4NZ4A

Structure of vibrio cholerae chitin de-n-acetylase in complex with 2-(acetylamino)-2-deoxy-a-d-glucopyranose (ndg) and zinc ion
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
403
structure length
403
Chain Sequence
PKGTIYLTFDDGPVNASVEVIKVLNQGGVKATFYFNAWHLDGIGDENEDRALEALKLALDSGHIVGNHSYDHMIHNCVEEFGPTSGADCNATGNHQIHSYQDPVRDAASFEQNLITLEKYLPTIRSYPNYKGYELARLPYTNGWRVTKHFQADGLCATSDNLKPWEPGYVCDPANPSNSVKASIQVQNILANQGYQTHGWDVDWAPENWGIPMPANSLTEAVPFLAYVDKALNSCSPTTIEPINSKTQEFPCGTPLHADKVIVLTHDFLFEDGKRGMGATQNLPKLAEFIRIAKEAGYVFDTMDNYTPRWSVGKTYQAGEYVLYQGVVYKAVISHTAQQDWAPSSTSSLWTNADPATNWTLNVSYEQGDIVNYKGKRYLVSVPHVSQQDWTPDTQNTLFTALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of chitin oligosaccharide deacetylation.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Hydrolase
molecule keywords Deacetylase DA1
total genus 147
structure length 403
sequence length 403
chains with identical sequence B
ec nomenclature ec 3.5.1.41: Chitin deacetylase.
pdb deposition date 2013-12-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.90 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4nz4A02
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 4nz4A01
2W3ZA 2XU2A 1W17A 2E67A 3RXZA 2CC0A 4M1BA 4WCJA 2Y8UA 1V6TA 3HFTA 3QBUA 1W1B1 2C1GA 2J13A 4NYUA 4F9JA 4NZ1A 4NZ3A 2NLYA 3CL6A 2C71A 2I5IA 3WX7A 2C79A 4OUIA 2DFAA 4U10A 2QV5A 1NY1A 3VUSA 5JMUA 5BU6A 2C1IA 1W1A1 4L1GA 4NZ5A 2IW0A 3CL8A 4NY2A 3CL7A 4NZ4A 1XW8A 4HD5A 4NYYA 4V33A 4LY4A 1Z7AA 2VYOA 3S6OA 4F9DA
chains in the Genus database with same CATH superfamily
1EEPA 3MO4A 1L8NA 1ADSA 4DQWA 3SIMA 3UETA 2MANA 2AOSA 3N2MA 4H4IA 1CGYA 5CGQA 4R27A 1E6XM 4A21A 1RBAA 4E2OA 3DI1A 1FFQA 3GH7A 3KEHA 3ID7A 2RKXA 3L27A 4AAJA 2DQXA 3UP8A 5C9XA 3HFYA 4XTDA 2XDFA 1KFWA 1KCXA 4QIUA 2EPLX 4FALA 4DB7A 5E9AA 4AZHA 3NPVA 3PBWA 2PZ0A 1W1PA 5GPRA 1VC4A 2IPGA 1U5JA 3EA3A 4QLKA 4IH3A 4OJYA 2Y2GA 2CZFA 3BOXA 2XVPA 3A3XA 2ZTKA 2BS9A 1VFUA 4AZBA 4KCVA 5D37A 4O19A 4GO9A 4XVDA 1F3WA 4ZB2A 1VYPX 1UWUA 1JIBA 2Y5JA 1XBXA 1FOBA 4DRSA 4GGBA 2BTMA 2TSYA 1KM1A 4F40A 4UOQA 5RUBA 1JDFA 2ZXAA 2ZUMA 1V02E 1F4HA 3Q65A 3EDKA 1DWFM 1VLIA 1ITCA 2PBGA 1IEQA 3TYEA 4HMDA 3VIFA 1QI0A 3CUFA 3NL5A 1OFBA 3SRHA 4M8UA 1FBAA 2PTZA 1X97A 1Z42A 4PR4A 3M4HA 2YCLA 3NYDA 1UR8A 4CEXC 3V16A 3LCGA 1KGXA 4KWWA 4JIRA 4BF7A 5FJJA 4DO7A 4Z1CA 1IWPA 3W2MA 2WMJA 3FVDA 3MO7A 3UZWA 1XIDA 1P0NA 4GZEA 4U5IA 3T2OA 5C2GA 2BASA 2E5CA 2E7FA 3DFYA 4R7OA 4UTTC 3QZAA 1F5ZA 2G4FA 4MADA 2DW7A 1FWHC 3P5ZA 1J12A 1EHAA 4DJFD 3HA1A 2QR6A 5DT5A 1SJDA 3BLPX 1E3XA 1XFBA 5EMKA 3KHJA 4DPQA 2FDSA 3TSBA 1IE7C 5HWMA 2Y1HA 1PIIA 4F8XA 1UIOA 2QEZA 3MKVA 3TW7A 4PL1A 3W1AA 2RDTA 4PEEA 2NZLA 3M44A 7TAAA 2G95A 3SSJA 3N9RA 3K4WA 4JL1A 3IGHX 2OWCA 1X7FA 2XYLA 3BPWA 3UWVA 2ZBTA 1W5NA 1RXOB 2I57A 2VD8A 2QCLA 4RNFA 4QROA 1O4UA 3CQ0A 4DBEA 2E67A 3S2CA 1W3JA 5FJOA 1I1XA 3QBUA 3B8SA 1FWTA 1PE1A 4J40A 4HSHA 4AB4A 3PFMA 2ZZ4A 3H4GA 5G1MA 3DYPA 1JEZA 4RW3A 1E6NA 1Y7VA 4R3UA 2PP1A 1WZLA 3EWDA 4J27A 3CUXA 3TCEA 3VMPA 5BOEA 1VD6A 2WKLA 4ADSA 4WY0A 3VD5A 4MNJA 2E9BA 2FIQA 1F6YA 3AHYA 5LIUX 1WUFA 3RX2A 4B4HA 4UCGA 1HN1A 3FHAA 4M6QA 3ERPA 3GC4A 3L26A 3BQ6A 2JKEA 4L6OA 4ZQPA 4IUGA 3PC0A 4FEZA 1XIGA 1XBZA 3BK0A 4WGHA 4GXWA 1C8XA 2EO7A 4AEOA 3J7HA 1XBYA 4NNCA 3DFPA 3M47A 2F7FA 3UVAA 2J7EA 3OBEA 1WQ5A 3CQHA 3VMNA 1TMLA 2X7WA 4NX0A 3PPCA 3KS6A 4AY8A 4ZO9A 5DT7A 3WLRA 2J79A 2CBIA 3GNXA 3MQLA 5FEZA 3WNOA 1D8CA 3SR7A 3PSWA 4GHRA 3WQ5A 3EKGA 4ZSUA 2DIKA 1LLOA 4RDVA 3KRUA 1MXSA 3B0VC 2BSLA 4JKLA 3S42A 3HURA 4CVWA 1WP6A 4WVXA 2NVCA 4Z42C 3E3HA 3ITLA 4E38A 3VOGA 4I9JA 4YCOA 2MUCA 3P2VA 1Y5VA 2CLHA 2O7SA 3BTNA 5A6LA 4TX8A 3GKFA 5FCZA 1HNYA 6XIAA 1M7JA 1GQLA 4KKXA 4X2RA 4O17A 2VX7A 4OFCA 4CQDA 3ZJ8A 2HVMA 3DUGA 3WD3A 3KBWA 1TTJA 1XL9A 4I6KA 2X1TA 4IMEA 4D6FA 3LI1A 1R3TA 4K8EA 4XZMX 3OYXA 3T07A 1ML1A 3WQFA 3GWQA 1IGWA 5AC5A 3O9NA 1UH2A 4NSBA 2YDRA 4A6GA 4JQ2A 3WH5A 4YIWA 2UWFA 1AA1B 1V0LA 2QQ6A 3HGJA 3MP5A 4W85A 5AZ0A 2A85A 1UKPA 4DWSA 1NDVA 5FD0A 4W84A 1RPXA 3R7MA 2BGQA 2ZC1A 2ZKMX 5K2ZA 4LEFA 5BXSA 1VBRA 4JTDA 1RQEA 3WD4A 3LPFA 2Y7EA 4FNRA 4AEFA 3EMZA 1MUCA 5DMMA 3WLSA 4CD5A 4QLLA 1Q8JA 4CD8A 3ITGA 2OGJA 3MJYA 3MC5A 1QT1A 3M43A 3RNDA 4RL3A 2DSZA 3BLLA 4DJDA 1K9EA 3BAKA 1H5YA 3BUVA 3CGTA 4OGZA 3LZ3A 4TTGA 3W7LA 2BGSA 4FI4A 1GVOA 1ESWA 4ZMGA 2BG5A 4DJDC 3FJLA 2GJLA 3SADA 3VGFA 4OQVA 3G0XA 4JHZA 3NL2A 4G1NA 4S2CA 4JOMA 3WDHA 2VR4A 2P3ZA 1J11A 3BOLA 4JXCA 1WNOA 4NL1A 5KZ6A 4BA0A 1KBBA 3F2BA 1BTCA 4EOUA 1ZUAX 4FNQA 1AVAA 1KC7A 2YCIX 4DBSA 5EBUA 4O13A 1TPDA 5FSDC 3WUBA 3N4FA 4WDXA 3W4RA 2L5HA 5HR7A 1YKWA 4DM2A 4PC8A 4UTMA 1B9ZA 1X1ZA 3WLOA 4LUYA 1ZAHA 4DJEA 4JHOA 1GJWA 4IJBA 4J1OA 1TE6A 1KWKA 3VC6A 2WM1A 3TWBA 4N7QA 4ZGYA 2XWEA 1M9HA 2P3EA 3O05A 4ROQA 1FWDC 3VOIA 5A3HA 1F8IA 2DIEA 1DJYA 4Y8FA 1W17A 1B9BA 3ALFA 3HU7A 3Q45A 4B5UA 3JVAA 1HKVA 3B0PA 1VFTA 4W93A 3RLUA 2GWNA 3R0DA 3WFLA 1LL7A 2ZX7A 4OIFA 3HGOA 3MCNA 1UWSA 3M0KA 1I60A 2BXZA 3SFWA 3QGKC 4GI8A 2B31A 3G5EA 2E6AA 4AVFA 5K9CA 1DYSA 6A3HA 1VFHA 1YLVA 1KM4A 3K46A 4TVDA 3RFAA 4D6CA 1GQKA 1B3OA 4DZHA 5BOFA 3QRHA 1QNOA 2PWUA 2WCGA 1UR1A 3PPGA 2V3GA 2A3CA 4BY3A 3I3EA 3B3DA 1YU1A 1EIBA 3WDRA 2Q09A 4V1YA 1ODZA 2PDBA 1DQWA 7ENLA 2DSKA 3A6OA 1XLJA 2ZVIA 4NZ5A 1DTNA 5KZMA 3WQEA 2UV8G 5EFFA 4L64A 1DIEA 4C6PA 3LRKA 1ZHAA 1K3UA 4P8VA 4LPCA 4QDPA 3M41A 3CPGA 1ISVA 3EB4A 3S1VA 4C5ZA 1PTAA 2YZ5A 3GDKA 1E43A 3W38A 2VFIA 2A7PA 3GYEA 1MRAA 2IQDA 2ZRZA 3FYOA 4AD5A 3WK2A 5BW6A 3DYOA 2AMGA 1QPRA 3VDAA 2QAPA 5AFDA 3BARA 3B9NA 3V1PA 1IZKA 1OC5A 2A7RA 2DIJA 2OO0A 3WO8A 1BWLA 5K4XA 5G1TA 3M16A 1S3TC 4AZ7A 1GVIA 4LRSA 5EMLA 3URNA 1PCKA 4JFVA 2RHGA 3PFRA 3W3OA 4P61A 3VKJA 2YYUA 1PKNA 1JNEA 3B03A 1MI3A 1RVKA 1Z44A 2PODA 2ONEA 3JS3A 3QM3A 4GJIA 3BLEA 4S3GA 4AW7A 4GZ7A 4BWLA 1K4HA 1R3RA 1K6WA 4UTTA 1EJUC 1VCGA 3UD6A 3LHVA 4RXGA 5I0DA 2YW3A 4QR6A 3DN5A 3OZYA 3WNNA 1GQIA 3OA3A 1ZB5A 4LC8A 2HVNA 5DF0A 3R89A 3BL3A 3OEXA 4AIEA 4GD0A 2JQXA 2QCHA 2ACUA 4PA8A 4YVXA 1NJJA 3B8VA 3R5EA 1J4EA 4P7LA 4AWSA 2OEMA 1D3GA 2CBUA 5TD4A 3ZR5A 3PB2A 1QW7A 1GVQA 4BQ3A 4CNPA 2VGIA 4REQB 3W7KA 3A4JA 2WC4A 2DSWA 2Q8XA 4DZIA 1XYAA 4ZCWA 5EYWA 3RF9A 2F6UA 1V6YA 3MVTA 2OKOA 3PN8A 5KTLA 2W4XA 3GHUA 5LZLA 1IV8A 5I3GA 5HNRA 2O0TA 3LXCA 4DX3A 4PUDA 3PK7A 1CNVA 2OLSA 4X0NA 4C1NA 2FH8A 3L23A 1GKQA 4O4WA 4MTVA 3PPFA 4LUIA 4HBKA 4H7VA 1DHPA 4NF7A 5AYXA 4AIOA 1EOMA 5DRCA 2ICSA 3AIWA 3PNUA 4C6OA 1VCVA 4NZ4A 1CXHA 1C29A 3E6EA 3LBOA 4K36A 3BC9A 5A6MA 4Y9AA 4GC4A 2OSYA 1QNVA 3IJDA 3N1AA 1H1NA 4DI9A 4BKNA 3GTNA 3DI0A 5LHEA 2PU0A 1OD8A 3GW3A 2O56A 2OOGA 1LROA 4HD5A 4AIBA 1JYWA 1SFJA 2GK1A 3H53A 2CKRA 2IQ0A 4Q4OA 3PUEA 4AZGA 4XUYA 1QNQA 1FHUA 1RY0A 4QNWA 3W23A 1Q65A 1S2TA 2JKAA 3DFNA 1XG4A 3N3FA 1EEXA 2F61A 3FJ4A 3LERA 3QC3A 3KOYA 3WFZA 3SN4A 4JCLA 4K37A 5DFAA 2QMKA 3I10A 1JZ8A 3W1PA 3OBAA 1L6YA 4JKKA 4N0RA 4DLFA 4L4LA 4D6IA 3FAWA 3EKZA 4F0SA 5C7HA 4XIMA 1LOSA 5LIYX 1TREA 4MDPA 4Y6GA 1D8WA 4KF1A 1YW1A 5LXXA 3RHGA 1AZ2A 2Y2OA 3KCLA 3ZS4A 4XX6A 2E68A 3BGGA 2XGBA 2OCZA 4E5TA 1YBQA 4IX0A 3WJXA 1EQCA 3WLLA 4QDMA 4LVDA 2GK1B 2Z6IA 4DVOA 3TJIA 1HJSA 1HQTA 1LWIA 4FXSA 5CZ0A 3RR1A 2XIIA 1HJQA 4QSHA 3K4DA 2CFFA 3FW6A 4AMCA 3R6IA 3KUMA 5JUVA 2C79A 4DM1A 2OYKA 4UTWA 1TQJA 3FYPA 2QZRA 2ZUUA 4KRTA 1NELA 1UUOA 4IBCA 1V3LA 3IVUA 1YMYA 4RXFA 1E55A 1V3KA 4CNUA 2XD1A 3BCDA 1OADA 3PWIA 3ABQA 4YN5A 3AYTA 1HVXA 4PUMA 3UG3A 4A8NA 3R11A 2PDQA 2HK1A 3BJFA 1GQJA 1R0MA 4Y9MA 1DXEA 3WLNA 4DLMA 1FX6A 1HT6A 1P0KA 4JD4A 1Z48A 2EG7A 3ARRA 1MW0A 4LF1A 5T26A 1K8CA 1V6UA 3IIOA 4MZ1A 1YPFA 4JTQA 5D2WA 4B9YA 3K2GA 4C1LA 4YMZA 3MMTA 1A5NC 1QPKA 3NQDA 6XIMA 3IIZA 4C7FA 1OBAA 2CHRA 2XN2A 3SN0A 3TMQA 1PIFA 1QPNA 3B4UA 3VKBA 4IBKA 4KWOA 3AXIA 1XLFA 4MDOA 4EXAA 3EWUA 4C7DA 5G2HA 3GNNA 3AIVA 1HP4A 2YBUA 2F6XA 3IIPA 1UKQA 3ONCA 3UCDA 4WJXA 2ESCA 2Z29A 3MUAA 1EDGA 4YXGA 4UFHA 1JDDA 4HK7A 1VS1A 1CX9A 1TV8A 2B4GA 1QOXA 2PDJA 1XIIA 3U0HA 4AQLA 3NZPA 1KTCA 4NJJA 1BSIA 4MNMA 1YTDA 1PB0A 3PY2A 3URAA 3MBDA 2YL6A 4P8XA 3B04A 3UCQA 4AISA 4HYVA 1AW5A 3ZZ1A 5BRQA 1W3TA 1RCOB 1XRFA 3EWBX 4NXKA 4IBJA 2PWDA 3TN6A 1BYBA 5KITA 3UR8A 3S2JA 3T0DA 2E5BA 3TNOA 3GLCA 4WKHA 2FHFA 4I5RA 4EPKA 3RPTA 2BHZA 4EXBA 1JD9A 1A0CA 1US0A 3OHIA 1Q5MA 4MHBA 4PFHA 4OTKA 3V35A 3DC0A 1OF8A 1KKRA 4HZ7A 2NV9A 3T40A 3WCZA 1J0YA 1EJVC 3V7PA 4HTBA 5HWNA 4FIRA 3QKZA 3AS1A 5AB3A 1OFEA 2GGIA 4CQ9A 1VBHA 3W02A 3E0VA 1I0BA 1E9ZB 3XINA 4CN6A 1IIGA 5T9BG 4Z17A 2PD9A 4CU8A 5DN1A 2GJPA 4U28A 4ES4A 4Z2JA 5D03A 4E0CA 5DMLA 4H9MA 4GZIA 3S6TA 2KX9A 2Z1KA 2J47A 4OUEA 2FVLA 3AO0A 4UMBA 4UR8A 4Q7IA 4OBTA 3N2TA 3RM4A 9CGTA 2E6DA 5C6MA 5C0QA 3IRSA 2TPSA 3GTFA 4RV8A 3HJEA 1UWRA 3L25A 3SY1A 3VOJA 2PDMA 3VCCA 5CPTA 3IJ9A 3ZVHA 4AYSA 3NM3A 3NDZA 4EKJA 1UR9A 1LM1A 1HTIA 1GPWA 1A50A 3EB3A 1EPXA 2IXVA 3F2CA 4CN4A 5ECVA 1XX1A 4Q8WA 4S2BA 5I3KA 2ADAA 5CC3A 3EZ4A 2BGNE 4UMAA 4PCTA 4PMDA 1DEDA 1EJRC 4FA3A 3IS4A 2HZGA 5LNUA 1J79A 4MKSA 4MWAA 1V93A 3TFCA 1V4YA 4JX5A 4WSHA 3GR7A 3GC2A 3NQ7A 2ZA1A 2WMIB 4EF8A 3VIJA 5EY5A 1V77A 3W86A 1UG6A 1WKEA 2ISSA 4K3ZA 4W5ZA 1KCKA 1O6IA 4QE4A 1JVNA 2FDMA 3L4VA 4E8CA 4ZQNA 3UW6A 1MUWA 4O1FA 1BEUA 3VE9A 3I6RA 3TROA 2REQA 4FLQA 3VNKA 4EWJA 4KFPA 3AFBA 4QG9A 5E0CA 1O60A 3FEQA 3THDA 2AKMA 5D2VA 4G9PA 4JEQA 3QR0A 4MB4A 3WQWA 1K6AA 5I06A 1UH4A 3DAQA 3UGVA 1V3HA 1PX3A 3WF4A 2J88A 4G8TA 2PUZA 8CGTA 2OZ3A 1Z6KA 4QEEA 1KM2A 4ICMA 4YWIA 3NAVA 2R1PA 4W89A 5AC7A 2W66A 2YJQA 4I90A 5J04A 4KQNA 1HW6A 3A5VA 3IJLA 3MANA 3FEMA 1K77A 2YR1A 2ATSA 2Y2IA 4H8UA 1DJQA 4DJDD 4AC1X 4MG4A 4RPQA 1UC4A 1YDYA 4MYXA 1VHNA 4DF2A 1FRBA 1P0EA 4DJFC 1SO5A 2PDNA 1XQLA 3NQ8A 4XV0A 3I6EA 3HFTA 3AIQA 3PPHA 4WZHA 5G4EA 3IV3A 4Q8MA 4MY1A 4PCSA 1G1YA 1X1NA 3W1QA 4KEUA 4UC5A 2WMHA 3ANVA 3HQ1A 2J9XA 4DI8A 4JZ5A 4EPDC 1NWTA 3TXZA 1XKYA 4JTUA 4LCRA 5LKYA 1DJXA 1UWTA 2PI6A 4WXZA 2XVNA 4B16A 4EAYA 3VNMA 4KEVA 1J0KA 1NQ6A 1P1MA 1R3VA 1X39A 4AHQA 3LXAA 3UR2A 1PWMA 1W1A1 2XH4A 3LHYA 2W27A 3UPBA 4FZIA 3HV9A 2FFCA 1K9TA 2G96A 4CNTA 3AXKA 2O9PA 1YEYA 2PTYA 4XAGA 4PYSA 3DKJA 4MKNA 1JPHA 3APTA 5LGXA 3D3FA 1G4TA 3F4VA 1YQ2A 4NAFB 4M1RA 3CLMA 3K13A 2WVUA 4OBRA 4FX8A 1QFEA 2PCEA 4IQLA 4H00A 4R7WA 4BFAA 2JGYA 2G3JA 1HO4A 1DWJM 1FWBC 3TCSA 3MI2A 1BXBA 1HL9A 4W8AA 3EBVA 1PKYA 1E0UA 1ZFJA 1GVRA 1C7SA 4HN4A 4O10A 4Q32A 4LANA 2VEKA 4HA0A 2BVTA 2AKZA 3BV4A 3H7RA 4G1KA 1JGIA 1XF0A 4M6PA 1JZ7A 3DDMA 5AN7A 2GVGA 2J13A 2NVAA 4GFSA 5GJPA 3QC0A 5BPVA 2QCCA 3W72A 4ZXLA 2P0OA 1XYCA 1S2VA 9RUBA 3IGUA 5CGMA 5BOOA 4Q4KA 2Z24A 4Z2IA 1BAGA 5DCDA 2QT3A 4IMAA 4WDTA 4RZ4A 3RYSA 1KCZA 2C18A 4AG0A 2RGLA 4JPGA 1WOAA 4XQ6A 3WL0A 2ODOA 3ENLA 3MHGA 2ZXDA 2RDWA 1PKMA 3FN9A 3ZR4A 3UXAA 4AD2A 2JALA 1JZ2A 1SPQA 2VFGA 3OG2A 4W86A 4TV5A 2DH3A 1K1DA 4PUEA 4V27A 3NZ1A 3EWZA 5JQ9A 3VABA 1S2WA 2WNWA 4QJ1A 3LBCA 3HMJG 3LYEA 4ZQCA 3WH9A 4R53A 5IM51 3GR4A 2OU4A 1ZP3A 3KLKA 4W5UA 1CGTA 5AYYA 3TAKA 3WJWA 3KWXA 2WW5A 3WELA 3KM8A 4UQBA 2XVLA 1E8BA 1H7PA 4OKDA 4NY2A 3GHSA 3IV8A 4BI6A 3H2CA 3MYOA 1AD1A 3NQBA 4PBFA 2CLPA 3U5UA 1QDSA 2ACQA 5GNZA 5KEZA 3EX2A 2J66A 2CLOA 3A13A 1JRBA 3W76A 4C91A 2WLZA 1GJPA 4HQVA 5C2XA 1SO4A 4UFMA 3BAJA 3SCWA 4WDUA 1WO2A 1CGVA 2E9LA 4LTSA 3GIQA 4UZSA 1NIUA 3C2VA 4PTVA 3R8HA 1QI2A 2XFFA 2PD5A 1Z41A 4Z08A 4A3QA 4AY1A 2B7QA 3UCCA 4I3GA 3EDEA 4JFWA 4KRZA 2P1FA 1NAL1 2E0PA 3L2IA 5JVLA 3ARPA 3WNLA 3PF3A 3PZOA 1LLZA 2YDQA 2PTWA 2PWGA 3VILA 1C7TA 4NILA 4HHMA 1E6RA 1JCJA 3CIVA 1IXPA 3H4WA 3H4XA 2G37A 2A21A 4HK6A 2Y5EA 1HX0A 1RY8A 1KBJA 4YYFA 3LBMA 3POCA 3KL5A 3CS2A 4NZ3A 4OUIA 1WDDA 4HYRA 2QCFA 3G0SA 4PBGA 1WPCA 5LNSA 4HJWA 1XR2A 2PDUA 4B5NA 3DG3A 3HPFA 1SO6A 5MF5A 2V68A 3H12A 1TELA 2X2GA 2Y2HA 3QQWA 2X1UA 4IM4A 1V6WA 1WZAA 3AAMA 2VL4A 3S2LA 4LAMA 4GGHA 4LH8A 2QDDA 5I3FA 5CZJA 3SSZA 1AMYA 1QVBA 2BHYA 4DXKA 3UWQA 1HXJA 2GGGA 1YNQA 3MV11 3KFTA 3CH9A 2ZZ6A 5I7GA 3W26A 1OX6A 3BCFA 4UNIA 1XICA 4MOZA 3F5JA 4GNJA 3SQSA 2WQDA 3N12A 2PDIA 3HM7A 3E5PA 3PANA 4GG9A 3SW6A 1F2JA 4JQ4A 3M5ZA 4ILSA 3USBA 3CIXA 4LS1A 4QRNA 5D8WA 2BP1A 4LB4A 4GMEA 4HT3A 3MDWA 1UMLA 3RPDA 4Q6XA 3T8QA 4MAVA 3SEPA 4AD4A 2AQVA 3GU1A 2A5HA 2OYLA 4LUTA 2GQAA 4YCPA 3VPLA 4JEJA 4L80A 4JTFA 3VIHA 3BLIA 3G8EA 3W9ZA 1OB0A 2IKIA 4KEZA 3WLJA 2IXUA 4D6JA 1TJ0A 4ALDA 3PZUA 3UXKA 1KR0A 1E0WA 4IMFA 3IANA 4JQ1A 2D0HA 1TJ2A 2X8RA 3HGRA 3CV7A 1OT2A 5AHLA 1KLZA 5F7UA 3CHFA 2XM2A 3DOPA 4HHHA 3W7EA 3GG8A 1JDCA 1JXJA 4O1DA 4AWTA 1I9CB 4UQDA 4CNOA 2VCBA 4YLWA 2VXNA 3PBMA 3UBPC 4A05A 2D1ZA 3WMBA 2IUZA 1GOMA 1QXLA 3H2NA 1BFNA 3QMRA 3HB9A 4U5KA 3W01A 4P7RA 3RRXA 1ME7A 5HQLA 2FFIA 1BVZA 2HE5A 6REQA 3LPPA 3NSXA 3WEZA 4E2DA 5ABFB 5FIPA 4DO6A 4NI8A 2YCEA 1LBLA 1Y0EA 1I2NA 3EGJA 3IUIA 1TV4A 2CHNA 2VCCA 3RM8A 1CLVA 1KRAC 4H01A 3FA5A 2CPUA 1ZJIA 3RN6A 3L12A 2ZRYA 2DDXA 3EAUA 3WQDA 5LHFA 4IIDA 1VEPA 3TWAA 2G3IA 3T05A 1QCWA 3VD4A 3FNDA 1QO6A 1V03A 2XD5A 1EP1A 1F74A 7TIMA 3QJAA 4DJFA 2VC9A 1W1ZA 1EFZA 1H51A 3GBEA 1R7OA 1UB3A 1EDTA 3P6LA 3POHA 3CWNA 5BMWA 1B5TA 4FB7A 3AIBA 4GE8A 3OO2A 1LRNA 1UWAA 1GOQA 3VIIA 1KLYA 4H6KA 4HOWA 4H7CA 4ZB0A 4UTFA 5A8OA 1D2KA 2ZX8A 2KZHA 1V6VA 3GTHA 3H7VA 4D8LA 3UF9A 4J4KA 4HKPA 4ML4A 2ZRXA 2R1LA 4WUIA 1HJXA 1O1HA 3VIMA 4DYEA 4F3HA 4F0LA 1H1ZA 4J5NA 1RSCA 2ISWA 3P14A 1JDEA 1EUNA 3DFHA 3M9YA 3PBUA 4JR5A 4QISA 3KW3A 1JCXA 2GWGA 1O5QA 4RKAA 3CWHA 2LLEA 2XHYA 1BVWA 3AC0A 4GJ1A 2BVDA 3IJ7A 3NVTA 4UFLA 1CENA 5LNWA 1H11A 5FAGA 2WJFA 1WE5A 4D8AA 2FVKA 2E6YA 4U4MA 1TVNA 3M0HA 1S46A 4PFMA 3IWPA 2W92A 3V75A 3T8LA 1XD1A 5U7SA 1FKWA 3G1XA 3GXIA 3G6MA 2GQ9A 3MZ2A 1ELSA 3ARVA 2BOEX 5H2ZA 3KDNA 3HQPA 3FV9A 3WDJA 5C55A 4DJED 3QY6A 3C2YA 5DXXA 1J10A 2IOUA 1XXXA 4DXVA 3PZGA 2Z00A 4ZO6A 2C14A 2WMGA 2A3HA 2PP3A 1G7UA 4S3CA 4A22A 5M2FX 4EXQA 3QEZA 2YFNA 3GG0A 1PZ3A 4Q4QA 3THQA 2OFJA 3LS9A 3SBFA 2PLCA 2H6RA 1BKHA 3QHOA 2X41A 2D69A 2OLAA 5IRPA 3BLOA 2Q6ZA 4QTGA 5EMMA 1CXKA 3N2BA 2V38A 4GQ0A 2WZEA 4HHLA 1R9ZA 3C0JA 4UFIA 2YL8A 3WYZA 3FVMA 1XLAA 3L4XA 3SZ8A 1LUCB 3S2NA 4UOJA 4PMXA 4UTWC 4N9EA 4HZMA 4AF0B 3BQ5A 3RU8X 1W9VA 3RCYA 4E2VA 4F0KA 5A8PA 1CEOA 4XAZA 1QR7A 2AGKA 4OJ6A 1DKWA 1XG3A 3LPOA 4Y96A 1LG2A 2TAAA 1MMFA 3R4IA 1PYFA 2EHHA 2ZUWA 2VEIA 1VGAA 3TN5A 3PZQA 2OWXA 1RR2A 2Y8UA 4QE1A 1HO1A 1E9IA 2Y70A 4BF5A 3TV8A 1ZJBA 1BXNA 3BSGA 1BWVA 2WCSA 4PTNA 4W8LA 3VTRA 4GYPC 2G41A 3MHFA 2GJXB 2VJXA 3W27A 3NL6A 3B8WA 3W1MA 3IAQA 3ABZA 4J3XA 5D32A 3B8IA 4B91A 1UCWA 5MKGB 1KQZA 4XZNX 4QG6A 3N73A 1CXWA 4ZQOA 5D2TA 4M6UA 4EAMA 5HXMA 5HUPA 1XIHA 4PMVA 4U2ZA 3N18A 4HIBA 1U1HA 4S23A 4DBWA 1H7RA 1E1CB 1UD5A 4AZIA 4CQ8A 4Q4PA 2WAGA 2WJDA 2WV8A 5DRIA 4AZ6A 1MEHA 2W9MA 1W3KA 4AU0A 1W9BM 3AJXA 3UVIA 1HJWA 4HZ8A 4MMWA 1LYXA 3QZEA 4PTWA 1IGSA 2BVYA 3K1GA 4CKQA 4XVEA 1GOOA 3OLDA 3CAVA 3TQPA 3BJSA 4IPPA 1W3LA 4GWEA 2Q3RA 3NURA 4LJ3A 3GC5A 5E1QA 1TPFA 4PCNA 5CJMA 3MMDA 1BXCA 2QV5A 3WK1A 1F3EA 2WYSA 3CYVA 3RAOA 2V3EA 3CL8A 2CZVA 2Y2MA 1ZBWA 3ES7A 3QGVA 2FB2A 4J3UA 3VIGA 3CK5A 3QPEA 4PCFA 3T0BA 1W1TA 1X38A 2E1DA 1Q66A 3BAYA 2FFFB 3SCUA 4IP7A 3HOJA 3VUPA 2Y61A 1J96A 2GLKA 3NQ2A 3GDTA 3DFSA 1JYNA 5JBDA 2D49A 4NT0A 2GQ8A 4GNVA 1B3YA 1BTMA 4XIAA 1M5WA 3QR1A 1JL8A 1TVLA 2Z6JA 3AMDA 3TYZA 4MZ8A 1PKLA 2XH2A 1LUCA 2ON3A 4P7QA 3Q4DA 1OX5A 3GR8A 3PZTA 1JUKA 3THAA 1AW2A 4YL2A 3WMCA 1PJ9A 2QCMA 1E72M 1H2JA 4ZEPA 1AQFA 3BW3A 1TVPA 4H8HA 4XBKA 1E4NA 1QNPA 2GUBA 1ZL1A 4UQAA 1TWZA 4HNNA 3TYBA 5DBUA 3P7YA 3INPA 4RUBA 5FKYA 3TJ4A 3Q94A 5C9WA 2HEJA 3QPZA 7ODCA 3AU6A 2ATMA 2VRQA 1S1RA 1LQAA 2JK2A 1XQKA 3C2FA 1WBHA 4GRSA 1ZS2A 2B81A 4LB3A 1OFAA 3T0TA 3GXFA 4J2PA 3WQPA 3WSUA 1XJBA 4OV4A 1DPMA 3CQKA 1IEIA 3BCJA 2D23A 7A3HA 5BROA 2BY1A 4IBIA 3B4YA 2ZYFA 3F4NA 4CD4A 1J2BA 4B3LA 4BEUA 2NX9A 1GG0A 3UJRA 2QAFA 1KNWA 3S5SA 1SJAA 1PBGA 2WZMA 5T8GA 2VGFA 5IXEA 2V2DA 1X98A 3MUY1 3CPUA 3EYPA 3VD7A 4GK8A 2CXGA 4JICA 2OX1A 4HPJA 3VIPA 4BR1A 1EOKA 3UG8A 4GACA 2QUMA 4A29A 4JIHA 1JFXA 1JZ4A 1V3MA 3GRIA 3HQNA 4TUFA 2X05A 1QAPA 4GVFA 5HATA 4UUIA 2NLIA 1ZJAA 4R88A 2CLFA 3PZVA 2QPXA 4OOZA 1KGUA 4L1XA 3HPAA 4M80A 4GY1A 4K8HA 3M64A 1KXTA 4BCEA 2DUZA 3DHFA 2OSWA 4ZOAA 1QW8A 4N4PA 2A2IA 2CC0A 2NWRA 3M5XA 3LK6A 3N6QA 1T0OA 1SR0A 1AK5A 1W5OA 2HBVA 2PDYA 4KCUA 3R58A 2NUXA 2HMCA 3U6WA 1TIWA 3TXVA 1A5MC 4Q8QA 4HA1A 1XRSA 4U3CA 3MUIA 1H41A 4XZ9A 2OKTA 5I2UA 1A5KC 1XPYA 1DWHM 4H83A 4YPJA 1XIBA 3OLEA 4QAWA 5F2GA 2VC6A 3N4EA 3AZSA 3BSHA 1RJQA 4O0KA 1VPXA 1LDCA 3PUDA 4IGHA 3VGBA 3MSDA 3R13A 3V4BA 3HPZA 1E1FA 3AHTA 1XW8A 1XUUA 2DZPA 1TV7A 4URIA 2YLAA 2G0WA 2WC7A 1IYXA 6CGTA 4NG3A 3BO9A 1SZNA 3F7JA 4ZO7A 1E15A 5REQB 1KV8A 3OVPA 3UR5A 4GPNA 3UNTA 3G1HA 4IIFA 6REQB 1AQMA 4MJ2A 5BYWA 2GJRA 5A8NA 3CM4A 3CAQA 1JNDA 4DXXA 1TMQA 4M1BA 1Q2RA 4JNZA 3BV7A 4GNKB 1NOFA 2OPJA 1H60A 4UTLA 5E0KA 3VYLA 4NRSA 1XIJA 2UBPC 2HDJA 4KERA 3EX6A 3C5QA 1ZGDA 4L9YA 3TW9A 5E9XA 2EPKX 1QK2A 4LGXA 3LN3A 3L0KA 2JEQA 2ZZ7A 2I56A 1P5BA 1EBGA 1W3IA 5F4WA 1QI5A 2V5LA 4KESA 1UJPA 2YBTA 2BBFA 3FHQA 4Q4RA 1Q3NA 4EK7A 3PUOA 5FF2A 2OELA 2DZSA 4HN8A 4MY9A 5DANA 2VELA 3M6YA 3NZRA 3HG3A 2CYGA 3FX4A 4FIQA 4NKCA 3TC6A 1BG4A 4A8IA 5A2CA 3VGEA 2WHLA 4L4OA 1KRCC 2WVSA 1XIEA 3URBA 2VCAA 1HGWA 3GBDA 2PZNA 3KTXA 2YL9A 3ZO9A 3DESA 1W5QA 2Z1SA 1O5RA 3C3NA 2QJGA 2ZXQA 5FF0A 4YTQA 3P74A 4FLOA 1ISXA 1E0XA 3G6LA 5G5IA 1QATA 3TZFA 3I7SA 3W71A 1PVNA 4Q3MA 3SDOA 2NXIA 4ZE4A 4ZXOA 3GYCA 1YADA 1O94A 2J6VA 2VT0A 2GFTA 3S3GA 3CL7A 5D30A 3KLLA 3CUJA 2V3DA 4DAIA 4DUOA 1JQVA 2KAUC 2VWSA 1UKSA 3BOFA 2OO6A 1P1XA 3RMJA 4QS5A 4O1CA 1FQ0A 3QKEA 4H9UA 2E9MA 3OLIA 3NZGA 1YXCA 1PWLA 2ANUA 4S3EA 4PUUA 4ZQRA 1NFBA 1TPH1 1OZMA 2CCRA 4ZO8A 3LM3A 3EXTA 2I9UA 2OX4A 2V67A 2HJPA 2EKGA 2PTXA 3NOEA 3KL0A 1JG9A 3PUGA 4G7EA 3ZVIA 4ZODA 5I02A 1A53A 1ADDA 1A5OC 1H63A 1C9DA 4IQEA 3W7PA 3KTSA 1E0VA 1CXIA 5A8GA 3OU8A 3P0WA 1LRTA 4IBFA 2CLEA 2XISA 3C8FA 3W84A 3L5AA 1OCNA 2PRHA 3AS3A 1CYGA 1DWGM 3QQ1A 3W25A 4JTGA 1WXJA 2DPEA 2WPGA 5CSRA 1E0TA 4EANA 1NTHA 1MEWA 3B97A 3RLVA 5CBBA 3SGUA 3GDRA 3A12A 4LAKA 4IPIA 1M7PA 1E5NA 2DZBA 4WSJA 3W7GA 3NO3A 4K6AA 4LRTA 2JKPA 3CT2A 1VBUA 4QEHA 1OK4A 4S39A 3MCOA 3NL3A 4JTTA 2GVJA 2WPBA 1DBTA 4JTJA 2J8TA 3PBVA 1F9CA 1FDZA 4BEQA 4F48A 5J8LA 1J0IA 4L61A 1A4LA 1XLHA 4OZOA 3WH7A 3MSGA 4D72A 4DNMA 1NQKA 4RX0A 4I8YA 3KOWA 4DF1A 3WUFA 3BLFA 2GGHA 1J5TA 2VEMA 3W6MA 3W1XA 4Y9PA 3VDHA 4KGJA 1E9LA 2YIHA 1CLKA 4O0ZA 4UTHA 1KGWA 3L4YA 1KM5A 3FY1A 3APYA 2VNCA 3I3DA 3ZT7A 1XC4A 1KV5A 4E8GA 3WJYA 4AXNA 1WZKA 4N9BA 1HKJA 3O0FA 3APGA 2D2GA 4MKVA 3FDGA 2J75A 1LOLA 2GUYA 2Q8ZA 3HGSA 3GAYA 1ECEA 3VZXA 5C54A 1FCQA 2PLKA 3I4KA 4V28A 1BLIA 3W7QA 1W1YA 3N4AA 4S38A 1E88A 1YU0A 1W56A 1IT8A 1B3WA 1TPWA 4QQ3A 2EPOA 4NZCA 4NJGA 8XIMA 3GIYA 1QOQA 2QCNA 2XN1A 1WXYA 5D2YA 1XSIA 4WKAA 3GO2A 1PDCA 3E02A 4PSRA 3AWOA 2Q3OA 1E3ZA 1MXDA 4ZVJA 1ZP4A 4UMCA 4GH1A 2DFAA 4PODA 3BW2A 4RR4A 2HROA 2OT0A 1VFMA 2WJEA 1T8XA 4JYEA 5ENLA 4GXMA 5FL0A 3ZM8A 1XLLA 3UR7A 2QJJA 5IOBA 1GEHA 1BQGA 3CTLA 1G9HA 2X0HA 4B5SA 4NAEB 2R1KA 4PUJA 4AD1A 4QCFA 3N2XA 4O12A 2A1YA 1OIFA 3TAOA 3VNYA 2V3FA 2NT0A 1JZ5A 2J7BA 3A9BA 1H7WA 1T41A 4GYJA 1EBHA 2O7QA 3AISA 5TIMA 5CPOA 4NJIA 3WJZA 1ZY9A 1TV2A 3SY8A 4XTIA 3KOZA 1FH7A 3DHPA 5EA9A 2XGZA 3TTQA 1DXIA 2EF9A 5CGTA 3E12A 1B3XA 4EPEC 3GX9A 1C93A 4NJKA 1IXOA 3QN3A 3KCJA 3IAPA 5C2CA 4Z1AA 1ALDA 2D20A 1OFRA 3FLUA 1NDYA 2R1MA 4D1JA 3RLGA 3TMLA 4ONVA 3N19B 3V3WA 3AYVA 3QSTA 1R86A 3DHUA 3W2LA 1R47A 3GH4A 1F61A 5TQLA 1BYAA 3UNDA 4REQA 3LHTA 4IZGA 4H7ZA 1GZJA 3A4WA 3BWWA 2V82A 3U2OA 1RCQA 2RJHA 2AMXA 2OJPA 2BV9A 3B8TA 1HJVA 2GJXA 3CZEA 2OT1A 1J2WA 2VYOA 2VFHA 5EGRA 1SZFA 1LQ2A 4DNHA 3G24A 3UERA 1VJZA 4DZ5A 2BY0A 1VYRA 3QV9A 1S2CA 2J62A 1SZRA 4QM1A 1OYAA 4HMCA 4IF2A 1QHPA 2RTSA 4AHPA 1ED7A 4IBGA 5XINA 5K9XA 4TTUA 2PDKA 2TRSA 2J7FA 2XWDA 4RPPA 3W7MA 1RK5A 4IJFA 3DFQA 4IJRA 2WZTA 1NEYA 3HMCA 4ZOBA 4JL2A 3W1NA 2WM0A 3CHVA 3GDLA 4N42A 4JDYA 1I45A 3NQCA 1EHNA 4MPQA 2VX6A 5LIWX 1FFRA 4M3PA 1VPYA 3MMUA 5IDZA 3ZQ9A 1J5SA 4Z1DA 1OJXA 3LHWA 3RCMA 4M81A 2WSYA 5FEWA 1W2PA 4JBRA 1KFKA 2UY3A 4F0MA 3DU0A 1VJIA 4CNNA 5GJMA 3F4DA 4HU3A 5EPDA 3FJ6A 5AC4A 3L66A 2X0YA 3GXPA 2QPSA 4HU4A 3ZIZA 3MMWA 5JXQA 1L6FA 3QOKA 3MWCA 1BKSA 1MW3A 1PX4A 5G4HC 4EP8C 3NGJA 3V1HA 2ISDA 5GNXA 4CCCA 2V9DA 3ZSSA 3UJ2A 3SGGA 4B4FA 1IR1A 2ALRA 4PUWA 4A2RA 4YU1A 2EBNA 2PGFA 1ZRQA 1T6MA 5ECUA 3ZFHA 4LW7A 3WNKA 1L6SA 4A2SA 3N17A 2DORA 2CNCA 3LTPA 3WDIA 1DQXA 4XAFA 2BWGA 2ZUNA 1ECQA 1YE4A 1DIDA 3RJXA 3U2CA 2XINA 1UD8A 2HNEA 3AS0A 4XK2A 2D0GA 1DVJA 3CYJA 2OB3A 3EA1A 3CV6A 1S5TA 2EEXA 4JYFA 3PSVA 2C91A 2PWVA 4X60A 5I23A 2EJAA 3ZXWA 3MU7A 1MNZA 3GH5A 5A6SA 1M7XA 3EXSA 1MFUA 4QITA 3GW0A 2WBGA 3N11A 4P7OA 1U1JA 1TV3A 2YYTA 3M0VA 1JAKA 4W7VA 1SMAA 3VNZA 1YXYA 4HGXA 1EP2A 1GK8A 4OJLA 3WLMA 1UR2A 3TQVA 4CD6A 3N6HA 3M5VA 3OLGA 1JRCA 2WZIA 3T08A 4PMZA 4ML9A 2VR2A 3CXOA 1LTDA 4RE2A 3UWYA 2G3FA 4DELA 4YWSA 4HB7A 3TX9A 4Q7BA 5KINA 1R30A 3SCNA 1FTXA 4IBEA 1XINA 2G3MA 4BQ2A 1HKWA 3GG1A 3AUOA 1QBAA 4IQJA 5HJLA 5KSWA 3REQA 1Q7MA 4TQTA 1JCNA 1MZRA 3ABOA 4OOUA 3R79A 3WIJA 1YU2A 1N2VA 4GY7A 4ASTA 3EWCA 3ARQA 4KETA 1CLXA 1WDRA 3CC1A 4X63A 4J3VA 1TO3A 2EPNA 4LWWA 4LEQA 1EA9C 2DEPA 4GIYA 2E77A 2I7GA 1GTHA 1IHIA 1K70A 2CLKA 4B5VA 2C13A 4C6NA 5JMUA 4H6EA 5IFPA 1P6CA 4AVNA 4QBXA 3S5NA 1M6JA 1B0IA 4C6CA 4O15A 3RXZA 2VURA 3H22A 2IPWA 1EYWA 1M7OA 3ZR6A 1P6BA 1B2YA 1ZLPA 5GVJA 4XD6A 1YE6A 4NRRA 4UTIA 3XISA 2VP8A 2VENA 3I68A 1IZCA 1FHVA 2Q02A 4PB4A 4WJ8A 2PGWA 3KOXA 1M01A 2D2OA 4ZB5A 3R12A 4GCXA 4IIHA 5IBXA 1AW1A 3IARA 1ZAIA 5F4SA 2J7GA 4HSOA 2WSRA 1CCWB 3ZT6A 4H8NA 4ACYA 3GXTA 1GG1A 3MWAA 5I3HA 4GIRA 3FGCB 4ACZA 2XSAA 2FQIA 4HCDA 3E38A 4XZIA 1ENUA 1G94A 2D2JA 5EL1A 1KM6A 1B1YA 4YTRA 2ZTJA 3LQGA 4MUPA 1G5AA 3QW3A 2I5IA 2G4JA 1RLDA 2I9EA 2Z4GA 3SI9A 3H21A 1KXHA 1LL6A 1H61A 1UWQA 3GIPA 4F2TA 3FKKA 1SW3A 3WBYA 3Q2DA 4HMEA 1S5VA 4V15A 5BXPA 2ZQ0A 3EOEA 4WR3A 5A6AA 1H7XA 1EX5A 3U2EA 1FXQA 2QPUA 2FPVA 1A3HA 2YDSA 5HBFA 1CXLA 3S2MA 2VDGA 5CC5A 3UQNA 4AD3A 1HJUA 2WSQA 2YCKX 2YBVA 1JPMA 1FP9A 5ABHA 1AH4A 2VUYA 4AF0A 2DT1A 3OYZA 1XP3A 2O4MA 3GHRA 4I7WA 1UROA 1SUXA 3UJFA 1J6PA 2HNHA 2HBXA 1ZSXA 2R82A 4NZ1A 5BU9A 3S46A 3LA4A 3PTMA 2HPIA 1X96A 1LT8A 4IOTA 4K8GA 3U8GA 2CETA 4UQ9A 1ITQA 3PG9A 3GFXA 1JCLA 1QJWA 4LXFA 1E71M 5JH2A 4MWAE 3TTEA 4BI5A 4C6EA 1VR6A 3CUZA 2VDIA 1EUAA 5CLTA 2D3NA 4DJEC 4DYJA 4GVHA 3DGRA 2IPJA 2XIQA 2GSJA 2C6QA 4WQ6A 1GTEA 4XO7A 1W9PA 3FA4A 1PTDA 2DW6A 3ANYA 4Z2GA 3NPUA 3IVTA 1HFBA 4B5XA 4O57A 4XD3A 4US5D 3TKFA 1T96A 2DH2A 3VKAA 2PWFA 3VXGA 2XH7A 3IRDA 1MDLA 4G7EB 4X2PA 8A3HA 2YFOA 1SFSA 2WNQA 1FDYA 2GUUA 2J25A 2I5GA 5CJ5A 3AI0A 4KIEA 1S5WA 4S3AA 3QPYA 3NXLA 2ZZ3A 1EO5A 2C1HA 4JX6A 3GVQA 4Y9OA 1IF2A 3ABRA 4LC6A 5K7JA 3GNDA 4L9ZA 3LU2A 3CIWA 3D47A 2JCHA 1C8QA 2R8WA 2VGBA 4DYKA 4ERGA 1YUEA 1WCGA 3ITVA 1A5SA 1G6CA 2WJZA 1J0JA 1DV7A 2J4GA 2Q01A 4Y90A 1MQQA 3LNPA 1E6ZA 1QNRA 1FH8A 5C8BB 4GI6A 2E40A 1QASA 3BG3A 2AAMA 3B0UX 2PRMA 1Q6CA 3HV8A 4IQDA 5HMEA 2A3EA 1HKKA 3ME3A 1GOWA 3LEPA 2VRKA 3K8MA 4Z2LA 2GVEA 3W0KA 3S9YA 2TYSA 4MFEA 3W1UA 4GI4A 2V5DA 3U4AA 3SFKA 3R10A 1XYMA 2OR2A 4HPHA 4LSBA 3KBSA 4MWAD 3VVGA 1ONEA 3F5KA 3CNYA 1KRMA 3N6JA 2Z2BA 3KVJA 2BFGA 3VM7A 1K9DA 1AL7A 4WOZA 3PTQA 1L2UA 3RM9A 4HK5A 4KBXA 3U57A 3NIYA 4DO5A 3A3WA 4G2DA 1ZBKA 2XVKA 2QJNA 4JTKA 5CBJA 2NX3A 1Z7AA 3W1LA 4IUOA 4M0XA 4TVUA 2E28A 4JGDA 1AFSA 1T5AA 1MSSA 2O9TA 2XIBA 3GS6A 1UQZA 1T8QA 4LOCA 2A6NA 5BRBA 3F4CA 1MZHA 4IIBA 2G97A 4LY4A 2AL2A 2ZZ1A 3AHVA 3TA6A 1GYNA 2OYMA 3ABXA 5DXYA 2OG9A 3NQFA 4QLJA 1O12A 3M0ZA 4MIMA 3K5XA 3N13A 3S9IA 3GK0A 3W88A 1G4PA 3QQ0A 2NQJA 1ITUA 3GU9A 3CZ8A 1HF6A 3RRAA 2DZUA 3U3HA 3GHTA 3QV6A 4H8VA 3LENA 1NOWA 1CW2A 4XZWA 4S3FA 4WSKA 1FCVA 1ISYA 1PIGA 1M1BA 4F9DA 5E70A 1A49A 1K7XA 2YOCA 2OEKA 4C60A 1D9EA 3E74A 1OCQA 1PHQA 1VRXA 4PRWA 1CB2A 4QHRA 1BSLA 2RFGA 1XFCA 2CW6A 1XCXA 1XD0A 3M1ZA 1ONRA 4BF9A 3O7UA 2YW4A 1EJXC 2RH9A 1VYSX 3EOOA 4IPLA 4HPNA 1IEXA 1OIMA 1UZHA 4ZOCA 3RPMA 4YVVA 4FAMA 1N8FA 1GYLA 1KM3A 4PZVA 4OJPA 3U48A 3O1NA 2J8GA 4PMJA 4HPXA 3SRFA 2F9RA 4GISA 1E70M 4IT1A 2J77A 4E3VA 1MQPA 4WDWA 1ONWA 3AUJA 2CZEA 3LHUA 5CH9A 3SCRA 1RA5A 1TR1A 3N9KA 3REQB 5DMYA 4XSMA 1TWSA 1Q85A 4ATDA 4LVFA 1U5VA 2RGMA 4UCFA 1B90A 4D1IA 2E5DA 2EXOA 3QYQA 3BSMA 1BYDA 2OXNA 3CAWA 2Z7KA 3GVWA 4JX4A 3TLLA 3MA8A 1LP6A 5CPSA 3TU9A 1JR1A 2FZDA 3RJYA 2ZWYA 4YTUA 2C0HA 2Y6ZA 3F2DA 1JD7A 4Z1YA 2HS6A 3DC8A 4BK9A 3M5YA 3BMVA 4AX6A 1K9FA 1SSGA 3DBNA 2PCQA 3ITOA 1AJZA 4IFRA 4NASA 1JI1A 4AIUA 3EMQA 1W54A 4UFJA 3OVRA 3VUSA 4RE0A 3DBPA 3CMGA 3VNIA 3EPMA 1XLDA 3MHUA 4EVZA 3HONA 1TPB1 1Q45A 3W75A 1B4KA 1HKMA 4O11A 2V5CA 5CG0A 1KR1A 2OSXA 4KWVA 1QO5A 2G8ZA 1GHRA 3EB2A 3U9IA 1T7LA 2DVTA 2REQB 4OT7A 1VLWA 2FMOA 2BLEA 3G2GA 1T99A 2DJLA 1SZGA 4WKFA 4XO6A 4ZENA 4A35A 3O07A 3IJIA 3GVVA 1CGWA 3MW7A 2HK0A 3M0JA 4TO8A 1E9YB 1IWAA 1A5BA 3KVKA 3UXDA 4KCWA 5HJYA 4FPSA 1A3WA 1QNSA 1DJZA 4HCHA 4LYRA 3ARZA 1UZ1A 2PURA 3WQOA 1WA3A 4MWAB 3T2PA 4R5EA 4ATWA 3P80A 2EKCA 2FTPA 4FOKA 4HNUA 1IT7A 4JNYA 4J9JA 4IGNA 3VKKA 3ES8A 3O16A 1NF7A 1H62A 3EX3A 2PDGA 5CCZA 3THUA 4IGMA 1D7KA 2YXOA 2YL5A 1TTQA 3K4AA 3IEBA 4S3BA 1GOKA 3KXQA 3EDJA 2H3DA 1UBSA 4DUXA 4Z0JA 1R7AA 4B92A 1X7IA 3AMCA 3PWGA 4H9YA 1K8XA 4RZ5A 3MJMA 2V81A 4DIAA 3SB0A 1CECA 2F84A 4HVXA 5FJRA 5MHBA 1GORA 4GINA 3BURA 2XG9A 3UZ5A 4WY0F 4C6FA 4TVCA 1O95A 3EMCA 3T81A 4B3ZA 3MCMA 3QHNA 5I09A 1TZ9A 2TODA 1RVGA 1XUZA 1V02A 3GNRA 1ZCOA 3AXMA 3SECA 3UWUA 3RR4A 5I3JA 3I65A 2Y63A 2DT3A 4PTMA 4LVBA 5EB8A 2BB0A 1FWWA 1HL2A 4IFOA 9XIMA 2Y0FA 4KH2A 4I9MA 1OYBA 4PGLA 3KE0A 1OF6A 1SYTA 5KMYA 2FHBA 4EACA 3PM6A 4GKTA 4O16A 3VINA 1DWAM 2WSKA 4HNOA 2FGBA 4LF2A 5DCEA 2QCEA 3DFOA 3UJSA 5LSMA 4XD5A 1WOBA 5AY7A 2NQZA 1WKFA 2ZDSA 4LYKA 1EC8A 2I17A 3LSBA 3VDBA 3CWOX 1JI2A 5AHFA 3NO5A 4Y2WA 1TZZA 2FZ9A 2OZ8A 3GVRA 1MO0A 4GHLA 4WHBA 2Z25A 4S3KA 3F03K 2Y88A 3O63A 4HNVA 3TN4A 4F9JA 1YPIA 3W29A 5B80A 3KRBA 3EX1A 4UWMA 4FOUA 1GEQA 4PRRA 3P93A 5DY2A 3GFYA 1XSKA 2Q71A 3N34A 4U3AA 1VZWA 1R5YA 3NZQA 1V0MA 3QSRA 4KPLA 1OX4A 1R46A 2NXHA 2XSXA 3VU2A 6TAAA 4WRHA 2ZZ2A 5T91A 1GGOA 3JR2A 3BXWA 1J6OA 3N3TA 3AROA 1LJYA 2VUNA 1W5PA 3T6CA 1U5HA 2W3ZA 2DZAA 1UH3A 4HNTA 1UHVA 3B0XA 1JUBA 4PN2A 3FSUA 3I3BA 5JH1A 3OG3A 4JHMA 3TJLA 1ISWA 3FOKA 3VOHA 4MWAC 3ABSA 3M7WA 4OJOA 4LCSA 1FWJC 2C7FA 1VCFA 4O1BA 4D71A 3L4WA 3NO1A 1C8YA 3SUTA 1DJWA 3QTPA 3O6AA 2WSPA 3E2RA 3NYZA 8RUCA 3UA4A 3WLQA 3PWAA 1Q6EA 1M41A 4UXDA 1U30A 4B90A 2VKZG 1I8JA 1GXDA 1YTKA 3QFWA 5CEWA 2I14A 3UZZA 3UY8A 1R3QA 2DU2A 4PMOA 3TE9A 1A5AA 4YVPA 2VM8A 4GIAA 2P8BA 1TRDA 2XVGA 2FB3A 3WNPA 5D8ZA 5D9NA 4P5UA 1M04A 1KTNA 3VGDA 1ZCCA 4OHQA 3VM5A 4FNTA 4J3TA 4LVAA 1UD3A 3BG9A 1MXGA 3A24A 1NWRA 3R8GA 1OX4B 5IDIA 4GCAA 5DLCA 3VNDA 5I00A 4QCEA 3TTYA 4IG2A 1NARA 5LA1A 2FJUB 4MB5A 1G7VA 5D09A 3CJPA 1UASA 1DE6A 1V51A 3CU2A 1F4AA 4IJCA 4M29A 3VIKA 3W7JA 2VR5A 3WF2A 2NWSA 5CZTA 3LMYA 1TV5A 1ZAJA 1TQXA 3SCQA 3L4ZA 1W9XA 3EDFA 5CPQA 2OZTA 1YDOA 4S3DA 2IW0A 1IXNA 1E4MM 1U2YA 3LLFA 1FWNA 4M19A 4JYDA 2HQAA 4GQGA 5D4YA 3M0IA 5A95A 3OA5A 1OG6A 3C52A 2EG8A 1POKA 5A8MA 4FF5A 3A4XA 3V0SA 3L5LA 1TG7A 1LRQA 1LQ0A 2FPTA 5JU6A 3WN6A 1T40A 1NP0A 3FK4A 3NQGA 2OWWA 5G1YA 2DZVA 1EA0A 1V3IA 2X30A 4OVXA 3A64A 1BF2A 2Z1XA 5JIPA 3WL1A 4XB3A 1VAHA 3GXDA 4DF0A 3T55A 4AD0A 4JS3A 2YB1A 3KRSA 1R3SA 5E93A 4I5UA 3NTYA 2J7CA 4B2DA 3TLQA 4LT9A 3VCNA 3W7CA 3FKEA 3W2KA 2C19A 3KBJA 5A6JA 1IEVA 4I7UA 3UWZA 4FLRA 3B9AA 3I7QA 4KFNA 2D0FA 2QF7A 3WF3A 3PJWA 4ECLA 1E1EA 1SVDA 4L1WA 1XLBA 4LBRA 3LTSA 4IJEA 3O0KA 4XSLA 3N25A 3HG4A 1TYGA 3ARWA 4C6MA 1Q6DA 1LF1A 2INZA 4DZAA 1BRLA 3WQGA 1X6UA 4I6VA 3S0CA 3WQ8A 2ZFAA 3I6TA 1QW9A 3P61A 2WMKA 4K7VA 3KBMA 3CQIA 2Y7FA 3H24A 1NVMA 3PZNA 2G50A 1YYAA 1YU3A 4Z1BA 2WVTA 2DZWA 1GOXA 3ITXA 1KBIA 3O3RA 1N8WA 3VOFA 2VVNA 2CXEA 1QTWA 5L6UA 1S2UA 3DG6A 2ZRVA 4GKLA 3SO7A 3PTKA 4Z0SA 5FL1A 4WK9A 5FEXA 2FZMA 3NSNA 1UC5A 1W0MA 3W7DA 1AUSL 2AL2B 5FJIA 4JIIX 3P82A 4FSAA 1BF6A 3H8AA 3CLWA 1CT5A 3R94A 3EPOA 3WH8A 2OQYA 1TIMA 3AHXA 2X0SA 4GABA 3MB9A 4H1ZA 1FHLA 4EF9A 5CG7A 1Z8AA 3BH4A 2FZBA 5I78A 5I07A 3WDPP 4QGCA 1JDAA 4G6CA 1REQA 3WEMA 1VKFA 1TCDA 1UP3A 4OWGA 4UQCA 1TTIA 7XIMA 2X1RA 1ONXA 3KS8A 1B3ZA 4MB3A 4IL2A 4H9TA 3W87A 5CJNA 1WZMA 1R2SA 2WO5A 3S1XA 1EGVA 2C8NA 3WKZA 4QJ4B 2W67A 2C16A 4ADUA 2C0AA 4CCEA 2BX7A 4Q8OA 3VK5A 4RZ6A 4G56A 1XLEA 2GYIA 3AICA 2V5JA 5HAOA 3GXMA 2PF0A 1DE5A 1TJPA 3HBLA 1M65A 2RUSA 2V8ZA 5I03A 2E25A 4BHYA 4BS0A 3E49A 2Y2KA 2PDPA 2Y2NA 5K3VA 1JYXA 1Q6FA 3OGRA 4O8AA 4JNMA 5I6SA 3ZJ6A 3LGDA 3WK0A 4LV4A 2PC4A 4NNBA 4W87A 4H9XA 1XLCA 3DG7A 5LIXX 4KWSA 1L2QA 2W61A 1RALA 3BDKA 1R3WA 5GJNA 3TSDA 4CN1A 2IPFA 3QYSA 4IHCA 3V5CA 3K30A 5KZDA 2Z7GA 2HCVA 3MDUA 2QHAA 3LCHA 2UY2A 4HHPA 2E8YA 3W37A 1KA9F 5FF4A 2CLMA 4I7VA 1NM9A 3W24A 3WBEA 1CPUA 2A79A 1RQHA 2X2YA 4LALA 4C6LA 2W79A 3S4TA 3QY7A 2B7NA 1PHWA 3JW7A 2XIJA 1ICPA 2CESA 3BVJA 1RD5A 3FDKA 3GTXA 1XCWA 3VNLA 3VZZA 3U7VA 1UZ4A 4GUFA 3C0SA 4XAPA 1YTEA 1I75A 4Y9NA 4U33A 2FLIA 3TW6A 1PEZA 2J9ZA 1XS2A 3E96A 2R9RA 5A8QA 1GHSA 1P0DA 4LS2A 1R87A 1UD6A 3EOUA 4MNKA 1FWEC 1FDJA 4HTYA 1NWSA 2XIMA 1GVFA 4H19A 4X0VA 4V33A 1SJBA 4H04A 3BAWA 3W2UA 3CMJA 3KX6A 3UZXA 2HVOA 3C4UA 3TOYA 5KETA 5HPCA 1FWCC 1FA2A 1W9DM 3O6DA 4RE4A 1EL3A 3R0KA 4ZE5A 2NLYA 4FNPA 4C6IA 1OGBA 1YPXA 1H0IA 2VZTA 1BD0A 2G3NA 4DO4A 3GM8A 4MGGA 2UY4A 3N2CA 2JFEX 1U33A 4IG2B 3MS8A 2VHLA 1FHDA 1XGZA 5B7ZA 3EX4A 3WQCA 4LUJA 2YA1A 1GZ1A 3OGSA 1LCOA 4CU7A 1TUFA 1F3XA 3QV8A 1GPFA 5D9MA 2ASHA 1PS9A 1G69A 3Q58A 1REQB 3EOLA 2HSAA 2QUTA 1NWUA 1FWSA 1V8EA 4HSNA 4RJEA 3QXBA 3UYIA 1TPVA 1A5UA 1VFOA 1UYQA 3M7SA 1SR9A 3HTWA 3LG3A 3SGZA 4MVAA 4NYUA 1QK0A 3ZWSA 2HPMA 1D3HA 3VI2A 3W70A 1HGYA 1UWIA 3C56A 1JCMP 2VX4A 4XISA 3KDOA 1G4EA 1FCUA 3SN1A 3QFEA 3MT1A 4AZ5A 1GKRA 4LUSA 1KRBC 4PBEA 2PLJA 3SUSA 2J9YA 2YPIA 4QP0A 3C61A 1Q2SA 2QDGA 5IFTA 3B0YA 3SM0A 2CZ5A 4JN8A 3AMGA 3T44A 3MY9A 2WKJA 5H8MA 1C9WA 5CZSA 1E51A 4H2HA 4DHGA 5BXTA 2ACSA 2ZA3A 4ERAA 4XAYA 3HSHA 3SJNA 1Y8BA 4Y7EA 5XIAA 2PDFA 3BZJA 4A8RA 1EKOA 3LQLA 3E1F1 5TNVA 4NAEA 5F2LA 3N3MA 1E6SM 3YPIA 5F1VA 1B54A 2W91A 5AOUA 1NSJA 3R2GA 3MBFA 3D0CA 3IK4A 3TYDA 2H8XA 3IJ6A 1AODA 1TRIA 4C90A 2HV5A 1ZPTA 1LBMA 3Q37A 4MJMA 4OE7A 3WD0A 1GOIA 4UFKA 3OZPA 2JF6A 2XUCA 4RNJA 3EWXA 4Q8VA 1NDZA 2NUWA 3IVSA 5D2XA 4A8LA 5BCAA 5C71A 2D2HA 2OLHA 2VZUA 1IWBA 4JTEA 4M56A 1F6KA 1VHCA 2R94A 1P6WA 4I8DA 1HVQA 5FEPA 1HP5A 2YA0A 3U5YA 1DL3A 1KWGA 3RUBL 1ODUA 1VF8A 3UZJA 3LCIA 4N6EA 2WNZA 1EPVA 1OFOA 3QW4B 3G1VA 2WK2A 5H8PA 1JF5A 3C2OA 3TVAA 3AHZA 3NNTA 3WMSA 1FXPA 3H7UA 4ICNA 5AHNA 1R3YA 1VB9A 3DERA 2H9AA 4NHVA 5CPMA 2VMFA 1I2QA 4UIOA 1QWGA 1BHGA 3NQEA 4J28A 3W74A 1EWDA 2XTKA 1NU5A 3UG4A 2JEPA 2DGAA 2CIPA 4GYPA 3OODA 3O6YX 1TPEA 4FMVA 3IGXA 1WBJA 3E2SA 2CHOA 3W7HA 4IL0A 2F6KA 3AMKA 3QY8A 3H26A 3B05A 1VFSA 2DVUA 4I5XA 3GB6A 1PSCA 3LLXA 4LAUA 1TKKA 2QS8A 1IQ8A 4TX6A 3L68A 1V5XA 1DXFA 2P5NA 4RCXA 1UUMA 1CTNA 1FCBA 2BVWA 2JBMA 2DUAA 2FYMA 4CVUA 2HRWA 1P0BA 4MYAA 3VGGA 1BGGA 2QULA 3SAZA 2OZ0A 1F7BA 2VVSA 3DECA 4JN7A 2YB4A 1EJTC 3TK7A 1SJCA 4ICCX 4INFA 5LXEA 3NPXA 2Z2UA 3UU0A 3BAXA 2PA6A 4JIEA 4LNCA 1V6XA 3WLIA 3AQUA 3BMWA 4UR7A 2O55A 2I5QA 1N8IA 1WXZA 1KM0A 1R85A 3ZOAA 2QDHA 3WQ4A 2GL5A 3WD1A 1Z9AA 4PMYA 4N9DA 1DJIA 4QQUA 1LLWA 2Y85A 4ORMA 1IIHA 1Y5WA 3UZYA 4LV9A 1EDQA 4W7WA 8TIMA 3ZSTA 3DKLA 4M51A 3EWWA 3WLTA 4L9XA 4TMBA 3TYCA 1JZ6A 1O1ZA 2AQWA 4C1NB 4L5ZA 4TIMA 2ZX6A 3MVIA 1BG9A 3MUCA 2PP0A 2NV2A 1W1IE 3CZJA 3TA9A 8XIAA 4HCLA 1ITXA 1Q6LA 2V6AA 1MUMA 4N6FA 3OGVA 1MVYA 2F2HA 2E4TA 4LYQA 1BPLB 3AYSA 3MSYA 1XC6A 3HQOA 4FXJA 3W7OA 1MNSA 2AL1A 4U10A 4ZL1A 4B5WA 1M68A 1EZ2A 1UD4A 4XZHA 1OC6A 4E4FA 1OINA 3TYAA 1L9WA 3NDOA 1RK6A 1WYIA 2PEVA 3LHZA 4KS0A 4R33A 5CAKA 3KRZA 4L7ZA 2VDHA 3MUZ1 5EFDA 4L4MA 5FA5A 4A3UA 2YSWA 1RBOB 3ZJ7A 4LY8A 2ZCGA 3MI6A 2P8CA 3USZA 2AAAA 3D46A 3IGSA 1FWRA 1JQXA 5K9DA 3RO8A 2TMDA 3TONA 1CK7A 3JU2A 4I9TA 3PBYA 4IMDA 4M6VA 3GTIA 1Q6OA 4WF7A 3CL6A 1L6GA 5LNRA 3SUVA 4N9CA 3ZLGA 2E3ZA 2A3BA 4LBSA 3P60A 4D6DA 3FGCA 4ACZB 3IUDA 3PR2A 1CBGA 2QLYA 1Q63A 4TU1A 1GONA 2CU0A 3HG2A 2G5WA 3NG3A 4YTTA 1BGAA 4NI3A 4GUIA 3OQEA 2NW0A 5DCBA 3L0NA 3AIUA 2C15A 3LCWA 4FP1A 4PMRA 3L2AA 1UA3A 1MW1A 1XGDA 4PE8A 3ONBA 4M24A 4FX6M 4J35A 1OFDA 2OGYA 1W6TA 3QZ6A 5C9RA 2P88A 1E1CA 5LYRA 1P7TA 1PV8A 1HL8A 4J3WA 5H1WA 2FHCA 2ZDRA 3H70A 1GYMA 1HIZA 1PZ0A 2D73A 1IR2A 1ZJHA 1NFPA 3CPRA 5HNUA 3NQMA 2D24A 4WIWA 4NP7A 3RK8A 4GYKA 5REQA 4C7GA 5CC6A 5HMSA 4ZTXA 2QGYA 1VENA 3QGAC 1S38A 5DQPA 1XYZA 3LNMA 4PRTA 3OPSA 4GQRA 1XLKA 2NQ5A 2PE4A 1WV2A 4AVOA 2NV1A 3MP4A 3GAKA 3LLDA 1CWYA 2Z2AA 3P81A 5ABEA 4HZ6A 1EXPA 3E9AA 1BQCA 4PMNA 4QNEA 3LB0A 1EQPA 4QFUA 3TTSA 3G1SA 3NCOA 4JKMA 1E5JA 4FK9A 4H9VA 4ZZ9A 3P8JA 3HF3A 4MNLA 1H8PA 1PXGA 5AYIA 1UQYA 5C9UA 4XBJA 2PDXA 5AHEA 3L29A 3L2LA 1AIWA 4V2XA 2YCJA 3T9PA 3CAKA 1CZ1A 1OK6A 1U83A 2XFRA 5FESA 2AQOA 4KRUA 2IS7A 5DELA 3WZ0E 2OEJA 1AD4A 1E6PA 2VQTA 1W1VA 3VX1A 1PDZA 3L0GA 3GZAA 5DX7A 1MDRA 3MKCA 4CLMA 1AH0A 1WDWA 2Z1WA 3TDFA 4TV6A 3P0XA 4JFSA 1ZZMA 3WBWA 4P8UA 4B5TA 4O8RA 1JAEA 3RG6A 1N55A 1MQRA 5I3DA 2PDWA 1SW0A 1DTUA 4YTSA 2NSOA 2WHKA 4MZYA 4DAFA 3S9ZA 7REQB 3G22A 1X8FA 4UR9A 1VH7A 2PC8A 2B7PA 3WLPA 4EIVA 4CEUC 1P43A 2PWHA 2BZNA 3NJ3A 2C1GA 1QPQA 1R38A 2DT0A 4D2JA 4HA4A 4RDZA 2ZRUA 1Q13A 2QUVA 2QUUA 2WOQA 3L2MA 1J7MA 1OZQA 2WHJA 3ITTA 3DZ1A 3C2EA 2J27A 1U22A 3FCPA 4WEVX 3W7RA 1C8VA 1OABA 2X42A 4AYGA 2PS2A 2CITA 3FXGA 1XPGA 2BODX 2ZZ5A 1Z89A 3CTTA 3S1WA 2Y4SA 4L4PA 2ZUSA 5HOSA 3W82A 2OMAA 2PMQA 1QHOA 3BG5A 3ARUA 3T4CA 3MUXA 4WOQA 5G2WA 3VNJA 3UYCA 3F4WA 4FR6A 1TX2A 3SCOA 4OJ5A 4O1EA 2ZX5A 1PAMA 3H6OA 1M3UA 3E5BA 4QJ3B 2X1SA 4R9XA 3E2VA 1DP0A 3PULA 1CIUA 2NT1A 1XRVA 4XZLX 3S47A 2B0MA 1OM0A 5HMFA 3CHEA 3PS7A 4Y8EA 1EWEA 1H50A 1NH6A 1DQUA 4AZCB 2P0IA 5AYBA 6TIMA 1XBVA 1KBLA 3NM1A 1UPMB 2XU2A 4HNLA 3UT0A 2IKGA 2Z1BA 4LAOA 3WH6A 3QR3A 2VFFA 2SFPA 5A5WA 4IP5A 4AHOA 3AOFA 2YCLB 1OY0A 1J93A 3NQAA 3TP4A 4CQCA 1TJ1A 3BMXA 3AIRA 2XFWA 5HMDA 1G01A 2QVNA 3BANA 4PCPA 3OVQA 1E6QM 4J3SA 1KFLA 3IJ8A 4BJHA 3S5OA 1D7FA 3P5YA 1NY1A 3VAVA 1TCMA 2VZVA 2FMNA 4JTHA 4RNHA 2VC5A 2VOTA 1K7FA 1QWKA 2R24A 3DIPA 3FAXA 4KFOA 1KW1A 1ME8A 4QXIA 2E09A 3GDBA 3IACA 4AH7A 1X8CA 2BOFX 5ABFA 2PGEA 1KTBA 3UA3A 1OGSA 3C8NA 4OV9A 4IICA 3FIGA 4GVIA 4ROPA 1S5MA 4JDBA 4A3YA 1US2A 1RJRA 2NQLA 1VP5A 1B3VA 1RQBA 3T7VA 1LL4A 2VX5A 3COTA 5D04C 2YLLA 5A6BA 3NEHA 3LV6A 4N2YA 5EKYA 4XG1A 4J2MA 3WJSA 3PJXA 1NDWA 1W2VA 3V5FA 3KWSA 4UTUA 3T0CA 5D02A 3BGAA 5C9ZA 4A3HA 4XZBA 5G4WA 1VFLA 4PB3A 4A3RA 2PBOA 4Q8PA 3GQYA 3NFUA 1D3CA 3HJZA 3E0WA 3TZNA 5A94A 1VIZA 1FWAC 2WCAA 4GX9A 4KT2A 4MJZA 3IUHA 1QMLA 4DWSD 4N4QA 4FNUA 2WLYA 3B9EA 5AVNA 1B57A 3JZUA 6ALDA 2X40A 2EQDA 2CBVA 1G0CA 2ZE0A 1PTGA 4L6HA 1YX1A 4Q8NA 1SO3A 1LZOA 2EAWA 2Y2QA 2HWGA 3LRLA 4AC7C 5M03A 2J7DA 1RUSA 1W3HA 3WUEA 1R2TA 1RJPA 4EWND 1SU5A 1FP8A 3OVGA 3UXIA 4GUJA 1SMDA 3NWRA 1SQ7A 5A2BA 1CI1A 4OU1A 4IXHA 5EMUA 3H55A 5BWFA 5GNYA 3W07A 2UWXA 3LTYA 2XN0A 3LGEA 5FJTA 1F8MA 5M3WA 4RDWA 2DSVA 4FO4A 3FA3A 3K1DA 4V1XA 1S39A 1TR9A 1XISA 2BMBA 2QJIA 2JE8A 2E8ZA 3PP7A 2GDVA 4O14A 3TC7A 1WB0A 1X6NA 2VZSA 2FJKA 2VEPA 4Q33A 2Q8LA 2GSEA 2GDQA 2QKFA 1XDMA 1G67A 3V5OA 3RIKA 3RMEA 3SURA 3ZLFA 1UP0A 1TPC1 1I2OA 1KCLA 2X16A 3A4AA 4X61A 3HO8A 3QVQA 1GWJA 4J3ZA 5D9PA 4D8ZA 3TIMA 2H8ZA 5KZEA 1XLIA 3GKAA 2WXDM 5DO8A 3OIHA 1ZBVA 4JTSA 4MB1A 4ORIA 1YXDA 5E6YA 5I3IA 1THFD 2QGHA 1L0PA 3H54A 5GQBA 1W5MA 3R8RA 2IQTA 1XIFA 4JN6A 4RV3A 1L8PA 4RK8A 4FHAA 5A69A 4FF7A 5DY3A 4PUNA 1OC7A 1TFVA 4K38A 2QDEA 2P76A 4LX4A 1O5XA 1JPDX 2QCGA 1TE1A 1QI4A 1CB7B 3G77A 1XWYA 1MYRA 4D6HA 4RNIA 1B31A 3AXXA 2ZUTA 4AEEA 1A3XA 1XDJA 3L5MA 1UR4A 3VDGA 3WBXA 4NZFA 1R9YA 5A2AA 3TQKA 2O4QA 1F6PA 1AQ0A 4A4AA 1SFTA 1R8LA 4L6DA 4GX8A 1DOSA 4XUGA 3ECQA 1JYVA 2J74A 3GUWA 4CCZA 3M46A 4QG8A 4M82A 4F0RA 5M5DA 1QUMA 4AUBA 3G1FA 4ZSTA 5I5RA 4YNGA 4E4PA 1KFEA 3SUUA 4UZUA 1H3GA 1KB3A 2CLLA 3KVMA 4D6EA 2GOKA 1C3FA 1JPIA 5F2MA 4DWDA 2JGQA 1LWJA 2QV4A 4N02A 4XKMA 3W83A 4AWUA 2UY5A 4IIEA 4WLCA 4X9SA 2ZXBA 4WX2A 3M7PA 3OZOA 3PAOA 3G0UA 4PMQA 1JXKA 2DQWA 3QF0A 3GXNA 2WHMA 2D22A 5A6BD 3T78A 1BWKA 2ZRWA 1P7TB 3EWYA 4YJ5A 4IWWA 1TTPA 3AZTA 4MF4A 2Y8KA 1K03A 3PJTA 3ARYA 2Y89A 3BLKA 3CO4A 4JQ3A 4XKYA 5HPOA 1W9UA 1J9YA 3EOSA 4GHAA 3G1DA 3VDCA 3CT7A 5M17A 4FS9A 1RAKA 1O7AA 4WD0A 5CC7A 1LWHA 3CASA 3E0FA 1LT7A 4XD4A 1V0NA 2EPHA 3UPWA 3ATZA 4ZTYA 4DBUA 2WBKA 4C6KA 4ZFMA 2PSNA 1GKPA 1O66A 2RAGA 3R0UA 4UB9A 4B15A 3WNMA 2JF7A 4Q7NA 2J78A 4KWUA 2UZ9A 1PO9A 4AY7A 1QBBA 4PEKA 3EEGA 1H0GA 1W31A 2V30A 1WDQA 1EC7A 1ICQA 3T4WA 3TJXA 3EKLA 3ATYA 2PAJA 2Z27A 4NU7A 4ZBCA 3A21A 4R9OA 3RLHA 2HE8A 1CDGA 1HKIA 4POCA 1Q4NX 1UOZA 1VFFA 3L65A 5DBTA 5XIMA 5LNVA 5JBEA 5J5DA 3DCPA 3AZRA 3L67A 3V0UA 3L4UA 1RBLA 5FACA 4LU0A 2Y2WA 2PB1A 3CV2A 3G8RA 2ZWZA 3E0IA 3RITA 4LNYA 4E2BA 1I2PA 1XKJA 2POZA 1AMKA 1JUEA 1PDYA 2I16A 2QMJA 5B7YA 3IIVA 4IBDA 1H09A 1JFHA 3I4EA 1SFLA 5C5YA 1V6TA 1UA7A 4DBDA 3WFAA 1L6WA 2WWCA 1KO0A 3TN3A 3DH7A 2HISA 2BY2A 3V0TA 1N7KA 2J24A 4PUKA 3CEPA 3CBWA 3DXIA 5HNTA 2INEA 4ATLA 3W6LA 3MYPA 2ZA2A 4ZFCA 1JPKA 2CKSA 3ITYA 5E6ZA 3URQA 3WF1A 3LRMA 1B4EA 4PH6A 1M53A 4O1AA 2QJMA 3WDQA 4KW2A 3CV1A 3EDDA 1J18A 1L6JA 3M0LA 2F2KA 1XLMA 2C3ZA 4TOQA 3FYYA 2EGZA 5DMNA 3ZWTA 2FVMA 5AYZA 3UWEA 3NA8A 2VEFA 6ENLA 4RW5A 5E5CA 4EPBC 2I1OA 3MSRA 1BVNP 3M0YA 4HP5A 2DUXA 1UR3M 5LGZA 2P10A 5PTDA 4O52A 2D3LA 1CXEA 5I24A 3TQ0A 3BGJA 3W7IA 1WKDA 2NX1A 3KOFA 3ORWA 2V63A 1FKXA 3LCLA 3N9SA 4MFDA 4O50A 3KZPA 3ELFA 2HXUA 4Q4MA 3W1TA 4NJHA 1RZMA 4PSPA 1XRTA 2OODA 1PPIA 2ZC8A 5E09A 3FSTA 2GVLA 3LOTA 5HANA 2VI0A 1A4MA 2WMIA 4C5YA 2QF8A 3UJEA 3S1UA 3TOPA 3ZT5A 2NQHA 4HJFA 3GFZA 3CO8A 1E56A 1FWIC 3K8KA 1I0DA 2A3AA 3S8HA 1DHKA 1F76A 4JFTA 1QRQA 1XYBA 5I77A 2VOMA 3SCTA 4ENLA 3WF0A 3MZNA 3S6DA 1UZDA 2DV0A 3KS5A 4NXSA 2CZDA 3LPGA 3GNOA 4C6QA 5AZ1A 1G4SA 3UWWA 3CB8A 4NQ1A 4BQ4A 3SRDA 4WJEA 3C0LA 3STGA 1J0HA 4JY9A 3LGGA 1XM3A 2FH6A 2EG6A 3CUGA 3ZVHB 3RO6A 1RHCA 4FLSA 5HQEA 3KBNA 3W81A 4X9YA 2H3BA 3A5FA 3QTGA 4GBDA 4P7NA 2OTDA 2IKHA 2VFDA 1W8GA 2QVHA 1IEWA 1GCYA 3D6NA 4L56A 1Z32X 3IIXA 1OWQA 3UY7A 5F2IA 1OHLA 4LAZA 4F2BA 3JZEA 4W9TA 2P53A 5IHSA 2XH0A 4CU6A 2H90A 3ZMRA 1FWFC 2XZ7A 3LUTA 3O6CA 1NFGA 3JRKA 3AJ7A 2O92A 1VIWA 2NVDA 3C3UA 4JTRA 1RLCL 4K68A 1I4NA 2QYGA 3VA8A 2BG1A 2Z26A 5AKQA 1A5LC 1ICSA 1Z3NA 1ZQ5A 5HJXA 2ZX9A 3PG8A 5D05A 1OEPA 3AXHA 4DUVA 2VWTA 3W00A 3LY0A 1W91A 1VEMA 3S5ZA 4CD7A 5FJUA 3LX9A 5U4NA 2PU1A 2VGGA 2RJGA 1XI3A 1H4PA 2XM1A 3FJNA 2WANA 4Z2HA 2V69A 3M0XA 1EF3A 1LG1A 4XBSA 5IBXC 1YIXA 2YKKA 5CSSA 4NUWA 1GW1A 3Q67A 1EJSC 3KP0A 3SIZA 3TUUA 3MP3A 3CB3A 3WENA 3L9CA 2HS8A 4CQBA 2GGEA 4F0HA 9XIAA 2YXGA 3AALA 2QJHA 3O06A 2A0NA 3CZKA 3OW1A 1WAWA 3PZMA 3L28A 2XZ9A 5H8UA 1DORA 1MEIA 1UBPC 4IPJA 5M1TA 3VKCA 1H7NA 2W63A 1OCBA 3SCSA 4IIGA 1V79A 3B9DA 2XJ7A 3LZ5A 3M07A 2VC7A 3LM7A 4UBPC 2WNNA 4JTAA 3O15A 3H2EA 4C6DA 4ERIA 1EJ7L 2X1IA 3NR0A 3EPNA 2GJNA 3HPXA 1Q6RA 2GPTA 2NUYA 2QCDB 3KS4A 4UNLA 4PTDA 2R6OA 1SM9A 4XKYB 5BMXA 4F79A 1OGGA 3O2LA 3BLDA 3LV5A 2GGJA 1JCTA 1K4GA 3SQMA 2Y5SA 1VBJA 3MKKA 3P62A 2V2HA 2Y2JA 1HZYA 3L21A 1YHTA 4YHEA 1GNXA 3UFYA 2Y8VA 3S6OA 3PBGA 3T1GA 5CQ1A 3MQTA 1EX1A 5T9CE 1IT0A 4GA8A 4MSSA 3UGRA 1XGEA 1PX8A 2NSXA 1UKTA 4JIPA 1XLGA 5HDRA 4E6MA 3VFLA 4RDYA 3SCVA 4LUTB 3GU2A 3BJTA 1S5NA 4H2CA 2JE5A 3H2OA 3ANUA 3QHMA 3NQ6A 2A7NA 4O4VA 1J01A 1KXVA 4O18A 3TH6A 2BNJA 3EEZA 2QW5A 5MKGA 1ME9A 2ZADA 4MM1A 4HU8A 3II1A 3RDKA 1BRLB 4GQBA 2VTFA 3DEQA 2PWEA 4TR9A 5HINA 1YRRA 2YXXA 3CHCA 3S83A 3JUGA 1VEOA 5A6TC 2CWXA 2Y7GA 4FXRA 3AS2A 3QV7A 4GXPA 1OT1A 2PDCA 3QMSA 4O53A 1JGMA 3G1RA 4GO8A 3WQVA 2PGRA 1OCJA 3P84A 1AH3A 3C0QA 1JULA 4ZQMA 3WUGA 1J0ZA 1H1YA 1YNYA 3PAJA 3WX7A 1CXFA 4TXEA 4MAZA 4JFUA 4KCTA 2CERA 3T42A 2GSHA 1RH9A 5D33A 4FNSA 3ZJKA 1V3JA 2WVVA 4NIRA 2F8QA 4K1WA 4R85A 3VZYA 4DPPA 2VFEA 1W8SA 4MPKA 1KBKA 4QS6A 1R9XA 5AVHA 1UJQA 3GSMA 1RCXB 5L9FA 1XCFA 3H2AA 3PZ9A 2ZOXA 3LI0A 4GY0A 2PTDA 2ACRA 1H7OA 2W6RA 4P8WA 1UOKA 1RP9A 3G3MA 3P8IA 4UTJA 5EMJA 2CWNA 4GH3A 1I6NA 3IPWA 2FKPA 2GQ3A 1E40A 7REQA 4H6QA 4LYPA 1KFCA 4DN1A 1KKOA 1F3TA 2QIIA 5FOOA 1LORA 1O5KA 4CNSA 1ZBCA 4HA3A 1JZ3A 3VCRA 5BWAA 1PUDA 3D5HA 3WQ6A 1KFJA 4JTLA 1MFVA 3AIEA 3WLKX 3DHDA 2Y2LA 4GQQA 3XIMA 4E4UA 1ISZA 2PDLA 1SGJA 1Q6QA 4AX7A 4GYFA 1FWGC 1POJA 5D9OA 1OQFA 2W0UA 5E0FA 1MWOA 4OBSA 3B9OA 5BZAA 2VQUA 3P3BA 2XIOA 4L65A 4Q8UA 4M7SA 3BE7A 4EX4A 5BXRA 1RPKA 1XYFA 4WGXA 1XDLA 4FX7A 2V5OA 4LS0A 1EJWC 3T0AA 3T2QA 3VC5A 5H6HA 2FZ8A 1Y5XA 3STPA 4PB5A 2QUNA 1EC9A 1A5CA 4K2SA 1XHGA 4H6RA 2RDUA 4I9AA 4HPGA 3OP2A 2PFHA 3A3HA 3WK3A 3VE7A 3G1AA 1SSDA 1EO7A 3HZ3A 2OQHA 2ABBA 2XFYA 4FR1A 2GDUA 4MLRA 2H9AB 1WX0A 3QMTA 4JCMA 4BI7A 3LD5A 1YDNA 3V18A 4M5PA 4P2VA 4HOXA 1K8YA 4L1GA 4FOJA 2WC3A 3MTWA 4F2UA 2V2CA 4IMCA 1TWDA 2XGIA 4AZCA 1PYMA 5K4ZA 4MY8A 3OB8A 4E3TA 4Q4SA 3KTCA 3VD9A 1NF0A 1X1OA 2PRLA 2C71A 5HUOA 3MV01 2YGYA 4F4RA 1V7AA 4YYCA 4PMUA 3TC3A 4EE9A 3WLHA 3LMZA 2ZIDA 2A3LA 1IZJA 3OQ8A 2AGTA 1TJRA 4HMNA 3PVFA 3VX0A 4O0QA 1WDPA 3KHDA 1RA0A 2R14A 4JIQA 4ZR8A 4LG2A 2ALDA 1P4CA 3MI3A 3B8UA 2QIWA 5CPLA 3V36A 1ZALA 1SW7A 4DWSC 4QJ5B 2MNRA 4Q22A 1C90A 2ZVRA 4X3ZA 2EJ1A 1GVYA 2ZICA 1GZGA 3I7RA 3NSMA 4O54A 1RD6A 3RCNA 3HN3A 1U1UA 3BZGA 3SJ3A 3N29A 3VMOA 1GVEA 2Z0IA 5HWJA 4DY1A 3R25A 3UG5A 2GZXA 3KP1A 4NAFA 1ZTVA 1Q4WA 2Z28A 5FF3A 3QLLA 2WZHA 1A0EA 1A0DA 2X7VA 1QI3A 3B06A 1Z69A 3ALGA 3SY5A 2VEGA 1XSJA 3WEOA 1UPPA 5CSUA 3AYRA 1YDVA 4MUZA 4LCQA 3ZLHA 1TA3A 3RX4A 3HPSA 1F07A 1FVPA 2FGLA 3UPMA 3SQLA 1TB3A 3NOYA 5AHIA 5AC8A 3DYMA 1F05A 3W53A 3AU2A 2DP3A 1GW9A 3F5LA 3FS2A 1R6WA 3PTDA 3UEQA 1TPUA 4GLEA 3WD2A 4GVGA 4XWUA 1VPQA 3TYUA 6PTDA 1WAUA