1EAKA

Catalytic domain of prommp-2 e404q mutant
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
421
structure length
421
Chain Sequence
b'SPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHQFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPDID'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 72 KDA TYPE IV COLLAGENASE
publication title Crystal Structure of Human Mmp-2 Reveals a New P
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 100
structure length 421
sequence length 421
chains with identical sequence B, C, D
ec nomenclature ec 3.4.24.24: Gelatinase A.
pdb deposition date 2001-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00040 fn2 Fibronectin type II domain
A PF00413 Peptidase_M10 Matrixin
A PF01471 PG_binding_1 Putative peptidoglycan binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.101.10 Mainly Alpha Orthogonal Bundle Muramoyl-pentapeptide Carboxypeptidase; domain 1 PGBD-like superfamily/PGBD 1eakA01
2.10.10.10 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Fibronectin, type II, collagen-binding 1eakA03
2.10.10.10 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Fibronectin, type II, collagen-binding 1eakA04
2.10.10.10 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Fibronectin, type II, collagen-binding 1eakA05
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1eakA02
1Y0VA 2WKXA 2OY2A 2X7MA 3HY7A 2WOAA 1XFWA 3OHOA 3V96B 1Y93A 2KRJA 3GBOA 4AIGA 1AYKA 3EHYA 2OI0A 1KUIA 1ZS0A 2W13A 2MLRA 4CTHA 2BH7A 3DWBA 4GWNA 3G5CA 3AYUA 2ERQA 2X3CA 2EROA 1Q3AA 3RTTA 4LPQA 1GE6A 1MMBA 1A86A 4PKWA 4XM8A 4G0DA 3DPFA 5I3MA 1ZVXA 5CUHA 1J7NA 4G54A 1CAQA 3CKIA 3KEJA 1OO9A 2YIGA 4H82A 3TS4A 3LE9A 4GR8A 3LQBA 1G49A 1OS9A 3K7NA 1UMTA 1AF0A 3ELMA 3E8RA 2FV9A 2OZRA 1HOVA 1CGFA 3M7PA 5D7WA 4H1QA 1GE5A 2E3XA 4A7BA 1XUDA 4H3XA 1JKYA 3TT4A 1XURA 1SLNA 1CXVA 1B8YA 1R1HA 5CXAA 1D8FA 4XM7A 1BIWA 2DW1A 3F17A 1BKCA 2ERPA 2Y6DA 2JT5A 4BOLA 1D8MA 2YB9A 4GF1A 2MZIA 1K7IA 1ZXCA 1JAPA 1E8BA 1O0TA 3LIRA 4G9LA 2W12A 3LGPA 3N2UA 5D2BA 4L19A 3DL1A 2MLSA 4EFSA 1CQRA 4J4MA 3F18A 3KECA 3KMEA 5D1UA 2Z2DA 1R54A 1H71P 3KHIA 3B8ZA 5CZMA 1BKCE 1DTHA 1YQYA 4IUWA 2W14A 2CKIA 1LBUA 3LK8A 1JAQA 1ZTQA 1I76A 3K7LA 1ND1A 4IJOA 1PWWA 4HMAA 3MQLA 1IAGA 2V4BA 1QJIA 1QJJA 4XBHA 1BUDA 1GO8P 3DPEA 3TSKA 3NX7A 3DNGA 5D3CA 1PDCA 1B3DA 1EUBA 3EDIA 1D7XA 4PKSA 4BXDA 3BKHA 1IABA 3KEKA 2JT6A 4PKTA 1UTZA 2DW2A 3I7IA 4DF9A 1G05A 5BOTA 4IN9A 3P24A 3ZUKA 1O0QA 3L0TA 2OW9A 1OM8A 1QUAA 4QKZA 1KUGA 5BPAA 3EWJA 3LJZA 4JIJA 1KUFA 3I7GA 5I2ZA 4AXQA 1CXWA 1EAKA 2OVZA 456CA 1CGEA 1RM8A 1QIBA 1KAPP 5B5OA 5BOYA 1G9KA 830CA 4WF6A 1XFZA 3B2ZA 4H30A 1K7GA 1ASTA 1S4BP 3WV3A 3LQ0A 4PKUA 3WV2A 1G12A 1R1JA 1G4KA 5I12A 1OM6A 2WO9A 3LILA 1ZXVA 4GR0A 2FN2A 3HBUP 1KS0A 3LEAA 1FBLA 2OW2A 3ZVSA 3Q2HA 1PWUA 4JQGA 2DDFA 2WO8A 1R55A 1YCMA 1OS2A 3AYKA 3RTSA 4H49A 1KBCA 3G42A 1SATA 1L6JA 1BUVM 1D5JA 1IADA 1FM1A 1C7KA 1KUHA 1BZSA 2OVXA 1KUKA 1JH1A 3D2YA 1PWVA 4ON1A 1H8PA 1ROSA 1QO6A 2RJPA 3HY9A 1XUCA 1MMQA 5I4OA 1DMTA 2D1OA 2XS4A 4H84A 2I47A 1OMJA 1YP1A 5B5PA 1GXDA 3KMCA 1PWPA 4DV8A 5JMYA 2X3BA 1JANA 4JP4A 2W0DA 1SMPA 4WK7A 1E88A 4BXJA 1UMSA 1GO7P 4PKVA 3UVCA 1XFYA 3HYGA 3O2XA 4FU4A 3SHIA 2XS3A 4I35A 1JJ9A 1SU3A 2J0TA 2X3AA 1BM6A 1USNA 1CGLA 1JAOA 1AKLA 5L79A 2D1NA 2V5OA 2CLTA 3HDAP 1PWQA 4H76A 1ATLA 1CK7A 1IACA 1YOUA 3BKVA 4WKIA 3N2VA 2QPJA 1WNIA 4JPAA 3LKAA 4BXEA 1HFCA 3HB2P 1R1IA 2PJTA 3KWVC 2JIHA 3O64A 2OY4A 1MMPA 1HV5A 3LIKA 3D2ZA 2FV5A 5D1SA 1C3IA 5I43A 966CA 2MZHA 2RJQA 1HTDA 5D1TA 4WZVA 3L0VA 1UTTA 1BQOA 4PKRA 1XFVA 1I1IP 1I73A 1SLMA 2K2GA 4BPAA 3USNA 2N8RA 1HFSA 3EDZA 2SRTA 4DD8A 2L0RA 3F1AA 4ZR5A 3VI1A 3BA0A 2OXZA 2TCLA 4GUYA 4A3WA 1K7QA 3VTGA 4DPEA 3F15A 1IAAA 2POJA 4PKQA 3EDHA 1HY7A 2AIGP 1GKDA 1Y8JA 3EDGA 3LJGA 2E2DA 5I0LA 1JIWP 1BKCI 3TVCA 4HX3A 2AYKA 4FVLA 2HU6A 2USNA 1QICA 1A85A 4XCTA 3DSLA 4FXYP 5L7FA 1UEAA 4Q1LA 1JIZA 1J7MA 3KRYA 4GR3A 1FLSA 1MNCA 2K9CA 4JA1A 1MMRA 2Y6CA 1IAEA 4AYKA 1GE7A 4ILWD 4BJ4A 4GWMA 3ZXHA 1JK3A 1RMZA 1XFUA 3LUNA 1EB6A 2MZEA 4AUOA 2OXWA 3LJTA 2J83A 3U1RA 1OM7A 3MA2A 3P1VA 2JSDA 1BSWA 3HBVP 3F16A 4GQLA 2DW0A 4L63A 1CIZA 3Q2GA 1Z3JA 1SRPA 2O36A 2O3EA 3EHXA 1QIAA 5H8XA 2W15A 1GKCA 2OW0A 3LUMA 3OHLA 1C8TA 3F19A 2DDYA 2A8HA 2OW1A 3HDBA 4I03A 4XM6A 1ZP5A 4L6TA 2OXUA 5LABA 1XFXA 2JNPA 3AIGA 4WKEA 3B92A 3WV1A 4FXQA 4H2EA 3LMCA 4R3VA 1BQQM
chains in the Genus database with same CATH superfamily
1Y0VA 4OJLA 2WKXA 4Z2KA 4QNLA 2OY2A 2BG1A 2X7MA 3HY7A 2WOAA 1XFWA 3WD2A 3OHOA 3V96B 1Y93A 2KRJA 2D49A 3GBOA 4AIGA 1AYKA 3EHYA 2OI0A 4NZ3A 1KUIA 1ZS0A 2W13A 4MB5A 2MLRA 4CTHA 2BH7A 4HMCA 3DWBA 4GWNA 3G5CA 3AYUA 4NY2A 2ERQA 2X3CA 2EROA 1Q3AA 3RTTA 4LPQA 1YU1A 1GE6A 1E15A 1MMBA 1A86A 4PKWA 4XM8A 4Z2LA 2YUFA 4G0DA 3DPFA 4HMDA 5I3MA 1ZVXA 3L2AA 5CUHA 1J7NA 4G54A 1E6NA 1CAQA 3CKIA 3KEJA 1W1PA 1OO9A 4LG2A 2YIGA 4H82A 3TS4A 3LE9A 4GR8A 3LQBA 1G49A 1OS9A 3K7NA 2IOUA 1UMTA 2Y2LA 3L29A 1AF0A 1XM5A 3ELMA 3E8RA 2Y2NA 2FV9A 2OZRA 1HOVA 1CGFA 3M7PA 5D7WA 4H1QA 1GE5A 2E3XA 4A7BA 1XUDA 4H3XA 1JKYA 3TT4A 1XURA 2Y2OA 1SLNA 1CXVA 1B8YA 1W1VA 1OZ9A 1R1HA 1TVIA 5CXAA 1OGBA 2XD1A 1D8FA 4XM7A 1BIWA 2DW1A 3F17A 1BKCA 3FKEA 3WX7A 4NZ5A 2ERPA 2Y6DA 2JT5A 4BOLA 1D8MA 2YB9A 4GF1A 2MZIA 4IBIA 1K7IA 1ZXCA 1JAPA 1E8BA 1O0TA 3LIRA 4G9LA 2W12A 3LGPA 3N2UA 5D2BA 4L19A 3DL1A 1O6IA 2MLSA 4EFSA 1CQRA 1W1YA 4J4MA 3F18A 3KECA 3KMEA 5D1UA 2Z2DA 1R54A 1H71P 3KHIA 3B8ZA 5CZMA 1BKCE 1DTHA 1YQYA 4IUWA 2W14A 2CKIA 1LBUA 4OJPA 3KS8A 3LK8A 1JAQA 1ZTQA 1I76A 3K7LA 1ND1A 1H0IA 4IJOA 1PWWA 4HMAA 3KS4A 3MQLA 1IAGA 2V4BA 1QJIA 1QJJA 4XBHA 1BUDA 1GO8P 3DPEA 3TSKA 2FFFB 3NX7A 3DNGA 5D3CA 1PDCA 1ED7A 1B3DA 1EUBA 4GHAA 3EDIA 1AIWA 1D7XA 4PKSA 4BXDA 3BKHA 1IABA 3KEKA 2JT6A 4PKTA 4Z2GA 3DTEA 1UTZA 2DW2A 3I7IA 4DF9A 2UWXA 1G05A 5BOTA 4IN9A 3P24A 3ZUKA 4GH9A 1O0QA 3L0TA 2OW9A 1OM8A 1QUAA 4QKZA 1KUGA 4MB4A 3DTKA 5BPAA 3EWJA 1H0GA 3LJZA 4JIJA 1UR8A 2Y2PA 1KUFA 3DTIA 4OJ5A 3I7GA 5I2ZA 4IBBA 2Y2IA 4AXQA 1CXWA 1EAKA 2OVZA 456CA 1CGEA 1RM8A 1QIBA 2Y2QA 4IBGA 1KAPP 5B5OA 5BOYA 1G9KA 830CA 4WF6A 1XFZA 3B2ZA 4H30A 1K7GA 1ASTA 1S4BP 3WV3A 4IBDA 3LQ0A 4PKUA 3WV2A 2Y2JA 1G12A 1R1JA 1G4KA 5I12A 1OM6A 5BPVA 2WO9A 3LILA 3L26A 1ZXVA 4GR0A 2FN2A 3HBUP 1KS0A 3LEAA 1FBLA 2OW2A 3ZVSA 4OJ6A 3Q2HA 1PWUA 4JQGA 2DDFA 2WO8A 1R55A 1YCMA 1OS2A 3AYKA 3WD0A 3RTSA 1YUEA 4H49A 1KBCA 3G42A 1SATA 1L6JA 4HMEA 1GPFA 1BUVM 1D5JA 1IADA 1FM1A 1C7KA 1KUHA 1BZSA 2OVXA 1KUKA 1JH1A 3D2YA 1PWVA 4ON1A 1H8PA 1ROSA 1QO6A 2RJPA 3HY9A 1XUCA 1MMQA 5I4OA 1DMTA 2D1OA 2XS4A 4H84A 2I47A 1OMJA 4OUIA 4OJOA 1E6ZA 1YP1A 4IJEA 1GXDA 3KMCA 1PWPA 5B5PA 4DV8A 5JMYA 3HONA 2X3BA 1JANA 4JP4A 3L28A 2W0DA 4IBFA 1SMPA 4WK7A 1E88A 4BXJA 1UMSA 1GO7P 4NZ1A 4Z2JA 4PKVA 3UVCA 1XFYA 3HYGA 3O2XA 4FU4A 4L7AA 1W1TA 3L25A 3SHIA 2XS3A 4I35A 1JJ9A 1SU3A 1YU2A 4MB3A 2J0TA 2X3AA 1BM6A 1USNA 3WD1A 1CGLA 1AKLA 1JAOA 5L79A 2D1NA 2V5OA 2CLTA 3HDAP 1PWQA 4H76A 1ATLA 1CK7A 1IACA 1YOUA 3BKVA 4IBJA 4WKIA 3N2VA 2QPJA 1WNIA 4JPAA 3LKAA 4BXEA 1HFCA 3HB2P 1R1IA 2PJTA 3KWVC 2JIHA 3O64A 2OY4A 1MMPA 1HV5A 3LIKA 3D2ZA 2Y2KA 2FV5A 5D1SA 1C3IA 5I43A 966CA 2Y2GA 2MZHA 2RJQA 1HTDA 4NYUA 3L27A 5D1TA 2JCHA 4WZVA 3L0VA 1UTTA 1BQOA 2XD5A 4PKRA 1XFVA 1I1IP 1I73A 1SLMA 2K2GA 4BPAA 3USNA 2N8RA 1HFSA 3EDZA 2SRTA 4DD8A 2L0RA 1YU4A 3F1AA 4ZR5A 3VI1A 3BA0A 2OXZA 2TCLA 1GOIA 4GUYA 2JE5A 4A3WA 1K7QA 3VTGA 4DPEA 3F15A 2Y2MA 1IAAA 2POJA 4PKQA 3EDHA 1HY7A 4IBEA 2AIGP 1GKDA 1Y8JA 3WD4A 3EDGA 1YU3A 3LJGA 2E2DA 5I0LA 4NYYA 1JIWP 1BKCI 3TVCA 4HX3A 2AYKA 3HSHA 4FVLA 2HU6A 2USNA 1QICA 1A85A 4XCTA 3DSLA 4FXYP 5L7FA 1UR9A 1UEAA 4TX8A 2RTSA 4Q1LA 1JIZA 1J7MA 4Z2IA 3KRYA 4GR3A 2Y2HA 3N3FA 1FLSA 1MNCA 2K9CA 4JA1A 1MMRA 1E6RA 2Y6CA 1IAEA 4AYKA 1GE7A 4ILWD 4BJ4A 4GWMA 3ZXHA 1JK3A 1RMZA 1XFUA 3LUNA 1EB6A 2MZEA 4AUOA 2OXWA 4IBKA 3LJTA 4Z2HA 2J83A 3U1RA 1OM7A 3MA2A 3P1VA 2JSDA 1BSWA 3HBVP 3F16A 4GQLA 4IBCA 2DW0A 4L63A 4NZ4A 4GHLA 1CIZA 3Q2GA 1YU0A 1Z3JA 1SRPA 2O36A 2O3EA 3EHXA 1QIAA 5H8XA 2W15A 1GKCA 2OW0A 3LUMA 3OHLA 1C8TA 1OGGA 3F19A 2DDYA 2A8HA 2OW1A 3HDBA 4IJFA 4I03A 4XM6A 1ZP5A 4L6TA 2OXUA 3WD3A 5LABA 1XFXA 2JNPA 3AIGA 4WKEA 3B92A 3WV1A 1E6PA 4FXQA 4H2EA 1XAXA 3LMCA 4R3VA 1BQQM
chains in the Genus database with same CATH topology
1Y0VA 2WKXA 2OY2A 2X7MA 3HY7A 2WOAA 1XFWA 3OHOA 3V96B 1Y93A 2KRJA 3GBOA 4AIGA 1AYKA 3EHYA 2OI0A 1KUIA 1ZS0A 2W13A 2MLRA 4CTHA 2BH7A 3DWBA 4GWNA 3G5CA 3AYUA 2ERQA 2X3CA 2EROA 1Q3AA 3RTTA 4LPQA 1GE6A 1MMBA 1A86A 4PKWA 4XM8A 2YUFA 4G0DA 3DPFA 5I3MA 1ZVXA 5CUHA 1J7NA 4G54A 1CAQA 3CKIA 3KEJA 1OO9A 2YIGA 4H82A 3TS4A 3LE9A 4GR8A 3LQBA 1G49A 1OS9A 3K7NA 1UMTA 1AF0A 3ELMA 3E8RA 2FV9A 2OZRA 1HOVA 1CGFA 3M7PA 5D7WA 4H1QA 1GE5A 2E3XA 4A7BA 1XUDA 4H3XA 1JKYA 3TT4A 1XURA 1SLNA 1CXVA 1B8YA 1R1HA 5CXAA 1D8FA 4XM7A 1BIWA 2DW1A 3F17A 1BKCA 2ERPA 2Y6DA 2JT5A 4BOLA 1D8MA 2YB9A 4GF1A 2MZIA 1K7IA 1ZXCA 1JAPA 1E8BA 1O0TA 3LIRA 4G9LA 2W12A 3LGPA 3N2UA 5D2BA 4L19A 3DL1A 2MLSA 4EFSA 1CQRA 4J4MA 3F18A 3KECA 3KMEA 5D1UA 2Z2DA 1R54A 1H71P 3KHIA 3B8ZA 5CZMA 1BKCE 1DTHA 1YQYA 4IUWA 2W14A 2CKIA 1LBUA 3LK8A 1JAQA 1ZTQA 1I76A 3K7LA 1ND1A 4IJOA 1PWWA 4HMAA 3MQLA 1IAGA 2V4BA 1QJIA 1QJJA 4XBHA 1BUDA 1GO8P 3DPEA 3TSKA 3NX7A 3DNGA 5D3CA 1PDCA 1B3DA 1EUBA 3EDIA 1D7XA 4PKSA 4BXDA 3BKHA 1IABA 3KEKA 2JT6A 4PKTA 3DTEA 1UTZA 2DW2A 3I7IA 4DF9A 1G05A 5BOTA 4IN9A 3P24A 3ZUKA 1O0QA 3L0TA 2OW9A 1OM8A 1QUAA 4QKZA 1KUGA 3DTKA 5BPAA 3EWJA 3LJZA 4JIJA 1KUFA 3DTIA 3I7GA 5I2ZA 4AXQA 1CXWA 1EAKA 2OVZA 456CA 1CGEA 1RM8A 1QIBA 1KAPP 5B5OA 5BOYA 1G9KA 830CA 4WF6A 1XFZA 3B2ZA 4H30A 1K7GA 1ASTA 1S4BP 3WV3A 3LQ0A 4PKUA 3WV2A 1G12A 1R1JA 1G4KA 5I12A 1OM6A 2WO9A 3LILA 1ZXVA 4GR0A 2FN2A 3HBUP 1KS0A 3LEAA 1FBLA 2OW2A 3ZVSA 3Q2HA 1PWUA 4JQGA 2DDFA 2WO8A 1R55A 1YCMA 1OS2A 3AYKA 3RTSA 4H49A 1KBCA 3G42A 1SATA 1L6JA 1BUVM 1D5JA 1IADA 1FM1A 1C7KA 1KUHA 1BZSA 2OVXA 1KUKA 1JH1A 3D2YA 1PWVA 4ON1A 1H8PA 1ROSA 1QO6A 2RJPA 3HY9A 1XUCA 1MMQA 5I4OA 1DMTA 2D1OA 2XS4A 4H84A 2I47A 1OMJA 1YP1A 5B5PA 1GXDA 3KMCA 1PWPA 4DV8A 5JMYA 2X3BA 1JANA 4JP4A 2W0DA 1SMPA 4WK7A 1E88A 4BXJA 1UMSA 1GO7P 4PKVA 3UVCA 1XFYA 3HYGA 3O2XA 4FU4A 4L7AA 3SHIA 2XS3A 4I35A 1JJ9A 1SU3A 2J0TA 2X3AA 1BM6A 1USNA 1CGLA 1JAOA 1AKLA 5L79A 2D1NA 2V5OA 2CLTA 3HDAP 1PWQA 4H76A 1ATLA 1CK7A 1IACA 1YOUA 3BKVA 4WKIA 3N2VA 2QPJA 1WNIA 4JPAA 3LKAA 4BXEA 1HFCA 3HB2P 1R1IA 2PJTA 3KWVC 2JIHA 3O64A 2OY4A 1MMPA 1HV5A 3LIKA 3D2ZA 2FV5A 5D1SA 1C3IA 5I43A 966CA 2MZHA 2RJQA 1HTDA 5D1TA 4WZVA 3L0VA 1UTTA 1BQOA 4PKRA 1XFVA 1I1IP 1I73A 1SLMA 2K2GA 4BPAA 3USNA 2N8RA 1HFSA 3EDZA 2SRTA 4DD8A 2L0RA 3F1AA 4ZR5A 3VI1A 3BA0A 2OXZA 2TCLA 4GUYA 4A3WA 1K7QA 3VTGA 4DPEA 3F15A 1IAAA 2POJA 4PKQA 3EDHA 1HY7A 2AIGP 1GKDA 1Y8JA 3EDGA 3LJGA 2E2DA 5I0LA 1JIWP 1BKCI 3TVCA 4HX3A 2AYKA 4FVLA 2HU6A 2USNA 1QICA 1A85A 4XCTA 3DSLA 4FXYP 5L7FA 1UEAA 4Q1LA 1JIZA 1J7MA 3KRYA 4GR3A 1FLSA 1MNCA 2K9CA 4JA1A 1MMRA 2Y6CA 1IAEA 4AYKA 1GE7A 4ILWD 4BJ4A 4GWMA 3ZXHA 1JK3A 1RMZA 1XFUA 3LUNA 1EB6A 2MZEA 4AUOA 2OXWA 3LJTA 2J83A 3U1RA 1OM7A 3MA2A 3P1VA 2JSDA 1BSWA 3HBVP 3F16A 4GQLA 2DW0A 4L63A 1CIZA 3Q2GA 1Z3JA 1SRPA 2O36A 2O3EA 3EHXA 1QIAA 5H8XA 2W15A 1GKCA 2OW0A 3LUMA 3OHLA 1C8TA 3F19A 2DDYA 2A8HA 2OW1A 3HDBA 4I03A 4XM6A 1ZP5A 4L6TA 2OXUA 5LABA 1XFXA 2JNPA 3AIGA 4WKEA 3B92A 3WV1A 4FXQA 4H2EA 3LMCA 4R3VA 1BQQM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y0V A;  2WKX A;  2OY2 A;  2X7M A;  3HY7 A;  2WOA A;  1XFW A;  3OHO A;  3V96 B;  1Y93 A;  2KRJ A;  3GBO A;  4AIG A;  1AYK A;  3EHY A;  2OI0 A;  1KUI A;  1ZS0 A;  2W13 A;  2MLR A;  4CTH A;  2BH7 A;  3DWB A;  4GWN A;  3G5C A;  3AYU A;  2ERQ A;  2X3C A;  2ERO A;  1Q3A A;  3RTT A;  4LPQ A;  1GE6 A;  1MMB A;  1A86 A;  4PKW A;  4XM8 A;  4G0D A;  3DPF A;  5I3M A;  1ZVX A;  5CUH A;  1J7N A;  4G54 A;  1CAQ A;  3CKI A;  3KEJ A;  1OO9 A;  2YIG A;  4H82 A;  3TS4 A;  3LE9 A;  4GR8 A;  3LQB A;  1G49 A;  1OS9 A;  3K7N A;  1UMT A;  1AF0 A;  3ELM A;  3E8R A;  2FV9 A;  2OZR A;  1HOV A;  1CGF A;  3M7P A;  5D7W A;  4H1Q A;  1GE5 A;  2E3X A;  4A7B A;  1XUD A;  4H3X A;  1JKY A;  3TT4 A;  1XUR A;  1SLN A;  1CXV A;  1B8Y A;  1R1H A;  5CXA A;  1D8F A;  4XM7 A;  1BIW A;  2DW1 A;  3F17 A;  1BKC A;  2ERP A;  2Y6D A;  2JT5 A;  4BOL A;  1D8M A;  2YB9 A;  4GF1 A;  2MZI A;  1K7I A;  1ZXC A;  1JAP A;  1E8B A;  1O0T A;  3LIR A;  4G9L A;  2W12 A;  3LGP A;  3N2U A;  5D2B A;  4L19 A;  3DL1 A;  2MLS A;  4EFS A;  1CQR A;  4J4M A;  3F18 A;  3KEC A;  3KME A;  5D1U A;  2Z2D A;  1R54 A;  1H71 P;  3KHI A;  3B8Z A;  5CZM A;  1BKC E;  1DTH A;  1YQY A;  4IUW A;  2W14 A;  2CKI A;  1LBU A;  3LK8 A;  1JAQ A;  1ZTQ A;  1I76 A;  3K7L A;  1ND1 A;  4IJO A;  1PWW A;  4HMA A;  3MQL A;  1IAG A;  2V4B A;  1QJI A;  1QJJ A;  4XBH A;  1BUD A;  1GO8 P;  3DPE A;  3TSK A;  3NX7 A;  3DNG A;  5D3C A;  1PDC A;  1B3D A;  1EUB A;  3EDI A;  1D7X A;  4PKS A;  4BXD A;  3BKH A;  1IAB A;  3KEK A;  2JT6 A;  4PKT A;  1UTZ A;  2DW2 A;  3I7I A;  4DF9 A;  1G05 A;  5BOT A;  4IN9 A;  3P24 A;  3ZUK A;  1O0Q A;  3L0T A;  2OW9 A;  1OM8 A;  1QUA A;  4QKZ A;  1KUG A;  5BPA A;  3EWJ A;  3LJZ A;  4JIJ A;  1KUF A;  3I7G A;  5I2Z A;  4AXQ A;  1CXW A;  1EAK A;  2OVZ A;  456C A;  1CGE A;  1RM8 A;  1QIB A;  1KAP P;  5B5O A;  5BOY A;  1G9K A;  830C A;  4WF6 A;  1XFZ A;  3B2Z A;  4H30 A;  1K7G A;  1AST A;  1S4B P;  3WV3 A;  3LQ0 A;  4PKU A;  3WV2 A;  1G12 A;  1R1J A;  1G4K A;  5I12 A;  1OM6 A;  2WO9 A;  3LIL A;  1ZXV A;  4GR0 A;  2FN2 A;  3HBU P;  1KS0 A;  3LEA A;  1FBL A;  2OW2 A;  3ZVS A;  3Q2H A;  1PWU A;  4JQG A;  2DDF A;  2WO8 A;  1R55 A;  1YCM A;  1OS2 A;  3AYK A;  3RTS A;  4H49 A;  1KBC A;  3G42 A;  1SAT A;  1L6J A;  1BUV M;  1D5J A;  1IAD A;  1FM1 A;  1C7K A;  1KUH A;  1BZS A;  2OVX A;  1KUK A;  1JH1 A;  3D2Y A;  1PWV A;  4ON1 A;  1H8P A;  1ROS A;  1QO6 A;  2RJP A;  3HY9 A;  1XUC A;  1MMQ A;  5I4O A;  1DMT A;  2D1O A;  2XS4 A;  4H84 A;  2I47 A;  1OMJ A;  1YP1 A;  5B5P A;  1GXD A;  3KMC A;  1PWP A;  4DV8 A;  5JMY A;  2X3B A;  1JAN A;  4JP4 A;  2W0D A;  1SMP A;  4WK7 A;  1E88 A;  4BXJ A;  1UMS A;  1GO7 P;  4PKV A;  3UVC A;  1XFY A;  3HYG A;  3O2X A;  4FU4 A;  3SHI A;  2XS3 A;  4I35 A;  1JJ9 A;  1SU3 A;  2J0T A;  2X3A A;  1BM6 A;  1USN A;  1CGL A;  1JAO A;  1AKL A;  5L79 A;  2D1N A;  2V5O A;  2CLT A;  3HDA P;  1PWQ A;  4H76 A;  1ATL A;  1CK7 A;  1IAC A;  1YOU A;  3BKV A;  4WKI A;  3N2V A;  2QPJ A;  1WNI A;  4JPA A;  3LKA A;  4BXE A;  1HFC A;  3HB2 P;  1R1I A;  2PJT A;  3KWV C;  2JIH A;  3O64 A;  2OY4 A;  1MMP A;  1HV5 A;  3LIK A;  3D2Z A;  2FV5 A;  5D1S A;  1C3I A;  5I43 A;  966C A;  2MZH A;  2RJQ A;  1HTD A;  5D1T A;  4WZV A;  3L0V A;  1UTT A;  1BQO A;  4PKR A;  1XFV A;  1I1I P;  1I73 A;  1SLM A;  2K2G A;  4BPA A;  3USN A;  2N8R A;  1HFS A;  3EDZ A;  2SRT A;  4DD8 A;  2L0R A;  3F1A A;  4ZR5 A;  3VI1 A;  3BA0 A;  2OXZ A;  2TCL A;  4GUY A;  4A3W A;  1K7Q A;  3VTG A;  4DPE A;  3F15 A;  1IAA A;  2POJ A;  4PKQ A;  3EDH A;  1HY7 A;  2AIG P;  1GKD A;  1Y8J A;  3EDG A;  3LJG A;  2E2D A;  5I0L A;  1JIW P;  1BKC I;  3TVC A;  4HX3 A;  2AYK A;  4FVL A;  2HU6 A;  2USN A;  1QIC A;  1A85 A;  4XCT A;  3DSL A;  4FXY P;  5L7F A;  1UEA A;  4Q1L A;  1JIZ A;  1J7M A;  3KRY A;  4GR3 A;  1FLS A;  1MNC A;  2K9C A;  4JA1 A;  1MMR A;  2Y6C A;  1IAE A;  4AYK A;  1GE7 A;  4ILW D;  4BJ4 A;  4GWM A;  3ZXH A;  1JK3 A;  1RMZ A;  1XFU A;  3LUN A;  1EB6 A;  2MZE A;  4AUO A;  2OXW A;  3LJT A;  2J83 A;  3U1R A;  1OM7 A;  3MA2 A;  3P1V A;  2JSD A;  1BSW A;  3HBV P;  3F16 A;  4GQL A;  2DW0 A;  4L63 A;  1CIZ A;  3Q2G A;  1Z3J A;  1SRP A;  2O36 A;  2O3E A;  3EHX A;  1QIA A;  5H8X A;  2W15 A;  1GKC A;  2OW0 A;  3LUM A;  3OHL A;  1C8T A;  3F19 A;  2DDY A;  2A8H A;  2OW1 A;  3HDB A;  4I03 A;  4XM6 A;  1ZP5 A;  4L6T A;  2OXU A;  5LAB A;  1XFX A;  2JNP A;  3AIG A;  4WKE A;  3B92 A;  3WV1 A;  4FXQ A;  4H2E A;  3LMC A;  4R3V A;  1BQQ M; 
#chains in the Genus database with same CATH topology
 1Y0V A;  4OJL A;  2WKX A;  4Z2K A;  4QNL A;  2OY2 A;  2BG1 A;  2X7M A;  3HY7 A;  2WOA A;  1XFW A;  3WD2 A;  3OHO A;  3V96 B;  1Y93 A;  2KRJ A;  2D49 A;  3GBO A;  4AIG A;  1AYK A;  3EHY A;  2OI0 A;  4NZ3 A;  1KUI A;  1ZS0 A;  2W13 A;  4MB5 A;  2MLR A;  4CTH A;  2BH7 A;  4HMC A;  3DWB A;  4GWN A;  3G5C A;  3AYU A;  4NY2 A;  2ERQ A;  2X3C A;  2ERO A;  1Q3A A;  3RTT A;  4LPQ A;  1YU1 A;  1GE6 A;  1E15 A;  1MMB A;  1A86 A;  4PKW A;  4XM8 A;  4Z2L A;  2YUF A;  4G0D A;  3DPF A;  4HMD A;  5I3M A;  1ZVX A;  3L2A A;  5CUH A;  1J7N A;  4G54 A;  1E6N A;  1CAQ A;  3CKI A;  3KEJ A;  1W1P A;  1OO9 A;  4LG2 A;  2YIG A;  4H82 A;  3TS4 A;  3LE9 A;  4GR8 A;  3LQB A;  1G49 A;  1OS9 A;  3K7N A;  2IOU A;  1UMT A;  2Y2L A;  3L29 A;  1AF0 A;  1XM5 A;  3ELM A;  3E8R A;  2Y2N A;  2FV9 A;  2OZR A;  1HOV A;  1CGF A;  3M7P A;  5D7W A;  4H1Q A;  1GE5 A;  2E3X A;  4A7B A;  1XUD A;  4H3X A;  1JKY A;  3TT4 A;  1XUR A;  2Y2O A;  1SLN A;  1CXV A;  1B8Y A;  1W1V A;  1OZ9 A;  1R1H A;  1TVI A;  5CXA A;  1OGB A;  2XD1 A;  1D8F A;  4XM7 A;  1BIW A;  2DW1 A;  3F17 A;  1BKC A;  3FKE A;  3WX7 A;  4NZ5 A;  2ERP A;  2Y6D A;  2JT5 A;  4BOL A;  1D8M A;  2YB9 A;  4GF1 A;  2MZI A;  4IBI A;  1K7I A;  1ZXC A;  1JAP A;  1E8B A;  1O0T A;  3LIR A;  4G9L A;  2W12 A;  3LGP A;  3N2U A;  5D2B A;  4L19 A;  3DL1 A;  1O6I A;  2MLS A;  4EFS A;  1CQR A;  1W1Y A;  4J4M A;  3F18 A;  3KEC A;  3KME A;  5D1U A;  2Z2D A;  1R54 A;  1H71 P;  3KHI A;  3B8Z A;  5CZM A;  1BKC E;  1DTH A;  1YQY A;  4IUW A;  2W14 A;  2CKI A;  1LBU A;  4OJP A;  3KS8 A;  3LK8 A;  1JAQ A;  1ZTQ A;  1I76 A;  3K7L A;  1ND1 A;  1H0I A;  4IJO A;  1PWW A;  4HMA A;  3KS4 A;  3MQL A;  1IAG A;  2V4B A;  1QJI A;  1QJJ A;  4XBH A;  1BUD A;  1GO8 P;  3DPE A;  3TSK A;  2FFF B;  3NX7 A;  3DNG A;  5D3C A;  1PDC A;  1ED7 A;  1B3D A;  1EUB A;  4GHA A;  3EDI A;  1AIW A;  1D7X A;  4PKS A;  4BXD A;  3BKH A;  1IAB A;  3KEK A;  2JT6 A;  4PKT A;  4Z2G A;  3DTE A;  1UTZ A;  2DW2 A;  3I7I A;  4DF9 A;  2UWX A;  1G05 A;  5BOT A;  4IN9 A;  3P24 A;  3ZUK A;  4GH9 A;  1O0Q A;  3L0T A;  2OW9 A;  1OM8 A;  1QUA A;  4QKZ A;  1KUG A;  4MB4 A;  3DTK A;  5BPA A;  3EWJ A;  1H0G A;  3LJZ A;  4JIJ A;  1UR8 A;  2Y2P A;  1KUF A;  3DTI A;  4OJ5 A;  3I7G A;  5I2Z A;  4IBB A;  2Y2I A;  4AXQ A;  1CXW A;  1EAK A;  2OVZ A;  456C A;  1CGE A;  1RM8 A;  1QIB A;  2Y2Q A;  4IBG A;  1KAP P;  5B5O A;  5BOY A;  1G9K A;  830C A;  4WF6 A;  1XFZ A;  3B2Z A;  4H30 A;  1K7G A;  1AST A;  1S4B P;  3WV3 A;  4IBD A;  3LQ0 A;  4PKU A;  3WV2 A;  2Y2J A;  1G12 A;  1R1J A;  1G4K A;  5I12 A;  1OM6 A;  5BPV A;  2WO9 A;  3LIL A;  3L26 A;  1ZXV A;  4GR0 A;  2FN2 A;  3HBU P;  1KS0 A;  3LEA A;  1FBL A;  2OW2 A;  3ZVS A;  4OJ6 A;  3Q2H A;  1PWU A;  4JQG A;  2DDF A;  2WO8 A;  1R55 A;  1YCM A;  1OS2 A;  3AYK A;  3WD0 A;  3RTS A;  1YUE A;  4H49 A;  1KBC A;  3G42 A;  1SAT A;  1L6J A;  4HME A;  1GPF A;  1BUV M;  1D5J A;  1IAD A;  1FM1 A;  1C7K A;  1KUH A;  1BZS A;  2OVX A;  1KUK A;  1JH1 A;  3D2Y A;  1PWV A;  4ON1 A;  1H8P A;  1ROS A;  1QO6 A;  2RJP A;  3HY9 A;  1XUC A;  1MMQ A;  5I4O A;  1DMT A;  2D1O A;  2XS4 A;  4H84 A;  2I47 A;  1OMJ A;  4OUI A;  4OJO A;  1E6Z A;  1YP1 A;  4IJE A;  1GXD A;  3KMC A;  1PWP A;  5B5P A;  4DV8 A;  5JMY A;  3HON A;  2X3B A;  1JAN A;  4JP4 A;  3L28 A;  2W0D A;  4IBF A;  1SMP A;  4WK7 A;  1E88 A;  4BXJ A;  1UMS A;  1GO7 P;  4NZ1 A;  4Z2J A;  4PKV A;  3UVC A;  1XFY A;  3HYG A;  3O2X A;  4FU4 A;  4L7A A;  1W1T A;  3L25 A;  3SHI A;  2XS3 A;  4I35 A;  1JJ9 A;  1SU3 A;  1YU2 A;  4MB3 A;  2J0T A;  2X3A A;  1BM6 A;  1USN A;  3WD1 A;  1CGL A;  1AKL A;  1JAO A;  5L79 A;  2D1N A;  2V5O A;  2CLT A;  3HDA P;  1PWQ A;  4H76 A;  1ATL A;  1CK7 A;  1IAC A;  1YOU A;  3BKV A;  4IBJ A;  4WKI A;  3N2V A;  2QPJ A;  1WNI A;  4JPA A;  3LKA A;  4BXE A;  1HFC A;  3HB2 P;  1R1I A;  2PJT A;  3KWV C;  2JIH A;  3O64 A;  2OY4 A;  1MMP A;  1HV5 A;  3LIK A;  3D2Z A;  2Y2K A;  2FV5 A;  5D1S A;  1C3I A;  5I43 A;  966C A;  2Y2G A;  2MZH A;  2RJQ A;  1HTD A;  4NYU A;  3L27 A;  5D1T A;  2JCH A;  4WZV A;  3L0V A;  1UTT A;  1BQO A;  2XD5 A;  4PKR A;  1XFV A;  1I1I P;  1I73 A;  1SLM A;  2K2G A;  4BPA A;  3USN A;  2N8R A;  1HFS A;  3EDZ A;  2SRT A;  4DD8 A;  2L0R A;  1YU4 A;  3F1A A;  4ZR5 A;  3VI1 A;  3BA0 A;  2OXZ A;  2TCL A;  1GOI A;  4GUY A;  2JE5 A;  4A3W A;  1K7Q A;  3VTG A;  4DPE A;  3F15 A;  2Y2M A;  1IAA A;  2POJ A;  4PKQ A;  3EDH A;  1HY7 A;  4IBE A;  2AIG P;  1GKD A;  1Y8J A;  3WD4 A;  3EDG A;  1YU3 A;  3LJG A;  2E2D A;  5I0L A;  4NYY A;  1JIW P;  1BKC I;  3TVC A;  4HX3 A;  2AYK A;  3HSH A;  4FVL A;  2HU6 A;  2USN A;  1QIC A;  1A85 A;  4XCT A;  3DSL A;  4FXY P;  5L7F A;  1UR9 A;  1UEA A;  4TX8 A;  2RTS A;  4Q1L A;  1JIZ A;  1J7M A;  4Z2I A;  3KRY A;  4GR3 A;  2Y2H A;  3N3F A;  1FLS A;  1MNC A;  2K9C A;  4JA1 A;  1MMR A;  1E6R A;  2Y6C A;  1IAE A;  4AYK A;  1GE7 A;  4ILW D;  4BJ4 A;  4GWM A;  3ZXH A;  1JK3 A;  1RMZ A;  1XFU A;  3LUN A;  1EB6 A;  2MZE A;  4AUO A;  2OXW A;  4IBK A;  3LJT A;  4Z2H A;  2J83 A;  3U1R A;  1OM7 A;  3MA2 A;  3P1V A;  2JSD A;  1BSW A;  3HBV P;  3F16 A;  4GQL A;  4IBC A;  2DW0 A;  4L63 A;  4NZ4 A;  4GHL A;  1CIZ A;  3Q2G A;  1YU0 A;  1Z3J A;  1SRP A;  2O36 A;  2O3E A;  3EHX A;  1QIA A;  5H8X A;  2W15 A;  1GKC A;  2OW0 A;  3LUM A;  3OHL A;  1C8T A;  1OGG A;  3F19 A;  2DDY A;  2A8H A;  2OW1 A;  3HDB A;  4IJF A;  4I03 A;  4XM6 A;  1ZP5 A;  4L6T A;  2OXU A;  3WD3 A;  5LAB A;  1XFX A;  2JNP A;  3AIG A;  4WKE A;  3B92 A;  3WV1 A;  1E6P A;  4FXQ A;  4H2E A;  1XAX A;  3LMC A;  4R3V A;  1BQQ M; 
#chains in the Genus database with same CATH homology
 1Y0V A;  2WKX A;  2OY2 A;  2X7M A;  3HY7 A;  2WOA A;  1XFW A;  3OHO A;  3V96 B;  1Y93 A;  2KRJ A;  3GBO A;  4AIG A;  1AYK A;  3EHY A;  2OI0 A;  1KUI A;  1ZS0 A;  2W13 A;  2MLR A;  4CTH A;  2BH7 A;  3DWB A;  4GWN A;  3G5C A;  3AYU A;  2ERQ A;  2X3C A;  2ERO A;  1Q3A A;  3RTT A;  4LPQ A;  1GE6 A;  1MMB A;  1A86 A;  4PKW A;  4XM8 A;  2YUF A;  4G0D A;  3DPF A;  5I3M A;  1ZVX A;  5CUH A;  1J7N A;  4G54 A;  1CAQ A;  3CKI A;  3KEJ A;  1OO9 A;  2YIG A;  4H82 A;  3TS4 A;  3LE9 A;  4GR8 A;  3LQB A;  1G49 A;  1OS9 A;  3K7N A;  1UMT A;  1AF0 A;  3ELM A;  3E8R A;  2FV9 A;  2OZR A;  1HOV A;  1CGF A;  3M7P A;  5D7W A;  4H1Q A;  1GE5 A;  2E3X A;  4A7B A;  1XUD A;  4H3X A;  1JKY A;  3TT4 A;  1XUR A;  1SLN A;  1CXV A;  1B8Y A;  1R1H A;  5CXA A;  1D8F A;  4XM7 A;  1BIW A;  2DW1 A;  3F17 A;  1BKC A;  2ERP A;  2Y6D A;  2JT5 A;  4BOL A;  1D8M A;  2YB9 A;  4GF1 A;  2MZI A;  1K7I A;  1ZXC A;  1JAP A;  1E8B A;  1O0T A;  3LIR A;  4G9L A;  2W12 A;  3LGP A;  3N2U A;  5D2B A;  4L19 A;  3DL1 A;  2MLS A;  4EFS A;  1CQR A;  4J4M A;  3F18 A;  3KEC A;  3KME A;  5D1U A;  2Z2D A;  1R54 A;  1H71 P;  3KHI A;  3B8Z A;  5CZM A;  1BKC E;  1DTH A;  1YQY A;  4IUW A;  2W14 A;  2CKI A;  1LBU A;  3LK8 A;  1JAQ A;  1ZTQ A;  1I76 A;  3K7L A;  1ND1 A;  4IJO A;  1PWW A;  4HMA A;  3MQL A;  1IAG A;  2V4B A;  1QJI A;  1QJJ A;  4XBH A;  1BUD A;  1GO8 P;  3DPE A;  3TSK A;  3NX7 A;  3DNG A;  5D3C A;  1PDC A;  1B3D A;  1EUB A;  3EDI A;  1D7X A;  4PKS A;  4BXD A;  3BKH A;  1IAB A;  3KEK A;  2JT6 A;  4PKT A;  3DTE A;  1UTZ A;  2DW2 A;  3I7I A;  4DF9 A;  1G05 A;  5BOT A;  4IN9 A;  3P24 A;  3ZUK A;  1O0Q A;  3L0T A;  2OW9 A;  1OM8 A;  1QUA A;  4QKZ A;  1KUG A;  3DTK A;  5BPA A;  3EWJ A;  3LJZ A;  4JIJ A;  1KUF A;  3DTI A;  3I7G A;  5I2Z A;  4AXQ A;  1CXW A;  1EAK A;  2OVZ A;  456C A;  1CGE A;  1RM8 A;  1QIB A;  1KAP P;  5B5O A;  5BOY A;  1G9K A;  830C A;  4WF6 A;  1XFZ A;  3B2Z A;  4H30 A;  1K7G A;  1AST A;  1S4B P;  3WV3 A;  3LQ0 A;  4PKU A;  3WV2 A;  1G12 A;  1R1J A;  1G4K A;  5I12 A;  1OM6 A;  2WO9 A;  3LIL A;  1ZXV A;  4GR0 A;  2FN2 A;  3HBU P;  1KS0 A;  3LEA A;  1FBL A;  2OW2 A;  3ZVS A;  3Q2H A;  1PWU A;  4JQG A;  2DDF A;  2WO8 A;  1R55 A;  1YCM A;  1OS2 A;  3AYK A;  3RTS A;  4H49 A;  1KBC A;  3G42 A;  1SAT A;  1L6J A;  1BUV M;  1D5J A;  1IAD A;  1FM1 A;  1C7K A;  1KUH A;  1BZS A;  2OVX A;  1KUK A;  1JH1 A;  3D2Y A;  1PWV A;  4ON1 A;  1H8P A;  1ROS A;  1QO6 A;  2RJP A;  3HY9 A;  1XUC A;  1MMQ A;  5I4O A;  1DMT A;  2D1O A;  2XS4 A;  4H84 A;  2I47 A;  1OMJ A;  1YP1 A;  5B5P A;  1GXD A;  3KMC A;  1PWP A;  4DV8 A;  5JMY A;  2X3B A;  1JAN A;  4JP4 A;  2W0D A;  1SMP A;  4WK7 A;  1E88 A;  4BXJ A;  1UMS A;  1GO7 P;  4PKV A;  3UVC A;  1XFY A;  3HYG A;  3O2X A;  4FU4 A;  4L7A A;  3SHI A;  2XS3 A;  4I35 A;  1JJ9 A;  1SU3 A;  2J0T A;  2X3A A;  1BM6 A;  1USN A;  1CGL A;  1JAO A;  1AKL A;  5L79 A;  2D1N A;  2V5O A;  2CLT A;  3HDA P;  1PWQ A;  4H76 A;  1ATL A;  1CK7 A;  1IAC A;  1YOU A;  3BKV A;  4WKI A;  3N2V A;  2QPJ A;  1WNI A;  4JPA A;  3LKA A;  4BXE A;  1HFC A;  3HB2 P;  1R1I A;  2PJT A;  3KWV C;  2JIH A;  3O64 A;  2OY4 A;  1MMP A;  1HV5 A;  3LIK A;  3D2Z A;  2FV5 A;  5D1S A;  1C3I A;  5I43 A;  966C A;  2MZH A;  2RJQ A;  1HTD A;  5D1T A;  4WZV A;  3L0V A;  1UTT A;  1BQO A;  4PKR A;  1XFV A;  1I1I P;  1I73 A;  1SLM A;  2K2G A;  4BPA A;  3USN A;  2N8R A;  1HFS A;  3EDZ A;  2SRT A;  4DD8 A;  2L0R A;  3F1A A;  4ZR5 A;  3VI1 A;  3BA0 A;  2OXZ A;  2TCL A;  4GUY A;  4A3W A;  1K7Q A;  3VTG A;  4DPE A;  3F15 A;  1IAA A;  2POJ A;  4PKQ A;  3EDH A;  1HY7 A;  2AIG P;  1GKD A;  1Y8J A;  3EDG A;  3LJG A;  2E2D A;  5I0L A;  1JIW P;  1BKC I;  3TVC A;  4HX3 A;  2AYK A;  4FVL A;  2HU6 A;  2USN A;  1QIC A;  1A85 A;  4XCT A;  3DSL A;  4FXY P;  5L7F A;  1UEA A;  4Q1L A;  1JIZ A;  1J7M A;  3KRY A;  4GR3 A;  1FLS A;  1MNC A;  2K9C A;  4JA1 A;  1MMR A;  2Y6C A;  1IAE A;  4AYK A;  1GE7 A;  4ILW D;  4BJ4 A;  4GWM A;  3ZXH A;  1JK3 A;  1RMZ A;  1XFU A;  3LUN A;  1EB6 A;  2MZE A;  4AUO A;  2OXW A;  3LJT A;  2J83 A;  3U1R A;  1OM7 A;  3MA2 A;  3P1V A;  2JSD A;  1BSW A;  3HBV P;  3F16 A;  4GQL A;  2DW0 A;  4L63 A;  1CIZ A;  3Q2G A;  1Z3J A;  1SRP A;  2O36 A;  2O3E A;  3EHX A;  1QIA A;  5H8X A;  2W15 A;  1GKC A;  2OW0 A;  3LUM A;  3OHL A;  1C8T A;  3F19 A;  2DDY A;  2A8H A;  2OW1 A;  3HDB A;  4I03 A;  4XM6 A;  1ZP5 A;  4L6T A;  2OXU A;  5LAB A;  1XFX A;  2JNP A;  3AIG A;  4WKE A;  3B92 A;  3WV1 A;  4FXQ A;  4H2E A;  3LMC A;  4R3V A;  1BQQ M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...