2Y2JA

Penicillin-binding protein 1b (pbp-1b) in complex with an alkyl boronate (za4)
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
488
structure length
470
Chain Sequence
ISEITYSDGTVIASISRDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTGQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PENICILLIN-BINDING PROTEIN 1B
publication title Structure-Guided Design of Cell Wall Biosynthesis Inhibitors that Overcome Beta-Lactam Resistance in Staphylococcus Aureus (Mrsa).
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 159
structure length 470
sequence length 488
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2y2jA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2y2jA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2y2jA02
3GRJA 1FR6A 2DNSA 1ES4A 3WWXA 5BOHA 1EI5A 4OPRA 4WZ5C 3HLCA 2EXAA 3NIAA 3UN7A 1SKFA 2FFFB 3HLWA 3AGFA 4HESA 3FZCA 3NC8A 5F1GA 3RXXA 3EQUA 2WK0A 4NK3A 1YMXA 2H0YA 4E6WA 3MFDA 3SH8A 2ZQAA 5CXWA 4S2OA 3G2YA 1GHPA 3FKVA 4K0WA 4DDYA 2WGVA 3AGEA 2QPNA 4WYYA 1H8ZA 4NETA 4XUZA 4BD0A 3S4XA 2H0TA 1FCMA 1PI4A 3LY4A 3VOYA 1PW1A 2V2FF 3MKFA 5EVIC 2ZC5B 3IT9A 2Y4AA 2ZC4B 2ZD8A 2ZQCA 3PBSA 4QU3A 1BUEA 1N9BA 1J9MA 1HD8A 5F1FA 1GA9A 3A3JA 1NZOA 4E3MA 1IKGA 5TR7A 4LV3A 3SH9A 3ZDJA 4BL2A 4EV4A 4U3TA 1LLBA 2Y59A 2ZM0A 3ZCZA 5GLBA 1E3UD 4OOYA 4OLGA 2WYXA 1PZPA 2VGJA 3VSLA 2J9OA 4R3JA 4BL3A 3HUOA 4KZ3A 2XDMA 1FR1A 2PU2A 3MZEA 4IVIA 4S2MA 2IWBA 3N7WA 5I94A 4E3OA 5AQ9A 4WEKA 4ZAMA 1YT4A 3ZG8B 3S1YA 1RCJA 2EXBA 3GTCA 2A49A 1K57A 4U0XA 1NY0A 1BZAA 1W8YA 4UA7A 4JXVA 5FQQA 1PIOA 1KE3A 3IH8A 1G68A 4UA9A 3IF6A 4WZ4A 1BT5A 4MBFA 4N9LA 1LL5A 4B4XA 4B88A 4DE3A 4E3LA 4Y0TA 4C6YA 2Q9MA 3C4OA 3IF6B 4JXGA 3OPHA 5FATA 1LI0A 2H5SA 2Y2NA 3ZG9B 5FAOA 3VP3A 3UPOA 3CG5A 4LCMA 3ZGAB 5FQIA 2Y2PA 2EX6A 4KQQA 3VSKA 3WS4A 3M6BA 3PBQA 3A3FA 4R0QA 1XGIA 2QZ6A 4GD6A 1FSWA 5EPHA 3ISGA 3IXGA 3W4PA 1FQGA 3ITBA 3E2LA 5EOOA 2Y2KA 3LO7A 2J8YA 2XFTA 4OQIA 3AGDA 1C3BA 5FASA 4R1GA 5DF7A 1L0DA 2JE5A 2XGNA 5GHYA 1HZOA 1QMFA 2HP5A 2Y2OA 4Y0OA 5CTMA 2OSUA 2V20A 4HBUA 5CHJA 3LCEA 4OVDA 4P85A 4EBPA 5HAPA 2HP9A 3TOIA 4KZ4A 3MBZA 5TGFA 2ZQ7A 1ESIA 2DRWA 3VMAA 4OQGA 2PU4A 1KDSA 2WUQA 3IHBA 5CECA 1IELA 3GSGA 3NCKA 2FFYA 2X02A 1Z6FA 4GDNA 1WYCA 3VOZA 3WRTA 2OLVA 2Y2MA 1Q2QA 1PZOA 4BD1A 1GHMA 4KZ7A 4FSFA 5IHVA 1K4FA 3JYIA 2EX9A 5A91A 1ZG4A 3PBOA 1K55A 1MBLA 4HEFA 4JBFA 4P87A 4YINA 1VQQA 3PAGA 1DY6A 1KE4A 4PM6A 3BRMA 4YFMA 1YLJA 4ZJ2A 3WRZA 2EX8A 5E2EA 1NXYA 4WMCD 3TG9A 5CEDA 3BEBA 4LCLA 3NDGA 1LL9A 3UDXA 3WS1A 4QJGA 4C3QA 1VM1A 1XGJA 3BFGA 3FYZA 4S2PA 4X68A 1XPBA 4OOMA 4OLDA 4JXWA 1K57C 1KGGA 3ZFZA 5EVID 5HFOA 1E25A 3O88A 5GL9A 4MNRA 4PPRA 4S2LA 4BQMA 3SH7A 3IF6C 3FV7A 5HW3A 1KGEA 3ZVTA 3HBRA 2JC7A 2EFUA 2P9VA 2ZC3B 1HTZA 3G34A 4MEZA 4OH0A 1CEGA 3HREA 4KG5A 3N8LA 3QHYA 1CEFA 1CK3A 1XX2A 5CGXA 1ALQA 3VFHA 3VP0A 3HLBA 4PM7A 2P9VB 4OP8A 2BG1A 2ZQ8A 4K91A 2J7VA 1ESUA 4XUXA 3S22A 1XKZA 2WADA 3IWOA 3ZG0A 4QY5A 1M40A 2WAEA 3HUMA 2H10A 3GR2A 1SCWA 4OONA 4PM9A 1IEMA 3HLGA 1JTGA 4A5RA 1DJBA 3D4FA 2Y2QA 5F82A 3G32A 5M18A 2HDRA 3RJUA 1K25A 4MLLA 4U0TA 3ZHHA 3HLFA 3OCLA 4CJNA 3GVBA 5HARA 4BLMA 4KENB 4PM8A 1W8QA 4X55A 1YM1A 5KSCA 2EX2A 4E3KA 3ITAA 5JYPA 4GOGA 5DTTA 4DRTA 5L2FA 3HVFA 4S2KA 3BFCA 2X01A 1K56A 2XK1A 5G18A 1MWSA 3MZFA 5KZHA 1DJCA 1KGFA 1YLYA 4WM9A 1K38A 2WGIA 4GN2A 5FAQA 3WS0A 3IHAA 4KQOA 3VFFA 1PI5A 1ZG6A 3ZG7B 4JF5A 1U60A 3BECA 5A93A 5CEBA 3MKEA 3M2KA 1K55C 4RX3A 2XQZA 5EVLA 3SS4A 5M1AA 1TEMA 3BFEA 3HUNA 3PTEA 4KG6A 4KQRA 4P6BA 3UE3A 4M3KA 3DTMA 1IKIA 4L0LA 5DTSA 3G30A 3VP2A 3MZDA 5FAPA 1NYYA 1ERQA 2OLUA 3BLMA 3G35A 4RYEA 1AXBA 1ES5A 1N4OA 4OKPA 2BLSA 1ZKJA 5CHMA 1HVBA 1MXOA 1XP4A 1YLTA 1E4DA 4RVAA 1DJAA 5FQKA 3GQZA 3NBLA 4DE2A 2XD5A 3IWIA 4P0MA 1S0WA 1WYBA 4QHCA 4WEJA 5CTNA 1BLSA 3OC2A 5DF9A 5FI7A 3V39A 4DF6A 3BFFA 3WS2A 3VP1A 3LEZA 2X71A 5E43A 1K54A 1ES3A 4GD8A 2CC1A 4CPKA 3ZNYA 2ZJ9A 3A3IA 3UDFA 2XD1A 3LY3A 2R9WA 3EQVA 1GHIA 2WKHA 1YLWA 2GDNA 2ZC6B 3NY4A 4FH2A 3UPNA 3W4QA 3HLDA 2WZXA 2J9PA 4IBRA 3P09A 2HP6A 4ZBEA 1BULA 4XXRA 5CGSA 1GA0A 3DWKA 3PAEA 4GB7A 1ES2A 4KZ9A 4X56A 1NJ4A 2ZQDA 2RCXA 1PWCA 4ZJ1A 3UE0A 4QB8A 3M2JA 1ZC2A 1MWRA 3Q81A 4EWFA 4RA7A 3B3XA 4X69A 3SS3A 3ZNTA 4UAAA 3IQAA 4JKTA 4WELA 1YQSA 2JCHA 1L0FA 2C5WB 4LV2A 5HX9A 4IEDA 2Y2LA 4OQ0A 1KE0A 1Q2PA 1JVJA 5EUAA 1TVFA 5DVAA 2V1ZA 4GZBA 3V3SA 1QMEA 4IVKA 3MXSA 2WZZA 2C6WB 4GKUA 1YLZA 1BLHA 2A3UA 3SS5A 4O7DA 1H8YA 3TSGA 3OZHA 4EUZA 1W5DA 1JWVA 4OPZA 3NI9A 5KSHA 4IBXA 3DWZA 4Y0UA 2Y2GA 2XF3A 3BFDA 3G4PA 3NDEA 5FSRA 3UPPA 1L2SA 4Y7PA 1ONGA 2XFSA 4RX2A 5GHZA 3HL9A 4EQIA 1E3UA 5KMWA 3QNBA 4BJPA 1MWTA 1CI9A 5TFQA 1IYPA 3RXWA 1EWZA 2ZLYA 3UDIA 4DE1A 3A3EA 3ZVWA 5AQ7A 4OOLA 5AQAA 1JWPA 4KZ6A 1G6AA 4S2NA 1TDGA 4N92A 1CI8A 1XA7A 3QNCA 5FI2A 3BLSA 3G31A 4DXCA 5GLCA 1W7FA 4GNUA 2HPBA 5GHXA 1BLCA 1FOFA 4UHUA 3FKWA 3UE1A 3OPLA 3O3VA 2Y2JA 5CGWA 3IXBA 2Y2IA 3UO9A 1JTDA 4LV1A 2RL3A 2Z2LB 3C7VA 1FCOA 3W4OA 4S2IA 2UWXA 3PBRA 1SDNA 5DF8A 3V5MA 3G2ZA 4Z9QA 5EECA 3PBNA 2Q9NA 4PMAA 1NZUA 4E3JA 3Q07A 4N9KA 3DW0A 5FQMA 3CMZA 4BENA 3FWLA 1K54C 1S6RA 1K6RA 3PBTA 5A90A 4FD8A 1M6KA 4OPYA 4KZAA 5HL1A 3N6IA 4H8RA 4B4ZA 4C75A 4ZJ3A 5CHUA 4E6XA 3Q7VA 3UNWA 1XA1A 3C5AA 3SOIA 2ZM2A 1SHVA 1TDLA 3IWQA 2WKIA 2I72A 3M6HA 5EE8A 3GV9A 1RP5A 1GCEA 3Q7VB 1K6SA 4R4SA 1RGYA 2Y55A 2R9XA 3OCNA 1JWZA 5FA7A 2OV5A 1W79A 1O7EA 3OPRA 3Q82A 1XXMA 1L0GA 1EROA 2DCFA 1MPLA 1WE4A 5D3OA 1KVMA 4EBNA 3O86A 2XLNA 3IXDA 1I2SA 2HDSA 2Z2MB 4N1HA 4ZTKA 5FQJA 4X6TA 5F83A 3W8KA 2JBFA 4QD4A 3N4IA 1NRFA 2IWDA 1K4EA 2HDUA 1KVLA 4R3BA 4WZ5A 4JXSA 4OPQA 5FI6A 2P74A 4PM5A 2E8IA 1YLPA 2XR0A 4GDBA 4OQHA 2QMIA 3CJMA 4DE0A 1OMEA 4R4RA 2VGKA 1MKIA 5DTKA 4DKIA 4F94A 3ZG5A 5A92A 1BSGA 1O07A 4MBKA 3WS5A 3GMWA 4WMCA 4OP5A 2HDQA 5E2FA 3O87A 4KG2A 5JYOA 1FCNA 1ERMA 4KZ5A 1H5XA 2WKEA 3BM6A 4E3IA 2Y2HA 2B5RA 4S2NC 4UA6A 5GLAA 3VP4A 4DXBA 2ZQ9A 1ONHA 1PWDA 5E2GA 3E2KA 5EOEA 5M19A 5EVIA 2PBYA 1MWUA 3HLEA 3A3DA 1FSYA 5GLDA 1PYYA 4FH4A 1PWGA 2EFXA 3C4PA 5FQ9A 2XH9A 4QY6A 4E3NA 3UY6A 1L0EA 4S2JA 4D2OA 1NYMA 2ZM8A 5EVIB 1K56D 2ZC7A 4ID4A 4JF6A 2WAFA 4LV0A 4X53A 4DDSA 1I5QA 4KZBA 5CRFA 5HAQA 2XEPA 3IXHA 2WGWA 4N1XA 1RGZA 1Y54A 3N8RA 4MBHA 1I2WA 1KDWA 2Y91A 1BLPA 4JF4A 4HBTA 4KZ8A 2WGWB 5CERA 4WBGA 5J8XA 3IF5A 1LHYA 1BTLA 3I7JA 4Q8IA 3P98A 4EBLA 3C7UA 4FCFA 2G2WA 3MXRA 4LENA 3BYDA 5HAIA 3Q1FA 4JPMA 4ZDXA 1MY8A 1SDEA 4JLFA 1YMSA 2G2UA 1IYSA 2IWCA 3N8SA 4K0XA 3OPPA 1PW8A 5AQBA 5U47A 3IH9A 3V50A 3V3RA 1IYQA 5FDHA 1LI9A 2ZMAA 3Q7ZA 1IYOA 3CZDA 4R23A 5E2HA
chains in the Genus database with same CATH superfamily
3AZEB 1N9LA 1VETB 1EI5A 4OPRA 2GNXA 3HLCA 1TZYB 4YS3B 3W98B 4H9NA 3VOLA 4IBJA 2D02A 4MB5A 5HL1A 4H9NB 4E6WA 3AZJC 3AZMA 4EESA 4WN5A 3FKVA 4IJFA 3C30A 2QPNA 3AZIC 1H8ZA 4NE3A 3AZMB 4KQDA 5L09A 4BD0A 2W27A 1PFLA 4IUKA 1PI4A 4NZ3A 5GSUC 4G92C 2HIOD 3B0DB 4ARZA 2ZC4B 3AZKD 2JKRI 1J9MA 1HD8A 1IKGA 4LV3A 4IBDA 4BL2A 2LY8A 4NYYA 1OT9A 4G3VA 3EPHA 3ZCZA 4H9OA 3KXBD 4O01A 1P3KA 2J3TD 1TS0A 3WA9D 2VGJA 3VSLA 4XZQB 3HUOA 3CAXA 4KZ3A 5I94A 2PU2A 3H0LC 1P3KB 3N7WA 1KX3A 4E3OA 3LICA 1YT4A 3S1YA 2EXBA 4NXFA 1K57A 4U0XA 1TS7A 5G4ZA 4JXVA 1KX3B 1H0GA 1DRMA 1PIOA 1XFNA 4HGAC 5B2IA 1G68A 1BH8B 4X1MA 1KOUA 1T1CA 1BT5A 4J8XD 4B4XA 1P3MD 4O8GA 5B2IB 2Q9MA 3KSHA 4C6YA 3T1XA 4IUHA 2DMWA 5FAOA 3ZGAB 5FQIA 2EX6A 3IBJA 3AZEC 3AZFA 5EPHA 3TE8A 3IXGA 1TZYC 4YS3C 3W98C 3FKEA 5EOOA 3IX4A 2RVQD 3AZFB 2M1CA 2J8YA 5EVEA 1NLYA 4R1GA 4OJ6A 2JE5A 1E6ZA 5GHYA 4Y0OA 2V20A 4OVDA 2HP9A 5B24A 3TOIA 1S67L 1YSQA 3VMAA 2PU4A 1KDSA 3AZMC 4BBTA 5B24B 4R38A 1KU5A 3LJAA 1Z6FA 2OWJA 1Q2QA 3PR6A 1KX5A 3UTAD 3B0DC 1GHMA 1YU2A 3LJAB 1KX5B 1ZG4A 2L1MA 3LIAA 2HZ5A 5J3WA 4YFMA 4ZJ2A 5B40A 4XZQC 5DNMA 1P3KC 4LCLA 2HUEB 3WS1A 3MGRB 1YUEA 1P9RA 1XGJA 1KX3C 2XA7M 2YFVA 4OOMA 1K57C 1KGGA 4EW7A 3AN2A 4ZUXA 5GL9A 4MNRA 2F8ND 3PXPA 2JHEA 2YFVB 5B2IC 1N9OA 4BQMA 5HWVA 3ZVTA 3KSFA 1H0MA 3HBRA 3AN2B 4ZUXB 1HTZA 4MEZA 5BNVA 2B18A 3N8LA 3VP0A 2P08A 5CGXA 3OBFA 5BNVB 2BG1A 2ZQ8A 1CJFA 4YOFA 3AZFC 3S22A 1QO6A 1XKZA 3K2NA 1G28A 3GR2A 4E44A 4PM9A 3IBRA 1IEMA 3HLGA 5CPKA 4A5RA 4WU8A 3NQUA 5CPKB 5BS7A 3EPKA 1K25A 4MLLA 1SKOA 5B24C 3HLFA 3D3OA 4WU8B 3LR4A 5HARA 4II7A 2BYKA 3NQUB 4KENB 5BNXA 1YM1A 1SKOB 2EX2A 1MZUA 3LJAC 1AIWA 5BNXB 2X01A 1K56A 2XK1A 1KX5C 3MZFA 2PDRA 3LI9A 5B31G 5HSQA 5DJTA 5CP6D 3CI6A 4KQOA 3ZG7B 5A93A 1WA9A 1ED7A 4RQ9A 2XQZA 1TEMA 1P3FA 3PTEA 1PRQA 4P6BA 3UE3A 4M3KA 5B40C 2HUEC 5HZHA 1P3FB 4LD9D 3BJNA 3EWKA 4RYEA 1N4OA 4K08A 2BLSA 1ZKJA 1HVBA 1MXOA 3RH8B 1DJAA 3GQZA 3C1BD 4P0MA 5FI7A 4WEJA 3OC2A 2M7VA 3S7PA 4DF6A 3BFFA 2L4RA 3UB6A 3AL0C 5AJGA 4BMWA 3AN2C 4ZUXC 3NHQA 2CC1A 2OWHA 4QWOA 3REKD 2ZJ9A 3A3IA 2R9WA 2WKHA 4KGCA 3ZQ5A 1M19A 2VGLM 3WX7A 4PHTA 1DP6A 4XXRA 3REID 5CGSA 4Z2IA 4X56A 1M19B 1NJ4A 3UE0A 4JGOA 5AVBA 1ZC2A 3M2JA 3F1PB 5HDCA 5B1LD 3IQAA 5CPKC 4JKTA 5AVBB 4NKPA 4WELA 1L0FA 2C5WB 4LV2A 5HX9A 1GSWA 2Y2LA 4GCZA 3L25A 4WU8C 1Q2PA 2XA7S 4HJ6A 1TVFA 5BS7C 2V1ZA 3V3SA 1YU3A 3H82A 2C6WB 1YLZA 1A0KA 1BLHA 3KSIA 1OPXA 2PR5A 5J4EA 5HWWA 4EUZA 3H82B 2V8CA 4Y7PA 1ONGA 5HL6A 2XFSA 4RX2A 3HL9A 1E3UA 2GZAA 1BFMA 4HOIA 3QNBA 3RXWA 2ZLYA 3BWLA 3MQOA 4OOLA 1G6AA 5FI2A 4N92A 1P3FC 1CI8A 4CQHA 3G31A 4NG2A 2G7UA 4EETB 1BLCA 3UE1A 1ZLAA 3O3VA 5CGWA 3RFBA 2Y2IA 4JJND 1M1AD 2UWXA 1ZLAB 1OJGA 5DF8A 4Z9QA 4I3JA 2Q9NA 4DRBA 5DNNA 3EEAA 3DW0A 5C5KA 4WU9D 5CPID 4L9GA 5DNNB 1K6RA 4JGPA 3PBTA 3P7NA 4OPYA 3VE3A 1G6OA 4DJ2A 2ZBBA 1XJ2A 5CHUA 4KUOA 4E6XA 4XUJD 3WTPE 1M19C 5B0ZD 2ZM2A 4NYUA 1TDLA 2OAP1 5GT3D 2I72A 3M6HA 3U4LP 1K6SA 4HJ4A 4MDZA 3WD0A 5AVBC 4J8WD 3WTPD 5D3OA 1G5UA 2PYOD 1UGUA 3IXDA 4N1HA 3C38A 4ZTKA 3AV1D 5F83A 2JBFA 4IBBA 2E8IA 1P3ID 3L26A 5CHLB 4GDBA 5JRGD 1OMEA 2VGLS 4R4RA 5DTKA 5B31D 1BSGA 3WS5A 4OP5A 1D1JA 4P6ZM 4CAYA 3TU4A 5IU1A 4E3IA 4CAYB 5GLAA 3TU4B 1PWDA 5E2GA 3REHB 5EVIA 4FH4A 1P3GB 3ULFA 2XH9A 1ZLAC 2A24A 5EVIB 3UB8A 4WNNA 3AFAA 4JF6A 4DDSA 3ICYA 5CRFA 5HAQA 5B1MD 5DNNC 2XEPA 3AFAB 3N8RA 4WLAA 1JNUA 3WKJB 3AZHD 4LRYC 5CERA 3IX8A 1N9NA 2W3DA 4EEUA 1BTLA 4NY2A 3I7JA 4NEED 5GXQD 4FCFA 1Z2CB 3B6FA 3BYDA 4NE6A 3Q1FA 4MB3A 2V8FA 3IP4C 3B6FB 1YU4A 4K0XA 4HMCA 2PT7A 5U47A 3UT9D 4Z1WA 1LI9A 1IYOA 5E2HA 1M18D 4LLOB 4DMZA 3EOIA 2CV5A 2QYBA 3WWXA 4MB4A 4HJ3A 1IFQA 3E98A 3NIAA 5JA4A 4HESA 3T4LA 2CV5B 3FZCA 2PYPA 4EO5B 5F1GA 1H3OA 3RXXA 3X1VD 3D9YA 5AY8D 5FL3A 5JA4B 3VV4A 3AZND 2JKGA 3M7PA 4OJPA 3MFDA 1H3OB 4CLCA 4LG2A 3AYWD 1YKDA 3TU4C 3W97D 2YFWA 5C3IB 3OLOA 3NULA 3A6NB 4Z5TA 2W0NA 3LY4A 2J8PA 3VOYA 2YFWB 5EVIC 1Y28A 3FPWA 1EAKA 4Z5TB 4E45A 5TR7A 1UWNX 3C1CA 1LLBA 3AFAC 1AOID 4X23A 4OLGA 3HONA 3WKJC 1PZPA 2BASA 4GLQA 1LSXA 1V9YA 5DFYA 4S2MA 2XDMA 4IVIA 3MZEA 1NLZA 2IWBA 4X23B 1P0ZA 1P3PA 1P3OA 4ZAMA 3W99A 3ZG8B 2A49A 1BZAA 5BT1C 3T1SA 5AV8D 1KE3A 1P3OB 4WF0A 3W99B 3VH5W 3FC7A 4KUKA 3B6FC 1F66D 4B88A 4GHIA 5F99D 1YPRA 4MN6A 2H5SA 3VP3A 3KUYD 4GHIB 3VSKA 1H3QA 2VV6A 3M6BA 3PBQA 4NZ5A 1XGIA 1HTAA 1FSWA 3WD2A 3ISGA 3LO7A 2CV5C 5E5AA 4EO5C 1IOUA 1ID3A 2XGNA 2Y2OA 5E5AB 2OSUA 4HBUA 5AV6D 2K2NA 4EBPA 1ID3B 3MBZA 4HP4A 2ZQ7A 1ESIA 4XZQD 3B0CT 5MC7A 5CECA 2XSSA 1S32A 2QJ5A 5AVCD 1IELA 3NCKA 4Y13A 4EERA 2ZL1B 1PZOA 4J8VD 4Y17A 1S32B 3L7HA 4Z5TC 5IHVA 3T4TA 3IX3A 3L2AA 2VEAA 4YM6A 1MBLA 4HGAB 4JBFA 3UE6A 4QLCA 1W1YA 3BRMA 4I3AA 4YM6B 3C1CC 4QLCB 4X1LA 5CEDA 4X23C 2VK3A 1XJ4A 3LEQA 1LL9A 5AV9A 4HHDA 3FDDA 4HMDA 1P3LA 1P3PC 1P3OC 4KUDB 2NZDD 3W99C 1XPBA 3C8CA 4NXEA 5AV9B 4JXWA 2F2AC 1P3LB 1E25A 3O88A 3X1TA 1KX4A 3SH7A 5CPJA 1W63Q 5HW3A 1KS0A 3B42A 3JPUA 3G34A 3X1TB 1KX4B 4OH0A 2AROD 1CEGA 4KG5A 5CPJB 2VJWA 1CEFA 1XX2A 4Z66D 3MFXA 3VFHA 3HLBA 3L9KA 2NQBD 4LRXC 3WD1A 2HJ9C 5TBMA 2J7VA 1ESUA 5AV5D 2W1RA 3MVDD 4EEPA 5E5AC 2QKPA 2MJ6A 1ID3C 3MGQA 3REJA 2HDRA 4ARZB 4WJ3C 4EUVA 5A8BA 4J8UD 3ZHHA 4CJNA 4BLMA 3MGRD 3MGQB 3REJB 4IBKA 4PM8A 4X55A 3FG8A 4H9OB 1E6NA 4E3KA 1S32C 5AVFA 3ITAA 4GOGA 5B0YD 5DTTA 4DRTA 4XT2A 5G18A 1MWSA 2LB5A 2DF4C 3DBAA 4R8PD 1KGFA 1E6PA 1K38A 3KO6A 5FAQA 3VFFA 4XT2B 1PI5A 3MKEA 5HDSA 4YM6C 5HPFA 2JKRM 5B33A 5EVLA 4QLCC 3CITA 5I5LA 1TD5A 5B2JD 4L0LA 3AV2A 3G30A 1NYYA 3BLMA 4R6LA 3MNNA 1P34A 3WAAA 4KUDC 1XP4A 4ETXA 5AV9C 2B95A 3AV2B 2J80A 3MNNB 3NBLA 1P3LC 4Z2KA 1P34B 5CTNA 3WAAB 1BLSA 5DF9A 3V39A 3O62A 3X1TC 2X71A 5E43A 1KX4C 3LZ1A 4GD8A 5CPJC 4DQYB 4DN0A 1GPFA 3O62B 2GDNA 2JKFA 2ZC6B 3W4QA 3LZ1B 3A1KA 5IS1A 4KZ9A 1ES2A 2ZY4A 3LUQA 2ZMVA 2ZQDA 2RCXA 4QB8A 2KDKA 4HQAA 5B32D 1MWRA 3Q81A 4EWFA 2OOLA 3B3XA 4X69A 3W96D 4IEDA 3T50A 1MKMA 1JVJA 3MGQC 3REJC 1BYWA 3TW8A 2PRFA 4IVKA 1A7WA 1W63M 3MQQA 4GKUA 5B40B 4AFIA 4O7DA 1H8YA 2HIOA 5DNMB 3TSGA 3OZHA 4I3IA 5DKLA 3AZKA 4OPZA 5KSHA 3NDEA 3G4PA 2HIOB 5GHZA 4EQIA 4H9QA 3KXBA 1LSVA 4DJ3A 1AWIA 3MQLA 1CI9A 1W2EA 3WA9A 3A3EA 2VA0A 4H9QB 4GJ4A 3KXBB 4HNBA 3L28A 5B33C 1OGGA 4S2NA 1TDGA 1XA7A 3QNCA 3WA9B 1FILA 4DXCA 3HSHA 4DRAA 1W7FA 3B0BA 1TS8A 3AV2C 4JGRA 3LFVA 3MNNC 1P34C 3WAAC 3IXBA 2W3FA 4LV1A 4J8XA 3C7VA 1P3MA 3TRCA 3KSYA 3H0RC 3PBRA 5TJJA 3B6GD 3V5MA 3KX0X 3LI8A 1NZUA 1T19A 4J8XB 1P3MB 3O62C 3CMZA 4BENA 4NZ4A 2EA9A 2NUTC 3LZ1C 1S6RA 4Z2HA 4FD8A 4Z2MH 4B4ZA 4ZJ3A 2FJ7D 1CK7A 3Q7VA 5FDSA 2BTFP 2BYKB 5GT0D 2WKIA 3Q7VB 4Z2LA 2V1BA 2R9XA 3HJKA 3OCNA 5FA7A 3LELD 1L0GA 3X1SD 4ME4A 2R78A 1U35D 2XLNA 1I2SA 2HDSA 3H0MC 5DNMC 3UTAA 2IWDA 2HDUA 4WZ5A 1KVLA 4JXSA 4OPQA 1E6RA 4PKYA 5FI6A 1YU1A 2HIOC 3UTAB 2XR0A 2BYMA 3AZKC 2GX5A 3NJAA 2QMIA 3CJMA 1MKIA 1N1JA 2BYMB 3KXBC 3R4KA 2J3TC 3WA9C 3O87A 1N1JB 4KG2A 1TZYA 4KZ5A 2WKEA 3LIDA 2B5RA 4S2NC 3VP4A 4EXOA 1EQZD 1P3BD 2ZQ9A 3BQAA 5EOEA 1W1VA 4IBEA 4BBUA 2PBYA 3HLEA 4KGCB 5GLDA 1PWGA 5FQ9A 2F8NA 4G3WA 4E3NA 5BPVA 3UY6A 2ZM8A 2ACGA 4J8XC 1W1TA 4HH2A 1P3MC 4ID4A 3D72A 1I5QA 5L10A 4N1XA 4MBHA 2Y91A 4ETZA 3NOTC 3MS6A 2RTSA 3SZTA 2RVQC 4Q8IA 4EBLA 3LIEA 4LENA 1HQ3D 5HAIA 4JPMA 2RIQA 1MY8A 1SDEA 2G2UA 2IWCA 4GH9A 3N8SA 1WWSA 2J3WA 3IH9A 3V50A 3V3RA 1YU0A 5FDHA 2ZMAA 2M7UA 2HGVA 3REHD 3F1NA 1FR6A 2DNSA 1ES4A 3UTAC 3AZGD 1P3GD 1XFQA 5BOHA 4OJOA 4WZ5C 5CP6A 4CSRA 3F1NB 3UN7A 2FFFB 3AGFA 5HPIA 3MGSD 2Z6CA 5CP6B 2KX6A 2WK0A 5AVEA 3SH8A 3SW1A 1VB6A 4S2OA 3G2YA 4LD9A 4K0WA 2WGVA 3WKJD 4WYYA 1CF0A 4NETA 4XUZA 3MGPD 4LD9B 4KGCC 3C1BA 3S4XA 2H0TA 5CX7A 4NZ1A 1GSVA 4Q0IA 1PW1A 2O99A 2V2FF 5EM1A 3MKFA 3C1BB 2ZY3A 3KWQD 2ZD8A 3UTBD 2ZQCA 4QU3A 1BUEA 2VV7A 5F1FA 1GA9A 3REKA 1NZOA 2HJEA 3ZDJA 4U3TA 2Y59A 5GLBA 4OOYA 3FPVA 3REKB 3VH6W 2J9OA 3REIA 4BL3A 3EPJA 1FR1A 3RELD 5AQ9A 4WEKA 3F1OA 4WV4B 3REIB 1NY0A 1W8YA 1PZRA 4QPRA 4UA7A 5B1LA 3UMEA 3EG5B 5FQQA 4NE5A 3F1OB 4UA9A 4MBFA 4IHQA 1LL5A 5B1LB 2W3EA 3AZLD 2ZY5A 4Z2MG 4JXGA 3OPHA 5FATA 3ZG9B 3UPOA 2Y2NA 3CG5A 2Y2PA 3MSHA 4R0QA 3A6ND 3E4QA 4GD6A 1FQGA 3E2LA 2XFTA 4OQIA 3AGDA 1C3BA 5FEFA 5DF7A 4R3AA 1L0DA 5CP6C 2I9VA 5F5YA 1HZOA 5CTMA 3LZ0D 3HJIA 5CHJA 2A24B 3X1UD 4H9PA 4WNNB 3LIFA 3UB5P 3IHBA 2Z6DA 4LD9C 1B6WA 3T12B 3GSGA 3DTEA 2X02A 1WYCA 3VOZA 3DTIA 4BD1A 4JJNA 1ODVA 1M1AA 3C1BC 2HV1A 3CPTA 4FSFA 1EW0A 4JJNB 1M1AB 3PBOA 4WU9A 5CPIA 3CPTB 1DY6A 3REKC 4I38A 1YLJA 3WRZA 3AZJD 4WU9B 5CPIB 5E2EA 4KHAA 4QNLA 4XUJA 4WMCD 3TG9A 2PAVP 3BEBA 5B0ZA 4NXBA 3AZID 2INWA 5GT3A 4QJGA 3REIC 2VV8A 4C3QA 1VM1A 3FYZA 4KHAB 1S4SA 4XUJB 4X68A 5B0ZB 1JFIA 1STZA 5GSUD 5GT3B 4J8WA 3F6TA 5B1LC 1JFIB 4HI4A 4PPRA 4S2LA 4X25A 1D06A 3FV7A 3QP4A 1KGEA 5F68A 4J8WB 3KS4A 2PYOA 2JC7A 2EFUA 2ZC3B 3KS8A 4D60A 4M6BA 3HREA 3QHYA 3AV1A 1ALQA 4TX8A 3A0RA 2PYOB 1F9IA 1P3IA 5KIZA 3AV1B 4CLCB 2ZY2A 2WADA 5JRGA 1P3IB 1M40A 2WAEA 5FEGA 1J3WA 5B31A 2W1TA 2K7SA 1DJBA 4IBIA 5JRGB 2Y2QA 5F82A 2WKPA 5B31B 4IJEA 5M18A 4LFUA 3RJUA 2VX8A 2W1TB 4U0TA 4B9OA 1H8MA 3GVBA 3O5YA 4MN7A 3MJQA 1P97A 3C1CB 3T1RA 4NFTA 1W8QA 3R7WA 2WKQA 5KSCA 3AZED 5J7EA 4KUDD 5JYPA 5G49A 3RTYA 5L2FA 3HVFA 4S2KA 1TZYD 4YS3D 3W98D 3BFCA 3S7QA 4BWIA 4JJNC 1M1AC 4OUIA 1WWIA 1P3PB 5G49B 1YLYA 4GN2A 5B1MA 3K3DA 4JF5A 1U60A 3BECA 2L5AA 3VH5A 3M2KA 4LPZA 5CPIC 4WU9C 4RX3A 1F98A 4UPKA 3BFEA 5B1MB 3HUNA 4KG6A 3AZHA 4EQ1A 1IKIA 3NOUC 3AZMD 3VP2A 5FAPA 1ERQA 3MMHA 4XUJC 3G35A 1S4RA 5B0ZC 1AXBA 1ES5A 4OKPA 5GXQA 4GHLA 2VLGA 5GT3C 1K0KA 1E4DA 3LR5A 4DE2A 3IWIA 4QHCA 1J7MA 1WYBA 1YSPA 3VP1A 5GXQB 2QHKA 3TJZC 2O9AA 4J8WC 1E88A 3BW6A 3UT9A 1K54A 1HLUP 2XD1A 3T4QA 1M18A 4FH2A 2PYOC 1YLWA 2JKTI 3UT9B 2WZXA 3QP6A 2J9PA 2IA2A 3AV1C 1P3KD 4CLCC 4ZBEA 1BULA 2ZM5A 3CWFA 1M18B 3DWKA 3PAEA 1P3IC 1KX3D 4ZJ1A 3X1VA 5AY8A 3AZNA 5JRGC 3SS3A 3EPLA 4UAAA 5B31C 5L8MA 5B2ID 3X1VB 3AYWA 3AZNB 4OQ0A 1KE0A 3W97A 1CXWA 5EUAA 2G5HC 5DVAA 3R45A 1P3AA 1UR9A 3AYWB 2K31A 3SS5A 3W97B 3NECA 3R45B 2PD8A 3P5JB 1P3AB 2PR6A 3AZFD 1JWVA 3GDIA 4IBXA 3DWZA 4Y0UA 2XF3A 5FSRA 3UPPA 3A0VA 1AOIA 3CHWP 1H8PA 5KMWA 5B1MC 4BJPA 3UDIA 4DE1A 1AOIB 5AQ7A 5AQAA 3JVUA 1JWPA 4KZ6A 5B24D 1VETA 1O6IA 2ZMFA 1NWZA 3MXQA 5GLCA 4GNUA 2HPBA 4UQIM 1FOFA 5AV8A 3L27A 4UHUA 3FKWA 1T3UA 3LJAD 5GXQC 3UO9A 1F66A 2RL3A 1DP8A 1SZVA 1KX5D 5AV8B 5TBMB 5F99A 3G2ZA 2O9BA 2GJ3A 5HD3A 5EECA 3PBNA 4Y2FA 4PAUA 1F66B 4E3JA 3KUYA 4WL9A 4N9KA 5F99B 4BBVA 2V1AA 3FWLA 3UT9C 1K54C 5A90A 3KUYB 1M6KA 5B40D 3EGXC 2HF6A 2L0WA 3DTKA 4KZAA 4H9SA 4C75A 1M18C 1E8BA 3T1QB 2OAQ1 5DNMD 5EFWA 1XA1A 3C5AA 1L3LA 5EE8A 4G91B 1F2KA 5AV6A 4R4SA 1RGYA 3X1VC 5AY8C 1JWZA 1ACFA 1W79A 3AZNC 1O7EA 3Q82A 2OV5A 2QJ7A 5AV6B 4XZQA 4AWLC 3AN2D 2VQRA 4ZUXD 2DCFA 3S7NA 3WD3A 1GXDA 1WE4A 5AVCA 3AYWC 4FOFA 3W97C 2O9CA 4J8VA 5B33B 5FQJA 5AVCB 1P3AC 4X6TA 3W8KA 1BH8A 4QD4A 4R3BA 2P74A 4J8VB 1YLPA 4YNRA 4WUJA 4OQHA 4DE0A 2VGKA 1TF1A 1AOIC 5CPKD 3GMWA 2HDQA 4L9FA 3U2AA 5E2FA 4WU8D 4L9EA 1ERMA 1H5XA 3BM6A 2Y2HA 4UA6A 2F8NK 2NZDA 4FTXA 1NRJA 3T4KA 1MWUA 1FSYA 3KFUG 1PYYA 5AV8C 3C4PA 2NZDB 2JSSA 4QY6A 5HDDA 2PHYA 1NYMA 1F66C 1K56D 3PHYA 3C2WA 5F99C 2AROA 4LV0A 2WAFA 4X53A 4Z66A 2EWWA 1TS6A 3KUYC 2WGWA 2NQBA 1I2WA 2AROB 1KDWA 2D49A 4Z66B 4Y15A 2PYRA 1P3FD 5AV5A 4KZ8A 2JN7A 2WGWB 2E8JA 2NQBB 2PBDP 4I39A 4WBGA 4H9SC 3MVDA 1V9ZA 3UB7A 4G91C 5AV5B 3P98A 4B93A 3L29A 2KLIA 2V0WA 4GHAA 3MVDB 5AV6C 3AZKB 4IJGA 4UQIS 4J8UA 2IO5B 1UR8A 3KSGA 4WZSB 3OPPA 3MGRA 5AQBA 1T18A 4J8UB 1IYQA 5AVCC 5B0YA 3CZDA 4UUZA 4I5SA 4KGCD 4J8VC 2DQNC 3E4OA 3GRJA 1M19D 4R8PA 5B0YB 1BH9A 4LGWA 3E0YA 4UUZB 2EXAA 3DAVA 1SKFA 1OTIA 3HLWA 4Q0JA 3VH5T 4R8PB 3NC8A 1OGBA 1BH9B 3EQUA 2PD7A 5DKKA 2WKRA 5AVBD 4NXGA 2ZOIA 4NK3A 5B2JA 1YMXA 2H0YA 3HCYA 3JVVA 2ZQAA 5F6AA 5CXWA 5L07A 1GHPA 4DDYA 2CMNA 3UMDA 5B2JB 3AGEA 1T1AA 5HD5A 3BQ8A 4UEYA 1FCMA 2NZDC 4Y5FA 1ZHHB 2ZC5B 3V67A 3IT9A 2Y4AA 5DFXA 3PBSA 4M4XA 1N9BA 5BO0A 3A3JA 4E3MA 3SH9A 4EV4A 3T4SA 2ZM0A 3LGOA 3QP1A 2AROC 1E3UD 3MQ0A 5BO0B 4Z66C 2WYXA 2NQBC 4R3JA 2VZWA 2YKFA 3B33A 4H9RA 5AV5C 1P9WA 1RCJA 3GTCA 1OTBA 5B32A 3MVDC 4YWZA 1ZLAD 4H9RB 3IH8A 1D7EA 3W96A 1DP9A 3IF6A 4R70A 4WZ4A 4ESPA 4N9LA 5B32B 2IO5C 3A1IA 4DE3A 4E3LA 4Y0TA 3W96B 3C4OA 3IF6B 3CLOA 3V9RA 4J8UC 4ZBJB 1LI0A 4MN5A 5DNND 4LCMA 3MGRC 3WS4A 4KQQA 3V9RB 3A3FA 1CQAA 3KYQA 2QZ6A 5B0YC 1GSXA 3W4PA 3ITBA 2Y2KA 4R8PC 5FASA 1VHMA 1QMFA 2HP5A 2NUPC 2F8NB 3LCEA 1LSWA 4P85A 5HAPA 4KZ4A 5TGFA 5B2JC 2DRWA 4OQGA 2WUQA 4Z2JA 4GW9A 1R4VA 2FFYA 4GDNA 3WRTA 2Y2MA 2OLVA 3F1PA 4ZRRA 2V9AA 3B6GA 3EGDC 4KZ7A 1K4FA 3JYIA 2EX9A 5A91A 3B6GB 1K55A 1S1ZA 4HEFA 4P87A 1X0OA 4YINA 1L6JA 1VQQA 1YAXA 3PAGA 1KE4A 4PM6A 2UV0E 2EX8A 1PDCA 2FJ7A 5KDMA 1NXYA 3QP2A 3KYEA 3NDGA 5IT5A 3UDXA 3TU4D 5GT0A 2FJ7B 2LB9A 5KDMB 3BFGA 4S2PA 2FZ0A 5GT0B 4OLDA 3UB9A 1XJ3A 5B32C 3ZFZA 5EVID 3NOPC 5HFOA 3LELA 2Y79A 3X1SA 4HY8A 3W96C 3IF6C 4ZBJC 4CSRB 1U35A 2VKSA 3LELB 3AFAD 1OT6A 2P9VA 1S66L 3X1SB 3B0CW 1CK3A 1U35B 4IBCA 2P04A 4PM7A 2P9VB 2YKHA 3QP8A 4OP8A 4K91A 4XUXA 3IWOA 3ZG0A 4QY5A 3HUMA 5BT1D 2IOUA 2H10A 4MCWA 1SCWA 4OONA 1FIKA 1JTGA 3B6FD 3D4FA 4H6JA 3G32A 1TAFA 4OJLA 3E4PA 2XROA 3OCLA 1EQZA 1P3BA 4H6JB 1TAFB 2A2LA 3VH6A 1EQZB 1P3BB 1LL8A 1F1EA 3A0SA 2CV5D 4CLCE 5KZHA 3B6GC 1DJCA 4WM9A 2WGIA 3WS0A 4MMNA 3IHAA 2Y8HA 1ZG6A 1OTEA 5CEBA 1K55C 3SS4A 5M1AA 4KQRA 3MF0A 3DTMA 5DTSA 2FJ7C 3MZDA 3VE4A 2OLUA 4CLCD 5CHMA 1YLTA 5GT0C 2V0UA 2D01A 4RVAA 5FQKA 1HQ3A 4LRZE 5FUGA 2XD5A 1S0WA 3GECA 3OOVA 4Z5TD 1OTAA 4IBFA 2F8NH 5G4YA 3WS2A 1HQ3B 3LEZA 3LELC 5FUGB 1S1YA 1T1BA 2W3GA 3X1SC 1ES3A 1Z09A 4CPKA 3ZNYA 3UDFA 1U35C 3LY3A 3EQVA 2KOIA 4JGQA 1GHIA 3C1CD 3NY4A 3REHA 3UPNA 3HLDA 3AZGA 1P3GA 2G5IC 4X23D 3P09A 2HP6A 4IBRA 5K5BA 3LIBA 4H9PB 2XRNA 3CUEA 3LYXA 1Q9CA 1GA0A 4GB7A 3AZGB 3MGSA 1PWCA 1P3PD 1P3OD 3W99D 4RA7A 3MGSB 3ZNTA 5LBRA 1OTDA 1YQSA 2JCHA 1MC0A 3WKJA 2EWVA 3MGPA 4GZBA 1QMEA 3MXSA 1EQZC 1P3BC 2WZZA 2A3UA 5HWTA 2CWEA 3MGPB 1W5DA 3KWQA 3UTBA 3NI9A 3T4OA 2Y2GA 3BFDA 3P01A 1L2SA 3KWQB 5E5AD 3UTBB 4Z2GA 3WTPA 1ID3D 1MWTA 1VEUA 4Y3IA 1IYPA 5TFQA 1EWZA 3WD4A 3H7WA 4HP9A 3ZVWA 4Q0HA 3WTPB 3RELA 3BY9A 1VEUB 3BLSA 3H7WB 5GHXA 3K3CA 3RELB 1S32D 1ZTUA 3OPLA 2Y2JA 1JTDA 3S7OA 3N3FA 2Z2LB 1FCOA 1OJ5A 1HQ3C 3BY8A 4S2IA 3AZLA 3W4OA 1SDNA 4PMAA 3ZYTA 3Q07A 3AZLB 4YM6D 5FQMA 4QLCD 3A6NA 4F3LA 3N6IA 4H8RA 3REHC 3QP5A 1P3AD 4HMEA 3AZGC 1P3GC 3UNWA 3SOIA 2H28A 4F3LB 1SHVA 3IWQA 3CUEC 5AV9D 3MR0A 2B02A 3GV9A 1RP5A 3R7WB 1GCEA 1P3LD 3LZ0A 3MGSC 2Y55A 3X1UA 3OPRA 1XXMA 2Q0OA 3LZ0B 3LR3A 1EROA 3X1TD 1KX4D 3X1UB 1W1PA 1MPLA 5CPJD 1KVMA 1UWPX 4EBNA 3O86A 2AVXA 1GOIA 2Z2MB 4HH3A 3MGPC 1PNEA 3N4IA 1NRFA 3AZHB 1K4EA 1Y4OA 4P6ZS 4PM5A 3G6OA 3KWQC 3UTBC 3W2ZA 3H9WA 2W3HA 3EEHA 1LT0A 4IBGA 3PYPA 3AZJA 4F94A 4DKIA 3ZG5A 5A92A 1O07A 4MBKA 4WMCA 3WTPC 2ZOHA 4EU0A 3AZIA 3AZJB 1E15A 3MGQD 3REJD 1F5MA 1FCNA 5JYOA 4OJ5A 3RELC 1H0IA 4DXBA 5GSUA 3AZIB 2V5OA 1ONHA 4FUWA 5B32G 3NQJA 3E2KA 4PKYG 5M19A 3KYZA 1ULYA 3A3DA 2W8SA 3IS2A 2EFXA 4HIAA 5GSUB 1L0EA 5F69A 4S2JA 4G92B 3NQJB 4D2OA 2ZC7A 3IS2B 4GS9A 4O0PA 3AZLC 4KZBA 3T4JA 5AY8B 3IXHA 1RGZA 4GS9B 1B67A 4AWLB 1Y54A 2ZL1A 1BLPA 5B33D 5C3IC 4G3KA 4JF4A 3A6NC 4HBTA 5J8XA 2JKTM 3IF5A 3AV2D 1LHYA 3MNND 1XJ6A 2F8NG 1P34D 3WAAD 3C7UA 2G2WA 3MXRA 5EV0A 2FH5A 2P7JA 5DJUA 4ZDXA 3LZ0C 2FN2A 2QWSA 4JLFA 1YMSA 3X1UC 1IYSA 2O0YA 4E04A 1PW8A 3O62D 3LR0A 3VH6T 3AZEA 3LZ1D 3Q7ZA 4KUDA 3AZHC 5EM0A 3B47A 4R23A 4YS3A 3W98A
chains in the Genus database with same CATH topology
3AZEB 1EI5A 4OPRA 3HLCA 1TZYB 4YS3B 3W98B 4H9NA 4IBJA 4H9NB 4E6WA 3AZJC 3AZMA 3FKVA 4IJFA 2QPNA 3AZIC 1H8ZA 4NE3A 3AZMB 4BD0A 1PI4A 4NZ3A 5GSUC 4G92C 2HIOD 3B0DB 2ZC4B 3AZKD 1J9MA 1HD8A 1IKGA 4LV3A 4IBDA 4BL2A 2LY8A 4NYYA 3EPHA 3ZCZA 4H9OA 3KXBD 1P3KA 3WA9D 2VGJA 3VSLA 4XZQB 3HUOA 4KZ3A 5I94A 2PU2A 3H0LC 1P3KB 3N7WA 1KX3A 4E3OA 1YT4A 3S1YA 2EXBA 1K57A 4U0XA 4JXVA 1KX3B 1PIOA 4HGAC 5B2IA 1G68A 1BH8B 1BT5A 4J8XD 4B4XA 1P3MD 5B2IB 2Q9MA 4C6YA 5FAOA 3ZGAB 5FQIA 2EX6A 3AZEC 3AZFA 5EPHA 3IXGA 1TZYC 4YS3C 3W98C 3FKEA 5EOOA 2RVQD 3AZFB 2J8YA 4R1GA 4OJ6A 2JE5A 5GHYA 4Y0OA 2V20A 4OVDA 2HP9A 5B24A 3TOIA 3VMAA 2PU4A 1KDSA 3AZMC 5B24B 1KU5A 3LJAA 1Z6FA 1Q2QA 1KX5A 3UTAD 3B0DC 1GHMA 1YU2A 3LJAB 1KX5B 1ZG4A 4YFMA 4ZJ2A 5B40A 4XZQC 5DNMA 1P3KC 4LCLA 2HUEB 3WS1A 3MGRB 1YUEA 1XGJA 1KX3C 2YFVA 4OOMA 1K57C 1KGGA 3AN2A 4ZUXA 5GL9A 4MNRA 2F8ND 2YFVB 5B2IC 4BQMA 3ZVTA 3HBRA 3AN2B 4ZUXB 1HTZA 4MEZA 5BNVA 3N8LA 3VP0A 5CGXA 5BNVB 2BG1A 2ZQ8A 3AZFC 3S22A 1XKZA 3GR2A 4E44A 4PM9A 1IEMA 3HLGA 5CPKA 4A5RA 4WU8A 3NQUA 5CPKB 5BS7A 3EPKA 1K25A 4MLLA 5B24C 3HLFA 4WU8B 5HARA 2BYKA 3NQUB 4KENB 5BNXA 1YM1A 2EX2A 3LJAC 5BNXB 2X01A 1K56A 2XK1A 1KX5C 3MZFA 5B31G 5CP6D 4KQOA 3ZG7B 5A93A 2XQZA 1TEMA 1P3FA 3PTEA 4P6BA 3UE3A 4M3KA 5B40C 2HUEC 1P3FB 4LD9D 4RYEA 1N4OA 2BLSA 1ZKJA 1HVBA 1MXOA 1DJAA 3GQZA 3C1BD 4P0MA 5FI7A 4WEJA 3OC2A 4DF6A 3BFFA 3AL0C 3AN2C 4ZUXC 2CC1A 3REKD 2ZJ9A 3A3IA 2R9WA 2WKHA 4KGCA 1M19A 3WX7A 4XXRA 3REID 5CGSA 4X56A 1M19B 1NJ4A 3UE0A 5AVBA 1ZC2A 3M2JA 5B1LD 3IQAA 5CPKC 4JKTA 5AVBB 4WELA 1L0FA 2C5WB 4LV2A 5HX9A 2Y2LA 3L25A 4WU8C 1Q2PA 1TVFA 5BS7C 2V1ZA 3V3SA 1YU3A 2C6WB 1YLZA 1BLHA 4EUZA 4Y7PA 1ONGA 2XFSA 4RX2A 3HL9A 1E3UA 1BFMA 3QNBA 3RXWA 2ZLYA 4OOLA 1G6AA 5FI2A 4N92A 1P3FC 1CI8A 3G31A 1BLCA 3UE1A 1ZLAA 3O3VA 5CGWA 2Y2IA 4JJND 1M1AD 2UWXA 1ZLAB 5DF8A 4Z9QA 2Q9NA 4DRBA 5DNNA 3DW0A 4WU9D 5CPID 5DNNB 1K6RA 3PBTA 4OPYA 5CHUA 4E6XA 4XUJD 3WTPE 1M19C 5B0ZD 2ZM2A 4NYUA 1TDLA 5GT3D 2I72A 3M6HA 1K6SA 5AVBC 4J8WD 3WTPD 5D3OA 2PYOD 3IXDA 4N1HA 4ZTKA 3AV1D 5F83A 2JBFA 4IBBA 2E8IA 1P3ID 3L26A 5CHLB 4GDBA 5JRGD 1OMEA 4R4RA 5DTKA 5B31D 1BSGA 3WS5A 4OP5A 4CAYA 3TU4A 4E3IA 4CAYB 5GLAA 3TU4B 1PWDA 5E2GA 3REHB 5EVIA 4FH4A 1P3GB 2XH9A 1ZLAC 5EVIB 4WNNA 3AFAA 4JF6A 4DDSA 5CRFA 5HAQA 5B1MD 5DNNC 2XEPA 3AFAB 3N8RA 3WKJB 3AZHD 5CERA 1BTLA 4NY2A 3I7JA 5GXQD 4FCFA 1Z2CB 3B6FA 3BYDA 4NE6A 3Q1FA 3IP4C 3B6FB 1YU4A 4K0XA 5U47A 3UT9D 1LI9A 1IYOA 5E2HA 1M18D 2CV5A 3WWXA 3NIAA 5JA4A 4HESA 2CV5B 3FZCA 4EO5B 5F1GA 1H3OA 3RXXA 3X1VD 5AY8D 5JA4B 3AZND 4OJPA 3MFDA 1H3OB 4LG2A 3AYWD 3TU4C 3W97D 2YFWA 5C3IB 3A6NB 4Z5TA 3LY4A 3VOYA 2J8PA 2YFWB 5EVIC 4Z5TB 4E45A 5TR7A 3C1CA 1LLBA 3AFAC 1AOID 4X23A 4OLGA 3HONA 3WKJC 1PZPA 4S2MA 2XDMA 4IVIA 3MZEA 2IWBA 4X23B 1P3PA 1P3OA 4ZAMA 3W99A 3ZG8B 2A49A 1BZAA 5BT1C 5AV8D 1KE3A 1P3OB 3W99B 3VH5W 3B6FC 1F66D 4B88A 5F99D 2H5SA 3VP3A 3KUYD 3VSKA 3M6BA 3PBQA 4NZ5A 1XGIA 1HTAA 1FSWA 3ISGA 3LO7A 2CV5C 5E5AA 4EO5C 1ID3A 2XGNA 2Y2OA 5E5AB 2OSUA 4HBUA 5AV6D 4EBPA 1ID3B 3MBZA 2ZQ7A 1ESIA 4XZQD 3B0CT 5CECA 1S32A 5AVCD 1IELA 3NCKA 1PZOA 4J8VD 1S32B 4Z5TC 5IHVA 3L2AA 4YM6A 1MBLA 4HGAB 4JBFA 4QLCA 3BRMA 4YM6B 3C1CC 4QLCB 5CEDA 4X23C 1LL9A 5AV9A 3FDDA 1P3LA 1P3PC 1P3OC 4KUDB 2NZDD 3W99C 1XPBA 5AV9B 4JXWA 2F2AC 1P3LB 1E25A 3O88A 3X1TA 1KX4A 3SH7A 5CPJA 5HW3A 3G34A 3X1TB 1KX4B 4OH0A 2AROD 1CEGA 4KG5A 5CPJB 1CEFA 1XX2A 4Z66D 3VFHA 3HLBA 2NQBD 2J7VA 1ESUA 5AV5D 3MVDD 5E5AC 1ID3C 3MGQA 3REJA 2HDRA 4WJ3C 4J8UD 3ZHHA 4CJNA 4BLMA 3MGRD 3MGQB 3REJB 4IBKA 4PM8A 4X55A 4H9OB 4E3KA 1S32C 3ITAA 4GOGA 5B0YD 5DTTA 4DRTA 5G18A 1MWSA 2DF4C 4R8PD 1KGFA 1K38A 5FAQA 3VFFA 1PI5A 3MKEA 4YM6C 5B33A 5EVLA 4QLCC 5B2JD 4L0LA 3AV2A 3G30A 1NYYA 3BLMA 3MNNA 1P34A 3WAAA 4KUDC 1XP4A 5AV9C 3AV2B 3MNNB 3NBLA 1P3LC 1P34B 5CTNA 3WAAB 1BLSA 5DF9A 3V39A 3O62A 3X1TC 2X71A 5E43A 1KX4C 3LZ1A 4GD8A 5CPJC 4DQYB 3O62B 2GDNA 2ZC6B 3W4QA 3LZ1B 3A1KA 4KZ9A 1ES2A 2ZY4A 2ZQDA 2RCXA 4QB8A 5B32D 1MWRA 3Q81A 4EWFA 3B3XA 4X69A 3W96D 4IEDA 1JVJA 3MGQC 3REJC 4IVKA 1A7WA 4GKUA 5B40B 4O7DA 1H8YA 2HIOA 5DNMB 3TSGA 3OZHA 3AZKA 4OPZA 5KSHA 3NDEA 3G4PA 2HIOB 5GHZA 4EQIA 4H9QA 3KXBA 1CI9A 1W2EA 3WA9A 3A3EA 4H9QB 3KXBB 3L28A 5B33C 4S2NA 1TDGA 1XA7A 3QNCA 3WA9B 4DXCA 3HSHA 4DRAA 1W7FA 3B0BA 3AV2C 3MNNC 1P34C 3WAAC 3IXBA 4LV1A 4J8XA 3C7VA 1P3MA 3KSYA 3H0RC 3PBRA 3B6GD 3V5MA 1NZUA 4J8XB 1P3MB 3O62C 3CMZA 4BENA 4NZ4A 3LZ1C 1S6RA 4FD8A 4Z2MH 4B4ZA 4ZJ3A 2FJ7D 3Q7VA 2BYKB 5GT0D 2WKIA 3Q7VB 2R9XA 3OCNA 5FA7A 3LELD 1L0GA 3X1SD 1U35D 2XLNA 1I2SA 2HDSA 3H0MC 5DNMC 3UTAA 2IWDA 2HDUA 4WZ5A 1KVLA 4JXSA 4OPQA 5FI6A 1YU1A 2HIOC 3UTAB 2XR0A 2BYMA 3AZKC 2QMIA 3CJMA 1MKIA 1N1JA 2BYMB 3KXBC 3WA9C 3O87A 1N1JB 4KG2A 1TZYA 4KZ5A 2WKEA 2B5RA 4S2NC 3VP4A 1EQZD 1P3BD 2ZQ9A 5EOEA 4IBEA 2PBYA 3HLEA 4KGCB 5GLDA 1PWGA 5FQ9A 2F8NA 4E3NA 5BPVA 3UY6A 2ZM8A 4J8XC 1P3MC 4ID4A 1I5QA 4N1XA 4MBHA 2Y91A 2RVQC 4Q8IA 4EBLA 4LENA 1HQ3D 5HAIA 4JPMA 2RIQA 1MY8A 1SDEA 2G2UA 2IWCA 4GH9A 3N8SA 1WWSA 3IH9A 3V50A 3V3RA 1YU0A 5FDHA 2ZMAA 3REHD 1FR6A 2DNSA 1ES4A 3UTAC 3AZGD 1P3GD 5BOHA 4OJOA 4WZ5C 5CP6A 4CSRA 3UN7A 2FFFB 3AGFA 3MGSD 5CP6B 2WK0A 3SH8A 4S2OA 3G2YA 4LD9A 4K0WA 2WGVA 3WKJD 4WYYA 4NETA 4XUZA 3MGPD 4LD9B 4KGCC 3C1BA 3S4XA 2H0TA 4NZ1A 1PW1A 2V2FF 3MKFA 3C1BB 2ZY3A 3KWQD 2ZD8A 3UTBD 2ZQCA 4QU3A 1BUEA 5F1FA 1GA9A 3REKA 1NZOA 3ZDJA 4U3TA 2Y59A 5GLBA 4OOYA 3REKB 3VH6W 2J9OA 3REIA 4BL3A 3EPJA 1FR1A 3RELD 5AQ9A 4WEKA 4WV4B 3REIB 1NY0A 1W8YA 1PZRA 4UA7A 5B1LA 3EG5B 5FQQA 4NE5A 4UA9A 4MBFA 1LL5A 5B1LB 3AZLD 2ZY5A 4Z2MG 4JXGA 3OPHA 5FATA 3ZG9B 3UPOA 2Y2NA 3CG5A 2Y2PA 4R0QA 3A6ND 4GD6A 1FQGA 3E2LA 2XFTA 4OQIA 3AGDA 1C3BA 5DF7A 1L0DA 5CP6C 1HZOA 5CTMA 3LZ0D 5CHJA 3X1UD 4H9PA 4WNNB 3IHBA 4LD9C 1B6WA 3GSGA 2X02A 1WYCA 3VOZA 4BD1A 4JJNA 1M1AA 3C1BC 4FSFA 4JJNB 1M1AB 3PBOA 4WU9A 5CPIA 1DY6A 3REKC 1YLJA 3WRZA 3AZJD 4WU9B 5CPIB 5E2EA 4KHAA 4QNLA 4XUJA 4WMCD 3TG9A 3BEBA 5B0ZA 3AZID 5GT3A 4QJGA 3REIC 4C3QA 1VM1A 3FYZA 4KHAB 4XUJB 4X68A 5B0ZB 1JFIA 5GSUD 5GT3B 4J8WA 3F6TA 5B1LC 1JFIB 4PPRA 4S2LA 3FV7A 1KGEA 4J8WB 3KS4A 2PYOA 2JC7A 2EFUA 2ZC3B 3KS8A 4M6BA 3HREA 3QHYA 3AV1A 1ALQA 2PYOB 1P3IA 3AV1B 2ZY2A 2WADA 5JRGA 1P3IB 1M40A 2WAEA 5B31A 1DJBA 4IBIA 5JRGB 2Y2QA 5F82A 5B31B 4IJEA 5M18A 3RJUA 4U0TA 3GVBA 3C1CB 4NFTA 1W8QA 5KSCA 3AZED 4KUDD 5JYPA 5G49A 5L2FA 3HVFA 4S2KA 1TZYD 4YS3D 3W98D 3BFCA 4JJNC 1M1AC 4OUIA 1WWIA 1P3PB 5G49B 1YLYA 4GN2A 5B1MA 4JF5A 1U60A 3BECA 2L5AA 3VH5A 3M2KA 5CPIC 4WU9C 4RX3A 4UPKA 3BFEA 5B1MB 3HUNA 4KG6A 3AZHA 1IKIA 3AZMD 3VP2A 5FAPA 1ERQA 4XUJC 3G35A 5B0ZC 1AXBA 1ES5A 4OKPA 5GXQA 4GHLA 5GT3C 1E4DA 4DE2A 3IWIA 4QHCA 3VP1A 1WYBA 5GXQB 4J8WC 3UT9A 1K54A 2XD1A 1M18A 4FH2A 2PYOC 1YLWA 3UT9B 2WZXA 2J9PA 3AV1C 1P3KD 4ZBEA 1BULA 2ZM5A 1M18B 3DWKA 3PAEA 1P3IC 1KX3D 4ZJ1A 3X1VA 5AY8A 3AZNA 5JRGC 3SS3A 3EPLA 4UAAA 5B31C 5B2ID 3X1VB 3AYWA 3AZNB 4OQ0A 1KE0A 3W97A 5EUAA 2G5HC 5DVAA 3R45A 1P3AA 3AYWB 3SS5A 3W97B 3R45B 3P5JB 1P3AB 3AZFD 1JWVA 4IBXA 3DWZA 4Y0UA 2XF3A 5FSRA 3UPPA 1AOIA 5KMWA 5B1MC 4BJPA 3UDIA 4DE1A 1AOIB 5AQ7A 5AQAA 1JWPA 4KZ6A 5B24D 5GLCA 4GNUA 2HPBA 1FOFA 5AV8A 3L27A 4UHUA 3FKWA 1T3UA 3LJAD 5GXQC 3UO9A 1F66A 2RL3A 1KX5D 5AV8B 5F99A 3G2ZA 5EECA 3PBNA 1F66B 4E3JA 3KUYA 4N9KA 5F99B 3FWLA 3UT9C 1K54C 5A90A 3KUYB 1M6KA 5B40D 4KZAA 5HL1A 4C75A 4H9SA 1M18C 5DNMD 1XA1A 3C5AA 5EE8A 4G91B 5AV6A 4R4SA 1RGYA 3X1VC 5AY8C 1JWZA 2OV5A 1W79A 3AZNC 1O7EA 3Q82A 5AV6B 4XZQA 4AWLC 3AN2D 2VQRA 4ZUXD 2DCFA 1WE4A 5AVCA 3AYWC 3W97C 4J8VA 5B33B 5FQJA 5AVCB 1P3AC 4X6TA 3W8KA 1BH8A 4QD4A 4R3BA 2P74A 4J8VB 1YLPA 4OQHA 4DE0A 2VGKA 1AOIC 5CPKD 3GMWA 2HDQA 5E2FA 4WU8D 1ERMA 1H5XA 3BM6A 2Y2HA 4UA6A 2F8NK 2NZDA 1MWUA 1FSYA 3KFUG 1PYYA 5AV8C 3C4PA 2NZDB 2JSSA 4QY6A 1NYMA 1F66C 1K56D 5F99C 2AROA 4LV0A 2WAFA 4X53A 4Z66A 3KUYC 2WGWA 2NQBA 1I2WA 2AROB 1KDWA 4Z66B 1P3FD 5AV5A 4KZ8A 2WGWB 2NQBB 4WBGA 4H9SC 3MVDA 4G91C 5AV5B 3P98A 3L29A 4GHAA 3MVDB 5AV6C 3AZKB 4J8UA 2IO5B 4WZSB 3OPPA 3MGRA 5AQBA 4J8UB 1IYQA 5AVCC 5B0YA 3CZDA 4UUZA 4KGCD 4J8VC 2DQNC 3GRJA 1M19D 4R8PA 5B0YB 1BH9A 4UUZB 2EXAA 1SKFA 3HLWA 3VH5T 4R8PB 3NC8A 1BH9B 3EQUA 5AVBD 4NK3A 5B2JA 1YMXA 2H0YA 2ZQAA 5CXWA 1GHPA 4DDYA 5B2JB 3AGEA 1FCMA 2NZDC 2ZC5B 3IT9A 2Y4AA 3PBSA 1N9BA 5BO0A 3A3JA 4E3MA 3SH9A 4EV4A 2ZM0A 2AROC 1E3UD 5BO0B 4Z66C 2WYXA 2NQBC 4R3JA 4H9RA 5AV5C 1RCJA 3GTCA 5B32A 3MVDC 1ZLAD 4H9RB 3IH8A 3W96A 3IF6A 4WZ4A 4N9LA 5B32B 2IO5C 3A1IA 4DE3A 4E3LA 4Y0TA 3W96B 3C4OA 3IF6B 3V9RA 4J8UC 4ZBJB 1LI0A 5DNND 4LCMA 3MGRC 3WS4A 4KQQA 3V9RB 3A3FA 2QZ6A 5B0YC 3W4PA 3ITBA 2Y2KA 4R8PC 5FASA 1QMFA 2HP5A 2F8NB 3LCEA 4P85A 5HAPA 4KZ4A 5TGFA 5B2JC 2DRWA 4OQGA 2WUQA 1R4VA 2FFYA 4GDNA 3WRTA 2Y2MA 2OLVA 3B6GA 4KZ7A 1K4FA 3JYIA 2EX9A 5A91A 3B6GB 1K55A 4HEFA 4P87A 4YINA 1VQQA 3PAGA 1KE4A 4PM6A 2EX8A 2FJ7A 5KDMA 1NXYA 3NDGA 3UDXA 3TU4D 5GT0A 2FJ7B 5KDMB 3BFGA 4S2PA 5GT0B 4OLDA 5B32C 3ZFZA 5EVID 5HFOA 3LELA 3X1SA 3W96C 3IF6C 4ZBJC 4CSRB 1U35A 3LELB 3AFAD 2P9VA 3X1SB 3B0CW 1CK3A 1U35B 4IBCA 4PM7A 2P9VB 4OP8A 4K91A 4XUXA 3IWOA 3ZG0A 4QY5A 3HUMA 5BT1D 2IOUA 2H10A 1SCWA 4OONA 1JTGA 3B6FD 3D4FA 3G32A 1TAFA 4OJLA 3OCLA 1EQZA 1P3BA 1TAFB 3VH6A 1EQZB 1P3BB 1F1EA 2CV5D 5KZHA 3B6GC 1DJCA 4WM9A 2WGIA 3WS0A 3IHAA 1ZG6A 5CEBA 1K55C 3SS4A 5M1AA 4KQRA 3DTMA 5DTSA 2FJ7C 3MZDA 2OLUA 5CHMA 1YLTA 5GT0C 4RVAA 5FQKA 1HQ3A 5FUGA 2XD5A 1S0WA 4Z5TD 4IBFA 2F8NH 3WS2A 1HQ3B 3LEZA 3LELC 5FUGB 3X1SC 1ES3A 4CPKA 3ZNYA 3UDFA 1U35C 3LY3A 3EQVA 1GHIA 3C1CD 3NY4A 3REHA 3UPNA 3HLDA 3AZGA 1P3GA 2G5IC 4X23D 3P09A 2HP6A 4IBRA 4H9PB 1Q9CA 1GA0A 4GB7A 3AZGB 3MGSA 1PWCA 1P3PD 1P3OD 3W99D 4RA7A 3MGSB 3ZNTA 1YQSA 2JCHA 3WKJA 3MGPA 4GZBA 1QMEA 3MXSA 1EQZC 1P3BC 2WZZA 2A3UA 2CWEA 3MGPB 1W5DA 3KWQA 3UTBA 3NI9A 2Y2GA 3BFDA 1L2SA 3KWQB 5E5AD 3UTBB 3WTPA 1ID3D 1MWTA 5TFQA 1IYPA 1EWZA 3ZVWA 3WTPB 3RELA 3BLSA 5GHXA 3RELB 1S32D 3OPLA 2Y2JA 1JTDA 3N3FA 2Z2LB 1FCOA 1HQ3C 4S2IA 3W4OA 3AZLA 1SDNA 4PMAA 3Q07A 3AZLB 4YM6D 5FQMA 4QLCD 3A6NA 3N6IA 4H8RA 3REHC 1P3AD 3AZGC 1P3GC 3UNWA 3SOIA 1SHVA 3IWQA 5AV9D 3GV9A 1RP5A 1GCEA 1P3LD 3LZ0A 3MGSC 2Y55A 3X1UA 3OPRA 1XXMA 3LZ0B 1EROA 3X1TD 1KX4D 3X1UB 1MPLA 5CPJD 1KVMA 4EBNA 3O86A 2Z2MB 3MGPC 3N4IA 1NRFA 3AZHB 1K4EA 4PM5A 3KWQC 3UTBC 4IBGA 3AZJA 4F94A 4DKIA 3ZG5A 5A92A 1O07A 4MBKA 4WMCA 3WTPC 3AZIA 3AZJB 3MGQD 3REJD 1FCNA 5JYOA 4OJ5A 3RELC 4DXBA 5GSUA 3AZIB 1ONHA 5B32G 3NQJA 3E2KA 5M19A 1ULYA 3A3DA 2W8SA 2EFXA 5GSUB 1L0EA 4S2JA 4G92B 3NQJB 4D2OA 2ZC7A 3AZLC 4KZBA 5AY8B 3IXHA 1RGZA 1B67A 4AWLB 1Y54A 1BLPA 5B33D 5C3IC 4JF4A 3A6NC 4HBTA 5J8XA 3IF5A 3AV2D 1LHYA 3MNND 2F8NG 1P34D 3WAAD 3C7UA 2G2WA 3MXRA 4ZDXA 3LZ0C 4JLFA 1YMSA 3X1UC 1IYSA 1PW8A 3O62D 3VH6T 3AZEA 3LZ1D 3Q7ZA 4KUDA 3AZHC 4R23A 4YS3A 3W98A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GRJ A;  1FR6 A;  2DNS A;  1ES4 A;  3WWX A;  5BOH A;  1EI5 A;  4OPR A;  4WZ5 C;  3HLC A;  2EXA A;  3NIA A;  3UN7 A;  1SKF A;  2FFF B;  3HLW A;  3AGF A;  4HES A;  3FZC A;  3NC8 A;  5F1G A;  3RXX A;  3EQU A;  2WK0 A;  4NK3 A;  1YMX A;  2H0Y A;  4E6W A;  3MFD A;  3SH8 A;  2ZQA A;  5CXW A;  4S2O A;  3G2Y A;  1GHP A;  3FKV A;  4K0W A;  4DDY A;  2WGV A;  3AGE A;  2QPN A;  4WYY A;  1H8Z A;  4NET A;  4XUZ A;  4BD0 A;  3S4X A;  2H0T A;  1FCM A;  1PI4 A;  3LY4 A;  3VOY A;  1PW1 A;  2V2F F;  3MKF A;  5EVI C;  2ZC5 B;  3IT9 A;  2Y4A A;  2ZC4 B;  2ZD8 A;  2ZQC A;  3PBS A;  4QU3 A;  1BUE A;  1N9B A;  1J9M A;  1HD8 A;  5F1F A;  1GA9 A;  3A3J A;  1NZO A;  4E3M A;  1IKG A;  5TR7 A;  4LV3 A;  3SH9 A;  3ZDJ A;  4BL2 A;  4EV4 A;  4U3T A;  1LLB A;  2Y59 A;  2ZM0 A;  3ZCZ A;  5GLB A;  1E3U D;  4OOY A;  4OLG A;  2WYX A;  1PZP A;  2VGJ A;  3VSL A;  2J9O A;  4R3J A;  4BL3 A;  3HUO A;  4KZ3 A;  2XDM A;  1FR1 A;  2PU2 A;  3MZE A;  4IVI A;  4S2M A;  2IWB A;  3N7W A;  5I94 A;  4E3O A;  5AQ9 A;  4WEK A;  4ZAM A;  1YT4 A;  3ZG8 B;  3S1Y A;  1RCJ A;  2EXB A;  3GTC A;  2A49 A;  1K57 A;  4U0X A;  1NY0 A;  1BZA A;  1W8Y A;  4UA7 A;  4JXV A;  5FQQ A;  1PIO A;  1KE3 A;  3IH8 A;  1G68 A;  4UA9 A;  3IF6 A;  4WZ4 A;  1BT5 A;  4MBF A;  4N9L A;  1LL5 A;  4B4X A;  4B88 A;  4DE3 A;  4E3L A;  4Y0T A;  4C6Y A;  2Q9M A;  3C4O A;  3IF6 B;  4JXG A;  3OPH A;  5FAT A;  1LI0 A;  2H5S A;  2Y2N A;  3ZG9 B;  5FAO A;  3VP3 A;  3UPO A;  3CG5 A;  4LCM A;  3ZGA B;  5FQI A;  2Y2P A;  2EX6 A;  4KQQ A;  3VSK A;  3WS4 A;  3M6B A;  3PBQ A;  3A3F A;  4R0Q A;  1XGI A;  2QZ6 A;  4GD6 A;  1FSW A;  5EPH A;  3ISG A;  3IXG A;  3W4P A;  1FQG A;  3ITB A;  3E2L A;  5EOO A;  2Y2K A;  3LO7 A;  2J8Y A;  2XFT A;  4OQI A;  3AGD A;  1C3B A;  5FAS A;  4R1G A;  5DF7 A;  1L0D A;  2JE5 A;  2XGN A;  5GHY A;  1HZO A;  1QMF A;  2HP5 A;  2Y2O A;  4Y0O A;  5CTM A;  2OSU A;  2V20 A;  4HBU A;  5CHJ A;  3LCE A;  4OVD A;  4P85 A;  4EBP A;  5HAP A;  2HP9 A;  3TOI A;  4KZ4 A;  3MBZ A;  5TGF A;  2ZQ7 A;  1ESI A;  2DRW A;  3VMA A;  4OQG A;  2PU4 A;  1KDS A;  2WUQ A;  3IHB A;  5CEC A;  1IEL A;  3GSG A;  3NCK A;  2FFY A;  2X02 A;  1Z6F A;  4GDN A;  1WYC A;  3VOZ A;  3WRT A;  2OLV A;  2Y2M A;  1Q2Q A;  1PZO A;  4BD1 A;  1GHM A;  4KZ7 A;  4FSF A;  5IHV A;  1K4F A;  3JYI A;  2EX9 A;  5A91 A;  1ZG4 A;  3PBO A;  1K55 A;  1MBL A;  4HEF A;  4JBF A;  4P87 A;  4YIN A;  1VQQ A;  3PAG A;  1DY6 A;  1KE4 A;  4PM6 A;  3BRM A;  4YFM A;  1YLJ A;  4ZJ2 A;  3WRZ A;  2EX8 A;  5E2E A;  1NXY A;  4WMC D;  3TG9 A;  5CED A;  3BEB A;  4LCL A;  3NDG A;  1LL9 A;  3UDX A;  3WS1 A;  4QJG A;  4C3Q A;  1VM1 A;  1XGJ A;  3BFG A;  3FYZ A;  4S2P A;  4X68 A;  1XPB A;  4OOM A;  4OLD A;  4JXW A;  1K57 C;  1KGG A;  3ZFZ A;  5EVI D;  5HFO A;  1E25 A;  3O88 A;  5GL9 A;  4MNR A;  4PPR A;  4S2L A;  4BQM A;  3SH7 A;  3IF6 C;  3FV7 A;  5HW3 A;  1KGE A;  3ZVT A;  3HBR A;  2JC7 A;  2EFU A;  2P9V A;  2ZC3 B;  1HTZ A;  3G34 A;  4MEZ A;  4OH0 A;  1CEG A;  3HRE A;  4KG5 A;  3N8L A;  3QHY A;  1CEF A;  1CK3 A;  1XX2 A;  5CGX A;  1ALQ A;  3VFH A;  3VP0 A;  3HLB A;  4PM7 A;  2P9V B;  4OP8 A;  2BG1 A;  2ZQ8 A;  4K91 A;  2J7V A;  1ESU A;  4XUX A;  3S22 A;  1XKZ A;  2WAD A;  3IWO A;  3ZG0 A;  4QY5 A;  1M40 A;  2WAE A;  3HUM A;  2H10 A;  3GR2 A;  1SCW A;  4OON A;  4PM9 A;  1IEM A;  3HLG A;  1JTG A;  4A5R A;  1DJB A;  3D4F A;  2Y2Q A;  5F82 A;  3G32 A;  5M18 A;  2HDR A;  3RJU A;  1K25 A;  4MLL A;  4U0T A;  3ZHH A;  3HLF A;  3OCL A;  4CJN A;  3GVB A;  5HAR A;  4BLM A;  4KEN B;  4PM8 A;  1W8Q A;  4X55 A;  1YM1 A;  5KSC A;  2EX2 A;  4E3K A;  3ITA A;  5JYP A;  4GOG A;  5DTT A;  4DRT A;  5L2F A;  3HVF A;  4S2K A;  3BFC A;  2X01 A;  1K56 A;  2XK1 A;  5G18 A;  1MWS A;  3MZF A;  5KZH A;  1DJC A;  1KGF A;  1YLY A;  4WM9 A;  1K38 A;  2WGI A;  4GN2 A;  5FAQ A;  3WS0 A;  3IHA A;  4KQO A;  3VFF A;  1PI5 A;  1ZG6 A;  3ZG7 B;  4JF5 A;  1U60 A;  3BEC A;  5A93 A;  5CEB A;  3MKE A;  3M2K A;  1K55 C;  4RX3 A;  2XQZ A;  5EVL A;  3SS4 A;  5M1A A;  1TEM A;  3BFE A;  3HUN A;  3PTE A;  4KG6 A;  4KQR A;  4P6B A;  3UE3 A;  4M3K A;  3DTM A;  1IKI A;  4L0L A;  5DTS A;  3G30 A;  3VP2 A;  3MZD A;  5FAP A;  1NYY A;  1ERQ A;  2OLU A;  3BLM A;  3G35 A;  4RYE A;  1AXB A;  1ES5 A;  1N4O A;  4OKP A;  2BLS A;  1ZKJ A;  5CHM A;  1HVB A;  1MXO A;  1XP4 A;  1YLT A;  1E4D A;  4RVA A;  1DJA A;  5FQK A;  3GQZ A;  3NBL A;  4DE2 A;  2XD5 A;  3IWI A;  4P0M A;  1S0W A;  1WYB A;  4QHC A;  4WEJ A;  5CTN A;  1BLS A;  3OC2 A;  5DF9 A;  5FI7 A;  3V39 A;  4DF6 A;  3BFF A;  3WS2 A;  3VP1 A;  3LEZ A;  2X71 A;  5E43 A;  1K54 A;  1ES3 A;  4GD8 A;  2CC1 A;  4CPK A;  3ZNY A;  2ZJ9 A;  3A3I A;  3UDF A;  2XD1 A;  3LY3 A;  2R9W A;  3EQV A;  1GHI A;  2WKH A;  1YLW A;  2GDN A;  2ZC6 B;  3NY4 A;  4FH2 A;  3UPN A;  3W4Q A;  3HLD A;  2WZX A;  2J9P A;  4IBR A;  3P09 A;  2HP6 A;  4ZBE A;  1BUL A;  4XXR A;  5CGS A;  1GA0 A;  3DWK A;  3PAE A;  4GB7 A;  1ES2 A;  4KZ9 A;  4X56 A;  1NJ4 A;  2ZQD A;  2RCX A;  1PWC A;  4ZJ1 A;  3UE0 A;  4QB8 A;  3M2J A;  1ZC2 A;  1MWR A;  3Q81 A;  4EWF A;  4RA7 A;  3B3X A;  4X69 A;  3SS3 A;  3ZNT A;  4UAA A;  3IQA A;  4JKT A;  4WEL A;  1YQS A;  2JCH A;  1L0F A;  2C5W B;  4LV2 A;  5HX9 A;  4IED A;  2Y2L A;  4OQ0 A;  1KE0 A;  1Q2P A;  1JVJ A;  5EUA A;  1TVF A;  5DVA A;  2V1Z A;  4GZB A;  3V3S A;  1QME A;  4IVK A;  3MXS A;  2WZZ A;  2C6W B;  4GKU A;  1YLZ A;  1BLH A;  2A3U A;  3SS5 A;  4O7D A;  1H8Y A;  3TSG A;  3OZH A;  4EUZ A;  1W5D A;  1JWV A;  4OPZ A;  3NI9 A;  5KSH A;  4IBX A;  3DWZ A;  4Y0U A;  2Y2G A;  2XF3 A;  3BFD A;  3G4P A;  3NDE A;  5FSR A;  3UPP A;  1L2S A;  4Y7P A;  1ONG A;  2XFS A;  4RX2 A;  5GHZ A;  3HL9 A;  4EQI A;  1E3U A;  5KMW A;  3QNB A;  4BJP A;  1MWT A;  1CI9 A;  5TFQ A;  1IYP A;  3RXW A;  1EWZ A;  2ZLY A;  3UDI A;  4DE1 A;  3A3E A;  3ZVW A;  5AQ7 A;  4OOL A;  5AQA A;  1JWP A;  4KZ6 A;  1G6A A;  4S2N A;  1TDG A;  4N92 A;  1CI8 A;  1XA7 A;  3QNC A;  5FI2 A;  3BLS A;  3G31 A;  4DXC A;  5GLC A;  1W7F A;  4GNU A;  2HPB A;  5GHX A;  1BLC A;  1FOF A;  4UHU A;  3FKW A;  3UE1 A;  3OPL A;  3O3V A;  2Y2J A;  5CGW A;  3IXB A;  2Y2I A;  3UO9 A;  1JTD A;  4LV1 A;  2RL3 A;  2Z2L B;  3C7V A;  1FCO A;  3W4O A;  4S2I A;  2UWX A;  3PBR A;  1SDN A;  5DF8 A;  3V5M A;  3G2Z A;  4Z9Q A;  5EEC A;  3PBN A;  2Q9N A;  4PMA A;  1NZU A;  4E3J A;  3Q07 A;  4N9K A;  3DW0 A;  5FQM A;  3CMZ A;  4BEN A;  3FWL A;  1K54 C;  1S6R A;  1K6R A;  3PBT A;  5A90 A;  4FD8 A;  1M6K A;  4OPY A;  4KZA A;  5HL1 A;  3N6I A;  4H8R A;  4B4Z A;  4C75 A;  4ZJ3 A;  5CHU A;  4E6X A;  3Q7V A;  3UNW A;  1XA1 A;  3C5A A;  3SOI A;  2ZM2 A;  1SHV A;  1TDL A;  3IWQ A;  2WKI A;  2I72 A;  3M6H A;  5EE8 A;  3GV9 A;  1RP5 A;  1GCE A;  3Q7V B;  1K6S A;  4R4S A;  1RGY A;  2Y55 A;  2R9X A;  3OCN A;  1JWZ A;  5FA7 A;  2OV5 A;  1W79 A;  1O7E A;  3OPR A;  3Q82 A;  1XXM A;  1L0G A;  1ERO A;  2DCF A;  1MPL A;  1WE4 A;  5D3O A;  1KVM A;  4EBN A;  3O86 A;  2XLN A;  3IXD A;  1I2S A;  2HDS A;  2Z2M B;  4N1H A;  4ZTK A;  5FQJ A;  4X6T A;  5F83 A;  3W8K A;  2JBF A;  4QD4 A;  3N4I A;  1NRF A;  2IWD A;  1K4E A;  2HDU A;  1KVL A;  4R3B A;  4WZ5 A;  4JXS A;  4OPQ A;  5FI6 A;  2P74 A;  4PM5 A;  2E8I A;  1YLP A;  2XR0 A;  4GDB A;  4OQH A;  2QMI A;  3CJM A;  4DE0 A;  1OME A;  4R4R A;  2VGK A;  1MKI A;  5DTK A;  4DKI A;  4F94 A;  3ZG5 A;  5A92 A;  1BSG A;  1O07 A;  4MBK A;  3WS5 A;  3GMW A;  4WMC A;  4OP5 A;  2HDQ A;  5E2F A;  3O87 A;  4KG2 A;  5JYO A;  1FCN A;  1ERM A;  4KZ5 A;  1H5X A;  2WKE A;  3BM6 A;  4E3I A;  2Y2H A;  2B5R A;  4S2N C;  4UA6 A;  5GLA A;  3VP4 A;  4DXB A;  2ZQ9 A;  1ONH A;  1PWD A;  5E2G A;  3E2K A;  5EOE A;  5M19 A;  5EVI A;  2PBY A;  1MWU A;  3HLE A;  3A3D A;  1FSY A;  5GLD A;  1PYY A;  4FH4 A;  1PWG A;  2EFX A;  3C4P A;  5FQ9 A;  2XH9 A;  4QY6 A;  4E3N A;  3UY6 A;  1L0E A;  4S2J A;  4D2O A;  1NYM A;  2ZM8 A;  5EVI B;  1K56 D;  2ZC7 A;  4ID4 A;  4JF6 A;  2WAF A;  4LV0 A;  4X53 A;  4DDS A;  1I5Q A;  4KZB A;  5CRF A;  5HAQ A;  2XEP A;  3IXH A;  2WGW A;  4N1X A;  1RGZ A;  1Y54 A;  3N8R A;  4MBH A;  1I2W A;  1KDW A;  2Y91 A;  1BLP A;  4JF4 A;  4HBT A;  4KZ8 A;  2WGW B;  5CER A;  4WBG A;  5J8X A;  3IF5 A;  1LHY A;  1BTL A;  3I7J A;  4Q8I A;  3P98 A;  4EBL A;  3C7U A;  4FCF A;  2G2W A;  3MXR A;  4LEN A;  3BYD A;  5HAI A;  3Q1F A;  4JPM A;  4ZDX A;  1MY8 A;  1SDE A;  4JLF A;  1YMS A;  2G2U A;  1IYS A;  2IWC A;  3N8S A;  4K0X A;  3OPP A;  1PW8 A;  5AQB A;  5U47 A;  3IH9 A;  3V50 A;  3V3R A;  1IYQ A;  5FDH A;  1LI9 A;  2ZMA A;  3Q7Z A;  1IYO A;  3CZD A;  4R23 A;  5E2H A; 
#chains in the Genus database with same CATH topology
 3AZE B;  1N9L A;  1VET B;  1EI5 A;  4OPR A;  2GNX A;  3HLC A;  1TZY B;  4YS3 B;  3W98 B;  4H9N A;  3VOL A;  4IBJ A;  2D02 A;  4MB5 A;  5HL1 A;  4H9N B;  4E6W A;  3AZJ C;  3AZM A;  4EES A;  4WN5 A;  3FKV A;  4IJF A;  3C30 A;  2QPN A;  3AZI C;  1H8Z A;  4NE3 A;  3AZM B;  4KQD A;  5L09 A;  4BD0 A;  2W27 A;  1PFL A;  4IUK A;  1PI4 A;  4NZ3 A;  5GSU C;  4G92 C;  2HIO D;  3B0D B;  4ARZ A;  2ZC4 B;  3AZK D;  2JKR I;  1J9M A;  1HD8 A;  1IKG A;  4LV3 A;  4IBD A;  4BL2 A;  2LY8 A;  4NYY A;  1OT9 A;  4G3V A;  3EPH A;  3ZCZ A;  4H9O A;  3KXB D;  4O01 A;  1P3K A;  2J3T D;  1TS0 A;  3WA9 D;  2VGJ A;  3VSL A;  4XZQ B;  3HUO A;  3CAX A;  4KZ3 A;  5I94 A;  2PU2 A;  3H0L C;  1P3K B;  3N7W A;  1KX3 A;  4E3O A;  3LIC A;  1YT4 A;  3S1Y A;  2EXB A;  4NXF A;  1K57 A;  4U0X A;  1TS7 A;  5G4Z A;  4JXV A;  1KX3 B;  1H0G A;  1DRM A;  1PIO A;  1XFN A;  4HGA C;  5B2I A;  1G68 A;  1BH8 B;  4X1M A;  1KOU A;  1T1C A;  1BT5 A;  4J8X D;  4B4X A;  1P3M D;  4O8G A;  5B2I B;  2Q9M A;  3KSH A;  4C6Y A;  3T1X A;  4IUH A;  2DMW A;  5FAO A;  3ZGA B;  5FQI A;  2EX6 A;  3IBJ A;  3AZE C;  3AZF A;  5EPH A;  3TE8 A;  3IXG A;  1TZY C;  4YS3 C;  3W98 C;  3FKE A;  5EOO A;  3IX4 A;  2RVQ D;  3AZF B;  2M1C A;  2J8Y A;  5EVE A;  1NLY A;  4R1G A;  4OJ6 A;  2JE5 A;  1E6Z A;  5GHY A;  4Y0O A;  2V20 A;  4OVD A;  2HP9 A;  5B24 A;  3TOI A;  1S67 L;  1YSQ A;  3VMA A;  2PU4 A;  1KDS A;  3AZM C;  4BBT A;  5B24 B;  4R38 A;  1KU5 A;  3LJA A;  1Z6F A;  2OWJ A;  1Q2Q A;  3PR6 A;  1KX5 A;  3UTA D;  3B0D C;  1GHM A;  1YU2 A;  3LJA B;  1KX5 B;  1ZG4 A;  2L1M A;  3LIA A;  2HZ5 A;  5J3W A;  4YFM A;  4ZJ2 A;  5B40 A;  4XZQ C;  5DNM A;  1P3K C;  4LCL A;  2HUE B;  3WS1 A;  3MGR B;  1YUE A;  1P9R A;  1XGJ A;  1KX3 C;  2XA7 M;  2YFV A;  4OOM A;  1K57 C;  1KGG A;  4EW7 A;  3AN2 A;  4ZUX A;  5GL9 A;  4MNR A;  2F8N D;  3PXP A;  2JHE A;  2YFV B;  5B2I C;  1N9O A;  4BQM A;  5HWV A;  3ZVT A;  3KSF A;  1H0M A;  3HBR A;  3AN2 B;  4ZUX B;  1HTZ A;  4MEZ A;  5BNV A;  2B18 A;  3N8L A;  3VP0 A;  2P08 A;  5CGX A;  3OBF A;  5BNV B;  2BG1 A;  2ZQ8 A;  1CJF A;  4YOF A;  3AZF C;  3S22 A;  1QO6 A;  1XKZ A;  3K2N A;  1G28 A;  3GR2 A;  4E44 A;  4PM9 A;  3IBR A;  1IEM A;  3HLG A;  5CPK A;  4A5R A;  4WU8 A;  3NQU A;  5CPK B;  5BS7 A;  3EPK A;  1K25 A;  4MLL A;  1SKO A;  5B24 C;  3HLF A;  3D3O A;  4WU8 B;  3LR4 A;  5HAR A;  4II7 A;  2BYK A;  3NQU B;  4KEN B;  5BNX A;  1YM1 A;  1SKO B;  2EX2 A;  1MZU A;  3LJA C;  1AIW A;  5BNX B;  2X01 A;  1K56 A;  2XK1 A;  1KX5 C;  3MZF A;  2PDR A;  3LI9 A;  5B31 G;  5HSQ A;  5DJT A;  5CP6 D;  3CI6 A;  4KQO A;  3ZG7 B;  5A93 A;  1WA9 A;  1ED7 A;  4RQ9 A;  2XQZ A;  1TEM A;  1P3F A;  3PTE A;  1PRQ A;  4P6B A;  3UE3 A;  4M3K A;  5B40 C;  2HUE C;  5HZH A;  1P3F B;  4LD9 D;  3BJN A;  3EWK A;  4RYE A;  1N4O A;  4K08 A;  2BLS A;  1ZKJ A;  1HVB A;  1MXO A;  3RH8 B;  1DJA A;  3GQZ A;  3C1B D;  4P0M A;  5FI7 A;  4WEJ A;  3OC2 A;  2M7V A;  3S7P A;  4DF6 A;  3BFF A;  2L4R A;  3UB6 A;  3AL0 C;  5AJG A;  4BMW A;  3AN2 C;  4ZUX C;  3NHQ A;  2CC1 A;  2OWH A;  4QWO A;  3REK D;  2ZJ9 A;  3A3I A;  2R9W A;  2WKH A;  4KGC A;  3ZQ5 A;  1M19 A;  2VGL M;  3WX7 A;  4PHT A;  1DP6 A;  4XXR A;  3REI D;  5CGS A;  4Z2I A;  4X56 A;  1M19 B;  1NJ4 A;  3UE0 A;  4JGO A;  5AVB A;  1ZC2 A;  3M2J A;  3F1P B;  5HDC A;  5B1L D;  3IQA A;  5CPK C;  4JKT A;  5AVB B;  4NKP A;  4WEL A;  1L0F A;  2C5W B;  4LV2 A;  5HX9 A;  1GSW A;  2Y2L A;  4GCZ A;  3L25 A;  4WU8 C;  1Q2P A;  2XA7 S;  4HJ6 A;  1TVF A;  5BS7 C;  2V1Z A;  3V3S A;  1YU3 A;  3H82 A;  2C6W B;  1YLZ A;  1A0K A;  1BLH A;  3KSI A;  1OPX A;  2PR5 A;  5J4E A;  5HWW A;  4EUZ A;  3H82 B;  2V8C A;  4Y7P A;  1ONG A;  5HL6 A;  2XFS A;  4RX2 A;  3HL9 A;  1E3U A;  2GZA A;  1BFM A;  4HOI A;  3QNB A;  3RXW A;  2ZLY A;  3BWL A;  3MQO A;  4OOL A;  1G6A A;  5FI2 A;  4N92 A;  1P3F C;  1CI8 A;  4CQH A;  3G31 A;  4NG2 A;  2G7U A;  4EET B;  1BLC A;  3UE1 A;  1ZLA A;  3O3V A;  5CGW A;  3RFB A;  2Y2I A;  4JJN D;  1M1A D;  2UWX A;  1ZLA B;  1OJG A;  5DF8 A;  4Z9Q A;  4I3J A;  2Q9N A;  4DRB A;  5DNN A;  3EEA A;  3DW0 A;  5C5K A;  4WU9 D;  5CPI D;  4L9G A;  5DNN B;  1K6R A;  4JGP A;  3PBT A;  3P7N A;  4OPY A;  3VE3 A;  1G6O A;  4DJ2 A;  2ZBB A;  1XJ2 A;  5CHU A;  4KUO A;  4E6X A;  4XUJ D;  3WTP E;  1M19 C;  5B0Z D;  2ZM2 A;  4NYU A;  1TDL A;  2OAP 1;  5GT3 D;  2I72 A;  3M6H A;  3U4L P;  1K6S A;  4HJ4 A;  4MDZ A;  3WD0 A;  5AVB C;  4J8W D;  3WTP D;  5D3O A;  1G5U A;  2PYO D;  1UGU A;  3IXD A;  4N1H A;  3C38 A;  4ZTK A;  3AV1 D;  5F83 A;  2JBF A;  4IBB A;  2E8I A;  1P3I D;  3L26 A;  5CHL B;  4GDB A;  5JRG D;  1OME A;  2VGL S;  4R4R A;  5DTK A;  5B31 D;  1BSG A;  3WS5 A;  4OP5 A;  1D1J A;  4P6Z M;  4CAY A;  3TU4 A;  5IU1 A;  4E3I A;  4CAY B;  5GLA A;  3TU4 B;  1PWD A;  5E2G A;  3REH B;  5EVI A;  4FH4 A;  1P3G B;  3ULF A;  2XH9 A;  1ZLA C;  2A24 A;  5EVI B;  3UB8 A;  4WNN A;  3AFA A;  4JF6 A;  4DDS A;  3ICY A;  5CRF A;  5HAQ A;  5B1M D;  5DNN C;  2XEP A;  3AFA B;  3N8R A;  4WLA A;  1JNU A;  3WKJ B;  3AZH D;  4LRY C;  5CER A;  3IX8 A;  1N9N A;  2W3D A;  4EEU A;  1BTL A;  4NY2 A;  3I7J A;  4NEE D;  5GXQ D;  4FCF A;  1Z2C B;  3B6F A;  3BYD A;  4NE6 A;  3Q1F A;  4MB3 A;  2V8F A;  3IP4 C;  3B6F B;  1YU4 A;  4K0X A;  4HMC A;  2PT7 A;  5U47 A;  3UT9 D;  4Z1W A;  1LI9 A;  1IYO A;  5E2H A;  1M18 D;  4LLO B;  4DMZ A;  3EOI A;  2CV5 A;  2QYB A;  3WWX A;  4MB4 A;  4HJ3 A;  1IFQ A;  3E98 A;  3NIA A;  5JA4 A;  4HES A;  3T4L A;  2CV5 B;  3FZC A;  2PYP A;  4EO5 B;  5F1G A;  1H3O A;  3RXX A;  3X1V D;  3D9Y A;  5AY8 D;  5FL3 A;  5JA4 B;  3VV4 A;  3AZN D;  2JKG A;  3M7P A;  4OJP A;  3MFD A;  1H3O B;  4CLC A;  4LG2 A;  3AYW D;  1YKD A;  3TU4 C;  3W97 D;  2YFW A;  5C3I B;  3OLO A;  3NUL A;  3A6N B;  4Z5T A;  2W0N A;  3LY4 A;  2J8P A;  3VOY A;  2YFW B;  5EVI C;  1Y28 A;  3FPW A;  1EAK A;  4Z5T B;  4E45 A;  5TR7 A;  1UWN X;  3C1C A;  1LLB A;  3AFA C;  1AOI D;  4X23 A;  4OLG A;  3HON A;  3WKJ C;  1PZP A;  2BAS A;  4GLQ A;  1LSX A;  1V9Y A;  5DFY A;  4S2M A;  2XDM A;  4IVI A;  3MZE A;  1NLZ A;  2IWB A;  4X23 B;  1P0Z A;  1P3P A;  1P3O A;  4ZAM A;  3W99 A;  3ZG8 B;  2A49 A;  1BZA A;  5BT1 C;  3T1S A;  5AV8 D;  1KE3 A;  1P3O B;  4WF0 A;  3W99 B;  3VH5 W;  3FC7 A;  4KUK A;  3B6F C;  1F66 D;  4B88 A;  4GHI A;  5F99 D;  1YPR A;  4MN6 A;  2H5S A;  3VP3 A;  3KUY D;  4GHI B;  3VSK A;  1H3Q A;  2VV6 A;  3M6B A;  3PBQ A;  4NZ5 A;  1XGI A;  1HTA A;  1FSW A;  3WD2 A;  3ISG A;  3LO7 A;  2CV5 C;  5E5A A;  4EO5 C;  1IOU A;  1ID3 A;  2XGN A;  2Y2O A;  5E5A B;  2OSU A;  4HBU A;  5AV6 D;  2K2N A;  4EBP A;  1ID3 B;  3MBZ A;  4HP4 A;  2ZQ7 A;  1ESI A;  4XZQ D;  3B0C T;  5MC7 A;  5CEC A;  2XSS A;  1S32 A;  2QJ5 A;  5AVC D;  1IEL A;  3NCK A;  4Y13 A;  4EER A;  2ZL1 B;  1PZO A;  4J8V D;  4Y17 A;  1S32 B;  3L7H A;  4Z5T C;  5IHV A;  3T4T A;  3IX3 A;  3L2A A;  2VEA A;  4YM6 A;  1MBL A;  4HGA B;  4JBF A;  3UE6 A;  4QLC A;  1W1Y A;  3BRM A;  4I3A A;  4YM6 B;  3C1C C;  4QLC B;  4X1L A;  5CED A;  4X23 C;  2VK3 A;  1XJ4 A;  3LEQ A;  1LL9 A;  5AV9 A;  4HHD A;  3FDD A;  4HMD A;  1P3L A;  1P3P C;  1P3O C;  4KUD B;  2NZD D;  3W99 C;  1XPB A;  3C8C A;  4NXE A;  5AV9 B;  4JXW A;  2F2A C;  1P3L B;  1E25 A;  3O88 A;  3X1T A;  1KX4 A;  3SH7 A;  5CPJ A;  1W63 Q;  5HW3 A;  1KS0 A;  3B42 A;  3JPU A;  3G34 A;  3X1T B;  1KX4 B;  4OH0 A;  2ARO D;  1CEG A;  4KG5 A;  5CPJ B;  2VJW A;  1CEF A;  1XX2 A;  4Z66 D;  3MFX A;  3VFH A;  3HLB A;  3L9K A;  2NQB D;  4LRX C;  3WD1 A;  2HJ9 C;  5TBM A;  2J7V A;  1ESU A;  5AV5 D;  2W1R A;  3MVD D;  4EEP A;  5E5A C;  2QKP A;  2MJ6 A;  1ID3 C;  3MGQ A;  3REJ A;  2HDR A;  4ARZ B;  4WJ3 C;  4EUV A;  5A8B A;  4J8U D;  3ZHH A;  4CJN A;  4BLM A;  3MGR D;  3MGQ B;  3REJ B;  4IBK A;  4PM8 A;  4X55 A;  3FG8 A;  4H9O B;  1E6N A;  4E3K A;  1S32 C;  5AVF A;  3ITA A;  4GOG A;  5B0Y D;  5DTT A;  4DRT A;  4XT2 A;  5G18 A;  1MWS A;  2LB5 A;  2DF4 C;  3DBA A;  4R8P D;  1KGF A;  1E6P A;  1K38 A;  3KO6 A;  5FAQ A;  3VFF A;  4XT2 B;  1PI5 A;  3MKE A;  5HDS A;  4YM6 C;  5HPF A;  2JKR M;  5B33 A;  5EVL A;  4QLC C;  3CIT A;  5I5L A;  1TD5 A;  5B2J D;  4L0L A;  3AV2 A;  3G30 A;  1NYY A;  3BLM A;  4R6L A;  3MNN A;  1P34 A;  3WAA A;  4KUD C;  1XP4 A;  4ETX A;  5AV9 C;  2B95 A;  3AV2 B;  2J80 A;  3MNN B;  3NBL A;  1P3L C;  4Z2K A;  1P34 B;  5CTN A;  3WAA B;  1BLS A;  5DF9 A;  3V39 A;  3O62 A;  3X1T C;  2X71 A;  5E43 A;  1KX4 C;  3LZ1 A;  4GD8 A;  5CPJ C;  4DQY B;  4DN0 A;  1GPF A;  3O62 B;  2GDN A;  2JKF A;  2ZC6 B;  3W4Q A;  3LZ1 B;  3A1K A;  5IS1 A;  4KZ9 A;  1ES2 A;  2ZY4 A;  3LUQ A;  2ZMV A;  2ZQD A;  2RCX A;  4QB8 A;  2KDK A;  4HQA A;  5B32 D;  1MWR A;  3Q81 A;  4EWF A;  2OOL A;  3B3X A;  4X69 A;  3W96 D;  4IED A;  3T50 A;  1MKM A;  1JVJ A;  3MGQ C;  3REJ C;  1BYW A;  3TW8 A;  2PRF A;  4IVK A;  1A7W A;  1W63 M;  3MQQ A;  4GKU A;  5B40 B;  4AFI A;  4O7D A;  1H8Y A;  2HIO A;  5DNM B;  3TSG A;  3OZH A;  4I3I A;  5DKL A;  3AZK A;  4OPZ A;  5KSH A;  3NDE A;  3G4P A;  2HIO B;  5GHZ A;  4EQI A;  4H9Q A;  3KXB A;  1LSV A;  4DJ3 A;  1AWI A;  3MQL A;  1CI9 A;  1W2E A;  3WA9 A;  3A3E A;  2VA0 A;  4H9Q B;  4GJ4 A;  3KXB B;  4HNB A;  3L28 A;  5B33 C;  1OGG A;  4S2N A;  1TDG A;  1XA7 A;  3QNC A;  3WA9 B;  1FIL A;  4DXC A;  3HSH A;  4DRA A;  1W7F A;  3B0B A;  1TS8 A;  3AV2 C;  4JGR A;  3LFV A;  3MNN C;  1P34 C;  3WAA C;  3IXB A;  2W3F A;  4LV1 A;  4J8X A;  3C7V A;  1P3M A;  3TRC A;  3KSY A;  3H0R C;  3PBR A;  5TJJ A;  3B6G D;  3V5M A;  3KX0 X;  3LI8 A;  1NZU A;  1T19 A;  4J8X B;  1P3M B;  3O62 C;  3CMZ A;  4BEN A;  4NZ4 A;  2EA9 A;  2NUT C;  3LZ1 C;  1S6R A;  4Z2H A;  4FD8 A;  4Z2M H;  4B4Z A;  4ZJ3 A;  2FJ7 D;  1CK7 A;  3Q7V A;  5FDS A;  2BTF P;  2BYK B;  5GT0 D;  2WKI A;  3Q7V B;  4Z2L A;  2V1B A;  2R9X A;  3HJK A;  3OCN A;  5FA7 A;  3LEL D;  1L0G A;  3X1S D;  4ME4 A;  2R78 A;  1U35 D;  2XLN A;  1I2S A;  2HDS A;  3H0M C;  5DNM C;  3UTA A;  2IWD A;  2HDU A;  4WZ5 A;  1KVL A;  4JXS A;  4OPQ A;  1E6R A;  4PKY A;  5FI6 A;  1YU1 A;  2HIO C;  3UTA B;  2XR0 A;  2BYM A;  3AZK C;  2GX5 A;  3NJA A;  2QMI A;  3CJM A;  1MKI A;  1N1J A;  2BYM B;  3KXB C;  3R4K A;  2J3T C;  3WA9 C;  3O87 A;  1N1J B;  4KG2 A;  1TZY A;  4KZ5 A;  2WKE A;  3LID A;  2B5R A;  4S2N C;  3VP4 A;  4EXO A;  1EQZ D;  1P3B D;  2ZQ9 A;  3BQA A;  5EOE A;  1W1V A;  4IBE A;  4BBU A;  2PBY A;  3HLE A;  4KGC B;  5GLD A;  1PWG A;  5FQ9 A;  2F8N A;  4G3W A;  4E3N A;  5BPV A;  3UY6 A;  2ZM8 A;  2ACG A;  4J8X C;  1W1T A;  4HH2 A;  1P3M C;  4ID4 A;  3D72 A;  1I5Q A;  5L10 A;  4N1X A;  4MBH A;  2Y91 A;  4ETZ A;  3NOT C;  3MS6 A;  2RTS A;  3SZT A;  2RVQ C;  4Q8I A;  4EBL A;  3LIE A;  4LEN A;  1HQ3 D;  5HAI A;  4JPM A;  2RIQ A;  1MY8 A;  1SDE A;  2G2U A;  2IWC A;  4GH9 A;  3N8S A;  1WWS A;  2J3W A;  3IH9 A;  3V50 A;  3V3R A;  1YU0 A;  5FDH A;  2ZMA A;  2M7U A;  2HGV A;  3REH D;  3F1N A;  1FR6 A;  2DNS A;  1ES4 A;  3UTA C;  3AZG D;  1P3G D;  1XFQ A;  5BOH A;  4OJO A;  4WZ5 C;  5CP6 A;  4CSR A;  3F1N B;  3UN7 A;  2FFF B;  3AGF A;  5HPI A;  3MGS D;  2Z6C A;  5CP6 B;  2KX6 A;  2WK0 A;  5AVE A;  3SH8 A;  3SW1 A;  1VB6 A;  4S2O A;  3G2Y A;  4LD9 A;  4K0W A;  2WGV A;  3WKJ D;  4WYY A;  1CF0 A;  4NET A;  4XUZ A;  3MGP D;  4LD9 B;  4KGC C;  3C1B A;  3S4X A;  2H0T A;  5CX7 A;  4NZ1 A;  1GSV A;  4Q0I A;  1PW1 A;  2O99 A;  2V2F F;  5EM1 A;  3MKF A;  3C1B B;  2ZY3 A;  3KWQ D;  2ZD8 A;  3UTB D;  2ZQC A;  4QU3 A;  1BUE A;  2VV7 A;  5F1F A;  1GA9 A;  3REK A;  1NZO A;  2HJE A;  3ZDJ A;  4U3T A;  2Y59 A;  5GLB A;  4OOY A;  3FPV A;  3REK B;  3VH6 W;  2J9O A;  3REI A;  4BL3 A;  3EPJ A;  1FR1 A;  3REL D;  5AQ9 A;  4WEK A;  3F1O A;  4WV4 B;  3REI B;  1NY0 A;  1W8Y A;  1PZR A;  4QPR A;  4UA7 A;  5B1L A;  3UME A;  3EG5 B;  5FQQ A;  4NE5 A;  3F1O B;  4UA9 A;  4MBF A;  4IHQ A;  1LL5 A;  5B1L B;  2W3E A;  3AZL D;  2ZY5 A;  4Z2M G;  4JXG A;  3OPH A;  5FAT A;  3ZG9 B;  3UPO A;  2Y2N A;  3CG5 A;  2Y2P A;  3MSH A;  4R0Q A;  3A6N D;  3E4Q A;  4GD6 A;  1FQG A;  3E2L A;  2XFT A;  4OQI A;  3AGD A;  1C3B A;  5FEF A;  5DF7 A;  4R3A A;  1L0D A;  5CP6 C;  2I9V A;  5F5Y A;  1HZO A;  5CTM A;  3LZ0 D;  3HJI A;  5CHJ A;  2A24 B;  3X1U D;  4H9P A;  4WNN B;  3LIF A;  3UB5 P;  3IHB A;  2Z6D A;  4LD9 C;  1B6W A;  3T12 B;  3GSG A;  3DTE A;  2X02 A;  1WYC A;  3VOZ A;  3DTI A;  4BD1 A;  4JJN A;  1ODV A;  1M1A A;  3C1B C;  2HV1 A;  3CPT A;  4FSF A;  1EW0 A;  4JJN B;  1M1A B;  3PBO A;  4WU9 A;  5CPI A;  3CPT B;  1DY6 A;  3REK C;  4I38 A;  1YLJ A;  3WRZ A;  3AZJ D;  4WU9 B;  5CPI B;  5E2E A;  4KHA A;  4QNL A;  4XUJ A;  4WMC D;  3TG9 A;  2PAV P;  3BEB A;  5B0Z A;  4NXB A;  3AZI D;  2INW A;  5GT3 A;  4QJG A;  3REI C;  2VV8 A;  4C3Q A;  1VM1 A;  3FYZ A;  4KHA B;  1S4S A;  4XUJ B;  4X68 A;  5B0Z B;  1JFI A;  1STZ A;  5GSU D;  5GT3 B;  4J8W A;  3F6T A;  5B1L C;  1JFI B;  4HI4 A;  4PPR A;  4S2L A;  4X25 A;  1D06 A;  3FV7 A;  3QP4 A;  1KGE A;  5F68 A;  4J8W B;  3KS4 A;  2PYO A;  2JC7 A;  2EFU A;  2ZC3 B;  3KS8 A;  4D60 A;  4M6B A;  3HRE A;  3QHY A;  3AV1 A;  1ALQ A;  4TX8 A;  3A0R A;  2PYO B;  1F9I A;  1P3I A;  5KIZ A;  3AV1 B;  4CLC B;  2ZY2 A;  2WAD A;  5JRG A;  1P3I B;  1M40 A;  2WAE A;  5FEG A;  1J3W A;  5B31 A;  2W1T A;  2K7S A;  1DJB A;  4IBI A;  5JRG B;  2Y2Q A;  5F82 A;  2WKP A;  5B31 B;  4IJE A;  5M18 A;  4LFU A;  3RJU A;  2VX8 A;  2W1T B;  4U0T A;  4B9O A;  1H8M A;  3GVB A;  3O5Y A;  4MN7 A;  3MJQ A;  1P97 A;  3C1C B;  3T1R A;  4NFT A;  1W8Q A;  3R7W A;  2WKQ A;  5KSC A;  3AZE D;  5J7E A;  4KUD D;  5JYP A;  5G49 A;  3RTY A;  5L2F A;  3HVF A;  4S2K A;  1TZY D;  4YS3 D;  3W98 D;  3BFC A;  3S7Q A;  4BWI A;  4JJN C;  1M1A C;  4OUI A;  1WWI A;  1P3P B;  5G49 B;  1YLY A;  4GN2 A;  5B1M A;  3K3D A;  4JF5 A;  1U60 A;  3BEC A;  2L5A A;  3VH5 A;  3M2K A;  4LPZ A;  5CPI C;  4WU9 C;  4RX3 A;  1F98 A;  4UPK A;  3BFE A;  5B1M B;  3HUN A;  4KG6 A;  3AZH A;  4EQ1 A;  1IKI A;  3NOU C;  3AZM D;  3VP2 A;  5FAP A;  1ERQ A;  3MMH A;  4XUJ C;  3G35 A;  1S4R A;  5B0Z C;  1AXB A;  1ES5 A;  4OKP A;  5GXQ A;  4GHL A;  2VLG A;  5GT3 C;  1K0K A;  1E4D A;  3LR5 A;  4DE2 A;  3IWI A;  4QHC A;  1J7M A;  1WYB A;  1YSP A;  3VP1 A;  5GXQ B;  2QHK A;  3TJZ C;  2O9A A;  4J8W C;  1E88 A;  3BW6 A;  3UT9 A;  1K54 A;  1HLU P;  2XD1 A;  3T4Q A;  1M18 A;  4FH2 A;  2PYO C;  1YLW A;  2JKT I;  3UT9 B;  2WZX A;  3QP6 A;  2J9P A;  2IA2 A;  3AV1 C;  1P3K D;  4CLC C;  4ZBE A;  1BUL A;  2ZM5 A;  3CWF A;  1M18 B;  3DWK A;  3PAE A;  1P3I C;  1KX3 D;  4ZJ1 A;  3X1V A;  5AY8 A;  3AZN A;  5JRG C;  3SS3 A;  3EPL A;  4UAA A;  5B31 C;  5L8M A;  5B2I D;  3X1V B;  3AYW A;  3AZN B;  4OQ0 A;  1KE0 A;  3W97 A;  1CXW A;  5EUA A;  2G5H C;  5DVA A;  3R45 A;  1P3A A;  1UR9 A;  3AYW B;  2K31 A;  3SS5 A;  3W97 B;  3NEC A;  3R45 B;  2PD8 A;  3P5J B;  1P3A B;  2PR6 A;  3AZF D;  1JWV A;  3GDI A;  4IBX A;  3DWZ A;  4Y0U A;  2XF3 A;  5FSR A;  3UPP A;  3A0V A;  1AOI A;  3CHW P;  1H8P A;  5KMW A;  5B1M C;  4BJP A;  3UDI A;  4DE1 A;  1AOI B;  5AQ7 A;  5AQA A;  3JVU A;  1JWP A;  4KZ6 A;  5B24 D;  1VET A;  1O6I A;  2ZMF A;  1NWZ A;  3MXQ A;  5GLC A;  4GNU A;  2HPB A;  4UQI M;  1FOF A;  5AV8 A;  3L27 A;  4UHU A;  3FKW A;  1T3U A;  3LJA D;  5GXQ C;  3UO9 A;  1F66 A;  2RL3 A;  1DP8 A;  1SZV A;  1KX5 D;  5AV8 B;  5TBM B;  5F99 A;  3G2Z A;  2O9B A;  2GJ3 A;  5HD3 A;  5EEC A;  3PBN A;  4Y2F A;  4PAU A;  1F66 B;  4E3J A;  3KUY A;  4WL9 A;  4N9K A;  5F99 B;  4BBV A;  2V1A A;  3FWL A;  3UT9 C;  1K54 C;  5A90 A;  3KUY B;  1M6K A;  5B40 D;  3EGX C;  2HF6 A;  2L0W A;  3DTK A;  4KZA A;  4H9S A;  4C75 A;  1M18 C;  1E8B A;  3T1Q B;  2OAQ 1;  5DNM D;  5EFW A;  1XA1 A;  3C5A A;  1L3L A;  5EE8 A;  4G91 B;  1F2K A;  5AV6 A;  4R4S A;  1RGY A;  3X1V C;  5AY8 C;  1JWZ A;  1ACF A;  1W79 A;  3AZN C;  1O7E A;  3Q82 A;  2OV5 A;  2QJ7 A;  5AV6 B;  4XZQ A;  4AWL C;  3AN2 D;  2VQR A;  4ZUX D;  2DCF A;  3S7N A;  3WD3 A;  1GXD A;  1WE4 A;  5AVC A;  3AYW C;  4FOF A;  3W97 C;  2O9C A;  4J8V A;  5B33 B;  5FQJ A;  5AVC B;  1P3A C;  4X6T A;  3W8K A;  1BH8 A;  4QD4 A;  4R3B A;  2P74 A;  4J8V B;  1YLP A;  4YNR A;  4WUJ A;  4OQH A;  4DE0 A;  2VGK A;  1TF1 A;  1AOI C;  5CPK D;  3GMW A;  2HDQ A;  4L9F A;  3U2A A;  5E2F A;  4WU8 D;  4L9E A;  1ERM A;  1H5X A;  3BM6 A;  2Y2H A;  4UA6 A;  2F8N K;  2NZD A;  4FTX A;  1NRJ A;  3T4K A;  1MWU A;  1FSY A;  3KFU G;  1PYY A;  5AV8 C;  3C4P A;  2NZD B;  2JSS A;  4QY6 A;  5HDD A;  2PHY A;  1NYM A;  1F66 C;  1K56 D;  3PHY A;  3C2W A;  5F99 C;  2ARO A;  4LV0 A;  2WAF A;  4X53 A;  4Z66 A;  2EWW A;  1TS6 A;  3KUY C;  2WGW A;  2NQB A;  1I2W A;  2ARO B;  1KDW A;  2D49 A;  4Z66 B;  4Y15 A;  2PYR A;  1P3F D;  5AV5 A;  4KZ8 A;  2JN7 A;  2WGW B;  2E8J A;  2NQB B;  2PBD P;  4I39 A;  4WBG A;  4H9S C;  3MVD A;  1V9Z A;  3UB7 A;  4G91 C;  5AV5 B;  3P98 A;  4B93 A;  3L29 A;  2KLI A;  2V0W A;  4GHA A;  3MVD B;  5AV6 C;  3AZK B;  4IJG A;  4UQI S;  4J8U A;  2IO5 B;  1UR8 A;  3KSG A;  4WZS B;  3OPP A;  3MGR A;  5AQB A;  1T18 A;  4J8U B;  1IYQ A;  5AVC C;  5B0Y A;  3CZD A;  4UUZ A;  4I5S A;  4KGC D;  4J8V C;  2DQN C;  3E4O A;  3GRJ A;  1M19 D;  4R8P A;  5B0Y B;  1BH9 A;  4LGW A;  3E0Y A;  4UUZ B;  2EXA A;  3DAV A;  1SKF A;  1OTI A;  3HLW A;  4Q0J A;  3VH5 T;  4R8P B;  3NC8 A;  1OGB A;  1BH9 B;  3EQU A;  2PD7 A;  5DKK A;  2WKR A;  5AVB D;  4NXG A;  2ZOI A;  4NK3 A;  5B2J A;  1YMX A;  2H0Y A;  3HCY A;  3JVV A;  2ZQA A;  5F6A A;  5CXW A;  5L07 A;  1GHP A;  4DDY A;  2CMN A;  3UMD A;  5B2J B;  3AGE A;  1T1A A;  5HD5 A;  3BQ8 A;  4UEY A;  1FCM A;  2NZD C;  4Y5F A;  1ZHH B;  2ZC5 B;  3V67 A;  3IT9 A;  2Y4A A;  5DFX A;  3PBS A;  4M4X A;  1N9B A;  5BO0 A;  3A3J A;  4E3M A;  3SH9 A;  4EV4 A;  3T4S A;  2ZM0 A;  3LGO A;  3QP1 A;  2ARO C;  1E3U D;  3MQ0 A;  5BO0 B;  4Z66 C;  2WYX A;  2NQB C;  4R3J A;  2VZW A;  2YKF A;  3B33 A;  4H9R A;  5AV5 C;  1P9W A;  1RCJ A;  3GTC A;  1OTB A;  5B32 A;  3MVD C;  4YWZ A;  1ZLA D;  4H9R B;  3IH8 A;  1D7E A;  3W96 A;  1DP9 A;  3IF6 A;  4R70 A;  4WZ4 A;  4ESP A;  4N9L A;  5B32 B;  2IO5 C;  3A1I A;  4DE3 A;  4E3L A;  4Y0T A;  3W96 B;  3C4O A;  3IF6 B;  3CLO A;  3V9R A;  4J8U C;  4ZBJ B;  1LI0 A;  4MN5 A;  5DNN D;  4LCM A;  3MGR C;  3WS4 A;  4KQQ A;  3V9R B;  3A3F A;  1CQA A;  3KYQ A;  2QZ6 A;  5B0Y C;  1GSX A;  3W4P A;  3ITB A;  2Y2K A;  4R8P C;  5FAS A;  1VHM A;  1QMF A;  2HP5 A;  2NUP C;  2F8N B;  3LCE A;  1LSW A;  4P85 A;  5HAP A;  4KZ4 A;  5TGF A;  5B2J C;  2DRW A;  4OQG A;  2WUQ A;  4Z2J A;  4GW9 A;  1R4V A;  2FFY A;  4GDN A;  3WRT A;  2Y2M A;  2OLV A;  3F1P A;  4ZRR A;  2V9A A;  3B6G A;  3EGD C;  4KZ7 A;  1K4F A;  3JYI A;  2EX9 A;  5A91 A;  3B6G B;  1K55 A;  1S1Z A;  4HEF A;  4P87 A;  1X0O A;  4YIN A;  1L6J A;  1VQQ A;  1YAX A;  3PAG A;  1KE4 A;  4PM6 A;  2UV0 E;  2EX8 A;  1PDC A;  2FJ7 A;  5KDM A;  1NXY A;  3QP2 A;  3KYE A;  3NDG A;  5IT5 A;  3UDX A;  3TU4 D;  5GT0 A;  2FJ7 B;  2LB9 A;  5KDM B;  3BFG A;  4S2P A;  2FZ0 A;  5GT0 B;  4OLD A;  3UB9 A;  1XJ3 A;  5B32 C;  3ZFZ A;  5EVI D;  3NOP C;  5HFO A;  3LEL A;  2Y79 A;  3X1S A;  4HY8 A;  3W96 C;  3IF6 C;  4ZBJ C;  4CSR B;  1U35 A;  2VKS A;  3LEL B;  3AFA D;  1OT6 A;  2P9V A;  1S66 L;  3X1S B;  3B0C W;  1CK3 A;  1U35 B;  4IBC A;  2P04 A;  4PM7 A;  2P9V B;  2YKH A;  3QP8 A;  4OP8 A;  4K91 A;  4XUX A;  3IWO A;  3ZG0 A;  4QY5 A;  3HUM A;  5BT1 D;  2IOU A;  2H10 A;  4MCW A;  1SCW A;  4OON A;  1FIK A;  1JTG A;  3B6F D;  3D4F A;  4H6J A;  3G32 A;  1TAF A;  4OJL A;  3E4P A;  2XRO A;  3OCL A;  1EQZ A;  1P3B A;  4H6J B;  1TAF B;  2A2L A;  3VH6 A;  1EQZ B;  1P3B B;  1LL8 A;  1F1E A;  3A0S A;  2CV5 D;  4CLC E;  5KZH A;  3B6G C;  1DJC A;  4WM9 A;  2WGI A;  3WS0 A;  4MMN A;  3IHA A;  2Y8H A;  1ZG6 A;  1OTE A;  5CEB A;  1K55 C;  3SS4 A;  5M1A A;  4KQR A;  3MF0 A;  3DTM A;  5DTS A;  2FJ7 C;  3MZD A;  3VE4 A;  2OLU A;  4CLC D;  5CHM A;  1YLT A;  5GT0 C;  2V0U A;  2D01 A;  4RVA A;  5FQK A;  1HQ3 A;  4LRZ E;  5FUG A;  2XD5 A;  1S0W A;  3GEC A;  3OOV A;  4Z5T D;  1OTA A;  4IBF A;  2F8N H;  5G4Y A;  3WS2 A;  1HQ3 B;  3LEZ A;  3LEL C;  5FUG B;  1S1Y A;  1T1B A;  2W3G A;  3X1S C;  1ES3 A;  1Z09 A;  4CPK A;  3ZNY A;  3UDF A;  1U35 C;  3LY3 A;  3EQV A;  2KOI A;  4JGQ A;  1GHI A;  3C1C D;  3NY4 A;  3REH A;  3UPN A;  3HLD A;  3AZG A;  1P3G A;  2G5I C;  4X23 D;  3P09 A;  2HP6 A;  4IBR A;  5K5B A;  3LIB A;  4H9P B;  2XRN A;  3CUE A;  3LYX A;  1Q9C A;  1GA0 A;  4GB7 A;  3AZG B;  3MGS A;  1PWC A;  1P3P D;  1P3O D;  3W99 D;  4RA7 A;  3MGS B;  3ZNT A;  5LBR A;  1OTD A;  1YQS A;  2JCH A;  1MC0 A;  3WKJ A;  2EWV A;  3MGP A;  4GZB A;  1QME A;  3MXS A;  1EQZ C;  1P3B C;  2WZZ A;  2A3U A;  5HWT A;  2CWE A;  3MGP B;  1W5D A;  3KWQ A;  3UTB A;  3NI9 A;  3T4O A;  2Y2G A;  3BFD A;  3P01 A;  1L2S A;  3KWQ B;  5E5A D;  3UTB B;  4Z2G A;  3WTP A;  1ID3 D;  1MWT A;  1VEU A;  4Y3I A;  1IYP A;  5TFQ A;  1EWZ A;  3WD4 A;  3H7W A;  4HP9 A;  3ZVW A;  4Q0H A;  3WTP B;  3REL A;  3BY9 A;  1VEU B;  3BLS A;  3H7W B;  5GHX A;  3K3C A;  3REL B;  1S32 D;  1ZTU A;  3OPL A;  2Y2J A;  1JTD A;  3S7O A;  3N3F A;  2Z2L B;  1FCO A;  1OJ5 A;  1HQ3 C;  3BY8 A;  4S2I A;  3AZL A;  3W4O A;  1SDN A;  4PMA A;  3ZYT A;  3Q07 A;  3AZL B;  4YM6 D;  5FQM A;  4QLC D;  3A6N A;  4F3L A;  3N6I A;  4H8R A;  3REH C;  3QP5 A;  1P3A D;  4HME A;  3AZG C;  1P3G C;  3UNW A;  3SOI A;  2H28 A;  4F3L B;  1SHV A;  3IWQ A;  3CUE C;  5AV9 D;  3MR0 A;  2B02 A;  3GV9 A;  1RP5 A;  3R7W B;  1GCE A;  1P3L D;  3LZ0 A;  3MGS C;  2Y55 A;  3X1U A;  3OPR A;  1XXM A;  2Q0O A;  3LZ0 B;  3LR3 A;  1ERO A;  3X1T D;  1KX4 D;  3X1U B;  1W1P A;  1MPL A;  5CPJ D;  1KVM A;  1UWP X;  4EBN A;  3O86 A;  2AVX A;  1GOI A;  2Z2M B;  4HH3 A;  3MGP C;  1PNE A;  3N4I A;  1NRF A;  3AZH B;  1K4E A;  1Y4O A;  4P6Z S;  4PM5 A;  3G6O A;  3KWQ C;  3UTB C;  3W2Z A;  3H9W A;  2W3H A;  3EEH A;  1LT0 A;  4IBG A;  3PYP A;  3AZJ A;  4F94 A;  4DKI A;  3ZG5 A;  5A92 A;  1O07 A;  4MBK A;  4WMC A;  3WTP C;  2ZOH A;  4EU0 A;  3AZI A;  3AZJ B;  1E15 A;  3MGQ D;  3REJ D;  1F5M A;  1FCN A;  5JYO A;  4OJ5 A;  3REL C;  1H0I A;  4DXB A;  5GSU A;  3AZI B;  2V5O A;  1ONH A;  4FUW A;  5B32 G;  3NQJ A;  3E2K A;  4PKY G;  5M19 A;  3KYZ A;  1ULY A;  3A3D A;  2W8S A;  3IS2 A;  2EFX A;  4HIA A;  5GSU B;  1L0E A;  5F69 A;  4S2J A;  4G92 B;  3NQJ B;  4D2O A;  2ZC7 A;  3IS2 B;  4GS9 A;  4O0P A;  3AZL C;  4KZB A;  3T4J A;  5AY8 B;  3IXH A;  1RGZ A;  4GS9 B;  1B67 A;  4AWL B;  1Y54 A;  2ZL1 A;  1BLP A;  5B33 D;  5C3I C;  4G3K A;  4JF4 A;  3A6N C;  4HBT A;  5J8X A;  2JKT M;  3IF5 A;  3AV2 D;  1LHY A;  3MNN D;  1XJ6 A;  2F8N G;  1P34 D;  3WAA D;  3C7U A;  2G2W A;  3MXR A;  5EV0 A;  2FH5 A;  2P7J A;  5DJU A;  4ZDX A;  3LZ0 C;  2FN2 A;  2QWS A;  4JLF A;  1YMS A;  3X1U C;  1IYS A;  2O0Y A;  4E04 A;  1PW8 A;  3O62 D;  3LR0 A;  3VH6 T;  3AZE A;  3LZ1 D;  3Q7Z A;  4KUD A;  3AZH C;  5EM0 A;  3B47 A;  4R23 A;  4YS3 A;  3W98 A; 
#chains in the Genus database with same CATH homology
 3AZE B;  1EI5 A;  4OPR A;  3HLC A;  1TZY B;  4YS3 B;  3W98 B;  4H9N A;  4IBJ A;  4H9N B;  4E6W A;  3AZJ C;  3AZM A;  3FKV A;  4IJF A;  2QPN A;  3AZI C;  1H8Z A;  4NE3 A;  3AZM B;  4BD0 A;  1PI4 A;  4NZ3 A;  5GSU C;  4G92 C;  2HIO D;  3B0D B;  2ZC4 B;  3AZK D;  1J9M A;  1HD8 A;  1IKG A;  4LV3 A;  4IBD A;  4BL2 A;  2LY8 A;  4NYY A;  3EPH A;  3ZCZ A;  4H9O A;  3KXB D;  1P3K A;  3WA9 D;  2VGJ A;  3VSL A;  4XZQ B;  3HUO A;  4KZ3 A;  5I94 A;  2PU2 A;  3H0L C;  1P3K B;  3N7W A;  1KX3 A;  4E3O A;  1YT4 A;  3S1Y A;  2EXB A;  1K57 A;  4U0X A;  4JXV A;  1KX3 B;  1PIO A;  4HGA C;  5B2I A;  1G68 A;  1BH8 B;  1BT5 A;  4J8X D;  4B4X A;  1P3M D;  5B2I B;  2Q9M A;  4C6Y A;  5FAO A;  3ZGA B;  5FQI A;  2EX6 A;  3AZE C;  3AZF A;  5EPH A;  3IXG A;  1TZY C;  4YS3 C;  3W98 C;  3FKE A;  5EOO A;  2RVQ D;  3AZF B;  2J8Y A;  4R1G A;  4OJ6 A;  2JE5 A;  5GHY A;  4Y0O A;  2V20 A;  4OVD A;  2HP9 A;  5B24 A;  3TOI A;  3VMA A;  2PU4 A;  1KDS A;  3AZM C;  5B24 B;  1KU5 A;  3LJA A;  1Z6F A;  1Q2Q A;  1KX5 A;  3UTA D;  3B0D C;  1GHM A;  1YU2 A;  3LJA B;  1KX5 B;  1ZG4 A;  4YFM A;  4ZJ2 A;  5B40 A;  4XZQ C;  5DNM A;  1P3K C;  4LCL A;  2HUE B;  3WS1 A;  3MGR B;  1YUE A;  1XGJ A;  1KX3 C;  2YFV A;  4OOM A;  1K57 C;  1KGG A;  3AN2 A;  4ZUX A;  5GL9 A;  4MNR A;  2F8N D;  2YFV B;  5B2I C;  4BQM A;  3ZVT A;  3HBR A;  3AN2 B;  4ZUX B;  1HTZ A;  4MEZ A;  5BNV A;  3N8L A;  3VP0 A;  5CGX A;  5BNV B;  2BG1 A;  2ZQ8 A;  3AZF C;  3S22 A;  1XKZ A;  3GR2 A;  4E44 A;  4PM9 A;  1IEM A;  3HLG A;  5CPK A;  4A5R A;  4WU8 A;  3NQU A;  5CPK B;  5BS7 A;  3EPK A;  1K25 A;  4MLL A;  5B24 C;  3HLF A;  4WU8 B;  5HAR A;  2BYK A;  3NQU B;  4KEN B;  5BNX A;  1YM1 A;  2EX2 A;  3LJA C;  5BNX B;  2X01 A;  1K56 A;  2XK1 A;  1KX5 C;  3MZF A;  5B31 G;  5CP6 D;  4KQO A;  3ZG7 B;  5A93 A;  2XQZ A;  1TEM A;  1P3F A;  3PTE A;  4P6B A;  3UE3 A;  4M3K A;  5B40 C;  2HUE C;  1P3F B;  4LD9 D;  4RYE A;  1N4O A;  2BLS A;  1ZKJ A;  1HVB A;  1MXO A;  1DJA A;  3GQZ A;  3C1B D;  4P0M A;  5FI7 A;  4WEJ A;  3OC2 A;  4DF6 A;  3BFF A;  3AL0 C;  3AN2 C;  4ZUX C;  2CC1 A;  3REK D;  2ZJ9 A;  3A3I A;  2R9W A;  2WKH A;  4KGC A;  1M19 A;  3WX7 A;  4XXR A;  3REI D;  5CGS A;  4X56 A;  1M19 B;  1NJ4 A;  3UE0 A;  5AVB A;  1ZC2 A;  3M2J A;  5B1L D;  3IQA A;  5CPK C;  4JKT A;  5AVB B;  4WEL A;  1L0F A;  2C5W B;  4LV2 A;  5HX9 A;  2Y2L A;  3L25 A;  4WU8 C;  1Q2P A;  1TVF A;  5BS7 C;  2V1Z A;  3V3S A;  1YU3 A;  2C6W B;  1YLZ A;  1BLH A;  4EUZ A;  4Y7P A;  1ONG A;  2XFS A;  4RX2 A;  3HL9 A;  1E3U A;  1BFM A;  3QNB A;  3RXW A;  2ZLY A;  4OOL A;  1G6A A;  5FI2 A;  4N92 A;  1P3F C;  1CI8 A;  3G31 A;  1BLC A;  3UE1 A;  1ZLA A;  3O3V A;  5CGW A;  2Y2I A;  4JJN D;  1M1A D;  2UWX A;  1ZLA B;  5DF8 A;  4Z9Q A;  2Q9N A;  4DRB A;  5DNN A;  3DW0 A;  4WU9 D;  5CPI D;  5DNN B;  1K6R A;  3PBT A;  4OPY A;  5CHU A;  4E6X A;  4XUJ D;  3WTP E;  1M19 C;  5B0Z D;  2ZM2 A;  4NYU A;  1TDL A;  5GT3 D;  2I72 A;  3M6H A;  1K6S A;  5AVB C;  4J8W D;  3WTP D;  5D3O A;  2PYO D;  3IXD A;  4N1H A;  4ZTK A;  3AV1 D;  5F83 A;  2JBF A;  4IBB A;  2E8I A;  1P3I D;  3L26 A;  5CHL B;  4GDB A;  5JRG D;  1OME A;  4R4R A;  5DTK A;  5B31 D;  1BSG A;  3WS5 A;  4OP5 A;  4CAY A;  3TU4 A;  4E3I A;  4CAY B;  5GLA A;  3TU4 B;  1PWD A;  5E2G A;  3REH B;  5EVI A;  4FH4 A;  1P3G B;  2XH9 A;  1ZLA C;  5EVI B;  4WNN A;  3AFA A;  4JF6 A;  4DDS A;  5CRF A;  5HAQ A;  5B1M D;  5DNN C;  2XEP A;  3AFA B;  3N8R A;  3WKJ B;  3AZH D;  5CER A;  1BTL A;  4NY2 A;  3I7J A;  5GXQ D;  4FCF A;  1Z2C B;  3B6F A;  3BYD A;  4NE6 A;  3Q1F A;  3IP4 C;  3B6F B;  1YU4 A;  4K0X A;  5U47 A;  3UT9 D;  1LI9 A;  1IYO A;  5E2H A;  1M18 D;  2CV5 A;  3WWX A;  3NIA A;  5JA4 A;  4HES A;  2CV5 B;  3FZC A;  4EO5 B;  5F1G A;  1H3O A;  3RXX A;  3X1V D;  5AY8 D;  5JA4 B;  3AZN D;  4OJP A;  3MFD A;  1H3O B;  4LG2 A;  3AYW D;  3TU4 C;  3W97 D;  2YFW A;  5C3I B;  3A6N B;  4Z5T A;  3LY4 A;  3VOY A;  2J8P A;  2YFW B;  5EVI C;  4Z5T B;  4E45 A;  5TR7 A;  3C1C A;  1LLB A;  3AFA C;  1AOI D;  4X23 A;  4OLG A;  3HON A;  3WKJ C;  1PZP A;  4S2M A;  2XDM A;  4IVI A;  3MZE A;  2IWB A;  4X23 B;  1P3P A;  1P3O A;  4ZAM A;  3W99 A;  3ZG8 B;  2A49 A;  1BZA A;  5BT1 C;  5AV8 D;  1KE3 A;  1P3O B;  3W99 B;  3VH5 W;  3B6F C;  1F66 D;  4B88 A;  5F99 D;  2H5S A;  3VP3 A;  3KUY D;  3VSK A;  3M6B A;  3PBQ A;  4NZ5 A;  1XGI A;  1HTA A;  1FSW A;  3ISG A;  3LO7 A;  2CV5 C;  5E5A A;  4EO5 C;  1ID3 A;  2XGN A;  2Y2O A;  5E5A B;  2OSU A;  4HBU A;  5AV6 D;  4EBP A;  1ID3 B;  3MBZ A;  2ZQ7 A;  1ESI A;  4XZQ D;  3B0C T;  5CEC A;  1S32 A;  5AVC D;  1IEL A;  3NCK A;  1PZO A;  4J8V D;  1S32 B;  4Z5T C;  5IHV A;  3L2A A;  4YM6 A;  1MBL A;  4HGA B;  4JBF A;  4QLC A;  3BRM A;  4YM6 B;  3C1C C;  4QLC B;  5CED A;  4X23 C;  1LL9 A;  5AV9 A;  3FDD A;  1P3L A;  1P3P C;  1P3O C;  4KUD B;  2NZD D;  3W99 C;  1XPB A;  5AV9 B;  4JXW A;  2F2A C;  1P3L B;  1E25 A;  3O88 A;  3X1T A;  1KX4 A;  3SH7 A;  5CPJ A;  5HW3 A;  3G34 A;  3X1T B;  1KX4 B;  4OH0 A;  2ARO D;  1CEG A;  4KG5 A;  5CPJ B;  1CEF A;  1XX2 A;  4Z66 D;  3VFH A;  3HLB A;  2NQB D;  2J7V A;  1ESU A;  5AV5 D;  3MVD D;  5E5A C;  1ID3 C;  3MGQ A;  3REJ A;  2HDR A;  4WJ3 C;  4J8U D;  3ZHH A;  4CJN A;  4BLM A;  3MGR D;  3MGQ B;  3REJ B;  4IBK A;  4PM8 A;  4X55 A;  4H9O B;  4E3K A;  1S32 C;  3ITA A;  4GOG A;  5B0Y D;  5DTT A;  4DRT A;  5G18 A;  1MWS A;  2DF4 C;  4R8P D;  1KGF A;  1K38 A;  5FAQ A;  3VFF A;  1PI5 A;  3MKE A;  4YM6 C;  5B33 A;  5EVL A;  4QLC C;  5B2J D;  4L0L A;  3AV2 A;  3G30 A;  1NYY A;  3BLM A;  3MNN A;  1P34 A;  3WAA A;  4KUD C;  1XP4 A;  5AV9 C;  3AV2 B;  3MNN B;  3NBL A;  1P3L C;  1P34 B;  5CTN A;  3WAA B;  1BLS A;  5DF9 A;  3V39 A;  3O62 A;  3X1T C;  2X71 A;  5E43 A;  1KX4 C;  3LZ1 A;  4GD8 A;  5CPJ C;  4DQY B;  3O62 B;  2GDN A;  2ZC6 B;  3W4Q A;  3LZ1 B;  3A1K A;  4KZ9 A;  1ES2 A;  2ZY4 A;  2ZQD A;  2RCX A;  4QB8 A;  5B32 D;  1MWR A;  3Q81 A;  4EWF A;  3B3X A;  4X69 A;  3W96 D;  4IED A;  1JVJ A;  3MGQ C;  3REJ C;  4IVK A;  1A7W A;  4GKU A;  5B40 B;  4O7D A;  1H8Y A;  2HIO A;  5DNM B;  3TSG A;  3OZH A;  3AZK A;  4OPZ A;  5KSH A;  3NDE A;  3G4P A;  2HIO B;  5GHZ A;  4EQI A;  4H9Q A;  3KXB A;  1CI9 A;  1W2E A;  3WA9 A;  3A3E A;  4H9Q B;  3KXB B;  3L28 A;  5B33 C;  4S2N A;  1TDG A;  1XA7 A;  3QNC A;  3WA9 B;  4DXC A;  3HSH A;  4DRA A;  1W7F A;  3B0B A;  3AV2 C;  3MNN C;  1P34 C;  3WAA C;  3IXB A;  4LV1 A;  4J8X A;  3C7V A;  1P3M A;  3KSY A;  3H0R C;  3PBR A;  3B6G D;  3V5M A;  1NZU A;  4J8X B;  1P3M B;  3O62 C;  3CMZ A;  4BEN A;  4NZ4 A;  3LZ1 C;  1S6R A;  4FD8 A;  4Z2M H;  4B4Z A;  4ZJ3 A;  2FJ7 D;  3Q7V A;  2BYK B;  5GT0 D;  2WKI A;  3Q7V B;  2R9X A;  3OCN A;  5FA7 A;  3LEL D;  1L0G A;  3X1S D;  1U35 D;  2XLN A;  1I2S A;  2HDS A;  3H0M C;  5DNM C;  3UTA A;  2IWD A;  2HDU A;  4WZ5 A;  1KVL A;  4JXS A;  4OPQ A;  5FI6 A;  1YU1 A;  2HIO C;  3UTA B;  2XR0 A;  2BYM A;  3AZK C;  2QMI A;  3CJM A;  1MKI A;  1N1J A;  2BYM B;  3KXB C;  3WA9 C;  3O87 A;  1N1J B;  4KG2 A;  1TZY A;  4KZ5 A;  2WKE A;  2B5R A;  4S2N C;  3VP4 A;  1EQZ D;  1P3B D;  2ZQ9 A;  5EOE A;  4IBE A;  2PBY A;  3HLE A;  4KGC B;  5GLD A;  1PWG A;  5FQ9 A;  2F8N A;  4E3N A;  5BPV A;  3UY6 A;  2ZM8 A;  4J8X C;  1P3M C;  4ID4 A;  1I5Q A;  4N1X A;  4MBH A;  2Y91 A;  2RVQ C;  4Q8I A;  4EBL A;  4LEN A;  1HQ3 D;  5HAI A;  4JPM A;  2RIQ A;  1MY8 A;  1SDE A;  2G2U A;  2IWC A;  4GH9 A;  3N8S A;  1WWS A;  3IH9 A;  3V50 A;  3V3R A;  1YU0 A;  5FDH A;  2ZMA A;  3REH D;  1FR6 A;  2DNS A;  1ES4 A;  3UTA C;  3AZG D;  1P3G D;  5BOH A;  4OJO A;  4WZ5 C;  5CP6 A;  4CSR A;  3UN7 A;  2FFF B;  3AGF A;  3MGS D;  5CP6 B;  2WK0 A;  3SH8 A;  4S2O A;  3G2Y A;  4LD9 A;  4K0W A;  2WGV A;  3WKJ D;  4WYY A;  4NET A;  4XUZ A;  3MGP D;  4LD9 B;  4KGC C;  3C1B A;  3S4X A;  2H0T A;  4NZ1 A;  1PW1 A;  2V2F F;  3MKF A;  3C1B B;  2ZY3 A;  3KWQ D;  2ZD8 A;  3UTB D;  2ZQC A;  4QU3 A;  1BUE A;  5F1F A;  1GA9 A;  3REK A;  1NZO A;  3ZDJ A;  4U3T A;  2Y59 A;  5GLB A;  4OOY A;  3REK B;  3VH6 W;  2J9O A;  3REI A;  4BL3 A;  3EPJ A;  1FR1 A;  3REL D;  5AQ9 A;  4WEK A;  4WV4 B;  3REI B;  1NY0 A;  1W8Y A;  1PZR A;  4UA7 A;  5B1L A;  3EG5 B;  5FQQ A;  4NE5 A;  4UA9 A;  4MBF A;  1LL5 A;  5B1L B;  3AZL D;  2ZY5 A;  4Z2M G;  4JXG A;  3OPH A;  5FAT A;  3ZG9 B;  3UPO A;  2Y2N A;  3CG5 A;  2Y2P A;  4R0Q A;  3A6N D;  4GD6 A;  1FQG A;  3E2L A;  2XFT A;  4OQI A;  3AGD A;  1C3B A;  5DF7 A;  1L0D A;  5CP6 C;  1HZO A;  5CTM A;  3LZ0 D;  5CHJ A;  3X1U D;  4H9P A;  4WNN B;  3IHB A;  4LD9 C;  1B6W A;  3GSG A;  2X02 A;  1WYC A;  3VOZ A;  4BD1 A;  4JJN A;  1M1A A;  3C1B C;  4FSF A;  4JJN B;  1M1A B;  3PBO A;  4WU9 A;  5CPI A;  1DY6 A;  3REK C;  1YLJ A;  3WRZ A;  3AZJ D;  4WU9 B;  5CPI B;  5E2E A;  4KHA A;  4QNL A;  4XUJ A;  4WMC D;  3TG9 A;  3BEB A;  5B0Z A;  3AZI D;  5GT3 A;  4QJG A;  3REI C;  4C3Q A;  1VM1 A;  3FYZ A;  4KHA B;  4XUJ B;  4X68 A;  5B0Z B;  1JFI A;  5GSU D;  5GT3 B;  4J8W A;  3F6T A;  5B1L C;  1JFI B;  4PPR A;  4S2L A;  3FV7 A;  1KGE A;  4J8W B;  3KS4 A;  2PYO A;  2JC7 A;  2EFU A;  2ZC3 B;  3KS8 A;  4M6B A;  3HRE A;  3QHY A;  3AV1 A;  1ALQ A;  2PYO B;  1P3I A;  3AV1 B;  2ZY2 A;  2WAD A;  5JRG A;  1P3I B;  1M40 A;  2WAE A;  5B31 A;  1DJB A;  4IBI A;  5JRG B;  2Y2Q A;  5F82 A;  5B31 B;  4IJE A;  5M18 A;  3RJU A;  4U0T A;  3GVB A;  3C1C B;  4NFT A;  1W8Q A;  5KSC A;  3AZE D;  4KUD D;  5JYP A;  5G49 A;  5L2F A;  3HVF A;  4S2K A;  1TZY D;  4YS3 D;  3W98 D;  3BFC A;  4JJN C;  1M1A C;  4OUI A;  1WWI A;  1P3P B;  5G49 B;  1YLY A;  4GN2 A;  5B1M A;  4JF5 A;  1U60 A;  3BEC A;  2L5A A;  3VH5 A;  3M2K A;  5CPI C;  4WU9 C;  4RX3 A;  4UPK A;  3BFE A;  5B1M B;  3HUN A;  4KG6 A;  3AZH A;  1IKI A;  3AZM D;  3VP2 A;  5FAP A;  1ERQ A;  4XUJ C;  3G35 A;  5B0Z C;  1AXB A;  1ES5 A;  4OKP A;  5GXQ A;  4GHL A;  5GT3 C;  1E4D A;  4DE2 A;  3IWI A;  4QHC A;  3VP1 A;  1WYB A;  5GXQ B;  4J8W C;  3UT9 A;  1K54 A;  2XD1 A;  1M18 A;  4FH2 A;  2PYO C;  1YLW A;  3UT9 B;  2WZX A;  2J9P A;  3AV1 C;  1P3K D;  4ZBE A;  1BUL A;  2ZM5 A;  1M18 B;  3DWK A;  3PAE A;  1P3I C;  1KX3 D;  4ZJ1 A;  3X1V A;  5AY8 A;  3AZN A;  5JRG C;  3SS3 A;  3EPL A;  4UAA A;  5B31 C;  5B2I D;  3X1V B;  3AYW A;  3AZN B;  4OQ0 A;  1KE0 A;  3W97 A;  5EUA A;  2G5H C;  5DVA A;  3R45 A;  1P3A A;  3AYW B;  3SS5 A;  3W97 B;  3R45 B;  3P5J B;  1P3A B;  3AZF D;  1JWV A;  4IBX A;  3DWZ A;  4Y0U A;  2XF3 A;  5FSR A;  3UPP A;  1AOI A;  5KMW A;  5B1M C;  4BJP A;  3UDI A;  4DE1 A;  1AOI B;  5AQ7 A;  5AQA A;  1JWP A;  4KZ6 A;  5B24 D;  5GLC A;  4GNU A;  2HPB A;  1FOF A;  5AV8 A;  3L27 A;  4UHU A;  3FKW A;  1T3U A;  3LJA D;  5GXQ C;  3UO9 A;  1F66 A;  2RL3 A;  1KX5 D;  5AV8 B;  5F99 A;  3G2Z A;  5EEC A;  3PBN A;  1F66 B;  4E3J A;  3KUY A;  4N9K A;  5F99 B;  3FWL A;  3UT9 C;  1K54 C;  5A90 A;  3KUY B;  1M6K A;  5B40 D;  4KZA A;  5HL1 A;  4C75 A;  4H9S A;  1M18 C;  5DNM D;  1XA1 A;  3C5A A;  5EE8 A;  4G91 B;  5AV6 A;  4R4S A;  1RGY A;  3X1V C;  5AY8 C;  1JWZ A;  2OV5 A;  1W79 A;  3AZN C;  1O7E A;  3Q82 A;  5AV6 B;  4XZQ A;  4AWL C;  3AN2 D;  2VQR A;  4ZUX D;  2DCF A;  1WE4 A;  5AVC A;  3AYW C;  3W97 C;  4J8V A;  5B33 B;  5FQJ A;  5AVC B;  1P3A C;  4X6T A;  3W8K A;  1BH8 A;  4QD4 A;  4R3B A;  2P74 A;  4J8V B;  1YLP A;  4OQH A;  4DE0 A;  2VGK A;  1AOI C;  5CPK D;  3GMW A;  2HDQ A;  5E2F A;  4WU8 D;  1ERM A;  1H5X A;  3BM6 A;  2Y2H A;  4UA6 A;  2F8N K;  2NZD A;  1MWU A;  1FSY A;  3KFU G;  1PYY A;  5AV8 C;  3C4P A;  2NZD B;  2JSS A;  4QY6 A;  1NYM A;  1F66 C;  1K56 D;  5F99 C;  2ARO A;  4LV0 A;  2WAF A;  4X53 A;  4Z66 A;  3KUY C;  2WGW A;  2NQB A;  1I2W A;  2ARO B;  1KDW A;  4Z66 B;  1P3F D;  5AV5 A;  4KZ8 A;  2WGW B;  2NQB B;  4WBG A;  4H9S C;  3MVD A;  4G91 C;  5AV5 B;  3P98 A;  3L29 A;  4GHA A;  3MVD B;  5AV6 C;  3AZK B;  4J8U A;  2IO5 B;  4WZS B;  3OPP A;  3MGR A;  5AQB A;  4J8U B;  1IYQ A;  5AVC C;  5B0Y A;  3CZD A;  4UUZ A;  4KGC D;  4J8V C;  2DQN C;  3GRJ A;  1M19 D;  4R8P A;  5B0Y B;  1BH9 A;  4UUZ B;  2EXA A;  1SKF A;  3HLW A;  3VH5 T;  4R8P B;  3NC8 A;  1BH9 B;  3EQU A;  5AVB D;  4NK3 A;  5B2J A;  1YMX A;  2H0Y A;  2ZQA A;  5CXW A;  1GHP A;  4DDY A;  5B2J B;  3AGE A;  1FCM A;  2NZD C;  2ZC5 B;  3IT9 A;  2Y4A A;  3PBS A;  1N9B A;  5BO0 A;  3A3J A;  4E3M A;  3SH9 A;  4EV4 A;  2ZM0 A;  2ARO C;  1E3U D;  5BO0 B;  4Z66 C;  2WYX A;  2NQB C;  4R3J A;  4H9R A;  5AV5 C;  1RCJ A;  3GTC A;  5B32 A;  3MVD C;  1ZLA D;  4H9R B;  3IH8 A;  3W96 A;  3IF6 A;  4WZ4 A;  4N9L A;  5B32 B;  2IO5 C;  3A1I A;  4DE3 A;  4E3L A;  4Y0T A;  3W96 B;  3C4O A;  3IF6 B;  3V9R A;  4J8U C;  4ZBJ B;  1LI0 A;  5DNN D;  4LCM A;  3MGR C;  3WS4 A;  4KQQ A;  3V9R B;  3A3F A;  2QZ6 A;  5B0Y C;  3W4P A;  3ITB A;  2Y2K A;  4R8P C;  5FAS A;  1QMF A;  2HP5 A;  2F8N B;  3LCE A;  4P85 A;  5HAP A;  4KZ4 A;  5TGF A;  5B2J C;  2DRW A;  4OQG A;  2WUQ A;  1R4V A;  2FFY A;  4GDN A;  3WRT A;  2Y2M A;  2OLV A;  3B6G A;  4KZ7 A;  1K4F A;  3JYI A;  2EX9 A;  5A91 A;  3B6G B;  1K55 A;  4HEF A;  4P87 A;  4YIN A;  1VQQ A;  3PAG A;  1KE4 A;  4PM6 A;  2EX8 A;  2FJ7 A;  5KDM A;  1NXY A;  3NDG A;  3UDX A;  3TU4 D;  5GT0 A;  2FJ7 B;  5KDM B;  3BFG A;  4S2P A;  5GT0 B;  4OLD A;  5B32 C;  3ZFZ A;  5EVI D;  5HFO A;  3LEL A;  3X1S A;  3W96 C;  3IF6 C;  4ZBJ C;  4CSR B;  1U35 A;  3LEL B;  3AFA D;  2P9V A;  3X1S B;  3B0C W;  1CK3 A;  1U35 B;  4IBC A;  4PM7 A;  2P9V B;  4OP8 A;  4K91 A;  4XUX A;  3IWO A;  3ZG0 A;  4QY5 A;  3HUM A;  5BT1 D;  2IOU A;  2H10 A;  1SCW A;  4OON A;  1JTG A;  3B6F D;  3D4F A;  3G32 A;  1TAF A;  4OJL A;  3OCL A;  1EQZ A;  1P3B A;  1TAF B;  3VH6 A;  1EQZ B;  1P3B B;  1F1E A;  2CV5 D;  5KZH A;  3B6G C;  1DJC A;  4WM9 A;  2WGI A;  3WS0 A;  3IHA A;  1ZG6 A;  5CEB A;  1K55 C;  3SS4 A;  5M1A A;  4KQR A;  3DTM A;  5DTS A;  2FJ7 C;  3MZD A;  2OLU A;  5CHM A;  1YLT A;  5GT0 C;  4RVA A;  5FQK A;  1HQ3 A;  5FUG A;  2XD5 A;  1S0W A;  4Z5T D;  4IBF A;  2F8N H;  3WS2 A;  1HQ3 B;  3LEZ A;  3LEL C;  5FUG B;  3X1S C;  1ES3 A;  4CPK A;  3ZNY A;  3UDF A;  1U35 C;  3LY3 A;  3EQV A;  1GHI A;  3C1C D;  3NY4 A;  3REH A;  3UPN A;  3HLD A;  3AZG A;  1P3G A;  2G5I C;  4X23 D;  3P09 A;  2HP6 A;  4IBR A;  4H9P B;  1Q9C A;  1GA0 A;  4GB7 A;  3AZG B;  3MGS A;  1PWC A;  1P3P D;  1P3O D;  3W99 D;  4RA7 A;  3MGS B;  3ZNT A;  1YQS A;  2JCH A;  3WKJ A;  3MGP A;  4GZB A;  1QME A;  3MXS A;  1EQZ C;  1P3B C;  2WZZ A;  2A3U A;  2CWE A;  3MGP B;  1W5D A;  3KWQ A;  3UTB A;  3NI9 A;  2Y2G A;  3BFD A;  1L2S A;  3KWQ B;  5E5A D;  3UTB B;  3WTP A;  1ID3 D;  1MWT A;  5TFQ A;  1IYP A;  1EWZ A;  3ZVW A;  3WTP B;  3REL A;  3BLS A;  5GHX A;  3REL B;  1S32 D;  3OPL A;  2Y2J A;  1JTD A;  3N3F A;  2Z2L B;  1FCO A;  1HQ3 C;  4S2I A;  3W4O A;  3AZL A;  1SDN A;  4PMA A;  3Q07 A;  3AZL B;  4YM6 D;  5FQM A;  4QLC D;  3A6N A;  3N6I A;  4H8R A;  3REH C;  1P3A D;  3AZG C;  1P3G C;  3UNW A;  3SOI A;  1SHV A;  3IWQ A;  5AV9 D;  3GV9 A;  1RP5 A;  1GCE A;  1P3L D;  3LZ0 A;  3MGS C;  2Y55 A;  3X1U A;  3OPR A;  1XXM A;  3LZ0 B;  1ERO A;  3X1T D;  1KX4 D;  3X1U B;  1MPL A;  5CPJ D;  1KVM A;  4EBN A;  3O86 A;  2Z2M B;  3MGP C;  3N4I A;  1NRF A;  3AZH B;  1K4E A;  4PM5 A;  3KWQ C;  3UTB C;  4IBG A;  3AZJ A;  4F94 A;  4DKI A;  3ZG5 A;  5A92 A;  1O07 A;  4MBK A;  4WMC A;  3WTP C;  3AZI A;  3AZJ B;  3MGQ D;  3REJ D;  1FCN A;  5JYO A;  4OJ5 A;  3REL C;  4DXB A;  5GSU A;  3AZI B;  1ONH A;  5B32 G;  3NQJ A;  3E2K A;  5M19 A;  1ULY A;  3A3D A;  2W8S A;  2EFX A;  5GSU B;  1L0E A;  4S2J A;  4G92 B;  3NQJ B;  4D2O A;  2ZC7 A;  3AZL C;  4KZB A;  5AY8 B;  3IXH A;  1RGZ A;  1B67 A;  4AWL B;  1Y54 A;  1BLP A;  5B33 D;  5C3I C;  4JF4 A;  3A6N C;  4HBT A;  5J8X A;  3IF5 A;  3AV2 D;  1LHY A;  3MNN D;  2F8N G;  1P34 D;  3WAA D;  3C7U A;  2G2W A;  3MXR A;  4ZDX A;  3LZ0 C;  4JLF A;  1YMS A;  3X1U C;  1IYS A;  1PW8 A;  3O62 D;  3VH6 T;  3AZE A;  3LZ1 D;  3Q7Z A;  4KUD A;  3AZH C;  4R23 A;  4YS3 A;  3W98 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...