4HMCA

Crystal structure of cold-adapted chitinase from moritella marina
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
528
structure length
528
Chain Sequence
GTITSQDDNVVVGYWHNWCDGRGYQGGNAPCVELKTVNPQYNVVNISFMKVYDIAEGRIPTFKLDPTIALSEAEFIAQIDTLNSQGRSVLIALGGADAHIELTRGDEDALAAEIIRLTDLYGFDGLDIDLEQAAITAKDNQFVIPAALKMVKEHYRKTGDNFMITMAPEFPYLTANGAYTPYLTELDGYYDFINPQFYNQGGDGLWIEGVGWIAQNNDALKEEFIYYIADSLINGTRNYHKIPHDKLVFGLPSNIDAAATGYIQDPQDLYKAFDRLKAQGQPLRGVMTWSVNWDMGTDAANNSYNQQFIKDYGNFIHNQLPPVTDMTPTLSGIVDTRVELDSHFDPLIGITAKDYQGNDITADVTVSGSVNTNQVGDYLLTYSVSSDDETTNQPRKITVYEILPAFTGITDTTVVIDSEFDPMQGVSASHPTQGDLTANITVTGEVDTNVVGVYELTYQLFYGQDNQQNMTDKRIVTVVTDAVSDDDWQVGSTYVKDDKVTHNGATWTAQWWTKGEEPGTTGEWGVWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a complete four-domain chitinase from Moritella marina, a marine psychrophilic bacterium
pubmed doi rcsb
source organism Vibrio marinus
molecule tags Hydrolase
molecule keywords Chitinase 60
total genus 167
structure length 528
sequence length 528
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2012-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
A PF16403 DUF5011 Domain of unknown function (DUF5011)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.20 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Carbohydrate-binding module superfamily 5/12 4hmcA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hmcA03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hmcA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4hmcA01
4OTXL 2AK4A 3D69B 3C5JA 4R8WL 1NARA 1BYAA 1DZBA 1BD2B 1GJIA 2QPSA 1TETL 2VH5H 1T1WA 1D6VH 4IS6B 2HKFL 5INCA 2H26B 2DQGH 1NCWL 4A2LA 4IIQA 4Y4KA 4N42A 3DMMD 1MLCA 2KQNA 1P4IH 3IXAB 1T3FA 4AEIH 5D2NE 4JRXB 3PG2A 4RL3A 1HN1A 3IYLW 2CEQA 1TCRA 3RTQB 3RU8L 1MI5D 2ATKB 2NTSP 3L6FA 1T2QL 4X5XB 2BERA 1QR1A 4ZS7H 3QFJD 2QPUA 1BVLB 1N7MH 4NQED 2ADJB 4W84A 3DUUB 4TUJA 5L6YL 5DMIH 4OI7A 1XGTB 2RQ8A 3GSXB 4PJBA 1MIML 2B7DT 2R0LL 4TNWF 5DJ2A 3QUMB 3S37X 4J6RL 5I1GL 1XYZA 2V3EA 4ACZB 3L3JB 3PWUA 3P77B 1YN6B 3ARWA 3BMVA 1GOIA 4R7DA 2WVTA 5HHPB 3L5XL 1PFCA 2GT9A 4EDWL 2EDFA 4F33B 4Q0XH 4OLUH 3WL9A 4K8RC 5EZOL 5BVPH 5JUEH 5F7LB 1HVQA 2XWTA 2WB5A 4RMWA 2A3EA 3BD3A 3ULVD 4M93C 4YK4C 1F45A 2VXTL 1DVFA 1MFAH 2YPLE 3WUWA 5JW3H 3C6LA 2PW1B 4Z9KB 1W2VA 5H37H 1CDUA 4RZCA 4M1GH 4Y8AA 3ULUF 1TJIL 4WFFE 4UFKA 3CMOH 4ISVB 5CD5D 5J56B 4Z8FH 5E0CA 4K94H 4K3JH 1BQHG 3S37L 2NLJA 3NFNA 2NY2B 2DICA 4S3KA 3ARFC 4RWYH 1M03A 4JZOB 5KTEH 1AVAA 1JGEB 3RY6C 2J7EA 3HR6A 3HZYB 5GRZA 3F58L 3NBNA 5HDQH 1NWSA 4KJPD 1ZL1A 1FNHA 3MFFB 3PGDB 3QDGD 5IKCB 4WFEE 12E8L 2VOTA 4BUGA 1HCFX 3GSOB 5K59F 4H7VA 1J8KA 4GG8A 1NQBA 4KKBD 5F88B 4ZS6C 4HDIB 1TFHA 4ZODA 3B8YA 1NFIB 5LCVH 4U1LB 3U7AA 5DUBA 1K8DA 1R8LA 2EPOA 3W37A 1WFTA 2HVKB 1KCSH 4BM7A 3O6FD 3OIHA 4E9LA 3FQNA 5C0CB 5EO0A 4OZIA 1PKQA 2VXUL 1D5ZB 4NKDA 4XPTH 5DJAB 5BRZE 1NANI 2VDQH 1RHFA 3OMZA 1NLDH 4F58H 1AHWA 4JPVH 5DMGC 5I8CB 3U0WH 2BVTA 4R4BA 3TZVA 4WHDA 1R3KA 3VFGL 4YHKH 2F8XC 1B6DA 3UYOD 1MPAH 2DF3A 4KHTL 3ARGD 2D7TH 4M8VA 2Y36H 1CQKA 4H1LG 3BESR 2GHWB 2J77A 4GI8A 3R8QA 2Z8VC 3QOKA 2BNRB 3U0WL 1UWIA 2AJVL 2AVGA 5A3HA 3H9SD 4HIJA 1X5YA 3GSVA 4PJFB 3WHE1 4NGHH 3IJ8A 3W38A 2APFA 4LHQB 1PKQB 3FRPA 3ZKND 3SCUA 3GJFB 1FO0A 2X4RB 4Z7WA 1UZ6F 4EDWH 5ICYB 2NT0A 2NW2A 1YEFH 2V6HA 1K3IA 4FQXA 5FOBB 1W32A 5I79A 4M6NH 4D71A 4G6JL 3VXMB 2AJSH 4Q74A 4I9WD 4EN3B 4CD6A 2VQ1A 3SUSA 1IC5H 2M8XA 4YHZL 2VDML 1GGYA 3C8HA 3LV3A 1P7QD 4WUUA 3SE8L 4FFZH 1Z9SA 2VH5L 1MWAH 5I18L 4RBPH 1FGNL 1PY4A 5E8NA 5AAWA 5EDXA 2HRLA 4OZGA 1HINL 2ZNWA 5BQ7B 2E9IA 1P5VA 2DKSA 4X9BA 2ARJA 4HK0A 4ZYKB 3RA7L 1E3ZA 1S8DB 2ZUMA 5KS9A 4W4NA 1FORH 4I0PC 4X99B 2YBRB 4NWTL 4I3RL 2LAGB 2LVEA 2W0LA 4OD2A 5IQ7L 3C6LD 4GAJL 2QADB 1K5NB 3MUGB 4EIZC 3AY4A 5DJYA 4ZXBC 3CZFB 5FGCB 2X1WL 3VRJA 2NY3C 4UAOB 4JFDD 2ESVB 3ARED 1I7RB 1S9XB 4JRYA 4LIQH 3UZQA 2CNCA 4W70A 3RWCA 3W6MA 1JWUA 1UYWH 4ACYA 3VW3L 3NA4A 5TPWH 2X89D 3QQ4A 1E6NA 1JV5A 4GKSA 3MMEB 2E7HA 4UIKL 1EX0A 3NA9L 4JO1L 5E2WH 2BHZA 4FF5A 2K1MA 4WCYH 3CVHL 4YAQB 3WO3B 2QQNL 1EHLH 4FS0A 4DKFH 5ADPH 5DLMH 1CL7H 1SY6L 2X44D 4YXLH 3ZT6A 4GO9A 3GRWL 3TNMB 1A14L 1WBYB 3GB7B 1HNYA 1C8PA 2IPKA 3ARVA 1QR1B 4GRLB 1XD0A 5KVEH 4MB1A 2AJZA 4P0DA 3PGFL 1MQRA 4TVPD 5KZ6A 1FJ1A 1RJYA 1LE5B 1NMBL 3KYNB 4JM2C 4ODVL 1RZKL 4R4ND 5FKPA 4M5ZH 1WZMA 2C3WA 2DDQH 4D0CA 3S9DB 4OZ4B 1RZJC 3BP4B 4OUUA 4MAUL 2D24A 1AGBB 1MCLA 1W0VB 3KYAA 5ALCL 4CVXA 1K6QL 1RULH 5I1AB 2GCYB 4L4VE 1AJ7L 4MNQB 5KZCD 4HGWB 4TULL 5IFHL 1DVFB 4UFHA 5B39G 3JWDC 1NOFA 1SJVA 3BDXA 5E5UB 4ZAKD 2WW8A 2AERT 3DJ9A 2AQ1A 2NY0C 3AXLB 2OR8A 3BPOB 3MLXH 4O2FA 1YNKH 1E4WH 1P6WA 1UXSB 2PCPB 4I2XB 1OVZA 1Q9OA 1E4XH 4L8CB 4XCFL 2ZUWA 1IAMA 4TTDD 2FATL 1LJYA 1JNJA 3HNTH 3WUBA 4ONHB 1FQ9C 3WJJA 2AI0H 3U0TA 4JGUA 3EYSH 1SEQL 2FGWL 2ZOKB 1NGXA 3EKCA 4PJGE 5ID0A 2CETA 5GGSY 3UG5A 3O0RH 1D9KC 1U8OB 3BQUC 4LSPL 2QQLL 2WSPA 5IW1B 1ED7A 3SPVA 1NCNA 2AMGA 4X9IA 1DSFL 1JWSA 5IGXL 1TETH 1LEGA 2AKRA 1P1ZB 4U0RC 3U83A 3BVNB 2QL1A 3BZDA 4RGND 1RURH 4P2YA 3WXVH 4Z2LA 3MOBL 4RWHA 3HI5L 2QHLA 1X5XA 4G6FD 1JPSH 1H3TA 1FVEA 2GFBB 5FYKD 4CVUA 1XGRA 4Y4KB 1MAKA 4M6ML 3DMMC 4YX2L 1CE1H 1LVEA 5JZ7D 5J11C 1MRCH 5JIIA 4LCWD 3QDJB 1VFMA 5JXAH 1ZLWK 5GS0H 3E8UL 1JNLH 2WVVA 3IFLH 4PTUB 1F6FB 3QXAB 3W9EA 1P2CA 4BQCA 2W9DL 5D1QC 5FYJH 3GSRA 4XTRD 4AIOA 4C7DA 1R7OA 4B3KA 1O7VA 4XXDB 3JZ7A 1NGPH 3X17A 2HKHL 2WWKO 1FYTA 4ZPTB 3ARBC 5AD0B 1LK3L 4G9FA 4M48H 3T1FB 3O4OB 5F1NB 1BTCA 1O7AA 2MCPL 4QF1B 1FOBA 3C2AH 2A6KB 1IAOA 4JIEA 2YRZA 3O9WC 2J4WH 2C3HA 4RGOL 1W9VA 1MHPL 4ZUUA 5TFSH 3CU7A 4NNPL 4WFED 1QO3A 2P24B 3CNKA 1B30A 5KEZA 3VXSE 3REVA 4DUWA 1B3ZA 5CMAB 1RJZB 2NZIA 3WF0A 1KB5L 1LWJA 5HHQA 4Y19E 5LJYH 4W86A 2OWXA 2EDNA 1NFDF 3BPNC 1JTOA 3ULUH 2EE9A 4HBCL 3TBSA 1JNNL 4P23A 4M7KL 4Y2DA 3O3BB 1D9KB 4LSPH 4M61B 4BK4A 5J9PB 1UWUA 4NI3A 4KI5C 4OZOA 2FJFB 1GGIH 4DW2H 4ODUA 4ZUSA 5GIRB 5I30L 5KVDH 1EJOH 3LPPA 1CF8L 1VEPA 1UQSB 2R1YA 4JFPB 3PZQA 2OJEA 3BN9C 2IADA 4HH9A 4OCWL 1N5YH 1MWOA 1GGBH 5D9PA 1I8LA 1ZANH 4O2CB 4D6CA 5CIPB 3WFBH 4D9QD 1CXHA 3LPGA 4U1NB 3W24A 1FA2A 1OB1B 4WY7H 1XIWA 2CIKB 3OKOB 3VWKD 2BFVL 3ULUC 3L1OH 5HPOA 2B1AH 1YHTA 5JR1L 1YY8A 5IFHH 4JFZH 1HJQA 2WKGA 1H3GA 1F6LL 4YGAB 3CH8A 1OARH 1IC4H 4XX6A 2XZQL 2E9WA 4P59H 3SE3C 5I19L 3C9NA 1F97A 1OM3L 4ZFOB 3W5NA 2AXJA 4WWKC 1QLFB 4M7KH 1YJDH 1W3JA 1G7MA 4KVNL 2XKNA 3UR7A 2ADIB 2Y9RT 4PJ7F 1TITA 2BVEA 4TUKH 2FJGA 3D39A 3WD1A 3U30B 1HHHB 1XEDA 4NO3A 1AIFB 5FM5M 3N04A 5BRQA 4LBEB 1BP3B 4NT6A 4GXUN 1JGDB 4A3YA 4XC3L 3TLRA 2GYSA 1QFWM 1JCKA 3CDFA 3MNVB 2AJYH 3LEXB 5HD8D 4HZAA 1KCUL 2ZKHL 3TNMA 2FLBT 3GBML 2CBIA 3ARBD 2Z92B 3LKOA 4JFDE 5GGVH 1SJHB 3R1GL 2JCCB 3EUUA 1IAII 1W0YT 3HE6B 4AIZB 4CKVX 3P2TA 4OFKA 4X6CF 4HA3A 4N0FA 5E70A 3QDME 1Q1JH 4NBXB 1DTUA 1J1PH 3WQ8A 1D5IL 4ONGH 1HQ4A 4GBXA 5EBMA 2YUXA 4WEBH 1RURL 3WXVL 5LQBL 2J8GA 4LEXL 5CP7A 5H94B 1HHKB 5MP6L 3BP7B 4IMLB 2AAVA 4F3FA 5LYRA 3SCPA 1Q0XH 3C6LC 3QEQA 3RP1A 2X4PB 5EORL 4GQPH 4K7PX 4HWZB 4DZ8A 3CVHH 1Z3GH 5A94A 2ZICA 5JDJA 2Y25A 4QXWA 4PJ5E 4ZE5A 2BNQB 4OZIE 2R4RH 5FL1A 5FKPB 4QXGH 4AT6B 4ODXA 3D3VE 2QMKA 3PL6C 1T1XA 4Z2IA 1E28A 2XICA 1OGTB 4WUKH 3MXVH 2WP3O 4HWUA 3NFNB 4ALAH 5I1AA 4J28A 4O2CA 3OKMB 2MPAL 3MJ9L 1VFOA 4ZUVB 2WLYA 1MUJA 4LU5L 4OZFB 3U4AA 1KTKE 4HFWB 4X4ME 2FD6L 3KYNA 5E2TL 1SEQH 2FGWH 2VDPL 2NY2C 4GMSL 5SWQB 2F54A 2VX4A 1G0XA 3HG1B 4MJIB 2XSAA 3MODH 2ZUXA 3FT4B 4WENB 1UZ6E 3GNOA 1XYFA 1QSFB 5L8KB 1X5HA 4DKAA 1AHWC 1V3KA 4M8QA 5A16B 1N64L 3X3GH 1BEYL 1YNLL 4RFNB 3TA9A 4Y4HB 1MCHA 5C09E 1EV2E 2IGFH 2E7BA 4TULH 4CN1A 2D7QA 3BZEB 3NCCB 1J9CT 1R3KB 5DJYB 5IOPB 1RU9H 2F5AL 1FV1A 3N50A 2R0WH 5F7WC 5IFJA 4HPOH 1H3VA 1RPQA 4F57L 2VXUH 2YBRA 1UJ3A 3MRMB 1RUPL 4FQXC 1HKLH 5DQDH 4JLRA 4QGTA 4J4PA 3T4YB 3CFCH 5BW7A 4HKJB 4LGXA 4CU7A 4JQVA 3N06B 3NABH 4PLNC 5EU6A 4MB3A 3QXDB 1V7MH 3SKMA 5FYKE 3F8UB 1E70M 2KZ1B 5SWSA 5D5MB 2O93L 5KS9B 2BOCA 1S7VB 3JV5A 1U6AH 1S7UA 3QEGH 4RDQF 3QXAA 4HK0B 4ZOAA 5DD3L 3W9EB 1T4KA 5HDQL 3T65B 3SJVB 4OZGF 5DC0A 4LOUC 3UJJH 2X41A 3QH3A 3O9NA 2HWZH 5E8NB 1CZ8L 1GRWA 2OL3A 4Z7WB 1CXKA 5ICYA 1MFVA 3NN8A 2W91A 2F5BH 5M95B 4Y5YC 4GO8A 5I2IA 1KG0A 3BCFA 3FAWA 3EO9H 4JVWA 4AZ7A 1KB5B 2F74B 1HHJA 2DQIL 5DT1L 4ZXBA 5DK0B 3KPQA 3AREC 2JB5H 4GKZB 5J8OA 4EUPA 2OS7A 4JREC 4LP4A 1F90L 4URIA 1E0OB 1DJSA 3TTQA 4JFTA 3Q1SH 5FOBA 1LQSR 2I9LA 3IKCB 5CZKA 5C0RL 1YC7A 2IANA 4HHAA 2NY0B 2QMJA 4FLOA 4W5UA 4POYA 4HLJA 4K3JL 2EH7L 4TSAH 5CPQA 5FIPA 2DM7A 1AD0A 2VLRA 3BT2H 5HYEA 5I8KH 5A69A 5IF0A 4J6RH 4JFHD 5I1GH 2F19L 4IOIB 4XC1L 2NY3B 4UAOC 1BOYA 4HIXH 3E6FB 3LSOA 3P73B 3UZEA 4HS3B 3WIIL 5EZOH 2IANB 4HHAB 1BVKB 4FFZL 2VSCA 3LN9A 3ZKXB 1HJUA 1C1EH 4WLCA 3L3OA 5KANI 1WJ3A 1ZS8B 5EO1A 3IANA 3VFRA 1NMAL 4JM2A 3Q2CA 4NQVA 1AR1D 4YHMH 1QI0A 1AQDB 4ZO9A 3UTQA 4FA8A 3J7HA 4U6HA 4FXKA 2JELH 5F6IB 3PZUA 3KS0H 5J11B 2I9TB 5D70H 4JFEE 4YHPA 2E7LC 1GOMA 3UTPD 3B6SA 3SDAD 1P5UA 3QI9B 3BAKA 2N56A 1PX8A 4XHJD 1BOGA 4D9RD 2KKQA 4EOWL 3SN6N 2XPGB 4P99A 5C0GB 1OOAA 1WTLA 4GMSH 3QPQC 3MO4A 4LNVA 3GJEA 3SO3B 1PSKH 3HS0B 4MVBD 3D5OF 4Y7MA 2R9HC 2X0YA 5HJ3B 2OYLA 2Y24A 5K59E 5HHPA 2ILLA 4EXKA 4NO0B 4UV7H 4X8JB 3QR3A 3O2DH 5HI3C 2HLAA 4I0KA 4JFPA 1FCCA 2DTML 1J0IA 2WNGA 3QO1A 5I78A 3WJJC 1R5VB 1H49A 3SCVA 5L8JB 1SHMA 5T1LA 1TMCB 1WDPA 4XWGL 3HLAA 3SUUA 3PWJA 3C87A 1AI1L 1C93A 3NSXA 5A6KA 5E94B 3LZFH 4PCTA 4JO3H 5DMJB 5TF1L 3SQOH 3NCEB 4KRPD 4OZIF 1G6VK 3BPNB 5E8OB 2W5FA 2XPKA 1LNUA 2XT1B 1WIPA 4WJXA 2XZCH 2VLME 4OLVL 3CFBB 4UTAH 3TV3L 3BAEL 4PN2A 2V9RA 3S37H 5DJCA 5KVFH 3ZT7A 3D25A 1JNDA 4XCYB 1QG3A 2WVSA 3D87B 1QNQA 1T1XB 1S46A 1RUML 3MLZL 4KV5E 2W92A 1OP5H 4NKOB 1L7IL 4U5KA 2OJZL 3S97C 2GKIA 4MAYD 1Y0LA 4KKCC 3TFKC 1EH9A 1IEBA 3EYOA 3FFCE 3ARBA 2ZP0T 4QRSA 3VX1A 4N90D 2ZUYA 4FQPA 3U48A 3VG0L 3VRLF 3OR6A 2CHOA 5JPMB 3PIQA 4DFHA 1XGQB 3DX8B 1NJ9A 1R5WA 1MHHB 4C58B 3AUVA 2D3LA 2QTEA 2GJ6D 4Q9CA 3OKYA 5IVXA 2ZUVA 3BX7C 1HKMA 1FVEB 2GFBA 5E5MA 4PUBL 4D6FA 4XPFH 5HI5C 5IVNA 2EDTA 5D1XC 2C3VA 4KKCD 3TFKD 4CADA 5E0QA 3ET9F 4P2RE 5EBLA 3CCHA 4AY0A 1L9MA 1LG2A 2B1AL 4APQB 3H3BC 4B53A 3DX6B 4P23C 1RIVL 3HPLB 1G6RA 5D7JD 5GS0C 1KF9B 3OJVC 3UO1H 4MAYB 1UQZA 3O6KL 1V3IA 3ZE0E 1E56A 3CAFA 4D9LL 5GHWL 2V7HB 3QCTH 4H1LB 2DD8L 4LSDA 2LU7A 3GEWB 3V5HB 1H5VA 1GZJA 5KG9B 3JSSA 1A7RH 4NZCA 2JKXA 4FXLA 2QJDA 5C09D 3MNVA 1BBJA 1NANH 1K8IB 3TGXA 3WIHH 5IT2H 3ZO9A 3GMLA 1EEZB 4GRLC 1G94A 4XVTH 2IPUG 2EDWA 3P9LA 2CKBH 1XIWC 3A6BH 3U1SL 1CICA 4X0VA 4O51B 3ECBA 4Y8DC 4U7SA 2GUOB 4P46A 4AENA 3EYQC 2A83B 3QIUB 3QUMH 4D8PB 3I84A 1ZLUH 3V4VL 5DD5L 3LEYH 4Z95H 4AH2A 4JZ5A 1IC4L 3SE3A 2NXYB 5K9KA 3RCNA 4ZFOL 1TTUA 3FHQA 2YLLA 4F3FB 1FE8L 4P3CL 1XCXA 2R1YB 3G6JF 3PWNA 1H3WM 3S3JA 1KULA 3UPCA 5GJSL 1XZ0B 2I5YH 4MVBC 1BFTA 2XTJD 1PG7X 1T5WB 2EBNA 5T3XE 3SUWA 5CSUA 3QDGE 5FO7A 1YN6A 3CDYA 1XV8A 1DBBL 5E2VL 3QEQE 2WCSA 3BAIA 2Z92A 3ZKMD 3BCDA 2WVUA 2WWMC 3AYSA 1HVXA 1HIML 4HWNA 3I85A 3PGCB 3VXMD 2O92A 4OLWL 5BS0E 4MNHB 1SM3H 4P4RB 5DVLA 4Z7QE 1FNGB 1MFEL 1MQKL 2R4SH 2YMXL 1KENH 5C2BH 3CVIL 2PXYD 4ZUWB 1ZHNB 4GW4A 4M7LH 1XF3A 3OZ9L 3TO4B 3RHWF 3GHEL 2XTLA 4GBXC 3BZ4A 5DRNA 3NIYA 4HWBA 5EUKB 1QEWB 4JFDB 2BVOA 1CFVL 4TX8A 4X4XB 1TMQA 1NH6A 4GUPB 1R24A 4KKBC 4LQFL 1FFPB 5TFSL 3WIFB 3N0PB 4LSUL 1JYNA 1F2XK 3EFDH 3PZNA 1C8YA 5E99L 2OP4L 2DQDH 4FG6C 3GJFK 4DVBA 1FC1A 1MRFH 4EVNA 2CBVA 2YPLB 3K46A 4FZ8H 4NPYB 2CBUA 4G6AC 3CPLB 4XB3A 1X5JA 3CFEB 2XG5A 2V2XB 4JEGB 1AC6A 1GGUA 3OJMB 4RE2A 2NY0D 3RDTD 4LVEA 2ZSVA 3H6JA 4MDIA 4X0NA 2Z8RA 1TQCC 2P8MB 4PRAB 3QDGB 1X4ZA 3DSFL 4O58H 5CZXC 3AIQA 1UJTA 1S7TA 4RGMC 3WXWH 3VGGA 4CNIB 3W0KA 2AK1H 5DI8A 4D3CH 2HRPL 4IOSD 1JRHL 3H9SA 2E9JA 3O3UN 1GW1A 4PCSA 1UADC 2F61A 1ZA3B 5DA0B 3WH7A 5BMFL 3MREB 3CPUA 2VN4A 5ALCH 1JZ8A 2CLRA 3BW9A 2PO6C 5KJRL 5IP4A 1JE6A 2WMPA 2BK8A 4MJIE 4PRDB 3APGA 1KPRB 2IPUK 3Q6GH 3L3IB 3PV6B 5HDLA 1EDGA 4Z5RB 4LDOB 4RAUB 3TIEB 3BPOC 3KXFA 2E3ZA 4PTVA 5FHAH 1ODZA 5KSBF 1U8LA 3INUL 4QRUA 4S1DD 1UJ3C 5DJ0B 1FH5H 4MCYB 1OAUH 4CUCA 2YRPA 5DUPL 4JKLA 2YN5A 5BW7C 2EEDA 1GAFL 5I0ZA 5BXTA 3UX9B 3MV9A 1UXSA 4JQVC 3VXTA 5J1AA 1JGVH 4EDXB 2G9HA 4WHYH 2IQ9H 5TDOB 3G6LA 1MCEA 5HGDB 2BFGA 3V52L 4PY8J 4UT7H 5EH1A 3HMXH 1UM5L 4KK5D 1MQ8A 4FQCL 3DSFH 4O58L 5KSUB 2NY2D 3BDYL 3VGAB 3ILQD 2P5WE 3D25B 4NO2A 4I77H 1Y0LB 1BIIA 3DMMB 1M53A 2GJRA 3WEXA 5DS8A 4PRPA 5I75B 4PJGB 4UDUB 1H3PL 1LDPH 1Z0MA 1UKOA 2G5BA 3W0WD 1FLRL 4HP5A 1LEIB 4L4VD 2Z91B 3GSQA 3RJYA 4UILH 5CJ8A 4UQCA 4YAQA 4G9FE 4Z2KA 3GGWA 5E8DL 5BXFA 1JPGB 5E2JA 5CSZA 4YR6A 5CFHA 5L2JB 2OMBA 1SYTA 4WTXA 4LKCB 2H6PA 1JWUB 2OSWA 5DLML 1BG4A 3O8XD 3KPNA 2F53A 4PJ9C 4BUHA 3GI9L 2N4IA 5F9AC 1B4JH 4Y19A 4LAJH 3VFGH 4P2RD 1J8HB 4MYWB 2NY6D 1PY9A 2IPTL 1C7TA 3GJFH 3OXRB 4PB0H 1R7AA 2YSSA 3SHSA 4YDLC 1T80A 2D0FA 3PIQB 1VFBB 1H0GA 4FXGA 3G08B 1QRKA 3THCA 3ZLQC 5DZLA 3H7LA 3L7FA 4S0SD 3RX5A 2PBOA 4PGCB 5JDSB 3UERA 1BQSA 5IK3B 4R90H 2BNUA 3KLSA 5DVMA 1AXSB 4R97C 4PBGA 2A6IB 5B3NA 5L0QC 2FYYB 1QW8A 2Q3AA 1M7DB 5LXGL 4P7LA 1IGYA 3L4VA 1MAMH 2R56L 2G3IA 4LIQL 4PTUA 4G8FB 4XNQB 3E0GA 5BRZA 3FFDA 1H3XA 1WB0A 1NFDE 5KSVB 1LD9B 3NTCH 1EEZA 2JALA 2P46B 4RX4D 1VEMA 3MRLB 3A0OA 4NRYA 3MJGX 2Z8WC 3LSOB 4DAGL 2HISA 1K4DA 3T4AA 2NXZD 1FNEA 3ROOB 2YD8A 4QFUA 4OFVA 3WN5C 1FAIL 2PYEA 1CGXA 4DTGL 4LRNL 4WHCA 1B3WA 5FKAB 3W0WB 4YX2H 3S98A 4PV9B 4HPGA 1NCUA 3U36B 1R5VA 1T20B 1BJ1H 1A4KB 2VR5A 4HKZA 5D8JH 3MOBH 5EPMB 3RWIA 3GZAA 2EDLA 5JLZA 1AFVL 5DDHB 3REWB 2VLJA 2Y07L 3MCG1 1ZLUK 5MEOA 1YEFL 2QSCH 4IEFB 1XR9B 4OD3L 2FB4H 3VXME 1U2HA 4FQIH 4XXCC 5FECB 3HCVA 5HI4C 4DGVL 4OQ1A 1NJ9B 1R5WB 1PKOA 1CG9A 3A4AA 4KQ3L 3U4EA 4HX1A 1T66C 3FTGB 5DUBB 1VDGA 3KYOB 2C3XA 4LLWA 4MA7L 1E4XI 5CHNA 4NF7A 3RWJA 2X2YA 1S7WB 3IDNB 4HIIB 1CDGA 5I24A 1E4WL 4POZD 4RAVA 2OJZH 3LIZL 4G43A 4WUUB 4NYLB 5I76A 1MNUL 1U3HD 2LE9A 3IGAB 2QSQA 2WWDA 1MIEL 3HE7A 4PGBA 2CERA 5T3XH 2GJZB 2VAAB 4WFGE 1RK0B 3VXMA 1RJYB 1LE5A 3O9WD 4JY6B 5D7IA 4XBPA 2J6EL 3IKKA 4PGZA 32C2B 5J3HC 3W11D 1CLZH 3L3HB 1MCPL 2DI7A 4DJMA 4PJFA 4C56A 1LO2H 3GB7A 3HB3C 4LEOA 1OD8A 5CBAB 4RMQA 2VKWA 4K9EH 5I1KL 5D1XA 4F7TA 1JHKH 2CQVA 3RVVD 5KW9H 2NY6B 4JREB 1GYAA 1S7XA 4K8RH 5C1MB 2GJ6B 1A6AB 4XT1C 4F33A 2KH2B 4NN7C 1NC4B 2HLFC 1WEJH 3FB6A 3O8XB 3L3KB 3WQ4A 1BJ8A 3EAKA 1X3DA 5BZDB 4ODSL 4WDIB 1BFVH 1U8JB 3DROA 2HYMA 4GXUM 4XX1E 3D85A 3BGFC 2HMIC 4LRIA 1SJEA 4ODHL 3AIWA 2QLVB 2VUOA 1IAKA 1ZV5A 3WSQL 2LVCA 4E42B 2WMJA 2BRRL 2IH1A 4QHUB 5D71L 4WI7A 4W4OC 4HLZH 5BVJA 1VKXA 3UP1A 4HA4A 1EFXD 4UFLA 2J8UA 3LN4A 1EPFA 2D9CA 2DYPD 3NCMA 3RIAK 5IMLB 2Y8VA 3ZIZA 2M26A 5DJXB 4TUKL 3IDXH 4OQTL 1AGDA 1KNOB 3GNRA 1H09A 4D0BB 4LLUA 1KWGA 3T0EC 4BH8B 4LPTA 3VXPA 1MCWM 2DI8A 3OKEB 4P2CG 3KLHC 4U6HB 3SKOB 3ZYJA 1NAML 3QIUD 4UV4L 3VIMA 1QSFE 2UY4A 3AXHA 4Y1AD 1A1MA 1K4CA 2G3JA 4KRNA 5C0IA 3W5MA 1S9VA 3P73A 3QUYD 2P5WD 1ZBKA 5F72S 1SY6A 4E41A 4AIXA 3MCLH 5E03A 2F53B 2E27H 1QACA 4HUVB 3QUMA 3JVGC 1CLVA 1GVIA 2H9GA 1HIZA 5D8JL 3O4LB 2AJSL 4MJ4A 1NGZB 1OQXA 4AIUA 3MV8D 4JHBA 4KMTH 4NM4H 5JOPE 1A1OB 2D1ZA 5CSZB 4YR6B 4K8RL 3QQ3B 3JWDL 5I74C 1QSFA 4OJYA 3GBLA 4JY5L 3VFUB 5CIPH 2HT4C 2E3VA 2NXYD 4K3DH 3N85H 3QCVL 4XVSL 2A6JA 2EDQA 5ECJE 3O2VL 1N8ZB 1K8DB 3GSQB 3TBVB 4PJHB 3KWWA 3FB5A 1J1XL 3SDAB 4OIAA 4QNPE 3AIBA 3QHTC 1MPAL 1KXTB 4E41E 2XKNB 1KB5A 1KN4L 2F74A 5J0BA 2P44B 4TOYL 4O5LL 4OJFH 1BFOB 3VXRB 2QKIA 2Q8BL 4RAVB 2ICWB 3G6JE 5I2UA 3WEOA 1BAFL 1LE9B 5A6AA 4J12A 1NGWA 1Q9WB 2WM0A 4LCYB 4Q6IB 5KSUA 3W28A 4NZJA 3U2SB 4WI8A 1IGJA 4G7VH 1R0AL 1HL9A 3WBDA 4M6OL 5D7LB 4UT9L 4B3LA 4L9LC 1PZ5B 5IWLC 5T33L 1OTUD 4GLRH 1ZA6A 3DTXB 1PBYA 4LSQL 3V6OC 5I19H 3GBEA 3VUPA 3NIDF 5ICXB 4L9DA 2YPVH 2ENYA 4UQEA 1RUAL 4JFZL 3HE6C 3HAEA 5FCZA 3DV6B 3LKSB 1NC2B 4IMKA 4X7FC 2DLHA 3U9UB 2FJFA 4KRMB 1N6VA 1QNOA 1KJVA 5EA0H 1NBQA 1RU9L 2F5AH 4N9GA 1JRHH 5M03A 4OSUL 4H2CA 5JMRA 2NTFA 3QYCA 1FSKB 4PMDA 3L3JA 5MENA 1KPRA 4XPBL 4KXZH 2PO6A 1MFAL 5JW3L 4KXZI 1U3HC 4L4OA 4FP8L 6A3HA 4PJCE 1IT0A 5I66A 5EWIL 4JZJB 5C6WH 3TNNA 2H6PB 3PZTA 4PR5B 4UU9A 4JANB 2TAAA 2VCAA 2G2RB 3U5YA 4LBEA 5GRUL 1YMMD 4JZJC 4QCIB 3VOCA 5D93C 1SJXA 2P5WB 1FP5A 3AIUA 5SX5H 2Y5TB 4JFXB 1GZPA 3TN0D 3ELAT 1RFDL 1HNFA 1F4WH 1GGTA 5A8OA 2R0LH 3K4DA 1KLUA 1I1AA 3KL0A 2BVYA 3O6FB 4PJDB 1NUNB 4NZTL 4KH2A 4XXDA 4JKPL 2D4DA 4PV8A 2MFNA 4Y5XB 1V08A 1DBKL 4NO5B 4JFFB 3MBEB 1XF1A 3E3QC 4U1HB 5IIEB 3AAZB 1ZGLP 2QV2A 2XV6B 4YHEA 1CBVL 1YNTA 3INUH 1HHGA 3QJHA 1OD9A 3TTYA 1I8IB 3T3PF 1ETZA 2HKHH 3BD5A 3TEUA 3IJSB 3RUGA 5LG1A 4P5TB 3KJ4B 5I8OH 1OW0C 1VGEH 2QHRH 4LLYA 1UEYA 2PB1A 2ED9A 3OLEA 2EIBA 3MXVL 1RUPH 2Y72A 2K7PA 4Y4HA 5GIRA 1IAIM 1VGEL 5BJTB 3S36X 5IBUB 1NCCH 3O81A 5DJ0A 2W1NA 4NQDE 4B7LA 5C0AD 4LYPA 4PJGF 3AS0A 5BOPA 4MJ2A 3EBVA 2ZG1A 3HMXA 4PMXA 5IBUG 5FB8B 2VC2H 1QFWI 5E00B 2X4QB 4ELME 5HHOA 4MZ2A 2NY5L 4CU6A 4PG2A 3VXUB 4ELKA 2OLHA 3V2AR 4WGWB 3MRPB 3FW6A 5IB1A 4W6YB 1T7VA 1A3RL 3ARFB 4MXVE 1JWSB 3QXUA 2PCPA 4I18C 2IBGA 3F7YA 4S1QL 3JTSB 5DMKA 5CEYA 1K9EA 3RM8A 1NAKH 1MRFL 1II4E 2WMKA 3GNMH 5E09A 1X5GA 5BWFA 1I9RL 1A3QA 5GZND 1OSEA 4YHNA 2IWGA 3LQZB 4M1CD 5MEND 1ND0B 3T2OA 3ROLB 1I7UA 2GTZB 4UDTB 4JFFE 1FL5B 2CDGA 3N9KA 3TBYB 5I8OL 2YDRA 4YGVB 3MV9B 3VXTB 4U1MB 1WDSA 4NQUA 4EAMA 2X4NA 3HZMB 3I6GA 3QG6A 2QHAA 3T1WA 4WW2B 3WD0A 3QHNA 1QRNA 5JBEA 1QSZA 1CXIA 3ZE1F 2HP4A 2LAAA 4CGTA 4D9LH 1T6VN 2PTVA 2YUVA 4JPKH 3LD8C 4AM0A 1C8QA 1JK8B 2I60H 3BIAX 3WNOA 1QQDB 4S2SB 1DDHB 5CLWA 3AZSA 4LAQL 1E6OH 2AXHA 5K9OA 5E6ID 1G7PB 2YBTA 5CWSB 3UTSA 2KUTA 1VIWA 5IJVA 5JW5A 3WN5A 1X5LA 3WNMA 1ZLVH 4FZEL 3C6SB 2IBBA 5DI8B 2Z31D 1R85A 1BGXL 3CD4A 1WZAA 1JZ6A 1ZT4B 3KNBA 2YPKB 5E9DD 4KKAC 2DH2A 4OCLC 3BPCB 2ZIDA 1RZGB 1UA6H 4L8SC 3WMCA 3N1FC 3ZM8A 4ZSOB 4JQXA 5DJZA 3ME0A 2IFFH 3TP4A 4LLMB 3I75A 1KJMB 4XGZA 1MFCH 8CGTA 1E4MM 1OIMA 1T5XB 2AEQL 2HT4D 1P69B 4QLRA 5D1ZA 4IDJH 3ZKSD 5GNXA 1JF5A 3ARBB 5DQ9B 4UNVA 3MLSL 3FB7A 4X7DC 3SCMC 4ZS6D 2GVYA 4PMYA 4PYGA 3KR3L 5I1IL 2YD5A 1KJ3H 1U30A 3SKOA 1T22A 2VR9A 4DM1A 2BNRE 4JL1A 4U2ZA 1RUKH 1LILA 4H25B 1RD6A 2WUBL 3RA7H 3W4RA 3LRSB 1AGDB 1KNOA 5FM4A 3VE0B 4HS8L 4ODHH 3BXNA 2DWEB 2KDGA 1D5BB 2AABH 2OL3L 1IEHA 4NCC2 4F37F 1CFSB 4V1DB 1Z9OA 1RSFA 2EXWC 4ZUWA 2JIXA 1VKXB 3UBXG 5D2NA 4PBVC 1ES0A 3RWDA 5IB3A 3BOVA 3TCLB 1E4LA 3FO9A 1TZHA 1H4PA 3RI5F 1EJOL 1FZMA 4OM1H 2J79A 3VO0A 2OSXA 2DAVA 3CZGA 5KBNC 4D0DA 1GCFA 1CI5A 2DJSA 2A77H 1NWRA 1BM3H 4N9GB 3QWQB 1GHFL 5I17B 1KJ2L 5D7KE 2I24N 5ESAB 3ARPA 5T3XD 4PD4K 4UQ3A 2BJML 1E6PA 2DDXA 3WN6A 2A6KA 1VFFA 3F7QA 4WO4A 4YWGH 5K9JH 4IOFC 4EKJA 2A0LC 1DBBH 2EIDA 5E2VH 3M8OH 3L9RA 2D49A 4IJ3B 3SQBA 1HNGA 3PUCA 1QBLH 4PJEB 5CILH 1E55A 4LRIC 4XRCB 1A3LL 5D4YA 1K85A 5C07E 4U1LA 5BS0D 3KS0J 1QBMH 1A6TB 5GISL 1ZLWH 3VIKA 1PDKA 2UZIL 2R2HA 3CXHJ 1UWQA 3W9DA 2V5CA 1NCAH 4YNYB 2DH3A 3KXFE 4O4YH 3B3IB 4P9MH 2X4UA 2FDBP 1PZ3A 2DLEA 3KPOB 5I76B 5IHUL 4HOXA 3QEHB 4KMQA 4J27A 2FGLA 3T0EA 5B3JF 1YEEH 4LDLB 3DWTA 3HRZB 3KYMB 4FQHA 4G7VL 2RB8A 4AYSA 4PD4J 2X9WA 3MFFA 2J88L 4KV5F 4P2OD 2BX5A 3ARDC 1TVBB 3IDMA 5TQ0L 2XZAL 4IM4A 4ENED 1FBIH 2ED8A 1CG9B 3EDEA 4XH2A 4KRUA 1FO0B 2XVKA 4PJHE 4OKDA 1GXEA 4KMLB 5FCUL 1U42A 3QUXB 1LL6A 4PG9A 1YEDA 4FQQB 3I6KB 5H35B 5IF0B 1R5IA 3SDDD 1EK3A 5D2LF 4X6CA 3HUJF 1NMBH 4ODVH 4KROC 1V6UA 1YEEL 5BVPL 2GY7B 2D20A 2R23B 4R4BB 1QBBA 1YY9D 3KYKL 4QRPE 3DUUA 2ZUNA 1CU4H 4JFSA 3O11B 1XH3A 5KVFL 2PWFA 5ANME 5C0AE 3U46B 3MLPA 2PYEB 4JHAH 4QRQA 2O9TA 2FEDC 3W25A 5TQ0H 5F96H 3JUGA 3QPQD 4JDTH 2CRZA 4WIWA 1ZHKA 2FWOB 5F93C 5H2BB 3W81A 3GSXA 2QQNH 1B3XA 4WSJA 4MJID 4P2QA 1A3LH 4HZ6A 3MJ7B 3RDTA 1RZFL 5HGAB 2EXYC 1EQPA 3STZA 4NRXA 4XBEL 3SDYH 1ZTXL 3AGVA 1TCRB 1ZT7B 1RHHB 3BO8B 4QAWA 3SJVA 3FO1B 4R0LC 1UD3A 2XPGA 4M02A 4BK5A 4ACPA 2MQCA 3HUJA 4OGYH 1ZHLA 3LN4B 4LSSH 5KW9L 1AO7D 3KPTA 1PZ2A 5GS0D 1IQDA 3MJ8A 1MLCB 2NLJB 1VAHA 5SWSB 3KPRA 1LG1A 1MCNA 4HT1H 5IMOA 3V6OA 4MNJA 3LIZH 3PHQB 3SE8H 1HK6A 4MHHI 3PJSA 1SJEB 5M17A 2JK5B 3U7WL 5IVOA 1B0IA 4HS6B 4OM1L 2R8SH 3T4YA 1ZS8A 2YD1A 4UINL 1T0PB 3WF1A 1I8KA 4HIHA 3KWXA 2V2TA 4PB9H 1KTDA 3NDYA 4FTVE 3H9HA 1ODAA 1GJUA 5D7SL 5F7NC 3ZHDA 2BVQB 2YBUA 4OD1H 3M6DA 3V4UL 2H32H 3UDWA 2HTLC 1TDQA 4ZXLA 2DQHH 3CC5A 4LLVB 4YO0A 3UEZA 3UTTE 3ILPB 1F4HA 3KNBB 2EYSB 5DHVB 4W89A 4X5WA 1ZVHA 3AM8A 1FFOB 2WBGA 3STLB 1XGTA 1OLZA 5LAXA 3FQUB 3WH6A 3KHQA 5C0CE 1ED3B 3WNNA 1A7QL 1MAJA 5E9AA 1O6IA 2X70B 3ALGA 2CR6A 1JPGA 3AMDA 1MJ8L 1W72A 1QRND 3SE4C 2NY1D 2R0ZH 4Y89A 3RTQA 4AG4L 4XNZC 1QLRB 3IETB 1VJSA 5C0GA 2F54B 4U4BA 4K8RD 3RY6A 2V2WA 3G5ZB 2DPEA 4Z7QF 1C8XA 3T3MF 2DRUA 4NM8H 3F6LA 5CSYA 1OY3B 1I1AC 3EO9L 2G60L 3R0NA 1JGIA 2DLFH 2G5RA 5HVHB 2B5IC 5EU3A 1L0XA 2HFEB 3K8MA 4EN3A 1W9UA 3QNZA 2GTWA 3LQAL 4PRHE 2AEQH 4C7GA 2VZVA 2VE6B 2WHKA 2OI9C 4L4VA 3A67L 3PNWB 3GKZA 4J2XA 1JPTL 1SMDA 2W9EH 3CLEL 1FRGL 4OFYA 1QOXA 2NPLX 1OW0A 4GT7A 4R26L 4JJ5A 4M1RA 5ETUB 1KGCD 1LMKA 1G9NC 2HT3C 1F4XL 2DN7A 1J86A 4GAYB 4OCNC 4R2GB 2AEPH 3BZFB 4RRPG 4Y4HC 4L4TD 3V6FB 1FO0L 1QSED 1UJ3B 2EO1A 3I3DA 3CZEA 1DUYB 2CLZA 2R0WL 1RVFL 5SX4H 2VDRH 4PRWA 2NW0A 4EBQH 2XRAL 4ODWB 4GRMA 4M1DH 2BV9A 1GONA 4BH7B 1RZ7L 2FBJH 5IB1B 1A0QH 4G7YL 2NT1A 4BKLA 3GI9H 4APQD 3SDCB 3HMCA 4ZNEA 1I7TA 1XGUB 3LS5L 1N64H 5T1KB 3VWJA 3X3GL 1ES0B 2VKXA 4PGDA 1U93A 2R39A 1CLOL 3TCLA 2ZX8A 4I18A 1ZSDB 4DOHE 5HHNB 3TWCH 3VFWA 3PGDA 3QG7L 1T7XA 1UM6H 2OTPA 4XP6L 1Z2KA 4HG4J 4DQOH 4O02L 3VDBA 1RK1A 2DWDA 2NY5C 4S1DC 4R5EA 4RMSA 5C86A 4EUPH 1OCQA 1K6AA 3N1MC 2YL9A 3L1OL 4U1MA 1IGYB 1E6OL 2P8MA 4HKBB 4I0PA 1N59A 2VRKA 1T22B 2BNQE 3C5ZC 3ARQA 3C60B 3WHXB 4JKPH 3CFEA 5CD3A 1BD2A 1CLCA 2V2XA 3GSNH 3G5VB 3AY4C 1M05B 3LQZA 5D2LA 5E6IA 1ZOXA 1U3JA 3RNQA 2YPLD 4YJZL 2GSIB 5DQ9A 5CPTA 2NYYD 2MSPA 4GRLD 3WNPA 1HSBB 1JD9A 4NO5A 4YDJA 1VFBA 1JGLH 3H3PH 1HHIB 3MRBA 4K71B 5E2UH 3JTSA 1T66D 3GBNH 1I1RA 2X40A 4UT7L 1QR4A 1PG7H 2OTUA 4J8RA 4JN1H 1DHKA 1CD9B 3MACL 1LF1A 3FZUD 4Y19B 2VI0A 4LHUA 5EU5B 4RQQB 4U49A 2F58H 3TBWB 3CK0L 5EUKA 1FH8A 1UA7A 3OA5A 1NM9A 2EXOA 1EHXA 5FB8A 2X7LA 4HKXB 1ZGLB 3P4MB 5L88H 1A4JA 5F1IB 3D48R 1U8MB 3BSZL 3QA3B 4AWEA 4P4RA 3P11L 4HJGB 4MD4A 3DUSA 4W68A 5CGYD 5DFVC 2VX5A 5IW6A 1KPUB 1DBKH 1B90A 1N26A 4QTIH 3FQXB 3AXXA 4LHUB 3HAEH 4PUEA 3RX8A 4OKVB 1DEEB 1UR8A 1FH5L 1FYTE 3MRCA 1BQHB 5F7UA 1U8PB 1YECH 3GBNL 1B6UA 3VXOB 2QEJA 5J6HA 4WHYG 5I9QB 2NNAA 1SVCP 1P7KA 1S9KC 1IAOB 1ZU8A 4W7VA 3I3EA 3MRIB 1GPOH 5T3ZE 4GSDL 2HKFH 5D1ZC 2PKDA 2XFXA 1DFBL 3EFDL 1D5MB 1WISA 5FUCC 1OM3H 4P5MA 1HQRB 5J1AB 1ACZA 4ZG1A 5J12C 5AYBA 1QI4A 1KGWA 1F4WL 3BH8A 4P46B 1VCAA 3IFNH 3EFFA 4MCYA 3MBEC 4KZDL 2VMFA 3L4YA 5F7MC 4U1JB 1OAKL 3PZMA 5CCKL 2NY4B 3BQUA 5AAMA 4PR5A 3TIEA 5DVNA 4LPWA 3GK8L 2VABA 1YQVH 3GMOB 4MMZC 4RE4A 5DVOA 1CL7I 3MLVL 1X5ZA 3VFSA 2OZ4A 1V7NL 4M82A 4HTYA 4JPIB 2J7FA 4N8CL 3CSYA 35C8H 3TVMC 2OTWB 1P1ZA 4XCFH 1F3RB 3JV4A 4UOZA 2NY1B 3C2SA 5DD5H 3S96B 1CD0A 5FDWB 3V0VB 3Q5TA 2RJMA 3A6BL 3U0TB 4K7FA 2ERJC 1NGXB 5ID0B 1CWVA 3PWVA 1FFOA 2QSVA 2VUYA 1MVYA 3AU1A 1MLBA 3IS0X 2R9HD 1F4YL 3RKDC 2R8SL 3HI1A 4D6HA 5DC9B 1I3RA 2XHYA 4K3GA 1KYOJ 5A8PA 4JO4H 2OSYA 4W81A 2ZX5A 2P49B 2ZXDA 2ESVD 5ADOL 4KWUA 1QA9B 1XGQA 3BKCH 3CZ8A 3WFDH 3S5LG 1G0YR 2DQEL 3H9YA 3OJ2C 5D1QD 3EHBD 1UR2A 2ITCB 5I1JH 2UVEA 1WCGA 2GFTA 2VIRA 3LN5B 4XPAL 3DO7A 3HC4H 1IEBB 4KTYA 5IMKA 5T5NG 1PLGL 4E41D 5JO5B 5FA3A 3PTMA 5B38A 3V5KB 4WHTA 1J0KA 1VESA 1NOUA 1WZLA 2OJEB 3MX0A 4HH9B 1U8NB 4JFDA 4HQQH 4KJWC 5DRNB 4HULB 1SBBA 1KC5L 4PRHD 4CW1A 2J8UB 2X1QA 2J74A 2Y06H 2FEDD 4NQXA 2WBJC 3WD5H 3O2LA 2V17L 1EQCA 3VG0H 3WIHA 5BRPA 2VDOH 3NZ8B 5D9NA 3LEVH 4YFLF 4KROD 1H15A 3NJ3A 4NIKB 1CR9H 3KL5A 4JM2F 1QFWH 3CMGA 5EBAA 4ODWA 1QSEE 4ORGB 5MEQA 2EIZA 1CBGA 4G6KH 4YFLI 3RL2A 5LA1A 4U3AA 5IQ7H 2WZHA 3O0RL 2CK0L 1NFDA 2P8LA 4CMHC 1WICA 3V6FA 3QAZB 1BREA 1NSNL 4YH6A 3E1F1 2VITB 3VRJB 1ECEA 2UV3A 4ESKA 1MQQA 4ZPTA 1P9MC 1SR0A 3QUXA 3KDMB 1YNKL 3CX5K 3FHAA 2A3CA 4LPVA 2WMGA 3RDTC 5D7LA 5F6IC 4YDKL 4XBGA 1LK2B 4FTVA 5TGBB 1AQHA 3GMPA 2ZXQA 1FVDB 1AKJD 3JUZA 4UNUA 2OR7A 4KUCF 5M3WA 3QG7H 3FNDA 1KFAH 4U1KA 4X80L 1IAKB 4Y5YB 3C5SA 3O6AA 1HOCB 1XGRB 1UB5B 3AHXA 5HYJA 4OD3H 1A9BA 2FIKB 1RK1B 2DWDB 3VFVA 3MV7B 3AROA 4UV7L 5KOMC 2AEIT 1E6RA 4N1EA 5HGHA 5D7LE 3IETA 4H20L 1K2DB 4MSWB 4ELMB 1IBGL 1JHTB 3TONA 1ZT1B 1W9DM 4I4WB 4YDLB 3W39A 1EFXA 1KJ2A 3VMPA 1CU4L 5DD6B 3UDWC 1QHOA 1OSPL 4PGJA 4MA1B 2EDJA 1AE6H 5LAXB 4ERSL 5E08H 1U2YA 1JF1B 1I9IL 3RWIB 4AMKH 1JDDA 1INEH 2Z31C 1QFPA 1ZWIB 1UKQA 3BRGC 3TJHC 4MA8L 1F90H 3GSNB 3AM8C 3MLZH 4GRMB 3UO1L 2JELL 4JJ5B 4GAJH 1QNPA 4ODSH 2CO7B 4NUJB 3JWDH 5SWSE 3RWGA 3GO1H 3HNVH 3L3HA 5MI0B 3O3AA 3H42H 4NQDD 1S9VB 1DLHA 2F5BL 3F5JA 1CE6A 3SE4A 2UYLB 4L9LB 1CPUA 3CHFA 4LKXB 1NAMB 5FHBH 3QHZL 4PRIA 1N6QH 2Z93B 1JGUH 4NQCA 3PL6A 4XCCL 3WY1A 4ZMAT 4R96A 5J57B 4YE4L 1MWAL 4K68A 3SCOA 2YD2A 3SQOL 1U6AL 1DE4A 1OP5K 2HFTA 3SKNA 2IAMA 1IC5L 4LVHC 2G60H 3MNZA 3VXPB 1OAYL 1IM9B 4L4VB 2C0HA 4GLRI 5EC1A 4XP5L 1INQA 5JIKA 1S3KL 3X12B 3VJ6A 4HA1A 1I1YA 4O4YL 4P9ML 2R1XA 1FC2D 1Q4NX 5DHYA 4KJYA 1RHHA 1BQLH 1T2JA 3RILA 1CGUA 4JZOA 5GS1A 3VVGA 5T3ZD 1W72B 3ZR6A 3OHXB 3WV0A 3C5ZB 5HDOA 1JN6B 1JXKA 5L8LB 1W9BM 4E42A 1EXUB 4KFZC 3D9AH 1AQ0A 4JFFD 3FQUA 1NFKA 4PY7A 3PTKA 3PP3K 2WC3A 3QIWD 2F19H 5JLZB 3MXWL 4R0LB 5FYKL 1G9HA 3DROB 3OGCA 5L9DL 2DL2A 1MHEA 3VXQA 4AZ6A 3SOBH 4GS7C 2Q8AH 4BZ1H 1BEYH 1Q9LA 1P4BH 1GHFH 1I1FA 1HXYA 1TQBC 1U8KA 1A6AA 3GUTB 1G01A 5CEZD 5DD1H 4YXLL 5IOPA 5T5FL 1S5HA 1BZ9A 1H2JA 3BZEA 2BCKA 2HJLA 1MAML 1V0MA 1AGFA 4JFOA 1DQMH 4J4PC 2HTKC 5ABFA 2JK5A 1J0ZA 4FQJH 4HWEH 3MMUA 5E1AA 2EH7H 3QQ9C 1MH5B 1K5NA 2YZ8A 4TSBH 3MROA 1L0QA 1FFQA 2XWBA 4IRSA 2J7BA 3IU3B 4L8DB 4U6XA 3LH2L 4OZIB 3L5JA 1G5AA 5TE4L 5IB5B 4L5FH 1LO5A 3MUJA 1QOKA 3LQAH 4JRXA 4F57H 1I1YB 2CBJA 4XVUC 4ONOA 1TPXB 5EBWA 3OAUL 4IOFD 1TQCB 4HFWA 4HH8A 5FYLH 1MCJA 3C5ZA 4OUOA 4G43B 1FORL 4Y5YA 4XWOD 5D9MA 1VPOH 1WQVT 5JHDD 2AXFB 4U3HA 5CUSL 5C07A 3RIAF 2Q87A 1QW9A 5C8JB 3MGAA 5DD3H 3L95A 5FHBL 1DQTA 2DSKA 3QRGL 2X4NB 3HZMA 3I6GB 1IV8A 3L5XH 4PJ5D 2PBGA 1QPXA 1K3ZA 5JW4R 5AYUH 3CMOL 3K8KA 4HK3N 2J75A 3L5WB 3BRDA 2VWEE 3D3VD 2CUIA 4P8VA 1F11B 1MLBB 2NY3D 3FOLB 4PJCA 1EIBA 4KQ3H 3KLHD 1JF1A 4UOW0 4H0IA 1AO7B 5TDNA 4GBXB 3VXRD 3ZYZA 5IHRA 4UIMA 1ZS2A 4JQIH 4PJ9D 4GRWH 5C6PB 5DO8A 4YBLB 4K7PH 1J18A 4WTZG 2SEBB 5FKAA 1JHTA 4GS7B 2I9LB 4R7DB 3ARTA 3GI8L 4QXGL 3U0PB 4KZDH 4H8VA 3VIPA 5ENWA 4KHTH 1M7IB 1NDMB 1ZB5A 2DQUL 3L4WA 3WUWG 1LDPL 4D6DA 2CDFB 3RFZC 3QEUB 1S5IH 1SYVA 3PHAA 2WSKA 3MLRL 3WMSA 1N7ML 4K3EL 5I1CL 4NO2B 2XQYK 4NT6B 3B5HA 1Y18B 1CYGA 5HVGB 2E7LA 3FFDB 5CQ1A 3QHZH 5DT7A 1LD9A 2V9TA 4LX4A 2PXYC 5E8EB 5F97E 2DIAA 5LCVL 4H25A 4NWUL 3QIBB 3VFMA 1A6WL 3HC0B 1JFQL 3AIVA 4EDXA 1ORQB 5HTSA 4UFJA 5BV7B 2EKJA 3NACH 3C9NB 3MNWA 4KZEH 4P5TA 3HRPA 4XMLH 5I71C 3M07A 2ZCKL 2EEXA 1NEZB 1KCUH 3KPMB 4OBSA 2VIRB 3EMZA 3MRQB 4PTMA 3C5JB 3HB3D 4EVNB 4TUOA 2A9NL 1HILB 2BVPB 2A3AA 5A6MA 1E6JL 1KQYA 1RZKC 1Y6KR 1NKOA 1KCRH 3MBEA 3IAPA 1NWUA 4JDVB 4ZFFA 5C9JB 1FZOA 3KXFD 1F3DJ 3D0LA 4MB5A 3M45A 1H3UA 4LF3A 3VA6A 4R9HA 1E0WA 3QDMB 5L7XL 1RZGA 2Z1KA 3R1GH 1A7PH 1J5OL 1GOWA 5HBFA 3CFJB 5T3ZH 3ARGA 3EOAA 4HMCA 5EFIB 5MP6H 5D5MF 3VXSB 1MY5A 3DHPA 3MRHA 4MNGB 2Y5TA 3QSKB 5TF0A 4JKKA 1LHZA 4E5XA 1J1PL 1HWGB 5D7LD 3KLAA 3P4NA 4AZIA 1PBGA 3O3BA 1FBIL 2D0HA 3D2UA 4EK7A 3VIJA 1ZGLA 4PFEA 5GSVB 2Y6SC 2IMNA 4CW1B 5A95A 4NO0D 4KRTA 3S5LB 5K9OB 3WFBL 5FO8A 2CGRL 4U1SB 1FLTX 5IFPA 4JG1H 1LK3H 3QUZA 3V5DA 1C16A 5GRVK 3TPKA 5I1HH 1DWGM 1A6ZA 2NY1C 4ZOBA 2K7QA 1FPTH 3FO2A 3GDBA 2YPVL 1FH7A 4PRNA 4NQDA 2XFFA 1NCAL 4Q7DA 1NC2A 3WXWL 3HR5A 4CBPA 2EPLX 4J1UB 5GRUH 4WY7L 5I8EA 4RMRA 5FA3B 1A2YA 3VFTB 4LCCB 5HPCA 5ESQA 2VB5A 1WIUA 4RFEA 4YHYC 3NCJL 1N3NA 2R69H 3BJ91 4P2QD 3QIUA 4D8PA 3UTSE 2FSEA 4X7SL 2VDOL 4C4KO 4D6EA 5E8EA 1J8HD 1W3KA 4LP5A 3VFNA 2UWFA 3QDJA 4X6BA 2YXMA 5HYQA 4DGIL 2R4SL 3BLKA 3SBWC 3ZOAA 3UTPE 1UD8A 2AW2A 4PJEF 1CT8A 5SX4I 2QKIB 4RGOH 1KOAA 1KTLB 2WBJA 5IROC 5IBTL 1HE7A 4MQXD 3TOPA 3BYYA 2G8ZA 3QFJB 4JGMA 4F2MB 1MWAA 3WDJA 2QQKL 35C8L 3GRWA 1YEKL 5T1KD 1M7IA 1NDMA 1RUAH 1NDGA 4DW2L 3IJHB 4J4PD 2ED7A 4R26H 5TE6L 2NX5A 4NKMA 2XVLA 3UBXA 4JG1L 4NNPH 1CGWA 1ZLSH 4FTVD 5KSBA 4Y2OA 3D5HA 3CZJA 4GSDH 2X0HA 3W29A 4X6DB 3DV6A 1AO7A 5TDNB 2WMFA 1AGEB 1IGIH 2A73B 1WIOA 1IFHH 4R4FL 5DJ8B 2G75B 2DSZA 1Q6EA 4EQ2A 4L4TB 4X98A 1P9MA 2AS5M 4O5LH 1G9NH 3TBYA 5GS3A 1TTGA 2R15A 3C8KA 4WW1B 5DZNA 2GTZA 4UDTA 3B43A 3ZE2F 4IDJL 1YYLL 2C4XA 3BPLB 4XZBA 4JY4A 3EJZC 3AHYA 5JPNA 4OCMC 4CMHB 4DZBB 2NNAB 1BIHA 1U8IA 4QRSB 5FYJE 1B1YA 1JF6A 3EO1A 3G6DL 5KANG 1ZGLM 4HIEA 3BPLC 4XNMB 3OZOA 1KIQA 5E4EB 1EHNA 4V2XA 4PRHB 2LFGA 1A3HA 4TVPE 1R24B 3PF2A 1C5DB 2DEPA 1IGIL 4F15B 2A9NH 2OZ4L 3VXUA 3FB5B 4TTDC 4LCIL 5FD0A 1AY1L 2BFVH 4NRRA 4JFXA 5MEPB 1KPUA 4BJLA 4ENEC 2CPCA 3OLIA 2I27N 2GITB 4BSJA 4GW4B 4Q9RH 3MUZ1 4N8VG 4XHJC 4QNPF 5HHNA 4L3EB 4NKMB 4KU1A 3VINA 1MJUL 3OR7A 3IDIA 1MCSA 3OAYH 5EU4A 3RKPA 1NGPL 1K9FA 3NIFF 4OZHF 1NGZA 4Y16D 2NXZB 2APWA 3VH8B 1QTYT 5ABEA 1IQWH 5F1OB 1OCWH 4UFMA 3T77A 3DXAD 3OJDB 3ULSA 3N11A 7FABH 4QRPB 4OCYH 3MLXL 4YDVA 3E8UH 4AQOA 2UY5A 1U3ZA 4HU8A 3L3KA 3FB6B 4KKNA 3FMGL 4OLWH 1XZ0A 2UWEE 2IF7A 4QTHA 1UH2A 1ADQH 1UWEL 3UXFA 3DXAB 3BWUC 3RAJL 4XUYA 4FMKA 4XMKL 5EZLA 4HUUA 5GPRA 3AB0C 4WI3A 1D5XA 4XNXH 4RFNC 4PJAF 5F70A 3O6FA 2J8UF 3MFGB 3EGSA 4GQQA 3MV9E 2IAMC 4NKOA 5IG7A 1UB6B 5GGUB 5JQHC 4LASL 5CEZL 4RGNE 4H8WL 4ZYKA 1GIGH 2O5XH 4M9OA 4Y4FD 5EOQL 3RUGF 3LZFL 3P11H 2VLKA 2NY4D 5GS1C 2HFEA 1Y18A 5DWUL 1C16B 1V02E 2F15A 1L8NA 1UR0A 3IF1A 5FF6B 4LPYA 3V4VH 4RBPK 2W59A 4PRPE 2EDHA 5L2KB 1CGVA 3Q3GA 3CFKB 4WCYL 3I2CH 2B39A 4EIGB 2V7HA 3PXJA 4F37K 5C0JA 5BCAA 1OGGA 2JCCF 5EOCJ 3AC0A 2MKLC 4M1DL 2X4RA 1Q0YL 3VFOA 3ZDZE 3RI5K 4IUGA 3QUKA 4EOWH 2GDUA 4ONHA 3FO0H 4QY8A 5TE4H 1MIEH 1UCBH 2JE8A 3VDHA 1DP0A 2VERN 1YPZA 5EULV 3F7RA 1KCVL 3ZYIA 2DLFL 4RIRA 3AFLA 4LF3B 1JG9A 1NKRA 1HEZA 3O4LE 4LARL 1SVZA 4IRSC 3QXWA 2ZUSA 3I50H 4DQOL 3FQTA 5EO0B 4M6NL 1CZ8H 5F3HA 3PZ9A 3WNLA 2W63A 4RAHA 2Z31B 4XPFL 4NRSA 5CLTA 2WNWA 3KPRE 2AJXH 3NIFE 4G8EA 2CKRA 4AG4H 3TYFB 4Z77B 1BFOA 2A3HA 4F9DA 3T0EB 2YR3A 1MW0A 1NMCB 5IKCA 3T8XA 2QR0A 2Y36L 4LLWB 4HF5L 5C8JA 1P7KB 1XCQA 5JBDA 4HV8B 1JWMA 2AJZB 1M6OA 4Y5VB 5DO2C 3D39E 2GJJA 3HCVB 4HS3A 2ZPKH 4UMGA 4GO6B 3QB7C 4N0UA 2K9UA 2H3NB 5DC4B 5FUZL 3RVTD 3REWA 3NCFB 1AFVH 2XWDA 5K93A 4P2QE 4JHZA 1NCDH 4LYQA 2ZWYA 2DQIH 3ILPA 5DT1H 3BJLA 1QLRA 4D6IA 3W26A 2VDRL 1AP2B 1UENA 2GT9B 4RIRB 2DLTA 3DECA 4NN7B 1W8NA 1G7QA 3ALFA 1JXJA 4NNYA 1X44A 1JZ2A 1N6QL 3ROOA 3IAQA 2XUCA 5A2IH 2EKSA 3FT3B 5SWZA 3DGGB 1UM4H 4HS6A 1MCOH 3T0DA 1GGCL 2DM4A 4U7KA 4ZXBB 3SCWA 2VDPH 1O0VA 4NQTA 4AZHA 4H88H 2D3NA 4NFDA 3GO1L 1L9NA 2VZSA 4QHNB 2XWJB 2W65A 3MUAA 1GNXA 4NZDA 1C08B 4JDVA 1MHEB 5FGCE 4MA8H 2V5RA 3VXQB 1O7SA 4YPJA 4ZFFB 4UB0L 5JOFA 5J13C 3VKKA 2JFEX 3RIKA 1HKLL 4JFQA 3IDMB 5D7IE 3F5WA 4XPGL 5BOZG 2PXYA 1CGYA 2AK4D 4OZGB 4OFPA 1EEYA 3VM7A 2Z4QB 3MRJB 5GRYA 1VACB 1CD1A 1RZJL 3QDMD 4E4PA 4FABH 1DE4B 4NN6B 4B9YA 1J87A 3IFOA 5ERWA 2R29L 5EFFA 4GJTB 4PGCA 4KHXL 2ZOLB 5JDSA 3PHOB 2F8VA 4OZHE 1TFVA 4HEPG 1CGSH 4PYHA 5HGBB 3N85L 3FL7A 1Q0XL 3WD4A 4ODXB 3VD4A 5A2AA 2D4FA 1MHCA 5GNZA 4Y4KD 3MBXH 2YUWA 4TUFA 2VXVL 2F54E 4FZEH 2YL6A 3M17A 3GM0A 1FDLL 1I7TB 1E6ZA 3TH2T 1SYSA 1OGBA 3QEUA 1IKFH 3OAYK 1HJXA 5EUOE 4KC3B 1DQML 2GI7A 2MHAA 3I2CL 5CP7B 5H94A 5KN5B 2VL5B 3DX9A 3AJ7A 3CUIA 1BQCA 3OG2A 5HDRA 1IVLA 3HZKA 1DQDH 4FNLH 2C1PA 3VCLB 2ZKHH 3HA0A 4C56B 4ERSH 4RWYL 4PPTA 1C91A 1HKIA 3QOMA 2AJ3B 3EDDA 1NBYA 2VLLA 4TNVF 6FABH 4X6CB 4Z7NF 3POCA 2IH3A 1WNOA 5I8KL 4N5ED 3CFKA 3T3PE 3WFEL 3NIGE 2E6JA 2JJTA 4QY8B 2D2OA 5ACMA 4F8QA 5ILTH 2FLRT 3QUZC 2ICEA 3OHXA 1GQIA 5AYQA 3CUPB 4JY6A 4QYOA 1KCSL 4U1JA 5MEPA 3MZGB 5J4MA 2VLKB 3HE7C 4K23L 3TCXA 2GTWB 4Y5XC 5HGBA 3P4OA 1FFRA 5D7IF 3GH7A 1N2RA 4CCEA 3H42L 2BRRH 3RM4A 1OAYH 4S1RL 2VWEC 3MU7A 5IG7B 1CDIA 5MI0C 4Z77A 4PJIB 3SKMB 1OGAE 3QZWA 5F9WB 3SDCD 4NQSA 5D5ME 1T89C 3L9RB 5CJQH 4OZFH 3EZ8A 3GMPB 5EZLB 4I3SL 4NJ9L 3MRIA 2ATPA 1BJ1J 2Q86B 3ZJ8A 1MCIA 5ESAA 4U1NA 2OQJA 2X70A 3PQYD 1RIUH 2QLYA 1KTRL 5J89A 3SBWA 5IFAL 3WJLC 2IG2H 4WSKA 4ZSOA 2MANA 3A3HA 4WFHE 4C56D 3VMOA 2G75A 5IROA 2PTTA 1QPPA 2DBLH 3OB0K 5GGTH 1QSVA 1V3JA 1UQSA 1RJLA 3P77A 4KVNH 1DWIM 3T77B 2B4CC 2EYTA 4QRRB 4KPHL 5A6BA 4HEME 4YBHA 5E1HB 3T2PA 3U36A 4JHOA 5IHBA 5T1MA 2WUBH 5CJOL 3QISA 2OYPA 2Y8KA 1PX4A 4QOKD 1YUHA 1IC7L 5HVHC 1GQKA 3UEQA 3VFOB 3L3DA 4Z7UA 5AWNH 5DRWA 1FNGA 2CCRA 1AP2A 1IGTB 5HVWA 3IU4H 1KEML 1BZQK 1EZVX 4W4OA 3JWOC 3JWNC 4ONFH 3STBA 5BROA 1L7TL 1MIMH 4MXVF 2J4WL 2PYFB 4ZSOE 1CK0L 1R6VA 3NZ8A 1B4RA 5GJTL 1U8NA 3BXWA 1KTLA 1UR1A 1AY1H 3UCRA 2BOBB 1G7IA 3KPSD 1GGBL 4P3CH 4HG4K 2YKKA 5ID1A 3O4LD 2AK4B 4XPHH 4Y1AB 1VB9A 4RNRA 1OGTA 3NOIA 1U8IB 4WKFA 4FFWC 2OWWA 4FQ2H 1H11A 1A64A 4U6VH 5D7JB 4G9FB 2XSBA 2D03H 1UB6A 3VWKA 3ZE2E 3ZQ9A 5AC5A 2CRYA 3KPRD 2MKWA 1BVNP 5F1SA 4TVPL 3QP3A 4R97B 1TZGH 7FABL 4UFIA 4WUKL 1HIMH 3PDOA 1EDQA 4HUUB 5FFLA 3BEWB 3VFPB 1NSNH 3EJYD 4Y1AA 4PSPA 1KSRA 2QQKH 4BZ2L 3DV4B 1ADQL 3KPLB 4QRQB 4K7FB 4GRWF 4HAGA 5B39A 2DM3A 3FB8A 2DB8A 4WF7A 4LRNH 1JRHI 4G6KL 2RTSA 5DMKB 3KPPA 1ZSDA 1I4FB 5C0NC 3BN9D 3KPSB 1XRVA 3WSUA 4L8SB 4LOUD 3B9VA 5GJSH 2UUDH 1F02I 2FO1A 2P45B 5IR1A 4F9PC 4U6VL 3BH4A 4RX4A 2HN7A 3SDCA 4HGMA 5IVXF 2B2XH 2YJQA 3V8OA 2V17H 3S7GA 2AJUL 1Q8MA 1FL6B 1G6RB 4E5XB 3MRRB 2W4XA 2W9DH 2IAMD 4B9ZA 3T2QA 2JB6B 5JXEC 1YJDC 4NHUB 4A6YB 1HXMB 2RR3A 5CGMA 3RWFB 1UVQA 4ATWA 3BZFA 1WC7A 3DARA 1LO3L 2EJ1A 1C5DA 2YZ1A 4Y88A 3BSGA 5GGSA 1YECL 5IWLA 2AGJL 3SKJH 4LLYB 5I73C 3DO7B 4ZTPH 3MLSH 4W5ZA 1X5KA 3P30L 4AY1A 1LO3H 4MAUH 2CGRH 2X4OA 1T7YA 5GNYA 1DFBH 3LY6A 3N1GC 3U1SH 4PJXB 5HY9B 1I9RH 4IMKC 3ECQA 2A38A 1LE9A 1KLGA 3DYOA 5GGUA 1R3JA 1XIWB 2CIKA 3OKOA 4UTBH 4OF6A 4PV8B 3V0AC 5TE6H 3VIGA 1A02N 2XFYA 1J88A 3ISWA 3RUGE 4LYRA 1YPZB 2CRMA 4U5IA 1KLUB 4HBQA 3HI5H 5K9QG 1KR0A 2ORBL 4YHNB 3ZJ6A 3SKUD 4NJ9H 4ELKB 3JV6B 3PWVB 4N0YL 3TJEL 3CBWA 5JHDE 2EE2A 5GZOD 1U3HA 2R2EA 5DZOA 4PJ7B 4QTIL 1H0DB 2N7AA 3FRUA 4KZEL 1ZBVA 1A7PL 1J5OH 1CLXA 1E4JA 4F9LC 5JXAL 4Y2DB 3BIKB 2EDEA 1FL3A 3QQNA 3FFCD 1C3FA 3V5DB 4MX7A 4P5KA 3U79A 1T83A 4JZJA 2FATH 5HHOE 4MLIA 4F2MA 2ZSVB 4PGEA 4MADA 2XQBH 4HSQA 2GJ6E 2WINB 1N5AB 5HYSB 2J78A 5T3ZL 1R3HA 3MYZA 5DUMH 2G41A 3PWJB 1OT2A 3DI3B 4FQCH 3V8CA 5T1LD 5EG6C 2W61A 3NH7H 2O5YL 4ZAKC 3V6BR 3V6ZB 4PJ5A 3CFDA 2HG5B 2W0FA 1AD9A 4YFDB 3L7EA 3GSNL 3TBTA 1HDMA 3FQRB 4AH2B 3UESA 3CXHK 4XX1G 1ZA6B 3DTXA 2GK1A 4OFYD 4YHIA 1RZIA 1QI5A 1S8DA 3GMRB 1HSBA 1BPLB 2JJSA 5HSFA 5CSGA 3S8WA 1EO8H 1JPFA 4JY4B 3QNXB 4QCIA 5FIEA 4AD0A 2BMKA 1XGPA 5H37G 4EBQL 3CVIH 1I3RB 2E5EA 2DM2A 3AOFA 2BP3A 1T03L 3SO5A 1BWMA 2OSLA 1JFHA 1MW1A 4YEEA 5I66B 4C54A 1FO0H 3UTQB 5A2LH 1QLEH 1WPCA 2R2BA 2DDQL 2AV7B 4ATDA 1DQLL 3IU3A 4L8DA 2CESA 4PSRA 4XB8A 2YUZA 3DIFB 3EW3B 4HOWA 5DJDA 4BH7A 3FN0L 1DLFL 5F1IA 2HRPH 1T5WA 3KEHA 3TNNB 1DBAH 3RWCB 3QDJE 3SJVD 4WU5A 1H5BA 1J1OL 2W0KA 1CDBA 2MCG1 4QRRA 2AEWA 3MBXL 2QQQA 4MD0B 4LSRL 3AMCA 1S78C 2XKSA 3BEVA 4S2SA 2NTFB 5JNYB 3F4VA 2KZWA 1JAEA 2VLRD 4X8JA 3RVXD 1W91A 4XV0A 4QOKE 5F7DB 5C0FA 1E71M 4TSCH 1LDSA 2XWEA 3FQNB 3VFNB 4EEEA 2EYRA 4WV1B 2NY6C 4G8GA 1PD6A 4XVSH 4GAYA 3LDBC 5F1KC 4FQ1H 4TTGA 3B9KB 3WD3A 1EAPA 5KTEL 3W27A 3UTTB 4MNQA 4P5MB 1T1ZA 4QHMB 5D7SH 4H26B 4NM4L 3KPSE 2Q8BH 3IAGC 4F66A 5JORA 4LLDA 4KY1L 2HT2D 4WUUD 2Q3ZA 1KBKA 1KLFA 3V5HA 2WC4A 2LU3A 5I5RA 1KV3A 3VU2A 3BKYL 3RGVA 1UACL 3D9AL 1CVRA 5C08A 1S7VA 4L1DA 3IDJA 1I3GH 1KYOK 1K6QH 1RULL 1TTFA 3P0YH 4L3CA 4YUEH 3SKNB 3MA9L 3QJFA 5FECA 4MNMA 1WDRA 3MRPA 2EZ0C 4LMQE 4OF3A 1DN0B 5C0BB 3B4NA 5IV2A 2XYCA 3SDXB 3FXYA 4ZO6A 4NC1C 1RMFH 2HFFB 4G6JH 3LKPA 4PUBH 1E1FA 1J8HE 2ERJB 3RRQA 4L8SA 2AJ3A 1KIPB 1ZAGA 4XTRC 4HPYH 4JQXC 3MZTA 3OKKB 3VCLA 2CDEB 3QO1B 4X5WB 3HFMH 4LDEB 3SDXA 5HHMB 2BCKB 2HJLB 2V3FA 3UYRL 3BD4A 2IQAA 5D71H 3SCMA 3KYKH 4U33A 3LKRA 1HZHH 4XI5C 3U4BH 1F3JA 12E8H 4K71C 1FZOB 1FHDA 1L7IH 2GSGB 1KGXA 5GJTH 5JPMA 1YY9C 3MRKB 1CFSA 3Q48A 4V1DA 1V3MA 4XPGH 3QO0A 1TVHB 2P5EA 5JMOC 1HJWA 3RJQB 1RUMH 1KXVC 4Y5XA 4LFHD 2Q7YB 3B6SB 1NLBL 3IFOB 1TXKA 5DJCB 1A1NA 4Q2ZB 3I50L 3LMJL 2H26A 4ZNCD 4BH8A 4GXPA 4YZFE 2RAMA 3EYQD 4IRZL 5D2NC 1AXSA 3FRPG 4HWEL 4FQJL 4U1SA 3TV3H 1RZFH 5IMMA 1EEYB 2E40A 4WNQB 3HUJB 1T89A 5CP3H 4GG6F 4M43L 4YPGA 2AXGB 1LO5B 4S3JA 1B0GA 1YNLH 2Z93A 2WCGA 4JHWH 1I9IH 4AMKL 3AISA 1DANT 3ZO0A 2W38A 4NRXB 3CUPA 4QYOB 1US3A 5BZWB 4CU8A 2P5EE 2J62A 3WJLA 3BN3B 3KGRA 3MODL 1SYVB 4AEIL 4KI1A 1H9VA 3EO0B 4NQCB 4WO4C 5MENB 1WGOA 4U7MA 5ENWB 5DJ6A 3TPUB 1MY7A 4LNRA 4K94C 3OB8A 4JFEA 4NZUL 5MEQB 4KVCL 1NGYB 1XR8B 3E6HB 4U05A 4X5LA 2WBKA 2O9OA 3SOBL 3M8OL 2ATPB 4GZJA 1E4KC 4MD5B 1DL7L 1A6VL 3BUYB 3U7WH 4G9FD 5DRZA 5LA2A 1NEZA 4KI5F 5KVGL 4MX7B 3ALXA 4ZPVB 2FH8A 3VNZA 3AVEA 3DXAE 3THDA 5F88A 2FB4L 3SO3C 1PZUB 1IMHC 4GKLA 1MJJA 2I07A 4PP1C 3DVIA 5D96C 4M7ZC 3S35L 4ALAL 4LSSL 4NO3B 1TJHL 1E28B 1U3HB 2R2EB 3JWOL 3HZYA 4OTXH 2R1XB 3QRFM 2XGBA 2XVGA 1FVDA 3QGVA 4HX1B 3MA7A 3ARDA 4G42A 1U8QA 2V5DA 1ZKAA 3FY1A 3V5KA 3STZB 3VWKC 3ULUD 2FZ3B 1EBPA 5C71A 1ISYA 2MQ3A 3ZT5A 2H1PH 2OR9L 4N1CA 3RVVC 3Q6GL 5EOTA 2J8FA 1INEL 4DGYH 1N8ZA 2X9YA 4F8XA 4MGXA 2LU4A 1VEOA 5DSCA 4P7RA 3OX8B 4OBRA 2BNRD 3ZL4H 3WL0A 1NFDB 1UWTA 4B7IA 1QBAA 3QI9D 1MJUH 2PR4L 4ZDHB 1XR9A 4LFHG 4IRJC 2VDKH 4LGRB 1RPKA 1BM3L 2EDXA 1SJHA 4F9PA 5DXWA 3L3IA 3G9AB 2UUDK 1QFWL 1N0XL 1ZWIA 3BEVB 4K9EL 3RZCC 3SDCC 1YEDB 2V3DA 4IPLA 4P5KB 1TCMA 4OLYH 4Q0XL 1KG0B 1GVYA 3MRRA 3AYRA 4TSCL 4NFCA 1NUDA 4NBYB 2PW2A 5GRWA 2DQFB 2XQYG 5IEKA 3OWEA 1KFWA 1YMHB 2FHCA 3NFPA 5HGHB 3DIFA 2CIIB 4WTWA 5JXEA 1C90A 4PREA 4M56A 2OL3H 4R0LA 4JAWA 1K4DB 4GXVH 3H3KA 3VE0A 3QWRD 3KYMA 3QT2A 2MCPH 1IGMH 4KRLB 5HHQB 3AHTA 5INCB 5D7KD 5LXGH 1NCBL 2XIBA 4AQ1B 2VZTA 3WLBA 4PJ7E 3RVUD 1IQDB 3MJ8B 3QXTA 3S36H 1ZHLB 4P9HL 2F8QA 5HY9A 1JPFB 1C1EL 4EI5D 4N68A 2JF6A 1YNTB 5JIPA 1AGCA 3CJJA 3LRSA 3RNKA 2R2HB 3MV11 1OB1A 3OLDA 4YHIB 4FQIL 1MFEH 1MQKH 2YMXH 3OXRA 5HGDA 5C2BL 4HPOL 4WJ5B 3DVNB 3V9FA 3ZJ7A 4HBCH 4KI5E 1XF2A 2D7OA 4NQEA 4H5SB 4UQ2A 3QEQB 5TQ2L 1OWRM 4NCDA 1XH1A 5HI5D 1TZIB 1EGJH 1QSEB 5ESVA 4TSAL 2NX5E 1KB5H 3VIFA 3MLVH 4RSVA 1DANU 1IE5A 4P7NA 2CLVB 5A16A 2IUZA 2E9LA 1CFTA 3DGCR 4MNKA 2P1YA 1G7HA 2XIDA 1MQPA 4YDVB 1J05A 1F6AB 4BFGA 5AY7A 4Z78B 4MNHA 3RTQC 3OB0H 1KQZA 1T83C 1GPOL 4OV6F 3RMEA 3BFOA 2VXQL 3AS3A 1H15B 4JFVA 2A6DB 4PREB 5BV7H 4DKEL 4OZFA 4QLLA 2ZCLH 1KJ3L 1SBSL 1XGYL 4L3EA 3HG1A 4BQ4A 1OQOA 3GXIA 4EN3C 2CD0A 2VAAA 3UPRA 5C0EA 2VDNL 3EOAB 5EFIA 1NGQH 5C0DB 1DWJM 2J7DA 3LHPL 1TA3A 1S7SB 1DWFM 4HJJH 1RUKL 4HUXB 4XAKD 4ZO7A 3DOSA 4TRPL 3OGRA 4NN5B 4M4PA 1IZJA 5FM8A 3R4DA 3AXLA 2YD3A 4XPAH 3CPLA 4B50A 3HNSL 3S34H 2CR3A 1HILA 1HSAA 3U4EB 5KS9F 4BQBA 2JJSC 5JUVA 3OPZH 2BSRB 3SDDA 1X6NA 3MNWB 5TDPB 3PN8A 2P43B 3BSZH 2WYSA 3RWGB 2FZ3A 4AIZA 2WUCL 2YC1B 1VSCA 2NR6C 43CAB 5EPMA 5E24E 1DQQA 1MJ7L 3ARDB 2DQJH 3BVNA 1CDYA 5C09B 3TBVA 2QADD 2NY5H 4LPXA 1H5BB 1Q94A 2Z8SA 3VWJC 3W39B 2J25A 4PMZA 5FUOH 1JFQH 2QQLH 3GYCA 3UBXB 3MQIA 1A1OA 2P5ED 1IJ9A 5AC4A 1H5BC 5ITFA 2AI0L 3ETBF 1D3CA 5E5RB 1V7NH 43CAA 1FP9A 2H9GB 1G7MB 3LQAC 2ARWA 1SFSA 2HN7B 1DBJL 4YXHL 3ZDXE 1QZ1A 3QIWC 4OAWB 1GOQA 2OSLB 3VWJD 3IDGA 1JK8A 4MDJA 4CN6A 4ZDHA 3NUKA 1I75A 2Q20A 4OF5A 1Q94B 4F7CA 5ECUA 1KXQE 2DQJL 2XZQH 5C2UB 5E6IC 4X9GA 1ZEAH 4IJ3C 1UWXK 3TPUA 4UQAA 4S0TD 4KK6D 3TIDB 3D18B 5JOPD 2G4FA 1UM6L 1RI8A 4DWHA 2YWYA 3V0WL 1MFNA 4LCCA 4XHQA 3FQWA 1UH3A 4HD9A 1ZANL 3ROLA 3MYJA 1AD9B 3GRWH 5EFDA 4J1UA 4YEFA 3BGMA 2WMIB 5DUPH 3TF7C 3WH9A 1U8QB 1P2CB 1VGKB 4XCNA 1EEQA 3QULB 3ES6B 1F4XH 1J0YA 4PJIE 3RGVC 5DTFA 3DBXA 5DEFA 3G5VA 5CD5C 2BDNH 1A6ZB 1BLNB 3AHZA 1KN2H 5FUOL 2W07A 4UUJA 3X13A 2F58L 4I0PB 5FDYA 3WQ6A 4JQIL 1CDHA 3EOTH 1AGEA 5IB5A 3VD5A 4A6YL 5CPSA 3P0VH 5HHVH 1UT9A 4PJXE 1W9PA 2VLLB 4R6UA 1IEAA 4MD4B 5B3JE 3KLAB 3P4NB 2WHLA 5I15H 1CFTB 1KEGL 1RZJH 1PGRB 5JW5B 4F58L 1A7OH 2BY2A 2VXQH 3MCKA 2IQAB 4L4TE 2OYMA 1OAQL 3B9DA 3IVKB 4E0RA 1PYWB 3JTTA 4TYUA 1VHPA 2ITDA 1A5FL 3QFDB 3OKKA 1HCVA 4LEOB 5JO5A 1GOFA 1IGFH 4ZTPL 1XF5A 5I8CA 3PHSA 1HHIA 5FA4A 5C9JA 3DX8A 5D1QB 2A83A 4RISL 5D7IB 2JIEA 5T33H 1LWHA 4R7NA 2J12B 2ESCA 4PYSA 2RGSA 1MXDA 2GW5A 4MTVA 1ONQB 5B4MD 2WZEA 3F58H 3AZTA 5K9KB 3V4UH 5FK9A 2ICWA 5I6SA 4HDIA 4X4YA 1NL0H 4HKBA 3NCYS 1W72L 5C08B 2AV1A 3FN3A 4OCXH 5GS2D 4P8XA 1UWGH 1JI2A 1YEKH 3WFCH 2ADFH 1HXJA 4JKMA 4UOW1 1N82A 1A7RL 3U7YL 4HFUL 2BNQD 4QO1A 3TVMA 3A4WA 3VXOA 3WLBB 4XCYA 1F3JB 1BF2A 1G6RL 3GXMA 2NZ9C 2BC4B 2YXFA 2R0ZL 3JV4B 1ZVYA 5KVGH 4J3TA 3QBTB 2OTWA 3UYPA 4KI5D 5MEOB 1BGGA 3KWWB 2GDVA 1RUQL 5F3HB 2BVUA 2RHEA 1W0WA 1MCRA 1AD0B 1WKYA 4D72A 2WC7A 4HPHA 2NX5D 3VFUA 4PUDA 1XCWA 3WLWD 3WL9B 3DETD 1XAUA 1KJVB 4PIRF 3Q0HA 1RVFH 1D5ZA 4NKDB 3CU1A 4IDLA 2NW3B 3S3SA 3CCHB 4HKXA 3KJ4C 4I13B 1L6XA 5CP3A 3V7MA 2P8PA 4CCDA 5BO1H 3PXHA 4JRWA 4ACZA 1E4KA 1BQLL 3RZCB 4G9DA 1IL1A 1F42A 3CSGA 5KN5A 5F44A 4AXNA 4NC2B 1FPTL 4RFEB 4K94L 1H41A 1BVLA 1AGBA 1W0VA 3NABL 4JFYA 4MLSA 4X7TB 3WSQH 4CVXB 2OK0L 3B83A 4PJ8C 2DT2A 1D5MA 3S88L 4NOBA 4NZUH 5I8EB 4PTXA 4G42B 2W0PA 3Q3GB 3GNPA 3L4XA 1J0HA 4K3HA 3AXIA 4ZQKA 1WVZA 3PHOA 3O6LL 2PYEE 4OCSL 3T65A 1FYTD 2GSIA 3LH2H 4ZD3H 1BAFH 5CJ5A 1MRCL 4OLUL 3QI9A 3UAJD 5IFAH 2B5IB 2IH1B 2VJXA 4QHUA 5EIQA 4XAKE 3EHBC 4TOYH 3MMWA 1DEEA 3QEHA 1HJSA 4LVNC 2DTSA 3ESUF 3UTTA 2BOBA 4JKWA 4P57A 2O5ZL 1G1CA 4LHUD 2PW1A 1GZPB 1B2WL 2VLJE 4DCQA 1GQLA 2CMRH 3S35H 4M8UA 1E5NA 1H8NA 1SQ2N 4C57C 1UG6A 4RCAA 5EMYA 1I7ZB 1MJJB 2I07B 3ARUA 5BVJB 3H2WA 2KBGA 5CG0A 2EDOA 5HGAA 1Q72L 3EGSB 1VF8A 5EOCH 1MCPH 3OF6A 4PB9L 4YBLC 4QGYA 1WTGT 3L3DB 5GRJH 3GH5A 4FFVD 4TQEH 3VRIA 4IRJA 4NJAH 3D85B 1WSST 2GQHA 1FIGH 3V6ZA 1DWAM 3QIBD 3DGGA 3QWRA 5K9QI