2Y2JA

Penicillin-binding protein 1b (pbp-1b) in complex with an alkyl boronate (za4)
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
488
structure length
470
Chain Sequence
ISEITYSDGTVIASISRDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTGQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Guided Design of Cell Wall Biosynthesis Inhibitors that Overcome Beta-Lactam Resistance in Staphylococcus Aureus (Mrsa).
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
molecule keywords PENICILLIN-BINDING PROTEIN 1B
total genus 159
structure length 470
sequence length 488
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2y2jA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2y2jA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2y2jA02
1L2SA 2Q9NA 4RVAA 3FZCA 1ES3A 5EVIB 2C5WB 3A3FA 4X68A 5HX9A 3BECA 3W4OA 4E3JA 2VGJA 4QU3A 1ES5A 3GV9A 1BT5A 4S2LA 5F82A 3QHYA 2V20A 5DF9A 5FAOA 2VGKA 4X55A 2BLSA 1YLTA 2C6WB 2XFSA 3ZNYA 5FDHA 4UAAA 1IELA 4DDYA 2EX2A 2J9OA 1ZG6A 3N6IA 1HZOA 3IH8A 3UY6A 1KGGA 3HUNA 5HAIA 2XR0A 3FKVA 4PMAA 1PWCA 5EVID 4WELA 3PBRA 3IHBA 4JXGA 5DVAA 4E6WA 2Y55A 3BFGA 1DJCA 1PYYA 1J9MA 4LV2A 2GDNA 2WADA 2XLNA 1LLBA 2EX6A 4OPRA 2H0TA 3MZEA 3IXDA 2PU2A 4S2OA 3MKFA 1IYOA 5E2GA 4N1XA 1BLSA 1JVJA 2WUQA 4BLMA 4BD1A 1SDEA 3IWIA 3HBRA 1SKFA 4S2NC 1U60A 4S2IA 2Y91A 5E43A 4F94A 2QZ6A 3UDFA 1LI0A 3PAGA 5CHMA 2IWBA 5EVIA 2XFTA 5M18A 3IXBA 3FWLA 4MNRA 3OCNA 3EQVA 3Q7VB 3Q7VA 5CGXA 4ZDXA 5FAQA 4QJGA 3WS5A 4DXCA 2ZC7A 2ZC6B 4EWFA 2Y2LA 4DE3A 4GDNA 3CJMA 4E3OA 3MBZA 3OPHA 4OQHA 3GR2A 4HESA 5KSHA 4DRTA 3WRZA 4JF6A 1GHMA 1KVMA 3V5MA 2OLUA 5CHJA 3G34A 3RXWA 4OH0A 3IWOA 3TG9A 3G2ZA 1CEGA 2FFYA 3M6BA 3WS1A 5A92A 4GD8A 4HBUA 3IXGA 3C7UA 1ZG4A 3HUOA 4Y0UA 1W5DA 4S2JA 2ZM8A 3NDEA 3HLBA 3N8LA 4M3KA 1GA9A 5U47A 4MBKA 5EE8A 5FQJA 1FCOA 1OMEA 4GN2A 3G4PA 2ZQ7A 3AGEA 1NYMA 2ZM0A 5HAQA 4RX2A 4KZ4A 2V2FF 3PAEA 3TOIA 2Y2HA 3DW0A 1H5XA 4X69A 3W4QA 1E4DA 3BFEA 1RP5A 4IBXA 3ZCZA 1K4EA 4Q8IA 3C7VA 1K54A 1S6RA 2HPBA 3FYZA 4XXRA 2Y2JA 2J8YA 2I72A 1VM1A 4WMCD 1S0WA 2G2WA 1DJAA 3WS4A 5GLDA 3CZDA 1ZC2A 1Q2QA 2OSUA 4X6TA 2WAEA 5J8XA 4IVIA 4OP8A 4JLFA 2HP6A 4R4RA 1LL9A 3LEZA 2XK1A 5GHXA 3HLDA 1MKIA 5CHUA 3BFCA 5F1GA 4E3NA 1BLHA 3P09A 4WZ5C 5HW3A 5FATA 3NI9A 3NC8A 2ZJ9A 3UPNA 1ONHA 1LL5A 4N1HA 5FQQA 4MEZA 1YT4A 5E2HA 4N92A 3VP4A 2HP5A 3OPLA 3ZG7B 3M6HA 3UPPA 3OC2A 3JYIA 4S2PA 3BEBA 5GHZA 3PBOA 2EX8A 3NDGA 4PM9A 5GLCA 3PBQA 3VP3A 3LCEA 5DTKA 3VP2A 4KG2A 2R9WA 4OVDA 4HEFA 3VP1A 3UE3A 3MXSA 3O87A 1K55A 3G31A 1RGZA 3ZG8B 4FSFA 1I2WA 1GA0A 2WGVA 4OOYA 1YMXA 3GSGA 2Q9MA 4DE1A 4EV4A 3A3IA 2WAFA 4KQRA 5DTSA 1LHYA 1NJ4A 3P98A 2HDSA 5HFOA 1JTGA 4DXBA 3BLMA 4R4SA 5FSRA 1XP4A 3PTEA 5EPHA 2Y2MA 1MY8A 3GRJA 5GL9A 2V1ZA 1RCJA 5CXWA 3ZHHA 1SDNA 3BLSA 3BYDA 1IKIA 4JF5A 2Y2GA 1MPLA 2XH9A 2ZQAA 2E8IA 4KZAA 1IKGA 1K38A 1VQQA 4ID4A 5IHVA 4A5RA 4BJPA 4BL2A 3UPOA 5EECA 3ZFZA 1K56D 4WMCA 1TDGA 1FOFA 1TVFA 3ZG0A 1DJBA 1G68A 4OQGA 5FQ9A 4YINA 3W8KA 1XPBA 4JXWA 4WM9A 4WZ5A 2XF3A 2CC1A 1JWPA 2WYXA 3AGFA 1FR1A 4JKTA 2Y2QA 4KZ6A 1NZOA 1XKZA 1JTDA 4GDBA 4E3LA 3SH9A 5FI7A 2WK0A 5CECA 3W4PA 3A3DA 4K0XA 1N9BA 1KGFA 2RCXA 1XA1A 3LY4A 3G32A 4UHUA 1CK3A 4WBGA 2Z2MB 2ZC5B 3TSGA 3S4XA 2ZQDA 3Q82A 2ZLYA 3WS0A 1XA7A 3OPPA 1ALQA 3G2YA 3ISGA 3UDXA 2H5SA 3N4IA 3O3VA 5HARA 5G18A 1EWZA 5FQMA 1YLYA 2G2UA 4EBPA 1BUEA 4L0LA 5DF8A 3Q1FA 1HVBA 2ZMAA 4KZ3A 1YM1A 1PWDA 3ZVTA 3NBLA 4R3JA 3M2KA 1GCEA 1WYCA 4E6XA 4OQ0A 1I2SA 1KE0A 3IQAA 2A49A 4KG5A 4X56A 5E2FA 2XQZA 5JYOA 3BFFA 1K4FA 4QD4A 3V39A 3SS5A 1K57C 4LV3A 2WGWB 4Z9QA 2DNSA 3QNCA 3N8RA 1AXBA 3IF5A 1Q2PA 1PW8A 4KZ8A 4LV0A 4NETA 3BRMA 3C5AA 3HLFA 3SH7A 5FQKA 3UE0A 4ZTKA 1K6SA 4OPYA 1W7FA 4U0XA 3VFFA 1E3UD 3RXXA 1ESIA 3HLCA 3HVFA 2XGNA 1ESUA 4LCLA 3VFHA 5GHYA 4WEKA 3Q07A 1L0DA 3LY3A 4K0WA 1H8YA 4RX3A 2EFUA 1MWUA 3PBTA 1K57A 4P85A 3ITBA 5A93A 1L0EA 3IWQA 2Y2IA 3E2LA 2J9PA 2DRWA 1NXYA 4Y7PA 5FQIA 3OZHA 3WS2A 4ZJ1A 4Y0TA 1KE3A 3EQUA 1W79A 3MKEA 2XD1A 5AQ7A 4ZBEA 3SS3A 4DE0A 3HL9A 3CG5A 1YLZA 3B3XA 4E3MA 3N8SA 5FAPA 2PU4A 4WEJA 4C75A 5CGWA 5FI2A 3NY4A 4JXVA 3AGDA 4UA6A 3HUMA 4KQQA 4WYYA 4OLDA 4IBRA 4OOMA 4JF4A 4PM6A 5GLBA 5HAPA 2EXBA 1IYSA 1FR6A 1M40A 2XD5A 2A3UA 5D3OA 3ZDJA 4PM7A 4QY6A 2WKEA 2P74A 1I5QA 4K91A 4XUXA 5BOHA 4QY5A 2WKHA 4FH4A 2EX9A 2RL3A 1PI5A 2ZD8A 3UE1A 3VSLA 2HP9A 1W8YA 2QMIA 4PM5A 5I94A 1Z6FA 2ZQ8A 4JPMA 1EI5A 4KG6A 1HD8A 4B4ZA 1BULA 2EFXA 3V3RA 1KDSA 2Y2OA 1FCNA 1W8QA 1IYPA 2XEPA 4OKPA 5DF7A 4ZJ2A 1NY0A 3MZDA 4JXSA 5FA7A 1GHIA 1NRFA 2Y2NA 4S2MA 3E2KA 2IWCA 3VP0A 3IT9A 1KE4A 3HLEA 1ZKJA 4GNUA 2IWDA 2P9VA 3C4OA 4R1GA 4S2NA 2X01A 1K55C 2WZZA 4ZJ3A 1PZPA 2J7VA 5EVIC 3UN7A 4GOGA 4OQIA 2JE5A 2P9VB 5GLAA 4CPKA 1M6KA 1YMSA 1E25A 3UO9A 4P87A 4FH2A 3N7WA 4D2OA 1CEFA 3GMWA 4P6BA 1ES4A 1IEMA 4MBFA 1YQSA 1H8ZA 5KMWA 1JWVA 3VOZA 3WRTA 5TFQA 4LCMA 2ZC3B 4HBTA 3NIAA 2WGIA 5F83A 3M2JA 1LI9A 4UA7A 3IF6C 1XGJA 3HREA 4DKIA 3LO7A 1L0GA 2HDQA 3Q7ZA 4B88A 3DWKA 4B4XA 3SOIA 4KENB 4UA9A 3GTCA 1MXOA 5E2EA 4QHCA 4OOLA 1BSGA 1MBLA 1YLPA 5FI6A 3VOYA 3ZNTA 1BZAA 1KDWA 3MFDA 2X02A 4PM8A 5CRFA 3ZG5A 4U3TA 5A91A 5M19A 1SCWA 2Y2KA 1CI9A 4KZ5A 5FASA 2QPNA 4RA7A 1WE4A 3SH8A 4BQMA 3WWXA 1K25A 3S22A 3RJUA 4QB8A 4RYEA 5TR7A 4GD6A 3IH9A 1WYBA 2ZM2A 2JBFA 2H0YA 3G35A 3UDIA 3MZFA 3PBNA 4X53A 4EBLA 1N4OA 5JYPA 4GKUA 4EBNA 2OLVA 1FSWA 1TEMA 2DCFA 1L0FA 4IVKA 4MLLA 3BFDA 1C3BA 1QMFA 2WZXA 3DWZA 1E3UA 4N9LA 2H10A 1IYQA 5HL1A 4BENA 1YLWA 1G6AA 1KGEA 5A90A 3I7JA 3A3EA 3GQZA 3Q81A 3UNWA 1FSYA 4E3IA 2UWXA 1MWSA 4OPZA 5EOEA 4PPRA 2BG1A 3PBSA 4U0TA 5CGSA 4Y0OA 1BLCA 2WGWA 4FD8A 1QMEA 2JC7A 1BTLA 3OCLA 2WKIA 4KZ9A 1NZUA 4R0QA 1XGIA 1XX2A 4JBFA 4DE2A 4LENA 4KZ7A 1GHPA 1PWGA 4GB7A 3S1YA 1K6RA 2EXAA 1TDLA 1PW1A 5CERA 4DDSA 4S2KA 3G30A 3IF6A 5DTTA 1JWZA 1K54C 1MWTA 5KZHA 1PIOA 5AQAA 5KSCA 4CJNA 3SS4A 5EVLA 1NYYA 4EQIA 4FCFA 1PI4A 4LV1A 2ZQCA 2OV5A 5CEDA 2JCHA 4YFMA 3C4PA 3NCKA 2Y59A 1RGYA 3O88A 3HLGA 5AQ9A 3ZG9B 2Z2LB 3CMZA 1FCMA 3ITAA 4WZ4A 2B5RA 4MBHA 1ONGA 1PZOA 5CTNA 3A3JA 5CEBA 4E3KA 4DF6A 1EROA 3VMAA 3ZGAB 3HLWA 4KQOA 1FQGA 3FKWA 1O7EA 5EOOA 2PBYA 4OPQA 2HDUA 1ERQA 2XDMA 1MWRA 1YLJA 5EUAA 4P0MA 3QNBA 3IXHA 4R23A 5CTMA 3V50A 2Y2PA 3V3SA 3VSKA 1K56A 4N9KA 2ZQ9A 3IHAA 1ERMA 4BL3A 1KVLA 1CI8A 1SHVA 4IEDA 1ES2A 3GVBA 5F1FA 3OPRA 1Y54A 1O07A 3D4FA 4OLGA 4H8RA 4R3BA 4ZAMA 2R9XA 3FV7A 3ZVWA 1XXMA 4C3QA 3IF6B 2HDRA 2FFFB 4OONA 3MXRA 3BM6A 4NK3A 5AQBA 3DTMA 4OP5A 4XUZA 4C6YA 4BD0A 1DY6A 5M1AA 5TGFA 1BLPA 2ZC4B 1HTZA 2Y4AA 4KZBA 3O86A 2X71A 4GZBA 4O7DA 4EUZA 5L2FA
chains in the Genus database with same CATH superfamily
3LJAB 1UR9A 1L2SA 5CPKC 4WU9A 3FZCA 4J8WA 1P3PD 2OWHA 1P3BB 4QU3A 1ES5A 3AYWC 2BASA 4EXOA 3QHYA 4DJ2A 1GPFA 5DF9A 1VB6A 3WD4A 2BLSA 3A0RA 5FDHA 1IELA 3B6GA 3LIEA 5F5YA 4DDYA 4WLAA 4EUVA 3FKEA 4WELA 4E6WA 4EEPA 3BFGA 5B32C 2XLNA 3MZEA 3AZJA 1ID3D 1TZYC 1IYOA 1BLSA 1JVJA 3AZJD 1ID3A 4XZQC 3W98B 1SDEA 1SKFA 1U60A 4S2IA 2QZ6A 1LI0A 5CHMA 2IWBA 5M18A 4NXEA 2XA7S 3FWLA 4MNRA 2EA9A 3EQVA 3Q7VB 5CGXA 5HWTA 4HH2A 3F1NB 4DXCA 2D49A 2O9AA 2ZC7A 4EWFA 3T4SA 3CJMA 4E3OA 4KGCD 4GS9B 2D01A 3V5MA 2RIQA 3R45B 2OLUA 2Y79A 5CHJA 4KHAB 3G34A 2O9CA 1T18A 1XJ3A 3G2ZA 4WU8A 5B2IA 2CV5D 1ZG4A 2O0YA 1TZYD 2HIOB 3NDEA 4NEED 5AVCB 4WU9D 3N8LA 4G92C 2W3HA 4GN2A 4YS3B 4EERA 3WA9B 2ZM0A 2V2FF 1E8BA 3DW0A 4X69A 4ME4A 3ZCZA 2PYOD 4IBXA 4Q8IA 1K54A 1S6RA 2Y2JA 1P3FD 1E6ZA 2G7UA 2I72A 2QYBA 2G2WA 2W1TA 2OSUA 2V8FA 2WAEA 5J8XA 1MZUA 4FTXA 2BYKA 4R70A 3UTAA 5HWVA 1MKIA 5F1GA 1CQAA 5HW3A 4CAYA 3LZ0D 1F1EA 3UPNA 5CPKD 1LL5A 4MEZA 1W63M 4Z1WA 4Z5TC 5E2HA 1AWIA 3KX0X 4Y2FA 5FEGA 4UEYA 1T3UA 4G91B 4HIAA 3X1TC 3M6HA 3OC2A 3JYIA 5GLCA 1F66A 1W1PA 1HQ3A 1U35D 3IX4A 1P34D 4HEFA 4WL9A 3LZ0B 3AZKA 3CUEC 2CV5A 3ZG8B 3W98C 4KQDA 5GXQB 1YMXA 5B1MB 4H9QA 2Q9MA 4EV4A 3VH6T 2WAFA 3KWQD 1LHYA 1TAFB 3W99A 1NJ4A 2HDSA 3P98A 1KX4D 3AZFB 3KSIA 3BLMA 4H9RA 2Y2MA 1RCJA 3ZHHA 4JF5A 1T19A 1IKIA 5BO0A 3UB7A 1P34C 1EQZB 3IS2A 4Z66B 4KZAA 1IKGA 1VEUB 2VK3A 5IHVA 1HLUP 3PR6A 2B02A 3KS4A 5EECA 3X1TD 1M18B 1T1CA 1K56D 4WN5A 1TVFA 4J8XD 1LSWA 3AV2B 3KYEA 4Z5TD 4YINA 5DNNA 3F6TA 3REIB 4FUWA 4WM9A 4HY8A 2WYXA 1FR1A 1NZOA 2W3DA 4CSRA 3AV2C 3WAAB 3SH9A 2W8SA 4X23C 5BNVB 3C1BB 3W4PA 3A3DA 4I3IA 3JPUA 1P3KA 4KUDD 2ZC5B 5B2ID 1OT9A 3UMEA 3G2YA 3ISGA 4GW9A 5HPFA 3CUEA 2H5SA 2J3TD 1P3LB 3QP6A 3MNND 1BUEA 3C8CA 3ZVTA 3LI8A 3ICYA 1I2SA 2JKTI 3UTBD 1W2EA 3KO6A 4NE3A 4KG5A 1P3FB 1OTEA 4XT2A 3LZ0C 4NKPA 4X1MA 3K2NA 3B0CT 4NE5A 3V39A 4O01A 4LV3A 1P3KD 2RTSA 5B31D 3QNCA 1AXBA 4KGCC 5B1LB 1Q2PA 5AVCD 3JVVA 1K6SA 4BMWA 1ESIA 3HLCA 3HVFA 2XGNA 1P3GB 3B42A 2IOUA 2XRNA 5DNND 3AZHB 2NZDA 1OGBA 4WEKA 2PYOC 1L0DA 1H8YA 2EFUA 4CLCA 3AZJC 5AV8A 2AROC 1K57A 2ZMVA 1L0EA 4X23A 3E2LA 4Z66C 4ZJ1A 1S67L 1KE3A 1CF0A 3EQUA 3LIBA 5AQ7A 5FDSA 5GT0B 4UUZB 5JA4A 1ED7A 2PU4A 5FAPA 5CGWA 2AVXA 3REKA 5CPKB 1XFNA 2HZ5A 3R7WB 4ZUXB 1IYSA 3LJAC 5D3OA 2A3UA 1XJ6A 4QY6A 2K7SA 5AV6A 2LB5A 2WKEA 3NOTC 4QY5A 2EX9A 2YFVA 2ZD8A 1S32B 1QO6A 3L7HA 4JPMA 4J8UC 3REJD 5HSQA 1P3ID 2YFWA 3K3DA 3V3RA 2JKRM 4XZQD 1IYPA 1D06A 3MZDA 3UTBC 1T1AA 2Y2NA 5GT3B 3E2KA 3NECA 4IUKA 1KE4A 2P9VA 1K55C 5CPKA 1P3AA 3A1IA 5LBRA 4GOGA 4BBVA 3EPKA 4MN6A 5GT0A 3UT9A 1YU0A 4FH2A 3N7WA 4P87A 4IJGA 2VQRA 3RELC 3GMWA 1IEMA 5F99D 3FC7A 1YQSA 4MBFA 1JWVA 3WRTA 2VLGA 1G28A 1Z09A 1XGJA 3AV2D 4OUIA 1G6OA 2Y8HA 4LG2A 2HDQA 3H0MC 3Q7ZA 4B88A 3GTCA 5E2EA 2YFWB 3ZNTA 5CPJA 3REKD 5EM1A 2P08A 1SCWA 3KXBD 4KZ5A 2F8NH 3MR0A 3RJUA 5BPVA 4RYEA 3GDIA 4J8UA 4JGPA 2V8CA 1EAKA 5TR7A 1S4RA 2H0YA 3G35A 5AV8D 2W3FA 1OJ5A 5IT5A 3REKB 3KFUG 4GKUA 5CP6C 4H9SC 4Y13A 4HGAB 3L26A 1W1YA 2NZDD 3BJNA 3BWLA 4UUZA 3DWZA 4Y3IA 2H10A 3T4QA 3L25A 1G6AA 1F5MA 3I7JA 3ZQ5A 3TU4D 5CGSA 1U35C 4IBCA 2WGWA 4FD8A 4G91C 3PXPA 2ZY3A 4L9FA 4BBUA 2FJ7B 3REID 3AZHA 4LD9A 1XGIA 2JKRI 3DAVA 4I38A 4LENA 1PWGA 3S1YA 1TDLA 4LD9D 1PW1A 3H0LC 3G30A 4HMEA 4S2KA 1FIKA 1M1AD 1PIOA 5DNNB 3REIA 3AZHD 2GX5A 5B1LA 2W3EA 3EEHA 1TS8A 3WKJC 2ZQCA 5J4EA 3MNNA 5AY8A 3MGSC 1M18A 2Y59A 5B40A 3MGQC 3B6FA 1RGYA 3HLGA 4XT2B 5E5AC 2CMNA 4WZ4A 1PZOA 5CTNA 4Y17A 5L10A 3B47A 4AWLB 4IUHA 5BO0B 2M7UA 3AZMB 5IU1A 3CHWP 4H9NA 1O7EA 4HJ6A 1H8MA 4JJNC 3PYPA 2KDKA 5C3IC 1F66C 5JRGA 3AZIC 5B1MA 2WKRA 3LYXA 3IBJA 3V50A 3V3SA 4P6ZM 1P3OC 4ETZA 5AY8D 1ERMA 4LLOB 1KX4A 4NZ4A 3GVBA 4ETXA 3AN2D 4ZBJB 4OLGA 4X25A 2O9BA 3IX8A 1M19A 2R9XA 3ZVWA 3W96D 2ZY2A 3OOVA 1TF1A 4OP5A 1P9RA 4XUZA 4QNLA 1O6IA 2NUTC 3REHC 2LY8A 4LD9B 2IO5B 1BLPA 2ZC4B 1VEUA 5HDSA 1YU3A 4O7DA 2HUEB 5L2FA 4RVAA 3CITA 5AJGA 4P6ZS 5DNMB 1P3OD 4CLCD 4R8PD 5HX9A 1ZLAD 1PFLA 3BECA 3MFXA 3HJKA 3GV9A 3A0SA 3X1SD 2I9VA 3KSGA 4OJPA 4X55A 3X1SA 3WD2A 1YLTA 4UAAA 1KX3B 4J8UB 3AZKB 1D1JA 3IH8A 3UY6A 1KGGA 4IBEA 1OGGA 4PMAA 3S7PA 3IHBA 4PKYA 1P3IB 4LV2A 2GDNA 5F69A 4OPRA 1LLBA 2EX6A 4IBGA 3FG8A 4L9GA 3MGSD 4S2OA 4IJFA 3WKJD 4N1XA 4CQHA 3AZMC 1P9WA 4QPRA 3IWIA 1H0IA 3DBAA 5E43A 3N3FA 4NZ5A 3UDFA 2F8ND 1YKDA 5CX7A 3Q7VA 3CI6A 4ZDXA 2RVQD 3UTAB 4QJGA 2Y2LA 4GDNA 1KX5B 3QP5A 4ZRRA 3TU4C 4DRTA 3SZTA 4MB5A 5J3WA 2FH5A 1OTIA 1CEGA 4GH9A 4S2JA 4M3KA 1GA9A 5U47A 3B6GB 1OMEA 3G4PA 4F3LA 5AVCA 3RELB 3AGEA 1J3WA 3PAEA 2Y2HA 1MKMA 2A2LA 3BFEA 4HJ4A 1S1ZA 1FILA 2W0NA 3R45A 3FYZA 4XXRA 4AFIA 2YFVB 2PD8A 3WS4A 5GLDA 3REKC 2VKSA 4IHQA 4IVIA 2HP6A 2IA2A 3HLDA 1HQ3C 5B33B 4ZUXA 3WTPB 2PYPA 4N1HA 3W98A 5B0YD 1KX3A 2HP5A 3OPLA 3BY9A 3X1SB 3UPPA 3BEBA 2EX8A 3PBQA 3VP3A 4X23B 1KS0A 1STZA 2WKPA 3LCEA 4MMNA 5DNMD 1ZLAB 3VP2A 4CLCB 4OVDA 4R8PB 1UWNX 5DNMA 3O87A 3G31A 4FSFA 1I2WA 1ZLAC 3KXBA 4OOYA 2JKTM 3WX7A 1M18C 3UT9C 3X1TA 4KQRA 1KX5C 5DTSA 3NOUC 4DXBA 1PDCA 4R4SA 1M1AA 5EPHA 3REJC 3IBRA 1MY8A 2V1ZA 5CXWA 4WU9B 2VV7A 1P3FA 4Z2HA 3BLSA 2Y2GA 2ZQAA 4K08A 3MQQA 4A5RA 5BNXB 1N1JB 1CK7A 5AV9B 3LJAD 3KWQB 3ZG0A 3HJIA 4O8GA 4DRAA 2KLIA 4NYUA 5HD3A 4JXWA 4WZ5A 3MGRB 2XF3A 4WU8D 1JNUA 4XUJB 5JRGB 1JTDA 4GDBA 1P3AD 2JN7A 3QP1A 5AV9C 2FJ7D 1F66D 3NULA 3G32A 2AROD 5B0ZA 4WBGA 3T4LA 2Z2MB 3TSGA 1W1VA 3Q82A 3W97B 4Z2KA 3OPPA 3P7NA 3RH8B 1PRQA 4BBTA 1S66L 1Z2CB 3N4IA 5HARA 3LELC 3AFAB 5FQMA 1L6JA 3MGPB 4EBPA 4L0LA 3WD0A 4WNNB 3H82B 4KZ3A 1YM1A 1PWDA 5B31C 3M2KA 1E6RA 1WYCA 3MGRD 4E6XA 3EGXC 1EQZA 2PRFA 3AZHC 3FDDA 1M1AC 4DRBA 1GSWA 2ZOHA 1EQZD 4QD4A 4H9RB 1XJ4A 4JJNB 1M19D 2GNXA 2WGWB 3N8RA 5B2JC 2J3WA 4NETA 3MNNC 5FQKA 4ZTKA 2J3TC 3KUYA 2LB9A 3LZ1D 3VFHA 2CV5B 3Q07A 4K0WA 4GHAA 1MWUA 4Z2LA 2V0WA 4MN5A 2WKQA 3ITBA 4J8XB 4H9PA 1NXYA 4Y7PA 5FQIA 3NQJA 4JJNA 3MKEA 4KUOA 3F1OB 3CG5A 3N8SA 4XUJC 3MGRC 3AGDA 2HGVA 3E4OA 2J80A 4IBRA 4PM6A 5CPJB 1FR6A 5MC7A 5AV5C 3LIAA 5FUGA 1TZYB 1ULYA 1I5QA 3MGPA 1ODVA 1P3MB 3AZLA 4FH4A 1PI5A 3KSYA 5A8BA 3X1UB 1Z6FA 1EI5A 1BH8B 1BULA 3LFVA 2XEPA 2FJ7C 3IX3A 4OKPA 5B31B 2KX6A 5B0ZB 1GHIA 1NRFA 2IWCA 3UB6A 2AROB 2J8PA 1ZKJA 2PR5A 3C4OA 3VH5T 2X01A 1DP8A 1H0GA 1P3AB 4ZJ3A 1PZPA 5B2IB 4WU8B 5EVIC 3UN7A 4TX8A 1DRMA 3WTPC 2JE5A 2P9VB 2F8NA 2QJ7A 2VGLM 3UO9A 5GSUC 3C2WA 3B33A 4Y5FA 5B33D 3MMHA 4I3AA 4KGCB 4ZUXC 3AZED 4LCMA 5B24A 1XFQA 3NIAA 3F1NA 1JFIA 3M2JA 4ESPA 1LI9A 1B6WA 3IF6C 4DKIA 4BWIA 1KX5D 1BH9B 3DWKA 2JHEA 4B4XA 4ZUXD 3SOIA 3T4TA 4UA9A 3H9WA 4QHCA 2GJ3A 4OOLA 3DTEA 2NQBD 1BSGA 1MBLA 3A6NA 4H9SA 1YLPA 1YSQA 3EEAA 5FI6A 1KDWA 3MFDA 2VGLS 4PM8A 4NXFA 5M19A 4H9OA 2Y2KA 4LGWA 3V9RA 2M1CA 5JA4B 1H3QA 4H6JB 2INWA 3REJB 3S22A 4PKYG 4R8PA 4GHLA 4GD6A 3IH9A 1L3LA 1WYBA 3UDIA 3PBNA 4IBBA 4EBNA 2OLVA 5CPJC 3REJA 2DCFA 4IVKA 3PHYA 3KUYD 4J8WD 1C3BA 2WZXA 5HL1A 4N9LA 1E3UA 2GZAA 1YLWA 3X1VB 3WTPA 3GQZA 4E3IA 2UWXA 1MWSA 4OPZA 1Y28A 5EOEA 3VE4A 3U4LP 3PBSA 4U0TA 5GSUA 5DJTA 4I5SA 2JC7A 5AVCC 5KIZA 1BTLA 4KZ9A 1NZUA 4R38A 4DE2A 3UB9A 1P34B 1GHPA 2XA7M 4PAUA 1JFIB 1K6RA 4XUJD 5CERA 3IF6A 1MWTA 3NOPC 3O62B 5B24D 5KSCA 2F2AC 4FCFA 4LV1A 1F98A 4YFMA 1P3LA 1WA9A 1T1BA 2VZWA 3CLOA 3MSHA 4Q0IA 5F68A 3K3CA 3KSFA 3W97D 3ITAA 2PYOA 4MBHA 1ONGA 3D9YA 3A3JA 1OPXA 3LZ1C 3AZGA 5B0ZD 2AROA 4EO5B 1UR8A 5C5KA 5B31A 1D7EA 5BNVA 3C1BA 1M19C 2XDMA 1BH8A 5EUAA 4P0MA 1R4VA 4Z2MH 3QNBA 1EQZC 4R23A 5E5AA 1ZHHB 3W96A 4Z5TB 1P3MD 5HDCA 3OBFA 1J7MA 3RTYA 1PNEA 5AV6C 1KVLA 1U35B 4IEDA 4J8XC 4G3WA 1W63Q 2Z6DA 4EEUA 4ZAMA 4H8RA 4KUKA 4QLCB 3FV7A 5JRGC 4C3QA 4OONA 4GJ4A 4NK3A 3BM6A 3AZNB 3KSHA 3F1OA 3NJAA 4KUDA 5TGFA 1HTZA 3KYQA 4GHIA 5AVBC 2X71A 3EPJA 3W2ZA 1KX4C 4EUZA 3WD1A 4H9QB 2Q9NA 4M4XA 1P3LC 5HL6A 4EETB 1ES3A 4WU8C 5EVIB 3AFAD 3TJZC 3A3FA 4X68A 3W98D 2VGJA 4E3JA 5B40D 3LZ1A 3REHA 5F82A 3MGSB 4I3JA 4OJ6A 3REHD 2XFSA 2C6WB 3LICA 3C1BC 3P5JB 1ZG6A 3N6IA 4YM6A 2XR0A 3FKVA 3PBRA 4JXGA 5DVAA 4IBJA 3MGPD 2D02A 4RQ9A 3IXDA 2PU2A 1YUEA 2ZY4A 3MKFA 3TU4A 5AV5B 3MQ0A 2Q0OA 2WUQA 1XJ2A 3HBRA 4S2NC 5GT0D 2Y91A 3E98A 5G49A 5EVIA 1OJGA 3H7WB 3IXBA 2A24A 4EW7A 3LIDA 3AZGB 2VV8A 5FAQA 3T12B 2ZC6B 3B6GD 1H3OA 5GT3C 4ZBJC 3MBZA 3OPHA 1OT6A 5CHLB 3AV1C 4JF6A 3T4OA 1KVMA 2OAQ1 3AZMA 4MDZA 3RXWA 1LT0A 3TG9A 4WU9C 3WS1A 1HTAA 5E5AD 3M6BA 5A92A 4HBUA 3IXGA 3D72A 4Y0UA 1K0KA 4PHTA 1NLYA 1E88A 3B0BA 2JKGA 1HQ3D 2HUEC 1U35A 4Z2IA 5B40B 4MBKA 5AY8B 4LD9C 3FPWA 2HJEA 1NRJA 4RX2A 3TOIA 3L28A 1H5XA 4HH3A 3W4QA 1E4DA 1K4EA 4HMDA 1M1AB 4HP9A 3UE6A 3CZDA 4OP8A 5B40C 4R4RA 1LL9A 2XK1A 5GHXA 2ZY5A 5F99B 5CHUA 3BFCA 4R3AA 3P09A 3AFAC 1ID3C 1TS7A 2PYOB 3NC8A 1V9ZA 5B32D 5FQQA 5CP6D 4H6JA 3ZYTA 1ZLAA 1BYWA 1YU4A 3X1VD 4NZ3A 3S7OA 4H9OB 3ZG7B 5GHZA 3PBOA 3NDGA 4GLQA 5B1MC 3O5YA 5FEFA 1P3PB 4KG2A 2R9WA 3VP1A 2QKPA 1DP6A 1BH9A 5G4ZA 3MXSA 1LL8A 2ZBBA 3AYWD 4NZ1A 4Q0JA 4ARZA 1V9YA 3KYZA 1GA0A 3T1SA 2WGVA 1KX3C 5AV6D 1AOIC 1VHMA 4DE1A 5EVEA 1JTGA 3LR4A 1F2KA 3WA9D 5BS7A 1XP4A 4L9EA 4NXBA 3GRJA 5GL9A 1CXWA 3BYDA 3MQOA 3NQUA 3T1RA 1MPLA 2XH9A 2E8IA 3RELD 5B1MD 1K38A 2L5AA 1VQQA 4XZQB 4BL2A 5B0ZC 3ZFZA 1TDGA 1FOFA 3MVDA 3AYWB 3UTAC 1DJBA 3OLOA 4OQGA 1YPRA 1XPBA 1Q9CA 3EWKA 3EPLA 2CC1A 2Y2QA 4CLCC 1XKZA 3X1UA 4Z2JA 1TS6A 4I39A 5FI7A 2UV0E 2WK0A 5CECA 4K0XA 1N9BA 1KGFA 2ZMFA 4EU0A 2FZ0A 2RCXA 3BY8A 4JGRA 3LY4A 2HIOC 3S4XA 5B1LD 2ZQDA 4IJEA 3B0CW 5B0YA 5B24B 1XA7A 3C1CB 3LUQA 4NFTA 1EWZA 3Q1FA 4HI4A 2ZMAA 5AV6B 2ZOIA 5CPIC 3NBLA 4R3JA 4HOIA 2P04A 4J8WC 3KUYC 3C1CC 3AZIA 2V1BA 2A49A 1S32C 2K31A 4LRXC 4X56A 5E2FA 2XQZA 3BFFA 3AZID 3SS5A 3R4KA 3UTBA 3IP4C 3IF5A 2VV6A 1PW8A 2W3GA 3B6GC 2L0WA 4LV0A 3BRMA 3HLFA 5AV8B 1W7FA 4U0XA 3VFFA 4YS3D 2QHKA 3CWFA 3AZEB 2NZDB 1P3MA 3LY3A 5B32A 5GT0C 5FUGB 3PBTA 4G3KA 5HDDA 4P85A 4J8VB 3IWQA 5B2JA 3MGPC 4Y0TA 2KOIA 4WNNA 3H82A 4ZBEA 5TJJA 4NY2A 3QP2A 5L07A 4E3MA 4HMCA 3B3XA 1Y4OA 4C75A 3AZEC 4JXVA 4UA6A 3NQJB 4WYYA 2JSSA 4OLDA 4OOMA 5GLBA 3AV1D 2EXBA 1M40A 3TRCA 2XD5A 3CPTB 4WF0A 3DTKA 4YS3C 1KX4B 4PM7A 2ZL1A 2EWWA 3AV1A 3AZFD 5GT3D 4G92B 5BOHA 2P74A 4XUXA 2PR6A 3E4PA 4AWLC 5B2IC 1W8YA 4XUJA 4PM5A 3D3OA 4KG6A 3MGRA 4LFUA 2EFXA 1KDSA 1W8QA 4ZJ2A 1NY0A 4JXSA 1P3KB 5FA7A 3KWQA 1N1JA 3IT9A 5HD5A 5CPID 2H28A 3HLEA 4GNUA 1AOIB 2IWDA 4NE6A 1H0MA 2WZZA 2F8NG 3KXBC 3WAAD 5GLAA 4CPKA 5AV5D 5EV0A 4D2OA 3MNNB 1CEFA 5B2JB 1H8ZA 3VOZA 4EQ1A 4Z66A 2ZC3B 2WGIA 5F83A 3KXBB 4UA7A 4LRYC 4YM6C 1ZTUA 3L9KA 3AZEA 4KENB 5AVBD 4DN0A 4DMZA 3VOYA 1BZAA 4G3VA 5A91A 1S4SA 1CI9A 2ACGA 4RA7A 1WE4A 4BQMA 3WWXA 3W97C 5JRGD 1K25A 4Z2MG 5AV9A 2JBFA 3LGOA 3MZFA 4EBLA 3T4KA 5BS7C 1FSWA 2K2NA 1P3IC 3V67A 4J8UD 4MLLA 1AOID 3BFDA 1KX3D 4UQIM 5B0YB 3UNWA 1GSXA 3G6OA 1WWIA 4PPRA 4Y0OA 1BLCA 1F9IA 3RELA 5B32B 4F3LB 2Z6CA 4E44A 3VE3A 4JBFA 4KZ7A 2NUPC 4GB7A 2EXAA 4DDSA 5DTTA 5I5LA 1K54C 5KZHA 1W1TA 3L29A 4CJNA 3SS4A 4EQIA 4YWZA 3VV4A 4O0PA 3VOLA 3HCYA 1KX5A 3VH6W 2IO5C 4HNBA 3NHQA 2Z2LB 1YAXA 1FCMA 2B5RA 5IS1A 1A7WA 5CEBA 3NQUB 4E3KA 4DF6A 1EROA 3E0YA 3ZGAB 5CP6B 3B0DB 3HLWA 4HGAC 1FQGA 4II7A 2NQBC 1OTBA 3FKWA 5CPIA 5EOOA 2ZM5A 2PBYA 4OPQA 2MJ6A 1ERQA 3F1PB 3S7NA 1MWRA 3TE8A 3C1CA 2PD7A 5CP6A 5CTMA 1S32A 1P3IA 2Y2PA 3MVDD 2V1AA 3VSKA 3AZKC 1K56A 4N9KA 1M18D 4EESA 2ZQ9A 4IBDA 1S1YA 5B33C 4BL3A 1OTAA 1SHVA 2G5IC 5DFYA 1ES2A 5F1FA 5GSUD 5AVBB 3AZJB 3OPRA 1XXMA 3WTPD 2FFFB 3VH5A 3UB8A 3MXRA 5AQBA 3MVDB 3AYWA 3JVUA 1DY6A 5FL3A 3M7PA 3VH6A 2Y4AA 4HJ3A 3O86A 5F99A 4X23D 3AZKD 3LELB 3MVDC 2C5WB 3TW8A 3W4OA 4J8WB 1BT5A 4S2LA 1H8PA 2V20A 1M19B 3C1BD 3A6ND 2VGKA 5FAOA 1PZRA 3ZNYA 4ARZB 5GXQC 2EX2A 2J9OA 1HZOA 3HUNA 5HAIA 1PWCA 5EVID 1P3BC 2Y55A 1DJCA 1PYYA 1J9MA 2WADA 2L4RA 2H0TA 3KWQC 1P3LD 2NQBB 5E2GA 4BLMA 4BD1A 3AN2B 1P0ZA 4F94A 2OAP1 3PAGA 2XFTA 3OCNA 3SW1A 3LIFA 5G49B 5EFWA 3WS5A 3KS8A 4J8VC 4OQHA 3B6FB 3GR2A 5B2JD 4HESA 5KSHA 1P97A 2E8JA 5AV5A 3WRZA 1GHMA 3WAAA 4MB4A 4OH0A 3L2AA 3AZLC 3IWOA 2FFYA 4GD8A 1G5UA 3AZMD 4E04A 3C7UA 3HUOA 1W5DA 1P3MC 3LEQA 2ZM8A 3HLBA 2VJWA 3AZLD 2FJ7A 2M7VA 5EE8A 5FQJA 1BFMA 1FCOA 2G5HC 2ZQ7A 4Z2GA 1CJFA 1NYMA 5HAQA 4KZ4A 1P3FC 1RP5A 3ULFA 3C7VA 3A0VA 2HPBA 5DJUA 2L1MA 2J8YA 1VM1A 4WMCD 1S0WA 3AZFA 1DJAA 3UMDA 1WWSA 3WD3A 1Q2QA 1ZC2A 4X6TA 4H9NB 2VEAA 5TBMA 4JLFA 2ZL1B 3LEZA 3C30A 1AIWA 4E3NA 4WUJA 1BLHA 4WZ5C 5FATA 2PYRA 2R78A 3NI9A 2CV5C 2ZJ9A 5B24C 1ONHA 4KUDB 3AZGC 5EM0A 1YT4A 3FPVA 4N92A 1P3BD 3VP4A 2HJ9C 2JKFA 3TU4B 5C3IB 1F66B 5A90A 4S2PA 3W99C 5HZHA 1MC0A 2OWJA 4PM9A 1B67A 4J8VA 2HV1A 5DTKA 2YKFA 3A6NC 3X1UD 3LELD 3W96C 2V9AA 3WAAC 3LR5A 3UE3A 4YM6B 3LELA 1K55A 1RGZA 5AVEA 3AN2C 2PAVP 4Z5TA 3W96B 3MF0A 3GSGA 5AY8C 3MGSA 3A3IA 5CPJD 4QLCD 3B6FC 5AV9D 3EG5B 2W1TB 5HFOA 3LR0A 5L09A 2VX8A 5FSRA 4NXGA 3PTEA 3E4QA 1KOUA 2BYMA 4R6LA 1TS0A 1SDNA 5K5BA 3AZIB 1UGUA 3RFBA 5AVBA 3MS6A 4GHIB 3WA9A 3AZFC 4ID4A 4BJPA 3UPOA 4WV4B 4WMCA 2HIOA 1G68A 5FQ9A 5B0YC 3W8KA 4DJ3A 3BW6A 4MCWA 4KZ6A 3AGFA 1JWPA 2QJ5A 3MGQD 4JKTA 1P3PC 3MXQA 4E3LA 1P34A 1IOUA 4YOFA 3F1PA 3C38A 4GS9A 2PBDP 3T4JA 2V0UA 5CPIB 1SKOA 1XA1A 4FOFA 4UHUA 1CK3A 5GSUB 5HWWA 5B31G 1GXDA 3R7WA 2ZLYA 3WS0A 3L27A 1ALQA 3UDXA 2F8NK 3O3VA 5DNMC 5G18A 1ID3B 1YLYA 1NLZA 2G2UA 5DF8A 4B9OA 3UT9B 1HVBA 4UQIS 4JGQA 1ACFA 1GCEA 4OQ0A 1KE0A 3IQAA 1P3GD 2NZDC 3C1CD 5JYOA 4UPKA 3T1XA 1K4FA 5GT3A 5AV8C 1K57C 1P3GA 2PHYA 2XSSA 4HHDA 2DNSA 4Z9QA 4KZ8A 1DP9A 4Y15A 3UE0A 3C5AA 3SH7A 4DE3A 4OPYA 1E3UD 3RXXA 1E15A 3MGQA 4B93A 1ESUA 4LCLA 1P3BA 2DF4C 5GHYA 2DMWA 4RX3A 3MGQB 3LJAA 1P3PA 3EPHA 5A93A 4IBIA 2Y2IA 4KGCA 2J9PA 2DRWA 1OTDA 3X1VA 3OZHA 3WS2A 2W27A 1W79A 2XD1A 3MJQA 3SS3A 4DE0A 3HL9A 1YLZA 2F8NB 4D60A 4WEJA 4NG2A 5FI2A 3NY4A 3HUMA 4KQQA 4Q0HA 1YSPA 4JF4A 5HAPA 3O62D 3CAXA 3ZDJA 3P01A 5DKKA 5BT1C 3T1QB 2CWEA 1E6NA 4K91A 2WKHA 3V9RB 3UE1A 2RL3A 3VSLA 2HP9A 4QWOA 4CSRB 4R8PC 2QMIA 5B32G 5I94A 2ZQ8A 3A6NB 4E45A 1HD8A 4B4ZA 4YM6D 2Y2OA 1FCNA 5DF7A 4OJLA 4WZSB 4NYYA 1SKOB 4S2MA 1TZYA 3VP0A 5J7EA 3UB5P 4R1GA 4S2NA 1P3OB 2FN2A 3IS2B 2J7VA 4OQIA 3EGDC 5DFXA 1AOIA 3BQ8A 1M6KA 4HP4A 1YMSA 1E25A 1UWPX 5F6AA 5L8MA 4P6BA 1ES4A 4MN7A 1TAFA 3W99B 3S7QA 1N9LA 4H9PB 1H3OB 5KMWA 3X1SC 3B0DC 5TFQA 3X1VC 4HBTA 3AZNC 5GXQA 4IBFA 3HREA 2EWVA 1P3AC 2A24B 4Z66D 3LO7A 3H7WA 3AZND 2BYMB 3VH5W 1L0GA 4QLCC 3B6FD 3AL0C 3KUYB 3AV1B 4JJND 2OOLA 1HQ3B 1MXOA 4CLCE 4LPZA 3CPTA 2XROA 2PDRA 3WKJB 4X1LA 2O99A 4HQAA 3T50A 3EOIA 5AVFA 5DNNC 1VETB 2X02A 5CRFA 3ZG5A 4U3TA 5FASA 2QPNA 3AZLB 3X1UC 3AV2A 4JGOA 3SH8A 4QB8A 3W99D 4WJ3C 5KDMB 2ZM2A 1P3KC 1LSXA 3WTPE 1N9NA 2YKHA 4X53A 5HPIA 1EW0A 1N4OA 5KDMA 4LRZE 5JYPA 4EO5C 2BYKB 1KU5A 1TEMA 4M6BA 3LZ1B 3REHB 2HF6A 3UT9D 3AZGD 1E6PA 1L0FA 3AFAA 1QMFA 3H0RC 4OJOA 1IYQA 4BENA 3REIC 1KGEA 1VETA 3W97A 3A3EA 3Q81A 3WKJA 1FSYA 4J8XA 5BT1D 1GOIA 2BTFP 1YU2A 2BG1A 3GECA 3UTBB 1NWZA 5TBMB 3O62C 1IFQA 1QMEA 3OCLA 2WKIA 4R0QA 1XX2A 3LZ0A 3AZNA 4KUDC 1N9OA 1X0OA 3U2AA 1JWZA 1S32D 5AQAA 2V5OA 4QLCA 5EVLA 3MQLA 1NYYA 3HSHA 1YU1A 1PI4A 2OV5A 5CEDA 2JCHA 3C4PA 2VA0A 3NCKA 3O88A 3DTIA 4OJ5A 5BNXA 5AQ9A 2P7JA 3ZG9B 3CMZA 4CAYB 2B18A 1P3OA 2PT7A 4IBKA 2W1RA 5E5AB 3VMAA 3A1KA 4J8VD 3QP8A 3LI9A 4KQOA 5B1LC 5G4YA 2HIOD 3LR3A 2HDUA 1A0KA 3X1TB 4GCZA 1YLJA 1GSVA 5DKLA 3IXHA 4MB3A 4YNRA 1P3GC 4YS3A 3AN2A 3IHAA 5F99C 4DQYB 1CI8A 2QWSA 2NQBA 3UTAD 4XZQA 1Y54A 1O07A 1LSVA 3D4FA 1TD5A 4R3BA 3BQAA 3O62A 2DQNC 3IF6B 2HDRA 4KHAA 5GXQD 3DTMA 2RVQC 4C6YA 4BD0A 5M1AA 3QP4A 4KZBA 3HONA 5B33A 1SZVA 4GZBA 3WA9C 2B95A
chains in the Genus database with same CATH topology
3LJAB 1L2SA 5CPKC 4WU9A 3FZCA 4J8WA 1P3PD 1P3BB 4QU3A 1ES5A 3AYWC 3QHYA 5DF9A 2BLSA 5FDHA 1IELA 3B6GA 4DDYA 3FKEA 4WELA 4E6WA 3BFGA 5B32C 2XLNA 3MZEA 3AZJA 1ID3D 1TZYC 1IYOA 1BLSA 1JVJA 3AZJD 1ID3A 4XZQC 3W98B 1SDEA 1SKFA 1U60A 4S2IA 2QZ6A 1LI0A 5CHMA 2IWBA 5M18A 3FWLA 4MNRA 3EQVA 3Q7VB 5CGXA 4DXCA 2ZC7A 4EWFA 3CJMA 4E3OA 4KGCD 3V5MA 2RIQA 3R45B 2OLUA 5CHJA 4KHAB 3G34A 3G2ZA 4WU8A 5B2IA 2CV5D 1ZG4A 1TZYD 2HIOB 3NDEA 5AVCB 4WU9D 3N8LA 4G92C 4GN2A 4YS3B 3WA9B 2ZM0A 2V2FF 3DW0A 4X69A 3ZCZA 2PYOD 4IBXA 4Q8IA 1K54A 1S6RA 2Y2JA 1P3FD 2I72A 2G2WA 2OSUA 2WAEA 5J8XA 2BYKA 3UTAA 1MKIA 5F1GA 5HW3A 4CAYA 3LZ0D 1F1EA 3UPNA 5CPKD 1LL5A 4MEZA 4Z5TC 5E2HA 1T3UA 4G91B 3X1TC 3M6HA 3OC2A 3JYIA 5GLCA 1F66A 1HQ3A 1U35D 1P34D 4HEFA 3LZ0B 3AZKA 2CV5A 3ZG8B 3W98C 5GXQB 1YMXA 5B1MB 4H9QA 2Q9MA 4EV4A 3VH6T 2WAFA 3KWQD 1LHYA 1TAFB 3W99A 1NJ4A 2HDSA 3P98A 1KX4D 3AZFB 3BLMA 4H9RA 2Y2MA 1RCJA 3ZHHA 4JF5A 1IKIA 5BO0A 1P34C 1EQZB 4Z66B 4KZAA 1IKGA 5IHVA 3KS4A 5EECA 3X1TD 1M18B 1K56D 1TVFA 4J8XD 3AV2B 4Z5TD 4YINA 5DNNA 3F6TA 3REIB 4WM9A 2WYXA 1FR1A 1NZOA 4CSRA 3AV2C 3WAAB 3SH9A 2W8SA 4X23C 5BNVB 3C1BB 3W4PA 3A3DA 1P3KA 4KUDD 2ZC5B 5B2ID 3G2YA 3ISGA 2H5SA 1P3LB 3MNND 1BUEA 3ZVTA 1I2SA 3UTBD 1W2EA 4NE3A 4KG5A 1P3FB 3LZ0C 3B0CT 4NE5A 3V39A 4LV3A 1P3KD 5B31D 3QNCA 1AXBA 4KGCC 5B1LB 1Q2PA 5AVCD 1K6SA 1ESIA 3HLCA 3HVFA 2XGNA 1P3GB 2IOUA 5DNND 3AZHB 2NZDA 4WEKA 2PYOC 1L0DA 1H8YA 2EFUA 3AZJC 5AV8A 2AROC 1K57A 1L0EA 4X23A 3E2LA 4Z66C 4ZJ1A 1KE3A 3EQUA 5AQ7A 5GT0B 4UUZB 5JA4A 5FAPA 2PU4A 5CGWA 3REKA 5CPKB 4ZUXB 1IYSA 3LJAC 5D3OA 2A3UA 4QY6A 5AV6A 2WKEA 4QY5A 2EX9A 2YFVA 2ZD8A 1S32B 4JPMA 4J8UC 3REJD 1P3ID 2YFWA 3V3RA 4XZQD 1IYPA 3MZDA 3UTBC 2Y2NA 5GT3B 3E2KA 1KE4A 2P9VA 1K55C 5CPKA 1P3AA 3A1IA 4GOGA 3EPKA 5GT0A 3UT9A 1YU0A 4FH2A 3N7WA 4P87A 2VQRA 3RELC 3GMWA 1IEMA 4MBFA 5F99D 1YQSA 1JWVA 3WRTA 1XGJA 3AV2D 4OUIA 4LG2A 2HDQA 3H0MC 3Q7ZA 4B88A 3GTCA 5E2EA 2YFWB 3ZNTA 5CPJA 3REKD 1SCWA 3KXBD 4KZ5A 2F8NH 3RJUA 5BPVA 4RYEA 4J8UA 5TR7A 2H0YA 3G35A 5AV8D 3REKB 3KFUG 4GKUA 5CP6C 4H9SC 4HGAB 3L26A 2NZDD 4UUZA 3DWZA 2H10A 3L25A 1G6AA 3I7JA 3TU4D 5CGSA 1U35C 4IBCA 2WGWA 4FD8A 4G91C 2ZY3A 2FJ7B 3REID 3AZHA 4LD9A 1XGIA 4LENA 1PWGA 3S1YA 1TDLA 4LD9D 1PW1A 3H0LC 3G30A 4S2KA 1M1AD 1PIOA 5DNNB 3REIA 3AZHD 5B1LA 3WKJC 2ZQCA 3MNNA 5AY8A 3MGSC 1M18A 2Y59A 5B40A 3MGQC 3B6FA 1RGYA 3HLGA 5E5AC 4WZ4A 1PZOA 5CTNA 4AWLB 5BO0B 3AZMB 4H9NA 1O7EA 4JJNC 5C3IC 1F66C 5JRGA 3AZIC 5B1MA 3V50A 3V3SA 1P3OC 5AY8D 1ERMA 1KX4A 4NZ4A 3GVBA 3AN2D 4ZBJB 4OLGA 1M19A 2R9XA 3ZVWA 3W96D 2ZY2A 4OP5A 4XUZA 4QNLA 3REHC 2LY8A 4LD9B 2IO5B 1BLPA 2ZC4B 1YU3A 4O7DA 2HUEB 5L2FA 4RVAA 5DNMB 1P3OD 4R8PD 5HX9A 1ZLAD 3BECA 3GV9A 3X1SD 4OJPA 4X55A 3X1SA 1YLTA 4UAAA 1KX3B 4J8UB 3AZKB 3IH8A 3UY6A 1KGGA 4IBEA 4PMAA 3IHBA 1P3IB 4LV2A 2GDNA 4OPRA 1LLBA 2EX6A 4IBGA 3MGSD 4S2OA 4IJFA 3WKJD 4N1XA 3AZMC 3IWIA 5E43A 3N3FA 4NZ5A 3UDFA 2F8ND 3Q7VA 4ZDXA 2RVQD 3UTAB 4QJGA 2Y2LA 4GDNA 1KX5B 3TU4C 4DRTA 1CEGA 4GH9A 4S2JA 4M3KA 1GA9A 5U47A 3B6GB 1OMEA 3G4PA 5AVCA 3RELB 3AGEA 3PAEA 2Y2HA 3BFEA 3R45A 3FYZA 4XXRA 2YFVB 3WS4A 5GLDA 3REKC 4IVIA 2HP6A 3HLDA 1HQ3C 5B33B 4ZUXA 3WTPB 4N1HA 3W98A 5B0YD 1KX3A 2HP5A 3OPLA 3X1SB 3UPPA 3BEBA 2EX8A 3PBQA 3VP3A 4X23B 3LCEA 5DNMD 1ZLAB 3VP2A 4OVDA 4R8PB 5DNMA 3O87A 3G31A 4FSFA 1I2WA 1ZLAC 3KXBA 4OOYA 3WX7A 1M18C 3UT9C 3X1TA 4KQRA 1KX5C 5DTSA 4DXBA 4R4SA 1M1AA 5EPHA 3REJC 1MY8A 2V1ZA 5CXWA 4WU9B 3BLSA 1P3FA 2Y2GA 2ZQAA 4A5RA 5BNXB 1N1JB 5AV9B 3LJAD 3KWQB 3ZG0A 4DRAA 4NYUA 4JXWA 4WZ5A 3MGRB 2XF3A 4WU8D 4XUJB 5JRGB 1JTDA 4GDBA 1P3AD 5AV9C 2FJ7D 1F66D 3G32A 2AROD 5B0ZA 4WBGA 2Z2MB 3TSGA 3Q82A 3W97B 3OPPA 1Z2CB 3N4IA 5HARA 3LELC 3AFAB 5FQMA 3MGPB 4EBPA 4L0LA 4WNNB 4KZ3A 1YM1A 1PWDA 5B31C 3M2KA 1WYCA 4E6XA 3MGRD 1EQZA 3AZHC 3FDDA 1M1AC 4DRBA 1EQZD 4QD4A 4H9RB 4JJNB 1M19D 2WGWB 3N8RA 5B2JC 4NETA 3MNNC 5FQKA 4ZTKA 3KUYA 3LZ1D 3VFHA 2CV5B 3Q07A 4K0WA 4GHAA 1MWUA 3ITBA 4J8XB 4H9PA 1NXYA 4Y7PA 5FQIA 3NQJA 4JJNA 3MKEA 3CG5A 3N8SA 4XUJC 3MGRC 3AGDA 4IBRA 4PM6A 5CPJB 1FR6A 5AV5C 5FUGA 1TZYB 1ULYA 1I5QA 3MGPA 1P3MB 3AZLA 4FH4A 1PI5A 3KSYA 3X1UB 1Z6FA 1EI5A 1BH8B 1BULA 2XEPA 2FJ7C 4OKPA 5B31B 5B0ZB 1GHIA 1NRFA 2IWCA 2AROB 2J8PA 1ZKJA 3C4OA 3VH5T 2X01A 1P3AB 4ZJ3A 1PZPA 5B2IB 4WU8B 5EVIC 3UN7A 3WTPC 2JE5A 2P9VB 2F8NA 3UO9A 5GSUC 5B33D 4KGCB 4ZUXC 3AZED 4LCMA 5B24A 3NIAA 1JFIA 3M2JA 1LI9A 1B6WA 3IF6C 4DKIA 1KX5D 1BH9B 3DWKA 4B4XA 4ZUXD 3SOIA 4UA9A 4QHCA 4OOLA 2NQBD 1BSGA 1MBLA 3A6NA 4H9SA 1YLPA 5FI6A 1KDWA 3MFDA 4PM8A 5M19A 4H9OA 2Y2KA 3V9RA 5JA4B 3REJB 3S22A 4R8PA 4GHLA 4GD6A 3IH9A 1WYBA 3UDIA 3PBNA 4IBBA 4EBNA 2OLVA 5CPJC 3REJA 2DCFA 4IVKA 3KUYD 4J8WD 1C3BA 2WZXA 5HL1A 4N9LA 1E3UA 1YLWA 3X1VB 3WTPA 3GQZA 4E3IA 2UWXA 1MWSA 4OPZA 5EOEA 3PBSA 4U0TA 5GSUA 2JC7A 5AVCC 1BTLA 4KZ9A 1NZUA 4DE2A 1P34B 1GHPA 1JFIB 1K6RA 4XUJD 5CERA 3IF6A 1MWTA 3O62B 5B24D 5KSCA 2F2AC 4FCFA 4LV1A 4YFMA 1P3LA 3W97D 3ITAA 2PYOA 4MBHA 1ONGA 3A3JA 3LZ1C 3AZGA 5B0ZD 2AROA 4EO5B 5B31A 5BNVA 3C1BA 1M19C 2XDMA 1BH8A 5EUAA 4P0MA 1R4VA 4Z2MH 3QNBA 1EQZC 4R23A 5E5AA 3W96A 4Z5TB 1P3MD 5AV6C 1KVLA 1U35B 4IEDA 4J8XC 4ZAMA 4H8RA 4QLCB 3FV7A 5JRGC 4C3QA 4OONA 4NK3A 3BM6A 3AZNB 4KUDA 5TGFA 1HTZA 5AVBC 2X71A 3EPJA 1KX4C 4EUZA 4H9QB 2Q9NA 1P3LC 1ES3A 4WU8C 5EVIB 3AFAD 3A3FA 4X68A 3W98D 2VGJA 4E3JA 5B40D 3LZ1A 3REHA 5F82A 3MGSB 4OJ6A 3REHD 2XFSA 2C6WB 3C1BC 3P5JB 1ZG6A 3N6IA 4YM6A 2XR0A 3FKVA 3PBRA 4JXGA 5DVAA 4IBJA 3MGPD 3IXDA 2PU2A 1YUEA 2ZY4A 3MKFA 3TU4A 5AV5B 2WUQA 3HBRA 4S2NC 5GT0D 2Y91A 5G49A 5EVIA 3IXBA 3AZGB 5FAQA 2ZC6B 3B6GD 1H3OA 5GT3C 4ZBJC 3MBZA 3OPHA 5CHLB 3AV1C 4JF6A 1KVMA 3AZMA 3RXWA 3TG9A 4WU9C 3WS1A 1HTAA 5E5AD 3M6BA 5A92A 4HBUA 3IXGA 4Y0UA 3B0BA 1HQ3D 2HUEC 1U35A 5B40B 4MBKA 5AY8B 4LD9C 4RX2A 3TOIA 3L28A 1H5XA 3W4QA 1E4DA 1K4EA 1M1AB 3CZDA 4OP8A 5B40C 4R4RA 1LL9A 2XK1A 5GHXA 2ZY5A 5F99B 5CHUA 3BFCA 3P09A 3AFAC 1ID3C 2PYOB 3NC8A 5B32D 5FQQA 5CP6D 1ZLAA 1YU4A 3X1VD 4NZ3A 4H9OB 3ZG7B 5GHZA 3PBOA 3NDGA 5B1MC 1P3PB 4KG2A 2R9WA 3VP1A 1BH9A 3MXSA 3AYWD 4NZ1A 1GA0A 2WGVA 1KX3C 5AV6D 1AOIC 4DE1A 1JTGA 3WA9D 5BS7A 1XP4A 3GRJA 5GL9A 3BYDA 3NQUA 1MPLA 2XH9A 2E8IA 3RELD 5B1MD 1K38A 2L5AA 1VQQA 4XZQB 4BL2A 5B0ZC 3ZFZA 1TDGA 1FOFA 3MVDA 3AYWB 3UTAC 1DJBA 4OQGA 1XPBA 1Q9CA 3EPLA 2CC1A 2Y2QA 1XKZA 3X1UA 5FI7A 2WK0A 5CECA 4K0XA 1N9BA 1KGFA 2RCXA 3LY4A 2HIOC 3S4XA 5B1LD 2ZQDA 4IJEA 3B0CW 5B0YA 5B24B 1XA7A 3C1CB 4NFTA 1EWZA 3Q1FA 2ZMAA 5AV6B 5CPIC 3NBLA 4R3JA 4J8WC 3KUYC 3C1CC 3AZIA 2A49A 1S32C 4X56A 5E2FA 2XQZA 3BFFA 3AZID 3SS5A 3UTBA 3IP4C 3IF5A 1PW8A 3B6GC 4LV0A 3BRMA 3HLFA 5AV8B 1W7FA 4U0XA 3VFFA 4YS3D 3AZEB 2NZDB 1P3MA 3LY3A 5B32A 5GT0C 5FUGB 3PBTA 4P85A 4J8VB 3IWQA 5B2JA 3MGPC 4Y0TA 4WNNA 4ZBEA 4NY2A 4E3MA 3B3XA 4C75A 3AZEC 4JXVA 4UA6A 3NQJB 4WYYA 2JSSA 4OLDA 4OOMA 5GLBA 3AV1D 2EXBA 1M40A 2XD5A 4YS3C 1KX4B 4PM7A 3AV1A 3AZFD 5GT3D 4G92B 5BOHA 2P74A 4XUXA 4AWLC 5B2IC 1W8YA 4XUJA 4PM5A 4KG6A 3MGRA 2EFXA 1KDSA 1W8QA 4ZJ2A 1NY0A 4JXSA 1P3KB 5FA7A 3KWQA 1N1JA 3IT9A 5CPID 3HLEA 4GNUA 1AOIB 2IWDA 4NE6A 2WZZA 2F8NG 3KXBC 3WAAD 5GLAA 4CPKA 5AV5D 4D2OA 3MNNB 1CEFA 5B2JB 1H8ZA 3VOZA 4Z66A 2ZC3B 2WGIA 5F83A 3KXBB 4UA7A 4YM6C 3AZEA 4KENB 5AVBD 3VOYA 1BZAA 5A91A 1CI9A 4RA7A 1WE4A 4BQMA 3WWXA 3W97C 5JRGD 1K25A 4Z2MG 5AV9A 2JBFA 3MZFA 4EBLA 5BS7C 1FSWA 1P3IC 4J8UD 4MLLA 1AOID 3BFDA 1KX3D 5B0YB 3UNWA 1WWIA 4PPRA 4Y0OA 1BLCA 3RELA 5B32B 4E44A 4JBFA 4KZ7A 4GB7A 2EXAA 4DDSA 5DTTA 1K54C 5KZHA 3L29A 4CJNA 3SS4A 4EQIA 1KX5A 3VH6W 2IO5C 2Z2LB 1FCMA 2B5RA 1A7WA 5CEBA 3NQUB 4E3KA 4DF6A 1EROA 3ZGAB 5CP6B 3B0DB 3HLWA 4HGAC 1FQGA 2NQBC 3FKWA 5CPIA 5EOOA 2ZM5A 2PBYA 4OPQA 1ERQA 1MWRA 3C1CA 5CP6A 5CTMA 1S32A 1P3IA 2Y2PA 3MVDD 3VSKA 3AZKC 1K56A 4N9KA 1M18D 2ZQ9A 4IBDA 5B33C 4BL3A 1SHVA 2G5IC 1ES2A 5F1FA 5GSUD 5AVBB 3AZJB 3OPRA 1XXMA 3WTPD 2FFFB 3VH5A 3MXRA 5AQBA 3MVDB 3AYWA 1DY6A 3VH6A 2Y4AA 3O86A 5F99A 4X23D 3AZKD 3LELB 3MVDC 2C5WB 3W4OA 4J8WB 1BT5A 4S2LA 2V20A 1M19B 3C1BD 3A6ND 2VGKA 5FAOA 1PZRA 3ZNYA 5GXQC 2EX2A 2J9OA 1HZOA 3HUNA 5HAIA 1PWCA 5EVID 1P3BC 2Y55A 1DJCA 1PYYA 1J9MA 2WADA 2H0TA 3KWQC 1P3LD 2NQBB 5E2GA 4BLMA 4BD1A 3AN2B 4F94A 3PAGA 2XFTA 3OCNA 5G49B 3WS5A 3KS8A 4J8VC 4OQHA 3B6FB 3GR2A 5B2JD 4HESA 5KSHA 5AV5A 3WRZA 1GHMA 3WAAA 4OH0A 3L2AA 3AZLC 3IWOA 2FFYA 4GD8A 3AZMD 3C7UA 3HUOA 1W5DA 1P3MC 2ZM8A 3HLBA 3AZLD 2FJ7A 5EE8A 5FQJA 1BFMA 1FCOA 2G5HC 2ZQ7A 1NYMA 5HAQA 4KZ4A 1P3FC 1RP5A 3C7VA 2HPBA 2J8YA 1VM1A 4WMCD 1S0WA 3AZFA 1DJAA 1WWSA 1ZC2A 1Q2QA 4X6TA 4H9NB 4JLFA 3LEZA 4E3NA 1BLHA 4WZ5C 5FATA 3NI9A 2CV5C 2ZJ9A 5B24C 1ONHA 4KUDB 3AZGC 1YT4A 4N92A 1P3BD 3VP4A 3TU4B 5C3IB 1F66B 5A90A 4S2PA 3W99C 4PM9A 1B67A 4J8VA 5DTKA 3A6NC 3X1UD 3LELD 3W96C 3WAAC 3UE3A 4YM6B 3LELA 1K55A 1RGZA 3AN2C 4Z5TA 3W96B 3GSGA 5AY8C 3MGSA 3A3IA 5CPJD 4QLCD 3B6FC 5AV9D 3EG5B 5HFOA 5FSRA 3PTEA 2BYMA 1SDNA 3AZIB 5AVBA 3WA9A 3AZFC 4ID4A 4BJPA 3UPOA 4WV4B 4WMCA 2HIOA 1G68A 5FQ9A 5B0YC 3W8KA 4KZ6A 3AGFA 1JWPA 3MGQD 4JKTA 1P3PC 4E3LA 1P34A 5CPIB 1XA1A 4UHUA 1CK3A 5GSUB 5B31G 2ZLYA 3WS0A 3L27A 1ALQA 3UDXA 2F8NK 3O3VA 5DNMC 5G18A 1ID3B 1YLYA 2G2UA 5DF8A 3UT9B 1HVBA 1GCEA 4OQ0A 1KE0A 3IQAA 1P3GD 2NZDC 3C1CD 5JYOA 4UPKA 1K4FA 5GT3A 5AV8C 1K57C 1P3GA 4Z9QA 2DNSA 4KZ8A 3UE0A 3C5AA 3SH7A 4DE3A 4OPYA 1E3UD 3RXXA 3MGQA 1ESUA 4LCLA 1P3BA 2DF4C 5GHYA 4RX3A 3MGQB 3LJAA 1P3PA 3EPHA 5A93A 4IBIA 2Y2IA 4KGCA 2J9PA 2DRWA 3X1VA 3OZHA 3WS2A 1W79A 2XD1A 3SS3A 4DE0A 3HL9A 1YLZA 2F8NB 4WEJA 5FI2A 3NY4A 3HUMA 4KQQA 4JF4A 5HAPA 3O62D 3ZDJA 5BT1C 2CWEA 4K91A 2WKHA 3V9RB 3UE1A 2RL3A 3VSLA 2HP9A 4CSRB 4R8PC 2QMIA 5B32G 5I94A 2ZQ8A 3A6NB 4E45A 1HD8A 4B4ZA 4YM6D 2Y2OA 1FCNA 5DF7A 4OJLA 4WZSB 4NYYA 4S2MA 1TZYA 3VP0A 4R1GA 4S2NA 1P3OB 2J7VA 4OQIA 1AOIA 1M6KA 1YMSA 1E25A 4P6BA 1ES4A 1TAFA 3W99B 4H9PB 1H3OB 5KMWA 3X1SC 3B0DC 5TFQA 3X1VC 4HBTA 3AZNC 5GXQA 4IBFA 3HREA 1P3AC 3LO7A 4Z66D 3AZND 2BYMB 3VH5W 1L0GA 4QLCC 3B6FD 3AL0C 3KUYB 3AV1B 4JJND 1HQ3B 1MXOA 3WKJB 5DNNC 2X02A 5CRFA 3ZG5A 4U3TA 5FASA 2QPNA 3AZLB 3X1UC 3AV2A 3SH8A 4QB8A 3W99D 4WJ3C 5KDMB 2ZM2A 1P3KC 3WTPE 4X53A 1N4OA 5KDMA 5JYPA 4EO5C 2BYKB 1KU5A 1TEMA 4M6BA 3LZ1B 3REHB 3UT9D 3AZGD 1L0FA 3AFAA 1QMFA 3H0RC 4OJOA 1IYQA 4BENA 3REIC 1KGEA 3W97A 3A3EA 3Q81A 3WKJA 1FSYA 4J8XA 5BT1D 1YU2A 2BG1A 3UTBB 3O62C 1QMEA 3OCLA 2WKIA 4R0QA 1XX2A 3LZ0A 3AZNA 4KUDC 1JWZA 1S32D 5AQAA 4QLCA 5EVLA 1NYYA 3HSHA 1YU1A 1PI4A 2OV5A 5CEDA 2JCHA 3C4PA 3NCKA 3O88A 4OJ5A 5BNXA 5AQ9A 3ZG9B 3CMZA 4CAYB 1P3OA 4IBKA 5E5AB 3VMAA 3A1KA 4J8VD 4KQOA 5B1LC 2HIOD 2HDUA 3X1TB 1YLJA 3IXHA 1P3GC 4YS3A 3AN2A 3IHAA 5F99C 4DQYB 1CI8A 2NQBA 3UTAD 4XZQA 1Y54A 1O07A 3D4FA 4R3BA 3O62A 2DQNC 3IF6B 2HDRA 4KHAA 5GXQD 3DTMA 2RVQC 4C6YA 4BD0A 5M1AA 4KZBA 3HONA 5B33A 4GZBA 3WA9C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L2S A;  2Q9N A;  4RVA A;  3FZC A;  1ES3 A;  5EVI B;  2C5W B;  3A3F A;  4X68 A;  5HX9 A;  3BEC A;  3W4O A;  4E3J A;  2VGJ A;  4QU3 A;  1ES5 A;  3GV9 A;  1BT5 A;  4S2L A;  5F82 A;  3QHY A;  2V20 A;  5DF9 A;  5FAO A;  2VGK A;  4X55 A;  2BLS A;  1YLT A;  2C6W B;  2XFS A;  3ZNY A;  5FDH A;  4UAA A;  1IEL A;  4DDY A;  2EX2 A;  2J9O A;  1ZG6 A;  3N6I A;  1HZO A;  3IH8 A;  3UY6 A;  1KGG A;  3HUN A;  5HAI A;  2XR0 A;  3FKV A;  4PMA A;  1PWC A;  5EVI D;  4WEL A;  3PBR A;  3IHB A;  4JXG A;  5DVA A;  4E6W A;  2Y55 A;  3BFG A;  1DJC A;  1PYY A;  1J9M A;  4LV2 A;  2GDN A;  2WAD A;  2XLN A;  1LLB A;  2EX6 A;  4OPR A;  2H0T A;  3MZE A;  3IXD A;  2PU2 A;  4S2O A;  3MKF A;  1IYO A;  5E2G A;  4N1X A;  1BLS A;  1JVJ A;  2WUQ A;  4BLM A;  4BD1 A;  1SDE A;  3IWI A;  3HBR A;  1SKF A;  4S2N C;  1U60 A;  4S2I A;  2Y91 A;  5E43 A;  4F94 A;  2QZ6 A;  3UDF A;  1LI0 A;  3PAG A;  5CHM A;  2IWB A;  5EVI A;  2XFT A;  5M18 A;  3IXB A;  3FWL A;  4MNR A;  3OCN A;  3EQV A;  3Q7V B;  3Q7V A;  5CGX A;  4ZDX A;  5FAQ A;  4QJG A;  3WS5 A;  4DXC A;  2ZC7 A;  2ZC6 B;  4EWF A;  2Y2L A;  4DE3 A;  4GDN A;  3CJM A;  4E3O A;  3MBZ A;  3OPH A;  4OQH A;  3GR2 A;  4HES A;  5KSH A;  4DRT A;  3WRZ A;  4JF6 A;  1GHM A;  1KVM A;  3V5M A;  2OLU A;  5CHJ A;  3G34 A;  3RXW A;  4OH0 A;  3IWO A;  3TG9 A;  3G2Z A;  1CEG A;  2FFY A;  3M6B A;  3WS1 A;  5A92 A;  4GD8 A;  4HBU A;  3IXG A;  3C7U A;  1ZG4 A;  3HUO A;  4Y0U A;  1W5D A;  4S2J A;  2ZM8 A;  3NDE A;  3HLB A;  3N8L A;  4M3K A;  1GA9 A;  5U47 A;  4MBK A;  5EE8 A;  5FQJ A;  1FCO A;  1OME A;  4GN2 A;  3G4P A;  2ZQ7 A;  3AGE A;  1NYM A;  2ZM0 A;  5HAQ A;  4RX2 A;  4KZ4 A;  2V2F F;  3PAE A;  3TOI A;  2Y2H A;  3DW0 A;  1H5X A;  4X69 A;  3W4Q A;  1E4D A;  3BFE A;  1RP5 A;  4IBX A;  3ZCZ A;  1K4E A;  4Q8I A;  3C7V A;  1K54 A;  1S6R A;  2HPB A;  3FYZ A;  4XXR A;  2Y2J A;  2J8Y A;  2I72 A;  1VM1 A;  4WMC D;  1S0W A;  2G2W A;  1DJA A;  3WS4 A;  5GLD A;  3CZD A;  1ZC2 A;  1Q2Q A;  2OSU A;  4X6T A;  2WAE A;  5J8X A;  4IVI A;  4OP8 A;  4JLF A;  2HP6 A;  4R4R A;  1LL9 A;  3LEZ A;  2XK1 A;  5GHX A;  3HLD A;  1MKI A;  5CHU A;  3BFC A;  5F1G A;  4E3N A;  1BLH A;  3P09 A;  4WZ5 C;  5HW3 A;  5FAT A;  3NI9 A;  3NC8 A;  2ZJ9 A;  3UPN A;  1ONH A;  1LL5 A;  4N1H A;  5FQQ A;  4MEZ A;  1YT4 A;  5E2H A;  4N92 A;  3VP4 A;  2HP5 A;  3OPL A;  3ZG7 B;  3M6H A;  3UPP A;  3OC2 A;  3JYI A;  4S2P A;  3BEB A;  5GHZ A;  3PBO A;  2EX8 A;  3NDG A;  4PM9 A;  5GLC A;  3PBQ A;  3VP3 A;  3LCE A;  5DTK A;  3VP2 A;  4KG2 A;  2R9W A;  4OVD A;  4HEF A;  3VP1 A;  3UE3 A;  3MXS A;  3O87 A;  1K55 A;  3G31 A;  1RGZ A;  3ZG8 B;  4FSF A;  1I2W A;  1GA0 A;  2WGV A;  4OOY A;  1YMX A;  3GSG A;  2Q9M A;  4DE1 A;  4EV4 A;  3A3I A;  2WAF A;  4KQR A;  5DTS A;  1LHY A;  1NJ4 A;  3P98 A;  2HDS A;  5HFO A;  1JTG A;  4DXB A;  3BLM A;  4R4S A;  5FSR A;  1XP4 A;  3PTE A;  5EPH A;  2Y2M A;  1MY8 A;  3GRJ A;  5GL9 A;  2V1Z A;  1RCJ A;  5CXW A;  3ZHH A;  1SDN A;  3BLS A;  3BYD A;  1IKI A;  4JF5 A;  2Y2G A;  1MPL A;  2XH9 A;  2ZQA A;  2E8I A;  4KZA A;  1IKG A;  1K38 A;  1VQQ A;  4ID4 A;  5IHV A;  4A5R A;  4BJP A;  4BL2 A;  3UPO A;  5EEC A;  3ZFZ A;  1K56 D;  4WMC A;  1TDG A;  1FOF A;  1TVF A;  3ZG0 A;  1DJB A;  1G68 A;  4OQG A;  5FQ9 A;  4YIN A;  3W8K A;  1XPB A;  4JXW A;  4WM9 A;  4WZ5 A;  2XF3 A;  2CC1 A;  1JWP A;  2WYX A;  3AGF A;  1FR1 A;  4JKT A;  2Y2Q A;  4KZ6 A;  1NZO A;  1XKZ A;  1JTD A;  4GDB A;  4E3L A;  3SH9 A;  5FI7 A;  2WK0 A;  5CEC A;  3W4P A;  3A3D A;  4K0X A;  1N9B A;  1KGF A;  2RCX A;  1XA1 A;  3LY4 A;  3G32 A;  4UHU A;  1CK3 A;  4WBG A;  2Z2M B;  2ZC5 B;  3TSG A;  3S4X A;  2ZQD A;  3Q82 A;  2ZLY A;  3WS0 A;  1XA7 A;  3OPP A;  1ALQ A;  3G2Y A;  3ISG A;  3UDX A;  2H5S A;  3N4I A;  3O3V A;  5HAR A;  5G18 A;  1EWZ A;  5FQM A;  1YLY A;  2G2U A;  4EBP A;  1BUE A;  4L0L A;  5DF8 A;  3Q1F A;  1HVB A;  2ZMA A;  4KZ3 A;  1YM1 A;  1PWD A;  3ZVT A;  3NBL A;  4R3J A;  3M2K A;  1GCE A;  1WYC A;  4E6X A;  4OQ0 A;  1I2S A;  1KE0 A;  3IQA A;  2A49 A;  4KG5 A;  4X56 A;  5E2F A;  2XQZ A;  5JYO A;  3BFF A;  1K4F A;  4QD4 A;  3V39 A;  3SS5 A;  1K57 C;  4LV3 A;  2WGW B;  4Z9Q A;  2DNS A;  3QNC A;  3N8R A;  1AXB A;  3IF5 A;  1Q2P A;  1PW8 A;  4KZ8 A;  4LV0 A;  4NET A;  3BRM A;  3C5A A;  3HLF A;  3SH7 A;  5FQK A;  3UE0 A;  4ZTK A;  1K6S A;  4OPY A;  1W7F A;  4U0X A;  3VFF A;  1E3U D;  3RXX A;  1ESI A;  3HLC A;  3HVF A;  2XGN A;  1ESU A;  4LCL A;  3VFH A;  5GHY A;  4WEK A;  3Q07 A;  1L0D A;  3LY3 A;  4K0W A;  1H8Y A;  4RX3 A;  2EFU A;  1MWU A;  3PBT A;  1K57 A;  4P85 A;  3ITB A;  5A93 A;  1L0E A;  3IWQ A;  2Y2I A;  3E2L A;  2J9P A;  2DRW A;  1NXY A;  4Y7P A;  5FQI A;  3OZH A;  3WS2 A;  4ZJ1 A;  4Y0T A;  1KE3 A;  3EQU A;  1W79 A;  3MKE A;  2XD1 A;  5AQ7 A;  4ZBE A;  3SS3 A;  4DE0 A;  3HL9 A;  3CG5 A;  1YLZ A;  3B3X A;  4E3M A;  3N8S A;  5FAP A;  2PU4 A;  4WEJ A;  4C75 A;  5CGW A;  5FI2 A;  3NY4 A;  4JXV A;  3AGD A;  4UA6 A;  3HUM A;  4KQQ A;  4WYY A;  4OLD A;  4IBR A;  4OOM A;  4JF4 A;  4PM6 A;  5GLB A;  5HAP A;  2EXB A;  1IYS A;  1FR6 A;  1M40 A;  2XD5 A;  2A3U A;  5D3O A;  3ZDJ A;  4PM7 A;  4QY6 A;  2WKE A;  2P74 A;  1I5Q A;  4K91 A;  4XUX A;  5BOH A;  4QY5 A;  2WKH A;  4FH4 A;  2EX9 A;  2RL3 A;  1PI5 A;  2ZD8 A;  3UE1 A;  3VSL A;  2HP9 A;  1W8Y A;  2QMI A;  4PM5 A;  5I94 A;  1Z6F A;  2ZQ8 A;  4JPM A;  1EI5 A;  4KG6 A;  1HD8 A;  4B4Z A;  1BUL A;  2EFX A;  3V3R A;  1KDS A;  2Y2O A;  1FCN A;  1W8Q A;  1IYP A;  2XEP A;  4OKP A;  5DF7 A;  4ZJ2 A;  1NY0 A;  3MZD A;  4JXS A;  5FA7 A;  1GHI A;  1NRF A;  2Y2N A;  4S2M A;  3E2K A;  2IWC A;  3VP0 A;  3IT9 A;  1KE4 A;  3HLE A;  1ZKJ A;  4GNU A;  2IWD A;  2P9V A;  3C4O A;  4R1G A;  4S2N A;  2X01 A;  1K55 C;  2WZZ A;  4ZJ3 A;  1PZP A;  2J7V A;  5EVI C;  3UN7 A;  4GOG A;  4OQI A;  2JE5 A;  2P9V B;  5GLA A;  4CPK A;  1M6K A;  1YMS A;  1E25 A;  3UO9 A;  4P87 A;  4FH2 A;  3N7W A;  4D2O A;  1CEF A;  3GMW A;  4P6B A;  1ES4 A;  1IEM A;  4MBF A;  1YQS A;  1H8Z A;  5KMW A;  1JWV A;  3VOZ A;  3WRT A;  5TFQ A;  4LCM A;  2ZC3 B;  4HBT A;  3NIA A;  2WGI A;  5F83 A;  3M2J A;  1LI9 A;  4UA7 A;  3IF6 C;  1XGJ A;  3HRE A;  4DKI A;  3LO7 A;  1L0G A;  2HDQ A;  3Q7Z A;  4B88 A;  3DWK A;  4B4X A;  3SOI A;  4KEN B;  4UA9 A;  3GTC A;  1MXO A;  5E2E A;  4QHC A;  4OOL A;  1BSG A;  1MBL A;  1YLP A;  5FI6 A;  3VOY A;  3ZNT A;  1BZA A;  1KDW A;  3MFD A;  2X02 A;  4PM8 A;  5CRF A;  3ZG5 A;  4U3T A;  5A91 A;  5M19 A;  1SCW A;  2Y2K A;  1CI9 A;  4KZ5 A;  5FAS A;  2QPN A;  4RA7 A;  1WE4 A;  3SH8 A;  4BQM A;  3WWX A;  1K25 A;  3S22 A;  3RJU A;  4QB8 A;  4RYE A;  5TR7 A;  4GD6 A;  3IH9 A;  1WYB A;  2ZM2 A;  2JBF A;  2H0Y A;  3G35 A;  3UDI A;  3MZF A;  3PBN A;  4X53 A;  4EBL A;  1N4O A;  5JYP A;  4GKU A;  4EBN A;  2OLV A;  1FSW A;  1TEM A;  2DCF A;  1L0F A;  4IVK A;  4MLL A;  3BFD A;  1C3B A;  1QMF A;  2WZX A;  3DWZ A;  1E3U A;  4N9L A;  2H10 A;  1IYQ A;  5HL1 A;  4BEN A;  1YLW A;  1G6A A;  1KGE A;  5A90 A;  3I7J A;  3A3E A;  3GQZ A;  3Q81 A;  3UNW A;  1FSY A;  4E3I A;  2UWX A;  1MWS A;  4OPZ A;  5EOE A;  4PPR A;  2BG1 A;  3PBS A;  4U0T A;  5CGS A;  4Y0O A;  1BLC A;  2WGW A;  4FD8 A;  1QME A;  2JC7 A;  1BTL A;  3OCL A;  2WKI A;  4KZ9 A;  1NZU A;  4R0Q A;  1XGI A;  1XX2 A;  4JBF A;  4DE2 A;  4LEN A;  4KZ7 A;  1GHP A;  1PWG A;  4GB7 A;  3S1Y A;  1K6R A;  2EXA A;  1TDL A;  1PW1 A;  5CER A;  4DDS A;  4S2K A;  3G30 A;  3IF6 A;  5DTT A;  1JWZ A;  1K54 C;  1MWT A;  5KZH A;  1PIO A;  5AQA A;  5KSC A;  4CJN A;  3SS4 A;  5EVL A;  1NYY A;  4EQI A;  4FCF A;  1PI4 A;  4LV1 A;  2ZQC A;  2OV5 A;  5CED A;  2JCH A;  4YFM A;  3C4P A;  3NCK A;  2Y59 A;  1RGY A;  3O88 A;  3HLG A;  5AQ9 A;  3ZG9 B;  2Z2L B;  3CMZ A;  1FCM A;  3ITA A;  4WZ4 A;  2B5R A;  4MBH A;  1ONG A;  1PZO A;  5CTN A;  3A3J A;  5CEB A;  4E3K A;  4DF6 A;  1ERO A;  3VMA A;  3ZGA B;  3HLW A;  4KQO A;  1FQG A;  3FKW A;  1O7E A;  5EOO A;  2PBY A;  4OPQ A;  2HDU A;  1ERQ A;  2XDM A;  1MWR A;  1YLJ A;  5EUA A;  4P0M A;  3QNB A;  3IXH A;  4R23 A;  5CTM A;  3V50 A;  2Y2P A;  3V3S A;  3VSK A;  1K56 A;  4N9K A;  2ZQ9 A;  3IHA A;  1ERM A;  4BL3 A;  1KVL A;  1CI8 A;  1SHV A;  4IED A;  1ES2 A;  3GVB A;  5F1F A;  3OPR A;  1Y54 A;  1O07 A;  3D4F A;  4OLG A;  4H8R A;  4R3B A;  4ZAM A;  2R9X A;  3FV7 A;  3ZVW A;  1XXM A;  4C3Q A;  3IF6 B;  2HDR A;  2FFF B;  4OON A;  3MXR A;  3BM6 A;  4NK3 A;  5AQB A;  3DTM A;  4OP5 A;  4XUZ A;  4C6Y A;  4BD0 A;  1DY6 A;  5M1A A;  5TGF A;  1BLP A;  2ZC4 B;  1HTZ A;  2Y4A A;  4KZB A;  3O86 A;  2X71 A;  4GZB A;  4O7D A;  4EUZ A;  5L2F A; 
#chains in the Genus database with same CATH topology
 3LJA B;  1UR9 A;  1L2S A;  5CPK C;  4WU9 A;  3FZC A;  4J8W A;  1P3P D;  2OWH A;  1P3B B;  4QU3 A;  1ES5 A;  3AYW C;  2BAS A;  4EXO A;  3QHY A;  4DJ2 A;  1GPF A;  5DF9 A;  1VB6 A;  3WD4 A;  2BLS A;  3A0R A;  5FDH A;  1IEL A;  3B6G A;  3LIE A;  5F5Y A;  4DDY A;  4WLA A;  4EUV A;  3FKE A;  4WEL A;  4E6W A;  4EEP A;  3BFG A;  5B32 C;  2XLN A;  3MZE A;  3AZJ A;  1ID3 D;  1TZY C;  1IYO A;  1BLS A;  1JVJ A;  3AZJ D;  1ID3 A;  4XZQ C;  3W98 B;  1SDE A;  1SKF A;  1U60 A;  4S2I A;  2QZ6 A;  1LI0 A;  5CHM A;  2IWB A;  5M18 A;  4NXE A;  2XA7 S;  3FWL A;  4MNR A;  2EA9 A;  3EQV A;  3Q7V B;  5CGX A;  5HWT A;  4HH2 A;  3F1N B;  4DXC A;  2D49 A;  2O9A A;  2ZC7 A;  4EWF A;  3T4S A;  3CJM A;  4E3O A;  4KGC D;  4GS9 B;  2D01 A;  3V5M A;  2RIQ A;  3R45 B;  2OLU A;  2Y79 A;  5CHJ A;  4KHA B;  3G34 A;  2O9C A;  1T18 A;  1XJ3 A;  3G2Z A;  4WU8 A;  5B2I A;  2CV5 D;  1ZG4 A;  2O0Y A;  1TZY D;  2HIO B;  3NDE A;  4NEE D;  5AVC B;  4WU9 D;  3N8L A;  4G92 C;  2W3H A;  4GN2 A;  4YS3 B;  4EER A;  3WA9 B;  2ZM0 A;  2V2F F;  1E8B A;  3DW0 A;  4X69 A;  4ME4 A;  3ZCZ A;  2PYO D;  4IBX A;  4Q8I A;  1K54 A;  1S6R A;  2Y2J A;  1P3F D;  1E6Z A;  2G7U A;  2I72 A;  2QYB A;  2G2W A;  2W1T A;  2OSU A;  2V8F A;  2WAE A;  5J8X A;  1MZU A;  4FTX A;  2BYK A;  4R70 A;  3UTA A;  5HWV A;  1MKI A;  5F1G A;  1CQA A;  5HW3 A;  4CAY A;  3LZ0 D;  1F1E A;  3UPN A;  5CPK D;  1LL5 A;  4MEZ A;  1W63 M;  4Z1W A;  4Z5T C;  5E2H A;  1AWI A;  3KX0 X;  4Y2F A;  5FEG A;  4UEY A;  1T3U A;  4G91 B;  4HIA A;  3X1T C;  3M6H A;  3OC2 A;  3JYI A;  5GLC A;  1F66 A;  1W1P A;  1HQ3 A;  1U35 D;  3IX4 A;  1P34 D;  4HEF A;  4WL9 A;  3LZ0 B;  3AZK A;  3CUE C;  2CV5 A;  3ZG8 B;  3W98 C;  4KQD A;  5GXQ B;  1YMX A;  5B1M B;  4H9Q A;  2Q9M A;  4EV4 A;  3VH6 T;  2WAF A;  3KWQ D;  1LHY A;  1TAF B;  3W99 A;  1NJ4 A;  2HDS A;  3P98 A;  1KX4 D;  3AZF B;  3KSI A;  3BLM A;  4H9R A;  2Y2M A;  1RCJ A;  3ZHH A;  4JF5 A;  1T19 A;  1IKI A;  5BO0 A;  3UB7 A;  1P34 C;  1EQZ B;  3IS2 A;  4Z66 B;  4KZA A;  1IKG A;  1VEU B;  2VK3 A;  5IHV A;  1HLU P;  3PR6 A;  2B02 A;  3KS4 A;  5EEC A;  3X1T D;  1M18 B;  1T1C A;  1K56 D;  4WN5 A;  1TVF A;  4J8X D;  1LSW A;  3AV2 B;  3KYE A;  4Z5T D;  4YIN A;  5DNN A;  3F6T A;  3REI B;  4FUW A;  4WM9 A;  4HY8 A;  2WYX A;  1FR1 A;  1NZO A;  2W3D A;  4CSR A;  3AV2 C;  3WAA B;  3SH9 A;  2W8S A;  4X23 C;  5BNV B;  3C1B B;  3W4P A;  3A3D A;  4I3I A;  3JPU A;  1P3K A;  4KUD D;  2ZC5 B;  5B2I D;  1OT9 A;  3UME A;  3G2Y A;  3ISG A;  4GW9 A;  5HPF A;  3CUE A;  2H5S A;  2J3T D;  1P3L B;  3QP6 A;  3MNN D;  1BUE A;  3C8C A;  3ZVT A;  3LI8 A;  3ICY A;  1I2S A;  2JKT I;  3UTB D;  1W2E A;  3KO6 A;  4NE3 A;  4KG5 A;  1P3F B;  1OTE A;  4XT2 A;  3LZ0 C;  4NKP A;  4X1M A;  3K2N A;  3B0C T;  4NE5 A;  3V39 A;  4O01 A;  4LV3 A;  1P3K D;  2RTS A;  5B31 D;  3QNC A;  1AXB A;  4KGC C;  5B1L B;  1Q2P A;  5AVC D;  3JVV A;  1K6S A;  4BMW A;  1ESI A;  3HLC A;  3HVF A;  2XGN A;  1P3G B;  3B42 A;  2IOU A;  2XRN A;  5DNN D;  3AZH B;  2NZD A;  1OGB A;  4WEK A;  2PYO C;  1L0D A;  1H8Y A;  2EFU A;  4CLC A;  3AZJ C;  5AV8 A;  2ARO C;  1K57 A;  2ZMV A;  1L0E A;  4X23 A;  3E2L A;  4Z66 C;  4ZJ1 A;  1S67 L;  1KE3 A;  1CF0 A;  3EQU A;  3LIB A;  5AQ7 A;  5FDS A;  5GT0 B;  4UUZ B;  5JA4 A;  1ED7 A;  2PU4 A;  5FAP A;  5CGW A;  2AVX A;  3REK A;  5CPK B;  1XFN A;  2HZ5 A;  3R7W B;  4ZUX B;  1IYS A;  3LJA C;  5D3O A;  2A3U A;  1XJ6 A;  4QY6 A;  2K7S A;  5AV6 A;  2LB5 A;  2WKE A;  3NOT C;  4QY5 A;  2EX9 A;  2YFV A;  2ZD8 A;  1S32 B;  1QO6 A;  3L7H A;  4JPM A;  4J8U C;  3REJ D;  5HSQ A;  1P3I D;  2YFW A;  3K3D A;  3V3R A;  2JKR M;  4XZQ D;  1IYP A;  1D06 A;  3MZD A;  3UTB C;  1T1A A;  2Y2N A;  5GT3 B;  3E2K A;  3NEC A;  4IUK A;  1KE4 A;  2P9V A;  1K55 C;  5CPK A;  1P3A A;  3A1I A;  5LBR A;  4GOG A;  4BBV A;  3EPK A;  4MN6 A;  5GT0 A;  3UT9 A;  1YU0 A;  4FH2 A;  3N7W A;  4P87 A;  4IJG A;  2VQR A;  3REL C;  3GMW A;  1IEM A;  5F99 D;  3FC7 A;  1YQS A;  4MBF A;  1JWV A;  3WRT A;  2VLG A;  1G28 A;  1Z09 A;  1XGJ A;  3AV2 D;  4OUI A;  1G6O A;  2Y8H A;  4LG2 A;  2HDQ A;  3H0M C;  3Q7Z A;  4B88 A;  3GTC A;  5E2E A;  2YFW B;  3ZNT A;  5CPJ A;  3REK D;  5EM1 A;  2P08 A;  1SCW A;  3KXB D;  4KZ5 A;  2F8N H;  3MR0 A;  3RJU A;  5BPV A;  4RYE A;  3GDI A;  4J8U A;  4JGP A;  2V8C A;  1EAK A;  5TR7 A;  1S4R A;  2H0Y A;  3G35 A;  5AV8 D;  2W3F A;  1OJ5 A;  5IT5 A;  3REK B;  3KFU G;  4GKU A;  5CP6 C;  4H9S C;  4Y13 A;  4HGA B;  3L26 A;  1W1Y A;  2NZD D;  3BJN A;  3BWL A;  4UUZ A;  3DWZ A;  4Y3I A;  2H10 A;  3T4Q A;  3L25 A;  1G6A A;  1F5M A;  3I7J A;  3ZQ5 A;  3TU4 D;  5CGS A;  1U35 C;  4IBC A;  2WGW A;  4FD8 A;  4G91 C;  3PXP A;  2ZY3 A;  4L9F A;  4BBU A;  2FJ7 B;  3REI D;  3AZH A;  4LD9 A;  1XGI A;  2JKR I;  3DAV A;  4I38 A;  4LEN A;  1PWG A;  3S1Y A;  1TDL A;  4LD9 D;  1PW1 A;  3H0L C;  3G30 A;  4HME A;  4S2K A;  1FIK A;  1M1A D;  1PIO A;  5DNN B;  3REI A;  3AZH D;  2GX5 A;  5B1L A;  2W3E A;  3EEH A;  1TS8 A;  3WKJ C;  2ZQC A;  5J4E A;  3MNN A;  5AY8 A;  3MGS C;  1M18 A;  2Y59 A;  5B40 A;  3MGQ C;  3B6F A;  1RGY A;  3HLG A;  4XT2 B;  5E5A C;  2CMN A;  4WZ4 A;  1PZO A;  5CTN A;  4Y17 A;  5L10 A;  3B47 A;  4AWL B;  4IUH A;  5BO0 B;  2M7U A;  3AZM B;  5IU1 A;  3CHW P;  4H9N A;  1O7E A;  4HJ6 A;  1H8M A;  4JJN C;  3PYP A;  2KDK A;  5C3I C;  1F66 C;  5JRG A;  3AZI C;  5B1M A;  2WKR A;  3LYX A;  3IBJ A;  3V50 A;  3V3S A;  4P6Z M;  1P3O C;  4ETZ A;  5AY8 D;  1ERM A;  4LLO B;  1KX4 A;  4NZ4 A;  3GVB A;  4ETX A;  3AN2 D;  4ZBJ B;  4OLG A;  4X25 A;  2O9B A;  3IX8 A;  1M19 A;  2R9X A;  3ZVW A;  3W96 D;  2ZY2 A;  3OOV A;  1TF1 A;  4OP5 A;  1P9R A;  4XUZ A;  4QNL A;  1O6I A;  2NUT C;  3REH C;  2LY8 A;  4LD9 B;  2IO5 B;  1BLP A;  2ZC4 B;  1VEU A;  5HDS A;  1YU3 A;  4O7D A;  2HUE B;  5L2F A;  4RVA A;  3CIT A;  5AJG A;  4P6Z S;  5DNM B;  1P3O D;  4CLC D;  4R8P D;  5HX9 A;  1ZLA D;  1PFL A;  3BEC A;  3MFX A;  3HJK A;  3GV9 A;  3A0S A;  3X1S D;  2I9V A;  3KSG A;  4OJP A;  4X55 A;  3X1S A;  3WD2 A;  1YLT A;  4UAA A;  1KX3 B;  4J8U B;  3AZK B;  1D1J A;  3IH8 A;  3UY6 A;  1KGG A;  4IBE A;  1OGG A;  4PMA A;  3S7P A;  3IHB A;  4PKY A;  1P3I B;  4LV2 A;  2GDN A;  5F69 A;  4OPR A;  1LLB A;  2EX6 A;  4IBG A;  3FG8 A;  4L9G A;  3MGS D;  4S2O A;  4IJF A;  3WKJ D;  4N1X A;  4CQH A;  3AZM C;  1P9W A;  4QPR A;  3IWI A;  1H0I A;  3DBA A;  5E43 A;  3N3F A;  4NZ5 A;  3UDF A;  2F8N D;  1YKD A;  5CX7 A;  3Q7V A;  3CI6 A;  4ZDX A;  2RVQ D;  3UTA B;  4QJG A;  2Y2L A;  4GDN A;  1KX5 B;  3QP5 A;  4ZRR A;  3TU4 C;  4DRT A;  3SZT A;  4MB5 A;  5J3W A;  2FH5 A;  1OTI A;  1CEG A;  4GH9 A;  4S2J A;  4M3K A;  1GA9 A;  5U47 A;  3B6G B;  1OME A;  3G4P A;  4F3L A;  5AVC A;  3REL B;  3AGE A;  1J3W A;  3PAE A;  2Y2H A;  1MKM A;  2A2L A;  3BFE A;  4HJ4 A;  1S1Z A;  1FIL A;  2W0N A;  3R45 A;  3FYZ A;  4XXR A;  4AFI A;  2YFV B;  2PD8 A;  3WS4 A;  5GLD A;  3REK C;  2VKS A;  4IHQ A;  4IVI A;  2HP6 A;  2IA2 A;  3HLD A;  1HQ3 C;  5B33 B;  4ZUX A;  3WTP B;  2PYP A;  4N1H A;  3W98 A;  5B0Y D;  1KX3 A;  2HP5 A;  3OPL A;  3BY9 A;  3X1S B;  3UPP A;  3BEB A;  2EX8 A;  3PBQ A;  3VP3 A;  4X23 B;  1KS0 A;  1STZ A;  2WKP A;  3LCE A;  4MMN A;  5DNM D;  1ZLA B;  3VP2 A;  4CLC B;  4OVD A;  4R8P B;  1UWN X;  5DNM A;  3O87 A;  3G31 A;  4FSF A;  1I2W A;  1ZLA C;  3KXB A;  4OOY A;  2JKT M;  3WX7 A;  1M18 C;  3UT9 C;  3X1T A;  4KQR A;  1KX5 C;  5DTS A;  3NOU C;  4DXB A;  1PDC A;  4R4S A;  1M1A A;  5EPH A;  3REJ C;  3IBR A;  1MY8 A;  2V1Z A;  5CXW A;  4WU9 B;  2VV7 A;  1P3F A;  4Z2H A;  3BLS A;  2Y2G A;  2ZQA A;  4K08 A;  3MQQ A;  4A5R A;  5BNX B;  1N1J B;  1CK7 A;  5AV9 B;  3LJA D;  3KWQ B;  3ZG0 A;  3HJI A;  4O8G A;  4DRA A;  2KLI A;  4NYU A;  5HD3 A;  4JXW A;  4WZ5 A;  3MGR B;  2XF3 A;  4WU8 D;  1JNU A;  4XUJ B;  5JRG B;  1JTD A;  4GDB A;  1P3A D;  2JN7 A;  3QP1 A;  5AV9 C;  2FJ7 D;  1F66 D;  3NUL A;  3G32 A;  2ARO D;  5B0Z A;  4WBG A;  3T4L A;  2Z2M B;  3TSG A;  1W1V A;  3Q82 A;  3W97 B;  4Z2K A;  3OPP A;  3P7N A;  3RH8 B;  1PRQ A;  4BBT A;  1S66 L;  1Z2C B;  3N4I A;  5HAR A;  3LEL C;  3AFA B;  5FQM A;  1L6J A;  3MGP B;  4EBP A;  4L0L A;  3WD0 A;  4WNN B;  3H82 B;  4KZ3 A;  1YM1 A;  1PWD A;  5B31 C;  3M2K A;  1E6R A;  1WYC A;  3MGR D;  4E6X A;  3EGX C;  1EQZ A;  2PRF A;  3AZH C;  3FDD A;  1M1A C;  4DRB A;  1GSW A;  2ZOH A;  1EQZ D;  4QD4 A;  4H9R B;  1XJ4 A;  4JJN B;  1M19 D;  2GNX A;  2WGW B;  3N8R A;  5B2J C;  2J3W A;  4NET A;  3MNN C;  5FQK A;  4ZTK A;  2J3T C;  3KUY A;  2LB9 A;  3LZ1 D;  3VFH A;  2CV5 B;  3Q07 A;  4K0W A;  4GHA A;  1MWU A;  4Z2L A;  2V0W A;  4MN5 A;  2WKQ A;  3ITB A;  4J8X B;  4H9P A;  1NXY A;  4Y7P A;  5FQI A;  3NQJ A;  4JJN A;  3MKE A;  4KUO A;  3F1O B;  3CG5 A;  3N8S A;  4XUJ C;  3MGR C;  3AGD A;  2HGV A;  3E4O A;  2J80 A;  4IBR A;  4PM6 A;  5CPJ B;  1FR6 A;  5MC7 A;  5AV5 C;  3LIA A;  5FUG A;  1TZY B;  1ULY A;  1I5Q A;  3MGP A;  1ODV A;  1P3M B;  3AZL A;  4FH4 A;  1PI5 A;  3KSY A;  5A8B A;  3X1U B;  1Z6F A;  1EI5 A;  1BH8 B;  1BUL A;  3LFV A;  2XEP A;  2FJ7 C;  3IX3 A;  4OKP A;  5B31 B;  2KX6 A;  5B0Z B;  1GHI A;  1NRF A;  2IWC A;  3UB6 A;  2ARO B;  2J8P A;  1ZKJ A;  2PR5 A;  3C4O A;  3VH5 T;  2X01 A;  1DP8 A;  1H0G A;  1P3A B;  4ZJ3 A;  1PZP A;  5B2I B;  4WU8 B;  5EVI C;  3UN7 A;  4TX8 A;  1DRM A;  3WTP C;  2JE5 A;  2P9V B;  2F8N A;  2QJ7 A;  2VGL M;  3UO9 A;  5GSU C;  3C2W A;  3B33 A;  4Y5F A;  5B33 D;  3MMH A;  4I3A A;  4KGC B;  4ZUX C;  3AZE D;  4LCM A;  5B24 A;  1XFQ A;  3NIA A;  3F1N A;  1JFI A;  3M2J A;  4ESP A;  1LI9 A;  1B6W A;  3IF6 C;  4DKI A;  4BWI A;  1KX5 D;  1BH9 B;  3DWK A;  2JHE A;  4B4X A;  4ZUX D;  3SOI A;  3T4T A;  4UA9 A;  3H9W A;  4QHC A;  2GJ3 A;  4OOL A;  3DTE A;  2NQB D;  1BSG A;  1MBL A;  3A6N A;  4H9S A;  1YLP A;  1YSQ A;  3EEA A;  5FI6 A;  1KDW A;  3MFD A;  2VGL S;  4PM8 A;  4NXF A;  5M19 A;  4H9O A;  2Y2K A;  4LGW A;  3V9R A;  2M1C A;  5JA4 B;  1H3Q A;  4H6J B;  2INW A;  3REJ B;  3S22 A;  4PKY G;  4R8P A;  4GHL A;  4GD6 A;  3IH9 A;  1L3L A;  1WYB A;  3UDI A;  3PBN A;  4IBB A;  4EBN A;  2OLV A;  5CPJ C;  3REJ A;  2DCF A;  4IVK A;  3PHY A;  3KUY D;  4J8W D;  1C3B A;  2WZX A;  5HL1 A;  4N9L A;  1E3U A;  2GZA A;  1YLW A;  3X1V B;  3WTP A;  3GQZ A;  4E3I A;  2UWX A;  1MWS A;  4OPZ A;  1Y28 A;  5EOE A;  3VE4 A;  3U4L P;  3PBS A;  4U0T A;  5GSU A;  5DJT A;  4I5S A;  2JC7 A;  5AVC C;  5KIZ A;  1BTL A;  4KZ9 A;  1NZU A;  4R38 A;  4DE2 A;  3UB9 A;  1P34 B;  1GHP A;  2XA7 M;  4PAU A;  1JFI B;  1K6R A;  4XUJ D;  5CER A;  3IF6 A;  1MWT A;  3NOP C;  3O62 B;  5B24 D;  5KSC A;  2F2A C;  4FCF A;  4LV1 A;  1F98 A;  4YFM A;  1P3L A;  1WA9 A;  1T1B A;  2VZW A;  3CLO A;  3MSH A;  4Q0I A;  5F68 A;  3K3C A;  3KSF A;  3W97 D;  3ITA A;  2PYO A;  4MBH A;  1ONG A;  3D9Y A;  3A3J A;  1OPX A;  3LZ1 C;  3AZG A;  5B0Z D;  2ARO A;  4EO5 B;  1UR8 A;  5C5K A;  5B31 A;  1D7E A;  5BNV A;  3C1B A;  1M19 C;  2XDM A;  1BH8 A;  5EUA A;  4P0M A;  1R4V A;  4Z2M H;  3QNB A;  1EQZ C;  4R23 A;  5E5A A;  1ZHH B;  3W96 A;  4Z5T B;  1P3M D;  5HDC A;  3OBF A;  1J7M A;  3RTY A;  1PNE A;  5AV6 C;  1KVL A;  1U35 B;  4IED A;  4J8X C;  4G3W A;  1W63 Q;  2Z6D A;  4EEU A;  4ZAM A;  4H8R A;  4KUK A;  4QLC B;  3FV7 A;  5JRG C;  4C3Q A;  4OON A;  4GJ4 A;  4NK3 A;  3BM6 A;  3AZN B;  3KSH A;  3F1O A;  3NJA A;  4KUD A;  5TGF A;  1HTZ A;  3KYQ A;  4GHI A;  5AVB C;  2X71 A;  3EPJ A;  3W2Z A;  1KX4 C;  4EUZ A;  3WD1 A;  4H9Q B;  2Q9N A;  4M4X A;  1P3L C;  5HL6 A;  4EET B;  1ES3 A;  4WU8 C;  5EVI B;  3AFA D;  3TJZ C;  3A3F A;  4X68 A;  3W98 D;  2VGJ A;  4E3J A;  5B40 D;  3LZ1 A;  3REH A;  5F82 A;  3MGS B;  4I3J A;  4OJ6 A;  3REH D;  2XFS A;  2C6W B;  3LIC A;  3C1B C;  3P5J B;  1ZG6 A;  3N6I A;  4YM6 A;  2XR0 A;  3FKV A;  3PBR A;  4JXG A;  5DVA A;  4IBJ A;  3MGP D;  2D02 A;  4RQ9 A;  3IXD A;  2PU2 A;  1YUE A;  2ZY4 A;  3MKF A;  3TU4 A;  5AV5 B;  3MQ0 A;  2Q0O A;  2WUQ A;  1XJ2 A;  3HBR A;  4S2N C;  5GT0 D;  2Y91 A;  3E98 A;  5G49 A;  5EVI A;  1OJG A;  3H7W B;  3IXB A;  2A24 A;  4EW7 A;  3LID A;  3AZG B;  2VV8 A;  5FAQ A;  3T12 B;  2ZC6 B;  3B6G D;  1H3O A;  5GT3 C;  4ZBJ C;  3MBZ A;  3OPH A;  1OT6 A;  5CHL B;  3AV1 C;  4JF6 A;  3T4O A;  1KVM A;  2OAQ 1;  3AZM A;  4MDZ A;  3RXW A;  1LT0 A;  3TG9 A;  4WU9 C;  3WS1 A;  1HTA A;  5E5A D;  3M6B A;  5A92 A;  4HBU A;  3IXG A;  3D72 A;  4Y0U A;  1K0K A;  4PHT A;  1NLY A;  1E88 A;  3B0B A;  2JKG A;  1HQ3 D;  2HUE C;  1U35 A;  4Z2I A;  5B40 B;  4MBK A;  5AY8 B;  4LD9 C;  3FPW A;  2HJE A;  1NRJ A;  4RX2 A;  3TOI A;  3L28 A;  1H5X A;  4HH3 A;  3W4Q A;  1E4D A;  1K4E A;  4HMD A;  1M1A B;  4HP9 A;  3UE6 A;  3CZD A;  4OP8 A;  5B40 C;  4R4R A;  1LL9 A;  2XK1 A;  5GHX A;  2ZY5 A;  5F99 B;  5CHU A;  3BFC A;  4R3A A;  3P09 A;  3AFA C;  1ID3 C;  1TS7 A;  2PYO B;  3NC8 A;  1V9Z A;  5B32 D;  5FQQ A;  5CP6 D;  4H6J A;  3ZYT A;  1ZLA A;  1BYW A;  1YU4 A;  3X1V D;  4NZ3 A;  3S7O A;  4H9O B;  3ZG7 B;  5GHZ A;  3PBO A;  3NDG A;  4GLQ A;  5B1M C;  3O5Y A;  5FEF A;  1P3P B;  4KG2 A;  2R9W A;  3VP1 A;  2QKP A;  1DP6 A;  1BH9 A;  5G4Z A;  3MXS A;  1LL8 A;  2ZBB A;  3AYW D;  4NZ1 A;  4Q0J A;  4ARZ A;  1V9Y A;  3KYZ A;  1GA0 A;  3T1S A;  2WGV A;  1KX3 C;  5AV6 D;  1AOI C;  1VHM A;  4DE1 A;  5EVE A;  1JTG A;  3LR4 A;  1F2K A;  3WA9 D;  5BS7 A;  1XP4 A;  4L9E A;  4NXB A;  3GRJ A;  5GL9 A;  1CXW A;  3BYD A;  3MQO A;  3NQU A;  3T1R A;  1MPL A;  2XH9 A;  2E8I A;  3REL D;  5B1M D;  1K38 A;  2L5A A;  1VQQ A;  4XZQ B;  4BL2 A;  5B0Z C;  3ZFZ A;  1TDG A;  1FOF A;  3MVD A;  3AYW B;  3UTA C;  1DJB A;  3OLO A;  4OQG A;  1YPR A;  1XPB A;  1Q9C A;  3EWK A;  3EPL A;  2CC1 A;  2Y2Q A;  4CLC C;  1XKZ A;  3X1U A;  4Z2J A;  1TS6 A;  4I39 A;  5FI7 A;  2UV0 E;  2WK0 A;  5CEC A;  4K0X A;  1N9B A;  1KGF A;  2ZMF A;  4EU0 A;  2FZ0 A;  2RCX A;  3BY8 A;  4JGR A;  3LY4 A;  2HIO C;  3S4X A;  5B1L D;  2ZQD A;  4IJE A;  3B0C W;  5B0Y A;  5B24 B;  1XA7 A;  3C1C B;  3LUQ A;  4NFT A;  1EWZ A;  3Q1F A;  4HI4 A;  2ZMA A;  5AV6 B;  2ZOI A;  5CPI C;  3NBL A;  4R3J A;  4HOI A;  2P04 A;  4J8W C;  3KUY C;  3C1C C;  3AZI A;  2V1B A;  2A49 A;  1S32 C;  2K31 A;  4LRX C;  4X56 A;  5E2F A;  2XQZ A;  3BFF A;  3AZI D;  3SS5 A;  3R4K A;  3UTB A;  3IP4 C;  3IF5 A;  2VV6 A;  1PW8 A;  2W3G A;  3B6G C;  2L0W A;  4LV0 A;  3BRM A;  3HLF A;  5AV8 B;  1W7F A;  4U0X A;  3VFF A;  4YS3 D;  2QHK A;  3CWF A;  3AZE B;  2NZD B;  1P3M A;  3LY3 A;  5B32 A;  5GT0 C;  5FUG B;  3PBT A;  4G3K A;  5HDD A;  4P85 A;  4J8V B;  3IWQ A;  5B2J A;  3MGP C;  4Y0T A;  2KOI A;  4WNN A;  3H82 A;  4ZBE A;  5TJJ A;  4NY2 A;  3QP2 A;  5L07 A;  4E3M A;  4HMC A;  3B3X A;  1Y4O A;  4C75 A;  3AZE C;  4JXV A;  4UA6 A;  3NQJ B;  4WYY A;  2JSS A;  4OLD A;  4OOM A;  5GLB A;  3AV1 D;  2EXB A;  1M40 A;  3TRC A;  2XD5 A;  3CPT B;  4WF0 A;  3DTK A;  4YS3 C;  1KX4 B;  4PM7 A;  2ZL1 A;  2EWW A;  3AV1 A;  3AZF D;  5GT3 D;  4G92 B;  5BOH A;  2P74 A;  4XUX A;  2PR6 A;  3E4P A;  4AWL C;  5B2I C;  1W8Y A;  4XUJ A;  4PM5 A;  3D3O A;  4KG6 A;  3MGR A;  4LFU A;  2EFX A;  1KDS A;  1W8Q A;  4ZJ2 A;  1NY0 A;  4JXS A;  1P3K B;  5FA7 A;  3KWQ A;  1N1J A;  3IT9 A;  5HD5 A;  5CPI D;  2H28 A;  3HLE A;  4GNU A;  1AOI B;  2IWD A;  4NE6 A;  1H0M A;  2WZZ A;  2F8N G;  3KXB C;  3WAA D;  5GLA A;  4CPK A;  5AV5 D;  5EV0 A;  4D2O A;  3MNN B;  1CEF A;  5B2J B;  1H8Z A;  3VOZ A;  4EQ1 A;  4Z66 A;  2ZC3 B;  2WGI A;  5F83 A;  3KXB B;  4UA7 A;  4LRY C;  4YM6 C;  1ZTU A;  3L9K A;  3AZE A;  4KEN B;  5AVB D;  4DN0 A;  4DMZ A;  3VOY A;  1BZA A;  4G3V A;  5A91 A;  1S4S A;  1CI9 A;  2ACG A;  4RA7 A;  1WE4 A;  4BQM A;  3WWX A;  3W97 C;  5JRG D;  1K25 A;  4Z2M G;  5AV9 A;  2JBF A;  3LGO A;  3MZF A;  4EBL A;  3T4K A;  5BS7 C;  1FSW A;  2K2N A;  1P3I C;  3V67 A;  4J8U D;  4MLL A;  1AOI D;  3BFD A;  1KX3 D;  4UQI M;  5B0Y B;  3UNW A;  1GSX A;  3G6O A;  1WWI A;  4PPR A;  4Y0O A;  1BLC A;  1F9I A;  3REL A;  5B32 B;  4F3L B;  2Z6C A;  4E44 A;  3VE3 A;  4JBF A;  4KZ7 A;  2NUP C;  4GB7 A;  2EXA A;  4DDS A;  5DTT A;  5I5L A;  1K54 C;  5KZH A;  1W1T A;  3L29 A;  4CJN A;  3SS4 A;  4EQI A;  4YWZ A;  3VV4 A;  4O0P A;  3VOL A;  3HCY A;  1KX5 A;  3VH6 W;  2IO5 C;  4HNB A;  3NHQ A;  2Z2L B;  1YAX A;  1FCM A;  2B5R A;  5IS1 A;  1A7W A;  5CEB A;  3NQU B;  4E3K A;  4DF6 A;  1ERO A;  3E0Y A;  3ZGA B;  5CP6 B;  3B0D B;  3HLW A;  4HGA C;  1FQG A;  4II7 A;  2NQB C;  1OTB A;  3FKW A;  5CPI A;  5EOO A;  2ZM5 A;  2PBY A;  4OPQ A;  2MJ6 A;  1ERQ A;  3F1P B;  3S7N A;  1MWR A;  3TE8 A;  3C1C A;  2PD7 A;  5CP6 A;  5CTM A;  1S32 A;  1P3I A;  2Y2P A;  3MVD D;  2V1A A;  3VSK A;  3AZK C;  1K56 A;  4N9K A;  1M18 D;  4EES A;  2ZQ9 A;  4IBD A;  1S1Y A;  5B33 C;  4BL3 A;  1OTA A;  1SHV A;  2G5I C;  5DFY A;  1ES2 A;  5F1F A;  5GSU D;  5AVB B;  3AZJ B;  3OPR A;  1XXM A;  3WTP D;  2FFF B;  3VH5 A;  3UB8 A;  3MXR A;  5AQB A;  3MVD B;  3AYW A;  3JVU A;  1DY6 A;  5FL3 A;  3M7P A;  3VH6 A;  2Y4A A;  4HJ3 A;  3O86 A;  5F99 A;  4X23 D;  3AZK D;  3LEL B;  3MVD C;  2C5W B;  3TW8 A;  3W4O A;  4J8W B;  1BT5 A;  4S2L A;  1H8P A;  2V20 A;  1M19 B;  3C1B D;  3A6N D;  2VGK A;  5FAO A;  1PZR A;  3ZNY A;  4ARZ B;  5GXQ C;  2EX2 A;  2J9O A;  1HZO A;  3HUN A;  5HAI A;  1PWC A;  5EVI D;  1P3B C;  2Y55 A;  1DJC A;  1PYY A;  1J9M A;  2WAD A;  2L4R A;  2H0T A;  3KWQ C;  1P3L D;  2NQB B;  5E2G A;  4BLM A;  4BD1 A;  3AN2 B;  1P0Z A;  4F94 A;  2OAP 1;  3PAG A;  2XFT A;  3OCN A;  3SW1 A;  3LIF A;  5G49 B;  5EFW A;  3WS5 A;  3KS8 A;  4J8V C;  4OQH A;  3B6F B;  3GR2 A;  5B2J D;  4HES A;  5KSH A;  1P97 A;  2E8J A;  5AV5 A;  3WRZ A;  1GHM A;  3WAA A;  4MB4 A;  4OH0 A;  3L2A A;  3AZL C;  3IWO A;  2FFY A;  4GD8 A;  1G5U A;  3AZM D;  4E04 A;  3C7U A;  3HUO A;  1W5D A;  1P3M C;  3LEQ A;  2ZM8 A;  3HLB A;  2VJW A;  3AZL D;  2FJ7 A;  2M7V A;  5EE8 A;  5FQJ A;  1BFM A;  1FCO A;  2G5H C;  2ZQ7 A;  4Z2G A;  1CJF A;  1NYM A;  5HAQ A;  4KZ4 A;  1P3F C;  1RP5 A;  3ULF A;  3C7V A;  3A0V A;  2HPB A;  5DJU A;  2L1M A;  2J8Y A;  1VM1 A;  4WMC D;  1S0W A;  3AZF A;  1DJA A;  3UMD A;  1WWS A;  3WD3 A;  1Q2Q A;  1ZC2 A;  4X6T A;  4H9N B;  2VEA A;  5TBM A;  4JLF A;  2ZL1 B;  3LEZ A;  3C30 A;  1AIW A;  4E3N A;  4WUJ A;  1BLH A;  4WZ5 C;  5FAT A;  2PYR A;  2R78 A;  3NI9 A;  2CV5 C;  2ZJ9 A;  5B24 C;  1ONH A;  4KUD B;  3AZG C;  5EM0 A;  1YT4 A;  3FPV A;  4N92 A;  1P3B D;  3VP4 A;  2HJ9 C;  2JKF A;  3TU4 B;  5C3I B;  1F66 B;  5A90 A;  4S2P A;  3W99 C;  5HZH A;  1MC0 A;  2OWJ A;  4PM9 A;  1B67 A;  4J8V A;  2HV1 A;  5DTK A;  2YKF A;  3A6N C;  3X1U D;  3LEL D;  3W96 C;  2V9A A;  3WAA C;  3LR5 A;  3UE3 A;  4YM6 B;  3LEL A;  1K55 A;  1RGZ A;  5AVE A;  3AN2 C;  2PAV P;  4Z5T A;  3W96 B;  3MF0 A;  3GSG A;  5AY8 C;  3MGS A;  3A3I A;  5CPJ D;  4QLC D;  3B6F C;  5AV9 D;  3EG5 B;  2W1T B;  5HFO A;  3LR0 A;  5L09 A;  2VX8 A;  5FSR A;  4NXG A;  3PTE A;  3E4Q A;  1KOU A;  2BYM A;  4R6L A;  1TS0 A;  1SDN A;  5K5B A;  3AZI B;  1UGU A;  3RFB A;  5AVB A;  3MS6 A;  4GHI B;  3WA9 A;  3AZF C;  4ID4 A;  4BJP A;  3UPO A;  4WV4 B;  4WMC A;  2HIO A;  1G68 A;  5FQ9 A;  5B0Y C;  3W8K A;  4DJ3 A;  3BW6 A;  4MCW A;  4KZ6 A;  3AGF A;  1JWP A;  2QJ5 A;  3MGQ D;  4JKT A;  1P3P C;  3MXQ A;  4E3L A;  1P34 A;  1IOU A;  4YOF A;  3F1P A;  3C38 A;  4GS9 A;  2PBD P;  3T4J A;  2V0U A;  5CPI B;  1SKO A;  1XA1 A;  4FOF A;  4UHU A;  1CK3 A;  5GSU B;  5HWW A;  5B31 G;  1GXD A;  3R7W A;  2ZLY A;  3WS0 A;  3L27 A;  1ALQ A;  3UDX A;  2F8N K;  3O3V A;  5DNM C;  5G18 A;  1ID3 B;  1YLY A;  1NLZ A;  2G2U A;  5DF8 A;  4B9O A;  3UT9 B;  1HVB A;  4UQI S;  4JGQ A;  1ACF A;  1GCE A;  4OQ0 A;  1KE0 A;  3IQA A;  1P3G D;  2NZD C;  3C1C D;  5JYO A;  4UPK A;  3T1X A;  1K4F A;  5GT3 A;  5AV8 C;  1K57 C;  1P3G A;  2PHY A;  2XSS A;  4HHD A;  2DNS A;  4Z9Q A;  4KZ8 A;  1DP9 A;  4Y15 A;  3UE0 A;  3C5A A;  3SH7 A;  4DE3 A;  4OPY A;  1E3U D;  3RXX A;  1E15 A;  3MGQ A;  4B93 A;  1ESU A;  4LCL A;  1P3B A;  2DF4 C;  5GHY A;  2DMW A;  4RX3 A;  3MGQ B;  3LJA A;  1P3P A;  3EPH A;  5A93 A;  4IBI A;  2Y2I A;  4KGC A;  2J9P A;  2DRW A;  1OTD A;  3X1V A;  3OZH A;  3WS2 A;  2W27 A;  1W79 A;  2XD1 A;  3MJQ A;  3SS3 A;  4DE0 A;  3HL9 A;  1YLZ A;  2F8N B;  4D60 A;  4WEJ A;  4NG2 A;  5FI2 A;  3NY4 A;  3HUM A;  4KQQ A;  4Q0H A;  1YSP A;  4JF4 A;  5HAP A;  3O62 D;  3CAX A;  3ZDJ A;  3P01 A;  5DKK A;  5BT1 C;  3T1Q B;  2CWE A;  1E6N A;  4K91 A;  2WKH A;  3V9R B;  3UE1 A;  2RL3 A;  3VSL A;  2HP9 A;  4QWO A;  4CSR B;  4R8P C;  2QMI A;  5B32 G;  5I94 A;  2ZQ8 A;  3A6N B;  4E45 A;  1HD8 A;  4B4Z A;  4YM6 D;  2Y2O A;  1FCN A;  5DF7 A;  4OJL A;  4WZS B;  4NYY A;  1SKO B;  4S2M A;  1TZY A;  3VP0 A;  5J7E A;  3UB5 P;  4R1G A;  4S2N A;  1P3O B;  2FN2 A;  3IS2 B;  2J7V A;  4OQI A;  3EGD C;  5DFX A;  1AOI A;  3BQ8 A;  1M6K A;  4HP4 A;  1YMS A;  1E25 A;  1UWP X;  5F6A A;  5L8M A;  4P6B A;  1ES4 A;  4MN7 A;  1TAF A;  3W99 B;  3S7Q A;  1N9L A;  4H9P B;  1H3O B;  5KMW A;  3X1S C;  3B0D C;  5TFQ A;  3X1V C;  4HBT A;  3AZN C;  5GXQ A;  4IBF A;  3HRE A;  2EWV A;  1P3A C;  2A24 B;  4Z66 D;  3LO7 A;  3H7W A;  3AZN D;  2BYM B;  3VH5 W;  1L0G A;  4QLC C;  3B6F D;  3AL0 C;  3KUY B;  3AV1 B;  4JJN D;  2OOL A;  1HQ3 B;  1MXO A;  4CLC E;  4LPZ A;  3CPT A;  2XRO A;  2PDR A;  3WKJ B;  4X1L A;  2O99 A;  4HQA A;  3T50 A;  3EOI A;  5AVF A;  5DNN C;  1VET B;  2X02 A;  5CRF A;  3ZG5 A;  4U3T A;  5FAS A;  2QPN A;  3AZL B;  3X1U C;  3AV2 A;  4JGO A;  3SH8 A;  4QB8 A;  3W99 D;  4WJ3 C;  5KDM B;  2ZM2 A;  1P3K C;  1LSX A;  3WTP E;  1N9N A;  2YKH A;  4X53 A;  5HPI A;  1EW0 A;  1N4O A;  5KDM A;  4LRZ E;  5JYP A;  4EO5 C;  2BYK B;  1KU5 A;  1TEM A;  4M6B A;  3LZ1 B;  3REH B;  2HF6 A;  3UT9 D;  3AZG D;  1E6P A;  1L0F A;  3AFA A;  1QMF A;  3H0R C;  4OJO A;  1IYQ A;  4BEN A;  3REI C;  1KGE A;  1VET A;  3W97 A;  3A3E A;  3Q81 A;  3WKJ A;  1FSY A;  4J8X A;  5BT1 D;  1GOI A;  2BTF P;  1YU2 A;  2BG1 A;  3GEC A;  3UTB B;  1NWZ A;  5TBM B;  3O62 C;  1IFQ A;  1QME A;  3OCL A;  2WKI A;  4R0Q A;  1XX2 A;  3LZ0 A;  3AZN A;  4KUD C;  1N9O A;  1X0O A;  3U2A A;  1JWZ A;  1S32 D;  5AQA A;  2V5O A;  4QLC A;  5EVL A;  3MQL A;  1NYY A;  3HSH A;  1YU1 A;  1PI4 A;  2OV5 A;  5CED A;  2JCH A;  3C4P A;  2VA0 A;  3NCK A;  3O88 A;  3DTI A;  4OJ5 A;  5BNX A;  5AQ9 A;  2P7J A;  3ZG9 B;  3CMZ A;  4CAY B;  2B18 A;  1P3O A;  2PT7 A;  4IBK A;  2W1R A;  5E5A B;  3VMA A;  3A1K A;  4J8V D;  3QP8 A;  3LI9 A;  4KQO A;  5B1L C;  5G4Y A;  2HIO D;  3LR3 A;  2HDU A;  1A0K A;  3X1T B;  4GCZ A;  1YLJ A;  1GSV A;  5DKL A;  3IXH A;  4MB3 A;  4YNR A;  1P3G C;  4YS3 A;  3AN2 A;  3IHA A;  5F99 C;  4DQY B;  1CI8 A;  2QWS A;  2NQB A;  3UTA D;  4XZQ A;  1Y54 A;  1O07 A;  1LSV A;  3D4F A;  1TD5 A;  4R3B A;  3BQA A;  3O62 A;  2DQN C;  3IF6 B;  2HDR A;  4KHA A;  5GXQ D;  3DTM A;  2RVQ C;  4C6Y A;  4BD0 A;  5M1A A;  3QP4 A;  4KZB A;  3HON A;  5B33 A;  1SZV A;  4GZB A;  3WA9 C;  2B95 A; 
#chains in the Genus database with same CATH homology
 3LJA B;  1L2S A;  5CPK C;  4WU9 A;  3FZC A;  4J8W A;  1P3P D;  1P3B B;  4QU3 A;  1ES5 A;  3AYW C;  3QHY A;  5DF9 A;  2BLS A;  5FDH A;  1IEL A;  3B6G A;  4DDY A;  3FKE A;  4WEL A;  4E6W A;  3BFG A;  5B32 C;  2XLN A;  3MZE A;  3AZJ A;  1ID3 D;  1TZY C;  1IYO A;  1BLS A;  1JVJ A;  3AZJ D;  1ID3 A;  4XZQ C;  3W98 B;  1SDE A;  1SKF A;  1U60 A;  4S2I A;  2QZ6 A;  1LI0 A;  5CHM A;  2IWB A;  5M18 A;  3FWL A;  4MNR A;  3EQV A;  3Q7V B;  5CGX A;  4DXC A;  2ZC7 A;  4EWF A;  3CJM A;  4E3O A;  4KGC D;  3V5M A;  2RIQ A;  3R45 B;  2OLU A;  5CHJ A;  4KHA B;  3G34 A;  3G2Z A;  4WU8 A;  5B2I A;  2CV5 D;  1ZG4 A;  1TZY D;  2HIO B;  3NDE A;  5AVC B;  4WU9 D;  3N8L A;  4G92 C;  4GN2 A;  4YS3 B;  3WA9 B;  2ZM0 A;  2V2F F;  3DW0 A;  4X69 A;  3ZCZ A;  2PYO D;  4IBX A;  4Q8I A;  1K54 A;  1S6R A;  2Y2J A;  1P3F D;  2I72 A;  2G2W A;  2OSU A;  2WAE A;  5J8X A;  2BYK A;  3UTA A;  1MKI A;  5F1G A;  5HW3 A;  4CAY A;  3LZ0 D;  1F1E A;  3UPN A;  5CPK D;  1LL5 A;  4MEZ A;  4Z5T C;  5E2H A;  1T3U A;  4G91 B;  3X1T C;  3M6H A;  3OC2 A;  3JYI A;  5GLC A;  1F66 A;  1HQ3 A;  1U35 D;  1P34 D;  4HEF A;  3LZ0 B;  3AZK A;  2CV5 A;  3ZG8 B;  3W98 C;  5GXQ B;  1YMX A;  5B1M B;  4H9Q A;  2Q9M A;  4EV4 A;  3VH6 T;  2WAF A;  3KWQ D;  1LHY A;  1TAF B;  3W99 A;  1NJ4 A;  2HDS A;  3P98 A;  1KX4 D;  3AZF B;  3BLM A;  4H9R A;  2Y2M A;  1RCJ A;  3ZHH A;  4JF5 A;  1IKI A;  5BO0 A;  1P34 C;  1EQZ B;  4Z66 B;  4KZA A;  1IKG A;  5IHV A;  3KS4 A;  5EEC A;  3X1T D;  1M18 B;  1K56 D;  1TVF A;  4J8X D;  3AV2 B;  4Z5T D;  4YIN A;  5DNN A;  3F6T A;  3REI B;  4WM9 A;  2WYX A;  1FR1 A;  1NZO A;  4CSR A;  3AV2 C;  3WAA B;  3SH9 A;  2W8S A;  4X23 C;  5BNV B;  3C1B B;  3W4P A;  3A3D A;  1P3K A;  4KUD D;  2ZC5 B;  5B2I D;  3G2Y A;  3ISG A;  2H5S A;  1P3L B;  3MNN D;  1BUE A;  3ZVT A;  1I2S A;  3UTB D;  1W2E A;  4NE3 A;  4KG5 A;  1P3F B;  3LZ0 C;  3B0C T;  4NE5 A;  3V39 A;  4LV3 A;  1P3K D;  5B31 D;  3QNC A;  1AXB A;  4KGC C;  5B1L B;  1Q2P A;  5AVC D;  1K6S A;  1ESI A;  3HLC A;  3HVF A;  2XGN A;  1P3G B;  2IOU A;  5DNN D;  3AZH B;  2NZD A;  4WEK A;  2PYO C;  1L0D A;  1H8Y A;  2EFU A;  3AZJ C;  5AV8 A;  2ARO C;  1K57 A;  1L0E A;  4X23 A;  3E2L A;  4Z66 C;  4ZJ1 A;  1KE3 A;  3EQU A;  5AQ7 A;  5GT0 B;  4UUZ B;  5JA4 A;  5FAP A;  2PU4 A;  5CGW A;  3REK A;  5CPK B;  4ZUX B;  1IYS A;  3LJA C;  5D3O A;  2A3U A;  4QY6 A;  5AV6 A;  2WKE A;  4QY5 A;  2EX9 A;  2YFV A;  2ZD8 A;  1S32 B;  4JPM A;  4J8U C;  3REJ D;  1P3I D;  2YFW A;  3V3R A;  4XZQ D;  1IYP A;  3MZD A;  3UTB C;  2Y2N A;  5GT3 B;  3E2K A;  1KE4 A;  2P9V A;  1K55 C;  5CPK A;  1P3A A;  3A1I A;  4GOG A;  3EPK A;  5GT0 A;  3UT9 A;  1YU0 A;  4FH2 A;  3N7W A;  4P87 A;  2VQR A;  3REL C;  3GMW A;  1IEM A;  4MBF A;  5F99 D;  1YQS A;  1JWV A;  3WRT A;  1XGJ A;  3AV2 D;  4OUI A;  4LG2 A;  2HDQ A;  3H0M C;  3Q7Z A;  4B88 A;  3GTC A;  5E2E A;  2YFW B;  3ZNT A;  5CPJ A;  3REK D;  1SCW A;  3KXB D;  4KZ5 A;  2F8N H;  3RJU A;  5BPV A;  4RYE A;  4J8U A;  5TR7 A;  2H0Y A;  3G35 A;  5AV8 D;  3REK B;  3KFU G;  4GKU A;  5CP6 C;  4H9S C;  4HGA B;  3L26 A;  2NZD D;  4UUZ A;  3DWZ A;  2H10 A;  3L25 A;  1G6A A;  3I7J A;  3TU4 D;  5CGS A;  1U35 C;  4IBC A;  2WGW A;  4FD8 A;  4G91 C;  2ZY3 A;  2FJ7 B;  3REI D;  3AZH A;  4LD9 A;  1XGI A;  4LEN A;  1PWG A;  3S1Y A;  1TDL A;  4LD9 D;  1PW1 A;  3H0L C;  3G30 A;  4S2K A;  1M1A D;  1PIO A;  5DNN B;  3REI A;  3AZH D;  5B1L A;  3WKJ C;  2ZQC A;  3MNN A;  5AY8 A;  3MGS C;  1M18 A;  2Y59 A;  5B40 A;  3MGQ C;  3B6F A;  1RGY A;  3HLG A;  5E5A C;  4WZ4 A;  1PZO A;  5CTN A;  4AWL B;  5BO0 B;  3AZM B;  4H9N A;  1O7E A;  4JJN C;  5C3I C;  1F66 C;  5JRG A;  3AZI C;  5B1M A;  3V50 A;  3V3S A;  1P3O C;  5AY8 D;  1ERM A;  1KX4 A;  4NZ4 A;  3GVB A;  3AN2 D;  4ZBJ B;  4OLG A;  1M19 A;  2R9X A;  3ZVW A;  3W96 D;  2ZY2 A;  4OP5 A;  4XUZ A;  4QNL A;  3REH C;  2LY8 A;  4LD9 B;  2IO5 B;  1BLP A;  2ZC4 B;  1YU3 A;  4O7D A;  2HUE B;  5L2F A;  4RVA A;  5DNM B;  1P3O D;  4R8P D;  5HX9 A;  1ZLA D;  3BEC A;  3GV9 A;  3X1S D;  4OJP A;  4X55 A;  3X1S A;  1YLT A;  4UAA A;  1KX3 B;  4J8U B;  3AZK B;  3IH8 A;  3UY6 A;  1KGG A;  4IBE A;  4PMA A;  3IHB A;  1P3I B;  4LV2 A;  2GDN A;  4OPR A;  1LLB A;  2EX6 A;  4IBG A;  3MGS D;  4S2O A;  4IJF A;  3WKJ D;  4N1X A;  3AZM C;  3IWI A;  5E43 A;  3N3F A;  4NZ5 A;  3UDF A;  2F8N D;  3Q7V A;  4ZDX A;  2RVQ D;  3UTA B;  4QJG A;  2Y2L A;  4GDN A;  1KX5 B;  3TU4 C;  4DRT A;  1CEG A;  4GH9 A;  4S2J A;  4M3K A;  1GA9 A;  5U47 A;  3B6G B;  1OME A;  3G4P A;  5AVC A;  3REL B;  3AGE A;  3PAE A;  2Y2H A;  3BFE A;  3R45 A;  3FYZ A;  4XXR A;  2YFV B;  3WS4 A;  5GLD A;  3REK C;  4IVI A;  2HP6 A;  3HLD A;  1HQ3 C;  5B33 B;  4ZUX A;  3WTP B;  4N1H A;  3W98 A;  5B0Y D;  1KX3 A;  2HP5 A;  3OPL A;  3X1S B;  3UPP A;  3BEB A;  2EX8 A;  3PBQ A;  3VP3 A;  4X23 B;  3LCE A;  5DNM D;  1ZLA B;  3VP2 A;  4OVD A;  4R8P B;  5DNM A;  3O87 A;  3G31 A;  4FSF A;  1I2W A;  1ZLA C;  3KXB A;  4OOY A;  3WX7 A;  1M18 C;  3UT9 C;  3X1T A;  4KQR A;  1KX5 C;  5DTS A;  4DXB A;  4R4S A;  1M1A A;  5EPH A;  3REJ C;  1MY8 A;  2V1Z A;  5CXW A;  4WU9 B;  3BLS A;  1P3F A;  2Y2G A;  2ZQA A;  4A5R A;  5BNX B;  1N1J B;  5AV9 B;  3LJA D;  3KWQ B;  3ZG0 A;  4DRA A;  4NYU A;  4JXW A;  4WZ5 A;  3MGR B;  2XF3 A;  4WU8 D;  4XUJ B;  5JRG B;  1JTD A;  4GDB A;  1P3A D;  5AV9 C;  2FJ7 D;  1F66 D;  3G32 A;  2ARO D;  5B0Z A;  4WBG A;  2Z2M B;  3TSG A;  3Q82 A;  3W97 B;  3OPP A;  1Z2C B;  3N4I A;  5HAR A;  3LEL C;  3AFA B;  5FQM A;  3MGP B;  4EBP A;  4L0L A;  4WNN B;  4KZ3 A;  1YM1 A;  1PWD A;  5B31 C;  3M2K A;  1WYC A;  4E6X A;  3MGR D;  1EQZ A;  3AZH C;  3FDD A;  1M1A C;  4DRB A;  1EQZ D;  4QD4 A;  4H9R B;  4JJN B;  1M19 D;  2WGW B;  3N8R A;  5B2J C;  4NET A;  3MNN C;  5FQK A;  4ZTK A;  3KUY A;  3LZ1 D;  3VFH A;  2CV5 B;  3Q07 A;  4K0W A;  4GHA A;  1MWU A;  3ITB A;  4J8X B;  4H9P A;  1NXY A;  4Y7P A;  5FQI A;  3NQJ A;  4JJN A;  3MKE A;  3CG5 A;  3N8S A;  4XUJ C;  3MGR C;  3AGD A;  4IBR A;  4PM6 A;  5CPJ B;  1FR6 A;  5AV5 C;  5FUG A;  1TZY B;  1ULY A;  1I5Q A;  3MGP A;  1P3M B;  3AZL A;  4FH4 A;  1PI5 A;  3KSY A;  3X1U B;  1Z6F A;  1EI5 A;  1BH8 B;  1BUL A;  2XEP A;  2FJ7 C;  4OKP A;  5B31 B;  5B0Z B;  1GHI A;  1NRF A;  2IWC A;  2ARO B;  2J8P A;  1ZKJ A;  3C4O A;  3VH5 T;  2X01 A;  1P3A B;  4ZJ3 A;  1PZP A;  5B2I B;  4WU8 B;  5EVI C;  3UN7 A;  3WTP C;  2JE5 A;  2P9V B;  2F8N A;  3UO9 A;  5GSU C;  5B33 D;  4KGC B;  4ZUX C;  3AZE D;  4LCM A;  5B24 A;  3NIA A;  1JFI A;  3M2J A;  1LI9 A;  1B6W A;  3IF6 C;  4DKI A;  1KX5 D;  1BH9 B;  3DWK A;  4B4X A;  4ZUX D;  3SOI A;  4UA9 A;  4QHC A;  4OOL A;  2NQB D;  1BSG A;  1MBL A;  3A6N A;  4H9S A;  1YLP A;  5FI6 A;  1KDW A;  3MFD A;  4PM8 A;  5M19 A;  4H9O A;  2Y2K A;  3V9R A;  5JA4 B;  3REJ B;  3S22 A;  4R8P A;  4GHL A;  4GD6 A;  3IH9 A;  1WYB A;  3UDI A;  3PBN A;  4IBB A;  4EBN A;  2OLV A;  5CPJ C;  3REJ A;  2DCF A;  4IVK A;  3KUY D;  4J8W D;  1C3B A;  2WZX A;  5HL1 A;  4N9L A;  1E3U A;  1YLW A;  3X1V B;  3WTP A;  3GQZ A;  4E3I A;  2UWX A;  1MWS A;  4OPZ A;  5EOE A;  3PBS A;  4U0T A;  5GSU A;  2JC7 A;  5AVC C;  1BTL A;  4KZ9 A;  1NZU A;  4DE2 A;  1P34 B;  1GHP A;  1JFI B;  1K6R A;  4XUJ D;  5CER A;  3IF6 A;  1MWT A;  3O62 B;  5B24 D;  5KSC A;  2F2A C;  4FCF A;  4LV1 A;  4YFM A;  1P3L A;  3W97 D;  3ITA A;  2PYO A;  4MBH A;  1ONG A;  3A3J A;  3LZ1 C;  3AZG A;  5B0Z D;  2ARO A;  4EO5 B;  5B31 A;  5BNV A;  3C1B A;  1M19 C;  2XDM A;  1BH8 A;  5EUA A;  4P0M A;  1R4V A;  4Z2M H;  3QNB A;  1EQZ C;  4R23 A;  5E5A A;  3W96 A;  4Z5T B;  1P3M D;  5AV6 C;  1KVL A;  1U35 B;  4IED A;  4J8X C;  4ZAM A;  4H8R A;  4QLC B;  3FV7 A;  5JRG C;  4C3Q A;  4OON A;  4NK3 A;  3BM6 A;  3AZN B;  4KUD A;  5TGF A;  1HTZ A;  5AVB C;  2X71 A;  3EPJ A;  1KX4 C;  4EUZ A;  4H9Q B;  2Q9N A;  1P3L C;  1ES3 A;  4WU8 C;  5EVI B;  3AFA D;  3A3F A;  4X68 A;  3W98 D;  2VGJ A;  4E3J A;  5B40 D;  3LZ1 A;  3REH A;  5F82 A;  3MGS B;  4OJ6 A;  3REH D;  2XFS A;  2C6W B;  3C1B C;  3P5J B;  1ZG6 A;  3N6I A;  4YM6 A;  2XR0 A;  3FKV A;  3PBR A;  4JXG A;  5DVA A;  4IBJ A;  3MGP D;  3IXD A;  2PU2 A;  1YUE A;  2ZY4 A;  3MKF A;  3TU4 A;  5AV5 B;  2WUQ A;  3HBR A;  4S2N C;  5GT0 D;  2Y91 A;  5G49 A;  5EVI A;  3IXB A;  3AZG B;  5FAQ A;  2ZC6 B;  3B6G D;  1H3O A;  5GT3 C;  4ZBJ C;  3MBZ A;  3OPH A;  5CHL B;  3AV1 C;  4JF6 A;  1KVM A;  3AZM A;  3RXW A;  3TG9 A;  4WU9 C;  3WS1 A;  1HTA A;  5E5A D;  3M6B A;  5A92 A;  4HBU A;  3IXG A;  4Y0U A;  3B0B A;  1HQ3 D;  2HUE C;  1U35 A;  5B40 B;  4MBK A;  5AY8 B;  4LD9 C;  4RX2 A;  3TOI A;  3L28 A;  1H5X A;  3W4Q A;  1E4D A;  1K4E A;  1M1A B;  3CZD A;  4OP8 A;  5B40 C;  4R4R A;  1LL9 A;  2XK1 A;  5GHX A;  2ZY5 A;  5F99 B;  5CHU A;  3BFC A;  3P09 A;  3AFA C;  1ID3 C;  2PYO B;  3NC8 A;  5B32 D;  5FQQ A;  5CP6 D;  1ZLA A;  1YU4 A;  3X1V D;  4NZ3 A;  4H9O B;  3ZG7 B;  5GHZ A;  3PBO A;  3NDG A;  5B1M C;  1P3P B;  4KG2 A;  2R9W A;  3VP1 A;  1BH9 A;  3MXS A;  3AYW D;  4NZ1 A;  1GA0 A;  2WGV A;  1KX3 C;  5AV6 D;  1AOI C;  4DE1 A;  1JTG A;  3WA9 D;  5BS7 A;  1XP4 A;  3GRJ A;  5GL9 A;  3BYD A;  3NQU A;  1MPL A;  2XH9 A;  2E8I A;  3REL D;  5B1M D;  1K38 A;  2L5A A;  1VQQ A;  4XZQ B;  4BL2 A;  5B0Z C;  3ZFZ A;  1TDG A;  1FOF A;  3MVD A;  3AYW B;  3UTA C;  1DJB A;  4OQG A;  1XPB A;  1Q9C A;  3EPL A;  2CC1 A;  2Y2Q A;  1XKZ A;  3X1U A;  5FI7 A;  2WK0 A;  5CEC A;  4K0X A;  1N9B A;  1KGF A;  2RCX A;  3LY4 A;  2HIO C;  3S4X A;  5B1L D;  2ZQD A;  4IJE A;  3B0C W;  5B0Y A;  5B24 B;  1XA7 A;  3C1C B;  4NFT A;  1EWZ A;  3Q1F A;  2ZMA A;  5AV6 B;  5CPI C;  3NBL A;  4R3J A;  4J8W C;  3KUY C;  3C1C C;  3AZI A;  2A49 A;  1S32 C;  4X56 A;  5E2F A;  2XQZ A;  3BFF A;  3AZI D;  3SS5 A;  3UTB A;  3IP4 C;  3IF5 A;  1PW8 A;  3B6G C;  4LV0 A;  3BRM A;  3HLF A;  5AV8 B;  1W7F A;  4U0X A;  3VFF A;  4YS3 D;  3AZE B;  2NZD B;  1P3M A;  3LY3 A;  5B32 A;  5GT0 C;  5FUG B;  3PBT A;  4P85 A;  4J8V B;  3IWQ A;  5B2J A;  3MGP C;  4Y0T A;  4WNN A;  4ZBE A;  4NY2 A;  4E3M A;  3B3X A;  4C75 A;  3AZE C;  4JXV A;  4UA6 A;  3NQJ B;  4WYY A;  2JSS A;  4OLD A;  4OOM A;  5GLB A;  3AV1 D;  2EXB A;  1M40 A;  2XD5 A;  4YS3 C;  1KX4 B;  4PM7 A;  3AV1 A;  3AZF D;  5GT3 D;  4G92 B;  5BOH A;  2P74 A;  4XUX A;  4AWL C;  5B2I C;  1W8Y A;  4XUJ A;  4PM5 A;  4KG6 A;  3MGR A;  2EFX A;  1KDS A;  1W8Q A;  4ZJ2 A;  1NY0 A;  4JXS A;  1P3K B;  5FA7 A;  3KWQ A;  1N1J A;  3IT9 A;  5CPI D;  3HLE A;  4GNU A;  1AOI B;  2IWD A;  4NE6 A;  2WZZ A;  2F8N G;  3KXB C;  3WAA D;  5GLA A;  4CPK A;  5AV5 D;  4D2O A;  3MNN B;  1CEF A;  5B2J B;  1H8Z A;  3VOZ A;  4Z66 A;  2ZC3 B;  2WGI A;  5F83 A;  3KXB B;  4UA7 A;  4YM6 C;  3AZE A;  4KEN B;  5AVB D;  3VOY A;  1BZA A;  5A91 A;  1CI9 A;  4RA7 A;  1WE4 A;  4BQM A;  3WWX A;  3W97 C;  5JRG D;  1K25 A;  4Z2M G;  5AV9 A;  2JBF A;  3MZF A;  4EBL A;  5BS7 C;  1FSW A;  1P3I C;  4J8U D;  4MLL A;  1AOI D;  3BFD A;  1KX3 D;  5B0Y B;  3UNW A;  1WWI A;  4PPR A;  4Y0O A;  1BLC A;  3REL A;  5B32 B;  4E44 A;  4JBF A;  4KZ7 A;  4GB7 A;  2EXA A;  4DDS A;  5DTT A;  1K54 C;  5KZH A;  3L29 A;  4CJN A;  3SS4 A;  4EQI A;  1KX5 A;  3VH6 W;  2IO5 C;  2Z2L B;  1FCM A;  2B5R A;  1A7W A;  5CEB A;  3NQU B;  4E3K A;  4DF6 A;  1ERO A;  3ZGA B;  5CP6 B;  3B0D B;  3HLW A;  4HGA C;  1FQG A;  2NQB C;  3FKW A;  5CPI A;  5EOO A;  2ZM5 A;  2PBY A;  4OPQ A;  1ERQ A;  1MWR A;  3C1C A;  5CP6 A;  5CTM A;  1S32 A;  1P3I A;  2Y2P A;  3MVD D;  3VSK A;  3AZK C;  1K56 A;  4N9K A;  1M18 D;  2ZQ9 A;  4IBD A;  5B33 C;  4BL3 A;  1SHV A;  2G5I C;  1ES2 A;  5F1F A;  5GSU D;  5AVB B;  3AZJ B;  3OPR A;  1XXM A;  3WTP D;  2FFF B;  3VH5 A;  3MXR A;  5AQB A;  3MVD B;  3AYW A;  1DY6 A;  3VH6 A;  2Y4A A;  3O86 A;  5F99 A;  4X23 D;  3AZK D;  3LEL B;  3MVD C;  2C5W B;  3W4O A;  4J8W B;  1BT5 A;  4S2L A;  2V20 A;  1M19 B;  3C1B D;  3A6N D;  2VGK A;  5FAO A;  1PZR A;  3ZNY A;  5GXQ C;  2EX2 A;  2J9O A;  1HZO A;  3HUN A;  5HAI A;  1PWC A;  5EVI D;  1P3B C;  2Y55 A;  1DJC A;  1PYY A;  1J9M A;  2WAD A;  2H0T A;  3KWQ C;  1P3L D;  2NQB B;  5E2G A;  4BLM A;  4BD1 A;  3AN2 B;  4F94 A;  3PAG A;  2XFT A;  3OCN A;  5G49 B;  3WS5 A;  3KS8 A;  4J8V C;  4OQH A;  3B6F B;  3GR2 A;  5B2J D;  4HES A;  5KSH A;  5AV5 A;  3WRZ A;  1GHM A;  3WAA A;  4OH0 A;  3L2A A;  3AZL C;  3IWO A;  2FFY A;  4GD8 A;  3AZM D;  3C7U A;  3HUO A;  1W5D A;  1P3M C;  2ZM8 A;  3HLB A;  3AZL D;  2FJ7 A;  5EE8 A;  5FQJ A;  1BFM A;  1FCO A;  2G5H C;  2ZQ7 A;  1NYM A;  5HAQ A;  4KZ4 A;  1P3F C;  1RP5 A;  3C7V A;  2HPB A;  2J8Y A;  1VM1 A;  4WMC D;  1S0W A;  3AZF A;  1DJA A;  1WWS A;  1ZC2 A;  1Q2Q A;  4X6T A;  4H9N B;  4JLF A;  3LEZ A;  4E3N A;  1BLH A;  4WZ5 C;  5FAT A;  3NI9 A;  2CV5 C;  2ZJ9 A;  5B24 C;  1ONH A;  4KUD B;  3AZG C;  1YT4 A;  4N92 A;  1P3B D;  3VP4 A;  3TU4 B;  5C3I B;  1F66 B;  5A90 A;  4S2P A;  3W99 C;  4PM9 A;  1B67 A;  4J8V A;  5DTK A;  3A6N C;  3X1U D;  3LEL D;  3W96 C;  3WAA C;  3UE3 A;  4YM6 B;  3LEL A;  1K55 A;  1RGZ A;  3AN2 C;  4Z5T A;  3W96 B;  3GSG A;  5AY8 C;  3MGS A;  3A3I A;  5CPJ D;  4QLC D;  3B6F C;  5AV9 D;  3EG5 B;  5HFO A;  5FSR A;  3PTE A;  2BYM A;  1SDN A;  3AZI B;  5AVB A;  3WA9 A;  3AZF C;  4ID4 A;  4BJP A;  3UPO A;  4WV4 B;  4WMC A;  2HIO A;  1G68 A;  5FQ9 A;  5B0Y C;  3W8K A;  4KZ6 A;  3AGF A;  1JWP A;  3MGQ D;  4JKT A;  1P3P C;  4E3L A;  1P34 A;  5CPI B;  1XA1 A;  4UHU A;  1CK3 A;  5GSU B;  5B31 G;  2ZLY A;  3WS0 A;  3L27 A;  1ALQ A;  3UDX A;  2F8N K;  3O3V A;  5DNM C;  5G18 A;  1ID3 B;  1YLY A;  2G2U A;  5DF8 A;  3UT9 B;  1HVB A;  1GCE A;  4OQ0 A;  1KE0 A;  3IQA A;  1P3G D;  2NZD C;  3C1C D;  5JYO A;  4UPK A;  1K4F A;  5GT3 A;  5AV8 C;  1K57 C;  1P3G A;  4Z9Q A;  2DNS A;  4KZ8 A;  3UE0 A;  3C5A A;  3SH7 A;  4DE3 A;  4OPY A;  1E3U D;  3RXX A;  3MGQ A;  1ESU A;  4LCL A;  1P3B A;  2DF4 C;  5GHY A;  4RX3 A;  3MGQ B;  3LJA A;  1P3P A;  3EPH A;  5A93 A;  4IBI A;  2Y2I A;  4KGC A;  2J9P A;  2DRW A;  3X1V A;  3OZH A;  3WS2 A;  1W79 A;  2XD1 A;  3SS3 A;  4DE0 A;  3HL9 A;  1YLZ A;  2F8N B;  4WEJ A;  5FI2 A;  3NY4 A;  3HUM A;  4KQQ A;  4JF4 A;  5HAP A;  3O62 D;  3ZDJ A;  5BT1 C;  2CWE A;  4K91 A;  2WKH A;  3V9R B;  3UE1 A;  2RL3 A;  3VSL A;  2HP9 A;  4CSR B;  4R8P C;  2QMI A;  5B32 G;  5I94 A;  2ZQ8 A;  3A6N B;  4E45 A;  1HD8 A;  4B4Z A;  4YM6 D;  2Y2O A;  1FCN A;  5DF7 A;  4OJL A;  4WZS B;  4NYY A;  4S2M A;  1TZY A;  3VP0 A;  4R1G A;  4S2N A;  1P3O B;  2J7V A;  4OQI A;  1AOI A;  1M6K A;  1YMS A;  1E25 A;  4P6B A;  1ES4 A;  1TAF A;  3W99 B;  4H9P B;  1H3O B;  5KMW A;  3X1S C;  3B0D C;  5TFQ A;  3X1V C;  4HBT A;  3AZN C;  5GXQ A;  4IBF A;  3HRE A;  1P3A C;  3LO7 A;  4Z66 D;  3AZN D;  2BYM B;  3VH5 W;  1L0G A;  4QLC C;  3B6F D;  3AL0 C;  3KUY B;  3AV1 B;  4JJN D;  1HQ3 B;  1MXO A;  3WKJ B;  5DNN C;  2X02 A;  5CRF A;  3ZG5 A;  4U3T A;  5FAS A;  2QPN A;  3AZL B;  3X1U C;  3AV2 A;  3SH8 A;  4QB8 A;  3W99 D;  4WJ3 C;  5KDM B;  2ZM2 A;  1P3K C;  3WTP E;  4X53 A;  1N4O A;  5KDM A;  5JYP A;  4EO5 C;  2BYK B;  1KU5 A;  1TEM A;  4M6B A;  3LZ1 B;  3REH B;  3UT9 D;  3AZG D;  1L0F A;  3AFA A;  1QMF A;  3H0R C;  4OJO A;  1IYQ A;  4BEN A;  3REI C;  1KGE A;  3W97 A;  3A3E A;  3Q81 A;  3WKJ A;  1FSY A;  4J8X A;  5BT1 D;  1YU2 A;  2BG1 A;  3UTB B;  3O62 C;  1QME A;  3OCL A;  2WKI A;  4R0Q A;  1XX2 A;  3LZ0 A;  3AZN A;  4KUD C;  1JWZ A;  1S32 D;  5AQA A;  4QLC A;  5EVL A;  1NYY A;  3HSH A;  1YU1 A;  1PI4 A;  2OV5 A;  5CED A;  2JCH A;  3C4P A;  3NCK A;  3O88 A;  4OJ5 A;  5BNX A;  5AQ9 A;  3ZG9 B;  3CMZ A;  4CAY B;  1P3O A;  4IBK A;  5E5A B;  3VMA A;  3A1K A;  4J8V D;  4KQO A;  5B1L C;  2HIO D;  2HDU A;  3X1T B;  1YLJ A;  3IXH A;  1P3G C;  4YS3 A;  3AN2 A;  3IHA A;  5F99 C;  4DQY B;  1CI8 A;  2NQB A;  3UTA D;  4XZQ A;  1Y54 A;  1O07 A;  3D4F A;  4R3B A;  3O62 A;  2DQN C;  3IF6 B;  2HDR A;  4KHA A;  5GXQ D;  3DTM A;  2RVQ C;  4C6Y A;  4BD0 A;  5M1A A;  4KZB A;  3HON A;  5B33 A;  4GZB A;  3WA9 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...