4MB4A

Crystal structure of e153q mutant of cold-adapted chitinase from moritella complex with nag4
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
528
structure length
528
Chain Sequence
GTITSQDDNVVVGYWHNWCDGRGYQGGNAPCVELKTVNPQYNVVNISFMKVYDIAEGRIPTFKLDPTIALSEAEFIAQIDTLNSQGRSVLIALGGADAHIELTRGDEDALAAEIIRLTDLYGFDGLDIDLQQAAITAKDNQFVIPAALKMVKEHYRKTGDNFMITMAPEFPYLTANGAYTPYLTELDGYYDFINPQFYNQGGDGLWIEGVGWIAQNNDALKEEFIYYIADSLINGTRNYHKIPHDKLVFGLPSNIDAAATGYIQDPQDLYKAFDRLKAQGQPLRGVMTWSVNWDMGTDAANNSYNQQFIKDYGNFIHNQLPPVTDMTPTLSGIVDTRVELDSHFDPLIGITAKDYQGNDITADVTVSGSVNTNQVGDYLLTYSVSSDDETTNQPRKITVYEILPAFTGITDTTVVIDSEFDPMQGVSASHPTQGDLTANITVTGEVDTNVVGVYELTYQLFYGQDNQQNMTDKRIVTVVTDAVSDDDWQVGSTYVKDDKVTHNGATWTAQWWTKGEEPGTTGEWGVWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Chitinase 60
publication title Crystal structures of substrate-bound chitinase from the psychrophilic bacterium Moritella marina and its structure in solution
pubmed doi rcsb
source organism Moritella marina
total genus 174
structure length 528
sequence length 528
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2013-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
A PF16403 DUF5011 Domain of unknown function (DUF5011)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.20 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Carbohydrate-binding module superfamily 5/12 4mb4A04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mb4A03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mb4A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4mb4A01
2XVKA 5SV3A 3CX5J 2VKXA 3KPNB 3QIUC 4TULL 1EXPA 1FZOB 1ONQA 1T1XB 5GGVH 3VD7A 4E41A 4FQPA 3S3PA 1BGAA 1B0RB 5C09A 3G5YA 4J7RA 4GT7A 3SE8H 5CSBA 3OKDB 3QHMA 4JY4B 1AXTH 4OV5B 2J77A 2XWBA 2Y24A 2Y1VA 5BV7C 1FQ9C 3GBML 2ADJA 4JFPB 2HWZL 2MHAB 2A1WL 5ISZD 2UWEF 5C0AD 3UXFA 1G7IA 1IZJA 4DZBA 1Q8MA 5HVHC 4M7LT 3CMGA 4MA1B 4XVTL 5IKCA 1JWSA 4P2QA 2Y7QB 3CHEA 3VXSA 2PYED 2BDNL 1TQCC 2RHEA 1BAGA 5DJAA 5EUOE 4N8VB 4HQQL 1D7FA 4TUFA 2GCYB 2GSJA 1XH1A 4BZ1L 4OD1L 3PV7A 4NQDA 5TE6H 1XF1A 5EIVA 2O5YH 5ENWA 2EE9A 5SX4H 1YY8B 3POCA 1ZT4A 4MNQE 2P5ED 3BFOA 1MFDH 3MGOB 5JOFB 2BVDA 4MX7B 5FD0A 3STLB 1YEHH 4M4PA 1LEGA 4WHTB 3DHMA 3IJHB 1K4DA 4JB9L 3HRZA 4U1MB 4NGHL 2VLKB 3T4YB 3KL5A 4QTIH 3LIZL 4S1SH 3HS0B 3EYFA 1AGEA 3MCKB 4M62L 5F7UA 2Y23A 1HQ4A 3V0WH 3AFLA 1I3RB 1U3HD 1VFAA 1RUPH 2VZSA 2ITDA 3QG6B 4PJ8D 2IH1A 4WI7A 3MLPA 5E4EC 1DQQA 3LDBC 4YK4C 1N4XH 1IQDB 5DF0A 4LGXA 4HGMA 3QG7H 3I6LD 5K93A 4H1LB 1C16A 3JTTA 3LS5L 1KGXA 2HT2C 4WW1A 1B3JA 4S11A 3U6RB 1EIBA 5F7EH 1IL1A 2AGJH 4JFFA 3W0WA 4RFOL 3C6SA 8A3HA 3L9RB 2LFGA 1KG0B 4TUJA 2ZCLH 4LFHD 5DA0B 4WFEE 5IB4B 4XBPB 3GIZL 4I2XE 4LCWB 4KKCD 1RZ7H 2CUIA 4UAOB 4XB8A 4Y0GA 2F5BL 5HGHB 3MUY1 4LSPH 2YLAA 5E00A 2EXYC 3GRWH 5EFIA 3GHBL 2PR4L 4DN4L 3MUIA 1WFNA 4JPVL 1IM9A 1LO0L 3HUJB 3QCUH 4PJHA 3W11C 1M03A 4ODWA 1ZGLP 3HZMA 3GMLA 5EOCH 5GSVA 1X5YA 3RWDA 2X89D 1AGBB 3NAAH 2NY5H 4HGWA 3P9WB 4OCYH 1AO7E 1F45A 4ELMB 4HU0A 2VVSA 2M1KA 5GSRB 4HPOH 1JNNL 4YXLL 1BPLB 3ZYJA 2AV1B 2XKNB 5EBAA 1FE8L 1T4KB 3L7FA 1GOWA 5FKYA 4JPIA 2Y25A 1BFSA 3A4WA 2BNRA 3ALWA 1BEYH 2VAAA 4P7RA 1KWKA 4LCYA 4PD4J 5E1AB 4YEFA 4GRLC 5CLWA 3KPQB 25C8L 1GZQA 3EJYC 5BO1L 3SPVB 3W2DH 3BGAA 2LU7A 1KC5H 3ARFC 1B6DA 3NACL 1INEH 2X9YA 5FK9A 4F9PA 3OR7B 3VXMA 3IAQA 4RGOL 5IFHH 1UM5H 1FPTL 4R8WH 2Z92A 2ZKHL 2APVA 3RWHB 5I2IA 3F5LA 3MLSH 2FX7H 1NBQA 4YDVB 2IBBA 2VXVL 3PWNB 1KBGL 3GJFH 4P23C 2H2SD 3DX7A 1KQZA 1HL9A 3MSDA 3S35X 5C07D 4KK6D 3PZOA 1EUUA 4OQTL 3BAKA 1E4IA 1U92B 1KN2L 3N15A 3W27A 3ARGB 1BD2B 1V0KA 4AEHH 1P9MA 4N1CA 4UB0H 4Y2DA 4AEFA 4XP1H 2YIHA 4JREC 2AK4A 3UAJC 3LAFA 3ZJKA 1I8KB 3UTQB 5B39G 5TDNB 3HTLX 1SM3L 3S98A 4QEGA 1QNRA 4XNUL 1XIWB 4A6YH 2DQIL 1TPXC 5JZ7D 1AD0A 1QPKA 4QHLB 1FNHA 2ZXBA 3WKZA 1I1YB 5E2WL 3EYOA 4HWBL 5HVWA 5DUMH 3EYQD 1OD9A 4FQXB 2YA0A 4MD0A 4DOHB 5ITBH 1QRKA 2GJ6D 1E4XL 3FOLB 1JG9A 3VXRE 2ZSWB 3MRFA 1SJHA 2A73A 2BCKB 1NCAL 4G9FD 1DDHA 2A2QT 3M17A 3MRIA 5CEZL 1H41A 2UY3A 5A3HA 1NC4D 1TVHA 2XXCB 2NNAB 4LGSB 3LPPA 1T7ZA 2C5DC 1AMYA 1UZ6F 4UT7H 3DNKA 2VSCA 1J88A 3F65A 3GBNH 3GJFB 1MFVA 3AS3A 1UZ4A 4F80A 1VESA 1NM9A 1NCDH 5IP4A 3MLUL 3O2DA 3DXAE 5FCSH 2ICES 3I6LE 3WUGA 1IM3B 5E9DA 3KHQA 1KCVL 4X5XA 3ARUA 2R2EA 4X6CB 2D31B 2XV6B 4R4FH 1HCFX 1QHOA 2R1YA 2YD3A 5L8JB 4U1KA 1KTRL 3KPRB 3BP7B 2WVSA 1ADQH 2F19L 1E27B 4X9GA 2VXQL 2CYGA 3BD3A 3D0VB 2V6HA 3CZ8A 4GAJH 5KVEL 1HKLH 1RZGB 3GXDA 2QF8A 2H2PC 4X6FB 2D7QA 5DJZB 5FOOA 3VWJA 1INDH 1XSJA 3DMMD 1HH6A 2DQTH 3DBXB 2GHWB 4M6AA 1LL7A 1NFDE 4LSTH 5DT7A 1NMAH 2A83A 3QISA 1SYTA 1A2YB 2SEBB 4HA1A 3W39A 1S7QB 4HFWB 1A3QA 4TVPD 4ODXA 5LQBH 2X1IA 2RCSL 4PBVC 3CC5B 4P4KA 3O11A 4YX2L 3MV8B 5DT1L 3RGVD 3RWFA 1AFVL 4FQQA 2VXTL 1S78C 4YGVB 1ZHNB 4GZIA 4OLYH 1MI5E 4ZUWA 3QJHB 32C2B 2Y36H 4XAWH 3BKJL 4XC1L 4KROB 1U8PA 3VRLF 3UC0H 3WELA 4RFNB 1FBIL 1OAUH 2WNGA 4JG0H 4NNYA 2P7TA 4ORGB 4FXGA 2UUDK 3U57A 3TFKC 2E7MA 2YPLE 4L9LA 2ED9A 3MLZL 3MROB 2KUTA 4FQIL 5D1QC 4QTHB 5BZWA 1KB3A 4AZ6A 1G1CA 3W25A 1T7XA 4I3SL 1S7RA 1T7YA 1QOXA 4JRXE 1Z9LA 5MENA 4NPYA 1YQ2A 5L2JA 2VDLL 1CGXA 4XX1E 4K2UL 1P53A 3GO1L 1T20A 3FAWA 3ZE2E 4KKBC 1FL6A 3AFBA 1Z5LB 1YJDH 4PBGA 2VLJB 3WUEA 1YEEL 2DQEH 3K4ZA 4V1DB 5CGTA 3BDBA 4EBQL 2X5PA 5DRNB 5ABHA 1C8YA 1UWUA 5IW1A 1A6WL 1I9EA 1GGIH 3WD2A 2XQBH 4P3DA 2LU3A 2W60B 1S9WB 1LG1A 4I77H 1BLNA 4YDKL 3DX8A 3K2MC 4P9ML 3CH8A 1T2JA 3WH7A 1OPGH 4U6YB 4CCCA 2W9DH 1N59B 1R24B 3DPBA 1QFWH 1ITXA 4HXBL 4L4VE 3HNVL 4DGVL 3TJHD 4M7ZC 4JZJB 3NSMA 3HR5B 3PGCA 3B2UC 43CAB 5F9DC 2F5AH 1I3GH 2C3WA 4TPRL 2YKKA 3F12B 1YN6A 1CFNB 1MIMH 3N85H 5LA1A 4U2YA 2VVNA 2H3NA 2DQCH 5E4EB 4CD6A 1YDPA 1W0YT 3GNML 2BVQA 1JV5A 4PJ9C 2IMMA 1XAUA 3BHBA 3B9KD 3L2MA 5A2LH 1MUJB 1MRFL 4UQ3B 5DQDH 2DTMH 1K6QL 3OSKA 4K3JL 2YPKA 1UQYA 2HLAA 3WENA 1U8QA 3DARA 3WFEL 2OQJA 1UJ3A 1LF1A 3B3IA 2X4TA 4HWZA 3ZQ9A 1GOMA 2C1OA 2PETA 2WM0A 2HFTA 3QQ4B 2O61A 2OR9L 1OAKL 2F8OA 2X4UB 4LPXA 5KG9B 3IJ8A 5HHOB 1Q0XH 5EO9B 3V7MA 5TH2B 1AHWB 4OCMC 1OGSA 4Z7WB 2WP3O 5IB1B 3QHZL 4Z7VA 3IRPX 2HFFB 5GZOC 2PF0A 1LK2A 5BW7C 2G2RB 2YMXL 1HP4A 5IT2L 2VLRD 2B5IB 4P59L 4ZNEE 3EBAA 2B8OT 2MCPH 3QFJD 3AB0B 3LD8C 1E15A 2R23A 2XTLA 4G8EB 3W9EA 4XH2A 2XQYG 4XNZC 4KJWD 1GJUA 4QCEA 4P2RB 4D1IA 5M3WA 4DK6A 1YQVH 2VOTA 4GRWB 4NZJA 3GMQB 1NFIB 1ORQA 4ZYKA 1EAPB 3D2UA 2YN3A 3WFZA 2OXHA 2XNAB 3P4MB 1DL7L 1YY8A 2YPVH 3L3JA 5ESAB 1PZ3A 1NQ6A 5E6ID 3C08L 5HD8C 4DGYL 2GQHA 3MGOA 1U8HB 4HFUH 4CCDA 4MZ3A 1JMXA 3K2UH 3GXFA 5H94A 3UDWA 4PY7B 4Y4HB 2FECI 1UB5A 2PCPB 5IBLC 4AW7A 4WHTA 1Z0MA 3FB7B 4UCFA 1HJUA 5A2BA 5IBTH 4PJ7E 3ZKNC 1HOCB 2PXYA 4MJIE 1QA9B 2ZG2A 1NAMB 3OHXB 3RRQA 3UZVB 3LPOA 3SJVA 3CZGA 1DE4B 3R4DA 5DTFA 3EAKA 4CU8A 3UEZA 2X7LB 3WF0A 1XCWA 4LHJB 4F7EB 3CFCH 3LH2L 1IQDA 3JBG7 3BX7C 4WTXA 4ZXBB 3PG2A 4OGYH 4H1LA 3SO5A 1F6AB 1BSIA 4NFDA 3DWTA 2EDHA 4W7VA 4HA4A 2CJUL 4KDTA 3AAZB 4K9EC 4M6NH 4K71C 1I9JL 4K68A 2NZ9C 4JFDA 1NWSA 3WS3B 3GH7A 3U46B 5I1GH 2VDOH 3BE1L 4JFED 3OXSB 2FR4B 4Y19B 5IB4A 1UXSB 5I5RA 1FL3B 4I1NB 2F15A 3TN0C 4XGZB 2E27L 3PP3K 1QNPA 1GORA 2EECA 2QSCH 4HCRL 3BP6A 2X41A 2R2BB 4QWWC 1WDPA 3VI4F 2Z93B 3HUJA 3TO4D 4M8QA 5F9OL 4N0CD 4QRPA 4YZFF 1QPXA 2DLGA 3QXDA 3ZDXE 1B31A 2O5ZH 3LSOB 4WW2A 1IQWH 4PJCF 2YL9A 3MJ8B 2H8PA 2A6DB 1F11B 5FUZL 3ZL4L 1F02I 2LAGB 1J0IA 3HFML 5FO7B 2IPTL 5JLZB 2JF1A 4NYLA 3MV7D 1JYXA 3U0TB 5E1AA 3KPQA 2E9MA 2EDNA 1HXMA 5KOMC 5LAXA 3SPVA 5ABFA 2OSLA 2ILLA 4GXUM 1T1YB 2EDOA 1S8DB 5LVEA 5ADOH 3VG9B 4M7KH 5ESVA 2DT0A 3AREC 3UTZA 3CH9A 1G7PA 1ZK9A 3Q5YA 1XD0A 2L7JA 1MFAH 2C1PB 2H32B 5KSBE 5IWLA 2DI8A 5T3XD 4YDVA 1OAXL 4LASL 4ZO7A 5CD3B 5FECA 1MY7A 1NGWA 2VLRE 4HUXB 1A1NB 3PWNA 4PRBB 3SCMA 1YEJL 3NIDE 3F7RA 5LA2A 4IOFD 2IAMD 1A14L 4YBHA 5B39B 5E09A 1LVEA 2VXUL 4ZS6C 4I5BB 5CCKH 1CDJA 4U1LA 3WLWC 3UO1H 2X70A 4XAKE 4XVUD 1BD2A 2V5RA 4LVNB 4POZD 4NC1C 1I7RB 5A2IH 1JD9A 1PX8A 2F53B 2N4IA 3N1MC 1AI1H 3BZEA 2UWEB 1KGCD 4HUUB 1V6YA 2X1XR 2R56H 4XCEB 4UIKH 1Y6KR 1ZLVK 3UTQA 2EE2A 4KRLB 4HK0B 3TBTB 5CXPA 1OGAA 4IMLB 2B20A 2CKRA 3POHA 5HI5D 1W91A 1FP9A 1E4WH 3IFLH 1XCTB 1RJLB 5JOPD 1S7VA 1I1YA 5JUEH 3RMEA 4GLRI 4P2OD 2D7TH 1KYOK 3DLQR 5I8CB 1ZLSH 1IAIH 4N0UA 2EH7H 2Z1SA 1Z9OA 4WJ5B 4FQ1L 3MJGX 3CK0H 1I8MA 5A2CA 3GFUA 3O6FC 5D1XB 5TQ0L 3TZVC 3U30C 2WBJC 3O6MH 1ZT1B 5IROC 5HGDA 4GO8A 1NUFA 2EYTB 4TTDC 2V7NB 3KPLA 1INQB 1OL0A 3NCFB 3OAZK 4JDZA 4ONFL 4JHBA 4XCFL 5AD0A 3MJ7B 5ABEA 5I77A 1W3JA 4LLDB 3X13A 5HDOA 3RPKA 3U7VA 3GGWB 3KVQA 3H3PH 1IVLA 4QKXB 4OIIH 3OB0K 3AS1A 3WKMH 2A6JB 1E5JA 3C60C 1Q94B 3ZKXB 1HI6B 1E27A 3W9DB 2PB1A 4U1GC 4ENED 1E1EA 3KYKH 2NW2A 1P7KA 1RZGA 3G6JE 2C4FU 4FHBD 1CLXA 2PYFA 1DR9A 4W8AA 1I7TB 2EBNA 2F54A 2QHRH 5CGMA 5D7IF 1JJUA 4NSKB 5D96C 1NL0H 4M1DH 4J1UA 3FONB 4JR9H 1EAJA 4BSWB 4PJXF 3E6FB 4HFWA 1XGUB 2OZ4A 4QLJA 3UMTA 1J8HB 2OI9B 4ODUB 1KB5A 3CC5A 5CBAA 3WL0A 7FABL 1MFCH 3CX2A 3GSWA 3IU3B 1KIRB 2XIDA 1B90A 32C2A 3KYNA 3M07A 5B3JE 1CLVA 2PC8A 5DDHB 5EU6E 4MPKA 1PQZA 4KTDL 5CZXC 5F8QC 1MCDA 1X5IA 2ESVB 1KJMA 3IDGB 4HPYH 4KK5C 4TNWK 15C8H 3O3EB 3LD8B 4OJFH 1Q9OA 2OJZL 4LIQH 4FZEL 1RULL 4D6IA 3IF1B 3MRJB 4X5WA 5ILTH 1LJYA 4KZDL 4L3EB 4MDJA 3CVHL 3CMJA 5EOCJ 4DAGL 3CTTA 4B7IA 4F7CB 4X4MA 5DC4B 4MXVF 1MLBB 1UWRA 3WF2A 5D2NC 1OSPH 3MXWL 2VLJA 5T3XE 2CKBB 5JQ6H 4IRSD 4G8GD 2GK0B 3OGOE 3T0AA 3HC4L 3O3UN 1JGEA 2X42A 4MD5A 5EC2A 2J8UE 1V0MA 3NPSB 2NX5A 1FGNL 3X3FL 3SE9L 3NIFE 1H0GA 2G8ZA 3DV6B 2PO6B 2J6EL 2EJ1A 5E94B 1J1PL 4QRRB 1N59A 1R24A 2Z9TA 1FORH 4I18B 3U36B 1I3VA 3EO0A 3GSNA 4K94C 4NNPL 3REWB 4IHOB 3CXHJ 2RIKA 4YPJA 3T1WA 3A47A 5I74C 5HVFB 4HHAA 4N1HB 1MJ7H 4LCCB 4LCUB 2GEEA 2DI7A 4NRSA 4MD4B 2OL3A 4BH7B 2IFFL 4M1RA 1CIDA 2GTZA 4C55A 1E6SM 5AYBA 4CNIB 1YY9D 3P9MB 3CMOL 2DGAA 2VH5H 5D5ME 5E99L 3V2AR 4OTXH 1DBKH 4G6JL 1RZIB 4ODVH 1CBVH 1WAAA 2AEQL 3QUYD 2BP3A 4QGYA 5A43C 1T0PB 1FGVH 3E8UL 2D4FA 3AXLB 5AG9A 1MCPH 3RZCB 2D3VA 3ZHKA 2DQHL 1DQJB 3O9WD 3TN0B 1A6TA 4JN1L 1P7QA 3O3AB 4N8CH 5TH2A 4AEIH 3EOTH 1CWVA 1NPUA 2VDMH 1A7RL 2X44D 5A1AA 4HKZB 2VL5A 1TJHH 2EIZA 4YUEL 3G5VB 4Z7WA 2IALB 3UEQA 3NIYA 4MHHI 1EPFA 2NW0A 1YC7A 1GOIA 4HH9B 1YNKH 1WFUA 3L3DB 2W65B 1YHTA 3U9PH 5F1KC 5GRVL 5ANMA 4CU6A 2A77H 4J3WA 1W2KT 3TT1L 1IGIL 3NZHL 1M6OB 5C0CD 1DLFL 1KEML 4P5KB 4ZFGL 3QZWA 2QLYA 3VXQB 4PRNA 4ONGL 3N06B 3O2VL 4O5LL 5GS0H 2GVYA 1G6RA 3HKFA 3VXUB 3KYAA 4IRJD 1JTOA 2H26A 3L5JA 4GRLA 5I1JL 2BOCA 4D0BA 3VIMA 2UY2A 2ZUNA 3DHPA 3FQUB 2ATPB 1YMHA 1UGNA 4AZ5A 2NXYD 3EYSL 3RY6C 2NY2C 3ARFA 4NC0B 4MA3B 2VJXA 3L5IA 4NRZB 3WBEA 4P5TC 5I19L 1FRGL 1ZWIB 3AREB 5LGKA 3SCNA 1T66C 1J05B 1OCWL 4LDOB 5EBMB 4WDIB 5D1ZD 4I0CC 2CDGB 4D8PA 2HTKD 5FA4B 3WS6C 1S9VA 4NJ9H 2PCPA 1CFVH 1KNOA 2CMRL 4TVDA 5FGCB 2J78A 5FL0A 4P23A 2IANB 3FT3B 4JM2F 2HJKB 3HG1D 4LVHB 4WU7B 1CK0H 4DM1A 1DEEA 5JBDA 5FYLD 1J12A 3BWAB 2OS7A 2DSWA 4C83B 3EKCA 3MV9A 1M05B 1EEUA 1QRND 1CFQA 3OAUH 1DVFB 4WCYH 4AIXA 2XRAL 5JR1L 5KTEL 5IHZB 1FZKB 1US3A 5GGRB 4R3SB 5TDPA 4HJJH 4O02L 4LVEA 5DHVB 4ZXBA 4AY0A 5I75B 5C0DA 3O2DH 3T4AB 1EGZA 4QOKB 5F7YC 4XP5H 3DX6A 2VISB 3BAEL 3AAZA 1VDGA 3GBMH 1CEOA 1RK0B 4NI3A 3LN4B 3QULB 3CFJA 3AMKA 3CLFL 3VXOB 4Z78B 3QI9D 1G6VK 4Y19A 5HYFA 5D7KD 2VZOA 5HHMB 5JQHC 4YDLC 2BDNH 2ID5A 4G6FB 3QRFM 5IB5A 4XGZA 3O8XB 4PRPB 4X9YA 3O6FB 4Y7EA 2WC7A 1FZMB 2VC9A 3T3PF 5KZ6A 4BKLB 2Z93A 3C87A 4LCIH 2FJFA 5E03A 4YHNB 2XHYA 5TDOA 2B1AH 2R0LH 4MCYB 2CK0L 4UTAL 4EJ1C 1JMZA 4Y5VB 3MJ9H 4XHQA 1A6UH 1PY4A 1QSZA 3LSOA 3SDCC 4C56D 2VX5A 2HVKB 3WF3A 4EDWH 1BFOA 5IGXH 1FIEA 2CLRA 2YS4A 5HI4C 1D5MB 2H1PH 3V0VA 3I85A 2Z0BA 4P9HH 1MF2H 2EE6A 5I1DA 4P0DA 1DLHB 4M62H 4Q9BA 1UKTA 4AZGA 4UFMA 4LHQB 1HHGA 1IT9H 3P30H 2R4RL 1TCRB 4YC2B 1T1YA 8FABA 1S8DA 3MODL 3JTSB 4S1QL 4OKVA 3DYPA 1CD8A 2V5TA 2C4XA 1CXLA 3VFWA 3P4NB 3BPLC 5I8EB 3MOQA 2JB6A 5K33A 1BQHG 1IC7L 2NY4B 2ORBH 1DZBA 3P73A 5C9KA 1MCWW 3V8CA 5CD3A 4LBEB 4LOUD 4AIZB 4OCSL 3BSZH 2XTJB 2FYYB 5CINH 2W59A 4RGMB 4NZRL 1D9KC 3BEVB 3IFPB 4BK5A 2VAJA 5E0FA 1LK3L 2R9HD 2GSIB 2BNQB 1R3KA 4WRLA 4JAMA 3OX8B 2ZCHH 4I0PC 4KAQH 5B4MC 5F1IB 1PGRB 1M7DA 5BVJB 4PLKD 4PV9A 1WCGA 5I24A 5HHXH 3WCYA 1HT6A 3O6LL 4HUUA 5D1QA 5E70A 1U8JA 5HDLA 3BAYA 5CUSH 3TBTA 5LKNA 3FB6B 4IMLA 5DO8A 5DEFB 5KS9A 3QO1B 1C5BL 4FXKA 4LLVB 2FD6L 1FFQA 4NZDA 5E2VL 4POUB 3QUXB 1RJLA 5D2NB 1ZTXH 3W6MA 3NH7H 4YXLH 2M8XA 2YC1B 2DQGL 4HTYA 1HQRA 4Y1AE 3HG1E 1FL5B 1PKQE 2IC2A 5H37G 4LLWB 5T1LB 3NABL 3NN8A 4YHYB 4TVPL 3VRJA 25C8H 5B38B 1ZLUH 4PRIA 3F7PC 3NACH 5DS8A 4UDTB 5JW5B 2VLME 4FRWA 5JXEC 4AD2A 1OAZL 5IFAL 1FPTH 1QSEB 4LLDA 3DO3A 4D3CL 3H9SB 5BCAA 4U6VH 4Z9KB 5HVGB 4EQ3A 2VXVH 2A6JA 1YC8A 3AUVA 3SGEH 5FGSA 4RGNC 1CFBA 3W9DA 4XZWA 5TGBA 4PJ9A 3UJIH 3MLXL 5J1AA 2WKGA 3NIGF 1JZ6A 3G6AA 1UD5A 2APBA 1H0IA 3MUGB 3QDJD 4WV1B 1YYLH 3UR7A 4NN5C 1VGKA 4NSKA 3U7WL 4F58L 2JALA 4NQCD 3K3QA 5LCVL 1HYSD 3FZUD 3F5JA 2HKHL 2OX5A 3X3GL 3AS2A 1ZHKB 5C0ND 2DQDH 4TOYL 4WIWA 5BRZB 1XGUA 5DGRA 5EPMB 2CD0A 1T0MB 4Q9QH 4DVBB 4M24A 4XB3A 2C7FA 1NLDL 4ODUA 2R29H 3TIDA 4BQCA 1ZMYA 1HKKA 4FFYL 3IU3A 3I50H 3MLYL 4XNQA 3JV5A 4NO0D 2KH2B 3DUHA 2MQ3A 2EDKA 2AJZA 5BW7A 1MW2A 3RNKA 4ZNCD 3FQRB 5EA0L 4R7NB 5T5NF 3VFGH 2NLJB 3VXPA 4D6EA 2D3LA 3ZT5A 4PJCB 5C0IB 5EFFA 3QEHB 4K07A 1IEBA 3TA3B 1G9MH 3FB8B 1MRCH 4K23L 4L8DA 1QD0A 2VDKH 4L3EA 5AC5A 3QDGE 4RE4A 4O2EB 1J9YA 3KZSA 2UV3A 2WP3T 1LP9A 2HRLA 1MLBA 3MNZB 1RURH 3BRGC 1KCVH 3VDCA 1IKFL 1CIUA 1ZGLM 5DMGD 5HNNA 4UQ2B 3RKPA 3QCVH 4KKNA 4GW1A 4MNJA 1YNTB 4XMLL 5HJ3A 4JHAH 5GXBB 4MTVA 1MCRA 5TFSL 1MHEB 2ICWJ 4KY1H 2G3MA 1NEZG 4HMDA 3CCHA 1YMMB 2O5XL 3TTQA 4E42B 2NXZC 5JHDB 4UTFA 1RHHB 4BM7A 1KB9K 4HOWA 4YGAB 3PZIA 2LU4A 1OGGA 4QRRA 1HIML 4LLYB 3QZWG 2P8PA 1HILB 3QRGH 4IHOA 5D2LE 5HYSG 3FHAA 4CD8A 3D69A 5C0EB 3FO2A 4GINA 1ZBKA 5HYJE 4KXZI 4YFLF 4OLWL 1U36A 3UTPE 2NYYC 3CFEB 3MCLL 3RNQA 1V02A 5CEYA 3V4UL 3D39B 5L2KD 1EDTA 1HHIA 3PL6B 1C5CL 1A7PL 1SYSA 4BZYA 1KTKE 3ALXA 1FBIH 3DURB 3T0ED 3TBWB 2MPAH 3KG5A 4J28A 3FT4B 5IMOB 1LHZA 2BJML 1KXQE 3EHBC 1P84J 1FO0L 2J88H 5ALBL 3U7YH 5FYJU 3MBED 3AXLA 1GQIA 5ICZB 3FOMB 3MLZH 2J5LB 4OZGE 2NW3A 5JW4Q 1BGXL 3ULSB 4UOW1 3TN0A 1Q4NX 1FFNA 1KLUB 4KHTH 3ETBF 5I8OL 3GO1H 1NKOA 3AY4C 3OWEA 5DJ8B 2OYPA 3TVMB 4XXDA 5FO8A 3EYPA 3G5VA 1OB1B 5BRQA 3L3IB 4MZ2A 3VW3H 5IIEB 5JNYB 1H0DB 1WUNT 5SWZD 5IMKB 3O4LD 3L3HA 5H2BB 4OZFG 3H0TB 4KK9D 1ZANL 4FQJL 4LPYA 1BYBA 3L4UA 3BC9A 3X17A 4OAWA 1M6OA 1T5WB 1KXHA 3KR3L 4OCLC 4GG6F 1P6FA 5GJSL 1MHHA 2A9NH 4Z7QF 3VXQA 1N2RB 4KHXL 4ZFZA 5KSAD 4JFZL 4YE4H 3EDFA 3INUH 4HXBH 2JFEX 4NT6A 1BLIA 4AIEA 1OM3H 5FUCC 1DUYB 3WIFB 4Q0XL 3UR8A 5D7IB 1MVYA 2MFNA 4F37K 3WEMA 3LEVH 1AD9B 2GI7A 4NRZA 1ZWIA 3AREA 2FH6A 2QR0A 2DQUL 3D18B 3SO3C 4PJXB 3SKMA 3TV3L 1U2CA 3SGDI 2DSVA 4FLOA 5EBMA 3WEXA 3PWPB 1KCRH 1ZSDA 2FRGP 1A6ZA 3CUPA 1Q9KB 1N0LA 2BFVH 4K3JH 3JVGC 2AJVH 4JFSA 1QFUL 3FKUS 5BMFH 2EZ0D 1GHRA 3SURA 2CBUA 4X83A 5F72S 2E40A 1B4JH 3K74B 4N1EA 4MCZA 4HZ6A 4DCQB 3P3YA 5FXCH 5MI0C 3RILA 3ZKMD 5HBBA 3MO4A 1FG2A 3BIAX 3ULUH 3QEQD 9CGTA 2WCAA 4R3SA 4JFUA 5T33H 3MV11 5BS0A 3ZE2F 3LQAC 3T4AA 4DWSC 4NWTH 5KVGL 4QOKA 2ZOXA 3OF6A 5L8KB 3C6LC 5FKAB 2OJEB 4PV8B 3EO9L 5T5NG 4KK8C 4P59H 1RK0A 1S7TB 3VWKD 2BMKA 1LLOA 1JFXA 3MRKB 4Z78A 3HE7C 5K9QG 2KQNA 3EYUH 5D7LA 2Q87A 2B31A 2PTUA 2OMBA 1SJVA 4O51A 1CL7L 3CFKB 2EKSB 4XPBH 1OLLA 2GW5A 2D23A 2ZUQC 3IDIA 3WUZA 1MFEL 1WC7A 2HTLD 3IETB 3O6FA 5LJYH 1GIGH 3LEYH 3TZVA 1GJWA 5E8DL 3ZTJG 4EDXA 2ZX8A 3RO8A 2WBJA 5IROA 3CBWA 5E8NB 4W89A 4PUDA 1JF5A 3MOBL 5ITFB 2Z8WC 1CXIA 2OZ4H 2V9QA 5F1NA 5T3XL 1QI5A 5FDWA 3SCQA 4AZ8A 4X8JB 2WVVA 1MWAA 4MCYA 4KRUA 1GHFL 4TSAL 3FFCB 5D9MA 1KB5H 5E5RB 5BXRA 3N11A 3MUHL 3EDEA 2VZVA 1O7VA 3RU8H 5IMLA 1BTCA 3T77B 3N13A 5F3HB 3FCTB 2V7HB 1ZLWH 3R8BB 3RX8A 1QVBA 1DQDH 1A9EA 2KDGA 3T0EE 4QYOB 5EBGA 1F42A 2VQ1B 2VLKE 3C60A 5M94B 1HINL 4YLQT 1RVFH 2R1XB 4L4TB 2HAZA 1V3LA 3BP5A 4WUUD 3RA7L 5J57B 4H0HB 3PABB 1TE1A 3M1BA 3JXAA 1JUFA 1E0WA 4NQED 1W0WB 5EBLB 1BQHB 2ZOLB 3NYDA 1RZFL 2A9MH 1PD6A 2AI0L 4CCEA 3RQ3A 3JTSA 2XN9A 5B22A 3N1GC 1IGMH 4NUGL 5DD5L 3LH2H 4AD5A 4RWHA 1V7NH 3BZFB 3PN8A 4WF7A 1EGJL 5E8EA 3OJMB 3F7YB 1JRHL 3B9DA 4JCMA 3O4LE 3BKMH 2V2TB 1GNXA 3HPJA 5ID1A 1WBXA 1WQVT 1GOGA 4C58B 2CDFB 3B9AA 1T03L 3GKWL 3KNBA 4QHMA 2WWMD 3F58L 1T1WB 4NQXB 2HN7A 5DLMH 3GSUB 2P8MA 5CZKA 5AZEL 5AZ2L 1FLRL 3DRTB 4D9LL 3OX8A 3HPLB 4LCWE 3UTSB 4YQXH 3WIHL 3VFMB 1G01A 3GHEL 4XWGH 5BVJA 2ED8A 1ODAA 3WL9A 4FABL 3TO2B 4GPNA 5HYQB 1NBVL 4J6RL 3GSNH 2A6IB 3OKLA 5C8JA 2UZYB 5E8PB 3RX7A 3SDDC 1PG7W 2EC9U 4BFGA 5F9OH 5DI8B 5IVNA 4Z2KA 4LNRA 4ELME 2MOVA 1KCLA 3FO0L 4D72A 4GKNB 3STZB 4CGTA 5DMIL 5JPNA 5D2NA 3NSXA 1GZPB 4M1GL 1HKFA 1B9ZA 4WSKA 4MXQD 3QIWB 3I2CH 2EDWA 4HBCL 2D7OA 1LMKA 2V3GA 3HFMH 4W88A 4JKWA 4AL8H 1LO4L 4Q6YA 3MRHB 4LLWA 2CITA 1NBYB 2Q7NA 4NCDA 4PLOB 4FXLA 4IDJL 3BIKB 3W0KA 3D85A 5B38A 2ZSVA 3EYVA 5K9KB 3PQYD 3QEQE 5JW5A 3TCLA 4JM2B 2W38A 1QSEA 4U1IB 1YEGH 2J7HA 2OWWA 3H9SA 1CQKA 1L6ZA 1F6LL 5JPMA 5J12C 1TZHA 1CWYA 4MAUH 2EXWD 4TRPL 3SQOL 4RMTA 2E6JA 4PEEA 2FSEB 3IXTA 4LVOB 4ODTH 1FNGA 4Z8FL 1T7WA 2VXUH 1MRDL 3WQ8A 1TZ7A 3MUGA 1ZJBA 4KRNA 1BD2E 4X6DF 3ME0A 2XZQH 3O41B 5EORL 1DJSA 5DD0L 5I15H 4YPGB 5GQBA 4HF5L 1GQJA 3VE0B 4MQ7A 4XRCB 4LK4A 3VX0A 5JDSA 1ES0A 2HA1A 4AMKL 5EPMA 4DKAA 1G6RH 4P48A 1B0WA 1FZJA 3HRPA 3ZKSD 1QSFD 1U8LB 12E8L 3KXFD 5GRWA 1T6VN 4RZCA 1HJXA 4DOHE 4RISL 4PFEA 1UH4A 3T3ME 1XGRA 4XNYL 3IAGC 4WUUE 4WGVB 5JHLL 3HZVA 3C5ZC 4HIXL 5TQ0H 1PG7L 4GSDL 3KPSA 5C0IA 2P5WB 4X0KA 2ZUMA 3QEHA 4NRYA 4LSVL 5M7QA 5DHYB 3OB8A 2QQLH 3IJSA 2EH8L 3FB8A 3S2CA 2VITB 1OVZA 4BK4A 4GZJA 2Q76A 2X05A 5TF1H 4XCFH 4X6CE 3L4ZA 1OF2A 3KPRE 1XGPA 3RY6A 2DLIA 1CENA 2HFEA 2WMKA 3WO4C 1V0LA 2OSWA 3OAYH 4OZFH 1H8SA 4P5TA 4JN2A 1ZT7A 5DJXA 3W81A 5HYSB 2HMID 2NTFA 3MYZA 1CDCA 1YMMA 1FNLA 4PTTA 3NCBB 2VCAA 4ZD3L 4E42A 2W9LA 1RHHA 3WS6A 3DVNA 1QI2A 4F7PB 1RZKL 2YD8A 2X0HA 1W9UA 5L9DH 4P2RD 3BP4B 4PRHB 5F88B 1J5OH 4IOIB 4XX6A 2Q6WA 1VADB 2IGFH 5GRUH 2GK2A 5T1MA 1HILA 4PJDF 2EYSA 2XPGA 5I71B 4C4KT 2VC2L 5C0EA 1BX2A 2D7MA 5IVXF 3MV8E 4H88H 5MI0B 4Z2HA 4ORZC 2DM3A 2E0PA 1CDGA 3DSFL 3PIQB 3D39A 4G6KH 4AD4A 5FL1A 2X4NA 4O9HL 2E3ZA 4JGJA 5E6YA 3HHRB 4CN6A 1JHLL 1FDLH 3QUZB 4GMSL 2I60H 3FT4A 1R3IH 2MMXA 1KPUA 5KSUA 1F3JA 4MJ4A 4XT1C 1NSNH 1W2PA 2WMJA 5ICZA 4KK6C 2VDRH 4FZEH 1YEFH 1A21A 3LS4H 1HP5A 4R2GD 2VTFA 4OD3H 5EU5B 3QA3B 5DR5L 4HU8A 4L3AA 3HNTL 2DWDA 1ISWA 2FDMA 4G9DA 3I6KB 3O9NA 2IEPA 3MGTB 1B3ZA 2XVGA 4FQCL 4V1DE 1RUAL 5ACZA 1FC2D 5IHUH 5IIEA 1C1EL 2BY1A 3P11L 5IMKA 4ZMAT 3VJ6A 5EN2B 3HC4H 4TVCA 4MWFB 3ULVF 3I3EA 1CGYA 4GW5B 4WVRA 3T09A 1UA6H 1ACYL 2DBLH 3SDCA 1R0AH 3G6JF 1UT9A 2Y07L 1T2XA 4Z2JA 5FYLL 3X3FH 2XFFA 1CFSB 1VAHA 3OKEB 4MDOA 1ZHLB 1N2RA 1RY7B 5EH1A 1DFBH 3ZDYF 4XPFH 5I1KH 3VFSB 4RAUB 3AIRA 4NNPH 5CEXA 3TA9A 1JWUA 3ZTJH 3GBEA 5IK3B 3QIBC 1AKJB 3RHWF 1DUYA 2CCRA 3IFOB 4L8SB 4K7PL 3OLEA 4HKBA 2PBGA 3SCSA 1A7NH 2ARWA 4QP0A 1AD9A 4HUKB 4CBPA 1QI3A 2GAZB 3O3DA 1II4E 5A95A 5GGRY 1U8NA 4PJXA 4QRUB 3JWOL 1J18A 2W0KA 5E2TL 1QLEL 3CVHB 3MA7A 1JXKA 4NC2B 1JDAA 4Q58C 4LARL 3BDYL 4QO1A 4GI8A 1D9KA 3SN6N 4XC3L 2OCFD 3N9GH 3NDZA 1UACH 3D3AA 5F7HA 1ZBWA 2KL6A 4CUCA 1MHCB 4I0PA 2DF3A 4PJ5B 2HVJB 5EU4A 1QI0A 3DMMC 2R2HB 4PGBA 4DCQA 5HHOE 4S0SD 3QDMD 4IOSD 3WXVH 4WFGD 3QCTL 4E0RB 5L0QC 5IW6B 3DTXB 3QHOA 4G43A 1S5HA 3HE6D 1T0NB 5MEQA 4GAFB 4LRNL 1E73M 2N56A 1BMGA 4LX4A 1CLYL 5FKAA 3ZE0E 3NA9H 2OJEA 5TE4L 2YZ8A 3RGVC 3VD4A 3F4VA 1UQSB 5ICYB 2XM1A 3NZHH 3OLGA 1DLFH 1XGYL 4F7MA 2XFXA 4P2RE 4Z0BL 4YHPA 1SJEA 3W37A 4G3YL 3RWIB 3CFKA 4GRWE 4ZUVA 1HKMA 3QO0B 1FVCB 5D72L 1NGYB 3IETA 5FYJE 5ISZB 4OBSA 5C0AB 4PIRF 1FHGA 4M6OH 4LYQA 3Q3GB 4ONOA 1KULA 2J7BA 1LG2A 3WLBB 3TYGH 4O58H 2PYEB 2QTEA 1FRGH 1G7MA 3QEUB 3LB6C 1VFBB 3RAJL 5JXEA 4JG1H 5D9SA 2VT0A 4ML4A 2DYPA 3C8KB 4IRZL 2UY4A 3FCTA 1NBZA 4KKLD 3UPRB 4HV8B 3AICA 4F2MB 3MA9H 5K59E 3MFGB 1AQDB 3AVEA 3DIFB 4KGLA 2P5EB 1LO5B 3VILA 2WVUA 3FJTA 2ADFL 2CRYA 3BGFC 1W0WA 5LWYH 2QPSA 1JWMB 4O4YL 2BVPA 3RPIB 5EZOH 4PCTA 3MBXH 3QAZB 3WE6A 5KTEH 5JW4N 3IT8D 4Z7UF 1CFTB 3BQUD 4KQ4H 4I13B 1E28A 1KT2B 5IOPA 1PIGA 2X09A 3BZFA 1LDSA 1GJIA 1EXUA 4UFKA 1H5BC 2JJUA 3VIOA 4OSUH 3S5LA 1V3HA 4NZUH 1C91A 2YBRA 4PD4K 2V2TA 3LMYA 3BUTA 4D2NA 3QUML 5EC1A 2J7CA 1U3HB 4KMLB 3BAEH 4PJ8B 1TXKA 3IDMA 2VN7A 1CGSL 5FIPA 1LWHA 1T1WA 2BNUB 4PB9H 3BRFA 1KLFA 3S36X 1PX4A 5C0GB 3IDYC 5DO2C 2NY6C 3FRPA 3BYTA 3JV4A 4EI5C 2RAMA 1IFHL 1B30A 3MZTA 4AIOA 4L1DA 1B3WA 1RZJC 1HHHA 1X6LA 3RIFF 5HYQA 3RJQB 2A6IA 4GG6B 1BJ8A 2YLLA 3VFNA 4X9HA 5J13B 1AE6H 2NY7H 1LDPL 3MRNB 4C57C 2CK0H 4RBPK 4GKNA 3SOBH 3MYJB 4GAGH 4HWEL 4QCFA 5ERWA 1U8MA 4FF5A 1KLGA 2D3NA 3GUTB 4LLQB 3MLRH 1QFOA 4XPAH 3E6HB 4OZHE 4U7KA 3GSVB 3BPCB 5GNZA 4PMDA 3C5JA 4JKKA 3VM5A 2VR4A 4W4OC 4ZUSA 4D6FA 3A4XA 2ERJC 5IQ7L 1P6AB 5DMKA 4KJYA 4E41D 1RU9H 5CSZA 1IC4H 1U6AL 3BIKA 1UM4L 3CLEH 3QDME 5CJXC 3LHPL 3MODH 2RB8A 2JB5H 4S1QH 4WFGE 3B9EA 3U48A 4BQ9A 3NUKA 1M04A 1JP5A 3GMNA 1U8OA 1AY1L 2Q7YA 4Y16D 3HC0B 5J11B 5ELIA 3Q1SL 1Z3GL 4HX1A 5C7XH 4Y7MA 2NT0A 4P2QD 1NCTA 1IEHA 4IJ3C 3BW9A 3VXSD 4YXHL 4F57H 4KRPD 4R96B 1QEWA 4LSUH 4NZRH 4HCRA 4C7GA 2E9IA 5DQJB 2MNUA 3CDGA 1Q9LA 1UZ8B 2WW5A 4G7YL 3FT2A 4TTUA 1MIEL 2F53E 2IF7A 5ESQA 3OG2A 1MQ8A 4L8BB 3KPPA 3S35H 2UWEE 1KPVA 4UOZA 4YFDB 5C07B 1KSRA 1DUZB 1F2QA 5EZLA 5B8CC 4RL3A 3GSRA 4BFIB 4HIJA 2X4OB 1URLA 4FZ8L 1GOHA 1B0GB 5L6YL 1MNUL 5DJ0B 2ZWLT 1U8LA 4G5ZL 3RVVD 1OM0A 1N8ZA 1Z2KA 3VIIA 1XF3A 1RMFL 4U5IA 1J7VR 1S9YA 3LEXA 4POYA 2G60H 2BRQA 4HUVB 1E6XM 2B1HH 1SEQL 2DLFH 1JAKA 2B0SL 3PHSA 4JO4L 1UH2A 1JIBA 2WKLA 3A6BH 4CADA 4QRQB 4ZTPH 1X5KA 3RL1B 2AABH 4J12A 2P5WA 4FA8A 3NZ8A 1Y0LB 2GJ6B 3MRPB 3VPLA 4H5SA 2AVGA 3P0VH 4U49A 3VXNA 4ZFMA 5DURD 3R06B 5HYEA 1S7XA 2ZUWA 2NY3C 1EMTL 3PWLB 4PJAF 4G9FB 5IFAH 3W0WD 1BFVH 1TNNA 4QF1A 1NC4B 2VKWA 2R1WA 2OTPA 5DJCA 4QXTB 3MLTB 2Y9RT 3DROA 2XWTA 1QUNA 4UQCA 1ZA3B 1XR8B 1WB0A 4GQRA 1QBLL 4GQPH 4XP6H 4DTGH 4K8RC 3WUBA 4YWGH 3I9GH 5CWSB 4LHUG 1AXTL 1D5ZB 5A16B 1FA2A 4JRWA 3GNPA 1L9MA 3LKOB 2D7NA 2MJWA 3JVGA 5GGQH 4YXKH 1Z0NA 3GSOB 3O4OB 3X3GH 1W72L 4M00A 3W82A 3RWEB 1J8HE 3DMMB 3PWVB 1UB6B 3EFFB 3KLAA 1DBMH 1HEZA 2R8SH 5L0QB 5HPMB 3RWGB 2AXFA 5DFVD 1A02N 5EUOA 3DYMA 1FVEB 1HJWA 4LU5H 1NGZA 2BXYA 1MWAH 2R0ZH 4PYHA 4DWSA 1OSZB 5TE6L 2ESVE 3CFBB 4JVPA 3VD9A 1VERA 3C6LA 5I16B 3S34H 1CDHA 4UUJA 1HZHH 5JUVA 1MFDL 3ARZA 4MNQA 3IGAA 3V5HA 4O2CB 1RZ8B 3HE7A 2E7BA 4IOFC 1YEHL 5DJ6A 4Z7NF 3FAXA 4ZOCA 2YRZA 2ZUSA 2R0KL 2HRPH 4PRDB 4QTIL 4WTZG 4S1SL 3I6KA 3BKCH 4XBEH 5T1KD 1F58H 1IKFH 3VGFA 3V0WL 5M17A 4M6MH 2Z4QA 4XCYA 4DVRH 4XMLH 1T2QH 2EEXA 3MR9A 1L7TH 5GS0D 1R3LB 2WPGA 4BQ6A 1RUPL 1GQLA 5EN2A 3WUWG 3WSQL 1LL6A 1N4XL 5HI5C 2GTWA 4Y2DD 2O5XH 1F4YH 4GW5A 1E56A 2XIBA 2XGIA 5DGQA 1OP3K 2AK4D 2MQ0A 3GH4A 1A5FH 3ORJA 1XGQA 4M5ZH 5DEGA 1AJ7H 4G6FD 1HIMH 2ENSA 1MJ8L 5F7EL 3RI5K 2AGJL 2Y5TA 3L95B 3BGFB 3U82B 1P5UA 1T21A 5IHLB 3MRQB 5C71A 2Q86B 3IFOA 1U30A 2AK1L 2ZCLL 1D6EA 1H3GA 4H7VA 4AC1X 3WD3A 4X98B 4WO4B 1RZ7L 3KAAA 5HDRA 4I2XA 4LSPL 1A1MA 2GAZA 4XWOD 2MKLC 3GRWL 4LIQE 2VWEE 1H5BB 4XXCC 3MU7A 3H9HB 3QB7C 1FAIH 2I27N 3ARVA 1J87A 4LYRA 3TPUB 4R26H 4NDMA 3QCUL 1JNLL 4NZTH 4OF8A 1W0VB 3ZT7A 3MNWA 3CVHA 5EOCL 4JFOB 4X0NA 4MDIB 3LKSB 3W53A 3IDJA 1AC6A 2K7PA 5C1MB 4OCXH 3DYOA 4OCYL 4OBRA 1WEJH 2CRMA 4ZO6A 1VEPA 5C6WH 1AO7A 4HPOL 3B9KB 5I1IH 5E9DD 3A4AA 3MXVL 5EZJB 1WCQA 4LYPA 2WHMA 3TH4T 3O2LA 1DWFM 1TCMA 1MCBA 5ID0B 2A74A 1BEYL 4YAQB 4L1HA 2WMIA 4F66A 1AGDB 4K94H 4KFZC 4RIRA 1C12B 5BQ7A 3SDDA 1CE6B 1FFPB 3VWJD 3W2DL 4NKQB 2J6EA 4WFFE 1CBGA 1KC5L 1OTTD 4GIAA 1INEL 3I02B 3W28A 1TIUA 2DH3A 5IFHL 1UM5L 4RE3A 4R8WL 5ICYA 4P7OA 1H4PA 1WCBB 5IM7B 5IVOA 5D9NA 5DYOA 3MLSL 2FX7L 5CD5C 2VQUA 3RDTB 1AR1D 4X6EA 1E71M 4MB4A 2QQNH 3RWIA 3VDAA 4R7DB 2VLRB 3QO0A 3VXUE 4XCCH 2NTSP 4BQ5A 1UFUA 4MYWB 3QFJB 1XYZA 2ARJA 3U5UA 2DSKA 5GZNC 5FF6B 3JV6A 5GIRA 4AEHL 4OF7A 4UB0L 1FVDA 4MSWA 1VFUA 4PRWA 3OIHA 1FO0B 1K85A 4XP1L 3ULVH 1FG9C 4OGAC 1JZ2A 4CMHC 2Y8VA 2EICA 4HJ0D 1RIUH 5IVXB 4APQD 2XA8H 4XBGA 2X9XA 5GJTH 4A6YL 1B4RA 4N5ED 3MJ6A 2IANE 5E6IB 4W93A 5MEND 2IUZA 1RK1B 4PJFF 2DL9A 1ED3B 3VRLE 3V8OA 5F6HI 3T0WA 2A3EA 1WWWX 2IG2H 4R90H 5DUML 3PTMA 1LO3L 2GT9A 4WI6A 3NTCH 5CJBA 4QLKA 4NC1E 3MUZ1 2VLLA 5ITBL 3CUIA 5I76B 4TN9A 1MJJB 4HGKC 1BJMA 1N5YH 4MJ5B 2N7AA 5DRXB 4U0RB 3VXRA 1ZGLA 1CICC 4EIGB 2JEPA 1NEUA 1TQBC 5CMAB 1P4BH 1DSFH 4X9BA 3GBNL 3QXAB 1DWGM 4G80A 2EDRA 3EOAB 1I1FB 3DXAA 3N1QC 4R4FL 5HHME 4LP4A 4DZ8B 3C9NB 3PJSA 4GI6A 5F21B 4RDQG 1EVUA 4JO3H 3GEWB 1IGCH 2IWGA 1ADQL 3GMRA 2CPUA 4PRPE 5E5UB 4WTWA 4GAJL 1OGTA 4P57A 5TPWH 1HKLL 1FFOA 3C5ZA 3KDMB 1KUMA 2P43B 3QUYC 4D94A 1JPSH 1E3ZA 5E8DH 1X44A 2BRRH 4JFEB 1FNAA 1WIUA 3G6JB 4ACZB 1G94A 4M43H 1INDL 5FO9B 2DQTL 4D9QE 2FGWH 4LSTL 2JCCF 3CUHA 3MMUA 4TXEA 4GMTH 3OJ2C 3MRNA 1NFDA 4Y5XC 2NSXA 2UZIL 1GHFH 1T7VA 4LQ1A 3DUUA 4NCC2 1SVZA 3LPFA 5DHXB 2YZ1A 4M7JH 5A69A 1SBSH 3FTGB 1E4XI 4MMXC 4JJ5B 5LQBL 4ZG1A 1L9NA 3T04D 2XG4A 5INDB 3E6HA 4AWEA 4P7NA 3KWXA 3PDOB 4HZLB 3TO4B 2O93L 4YHLH 3BPCA 3DUSB 3IVKB 4HUNB 2P1YA 3UG3A 3V0AC 2VX4A 1X3DA 3IU4L 5FYKU 3S3JA 2Y36L 1HCVA 4XAWL 3ZYZA 1E6QM 1MI5A 4UFJA 4OFDA 3UC0L 1I7UB 4AH2B 1OAUL 2PBOA 1XCQB 5FV2A 4JY6A 4JFXB 4JG0L 4BZ2H 3DGGB 1BOGA 5IJVA 2FBJL 2QJDA 4P46C 4QRSB 3LN9A 1XZ0B 2NMSA 3MV7B 2F74B 4TNVF 3ZHDA 2YPLA 3QHFH 3WFCH 4JVUA 3ECBB 2XTJE 1EDQA 3OJDA 1GONA 1HJVA 4PB0H 5D70H 4JRXA 2OLDA 3GKWH 3TBSB 4JFQB 1VRXA 5HGBA 1YJDL 3KLDA 3I6GA 2BNQE 3D9AH 4N0YH 2DQEL 5KOVC 5BVPH 4NBZB 5CHNA 3D2UD 5BJTB 2HTKC 4E2OA 1UZ8A 2ADIB 3WIHH 3WFHA 3VU2A 3X11A 2Q3AA 4ZTOH 5F1SA 3L4TA 4L8BA 2QKIB 1AP2A 2XKUA 4RX4A 1EO5A 1GGIL 2IAMB 3QNYA 1DUZA 4G7VH 4I77L 4J6RH 2OTUB 1TJIL 1U93B 2AEIT 5D6CB 4A2MA 3WIIH 3CZFA 4WEUD 4X4XB 2VXSH 1OPGL 1DWHM 2OLHA 2W9DL 1AQMA 2V5CA 3BAWA 1QFWL 3FO0H 4W7WA 2YK1H 4GKOA 4L4VA 3VFVA 1NARA 1MH5A 2PXYD 2VR5A 2F5AL 1I3GL 1S3KH 2ZP0T 3SJVD 1YPZF 5JMOC 1MIML 3MLWH 3VH8A 4F8XA 1UKPA 1ED7A 2EXOA 4HMEA 4HUVA 3ARDD 1OT2A 2QV2A 2FDBP 4AZBA 4U1JA 4NWUH 5JIIA 4JFYB 3RL1A 3MQIA 1ISVA 4PMQA 5DQDL 5JORA 4P2OB 2DTML 4XI5D 4RMSA 5GGUB 1VGEH 3QJFB 4FG6C 2FEEL 3TBVB 3LKQA 2G5BB 2P24A 3RWJA 3MRGA 4RAVB 3PWLA 1XF4B 1VACB 3QIBA 4JFDD 3THCA 1NC4A 4A2LA 3P0GB 1Q6CA 1I4FA 4UINH 4OM1H 1AGCA 4JQXC 1X1NA 1Q9WA 1Q0XL 5EUKB 4Z7UB 1C5DB 4EOWH 4XP9H 2WUBH 3OGCA 1P1ZA 1MFBH 1HK6A 1IAOB 3D25A 5A16A 1BPVA 2I07B 4GI9A 2D9QB 5EORH 4QY8B 1NDMA 1EA9C 1XGTB 3UYOD 2FGZA 1JN6B 4PJBF 3EMZA 3H9YA 2MCPL 4UQDA 1DWJM 4G42A 5BRZE 4ZNEA 4QRPD 1H3PH 1JYVA 3RWEA 1XC6A 2UY7A 3APGA 3DMMA 3PWVA 4FQ2H 4NFCA 4OZIF 1ZL1A 2VABB 3AXHA 4NJAH 4ZQKA 1U2HA 4ERSH 3RWGA 2X1WL 3WHE0 3IYLW 1FVEA 1SBBA 3VI4E 12E8H 5H35A 4TTGA 2AOSA 1HVQA 3CFBA 3CXHK 1E40A 5F9JB 1B3XA 3RGVA 43C9A 4YZFE 3MZGB 2CEQA 3DI2B 4ODHL 4ODBD 3QYCA 4LOUC 3PWUB 4NCC1 1RZ8A 4HFUL 2FECL 4PJCE 3K2UL 1IGJB 2NY0D 2DLEA 5CSYA 5BXFB 1A22B 2ARJQ 4OCRH 4KI5F 3DVGB 4L29A 3GJFK 1V08A 5DRZB 2PWGA 1DBAH 1QNOA 2VX7A 5IBTL 3IKCB 3F62A 3SEPA 1CVRA 4PG2A 2CPCA 1UD2A 4PRDA 4PJ7A 3SCMD 5C0FA 3TOPA 1V6XA 1F4XH 4MJIA 4XVSH 5D93B 2WMPA 4UZSA 1PVHA 1DN0B 4LLUB 2BNJA 1UD3A 3HAEA 5JTWA 1HSBB 2I9LB 3CFCL 1XMWA 2VO5A 3KPMB 5JHDE 5DD6B 4M80A 1CD0A 4CMHB 1BVNP 4OGYL 1YYMH 4GH7B 4F7TB 1EEZB 5FA3A 3KS0J 1A7BA 4IRSB 4G8GB 4LEXH 1EDGA 5HSFA 1CECA 1KFAL 1XYFA 1OGAD 4M6NL 3SDAC 1IV8A 1AGFA 2DJSA 4HULB 5I1GL 2VDOL 3NCYS 4UV4H 3LCYA 4ZAKD 4R6UA 3MRQA 2FO1A 2EIDA 3G6DH 4U3CA 5J6GB 1WZLA 4U1HA 2FLBT 4Z95H 4JFHD 1OWQA 1KEGH 2J7GA 3ZE1F 5CEZE 5EOQH 1QO3B 2G4FA 1UR2A 2A0LD 2QSCL 1H5BA 2WBGA 4HJGB 3VGHA 1BQSA 2R0WL 1KR0A 3VRIB 3NVQA 3ULUD 4JFOA 1W1PA 1WZ1H 4L4TD 2GYSA 3VFPB 3OLIA 5J1TC 4J3VA 3MPCA 1Y7VA 1CS6A 3AXXA 1QLFB 3SKOB 5KEZA 1IQWL 1UXWB 4EN3C 4L8CB 3U4BL 5EZJA 2EDQA 4Q2ZA 5JIPA 4EI5A 4AD3A 3S96A 5HPOA 1N6UA 3LQZA 3QUYB 3BYYA 1LILA 2C8NA 2PUQT 2YL5A 3AIWA 3QQ3B 4NO5A 3NCJH 5IEHB 4XNMA 1VBUA 2F54D 2DWEB 1I8IB 3O9WB 3S37X 4WNQB 5ADOL 3L5XH 4M7KL 4OM0H 5SX5H 4PJAB 5IUSA 1L0XA 4A3HA 2WCSA 2WZEA 1MFAL 4GOSA 2ED7A 1WCBA 2HJLA 3CH1A 5FYLH 4BSVA 1WNOA 3IKKA 1GYAA 1QYGH 3IS0X 5JXAH 5KSBA 1FJ1B 5DT5A 1MAMH 2VLRA 3QIUD 4W4OA 4PJIF 4LSSH 5D7IE 1Q72L 5CCKL 5C0CB 3UO1L 2FO4B 1ISYA 3LKRB 2FL5A 3RVWD 5E95B 5IQ9B 1LL4A 5CJXA 3L3GB 3PHQB 3O6KL 4FTVD 1FV1B 1CLOH 1QBML 3LMJH 4IIQB 1AI1L 2YEZB 2R56L 3PWPE 4IRJB 4UIKL 4ALAH 2EDTA 1UKOA 1Q0YH 2NXYB 4HZ7A 4H0GA 4IMKC 3BRDA 2ZOKA 3QNXB 3BDYH 1A0QH 1RK1A 4GG8A 1MVUB 5INCA 5JUEL 2J7EA 4FOMA 5D1ZB 2J4GA 2DDXA 5FKPA 2O9PA 3TP4A 1RIHH 1IAIL 1ZLSL 4MA1C 2EH7L 3FW6A 5DK2A 5IHRA 3PHOB 4RMWA 5JO5A 3CK0L 5D8JH 4OCWH 1JVKA 1V5JA 2AQ1A 3AU1A 2APXA 3DRQB 3HG1B 4ONHA 4QT5A 4OLZH 2R69H 3WKNA 5A8PA 3O6ML 5B8CA 1UR0A 3QWOB 2F61A 4ELKA 3S4SG 2WINA 1QRNB 1EV2E 2AKRB 1NGQH 1XH3A 3QXAA 4MXVE 3GMPA 4PLNC 4XCNB 4BJLA 1QW9A 3EMQA 5I73C 1R5IB 2J62A 3T2NH 1NCBH 5DFWH 4Z76B 1UD6A 2YKLH 3C9NA 4OIIL 1UD8A 4BSJA 4DW2L 4X6BA 4NO3B 3T0EC 4YN5A 3OJVC 4FQLH 3HI1B 3EW3B 3RJYA 5J7CC 3KYKL 2B7DT 3S88L 4YR6A 4MAYB 3S36L 2BSTB 4PY8J 2Q8BH 1KJ2A 4JFEA 3G6JA 1G7JA 4AY1A 3QI9B 1CR9L 5DVMA 3MBEC 2QHRL 3CZEA 1NL0L 4M1DL 2HT2D 1WIPA 3FFCE 4ZOAA 2YOCA 4GBXD 4X99B 4B5EA 3UP1A 1RJCA 2DQFB 1ZA6A 4PYGA 1J0JA 5C9JB 1L0PA 4URIA 4JJ5A 1O7SA 4MQXD 5AWNL 2KPNA 1D5XB 3VGAB 4HUWB 3LQAH 4L4TE 5DJYB 1JPFA 2KZWA 2G3NA 3DUSA 1MFCL 4CW1A 3GI8H 3IVKA 2DSUA 3AGVA 1MREH 1HDMA 3NCOA 2FB4H 4YNYA 2EXYD 1P7QD 1YEKH 4PGEA 4J4PD 2OYKA 2ZE0A 4C56B 3BPNB 1I7UA 1F97A 3ZJ8A 5EU6A 3F6IA 5HPCA 4HPYL 5IEKB 1NDGB 1TENA 5L88H 3TNNB 3K0WA 4M1CD 4QRSA 2P48B 3BISA 5J9PB 2V3DA 1H3XA 2CKSA 3SQBA 1V3IA 1RAMA 3U83A 5ILTL 3UG4A 2E4TA 4KVNH 4JKMA 3QUMH 5CS7A 1G7LB 2IPKB 4K55A 1ISXA 1NGXA 1KQYA 1DBBH 1LGVA 1MCFA 1KR1A 1CGSH 4I9WD 3JWNC 2YSSA 4NO2B 4JFQA 4P3CH 4P2YA 3HLAA 1QG3A 1OSPL 3MNVB 3WHXB 3UTSE 4GRLD 3OKKA 5JQ6L 3EJYD 4ZE5A 1GOQA 4JIEA 2J7DA 4MB3A 5M95B 5E2UH 3ARFD 4LKXB 5ECJE 2CRIA 2QKIA 3SHSA 3SDXF 3L5HA 3I75B 2J8UA 5M03A 5AEAA 3PF2A 2EZ0C 2OTUA 1U93A 5CILH 4W6YB 1ETZA 4XZUB 4R0LB 3P4OA 1LDPH 1B3YA 1FORL 3PNWA 1IJ9A 1I8LC 2XWJB 5IB3B 2ZX6A 3N1FC 1QPPA 4P23D 1MJ7L 5MEOA 2D22A 2VUYA 3MV9D 3VVGA 1MCLA 1TVPA 2A6KB 4MNGB 5F70A 4JLRB 5HHNB 1K5NA 3VWKC 4QDMA 4JFYA 1SYVB 3OV6A 2W0FA 3ZKQD 2VH5L 5CIPA 3QUMB 4OTXL 1DBKL 3ARGC 1KGUA 4ODVL 5D5MA 3QJFA 2J4WL 3LHPH 3G6LA 2NY5C 4PJFB 3L3OB 1UOKA 1Z9MA 1MCPL 3SKNB 2G41A 1CXKA 3UBXB 1HJQA 1X5GA 2IPUG 2VRKA 1XIWC 5K9QI 5EUKA 3HZKA 4N8CL 2QLVB 4AEIL 3QPQD 3EOTL 4HC1H 4M5YH 4XXCA 2VDML 1C5DA 4ISVB 3VCLB 1TJHL 3FQWB 1J8KA 1U33A 4AD0A 1RPQA 1IAOA 5D7SL 5LGJB 1YNKL 4FQXC 1JF1B 2V38A 2I07A 2HKFH 2M26A 4OIFA 3LZFL 3IK2A 1B6UA 4KUZH 5CP3H 2A77L 1EFXD 2VERN 1JNDA 5D7JD 2AQ3A 5IMMA 3QDJB 3BH8A 3O81A 4JPKH 4OUEA 2XGBA 1M01A 3IJ7A 4X7SH 2EQDA 4FZ8H 4BA8A 4NQCB 5GS0L 2VABA 1IEAA 3ARWA 1PFCA 4WENB 1C8PA 4H41A 3T3PE 2H2PD 1WO2A 5FOBB 1A7OH 4H25A 3V5DB 4QHNA 3S9DB 2JCCB 5C0RH 4GUPA 4RCAA 3F7VB 4H04A 4OZHF 3VINA 1BIIB 1F6FB 3PWUA 2JIWA 1P5VA 4AZHA 4NQVB 3OKOB 4YFLI 1PZ2A 1Y6MR 4NO0B 1JHKH 4WK9A 4NJ9L 1CFVL 3DVGA 3PP4H 1CN4A 4FFWC 5DXWA 4NBYB 2J2ZA 4MJ2A 4AK1A 2ZUXA 4P4RA 5F7KC 4BUHA 4H8WC 3MO1A 1ZEAH 1BVKB 1S78D 4NKIH 2PNDA 1CK0L 4JHZA 5J89A 4WLCA 3VX1A 1BZ7B 4WY7H 3VXTA 5CBEA 2Z35A 2OSXA 2CIIB 1ERNA 4MXWH 4S2SB 1CD9B 1K4CA 1ZS8B 3OAUL 3BPOB 4WCYL 5F7MC 5GS1C 1BYAA 4M93C 1FP8A 4FFVC 3WNMA 1QBLH 3KWWA 4YHIB 4HJJL 1WBYA 3FQTB 3WDPP 3TFKD 1XF2B 4HPHA 2V5MA 4F7TA 3O2DL 1EEZA 2R2CA 5D1QD 3VFTB 3B83A 4KROC 1K8DA 4PJGF 4PRHE 4RFNC 4XP5L 4MXQC 4HT1H 3RUGF 1HSAB 5CSGA 5SWQA 3TBYB 4ZO8A 4ETQA 1UR1A 4W86A 1W72H 2AQ2A 5C86A 4L4PA 2BOBB 4LGPB 4S3KA 3EO1B 4PP1D 3WJLC 3GMOB 1BBJB 3G08B 3DO7A 1CICA 2DBJA 2ZPKL 1JZ5A 1UA3A 3T8XB 1AIFB 3WN5B 1A8JH 3WNOA 4RRPA 3C2AH 1OAQH 4LCIL 2VE6B 1G9NH 1JGLH 4AENA 5ETUB 3CVIH 2X4SB 3VRIA 3AIEA 2B1AL 2R0LL 2EXWC 4PRID 4CVZB 5I73B 3MJ9L 1A6UL 3CPLA 4TSBH 3SKOA 5L2KB 1XRVA 2X8RA 3MRLB 4EDWL 3B2UD 3PGDB 1YPZB 4NRRA 5BROA 5IGXL 4P8WA 1KELL 1AXSA 1YN7B 5GRYA 3T0EB 1US2A 2H1PL 1A3LH 2R0KH 3DV4A 4K3GA 3SCRA 4P9HL 1EQPA 1MF2L 2NQCA 3QUYA 1GXEA 2GITB 2H6PB 2NY1D 4AM0B 4MJ6B 2XZZA 4PJ9D 3CFDA 2EDXA 4JZJC 3MBEB 1SR0A 4R5EA 3C09B 1IT9L 3P30L 2WB5A 1VFMA 4YO0B 2DWEA 4Y5XA 5FHAH 2CHNA 3WSQH 1W72B 4OF3A 5HDBF 2BSRB 4H8VA 5F7DB 4AYFA 4PJEF 1ZHBB 3WMBA 1S7UA 1G5AA 4IPLA 2ORBL 3ES6A 3V5KB 3AZRA 3FO9A 3TEUA 5SWZB 3O4LB 5F89B 5KANI 3NIGE 3BSZL 1MJ8H 4B3LA 5CINL 4PGCA 2PF6A 1YJDC 3X14B 1AR2A 2J25A 1N5AA 4LPCA 1R5VB 2AK1H 2ZCHL 4KAQL 4YHOL 1YUHB 3L7EB 1JPGA 5KSAB 1OBAA 4P46A 4H8HA 4FMKA 2DIEA 4HKXB 2YD4A 5HHXL 4Q97A 2CESA 3ARSA 4JANA 1SY6A 2YEZA 4Q9RH 1XEDA 5DUBA 3AZSA 1AHWC 3QP3A 4IBLT 2VIRB 2W91A 5A3IC 5CUSL 1OD0A 5F9WB 1JNLH 1HHJB 2GJJA 4MNKA 3IAPA 3OR6B 1BOYA 4OZIB 3TF7C 1BBDH 5HTSA 1RPKA 2B5IC 4GKSB 4PSRA 1GHSA 2EO1A 1ZTXL 3ALFA 3AB0C 2FX9L 3NH7L 4PJ5E 3QH3A 3MXVH 3S4SB 3T0XA 3HZYB 3R0NA 4QXUH 4JQIH 4OF6A 4OV6F 5E6ZA 1IGFH 2E6QA 3BXNB 4Y1AA 2VDPH 2A3BA 3HG1A 1PKQA 1NJ9B 4U6XA 1WZKA 2AEWA 4WU5A 5EIIA 5I6XC 2CIPA 5E8OA 5C0JB 4X9FA 5IBLD 1HH9B 1DN2A 3V4PH 3AZTA 2AAVA 1GAFH 3ZKND 4JGMA 3QEQB 4XCNA 2OR7A 4RSVA 4U6VL 3B4NA 5GS2D 1IGTB 4AT6B 4Y4HC 3AOFA 4O2FB 2DIJA 1QKZH 1H3UA 4HDIB 4ZPTA 1N26A 2H9GB 2GFBA 4H26A 3IDNA 3JWDL 3HI1A 1IAMA 3UJIL 2J8HA 5ISZE 1D5BA 1SEBB 5C0AE 3VWKB 1R7AA 1P4LA 4LP5A 1M7IA 1KCUH 4Y5YB 1YYLL 5KZCD 4Q6IB 2PYEE 3R8QA 4QHKI 4H20H 4JHOA 3RKDC 3A0OA 5DQ9B 4LSRL 3PZGA 1OB0A 1XSIA 3MRMB 5E5MB 4X99A 1EBAA 3UCRA 5CSUA 2DQDL 4G6AC 4ACPA 4OB5H 5GHWH 2VZUA 4W68A 3OKMA 4ZXBC 4Q9QL 3U9UB 3RZWA 5BXSA 2QHLA 1OWWA 5A2FA 1D5XA 1V8HA 1ZB5A 4HUWA 4GRMA 1Y18A 2R29L 4JQXA 2P5EE 1CG9A 5DJYA 2OSYA 4HS6B 3I50L 2Z91B 4UIMA 5FAAA 5GRJH 4TX6A 1UQZA 4D6HA 3BUYA 1LO3H 2VURA 4QWWD 2ZIDA 1KXTB 2OK0H 3ILPA 1OARH 5IEKA 3VFGL 3QUKA 1QNZH 1HXJA 4WUUB 4NKDB 1T22B 1X5JA 3LN5A 3RGHA 5J9PA 4NQEB 1PYWA 2DN7A 3OKNB 1ND0B 1FIGH 3OXRB 1G9ML 1MRCL 2VDKL 1O5DT 1G7LA 3H7BB 5GGTA 2V2XB 3QDGA 4NO2A 1RURL 3HAEH 1NKRA 2I25N 2ATKB 4ZFOL 5F3BB 2CETA 3WHXA 3QXTA 3QCVL 2PWHA 1TTFA 1DP0A 1GOFA 4JHAL 4OUOA 4LXFA 4PJHF 4N9GB 5E7BA 4RA3A 4KY1L 4OUUB 1RJZA 2DQJH 4LKXA 1R3JB 1RJYB 4EUPG 4HA3A 2J47A 3ECQA 4GG6E 5EO0B 2XUCA 5GGSA 4Z7QE 3ZDZF 3RVXD 4LF3A 4A6YB 1EBPA 4ZUUB 3DECA 4FLQA 4ZO9A 5F7LB 4MNMA 2UZIH 3VG9C 3F5WB 4PJIB 3QRGL 3PZMA 2B4CH 4WKHA 1HL8A 2PTTB 5D2LA 4ZFFA 4ZS6D 2Q1EA 3RBSA 3MS8A 4YBQC 1LO2L 5DSCA 1IC5H 5GS1B 5HY9A 4M93B 5HYJA 4JDVA 3LRSA 1KN4H 5EU3A 5EWIH 4Z77A 3CNKA 3IU4H 5FHBH 4J27A 4FQHB 1M71A 1SYVA 4X8XA 4UT6L 5BS0D 5TE7H 2OYMA 2AJ3A 3MRRB 4CKQA 2CLVB 4NKMA 2MPAL 4TYUA 1TA3A 1S9XB 1A1OA 1I7ZA 3OF6D 4HS3B 3SDAA 4LVNC 2FBJH 2XZCH 1YNLH 2J88L 3BVNB 1KXQA 2YUZA 3U7YL 3AS0A 4IEFB 3SKNA 3VFRB 1RZJH 3TIEA 4OD2A 5IG7B 4OZGA 5D7LD 3P0YL 1LEIA 4S1DD 4DKEL 1QFPA 3NFNB 3PQYB 4KHTL 3GSQA 3QOKA 5HOSA 3TNMB 4LQFL 1HIZA 3PXHA 3GB7A 4GW4A 5BZDB 1OIMA 4W85A 3TZVD 1FNEA 1U8KB 2AV7B 1M53A 3VW3L 5LGJA 1JF1A 3FB5A 4RFEB 4UT9H 4TVSa 5C3LD 4TTDD 5C07E 1OLZA 3QXUA 2QMJA 1XR9A 1NANI 4EN3A 5ACLA 3ARBD 5D1XC 4CU7A 1TJIH 2V9TA 2A9NL 1KENH 4WO4D 4K3EH 4NQCA 4YE4L 3C60D 1NOWA 3INUL 2I26N 3PZ9A 1NWTA 4PS4H 1OM3L 3TWCH 4EQ2A 2P8LA 1ODZA 2WAHA 2K7QA 4ZPVB 4LLMA 5IJKC 1CT8B 2GJZA 3LEVL 1QSFB 4UDUB 3P9LB 1IBGH 1BIIA 1KIQA 3ZKXC 2WIIB 1J1OL 3BAIA 1WK0A 4NQVA 3KXFB 3BH4A 1H8OA 1KCRL 1F4WL 3RM9A 2GJ6E 1TETH 3JSSA 4ESKA 3QXWA 1LEKA 2BFVL 1LE5B 2AXGB 2AJVL 3MRBB 4G9FE 4QCIA 5FB8B 1E6PA 4MS8C 5BMFL 4Q7NA 4HIEB 4EI6A 3D0LB 3V7AG 2ZXDA 1B4JL 1BZ7A 3SBWC 1MCHA 4LKCA 5CZXD 2OI9C 2CIIA 4P8XA 5I1LB 1DBJH 3KPNA 4X4YB 3T0DA 4P8UA 5I18H 4ZSOE 3ULUL 4YHIA 1FZOA 5I8KL 5T33L 4PR5B 1T1XA 1UD4A 1B0RA 5J4MA 3NJ3A 3K1KC 3FO1B 4NQUA 2ZUUA 3OKDA 3ZT6A 4NWTL 4JY4A 3RDTD 4OV5A 1Q6GA 1S7WB 5A6AA 3HNSH 3QR2A 1EJOL 2GK1B 4IMKA 1O7AA 3VA2C 3QNZB 4JFPA 3UROR 2MHAA 4HIIB 4YHMH 1T04B 3EYUL 1B1YA 4K3DH 4Y4KD 4RWYL 4LEOB 4WGWB 5FEBA 3CIVA 4UNTA 2Y7QA 1KJ2H 1PDKA 5DA4A 2V2WB 2ZUVA 4XPBL 1H2JA 4ZS7H 4E4PA 4MQTB 3BMVA 3V95A 2W62A 4N8VA 1GIGL 3LEYL 3O45B 2CLZB 3NPZB 4TVPE 3SDXB 3LV3B 2GCYA 3T8XA 4AEEA 1RIVH 3ZTNH 2O9TA 5I6XB 4Y16C 1TNMA 5E24E 2VE6A 2OZ4L 1NP2A 2YRPA 5IB2B 3D85D 4ODHH 4AD1A 3HA0A 3QFDB 4CVZA 1KB5L 2CDEB 5JOFA 3RU8L 1X5AA 4NZCA 4MX7A 2WSKA 3STLA 5TQ2H 1RFDH 3NPSC 3KE0A 1KTLB 4B9ZA 1DQDL 2VZ1A 2DT3A 4KPHL 1P2CB 1PZUB 5F1OB 1YN7A 2E7LC 4WI3A 3T0EA 3IJHA 1DTUA 1GPOH 1RVFL 2PO6C 1K3IA 3HC3H 1GL4B 4U1MA 2VLKA 5IW3A 2WUCH 3T4YA 4EVNB 4D6DA 6TAAA 4I18C 5BV7L 5ECUA 5IVZB 2HT4C 3HS0A 3MCKA 1WBZB 2FX8H 1NCUA 5E0CA 1OP5K 1K8IB 3MBEA 2RGMA 4NM8H 2A9ML 4LCCC 4R2GB 4Y88A 4UQEA 1I3RA 1K2DB 3QG6A 3RP1A 5CGYC 1C8QA 5E7FA 2HG5B 1IGML 1HKIA 5T3ZD 5FFLA 1V7NL 4MHHG 1CL7I 2NZIA 1GSMA 2GJXB 3BN9C 2VWEC 4XUYA 3S37L 5SWSD 3BKML 4ACYA 3QEGH 4DN3H 2PKDA 3O4LA 1KFAH 3U6RA 3TT3H 3ULVD 4TUOB 2FJHB 2JLLA 5DD3H 1M4KA 5DLML 3VI3F 3RM4A 2EE3A 1O6IA 5MP6H 3L9RA 4X6DE 1KG0A 3FN3A 3MACH 3RZCC 2YD9A 4YQXL 2WWKT 2E9WA 3D48R 4MVBD 4HLZG 4L5FH 1VKXB 3PGFH 4XBPA 4LCWA 4XWGL 5HGHA 1VF8A 3MSGA 2ICEB 3KYOB 4HKXA 5DJ2B 2V17H 4K7FB 2ZG3A 3U4EB 3GSNL 4GQQA 2R0WH 1FNSH 3O6AA 3A6CH 4UZUA 1N3NB 3OR6A 4W5ZA 3VM7A 1UWSA 5E4IA 2HFGH 3BT2H 1AGBA 1CDUA 1CXFA 3DSNA 3CZJA 4GKSA 4ELMA 4B16A 1TLKA 2OL3L 5GSRA 2RGLA 3NCMA 1MHPH 3U4BH 4K7PY 1EHAA 3LY6A 2AV1A 2XKNA 2A3AA 3I2CL 2XT1B 2G9HB 1T4KA 2NY2D 4Z7VF 3T0VA 3GTNA 4B7LA 4OZHB 2H41A 1W2VA 4AL8L 1HNYA 1JRHI 3BXNA 1MCEA 5IF0B 1NJ9A 4XVJH 1NFKA 4PMZA 1X4YA 1UWGH 3UX9B 4DKDC 2F8QA 2VDQH 5MHSD 1HH9A 4YBLB 1GC1H 5GPRA 1B0IA 1I8LA 3OR7A 3QDMB 2XSBA 5D71H 3GSXB 3QEQA 5KVDH 3V6ZB 1YEGL 3M45A 1MAJA 3RWHA 4PMOA 2R39A 3LKNB 4Y4FD 3UZEA 1BQLH 3HE6B 5CAYB 3ISWA 3HU7A 4O2FA 1A7QL 4MAUL 4I3RH 5HI3C 1NUNB 1WPCA 4WJXA 3QFJE 4EUPH 4G8IB 5ICXB 3VWKA 1JHTB 4ODTL 3V6OE 1R5WB 4LVHC 5JDJA 2GUOB 1E0VA 5AC4A 3FN0H 1Q72H 3WMSA 4A3YA 5FV1L 1U92A 2YD5A 4PJGB 3ARGA 2XZQL 1C7TA 2IQAB 2NR6C 1HNGA 5I15L 3O6KH 3RUGB 4MNHB 1DVFC 5I17B 3ZMRA 4PJDE 1QBMH 1UADC 2YRLA 3MRMA 1L4IA 2UYLB 2AW2A 1CXHA 4OOZA 2P4AB 5IVXE 4WI2A 1I8KA 1G6RL 4U33A 5TDNA 5I75C 1B3VA 2ICWB 4HWNA 4XTRD 3THDA 1XIWA 5L7XH 1ZAGA 4OFYD 3B2VL 3UJJH 1K9FA 4GLRH 4HS6A 4N0FB 4NHUB 4QHLA 2UY5A 4D0CB 1REIA 1T89A 1BFTA 4FQXA 1C93A 4F9LC 4JDTL 3UJTH 1V6WA 3FOLA 2ZSWA 4GAYB 4U6HB 5T5FH 2YDQA 4WUUA 3DHUA 1T22A 2BCKA 3O8XC 4U3AA 4LHUD 1MCOH 2NNAA 1MW3A 3SDCD 1UKQA 1ND0A 5GGSY 2IH3B 1VFFA 2QQLL 5I66B 5HI4D 3GJFA 4IPNB 1NLBH 3PXJA 4EUPB 4KDVA 1BWMA 5TF1L 1IM3A 3WL1A 4Y5VC 3BQUB 4XWOC 5AUMB 2XG9A 4DGIH 2ATKA 5F3BA 4X6CA 2D31A 5SWSE 3I3DA 5IFJB 3FFDB 4PG9B 1PEZA 2FWOB 3BP7A 3C8HA 3KPRA 4DW2H 3ULVE 4OUUA 3D0VA 2E9BA 5J6HB 3S88H 3WJJC 4JFEE 3S36H 3VGEA 1RP8A 4AZIA 4PJEB 4X6FA 5DJZA 2WZPD 1Y6NR 1CR9H 1QW8A 1FH5H 3ZZ1A 1U42A 3ZDYE 4MGXA 3EJZD 4OIBA 3DBXA 4WW2F 5L9DL 4A6YA 3DETC 4YC2C 1J5OL 1HJSA 1KWGA 1A2YA 2IGFL 5A40E 5GRUL 4PJIA 2SEBA 1V0NA 1S7QA 1CD1B 1D9KD 2PTTA 4OCNC 1JCKA 3GM8A 5AWNH 3SKJL 1LWJA 1W1TA 4PRAB 4H88L 2NY4C 3BO8B 5GS1A 4M82A 1H3TA 5B4MD 3MV8A 4NN7B 5C08D 4DUVA 1E4NA 1OTTC 4BS0A 4YGVA 1ZHNA 2XTJC 5D4QA 3EOBB 4G6KL 5D4YA 4RGMC 5K9OB 2VNCA 3QJHA 4KRMB 4JZOB 5HHQB 4RMQA 1FDLL 3H9ZA 2I60L 4ORGA 1KV3A 1R3IL 3RVTC 3MV7E 1XT5A 3BVNA 3QGVA 1T3FB 1QI4A 1ONQB 1NSNL 4Z2LA 5A6SA 4U1NB 3MROA 1JFQH 2VDRL 4E41B 1YEFL 4QTHA 3LS4L 3WJLA 3G5YB 5I3DA 3FQXB 4OD3L 3EUUA 4QNPF 2XWBB 3IANA 4M8UA 1U41A 5JA9A 3NFNA 2FEDC 1PBYA 7A3HA 4NNXB 3QUXC 1A4KB 1Z5LA 3T08A 5BZDA 4Y16B 2VX6A 4A4AA 2CO7B 4OLUH 1U8KA 1G7IB 4DZBB 4V1DA 2AV7A 5AG8A 5IHUL 1W9PA 5DRNA 4APQC 4MB1A 5IKCB 1JWSB 4P2QB 4PGDB 3DI3B 3VXSB 3UTTD 4KRPB 1ZLWK 5KW9H 2W07A 4CRPA 1UA6L 1JPTH 2XI9A 5GRXG 2DBLL 4TQEH 1R0AL 2W60A 1S9WA 2DYPD 4YHYC 5EIQA 4NQDB 4XNXH 3WDHA 1DFBL 4FS0A 5ENWB 4XPFL 4U6YA 5I1KL 3VIPA 4RGND 4LL9A 1ZT4B 2EKJA 1KGCE 5AYUH 3RPMA 2YWZA 1CLZH 2AP2A 1UR8A 4JZJA 3HR5A 2XOTA 43CAA 2PWEA 4W8LA 3F12A 1CFNA 1SY6H 1A7NL 1OOAA 1LEGB 3ULUF 1K4DB 5JOPE 3HRZB 1JGDB 4JPWH 3TPKA 3UZQA 1MUJA 1OTSC 4UQ3A 3EYFB 1AGEB 4S0TD 3HCVB 4WV1C 1HQ4B 1XFPA 4EXKA 3EDKA 2J4WH 2ZG1A 3VO0A 2CUMA 1LE5A 2HLFC 3MRBA 2JE8A 3THMH 2IH1B 4HIEA 3EJJX 2N1KA 3N9GL 1UACL 3D0LA 2BVYA 4XPTH 4UNVA 3UYRH 2EEBA 1C16B 2ZICA 2BSED 3ILQD 3JTTB 3ALGA 5I1LA 4HS8H 3QQ4A 1WTGT 2X4UA 5A2JH 4X4YA 5KG9A 4Z7UE 1S46A 5HHOA 3WXVL 5EO9A 4WW1B 5DURB 2DKUA 1RSFA 1V05A 1AHWA 3WFDL 1IL1B 3W0WB 1P7HL 3QQNA 3C6SB 3FO1A 3QQ9C 4LLAA 5I79A 5IB1A 2HFFA 5D7SH 3N1AA 2G2RA 4TUJB 1RV6X 4H1LG 2GK1A 3NA9L 5T1DH 4XMPH 2TAAA 3LZFH 3BN3B 5IHBA 4WI5A 4U7SA 1O0VA 4HIIA 3VA6A 3HMCA 3NFSH 4G8EA 3AHXA 5E00B 2Z1KA 5K9JL 2F8XC 5EFIB 1J1XH 4W6XB 2XXMB 4DFHA 4RE2A 4HLZH 2V2WA 4P2RA 3TA3C 4B41A 4ODWB 3HZMB 5GGVY 4WKFA 3RWDB 3GMQA 1HWGB 1BGGA 3EFDL 1NFIA 1CGTA 2ZCKH 4MAVA 3LV3A 1EAPA 4HGWB 4M6OL 2WLYA 4C4KO 4UFLA 2XNAA 3P4MA 5FCZA 4HOXA 3TYGL 4O58L 1D2KA 5C08E 3HB3D 5ESAA 4OOUA 4JG1L 3QFDA 4KUCD 2CDEA 1U8HA 3D3VD 4JPIB 3G9AB 2JTDA 2BNRB 5E08L 3WD5H 4PY7A 4Y4HA 4LCYB 1KTLA 2LV4A 2B2XH 4HP5A 5D9PA 4QHUB 1P2CA 3MA9L 2X6MA 1GCYA 3FB7A 4XHJD 3KLHC 2NYYD 3UPAA 1HOCA 3SDYH 5FK9B 1QA9A 3VXMB 1NAMA 3OHXA 1F8TH 1WBZA 5LWYL 4S3JA 1DE4A 5C0BD 1CF8H 3ET9F 1G7QB 5I2IB 1K2DA 5EZOL 3MBXL 2X7LA 2VZ3A 2BV9A 4F7EA 4OZ4B 5IBUG 2WANA 4KQ4L 4URTB 4HBQA 5T1KB 3TGXA 3B6SB 4HUMB 1F6AA 3PL6C 5GGTH 4MDPA 1N0XH 1JE6A 3ROLB 4OSUL 4G8GE 5FYKD 4NZUL 3ZYOA 1G9MC 1DQMH 1BREA 3UTTE 4TUOA 3ARDC 4MAYD 3WS3A 1VJSA 3U46A 1BAFL 4UBDC 4Y2DB 1ISZA 1WDSA 4PB9L 2DAVA 3DOSA 3OXSA 2AK4B 3L5WB 2FR4A 2J5LC 1OSEA 2YD1A 4M3KB 1VKXA 1UXSA 3OQ3B 1FL3A 1OP3H 3VGBA 2QADD 2ZPKH 4HEME 1EX0A 3RY4A 1WAAF 1AC0A 1U91B 1ZVHA 4KV5F 3U4EA 2R2BA 1PX3A 3TVMC 4OI8A 4DKFH 4MAZA 2DLTA 1AE6L 2NY7L 2AJYL 4MD0B 4PLJD 2JIEA 2WV3A 3SOBL 1SJHB 2XWDA 4GAGL 2A73B 4D9RD 3WQ5A 3OAYK 1CGVA 1DANT 3MJ8A 3M17B 3MRIB 3MLRL 4XPAL 4V28A 1TVHB 3D5OF 1KELH 2A6DA 3MRDB 1F11A 3ARRA 4Z7WF 5I1HH 2G9HA 5FO7A 4MNLA 4OZHA 4I3GA 4UV7H 5JLZA 1JK8B 4K9EL 2BK8A 3U0TA 1RU9L 3VIGA 5E9DB 1IC4L