4HMCA

Crystal structure of cold-adapted chitinase from moritella marina
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
528
structure length
528
Chain Sequence
GTITSQDDNVVVGYWHNWCDGRGYQGGNAPCVELKTVNPQYNVVNISFMKVYDIAEGRIPTFKLDPTIALSEAEFIAQIDTLNSQGRSVLIALGGADAHIELTRGDEDALAAEIIRLTDLYGFDGLDIDLEQAAITAKDNQFVIPAALKMVKEHYRKTGDNFMITMAPEFPYLTANGAYTPYLTELDGYYDFINPQFYNQGGDGLWIEGVGWIAQNNDALKEEFIYYIADSLINGTRNYHKIPHDKLVFGLPSNIDAAATGYIQDPQDLYKAFDRLKAQGQPLRGVMTWSVNWDMGTDAANNSYNQQFIKDYGNFIHNQLPPVTDMTPTLSGIVDTRVELDSHFDPLIGITAKDYQGNDITADVTVSGSVNTNQVGDYLLTYSVSSDDETTNQPRKITVYEILPAFTGITDTTVVIDSEFDPMQGVSASHPTQGDLTANITVTGEVDTNVVGVYELTYQLFYGQDNQQNMTDKRIVTVVTDAVSDDDWQVGSTYVKDDKVTHNGATWTAQWWTKGEEPGTTGEWGVWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a complete four-domain chitinase from Moritella marina, a marine psychrophilic bacterium
pubmed doi rcsb
source organism Vibrio marinus
molecule tags Hydrolase
molecule keywords Chitinase 60
total genus 167
structure length 528
sequence length 528
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2012-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
A PF16403 DUF5011 Domain of unknown function (DUF5011)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.20 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Carbohydrate-binding module superfamily 5/12 4hmcA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hmcA03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hmcA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4hmcA01
2DPEA 3MV8E 3VDAA 3N17A 3TN0D 1N3NA 5I16B 1UENA 5E2VL 1C16B 4U6YA 4WWKA 4U2YA 1IC5H 1OSZA 1MHPL 3WFBH 4W6YB 5DFTA 5EC2B 3SDDA 5CXPA 2YD1A 2GTZB 1QRNB 1T03L 1OCWH 1U8OB 3RU8L 5DLMH 3CFEA 1M7IA 3M17A 4XCYB 4ZOBA 4ZS7L 3BKCH 4RIRB 3KDMB 1MCJA 3AMCA 4U6HB 1NWSA 4EDXB 5H94A 4N5EC 3IFLL 1PEWA 3STZA 5GS2D 3ZJ7A 1G0CA 3SDXF 3WBDA 5JOFA 3CVIL 3MYJA 4FFVD 4B9YA 5HHMB 2BHZA 4LPXA 1KJVB 2O5XL 3VWJA 5LWYL 3LSOA 5B4MD 1J88A 3ARUA 4AL8H 1NFDA 4G43B 2WBJD 3O9WC 4NUGH 4ZUTA 1AMYA 3NPSC 2NXYD 3LPWA 4QGYA 4KRPB 2F8QA 5L7XH 2X89A 5FCSH 4ML4A 4LPUA 4ZUWB 3IDJA 3T0XA 5FYLL 2OXHA 1Q94A 4XC1H 3ZE2E 4ZFFA 3IJYA 2CK2A 1A6AA 5DD3L 5KSAC 5DFAA 1CTNA 4PJEF 4X6CB 4MZ3A 2F8VA 1OF2B 2VITA 2EDRA 5IW6A 1AJ7L 2E9WA 4F66A 1HXYA 3OGCA 3LKPB 4GMSH 4QRSB 2XTLA 4AEEA 5D7LB 3B9VA 3ZLQC 3ARVA 1H11A 3TEUA 3MRHB 2FX9H 4HH8A 3C5ZB 5AEAA 1AI1H 5DFWH 4UDUB 2P43B 3RPMA 3SDAA 3F5WB 3L4WA 1OAYH 1E28B 2ORBL 2NYYC 4OIBA 5DJZB 3NIDF 4MXVE 3MJ9A 2XN9B 5D7JA 5A6KA 1WICA 3VXOB 1CDIA 1H0DA 4MD0A 3RY6A 1U6AL 3TV3H 3GUTA 1HDMB 5KVFL 4NKMB 1F4XL 1FNSH 1P7QB 3EBVA 4WFGD 1AQ0A 3MOQA 4U7SA 3GNOA 4PREB 2CDFB 3LEXB 3IB4A 4OD3H 2HFGL 3TBYB 5I8CB 1V6UA 5HOSA 2ZOLA 3MOAL 1QBAA 1HDMA 5CJQH 3IFPB 1WIOA 4M80A 3DLQR 1LE5A 3CFBA 1ZT4B 3ULUC 2HA1A 5TDNA 3BFOA 4G42A 3RL2B 3WNLA 3P0GB 4APQD 1D6EA 3O2DL 2D3NA 4YE4L 4UU9B 1H5BB 4N1EA 3WFEL 3KPPB 3CHEA 3KPLA 1CFNB 3VUPA 1FORH 1F3DJ 3VWKA 4OZOA 3DSNA 4M4RA 4P48A 4MCYA 2E9BA 3ARXA 4JZOA 4QTIL 5TJWK 4F7TB 3V4UH 1JN6A 1WBYB 2Q8AL 2V3EA 2EH7L 1ZHNA 4F7PA 5KVEL 2Q6WB 2D7TH 4XVSL 3MLSH 5I1CH 4Y16C 2PW2B 5C3LD 4M24A 3VDCA 1FG2A 4I0CC 1XF4A 5LBSL 2F54D 1V3MA 5HYJB 1M7DB 3MRRB 1PG7X 3AAZB 1CL7H 2D20A 4LKXA 5FYJD 3E8UL 5CBAA 4YAQB 2GUOA 5TF1L 4LHJB 1LE5B 5FGCB 1NP2A 4ZXBD 3DURB 5KG9A 3R8QA 3W4RA 3O4OB 1N59A 4MA7L 3RNKA 1Q0YH 2V17L 1WTGT 2VH5H 4GLRH 5F7NC 5C07E 1ZOXA 1CFNA 2OWXA 1RUML 1VFFA 1F4AA 1BGXH 3QRGL 1JHLL 1Y0LB 4EOWL 1T89A 3KE0A 3LS4L 3MUAA 5DJ6B 3VIKA 4V2XA 1AXSB 1DWAM 1INQB 1WZMA 5DUPL 2GSGB 3KPRE 4ZFOL 2OJEB 4YHNA 4EN3D 3GMOB 4FOMA 4Z7VB 3WL1A 2AS5M 4CCCA 4UTBL 3F5WA 1YNLH 1AP2B 3MA9H 3WEXB 2BCKB 3RZWA 3O2DA 5E2JA 4ETQA 4TSAL 5FAAA 4TSAH 4C54A 1DBKH 3W29A 1N3NB 1SYTA 2P7TB 1B4RA 1K85A 4RGND 3KPRA 3ZKMC 4EN3C 1NKRA 4MNKA 2GJ6E 1KB5B 4NWTL 3IXAB 1B3YA 5EU6A 4FK9A 1ZT1B 1NKOA 1RAMA 4M3JA 2XKNA 1LK2A 4MJ6A 1A6AB 5DGQA 3MSPA 5JW3L 1YNKL 3P9MA 1DP0A 3X12A 5E2WH 2W63A 1RZJH 2WMGA 3TPUA 1ZT7B 4GXVL 4XAWH 3FO1B 4KH2A 2NY1D 4M1DH 2R0KH 4JFED 5GXBB 3ZKXB 4BJLA 1MCPH 1NLBH 1EERB 2OQJA 3CFCH 5CEZD 4HC1A 3D3VB 4HPGA 1OF2A 3VXQA 2X4NA 4XP9L 4Z2KA 3WD3A 4FQ1L 1INDH 2J12B 4LVOC 3B9DA 4DCQA 4ZFFB 3NCOA 3V5DA 1M7IB 3OX8B 4HOZA 3AXIA 1U8OA 1I75A 2XI9A 3MLVL 3MRIA 5IHRA 2GT9A 5F21B 5IB3B 3IANA 2NY7H 4QXTA 1YUHB 1GGBL 3SGKC 1Q1JL 1N2RA 3LSOB 1OAXH 1TTFA 1N5AB 3VWJB 4U6YB 1A2YA 1RZKH 1IAIL 4GBXB 2X7LB 3TVMB 1ZHNB 4F7PB 2DQDL 3CDCA 3KYOB 3TA9A 1R8LA 5J9PB 3X13B 2X4PA 1QNZH 1V3KA 2VLMD 3WKML 2C0HA 1RVFL 2A6DB 2B39A 3T8XB 3MODL 3CSYA 2GTZA 5I0DA 3WXWH 1KBKA 4WFGE 1IAKB 1KR0A 4PIRF 4NFCA 4P46D 4DVBA 2W61A 3UTSB 1H09A 1FBIL 2ZCKH 4GG8A 4PRWA 3L3DA 1AH1A 2RTSA 3DRTA 1V7MH 3QEQA 4X80L 4NRXB 1NQ6A 1IAIH 3N50A 5FKPB 5GSVA 1QP1A 2F54E 4ODVH 4BYHA 1XCQB 1JI1A 2VXQH 4G6MH 2O9PA 4BQ8A 3NSXA 5HGDB 1I8LC 5L0QC 4ETYA 1R0AL 3MMEB 1XGUB 5IFJA 2IBBA 3PJSA 1YQ2A 2J5LB 5EO9A 5L2JA 1N6QH 2C8NA 5DD1H 1ZBVA 4JY6B 1Z9MA 5CEXA 2J78A 2YN5A 4WEUD 1A14L 2AEWA 1B6DA 3C08L 3VU2A 3D85B 1FO0L 5C0RH 4AIZB 1N64H 3PABA 4HGWB 1BVZA 4WUUE 2LTQC 5GS0C 4NQCD 5I17B 1FZMA 1I7UA 2J5LC 3REWA 5HBBA 5CSUA 1S9WA 1XGQB 3CDFA 4GRWH 2QR0A 3BKJH 3AHZA 1A7NH 5LA0A 3RWIB 5ACZA 3O8XA 2G60L 4MNGA 5CZXC 5F93C 1UGNA 1ISVA 1I8LA 3QUYB 1F3DH 1PW3A 5J6HA 3QXDB 2F53D 5I76B 4BFGA 3MUGB 2XWJA 4C59B 1A6UL 5JUEL 2WHMA 5ILTL 1J0YA 3CVIH 4BKLB 4L4PA 2PXYB 4AD3A 2W66A 4KTDL 5KOVC 3MA7B 2F53E 3EFFB 1TVDA 3FNDA 4JPIB 4V2CB 5L88L 2QHRL 4G43A 4ZUTB 3EO1A 3SE3C 3GJEA 1CZ8L 1MJ8L 4KHXH 1UEYA 4JRXD 5FIPA 2MSPA 3SBWA 1JNHA 4X99B 1BZ7B 5CSYA 4NQXA 2UWEE 3V0AC 3SN6N 4MX7B 2NY2D 1QNRA 3GZAA 3GGWA 1HI6B 4KTYA 1OTSD 5M03A 2EDFA 5BXRA 4N0CC 1R85A 1NMBL 2YXFA 4F9JA 4N1HB 4F8TA 4NRXA 4LPTA 3WLBA 1VGEH 2O5XH 1ED3B 5DC9B 1QPKA 1J9YA 1P1ZA 2I5YH 2WIIA 1QW9A 3IDIA 1W3LA 1GC1C 4OOUA 1BM3H 1FFQA 1YDPB 5CGYD 1BX2A 5F1IA 1NAML 2WZHA 4H2CA 1IM3A 5H35B 1JF5A 3NN8B 1YJDC 3ARBB 2X4PB 2XTJC 3GKZA 3OLEA 4UTFA 2IFGA 4OF0A 2XA3A 3RU8H 1MVYA 1QRKA 1QLFA 3MRDB 4Y4FC 5SWQA 2X9WA 2VZTA 2QMKA 5HVWA 2JIWA 1TTUA 4Z7OF 3BH8B 4G9FA 5IR1A 5DEFA 2EDDA 1JRHL 3MU7A 3DV4B 4Y19D 4J2XA 4F3FB 4U1MB 1WFTA 5E2VH 1YEKH 5KJRL 3JV6A 5E8OA 2DWDA 4KI5D 4V1DD 1M03A 2IBZY 1XF2B 3FQWB 5T1DL 3WQVA 3UJTH 4NZRL 3UYPA 4FFVC 3MRBB 3UBXG 5HHNA 4FRWA 2NX5D 4PCSA 2GK1A 3QIUC 1TNMA 3RVTD 5TFSH 2W0LA 2ZZUT 3AIEA 3DMMA 1E6OH 2AABL 4LASL 3MCKA 3TWCL 1HNFA 4MXVF 1U8IA 4W7UA 2Q20A 2GFBB 3HZMA 3MRPB 4OLEA 1OP9A 1IM9A 4KRUA 4ZQKA 2WCSA 1BFOB 4H88L 3BWUC 5BRZE 4L8SB 4QRRD 2E8ZA 5D5MF 3JTTB 1TJIH 5I8OL 3AHYA 1AR1D 4M9PA 3GXDA 3AB0B 3ALPA 4LQ1A 5TGBB 3OGVA 5TDOB 4Y8AA 3VW3H 2EDTA 3UPAA 1F6AA 3QEQD 2RQ8A 5DMIL 3S34L 1I7ZA 1E4JA 5D2LB 1E40A 5I1EH 1FO0A 4I3RH 3TO4A 3IAQA 3UESA 3WFHA 3DMMC 3P0VL 4HJ0D 4HFUH 1ZJBA 3OR6B 1FP5A 1X4XA 4GUPA 1HL8A 4ETQB 1O6IA 5HGBB 5DF0A 1HQRB 2DQUH 3CFDB 3DV6B 1FJ1B 4I4WB 3FONB 4CU7A 1JWUB 3U5UA 3G04B 1BOGB 1KJ3L 5D5ME 1RJYA 1ZA3A 4E2OA 4LL9A 4RWYL 3MBEA 4PLKC 1F58L 4LCYB 3BKML 1CBGA 1RURL 4TX6A 1VKXA 5LAXA 4AZ6A 1HXMA 4YPGA 1A7BA 3UXFA 1NGZB 2DM2A 5BS0E 4OFYA 4R96B 5F9WC 4I5BA 4LMQI 4BK5A 2DI8A 3CBWA 5JA8B 2NW2A 2RJMA 5C86A 5BW7A 4L8CB 6FABL 1QHPA 5IMLA 2BNQB 1MFVA 1OW0C 3MV7B 4EI6B 4UFMA 2EO9A 1QFUL 2J8UF 4I9WD 5B39G 4LEXL 2J77A 4NNXA 1BJ1H 1CXHA 3BRGC 1HIMH 1ZVSA 1BEYL 2HMID 1TE1A 3D3VD 2O9OA 4OD1H 1PBGA 1XGTA 4YDVB 3CPLB 2FATH 4OZHA 4FQ2H 4R7DA 1DFBH 4LVHC 5IB4A 3GSWB 3LN5B 1YQVH 2W59A 4C83B 4P23D 4EQ3A 4YUEH 4P8UA 4FHBD 2V5MA 5JQ6H 2P48B 3MLPA 4K8RH 1ZBWA 4I9WE 4HAFA 4MAYD 3WUEA 4X4MA 3HG1B 5HGAB 3WMSA 3GIVB 1XGRA 1QLEH 1T5XB 4AM0B 4MNLA 2XWDA 2ICWA 2Q1EA 3D2UD 1HHJA 5FUZH 3BZFA 1Q9WA 2V5YA 4JDVA 4OFPA 3LIZH 2MQ3A 1T5XA 5A95A 1C1EH 4D94A 2ZWLT 4JFYB 1XGPB 1MF2L 5A2BA 4JG1H 4PTUA 4Z78A 3D39D 1P7KA 2APVA 1DE4A 5BV7C 2L4OA 4PYSA 4NKQB 4HJJL 3O6ML 4OAWA 1EDQA 3HB3D 1TMQA 3T2NL 2W0PA 5TE7L 5A8NA 3BISA 4PJXF 2CPUA 2E3ZA 5HTSA 4KQ4H 4K9EL 1KB5L 1YC8A 5F1KC 2BSRB 5B4MC 4K3HA 3GYCA 5AY7A 5TQ2H 2D7NA 5HI3C 5DRNB 2D7QA 2C1PA 2VISA 4XNXL 3EMQA 5E5RB 4JLRB 2GHWB 4MD0B 2WANA 3WQWA 4ODSH 4R96A 4CN6A 3PWPD 5D7JB 4JQVC 4BA8A 3I75B 5ADPH 2V7NB 4KZDH 4KK9D 2IH1B 3WH8A 3QYCA 4LRIA 2AVGA 1MCOH 3IS0X 4Z7QE 1U8KB 1UQSB 1J1PH 3VXTA 1QA9B 4NGHH 3SPVA 1ZA3B 4Z77B 4HBCH 4OF6A 5KW9L 3O4LB 4FFYH 2VIRA 3VNZA 4L4VB 1WDRA 2E9MA 1FHGA 1AY1H 5E00A 2ZJSH 5E94B 1MW1A 3BLPX 1C90A 1WAAA 3RUGA 2FX8H 4WW2F 2HH0H 3OL2A 2EXYC 2DS4A 4BA0A 1DN0B 5C7XH 3ARGA 3DROB 4YWGH 4PN2A 3SURA 1CDBA 2DI9A 1IM9D 4L9LB 5F6HI 4LKCA 1MIEL 5LJYH 2J1KA 4LBEB 4W8AA 2DQFA 4XWGL 3ZL4H 3HC3H 2V7HA 4PY7B 5CSBA 5C0JA 1CICA 5F89B 5A6BA 4ORGA 3TT3H 5CZVL 5IVXA 1A6TA 2I07A 3POCA 2CO6B 5FUOH 4WTZG 3STZB 4IISA 5BWFA 5ETUB 1J0IA 2E9JA 5IBUB 3NCBB 3ZDZE 4Z76A 1DLHB 3BAKA 3BXWA 2VDOH 4FQXA 1ACYH 5BQ7A 3V52H 4S0SD 3BPOB 5C9KA 4OOZA 2OR9H 8FABA 1A7PL 4GSDH 4QHUA 3VXRA 4BK4A 3CZFB 4Z7WA 4AWEA 3NZ8A 5E9DD 3OAYK 5CEYA 5FL0A 3H0TB 1Z5LB 2EC8A 2W1NA 3QXUA 3S8WA 3AQUA 1JGLH 1L4IA 3MBED 4HK3N 4Z2GA 1KTKE 3RWDB 3WQ4A 5MEQB 1GQJA 1MELA 5DHVA 2CGRL 4LOUD 5EOTB 1Z9LA 2OZ4L 5E8NB 2H41A 4D9RE 1JGVH 2VDKL 2PW1A 1MHPH 3MGAA 3FW6A 3WMCA 2YUVA 4TQEL 1CS6A 4ATLA 1GOFA 3NCJL 3MBXL 3BAEL 4ERSL 1SJHB 2VDRH 1U58A 2ESVE 3VXSE 4OCYL 1UUQA 1L7IL 5IHUL 5E1AB 1LF1A 1UXSB 4W68A 1UM5L 4UQ9A 4UOW1 4RFNC 4NRSA 1VBUA 3G9AB 3QOKA 2JE8A 5I23A 2NXZD 1LO0L 1T04B 1UZ8A 2OYKA 4MD4A 1WO2A 3LB6D 4MXQC 5K9OB 1KFWA 3NIYA 5E8EB 4FN0A 5EUOE 1FNGA 4JFOB 4N8CH 3ZE1E 1XCTA 1YN7B 3BKJL 4RFEA 4P7QA 1OAKH 1V03A 5HGGS 1X5HA 4TSBL 2ZXQA 15C8H 4PJCB 5C0BB 1W91A 4DGVL 5AYUH 2EQDA 4MGXA 5JR1L 1QFWL 2D4FA 3NSMA 3WD1A 4Q6YA 2EDKA 2V38A 4NM8H 2ZNXA 3L95B 2AXGB 4U1LB 4XTRC 4HDIA 1UFUA 3DHMA 2ICEA 4KGLA 4X8XA 3BPNC 1NC4D 5IFAH 4MLSA 3U83A 1V3IA 3L7FB 2VLRE 4GXUN 4P7NA 4D6HA 2VNCA 3MREB 2YK1H 5SWSA 2BY1A 4HUUA 4PUBL 2NY3D 5CD5D 1BAGA 5DK2A 3ZT7A 4Y19A 3QEUB 3JUYA 2XV6B 4L9LC 5EN2B 4AEFA 3QXDA 3WCYA 1R0AH 1UJ3B 4KVNH 1F3RB 4YX2L 4ZUUB 4QNPE 1OGTA 2UY5A 4I77L 1SJXA 5C0CB 4E41A 1CDCA 1E27B 2EIBA 2IG2L 2YMXH 1BD2B 1C5CL 1N8ZB 2ICWI 1FL3A 3GJFB 5F9OH 4ZEPA 3QZWG 4P8VA 5FECB 4UIMB 4K71B 5E5UB 4JHZA 1RZGA 3BO8B 4J3WA 3L5WA 4PJDF 5IMOA 4LLYA 3RZCB 4FQCL 1RY7B 3EYVA 4HKXA 4F7CB 5FA3B 3EYUL 5DQDH 3PWUB 4Y88A 1LJYA 4U3HA 1OSPH 5L2KA 2EECA 2X1IA 5ABHA 5JO5A 2AGJH 3WN6A 3AGVA 5D1QA 1DQLH 3I02B 4H04A 3TFKD 3NIGE 3HCVB 1CR9H 5C0DB 4HX1B 2MTPA 2BSTB 5CJOL 4N90E 4KV5E 1HXJA 2YS4A 3BP6A 1ECEA 1V6WA 2VWEC 5LXGH 2ITDB 2DIJA 5IMKA 2VYRE 5EZIL 1XCTB 1YN7A 4RFEB 2IH3B 4BUHA 1DBJH 4CADA 5K9OA 3O11A 1SEBB 4QYOB 1N6VA 1HH9B 5GS1C 2J74A 5BS0B 4WO4C 1UXSA 3TN0A 4IRSA 3OKNA 3PZGA 1X6LA 4R97B 1NSNL 4BSWB 3CK0H 2FECI 1UZ6F 2XG9A 1SJHA 1D5ZA 1CFSA 5J1TC 1MH5B 4XNQB 3T0EA 5DK0B 5IB5B 5TF0A 4GBXA 1JD7A 1RZ8A 4L4TD 3G6LA 3RL1A 2QKIB 3E3QC 2OWCA 2VAAA 4ZTOH 3LPPA 3MRJA 4K3DL 1LE9A 1MFCL 4PJXA 1SM3L 3KPSA 4LF3B 2FATL 1G6RH 4KROC 1YY9D 5EORH 1BEYH 3QHZH 2G9HA 1BIHA 3U7YH 2A1WH 1U92A 1S9XA 3MLRH 4LSDA 1KXTB 4QOKA 4MTVA 4QFUA 5CZXD 1ES0B 3DO7B 1E3XA 3VIJA 1FVCB 1K5NB 1YEFL 4TNVF 1MJ7H 3BIKA 3RGHA 1BYBA 1G94A 1EZVX 4LU5L 3VXNA 1AGBB 1NL0H 1BG9A 4J1UB 4DK3A 2VVNA 1F11B 2AJYH 3VGBA 5I1LA 4PMRA 2DKSA 1YHTA 1TNNA 1UVQB 1UCBL 3TA3C 1UWEL 1FSKB 3A67L 4Y4HD 2UYLA 3QRGH 2ITCB 2J47A 4FQQA 3UPRA 1DVFA 2OR9L 1NOFA 4XWOD 4IJ3C 1IFHL 1BQHG 3QZWA 2XZCH 1T21B 3O6FB 1VADA 2AV1A 4Q9BA 2CJUH 5D8JL 3PTQA 4MYWB 4MS8C 4U1IA 4LBEA 3MSDA 1W2PA 3G5ZA 4FQLL 1AQDA 3VTRA 3FZUD 3N1PC 4Y5YA 1AD9A 2UWFA 1IQDA 3NMEA 1CD0A 4YR6A 4ZXBB 2AKRA 1NCCL 2B1HL 1EQCA 3MCLH 4XNUL 5JIPA 5IESH 4CN4A 3L3IA 3OAUL 4TUOA 1QNOA 4IMLB 4QRRA 3W0WB 5BXSA 1PLGH 2R2HA 2VUYA 3G6DL 4HMCA 3OG2A 4YXHL 1CLCA 3X11A 4AQ1B 1V6YA 5CPQA 3RQ3A 2ILLA 4U3CA 1P4LA 3UERA 5DUBA 3W9EA 5ID1A 1XIWA 2ICCA 3O0RH 4F57H 3VDHA 4WSKA 4BELD 4A6YA 2YWZA 4Z5RB 4CNIB 2OL3H 4YHGA 4GG6B 4OZHB 4HKZA 5JHLH 4FFWC 4TULH 5DRXA 2DLEA 3FFCB 1YYML 3BSZH 4XAKE 5E6ZA 4G3YH 1FFPB 4ZAKD 4YXLH 4AD2A 3RVWC 3IDXL 5E8EA 3JWOL 3VFTB 1PLGL 3QB7C 3CVHH 3QIUB 4P9HL 1LNUB 5ADPL 3N11A 4XCNA 4OIIH 3K8MA 2AQ2A 3T0ED 5BO1L 1A0QL 1HILB 3BE1L 1V3JA 3ARGD 4TVCA 4DN3H 3UJJH 1U58B 1NQBA 5IVOA 4L4TE 5E0QA 1IMHC 4QXUH 4OFDA 3RDTB 3DJ9A 1FV1A 1JZ3A 4G6KL 2ZPKH 4CW1A 4S2SA 4K55A 4J27A 2XQBH 4M1CC 4YXKH 1B31A 5HI4D 1RIVL 4BFEA 1D6EB 1W72B 3HUJF 2ZOKA 3LS5L 4ZXBA 3OGSA 3KL0A 3QHMA 1AQDB 4U1HB 3GHBL 1K4CB 2Z35A 3AM8A 1ZGLA 4LLAA 4UQEA 4FXGA 1NCWH 2X2YA 2I9TB 2ZOLB 5IQ7L 1JUFB 1U91B 4JFPA 2XFRA 3MV8B 1AR1C 3UPRB 1FSKC 1NPUA 3EGSB 3MO1A 5J3HD 4OZGE 4EN3A 5HSFA 4Q9RH 1V0LA 4JQXA 3C09B 2OZ4H 5D7KE 4I18A 1A47A 5I1LB 2YDQA 4XP6L 4Z95L 4AT6A 1AO7E 5CINL 5BOZG 4LLWA 4MAYB 2GAZA 4U7KA 3LHPH 3C8KB 4L8DB 1UG6A 4HJ0C 4MVBC 3HC4H 3WV0A 3EW3B 1O7VA 5D7KD 4HIIA 2AAVA 1RIUL 4NT6B 4NRZA 4MADA 1G6VK 2P24B 4HIJA 4G7YH 1H3UA 4PJBF 1OB1B 2BNQE 5T1KD 3IK2A 3DUUA 3T1FB 5IBLD 2YPLA 4W6XB 4OZIE 2OSYA 3KPMB 3JV6B 5DS8A 3SDAD 4X6CA 1DN2A 1T5WA 2E8YA 3ELAT 2AAAA 5I19H 3OR6A 3ZHKA 2XTKA 2A3CA 2WVSA 3LRSB 4UFIA 4ZUWA 4XNYL 1WNOA 3QR3A 3BXNB 1R3HB 4K23L 3KLHC 3VXUA 4X9GA 2ZICA 1GPFA 3UTPE 4NIKB 1DDHA 3LKQA 5EWIL 1MWAB 5FO8B 2J8GA 3W2DH 1NAMB 2J8HA 3D9AL 2XVLA 4GT7A 3QIBB 3AXXA 3WH7A 5DJ8B 5GJSH 4QRQB 2DKUA 2YZ1A 3IDIB 5ICXA 4U6HA 1J0ZA 2VDPH 4KMTH 2IF7A 3C5ZC 1UACL 4UIKH 1GVYA 5DDHA 1QRNA 4PJ8D 1VFMA 1KYOJ 3R06A 5DHYA 5C0GB 1YEHL 2YOCA 5DHXB 1KC5L 4XAKD 1QO3A 5JA9A 2K7QA 3U57A 2VQ1B 2SEBA 1IILE 4LHUG 4E41D 2H2SD 1VSCA 1J1XL 4OT1L 3AMLA 1C5DB 4F37F 4B5EA 1FCGA 1K4CA 3EYPA 1P7KB 4FXLA 3K4AA 1HH6B 2QBWA 3D2UB 4NJAH 4Z0XA 2EIZA 5F7EH 4IRZH 3KJ4C 1OAYL 1M7XA 4GI9A 3U4EB 1UWGL 2GITA 5E8DL 3BZEB 4UIMA 4HLJA 1MXDA 2K1MA 4K2UL 2AP2A 1FVEA 3LH2H 4NN5B 4WI4A 3TBWA 4Z2HA 4A3YA 3MLVH 4LARL 4YBHA 1QLRA 4TSCH 1EHLH 4LGRB 4PB9L 4ELME 3OHXA 5I1IL 2NY1C 5D7IF 1QD0A 3QDGB 4WTZA 2DAVA 4N8CL 3RZCC 4O2FB 1ED3A 3VFTA 4MJ2A 1EGJL 4X6DA 1IAOA 4I48B 3PN8A 1KPVA 4PRPD 3WFLA 3L95A 4U1LA 1MWAH 4YHIB 1IGFL 5DTFB 5CEXB 3C6LD 3TM6A 2C7UA 4MX7A 1MCKA 1LL4A 5IVXF 3QI9B 4NKDA 3V0WL 1IGMH 2ZNWA 4X7SH 2W5FA 3UX9B 2HYMA 1FZKA 3H42L 4Y2DB 2Y36H 4L5FH 1KPRB 5EBMA 5EZJB 1YEDB 4WDIA 3MYZA 1EZVY 1B4JH 3OGOE 2PCPB 3KPRD 3BRFA 2ZUMA 1U3JA 1ODUA 2K9UA 3PV6A 3O3DA 3QNYA 4XZUB 4GZEA 4X9YA 5EBLA 4EUPG 1CWVA 1BQCA 3QG6B 2RGLA 1MJ8H 4KHXL 4XB7A 5I18L 5FOOA 4X9BA 2FB4L 4EI5B 3BPNB 2VLJD 1U8NB 2R29H 4JANB 4WJ5A 1XGYH 4JO1L 3IDMA 5HVFB 4WEBL 1DJSA 4X8JB 3IDYB 4XPGH 4QT5A 1JNLH 5SX5K 1L8NA 4JQIL 5EO0A 4KY1H 5KAQF 1G7HA 2B4CL 4QKXB 3QIBA 3AXHA 1NBYB 5BMFH 1A2YB 3DHJA 4HS3A 3NFPB 2VXVH 4WV1A 1UVQA 2VQTA 3VD5A 4YDJB 3QQNA 2W92A 1QPXA 3VG0H 2DDQH 1LEKA 2K7PA 4UT7H 4H5SA 1KNOA 1QSFD 1KJ2L 2N56A 4HEME 2IAMA 3DX9B 3P9LB 1D9KB 4FQJL 4XPTL 1OLLA 5C0IA 1IAOB 4EI5C 4PG9B 1FH8A 2FL5A 4XXDA 1UKQA 4FZEL 4UT6H 4JKPH 5IFJB 2A6IB 2Y24A 4M7ZC 3L3HB 4UILL 5HGDA 5IESL 3DTXB 3OBAA 1NCCH 4GI8A 3KPOB 3DX8B 4KMTL 5A2FA 3BSZL 3WQ8A 3QO0A 3IS1X 4H8WL 3O6KH 2VLLB 4WI5A 2PO6D 4MNHB 1T4KA 2BMKB 4KUCD 4ZPTA 1Y18B 3BZEA 3IJ8A 4WV1C 2NR6D 4CVZB 1CGSL 3I2CH 2VSDA 4PTWA 1RJCA 3W24A 5C0IB 3PL6C 3T2NH 2BC4A 2Z93A 1MCEA 4MNMA 3BH8A 3WXVL 5A43C 1G9NC 2LE9A 1I3GL 3ZE0F 3MXVH 1S7WB 4Z0XB 1E71M 4P57B 2J7BA 4TOQA 3IXAA 1QLFB 1LEKB 3MRDA 2JF7A 1ZLWK 4KY1L 4AIOA 4IPLA 1KB5A 3GI9H 3MRMA 4N90D 3RIAK 1KXQE 1ONQB 1ODZA 2VZOA 3M8OL 1UA7A 4KZEL 5SV4A 1P4IL 2A6KB 2WVTA 1JYXA 1E4MM 2OLDA 3BDYL 4JKKA 2YN3A 4WI6A 5D2LE 2EH8L 5CGMA 1W1PA 1NFIA 3EOTL 1JNNH 4WFED 1SJVA 3SCMA 1S7SB 1QA9A 2YD5A 2A2QT 4NQEB 5ABEA 2F5AH 5HYJD 2GSIB 3BUTA 2G3IA 1JZ2A 4YBLB 4W89A 3WSQH 3WMBA 1W72A 5D70L 3MV8D 1QR4A 4NCDA 1N5YL 3GSNH 2X4NB 1XF3A 1RU9H 3OLGA 1U8HA 5D1QD 1JNHB 4X99A 4S2SB 1IZKA 4Z18A 4JGUA 3QDGD 2O5ZL 4PV9B 3MNWA 1Q72L 1VIWA 4NN5C 4XP9H 2XRAH 1R3LB 2ERJC 5GS0L 3T3PF 3SDCD 4WI8A 3H8NA 1F97A 1SEQL 2YA0A 3MACH 5J06A 4XNYH 3SO5A 4Q6IA 1R5VA 1TDQA 1GL4B 3FRUB 5CJXC 1ZANH 2C7UB 5GRJH 3MRRA 4NQCE 2MANA 5DJYA 5BW7C 3QIUA 5AZ2L 4XNMA 1OW0A 2XFXA 5FYJL 4XVUC 3GJFA 2I60L 4MNGB 4MB5A 2ZUUA 2HT3C 2XICA 2EYTA 4YDKL 1FZMB 2YUXA 4Z5RA 4HTYA 5KVDL 4W5UA 2HFTA 3RBSA 3DOSA 2J79A 5BRQA 5AUMB 1MCBA 4LLMA 2VXTH 2YKLH 2GSGA 1A0QH 4OFVA 4KJYB 5GQBA 4OGAD 5ALCL 3S4SB 5CJXA 4UV7L 4XBEH 3MRQB 1JF1B 5FGBC 4OT1H 3ARBD 3WFCL 1CCZA 4K71C 4P46B 1K6QL 5IF0B 3BH9B 3L9RA 1UZ4A 3JWOH 4NNXB 2CUMA 4QXWA 1N4XH 3AZSA 2P8MB 2VLJE 3QNZA 1X5AA 1NCUA 4P4RB 5KS9B 2NW2B 3VIFA 3E6FA 4FNLL 2M8XA 3A6CH 4IOFD 2BVQB 2EO1A 3OTTA 4RA0C 4B7IA 2BXZA 1EIBA 1LO2L 4G9FD 1HN1A 2XIIA 4ONGH 4XMPL 3TC9A 2VLKB 4JFDB 2ITCA 5DO2D 2YLLA 1JZ7A 3RHWK 3P0YL 2EPOA 2XQBL 1MCLA 4GRLA 3TTOA 2DF3A 3BWAB 1L6ZA 3GSVB 2IEPA 5HHVH 5FGBA 1JN6B 1WBYA 5D7SH 3GMPA 4HSQA 4FG6D 5D96C 3SCTA 4Y5VA 4PB0H 2J8OA 1FYTE 1UZ6E 1QSEA 4L3ED 4X98A 4D3CL 3KPPA 3LQAH 1YEHH 4ZSOB 5FHBL 4WW1B 3Q3GA 15C8L 3HI1B 2JF6A 3PP3H 4ONHA 1MI5B 2R56L 3K1KC 1C8QA 3EJYC 2RHEA 4G42B 5I30L 5BROA 4G6JL 5A3IC 5BV7B 2EDXA 2CERA 3RWJB 4AISA 2DQJH 7A3HA 2B2XL 5CHNB 1OAZH 2J7DA 3QQ9C 1U42A 4D6JA 4HFWA 2R0ZL 1AHWB 2CIPA 2OTUA 5F3BA 3PDOB 1AGDA 1CF8H 2NY3C 5CD5C 1YJDH 2ZSVB 3VIMA 2A83A 2Q3ZA 5HGHB 3OAZK 5CMAA 4XPHH 3T0EB 3MRPA 3KR3H 2GFBA 3MLYL 1N82A 4ODUA 4UQCA 3HR6A 1FYTB 2WNGA 3MBXH 3W9EB 4U4BA 3QUZD 1Z3GL 5ABGA 3LPOA 2OP4H 4XVJH 3QIUD 3SGJA 4PY7A 1WCBB 2R2HB 2V7HB 5D71L 1QYGL 4I0PC 5IV2B 3ZYZA 1VERA 3RTQC 3MRBA 5CJBA 2FR4B 2GAZB 1G7MA 2IFFL 1KFAL 3VJ6B 3CMOL 3C5JB 1KGCE 3FJTA 2VC2L 3AHTA 4OJFH 4YHZH 1WFOA 4F3FA 3F58H 3EYFA 2C1OA 3BIAX 5DMKB 1FA2A 1VADB 2BCKA 1CLVA 1I1AC 4YDIH 1MJJA 3WE6A 1BQSA 3RTQB 3PP3K 2QEJA 3MJGX 5FF6A 4X4YA 4JZ5A 3S3SA 3GRWL 3VFSA 4KK6D 2O9TA 1E6JL 2V7NA 1KCUH 4HKXB 1UWIA 4CDGC 1W2KT 3OPZL 1FZJB 3HZVA 1RD6A 2YPVL 3QUMH 3QUML 3ARBC 1HP4A 4JLRA 4QHNA 2DT2A 3QEHB 3RDTA 3T77B 2G3JA 1VFAA 2P5WB 3DURA 5LCVH 3DGGB 5KG9B 1GHRA 3BVNB 1U92B 2PYEE 5DUPH 5C0CA 3HZYB 4TPRH 4G8GA 3CFEB 4Q0XH 4U1GB 3U0WL 3NA4A 5C1MB 3LZFH 2A3EA 5HDOA 2NR6C 3SCRA 2PBGA 2JJSA 2E3VA 4D71A 3CUIA 4K3DH 3MGTB 4WY7H 5FDYA 4RBPK 1BFSA 1EOKA 5C9JA 2RR3A 4KWUA 2QQNH 5F7YC 4OZ4A 1TQBC 4N68A 1AVAA 2RBLA 1IVLA 4HKJB 3MS8A 4OLYL 3PWJB 2GJZB 2EYRB 3GNMH 4FQXC 4S1SL 2ZUNA 4X4ZA 5MENB 4OM1H 3B9KA 3VWKB 5E4IA 4CAGA 3OKNB 5ADOH 3NA9H 2VDQL 2ARJB 5D2NA 1X44A 1B0GA 5GGRA 2H45A 4PJAE 4JRYE 3W11C 3X11B 3MMUA 4TVSa 1DZBA 4PRHE 3TBSA 2Z4QA 3L5XH 2MWCA 1GRWA 1ZXQA 1I9IH 2JF1A 2ZSWA 4A6YH 2CRYA 4MWFB 1RZFL 1I7RB 1T1XA 4LOUC 5CP7B 5AD0B 4XH2B 4IMLA 2WCAA 4KKNA 2ZUYA 1A3QA 1E72M 2X70A 4N0UA 2HRPL 4N8PA 3MUIA 1UWXK 4DGIH 3RJXA 3QDHA 4G6ML 1AIFA 2XYCA 4Z7VF 5CCKH 1G9MC 3NFSH 4WU7B 2NY5C 4N0FA 4XCEB 3B9KD 1BQHA 5D9NA 2H6PA 4LLDA 2OYLA 4PJ5A 4ZODA 3TH3T 1U8QA 1G0YR 1H0DB 2PW1B 2Q86B 1RULH 3U7VA 2CK0H 2P47B 2W65B 4G6AC 4K94C 3II1A 5FA3A 3HPLA 1ZSDB 1TG7A 3PE9A 4FQCH 1BF2A 2NZ9D 4JRYD 4XHJD 5C08A 4ELMF 1R24A 2CITA 5D8WA 3WDPP 1FFRA 4PRPE 2DQDH 4YEEA 4RCAA 4X6FA 4QRTA 3CGTA 3W11D 4ZE4A 2A1WL 5CCKL 4AZCB 2MHAA 1CGSH 3I2CL 3KYMB 5D2NE 3FT4B 3BAWA 3S3PA 1EO5A 1OGTB 5KSUA 3H3BC 4QEGA 1T83A 4OQ1A 4XMPH 5BQ7B 1E43A 1FC2D 4KK8C 2EC9T 5BOPA 3IVKA 4ONFL 2GJZA 3KYOA 4NZJA 5A2LH 2I9LB 1BYAA 2O61A 3K46A 3RJDA 2TAAA 1IRAY 3WH5A 4PJXB 3QH3B 5EG6C 2YBRA 3MRKA 4N5ED 4HT1H 4JVWA 4QLKA 4ISVB 5C0JB 3RVVC 1CZ1A 1S7VA 1U8MA 2ZCLL 1GOHA 2QKIA 1NCBH 4UTAH 5JPMB 3KJ6L 1U2YA 4L9LA 1OAKL 3N06B 4HP5A 3B9AA 3LKOB 1J9CT 1MIML 4Y2DD 3WIIL 5C0EA 4BSWA 3V5DB 3HZYA 3MC0A 2HJLB 4PMYA 4ZOAA 1KIQB 1VDGA 3DMMB 4GRWE 4ELMB 4PLNC 4KTDH 2F8OA 3JWDL 4Y1AB 1XR9B 5LXGL 1A3HA 1UM5H 3L3JB 3BQUB 3KYMA 4K7PL 4PJ9D 1AXIB 2LVEA 5CP3H 1E4IA 3O4LA 3TTQA 2WUBL 1SJEA 3ZT5A 1I8MB 3KHQA 3LHPL 3SOBH 2Q8BL 3EO9L 3TPUB 4Y4KD 3B5TA 3VFSB 4J3UA 2JJVA 1B3WA 4TQEH 4AH2A 4M03A 1MIMH 3SCVA 5F96H 1O5DT 3BN3B 3UJIH 5TH2B 2YD9A 4WFHD 3VGFA 2R4SH 2IPUK 3ZR5A 5HHOD 1T0MA 3VXMD 2BOBB 3VWJC 3BPCB 2F5BL 2HLAA 1H3XA 4ZO7A 4XP5L 1DSFL 4P3DB 1PG7H 4TUFA 1TITA 5F44A 3FQRB 2FYYA 4X6CF 5LG1A 3L5WB 4P2YA 5JHDA 3QSKB 4I3GA 5D7IB 1I7RA 3VFRA 4WHTA 2FBJL 3HKFA 1G7PA 3VFWB 3SCPA 4RE2A 2BVPB 4TTUA 8FABB 1NC2B 3GSNB 4NQVB 3WBAA 2DQJL 1D3CA 1X1NA 4ODHH 1Y0LA 2GW5A 1PDKA 5ETUA 4JRWA 1I85C 3ARQA 1K8IB 2MCG1 4TOYL 4WIWA 4X9HA 5F88B 3UEZA 4X7TA 3G5XB 1A7OL 1XF1A 4TSBH 1EEZB 3ES6B 1IKNA 4G6FD 3VGGA 3VGEA 1NGQL 4PLOB 3KNBB 2WMFA 5IDIA 3MV9E 2FECL 3IFNL 4OLVH 4XX1E 1TVPA 1E4KC 4PD4K 5GGSB 1F90L 2XWTB 4LCUB 3VH8B 3T3MF 2AOSA 3D0VB 3AZRA 2C3VA 2FZ3B 1P4BL 1MFAH 5ENWB 2CIIA 4XP5H 4F7MA 4Z7NE 3J8F7 2Z9TA 5E6ID 1KIRB 3Q6GL 4QHNB 2FWOB 5DI8A 4FQHB 5ERWB 3STLA 3BDBA 3PWNA 1DWFM 3G6DH 3L4VA 3D85A 1A4KA 4L3EA 1Y6NR 1JPST 2AW2A 3NA9L 1U6AH 3AZTA 2W9LA 3ZTNL 4WHYG 4NC2B 4FQHA 4YK4C 5FF6B 1W2VA 4U6VH 4JY4B 3PGDB 3P0YH 3ULVC 4WU5B 2EDJA 1XEDA 3MV11 5L2JB 3QWOA 5JPNB 3PZ9A 4GXVH 4XAWL 4GKNA 2WMIB 5FCZA 3QIWA 4LEXH 4M62L 1AIFB 2CDFA 5GGSA 1I1WA 2DT1A 2FLBT 2X70B 4N0UB 4H1LA 3WIHH 2X1XR 3E2HB 4YO0A 1DQDL 4IRJD 5K9QI 1OTSC 4XGZA 3QUKA 2ADIB 2PNDA 2V9QA 2KH2B 4PMXA 3WF0A 2WMKA 1A1MB 3A6BH 2NY6B 3TO2A 3KYAA 1RMFL 1IZJA 5B3JF 1OCWL 4BSJA 4NBXB 5BRZB 3WENA 4C7DA 2PR4L 2VO5A 3HUJB 2VR5A 4N8VB 4CCEA 4UV4L 1NGWA 4I18C 1P7QD 3DUSB 4NRYB 4KK9C 3RY6C 3X13A 1FOBA 3CFJA 4Z76B 4Q2ZA 3BD3A 2M1KA 4LSRH 5D7LA 4JB9H 2RIKA 3EKCA 3JXAA 2BV9A 2OJZH 3TBVB 1MQPA 4AJ0A 5HYSG 4MD5B 3V6OC 5SWZE 1JDCA 3VKKA 4HC1H 4LLQA 4TNWK 2ZSVA 4Y5XB 4AEHH 3LS4H 1C8XA 5AWNH 4HV8A 1V6XA 2JELL 2DYPD 4JFEE 3PDDA 3F7VB 1GC1L 1OAQL 5K9QG 3UG5A 3MRIB 3V0WH 1WDSA 3O6FC 2P5EE 3N13A 2R23B 4NZUH 3LN4B 4ZUSA 1P2CB 3QDJD 4U33A 1YPZF 2BNQA 5KW9H 4JFQA 2C3XA 3WD5H 1DBML 5I1KH 4AD5A 2G4FA 4Y7EA 2HN7B 5JDSA 2HJFB 5D4YA 1EGJH 2XZAL 3DWTA 1B0WA 1EK3A 1U3ZA 2IALB 3QISA 4OLUL 3RO8A 5IEHB 3W0KA 2E7LC 5LBSH 1C7TA 5EOQH 1MPAL 3RDKA 5J57B 1W3KA 1IGYB 3GNPA 1UQSA 2ZX7A 3BI9X 5IEKA 3D25B 4XHQA 1F3JB 4UB0H 5K93A 1TVNA 3MXVL 3R8BB 4BZ1L 4GAYB 3DIFB 4XX6A 1KB5H 5HHMD 3GRWA 1CFTB 4NQDE 1OBAA 2BVQA 3FCTB 3PHQA 4YBLC 1WUNT 4RAHA 4WO4D 5DMKA 4Y1AA 2HRPH 5DFVC 4LLUA 3WELA 3MPCA 2AJ3A 4NKIL 4NO5A 4R26H 1UWEH 3A67H 4JQXC 4ZUSB 5BXFA 3IXTB 3SCWA 3ZHLA 5I19L 3MJ6A 3RJYA 1A7QH 1BVKB 3FAXA 3MODH 1HJWA 1VGKB 3PQYD 3V8OA 3VFPB 3U7WL 1WCBA 3QDAA 4UT6L 4RMSA 3UDWA 5EU6D 1MAML 1UHVA 4LLQB 3EO1B 4NM4L 4H0HB 4LAQH 3PZMA 3R1GH 1G6RB 3EUUA 5JHLL 4ZAKA 4GXUM 1QSED 3PTKA 4B15A 4HIEB 1LK3L 2Y06H 4BKLA 3E2HC 1UOKA 5A2JH 3HUJE 3MCKB 3KPSD 4IM8A 1FL6B 4ODBD 5HPCA 1AGDB 2D2OA 2HT2D 3JWOC 4NNPL 1G9EA 2ORBH 2X4QA 4L4OA 2J6EH 1WZAA 1UWTA 3VRJA 4X0VA 1CGWA 1RJZB 3QDGE 3A6CL 3RWJA 2IAMB 1FIEA 3UJIL 2VABB 3MFGB 4YO0B 4DWHA 1RUQH 1LO5A 2OS7A 1KV3A 2B1HH 1YNTA 3C8HA 3Q3GB 1QTYT 4RBPH 5GGUB 3CUGA 3BGFC 4H25A 2Q7YA 4BSVA 3OG6B 4QAWA 4YLQT 4OLYH 1E0WA 4HS6B 4RISL 1NUFA 5C0BE 1LLOA 1OPGH 4KK6C 4H1LH 5GRVK 1HINL 4R4FL 3KPLB 1VF8A 3QJHB 1TVHB 3VGAC 2YKLL 4JANA 4M7ZB 4G80A 2R69L 4PJHF 5D8ZA 1US2A 2VZUA 2ZX8A 2QHAA 2APTA 3KLDA 1SY6L 5E8PA 4MQTB 4F9LC 4NOBA 1CL7I 4JO2H 1JNEA 4LSRL 1YPZA 3DRTB 4A2MA 1JWUA 4GAGH 2DJ4A 2ZXAA 4FLRA 2PCPA 2YA2A 2CR3A 3H3KA 4XI5D 3CMOH 4WUUA 1HHGA 1JGEA 3OGRA 2PO6B 3BDYH 3OKLB 2C5DC 3RWFB 2HFFA 2OM5A 4OCWH 4EI5D 2V5CA 3LDBC 2A9MH 3VIPA 5EIVA 2XGIA 1DQQB 1RPKA 4JO3H 4MNQE 5TE6L 1Z3GH 3VI3F 1FNFA 1UYWL 4OSUL 2OI9C 5DUMH 2E7MA 1ETZA 4JEGB 2D1ZA 5J0BA 1FN4A 1P4BH 5GIRB 1N2RB 3P0VH 3ME0A 5IVZB 1MQKH 2YD2A 3QPQC 4MQ7A 4NC1C 3VWKD 1KOAA 3LS5H 3SBWC 2DYPA 5LGHH 3G08A 2FJGB 4XP4H 1W9XA 3QPXH 4PJGA 5SX5H 1QEWB 4D6IA 3W5MA 1QLRB 2OTWA 1U3HB 2P5WE 4NN6B 1H8OA 3RWIA 3RRQA 3T2QA 4M6OH 5H2BA 2HISA 2R56H 4FZ8L 3MRLA 2OQJB 3VI4E 5KSAB 2JEPA 4X0NA 3SUSA 4PG2C 1T7VA 2CDEB 1RJLB 4ZPVB 1EX0A 1U3HD 3V4UL 2DLIA 2D23A 2DWDB 1UWSA 3TNMB 4EDWH 5FKYA 5T1KB 5HHVL 3THCA 5IBUG 5I2IA 1UG9A 4JFWA 3SE8L 2VMFA 5AYQA 4I1NB 3MYJB 3RVXC 4E0RB 4OGYL 5EO9B 3PJSB 1JL8A 1XGUA 3IJHA 2WC7A 1BAFH 3RWGA 5C71A 2UUDK 2R0WH 3W2DL 2HTKD 5EWIH 3M17B 1T66D 5DDHB 3Q1SL 1H3TA 3M1BA 1WF5A 1B0RB 1SJEB 3MRFA 4WSJA 2MFNA 2LU7A 1M53A 4OJYA 2RFXA 4YFEA 1HCVA 3C2SA 1IGTA 1IAKA 2XTJE 1EFXD 1ETZB 3T2PA 2ICES 2OJEA 4M6ML 4RDQG 3M1BB 5JW5A 1L0PA 1V08A 1J7VR 1I9RH 3NAAH 2IXVA 2VL4A 1UM6L 3FN3A 3CUHA 4XC1L 5EBMB 5JQ6L 1OSEA 4POUB 3DNKA 3ORJA 4XPTH 1MNUL 3U82B 5AWNL 4OV5B 2H32H 3WS6A 5EUKB 3LRSA 2WB5A 3H9SB 4FTVD 1VGEL 5I1DB 5DMJB 1H5BC 4HHAA 1RHFA 3NIGF 1HJQA 1IGCH 1DSFH 2YSSA 3KS0H 4P9ML 1A9BA 4JM2C 3VRIB 5M94B 3MA7A 1RZJC 4HXAL 5DSCA 1MLCA 2V2XA 3HE6B 1GNXA 4NF7A 2AK4A 5BXPA 4RRPA 1LGVA 4JFXA 5CFHA 5E7FA 4F8XA 2HTLC 3IVKB 1F6FB 1MF2H 1OB1A 1HVQA 1MI5A 3QDGA 3HI1A 3GBMH 4PYHA 2VCBA 4AY0A 3SKJL 1ESWA 4OUOA 3L3GA 1HCFX 2DM4A 1TVHA 1LL6A 1HQ4B 3D48R 3HLAA 4HIXH 4NN6C 2YD3A 2V2TB 1Q9OA 4V1DA 2QR0B 3C8KA 4L8DA 3SDYH 3DX9A 3P9LA 1MFDH 3GMRA 4X6FB 1S9KC 3T2OA 1M6OA 1DBBH 1PZ5B 1WSST 2VCCA 3OR7B 2V17H 2PYED 1B4JL 4F9PA 5FUCE 2P4AB 3WN5A 1H5BA 4GW5A 3CD4A 4MNQD 1HKLL 3NFPA 4YHZL 3HC0A 5LVEA 2WC4A 3QFJA 4NYLA 1NGYA 1DQLL 3CMJA 3UTTD 3GMMA 3NIDE 5TDNB 4JL1A 2XZZA 4YFLI 5ICZB 1U8QB 3DVFA 3CFBB 4G9DB 3WQ5A 1ADQH 1BIIB 2FJHB 3KPRB 4D9LH 2QL1A 2W38A 5GGRY 3DYPA 4NO2B 1DQTA 1WDPA 3K81A 1DWJM 2R1XB 5GGQH 3MFFB 5E6IB 3VD3A 4APQB 3HRPA 2R2EB 1IC4L 3BH9A 4V28A 1PD6A 4P46A 4XP1L 5MEPB 2EH7H 4MB4A 4XH2A 3UTPD 3FHAA 1JXJA 4B3KA 2ZUQC 1BG4A 4ODSL 4DAGH 1UEMA 1GGUA 1QBLL 5EFIB 1CQKA 1S7XB 4KJQD 1A6WL 5JQHC 1BBDH 3QQ3B 2VE6B 4CKVX 5KSBA 4G80B 5E08L 1GQKA 2LVCA 2XSBA 4KI5E 4L1DA 4V1DE 3UTOA 1SYVA 4HJGA 1A3RL 1LDSA 2WKLA 2FWOA 1XFPA 2PXYD 5DI8B 4PTTA 2F15A 5ABDE 3HI5L 5DTFA 3ABZA 2BVEA 1V7ML 1DANT 5FUOL 3ESUF 5IK3B 4WKHA 1V02E 2HFGH 4E42B 1QSFA 3BYTA 1HHKB 2Q7YB 4XNMB 5F7UA 5F1NA 5HYSB 4FQ1H 3F7PC 2P5EA 5SWSE 1XHGA 4Z7WF 2NY2B 1NCAH 1Q94B 3BSGA 2GJJA 3B2VH 4Q6IB 3DI2B 3RTQD 4KMLB 1BQLL 4PD4J 1BVLA 2BVYA 3VA2C 4YQXL 3W28A 5IHLB 3QHNA 3ULSB 3S4SG 3GJFH 3FQTB 1EVTC 3GMNA 4OFIA 4QTIH 1S9YA 3TWCH 1JE6A 2EEBA 2XY2A 4PR5B 3PQYA 1Q1JH 4WY7L 1AY1L 3MMDA 3S5LG 4DJMA 3VGHA 1RZ7L 4QRRB 4LSSL 4PJ7A 4D6CA 1YMME 1FH5L 5F1OB 1MVUA 1UA3A 4FQ2L 3MV01 4H8WH 1HH6A 3D2UA 5BJTB 3MUY1 2P44B 1AD9B 2DH2A 4NWTH 5BYWA 5GRWA 4URTB 5HDBE 5I9QB 5F7WC 4PGDA 3K4DA 1UR2A 3W26A 1E9LA 5CWSB 2UV3A 3RTQA 1H3WM 1QVOA 2VQ1A 3DI3B 5C92A 1NOUA 1W0YT 3HZKB 1H2JA 3AIRA 3ZM8A 2H3NB 2YD4A 4P2OB 4E8CA 5GGQL 1JRHH 2YL9A 3EYFB 1Q0XL 4PREA 3FQNA 4LIQE 4PP2A 4PGDB 1MCWW 4JO2L 4GJTB 4YHMH 5LWYH 1X5XA 5E6IC 4FG6C 1RUPL 3GSRB 4HS8H 4YDKH 3DUHA 2RCSL 3VFNA 1S7TB 4X5WB 2X4TA 4HJJH 5FOBB 4LEOB 3I6LD 1HSBB 1PY4A 3KWXA 4HULB 4JIEA 4CN1A 3GI8H 1TVBB 2EDQA 4P3WA 4LU5H 1AGCB 5AC4A 2CKRA 5IEHA 2BNQD 4KRTA 3TJEH 1HXYB 3L3JA 1FO0H 5C0RL 1GJIA 1UD4A 3ARRA 1FC1A 3RZCD 3NDZA 4GW1B 2G5BA 1TPXC 1T5WB 2PYEB 3S6CA 4XX1G 4P9HH 3CH1B 3MNZB 3V8CA 4PJ9C 5DEGB 5D9PA 3EYOB 1VFBA 4XB3A 5FYLH 5IFPA 3MLSL 5CHNA 3GSOA 5DZNA 1RZ8B 4NPYB 5IK3A 1YQVL 4LKXB 3PZIA 2FGLA 5A3ID 1NWRA 2Y07L 1XF4B 5D5MB 1T6WA 4H20H 4GO6B 4ZSOA 5GHWH 3JBG7 1G9HA 5I74C 5ERWA 2GTWB 1XIWB 3RPIA 3GH7A 5DUBB 1RZIB 4I0PA 1KIRA 4HG4K 1CXFA 2OWWA 3WUWB 2ZUXA 2DICA 2AEQH 5C70A 2DQTH 2JTDA 4RIRA 4K3JL 4YXHH 3LQMA 4L29A 1A7NL 4I18B 1PKOA 3C2AH 1I9RL 4OBRA 5IMKB 1S7RB 4N8VA 3DGCR 4Y2OA 4Z2JA 4M5ZH 1H15B 1WBZB 1RIHL 2UWEF 1YECL 1MCNA 1XC6A 1AO7A 1G1YA 4APQC 3O6LL 2CLZB 3GIZL 4P8WA 1KJMA 3OG4B 5DA4A 1E4WL 5C09B 1OLZA 4CDHA 3I9GL 5EIIA 4OZFH 4M5YH 2O26U 3WD4A 3E6FB 3AIBA 5L2KE 3FB6A 3Q1SH 4D1JA 1AGEA 1T21A 2RGMA 3TA3B 4C58B 3NCFB 3C5ZD 3PIQB 1WFUA 5HD8C 5LA2A 3STBA 5HVHC 1LEGB 4OFYD 2ZUQB 5KANG 4NYLB 2NSXA 4QF1A 3IKKA 3SJVD 5CILL 5B3JE 4JFZL 1UCBH 3WIFB 4JFFB 3EJZC 3FRPG 5J12C 3IDGB 5IB2B 1FNHA 4N0FB 4MSWB 5T33L 5EOQL 2BVPA 2IWGA 2FCBA 3BEVB 4KKCD 1PYWA 3O45A 1DLFL 4M5YL 4FA8A 3GSQA 1GIGL 2IBZX 2VDLL 2WWCA 2F5BH 3HRZB 5E6YA 3TPKA 3ULVF 2Q76A 3B6SB 4XCFL 3STLB 3JV5A 4WLCA 3EOBB 3BGMA 2AV7B 4W8LA 1UR9A 4ZS6C 4JM2F 4U0RC 5GS1B 5D7SL 2CUHA 5C8JA 1R3KA 5TD4A 1Z0NA 3MJ9H 4HMEA 4XNUH 1ZLVK 4DW2L 3SCNA 3QNXB 1YEIL 3Q2CA 2A73A 1LP9F 5HI3D 3I85A 3DYMA 4DOHE 3UEQA 5DJ2A 4JM2B 3WQ6A 4HKZB 3MRJB 2ARJQ 2CIKB 1QUNA 1WITA 3ULVL 4TPRL 3PWJA 4XPGL 5DK0A 1BTCA 3QCTH 1RUKH 4PUDA 3NGBC 1YEKL 5KJRH 4RAVA 4IHOA 4W8BA 3NTCL 3UAJD 1GQLA 4LGXA 2H2PD 3HPJA 3SKMB 5CG0A 1JGUH 4Z7UA 3LIZL 2IPTL 4XPFL 3ECBB 2G2RB 3PUCA 5J11C 5H94B 1GZJA 4JN1H 3CCHA 3W39A 3WHXA 2XG4A 2VL5B 3DETC 3EZ8A 4YR6B 3QUZC 3D0LB 1E6SM 5T3ZH 4UOQA 1FQ9C 4FTVB 2VLRB 4JFHD 4ODTH 1IGML 4U5KA 1RZJL 5CGYC 2CDGA 5DYOB 3EFDH 3H7BB 1UQZA 3MOBL 3WD0A 4P23C 4D6GA 1EEYA 4KU1A 1FAIH 4OJFL 3ULUE 4HH9A 5EC1B 4RGOL 1V0NA 4W84A 1UH4A 3TN0C 3SE4C 3K2MC 3O2WH 1MWAA 5L2KB 2JB6B 1DDHB 2ED9A 2VDOL 1CQYA 5K9JL 3CXDL 2EXWC 2NY0D 3NAAL 1T0MB 4FXKA 4U49A 2N1KA 4AMKH 2AEPH 2CDEA 4U6TA 3DX6B 4MA3B 2EEAA 4Y16D 4GG6F 4OI9A 2E5EA 3SO3B 5D7LD 3PWVA 3LKNA 1VB9A 4AZCA 3VXRB 1MFNA 2YPLD 5L2KD 1TZIA 2WHLA 2C26A 1U3HA 2PO6C 2E27L 5ECJE 5D9SA 2VXSH 3A4AA 4AG4H 4FMVA 2KBGA 4AXNA 5EH1A 4HIJB 4FMKA 2GIYA 4NRZB 4GSDL 2XKUA 3L3HA 3WLWC 4L8SC 2EDHA 5CIPB 5ESVB 1QI2A 1G7QA 1EHAA 4P3CH 1BQHB 3BZDA 1QI3A 1CWYA 1T1WB 1D5ZB 1B30A 1EO8L 4JHWL 4U1GC 5EU6E 1JRHI 3TT3L 4NM4H 1ZLSH 5D7LE 4HZLB 1XF5A 1V7NH 4KZEH 3M8OH 1IL1B 4UZSA 1SEBA 4QYOA 5C7XL 4MD4B 5E2UH 3THDA 2PC8A 2VIRB 1XD1A 3HHRB 4FXGB 3KAAA 2XPGA 4L4TA 1G0DA 5GS1A 2YPKA 2Z35B 2A9NH 5D2NB 4OD2A 4WO4A 1CDJA 4P3CL 3O3EA 3O3AB 2IG2H 2YMXL 2CKBL 4M48L 4YPJA 4CMHC 1R5WB 2BFVH 4F58L 3AYSA 2HLFC 1T0PB 2H26B 1HSAA 3H9HA 3QUXC 3W38A 3NIFF 3C87A 5ECUA 5IG7B 3GSVA 1UQYA 3G6MA 1OD7A 4LGSB 3TIDA 5J12B 2VISB 4KJWC 4M7LH 3SHSA 1E70M 3FO0L 5C0ND 1LHZA 3O81A 3PWLB 1NLDH 4U6XA 4DTGH 1MFEH 1S5IL 5CAYB 2DBLH 2DWEB 5HJ3A 4K7FA 5D7JC 3S88L 2E9IA 4OV6F 1VPOH 5DZOA 2F8XC 5GGUA 5MEQA 2UZIH 4JJ5A 3ZO0A 5L7XL 3PWPB 5D7JD 4JKMA 3U0TB 2XJ7A 2GK2A 2VR9A 5EBWA 3AMGA 2HTKC 2A0LD 5FECA 5ICYB 1AHWC 4O58H 1BWWA 1SY6H 4PGBA 5GHWL 1E27A 3CZFA 4Z7WB 4PYGA 2R2CA 3REVB 4MA8L 3JWDH 4ZUUA 4D9QD 1W9PA 3OKOB 4MDIA 4POZD 3VRLE 4G6FB 4UFHA 3IETA 1BP3B 2ZSWB 1K9TA 4C4KT 5F6HJ 1OIFA 3KJ4B 3NYDA 1C92A 4LPWA 1D5MB 4OLWL 1KIPB 4UDTB 3QO1B 4JFSA 3VXSB 1GORA 1NSNH 5F89A 2NXZB 2A3AA 1J8HA 1TZHB 4MAZA 4HOWA 1RUQL 5IB4B 2FJFA 4LFHG 1ISZA 1S9VB 3RBGA 5IGXH 1WBXA 2WVVA 2VXUL 3REVA 3QA3B 5I1IH 3E1F1 3DXAD 2X40A 4OCNC 4J4PA 3WHE0 1QBMH 1SM3H 2EDLA 2VCAA 2PF6A 3QPQD 3EMCA 4M6NL 5F6IC 5IBLC 2VLJA 3U4BH 2H9GA 5LQBL 1I1YA 3O6FA 3QZWB 5E00B 3EOAA 1FFOA 2CKBH 4G8GB 4M48H 1QI4A 3GTNA 4H41A 1MY7A 2DWEA 4JAMA 1Y7VA 4HBCL 3UJJL 3O2DH 4HLZG 5F3HA 1BGGA 4M7LT 5I1EL 3QHFH 3ZDYF 3CX5J 4NZTL 3IGAB 3OKEA 4OZFA 4XVTH 1ITXA 1LQSR 4J1UA 2VC9A 3QAZB 4LFHD 4OZFG 5E0FA 1BOGA 4E4PA 5DQDL 5DD0H 3I6KA 1ZBKA 1K4DB 1KCLA 2E7CA 3PP4L 4I0PD 3IGAA 4D3CH 4H8HA 3RM8A 3D3AA 3HMWH 5CEZE 5JMOC 2YBUA 2XPGB 4I8DA 1MCFA 3MMWA 3RP1A 3WE6B 1HKFA 3GO1H 3ZKQD 4ZUVA 1FHLA 1L6XA 1GGYA 2D3LA 3F7VA 2KKQA 1W9BM 4HWBH 2JIEA 1N6UA 3CHCA 2HP4A 4NQED 5DJDA 1FLRL 5E99H 2COQA 4FQIH 3TF7C 1NEZA 3VWKC 4KK5D 4NZDA 4NZRH 5TDPA 1QSZA 4FQXB 4P57A 2GDUA 1T1YB 1NFKA 2BVUA 1H3VA 4UQ3A 1DQJB 2X44D 3L7EA 3VFGL 3S36X 4KC3B 4BZ2H 4D0BA 3HMWL 3PQYB 3QCUL 5AYUL 4LCIH 2WZEA 4U1KA 3QDJB 3HNSH 1IGJB 1JGIA 1NBQA 2VLLA 3GIVA 3HG1A 5HGAA 1DQJA 1SY6A 3QO0B 4N5UA 4YHYB 1KCSH 1A1MA 2P8MA 4DWSC 1BZ9B 3P9WB 3OA5A 1TZIB 1BOYA 1FHDA 1NEZB 4DZBA 1U8PA 1BD2D 1MRFH 3AFLA 3SGEI 1KBBA 3FOMA 3VRLF 4EK7A 4BQ5A 3HNVL 4HZ6A 5GGTL 1KXQA 4BQ2A 1V8HA 2CLVB 4DGYL 3S4SA 5T1LD 2YD7A 5IR1B 5LCVL 4QRPE 25C8H 2ZX9A 3P30L 3HI6H 4I5BB 2WK2A 4WV1B 2NY6C 2BX5A 4EIGB 1S78D 5INCA 3N9GH 3V5HA 5JOPD 5LAXB 5T1LB 5A16A 1EEYB 1LO3H 4OTXL 1JGUL 1GW1A 1YMMB 3BKMH 1MCPL 3O2WL 4RWYH 2C1PB 4PGEB 2XFXB 1AGFA 5J1AB 3UTTE 5ACMA 3V5KA 1PQZA 5HGBA 4JAMB 1HILA 2DD8H 2XXCB 2M26A 1I3RA 1OGAE 3EOAB 2IXUA 4OD2B 1H0GA 1YNKH 5EBLB 4M93C 2BK8A 3CZJA 3QEUA 1YC7A 5D2LA 4XCNB 4MPKA 1MRCH 2B20A 4PY8I 3FMGL 5EZJA 3QCVL 4DQOH 2FBOJ 3HE7D 1OWWA 2AXFA 2VN7A 2OK0L 4PJ8A 4ZAKC 5DEZA 1CE6B 2IPTH 1P6AB 4YNYB 3FB7A 1I3UA 1CE1L 5GGVH 5E9AA 3DX7A 5HYEA 4X6DE 2J3SA 2AK1L 4KVCH 2XWJB 3QCUH 1G1CA 1IM9B 2BHUA 1IAIM 1R86A 2WWMD 1L0YA 3VXSA 5J6HB 4K2UH 1X5GA 2NNAA 4P99A 2V2TA 2XIBA 4MNQA 3QEGH 4JGJA 3BQUC 1XGQA 1WIUA 2FH6A 1EQPA 1Z6JT 3IFLH 3OKOA 4MDIB 1MRFL 3OHXB 1HIZA 2AGJL 4RGNB 2P5WD 2W60B 4LSQH 3O8XC 1EBAA 4YC2C 2P42B 3LRHA 2YD8A 5FYKE 1Q38A 1HWGB 5IROA 1OD0A 3FZUC 5I1JH 1ISYA 1A4JA 3V7MA 2GITB 1CDHA 1J1PL 3I6GB 4P5TB 4JJ5B 4OF3A 1M71B 1O7SA 3PNWB 3HC3L 5I1GL 2DLTA 1A14H 3ESVF 4NP4H 4LCCA 1W8NA 2UYLB 3EYSH 1U95A 1QVBA 5FYJE 4WCYH 3UP1A 4BM7A 1UWXH 4DKDC 5M95B 2DMBA 1ZA6A 3T0EE 2WW8A 2FX8L 4NKIH 2I25N 3KPTA 1RJYB 5HYIA 2SEBB 2IAMC 4EUPB 3NFNA 1HSAB 1JPTL 3L3OB 1ZGLM 5AAMA 4Z9KB 4U2ZA 4GUPB 3SDXE 4TVPE 5KANI 4CD4A 1W0VB 2DM3A 1DWHM 3O3EB 3O3AA 4NQEA 4YHLH 3T8XA 4WO4B 4MJIE 1JMZA 4ZFGH 5A2IH 1A02N 3F5LA 4XZBA 4FXKB 1E4XL 4CVUA 2XTJB 1TLKA 1CI5A 4WCYL 4L8BA 1OGSA 1UJ3C 4EXPX 2OSLB 4UBDD 5I73B 5MENE 4HS3B 1T2JA 2ERJB 2OK0H 4M82A 3Q5YA 4LCCC 1LE9B 2J6EA 4OLUH 1I7TB 4TX8A 3CFCL 3QFJE 4ISVA 4MNJA 1CIDA 1L9MA 5T1KA 3HG1D 1YEGH 3PL6A 1BBJB 3INUL 4UR9A 1QZ1A 4PRHB 4Y4FA 4IMKC 3SOBL 3MLRL 2FH8A 4J6RL 4LDOB 5LGJB 2E9LA 3PZNA 3HZMB 4KKAC 3GKWH 5EB8A 1X6NA 4R3SA 3VPLA 3RGVA 4DVRH 4V27A 2J25A 1JPGA 4PRBA 5E70A 3NFNB 4JM2A 2G2RA 2FIRT 1H41A 2BDNH 4R7NA 1HL9A 4NWUH 3IJSB 1Q6CA 1HIML 5IWLA 3GK8L 4OQTH 3KPOA 1WE5A 3AB0C 1EMTL 4KUZH 2EEDA 4A2LA 1KCRH 1I7UB 3REWB 1KEGH 4LCCB 2FJGA 4S11A 3G6JE 4WGWB 5TE4L 3SCMC 2AV7A 3WL9B 3OKYA 3FHQA 1GZPA 3PL6D 5C08B 1UKSA 1KEML 3S35L 1G01A 3QULB 2VN4A 4RGNE 2AJVH 4UQDA 4LLWB 4MAYA 1CYGA 1J0JA 1UWUA 4IDJL 4P5MA 5F70A 5IQ9B 2NY0C 4ONFH 4DM1A 2CH8A 3U46B 5ITFA 2A73B 4KQ3L 2FHFA 5GRVL 4RQQB 4RGNC 1UJTA 4CUCA 4MVBD 2BSRA 2ESCA 1KPUA 2P7TA 1NBYA 5EU7E 4DEPB 3RDTD 2DQUL 4G7VL 3CZKA 1B2WH 1JUFA 1JBJA 4Z0BH 1AFVH 5IWLC 4RGMC 1V5JA 1XCQA 2CDGB 5DYOA 4JPWH 1CBVL 5AG9A 1WAAF 3RUGF 2ZXDA 3HRZA 3TBTB 3OWEA 1YPZB 3PXHA 5D6CA 1T1XB 5CP7A 3L6FA 2YBTA 4FP8H 4MSWA 1SBSH 1ZTXL 5CD3B 4Z7UF 2E7HA 3BUYA 1E1EA 3WH9A 1W3JA 1TPXB 3SE9L 1J1XH 1QYGH 1U93A 3DXAB 4PJAB 3B9KB 1WP6A 32C2A 3ZDXE 4R5EA 5IB1A 3VDBA 4PMVA 4YXLL 3EAKA 4HUUB 3ZT6A 2FEDC 4YJZL 1IKFL 5KVGH 3HFMH 2GSJA 2BSSB 2DDXA 4AM0A 1HEZB 1C5DA 5GGTA 4RAVB 1CNVA 4HDIB 3KR3L 3P73A 2CPCA 2XA8H 5BXTA 2C3HA 1UACH 1MAKA 1GOMA 2MKWA 2D22A 1YPZE 4F58H 1I3RB 3WUFA 2NX5B 3S36L 4KTEH 1BQUA 2CIKA 3V6OE 1ZVHA 2Z8WC 4I3RL 4D2NA 2AEIT 3ARDA 1KGXA 1RSFA 1ZVSB 3B4NA 5DRWB 1HP5A 3ALXA 5I8EA 1OAZL 2E6PA 2YWYA 1Z9SA 4U1NB 3RVUC 4WHDA 3UYRL 1URLA 4NNYA 3EYUH 1QFWM 4OI7A 3WEOA 1R3KB 4HK0A 3L4XA 3PQYE 1AQMA 3KGRA 4JO4L 4MDOA 1FE8L 4EVNB 4A6YB 1CFQB 1Q9LA 4MQXD 1MFBL 2WYSA 2D7TL 4PB0L 2XWBA 4C7GA 1E6NA 2VE6A 4NCC1 2DLFH 4GQ9H 5ID1B 1PYWB 5F9OL 4BQ3A 5A2KH 4U1SB 1ADQL 2UZXB 3TV3L 1KTRL 2V9TA 1EAJA 4JFTA 3ILQD 1F00I 3WDQA 4NHCH 3C6LA 3WFEH 5FM5O 2D0GA 5KSVB 5FGRA 4YGVA 2X1PA 4G8EA 3FO2B 1U8PB 1LEGA 2P49B 4P2OC 1OAXL 2E27H 4TVPD 5T1DH 5HHXL 5L9DH 4JDZB 1MCDA 1BFNA 5E5MA 5EFDA 3RWDA 4R2GD 1ZV5A 5F7DB 4H8UA 2QSCL 2AV1B 4P2RA 4OZGB 5DQ9B 5TDOA 1QFHA 2A6JA 3QRFM 3AJ7A 2APXA 2NY2C 1AO7B 5KEZA 5MEND 1R3IL 4OUUA 1QNSA 5A6SA 5ITBL 1L0XA 4D9LL 5KVFH 3CSYB 5I6XC 5IEKB 5ELIA 4PBVC 4FQPA 1PZ5A 5FYJU 3H42H 5J9PA 4JPKH 1ZU8A 2CXKA 4M1DL 3O6AA 2Y7QB 1MCCA 2GJRA 2X4UA 3RGVD 5L8KB 3VO0A 3AHVA 4M81A 2I07B 4BF7A 4JFPB 5ESAB 3LKSA 5IM7A 4PJDB 3ARTA 2X4SA 2V3DA 2Y8KA 2GK1B 2F58L 5T3ZL 5A3HA 3IJYB 5C2BH 3CK0L 1U30A 1R3HA 1MNUH 4E9LA 3CFKA 4HIXL 4JDZA 1H5VA 5A8PA 2AK4D 4KQ3H 4AZBA 5CQ1A 4DK6A 4DCQB 3IRPX 4GO9A 1IEAB 3ARZA 1WEJH 1WZ1L 1QSFB 2BVOA 4QTHA 4XVSH 3U9UB 4I2XE 5L88H 3N1FC 4NJ9H 1HJVA 3MLYH 1Q6FA 1I3VA 3F7RA 1WPCA 1W1YA 4HZAA 1TVBA 2UUDH 5CGTA 2XPKA 4KRPC 5EU5A 1CK0H 1AE6H 3K2UL 3VINA 1YDPA 3GBEA 2X42A 4BFIA 4GKOA 4WUKH 4NQEE 4PJBA 5GS3A 1MW3A 5HYSA 1ZT1A 2A6JB 1B1YA 2AK4E 1RH9A 2ZJSL 1VFOA 3CXHK 3OB8A 4NQUA 1GHSA 5A6LA 5F6IB 1N7MH 4ODVL 4WJXA 1S7UB 4FLQA 3TBYA 1PKQA 4APQA 4PTTB 1FYTD 3MFFA 5E6IA 3CVHA 1VPOL 1CICD 2ARWA 4YFLF 3QWOB 1WVZA 4M5ZL 4NQXB 4QRUA 4AMCA 1HEZA 1P5VA 5JO5B 2DQGH 1OD9A 1X3DA 3SCMD 3O9WD 5EFIA 4Y19E 1E4XH 5T5NF 5DT7A 1WQVT 4FQXD 1JYVA 4TVUA 1EH9A 3VMOA 3V6FA 1MSPA 1OGGA 4LSTH 1XCWA 3UR7A 1WT5A 5JXEC 3FY1A 1G9ML 4QLRA 4UDUA 5FO9B 2NT0A 1NDGB 3RKDC 3BO8A 4MJIB 4XT1C 2VOTA 5GZOD 1B2WL 2R1XA 4ZG1A 4PRAB 3BP4A 4TRPH 3G9VA 3L6FB 3ARFC 3O8XB 4YC2B 4RMTA 3BZ4A 1XRVA 3GBDA 1CG9B 1PX8A 2XT1B 2QSVA 5EN2A 3GMMB 4XCCL 3S98A 1MHEA 1UR1A 1JWSB 3QFJB 2BNRE 4DQOL 5F1NB 3KNBA 3NCEB 1R5VB 3VM5A 1GPOL 2C4FT 4J3SA 3BOVA 3OR7A 2Z1KA 2YD6A 2X9XA 4HUKB 2NW3A 1OP3K 1NFDB 1KEGL 2AJXL 4HXBH 5JW4N 3WIJA 2IADB 4GQQA 3U4BL 4NQCB 1J05B 3HC4L 2X9YA 1BD2E 1CU4H 2VDRL 1NWUA 4D9QE 2R69H 3T04D 2DKMA 2G9HB 1MQ8A 4HQQL 5DMYA 5FYJH 2EZ0D 2P46B 4O58L 5T3XL 4JB9L 2GY5A 5DSCB 5C08E 2JJSC 4PGZA 2NXYB 5JDJA 1ZS8B 1OP5K 1C08B 1CD1B 4PLJC 3MUJA 4JREB 5EO1A 4J8RA 5FIEA 1I7ZB 1BBJA 3NCMA 3AUVA 4OM0L 1IEHA 3Q6FA 5I78A 3AROA 3VXOA 4NBZB 3LOWA 4PP1D 3ZTJH 1N5YH 5F7HA 1HH9A 4KKLD 4TTDC 1UKPA 1RZ7H 3OMZA 5DHVB 5I71C 2W0FB 4M43H 2EKSA 3MJ9L 3NGBB 4XBPB 4P4KA 2R4RH 1TIUA 4HMDA 4M1CD 4R2GB 4GPNA 1IGIH 1JHTB 1KTLB 3DVNB 3CDYA 4HGKC 4JN1L 4KDTC 3DX6A 4XWGH 5H2BB 2ADGB 4ONOA 3BPLC 3PBGA 3I3DA 4XCCH 5I3DA 5HHNB 3FO9B 3P77A 4ZNEA 3HI6L 4ZDHA 1EPFA 2ZIDA 4NWUL 3C6SB 4KROD 1I1CA 1U95B 2ATKA 4RMWA 5CEZL 1OT2A 2HVMA 3HE6A 5BCAA 3X14A 3PHOB 4MQ7B 1A9BB 1NM9A 3VIOA 2YSSB 3PDGA 1B3ZA 3MJ8B 3ROOB 4LSUH 3OZPA 1EHXA 3VVGA 1T1ZB 3U6RB 4TVPH 2AJXH 4F37K 3DV4A 3UC0L 4DGYH 2Y5TB 3HB3C 1NBZB 2GCYA 2PETA 3KPQB 2XKNB 4MA1B 3RIFK 3MR9A 3CX2A 1JJUA 2OCFD 2WINB 3GH5A 3MUZ1 1OTUD 1OARL 3QUZA 2AJ3B 1G7IB 3CCHB 4R2GC 1R5IA 3AXLB 3A47A 5KSBF 1K9EA 1X4YA 4K3JH 3WD2A 3SJVA 4K3EL 1PKQE 4P23A 4MNQB 4GAYA 3QNYB 3BKYH 3PV6B 1RZKL 3D25A 1UT9A 2LTQB 5JLZB 1UR8A 3QI9C 1IGYA 5E2TH 2JIXB 4DOHB 4OQTA 4XMKL 3QDMB 5GISH 1WZKA 1NGPH 5B38A 5DHVH 4QY8B 4JREC 3NH7H 5CLWA 4MS8D 3MCG1 5A8OA 3RVXD 4GO8A 2NYYD 3MJ7B 4HWBL 3WFDL 1DUYA 5D6DC 4AZGA 1JK8A 2L7JA 4L3CA 4O5LL 2VLKD 4JFDD 5JOEA 3TVMC 4B41A 3L3KA 2FX9L 5DT5A 2VX7A 3PWUA 4C4KO 5JW4Q 1HNYA 2WP3O 1RJLA 3LN4A 4JFFE 1CGTA 3GJFK 3EOBA 1V3HA 4NC0B 5I71B 2CRIA 1LO5B 3GNML 4P7OA 5KSAA 3F12A 4ENEC 1E4KA 3VIGA 4AMKL 3RWHB 1ZHKA 3SDXB 1JZ4A 3RX8A 3VFOB 3QUYA 5L0QB 4R0LB 4RMVA 4ZOCA 1B9ZA 1J11A 4IRJC 3WNKA 4W87A 4OZHE 4H8VA 4P2RD 3ROLB 1KLUA 4DWSB 4JFFA 4HWBA 1OCQA 1JTTA 4PJGB 5A16B 5T1LA 2BNJA 2QPUA 3V5HB 1IGCL 4J3OC 1CVSC 5FO9A 2NXZC 1BZQK 2YEZA 5EOTA 2GUYA 2WMHA 1OGAD 5D9OA 2VDML 3HNVH 4TTDD 4XHJC 4HPYL 4IOSD 2BVTA 4YEFA 2IQ9H 5T1MB 1A7PH 5ABFB 3IDNB 1ZE3C 3MGTA 3SUVA 4GZIA 3S88H 3L4UA 5C0BA 2G75A 3N12A 5JOPE 3WUBA 4KMQA 3K8KA 3WEZA 3EMZA 3KL3A 4LCWD 3FFDB 3GRWH 3N04A 1QRND 5BXFB 3QR2A 4IDLA 5CZVH 2DJUA 3W6MA 3WHE1 3NTCH 4GKNB 3U2SB 2NCMA 1DLHA 4OIFA 1J1OH 5J4MA 1UZ8B 4HPYH 3MLWH 4LSSH 2Z0BA 5EZOL 4GRWF 1A6TB 4CD6A 5HVGB 2D7PA 1WAWA 4Y4HB 1EHNA 1CICB 1BPLB 4GLRI 5DJ8A 3QUMB 1KCKA 1CXKA 3L7EB 1A4KB 4L3EB 2FO1A 2YRPA 1DVFC 3FTGB 5GISL 1ZK9A 5EU5B 1LL7A 1UR4A 3VXUD 5EMYA 5KZ6A 4MXWL 2JK5B 3LB6C 4XPAL 1LO3L 4FFYL 4KK5C 1MJJB 4GRMB 3BJ91 2KUTA 2BVOB 4QTHB 3PHAA 3D6GA 3V6OA 1Z9OA 1A3LH 4X4XB 4PJHB 4ACYA 3TYFA 2I24N 5E9DA 4KZDL 4QXTB 4HWZB 2VABA 2GVYA 1YA5A 3CVHL 4PRNB 3WDRA 3WKMH 4YK4B 1G7MB 3I50H 3VA6A 2D03H 2VRAA 1BLNA 1DWIM 4YE4H 2ZX6A 1F8TH 3NSNA 3G5XA 1XIWC 4Q7NA 4KJQC 4QHUB 1JCKA 1K8IA 3UO1L 2ED7A 2CKBB 5T3XE 3SKNB 3BAIA 4P2QB 4MDJB 4UBDC 2XOTA 5F3HB 3CFJB 5DWUL 5ISZA 4BCEA 3TNNA 1G7JB 1AXTL 4R0LC 4JHAL 2OLHA 2IJ0C 4J4PC 3BYYA 5B21A 2R1YA 2QQKH 3LY6A 4LNVA 2ED8A 2OZ4A 4RSVA 1BLNB 1SFSA 3OLDA 1U91A 4LSPL 5ALBH 3LVEA 4KKCC 5FK9A 2X6MA 4PRNA 3ARGB 4XUYA 2YIHA 2EXYD 1KULA 4G7YL 5JNYA 4U1MA 7CGTA 3KZSA 4M43L 2WBWB 4M1GL 2UWEB 4LK4A 2VVSA 1MCIA 2ZOKB 1ITBB 3PF2A 2GFTA 3GSUB 4Z0BL 2D7MA 1JG9A 5HDLA 4L4VA 5DMGC 4WU5A 4Z77A 3H9SD 2WKGA 1IE5A 3UDWC 1WZLA 1BVLB 3WO3B 4R0LA 1F6LL 4MLIA 3WIIH 3AM8C 4D9RD 4JHBA 2APBA 1TZ7A 2E6QA 3OJVC 2XWBB 5H8DA 5E9DB 4UV7H 1DBKL 4JY5H 2CGRH 2FIKA 4PMOA 4MAUH 3WLBB 4X4XA 5DJCA 1YY9C 5BVJB 4YHKH 3RNKB 2HN7A 4MHHG 4P49A 2FX7L 4ZOEA 5JDSB 4GRLD 4GQRA 2DBLL 2WUBH 3HMXH 5ENWA 4H7VA 2J8FA 1KIQA 3JV4A 1MFEL 1S5IH 1EMTH 3BLKA 5HHXH 4Y1AD 3D0VA 4Z7QF 4YAQA 1CDYA 1F58H 5LQBH 2H1PH 5GGTH 4OZIB 5CPSA 5I6XB 2XGBA 4LHUD 4KRLB 5KSBB 2N7BA 2BFGA 4U05A 5DC4B 5FFLA 2HVKB 1FH7A 3VIHA 2PW2A 4HWEL 4DM2A 3MRKB 4AZIA 4MD5A 3PZTA 3RIFF 3EJZD 4UDTA 4WFHE 1KIPA 3CLWA 4ZNEE 2FX7H 3VFMB 4NFBA 5C0AD 2H26A 2VX5A 1LEIB 1D5IH 1F2XK 1LDPH 3JUZA 3T4YA 4XXCC 3S6TA 1IJ9A 5EUOB 5LGKA 3TCLA 1C5BH 4BH8B 1T66C 5SX4I 3PZOA 5DO8A 3LQZB 3M46A 5ACZB 2PF0A 5DA0B 2R0WL 5FK9B 4F9LA 3B2UD 3NH7L 3LH2L 3CAFA 3ZSTA 4XGZB 5T3ZD 5I17A 4PLKD 3VG9B 3DVIA 4M7JL 1VESA 3VXSD 3CXHJ 2X4OB 3CH8A 3FRUA 4GMTH 1KQYA 1FFNB 1KT2A 3IU4L 3HPLB 4WHYH 1FORL 3PHOA 4JPVH 5ISZB 4PJBE 3K80A 1QFOA 3KG5A 3TTYA 1T1WA 4NJAL 4MDJA 3UPCA 4WEMB 5ANMB 4C56D 3BPCA 1GOQA 2W07A 3I50L 5HY9A 4BZYA 4D6EA 5IP4A 3B43A 3RPKA 3IDYC 4XCEA 5IG7A 3MV9B 4G6AD 1OINA 1XR8B 1HNGA 3RWHA 3SDXA 1RVFH 4X6EB 2VDQH 2GK0A 1N26A 3HNSL 3GI9L 5BZDA 5JIIA 4E8DA 2FYYB 4XCFH 2J8UE 3FT3B 4NZTH 4K94L 4P5KB 3NZHH 2AK4B 1CD8A 4OF7A 2JB5L 5HHOB 3L3KB 3CFDA 3DV6A 4I4WA 2YHGA 3SGKA 5MI0B 4F2MB 4JPWL 1CBVH 3TYFB 4X7CC 3OQ3B 4YHOL 2VDPL 4RA3A 3WFZA 4W4OA 3H9SA 4YX2H 3MJ7A 2XWTA 4QOKD 3TTSA 3T0BA 1XH0A 3UTSD 3KYNA 4NUJA 4ONGL 5FYKH 3QDMA 4JO3L 4R3SB 5C0EB 1G9NL 5K33A 5IFAL 2LAGB 4AIUA 5H35A 2X7LA 3QIBC 3TOPA 1EEZA 3ES6A 1NBZA 2GCYB 4KKBC 3SDYL 1FL5A 2J4WL 2DLGA 3BAXA 4QXGH 4K3GA 5KSBE 2RFXB 2HKFH 3RMEA 1WEJL 3BQUA 1FPTL 3RY4A 5C6PB 4X0KA 1KENH 4XPFH 3MXWH 5JBFA 1N7ML 3BT2L 4Q9QL 4JL2A 3WF3A 4PRIA 4WNQA 2VL5A 3C60C 1IT0A 4IRSD 4CMHB 4ACZA 5AG8A 1IV8A 1TA3B 2JELH 4X6BA 1AE6L 3K2UH 4KHTL 5D7IA 3QWRA 1I1FB 2C7FA 1CLOH 3BW9A 1T1ZA 3U6RA 3HCVA 3IDNA 4B7LA 3HAEG 3UAJC 4AD0A 2VC2H 1NCDL 3H9SE 3QQ9D 2DRUA 4JPKL 1B3XA 4GW4B 1MEXH 4N0CD 1BJ8A 4QGTA 3BX7C 1B3JA 5DEFB 1MHEB 2AEPL 2QSQA 3F7YA 5EU6B 2Q86A 4UTAL 3WJLA 5BZWB 4X7FC 3OZ9H 1NEUA 3P30H 2GYSA 2W62A 1MRCL 2IC2A 2X89D 5F1IB 5B39A 4UFJA 5JBEA 1G7LB 1FNAA 3X17A 2R1WB 4Z7VE 2WM0A 5IVZA 6A3HA 4LCWA 4G9FE 1UJ3A 3R4DA 3P3YA 5IV2A 4X6EA