4NZ4A

Structure of vibrio cholerae chitin de-n-acetylase in complex with 2-(acetylamino)-2-deoxy-a-d-glucopyranose (ndg) and zinc ion
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
403
structure length
403
Chain Sequence
b'PKGTIYLTFDDGPVNASVEVIKVLNQGGVKATFYFNAWHLDGIGDENEDRALEALKLALDSGHIVGNHSYDHMIHNCVEEFGPTSGADCNATGNHQIHSYQDPVRDAASFEQNLITLEKYLPTIRSYPNYKGYELARLPYTNGWRVTKHFQADGLCATSDNLKPWEPGYVCDPANPSNSVKASIQVQNILANQGYQTHGWDVDWAPENWGIPMPANSLTEAVPFLAYVDKALNSCSPTTIEPINSKTQEFPCGTPLHADKVIVLTHDFLFEDGKRGMGATQNLPKLAEFIRIAKEAGYVFDTMDNYTPRWSVGKTYQAGEYVLYQGVVYKAVISHTAQQDWAPSSTSSLWTNADPATNWTLNVSYEQGDIVNYKGKRYLVSVPHVSQQDWTPDTQNTLFTALE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Deacetylase DA1
publication title Structural basis of chitin oligosaccharide deacetylation.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Hydrolase
total genus 147
structure length 403
sequence length 403
chains with identical sequence B
ec nomenclature ec 3.5.1.41: Chitin deacetylase.
pdb deposition date 2013-12-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.90 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4nz4A02
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 4nz4A01
2C79A 1W1A1 4NYUA 3S6OA 2C1IA 3HFTA 2QV5A 4NZ3A 2I5IA 1Z7AA 5BU6A 2E67A 1V6TA 3WX7A 4LY4A 2CC0A 2W3ZA 4F9DA 2Y8UA 2C71A 3QBUA 4WCJA 4M1BA 2NLYA 1W17A 4L1GA 4NZ1A 4NY2A 1NY1A 2C1GA 4U10A 1XW8A 2DFAA 4NZ5A 1W1B1 2IW0A 4OUIA 3CL7A 2VYOA 4HD5A 3CL8A 4V33A 5JMUA 2J13A 2XU2A 3CL6A 3RXZA 4F9JA 4NYYA 3VUSA 4NZ4A
chains in the Genus database with same CATH superfamily
3N14A 2WNNA 4Z1DA 3L0KA 3QZEA 7CGTA 5A8OA 1ZLPA 2EJAA 3EB4A 1TSIA 1EJSC 2W79A 1Q6RA 3E3HA 1A53A 2XH4A 4M19A 1TMLA 6PTDA 3T40A 4L9YA 3ITYA 1HKVA 3HB9A 4X60A 4M24A 1MEIA 3QGAC 1E40A 2NV9A 2OTDA 4QG8A 1FKXA 1QK0A 1G1YA 3MI6A 4D6EA 3TYEA 2ISFA 1UD3A 2CFFA 2WOQA 5DF0A 2QDHA 1UUOA 3VE7A 4H9MA 3RMJA 2WSKA 4HMNA 4WQ6A 1B0IA 3GU9A 3XISA 4LUIA 1XSIA 4B3ZA 3O6DA 3W86A 2J9ZA 4Q8UA 3ZVIA 2V5CA 1K3UA 2QXWA 1DQWA 1W2PA 2HRWA 5DBTA 2YCJA 3PWIA 4S38A 4HTBA 4MPQA 1PDZA 4JYFA 2OLHA 4QX4A 1JCMP 1OIFA 3TTEA 4U3AA 3QQ1A 3OU8A 5A3HA 3UBPC 3LSCA 4M8UA 1E0UA 1NF7A 2VC7A 1H62A 2OQLA 3NEVA 3SY1A 2PP0A 1EUAA 1IT7A 4C6OA 1M7JA 4MNKA 3RMEA 2PS2A 1TZ9A 1N82A 3LNMA 1ZQ5A 3WFAA 3F5JA 1MW2A 4WGHA 1KBIA 3CH9A 3ZWSA 1VFHA 1L6YA 1HJUA 2Z28A 4ZL1A 4NAEA 3FAWA 1JPIA 2EG8A 1XLJA 2CZVA 3BLPX 4UOQA 1KFJA 5HOSA 3OGRA 2P3ZA 1ITCA 5CSYA 1XG4A 3R58A 5D9PA 3HPAA 4C6QA 4GWEA 2OO6A 1T8XA 1ZCOA 2ZXBA 4HP5A 2YL5A 4B92A 4JX5A 1X38A 3VDGA 2V5KA 1NDVA 1OJXA 1GOWA 2GQ9A 2E7FA 1DWFM 5I2UA 4OBRA 2FFFB 4DQWA 4JL2A 3PJUA 1WXYA 3N17A 1L6WA 4IUGA 3KZSA 3MZ2A 2X1RA 2HWGA 2ZC1A 4AD0A 2FVLA 2QZRA 3N19B 3UZJA 3LG3A 3UG3A 2D69A 3QHMA 5JQ9A 1HW6A 1J96A 1CWYA 4MYAA 4FAMA 1A0DA 1WZKA 1G9HA 5IFTA 4HCHA 2IS7A 1A5UA 1Q4NX 3B04A 3H4XA 4FR1A 3LLFA 3MUZ1 3L66A 3NQFA 4QJ4B 5IHRA 3GAYA 3VDHA 1EJXC 1Q65A 2FB2A 2ZRVA 1DOSA 4MWAB 4WXZA 1XINA 3IEBA 3CO4A 1KC7A 3WQPA 4TO8A 3CMJA 5A95A 4PMXA 5ABEA 1W8SA 2NW0A 2YB1A 4U3CA 3EDEA 1I2NA 3D3FA 3WJWA 3H2FA 3G0XA 1Y5WA 3T4CA 3N6QA 4AWUA 3LTPA 3N34A 5F2LA 2H9AB 4AY8A 1L8PA 3VFCA 3CB3A 1B30A 3WIJA 2UY2A 4C1KA 4XQ6A 2C79A 4CKQA 1I1WA 4ZENA 3UWUA 2UY5A 1E5JA 3AROA 1KS0A 4FI4A 1GQKA 1NDYA 4W89A 5DY2A 4X9YA 3O8AA 2Q3OA 3E5PA 1K7XA 3S1VA 4A4AA 2G41A 3CZLA 4O53A 3UERA 1VLWA 1W1VA 4BQ3A 3GM8A 1IT8A 4KFNA 3RFAA 2E67A 4OV9A 3QQWA 4M3PA 2FN2A 3OLIA 3PTMA 4H19A 3CEUA 4DJFA 1YNYA 2R24A 1EO5A 3JZEA 2NT1A 3GR8A 1PPIA 3CAWA 4IG2B 3MUAA 2PWFA 4M0XA 1JZ5A 1Q45A 2MANA 3GDBA 4C6MA 3AYRA 3PHAA 3L68A 5T26A 2WJZA 5PTDA 4NKCA 1EGVA 2ZX9A 3TWBA 3WLLA 3BSMA 3M5ZA 5C5YA 1JUKA 1NARA 4DY1A 2G8ZA 4DUVA 1DORA 1MRAA 5D8ZA 4JGDA 3FXYA 4Y9OA 2YFNA 3B0YA 3T0AA 3R13A 1X6NA 1SZFA 1P4CA 2J25A 4JTHA 2NZLA 3WSUA 1OD8A 5KETA 1E1CB 4S3JA 4I9TA 1E4NA 3APGA 3SO7A 1AMYA 2W92A 4HNUA 1UH2A 3TR9A 1VHCA 4GCXA 3FVMA 2AL1A 4KEVA 1L6JA 1MW1A 2F6KA 1H61A 1YLVA 2CLKA 1EPXA 1KLZA 4KWUA 4V15A 4U28A 4JTEA 4J3SA 4W5ZA 3OP2A 1UBPC 2BDQA 3HMCA 4Q8PA 3RF9A 5K3VA 1V03A 2X30A 3MWCA 4JTJA 2PLMA 3PPHA 4E3VA 3W2JA 1E6XM 4AX7A 3PBVA 2H3DA 1IHIA 1HL9A 3GXFA 1DJQA 2VC9A 1Z8AA 3RIKA 1OFEA 4M1BA 2ZRYA 1XC4A 3AU6A 2AQVA 3PZIA 3LU2A 3OLEA 2J7CA 4LY8A 3GTFA 3STEA 3USZA 4DF0A 5CGQA 4GQQA 1VFFA 3HFTA 2PTWA 3N2CA 1XYLA 3DI1A 1R3VA 2Z00A 1U22A 4KEUA 4D6FA 4IPLA 4LOCA 3D0CA 3PTDA 3IJIA 4PUEA 2YIHA 5CZSA 1JNDA 1V8EA 2Z1VA 5CLWA 3PP7A 1P6CA 2Y2PA 1A5CA 3F5KA 2DSWA 3VPLA 5CPLA 1TRDA 1A50A 3GD6A 5CPMA 2DVTA 2CWXA 4C6LA 3UPBA 2PBOA 4JY8A 4IUOA 5MKGA 3CWOX 1WXZA 3RR1A 5FEZA 4A3HA 3O0FA 4J5NA 5AYXA 1FFRA 4B5TA 1MUCA 1GYMA 1V6TA 1QNOA 4ICNA 3C3UA 1D3CA 1Z42A 3O6AA 1XYAA 2WMKA 4AIUA 2BBFA 4M81A 3EX1A 4A35A 2VD9A 5I7GA 3CL8A 4A8RA 3W7NA 1HKIA 3W7KA 4C7DA 4I6VA 4UTWC 4DZHA 3CZKA 2DZWA 2FGLA 2OGYA 4JFWA 3H7UA 4CNPA 1FWRA 3GC2A 5CH9A 4JQ4A 5I79A 3SY8A 1U30A 2Y63A 1AL8A 4CN4A 2CW6A 4D6CA 3BAXA 4UCFA 4GBDA 2V38A 3VINA 1M53A 1YEYA 3IIVA 2IKGA 4LU0A 4QE5A 1EJTC 2QJHA 6ALDA 4EVZA 2AQOA 3UNDA 5CEWA 3S5YA 3CPUA 2F8QA 4D9PA 2IW0A 4OVXA 3H6OA 3ELFA 1EZWA 3KDOA 4DXKA 2C0HA 4LS0A 4IJBA 3FYOA 1XM3A 1I2OA 2ZFAA 3CC1A 3RO6A 3E2QA 4DWDA 3IANA 3GXPA 3CIXA 5GNYA 3NPVA 2WPGA 4XK2A 2BVTA 1QNRA 2G3IA 4MOZA 2HNEA 2VZSA 4J2MA 4PMOA 3VMOA 1K77A 4B91A 1NFPA 4W88A 1VKFA 2A7RA 1GYNA 3SRDA 2A0NA 3WF4A 1W2VA 3W2UA 2GQ8A 2PP1A 5BXTA 2ZZ2A 6CGTA 5F4WA 4C65A 1A0CA 4PODA 4IMDA 1ONEA 3YPIA 2PLCA 1DXEA 3CZ8A 2BWGA 5IRPA 3NYZA 2ZYFA 3B8DA 1PV8A 3VD9A 2QUMA 4O0QA 3GH4A 4QITA 5REQB 4GIEA 2V5OA 1YHTA 3EWUA 3UZYA 1OCJA 2CLLA 3L4ZA 3UF9A 4DF1A 1Z6KA 1F2JA 4MIMA 4AHPA 3BLOA 4B4FA 2VZVA 3JR2A 4PMYA 3R0UA 2JQXA 1RALA 1UKPA 2C1GA 3OG2A 4BA0A 2PPGA 3G1FA 3BSGA 1JIBA 1BYBA 3R0KA 4H7VA 4MJ4A 4NAFB 3SGUA 5KEZA 2VR4A 4F0RA 3H7RA 2E9MA 4QRNA 1MQPA 3CWNA 1N8FA 4CCZA 2O55A 5CJMA 1H50A 3P60A 4NNCA 1C93A 3MQTA 1HKWA 3GNOA 4JN6A 3L28A 1OBAA 1KM5A 3FVDA 3FS2A 1B3VA 4UQ9A 3MS8A 4FXSA 1MVYA 4W5UA 2QIIA 1X1NA 1UUQA 4AC7C 1WBHA 1OEPA 3QMTA 4Q8MA 2Z2AA 5FF7A 3OOQA 5LHFA 2VEGA 1JDAA 1D8CA 3GNRA 1TE1A 3W1LA 1NM9A 5M1TA 2R1NA 3OGVA 2AQWA 1BWVA 3Q94A 4AWSA 2WHKA 2G3NA 1RQEA 4EANA 4GX9A 4EACA 3P93A 1KFEA 2CBIA 3PUEA 3HG4A 5HINA 4LVAA 2J6XA 4JKKA 4MM1A 5IXEA 1TV4A 1R3RA 2WW5A 4NHVA 3WLKX 4JTDA 1TX0A 3NQBA 1O1ZA 3W88A 4TVUA 4QG9A 2HE8A 4AD4A 1VJSA 3FY1A 3H2CA 4PTDA 3EXSA 3OYZA 1ZU8A 4XISA 4Y9MA 2CHOA 2FFIA 2TAAA 1GOOA 3NSMA 5C9WA 2PLKA 2Y2LA 2ZUUA 1G6CA 2CLFA 1VFTA 1TVNA 2GOUA 1GQNA 2OMAA 3CH0A 2KAUC 3VNDA 3TC7A 3ZFHA 1PUDA 1E1FA 4PEKA 4R53A 1PDYA 5DLCA 3A4AA 4LYPA 3FEMA 1BVWA 1CLKA 3LX9A 1GTHA 4JFUA 5C7HA 2CLOA 4HU4A 5I3KA 1UASA 3MU7A 3N11A 3URNA 4MTVA 2E5CA 3E9AA 4X9SA 1VEPA 2YCKX 3TTYA 4G7EB 2X1UA 3BCDA 2J77A 4AEFA 3HJEA 3W6YA 3PSVA 4YS1A 1NIUA 3TLQA 1PHWA 1K9TA 3ZLHA 1CT5A 3T09A 4AD1A 1W3IA 1FOBA 1SZEA 4CVWA 2BOFX 3W82A 1ISVA 4IFKA 1LQ2A 5D04C 1QU4A 5H6HA 1QI0A 1JZ4A 4FX6M 4MGGA 3PB0A 1CBGA 4ATLA 3FSTA 4ROPA 1XL9A 3GXDA 4GLEA 4E4FA 4S3GA 4B16A 3OEXA 4OJOA 3WQFA 2HZGA 3TYCA 1S39A 2Y85A 4AEOA 1XPGA 1JQVA 1XF0A 1TV8A 1YIXA 3I7SA 4IJCA 3QN3A 4JTLA 2BHYA 3DGRA 1U5VA 2ICSA 1SZNA 4JEJA 4CNNA 5HJYA 3HGSA 1RY0A 1ENUA 3SSZA 3TN4A 3KL5A 3RX2A 3DHFA 1UD4A 5BU9A 2NVDA 4TV5A 5F1UA 3RCMA 1U83A 2R82A 4GYJA 2GSEA 3ITOA 5CSSA 2PDMA 3A3HA 1BRLB 4ORMA 1VFUA 4N02A 1RJQA 1WQ5A 4JIIX 3VD3A 3HPSA 2WSYA 1XRVA 3RLVA 1W3NA 1K4HA 4A3UA 2YDRA 1OFPA 3VNIA 1ZRQA 3L4UA 2YYUA 3G1DA 2IQTA 3VABA 3U4FA 4ADUA 2ODOA 3GX9A 1UMYA 3DN5A 2A1YA 3DFYA 1T0OA 4X2PA 4ERGA 5EMMA 3L7RA 3IAPA 1C29A 3LHZA 3QBUA 1KFCA 3GH7A 4WSHA 3VKDA 1V0LA 1F6PA 2XDFA 1TVPA 3UETA 2O7QA 3QRHA 3L4YA 4BQ2A 5FF4A 3TN6A 3BCFA 2RDTA 1B3OA 4RZ5A 3VIKA 2DT2A 1TTJA 2HXTA 4D6IA 1G4PA 5LA1A 1JF5A 3GDRA 3H26A 1XFCA 2OX1A 5H91A 4F2BA 1FQ0A 1IIHA 3O7UA 2R9RA 1HIZA 2RHGA 5A94A 3VZZA 4PCTA 4J35A 1EWDA 3TA6A 3KBSA 3AWOA 3VOGA 3N4FA 2VCBA 2JIEA 1CXWA 3KOWA 3ARZA 2BB0A 1OZMA 1R0MA 1NSJA 2WZMA 3ABOA 3C5QA 1R46A 4KMQA 4FF7A 4AUBA 4BI7A 2QDEA 2PWEA 3LPPA 1R6WA 4Z1AA 4GISA 2OGJA 5MHBA 3UZZA 2TRSA 4FR6A 5EFDA 1SFJA 4W86A 2ZWYA 3ITXA 3FFSA 3DBNA 1TREA 3CMFA 3AZSA 2G37A 3SB0A 3VAVA 1V77A 4QNLA 3MHGA 3JS3A 4UIOA 1GCYA 1GZGA 2BGSA 4B5UA 4DPQA 4WF7A 1RLDA 4QE1A 3INPA 2ZICA 1GKRA 2NVCA 1BXNA 2OWXA 3P80A 3EKGA 1XIBA 4GHAA 3B8VA 5CC5A 4A29A 1HN1A 2ZOXA 3GR4A 2VVNA 4Q4SA 3W3OA 1BTMA 2A85A 1V4YA 4Y8FA 1QNQA 1QHZA 1OYAA 4Q4RA 3GTIA 3H23A 4LB3A 2DUAA 5EMKA 4MSSA 3GFXA 5AZ0A 4HHHA 5C2CA 1GORA 2J75A 1W1TA 3TW7A 3OVPA 3W7OA 4R33A 1G67A 1GZ1A 3WZ0E 4E8DA 2YCLB 4JTTA 4GMEA 4ZGYA 1IV8A 2V2DA 1QAPA 1FWBC 5AOUA 4HU0A 3WLOA 2VRJA 3BURA 3KHJA 3APTA 1VR6A 4R7WA 3M9YA 3PJTA 2PODA 4H3DA 4X22A 3W1NA 1J0JA 4ZOCA 2NUYA 1WZMA 4O4VA 3G22A 3G6MA 4UTJA 2XSBA 4Z2LA 4XD4A 1R30A 1QVBA 3EMCA 3THCA 2TMDA 1L8NA 3B9DA 1GQJA 1XIJA 5DN1A 2V5BA 1XW8A 2EEXA 3WH6A 4UTIA 5AHEA 1Z89A 2V5JA 4Z17A 3C8NA 3MO7A 3V3WA 3KAOA 4E6MA 1TV3A 4TX9A 3BVJA 1XX1A 3O63A 2W62A 4S3FA 3MMDA 2C7FA 3RJYA 3VCRA 2FJKA 1EP2A 4JX4A 3ZVHA 3AOFA 2ACSA 2E3ZA 3QV6A 1H0GA 4RR4A 2BXYA 4MNJA 3IK2A 3GC4A 3EXTA 2I17A 4P5UA 3H4WA 5HNRA 1E43A 3ZSTA 1UIOA 1K6AA 2E25A 3R6IA 3E0FA 2Y5SA 2BZNA 3MVTA 1F61A 3QHNA 2UBPC 3G1SA 3H12A 4WDUA 4A3RA 2YSWA 3K4DA 1P0DA 4GUJA 2CLIA 5E5CA 1JDDA 3S5SA 5BU6A 1LTDA 1IXOA 1GONA 3TA9A 4ML4A 1FXQA 3AXXA 1YNQA 4G2DA 3C0QA 3ME3A 3N15A 1P6BA 4F0KA 4PUNA 4RXGA 3LUTA 2NT0A 1WDWA 1ZY9A 1NP0A 2W63A 3DU0A 4EWND 1KV5A 4NXKA 1F8MA 4ZMGA 1J0YA 1J11A 1H4PA 2NUXA 1MUWA 5I00A 3R8HA 1JCLA 4LALA 4PBFA 4JEQA 4A21A 1K1DA 5HXMA 1AH3A 5CGTA 2FMOA 3UZ5A 5EMUA 2EF9A 3CLWA 1BYCA 2EXOA 4OBSA 5T8GA 1B3WA 5LXEA 2VWSA 4YTUA 3V1HA 1G4EA 2J74A 2OSYA 3KDNA 1GOXA 4H9UA 4KWWA 5F7UA 1V02A 3TMLA 1XIFA 2B7QA 5HJXA 4MJ2A 4JHMA 4YN5A 2PMQA 2YXGA 1DKWA 3FKEA 3TN5A 1KLYA 3DDMA 5M3WA 3SFKA 1SFSA 1ISWA 3CZJA 4Z2IA 3L2IA 2Y2GA 1E6PA 4G9PA 3UWYA 3VZXA 3LGGA 1HKKA 4PB4A 7REQA 3DX5A 3H2MA 1DIKA 4QDMA 3W24A 3GVRA 2DGAA 2P3EA 3BWWA 2GK1B 3WDIA 3A4JA 1DL3A 5K4XA 1G69A 1OT2A 2DZBA 3GDTA 4L6DA 4D8AA 1XRFA 2WC3A 1GUVA 1M6JA 2YDAA 5KITA 2INFA 3WLSA 1QCWA 4IHCA 4K36A 4JKLA 1POKA 2INZA 1VC4A 1PZ1A 4HZ6A 4K8HA 3SCOA 4HA1A 4KERA 4URIA 3S9ZA 3O2LA 3R5EA 3QMRA 3U9IA 3TTQA 1WDRA 3MY9A 1YTEA 1TA3A 2Y2JA 1AW5A 3VZYA 4QIUA 2QQ6A 4B2DA 3UG8A 3QFWA 4L5ZA 1V02E 1XSJA 4AC1X 2ZC8A 2BY1A 3UWEA 2AGTA 3LPFA 1C7SA 1UZ4A 3AIBA 1R9ZA 1CGVA 1NWSA 1F3TA 4F79A 1TR9A 7PTDA 4QJ1A 2PZNA 3S2MA 4CD7A 4O18A 3W26A 4GC3A 2E5DA 1EJ7L 3MI2A 4FOUA 2XH2A 3B3DA 2VL4A 3VGBA 3U7VA 1FWDC 1UQZA 4AYSA 4PA8A 4J40A 3W7IA 5FJUA 4BZYA 2FJUB 2ZTKA 3NURA 3TAKA 3CQJA 4HD5A 4RCXA 3DCPA 1JRCA 1JYVA 1GOMA 2WMGA 4D72A 2ZE0A 2HSAA 2WVVB 4ENLA 3H8AA 1BYDA 2O9OA 4QLKA 3N3FA 4WRHA 4J3TA 2WSRA 5D09A 4HNOA 5EBAA 4RJEA 4C91A 5K7JA 3WDJA 1UW9A 1KBLA 2PU0A 2HBXA 3GW3A 3M16A 2WBGA 4DYJA 4MY8A 3KS6A 1WO2A 1E4MM 1YU0A 1H0IA 3FA3A 3W25A 3LYEA 2QJNA 5HMDA 2RGLA 3UU0A 4PTMA 2XFWA 5G4EA 1R8LA 1QPNA 4PL2A 3A22A 3THDA 4DBSA 1PSCA 3NL5A 5BXSA 4WEVX 3E5BA 2J88A 2C19A 3ABXA 3QLLA 1LUCA 4GKTA 2ZRXA 3P62A 1DHKA 3W2NA 1IEQA 3AC0A 3KCOA 3I7QA 3CO8A 1VENA 1PX4A 4WIWA 3GUGA 3QKEA 4S3KA 1CPUA 3CAQA 3HQPA 4BFAA 4ML9A 2YPIA 3KRZA 3RO8A 3GC5A 2PDXA 3G1HA 2OZ3A 3Q45A 1JDEA 1Q4WA 3CXOA 3CV7A 2V63A 3UJFA 3UGRA 4HIBA 4Q33A 4OIFA 3S46A 4PCFA 1J6PA 1LLOA 4QGCA 2Y8KA 2P76A 1QOXA 4HMDA 4TTGA 1E8BA 5A6TC 4ERIA 1BG9A 4HA3A 3NNTA 1EF2A 1X39A 4PCPA 4RW5A 3ID7A 4PTWA 4JTSA 1XLHA 3F2DA 1DIOA 1TCDA 2QGYA 2V81A 4FX7A 3WN6A 4OUEA 4QE4A 3VKBA 2VZTA 1W6TA 1EJVC 4G1NA 2FZ8A 1LWHA 1HGYA 3EWYA 1C8QA 4ZODA 4QEEA 3LHTA 4POCA 1U2YA 3MZNA 5FJPA 5A8GA 2QCEA 5JUVA 3LRMA 1WPCA 3WLTA 2FLIA 1C91A 2V30A 1S5VA 1KM2A 1DEDA 5EMYA 4GYKA 2ATMA 4LUSA 2PB1A 4IMFA 1LORA 1GXDA 1W5MA 1CNVA 4DLFA 3EX2A 3WNLA 1K8XA 4HJWA 3LRLA 2PE4A 1T40A 1GOIA 4LYKA 1U1JA 3W28A 1GVOA 1TKKA 2R94A 4BEUA 3LZ3A 3AIVA 2QCLA 5LNRA 4DF2A 1NY1A 5FAGA 1EEXA 4K2SA 1ISXA 1EA0A 5DXXA 2WQPA 3MYOA 4CU6A 1QO6A 3WFZA 5I3DA 2PSNA 3UPMA 4EAYA 2C8NA 2DUXA 2P88A 2Q71A 1I45A 3SJNA 2O0TA 1OY0A 3KL0A 4ZOAA 1JPMA 3EWWA 5LGZA 4L9ZA 4HJFA 3ARWA 4C5ZA 1LBFA 3CK5A 2Y70A 5HMSA 3DG7A 1TTPA 3PTQA 5IFPA 4DJEC 2J6VA 3DKLA 3P8JA 3RCYA 7XIMA 1A4MA 3LGEA 5HBFA 3I4EA 3A13A 3AIEA 2B0MA 5HA7A 3T6CA 3AIWA 4DJDA 1FP9A 3ZJ7A 2HBVA 4JY9A 4AF0A 2PDWA 4MZ8A 4MUZA 3G1VA 3GXTA 4RDVA 3T81A 4O13A 2IPWA 4JTAA 3M5YA 4M82A 4JKMA 1QHOA 1ZGDA 3UCQA 1AH4A 2QCNA 4ECLA 1QR7A 1A80A 3P0WA 5FJTA 1JZ3A 4PUJA 3H2NA 3KVMA 1QMLA 1VPYA 4LBSA 1YPIA 4KW2A 4WDWA 1WKEA 1US3A 4U5KA 1IYXA 4I9JA 4GG9A 4WY0F 1SO3A 4JD4A 3CV1A 3LHWA 4DUXA 3E49A 3GHTA 4HN8A 3OA5A 4QJ3B 4LPCA 1MRQA 3VILA 5A8MA 3TOYA 4GZ7A 4R7JA 3TW6A 4YMZA 2YCEA 2PDHA 1UKTA 2VVSA 5F1VA 3PBMA 2DORA 4ROQA 2ZRZA 4UQCA 3KS4A 1FVPA 2X40A 2CHRA 2FPTA 3HJZA 5CPQA 3W7QA 2WJFA 3KBMA 4ICCX 1D3GA 3IJLA 3O1NA 4FNUA 2G97A 2C13A 3QOKA 4UNIA 3Q65A 1YPFA 4MFDA 4KEMA 4MFEA 4J27A 1S1PA 4BQ5A 5G1YA 1FWIC 3W70A 1TWDA 5ENLA 4GABA 2WO5A 1HL2A 5HPOA 1AZ2A 1Q6OA 3RRXA 3VIOA 3VCCA 3ARTA 1S38A 4XZ9A 4V1YA 2Q8XA 2VC5A 3OBKA 3N1AA 3AJ7A 5D2VA 5DQPA 3KTCA 1EC9A 5ECVA 4HZ8A 3B4YA 1NELA 3BLIA 3COTA 4P8XA 1O4UA 5IHSA 3KS8A 5CC6A 3DHPA 4LUTA 3UNTA 3WUGA 4OGZA 3T2PA 3DESA 2PWGA 3M47A 3TFXA 3RG6A 1PX8A 4WOQA 5D38A 1NOWA 4TU1A 1JEZA 4IBIA 1YXCA 2ZDSA 3BZGA 1F07A 4Q4MA 4KGJA 1IZKA 1YNPA 4E2DA 4UTUA 1DJGA 4PN2A 3FKRA 3OBAA 3TR2A 2VXNA 2Q8ZA 4MAZA 3FIGA 5E9XA 3E6EA 4W7UA 3ITVA 3SN4A 2CXEA 4ILSA 4AD5A 3W02A 3L12A 1UWQA 3QJAA 4NZFA 3APYA 1B3ZA 1B1YA 3M7SA 3LI0A 1CI1A 3EDDA 3ENLA 1GOQA 3N6HA 3HMJG 1Q6QA 1JR1A 4ZO7A 3UXLA 1ME7A 2OELA 5CLTA 3W73A 1RCQA 3S83A 3V36A 2JE5A 4PMDA 3L5MA 1P0NA 4O1DA 3AALA 3A9BA 3LOTA 1P1MA 1H3GA 4JNYA 3WG6A 2PZ0A 2E6YA 1H41A 3KOYA 4B5NA 2BNJA 1CX9A 3HIJA 4LEQA 1F6KA 1PEZA 3IS4A 2PDJA 1RA0A 3ZMRA 1X6UA 3MC5A 3T2OA 1KCLA 1DP0A 4JQ1A 1JCYA 1EP3A 5BRPA 1ZUAX 4AIBA 2OT1A 3HG3A 3IIXA 1W1ZA 3SCSA 4FNPA 5L6UA 2QPUA 4KWVA 2WZTA 1H5VA 1BSIA 1XIHA 4AZIA 3FDGA 3KRBA 1E9YB 1W9PA 2X8RA 4W93A 1CGWA 2FTWA 3R12A 4H04A 3A5VA 1FKWA 1HZYA 4DN1A 2B81A 3EGJA 4R9OA 3W1QA 4XIMA 1WOAA 1OFRA 2NUWA 4DZAA 4Q4OA 3FGCA 1ZSXA 1Q2SA 1SYTA 4HCLA 4K7VA 2XVNA 2Q02A 5I5RA 2A3CA 3BLLA 4WVXA 1OK6A 3LLDA 4LW7A 1KXVA 2J7EA 1M7PA 4MMWA 4F3HA 5EBUA 4NYUA 3PZMA 2J47A 3QGVA 2DDXA 1V3KA 1KXTA 3AYTA 3PC0A 2OYLA 3S4TA 1H09A 2NSXA 4ZFCA 3F4CA 3VKAA 1Z44A 1KRCC 4ZO8A 2ANUA 3NO5A 3E38A 1ADDA 5K9DA 1UIPA 4PMQA 3ITCA 4FA3A 1ITQA 1AJ0A 2JKPA 1EEPA 4IXXA 2WLZA 5CKSA 1O5KA 4HYVA 3M6DA 1SR0A 4ICMA 2AKZA 3LTYA 1F8IA 1TPWA 3WLMA 1PIFA 2GJPA 1TVLA 2PDCA 4C6PA 2DIKA 1GWJA 1LJYA 4I8DA 1VEOA 2DW7A 2VGFA 4H01A 1GHRA 3BMWA 4C6EA 5E1QA 3S6OA 1BSLA 4WUIA 1HP4A 3ARSA 1Q7ZA 3GUWA 4W7VA 1EIBA 1H11A 4CCEA 2ZQ0A 3O15A 5DRIA 2YJQA 2XTKA 4ORIA 1ZALA 4DXXA 3N3TA 1LDCA 4ZEPA 4BCEA 2GJNA 4DYKA 4UZSA 4DBWA 1R38A 3UESA 3POHA 3EA1A 4M1RA 2YYTA 3OBEA 3UWVA 3W7PA 4W8LA 3L29A 3W0KA 4CU8A 3QM3A 1CDGA 2J8GA 1QW8A 5CGMA 1MFUA 3CQ0A 3PULA 4L4OA 2O92A 4GNJA 3KWSA 4DUOA 4IBFA 1HT6A 1EHNA 7TIMA 2ZZ6A 3ICJA 2FPVA 2RDXA 4G6CA 1B5TA 1DE5A 1CGUA 1Z69A 3CUGA 2A79A 3ZM8A 2WNWA 4QXIA 3SY5A 1Q85A 3WENA 4G1KA 1EOKA 4PMJA 2R1KA 3HA1A 2OWWA 1T41A 3A5FA 1SJAA 3U57A 2YFOA 2GOKA 3GB6A 4O57A 1VF8A 2JF6A 1MDRA 1EX5A 2NQJA 4Y9AA 3GQYA 2E9BA 1U33A 3AI0A 4TX6A 3KOXA 4XAZA 1GZJA 1C8YA 1NOUA 3PZQA 2CIPA 3P3BA 4B2DD 2C71A 2NWSA 2TPSA 4JTFA 3OODA 4H9TA 4JIHA 3DC8A 1KA9F 2JF7A 4O8AA 4LNCA 3L4XA 1QI2A 1DIDA 4Q8VA 2WWDA 1UP2A 1BXBA 1H49A 2GJXA 1FDYA 1MXGA 1B54A 1P5BA 4WZHA 3AICA 2ABAA 2WBKA 5CCZA 1IXPA 5C8BB 4G5DA 3PPCA 4CD5A 2Z4GA 5XINA 2GFTA 1G5AA 2WMIA 4MZ1A 4XD3A 4PC8A 4YPJA 3UZXA 3WH8A 1ITUA 2WKGA 2W3ZA 1JZ6A 3VU2A 4JIPA 3N29A 3C2EA 2G4JA 3DUGA 4IQEA 4WXYA 3VNMA 2CBUA 4BEQA 1XLKA 2VX6A 1DTUA 4V1XA 4H6EA 2YDQA 2VFGA 1EBHA 1JJKA 6TAAA 1VS1A 1J0HA 3ERPA 4GGHA 4WOZA 3CQKA 3GNPA 3TXVA 1XGZA 4BS0A 1EA9C 2PC8A 1EWEA 4NYYA 1UR9A 3DH7A 1I9CB 4MZYA 1XYBA 4LVBA 1TO3A 3WO8A 2WCSA 1W8GA 1LRTA 2A2IA 3DHUA 1JYXA 3B40A 1LQ0A 1OGGA 3FA5A 3WQCA 3S5NA 1PKLA 1ZCCA 5HK4A 3CASA 5HULA 3UJRA 4YYCA 1Q7MA 3DENA 1UG6A 1XIEA 2BHUA 3N73A 4HPJA 1F3EA 3PZTA 2Z1WA 2CCRA 3W23A 1TQXA 2IKJA 5SWUA 3IGUA 3DC0A 3C86A 3O6YX 1O66A 3CHVA 2R6OA 3PZNA 3ZT5A 2CPUA 3F4DA 2YXOA 4UZUA 4XAGA 3L9CA 4XZBA 2A3EA 3RPTA 3O0KA 1DJWA 3TUUA 2FDSA 3TXZA 4EXAA 3C0JA 1T6MA 4Z2KA 2CBVA 4QP0A 2XD1A 4AAJA 1W9UA 4B5VA 1JYWA 4X0VA 1ADOA 2WHJA 1K8YA 3JZUA 4PCNA 1IR1A 1MI3A 3LD5A 1CENA 1RR2A 3N12A 5D33A 2W5FA 1E6ZA 4GYFA 2VFHA 1TWWA 1FRBA 4CQBA 1E6NA 3EOEA 3B8IA 4ZQNA 4ZFMA 4XV0A 4M7TA 3VIJA 2GVYA 4H9VA 4CD6A 1U1UA 2CZFA 2YW3A 1Z41A 1AJ2A 2D0GA 3AU2A 2PF0A 3L2LA 1OC5A 4XAYA 2NX9A 3BUVA 2PRHA 4WDTA 1MNZA 2HXUA 9XIMA 3IJQA 5AB3A 4CNSA 3WQEA 2J7DA 3NPWA 3RUBL 3RCNA 5LZLA 2BS9A 4F0LA 3W81A 2P0OA 5MKGB 3THAA 4O16A 3TDFA 4KCWA 4O17A 3BXWA 4GHRA 5LXXA 1RAKA 3PF3A 4FNSA 3T0CA 4HNCA 1HJXA 2HMCA 5I24A 1VRXA 4EKJA 1SO4A 4FALA 3AQUA 1GG1A 4TX8A 2D0HA 4I3GA 3E2VA 3P5ZA 1WE5A 1MZRA 4S39A 5T91A 3T1GA 4YYFA 1W1B1 4JFVA 1Y0EA 2FFCA 1SMAA 4AXNA 2YA1A 3NDZA 4OKDA 2OOFA 4HPGA 1CGYA 4IQJA 5FI8A 1O5QA 4HT3A 1UHVA 3A4WA 4N9DA 1L2UA 5HQMA 1PZ3A 1UR4A 1KRBC 3F03K 4MWAA 4DJDD 2QUVA 1MQRA 4GYPA 5D4YA 5CBBA 3NSNA 4O0KA 4GXWA 4D6GA 3PJXA 3ZWTA 5E0FA 3WD0A 1W37A 2QDDA 2VFIA 5DT7A 2B4GA 2A3BA 4MG4A 3F4VA 4LXFA 1XCXA 2ABBA 4ATWA 3EDFA 4JHOA 4AWTA 2GSHA 2OVLA 1IGWA 4RW3A 4HYWA 3BDKA 1P6WA 2EKCA 1KRMA 3C61A 2V9DA 1F5ZA 4MHBA 3VO0A 3L5LA 2J8TA 1QJWA 3E02A 1IQ8A 3GG8A 4E0CA 2WHLA 3WJSA 3LPGA 1KKRA 1VCFA 1E5NA 5CXPA 4MLJA 3PY2A 4KETA 1CEOA 1VB9A 3CUZA 3W29A 1J0ZA 1ONRA 5I06A 1VFMA 3B03A 2I9EA 4LAMA 1EQPA 4ZCWA 1GEHA 1R3WA 3U6WA 3BTNA 2WXDM 3W37A 4PTXA 3QTPA 3ZO9A 3U8GA 4ZO9A 5TIMA 2HNHA 2OQYA 3MHUA 1VYPX 3N9RA 2Z1SA 2XWEA 4MWAE 4UC5A 1GVSA 2DVXA 2D22A 4CLMA 3T9PA 2NQHA 1MEHA 4NU7A 3RN6A 5FJOA 1PYMA 2ZX8A 4S1FA 2W61A 3GNXA 2D1ZA 3TYAA 2POTA 2F6UA 3L27A 3FYYA 4F2UA 4NJGA 2QHAA 1IWBA 3AXHA 2D2JA 3H7VA 4DJFC 5HPCA 4LUJA 1J7MA 4H2CA 1V6WA 2AGKA 2E0PA 5CAHA 1E1CA 4M6UA 4LT9A 3WK1A 1XYZA 2OLAA 1W32A 2Z7GA 3TTOA 3QY7A 3GFYA 4NIRA 4H8NA 1VZWA 2WSPA 1E4IA 4L65A 4DVOA 4A05A 4EK7A 3UQNA 2IKHA 2CLEA 2X7WA 3GR7A 5HUPA 1A3HA 3W01A 1BWKA 3BCJA 3WCZA 1H51A 1UCWA 2NSOA 2DSUA 4TMBA 4OQVA 4HN4A 1RD6A 3ANUA 1LF1A 1CGTA 3TZFA 1YRRA 4DIAA 4V28A 3DYMA 1R47A 2NLIA 5E6ZA 1C3FA 1UWRA 3DG6A 4GI8A 3NPUA 3IVUA 4JICA 1LBMA 2WKLA 4UUIA 2OPJA 5KTLA 3EWZA 1Q8AA 4OOUA 1U1HA 2UWFA 1Q7QA 3W6LA 1TJPA 2GDVA 3W07A 1IF2A 1J8VA 1UR2A 3PFMA 3C4UA 3LS9A 4A3YA 2H6RA 3SI9A 4NASA 2JALA 3M41A 1F7BA 3T08A 1UROA 1GKPA 1PHQA 1DXIA 3L65A 4LC8A 3NQ7A 3ES8A 2DZTA 1W17A 2QAPA 3WF3A 4QM1A 1SVDA 4PRWA 4ZBCA 4DWSA 1X7IA 1RBOB 3WLNA 1KFBA 3S5ZA 4GNKB 2QVHA 3RILA 2IPJA 2X41A 1FWJC 1E51A 4L56A 4QCEA 2HEJA 4DO5A 4ZE4A 3VGHA 1A5KC 1FHUA 1NVMA 5AHNA 4AZGA 4C1NA 5G5IA 3G0SA 2XH0A 3RM9A 2ZXDA 2VDGA 3AHYA 5AHIA 2DZAA 3Q37A 4GHLA 1HJQA 3T55A 3GG7A 4JN8A 3OTRA 1AIWA 2BOEX 1XLBA 3EDJA 4XD5A 1AD1A 2VOTA 3RK8A 3WK3A 2QCDB 2FHCA 4C5YA 1E15A 3IGHX 5I3FA 3ABSA 3TTSA 1Q5MA 2ZADA 1WDDA 1OSEA 2BVDA 4ZXLA 5H2ZA 5K9CA 2FZ9A 2OCZA 1ZAJA 2JE8A 3W71A 1RXOB 1V5XA 2FGBA 5CAKA 3LCIA 4GD0A 1V3MA 1ZBKA 2DY3A 2GZXA 3V0TA 4OJPA 2VI0A 1NTHA 5DMMA 1HTIA 3BLFA 3TQPA 2YL8A 4F0HA 4CQ8A 1TV5A 1VBGA 1AUSL 4EF9A 5TF0A 3TROA 3RX4A 4N42A 1XP3A 2QVNA 2ONEA 4UCGA 1PYFA 2ALDA 4YL2A 4M6PA 3A23A 3RU8X 1IEXA 1G4TA 3S1UA 4DI9A 3GXIA 5FJJA 4DRSA 4CUCA 1JCTA 1FCQA 1LYXA 5M2FX 4QNEA 3M0YA 1KR0A 4P7LA 3NZRA 1WP6A 3QGKC 1RQBA 3RXZA 4NILA 3E96A 3SCWA 1EXBA 1Q8JA 3P81A 4JTKA 1PXGA 3GYCA 5GPRA 2RDWA 1AJZA 1V79A 1L6SA 2R1PA 4MDOA 4LV9A 1R3SA 2GLKA 3F2BA 1SJCA 1E0VA 4LH8A 4MDPA 3GDLA 1S3HA 1KGWA 3LXCA 2ZVIA 3DAQA 1OC7A 2W9MA 3NAVA 3R0DA 1S2TA 4JFTA 3W27A 4IMCA 3SZ8A 3UWWA 1FWSA 4FLSA 1DTNA 2J7GA 3I4KA 1JRBA 1H7XA 1RZMA 2ZA1A 5BRBA 3QVQA 3IPWA 3HPXA 1W3JA 2I5GA 2YA2A 3H2AA 4L4MA 4I5UA 1QNSA 2TSYA 3REQA 1H8PA 3QV9A 1DYSA 5AY7A 1BVNP 2WM1A 5GNXA 3L0GA 1CB7B 1JZ8A 4DPPA 2PUZA 3U2ZA 4NAFA 4H6KA 3SCVA 2BG5A 1M68A 5HMEA 3DG3A 1JULA 3KCJA 3RLHA 4ACZB 2GDQA 1HXJA 1I75A 2VQUA 1KCXA 4WDXA 1ZENA 3H2OA 1K9EA 4NNBA 4EOUA 3H4GA 3GBDA 2LLEA 1FXPA 2VT0A 2OEKA 4BK9A 1KXQA 4XZMX 1NQ6A 4Q4PA 2FDMA 4QAIA 1ZJAA 1KQZA 1EDQA 4HQVA 3NA8A 3A9IA 1EDTA 3GXMA 1S2WA 1UA7A 1EQCA 3G3DA 1ME8A 2KZHA 1XCFA 3FHQA 3V5OA 1A5LC 2PC4A 4DB7A 4GGBA 8A3HA 3K8LA 3W9ZA 1K02A 1WKYA 4G8TA 2C18A 4IPNB 4YVPA 3ORWA 4HU8A 4ZXOA 3V18A 5AYIA 1NWTA 4ZTXA 3VC5A 3T05A 1QXLA 4OJ5A 3GH5A 3RDKA 4CCCA 1CECA 1A3XA 4PBGA 2BG1A 3M0VA 4ZQOA 3SGZA 2JKAA 2W6RA 1P48A 3G1YA 4QSFA 4LUYA 1VCVA 2PAJA 3BV7A 2YW4A 2G5WA 3PPGA 4D1IA 4O1AA 3T78A 2PEVA 1MEWA 2AMGA 3NQAA 3R4IA 1S1RA 3W7RA 2P53A 4UQEA 1EDGA 3H53A 3P7YA 3DFQA 2Z24A 4YHEA 2VCAA 4QR6A 2FTYA 1OFAA 1P7TB 3K1DA 1TV7A 3L25A 2ESCA 2NQLA 5BYWA 1Z7AA 4V27A 1BQCA 1EX1A 4G7EA 1DJXA 5CG0A 1XLGA 3WY1A 5EGRA 5DX7A 1FWHC 1O7AA 3NO1A 2H8ZA 4GZEA 4Z0JA 5AYYA 4K6AA 3U7BA 1PWLA 3ZVHB 3TFCA 2VQTA 3BG5A 3PM6A 2XN1A 4XTIA 2VFDA 4PB3A 3QPEA 4RZ4A 3JU2A 1TPDA 4A6GA 5A6JA 2GQAA 1DVJA 2OYMA 2GGIA 3MP3A 3N04A 3QHOA 1E0WA 4GFSA 2C0AA 4MY9A 2O4MA 3N4EA 3QW4B 3OVRA 2EQDA 3SCTA 3T0TA 4DNMA 1LROA 4W8BA 3UY7A 4NZJA 2B7NA 1E73M 3G8RA 4HHMA 3XINA 1UWSA 3KRSA 3NJ3A 1JCNA 4LQ1A 1VFLA 4W87A 3P84A 2GSJA 2D23A 5FESA 1YDNA 2FH8A 3EAUA 3JVAA 3M6YA 1E6RA 3TN3A 3K1GA 4ASTA 1CYGA 2RGMA 4J7RA 4E2BA 3ARVA 1VBJA 2F6XA 3BG3A 4LANA 2B7OA 3EXRA 3UCDA 5HWJA 1TPEA 3W1UA 1LRNA 9RUBA 5JXQA 3G24A 2C1IA 4OU1A 5I23A 1GW9A 3MO4A 3K4AA 1LLZA 4F40A 3W1TA 1E56A 1XI3A 3MUY1 4Y8EA 2CBJA 5AC7A 1LWIA 2Z2BA 3TQKA 2NXGA 3GDKA 1TJ2A 1GEQA 2GVGA 4US5A 1UOKA 5F2GA 2VEPA 2PI6A 3PFRA 4Q32A 3VOJA 1UZHA 1SFLA 3QSTA 1A5NC 3PAOA 1YDVA 4AY1A 4A22A 1E3ZA 4MB3A 2HVOA 3BJTA 5K4ZA 3LCWA 4YTSA 1ZP4A 1VFOA 1CLXA 2ZRUA 3KX6A 2AAMA 1TPFA 6REQA 2WZIA 2CLMA 2DV0A 4ADTA 2OEJA 5AC6A 1EYWA 1REQB 4S3AA 5JH2A 2XGIA 1IWPA 1J9YA 5HJLA 1CXIA 5FF0A 1AQ0A 3GK0A 3U5YA 3RLGA 1TUXA 4E3TA 4HYRA 4H8HA 3LB0A 5TQLA 1JL8A 4GXMA 3BOFA 2WJEA 1FCUA 2VD8A 4Y6GA 1PTDA 1E9IA 1CLVA 3AAMA 2QDGA 2EKGA 1UC5A 4FX8A 4IGNA 5TBOA 5DT5A 1H63A 1OFDA 2O9PA 2Q09A 3SGGA 3FKKA 4MWAD 3LN3A 3GSMA 4NZ1A 2WCGA 4QBXA 5H1WA 5AYBA 3S3GA 2XZ7A 3I6EA 2VCCA 5D30A 4G7FA 1NDZA 3GU1A 5FF3A 2CKSA 1KBBA 1CIUA 3VDAA 3ZZ1A 3H54A 2VKZG 1OK4A 3VDCA 2QCMA 1QATA 4JQ3A 2V3FA 4U33A 5A6LA 4B90A 2P10A 4O12A 4JQAA 1YU2A 3MUCA 2Y1HA 4YVXA 4Z2GA 3TV8A 1ICSA 3CJPA 2PGWA 2DZVA 5DMLA 1SO6A 4PRTA 3S9IA 5A5WA 1F05A 2C15A 2ZZ3A 3LV6A 2FHBA 1Q6GA 4FHAA 5ABFA 2NV2A 4L7ZA 1XG3A 2FKPA 3H55A 4DZ5A 1NJJA 4QROA 4HKPA 3UD6A 3HZ3A 4NI8A 4WX2A 3AXKA 2FVKA 3U2EA 4JDBA 3AYVA 3PBWA 4IZGA 3B9EA 3UGVA 4FEZA 3AS3A 3IJDA 4QNWA 3VE9A 2DPEA 4XWUA 4H7CA 3CUJA 3VIHA 2PDBA 1V7YA 4UR8A 3CIWA 2FYMA 4RX0A 4YCPA 1KD0A 1MFVA 2P0IA 2A3LA 2W0UA 4Z42C 4GO8A 1JXJA 1ZS2A 3GU2A 3POCA 4LAOA 3R43A 2V6AA 3A6OA 1XBVA 2JEQA 2CZDA 2R91A 4RNHA 4N9EA 2PDPA 1OB0A 4PFHA 4W9TA 1FY6A 4UTTA 4DELA 3EMZA 5B7ZA 3CUIA 5LNUA 2VNCA 1UH4A 1FH9A 2IPGA 3VCNA 1HL8A 3BSHA 3HF3A 3UVAA 1YYAA 3KTSA 3C3NA 2XVPA 3G1AA 3FA4A 4JFSA 4KESA 3BW2A 2EJ1A 2J7HA 1Z3NA 3UWQA 1ZBCA 4AH7A 4XBJA 2CNCA 5BCAA 3RITA 1XRSA 1SW7A 3CL6A 4GXPA 4YNGA 5J5RA 4KS0A 3W1RA 4AYGA 2G3FA 3UG4A 3ITGA 1FP8A 1LT8A 4EXQA 4A2RA 2J9YA 1PTAA 3WQ4A 3EEZA 4F2TA 3LMZA 4CD8A 3SSJA 3CAVA 1HO4A 1DJIA 4GQBA 1ED7A 3IACA 1QASA 3TKFA 4NL1A 4CQDA 3EPMA 5C6MA 2BFGA 1PZ2A 1GVQA 1Q3NA 3LCGA 2Y7FA 4OJYA 4NI3A 3ZR4A 5K9XA 1LL6A 2EO7A 3BGGA 3LHVA 4LUSB 4B9ZA 1NDWA 1GVEA 2QLYA 1OG0A 1ODUA 1O94A 3NQ8A 3SFWA 1PKNA 4GCAA 5EKYA 3N2MA 3GVGA 1OZQA 2WVTA 4DWSD 1RD5A 2DT3A 3U48A 1K8CA 3OZPA 1PAMA 3CHDA 2GJLA 1FWFC 4HPHA 1JFHA 2EPNA 1AFSA 1Q2RA 1OD0A 1JUBA 2DU2A 2Y89A 3UYCA 2BHZA 3CS2A 4CVUA 3BARA 4OOZA 3CV2A 2SFPA 1XD0A 2ZKMX 4DBDA 1O5RA 1DWJM 1T7LA 4A3QA 4N9CA 1EAKA 1KFWA 4HBKA 1TPH1 4DO6A 3IRDA 1KRAC 4EE9A 3EOUA 4JR5A 1TWIA 1UKOA 3IVSA 4K68A 5I3IA 1E71M 1MNSA 1O5XA 3G0UA 4KH2A 4XBKA 5E0CA 3KL3A 4J3VA 3MSDA 3OB8A 1ECQA 4J3ZA 4NP7A 2QULA 1HJVA 5KZ6A 4F66A 3LHYA 1ZPTA 3R8GA 3ANVA 3MYPA 4JXCA 3TYDA 3SUSA 1FCVA 3GWQA 2NXHA 2PTXA 3N25A 2VYOA 3DKJA 5HQEA 3GS6A 2XG9A 4AZCA 2XN2A 3WH7A 4O50A 3QOMA 3VGEA 2OB3A 1AH0A 2WKJA 2HCVA 3PS7A 1M7OA 3BC9A 2GJRA 2OYKA 4J9JA 2WSQA 4H8UA 3TZNA 1J4EA 1VBRA 2XU2A 4LCRA 5BRQA 1S5MA 1B3YA 2TYSA 1JPDX 1MYRA 3RGTA 3PANA 3SCRA 5A8NA 1LOLA 3M7WA 1V3JA 2VMFA 1HVXA 2HV5A 3MPGA 5CPTA 2XM1A 5D8WA 3VNLA 4FO4A 3URBA 2PA6A 4H6RA 1POJA 4YTTA 4KT2A 1F6YA 1W3TA 1GHSA 4GQGA 4IQDA 3S1WA 4RXFA 1ZJHA 3S2NA 2PTDA 5A6BA 1AODA 4BKNA 4F9DA 1H5YA 1EFZA 4MYXA 4R3UA 1XICA 2VGGA 2WB5A 4IFOA 4LYRA 4PMVA 4O1CA 2Y2QA 3V7PA 3NIYA 1KB3A 5D05A 3KBJA 2AMXA 1IT0A 2ON3A 1I8JA 4RDYA 2XWDA 3SUVA 3JUGA 1NOFA 2QT3A 2G96A 3GYEA 2EPOA 3MBFA 3VYLA 4PTVA 2R8WA 1GKQA 2W91A 3CMGA 1VGAA 2CITA 2YA0A 1W1IE 2C16A 3URAA 4C6IA 1MW0A 3V4BA 4AXKA 3PBYA 3C2RA 4DNHA 2HJPA 3C52A 2VUYA 3LEPA 3PNZA 2FZMA 1VFSA 4M29A 3ONBA 3CT2A 4UQAA 4XG1A 3UJEA 3MKVA 2RJHA 3OO2A 1JFXA 3CYJA 2YKKA 4LCSA 4CQAA 2WMJA 1TPVA 1YX1A 4I8YA 1LL4A 2IMRA 3BK0A 2AOSA 5BZAA 4E2VA 2BGNE 2ZUMA 1JGMA 4L4PA 2H8XA 5AYZA 6XIMA 3U3HA 3HQ1A 1KM0A 2VX4A 1C8XA 4CEXC 2PDIA 3UT0A 1V3HA 4FOJA 4FB7A 1R7OA 2QV5A 1PE1A 3E74A 4LAKA 1K9DA 3MP4A 1B4EA 5E0KA 3RRAA 3LPOA 3CWHA 1ZAHA 1R5YA 3K8KA 4MF4A 2ISVA 1Q6FA 2WVUA 3TOPA 3WMBA 4GKLA 3NZQA 3MBDA 1LQAA 2Z7KA 4GJ1A 1JXKA 3CT7A 3OVGA 3QV7A 1NP2A 1HKJA 4KQNA 2FH6A 1XPYA 1HJSA 2F38A 2PRLA 4NJHA 2J7BA 9XIAA 2PLJA 4TVCA 3BO9A 2J13A 3WDHA 2DT0A 2E8ZA 4AISA 4H9YA 4N4PA 4EP8C 4S2BA 1IWAA 2BLEA 1R2TA 1QI5A 5DO8A 3RM4A 4M80A 3F2CA 4LG2A 3CHEA 3IUHA 4UFIA 4X0NA 2Z6JA 4ZOBA 4AD3A 6A3HA 1NU5A 3FGCB 1UR8A 4RNFA 2AL2A 1QFEA 1UR0A 3SCQA 4FMVA 4WGXA 1JF6A 4U31A 4IBKA 2I5IA 3N2OA 5CBIA 3VKJA 2VRQA 4M51A 1S2VA 4IGSA 4Q6JA 4PSPA 2D2HA 4N7QA 5DCEA 5LSMA 1ALDA 4QDWA 3NDYA 1M5WA 1VPXA 3OZOA 1YDYA 5JBEA 3V5CA 3T8QA 3WFLA 2P1FA 4H83A 2YLLA 2OZTA 2GGJA 2QUTA 3OW1A 1UWUA 1EZ2A 4ZVJA 2QMJA 3V35A 4FNTA 1GOKA 2Y2WA 4WJ8A 1WAUA 4LWWA 4ERAA 4KWSA 1E0TA 3LCLA 5JBFA 1VQTA 4JAWA 3TYZA 3M64A 2C6QA 3VVGA 1US0A 1RPKA 4IP7A 1OVDA 3W76A 3ZIZA 2D3NA 2CZEA 3W1PA 4EPBC 2VC6A 2B7PA 5LNWA 3MSYA 1MDLA 4BY3A 4DO4A 5BMWA 3MV01 4R5EA 3KVKA 3MDUA 3C2FA 1ISYA 2E40A 3M0ZA 1OADA 2C1HA 1TMHA 4DJDC 4YJ5A 3W38A 3LZ5A 1AW2A 5XIMA 3BAJA 1RUSA 4XAPA 3WNKA 1CTNA 1VEMA 4US5D 5XIAA 1YBQA 4QSHA 1W3HA 4Z1BA 3WNNA 4LX4A 5EFFA 1JZ7A 3QPYA 3E2SA 3U2CA 3I7RA 1FH8A 1EBGA 2PGFA 3N13A 4O10A 2J62A 2Z26A 1I6NA 2QS8A 2Z0IA 4KIEA 3BMXA 1PIGA 4JOMA 4LTSA 4P2VA 3DFTA 1SMDA 4UBPC 3WD4A 5EMJA 3LBOA 3QTGA 3I3EA 3HM7A 3O6CA 5CG7A 5RUBA 4GH1A 2PDGA 1W5PA 2WC7A 5C70A 5AECA 4QISA 1V6VA 1E0XA 2J79A 3AZRA 1IEIA 1EO7A 4GIYA 4IL0A 2QJMA 2VHLA 3N9SA 4Z2JA 4HVXA 1CXLA 1ZL1A 4HA4A 2XFFA 4MVAA 3W2KA 2HPMA 3O05A 3DFNA 2PTYA 4IT1A 1XQLA 2EPMX 1OFOA 1JYNA 1YTDA 2F7FA 2G3JA 1UA3A 3SN1A 1I1XA 3EX6A 5E93A 3LDVA 5LGXA 3CPGA 3S0CA 1X98A 5F4SA 3VX1A 5I09A 4GIAA 2BSLA 5FKYA 1FWCC 1P1XA 2DVUA 3WL1A 4P7QA 1VHNA 1KM3A 1X96A 4RZ6A 4RE0A 4NT0A 3UA4A 1MW3A 1DHPA 3E1F1 4C6CA 2QAFA 2OZ8A 2IUZA 7TAAA 4N6EA 3P5YA 3IJ6A 1TTIA 1O1HA 3QKZA 3S2LA 3KHDA 2WMIB 5ECUA 3ABQA 3MMWA 3IWPA 4RKAA 4D71A 5DMYA 1QUMA 1PKMA 2OODA 3V0UA 4JDYA 6TIMA 4FSAA 3SEPA 1EJWC 2WNZA 3L4VA 3W2MA 2G95A 2XFRA 4X61A 5EU9A 2G0WA 1S3TC 1FUYA 2E9LA 5BWAA 5FA5A 4AVFA 3UW6A 3BJSA 3CB8A 3STPA 7ENLA 2GWNA 1PZ0A 4BWLA 4NVTA 2I7GA 3VXGA 3VUPA 3QFEA 5HNTA 1Q6LA 1YMYA 2VELA 1KM1A 3W72A 3WLHA 1JZ2A 4CU7A 3OVQA 1MMFA 3IUIA 3OQ8A 1F74A 2QCCA 4U10A 4A8LA 3FCPA 4U2ZA 3GNDA 1KBJA 1QTWA 4REQB 5E09A 2WHMA 3KW3A 3IJ7A 2UZ9A 3QLDA 2Y7EA 4WSKA 4KGLA 3MCMA 3SCNA 3ATYA 1VRDA 4IIBA 2PDUA 2WLYA 4HNTA 2JKEA 5HR6A 1DQUA 2EG6A 1TFVA 3PZVA 5M03A 4Z1CA 4MADA 2GVLA 4C6JA 1A5AA 2J4GA 2VURA 4JTRA 4NXSA 2IXVA 3J7HA 1EGZA 1ZNNA 3VNJA 2OSWA 1GVRA 5FSEC 1OG6A 3TC3A 2Q6ZA 2VUNA 3QY6A 1QW7A 2DH3A 3NZ1A 4AVNA 5G1MA 3FAXA 5KINA 3WNMA 1D8WA 1VIWA 2XIQA 2XIBA 4TVDA 1WV2A 1W0MA 4C6BA 5J8LA 1DIEA 4Y9PA 5CJNA 3NQEA 2O9TA 4DM2A 2ASHA 3LQGA 1KTNA 3IJ9A 2D2GA 3BOXA 5IBXA 3DBPA 2X2GA 3P2VA 4IMGA 4I7WA 2L5HA 1XD1A 1MZHA 1F4AA 3EYPA 5FEWA 5HDRA 1Q13A 1WKFA 2HE5A 2VTFA 3HG5A 1WDPA 5EA9A 4F48A 1MQQA 2PBGA 4V2XA 1KTBA 3GFZA 1LWJA 4IJFA 2X05A 3WF0A 2OT0A 3L5AA 2Y7GA 4N6FA 2FIQA 1FDJA 4L1GA 4DJED 1FCBA 1LT7A 1RK6A 3WYZA 3D3AA 3SUTA 3QEZA 4QG6A 5D37A 2YZRA 3DFHA 4W8AA 4H2HA 5FF2A 4HPXA 1JNEA 2PGRA 3OIXA 1WZAA 4UFLA 4IWWA 5C7VA 3LQLA 3TJIA 8XIAA 2G3MA 2WZEA 1SFTA 1C9WA 2Q8LA 3OHIA 2PDFA 1HF6A 4XZNX 4A2SA 1B2YA 3B8UA 2IPFA 3LBMA 4IMEA 2DIEA 3TYUA 4CGTA 3WELA 1DWAM 1UZDA 2EPKX 2XYLA 3NTYA 4UTKA 3GKAA 3M44A 5AC4A 1TE6A 3E0LA 2PDQA 3ZJKA 3VI2A 4PZVA 1FFQA 2XHYA 2Y24A 2E6AA 3NG3A 2QIWA 3QSRA 4HHPA 3VOCA 4C6FA 2V82A 5M5DA 3KVLA 3LI1A 1I2RA 2I1OA 1IEVA 2PCQA 1V0KA 4ALDA 3VNKA 2BXVA 2D0FA 2F84A 1UPMB 1FWNA 1SSDA 3B9OA 4HPNA 1GGOA 2X0YA 1GVYA 3BMVA 4XKYA 1J6OA 3NGFA 3L67A 1NAL1 5H8PA 3FLUA 4FZIA 3BZJA 1YXYA 4WD0A 3QR0A 3W75A 4QJ5B 4UFMA 4LV4A 3WDQA 2Y4SA 3G18A 1XXXA 5FIPA 5E9AA 3VMNA 4Q8OA 1M3UA 3W7LA 4YCOA 4RPPA 4KWOA 4J2PA 1ZJBA 4GO9A 3G2GA 1G4SA 4I90A 2W66A 3DECA 5EMLA 3GZAA 3VMPA 2PD5A 3HN3A 3AYSA 5A6BD 1HO1A 1W56A 1XIDA 4TV6A 1IXNA 3T42A 2Z29A 3WQGA 4YWSA 4M6QA 3NQ2A 4HK6A 3LHUA 3PUDA 4K3ZA 1HP5A 5JVLA 4LRSA 4JYEA 3SN0A 3MP5A 2YCIX 5A2CA 5LKYA 3BGJA 2VOMA 2CU0A 1GNXA 1SGJA 1OX4B 3DERA 1AQMA 3WD2A 2YB4A 3MB9A 2J7FA 2Y88A 1N8IA 3L2AA 2HTMA 3L26A 2GUYA 1BEUA 1X6LA 4EPDC 4HNVA 4Z2HA 1YU4A 2DW6A 2BOGX 1WOBA 4O4WA 4IF2A 3S42A 2IOUA 1QWKA 3SURA 3HTWA 2UY3A 2OU4A 1C7TA 3KP0A 3BAIA 4FLOA 3EWXA 1S5WA 1BGAA 4XUYA 1A4LA 1HUVA 3Q4DA 1JAEA 5FOOA 1AQFA 5DRCA 3SRFA 3AISA 5AHFA 4YXGA 5BXPA 3KTXA 4Q7NA 3KLKA 4PH6A 2ZDRA 3L0NA 3CZGA 5H8MA 1TJRA 3F7JA 3T0DA 4JTQA 1LLWA 2BODX 3PBUA 2PRMA 4LEFA 2JIWA 1KM6A 3B9NA 3SR7A 4EAMA 4O19A 1L6FA 3WJZA 3RLUA 1Q63A 5LIWX 4S3DA 4LB4A 5HMFA 4PE8A 3MT1A 4Q8WA 4CCDA 3WX7A 5I6SA 1RCOB 3NQVA 4KCVA 5G2HA 3GDMA 4ZE5A 3SDOA 3EKZA 3NM1A 5BW6A 2ZZ4A 5JBDA 2Y5EA 4ZZ9A 1AL7A 2NX3A 3PBGA 3PUGA 4QAWA 3F4NA 2VDHA 3MV11 5AFDA 3NPXA 1VLIA 1S2CA 4DWSB 3GXNA 2V2HA 2XSAA 4AFYA 3WUBA 1EL3A 2ZA3A 1XS2A 1F3WA 3O9NA 3IK4A 1XCWA 2XVKA 1JDCA 3QW3A 1FWAC 4C1NB 2J78A 3U0HA 4C60A 2PCEA 2HVNA 1UBSA 3VGDA 2XIMA 3N2BA 2OO0A 3STCA 4HOXA 1CXHA 2GVEA 3TJXA 4B15A 4DBEA 1BTCA 4YIWA 2JGYA 4PRRA 3TQ0A 2Y5JA 3GVQA 5L9FA 1W9DM 4FLQA 1PO9A 3SIMA 4M6VA 2WANA 1OM0A 3M7PA 3GTNA 2ZUTA 5DMNA 4YHGA 4PMNA 1OHLA 1NQKA 1R86A 1H1NA 3A21A 1XR2A 2DP3A 4Y2WA 3UP8A 3NM3A 4HHLA 3W83A 3TQVA 4H4IA 1UD5A 3PG9A 4GA8A 3LERA 3NDOA 4JNZA 4S23A 4RE4A 1C8VA 1FHLA 4PUWA 4BQ4A 3OLGA 3QH2A 4PBEA 3E0VA 4FP1A 2JFEX 3N2TA 4OTKA 2HS6A 3SQLA 4HMEA 3JRKA 5C9ZA 2C14A 1KCKA 4HTYA 1O68A 1QHPA 3DXIA 4UTHA 3GHSA 3MJMA 4B5XA 3DFSA 1D2KA 1EC8A 3GHUA 2Y2OA 6XIAA 1UC4A 2CWNA 1TCMA 1O95A 4JPGA 5FJRA 3A3XA 1BVZA 3CIVA 4IM4A 4HZ7A 4MWAC 1YU3A 3S5OA 4GYPC 3W7HA 2BY2A 3K13A 5BROA 4K7YA 4D8ZA 2ZTJA 5AKQA 4JCLA 3L4TA 3BH4A 3LM7A 1US2A 2DFAA 4D1JA 4HA0A 1JI2A 1WDQA 3D5HA 3O16A 5H8UA 3IGXA 3MVIA 4CQ9A 3SIZA 4GQ0A 4PMZA 1THFD 1IZCA 1QK2A 1QI3A 1SJBA 2QKFA 3WBWA 2XFYA 5LYRA 3P6LA 4A8IA 5LA0A 4QEHA 2OZ0A 4N0RA 1RCXB 1QO5A 4IJRA 1OF8A 1UR1A 3AS2A 2W27A 2PDNA 1NWUA 3WMCA 2Y2MA 3FNDA 3REQB 3TYBA 2EG7A 2REQA 4BF5A 3BG9A 4KRZA 3KBVA 1DJYA 4UQBA 3MTWA 4WY0B 1SQ7A 3I68A 4BI5A 2OX4A 2YL9A 2ISSA 4XAFA 2O56A 4XVEA 1I0BA 3CM4A 5FSDC 4AQLA 4J1OA 3CHCA 3TEVA 4GY1A 1R2RA 3LENA 1YUEA 2NV1A 5CSUA 2OWCA 1TR1A 1RBAA 2X16A 2ZE3A 3M0XA 1MSSA 1TELA 3ALFA 4PMRA 4ZTYA 1AA1B 2VENA 4GK8A 2HK1A 5F4XA 3EOOA 1V0NA 1A3WA 1WAWA 1RJPA 3R11A 4MNMA 1GVIA 2DSVA 1EUNA 4AZ7A 1QRQA 4JX6A 1YU1A 1FHVA 4RE2A 3NYDA 4HNLA 4IISA 2XINA 1M7XA 1ODZA 1MXSA 1M1BA 2UY4A 5DXYA 3ZLGA 3H21A 3RR4A 2YBTA 2IKIA 1TQJA 1XLCA 2PURA 3FDKA 1OFBA 4IGMA 1EYEA 4UTFA 3L2MA 2Z1KA 4RNJA 5FL0A 1VJIA 4PB5A 1RVGA 2VEIA 4ZQPA 1BPLB 3ITLA 4F8XA 3P67A 4UNLA 1GQIA 3CL7A 4MJZA 2Z1XA 3EA2A 4QCFA 1EJUC 2CERA 3M46A 4LGXA 4P8VA 3H22A 3WLQA 3E0WA 4OJ6A 3VTRA 4IBEA 4Q7IA 1P0KA 3IARA 3QYQA 4XD6A 1XYCA 3ZSSA 1DWGM 3QZAA 3S1GA 2WAGA 1FX6A 1XDMA 4JNMA 4IPPA 5FD0A 3M1ZA 3W74A 4UWMA 3EPNA 3FN9A 3IIPA 4WKFA 4OUIA 5D02A 1RH9A 2GYIA 1H7PA 4GUGA 4O8RA 1UJQA 4F9JA 4WR3A 3RYSA 4WCJA 1V6YA 3B06A 1EJRC 4DAFA 2XIJA 1VAHA 1TJ1A 2E1DA 4TR9A 4KBXA 2INEA 3KXQA 3K8MA 5FCZA 1TPUA 2QF8A 3NFUA 2QCDA 4DWSC 3UXIA 5BXRA 3TVAA 4P7NA 2YBVA 5IM51 4HK5A 1QO2A 4JN7A 8TIMA 4R7OA 5D9OA 4EXBA 4QS5A 4UNKA 1SO5A 1WCGA 1SR9A 4NAEB 1XGDA 2H90A 1VP5A 3CV6A 3PJWA 4BF7A 2A7NA 1LCOA 4KFOA 4H00A 3ZT6A 4C6KA 4KCUA 3A12A 3MHFA 2HROA 4Q8TA 3UEQA 4O0ZA 3OA3A 2BVYA 1XC6A 1XLFA 2V3DA 3M0JA 2VDIA 5CSRA 1HFBA 2GGEA 5K2ZA 5GJMA 4XZIA 6ENLA 3HV8A 4PULA 1H7NA 2WZHA 2VEMA 4M56A 2O4QA 3GE7A 4N2YA 4GI4A 3UVIA 1QBAA 3KVJA 1W91A 3FJNA 5FL1A 4ES4A 5E70A 1RQHA 2ALRA 3STFA 4PEEA 4ZQRA 5CBJA 1E72M 4JIEA 1FWGC 3EBVA 1GJWA 3KOZA 2VZUA 3II1A 3ARRA 2ZA2A 2Y2NA 1QPOA 3GZ3A 4DBUA 3W00A 4CEUC 4EPKA 2OSXA 1L0PA 5I3GA 3PUOA 3AIRA 3PZOA 1L6GA 5I78A 2HDJA 1SJDA 4AZ5A 2ZZ7A 3A24A 4N4QA 1GTEA 6REQB 1KKOA 3UR5A 2QEZA 3W7GA 1RLCL 2E68A 4ZQMA 1GPWA 2WCAA 3UR2A 3G3MA 5LIXX 1PX3A 1PCWA 1UP0A 4IBJA 3EWDA 3EX3A 4MB4A 4AD2A 3WJYA 2GUBA 4XO6A 4K8GA 1A0EA 1ZB5A 3O06A 1Q6CA 1WA3A 2D73A 4AU0A 4DEFA 2FMNA 4ACZA 3VGGA 5JU6A 4H7ZA 3L4WA 1E70M 4OHQA 1OYCA 2I16A 4JTCA 4C1LA 2XN0A 4JHZA 4NUWA 1LL7A 1J2WA 4IP5A 2V0TA 2QUNA 5I0DA 4E38A 5I77A 2R14A 3CAKA 1UKSA 5AHMA 3I3DA 1RP8A 4B3LA 2A3HA 2X2YA 2ZZ5A 3ISIX 5JIWA 2BP1A 2NX1A 5ABTA 5HNNA 5DFAA 2XIIA 2WPBA 4MB5A 1OF6A 3IV8A 3R94A 1FDZA 1ZHAA 3KM8A 3LY0A 2BVWA 3SRHA 4IXHA 2X09A 1B57A 4DM1A 4D6DA 5J5DA 1I0DA 3AMCA 3GKFA 3T8LA 2PFHA 1GJUA 2BXZA 3MUXA 4BR1A 2I57A 1XDJA 3RU6A 3FSUA 3CU2A 3CZEA 1TIMA 4HOZA 1V51A 2X1SA 1GQLA 2MUCA 5AHLA 4AX6A 1TWZA 5KSWA 2Q3RA 3GRIA 1ESWA 4O11A 1S2UA 3E12A 3BV4A 5IDIA 1JD7A 4GE8A 4NZCA 1EXPA 3FW6A 1RP9A 3XIMA 5ABFB 3BQ5A 3HONA 1CXFA 3MW7A 4S2CA 3PZGA 3MUIA 5A6MA 4K39A 1F4HA 4MY1A 4GX8A 4C6NA 3NO3A 1UKQA 4DJFD 1EF3A 4B9YA 2Y8VA 1BKSA 1KM4A 1BG4A 1I2QA 1P7TA 2I14A 4S3EA 2OJPA 1G01A 4Y96A 5D9MA 3ZR6A 3BLEA 1FHDA 2CZ5A 1E55A 2QGHA 5C2GA 3NVDA 1KFLA 2HISA 3PPFA 1V3LA 4XIAA 3G8EA 4LVGA 1RHCA 3DI0A 2WWCA 1KFKA 2XUCA 1K6WA 3R25A 2I5QA 1H7WA 4AZHA 4AMAA 2VZOA 1GYLA 4JBRA 3HURA 2Z27A 1DJNA 1XLEA 1S46A 1QBBA 2E4TA 4NSBA 1FH7A 3FEQA 2NVAA 1ICPA 4J4KA 1QNPA 3K5XA 1J12A 2QF7A 5LIYX 4PUDA 4RPQA 1YQ2A 5I3HA 4KF1A 1P43A 3VD4A 5HUOA 1N55A 4MAVA 2FTPA 5C55A 3AS0A 3LCFA 3W7DA 3VKKA 5C9RA 4IMAA 1KR1A 4MKNA 4LAUA 4KCTA 1XLLA 3K30A 3BQ6A 2E28A 3W1AA 2CXGA 4AWEA 5JIPA 1ZZMA 4UB9A 1Y5VA 2JBMA 1UUMA 1XRTA 2DQWA 2XISA 1XWYA 3R79A 2F9RA 3AUJA 3DYOA 4UTWA 2H3BA 3R8RA 3B8SA 4NZ3A 3CEPA 4S3BA 1X1ZA 2ISWA 3HGOA 3HO8A 5LHEA 1BKHA 4LC6A 4IX0A 5KZEA 4F0SA 4MUPA 1ZBVA 1SPQA 3T0BA 2XVGA 3W7MA 4FPSA 4NZ4A 4MKSA 5B80A 4QTGA 3LTSA 3ARUA 3NXFA 2X7VA 1CXKA 1JDFA 3N4AA 5G2WA 4FXJA 4I9MA 3TU9A 1SW0A 1NWRA 1TPC1 2V3GA 1CB2A 4N9BA 3HOJA 3C8FA 2JK2A 1UWIA 5HQLA 1K9FA 2NQ9A 2QUUA 4JIRA 2UWXA 3WUEA 4L61A 3WL0A 5CZKA 3WMLA 1UD8A 2OLSA 5A6AA 2DZSA 3Q2DA 4QLJA 1RK5A 3KBNA 5A6SA 1VBUA 1Y8BA 4PCSA 3RPMA 3BW4A 1REQA 2V69A 3TC6A 4DO7A 1W1YA 2A3AA 5FAJA 1AW1A 4E4UA 3T2QA 3TSMA 4QQUA 3ONCA 2XVLA 1XJBA 3ANYA 2XJ7A 5HWMA 3MCOA 3I3BA 3SQSA 4ACYA 3ITTA 4UR7A 4I5XA 1LBLA 2DQXA 2H9AA 3HSHA 3ARYA 3AIUA 3LLXA 1B9ZA 4LVDA 3BOLA 2FQIA 3BICA 4GACA 1M04A 3RM8A 2V3EA 2RH9A 3IUDA 4B4HA 3S47A 4IIGA 4US6A 4NRSA 3WQ5A 2YX0A 4QQ3A 4GJIA 1OCQA 2P8CA 3QR1A 4C90A 1AZ1A 1BHGA 1Q66A 4JTUA 1SW3A 2ZUWA 4J28A 5I03A 1G7VA 3BL3A 3UYIA 4KKXA 2QJGA 2YLAA 4YTQA 4AZCB 1C92A 4AHQA 1MWOA 4WK9A 3WQOA 3NZGA 1OQFA 1W5OA 4CN1A 1JGIA 4K1WA 5CZTA 2VWTA 2HS8A 2GL5A 3U4AA 1QPQA 4C7GA 3GIPA 3LV5A 3C0SA 5TNVA 1KGUA 4RK8A 5ABHA 2Z2UA 4WSJA 3AIQA 1VH7A 1PDCA 4IG2A 3M5XA 2CC0A 1GT8A 2QMKA 3WK2A 4AVOA 2ZZ1A 1QW9A 1PWMA 2Y2IA 4XBSA 4LF1A 2YZ5A 4H1ZA 4L80A 1S5NA 4UFHA 2VR5A 3LA4A 2J8FA 5EY5A 3SM0A 3LCHA 3FX4A 2IQ0A 1ML1A 1KV8A 2ZVRA 3DZ1A 3T7VA 3P0XA 3CLMA 3M0KA 5AC8A 4MPKA 1RJRA 1W9XA 2OFJA 1R3YA 2X0SA 3GNNA 2XSXA 2BY0A 4GVFA 4E5TA 3SW6A 3WBYA 3ZR5A 1LZOA 4W4QA 1R3TA 2VGBA 3ZXWA 4NQ1A 3T07A 5C54A 5F2MA 1EHAA 4O54A 5C9XA 4AHOA 1EIXA 4PR4A 2FZBA 4GPNA 4WKAA 3R2GA 3IV3A 3EB2A 1PVNA 3ZT7A 3URQA 3C6CA 1W1A1 2WNQA 3BJFA 1R9YA 1P0BA 5HNUA 3NOYA 1OT1A 4TXEA 4B3KA 3QYSA 3TCSA 3WBEA 1YTKA 2PD9A 1LP6A 5GVJA 3KBWA 1SSGA 2DH2A 1V6UA 1AQHA 1A5MC 3K2GA 4O1FA 3HV9A 3GG1A 4UMAA 2X42A 3G77A 4NJKA 1S2AA 1U5JA 2OKTA 1M65A 4UXDA 1MUMA 1LOQA 1W9BM 5A8PA 1OCBA 4JIQA 3V1PA 7A3HA 1QOQA 3TX9A 4Z0SA 3VM5A 3SUWA 4H6QA 3KLLA 1XIMA 1AVAA 3VNZA 4U4MA 3AMKA 3L21A 2FZNA 4W7WA 4IBGA 1TJ0A 1OABA 3QQ0A 3QC0A 1IIGA 4Y9NA 4UTTC 4XB3A 1E6SM 4TQTA 3VIGA 1HQTA 2VX5A 2OOGA 2X0HA 4PL1A 2Z25A 4OWGA 5DELA 4JZ5A 3UY8A 3M5VA 1D9EA 5C0QA 1E9ZB 4GFIA 4XKMA 4IH3A 4IBBA 5I3JA 3HPZA 4LVFA 5CQ1A 4R88A 1W5NA 4GNVA 4KEZA 1RSCA 5T9BG 5T9CE 4IFKB 1HVQA 1YPXA 4LJ3A 1JD9A 4IX2A 4Y90A 1N2VA 4JS3A 1JQXA 3PG8A 3SQMA 1X1OA 4UFJA 2ZXAA 4LYQA 3NL3A 3BAKA 1BYAA 1Y7VA 3TMQA 2FGZA 4IL2A 3LK6A 2WV8A 2QCGA 3VOFA 3S1XA 1Z9AA 2PTZA 4YU1A 3VKCA 2Y8UA 3HQNA 1E9LA 3IIZA 3MKKA 1JG9A 1YE4A 3WUFA 3WD3A 3TSBA 1V08A 1P0EA 3PR2A 4JCMA 3MA8A 2D2OA 1XLAA 1LG1A 4P8WA 3WH5A 3SAZA 1B3XA 3SCUA 4NX5A 4ZOEA 5AN7A 2BGQA 4Q7BA 5HANA 4RZBA 2AL2B 4GI9A 4QFUA 3PAJA 3LNPA 1QNVA 2BX7A 2QV4A 4XZLX 4FF5A 5GJNA 2YDSA 2DJLA 4LS2A 3DEQA 4OBTA 3TCEA 2WK2A 3CTTA 2RJGA 4LNYA 1B4KA 3PZUA 3SJ3A 4WLCA 4BJHA 4XUGA 2Y62A 3RJXA 5HATA 1BD0A 2HK0A 1D3HA 2DSZA 3U2OA 2ACQA 4PUMA 3TLLA 1GG0A 1OIMA 4A8NA 3GVVA 1LOSA 3WLIA 2TODA 4XTDA 4UOZA 3USBA 1UMLA 1J2BA 1XIIA 5U7SA 5GQBA 7ODCA 5DEZA 1BLIA 5EYWA 1DJHA 4HK7A 4L1XA 3JW7A 4E4PA 3MCNA 4C7FA 2GGHA 5REQA 5A1AA 4Q6XA 1H7OA 3B0VC 3FJ4A 4UOJA 1CZ1A 2I9UA 2EHHA 4WKHA 2PF8A 3AO0A 1IGSA 1PTGA 5C71A 2PDKA 2VGIA 4NNAA 4ATDA 4DAIA 4IJEA 4LFYA 3NXLA 4OJLA 3UWZA 1TZ7A 3DFOA 1YBQB 2A6NA 3ECQA 2XIOA 1PL9A 3EKLA 1K4GA 1BAGA 3GHRA 2GPTA 2V67A 3MDWA 1KWGA 1FBAA 4DHGA 1AG1O 2CETA 1IEWA 4EX4A 3GLCA 4EWJA 3RNDA 3ZOAA 1R3QA 3AMGA 1M01A 2QPSA 4O1EA 3NUKA 3C2YA 1XBYA 1SUXA 4NRRA 1J79A 4IPIA 4HB7A 2OKOA 4FXFA 3TWAA 3WQ6A 1A5BA 2NWRA 4OT7A 1ME9A 2PWHA 3MMUA 1YKWA 3MI3A 4B5WA 1HKMA 4F0MA 1TB3A 4ZQCA 1A5SA 2QW5A 1XH0A 2QYGA 4L9XA 1XDLA 1ZJIA 3W7JA 3ARQA 3WEOA 5C2XA 4HNNA 3HFYA 4ZSUA 2DIJA 1G94A 1L9WA 3IIOA 3KP1A 3QR3A 1TG7A 4I7VA 4F4RA 5LA2A 4D6JA 3LMYA 3DYPA 8RUCA 2X1IA 4U2YA 5LNSA 1BXCA 3VOIA 3VOHA 1WNOA 4Q22A 4GZJA 5JMUA 5DCDA 4Q4KA 3CUXA 4KIRA 4KRUA 4ZO6A 2Y6ZA 4MLRA 5DANA 2RDUA 2OXNA 1ZBWA 1JCXA 1WB0A 3WQWA 1OX5A 2RKXA 4HGXA 3WDRA 3FXGA 3H24A 3NQMA 3WDPP 2R1LA 5ABGA 3W85A 3I6TA 2P50A 4X63A 3M0IA 1N7KA 1B9BA 1WKDA 2XPKA 1RV8A 4TUFA 4GVIA 1T5AA 4AZ6A 4R27A 3SBFA 3W7EA 3B0UX 3PWAA 1YXDA 4PSRA 5E6YA 4J3XA 4LBRA 2Y2HA 2WM0A 4P7RA 2V8ZA 3UFYA 2Q01A 5D2YA 2ZX6A 3QF0A 2RAGA 4XSMA 1Z32X 2DZXA 5D32A 2E6FA 3BAWA 4I6KA 1I60A 1KCZA 4NJIA 1OGBA 3I10A 5FEPA 3HBLA 3VFLA 5G4WA 2GUUA 1TWSA 1MXDA 1XH2A 2QCFA 2PWUA 1CW2A 5CPOA 3C56A 3GVWA 5EPDA 4GQRA 1DJZA 5IDZA 2CLPA 2DZPA 3NWRA 3W7CA 3M0HA 3ZLFA 3VUSA 3AHXA 3EX4A 3KS5A 4CN6A 1UD2A 1EOMA 4HOWA 2ZWZA 3GO2A 5EB8A 5D2WA 1H1ZA 5BOOA 4XZWA 1XUUA 2A7PA 1J0IA 4KPLA 3P82A 4R9XA 5AVHA 3VIMA 2E6DA 1K03A 3AHVA 3WD1A 3G1RA 2CKRA 3EA3A 1SZRA 3C0LA 4L64A 4TMCA 3NR0A 3B8TA 2D24A 1ELSA 3I6RA 4E8CA 2G4FA 2V2CA 4GIRA 1J93A 3E0IA 2PDLA 4UMCA 3OPSA 2E09A 4JYDA 1TIWA 2VRKA 2VEKA 3KEHA 1I2PA 2CYGA 4O28A 3UJSA 3B0XA 4P7OA 1BQGA 3KOFA 1BRLA 2W4XA 1W9VA 3CTLA 2J66A 4JL1A 4QS6A 3ZS4A 3V16A 4GRSA 3WLPA 4WHBA 1DBTA 1KTCA 1QI4A 4CD4A 1DWIM 4FS9A 2JCHA 3ATZA 2RTSA 5DY3A 1EGMA 1KO0A 3CGTA 4E2OA 3NCOA 3ZYZA 1JPKA 3VIIA 4AY7A 4XZHA 1NFBA 4IP4A 2HPIA 1SZGA 3EWCA 1CXEA 2ZRWA 1W1PA 4R34A 3AHZA 3E2RA 3QV8A 3VC6A 5D2TA 2P8BA 1ICQA 4UTLA 2RFGA 2ZXQA 4HSHA 4HSNA 5LIKX 5IOBA 5G1TA 4KFPA 3W87A 2DSKA 3LBCA 1WDSA 5GJPA 1TMQA 2P5NA 1KW1A 7REQB 1FWEC 1PBGA 1B90A 1T8QA 3LRKA 3D47A 5AZ1A 3TAOA 4NY2A 3VD7A 3T44A 1AK5A 5A2AA 5A69A 1KGXA 4AIEA 3VIFA 1H2JA 1V3IA 4GH9A 5BPVA 5B7YA 2E77A 1UH3A 3GAKA 5CC3A 3S9YA 1LRQA 2WC4A 4Z08A 4K38A 1JAKA 1WUEA 3NOEA 1PJ9A 1L2QA 4L4LA 3F4WA 3G6LA 3MSRA 3P74A 1HX0A 5A2BA 1RA5A 1I4NA 4V33A 4EIVA 4UTMA 4M5PA 4MNLA 5D9NA 5KZMA 2R1MA 3IGSA 2ATSA 3QXBA 4GY0A 3RPDA 3HPFA 3AXIA 1TA3B 5BMXA 2GDUA 3OZYA 1H1YA 1UPPA 1NH6A 3AS1A 1WBJA 2VEFA 3WJXA 2BASA 4CNTA 1FWTA 1OX6A 1ZTVA 3OJGA 2QCHA 1KBKA 4GVHA 1SM9A 2VFFA 3AZTA 3HGJA 4XVDA 3IRSA 4H9XA 4CNOA 2JGQA 1E88A 1TV2A 4RV3A 3VGFA 1XYMA 3S2JA 1DPMA 3TW9A 4W85A 1OWQA 2CEQA 1XLIA 3M4HA 1BF6A 2PGEA 1GJPA 4J3UA 4XX6A 4BF9A 3PVFA 1G7UA 3OYXA 2QR6A 3L23A 4OZOA 4Z1YA 3BLDA 4D8LA 5I02A 1H7RA 3N6JA 4AG0A 3CPRA 2NLYA 3A4XA 4QHRA 2YCLA 1FWWA 3MANA 1UJPA 2ACUA 1YW1A 3OHMB 1X8CA 4RE3A 1F76A 3UJ2A 4D6HA 2ADAA 1EPVA 3GIQA 1WX0A 1IZJA 2A5HA 2EAWA 2UV8G 3V0SA 1Q6DA 2E5BA 3AHTA 3W22A 1ZAIA 3SCPA 2MNRA 2O9RA 3IVTA 2CLHA 3UXKA 1R87A 1EB3A 3PZ9A 1F9CA 5LIUX 4XKYB 1J01A 4GUIA 8CGTA 1VCGA 9CGTA 3TONA 3CHFA 3U5UA 3ARXA 1JI1A 1LUCB 2VM8A 1QT1A 3B97A 3W1XA 1RBLA 2YOCA 1R2SA 1K7EA 4INFA 4DXVA 3P61A 5BOFA 2VO5A 4AEEA 3FYPA 1EH9A 3A64A 3TJ4A 3O3RA 2BV9A 1DWHM 2Z1BA 1O6IA 3S2CA 5U4NA 1XYFA 2W67A 1UP3A 4M7SA 2YXXA 3UZWA 2Y0FA 3BPWA 3DGBA 1XLDA 3TSDA 1KNWA 3FOKA 2QPXA 3DFPA 3UG5A 3ZQ9A 5CZ0A 3P14A 3NQGA 1V7AA 3W53A 2WMFA 1XHGA 1EKOA 2WQDA 3LSBA 2FB3A 1Q6EA 2XD5A 2OR2A 4REQA 3PNUA 3AMDA 3H2EA 1XISA 1XQKA 3WBAA 2YGYA 1O12A 4WJXA 3P8IA 4BWLC 4LCQA 1QPKA 1O60A 4GUFA 3WBXA 3BE7A 3PWGA 3AFBA 3R10A 1QOPA 1R9XA 1J5TA 3N18A 4B5SA 5FEXA 3HGRA 4UMBA 1OINA 4FXRA 1GK8A 3PSWA 5CC7A 3N2XA 1TUFA 3R89A 2ZX7A 5JH1A 4H9ZA 5HR7A 1XKJA 2A21A 2ZUSA 3MJYA 3NSXA 3CNYA 1XSKA 2DUZA 3LXAA 2FPYA 1S5TA 3ALGA 1B31A 2QNEA 1Y65A 4AMCA 2ZIDA 1UYQA 1K7FA 4S3CA 1UQYA 1A49A 4ZR8A 2F2KA 1TPB1 2JEPA 1WZLA 4DZIA 3EOSA 4DJEA 1C90A 4C6DA 5HAOA 3BAYA 3AUOA 4O15A 5AVNA 1K70A 2GK1A 3NGJA 1IR2A 5CPNA 3WQVA 1UR3M 4GI6A 3EB3A 2VR2A 4HZMA 4P61A 3EEGA 3VX0A 4PUUA 3EMQA 4AZB