4NZ4A

Structure of vibrio cholerae chitin de-n-acetylase in complex with 2-(acetylamino)-2-deoxy-a-d-glucopyranose (ndg) and zinc ion
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
403
structure length
403
Chain Sequence
PKGTIYLTFDDGPVNASVEVIKVLNQGGVKATFYFNAWHLDGIGDENEDRALEALKLALDSGHIVGNHSYDHMIHNCVEEFGPTSGADCNATGNHQIHSYQDPVRDAASFEQNLITLEKYLPTIRSYPNYKGYELARLPYTNGWRVTKHFQADGLCATSDNLKPWEPGYVCDPANPSNSVKASIQVQNILANQGYQTHGWDVDWAPENWGIPMPANSLTEAVPFLAYVDKALNSCSPTTIEPINSKTQEFPCGTPLHADKVIVLTHDFLFEDGKRGMGATQNLPKLAEFIRIAKEAGYVFDTMDNYTPRWSVGKTYQAGEYVLYQGVVYKAVISHTAQQDWAPSSTSSLWTNADPATNWTLNVSYEQGDIVNYKGKRYLVSVPHVSQQDWTPDTQNTLFTALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Deacetylase DA1
publication title Structural basis of chitin oligosaccharide deacetylation.
pubmed doi rcsb
source organism Vibrio cholerae
total genus 147
structure length 403
sequence length 403
chains with identical sequence B
ec nomenclature ec 3.5.1.41: Chitin deacetylase.
pdb deposition date 2013-12-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.90 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4nz4A02
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 4nz4A01
4NZ5A 3HFTA 2NLYA 5BU6A 2J13A 3RXZA 1W1A1 1W1B1 2C1IA 3WX7A 4F9JA 4NZ4A 4NY2A 2C1GA 2DFAA 3CL8A 4NZ3A 4U10A 5JMUA 4NZ1A 2I5IA 2IW0A 1XW8A 2Y8UA 3QBUA 2CC0A 1V6TA 3S6OA 4NYYA 2C79A 3VUSA 4WCJA 4F9DA 1W17A 4HD5A 2C71A 2QV5A 4M1BA 4V33A 3CL7A 1NY1A 1Z7AA 2W3ZA 4LY4A 4NYUA 2XU2A 3CL6A 2E67A 4L1GA 2VYOA 4OUIA
chains in the Genus database with same CATH superfamily
3EGJA 4E3TA 2XIBA 1C93A 3S1XA 5I5RA 1DVJA 3BCFA 4L9ZA 3WD4A 1OFDA 2YGYA 4B5XA 1QPRA 1KRAC 3LHWA 2NUWA 1HP4A 3BCJA 2VEGA 4PFHA 3GE7A 1H7PA 3VDCA 2EEXA 3ARSA 3HF3A 3QRHA 5AN7A 4ZFCA 3UERA 2QUMA 3BK0A 4U3AA 1GVOA 4AIOA 1M65A 4JX6A 5BXPA 3UR7A 3GG7A 3LHVA 2OCZA 3WJZA 2QIIA 5E9AA 2IKIA 2XPKA 3EOUA 3N18A 1EQCA 2G50A 3N4EA 2RHGA 3TLLA 5FF2A 2Y5EA 1OG6A 1IEQA 4KERA 3EA2A 1E5NA 4L6DA 5AVNA 1E9LA 4FP1A 3S46A 3CH9A 3HA1A 4Z2JA 1EJTC 1C29A 1IXOA 1TE6A 4IISA 1X8CA 1XUZA 2EBNA 4KFOA 3U57A 3DGBA 7ENLA 3ARVA 4AISA 2E67A 5MHBA 4IL2A 1EP1A 1PTDA 3W7DA 3TQ0A 1MUMA 3WK2A 1Q5MA 5GNXA 4IIBA 2X30A 1PYMA 4FALA 4ATLA 4P8VA 3DG3A 4JKKA 1E1CB 1KM1A 3M16A 4O1AA 4QFUA 3U4FA 1HTIA 5EYWA 2Z6JA 2ZXAA 3O6DA 4G8TA 2HBVA 4PCTA 3FXYA 2J8TA 3GG8A 3B05A 2OSWA 3DBNA 3TYUA 3EKZA 4GCXA 5CPQA 4Z0JA 2JFEX 5FL0A 3B0XA 2B81A 1KD0A 1QW7A 3W22A 1ZAJA 1O5KA 2FJKA 1TV5A 3U2ZA 2ZIDA 1CX9A 4UZUA 1OYAA 1H7OA 3CL6A 3TFCA 3GHTA 4O0QA 2HISA 2D20A 2YOCA 1A5AA 3WLKX 3IVTA 1IEVA 2XGZA 3TC6A 2WVSA 2ZUMA 3KTSA 4H83A 3UWQA 1XX1A 3W87A 1K70A 4AF0B 1V0NA 4JQ3A 3SRKA 3TAOA 4IMAA 1GONA 4PTMA 3I7RA 5G4WA 3C56A 1E4LA 2VD8A 3LOTA 1A5LC 5D2TA 1MEIA 4HYRA 3AHXA 3VIMA 4PMYA 3W3OA 5G2IA 4F9DA 1VFFA 5CSRA 5J8LA 1F05A 3CLMA 3WLOA 1E9YB 3CZ8A 4JNZA 3SZ8A 1W3KA 1DTUA 1PO9A 2POZA 1U30A 3ZSTA 2A1YA 4W5UA 5G5IA 4K39A 5HATA 3G1HA 3AC0A 4RL3A 1G9HA 4S3JA 1TFVA 3NQ2A 3TW9A 2HMCA 4ADUA 3NL5A 4N0RA 1CLXA 1D3GA 5HJXA 5I3JA 3HONA 1Z44A 2OQYA 2QGHA 2Q8LA 4S3FA 4H8HA 4DNMA 1O4UA 1AUSL 2WLZA 1B3VA 3AISA 5D37A 4JY9A 3WH6A 2GGIA 1PXGA 4DO5A 1PHWA 2RKXA 2HS6A 4IMDA 5AECA 4H9UA 1EBHA 4DYJA 4Y2WA 3WG6A 5A6MA 5E09A 5C71A 2W6RA 3W7HA 4B3LA 4UQDA 5EY5A 2C14A 4B15A 3KW3A 2D1ZA 2FPYA 2QCHA 1SZEA 5DQPA 3J7HA 3RHGA 3CO8A 3O16A 2TSYA 1YPXA 2XH2A 3SJNA 1A49A 4C6MA 4J40A 4L1WA 5DF0A 3W00A 4P7RA 3NEHA 1CXKA 2C6QA 3WMSA 4FNPA 3K4WA 2O4QA 2XIOA 3ABOA 2PURA 1OK6A 4D6GA 3ANUA 1TCMA 4IJRA 3MMWA 1OGBA 4Q7NA 2VEIA 3S42A 2VFDA 4LBRA 3OZMA 2NQZA 4IPNB 1XL9A 2GJNA 1TA3A 1YBQA 2I9EA 5M03A 2YCEA 1VAHA 3KOZA 1N82A 5EFFA 3AXKA 4W5ZA 2VRKA 2ZRUA 2R91A 1BXCA 1XSJA 3DFSA 3HSHA 3V36A 3PULA 3SAZA 1ITCA 3OZPA 4E2VA 4DWSB 4DQWA 4JN7A 2XHYA 1XICA 2XFRA 5AC6A 1SR0A 2VEFA 2WQPA 2OOGA 1NM9A 4ROQA 3HPSA 4X9YA 4YS1A 1A5SA 4QLJA 1EO5A 3MWAA 4ROPA 4LVBA 4H4IA 1CGVA 1QK2A 4LUSA 5I0DA 1W3NA 1DWIM 2RDXA 4B5VA 1E6RA 5HULA 4ZL1A 1K8CA 9CGTA 1WDRA 2XWDA 2A3HA 1QAPA 3UWVA 4S1FA 3T0BA 3UCDA 1D2KA 3R5EA 2XGBA 4D6HA 4N7QA 3GG1A 1KV8A 4H00A 2VURA 4BZYA 1V79A 1J0KA 3VYLA 3OIXA 2YL8A 3QZAA 2V8ZA 5HNRA 1NFGA 1Q85A 3CEUA 1VYPX 3WK1A 1WZMA 2J78A 4GBDA 3KTXA 4IPIA 1B54A 1S2AA 1TWIA 1YW1A 1VBGA 3M0XA 4HZ6A 1W9VA 4KS0A 5XIMA 2E7FA 1PX8A 2BY1A 2VGIA 4IGHA 4D72A 2OKTA 3GXPA 1N8WA 3TP4A 4NX0A 4GFSA 1JDAA 1LM1A 3B4UA 4MZYA 1F3TA 1H51A 5HJYA 4OUIA 3U2OA 1XIGA 4XAZA 4MF4A 3T44A 4J3VA 4QM1A 2WYSA 3WLMA 3VOHA 4RDWA 3BMXA 4U5IA 1X1OA 2AGKA 3W7JA 3AHVA 1ME8A 2NXGA 4V1YA 3V0SA 3SQLA 4XIMA 1C9DA 2WJDA 1TRDA 3LYEA 3WJSA 4WKHA 3A5VA 4KGJA 3GBEA 1V8EA 3V75A 4CNOA 1YPFA 3GU1A 3FGCA 5LNVA 1PUDA 4GY1A 4ZO6A 2VR5A 2Y0FA 2MUCA 4RCXA 3ABSA 1NDYA 3SW6A 3PNZA 3ATZA 4G6CA 4N6FA 3C8NA 3QYQA 2NX1A 5T91A 3ZLFA 3MANA 2VCAA 3VM5A 5FF4A 4M24A 1G5AA 2A7RA 4WZHA 1QFEA 2CU0A 1IHIA 3G0SA 3K13A 2PLMA 4UTKA 4I7VA 1WOAA 4MPQA 2PWGA 3W86A 1ZHAA 1MNSA 3E5BA 3MKCA 3CYVA 4A3HA 1SO4A 3VDHA 4OV9A 2QV5A 3LLDA 3GIQA 1R3SA 3HGJA 5CC7A 3L21A 1H1ZA 1ZJBA 3QEZA 3LM3A 4OHQA 1AQFA 2CXEA 5FJRA 4B91A 4GXMA 2BNJA 1UUQA 4PODA 3O3RA 4I3GA 4C6CA 4ZCWA 2OWCA 4H2HA 5I09A 3GNNA 2Q01A 4M6UA 3NQGA 4QDMA 5AHMA 3T55A 5LYRA 1XLKA 3FAWA 3CTLA 4RZ5A 4XSMA 3GR4A 1O5RA 4H2CA 1VPYA 1P6CA 2PWFA 1RR2A 5CPTA 4PBGA 1R3VA 4LXFA 5H8MA 1NDZA 3MUAA 2QZRA 3VC5A 3BJFA 4AC7C 3W1PA 4Y7EA 4DN1A 3IJDA 1EDTA 3HM7A 1BWKA 3WLLA 1J5TA 2QIWA 1NOWA 2EG7A 4DUOA 1XSIA 2NX3A 2O9RA 4NUWA 1C8QA 4ML9A 3B9NA 1KM6A 1CGTA 1FHUA 1NF7A 1HL8A 3CLWA 2BV9A 2PC4A 2Y8KA 1YXDA 3P8IA 1G4TA 1DJZA 3CZKA 2Z29A 1QW9A 3O9NA 4M0XA 5DX7A 3CPRA 2WKJA 4ZZ9A 3AWNA 3THCA 4GQ0A 4UXDA 1K3UA 2CKSA 2OFJA 2VVNA 1ZLPA 5KITA 1AW1A 8TIMA 4AG0A 3BLOA 5CPOA 1OIMA 1CXIA 4NNAA 1VS1A 5M1TA 1GVFA 1JUKA 1VFOA 1NWRA 5A6BA 3T0CA 2V3EA 3L2MA 1OIFA 2RDWA 2A3AA 1UIPA 1KKOA 4C7FA 4JZ5A 1KNWA 1NWUA 2TPSA 5LGXA 5CJ5A 1UR2A 4QEHA 6ALDA 3ZIZA 4GQBA 1EO7A 3PBVA 3STGA 3RO8A 5HJLA 4P7OA 4UZSA 3HG3A 3LXCA 1VJZA 4GA8A 2EPOA 4JN6A 4R9XA 3MUXA 4O19A 4XTDA 1E6XM 4AZIA 4GK8A 4WJXA 3W73A 4H7ZA 1Q3NA 1UMYA 4WDWA 3VCRA 4JYFA 4LUSB 4F0KA 4GI8A 1KC7A 3SN0A 5HANA 3TU9A 1FFQA 2OELA 4LUIA 2V82A 4MY1A 4LAUA 3EWBX 2E5DA 1BF6A 4W9TA 2P3ZA 3WQOA 3N13A 3TA9A 4K1WA 1WXJA 2DZAA 2YBUA 3UWUA 4EPBC 2D2JA 1J8VA 3S9YA 3B9OA 3GDTA 5EMJA 1KWKA 4LYKA 4NNCA 1JNDA 4WSKA 3SIMA 2HK0A 4LQ1A 4IX2A 1C8YA 3LHTA 1EHNA 4AHPA 4TX8A 2XGIA 4KPLA 2E77A 2QCCA 4IMGA 3LCIA 1JFXA 1QJWA 5BROA 1ZU8A 2X1TA 3EWCA 2IPFA 4CN4A 4UCFA 3WFZA 2OX4A 3VFLA 3F03K 3QSTA 1MUWA 3FSUA 3TTYA 3WDIA 4CCZA 3GFXA 2FZ8A 1XIFA 3PPHA 2CLLA 4KWOA 3JS3A 4RDVA 3KCJA 2CPUA 1J6OA 1SJDA 2D0FA 5L9FA 4YXGA 2EPNA 2YA2A 4ASTA 3CEPA 2GPTA 1MZHA 2NVDA 1GYMA 3LUTA 1TVPA 2CHRA 2WLYA 1MRQA 1JIBA 3THDA 3BOXA 1CXLA 3UXAA 1QW8A 1XIIA 4NT0A 3JU2A 3B9DA 4NZ3A 3MQTA 1KO0A 2PRLA 3FNDA 3L23A 3ERPA 2XN2A 3AHYA 4GNJA 3TYCA 2E6YA 4EX4A 1T5AA 3MSGA 1U5VA 3FVMA 1CDGA 1T0OA 4JFSA 2A3LA 2ZRXA 2Y2QA 2ZQ0A 3TXZA 5BRQA 2DUAA 3AIVA 1F8MA 1M6JA 1IGWA 1P0KA 1PZ1A 2WHKA 4QROA 2A2IA 1EIXA 1F3XA 1A47A 4XUYA 1E71M 1SGJA 2Z1BA 3WJXA 1ED7A 3IANA 2FVLA 1UWTA 3GDKA 4GPNA 1O7AA 5FAJA 3UJ2A 1LL6A 2PDJA 4XZMX 4PMUA 2QCEA 2INFA 2BB0A 1JZ8A 1J12A 3W2LA 3W1AA 4TV5A 2XFYA 2OT0A 4LCQA 4B5SA 1KRCC 4XV0A 4Y9PA 1SW7A 2V5BA 2E6FA 2VM8A 1J0YA 3GQYA 1I1XA 3USBA 2HRWA 1W32A 3R8RA 4Q33A 1M7XA 4JIQA 4IBKA 4I9MA 3VPLA 3TYDA 1XR2A 2BGSA 3L9CA 1V0LA 5C2GA 3S3GA 2V67A 3MP3A 3UY8A 1C8VA 1IE7C 1XYLA 1GT8A 1OT1A 4CQCA 2QCFA 3AZSA 3O7UA 3UR8A 1TWSA 3GVQA 5CPNA 3VO0A 5FF0A 2CZFA 4A21A 4I6KA 3DZ1A 4FNQA 2X7VA 3W6YA 1VBHA 3EKLA 3UWWA 3P62A 2ZZ4A 2KX9A 4PRWA 4FPSA 2YLLA 3QFWA 3WDJA 1S38A 1WKEA 1K77A 1W1TA 3DFTA 3CXOA 5EB8A 4N2YA 3GHUA 1BEUA 3D3FA 3EA1A 3OB8A 4WD0A 4ONVA 5GPRA 3R43A 4OU1A 2D0HA 4ZB0A 2QCDA 4D6IA 3CHFA 1YIXA 4EF9A 3L65A 1ALDA 3CGTA 2VC5A 5AC7A 3TN4A 2OYLA 1W6TA 4BWLC 2Q09A 3ISIX 4GKTA 2W0UA 3P14A 1LLOA 1OJXA 4L6OA 4E8CA 3B04A 1NIUA 5HNTA 1BVWA 4JCMA 4JNMA 4MAVA 4KKXA 1H0IA 1QI0A 1TREA 2ZDRA 3FCPA 4HNCA 3RJYA 4DPPA 3G0XA 1EL3A 3LM7A 4H9XA 3F1QA 5DXYA 5A8GA 3DECA 3THAA 3OVGA 1Y5XA 4ERIA 3FV9A 4V27A 3UEQA 4AWTA 3W01A 2BHZA 4D6FA 4GYPC 4LCSA 1FP8A 5FEZA 2D23A 2ZZ6A 1W8SA 1MWOA 4RLIA 3M5VA 3R94A 4FNUA 2Y2WA 4AYSA 3PWAA 2P76A 3CUJA 3D6NA 1VBRA 4ZO8A 4JQ4A 4HPHA 3VCNA 3R25A 2CKRA 5CZKA 4QS5A 4DBSA 5A6JA 4AFYA 2AL2A 2B0MA 3BURA 1MMFA 1AZ2A 2ZUUA 3KLKA 1XLFA 3CPGA 4LB4A 2W62A 1I0DA 2GSHA 3E74A 3WF1A 1UMLA 1XBYA 4QLLA 4JS3A 2OZTA 1QNSA 4C5ZA 3A4WA 4PH6A 3S5NA 3PJWA 1MXDA 4MB4A 2I5QA 2IQ0A 1Y5WA 3BE7A 5K2ZA 1UQYA 2QNEA 4CU7A 2J24A 3H55A 2HDJA 4ZOBA 3GXDA 3HBLA 1WA3A 3MVIA 5CJNA 2O92A 4I90A 3FA5A 2PU1A 3VIJA 4R7WA 3LGDA 4ICCX 1ZY9A 4IXHA 2BHUA 4E3VA 2QPUA 2WVVA 1YUEA 4IUGA 3F5JA 3W38A 3LY0A 1YXYA 4Z17A 3AMDA 1FXPA 1GEHA 3M5ZA 4GJ1A 3G8EA 5H8PA 3FX4A 1BLIA 4NZCA 3WLPA 4RE2A 5FJOA 6PTDA 3KRBA 1RSCA 1T7LA 1DJWA 3QV9A 4DJEA 4MGGA 1ZQ5A 3G0UA 4HN4A 4XZIA 3KS5A 2HPMA 3UCQA 1QBBA 3VKDA 5TF0A 3UNDA 1BYAA 4IQEA 1R2SA 3JVAA 4QJ1A 4U28A 3TN6A 2NV2A 1VEMA 1M01A 4FX7A 3QOKA 3VK5A 3MT1A 1VFMA 4HCDA 1O5XA 1AZ1A 3OODA 3DERA 4KWSA 3PY2A 4QS6A 3FDKA 4D6DA 2GOKA 2NVAA 3C6CA 1XWYA 5BNKA 1R6WA 3S2JA 4E38A 2WBGA 3L2AA 2WJZA 4LF1A 1KM0A 2R1LA 3NURA 3RDKA 3RILA 3WBYA 1HJSA 4LALA 3AXIA 3SUVA 2XJ7A 1JCXA 3ARZA 3R12A 1UJQA 3C0QA 2PDFA 2QUTA 4IIEA 2Q8ZA 5A6LA 1OABA 3RG6A 3B8TA 3DKJA 3Q58A 3T81A 5KMYA 4AQLA 2ZWZA 1TWWA 4F2TA 4HZ7A 4FNRA 1WXYA 4LTSA 3SCSA 4HB7A 1DQWA 2VGFA 4B92A 3OLDA 2WXDM 4JHMA 1KA9F 4A8RA 3FA3A 3Q65A 1OG0A 2DP3A 4GI9A 3LNMA 1V5XA 1TMQA 1QDSA 4FXFA 2YX0A 4O1FA 4EOUA 1UPPA 3GTFA 3PZNA 1TPDA 4WCJA 1DJNA 2QJNA 4AC1X 4MTVA 5JUVA 1JEZA 2VXNA 1S5MA 3W0KA 2ZC1A 3RU6A 2R6OA 4JTQA 2VR4A 4WR3A 2ZVRA 4NI3A 3KBVA 1RP8A 4B9YA 2Z24A 4UQ9A 4XZ9A 2ZRVA 1E40A 3MDUA 3NZPA 2PODA 3HGOA 3M44A 1BHGA 4C6JA 1OX5A 1QOQA 1GKPA 5KINA 4AYGA 1J9YA 2PDPA 1PV8A 3A4JA 5M17A 3LD5A 1I2QA 9XIMA 5KTLA 2OYKA 1GVIA 2WNWA 3WNNA 1DEDA 3INPA 4IXXA 4FK9A 1J79A 3NPUA 4M1BA 3BJSA 4WEVX 1RPKA 2P5NA 2JCHA 4R3UA 3LTYA 2ISFA 5D2YA 4LAMA 1TPEA 4BF9A 3CQIA 1R3YA 1UHVA 1GKRA 3H2MA 3V5OA 1UR8A 2QCDB 3U3HA 2IKHA 4ZTYA 5EMMA 2HVMA 1T96A 2JBMA 2GQAA 4DZ5A 4G1KA 3WD3A 5H1WA 1EC9A 2Y70A 4AX7A 2OWWA 3GIYA 4M82A 3UXIA 4M81A 1XW8A 3REQB 4CNUA 2ALRA 3KL3A 3WQ6A 3W82A 5AKQA 4JBRA 1VJSA 3HO8A 2YA0A 4OKDA 7CGTA 3EPMA 4GGHA 4JTFA 1V51A 3MHFA 3SJ3A 3RIKA 4CUCA 3QPZA 3W6LA 3Q67A 2XVNA 2OGYA 3G77A 1BSIA 1WDQA 2ZZ5A 1ZJAA 1CZ1A 3ECQA 1Q2RA 3UG8A 4F4RA 3W7IA 3WEZA 5HWNA 4E8GA 4HHPA 4NX5A 1GUVA 3BQ5A 4KF1A 4HPNA 4UQCA 1UP3A 1FWDC 1CPUA 3OLGA 2AL2B 4OJ5A 3UA3A 2OLHA 3T4WA 4WX2A 1JYXA 1IF2A 1R2TA 1YLVA 1TUXA 4JTRA 3WF2A 1EWDA 2C18A 1NWSA 3CTTA 3T09A 3UT0A 5LIXX 2FQIA 3MKKA 3BLPX 5CPMA 1BTMA 4D6EA 4NHVA 5HMDA 1PKYA 3OBEA 2PCEA 3USZA 3ZMRA 5I78A 4AB4A 2V2DA 1XHGA 3B0PA 2A6LA 2ZX9A 5HUPA 5LXEA 1EEXA 2DJLA 3CS2A 2BWGA 1BQCA 5DCEA 2PA6A 2Y1HA 2W79A 1KR1A 2WVVB 1CLKA 3EWZA 5HR7A 4O8RA 3BSGA 2O9OA 3GH4A 3RK8A 3O06A 1Q8AA 2JKAA 3RPTA 3NDZA 2DH3A 3Q45A 1V03A 1US0A 1XDMA 3TYZA 4CVWA 2WCGA 1TUFA 1IIGA 3W1UA 6XIMA 3W1TA 2QS8A 3IRDA 3N25A 4CCDA 2J66A 1VCFA 3VNMA 4H7VA 3R8HA 2INZA 3N73A 4XUGA 4MKNA 4B2DA 5AB3A 3DN5A 2CLIA 3KTCA 3IGUA 3APTA 4GINA 4IJBA 3UPWA 2Y2MA 3U5UA 4AZ7A 1PIFA 3CUHA 1W9BM 1DIKA 3SFWA 2WC3A 3TSBA 1S39A 2I57A 1RJQA 2YCKX 3PZTA 2BVTA 1X96A 3BLKA 2Z6IA 3W2UA 5FJTA 4IIHA 2NQHA 4EPDC 4X3ZA 3G8RA 4J1OA 3NYDA 9XIAA 5MKGA 2BTMA 2DSVA 2J77A 4CNNA 3L4YA 3C0SA 2J7GA 1M5WA 2G8ZA 1P6BA 3SRDA 5A2AA 1P0NA 2ACRA 1A0CA 5JBDA 4GVGA 2VTFA 1AQMA 1S2WA 3A3WA 3QZEA 4X2RA 3UY7A 4GVIA 4O1EA 1V0MA 4G7EA 2JKEA 3FKRA 3ME3A 3QFEA 4LS2A 3F4NA 1DP0A 3QY8A 3KZPA 4HPJA 3LMYA 1LT8A 2H9AA 1D7KA 4PTNA 2QMKA 3KVLA 3MWCA 2PF0A 3BSHA 3DFHA 3L4VA 3C2VA 4JN8A 3NYZA 2ISWA 1FDZA 4ICNA 5J04A 4OJ6A 3F7JA 2NLIA 2C16A 4GQGA 3OG3A 3M5YA 1BGGA 2ZUNA 3O2LA 1OCJA 3IEBA 3OO2A 5K9CA 1E1EA 1US3A 2VGBA 3IVUA 3FHAA 2V3DA 1I1WA 4IBJA 1GGOA 5JVLA 1KBJA 3M0IA 5BU6A 2J25A 1DHPA 1F2JA 4F0MA 2PDYA 4CD8A 2HK1A 1R7OA 4OJLA 2ZWYA 3LN3A 4AVOA 1KGUA 2Y8UA 3L5LA 1UKSA 4JTCA 2ZRWA 5ECUA 4FR1A 5C55A 4CQBA 3W24A 1PE1A 2X16A 2I17A 5LIUX 2RJGA 5TBOA 1PHQA 3SUUA 4PEEA 3VGEA 1UP0A 2FMOA 3OU8A 4PZVA 4IJFA 1TZ9A 4BY3A 1BYCA 4DY1A 5HQLA 1DJGA 3NZ1A 1VZWA 3MI6A 1DJXA 3S2MA 2PBOA 1EJUC 4GUHA 2R1MA 1RPXA 3IJ7A 4Q8QA 1IZCA 2XVGA 3I4KA 1FOBA 2DT0A 1AIWA 3B97A 1X39A 4ZBCA 2NVCA 4O57A 1TCDA 2A5HA 3A47A 2OLAA 3DXIA 3AIUA 1GOQA 4PB5A 2VEKA 2HJPA 1F74A 1I8JA 1J0ZA 4L6HA 3KBWA 2CLFA 1UR1A 4I6VA 1Q66A 2NZLA 3FW6A 3P82A 3ZT5A 1KBKA 2UY5A 2FVMA 1F73A 3CC1A 2CZVA 3VNKA 3L29A 2J8FA 3QN3A 5TQLA 4H01A 1FRBA 1UC4A 4BQ5A 3DFOA 2B7PA 1E70M 1JYWA 1KM5A 4M29A 4MNKA 2PDQA 4KIEA 4P7QA 3WQEA 3DFQA 4DZAA 2HEJA 4QSFA 1HVQA 4WGHA 2FJUB 4DJFC 1IWBA 3WH7A 4LGXA 3GKFA 4PCPA 3VNDA 1ZBWA 4OFCA 3SQMA 1YTKA 1DIEA 3MSRA 4D8ZA 2E6AA 1XLAA 5DO8A 4BF7A 2DSUA 1XGZA 3LPPA 3O6CA 2A21A 4MHBA 1JUEA 2V30A 2GVEA 2D69A 4ES4A 3W29A 2Y2JA 3C0JA 3LU2A 4HU0A 2W9MA 4O50A 3TROA 5AYBA 1L8NA 2WC7A 4N4QA 3RFAA 2J8GA 3S9IA 2DGAA 2QW5A 3KDOA 4N4PA 4L1XA 2H8ZA 5LIKX 3T7VA 4YLWA 2J6XA 3LBCA 2G5WA 3ARYA 1XP3A 1IXQA 2JF7A 5D33A 6A3HA 4Q8UA 4GABA 1ZPTA 5F4XA 2FHBA 4MWAC 3P7YA 1XG4A 3ARPA 1A0DA 4GI6A 2IOUA 3C5QA 1THFD 4CLMA 1EF3A 2QDDA 5D9OA 2YL9A 1CGXA 1SW0A 1EUNA 4PA8A 3BJTA 3WQDA 2YDAA 3VDAA 1FA2A 2QYGA 4WJEA 3R8GA 1CTNA 3DFNA 4IBDA 2Z27A 4QE1A 1EB3A 3OJGA 1ECEA 4HSHA 1ZB5A 2OU4A 3N11A 1ZS2A 1SFSA 2A3BA 4MYAA 4YL2A 4FOKA 3K4AA 3NZGA 1VKFA 2YCJA 1PKMA 4TO8A 3LPOA 3B8VA 4GVHA 2CZDA 1SFTA 1OGGA 4M56A 2YJQA 1TPUA 1N55A 1UJPA 3UZZA 2D73A 2UZ9A 5DY2A 4PMQA 5A3HA 3P74A 4C1NB 2Z1VA 3WQ5A 3GU2A 2EJ1A 2PLCA 3CH0A 1JJKA 1JDDA 1S1PA 3NO3A 3N34A 1LOQA 4X0NA 4I7WA 2RGMA 2HZGA 4PMVA 3JW7A 1W5MA 3QYSA 4M19A 3BG3A 4AZ5A 2BODX 4OTKA 1S2VA 2BG5A 1JUBA 2QPXA 3L67A 4AEOA 3T0DA 5IBXC 1KM4A 4B4FA 3W1RA 3EX4A 3CQJA 5KZDA 5MKGB 1A5OC 5AHFA 1DJYA 4Y9OA 2CLPA 4UUIA 5HPCA 4TMBA 1QNQA 4LVDA 1E73M 3OP2A 3AIBA 3S5YA 3B0UX 1HVXA 1YDVA 1ESWA 4L7ZA 5DANA 3GXTA 4ZENA 2Z7GA 3PBUA 5D4YA 3QMSA 2Y2HA 4G7EB 3QF0A 1L6JA 2CBUA 4JQ1A 2H9AB 2FZDA 4MPKA 3T4CA 4MFEA 1MFUA 2DDXA 1FCQA 5AOUA 4M6PA 4O1CA 5TIMA 4M7SA 4GZJA 1TWZA 1ML1A 2GDVA 3LHYA 4JYEA 4D71A 3WBAA 4H9VA 3TTEA 4H19A 2CNCA 1JI2A 4QG8A 5BXSA 3E1F1 5CZTA 4L4PA 4O1DA 1AA1B 1AJ2A 2Y5JA 4HK6A 1Z69A 2EPLX 2PWDA 5BRPA 3E2SA 2GQ9A 1KRBC 1VPXA 1IEWA 3GYCA 4HZMA 2OR2A 1G4PA 3W37A 1Q6FA 1J0HA 4CCCA 2WMFA 1DV7A 5DMNA 5J5RA 4KESA 2CWNA 4ZSTA 4UB9A 1POJA 2J74A 2C91A 1GORA 1TZ7A 1X7FA 1KBBA 1UWSA 3WNPA 2XVPA 3WYZA 2O55A 2IUZA 4DUWA 3WLTA 3OA5A 4S2CA 2GUUA 2OODA 2HQAA 5I24A 1EFZA 1NDWA 3S5ZA 3LA4A 5CZJA 5B7YA 4UQAA 2OZ3A 1X38A 2Z7KA 3W7RA 3GB6A 3KBMA 2CZEA 4RPPA 4GH1A 3RR1A 2ZC8A 3VINA 1KW1A 1KFJA 3KOFA 2AOSA 4A3RA 3VGBA 3RXZA 3MMUA 1EBGA 3CMGA 1JFHA 1XDJA 1JCTA 4NJGA 3PAOA 3TNOA 3P2VA 1W0MA 3M6YA 1FHLA 5HK4A 4ZA0A 1DKWA 3CZGA 5FOOA 4C7GA 4W88A 1EP3A 4G2DA 4LNCA 3TR2A 2NW0A 3S1WA 4LB3A 3DESA 1A4LA 2OG9A 4IIFA 4CQAA 4O11A 5CSYA 3QV7A 1R9YA 1E0UA 3VOJA 4DZHA 1VLWA 3DDMA 3M4HA 3QKZA 1UWAA 1VPQA 3PG8A 2VZTA 4O4WA 4ZO9A 1UR0A 4ZQRA 3RR4A 2HCVA 1MQRA 4LS1A 3SBFA 4J3XA 1XYBA 3LXBA 2QAFA 4QGCA 2J4GA 1F07A 5E93A 4DBWA 1J0IA 2VT0A 4XAYA 4RNJA 4TUFA 3RM8A 3ITXA 2PGFA 2VUNA 1FWGC 3KS8A 2X2GA 4GYJA 1ONWA 3ITTA 2OZ8A 1U1UA 4QISA 1J93A 1XJBA 1TVLA 1UWUA 4K8HA 4GZ7A 5F4WA 2YKKA 1AD4A 3BO9A 4J28A 1KGWA 3FY1A 1NJJA 3BAXA 1OFAA 5JH2A 4S38A 4DM2A 2DY3A 3OTRA 1HKVA 2P53A 1B5TA 1T8QA 5LA1A 4JHZA 5CGTA 5T9BG 1OX4A 1C8XA 4YVPA 3CAKA 2Z25A 4H3DA 4EXQA 3RO6A 1GYLA 4KMQA 4ZE5A 1I75A 4KEUA 3T40A 1V3HA 3C86A 2TRSA 3TK7A 4QQ3A 2W91A 4C6PA 1VEPA 1TV2A 3NA8A 2E9LA 1ENUA 1PKLA 1ISXA 1Z42A 1KFKA 6XIAA 1J18A 1ADOA 1G4EA 4OVXA 1PX3A 2PU0A 2ZTKA 3EA3A 1X8FA 3KRUA 3LXAA 3M5XA 1W5QA 3WJYA 4HTBA 2VFHA 5DFAA 5HBFA 5I03A 2VNCA 1G4SA 3OA3A 1KWGA 2B31A 2XU2A 3WENA 4L9YA 3L28A 4RW3A 4L80A 3GUWA 4HMCA 2ZDSA 3VDGA 2FZMA 3BW2A 5FA5A 5CAKA 3RITA 1MNZA 3URNA 1CNVA 3ITYA 1FWJC 3N2BA 3IJ8A 1YHTA 3NQ6A 3BVJA 3ZOAA 3N9KA 4TX6A 1OSEA 3O05A 3SSZA 1RA0A 1H50A 2BLEA 3G6LA 4K2SA 1XLHA 3ZR5A 1CXWA 3FVDA 1GEQA 3AYRA 4WOZA 2FIQA 5JH1A 1WYIA 3GXFA 3MPGA 3D3AA 3Q2DA 3NWRA 2QDHA 8XIAA 1WDWA 3WQ4A 4MM1A 3WQGA 1JZ5A 1IQ8A 3BLDA 4HGXA 3A4XA 1TO3A 3T2OA 3EKGA 2MNRA 2RAGA 4OQVA 4AZ6A 3P60A 3AUOA 5AYIA 4WSHA 1YE6A 3NGJA 2Z2AA 4UOQA 3L25A 1B1YA 4YCPA 1XSKA 2HXUA 2DFAA 4JIHA 2X1SA 3GYEA 1UOZA 1ZZMA 1B2YA 4TVDA 1C9WA 3VI2A 1YADA 5DT5A 1K8XA 5FI8A 3PZVA 4KRZA 4RKAA 4WDUA 4B90A 4C65A 1N8IA 3ZLHA 1Q2SA 2VKZG 3K4DA 4HSOA 3BL3A 4J27A 2A79A 1QTWA 3AUJA 1EOMA 2PGEA 4FLOA 1JQXA 3EDJA 1RJRA 4E2OA 5LIYX 5CSUA 3BW4A 4W87A 1QVBA 3CASA 3EB2A 3O07A 2NWRA 3WELA 3AHTA 4LUYA 1FP9A 1VCGA 2IKJA 2VJXA 4A3QA 4C6IA 2PDWA 3GTHA 3A21A 5HWMA 2WKGA 2CEQA 1W3LA 4UQBA 1LQAA 2BHYA 2BY3A 4ALDA 1KLZA 4GCAA 2YFNA 4DI8A 1TE1A 5HQEA 2VWSA 1EH9A 3G24A 4Y9MA 1UG6A 4IP7A 2H6RA 4S3GA 2WSPA 2YLAA 2TODA 2CBIA 3WD2A 2AKZA 5AFDA 1R30A 3QQWA 1E3ZA 4HZ8A 4PTVA 2ZOXA 4F79A 2WMGA 4LY4A 4BQ2A 2V3FA 1TR1A 2QKFA 2PLJA 1LTDA 2F9RA 2QGYA 3GNRA 2PAJA 4IBFA 3M0VA 1R3WA 2GOUA 1H5VA 2JGQA 2ADAA 4JQAA 3VIIA 4AHOA 4BF5A 4UCGA 1WCGA 4PFMA 3W1XA 1RAKA 7REQB 1N2VA 4JL1A 2FFFB 4M80A 1G01A 3CU2A 5AYZA 1VBUA 1FQ0A 2WVTA 3QJAA 1KFCA 4J3WA 3NCOA 5AY7A 3OZOA 1YXCA 1J2BA 1U2YA 1M7JA 1K7EA 1HQTA 4UTJA 3NQCA 3I4EA 3ICJA 2HWGA 5D04C 1QI3A 4U4MA 3MS8A 3LCHA 1LQ0A 3C2EA 1H0GA 2YL6A 4HN8A 3NFUA 2PD9A 5MF5A 4J35A 3HQ1A 1SZGA 3EMCA 3V1HA 2BY2A 5LNSA 1QWGA 1F4HA 1SU5A 3DX5A 1KCKA 2PGWA 2ABBA 3C3NA 4CEXC 2OLSA 4O52A 2ZE0A 1Q4WA 3VMPA 3W71A 5FF3A 4S3BA 4AIUA 2NT1A 1EF2A 3W07A 1C90A 4Q22A 2QR6A 3C61A 4YMZA 4XO7A 3SR7A 1TELA 1IWPA 3W7QA 4QITA 2XFWA 4DRSA 3A24A 3V1PA 1MXSA 1IEXA 4K38A 5A2BA 1UKQA 1JYNA 4C6OA 3KVMA 1GWJA 3PANA 1YNQA 4MG4A 1T41A 2FDSA 3PWIA 3STPA 1RCQA 1TX2A 3UXLA 3I65A 1UR9A 1UH4A 1Z48A 1H7WA 1V3IA 2XZ7A 2X2YA 1YQ2A 4GLEA 3TDFA 4K37A 5G1YA 3PTQA 5T26A 2PE4A 4XBJA 4RE4A 1TSIA 4DM1A 2E28A 3ZJKA 1XLLA 3BZJA 1M9HA 3GDMA 3HN3A 3LCLA 4M51A 2QCNA 3TAKA 4GGBA 3UG3A 5G2HA 4YWSA 3STFA 4BA0A 3FK4A 1K6WA 1UZHA 2QDGA 2WMKA 2EGZA 3V16A 5IRPA 1A3XA 3LBMA 2QVHA 2R1KA 1X6NA 4O54A 4QE5A 2EHHA 4IMFA 4L56A 5E70A 3SCOA 3P6LA 4QX4A 2H3DA 4GH9A 4UFLA 5FCZA 2WZIA 4LF2A 1E8BA 2XWEA 3N14A 1Q7QA 3NXLA 3G1FA 2WSQA 3MDWA 3LV6A 3CIVA 3EXTA 1V4YA 4MYXA 3R11A 1JZ2A 4EPKA 3AIQA 1LDCA 4EAMA 1CENA 3S2LA 5JXQA 3MYOA 4HJWA 3LI0A 1DL3A 1Q6OA 2F6XA 2WCAA 2Z1WA 4LRSA 4PULA 6CGTA 3DGRA 4K8EA 3KL5A 3GS6A 4YYFA 3VIGA 1QNOA 4MZ1A 5HQMA 5HWJA 4ACYA 4AWEA 3C52A 3HQNA 4S3KA 3MCOA 1OK4A 2XH7A 1I2RA 1HL9A 2ZXDA 1PKNA 5EPDA 2ZVIA 3GFYA 3W2JA 2WWCA 5LNRA 4U2YA 3ABQA 3CUFA 4QG6A 3S6DA 1EXBA 3FKEA 4ZGYA 3RAOA 3ZT7A 7TAAA 1L6WA 3HG4A 4UTLA 3HGRA 1MUCA 2PCQA 4NI8A 2XTKA 2X40A 1U22A 1S1RA 2WMIA 3MW7A 2OSYA 1ZGDA 5GNYA 4BEQA 2SFPA 5HR6A 4TXEA 4Q4SA 3R89A 1JDFA 3W53A 4YJ5A 3SIZA 4LC6A 4JR5A 3C2YA 3PNUA 3PZMA 3PUOA 3GKAA 4HTYA 1HFBA 3IJ6A 3O63A 4JTTA 4E4UA 3C3UA 1KM3A 3WZ0E 1SSGA 2F61A 2J9ZA 1CXFA 3QTGA 3S2NA 5C9WA 4NY2A 3NNTA 2QCGA 1XC6A 1DE6A 1V6WA 5FACA 3ZYZA 4RJEA 3WDRA 2DW6A 5E6ZA 1ONXA 1EJ7L 1XPYA 1HGWA 5KEZA 4PUNA 1OFEA 3ENLA 3T05A 4MY8A 2V5OA 3SGGA 5HDRA 2BSLA 4IICA 3UNTA 3VGFA 2NV1A 3LTPA 2PDHA 1BG4A 1DOSA 1W8GA 1AFSA 4LYQA 2Y7EA 1NELA 4XD6A 2HPIA 3SM0A 1E9ZB 1NOFA 3CV6A 4A05A 4XAGA 4XQ6A 3SGUA 3R7MA 3PUGA 1Y0EA 1SVDA 1YE4A 3EOOA 4REQA 4Y96A 1PX4A 3ALGA 1C92A 3DC8A 3JUGA 3GUGA 1N8FA 1GNXA 4AW7A 4O1BA 2X1UA 1Q45A 1WQ5A 3FEMA 4CD6A 4OV4A 3MCMA 1VIZA 2DT3A 3WEOA 5LGZA 1SM9A 1AG1O 1YDOA 5I3GA 2Y88A 1NDVA 2XIJA 5RUBA 3BZGA 4ZSUA 4IGMA 3ZJ7A 4JD4A 1ITQA 3PZOA 1DIOA 4XZNX 4UIOA 5ABGA 3XINA 5BOOA 1RQEA 1E4NA 1WUEA 3B03A 5DRIA 4MJ2A 4RE3A 5IXEA 4NNBA 1J5SA 1FWFC 2YCLA 4XD3A 1SJCA 1E1FA 1SUXA 4MKVA 2CERA 4KFPA 4CD5A 5FJPA 1V08A 3BLFA 8A3HA 2R94A 1LT7A 3WF0A 3V5CA 3N6QA 1HN1A 3THUA 2Q6ZA 3VFCA 3AQUA 3AS3A 4IPJA 5FIPA 1WX0A 3NM1A 5LA0A 5G1TA 3NDOA 3G1SA 1ZBCA 4UTHA 1D3HA 4UNKA 1YYAA 3PVFA 1KCLA 5K9DA 2G96A 4JTSA 1IWAA 1A50A 1R3RA 1W3JA 2GVJA 3H2OA 3SCNA 2C79A 3WQWA 1GVQA 2VZSA 3TN5A 4DNHA 2R14A 3EWYA 3MUY1 2GVYA 4DBEA 4H6QA 5DMYA 4KT2A 1JD9A 2G3IA 2WV8A 3AXHA 1QT1A 3UFYA 1OZQA 1Q7ZA 3PSWA 1GTHA 1JDCA 4ZEPA 2QEZA 3R6IA 1OHLA 4JTGA 2ZX8A 2E5BA 3STCA 3DBPA 4L61A 3NJ3A 3FDGA 4EKJA 2P8BA 4IF2A 4EK7A 1FH7A 4A8NA 5GNZA 4KWWA 1W3HA 4BQ4A 4N6EA 3GC5A 2W63A 6TIMA 2VZOA 3SEPA 3TTQA 2EPKX 4PE8A 4JNYA 1MFVA 4J3TA 1P7TA 5AZ1A 4MB1A 1XQLA 3NM3A 1NTHA 3PPCA 3EEGA 3S4TA 2DIJA 1LLZA 4X61A 3R0DA 5IFTA 5I6SA 3SY5A 1HZYA 2YR1A 4ICMA 2DZTA 1YU0A 1KXVA 5FSDC 2BASA 1PL9A 4I8YA 3I6TA 4H9MA 2OZ0A 4EWJA 1M7OA 3OGRA 1O5QA 2XINA 3BAWA 3PB2A 3WNOA 2DQXA 2WZTA 1R46A 3AU2A 4R53A 1X6LA 1VF8A 4XTIA 3S0CA 4NP7A 1YU4A 3CPUA 1FFRA 4R9OA 2WM1A 5BWFA 4HNVA 4NQ1A 4HMDA 2BXVA 2PZNA 1A4MA 3LK6A 2CESA 4Z1AA 4JKLA 5HINA 4JIIX 3QHNA 1I6NA 5I00A 1GPFA 4FIQA 4YHGA 2J7DA 2C3ZA 1G7VA 3SUTA 4FR6A 2G3MA 4JHOA 3M0JA 4R27A 1GHRA 1S46A 4FB7A 5HNNA 2Z2UA 4GO8A 1OM0A 1RJPA 4HMEA 4RX0A 5A2CA 4DAFA 4PUEA 3T08A 3M7SA 3OQEA 1J10A 3GD6A 3LB0A 3PZ9A 4XVDA 2VRJA 1LG1A 2DZSA 2OYMA 4ZR8A 3TC3A 3VU2A 1VHCA 2POTA 4WOQA 1ZAHA 4HPXA 1XD1A 1EJSC 3EMZA 1OY0A 1W37A 3IIOA 1UZ1A 3DAQA 1XD0A 3NTYA 1ZNNA 3ABRA 2FPTA 1ISWA 1MQPA 4NF7A 1KFLA 2Y2GA 1ZFJA 1OC6A 4EAYA 2WZEA 4AY8A 4AZHA 4IFKA 1RK5A 3FHQA 2P10A 2D49A 4RPQA 3GAKA 1NP2A 4GD0A 3FJ6A 1H8PA 1EJVC 1RV8A 4POCA 2PZ0A 1UBSA 3TYAA 4HA0A 4J2MA 3BG9A 3AS1A 5FKYA 3G18A 1U33A 2RTSA 1T40A 1AD1A 4KCVA 3W7MA 1BVNP 2ACUA 4Z1CA 2PS2A 1TJRA 2INEA 4KW2A 1AK5A 2VDHA 2AKMA 4C6FA 3URBA 4ZE4A 2FZBA 4DF0A 5CGMA 4ZQPA 3K8MA 4RDYA 1BG9A 3S6OA 5EU9A 4BQ3A 4XD5A 1FWEC 4LY8A 4PB3A 2ZXBA 4JTAA 3IAPA 4FF7A 3TJ4A 3TOYA 4JEJA 1LBFA 4XISA 4MB3A 2PGRA 4NZFA 2C7FA 4PR4A 2QF7A 1ZSXA 3BPWA 2C1HA 4W86A 2A85A 5U4NA 1JVNA 2WPGA 5M5DA 1YMYA 1IV8A 4ZQOA 1XIHA 1IXNA 3F5KA 5M2FX 3H2EA 2G3JA 3BOLA 2UWXA 1RH9A 3VUPA 2E68A 4YHEA 1OB0A 3OGSA 4PB4A 1OVDA 5BU9A 4F8XA 1UH3A 5BXRA 2XSBA 1PYFA 1QO2A 3U0HA 3V4BA 2V2CA 3AXMA 4NAEB 3UG4A 1DYSA 3MJMA 1A5CA 1FVPA 3W1QA 4E2BA 1DWGM 3LZ3A 4DF1A 3E38A 1HKMA 2GGHA 1TV4A 1OFQA 4L4MA 1G1YA 1OX6A 2A6NA 2V63A 3I6RA 3PC0A 3QHMA 4PMRA 4HYVA 3M1ZA 2P8CA 4FAMA 3ABZA 1TPC1 1Z8AA 2WHMA 5AC8A 3KX6A 2EO7A 3ZS4A 1K4GA 4O17A 3G2GA 2IMRA 4K68A 1JPIA 1LP6A 4FNTA 5C0QA 2VR2A 3TWAA 3W26A 4N9CA 4JXCA 4E6MA 4GYKA 3GY1A 3WD1A 1RUSA 1S2UA 2CBJA 3LERA 4NJJA 1PDYA 3AMGA 1HGYA 2JIEA 4HCHA 1VRDA 2UBPC 1S2CA 4Z2LA 3IPWA 3QC0A 5BOEA 2CBVA 3APYA 2F84A 3KEHA 1TV3A 2EQDA 3G5EA 3TA6A 2XUCA 4Y90A 2P0IA 3AAMA 4XK2A 4Q7BA 3UZXA 2CYGA 3PG9A 1ONEA 1V77A 4PEKA 2V5DA 2A7NA 4MADA 1JNEA 4GY0A 3VCCA 4AEEA 1RD5A 2FB3A 1MZRA 4LAOA 4A8LA 1CYGA 2EJAA 4OBTA 3IJIA 1P7TB 1HF6A 1RXOB 4JL2A 1VD6A 2YW4A 3NVTA 3XISA 3PTMA 1GK8A 2WSYA 3HGSA 3O8AA 3PM6A 3H7UA 2BX7A 2YCIX 1EYWA 1FDYA 3TYEA 2GSJA 5TAOA 4TTGA 1GJPA 5AVHA 1HJVA 1M04A 3L66A 2FVKA 1EPVA 1MEHA 3K30A 1P43A 4JFVA 2AMXA 2WZHA 2R8WA 1P1XA 4HSNA 3F2BA 2E8YA 4WUIA 1Y65A 1EA9C 1FBAA 2VQTA 3N4AA 2QJIA 1TQJA 3BANA 4KCTA 4NZ4A 1TPFA 3WN6A 3U7VA 2NXHA 1GZJA 2VEPA 2YA1A 4TIMA 1JL8A 4MLRA 4LAZA 1GZGA 4JDBA 4J3SA 5C9XA 3WLQA 4LVGA 3NQEA 1H63A 3GNOA 1RCXB 4Y6GA 3E6EA 2H8XA 2J7EA 1LWJA 4S3DA 2XH0A 1H49A 2FPVA 2C1IA 1WXZA 2WMJA 4JTLA 1Z32X 4X2PA 3SRHA 4DJFD 1XIDA 3D47A 3MO4A 3W1NA 2BOFX 2NX9A 1E56A 3CMJA 3IACA 3VD5A 2J9XA 3SO7A 3UXDA 3R4IA 3QY6A 2E3ZA 3KUMA 1JZ4A 2X7WA 3SFKA 1WBJA 2DUXA 3AFBA 4PTWA 1W56A 3CV2A 3CL8A 4BEUA 1DWAM 3UQNA 3KM8A 3CO4A 3NR0A 4KH2A 1I2PA 2GVGA 3IUDA 3KS6A 2FTPA 3UWYA 1SZRA 3I10A 4BR1A 3BMWA 4FLRA 4XX6A 3RLVA 4IFKB 3PK7A 4GO9A 2QUUA 3HB9A 4IHCA 2YYUA 3RLUA 3I3DA 3UR2A 5B80A 3CHVA 2FHCA 2IKGA 2AQOA 2WNNA 4MWAD 4WIWA 3N1AA 3LZ5A 5HMFA 2Y85A 2YZRA 2FLIA 3CQHA 4HNUA 3OVQA 1H09A 1RP9A 4PBFA 3BQ6A 3RNDA 2PP3A 4QAWA 1S2TA 1VFUA 3CUZA 1JR1A 3UVIA 3TH6A 6ENLA 4RZBA 2OGJA 1ZRQA 3HURA 4DO4A 1OF6A 1UZDA 3B9AA 3HPFA 1L9WA 3VNLA 1L6SA 4LNYA 1JCLA 3NO1A 4W8AA 4IUOA 5I3FA 4R7JA 3TE9A 4PMOA 1LL4A 5EL1A 3BAIA 3FYOA 4G1NA 5GJMA 2DJXA 1JXJA 4HCLA 1HUVA 4CQ8A 1REQA 4NKCA 1JG9A 4W93A 3ITOA 4GUGA 3NIYA 3QV6A 2ONEA 2NLYA 3IGSA 3WNMA 3N17A 2PRHA 1JYVA 4KRUA 1DJIA 4UOJA 4KRTA 3OVPA 3QLDA 4QBXA 4QQUA 2EPHA 4BFAA 1E0TA 2A3EA 3QC3A 4US5D 3W70A 3M0ZA 3F4CA 2X0YA 1LUCA 4Z2IA 2Z00A 1W9UA 3S47A 3COTA 3BWWA 3GAYA 2PRMA 4JYDA 3IK2A 3B8IA 4Q8TA 2J47A 1OBAA 4NJIA 1Q6QA 4GQRA 3AROA 4J7RA 1UIOA 4Q8VA 1E5JA 1PSCA 3LCXA 4CN1A 2QDEA 1XV8A 1TA3B 2QJJA 1YBQB 3VOFA 4NAFA 1XIJA 2JGYA 3MA8A 1MDRA 3DHPA 2PTDA 1C7TA 3IVSA 3W9ZA 5HOSA 2BOGX 5CQ1A 2F2KA 4H8NA 3C0LA 3UF9A 4DI9A 1KBLA 2QT3A 4GJIA 4KETA 1KQZA 1US2A 5AZ0A 3BW3A 1S5NA 1W1B1 4UTTC 1FTXA 4IG2A 3NGFA 1B57A 3QBUA 1GZ1A 1EGVA 4IPLA 4QG9A 1TQXA 1M7PA 2YDRA 3UZYA 3UU0A 2ZADA 4TOQA 3M6DA 1FWWA 4MLJA 4LV4A 3CHCA 4US5A 3UA4A 5IBXA 3EX2A 1M03A 5D30A 5EMKA 4O0KA 1R5YA 1E4IA 2NXIA 3B8DA 1SO3A 3A64A 4Q8WA 1XIEA 2VOMA 3UESA 2DIEA 3W02A 8CGTA 4QCFA 1EJWC 3G3DA 5ABFA 4IJCA 5G2WA 3L7RA 4GC3A 1I9CB 3H8AA 3S2CA 1NEYA 1EP2A 4QXIA 1VRXA 4H41A 2IXUA 3ELFA 1EZ2A 4Z1DA 4ERAA 4O28A 2DU2A 4I9TA 3G6MA 4FXSA 3A3HA 3M0KA 2GLKA 4HYWA 2OSXA 3EDKA 3V0UA 3LCWA 3U9IA 2KAUC 2V0TA 3QQ0A 3SGZA 3OVRA 4F0SA 1GQJA 3FFSA 3PS7A 2QJGA 1F3WA 3GM8A 3DYMA 3S5OA 4TMCA 4IP4A 3U6WA 3C2FA 1NU5A 3AS2A 2W67A 3QGAC 3N12A 3H6OA 3N3TA 3T07A 1QK0A 4IM4A 3BCDA 3F4VA 8XIMA 1K9EA 3WMLA 3PPFA 6REQA 3OOQA 3ANVA 3Q4DA 1M1BA 4HHMA 3CYJA 3ZVHA 3LRMA 3FGCB 3RCMA 1EYEA 4YTTA 3A6OA 1HXJA 2FDMA 3B4YA 5FEXA 3OQ8A 5IDIA 3VTRA 4E4PA 5BRBA 3CWOX 3TOPA 5CLWA 4IWWA 1OCBA 1XCWA 5F7UA 1M68A 2Y62A 1GCYA 4BJHA 1SZFA 3TTOA 4H1ZA 3WLJA 1DORA 5D2VA 4QE4A 5CXPA 3W7NA 3W2KA 3R0UA 1QI5A 4FA3A 1G94A 3RX2A 1BXNA 5A8QA 2V81A 3BLEA 2P50A 1CBGA 2FZNA 3P5YA 4E5TA 1CI1A 1BXBA 4AD3A 1PAMA 3MU7A 4MSSA 1PPIA 2JF6A 1QNPA 4IFOA 4LYRA 4GIEA 3QH2A 2Y2IA 3TKFA 5BMXA 4YPJA 2GSEA 3FN9A 1VFLA 3M46A 4XO6A 2OTDA 4IBEA 4PTXA 5CBBA 3GXNA 2ZUWA 2PDKA 5AHLA 3SN1A 3TR9A 1E0XA 1TB3A 3KOXA 3IIVA 2Y7FA 1FXQA 3DYPA 3RCNA 3VOCA 1WDPA 3GVRA 4GX9A 4O18A 4CKQA 3POHA 3TCSA 2ACSA 3UWZA 2BOEX 4EF8A 4P7LA 4V2XA 1JXKA 3P84A 3A5FA 3BC9A 3O1NA 3BV7A 3I6EA 4IFRA 3WLIA 4GVFA 2VMFA 1PJ9A 1MW0A 1HNYA 2GUBA 1FH9A 1W5PA 1ODZA 5BOFA 1WZKA 2E9BA 4C90A 4O12A 5I3IA 4AEFA 3CV7A 3EOLA 4KCUA 2NSOA 2Z1XA 1VGAA 4QHRA 2GWNA 1PDCA 1I4NA 1REQB 2VC6A 4RZ6A 1TYGA 2VL4A 5D2XA 1CB2A 2VD9A 3VUSA 3UWEA 3V3WA 2HSAA 3NQBA 5BMWA 1R85A 1JZ7A 2RDTA 1WO2A 3NQ8A 1H62A 1LROA 5ABHA 2D2HA 3AIWA 3RMEA 3LCGA 4QCEA 1LUCB 2PTYA 1BAGA 3HIJA 1MYRA 1IT0A 2Z0IA 2GVLA 1ME9A 3VOIA 5I07A 2BXYA 1X7IA 2VVSA 3G1DA 4C60A 4FZIA 1AH4A 3WQ8A 1TX0A 5E0FA 3IJLA 2B7NA 4D6CA 4DWSD 4DYKA 4KGLA 1KFBA 3H7VA 2GWGA 3DG6A 4YCOA 3DFYA 3SURA 1NWTA 1X98A 3PF3A 3RMJA 5K4XA 3E9AA 1EZWA 1KFEA 4PTDA 2OKOA 3A4AA 4OECA 3KHDA 4C6DA 3URAA 1PWLA 4HOZA 1UH2A 2NQ9A 2XH4A 3O0FA 1F6YA 5CJMA 2IQDA 2WHJA 3W7GA 1T8XA 4P8WA 4IG2B 4ZMGA 4IT1A 3PP7A 4CNPA 1UD3A 3F4DA 2CLKA 2HE8A 5I3DA 1ZCOA 4WSJA 4HNLA 4JPGA 4N9DA 1V6UA 4GNKB 1JULA 4GUJA 1UZ4A 2G4FA 5CSSA 3GZAA 4GH3A 4O14A 4WY0A 2G0WA 3S9ZA 3IAQA 1B90A 2V5CA 3GTNA 4LRTA 4LW7A 3MYPA 3RX3A 3BDKA 1KXQA 1V93A 5H8UA 1F6PA 4GXWA 2EAWA 5XIAA 3UYCA 3WQCA 1FCUA 3LLXA 2MANA 4LEQA 4ZXOA 1XKJA 4L9XA 4UFMA 2Y2PA 3SUWA 2JE5A 2VC9A 2O4MA 1KQYA 4RZ4A 2ISSA 4U10A 1R9XA 4DXKA 2REQA 3GR8A 4R88A 2GK1A 1PTGA 4LG2A 1L8PA 4AD4A 2ZX5A 1XCFA 4FSAA 3FIGA 1HKWA 1AODA 5DLCA 4QP0A 3SY8A 1B3YA 3TJIA 1QPKA 3L4UA 3MQLA 2D3LA 4IPPA 2OEKA 4NZ1A 2Z2BA 3KE0A 1JDEA 3MKVA 3P67A 4HJFA 3WUBA 4ACZA 1BTCA 1IZKA 4UTWA 1ECQA 3GIPA 2D3NA 3NSNA 2QQ6A 1TV7A 2OPJA 1FWRA 1M41A 2FHFA 3TWBA 1SFJA 2WQDA 4GG9A 2JEPA 2E8ZA 1QPQA 1OT2A 1EXPA 2CFFA 3A3XA 1OYCA 4GQQA 4LC8A 1H7NA 2F6KA 1BWLA 1WP6A 1U5HA 5K4ZA 3LPFA 2BMBA 2WOQA 3P5ZA 2EKCA 4RUBA 2NQJA 6REQB 2ATSA 3VIHA 4GUIA 1RQHA 3L2LA 1JPHA 3ZVHB 4BI7A 2ZICA 1XLIA 3VKCA 4XAPA 3K1GA 3S8HA 4S3AA 1A5BA 1XISA 5IHSA 3H22A 3NO5A 4GZEA 3KAOA 2GQ8A 2BVDA 1UKPA 4AMCA 4DO7A 5LNUA 4BI6A 4K7YA 3GVGA 4KWVA 1UBPC 2VEMA 4F0LA 1IR2A 3M0HA 3HV8A 3DHUA 2PDUA 5DBUA 3FSTA 4PUWA 1GG0A 7ODCA 4UTFA 2P0OA 4NG3A 4JKMA 4NRSA 3UP8A 3AU6A 1TIMA 4YNGA 4MJMA 3L68A 3IIXA 3WNKA 2X0HA 4FMVA 3CAWA 3R0KA 4X0VA 3DIPA 3P3BA 1OD0A 1WPCA 3DFPA 3S5SA 4B5NA 5AYYA 4A2RA 5G4EA 1LG2A 3EPNA 4AZCA 3VMOA 3U2EA 3A12A 5F2LA 1X6UA 4UTIA 4LUTA 4DYEA 2Z4GA 4N9EA 3L26A 2FGLA 2QAPA 4DXXA 2WZMA 3VNYA 2OOFA 2IPGA 3G1XA 3VE7A 1P0DA 1X1NA 1BKSA 2EG6A 2CHOA 4IGNA 1OFPA 3HPAA 4CU8A 3B8WA 4M6VA 1TTIA 5D9PA 7TIMA 3WQVA 1WOBA 1CGYA 4JCLA 3B9EA 1F3EA 4WKAA 3PUDA 3QR3A 1TJPA 2XD1A 3CNYA 3DU0A 2XYLA 3FA4A 1EDQA 8RUCA 3N19B 2DVUA 5JQ9A 3GVWA 4H6KA 4B5WA 3LTSA 3UJFA 4PSRA 4GIYA 3ZO9A 3MVTA 3UXKA 4DLMA 1BYDA 4UFHA 3HU7A 3GBDA 2DW7A 1Z9AA 3ZXWA 2X8RA 2HTMA 4XZBA 3VNJA 1YU2A 2Y4SA 3KOWA 3EDDA 1I45A 4ERGA 1JGIA 4JTKA 3EWDA 4YIWA 1OFBA 3B0VC 3WJWA 1YEYA 2ZYFA 1JF5A 2PC8A 2VRQA 1TMLA 1KB3A 3CIXA 5G4HC 4EXBA 5DT7A 5BYWA 4AZBA 4FI4A 1LYXA 3E0FA 1LZOA 1W3TA 1OC7A 3T42A 1Q6GA 5D9NA 3W25A 1K9FA 1PIIA 4PSPA 1SJAA 4PCNA 3ZQ9A 4IIGA 3GNPA 4PRTA 2PDMA 2Q71A 1OF8A 1F5ZA 5EBUA 3WH8A 1IXPA 1B9ZA 2GGJA 1Q6LA 3MY9A 5I79A 3SUSA 1QATA 3B0YA 3N9RA 1AL8A 3HPXA 4WK9A 5FESA 3VXGA 3AYTA 3RJXA 4LFYA 3UD6A 1LRNA 3GK0A 3K1DA 1SJBA 1WB0A 3BUVA 2CLHA 3CZJA 3AMCA 4YTQA 4Z42C 4Q4MA 2RJHA 3MO7A 3DOPA 2F8QA 3UJSA 1U5JA 1HJUA 2HE5A 2XD5A 4GYFA 3TC7A 3NL6A 3MBDA 3M64A 2JE8A 3QGKC 3NQDA 1RBLA 1XYAA 3CUGA 1CIUA 1ICSA 4QRNA 3G1RA 3RYSA 3H7RA 5FJUA 1XBZA 5C5YA 4F2UA 4F0HA 5AHNA 1E6NA 1ZBKA 4LX4A 4R7OA 1ZAIA 1UWRA 3QY7A 3TIMA 4I9JA 2DEPA 1ZJHA 3L4ZA 2VX4A 4WY0B 5D9MA 3T2QA 3VM7A 2DH2A 4FX8A 4C7DA 2GJRA 1IIHA 2IPJA 2E4TA 2UWFA 2WC4A 3MHUA 3OYZA 2W61A 1AW2A 3HFYA 4C6KA 4OIFA 4W7VA 4DAIA 4YTSA 2REQB 2WNQA 4EXAA 1NF0A 2GK1B 2JALA 1VFHA 1Z89A 1LF1A 3LHZA 1XH0A 3I7QA 5HMEA 3VVGA 1ICQA 5CCZA 1UYQA 4ORIA 3ZLGA 2XFFA 1QO5A 2OEMA 1RLCL 3E02A 3VA8A 4NVTA 1WDSA 5EMYA 4ACZB 3CT2A 1KCZA 5C70A 5CH9A 1TMHA 4HP5A 3PBWA 3WY1A 4I5RA 3QW3A 1UASA 1UOKA 3LS9A 3AMLA 1H4PA 3QSRA 4GX8A 4J9JA 1FWAC 3N6HA 1QOPA 1XRVA 2XZ9A 1NAL1 3P61A 2C0AA 2VCBA 3IV8A 2J7CA 1MSSA 4IIDA 2G3FA 1V6VA 2GZXA 1KR0A 1CLVA 1ZJIA 1GQIA 1QBAA 2DORA 3U8GA 4AVNA 1XH1A 4DBUA 4HBKA 1L6GA 1UKOA 4ZFMA 4GUFA 3PJXA 4P8UA 2NSXA 2TAAA 3RRXA 4IJEA 2DZBA 5D03A 4UFIA 4A2SA 3SY1A 3EBVA 1IGSA 2VFIA 3G3MA 4HA4A 4GE8A 1P48A 3VC6A 4GIRA 2V5KA 1XKYA 2W27A 3ES7A 1WV2A 3BTNA 1GKQA 4Q3MA 3WSUA 3KWXA 3WK3A 3F2CA 5GJNA 3BLIA 1DHKA 3CAQA 3WUFA 5FSEC 4GHLA 2HXTA 3E2QA 4MKSA 2C0HA 1GOIA 1H11A 4GHRA 4C6EA 4GFIA 3QZ6A 1GVRA 4EVZA 9RUBA 4DVOA 4F66A 1FX6A 4AZCB 2HV5A 2XN1A 1PCWA 5HUOA 4LUTB 4JDYA 4R85A 2WW5A 3C8FA 1XLJA 5A6AA 3LLFA 3NQ7A 3SCUA 4RV3A 2WANA 4AD5A 1QOXA 4PUUA 4URIA 1LWHA 4GWEA 1G6CA 3SCVA 1TIWA 4A6GA 1BWVA 2J7FA 4NXSA 1R38A 4ZB5A 1BYBA 3A9IA 4B5TA 4MUPA 5D32A 2HVOA 5AYXA 1PWMA 2EF9A 1O12A 7PTDA 3LQGA 4Q4QA 4WKFA 1QO6A 4I5UA 4GC4A 2YYTA 4RV8A 2FKPA 3R58A 5E9XA 1V3MA 3CMFA 1QUMA 1H2JA 3WMBA 2VDGA 4U33A 3H4GA 3FJ4A 2HBXA 3AICA 3TW7A 3DKLA 3W1LA 4H6EA 1Q6RA 2C13A 4L5ZA 2FTYA 4QEEA 4E2DA 1CXHA 3KL0A 3VNZA 3ARWA 2G4JA 3QMRA 1UUOA 1LWIA 4JTDA 1E15A 2ZUSA 5EMLA 4MB5A 3GXIA 1VYRA 3G22A 4RW5A 5U7SA 1W3IA 1MDLA 1F6KA 1C91A 2E09A 4OE7A 1QI4A 3EWUA 3OIHA 4AD0A 5A6BD 5KZEA 4M6QA 3VGGA 4Z2HA 2HVNA 2J75A 2CXGA 4AX6A 2VCCA 3HMCA 3HFTA 3UZWA 3DYOA 3I68A 1TPB1 1W1A1 1XGDA 3LRKA 2QCMA 2OB3A 2E5CA 1B3ZA 3DC0A 1JGMA 4KEMA 3KCOA 1IT7A 1O68A 3H21A 3NG3A 4H9ZA 1SMAA 2VWTA 3GX9A 4M3PA 3M7PA 3OBKA 1F7BA 1TR9A 4FNSA 1QHOA 2HNEA 3RX4A 2Y7DA 1FY6A 4H8UA 1UC5A 5H6HA 1AMYA 1XG3A 5C6MA 1K1DA 3TSDA 4K7VA 1QI2A 4UTMA 4ILSA 1PVNA 1RLDA 2ISVA 3ARRA 3R2GA 3VGDA 2Y6ZA 1WE5A 2OXNA 4XSLA 1S5VA 1HKJA 3TSMA 3H53A 1MVYA 3OBAA 2JK2A 3KWSA 2O9TA 3H70A 1R2RA 3N9SA 4ZXLA 5F2IA 4KIRA 3WF4A 1QMLA 5C54A 4MDPA 3SDOA 4PRRA 3S1VA 4CNSA 1PDZA 3P0WA 1J4EA 2YBVA 1RVKA 1R0MA 4MIMA 2C15A 1TV8A 3WLNA 2GGGA 4QAIA 3GHSA 4MNJA 2RFGA 4B9ZA 2WO5A 2ODOA 5F2MA 1IT8A 5C2XA 3BICA 1GW9A 2I1OA 4LEFA 3W84A 3RCYA 3ZR4A 2BY0A 4LSBA 1TJ0A 1AL7A 5EKYA 3DENA 3WIJA 2UY4A 1BQGA 4RDZA 4IL0A 3T2PA 1NSJA 2CWXA 2Q8XA 4WDTA 1E72M 1WZLA 4D8AA 3POCA 1K6AA 3ONBA 3U2CA 3E96A 2V6AA 4Z1YA 3K8LA 2XN0A 5J5DA 2WSRA 1OADA 1YTDA 2Y8VA 3GC4A 1F61A 3OLEA 4S23A 1W17A 1IEIA 3VX0A 2Y2NA 3E2RA 3VKKA 3JRKA 1CGWA 2V3GA 2CLOA 2VQUA 5AC5A 4MOZA 2XM1A 2W92A 3PB0A 3VABA 1MW1A 3E0WA 5HA7A 1XBVA 2Q3RA 5DMLA 3HG2A 3OHIA 3SCPA 4Z2KA 3DI0A 1EX1A 2W3ZA 1LORA 1Q8JA 2QVNA 4JFUA 2ABAA 3GC2A 2XIQA 2XIIA 3EDEA 2EKGA 3CUXA 3AJ7A 3MP5A 4OOUA 4C6NA 1XLEA 3UPBA 1B4EA 2DZUA 2ZA3A 5F1VA 1KV5A 5JBEA 4A35A 2DVTA 1UD4A 2UY3A 3EDFA 1T6MA 4RNFA 4US6A 3QM3A 4OWGA 2GJLA 3HTWA 3W75A 3CHDA 2CLMA 1DWJM 5KETA 1KXHA 4XVEA 3WEMA 1SFLA 3FJNA 4X60A 5A69A 2ZA2A 3VD4A 1EC8A 1A5NC 4V33A 5KSWA 5AHEA 2GDQA 3ARTA 2R24A 1E55A 3PJTA 1ZL1A 1TZZA 2XM2A 2Y2LA 2C19A 3OW1A 4PMJA 1GOWA 2CHNA 1E3XA 3CB3A 1M53A 1QNVA 4OBSA 3T0TA 1HKKA 3FEQA 3H4WA 3IK4A 3CWHA 1I2OA 1D7FA 5CZ0A 1K03A 4WXYA 3VGHA 1FWHC 4MJ4A 3W2MA 1NFPA 4R34A 4JICA 1R87A 4XB3A 3GXMA 3C2OA 4KWUA 5K7JA 2PBGA 4O16A 4HU8A 1GW1A 5HNUA 4TVUA 2W5FA 5LIWX 2YXOA 1Q4NX 2QF8A 3L0NA 4UR9A 4HHHA 1CCWB 4JTEA 5BPVA 2I7GA 1V6XA 2GUYA 3MHGA 4OGZA 2OO0A 4AU0A 3N15A 3MSYA 5SWUA 7A3HA 1LOLA 5LHFA 4ZTXA 4INFA 1GTEA 4LPCA 5K9XA 5ABTA 3W74A 1A5UA 4XBSA 3A23A 1SW3A 1E6PA 2WHLA 2D2GA 4UTUA 1UP2A 1WUFA 3N04A 4IH3A 1HP5A 3APGA 1RQBA 5LHEA 2ZXQA 4TV6A 2ZUTA 1DIDA 5DELA 5EMUA 2E1WA 2V68A 1AQ0A 4MUZA 2RDUA 3VIFA 1AMKA 5I77A 2V69A 4CEUC 3THQA 4CVUA 3XIMA 4P5UA 4YTUA 1S5TA 4NZ5A 1R9ZA 2F7FA 2PMQA 4AH7A 1D8CA 1TTPA 1O1ZA 3Q37A 3SCQA 1CGUA 1XINA 1EHAA 3O6AA 4K1GA 3AIRA 4OUEA 3KBNA 4DWDA 3GWQA 1QNRA 2XDFA 2IQTA 1RVGA 4HNNA 3REQA 4LWWA 4IQLA 4DHGA 3G1AA 4B3ZA 2YZ5A 4Y9AA 3CUIA 4I9AA 3HJEA 2BGNE 1A5MC 1UPMB 4P8XA 3O6YX 3TW6A 1DXFA 1GQNA 2VP8A 4L1GA 3QLLA 4DJDC 4I5XA 1Y5VA 5CBIA 3HQPA 2ZX7A 3GZ3A 1Y8BA 4M7TA 1XDLA 1LBMA 5LNWA 1HX0A 4GXPA 3M0LA 3IUHA 5JU6A 4S3CA 3BAKA 2PF8A 3KBSA 1LLWA 3JZUA 4Q4KA 5GQBA 2QUNA 1XS2A 4W7WA 1EUAA 3MV01 4DJED 4M5PA 4BHYA 1ITUA 1F4AA 2F2HA 1BPLB 3ZJ8A 5D02A 1W9XA 1OEPA 2X0SA 2WJFA 3AS0A 4S2BA 4DUXA 2ALDA 3I7SA 1VFTA 3NZQA 1KRMA 5HPOA 3W1MA 1VBJA 4JFTA 4WXZA 2PSNA 2PFHA 3TEVA 3WD0A 1G69A 2VX7A 5JBFA 1BFNA 1VLIA 1WDDA 4MMWA 2CIPA 3GH5A 1OWQA 4CN6A 1HJQA 3L0GA 4JTJA 3L5MA 3AZTA 3TMLA 4S3EA 4Q8NA 5FAGA 4CCEA 1TRIA 3ZWTA 1KKRA 3PFMA 3WBXA 1J96A 1WKYA 4F2BA 1CB7B 4QSHA 1YPIA 2BP1A 4GI4A 3SCTA 4JEQA 3T8LA 1E6QM 5A8PA 3LENA 3B06A 1H7RA 3W27A 3SN4A 4DPQA 4Y9NA 3L4XA 1V3KA 4WF7A 1YTEA 4GRSA 4DWSC 4PC8A 3MP4A 2PWEA 4IBGA 2OX1A 3GTIA 3H2NA 2UY2A 5EBAA 2ESCA 3GNDA 1XLMA 4H04A 2PD5A 1LRTA 2R1NA 4NXKA 3E12A 2WKLA 1EC7A 4AD1A 3AYSA 2TYSA 5I02A 3WKZA 2PWVA 3ZM8A 3N29A 5HMSA 3H24A 2WSKA 3L4TA 1J11A 3OEXA 3VDBA 1CWYA 1ITXA 3FAXA 3QW4B 1P6WA 1UW9A 1G67A 5C8BB 4H8VA 4HIBA 1NARA 1TVNA 5DCDA 1GJUA 2JQXA 3ARUA 3W83A 1PZ3A 2J62A 3UZJA 2YB4A 3FKKA 1BF2A 2LLEA 2ASHA 1QPNA 1RHCA 2A0NA 3MZ2A 3NEVA 1O66A 3UGVA 3EEZA 4ORMA 4IBCA 2B4GA 3MMTA 3PTDA 2I56A 4PYSA 4U2ZA 5TNVA 4HD5A 5ECVA 3KZSA 3MI3A 4MVAA 2V2HA 4Z2GA 1SO6A 3ZVIA 2TMDA 1YDNA 3CZEA 2GL5A 3UJEA 3GHRA 5B7ZA 4Q32A 4V28A 4IOTA 5CC6A 3LDVA 5A1AA 3WO8A 1RA5A 1FKXA 3B8SA 4RR4A 3TXVA 3N2XA 1NH6A 3I3BA 3N6JA 1W1ZA 4TU1A 4U3CA 4TQTA 1Q6CA 1V02E 3NDYA 3CBWA 3P81A 1BGAA 4E8DA 3OPSA 1K7FA 3B8UA 4G7FA 2QULA 3BGAA 3TJLA 3EX3A 5D05A 2A7PA 4W7UA 1R47A 4EP8C 3QPYA 1JPMA 2DUZA 3OHMB 1EDGA 4JX5A 5K3VA 1LBLA 4ATWA 5C7VA 2VFFA 1W9PA 1UB3A 5AC4A 1HKIA 3E49A 4MZ8A 1LOSA 1HO1A 4ATDA 4Y8EA 1QHPA 2BZNA 4NJKA 4UTTA 3EAUA 4WVXA 3NAVA 3RLGA 3F5LA 4ENLA 3PBYA 4HMNA 5H2ZA 1UROA 4AVFA 3H54A 4F48A 4PN2A 2GJXA 4R33A 4EANA 1X1ZA 4Q4OA 4YU1A 2V9DA 4UMAA 2ZBTA 3TLQA 4CD7A 3LBOA 3IIPA 3UW6A 4YTRA 2QHAA 3KFTA 3PJUA 4C6QA 2ZX6A 1ODUA 3IJ9A 4XBKA 1B9BA 3MZNA 4KBXA 4A8IA 2H90A 2R1PA 4WHBA 5A6SA 3S1GA 2I14A 4EPEC 4UWMA 4ZQNA 3N3MA 2J13A 1E43A 4UR7A 2J7HA 3H12A 3ORWA 3W7PA 3ATYA 5CKSA 5FD0A 2W66A 2E9MA 3DH7A 4Y8FA 3E0IA 3KBJA 3WLSA 1G0CA 1WAUA 2KZHA 1SPQA 1EPXA 1OX4B 5CLTA 4NRRA 3CIWA 1H60A 4L65A 4DELA 1AW5A 1A53A 4D1IA 3PR2A 1XLCA 4HPGA 4A3YA 3H2CA 2PDNA 4UMBA 2VELA 2DQWA 1AJ0A 3P80A 2E0PA 4DX3A 3UG5A 3MTWA 1ISZA 2IS7A 2E1DA 1XYZA 4NASA 2OJPA 4KQNA 4B2DD 3NL3A 3ANYA 4A3UA 2D24A 2EXOA 3VNIA 1J0JA 1Q6DA 2CCRA 2CLEA 2YSWA 3U4AA 5IFPA 4XZWA 2BVWA 2VDIA 3IJQA 1OCNA 4WRHA 3GDRA 4MFDA 3G1VA 3L27A 4LT9A 1JCYA 4G56A 3FJLA 4D2JA 2BG1A 4U31A 1KGXA 3N2TA 1B3OA 4LANA 5D2WA 4YN5A 5DCBA 2ZZ7A 4MNMA 5D8ZA 1KS0A 1OINA 3LV5A 3GW0A 1PS9A 4QNWA 3DHFA 1P1MA 2FFIA 3QR0A 3F2DA 1Q65A 3WDHA 1AVAA 3H26A 1MI3A 3ITCA 4FIRA 2BXZA 1L2UA 3E5PA 1JRBA 3KP0A 2YFOA 5A8OA 3HZ3A 2G3NA 1V02A 2I9UA 4KEZA 1H3GA 1YRRA 1WKFA 3SADA 3QKEA 2Z1SA 3IWPA 1B30A 4GHAA 3FLUA 4DEFA 1K8YA 3FYYA 3NVDA 4LU0A 3ONCA 2QV4A 2DZWA 4CD4A 2VO5A 2Z28A 1JCJA 3ES8A 1XLGA 3E3HA 4C1NA 3CAVA 3ITLA 1AH3A 3K46A 1NVMA 5BWAA 5TD4A 5EA9A 3VZZA 1QR7A 4QNEA 3TNBA 3T0AA 1ONRA 4LBUA 1UD2A 1TTQA 5F4SA 2AQWA 3VE9A 5BZAA 1OFOA 3LMZA 4JQ2A 4JIRA 1QU4A 2CETA 3LG3A 1ZP3A 3NXFA 1UUMA 4FEZA 3VD3A 1Z3NA 3R13A 3WF3A 3LGGA 5LXXA 1TPVA 2H3BA 3LSCA 3AALA 4Q8OA 4UNLA 5LZLA 4TVCA 3EPOA 4AY7A 2O0TA 3SSJA 3FXGA 3MUIA 1Y7VA 1TWDA 3WL0A 3TQVA 2YL5A 3ZZ1A 3RUBL 1GPWA 4BWLA 2NUXA 3VOGA 4EACA 4O15A 3W2NA 2G95A 2J88A 1V6YA 2QLYA 4D8LA 3NOYA 4EIVA 1H5YA 3PZQA 5DBTA 1QXLA 3MMDA 4F0RA 3BH4A 1XYMA 3JZEA 3M0YA 4Z08A 1OYBA 3T6CA 4FXRA 3PBGA 2PWUA 1FHVA 4AZGA 2D22A 1UA7A 2FGZA 2YDSA 3CHEA 3R10A 1SMDA 2G37A 2PTWA 1HT6A 1XC4A 3QHOA 1H7XA 1R3TA 2GYIA 1XGEA 4GYPA 2P3EA 2AAMA 2VC7A 3TTSA 4LH8A 1AH0A 3SQSA 4GIAA 4AWSA 1IR1A 3RU8X 1V6TA 4DF2A 4H6RA 2B7QA 3EXSA 4FX6M 4NJHA 4AMAA 5I3HA 3AMKA 2ZKMX 3LRLA 1E9IA 3BGGA 1VFSA 4W8LA 5D38A 3EWXA 3V7PA 3WUGA 2YBTA 1JCMP 3RM4A 3EB3A 4DXVA 4ZOEA 3W81A 2Q02A 3VD7A 3II1A 1HL2A 4QDWA 2C8NA 4X22A 5DMMA 4YYCA 3BMVA 1XIBA 3HJZA 1A0EA 2DPEA 2GJXB 3TQPA 1YKWA 3SRFA 5F2GA 3GLCA 3E2VA 1K4HA 2QXWA 5DY3A 1UQZA 4C6BA 3WNLA 4PMXA 3V0TA 1ZTVA 3LHUA 3MB9A 1B4KA 3W7EA 3AHZA 1K9TA 5GJPA 3VKBA 4J2PA 3NPVA 3M43A 1XFCA 4J3UA 1WBHA 4L4OA 2PTZA 3CWNA 4XKYA 4YVXA 2I16A 3LGEA 4LVAA 6TAAA 3P0XA 2AMGA 3AIEA 3RF9A 3I3EA 3MSDA 2DZXA 4QJ4B 3QR1A 3W7LA 3BGJA 4HOWA 1XI3A 4OBRA 4W4QA 4QJ5B 4UMCA 2IW0A 4PBEA 3ZT6A 3W85A 3SECA 3PHAA 2FB2A 1XYCA 2WB5A 2FMNA 4W89A 1DQUA 4AWUA 1R8LA 4ZQMA 1W5NA 2PP1A 1K7XA 4TTUA 3UBPC 4QNLA 2XISA 4HT3A 3CK5A 4W84A 1GVSA 4PUKA 3N2MA 1B3WA 1VP5A 3A9BA 4OJYA 3IARA 3IGXA 1LL7A 3S6TA 3WMCA 3UVAA 3VKAA 5A94A 1JI1A 4QTGA 3U5YA 3TN3A 2VENA 1J6PA 1CK7A 2XSXA 3S83A 4AY1A 3N3FA 3W6MA 3GSMA 1K8ZA 4C6LA 1Z7AA 1JQVA 1MO0A 1XCXA 1B3XA 3PSVA 5M3WA 4YWIA 1RALA 5BCAA 2NUYA 4BCEA 4GOAA 1QWKA 1W1IE 3LQLA 1FWBC 2NWSA 4DBDA 1UR4A 3GH7A 3PPGA 3TQKA 3W7OA 3BXWA 4OJOA 2YIHA 1ICPA 2B7OA 2A3CA 4NL1A 1J01A 4XD4A 3TX9A 1ADDA 1Z41A 4HVXA 3HV9A 2PDLA 1ME7A 3BG5A 3IRSA 3RRAA 1H1YA 3WCZA 1VQTA 3CB8A 2QPSA 2PI6A 4QIUA 5FEPA 4K6AA 3KXQA 3H2FA 1L6FA 1X97A 1VCVA 1PIGA 1W9DM 2O9PA 4O8AA 3MJYA 1VB9A 1YNYA 3NUKA 1WAWA 5LSMA 1ELSA 2ZZ1A 4LYPA 4DZIA 4XZHA 3FS2A 1RBOB 4EWND 4JTHA 2VYOA 4N02A 2QCLA 3M41A 3RGTA 3ZJ6A 1FWSA 3R79A 2PB1A 2G41A 1EGZA 1PB0A 5EFDA 1D9EA 4NU7A 3WLHA 3TFXA 3WUEA 1O1HA 3LEPA 3EZ4A 4PUMA 2E25A 2NQLA 4KFNA 2JEQA 1BRLA 2WMIB 3M7WA 5D09A 2FYMA 3BAJA 2J79A 2FTWA 3WX7A 4BKNA 4UNIA 1OCQA 1MRAA 4IBIA 4WGXA 3MC5A 5EGRA 3TJXA 3AJXA 4F3HA 1DJHA 1RY8A 3EX6A 2OQHA 3DG7A 3T9PA 3WQPA 2DVXA 1JZ3A 1JCNA 3AO0A 3GU9A 5JIPA 5CEWA 1ISYA 1GYNA 1A3WA 3IUIA 2I5GA 1W31A 1O94A 1XRSA 1EQPA 1CXEA 4IQJA 1VH7A 5G1MA 2PDIA 4XG1A 4RNIA 1GQKA 5IM51 3KVJA 1K02A 4RE0A 5FJIA 2XVKA 1UD6A 4H9TA 3ARQA 5IDZA 1FCBA 4C91A 4E4FA 1OGSA 1U83A 2RH9A 3DEQA 1F9CA 4Q8PA 3W28A 5I2UA 4GMEA 4JFWA 1LCOA 1EOKA 4DO6A 2WVUA 2V5JA 2PP0A 3EMQA 4TX9A 1MQQA 1QRQA 1EEPA 1EAKA 1R3QA 1R86A 2X42A 3CQ0A 4G5DA 3L2IA 2XG9A 1E0VA 5CAHA 3BARA 2GJPA 3KVKA 4QLKA 4REQB 2GFTA 4J5NA 4JY8A 1MW2A 2R9RA 3UZ5A 1M3UA 2QJMA 1XLDA 4MY9A 4XIAA 3NSMA 3TZFA 2DSKA 1E0WA 1W2VA 2WK2A 4GZIA 1ZALA 4PL1A 1GXDA 3AZRA 3DCPA 3E0VA 4H7CA 4UFKA 4LOCA 1TJ2A 4CNTA 2ZRZA 4N42A 4ZB2A 4L64A 2XVLA 4KCWA 1NOUA 3WH5A 1F8IA 4NIRA 4RXGA 1HG3A 1Q63A 1W91A 2WM0A 5F1UA 3WQFA 3NPWA 2DZVA 5CGQA 4PUDA 3O0KA 3CQKA 2OWXA 2YCLB 4AUBA 4MJZA 3BLLA 3LI1A 2ZFAA 1UA3A 2WBKA 2HROA 4AIBA 3N2CA 1PBGA 7REQA 5KZ6A 4ECLA 5AHIA 2WCSA 2C71A 3GRIA 1AJZA 3V35A 3NSXA 2J27A 2XSAA 2X09A 5H91A 1E4MM 2A4AA 4XKYB 3NZRA 2NT0A 4L4LA 4Q8MA 3UR5A 5CG0A 1KXTA 4WJ8A 4DUVA 1V3LA 1MXGA 1QPOA 4FHAA 4Q6JA 3W76A 4C1LA 3L4WA 2VFGA 1EJRC 5BXTA 1KLYA 4V15A 1SO5A 3CJPA 4ZQCA 2ZA1A 1DE5A 1ZENA 3C2RA 3PZUA 1OFRA 1JPKA 4JIEA 3HOJA 3ID7A 3ZWSA 3GFZA 4P7NA 3PUEA 1CECA 5A6KA 2F6UA 3WLRA 2HNHA 3AXXA 3GR7A 1DXEA 5L6UA 1EKOA 3OG2A 1FHDA 4JOMA 3RPDA 4A4AA 1Q13A 1TG7A 3W7KA 3GDBA 2RGLA 1QASA 2HS8A 1LQ2A 3TVAA 4RNHA 3VKJA 3HQOA 3B40A 2CC0A 4NYYA 1HW6A 3ZR6A 3KRZA 1Z6KA 1PTAA 3HG5A 1UWIA 3UYIA 1H1NA 3OGVA 2QMJA 3P93A 1VYSX 2DV0A 4FS9A 4BK9A 4O13A 3WFAA 3AYVA 1E6SM 2Y5SA 2Z26A 4DB7A 3WDQA 4MWAE 4FLSA 2DIKA 3GDLA 3GG0A 3TMQA 1POKA 1L6YA 4OT7A 5REQA 2AL1A 2RUSA 4O0ZA 3WBWA 1ZCCA 1SR9A 5IOBA 1OZMA 5XINA 4UQEA 4HNTA 2BFGA 4WDXA 1WNOA 1S3TC 2V38A 4Z1BA 1KTCA 5FJJA 1V7YA 4UFJA 3ZSSA 1JD7A 3N4FA 3NQVA 4LV9A 2FH6A 3ABXA 3EXRA 1G7UA 3ALFA 3IV3A 1HIZA 7XIMA 4HHLA 1WZAA 1S5WA 2VI0A 4IX0A 1VEOA 4AD2A 4K8GA 4AHQA 3D0CA 4M1RA 3QGVA 1JZ6A 1FWTA 1B0IA 4FXJA 3CV1A 3KCLA 1UKTA 3HPZA 3EOSA 3IIZA 4NSBA 2Z1KA 2AQVA 2O56A 4Q4PA 1BRLB 2O7SA 2YXXA 2ZRYA 1BD0A 2FGBA 2OQLA 1NQKA 2PPGA 4PCSA 3W88A 1KM2A 1GVYA 1FWCC 1PCKA 1N7KA 1A5KC 4UC5A 4PGLA 4QJ3B 4ZOCA 5C7HA 1GOMA 4GNVA 1R7AA 3BV4A 4NZJA 1FCVA 1LJYA 4KEVA 1CW2A 1TPH1 2BVYA 5E0KA 3KDNA 4N9BA 3O15A 5LKYA 1EJXC 2QUVA 4YVVA 2NQ5A 4IMEA 4ADTA 1W1YA 4IMCA 1H61A 5C9ZA 1EA0A 2L5HA 1W2PA 5ABEA 4DJEC 3RM9A 2VOTA 1B31A 2VZUA 3QMTA 5GVJA 4GY7A 1JAEA 2GQ3A 4UTWC 4B16A 2PDGA 5C9UA 2Y24A 1FUYA 3LNPA 1V0KA 1TJ1A