4NZ4A

Structure of vibrio cholerae chitin de-n-acetylase in complex with 2-(acetylamino)-2-deoxy-a-d-glucopyranose (ndg) and zinc ion
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
403
structure length
403
Chain Sequence
PKGTIYLTFDDGPVNASVEVIKVLNQGGVKATFYFNAWHLDGIGDENEDRALEALKLALDSGHIVGNHSYDHMIHNCVEEFGPTSGADCNATGNHQIHSYQDPVRDAASFEQNLITLEKYLPTIRSYPNYKGYELARLPYTNGWRVTKHFQADGLCATSDNLKPWEPGYVCDPANPSNSVKASIQVQNILANQGYQTHGWDVDWAPENWGIPMPANSLTEAVPFLAYVDKALNSCSPTTIEPINSKTQEFPCGTPLHADKVIVLTHDFLFEDGKRGMGATQNLPKLAEFIRIAKEAGYVFDTMDNYTPRWSVGKTYQAGEYVLYQGVVYKAVISHTAQQDWAPSSTSSLWTNADPATNWTLNVSYEQGDIVNYKGKRYLVSVPHVSQQDWTPDTQNTLFTALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Deacetylase DA1
publication title Structural basis of chitin oligosaccharide deacetylation.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Hydrolase
total genus 147
structure length 403
sequence length 403
chains with identical sequence B
ec nomenclature ec 3.5.1.41: Chitin deacetylase.
pdb deposition date 2013-12-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.90 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4nz4A02
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 4nz4A01
5BU6A 1XW8A 4F9DA 2C79A 4NYUA 2DFAA 3CL7A 4U10A 4NZ1A 1V6TA 2CC0A 4NY2A 4LY4A 3WX7A 1Z7AA 4OUIA 1NY1A 3RXZA 1W1B1 2E67A 2NLYA 3CL8A 4F9JA 4NZ4A 2QV5A 2IW0A 2C71A 4HD5A 3QBUA 3VUSA 4NZ5A 1W17A 4L1GA 2C1IA 4M1BA 4WCJA 2VYOA 3CL6A 2XU2A 4V33A 4NZ3A 2Y8UA 3S6OA 2C1GA 3HFTA 5JMUA 1W1A1 2J13A 2I5IA 4NYYA 2W3ZA
chains in the Genus database with same CATH superfamily
4U2ZA 3U7BA 3WF4A 5EMKA 5LA2A 4TTGA 2VWTA 3LU2A 3W75A 1ZBVA 4WOQA 3GG8A 2ZA2A 3FXGA 3FA3A 1J12A 4LWWA 3E2SA 3HQ1A 3W53A 2CXGA 1UJPA 4L80A 2YA2A 1O94A 4JKMA 1DJQA 1KS0A 4XZ9A 4CVWA 4W5UA 3CLWA 3C5QA 1NOUA 2YL8A 1VPXA 2RJGA 3LGEA 4Q4KA 1BF6A 2GGJA 5BWFA 3ARPA 2WCAA 3MKCA 2YCIX 3UG3A 4QGCA 1G01A 4KGLA 3EA2A 4O28A 4S2BA 4D6DA 3RX3A 4S3EA 3VCCA 3H7UA 3E2RA 4M19A 4J3XA 1X7FA 4HA0A 4JYDA 2XN2A 4JTKA 2FZ8A 3WD2A 3VOHA 3HF3A 1IXQA 4IPIA 4GFIA 1F3EA 1PDYA 1LOSA 2VOMA 4ORMA 2QJGA 3IPWA 5C0QA 1KO0A 3WJSA 4AF0B 2AQVA 4IIBA 2FN2A 1IT7A 3KBSA 1LLWA 3NXFA 3CL6A 1XSKA 1U30A 3PHAA 2DW7A 5AC6A 3VNIA 2D24A 3LBOA 4DB7A 4HTBA 1YXYA 4C6OA 5BRBA 3K4WA 2NXGA 2P5NA 1ZBWA 4XTIA 1E0XA 2DVTA 1JYVA 3CAKA 2FGLA 2HVMA 4AB4A 1YLVA 4IJCA 2ZC8A 3VGEA 3WFZA 2A5HA 2J88A 3MP5A 5H1WA 4R33A 2DH3A 3M0KA 3G18A 3W81A 1S39A 1CXKA 1UH4A 4FF5A 1QHZA 4O54A 2R1NA 1LT7A 1B3YA 1EPXA 1B4EA 2TMDA 3C8NA 3RO8A 1G7VA 1I45A 2E40A 3TYCA 5BWAA 3HGOA 3CH0A 5M1TA 4I9TA 2BXVA 4O13A 2IQTA 3K1GA 4O17A 2ZKMX 3RR1A 3DKLA 5ABTA 3BANA 4MPKA 3O0KA 1NIUA 4OBSA 5KZDA 1N8FA 3ZJ6A 2VD8A 3K8MA 3ZR6A 1M7OA 1PS9A 1WBHA 4AWUA 3MV01 3EEZA 2ZOXA 4PMOA 5I7GA 2R1KA 3RRAA 3S1XA 2HRWA 2FKPA 3KLKA 1XIEA 1QNOA 3S47A 3B04A 1XD1A 3V5FA 1CI1A 2V5DA 3M5ZA 3VNKA 1FRBA 1HL9A 3RXZA 3UGVA 3QSTA 1Q6EA 2ZZ4A 2AQWA 4HHLA 4ICMA 4PFMA 3GTHA 5A1AA 2C1HA 3B0PA 3OHIA 2PGWA 1UP2A 3OOQA 1N55A 2EJ1A 4UR8A 3G3DA 3FJLA 1Q6RA 3S5SA 1HN1A 3BCFA 2ATSA 3WELA 4UQDA 2OYLA 3VKKA 1XDLA 5A6MA 3MZ2A 4L1XA 2DZXA 4ZO6A 3W85A 1EX1A 2A3EA 1ME9A 4BA0A 5LA0A 1HGWA 5DBUA 3A13A 4GE8A 3EWCA 4LNYA 3HV8A 3S1GA 3CC1A 1TG7A 4UOZA 1HJXA 2C7FA 1KW1A 2AKMA 4PL2A 4HCDA 3KS5A 3SJ3A 3SEPA 4GXMA 1QNVA 1QJWA 4OZOA 4GIEA 2Z25A 3T42A 5EMUA 4XUYA 3JRKA 1JUEA 2DFAA 3N2MA 1XRVA 3QOKA 3FKEA 2X7WA 3EDDA 3UWEA 3WIJA 1V8EA 4UNKA 1RP9A 1S1RA 1J18A 3CIXA 2NXHA 3AS0A 1DWGM 3VOIA 3KOFA 5ABGA 3E12A 4DO7A 1EB3A 3NSXA 4B5TA 1K8CA 4J35A 4TQTA 1GOOA 2JF7A 1CXWA 1E4MM 3LSCA 4ERAA 4MADA 1VFTA 2X1SA 2V30A 1RR2A 1AQFA 2QDEA 1KB3A 4ZBCA 3WJZA 5FJUA 2G4JA 1OF6A 4WDXA 1W17A 5KMYA 1CGXA 3VNLA 1EUNA 4OJOA 2XG9A 1H1NA 1W56A 2PF8A 4MKSA 1ZFJA 2WHLA 1MNSA 3MB9A 4NYUA 2V69A 3BURA 1FVPA 3KVKA 4IJEA 6PTDA 4JTGA 1MZHA 2CETA 3U6WA 3HPAA 1U1HA 4L7ZA 1VCVA 3ZVHA 1XIDA 4QM1A 3DGBA 3LHZA 3HFTA 2QJMA 5AYIA 4IISA 3TJ4A 3LA4A 1XGEA 1H11A 4ZO8A 3GTFA 4IFRA 1AH4A 1LWIA 2ZVRA 4C7DA 5DT5A 1M3UA 3W1PA 2E6AA 1WO2A 5AHIA 4MMWA 1UJQA 4Q4SA 2AL2A 4NJGA 4LUJA 3LOTA 3H2EA 4WK9A 3VGBA 4O4VA 5BU6A 1JZ6A 4GZIA 4AEEA 2EGZA 2GZXA 4EPDC 2YBUA 3CPGA 1WBJA 3Q37A 3FA5A 4NZFA 1IEXA 4B9ZA 3PBMA 1EF2A 1KFJA 5A6LA 1V6XA 3MMUA 3TEVA 1XJBA 4M56A 3ITLA 1Q3NA 1U83A 3SUTA 2DDXA 8CGTA 1FKXA 4JR5A 2VCCA 1OX4A 1K1DA 3P80A 1ITQA 4V1XA 3M6DA 3SCOA 4JTEA 1HKIA 1ME7A 5B7YA 1TVLA 2DZUA 3FAXA 5E9XA 4QLKA 3DG6A 2XWDA 4V33A 2FPYA 1S1PA 1M7JA 1XL9A 4LBRA 2A4AA 1TKKA 3EX6A 1S2WA 4ZQRA 3THDA 1GQLA 2ALDA 1J0JA 4M6VA 1IEWA 3GR4A 2QLYA 1OYBA 3ABOA 4RZBA 3NYDA 3P81A 1DWFM 2P50A 1ZCCA 2OQHA 4H3DA 2VJXA 2IOUA 1OC7A 1TWZA 2GGEA 4WXZA 2WSKA 3FOKA 5DX7A 4OECA 4IP4A 1J6OA 3QR1A 1K3UA 4POCA 1GNXA 4BWLC 1M1BA 4Z1BA 4BJHA 4ZTYA 3WEZA 3EOLA 2FIQA 3N25A 4IIGA 5F7UA 4GNVA 3UR2A 3FNDA 3G1YA 3VCRA 5IRPA 1O68A 3DFQA 1O7AA 3RM4A 2BASA 3WBXA 4HNTA 1S2TA 5AC8A 3W7NA 3H2NA 3E6EA 3WENA 4O1EA 3A4WA 4AWSA 4PSRA 3LX9A 3TE9A 2Y5JA 2IXVA 2Z7KA 4JN8A 3DEQA 1TJ2A 1W0MA 1SFSA 2QJJA 5T9CE 4AZBA 4Z2HA 4L9XA 1B9ZA 3ITYA 5C7HA 1DHPA 1NP0A 4A3UA 2B0MA 4CNNA 5D37A 3IS4A 2XFFA 3EB4A 3PS7A 1MEHA 2ISDA 1MW3A 1RA5A 3KZPA 3UU0A 4EVZA 4AZCA 2VRJA 1J6PA 5M17A 5A8MA 3TU9A 2VD9A 4IOTA 4DWSB 1UWIA 1R3WA 3M16A 3BLOA 1OFBA 1JNDA 4W8BA 1ZNNA 3I65A 4A3YA 4HVXA 1A47A 4AX7A 3LI1A 4DYKA 4W4QA 3BOLA 3WUFA 3H23A 3A3WA 3ZIZA 3LPOA 4ZXLA 3BK0A 2INEA 3S1WA 4ECLA 2A7NA 1OCJA 2IPGA 3IANA 5GNZA 4O15A 4G56A 2RDXA 3UWUA 3FV9A 4A21A 1HKKA 2VL4A 4X3ZA 4OUIA 4QSHA 4JNMA 2W9MA 3SCTA 2J66A 4J3UA 1LRTA 1GYNA 1J10A 4GYKA 3GM8A 1I1WA 2PI6A 1HF6A 3VFLA 4UTKA 3NO1A 1Z8AA 1RXOB 3EB3A 1I1XA 3JVAA 1PKMA 2GJLA 4MFEA 2I16A 4HB7A 1OFQA 3RR4A 2GLKA 3B8VA 5HULA 4Z2KA 4RV8A 4W5ZA 3WDJA 1W9UA 3UFYA 3WLQA 3TTQA 1TWWA 1WQ5A 5C8BB 4CNUA 3SURA 1CX9A 1ZAJA 4H9ZA 4GGHA 4ACZB 2XWEA 2IMRA 4V2XA 3FDGA 1LJYA 4FHAA 2PWUA 1NFBA 1UP0A 3M5VA 3LTYA 5C9WA 1VFMA 4FPSA 4H8NA 4HSNA 4O4WA 3QGKC 1UMLA 3TYUA 3ZR4A 2BY1A 3PANA 3DZ1A 4J3ZA 1S3TC 5M3WA 4XKYA 5JIPA 3LBCA 1DP0A 1L2UA 4MUZA 5JBEA 2PTDA 1J0YA 4H8HA 1L6SA 3P2VA 5CPMA 3W7RA 4CQDA 4HYRA 3UYIA 3R5EA 4ZE5A 4ATLA 1WKYA 1ECEA 1E4NA 2Q09A 3WCZA 4ZSUA 1TZ7A 3WDRA 5A5WA 3GDTA 1YPXA 2PLMA 3RUBL 4ATWA 1VIWA 4PUEA 1PIFA 3IIOA 3TP4A 5CSYA 3THCA 2D3LA 1UR9A 3HPSA 3RCNA 2XM2A 3EOOA 2E09A 3QVQA 4JTLA 4ML9A 2PB1A 3IK2A 1GOMA 5AC7A 2O92A 1E56A 1A5BA 3LPFA 3QYQA 4IBIA 2PGFA 2WSPA 2F6XA 2YBTA 4AMCA 4KRTA 3MSRA 3P84A 1E5JA 1FWGC 2HPIA 5AB3A 3UXKA 3W70A 1DIOA 2QUMA 3H4GA 4TOQA 3W2KA 3W1XA 1S5VA 2VWSA 3VC5A 1A0DA 2WO5A 4RX0A 4IMEA 1JDFA 3MCNA 1JZ4A 2NX3A 3TXZA 4QHRA 1ML1A 3UCQA 3GNXA 3LQGA 3WK0A 2L5HA 3E0FA 2D2GA 5U7SA 2VP8A 3W83A 4M1RA 3RJYA 1P48A 1TR1A 3F5JA 4YCOA 4FX7A 3UEQA 1XLLA 5D9MA 2QCDA 1BD0A 4JIQA 2XUCA 4PMYA 3UCDA 1YX1A 3UVAA 3CMGA 4DF1A 1NOFA 2H6RA 5CPNA 1P7TA 1Z9AA 1ONXA 4RV3A 2E5DA 1LL6A 4A05A 2PU1A 4C1LA 3ZLFA 3UXLA 4CQAA 3M46A 4LF1A 3W23A 1WZMA 1R2TA 4TX9A 5D2VA 1CDGA 2VFIA 1LP6A 4ZZ9A 4PRRA 3SO7A 3SCRA 2BGQA 2VC6A 2OSYA 3CHCA 1TV3A 4JQ2A 2TYSA 4DX3A 3LCXA 2F6UA 3IWPA 4GH9A 3T05A 3LGGA 4CU8A 4ZMGA 2PDWA 1JI2A 1ZJHA 4QJ3B 3SDOA 4GABA 3QMRA 1TPH1 3U8GA 3W88A 4MKNA 1BG4A 2X05A 2PDCA 4GG9A 2A0NA 5HPCA 1H8PA 1ZALA 1WXJA 4NVTA 1Q8AA 3GNRA 3EMZA 2V5CA 2WLZA 4JN6A 4MLJA 2GOKA 3O3RA 4IUOA 2ZXDA 4E8GA 3MZNA 4Q8WA 2YXXA 3TNOA 4JY8A 2ZRWA 4K8EA 6TAAA 1HJWA 3KE0A 3GVGA 5K4XA 3WBWA 1JD9A 4B5WA 3QOMA 2WMJA 3ZS4A 4DELA 3UR7A 1BYAA 4GCXA 4NSBA 4O0ZA 1HJUA 1SZGA 3RK8A 3M0VA 4D6EA 3FYPA 3KL5A 4IL2A 5IM51 1XRTA 1E3XA 4D6JA 4IJRA 1THFD 4EIVA 4V15A 1TE6A 3LUTA 1ELSA 4E2BA 2HBXA 4RZ5A 3DXIA 3MYPA 4WXYA 4OOUA 3WQFA 3WNPA 4AIEA 4TIMA 3GIYA 4CN4A 4E4UA 3H2MA 3UGRA 2D2HA 1XLJA 3U0HA 3BOXA 3F4WA 4Z0JA 4DNMA 3K8LA 1W5MA 3CK5A 3CMJA 4D6FA 1S2CA 3TJIA 2WVVB 1PTAA 4H8UA 1P0KA 3USZA 1DHKA 3TN6A 2A3LA 3NVTA 4BEUA 4IH3A 2WZHA 4R7OA 1Q4WA 3PB0A 1W91A 1KBKA 2PTXA 1VCGA 5JU6A 2D69A 4PTXA 1FWJC 3TR9A 3W6LA 4N4QA 4UTIA 3ZJ8A 2Y61A 4MAZA 5K9CA 4CD6A 3N73A 1R46A 2ZX9A 3WH7A 4IFKB 3PUGA 3SAZA 4AG0A 1V77A 3K13A 1K70A 2OYKA 3KAOA 3UPBA 4LPCA 4S3GA 2G3IA 2VCBA 1HJQA 5LXEA 3RIKA 3TDFA 3OHMB 4BF5A 4XVDA 5DCDA 2ZTKA 3GY1A 1QPQA 2NUWA 4AU0A 3QZEA 1AQ0A 1A50A 3CMFA 3ZQ9A 1L8NA 1DTNA 3GXMA 1BQGA 4QDWA 3T0AA 2WZIA 5CGQA 5I6SA 4ERIA 1XLBA 2YW4A 1OBAA 2BX7A 1Z3NA 4JFWA 3WQDA 1XKJA 3C4UA 1SGJA 3A5FA 1JRCA 2OSWA 5FF4A 1H62A 2X0HA 3TTOA 1J93A 4DBSA 4MB1A 4Y7EA 5BOOA 4LQ1A 2JFEX 2ZX5A 4M51A 4C5YA 4FB7A 1PE1A 2INZA 2B81A 3QLDA 2NW0A 5CC3A 3KX6A 2ZE3A 1XH0A 4JY9A 3BV4A 3QZ6A 1S46A 2ZC1A 4PUNA 1O95A 1WOBA 2P8BA 4GYPA 3STEA 3CS2A 1H63A 4EANA 2YW3A 2ZCGA 2DU2A 1TQJA 2IKJA 1OM0A 4PCNA 2CZFA 3AJ7A 2PBOA 1TVNA 2XZ9A 3VKJA 4JFVA 3P8IA 1EJRC 2V3EA 1XW8A 1MSSA 1UZHA 2X41A 3S8HA 2D2JA 5E1QA 3GQYA 1NELA 1VFLA 1H7OA 2ALRA 3VA8A 2I56A 3PSVA 3BWWA 4QS6A 4UTHA 7REQA 1P0NA 3IGXA 1ZSXA 1KFCA 2WSQA 3KP0A 3NL2A 3HFYA 2Z27A 1PUDA 5A8GA 3UPWA 1V7YA 1TJ1A 2OGYA 1KR1A 1PBGA 5A6KA 5AOUA 4W87A 4UZSA 3QPZA 4ACYA 3AALA 6REQA 4H7CA 1SPQA 2G97A 2QDDA 4HK5A 2FVMA 3LLFA 4NT0A 5TQLA 2DH2A 5A6BA 1Y5WA 3SUVA 5AN7A 4B4HA 3I6TA 3IJ8A 4QR6A 1V4YA 3K4DA 3SCNA 2OOFA 3BZJA 1DXFA 1A5LC 2DZWA 1EJWC 1JI1A 1FWDC 3EOSA 4O1CA 3ARVA 3HPXA 4NY2A 3UCCA 1H1YA 3ZFHA 3QEZA 2J74A 3IJDA 3ABZA 3QFWA 1JYXA 4JTHA 3W87A 3DDMA 3W22A 3A21A 3ONBA 3WDQA 2JCHA 2F2HA 1UD6A 2QAFA 3EKLA 3T81A 1X6LA 3OG3A 3HTWA 2WBKA 1FX6A 3EX2A 3RFAA 3STCA 2F9RA 3NVDA 1JIBA 5JBDA 2NSOA 2VYOA 1IV8A 3UP8A 3PWAA 3GO2A 2Q3RA 1FFRA 3S2LA 2CNCA 4G1KA 5I79A 1E0WA 1GW9A 3R8RA 1HL8A 4US5A 3G77A 1E5NA 1M6JA 3B8WA 4PCPA 4UCFA 3PSWA 5EA9A 5CXPA 1KV5A 1I2QA 1U5VA 4ZOAA 1MRQA 1V0KA 1E3ZA 5KZEA 4NU7A 4BK9A 2PMQA 3MWAA 1KM3A 3RGTA 2X0SA 4WLCA 3N6QA 4PMNA 2EPLX 1Y5XA 1K02A 3LM7A 2QS8A 2QYGA 3MHUA 3WQWA 1H1ZA 4MY1A 4Q4QA 3Q58A 1UR4A 1RBOB 4OBTA 3JW7A 5G4EA 3BJTA 3KOYA 1B3ZA 2B31A 1KC7A 3M0XA 3NA8A 2V5JA 1TSIA 3VCNA 5I09A 1UPMB 1W2PA 1PZ0A 2GFTA 4ZFMA 3FSUA 1A0EA 1LTDA 2QCNA 1M53A 1TPC1 1OG0A 3GXFA 3AMDA 3Q65A 2YKKA 4PUWA 1IXOA 4FSAA 3WEMA 2Y7EA 4FOUA 3UNDA 1KCLA 1XIFA 1EP1A 2OWCA 1XIMA 1VP5A 3TFXA 3TN5A 3MP4A 5DQPA 5J04A 1C8YA 4JGDA 2Z29A 4BQ5A 2FTWA 2AAMA 3SSZA 2VZTA 4AY1A 4GO8A 3CB3A 3VKAA 4PB4A 1CXLA 5K2ZA 3WFLA 2W5FA 3EWYA 3W9ZA 3SCPA 2I5GA 1GT8A 1ADSA 3GU1A 3LEPA 2R91A 8TIMA 3W27A 3NDOA 1TTIA 4HJFA 2ZZ2A 3VIGA 2GWGA 4YYCA 1RY8A 4DQWA 1ZHAA 3DUGA 3N18A 1BYDA 4UZUA 3CUJA 4Z2LA 1VLIA 1XFBA 1QPOA 3QC0A 1Y5VA 2HEJA 1WKDA 2Q8XA 1W8SA 2WNWA 3NZRA 3PPHA 4LW7A 3ZSTA 4L61A 5D2TA 3APYA 2ACSA 1KNWA 4CCCA 1XS2A 4I7VA 3GXIA 1DOSA 1HUVA 1J96A 1A5CA 5BOEA 3E5PA 1GXDA 1UWAA 2V3FA 3WLIA 3WQ6A 3ITTA 1PO9A 1SSGA 1WNOA 2DSVA 4HMNA 3MSYA 2GPTA 4JHZA 2BXYA 1JGIA 1XI3A 1QTWA 3TQKA 5LKYA 1NDWA 3KLLA 3W07A 4IBCA 3L4WA 2HPMA 4ZENA 3QV9A 1GK8A 1ICPA 1GORA 4JQAA 3WY1A 4PUUA 2YA0A 4QEEA 4IX2A 1KGWA 2ZA1A 1UBPC 2WM0A 3HG5A 3B05A 4NZCA 2PAJA 3W7MA 5I07A 3CO8A 4ZO7A 1I2NA 2E0PA 1UR0A 3KBVA 2Y63A 4M7TA 1D2KA 3AWOA 5FAGA 3MDUA 1DJNA 4P8UA 1CXEA 4X2RA 4C1NA 1FHDA 1UD2A 3C52A 2ZE0A 2NV2A 3I3EA 1G4TA 3WH6A 1GVOA 1C90A 2E7FA 2QUTA 2VVNA 4R88A 3OB8A 3AIRA 3VOCA 4CD5A 1AA1B 1MMFA 1JDDA 2RKXA 4MSSA 1YXDA 4ZTXA 2Y8KA 2Y2IA 2YL9A 2O4MA 3MBFA 3TTEA 5FESA 5GVJA 2E8ZA 1VEMA 1JJKA 1R6WA 3VILA 4PCFA 4YWIA 1V3IA 3K4AA 3P14A 5FACA 3F4VA 1TWSA 2J7BA 1XYZA 4LVAA 4B5UA 4B5SA 4D8LA 3QHMA 1T6MA 4GVHA 4C65A 1Q6FA 2G0WA 4MTVA 2R82A 4LUTA 3UD6A 2X0YA 1SJCA 6ENLA 2NQLA 4YVVA 3LMYA 1V3LA 3TMLA 3GTIA 4XAPA 3RM8A 3LHTA 5HNUA 1H09A 4I5XA 1AUSL 3GDKA 4L4MA 4P7NA 1UH3A 1P6WA 3V35A 4PTVA 1Q65A 1T8XA 5KSWA 3LLXA 1EHAA 5LNUA 1IIGA 4P7QA 4UTTC 1Q6LA 5HA7A 3N2BA 3H4XA 1LL7A 3RN6A 5FKYA 1BRLA 4NG3A 2XYLA 5I5RA 1TX2A 1XDMA 2NUYA 4U3AA 3G5EA 5D8WA 4NX5A 1GW1A 2ACQA 2NWSA 1OYAA 2V8ZA 2Z0IA 6A3HA 3AICA 3BZGA 1KBJA 4J3TA 2XVKA 2NXIA 3KTSA 4FNPA 2XN0A 1OINA 3VOFA 1BWKA 3FGCB 4LJ3A 4JFUA 4M0XA 5A2CA 1SFLA 1QO6A 1GGOA 1F9CA 2DPEA 2OR2A 3VMPA 3W2JA 4JD4A 1V6WA 4IICA 2CWNA 2IQ0A 4CNTA 2RGLA 2OZ3A 3THUA 3IVUA 2GSJA 3LCHA 2XVNA 3R94A 4Q8NA 3MC5A 3UY8A 4ZA0A 2Y0FA 3CB8A 3HB9A 1QK2A 2WC4A 3PTKA 3PBVA 4KIEA 6XIAA 2PDKA 2WQDA 4B3ZA 4NI8A 1YBQB 2QCFA 3G1XA 5A69A 1UHVA 1A3WA 2QUUA 3B9EA 3QSRA 3AXMA 4A2SA 4N0RA 3A12A 3FJ4A 3PR2A 3GXPA 3MDWA 2VFDA 4Y90A 1IXPA 4PH6A 2XD1A 3ATZA 4YN5A 3VNYA 5BRPA 1TUXA 1OD8A 1ZJAA 5KZ6A 4NZ1A 3LV6A 3EEGA 1TPFA 4LAOA 1L8PA 4FA3A 1MVYA 4LRSA 1RSCA 4AQLA 2O55A 2VEMA 2RTSA 5DXXA 1BTCA 3HBLA 4A2RA 3SCWA 4LV9A 3LZ3A 2ZX8A 1PCKA 2GSEA 3CU2A 3QR0A 4DEFA 1S5TA 2OELA 1ADOA 3OLDA 3UZZA 2E6FA 1G9HA 4U5KA 1GZGA 4HNNA 3TYBA 1QI3A 3CASA 3CQJA 2FFFB 5FOOA 2BS9A 4WY0B 1UPPA 2GDQA 4BWLA 4B3LA 4EXAA 4MHBA 3WQPA 2GGGA 3BARA 4HNOA 2AMGA 3PTQA 3BAWA 1H60A 4LALA 2V0TA 1RQBA 1NOWA 4G9PA 1YPIA 4XAFA 4BF7A 3NDZA 1FWFC 1NDVA 3SJNA 1B4KA 3LCWA 4KESA 2ZUTA 1Z44A 2HNEA 2QUNA 4J3SA 5FIPA 1X1ZA 3AOFA 3GVRA 2C0HA 3WL1A 4UUIA 3CL7A 3GNDA 4X0NA 3FVDA 4U33A 2C71A 5E6ZA 3GTXA 2OVLA 4Q8PA 5HJXA 4QNEA 1OD0A 4NZ3A 3L21A 1GTHA 5KTLA 4MWAE 1X6UA 1NSJA 3KHDA 3M7SA 3NQ6A 2OSXA 3WLKX 1MFUA 2ZZ1A 4CCEA 2VDHA 3KS6A 3RX2A 4GRSA 3BAKA 2QVNA 3QTGA 2OLSA 3W73A 4PMQA 2DSKA 3E9AA 1NTHA 2C6QA 4Z1CA 4AAJA 1PXGA 1ICQA 2V5LA 5FA5A 3G0XA 4Q4MA 1GKPA 3N3MA 4RE2A 5D03A 2O9OA 1PJ9A 3MP3A 3P6LA 4K6AA 4PB3A 1VB9A 5AYBA 4K7VA 1F76A 3IUDA 2A21A 3H21A 3QY6A 2EG6A 1VJIA 4IG2A 4AY7A 3V5OA 1R7AA 2Y2JA 4LOCA 1DE6A 3RM9A 3T07A 4NASA 1X98A 1NY1A 4FX8A 2BG1A 4UQ9A 4GACA 2GDUA 4KRUA 3QBUA 4KCWA 2PWFA 4PGLA 2VEKA 1VHNA 4J9JA 4HU4A 3VABA 4HHMA 5AHFA 1E9YB 1MRAA 1GOXA 1OB0A 3LDVA 4X22A 3CZJA 1ISWA 1DJYA 1E51A 3WNOA 2F7FA 3WQGA 4A3HA 1OX6A 2Z6JA 3W72A 4QROA 2YR1A 1ISVA 4HZ6A 4UQBA 2OEMA 1UZ1A 3MUY1 4WJXA 2GSHA 5AVNA 4F66A 5AECA 1NDZA 1HVQA 5HR6A 1H7NA 2XIOA 4L4LA 1W3IA 2FH8A 4F8XA 2G37A 1LOQA 4IM4A 2CZ5A 4DPQA 2QUVA 3OEXA 4WSKA 2PGEA 5CSRA 2ZUVA 4A8RA 3A4JA 3TCEA 5F1VA 4GO9A 4MY9A 1UW9A 4Y8EA 1DJHA 3UW6A 4WKHA 3ZJKA 4UXDA 1FCBA 1XQKA 3IIPA 1GOQA 1FWNA 3R0DA 1FP9A 1VJZA 2YXOA 2NQZA 4GD0A 2PLKA 3E38A 3LV5A 4UFKA 3V5CA 4LRTA 2QGHA 1H41A 1NFGA 3IIXA 1XCWA 1X1NA 3B8TA 1Z6KA 3AS2A 1XBXA 2PPGA 5C2GA 1W5NA 1QO5A 3BC9A 5D9NA 4MVAA 3AYVA 1CB7B 4HNUA 1TTPA 4HOWA 4AYGA 4DO4A 4MNMA 5LIUX 4EP8C 3KVLA 2ZVIA 2YOCA 3CYJA 5AHNA 3DI1A 1NF0A 3BLEA 3UXIA 1JUKA 2O4QA 3HGRA 5TIMA 5D9OA 1UG6A 2ZTJA 4D6IA 2VC5A 1ZTVA 2IPWA 1TUFA 4X0VA 1NU5A 2VKZG 3TNBA 3A3HA 4GI6A 3GK0A 2I5IA 3DC0A 3ZOAA 3UT0A 5A2BA 1GKQA 4LSBA 2P8CA 1EIXA 4K8GA 1KA9F 3N4EA 2XGIA 1A3HA 1J5SA 4ZB2A 1ZBKA 3TW9A 3KS8A 4YMZA 2CBVA 3FY1A 1TPVA 5GJNA 5CC7A 5BCAA 4CNPA 4O12A 4NI3A 3WNMA 2PE4A 2YCEA 4NRRA 3LRKA 1W8GA 1ZL1A 1OG6A 1HJVA 1S2VA 3JZUA 4ADUA 1TMLA 4V27A 1VZWA 2W66A 2WVSA 1CK7A 1KM0A 1B3WA 1W3KA 1FWAC 3V75A 3W7LA 1WZLA 2GL5A 2X30A 2Y7FA 2VEPA 4XZWA 1FFQA 2BOEX 4MNKA 4Q4RA 1RZMA 1H5VA 2XDFA 4GX8A 4DNHA 1SR9A 3T9PA 4AUBA 3S83A 4ZQPA 3GR8A 3WF0A 4NUWA 5DMYA 1UD5A 4RXFA 3TCSA 4PMVA 3AXIA 3HMCA 1P6BA 4AC7C 4JHMA 1QDSA 5CLWA 1P0DA 1US0A 5I3FA 3KBMA 3H7RA 4CQBA 1OIMA 1RBLA 1EYWA 4YVPA 1HKJA 3AMCA 5XIMA 2ABBA 3GFXA 4MNJA 1HP5A 1QW7A 1JD7A 4TMCA 1EJSC 2QF8A 1XH2A 5HAOA 1D3GA 3UJFA 5FL0A 3N2OA 2VI0A 1EBHA 3RG6A 4NX0A 2GVJA 3LCLA 3L0GA 5BXTA 4PCTA 3CT7A 4DLMA 3GH4A 5L6UA 3DHPA 4GQGA 2WC3A 5HPOA 4IIDA 5BXPA 3L4XA 3L9CA 1OX4B 2WZTA 3NQ8A 4QE4A 1J0KA 5FD0A 3WUGA 2NT1A 3BH4A 3TN4A 1JYNA 3PVFA 4JCMA 2YCKX 1EXBA 3DU0A 4FLOA 3L0NA 1QNSA 3Q2DA 4PC8A 2BDQA 3V18A 1GWJA 3UZXA 1AQHA 4HPGA 3W28A 4PULA 1TCMA 3GE7A 5AZ1A 4IHCA 2J62A 1CXHA 2Y5SA 1AZ2A 4IBFA 1JZ7A 2W79A 3HPFA 1D8WA 1MDRA 1WE5A 5C71A 2G4FA 2HZGA 5C9ZA 1K9FA 5DFAA 4LV4A 1YU4A 3N12A 4MB3A 2BVYA 2PWVA 2Y2GA 1OYCA 5DEZA 1MW1A 3L2AA 3E0LA 3IV8A 2C3ZA 1C9DA 1J2WA 2PTYA 4NHVA 3GHUA 3CUZA 4N6FA 3ABXA 3LQLA 1POJA 3GHTA 2GWNA 2KX9A 4GVIA 4LYRA 4DJFD 2GQ9A 3SQSA 4P5UA 5HNNA 3HN3A 2DY3A 2CIPA 2CLLA 3LD5A 2J9YA 4PBEA 3XIMA 2VUYA 4P61A 3BUVA 3H24A 4DBWA 7ENLA 4F0HA 4HZMA 5EBUA 4ZE4A 4IMCA 2A2IA 4MJMA 3TONA 3J7HA 1ZLPA 4ROPA 1JGMA 1F3WA 4O53A 2W0UA 2Q01A 3F5KA 5LHFA 3KWSA 2Q02A 4RK8A 1V6VA 1WV2A 1UZ4A 3O9NA 3WL0A 4PUJA 2H90A 3B8DA 4JYFA 5CGTA 3RCYA 3CBWA 4JQ4A 2FVKA 3G1HA 1GOIA 3AC0A 2BXZA 2F84A 1H50A 1OFDA 1QPKA 4PA8A 1W1TA 3L5LA 1QK0A 5F2GA 3SN1A 2VURA 3GG7A 3W74A 1VYPX 3R43A 2E9MA 3OLIA 3DH7A 4Y8FA 4CD7A 2I5QA 3L4ZA 2YB1A 4KFOA 2XH0A 1GEQA 3CH9A 4NL1A 1Y7VA 2W62A 4Z2IA 1KM6A 4D9PA 2XISA 2ZX7A 4PMXA 1P0BA 2EPOA 5LNWA 3TFCA 4HPHA 2WW5A 4HZ8A 1F6YA 4JTCA 4DXKA 2BNJA 3VE7A 1P4CA 4E4FA 4PCSA 1EWEA 4UQCA 3QGAC 3W2UA 5G4HC 3QF0A 1C8VA 4J28A 4BS0A 4UFMA 2Y89A 3GDLA 4Q8MA 3R58A 3G0SA 2G41A 3D3AA 4YIWA 3VMOA 4NJHA 3N14A 3P0XA 1GVSA 1KM5A 4LGXA 1V5XA 1BVZA 2AAAA 3MYOA 3PPGA 4F9JA 1XYBA 4DJEC 3ITOA 1HZYA 3POHA 1P43A 3GIPA 4C91A 3K46A 4QS5A 5LHEA 2DSZA 1KTNA 3HA1A 1GQKA 1NWTA 4A4AA 4M6UA 4H01A 1GQNA 4KEMA 3GC5A 3TROA 9XIAA 2PC4A 3AU2A 3BAIA 3VNJA 3L2LA 4FEZA 5MF5A 1JZ3A 1UD4A 2OT0A 3LBMA 1EXPA 5RUBA 2OX1A 1E1FA 1B30A 2VXNA 1YRRA 5BMXA 1J01A 3DYOA 1YDVA 2HQAA 3VE9A 3U7VA 4A3QA 2OKTA 1KWGA 2A85A 3V0TA 2Z1BA 4Q7IA 2OU4A 3NSMA 3EWDA 3DG7A 1R3VA 4GVGA 5FF3A 3LPGA 5I00A 4GOAA 5G2HA 4MUPA 4XKYB 5A3HA 3GIQA 3FJ6A 1HP4A 1W32A 1SJDA 1X8CA 2WVTA 3NGJA 4OV9A 3I7RA 3G8EA 3AQUA 1AH3A 1ENUA 4DN1A 3THQA 5G1YA 4W84A 3PTMA 2JKAA 2IQDA 1QWKA 5DY3A 2C91A 5A6BD 4G8TA 1T40A 4Y9AA 2HSAA 4C6DA 4TU1A 1PSCA 3DKJA 4B5NA 2HTMA 4M8UA 4NJIA 1F6KA 4L6DA 2HNHA 3IGHX 1C91A 3W01A 4HOZA 1KBLA 5DT7A 4YVXA 5A2AA 3GG1A 4QQ3A 3EWUA 3A64A 4LFYA 4J1OA 5F4XA 5F4WA 1Q63A 2NLIA 1KLZA 4JIEA 2PBGA 2ZUWA 2WJEA 1V6UA 3AHTA 1EGZA 3GRIA 3DAQA 4DAFA 1OGSA 2E1DA 4QXIA 1TJ0A 2J7EA 2GVLA 4HNVA 3AWNA 3KDOA 4QG9A 5M5DA 3M0JA 1E43A 1FHLA 2FVLA 3F2BA 3EOEA 4AX6A 2VGGA 3M44A 3NG3A 3AUOA 4EOUA 4US5D 4KCUA 4MWAB 2OWXA 5T91A 4BHYA 3WX7A 3O05A 2BOFX 3IIVA 4H9UA 1MW2A 4UQAA 3IEBA 2W6RA 1UBSA 3KFTA 3PPFA 2WHKA 1GZ1A 2Y2OA 5TNVA 1E73M 4KQNA 2XHYA 2VZUA 5FEWA 1PZ2A 3N4AA 2QCDB 4U5IA 3URAA 2ZRZA 2QKFA 1I75A 1JAEA 2FJKA 4RNJA 1ITCA 3CHEA 3WH9A 2PDHA 1R3RA 2XTKA 3NR0A 4QP0A 4F48A 3N4FA 2I14A 2PA6A 1FWIC 5MKGA 2TAAA 1LQ0A 3GBDA 3TYEA 1L6GA 2QCLA 5MHBA 4BI7A 1YUEA 1GCYA 5BMWA 3IIZA 3WYZA 4ERGA 1DVJA 4AZHA 4DVOA 4WY0F 3FKRA 2NT0A 1H5YA 3JU2A 3AMKA 4WF7A 2EHHA 3GZAA 5CSUA 4YU1A 3NQDA 3CTLA 3T4CA 5HJYA 3IK4A 4F2TA 4BCEA 4XX6A 1QI4A 3R8HA 3GS6A 3RLUA 1N8IA 2B7OA 4UFIA 1VCFA 1ZAHA 4H6KA 3HOJA 2V2HA 3WLHA 3OYZA 1G4EA 2QNEA 2YB4A 3D0CA 4L1WA 3G0UA 4JFTA 3L0KA 3IRDA 3MCMA 5C9UA 2BGNE 1BXCA 3OVQA 3UJ2A 1XINA 2O7QA 4HCLA 2YL5A 1R9XA 2DVUA 4QISA 2QXWA 4G6CA 4Y96A 2BODX 4JL1A 3L2MA 3UNTA 3WK3A 5HMSA 4P7RA 3DECA 4ZR8A 1K9DA 3UF9A 3TV8A 3OBEA 4H4IA 1V51A 4PMJA 3TR2A 3VDGA 3NZQA 3UA4A 1HNYA 4XD6A 3AZSA 1JCNA 1R30A 1CEOA 3AFBA 1F61A 5IFPA 4LAMA 3MPGA 1XSJA 3MHFA 1JCTA 1NFPA 1JL8A 4OJPA 4CU7A 2OWWA 4GI9A 3F4NA 2R14A 1XIGA 3ONCA 1CCWB 1FUYA 3ANVA 3O63A 4RDWA 4S3JA 3O6AA 4XTDA 2OPJA 2VR5A 4RPPA 3C0LA 1UUOA 1E40A 4Z42C 2WMKA 1V0LA 1YEYA 1G94A 3AS3A 3EXTA 4J5NA 5IFTA 1DIDA 3BGJA 1KFLA 4NXKA 3CHFA 2DUXA 4H7VA 3WF1A 1AVAA 1EJUC 1EFZA 2I7GA 4AD2A 1S2UA 3CO4A 4LS0A 1RV8A 2FZBA 4K3ZA 5A6AA 1G6CA 2PDBA 1Q13A 4URIA 3BLKA 3L66A 4Z08A 1QNRA 3DN5A 3L4VA 3Q67A 3G6MA 5D2WA 5LIKX 1CT5A 1PX3A 2Y2NA 4AMAA 3RU8X 4C6CA 4GY7A 5L9FA 3A5VA 1V08A 3RMJA 3VNMA 4KW2A 2IW0A 1P0EA 4G1NA 3U5YA 1VEOA 3MVIA 5G2WA 1TRIA 3WLOA 4BF9A 2YYTA 1FWBC 1E8BA 1MO0A 1KXHA 1PYFA 2J27A 4UBPC 4FNRA 2JIEA 3REQA 2XSXA 3SI9A 2PWDA 1L6FA 2CZVA 1J9YA 3TW7A 1JVNA 1EJTC 3EPMA 1OQFA 1QBBA 2RDTA 3QM3A 1VF8A 2C16A 4E8CA 5M2FX 3RLVA 3V0SA 3AUJA 5BW6A 4WDWA 3AS1A 3VZXA 3UR8A 1H7PA 2J78A 3M0HA 4JEJA 2P0OA 1CPUA 1DWJM 2VRKA 3TZFA 1OIFA 2QCCA 4IQEA 4AHQA 1G69A 1MQQA 2C1IA 5F2MA 3IAQA 3F1QA 4C6FA 1DWHM 2PDLA 3S5NA 4FNUA 5EL1A 3G24A 2BG5A 2I9EA 4HT3A 2Q71A 4XVEA 2VX7A 2C15A 3S5ZA 3SUUA 3MU7A 1EZWA 2XZ7A 4UTTA 1OJXA 4DPPA 1TZZA 4L1GA 3GVQA 2DUZA 1RD6A 2OFJA 3W4RA 3KTCA 3K5XA 2FZNA 2EPHA 4RUBA 2VNCA 4CGTA 1VEPA 3HZ3A 2E8YA 3PAOA 1SR0A 3GH7A 1UOKA 3IAPA 3C61A 1JULA 4XV0A 4QITA 3PF3A 1C8XA 3VKDA 3ZLHA 3LM3A 1JYWA 3AYSA 1K8XA 3B8SA 3LMZA 1P1MA 4M6PA 3OBAA 3TXVA 1PZ3A 2GJXA 5CBJA 3M41A 1LORA 4AYSA 3WLNA 4K39A 2VX6A 3QN3A 2QGYA 5D33A 3ARXA 3BE7A 2Z2BA 7REQB 1F3TA 3EYPA 5I3IA 4FXRA 3AIEA 2ZX6A 3NQAA 1CXFA 5HDRA 4ZQNA 3S0CA 1YU2A 2E28A 3P8JA 2OMAA 1XDJA 4Y2WA 2X16A 3L4YA 3VD5A 3M5XA 3USBA 5K9DA 3TH6A 4LX4A 2UY4A 5CPSA 3ORWA 3W7HA 6REQB 4RXGA 1BVNP 1N8WA 3W1NA 2CBIA 3S4TA 1UH2A 1FWSA 4LY4A 2EG7A 1EF3A 4RW5A 4OIFA 4W7WA 2CBUA 1U1UA 2WSYA 4PTMA 4AY8A 3WLPA 4KCVA 1IF2A 5CJNA 3STPA 3LNMA 4FP1A 1FWHC 3TC3A 1E6PA 1V03A 1GJUA 2ZQ0A 4QJ1A 5HNTA 1C3FA 1GVEA 2CFFA 2IPJA 3SY1A 2BB0A 2QIIA 1KCZA 2WNQA 2ZBTA 3HO8A 5M03A 4MKVA 3M0ZA 1ZZMA 3C0SA 4Q6JA 2OOGA 1DIKA 4GZJA 1V3JA 2V6AA 4N42A 1OGGA 4EXQA 2A6LA 3M43A 3E1F1 2XVGA 1RQHA 3WO8A 1AK5A 1PX4A 4JAWA 3I10A 3DFPA 5CQ1A 4E5TA 4KF1A 1EO5A 1TV8A 4R9OA 1TVPA 4HGXA 4PR4A 5SWUA 1WOAA 5TF0A 4QRNA 3G8RA 1O5KA 2VEGA 3FA4A 1LM1A 1CIUA 3FHAA 4JTFA 2BSLA 1EYEA 2Y7GA 3KHJA 1HX0A 2WNNA 3H53A 1JPMA 4C6QA 3L12A 1VAHA 4GNKB 1CLKA 3FN9A 3MWCA 4Q8VA 4B92A 3ERPA 2HV5A 2OODA 3M47A 2AGTA 2Z28A 3E96A 2VR4A 4Y9MA 4EAYA 3UY7A 1ZS2A 5FL1A 2EEXA 3OG2A 3RILA 3TKFA 2VX4A 3GTNA 4RE0A 3EX4A 2PRLA 1KRCC 2UY2A 3VNDA 5BYWA 5FJPA 1EOMA 3R12A 3SBFA 4IL0A 4ZEPA 1PHWA 1PDZA 3BLDA 3PM6A 1M9HA 2YIHA 1WDWA 4GQBA 5DRIA 4DLFA 3O6YX 1A5SA 3UVIA 4HPXA 1CGYA 3UESA 2ZRYA 3O06A 3POCA 3TYAA 2EBNA 3B0UX 3OVGA 3HMJG 2H8XA 4A29A 1T41A 3FKKA 3UXDA 5I3DA 1KFEA 2XD5A 4R34A 1VBJA 1VRXA 1CXIA 3SY8A 4LBSA 4QE1A 2HCVA 2VMFA 1UB3A 2DZSA 3A9BA 4MYAA 2ZZ7A 2E6DA 2QPUA 5AKQA 2JIWA 3PPCA 2Y8VA 1PB0A 1J5TA 4IGMA 2QAPA 4W85A 3GKAA 3K1DA 4GUIA 4OOZA 2VC7A 1R3TA 3W86A 3APTA 2QJIA 4KT2A 2CLPA 2ZZ6A 4C60A 1FTXA 5D32A 3VIHA 2P76A 3BCJA 2BGSA 2BVWA 3LXBA 1QHPA 1W2VA 3H7VA 3N17A 1J0ZA 2GQAA 2V2CA 2C8NA 2V3DA 4Q32A 3ABQA 2GVGA 4MPQA 1YKWA 2ZXBA 3EMCA 5AFDA 1W9PA 2G95A 2QZRA 3KOZA 4Y9NA 1EL3A 5F2IA 4N9EA 2HS6A 2GJPA 2HVNA 8RUCA 1SJBA 3MTWA 2PUZA 3BMWA 1Z41A 1RPXA 3VK5A 4M1BA 2HK0A 4GIRA 2YZ5A 5CJ5A 1AZ1A 3Q45A 1YDOA 2JBMA 1J11A 3SFWA 1AODA 3CXOA 2QJHA 1TV5A 1G5AA 2RH9A 2C14A 5I3KA 4ZCWA 4F0RA 2ZUMA 4MYXA 3L29A 1VR6A 2X1IA 3RPMA 2Z4GA 3M07A 3LSBA 3NL6A 1XRSA 4JN7A 5DCBA 5EB8A 1PPIA 1Z7AA 8XIAA 4XAZA 1MDLA 4L4PA 1NP2A 2GUUA 3NQCA 4FZIA 1Q2SA 4WCJA 5AYZA 4JTRA 3ITVA 1FWRA 5F1UA 1F2JA 1SM9A 4AHOA 4UR7A 4HU0A 3ARRA 2VENA 3T2OA 1GOWA 1X7IA 3URQA 1S38A 4RDYA 2WJFA 4I8DA 3DFNA 4QQUA 2DT1A 4O0KA 3CV7A 1TTQA 4I9AA 1VKFA 4XBJA 1DJXA 1T96A 4JX5A 4OQVA 3VM5A 7TAAA 3W0KA 3LCGA 4C1NB 1Q66A 2PP0A 1IGWA 2FB2A 4WDTA 5C7VA 3MJYA 5LZLA 1WDSA 1VPYA 3P60A 3KOXA 3NL5A 3VZYA 2WWDA 3XINA 2YFNA 3ES7A 4PB5A 2A3HA 3E74A 4WIWA 1FA2A 1RPKA 3N11A 3PUDA 1KFWA 2VT0A 3N29A 1GONA 2E9BA 2DUAA 2REQB 3CEPA 3RF9A 4WOZA 4YPJA 2DT3A 3HJZA 4MF4A 5DMLA 4BQ2A 3AXHA 1XYLA 3TJLA 2NSXA 5C70A 3ARTA 1JFHA 1JZ2A 2KAUC 3H8AA 4B16A 1Q4NX 4JTIA 4MDOA 3B4UA 3T44A 2OEKA 3KP1A 4PUDA 4XB3A 4B15A 2XVLA 1JF6A 2DV0A 1JZ8A 4F2BA 1A5NC 4CQCA 5I24A 3BGGA 2PDXA 1J79A 2YL6A 3KOWA 1UWTA 2WZMA 2X2YA 3D3FA 1SZEA 3T0DA 3JR2A 3PP7A 4W9TA 1TV4A 2YA1A 3W7EA 5ABEA 1GUVA 4JTAA 1BRLB 4AWEA 2W61A 3KWXA 1WX0A 1UR2A 3TOYA 4IGSA 3PG9A 2H9AA 1XC4A 1E1EA 2XSAA 3OPSA 2DJLA 4DO5A 4KWOA 4AW7A 3RLGA 4UTFA 3QMTA 1JPKA 1KXQA 3I4KA 3OZMA 1UZDA 3W71A 4EKJA 3WUBA 2G3NA 1LRNA 2XIBA 4O14A 5CPQA 3RLHA 3UJRA 2XH7A 5E6YA 3S5OA 2F8QA 1SFJA 3UWQA 2ZRXA 3ALGA 5DCEA 2ZYFA 5AC4A 5XIAA 1U22A 2Y4SA 2FMOA 2OGJA 1J4EA 3C3NA 4XBSA 1DXIA 3CZGA 1SW0A 2X2GA 5D38A 1PIGA 4E3TA 1AQMA 5AC5A 1T7LA 4AXNA 1BVWA 3VM7A 2WOQA 3D46A 3TZNA 2ON3A 2B7NA 3BLFA 5FF2A 3LHVA 3W00A 6TIMA 2OG9A 3W1UA 2Z1KA 1CGUA 2IKGA 1XICA 2XIIA 1V79A 3ZSSA 1MQRA 4F2UA 2FGZA 1LROA 1VHCA 1XC6A 1JQXA 3GXNA 4PUKA 4LUIA 3A4AA 1XLDA 1DPMA 3CZEA 3ECQA 1XLMA 1GPWA 4HA4A 4ZOBA 3L65A 3W6MA 2DIJA 2FHBA 3MI6A 5HBFA 5HK4A 2ONEA 3EPOA 4PODA 3RPTA 1XLKA 3MQTA 1WPCA 4O1DA 2C13A 2I9UA 3QHOA 3UG8A 5C9XA 1I2OA 1ZP3A 5LGXA 1UCWA 4UTWC 5T26A 3WQCA 3MMTA 1W3TA 2ACRA 2E6YA 3PZVA 4DHGA 5HWJA 4C6MA 4CVUA 4PMRA 1PHQA 1BYBA 3AXKA 4IIHA 4GH3A 2C1GA 2YDQA 4F0MA 3HG2A 3OZYA 4R27A 2X8RA 5CEWA 3V3WA 1QI2A 4LNCA 2XM1A 4KGJA 3UXAA 4EPEC 1EAKA 1W9BM 1W37A 2E3ZA 4HA1A 4IMAA 2V2DA 3N2XA 3KRZA 3QPYA 3MVTA 3BMVA 1BSLA 4ZVJA 3W1RA 3KCLA 1OFEA 3VAVA 3TQ0A 1UR3M 4GHAA 2JEQA 4AXKA 1MWOA 3KW3A 3O8AA 1S2AA 4NJJA 5D4YA 3SN0A 5A94A 1ZQ5A 3UWWA 3VD3A 4NXSA 4OFCA 3ARUA 4MDPA 2PD5A 4FR6A 3IUHA 1IYXA 3KRBA 2PEVA 3U5UA 2W63A 1W6TA 5I03A 2JKPA 4MWAC 1XLFA 2ZZ5A 1F4AA 1OGBA 3DFYA 4HNCA 5HQEA 3OIXA 5EMMA 2Y2KA 3DFHA 5BNKA 1EX5A 1ZAIA 2ATMA 1YPFA 1CNVA 4YTRA 1HVXA 1JPIA 3LB0A 1EJVC 1I2PA 2HS8A 3VVGA 1XRFA 3N19B 1ZB5A 4NZ4A 3WQ5A 7XIMA 4MOZA 3CHVA 4D6CA 4LVGA 2VRQA 3C56A 3QYSA 4S23A 1UKTA 3MUAA 4DBEA 3AHXA 3QV7A 4B3KA 4OWGA 3T0TA 1X6NA 3H6OA 4OU1A 1VFOA 3W76A 1QNPA 1B9BA 3KL0A 4A8NA 1LCOA 3QKEA 1FDYA 4DO6A 4RZ4A 1R8LA 1Q5MA 4ALDA 3IGUA 1M68A 4LCRA 4ZQOA 3WBEA 4DJEA 2FHFA 1T0OA 1VRDA 2CERA 4I5RA 1SJAA 3RO6A 4ZQMA 3BL3A 2D0HA 5FJOA 4NP7A 2PDFA 4C6JA 5CAHA 3ZT6A 2ASHA 1ZGDA 2MNRA 3PZIA 5EU9A 1RJRA 4CQ8A 4DF0A 2NVAA 4GQQA 3WMSA 1KFBA 1PCWA 1KRAC 3AXXA 3GZ3A 5ABFB 3GVWA 1XGZA 4AWTA 3OU8A 1BXNA 3QHNA 3QXBA 5CBBA 1SMDA 2V38A 3S1VA 2PSNA 2V5OA 5H8MA 1R9YA 3UQNA 4KRZA 4YNGA 1IEIA 3TYZA 4O1FA 4TX8A 3F4DA 1V6YA 2OEJA 1ADDA 3ANUA 3R1ZA 2JEPA 4O19A 3MUZ1 4NNBA 3H4WA 2VZOA 1FCQA 2J6XA 4EACA 5LNSA 5EBAA 2CCRA 4LYQA 2G3MA 2O9RA 3H54A 1EH9A 1HXJA 1MNZA 2J25A 1FH9A 2PDGA 3E0WA 4OBRA 5J8LA 2B7PA 3A47A 1PDCA 4QDMA 4JX6A 1SZNA 1S5WA 3KZSA 2NV9A 1K4HA 3SRHA 3VIOA 3CUIA 2CLOA 3U2EA 3S2CA 1SFTA 1PKNA 1EQCA 4GZEA 3TYDA 4F0KA 5D2XA 4RDVA 3BW3A 4IMFA 3E2QA 2JE5A 1F73A 5B7ZA 4XZLX 1QOPA 3GNOA 5KEZA 2NX9A 4OGZA 2B4GA 4MZ1A 3ALFA 2J8GA 3VD4A 4GH1A 3L27A 3CUFA 2C79A 4S3DA 3MUXA 4DXVA 3FS2A 2G5WA 2WBGA 5DY2A 9CGTA 3ZWSA 3I4EA 4H6QA 2HXUA 3B8IA 5XINA 1KBBA 5BOFA 4PN2A 4ASTA 1A5AA 3CM4A 3IJQA 3IVTA 3CAWA 3WLSA 4EXBA 3NL3A 2ZDSA 1KRBC 3IJIA 3LRLA 1VIZA 5FI8A 4K68A 3N04A 3WQ4A 3TTYA 3EWXA 2G50A 5BU9A 2YXGA 1GJWA 3WJYA 1TJPA 3SZ8A 3KTXA 1O60A 4H7ZA 1SVDA 1XPYA 1C9WA 1UIPA 3BICA 3R25A 4DJFA 3GHSA 3TAOA 4WGXA 2DZTA 4DJDC 1IZJA 4UFJA 2VZVA 3KRUA 4Q22A 3BMXA 3MO4A 2V3GA 3L7RA 3B97A 3CGTA 4LUYA 1IHIA 2FZ9A 3QV8A 2ZUNA 4YS1A 3L2IA 1UC5A 1W1ZA 5IHRA 3O0FA 2EO7A 4D1JA 3E0IA 4QLLA 3UJSA 4E6MA 3A6OA 4P8XA 3KRSA 3V7PA 4A8LA 2ZRVA 3FJNA 2BOGX 1SYTA 4B5VA 1F4HA 1XD0A 1CWYA 3EDKA 2QPXA 3L4TA 4MJ2A 1K6AA 4YXGA 3CUHA 4PFHA 4ES4A 3VX0A 1D3CA 4RR4A 1QR7A 3FGCA 1WAWA 2Y1HA 1N2VA 3DFOA 3WK1A 4AD3A 1YQ2A 3BVJA 1KTCA 3DENA 2WJDA 1I60A 2QCEA 3LTPA 4X9SA 2X1RA 4L9ZA 1REQA 1PAMA 4IGNA 5CZ0A 1ESWA 4HCHA 1TA3A 4C7FA 3GNNA 1G7UA 1LUCB 3L68A 3N9KA 5DN1A 3PJTA 4ZXOA 1ZP4A 2AOSA 1S3HA 4HMEA 1L6WA 3M1ZA 4LUSA 1EGVA 1E88A 1K77A 2NX1A 1EC9A 3HJEA 4ATDA 3A23A 1DEDA 2XSBA 4K38A 2DGAA 5EMJA 2HWGA 4LY8A 1P1XA 3N3FA 4O16A 4Q6XA 4K2SA 1KXTA 4JCLA 3RITA 5D8ZA 1SMAA 1E70M 4ADTA 4GMEA 4NZ5A 1NWRA 1YNPA 4NF7A 4FIQA 4DUOA 3G1FA 1JZ5A 3C2YA 4AZ7A 3WF3A 1UWRA 4IFOA 4WSHA 3W26A 1VBHA 3S42A 1GJPA 5DXYA 3URBA 2VEIA 2HE8A 1R3QA 5BZAA 1PTGA 3WNLA 5ABHA 2OT1A 4OT7A 5DF0A 1Y65A 3CV1A 2CEQA 1FDZA 3JUGA 1EWDA 5FJIA 3LHUA 1KFKA 3DBNA 3WLTA 4D6HA 3BO9A 5A8OA 4UMCA 4LB3A 5HATA 1UA7A 1CLVA 4WY0A 5JBFA 3GHRA 5E9AA 3NPXA 5CZTA 3I6RA 4C6LA 4PYSA 3VI2A 1IR2A 1W5QA 3TWBA 3H2OA 3PBWA 4IBEA 3EOUA 3PJXA 1UIOA 4QAIA 2BY2A 3KUMA 2OQLA 2D73A 1HO4A 4GHLA 3S6DA 3H26A 3GLCA 4DI9A 1GHSA 2PU0A 1HKVA 1LQ2A 1GYLA 1R9ZA 5TAOA 5LXXA 1LBFA 2ICSA 1ZY9A 1EP2A 2QVHA 5KITA 1JXJA 2J4GA 2OX4A 1K7EA 1SW7A 3APGA 2XGBA 3BAJA 4IWWA 3CWOX 4IJBA 3PNZA 4GLEA 1KKRA 3NSNA 1B5TA 3G3MA 2J9ZA 1YU1A 4WGHA 4W7UA 2GGIA 2PDJA 1D3HA 1UASA 2ISWA 1JAKA 3IUIA 1XCXA 2WYSA 3VXGA 4QJ4B 3CL8A 2WMHA 3LYEA 1LZOA 3EGJA 1XPGA 3I7QA 3B9DA 3ZJ7A 1K6WA 5G1MA 3U57A 2EKGA 2WAGA 3GYEA 1GG1A 2WZEA 3O15A 3GVVA 1YYAA 4C6KA 1IEVA 4REQB 4TO8A 3ZT7A 3PZNA 4RE4A 3W7JA 1UQZA 1VQTA 1B0IA 1D9EA 5I3JA 3BW2A 2XH4A 1TO3A 3ITGA 4DIAA 5HNRA 3WBAA 1X38A 2WJZA 2XIJA 1OT1A 1XIHA 1XM3A 4WJ8A 4DWSD 3HG4A 1OFPA 1V6TA 2CHNA 2RDUA 2VHLA 1FBAA 2QV4A 4AH7A 4TX6A 5REQA 3I68A 1RVGA 3TUUA 3R2GA 4AHPA 5I0DA 4JHOA 4W7VA 1O5RA 4ORIA 3L5MA 1O4UA 2IPFA 1FXQA 2Y2MA 1CECA 1QO2A 4U31A 1VLWA 2E68A 4GQRA 3BG3A 1SO6A 1LT8A 2QCMA 4WJEA 3GH5A 1TIWA 1QPNA 4R5EA 1ODUA 1QVBA 1XYCA 3VIJA 4YTTA 5IHSA 4PTDA 4HPNA 1IZKA 4UIOA 2EKCA 5A6TC 4HA3A 2A6NA 4S3KA 4I7WA 2X42A 2G8ZA 4GKTA 1Q6CA 1RA0A 3L67A 2NLYA 2WHMA 2I17A 5C5YA 2E25A 1N82A 1WXZA 5LNRA 3PZ9A 4P8WA 1NM9A 1JUBA 4J3WA 4HU8A 3WUEA 3PBUA 2Y8UA 1UKOA 1W9VA 4KWSA 3DESA 4XD3A 2WM1A 4NYYA 3ARZA 1D8CA 2PC8A 3UBPC 1KGXA 4G7FA 2AKZA 2VQUA 5C55A 1IT0A 3NWRA 4HZ7A 3FX4A 5GJPA 4QLJA 1OWQA 3IJ7A 3C8FA 4KFNA 1GVRA 2OKOA 1RK5A 3IGSA 3KEHA 1F05A 4EX4A 1ZUAX 2O9TA 1OT2A 3VIPA 4KPLA 3GNPA 4M5PA 5AYXA 2WV8A 2QDGA 1DORA 4ZQCA 3ARSA 5LSMA 1YXCA 2VC9A 5IBXC 1C93A 1QFEA 1A80A 1JCLA 1CLXA 4PMZA 4X9YA 3WEOA 2ABAA 2RJHA 1E6QM 5I3HA 3COTA 2EJAA 4F0LA 3H12A 4MY8A 3UZWA 5CC5A 3C6CA 5BROA 3PJUA 1W1PA 1H7XA 1MXGA 4Z1DA 4UB9A 1HW6A 1WDQA 3W7CA 5DANA 1YTEA 3FSTA 3NEHA 4PRTA 4GIYA 3MBDA 1Y0EA 3IRSA 5CKSA 2VFGA 2CKRA 1XYAA 3EWWA 4H00A 3WDHA 3LI0A 1M7XA 5U4NA 1V7AA 3CZ8A 1ZCOA 4PRWA 4DM1A 3OTRA 3T8QA 3LCIA 4LVBA 3VD7A 1Q85A 4M29A 4M3PA 3WD0A 4IPPA 3BQ6A 1W1VA 2EPKX 2PLJA 1XX1A 3AZRA 4WKAA 1V3HA 3FCPA 1Q45A 3DHFA 4HQVA 3U4AA 2Z1SA 3Q4DA 5HMFA 1OCNA 3SN4A 5CC6A 4UQEA 3LHYA 4E0CA 5HXMA 4Q7BA 2AQOA 1K7XA 2Y24A 4JTDA 5AZ0A 5MKGB 2R24A 1C92A 4XIAA 1Q6OA 2Y88A 1Z42A 3PWGA 4BEQA 1SZRA 3V0UA 4CLMA 4ZGYA 1U33A 4LAZA 2WB5A 1MQPA 3VPLA 3NAVA 2O9PA 3RX4A 1G4SA 2FDSA 2OLHA 7TIMA 2BMBA 4JXCA 1O6IA 4EF9A 4GGBA 2TODA 2NUXA 1V02A 3WKZA 3F2CA 5G4WA 3AMLA 4UC5A 4M80A 5CG0A 2DT0A 4A3RA 2FTPA 1F74A 3OIHA 3W7PA 2FHCA 1G1YA 4K8HA 2PWHA 3GW3A 4WEVX 3QLLA 3O6CA 1H0IA 1QOQA 1I0BA 2R1PA 2UBPC 1W3JA 4NZJA 1EPVA 2ANUA 3NPVA 2XN1A 2Y2WA 1WDDA 3PZGA 2PODA 3UYCA 2QMKA 1A5UA 3B0VC 2EXOA 2JQXA 1RHCA 4L5ZA 1TTJA 2UWXA 2WCSA 1ICSA 3VYLA 4N9CA 2Y70A 1OFOA 5GJMA 4K36A 3R6IA 2HROA 2D3NA 4O50A 1XHGA 4ILSA 3BAXA 6CGTA 4KFPA 3W1QA 3N2TA 4A6GA 1VD6A 2G3FA 2IUZA 4OHQA 2DW6A 3HIJA 4ICCX 1XF0A 4DWSC 4U4MA 2C0AA 3A4XA 4UFLA 1CENA 1XLEA 1BG9A 3IARA 3RMEA 4O1AA 4FXJA 2CESA 2ZXAA 4NAEA 1KTBA 2CZEA 2PP1A 2QCHA 4BFAA 4OVXA 2Z00A 4NAFB 4PTWA 1DQWA 1F7BA 4MIMA 1XCFA 5HMDA 4HU3A 2HISA 2WKGA 3TC6A 1TZ9A 1IQ8A 1L6YA 3T08A 3T8LA 5I78A 1OEPA 1KM2A 1WZKA 2ZDRA 1DJWA 2RUSA 1KV8A 2H3DA 2BY3A 4S3AA 5EKYA 2A79A 3B0XA 3QKZA 4RZ6A 3VKBA 4C90A 4EE9A 4WQ6A 4IBBA 3W2MA 4J27A 3TX9A 3WMLA 2Y2PA 3RYSA 3I6EA 1OCBA 1ONEA 3OLEA 4AZ5A 3O16A 3VINA 4EF8A 3GDRA 5KETA 1H51A 4ONVA 2R9RA 3REQB 1HL2A 4IBGA 3NQMA 7CGTA 2FMNA 4MB4A 3KVJA 1HJSA 1IEQA 4FLSA 1VFUA 2DZVA 4XWUA 4G7EA 4HN4A 1OSEA 1B3VA 2YCLA 3QMSA 3VFCA 3DGRA 2FJUB 5T8GA 4H9MA 3ISIX 3FEQA 4EPBC 3SSJA 2BP1A 2PDQA 4IQDA 4E2VA 1HKWA 2Y7DA 3VMNA 1E9LA 1KBIA 1AJ0A 2VFHA 2O7SA 8XIMA 2P3EA 4I8YA 2PDIA 5H2ZA 2V82A 1WZAA 1J2BA 2P53A 2GK1A 2FPVA 2QCGA 1MEIA 3WLMA 5D09A 4N7QA 1UD8A 3E0VA 3VIFA 2J8FA 3S6OA 2XU2A 4B2DA 3G1SA 1ZENA 2W92A 1I6NA 4P7OA 1KXVA 3PJWA 2NVDA 2Z2UA 4YHGA 4GY1A 3M7PA 4FNTA 5CAKA 3F5LA 4RNIA 3ITCA 3VOJA 3GR7A 1V3KA 2RHGA 4L4OA 3SGGA 2WMIA 3ATYA 4XBKA 4L56A 4CKQA 4X63A 1XXXA 3O2LA 5J5DA 6XIMA 1WUEA 1M5WA 2GJXB 4GJ1A 4MAVA 1C8QA 2O0TA 1YTKA 3SIZA 4MG4A 1K8YA 1M65A 2JGYA 4AIOA 4QAWA 3AAMA 1OABA 4RNHA 2WNZA 1CGTA 5K7JA 1EHNA 3O6DA 1OFAA 1DYSA 5HUOA 4Z0SA 2J75A 5JXQA 3ZYZA 3PUEA 4LS1A 4YHEA 1AD4A 2E5BA 4HYWA 4NKCA 1OF8A 3V1HA 4A22A 4M24A 2YLAA 3BCDA 2AGKA 4QFUA 1UR8A 1EQPA 3S9IA 5GNXA 2YFOA 1E1CA 4UMBA 4JTSA 3R7MA 4K1GA 4ENLA 1D7FA 3FFSA 1E9ZB 4OV4A 1KCXA 3L25A 1O66A 1W3HA 3KCOA 3UZYA 4W86A 3NJ3A 2GUYA 2PTWA 1BGAA 4W89A 1EO7A 5A8NA 3AYRA 3K2GA 4FOKA 5E93A 1H49A 5F4SA 1TELA 3I3BA 1V3MA 2G3JA 4XQ6A 4GVFA 3ZLGA 4MLRA 3S2MA 5CZKA 4UTWA 1RLCL 3NQFA 3W37A 3SM0A 3HQOA 4D2JA 1YNQA 2W67A 5BRQA 2FZMA 3GXDA 1EBGA 2VM8A 4PSPA 3TK7A 3KL3A 2A3BA 2FGBA 3W3OA 1XR2A 1BPLB 2EQDA 2ESCA 3VU2A 4J3VA 2F2KA 3EKZA 4S3BA 3W7IA 4LANA 1NARA 3AI0A 1H7RA 3SRDA 3TC7A 4YTUA 1KM1A 1UKQA 3WMCA 4MGGA 1Z69A 4DRSA 4FNQA 2ODOA 3H2CA 3SCVA 3OJGA 3R4IA 4JBRA 3CEUA 1SO3A 1LF1A 1PX8A 1E4LA 3QZAA 1YE4A 4NILA 1GZJA 3OZPA 2DIEA 3NZPA 3C3UA 2V63A 2GUBA 1DV7A 3NQ7A 1FCUA 3CQIA 2Z1XA 2Z1VA 1E15A 1XSIA 3OODA 4D71A 4QX4A 1O5QA 4ICNA 4J2PA 4IT1A 2P88A 4UWMA 4CEXC 4IPLA 1QXLA 4OKDA 1DL3A 3LHWA 1EDQA 1HG3A 4NRSA 1CGWA 3OW1A 3WD3A 3HG3A 3BG5A 4LAKA 3SR7A 2E9LA 2WCGA 1E0UA 5FJTA 3A3XA 4O52A 4AZIA 4WDUA 4MWAA 1UR1A 3EXSA 1B3OA 4QJ5B 3ITXA 3WBYA 1GEHA 4TVDA 4D6GA 1WAUA 3MSDA 4E4PA 1XBYA 1XLAA 1KGUA 1QMLA 1WKFA 3S5YA 3LGDA 4CN6A 4EK7A 3OGRA 4HPJA 2ZIDA 3ANYA 1FWEC 3DCPA 1RALA 2QV5A 4GC3A 2A7RA 5LGZA 3GKFA 4YL2A 4XZNX 3ZR5A 3W38A 3UWVA 4INFA 3SIMA 4IPNB 4LYKA 3BDKA 5EPDA 3NM1A 1AW2A 3BSGA 4HKPA 1JQVA 3EWBX 1K4GA 2YDAA 1TMHA 3PBYA 5E70A 4H9VA 5C6MA 4GWEA 1XG4A 1A3XA 3BW4A 4IBDA 3EDEA 4J4KA 5B80A 1M7PA 1XKYA 3KDNA 2QR6A 3OA5A 2PF0A 3TA6A 3OGVA 4U10A 3T6CA 1P5BA 3PULA 2CLMA 3HSHA 3ARQA 4GC4A 2TPSA 4RNFA 4XD4A 2WMGA 3GBEA 3NO5A 2PCEA 1UMYA 3N9RA 5HOSA 1UWQA 1Z32X 3II1A 4DYJA 2Q3OA 3G1DA 3U4FA 4KEZA 4B91A 1LBLA 3NO3A 4HSOA 4DJED 1XLGA 1YU0A 3PAJA 3CT2A 3A9IA 3SUWA 2VUNA 4X61A 3B40A 5G1TA 3E3HA 4X60A 3THAA 3OQ8A 2J47A 3PY2A 2NQHA 1PV8A 1XGDA 4HK7A 1QRQA 2POZA 3S9YA 3T0CA 1WP6A 3YPIA 1XWYA 2DP3A 2VGIA 3R13A 5FJJA 3SB0A 1TB3A 4CNSA 5ECUA 3VDAA 3EDFA 3WH5A 1PWMA 2YYUA 1NAL1 3ARYA 4GIAA 3ZVHB 4Z1YA 4Q4OA 4KBXA 3O1NA 5A6JA 3IACA 4EWJA 2JF6A 5IDZA 5F2LA 4AC1X 2PDPA 3PBGA 2HXTA 2IS7A 1K03A 1AJZA 4RL3A 3E49A 2BWGA 3SY5A 1TV2A 3CQ0A 3HQPA 2AL2B 1TJRA 1AD1A 3ZT5A 1YDYA 5C9RA 1UKSA 3N3TA 3NQEA 4Q8TA 3INPA 1HKMA 2J9XA 1W5PA 4O57A 4JKKA 4QNLA 1ZBCA 4Q4PA 2BVTA 2WMFA 2WPGA 1B54A 3QPEA 1JCYA 1KD0A 4E2DA 1BQCA 3VDHA 3BLIA 1JDAA 2PZ0A 1Q6DA 2QJNA 4Z17A 4QG6A 2WWCA 5AHLA 4S1FA 3F03K 1NQ6A 4P8VA 3SFKA 2Z24A 4UTLA 5I77A 2OZTA 1W3LA 4LVFA 1RY0A 3AMGA 5EYWA 3M7WA 4JTUA 1LG2A 5FEZA 4EPKA 2D0FA 3FVMA 3T0BA 3VC6A 4FF7A 2Y2LA 3NTYA 4IF2A 2XVPA 4XK2A 3R89A 4CD4A 5GQBA 3W2NA 1NJJA 4JQ1A 4GXWA 4IGHA 1VBGA 4IQLA 4DJDA 1V0MA 2I57A 3HURA 3CV2A 5I23A 2YPIA 4IP7A 4L9YA 1RBAA 2P10A 4UMAA 3WMBA 3FDKA 4KH2A 3PZMA 3MJMA 3QQ0A 3VZZA 3NGFA 1BKSA 2HK1A 5CSSA 4B4FA 4IBKA 2ZXQA 4V1YA 2OTDA 1VFSA 2H9AB 4ML4A 3KS4A 4HHPA 2WKLA 3LCFA 3ENLA 4DAIA 4WVXA 3AHYA 4M6QA 1MUCA 2BY0A 3UG4A 3Q94A 3KBWA 1RAKA 2PDYA 4K37A 2LLEA 1TRDA 1CGVA 1L6JA 1WYIA 1DTUA 3VO0A 5CG7A 2GVYA 7ODCA 1T5AA 1W9XA 3STGA 1JXKA 1F3XA 1VS1A 4H83A 1X97A 3QRHA 1GQIA 1UC4A 2ZA3A 1E71M 4OJYA 4PTNA 3EB2A 3WG6A 1B90A 5GPRA 4UFHA 1YDNA 3PZTA 5I06A 3WQOA 2WLYA 3SUSA 2Z1WA 4N9BA 3LN3A 1OY0A 3O07A 3B06A 4AIUA 4GFSA 4AZCB 4Z2JA 3MY9A 4O8AA 3V16A 4O11A 1H7WA 4R9XA 3M0MA 4AZGA 4ZL1A 4OJ5A 4OJLA 1JPDX 3OVRA 2IKHA 2J77A 4DZAA 4IQJA 4AD0A 4JZ5A 2PD9A 1OFRA 4GINA 4KWUA 3NUKA 3PG8A 1O5XA 4AVFA 1SW3A 2OQYA 1WXYA 5I3GA 1RJQA 3QJAA 1RLDA 3MMDA 2MANA 4LTSA 2CU0A 4IXXA 4ZO9A 2CC0A 3WLJA 1E6SM 3EZ4A 4I5UA 3DOPA 3AU6A 4XO7A 4AF0A 4KWWA 4DF2A 5FCZA 4DZHA 3GB6A 3DI0A 4WSJA 1E9IA 3UA3A 1QU4A 4YCPA 2P0IA 1ISZA 3VIKA 1DWAM 3K30A 2VOTA 2J24A 3L26A 3VTRA 4FNSA 1G4PA 2X7VA 2YCJA 1FKWA 3M64A 2J79A 2Z7GA 3LERA 2DSUA 5AHEA 1POKA 1R85A 1FCVA 4GUFA 3F2DA 3PWIA 4JTJA 4HN8A 4J40A 1QBAA 2BVDA 1TPDA 5JMUA 2UZ9A 1IZCA 1H4PA 2QF7A 2A3CA 3NPUA 3VKCA 1FH7A 3GFYA 3W29A 1AG1O 3OO2A 3PZOA 3NXLA 2BZNA 2VEFA 5H8PA 1CW2A 2VFFA 4GISA 5HWNA 3SECA 4D8AA 3NPWA 3MHGA 5JH2A 4CCDA 5CZSA 4U3CA 2QPSA 1E0TA 1HTIA 2BTMA 3L5AA 2ZRUA 1E72M 1EC7A 2WANA 2Z6IA 3K8KA 4O10A 1KM4A 4HD5A 1WDPA 3NOEA 3GDMA 3N15A 3BPWA 4IXHA 4S3CA 1GVYA 1XUZA 3P61A 3GC4A 1U1JA 1KR0A 2Y5EA 3S1UA 1ONRA 2IKIA 1VH7A 4Q33A 4FLQA 3AJXA 4TUFA 1IIHA 4U28A 2FQIA 1UUMA 2V67A 1LDCA 4PEKA 3CIVA 1V93A 2J13A 2IXUA 4DUXA 5H8UA 4HTYA 4IBJA 1I2RA 4H8VA 3TLLA 3QQWA 3EX1A 5ENLA 1BKHA 3L4UA 4AVNA 1V02E 3A24A 2E1WA 3M4HA 3ES8A 5A95A 4DBUA 2CLHA 5I2UA 1UP3A 3R8GA 3AHVA 1J0HA 3WN6A 4R85A 1M41A 4CNOA 4GK8A 2QEZA 4ZOEA 3C2OA 1ZRQA 4XISA 3MW7A 3IJ9A 1NDYA 1BSIA 4ZSTA 3KM8A 1DIEA 1DQXA 2BHYA 3DBPA 4JIHA 5CCZA 2D49A 4KIRA 3MUIA 2DORA 3GFZA 2PWGA 1QI0A 3MANA 1J0IA 2WHJA 4BI6A 1H2JA 4XKMA 4Y9OA 1CB2A 3W82A 3BSMA 1OK4A 1WA3A 3B4YA 3ME3A 1MZRA 3W7OA 1QI5A 3W7QA 2WK2A 1R87A 1GOKA 2CPUA 2XGZA 3P3BA 3S2NA 2OLAA 3BLPX 3WJWA 4H41A 1EEPA 3EBVA 3UERA 1EDTA 1A5OC 2BHZA 5D05A 5CPOA 4EAMA 1SZFA 4GUHA 3T09A 4L6OA 5JIWA 3LNPA 2R8WA 2RGMA 1VYSX 2PDNA 2YDRA 2NQ5A 3C2FA 4HMCA 2RAGA 4H6RA 2F38A 1P7TB 4YWSA 3ZWTA 4IMDA 1GG0A 4Y6GA 4J7RA 1US2A 1GYMA 4U2YA 5BXRA 4KEUA 2KZHA 3RHGA 2FZDA 1RH9A 3GC2A 3WLRA 4C1KA 1AL7A 4GY0A 1MXSA 1EEXA 3CJPA 3LTSA 4CEUC 5CGMA 3H2AA 1SUXA 1L2QA 1YW1A 3HM7A 3TAKA 1EIBA 4IZGA 2FYMA 3UPMA 1RCOB 5IBXA 2DEPA 1E6NA 1TWIA 4WRHA 1A0CA 2X1TA 3GWQA 1TIMA 3CYVA 2FFIA 1AW5A 3EPNA 3CWNA 4JQ3A 2EG8A 4LEFA 1MEWA 5FSDC 3S2JA 1JFXA 4JPGA 1JEZA 1FWTA 3GUWA 2VFEA 3E02A 3NYZA 1U5JA 3VGHA 4XAYA 1QUMA 2GGHA 3W25A 3W7KA 2EAWA 1ODZA 4HJWA 7A3HA 3EXRA 3N6JA 1P6CA 1EOKA 2ZFAA 2AL1A 2REQA 1H3GA 4C5ZA 3JS3A 2DSWA 2ADAA 2VO5A 4O18A 2J7HA 1EDGA 1IWPA 1WDRA 4GHRA 1XG3A 4ZFCA 3WK2A 1E4IA 4N02A 5DLCA 2UWFA 1E55A 1OVDA 4QCEA 3B0YA 5AVHA 2V5BA 4K7YA 5DELA 1TR9A 3PFRA 4RDZA 3C0QA 4M7SA 3EA1A 3GYCA 3OLGA 3CUGA 3B3DA 3GU2A 2Q8ZA 1A5MC 1LLZA 2C18A 1OC6A 4I6KA 1D7KA 4AEOA 5FEXA 3OYXA 3T55A 5HINA 3LXAA 3PTDA 3EWZA 5EFFA 4I9MA 3VD9A 3ABSA 4DYEA 1Q7MA 3MT1A 3TJXA 3GX9A 4WD0A 3T7VA 3PZUA 1QCWA 3L28A 4BKNA 4YTSA 3MI2A 1EZ2A 1GTEA 5BXSA 3URNA 2OO0A 1AMKA 4YLWA 1N7KA 4HIBA 3TVAA 3HGJA 4B9YA 3DHUA 2FDMA 4BQ4A 1IWBA 1JNEA 5IXEA 3QV6A 3DG3A 2VCAA 3OGSA 4R7WA 4HBKA 4NJKA 3M5YA 3OP2A 1C7SA 1PKYA 1NH6A 4Q3MA 4ZOCA 1X1OA 4QE5A 2XJ7A 1TMQA 4D8ZA 4P7LA 3FEMA 3W1LA 4H2CA 4FX6M 1RVKA 3W7GA 1DXEA 1F8IA 3I7SA 1XP3A 1REQB 4S39A 1WKEA 3NM3A 3TN3A 3E5BA 4G2DA 2QDHA 1E6XM 1ITXA 1YADA 3G2GA 3RU6A 2WC7A 1TA3B 4DBDA 1R47A 3ZVIA 3TSMA 4AD4A 3PFMA 4LUSB 3QY8A 3LENA 3NOYA 3FK4A 1RD5A 1ZPTA 2ZZ3A 3MI3A 3AO0A 3OBKA 4HP5A 4GX9A 2E67A 5AY7A 2E77A 4A35A 4O0QA 2V5KA 4CCZA 5H91A 1DBTA 3CTTA 3KBNA 3WLLA 4CU6A 3QR3A 2CW6A 5PTDA 5FEPA 4QSFA 3FLUA 4DWSA 3NNTA 1W3NA 2XFRA 3SADA 1UQYA 1TQXA 4LT9A 1HO1A 3DYPA 3SCQA 5T9BG 4JEQA 3ID7A 2D20A 4BY3A 1I0DA 1VBUA 4JDYA 4GYJA 2BHUA 4H1ZA 4XSLA 4FS9A 2NQJA 3GDBA 4GNJA 2Q8LA 3N2CA 4HSHA 1B1YA 1W1A1 2BV9A 1GKRA 3CHDA 1SU5A 1Y8BA 4YTQA 1I8JA 1PTDA 5CPTA 2CLFA 3CZKA 1B57A 4K1WA 3UETA 1QASA 3LS9A 4O8RA 4DM2A 2HE5A 4C6IA 4M82A 3VOGA 4KWVA 2ZICA 2XH2A 3UR5A 4TV5A 1RCQA 1VJSA 2DZPA 3TIMA 3P5YA 1SO4A 3G22A 3NEVA 2Y2QA 2ISFA 4RLIA 1EGMA 3RCMA 4JIIX 2HMCA 3WD4A 4N9DA 4PMUA 2FFCA 4NNAA 3WJXA 1LG1A 3M0YA 3LRMA 3N34A 4ACZA 3QY7A 2G96A 2GJNA 4JNZA 2CLEA 3UWZA 5EMLA 3T40A 3TOPA 2A7PA 2QULA 5LIYX 2J7GA 1E6ZA 3AHZA 1PWLA 4PL1A 3E2VA 1G0CA 1TYGA 1AJ2A 1BWLA 2DZAA 4XZMX 1LOLA 1A4MA 1KLYA 4R53A 2ISVA 3TSBA 3P82A 4JKLA 1EJ7L 1A53A 3BOFA 3CNYA 4KKXA 2OYMA 3SGZA 3FXYA 5E0CA 2VX5A 4KS0A 1AL8A 2Y85A 4XD5A 2P1FA 1XYMA 4E3VA 1YNYA 2VDIA 1MW0A 3H2FA 3EKGA 4AISA 1EUAA 4DWDA 1AFSA 1Q2RA 1F5ZA 3DIPA 4IX0A 4LAUA 3RPDA 4I90A 3DX5A 4TMBA 1XBZA 1BEUA 3IJ6A 3T2PA 5REQB 1K9EA 4RJEA 2PDMA 3QC3A 4B2DD 1XLIA 5FJRA 1LWHA 1QW8A 3AROA 1NWUA 3WQ8A 1JG9A 5IDIA 4QDPA 3EAUA 2E4TA 4GJJA 2D2OA 4QTGA 4XZIA 5CZJA 4FLRA 1R0MA 3ZM8A 1OC5A 1YU3A 1BHGA 5EMYA 4ZB5A 4RCXA 2QT3A 1HT6A 3ICJA 4DY1A 4L6HA 3QFEA 4HOXA 3PUOA 3VNZA 1GQJA 4WX2A 1UWUA 1QT1A 5HANA 5ABFA 2NQ9A 2FH6A 4GPNA 1B3XA 4GXPA 5H6HA 2VGBA 1CBGA 3WNKA 1C7TA 2WPBA 2W91A 2PGRA 5GNYA 3UZ5A 3VGDA 4HNLA 3RRXA 2YBVA 2PURA 4FR1A 4MZYA 2CLIA 4PBFA 1Q6QA 1IWAA 1DJZA 2VTFA 1A5KC 1LL4A 2XIMA 4JFSA 1ITUA 5HQMA 3ABRA 1MUMA 4LS2A 1IGSA 1FY6A 4UOQA 4YJ5A 2YLLA 1M04A 2D23A 3BTNA 1QHOA 3G1VA 3NIYA 1OX5A 3V4BA 3RDKA 2JE8A 3SQLA 2OXNA 2RFGA 2PFHA 2PDUA 1ZJBA 4LU0A 1I9CB 1VYRA 4KETA 2I1OA 4OJ6A 5TD4A 3MS8A 2J6VA 4PE8A 1EA0A 4XZBA 4ZB0A 2CWXA 3NQBA 1BF2A 4LF2A 3CQHA 5FSEC 2JGQA 4JYEA 3T2QA 1EKOA 3WH8A 2YDSA 4AVOA 1U5HA 3DFSA 4AD5A 2TSYA 2D1ZA 3W1MA 4JNYA 1W1YA 4RPQA 1RUSA 2OZ8A 1E6RA 5A6SA 3CV6A 5DMNA 5D04C 4GZ7A 5CBIA 5G5IA 2GQ3A 5E0FA 2D0GA 3GD6A 5D2YA 1TV7A 1M03A 3VDBA 3HONA 2GJRA 4KEVA 1X96A 2YGYA 1XFCA 1SQ7A 1LQAA 2JK2A 3AIQA 4HMDA 5K4ZA 1XUUA 5D02A 4W8AA 1R2SA 3WFAA 3VUSA 1R7OA 1PKLA 4LB4A 2Z2AA 4C6EA 2YX0A 4UCGA 1ISXA 1WCGA 4F3HA 1W5OA 1UUQA 2INFA 3DFTA 5A8QA 1R3SA 3P93A 1XLCA 2MUCA 4JTTA 2UY3A 3SRKA 5A8PA 1C29A 7PTDA 4JS3A 3BQ5A 1BYCA 3CIWA 4MJZA 2GVEA 3PN8A 4MWAD 3B9OA 4KCTA 1K8ZA 3TTSA 4E8DA 3MUCA 5CJMA 4FMVA 4OE7A 3S6TA 3FIGA 3N1AA 3U9IA 3NFUA 1L9WA 2A1YA 4FK9A 4A8IA 4ADSA 3SCSA 3W1TA 4AFYA 2R6OA 1CZ1A 1XIBA 2FB3A 3DERA 4XZHA 2QW5A 2OZ0A 2OO6A 3CUXA 2XIQA 4EWND 2WVVA 3A22A 1PEZA 3NQGA 1CYGA 1EP3A 1HIZA 4GCAA 1ED7A 2H3BA 3QQ1A 3WDPP 3P74A 1H0GA 1OHLA 3AISA 3VGGA 5E5CA 2CXEA 4S38A 3F4CA 3MO7A 1BFNA 3IVSA 1E0VA 3W84A 2QIWA 1R3YA 3ARWA 4LCSA 4IFKA 1GPFA 4UTUA 1K7FA 1Q6GA 1JPHA 1BLIA 1ONWA 2TRSA 1LUCA 5LIWX 1XBVA 2CITA 3C2EA 1BTMA 1RJPA 1TCDA 2HDJA 4LUTB 4GI4A 2WQPA 1TPWA 3TQPA 3EX3A 2DT2A 1ZU8A 1GVFA 3G1AA 2R94A 3BLLA 5C2XA 3LPPA 2ZWYA 1O1ZA 1UKPA 1KKOA 1PZ1A 4GI8A 3U2OA 5E0KA 4ROQA 1M01A 4NAEB 4P2VA 1X39A 3AIVA 3OA3A 3U48A 2CLKA 1BWVA 2PS2A 2SFPA 2CYGA 3SGUA 3BJFA 3D47A 4GUJA 3FW6A 1YE6A 1UYQA 3AIBA 4AZ6A 5TBOA 2HJPA 1F8MA 3AZTA 4I9JA 3GG0A 3JZEA 5KINA 3D5HA 3BXWA 3RAOA 4US6A 3OZOA 4F9DA 1XH1A 5EY5A 3M0IA 4MJ4A 4PZVA 3ELFA 3MSGA 4QEHA 3NZ1A 2GYIA 4OUEA 3FAWA 5EGRA 1UOZA 3WF2A 4YYFA 1AW1A 4ZODA 4XG1A 1FHUA 2QHAA 3B8UA 3BJSA 4H9YA 5LA1A 5D30A 2OJPA 5LNVA 1W54A 4F79A 1VFHA 3CLMA 4FO4A 2JALA 3MCOA 3FYOA 4MM1A 2Y6ZA 1FHVA 3LXCA 3NQ2A 4H2HA 3STFA 5HQLA 4G7EB 4BQ3A 3TLQA 1PVNA 5AHMA 3GU9A 3U2CA 2YCLB 1JDCA 1K9TA 2DJXA 4S2CA 3VDCA 3GXTA 5HR7A 2XFYA 1R5YA 3HGSA 4NQ1A 3MV11 1QAPA 1Z48A 2NV1A 1OZMA 2GDVA 2HBVA 3GUGA 2PRMA 4TVCA 2XFWA 2B7QA 4XAGA 4H04A 3UJEA 3GAKA 2ZUSA 2GK1B 4DUWA 1Q8JA