 4Y0UA 2WZZA 1JFIB 5FAQA 1YT4A 3UY6A 5FSRA 3VP0A 3N8LA 3N8SA 2J7VA 4YM6A 1M18D 3TOIA 2Y2OA 1CEFA 4LD9A 3AV2B 4FSFA 1QMEA 4CAYB 4LV0A 3SH8A 3ZDJA 1HTAA 4H9PA 4EO5B 3W97C 3WS4A 1YLTA 1XA7A 2EX2A 1BSGA 2ZC7A 4J8VA 3RELC 3IT9A 3E2LA 1ID3A 5AVBA 3GSGA 3IXBA 3MGRA 3OPLA 1U35D 1HZOA 5AV5D 3IWIA 5EVIC 5JA4A 3NC8A 4OQGA 1BTLA 4YS3B 3PTEA 4BLMA 4OQIA 3AV1D 5F82A 1GHMA 1ZLAA 1B6WA 3DTMA 2RL3A 1MXOA 1GA0A 3VH6W 5AVCB 5AV6D 3UTBB 1NYYA 5GXQD 5GHXA 3ITAA 5B2IC 5EE8A 1HVBA 3LZ1C 4DE0A 3AZNC 3VMAA 3MGQD 3A3DA 3W99B 2JBFA 4JF6A 4ZUXB 3C1BC 5JRGA 3MVDB 1P3BA 3EPLA 3A6NA 2JC7A 4J8WB 1SHVA 3GTCA 4JJND 5GT0B 3Q7VB 4PM8A 3UO9A 5KSHA 1EQZA 4GKUA 3KWQD 2F8ND 3Q82A 1E3UA 3LZ0C 3PBSA 4KZ5A 2VGJA 1ZKJA 1M1AA 3DWZA 1TAFB 2PYOC 3REKA 4IBCA 2OLUA 4S2NC 4JBFA 5AY8A 3X1UD 3WS0A 1TZYD 1IYPA 3S4XA 3W98D 2G2UA 4ZJ1A 2G5IC 2XFTA 1PI4A 2ZC4B 4KZBA 4OPRA 1KX5C 4IBEA 3C1CD 4QLCB 1NZOA 5CHJA 3AZMA 2JSSA 5DTTA 5CPID 5M18A 4Y7PA 5AV8D 4EQIA 3MGPB 1K54A 1YQSA 2WAEA 1P3MA 4KZ8A 1P3LA 1ESUA 3ZVTA 1EQZD 5B0YC 1N1JA 4G92B 2FJ7A 4E3LA 4Z5TA 3HLWA 5B1MC 3X1TC 1W5DA 3KS4A 5B2IB 4UHUA 1M1AD 3GRJA 3CZDA 3H0RC 4Z2MG 3SOIA 3WWXA 4LV2A 4FCFA 4ZJ2A 1S0WA 4DKIA 3VH5A 4OJPA 3ZFZA 5F1GA 3UN7A 4IBJA 2JE5A 1I2WA 3MGSD 3EQVA 4JLFA 2H0TA 5CPKD 2NZDC 4J8UA 3C7VA 4X53A 5CHUA 2EX8A 1P3AC 2OLVA 3AZLA 4HBUA 5DF7A 3PAGA 1P3KA 4WMCD 2VGKA 4XUZA 5B33B 1L2SA 3D4FA 3F6TA 3AZKB 2PYOB 3VOZA 4XUJC 2CV5A 1KX4C 3PBTA 1BZAA 1BT5A 2W8SA 1Z2CB 5G18A 4PM7A 4WU9C 4KUDD 1ALQA 3NQUB 2XFSA 5BNVB 1KX5B 3W4PA 4IJFA 3IP4C 4N9KA 1P3OB 4L0LA 1WWSA 1BH8A 3NDGA 1ZG4A 1G68A 3MKFA 4BQMA 4WU8B 3GVBA 1KDWA 4NYUA 4ZUXD 3M6BA 2ZQ9A 1A7WA 4Z66D 4QHCA 2IWDA 4N1HA 3VH5T 3Q07A 4R8PD 3QHYA 5FDHA 2Z2LB 1P3PC 5A92A 2Y2GA 1XKZA 5BO0B 1SDEA 5BOHA 3KUYC 1K55A 4GD6A 3AFAB 1AOIC 3MKEA 1YU2A 1K57A 3V50A 5FI7A 5FI2A 3Q1FA 3W97D 1IKGA 3WTPB 3VP4A 3X1SC 4KENB 3RELD 1H8ZA 1K56A 2Y2MA 3AZFA 3KXBA 2HIOA 3Q7ZA 5B1LB 4HGAC 3WKJA 3LELA 3WAAB 4QNLA 5EVID 4XZQC 5B0ZC 4ZBJB 1YMXA 1GCEA 1HQ3B 4XUJB 3B6FC 5HW3A 3G34A 4QJGA 2PU2A 3REHC 1VM1A 3VSLA 2Y2KA 3P09A 5CPJC 1CK3A 4U0TA 2DRWA 3LJAA 3E2KA 3NQJB 3BEBA 5B2ID 5A93A 3LZ1D 3AZND 4MBHA 1P34A 5B31C 2WGIA 5TFQA 4BENA 1M19B 3C1BD 4H9RA 2RCXA 4NE3A 3C4PA 4CSRB 3REIB 3SS5A 1P3PB 4UUZB 5DNNB 5DTKA 4YM6C 5BNXA 4LD9C 5E2GA 5E5AA 1P3GC 4JKTA 4E3KA 3WS5A 3NCKA 5B1MA 2C6WB 5DNMA 4J8XB 3CJMA 4DXCA 3LZ0D 1K4FA 3O86A 3IF6B 4J8VC 3O62B 2PYOD 4X23A 4NY2A 2BYKB 1ID3C 3ZG8B 4IBRA 5AVBC 5GT3B 3X1SB 3MGRC 4P0MA 2ZC5B 3L29A 2NZDA 3HONA 1F66A 4KGCA 1O07A 1K38A 2NQBA 3MNNA 1F1EA 1ZLAC 4IJEA 5F99C 1ZC2A 5B31G 3AGFA 4X55A 4GHAA 3A3EA 5EPHA 3AZEA 5B0YD 5CPJB 5B1MD 4E45A 3X1TD 1H3OB 5AV5B 2UWXA 5JRGC 4PM6A 2DNSA 1P3BC 3ZG7B 3A6NC 4H9NA 2EFXA 2ZY4A 3OC2A 1MWUA 2J9PA 3AV1B 3HSHA 3G30A 1ES2A 3BYDA 1SKFA 4KQRA 4LV1A 3DWKA 2NZDD 3GR2A 2ZY2A 1BLHA 1P3AD 4PPRA 4M3KA 5AV6B 5HARA 2WZXA 5GXQB 5FQQA 4OP8A 4DRBA 3REKC 2ZY5A 5AY8C 1BUEA 3G4PA 3MGQB 4OLGA 5F83A 1MPLA 1NJ4A 1YU4A 4XUJD 4E6WA 1KX4D 1ID3B 4WZ5C 2WGVA 3HBRA 4HEFA 5CGWA 4JJNB 4WU9D 2BYMA 4ZBEA 5GSUA 3AZMC 3QNCA 5G49A 3ZG0A 3HLGA 1K54C 1ZLAB 2J9OA 3BECA 1P3MC 5CTNA 2R9WA 1P3LC 1TZYB 2FJ7C 3C5AA 4Z5TC 4NZ5A 4KG6A 3W98B 3BFGA 5BPVA 4HBTA 4WYYA 3L27A 3B0BA 3L28A 1P3PD 4H9SA 2X01A 3A3IA 5L2FA 1MKIA 5JRGB 4K91A 1W79A 2P9VA 3KUYD 5CPIB 2X71A 3N7WA 1AOID 4RVAA 5AV8B 5HFOA 4J8UC 1N9BA 3IF5A 3FWLA 3ZGAB 5E2HA 3AZLC 4OJ6A 1NXYA 3S22A 4MBKA 3X1SD 1EQZB 1P3KC 2XH9A 3RXWA 4JXVA 1YLPA 3MXSA 4NE6A 1M1AB 3REKB 4BL2A 2OSUA 5AY8B 2CV5C 3VH6A 3AZGA 4KHAA 4UAAA 4XZQD 5B0ZD 2ZLYA 3UDIA 4OOYA 3KS8A 3B6FD 1P3GA 3MGSB 5CPKB 1W8QA 3REJA 3HLFA 3UTAA 3REHD 4UA9A 2YFVA 4EBLA 1BLSA 4S2IA 5CPJD 1DJCA 4IEDA 3VFHA 3UT9A 3X1VA 1RGZA 3KFUG 5B31D 1P3LB 3FDDA 4IBFA 5CP6A 2LY8A 3L2AA 5F99A 4KUDB 1KE0A 4MLLA 5AQAA 1S32A 1K55C 4YM6D 3B6GA 4KQOA 5CGSA 4LD9D 5B24A 1YMSA 5GHZA 1GHIA 1P3GD 1K57C 2AROA 3AN2A 4DQYB 3H0LC 3VH6T 4OPQA 3TU4A 1YLYA 4XUXA 4J8VD 4Z66B 3AZFC 1ID3D 3KXBC 2HIOC 4R8PB 1IYSA 2FFYA 5AVBD 2F2AC 3W96C 3MGRD 3WKJC 3LELC 4HESA 5EUAA 4WNNA 3ZHHA 1T3UA 2RIQA 1YU1A 3MFDA 5B32A 4GNUA 1VQQA 2CV5B 3NY4A 1P3FA 5FUGB 1ZLAD 2RVQC 2BG1A 5F99D 3AZHA 4OKPA 3AZIA 3W97B 1KE3A 3LJAC 3RELB 3W4QA 1BH8B 4WZ5A 4S2LA 1HTZA 1P34C 1JFIA 3UPPA 4C75A 5JRGD 4KZ4A 5EVIB 1P3BD 3HLBA 3V3SA 4MEZA 3A6ND 5EOOA 4YFMA 1CI9A 3AV2A 1FSYA 2Q9MA 3G2YA 2Y4AA 3HREA 5E5AC 1MY8A 5DNMC 5AV9A 1E3UD 5BT1C 4GD8A 3LZ1B 3REKD 4X23C 3AZNB 5AY8D 4ID4A 4UA7A 1BH9B 2J8YA 3C1BB 5HAIA 4YS3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FQK A;  2BLS A;  4S2K A;  5FAT A;  4LCM A;  5E2F A;  3OCN A;  3UE3 A;  5EOE A;  5IHV A;  1I2S A;  1VM1 A;  4H8R A;  3VSL A;  4E3I A;  4WEK A;  3LY4 A;  4GZB A;  1FQG A;  1JWP A;  5GL9 A;  1MWT A;  3NBL A;  4KG5 A;  3RXX A;  3V39 A;  3VSK A;  1ERQ A;  1JTG A;  2Y2K A;  3P09 A;  1JTD A;  2G2W A;  1PW1 A;  4R1G A;  2ZM2 A;  1CK3 A;  4U0T A;  2DRW A;  5CED A;  4R4S A;  2HPB A;  2XK1 A;  3E2K A;  3BEB A;  3OPR A;  1XA1 A;  5A93 A;  2OV5 A;  4EBN A;  1TEM A;  4NK3 A;  2A3U A;  1G6A A;  2EXB A;  4MBH A;  4P87 A;  4E3O A;  2WGI A;  4OP5 A;  4CPK A;  5TFQ A;  1LL9 A;  4BEN A;  4MBF A;  2P74 A;  3VP1 A;  4QU3 A;  3G2Z A;  4DDY A;  4X69 A;  1BUL A;  2RCX A;  3I7J A;  4C6Y A;  3C4P A;  4IVI A;  4WBG A;  3SS3 A;  1KE4 A;  1FCM A;  5FAP A;  4RA7 A;  5FI6 A;  3C7U A;  3P98 A;  4U0X A;  5CTM A;  4NET A;  5KSC A;  4OOM A;  4ZJ3 A;  3SS5 A;  2WKH A;  1KGG A;  5DTK A;  4LV3 A;  3WS1 A;  5FQ9 A;  4OVD A;  4S2O A;  4B88 A;  3HLE A;  5E2E A;  1TVF A;  2HDS A;  3Q7V A;  4S2J A;  1IYO A;  2WUQ A;  4U3T A;  5E2G A;  4PMA A;  2V2F F;  3ZVW A;  5E43 A;  3WS2 A;  3ZNT A;  1IEL A;  4JKT A;  4QB8 A;  2XD1 A;  3NCK A;  3WS5 A;  4E3K A;  3NI9 A;  5CGX A;  4EUZ A;  1IEM A;  2C6W B;  3CJM A;  4DXC A;  4N1X A;  3GV9 A;  4KZ6 A;  5FAS A;  5JYP A;  1K4F A;  3O86 A;  1PWG A;  3W8K A;  4A5R A;  4MNR A;  1ES3 A;  1ESI A;  3IF6 B;  1OME A;  1PIO A;  3IHA A;  3GMW A;  5FA7 A;  2HP5 A;  2Q9N A;  3IH9 A;  4KZ9 A;  3VOY A;  1TDL A;  1KGF A;  3V3R A;  3B3X A;  3ZG8 B;  5CRF A;  5GLD A;  2ZD8 A;  4IBR A;  4X68 A;  1ES4 A;  1AXB A;  1WYB A;  3IXD A;  3A3F A;  4P6B A;  4GDB A;  4P0M A;  2ZMA A;  1JVJ A;  1FOF A;  1SCW A;  2ZC5 B;  1LHY A;  4BJP A;  4S2P A;  2ZQD A;  2XEP A;  1XP4 A;  4KZA A;  3AGD A;  1O07 A;  4YIN A;  4DDS A;  1K38 A;  3N8R A;  4R4R A;  4BL3 A;  3BFF A;  4WM9 A;  5FQM A;  4DE3 A;  3OZH A;  5CHM A;  2PU4 A;  2Y2P A;  3O87 A;  2WAD A;  3BLS A;  5FQI A;  1ZC2 A;  4OQH A;  5GHY A;  4IVK A;  1KVL A;  4FD8 A;  4JF5 A;  4WZ4 A;  4E6X A;  2C5W B;  1TDG A;  3AGF A;  3IH8 A;  4X55 A;  4R3J A;  1ERO A;  1PZP A;  1Y54 A;  4GN2 A;  3A3E A;  3BM6 A;  5EPH A;  4PM9 A;  3SH9 A;  1JWZ A;  4S2M A;  3N4I A;  3FKW A;  4Y0U A;  4N92 A;  2WZZ A;  1LL5 A;  5D3O A;  1K6S A;  2GDN A;  5FAQ A;  1YT4 A;  2HP9 A;  3UY6 A;  4FH4 A;  3CMZ A;  5FSR A;  3VP0 A;  3N8L A;  4EWF A;  3N8S A;  2XDM A;  3BRM A;  5CEC A;  1FCN A;  2QZ6 A;  2UWX A;  2J7V A;  4PM6 A;  2DNS A;  2EXA A;  3TOI A;  2R9X A;  2Y2O A;  3ZG7 B;  1CEF A;  3MXR A;  4WMC A;  3AGE A;  3FV7 A;  1L0F A;  3G32 A;  4FSF A;  1QME A;  4LV0 A;  4OPZ A;  3SH8 A;  2EFX A;  3ZDJ A;  3OC2 A;  1MWU A;  3WS4 A;  2J9P A;  3G30 A;  1ES2 A;  1YLT A;  1SKF A;  1XA7 A;  2EX2 A;  1BSG A;  2ZC7 A;  3BYD A;  4KQR A;  4LV1 A;  3DWK A;  1LI9 A;  3GR2 A;  1Q2P A;  3BFC A;  3IT9 A;  3E2L A;  1BLH A;  1RCJ A;  2Y55 A;  4PPR A;  1Q2Q A;  4M3K A;  3M2J A;  3GSG A;  5HAR A;  2WZX A;  3IXB A;  4JXW A;  5FQQ A;  3OPL A;  5TGF A;  4OP8 A;  1ZG6 A;  4K0X A;  1HZO A;  3IWI A;  2WAF A;  1FR6 A;  3LCE A;  5EVI C;  3NC8 A;  1BUE A;  1YLJ A;  3G4P A;  4OQG A;  4OLG A;  4B4X A;  1YLZ A;  2HDR A;  2V20 A;  3LO7 A;  2Y2J A;  5F83 A;  1BTL A;  3HUM A;  1MPL A;  2HP6 A;  3PTE A;  1NJ4 A;  4BLM A;  1M6K A;  1I5Q A;  4JXG A;  4OQI A;  4OQ0 A;  4E6W A;  1J9M A;  2Y2N A;  4WZ5 C;  1GHM A;  5F82 A;  2WGV A;  5F1F A;  3HBR A;  1IKI A;  4WEJ A;  3DTM A;  1O7E A;  2RL3 A;  2PBY A;  2QMI A;  1K56 D;  4HEF A;  1MXO A;  1NRF A;  3VP2 A;  1GA0 A;  5CGW A;  2X02 A;  3UPN A;  5CEB A;  2ZC3 B;  4ZBE A;  4KG2 A;  4LEN A;  2H10 A;  1NYY A;  3JYI A;  5GHX A;  3ITA A;  3O3V A;  3QNC A;  5EE8 A;  1HVB A;  1L0E A;  4DE0 A;  3VMA A;  5AQB A;  3ZG0 A;  3HLG A;  3A3D A;  1LLB A;  4K0W A;  1K54 C;  2JBF A;  4JF6 A;  2J9O A;  3BEC A;  5CTN A;  1FCO A;  3DW0 A;  2R9W A;  3UNW A;  5KZH A;  2V1Z A;  1K4E A;  1W8Y A;  3N6I A;  1PI5 A;  2WGW A;  5DF9 A;  2JC7 A;  3C5A A;  4N9L A;  4P85 A;  4KG6 A;  5HX9 A;  3BFG A;  4R3B A;  4HBT A;  3PAE A;  1IYQ A;  4WYY A;  2B5R A;  1SHV A;  3GTC A;  5GLC A;  4E3J A;  3Q7V B;  3IXH A;  4PM8 A;  2X01 A;  3PBR A;  3UO9 A;  3A3I A;  4GDN A;  4Y0T A;  5L2F A;  5KSH A;  1C3B A;  1MKI A;  2HDQ A;  4K91 A;  4E3M A;  1KGE A;  4GKU A;  1W79 A;  2P9V A;  3Q82 A;  1ES5 A;  1E3U A;  3PBS A;  2X71 A;  2WGW B;  4KZ5 A;  4R0Q A;  3N7W A;  2VGJ A;  1ZKJ A;  4UA6 A;  1M40 A;  3DWZ A;  4RVA A;  5HFO A;  2XF3 A;  2OLU A;  4S2N C;  5EVI A;  4PM5 A;  1N9B A;  3EQU A;  4JBF A;  3IF5 A;  3FWL A;  3ZGA B;  3HLC A;  4C3Q A;  3WS0 A;  5E2H A;  3IWQ A;  1K25 A;  3HL9 A;  1NXY A;  1PZO A;  2IWC A;  5A90 A;  1IYP A;  3S22 A;  4E3N A;  3S4X A;  2XGN A;  3O88 A;  4OH0 A;  2G2U A;  3QNB A;  4ZJ1 A;  5I94 A;  4ZTK A;  3SH7 A;  4MBK A;  4LCL A;  2XFT A;  3PBO A;  1PI4 A;  2ZC4 B;  4KZB A;  4OPR A;  3BFD A;  3MZD A;  2P9V B;  2XLN A;  2XH9 A;  1FSW A;  3RXW A;  4JXV A;  3UDX A;  1YLP A;  3MXS A;  4IBX A;  3IHB A;  1LI0 A;  1MBL A;  3IXG A;  4RX2 A;  4F94 A;  4KZ3 A;  1HD8 A;  1NZO A;  5CHJ A;  4BL2 A;  1DJB A;  2OSU A;  4ZDX A;  5DTT A;  4QY5 A;  5M18 A;  2ZQC A;  4UAA A;  2XD5 A;  3IF6 C;  4Y7P A;  2ZLY A;  3NIA A;  3OPP A;  3UDI A;  4OOY A;  3LEZ A;  5CER A;  4EQI A;  2Y91 A;  2WK0 A;  1CEG A;  1K54 A;  1PWD A;  3FZC A;  3M6H A;  5EEC A;  1YQS A;  2EX9 A;  5AQ7 A;  4EBP A;  3G31 A;  2WAE A;  2ZQ8 A;  4KZ8 A;  1W8Q A;  1XGJ A;  2HDU A;  4OOL A;  1XXM A;  3HLF A;  1ESU A;  4EV4 A;  2XQZ A;  3MZE A;  4UA9 A;  3ZVT A;  2EX6 A;  3BFE A;  4E3L A;  3HLW A;  5A91 A;  1NY0 A;  1MWR A;  3G35 A;  2Y2I A;  2Y59 A;  4EBL A;  1WE4 A;  1W5D A;  1BLS A;  4S2I A;  1QMF A;  4UHU A;  1DJC A;  4IED A;  3VFH A;  3GRJ A;  3CZD A;  1EWZ A;  3SOI A;  3WWX A;  4LV2 A;  4XXR A;  5DF8 A;  4FCF A;  4ZJ2 A;  1RGZ A;  5FAO A;  1H8Y A;  1S0W A;  5DTS A;  4DKI A;  3ZCZ A;  4JF4 A;  3ZFZ A;  5F1G A;  5TR7 A;  3TG9 A;  3W4O A;  4DE2 A;  3UN7 A;  4KQQ A;  2JCH A;  2JE5 A;  2WKI A;  1I2W A;  3PBQ A;  3EQV A;  4JLF A;  2H0T A;  1KDS A;  3MBZ A;  4S2N A;  3C7V A;  4X53 A;  5CHU A;  1EI5 A;  3V5M A;  2EX8 A;  3SS4 A;  4RYE A;  2OLV A;  3HVF A;  4OPY A;  4JXS A;  1YLW A;  4HBU A;  4QD4 A;  3UE1 A;  4QY6 A;  1KE0 A;  2I72 A;  2ZJ9 A;  4MLL A;  5AQA A;  5DVA A;  1K55 C;  3HUN A;  5FQJ A;  4ZAM A;  3UDF A;  1CI8 A;  2CC1 A;  3GQZ A;  5DF7 A;  2FFF B;  5HAQ A;  4KQO A;  2ZQ7 A;  3PAG A;  5CGS A;  4WMC D;  1YMS A;  2VGK A;  4X6T A;  4XUZ A;  1GHI A;  5GHZ A;  3IWO A;  1K57 C;  4DRT A;  4Y0O A;  1L2S A;  3ZNY A;  3D4F A;  2Y2L A;  4BD0 A;  3BLM A;  3FYZ A;  1ONG A;  3VOZ A;  2QPN A;  4OPQ A;  1NZU A;  1L0D A;  1DY6 A;  1YLY A;  4XUX A;  1WYC A;  3PBT A;  1N4O A;  4O7D A;  1BZA A;  4FH2 A;  2ZM0 A;  1BLC A;  3IF6 A;  1Z6F A;  1BT5 A;  3UE0 A;  4BD1 A;  4DE1 A;  1IYS A;  1W7F A;  2FFY A;  5G18 A;  4PM7 A;  1ALQ A;  3TSG A;  3ISG A;  4HES A;  5EUA A;  3ZHH A;  3A3J A;  2XFS A;  4OON A;  1KVM A;  5M1A A;  3W4P A;  3OCL A;  3MFD A;  3FKV A;  4GNU A;  4N9K A;  1BLP A;  4L0L A;  1VQQ A;  3NY4 A;  3NDG A;  4B4Z A;  1ZG4 A;  1G68 A;  3MKF A;  3NDE A;  3Q81 A;  2Z2M B;  1H5X A;  4BQM A;  3GVB A;  5EVL A;  1KDW A;  2Y2Q A;  5M19 A;  3PBN A;  2BG1 A;  1PW8 A;  4DF6 A;  3M6B A;  2ZQ9 A;  4OKP A;  3WRZ A;  1ONH A;  1SDN A;  4QHC A;  2IWD A;  5GLA A;  4N1H A;  1KE3 A;  3Q07 A;  3WRT A;  3QHY A;  2ZQA A;  2WYX A;  3M2K A;  5FDH A;  5U47 A;  2Z2L B;  5A92 A;  1L0G A;  2E8I A;  2Y2G A;  1XKZ A;  2H0Y A;  3W4Q A;  4X56 A;  1U60 A;  1GHP A;  2EFU A;  4DXB A;  4WZ5 A;  1SDE A;  4S2L A;  1HTZ A;  3VFF A;  3MZF A;  3VP3 A;  3S1Y A;  3ITB A;  2ZC6 B;  1YM1 A;  5BOH A;  4RX3 A;  3LY3 A;  2WKE A;  1E25 A;  1K55 A;  5KMW A;  4GD6 A;  3UPP A;  3ZG9 B;  3HLD A;  4KZ4 A;  4C75 A;  5CXW A;  4Q8I A;  5EVI B;  2DCF A;  3HLB A;  3V3S A;  4MEZ A;  1ERM A;  5HL1 A;  5EOO A;  1E4D A;  4KZ7 A;  3RJU A;  4YFM A;  1NYM A;  3MKE A;  1K57 A;  2XR0 A;  3V50 A;  1MWS A;  1CI9 A;  5FI7 A;  2Y2H A;  5FI2 A;  1RGY A;  5AQ9 A;  3Q1F A;  1FSY A;  1IKG A;  1XPB A;  3C4O A;  4OLD A;  3VP4 A;  1GA9 A;  2Q9M A;  3IQA A;  3G2Y A;  2Y4A A;  1K6R A;  3HRE A;  4KEN B;  3UPO A;  1H8Z A;  1XX2 A;  1K56 A;  5HAP A;  2Y2M A;  1XGI A;  2A49 A;  2ZM8 A;  4JPM A;  4WEL A;  3Q7Z A;  4GB7 A;  3ZG5 A;  1MY8 A;  5JYO A;  1FR1 A;  1JWV A;  1E3U D;  1PWC A;  1RP5 A;  4CJN A;  1S6R A;  4GOG A;  2IWB A;  4GD8 A;  4R23 A;  5EVI D;  3CG5 A;  2H5S A;  4ID4 A;  5J8X A;  1YMX A;  3OPH A;  1GCE A;  1DJA A;  4UA7 A;  2J8Y A;  5GLB A;  5HW3 A;  3G34 A;  4QJG A;  4D2O A;  5HAI A;  2PU2 A;  3HUO A;  4Z9Q A;  1PYY A; 
#chains in the Genus database with same CATH topology
 4IBI A;  3KXB B;  2HIO B;  1E6R A;  3FKE A;  5E2F A;  5EOE A;  2VV7 A;  3WKJ B;  3U2A A;  4H8R A;  3LEL B;  1F66 C;  4WEK A;  4GZB A;  1FQG A;  1JWP A;  5CX7 A;  3NBL A;  5GL9 A;  3VSK A;  4JGQ A;  4KGC C;  1ERQ A;  3T4O A;  1CJF A;  2HUE C;  4H6J A;  2NQB C;  3AZM D;  5C3I C;  3MNN C;  1DP9 A;  1Q9C A;  5AVC A;  2G2W A;  1VET A;  4R4S A;  2HPB A;  4EBN A;  2A3U A;  1G6A A;  2EXB A;  4G3W A;  3LIA A;  3CHW P;  1PRQ A;  3LZ0 B;  5DFX A;  5KDM A;  1LL9 A;  2W3F A;  4MBF A;  3QP2 A;  5B2J A;  1TD5 A;  2V9A A;  1L3L A;  1P3M D;  3AZE C;  3W99 A;  4DDY A;  3I7J A;  1P3L D;  3MVD A;  3EPH A;  1FCM A;  5FI6 A;  2FJ7 D;  3WA9 A;  4Z5T D;  1UGU A;  2ZOH A;  4J8W A;  4CLC A;  3HLE A;  5E2E A;  3Q7V A;  5GT0 A;  3D72 A;  1IYO A;  2WUQ A;  1H3Q A;  4GJ4 A;  5E43 A;  3WS2 A;  3ZNT A;  4ARZ A;  1P3I C;  4QB8 A;  2XD1 A;  1PFL A;  3FPW A;  5CGX A;  1IEM A;  5FAS A;  3AL0 C;  3E4P A;  1PWG A;  3N3F A;  1ESI A;  3VOY A;  4J8U D;  2HV1 A;  1TDL A;  1TAF A;  3MQL A;  3AZL D;  2ZD8 A;  3LIC A;  1AXB A;  1WYB A;  3T1S A;  4GDB A;  5B40 A;  5B0Y B;  1P3K D;  5B1M B;  3T4L A;  3X1T B;  4OJ5 A;  4KZA A;  2BAS A;  1OGG A;  2M1C A;  2CV5 D;  4DE3 A;  3CI6 A;  3OZH A;  1EAK A;  2Y2P A;  2WAD A;  3BLS A;  5GHY A;  4JF5 A;  1SZV A;  4WZ4 A;  1H8M A;  4Z2L A;  4YWZ A;  4E6X A;  1TDG A;  3AZJ C;  3MGP A;  5GSU C;  1PZP A;  1Y54 A;  3BM6 A;  4OUI A;  1YAX A;  4WZS B;  2NZD B;  3FKW A;  1F66 B;  2VGL S;  1P3A B;  3WTP E;  4HH2 A;  4G91 C;  2GDN A;  2W3H A;  2HP9 A;  3CMZ A;  2VV8 A;  2XDM A;  5CEC A;  1XJ4 A;  2O99 A;  1FCN A;  2QZ6 A;  5DJU A;  3W96 A;  4M4X A;  2G5H C;  2EXA A;  5HWT A;  2R9X A;  3FV7 A;  1L0F A;  3G32 A;  2V5O A;  3AZE B;  1KX4 B;  4H9S C;  3GEC A;  3CUE C;  4WL9 A;  1LI9 A;  3FPV A;  1J7M A;  3BFC A;  4WU9 B;  1RCJ A;  3NOU C;  3M2J A;  4P6Z M;  4JXW A;  4CQH A;  4H9N B;  5TGF A;  3TW8 A;  4K0X A;  2WAF A;  3LCE A;  4K08 A;  1H0M A;  2V20 A;  3LO7 A;  3HUM A;  2HP6 A;  5J7E A;  5B33 A;  1M6K A;  4JXG A;  1J9M A;  3AZK A;  2Y2N A;  5F1F A;  3IX4 A;  1IKI A;  4WEJ A;  1O7E A;  2PBY A;  2QMI A;  1K56 D;  3AZF D;  3KXB D;  2HIO D;  4P6Z S;  4O01 A;  5CEB A;  3W96 D;  3WKJ D;  4KG2 A;  3LEL D;  4ESP A;  2V1A A;  3AZG C;  3JYI A;  5F69 A;  3O3V A;  2JKT I;  3IX3 A;  1L0E A;  5BNV A;  3KUY B;  1P3O A;  4K0W A;  3SZT A;  4IBD A;  1AOI B;  3DW0 A;  4R38 A;  3UNW A;  5KZH A;  3F1N A;  3REJ C;  2RVQ D;  4M6B A;  3UTA C;  2V1Z A;  4WU8 A;  1K4E A;  1W2E A;  2BYM B;  4WV4 B;  1PI5 A;  4HP4 A;  2WGW A;  3VE4 A;  3ZQ5 A;  4QWO A;  5HX9 A;  1P97 A;  2XRN A;  4NZ3 A;  4R3A A;  1IYQ A;  3NEC A;  5GLC A;  3UME A;  4JGP A;  3PHY A;  3UT9 C;  3LJA D;  4HP9 A;  3PBR A;  2CWE A;  3X1V C;  3DTK A;  1C3B A;  5EM0 A;  5BO0 A;  2HDQ A;  3NUL A;  4HGA B;  1P34 D;  3KSY A;  1KGE A;  4UPK A;  1ES5 A;  4R0Q A;  4XZQ B;  5B0Z B;  1MKM A;  5CP6 C;  2FN2 A;  3EQU A;  3AFA A;  3B6F B;  3HLC A;  4C3Q A;  3IWQ A;  1K25 A;  1PZO A;  5A90 A;  2V0U A;  2XGN A;  3O88 A;  1S32 C;  4OH0 A;  3QNB A;  3P5J B;  3B6G C;  3REH B;  3BFD A;  3WTP A;  5B24 C;  2P9V B;  2XLN A;  3MZD A;  5E5A D;  1BFM A;  2ARO C;  4IBX A;  3AYW A;  3AN2 C;  1LI0 A;  2IO5 C;  5DNM D;  1MBL A;  3BWL A;  3IXG A;  4RX2 A;  4F94 A;  1HD8 A;  3B0D C;  5B1L A;  3IBR A;  4ZDX A;  5BT1 D;  4QY5 A;  4H9Q B;  3TU4 C;  1Y28 A;  4X23 D;  3EPK A;  2XD5 A;  1XFN A;  5B31 B;  1KX3 A;  3WAA A;  3KSH A;  3LEZ A;  5CER A;  2F8N K;  4NE5 A;  1HQ3 A;  1P3I A;  5EEC A;  5AQ7 A;  3S7O A;  3G31 A;  4E04 A;  2KLI A;  2HDU A;  2D01 A;  2XSS A;  1P0Z A;  2HF6 A;  1GSX A;  2ZM5 A;  2XQZ A;  5B32 C;  1HLU P;  2VK3 A;  2EX6 A;  4DJ3 A;  1F66 D;  1N9N A;  5A91 A;  1YU3 A;  3G35 A;  2Y59 A;  3T4K A;  4KGC D;  4YM6 B;  1P3F C;  4H9O A;  2NQB D;  1QMF A;  2Y79 A;  4WF0 A;  3MNN D;  4LD9 B;  1EWZ A;  3NHQ A;  3LIE A;  3LYX A;  1P3G B;  3AZH C;  2I9V A;  3R45 A;  2YFW A;  3NQJ A;  4H9P B;  3AZI C;  4KQD A;  3ZCZ A;  4MN6 A;  5TR7 A;  3TG9 A;  3W4O A;  3UTA B;  4KQQ A;  2JCH A;  4J8V B;  3AZE D;  2WKI A;  2W1T B;  1M19 A;  1KDS A;  3MBZ A;  1EI5 A;  3V5M A;  4CSR A;  3PR6 A;  5AVB B;  3REI A;  3WX7 A;  3L26 A;  4RYE A;  3HVF A;  3MGR B;  4QD4 A;  1YLW A;  3AZJ A;  4UUZ A;  3HUN A;  4ZAM A;  3UDF A;  1CI8 A;  5JA4 B;  3GQZ A;  2FFF B;  5HAQ A;  2YKH A;  1BYW A;  4X6T A;  3SW1 A;  3IWO A;  3AV2 C;  4LRY C;  1P3I D;  2Y2L A;  4GH9 A;  3F1P A;  4R6L A;  5CP6 B;  3R4K A;  2QPN A;  4EO5 C;  5F99 B;  2W3G A;  3NOT C;  4J8X A;  1NZU A;  1L0D A;  1W1Y A;  4NFT A;  1N4O A;  3LR4 A;  4O7D A;  3IF6 A;  1BLC A;  1Z6F A;  3UE0 A;  3O62 A;  2BYK A;  5BS7 A;  3B6G B;  3EEA A;  4NXE A;  5AV9 C;  3WD3 A;  5GT3 A;  3A3J A;  5HL6 A;  2ARO B;  5B32 G;  3OCL A;  3FKV A;  1BLP A;  3B0D B;  3MF0 A;  1DRM A;  3TU4 B;  5I5L A;  1OJ5 A;  1P3B B;  3NDE A;  4YS3 C;  1Z09 A;  3A6N B;  2Y2Q A;  1M18 A;  3PBN A;  4HMC A;  2JKR M;  1P9W A;  1OPX A;  5AVF A;  4DF6 A;  2XRO A;  1B67 A;  3B33 A;  1SDN A;  3AZJ D;  2ZQA A;  2WYX A;  5GSU D;  3EGX C;  3M2K A;  5AVC C;  1L0G A;  2ZOI A;  3UTB C;  1GHP A;  4DXB A;  3LGO A;  3A0S A;  3MZF A;  3VFF A;  3H7W A;  3S1Y A;  3ITB A;  1YM1 A;  4PKY G;  4IUK A;  3LY3 A;  5B2J C;  3OOV A;  3AZH B;  5KMW A;  3ZG9 B;  3HLD A;  3W99 C;  5CXW A;  1SKO A;  1U35 A;  3B0C W;  2DCF A;  5AV5 A;  3MVD C;  4WJ3 C;  1ERM A;  5HL1 A;  1UWP X;  1E4D A;  3WA9 C;  1E6N A;  2XR0 A;  3EG5 B;  2Y2H A;  5AQ9 A;  5MC7 A;  5F6A A;  4J8W C;  1S1Y A;  4CLC C;  3V9R A;  5GT0 C;  3AV1 A;  3IQA A;  3B0C T;  1K6R A;  4KUK A;  3UPO A;  5HAP A;  4JPM A;  4WEL A;  3AZM B;  4GB7 A;  3ZG5 A;  4GLQ A;  1JWV A;  1PWC A;  4GHI A;  5AV6 A;  4CJN A;  2E8J A;  1S6R A;  4GOG A;  5GXQ A;  4IJG A;  4B93 A;  1WA9 A;  3FG8 A;  3MGQ A;  4OJO A;  1P3M B;  1FIL A;  2GZA A;  1PYY A;  5B40 C;  2BLS A;  4S2K A;  4LCM A;  2FJ7 B;  1N1J B;  4TX8 A;  4Z5T B;  3UE3 A;  5IHV A;  1I2S A;  5AV9 B;  4E3I A;  3RXX A;  4R70 A;  4KG5 A;  3A1I A;  4D60 A;  4JJN A;  1PW1 A;  4QLC C;  3AZG D;  5CED A;  2XK1 A;  4EQ1 A;  2OV5 A;  1TEM A;  4NK3 A;  2A24 B;  5HD5 A;  4CPK A;  3KWQ A;  3MGP C;  2F8N A;  2P74 A;  5IS1 A;  4I5S A;  4J8U B;  3REJ D;  1JNU A;  4WBG A;  3UTA D;  5FAP A;  3AZL B;  3P98 A;  4L9G A;  4U0X A;  5CTM A;  4OOM A;  4ZJ3 A;  4I3I A;  3X1U A;  3C38 A;  1TZY A;  4G92 C;  1DP6 A;  4LV3 A;  5DFY A;  5FQ9 A;  3W98 A;  2M7V A;  4OVD A;  1P3K B;  3K2N A;  3IS2 B;  1H8P A;  2MJ6 A;  3UT9 D;  4S2O A;  2WKQ A;  4B88 A;  1TVF A;  2HDS A;  3U4L P;  3KSG A;  1UWN X;  4S2J A;  3X1V D;  5KDM B;  4Y17 A;  5B2J B;  5L07 A;  1IEL A;  3V67 A;  2RTS A;  4EUZ A;  1Y4O A;  3C1C A;  4KZ6 A;  2W0N A;  3WA9 B;  3W8K A;  4MNR A;  5CPI A;  5CP6 D;  1PIO A;  1XJ3 A;  1VEU A;  3GMW A;  2HP5 A;  4KZ9 A;  3LR3 A;  1KGF A;  3V3R A;  5AV8 A;  5CRF A;  5GLD A;  5J3W A;  2B95 A;  1S32 D;  3A3F A;  3DBA A;  1R4V A;  2J8P A;  2ZMA A;  3A0R A;  4HJ6 A;  3B6G D;  1SCW A;  4ARZ B;  1E15 A;  4MB4 A;  2JN7 A;  5B24 D;  1LHY A;  3C2W A;  2ARO D;  1W1P A;  5K5B A;  3RFB A;  3AN2 D;  2K31 A;  5B33 C;  4YIN A;  4L9F A;  4R4R A;  4WM9 A;  3AZK C;  3TU4 D;  5CHM A;  4QPR A;  4Z1W A;  1E6P A;  3UE6 A;  5FQI A;  5FEF A;  1KVL A;  3K3D A;  4LLO B;  5B40 B;  4NKP A;  1ERO A;  4CAY A;  4GN2 A;  4PM9 A;  4S2M A;  3N4I A;  3MGS A;  4N92 A;  1W1T A;  5CPK A;  1LL5 A;  4HMD A;  5B32 D;  1K6S A;  5D3O A;  4FH4 A;  1P3O C;  4EWF A;  4Z2J A;  3BRM A;  4HQA A;  1P3F D;  4IBB A;  3DTE A;  4NYY A;  1MC0 A;  4FOF A;  4IBG A;  4Y3I A;  5EV0 A;  4WU8 C;  3MXR A;  3AZH D;  4WMC A;  3AGE A;  4OPZ A;  3F1O B;  3AZI D;  1NRJ A;  1S66 L;  1E6Z A;  2OAQ 1;  3AZF B;  2PYP A;  1W63 M;  1Q2P A;  1YUE A;  2Y55 A;  1Q2Q A;  3W96 B;  2F8N H;  4KUD A;  3D9Y A;  5DKL A;  3CIT A;  3H9W A;  1ZG6 A;  1FR6 A;  1LT0 A;  3T4S A;  4NXB A;  5AVE A;  3AFA C;  3UTB A;  1YLJ A;  4B4X A;  1YLZ A;  2HDR A;  2V0W A;  3AV2 D;  2Y2J A;  1ULY A;  2ZMF A;  1I5Q A;  4OQ0 A;  3WTP C;  2J3T C;  4ZUX A;  1NRF A;  3VP2 A;  4Z66 A;  3UB5 P;  2X02 A;  3AYW C;  3UPN A;  2ZC3 B;  4R8P A;  4LEN A;  5HPF A;  5AV9 D;  3A1K A;  5B1L C;  3LJA B;  2H10 A;  4ETZ A;  1O6I A;  4KUO A;  1KU5 A;  4EXO A;  1P34 B;  1KX3 C;  3WAA C;  5AQB A;  4ZBJ C;  1LLB A;  1HQ3 C;  4GW9 A;  4H9R B;  1G6O A;  3QP4 A;  1T18 A;  4YS3 D;  4Z2H A;  3MQ0 A;  1FCO A;  1N9O A;  4NG2 A;  2OOL A;  5FUG A;  1YU0 A;  1W8Y A;  3N6I A;  5DF9 A;  4N9L A;  4P85 A;  4R3B A;  1X0O A;  4PHT A;  3PAE A;  2B5R A;  3BJN A;  3W97 A;  4E3J A;  3IXH A;  5BNX B;  2O9A A;  5AVC D;  2CMN A;  1UR9 A;  3UTB D;  2VZW A;  5E5A B;  4GDN A;  4Y0T A;  3VH5 W;  3REL A;  5DNM B;  4NZ4 A;  4E3M A;  2PDR A;  5B2J D;  5FEG A;  3L25 A;  3W99 D;  2WGW B;  4X23 B;  4UA6 A;  3JVV A;  1M19 C;  1M40 A;  3MVD D;  4QLC A;  2XF3 A;  2ZL1 A;  5EVI A;  4PM5 A;  3WA9 D;  3REI C;  3HL9 A;  2IWC A;  1LSX A;  4E44 A;  1G28 A;  4E3N A;  5DNN C;  5I94 A;  4J8W D;  4ZTK A;  3SH7 A;  4CLC D;  4LCL A;  5GT0 D;  3PBO A;  5C5K A;  3JVU A;  1FSW A;  4JGO A;  3KX0 X;  3UMD A;  4KGC B;  5TBM A;  3UDX A;  2HUE B;  2NQB B;  3IHB A;  5C3I B;  3MNN B;  1TS8 A;  4KZ3 A;  1DJB A;  3LR5 A;  4J8X C;  4NEE D;  4G3V A;  1PNE A;  2ZQC A;  1OJG A;  1OTB A;  5B2I A;  4GS9 A;  3IF6 C;  4EW7 A;  3O62 C;  3LZ1 A;  3NIA A;  3OPP A;  4IHQ A;  3AZN A;  4EUV A;  2Y91 A;  2WK0 A;  1CEG A;  4I3J A;  5BS7 C;  1PWD A;  3FZC A;  3M6H A;  3MXQ A;  2EX9 A;  1BH9 A;  4EBP A;  5GT3 C;  3C1B A;  2ZQ8 A;  5B40 D;  1XGJ A;  4OOL A;  3AYW B;  1XXM A;  4EV4 A;  3MZE A;  3BFE A;  3H0M C;  1NY0 A;  1MWR A;  2Y2I A;  2KDK A;  2PYR A;  1WE4 A;  4QLC D;  1KX3 B;  1M18 C;  4MDZ A;  1F2K A;  2JKF A;  4XXR A;  5DF8 A;  1P3I B;  2PBD P;  2VA0 A;  5FAO A;  1H8Y A;  4AWL C;  5DTS A;  5KIZ A;  4JF4 A;  2NUP C;  3RH8 B;  5F5Y A;  3MGP D;  4DE2 A;  3LZ0 A;  1F5M A;  3PBQ A;  4I38 A;  2PYO A;  2L5A A;  4S2N A;  1E88 A;  1W1V A;  4X1M A;  4H9O B;  3BW6 A;  3SS4 A;  3T4Q A;  4OPY A;  4JXS A;  3UE1 A;  4QY6 A;  2ZJ9 A;  2I72 A;  5DVA A;  5FQJ A;  3W2Z A;  3R45 B;  2YFW B;  2CC1 A;  1U35 C;  4OJL A;  2V1B A;  5AV5 C;  2DQN C;  2ZQ7 A;  3LI8 A;  1KS0 A;  3C30 A;  2OWJ A;  5HWV A;  4DRT A;  3NQU A;  2WKR A;  4DRA A;  4Y0O A;  3ZNY A;  1KX5 A;  1WWI A;  4BD0 A;  4BBT A;  3BLM A;  3FYZ A;  3JPU A;  1ONG A;  1D7E A;  2B02 A;  3AV1 C;  1DY6 A;  2DF4 C;  1WYC A;  4NZ1 A;  4FH2 A;  2ZM0 A;  1UR8 A;  3LID A;  4BD1 A;  3AZJ B;  4DE1 A;  1W7F A;  5GSU B;  3KSI A;  4GCZ A;  1S67 L;  4F3L B;  3TSG A;  3ISG A;  5AV6 C;  5GXQ C;  5G49 B;  4OON A;  2PAV P;  4G91 B;  1KVM A;  5M1A A;  3F1P B;  4ETX A;  3QP1 A;  4LRX C;  5B0Y A;  3EPJ A;  3MGQ C;  2PD7 A;  5B33 D;  3X1T A;  4B4Z A;  3MJQ A;  3Q81 A;  2Z2M B;  1H5X A;  4UQI M;  5EVL A;  3AZK D;  3LFV A;  5M19 A;  1PW8 A;  1W63 Q;  1VB6 A;  3WRZ A;  1ONH A;  5GLA A;  1XJ6 A;  3WRT A;  5U47 A;  4JJN C;  1YSP A;  2E8I A;  3TE8 A;  2H0Y A;  4X56 A;  1U60 A;  3E98 A;  2EFU A;  1KX5 D;  3H82 B;  1P3A A;  3VP3 A;  1P3O D;  2ZC6 B;  1M18 B;  3KWQ C;  4HHD A;  4RX3 A;  4UQI S;  3BY8 A;  2WKE A;  1E25 A;  1MZU A;  4Q8I A;  4AWL B;  4WU8 D;  3RJU A;  4KZ7 A;  4WUJ A;  1NYM A;  2VQR A;  3X1U C;  1MWS A;  1TZY C;  2ZY3 A;  1RGY A;  1ZTU A;  3W98 C;  3DAV A;  4XUJ A;  1G5U A;  1XPB A;  3C4O A;  2K7S A;  1KX4 A;  4OLD A;  1GA9 A;  3HJI A;  4Z2M H;  3T50 A;  3CPT B;  3K3C A;  1XX2 A;  1XGI A;  2A49 A;  2ZM8 A;  4IUH A;  3UB8 A;  1SKO B;  1U35 B;  3C1C C;  4WU9 A;  5JYO A;  1FR1 A;  3AZG B;  1RP5 A;  4KHA B;  3TRC A;  2W3E A;  5CPI C;  2IWB A;  2EA9 A;  4R23 A;  2NUT C;  3AFA D;  3CG5 A;  2H5S A;  3MFX A;  5J8X A;  5AV8 C;  3OPH A;  4MB3 A;  4BWI A;  1DJA A;  5GLB A;  3V9R B;  2O9C A;  4D2O A;  3REJ B;  3HUO A;  4Z9Q A;  5FQK A;  5FAT A;  4BBU A;  3WTP D;  3ICY A;  2J3T D;  3OCN A;  2YFV B;  1EQZ C;  2IOU A;  3AYW D;  3LY4 A;  3V39 A;  1MWT A;  1NWZ A;  3OBF A;  4MN7 A;  4DN0 A;  1JTG A;  3UT9 B;  5B1L D;  1JTD A;  3MSH A;  1M1A C;  1P3P A;  4R1G A;  2ZM2 A;  3X1V B;  5DNN A;  3OPR A;  1XA1 A;  1KX3 D;  3WAA D;  2W27 A;  4P87 A;  2F8N G;  4E3O A;  4OP5 A;  1HQ3 D;  3KUY A;  3VP1 A;  2K2N A;  3E4Q A;  4QU3 A;  3G2Z A;  1PDC A;  2VV6 A;  3MGS C;  1BUL A;  4X69 A;  4C6Y A;  4MN5 A;  4IVI A;  3SS3 A;  5CPK C;  1AOI A;  1OTI A;  1KE4 A;  4RA7 A;  3C7U A;  1IFQ A;  4NET A;  5KSC A;  2WKH A;  3PYP A;  1S32 B;  4IBK A;  1KGG A;  3WS1 A;  4GHL A;  5B24 B;  3X1S A;  3KWQ B;  2F8N B;  4U3T A;  2JKR I;  3ZVW A;  4PMA A;  2V2F F;  3AN2 B;  2IO5 B;  3NI9 A;  2HJE A;  4N1X A;  3GV9 A;  1D1J A;  5JYP A;  4A5R A;  1M19 D;  3X1U B;  1ES3 A;  1OME A;  3IHA A;  3C8C A;  5FA7 A;  2Q9N A;  2W1R A;  4XZQ A;  5B0Z A;  3IH9 A;  1CXW A;  3REI D;  3B3X A;  1DP8 A;  5J4E A;  3B6F A;  4X68 A;  4XT2 B;  4WNN B;  4KUD C;  1ES4 A;  4EER A;  3IXD A;  4P6B A;  4G3K A;  5DNN D;  1JVJ A;  1FOF A;  5B32 B;  4BJP A;  3C1C B;  3REH A;  4S2P A;  2ZQD A;  2XEP A;  1XP4 A;  1P3F B;  1PZR A;  3AGD A;  4LG2 A;  4DDS A;  3N8R A;  4BL3 A;  3BFF A;  5CPJ A;  4J8X D;  5FQM A;  1H3O A;  2PU4 A;  3O87 A;  5CHL B;  4ZUX C;  3AZI B;  4Z2I A;  4H9Q A;  3O62 D;  4OQH A;  4Z66 C;  4IVK A;  4FD8 A;  5B31 A;  2C5W B;  3LI9 A;  4EU0 A;  3IH8 A;  4R8P C;  4R3J A;  5GT3 D;  3SH9 A;  1JWZ A;  2Y8H A;  4Y0U A;  2WZZ A;  3R7W B;  1JFI B;  5FAQ A;  1A0K A;  1YT4 A;  3UY6 A;  5FSR A;  3VP0 A;  3N8L A;  3N8S A;  3T1X A;  2J7V A;  4YM6 A;  1M18 D;  2VKS A;  3TOI A;  2Y2O A;  4Q0I A;  1CEF A;  4LD9 A;  3AV2 B;  4FSF A;  1QME A;  4CAY B;  4LV0 A;  1J3W A;  2Q0O A;  3SH8 A;  3ZDJ A;  1HTA A;  4H9P A;  4EO5 B;  3W97 C;  3WS4 A;  3ZYT A;  1YLT A;  1XA7 A;  2EX2 A;  1BSG A;  2ZC7 A;  3WD4 A;  2OAP 1;  4J8V A;  2W1T A;  3REL C;  4Q0J A;  3IT9 A;  3E2L A;  1ID3 A;  5AVB A;  3GSG A;  3IXB A;  3MGR A;  3OPL A;  1U35 D;  1HZO A;  5AV5 D;  3IWI A;  1YSQ A;  4MMN A;  1D06 A;  5EVI C;  5JA4 A;  3NC8 A;  4OQG A;  2INW A;  4EES A;  1VHM A;  1BTL A;  2HGV A;  4YS3 B;  3KYE A;  3PTE A;  1AIW A;  4BLM A;  4NXF A;  4OQI A;  3AV1 D;  2GNX A;  1GHM A;  1ZLA A;  5F82 A;  4EEU A;  1B6W A;  3DTM A;  2RL3 A;  1MXO A;  1GA0 A;  2B18 A;  1CK7 A;  4H6J B;  3VH6 W;  5AVC B;  1VET B;  5AV6 D;  3UTB B;  1NYY A;  5GXQ D;  5GHX A;  1TS0 A;  2P08 A;  3ITA A;  5B2I C;  2VJW A;  4Y5F A;  1HVB A;  5EE8 A;  2L1M A;  3LZ1 C;  4DE0 A;  5IT5 A;  3AZN C;  3VMA A;  3MGQ D;  3A3D A;  3W99 B;  2JBF A;  4JF6 A;  4ZUX B;  3C1B C;  4HI4 A;  5JRG A;  3MVD B;  1P3B A;  2WKP A;  3EPL A;  3A6N A;  2JC7 A;  3HJK A;  3EWK A;  4J8W B;  4CLC B;  1SHV A;  3GTC A;  3D3O A;  4JJN D;  5GT0 B;  3Q7V B;  4PM8 A;  3UO9 A;  5KSH A;  3RTY A;  4L9E A;  3T1R A;  1EQZ A;  5HD3 A;  4GKU A;  3KWQ D;  2F8N D;  3Q82 A;  2BTF P;  1OT9 A;  1E3U A;  3LZ0 C;  3PBS A;  4KZ5 A;  4FUW A;  2VGJ A;  1ZKJ A;  1M1A A;  1TAF B;  3DWZ A;  5G4Z A;  2PYO C;  3REK A;  4IBC A;  2OLU A;  4S2N C;  3VV4 A;  4JBF A;  5AY8 A;  2A2L A;  3X1U D;  1LSV A;  3WS0 A;  1TZY D;  1IYP A;  3NJA A;  3S4X A;  3W98 D;  2G2U A;  4EEP A;  4ZJ1 A;  2G5I C;  4HME A;  2XFT A;  1PI4 A;  2ZC4 B;  4KZB A;  4OPR A;  1KX5 C;  4IBE A;  3C1C D;  4PKY A;  4QLC B;  2KX6 A;  1NZO A;  5CHJ A;  3AZM A;  2JSS A;  5DTT A;  2ZBB A;  5CPI D;  5M18 A;  3M7P A;  3B47 A;  4Y7P A;  5AV8 D;  3WD1 A;  2XA7 M;  1KOU A;  4EQI A;  2L0W A;  3MGP B;  3P01 A;  1GOI A;  1K54 A;  4HJ3 A;  1YQS A;  2WAE A;  1P3M A;  3QP8 A;  4KZ8 A;  2VLG A;  1P3L A;  1ESU A;  3ZVT A;  1EQZ D;  5B0Y C;  1N1J A;  4G92 B;  2FJ7 A;  4E3L A;  4Z5T A;  3HLW A;  5B1M C;  3X1T C;  2PHY A;  1W5D A;  3KS4 A;  3UB9 A;  5B2I B;  4GS9 B;  4UHU A;  1M1A D;  3GRJ A;  3CZD A;  3H0R C;  4Z2M G;  3SOI A;  3WWX A;  4LV2 A;  2XA7 S;  4UEY A;  4FCF A;  4ZJ2 A;  1S0W A;  4DKI A;  3VH5 A;  4OJP A;  5FL3 A;  3ZFZ A;  5F1G A;  2A24 A;  3UN7 A;  4IBJ A;  2JE5 A;  1I2W A;  4DMZ A;  3MGS D;  2PR6 A;  3EQV A;  4JLF A;  2H0T A;  3OLO A;  3EOI A;  5CPK D;  2NZD C;  4J8U A;  3C7V A;  4X53 A;  5CHU A;  2EX8 A;  1P3A C;  2OLV A;  3AZL A;  4HBU A;  4FTX A;  1YKD A;  3LIB A;  5DF7 A;  2G7U A;  3PAG A;  1P3K A;  4WMC D;  3IS2 A;  2VGK A;  4XUZ A;  4X25 A;  5B33 B;  5TJJ A;  1L2S A;  3D4F A;  3F6T A;  1N9L A;  3AZK B;  2PYO B;  4Y15 A;  3VOZ A;  4XUJ C;  2CV5 A;  1KX4 C;  2ZMV A;  3PBT A;  1BZA A;  3VOL A;  1BT5 A;  2JHE A;  3TJZ C;  2W8S A;  1GPF A;  1T1A A;  1Z2C B;  5F68 A;  4PM7 A;  4WU9 C;  5G18 A;  4KUD D;  4BMW A;  1ALQ A;  1OTD A;  3NQU B;  2XFS A;  5BNV B;  1KX5 B;  3W4P A;  4IJF A;  3IP4 C;  4N9K A;  1P3O B;  4L0L A;  4YNR A;  1WWS A;  1BH8 A;  3NDG A;  3F1N B;  1ZG4 A;  1G68 A;  3MKF A;  4BQM A;  4WU8 B;  3GVB A;  1KDW A;  4NYU A;  3DTI A;  4ZUX D;  3M6B A;  2ZQ9 A;  1S1Z A;  1A7W A;  4Z66 D;  1ACF A;  2LB5 A;  4QHC A;  2IWD A;  4N1H A;  3VH5 T;  3Q07 A;  4R8P D;  3QHY A;  5FDH A;  3E4O A;  2Z2L B;  1P3P C;  5A92 A;  1F98 A;  2Y2G A;  1XKZ A;  5BO0 B;  1S4R A;  2VGL M;  4Y2F A;  3KSF A;  1SDE A;  1V9Y A;  5BOH A;  3KUY C;  2ACG A;  5DJT A;  1K55 A;  4GD6 A;  3UB7 A;  3AFA B;  1AOI C;  5HPI A;  2FH5 A;  3KYQ A;  3MKE A;  1YU2 A;  1K57 A;  3V50 A;  5FDS A;  5L09 A;  5FI7 A;  3F1O A;  5FI2 A;  3Q1F A;  3W97 D;  1LL8 A;  1IKG A;  3WTP B;  5A8B A;  3LEQ A;  3VP4 A;  3X1S C;  3FC7 A;  4KEN B;  3REL D;  1H8Z A;  1K56 A;  2Y2M A;  3AZF A;  3KXB A;  2HIO A;  3Q7Z A;  5B1L B;  2H28 A;  4HGA C;  3WKJ A;  3LEL A;  3LUQ A;  3WAA B;  4QNL A;  3L9K A;  5EVI D;  4XZQ C;  5B0Z C;  1E8B A;  4ZBJ B;  1YMX A;  3CWF A;  1GCE A;  1HQ3 B;  3BY9 A;  4XUJ B;  3B6F C;  5HW3 A;  3G34 A;  4QJG A;  2PU2 A;  3MQQ A;  3REH C;  5HSQ A;  1VM1 A;  3VSL A;  2Y2K A;  3P09 A;  5CPJ C;  2Z6D A;  1CK3 A;  4U0T A;  2DRW A;  3LJA A;  3E2K A;  3NQJ B;  3BEB A;  5B2I D;  5EM1 A;  5A93 A;  5HDD A;  3S7N A;  3LZ1 D;  3AZN D;  4MBH A;  1P34 A;  5B31 C;  2WGI A;  3CLO A;  5TFQ A;  4BEN A;  1M19 B;  3MMH A;  3C1B D;  2VEA A;  3E0Y A;  4H9R A;  3A0V A;  2RCX A;  4NE3 A;  3C4P A;  4X1L A;  4CSR B;  1CQA A;  3REI B;  2FZ0 A;  4ME4 A;  3SS5 A;  1P3P B;  4UUZ B;  5DNN B;  5DTK A;  4Z2K A;  4EET B;  4YM6 C;  5BNX A;  5EFW A;  4YOF A;  4LD9 C;  4II7 A;  3LR0 A;  5E2G A;  5E5A A;  1P3G C;  2QJ7 A;  4ZRR A;  4JKT A;  4E3K A;  3WS5 A;  3NCK A;  5B1M A;  2C6W B;  5DNM A;  4J8X B;  3CJM A;  4DXC A;  1OTA A;  3LZ0 D;  1K4F A;  3O86 A;  3VE3 A;  1STZ A;  3IF6 B;  2JKT M;  4J8V C;  3O62 B;  2PYO D;  4X23 A;  4NY2 A;  2D49 A;  1H0G A;  1ED7 A;  2BYK B;  1ID3 C;  3ZG8 B;  4IBR A;  5AVB C;  5GT3 B;  3X1S B;  1AWI A;  3MGR C;  4P0M A;  3PXP A;  4JGR A;  4WLA A;  2ZC5 B;  3L29 A;  3T1Q B;  2W3D A;  2NZD A;  2LB9 A;  1V9Z A;  3HON A;  4PAU A;  1F66 A;  4KGC A;  1O07 A;  1K38 A;  2NQB A;  3MNN A;  1F1E A;  1ZLA C;  4IJE A;  5F99 C;  2O9B A;  1ZC2 A;  5B31 G;  3AGF A;  4X55 A;  3IBJ A;  4GHA A;  3A3E A;  5EPH A;  3AZE A;  4BBV A;  1ODV A;  3H7W B;  5B0Y D;  5CPJ B;  5B1M D;  4E45 A;  5AJG A;  3X1T D;  1H3O B;  4NXG A;  5AV5 B;  2UWX A;  5JRG C;  4PM6 A;  2DNS A;  1P3B C;  4MB5 A;  3ZG7 B;  1NLZ A;  3A6N C;  4H9N A;  3NOP C;  3S7Q A;  2EFX A;  2ZY4 A;  3OC2 A;  1MWU A;  3MS6 A;  2J9P A;  3AV1 B;  3HSH A;  3G30 A;  1ES2 A;  2GJ3 A;  1SKF A;  3BYD A;  3QP5 A;  4KQR A;  4LV1 A;  3DWK A;  4MCW A;  1K0K A;  2NZD D;  3GR2 A;  2DMW A;  2ZY2 A;  1BLH A;  1P3A D;  2YKF A;  4PPR A;  4M3K A;  4GHI B;  5AV6 B;  5HAR A;  2WZX A;  5GXQ B;  5FQQ A;  4OP8 A;  4DRB A;  3P7N A;  3REK C;  2O0Y A;  2ZY5 A;  5AY8 C;  1BUE A;  3G4P A;  3MGQ B;  4OLG A;  2PT7 A;  5F83 A;  1MPL A;  1NJ4 A;  1YU4 A;  1TS6 A;  1ZHH B;  4XUJ D;  4E6W A;  1KX4 D;  1ID3 B;  3LIF A;  4WZ5 C;  2WGV A;  5DKK A;  3HBR A;  4HEF A;  5CGW A;  3L7H A;  4JJN B;  4WU9 D;  2BYM A;  3WD2 A;  4ZBE A;  5GSU A;  3AZM C;  1EW0 A;  2PR5 A;  4I39 A;  4F3L A;  3QNC A;  2J3W A;  5G49 A;  2QWS A;  3CAX A;  3ZG0 A;  3HLG A;  3UB6 A;  2AVX A;  4HNB A;  1K54 C;  1ZLA B;  2J9O A;  2PRF A;  3BEC A;  1P3M C;  5CTN A;  2R9W A;  1S4S A;  1P3L C;  4HY8 A;  1TZY B;  2FJ7 C;  2OWH A;  3C5A A;  4Z5T C;  4NZ5 A;  2QJ5 A;  1T1B A;  4KG6 A;  3W98 B;  1FIK A;  3BFG A;  5BPV A;  4HBT A;  4WYY A;  3L27 A;  3B0B A;  3L28 A;  1P3P D;  2D02 A;  4H9S A;  3CUE A;  4I3A A;  2X01 A;  2EWW A;  1GSV A;  3A3I A;  5L2F A;  5IU1 A;  1MKI A;  1H0I A;  5JRG B;  4K91 A;  1W79 A;  2P9V A;  2V8F A;  3H82 A;  3KUY D;  5CPI B;  1VEU B;  2X71 A;  3N7W A;  1AOI D;  4RVA A;  5AV8 B;  5HFO A;  4J8U C;  1N9B A;  3IF5 A;  3FWL A;  3ZGA B;  5E2H A;  3AZL C;  4OJ6 A;  1NXY A;  1XFQ A;  3S22 A;  5HWW A;  2M7U A;  5EVE A;  4MBK A;  3X1S D;  1EQZ B;  1P3K C;  2XH9 A;  4WN5 A;  3ULF A;  3RXW A;  4JXV A;  3T4T A;  1YLP A;  3MXS A;  4NE6 A;  3CPT A;  3EEH A;  3HCY A;  4O0P A;  1M1A B;  3REK B;  4BL2 A;  1L6J A;  2OSU A;  5AY8 B;  2CV5 C;  2QKP A;  3VH6 A;  1QO6 A;  3AZG A;  4KHA A;  4AFI A;  4UAA A;  4XZQ D;  5B0Z D;  2ZLY A;  3UDI A;  4OOY A;  3KS8 A;  3B6F D;  1P3G A;  2KOI A;  2EWV A;  2V8C A;  3MGS B;  4Q0H A;  2GX5 A;  2HZ5 A;  5CPK B;  1W8Q A;  2JKG A;  3REJ A;  3HLF A;  3UTA A;  3REH D;  4UA9 A;  2YFV A;  4EBL A;  3B42 A;  1BLS A;  5LBR A;  4S2I A;  4Y13 A;  5CPJ D;  1DJC A;  4IED A;  3VFH A;  3UT9 A;  3GDI A;  3X1V A;  1RGZ A;  3O5Y A;  3KFU G;  5B31 D;  4HH3 A;  5HDS A;  1P3L B;  3FDD A;  4B9O A;  4IBF A;  5CP6 A;  2LY8 A;  2QHK A;  2HJ9 C;  3L2A A;  5F99 A;  4KUD B;  1IOU A;  3BQ8 A;  5L10 A;  4RQ9 A;  2P7J A;  1KE0 A;  4MLL A;  5AQA A;  1S32 A;  1K55 C;  4YM6 D;  3KYZ A;  3B6G A;  1F9I A;  4KQO A;  5CGS A;  4LPZ A;  4LD9 D;  5B24 A;  2PD8 A;  1YMS A;  3T4J A;  5GHZ A;  1GHI A;  1P3G D;  1K57 C;  2ARO A;  1GXD A;  3AN2 A;  4DQY B;  1CF0 A;  1TS7 A;  1LSW A;  3H0L C;  3VH6 T;  4OPQ A;  1YLY A;  3TU4 A;  4XUX A;  4J8V D;  4DJ2 A;  2L4R A;  4Z66 B;  1OT6 A;  4LRZ E;  4HIA A;  3AZF C;  1ID3 D;  3KXB C;  2HIO C;  4R8P B;  1IYS A;  2FFY A;  5AVB D;  2QYB A;  2F2A C;  3W96 C;  3MGR D;  3WKJ C;  3LEL C;  2P04 A;  4HES A;  4XT2 A;  4WNN A;  5EUA A;  3ZHH A;  1T3U A;  4CLC E;  3T12 B;  2RIQ A;  1YU1 A;  2IA2 A;  3MFD A;  5B32 A;  4GNU A;  1VQQ A;  2CV5 B;  2R78 A;  3NY4 A;  3MR0 A;  1P3F A;  3BQA A;  5FUG B;  3MQO A;  1ZLA D;  2RVQ C;  2BG1 A;  5F99 D;  1T19 A;  3AZH A;  5G4Y A;  4OKP A;  4Z2G A;  1OTE A;  3AZI A;  3W97 B;  1KE3 A;  5HZH A;  1NLY A;  3LJA C;  3REL B;  3QP6 A;  3W4Q A;  1BH8 B;  4WZ5 A;  4LFU A;  4S2L A;  1HTZ A;  3KO6 A;  3R7W A;  1P34 C;  1JFI A;  1TF1 A;  3S7P A;  4HOI A;  3UPP A;  4C75 A;  5JRG D;  4KZ4 A;  3WD0 A;  2ZL1 B;  5EVI B;  1P3B D;  3HLB A;  3V3S A;  1YPR A;  4MEZ A;  3A6N D;  5EOO A;  3EGD C;  4YFM A;  5HDC A;  1CI9 A;  3AV2 A;  2J80 A;  3G6O A;  2Z6C A;  1FSY A;  1XJ2 A;  5L8M A;  2Q9M A;  4LGW A;  5TBM B;  3G2Y A;  2UV0 E;  2Y4A A;  3HRE A;  1T1C A;  5E5A C;  3IX8 A;  2VX8 A;  1MY8 A;  5DNM C;  5AV9 A;  1E3U D;  1P9R A;  4O8G A;  5BT1 C;  4GD8 A;  3LZ1 B;  3REK D;  4X23 C;  3AZN B;  5AY8 D;  4ID4 A;  4UA7 A;  4HJ4 A;  1BH9 B;  2J8Y A;  3C1B B;  1OGB A;  5HAI A;  4YS3 A;  1GSW A; 
#chains in the Genus database with same CATH homology
 4IBI A;  3KXB B;  2HIO B;  3FKE A;  5E2F A;  5EOE A;  3WKJ B;  4H8R A;  3LEL B;  1F66 C;  4WEK A;  4GZB A;  1FQG A;  1JWP A;  5GL9 A;  3NBL A;  3VSK A;  4KGC C;  1ERQ A;  2HUE C;  2NQB C;  3AZM D;  5C3I C;  3MNN C;  2G2W A;  1Q9C A;  5AVC A;  4R4S A;  2HPB A;  4EBN A;  2A3U A;  1G6A A;  2EXB A;  3LZ0 B;  5KDM A;  1LL9 A;  4MBF A;  5B2J A;  1P3M D;  3AZE C;  3W99 A;  4DDY A;  3I7J A;  1P3L D;  3MVD A;  3EPH A;  1FCM A;  5FI6 A;  2FJ7 D;  3WA9 A;  4Z5T D;  4J8W A;  3HLE A;  5E2E A;  3Q7V A;  5GT0 A;  1IYO A;  2WUQ A;  5E43 A;  3WS2 A;  3ZNT A;  1P3I C;  4QB8 A;  2XD1 A;  5CGX A;  1IEM A;  5FAS A;  3AL0 C;  1PWG A;  3N3F A;  1ESI A;  3VOY A;  4J8U D;  1TDL A;  1TAF A;  3AZL D;  2ZD8 A;  1AXB A;  1WYB A;  4GDB A;  5B40 A;  5B0Y B;  1P3K D;  5B1M B;  3X1T B;  4OJ5 A;  4KZA A;  2CV5 D;  4DE3 A;  3OZH A;  2Y2P A;  2WAD A;  3BLS A;  5GHY A;  4JF5 A;  4WZ4 A;  4E6X A;  1TDG A;  3AZJ C;  3MGP A;  5GSU C;  1PZP A;  1Y54 A;  3BM6 A;  4OUI A;  4WZS B;  2NZD B;  3FKW A;  1F66 B;  1P3A B;  3WTP E;  4G91 C;  2GDN A;  2HP9 A;  3CMZ A;  2XDM A;  5CEC A;  1FCN A;  2QZ6 A;  3W96 A;  2G5H C;  2EXA A;  2R9X A;  3FV7 A;  1L0F A;  3G32 A;  3AZE B;  1KX4 B;  4H9S C;  1LI9 A;  3BFC A;  4WU9 B;  1RCJ A;  3M2J A;  4JXW A;  4H9N B;  5TGF A;  4K0X A;  2WAF A;  3LCE A;  2V20 A;  3LO7 A;  3HUM A;  2HP6 A;  5B33 A;  1M6K A;  4JXG A;  1J9M A;  3AZK A;  2Y2N A;  5F1F A;  1IKI A;  4WEJ A;  1O7E A;  2PBY A;  2QMI A;  1K56 D;  3AZF D;  3KXB D;  2HIO D;  5CEB A;  3W96 D;  3WKJ D;  4KG2 A;  3LEL D;  3AZG C;  3JYI A;  3O3V A;  1L0E A;  5BNV A;  3KUY B;  1P3O A;  4K0W A;  4IBD A;  1AOI B;  3DW0 A;  3UNW A;  5KZH A;  3REJ C;  2RVQ D;  4M6B A;  3UTA C;  2V1Z A;  4WU8 A;  1K4E A;  1W2E A;  2BYM B;  4WV4 B;  1PI5 A;  2WGW A;  5HX9 A;  4NZ3 A;  1IYQ A;  5GLC A;  3UT9 C;  3LJA D;  3PBR A;  2CWE A;  3X1V C;  1C3B A;  5BO0 A;  2HDQ A;  4HGA B;  1P34 D;  3KSY A;  1KGE A;  4UPK A;  1ES5 A;  4R0Q A;  4XZQ B;  5B0Z B;  5CP6 C;  3EQU A;  3AFA A;  3B6F B;  3HLC A;  4C3Q A;  3IWQ A;  1K25 A;  1PZO A;  5A90 A;  2XGN A;  3O88 A;  1S32 C;  4OH0 A;  3QNB A;  3P5J B;  3B6G C;  3REH B;  3BFD A;  3WTP A;  5B24 C;  2P9V B;  2XLN A;  3MZD A;  5E5A D;  1BFM A;  2ARO C;  4IBX A;  3AYW A;  3AN2 C;  1LI0 A;  2IO5 C;  5DNM D;  1MBL A;  3IXG A;  4RX2 A;  4F94 A;  1HD8 A;  3B0D C;  5B1L A;  4ZDX A;  5BT1 D;  4QY5 A;  4H9Q B;  3TU4 C;  4X23 D;  3EPK A;  2XD5 A;  5B31 B;  1KX3 A;  3WAA A;  3LEZ A;  5CER A;  2F8N K;  4NE5 A;  1HQ3 A;  1P3I A;  5EEC A;  5AQ7 A;  3G31 A;  2HDU A;  2ZM5 A;  2XQZ A;  5B32 C;  2EX6 A;  1F66 D;  5A91 A;  1YU3 A;  3G35 A;  2Y59 A;  4KGC D;  4YM6 B;  1P3F C;  4H9O A;  2NQB D;  1QMF A;  3MNN D;  4LD9 B;  1EWZ A;  1P3G B;  3AZH C;  3R45 A;  2YFW A;  3NQJ A;  4H9P B;  3AZI C;  3ZCZ A;  5TR7 A;  3TG9 A;  3W4O A;  3UTA B;  4KQQ A;  2JCH A;  4J8V B;  3AZE D;  2WKI A;  1M19 A;  1KDS A;  3MBZ A;  1EI5 A;  3V5M A;  4CSR A;  5AVB B;  3REI A;  3WX7 A;  3L26 A;  4RYE A;  3HVF A;  3MGR B;  4QD4 A;  1YLW A;  3AZJ A;  4UUZ A;  3HUN A;  4ZAM A;  3UDF A;  1CI8 A;  5JA4 B;  3GQZ A;  2FFF B;  5HAQ A;  4X6T A;  3IWO A;  3AV2 C;  1P3I D;  2Y2L A;  4GH9 A;  5CP6 B;  2QPN A;  4EO5 C;  5F99 B;  4J8X A;  1NZU A;  1L0D A;  4NFT A;  1N4O A;  4O7D A;  3IF6 A;  1BLC A;  1Z6F A;  3UE0 A;  3O62 A;  2BYK A;  5BS7 A;  3B6G B;  5AV9 C;  5GT3 A;  3A3J A;  2ARO B;  5B32 G;  3OCL A;  3FKV A;  1BLP A;  3B0D B;  3TU4 B;  1P3B B;  3NDE A;  4YS3 C;  3A6N B;  2Y2Q A;  1M18 A;  3PBN A;  4DF6 A;  1B67 A;  1SDN A;  3AZJ D;  2ZQA A;  2WYX A;  5GSU D;  3M2K A;  5AVC C;  1L0G A;  3UTB C;  1GHP A;  4DXB A;  3VFF A;  3MZF A;  3S1Y A;  3ITB A;  1YM1 A;  3LY3 A;  5B2J C;  3AZH B;  5KMW A;  3ZG9 B;  3HLD A;  3W99 C;  5CXW A;  1U35 A;  3B0C W;  2DCF A;  5AV5 A;  3MVD C;  4WJ3 C;  1ERM A;  5HL1 A;  1E4D A;  3WA9 C;  2XR0 A;  3EG5 B;  2Y2H A;  5AQ9 A;  4J8W C;  3V9R A;  5GT0 C;  3AV1 A;  3IQA A;  3B0C T;  1K6R A;  3UPO A;  5HAP A;  4JPM A;  4WEL A;  3AZM B;  4GB7 A;  3ZG5 A;  1JWV A;  1PWC A;  5AV6 A;  4CJN A;  1S6R A;  4GOG A;  5GXQ A;  3MGQ A;  4OJO A;  1P3M B;  1PYY A;  5B40 C;  2BLS A;  4S2K A;  4LCM A;  2FJ7 B;  1N1J B;  4Z5T B;  3UE3 A;  5IHV A;  1I2S A;  5AV9 B;  4E3I A;  3RXX A;  4KG5 A;  3A1I A;  4JJN A;  1PW1 A;  4QLC C;  3AZG D;  5CED A;  2XK1 A;  2OV5 A;  1TEM A;  4NK3 A;  4CPK A;  3KWQ A;  3MGP C;  2F8N A;  2P74 A;  4J8U B;  3REJ D;  4WBG A;  3UTA D;  5FAP A;  3AZL B;  3P98 A;  4U0X A;  5CTM A;  4OOM A;  4ZJ3 A;  3X1U A;  1TZY A;  4G92 C;  4LV3 A;  5FQ9 A;  3W98 A;  4OVD A;  1P3K B;  4S2O A;  3UT9 D;  4B88 A;  1TVF A;  2HDS A;  4S2J A;  3X1V D;  5KDM B;  5B2J B;  1IEL A;  4EUZ A;  3C1C A;  4KZ6 A;  3WA9 B;  3W8K A;  4MNR A;  5CPI A;  5CP6 D;  1PIO A;  3GMW A;  2HP5 A;  4KZ9 A;  1KGF A;  3V3R A;  5AV8 A;  5CRF A;  5GLD A;  1S32 D;  3A3F A;  1R4V A;  2J8P A;  2ZMA A;  3B6G D;  1SCW A;  5B24 D;  1LHY A;  2ARO D;  3AN2 D;  5B33 C;  4YIN A;  4R4R A;  4WM9 A;  3AZK C;  3TU4 D;  5CHM A;  5FQI A;  1KVL A;  5B40 B;  1ERO A;  4CAY A;  4GN2 A;  4PM9 A;  4S2M A;  3N4I A;  3MGS A;  4N92 A;  5CPK A;  1LL5 A;  5D3O A;  5B32 D;  1K6S A;  4FH4 A;  1P3O C;  4EWF A;  3BRM A;  1P3F D;  4IBB A;  4NYY A;  4IBG A;  4WU8 C;  3MXR A;  3AZH D;  4WMC A;  3AGE A;  4OPZ A;  3AZI D;  3AZF B;  1Q2P A;  1YUE A;  2Y55 A;  1Q2Q A;  3W96 B;  2F8N H;  4KUD A;  1ZG6 A;  1FR6 A;  3AFA C;  3UTB A;  1YLJ A;  4B4X A;  1YLZ A;  2HDR A;  3AV2 D;  2Y2J A;  1ULY A;  1I5Q A;  4OQ0 A;  3WTP C;  4ZUX A;  1NRF A;  3VP2 A;  4Z66 A;  2X02 A;  3AYW C;  3UPN A;  2ZC3 B;  4R8P A;  4LEN A;  5AV9 D;  3A1K A;  5B1L C;  3LJA B;  2H10 A;  1KU5 A;  1P34 B;  1KX3 C;  3WAA C;  5AQB A;  4ZBJ C;  1LLB A;  1HQ3 C;  4H9R B;  4YS3 D;  1FCO A;  5FUG A;  1YU0 A;  1W8Y A;  3N6I A;  5DF9 A;  4N9L A;  4P85 A;  4R3B A;  3PAE A;  2B5R A;  3W97 A;  4E3J A;  3IXH A;  5BNX B;  5AVC D;  3UTB D;  5E5A B;  4GDN A;  4Y0T A;  3VH5 W;  3REL A;  5DNM B;  4NZ4 A;  4E3M A;  5B2J D;  3L25 A;  3W99 D;  2WGW B;  4X23 B;  4UA6 A;  1M19 C;  1M40 A;  3MVD D;  4QLC A;  2XF3 A;  5EVI A;  4PM5 A;  3WA9 D;  3REI C;  3HL9 A;  2IWC A;  4E44 A;  4E3N A;  5DNN C;  5I94 A;  4J8W D;  4ZTK A;  3SH7 A;  4LCL A;  5GT0 D;  3PBO A;  1FSW A;  4KGC B;  3UDX A;  2HUE B;  2NQB B;  3IHB A;  5C3I B;  3MNN B;  4KZ3 A;  1DJB A;  4J8X C;  2ZQC A;  5B2I A;  3IF6 C;  3O62 C;  3LZ1 A;  3NIA A;  3OPP A;  3AZN A;  2Y91 A;  2WK0 A;  1CEG A;  5BS7 C;  1PWD A;  3FZC A;  3M6H A;  2EX9 A;  1BH9 A;  4EBP A;  5GT3 C;  3C1B A;  2ZQ8 A;  5B40 D;  1XGJ A;  4OOL A;  3AYW B;  1XXM A;  4EV4 A;  3MZE A;  3BFE A;  3H0M C;  1NY0 A;  1MWR A;  2Y2I A;  1WE4 A;  4QLC D;  1KX3 B;  1M18 C;  4XXR A;  5DF8 A;  1P3I B;  5FAO A;  1H8Y A;  4AWL C;  5DTS A;  4JF4 A;  3MGP D;  4DE2 A;  3LZ0 A;  3PBQ A;  2PYO A;  2L5A A;  4S2N A;  4H9O B;  3SS4 A;  4OPY A;  4JXS A;  3UE1 A;  4QY6 A;  2ZJ9 A;  2I72 A;  5DVA A;  5FQJ A;  3R45 B;  2YFW B;  2CC1 A;  1U35 C;  4OJL A;  5AV5 C;  2DQN C;  2ZQ7 A;  4DRT A;  3NQU A;  4DRA A;  4Y0O A;  3ZNY A;  1KX5 A;  1WWI A;  4BD0 A;  3BLM A;  3FYZ A;  1ONG A;  3AV1 C;  1DY6 A;  2DF4 C;  1WYC A;  4NZ1 A;  4FH2 A;  2ZM0 A;  4BD1 A;  3AZJ B;  4DE1 A;  1W7F A;  5GSU B;  3TSG A;  3ISG A;  5AV6 C;  5GXQ C;  5G49 B;  4OON A;  4G91 B;  1KVM A;  5M1A A;  5B0Y A;  3EPJ A;  3MGQ C;  5B33 D;  3X1T A;  4B4Z A;  3Q81 A;  2Z2M B;  1H5X A;  5EVL A;  3AZK D;  5M19 A;  1PW8 A;  3WRZ A;  1ONH A;  5GLA A;  3WRT A;  5U47 A;  4JJN C;  2E8I A;  2H0Y A;  4X56 A;  1U60 A;  2EFU A;  1KX5 D;  1P3A A;  3VP3 A;  1P3O D;  2ZC6 B;  1M18 B;  3KWQ C;  4RX3 A;  2WKE A;  1E25 A;  4Q8I A;  4AWL B;  4WU8 D;  3RJU A;  4KZ7 A;  1NYM A;  2VQR A;  3X1U C;  1MWS A;  1TZY C;  2ZY3 A;  1RGY A;  3W98 C;  4XUJ A;  1XPB A;  3C4O A;  1KX4 A;  4OLD A;  1GA9 A;  4Z2M H;  1XX2 A;  1XGI A;  2A49 A;  2ZM8 A;  1U35 B;  3C1C C;  4WU9 A;  5JYO A;  1FR1 A;  3AZG B;  1RP5 A;  4KHA B;  5CPI C;  2IWB A;  4R23 A;  3AFA D;  3CG5 A;  2H5S A;  5J8X A;  5AV8 C;  3OPH A;  1DJA A;  5GLB A;  3V9R B;  4D2O A;  3REJ B;  3HUO A;  4Z9Q A;  5FQK A;  5FAT A;  3WTP D;  3OCN A;  2YFV B;  1EQZ C;  2IOU A;  3AYW D;  3LY4 A;  3V39 A;  1MWT A;  1JTG A;  3UT9 B;  5B1L D;  1JTD A;  1M1A C;  1P3P A;  4R1G A;  2ZM2 A;  3X1V B;  5DNN A;  3OPR A;  1XA1 A;  1KX3 D;  3WAA D;  4P87 A;  2F8N G;  4E3O A;  4OP5 A;  1HQ3 D;  3KUY A;  3VP1 A;  4QU3 A;  3G2Z A;  4X69 A;  3MGS C;  1BUL A;  4C6Y A;  4IVI A;  3SS3 A;  5CPK C;  1AOI A;  1KE4 A;  4RA7 A;  3C7U A;  4NET A;  5KSC A;  2WKH A;  1S32 B;  4IBK A;  1KGG A;  3WS1 A;  4GHL A;  5B24 B;  3X1S A;  3KWQ B;  2F8N B;  4U3T A;  3ZVW A;  4PMA A;  2V2F F;  3AN2 B;  2IO5 B;  3NI9 A;  4N1X A;  3GV9 A;  5JYP A;  4A5R A;  1M19 D;  3X1U B;  1ES3 A;  1OME A;  3IHA A;  5FA7 A;  2Q9N A;  3IH9 A;  4XZQ A;  5B0Z A;  3REI D;  3B3X A;  3B6F A;  4X68 A;  4WNN B;  4KUD C;  1ES4 A;  3IXD A;  4P6B A;  5DNN D;  1JVJ A;  1FOF A;  5B32 B;  4BJP A;  3C1C B;  3REH A;  4S2P A;  2ZQD A;  2XEP A;  1XP4 A;  1P3F B;  1PZR A;  3AGD A;  4LG2 A;  4DDS A;  3N8R A;  4BL3 A;  3BFF A;  5CPJ A;  4J8X D;  5FQM A;  1H3O A;  2PU4 A;  3O87 A;  5CHL B;  4ZUX C;  3AZI B;  4H9Q A;  3O62 D;  4OQH A;  4Z66 C;  4IVK A;  4FD8 A;  5B31 A;  2C5W B;  3IH8 A;  4R8P C;  4R3J A;  5GT3 D;  3SH9 A;  1JWZ A;  4Y0U A;  2WZZ A;  1JFI B;  5FAQ A;  1YT4 A;  3UY6 A;  5FSR A;  3VP0 A;  3N8L A;  3N8S A;  2J7V A;  4YM6 A;  1M18 D;  3TOI A;  2Y2O A;  1CEF A;  4LD9 A;  3AV2 B;  4FSF A;  1QME A;  4CAY B;  4LV0 A;  3SH8 A;  3ZDJ A;  1HTA A;  4H9P A;  4EO5 B;  3W97 C;  3WS4 A;  1YLT A;  1XA7 A;  2EX2 A;  1BSG A;  2ZC7 A;  4J8V A;  3REL C;  3IT9 A;  3E2L A;  1ID3 A;  5AVB A;  3GSG A;  3IXB A;  3MGR A;  3OPL A;  1U35 D;  1HZO A;  5AV5 D;  3IWI A;  5EVI C;  5JA4 A;  3NC8 A;  4OQG A;  1BTL A;  4YS3 B;  3PTE A;  4BLM A;  4OQI A;  3AV1 D;  5F82 A;  1GHM A;  1ZLA A;  1B6W A;  3DTM A;  2RL3 A;  1MXO A;  1GA0 A;  3VH6 W;  5AVC B;  5AV6 D;  3UTB B;  1NYY A;  5GXQ D;  5GHX A;  3ITA A;  5B2I C;  5EE8 A;  1HVB A;  3LZ1 C;  4DE0 A;  3AZN C;  3VMA A;  3MGQ D;  3A3D A;  3W99 B;  2JBF A;  4JF6 A;  4ZUX B;  3C1B C;  5JRG A;  3MVD B;  1P3B A;  3EPL A;  3A6N A;  2JC7 A;  4J8W B;  1SHV A;  3GTC A;  4JJN D;  5GT0 B;  3Q7V B;  4PM8 A;  3UO9 A;  5KSH A;  1EQZ A;  4GKU A;  3KWQ D;  2F8N D;  3Q82 A;  1E3U A;  3LZ0 C;  3PBS A;  4KZ5 A;  2VGJ A;  1ZKJ A;  1M1A A;  3DWZ A;  1TAF B;  2PYO C;  3REK A;  4IBC A;  2OLU A;  4S2N C;  4JBF A;  5AY8 A;  3X1U D;  3WS0 A;  1TZY D;  1IYP A;  3S4X A;  3W98 D;  2G2U A;  4ZJ1 A;  2G5I C;  2XFT A;  1PI4 A;  2ZC4 B;  4KZB A;  4OPR A;  1KX5 C;  4IBE A;  3C1C D;  4QLC B;  1NZO A;  5CHJ A;  3AZM A;  2JSS A;  5DTT A;  5CPI D;  5M18 A;  4Y7P A;  5AV8 D;  4EQI A;  3MGP B;  1K54 A;  1YQS A;  2WAE A;  1P3M A;  4KZ8 A;  1P3L A;  1ESU A;  3ZVT A;  1EQZ D;  5B0Y C;  1N1J A;  4G92 B;  2FJ7 A;  4E3L A;  4Z5T A;  3HLW A;  5B1M C;  3X1T C;  1W5D A;  3KS4 A;  5B2I B;  4UHU A;  1M1A D;  3GRJ A;  3CZD A;  3H0R C;  4Z2M G;  3SOI A;  3WWX A;  4LV2 A;  4FCF A;  4ZJ2 A;  1S0W A;  4DKI A;  3VH5 A;  4OJP A;  3ZFZ A;  5F1G A;  3UN7 A;  4IBJ A;  2JE5 A;  1I2W A;  3MGS D;  3EQV A;  4JLF A;  2H0T A;  5CPK D;  2NZD C;  4J8U A;  3C7V A;  4X53 A;  5CHU A;  2EX8 A;  1P3A C;  2OLV A;  3AZL A;  4HBU A;  5DF7 A;  3PAG A;  1P3K A;  4WMC D;  2VGK A;  4XUZ A;  5B33 B;  1L2S A;  3D4F A;  3F6T A;  3AZK B;  2PYO B;  3VOZ A;  4XUJ C;  2CV5 A;  1KX4 C;  3PBT A;  1BZA A;  1BT5 A;  2W8S A;  1Z2C B;  5G18 A;  4PM7 A;  4WU9 C;  4KUD D;  1ALQ A;  3NQU B;  2XFS A;  5BNV B;  1KX5 B;  3W4P A;  4IJF A;  3IP4 C;  4N9K A;  1P3O B;  4L0L A;  1WWS A;  1BH8 A;  3NDG A;  1ZG4 A;  1G68 A;  3MKF A;  4BQM A;  4WU8 B;  3GVB A;  1KDW A;  4NYU A;  4ZUX D;  3M6B A;  2ZQ9 A;  1A7W A;  4Z66 D;  4QHC A;  2IWD A;  4N1H A;  3VH5 T;  3Q07 A;  4R8P D;  3QHY A;  5FDH A;  2Z2L B;  1P3P C;  5A92 A;  2Y2G A;  1XKZ A;  5BO0 B;  1SDE A;  5BOH A;  3KUY C;  1K55 A;  4GD6 A;  3AFA B;  1AOI C;  3MKE A;  1YU2 A;  1K57 A;  3V50 A;  5FI7 A;  5FI2 A;  3Q1F A;  3W97 D;  1IKG A;  3WTP B;  3VP4 A;  3X1S C;  4KEN B;  3REL D;  1H8Z A;  1K56 A;  2Y2M A;  3AZF A;  3KXB A;  2HIO A;  3Q7Z A;  5B1L B;  4HGA C;  3WKJ A;  3LEL A;  3WAA B;  4QNL A;  5EVI D;  4XZQ C;  5B0Z C;  4ZBJ B;  1YMX A;  1GCE A;  1HQ3 B;  4XUJ B;  3B6F C;  5HW3 A;  3G34 A;  4QJG A;  2PU2 A;  3REH C;  1VM1 A;  3VSL A;  2Y2K A;  3P09 A;  5CPJ C;  1CK3 A;  4U0T A;  2DRW A;  3LJA A;  3E2K A;  3NQJ B;  3BEB A;  5B2I D;  5A93 A;  3LZ1 D;  3AZN D;  4MBH A;  1P34 A;  5B31 C;  2WGI A;  5TFQ A;  4BEN A;  1M19 B;  3C1B D;  4H9R A;  2RCX A;  4NE3 A;  3C4P A;  4CSR B;  3REI B;  3SS5 A;  1P3P B;  4UUZ B;  5DNN B;  5DTK A;  4YM6 C;  5BNX A;  4LD9 C;  5E2G A;  5E5A A;  1P3G C;  4JKT A;  4E3K A;  3WS5 A;  3NCK A;  5B1M A;  2C6W B;  5DNM A;  4J8X B;  3CJM A;  4DXC A;  3LZ0 D;  1K4F A;  3O86 A;  3IF6 B;  4J8V C;  3O62 B;  2PYO D;  4X23 A;  4NY2 A;  2BYK B;  1ID3 C;  3ZG8 B;  4IBR A;  5AVB C;  5GT3 B;  3X1S B;  3MGR C;  4P0M A;  2ZC5 B;  3L29 A;  2NZD A;  3HON A;  1F66 A;  4KGC A;  1O07 A;  1K38 A;  2NQB A;  3MNN A;  1F1E A;  1ZLA C;  4IJE A;  5F99 C;  1ZC2 A;  5B31 G;  3AGF A;  4X55 A;  4GHA A;  3A3E A;  5EPH A;  3AZE A;  5B0Y D;  5CPJ B;  5B1M D;  4E45 A;  3X1T D;  1H3O B;  5AV5 B;  2UWX A;  5JRG C;  4PM6 A;  2DNS A;  1P3B C;  3ZG7 B;  3A6N C;  4H9N A;  2EFX A;  2ZY4 A;  3OC2 A;  1MWU A;  2J9P A;  3AV1 B;  3HSH A;  3G30 A;  1ES2 A;  3BYD A;  1SKF A;  4KQR A;  4LV1 A;  3DWK A;  2NZD D;  3GR2 A;  2ZY2 A;  1BLH A;  1P3A D;  4PPR A;  4M3K A;  5AV6 B;  5HAR A;  2WZX A;  5GXQ B;  5FQQ A;  4OP8 A;  4DRB A;  3REK C;  2ZY5 A;  5AY8 C;  1BUE A;  3G4P A;  3MGQ B;  4OLG A;  5F83 A;  1MPL A;  1NJ4 A;  1YU4 A;  4XUJ D;  4E6W A;  1KX4 D;  1ID3 B;  4WZ5 C;  2WGV A;  3HBR A;  4HEF A;  5CGW A;  4JJN B;  4WU9 D;  2BYM A;  4ZBE A;  5GSU A;  3AZM C;  3QNC A;  5G49 A;  3ZG0 A;  3HLG A;  1K54 C;  1ZLA B;  2J9O A;  3BEC A;  1P3M C;  5CTN A;  2R9W A;  1P3L C;  1TZY B;  2FJ7 C;  3C5A A;  4Z5T C;  4NZ5 A;  4KG6 A;  3W98 B;  3BFG A;  5BPV A;  4HBT A;  4WYY A;  3L27 A;  3B0B A;  3L28 A;  1P3P D;  4H9S A;  2X01 A;  3A3I A;  5L2F A;  1MKI A;  5JRG B;  4K91 A;  1W79 A;  2P9V A;  3KUY D;  5CPI B;  2X71 A;  3N7W A;  1AOI D;  4RVA A;  5AV8 B;  5HFO A;  4J8U C;  1N9B A;  3IF5 A;  3FWL A;  3ZGA B;  5E2H A;  3AZL C;  4OJ6 A;  1NXY A;  3S22 A;  4MBK A;  3X1S D;  1EQZ B;  1P3K C;  2XH9 A;  3RXW A;  4JXV A;  1YLP A;  3MXS A;  4NE6 A;  1M1A B;  3REK B;  4BL2 A;  2OSU A;  5AY8 B;  2CV5 C;  3VH6 A;  3AZG A;  4KHA A;  4UAA A;  4XZQ D;  5B0Z D;  2ZLY A;  3UDI A;  4OOY A;  3KS8 A;  3B6F D;  1P3G A;  3MGS B;  5CPK B;  1W8Q A;  3REJ A;  3HLF A;  3UTA A;  3REH D;  4UA9 A;  2YFV A;  4EBL A;  1BLS A;  4S2I A;  5CPJ D;  1DJC A;  4IED A;  3VFH A;  3UT9 A;  3X1V A;  1RGZ A;  3KFU G;  5B31 D;  1P3L B;  3FDD A;  4IBF A;  5CP6 A;  2LY8 A;  3L2A A;  5F99 A;  4KUD B;  1KE0 A;  4MLL A;  5AQA A;  1S32 A;  1K55 C;  4YM6 D;  3B6G A;  4KQO A;  5CGS A;  4LD9 D;  5B24 A;  1YMS A;  5GHZ A;  1GHI A;  1P3G D;  1K57 C;  2ARO A;  3AN2 A;  4DQY B;  3H0L C;  3VH6 T;  4OPQ A;  3TU4 A;  1YLY A;  4XUX A;  4J8V D;  4Z66 B;  3AZF C;  1ID3 D;  3KXB C;  2HIO C;  4R8P B;  1IYS A;  2FFY A;  5AVB D;  2F2A C;  3W96 C;  3MGR D;  3WKJ C;  3LEL C;  4HES A;  5EUA A;  4WNN A;  3ZHH A;  1T3U A;  2RIQ A;  1YU1 A;  3MFD A;  5B32 A;  4GNU A;  1VQQ A;  2CV5 B;  3NY4 A;  1P3F A;  5FUG B;  1ZLA D;  2RVQ C;  2BG1 A;  5F99 D;  3AZH A;  4OKP A;  3AZI A;  3W97 B;  1KE3 A;  3LJA C;  3REL B;  3W4Q A;  1BH8 B;  4WZ5 A;  4S2L A;  1HTZ A;  1P34 C;  1JFI A;  3UPP A;  4C75 A;  5JRG D;  4KZ4 A;  5EVI B;  1P3B D;  3HLB A;  3V3S A;  4MEZ A;  3A6N D;  5EOO A;  4YFM A;  1CI9 A;  3AV2 A;  1FSY A;  2Q9M A;  3G2Y A;  2Y4A A;  3HRE A;  5E5A C;  1MY8 A;  5DNM C;  5AV9 A;  1E3U D;  5BT1 C;  4GD8 A;  3LZ1 B;  3REK D;  4X23 C;  3AZN B;  5AY8 D;  4ID4 A;  4UA7 A;  1BH9 B;  2J8Y A;  3C1B B;  5HAI A;  4YS3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...