4MB4A

Crystal structure of e153q mutant of cold-adapted chitinase from moritella complex with nag4
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
528
structure length
528
Chain Sequence
GTITSQDDNVVVGYWHNWCDGRGYQGGNAPCVELKTVNPQYNVVNISFMKVYDIAEGRIPTFKLDPTIALSEAEFIAQIDTLNSQGRSVLIALGGADAHIELTRGDEDALAAEIIRLTDLYGFDGLDIDLQQAAITAKDNQFVIPAALKMVKEHYRKTGDNFMITMAPEFPYLTANGAYTPYLTELDGYYDFINPQFYNQGGDGLWIEGVGWIAQNNDALKEEFIYYIADSLINGTRNYHKIPHDKLVFGLPSNIDAAATGYIQDPQDLYKAFDRLKAQGQPLRGVMTWSVNWDMGTDAANNSYNQQFIKDYGNFIHNQLPPVTDMTPTLSGIVDTRVELDSHFDPLIGITAKDYQGNDITADVTVSGSVNTNQVGDYLLTYSVSSDDETTNQPRKITVYEILPAFTGITDTTVVIDSEFDPMQGVSASHPTQGDLTANITVTGEVDTNVVGVYELTYQLFYGQDNQQNMTDKRIVTVVTDAVSDDDWQVGSTYVKDDKVTHNGATWTAQWWTKGEEPGTTGEWGVWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of substrate-bound chitinase from the psychrophilic bacterium Moritella marina and its structure in solution
pubmed doi rcsb
source organism Moritella marina
molecule tags Hydrolase
molecule keywords Chitinase 60
total genus 174
structure length 528
sequence length 528
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2013-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
A PF16403 DUF5011 Domain of unknown function (DUF5011)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.20 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Carbohydrate-binding module superfamily 5/12 4mb4A04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mb4A03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mb4A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4mb4A01
4IIQA 3QG7H 4HPOL 4D1JA 1I8LC 4U1GC 5HDBE 1YA5A 4LCCC 4LXFA 1ACYL 1WWWX 2LTQC 3IGAA 4XZBA 4IS6A 5FHAH 2B31A 3I3EA 3PV7A 4JRYB 4ZPVB 4J3TA 3K7UA 2D4DA 5TF1L 1BQLL 3BSZL 1Q9WB 2WINA 2OJZH 3FJTA 4OQ1A 3LPOA 2EEAA 3VJ6A 1F4HA 1MFAL 5F96L 1JZ3A 3L3GA 5B4MC 4P4KA 1SBSH 2N7BA 4BF7A 3A3HA 4NZDA 3FZUD 3GNRA 3WDRA 1A6WH 3SCQA 5JOPD 2HWZH 1GOMA 1FZJA 4OD1H 1BM3L 2A83A 4JFEA 2I9TA 4M4RA 3EYUL 3QUMB 3TYGL 5CQ1A 3ZTNH 1Z9LA 3GBLA 2CQVA 3V5KA 3MLUH 5B38A 5ESVB 2H26A 4QWWD 5GS0L 1D6EA 3RGVB 4RGND 5IT2L 2A0LD 2CR6A 3B2VH 4HWBL 1LNUA 1MH5B 3KEHA 1J1XL 3PWUB 3L2LA 2YOCA 4X7TA 1U91A 4DUXA 1IM9A 1E71M 2AV1A 1T4KA 3OXRB 3VD9A 2GK1B 4R7DB 2V5CA 3R0MA 4Y4HA 4MNHA 3UTSB 1UQYA 2VC9A 3DLQR 4WTXA 3WF3A 1RZKL 1T1XA 4PB9L 5ETUB 1AGDB 5D71L 3EJYD 1U3HA 1OLLA 3VGEA 1R3LB 3BAEH 5ICZB 1R0AL 2A3CA 3MLXL 1GUVA 5J1SC 3H0TA 2ZUTA 1KSRA 2HISA 2BFVL 2X4TA 3ALWA 3KL0A 3I75A 5IEKA 2Y5TA 1CD9B 1JVKA 5HSFA 1JFQL 4V2XA 4M1GH 4FFYL 3IDMA 1DN2A 2FATL 1G01A 3CXHJ 5EU4B 5BXFB 5IW3A 2E5EA 2V9QA 3MUIA 4LYRA 3WLWC 4JDZB 1IT0A 1LEKB 4PMZA 1JNNH 1HVXA 1GGBH 4U7KA 4I3GA 4H8UA 1OD7A 1SM3L 4ERSH 2YL8A 4TUFA 5IVNA 4Z7WF 4I0KA 2P8MB 1MFUA 1MJJB 4H0IA 4KMTH 1J05B 4TSBH 2C3GA 4AEIH 3W4RA 2ZUMA 5I1CH 5IW6A 4LL9A 2R2HB 2YRPA 1J8HD 1ES0A 4P23B 4DEPB 3NYDA 3WF1A 3U2SB 4IOIA 2XZAL 2PXYC 1BQHB 1FH9A 1T1ZB 1BJ1J 4M82A 2RIKA 4YPGA 1BD2E 5B21A 2BC4B 4UT6H 3TT1L 5F1OB 5DRZA 3RY6C 1RJCA 1DFBH 3ARVA 2CDEB 2FIRT 1S78D 2FLBT 2XWTA 1KJMA 1F6LL 1PG7W 1FP8A 2BOCA 3RBGA 5ILTL 3DGCR 4MA3B 1QVOB 5BW7A 2UZIL 3K46A 5CPQA 3B9DA 4GSDL 4JPIB 4NQSB 4ZUVA 2DLEA 4LLWB 2PWHA 3W28A 3L3HB 1HE7A 1I8KA 2J25A 1Q0YL 2VLRB 1A7BA 3O6MH 1A7NL 5BZDB 4NN5B 5EORH 1CWYA 4WKHA 5C0AB 3O2DA 5ACMA 1F42A 3ARFB 5DD5H 1FH5L 5ID0B 3VIJA 1HHIA 1QSZA 2WM0A 2WWCA 2AEPL 4MJIE 1KG0B 4JFFB 3MR9A 4OCRH 1D3CA 3U6RB 1YECH 3T8XB 4PY8J 3MO1B 4KK8C 1QKZL 2Y23A 2EJ1A 1OSPH 4WCYL 1UQSB 4PJ7A 5BJTA 2YBRA 1MRFL 5HHXH 5JNYB 5KSBF 2WKGA 2EBNA 2XHYA 5IVZA 3CFJB 5DZLA 4P2OB 2WVSA 3OWEA 5EUOE 1TFHA 2IGFL 4MJ5A 3GXIA 1RMFH 1ZGLB 4U1JA 5EFFA 3RJDA 4P46A 1U0QA 2PF0A 3FQWA 1I3UA 3FT4B 5FYJL 3DHPA 2VRKA 2NY4D 1OTUD 1A6VL 3E6FB 3PQYE 2DLFL 3DHJA 5CJ5A 5A69A 3VXUB 3QNYA 1L0PA 4P9HL 2HAZA 4DM2A 3MXVL 2VJXA 1RIHL 5FM5O 2CUHA 3EOBB 4KXZI 3W0WD 1A4KB 3GI8H 3CK0H 5IFPA 3DVGA 2WBJC 2R0WL 3ZYJA 4LFHG 3VIHA 5DHVH 2IWGA 1LK3L 1QA9A 4L4VB 4Y5YB 2W60B 1JWSB 3MRLB 4PJHB 3LQZB 1UWEH 3LZFH 2HVJA 3FO0H 5B39G 4EUPA 3HZVB 1KXQA 4HMDA 1T1WA 1U8JA 5H94A 3EYVA 3JBG7 1R85A 4XXCC 3NIFF 3H9HA 3PTKA 4U4BA 2FR4B 3HI5L 3QQNA 5KJRL 3BP7B 1E6SM 4X6FA 4ZFGL 1KGWA 2DLTA 1WWAX 5L6YL 2XKNA 1IGTB 4NM8L 1TG7A 4AIXA 1V0LA 3VVGA 1FVEA 3WUWG 5HHOA 3T0ED 5C0IB 4D8PA 4EN3D 4LRIC 1HOCB 3BSZH 3S34H 3LEYL 4S1DD 2F5BH 1JI2A 4HC1H 4DAGL 1DCLA 3MGTA 3ZO9A 1Z9SA 4GZEA 1Q9KB 5DQDH 4IEFB 1UWTA 5LA0A 1BFOA 5C7XH 5DI8A 1ITXA 3IFOA 1YEEH 3WDIA 2OX5A 1AGDA 4HFUL 3SDDA 4O58H 4D0BB 2F8XC 1NWTA 4IPNB 5ABEA 4YBHA 2E9JA 4P5TA 4AQ1B 3ZDZE 1OTTD 1KJMB 3FO9A 1BD2B 1SEBA 4PGBB 1JMXA 2ZUQB 1JPST 4M5YL 4QTIH 3O9NA 4LLYA 1IT9H 4NQCA 2VXVL 5MEND 1BIIB 3T04D 4BKLA 4XPTL 2AW2A 2ARWA 3QXUA 5C0BB 3TM6A 5A8MA 5IMKA 4CU6A 4G7YH 2XRAL 4PRPB 5BVPL 4WHTA 3RZCB 4M24A 4OAWB 2OMBA 4KHXH 4WHCA 3GSWA 1LO5A 3QPQC 3PHOA 4WHYH 2GI7A 4JG0H 5FYLE 1YEKL 1HKMA 1OB0A 4A6YB 3QIWA 3L5HA 2FX7L 1MJ8H 4LNRA 3NJ3A 3O4OB 2P46B 3QI9A 1NMAH 3HAEH 1LHZA 3HG1D 4Y1AA 1XGTB 1S7RA 3KYOA 3QXDA 2J74A 5E0QA 5FV2A 4QEGA 4H25B 4HGWA 3N17A 1UB5A 2YUWA 3FONA 3BSGA 1Z5LA 4H1LH 4Q6YA 5INDA 1LP9E 3D5OF 2JJSC 2QEJA 4X7EC 1HQ4B 1KB5L 3WIHH 3ECBA 3S6CA 1TVBA 3DRQB 1AO7E 5EUOA 3L3KA 3OHXB 4UQ3A 1R3KA 2HT4C 3MUJA 1UYWH 4ZFFB 3LS5H 4KKCC 3STZA 1AR2A 4MD4B 5IHUH 1OCQA 1YQ2A 4C57C 5FKPA 3CFCH 3CXDL 1A21A 1JHKH 4JKKA 2I9LB 3VFGL 3FAXA 3T2NH 5KSAB 1IFHH 1K2DB 2Z31A 3MFGB 4HDIB 2I24N 3OKLA 3L3HA 3VXRA 2BJML 1V6WA 4OZFH 3DGGB 1T0PB 4PJDA 4KQ4H 32C2A 5C0FA 4BUHA 2GFTA 5D1QA 4NC2B 3T0VA 1JWUA 3WSQH 4PJXE 1YYLH 3BEVA 2NXYD 1S5HA 2DLHA 4LVNB 5TQ2L 4D9RE 1CD8A 1HZHH 2HA1A 3W25A 4OCLC 4K71B 4PJBF 1BG9A 3B9KB 1KFWA 3V4VH 3KJ6L 1RUKL 3T3PF 4WEBL 3DROB 5T33L 4JDZA 3VD3A 4UILL 1DEDA 3T4YB 1W0WB 4JHAL 4MX7B 4HFWB 5I1EH 1YYML 4RDQG 2ESCA 5GRZA 1KPUA 3RZCC 1N7MH 1QNRA 4KY1L 1F00I 3QR3A 2X9WA 2ESVB 4HS3A 5HHVH 3CHCA 5E95B 5HPMA 2HFFB 5BS0B 3VM5A 1NFIA 4WW2F 2GW5A 4GW4A 1IM9B 1A2YA 2V7HA 4WI2A 3JWDL 3WQ8A 2WZEA 3CNKA 3LN4A 1NCTA 5KOVC 2BY2A 2EXWC 4GRLA 2R56H 3OKMA 5FA4A 3A67H 5FF6A 2BFGA 2A77L 4DKFL 1QBLL 3L3JB 1LEKA 4MAUL 4N0UE 1FLRH 3S34L 4JDVA 1BMGA 3I6GB 2HT2D 2AXGA 1GPOL 3QB7C 4OCYH 1K8IB 1HHHB 1VFMA 2E3VA 5ISZE 2GJ6A 2HRPL 5C0RH 2B1HL 3EJJX 1UD4A 5F44A 3G5YA 4G9FA 2Z0BA 4OAWA 3T0AA 1IM3B 4Q0XL 5DEGA 1RZGA 3C2SA 1KXQE 1MWAA 3P4LA 3MNWA 2CPUA 5BRZA 2Z91B 1WK0A 4CADB 4GKOA 5BZDA 1II4E 2YUXA 5E2WL 5SWQA 3WS6A 5TQ2H 1RZJH 2GKIA 1UR4A 1N0XL 1WDSA 4DWSA 3D9AH 1DP0A 2XXCB 1N3NB 5C70A 1JV5B 4W6WB 4PJ7F 3WD0A 4JKMA 1IAOB 4P9ML 3EDDA 4EUPH 3K1KC 4GKZA 4OGAD 3WS3A 2M1KA 1YY8A 4QOKE 1B2WH 4OGYL 2DQIL 2VDOL 1T22B 3QIUB 4GLRH 4K23L 1NGYB 5I19H 5FFLA 2DQGH 2WXDM 8A3HA 1WTLA 5D5MB 4QLJA 5C07B 2ED9A 5LAXA 1J0HA 2V5TA 3OV6A 3QQ4B 3NFPB 1N5AA 2ZG3A 4BH8A 1LWJA 1UM4H 2I07A 2XTJB 1FO0A 5T3ZH 3AOFA 2V7NB 2A77H 3VDHA 1XH3A 1ODAA 1NGWA 4G6AC 3HTLX 4PYHA 1A47A 2DQDH 1D9KC 1ZXQA 3CVHA 4ODTH 3C9NA 2EIZA 4CVUA 3MNZB 3RWIB 4JFED 5E9DD 4IBLT 3L95B 1U8LB 5FXCH 4ZO8A 1CE1H 1FPTH 4WFGD 1EGJH 5C0CE 2AGJH 4OLWL 2W60A 3MC0A 3SCRA 3MV8D 3KHOA 3ARFC 1J8HA 5IVXF 1Q0YH 4OIBA 4L8DB 4Y16A 2IBGA 4JG0L 5ADOL 1ULVA 4TTUA 4WEBH 2Q1EA 1QSEE 2VDMH 3NFNA 1WAAF 4GSDH 4ZNCD 3W6LA 4K7PH 4V1DA 2XFXA 1DWGM 2NY7L 3V6ZB 2A3BA 3RDKA 4JFTA 5HHOE 4KDTA 4KTEH 5B8CC 5KZ6A 1QVBA 4W89A 4HDIA 5T1DL 1U8NA 3QDHA 1K85A 1Z2KA 1ZT4A 1IEAA 4LSVH 2WMIA 4PGCA 4ZFOA 3AHYA 5SWSD 2H41A 1NAMB 5KS9F 5H8DA 2AJSL 2GDVA 1L7IH 2J79A 1FFPB 3M1BB 2YD2A 2XY2A 3AM8A 2OM5A 3GRWH 1CGYA 1FNGB 5C09D 4NIKB 1EO5A 1WBXA 2AKRA 3QFJE 1JWUB 4JO3L 1JHTB 4PJAE 5IBTL 4JHWL 1ZS2A 3RTQA 3A4WA 3TZVD 3CUPA 2VXSL 4Y5YA 1K8IA 3UXFA 1G1CA 4IDLA 3OB0H 2OYPA 1NBYB 2ED8A 4MJ4A 1JGUH 4KRPB 3LKOA 4Y4KC 4D3CH 3V5DA 2IPUG 2WWKT 4XWGH 3CSYA 4YAQB 3HE7B 4HK0A 3RL2A 2MCPL 2AJ3B 1A6ZB 3IU4H 2QQNL 2SEBB 3MRNB 4PMUA 2GTZB 3GSUB 3BN9D 2EO7A 4ZOCA 5HVWA 2X4QB 2HMIC 5EOQL 4YFDB 4LQFL 1X1NA 1XGRB 2PCPB 5EBLA 3EIFA 1NMAL 4KC3B 1H0GA 5F3HA 5HPMB 3LVEA 1MSPA 4HWZA 4WLCA 1E0WA 1JUFB 1OM0A 3AIRA 3AVEA 4HAFA 2FHBA 1KQYA 3TZVA 4MNQB 4MWFA 1INQB 4Z5RA 3UO1L 3VFWB 3L3JA 3KPOB 1NBVH 1ZJAA 2F8QA 1T04A 2F9BT 2HYMA 3DTXA 2PO6D 4Y5YC 5TQ0L 4OZIF 4UFHA 1J1XH 3KPTA 1A6VH 1OGBA 4OLVL 4IOFD 5EA0L 4YO0B 1MFEH 1JPFA 1MCJA 2VX5A 3V6OC 1AQ0A 2XGBA 4OJFH 3VFUB 5BOPA 5DS8B 4WUKL 3TNNA 3SKOA 3RDTD 1RJYA 4GG8B 3RA7L 3CUIA 1NCCL 2VXQL 2RAMA 2D3NA 3T1FB 5K33A 3PWVB 5CGYC 1NUDA 3EYSL 2Y06L 4XVUD 1QBLH 2APWA 2QSCL 3KYKL 4WJ5A 1MHHA 1N6QL 3G6DL 4BH7B 4U1SA 5D96B 3UJJH 3KS0H 5D7LA 4JDTH 3PXHA 4EBQH 4DAGH 1I1FB 5D7SL 1X7QA 1FGVL 4C56A 1Q9OB 5D6DA 4C7GA 2F74B 1QLEL 5IV2B 4P5KB 1CYGA 1YNLL 1D5IL 1WFOA 2YXMA 4Z0XA 4P5MA 1QLEH 4BZ2H 1A6UH 3SDCC 4KI1A 1R8LA 5F9AC 3GTNA 4BZ1H 2D7NA 3FQTA 2VL5A 3SJVA 5IMOB 4YXHH 3TF7C 4JDTL 2MPAL 4WJXA 2P24A 2PR4H 1OD9A 4UI2A 4TUKH 1V3LA 1RHHB 1ISZA 3U30C 3VFNA 1FRGL 4XTRC 3HNTL 4NT6B 4I4WA 1BF8A 1BGXL 3QDME 5IHBA 4FQCH 3I3BA 3UYPA 3G5ZA 3SJVD 5ILTH 4F9JA 3QQ4A 3RGVA 4QTHA 3UTOA 4A2LA 2BV9A 3AXXA 1GL4B 3MJ8B 4G9FD 3RWCA 5CAYB 1AHWA 3S9DB 2R0WH 2ESVA 5EMYA 1EJ6A 1UXWB 5CD3A 2PW2B 2R0KL 4F33B 5B38G 3FB6B 3WD5L 2QHRH 5D4QA 5ISZD 2H32B 4M9OA 5AD0A 4OV5B 4C56D 5AYUL 4MAYD 4YDKH 3AB0C 2IF7A 4YGAB 4PV8B 4DVRH 1S7SA 1I1AD 2UUDK 35C8H 3R8BB 3LKRA 4WFGE 3GB7B 3M8OL 3QG6B 4ZEPA 1H3WM 2MFNA 3AB0B 1U3HC 3L3GB 1I3GL 2YD1A 4WDIA 2HLFC 3IJYB 4ODUA 4X4XB 1HJXA 2ZXDA 1NQBA 3MA9L 4X98B 5C6TH 5DQ9B 1KXVC 5DA0B 1KCSH 2HJLB 1CGTA 4PMXA 2LVCA 4NM4L 1XF2A 4JRXB 5IP4A 1IARB 3SEPA 2A38A 2SEBA 3GHEH 2WVTA 1BOGA 4Z8FL 4EN3B 4G5ZH 2GSJA 3MRRB 4MDJB 2X70B 5C08B 3X3GL 1CDUA 5ICYA 3TT3H 2C26A 3SDAC 1OAYL 3TA3B 4PRHD 4GKSA 4LLVB 3NH7L 4QOKD 2AXGB 5LGJA 4ZTPH 2D0HA 4K7FA 4L5FH 4V27A 4LCYA 3L4VA 5CJOL 4RSVA 3TN0C 1JRHH 1T7XA 4ZAKA 2VIRA 3OGCB 3CTTA 1S9YA 2OL3B 2JELH 2NY6B 3IF1B 3V2AR 4AC1X 2IQ9L 3WEXA 5DFWH 4IUGA 5ICZA 3RWDA 2UZIH 3UMTA 2MSPA 4LSSH 3F4VA 2VZUA 4JQIH 4OKVB 1VIWA 5GSRA 5I3DA 1BBDL 1M6OB 3LKOB 2C3XA 2NW2A 4MAYB 2OSXA 1KQZA 4S3KA 4ENED 3W29A 1D5BA 5I1KH 4HUWA 2APVA 3DJ9A 1AC6A 1NM9A 2F8OA 3QPXL 1US2A 3DRTA 5MEQB 2EE6A 5HI3C 1NMBL 3MRFB 4D6DA 1T83C 3KR3L 4G6AD 5SX5H 2HG5B 4J1UA 1T03L 1G0XA 5C08E 3H42H 4EDWH 3ZDYF 2ZSWA 3R1GH 1H5BB 3MV7D 3DECA 5DTFA 5EPMA 3MMWA 1A6UL 3RIKA 3KXFD 1F2QA 2MKLC 1E6QM 1E4XH 4IOSD 2J5LC 4PLJD 2W67A 3MO1A 5IQ9A 2XVGA 3N1PC 2IBBA 3FO2A 2IFFH 3GSXB 1ZS8B 4JM4L 4HH8A 4WI5A 3OX8A 4NO3A 4A2MA 2OR9L 5DD1L 2CLRB 4YC2C 1ACYH 4JGMA 5GNYA 3FO0L 3RVXC 4OZ4A 4R0LC 2EIZB 3K4ZA 5I6SA 4OCSH 5FOJA 5E8DH 5GGUB 3MSPA 5FCSH 4P3DB 2A9NH 2X1QA 5I19L 4OJFL 4XCNB 3VFMA 4XNUL 2W61A 5C6PB 5DQJB 5F7HA 1CICD 1NARA 4OLYL 2H2SC 2JALA 2QADC 1N5YL 3CZFB 4WIWA 1NBVL 4YBLB 4DVBA 4R2GD 3L7FB 2O61A 2CRZA 5I0DA 1GHSA 4NJ9H 4GW5B 2YD7A 1WBXB 2AKRB 4FZ8L 1IAIH 4P5KA 3PHQB 3ELAT 5GSVB 4YHGA 1U8KB 1XCTB 1XSKA 5IFJB 1JPSH 4AD3A 5B38B 1Q6EA 5HYIA 1KG0A 2XI9A 3OGVA 3MA7B 1XGUA 4FQQB 5I8CB 4U1MB 2EC8A 3KDMB 4KK6C 1UZ8B 3Q6GH 2DH3A 3SBWC 1ONQA 1NBQA 4NQED 3SQBA 3C2AH 1RUQH 1A3RL 4M7LH 4CJ0A 2W0LA 3AICA 3VINA 2BP3A 4YHEA 5HHXL 5L8JB 3BISA 5EFIB 4NZUH 5CP7B 5DO2D 5MHSD 4U5KA 1X6NA 2FBJH 4DM1A 4L4TE 3O2VL 4U2YA 1KJ2L 1TNNA 3WBAA 4LPYA 3ZTJH 1EEZB 3NIYA 3QDJD 4EI5C 3QYCA 4OZGF 3QWRA 2V5RA 2BOBA 2HVKA 3V0WL 3SGEH 2WSKA 4NFDA 1GPOH 3VRJB 1SMDA 1V08A 4XCFH 4XNMB 3WFHA 2ZUWA 3A67L 5HYFA 5I1LB 4YHZL 1CENA 1NEZA 1JNEA 2VC2L 5IG7A 2ZUSA 1EHLL 5KSUB 1WT5C 3UCRA 2XZQH 3SBWA 1KIRA 3O11B 3SE9L 3EDFA 3OLDA 2X4QA 1TVDA 3EO0A 4X5WA 5ERWB 1CICB 3EOAA 3MLTB 3L3OB 4IOFC 3PQYD 1HXMB 1MPAL 2XYLA 3C60C 1MVUB 4LLMA 2CO7B 3O45B 3TC9A 1ZJBA 4WHTB 3RL2B 3GDBA 4QHUB 1N4XH 4L29B 4OUUA 3TWCH 3VXPB 4XVSL 4OCXH 2W65A 4NZJA 1FL5A 4WF7A 4LEOB 1YPZB 4UT7H 4QLKA 2VLRA 5ICYB 1DQMH 2EYSB 1XF3B 3VOCA 2GEEA 4CAGA 1S7WB 3LS4H 5LGJB 3DXAD 3QUXD 4HKJB 4P2RB 1EBPA 3BP6A 3SE3A 3BZEB 3QDMD 4TVDA 1YEJH 3VH8B 3ULSA 3M45A 1MI5A 1U2CA 3SKOB 3HRZB 5JDSB 1IAMA 4LU5L 1YMMA 1MW1A 1ZHLA 2V2TB 4I3SL 5DRZB 1IL1A 5KSBB 1HQRA 5JORA 4U1IB 3O6FB 4W5ZA 2ZE0A 1LO3L 3S97C 2OMNA 1DANU 5CINL 4IRJD 3PWPA 4M6NL 5JUVA 4KTDL 4HAGA 3THMH 1HILA 4MJ5B 4P5TD 3W27A 1KIQB 3BKYH 3CDGB 3UESA 1UWXK 4LX4A 5HHNB 1T2XA 3PWVA 4N8VG 1JNDA 3SN6N 3QDJB 1PYWA 1RUAL 5LBSL 3V4UL 5BQ7B 1G7PA 4PJ9B 1B3WA 5IB4A 1MQQA 4W7VA 1HYSC 1RH9A 4D9LH 2J7EA 4LEXL 3BPCB 3LMJL 3X11A 1SYSB 2AK1H 1PKQB 3EDEA 3MBEB 1ZHBA 5D5MF 2E6JA 4UZGA 4OUEA 3AIQA 5M03A 5CGMA 4MXVF 1AXSB 3N1FC 5E8NA 5JTWA 2BNUA 1I1RA 4U6XB 4PLKC 5I73C 3O4LB 4I4WB 1MAJA 2WBGA 2PKDA 3B2VL 3UTZA 5IB2A 3POHA 1F3DJ 4RGMC 1MJ8L 2F19H 4F8XA 4I1NB 3RKDC 4HJJH 5D1XA 2APXA 3BN9C 4UT7L 3MREB 4GRWE 3HJEA 3BAXA 3D0LA 3FO1A 3WIHA 1F13A 3TYGH 2EE2A 1XF2B 4LRIA 4P3CH 1S9WB 4FQXB 1R3KB 4H88L 3VGGA 3IDUA 3SDAA 2N56A 3BP7A 4X80L 2OXHA 3VD4A 5DT1L 2J77A 5JW3H 1UENA 5DJCB 4FFZH 1MCNA 4OM0H 2XWJB 4WENB 1E15A 1BP3B 4XXDA 3BKCL 5E6IC 1MF2L 4KROB 4ETQB 1KYOJ 3ET9F 5KN5A 1XHGA 4I18C 3H9ZA 2XQYK 3DX7A 4OCYL 3WQWA 5A3HA 2B1AL 4KH2A 4PJ5B 1KLGA 5LA1A 4EXKA 1BFSA 4LMQE 5A43C 5TF1H 2G2RB 4XNYL 5F6IC 2CHOA 2BNRB 4D6EA 5DUPL 4P4KD 4PJBB 3ZSSA 3AFBA 5J13B 4B3LA 4RMSA 1AGFB 3FB5B 2DEPA 1MWAH 1EDQA 4YE4L 5DJDB 5ANMA 4JPKL 3TCLB 1G7HB 3MCKA 3TTSA 5C0JB 1A6TB 5CEXB 1S9XB 1CD0A 1FNLA 4JFXA 4JO4L 3VXQB 1P6AB 4XVUC 3VDCA 2PTVA 1VBUA 2YXFA 3BD3A 4UDUA 4OI9A 4EQ3A 5HHOB 4FMKA 4ACZA 3BMVA 4NBZB 4GAYB 1LMKA 1I8MB 1T83A 1YEFL 4ODVH 4X6DA 3WXVL 2NMSA 5KJRH 3M17A 4OSUL 3N85H 3HNVL 3SGKC 3QCVH 5DF0A 4IOIB 2JF7A 2HKHL 1KR0A 2JIXD 5KVGH 1H0DA 4F37K 4BM7A 4UQAA 2BCKA 4KROD 4HS8L 4KKNA 3ZJ8A 2VITA 1PGRB 1C08B 4HJJL 5IESL 3RI5K 2F19L 2QR0B 2ZX9A 2CCRA 4J3WA 2EH7H 4NRYA 3SPVA 3TH3T 5F3BB 3L3DB 2CIKB 1KJ3H 4NGHH 4XPHH 3UAJC 3MPCA 3P9MB 1UD3A 1D5BB 1QOKA 1YJDC 5F1SA 4O5LH 4OOZA 2VXTH 2C7FA 3QPQD 3VXOB 5TFSL 4NQSA 4NWUH 4U1IA 4JFOA 1LG2A 1OIFA 4OZOA 1NGZB 4ELMF 3TH4T 2I26N 5FEBA 2ZPKL 1ESWA 4PRID 3PGDB 2ADJB 2BRQA 4F7TA 3BKJH 2F2HA 5CPTA 2VO5A 1BHGA 3VIOA 3REVB 5HHNA 2CR3A 2XUCA 5IMKB 5KVDH 2I5YL 1LL4A 2YDRA 4NRSA 5DMGC 4ODHH 5IB4B 2FX9H 1QO3B 2OL3L 1UADC 2Z91A 3QCUL 4NHUB 5EWIL 1ZLUH 2J8FA 3X13B 1CR9L 4JFDE 2AEPH 3QI9B 2XY1A 5H35A 6A3HA 1UH4A 2D7QA 3PDOA 1RSFA 5HHVL 4HUXB 5EFDA 3E8UL 4EE9A 2HH0L 4U1JB 3O6ML 1Q38A 3WNMA 3VXUE 3NSXA 2XKUA 3KR3H 5EZOL 3OAUH 1TVBB 4RX4A 1TPXC 4QRRB 1C3FA 2A6KB 4KWUA 1Z6JT 3L5IA 5K9OA 5DC0A 4NHCH 4RMQA 2OXGA 3ULUL 4ACYA 4XCEA 1WCBB 3TYFA 1V5JA 1E6XM 4C58B 5AYQA 5JXEA 5JR1L 1TVHB 5AYBA 3IXTA 3WD4A 1G7PB 4HQQH 4PJ9A 5CP3A 5IHSA 1HSAB 2DYPA 5E8PA 1JWSA 4GW4B 1TVNA 3MBEA 4WW1B 5F6HJ 2XFFA 2HVJB 4P46C 1FOBA 2R9HC 4FTVE 3VWKA 3UJTH 4WEMB 3O4LA 1EFXB 5F7EL 1CLZH 4HH9A 4XT1C 4ATWA 1VERA 4JHBA 4JFXB 3QNXB 4W84A 5FO9A 3WUZA 3VILA 3RWEA 1ZHKB 3BP5B 4FQQA 3Q6FB 3WN5B 4RMTA 1UXSA 5I1IH 3QIUC 5BS0A 1T2JA 4K07A 1ZANH 1F4XL 1MFBL 3GI9H 1C5BL 1KB5H 1V7NL 2ENYA 2IAMD 3AREB 3L4YA 4BK5A 4GOSA 1MNUH 4U3HA 3VFSB 4YK4B 4AZCA 5SWZB 1UWEL 3LZFL 1MW2A 3MZTA 3Q6GL 1RIUL 4TUJB 1GJUA 1E4NA 4JFVA 1LK3H 4AEFA 5FUZL 3TVMD 4E42B 2Z35A 3MV11 4FQPA 3P4NA 2GJZB 4LLYB 5F7DA 1YUHB 1BQHA 3QUXC 1U8PA 3VGHA 1N8ZA 4KUCF 1CTNA 1HXMA 5J56B 3HRZA 35C8L 2Q8XA 3MBXL 3PABA 3SE8L 3TZVC 3WE6B 3LIZH 3NA4A 4UZUA 3KL3A 1HJUA 1LD9A 1E4WL 1QSEA 4RAVA 4LSTL 4ZUWA 2L4OA 1KFAH 3KGRA 5EU7C 5I1JL 3EOTL 1UB6A 4FQJL 2AABL 4DW2H 3NCJH 5IHRA 1NGYA 1VCAA 1KPRA 3MRJA 1UCBL 1A4JB 3IDXL 1N5AB 4MS8D 4UT9H 5I30L 1I7RA 5JDJA 2X41A 1BGXH 4Y1AB 4LVOC 4LLWA 4JN2B 3EYUH 2CH8A 3B9VA 4HGWB 1V6VA 2A1WL 3HI1A 5DR5L 4X9FA 1JDAA 2X2YA 4BS0A 2OP4L 3MLWL 5GHWH 3HE6C 4AZ7A 2ARJB 3ETBF 3CVHL 3WO4B 3KPRA 4H8WH 1B4RA 3QIWC 4DGIH 5CMAA 1UEYA 4BFBD 4NCDA 5HJ3A 1BZ7A 4TOYL 3UROR 4GPNA 4WK9A 1LDPL 5HI4D 2CXGA 5IUSA 4EI5D 3GMLB 1F58L 1OGAD 2A1WH 5K9KB 4OLZL 3BPOB 2Z92B 5GS1A 3FFCE 4CD6A 4V1DB 1WAAE 3K8MA 2ADJA 3TIDB 5I76A 5DS8A 4XV0A 3ES6A 1CE6A 3O6FC 3RA7H 3IJSA 4UNVA 3ARDD 2Z1SA 3RWCB 4TPRL 4F8TA 3ARGB 1JPGA 1CBVL 1KB5A 3U30B 2P47B 5JXAL 5DEFB 1DSFH 5C0AE 4AD0A 1AQKL 3ZKQD 1F5WA 4X0KB 3BCFA 4OLVH 3UBXI 4UTFA 5E8EB 5GJTL 1F4YH 1QTYT 3FFCB 3CX5K 4ISVB 3QUZC 4RDQF 4R3SB 3MCG1 4LARH 1AGCB 1S9WA 4FP8H 1HCFX 4CN6A 2X9YA 2YN3A 2V2XA 1UKOA 1EHNA 4G8GE 3STLA 2PWFA 1WDQA 4PJ8C 2YL6A 2NY3C 1RMFL 2VSDA 3NH7H 3SJVB 5LWYL 1L8NA 3AMCA 3QQ9C 5HYSG 3DV4A 4IHOB 4NZTH 5D2NB 4P2CG 5DJ6A 5I18H 2ZCKH 2QMKA 2E9IA 4YGVB 4ZG1A 1WFTA 4N0FA 3NIGF 5FKYA 2IANE 1M01A 2QLYA 4FF5A 4X6DB 4LP4A 1KPVA 4ZS6D 3WMCA 1V8HA 2V7HB 2D0GA 5GGQL 1KB9J 1FG2A 3AUVA 2ZJSH 3SJVE 1LEGA 4JVUA 2WANA 4J28A 2BSTA 1DWFM 3L9RB 3X12A 3RNQB 4HA1A 3P0VH 4JQXA 4G7VH 1T20A 1PG7X 2JIWA 4PJCA 3FHQA 4Z9KB 5I8OH 3CMOL 3MSDA 5A8QA 4N0YL 4N5EC 4MDOA 4MNHB 5CBAB 3V0VB 5M95B 2J4GA 4MWFB 4AZGA 3BLKA 3IFNH 3R0NA 5GGVL 4UFKA 4W5UA 1HNFA 5F1NA 1RAMA 2AJSH 1SJEB 1IM3A 5DEGB 2XSAA 4DQOH 5FM5M 3KPMB 4PJHF 4MA7H 4XP4H 3TN0B 1FVCB 2C3WA 4HQQL 3VXQA 4YHYC 3PZQA 4R90L 1UZ1A 5SWZD 1BYBA 1C08A 1N64L 2FJHA 4FMFA 5D6DC 3GSVB 1R3JA 4U1HA 1B90A 1N3NA 1Z3GL 1PZ5B 2VDML 1Y0LA 4RGNB 3U9UB 1JHLL 3SOBL 2DSUA 1HJSA 1I1CA 2HWZL 1OAQH 3DX9B 1IQWL 4JFOB 1NGXB 2H45A 4OGXL 2Z8RA 1ITCA 1MELA 2JIXA 4BZ1L 1BLIA 4HKXB 3CFEA 4BA8A 2BNJA 2CPCA 5FL0A 5IB1A 5K9QG 3TNNB 5I15L 3MR9B 4LHJB 5C0GA 3QEQA 2OTUA 5EC1B 3HI6L 4JQVA 5DVNA 3WE6A 4YDJA 1AE6H 1QLRA 5CIPH 3TBSB 4EBQL 1CDJA 4PBXA 2V7NA 4K71C 1GIGL 1JXKA 2EEDA 2HN7B 3IJHA 2QQKH 4P7NA 2YKLH 4G3YL 4QRQA 1JYXA 3CFJA 1BEYH 3RAJH 1TZGL 5F9OH 1GGCL 2X4RA 4I48B 3P11H 1ROWA 4JRYD 1NUNB 2X1WL 1QFWI 1A4JA 3SDCD 1Z0MA 1WBZB 1KEML 4JY5H 5HD8C 3PUCA 2J88H 5DUBB 5TDOA 3JWOL 4QRRD 4GI9A 4L4JA 2I25N 5EA0H 3CZLA 4P59H 4KKAC 4YDIH 1WC7A 1HI6A 2AMGA 3EAKA 4O2CB 3VU2A 3ALGA 3IU3B 3CUFA 4HXBL 3WQ5A 2JCCA 4Y2DC 2AS5M 1BGGA 3S4SA 6TAAA 2FSEB 4X6EB 5F7WC 3RU8L 4GG6E 1P6WA 4LGSB 4OZFG 1DHKA 3MV8E 4ZQKA 1I3RB 1GGTA 2CBVA 1P1ZB 4Z7NE 1IEHA 2ITDA 4R27A 1K9FA 4MQXC 4F15B 4ONFH 2J2ZA 3IFLL 2FD6L 4NQUA 5CJBA 3VMNA 1UG9A 4GRWF 5EB8A 3F65A 2Q3AA 3C8DA 2W9EL 2H32A 1U8JB 5M17A 5E8OA 3VFVB 1XH2A 4M7LT 3SDXB 1RP9A 3I50H 4NSKA 4JE4B 4R4FL 2YDQA 2JLLA 4MNJA 3FFCD 5H2BA 2MCPH 1CECA 2XOTA 1GYAA 3G5ZB 3KYAA 4IPLA 1GORA 4JN1L 3KXFB 5ETUA 1GGUA 1PX8A 4PMRA 1IEBA 4POZC 1QA9B 5E8EA 3GMRB 2YL5A 3DGGA 5KS9E 2UY7A 4L4VD 1UM5H 5GS2H 2XWEA 4OLUH 5FA3B 1V3JA 3WKNA 5BMFH 2VLKA 1NPUA 3RVTD 2DPEA 3C5ZC 3EYVB 4GRWB 2DQFB 4OCWL 1KTRL 3BXNA 3ULVD 3BEVB 1E5JA 3FQNA 1XC6A 4HPOH 2D22A 3JVGC 4L4VA 1Q0XH 3CGTA 2G75A 1JK8B 4HV8A 1B3VA 4AYSA 3B9KA 1U3ZA 2YLAA 2FB4L 4ZFZA 5GGRY 4H41A 5DFAA 1EPFA 3DROA 2NY7H 3BSHA 4NNXA 4O2EA 1FIEA 4S0TD 1RD6A 4M62H 2Z1KA 3AIVA 4WTZG 2HP4A 3KJ6H 3AHXA 3X3FH 3IFOB 5BRZB 3ESUF 5BO1L 4XMKH 5K59E 1ZL1A 4JPVH 5ID1B 5MENA 2ORBH 2JJTC 2AEQL 4WFED 1RZFH 4HKXA 4I0PD 5ADPL 3UZVB 2X44D 4KRMB 3O9WC 1A1OB 4EIGB 4H1LA 3V4PH 5INDB 1S5IH 4XMLL 1L7TH 5FA4B 2VR4A 5DHYA 4QRTB 5TDNA 4NRZB 5C0AD 1KT2B 2EIBA 5IQ7H 4YH6A 1LGVA 3P2TA 3RNKA 3VE0A 2A74B 5KZCD 2DTSA 1UD5A 1CPUA 5C07E 3V0AC 1RUAH 1P4BH 3UTQB 4G3YH 3QULA 4LIQH 3STZB 1EDTA 2YMXH 3F7VB 3WFEL 3SCNA 4C7DA 4OIIL 1P84K 2V9RA 3SCUA 2FJHB 5C0AA 3RVVD 1IC4L 1MVUA 5CLTA 4PGJA 5IGXL 3VFOA 4KTDH 4EVNA 4KPHL 1H41A 5AWNH 1KB9K 3SUUA 4JLRB 1RULH 2GSIA 5TF0A 3OG6B 4E4PA 2R15A 1A5FL 2JJTA 3A0OA 3LEVH 4I0PA 4QLLA 5MEPA 4WY7H 2JCCB 3ULVH 3IDYB 4HS6B 2IH1B 1J0YA 2DT2A 2NY5L 3HUJE 1GQKA 1O6IA 5ITFA 2Y72A 1BZQK 4JVWA 4JO1L 2Q8BL 2X6MA 4Z7QF 3IXAB 2WSPA 1TFVA 3GXDA 2ATPA 4M8VA 1H3PH 1VA9A 2AK4B 3LHPH 1JF5A 5GS0C 2HFGL 3TVMB 2PTUA 1CD1B 3UC0L 3HRPA 3QQ3B 1N64H 3D39E 4JFZH 4PCTA 1CVRA 1CGXA 3O8XB 2V5DA 1F8TL 4PJEB 1YMMD 1V3HA 4PJCF 4FHBD 2EDDA 1C7TA 4OZFB 1PIFA 3KJ4C 1MCSA 5F1IB 3GUTA 3SKUD 5C0RL 4KHTL 4LLUA 5JBFA 2GY7B 1AIFA 4PTWA 1NC4B 4KRPD 1A7OH 3MUY1 5IKCA 3BRGC 4FK9A 4HOWA 1NDMA 1S5HB 1CZ8H 1X3DA 3CMOH 1BGAA 4XHJD 4LKCA 1LL7A 4WVRA 3WH9A 4QRPB 3Q48A 1IGFH 2VLKB 1CL7H 4LCCA 1JYNA 2FO4B 4D9RD 1DDHA 3RRQA 5C0FB 3U83A 3BPLB 1CQKA 1XMWA 2FEEL 4HKBB 1ZGLP 4Y0GA 3VG0L 1FC2D 1CFNB 4KRTA 1MCPH 1PQZA 1Q9LB 1U8QA 3CUPB 3B2UD 1E5NA 4ODWB 4E0RB 2GQHA 4L3ED 1MHEA 2NX5B 5L0QB 4YZFF 1M53A 5A6LA 4U0RB 1RZKC 4PB0L 3EZJB 3UTPE 4LOUC 2GY5A 3MRKB 1HKJA 2DJ4A 4PGEB 3MJ6A 2BNQA 1INDH 2CK0H 4LPUA 2NX5E 2R1WA 1QFUL 3ILQD 4TNVF 5IG7B 3BT2L 1TQBB 3RWGB 3P73A 3UPRA 1S7XA 4HHAB 4JY4A 5B3JF 4MJIA 1KCRL 1UZ4A 4K9EC 1S9KC 2NR6D 4IMKC 1O0VA 5JA9A 3BQUA 2Y4SA 3Q0HA 5IMLB 1G7MA 2FGZA 2CLZB 1IAIL 2GJ6B 4WV1C 1LP9B 4LYQA 4ZUUB 1ZVHA 1ZHLB 2V2TA 4HULB 2YD8A 4PJ7E 1AGFA 3FB5A 3DTXB 3TJHC 1MAKA 4NQXA 5EU5A 1UT9A 3PBGA 4U7MA 5E5UB 5E0FA 2FYYB 2DLFH 2BJMH 3FFDA 1CTOA 1D6VL 4JZJC 3MRFA 1U41A 3EHBC 1A8JH 4BFGA 2XVKA 5LCVH 4QAWA 1VACB 1JHKL 3R06A 3HE7A 2VLJA 2YPLA 2JCCF 4HIEA 3PWLA 5E8DL 2X4UA 3WJJC 4RE2A 2EDRA 4U0QB 1V6UA 5CKGA 4KAQH 4IS6B 3BN3B 4PRIB 1ZLUK 4UU9A 3O41A 1ZHBB 1CVSC 4D6CA 3HR6A 3SCSA 1ZS8A 3I9GL 2O9OA 4PSRA 3QHNA 3X13A 2ICWB 2Y25A 3QOMA 2F74A 4PRBB 4UOW1 1QUNA 2IALB 3D69B 3CFEB 2WWMD 1BVLA 4YDLB 3DIFA 1K9DA 4WI6A 3NFPA 3OJ2C 4BH8B 2DT1A 4R2GB 4OZIB 1G9EA 3HNSL 5EO0A 2WCSA 4NRZA 2FIKA 5AZ2L 3MRPB 3M46A 1MXGA 5CEYB 2Y8KA 2A6KA 2ZXAA 3U46B 2FHCA 2CKSA 5LCVL 5HHME 3MMEA 5SV4A 3P30L 2YPKB 3VFTB 5I1KL 4UZSA 5A2JH 5DVKA 1HILB 3B3IB 1PBYA 3D39D 3MRDA 5TPWH 2P5EB 3MV9E 2QBWA 5IKCB 5BCAA 4Z7UF 3W0WB 1IEBB 2AERT 5CD5C 4HZ8A 4YBQD 1QOXA 4BH7A 1J9CT 5D7KE 5KTEH 2FDBP 3X17A 4Z7VF 3KPLB 4HPYH 4PRIE 4PJHE 4OZGA 4ZPVA 1QI3A 5I1GH 4PJFE 1DQDH 4JJHA 3NVQA 4EAMA 1CGWA 2IMMA 3V5KB 3F7PC 5GRUL 4PBWD 1CGSH 2DGAA 4UTBH 2DQUH 3GM0A 4RGOL 3BP5A 1C5BH 1V7NH 4R97B 4RIRB 4LYPA 1M7DA 4AL8L 1F4XH 1KUMA 1BAFH 5D1XB 5I8EB 1I7UB 1S9VB 3W38A 5BV7L 1A22B 3T3PE 2NTSP 1I8MA 2B0SL 4DCQB 2M2DA 5IVZB 1DQQB 1FE8H 2VERN 1V3IA 1DEEB 3HI5H 1FFNB 4I77H 4LSPL 4N42A 1MQRA 4JFYA 4DKEL 5CILL 1E0VA 3KS0J 2NY2C 2R1WB 2FATH 4Y88A 2XPGB 1IGIL 1HYRC 5B22A 5JUEH 3LKQB 3S35H 3JTTB 4QT5B 3IXTB 2VB5A 3DV6B 4G8FB 1HX0A 3ARFD 3TBYA 4ODSL 1T2QL 3C6LD 4HCRH 2GJZA 4FQIH 3CH9A 4J3OC 4LCYB 3KWXA 4YHIA 2YD5A 2CLZA 1UCTA 1HL9A 1SVZA 3RWFB 1WQVT 5JXED 1IC7L 1DQLL 1P7QA 4UR9A 1OWRM 5F9DC 5EBAA 3PQYB 4F9LA 2W62A 2DDQH 1KT2A 1J0ZA 3HAEB 5TPWL 1OP3H 3RIFK 4LSRH 2WHLA 5SWSE 2AJZA 1QYGH 4KK5C 5A8NA 4F15C 2H6PB 5CEXA 2QHRL 2YEZA 4YXKH 4HWBH 2X7LB 1JK8A 4XBGA 1KN4L 1G0YR 5IW6B 2FWOA 1NWUA 5DFVC 4AZ6A 1IV8A 2VDLH 3AREC 1Q4NX 1TDQA 3DRTB 4LCUA 2WKLA 2VXUL 2PYEE 3WV0A 4RFEB 4M8QB 1ZLWK 3IYLW 4M80A 2PXYA 5IBUB 1UJ3C 2V38A 1JZ6A 5ISZA 5D9NA 4G6KH 2WNGA 4ZUTB 2IALA 3BGFB 1HNGA 1VPOH 2BMKB 1TJIH 4G8GB 4P23A 2AV7A 5KANI 1AD9B 3QULB 4OOUA 1PPIA 5A6KA 2V3FA 4MDIB 2ITCB 1TQCB 1UJ3B 5FO7A 1XR9A 3FN9A 1JGEB 4Q6IA 5FAAA 5I17A 2RGSA 5IMOA 1K6QL 2D7TL 1SVCP 4HF5H 3W11D 5JW4Q 3O9WB 2BSED 1KGUA 1MIML 2W0FA 3VA2C 5E2JA 3RWJA 3S88L 4NQTA 1XZ0A 2V3DA 1FYTB 2Y06H 1BFNA 3RPIB 1JE6A 1VACA 5KSVA 4ZXBB 3FOLB 2R2BB 3BAWA 1AXIB 4ZUSA 2Y6SD 3AZSA 4N0CD 4P4RB 3BAIA 1QP1A 4HUXA 2R0ZL 2CD0A 2AK4A 3JV4A 2E9BA 1T6WA 2LV4A 4HZLB 3ZT7A 3AMDA 2XM2A 4CVZB 2AXJA 4KJQC 1H49A 4K3JH 1W2PA 4UFLA 2HTKC 4KVCL 4I8DA 4PREB 2O9PA 5HHPA 1Q6GA 3EGSA 1LO0H 1EHAA 3QUMA 4PJ5D 4MD5A 4KMLB 2VQUA 4JM2B 3GSRA 4HLJA 4X4XA 3ALFA 2VH5H 3BAYA 3AIUA 1U3JA 4MB1A 2XWJA 2OK0L 2IC2A 1GOFA 5EOCJ 4GAJH 5I1HH 5E8PB 1HINL 5HGAA 2W9LA 4M48L 4TSCL 4Y4HB 3UTSA 4BQ9A 1LEGB 1PD6A 1ZEAH 1BVNP 1URLA 5J3HD 2JK5A 4IMKA 2GAZB 4H0HB 3BQUC 1VFUA 5AC4A 3X12B 3JUYA 5J13C 4M1GL 1UUQA 4LLVA 2D7PA 4FTVD 4S3JA 1TJHH 1CL7L 1WE5A 2PWDA 4GIAA 4WO4C 1C8YA 1TZHB 1RZIB 1H2JA 4XCYB 2UY6A 2WAHA 1UQZA 3VRLF 4OF6A 1LEIA 1T1WB 5H94B 1J5OL 3EFFB 4YHYB 3CU7A 2GUYA 3STBA 5HDQH 3AXIA 3KLAB 4ELKB 2P44B 1XF5A 5IF0A 5C86A 2BHZA 1FVCA 4FFZL 5HPOA 4LSVL 1DBBH 3QAZC 5D1QC 4AT6A 3RPMA 1H0DB 5MENE 1CG9B 3I50L 4PJHA 1KIPB 1RK0A 2WHMA 3R06B 1HDMB 2YC1B 4L8SA 3MMDA 2DQJH 4OF7A 3UTSD 3DYPA 4MXQC 2BVPA 3NSMA 1GOIA 1ES0B 1ED3A 4K7PL 4JAMA 4MNLA 3WFBH 3BGMB 4GKNA 2HLAB 5ENWA 3OJVC 2J6EA 2GJRA 3CLEL 1JD7A 2YKKA 3FN3A 2NY1C 1A6WL 1KLUA 2J6EL 5DGQA 3O3EA 3BZ4B 5D5ME 3LN5A 2NXZB 1KBKA 1Q8MA 4N5ED 5FYLL 3ULSB 2FZ3B 3KVQA 1P7QB 1MRCL 4GUPB 1ORSA 5MHSE 2D3LA 2NY3B 2FEDD 1ZA6A 5IBUG 1BPVA 3P11L 5AY7A 4X6CF 2DSVA 1CXHA 1JRHI 3H7BA 4PGBA 1WFUA 2Q87A 4URIA 4DN3H 5IFHH 4Q2ZB 4DZ8B 3QG7L 2Z4QA 2GVYA 1CLCA 3WQ4A 5IV2A 2X4UB 2E8ZA 2XQBH 2WZPD 3U7YL 1DR9A 4XPAL 5BV7C 3PZUA 1DBMH 5A40E 1Y0LB 5D70H 3U9UA 4AENA 1JGIA 1I1XA 3VIIA 2KL6A 4U6YB 2O5ZH 4GBXB 5TD4A 1B0RB 4MNGB 3BJLA 4U6XA 1T7WA 2OI9C 4IRJB 4PMVA 4PJAA 3K8LA 1KCKA 3QHTC 3IJSB 4P3DA 3CFBB 5DD0L 4JFDA 3TCXA 4C7FA 1U58A 3DOSA 4XX1G 5FYLD 1X5IA 4FG6D 4CVXA 5E08L 3ECBB 5K9JL 4FQLL 3S37H 1CF8H 1UH3A 2ICWJ 3EO1B 4QKXB 3RGHA 2DBJA 1QNZL 4R3SA 5INCB 5E6ZA 2XZQL 4MQ7B 1RUPH 5C07A 5LAXB 2B1HH 4N68A 2IPKB 3OF6D 2J47A 3VCLA 2CESA 4YDVB 2VLJE 4Y19B 4TVUA 3G5XA 3D5HA 1XGUB 2DQTH 5TE6L 3VDBA 2GT9A 1BX2A 2VLRD 5IB3A 1I4FA 3BH9B 2AK4E 3WN5A 3WUWB 3LEXB 1DLFL 3B6SB 1IGYB 5FYJE 3VG9B 2E8YA 2RCSH 1R3HB 4LPVA 1I8IB 4QNPE 3I6GA 2W92A 3HUJA 2G9HA 1KCLA 4C4KO 1K5NB 2YSSB 4KJYA 1AH1A 2XKNB 3MJ7A 3UJIH 4YHMH 5SWZE 2QQLH 1C5CH 4HA3A 1IAII 5GRJH 1EOKA 5H37G 2WVVB 2BSSB 4HIXL 2KKQA 2YA0A 4EQ2A 3S5LG 4ONFL 5H2BB 4JFEE 5DFVD 4HFWA 1VFAA 4OT1L 1S7VA 2VIRB 3OGCA 5C09B 1W1PA 4OKDA 4YIQA 3CCHA 3Q1SL 1NLBH 4IRSB 4X6BB 4NJ9L 5EOTB 2PTTA 4Q6IC 4Z78B 3GMOB 4DGVH 1E55A 2AI0L 4XNZC 4Z2LA 3QI9C 3WUBA 1MLBA 5IIEA 4UNTA 4BSJA 2Z8VC 4S0SD 3HE7D 2H2PC 4GQRA 5DRXB 3SGEI 1WAWA 1OTSD 1I85A 1WISA 3O45A 3O3AB 1SBBA 4MADA 5ABGA 3ULVF 4K9EH 3BZDA 1CFBA 1TJGL 1SJEA 2UY2A 3DXAA 3MRGB 3QUXA 5AYIA 5GZOD 3FTGB 4YEFA 4DN3L 1KIRB 1DVFD 3O11A 5KVFL 2QKIA 3BWAB 2H2SD 3TOPA 3VIKA 2XZZA 4JR9L 3WEZA 2OR9H 3RTQC 1A7QL 5DDHB 4P8VA 2ESVE 2FJGB 5D7IA 1AE6L 4LSQL 4Y5VC 2R1YB 5J12C 1MQPA 2HJKA 4BFIA 1NLDH 2IANA 3IJ8A 2NY2B 4N8CL 3SDXE 3B9KD 5I17B 4JHOA 4L9LC 3IAPA 4NN7C 3ZE1E 4I0PC 3O3UN 5KZCB 2EDHA 4EI6A 3PZ9A 3X14A 5FM8A 1Q1JH 3TIEA 2VDNH 3O2DL 1CXIA 1RK1A 1GOOA 3U0WL 4KVNH 2VABA 4UINL 5DR5H 2IG2L 2AJUH 3QA3B 15C8H 3GSNH 3B5HA 3IS1X 5DO2C 2CDGB 2XTJD 3TZVB 4F58H 3J7HA 3D39A 4ZMAT 4YWGL 5DHYB 5TDNB 5HYQB 4QHKJ 5JMOC 5HHMB 4RE4A 1CDYA 5DEFA 3CPLB 4Y5XA 3NTCH 1ODZA 3CHFA 4XB3A 1N6UA 4R96A 1E3ZA 2QSTA 3RBSA 3ZKND 3WD3A 5BVPH 4J8RB 1TTUA 5A6MA 3GYCA 2NZIA 4JFQA 5E2VL 4G7YL 5E9DB 3GUTB 2D23A 1PEWA 3MV01 4YK4C 4NQDD 3MTRA 1GNXA 1P5UA 4GRMA 4FQ2H 2X0YA 3GSRB 4FQXD 5IWLA 3BKMH 1PYWB 5BQ7A 2RGMA 3LSOB 1MHHB 3AROA 4GBXA 3TBWA 4L4OA 4D6JA 1LO2L 4PRPE 4AJ0A 2ENSA 3QUML 4XVTH 2D49A 3EO9L 4TTDC 3BEWA 2HTLD 3BE1L 1FZOB 1U6AH 2IG2H 2OI9B 4IRJC 3VRLE 5HGAB 2FSEA 4X6EA 2ZCHH 2LFGA 3QUYD 3ZIZA 3C60D 3C09B 1A6TA 3CVIL 3UEZA 2FHFA 1BVKA 3BZFB 3RPKA 1INEH 3REWA 2DQCL 1CU4H 1P5VA 1UXSB 2CKBH 4NQCD 4M6ML 4OFKA 2VCCA 2YC1A 2VWEE 4YUEL 5FM4A 4AMCA 3MZGB 5J7CC 1XGZA 5T5FL 4TN9A 5FKAB 1OCWL 1NL0L 3FL7A 2ZIDA 3MUAA 1S7VB 25C8H 3SO3C 1CLZL 4Z7VB 3WJLA 3N12A 2VURA 1WIOA 3UJTL 5HDBF 1D6VH 4ETQA 5K59F 3QO1B 1EDGA 4Y8DC 4XHJC 3FZUC 5C09E 3OKNA 3DO3A 3CX2A 1B6UA 4YDKL 3K2MC 5DRNB 1V6YA 4LMQI 1JG9A 3WDQA 3QH3B 5I2IB 2Y36H 5MP6L 5HGDB 3WDHA 2Y07L 5DSCA 1ED3B 1QD0A 1I8IA 4B15A 1YC7A 4W81A 4DGVL 4HH9B 2ID5A 2HMID 2ICWI 5ITBL 2E7MA 2W65B 4FQCL 2Z31C 2F61A 3V6OA 3LRGA 4K3EL 1AP2A 2BSRB 3BPOC 3OZPA 2NT0A 2CK0L 2YRLA 5FB8B 4PTTB 3BZ4A 1GQLA 2YA1A 3OAUL 2MQ3A 3QRGH 2GJPA 2QR0A 3DMMC 4QHLB 4V28A 4NUJA 2PO6B 2YPVL 4HIJB 5LG1A 4LBEA 1FBIL 3SCPA 2E0PA 3QXWA 4H8WL 4UQCA 3S35X 5SWZA 2B4CH 4FLSA 4HOXA 4TRPH 3BJ91 4RMUA 5C0EB 5MEPB 3CCHB 3A6BH 1CR9H 3RWGA 3NZ8B 4TUJA 1J01A 2YUVA 2CNCA 1MCPL 2PNDA 1YY8B 2VRAA 3O4LE 2MJWA 1I9RH 2A6IB 4QRQB 2DIBA 5D96C 3UJJL 3KPRB 3DSFH 2X10A 5CGYD 5E2UL 3I02B 2BS9A 2VXUH 4ZODA 5DRXA 5K9QI 2ARJQ 1LO2H 1LDSA 1NUGA 2OL3A 3ARRA 3FOMA 5JOFA 1AY1H 1ISXA 2AXHA 4HP5A 43C9B 1T04B 3QDGB 2EC9U 1B6DA 3QHMA 3VE0B 1WB0A 4LIQE 2R1XB 4FG6C 1G6VK 1BZ9A 1IM9D 1YMME 4WW2A 4TOQA 3DI3B 1GCYA 2Z93A 4MNKA 1R5IB 5E1AA 1MHCB 3F7RA 4W8AA 2PW1A 3C6LA 5E2VH 1E4KA 5LQBL 3B8YA 2RFXA 1P4LB 3VXMB 4HIHB 4D2NA 5HI3D 1ACZA 3IB4A 4UCFA 4UOQA 1OY3B 1SHMA 4P2OC 4JY6A 1DQLH 2X5PA 3S2CA 4UU9B 5I23A 2VLJD 1UYQA 3PL6B 3ZE2F 5HOSA 1P9MC 5HYJE 1UKPA 2VZVA 1AGCA 4HCRL 3RL1B 2CO6B 1GQJA 4WKFA 3SKNA 5JW4M 3UX9B 5EC2B 3JTSA 4TXEA 1QACA 3BT2H 4LVEA 1W9UA 5E0CA 3PL6C 2EDWA 2NY6C 4WDIB 4Y19D 3ZKXC 1NP2A 2VDNL 3O2DH 4PJIE 4CU7A 25C8L 1HKIA 5J1AB 3OLEA 4LSPH 3T0DA 3UBXB 1MW0A 3TPKA 4X6DE 4PMYA 1JTTA 1AVAA 3BYTA 3MRQB 5AWNL 2WB5A 4PJDF 3U7YH 4JZ5A 3WS6C 2XACC 4ZO6A 1DVFA 2MQCA 1A9BB 1EHXA 3OB0K 1VEPA 4JFDD 4Z7WB 3EMQA 4X0VA 3ARBC 1FG2B 5BOZG 4CRPA 1IKFL 1U3HD 2EYRA 4JHWH 5I75C 1FL3A 4GJTB 4BA0A 4M5ZH 5DVLA 2ZCHL 4U6VH 1W3HA 2WAGA 2QADD 4R0LA 3IJYA 3P9LB 5C2BH 1A6AA 2FEDC 4TYUA 4KI5D 1GHFH 1J7VR 3BUTA 1MRCH 5HBFA 5C0CA 4B53A 3NA9L 3ZSTA 5A8OA 4V2BA 2DBLL 3O8XD 3BKCH 1OD8A 2CYGA 1T7VA 4NCC2 5L9DH 4WO4B 4HLZG 5D9PA 2EO1A 4UB0L 5TJWK 2J8HA 3POCA 5BXTA 5HDLA 2MANA 1MJJA 1ISVA 1FVEB 1LO4H 4QRSB 1YEGH 5HBBA 3MRJB 3O6KL 2NW2B 1DVFC 2XWBB 3GBNL 4L9LA 1NFDE 5EZOH 1CGUA 4K7FB 1R3JB 3SUWA 2R9HD 1FN4B 4B7LA 5FK9B 3AREA 3HC0B 4NQEA 1X5GA 4XZWA 5J8OA 2WBJD 4OLXL 2X70A 5C08A 3UJIL 4N9GA 3X14B 2EPLX 4ZUTA 4YLQT 1KIUA 2JJUA 4PJFA 1XCWA 4PJXB 3OAYH 2DTMH 4YO0A 3WIFA 3MODH 3KXFE 3P4NB 3VMPA 3A6BL 2Z8SA 1MFAH 5F96H 1ZAGA 2BNRD 1OINA 3RI5F 4PRDA 5GRXG 4URTB 3GSXA 1CDBA 4HZ7A 3WUGA 2XTJC 3N1GC 2NW3B 1R24B 3B9AA 4R26L 3VGFA 1L4IA 3IJHB 2J12B 3QUKA 3S8WA 3QDJE 5J9PB 2RR3A 5IMMB 3MMEB 2QPSA 3HMXH 4YFLI 4JFQB 3MLPA 4TX8A 3EBAA 5HHMD 1WT5A 4K3EH 1WBZA 4OIFA 1UWSA 4QYOB 3MV9D 1H5VA 5TDOB 2VXTL 1H15A 3ZM8A 4PLJC 4PRPA 5EIIA 1H0IA 4F7EB 4P2QD 5CSBA 4KGJA 5KBNC 3RY5A 1BQSA 3FCTA 4BSVA 2XG9A 4OFIA 5EO0B 4FNLL 1MJ7H 4PP2B 3HPLA 4K7PX 2XICA 3AMLA 2AAAA 2J1KA 4XMPH 1A0QL 3PZVA 3SCMC 1NLBL 3D0VB 4NO0B 1CBGA 1MVFA 4X7SL 1I3VA 2PXYD 3E6HA 3QUYC 3KJ4B 4HEPG 4GG6B 1WCBA 2QSQA 1AHWB 4LVHC 4S10A 1QRND 3FO2B 3IS0X 1HQ4A 2NYYD 5T5FH 4PJ9D 3VIPA 4CD5A 1GCFA 1PJ9A 2C9AA 1S78C 3BIAX 4B9ZA 4EN3C 2XN9A 5F89A 1R7AA 4ISVA 4KJWD 4WW2B 3NOIA 1TZIA 3AZTA 1MCIA 3PWPB 3TVMC 1DZBA 2M8XA 5GIRB 4LCCB 2EYRB 5FGCE 1OAZH 2GAZA 4LQ1A 5C0DA 5IJKC 1IAIM 4M43H 1HYSD 5CG0A 1A4KA 4OCWH 1P7KA 2NPLX 4U6TA 4KK6D 3IVKA 5F6HI 1O7SA 3L7EA 4GO9A 2OSLA 4PG2A 1OF2B 3ALPA 3KHQA 4FQ1L 5GRVL 5TE6H 1I7ZB 4GW1A 1YDPA 3IJ9A 1A7RL 3V0WH 3GHBL 3V0VA 3U36A 4G6ML 5JO5A 3MROB 4OQTH 5IHZB 2AXFB 1A7OL 4CKVX 3BAJA 5M3WA 4XP5L 4XVJH 3T2OA 4D6FA 4NDMA 4FA8A 4AT6B 2J6EH 5D8JL 3MA7A 4K7PY 1MCOL 1OOAA 4P5TB 3RNQA 1Z9OA 3CJJA 2JB6A 4M7LL 3C60A 3MRHA 4UV7H 5KG9A 1F97A 3S37L 3ZOAA 5KVEL 5E08H 3I3DA 5F7MC 5FK9A 4P23C 1XEDA 1Q9KA 1QNSA 3NACL 5L7XL 3ZDZF 4GQ9L 4JFYB 3QHFH 4MD0A 5ENWB 1AKJA 1LE9B 2YWZA 4V1DE 3I2CH 2ZZUT 3HAEA 1RFDH 3AYRA 5DVMA 1UB6B 2JIXB 3QIBD 2X4OA 3FB8B 3BDBA 2NY5C 3FQUB 2W9DL 4NKOB 5E6IA 1KEGL 4EXPX 4NNPL 3PZOA 2LQRA 4J3XA 4G6MH 2DAVA 3W9DA 1M1SA 4DZBA 2W63A 4ZS7H 1ZGLM 2NLJB 1NC4D 1UGNA 4Q6IB 5EOCL 1EO7A 3EFFA 4PJBA 4G9FB 1FNFA 4HIIA 2ZWZA 3PZTA 1NLDL 3RZCD 4ZSOE 1ZA6B 1X5KA 4O9HH 4AG4L 3BKYL 1T2QH 1AHWC 4LVHB 4PGDA 1NMCB 1PX3A 3JWNC 1R3IH 1G6RH 4M5ZL 3EYQD 3SQOH 3AIWA 3WL9A 3DRQA 1CN4A 4IRZH 3SKMA 4BCEA 5TE7L 3CFDB 3K1DA 3ULUE 3QJFB 4XP9L 3QJHA 4F7EA 1V0KA 1W2KT 4ZPTB 1JV5A 5I71B 4PV9B 5KS9A 3NCBB 2XIDA 1C1EH 2J78A 4NZTL 7FABL 2IPTL 1HQRB 3T0XA 3U9PH 2VH5L 1OAUL 3HCVB 3VW3H 4PJAB 3WNNA 5IDIA 4LVNC 4AIEA 1J1OH 3RPIA 1ZVYA 5CZVL 4XC3L 1TMCB 5D2LE 4GG6F 3W53A 4UMGA 3HZKB 4OFYA 1US3A 1FP9A 3WY1A 4KJQD 5JORB 1DQTA 2GJ6E 3IGAB 3KPSD 4JY6B 2WW5A 2ATKA 4NSKB 1PKQA 1HCVA 2VXVH 1IGCL 3K80A 4TPRH 5DUMH 3RVWC 1DBJH 3NIFE 3OXSA 4FXGA 1RI8A 4DQOL 1JN6B 4HA4A 3K3QA 3BLPX 3ZJ6A 3CDGA 3QXAA 4QHMB 2AVGA 2D9CA 5CZKA 1XH3B 3UTTD 43CAA 1WFNA 2NXZD 3FCTB 4BSVB 2O26U 4U6YA 4QRPA 2NZ9D 4OB5H 1I7ZA 4GW1B 3HPLB 4N0FB 4ZXLA 3IU3A 3F5WB 1QW9A 3SKNB 2BNUB 2P8PB 5H35B 1G7HA 4HLZH 4OFYD 1AI1L 2V9TA 1KJ2H 3ULVC 4NO5B 3PZGA 1WDPA 2OQJB 3RMEA 1VGEL 5I1DA 4Z2GA 3D3VE 1HSBA 5DRWA 3D18B 4R0LB 2AJYL 2CDFA 4GAYA 2WMIB 3BESR 5BWFA 3FRUA 4JFFE 1A6AB 1JGVH 3BRFA 4PJEA 1MCHA 3GIZH 5DK0A 3F58L 2DWDA 2P7TA 3D6GA 2EDLA 4I18A 1EVTC 3EJYC 1YEHL 4UT9L 3V9FA 4K2UH 5B3NA 3V6ZA 2ZSVA 4U0RC 2H9GB 4K55A 4M1CC 4AZ5A 4PY7A 4XXDB 2B4CC 5EO9B 2AABH 4DW2L 4X8XA 4FFWC 5D1QD 1X5ZA 3ABZA 1KWKA 1HIZA 1MWAB 1X4YA 3O3EB 4PJEF 4WFEE 5C0JA 1KTLB 4XP6L 2Q7YA 1TA3B 1GGIL 1I1YA 2GUOB 4XZUB 5FV1L 3W9EA 2NCMA 3FT2A 1V02A 3D1MC 4B7IA 2G2RA 2H3NB 1N5YH 3SE3C 1HDMA 2DM4A 4XBPA 4HK0B 4A6YL 3NCYP 4ZNEE 4RCAA 3FRPA 2L0DA 2NQCA 1RJLB 3JSSA 4WWKD 2VDRL 4LLDA 3TO4A 4XNZB 1NOWA 4Z7UA 3UR8A 1EEYA 4ATDA 1QFUH 5E70A 5ANME 1NBYA 1XGRA 3MLSL 4A3HA 1DL7H 4LF3B 2EH8L 3MOBL 4GAGH 3UYRH 5J6GA 4PJAF 2QQKL 4JFUA 1FORH 2J7CA 3RUGB 3UAJD 3ZE2E 1OCWH 1RIVL 4C59B 1GOQA 3GMNA 1W72L 3CSPA 5I1IL 4IIQB 2OSWA 4PUDA 1DN0A 1KBGL 3MFFB 2W59A 3N0PB 5ICXB 5C92A 4PJIF 3HCVA 3QNZB 2G5RA 3WS3B 4YJZL 2OP4H 1IQWH 3H3PL 3QA3A 4JRYA 5IK3B 4DFHA 3PDOB 3VFUA 5I1GL 2BOCB 4GI6A 5JOPE 2Z4QB 4WI9A 5BXSA 4ZUUA 4EOWL 3WXWL 3QXVA 3DX6B 1C8XA 2BHYA 3IDYC 5DJ2A 1KN2L 5FO8A 3TVMA 4NQXB 3PGCB 1UA6H 5KSAC 1R24A 1MRDH 2DIJA 3PP4L 1J8KA 5DURB 2VZ3A 2HT2C 3TA9A 5F1KC 4PCSA 3HHRB 4L8DA 5GNZA 3DURB 1AFVL 1MUJA 3PDGA 3RKPA 2P5EA 3CC5B 2VMFA 1F8TH 3UO1H 3WBDA 2XFXB 5L9DL 3W0WA 4TQEL 4EDXB 2GJXA 2GSIB 2W1NA 3BD5A 2VL5B 2CKBA 4JJ5B 3T8XA 1R5VB 1U58B 3WUFA 4I0CC 2R29L 4Y16B 4K94C 1OT1A 4W4NA 5E9DE 3VWKC 2K7PA 3WFDL 2Q8BH 1B0RA 4MNGA 2WMGA 1XIWA 4MLSA 3VFNB 3S6TA 1CXFA 4HTYA 5IOPA 4KUZL 4F57H 1CFNA 5EU3B 2APBA 1I9RL 3RVVC 5EIVA 2R8SH 1UFUA 3BYYA 3QCUH 1Q1JL 3ARSA 1NCBH 4XI5C 3VWJD 3LEVL 3VGDA 2W91A 3LDBB 4CN4A 1HHKB 3H6JA 1UR1A 1B2YA 1PZUB 3VXUA 4KUZH 4OGAC 2I5YH 2WQ8A 5IB3B 3CZ8A 2VLKD 2BVEA 4E41E 3E2HB 3EFDH 4NC1C 2FECL 4UNUA 4NC1E 3QEHB 3WFDH 2YPLD 5FDWB 3CU1A 3KNBB 2AJXL 3AQUA 4G43A 1FCCA 2AK4D 1T1YA 4XAWL 5KVFH 3MBEC 3CFIC 3LRSB 3MRNA 1AIFB 4DEPC 4W8LA 4X0KA 1CZ1A 1C92A 1S9XA 3AIBA 5BRQA 1IBGH 1SJVA 2YA2A 5DJ8A 1S5IL 4XMLH 1UKTA 1I4FB 2APFA 3BH9A 3WUWA 2VDKH 1YDPB 4HWZB 2R2HA 2VDKL 2R0KH 3LKRB 1JYVA 1OAXH 3OKEA 4LLAA 3V7MA 3CZGA 1ZBVA 4LFHD 3VG9C 3BGMA 4GKNB 3UPCA 3PN8A 3F62A 3GSUA 1INQA 3VFWA 4Z5RB 4TX6A 1ZHKA 1HJQA 4M81A 1E27B 2XA3A 3WL9B 4X6BA 1E3XA 5D7LD 5E7FA 2XWTB 3WIIH 1P4IH 1U9KA 2X4PA 3EHBD 2QV2A 4MSWA 5IHLB 3DC0A 4CMMB 1MXDA 3QCVL 1CEOA 1OD0A 4OIAA 5CHNB 3SUSA 4CNIB 3BHBB 4ODXB 4OFVA 2VQTA 5J0BA 4W85A 1AY1L 4W6XB 1O7AA 3MRKA 4RFNC 1OTTC 3O41B 4PJDE 1KBGH 4PTUA 1C5CL 1JF6A 1N6VA 1D5IH 1GOGA 4PFEA 2JTDA 2OJZL 4CD4A 3GSOB 5D2LA 3AI0A 1FGVH 3VXNB 3GO1L 4MQTB 4U1LB 4L9DA 5FYKU 4E42A 2VISB 6FABH 2DIEA 1KGXA 2DMCA 1X7QB 3G6JF 3RFZC 1U8PB 4TNWF 5I6XB 3RM4A 3BE1H 1SYTA 3ORJA 4Q58C 3SURA 4H8WC 5DDHA 3GNML 3PWLB 1XD0A 3OQ3B 2J7FA 1W9DM 1UM4L 5ALCL 3KPPA 5EU5B 1WBYB 2X4SA 4HXAH 1E43A 1BZ9B 4WUUA 1ERNA 3QEQD 4GBXC 2FGLA 4KHTH 4K8RH 1CE6B 1CFQB 4LNRB 3HE6D 3IAQA 5I1JH 1RP8A 3DO7A 4ZOEA 4P4RA 1AO7A 1RPQA 3OZ9H 5GJSH 3WMSA 4MGXA 4BFIB 3SE8H 5K9JH 3NTCL 1NCAH 3EYFB 5MP6H 4NQVA 3TNMA 4P46B 5HJ3B 1ADQA 3OJDB 4A3YA 3F5JA 3GJFH 4Y4FB 1CD1A 1H3PL 1LNUB 1MH5A 3EGSB 4Z7VE 2A0LC 1KOAA 2NZ9C 2D31A 1GZPB 2VSCA 4O02L 2AQ1A 4XC1L 1JGVL 1TCRB 1F4AA 3AAZA 1WWBX 3ARWA 2NY5H 4XH2A 4XP1L 3VFTA 5JIIA 3QUZB 1X9QA 4LKXB 5CILH 3QWOA 4HG4J 3IU4L 3MJ8A 4NQCE 1B0GA 4LHUB 4LEXH 2Y5EA 3UDWA 5HDRA 1MJUL 5GRYA 2C3HA 1MW3A 2NY4B 1ZTXL 4N8CH 1DQQA 1JGUL 3I75B 3RVUD 5IEKB 4QCFA 1BAFL 1B1YA 1BD2D 4APQC 3E3QE 4YHLL 1YN6A 4BQCA 1R5IA 4H20H 4H2CA 1UVQB 2VLLA 3D3AA 3LRSA 2EH8H 1A02N 1JPGB 3HZYA 5FUOH 2NY2D 5C0NC 3UG5A 4ETYA 3SKJH 2CBJA 2DM2A 2HKFL 3PP3H 2WIIA 4CDHA 2P5WA 4Y4FC 4XCYA 3LQZA 3D3VB 4F9DA 3VX1A 1CLXA 1FA2A 4XPBH 2ZOLB 1QLFA 5E99L 3OKOA 5ESAA 4UFIA 5F1NB 3ZR5A 4MX7A 4EK7A 4JB9H 4K8RD 2B5IB 5CSUA 1LJYA 3JV5A 3MXWH 4ZO9A 1P1ZA 3I85A 5D8ZA 1R7OA 1IAKA 3C5ZB 4NO5A 2BC4A 4OZHE 5BXPA 1BVKB 3BZFA 5T33H 1XCXA 2BOBB 2HVKB 4WFFD 4HG4K 4NKIL 1L9NA 3TBYB 1RQ5A 3TWCL 4IDJL 3ARBD 5ELIA 5T1MA 1A9BA 2C1PA 4W4OA 1ZT7A 5GGTL 1NGQH 2R23A 3LHPL 3FMGL 5AEAA 5C2UB 5KVEH 4MAYA 2XWDA 5BV7B 2MKWA 1TZ7A 3DHUA 3RIAK 1E4XI 1CE1L 3MNVB 3LY6A 4POZD 2H9GA 5GRJL 3RZCA 1AJ7L 1DBBL 2GK0A 3PNWB 4UDTA 2PI6A 3W2DL 3SDCB 1IC5H 3IKKA 4H8VA 3N9GH 3RVTC 4S1QH 5GSRB 3SCMB 4R8WL 1ZBCA 1ZLSL 1EA9C 3O6LL 3QH3A 5I2IA 5FO7B 2OTUB 5DD3L 3UG4A 1DUYB 2VKXA 3GRWA 3VFGH 2VAJA 1W3JA 1LQ0A 3LKPB 1IC4H 1OAKL 2Q86A 3LH2H 2GSGA 2F53A 2PYFB 3FQXA 5EULV 1OBAA 1TETL 2HLFD 5KEZA 3KPQA 1XSJA 4JN1H 4ODBD 5ERWA 2OWWA 2XM1A 3QNZA 2PW1B 2JCCE 4MSWB 1JI1A 3SO5A 4I5BB 1D5XB 1KYOK 1HH6A 4L29A 4H8HA 5EZJB 4S1SH 3GMNB 1JGEA 4TVPE 1PZ5A 1AJ7H 1IAOA 8FABA 1VF8A 4ZENA 3ZE1F 1YEJL 3I6KB 4MJ6A 1FGNH 1XAUA 4N1CA 1VDGA 1OSEA 1PG7L 3E6FA 1JNHA 4KTYA 3G6JE 3QFJB 1YQVH 4FZ8H 3RUGF 4MNQD 32C2B 4IDJH 4JM2A 3V8OA 4DWSC 4XMPL 1FVDA 1M05B 1WJ3A 1INDL 4HXBH 3TN0D 1KNOB 4ZD3L 4Q0XH 3VFRB 1ZHNB 5EU6B 5EU7E 1B3JA 1R5WB 4Z2HA 3DVGB 2IPTH 2ZUYA 3MV8B 1NOFA 2HRPH 4FFWD 3S36X 5DXWA 3TESA 3TV3L 2E7CA 1NBZB 1YMHB 1YNTB 4Z7WA 3QEGL 2E9MA 3AHTA 2KQMA 2K3TA 1A7RH 2WWDA 2X4NA 1K3IA 3AFLA 5TE7H 1S46A 4O58L 2C4FU 1MY7A 2P5WE 4P9HC 5IFJA 1RVFL 2EPMX 5JLZB 3CHEA 1IGTA 3OPZL 2O5YL 1AGBB 1FZKA 1J8HB 4I0PB 4R97C 3BCDA 4WFHD 5SX4I 4NRXB 1PX4A 1B0IA 1UWGL 3B6SA 5DZOA 4HUVA 2P8LA 3ARXA 3OKOB 4UQ2A 4H04A 5I1AB 1GOWA 3RWHB 5DD6B 4P5TC 4Z7OF 3LN4B 2UWEA 3F12A 5CSZA 2JB5H 1RFDL 4ZE4A 4JZOA 4X80H 3AS3A 3WD2A 2EZ0D 1LE5A 3W0KA 3C60B 3MRHB 2WVVA 4NZRH 1RUKH 1EEUA 4Y8AA 3VRIB 3L2MA 4AH2B 3CFKA 1B4JL 4Y19E 5GGTH 3C5ZD 3QEUB 2FD6H 2LABA 5I1LA 3ZHKA 3VIGA 3RVXD 1HKFA 4X9YA 2DQJL 4JKPH 5HGDA 3MNVA 4U2ZA 4NKIH 5ID1A 5MENB 4FLQA 2BVOB 2KDGA 2R69H 1NWSA 3OKEB 3GH4A 3SDXF 1KLUB 3FQNB 3TCLA 3G5XB 3VGBA 1DJSA 3WKML 2IQ9H 2H6PA 1XGYH 3MLVL 4UB0H 4J4PD 1L9MA 1Y18B 4OQTA 4RMRA 1KXTB 2X7LA 3MBXH 5HHOD 5FA3A 4ZFZB 4DUWA 5FOBA 1J8HE 4L8CA 3GHBH 1DUZB 4FQHB 1N59A 3RDTA 5LBSH 4WUUE 3RGVD 2DRUA 2XQBL 5F9JB 2Y6SC 3DXAB 3QUXB 5A16B 2ZG2A 4QXGL 5IGXH 4KI5F 2H32H 3GMPB 5FYKD 1KCVL 3LS5L 5E03A 5FUOL 4MCZA 4C55A 5KW9L 2GCYB 1MRFH 3KYNB 4L3CA 1QFWM 5HVFB 2ZUUA 1U33A 4IMLA 1GPFA 3VFOB 1MEXL 2QHLA 4NO2A 2G3IA 5FHBL 2PYED 3VXRE 4GINA 1DLHA 3KPSB 5B4MD 4LNVA 5FYKH 3VXOA 2BXYA 4FXKA 3PJSB 4X9BA 3OAZH 5LWYH 3QXTA 2X8RA 3MYJA 5FYLH 3O9WA 2WMPA 5C3TA 1I9IL 2PTTB 3LS4L 1CGSL 2FX7H 5F7EH 1OP5H 1XZ0B 2FCBA 4U1LA 4M02A 3U48A 1HT6A 1GSMA 4PG9A 4YNYA 5IJVB 4XH2B 3JV6A 4GXVH 5E8NB 3H9YA 3UP1A 2VRJA 1A1OA 2A73B 3UTTB 5FL1A 2OWCA 1YEGL 1GVYA 3GNOA 1QI0A 1VB9A 1OVZA 4Q74A 3QIBA 1NFDB 5KTEL 3HE6B 1NP0A 3QFDA 5F9WB 1NGWB 3RNKB 5GGSA 4NQVB 3TNMB 4NI3A 2QJDA 2OYMA 2QKIB 1XF4A 1P7HL 2O5XL 2CRYA 1YN6B 3VXTB 4F7PB 1WWCA 3EYPA 1OW0A 2YPLB 4J3UA 2ICEA 4QF1B 2DSZA 3DO7B 2B2XL 1QEWA 3IFNL 4PRHB 2V17H 3IVKB 4X7FC 3S88H 2E9LA 1J10A 2P5WB 5E6YA 1NDGB 3I6KA 3ZDXE 5I8OL 1XH1A 4OLUL 3ARGC 3D85D 4LCWA 3T0BA 1XGPB 5HVHC 1FZJB 4PJGA 3E8UH 2P8LB 4HKZA 2CUIA 4ZTPL 3MMUA 3FO1B 4GRLC 4P48A 1FHLA 3ILPA 1OAYH 4BZ2L 5ESAB 1LILA 4J3VA 1JAEA 1GQIA 3BH8A 1NSNH 4AK1A 3AZRA 1G0DA 2LVEA 3KLSA 4LASL 3I9GH 1OGTB 2XV6B 4Z8FH 3W82A 5EN2A 2AQ3A 4BUGA 1LE5B 4FTVA 4JFDB 1R3LA 2ZNWA 5MI0C 4PTXA 2ZG1A 1IZKA 3GBML 5B39B 1EFXD 4MAYC 4BQ8A 2BSSA 2VZTA 1I1WA 2JFEX 2X4TB 3C2AL 5TH2A 1N0LA 1ZSDA 4N8PA 2ZCKL 4D0CB 4MNQE 3TGXA 4EUPG 1R0AH 2D20A 4BK4A 3PZMA 4Z95L 1WAAA 2CIPA 4YXKL 3OIHA 2NXZC 1DBKH 1RZKH 2G60H 1RIHH 1K5NA 1E6ZA 4DVRL 1KFAL 1UJTA 4TQEH 4PRHE 4Q9RL 1KXTA 1WIUA 4UDUB 3N18A 2VQ1A 5I77A 1I9JL 4CCEA 3TA3C 4Z95H 3VMOA 5D7IE 5E00A 2P43B 1GHFL 3NBNA 1OARL 1F3DH 3GMPA 3SDAD 3NCFB 5FGCB 4RA0C 3CAFA 5D93C 1S3KL 3HNTH 5DC4B 4D8PB 4ZDHB 5C0IA 5KVGL 3WSUA 1KB3A 4QRUB 4HIEB 2PR4L 3H3PH 3WIFB 2GFBB 3E2HC 3T0WA 2IFFL 5DK0B 1QG3A 3D2UB 2NXYB 3OB8A 2OR8A 1U36A 1VFAB 1XIWD 4XX6A 4QWWC 2FBOJ 3AY4C 2G3JA 4HSQA 2ZUXA 4QT5A 3IDNA 3NDYA 3KPSE 4PGDB 2UVEA 3B9EA 2R8SL 3C6SB 5AC5A 4JO3H 4YNYB 5IJVA 1I1FA 1V0MA 3D87B 4R7NA 3EO9H 2FNBA 3ARFA 4PYSA 3EYSH 2J4WL 4HUWB 4DWSD 4WNQB 2GDUA 1BFTA 1D5XA 3P77A 2YBUA 1O7VA 4ZAKC 3A4XA 1QSEB 3VXSD 2GSGB 3FQXB 3BKML 5FYJU 1ZBWA 1H8SA 4HWNA 3G6JB 1WPCA 1NBZA 1YMHA 1YNTA 5D7IF 4A6YH 1IKNC 2RGLA 5JW3L 4Z2JA 5F7FA 4FXGB 1RK1B 3QO0B 4J3SA 1VJZA 2RFXB 1KGCD 4LSTH 1SMOA 1UR9A 5K9OB 4M3KB 5GGVH 4JRXD 4RQQA 3U4BL 4JN2A 1A64A 4N5UA 5HYJB 1DBKL 3D39B 2DD8H 2FECI 5HGHA 4UUJB 4J6RL 4OZGB 3NZ8A 1KN2H 2IAND 4CBPA 2P1YA 4FQIL 2Q3ZA 3VFPB 1JDCA 4PGCB 4ZFOB 5EZIL 4POUB 3TT3L 3S35L 1AMYA 1KELL 3INUL 1EZVY 2AJYH 3WDPP 4B5EA 4M6MH 4FLOA 3DX6A 4I2XE 3QSKB 4GRWH 1U8IA 4YDVA 1A5FH 4F33A 1CT8A 3WYRA 3N50A 5D7JB 3VXRB 3O2WL 2XG4A 3T0EC 3WFCH 5T3ZL 2P5WD 4NRRA 4OFPA 1WDRA 2C7UB 3QUYA 3PG2A 2B8OT 3MUHL 3CZJA 3F7QA 5KSVB 3QBTB 5BZWB 4RGOH 3QRGL 4JEGB 5F21B 1I3GH 2FR4A 4KQ3H 1IZJA 1QI4A 2EDBA 1G9MC 1UM6L 2DD8L 5JQ6L 3STLB 3VI3E 3CLFH 3TLRA 5F88A 1C7SA 4U1NB 5ITBH 4BQ3A 5A6AA 3MRLA 2WUCH 5T3ZD 2PCPA 5CJ8A 4GMTL 5EBLB 1DWAM 4U49A 1R6VA 3GIVA 4HK3J 2X89A 2VLME 1E4LA 2VZSA 1UWRA 3ARDC 3MJ9H 3BH8B 2VUYA 1V7ML 1RU9H 2J75A 1GGIH 1NEZG 4MD0B 3FRPG 5C09A 1E27A 3WL0A 4MB4A 2DIAA 3DV4B 4IHOA 2OZ4A 2X4PB 3OZOA 4CD8A 5J12B 2OYKA 1BBJB 1F02I 1JPFB 4GQPH 4OD1L 9CGTA 3EMZA 4XNMA 4OSUH 4TUOA 5T1LB 1U92B 4TTDD 5D9SA 3PWJB 4I18B 4OLWH 4LAQL 5EB9A 5BVJB 5IM7A 3S5LB 4YHML 1C1EL 1CU4L 3DX8A 2IMNA 1GAFL 1QQDA 3P9LA 1BQLH 3KWWA 4PSPA 1MWOA 1W0YT 4E9LA 3MLWH 5HI5D 2EDQA 3IFPB 2WBJB 3GZKA 3HMWL 1FAIL 2CITA 4IRZL 3MOBH 3ARDA 4GAGL 3UYRL 2VZOA 1V6XA 4NUJB 3QUMH 4F3FB 5IR1A 1LF1A 2AP2A 2X4SB 1CLOH 3QEGH 4NPYB 1QSFD 4P57B 3ZDYE 1DN0B 5E9AA 2BSRA 4PJBE 2YWYA 4KGLA 1IRAY 1KIPA 4KY1H 3MYJB 5ABFB 1MHCA 3FOLA 3IDGA 4Y4HD 2F54E 2K7QA 3ROOB 1C8PA 1UJ3A 5EBWA 3QEQB 5EC1A 5KAQF 2YLLA 3F8UB 2WMJA 1X44A 2HFGH 3G04B 2VDPL 4UAOB 3MUGB 4RAUA 4JKPL 3DI2B 4WI4A 3IDNB 4F58L 3F7YB 3SDDD 5FUZH 2YPLE 3OHXA 5DJXB 2ATKB 1EUUA 2A6IA 2P5EE 4GRLD 4DVBB 4PPTA 4UINH 4HS8H 4N0UB 1AR1C 3VXTA 1MUJB 3N15A 3UTSE 1KIQA 2I07B 2GYSA 2KPNA 2VNCA 3P77B 4YDIL 4D0DA 4WI8A 5EIQA 1ZU8A 1EAPB 3O3DB 3WNKA 3UDWC 5DGRA 5GS3A 4PLNC 3RWJB 1SYSA 1KJ2A 3GH5A 1NDGA 2FO1A 1VKXA 4PJFF 5ALBL 5EG6C 4O2CA 3ZE0E 4HKZB 4CMHC 4P8XA 5HGGS 4WHDA 2YMXL 1OPGL 1BEYL 1IVLA 1KACB 4XI5D 5DUBA 4PRHA 2ZX7A 1ZLSH 1WP6A 2H1PL 2PBGA 2ZOKB <