4NZ4A

Structure of vibrio cholerae chitin de-n-acetylase in complex with 2-(acetylamino)-2-deoxy-a-d-glucopyranose (ndg) and zinc ion
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
403
structure length
403
Chain Sequence
PKGTIYLTFDDGPVNASVEVIKVLNQGGVKATFYFNAWHLDGIGDENEDRALEALKLALDSGHIVGNHSYDHMIHNCVEEFGPTSGADCNATGNHQIHSYQDPVRDAASFEQNLITLEKYLPTIRSYPNYKGYELARLPYTNGWRVTKHFQADGLCATSDNLKPWEPGYVCDPANPSNSVKASIQVQNILANQGYQTHGWDVDWAPENWGIPMPANSLTEAVPFLAYVDKALNSCSPTTIEPINSKTQEFPCGTPLHADKVIVLTHDFLFEDGKRGMGATQNLPKLAEFIRIAKEAGYVFDTMDNYTPRWSVGKTYQAGEYVLYQGVVYKAVISHTAQQDWAPSSTSSLWTNADPATNWTLNVSYEQGDIVNYKGKRYLVSVPHVSQQDWTPDTQNTLFTALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Deacetylase DA1
publication title Structural basis of chitin oligosaccharide deacetylation.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Hydrolase
total genus 147
structure length 403
sequence length 403
chains with identical sequence B
ec nomenclature ec 3.5.1.41: Chitin deacetylase.
pdb deposition date 2013-12-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.90 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4nz4A02
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 4nz4A01
3QBUA 4NZ4A 4NY2A 4NYYA 4NZ1A 3CL6A 3WX7A 1XW8A 2DFAA 1V6TA 3S6OA 2I5IA 4NYUA 1W17A 2J13A 2XU2A 4F9DA 2W3ZA 3CL7A 2QV5A 3RXZA 2VYOA 4OUIA 1W1B1 4WCJA 5JMUA 2E67A 4L1GA 4NZ5A 4M1BA 3HFTA 1Z7AA 4NZ3A 2IW0A 2Y8UA 1W1A1 3VUSA 2C1GA 4HD5A 1NY1A 4V33A 5BU6A 4U10A 4LY4A 2C79A 2NLYA 2CC0A 2C1IA 4F9JA 3CL8A 2C71A
chains in the Genus database with same CATH superfamily
2V5JA 2FFCA 3CL6A 1EB3A 3I3EA 1XS2A 3APYA 4A3RA 4YVPA 5F4WA 1HO4A 3GIQA 4ZB5A 3L4YA 4DRSA 1N2VA 1TELA 3PHAA 5D04C 3HQPA 4Y8FA 4HMDA 3LCHA 1Q6FA 2CLIA 3MMUA 4AB4A 4GIRA 2DEPA 1N7KA 3IIPA 5C7VA 1RA5A 1V77A 4ZE5A 1GK8A 2ZUMA 3LEPA 5FJIA 1XLCA 4GCXA 1EZ2A 2FLIA 3PUEA 4HB7A 1AZ2A 1IHIA 3STEA 2VR4A 5G2WA 4JKMA 3LV6A 3M0IA 4YMZA 3WNMA 1IEVA 5LA0A 4O12A 3T0AA 3RX4A 2FFFB 4LT9A 4WSKA 3RR4A 3C4UA 4PR4A 1CXIA 3LY0A 3VOGA 2VZSA 1P4CA 2PPGA 3ITTA 1Z44A 2XD5A 1X39A 1R7OA 4I9AA 3FJNA 3PM6A 1BWVA 3L0NA 1HKJA 4JYEA 1RP9A 1OGGA 5A6BA 1A3HA 2W62A 2W9MA 2YL9A 3T2OA 5H8PA 4H41A 1DIKA 3OO2A 4IMFA 3WQPA 1GVSA 3FDGA 3HB9A 5AHEA 2WB5A 1TVLA 3MMDA 3VGHA 4IQLA 4MWAB 1Z3NA 3WFZA 3FDKA 1EKOA 2FVMA 4AZ5A 1PCKA 2KX9A 4J9JA 3V0TA 2QQ6A 1TV7A 1LP6A 3RM9A 4UNIA 5A8MA 2IPFA 2ZXDA 1FXPA 1PVNA 2WHLA 2Y24A 4DPQA 2CKRA 4GUJA 1OG6A 2NVCA 1XG3A 4DELA 3QYQA 2PS2A 4RX0A 2CBUA 2NZLA 5DMMA 4EK7A 4HYWA 1HKMA 2V63A 4G6CA 3VNLA 3ANVA 3B0UX 4AMAA 3W7EA 3F4WA 3SW6A 4ZB2A 2XIQA 1KFBA 4QJ1A 3R89A 4KWWA 4DJED 4M80A 3PVFA 1M01A 4A3UA 4OJ5A 1EJSC 5D2TA 1UWSA 1XIMA 4BEQA 5AC5A 4R7OA 2JF7A 1EC7A 3VOHA 4H9UA 6CGTA 3KZPA 2DVTA 1WO2A 4IISA 5AYIA 3UJFA 4JX4A 1DVJA 3P0XA 4GJJA 3C2RA 3W82A 5JXQA 4M5PA 2D22A 3BH4A 3O6CA 4XKMA 1XCFA 3W85A 1JI2A 2D1ZA 2HS8A 3BLKA 3FCPA 5CJ5A 1TCMA 4BR1A 2PLKA 2VRKA 3QGVA 5DBTA 3DFNA 3EMZA 3M5YA 1BYAA 3EX3A 3ZWSA 5LNUA 1CNVA 1E4IA 1XLMA 5BYWA 2ZIDA 3FJ6A 5C9UA 3TK7A 3HG2A 3VC5A 5TD4A 3PUGA 3M0MA 1VYRA 3UPBA 3TAKA 4KEVA 5F4SA 3FJ4A 2CZVA 4D72A 3OLIA 4X9YA 1GCYA 3QKEA 1E43A 4GA8A 1B31A 5I07A 2E67A 2OVLA 3TLLA 1WQ5A 5HXMA 3RAOA 2G3JA 3WDQA 1UR3M 3LB0A 2W63A 4KPLA 5JBDA 1KBKA 3UJEA 1L0PA 4IGMA 2CYGA 1AW1A 2CWNA 1RJQA 3DZ1A 2I16A 4PRTA 4ICNA 3SGZA 2VGIA 4ZQPA 5ABEA 2JALA 5CGTA 3RITA 4E8DA 2X1SA 2HVOA 5ABGA 3CBWA 1S3HA 1FY6A 1KM1A 4KETA 3L29A 1V6TA 2DORA 3IAPA 4HPJA 4MJ2A 4OT7A 2HXTA 3U57A 1E9YB 4TVDA 3KVJA 1Q66A 4D1IA 3PUOA 3OVPA 4GVIA 3KOFA 4D6HA 5CXPA 1YDOA 4ACZB 5DY2A 5LHFA 3J7HA 5A8OA 2EJAA 3MCMA 1E5NA 3K8KA 3MHFA 1JDDA 4MJZA 5F2MA 1X7FA 3EKGA 1TO3A 2XG9A 2YX0A 3L27A 2W27A 4IBEA 4ZA0A 1YX1A 2O9OA 4UTMA 2OU4A 2HPMA 1P6WA 1LOLA 4JTQA 4HN4A 4JKKA 3UCCA 1QPNA 4AZ6A 1GQLA 2Q3RA 2INZA 3N25A 4PMVA 1TE6A 3LBOA 3H4WA 3UGVA 2ANUA 4ZSTA 3GHSA 2Y2OA 3APTA 1Z69A 2VEGA 4MOZA 2JCHA 1C29A 3UNDA 1Z42A 9RUBA 3VD4A 5A95A 4EVZA 1K77A 3TZNA 3DYMA 2C7FA 2F6KA 1C90A 1HKIA 3TDFA 5FL1A 3TFXA 3HTWA 4ADUA 2VWTA 4XSLA 2YXGA 4MKSA 4JCLA 1JQXA 1FCUA 2HSAA 4J2PA 4DXKA 2B4GA 2VEMA 4EF9A 3ID7A 3O63A 4Q8OA 2JKPA 3I7RA 3UG8A 2QMJA 3BGJA 1VRDA 5HAOA 2GGGA 4ZMGA 1R87A 3VGEA 1OCNA 2BVDA 3NJ3A 3IIOA 4DYEA 1XH1A 4OBSA 4C6FA 3AC0A 3M47A 1E1FA 1VHNA 1BVZA 1KD0A 2BSLA 2E5DA 2ZX5A 1UR9A 1XLAA 4GZEA 2WBGA 1Q6DA 1IZJA 3BJFA 1KTNA 2ISSA 4ACYA 3R5EA 3N1AA 5BW6A 2CZEA 2C91A 3URQA 3BICA 1TPWA 4IM4A 3IV3A 3GC2A 2ZKMX 3ENLA 4WY0B 4J35A 3W2JA 3NR0A 5FA5A 3ZMRA 4QLLA 1GHSA 3G1XA 2O7SA 1FWGC 1TWIA 3AICA 4LAKA 3E5PA 4M7TA 3PG8A 4TV6A 1W8GA 3SI9A 1SZGA 3E3HA 4HOZA 1DXEA 4MPQA 4J28A 4L1XA 4PC8A 3SUVA 3W2KA 3XIMA 4GABA 5FI8A 2PTWA 2A4AA 1JD7A 1HGWA 3MB9A 3KBWA 2CZDA 5LGZA 3MP5A 1E6RA 5HWMA 1E0UA 3BAJA 4XAGA 5BXSA 4DQWA 1Z48A 4K68A 4MWAA 1QPQA 1FVPA 3S6TA 3H2CA 4QG8A 1TZ7A 3AYTA 4WEVX 1PKLA 1S1PA 1MEIA 3UXDA 4AXKA 3GNPA 1GJUA 2ZRVA 3TMQA 2I5IA 1PYFA 4M81A 3BLIA 2ON3A 1OFAA 3NL3A 3O05A 2TSYA 1GKQA 2ZA2A 5AC7A 1L6WA 1VD6A 4GG9A 4IP4A 8TIMA 3LRLA 2D23A 3CUJA 3QZAA 1JCMP 4IL0A 1Y5VA 4JTSA 4NYYA 4ZGYA 4B3ZA 1J7MA 4DEFA 4DY1A 5I03A 3SUSA 4RJEA 3F2CA 3OYZA 5DBUA 1GVYA 2OSXA 5FJOA 2Z2UA 3KL5A 5AYBA 3G8EA 2J8FA 2FZ9A 4AHOA 3LHTA 1TQJA 4ALDA 1VLWA 4FOKA 3OPSA 1EEXA 1ZAIA 3IAQA 3OA3A 4K6AA 2NSOA 4HNCA 2IQTA 2CEQA 1ITQA 4UR9A 2G8ZA 2OO6A 2WPGA 6A3HA 1SR9A 1AG1O 3FHAA 5G4EA 2P8CA 3WUEA 1XYCA 3IRDA 3EBVA 5B7YA 3ZQ9A 1K9EA 3UQNA 1ZSXA 3BCJA 3L21A 5EMJA 2DFAA 2OSWA 5IHRA 3WKZA 4JD4A 1U1JA 4DJFD 2H90A 2Y4SA 4JDBA 1R3YA 4RZBA 1UWAA 5HWJA 3WCZA 4IBJA 2V69A 4QP0A 5HPCA 4GH3A 3WLTA 4Z1BA 3B8SA 1HJUA 2FH6A 1GQKA 3KCJA 4Q7IA 4C65A 4CU8A 4PMRA 1XR2A 3A22A 3TUUA 1E4MM 4Z1AA 3GTXA 4P8XA 4K8EA 3JW7A 4GNKB 3RFAA 5CC7A 3K30A 1LOQA 4K8GA 4ZENA 5BRBA 2E8ZA 3WENA 3RILA 2GQ9A 4IFRA 3U4AA 1YU4A 2R1KA 4LTSA 2FDMA 3WBYA 3C56A 3NVTA 4EXBA 3CIVA 3LLXA 4E2OA 1RAKA 1QO2A 1W3HA 2R14A 4S23A 3QY8A 1U1HA 2IMRA 2R9RA 2V38A 4DBSA 4DAFA 1SO6A 1J5TA 3SBFA 2JQXA 1Q63A 1VYSX 3AXIA 3PFMA 1PZ3A 2ATMA 1TQXA 1TUXA 3K4WA 1T41A 1KXVA 1UOZA 1V7AA 3GY1A 4OIFA 1X8CA 3QSRA 1NH6A 3G1SA 4HQVA 4MTVA 3T40A 2AAAA 4BHYA 4GYJA 2PZNA 3VE7A 4QHRA 3WQEA 3MUIA 4ZEPA 2WVUA 3DECA 4QXIA 1G9HA 4Y9MA 4M6VA 2AGTA 3LV5A 1Y0EA 1RBOB 1F5ZA 1Q7QA 1K02A 5DMNA 4ACZA 2QCMA 2BHUA 3S46A 3AWNA 2E9BA 4FLRA 2E1WA 3QY7A 2D3NA 1CLVA 2PTYA 3PUDA 1XBYA 3UXKA 3TW7A 3SFKA 4MAZA 3ITCA 3FIGA 4RZ6A 1EWEA 3UZJA 1VJSA 2EKCA 3APGA 4QJ3B 4K3ZA 1Y7VA 3UY7A 3CO4A 3V35A 3T42A 3UZWA 4LOCA 4NASA 4AWSA 1UUMA 2WMJA 2I9UA 4FR1A 3WDJA 1W9DM 1E6SM 4QITA 1UG6A 2I5GA 4IWWA 5CQ1A 1KW1A 4Q4PA 3WJXA 3IJ8A 4FZIA 3DU0A 4R53A 3W72A 4E4FA 4H04A 4A22A 4O13A 4KWSA 1OGBA 3S4TA 4W8LA 3JZUA 3NAVA 3CZKA 2YPIA 3S1WA 1K4GA 1R47A 4NYUA 1V7YA 4BY3A 2VR5A 4LNCA 4NL1A 1KFEA 3ZT5A 1ADSA 3CPGA 2AQVA 4DUXA 1ICSA 1IXPA 4XZBA 3L2MA 1AVAA 4H2HA 1K6AA 4P61A 3PZTA 1UJQA 1XRSA 3II1A 3OTRA 2WLYA 3MO7A 2VZOA 3CHEA 3OLGA 2FZNA 4TQTA 4YTQA 2W3ZA 3ZSTA 4A3YA 3KTCA 2C18A 2DZVA 2OYMA 4D1JA 1XIDA 1KQZA 2J7BA 3EWCA 3QY6A 2PDMA 3V7PA 4KCUA 3ZO9A 1MZRA 3LXAA 3LPGA 1D3GA 1MXGA 1P5BA 4B5XA 3SY5A 3CUGA 1HL2A 1QPOA 4W9TA 4IL2A 4EAYA 3EWXA 1J0YA 4WY0A 5DX7A 2VC7A 4H8HA 3NZQA 1I1XA 1ISYA 1H5VA 4HA1A 4OBTA 2AQWA 4LUJA 6ENLA 1A80A 2YKKA 4GO9A 4C1KA 4LW7A 1OEPA 4XUGA 1E0XA 5F1UA 4B4FA 1MI3A 3S9IA 4GY1A 1A50A 2V5DA 2Y2WA 2J9XA 4WDXA 1VAHA 4WKHA 3H22A 1X6NA 2GJLA 2E68A 1ENUA 3TU9A 4X0NA 2PGRA 3GR7A 3ERPA 1BSLA 1L6GA 3TYCA 4RXGA 5C71A 2Z1BA 2A7PA 4HJWA 4AZHA 5K9DA 4G56A 3COTA 2VXNA 3UG3A 4CU6A 1CDGA 4DBWA 2WWDA 2L5HA 4AYSA 2OWWA 1LL7A 4QJ5B 4ZFCA 3GXTA 4DLMA 1O1HA 1UQYA 1TPVA 2ZRXA 4YCOA 1U33A 3W25A 4N2YA 4DF2A 4IJEA 4S2BA 1KLZA 2YDRA 4QDWA 1TMQA 3SN0A 2X40A 4CNSA 2O9RA 3DIPA 1UD6A 2Z27A 4EP8C 2ABBA 4JTLA 1K6WA 4IPJA 2VT0A 3BGGA 3LGEA 4C6QA 2R24A 4PCFA 4P7NA 3LCIA 3TP4A 4OE7A 2OKTA 3U2EA 5IDZA 1UROA 2I7GA 4DZIA 2P5NA 4F2UA 4IGNA 1QW9A 2GQ3A 3HGRA 3HGSA 4I7VA 2PDYA 1R3SA 3B04A 3CV7A 2WW5A 3ZJ6A 1AFSA 5ECUA 5G1MA 1ECEA 1PYMA 2BGQA 2V6AA 4L1GA 4QAIA 1GEHA 5JQ9A 2WSKA 4U2ZA 4BK9A 5BU9A 5GNYA 3OBKA 1OX4B 3WH5A 3MI2A 4F2BA 3ZOAA 4GX8A 1PTDA 3L4VA 2ICSA 1UCWA 3N04A 3T55A 1KXTA 4UWMA 4CD6A 3PTKA 1US0A 4GJ1A 4RE3A 2V3EA 1C91A 2NQ5A 1W9BM 3EDDA 1W32A 1JCNA 1SZRA 1UBSA 2XDFA 3CV2A 1LQ0A 1B1YA 3EA1A 4B92A 2FVLA 2OKOA 4OUEA 3VDGA 3KDOA 1HXJA 2V3DA 5FAGA 5LXEA 2XIOA 4L6HA 4L6DA 4WIWA 3UWQA 4PTWA 1M41A 3M16A 2NX9A 3TYDA 1NM9A 5DMLA 4IIFA 2XVNA 3AQUA 2WVVB 3MZ2A 3Q94A 1OBAA 5EY5A 3AMLA 3G3MA 4A8IA 3DYOA 1B4EA 1X6LA 5FAJA 3TTQA 1LWIA 3LYEA 3UZYA 1QNRA 3WMSA 2EPOA 3RMEA 1KNWA 1FWTA 5K9XA 4PGLA 1J2WA 3R8GA 3F5KA 4BJHA 1DJWA 2OQYA 1KR0A 3OZOA 4NNCA 3W0KA 3KVLA 3OHMB 4ERAA 1DBTA 4IZGA 4KFOA 2V5CA 4N6EA 3UXIA 4A29A 3H2MA 1I2OA 1OB0A 3L4ZA 1NIUA 1BXNA 4XAFA 3HQ1A 4HNUA 4CD7A 2PDXA 5DN1A 1EGZA 2W67A 5CJMA 1TIMA 2CLEA 4NVTA 3RM8A 3M1ZA 1TPEA 3AHVA 3NA8A 1FWDC 4X61A 3USBA 2Z7KA 3A23A 1Q8JA 1A3WA 3G1RA 3PTMA 1Z32X 1W2PA 3TSDA 1KGXA 1KRMA 3AHYA 2XGZA 3DG3A 4BQ4A 3MJYA 3FKEA 3U5YA 3ABRA 1OY0A 4J3XA 1UZHA 3QMTA 1QOPA 3UFYA 3SRHA 3OEXA 1W9XA 3QSTA 3B4YA 3KAOA 3KCLA 3MQLA 5AHNA 3IK2A 5C2GA 2DUAA 4GZIA 2VO5A 3VA8A 5D30A 3E0FA 4HPHA 1O5KA 1R2TA 5JBEA 4Z2HA 1QASA 1MRAA 3OBEA 1RCQA 3E6EA 4YXGA 3NTYA 5A94A 3I10A 5D38A 1EOKA 1HKKA 2DVUA 3W23A 1FUYA 5G1YA 2IKGA 2VD8A 3G0XA 3S83A 1BXCA 3BLLA 3B9EA 3GDKA 4W86A 8XIAA 4N9DA 4TUFA 4LC8A 4GACA 3WQVA 3RHGA 1MDLA 1GQIA 4JYFA 2AGKA 4OWGA 3V4BA 3ITXA 1RSCA 4L4LA 1BPLB 1FWIC 3CPRA 4X63A 3GAYA 7XIMA 4C91A 1XLJA 3ITLA 1BYBA 3SSJA 4ORMA 3ZT6A 1XFBA 3PY2A 2JE5A 1ZBWA 2GJXB 3SZ8A 1J0HA 3GYEA 1E51A 4H8UA 4O1BA 3H7RA 4H2CA 3R8RA 1SO5A 1F3WA 1IXQA 2G3MA 2XZ9A 2PDPA 1XF0A 1HG3A 3L68A 2V81A 5H8MA 4JTFA 2ISDA 7PTDA 1GW1A 1NF7A 4A05A 1E3ZA 3QV9A 1QO6A 2YBVA 2YLLA 1VIWA 4GVGA 1RD5A 2FTWA 4H6KA 1V0NA 3BW2A 4H9VA 2DIJA 1OFPA 3QTPA 3DI1A 3NXFA 3MW7A 3WY1A 5K3VA 3UWVA 4YJ5A 1J79A 2J6XA 3CWHA 3B0VC 1GJPA 2CCRA 3S42A 3H2OA 2Y8KA 3SY1A 1OYAA 1YPIA 1AD4A 4HMEA 2A3HA 1FKWA 4HCLA 4F8XA 1TA3A 5CEWA 2TYSA 1ICPA 2J9ZA 3EXTA 1L6FA 2G5WA 4EPBC 5DT5A 1PIIA 3LGDA 4J3ZA 1UW9A 1WBJA 2Z7GA 5AVNA 5ABTA 2XVKA 1I45A 1UWQA 3VKKA 3BLDA 1KBIA 3B0PA 1E15A 2VFFA 1CPUA 3R0DA 3AS2A 4K8HA 1T8XA 3O8AA 2QPXA 4PBGA 3KFTA 2R1PA 4R27A 3SSZA 2Y2QA 2DIKA 2FGBA 2JIEA 5I06A 1ITUA 4WX2A 2VEPA 1Q4WA 4MB1A 4XG1A 5E0FA 3I65A 3R8HA 3VI2A 4CQAA 3GVRA 2BOEX 4CD8A 1XI3A 2VDGA 1KCLA 4JL1A 1H7WA 2WKLA 2AOSA 4L9YA 5E6YA 3B9OA 4LJ3A 1JZ3A 5M3WA 3IWPA 2RGLA 1QHPA 3QR1A 3QN3A 4KEZA 3N6HA 2IPWA 4PUNA 4F0KA 1AH4A 1E6XM 1BWLA 4J3WA 3B06A 1U22A 2CXEA 1IT8A 2QZRA 4GVHA 2VX4A 3FKKA 3UESA 3OQ8A 5AVHA 3HSHA 3CUZA 1XIEA 5KEZA 1CB7B 1NVMA 3GUWA 4OZOA 3OB8A 2BHYA 3NDYA 3OA5A 3KTXA 1V6VA 2GGEA 3LS9A 1TIWA 1TREA 3ZM8A 3EB2A 1H0IA 4LV4A 3UF9A 3CB3A 4ZOCA 4IFOA 4C7FA 3VIHA 1VCFA 3WLIA 1F3TA 1GEQA 1OK6A 4GY0A 1XC6A 1OD8A 4F79A 3ARVA 1PTAA 3UA4A 3RJYA 5CZ0A 2ZWZA 3MCOA 4M6QA 3B4UA 1HTIA 1AJ0A 3QMSA 3OVGA 1G4TA 3VKAA 1EQCA 1O60A 2V5BA 5M1TA 1NELA 1REQB 3PTQA 4J3SA 4ZO9A 2WVVA 3KDNA 3TXZA 3U0HA 4C6DA 2Q02A 3VIKA 2DQWA 1BVWA 1LDCA 3C8FA 3L12A 4IT1A 2VOMA 3CTLA 1PWLA 3MI6A 3IEBA 3MUXA 3ZJ7A 3WNLA 2PEVA 1NARA 1IGWA 2DZXA 3UPWA 2D2GA 5AC8A 4OECA 3TVAA 4NZ1A 1JF6A 1J18A 3CUHA 1B9ZA 4PCNA 3GW3A 2ZUSA 4Z1YA 1RJRA 3P84A 1OF8A 2XWDA 1S5WA 2CNCA 3DENA 1QFEA 3LTSA 2GZXA 4KERA 3AHTA 3ABOA 1MNSA 1A47A 1J12A 5FEWA 3SCWA 3CPUA 1FCQA 3PZUA 3LLDA 3JU2A 3NDZA 3GKAA 4JOMA 1B3ZA 3W2MA 3C0SA 1IYXA 3A4WA 4N6FA 3OVRA 3QFEA 2VL4A 3H23A 2GVLA 1KM2A 4US5D 4XUYA 2NXGA 4L64A 3TJ4A 3EZ4A 3DFYA 1HFBA 3CMJA 1CGXA 1SUXA 1JD9A 2ZOXA 3D5HA 3M7PA 3MBDA 2XH7A 2XTKA 2ZC1A 3PF3A 4DYKA 3TWAA 3HGJA 3E0VA 4B5NA 1LQAA 4RLIA 2BFGA 2P50A 2QF8A 1B90A 3Q65A 2Y2PA 2H3BA 4LGXA 1Q6OA 3E0WA 4F48A 3N4AA 4HHMA 4YU1A 2VRJA 1LRTA 4S38A 1EX5A 2XWEA 2OT0A 3GUGA 3SRDA 1HUVA 3SUTA 4ASTA 1Y5XA 4DBDA 2YLAA 4LPCA 5EKYA 4Z1DA 4RZ4A 1NWUA 8XIMA 1U30A 3C2FA 2E5BA 3S2MA 2FDSA 3NOYA 3PAOA 1JYNA 1JGIA 2FPVA 3ITVA 1XG4A 4JQ4A 2G96A 1KFLA 4AVOA 2RH9A 3EGJA 1FCBA 4YTRA 4Q8MA 3LLFA 4GH9A 4QEHA 2J7CA 1NOUA 4D8LA 3CUIA 4JNZA 5PTDA 2TODA 1UD5A 3VD5A 1GZJA 1GGOA 4QDMA 1SFSA 1RALA 2GJXA 1R0MA 4QISA 4PMOA 3S5YA 2FTYA 3QR0A 1A0CA 3ABZA 1EJTC 4P8UA 3KUMA 4UR8A 3W84A 1H60A 2WJZA 3ARSA 3FY1A 4JN8A 1OCJA 3JZEA 3DGBA 3AUJA 2Y88A 3AOFA 3A13A 1CT5A 2EPLX 4H6EA 3UZZA 4AC1X 2OODA 4IX0A 4S2CA 2V2HA 3SCOA 4UOZA 5CJNA 3W6LA 3MZNA 5IOBA 4IBCA 2UWXA 2P88A 4I9JA 5IBXC 5J04A 4V15A 2Y7EA 3M0HA 3AISA 2IXVA 2ZZ2A 1G1YA 3CTTA 2J79A 3NNTA 4AD5A 2VCAA 1J6PA 4H7CA 5FIPA 1XINA 1YE6A 4DXVA 4JXCA 3EPOA 1HQTA 1OJXA 4GYPA 4D2JA 4PMYA 3CK5A 4PB4A 4B3KA 4FX6M 3M6DA 4FNPA 1XGZA 1DQUA 3NFUA 3CZ8A 1Z8AA 2MNRA 3M44A 3N3TA 1XHGA 3PZNA 4MLJA 3NXLA 4N42A 4QE1A 1PEZA 1L6JA 3DHDA 2YDAA 1TCDA 3P5ZA 3G2GA 3M41A 1X96A 1E0TA 1R8LA 3VKJA 3OVQA 1W3NA 3BSGA 1ITCA 5K9CA 2XFWA 7TAAA 5DCDA 2P0OA 4CNNA 2YCLB 4LUTB 3WEMA 4AMCA 1MVYA 2QHAA 4GI8A 4DWSC 5C2XA 1OCQA 1Q7ZA 2WZHA 3LSBA 3VOIA 3W27A 3DUGA 4JQ3A 4OJPA 4Z2GA 2QJNA 3NVDA 4UTUA 3QM3A 4N4PA 3FAXA 3U2ZA 1X6UA 1CXFA 5IXEA 1R9XA 4QJ4B 3N2CA 4IIGA 3VFCA 2XH4A 1KCXA 4ML9A 1XIGA 3WQ4A 2D0FA 1F2JA 1PV8A 2WPBA 3ZFHA 2HEJA 3QGKC 3FVDA 3WH7A 3B3DA 1JPKA 3H7VA 5EGRA 3UG4A 4AW7A 4CVWA 4TOQA 3H70A 3PPFA 5ABFB 5DEZA 1RZMA 3W7JA 1WDDA 1CGUA 3LUTA 6TIMA 1QBAA 3DG7A 1P6CA 1BFNA 3CIWA 5FF7A 1V03A 3AYVA 1SGJA 5RUBA 3B03A 1EPXA 4UMCA 4KCVA 5HOSA 3B8IA 5A5WA 2D49A 4TX8A 2V67A 2OELA 4O1AA 4S1FA 4B2DA 3DBPA 2WJEA 4G2DA 1ZHAA 3UD6A 2ADAA 2QCDB 3BG9A 1WAWA 3CQ0A 4X2PA 2CETA 3O6AA 3QF0A 4C60A 2PD9A 3WQWA 4MPKA 3U2CA 1V4YA 3M64A 2YW4A 3BLFA 4PBEA 5CSUA 5CLWA 1Q7MA 5T91A 2EF9A 1TV4A 3CS2A 3TQKA 3N6QA 1REQA 2OEJA 1EUNA 2OG9A 2J27A 3KS4A 3BTNA 4ZZ9A 4LAUA 1UA7A 3UXAA 5CG0A 1XCWA 1NAL1 3WLPA 3KM8A 2I1OA 2YDQA 3SCTA 5AB3A 1JNEA 4E5TA 4M1RA 3WZ0E 1BG9A 2Y85A 4Q4SA 3VM5A 1P0NA 2XSBA 4F66A 3MUY1 2GUBA 2I57A 4R88A 2ZICA 4L9XA 2VFIA 2FH8A 1DIEA 1MFVA 1XL9A 5FJUA 1P48A 4JTJA 5C9ZA 1BWKA 1JIBA 4FS9A 4RDVA 4BKNA 4Z2LA 3W88A 1PO9A 1M65A 2Z0IA 3GW0A 4U5KA 2D0GA 2YCJA 3VX1A 4QAWA 2ZUNA 3ECQA 3LD5A 1ZALA 2Y8VA 2E4TA 1UPMB 1TV3A 2BX7A 3CB8A 1JRCA 4O57A 3K4DA 1H1NA 1YU1A 2R8WA 3BMWA 4Q3MA 4G8TA 3BG3A 1D8WA 4LYQA 2Z1VA 5IDIA 3ALGA 2J8TA 2QPUA 3GTFA 3IJLA 3ATYA 1RCOB 4O28A 3DFOA 4H6RA 2GOUA 5LKYA 1UWIA 1IQ8A 1U1UA 2G37A 3A4JA 1E73M 4XIAA 4MUPA 3RK8A 1WZMA 3VUPA 3EA2A 4GINA 5GJPA 2EPKX 2Y2IA 3MSRA 2YA0A 4LS0A 3G18A 3CHVA 3VIJA 1CENA 4GNVA 2PWEA 2OB3A 3IJDA 5D33A 3A6OA 2X1RA 3PB2A 3V1HA 3CO8A 4YVXA 5CLTA 1AA1B 3KBMA 4LVFA 4JHOA 4IGSA 2JE8A 4NIRA 3B0XA 3UWZA 3P61A 1TJPA 4ZOAA 1QW8A 1W5MA 2BGSA 3A12A 4D6EA 3OODA 3L7RA 2DH3A 3E12A 9XIAA 1UH4A 2F38A 1E4NA 3AXKA 4LYPA 2Y5EA 2NQLA 4S3DA 2RDWA 3VGDA 3T78A 3WH6A 2HS6A 2E77A 1FWAC 1EUAA 1SMAA 1FP8A 1CW2A 4AQLA 1G0CA 4ZQMA 1XYFA 2B0MA 3GDMA 4H9YA 6XIAA 4HYRA 3O3RA 1FH8A 3S1XA 4OQVA 3W1LA 1RP8A 5FD0A 1VB9A 1UB3A 1BRLB 1PIFA 1DJNA 3L2IA 4DO6A 5TBOA 4JFTA 4JEJA 1ONEA 4C6JA 4ZR8A 1LG1A 3PN8A 1POJA 3HOJA 3VUSA 3MV11 2DZAA 4HZ6A 1XDMA 3EYPA 2BG1A 4GIYA 1W1IE 4POCA 1J6OA 1XLIA 3WLRA 5I2UA 4IPLA 1N82A 1DPMA 1K70A 3I3BA 1H1YA 2QV5A 2ZX9A 2VCCA 4QIUA 1A5UA 1MEWA 4Z17A 3W73A 1VQTA 2G4JA 2NWRA 2UY5A 1B30A 4GXWA 5L9FA 4XTIA 1DKWA 5LIWX 1IGSA 4KCWA 3DFPA 4H8NA 5BMWA 3RLUA 4BWLC 3M0YA 3KZSA 3SCVA 4LVGA 3E74A 4B16A 3OIXA 4IPNB 1FHVA 3NL5A 2WM0A 2BOGX 2EBNA 3GH7A 3JS3A 1V3MA 2VFDA 1YXYA 3CZJA 3W1MA 5D32A 1XIBA 4ILSA 3DGRA 3NZGA 1L6YA 3G6LA 1BTCA 1JPIA 1V3KA 1EC9A 4ZODA 2C0HA 5CSYA 4Z0SA 4LS1A 3K4AA 1BD0A 2NW0A 3ZLHA 2E28A 3GTHA 3A5FA 2WMFA 4MY9A 3W22A 3PJUA 3P80A 3GYCA 3VIOA 2A0NA 3MYPA 2PRHA 3LHZA 5BXRA 5D9OA 4IMCA 2XPKA 1W3JA 3VIFA 2YCLA 3BQ5A 1R9ZA 4RPQA 4C5ZA 1VYPX 2A3LA 2QNEA 4DO4A 3DFTA 2O4QA 4WF7A 4FNSA 3CEUA 4HZ8A 5CKSA 4L61A 1SZFA 1PHQA 3HA1A 3TNBA 3DDMA 4OU1A 5B7ZA 4P8VA 1UWUA 2YXOA 1RLCL 4O14A 1UR2A 2YL5A 4OUIA 2J9YA 1OX6A 5G2IA 3GR8A 1F4AA 3NG3A 2BBFA 5BRQA 1GJWA 3TW9A 1ISVA 1QCWA 2BG5A 3GNDA 4DN1A 1H49A 4JYDA 3A9IA 4GOAA 2Y63A 3SURA 2WZIA 5H91A 1KV8A 3SDOA 2VD9A 3QQ1A 2E40A 4CCDA 3QVQA 3WH8A 4DJDD 3WK0A 5ABFA 4FIRA 3RLGA 4UFJA 1V6XA 1DV7A 3NQMA 3ATZA 5E0CA 4UBPC 3ZLGA 3AIQA 3PBVA 3AS1A 2I14A 4UTHA 2Y61A 1BSIA 3GVGA 2V5OA 2X8RA 1A49A 1NWRA 2QV4A 4JFWA 4OOUA 1CLKA 2XYLA 3HONA 2YGYA 4O1DA 1KWGA 5D09A 3ITGA 4GFIA 3I68A 4JTAA 3GDBA 2QCDA 2XFYA 1B57A 1DJIA 7REQB 4UFKA 3ARWA 4AEFA 2FGLA 4ADTA 2P1FA 1GQNA 1A0DA 2PGWA 1BG4A 1GXDA 2PCEA 1ONWA 3W1AA 3WUFA 2X16A 3V75A 2VWSA 3GU2A 4LRSA 5EFFA 2CBJA 4JQ1A 2E8YA 5EPDA 3EWZA 3O07A 2HROA 4NP7A 1B4KA 4HHHA 4UMAA 3H12A 3GIYA 3RPTA 3N15A 1CEOA 2P10A 1YBQB 3MKCA 1XLFA 4NZJA 5AKQA 1VF8A 2Z1WA 4P8WA 3BO9A 4JY9A 4DUWA 4PTVA 4GLEA 2EEXA 3FSUA 1CCWB 1DWGM 1OM0A 2RHGA 3AJ7A 3ARYA 3TJLA 4A6GA 4DBUA 4X9SA 3IVUA 3UYCA 4MB5A 1L8PA 4DWDA 2WHJA 2AMXA 2E5CA 2X0SA 3AIWA 2J78A 3AHZA 1H3GA 5FJTA 3WD3A 4Q33A 3W2LA 4J3UA 5L6UA 1SYTA 1TUFA 4Q8WA 1WZKA 1TVNA 5GJMA 2HE5A 3NQEA 1DTUA 2WSQA 1G4SA 1GHRA 1JAEA 1WDSA 4BZYA 3A3XA 3EWDA 4PMJA 2A3EA 4X60A 2VMFA 1NOFA 2A3CA 4HZMA 1YRRA 2X1IA 3F5JA 4MHBA 1J0IA 3GO2A 3NGFA 3EX4A 1F07A 2P3ZA 1KWKA 4UQAA 1XD1A 4D6JA 3BW4A 4IP5A 3SJ3A 1BTMA 4Q4OA 4QLJA 1NEYA 4GHAA 2D3LA 3PBWA 3EWUA 2E25A 3L2LA 3XINA 1KBJA 4OJOA 1K4HA 1P7TB 1XKYA 1TRDA 3G1DA 1NDVA 3WBAA 1XFCA 4HPXA 1H0GA 3RCNA 4HSNA 2EGZA 3KOXA 1XQLA 1BYCA 1EA0A 1YNYA 4NY2A 1Q6GA 3CWOX 4HBKA 3RR1A 5KZEA 1JNDA 1LWHA 3NO5A 3PS7A 4DI9A 3AS0A 3LHUA 1UZ1A 4A4AA 1F8MA 4C1LA 1IR2A 1GOIA 1CYGA 1SSGA 3H7UA 1JCJA 3O2LA 4MKVA 3ANYA 1FCVA 2BY2A 3TN5A 2HTMA 3PJWA 3M0XA 3B8VA 5CC5A 5TIMA 5LNWA 1J11A 1E6PA 4XZMX 3KX6A 3UGRA 1ZFJA 1BRLA 1F8IA 3ZS4A 4ZB0A 2VI0A 3L4XA 3HMCA 1Q4NX 3P60A 5AFDA 1ZS2A 2ZUTA 3SIMA 4AIEA 3B9AA 4WLCA 3L23A 2Y62A 4NXKA 1JI1A 3EX2A 3UNTA 4W87A 3WDIA 5H6HA 3AYRA 1W91A 3LPOA 3H26A 5A6JA 1SJCA 1A5MC 4M6UA 4ZQCA 4XK2A 4DNHA 4L7ZA 2W91A 4R7WA 3H21A 3R0UA 4BF9A 2GLKA 4L5ZA 4Q22A 5C6MA 5I3DA 5FCZA 5K7JA 2WMIB 2C8NA 3TLQA 1M3UA 3W86A 2FMOA 1WX0A 3PB0A 3UCDA 5DCEA 1ZJBA 2A7RA 3DH7A 4LEFA 1N8IA 2R1LA 2CZFA 3L4TA 3E02A 1YDNA 2C6QA 4XZNX 3VNZA 1ZJHA 2C0AA 1RR2A 2XVGA 2VZTA 3WYZA 4XTDA 4R34A 3T81A 5GNZA 5A8NA 3SQMA 2Q8ZA 2NUWA 5C8BB 5A6AA 4C7DA 1Q6LA 3RJXA 3W9ZA 1F4HA 1VFTA 1JYWA 5IFTA 1U5HA 1HKWA 4GVFA 1XXXA 3LG3A 1CWYA 3W7RA 1YXDA 1PE1A 4DM2A 3F4CA 1JEZA 2NXHA 1FWEC 3QQ0A 4BI5A 3RX2A 4RV8A 2X41A 3I4EA 4UXDA 1B3YA 1P43A 4RDYA 3HFTA 3W7NA 4GIEA 1ECQA 4V33A 8A3HA 3K1DA 3MQTA 4GCAA 1FTXA 3KLLA 3WF4A 4YIWA 1O94A 3A3WA 3IJIA 1H5YA 2YYTA 1UHVA 3GG7A 1W37A 4S39A 3N13A 3NQ7A 1IE7C 1HJQA 3PNZA 1EPVA 1S1RA 3AYSA 2I9EA 5DLCA 4GQRA 3C5QA 4HU4A 2YDSA 3NSXA 1KM4A 1UOKA 2RKXA 1FP9A 4KWVA 1G67A 1SFJA 3MSDA 2CLOA 4Y2WA 1TX2A 1QNSA 2EHHA 3WD4A 1AMYA 3EX1A 6PTDA 4I8YA 2TAAA 4H1ZA 3O7UA 3WLLA 2BMBA 1WAUA 3M43A 1H41A 1H7OA 2Y1HA 4DX3A 5EU9A 1M7XA 1AIWA 1UKOA 2WJDA 3N9RA 2G3IA 3MWCA 7REQA 1JCTA 1EJWC 1IIHA 2REQB 2Y6ZA 2OLSA 5JMUA 4XIMA 3UZXA 4ECLA 1Z7AA 3TH6A 3MSYA 3HFYA 2FZDA 3CWNA 2NLYA 4IX2A 3SECA 1D9EA 4AZGA 2GVGA 4ZO6A 3ZSSA 5BWFA 3M5VA 1D7KA 4B5SA 1C7SA 1FBAA 4WY0F 5I02A 3MCNA 4C6PA 3B9DA 3EDFA 4HU0A 2GQAA 2IPJA 1EWDA 1GOKA 4PMXA 3WF1A 1YBQA 2W92A 1F6YA 3TQ0A 1LF1A 4QG9A 1JPMA 3LM3A 1JFXA 1KBBA 1O5RA 2FPYA 1V3JA 1JPDX 4XAYA 1EFZA 3RU8X 1SJDA 2BDQA 3ZT7A 1ED7A 1TG7A 2UBPC 2O0TA 1N55A 1VENA 3IACA 4ENLA 4DWSB 3W1XA 1FDYA 3C2YA 1I8JA 4B5UA 2V5LA 1V08A 1VPXA 1QR7A 4B5VA 3FFSA 3M7SA 1XP3A 4DLFA 5JBFA 1J10A 3ES8A 4EACA 3FYPA 4ZQRA 4ZTYA 1L2UA 4LG2A 4EX4A 3EXRA 2B7PA 4ZFMA 3VGBA 3MP4A 1ONRA 4JCMA 3S5NA 3ABSA 1WOAA 4MDPA 2PRLA 2PDLA 4MG4A 2QCFA 4QGCA 5CZSA 4Y96A 5HWNA 4FPSA 2DJXA 2ZDSA 3S1GA 1QW7A 1VBJA 2Q71A 1WDRA 1EIBA 4C6LA 1C8VA 3AXHA 1M1BA 1GNXA 3I7QA 1HJSA 1B0IA 2ATSA 5I3KA 5EMYA 1TJ1A 4FF7A 2G50A 1CGWA 1JUKA 3TYEA 3WSUA 1JCXA 4XV0A 5IHSA 4S3KA 3DKJA 2J7HA 1GVFA 1T6MA 4HNOA 3AMGA 2CHOA 5CZKA 2VEKA 1P7TA 1MW1A 2C71A 3RGTA 5DY3A 4IIBA 4I90A 3GC4A 4HJFA 4NJKA 2PDCA 2EXOA 3IS4A 5A8PA 1K9DA 3RYSA 1TJ2A 3RMJA 3W70A 2WZTA 4U10A 4WOZA 3AIEA 2PDHA 1M5WA 4DXXA 5XINA 4IUOA 3ZYZA 4Y9PA 1OD0A 3TNOA 4ATWA 1B9BA 4O10A 2UZ9A 5EB8A 4GUHA 3OOQA 3P14A 3P81A 2AQOA 1DQXA 3CH0A 3VCRA 4H7ZA 1ISXA 3H53A 3L66A 3RCMA 1EBGA 3N17A 1V93A 1FWBC 3STCA 2B7QA 1YDVA 4HK6A 4HT3A 3SEPA 1UWRA 4IQEA 4MZYA 4WJXA 1CXHA 4M19A 1E40A 4NKCA 2V3FA 1PWMA 4FOJA 3VNYA 3SO7A 1PZ1A 2ISWA 4JFUA 3LENA 1VZWA 3E0IA 4Z2KA 5JH2A 3SM0A 1RQEA 3GBDA 1H2JA 1XLHA 5I7GA 5A6BD 4JS3A 2HQAA 1OFEA 3F4VA 2BASA 4IMEA 1L2QA 4W7VA 5CPLA 4GUGA 1F3EA 5BZAA 1LZOA 2PU1A 4RW3A 4DAIA 1RVKA 3VNJA 1QOXA 2NQZA 2WMIA 2WCGA 3BZJA 3VU2A 1XSKA 4I8DA 3S0CA 1RQBA 5IM51 2VYOA 1VFLA 3CAKA 1C9WA 5FESA 2X7VA 3TR9A 4YTUA 3HM7A 3PWGA 2ALRA 4LAMA 5I5RA 1JR1A 2YZ5A 3DOPA 3LTPA 4MNLA 4DVOA 4JKLA 2HVMA 2IPGA 2W5FA 1JXJA 1TKKA 3CAQA 2PE4A 7ENLA 3N34A 1R38A 3CQJA 3SN4A 3RLVA 2CERA 4IMGA 2ISVA 2Y2HA 3HV8A 3PJTA 3SCPA 4KFNA 4AHPA 1I2RA 1V3HA 1W3TA 4QBXA 2BTMA 1ME7A 4BS0A 2PBOA 3NQ2A 3AZSA 4WR3A 3MVTA 1NWSA 2Y2MA 4FEZA 5FJPA 2FJUB 2DP3A 4EWND 3FA5A 3THAA 4MVAA 4GE8A 4RDWA 4CEUC 5AECA 3LQGA 3T8QA 1FDJA 3BAXA 3EB3A 3MMTA 2J24A 4Y6GA 1TMHA 4KWUA 4MLRA 1F7BA 1SFLA 1P0DA 2X7WA 4GIAA 3KW3A 5DFAA 3VDBA 3WQFA 4WRHA 1UA3A 1E6ZA 1MQRA 4B9YA 3EMCA 3HZ3A 2O55A 1UR8A 1Y8BA 3G5EA 1VCVA 3OZYA 1EYEA 3CUXA 4C6BA 4ROQA 3ZWTA 3N4EA 4CEXC 3HMJG 1EJ7L 1B3OA 4A2SA 3C86A 4NF7A 2QDGA 4I6VA 5DXXA 4XZ9A 3W7IA 3MA8A 3K46A 5FF2A 4M6PA 1DJGA 1GZGA 2AL1A 2J62A 2MUCA 3EAUA 2YBTA 2I17A 1X7IA 2HVNA 4JTIA 1X97A 3ITYA 2C13A 9CGTA 4LXFA 1A5SA 4GJIA 3PZQA 5A69A 1ZU8A 3TJXA 2KAUC 4AD0A 1TWDA 4NI8A 3SCSA 1QU4A 1G6CA 1VH7A 2WMKA 2RDUA 4ZQNA 5CAKA 1UJPA 1QDSA 4XBKA 1UQZA 4LF1A 2VQTA 5IBXA 1RQHA 2REQA 4AFYA 3MKVA 4MM1A 3OQEA 4RR4A 4S3AA 4F3HA 3I7SA 4KRUA 3EEZA 3AMDA 1WB0A 5HR6A 1ISWA 4LSBA 1EO5A 2XFFA 2PDNA 5BPVA 3LZ3A 1RHCA 4CNPA 2C16A 2QAFA 4Q7NA 1NDYA 1QPRA 3DI0A 3L5AA 3O15A 1R3TA 4RXFA 4QDPA 4XZIA 4FI4A 3E2QA 3KOYA 5CH9A 3EWWA 1EBHA 3QOKA 5E70A 1JYXA 3AZRA 3KBNA 4ZXLA 3STGA 4DJFC 1W1TA 6REQA 3GH4A 4NZFA 3TAOA 3TTEA 1QI5A 1GQJA 4O52A 4WJ8A 1ISZA 2EG7A 3EKLA 1IWAA 4KS0A 1HIZA 4QCFA 2WMHA 1JG9A 1M03A 1P0EA 2YR1A 4FB7A 1E3XA 3CUFA 2OSYA 1O6IA 4IJRA 5GJNA 2WNNA 1I2QA 1FRBA 4DWSA 3DAQA 3TKFA 2JGQA 3R12A 3KOWA 2ZZ7A 4GYPC 5HANA 4Q6JA 1GONA 2YFNA 4TTGA 1S2UA 1OFBA 4HA4A 1EJXC 1KBLA 1HP4A 1W17A 3E2SA 1GPFA 1E0VA 1JZ7A 1LG2A 2HK0A 5CPMA 5KTLA 3U48A 3WQ5A 1UUQA 1WDQA 3GSMA 3V1PA 3QEZA 1AJ2A 4JTTA 5CPOA 4MY1A 5DXYA 1P6BA 2F2HA 1FDZA 1X98A 1XYMA 5C9XA 3S9YA 2ABAA 1XIJA 3JRKA 4RPPA 1CXWA 4JHMA 4XAPA 4D9PA 3A5VA 5D9NA 3KRZA 1WOBA 2XSAA 3M46A 1NTHA 3QMRA 2ZE3A 4JN6A 2CHRA 2ACRA 1YEYA 1H1ZA 1LT7A 5BOEA 2Y89A 5AOUA 5C9WA 3C0QA 4MDOA 4GRSA 4A8LA 3G77A 3LERA 3QC3A 1ADOA 2BP1A 1OIFA 3NQ6A 1LQ2A 3BURA 3G22A 3LRMA 5FL0A 3HURA 4PE8A 4YPJA 4YCPA 4LBUA 1LM1A 4E2VA 2PWVA 4PL2A 1QI3A 1PHWA 2B31A 1SFTA 3QW3A 2XIMA 3BJSA 4MB3A 3G1VA 4EE9A 1FWSA 5AN7A 3V18A 4JTEA 1JCYA 2OJPA 2NQ9A 4FXJA 3BV4A 5HINA 4FLSA 2OLAA 1I2PA 3P74A 3W4RA 3STFA 1IEWA 3WJSA 4J5NA 2PF0A 2OWCA 3VNKA 4JR5A 1QNQA 1IT7A 4PUJA 3EOSA 3T0CA 3WMLA 5A6KA 4QE4A 3UJRA 2VTFA 1SM9A 3B05A 1TR1A 3C3NA 3BUVA 4O16A 1OABA 1GWJA 1XSJA 1V3IA 3NOEA 5B80A 2QCGA 5D9MA 3Q37A 3UR5A 2PC8A 2GWGA 1A5CA 3HPSA 5D2VA 1M7PA 2OZTA 1PIGA 3OJGA 4PUDA 1EP1A 3CZLA 2GVEA 3UZ5A 1BF6A 2J74A 1IV8A 1KFJA 2QPSA 4MYAA 4MWAD 4BF7A 2OOFA 3GG8A 4C90A 1K1DA 3U6WA 2E6AA 1MO0A 5FSDC 4DBEA 1R2RA 3W1NA 4E0CA 5HR7A 3C2OA 3W07A 3M4HA 4HP5A 1K7FA 1YW1A 3R0KA 4Q4RA 4GZJA 3ZR5A 1NFPA 4QQ3A 1XLBA 1ICQA 4INFA 1W8SA 3T07A 4X2RA 5ENLA 2B7NA 4MNKA 1PUDA 4N9EA 3M0JA 2X2YA 2W79A 3GK0A 3TV8A 3NCOA 3KVMA 3WDHA 1VPYA 5BRPA 1GVOA 2Y2NA 2ZTKA 4PN2A 3IIVA 4O53A 4QTGA 2BXYA 4FR6A 3EDKA 3UXLA 4FO4A 1JZ6A 3QTGA 4K36A 1OZMA 3BWWA 2XVLA 2X42A 4MYXA 2ACSA 1WBHA 2PMQA 2PF8A 1FWJC 2DW6A 2P3EA 4J3TA 2QCEA 3TYBA 1XUZA 4GQBA 2WXDM 4ZE4A 4F0SA 5I3GA 1TRIA 4I7WA 4G1KA 3O1NA 4IHCA 5D02A 4GKLA 3THUA 1HNYA 3WIJA 1XJBA 1IEXA 3WH9A 4HOXA 2FVKA 3WK3A 2OPJA 3QQWA 3M5ZA 4BEUA 4WGXA 2OWXA 1TWZA 2J8GA 4GUFA 2QVHA 4GISA 1W5OA 4FNRA 4S3CA 5I79A 1E5JA 2QJIA 1YUEA 2D2OA 2Y2KA 3BLOA 3T0TA 4CU7A 4N9CA 2UY3A 1SR0A 3SCUA 1GOQA 3VM7A 5C55A 1RPXA 2A3AA 3WLOA 2BOFX 4FLOA 1F74A 3FYYA 3A24A 1HO1A 1AUSL 3W26A 1K9FA 3CZGA 1W1PA 1EP3A 4N02A 3EEGA 3XISA 3T0BA 4GYKA 4B5TA 3MANA 2PGEA 1VC4A 4Q4KA 1OFOA 3W29A 2GUYA 5C5YA 1B3VA 1AODA 5E1QA 4BWLA 3GZ3A 1CIUA 4TU1A 1PS9A 3TC3A 2Y8UA 4DM1A 3MP3A 1FHUA 4K1WA 4Z2JA 4UFHA 1JVNA 2VDIA 2PURA 3WK2A 4KW2A 3A3HA 4AF0B 2EJ1A 3TOYA 3EWBX 2OGYA 4M56A 4IICA 4D8ZA 3HGOA 1FWCC 3EB4A 3BC9A 2FZMA 1IXOA 2YZRA 1J9YA 4OOZA 1Q6CA 1J5SA 2VCBA 1W1YA 4GY7A 3W7CA 1BGAA 4UFIA 4KWOA 1JDFA 1EC8A 1QWKA 2PWGA 2NQJA 1X8FA 2D20A 1VR6A 1R30A 4ZBCA 1MW2A 1R46A 4KEMA 3W24A 1KRAC 2J66A 3T1GA 3H2NA 4E3TA 5HQEA 1VIZA 5MKGB 4UFLA 3TYAA 1D3HA 2HISA 4GQGA 4LALA 4AYGA 4MMWA 3CIXA 2QDEA 4F0LA 2D2JA 3V3WA 3RU6A 4PFHA 3CU2A 3F7JA 3HJEA 1OFQA 2NVAA 1TPDA 4I7UA 1I0DA 1LYXA 1YADA 2GDUA 4CNTA 4HN8A 2ZWYA 5A6MA 4XVDA 2ZE0A 5AYYA 5CSRA 2VDHA 3N6JA 2E7FA 5MF5A 3SR7A 2ZUWA 5AY7A 3LHVA 1X1OA 2ZZ6A 4FHAA 4DUVA 2OFJA 1RXOB 4I5RA 4WKFA 3WEZA 3W01A 3GVQA 4HTBA 1A5AA 4ERIA 1K9TA 6ALDA 3LM7A 4V1YA 1E8BA 4DI8A 3UY8A 4ZL1A 1TR9A 2DT2A 4AVNA 1LOSA 1DWHM 1W3LA 2OQLA 3V5FA 1T8QA 2WWCA 4JPGA 1ZB5A 3GWQA 2Q8XA 1QAPA 3NZ1A 1UZDA 3R43A 2PWUA 4H9MA 1K03A 3W1UA 3LXBA 1DJYA 2D69A 2OMAA 3IRSA 1OC6A 3WUBA 3SCNA 2VC5A 4AIBA 1THFD 3DERA 1K8XA 3IVSA 1RCXB 1WCGA 4E8GA 3B0YA 3IJ6A 2X09A 1PPIA 2DUZA 2ZBTA 4O54A 1AJZA 1TMLA 1U5VA 2V2DA 3DHFA 3QBUA 2C1HA 2YCEA 2RAGA 1ZY9A 1KM5A 2BNJA 1E56A 2PLCA 3UJSA 3AIBA 4LCRA 2QR6A 1R7AA 5CGMA 5D2XA 1W54A 4PUMA 2C1IA 3U3HA 2QCNA 3TCSA 4LVDA 2QUNA 2AL2B 2I56A 3GBEA 3ZXWA 3W7GA 1WE5A 3INPA 1ADDA 2CLPA 3WELA 4ZOBA 5G2HA 1LTDA 4E3VA 4AX7A 1LLOA 4HD5A 1NY1A 1TTJA 4S3FA 4YHEA 3UYIA 2VZUA 1XGDA 4PA8A 3MDUA 2QAPA 2QMKA 2PDGA 1ZPTA 4LANA 2E0PA 4JN7A 1K3UA 1WA3A 3TN3A 2QDDA 3GNRA 5D2YA 1XICA 4IH3A 3CL7A 1HJVA 4HK7A 3N9SA 2OX1A 1TA3B 1SQ7A 4H19A 2WKJA 3V0SA 2G3FA 3THDA 3A64A 5BROA 2I5QA 6XIMA 3GG0A 1MXSA 1W5NA 2FQIA 2NV9A 2Q8LA 2XD1A 5HK4A 3WF3A 5G5IA 3KHJA 4FX8A 1V6YA 1X1ZA 1V5XA 2XUCA 5I6SA 5E6ZA 3ME3A 4AD3A 1QATA 3TTSA 2X1UA 3H4XA 4Y90A 2Y7FA 3MT1A 4LYKA 3WX7A 1TFVA 4LBRA 3OLDA 3ZJKA 2XN1A 3QOMA 1XKJA 1S2CA 2DZWA 2ISFA 5LA1A 4Q4QA 2RUSA 5DELA 1FWHC 4H9TA 3PR2A 1EXPA 4R5EA 1LBLA 2PODA 4YTTA 4JY8A 3W83A 7ODCA 1L8NA 4CQCA 1Q5MA 4UC5A 1MW0A 1UUOA 4I3GA 1WDPA 2Z1KA 4L56A 3LK6A 3MWAA 3CH9A 5DMYA 3EPMA 1GG1A 2HMCA 6TAAA 2R82A 1R2SA 5E5CA 5FEZA 1YIXA 3AZTA 3RX3A 3CNYA 1BQGA 4I6KA 4JTDA 3ARZA 3L25A 2W0UA 1G94A 4PTDA 3DC0A 1RBLA 3GKFA 3HN3A 4BI7A 2ZX6A 3NIYA 3W38A 1UKTA 4K37A 3QPEA 4HYVA 4L4MA 1EIXA 1KQYA 5GQBA 2MANA 2FMNA 5D2WA 5DANA 2HK1A 1LBMA 4AISA 2HWGA 1JZ8A 4M82A 1QHOA 1VFOA 4L4PA 2FN2A 1VGAA 4UQEA 1TJ0A 5AHMA 1XYLA 1OFDA 3FHQA 1XISA 3ZVHB 3GR4A 4Y9OA 1H7RA 2ZADA 4Q8NA 3PWAA 1IXNA 2FIQA 4NUWA 3AUOA 3LCWA 4OV4A 2DVXA 4PEEA 2OR2A 3NM3A 1KR1A 1UD8A 3LBCA 4J27A 4I5UA 3AI0A 4UTLA 1HN1A 4X22A 3F03K 5J8LA 1T40A 3LPPA 1R6WA 4AF0A 2DZUA 3L28A 4DIAA 3R58A 4URIA 3UVAA 3R7MA 1W9VA 5HBFA 1E72M 2DIEA 1OHLA 4UTWC 1CXEA 4C6IA 4HU8A 1QK0A 4FLQA 2EPMX 3BXWA 1DJQA 4GBUA 2PP3A 3BOFA 2IQDA 3R10A 1XBXA 1I9CB 1ME8A 4GQ0A 3THCA 2OO0A 3R13A 3RO6A 3LQLA 3W75A 3IUDA 1LLWA 4OBRA 1JYVA 4YHGA 4IXHA 2PSNA 2PDWA 4KRTA 2WV8A 2WC3A 1HP5A 3TMLA 4NZCA 4KESA 5E9AA 1LLZA 4EOUA 1W2VA 3P62A 5MKGA 5BCAA 1E55A 4LQ1A 1KLYA 2OYLA 3WJZA 1SO4A 3OLEA 4IXXA 3WQ8A 2NSXA 1VS1A 1FKXA 2QF7A 1S5NA 4QS5A 3SY8A 3UWYA 1PDYA 2VUYA 5H1WA 1SZNA 1OC5A 1T0OA 1UASA 3E49A 2JEPA 5M2FX 3GXNA 2P0IA 1ZZMA 4F0HA 3WL0A 1T7LA 3SB0A 4K2SA 4K7VA 3T08A 4XO7A 1T5AA 2NUXA 2R1NA 3W7KA 5A2CA 3PZOA 3N9KA 3KP1A 4CQBA 1LT8A 1WXYA 4J1OA 3TIMA 3SAZA 3VD9A 3L4WA 2YA1A 2NV1A 4ZTXA 1XYZA 2QGYA 3HG4A 1SVDA 1JL8A 4PUEA 1KCKA 3KXQA 3W74A 4G7FA 4KFPA 3E9AA 4OFCA 3EOUA 4JTUA 1MFUA 1FH9A 3IGHX 2VC9A 3CLWA 5D4YA 1UIPA 3DC8A 2WANA 4DJEA 1IIGA 1IZKA 3NSMA 4REQA 2RTSA 1ESWA 4GXPA 3IUIA 1W3IA 4Q8VA 5A3HA 1EO7A 3GNOA 3MDWA 1MNZA 3IJQA 1G5AA 1PJ9A 3K1GA 5JVLA 4D6IA 3VGFA 5F2IA 3MO4A 1IF2A 2O7QA 3GD6A 1AL8A 2O56A 3O9NA 4IUGA 4XBJA 2QVNA 2JEQA 1TZ9A 4QLKA 1GW9A 4E2BA 2A7NA 4FSAA 5A1AA 5A6SA 4KIEA 4MB4A 1XM3A 2AL2A 3M6YA 4XD4A 4L80A 3CASA 1W56A 3NQDA 3P0WA 3DXIA 3KVKA 3BZGA 4GI4A 1QJWA 3MU7A 1CBGA 3PFRA 2H6RA 4B15A 4GGBA 1WDWA 1KFWA 5G4WA 2POZA 5JIWA 2QUMA 1K8ZA 2ZRZA 2Y7DA 5AHLA 3GFXA 2C15A 4WSHA 1MRQA 2C14A 3TA9A 4F9JA 4JIQA 1R5YA 2XM1A 5HJYA 4LCQA 1EZWA 3WUGA 4JIIX 2WLZA 2WCAA 1GOMA 2XU2A 1TTPA 3LZ5A 3PZVA 3D3FA 1FWNA 1XH0A 3HQNA 4GUIA 3QPZA 2JKEA 2E09A 2Z6JA 3KL3A 4PB3A 4DB7A 3NUKA 3BARA 1UYQA 3FSTA 2GUUA 4WOQA 5FOOA 3S1UA 3VE9A 1U83A 1B3XA 9XIMA 4F2TA 3RRXA 1H11A 1I0BA 4YYFA 3BSHA 1S39A 1PL9A 2X0HA 3GC5A 2EAWA 4UB9A 4X0VA 1XLEA 3MI3A 1KKRA 4IQJA 5CCZA 3QKZA 4HPGA 2DU2A 3WLMA 3QLDA 5EMLA 1S46A 3VIGA 3VZZA 2ZDRA 1JPHA 4AZCA 4O17A 1EEPA 3KRBA 3BOLA 3TCEA 4GC4A 1W1VA 4O1EA 2BXZA 3OP2A 2QJGA 1V0KA 1PBGA 3R79A 3IUHA 3FYOA 1ALDA 3N3MA 2XVPA 1XD0A 3VXGA 1SJAA 3G0UA 2HBVA 3LOTA 3B8UA 4XD3A 2NXIA 5BXTA 2HBXA 2YCKX 3H6OA 4AG0A 4QS6A 4HNTA 3QR3A 4YTSA 2FZBA 2YB1A 2WKGA 1XPYA 2YIHA 1F05A 5LA2A 1A4LA 5ABHA 1W9UA 3MMWA 4QEEA 4KKXA 4E6MA 1JDEA 2DUXA 2NX1A 1Q6EA 3RO8A 2DDXA 4UOQA 4A8RA 5HNNA 1CGYA 2V8ZA 2W6RA 4PB5A 3RM4A 3OIHA 3PJXA 3WMBA 1UH2A 1DIDA 3V5OA 3EOLA 3GDLA 1PXGA 2ZUVA 4XQ6A 2OQHA 1GOXA 2WSYA 5DRIA 4JNMA 4WVXA 2A79A 4JFSA 4QNWA 2PWHA 4NU7A 3EA3A 2Z6IA 3LX9A 3ALFA 4GX9A 3GXDA 4FIQA 4NNBA 3ZR6A 1J0KA 2ACUA 4P5UA 1NF0A 2UY4A 3W53A 1DJZA 2PA6A 3ZVHA 3T4WA 5FACA 5U4NA 4QFUA 2DV0A 2A6LA 4HNNA 5GVJA 3HU7A 3LCFA 5A8GA 4R9XA 3F1QA 2Z1SA 1ZRQA 5CPSA 1CXLA 4PMNA 4ZO7A 2ZX8A 2WHMA 3MUCA 5CC6A 4AC7C 3PSVA 3QZEA 1M7JA 1Q6RA 3WLNA 4QE5A 2VP8A 4CNUA 5HMDA 1YU2A 3WBXA 1A5KC 1A5LC 1OWQA 1GTHA 4LRTA 4ZVJA 1BF2A 3PSWA 4YS1A 3NQFA 3LHYA 3SGGA 3TE9A 2VFGA 3VMPA 3QPYA 2RJGA 2QCLA 3L0GA 4Y8EA 4D6FA 2GJRA 2OX4A 1MQQA 3POHA 2ZXBA 3T09A 1JXKA 1TPB1 3OGSA 3PC0A 2INEA 3FKRA 1KCZA 5F2LA 5I3HA 1TWSA 5TQLA 1HKVA 4GH1A 1TJRA 1UWTA 1UR0A 4PTXA 2IW0A 3MTWA 1J0JA 5GNXA 2YBUA 4HHLA 2ZUUA 2CIPA 2EKGA 4AUBA 1WPCA 2WMGA 4IPIA 3C0LA 4IMAA 1LROA 3FS2A 3T0DA 3S2LA 3RF9A 1XYBA 4NAEB 3O6YX 3ARRA 4A3HA 3OG3A 2YL8A 2VOTA 3MPGA 3KL0A 4ATDA 2DSWA 1XQKA 4TMBA 3AJXA 2GVYA 1VEMA 2DT1A 4Z42C 5F7UA 1YTKA 3UR8A 1HT6A 3D46A 2YA2A 1N8FA 3MYOA 4LU0A 3OW1A 2DZBA 2IXUA 4PMQA 3DFQA 4AZIA 2AAMA 5LSMA 3F2BA 3QJAA 3MV01 4GBDA 4B5WA 2DSZA 3IIZA 2H8XA 1VEOA 4LVAA 3AXXA 3BSMA 1DP0A 4AWEA 2PBGA 3TYZA 4GK8A 3T05A 1GPWA 5M17A 3VYLA 1XYAA 3DFSA 1K8CA 1OCBA 2RGMA 1V3LA 3LXCA 4XD6A 3BGAA 1K8YA 2D24A 3P67A 1ZL1A 3NEHA 4CD4A 4KEUA 4UQBA 3LGGA 3JR2A 3GU1A 3T2QA 4KRZA 4TV5A 1CECA 1XC4A 5M03A 1UIOA 4P7RA 2Z1XA 4OV9A 1RK5A 1CX9A 2QCHA 1AQHA 1E9ZB 4NJJA 1DXFA 4PL1A 3KS8A 4RCXA 2PP0A 4O15A 1GKPA 1W31A 3S2NA 3M7WA 3NL6A 4H83A 4QM1A 1ZQ5A 3WQCA 3WD0A 4DJFA 1OADA 2WZEA 3EMQA 5EBAA 2J7FA 1A4MA 3CQHA 2UV8G 4IQDA 3AWOA 3E38A 4FNUA 3GX9A 1H7NA 1IWPA 3VTRA 1WZLA 2YFOA 2ASHA 3STPA 3NSNA 1C7TA 3TC7A 1S38A 2VQUA 3WMCA 4KCTA 3ZVIA 1DYSA 3H4GA 2XH0A 4D6CA 3ABQA 2G97A 4LY4A 2GSEA 4LCSA 1JUEA 1RPKA 5F4XA 3UW6A 3POCA 4AEEA 3WEOA 2PDBA 5D05A 1CI1A 5E09A 1TPUA 4CVUA 4CCZA 2BZNA 4XISA 2RDXA 2XGBA 4MJ4A 4X3ZA 1YHTA 3PZMA 4TX9A 4YWIA 3DBNA 1OZQA 1UMLA 4PBFA 1JUBA 5E0KA 3ISIX 2GFTA 3BJTA 4P7QA 4AIUA 3ONBA 2E1DA 2W61A 3W7QA 2FKPA 4A2RA 1F9CA 5T9BG 2DPEA 2RDTA 3D3AA 4B91A 1SZEA 4F40A 3DHUA 1F76A 1TV8A 1C92A 4TR9A 4YYCA 2PFHA 1AD1A 4H7VA 4LBSA 1S2VA 2WSPA 4NI3A 1PZ2A 4EIVA 3K5XA 4NT0A 4G9PA 2BV9A 3HPZA 1AZ1A 4TTUA 4Y7EA 3BK0A 3PTDA 1SW7A 2PUZA 4PODA 4D8AA 1LJYA 3GLCA 4AZBA 1XBZA 3CEPA 4LB4A 1PKNA 1D3CA 1JDAA 3VOFA 4L4OA 3N18A 5HULA 3HPAA 1D8CA 1OG0A 3HPFA 3SQLA 3ZIZA 2FJKA 4O1CA 4OVXA 3ZJ8A 3CHCA 3ZLFA 4AX6A 1JULA 3VMOA 3SRKA 2Y5SA 1S3TC 3RPMA 3G6MA 4W88A 3VNMA 3CZEA 1JRBA 3RLHA 5LXXA 1US3A 4J40A 5BOFA 4MGGA 4Y9NA 1V79A 2JIWA 4P2VA 2INFA 3W2UA 2EPHA 3GIPA 3RIKA 1WYIA 4TO8A 1EA9C 1V51A 1NP2A 3QHNA 1GKRA 2EPNA 1IWBA 4QQUA 3FW6A 4JQAA 1GTEA 4WXYA 3WNKA 2Z4GA 2NX3A 2BS9A 4NZ4A 5JUVA 3FN9A 2PZ0A 1VRXA 3CLMA 4B9ZA 1TE1A 1XRFA 2WHKA 4KQNA 1GVIA 4NRRA 4XKYB 5DT7A 3WK1A 5CPQA 1RV8A 3G1HA 4A3QA 4B2DD 4HTYA 4M7SA 3MSGA 1P1MA 3VZXA 1JZ2A 4UZSA 2Y2JA 1OSEA 4WXZA 3SCQA 1RY0A 1WZAA 4JBRA 5LYRA 4PSPA 1EJUC 3Q67A 2PRMA 1EF2A 3F2DA 2GJPA 2SFPA 4OTKA 1VPQA 1MSSA 4W4QA 3VOJA 3LTYA 1YKWA 1NQKA 4XZWA 4W7UA 3GQYA 1WP6A 4FNQA 1E88A 3H8AA 3DESA 3VAVA 3W7HA 4YL2A 1RJPA 1HF6A 1HX0A 1HGYA 4UNKA 3LN3A 1QTWA 2PWDA 1HL8A 3LMZA 1R86A 3WLQA 4JNYA 1ZAJA 1DE5A 2X1TA 1QK2A 2O4MA 3HIJA 2GL5A 3S9ZA 4FF5A 4QROA 4AEOA 2Q01A 4WSJA 2WYSA 3PBMA 1H7XA 2E6YA 4DJDC 3OG2A 5LIYX 1V6WA 2ZYFA 3UERA 3BAYA 2HPIA 4TMCA 5J5RA 2DT0A 2DY3A 4EF8A 4MIMA 2PLJA 3PZ9A 1JZ4A 5I77A 4NX0A 4CQ8A 3M07A 2Q6ZA 4BF5A 2RFGA 3BCDA 5I3FA 1O5XA 2CLLA 4H6QA 1BYDA 2GGIA 3NM1A 3SFWA 2J7DA 1NFBA 4CCCA 4NAEA 1AH3A 2DW7A 5KINA 3SRFA 1ITXA 3LHWA 1GG0A 4C6OA 4D71A 4GD0A 1M9HA 3AIRA 4PEKA 1FOBA 2Z2BA 3GG1A 3AMCA 2R6OA 4CQDA 1NWTA 1NQ6A 5EYWA 4DHGA 2NT1A 3FAWA 1M68A 2CKSA 1QPKA 4JIRA 5HNRA 3VCNA 4JFVA 3PWIA 3GH5A 3IGXA 3M0VA 4ICMA 1AW2A 2QULA 3FXGA 1Z89A 4ORIA 1VKFA 3BG5A 3RDKA 2HE8A 3W28A 1Q8AA 2V9DA 3VCCA 1KM0A 2CWXA 1MYRA 3KBSA 4MFDA 3LBMA 1AQMA 1XV8A 4W5ZA 2PU0A 2FZ8A 1EHAA 2F7FA 1UBPC 1KXHA 3VMNA 1BAGA 3I3DA 1QOQA 5KMYA 4IG2B 2FYMA 3N2OA 1H61A 2HJPA 3BLPX 4XVEA 5DF0A 1GOWA 2ZVRA 4OGZA 3QFWA 5I78A 1OVDA 3OYXA 3VD3A 2ZZ5A 4XAZA 4DZ5A 4UTKA 4LAOA 3GNXA 5F1VA 2CESA 5LGXA 1SPQA 3BQ6A 1YNPA 1TPH1 2GSJA 1FA2A 4B4HA 4BCEA 4KBXA 3B97A 3KLKA 1DWIM 5BWAA 2QJMA 2BVWA 4E2DA 1G4EA 1WKEA 3R94A 3RN6A 3FA4A 1UH3A 5KSWA 1XIHA 1LRQA 4C6EA 3TQPA 2YXXA 3A21A 3R2GA 1S5MA 5MHBA 3U7BA 1Z9AA 3W87A 2BY3A 1D2KA 3LU2A 3QRHA 3GZAA 3N19B 3IVTA 3VFLA 5KZMA 5FJRA 4ML4A 1J93A 3RRAA 2PWFA 3A47A 4O4VA 1QUMA 1ZP3A 4MZ8A 4WCJA 3TJIA 3TW6A 4UTTA 1YTEA 4RE4A 1FFRA 4NRSA 4PZVA 2H8ZA 3M0LA 3QV8A 1Y5WA 1L6SA 4D6DA 3KTSA 5C0QA 2WVTA 3MHGA 3VNIA 3AO0A 1U2YA 2CLHA 3WLSA 1NFGA 3S3GA 2HZGA 4CN1A 4Q32A 3VGGA 1WNOA 3IK4A 4CCEA 1Z41A 3N2XA 3W7DA 1OT1A 4PULA 5AHIA 3SCRA 1NDZA 2ONEA 4AH7A 5HA7A 2YCIX 3CAWA 3C8NA 2NV2A 1FHDA 3O6DA 3UEQA 5JH1A 4FMVA 4KF1A 4AXNA 3I6RA 1OT2A 2QJJA 3W81A 4TVCA 3LI1A 1A3XA 3Q4DA 1P1XA 3PZGA 4NXSA 4O8RA 1W1A1 4LVBA 2FHCA 4IFKB 5JU6A 2HRWA 2PAJA 5CGQA 1FWWA 1YQ2A 2JKAA 2CLKA 4PRWA 5KZ6A 5D9PA 1DWFM 5D8ZA 1VBHA 1PAMA 4ZXOA 1O66A 3TTYA 5HJXA 1V0MA 2F61A 2XIIA 5HNUA 1EHNA 2PD5A 3VOCA 5I09A 1Q85A 4B3LA 3L5LA 4S3BA 1MEHA 3FLUA 3PG9A 3WFAA 2HCVA 3Q58A 3WQ6A 4AAJA 2Q3OA 3VKCA 5LZLA 5LHEA 4FAMA 1UC5A 2Z2AA 4RZ5A 4V28A 3BAWA 1JF5A 1UKSA 4H3DA 3ORWA 1OGSA 2YW3A 1F6KA 1WKDA 3L4UA 1SO3A 4JTGA 2XSXA 2KZHA 4XKYA 3VILA 4TXEA 2VFHA 3FOKA 3CV6A 5E9XA 4GNJA 5BNKA 3P7YA 1CXKA 3URNA 5EA9A 1GZ1A 4JAWA 3L9CA 1FH7A 4K1GA 1OYBA 1GVRA 4U2YA 1DORA 4L65A 1XBVA 4KT2A 2XM2A 2IKHA 2V68A 3TA6A 1GYNA 4CN6A 5FKYA 2WJFA 1BHGA 1S2AA 3NO1A 2VC6A 3GHRA 5BOOA 4Z08A 5IRPA 4EXAA 4Q6XA 2VX6A 3T6CA 3GE7A 4UTIA 3NPXA 1B3WA 4BQ2A 4UZUA 4OJ6A 3GB6A 2CHNA 3CXOA 3P3BA 2BY0A 5AHFA 1KGWA 3TR2A 3TXVA 2PDJA 1UP3A 2EQDA 3BMVA 1V02E 3D0CA 2PI6A 4PH6A 3E0LA 5ECVA 3FNDA 4OJYA 3WJWA 1DE6A 4U28A 4XBSA 3P82A 4TIMA 4EPKA 2V0TA 2VURA 2G95A 3QH2A 2GGHA 2Z24A 4NHVA 4QSHA 1QNOA 2QKFA 3C6CA 3GHTA 2NT0A 4MAVA 2J88A 1BEUA 3W1TA 2OXNA 3PPHA 2WCSA 1VEPA 2J7EA 4EAMA 4EXQA 4EPEC 2BWGA 3UPMA 1M7OA 4GWEA 1W1ZA 5LNRA 3N29A 2UY2A 2VENA 3GXFA 2E6FA 4O4WA 3SADA 4R3UA 5BU6A 2NVDA 3H2EA 1MXDA 1BGGA 4W89A 4QCEA 2HDJA 4PUWA 1J01A 1XIIA 4XZHA 3GDTA 3AIVA 4PMDA 2NLIA 4YWSA 2D73A 1XWYA 1XH2A 3DX5A 4FXSA 4BQ5A 3V36A 4C1NB 2OGJA 1XRTA 1QHZA 5AYZA 3U4FA 4DZHA 3U5UA 2C79A 2QUVA 3M9YA 1YDYA 5EFDA 3K13A 1XDJA 1W9PA 2CW6A 1ZAHA 5LIUX 4WHBA 1HJXA 4H00A 1XDLA 1WUFA 3VVGA 3ARTA 3P2VA 2GSHA 1L9WA 1VFMA 3WD1A 1UKQA 1T96A 2CC0A 3QHMA 1EQPA 1POKA 2QJHA 3TN4A 1ZP4A 2DSUA 1S2TA 3HQOA 3NPWA 4W84A 3AXMA 3G1FA 5HQMA 3UG5A 4WD0A 3K8LA 3AU2A 4IJFA 1CZ1A 3IGSA 3ICJA 4AZ7A 4W85A 4IG2A 1Q3NA 2EG8A 4WDWA 1P0KA 3C52A 3C2EA 3WQOA 2Z28A 2FGZA 3MBFA 2CU0A 4RNHA 4MZ1A 3FK4A 2ACQA 3KBVA 4IOTA 3OBAA 3UU0A 5D37A 4RW5A 2ZZ3A 3P93A 2POTA 3MUZ1 3ANUA 2ZA1A 4MNJA 1RBAA 4RUBA 3GRIA 5C9RA 3ELFA 4W8AA 4CGTA 2ZZ1A 3UWEA 3M5XA 4UTWA 2TRSA 2XIBA 4CNOA 1LUCB 1SW0A 4G5DA 3TX9A 4WQ6A 1CGTA 3NZRA 4RE2A 3K8MA 4M8UA 1UZ4A 4UQ9A 2XH2A 4Z2IA 4S3EA 3S2CA 2E3ZA 1A5NC 4I5XA 1QRQA 1Q2SA 1DXIA 1XCXA 1OX4A 5I23A 3V0UA 2QUTA 4O0QA 2A3BA 2CZ5A 1SU5A 4IF2A 3GU9A 3IANA 2F8QA 1ELSA 3VNDA 1AMKA 2OEMA 3G1YA 3MY9A 3GVVA 1Q45A 2QYGA 5HMFA 2H9AB 3E2VA 4IP7A 3L5MA 3WN6A 3RUBL 4PYSA 1CB2A 1MQPA 1MZHA 2FPTA 3W37A 5K4ZA 3EDJA 2VEIA 2X05A 2QDHA 3NZPA 1ODZA 2VZVA 1ONXA 2XJ7A 4MJMA 2ZTJA 3BOXA 4DF0A 2VGFA 2J4GA 4IGHA 4O19A 3W7PA 3EPNA 3BCFA 4ZO8A 2Z25A 3NWRA 3TWBA 3AIUA 1O1ZA 3DN5A 1M6JA 1J4EA 1AH0A 5LIXX 1FWFC 4IFKA 4LYRA 1E1EA 1U5JA 2ZXAA 3BANA 1UR1A 2YOCA 3FEQA 3CL8A 2PDQA 4JTKA 4NJIA 5REQB 2WO5A 4E4PA 4M51A 1G7UA 5EBUA 5CBBA 4KIRA 3GFZA 5LIKX 1E1CB 2Z00A 4JX6A 2VELA 3N11A 5TAOA 4CLMA 4FXRA 5HUPA 2QUUA 4H9ZA 1XRVA 2PCQA 1A5BA 3IIXA 2BVYA 4Q4MA 3IGUA 3EX6A 4LY8A 3OHIA 3PP7A 4LUIA 1VHCA 3GXIA 1V6UA 1R85A 4C6CA 3ONCA 4U3AA 4RNIA 3PANA 3R6IA 2Y7GA 1XSIA 2VFEA 4K38A 1I1WA 1KFKA 1KKOA 1QWGA 1QNPA 2XN2A 2E9MA 3HV9A 1C8XA 4NZ3A 2O9PA 5LNSA 1ME9A 2J6VA 8RUCA 5I3JA 3SN1A 4US5A 3UA3A 1O4UA 3KOZA 4DJEC 3BDKA 3W1RA 5EMKA 3TC6A 2HXUA 5DQPA 1LRNA 3GTNA 4JDYA 1KM6A 3EKZA 3WLKX 2CBIA 2BB0A 3QW4B 2C1GA 1FWRA 3N3FA 3CYJA 2OT1A 4BFAA 3EOEA 3L2AA 5I3IA 4HA3A 4KGLA 1HVQA 5BMXA 1AQFA 3EDEA 1KRBC 3HO8A 2OZ8A 2G0WA 4LAZA 3B40A 2E6DA 4C6MA 1LORA 4Y9AA 5CG7A 6REQB 3PBYA 2P8BA 2HV5A 5FSEC 3CYVA 3N12A 1DOSA 5K2ZA 3UWWA 4N0RA 8CGTA 5SWUA 1SMDA 2VHLA 1I4NA 3WD2A 1NSJA 3LI0A 2JFEX 2DGAA 4O18A 1QT1A 4CN4A 2F84A 3REQB 4CKQA 5HDRA 3W76A 2IS7A 1W5PA 3KBJA 2RJHA 2Y2GA 2BLEA 2WQDA 1NU5A 2QEZA 1JGMA 3H2AA 1J96A 3U2OA 3TN6A 2HNHA 4Z0JA 7CGTA 1RA0A 2PDUA 3KRSA 1DEDA 2A21A 3B8WA 2ODOA 3BL3A 4A8NA 1YMYA 1QI4A 1YTDA 3NQCA 1DHKA 1KRCC 3QHOA 5HPOA 3AALA 1ZUAX 4PCTA 4FALA 3U9IA 1VFFA 4AVFA 3EOOA 3WO8A 5H2ZA 4HIBA 4EANA 3R25A 4DUOA 1TX0A 2XIJA 2JGYA 1X1NA 4C1NA 1A0EA 3TONA 1OFRA 5E93A 3AMKA 1H51A 3F4DA 2Z29A 2ZCGA 1R3VA 2O9TA 2D0HA 4O8AA 2FTPA 1EGVA 1G4PA 1F3XA 4Q8TA 2VVSA 1E0WA 4JQ2A 1TPC1 2JBMA 5A2BA 4IIDA 3S2JA 3I4KA 4BA0A 3NQBA 4NJHA 4MFEA 2ZRYA 5A2AA 3L26A 3LCGA 2FHFA 3MHUA 1XPGA 1EJVC 4W8BA 3TQVA 1KM3A 4HK5A 1MMFA 3AROA 5D8WA 3OGVA 3GXPA 3PNUA 5EMMA 3WF0A 1VFUA 2P53A 3W7LA 1PSCA 4LH8A 2ZA3A 4KMQA 3FV9A 2JK2A 1RUSA 3W1PA 1OC7A 4GXMA 4NZ5A 3DEQA 4N9BA 3DKLA 3QC0A 1QXLA 4IBBA 5I0DA 3QLLA 5CPTA 1SW3A 3VKDA 1ZGDA 4TX6A 3GTIA 3NPVA 2WNZA 1KV5A 4HSHA 1TTQA 3IV8A 4YLWA 3M0ZA 2FHBA 3QGAC 2H3DA 4LF2A 4J4KA 3W3OA 1TTIA 4C6KA 3R4IA 5I24A 2IOUA 1BKHA 4EPDC 2GOKA 1G7VA 1YU0A 2O92A 1EDGA 1LUCA 3G8RA 2WBKA 5CC3A 4JICA 2XHYA 1MUCA 4RDZA 4EKJA 1IT0A 3PULA 3AAMA 3S1VA 2IKJA 3WL1A 3DCPA 4J7RA 4PCSA 1H4PA 5G4HC 2W4XA 3NURA 3WG6A 1YNQA 3HG3A 2R91A 3W2NA 1VBRA 1KS0A 2ZRUA 3H54A 1ML1A 1EP2A 1NJJA 3T7VA 7A3HA 2NUYA 4CUCA 3THQA 4KH2A 4N4QA 3W7MA 2DZTA 3UVIA 1OK4A 3S6DA 3URAA 5I00A 2WQPA 3MUAA 2ZRWA 4JL2A 3D47A 1JFHA 2A6NA 1BQCA 1TZZA 4LEQA 2H9AA 5CSSA 3CAVA 1VP5A 3O0FA 1BKSA 3N2TA 2ZVIA 3OGRA 1T99A 3V5CA 1HVXA 3RPDA 3LA4A 3OZMA 3VIPA 1LL6A 3FVMA 2J7GA 2ZQ0A 4M3PA 1E6NA 4HHPA 1AL7A 3KS6A 4V2XA 4RK8A 1FQ0A 4JEQA 1TWWA 5HMEA 2LLEA 3NL2A 2AKMA 3ARUA 4GFSA 4GYFA 3L0KA 2J25A 3PAJA 4PMUA 4XX6A 1V8EA 3RG6A 1UR4A 3USZA 4HKPA 4QX4A 1C8QA 4UQDA 3WDRA 1NOWA 2V2CA 1IR1A 1I60A 4U33A 5AC6A 4I9TA 2PB1A 2CITA 4ZSUA 2CBVA 4L1WA 3AHXA 4U5IA 4MKNA 4UIOA 3SIZA 1ZBCA 3B8DA 4UCGA 2ESCA 4DYJA 5A6TC 3ITOA 3GS6A 2GJNA 2GDQA 5REQA 3GFYA 1J2BA 4ZOEA 5FJJA 3H55A 1EH9A 1Q6QA 3DYPA 2HNEA 1WUEA 1ODUA 2OZ3A 4UR7A 5FF3A 3EXSA 2OYKA 3R11A 2EO7A 1H09A 1E1CA 1HJWA 4E8CA 1R9YA 2D2HA 3LPFA 5AZ1A 1TV2A 4S3GA 1W6TA 4MWAC 4UCFA 4JTCA 1MW3A 3B8TA 2QCCA 3NQ8A 4IBIA 3WFLA 4J2MA 3CC1A 3GM8A 2X2GA 2BVTA 4LWWA 2EG6A 4LC6A 1PDZA 3FEMA 4C5YA 1EF3A 3F4NA 1KO0A 4CD5A 1HL9A 4DNMA 4Z1CA 3E2RA 2VNCA 1YXCA 2WNWA 2WVSA 3MKKA 1W1B1 3CGTA 1YPFA 4S3JA 1EXBA 2VRQA 1EJRC 3CQIA 1EDQA 3L67A 3VABA 1M53A 3O0KA 4HSOA 4GQQA 4O1FA 3RCYA 3VDAA 1XLLA 3OZPA 4RNFA 2ALDA 4FOUA 4YVVA 3KS5A 3NYZA 1Q65A 3S5SA 4GGHA 4JHZA 3R1ZA 4M24A 3SUWA 1ZTVA 4U4MA 3LCXA 1P0BA 1H50A 4ONVA 2F6XA 4NG3A 3S47A 1O5QA 1RD6A 3K2GA 4F9DA 3H2FA 5LNVA 3S5ZA 4FA3A 3UP8A 1C9DA 1DJHA 2PP1A 2VUNA 4DO5A 4DZAA 1SSDA 2A85A 2VX7A 4GHLA 2YYUA 3G1AA 1B54A 4JIHA 4H4IA 1R3WA 1UKPA 1RY8A 3W6YA 1FXQA 4UMBA 4IJCA 3RNDA 4IBKA 3TFCA 4GPNA 1QMLA 2ZXQA 3REQA 5C54A 3TYUA 2QIWA 1I6NA 1UD3A 2QLYA 4RL3A 4IMDA 1G69A 2PTDA 4GHRA 2BHZA 3JVAA 3YPIA 1KTBA 3UCQA 4DWSD 4ES4A 1RVGA 3PPGA 5FEXA 1E9IA 1B2YA 1PTGA 2CLMA 3FA3A 3CMGA 5FF0A 2IQ0A 3A4XA 1VFHA 4ATLA 3BW3A 4ERGA 2VJXA 3GVWA 4WUIA 2DQXA 4G7EB 3PBGA 4XSMA 1K7XA 4M0XA 2DZSA 1GVEA 2CXGA 1UP0A 4V1XA 4KGJA 3FGCB 1EOMA 4G1NA 1S2WA 3QV6A 5T9CE 1F73A 1JAKA 4O50A 1UC4A 3G0SA 1TYGA 3CT2A 3ZZ1A 3A9BA 4UTFA 3GAKA 5CBJA 1US2A 1GORA 3KHDA 4EWJA 2QIIA 1E4LA 1WXZA 1ZCOA 3EWYA 2OTDA 4FXFA 1GOOA 1YPXA 2P76A 4DO7A 1EYWA 5BXPA 4OHQA 4HA0A 1YLVA 2GDVA 3N14A 1VFSA 1AW5A 2NQHA 3V16A 4GKTA 4MADA 3C61A 3NQVA 4FNTA 1YYAA 1WKYA 4K7YA 2GQ8A 3NDOA 4PTNA 2WC7A 3VIIA 4O0ZA 1LBFA 3E5BA 3KEHA 1ZJIA 2QW5A 2OOGA 4LV9A 1ZJAA 4UTJA 1XIFA 3IPWA 4XB3A 1EL3A 1X38A 5C2CA 4RV3A 4BQ3A 3KWSA 4IBFA 4AY8A 4ROPA 4U3CA 1BXBA 5HMSA 1RK6A 3AFBA 3W00A 4PSRA 4LUTA 3WBEA 1QI0A 4QRNA 2V3GA 5AZ0A 3VC6A 3VPLA 5CAHA 4A35A 4JIPA 2TPSA 3NYDA 3T8LA 3ARQA 1MUMA 1AK5A 1WXJA 3T2PA 4FK9A 4I9MA 4LB3A 2WSRA 2X0YA 5KETA 3M0KA 2Y5JA 3S6OA 1J0ZA 3T4CA 1GT8A 3JUGA 4Q8PA 3NGJA 3N2MA 3BAKA 1O68A 4W93A 5G1TA 4DJDA 4HNVA 3TTOA 1VJZA 4MWAE 2XFRA 4Q8QA 3P8IA 2OEKA 3TROA 3HPXA 3GXMA 1OF6A 4JZ5A 1K7EA 3NO3A 2XINA