4MB4A

Crystal structure of e153q mutant of cold-adapted chitinase from moritella complex with nag4
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
528
structure length
528
Chain Sequence
GTITSQDDNVVVGYWHNWCDGRGYQGGNAPCVELKTVNPQYNVVNISFMKVYDIAEGRIPTFKLDPTIALSEAEFIAQIDTLNSQGRSVLIALGGADAHIELTRGDEDALAAEIIRLTDLYGFDGLDIDLQQAAITAKDNQFVIPAALKMVKEHYRKTGDNFMITMAPEFPYLTANGAYTPYLTELDGYYDFINPQFYNQGGDGLWIEGVGWIAQNNDALKEEFIYYIADSLINGTRNYHKIPHDKLVFGLPSNIDAAATGYIQDPQDLYKAFDRLKAQGQPLRGVMTWSVNWDMGTDAANNSYNQQFIKDYGNFIHNQLPPVTDMTPTLSGIVDTRVELDSHFDPLIGITAKDYQGNDITADVTVSGSVNTNQVGDYLLTYSVSSDDETTNQPRKITVYEILPAFTGITDTTVVIDSEFDPMQGVSASHPTQGDLTANITVTGEVDTNVVGVYELTYQLFYGQDNQQNMTDKRIVTVVTDAVSDDDWQVGSTYVKDDKVTHNGATWTAQWWTKGEEPGTTGEWGVWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of substrate-bound chitinase from the psychrophilic bacterium Moritella marina and its structure in solution
pubmed doi rcsb
source organism Moritella marina
molecule tags Hydrolase
molecule keywords Chitinase 60
total genus 174
structure length 528
sequence length 528
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2013-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
A PF16403 DUF5011 Domain of unknown function (DUF5011)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.20 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Carbohydrate-binding module superfamily 5/12 4mb4A04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mb4A03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mb4A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4mb4A01
4G8IA 1IM9D 2C1PA 3NTCH 1NL0L 4UFJA 2VR4A 1ZHBB 1DLFL 4R90L 3TO4D 4I18C 4OZIF 3BSHA 4DJMA 3C2AL 4I3RL 2E9MA 1OPGL 4F7MB 3MNVA 2DMCA 1MHCB 3ILPB 1HJVA 1LEGA 4HBCH 5FCUL 3BRGC 1IEAB 3LS4H 5KVDL 4AL8H 2R2HB 2C26A 1J8KA 3G6JE 3QEQB 1EJOH 4W8BA 1B2WL 4P99A 1KTLB 4YO0A 3PV6A 1NSNL 4P2QA 5M5DA 1CGVA 5I8OL 1XRVA 1MW3A 1X5ZA 4LEOA 1SYVB 4OFVA 1JP5A 1YNLH 4JZJA 1JPSL 3C8DA 4LPUA 3T65A 1MIEL 1A5FH 1CU4L 4F66A 4W89A 1FDLH 2C8NA 1WAAF 4LP5A 2J8GA 4P2OD 1CDIA 4NOFA 2HG5B 4IDLA 5D8WA 1KTLA 4WRLA 4YXKL 4K3DH 4TQEL 3O6ML 1G9NH 2VLLA 1T66C 3HPLB 4C4KT 2GDVA 4G43B 5IIEB 3T2OA 3V6OE 1WE5A 1GQIA 5HDBF 1V5JA 5DSCB 2Q8BL 5JBFA 2XKSA 1MQ8A 1A4KA 4PRID 5EO1A 3WDQA 5CFHA 4M7JH 4U5IA 4GKLA 4P2RE 1FLRH 1T80A 4TVCA 3G5XB 5D2LA 2XRAH 5HHXH 2H32H 3O41B 2QF8A 4R97C 3LD8C 1IAII 5KS9A 1S9VB 4MNHB 3ISWA 2NSXA 5IW1A 1G6RA 1KCUL 3QCUH 4R90H 4PSPA 1RSFA 5IROC 2J77A 4J23A 4WI3A 3C2AH 3SE3C 5EOCL 3ARBA 2OK0H 2NW3A 1RQ5A 2ZCKH 4KJQD 4NRXB 4PMDA 1AXTL 2EE6A 2IEPA 4JY5H 1HHIB 1KOAA 1BFTA 1DQJA 2Y25A 4FQJL 4MDIB 2FCBA 4WDIB 3MXVH 1HNYA 3KYKL 3LS4L 4JY4A 4LGRB 1EZVX 1XGYL 5JA8B 3RHWK 4MJ6A 1GQKA 1CL7L 3VG0L 1A47A 4QCEA 3GKWH 3IDJA 1FYHB 1MI5A 1T66D 1J7VR 4NP4H 4OZ4A 1JAKA 5I1AA 4W7VA 1JF6A 2VSCA 3KJ6H 5MEND 4KV5F 3VXTB 2PO6D 5BZDA 2NX5D 2R0KH 5CPQA 3NZHL 2XY2A 4QP0A 4X8XA 1KCKA 4Z7NE 1DP0A 3V7MA 4MB1A 4ODSH 2EPLX 2JB5L 4OT1L 4Q6IC 2DSUA 3LMJH 4NQCA 4KRMB 1OAXH 4K9EC 3ULVD 1AFVH 1X3DA 4I3SL 3GGWB 4OZ4B 2ICWA 5JOEA 4LLVA 3V9FA 5ANMB 4UFHA 2YPVH 3HG1D 2WBJB 4F57H 1U3JA 2V5MA 4G9DB 3CHCA 3VXOA 1HOCA 3G08B 4GOSA 3QUML 5I8EB 4M7JL 5D93C 4DWSD 3DOSA 4WUUD 1FGVH 3G6MA 1BVLA 1KGCE 1DVFD 1UM5H 5CEZH 4JY4B 3OXRA 3TO4C 4G42A 3SN6N 1CE1H 2OS7A 3W24A 3D25B 2Z8VC 4UB0L 3QDMD 4G80B 4QHMB 4XBEL 1R0AL 5DVNA 4KZEH 4ESKA 3SDAB 2WVVB 4YHEA 5EOCH 4NUGL 5B22A 2C0HA 1M6OA 2ZCKL 5EZJA 4DTGL 1JRHH 4UZUA 4YAQA 2J8UB 1I75A 4D6FA 2AI0H 3PIQA 1TPXB 1WZLA 3CFCH 3UTSD 4RFOL 1S46A 1EBAA 1MOEA 4XVSL 5D1XA 4EANA 3NIFF 2E7LA 1G0CA 3MREB 4QEGA 4NC2B 4XPHH 2AABL 5E70A 3MUAA 3BO8A 3TC9A 1CGUA 2FGZA 2BNUA 2IG2H 3PDOB 3NDZA 4OQTA 1NCDH 1AQDB 2AEWA 1M6OB 5EZJB 1KXTA 4P3CL 3HC4H 2VLJB 1LL6A 4Z7OE 3PGCA 4PRIA 1I7UA 2B7DT 2YDRA 5GRZA 3UTQB 1P69B 4P46D 3CMJA 1PSKH 5LAXB 1GZJA 4ZXOA 1OSPH 5TE7H 2QHRL 2CLRB 4ZO9A 2GW5A 2AV1B 4QHNB 4CVZB 3MV11 4M3JA 4UQ9A 4HFUL 3WLWC 5E99H 1A2YA 5GRUL 1U58A 3JWOL 4QKXB 4Z0BH 2X2YA 3AIRA 3PZIA 5DYOB 2DDQL 3NFPB 3S5LB 5IMKA 3QUMH 4W4NA 1QA9B 1ZLWK 3SGEH 1UYQA 4DKAA 4HCRL 1OP9A 2BDNH 3L3HB 5MI0C 3HMXH 2R15A 2P5WE 4U5KA 1XGTB 2HH0H 3L3IA 3P0GB 4U3XA 4JDZB 2EH8L 4U7SA 5FA3B 4LQ1A 4S1QL 2OTPA 2VDQL 4Z7UB 1ZU8A 4N8VG 1I1XA 4F80A 1JHKL 3LQAC 4Q9CA 1C5CH 2ZPKL 1F11B 2WWKO 3W81A 3WL1A 1A6UL 4U3HA 3LD8B 4R96B 1FH8A 4JZOA 2AJUH 1S9VA 5CHNB 4ZUTA 5I17B 1E55A 1BLNB 3EOBB 5E8OA 1OTUD 3SDAD 4G8GD 3VILA 4AEIL 4XNQB 3CJJA 4S1RH 4U2ZA 4HHAB 2V38A 1FIGL 2PW2A 1MIMH 2Q7NA 4OQTH 2ICEA 4Y89A 5ILTL 4QDMA 4N0RA 5F7YC 4QHLB 1ZLUK 3T1FA 2JTDA 1TFVA 5FIPA 4N8PA 2NT0A 4HC1H 1MFEH 3HRZA 4I8DA 2CRZA 5EFIB 3U4EA 2J7DA 5EOTB 4Y19D 3SQOL 4HZ7A 1K9EA 5D2NE 3RZCC 5DWUH 3MUZ1 4Y19E 2E7MA 1D3CA 3VRJB 1N7ML 2ZNXA 2DLTA 3TESA 1I3GL 4KK8C 5DUMH 1JNJA 2EBNA 2X9YA 5FYKU 5CZXC 2O5YL 2ZXQA 4BF7A 4CMMB 3JUGA 2BY0A 1D6EA 3VFRB 1JK8A 1WP6A 2BDNL 2X44D 4DM2A 3MO1A 4IOFD 1INEL 5JIPA 1N0XL 3W11D 1LP9F 3VDBA 1YNTB 1SJHA 2R9HC 3KPNA 3L3JB 1IM3B 3MKKA 1WC7B 5C2BL 5D93B 2A0LC 4IHOB 5E00B 1EHLH 4U6VL 4XPBH 1C93A 4D8PA 1GOMA 1WKYA 5AWNH 3ARGC 3ZE1F 3L95A 4XZWA 1KXVA 5IHUH 1EX0A 3MRIA 2DWDB 1F4YL 1MCFA 5DK2A 4ZFGL 5T3ZL 5DJ6B 1X4ZA 1KR1A 4HTYA 1UUQA 1TJGL 1WTLA 1QTYT 2NY0B 3WO4C 4AY1A 1X5JA 4Z7UF 2X4PA 3REVA 3LQAL 2WXDM 2XTJC 3QULA 4AG4L 3F7QA 3OB0K 4Q9QL 5IG7B 2XZCH 3MRPA 2F54D 3LN9A 4L8DA 2ZNWA 3EFDH 1RP9A 1D6VL 4EDXA 2J3SA 1AIWA 4ELME 4PP2B 3BIKA 4DN3H 3EZJB 1KCRH 4G6MH 3CZEA 5E6IA 3RNQB 2LAGB 4Q2ZA 5J1AB 3BYYA 1JV5A 2FJFA 3QHTC 4LCIL 2RGLA 3VKKA 1XCXA 1IAIM 5JO5A 4NC0B 4O00A 3MOBH 3N15A 3FN0H 4YHZH 4JPKH 5EFFA 5DEGA 5FO9A 4JCLA 4IDJL 3P0YH 3QP3A 3WH5A 3WNMA 3BUYA 5LKNA 3SGDH 5IFHL 1VDGA 1U8JA 2J7HA 1LEGB 3AFBA 3UXFA 3VFSA 4Y5VC 5C08E 5F1NA 3CLFH 1HHKA 1GGIL 4EN3C 2CQVA 3RIAF 1UKSA 4U05A 5HYFA 3MNWA 3VFVB 1NGXB 4YQXH 4Y2OA 1MHHB 4FLSA 3BCFA 1ZJAA 4U6YB 3H42H 3ZT7A 4PLKC 4XPFL 3H9SD 5AAMA 3AHVA 3EYOB 3K80A 1IFHH 1EHAA 4ZFGH 1FNGA 1J18A 3SDDB 1KFWA 3OB8A 2VAAA 2VTFA 5JHLL 4I2XB 3T0DA 2DQFA 4LIQH 3AIVA 3NAAH 5ETUB 2EDKA 2FGLA 1HCVA 1ZGLM 2IBZY 2XZCL 4MNLA 3KXFE 1KXQA 1B90A 5DJ8A 1E3ZA 4LNRA 4KY1L 3C60D 5HYQB 1HVXA 3OKOB 1NGPL 3VFTA 2F61A 4KK5C 4LMQE 4PJBF 3VGEA 4DN3L 4OIIL 4FP8H 5FAAA 1KWGA 1FJ1A 2H2SC 3HRZB 4UOQA 4OUOA 1F4XH 2R8SH 1NGWA 5ECUA 3GSNA 3P9LB 4KKLD 5ITFA 3WHXB 1S7XA 1S5IH 1CFQA 3WS3B 3UAJD 1R3JA 3RVTD 4K7FA 2HT4D 3QWRD 2I07B 3QUZD 4POZC 3WLBB 4UIMB 2NX5E 3SE8L 1IGTA 4AENA 4PRPD 2GJ6D 3IFLL 1FZKA 2XSBA 1G9MC 4PYSA 5I74B 4G9FE 3BVNA 3GUTA 1HKLL 1V02A 3AREC 3F5KA 3MLPA 5MENA 1EHNA 2B5IB 1RZIB 3ZHLA 5KSBF 3G9VA 4DKEH 1I1AC 5FM5O 1RFDH 3EOAB 5E2JA 1FL6A 5BO1L 4ATDA 5L0QB 2W0KA 5BRZD 2R0ZL 3WD5H 2HJFB 5KG9A 3KPLB 4UBDD 2QSCH 2W61A 1NFDF 3I9GH 4R4BB 3VGDA 5BRQA 4M7LH 1A3HA 1AQDA 5HGBA 4FFYH 2EC9T 4AISA 2VLRB 3VFGH 2XZQL 5IHZB 4JPIB 4MZ3A 4PJCA 3C5ZD 4QRTB 2WMIA 1NBQA 1BOYA 1M04A 3HI6H 1PAMA 5BYWA 5HHPB 1KTKE 5IFTA 5ID0A 1MHEB 4JB9H 2OSLA 3QJFB 4GXUM 2XV6B 3NH7L 2Z8WC 4RAUB 8FABA 2CIPA 4XP5L 3HAEA 3H7LA 4NO5B 3RPIA 4HS8L 4Y1AE 1KELH 4JFXA 2NY0C 5A2LH 5HI5D 2QADC 3KPRD 4UQEA 2YEZB 4OIBA 2XTJB 2H2PC 3S3JA 1JHLL 4K3JH 4PJAB 4AD4A 3D9AL 5A6MA 3T4YA 3IVKA 4HHAA 2VX5A 2VE6B 4LCYB 1CG9B 2ZUWA 4P5TA 4JFZH 1DE4B 3UESA 3LDBB 4FF5A 1EFXA 4QRSB 4MDJB 4RZCA 8A3HA 4MJ4A 4JANB 4PJ8A 5IV2B 4KTYA 1G01A 4JN2A 2Y06H 3D85A 5ABHA 3SE8H 4FQ2H 1FFPA 4AZCA 1OF2A 4JGJA 4KDWA 2AK4A 2EEAA 2Z31C 3ARDC 3KPPA 4I0PD 5GXBB 5KS9B 1KTDB 1IGMH 3OAUH 1UWTA 1BJ1J 4ELMB 3VXQB 3P30L 4ZS6C 5H8DA 1U9KA 3EAKA 4G6FD 1GHRA 4A2MA 4YDVA 5BO1H 2DJ4A 3OLEA 1MJJB 3QJFA 4I5BA 2R0LL 1OQXA 2DYPD 3OKNA 1FN4B 3K74B 3O2WL 2DKUA 3DXAE 4Y0GA 1MREL 1EQPA 4LLUB 2DIJA 2G75B 3L3HA 1NMAL 5D7IF 2VRAA 2J4WL 1S7SB 4L3EB 1RJCA 1CLVA 2YEZA 4DN4H 3D39D 1HXMB 4LSSL 4LSTL 5J56B 4JB9L 4M3KB 4P2QE 2CLRA 5I1LA 5DURB 4PB0L 3AC0A 3NH7H 1DL7L 2NY6C 2ZUSA 2FGWL 2ENYA 3Q5TA 3G6JA 4FQHB 4BS0A 3MCLL 4XX1G 3V8CA 5A6BA 1OGAB 1BJ1H 1P6AB 4X4ZA 3CVHH 4XC1L 3UPAA 5FGBA 3FAXA 1MCQA 3DSNA 1KWKA 4I77H 4W5ZA 1LILA 5D7IB 2FD6H 4KAQH 3WQ8A 1FC1A 4V2CB 1FDLL 1HVQA 1YN7A 1AXIB 5ISZA 3Q48A 2UWEE 4IIQC 2VQUA 3QEUB 5DQJB 1EAJA 4ETYA 5SX5H 2HTKC 4H0IA 1T03H 4HJGA 4XPGL 3U0TB 3UETA 4LCWA 4MJID 3VIJA 3H6JA 1WNOA 2AEPL 3GJFB 1YYML 1V8HA 4HU8A 3O6FC 1RZIA 3UCRA 3SO3C 4BYHA 5DF0A 5E9DB 4QXUL 1LMKA 5FECA 5KVEH 5CHNA 3DGCR 3SGDI 2HG5A 1XIWA 4UOJA 4HWZB 2G5BB 3A67H 4H8WC 2ZWLT 3S97C 1FL5A 3SGJA 2JIWA 4NC1C 1ZA3A 4DVRL 1K4CB 2XWTB 4L5FL 3U6RB 3MGOA 4W7WA 4DWSA 1WZMA 2FIKA 4GS7B 5EZIH 3CLEH 1QI5A 3AM8A 1XF2B 2YA0A 5LG1A 3DX9B 5DMGC 2AGJH 43CAA 3QXAA 4DN4L 2EPMX 4UOZA 4ZE5A 4NNPL 3QXWA 4N0YH 1NOUA 2VXSH 4LRIC 5CZVH 3WHE0 4FG6C 5EBWB 2YR3A 4UDTB 1IC7L 1M53A 3ZL4L 1UD3A 4Z18A 1B3XA 4BCEA 4U2YA 1BLIA 2AKRB 2YOCA 3H3PL 1T2XA 4PGJA 1A0QL 4HUMB 4NP4L 4HX1B 3T2NH 4I77L 1LG2A 3PP3K 3TTQA 4X0KB 4CVXB 4UT9L 4WO4D 5GSVA 4KROC 1OARL 1QSFA 1W0VA 4JR9L 5FKPB 2BSTB 4D2NA 4EI6A 5ICYA 1N3NA 4TULL 1MLBB 4F7CB 3QG6B 5CQ1A 1IC5L 3IB4A 4NZUH 4ZFOA 4XNYH 4UTAH 1G7LA 5A2BA 2PYFB 3LPFA 3CMOL 1MAJA 4OCMC 2ATPB 4QXUH 2YD3A 4F57L 1NUNB 1IQWH 1NBZA 3TGXA 4R0LA 2Y8VA 3NSNA 3S34L 1C12B 3X14A 3AJ7A 2VDNH 2OWCA 1FORL 1F3JB 4EVNB 1QFWM 2FEEI 4MA7L 4U1SB 5EA0H 3IF1B 3F12A 4JGMA 3P0VH 4DGYL 5FM4A 4UB0H 4PUEA 5CUSH 2Y5EA 4Y2DD 2Y07L 2OP4H 3U9PH 4KZEL 4YN5A 4K68A 5GHWH 2VMFA 3CMGA 1IZJA 3LS5H 3BX7C 4V2BA 5J57B 3APGA 3UTSB 5CEZE 5C2UB 1T1XA 4RAVA 1ZT1A 5HYSA 2IANB 3L3OB 3O9WA 4O9HL 2IBBA 1B6UA 3WN5C 1YEKH 3F4VA 3BAYA 3RU8L 3QUXA 4ACYA 4UUJB 2PYEA 4FQQB 2QR0B 4LHUB 3A4AA 1EAPB 4QHKJ 2NY6B 4KHXH 3ZE2E 1KIPA 5HDQL 3TN0D 2OR8A 1I9RL 4X5WA 4XP4H 3GO1H 1BVZA 5BXFA 5C0DB 4LLWA 4MA1B 2BXZA 5GGVH 1CS6A 5IR1B 1JNEA 5EOQL 1GH7A 2IADA 3SY0A 4JJ5B 1FH5L 3MV8E 4K8RC 3X3GL 3JWOH 1OGAE 4EDWL 2C4FU 4AIZA 1AGCB 2CXGA 3S34H 1L4IA 2EDFA 2VXVH 1E4WH 2GQHA 3G6AB 2E9BA 3HA0A 5AAWA 1LF1A 2DTML 3CUPA 4NQUA 1WAWA 1G7IA 4DGYH 1SVZA 4GMTH 4LVOC 3QCVL 3TIEB 5CAYB 1JZ5A 2OP4L 3U9PL 4YR6B 4UIMA 3U0PB 3D85B 2XG5A 3OV6A 5DK2B 1A21A 3FOLA 3FQUA 5CJQH 1N8ZB 3RVXC 3QIUA 1FYTA 2CLVA 3CGTA 3TO2A 4HK3N 1FZJA 1OAQH 4NM4H 2CMRH 3F7RA 1I3RB 2COQA 3G5VA 5EPMB 4U6XB 1A7OL 3S96A 4Y4FD 2P7TB 1KGUA 3HJEA 2H32B 4AEIH 3DBXA 3GSXB 1ZVHA 4S1RL 5DFWH 1FNEB 2CKRA 3Q6GH 3PWVA 4ODVH 4PYHA 1BFOA 2ZX6A 1VFUA 4PGDB 5ABFA 3W28A 2WBJA 1MFEL 1A6TA 2DBLH 4OZFH 2VLKD 4K7PH 4XP4L 1CE6A 4BQ9A 3VXME 4JVWA 1J1OL 3GHBH 3I6KB 2VABB 4YUEL 5BVPL 4BKLB 2EQDA 1B0IA 3CIQA 1X5LA 4F9DA 4RGNE 3SBWC 3O4LD 5HI3D 3UERA 2VDLL 5C08D 4FQHA 3R0MA 2QMJA 3O8XC 1BF8A 2P8MB 4Q9RL 2D7NA 3OKMA 2OZ4A 4FTVD 2FNBA 3AS0A 1MJUL 1QLEL 5EU7C 3FN3A 3JV5A 1E4WL 1A7QH 3RWCA 1TVPA 5F3HA 3CVHB 4WWID 3GB7B 4V27A 5CEYB 2JJSA 3S96B 4I0KA 5EU6B 4X99B 3DVIA 4IRSA 3WS6A 1N26A 4IJ3C 1RI8A 3V4VL 4QRUB 3MMUA 3HE6B 5T1DL 4MMZC 1NQ6A 5DR5L 1NGQL 1UA7A 1U8OA 3BP6B 5T33L 5MHSD 1HINH 4PCTA 5CJQL 5INCA 5C6WH 3M1BA 4BSWA 5ITBH 1TZHB 4U6VH 5KOMC 4R3SB 5H35A 3ECBB 4QXWA 4LSPL 1QSEE 1GRWA 5DK3A 2DPEA 1FV1B 3QQ4B 4R4ND 4PJHE 1WFOA 3AZTA 1A14H 2X4UB 5SWSB 4N0FB 4L8SB 2UYLA 1LDSA 4WHYH 2CBIA 4GJTB 1TJGH 4HEME 3B2VL 4J3VA 3QFJD 3LQAH 2FH6A 4K8RL 1LD9B 3RVVD 3VFWB 3QT2A 2J7CA 1MCIA 3H9HB 4IOIB 3NABL 5JUEH 2BVTA 4LSUL 1W3JA 3D18B 3NZ8B 5E8OB 1ZLWH 5IR1A 5IP4A 3VWKD 5DVKA 3GHBL 1G7QA 2BX5A 4QRRB 4G9FD 5EZOL 3ARBC 2WWCA 3D1MC 4WV1C 3W5MA 1QKZL 4U1JB 1TLKA 3DX7B 3U83A 5DD6A 1DTUA 4J7RA 5HPCA 1AGEA 1E73M 4LCIH 1FHLA 1VGEL 1V7ML 4XB3A 3A6OA 3HPJA 3MGTB 4FXGA 5MERB 3M1BB 4BSWB 3SDYL 2BVYA 2ZCHL 3GXMA 5A8OA 4YBHA 1LGVA 1DQML 3VIPA 2HA1A 2YUXA 1H0IA 3WJJA 3MLXL 1MQRA 1BF2A 4WV1A 3CFEB 3HI5L 1I85C 3T0XA 2W65A 3H9ZA 2Z8RA 4N0UB 2WMJA 4F37K 4Z6AT 3GMQA 3JV6A 4R4BA 1Z3GH 4NNXB 4L8CB 1A7NH 2PTTB 3VRLE 3OKKA 4BJLA 3OAZK 3W25A 2CLVB 2GK0B 3VIFA 1A2YB 2XOTA 4BQBA 4P23C 1JL8A 2XVGA 2KL6A 4XNXH 3T8XB 4M1CC 3MRMB 3VUPA 3S37L 2OR9H 3REWB 1E4XH 3KPSD 4GUPA 4XWGL 5DT1L 4XMPH 1E4NA 3TIEA 4G6AD 2QTEA 4ZFMA 1F58H 2CPUA 4BELD 2NY2D 2YUWA 3MBXL 3F12B 1QI3A 4HK0A 3LHPL 1MCOL 2P47B 3FOLB 5JUVA 5EOCJ 4UOW0 3CUJA 1CZ8L 1ITCA 3QDGD 4UI2A 5ICXB 5DRWA 4H1LA 3FCTB 5FOBA 1N5YH 3D6GA 1I7RA 2GY5A 3BGMB 3CHFA 4MNQB 2PBGA 2GK1A 3OX8A 3WUWG 2NX5A 2VQTA 1UZ4A 3IVKB 2DT2A 4UQAA 1EFQA 5A6JA 4GW1B 4E0RA 2IADB 3IRZA 3PWVB 4LRIA 4PRHB 1KJ3L 4J8RB 4WFEE 3SY0B 1UR2A 3F7VB 3LPOA 3S5LA 3U7AA 1S7RA 1SR0A 3LKPB 2WVSA 3QG7L 2PBOA 5AC4A 4LKXA 1W1YA 3ZMRA 4ERSH 2A6IB 1UQYA 1MCDA 1OSZB 1E28B 1R5IB 3TV3H 3JXAA 1E6JL 5T1LA 3F6LA 3SDYH 3Q6FB 1DBKL 4KPHH 3NCFB 3UJTL 2CK0H 2ZCHH 1OM3L 2WSPA 3BAKA 3VI4F 5ABDE 1ZWIA 1IAOB 2JCCB 2NY4D 1A7RH 4JO1H 2CKBB 4PTUA 4IISA 1HKLH 3AFLA 3OGRA 4UDTA 1T1XB 2GAZA 4D9LH 2X4QB 4FXLA 4HWEL 5FF6B 3BKYH 1UB6B 1ZHNB 5E5RB 2X6MA 7TAAA 1Q9WB 4NQSB 3QGVA 3R0NA 3UR8A 2J6EH 1H3PH 4KK9D 2C3HA 3GKZA 4IJ3B 1ISWA 3AMKA 5D1ZC 3MBXH 1T5XB 5E09A 3O2LA 1HQRB 4UU9B 3VD5A 5HYSG 1BFVH 1MFBL 5GJSL 1CZ8H 2R1YA 3VGHA 4BQ3A 3LKPA 2DQTL 4LF3A 3TNMA 5IWLA 4ZXBD 1PX8A 3VXUB 3WIHA 1J8HA 2Y1VA 2RHEA 1DSFL 1YUHA 1JGIA 3B8YA 3EYUL 4AEHH 25C8L 3OJ2C 3CSYB 1CBGA 1R3IH 3V6BR 2X4NA 1NCBH 5TJWK 1NGZB 1H0DA 3RWJA 1G84A 4GRMB 1XT5A 3ZKMD 5I1KH 2HVJA 3EYVB 1TVNA 1U95A 2W60B 3DXAB 1BAFH 4XCEA 5EU6D 1I1YB 5A8MA 1RJLA 3TT3H 3GBMH 3RZCB 3CSGA 1IGFH 3CFBB 4JFXB 5D70L 3D5HA 5F9WB 1WJ3A 3WQVA 1OP5H 2CK0L 1SVCP 4Y5XB 4GKSB 4DZ8B 5IEKA 4LLMA 3WO3B 2UY5A 3M8OH 1T5XA 4UTBL 2XHYA 4HAFA 4WWKB 4YDLB 4YGVB 1UZ6F 4HUUA 3RWFA 1NLBH 5FGBC 3W6LA 2YD7A 4NRZA 5IBLC 4F9PA 4OCWL 1B0GB 1X5FA 4LBEA 1T7ZA 4Y4HB 3CFDB 5CJOH 5EORL 4HPOH 4RGOL 3UROR 1V3LA 5M94B 1OB1A 3PUCA 4WFHD 5DK0A 2DQDL 2R56L 4TYUA 3UTTA 3ULVE 3W29A 3BKML 2VLKB 3WFLA 2WLYA 2WANA 4YX2L 1RMFH 1FFOB 5MP6L 1BEYL 3ZTJH 3ARFA 4PCSA 1CXFA 4NZRH 3GBNL 4GXPA 4X6DF 1TQBC 1XGTA 2AJSH 2YPLD 2IAMB 1W2VA 3DX6A 2R4SL 2B1HL 3BUYB 4PJXB 4PIRF 2I9LB 4P4KA 5GGUA 5C70A 2GUYA 2L0DA 4PB0H 1JGVH 4B9ZA 25C8H 1KBGL 1W8OA 3SGJC 1MVUA 2DT0A 2I07A 3MRBB 2CPCA 4R2GB 1L9MA 2CYGA 3MOAH 1T7WA 5FYKD 4HJGB 4PLNC 1GPOL 3FB5A 4OZFB 3V6FA 3TO4A 4Z7UE 3X3FL 2GSIA 2HJLA 2C4XA 4KMLB 4ODXA 2H32A 4I18B 4P5TD 2J8OA 4H20L 3BWAB 2H26B 2UUDH 4PJAF 4Z9KB 3S35L 3FN9A 4Y8DC 4MJIE 3I84A 3WFCL 3PQYB 1GGYA 1K8DB 4EUPB 4PJ7B 3A6BL 2NPLX 1DJSA 2PO6C 3RWIA 5INCB 1XIWD 2EICA 4BQ8A 3WEOA 3FB5B 1P84K 3HHRB 3PHOA 3MGOB 3ECBA 5B4MD 5I66B 4U1MA 5LA0A 3QWOA 3VXNA 1KIRA 3BESR 4XMKH 2BC4A 5CJBA 1J0YA 3A67L 2DSZA 2D31B 4Z2LA 3OLGA 1JPFB 3EO1A 2V3EA 1CFNB 1U36A 5MEOA 3ARGA 1PQZB 1EA9C 2CO6B 4JAMA 4WGWB 4LPCA 4WVRA 5GISL 1RMFL 2W0FB 3EYQC 3VD4A 4OZHB 3UTPE 2R2HA 5KANI 5HHOD 3QEHB 3BN3B 2V5DA 1DEEA 5CBEB 2AXFB 3QJHA 4PJ7F 1MJ7H 2B1HH 3WNPA 1Q6EA 5BXRA 2W5FA 2JIXD 4TVPH 2CHOA 3IDMB 4N0YL 4PMVA 4KRPD 3LPPA 2IAND 4R4FH 3MRQA 5I3DA 5FUZH 2FECL 3SPVB 2R2CA 1UWXH 3U4AA 1KPRA 2JIEA 4N9GA 2R4RH 3GJEB 1MCRA 3VFOA 4Y88A 2I5YL 3G04A 4V1DD 4JY6B 2YL9A 2WMFA 4ZOEA 2ZX5A 3GMRB 4X4XB 4X6CB 2EPNA 3MRFB 4QFUA 1I9JH 1A5FL 1CU4H 1HH6A 2DIEA 3QI9A 1PW3A 4HT1L 1DBJH 3GSVB 2BFVH 4OLEA 3UO1H 2EZ0D 2A1WH 3BO8B 3DSFH 4NKIL 4P59L 3DURA 4YFDB 3DC0A 3HAEB 2Y6SC 4LBEB 4Y4HA 1V6YA 1N59A 3MSGA 1A02N 5FGSA 5A16B 1FLTX 4JKPL 4HKJB 3U7BA 3HI1B 3W37A 1Z5LA 4NZJA 1J86A 4U3CA 4POYA 3L5XL 5FYJU 5FO8A 4Y5XC 4UIKH 3T4AA 4A4AA 1VA9A 5E56A 4JREB 4TVUA 2J1KA 4ALAL 1KPRB 1BQSA 1UENA 5LBSL 3VFNA 5IGXL 2HMIC 3BFOA 5A43C 3WF2A 2DSWA 1G0DA 3R1GL 3WXWH 4K3EL 5F7EH 4R8WL 2FBJL 1CBVH 3VIOA 1EUUA 2OMNA 1SFSA 3LS5L 3AU1A 3WFDL 4KKAD 3II1A 1I9IL 4HZ6A 3W2DH 2D2OA 1MQPA 1X9QA 1W1TA 5TQ0H 4U0RC 1ITBB 4H1LG 2H6PA 1CGTA 5CXPA 3VGGA 4JKWA 4JRYA 5EBGA 5ID1A 1I8IA 1OTSC 3RU8H 1UACL 2CIIB 1MYRA 1ED7A 4Z7OF 3DETD 5JPMA 4JFTA 5AG9A 4QCIA 3I6KA 4PLJD 2FWOB 1ZS2A 4MHHI 3V0WH 1N5AA 4M1GL 5JNYB 3VXRB 1S7QB 1N6QH 3DV4B 1S7XB 4J4PA 4KFZC 1Q4NX 1UCBH 4KHXL 1VFAB 4MXQC 2OL3B 4G8FA 3KYAA 3VRIA 1WO2A 1F8TL 2RFXB 1QBML 5D7LD 5DO8A 3V52L 5EWIH 1QSFD 3SQBA 4HGWA 1ORSB 1T89C 2BSSB 3IETB 1I8IB 3K7UA 4NKIH 3WIFB 4UNTA 3X11B 3VFPB 5TE6H 4XBPB 4AMKH 1R3KA 1S7UA 4LOUC 2ICES 4R9HA 4TTDC 1EPFA 3CFDA 5MHSE 4L4OA 3WUEA 3DROB 3IDXH 1BD2B 2APTA 3GMNA 1PJ9A 2XWJA 2CKSA 3BAEL 2YL8A 3WF3A 3L5XH 1UD2A 3MFGB 4MDOA 5JOFA 3ARYA 1EDGA 2PO6B 5DJZA 1IEHA 4E2OA 1UB5A 5I19H 2Z31B 2CNCA 3OG2A 4YAQB 4LEXH 5J12C 5ICXA 4C57C 3FW6A 2E6QA 5DFVD 2GFTA 4XB8A 1E6XM 5A8QA 3F5WB 5IMLB 1YNKH 1IGIL 2RIKA 4K3EH 4NQVB 3WEXB 4PJXE 1O7SA 3Q5YA 4N8VB 3TA9A 1J0IA 3T1FB 3RILA 1A6ZA 3HC3H 3RQ3A 3C60A 2ZOKB 5EMYA 1QSEA 3R06B 2AQ2A 1K85A 1L8NA 5FKPA 1FFOA 4XAWH 5LJYH 4JLRB 2EIDA 1BAGA 1UKOA 1GOFA 4NQSA 5AZEH 4QRPD 1JF5A 3HMCA 4JZNA 3DNKA 4PJBE 4NKMA 4ODVL 1US2A 1JN6B 1UZ8A 4QT5A 1R5WA 4RE2A 3WEZA 3I75A 1U58B 5FCSH 3H9SA 4UU9A 1IT9H 4HKZA 1ZGLP 4XAKE 4HK3J 3L5JA 2V2XB 5KSAA 2HISA 1AKJB 2XACC 1DWJM 3UJJH 1U8NB 4N5ED 4XMLH 1OSPL 3PWUB 4NQTA 3S4SG 4BUGA 4KWUA 3QUXB 3VWJC 4ELMF 2ZXAA 5H94B 1KB5A 1DWFM 1T4KA 4GXUN 1E43A 3CX5K 1R8LA 5GRUH 2QHLA 2GTWB 1H49A 1Q6FA 3RGVA 1QW9A 3NIYA 5FL1A 2QEJA 2WSKA 4G5ZH 3NCEB 2HVJB 5C6PB 3MRNA 3LRSA 1PQZA 4JAMB 4CCDA 3MFFA 3TBSB 3U6RA 1A7QL 3QIBA 2FEDD 3U7WH 3O6FB 4PGBB 5DJDB 1HJUA 3SDXA 4LEXL 3I2CH 4QWWC 3V4VH 1J8HB 1TZIA 4OGYL 4RNRA 2BOBA 1A9BB 1PLGL 1Q0XL 3HC3L 4S1DC 3U2SA 1BPVA 3P4MA 1A4KB 1A1NB 3ARGD 4GS7C 7FABL 4GG6B 1DLHB 1MHPH 2GSIB 1NWSA 4KXZH 2Y9RT 1MW1A 2CEQA 5CLWA 4X80L 1FIGH 2GUOB 4P4RB 3RM4A 1PZ5B 2BVPA 5D7IA 5I75B 1IC4H 2C3VB 3N1QC 4OCRL 4NWTH 1NMCB 5CGTA 1UD8A 4U0RB 4PS4L 4BSJA 1AH1A 5TE4H 4PV9B 5HJ3B 4MSWB 4LSVH 1MCWW 1RZFL 1IT9L 1CDUA 3DMMC 3NDYA 4U4BA 6FABH 2OYPA 3GSUA 5DFTA 2GJJA 5F97E 1W72H 2WWMC 4CNIA 2P1YA 1KCSL 4TSBL 5F8QC 2OYMA 1N7MH 3MUHL 4HGKC 4P5KB 5EZOH 3O6FA 3RL2A 4PJEE 1QVBA 1HNFA 5DHXB 4OCSH 4ZFZA 4HUVB 4OSUH 2LTQC 4GQ9H 2LV4A 4W93A 3VFUB 2EEDA 5FO8B 4PRHE 2FEEL 1QQDB 2VDOH 2RGSA 1UADC 4CD4A 4P5MA 3AS3A 2YD8A 3BE1L 1U91B 3KGRA 1DLHA 2QQNL 2P7TA 4NQVA 3SCVA 3DVGB 5TQ2H 3EJYD 1DQJB 4MDIA 4L29A 4G7YH 4Q0XL 1EO5A 1ES0B 4OUUB 1BGAA 4HXBH 2Z35A 1BQHB 3CSBA 5J3HC 1HSBA 1MEXL 2G5BA 3MBED 3ARFD 3MUGB 5J12B 4U1MB 2DLEA 1J1PH 4HKJA 3Q3GB 3BH9A 2PB1A 4NOBA 3ROLA 4WEMB 5IMMA 1EO8H 4OZIA 1U3HA 4PRDB 3G6DH 5IFPA 3IXTB 2BVEA 2X7LA 4MYWB 3GDBA 3H0TA 2YD1A 1U33A 2NR6C 2VSDA 3L6FB 1XV8A 5I2UA 2CIKB 5GGRB 1LP9B 3CLWA 2VDMH 1CIUA 1KBKA 1KCSH 4TSBH 1YZZA 2EDDA 5F7FA 2QPSA 3PXHA 3RVUC 5F3BB 1X5YA 5JPMB 5I1JL 4GQ9L 1TZGL 3SDDC 5ID1B 4WFHE 3TN0A 1NC2B 2PCPA 4JFFB 4QNPF 1FHDA 5F96H 4QCIB 3TV3L 4TTUA 2MCPH 2ITDA 4XCNB 1EHXA 1KEGL 1B4RA 3QUXC 3VWJB 1YYLH 3ZE0F 3MRKB 3KPLA 3P0YL 3POCA 2ZUQB 3BE1H 1JIBA 5JBDA 2QPUA 4TUOA 4LARH 4MAUH 5MEPB 1Q6CA 3QRGL 4FABL 3QNZB 3PIQB 1BIIA 1NBVH 4N0CD 3HZKA 4Z78B 5IW3A 1C16A 1GGIH 4K3GA 3TVMD 2XWDA 4F2MB 3X13A 2W66A 5EUOA 4D3CH 4Z8FH 1BX2A 1UJ3B 1B30A 2CKBA 5C71A 4WTZA 4ZUUB 5C0EA 1UVQB 5EU5B 3UYRH 3H42L 4NKOA 1JD7A 3KPPB 4K71B 1XSKA 1A6TB 1VPOL 5DVMA 1ED3B 1QBLH 4RRPG 1BFVL 5C0RL 5E95B 4C56D 2FHCA 3K2MC 5JHLH 1L7IH 1WICA 4KDVA 4TSAH 3MODL 1JPGB 3W39B 5F9JA 1TZ7A 3D48R 3MCKA 4BZ2H 2OZ4H 2H8PB 4XBPA 2GK2A 1UFUA 2XICA 1R3IL 1V7NL 4RFEA 5T1LD 5L0QC 1MFCL 3SDCA 1KB5B 2VL5B 3ILQD 5I75C 2MQCA 4EXPX 1JDCA 3G08A 1W2KT 3QXTA 2MMXA 1G7MB 4FLQA 3EOTH 4XHJD 4B0MM 1A7PL 3DMMB 4L4VB 4O58L 1CGYA 1I7RB 3BGMA 3KLHD 3ZKNC 4A2LA 4OLVL 3AOFA 4N1HB 2DLIA 5F96L 3OGVA 1MUJA 3BEVA 5CIPH 1UM4L 2F54A 1QSED 1VERA 3OGOE 4J3WA 5CKAA 4RQQA 3VIHA 3RWEB 4TPRH 5IVOA 3KYOA 1KENH 4PRWA 4YC2B 2VDPL 4OAWA 4EI5B 5KW9L 3HZMB 3RWGB 4JHZA 1DBBL 3RM9A 2UUDK 3RDTA 3FO9B 3LCYA 2NY1D 4HBQA 1DBAL 5F1KC 1JXJA 4H88H 3D3VE 2WAGA 3C6SB 4H5SB 2OQJB 3DIFB 4AM0A 4D9RE 1LO4H 4RISL 3MROA 5HGDA 4D9RD 5BS0B 3GEWB 2BRRL 3HE6C 3EO0A 1TFHA 1I8LC 4CU8A 1CICB 2AJSL 3SKOB 1ODUA 2YLLA 5FA4B 5DK0B 5C0NC 1ZVSA 1ADQA 4MTVA 3GMLB 2YXMA 4M43L 3HS0B 4XBGA 4JFOB 1G7MA 3MRLA 5J9PA 3WF1A 5KSUB 1KB9K 3DGGA 3Q3GA 4U1LB 1MI5D 3P9MA 3VGAB 3NZ8A 3D18A 3DRQB 1ZS8B 2GCYA 3WFEL 5D8JH 2KDGA 4JFPA 1R3KB 1S7UB 1ZOXA 3HNTL 3ROOB 3UBXB 1UM6H 3L4UA 1KUMA 3B9KD 3FQWA 3WL0A 2X7LB 4MDJA 4RZCB 3KPMA 4JL1A 4MNGB 2GUOA 4P4RA 3M17B 1P1ZA 3MUY1 5IB2A 4ACZB 4KU1A 1GHSA 5E2WL 1NFKA 1GGBL 3U82B 1JWSA 2FJHA 4P48A 3PHOB 5DRWB 1U8HB 2A73A 3ELAT 2XFXB 3BOVA 5DJ0A 1XGPA 4OD1L 3QCTL 1ODAA 5H37H 4AIEA 1VACA 3NOIA 1CICA 2XJ7A 3B3IB 2I60H 1F00I 1JCKA 1BG9A 2XA3A 3VGBA 3N9KA 4GUPB 4Q97A 1YEFL 4P5KA 5I1EL 4LYRA 2NY3B 2E3ZA 1JNLL 2CDGB 1CD0A 4IRZH 3CZFB 3U0WH 1WK0A 4K23L 2DMBA 2KKQA 2FO1A 3BKJH 1UQZA 3ZIZA 1MLBA 1MQQA 1EEUA 2F54E 4HOXA 1LO4L 4HIHB 4RISH 5FYLD 5MEPA 3KXFD 1AGFA 1YEDB 4HOWA 3FJTA 1EXPA 3SCMB 4I3GA 2QMKA 2Y7QB 4N8CH 3PP4H 3QUMA 3QZWA 4NN7C 4ODHL 3EO1B 4PY7B 3PHAA 1M7XA 4G7VH 2B1AH 4M48H 1HI6A 4Y16C 2WC4A 4HG4K 2IQ9H 4WGVB 3P4LA 1B88A 1B31A 3BAXA 3MUGA 1Q38A 2R4RL 4JQVA 5JW4R 3L4TA 1PZ2A 5DJ0B 1T2JA 1UEMA 1YDPA 2A6IA 4OCXH 2D20A 3CD4A 4X9GA 5ALCL 5IB1A 4JO2L 4ZDHB 2AJVH 4TRPL 2QSQA 2YIHA 3ZJ6A 4OJYA 1T7YA 1MCBA 4YXLH 1FA2A 3IXTA 1K8IA 1CFSA 1RD6A 1TA3B 5BRZE 1OAYH 3ARQA 4OF7A 4PP1D 1UD4A 3T0EE 3M45A 5J11C 3IRPX 2KUTA 1I85A 4N0UA 1P7QD 2ATKA 3QCTH 2WBJD 4PJ5D 4WI6A 4YHLH 3S98A 5C7XH 4EK7A 2HN7B 3VXQA 4GI8A 3A3HA 4QGTA 3VA2C 2XWBB 5IB4B 4XTRC 3GH7A 2F53E 4JKPH 4NQCB 3F62A 4P23A 5JBEA 3PF2A 4UMGA 4X98A 3WBAA 5D1XD 4JN1L 2EDOA 4XVUC 1ZANH 1UHVA 1G9HA 5BZWB 4H25A 1LE9B 1FO0H 3UPRB 1TR1A 4YC2C 1W0YT 3FT4B 1UWRA 3OR6B 3RIFF 1BZ9B 2W0LA 4MQXC 2A3CA 4O02L 2DS4A 1BD2E 3WJLA 4PMQA 1QLRA 1DLFH 1MWOA 2LU7A 5HD8C 3CHDA 4PR5B 1YUHB 3OKKB 3B83A 4M00A 1JPTH 4XH2A 2D31A 5F7LB 4MA8L 5LCVL 3SBWA 2EKSB 3MRCB 3BIBX 4HBCL 2VN4A 3VXPB 2NYYC 5TDPA 4LGPB 1HCFX 1NMBL 4HUVA 3V6ZA 1FCGA 4HKZB 1ECEA 1Y6NR 4DKDC 3AMLA 2XPGB 2Z4QA 1QUNA 2M8XA 4P9HC 4U49A 4LVNB 3C8KA 4X6FA 5B8CB 2RJMA 5FDWA 1UYWH 2FJHB 3SE9H 1DQLL 4RWHA 5DRZB 5I9QB 5SWSE 2HT2C 1FC2D 2GYSA 5I76A 1GGUA 2FHFA 1WTGT 4D0BB 3MRNB 4GPNA 1IAOA 3KR3H 3SCRA 2XTJE 2YKLH 5E2TH 4ZD3L 4QHUA 4XNUH 4K94L 5GRJH 4XNYL 2V9QA 3QR3A 1IBGL 3CMOH 1OD8A 2J62A 3BH4A 3AI0A 4QY8A 3LZFH 1ZLSH 1N8ZA 4NPYB 4AL8L 4AJ0A 4V28A 3BN9D 1RK0B 12E8H 2XRAL 4RIRB 1LO3L 2F58H 4Q6IB 2XWJB 5ID0B 2A74B 1J0KA 2VZ3A 1X4YA 2DL2A 1HWHB 2HRPL 3MJ8A 3N12A 2IPUG 2Y07H 1AC0A 1JPSH 4P8XA 4L3EE 5HBFA 3X14B 5T1KD 1LO5B 3GRWH 4QO1A 4QYOA 5KVFH 3ZJ8A 3KWXA 3QEQD 3JV0A 4H26A 4MQ7A 1YECL 3OXSA 4RMUA 4M29A 3WQ5A 4NJ9L 3SCPA 3NACL 4CD6A 2CK2A 1EERB 3A4XA 2EIZA 5DD3L 3AAZA 3EGSB 4WHTA 4M8UA 4GKNA 2BNQE 1F6FB 2A3BA 4NN7B 3MMWA 1P6FA 1T04A 1SM3H 3GIZL 3OZ9L 4PJBB 3S36H 1OW0A 3MACL 1KQZA 1U8NA 1YEGL 3EHBD 5C0DA 1M05A 2Q8BH 5BXFB 5T3XE 4LVOB 5AYUL 4Z7VE 3OKMB 3CK0H 5GSVB 1MPAH 4Y4KA 5I18L 3WELA 5K9KA 1C8XA 1QD0A 1W9BM 1U6AH 2IH3B 5A94A 5CSGA 1OF2B 3L7EA 4CAGA 1KN2L 4X7SH 5JW3L 3MJ9A 3QUKB 1NEZG 2E4TA 5FO7A 4H7VA 4PJBA 2ZUUA 3FFDB 2YKLL 3W0WD 2BVQA 4I3SH 3RL1B 3UG4A 2DQCL 3G6AA 1YY9C 5HDLA 3X3GH 2XI9A 1ZEAL 2OI9B 4LLDB 1ETZB 4H26B 3MJ9H 3KPOB 4MQ7B 3NYDA 3V0VA 5J11B 2ZOLA 4Z95H 1I1CA 2JJTC 4G8EB 1XC6A 4R5EA 5GGRY 4EUPH 1AHWB 1IGCH 4XP1L 3TZVD 1CL7H 3VG0H 4EAMA 1PKOA 2Y5TB 3GKWL 4HLZH 1EGZA 5IW1B 3BJ91 1E5JA 1CE1L 2Y23A 1YEEH 2XYLA 1N2RB 4HJJL 4NCC2 4V1DE 4KKBC 3TIDA 3WD0A 4KTEL 1HL8A 3ZO0A 3RJYA 5DT5A 1Q0XH 4B5EA 5HGGS 1I8KB 3ALGA 4BFIB 1FAIL 4HWUA 3FXYA 3DTXA 3L3JA 5B3JE 2QSVA 4EKJA 2VXTL 1A7OH 3CFEA 1MHPL 5HY9B 2PYEB 2ORBL 4OLZL 3ZDZF 5E03A 3GIZH 3OZ9H 4X6FB 1IM3A 2YN5A 4W7UA 4FLOA 4Z2GA 5SV4A 4XRCB 3DI2B 1CYGA 1U8QB 1A6VL 3CXDH 3NCOA 1AQHA 4PJ5E 4FMKA 5SX4I 4ZXLA 3RGHA 2DBLL 2XGIA 3MUJA 2O61A 3VXMD 3PWJA 3FO1B 4GRWF 3W0KA 3S4SA 2JLLA 1PSKL 4RGMB 3RZWA 3VE0A 1S9XA 3GM0A 4JZNB 5TF1H 4XBEH 1FNHA 3E3QE 3DX8B 3ZQ9A 2DSVA 2G3JA 2Z1SA 1BMGA 4L8SC 2RTSA 2RCSL 5D1ZA 4ZS7H 2R23B 4KI5C 4MXWH 3VIMA 3QISA 1DDHB 5E1AA 4B53A 4DUXA 2X41A 3GHEH 3VFNB 1RUAL 4XGZB 4Y1AA 4H25B 1LE9A 1KV3A 2W9DH 3HE7D 4HCRH 4XT1C 1EMTL 2G75A 1XF2A 1JGUH 4OKVB 1PFCA 5I77A 3MJ8B 2D3VA 1FV1A 3WYRA 1PGRB 1SBSL 5F9AC 4RA0C 4C56E 1R7OA 4M1DL 3BH9B 1D5BB 1D5XA 2HN7A 2PW2B 2XQYK 1QNOA 1G7HA 3V5DB 2WWDA 2X0YA 4GQRA 1DQQA 2A9NH 3LY6A 4PJ9B 3IU4L 3TWCH 2XA8L 4JREC 3VH8G 4F7PA 4K7PX 1MELA 1MEXH 5E8PB 4N9GB 4AD5A 3HR6A 3GMNB 3EDFA 2WBWB 1E27B 4L29B 2CUIA 2WINB 1Q1JH 4OKVA 5JQHC 2QKIA 3SDXB 3C08H 5JR1L 2OBGA 4NM8L 1E1EA 1EO8L 1CK0H 4OF0A 1OGTB 5DS8A 4MB5A 5CIPA 4IS6B 4H41A 1HHHA 4FK9A 1K8IB 3GSNL 1NDMB 1M7DB 3I02B 5F6HI 4YEEA 5D9MA 2YPKA 3SQOH 4Z7WE 3D0LB 2V5RA 2VITA 4NUJA 2P5WB 1P4BH 2RR3A 3AXHA 1IV8A 4QLRA 3VDHA 3ARTA 5C8JA 3IFNH 3WSQL 4CVUA 1A9EB 4I9WD 5EULV 2OJEB 4RMVA 3PL6D 1UT9A 5CSZA 2WPGA 2UZXB 4C55A 1CQYA 4MSWA 2QR0A 4MJ5A 1N6VA 2EE3A 1FBIH 4GRLD 3QO0B 1YYLL 3STLA 4M4RA 5L2KB 5ABGA 2HP4A 3ZDXF 1JGUL 1DQMH 1N0XH 2ADFH 3E0GA 5I78A 5IK3A 2F8VA 2QKIB 4UDUB 5BROA 3F58H 1NFDA 5D4QA 4FQ1H 4ZO6A 3QUYD 3UTSA 3HE7B 4D0BA 1IMHC 2NTFB 1E6SM 5FYLL 4TVPD 3PQYE 1W3KA 2VX7A 4OD2B 2G4FA 3OGCA 3BP4A 2DIAA 1F2XK 4OD3L 1YMMD 4WI4A 5C0BE 1Z5LB 1YEHL 3KPSE 2HJKA 4PJXF 3SO5A 4FQQA 2ESVB 4FOMA 5F88B 4ZUSB 2H9GB 3C8KB 2APWA 2BNRD 3UYRL 1Q1JL 5C0IA 2V2TA 4D6EA 5CEZD 4NM8H 5FYJD 3PBGA 3EO9L 4F2MA 4OZGB 3IT8D 4IRJC 4W86A 1JGLL 2BY2A 4G80A 1U95B 2W60A 5GNXA 5C08A 1F4AA 2GSJA 3RPMA 4J8RA 1CGWA 3WJLC 4FXKA 4HMCA 4XPTH 4MB3A 4J3UA 4LSRH 4D0DA 3QPQC 4EN3B 4CJ1A 2OZ4L 2G9HA 3PWPB 5IB5A 5F71A 3BSZH 1A6WH 5JPNA 2AMGA 4XX1E 4JPWH 1WBYB 1P4BL 3QEUA 4P3DA 3RTQA 1KCRL 4G6ML 1QSZA 4WWKA 1C12A 1UH2A 4W88A 3JWDH 3V79C 4YFLF 5ENWA 1EHLL 4XPBL 2ARJQ 3ESUF 4JPKL 3KDMB 1FFQA 4ELMA 1RHHA 2YMXH 5I16A 4HQQH 1RUQH 3PHSA 5BVJB 1Q9WA 1G9MH 4H8WH 2VURA 3KPTA 3TZVB 1KENL 1JGDB 1R3LB 5SWQA 3MYJA 1YEDA 1BIHA 1MFNA 3GFUA 3AIWA 3VXSB 2AJYL 2J79A 5E8DL 5D7JD 5FKYA 4Q9QH 4OD3H 4Y4KD 3WH8A 1B0WA 1CFTB 3CC5B 1D6VH 4YQXL 3OKLB 3SUVA 3F7YB 1D7FA 1CLXA 3TCXA 1VGKB 4MD5A 4WKHA 4LLYB 2AXGB 2G2RB 1AHWA 5BOZG 3FNDA 1MFBH 1ADQH 2X70B 5HPMA 2DLFH 4L4TE 5I74C 1F90H 2BJMH 1YEIH 5F72S 4YWGL 2WHLA 1VFBB 2AERT 5EIVA 2D7MA 3OG4B 4PB9L 3AREB 2OCFD 4MAZA 1RZ7L 4Y4HC 3VNZA 5L9DL 4KUCF 1QFWH 3RM8A 3V6OA 3CC5A 1DE4A 5EN2A 4AEHL 1CDGA 3FB8B 1NP2A 3O9WC 2FJGA 5HVWA 1IEBA 5KSAD 2HT3D 4FZEH 2J8UF 4PJ8B 4ZSOA 2X1IA 5ACMA 3TH4T 4YK4C 1F3DJ 3ULUL 5DJXB 1RZGA 4FP8L 1TQBB 1CN4A 2IUZA 5TDOA 4B7LA 3TCLA 4WTXA 5IHSA 4Y7MA 3PN8A 1J8HD 1GOQA 3OWEA 5J6GA 1DN2A 5F21B 1M05B 3VH8A 3MZTA 5D70H 5EBMA 5EUOB 1ZGLB 5D2NA 1RUQL 1E71M 3MV9B 2ZUXA 4ONHA 3LKOA 1FIEA 4FA8A 1RJZA 5DD0L 1JYVA 2O61B 5EZLA 1GHFL 1QHPA 1CLZL 4GMSH 4APQC 5BZDB 4LLUA 1J5OL 3EDDA 1YQ2A 3EBAA 2QADB 3THCA 2IANE 3QI9C 1CTNA 5AC5A 3G5YB 5K9QI 2ED9A 1L7TH 5HDOA 3B4NA 4M4PA 4YX2H 3LDBC 2F5AL 3SCTA 3I9GL 4NQEB 4M7LL 1QLFB 1VCAA 1OGAA 4FFYL 1JMZA 4OJFL 3QO1B 5L88L 4HJ0D 5A2AA 1EBPA 2DLFL 3ARDB 2B1AL 5CLTA 1YPZF 1SEQL 3ZJ7A 4X0NA 2C1PB 1S7VA 1G7QB 3MRHA 2F53B 4WU5A 1D5BA 5JPNB 5EO9A 4JFYB 5E24E 2J74A 1FH9A 4GO9A 5I6SA 2VC2L 3TYFA 2YKKA 2JFEX 3QFDB 4N42A 1L0XA 4JO4L 4HS8H 1MY5A 3MNVB 1ND0B 5GJTL 1JZ2A 3KJ4C 4Z2HA 3LEVH 2GJZA 4BK5A 4CCCA 4FFWD 2JELH 3TOPA 1MW0A 4H20H 4GG6F 4P9MH 3GMOA 4DM1A 1PG7X 3RDTB 4M61B 2OXGA 5DFAA 4OGAC 3VGFA 4GRLA 3MJ7A 2MFNA 1H15B 2ZKHL 3O11A 4ONGH 2R2EB 2JK5B 1QRND 2PXYD 4PJ9A 5FM8A 5C0BD 5ESVA 2A6DB 2XZQH 5K33A 3OAYH 3QDHA 4MADA 4B50A 4NWUH 1KXVC 5C09B 4M5YL 4C59B 4Z76B 5GRVL 1UD5A 1I7TB 4JQXA 3O4LE 1UGNA 3S5LG 3MNWB 2W91A 1Y7VA 3GH5A 3BZFA 3LQZA 3BD3A 1L7TL 4XP5H 1B3YA 1P6WA 2VDRL 5HHME 4U6YA 1MJ8H 3IETA 3L9RB 2DAVA 3VD3A 2H6PB 1ISVA 5GS3A 3I6LD 4OOUA 1DDHA 1MLCB 1OT2A 3MRQB 4OCYH 5D7LB 5E1AB 2XVKA 4O02H 4WDIA 2GT9B 5GIRB 3L3GA 4X7TB 3MV7D 2OWXA 5KN5A 1A6AA 4YNYB 3A4WA 2PNDA 1N5AB 1QA9A 1FZOB 3T0EA 5L2JB 5E08L 1S7WA 3L3DB 4MA8H 4AD3A 5EDXA 4QRRA 1I7UB 5JIHA 3T09A 1WFUA 3FMGH 2XKNA 4XWOC 1DL7H 3DX7A 5IBTL 2FHBA 2JK5A 4JFUA 1R24A 2F15A 4ZFOL 2JB6B 1I1FB 3GNML 4JRXA 2OJZH 3E3QC 3I6GB 1URLA 3GSNB 4ORGB 1N59B 5ITFB 4GINA 3DROA 2FJGB 1C1EL 3O9WB 2WHJA 2WZHA 2VB5A 4PJ8C 1ZT1B 1P9MA 1UR0A 3QDJE 3QIBD 1T22A 2R0LH 4YK4B 4ZQKA 5I1GH 2ZOXA 5DJ8B 3AUVA 2GJXA 1R24B 1YC7A 4NQXA 5DJCA 1JAEA 2EO7A 4YXHH 5IROA 5KJRL 1S8DB 3IDNA 3IGAA 4JRXD 5SWZD 2EC9U 3A0OA 1TCRA 3B5TA 4X5XA 3REWA 1MH5A 2ADIA 2ITCA 5KVEL 2YRPA 1MAML 4MAYB 2EXYC 1OGBA 4OFPA 3RY6C 5T3ZD 3T0EB 3SUWA 4XP9L 3BP6A 1EUTA 1OCQA 1E6NA 5T3ZE 3EMZA 4L8BA 2Q76B 4GG8B 2FLRT 5ACZA 4KROB 2QSTA 4APQB 2LQRA 4OCYL 5HGHB 5CILH 1WGOA 4R7NA 2XG4A 4HG4J 1HXMA 2FBJH 5BVJA 5CSBA 3WFBH 1CBVL 3GYCA 3G5YA 3OB0H 5DDHB 1YY8A 3HUJE 3F6IA 3GSXA 5EH1A 4QRPA 3HFMH 1JK8B 4ODUB 5IFAL 3UJIH 2EDYA 1JUFB 2VXUL 2XQBL 3A6CH 5EC1B 3TJEL 3AIQA 2V2XA 5KSAB 1MRCH 2IH3A 2AEPH 3H3PH 3MA9L 1H9VA 1JV5B 3C6LB 4NBXB 2ADJA 2BSRA 5GNZA 1NARA 1E28A 1R5IA 2JIXB 4UILL 4AWEA 4M1GH 1GONA 5LGHH 3MC0A 4JFEE 3UCQA 1G6VK 3KPRE 4GKSA 4DZ8A 4KQ4L 2X1XR 4UT9H 3FT2A 3N50A 4NYLA 1U8JB 1SYTA 1EO7A 2BNUB 3PDOA 4LLDA 5I1GL 3PWLB 1X5AA 3OF6D 4XGZA 3AYSA 4WK9A 2GEEA 4WW2F 4RFEB 1BBDL 1BFSA 2FIRT 2WP3O 3N9GH 4ENED 3VDCA 3RPIB 4LL9A 4Y4FA 5D1QA 5M17A 1GOHA 3TEUA 5D4YA 2A3HA 2NY1B 4UNIA 1F02I 3RDTC 1TITA 4NNPH 2X4SA 4GAGH 5ECJE 1OAKL 1MAMH 4JM2D 3DRTA 2W1NA 1ZA3B 5K59F 3T3PF 4D9QE 3A47A 5M95B 4PMOA 5I6XC 1FNGB 4GBXA 4OGXL 4PY7A 1G6RL 3GMPB 5BJTA 3FQRB 4JFEA 3SKOA 2Y7QA 3W5NA 4P4KB 5BV7L 4D71A 3D0VB 3O45B 1QNRA 2NY3C 4DCQB 2J4GA 5IDIA 1HI6B 1YNLL 5D9SB 5JOFB 3IAQA 3HUJB 1E9LA 1UG9A 2YPLE 1AGDB 4FNLH 4UT7H 4W8AA 1JZ7A 3WV0A 3OHXB 1IE5A 4MA3B 3QUZA 2WCSA 2IGFH 4ELKA 1KJ2H 1MWAB 4XAWL 1G5AA 3OG6B 2ORBH 4F79A 1AIFB 4TVPE 4EXKA 1W3HA 4R7DB 1IC1A 4AD2A 2DT3A 1JZ3A 3LKNA 1JXKA 1LWJA 5T1KA 4Y16B 5A2FA 4XI5C 5IWLC 3RAJH 4M56A 1IKNA 1S7TA 4M61A 4ONHB 3RWIB 2AAAA 1I9RH 4NO0B 4PTTA 1B2YA 1C5BL 5HHXL 1AVAA 5F7MC 3RWDA 4QT5B 4FHBD 2FL5B 2DLGA 3UEQA 4QHLA 4HXAH 5TF1L 3O3BB 5CUSL 5ESQA 4ONFL 4YPGB 4HWBA 5CP7B 3TJHD 3H9HA 1IEBB 4IOIA 4Y4HD 3GMMB 4RMQA 2OK0L 1LD9A 4RMRA 3VFWA 1FRGL 3QUYB 4JY5L 4HIIA 2BK8A 3OR6A 4BUHA 1EV2E 3GHEL 5T1MA 2ZX8A 1NMCC 1B4JL 3KYKH 3RIAK 3QIUC 4MJ2A 2VO5A 1QNZH 1H15A 4OLXH 4LAQH 43C9A 1SBSH 5L8JB 1BHGA 1VFBA 2GITA 3S88H 1S7VB 5F88A 4ZUSA 5JORA 3QCVH 1HKFA 3SPVA 5CEXB 1FZOA 4OQ1A 3VRLF 4I2XA 4LPTA 2FDMA 1MFAH 3MLVL 1A1MA 4YHIA 2XA8H 5B38A 4JG0L 3WQ4A 4GW4B 2F19H 1Z0NA 1CGXA 1RVFL 4W8LA 1T89A 4NNXA 4L8CA 4NKDB 3BLPX 1C08A 4XPAL 2XN9D 4LSQH 3DPBA 4MLSA 2OTUB 5LWYL 1RZJH 1W9XA 4PD4J 3KE0A 1NQBA 5FDWB 5B8CA 2BVDA 3DUSA 3L5HA 3P4OA 3MLYH 3VVGA 4OCRH 4LHQB 2EDEA 2A74A 5EBMB 1ZGLA 2WVTA 1AKJA 1LQSR 5HHOA 3DYOA 2WW8A 3LKOB 1WDQA 5KOVC 3SUSA 3RO8A 3O3AA 1X6NA 3RJDA 4AZ8A 3BXNB 2DTMH 4OI7A 1F97A 1DN0B 3WD1A 5IQ9A 1OSZA 4LVNC 1HJSA 3OKDA 2VH5H 2XWBA 5IB4A 5IHBA 5JQ6H 1KG0B 5FV2A 1SMAA 4YHML 2VCCA 2YPKB 1G7PA 4HEPG 3RMEA 4QGYA 3MREA 3G5XA 2ID5A 4AIXA 4ETQB 4PV8A 1JRHL 4NHUA 5E0FA 1UOKA 1FN4A 1ITXA 5CGYD 3OMZA 2BVOB 1FBIL 1DWHM 3UPRA 2PTVA 5C92A 2E40A 2XIDA 2AXFA 3EOAA 4HA1A 1I8MB 3KYNA 1EEYB 1NH6A 2C3XA 1JTOA 1IGJA 3LMYA 2QQNH 1G6RB 2AAVA 4HMDA 3S88L 3R8BB 1E4IA 2F53A 3LEXB 3ARBB 4LKXB 3RBSA 2CRMA 1G1CA 4PREB 4P2CG 4P57B 1CZ1A 4PJXA 4JG0H 4N0UE 3KWWA 3ULVH 4PRHD 3UPCA 2DH3A 1KFAL 1J1OH 4P4KC 4X6DE 2EDLA 4Q6YA 3CHEA 2FWOA 3AS2A 1MCJA 2AJ3B 5I2IA 4M82A 4YDJB 3VU2A 5ALBH 3U5UA 2P42B 2ZSWB 4CL7A 4K94C 1NCNA 1UB6A 1ZHNA 3OSKA 2CDEB 2EXWC 3V0AC 5F7HA 3RNKB 5JIWA 2F74A 4W84A 3T1WA 2R23A 2ZSVB 3WDIA 2JF7A 3QPQD 1VADB 3OKNB 2CBUA 1RH9A 1T7XA 4PMRA 2AK1L 1ZB5A 5B39B 4XCCH 1LDPH 5TDPB 1UJ3C 4Z2JA 1HH9A 1NJ9A 2DQEH 1KF9B 3PXJA 5KSVB 3JV4A 5FYKL 1D9KD 2VDQH 5JZ7D 5HTSA 3BPCB 5CG0A 1QVOA 4K71C 5JW4Q 4HLZG 1TJIL 2OTWA 1E3XA 3MCG1 1H11A 5L8LB 3TH2T 1KC5L 3KVQA 1VB9A 3NJ3A 3POHA 2DKSA 4G8GA 1UH3A 1VEMA 1YJDC 1BG4A 4PRPE 2NXZB 3QHNA 2HTLC 5EO0A 4A3HA 3EYVA 3PG2A 1RK1A 3RJXA 4HA4A 4I5BB 3JVGC 4XI5D 5DD1L 3V8OA 5BRPA 2N7AA 1KB3A 4MD0A 3MLZL 3QOKA 3QUYC 5J1SC 1VESA 1C90A 3QEHA 3QRGH 3PWLA 5ILTH 2V5CA 4MNHA 5B38B 4W5UA 1IL1B 1I8KA 1FYTB 3QIUB 4MCYB 3TO2B 3VNYA 4ZAKC 3T0ED 1AHWC 1TJHL 1YJDH 2CITA 1D5ZA 3NABH 5JUEL 4MAYD 5C0AB 5D5MB 4D3CL 4F15C 5CJXA 1BZQK 5JHDD 4AZ5A 2GITB 4YGVA 3PNWA 3QUXD 2YC1B 4E8CA 1F58L 4IEFB 2D1ZA 4HUWB 1X5GA 4K07A 2WIIB 2EYRB 1U8LB 4HKXB 1NFDB 1WZKA 3WMBA 3QIBB 1QBLL 3QHMA 2W67A 3X13B 1RUKH 2PR4H 4PGCA 5AYIA 5FK9B 4NHCL 1ORSA 4HGWB 5HGBB 1RZ7H 1YN7B 4WFFE 3ULSB 1IAMA 4BZ1L 2D4DA 4HIHA 4PJEB 4WFFD 4Y2DA 4ZFOB 2MQ3A 2C1OB 3U1SH 4DW2L 1KJ3H 1D5MA 4LPWA 2EO9A 5FXCH 1MHEA 3TPUB 2FX9H 3NFPA 2VVNA 5D1ZB 3FT3B 2XKUA 3R4DA 5T1KB 3LN4A 2YD9A 1ACYL 4O58H 4R7DA 1KB5L 4L8BB 1KC5H 3HE6D 3L2MA 2BRQA 4YDIH 3LRHA 2WCGA 2P4AB 3WFHA 1T21B 3V7AG 3VGAC 3GB7A 1NEZB 5E5UB 3E6FB 3UJTH 4NRYB 3UTQA 5DJ2B 5I1HL 4JFDD 1W9DM 1CD9B 2G60H 4NQDB 1F4YH 3MV7E 4PJFA 4I0CC 2J88H 2ZX7A 3HZVA 1W1PA 4JDTH 1N5YL 1DBBH 5C08B 4AG4H 4RQQB 2WC3A 4KK6D 1ONQB 1QZ1A 5I8CB 4MNMA 5LGJB 4UAOC 2GCYB 4HK0B 4M02A 4OB5H 5MENE 2P24B 2IC2A 1D2KA 4GRLC 1NAKH 3D39E 3P9MB 3KL3A 4OI8A 3PTKA 4WNQB 1DQDL 2PC8A 1GXEA 2D7TH 5AZ2H 4GBXC 4P57A 1YPZE 1ZLVH 3BHBB 3PGDA 2HLAB 1HX0A 2DH2A 4LNVA 3EDEA 3SCSA 1AO7D 3RDTD 4LPVA 1Z32X 3VXRD 2ZG1A 1ZMYA 2E6PA 2K9UA 3KPSA 2NLJB 5E94A 1L9NA 4YPGA 2Q8AH 2KQNA 1O7VA 4Z5RA 4PMXA 4BH7B 2JJUA 4MD4A 5GRXG 1A7RL 1AGBB 3BZ4A 3VW3H 4AIZB 5GS0D 3DGGB 4U1LA 1WDSA 1N3NB 4ATWA 2R1XA 5CCKL 5BXTA 5IMMB 4LMQI 2VLJE 2JELL 3SDDA 5DUBB 2FZ3A 2LVCA 1GC1H 4G6AC 4UQCA 3K8MA 2DQFB 1C8YA 4DEPC 3RVWC 4MAYA 4ZUVB 1JMXA 2C5DC 2E8ZA 5A3HA 1JF1A 1T5WA 1PX4A 5E00A 3FRPG 2E5EA 1NCAH 1XGQA 2R1XB 2QJDA 1NLBL 1AGFB 1LWHA 2NXZC 4JDZA 3NAAL 3MJ7B 4G9FA 4NBYB 3L1OH 4UFIA 1AMYA 2ZUTA 1I4FA 5A8PA 4HH9B 3ALXA 2W38A 3BKJL 4NQDE 3DX9A 4OZGA 1PDKA 4KI5F 3QXVA 2FEDC 1SJXA 1OHQA 4KY1H 1WWAX 2OXHA 3QIWD 3HE7C 1FVCB 2YLAA 5MEQA 3F5JA 4LQFH 4MVBC 4HGMA 4OV5B 3AROA 1LLOA 5DJAA 4HUXA 4ZAKB 3T4AB 2G3IA 4XNQA 4YBQC 5A2KH 3BEWA 2R8SL 1XH2A 4LHUA 5T3XH 4HS6B 3VJ6A 3MLTB 3BZEB 2CHNA 4H0GA 2QQLH 1LO0L 4KVNL 5LXGH 5H2BB 3NIGE 5JORB 1F45A 3MU7A 1R5VB 1WSST 4WKAA 3MLRH 3OBAA 3QIBC 1RJYA 4M03A 1LWRA 1H09A 2VRKA 4MNGA 4HV8A 3M8OL 2WZEA 3DXAA 1HILA 3GXFA 1FHGA 3U0WL 2NNAB 3HZYA 3P9WB 5CJOL 3WD4A 1PBYA 2EDXA 4TRPH 1RIVL 1ED3A 4M6OL 4P5MB 4D9QD 3NA9H 1S3KL 4UQDA 3REVB 2DEPA 1F6AB 4PJCF 3RCNA 1LNUB 1B3JA 2P43B 4YXLL 2CLZA 3EJZC 3QDGA 3SKJL 5DEZA 2BS9A 2HFTA 1ERNA 4M7ZC 2AK4E 2P5WA 1S78C 2BHUA 2W9EL 4OUUA 1K6AA 1OWQA 2PWFA 2VQ1A 2VISA 3DUHA 5D7JB 4LVHC 1QNQA 1CTOA 4BSVB 3ZDXE 3HN3A 1JWUA 4CGTA 3FO0L 5E8NB 4NQDA 1FFNB 3OJMB 5I9QC 1EJOL 3TZVC 4ZYKB 3L4ZA 3VTRA 4DK6A 5E8EA 1KELL 1CR9L 4FS0A 4O2EB 3CTTA 2MPAH 4M8QA 5IT2L 4OF3A 3X3FH 3VD7A 4OLYH 1OY3B 3KS0H 5F9OL 2VKWA 2W0PA 3ZR6A 5HI4D 1NJ9B 2C7UA 4U1IA 2D24A 2B0SL 2WUBH 2C1OA 1MRCL 1E40A 2H41A 4YXKH 1D5ZB 4FQ2L 3O11B 2UWEB 3PABB 1RULL 3KLAA 5E6YA 1E1FA 1BQHG 3NCJH 3O0RH 2L4OA 3SJVB 4M1RA 1RIVH 4JKKA 5E94B 3QHOA 4JLRA 4U3AA 2CH8A 1I8MA 4DGIH 2WMHA 1T2QH 1WEJH 3D3VD 1F3DH 4D6DA 4WU5B 1JHTB 2MKWA 2A1WL 3RIKA 1TENA 4F8XA 1XFPA 1JYNA 2ICCA 4G3YL 1NMAH 4KV5E 1U8KB 2J4WH 4F7TA 3QWRA 3F5WA 1OSEA 2UZYB 4QCFA 1AXTH 4Y16D 4UNUA 2GJ6E 3SJVD 4DEPB 3LZFL 4WY7H 1YMMB 4YBQD 5I8CA 2B8OT 1CI5A 1K2DB 1ORQB 3EMCA 4LASH 1QP1A 4MVBD 3WN5A 4PJCB 4B15A 2YK1H 2GJRA 3SE4A 1JJUA 4U1JA 5L2KD 1S9WB 2F58L 5DQJA 5HHPA 1QSVA 5IGXH 4UFMA 3R1GH 3LB6C 5DMYA 4C83A 4WUKL 4OLYL 4HH9A 2OTUA 4PG9B 2BNQA 3WBDA 1OTTD 3PZ9A 1SYSB 3FB6A 4Y7EA 1K3ZA 1T0NA 3BDXA 5A6SA 3SOBL 2YUVA 4Z76A 5KSVA 3UO1L 3T0VA 2XFFA 1T03L 2B0SH 3FZUD 1EFXD 5D7SL 5GGTL 4APQA 1JDAA 2R29H 4AC1X 3PTMA 3SGKA 2IPTH 5C0AA 3WIJA 3PP3H 1SYVA 3S36L 2GJXB 2YL5A 2V9TA 3GI8H 4PBXA 2XFXA 1BPLB 4L3ED 3GMOB 1NCWL 3AXXA 5DQDH 2BNRE 4C54A 4QTHA 5I1IL 4YHKH 4L4VE 4DGIL 1CXIA 1DFBL 4LCUA 1N64L 5FYJE 5CEZL 5D5ME 5EN2B 1PIFA 4L5FH 3DURB 5JTWA 1MHCA 3ILPA 1GCFA 4MXVF 1UXSB 3T0BA 4Z5RB 1MY7A 5CD5D 3HU7A 4ONFH 3ZR5A 3UZEA 5F7EL 4KRPC 1DUZA 3WNLA 1IAKB 1ZHKA 2WBGA 2ERJC 3W9DA 5DFVC 3IDXL 4G8IB 5CZVL 2FL5A 2W9LA 2XZAL 4P7RA 1IT0A 1RU9H 4GBXD 4GT7A 4PUDA 4Z95L 4RE3A 3MRMA 2OSYA 1CFVL 4KKCC 4OF6A 1J0HA 4ZTOH 3TONA 3GMLA 4XVTH 2YBRA 5IV2A 1CLOL 3WIHL 3S2CA 5D7JC 1NSNH 4RGMC 5J9PB 5FHAH 2IG2L 1LEKA 2CUMA 4YZFE 1OIMA 5IIEA 1N6QL 4WUKH 3FFCE 1MIEH 1KJMA 1LL7A 1G0XA 5IHZA 1QQDA 3OF6A 4WEUD 3OR7B 1BSIA 4F33B 1WCBB 5TE7L 1HZHH 1TMCB 2JCCA 2VDKL 4MXQD 3RTQD 3IJHA 4NNYA 1M71B 1EVUA 2Q76A 2B2XL 5JNYA 5KANG 4NGHL 2BSTA 1E4MM 1X5KA 4FQCL 2NXYB 3B9KC 1A6VH 3CXDL 3BAEH 5AD0B 5I73B 5EBLA 5CGYC 1KPVA 1UD6A 1AD9A 2A9MH 3I85A 2VXQH 2BY1A 4B3KA 3P4NB 4XMLL 3W0WA 4QRSA 1XCTA 5CINH 2AEIT 3O6AA 4P2YA 1XGUB 4S2SA 2VWEE 2CERA 1RJYB 2LAAA 2HMID 1UXWA 3DUUA 1BQUA 5I1DB 1A6UH 1F4HA 1U8MB 4HPYH 3SDCD 4G5ZL 3P77B 2OSXA 4D6HA 1NGZA 4U33A 4M6ML 1EMTH 1HP4A 4NCDA 5AZEL 3QI9D 2FIKB 2V2TB 3QDAA 3ROLB 5KEZA 2J8FA 1CFBA 5IMOB 3B5HA 3T65B 1NANH 3PNWB 1WV7T 4ZUUA 4R0LC 3UTPD 4MAYC 5I0DA 4Y19A 5DJ6A 4MS8C 5JA9A 2AXJA 5IQ7L 9CGTA 2KZ1B 4PJGF 5JIKA 3FZUC 2ESCA 3FONA 3QEQA 4L3EA 5DMIH 3LKSB 3LH2L 3ZHKA 2JCCE 1CD1B 4JKLA 4D1IA 3U7VA 5DHYA 4G9DA 3LMJL 5DD5H 3QDGE 1M7DA 3I02A 2K7QA 4UINH 5FOOA 3CDGA 3L3IB 1NAMA 2FR4A 4LDEB 1FFNA 4HZAA 5SWZB 3ZT6A 2NW0A 1SJVA 5FL0A 2CGRL 3ZHDA 3HR5A 1S7QA 3RY6A 4HPHA 3MRRB 4EI6B 5D2LF 2UWEF 2ZJSH 3D0VA 4LRNL 1Z9OA 3O6LL 2SEBA 5KSAC 3VXSE 3LRGA 1HSAA 4XZUA 4EOWL 1HEZB 5DEFB 1UM5L 2EXOA 4GIAA 4QHNA 3WLBA 5SWSD 3WDPP 3B8SA 1MUJB 4MA3A 1U8HA 2A73B 3WN6A 3IKCB 4YIQB 3ZYOA 2EYTA 4WW2C 2VLME 4X6EB 3DBXB 3PV7A 4JM4L 1P7KB 4IRJB 2IJ0C 3SJVA 3CPLA 1KSRA 3EYQD 2V2WA 4NM4L 2ICWI 1MF2H 4OM1L 4RAHA 3IANA 3LKSA 4KUZH 1BQCA 3ZJKA 3QRFM 1TTUA 4XVSH 4P2RA 4XPHL 1UR4A 4KUCD 5IMLA 2WCAA 2NY1C 4LLYA 4OZFA 3F58L 4HAGA 4J3TA 1HKIA 1CLCA 3SGEI 2WMGA 2R2BB 3CDCA 3Q2CA 4JPVL 5C0BA 5IQ7H 5TFSL 4GFTB 4TXEA 2E27L 4KRNA 5DO2C 3PQYA 3KG5A 3RA7H 2Z91A 5BVPH 4X7DC 5C09E 1NFDE 1JYWA 1HHGB 1IGJB 4OFYD 3U7YL 2J78A 3CDYA 4JRWA 1WZ1H 4HFUH 1KNOB 2W4XA 4OZHF 2Q6WA 4KVCH 2CGRH 1RUKL 4Z7UA 3WNKA 2NY0D 3EKCA 1HJQA 3FHAA 4C83B 5A40E 5FA3A 3SEPA 1QRNB 3QUKA 2I25N 5D96B 3ZSSA 1MJUH 1QLEH 1EEZA 1FGNL 2VE6A 4LCYA 3V4PL 1GYAA 3OKYA 1NWTA 3WDRA 4BZ1H 1TETH 4JFFA 4IDJH 4ENEC 5DVLA 1UR1A 1RIUH 2VQ1B 5C8JB 4J28A 2VDML 1HHJB 1LE5B 2A2QT 4LF3B 1T21A 2NXYC 3BGAA 3C2SA 4ODWA 1DVFA 1DUYB 4UUJA 5KVGL 5T33H 3VINA 1TZGH 3PWPA 5IB5B 1RK0A 4HXBL 2Y5TA 1BIIB 2CRIA 4YLQT 4UBDC 3D39A 3EFFB 4YHOH 1GSMA 3HG1A 3S3SA 3KPMB 4OLWH 4PJHB 1VFOA 4KUZL 3ZDYF 5FGCB 2VCAA 1LO5A 4DCQA 2LFGA 3RKDD 2W62A 1K6QH 2GJZB 4LARL 4F58H 1GAFH 4OQTL 1SEBB 2UY6A 1HQ4A 1BGXH 3BT2H 1R3HA 4JPVH 2BSED 2HJKB 3LSOB 3T0AA 1ZVYA 5D1XB 5IEKB 3BPLB 5JHDE 4L8SA 4DGVH 5F7NC 3LAFA 4P9HH 4XC3H 4JFYA 2G3NA 5DWUL 1OP5K 5EFDA 2GSGB 4O4YL 1QFHA 2V7NA 1PZ3A 4KZDL 5HGAA 2Z92A 3W9EA 4R0LB 4E5XA 5FV1L 1R86A 2AV7B 3MNZB 1JBJA 4DQOL 1QKZH 1P7QB 3CU1A 3PTQA 1MFDL 4L4TD 3RPKA 4KVCL 1CFTA 5I0ZA 3B2UC 2O5YH 4X4YA 1NANI 4K9EL 4S3JA 4HS3B 4OZFG 4PB9H 2I9TA 2WYSA 4LHUD 4WJXA 1YY9D 3QI9B 1QFWL 2Y2WA 4G8GB 1U93B 5GS1B 3N1AA 1G7PB 1H8NA 3LPGA 3KPRA 1RK1B 4Z7NF 1KYOJ 4MAUL 4ZFZB 1K5NB 5TF0A 1WPCA 2DQGH 1LG1A 5DZNA 1NGYB 4HW6A 1F11A 4HC1A 3VFUA 5EC2B 2DN7A 1G9EA 1WAAE 2NMSA 4XZUB 5C0CE 1AQKH 1RJZB 3CH1A 3KNBA 1GIGL 5F93C 1X7QA 4YJZL 4XNXL 3WD5L 2B31A 5E5MA 2EEXA 5M03A 4EBQH 2O9RA 5DT1H 3C5ZA 1DHKA 1IAIH 3KYMA 4MX7B 2AP2A 1D5IH 4LPYA 3KL0A 2IF7A 1QO3A 3W38A 5C0RH 4F58L 5D7KE 5FCZA 5C3TA 3SCUA 43CAB 3L1OL 4WENB 1HXYA 4YDJA 4OV6F 2WC7A 4NZCA 2F8OA 5D1QD 1DQTA 4L9DA 4X5LA 4R27A 2AW2A 2J8HA 3ZE1E 3FCTA 3VXSD 3PZGA 2IFFH 5HPMB 1CT8B 2HRLA 4UQ3B 3RWHB 3EOTL 1JHLH 3MXWH 3FL7A 4BM7A 3VMNA 4UV4L 3IXAB 4CDHA 4OFIA 4NRRA 3S6TA 4YHZL 1QLFA 4TTDD 4RX4A 2DM2A 1YNTA 2DM7A 2VC2H 1XGUA 4HIEA 4S2SB 2HAZA 3RNQA 5B3NA 2CXKA 4NIKB 5DO2D 1XH3A 5GGSB 4F7CA 4YIQA 1RY7B 4NRYA 3RVWD 1KG0A 1KCVH 1I1RA 5GJTH 3MRHB 4JRXE 1L0QA 3AYRA 5D96C 3U4BH 4AMCA 1CDJA 2VUYA 3ALWA 3HRPA 5IVXB 1B0RA 1PYWA 1JPST 1GGBH 1ZV5A 3PWPE 3FRUB 3QBTB 3NIDF 3O2VL 1MCEA 4W6WB 1EGJH 3MV9A 5HHOB 4KI1A 1HJXA 1LO2H 2BRRH 4ONGL 4JO3H 2NXYD 4AT6A 1N4XL 4IHOA 3CUHA 4Z7WB 1AI1H 1HEZA 4RE4A 2VLJA 4M43H 4PMUA 5CKGA 3OAZH 2GTZB 1MLCA 3QZWG 4P2QB 1MHHA 3RTQB 5ISZD 3D87B 1BVNP 1DSFH 3JTTB 4CW1B 3L4VA 4NZDA 1ZA6A 2HWZH 4PJGE 4XVJH 5SWZA 3PQYD 3QQ9C 3IAGC 1U8LA 2EYRA 3OLDA 3OZOA 5C09A 2ZOKA 5B3JF 5I1KL 1ZKAA 1BLNA 3V4UH 3E2HC 5TH2B 3MV9E 4WW1B 3ULUE 3FQXB 3GI9L 5EUOE 2B20A 4Y5XA 5D1XC 1TCMA 4DKFH 5KZCD 4UV4H 5F9OH 5E1HB 4M48L 5DEGB 4K2UH 3J8F7 4NKMB 3GXIA 4F37F 4TSCH 1SJEA 5KZCB 4ZNEA 4KTDL 3K0WA 3CUPB 3HMWH 4XCEB 3TYGL 1GJIA 4X9FA 4PD4K 3IFLH 3M17A 1TQCB 4UTBH 1XCWA 2I27N 5EU4B 3T0WA 1KCVL 2BY3A 4HMEA 2NW2A 4OCWH 2BSSA 4FQIH 3ABZA 5A3IC 5CPSA 1T1WB 3EYSL 1JNLH 5ISZB 1ZTXL 1BYDA 5DMKA 3X11A 2X4UA 5SWSA 4PJHA 4E41A 4QTIH 4HULB 3DVFA 1MVYA 1PPIA 5DJ2A 5IOPA 2ICEB 1I1FA 2EE9A 1WUNT 2OSLB 3TM6A 3S3PA 5CD3A 4PTXA 3AGVA 4Y16A 1WT5C 4L9LC 3ETBF 3PP4L 2AS5M 1LK3H 3FQTB 3PGCB 3C6LC 4PRIB 3HI6L 3TVMB 3WKMH 4PV9A 5HJ3A 2VXSL 3U30B 2DM3A 3GMQB 3JV6B 4NCC1 2AJXL 1RZGB 3N13A 5JXEA 5B8CC 1CE6B 5KVDH 4U7KA 1IRAY 3CZLA 1WBZB 1Q9KA 2DICA 3EGSA 2YK1L 2YA1A 4GQPH 4MQXD 5SX4H 4PJ9D 2FX7H 2IANA 3RDKA 1QRNA 3PGFL 2YJQA 3HPJB 2VI0A 1A1NA 3DTXB 1FZMB 1GPOH 2D23A 3FAWA 5ALCH 4JFFD 3WFBL 2CBJA 4JFZL 1OARH 3SOBH 3UJIL 4XCFH 3A6CL 5C9JB 3QWOB 2X4PB 1FPTL 3WFCH 3VXMA 4QAWA 1LNUA 4KTDH 4D6IA 1ZK9A 5F7DA 2R29L 3TCLB 5I6XB 5KSBE 2O5ZH 3VPLA 1BREA 5A2JH 4KJYB 4U7MA 1VFMA 4ZXBB 3CFKA 1NM9A 4PRHA 3WDHA 1SY6A 4PP2A 4FQIL 3UEZA 3SDCC 3SE9L 1WITA 4KDTA 5DQDL 1G9NC 3DETC 4F9LA 1IAKA 2VAJA 3FQNA 2VLLB 3HPLA 3TFKC 2DQIL 3QQ4A 3MGAA 4LCWE 1ZS8A 4MX7A 4AZGA 5HHMD 5H2BA 2FO4B 3O2WH 3GBLA 3B43A 4PRPA 3UC0L 2UWEA 3PABA 3UBXA 1HE7A 1HYSC 1KB9J 1H8OA 5I23A 5C6TH 4RBPK 5GHWL 3OIHA 4CD5A 2Y36H 1AXSB 5E7FA 5AYQA 1ESWA 5JW5B 1HKMA 2J47A 4LSSH 3JTSB 2IH1B 1F3JA 2W07A 1T20B 1RU9L 3AMCA 4MHHG 2YL6A 4JPIA 1S7SA 2IBZX 5IJKA 5A6KA 3AXLA 4P4KD 2FX7L 2V17H 3QUZB 4TUKH 3RTQC 3HG1E 3GIVB 4F33A 4WKFA 3FFCD 1CLYH 3JWDC 1E6ZA 2VUOA 4XXDB 2ICWB 1DQLH 3GRWL 3NZHH 3X12A 1T83A 3ULVC 4DVBA 3VDAA 1YECH 2APVA 2Y72A 4Y4KC 1OB1B 1DBJL 1GGCH 3L6FA 2OI9C 4JY6A 3QDJD 4L3AA 1HZHL 2ZUYA 3LN5A 1AFVL 1Z0MA 4OZIE 3IJSA 2VIRB 4K94H 1YPZB 4MS8D 4L1DA 1RZ8A 4BQ4A 3STZA 1DQQB 4WNQA 3QDGB 3TPKA 3N17A 3MRGA 2WB5A 1ZLSL 4E41B 1U6AL 5C09D 1P4IH 5HHVH 1FFPB 1WWWX 1WAAA 1HXJA 5BV7C 3KPSB <