1EAKA

Catalytic domain of prommp-2 e404q mutant
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
421
structure length
421
Chain Sequence
SPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHQFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPDID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords 72 KDA TYPE IV COLLAGENASE
publication title Crystal Structure of Human Mmp-2 Reveals a New P
rcsb
source organism Homo sapiens
total genus 100
structure length 421
sequence length 421
chains with identical sequence B, C, D
ec nomenclature ec 3.4.24.24: Gelatinase A.
pdb deposition date 2001-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00040 fn2 Fibronectin type II domain
A PF00413 Peptidase_M10 Matrixin
A PF01471 PG_binding_1 Putative peptidoglycan binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.101.10 Mainly Alpha Orthogonal Bundle Muramoyl-pentapeptide Carboxypeptidase; domain 1 PGBD-like superfamily/PGBD 1eakA01
2.10.10.10 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Fibronectin, type II, collagen-binding 1eakA03
2.10.10.10 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Fibronectin, type II, collagen-binding 1eakA04
2.10.10.10 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Fibronectin, type II, collagen-binding 1eakA05
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1eakA02
1QUAA 4L6TA 4G9LA 1OO9A 1SMPA 2Y6DA 4G0DA 2OVXA 1CAQA 2J83A 5BPAA 4H82A 1JAPA 3HB2P 2X3CA 1ZP5A 1XFUA 1ND1A 3LGPA 1G05A 3KMCA 5L79A 3TVCA 1DMTA 5D1TA 3EDGA 1OMJA 4XM8A 3M7PA 2OW0A 3LIKA 2E2DA 4FVLA 1EAKA 1GO7P 3NX7A 1YCMA 2L0RA 3KRYA 2K9CA 2RJQA 2YB9A 3BKHA 1PWVA 2D1OA 1JH1A 1KAPP 1EB6A 2JSDA 1XUCA 1HFSA 1JAQA 1GE5A 1OM6A 2W0DA 1BUDA 2OI0A 1C3IA 3G5CA 1A86A 1OM7A 4BXJA 4AYKA 3HBUP 3DL1A 2MLSA 5I2ZA 3I7GA 966CA 1J7NA 4BPAA 2OZRA 3U1RA 3LJTA 1GE7A 2QPJA 1I76A 3L0TA 3D2ZA 3VTGA 4EFSA 1QICA 1GE6A 5L7FA 4IJOA 5I12A 3B8ZA 4GWNA 1JK3A 3EHXA 4HX3A 2WOAA 1HV5A 2XS3A 2D1NA 1BQQM 2O36A 1PDCA 1QJIA 5D1SA 1AYKA 3V96B 3HY7A 5B5OA 1CIZA 1ZTQA 3TT4A 4PKVA 2W15A 1BQOA 4WKIA 4H3XA 1I73A 3LILA 2W13A 1C7KA 3KEJA 1KS0A 3OHOA 4A3WA 1FBLA 4BJ4A 2JT6A 4G54A 2EROA 5LABA 1R54A 3LUNA 3K7NA 1PWWA 2OVZA 2J0TA 2WO8A 4AIGA 2V4BA 2OY2A 1R1HA 3HDBA 2OW9A 4GR8A 5JMYA 4PKTA 1XFZA 1YOUA 3RTTA 4H76A 4L63A 1XFVA 3Q2GA 4GR3A 1KUKA 1BM6A 3LIRA 2CLTA 3O64A 4FU4A 1KUFA 2HU6A 2JNPA 1G9KA 4H2EA 3P1VA 3DPEA 2X3BA 1D8FA 4ZR5A 1WNIA 3D2YA 1YP1A 1K7IA 1IABA 4QKZA 1BZSA 1Y8JA 3DPFA 1JANA 4PKQA 4AXQA 1HY7A 4AUOA 3G42A 4ILWD 2OXUA 2DDYA 3AYKA 2SRTA 2ERQA 1AF0A 3LUMA 2N8RA 1GKDA 1ROSA 3GBOA 1PWPA 2BH7A 4WF6A 1D5JA 3O2XA 1BKCE 2YIGA 1IAGA 3N2VA 3EDZA 5BOTA 3P24A 5D7WA 3F15A 3AIGA 2WKXA 2AYKA 1C8TA 4JQGA 1GO8P 1SATA 1OS2A 4WKEA 3WV2A 2MZIA 3HY9A 2JIHA 1KUGA 1O0QA 2FV5A 3F1AA 4CTHA 1IADA 1FLSA 1J7MA 3HBVP 1UTTA 3N2UA 1B8YA 3EDIA 4BOLA 1JKYA 1ZXCA 2MLRA 4FXQA 3F17A 3LQ0A 1OS9A 3K7LA 1MMPA 1SLNA 2W12A 2PJTA 1GXDA 1ZXVA 1S4BP 2USNA 3LQBA 4JA1A 2OXZA 4DD8A 2OW1A 3Q2HA 1IAAA 1XFWA 3EDHA 1FM1A 2I47A 5I43A 5I4OA 2FN2A 4H49A 2W14A 1CGFA 4JP4A 5H8XA 1XFXA 1CGEA 1MMRA 1EUBA 4PKRA 1O0TA 2Z2DA 4DV8A 4L19A 3ELMA 4IN9A 1E88A 1IACA 3SHIA 1L6JA 2CKIA 4PKSA 1BKCA 5CUHA 3HDAP 1MMQA 3ZUKA 3DWBA 4JPAA 1G12A 3OHLA 1AKLA 3ZXHA 1ATLA 2O3EA 3VI1A 4DF9A 2DW0A 2POJA 1Z3JA 4GQLA 1CQRA 2E3XA 3HYGA 5BOYA 3LE9A 3WV3A 1G49A 4GF1A 1JJ9A 1H8PA 4Q1LA 1KUHA 1R1JA 4H1QA 1BIWA 1ZVXA 1UMTA 1DTHA 2DDFA 3B2ZA 1USNA 4DPEA 4BXEA 1PWQA 1XUDA 2A8HA 1CGLA 2MZHA 2FV9A 3KWVC 1Q3AA 3F18A 5B5PA 3KEKA 4R3VA 4I35A 1KUIA 1R55A 456CA 3CKIA 2RJPA 2KRJA 1BSWA 4WK7A 5I3MA 2DW1A 1HTDA 3LJGA 1YQYA 4J4MA 1ZS0A 3MQLA 1LBUA 4FXYP 2V5OA 3BKVA 3AYUA 3F19A 1Y93A 3LEAA 1BUVM 4PKWA 3F16A 1PWUA 1RMZA 2OXWA 1MNCA 3LK8A 4XM7A 1D8MA 1QO6A 5CXAA 2X7MA 830CA 1GKCA 2OY4A 4ON1A 4LPQA 1JIZA 4JIJA 1JAOA 1UTZA 1IAEA 2XS4A 3TSKA 2JT5A 4GUYA 5D3CA 2MZEA 1K7GA 3EWJA 1SRPA 1MMBA 1CXVA 1SLMA 1R1IA 1RM8A 3MA2A 4PKUA 1K7QA 1E8BA 2AIGP 3LKAA 4H30A 1QIBA 1XURA 1JIWP 3TS4A 2Y6CA 3USNA 3L0VA 1SU3A 1XFYA 1KBCA 1A85A 4GR0A 4HMAA 4XCTA 1HOVA 1ASTA 3E8RA 5D1UA 3B92A 1I1IP 1CXWA 4WZVA 3LMCA 3RTSA 2K2GA 2ERPA 4H84A 4XBHA 3BA0A 2X3AA 5CZMA 1G4KA 4IUWA 3EHYA 4GWMA 4XM6A 1UMSA 2DW2A 4BXDA 3DSLA 1HFCA 1QJJA 3ZVSA 4A7BA 2OW2A 3KECA 3DNGA 1B3DA 2TCLA 3UVCA 3KMEA 1H71P 1BKCI 3LJZA 2WO9A 1CK7A 5I0LA 3WV1A 1D7XA 3KHIA 4I03A 3I7IA 1Y0VA 5D2BA 1UEAA 1QIAA 1OM8A
chains in the Genus database with same CATH superfamily
1QUAA 4OJPA 4L6TA 1YU4A 3L27A 4G9LA 1OO9A 1SMPA 2Y6DA 4G0DA 2OVXA 2YUFA 1CAQA 2J83A 3N3FA 5BPAA 4H82A 1YUEA 4L7AA 4Z2KA 1JAPA 3L26A 3HB2P 2X3CA 1ZP5A 1XFUA 1ND1A 3LGPA 1G05A 3KMCA 1OZ9A 4GHAA 5L79A 3TVCA 1DMTA 5D1TA 3EDGA 1OMJA 4Z2JA 4XM8A 2D49A 3M7PA 2OW0A 3LIKA 1O6IA 2E2DA 1EAKA 4FVLA 1GO7P 3NX7A 4TX8A 1YCMA 2L0RA 3KRYA 2K9CA 2RJQA 2YB9A 3BKHA 1PWVA 2D1OA 1JH1A 1KAPP 1EB6A 2Y2HA 2JSDA 1XUCA 1HFSA 4MB4A 1JAQA 1GE5A 1OM6A 2W0DA 2BG1A 4IBFA 1BUDA 2Y2KA 1C3IA 2OI0A 1A86A 3G5CA 1OM7A 1XAXA 4BXJA 1GPFA 3HBUP 4AYKA 2Y2OA 3DL1A 2MLSA 5I2ZA 3I7GA 966CA 1J7NA 4BPAA 1YU2A 2OZRA 3U1RA 3LJTA 1GE7A 2QPJA 1I76A 3L0TA 4HMCA 3D2ZA 3VTGA 1E6PA 4EFSA 1QICA 1GE6A 5L7FA 4IJOA 5I12A 3B8ZA 4GWNA 1JK3A 3EHXA 4HX3A 2WOAA 1HV5A 2XS3A 2D1NA 3WD4A 1BQQM 1PDCA 2O36A 1QJIA 5D1SA 1AYKA 4NY2A 3V96B 4NZ3A 3HY7A 5B5OA 3FKEA 1CIZA 1ZTQA 3TT4A 1YU3A 4PKVA 2W15A 1BQOA 4WKIA 4H3XA 1I73A 3LILA 2W13A 1C7KA 3KEJA 1E6ZA 4LG2A 1KS0A 3OHOA 4A3WA 1FBLA 4BJ4A 4IBIA 2JT6A 3WD1A 4G54A 3L29A 2EROA 5LABA 1R54A 3LUNA 3K7NA 1PWWA 2J0TA 2OVZA 2WO8A 4AIGA 2V4BA 2OY2A 1R1HA 3HDBA 2OW9A 4GR8A 5JMYA 4IBKA 1XFZA 4PKTA 1YOUA 3RTTA 4H76A 3KS4A 4L63A 1XFVA 3Q2GA 4GR3A 1E15A 1AIWA 4OJLA 1KUKA 1BM6A 3LIRA 2CLTA 2IOUA 4IBJA 3O64A 4FU4A 3DTKA 1KUFA 2HU6A 2JNPA 1G9KA 4H2EA 3P1VA 3L2AA 3DPEA 1D8FA 2X3BA 4ZR5A 1WNIA 3D2YA 1YP1A 1K7IA 1IABA 4QKZA 1BZSA 1Y8JA 3DPFA 1JANA 4PKQA 4AXQA 1HY7A 4AUOA 3DTEA 3G42A 4ILWD 2OXUA 2DDYA 3L25A 3AYKA 2SRTA 2ERQA 1AF0A 3LUMA 2N8RA 3WD2A 1GKDA 1ROSA 3GBOA 1PWPA 2BH7A 4GH9A 4WF6A 1YU1A 1D5JA 3O2XA 1BKCE 2YIGA 4HMEA 1IAGA 3N2VA 2Y2MA 3EDZA 4OJOA 5BOTA 3P24A 5D7WA 3F15A 1W1PA 3AIGA 2WKXA 2AYKA 1C8TA 4JQGA 1GO8P 4Z2IA 1SATA 3WD3A 4IJFA 1OS2A 4WKEA 4NYYA 3WV2A 2MZIA 4NZ5A 3HY9A 2JIHA 1KUGA 1O0QA 2FV5A 3F1AA 4CTHA 3WX7A 1IADA 1FLSA 1J7MA 3HBVP 1UTTA 3N2UA 1B8YA 3EDIA 4BOLA 1JKYA 1ZXCA 1OGBA 2MLRA 4FXQA 4IJEA 3F17A 3LQ0A 2Y2JA 1OS9A 3K7LA 1MMPA 1SLNA 2W12A 2PJTA 1GXDA 4GHLA 1S4BP 1ZXVA 2USNA 3LQBA 4JA1A 2Y2QA 2OXZA 1TVIA 4DD8A 2OW1A 1UR9A 3Q2HA 1IAAA 1XFWA 3EDHA 3KS8A 1FM1A 2I47A 5I43A 5I4OA 2FN2A 4H49A 2W14A 1CGFA 4JP4A 5H8XA 1XFXA 1CGEA 1MMRA 1EUBA 4PKRA 2Y2NA 1O0TA 2Z2DA 4DV8A 3WD0A 4L19A 4OUIA 3ELMA 4IN9A 1E88A 1IACA 3SHIA 4IBCA 1L6JA 2CKIA 4PKSA 1BKCA 5CUHA 3HDAP 1MMQA 2Y2PA 3ZUKA 2JCHA 3DWBA 2RTSA 4JPAA 1W1YA 1G12A 3OHLA 1AKLA 3ZXHA 1ATLA 3DTIA 2O3EA 3VI1A 4DF9A 2DW0A 2POJA 1Z3JA 4GQLA 1CQRA 2E3XA 3HYGA 5BOYA 3LE9A 3WV3A 4OJ5A 1G49A 4GF1A 1JJ9A 1H8PA 4Q1LA 1KUHA 1R1JA 4H1QA 4OJ6A 1GOIA 1BIWA 1ZVXA 1UMTA 1DTHA 2DDFA 3B2ZA 1USNA 4DPEA 4BXEA 2UWXA 1PWQA 1XUDA 2A8HA 1CGLA 2Y2IA 1H0IA 4MB5A 2MZHA 3L28A 2FV9A 3KWVC 1Q3AA 3F18A 5B5PA 4IBEA 4HMDA 3KEKA 4R3VA 4I35A 1KUIA 1R55A 456CA 3CKIA 2RJPA 2KRJA 1BSWA 4WK7A 5I3MA 2DW1A 1HTDA 3LJGA 1YQYA 4J4MA 1ZS0A 3MQLA 1LBUA 4FXYP 2V5OA 3BKVA 1E6NA 4NZ4A 3AYUA 3F19A 1Y93A 3LEAA 1BUVM 4PKWA 3F16A 1YU0A 1PWUA 1RMZA 2OXWA 1MNCA 5BPVA 3LK8A 4XM7A 1D8MA 1QO6A 1OGGA 5CXAA 2X7MA 830CA 1GKCA 2OY4A 4ON1A 4LPQA 1JIZA 4JIJA 2Y2GA 1JAOA 1UTZA 1IAEA 4Z2HA 2XS4A 3TSKA 2JT5A 4NZ1A 4GUYA 5D3CA 2MZEA 1K7GA 3EWJA 1SRPA 1MMBA 3HONA 2JE5A 1CXVA 1SLMA 1R1IA 1RM8A 4IBGA 3MA2A 4PKUA 1K7QA 1E8BA 1W1VA 2AIGP 3LKAA 4H30A 1QIBA 1XURA 4QNLA 1JIWP 3TS4A 2Y6CA 2FFFB 2Y2LA 3USNA 3L0VA 1SU3A 1XFYA 1KBCA 4MB3A 1A85A 4GR0A 4HMAA 4XCTA 1E6RA 1HOVA 1ASTA 3E8RA 1H0GA 5D1UA 3B92A 1I1IP 4IBBA 1CXWA 4WZVA 3LMCA 3RTSA 2K2GA 2ERPA 4Z2GA 1XM5A 4H84A 4XBHA 4NYUA 3BA0A 2XD5A 2X3AA 5CZMA 1G4KA 4IUWA 3EHYA 4GWMA 4XM6A 1UMSA 4IBDA 2DW2A 4BXDA 1W1TA 3DSLA 1HFCA 1ED7A 1QJJA 3ZVSA 4A7BA 2OW2A 2XD1A 3KECA 3DNGA 1B3DA 2TCLA 3UVCA 3KMEA 1H71P 1UR8A 1BKCI 3HSHA 3LJZA 2WO9A 4Z2LA 1CK7A 5I0LA 3WV1A 1D7XA 3KHIA 4I03A 3I7IA 1Y0VA 5D2BA 1UEAA 1QIAA 1OM8A
chains in the Genus database with same CATH topology
1QUAA 4L6TA 4G9LA 1OO9A 1SMPA 2Y6DA 4G0DA 2OVXA 2YUFA 1CAQA 2J83A 5BPAA 4H82A 4L7AA 1JAPA 3HB2P 2X3CA 1ZP5A 1XFUA 1ND1A 3LGPA 1G05A 3KMCA 5L79A 3TVCA 1DMTA 5D1TA 3EDGA 1OMJA 4XM8A 3M7PA 2OW0A 3LIKA 2E2DA 4FVLA 1EAKA 1GO7P 3NX7A 1YCMA 2L0RA 3KRYA 2K9CA 2RJQA 2YB9A 3BKHA 1PWVA 2D1OA 1JH1A 1KAPP 1EB6A 2JSDA 1XUCA 1HFSA 1JAQA 1GE5A 1OM6A 2W0DA 1BUDA 2OI0A 1C3IA 3G5CA 1A86A 1OM7A 4BXJA 4AYKA 3HBUP 3DL1A 2MLSA 5I2ZA 3I7GA 966CA 1J7NA 4BPAA 2OZRA 3U1RA 3LJTA 1GE7A 2QPJA 1I76A 3L0TA 3D2ZA 3VTGA 4EFSA 1QICA 1GE6A 5L7FA 4IJOA 5I12A 3B8ZA 4GWNA 1JK3A 3EHXA 4HX3A 2WOAA 1HV5A 2XS3A 2D1NA 1BQQM 2O36A 1PDCA 1QJIA 5D1SA 1AYKA 3V96B 3HY7A 5B5OA 1CIZA 1ZTQA 3TT4A 4PKVA 2W15A 1BQOA 4WKIA 4H3XA 1I73A 3LILA 2W13A 1C7KA 3KEJA 1KS0A 3OHOA 4A3WA 1FBLA 4BJ4A 2JT6A 4G54A 2EROA 5LABA 1R54A 3LUNA 3K7NA 1PWWA 2OVZA 2J0TA 2WO8A 4AIGA 2V4BA 2OY2A 1R1HA 3HDBA 2OW9A 4GR8A 5JMYA 4PKTA 1XFZA 1YOUA 3RTTA 4H76A 4L63A 1XFVA 3Q2GA 4GR3A 1KUKA 1BM6A 3LIRA 2CLTA 3O64A 4FU4A 3DTKA 1KUFA 2HU6A 2JNPA 1G9KA 4H2EA 3P1VA 3DPEA 2X3BA 1D8FA 4ZR5A 1WNIA 3D2YA 1YP1A 1K7IA 1IABA 4QKZA 1BZSA 1Y8JA 3DPFA 1JANA 4PKQA 4AXQA 1HY7A 4AUOA 3DTEA 3G42A 4ILWD 2OXUA 2DDYA 3AYKA 2SRTA 2ERQA 1AF0A 3LUMA 2N8RA 1GKDA 1ROSA 3GBOA 1PWPA 2BH7A 4WF6A 1D5JA 3O2XA 1BKCE 2YIGA 1IAGA 3N2VA 3EDZA 5BOTA 3P24A 5D7WA 3F15A 3AIGA 2WKXA 2AYKA 1C8TA 4JQGA 1GO8P 1SATA 1OS2A 4WKEA 3WV2A 2MZIA 3HY9A 2JIHA 1KUGA 1O0QA 2FV5A 3F1AA 4CTHA 1IADA 1FLSA 1J7MA 3HBVP 1UTTA 3N2UA 1B8YA 3EDIA 4BOLA 1JKYA 1ZXCA 2MLRA 4FXQA 3F17A 3LQ0A 1OS9A 3K7LA 1MMPA 1SLNA 2W12A 2PJTA 1GXDA 1ZXVA 1S4BP 2USNA 3LQBA 4JA1A 2OXZA 4DD8A 2OW1A 3Q2HA 1IAAA 1XFWA 3EDHA 1FM1A 2I47A 5I43A 5I4OA 2FN2A 4H49A 2W14A 1CGFA 4JP4A 5H8XA 1XFXA 1CGEA 1MMRA 1EUBA 4PKRA 1O0TA 2Z2DA 4DV8A 4L19A 3ELMA 4IN9A 1E88A 1IACA 3SHIA 1L6JA 2CKIA 4PKSA 1BKCA 5CUHA 3HDAP 1MMQA 3ZUKA 3DWBA 4JPAA 1G12A 3OHLA 1AKLA 3ZXHA 1ATLA 3DTIA 2O3EA 3VI1A 4DF9A 2DW0A 2POJA 1Z3JA 4GQLA 1CQRA 2E3XA 3HYGA 5BOYA 3LE9A 3WV3A 1G49A 4GF1A 1JJ9A 1H8PA 4Q1LA 1KUHA 1R1JA 4H1QA 1BIWA 1ZVXA 1UMTA 1DTHA 2DDFA 3B2ZA 1USNA 4DPEA 4BXEA 1PWQA 1XUDA 2A8HA 1CGLA 2MZHA 2FV9A 3KWVC 1Q3AA 3F18A 5B5PA 3KEKA 4R3VA 4I35A 1KUIA 1R55A 456CA 3CKIA 2RJPA 2KRJA 1BSWA 4WK7A 5I3MA 2DW1A 1HTDA 3LJGA 1YQYA 4J4MA 1ZS0A 3MQLA 1LBUA 4FXYP 2V5OA 3BKVA 3AYUA 3F19A 1Y93A 3LEAA 1BUVM 4PKWA 3F16A 1PWUA 1RMZA 2OXWA 1MNCA 3LK8A 4XM7A 1D8MA 1QO6A 5CXAA 2X7MA 830CA 1GKCA 2OY4A 4ON1A 4LPQA 1JIZA 4JIJA 1JAOA 1UTZA 1IAEA 2XS4A 3TSKA 2JT5A 4GUYA 5D3CA 2MZEA 1K7GA 3EWJA 1SRPA 1MMBA 1CXVA 1SLMA 1R1IA 1RM8A 3MA2A 4PKUA 1K7QA 1E8BA 2AIGP 3LKAA 4H30A 1QIBA 1XURA 1JIWP 3TS4A 2Y6CA 3USNA 3L0VA 1SU3A 1XFYA 1KBCA 1A85A 4GR0A 4HMAA 4XCTA 1HOVA 1ASTA 3E8RA 5D1UA 3B92A 1I1IP 1CXWA 4WZVA 3LMCA 3RTSA 2K2GA 2ERPA 4H84A 4XBHA 3BA0A 2X3AA 5CZMA 1G4KA 4IUWA 3EHYA 4GWMA 4XM6A 1UMSA 2DW2A 4BXDA 3DSLA 1HFCA 1QJJA 3ZVSA 4A7BA 2OW2A 3KECA 3DNGA 1B3DA 2TCLA 3UVCA 3KMEA 1H71P 1BKCI 3LJZA 2WO9A 1CK7A 5I0LA 3WV1A 1D7XA 3KHIA 4I03A 3I7IA 1Y0VA 5D2BA 1UEAA 1QIAA 1OM8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QUA A;  4L6T A;  4G9L A;  1OO9 A;  1SMP A;  2Y6D A;  4G0D A;  2OVX A;  1CAQ A;  2J83 A;  5BPA A;  4H82 A;  1JAP A;  3HB2 P;  2X3C A;  1ZP5 A;  1XFU A;  1ND1 A;  3LGP A;  1G05 A;  3KMC A;  5L79 A;  3TVC A;  1DMT A;  5D1T A;  3EDG A;  1OMJ A;  4XM8 A;  3M7P A;  2OW0 A;  3LIK A;  2E2D A;  4FVL A;  1EAK A;  1GO7 P;  3NX7 A;  1YCM A;  2L0R A;  3KRY A;  2K9C A;  2RJQ A;  2YB9 A;  3BKH A;  1PWV A;  2D1O A;  1JH1 A;  1KAP P;  1EB6 A;  2JSD A;  1XUC A;  1HFS A;  1JAQ A;  1GE5 A;  1OM6 A;  2W0D A;  1BUD A;  2OI0 A;  1C3I A;  3G5C A;  1A86 A;  1OM7 A;  4BXJ A;  4AYK A;  3HBU P;  3DL1 A;  2MLS A;  5I2Z A;  3I7G A;  966C A;  1J7N A;  4BPA A;  2OZR A;  3U1R A;  3LJT A;  1GE7 A;  2QPJ A;  1I76 A;  3L0T A;  3D2Z A;  3VTG A;  4EFS A;  1QIC A;  1GE6 A;  5L7F A;  4IJO A;  5I12 A;  3B8Z A;  4GWN A;  1JK3 A;  3EHX A;  4HX3 A;  2WOA A;  1HV5 A;  2XS3 A;  2D1N A;  1BQQ M;  2O36 A;  1PDC A;  1QJI A;  5D1S A;  1AYK A;  3V96 B;  3HY7 A;  5B5O A;  1CIZ A;  1ZTQ A;  3TT4 A;  4PKV A;  2W15 A;  1BQO A;  4WKI A;  4H3X A;  1I73 A;  3LIL A;  2W13 A;  1C7K A;  3KEJ A;  1KS0 A;  3OHO A;  4A3W A;  1FBL A;  4BJ4 A;  2JT6 A;  4G54 A;  2ERO A;  5LAB A;  1R54 A;  3LUN A;  3K7N A;  1PWW A;  2OVZ A;  2J0T A;  2WO8 A;  4AIG A;  2V4B A;  2OY2 A;  1R1H A;  3HDB A;  2OW9 A;  4GR8 A;  5JMY A;  4PKT A;  1XFZ A;  1YOU A;  3RTT A;  4H76 A;  4L63 A;  1XFV A;  3Q2G A;  4GR3 A;  1KUK A;  1BM6 A;  3LIR A;  2CLT A;  3O64 A;  4FU4 A;  1KUF A;  2HU6 A;  2JNP A;  1G9K A;  4H2E A;  3P1V A;  3DPE A;  2X3B A;  1D8F A;  4ZR5 A;  1WNI A;  3D2Y A;  1YP1 A;  1K7I A;  1IAB A;  4QKZ A;  1BZS A;  1Y8J A;  3DPF A;  1JAN A;  4PKQ A;  4AXQ A;  1HY7 A;  4AUO A;  3G42 A;  4ILW D;  2OXU A;  2DDY A;  3AYK A;  2SRT A;  2ERQ A;  1AF0 A;  3LUM A;  2N8R A;  1GKD A;  1ROS A;  3GBO A;  1PWP A;  2BH7 A;  4WF6 A;  1D5J A;  3O2X A;  1BKC E;  2YIG A;  1IAG A;  3N2V A;  3EDZ A;  5BOT A;  3P24 A;  5D7W A;  3F15 A;  3AIG A;  2WKX A;  2AYK A;  1C8T A;  4JQG A;  1GO8 P;  1SAT A;  1OS2 A;  4WKE A;  3WV2 A;  2MZI A;  3HY9 A;  2JIH A;  1KUG A;  1O0Q A;  2FV5 A;  3F1A A;  4CTH A;  1IAD A;  1FLS A;  1J7M A;  3HBV P;  1UTT A;  3N2U A;  1B8Y A;  3EDI A;  4BOL A;  1JKY A;  1ZXC A;  2MLR A;  4FXQ A;  3F17 A;  3LQ0 A;  1OS9 A;  3K7L A;  1MMP A;  1SLN A;  2W12 A;  2PJT A;  1GXD A;  1ZXV A;  1S4B P;  2USN A;  3LQB A;  4JA1 A;  2OXZ A;  4DD8 A;  2OW1 A;  3Q2H A;  1IAA A;  1XFW A;  3EDH A;  1FM1 A;  2I47 A;  5I43 A;  5I4O A;  2FN2 A;  4H49 A;  2W14 A;  1CGF A;  4JP4 A;  5H8X A;  1XFX A;  1CGE A;  1MMR A;  1EUB A;  4PKR A;  1O0T A;  2Z2D A;  4DV8 A;  4L19 A;  3ELM A;  4IN9 A;  1E88 A;  1IAC A;  3SHI A;  1L6J A;  2CKI A;  4PKS A;  1BKC A;  5CUH A;  3HDA P;  1MMQ A;  3ZUK A;  3DWB A;  4JPA A;  1G12 A;  3OHL A;  1AKL A;  3ZXH A;  1ATL A;  2O3E A;  3VI1 A;  4DF9 A;  2DW0 A;  2POJ A;  1Z3J A;  4GQL A;  1CQR A;  2E3X A;  3HYG A;  5BOY A;  3LE9 A;  3WV3 A;  1G49 A;  4GF1 A;  1JJ9 A;  1H8P A;  4Q1L A;  1KUH A;  1R1J A;  4H1Q A;  1BIW A;  1ZVX A;  1UMT A;  1DTH A;  2DDF A;  3B2Z A;  1USN A;  4DPE A;  4BXE A;  1PWQ A;  1XUD A;  2A8H A;  1CGL A;  2MZH A;  2FV9 A;  3KWV C;  1Q3A A;  3F18 A;  5B5P A;  3KEK A;  4R3V A;  4I35 A;  1KUI A;  1R55 A;  456C A;  3CKI A;  2RJP A;  2KRJ A;  1BSW A;  4WK7 A;  5I3M A;  2DW1 A;  1HTD A;  3LJG A;  1YQY A;  4J4M A;  1ZS0 A;  3MQL A;  1LBU A;  4FXY P;  2V5O A;  3BKV A;  3AYU A;  3F19 A;  1Y93 A;  3LEA A;  1BUV M;  4PKW A;  3F16 A;  1PWU A;  1RMZ A;  2OXW A;  1MNC A;  3LK8 A;  4XM7 A;  1D8M A;  1QO6 A;  5CXA A;  2X7M A;  830C A;  1GKC A;  2OY4 A;  4ON1 A;  4LPQ A;  1JIZ A;  4JIJ A;  1JAO A;  1UTZ A;  1IAE A;  2XS4 A;  3TSK A;  2JT5 A;  4GUY A;  5D3C A;  2MZE A;  1K7G A;  3EWJ A;  1SRP A;  1MMB A;  1CXV A;  1SLM A;  1R1I A;  1RM8 A;  3MA2 A;  4PKU A;  1K7Q A;  1E8B A;  2AIG P;  3LKA A;  4H30 A;  1QIB A;  1XUR A;  1JIW P;  3TS4 A;  2Y6C A;  3USN A;  3L0V A;  1SU3 A;  1XFY A;  1KBC A;  1A85 A;  4GR0 A;  4HMA A;  4XCT A;  1HOV A;  1AST A;  3E8R A;  5D1U A;  3B92 A;  1I1I P;  1CXW A;  4WZV A;  3LMC A;  3RTS A;  2K2G A;  2ERP A;  4H84 A;  4XBH A;  3BA0 A;  2X3A A;  5CZM A;  1G4K A;  4IUW A;  3EHY A;  4GWM A;  4XM6 A;  1UMS A;  2DW2 A;  4BXD A;  3DSL A;  1HFC A;  1QJJ A;  3ZVS A;  4A7B A;  2OW2 A;  3KEC A;  3DNG A;  1B3D A;  2TCL A;  3UVC A;  3KME A;  1H71 P;  1BKC I;  3LJZ A;  2WO9 A;  1CK7 A;  5I0L A;  3WV1 A;  1D7X A;  3KHI A;  4I03 A;  3I7I A;  1Y0V A;  5D2B A;  1UEA A;  1QIA A;  1OM8 A; 
#chains in the Genus database with same CATH topology
 1QUA A;  4OJP A;  4L6T A;  1YU4 A;  3L27 A;  4G9L A;  1OO9 A;  1SMP A;  2Y6D A;  4G0D A;  2OVX A;  2YUF A;  1CAQ A;  2J83 A;  3N3F A;  5BPA A;  4H82 A;  1YUE A;  4L7A A;  4Z2K A;  1JAP A;  3L26 A;  3HB2 P;  2X3C A;  1ZP5 A;  1XFU A;  1ND1 A;  3LGP A;  1G05 A;  3KMC A;  1OZ9 A;  4GHA A;  5L79 A;  3TVC A;  1DMT A;  5D1T A;  3EDG A;  1OMJ A;  4Z2J A;  4XM8 A;  2D49 A;  3M7P A;  2OW0 A;  3LIK A;  1O6I A;  2E2D A;  1EAK A;  4FVL A;  1GO7 P;  3NX7 A;  4TX8 A;  1YCM A;  2L0R A;  3KRY A;  2K9C A;  2RJQ A;  2YB9 A;  3BKH A;  1PWV A;  2D1O A;  1JH1 A;  1KAP P;  1EB6 A;  2Y2H A;  2JSD A;  1XUC A;  1HFS A;  4MB4 A;  1JAQ A;  1GE5 A;  1OM6 A;  2W0D A;  2BG1 A;  4IBF A;  1BUD A;  2Y2K A;  1C3I A;  2OI0 A;  1A86 A;  3G5C A;  1OM7 A;  1XAX A;  4BXJ A;  1GPF A;  3HBU P;  4AYK A;  2Y2O A;  3DL1 A;  2MLS A;  5I2Z A;  3I7G A;  966C A;  1J7N A;  4BPA A;  1YU2 A;  2OZR A;  3U1R A;  3LJT A;  1GE7 A;  2QPJ A;  1I76 A;  3L0T A;  4HMC A;  3D2Z A;  3VTG A;  1E6P A;  4EFS A;  1QIC A;  1GE6 A;  5L7F A;  4IJO A;  5I12 A;  3B8Z A;  4GWN A;  1JK3 A;  3EHX A;  4HX3 A;  2WOA A;  1HV5 A;  2XS3 A;  2D1N A;  3WD4 A;  1BQQ M;  1PDC A;  2O36 A;  1QJI A;  5D1S A;  1AYK A;  4NY2 A;  3V96 B;  4NZ3 A;  3HY7 A;  5B5O A;  3FKE A;  1CIZ A;  1ZTQ A;  3TT4 A;  1YU3 A;  4PKV A;  2W15 A;  1BQO A;  4WKI A;  4H3X A;  1I73 A;  3LIL A;  2W13 A;  1C7K A;  3KEJ A;  1E6Z A;  4LG2 A;  1KS0 A;  3OHO A;  4A3W A;  1FBL A;  4BJ4 A;  4IBI A;  2JT6 A;  3WD1 A;  4G54 A;  3L29 A;  2ERO A;  5LAB A;  1R54 A;  3LUN A;  3K7N A;  1PWW A;  2J0T A;  2OVZ A;  2WO8 A;  4AIG A;  2V4B A;  2OY2 A;  1R1H A;  3HDB A;  2OW9 A;  4GR8 A;  5JMY A;  4IBK A;  1XFZ A;  4PKT A;  1YOU A;  3RTT A;  4H76 A;  3KS4 A;  4L63 A;  1XFV A;  3Q2G A;  4GR3 A;  1E15 A;  1AIW A;  4OJL A;  1KUK A;  1BM6 A;  3LIR A;  2CLT A;  2IOU A;  4IBJ A;  3O64 A;  4FU4 A;  3DTK A;  1KUF A;  2HU6 A;  2JNP A;  1G9K A;  4H2E A;  3P1V A;  3L2A A;  3DPE A;  1D8F A;  2X3B A;  4ZR5 A;  1WNI A;  3D2Y A;  1YP1 A;  1K7I A;  1IAB A;  4QKZ A;  1BZS A;  1Y8J A;  3DPF A;  1JAN A;  4PKQ A;  4AXQ A;  1HY7 A;  4AUO A;  3DTE A;  3G42 A;  4ILW D;  2OXU A;  2DDY A;  3L25 A;  3AYK A;  2SRT A;  2ERQ A;  1AF0 A;  3LUM A;  2N8R A;  3WD2 A;  1GKD A;  1ROS A;  3GBO A;  1PWP A;  2BH7 A;  4GH9 A;  4WF6 A;  1YU1 A;  1D5J A;  3O2X A;  1BKC E;  2YIG A;  4HME A;  1IAG A;  3N2V A;  2Y2M A;  3EDZ A;  4OJO A;  5BOT A;  3P24 A;  5D7W A;  3F15 A;  1W1P A;  3AIG A;  2WKX A;  2AYK A;  1C8T A;  4JQG A;  1GO8 P;  4Z2I A;  1SAT A;  3WD3 A;  4IJF A;  1OS2 A;  4WKE A;  4NYY A;  3WV2 A;  2MZI A;  4NZ5 A;  3HY9 A;  2JIH A;  1KUG A;  1O0Q A;  2FV5 A;  3F1A A;  4CTH A;  3WX7 A;  1IAD A;  1FLS A;  1J7M A;  3HBV P;  1UTT A;  3N2U A;  1B8Y A;  3EDI A;  4BOL A;  1JKY A;  1ZXC A;  1OGB A;  2MLR A;  4FXQ A;  4IJE A;  3F17 A;  3LQ0 A;  2Y2J A;  1OS9 A;  3K7L A;  1MMP A;  1SLN A;  2W12 A;  2PJT A;  1GXD A;  4GHL A;  1S4B P;  1ZXV A;  2USN A;  3LQB A;  4JA1 A;  2Y2Q A;  2OXZ A;  1TVI A;  4DD8 A;  2OW1 A;  1UR9 A;  3Q2H A;  1IAA A;  1XFW A;  3EDH A;  3KS8 A;  1FM1 A;  2I47 A;  5I43 A;  5I4O A;  2FN2 A;  4H49 A;  2W14 A;  1CGF A;  4JP4 A;  5H8X A;  1XFX A;  1CGE A;  1MMR A;  1EUB A;  4PKR A;  2Y2N A;  1O0T A;  2Z2D A;  4DV8 A;  3WD0 A;  4L19 A;  4OUI A;  3ELM A;  4IN9 A;  1E88 A;  1IAC A;  3SHI A;  4IBC A;  1L6J A;  2CKI A;  4PKS A;  1BKC A;  5CUH A;  3HDA P;  1MMQ A;  2Y2P A;  3ZUK A;  2JCH A;  3DWB A;  2RTS A;  4JPA A;  1W1Y A;  1G12 A;  3OHL A;  1AKL A;  3ZXH A;  1ATL A;  3DTI A;  2O3E A;  3VI1 A;  4DF9 A;  2DW0 A;  2POJ A;  1Z3J A;  4GQL A;  1CQR A;  2E3X A;  3HYG A;  5BOY A;  3LE9 A;  3WV3 A;  4OJ5 A;  1G49 A;  4GF1 A;  1JJ9 A;  1H8P A;  4Q1L A;  1KUH A;  1R1J A;  4H1Q A;  4OJ6 A;  1GOI A;  1BIW A;  1ZVX A;  1UMT A;  1DTH A;  2DDF A;  3B2Z A;  1USN A;  4DPE A;  4BXE A;  2UWX A;  1PWQ A;  1XUD A;  2A8H A;  1CGL A;  2Y2I A;  1H0I A;  4MB5 A;  2MZH A;  3L28 A;  2FV9 A;  3KWV C;  1Q3A A;  3F18 A;  5B5P A;  4IBE A;  4HMD A;  3KEK A;  4R3V A;  4I35 A;  1KUI A;  1R55 A;  456C A;  3CKI A;  2RJP A;  2KRJ A;  1BSW A;  4WK7 A;  5I3M A;  2DW1 A;  1HTD A;  3LJG A;  1YQY A;  4J4M A;  1ZS0 A;  3MQL A;  1LBU A;  4FXY P;  2V5O A;  3BKV A;  1E6N A;  4NZ4 A;  3AYU A;  3F19 A;  1Y93 A;  3LEA A;  1BUV M;  4PKW A;  3F16 A;  1YU0 A;  1PWU A;  1RMZ A;  2OXW A;  1MNC A;  5BPV A;  3LK8 A;  4XM7 A;  1D8M A;  1QO6 A;  1OGG A;  5CXA A;  2X7M A;  830C A;  1GKC A;  2OY4 A;  4ON1 A;  4LPQ A;  1JIZ A;  4JIJ A;  2Y2G A;  1JAO A;  1UTZ A;  1IAE A;  4Z2H A;  2XS4 A;  3TSK A;  2JT5 A;  4NZ1 A;  4GUY A;  5D3C A;  2MZE A;  1K7G A;  3EWJ A;  1SRP A;  1MMB A;  3HON A;  2JE5 A;  1CXV A;  1SLM A;  1R1I A;  1RM8 A;  4IBG A;  3MA2 A;  4PKU A;  1K7Q A;  1E8B A;  1W1V A;  2AIG P;  3LKA A;  4H30 A;  1QIB A;  1XUR A;  4QNL A;  1JIW P;  3TS4 A;  2Y6C A;  2FFF B;  2Y2L A;  3USN A;  3L0V A;  1SU3 A;  1XFY A;  1KBC A;  4MB3 A;  1A85 A;  4GR0 A;  4HMA A;  4XCT A;  1E6R A;  1HOV A;  1AST A;  3E8R A;  1H0G A;  5D1U A;  3B92 A;  1I1I P;  4IBB A;  1CXW A;  4WZV A;  3LMC A;  3RTS A;  2K2G A;  2ERP A;  4Z2G A;  1XM5 A;  4H84 A;  4XBH A;  4NYU A;  3BA0 A;  2XD5 A;  2X3A A;  5CZM A;  1G4K A;  4IUW A;  3EHY A;  4GWM A;  4XM6 A;  1UMS A;  4IBD A;  2DW2 A;  4BXD A;  1W1T A;  3DSL A;  1HFC A;  1ED7 A;  1QJJ A;  3ZVS A;  4A7B A;  2OW2 A;  2XD1 A;  3KEC A;  3DNG A;  1B3D A;  2TCL A;  3UVC A;  3KME A;  1H71 P;  1UR8 A;  1BKC I;  3HSH A;  3LJZ A;  2WO9 A;  4Z2L A;  1CK7 A;  5I0L A;  3WV1 A;  1D7X A;  3KHI A;  4I03 A;  3I7I A;  1Y0V A;  5D2B A;  1UEA A;  1QIA A;  1OM8 A; 
#chains in the Genus database with same CATH homology
 1QUA A;  4L6T A;  4G9L A;  1OO9 A;  1SMP A;  2Y6D A;  4G0D A;  2OVX A;  2YUF A;  1CAQ A;  2J83 A;  5BPA A;  4H82 A;  4L7A A;  1JAP A;  3HB2 P;  2X3C A;  1ZP5 A;  1XFU A;  1ND1 A;  3LGP A;  1G05 A;  3KMC A;  5L79 A;  3TVC A;  1DMT A;  5D1T A;  3EDG A;  1OMJ A;  4XM8 A;  3M7P A;  2OW0 A;  3LIK A;  2E2D A;  4FVL A;  1EAK A;  1GO7 P;  3NX7 A;  1YCM A;  2L0R A;  3KRY A;  2K9C A;  2RJQ A;  2YB9 A;  3BKH A;  1PWV A;  2D1O A;  1JH1 A;  1KAP P;  1EB6 A;  2JSD A;  1XUC A;  1HFS A;  1JAQ A;  1GE5 A;  1OM6 A;  2W0D A;  1BUD A;  2OI0 A;  1C3I A;  3G5C A;  1A86 A;  1OM7 A;  4BXJ A;  4AYK A;  3HBU P;  3DL1 A;  2MLS A;  5I2Z A;  3I7G A;  966C A;  1J7N A;  4BPA A;  2OZR A;  3U1R A;  3LJT A;  1GE7 A;  2QPJ A;  1I76 A;  3L0T A;  3D2Z A;  3VTG A;  4EFS A;  1QIC A;  1GE6 A;  5L7F A;  4IJO A;  5I12 A;  3B8Z A;  4GWN A;  1JK3 A;  3EHX A;  4HX3 A;  2WOA A;  1HV5 A;  2XS3 A;  2D1N A;  1BQQ M;  2O36 A;  1PDC A;  1QJI A;  5D1S A;  1AYK A;  3V96 B;  3HY7 A;  5B5O A;  1CIZ A;  1ZTQ A;  3TT4 A;  4PKV A;  2W15 A;  1BQO A;  4WKI A;  4H3X A;  1I73 A;  3LIL A;  2W13 A;  1C7K A;  3KEJ A;  1KS0 A;  3OHO A;  4A3W A;  1FBL A;  4BJ4 A;  2JT6 A;  4G54 A;  2ERO A;  5LAB A;  1R54 A;  3LUN A;  3K7N A;  1PWW A;  2OVZ A;  2J0T A;  2WO8 A;  4AIG A;  2V4B A;  2OY2 A;  1R1H A;  3HDB A;  2OW9 A;  4GR8 A;  5JMY A;  4PKT A;  1XFZ A;  1YOU A;  3RTT A;  4H76 A;  4L63 A;  1XFV A;  3Q2G A;  4GR3 A;  1KUK A;  1BM6 A;  3LIR A;  2CLT A;  3O64 A;  4FU4 A;  3DTK A;  1KUF A;  2HU6 A;  2JNP A;  1G9K A;  4H2E A;  3P1V A;  3DPE A;  2X3B A;  1D8F A;  4ZR5 A;  1WNI A;  3D2Y A;  1YP1 A;  1K7I A;  1IAB A;  4QKZ A;  1BZS A;  1Y8J A;  3DPF A;  1JAN A;  4PKQ A;  4AXQ A;  1HY7 A;  4AUO A;  3DTE A;  3G42 A;  4ILW D;  2OXU A;  2DDY A;  3AYK A;  2SRT A;  2ERQ A;  1AF0 A;  3LUM A;  2N8R A;  1GKD A;  1ROS A;  3GBO A;  1PWP A;  2BH7 A;  4WF6 A;  1D5J A;  3O2X A;  1BKC E;  2YIG A;  1IAG A;  3N2V A;  3EDZ A;  5BOT A;  3P24 A;  5D7W A;  3F15 A;  3AIG A;  2WKX A;  2AYK A;  1C8T A;  4JQG A;  1GO8 P;  1SAT A;  1OS2 A;  4WKE A;  3WV2 A;  2MZI A;  3HY9 A;  2JIH A;  1KUG A;  1O0Q A;  2FV5 A;  3F1A A;  4CTH A;  1IAD A;  1FLS A;  1J7M A;  3HBV P;  1UTT A;  3N2U A;  1B8Y A;  3EDI A;  4BOL A;  1JKY A;  1ZXC A;  2MLR A;  4FXQ A;  3F17 A;  3LQ0 A;  1OS9 A;  3K7L A;  1MMP A;  1SLN A;  2W12 A;  2PJT A;  1GXD A;  1ZXV A;  1S4B P;  2USN A;  3LQB A;  4JA1 A;  2OXZ A;  4DD8 A;  2OW1 A;  3Q2H A;  1IAA A;  1XFW A;  3EDH A;  1FM1 A;  2I47 A;  5I43 A;  5I4O A;  2FN2 A;  4H49 A;  2W14 A;  1CGF A;  4JP4 A;  5H8X A;  1XFX A;  1CGE A;  1MMR A;  1EUB A;  4PKR A;  1O0T A;  2Z2D A;  4DV8 A;  4L19 A;  3ELM A;  4IN9 A;  1E88 A;  1IAC A;  3SHI A;  1L6J A;  2CKI A;  4PKS A;  1BKC A;  5CUH A;  3HDA P;  1MMQ A;  3ZUK A;  3DWB A;  4JPA A;  1G12 A;  3OHL A;  1AKL A;  3ZXH A;  1ATL A;  3DTI A;  2O3E A;  3VI1 A;  4DF9 A;  2DW0 A;  2POJ A;  1Z3J A;  4GQL A;  1CQR A;  2E3X A;  3HYG A;  5BOY A;  3LE9 A;  3WV3 A;  1G49 A;  4GF1 A;  1JJ9 A;  1H8P A;  4Q1L A;  1KUH A;  1R1J A;  4H1Q A;  1BIW A;  1ZVX A;  1UMT A;  1DTH A;  2DDF A;  3B2Z A;  1USN A;  4DPE A;  4BXE A;  1PWQ A;  1XUD A;  2A8H A;  1CGL A;  2MZH A;  2FV9 A;  3KWV C;  1Q3A A;  3F18 A;  5B5P A;  3KEK A;  4R3V A;  4I35 A;  1KUI A;  1R55 A;  456C A;  3CKI A;  2RJP A;  2KRJ A;  1BSW A;  4WK7 A;  5I3M A;  2DW1 A;  1HTD A;  3LJG A;  1YQY A;  4J4M A;  1ZS0 A;  3MQL A;  1LBU A;  4FXY P;  2V5O A;  3BKV A;  3AYU A;  3F19 A;  1Y93 A;  3LEA A;  1BUV M;  4PKW A;  3F16 A;  1PWU A;  1RMZ A;  2OXW A;  1MNC A;  3LK8 A;  4XM7 A;  1D8M A;  1QO6 A;  5CXA A;  2X7M A;  830C A;  1GKC A;  2OY4 A;  4ON1 A;  4LPQ A;  1JIZ A;  4JIJ A;  1JAO A;  1UTZ A;  1IAE A;  2XS4 A;  3TSK A;  2JT5 A;  4GUY A;  5D3C A;  2MZE A;  1K7G A;  3EWJ A;  1SRP A;  1MMB A;  1CXV A;  1SLM A;  1R1I A;  1RM8 A;  3MA2 A;  4PKU A;  1K7Q A;  1E8B A;  2AIG P;  3LKA A;  4H30 A;  1QIB A;  1XUR A;  1JIW P;  3TS4 A;  2Y6C A;  3USN A;  3L0V A;  1SU3 A;  1XFY A;  1KBC A;  1A85 A;  4GR0 A;  4HMA A;  4XCT A;  1HOV A;  1AST A;  3E8R A;  5D1U A;  3B92 A;  1I1I P;  1CXW A;  4WZV A;  3LMC A;  3RTS A;  2K2G A;  2ERP A;  4H84 A;  4XBH A;  3BA0 A;  2X3A A;  5CZM A;  1G4K A;  4IUW A;  3EHY A;  4GWM A;  4XM6 A;  1UMS A;  2DW2 A;  4BXD A;  3DSL A;  1HFC A;  1QJJ A;  3ZVS A;  4A7B A;  2OW2 A;  3KEC A;  3DNG A;  1B3D A;  2TCL A;  3UVC A;  3KME A;  1H71 P;  1BKC I;  3LJZ A;  2WO9 A;  1CK7 A;  5I0L A;  3WV1 A;  1D7X A;  3KHI A;  4I03 A;  3I7I A;  1Y0V A;  5D2B A;  1UEA A;  1QIA A;  1OM8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...