4MB4A

Crystal structure of e153q mutant of cold-adapted chitinase from moritella complex with nag4
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
528
structure length
528
Chain Sequence
GTITSQDDNVVVGYWHNWCDGRGYQGGNAPCVELKTVNPQYNVVNISFMKVYDIAEGRIPTFKLDPTIALSEAEFIAQIDTLNSQGRSVLIALGGADAHIELTRGDEDALAAEIIRLTDLYGFDGLDIDLQQAAITAKDNQFVIPAALKMVKEHYRKTGDNFMITMAPEFPYLTANGAYTPYLTELDGYYDFINPQFYNQGGDGLWIEGVGWIAQNNDALKEEFIYYIADSLINGTRNYHKIPHDKLVFGLPSNIDAAATGYIQDPQDLYKAFDRLKAQGQPLRGVMTWSVNWDMGTDAANNSYNQQFIKDYGNFIHNQLPPVTDMTPTLSGIVDTRVELDSHFDPLIGITAKDYQGNDITADVTVSGSVNTNQVGDYLLTYSVSSDDETTNQPRKITVYEILPAFTGITDTTVVIDSEFDPMQGVSASHPTQGDLTANITVTGEVDTNVVGVYELTYQLFYGQDNQQNMTDKRIVTVVTDAVSDDDWQVGSTYVKDDKVTHNGATWTAQWWTKGEEPGTTGEWGVWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chitinase 60
publication title Crystal structures of substrate-bound chitinase from the psychrophilic bacterium Moritella marina and its structure in solution
pubmed doi rcsb
source organism Moritella marina
molecule tags Hydrolase
total genus 174
structure length 528
sequence length 528
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2013-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
A PF16403 DUF5011 Domain of unknown function (DUF5011)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.20 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Carbohydrate-binding module superfamily 5/12 4mb4A04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mb4A03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mb4A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4mb4A01
4ZENA 1HILB 1KCKA 1PKOA 3WIJA 3GHBH 4P5TB 1IE5A 1QQDB 1H3GA 2A74A 3AXIA 4CCCA 3GBNH 1A1MB 5HHXH 2ILLA 4GRWH 4NQCB 4PRPE 3Q1SL 3GO1H 2VDPL 1FCGA 4PTVA 1PSKH 4Z18A 2F19H 1WVZA 3DMMB 1E0VA 3TTQA 4DTGH 5E9AA 2CRMA 2YD2A 5EUOF 1CVRA 5T3XH 4G8GD 4RFOL 2C1OA 4XP4L 5CEZL 1ZHNA 4K8RH 4NO5B 3VFNB 1ZT1A 2WBJD 4M7LT 5D93C 5F3BB 2QADC 4P0DA 2Z91B 5JBEA 1ZB5A 3U5YA 4HS8L 2PW1B 4YXHH 5HGAA 3NFPB 4ZAKA 4GW5A 1FZJB 4F9LC 4OLUL 4HKXB 5LWYH 3T08A 4KROC 4R8WL 2YK1L 3KLDA 3TPUB 1G0DA 1IGCL 3QPXH 1G7LB 1DVFD 4EI5D 2X1IA 3UPRB 3KPRD 2NY7L 2X41A 3DETC 4NQVA 3VUPA 2VXVL 2D31A 3MRFA 5C0AE 1D5XA 1JGEB 3GBEA 1KLGB 3MZTA 1E4WH 3JV0A 3TJHC 5GGRA 1A6TA 2Q8AL 1JYWA 1R7AA 3VFSB 3BZFA 3UCRA 4APQB 4OOZA 1JMXA 1TQBB 5C0JA 1GC1C 1UA3A 5IQ9A 2YL8A 1UOKA 5HHNB 5C0IB 1LP9F 5K9KA 4WW2A 4X83A 1YECH 4XWGL 5DD1H 4BFGA 2UZYB 4LAQL 1NBVL 3OGCA 1QNOA 4LCCB 5KSUB 3M7SA 1U8PA 2J8UE 4AM0A 3T1WA 5DS8B 1E4LA 2MANA 3IK2A 4K7PH 3WF1A 1OCQA 3RJXA 4JL1A 1GQLA 1TJHL 4PJDE 3FQUB 4EUPH 1B0IA 3ZDXE 4XZWA 1WTLA 3MZGB 1VDGA 3H0TA 3K1KC 4ACPA 1PKQE 1WZ1H 4PY8I 3LCYA 3F5LA 3UTPE 2XOTA 1MHHB 3VXRD 5IFJB 2DL9A 4KMTL 2D7MA 1FGNL 4POZD 3L3GA 2BP3A 3DX6A 4LNRB 5I1EL 5EC2B 3CUJA 3QUXC 5DJ8B 1FSKC 1NC4A 1MWAA 5GRXG 1G7IB 2XG5A 2XSBA 3KYMA 2YD3A 1MCLA 3MJ9L 2V2WA 1OP5K 2QLYA 1YJDC 1NCDL 2BSRB 4U1JB 5ESAA 2G4FA 4PMDA 3MLVH 2ZE0A 2R56L 3TFKD 3PZTA 5T1LB 4LOUD 4DVBA 1BOGA 4MAZA 1B4JL 3QUKB 3WUWA 8A3HA 1RK0B 2JIWA 4FFVC 4IOFD 4Q6IC 2J12B 1BFTA 4ALAL 2P5WA 2EDNA 2W9EL 1JK8A 3DSFL 5ICZB 1I8IA 2CIKA 5HTSA 3GMNA 3QUZD 2DOCA 1A7QL 5EIIB 3TYFB 1ZANH 4A6YB 1LO4L 3GMQB 1KXHA 3I6GB 4Z7VA 4K71C 2OTPA 1QACA 1D9KA 3SOBL 3FRUB 5CWSA 3MRCB 3TM6A 1ZA3A 3EYFA 4LLAA 1N8ZA 2V3EA 2J2ZA 4DKAA 4PRBB 3AHYA 3DPBA 3HNTH 4HFWA 3BSZH 4PJIF 1MELA 2X4QA 2ZX8A 1J0JA 3SDDB 1NAMB 4W87A 3D25B 5CCKL 2J4GA 4MD5B 1EQPA 5LVEA 2UYLB 3SDAC 1OAXH 4GG6B 5D7IB 1VACA 4M5YH 2WCGA 3AIBA 3ZYIA 2NYYD 5LAXB 5JLZA 4NNYB 3JWOC 4MYWB 4UILH 4G8EB 3MUAA 1IFHH 4Y2DD 3OAYH 1UD6A 2C3VB 1Q6CA 4JANA 4XH2A 4U49A 3IFPA 3BIKB 2GTWA 1A7PL 2Q1EA 3O3EA 5GJSL 3BRGC 3GRWL 2O92A 4EKJA 3GMLB 2EXOA 4WNQA 2MOVA 2X10A 5AUMA 3AS3A 3REVA 4NN6C 3B4NA 4JFQA 2RJMA 1BZ7B 1T3FA 1BAFL 5ERWA 2H1PL 3PZNA 4B0MM 1DQDH 2NTSP 5DJYB 3BP7B 3W0WB 4F33A 2C4XA 4ZNEA 3M17B 1KBBA 4PYHA 2FJFA 1VJZA 2UY2A 3GXIA 3SCRA 1KF9B 5A3HA 1C12A 3B43A 4PIRF 2AV7A 5DI8A 4PP2B 1FNAA 2C4FT 2VZ1A 4XP9L 4G6FB 1SEQH 2IAMC 2VLRB 3MNZA 4YE4H 4BQ6A 4UNVA 2XUCA 5T3ZE 3KPRE 1I1AD 3OAUH 1LEKA 4XVJH 1C1EH 4Y1AB 3EO9L 2J5LB 1TNMA 5IOPA 1KGUA 3WUFA 2QQLH 5BS0A 3V52L 3U7YL 2N56A 5I2IA 3JVGA 5LGHL 4X6FA 1H2JA 3P0VL 4HHAA 3TT1H 4KFZC 1M6OA 2V3GA 1WDSA 5DA0B 2FHBA 2WCSA 4X5WA 4D0CA 2FGWH 2VKWA 1FNGA 4UV7H 1JHKL 1XT5A 4LMQE 2GSIA 2WZIA 1YZZA 1EXUA 4KJPD 5IMMA 1DQMH 3W53A 1S7RA 2IH3B 4TVPD 3RM8A 2FLBT 3UEZA 2F58H 3RX5A 4FQXC 2H2SC 2ATPA 5EG6C 3A6BL 2NZIA 3U36B 4TX8A 5A95A 1Q94B 1X5JA 2KH2B 3B9AA 3BDYL 4B9YA 3DVNA 1FO0B 3RPIB 3V4PL 1XMWA 3KVQA 3RGVD 4F9PA 4XPFH 3WNNA 4RAUB 5EU6D 1RURL 1T0NA 3GJFK 3IS1X 1MCSA 1XF4B 4JFDB 4RBPH 5C2BH 4MWFB 3AREB 4I0PA 4TRPH 3L5WB 3GZKA 1OW0A 3VXRE 2IBGA 3V6OE 4FZ8L 4OZHF 4HH9B 4NUJA 4HIXL 3BUYB 1IGYB 4BH7B 1IILE 4RFNB 1TPXC 5HSFA 4G43B 5DEGB 3FAXA 1J7VR 2I5YL 2HTLC 4U6XB 4OZIA 5CJXA 3FO0H 3O2WH 1UQZA 3RBSA 1YEEL 4M1CC 5C07E 4JFZH 4JZNB 1NDGB 3QNXA 4ELMF 2EXYC 4HPGA 2XWTB 5FGRA 3PL6B 3T0DA 1KCSL 5IBTH 3CVHB 5E8NB 2R9HC 5C09A 2X2YA 1BM3L 2HWZH 1HP4A 3T77B 4HP5A 2Z92A 1QSEA 2V2TA 5MP6H 1OGTA 3L3JA 2FX8H 5ALCH 1LWRA 4QOKD 4KQ4L 1W1PA 3WDQA 1CDBA 1GOOA 2EKJA 3L5XL 1RIVL 4ZSOB 3THCA 1FNSL 3X11A 3WH8A 4JO3L 3BEWB 1LO0L 4XP6H 1UR2A 1SJVA 3FZUC 2F8QA 2EPMX 3LEXA 3O8XB 8FABB 1FNEB 3ZJKA 1LWJA 2MJWA 4N0UB 1U3JA 2QHRL 4V27A 4E0RB 3AIEA 4OAWA 4KGJA 1A9EB 3TPKA 2ITDA 2HFFB 3S88H 4MQ7A 5I8CB 3MRRB 1HZHL 5CINL 4OLVL 2C7UA 4WLCA 1W72B 4GAJH 3F7PC 4IMLB 3CPLB 3CH8A 3I3EA 1R3HB 4IS6B 3NN8A 5C0RH 1EQCA 1CFQB 2F5BL 1HKJA 1BWMA 3LPFA 3BKJL 1JTOA 3T1FA 4CVWA 5C0GA 1I7UA 2OMBA 1MQPA 3ZO0A 1VCAA 4HQQH 3OBAA 3FMGH 4J3OC 1P4IL 3U9PH 5BYWA 3RRQA 3W2DH 4FQJL 4O58L 1ACZA 1T0PB 4MJIE 1XH3B 5F1IB 2EDLA 4M7KL 4Y5VA 4P4KC 2WZEA 1IAKB 3X3GH 3AAZA 5ECJE 4TNWK 1UWXH 4JKWA 4JFEB 3MC0A 4LBEA 4FQHA 2X42A 5MEQB 4M29A 4OSUL 2JIXA 5K9QI 4UQ3B 3O0RL 1EHAA 4M1GL 4MJ5A 3VMOA 1NBZB 5D5MF 1HHGB 5TH2B 2O93L 1EZVY 3BDXA 2OM5A 3U0WL 2G3NA 2R2HA 4M1DL 2Q86B 1FZOA 1G7JB 4K2UH 3PIQB 4Z7UB 3VFUA 4PJHB 5IB5A 2ZXQA 3MKKA 4HAGA 3GKWL 4MCYB 3MLYL 4ZYKA 1PAMA 4OGZA 5GS0H 5F96H 4Y5YB 1IC7H 1MCWW 2B2XL 5FD0A 2RAMA 5DJZA 3H42L 4M5ZH 3HLAA 2DQCH 2LU4A 3QWRA 1LEIA 3SGJC 1JPSH 3DURA 3MUZ1 2Q8BL 1I7ZB 2BSTA 3KYOA 2OLDA 3SCMC 3W9EA 4AENA 2D0FA 1OAUH 1NCBL 3GSVB 4BZ2H 5CEXA 1ISZA 1QI0A 2R1XA 2ENYA 5FGBC 3FN3A 4JFYB 1RIUH 1JNJA 1I8KB 3S36L 3ARBA 4KKAC 3DGCR 4FXKA 4OI7A 3FXYA 4TUFA 4E8CA 3L5JA 3QXDA 4OKVB 4TVPE 1G7MB 2NTFA 2R8SH 1XYZA 3B8YA 4WI3A 2JJTA 5MI0B 3LPWA 2GY5A 4PV9A 5TPWH 3G6AA 1A4JB 3WH9A 1OGGA 1PG7L 1X7QB 4YDIL 4NP4L 5EU6E 4BFEA 3OKNB 1DE4A 5FECA 3F6LA 3VD5A 1FFNA 2VMFA 5A2JH 3O6MH 2XQYG 3CLEH 4WUKH 5EORH 3MBEA 3BD4A 2J1KA 1ITBB 4Z0BH 1MI5A 3STZA 5HGBB 5LGJA 3H9YA 1J10A 5D1ZC 2FL5A 4WENB 1TZGH 3BP4A 4K23L 3O9WB 4YFLI 5HHOE 4M7LL 5CIPA 1T0MA 1P7KB 4OIIL 4YDLB 4HA3A 1MFCL 4X4YA 4RISL 2WSPA 5JIHA 2RBLA 3BE1H 3VFPA 5ID1A 2X4TB 3S37L 1QRKA 4XMKL 1S5IH 3ROOB 4LMQI 1EGZA 1AGFB 3ALPA 4UT6H 2G8ZA 4YHIA 4OZFA 5DWUH 3EMQA 3M1BB 2DQFB 4HUMB 3DRTA 3FN9A 3L4XA 3BGMA 7CGTA 3GXDA 4HC1L 5T1DL 1F58L 3UAJC 4HIEB 5CSBA 1V6UA 2HT4C 5CSYA 2PBOA 1V0NA 2XPKA 3RCNA 3CK0L 2PTTB 2XNAB 1TCRB 4IISA 4CD8A 4NYLB 3CSBA 1LEGA 3U46B 1PBYA 5FYLD 4WFHD 3HI1B 3CVIH 1RJZB 3GZAA 1QSFA 3WEXA 3NABH 1AGEA 3OB8A 3E6FA 3VU2A 1H3WM 5FCUH 5T3ZH 5H37H 3FO9A 5CZXD 2X4NA 1WITA 2VE6A 4WHYG 1U0QA 4LLWB 3J8F7 3T2OA 2D7PA 5A8MA 4Y4FD 1UADC 3POCA 1OLZA 4DCQA 4S3JA 1K9TA 1AP2A 3VWKC 4Z78B 5I0ZA 1HH6B 2VSCA 3DI3B 4HXBL 1ERNA 3UX9B 3GYCA 4ZAKC 4ATDA 2BNQB 1WFUA 2W0LA 5GS1B 4H25B 1YEKH 4BKLB 3BMWA 1ZHLA 5JXAH 1AXSB 4H8WC 5DXWA 3T3PE 2A9MH 2IPTL 4UOJA 2XM2A 3QNZA 3AHVA 2ZUUA 3SUSA 3CC5B 5CSGA 2D0GA 5GNZA 5D96B 2R29H 3FNDA 1T04A 2BY0A 1CF8L 4UU9B 1B0GB 1OP3H 4ONGL 1NWRA 1GGBH 2WMFA 3NFSH 3C87A 3EZJB 2DMKA 5EOQH 1HINL 2OR9L 2A6DB 5C71A 2AABL 1FLRH 4A6YL 1AJ7L 2NXYD 2R2EB 2Z93B 3G5ZA 4MA8L 3W39A 4N0YL 4WW2C 5DD0L 5F3HA 2ERJC 2P49B 4KHTL 1QOXA 2GK0B 2FWOB 2PYED 2ORBL 1FNFA 3FB6A 4MDJA 4M8UA 4YQXL 4M4RA 4L9LC 3DUSA 3STLA 2DTSA 2ITCB 1S9XB 3U0PB 1MPAH 2HMID 4W4OA 3FQRA 2CLRA 1TNNA 1H3UA 1JPFB 1JD9A 1Q9WA 1IGMH 1NCWL 3I9GH 5I6SA 2FGLA 1FFOA 2W0FA 1LO5A 3Q6GL 1X5XA 4NQDB 4ERSL 4EANA 1D5MB 4AH2A 4C56A 5D72L 4LSRH 2DDQL 2XZQH 5D1XC 3WH6A 3T0AA 4DWSD 4UCFA 2GUOA 2GT9A 3L3KA 2BV9A 2AK1H 1HWGB 2V5SA 1MQKH 4G9DA 1GGIH 1RSFA 3VXSB 3QEQA 1BQLH 2IALA 2VISA 4DOHB 2EDBA 1ZEAH 2ZP0T 1CFNA 4HGWB 3DHPA 2ADFH 1J05B 1HH9B 3TBTB 5FHAL 4KK9C 2LABA 4OJFL 5GS3A 2FEDC 1OARL 1BG4A 1O0VA 5I8EB 1CLOH 3QRGH 1VEPA 4W68A 4D6DA 1TG7A 4YHEA 2XN9D 4NIKB 3RZCD 2KL6A 1XIWC 5EOTA 5JTWA 4PRAA 4JO1H 4D6GA 3RVVC 3ULSA 5EO1A 1YN7B 2HFTA 1A6WL 3ARFC 5F6HI 1KBKA 1SY6A 3F8UB 3NPZB 1EERB 3SURA 2YZ1A 1D9KC 4XC1H 5B39A 3CFCL 3DXAB 1Z6JT 2X8RA 1W9DM 1EFXD 2ZSVB 2WNGA 3BAXA 4N0CC 3LEVH 5E9DD 2YSSB 3MRKB 1FL6B 3BAEL 3X14B 2IBZX 3MA9H 4HK0B 3S3JA 4OCLC 2G41A 4PMUA 1BG9A 3KYAA 3VXNB 4YFEA 1LNUA 4PJBE 4G7YH 1XCXA 4ZFZA 1GGYA 1S8DB 2B1HL 5DR5H 2C0HA 2EPOA 5I1GL 3OIHA 4HZ7A 5A6MA 4GUPA 4L4VD 1G9MC 2HTKD 3BH9A 4KXZI 3W11C 2A3EA 1A3LL 2GCYA 3MCKA 2VUYA 1QRNA 5A6AA 4WO4B 4WTWA 3UTOA 2H2PC 2D7TL 1FO0L 5CZVL 5D9SA 3GI8H 1E4IA 1X5AA 4NFDA 5ABDE 1M04A 4HOXA 3WIHA 2V17L 4NRYA 4IPLA 3W26A 3C9NA 2DLGA 3IDMA 4FMKA 3D39A 4E8DA 1LK2B 2VLLA 1TZ7A 5BO1H 1D2KA 5D1QA 3BQUC 3D0LA 3MLTB 4WEBL 3P2TA 2GKIA 3B5GA 3SE8H 3OKOB 5HDQH 3NOIA 1BBDH 5IHRA 1CD1A 3VKKA 5HYFA 3REWA 2VXSH 5IHLB 5GZNC 5JDSB 3C6LB 4HKBB 2CXGA 2BC4B 1U8KA 1S46A 5JMOC 1PEWA 2Z4QA 5GGTH 3NACL 3CVHL 1HHKB 5IJKA 4TVPH 2H6PA 5DT1L 4LCUA 3CDGA 1L7TL 4MNHB 4P2OB 2NY3C 3MOAL 4XNUL 4UQ9A 1MY7A 5IVZB 4O51B 4AL8L 3PNWB 4NZUH 1TVHB 3JVGC 3AHXA 1KJ3L 1OAQL 4JQXA 4GAGL 4RBPK 4PJ5A 3CLFL 4M61B 1RPKA 4H41A 4YXKH 4XXCC 1QI4A 4UTFA 2EJ1A 1VERA 1WC7B 2HRPH 1H1NA 4EZMA 4P7LA 1AD0B 1CICD 4RQQB 2WWKO 1MCJA 4HT1L 5FYKL 4Y19D 5FKAA 3TO4B 5ESVB 2OJEA 3TZVC 1H3PH 1N4XH 4HIHB 2EDOA 1KQYA 1MNUH 4Z7WB 5JO5A 5DK0A 2PYEE 2QHLA 5KJRL 1VBUA 2GK1A 3IDXL 3PWLA 4X5XA 1W72L 1QR4A 3VIJA 2YR3A 3L3HA 2BNJA 1IM3B 5BZWA 2H32A 3IKCB 4M7ZC 4P2QE 1V7MH 4AYSA 2J8FA 1BQUA 5DZLA 4F9PC 1J5OH 5IB1B 1V7NL 2OP4L 3SCWA 4KRPD 4U0RB 1KBGH 3UPAA 4JB9H 3QIBA 4PLNC 1AO7B 1H5BC 4R7NB 1BBJA 5ISZD 1RH9A 3U2SB 3LIZH 4I0PC 1GZQA 3VFVA 5I16A 1OW0C 5F1KC 4X7TB 4TOYH 4M6MH 1BFVL 4JZJC 4AT6B 1RP8A 3HNSH 3RGHA 1OM0A 4MXVF 5EWIH 4QEGA 2WINA 5CJXC 4NKMA 4X98A 5HHPA 4JO4H 2PWHA 4PRDA 3VXQA 3GJFA 2GQHA 3RWHB 5TDNB 2VABB 4NQXB 3RX7A 2PF6A 3O6FC 4HXAH 1JI2A 4PRHB 3TH4T 2CDFA 1K4DA 3ETBF 3PJSA 3RHWK 5IMOB 1LILA 4X8JB 2XN9E 1CENA 5D9OA 4LCIH 5E6IC 4PUBH 2GW5A 4LHUD 5GSVA 4RAVB 2R23B 1F45A 1P4LA 1UR4A 4EJ1C 1EUUA 3QI9B 2QKIB 1UWXK 2X4SB 3HAEH 5HVFB 3ULVD 3EZ8A 4P23C 3RL1A 1RUAH 4OZ4B 2AXGA 1MJJA 2VERN 4GRWB 5ILTL 4AZBA 1L0XA 3MV8D 3UR8A 5E9DE 1NL0L 1QBMH 2WWMD 2OMNA 3S4SB 4LPUA 5BJTA 4RIRA 5C1MB 4HJGA 3WQWA 1H15A 3UROR 4G5ZL 2ZX9A 3E6HA 1DSFH 4EDWH 1KCRH 4D1IA 2ZXBA 4J2XA 3HE6B 3DO7B 1UYWH 1F2QA 1J87A 2CH8A 4P59H 1AGDB 2HLFD 4D94A 4ATWA 3BN3B 1NBQA 1OGAD 3KPSE 5E8EA 5FA4B 4LKCB 2QSCL 1AIFB 3ZKMD 3QB7C 4MAYC 1ECEA 4Q9BA 4NKDB 4YDKL 3KHOA 1FH7A 1T83A 4Y5VC 2R2BB 3TVMC 5KN5A 1M71B 2WUCH 3D2UB 5AYQA 5KVGL 4HA1A 4KRUA 2R1YB 3IDYB 1JFHA 1AD9B 1SYVB 1UT9A 4HIJB 1F6AA 5CPQA 4C7FA 1CT8A 5D5MA 2VDNL 4GKZA 5E99L 3ZYJA 5J6HA 1BD2B 1UQSB 1GPOL 4NC0B 4L8SC 3HPJB 4AZ7A 1T4KB 2CJUL 1YMHB 1KJMB 4Z8FL 1TETL 3SDXB 5ADPL 2WNWA 3V4UL 1UHVA 4JPKL 4R9HA 3TO2A 3WFDL 1EO8H 4I4WA 4XNQB 3QUMA 3SDCC 1HIMH 1AHWC 1GH7A 2ESVA 4S11A 4PJ8A 2R69L 5KSBE 1DUZA 4X80H 1ISXA 2AK4A 3QUYC 4IM4A 1H9VA 4FTVD 2WAGA 1OTTC 4JG0H 4G6AD 4PLKD 2BOBA 2DF3A 4LDEB 4NQED 5BXRA 5FHBH 5JDJA 1T5WB 3MRBB 4UINH 1WLHA 4S1QH 3FQWB 1U8NB 1UC6A 4NQSA 4NRRA 3WY1A 2C3GA 4UIKL 2PKDA 2Y7QB 3IFLL 4EUPB 4GG6F 5D7IF 3RNQB 5E94B 5B3JF 1IM9D 1KENL 4WI9A 4OV5A 5FL1A 3ARBC 3GMOB 4OIAA 1LO3H 1RZ7H 1ZWIA 1L7IL 5SWSD 4QTHA 4TOQA 4PGDA 1KJVA 5LXGL 1XRVA 3EDKA 4MA1C 3BISA 2M1KA 1N5YH 1SVCP 4QLLA 5HDRA 1A2YA 2XICA 5L0QC 1BJ1H 1F3DH 4TTDD 4XX1G 3U4EA 4KKBC 3MLUH 3QQNA 3A6OA 3BH8A 2GJ6D 3QHZL 2YOCA 3QQ9C 4M02A 3U48A 1PPIA 5F1NB 3DTXA 3O3DB 3LQZB 4W6XB 5JPMA 5EC1A 4LGRB 4PJXE 3ZKNC 3I50L 3PUCA 3VGAB 4P3WA 2VDQL 5ISZE 3VCLB 4X6CB 5EO9B 1W2PA 1GAFH 3L1OL 4V2XA 2D24A 4M6NH 5AYUH 4LEXH 1U3HC 3MBEC 3WDHA 4X5LA 2LAAA 4ZS7H 3RUGB 4AIUA 2CO7B 1EMTL 4Z76A 5KW9L 2YEZB 2Y24A 2X4RA 5D7JA 3N18A 1QW8A 5IV2A 1JUFA 4P46B 3MLRH 2PC8A 4PLOB 2J8OA 3BPCA 4I77H 1I3RA 3QNYA 4HBCH 2YJQA 2XZAL 3ILPA 4JHBA 1P7QB 1NFKA 5FYLH 1UH3A 2PWFA 3TIDA 3MBXH 1N6UA 1Q72L 1WK0A 1U8JB 3DX9B 5DEFB 1D5IL 3JWNC 2XTJB 5A6KA 4JFWA 4AZ5A 3OXRB 4R90L 4QRPE 2CBJA 3G6JB 5E1HB 4F7PB 4PJFB 3BD5A 1H0DA 2EXWC 4LF3A 4TSAL 1VFBB 2Y4SA 4WHTA 4HWBL 2WBGA 3KL3A 3VI3E 1SVZA 2O9OA 3AUVA 3RL2A 1T03H 3RDTD 2ZUQC 1MREL 2VRAA 3BP6A 4OCRH 4J1UB 2EPLX 5A8QA 4D72A 2X4OA 3BEVB 1AH1A 4LIQE 4PJAA 2FX9L 3KXFA 1OWRM 2FHFA 3MFFB 3CUIA 32C2B 4AMKL 3N85L 4GFTB 2XFXB 5IHSA 4EOWL 2AEPL 4UMGA 2ZSWA 1MFBH 3MV8E 3OHXA 1SJHA 2RFXB 3PWPE 2JALA 3BAIA 2IANA 3LEYL 4I2XE 4PLJD 4WV1A 1NAKL 1R86A 2IH1B 1WBZB 2NY2C 4FFWD 5AZEH 1B0RB 1CPUA 3AM8A 1ADQH 5D7LE 3D3AA 4NGHL 5F71A 4YPGB 2BNRB 1OSZB 4R0LB 1YEDA 3PGDA 3VPLA 4N9GA 4J4PD 4ODSL 3SCPA 2XWBB 2D3NA 1ZE3C 2XPGB 5DMKA 2X7LB 4OQTA 1HDMB 1F4YH 3VXPA 2DQEH 3SGKA 3MR9B 4AD4A 3GI9L 5EPMB 1A0QL 3OKDA 4QHNA 4YDVB 3T0EA 4YX2L 4HZ6A 1NSNH 4MXQD 5HPCA 4MQTB 2X44D 1TLKA 1CLXA 3E8UH 2CETA 1HSAB 2JF1A 4PJGE 3R0NA 3CPUA 1D5ZB 3HUJE 4CNIA 2VKXA 4IJ3B 3DRQB 2DIJA 3KR3L 3QXTA 2XFFA 3WS3B 3I2CL 1N6QL 4YGAB 1M7XA 3U9UA 1NOUA 3HC4H 5IFAL 2EDQA 1H0GA 5BV7H 5DQDL 3ZL4L 5TE6L 1IBGH 1NC2B 4NZRH 5EZIL 3PABB 5DD6B 4P5KB 1TJIH 3KJ6L 5FDWB 4JVUA 3L95B 4FTVE 2IG2H 1LLOA 3D0VB 1GZJA 4IHOB 4ZS6C 4R4BA 5E2VH 4UV4H 3NCEB 3HG1B 5ACLA 3DX8B 5JQ6L 3AIRA 2BY2A 5ALBH 4U1HB 3HZVB 3Q0HA 1DJSA 4P9HL 1ODZA 5EOCL 3BP5A 5EZOH 4K68A 3SHSA 2DH2A 3NCBB 5DGQA 2AJXH 2ATKB 4QXTB 1R85A 5KS9B 3GGWB 3UJJL 4NJ9H 4RGNB 4H20L 1NFDA 4UQBA 1B3JA 3WELA 4MB5A 1ND0B 4EIZC 3NBNA 2APXA 3ET9F 2CBUA 1YYLL 5SWSE 1LO2H 1KB5H 4MSWB 1CCZA 3TESA 1UACL 4Z7QE 2Y36L 3QHTC 4X0KA 3NTCH 3MMEA 3TBVB 4NN7B 2O5XL 2EYTB 2V5RA 2VXTL 4WWKD 2XYLA 4MB4A 4OLZH 1JZ3A 5E7BA 1ZSDB 4KPHL 1JD7A 2CDGA 3H7BA 1H49A 3N17A 3GMMA 4XRCA 4R6UA 4UDTB 2BRRL 4PRPB 4U6HA 4JM2F 3UZQA 4YHLL 2XG4A 2GITA 5CBAB 1GVIA 1DBKH 3FKUS 4J7RA 3WXVH 3D9AL 4X7CC 1FV1B 3O41A 4PJHF 4ACZA 4P7QA 4FQIL 1R3JB 2ZX6A 3NPSB 4OCSL 2ICWI 1BLIA 4JJ5B 5DJXB 1NLBH 4CMMA 4PTUA 4F57L 3MLSH 3FT4A 2QQKH 5CGTA 4ZFGL 2C26A 2AJVH 4M43L 4ZG1A 5C7XH 4PV8A 1BHGA 5DSCA 1R3LB 1XZ0A 2RTSA 2SEBB 1JDCA 2B5IC 3DVGB 1OWWA 3VXOB 1NM9A 3A4AA 1D3CA 3EOBB 3WMCA 4OZGA 4FABL 2DSVA 2DWDB 3RU8H 1KN2L 1II4E 1YEJL 4QRUA 1UD5A 3TBYA 4KVNH 5IVOA 2NY4D 2P47B 5IG7A 2H8PA 3EUUA 5DMJB 5E8PA 5IK3B 2IWGA 5C0AB 4MPKA 5FYJE 4ELKA 3RWDA 5CKAA 4GINA 5HPMB 3D18A 3UG4A 1QPXA 4UAOB 1J1OL 2A3BA 2DYPB 2WBWB 1TVNA 4OD2B 3WFHB 1CFTB 4TUKH 2OQJA 2XZZA 4RGOL 3IF1B 3PP3K 3FRPA 2V5DA 5DD5L 1IGFH 4XNMB 4LX4A 3B9VA 4ZPVA 3CAFA 4HWZB 3F7RA 1T1YA 3QPQD 4NQTA 3NDZA 4YHYB 4ZTPL 1I9RH 3RKDD 1I9IH 3FONA 1YN6A 1M7DA 2J8UB 4ZFOA 5M17A 1KN4L 5D1QC 4MB1A 2V7NA 3BGFC 1DLFL 1UM5L 1PVHA 5DQJB 2GJZA 1G9HA 3GMPA 4LKXB 3BKCL 4Z7OF 1FJ1A 2R0ZL 3IJYA 3WD4A 2XZCH 5C8BB 1PKQB 12E8H 5IROA 1OAKH 4XBGA 3R1GL 3WKNA 1F11B 3OXSB 4QLRA 4P8VA 4MQXC 4K3EH 4TUOB 2EICA 2QQNL 1FYTD 5IHZB 2AXFA 3POHA 3KNBA 4OLEA 4Q9QL 4AC1X 4PY7B 2OSLA 1ZLVH 5HYSB 4PTWA 3CMOH 2JF6A 2QSVA 4X6DA 1MRCH 4GS7B 5TDPA 2YD8A 4JQXC 4IRZL 3QEGH 1R8LA 1AR1D 2PO6A 4P5TA 1SM3H 1M05B 1PX3A 1BF2A 1I8LC 4MNGE 1GCYA 3CLWA 3S96A 4F15C 5ABFA 3GHBL 5FUOH 3U57A 2JCCE 3C5ZB 4DKEH 3GBNL 5EB9A 4M93B 1DQQB 5D6CA 3S5LB 4LU5L 2QMJA 2WIMA 3BJLA 3GO1L 4PTXA 5L88H 3SCUA 1PSKL 5A2KH 3FFCD 4EN3C 2YKLH 5C0CD 3BVNB 2GJXB 5T3XL 1YPZE 3VFNA 4CUCA 4KY1H 4PTTB 4TVSa 1LD9B 5I30H 2YPLA 1YNKH 3T2QA 4Z7NE 3WS6A 3NIDF 3D85B 2FR4B 2VVNA 5T1KB 4K8RL 1NDMB 2Z91A 3BGAA 3HZMA 3UTSA 5JW5A 4ZXLA 1KEML 1T2JA 3EOAB 4QP0A 2G3IA 2DLFH 5B8CB 1GORA 3F65A 1M7IA 4JHWH 4UT7H 3CIVA 3L4VA 1BFOB 1UA6H 4J27A 3WFCH 5MEPB 3OKEB 3QPXL 3Q2CA 4AIZA 1MHEA 1NOFA 3MREB 1HJQA 1N0LA 1Q9LA 1UR0A 1HSBA 2VDRH 1DTUA 4XZUA 2BSED 4LIQH 3DIFB 2HLAB 2XV6B 2DQXA 2J7LA 1DDHB 1E4WL 3O2VH 1GC1H 2VX5A 4K07A 5F7FA 3GSNH 4ONHA 5C0IA 5E2WH 1NGXA 1T1XB 3MRMB 2A0LD 4FZEH 3OJDA 5JUEL 3VFWA 4OFPA 4QKXB 1XFPA 1QLFB 1YECL 5DD1L 5HHQA 1YEFH 4JFOA 1A21A 2WBJB 1ZV5A 3KYKH 1KC5H 4K7FB 4R96B 1TQCC 3N1PC 4NKQB 4YC2C 4H1LH 4N8VB 4NO0A 3OZ9H 2AS5M 2G9HB 3FQUA 1FAIH 2CKBA 4IIQA 4FFWC 4K7PL 4JFFA 4P3DB 3ALGA 1S5HB 2BHUA 3EJJX 4DJMA 4EI5B 3CO4A 1DVFB 1JG9A 3PQYA 1MHHA 3KPRB 2C9AA 5DJ0B 5F7LB 1WZ1L 3ILQC 4G6MH 5J4MA 3MYJB 1UWQA 3OGVA 4JZOA 3NJ3A 3IXAB 4PS4L 4D0DA 2R0WH 1WT5A 2WZPD 1U8QB 2IBBA 3GB7B 2EEXA 4JHAH 1UXWB 1YJDH 1W9UA 2ZJSH 3L3DB 1JHLL 2J7EA 3VWJC 3GUTB 2CK0H 4OFIA 1IEHA 2Y8VA 4KTEH 1UWUA 3VNZA 3G5VA 4ZUSA 1DL7H 1F8TH 1F90H 1UWGH 1W9BM 3C8KA 3B9KD 3CDCA 1RUQH 2UWEE 4HV8A 4V1DA 1HI6A 2J88H 4OUOA 3UJIL 3WEZA 3UDWA 1KLUB 4U4BA 3IFOA 1S7WB 5ICZA 3WUBA 1NC4D 3UERA 4KQ3H 2NY1D 4L3EE 4PJ7A 2AV1B 1DWGM 4Y16C 1XD0A 4A6YA 5D2NB 4C83B 3IETB 4LRIA 1A22B 1VENA 1ZANL 5CJBA 4YZFE 1LG1A 1LE9A 4KI1A 4C55A 1GOFA 4PJ8C 4PREB 1BIHA 5A3ID 1KXTA 3GSWB 4WI2A 3WL0A 3VXRB 1GZPA 1KB9J 1FYTE 2WKLA 3HNTL 3BSZL 4BM7A 5HYJD 2BVOA 4WTZA 4Z2JA 3S8WA 1N5AB 5T5FH 4KTDL 3WBAA 2VH5H 2PR4H 5C6WH 1H09A 1TFHA 5C07B 5M95B 2ZXDA 5KBNC 3CFEA 1CE1H 1OAXL 4UDUB 3G9VA 2C3VA 4M5YL 1BMGA 5HHMD 5IW1B 3QQ4B 4HEPG 1YDPB 1GGCH 3BIKA 2UVEA 4YNYA 4WVRA 1IFHL 1JGVH 3ZE1E 4PB0H 5FIEA 1CXEA 1CTNA 5FO9B 4HGMA 4KVCH 1QW9A 1RHHA 4M48H 1C16A 3HFMH 5LG1A 3L4ZA 3ZDYF 3AU1B 3FFCE 4IRJC 4LQFH 4GBXB 4YHNA 1MVUB 3QUZB 2GAZB 3RO8A 5EBAA 1BX2A 4IDLA 3VILA 3Q48A 1IKNC 3S4SG 1IEAA 1U9KA 1VADA 1J9YA 5EZJA 3N50A 4AZCB 3MQIA 1DQDL 4QWWD 2WVUA 3F62A 3R4DA 5FF6A 1QO3B 3U4BH 2O61A 2FSEA 5L2JB 1S78D 5D7JC 5FYJH 3OJMB 3QIUA 1G9NH 1SEQL 1VESA 4YE4L 5DFTA 5KSAB 3OAUL 2OYMA 2VLKA 4XVJL 5J3HD 1C1EL 4IRSB 4MD0A 5JHDA 5FV2A 1MAJA 4L8CA 4JPVH 1A6VL 4MJIB 4OQ1A 3K3QA 4XBPB 4HULB 3WEMA 2VXUL 4J3VA 5DK2B 2QQLL 1QFHA 4QRRA 1MJ8H 3DWTA 2Q76A 1EEUA 3QQ3A 4K3GA 3ARXA 3TT1L 2YL6A 1RZFH 4U6YA 4EVNA 5L8JB 5JXEC 4F8TA 2YL5A 4JFXB 3BD3A 4YHZH 1MCBA 5EBWB 3PWUB 3SUWA 1CG9B 1KUMA 3RY6A 3UCQA 5IW6B 2D20A 4UV7L 2AVGA 4PGCA 1ZT4B 4Z7WF 3L6FA 2A9NL 3QP3A 1DQML 4CRPA 4XWOC 4I8DA 4R4ND 2F58L 2VDMH 3JV6B 5BS0D 3W27A 2WP3O 1IL1B 5IFTA 1K5NB 4BA0A 4F7MA 4PRNA 3ALFA 2WSKA 4JFDA 3X12B 2PETA 4LDOB 4XPFL 5TGBA 3MGOB 2CKNA 2BK8A 3C2AL 1LL7A 1DZBA 4WI6A 3QA3B 5F21B 1VHPA 1SMOA 1I1AB 1IGJB 1JWMB 3W37A 2QL1A 4HH9A 3AM8C 4EUPG 4TRPL 4KDVA 3BUYA 2DIEA 3GSQB 2QLVB 1QI3A 4GQPH 5DEGA 1EBAA 1XEDA 1HCVA 4PGJA 1XGRB 5K9OA 3MGTA 3WD2A 2NX5A 2GFBB 5MERA 4AD1A 4JZNA 1NDGA 4PJCA 3QHNA 2EIEA 3EO1A 7FABH 3FO0L 3O2WL 3TA9A 3MUGB 4JN2B 5I0DA 4JFZL 2VZVA 4XNXH 4M3KB 3QWOB 1ZT7B 3TCXA 3FB8B 3T77A 5IBTL 2VITB 2HWZL 4KK6C 2Z8VC 4L3CA 5TDOB 5MP6L 1I9JL 2GJRA 2VDLH 5GS2D 2X0YA 2FX8L 2HVKB 2C4FU 1T2QH 3P30H 1J12A 4JCLA 4NRZA 1YYMH 2FEEI 1JGLH 4MX7B 4XMPH 1CN4A 3RGVB 5BQ7B 5ECUA 5EU6B 4N0UA 2PI6A 4XP6L 3SUUA 3ULUD 1NEZB 3DBXB 5C09D 2ADGB 3TA3C 1QSED 3MRGB 4GRWF 1I7RB 3ARGA 2HFGH 3S88L 1I3UA 4PR5B 3G08B 3P9LA 2DSZA 2EECA 2P5WE 5DMIH 3D3VA 4M81A 4GAJL 4G7VH 5HHOB 5L2KA 2BERA 5C0RL 5I19L 1A9BA 1S7SA 1LJYA 3QDJD 1B6UA 3TTSA 2Z31C 1UR1A 4Z7VE 2OYLA 1DUYB 1ITCA 2F5AH 3BKYH 3QXAB 5ADOL 1BGXH 4KK8D 3IU3A 3FB5B 3KJ4C 4Y5XB 3EFDH 4HQQL 3FMGL 5HHME 3U9PL 3W2DL 4OIFA 3WIIH 5L6YL 1TVBB 1KV3A 2F61A 5HBFA 3OKMB 1Y18B 4DK3A 2A6KB 4FS0A 5FGSA 3ZDZE 1TXKA 4QOKB 4RWYH 3V5DB 4PRIA 5FXCH 3S35X 1G6RA 3N15A 4N0FB 4GI9A 1DHKA 1OP9A 3MRNB 5TH2A 3U6RB 2V2XA 1T7ZA 5KSVA 5BVJB 5JORA 1FVDB 2XY1A 2Y9RT 4JM2A 1HKMA 2HVMA 4KC3B 1F4XH 1SYSB 4XZBA 3V0WH 4QCEA 1C5DA 4NI3A 3UJTH 3SDXF 4CCDA 3B2VH 1KELH 1DWHM 1BZ9A 3VRLF 4N5UA 3MV9A 3C09B 5AC5A 5HYQB 1NJ9B 2O5ZH 4I9WE 3X3FH 1ES0B 5KZCD 1D6EB 2ED7A 4Y5YA 4XNZC 2JIXD 5DVNA 3W0WD 1GOWA 2JB6B 4HA4A 3B2UC 1F2XK 4F3FB 5BRZA 3RWFB 1P5VA 4MVBD 4G8FB 3O4OB 5GS0L 3TF7C 1UCTA 5F96L 1IC7L 4O2FB 3WNPA 4Z9KB 1GHFH 3JZ7A 4G6FD 2APWA 4NQUA 3HAEB 1KT2B 2ICCA 4ZNEE 4JFYA 4U1GC 2YZ8A 2DT3A 1OAUL 4BZ2L 3HZYA 1IKFH 4WUUA 1I8KA 1B1YA 1QBBA 2OCFD 1NQBA 3QGVA 1P5UA 1RIUL 4LSQH 3RWGA 3L2LA 3S3SA 1MAKA 4X7SH 1JWUA 5DQ9A 1R24A 4HAFA 2W65B 5DFVD 3BZEB 1K2DB 3C60B 5IFPA 2UY6A 4LP5A 5BS0E 1JNHA 1A4JA 4TNVK 4QCIB 2C5DC 1WIPA 2PYFA 3QAZC 1MFAL 1Q9KA 4LCWA 4ZUTB 1FNLA 4WW1B 2OL3H 5TPWL 1A6AB 5AWNH 2WC4A 1BQHB 3TH2T 4CU7A 3I6KA 2WQ8A 3IVKB 4X6CF 2V3DA 1IGTA 2C1PB 3RJQB 3MMDA 5HGBA 3LRHA 4R3SB 3O6ML 5IR1B 3BO8B 3RUGF 3CX5J 3CLEL 4WUKL 2IADA 5EORL 2J7DA 4Z0BL 1SBSH 4PGEA 4CD4A 4OCWL 1P7KA 1TZGL 1MCKA 1DQLH 3G5XA 5IVXB 2X4TA 3TWCL 1YA5A 4OOUA 5DFAA 4YHPB 3BE1L 1J88A 1MI5D 3W9DB 1HHHB 1JF6A 3G6JF 3OR7B 1S5IL 2YUVA 4PJFF 3UTZB 1KWGA 3MRPB 4QHMA 4H26B 5EBGA 4D6JA 3HS0B 2MHAB 3RVWD 4P5TC 5DWUL 8CGTA 4KJYA 4OKDA 2MQCA 2FYYB 2MSPA 2EYRA 4R7DA 4G8IB 1INQB 2IQAB 1TZIB 4MS8D 3DMMC 3P4MB 2ADJA 2NR6D 3ARDA 5C09E 5F88A 3CVIL 3OR6A 3Q6FA 5ICXB 5TF1H 1QSEE 3O8XD 3NABL 2PUQT 1CFVL 4I18B 3NGBB 3TYGH 1KGCD 4Y88A 5FCUL 3QXVA 5CEYA 4NPYB 1X5LA 5F89A 1XHGA 1PZUB 1S3KH 1N59A 5HI4D 1T66D 1G7QA 3QDJE 2BNQA 4ZO9A 4RL3A 1P4BH 7A3HA 2W9DH 4H25A 3LMJH 4L4TA 5J13B 3KPNA 3CFJB 3MSDA 5J12B 2OR8A 2DKSA 5IFHH 2IGFH 1YEKL 2ADIA 4HPYH 5JXAL 4PJBB 4HS6B 3NUKA 4YFDB 2A9ML 5DYOB 4DFIA 3Q5OA 5D6DC 1A5FH 2I24N 2Q3AA 2XFRA 2VAAB 3IJSA 4QF1A 2VUOA 4HIIA 1R5WA 2R29L 4JFED 43CAB 2HJLA 4KUZH 1T7YA 4OT1L 3NCJH 3DLQR 5IMKA 4APQC 1TQBC 1GGBL 4CMHB 1HQ4B 3NFSL 1PX8A 2NSXA 5JOFA 2Z93A 1JGDB 2DM2A 4NFCA 5CJ8A 4LDLB 5EOQL 1G6VK 4XCNB 2DLTA 3PV6A 1FLRL 4PYGA 4LCCC 4UT9H 3T65B 3U0TA 3QOKA 1JNLH 4V2BA 4XCEA 3MSPA 3VFTB 4F7TB 4Y4FB 3PP4L 3GSXA 3NIFE 5I77A 4XVTL 5DHXB 5SV4A 4UFLA 3OGRA 5GGUB 1UD2A 1AKJA 2GK2A 3IXTB 4RNRA 1Q9OA 1MPAL 5HYSG 1IGML 1Q0XH 3TNMB 3I9GL 4ATLA 3JV5A 1ACYH 1XF5A 1D5MA 5ETUA 2F15A 4W8AA 1FZMB 1KIUA 5KS9F 4YHMH 4HZLB 4N0RA 4CVXB 2EPKX 3PE9A 1A7RH 5CP7A 1CK0H 5EFDA 2QQQA 4LSRL 5IB3B 2VL5A 4YBHA 3LQAL 2CIIA 1MWAH 4HJ0D 2AK1L 5JW3H 1ZBKA 1S9WB 1MQKL 5SWQB 2BRQA 3KLHC 4HGWA 1X5IA 2LU7A 3LSOA 2WAHA 1HP5A 2EE2A 3CUPA 1FVEB 1BQLL 3DUUB 3HU7A 3I02A 1ZEAL 4U1LB 5K9QG 3NZ8B 2ADFL 2NXYB 5F7DB 5I1LB 5LGKA 3U5UA 5I8EA 4C56D 4YBQC 2E9WA 3GJEB 5EZLA 2YBUA 1MHCB 2KQNA 1CLOL 3QRGL 1EOMA 2PYEB 3OF6D 4Q0XH 1VGKB 4NOFA 4K3DH 3MODH 5I1AB 3VMNA 3QEQD 4P2QB 1K6QL 2DQHH 4O9HH 4JO1L 1IQDA 1UB6B 4M6OH 4UUJA 2EQDA 3CZFA 5A2IH 4DVRH 1T20B 5FA3B 5ESQA 4GRLA 3L5IA 1DLHB 3RKPA 2EIBA 4XC1L 4GXUN 1A14H 3TN0A 1L4IA 5CGMA 1CBVH 3MRKA 4LSUH 4X7EC 3RWCB 4QYOB 3O9WD 3SDDC 2X89A 4DWSB 4KK8C 3LEVL 4RGMB 2HRLA 2NCMA 4PFEA 3VXNA 1KIRB 1KPUA 1MI5E 1ORSA 1FLTX 3H8NA 3MA9L 1VFFA 2JLLA 2IBZY 2LTQB 1UVQB 4YHOH 3RHWF 4G7YL 4E5XB 3RWEB 1OIFA 5DR5L 4X6EB 1ETZB 3BKMH 4ENED 4HEME 4JY4B 4AK1A 5A94A 1B3VA 1M1SA 1JNEA 1T5XA 2APTA 5EBMB 2XN9B 5AYIA 4D9QD 3RZCB 3WF3A 1P84J 2ZUMA 1PLGH 1B9ZA 5DUMH 2Z1SA 4N8VG 4BK4A 4U1NA 2YS4A 2X1OA 4NZDA 3S2CA 1HHJA 5C9JA 2J8UF 3JSSA 2XVPA 1G01A 3BIAX 4YEEA 1N3NB 3G6DH 5E4EB 5BO1L 1PYWB 2D7QA 3OKOA 5H37G 5I66A 1EFXB 3WO4B 3ZDXF 1U8LB 4S2SB 3SE8L 5E9DB 4CD6A 5HDQL 1RULL 1QSFE 4I3RH 1BBDL 2WVSA 1CFBA 3C6LA 4AQOA 3A3HA 1SMAA 2VXSL 4ZOBA 2VNCA 2H41A 2MTPA 6CGTA 1KG0A 3VI4E 5EUKB 3D39D 4XV0A 1JYVA 5GGTL 1IC5H 3QJFB 4TVPL 3S35H 4H7VA 3CFBB 4D8PA 2W66A 1S7VA 4NZUL 5D8WA 5CGYC 1CXLA 2EYSB 3HE7A 4URTB 4JO2H 2AQ2A 4RQQA 4YXKL 1TZHB 2NY0D 3LPOA 2HRPL 4HIHA 1EK3A 4FFZH 2CIPA 5JPNA 1Q4NX 1N4XL 4PJ9A 3A0OA 1MNUL 4BQ9A 1JF1B 2XKNB 1AQHA 3GBDA 2Y5TA 4NO3B 2K1MA 4U1MB 1DFBH 1I1FB 2YWYA 4PJ5D 4XI5C 2X70A 2ZUXA 1HJWA 1V7ML 4L1HA 1J5OL 5DRWA 3W28A 3AREC 3DV6B 1KBGL 4JB9L 4KKCC 5KSBB 1AFVH 3LRSA 2AJ3A 3GNOA 4QO1A 3LIZL 4TULH 3TBWA 2BY3A 3M45A 4RFNC 2VI0A 2ICWB 2G75A 3FO2A 4TOYL 4M6ML 1ZGLP 4YR6A 2CUIA 3WFZA 2ZOKB 1XF2A 1CLCA 4HPOH 3F58H 3HNSL 5A16A 5EWIL 1B31A 5A2BA 4D0BA 2VC9A 3QIBD 2P5EA 3R8QA 1G7HB 3PL6C 4JO4L 3O3UN 3PTKA 4FFYH 1CICB 1XR9A 1KTDB 1ORQB 4C56E 3CXDH 1LMKA 1U91B 4H5SB 3VXMA 4R26H 4J23A 1E28A 2F54A 2OX5A 4LCIL 4YO0B 2XFYA 3QEQE 4P2YA 5C6PB 3ECQA 1BVLB 1XGUA 3O8XC 1MIEH 4PUBL 1XGPB 4PJXB 5MEOB 2NY5H 4KRPB 1UA7A 5ISZB 4TVCA 1JHTB 4WDIA 4EBQH 3OKLB 2A6JB 1RUAL 3F7YB 2VVSA 3IU4H 4RMUA 1I4FB 1A6ZB 5IESH 1E0OB 3DXAD 4HUVA 2DQIL 4QHKI 3MROB 2P42B 2KPNA 4FP8H 3HE6A 4YHKH 3CTTA 2WCAA 1MLCA 1AGDA 3CBWA 2P8LB 4EDWL 1KCRL 3AXXA 3JUYA 1S9YB 4YFLF 5IKCA 4DEPB 3IAQA 1PQZA 4P59L 3QDMD 2WMJA 3D1MC 5JW4M 5DLMH 5FK9B 1YEHH 4LEOA 3FTGA 3LKRA 4RZCB 4XVUD 1RQ5A 4QRPB 2V3FA 4HBQA 4IPNB 3X13B 4PRWA 2DSWA 4AD5A 4D9QE 2WUCL 1FZKB 4LHUB 4AYFA 4UB0H 1KIPA 1OM3L 4OM1H 2BVPA 4HW6A 1R5IA 1UQSA 2VTFA 3DYOA 4OCMC 2FIKA 3SKOA 4JM2C 3MJGX 3FW6A 1D5BA 2HVJA 1NCCH 2ARJA 4HG4K 3LKSA 5FB8B 2R4SH 2B1AH 3B6SB 4W70A 1C3FA 1QRNE 3V6ZB 4ZXBA 4UIMA 3GSNB 3MV8B 3PWPB 1EO8L 4IMKA 2YC1B 2HG5A 4Y5YC 4CVZB 3LMYA 1GQKA 4I2XB 2Y6SC 2PXYA 4OGAC 1HIML 2BFVL 3NSNA 4L29B 5INCB 5I2UA 5D7LB 4X80L 3RBGA 3D39E 2CXKA 5F7YC 3IJ7A 4G9FD 3EKCA 1HNYA 5I18H 1XF3B 4JG0L 5C6TH 2G3MA 5FHBL 1EUTA 4H1LB 4GKSA 2L0DA 4GQ9H 4UINL 1CE6B 4S1QL 1PG7W 3DUHA 1BQSA 4ZOEA 4AZIA 3NCYP 4CGTA 3MV7A 4S1DD 1HXJA 3EYQD 1S9VA 1R3IH 4JQVC 3W5NA 2YD9A 2ESVD 3VA2C 1U6AL 1LF1A 1OWQA 2E4TA 1Z5LA 1XGQA 2R1WB 1LO3L 1RZ7L 3SQBA 2Q6WB 4H8VA 3QG6A 1FG2A 4PJGB 5H2BA 4HDIB 1LGVA 1N5YL 4D6EA 3MNWB 1ZL1A 3QYCA 4XPGL 4GO8A 2YRLA 1OSPH 2QTEA 4PJ5E 3O3DA 3LQZA 4HKZA 3EGSA 4S1RH 1UCBH 2VWEE 4JY6B 2WVTA 2CNCA 5E56A 3WN5B 4AD3A 2I9TB 1K3ZA 4R5EA 1C8PA 5C0DB 3EAKA 4FTVB 1GAFL 5HGDB 5CILH 5AYUL 2ED8A 1N2RA 4TPRL 3QULB 1G7PB 4ZS7L 3VD4A 2VN4A 3F7QA 1R5VA 4JDTH 1OF2B 5J9PB 3CFKA 1NLDH 2COQA 3BXNA 4YDLC 5CIPH 1MW3A 5TFSH 3MLRL 3BAYA 2A3CA 4Y4HA 4YDJA 5CQ1A 1IM9B 3BWAB 3OAZK 4I77L 4HBCL 4AZ8A 3HJEA 3DX9A 5DEFA 1WAAA 1D7FA 4OUUB 3W82A 1I1RA 3B5TA 3D69B 3QO0A 5FYLL 4Z77A 5SWSB 4DZBB 1K8IB 1QI2A 2QPUA 1VFBA 4OZFH 1FGVH 4K55A 1WSST 2BMKA 2WMIA 1Z2KA 3AB0B 3AICA 4MDIB 3P4OB 2OI9B 3DSNA 4PRHD 3MJ7B 5F1SA 1F4AA 1OHQA 4J1UA 2GJ6B 3SKUD 1FYHB 2EIZA 5FV1L 4XGZA 1F00I 2MNUA 4OCRL 4ORZC 3MFFA 4KI5D 2OZ4A 4DAGH 2CKSA 1IC4H 5INDB 1C08A 3WHE0 5DFWH 4HUNB 4P57B 2FJGB 5JIWA 5FDYA 3EYPA 3VDCA 4WCYH 4GH7B 1MFBL 1QG3A 3HAEG 4XVSH 1WBZA 1N26A 4QRQB 1B0RA 1RZKH 2G5BB 1RZGA 4F9LA 2GSGB 4GSDH 4M7JL 5CS7A 3IDIB 3QDGA 2P24B 2W0KA 3KDMA 4W6WB 5AZEL 1BWWA 1MQQA 5FUZL 5GS1C 5DJ2A 4BFBD 2YD5A 3KXFD 1U95B 1A6PA 2FGZA 1HDMA 1E4KC 3WD5H 1MRFH 3GM0A 3GH4A 4ORGA 2LVEA 4QLKA 5ITFB 5EPMA 9CGTA 1RVFH 4OF7A 5CEZE 1F4YL 1QFWM 1X3DA 5A2FA 2DQEL 1JJUA 1JWSB 1FL3B 2VDKH 4AEHH 5D96C 1BGAA 1NCTA 2KUTA 1JBJA 5GNXA 1NSNL 1HSAA 3RDTB 5EU5B 4X4XA 5IBLD 1BLNA 3D2UD 3HTLX 1SQ2N 2XY2A 1AGCB 3E8UL 5DGRA 1BQHG 3WUGA 3R8BB 3H3KA 3FFDB 1KIQB 4CKQA 3EYVA 3QHFH 1MLBB 3CMJA 5D9MA 3WHXB 1JP5A 1UG9A 3T2PA 5GZOC 2A73B 3T0ED 3H7LA 4XB3A 1I9EA 4KJWC 5F93C 1IBGL 4NJAH 2Q7YB 1CGTA 4NZRL 2NLJA 3F5WB 4MD4B 5D5ME 1KNOB 3T8XB 1UG6A 4LSPH 1TJIL 5M7QA 3HC0B 2HAZA 2IG2L 3ZKXB 5E2VL 4UV4L 2VIRB 1CL7I 3IFNH 5GXBB 2OSYA 3CHFA 4GG8B 1X4XA 5ALBL 3RNKA 1QVOB 3WJLA 3ZSTA 5LA2A 1PFCA 2VCBA 2V7HB 1IT0A 4N5ED 3KPPB 3HB3D 1FPTH 1A1NB 5EN2A 2ESVE 2AJXL 2CUMA 3DX7B 4NJ9L 5HVGB 5BZDB 2AK4E 4MSWA 2NMSA 4WU5A 1JFQH 4EI6A 1QNZH 1BOYA 3QIWA 1LO2L 3WMBA 1LDSA 1I8MA 3TIEB 2EYTA 4J6RH 1U8IB 4TSCH 4MNGB 2CQVA 1QBLL 3CSYB 1GQJA 1UWSA 1I7TA 2NQCA 3T4YA 1WBYB 2JCCB 4OLZL 4Q6IA 1FP5A 5SWZA 3HMWH 5DTFA 3E0GA 2YHGA 4QT5A 3T09A 2I07B 2K7QA 5IMLB 4PBWD 5SX4I 2B8OT 2IPUK 3C08L 1YPZB 2R0LH 3KPQB 3K2UH 3WXVL 4JPIB 3BPOC 1HQRA 3FCTA 5DUPL 4WU7B 3GMRB 3LB6C 1SY6H 2VR4A 4WWID 1GOIA 4ODTH 2I9LA 4BZ1H 2APFA 1CL7H 5GRWA 1HXYA 4GRLC 2W38A 1HKLH 4WIWA 1WEJH 2UUDK 4MA3B 3WL9A 5DMYA 3RDKA 1NLBL 1MCIA 2BCKA 3MLSL 1DQTA 2QQKL 3AVEA 3C5SB 4PMOA 5C7XL 1RJYB 3VXOA 2C8NA 4P46D 4ZDHB 4C7GA 2CDEA 2BSSA 3JUZA 2DJSA 4J8RB 4L3AA 3T3PF 3SDAA 3G9AB 4JGUA 4P9HC 5EOCJ 4FMFA 4KVNL 3W6LA 2HJKA 3DROB 1J8HD 1VFAA 1UWIA 4WWKB 2XVKA 5E8DH 5IM7B 4LVHB 2CLZA 3PTMA 4FQLL 3WFHA 3L3IB 4WO4C 2PCPB 3RZWA 2P7TB 5KVFL 5IF0B 4KV5F 4D9LL 4U5KA 3QDHA 3P0YH 4KI5E 4TUKL 1Q0YH 3LVEA 3K81A 2XRAH 3C6SB 1CDGA 1DBMH 2MKWA 3WIHH 1IGFL 1LK3L 1ZA6B 5JQHC 5FL0A 1CDUA 3TBSA 5FOBB 4EDXA 3RVTC 1W8NA 1MCQA 1VGEL 1WF5A 1Q6FA 1WIOA 4GRMB 1I9RL 4ZUUB 1I9IL 5DMGD 2XIIA 3KLAA 1R6VA 2B20A 3IDGB 3WFEL 1P69B 4K94H 4GI8A 3GNPA 1R87A 3V7AG 1IARB 2RR3A 1YMMA 3B5HA 1HKFA 4PJAE 3VGDA 4F2MA 3KXFE 4ACYA 3KPLB 2NZ9D 3V4VH 3LKQB 3C6LC 1YNTB 3T04D 4Z2IA 2XZCL 3BYTA 5IVXF 12E8L 1OAKL 2R0KH 2G2RB 4K3EL 2IANE 4P2OC 4TN9A 4D3CH 3TP4A 2UY3A 1YNLH 1PIFA 1HYSC 3RILA 1U2YA 1OVZA 3CMOL 4O2CB 3RIAK 3SCMB 1MRCL 1DN0B 1I85A 2HT2D 2IFFH 3QEGL 4KJQC 1FFPA 2VN7A 1SM3L 1ONQA 4BSJA 2F53A 4NRXA 4UBDD 3TO4C 5FUOL 3JTSA 3STBA 3T0EE 1KCUH 1U41A 1XH1A 4DKEL 4FQ2H 1UZ6F 4KRMB 3MUY1 4L3EB 4XC3L 1N64H 1K9DA 3VIKA 1EH9A 4EIGB 3MRHB 2PO6D 4DW2L 2YKLL 5IB2B 2IUZA 2VR9A 4U0RC 3IJHB 3ZOAA 4KY1L 4HMCA 4FG6D 4MA7H 4U1IB 5I30L 4W86A 1YNKL 1ZBCA 4N8CH 2JK5B 2OL3B 3EOTH 2D7OA 4J3TA 2X4PA 3CCHA 3TTYA 1FYTB 3QFJA 1WE5A 1KTLB 4MAVA 3OB0K 1UM6H 3OKEA 4JHWL 1UA6L 3MREA 1UQYA 4C4KO 4MCZB 4M56A 4ODUA 4PJBF 1E6ZA 3WFCL 3S3PA 2CLVB 2YPLD 5HY9A 1F3JB 3HZKA 3UTSD 1RZIB 2EKSB 3GJFH 1A1OB 2HLAA 3WDIA 3I75B 3FOMB 1N0XH 2VDRL 3V6BR 1DDHA 4NT6A 1DBAH 3ULVL 3HMCA 5B38A 1NFDE 3NCFB 1F6LL 1MRDH 3N9KA 2DI8A 3HR5B 4QGYA 4ZE5A 4G8GA 3GSNL 5E2WL 5HGHB 3FFCB 1UZ1A 1W91A 3MLWH 5C0CB 4XUYA 4FZEL 35C8H 5E5MA 4Q9RH 3MJ6A 1I1CA 4JREB 3BN9D 3F7VA 3QI9C 3MSGA 5LA0A 1YEFL 5GQBA 4IBLT 5AAMA 1AR2A 2AOSA 1GL4B 3KYKL 1KC5L 1WZMA 4W84A 5DO2C 3KPOA 3VJ6A 3JTTA 3OZ9L 1FAIL 1KXVC 1L9MA 4Q58C 5CEZH 3JWDH 3UETA 1ODAA 1OTUC 3FOLA 5DJ0A 4CU6A 4CCEA 5JW4Q 2C1OB 4LYPA 3HE6C 4K8RC 4JVPA 2BS9A 4ETQA 1ZHNB 4LPYA 3EHBC 1ZT1B 1O7SA 3KS0H 3BSGA 4ZQKA 2UVFA 4P4KA 5ANMA 4R2GD 3V2AR 4NO0D 3WLWC 4U1KA 5HGAB 4ZAKB 3SQOH 4GW5B 4JFFD 2EE9A 5CHNA 2FO4A 3WSUA 2NY7H 4JHAL 2DJUA 3IDYC 2ZJSL 4FNLH 4OZGE 2CK0L 3ARRA 5I6XB 1VRXA 3PQYD 4KTEL 5ICYA 1EA9C 4NQVB 2DYPD 1DL7L 5KAQG 1F8TL 1F90L 1UWGL 2D31B 3UG5A 4NKIL 4F9DA 2ZOXA 3MRFB 1CD9B 1D5XB 2OWCA 2J88L 5E6ZA 2AV1A 3S36X 4ODWA 4LVEA 5GGRB 1A6TB 1IAOA 5D2NA 5GIRA 4KQ3L 2EO9A 4M1RA 1MH5A 2XA3A 3ZTJH 5IQ9B 3QUMH 2MQ3A 4KK5D 5I3DA 4LAQH 1NBVH 5I1IH 5K9KB 3RQ3A 4WW2B 1EO7A 2PXYC 4V1DD 5KZ6A 1V03A 3OGCB 1V3HA 4QHLA 3R0MA 3ABZA 3K80A 1PG7X 1U8PB 3FT2A 4I0KA 4YK4B 5E1AA 1OD7A 1QNSA 1TJHH 5FGBA 4TQEH 2AJZA 3O11B 1Y0LA 2HH0H 5I74B 2NNAA 3ZLQC 3UTPD 2Z1KA 5I73B 3L7FA 1WNOA 5E2UL 4ZOCA 4DN4L 3LAFA 3H0TB 2VH5L 2PR4L 1JNNH 3O4LA 1UEMA 2VX6A 2Y07L 4RMQA 1T1WA 2HYMA 4LPWA 4AG4H 2PF0A 4JPWH 1CE1L 2OTUA 2IJ0C 4PPTA 3B9KB 4KKLC 1XSJA 4BSVB 1GGCL 3DX6B 4P4RA 2AMGA 1EFQA 3AYSA 1JGVL 3PGCA 1NC4B 1CGUA 1MWAB 5IJVA 4X6DE 2NT0A 2NY1B 3RM9A 3HFML 2FBJH 1JXJA 5JZ7C 4X9BA 3KYMB 2V2WB 4LQFL 5ESAB 5GGRY 2CK2A 2AKRA 2JJWA 1QFUL 1BOGB 1JGIA 3EDEA 3WUWB 5D1ZA 4JRYA 1QPKA 1NCAH 3GNMH 1EGJA 4JAWA 3AIQA 1YC8A 1UYQA 4W8BA 2P5WB 3K7UA 5HYJB 4E4PA 1I8IB 3U4BL 3ORJA 2CIKB 3GMNB 3SOBH 1JYXA 1ZVYA 5FYJL 1TUXA 3EJZC 2YPLE 4Z7VB 5I1CH 1G9NL 1FCCA 4BH8A 1JF5A 2NY6D 1D9KB 5CWSB 3FO1B 2J79A 3EYFB 1ZA3B 3UTSE 1EEQA 1EIBA 1N8ZB 4U7SA 4Y2DA 2XVNA 4NNXA 5HHMB 2XTJC 2CPCA 1RK1B 4JPVL 4LLMA 1VFUA 3JV4A 4HFWB 4LHUG 5H94A 1NUGA 5FM5O 2X4QB 5DHVB 3CZJA 1PZ3A 1BYBA 1MJ8L 4L9DA 1N82A 4P2RA 1B3WA 1Q8MA 4Y7EA 2GVYA 1CG9A 4F37F 2IMMA 5C0ND 1RZFL 3QIUD 4YHZL 2YKKA 1ZT4A 2VLKD 1CGXA 3DHMA 4U6TA 1EHXA 5JHDD 5BRPA 5I5RA 1IT9H 1VACB 3JV6A 5JA9A 3T0BA 2ESCA 2FZ3A 1CFSA 5JLZB 3HMXL 4HFUH 5GJSH 4W81A 1XSIA 5KAQF 2VDML 4JANB 1CZ1A 3MRQB 1NUDA 3RP1A 4F7EA 2EDDA 1O7VA 3IFPB 3O3EB 5GHWH 1BEYH 5E5RB 4DKDC 4RMVA 3AHTA 1V5JA 1OQXA 3NAAH 3VWKA 1QNRA 3QA3A 2YLAA 5KSBF 1WPCA 5AUMB 4ZD3L 4H1LG 5B4MC 3REVB 5I17A 4ZTOL 3EO0A 2D4FA 1T3FB 3GIVA 4KTYA 2FH6A 4R0LC 1KTKE 3SJVA 1E1EA 4UI2A 4V28A 2EDYA 3ARWA 5T3ZD 2VRKA 4F33B 25C8H 3N13A 2GFTA 4OQTH 4PGBA 1C12B 4JFFE 2AV7B 5DI8B 5TE7H 1JMZA 1EAPA 3UR7A 7FABL 3IDNA 2NW3B 1UJ3A 3MNZB 2YA2A 4LCYA 3RTQD 3PQYE 4TNVF 4XNXL 2JF7A 3SY0A 3PWNA 5CD5D 3U7YH 3ZSSA 5C0BA 1NARA 3EYOA 4IJ3C 5JHLL 5BOZG 3U7VA 4FK9A 3UC0H 5BS0B 3TNNA 5I2IB 2NX5D 4X6FB 5BQ7A 5HYEA 3P30L 1T2QL 4HHAB 1YYML 1M6OB 1JGLL 3W24A 5DJAA 4PJXF 4XMPL 1J0IA 4OTXH 1AI1H 2GJJA 4X5WB 4L9LA 2VJXA 4D0CB 3SDYH 1AVAA 1FNGB 3ZE2E 2E7LC 3MRGA 3P4LA 2G60H 2GSIB 2J74A 3A6BH 4NKOA 1EXUB 5IMMB 4V1DE 4CD5A 1OTSD 1GIGH 4E41A 3Q5YA 2ATPB 3V4PH 3WXWH 3QXWA 2HFGL 4M8VA 4AY1A 1RURH 4PJ7E 3HPLA 3DVNB 5E00B 5A40E 1BAGA 1P6FA 5DMIL 5IQ7H 5D1XA 2EEAA 4G7VL 5HI5C 3WJLC 4RGNC 2OWXA 3FB5A 1E6OH 2EZ0D 3MCLL 1MJ7H 5BXTA 2F5AL 3BKYL 4P2CG 1BGXL 1T21A 4I0PB 3OKMA 4A4AA 3EFDL 1L6ZA 3ARGD 4ODBD 5C07D 5J1AA 2DRUA 3MO1A 5IEKA 4B5EA 3RWIA 4QOKA 1OBAA 4NUJB 3QIWC 4NN7C 4KWUA 3VI3F 2FRGP 3H6JA 2LAGB 4N0FA 4K3JL 1M03A 3EDFA 4RWYL 4BFIA 5DURD 5BVJA 3L2MA 5IIEA 4LGSB 3EJYC 3QNXB 3CMGA 2FEEL 1EV2E 4MNQA 1XIWA 1HNGA 4MADA 1JZ2A 4OF6A 3BN9C 3ULVF 4GBXD 3PHOA 5C09B 5HYQA 3FQTA 3UJTL 2Z92B 1QSEB 3ARFA 3L5XH 3B2VL 1KELL 4MLSA 3V0AC 1OGTB 3L3JB 4G80A 1JZ8A 2O5ZL 3KWWA 3P77B 1NGZA 5D7SH 2FB4L 3TONA 3ZZ1A 4LASH 3X11B 5JOEA 1W0VA 3NYDA 3KZSA 1FDLH 4FQ1H 4ZFFA 3LPPA 4LSDA 5A6BD 2QJDA 3LEXB 3QDJB 3GIZH 2X1WL 5LJYH 3KL5A 1EEZB 4OAWB 1GHFL 4QDMA 3QG7H 4MQ7B 4OLXH 2C7UB 5KSAD 5IGXH 3LKOB 1UKQA 1U58A 3KPMA 4IRSD 1IKFL 4B9ZA 4MJID 2VQUA 1W9XA 2CSPA 3NN8B 5BRZD 1VJSA 2Z35A 2MPAH 4UAOC 3TJEH 5C0GB 2YMXH 1I7UB 4OLYH 4LSQL 3MU7A 4N1CA 5FO8B 1K2DA 4PJGF 2VLKE 3FQNA 4Y8AA 5JHDE 3WKMH 1GOHA 1FN4A 4G6KH 3VFOA 4C54A 4UOW0 5KVDH 1ZU8A 3S34H 3WCYA 1I1YA 1WFOA 2L7JA 1A7BA 1U93A 3PHQA 4QRRE 5EIVA 4XAWH 1RD6A 4OGXH 3VE0A 4LSVH 3DI2B 5DRZA 4OD1H 4YHYC 4M1GH 3IVKA 4RAHA 3BQUA 5KZCB 2OL3L 5AWNL 1BECA 1HEZA 2JIXB 4CL7A 1FFRA 3KLSA 3VRIA 1U30A 2R4RH 4MJ5B 4R3SA 4CBPA 5IR1A 1WICA 3MOBL 4M1DH 1QBAA 2VT0A 5BRQA 5DEZA 4W5UA 1IAIM 3CH9A 4L1DA 2R2HB 3CUHA 4UFJA 3QZWA 1SBSL 3VGFA 3GKWH 4XHJC 4DWHA 3MLYH 1FZOB 1MJUH 1FIGL 4TSBH 5IVXA 3VFUB 2HJFA 4JFDE 5IB5B 4BCEA 3UTQA 4ZYKB 1DQLL 5GS0C 4HWEH 1S7UA 1L6XA 4YHPA 5DJZB 3TC9A 4MGXA 4U05A 1LEIB 3OR7A 3UTZA 4GS7C 4ODVL 1V0KA 2CRIA 5HDLA 4XXCA 5FOOA 4ODHH 2BSTB 3KYOB 5JUVA 3UZVB 3W9EB 1I85C 4GPNA 3EYUH 5CEXB 3F12A 2R1XB 2NX5E 3UZEA 2FYYA 1ED3A 3TZVA 4P3CH 4PJCE 1RHFA 5FKYA 3C5ZC 1P7HL 1BREA 3MMUA 2JTDA 1BZQK 3ARBB 4M93C 2XIBA 4LK4A 5ICXA 4NWUH 5I79A 3QXDB 5DK3A 6FABH 4XPAH 1KYOJ 1NMAL 4QTIL 5TF1L 2NTFB 5D9PA 5D71H 1OGBA 1QA9B 1H5BA 3TYGL 1PG7H 5DJ6A 4NCC1 4PV9B 3TV3H 5B8CC 1TTUA 4N0UE 4JZJA 3LHPL 1DE4B 3QHOA 1FFNB 1P4BL 3P73A 3ARDD 5HHOD 1HIZA 2W9DL 4HKJA 3LMJL 2WZHA 1C93A 3H9HB 1MI5B 4K23H 1ZS8A 4NN5C 5LGJB 5IFHL 3O81A 2IGFL 4X99A 3D3VE 4HPYL 3BP4B 3O6FA 1WDPA 4RISH 5L2KE 2AJSL 4NUGH 1CBGA 43CAA 5CIPB 1T0MB 1FH5H 1A5FL 1WIUA 2IF7A 1MHPH 4X4YB 1PIGA 1UWEL 4L4TD 4QXUL 3VFPB 4KUZL 3NCJL 5E6IA 5ID1B 2NXZD 2ZCLH 1T6VN 1JZ7A 3RJYA 3K8MA 5HVWA 4U33A 3LS4H 3MRIA 4P48A 5T1DH 4BQBA 4YHIB 1HCFX 4C7DA 2VCAA 2WHKA 4G42B 4PRIE 3DRTB 1N6VA 1E27B 3BGMB 2VX4A 3RM4A 4P23A 4UT9L 2WBJC 4O5LH 4U0QB 2E6PA 1BVKA 2QPSA 4FXLA 4YUEH 2KZ1B 4MNMA 4AXNA 4BSWB 3NFNA 1ZHKA 1YY8A 2CKBH 1AGBA 3OX8A 4LPVA 1RUMH 2DBLH 4F7CA 1WDQA 4DFHA 2ZOLA 1QSFB 3WEXB 4EI5C 1MUJA 1HNFA 1DVFC 3MV9E 4X0VA 3E6FB 1QZ1A 3RMEA 3OTTA 3FO9B 3T2NH 1Q0XL 2X4NB 4CVXA 2VE6B 5GGSA 3CZ8A 4YHML 4HXBH 4DCQB 4MAYA 4XPHL 5BRZE 1HVXA 1FE8H 1MCWM 1BPLB 1A7RL 1CK0L 4XCCL 1AP2B 2ZUVA 2UZIH 1S9WA 3TVMA 5J6GA 3VW3H 2W62A 1W3LA 4YIQA 3ZJ8A 3VH8A 1AKJD 1MWAL 4BK5A 4PD4J 2Z8RA 5JW3L 3DGGA 1UXSA 4M8QA 1ZHLB 4LRNL 4WUUE 2JCCF 3C60D 3QNZB 5LQBH 3SEPA 5FO7A 1CF8H 4L8SA 5DUBA 5KG9A 1JXKA 1QFWI 5DDHA 1UWRA 4S1SH 5F9JA 1GW1A 5F7UA 1A3QA 4Z5RA 4CW1A 2OR9H 4Q0XL 5D2NC 3K4ZA 1M4KA 4K3DL 1YPZF 3SDCA 1UB6A 3T3ME 2RB8A 4A6YH 2JFEX 4MA8H 1AHWA 4Z7NF 3CDFA 5DD0H 2DQHL 4PMVA 5FGCB 4LLUA 1QYGH 1DLHA 3GSUA 4M6OL 3G5ZB 3QUYA 4DVRL 3W39B 2WUBH 4LCWE 1ODUA 2WP3T 5F3HB 4WKFA 1KEGH 3QH3A 1P9MC 4U1SA 3V6OC 3RI5F 4POZC 4MNKA 3P4NA 1A14L 2FIRT 4D71A 3FB6B 4MDJB 5BROA 4LSUL 5F7WC 4ZNCD 4YGVA 1OQOA 3DUSB 3STLB 5ACMA 2H26B 4H0IA 2EH8H 3FQRB 2CLRB 4WJ5A 5CJOH 3Q6GH 1RIHH 1FFOB 4GXVH 3TFKC 1A6UH 2W0FB 1SEBA 4X6EA 1J86A 1ULVA 4LOUC 4YHOL 5IB4A 1LO5B 4XAKE 1KJ2A 4JY4A 3TN0D 5I8OH 4AH2B 4I3SH 4C56B 3LD8B 3EOYG 3LQAC 3UBXG 3BKML 3JBG7 4IOFC 2GUOB 2GT9B 2Y72A 3SE3C 1U8OA 1QFWH 4G9DB 3QISA 4XTRD 3QUZC 3AXHA 2E9LA 4FLRA 1PLGL 1XCTA 3QEQB 3O6LH 5FHAH 2IALB 2VISB 5DUML 1CFNB 2X5PA 1V6XA 4JEGB 1OARH 2R15A 5D4YA 1CXIA 3MLXH 5SV3A 3SCTA 1U3HA 5GISL 4JDZA 3QJHB 2CGRH 3BHBA 4WI7A 4ISVA 1U92B 4XMLH 5HBBA 1G9EA 2PW2A 1XGYH 3G6DL 4Y4KD 5E9DA 3PDOA 5EOTB 1A6WH 1WFTA 2VLME 3VFRA 4ZO7A 4PRAB 3ULSB 5EO1B 1YY9D 2XJ7A 1JNDA 4BUGA 3CFCH 3J7HA 3CUFA 1CR9H 3QJFA 2A2QT 2NYYC 3ZTNH 4L4VA 2YBTA 2ZG3A 5B39B 4Y2DC 1IC5L 2W63A 3BJ91 1W8OA 2BNQE 1S7TA 3S35L 5I15H 4UZUA 3VM5A 4DM2A 2EC9T 1CDIA 4HX1A 4L4TE 1HN1A 4BQCA 3BCDA 2B5IB 2RCSH 4OLWH 3MUIA 2X9WA 5C0FA 3RIKA 4NHCH 4FXGA 4JO2L 4DK6A 1LNUB 2CR3A 2FECL 2MCPH 2DT2A 3IDJA 3VGBA 1PGRB 4FFZL 1JF1A 1JI1A 5EO0A 5EUOA 4GUPB 3L9RA 3BH9B 2YPVL 2W60B 2EDKA 4RWHA 5JR1H 2GCYB 3MCKB 1QI5A 3AMGA 1DFBL 3HE7D 3GDBA 5D9SB 4TUJA 3EMZA 4YZFF 1MWOA 2XACC 3HRZA 2J75A 1I1AC 3C9NB 2X0HA 4OCYH 5K9JH 1QHPA 5F6HJ 5I76A 1AFVL 2P8MA 2J8HA 3E1F1 3D39B 4GLRI 4ML4A 2Q8XA 3TCLA 4PJ9D 2F74A 4POUB 5D1QB 4FQCH 4KZEH 4TULL 1IAMA 1K4CB 1L0QA 1REIA 3D0LB 2CEQA 4FLSA 1OLLA 1J1XL 1A7OH 4X6BB 4JAMA 2WYSA 4KHXH 3Q3GA 3EYSH 1UUQA 5GSRA 2HT3D 3FN0H 5DHYA 1CD1B 4HPOL 3F58L 2X1XR 3REWB 1UJ3C 1UH4A 2NY0B 2OTWA 4Y19A 5DT1H 1CYGA 5FCZA 1L7TH 2VR5A 2Z4QB 1QFOA 4KJPC 3ULUL 4FFYL 2DD8H 3ZE1F 3SPVA 5IEHA 4AL8H 2ZCKH 3CXDL 1TFVA 3CDGB 4NC1C 1LP9A 1IEBA 2KBGA 4R26L 2ZNXA 5KOMC 1BVLA 5F9WB 3RGVC 4Z2KA 4PJ5B 3RVXD 2VQ1A 2P5ED 3TOPA 4CKVX 1MIEL 3PXHA 1CS6A 3AHZA 2NY5L 2D49A 3UTTA 1NAML 4P2QD 2YRZA 1C5BH 3I84A 5FKAB 1L8NA 3OKLA 2OJEB 4J3XA 3VXMD 5HD8D 5JO5B 4GLRH 5DK0B 4EBQL 2GK1B 3PWLB 3MROA 4X5XB 2F54D 1X5FA 2WHLA 3IU4L 3S97C 3L3HB 5BZWB 5IESL 1QEWA 3O2DA 5IUSA 2XWJB 4FP8L 1S9YA 2Y25A 4Y5XC 3QIBB 4YHKL 1BBJB 2ZWLT 4PBVC 1IMHC 3VVGA 2AXHA 1GZQB 3VFVB 5HVHC 5DLML 5I16B 3MACH 1YEHL 2P45B 1NGYA 2IPUG 4XCFH 4NWTH 1JE6A 1G6RH 5FKPA 5CMAA 4KZDH 2WINB 4ZODA 4ESKA 1U42A 4NKMB 4X98B 5HHPB 2F8VA 4PRDB 1K8DA 4PP1D 4UB0L 3VXQB 4OM1L 2PB1A 3GJFB 3E3QE 4MJ6A 1KCLA 3GFUA 4XB7A 3WIFA 2A6IA 3C09C 1NCCL 3TH3T 2CDFB 3PJSB 2R4SL 2B1AL 3BPLB 5EU4A 5IHUH 1TTFA 4Z95H 5CSZA 4WW2F 1NBYA 2Y1VA 4U2YA 4HUXB 3O4OC 1Q38A 5L9DH 4PJIA 4F8QA 3GBLA 5GSVB 4M9OA 2WM0A 4IOIA 1P4LB 2IPKA 1OGAA 3V5HA 2BXZA 3QDMB 3VFMB 4OZOA 3GM8A 3RL1B 5I18L 4ZXBD 5C6TL 1XGZA 2AXGB 1MJJB 2M2DA 4PSRA 3OA5A 4GQ9L 3APGA 3WBEA 1CTOA 2VLJA 4NNPH 3KPSD 5CP3A 5BJTB 1CECA 4HJGB 1R3IL 3CX5K 4UQ2A 3E6HB 4ZPTB 4JY5L 4HMEA 2AP2A 1FAKT 1CIUA 1QLEH 5IBUB 3N11A 3MJ8A 1K85A 4YDKH 3PZUA 3MNWA 5HDBF 3ESVF 1ZS2A 2D7NA 1KPRA 3MOQA 3LH2H 2ZPKH 4DZ8A 1J1PH 3W81A 2WIIA 5TF0A 4HOZA 3A4XA 4JY6A 1OSPL 1XGTA 3MNVA 4KAQH 3G6LA 4S1RL 1UCBL 1EEYA 3SCVA 1IGIL 4WHDA 5C0DA 2W59A 1F6AB 4HCRA 1OPGH 1WWBX 4WY7H 2DEPA 1CT8B 4Y8DC 4GKZB 4GKNA 5M3WA 4NQEA 5J6HB 2J4WH 3V4UH 2E8YA 4G9FB 3WNMA 4P7RA 1I3VA 1UH2A 3T0WA 3AIUA 3NIYA 3PP3H 5GGQH 4JDTL 4Z7VF 3TO2B 1IM9A 2R69H 3BWUC 4I4WB 1INDH 1SYTA 3QUMB 2J77A 1MFDH 2VC2H 5TFSL 4JRXA 1NKOA 2ESVB 2GTZA 5CD3A 4PJ8B 3D48R 5KTEH 4PSPA 3CU1A 4KXZH 5T1MA 2E9BA 3VXTA 2C3HA 1X5GA 3QFDA 5D70H 1I8LA 2BOBB 5K93A 4E42A 4GO6B 1WB0A 2R39A 2D4DA 4XPTL 3WH5A 2DBJA 4JFPA 4MDIA 2X6MA 1Y6MR 3IFLH 4MAUH 1FGVL 3WMSA 4I48B 3EFFA 1DQJA 3MANA 2WW8A 4NQSB 2GJ6A 4QRSA 1E6RA 3VFGH 4YAQA 5MENA 4Y4HD 1XCQA 3HCVA 1JDAA 4GZIA 2QV2A 2P5EE 4OV5B 5JW4R 5D2LB 4CD7A 1SR0A 2O9PA 5INDA 1RPQA 4EN3A 3VD9A 1NWUA 4B7IA 3A4WA 2MQ0A 5EBLA 4QTHB 1KJVB 3QCVH 2Q7NA 3WFBH 4D6HA 2ENSA 4ZE4A 1IC4L 4I18C 5IW3A 1D6VH 3NGBC 3AZSA 3CUGA 3WFLA 4HS3A 1F3DJ 3VXME 1A2YB 4UTAH 1UZ8A 3QHZH 3U4EB 4I5BA 1V05A 4LVNB 4QRQA 4JM4L 2F54E 4WCYL 4D6CA 1E15A 4HGKC 5GRUH 4DKFH 1BVNP 3I50H 2XQBH 3BH8B 3IDIA 4XVSL 3KGRA 5HHVH 4OZHA 2JB5H 4QY8A 1RZKL 1MQRA 3DTXB 3DVIA 5JPMB 2BOCA 2OLHA 5EC1B 3LKNA 4PJEB 4H88H 1U95A 2EEDA 4GSDL 4HJJH 5J13C 3NCMA 1DEEA 2JJUA 1NWTA 1JAKA 2MFNA 1Z9OA 3WD5L 4ELMA 1MRFL 1U8MA 4NO2A 2QADD 4AEIH 4Z76B 4JKPL 2I26N 3WSQH 2X4RB 2DI9A 1RVFL 5IV2B 1XH2A 1JUFB 2VDKL 3PXJA 4QRPD 2WW5A 4KROD 3BPCB 3QNYB 1XV8A 5HJ3A 1T22A 4XNYH 3ILPB 3MRJA 4CMHC 4HLZH 1E40A 2IC2A 3CD4A 3DETD 4HUUA 3TIDB 2JEQA 1BTCA 1T7XA 1UGNA 3I3BA 1VFOA 4TSAH 1EAJA 4B3LA 3WHXA 5F6IC 5CZXC 5BXSA 1H0DB 3QHFL 4LF3B 2H3NA 4WHTB 4XCYA 1HJVA 3L7EB 1J0YA 4ZEPA 4PMNA 3TJHD 3PWVA 4Y4FC 3UYOD 2Q7YA 4LSSH 4NSBA 1KNOA 1NMCC 3ZM8A 3HMXA 4PMQA 3BP6B 2ZUWA 2P8PA 4X9GA 2ZNWA 3PWPD 2X4OB 2VIRA 4J4PA 1CGWA 3IRZA 4PJAB 1R3KA 3KXFB 3SE4C 4PCSA 4PYSA 5D7LD 5LBSH 1T1ZB 3O3BA 3IFNL 4P8WA 2ZSWB 5DJCA 3U1SH 3UYRH 3OHXB 1EO5A 1SJHB 3RIAF 4P5MA 5BZDA 1A3HA 2IANB 4WV1B 2W0PA 5FFLA 1FPTL 2MMXA 1NUNB 2DLHA 5IWLC 1WZLA 3VWJA 5I1DA 3BW9A 2X4UA 3QCUH 1YEDB 3AZRA 1QNZL 3PGDB 4N9GB 3ROLA 3MFGB 3SCQA 4J6RL 5DMKB 3GI9H 1EX0A 2NXYC 1WBYA 3C5JB 4TSCL 3VXPB 1FRGL 2ZG2A 5F70A 1P1ZA 3GSOA 4HK3N 4DQOH 3MV7E 3QUXD 2X05A 3OKDB 4QHNB 3RVXC 3T0EB 3ULUF 2G5RA 3QSKB 4UNUA 4Y16A 1VPOH 2C7FA 3MXVH 3D5OF 3Q5TA 2AEQH 1S9KC 5TQ2H 1CQKA 1HX0A 3KPQA 4Z0XA 4JLRA 2CHOA 2HMIC 1MCFA 2EDFA 1ZVHA 3WJJC 1N6QH 4CNIB 5AD0A 2YUWA 2R0LL 3HKFA 1H8OA 3K2UL 5DA4A 2FJHB 3ZL4H 2V6HA 1SY6L 1JN6A 3I85A 1W3JA 3G04A 4ODTL 4FFVD 3U9UB 2GHWB 4BZ1L 2AERT 5J1TC 1CL7L 4OFYA 5EU7E 4P8UA 3OKKA 3VIPA 2UV3A 5SWZD 1HKLL 1P84K 4JDVA 1WEJL 3F5JA 4DWSC 4RGMC 4J8RA 1U8HA 3VG9B 5CAYB 2DWEB 3WLBB 4R4BB 3CZLA 4W8LA 2LTQC 4GMSH 3BZ4A 4N1EA 5I75C 3BP5B 4L8DA 4PGZA 5E8DL 4RFEA 3MJ9A 15C8H 1NFDB 1AXIB 1WAAE 3RZCC 1W0WA 2A3AA 4IRJA 2Y36H 1MCEA 3EMCA 4GZJA 3P0YL 1CU4H 3OG4B 1Q0YL 2XRAL 5FOBA 1DBML 4XXDA 1IKNA 4KPHH 4X0KB 3MMEB 1A4KA 4PUDA 3MV11 4GRMA 5CPSA 3N1AA 1IZKA 3NIFF 5E4EC