4MB4A

Crystal structure of e153q mutant of cold-adapted chitinase from moritella complex with nag4
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
528
structure length
528
Chain Sequence
GTITSQDDNVVVGYWHNWCDGRGYQGGNAPCVELKTVNPQYNVVNISFMKVYDIAEGRIPTFKLDPTIALSEAEFIAQIDTLNSQGRSVLIALGGADAHIELTRGDEDALAAEIIRLTDLYGFDGLDIDLQQAAITAKDNQFVIPAALKMVKEHYRKTGDNFMITMAPEFPYLTANGAYTPYLTELDGYYDFINPQFYNQGGDGLWIEGVGWIAQNNDALKEEFIYYIADSLINGTRNYHKIPHDKLVFGLPSNIDAAATGYIQDPQDLYKAFDRLKAQGQPLRGVMTWSVNWDMGTDAANNSYNQQFIKDYGNFIHNQLPPVTDMTPTLSGIVDTRVELDSHFDPLIGITAKDYQGNDITADVTVSGSVNTNQVGDYLLTYSVSSDDETTNQPRKITVYEILPAFTGITDTTVVIDSEFDPMQGVSASHPTQGDLTANITVTGEVDTNVVGVYELTYQLFYGQDNQQNMTDKRIVTVVTDAVSDDDWQVGSTYVKDDKVTHNGATWTAQWWTKGEEPGTTGEWGVWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chitinase 60
publication title Crystal structures of substrate-bound chitinase from the psychrophilic bacterium Moritella marina and its structure in solution
pubmed doi rcsb
source organism Moritella marina
molecule tags Hydrolase
total genus 174
structure length 528
sequence length 528
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2013-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
A PF16403 DUF5011 Domain of unknown function (DUF5011)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.20 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Carbohydrate-binding module superfamily 5/12 4mb4A04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mb4A03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mb4A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4mb4A01
2VDQH 5KAQF 1IC7H 5DJ0A 3QXDB 3BIAX 2GCYA 2A1WH 1GNXA 3PGDB 2WSPA 4DWSD 2FGWL 4K7PY 5AZ2H 3VW3H 4G9FA 5F9WB 3BP7A 3C60D 1QBLH 4LSVL 2HT4D 4FK9A 9CGTA 5CP3A 1T0NA 2CRZA 4GMTH 2D7NA 4ZS7L 4DGIH 5DJ2A 2EIDA 1BECA 3EUUA 5JHLL 4Z7OE 1ES0B 4Y88A 1VGEH 2HH0H 3MODL 3VXTB 1QO3A 5AD0B 1QVOA 1WITA 1BQSA 1X3DA 3D85B 4FQ1H 3OGOE 1BVNP 4J3VA 4OLUL 5F7EH 3BX7C 4V2CB 3ARFC 2CPCA 4U3AA 1JV5A 1OIFA 1H9VA 2XTJD 2WBJB 5GS1B 1RHHB 3G6DL 1GC1C 3S98A 4YXLL 3QDJB 1MQ8A 2C26A 3L3GA 1JG9A 2BY0A 3OKKA 4ZSOA 1OY3B 3S88L 4I18C 3ZTNL 1CGVA 3FCTB 2UZIH 3O2VL 4QOKB 5EMYA 4PREB 1K9DA 2ZX9A 2X7LB 1AXTH 1AQHA 4FG6D 4PG2C 4UTAH 2XQBH 2CPUA 1TQCC 3GB7B 4HEME 4LLVB 4MD0B 2WINA 2AMGA 4FQCH 4PJEE 5JIHA 2FO4B 3E8UL 4LPTA 1HXYA 1JF6A 5FV2A 5I66B 4QCFA 3TBWB 3RDKA 4U1GB 1CEOA 1MPAL 1YNLH 5J3HC 25C8H 3BGFB 3U9PH 1WC7A 1X4XA 1U2YA 2DSVA 1Y0LB 3BGMA 1RUQH 1TJIH 3HLAB 1UQSA 4UT9H 3W5MA 4CD8A 2VL5A 4W70A 4HH8A 4X6CB 1HHGA 4Z2KA 4MD4A 5FIEA 2YD3A 4XMKL 3STLA 2QADB 4XPGL 4UOQA 2NZ9C 4OD1L 5T1LB 3IYLW 3FAXA 1GC1H 4BM7A 1QSEB 2O93L 3CLEL 4WI9A 4PBXA 1R24B 1YYLH 3KPRE 3S3JA 1PEZA 4FQPA 5FGRA 3OGRA 4R0LA 3OKEB 1FFPB 4JR9L 4U6YB 3X11A 2ITDA 3MOBL 1BD2E 4CD5A 1N64H 5T3ZE 4LOUC 4U6VL 3PV6B 1T7WA 3VXMA 3GDBA 5IM7A 4GOSA 1PG7L 3AU1B 2YC1B 4XMPL 4HIIB 3FT3B 4BJLA 2QHRH 5ESAB 3RNKB 4WK9A 4UIKH 4JN2B 1WBYA 3CXDH 2O9OA 4MNQE 2P7TA 3HI5H 5E56A 1J10A 1NGZA 3LMYA 3AFLA 4JFYB 3TJHD 1BFOB 2DAVA 2DM3A 4XAWH 5D5MA 1W9VA 2J74A 2BOCB 2C3WA 1BQHG 1WDSA 4C56D 4RA3A 3PL6B 4NO2A 4GKNA 4HCRL 3T0XA 2YD2A 1GPOH 2ZCHL 2XTLA 1V08A 4XGZA 2A6IA 2P5WD 4KMTL 5ID1B 4PJ9C 1I1FB 1WGOA 2G60L 1JXJA 1NWRA 4QF1B 1UH3A 2YOCA 3PABB 3RWIB 2ED9A 5D7IE 2WC7A 4MJIA 1ACYH 1UM6H 5CZVH 3CU1A 1VEMA 5D8WA 3AM8A 1JGDB 1Q9OB 2WWMD 4UINL 1FNFA 4PRIB 5KZ6A 1ZWIA 2DQIL 5D1XB 4F8TA 4ONGH 2BS9A 3RVXC 3KLDA 3UPRA 2B1HH 3DVNB 1NOFA 2HFTA 3PJSA 2P1YA 4JL1A 4LDOB 2N4IA 4LVOC 3IJ8A 5I17A 4PCTA 5C0AB 4Y4HC 1AE6H 1JGEB 2UVFA 3U7BA 3MRPA 1RZJL 4LLWB 4Y4FB 1LEIB 4ALAH 1SJHB 4HXBH 1YY8A 2Q1EA 4TPRH 5FCUL 5D9SB 5CPQA 3SQOH 5ANME 4DAGH 1EX0A 2DBLL 5M94B 1IGJA 2HVJB 1ND0A 3U7WL 5HDOA 3X3GL 4P2QD 3BAEL 5TH2B 5F7WC 1YMMA 4JFEE 2ZOKB 2EXYC 2BSTB 1VJZA 5C09A 3C5ZD 1ITCA 3IJSA 5BXPA 2DYPD 3SKUD 5DJZA 3ARTA 4UV4L 4HGWA 3KPOA 5I30H 3OAUL 4WKFA 3P0GB 3IJYA 4NJAH 2ZE0A 1V0NA 3IETA 3T3MF 5E24E 1AGEB 3DX9A 3VG9C 3PWLA 4GRWB 1UZ8A 4X7SL 1UD8A 5EC2A 1AC0A 4J3XA 2OWXA 5DDHB 5DFTA 1RURL 4PD4J 5F7UA 1WK0A 4JM2A 5DHVB 3GIZL 2F54B 3QUXC 5J89A 1I7RA 3FFCA 2ZWYA 2VZUA 5D7LE 5F9WC 3NCYP 1FO0B 2NY1B 3L2LA 2VZTA 2A6JB 2NCMA 3NSNA 2Z1SA 5E1AA 4FQXD 1Q9WB 1N2RA 3FKUS 1JWSA 4JO4L 3STBA 5ISZD 1TCRB 4WSJA 4J3WA 5I15L 2VZ1A 2QTEA 4C55A 3OKMB 3W29A 1XD0A 2I25N 5A6SA 3TT1L 2C1PB 2J62A 1PZ5A 5F8RC 2R2HA 4YXHH 4TUFA 1E5JA 3L3DB 2BSED 1CF8L 5JHDD 1DBJL 4HFWB 2AXFA 4NRZB 5H37G 4FQQB 2R1XB 4LX4A 3WL1A 4C83B 4LKCB 5K9QG 1JNNH 2WBJC 5GS1C 5J6HA 4YO0B 2X4PB 5I1KH 1J0HA 1WSST 2BVQA 2BNQB 5KS9E 4XP4H 1BYAA 4GAJL 4YDIL 5HHQA 4NOBA 5FL0A 1EBPA 5TQ0H 4DOHB 4CMHC 2DSWA 4PSRA 3O2DH 3WV0A 3GH5A 1NJ9B 5DJAB 4Y19E 1NEZB 1VFMA 5EUOF 1INQB 1DQQB 3FO9A 1LEKA 2DT0A 2WYSA 3JV6B 3QI9B 2J8HA 1CDHA 4CD6A 2QQLL 4UQ3A 1FNLA 1FYTA 1HKLL 1KFAL 4QTIL 3JUZA 1MCPH 2YD8A 1KEGH 2OTUB 4HAFA 5I74B 4XCCH 4JKLA 3ULSB 3BSHA 4UZGA 1RZFL 1E28B 4U1GC 1EFXA 5DRNB 5DUMH 2LE9A 3SEPA 1G7HA 5FB8A 1WQVT 3BGFC 1JIBA 1XC6A 4WV1B 4FMFA 2VABA 1MIEH 1EVTC 4MVBD 4LPUA 2V17L 4XHQA 1DWIM 2QQQA 2A3AA 4PB9L 4OD3L 4JPWL 2QADC 1K6QL 4D9QE 1KN2H 1OTUC 1QOXA 4LSQH 3IDIA 3PWUA 1P7HL 1D9KA 1F00I 3QEQD 2WHKA 1E4NA 1MLBB 3LD8B 4XP9L 1UWTA 5E95B 2HP4A 4JHBA 1H15B 4S1DC 4MNLA 2Q86B 2QQKL 4NWTH 3POHA 2I9TA 1EEYA 3UCRA 3IT8D 2X0YA 1U8OB 3MO4A 4IUGA 5GGVL 1TTUA 1PKQB 1NWUA 3IK2A 1MHCA 2WWCA 3S6CA 2I26N 2G75A 3MV8A 4ZQKA 2WIIA 3DBXA 1SM3H 1ZHNB 2EE6A 2VQ1A 1NEUA 5A94A 4M7LT 4HS3A 3SDXA 2DI8A 4F9LC 5D6CB 3N9GL 2GJXA 1Z5LB 4P3WA 2G4FA 3L7EB 2YZ8A 5D7JA 1DQDH 5GGTL 4WUUB 5GZNC 3TCXA 3AIQA 3CIVA 4LRNL 2J88H 1NBZA 3UTSA 2A2QT 4DGVL 2YLLA 3O41A 3HZMB 2EEBA 1Y6NR 5E0QA 1XF5B 2NXZB 3L4ZA 3PL6C 4Y5YB 3FQNA 2VX6A 1KB3A 2VUYA 1IAKB 4N8VG 4KRPB 3CDGB 5CSZA 4MZ2A 1EXUA 4MAYD 4Z76B 5FOBB 43C9A 2AJVL 3KNBA 4KJYB 3RIAK 1R3HB 4LXFA 2WC4A 1XGTB 2I9LB 3QNZA 3WFEH 1CN4A 1J86A 2EZ0D 6FABL 4R26H 1WKYA 2W92A 3FT2B 1ECEA 3WH9A 5SWZA 1J9YA 2V3FA 4N0UE 3EJZD 3GMPB 1I7TB 3MXVH 1DTUA 1EV2E 2OBGA 3ZJ8A 3G5XB 4K8RD 5D1XC 2X4NB 5DLMH 3RWHA 3SGKA 3V7AG 5I1HL 3HMXL 2EBNA 3T77B 4MDOA 1HNYA 1QW9A 1N3NA 1I75A 1WAAF 1HKFA 3ARED 1I1WA 5TDPB 5IW3A 4Y4FC 5DT5A 5HHVH 3EHBC 5D2LF 3AIRA 4YHPB 3F5WB 4Q2ZA 1FGNH 3LV3B 4WTZA 5MENA 4HH9A 5HD8C 3U48A 2NR6D 5FKAA 2FO1A 4PTWA 1X5LA 1FFOA 2V9QA 3IRZA 4PRHA 1JWMB 1MHEB 5F1OB 2GDVA 3MA9L 4Q0XL 2R0ZH 1BWWA 4EKXA 5T5FH 2WCGA 4LLDB 4WIWA 1B2WH 2DQJL 1KXVA 1F3JB 1L7TL 2V5DA 3L4XA 5IMMA 1OAXL 4LCCA 4QRSA 1CFQB 4QRPB 3QG7H 4BQ8A 5I2IA 3CSPA 4TNWK 4JDZA 4P5MA 2OP4H 4CDGC 1KB9K 2ARWA 5FOOA 4O02H 5EU5B 1QTYT 2XVPA 2R4SH 3K1KC 3ULUC 3LKPB 3IKCB 4Z0BL 4Y16A 1UWEH 5IW1B 3WFBL 2NX5B 2F53E 3UC0H 4XCYA 5JOFB 2NY1C 3MLUL 5C2BL 1X6NA 3MRNA 3FQTA 2DTMH 3KR3L 5J1AB 4ZMAT 1E55A 1DWJM 2HTKD 4JFXB 4D6GA 2D3VA 4OAWA 4ENED 3DROB 4WLCA 3IFLH 1RIUH 1UM4L 1JDCA 3SOBL 1J1OH 3VH8A 3VIJA 2X5PA 4HT1H 1IAOB 4R7DA 1Q6FA 5CSUA 4PJ5B 2OYLA 4AZ7A 4XPFH 3KWXA 3VXQA 2EDDA 3WUGA 1ONQA 4ACYA 2WQRA 1FYHB 1LL4A 4RISL 4MDIB 5GPRA 4RQQB 1NLBL 4LCUA 1JPFA 1E4IA 2JCCE 1CGTA 4Y0GA 4PMXA 1QYGL 4EK7A 4KZDL 3LPGA 1Q9KA 4WWKB 1EEUA 1TETH 1S78C 2OK0L 1IM3B 3L3KB 1OWRM 4H0IA 3T0VA 1JCKA 4UNUA 4GRWH 4IMLB 2W62A 4K23L 2EEDA 1F6FB 4JRWA 3WNLA 3W6MA 1GOWA 2X89A 3ULUH 5DHVH 3VI3F 4HWBL 1ZJBA 4RGNE 5FDWB 4JJ5B 2CYGA 4P4KA 1V0LA 3DGCR 4L4TA 2V2TA 4LCWA 3CU7A 3QI9C 1XF4B 2A9NL 4RMVA 1FO0H 2UYLA 4PGZA 2DN7A 2JIXA 5BVPL 3STZB 4UDUA 2PYEB 4L1DA 4I1NB 4P46A 1BFVH 1BG4A 4ORGB 3WHXA 4KQ3L 4U1MA 2DT3A 4NN6B 2NY4C 3C8HA 4ZFOA 4HV8B 2W38A 2W65A 1F13A 2FSEB 4WV1C 1QEWA 1LO2L 2HKFL 2X4TA 3PQYD 2LVEA 2OR7A 3X13A 2LVCA 1ZLSL 3BH4A 4KKCD 4IBLT 4NN5B 1NCDL 3U4EB 4YE4L 3PWPA 4UQ2B 5FEBA 4M1DL 4U6XB 2GAZA 1WZMA 3BISA 4JY5H 4EKJA 2VDNH 1YEJL 1S7RA 1HIML 4OCWL 2BHUA 3LD8C 1SBBA 3DIFA 5IESH 3VDAA 3D48R 4YAQA 1R5IB 4IOIA 2Y24A 3TJEL 1B31A 5KSBA 2BK8A 2VC2H 2Q6WB 2C3VA 1MAKA 5IB4A 4G43A 5KVEH 3FFDA 4WJXA 1MAML 2W1NA 4LKXB 2PWHA 4AD2A 4LMQE 3QOMA 3IF1A 3RUGB 3NPSB 1CFVH 3NFSH 2ADJB 3WN5B 1U58B 1CICC 1R3KB 4JQVC 4F57L 3QDME 2WZHA 35C8L 2AJUL 5H35B 3ZR5A 4CNIB 4GG6B 1U8HB 1JXKA 3ZKNC 1MXGA 1SJXA 5E8NA 3NN8A 3PV7A 3DXAA 1A0QH 4LLAA 4NZTH 3T0ED 2ZWLT 2AS5M 3HB3C 4R7NB 4OIIH 3T2NH 4Y5YC 4XZWA 2VDPH 1GZQB 2OL3H 4TTDD 3TONA 1W72L 3RY6C 2AEWA 4HGMA 2AXHA 4KRPC 4XZUB 4UB0L 2YXMA 3KPLA 4JCMA 3QIBB 1DUZA 1WFNA 5E8DH 1G9MC 1FP8A 3Q2CA 5DZNA 5ABHA 4F7EB 1E43A 4E42A 1I3RB 1V3LA 4ODTL 3OR6B 1V6XA 3O4LA 3S34L 4AZ8A 2A38A 2AVGA 2R4RL 4CMMA 2WBWB 1IFHL 4MJID 5KVDH 2GEEA 4DKFL 3NCOA 1H3TA 1D2KA 4HKZA 3W39B 4E2OA 4X6CE 3GSVA 3O9WA 3WLWC 1S9XA 2C9AA 1KJVB 2LABA 3L95A 5AAWA 5ACZB 1NGXB 4JRXB 3LOWA 1C5BL 3T1FB 2QHAA 1UB5A 4I9WD 1ZXQA 3LPWA 3JV0A 5CBEA 5EC1B 5MI0C 3KYNB 2V9RA 3HZYB 5KVFL 3WUEA 3VINA 1N6UA 2DJ4A 1T83A 4MS8D 5F9DC 3TZVB 4F58H 1P6AB 2NYYD 3DHMA 3GM8A 4LSDA 3EKCA 3NCBB 2CIKA 5CCKL 1YMMD 1XHGA 1G9MH 1DWFM 3SKMB 2OTPA 1EVUA 1NDGA 2GITB 2XI9A 4NO5A 5C09D 5INDB 1U8MB 2EIEA 4O5LH 4PJAF 2BZDA 1A1MA 2OQJA 2YEZB 1Y18B 3MCG1 2D7TL 2AK4B 3BN9D 4FFYH 1W9XA 1CXLA 4K8RL 5CD3A 3X12A 2OX5A 1MCQA 1KB5A 5D6DA 3AIBA 1FNEB 1JPSL 1A7NH 3WH6A 4UMGA 4NPYB 4H41A 12E8L 1HSAB 4GKLA 4K3JH 4Z0XA 2PYFB 4W88A 3BT2H 3VFPB 4LSTH 1MWAB 4CVXB 3BDYL 1FBIH 1UWGL 3FFCD 4PJGB 1S7WB 5HY9B 1GW1A 3SE9L 4P8WA 4PLNC 5ALBL 5E9DB 1OLZA 2VT0A 2AK1H 3T0BA 1A6PA 2XKUA 3BHBA 4JG1L 3L5JA 2D31A 2AQ1A 4GPNA 5CJ5A 3U0PA 4XRCA 4PRIE 4F8QA 3LAFA 3VGEA 2FJGB 2UWEB 4HTYA 4LPWA 4XCNA 2VMFA 4WWKC 5HDQH 3T4YB 4LHUD 1UA3A 4DN4H 3FONB 1BJ1J 4MNGA 3A4AA 3LZFL 3ZYZA 4XB7A 4M03A 3V5DB 4YDJB 4PGJA 2Q20A 5GRJH 3WIHA 5AWNL 1IQWH 5EBMA 4Z6AT 4HMEA 5J12C 3QAZC 3S7GA 3HR5B 5J06A 1B0GB 2Y07L 2NY0B 1K9FA 4F15B 5GISL 4ONFL 1QP1A 2Z31D 5D7KD 1DBKL 1A14L 3KPNA 5ABEA 4JFSA 3WFCL 4XPHH 1TQBB 2EXWC 1UXWA 2JELH 1I7ZA 5C07A 1BVLB 1KELL 1HXJA 5JBDA 1BF8A 5CMAA 3GMQA 1LP9F 3ZDXF 4OLEA 2K9UA 2HFEA 1Q1JL 3HE7B 4EXPX 4FXKB 2HJKB 1EAPB 4AQOA 2FLBT 5I6SA 4UOW1 1X5AA 4NN5C 2RGMA 2F54E 4ODHH 4EDWL 1S9YA 3Q5OA 4BK5A 1KWKA 1BAFH 5DD0L 3LRGA 3SKJH 5DI8B 3EO0B 5IMOA 4LSPL 4PMDA 5ICZA 4OLZL 3U7AA 5DQJB 1FLRL 1K8DB 2EDLA 3W5NA 4H8UA 4O2CB 1TITA 2R2CA 4PRBA 4GKSA 5DQ9A 2PXYA 4FQLL 1I8MA 3V5KA 1H8OA 3GRWA 4JQIL 1D9KD 1F3DH 4YHNA 2CKRA 5KSAB 4HKJB 4QY8A 5GRWA 3C6LB 4X6DA 5CP7A 1IEAA 2BDNL 5EULV 3SBWA 1JZ3A 2G3NA 1KWGA 2OMBA 3I75A 5IB2A 3NPSC 3VFUA 1RUKH 3BRDA 3WD5L 2D7QA 3WN5C 2LQRA 1L0QA 3NA9L 2C1OB 5EUKA 1J5OH 4ATLA 2DLIA 4PYSA 2VDMH 3KYMA 1XGQA 4ETYA 1MW1A 4TX6A 3D1MC 1FNHA 1DVFB 5J8OA 4HGKC 5FL1A 3EOTL 3GO1H 1OINA 4Z2GA 1R85A 5L88H 3IDGB 5D4QA 5F97E 1E4KC 5FGCB 1F4YL 5D7SH 7FABL 1KGCD 4U31A 1YN7B 5D7JD 3CLWA 5HYJA 3POCA 4IRSA 3TA3A 2DJSA 2ESVB 1CDUA 1W1VA 3UTSD 1KB9J 1W0VA 4XCFH 1S5IL 3QPQD 1ZSDB 5DD5L 1OCWH 2VXTH 5EORL 5DMIH 3QIBC 4YHKL 5J9PA 4I0PA 2VDRL 5C9JB 2E7CA 3Q1SH 4NFDA 4G5ZL 1V6YA 3U0TB 4PV8A 5MHSE 2EDXA 5E08H 4OCLC 1IVLA 1I9EA 2J8UA 3WEMA 5IT2L 1D5XB 1UJ3C 3RAJH 1AGDA 3AB0B 4AXNA 5CJQL 2VE6A 3TM6A 5C0BB 5SWZD 2WP3T 4BSJA 4PTTA 5BJTA 2X44D 5KANI 4C59B 2A74A 2F5BH 1US3A 4PP2A 3V6OA 4CW1B 3MCKB 3G5ZA 3OWEA 5T1KD 1L0YA 2BJML 5E1HB 3RKPA 3VMOA 5FCZA 2GYSA 3UYPA 1WICA 5GGVY 5JDJA 1T80A 3NABL 3WN6A 1P4IH 1OGBA 3REWA 5IIEB 1BZ9A 1GOMA 1PKQE 2HLFD 3TYFB 4QYOB 2ZUXA 5GGRB 3TZVC 3MSPA 3E2HB 1JAEA 3IB4A 3PIQB 5FUCE 1TPXB 3UP1A 4H88H 3A67L 5GJTH 3HE6B 1JHTB 1RJLA 2DKUA 3GGWB 2YL5A 2ZUQB 3T4AA 5JDSB 1I85C 3QUZC 4CVUA 1WCBA 3WIJA 1QQDA 2P5EE 1IT9H 3O6MH 3MX0A 3ZE2F 2O61A 1MLCB 1ZT4B 4NQED 5E5RB 1KXQA 4Z7UB 3X17A 4OI7A 1I1RA 3IJ7A 1WAWA 4Z7VF 4B9ZA 1OAUH 1DP0A 2A77H 1N5AB 3WF0A 1B9ZA 4D0CB 4S1SL 5DRZB 3T65A 2B31A 3GIVA 4UTBL 1ZLUK 3REVB 3G5VA 1UD2A 2XV6B 5F3HB 2IGFH 1JWUA 3LQZA 1OSEA 4MDJA 4DM2A 3MLZL 1IKFL 2EDOA 1ED3B 5JW4N 1E6JL 5C0RL 3IVKB 1KCRH 2LU3A 3WQ8A 4U7SA 2Z8WC 4G9DB 2X1IA 2H2PC 3PWVB 2VRJA 1ISYA 3AIEA 4POZC 2NY5C 3RNQA 1LO3L 1MRFL 2NXYB 1K5NB 4MNHA 1AJ7H 2JJUA 1KF9B 5LKNA 4FTVB 1KIRB 5TQ2L 4NRYB 1QLFA 3P9MA 3RVWD 1YPZB 4H25A 4GSDH 4PY7A 4S1QL 4G6AC 1DCLA 1QNSA 4BH8B 3HRPA 1CU4L 4NKOB 4HIEB 3D69B 3B43A 4Z77B 3SDDA 4URIA 2FX8H 3C9NA 5J6GA 3QFJB 3JTSB 3VOCA 4DW2H 5F1KC 4KK6C 2AJSL 5D2NB 5EZLB 2APTA 1PX8A 5F1IA 3L3OA 1BVKA 2NY0C 1AD9A 3I6GB 2AJZB 1TNMA 4PV9A 1HK6A 4D6HA 4XXCA 4WTZG 1KN4L 5ILTH 4QRRD 2IQ9L 2X89D 1HJUA 2FX7L 1MWAH 2QKIB 3VDCA 4KQ4L 1XD1A 5IHRA 1TQBC 4P4KD 1W2PA 2PO6D 4L4TD 5FF6B 4D6IA 3I9GL 1BQLH 2JIXD 1V6VA 2Y1VA 3HE7C 3S3PA 3N1MC 1A9BA 4YHLH 3BP4B 4KTDH 5C1MB 2VLJA 3NGBB 2V2XA 5HYQB 1MFCL 4MB1A 4HMCA 4L3EB 3BD4A 2F74A 3RZCB 3UTPD 1S7SA 3FOMA 2NY5H 3MNWA 4JFHD 1HEZB 1FDLL 3ARGB 1U95B 1KIUA 4XP6L 4X5WB 5F7DA 4UQAA 2XRAL 2EE2A 3BPOC 5HGHA 3CUJA 4HBCL 4GAGL 4OCYL 4NDMA 3H6JA 4MSWA 3TBVA 5B39B 1RQ5A 3K80A 5GJSH 1E4MM 3H9ZA 4KAQH 4U1SA 4PJ8C 1SJEA 3W0WB 3O2LA 1CCZA 3X3FL 5HGBB 5IMLA 5KSAC 4XNQB 3UYRL 4O58L 3C6LC 3FTGB 5DD3H 3VH8G 4B0MM 2EDJA 4LVEA 5FUOH 1D5MA 4ZS6C 3B83A 4JHWL 2EIZB 2O5XH 1Z0MA 4PUBH 4JL2A 1IGIH 1R6VA 4MQ7B 1F90H 3FQRA 1PGRB 3CGTA 3MXWH 4M5YH 1H3VA 4HW6A 2UUDH 3KPSA 3OAYK 5A2FA 1A7PH 1N4XL 1HYRC 4XMLH 2VRAA 1W0WB 3D9AH 4EUPA 2Z8VC 1K4DB 3MRBB 5F7YC 4IRZH 1TFHA 1UYWL 2Q3AA 1IGCH 3OTTA 4JLRA 5EU4A 3NACH 2R2BB 1C5DA 1MHHA 3U83A 4PJFE 3IDJB 2V9TA 3KWWA 4V1DE 5I23A 2JF7A 5AG8A 1UZ4A 2JEPA 5SWQB 1LG1A 1I8IA 2VWEC 4U1IB 3WNOA 2GK1B 2PYEE 4QRUA 5EOQL 3H42L 1BPVA 4HS8H 1M7DA 2ZNXA 4O2FB 4I2XB 4RDQF 4Y8DC 4CN4A 1QG3A 4HJJH 2MWCA 2NMSA 4D6DA 1MJ7H 2OR9H 3QDHA 4P7NA 4MXWH 1XR9B 5A8MA 4QLRA 4YC2B 1FPTH 5IWLA 4D9RE 4TRPL 4PR5B 2YMXH 3HPJB 4Y1AA 3HC4L 3BIKA 3BEWA 4QT5A 4PJHB 1B90A 1IAIM 2ZCKH 1F11B 3S37L 1JGLL 4HIJB 1IMHC 4WFHE 2X05A 1OGAA 2CDEA 3EBAA 4CCEA 2R2EA 2FX9H 1G9NC 3KYKL 4PRDA 2J7FA 4L4VB 2V7NB 4KZEH 1DQLL 1BIIB 3P2TA 5F9AC 4G6FD 1T66C 5EO9A 1OF2A 3H3BC 4ONOA 1TPXC 2YPLB 2Q8BH 3HE6C 1AY1H 2VXUL 5HHXL 2ZUQC 4KDVA 1A3RL 4LNRB 3DVGB 3H2WA 3S4SA 1BP3B 4GG6E 3ARXA 5E00B 2H26A 4LBEA 3V4VH 4FLRA 4JRYB 1MW2A 4LOUD 3ZDZE 1EUTA 1E0WA 4L8SA 5CILH 5HGGS 3SCMB 2E9IA 5HVFB 1MFBL 4A3HA 1MCRA 3GTNA 1QI2A 3ULVE 2GJZA 2B0SH 3UAJC 5I8CB 3GI8H 3QCTL 2FJFB 3QULB 2IADA 4S1RH 5J4MA 1E15A 4H1LB 2R15A 3WDHA 5IGXH 3HNVH 1DWAM 2DMBA 1JPGA 3LMJH 3IU3A 3CVHB 1IKNC 5C0GB 2DQGL 4WO4A 3BKML 3BAWA 4MNMA 2XSAA 3NA4A 1US2A 1N8ZA 3LQMA 1H1NA 3TA9A 4PJBF 4A6YA 4ELKB 4OFKA 4PJCA 4OGYH 1ZVYA 4PJ9D 1T03H 1R5WB 3MJGX 3P0VH 3SGDH 3AY4A 3BW9B 1KACB 3RIKA 3GSNA 2VRKA 3UERA 5FA4A 1D5BB 4RFEB 4RNRA 1MVUA 4NQUA 2UY7A 4JAWA 2NXYC 1JPTH 1OQXA 4UFJA 1RMFL 3SGJA 4EI5A 1UZ1A 3QIUD 2R29H 1DBBH 2FEDC 2B39A 3WJJC 4X7CC 2D20A 2DEPA 5BWFA 3SJVB 1NAMB 2YSSA 1FIGL 1PQZA 5IG7B 3RVXD 1ZGLB 3KS0J 4LSSL 4YUEL 3CUGA 3CPLA 3MZGB 5A43C 5KG9B 1T2QH 3WXWH 4X7TA 1HQ4A 3U0WH 3LPPA 5D2NC 5DJCB 1I1AB 1E0XA 2G5RA 2ICWB 4X6FB 2ZXDA 3QCUH 5EU6A 4WI4A 3EFDH 2CK0H 3PDOB 5CJBA 5HHNB 3ZTJG 3MCLL 1UD6A 5FM5M 3VFGL 2YDSA 2PW2B 3C6SB 1V3HA 3CFEB 3SDXF 2GK0A 1IT0A 3M1BB 3B9AA 4DKEL 4LLQB 1J11A 3RGVB 5B8CA 4GKZB 2BY1A 4IJ3B 5C07D 2VC9A 3IXTA 4ZFZB 5HYSA 4F9DA 1KTDA 3GSRA 4ONHA 4YWGH 2ZJSL 4JFDE 2AI0H 5FKPA 2IQAA 3IDMA 1NUFA 3H7BB 4U33A 3GKWL 3SDAB 3CSYB 4OZIE 3ARGC 5L2KB 4P7RA 3OR7A 1Y6MR 5DTFB 5GXBB 1PYWB 4CRPA 4JHAL 4XPAH 1UKSA 2X9XA 4OV5B 4XCEA 4Z78A 5IKCB 3QUXD 4PJGE 5DEFA 2VLRA 5ABFB 3L3HB 4XC1L 5C6PB 4OFDA 4PRAA 1U9KA 3HHRB 4GBXB 1ISWA 4N90E 2DIEA 4S2SB 5DRWA 1W9DM 3IFPB 2XZQL 5IROA 5I1IH 1TJHL 1ZHLB 4K55A 1OD0A 4AENA 5HI4C 4B15A 1CG9A 3MRDA 4NT6B 5BOPA 1IAIL 3HC3L 5IXEA 2XGIA 4PRNB 5E6IA 4FOMA 4RBPK 5DMKA 1XR8A 4HUUA 1QLEL 3SDCA 1EZVY 5F88B 1LILA 4NKMB 1HP5A 5IMKA 3LKRB 5GGUB 3U1SL 4X9FA 3V4PL 1NFDA 5JW3H 3QXAA 1EGJH 3MUJA 4BZ2H 4KY1L 4QHLB 4P23A 4ZFOL 1ZV5A 3GK8H 5J7CC 1U42A 4IS6B 1GHRA 4HK0B 3DUUB 1GVYA 2ZUSA 3V6FB 3Q3GA 2VXQH 4LEXH 5I1EL 5DQDL 5HYJD 2CDGA 2G5BB 4YPGB 4IRSD 5C0EA 4M7KH 5HVWA 1EMTH 5DR5L 1U33A 1XIWA 4LQ1A 3WLBA 3MREA 1BBDL 3G6AA 4X4YB 5KSVA 4I0PD 1JNHA 3VX0A 3VFWA 3INUH 5KVGL 2DQXA 3AXLB 4EVNA 1B4RA 3VFTB 3UG3A 4IOFC 3SN6N 3QDAA 1L6XA 5SV4A 3WUWA 3MRCB 1M71B 4FRWA 3GBNH 4EDXA 1ZL1A 3VRLF 1MCWW 1N59A 3BWAB 4YC2C 4IIQB 2XZCL 2ENYA 1OLLA 4BCEA 1GZPB 4HUVB 3N18A 4Y4KB 4LASL 1CGSL 5HDBF 3M6DA 4KMLB 4DCQB 4U0QB 1OP3H 3RDTD 1H3PH 3FO1A 1RAMA 2CSPA 1GPFA 3QRGL 4PP1D 5CINH 5EU7C 5GGSY 3VRIA 1HXMA 3LKQB 4YGAB 2MCG1 4JM4H 1OTUD 1I1YA 4GQRA 1B4JL 1NFIB 2R23B 4J6RH 3OZOA 3B3IA 2IPKB 3GJFB 1QFWM 4S1DD 3PWJB 4JO3H 1T1XA 1XGUB 2HFGL 1UENA 4GRMB 1G6RA 3ARVA 2GTWA 3O6FA 4MQTB 3U36B 4R2GB 4TNWF 4G6MH 3VXRB 1JNLL 3Q6FB 1A8JH 1I4FB 1MVYA 1C08B 5BXTA 5KN5B 4AQ1B 2BCKB 4WKHA 3WFDL 3SCMC 3GMMA 3OHXA 4M1RA 2IEPA 5A16B 3MRKA 4JFQB 2XG5A 1JZ8A 1NCAH 4HSQA 5EPMA 2GQHA 2NY3D 1F58H 1GGIL 4PJEA 3EO1B 4OFVA 1NLDL 3VWKB 1FJ1B 4HAGA 3CFKA 1Z3GL 4FQHA 3VD9A 3I6KB 1AGBB 4P2RD 4HC1H 4E0RB 4APQD 1HINL 1KCUL 3GSXB 1E72M 1A4KB 4NZJA 2BMKA 5EUOB 2C7FA 4QXTB 2PW1A 3L5WA 1Q0YL 2AGJL 4HUNB 3TWCL 3MLSH 4ZEPA 2VO5A 1TZGL 4DKDC 3R4DA 5DT1H 4O9HL 5EOCL 32C2B 2GHWB 5EFFA 2EXOA 4RZCA 1RZKL 3ZT5A 5JZ7C 3E6FA 1KC5H 3HCVB 3H9SD 2AQ3A 5BRZE 4NM8L 1KPRA 3CNKA 5A6AA 5E5MA 3KPRA 4YHOH 4Z2JA 2BP3A 4OB5H 3MJ6A 4FQ2H 4OCRL 1AFVH 4GW5A 1VEPA 4HULB 4Z95L 3KE0A 4UU9B 5DFWH 3SDDD 4JANA 2J7HA 3QCVL 1BD2A 2PB1A 2ZX7A 1KB5L 2GTZB 3SCWA 3CMOH 4JIEA 3EHBD 3WO4B 3EOYG 4EN3C 5L2JA 3DNKA 2CLVB 3JWDL 4H1LH 3AGVA 1UKPA 4PLOB 3CVHH 1J05B 3QBTB 4P57B 1S8DA 4Z7NE 4MNQA 4PUDA 5LXGL 4PGBB 3AZRA 1OIMA 4NFBA 3C8KA 2RGLA 5FV1L 4J1UB 1XF3A 4IJ3C 2ZPKL 2H9GB 3AHZA 4CCDA 1ESWA 1OGTA 1VGKB 2L7JA 2DT1A 3V6ZA 2X4OB 3L1OH 2FR4B 4QLLA 3LH2H 2EC8A 2AV7A 2WSKA 2VQUA 3SDAC 5BQ7A 2YD9A 2ICES 4M61B 2VZVA 1CFTA 1JNDA 1VFAA 5D7IA 1NAMH 4X6BB 4B50A 2DLFL 1JI2A 1CT8A 4MA3A 4Q9QH 5I18H 4ZOEA 5HJ3A 2XN9B 2EO7A 2XPGB 1GOGA 4XNUH 3BESR 4AJ0A 1XSJA 4NYLA 4Z7WE 4JFUA 5INCA 3WIHL 2NW3B 3QDGD 4PJIE 1RIHH 6CGTA 2OM5A 1C92A 4JG0L 3WL0A 1TVBB 1FFNA 2EDBA 5ADOL 1YNTA 1SQ2N 4KTEL 3MR9B 4FTVE 5L0QC 4M7LL 4MA7L 3PZQA 1YPZE 4DWSB 2NTFB 4XP5L 1JYVA 1U30A 2FGWH 3OGCB 4W4OA 5ANMA 3C60B 1U8JA 3E3QC 3W0KA 1GHSA 4JFEA 3L3JB 4LSVH 1DUYA 5D2NE 4LVHB 3U9UA 2PWEA 1IGYB 1LQSR 3I2CH 4OGXH 1NC2D 4M3JA 2ESCA 5A8PA 3WMCA 4Q6IC 4TNVK 4MCYA 4AG4H 5IBLC 1J0IA 4NQDE 4YBQD 4XT1C 5D2LB 3DGGB 3V52H 1KLUB 4V27A 4HIXL 1KJMA 1I9IL 1LE5B 4U3CA 4NKDA 4K94H 4I48A 4ODVH 1M53A 3OBAA 4OLUH 3WQVA 2DWDB 3IDNB 3GRWL 5D7LA 4MQSB 2P42B 2XTJB 5BCAA 5IFAL 1L7IL 1GOHA 1YY9C 2NY4D 2VIRB 1S7QB 3UJJL 4G80A 3S96B 1AD0B 1EPFA 2FL5A 4D3CL 5CEZE 4YXLH 4YFLF 4Y4KC 3W4RA 4NC2B 1MCWM 3CDFA 4WFGD 3VXNA 2XICA 1NOWA 4AM0B 2EO1A 5E8OA 1G7MB 3BEVA 3ZTNH 4Y1AD 1DBAH 3LKOA 5IB1A 5F6IB 3C87A 3TGXA 1M7IA 3W0WE 3MUIA 5FYLE 3QIWA 1OGAD 2B2XL 2D3LA 2AERT 2DD8H 3BH8A 7TAAA 5FGBC 1QBBA 3JV4B 3QG6B 4KROD 1RUPL 4OV6F 4UNIA 2JIWA 4NM4L 1BX2A 1YEDB 3EDJA 4PMNA 5KS9A 1JF1B 2KQMA 4YX2L 4KKAC 1E6ZA 1ZE3C 2KDGA 2C4FT 3ARQA 3IKKA 3O3BB 3TPUB 1ZEAL 4XMKH 1CICD 4Y19A 4CL7A 5JLZA 1WP6A 1Q8MA 1RU9L 4YQXH 4JFWA 2G3MA 2Z93A 1EJ6A 3B2VH 4OD1H 4EUPG 1YA5A 1U91A 2Q76A 4Z7QE 2CBUA 1MF2L 3QQNA 5EU3B 3JVGA 5IOPB 3FT4A 3D0LB 3CLEH 5T1MB 1VADB 1G6VK 1R3IH 1IC5L 1W2KT 1F3DJ 4R5EA 2XIIA 1IEBB 3RWJA 2FZ3B 4MJ6A 1C5CH 2WBGA 4R4NC 4YGVA 4MHHI 4M1CC 4D2NA 4KK9C 1HHJB 4K3DH 1WEJH 4I2XE 3CH1A 1OD9A 3ZKMD 4MJ5A 2Y23A 4F33A 5M3WA 1XYFA 3MTRA 1ODUA 5JPNB 1G7JB 1FV1B 1Z32X 1XFPA 3GJFH 3I02B 4S3KA 4E8DA 1OP9A 5CS7A 3TF7C 1YEEH 3EGSB 2VAAB 2HJFA 3P4MB 3ARRA 4JZJB 4XX1G 3HAEG 5DJXA 2DQFA 4C56B 2BHYA 3FQUA 1FL6A 4PJHE 4X8JA 4EI5D 2PTTB 1XCQB 5K9JL 4HCRH 4ISVB 1J8HD 1U36A 2P5WB 5IVNA 2DWEA 1DFBL 1M05A 4G6KH 1FVCB 4KMTH 2GKIA 4X6DF 1ODZA 5IK3A 1CGUA 5CSYA 1WDPA 2OJZH 3TO4D 2G60H 3WO4C 2EE9A 3VXUD 2QQNH 5DO2D 5JW5B 3RPIB 3TFKC 3S8WA 4HUWA 3ARFA 4D8PB 1GQKA 5EU6D 4EXKA 1QR1B 2ORBL 4UINH 3DRQB 2WLYA 2Y5TB 2DQIH 3JSSA 3MLWL 5T1DH 4CVZB 3S4SG 5C8JA 1AR2A 3VGHA 1DDHA 1OSZA 5E7BA 3SGDI 3T2QA 3KXFA 1UKQA 4NBYB 1CE6A 2BVPB 3LEVL 3D39E 3MFFA 1KXHA 1CFSA 2DH3A 1LK3H 3CSGA 5FCUH 5BS0E 2ITCA 4P2QB 4UZUA 2DBLH 3WDJA 5FYJU 2BVUA 3PWNA 3X3GH 3BAEH 5L6YL 4U1HB 5MEQA 3VKKA 1QFOA 1K2DB 4N0UA 5DHYA 3C5ZB 1C12A 5C3TA 2D23A 2DYPB 4MQXC 4RFNB 3PGCA 5IV2B 4MA8L 4TYUA 1UQYA 4FFZL 2X1PA 2AEPL 5F6HI 4YXKL 4X7SH 1I8KA 4KK5C 1FYTE 2VR5A 3FQXA 4QHMB 1RURH 4DWSC 1OOAA 3FN3A 4HJGA 3SDYL 3GIZH 5E6ID 3SJVE 1S7XA 2EC9T 3C60C 1EDGA 4XNYL 1BM3H 5HXMA 4Z8FL 4HZLA 2HT4C 1EJOH 4XAKD 1XF2B 5CSBA 2RTSA 1RK0A 4PBGA 4LVHC 4F37F 2B5IB 4FQXB 3VM7A 2J7CA 5ISZB 2WV3A 1V03A 5ITFA 5SX4H 4TSCH 4MXQC 3PXJA 4JO4H 1YJDL 4EOWL 4P23D 2VZOA 4POYA 1LEGB 3CC5A 3FZUD 3NUKA 5DMGD 4IRJA 3QO1B 1KR0A 3ZSTA 5JHDB 4CDHA 1INEL 4P5TD 8FABB 1CF8H 4W5UA 1ZBKA 4PJDA 2DI9A 5CEYB 5IFPA 4ZXBA 1FG9C 1XIWD 5FM5O 1GGBL 3SCUA 1CXKA 3WDIA 2F53A 3F58H 2XTJC 3ROOB 1OQOA 1K85A 1DE4B 5HYSG 1PZUB 1A22B 2Z92A 1K3IA 3CJJA 4K71B 4OM1H 3FY1A 3I3DA 4OZHF 3PDDA 4P2OA 5I75B 3AUVA 3LKSB 4PJAB 4YDIH 2WVTA 2VCBA 1K3ZA 3QHNA 4XVJH 1W1PA 3NDZA 4YN5A 3BLKA 5F6IC 1NBVL 1CLYL 3F7RA 5FM4A 2WANA 3HUJA 4WRLA 3IDYB 3LEXA 2XUCA 3O3UN 2QQLH 4WEUD 5C0ND 1KFAH 4PGDA 5JUEH 5GIRB 2FATL 4QTIH 2J4WL 1YEIL 3BXNA 4F7MB 4OGAD 3K74B 3AI0A 2ZUTA 3ZYIA 5HVHB 1RUAL 4R96B 1T4KA 3BO8B 4Y4HA 4H8VA 1P7QA 3WDQA 2V17H 2VDOH 4YHMH 1AHWA 3O6FD 3ZL4H 4X9GA 1W72B 2BVOB 5BVJA 3QJHA 3TNNB 4YIQB 3WF2A 2WMPA 1XRVA 2X4QA 4M5ZH 4ZPTB 3ZIZA 1E6SM 2JJSA 3QEQB 4QRTA 4D0BB 2J8FA 1UC6A 1RK1B 1N5YH 1ZVSB 1IM9D 1CTNA 1S7UB 4HHAA 2DQUH 4MXVF 4ZO6A 1S9WB 5BO1L 3TNMA 2ZOLB 4WHYG 2CRYA 1WJ3A 5I2UA 3R1GH 1A5FH 1ZHBA 4XVUD 1LDPL 2P8MB 3DX6A 1DSFH 3WL9A 4Q7NA 2XKNA 4MAUL 5MP6L 1A4JB 2APWA 4PMUA 4B3LA 2C3HA 1NUGA 4QHKI 2WWDA 2BNRE 4GRWF 3QXDA 1TVHA 4P7LA 4KRMB 5ERWA 5L7XH 5MENE 3PGDA 3RBGA 5SWSE 3JTTB 3AZSA 5ID0B 4PRHE 2VH5H 1E40A 3TJHC 2EYSB 2XOTA 4HF5L 4PJ7F 3FHAA 5KSUB 4JZJC 1LP9B 4HEPG 5CBAB 1WF5A 4DGVH 4G3YL 4N0RA 1G0YR 1H5VA 4HOWA 2OXGA 3V5HB 5JPMA 3ROLB 1E0OB 3DTXB 3THCA 4UFKA 4F2MA 4AL8L 1ES0A 4MAVA 3P4NB 4U0RB 3VXOB 5F7HA 3RWFB 2QSCL 3VXTA 4MAYB 2W60A 4TVPD 3A6CL 3CZ8A 1QPKA 2HA1A 2AJVH 3MLVH 5KVMC 4YZFF 1NSNH 4HWNA 4J27A 2GUYA 1SEBB 1KT2B 3QDMA 2EH8L 1DLFL 5T3ZD 5DWUL 4J23A 1KIQB 2WBJA 4AZCA 1FA2A 5I1JL 2E4TA 5JW4Q 3MMDA 4NCDA 4OFIA 4CAGA 5DFAA 2A6DB 3HMXH 3QHTC 2JJTC 3BZ4B 2A6KB 4LYRA 4KMQA 3AAZB 4A6YL 3AREB 3UO1L 3FCTA 4D9LH 2FWOA 4DJMA 3IAPA 4QOKA 2J8OA 4OF8A 4PG9B 1HL9A 1KYOK 4PREA 4DVRH 4PS4L 3GSNL 1QLRB 3MRRB 1QI3A 1WT5C 4ODWB 4XC3H 4LLVA 3BAKA 1R5VB 2XA8L 3ZLQC 4PMVA 3IXAB 1JUFB 1J88A 2FO4A 2GFTA 1UUQA 3R06B 3TBWA 4GRLD 4RFOL 2DBJA 3THDA 1S9KC 4K7FA 3V0AC 1T1YB 3C5ZC 1PIGA 5KZCD 5FYJL 4IDJL 3HLAA 5AUMA 5EUOE 1YDPB 1L7TH 4RFNC 3PE9A 1BBJB 1C7SA 2E8ZA 1MJJA 4X6CA 4W5ZA 1OAXH 4XVSH 1UWIA 5EB9A 4C7FA 2BFVL 1RJYA 5T1LA 4XPTH 2QF8A 3DURA 3HNTL 4AZ6A 1CR9L 4D6EA 3O6KL 4Z0BH 1R24A 4OBSA 4UI2A 1C8XA 1G5AA 1P69B 1MY7A 3MLUH 3FQWA 2GCYB 1FFPA 3OKEA 5E2VL 5JW4M 5AY7A 1IC4L 5TE7L 2QLVB 4FQXC 1BYDA 2ZUNA 3KR3H 3BZDA 3VA6A 2XSBA 3GBEA 1QNQA 15C8L 4HK3N 3CZFB 1V6WA 1X7QA 4OQTA 3PV6A 1DEDA 1UM4H 2VXSL 4JFED 5I8KL 3SOBH 3AU1A 3FNDA 4GINA 3PWPE 4DZBB 4HIIA 3SO3C 2BOBB 4F9LA 5DJ2B 5ESAA 1D6VH 3RNKA 3JWNC 1VF8A 2QPUA 4JN2A 2CJUH 3GBMH 3TLRA 3M45A 2DICA 3OQ3B 4JFYA 4LSRL 1A3LH 1BFOA 1NLBH 1MNUH 3OL2A 4UFHA 2WUBL 5DEZA 4X7FC 3QFDA 4NQCD 5KSBE 2CIPA 3EBVA 2ICWI 2EIBA 2V5RA 4OFYA 4UAOB 5JORB 4K71C 5HPOA 2OK0H 2F8VA 3BKJL 3S3SA 4PMYA 2CITA 1PZ2A 5ID1A 1I1FA 2WB5A 1JV5B 1MJUH 5I75C 3KEHA 5D7LD 4OSUH 1D5IL 4K68A 4W93A 4A3YA 3AS0A 4QF1A 3PABA 3RWIA 4KVCL 2VKWA 3WXVH 1LHZA 3DPBA 2XN9E 3IDYC 3OKKB 2CBIA 2A9NH 4XWOD 1Q9OA 4ZSOB 4I3SL 5IHZB 2VLLB 2RR3A 4PRIA 4AMKL 3THMH 4BZ1L 3LHPH 2DKSA 5F6HJ 4X99A 1CZ8L 1FL3B 4Z7VB 3DXAE 3K8LA 2QSVA 4NC0B 4KQ3H 2DQHH 4PJ8D 3DV6A 5ETUA 3QIWD 5HVHC 3H3PL 3OKLA 5C0AA 3PQYB 2H41A 4MVBC 1OHQA 2HKFH 3BKCL 1UB6B 1HXYB 2JB5L 4LLWA 4N8CL 4Y4FA 1SJHA 4Y7EA 3FO2B 1ZLSH 1VFOA 1VBUA 1HWGB 4QCIA 1UOKA 2HVJA 1UQSB 5D1ZA 5TH2A 3IJHA 3UZEA 1MQRA 2ZOKA 2NT0A 5CQ1A 1HIMH 4OCWH 4Y19D 5DK2A 2QMKA 4TOYH 1FHGA 5IBTH 5KW9L 2L4OA 3OZ9L 5E09A 1T5XA 5I19H 4AD5A 5D2LE 3IFNL 3KJ6H 1AGEA 1JZ7A 4GI9A 1TTFA 2XPKA 3DJ9A 3G5YB 2I5YL 3P30L 4R0LB 5HTSA 1J0ZA 1RULL 3O11A 4PTMA 5C0CE 1W3HA 3X11B 1XH3B 5DHVA 4UCFA 2F54A 3RPKA 1E6NA 2AJUH 2XTJE 1FO0A 5TF0A 1FLTX 3IU4H 1PW3A 2APVA 5E94A 2GJ6D 2D1ZA 1UR4A 2A6JA 2X6MA 1WBYB 2P7TB 4D9QD 5BV7L 3T0EB 3MBXL 3WJLA 1G6RL 2H2SD 4NZCA 4FMVA 5A1AA 1QNPA 4U0RC 1PX3A 1W72H 1OSPH 2DS4A 1AXSA 4MAYC 5IFHL 5ADPL 2DM7A 3L3DA 4P49A 1MJ8L 4GKNB 4ZAKA 4KI1A 4NRZA 2EZ0C 1A7OL 2A6IB 1ZA3A 4DWHA 4AT6B 2Y2WA 2DMKA 4ODTH 4C83A 4WTWA 3EJZC 3D6GA 4OBRA 3S34H 4K8RC 3MRHB 5C0JB 4MJIB 2J6EH 1BGXL 2VLKD 4EBQL 1T66D 1CDBA 1IFHH 4ACZB 3P77B 1XV8A 1A7RL 4AIEA 2XY1A 3AREC 5DJAA 1INQA 1KCSL 2E9JA 1C5BH 3BH9A 3GSUB 3QI9A 4H20L 2LU7A 3HI1A 1E73M 3C08L 5F89A 4K3HA 5I17B 4L8DB 4M1GL 4XXDB 1YEFH 2NR6C 2CXKA 3MRPB 5IQ9A 1CGYA 3O3AA 2OTUA 4U1LB 3EFFB 4QHKJ 4WUKH 3ULSA 2AJYL 4WU7A 5DRNA 1ND0B 3WFZA 1XCTA 3VI3E 1CQKA 3KPPA 3F7PC 4LEOB 4AZGA 1S5HA 2YBUA 5CCKH 2YWYA 4XPBH 3QZWB 4WFEE 3V0WL 3SCTA 2OS7A 3ZT6A 2GY5A 1M4KA 3VIOA 5DJZB 1J8KA 1CLOL 2AEQH 2GK2A 1JL8A 3KPOB 4XNXL 2D7TH 4UQCA 3IJYB 4E41E 4Y5VB 3OJVC 4K8RH 1MLBA 4JPKL 4HA3A 3PWLB 5K59F 4Z7OF 1JPSH 5EC2B 2Q86A 2IALB 1EQCA 3BCFA 1FSKB 5AZEL 2EQDA 3OPZH 2Y8KA 12E8H 2RB8A 1OD8A 1I7RB 4GQ9L 1PKQA 1V3IA 3G08A 1R8LA 4OCNC 4RL3A 1NGQH 3BDYH 5I8OH 1D6EB 4K7PL 4MNKA 1ZHNA 2HG5B 2VVNA 2XVNA 1CL7L 5HPMB 3O2WL 5ALBH 3OB8A 5E1AB 1IGTA 2IAND 1N2RB 1AQDB 1JWSB 1EO8H 5D6CA 4JG1H 1Z5LA 2BV9A 3OF6A 3L7EA 2P5EA 5DXWA 4FZEL 1C7TA 2W0LA 4UV7L 1IJ9A 1T6WA 1FZMB 3MUGA 3MZTA 2UWFA 1SEQL 4IRJD 1F4XL 3UG5A 2I07A 2DDXA 1X5FA 4LHUB 1XF5A 2OZ4A 4GMSL 2AXFB 4JDTL 4Y5YA 4NRSA 1NC4A 4GO6B 4R6UA 3VXSE 4UAOC 4K7PX 5EBWA 2J47A 1IAKA 5CIPB 2I60H 3CDGA 3VFRB 4P8VA 5FOBA 4Z76A 1JHLL 4ZO8A 5GGQL 4KJYA 2A83A 3VIHA 2CGRL 1T04A 4PJEF 1ZAGA 5AWNH 3O0RH 3TH4T 4YJZL 4P2QE 3ZSSA 3MGTB 5E2UH 2EDQA 2F2HA 4P2OD 4PGCA 3TIEB 2Z31B 3PP4L 5GISH 1DQJB 3UR7A 4P59L 3ME0A 2Y7QB 1A14H 1P4BL 1G7IB 3GMPA 1KGUA 1I7TA 5D71H 4OIAA 4MB4A 3FO9B 2VXVL 3G5XA 4ZUUA 2X4NA 2IMMA 1KGWA 5IVZB 1E5NA 1SBSH 5SX4I 3RVVD 3T77A 5CP3H 2VLME 1BPLB 5FYKD 2Y06H 1WB0A 3ISWA 1FCGA 1QR4A 1QI0A 4KI5E 2A3CA 1PPIA 1QNOA 3MV9D 4KKCC 2CLRA 4MDPA 4JN1L 4Q58C 1PX4A 3GI9H 4PJBB 3D0VB 1KCVH 5FB8B 2J78A 3EJYD 5JOPE 4EDWH 4RWYL 4R8WL 1RJZA 4DKAA 1M01A 1JWMA 4LSPH 1MHEA 4OZ4A 3SKNB 4DQOL 4ZENA 4FP8L 4OLZH 1HSBB 2JJVA 1FLRH 3LKNB 5T3XD 1YECL 5HHOD 4RGND 4LLDA 3PZVA 5ENWB 3UJTL 1MXDA 1ZB5A 4FQLH 5IBUG 4QHNA 4R4BA 2VVSA 4JQIH 1ZKAA 4TQEH 2X1WL 1AO7D 1CDGA 3OXSA 4QRPA 2F8OA 2I9TB 1NCBH 2ICWJ 4R0LC 5JHDE 2WZEA 1WUNT 1VAHA 5EU5A 5I78A 1YMHB 3WD5H 1MHCB 4LHQB 1BHGA 3GMRB 3IKCA 3SCPA 5LA0A 4KK8D 5IW1A 4ZQKB 3NA9H 3PHSA 4OF7A 2M1KA 1X44A 2WIIB 1LD9A 4WJ5B 2VQ1B 1IC7L 5D70H 4DFHA 1UQZA 2E7MA 4HS3B 4PYHA 3VDBA 3SDXB 3VW3L 3EOTH 1SY6A 3WUBA 1B0RB 2YRZA 3T0EC 5D7IF 5F7MC 5I1AB 4OF5A 3Q48A 5FHBL 4QXGL 7FABH 3RU8L 4OD2B 2FNBA 4HJ0D 3UTSB 5BRPA 1G7PA 4DGIL 2VDKL 4L3CA 4XH2A 3SE4A 3RJYA 5DD5H 2WIMA 1TZIB 5EORH 5D1QA 1VGEL 1KBGL 2G9HA 4MDIA 2Z4QB 2VDRH 3KHOA 4NBZB 5ICXA 1MQKH 4G5ZH 5CSZB 1YEHL 1T2JA 2B7DT 3OG4B 5GSVB 4FQ1L 1CI5A 43C9B 1G7QB 1F5WA 2OTWB 1NARA 3G6JE 5EG6C 3L5HA 5IT2H 2YKLH 2DLHA 3L3KA 1NMAL 2P47B 2ED7A 5CJQH 5SWZB 4TSAH 1XEDA 3QDMD 3AM8C 5IVXF 2L0DA 3QWOA 5E0CA 1EUUA 1A6AA 4LQFL 4PMRA 5FO8B 5FDWA 4OUUB 1V7NL 5T5NF 2RAMA 4JKPH 5FO7B 4PJFA 5E99H 4AK1A 4Z9KB 1XF4A 1N3NB 4LGRB 4NNXA 5T1KB 3WY1A 3VXPA 1IAMA 2UZIL 2YD5A 3STZA 4JY6B 2QSTA 2PYEA 3QEGL 2HTLD 4ORGA 3ILQD 4NF7A 1ORSB 5BZDA 2O5YH 4MS8C 4UTAL 1T0MA 2XQBL 1I8LA 1I9RL 2EDWA 2NYYC 2ZNWA 5I76B 4HV8A 5CLTA 4HH9B 1YHTA 2DGAA 2FSEA 2YDRA 3WQ4A 2Q8AL 1YNLL 4WTXA 1EHAA 1CPUA 3VFMB 3MUAA 3U4EA 4AEEA 2XYLA 2P46B 4UT9L 3NIFE 4U6XA 3AMLA 3BN9C 2CETA 3AZTA 4LCCB 4NQEB 4HZ6A 1A1NB 4OFPA 1XH2A 1WFOA 5BZWB 4AD0A 1R5IA 1FSKC 1RVFH 5T1LD 1GC1L 1GGCH 4XBEL 2WMHA 5JIWA 2YPKB 1FGVL 3O3DB 2X8RA 1XSKA 3WBDA 4EI6A 4LKXA 2J79A 1P1ZB 4PTUB 1KCLA 5C0FA 4UTBH 4P7OA 3MRNB 1FE8H 5MEPB 5D93B 3WN5A 4LU5L 1U58A 1BSIA 3VCLB 3MLZH 4OAWB 1R3KA 1N64L 4OLYH 3N1FC 1E6JH 5H94A 4JREB 1F6AA 4CNIA 4ZYKA 1U8HA 4GG6A 3OG2A 4O4YL 3L2MA 4UIKL 2P48B 4EN3D 3HI5L 2VB5A 3U30C 3L5IA 3HFML 4RIRA 2R8SH 5TQ2H 3G9AB 4R7NA 3P40A 4TULH 5J13B 3PG2A 4S1QH 3VWJD 2DJUA 4M6NH 4C4KT 4XZUA 3AQUA 5LAXB 3RWGB 1PG7W 1HKIA 3QIBA 2A9MH 3K3QA 3O8XD 1CXHA 4F7EA 2OWWA 4OFYD 2AJSH 5CPSA 4FLOA 3OR6A 4PFEA 2VDLL 1NQ6A 4QRRB 1KN4H 1Q6DA 2DLEA 2CMRL 3CXHJ 3VFSA 4D1JA 1UCTA 3LY6A 1NWTA 3N15A 2IQ9H 4ZTPL 1MCKA 1UM6L 2PO6B 4L4TB 4P4KB 2FX7H 2V2TB 5CZVL 2EKJA 4E5XB 4GO8A 1GAFH 2JIXB 4NQSA 3W39A 1JD7A 1U8LA 1BF2A 4EIZC 4XNMB 3K1DA 4ONGL 2OWCA 4AY1A 4UDUB 5I16B 1KJVA 1RFDH 5ACZA 1NGXA 3T1FA 4FN0A 4X98B 2O92A 2C4FU 2IF7A 4YPJA 1T7XA 1FNSH 2J1KA 4XUYA 5FHAL 1UKTA 2X4TB 3EMCA 1AQKL 3KYNA 1B3ZA 3A3HA 1OARH 3HZYA 4FABH 3X13B 1KV3A 2H3NB 1MCFA 4KVNL 4M43H 1Q4NX 2HRLA 1NP2A 4TPRL 2R1WB 5M95B 2FIKB 3SQOL 4HOZA 2DSZA 2NY2D 2ZG2A 3TZVA 1F02I 4GAGH 5DJ6B 5CIPH 5D1ZD 4R27A 4G8FA 1X6LA 1D9KC 4XX1E 3EJJX 4NCC2 3UPAA 1S7RB 3SIMA 2V5TA 2BSSA 2H6PB 2GITA 3X3FH 5INDA 5E0FA 4YAQB 5F1NB 1I85A 1BLIA 1Y18A 4TUKL 4IMKA 3KYAA 5I30L 1E3ZA 4JHZA 4NJAL 5TDNA 1OTSC 3G04B 3HG1E 4JHWH 4JFDA 5IB4B 1TG7A 3FFDB 3WEOA 5CD5D 3UJIL 4CVWA 3PUCA 2ZUUA 4PTVA 3R8BB 2DRUA 1CLXA 4NPYA 4OZIA 4KDTA 1UA6H 1K8IA 3JXAA 3VNYA 1N4XH 1E70M 2IH1A 3T2OA 3VFPA 5HHMD 4X0NA 4CVXA 4PJGA 5HY9A 5D7JC 1S7WA 3PZNA 2NW2B 3WSQL 3U5UA 2ZUMA 3ZHKA 5E9DA 3WE6B 1YY9D 5DJDB 1K6AA 3NN8B 3QPQC 3ZE2E 1U2CA 3OZPA 3ALPA 1FORH 3GXDA 2W0PA 4N8VA 3DI3B 1K9EA 1TIUA 4J28A 4Z7VE 1NMCB 3KPLB 3TPKA 1UKOA 5EOQH 4H0GA 5HBFA 4ZAKD 1X5IA 2CERA 3CFDB 3CX5K 3CH9A 3FOLA 3WS3A 2MKLC 5D9MA 3V5DA 1AP2B 4YDJA 1JNNL 3MRGA 1GGTA 5EZJB 4CMMB 1UA7A 4NFCA 3WHE0 1S3KL 4RMRA 3HR5A 1F2XK 2X4SB 1YN6B 1B0GA 1B3JA 4U05A 1M6OB 5I8EB 4HKZB 1A6WH 2WC3A 4LIQH 5A6BA 1WBXA 3SUTA 2B4CL 1HYSD 3NFNB 1NGPH 4G6FB 2HLFC 3V4UL 2AAAA 1KEGL 2HWZH 2V7HB 5ABGA 2J2ZA 2N7BA 3U4BL 3VMNA 3QO0A 2JE8A 5JW4R 2HJKA 5DUML 4AWEA 1EAPA 2QLYA 2VXUH 4IHOB 3UR8A 4WFFE 1MIEL 3BQUA 2DM4A 2AJXL 4M1CD 2CIKB 2W9DH 3EO0A 4O51B 5C8BB 4LCCC 4LK4A 2ARJQ 5DQJA 1OAZH 1UG9A 5F96H 4YDLC 1PZ3A 2EC9U 3D3VD 1KN2L 2BNUB 3ZO0A 1HI6A 4LSQL 2HMID 1CLVA 4KH2A 3CAFA 3X12B 1KB5B 2MSPA 1U8IA 1BJ1H 3LRSB 5KSAA 3U4AA 3C6LA 4QGYA 4NWTL 3DO7B 2HRPH 2JCCF 2DQGH 3BKMH 4CU6A 1IBGL 3RL1B 1Q6GA 4WI3A 4CD7A 1LVEA 1SM3L 4PJ9B 3SCNA 1X5HA 1P7KA 1RIVH 4JREC 2MJWA 1DVFA 5K93A 2GY7B 1OVZA 4D6JA 5AG9A 3IFOA 3SO5A 5CPTA 1HDMB 4U6TA 1FNAA 3RVWC 1LWRA 2P5ED 3QIUB 2M2DA 4XRCB 3AHVA 2IG2H 2J88L 3PZOA 5H8DA 5J13C 2EICA 5F8QC 1UR0A 1J9CT 3MLYL 3NMEA 5FFLA 1MCJA 4PMOA 2FD6L 1FIGH 1U0QA 3DC0A 3EZ8A 5SV3A 4LSSH 2NXZD 5C9JA 3KL5A 4MNGB 3RIFK 4LVOB 1NC4D 1TJGH 4U1JB 2MHAB 4W84A 3RY4A 1CDJA 4YEEA 3UTQB 2M8XA 4IM8A 1EK3A 5LBSH 1AH1A 4ELMF 5SX5K 1W3KA 5TDOB 1PY4A 1NFDE 3CCHB 4P4KC 3C5JB 3VFGH 5B3JF 1MOEA 1T5WB 3QISA 3TCLB 3RVTC 2FHFA 3DRTB 4DKEH 3MXVL 4XZBA 2VN7A 1JGUL 2V2WB 1OP5H 1UXWB 5C07B 2D3NA 1MI5E 4OQTL 3MJ8B 2XIBA 1OPGL 2HFEB 3MCKA 4OLWH 4B5EA 3VG9B 4H8HA 5FDYA 5HHVL 4X0KA 1VKXA 4GH7B 5E2WL 5C0IA 1FGNL 4KK5D 2J4GA 3U5YA 4BSWB 1MCLA 1F4AA 2DQTH 1S9YB 2L7UA 3M8OL 3QUXB 4JHAH 4QYOA 5GGRA 3TYFA 3RJXA 4M8QA 3CO4A 1NUNB 2MMXA 3DMMA 4NHUB 1HKKA 3N17A 1JBJA 1JHTA 3GGWA 1EOKA 3EYOB 5EFIB 1NDMB 5GRXG 3AHYA 5D4YA 1V7ML 5JDSA 2XZQH 1MRCH 3V5KB 3S35L 4LRIA 1BFNA 4YEFA 4MXQD 4NKIL 3MMEB 1UH4A 1MLCA 1SHMA 4NWUH 4X6DB 3KDMB 1IAIH 3HZKB 1P84K 1IEAB 2OP4L 1UJTA 3I75B 4O02L 3ILPB 5IB2B 5TE6H 1QLEH 4F7PA 4MMZC 1KPUB 1HZHH 4UQDA 1UWEL 4JZNA 4XTRD 3UC0L 3U1SH 5DRZA 1XGQB 3REVA 5KJRL 2GSGB 5GGSA 1BQUA 4OTXH 1ED3A 5CKGA 3IVKA 5D7KE 1H8SA 4Z7WA 5HYJB 5I1EH 4HT1L 4PJIA 5DQDH 1WO2A 4CMHB 3PWVA 4IRSB 3B9VA 4OF6A 4XPFL 2W67A 3KZSA 3JUYA 1NMCC 2H8PA 2HVKA 3TBTA 1K5NA 2N56A 5DR5H 3ALXA 3LN9A 5J9PB 1BBDH 4FTVA 1OWWA 4I0PB 4JY4A 4NRYA 5D1QD 2J3SA 5CZXD 1YPZA 1EHLL 1C1EL 1E6RA 4NKOA 4XP1H 5JIPA 3D69A 4I4WB 3I6LE 4Z77A 1TETL 1U93B 2ADFH 1G1CA 4ML4A 2HFFB 5GRVK 5D2NA 5EZLA 3TVMA 2VE6B 2BHZA 3O45B 4CJ1A 2AJZA 3L4UA 3LIZH 1V05A 4LASH 3ULUL 1MFDH 3TYGH 2W4XA 4X4XB 4RSVA 3RDTB 1H0DA 5BJTB 2YS4A 2F15A 4NQDA 5F93C 5FF6A 1FO0L 4U3XA 2AABH 4PP2B 4V1DD 2R56H 1B4JH 2FGZA 5DYOA 3VIMA 1LQ0A 5L9DH 1BFVL 1OP3K 2EECA 3NCMA 1EGJA 3BP4A 4BH7B 3D3AA 1KLFA 1T83C 2SEBB 1NUDA 1T89A 5HYQA 1BZ9B 2FDMA 3ZKXC 2HFGH 4BS0A 3PZMA 3RZCA 3W82A 4PLJC 1OB0A 4ZPVB 2PTVA 2BRRL 1U8QA 4BK4A 1W0YT 5A2KH 5IQ7L 3Q0HA 5GZOD 4GQPH 4LIQE 1JNLH 4X5WA 4JGMA 1U3HA 3U79A 2VDNL 5B39A 5I1DB 2RHEA 5ESQB 5L8LB 3EYFA 3LRHA 2AOSA 3W0WA 3OJDA 2KL6A 1YEKL 4WFHD 3FTGA 3JWDC 4G7VH 2VC2L 1QSFE 4OI9A 3VFNA 4P3CL 3W2DL 2EIZA 3DI2B 5KTEH 5KVEL 5A6MA 3W25A 1NLDH 2CIIB 4OZHB 3SPVB 1QZ1A 1W2VA 3WQ5A 1HF6A 4P2RB 3LN5B 1E4LA 5D9OA 3GIVB 4APQB 4UBDD 1OM0A 1NGWB 1PG7X 4PJXE 4V28A 1HINH 4MMXC 4OJFL 2OR8A 1FVDB 4NZUH 2NY7H 2YD7A 1ISZA 1VPOH 4DZ8B 1NQBA 3OAZK 3J8F7 1W0WA 1QRNB 3CFJB 1K4DA 3MRBA 1A9EA 2IBZY 3TWCH 1TZGH 4WI7A 3S97C 2Y36L 3QIUC 1AVAA 4KRLB 3F12B 2CR6A 2XWDA 3H9SB 4DUVA 1MCEA 5JO5B 2J7BA 2XA3A 3SCRA 4LP5A 2WAHA 4NM8H 5DD6B 3T2NL 3TP4A 4ZOBA 4PY7B 1VDGA 1K4CA 3ULVD 5KEZA 1A3QA 4C57C 4U1IA 5LQBL 5BW7A 2XWBA 3P0YH 2GK1A 5E8DL 4UT6H 1E1FA 1UVQB 1KPVA 3C9NB 1OM3H 4DEPB 4O2FA 1FZJB 4I2XA 3TBSB 3MLPA 4FQIH 2DDQH 1KB5H 1ZS8B 1VRXA 3JWDH 1AD9B 1LE9A 1FN4B 2VZ3A 1A6TB 2P8LB 5KVDL 3EOBA 4PR5A 3HPJA 1MQQA 5A2JH 1SMOA 1UWUA 4JFPB 3NYDA 4PJHA 2D4FA 2RCSL 1F11A 5MEOA 2WUCH 1GJIA 5E2JA 2CQVA 4HIJA 3VIGA 3WH7A 2GFBA 4PRPD 1A9BB 1TMCB 4HC1A 2V2XB 4NNYB 1L9MA 2XM1A 1BIIA 1ZANH 3N0PB 4EEEA 3FOMB 3MNWB 4F7TB 1XGPB 4IM4A 3FJTA 3VRLE 1SR0A 3MA7A 3QUMB 5DUPH 2OZ4L 4PJ7B 3RWEB 2DLFH 2PI6A 2NT1A 2KH2B 5HGHB 3VUPA 1KIPB 4UIMB 4LPYA 1E4WH 4LNRA 3ZDYF 3DVGA 1MY5A 1MIML 1L0PA 2PXYC 3QDGB 1RP8A 3WEXA 5E00A 3MACH 1CBVL 3NFPB 3FO0H 4OKVB 5IMLB 5A2CA 4O5LL 5D96B 3UETA 3WEZA 3GJEB 3SBWC 3MRFB 3SCMA 4W8LA 4U1NB 4KTEH 4KGLA 1V3MA 2XFYA 2E0PA 4M7LH 3UPCA 3C8DA 4QHUB 5DMJB 4JFDD 4NO0D 3D39A 3QULA 3FQRB 4WEMB 4BA8A 5F70A 4KRNA 1WWCA 5BS0A 3BI9X 4K3JL 2XQYG 2AXGB 2C0HA 2WHJA 4HFUL 1LO0L 5IEKB 2OMNA 1QFWH 1BTCA 3BSZH 4MADA 1FNGA 1NC2B 2P43B 1FZKA 3CVIH 4W87A 1XF1A 4QRRE 4QXUL 1XAUA 2V5CA 1G7LB 2H32B 4IRSC 3TA3C 4V2XA 1C5DB 3BW9A 4QTHA 4N90D 4L29B 1D5BA 4RFEA 2WNGA 1U8PB 1X4YA 5GSRB 3WBAA 4I0PC 1MW0A 1I7UA 1I9IH 4JDVB 2ZX6A 2FLRT 4JJHA 2O9RA 5JBFA 3MSGA 2N1KA 3WHE1 4JE4B 2XVLA 3CLFH 3SJVA 1NAMA 3QJFB 4MD5B 5IG7A 1RV6X 2X1OA 3GRWH 3Q5YA 1HHKA 3UTPE 1HCFX 2NY4B 3AYRA 5KG9A 5IFAH 1L7IH 4X4ME 4JFHE 3AMGA 3FN0H 4WWID 5DJCA 1I1AA 3UJJH 3TTSA 1C16B 4J3TA 1IQWL 4MPKA 3P11L 3RDTC 4LGSB 3SGEH 2DQEH 2OL3B 3PDOA 4PP1C 4LCIL 3CFEA 2ZKHL 3BEWB 5FA3A 1DN0A 4UOW0 3M1BA 4LLQA 1GYAA 2E5EA 3V6OC 1Z9LA 1OGAB 2BRQA 4XPHL 5A6BD 2R2EB 1SY6L 4JKKA 3RGVA 1A6VL 3C09B 3FB6B 4KROB 3PGFH 1RUPH 5EO9B 5GRUH 1DHKA 1OF2B 2CO7B 4NM4H 4N8PA 3H7BA 3T8XB 2WMGA 3VIKA 1N6VA 1IL1A 2YWZA 1TE1A 5I5RA 4M00A 2YD6A 1WWAX 4RX4D 5DTFA 2QSQA 3W26A 4W81A 3AISA 1NBYB 4OV5A 4P8UA 1XGYL 1BAFL 1CICB 3KPQA 1QNRA 3BQUD 5IKCA 4JFFD 3CK0L 5ABFA 4Q22A 3L3HA 2H26B 1RU9H 3BIBX 3VD3A 3MV7D 2NY3C 3MLTA 4GBXA 3F62A 3K0WA 3IFPA 3WKNA 4QCEA 1ZHLA 2ICEB 3KS0H 2EYRB 2GJZB 4HWEH 4F9PA 1S7VA 4QNPE 1IC5H 4WIQA 4NT6A 5ELIA 3KXFE 2E7HA 4H5SB 4NIKB 2W07A 4PRNA 1KLGB 4APQC 1Q6CA 1R86A 3G6MA 3MRJB 1RUKL 3VX1A 4FXGA 3RI5F 4C7GA 5F88A 5DS8A 2CUHA 4XVTL 3LKRA 1V02E 2VDML 3IS1X 2IAMD 3V0VB 4QHLA 4OM0L 3GSNB 5FA4B 1HH6B 3UTTE 4RNRB 4HK0A 4G8EA 2COQA 3V6FA 4KXZH 4AEHH 1P2CA 4EI5B 1WDQA 3WSUA 4PB0H 3EW3B 3GHBH 3GJFK 4AW7A 4TSBH 2G5BA 4UTFA 1J8HB 4XCFL 2Z35B 3VRJB 1PQZB 5DMIL 3A6OA 3SDDC 2ZX8A 4DEPC 4X4YA 2PC8A 4N5ED 3TO4B 3VVGA 3VXUB 5J57B 2BNRA 3AXLA 4FHBD 5MI0B 3VFTA 5E08L 1UZ6E 1WTGT 5SWSA 4XXCC 5DO8A 1IGMH 3DYMA 3K8MA 3IANA 5EU6B 4NBXB 2Z91B 3GXFA 3BWAA 1MFUA 4IIQA 3IDXL 2ED8A 4Y2OA 2JIEA 3O9NA 1QFUH 3QR3A 3TIDA 4OF0A 2VZSA 4MB5A 3MLWH 1U8KA 5A8QA 2AJ3B 3NIYA 1EEZB 2VQTA 4G8GD 5F7LB 4DCQA 4W89A 2X41A 1CDCA 3WMSA 3IXTB 3LKQA 1TTGA 4M8VA 1KTDB 5BRZD 1JHKL 1KNOB 1ZGLP 1VACB 4N0CD 2D49A 1YJDC 3LEVH 3HPLA 3QP3A 3ZMRA 4PJDE 1NFIA 2V38A 4OZGF 5TF1H 5I77A 3GJFA 1UWSA 3BJ91 1P4IL 3PWJA 3ULVL 1XGUA 1IRAY 4GRMA 3QQ3B 3NAAH 4JO1H 2DOCA 1H5BA 3V8CA 4H88L 4G9FD 3LDBB 1JTOA 4FZ8L 1HHIB 4V2BA 3Q6FA 2R9HD 3DMMD 1HH9A 2Z8RA 3LN4B 4LCYA 1C08A 3RVUD 5KN5A 4PTXA 5D96C 1T20A 2XIDA 3MOAH 4KUZH 4MA8H 3TO2A 2BCKA 1IT9L 3HRZB 4AENB 4FFZH 3RILA 3HUJE 5A16A 2AEPH 5F9JB 4YXKH 3NH7H 4JFQA 4OF3A 3MRDB 4PJFF 1JDDA 5E6IB 1PIFA 5DMKB 3SDYH 1GQJA 5E6YA 3D2UA 4XNYH 4Z8FH 3VWKA 3ES6B 5BMFH 3OB0K 2A0LD 4M48L 3G6LA 4N0YL 3EYSL 2YD4A 4E0RA 4MX7B 2IGFL 1JMZA 4P23B 5DRXB 4H8WL 2BNJA 3GSXA 1A4KA 1YJDH 5EUOA 4EOWH 1OAKH 1ETZB 2NNAB 3EYVA 2HJLA 4HWZA 4QXTA 3QAZB 4YBQC 5C08E 5J12B 2AV1B 1KCRL 2YK1H 3Q3GB 3QXWA 3QUMH 3R0MA 4BSVB 4P9HL 4HKXB 5HHPA 1ORQA 5IF0B 4P5TB 3FRUA 1INEH 1D5ZA 4WI2A 1XIWB 3WLBB 3MREB 1F4WH 4WU5B 4KC3B 4FTVD 1JNHB 5JTWA 3HC0B 1FC2D 4ODSH 3BOVA 4EVNB 2ZSWB 2ERJC 2G3JA 1YQVL 1PBGA 5FECB 5JXAL 3MRMA 3WUWB 2FX8L 1IAII 4UU9A 4EDXB 5JIKA 1MFNA 4DW2L 2CKBA 5IWLC 1G0CA 4ETQB 3TVMD 2CLVA 1RI8A 2C7UA 3DV4B 3KPMB 1BLNB 5ILTL 1WTLA 1J05A 4NOFA 4P57A 1CLYH 1GOKA 1JGVH 2RIKA 1Q0XL 4ZUVB 1OAQL 4AMCA 4PGBA 4Q9BA 4UILL 3CZEA 1NCCL 1HXMB 4NQTA 4NQDD 3ZDZF 3KLAB 2J4WH 1I1YB 3C09C 1YEIH 3P4OB 4K2UH 2H9GA 4NUGL 3SE3A 1BQLL 4KROC 1VGKA 2H32H 2R1YA 4WCYH 3AROA 3OKNB 2X4OA 3ULVF 3B3IB 4YHLL 1RUAH 4Y2DA 2DSUA 3BZEA 4ODXB 4M61A 2DL2A 1Q72L 4GAYA 4MA1B 1G6RB 3RZCD 2GTWB 3O6FB 1UACL 3BFOA 3ZE1F 4X6BA 2CCRA 3OGSA 5CEZD 3WNNA 3WIIH 3A0OA 3VXMD 2XN9A 1E6XM 4DTGH 4L8SC 1IM9B 5GJSL 4KAQL 1U3HD 3QDJE 2CDFA 1LO5B 3MRKB 1E6OL 2NW3A 5BO1H 1XT5A 3DYOA 1TVBA 5DD3L 5FYLD 4DN3L 3NIGE 1LDPH 1B3WA 3MMUA 4QOKE 1KG0B 1OAYL 3ZKMC 3MR9A 4PJEB 2O5XL 4WO4C 4MAUH 5HOSA 4PUBL 5MP6H 2ZCLH 4ZDHA 5EZOH 5A2IH 1H41A 4JFVA 1IGIL 5ITBH 3CZGA 4M5YL 3OGCA 1FFRA 1X5JA 3AY4C 3MGAA 4HZ8A 3L5WB 1UJ3B 3L3JA 4POUB 3D9AL 4HF5H 4K07A 1A7QH 4HS6B 1P6FA 3GZKA 1IGYA 1U41A 5TE4H 4EI5C 1IGCL 1BIHA 2R0LL 4G3YH 3RTQA 1VFBB 4AL8H 3DUSA 1EFQA 1BJMA 2DIBA 4NC1C 5D2LA 4IDLA 2QSCH 3CTTA 3CHEA 1LE5A 5B4MD 3TO4C 3A6CH 4H7VA 3EDDA 5DO2C 4PN2A 5C0CA 1QSEE 4GW5B 1RSFA 1VFUA 3PP3H 5LGHL 2DWDA 4JANB 3HMWL 4MYWB 4HJJL 4RMSA 1P9MA 5E03A 2EH8H 1MJ7L 3AXXA 1AI1L 1DLFH 5L2JB 4OZIF 2IC2A 2VIRA 4D0DB 2X1QA 3S96A 1N0XH 4I77L 2W0KA 1FPTL 1EO7A 1KJ3L 4AIUA 2DQCH 4NRRA 4RAHA 1IILE 4AM0A 5B8CC 4D6CA 1XF3B 3QUZB 1G7MA 3BVNB 1QNZL 3FB5B 1HQRA 4M9OA 3BMWA 3BAYA 3D5HA 4KRTA 4B53A 4PS4H 4PCSA 3GSNH 5B39G 2AV7B 4HIHA 4NCC1 1JYXA 1KBBA 3UX9B 5B3NA 4KZEL 1B2YA 3L3IB 4GRLB 1VIWA 1CLZH 3JV4A 3OKDA 4NP4L 5ICYB 4JM2D 4RFOH 4P2RE 2D7MA 5FCSH 5D7IB 3W27A 5KZCB 1YEDA 4A4AA 2Q8BL 2XXCB 3LDBC 1II4E 2XYCA 1A1OB 5HJ3B 1AY1L 1JF1A 2CKNA 1W32A 4LAJH 5AYBA 3O3BA 5IROC 2X1XR 1QRNE 3LVEA 5HYEA 1HIZA 3MRIB 3VA2C 1L8NA 1T7VA 3J7HA 5LA1A 2ZX5A 2BFVH 1UXSB 5CILL 3H9SE 5I1LB 5E6IC 3UMTA 1MHPH 1U92A 3HNTH 4ZUSB 5IOPA 4YFLI 3D0LA 4B9YA 1CR9H 4MLIA 1VADA 2B0SL 1UG6A 1OBAA 3ALGA 2YZ1A 3QUKA 5IGXL 2J5LB 3HNVL 5GHWH 3D39D 2FZ3A 3LMJL 5C0AE 4GUPB 5IVXB 4WW2A 1IC4H 5TE7H 3VJ6B 3GMLB 1U8JB 5BS0D 4KV5E 4J7RA 5EBLA 4P23C 2NQCA 15C8H 4JFEB 1TZ7A 3DX8B 5K9OA 2LAAA 3U9UB 1DWHM 1S9VB 2VXSH 3FZUC 2CRMA 4G8IB 5I8KH 5DMGC 1DBMH 4FQJL 5JPNA 1G7JA 1FZOB 4OGYL 1T03L 3CUPB 3AC0A 2F9BT 2K7QA 2V3EA 2F58H 2E3ZA 2EKSA 4P5TC 4MXVE 2PCPB 3CSBA 4E41A 3EGSA 1CFBA 1XIWC 2VAAA 3SE8L 4JZJA 4NQCB 3TBYB 3KYOB 4NRXA 2CH8A 4X9BA 2WUBH 1ZTXH 3TN0A 2R29L 4LLUA 4QAWA 4I48B 3GBLA 1FYTD 1EZVX 1N7MH 1XCQA 5E4EB 3MRLA 4GRWE 5D7LB 4R97C 1FVCA 1P4LA 3OG6B 3U0WL 2AKRB 5KAQG 5E7FA 3ULUE 1EFXD 1D5IH 3K2MC 3TC9A 4DK6A 2ZXAA 4G80B 2FL5B 1MFAL 4J4PA 5A8NA 2WW8A 3RPIA 1I1AD 1XMWA 1F3RB 4PJ7E 1RZIB 3QCUL 4D8PA 3WKML 5JBEA 4YBHA 3ARDA 3EFDL 2CK0L 5C0NC 3VXNB 3RQ3A 4BKLB 4NN7B 1QR1A 3VI4F 3NCCB 3BPOB 2AP2A 2J7GA 1QFWI 4P4RB 4Q74A 4UNTA 4AMKH 4BZ1H 3DRQA 3GM0A 5IB1B 3QDGE 2Y5TA 3LS5H 4CVZA 1CZ8H 4OGAC 2FGLA 4PJ8B 1FH9A 3QIWB 2XNAB 2JJTA 2E40A 3H3PH 3VXSA 4HPYH 3BH8B 1ZHKB 3RGVD 3SY0A 4YZFE 5CXPA 2AI0L 3BKCH 4Y89A 2JB5H 4MA1C 4N8CH 3II1A 4LAQH 1OTSD 1WT5A 3O6FC 2J25A 3RM8A 4P2QA 2J7EA 3MV8D 4YFDB 4H1LG 1ZLWH 3KLHD 2YLAA 4XPAL 5IJKA 4U1HA 1ZT1B 2ATPB 2WVUA 1K2DA 4Y19B 4ZUTA 4H26B 5JLZB 3EYPA 2BNQE 1JE6A 2Z93B 3BPCB 2Q76B 4DOHE 1KXTB 3NZ8B 4XVUC 5IV2A 4RBPH 5DFVD 2XZAL 5I1IL 3SGEI 1TVDA 2XACC 4KWUA 4U5IA 1B0WA 3CFCL 2YIHA 3WH5A 5I6XB 3P30H 3GMOA 5EB8A 1RULH 4MJ6B 3MROA 3Q5TA 2DM2A 2GIYA 2YA2A 1BEYL 4GXPA 5E2TL 3IGAB 4KRUA 1XF2A 2GJ6B 1T3FB 2YBRB 3GHEL 1EGJL 2VI0A 1PSKL 4BZ2L 4RMWA 1GOOA 3GK8L 1INDL 3MBXH 1JZ4A 1G6RH 4W6XB 2HJFB 3BZFB 2HT2D 1XGRA 2VXQL 3W11D 4ODBD 2DQFB 2E6JA 5CEZL 2RFXA 3FQUB 4HX1B 1R3LB 4X7DC 4P2YA 2R69L 3QO1A 5ADPH 5IFHH 2NY6C 3O3EA 5JHDA 1MJ8H 1EMTL 1QVBA 3T3PF 8FABA 2IPTL 2DWEB 4R3SA 5CEYA 4JQXC 2CXGA 5A40E 5C7XH 5GRVL 4FA8A 4L4JA 5FYLL 5A3HA 4O00A 1WPCA 3ROOA 1FVEB 3ZKSD 1E4XH 2BNRD 2VLKB 1MYRA 1IQDB 2K3TA 1MUJB 1BGXH 5MEND 1B30A 5HDLA 5SWSD 5T33H 4EBQH 3LSOB 3H9HA 3LKSA 4I3RH 4PRHD 1FIEA 2APXA 1W3LA 1MW3A 1BG9A 3GMNA 1KCSH 2Y6SD 4WUUE 4KJPD 3WQ6A 1DDHB 1H3PL 1N26A 4Z7WF 1CWYA 3UTZA 5CINL 4PJIF 2D7OA 2FCBA 3GFUA 4Z18A 5GIRA 5A2AA 1AC6A 2GSJA 3EOAB 1CE6B 1ODAA 2G8ZA 4KXZI 4F7MA 3VNZA 4GRLC 3MFFB 5EZIL 4J6RL 2HLAA 3G6JA 1CFSB 2AJYH 3VFVA 4A2LA 4NQXA 4R96A 4Y16D 3BO8A 4GFTB 4TVPH 1C8QA 1O6IA 4QO1A 3HJEA 4NZDA 4N0UB 1XCXA 4GG8A 2EDHA 3M46A 1OT1A 2EH7L 4X6EB 3AIUA 1MCIA 3BAJA 1YYML 3P3YA 5IJVB 2ZG1A 2BVOA 4YIQA 3MGOA 3CZKA 5H2BA 1CLOH 4ZPTA 5T3ZH 2J7DA 1ZT7B 4DM1A 2P45B 3WS6C 2F19H 4D0BA 1VERA 2O5ZL 1MRDL 4ACPA 1RK1A 5J11B 5I1CH 5FKYA 1GQIA 4JPKH 2V5MA 3D25B 2YXFA 4M62L 4I0KA 1NCAL 1EHNA 2ZOLA 2V3DA 3M17B 4X0VA 3ZYJA 1KR1A 1J8HE 2J5LC 2J6EA 2P8MA 2R0WH 1EBAA 3Q6GH 4W4OC 4GQ9H 3RGHA 1GUVA 1QI5A 1P5VA 1A4JA 4DUWA 3D2UD 4AYFA 2IFFL 3DECA 3NZHL 4K7PH 3VXUE 4HU0A 2VX5A 3ZJKA 2D2OA 5CG0A 5LWYH 2IANB 3O2WH 4HC1L 5FIPA 4NQVB 5ITFB 3JTTA 3T0AA 3C2AH 3HS0B 1E4JA 1I3UA 2EYSA 3CC5B 4U5KA 8CGTA