4HMCA

Crystal structure of cold-adapted chitinase from moritella marina
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
528
structure length
528
Chain Sequence
GTITSQDDNVVVGYWHNWCDGRGYQGGNAPCVELKTVNPQYNVVNISFMKVYDIAEGRIPTFKLDPTIALSEAEFIAQIDTLNSQGRSVLIALGGADAHIELTRGDEDALAAEIIRLTDLYGFDGLDIDLEQAAITAKDNQFVIPAALKMVKEHYRKTGDNFMITMAPEFPYLTANGAYTPYLTELDGYYDFINPQFYNQGGDGLWIEGVGWIAQNNDALKEEFIYYIADSLINGTRNYHKIPHDKLVFGLPSNIDAAATGYIQDPQDLYKAFDRLKAQGQPLRGVMTWSVNWDMGTDAANNSYNQQFIKDYGNFIHNQLPPVTDMTPTLSGIVDTRVELDSHFDPLIGITAKDYQGNDITADVTVSGSVNTNQVGDYLLTYSVSSDDETTNQPRKITVYEILPAFTGITDTTVVIDSEFDPMQGVSASHPTQGDLTANITVTGEVDTNVVGVYELTYQLFYGQDNQQNMTDKRIVTVVTDAVSDDDWQVGSTYVKDDKVTHNGATWTAQWWTKGEEPGTTGEWGVWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chitinase 60
publication title Structure of a complete four-domain chitinase from Moritella marina, a marine psychrophilic bacterium
pubmed doi rcsb
source organism Vibrio marinus
molecule tags Hydrolase
total genus 167
structure length 528
sequence length 528
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2012-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
A PF16403 DUF5011 Domain of unknown function (DUF5011)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.20 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Carbohydrate-binding module superfamily 5/12 4hmcA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hmcA03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hmcA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4hmcA01
1PDKA 3B5GA 3THCA 2Q8AL 3S2CA 3OA5A 3S9DB 5DK0A 3ZJ7A 3SE9L 1LGVA 4RIRA 3QIWA 5DS8A 4MNJA 4F7MA 3G6DL 4ZFZA 3LN9A 4EXKA 3ARYA 1QSEA 1YPZB 2ZUYA 3DHMA 2N4IA 2AK4B 3QB7C 2XG9A 3GIZL 4FQXB 3LMYA 2Y06L 1Y7VA 3D39A 2JF7A 1I9RL 3QOKA 1K85A 4MWFB 4CW1B 1QSVA 4GAJL 1KNOB 4PLNC 2C1PB 5F96H 2R2BA 3QIUC 1S78C 2NMSA 1JGUH 2AQ3A 2VDLL 2B2XL 5IOPB 3CUHA 1UWTA 1OD7A 1AGEB 1WQVT 4YGVB 3B6SA 4X0KA 2EECA 1GJIA 1P4LA 2DJ4A 3PQYB 1W9DM 4C57C 3JVGA 5T1KB 3GSVA 4M62L 3A67H 3VXRB 2LAAA 3RWFB 5JZ7C 1GGCH 5CEYB 3IDNA 4N9GB 3L3JA 1RFDL 2LVEA 4PY7A 5EO0A 2O61A 3OG6B 1WIUA 4I3GA 4I18B 1FBIH 4BQ8A 3W53A 3CH9A 2BNQA 1XGRA 2D4DA 4KJYA 4N5EC 1Q6GA 4OUEA 1MJ8L 3HC3H 4NWUH 1F5WA 2MQCA 5JPMA 4JVUA 3WMCA 1QD0A 5CKAA 4L4TE 3LEXB 1EHNA 1FJ1A 4QRSA 1RHHB 3RVTD 2CR6A 4CVZB 1DWJM 3I50L 3C60D 2AKRB 5INDB 4S2SA 3D18A 3DRQA 3ARFA 3KXFD 4DVBB 3GSNB 1J1PL 2APFA 4P2QD 4LCYB 2WZPD 4LCWB 2YBTA 3ZJ8A 4JFPB 3IKCB 2ZXBA 5I1JH 3TESA 1X1NA 5JHDE 2P47B 1BBDH 4PJ8D 1MLBA 1PVHA 3EOTH 3V4PL 3WKZA 1A6VL 1RHFA 3HB3C 1MWAB 3QJHA 1TJHH 2WQRA 3OIHA 1QRND 3IFOB 2I60L 2XTLA 5KSBB 1OTTC 2OBGA 3U0PB 1ISWA 1O7AA 3MBXL 5FUZH 1YJDH 2Q1EA 4PTVA 2GJXA 4XCCH 4M5ZL 3B2VL 4TVDA 2PYEB 1KLGB 2D0FA 3PWNA 2VX4A 2P8LB 4PJ9B 1LO4H 2H32A 2XZZA 4X80H 4F57L 2X4TA 3BAEH 3FO0H 2OM5A 3MACH 3TJHC 4W5ZA 3TONA 5FUOL 2OL3A 1I8IB 2WUBH 3IXTB 3HAEA 1MIEL 3MMDA 2Y07L 4NM8L 1QVBA 4RBPK 5K33A 1XR9B 1QHOA 3GI8L 1IQDA 4HGWA 1B3JA 3DMMC 2ZJSL 5JTWA 3VXSD 1NCAL 1RI8A 1D5XB 1J0YA 3PZQA 4S3JA 4JHZA 2OJZH 3CZJA 5LCVL 3AMGA 4NHUB 2C0HA 3R0NA 1NC4D 3PP4L 1GIGH 4LK4A 2ADIA 1YEDB 1MH5A 2CDEA 2VXQH 3PGFL 1KXQE 4RISL 5I75B 1JF1B 4M7KH 3SCMC 4OZGA 1FH7A 2BSTB 4Y4KA 2VXUL 3BE1L 2NY1B 5B39G 1FN4A 3EKCA 1E15A 1JMZA 5H37G 4LLVA 3ESUF 4OM1H 5IM7B 5JNYA 3UROR 1JPST 3JUGA 3CBWA 3MCLL 5I1AA 3RA7H 1JGLH 4ZTOL 1Y18B 3B43A 1YEFH 2XXMB 4S1QH 4S1DD 4OSUH 3LRGA 1ZA3A 4BZYA 4UBDD 5BRZB 3H0TA 1NBVH 2VE6B 1KG0A 4QLRA 1OP5K 4OLZH 1MCJA 2DQCH 3QIUD 1S78D 1UWEH 3H9SD 3F62A 2AK1H 4OLXH 1AQMA 2XXCB 4YXHH 1FP5A 4XXDA 1HL9A 3CFKA 1A4KB 2DQFB 2WAGA 1MHEA 3MLRH 3NIGE 4M43H 2WWKT 3DX9B 3FT3A 3QULB 4ZDHB 4GQQA 5D5MA 5D7IE 1XH3B 3O8XD 3X14A 4CKVX 1YY8B 5JZ7D 3UZQA 3C8HA 1K8IA 2CXGA 3PL6C 5JMRA 1DBKH 2X8RA 4MNGA 3X3GH 1Z9MA 5BZWB 5DLMH 5C07D 3TV3L 1SVZA 4ALAL 1ONQB 1YEGH 2VDNL 2WWCA 4OD3L 3G6JE 4DUWA 1ISYA 5KANI 4EXPX 4YHYC 2H1PL 4QXTA 2CPUA 2XQYK 4UU9A 3O4LD 1IAIL 3WFHB 1C7TA 4WJ5B 5M94B 4WGVB 5GNXA 1US3A 4PLOB 1NGPH 2NX5B 4U6XB 4L8CA 5CD5C 3I3BA 1DBJH 1YN6B 3SDDC 4PJGE 3EDDA 3HMXL 1R5IA 2QR0A 3F12A 2AJ3A 5JIIA 2Z8RA 4KRMB 3STBA 3LPFA 4MLSA 2PF0A 1QLFA 5T1MB 1QSFB 2NY7L 3MROA 3I6GA 1F6LL 3N04A 3HB3D 2EDBA 3TT1H 3CH1B 5EO1B 1H3WM 1QFWI 1A1OB 1KB5H 4DZBA 4AZCB 3NIGF 2BFVL 3QCVH 4L3CA 3TZVC 3AS1A 4WO4C 1PX4A 3GJEA 5D7IF 3MRDA 5BOPA 4CVXB 4JFQA 3OZOA 3UYPA 1W32A 1H5BB 5E99H 1AQKH 4NP4H 43CAB 1IMHC 4RMWA 1KEML 1W72A 5JUEL 2CBUA 4KQ4L 4U7SA 4OZFH 1BVNP 1FGNL 3GSXB 2PWHA 5D4YA 5ESQB 3DVIA 3MRLB 2AI0L 2XVPA 1RZ8B 2XQYG 3TJHD 1GH7A 2QQNL 4U3AA 1WWAX 1T03H 3L9RB 4GBXB 3G6JF 5D1QC 5IMOA 3GHEH 4BA0A 3GSRA 1UQSB 5I71B 5IW6B 3FONA 4PJXF 3DMMD 1GC1C 4G7VL 1AR1D 4JM4H 2ADGA 4JFXB 3L3HB 3TIDA 4JZJB 5CPSA 4WU7B 1DZBA 5ALBL 1MCSA 3ZE2E 3DSFH 1WBYB 1CFNA 5IEKA 5GISL 4U6TA 3TCXA 5FGCE 4XAKE 1CD1A 5FCZA 2Z35A 1KPVA 2ED8A 3SGKC 2XICA 1FYTE 1KFAH 2XSBA 3PZVA 4PJGF 3FT2A 1FC2D 3KPRE 2C3VB 3I75A 5DEZA 3DXAE 3L4WA 3D2UB 2EQDA 1HDMB 4G43B 3SCMD 3SDCB 4BYHA 5FK9B 4R5EA 1QSZA 5KEZA 5GRYA 7TAAA 4AL8H 5I66B 3SUVA 2V2WB 5DJ2A 4WW1A 1M1SA 3ZO9A 3ROLB 4KXZH 1QNOA 5GSVA 1R24B 4PTUB 4XWGL 4AEEA 2P42B 3VTRA 4N0UA 1KBGL 3SDXE 1S3KL 5I1HL 2DI9A 3QDGB 4AZ5A 1BQUA 5C0DA 5A8OA 5IGXH 2IJ0C 3GSWA 5DJAA 3U0WH 3TT3H 1KJ2B 4RFEB 4M6MH 3H6JA 3BI9X 5CSGA 4JB9L 5HHVL 2JCCE 1BJ1J 3S4SG 3CMOL 1MCWM 4OCWH 1MPAH 4JO3H 2ZCKH 4L3EB 1P9MC 4X4XB 3HE6A 1R3JA 4P7LA 3KYOB 2EDHA 4LHUD 4QEGA 3OLGA 3GMPA 4WHTB 1U30A 2AJVL 3REVA 4M1GH 1ZS2A 4JY5H 2V5DA 3UESA 3IETB 5IK3A 3RIAK 3WNPA 5CSZA 2VSDA 1FC1A 3PL6D 4QHNB 1NFIA 5C0GA 3DROA 3FRPG 1KXVC 4H20L 3FW6A 2HKFL 3BEWA 1I1AA 1UWXH 4R8WL 2WMIB 1ED3A 5D9NA 3BH8A 3AXIA 1O7VA 4ZS7H 4NQDD 2A38A 1ITCA 5GZNC 1GOMA 1KCSH 4CVUA 3A6OA 3FB5A 1QNQA 3RTQB 4KMLB 3LKQA 3P11L 4TSCL 3UZEA 2XYLA 4D8PB 1RJCA 5A8PA 1MJUH 5LA0A 1A7NH 4POZD 1NMCC 1QA9A 3MRHB 1BQLL 1L0QA 1UB5A 4Y5YB 4GI6A 5I78A 1A6ZB 4JRXA 5F7DA 5HI4C 2XT1B 5CD5D 3SDXF 5CP3A 4Z77A 5TDOB 1W0WB 2LV4A 1LP9B 1JN6B 1DL7H 1FZKA 3SDDD 3BYTA 3RVUD 4N5UA 3PXJA 2Y5TA 3WD1A 1ODAA 2NW2B 4GKSB 4KWUA 3G04B 2IQ9H 4MA8H 3M17B 4O4YL 3AZTA 2ZG3A 1U42A 2ZUVA 2OSYA 2WAHA 2AW2A 4XPFH 1RPKA 3ARBA 3QQ4A 2IFFL 5LXGL 5HGGS 5C09D 1W2PA 3P4LA 4OOZA 4E41D 2EPKX 4MQTB 4GLRI 4XCFH 5C0BE 4W6YB 5TQ0H 1TVHA 3VD3A 1TA3A 1AIFB 2V2TA 3WD4A 1JPTL 4B7LA 1ISZA 5FXCH 1HILB 4C4KO 4XMPL 1IGCL 1C7SA 3TZVD 4WO4D 3PWPE 3CU7A 4L5FL 5DJ6A 3ZLQC 1AFVH 1V05A 3MGOB 4N8VA 3AAZB 2VI0A 4ZOEA 5AEAA 4K3GA 3SKJL 5M03A 2VDKL 2BV9A 2IAMA 2YK1H 4JRYB 1GC1H 3IU4L 3Q1SL 4UQEA 1LDPH 5F3BB 1A0QL 3JV6A 1ZTXL 1CFVL 5INCB 4IDJH 4XMKL 3DO3A 3QHNA 5EIVA 3O6AA 5F44A 1DVFA 4OFIA 5AWNL 4ZUWB 7A3HA 3HZMA 3PJSA 4POYA 3SBWC 2XKNA 3MJ8A 3QWRA 1C91A 3UDWA 1UJTA 1MFBL 4U1NA 3GMNB 4P57A 3OGCA 3GHBH 5C0RL 5HYJB 4JHWL 1BZ7B 1MCRA 3CSGA 3WNNA 4JFDB 4QTIL 3V5HA 1JVKA 3HC4H 4OAWA 1M4KA 1PKQE 4C56A 4I0PA 4IM8A 3GYCA 4W8BA 4HIJA 2R8SL 5F6HI 4NNYB 1KC5L 2DB8A 3H3PH 2VQ1B 3OG2A 2Q3ZA 1LHZA 4XUYA 4FNLL 3A6CH 1FNEB 2FX7H 5EUOA 3T09A 3MXVH 3STZB 3WIJA 3MJ9A 1MJJA 1JF6A 5GGRB 4HXAL 2PO6B 1MREL 1RUQH 5F7FA 2YPVH 2FX9H 4LRNL 4ONFL 1NGYB 4OLVH 1I1WA 1AO7D 2JELH 4MDOA 4P23B 4FRWA 1SM3L 1GCFA 3E8UL 3TTSA 1SYSB 5CSUA 2DKSA 3WFEH 1YPZA 1HHKB 3AICA 2DN7A 2AK4A 4JZNA 3UC0H 4FQXA 1U8MB 2O9RA 3Q6GL 4JO2H 4ML4A 1WDPA 2BK8A 3MLVL 2PETA 5I79A 1VAHA 2HFFB 3GRWA 4HP5A 4MWFA 1CQKA 1FV1B 4CW1A 3HTLX 1KNOA 1UYWH 1S9YB 2C1PA 2PI6A 5JXAH 2E9MA 2ARWA 3U4BH 1MCOH 1EQCA 2DQTH 5IOPA 1U0QA 1WCBB 1AKJD 3K3QA 1IJ9A 1AGEA 1WPCA 1ZLWK 4D71A 2HMIC 4YGVA 5HDOA 4LSPH 1CZ8H 1T0NB 1UH4A 3PQYA 1N64L 4OCLC 5K59E 5BO1H 1F4YH 3ALWA 2DQIH 4P2YA 5T1KA 2F15A 3VXRA 1BYDA 5GRJH 3GMOB 3RWFA 5CEYA 4S10A 3UYRL 4OI7A 1Q1JL 3E1F1 3QQ3B 1TMQA 4N8PA 2CJUL 4N9GA 3L4TA 4KH2A 1TVBB 3ET9F 3QCTH 4BQ3A 5L2KD 4I18A 1BEYL 1K9TA 3WEMA 5BVPL 2EDNA 5IQ7L 5C0NC 1QACA 1LE5B 4OCRL 1T89C 3WEOA 1P69B 3WJJA 1JJUA 3S37X 1A9BB 3LEXA 1H0GA 4XRCB 5L7XH 2W92A 1RHHA 2FEEI 4CVZA 1TTUA 3P40A 4DGYL 4Y4HC 3ZKNC 1V0MA 2AKRA 1U33A 1U6AL 1T0MB 3IU3B 5INDA 4S1RL 5IFHL 1FVDB 1CGXA 4DVBA 1G9MC 4YXLL 4FFYL 2DIEA 1UZ8B 3GSNA 5ESAB 3NCJH 2F74B 4LCYA 4JJ5B 3MLZL 4LCWA 4JVWA 4JFPA 1QW9A 1JK8A 1CGSL 3VWKC 4HJGB 2BNUB 1U36A 5DD0L 2EDQA 1K9DA 4PUEA 3I2CL 1UJ3C 5HVHC 1MWAA 2J8UB 4CN6A 3BPCB 3WFBH 2WBGA 5EFFA 5EORH 1BFOB 1P7QD 3VH8B 3IFOA 5JHDB 5H37H 5KSBA 3U0PA 1SVCP 3FAWA 3W25A 2ZOKB 1YEKH 5K59F 3SUTA 5ESVB 1MI5E 3DPBA 4K2UL 3CSBA 3QOMA 2OR9L 2PYEA 1KLGA 2JJTC 1RU9L 2P8LA 4PJ9A 3ISWA 1FAKT 1JGVH 2CLVB 3QUZD 3KJ4C 5A8MA 4B50A 4X7CC 1A64A 1MCNA 3HNVL 5JHLL 1OAUH 1I8IA 2BS9A 4RBPH 1JNEA 5D1XB 3IXTA 3U79A 1T1WB 2ICWB 3IDMB 1XR9A 2UVFA 1VFAB 5F88B 5IEHB 4P7OA 2MPAH 5CINH 2EDWA 4WTWA 1X5ZA 3O3EB 3ZL4L 5KVGL 1D5XA 3NCMA 3WFDH 4PRWA 1JFQH 1FO0B 1SY6A 2JFEX 5HDLA 4NHUA 4WU5B 1FAIH 4IPLA 4PG2A 3W0WD 1R86A 1YEDA 4LU5L 1CWYA 2Q8BL 2LTQB 3NTCL 2E7LC 3DIFB 1AMYA 1U8IB 1JF1A 1Z3GL 3FN3A 3QHFL 4XZUB 5FYLD 3RPMA 2BSTA 1IT0A 3SE4C 1JV5B 2GY7B 5CILH 4GRLC 4XP9H 3K74B 4ZD3H 4C4KT 4J3UA 4O5LH 4W93A 3OJ2C 5IM7A 5GSRB 4O58L 4ELME 1U58B 3MLUL 4HIXL 1Y18A 4A3HA 1GUVA 5ACMA 4GW4B 2R56H 3CUPB 4EN3C 3OGVA 5IROC 3S88H 5I30H 3SCQA 5BRZA 2VE6A 5J1AB 3BQUB 3U4EB 3WCYA 1I8MB 4RMUA 4Z7UB 3GBMH 3VW3H 1M03A 5BV7L 2B31A 3U9UB 3S5LB 3LVEA 4GAFB 1A4KA 4WW2F 2VABB 2DQFA 2GKIA 3TWCH 1E4JA 4G8FA 3DX9A 1FFNB 2NW3A 3QULA 4XPTL 1S7QB 4ZDHA 1JNJA 4KZDL 1XH3A 3UAJC 3WNOA 4D1IA 3PUCA 1FCGA 1U8PB 2QSTA 2VLJD 4LLQB 3APGA 1YY8A 3LN4B 2NPLX 4W89A 2EC9U 4FA8A 2YN3A 2EDXA 1G7PB 3BP7B 4NOBA 4ORGB 1VJZA 1AD0B 4JKMA 4EI5C 5BZWA 2QHRH 4YC2B 1ONQA 3B9DA 3Q0HA 4WGWB 5D7IB 5DFVC 3S36H 3QCUL 3FHAA 4S11A 1R8LA 4IRJB 4YBLB 4PJ5D 5D7SH 1ZLSL 1J86A 3FY1A 3DECA 4HPHA 5DMJB 5HY9B 5IBLC 4M80A 1HOCB 1AHWB 4PFEA 3WFHA 4PJCE 4ODTL 43C9B 3ARVA 1G9MH 4LL9A 4WJ5A 5JR1H 4XP5H 4JG1H 3ZKXC 2NX5A 4Y4HD 5EO9B 1X6NA 1A1NB 3RWHB 1YN6A 5TE4H 3T2NL 1KJ3H 2I5YH 3PXHA 4R4FH 4ELMF 1NMAL 1PZUB 4H41A 3DO7B 3OZPA 2D0HA 1XCQA 5A2IH 4JFHD 3O81A 1OTUC 2DQJL 1LO3L 3SCTA 2Q87A 1RZFH 5T1MA 1E55A 1OM3L 1MQKL 1QSFA 4PJGB 2EICA 3CH1A 5EO1A 1D5MB 1Q4NX 5JORB 3PTKA 4AZCA 3H9ZA 4M56A 5MENE 3SCOA 2AEQL 1LQSR 1SBSH 1U8OB 5TPWH 1M04A 1MEXL 4CVXA 3AYSA 3KR3L 2OLDA 4A6YB 2VZVA 5FKYA 1QR1B 4DCQB 1H5BA 43CAA 4LDLB 2EH7L 1S7RB 2VLRD 3TO4B 5C2BL 3GSXA 1NCUA 4TPRH 2M8XA 3MRLA 5ESQA 1N5YL 1RZ8A 2IC2A 3I02B 2CESA 1E5JA 5MHSE 3K1KC 4AMKL 4X6CE 1QFUH 3L9RA 4GBXA 4RE2A 1DUYB 3VGGA 5KTEH 2LU7A 1UQSA 3BZDA 2XVNA 1NAML 2D3VA 1BZQK 4JFXA 3L3HA 1UWGH 4PJCF 3EYOB 4JZJA 4WU7A 4M7ZC 4GINA 1WBYA 3AY4C 1IFHH 3L7EA 3TBTB 1T2XA 1JHKL 1FDLL 3JTSB 3ZSTA 2YUXA 2AXJA 2C3VA 3G5XB 1XF1A 1XT5A 3GMLB 2WXDM 2FECL 3D2UA 1HDMA 3C9NB 4G43A 3SDCA 2V5TA 3KVQA 5FK9A 5CJQL 1CXEA 3AIBA 2QSCH 5I66A 2V2WA 1YY9C 2ESCA 1FYTB 4K68A 5D9PA 4LVHB 3ROLA 5CEXB 3QHZH 1S9WB 5KSAC 3LEVH 3KPRB 5DFAA 1R24A 4PTUA 2CBIA 2IANE 4DEPB 4M6OH 3QDGA 4LPCA 3KAAA 1JGEB 4GUPB 4FQCL 4UT9H 1V7MH 4KRUA 2Q8XA 2VR5A 3LV3B 1KJ2A 3CZ8A 2YUZA 1PZ5B 4RFEA 2VR4A 2OZ4H 4D6EA 4JFEE 5GGTA 5SWSE 3SDXB 2R0WL 3MLTB 4E42B 1A5FL 3PE9A 5EU5B 4L3EA 4X4XA 2HLAB 3N50A 1ZEAL 5LVEA 4MNQE 4HZ6A 3KYOA 4X6CF 2JCCB 5F93C 5LA1A 5JXED 3UERA 4WHTA 1MCBA 2A74B 5HD8C 3FQXB 1EVTC 3IETA 1FH9A 4RL3A 4RMVA 4WEBL 5ITFB 4X6FB 4Y5XC 1EEZB 2VIRB 2V5CA 3UJIH 1ED7A 4EI5D 5GRVL 1QP1A 1TPXC 2XHYA 5FF6B 2VB5A 2WMIA 3I3EA 4OCSH 5E2VH 5C0JB 3WD3A 1U93B 3CUFA 4I3RH 1PSKH 3TGXA 4X5WB 3RTQA 1OAQL 4XC3H 5FIEA 2XY2A 4D8PA 1AXTL 3LPOA 1WIPA 1B2WL 4ERSH 2ZOLB 3BP5B 3LPGA 3G5YB 3HCVB 3MRHA 4Y5YA 1I8LA 4WCYH 4TULL 1A6ZA 4N0CC 4U7MA 3BISA 3TYGL 2G8ZA 2BY1A 5TDOA 1W0WA 4DKEL 3VFPB 1LP9A 1JN6A 2XPKA 3SCNA 4EOWL 4TOQA 1NEZG 3ZHDA 2J4WH 2AEPL 2NW2A 4AQOA 1IV8A 3G04A 4XX6A 1BMGA 1N6UA 4YDIH 3M17A 3AMCA 1EK3A 3U83A 4QFUA 5FL0A 2ICES 2L0DA 3VDBA 2V17L 2EBNA 3QUMH 4MAYC 1MCQA 5T5NG 4F80A 3CFCL 2ORBL 1JRHI 1AIFA 1UKSA 1D6VH 3MYZA 3QUYB 1W3HA 4OTXL 5IHLB 1HILA 1GOGA 3PHQB 2J7FA 1IBGH 4JM2D 4M5YL 4UINL 1NCWL 5C0BB 3X3FH 4ENEC 3MGOA 3C87A 1VESA 4GZIA 3AAZA 4UCFA 5IW1B 3DHJA 1HEZB 4JRYA 1D5IL 2R9HD 4UFLA 1PLGL 1Q9WB 1IC4L 4K07A 4PJEF 3RU8L 3AS3A 2GCYB 4RWYL 5F3BA 3W26A 1WWWX 4UTAH 3NA4A 3L3IB 5INCA 5I1GH 1YC7A 2V6HA 4LARH 3LKPB 3KYAA 4ZUWA 5ISZD 4G8EB 3EUUA 4TRPL 2RIKA 1WUNT 4KZEL 2X4NA 5GRWA 3VWJC 3L4UA 3DX7B 3GMNA 2XA3A 3FN0H 1NMBH 5HYJA 1BZ7A 2XTKA 2AEWA 1DJSA 1MFEH 4JFDA 2F58L 5IDIA 1RIVH 4OIIH 3T8XB 1EXUB 2J7BA 4X9BA 5A3ID 3MA7B 3CMJA 3OX8B 2JK5B 4UT7H 3QZWB 4GSDH 3S35H 1A6WH 3RWJB 1PG7X 1QBLL 25C8H 4NNYA 1GQJA 2VQ1A 2UUDH 4Y2OA 1YY9D 4UV7H 1IAMA 4XNUH 4N1HB 4YHZH 1XZ0B 5KSAD 1KGCD 5D96B 3STZA 1NBZB 1RK0B 5GGRA 2PO6A 2CRIA 2P5WA 2AAVA 5SWZA 2XPGB 4JFFD 3P4OB 1BQCA 3R0MA 4RRPG 5F7EH 2XTJC 1NGYA 5JW3H 4OGXL 3FOLB 4P23A 3ZDZF 2WNWA 4IOIB 4DN3L 3GNML 4U4BA 1SYSA 3L3GB 1T2JA 4P9HC 3BKJL 5MERB 1BQHG 1HHKA 5EOCL 5T3ZH 1U8MA 1KN2H 1DQQB 3GMMB 1INQB 1YA5A 2C4FT 2HFFA 2YD1A 3MV7E 4OQTH 3KPSD 4GRWE 5A1AA 5LJYH 1T6WA 1VRXA 1A7QL 3MOAL 3MGTB 1FV1A 3SQOH 5HD8D 1E4WH 1S9YA 5T3ZD 3KGRA 1RSFA 3UG4A 2ZUMA 5GS1C 1FG9C 1WCBA 2LABA 4G42B 5I73B 3UTQB 5JOEA 1FFPB 3VPLA 3A0OA 3G6MA 2XM2A 1IGFL 1T0NA 4KKAC 1VJSA 3EDFA 5J57B 2VVNA 4KUCF 4N1EA 3DTXB 1ZA6A 3GMOA 3O2DH 1E4NA 5TD4A 4G6JL 3QQ3A 4Q7DA 3RNQB 1XR8B 3BKMH 4PD4J 2HKHH 4N90D 4ZOCA 4HGKC 3WH8A 1R3IH 1TVBA 2C3XA 2PTUA 1V7NL 3BPNC 4Z95L 5H2BB 5GGVH 1GOKA 4GQRA 4HWBH 2VN4A 2DMCA 3DLQR 4N0CD 4TVPD 4C58B 3WDRA 3V0VB 5HDQL 4H88H 1LE5A 1MQRA 2GJ6D 3RVVD 4JY6B 2BRQA 2QSQA 4M00A 2MHAB 1A9BA 2CGRH 1UCBL 4WV1B 4QOKE 1JI1A 3R06B 2BVPA 3MXWL 5FHAL 3V95A 3O0RH 4NC1C 1OCWH 1G6RL 3KYMB 3IU3A 1T0MA 2ZKHL 4D6GA 3QNYB 2BX5A 1FVDA 2VZSA 1EEYB 4QHLB 3TH3T 1UZ8A 3VIFA 2F74A 4QHUB 4JJ5A 1ITXA 4NBYB 2WM0A 4GRWF 1QNZL 4HJGA 2BNUA 2X4OB 2G3NA 4BM7A 3WF0A 3WN5B 2FGWH 2XWBB 3ZKSD 4OM0L 4ENED 3RKDC 5BXRA 1DQMH 3MLSH 2J8UA 3BPCA 4AMCA 1OAXL 3AZSA 3FRUB 4HMCA 2EDLA 4V28A 5JHDA 2YBRB 2EPMX 1KELH 2ZOKA 1B3ZA 5ESVA 4QT5B 3WLWC 3HMXA 4YLQT 2AS5M 1KCUH 1A2YB 1T3FB 2CK0L 2JB5H 3U7YH 4RFOL 3EOYG 2CLVA 2Y5EA 2DEPA 2GFTA 2N7AA 5JOFB 4HUVB 4L8SC 3SO5A 2DYPB 1Q6DA 3VWJD 1MI5B 1CL7I 2ZUSA 3QFJD 5C0AE 5D1XA 3VG9C 2ICWA 3HMWH 1RUKH 1OGAD 4FOMA 4EI6B 3MV9E 1VFAA 5F88A 2EIBA 5IEHA 3VFNA 2FSEB 1KULA 1Q72L 4XPGL 3BIKB 5HI5C 3O3EA 1WNOA 1VFOA 1XH0A 1IC7L 2HYMA 3MBEB 4OZIB 4F9JA 1FO0A 3ARGB 3UJTL 4MD4B 3ARXA 4L8DB 1LO2H 2FRGP 4WU5A 5DVLA 3U4AA 4LCCB 2A1WH 1I9IH 4FQIH 4MB4A 1S5IL 4DVRH 1U3YA 2OJEB 3HI1B 3DIFA 5J13C 1U8IA 2VZ1A 4AEHH 3L5XL 1E0XA 4P9HH 2NY5H 2UY7A 2DICA 12E8L 1AGCA 3BPOB 2WZIA 4XZUA 2XTJD 4HC1H 3J7HA 4V1DD 1JV5A 2W0KA 4JN1H 3BDXA 1CICB 2B1HH 1KXQA 4LBEB 2GUOB 2WBJC 3EOBB 3OJDB 2ZPKL 3JWDC 2HTKC 3BH9B 5GSRA 5LBSH 3C5ZD 1CIDA 3ARWA 4H26B 2DQDL 2QQLL 1INEH 4HHAB 1U58A 4NQUA 4KRPC 4OZ4B 5C08E 4JQXC 1OWRM 1A22B 1TJGH 3PWVA 4H7VA 3EMZA 1QTYT 4TVCA 4GAYB 2YPLD 1FNGB 4GW4A 3CUPA 3BCDA 2CO6B 1QFWM 5J1AA 3BQUA 2HT4D 5EA0H 3U4EA 3WBEA 5LWYH 4ELMB 2X09A 1I8MA 2C1OB 1JNNH 4JG0H 2DGAA 2F5AH 4NQCD 4LAQL 3U9UA 5C0EB 4YQXL 3S5LA 3ZE1E 2CRYA 4OFKA 2VABA 4QRTB 1AY1H 3INUH 2WHMA 1FFNA 4HH8A 1OPGH 1S7QA 4ZEPA 1U8PA 1OGTB 4LLQA 4BQBA 2ZCHH 3LN4A 1G0XA 4HV8B 4Y88A 4YE4L 5GJSH 1FFRA 3W2DL 2J8OA 4DK6A 1G7PA 3BP7A 1AD0A 4W4OA 4PGEB 3JWOH 4PD4K 3MV01 4J4PA 5DR5L 5D7IA 4NRZB 2V2XB 4ATWA 5IHUH 2C3WA 4ZUSB 3ZKQD 3C08H 4NRYB 2ZX8A 5KW9H 1IC5H 3OV6A 5D8ZA 5DMGC 4QO1A 4WUUD 4MJ5B 5HY9A 1JYXA 1HOCA 1E6ZA 1AHWA 5HYSG 4YDLC 5GRZA 5EIIB 3PHSA 43C9A 4JREB 6FABL 4GO6B 5F1SA 4R96B 5I1LA 5L9DL 2DSVA 3CSPA 4PTTB 5DD5L 5EO9A 4KROC 4PEEA 5GZOC 1A1NA 4G8GD 1I3RB 5B8CB 2XZAH 1AQ0A 2GK1B 3RWHA 4UDTB 5FYJD 2DLGA 3NCOA 2WWMC 2DWEB 3S6CA 3C6LC 3DO7A 3DUSB 2FIKB 1MQ8A 2ENYA 1G9NL 1NH6A 1LILA 2P4AB 4P8XA 4JCLA 2DD8H 2HG5B 3OKNB 4UR9A 8CGTA 3RKDD 4PJGA 1UA7A 1QKZH 2NY2B 2X4RA 3WNKA 4MD5B 4AYFA 3RZWA 1ITBB 3ZE1F 1D5MA 1JWMB 3BT2H 1KFWA 3WIIH 5JORA 1E4XL 1R6VA 3BAWA 2R23B 1U8OA 5EOQL 2VXVL 5K9JH 3WLWD 4BZ1L 4A6YA 3OB0K 1QR1A 3EHBC 4DCQA 3RQ3A 1S7RA 4PJDE 5KAQF 3TO4A 1RIHL 5TQ2L 3RIFK 3HE7B 5EWIL 5MENB 4TQEL 4WFGD 5BYWA 4JFZH 3I02A 1PY4A 1DUYA 1K6QL 5I8KL 2IF7A 3HAEG 4GI9A 1HYSC 1C5BL 4J3WA 1A7PH 1IVLA 5D7JB 4U05A 5T1DH 4KVCH 4X6CB 3EYOA 3WXWH 4XCNB 3KXFE 3S37H 3SDYL 3I6KA 15C8H 5GS0C 3O6FC 5F9OH 3TBTA 2FDMA 1TG7A 4GQPH 1R0AL 3LIZL 3JTSA 4XX1E 5CJOH 5HGHB 4X7SL 3VFGH 4W6XB 3RWIB 1EV2E 1CLYL 2ESVD 3G5XA 2H9GB 1FNSL 1JYNA 3GMLA 3GUTB 1NSNH 1Z0MA 4Q9RH 1ORQB 4TUKH 1WZ1L 4GXUN 4F15B 5C0FB 3VIMA 3WN6A 1JTTA 4PMRA 1E72M 2C3GA 1A3RL 3QPXH 4A3YA 1FYTA 4GMSH 4KVNL 4D3CL 3T0EC 5CEXA 2NXYD 4AIEA 1S9WA 3TH4T 4EEEA 5F1OB 3KPRA 2J6EA 2W9EH 2ZWLT 3HUJE 4KK9D 3N9GL 2HTKD 1GQLA 3GB7B 3WUWB 3FAXA 1JGEA 4GUPA 3ZTJG 5IVZB 5DURB 3LV3A 3CIVA 2I25N 2W4XA 2W0LA 1PZ5A 2JEQA 1I1YB 3QNZB 3ULUC 4L9DA 3DGCR 3SDXA 2IANB 3MLTA 1Q9OB 4PJDF 4TSBL 3QO0B 4E42A 5ADOH 1ISVA 2DLIA 5EU5A 3V5KB 2HLAA 3TVMC 2R4RL 4Y19E 3VXSE 4XVSL 2XZCH 1HP4A 2JCCA 3G6LA 2BNRB 2NNAB 2WP3O 2A74A 5CGMA 2AV1B 3FQXA 2B7DT 2YMXH 2AGJH 5DFTA 5IBTH 5ITFA 2I26N 4M7LH 2ZWZA 2YOCA 4X6FA 3VXMD 1EEZA 1RUAH 5IIEB 2VIRA 4JVPA 1D3CA 3LSOB 3OKKB 1QUNA 1XGZA 1PY9A 4NKDB 4P5KB 3W9DB 5FF6A 1EPFA 5TE6H 1YNLH 4DAGH 3VFUB 2A77H 1XIWC 1U93A 2HLFD 2P5ED 1VFFA 2M1KA 2NW0A 1C90A 4X5WA 4MA1C 1R5VB 1R3KA 2BC4B 4HLZG 1VGEH 5DMGD 3UTTE 1JDCA 2EH8H 5DGQA 3ILPB 4X83A 2QLVB 5GIRB 1Z5LA 2V5SA 2ZOLA 3BP5A 5F97E 2F5BH 2OTWB 3G5YA 2VRJA 3HCVA 4LF3B 1T7XA 3D0VB 1B9ZA 4XB8A 3ARPA 4UQDA 3HUJF 2IALB 3T65B 5GZOD 5F96L 1LLOA 3VFPA 3HFMH 3UPRB 1JGUL 2WWMD 4KK5D 4WWKB 5BWFA 4O02H 1KCRH 2F54E 4HW6A 3A67L 2BHUA 1AIWA 4AZ7A 6CGTA 2FL5B 3QUYA 5A2AA 4K71C 2RR3A 1FIEA 3PHQA 5E9DE 2ICCA 3UTSB 1R3HB 3GBNH 5C07E 4H8WC 1MFNA 5GPRA 1FBIL 5C0BA 1XCWA 3EHBD 3BWUC 4P46A 1XF2B 3GBDA 4ORZC 5IW1A 3PP3K 3QXUA 1HEZA 4NKIH 5ICXB 4B16A 3O4LE 3HU7A 3HC3L 4G9FB 4GFTB 4NWUL 4PIRF 1DSFH 2GCYA 1HHHB 3T2QA 1DFBH 3L3IA 5E4EB 3ZDYE 1CNVA 5GS0H 1HYSD 1ZLVK 1LK3H 3B9VA 2Z31B 1EBAA 3LKPA 1WP6A 3NCYS 4FN0A 4G8EA 4YHPB 5T3XH 4IPNB 3WH6A 5ACZB 2WC3A 3PIQB 4POUB 1V0KA 4WDIB 5KOVC 5GS0D 5CWSB 1OAYH 3DX7A 4GRMB 5I1JL 4F9DA 4XXCC 3BEVB 5EBAA 1TQBC 4PV9B 1BBDL 3CX5J 3EOTL 4PUBH 1CZ1A 1UGNA 4QYOB 5AC4A 3T8XA 1EXUA 1TJHL 3KHOA 2JK5A 3D3VE 3QZWA 5A8QA 3RWJA 3P77B 4YEEA 3OAYH 4AENB 5FUZL 4LSVH 2ZIDA 4HIEB 1FNFA 4XCCL 1XZ0A 4QWWD 3ULUH 3S96B 2PWGA 1NBZA 1RK0A 1LO4L 4X80L 1IGMH 4MADA 5AYQA 2LU4A 3BAEL 3FO0L 2F9BT 3NIDE 4HH9B 2XPGA 3P4OA 1W1TA 4C55A 1E6RA 1SHMA 2WUBL 3G5ZB 3FOLA 3ZYZA 3NFNB 1BBJB 4NCC1 5SX4I 4IOIA 4CMHB 5C6PB 2V38A 3P30H 3L3GA 3ALGA 4U6YB 1PJ9A 3U7VA 4NKMB 5MERA 3RJYA 1U2CA 3WELA 4LVNB 5HHMD 4RAVB 3KPPB 1DQQA 3MNZB 2O5XH 5IWLC 2X89D 1SJVA 3GMMA 4LPWA 1NCAH 1MIMH 3ZDYF 2OJZL 3A47A 4OJYA 1KR1A 2V5MA 4YWGL 3MGTA 4PRIE 3VG0H 1ZHNB 5LCVH 1IT9H 4DW2H 2HFEB 3I6LD 2J7GA 2VXQL 3EYPA 3MV7B 4M7KL 4GRWB 1HH9B 1MCCA 4G42A 5MI0B 3UTQA 3QEGH 3HRZB 1FFPA 1YMHB 1J18A 1IM3B 1MNUH 5FOOA 4GG6E 4P5TB 2R0KH 4YHIB 3DTXA 3KL3A 4MCZB 3T0DA 3DARA 1RJYB 4GKOA 4OM1L 3RNQA 1XR8A 3IS1X 3QEQE 5F70A 4ZG1A 1F3RB 5H2BA 1GHSA 3RA7L 1JGLL 1YEFL 3VIIA 4S1QL 5IR1B 5EFIB 3V0VA 1NBVL 1HL8A 4OLZL 4BQCA 2DQCL 1UWEL 2AK1L 3NIDF 3OKOB 4YXHL 1FH8A 4JY6A 2V9TA 3QH3B 2MHAA 3WY1A 1V3IA 2E27H 3MLRL 3R06A 3QXVA 2I07A 3KYMA 3QNYA 4H8WH 1KWGA 4YK4C 1EEYA 3AMLA 3SKOB 4P2RD 3ZT6A 1C5CH 4KJQC 2V7NB 1DBKL 4L29B 4QHUA 3X3GL 1L0XA 2CKBH 5DLML 5SX5H 3H9HB 1QPXA 4D9RD 5DEFB 2GUYA 1YEGL 2IBGA 2X4OA 2W5FA 3IXAB 5K9OB 3WN5A 2XWBA 4URTB 5DQDH 3TA3B 2XIBA 5MP6H 2GVYA 4TVUA 1QPPA 1EX0A 1XF3B 2WP3T 3FRUA 1LO5B 4LGRB 4U1KB 4Q6IC 2RB8A 2Y7QB 2YBRA 3QDME 2FBOJ 3D87B 4GG6F 4QT5A 5LGKA 4NWTH 4PCTA 1NGPL 5IFJA 1NOWA 2IWGA 1A2YA 1T3FA 4XNZC 4Y4KC 4PTWA 4WKAA 4FZEH 3QIWD 1DBJL 2OTUB 4GW5B 4LAJH 5JOFA 5EC1B 4HUVA 1E6OH 4AW7A 1QSED 2DYPA 1MI5A 3A4WA 5AYIA 2Z8VC 3W29A 2IG2H 2YD2A 4GZEA 1DBAH 1P6FA 3D39D 4R4BB 4EI6A 1PX3A 2FSEA 4KKBC 2UY4A 3BIKA 3TT1L 1KQZA 3CX5K 2QKIB 3K4ZA 1HNGA 3MKKA 3MBEA 1KB5L 4G6AC 3ARGA 4MD4A 4L8DA 3QCVL 1QI4A 4I9WE 4LCCA 4XP4H 5D7KD 4JPWH 1AQKL 4NP4L 2OJEA 3HI1A 4KI5C 5DJ8B 3N15A 1NAMA 1T03L 3AHXA 1X5XA 2X4PB 4OZHB 3F7QA 1AQHA 1CICA 1KXTB 4LBEA 2GUOA 3OJDA 3EOBA 3VD7A 4C7DA 1I9EA 2VDPH 4JM4L 2IQAB 2BNQD 4Z78B 3U7AA 4H26A 4HHAA 3KS0H 3V52H 4OZ4A 4Y2DB 4OGYH 3DSFL 4YGAB 4ZXOA 4H8UA 4TOYH 4PMQA 1WISA 1FSKB 1Q8MA 4GAYA 1FNGA 3GMRB 4M81A 1ZJAA 1OP3H 1JFHA 1ECEA 2XG5A 1KFAL 35C8H 4ELMA 2C1OA 4YHOH 5KZCB 4L4VD 1J8KA 4D0BB 3GEWB 2W63A 3ARFD 2DJSA 4QRTA 5FYJU 1YEEH 1F4WH 2HJFB 1OCQA 2NCMA 4NO0B 1FHDA 3IDJB 4AL8L 3PWJB 2G60H 1QI0A 4K3EH 1XGTA 2P7TB 2QQKH 4HV8A 4HBCH 3T4YB 4AZ6A 1A3LH 3RHWF 5IESL 4G9DB 4FG6D 3CFBB 4PGEA 4M6ML 1PG7H 1FGVH 2H32H 4NCC2 4NRZA 2V2XA 4M29A 3VI3E 2X1QA 4ZUSA 4NRYA 1W9UA 3MJ6A 4BQ4A 4KKCD 3P0GB 4OCWL 5CAYB 5I1EL 3MO4A 2JTDA 1MPAL 1RULH 4JO3L 2V3DA 2WWDA 2UV3A 2XA8L 2ZCKL 3AYRA 4MJ5A 4ETQB 4KHXH 4HS6B 1W91A 3HAEH 5EIIA 1NWUA 2BERA 3PV6B 4M1GL 4PTTA 4F9PA 4JY5L 1PIGA 3MLYH 4X4ME 1I1CA 1I3RA 2DIBA 5B8CA 2GK1A 4MXQC 4PY8J 1D9KC 4UDTA 1LWJA 1OTSC 4K3JH 5KVFH 4H0HB 2HA1A 2DWEA 3QHMA 4KJQD 5FM5M 5IBUG 1HJUA 3DUSA 2FIKA 2FBJH 5I8EB 5BJTB 3P0YH 3CJJA 4JPVH 1RH9A 2RGSA 4QXWA 1T80A 2VZOA 4ZS7L 2APTA 3OKNA 1KCSL 3JWNC 3HG1E 5GRVK 5DC4B 4MD5A 4CMMB 1HXYB 4GKZB 5GNYA 4UQBA 4R2GD 3DVGB 1BX2B 1KT2B 1JWMA 1BF8A 1MJUL 4RGOH 1G7LB 1A7NL 3TNMB 2WHJA 2R23A 5A6BA 2X5PA 4Y1AB 2CERA 3ZTJH 2VZTA 1NOUA 5L2KE 1HSBB 4LPTA 5E6IB 4P2CG 4Y4KD 1DL7L 3HE7A 3GH5A 4OI9A 5MENA 1RZJC 1CENA 4MNMA 2DTMH 4NKOB 3HA0A 2IQ9L 2WIIB 4MA8L 3OL2A 3VI3F 3CVHB 4XPFL 3AIUA 4ODUB 4PGCB 3MRRA 4PMNA 4ETYA 4YBQC 4PJDB 1DANT 3AB0B 1M6OA 2VITB 5D7JA 5ADPH 4XCFL 1V02E 3CZEA 4X6CA 4U0RC 5TQ0L 1PZ2A 4XCNA 1GJWA 2ZUQB 1W2KT 3ILQC 3VCLB 2DBLH 2FJHB 4MJ6B 5F9WB 3EFFB 1OLZA 4RGNB 3DHUA 4TTDC 5HGHA 1T21B 1IGCH 1AFVL 3RWIA 3E6HB 1B2YA 2YA2A 2ZUUA 2IPUK 3PV7A 2H9GA 3W11C 3GUTA 2YK1L 3AFLA 1GC1L 1ORQA 2ZICA 1N7MH 1NGWB 5C0FA 4G6KL 4HLZH 1K4CB 3O4OC 1I1AC 4IDJL 5F72S 5E8EB 5DUPH 2PTTB 1A0QH 1PG7W 5JOPD 4IOFC 2EO9A 3GB7A 3WUWA 1OBAA 3NPSC 3OAZK 3VFWB 5IVZA 3RGVB 3MODH 4BUGA 3V6OE 3SJVB 3WS6A 3QNZA 5BRPA 4HK3N 3U30C 3T1FB 3GHBL 3HUJB 1H8NA 1HKFA 4RMQA 2MNUA 2IANA 5DMKB 4R97B 1UD5A 1Q9OA 1X44A 3V5KA 3QIBB 1VFMA 3O3AB 3HC4L 1W1PA 3ARDC 3UEZA 4JZ5A 5I6SA 3GIVB 5CJBA 3T0VA 1P2CB 3GH7A 3H3PL 4UOW0 4R26L 5D2NB 3TH2T 5DVMA 2BNRA 2NNAA 2AV1A 4OOUA 1KC5H 1S9VB 4H1LB 3A6CL 2FX7L 3HHRB 4GT7A 4Y19B 3W0WE 3MXVL 3K1DA 3BDBA 3C8DA 4FNLH 4ZFOB 1K9FA 3LSOA 1RUQL 3OKKA 4I4WB 4PRBB 32C2B 4NKDA 4P5KA 2WCGA 3W9DA 2FX9L 1CE6B 5J56B 5F89B 1J11A 1W72H 1EOKA 1UQZA 3VFUA 2JELL 4AZIA 4I8DA 5EB8A 4YHKH 1R5VA 4YDVB 3WHE0 2BC4A 4D6FA 2N7BA 5LGJB 3HMCA 3E8UH 3ILPA 3OJMB 3WFEL 4YDKH 1NGQH 2E9JA 1XGUB 3UC0L 4RGMB 1I7TB 2C9AA 2ITCB 4JO2L 5GIRA 2OWCA 2OTWA 4UNTA 4LF3A 1TENA 5GGVY 3BSHA 3UP1A 1QBAA 3D0VA 3UTTB 4GAGL 1EFXB 3W39B 5CPQA 1W9VA 2IALA 3T65A 1UYWL 5JXAL 4MXQD 3UPRA 1VFUA 3HPJB 4WWKA 1MCOL 1DVFC 2DQTL 2JIXB 3G9VA 4GG8B 5DJZB 1SQ2N 4HK0B 4N0YH 5DK3A 1KQYA 1BFSA 3O9WB 4ZUTB 1TETH 4LSPL 1CZ8L 1Z9LA 4GPNA 5BO1L 1F4YL 2DQIL 4Y7MA 4PGBB 5HTSA 5GRJL 4JAWA 1JZ4A 2EE2A 2VLJE 2FL5A 1IKNA 5BV7C 3B83A 3R4DA 2VDOH 4BSVB 3VMPA 4AYSA 1E28B 1K3IA 3UTSA 1R3HA 3QCTL 5KOMC 1RZJH 3MLPA 4CD6A 2UWEE 3CFDB 2F54B 2MWCA 5C0IB 2X05A 1XCTB 4ATDA 3DETD 3PP3H 4PJ5E 1XF2A 5I23A 1GZPB 5FV2A 4U6VH 5E9DB 4U1LB 2CR3A 5ICXA 3KYKH 2DIAA 2JF6A 3N06B 4G9FA 5A95A 1DCLA 5D71H 3TA9A 1HHHA 1U2HA 1ZLVH 4YBQD 3SCSA 2GSGB 1P7HL 3UETA 3X11B 2DIJA 4J1UB 5GNZA 2Z31A 3EYQC 1U6AH 4YHPA 1KIQB 3O3UN 5ACZA 3T77B 3NCJL 1Q6FA 2EEDA 1LO0H 3L7FB 4WDIA 3HE6D 1NDGB 2PXYC 4XI5D 5CWSA 4GRMA 4X8JB 4FQXC 4KAQH 3T3PE 4X6DE 3BEVA 2EEBA 4PV9A 3BJLA 5B3NA 1CGSH 4TYUA 1QLRB 1S9KC 4QYOA 3W11D 1HQRB 4PJBE 5SX4H 4K8RD 3WFBL 2DT1A 5EORL 3AHVA 1CGYA 4MD0B 2W59A 3P77A 4WVRA 1L6ZA 1YC8A 4AENA 4JKKA 1YEKL 4HIEA 1I1AD 3ZMRA 3VFOB 2XKUA 3TM6A 1UOKA 3S96A 3RUGE 4AD5A 5I3DA 1E40A 2D0GA 2DM2A 5GGSY 3D3VB 1LVEA 1JGVL 3MSPA 4EDXB 4R90H 4HH9A 3QFDB 4IS6B 4W85A 3FN9A 1LE9B 2K1MA 2UWEF 1OAUL 5CP3H 2OK0H 4HF5H 3G5ZA 2OYMA 3NFNA 1BBJA 1I9JH 4PMVA 4L4OA 4X6BB 4PJAB 4U6YA 5J4MA 1E71M 3ORJA 1A7BA 4JRXD 3VM5A 2MPAL 5CINL 1GQKA 3ARDD 3UG3A 4WFFD 5E0QA 2VX5A 4RAVA 3KPPA 3E0GA 3K4DA 3MNZA 4DKDC 5A2JH 1JFQL 4E5XB 2OMBA 2J74A 1KV3A 1CTNA 4UZGA 1FAIL 2A73B 1ZHNA 3ARBD 3VA2C 2HFEA 1R3LB 4ACPA 4EUPG 4YPJA 4TX6A 4PP2B 3MV7A 1HH9A 1V0NA 3T3PF 2FCBA 4X6DF 3HRZA 1YMHA 4PRIB 1IM3A 2XWEA 3QHFH 4P5TA 5CILL 4YHIA 4XP9L 1P1ZB 4ZD3L 1JHTB 4QDMA 4MCZA 4O5LL 1RJYA 1YYMH 4Y16B 5E7FA 4PJBF 3REWB 4CU6A 3IB4A 3IVKB 1GAFH 3R8BB 4KDTC 4GG6B 1MVUB 2CPCA 1F11B 5A94A 5HVFB 2R56L 4AY1A 3RUGF 5IR1A 4EQ2A 3VRIB 5EFIA 5I30L 3S88L 2W91A 3QEQB 8FABB 2J7HA 2Q3AA 3VW3L 3OKOA 4G6FB 4PJ9C 1DVFD 2XGIA 3V4UH 3QH3A 5BV7H 5FYKH 3TWCL 4WHYG 3QWRD 3WHE1 4UQ2B 3SO3C 3LZFH 1KTDA 3QUKB 3SKOA 3OR6B 1UB6B 5FYKD 2WMKA 5E95B 2V7NA 4L29A 1H49A 4C56D 4I0PD 2QHRL 4A2MA 3H9HA 5DEFA 1ZHBB 2ZUNA 2C5DC 3S36L 1OIFA 2LE9A 2JJVA 5K9OA 4XVTL 1IGIH 5D7SL 2WSPA 3TA3A 4PG2C 3D25A 4FFVC 4LSSH 1XF3A 2OI9B 4R9HA 2DLEA 2L7JA 1LO5A 4U1KA 4JDTH 2Y7QA 5I75C 1G9ML 2GSJA 2QL1A 5JR1L 4XP5L 4JG1L 1FL5B 2YRLA 4YHYB 1IQWH 2AJXH 4J3XA 3STLB 1JZ2A 2GDUA 1MY5A 3EYQD 2NY1C 1C8PA 3ARZA 3BSZH 3GRWH 4GW5A 5TE4L 1KJ3L 2I5YL 3QDMB 4R4FL 2J88H 5EC1A 3BKCH 5JBFA 2AK4D 4FQXD 4NJAL 3AS0A 1F4XL 1RZFL 2XG4A 4R4BA 5SV3A 2ZXQA 4HPGA 3I85A 3F8UB 4AZBA 3MRCB 1E70M 1F45A 5KS9E 1J05B 3W82A 1SBSL 1H3VA 1EGJA 4EAMA 3QUXB 1L0PA 1QBMH 5IXEA 4JFYB 1T04A 5CG0A 3PQYD 1MEXH 4MS8C 1VERA 5T1KD 3DVNB 3VXRD 1JDDA 4BQ5A 4RFNB 2YWYA 4TPRL 4L1DA 5F6IB 4JY4B 1QFUL 1TZGH 5T5FH 2X4PA 4OZHA 5J7CC 5KTEL 4AMKH 4XV0A 1KXTA 1CBVH 3K0WA 2B0SH 2J62A 1IEAB 3RBGA 1H3XA 2IQAA 3ZE0F 2ICEB 5EBGA 1UWGL 4Z78A 2YDSA 4P4RB 3WIHH 4Y2DA 5D1QB 4YO0B 1IFHL 1IGJB 3GMRA 3CZGA 3ZHKA 3GSNH 3NFSH 4F33B 2VERN 4CDHA 1FDLH 5IMMB 2AJYH 5C08A 1B3WA 1MAMH 4D0BA 3GJFK 2D3NA 4PBGA 4X99B 1BQSA 4OLEA 3HNSH 1YHTA 1F6FB 2HJFA 3SPVB 4AC1X 3IDJA 2QSCL 4LCWD 3PWJA 3QHZL 3L5HA 3LEVL 1BP3B 3FB7A 3T4YA 1KGCE 1MHPH 4M6OL 2HISA 4G9DA 1HQ4B 4UT9L 1V7ML 3CFBA 5KS9F 1D5ZB 2MSPA 3BDYH 4JFFE 4FQCH 1FP8A 2OZ4L 4NI3A 3ZJKA 3MRBB 4RAUB 1VACB 1LG1A 4CU7A 2R4SH 1IAII 1WWBX 2NR6D 4KUZL 4DUXA 1H5BC 2PYED 4ETQA 4HS6A 4PJ9D 4YX2H 4M1CC 3OB8A 2ZSWB 2QTEA 3PV6A 4XPHH 3KPSE 3DRTB 4GBXC 5GGUB 1ACYH 3U2SB 1FQ9C 3BW9B 1XYFA 2JLLA 1YQVH 1SY6H 4U1IB 5T3ZE 1S5HB 2W67A 4KY1H 3QDHA 1HE7A 1ZU8A 4WLCA 4K9EL 3UJIL 4GOSA 4KTEH 4JZJC 1KN4H 5I8EA 1HIZA 1Z9OA 3CDGB 2ERJB 3RVXC 4OCSL 5BJTA 3UG5A 5E2VL 5JIPA 2FJGB 2EO7A 3CXHJ 4W5UA 2GK2A 2WK2A 4I3RL 1PSKL 1H11A 5HDRA 4HCRH 4CMMA 1HXYA 4GKZA 4XC3L 3DVGA 1BX2A 1KT2A 4YHMH 3W81A 4TTUA 3M45A 4U31A 4WTZA 1G7LA 3VH8G 4ERSL 3WQ4A 2B5IB 3OKLB 2DDXA 4Y1AA 3SDCC 3HG1B 1HSBA 4X7EC 5C3LD 5E6IA 2IH3B 5L2JB 7FABH 2EIDA 5IB5B 2NY1D 2QADB 5DHVH 2X0HA 1W8OA 2J4WL 1UR0A 2XUCA 5DD1H 5D9MA 2GJ6E 1ZL1A 4NKOA 2R2EB 3K2MC 4YDIL 2WIIA 1S9XB 3SCWA 1DN2A 1VGKB 3IJ7A 1EJ6A 2AEPH 1DQJB 3BMWA 1T7ZA 2FB4H 4ODUA 4PGCA 4OB5H 2DTSA 4PJDA 4KJWC 1V8HA 3QUML 4GKNB 2VITA 1A1MB 1UENA 4X0KB 5FO8B 5BRZD 5EBWB 4AEFA 1D6VL 4ZS6D 3VCLA 1DWAM 3ZIZA 2FJHA 5L0QB 4MJ6A 4YHLH 1IBGL 1RZIB 1ERNA 3EFFA 5CQ1A 4O2FB 1T21A 4HKZB 3E6HA 1NCNA 4MS8D 2GIYA 4CDGC 1PEZA 2F2HA 3MZTA 1ZE3C 1NGWA 2YL9A 2KZ1B 5ABGA 1K4CA 4FQLH 4UTAL 4TUOB 4WIQA 1CLCA 5I1GL 5E8EA 1X6LA 5CZVH 2VQTA 2PTTA 4MX7B 3OAZH 2X2YA 4LARL 1C93A 5DI8B 4Z7VB 3QEUB 5F21B 3BXNB 3VFWA 1E0WA 1C12B 4I48B 3RGVA 2XKSA 3UO1H 3RZCB 3SJVA 2D24A 2RQ8A 3AXXA 1MFDH 2G75B 5EC2B 4MVBD 3KJ6L 3FN0L 1X5YA 2MKWA 3UTZB 3AREB 2WNGA 3HUJA 3QFJE 5DMKA 1NMBL 4Y5YC 1I8LC 5E2WH 1Y0LB 4HT1H 2HJKB 4F37K 1MFEL 2NX5D 3HN3A 4BH7B 3QIBA 2WVVB 3O3AA 3FB8B 1RIVL 4NM4H 4OIIL 5DRXB 5HPCA 3GIVA 2ATPB 2F58H 4UT7L 1P2CA 4GSDL 1RVFH 1QBBA 1EAPB 2APBA 1A6WL 3ZT5A 25C8L 1F4AA 2DMKA 2YD9A 4UV7L 3BH4A 4XNUL 1GGUA 4H1LA 4YHZL 2VWEC 3PDGA 4Y19A 2V7HA 2G3JA 1QSFD 4MMZC 1T66D 4ZFOA 1CLZH 4PJFB 1I85A 4I4WA 4PRBA 32C2A 4PP1C 2GJPA 2YDRA 2D23A 1HI6B 1WV7T 1CE6A 4ZSOB 4Y89A 5F89A 4F9LA 5F7EL 1MCIA 5JW3L 5A3HA 2XTJE 1NC4A 4FABH 4PG9B 2WINB 2OL3B 2IGFH 3SCRA 4WHCA 4YDVA 4DGIH 5LGJA 5ABFB 1Q38A 5T3ZL 4JO1H 1XGUA 1I7TA 1KN2L 2ITCA 4UZSA 4M1CD 3OXRB 4H2CA 1F58H 2JEPA 4OQTL 3MR9B 3X13B 2FHBA 5JIWA 3UTTA 2DAVA 4GBXD 1EFXA 3C2AH 3SQOL 3W39A 1E4WL 1A6UH 1A7QH 3MOAH 1RMFH 1I7RB 3HPJA 3B2UC 5DJXB 1E6SM 2Y6SC 2DS4A 2JIXA 5DJZA 1H9VA 4HK0A 3WDJA 3MV8B 3O9WA 4ZUTA 4ZXBB 1MRFH 5DF0A 2BVTA 3O2DL 3VFTB 3CXHK 3BKML 4ZAKC 1GGTA 4TVPL 2HKHL 3QJFA 4FFWC 4BSVA 3SE3C 4UT6L 1WAWA 1E28A 4F3FB 1X5KA 1V3HA 3D2UD 1A9EB 2ILLA 3CFDA 5GGVL 3SDCD 2F54A 5C0IA 2IXVA 5LYRA 1XCTA 1QG3A 4HWBL 4OBSA 2GTWB 1HKLL 3F7PC 1J1XH 4QCEA 1KJ2H 3PF2A 4JHAH 4H88L 3D5OF 1GZPA 1K5NB 5E9DA 4U1LA 1KYOJ 3VJ6B 5GGTH 2UWEB 3QDGD 4Q97A 2CGRL 1LWHA 5DO2C 1V3KA 3O0RL 2GSGA 4KJWD 1OCWL 5DRNB 3JUYA 3X11A 1FP9A 4NC1E 3WQWA 4J1UA 2DLTA 4G8GE 2D7NA 4LSUL 2ZKHH 1KIQA 4JJHA 5F1IB 3T77A 4L3ED 1N8ZB 2YD7A 3L7FA 4RMSA 4RWHA 1NDGA 4X8JA 3TN0C 3CLWA 1ROWA 2W61A 4P9MH 2X70B 2FGWL 4R3SB 4URIA 4MXVE 5E8DL 1QLRA 3MGAA 3N0PB 1DQML 1T5WB 3MLSL 5FGSA 1LD9B 3TTYA 4DWSB 4RCAA 1HQRA 1NFDE 1FA2A 4GQ9H 1QFPA 4LKCB 4MD0A 4OIBA 4X6DB 3VWKB 1G9NC 1KELL 3VFOA 4U3HA 4KFZC 5HVHB 1KCUL 2JB5L 1IGYB 4DWHA 2TAAA 4QY8B 3D3VA 2X1OA 2CHOA 3P4MB 3QFDA 3RTQD 2CK0H 4IS6A 4EJ1C 1ESWA 1PEWA 5ANME 3O6LH 3OKYA 2H6PA 4LP4A 3RUGB 5A69A 1ETZA 2X10A 3HMWL 1RUKL 2OTPA 4X6BA 4PJAA 1H5VA 1JP5A 2QV2A 4WHYH 4QKXB 2VRAA 5L88H 5IW3A 5LG1A 5I1KH 2HRPH 3JZ7A 4IJ3B 2OYKA 1AE6H 3IDXH 1WIOA 1O5DT 3FTGB 4E5XA 1LO2L 3S6TA 5ABHA 4OZFA 2A73A 1Q94B 1LK2B 2A1WL 1I9IL 4FQIL 4QRPE 5DQ9B 2AJZB 3S4SB 3VFRB 5E5MB 1R3LA 4DVRL 4KV5E 1G01A 4AEHL 4PP2A 2ESVE 5IF0B 4P9HL 2NY5L 4PP1D 3WQ5A 5FYKU 1OAKH 3LQMA 4PRIA 1AI1H 3HZVB 4HC1L 1LEKB 3LS4H 1UR9A 4JN1L 4NO3B 1GHRA 1TMCB 1P1ZA 4BSWB 2B1HL 4MXVF 2CUIA 2YL6A 2W62A 5E56A 4Y16A 1NFDF 3REWA 2RGMA 1EZVX 3OZ9H 4AD3A 1HJQA 5JDSB 3IVKA 2AAAA 1OHQA 3SGDI 1KLUA 5I2UA 1J8HE 1INEL 3EYSL 1N3NB 1XGQB 4JRYD 4NNPH 4GG6A 1MVUA 1TJGL 2XFFA 3MOBH 4GRLB 4O51B 1C16B 4IEFB 1MW1A 3VRIA 1U8NB 3DUHA 3QEQA 8FABA 5EA0L 5LWYL 1JNNL 4PUDA 2F5AL 3B2UD 1NC2B 1ZT7B 4UFJA 1AY1L 1OSPH 3INUL 3IJSB 5MEPB 5DJ0B 4EN3B 4UQ2A 1OPGL 4IOSD 4Y4FC 4YIQA 3K7UA 4K3DH 3W38A 5D1XC 3QUKA 3ARSA 2ZCHL 5GJSL 3OR6A 1ZBWA 5HYJD 1UB6A 2ZNXA 4ZNEE 4JFDD 3VXME 1LEIA 5GSVB 3JWOL 4HUKB 1WCGA 3MNWB 2W1NA 5FB8B 1EDQA 3M07A 5IHUL 3C08L 2P5EE 5KW9L 5AYBA 1IC5L 4KV5F 1G1CA 1YECH 1RJLB 5C0CE 4NCDA 2LTQC 2EPLX 2PO6D 1KYOK 5DO2D 1WLHA 2WMJA 4ZXLA 4XWOD 1UD2A 4AWEA 4XBEH 2M26A 3O6KH 4P23D 3STLA 4TUFA 4I77H 3QDMA 4GXPA 2B20A 4MNHA 1XCXA 3RWDB 5C0GB 1SFSA 3ZKXB 4PGDB 4PRPE 2A9NH 2DD8L 5E03A 1NUFA 2YA1A 4HJ0D 4N8CH 3SDAB 2DT2A 1QKZL 3BH8B 1UWXK 3RM9A 2GJZB 2H3NB 1X4YA 3MOQA 3MRCA 1BPVA 3BT2L 3WIIL 3QZWG 1J05A 3NIFE 1KCKA 4UOZA 1CFSB 1H15B 5K9JL 3QUXA 5EZOH 4JFYA 3BAKA 2XWJA 1XYZA 4LPUA 1DBMH 2EYTB 1DQLH 1QI2A 5T5NF 4XVUD 3DVNA 2YL5A 3KDMB 4JFZL 2YR3A 4ZTPH 4HX1B 1OB1B 4JY4A 3NCCB 4XAWH 4GO8A 3VU2A 4PJIB 4J4PC 4YC2C 1T7WA 2VTFA 3WUZA 4M6NH 1WDSA 2IPTH 1A7PL 3RHWK 4IRJC 4YBLC 3QQ4B 5T1DL 3W5NA 3P4NB 3ZO0A 2ICEA 5FO9B 4WKFA 4KVCL 4XNMB 3PTQA 2DQUH 3WXWL 3MJ7B 5FO7B 4P4RA 3IAQA 3S37L 5D1QA 1AHWC 4YO0A 1MFVA 15C8L 1TVHB 1IGJA 4FQ1H 2R0LH 1MFCH 1EFQA 4UZUA 5CJOL 4X7TB 4F33A 2X41A 5F71A 2OYPA 3VFGL 2Y8VA 5J12C 2FATH 5T3XE 5IMMA 1JZ5A 2VRQA 1G7MB 4X99A 1NSNL 2EIEA 4Q9RL 3GTNA 4TUKL 1LWRA 3QG7H 1FNSH 1MRDH 3SPVA 4Q22A 4MHHI 2EDOA 1W3JA 1MCKA 3MRPA 3QPXL 4GMSL 2PW1B 2W9EL 3T0EE 5ECUA 4X5LA 3MA9H 4F58L 3AFBA 5I74C 4TXEA 4LFHD 1HQ4A 4Z7QE 3NIFF 1D5ZA 4CU8A 3FKUS 3HZMB 4Y8DC 5JHDD 2IUZA 3MRBA 4RAUA 3ULUE 1VACA 1L0YA 4Z18A 1TJIH 1FFOB 1AGFB 3GXIA 5ADOL 4CRPA 5BS0B 4PMZA 4BELD 1YMME 2XYCA 4NQXB 5GRXG 3DBXB 2EYSB 5TE7H 4JEGB 2XZCL 4OBRA 5EU3B 3GDBA 2ZSWA 1JHLH 5IB4B 2XGBA 3CD4A 1WICA 3DRTA 3MRJB 5GGUA 1BSIA 3U2SA 3BW9A 5D1XD 2YMXL 1FO0H 5IBTL 4M7LL 5HJ3B 1S5HA 2NYYC 5GQBA 1RUAL 4PMYA 4GIAA 3WJLC 5E0FA 4J2XA 3CDGA 2G5RA 1GOIA 1YNLL 5TE6L 4DAGL 5A6LA 5KVEH 4X4MA 3BPLB 2A77L 2FJGA 1H3TA 2E0PA 2VDMH 4KJPD 1F42A 4X9FA 2XZQH 4Y5XB 3PZTA 1VGEL 3M1BB 2EH8L 1KXVA 1AKJA 1NFKA 1EHAA 1MCWW 3MLXH 2F5BL 5F8RC 3OKLA 3VGFA 4Z0BH 4JZNB 4GO9A 2E8ZA 3HG1A 2IH3A 5L2JA 4QRRB 4R27A 5IB5A 4H8VA 4AXNA 4S1DC 3HFML 2K3TA 4Z7QF 4UBDC 4DEPC 2R2EA 1U8JB 4WI7A 4M61B 1L8NA 1S9XA 4O02L 1VGKA 2AERT 4MDPA 3B9EA 1DQJA 2H26B 1CGVA 3ULUF 1UUQA 4S1SH 1KCRL 4GKNA 4D6DA 1A1MA 1UA6H 1DR9A 5FO8A 1XH1A 2NY3C 2GJ6B 3B5TA 3QWOB 5EBWA 3O8XC 4BQ2A 1RQ5A 4NHCH 2X4SA 3GBNL 4P59L 1RZIA 4MAYB 5HYQB 4HUXB 4O2FA 2WMPA 1YEIH 1Q9KA 5HSFA 4HKZA 1T0PB 2FECI 5BVJB 5HHOB 4X5XB 4NKIL 5L6YH 2KL6A 4MAZA 4XTRC 1ODZA 1DSFL 1DFBL 4TUOA 1UWUA 4J4PD 4PS4L 5GS0L 3AISA 4MX7A 1W3LA 1LK3L 1N5AB 4IRJD 2XWDA 4QAWA 3O2WH 5DI8A 4Z7VA 3QEUA 5FUCC 3BXNA 1C12A 4I48A 4QXUH 5T3XL 2LAGB 4PV8B 4PYHA 3RZCA 4GKLA 2G75A 5EC2A 4MAUH 1OAYL 2VH5H 4DM2A 3UTZA 3AREA 1A47A 1Y0LA 4R6UA 2HJKA 1JK8B 1TVNA 2J77A 2WMGA 3VM7A 4PUBL 2HFGH 4OKDA 5D6DC 4BH7A 2WVVA 3FB8A 3V6OA 5DRXA 2ATPA 2K9UA 4OZIA 2DSWA 5ABEA 1L7IH 1EAPA 1QEWB 3QPQD 2HN7B 1JYWA 4LSVL 1DN0B 1HXMB 1S8DB 5D7KE 3ULUL 2F8QA 1IGML 2XFXB 4LEOA 4PJFA 3GXDA 3WF1A 2WYSA 1HI6A 2EE9A 3FJTA 3QUYC 4ZSOA 4WI4A 5HXMA 4PG9A 3VA6A 2WINA 1JNLL 2I27N 5CIPB 5LQBH 3P30L 5M5DA 4JDVB 5ABFA 4OD1H 3TO4D 1J5OH 4ZPVB 1HF6A 2O5XL 1AR1C 4EQ3A 4L9LC 3OXRA 4MZ2A 1MIML 4UB0H 3B9AA 3MR9A 1P53A 3X13A 4X8XA 2IBZX 4LPXA 3VG0L 2A3HA 1IT9L 4DW2L 3PZMA 4I2XB 4YWGH 2NYYD 4LNVA 1Z2KA 1I7RA 1OAZH 5C92A 3C5SA 1A7RH 2CD0A 5I1DB 5DJXA 2WC4A 4Y5VB 3CSYB 4L4VE 3ETBF 3QEGL 3MV8A 4ZXBA 4WFEE 1MNUL 2X0YA 2R0KL 5C2UB 5A2BA 4NJ9L 4MJ4A 3VFTA 3KL0A 4CD8A 4OF7A 3Q5OA 1V08A 2J6EH 4F3FA 2SEBB 4M7LT 3TP4A 1A9EA 3D9AH 4U1SB 4XAKD 2GTWA 1EO8H 2VLJA 1MVYA 1FYTD 3EJZD 1DUZB 1KJMB 1A8JH 4J3VA 3KPRD 1K5NA 2EXWC 3VJ6A 2D22A 3CZLA 2UWEA 3TJEH 1BVZA 3BPNB 3VGHA 5HHPB 2E27L 1MCLA 5DRNA 4AT6B 2UVEA 1EOMA 2R39A 1UADC 4G8FB 1T89A 4H8WL 2NW3B 2NY3D 5GGQH 3CH8A 4ZMAT 1C5CL 5F1IA 2PN5A 3T2OA 1N8ZA 5A6AA 1R5WB 2CKBL 3MPCA 2EEAA 4RX4A 5CKGA 4B15A 4Z2KA 4M8UA 4DN4H 3VX0A 2EEXA 2EKSB 5FA4B 5TJWK 2X70A 4DKFH 4R3SA 5DQDL 3WIFB 1T2QH 5MP6L 4EKXA 1T5WA 5CMAB 1LD9A 4DWSA 1AR2A 4C59B 3L4XA 4LKCA 3D69B 4X6DA 4XTRD 4PJXE 3VWKA 3C8KB 5C7XH 1VENA 4NWTL 5I73C 1BM3H 1HKMA 4POZC 3RGHA 1NFDB 1WEJH 4E2OA 1IGYA 3SE8H 4FZEL 2AXFB 4QY8A 3WUWG 3L1OH 3P4MA 1E6OL 2X42A 1NBYB 4W8LA 3RVUC 3VIJA 1F3DH 5CSYA 2X7LB 4NBXB 1YN7B 3RUGA 2D20A 2IG2L 1NCTA 1XCQB 1DBAL 3O3BB 2JJTA 4MJ2A 4M02A 4B3LA 1NCCH 1VSCA 1YDPB 4YPGB 1BECA 5KANG 3NGBB 4L8SB 1FL3B 3O11B 2IPKA 4PB9H 3FTGA 4LYQA 4FLRA 1UWIA 1HKJA 4WV1C 4XP4L 3U5UA 3BFOA 5L8JB 1Q94A 1LK2A 5DQ9A 3VFRA 3S4SA 2AJZA 5E5MA 4JPWL 4DGVL 1ZT4B 4CUCA 2NZ9D 1EXPA 4Z2HA 5IF0A 1MCDA 4KI5E 1JD9A 3QUYD 4KTDL 5CBAB 4QRPB 3HZVA 1LEKA 4MNGE 4NO3A 4QP0A 1CQYA 3EAKA 4BSWA 4AD1A 4F2MB 5I2IB 4N68A 5F7MC 2A3BA 4QXGH 2E7LA 5J13B 4HWEH 3WN5C 2VDPL 5JDSA 3DSNA 1JWUB 2O9OA 4DM1A 3VFSB 3V52L 3FRPA 3RM8A 3G08A 2UZIH 1N3NA 1XGQA 4OGYL 4Y8AA 5EU6E 1ZLUH 3SE4A 4TOYL 4GRLA 4O51A 3PZUA 1C16A 2CH8A 2DWDA 3KL5A 3WENA 3DNKA 4OZGF 2WBJB 1JDAA 3HC0B 3L7EB 1U8NA 2VAAB 3NSNA 35C8L 4MQXD 5JQHC 1J8HB 4XZBA 3UEQA 2RTSA 1NC2A 4YHOL 1E4KA 4KRPB 3RPIB 4YNYB 4PRHB 2FH8A 1YEEL 1ZT7A 1F4WL 3IJSA 3AM8A 4JGJA 3RIFF 5MEPA 5DJ0A 4EN3A 4TUJA 4X9IA 5B38B 5IROA 2G60L 1JFXA 4K3EL 3QNXB 2JB6B 4FTVE 1KBKA 2QQKL 4HBCL 4WK9A 3WF2A 4B5EA 1A3LL 2OZ4A 1BGXL 3NACH 1NEZB 3WLBB 4RDQG 5FFLA 5IESH 3MNWA 1PG7L 1FGVL 2D4FA 3EDKA 5FB8A 5HBFA 3GNRA 1XGPB 2F53E 1CF8L 4LCCC 3DV4B 4AG4H 1OW0A 4PMDA 1RULL 5D5MF 1RJLA 3VINA 3RKPA 2KBGA 2EXWD 4KHXL 4KI5F 5I1EH 2XA8H 1NL0H 5HYEA 1E6JH 3K80A 4HS8H 3MLYL 5C0CB 4EIGB 4F8QA 2BVYA 3IDIB 4HEME 4K3JL 5KVFL 3WD5H 3IJ9A 2ZX6A 5HHXH 3RWDA 5D9SB 5EZIH 4NQEE 2FBJL 1U3ZA 5E6ZA 3P0YL 4JPVL 4D9LH 4PGDA 4YR6B 4KROB 4JL1A 4LLMA 3ALFA 1GCYA 3SDAA 4BF7A 4FMKA 3DUUA 2GJZA 2H3NA 3C6LB 3IRZA 3FB6B 5I0DA 3BKYH 2V5RA 4RGOL 2X4UB 3VIKA 3EO1B 2E7CA 1C92A 4PRPB 1CFSA 1IAIM 1H15A 3QAZC 4ZUUB 3BZ4B 2PR4H 2DF3A 2WZHA 2BFGA 2EYTA 3QHTC 3WDPP 5KS9A 1MXDA 5DJYB 2DTML 3KDMA 4HX1A 1OB1A 1HVQA 2D31B 1RV6X 2Q6WB 4PJIA 4KQ3H 1HWGB 1J7VR 1XMWA 4OFYA 1UACH 3P4NA 4KDWA 5ADPL 1SR0A 5FO9A 1VEPA 4XNMA 5CZXC 4PBVC 3MJ7A 2PB1A 5FO7A 3T0XA 2DJUA 4OCMC 3KLAB 2DBLL 3PDDA 1CU4H 3C5JB 2WV3A 3BGFB 4QTHB 4WI6A 4JREC 5I9QC 4X7TA 4FXKB 5DFWH 4F9PC 1NGXB 3W27A 3U7BA 4P48A 1G7MA 3MZGB 3VD4A 1A4JB 1AVAA 2VOTA 5HGAB 1BTCA 2VDRH 1N7ML 3O6FB 1R7AA 3N1MC 1H3PH 4OT1H 4PRAB 2R1XA 3IGAB 5IV2A 3OKEB 1EUUA 4G6KH 2PW1A 5DUPL 3WHXB 3UTPD 3CDCA 5EU7C 5E2TH 3OAUH 3MODL 1JUFB 3BD5A 2KUTA 4M9OA 3QUZC 2OP4H 2KKQA 3T0EB 3RRQA 1FFOA 3CLFH 2CDGB 2X4NB 4EE9A 1AGFA 3T1WA 2H2PC 5BS0A 1HSAB 2GK0B 3WNLA 4JRXE 4NQXA 3DBXA 2EYSA 3LCYA 4XT1C 2FLBT 4WFFE 5EU3A 2EZ0C 5IB4A 1GGIH 2DYPD 3MV11 5IQ9B 1MI5D 1K2DB 3MRJA 1YMMB 2WLZA 4R26H 5DRZB 2VLKE 3SUSA 5HJ3A 1U3HB 3TVMB 4IIQC 2XFRA 4PTMA 2O9PA 2UUDK 5HI3C 2NY4B 3BD4A 5B22A 2GITB 1W72L 3MBED 2P5WB 2CIIB 3ARGD 5SWZB 2W0FB 1JZ3A 1S7UB 3RDKA 1E4XI 4YHKL 2BSED 4Y5XA 3GSUB 4AQ1B 3FFCE 3RM4A 3M1BA 4HIHB 4YDKL 5KJRL 2UY3A 1NGQL 2VC9A 3L2MA 1AXSB 4TN9A 5EN2B 4NUGH 1UHVA 1XIWB 3AIRA 2E7MA 1E6XM 3LKSB 5D6CB 3U36B 1YQ2A 4QRRA 4ZFGH 1CICD 3AVEA 4GAGH 2DL9A 3PGDB 5IP4A 1U8JA 2VL5A 4M61A 4AIOA 1TZIB 5FAAA 3ROOB 4N0YL 3AMKA 2H26A 2A9MH 2CMRH 4YFLF 3V7MA 1TETL 1JD7A 2P8MB 1F8TH 1ZOXA 2VSCA 4KK6C 1BOGB 2HTLC 5DD3H 3H7BB 2GJ6A 1IKFH 4JANB 3QWOA 1CDBA 3DV6B 5IB2B 3OQ3B 3DC0A 4WKHA 1N0LA 4IMLB 2OSXA 2GAZB 1WBXB 4JKPH 4WI8A 2VDOL 1ZA6B 1B0IA 1D5BB 5FYKE 5BMFH 2UY5A 4U5IA 2BMKB 3EYVB 5E5RB 4UQCA 4MSWB 4AIUA 1RZJL 1GOWA 3NPZB 4MAYA 5HYQA 4HUXA 5EBMB 4LNRB 1RIUH 4LSRH 1ADQA 3PNWB 5E1HB 1P6AB 5BVJA 5HHOA 2XVLA 1ZV5A 4AZHA 4K71B 2VZ3A 2FGLA 1BVKA 4U6VL 4X5XA 4LLUB 3SY0B 3LPPA 3KYKL 5F3HB 5EUOE 5D71L 2EDTA 3MSDA 1K8DA 1CXIA 5C70A 4PGZA 2OXGA 1N5AA 2BVPB 4R7DB 4MJIE 3NFPB 4HKXB 1SMAA 5CZXD 3EGSB 3F4VA 4PV8A 2X1WL 3EW3B 3B8SA 4JLRB 1LO0L 1BG9A 4MTVA 4R4NC 1CXHA 2WHLA 4KAQL 3SGEI 5ENWB 4L4TB 1KCVH 5DWUH 5EH1A 4W68A 4LQFH 1YNTB 5DUMH 2YRZA 1E0OB 3DI3B 3BUYB 2A83A 1ZKAA 2XN9E 3HZKB 1EEUA 4LRIA 2EIZB 1UG6A 4EBQH 1QEWA 4WWKC 3QFJA 3N18A 5F7YC 2HN7A 3ALPA 2J1KA 1DN0A 3HPLB 2GJJA 1HXMA 1KOAA 1S8DA 2OXHA 5IKCB 5KBNC 2M2DA 4OF8A 1WZMA 3PQYE 1WDQA 2XFXA 2NY2D 1XF5B 4R90L 3VXRE 1HCVA 1DWIM 4J6RH 2KDGA 2OK0L 4HF5L 4LPVA 4AD2A 1I9JL 5A6BD 1B0WA 1BJ8A 1L6XA 5CIPA 5H94A 3CPUA 3BLKA 2H2PD 5JIHA 3G9AB 1UWRA 1I7UB 4JDVA 2CIKB 4EDWH 4P2OB 2EPNA 3NUKA 2C7UB 3BN3B 5EUOF 5A6MA 3VFNB 4ZPVA 3HE7D 5MEND 2EZ0D 1YNKH 3O45B 1FRGH 5I18H 1GZQB 3RI5K 5E4EC 2APVA 4I2XA 3VXQA 5D7JD 4XPBH 3GK8L 2Z31C 5FYLH 5I1DA 5HI3D 5IB1B 5HYSB 4Y5VA 1KIRA 3CSYA 3RFZC 5MHSD 1UWSA 2A6DB 4J3SA 3LDBC 3RILA 3PZGA 5LA2A 3NZ8B 1AGCB 4LCWE 4M8VA 1DLFH 1YYML 2W38A 4L4VB 7CGTA 2DM7A 1TITA 1GAFL 1EEQA 2SEBA 4U1SA 3VFMB 3V4VH 5GGRY 1MAKA 3VNZA 4NRXB 3PWVB 1DUZA 1KJMA 2X40A 4JL2A 5CP7B 4MNKA 1KGXA 3V4UL 5HHPA 5DURD 5FYKL 4RA3A 3TC9A 3V6FB 1Y6KR 4AT6A 4KK6D 5JXEC 2HTLD 3LZFL 1PGRB 4W88A 1F6AB 3CGTA 2IAND 5GRUH 2ZNWA 1PZ3A 2O26U 4MDJB 1ZXQA 1R5WA 4JKWA 3N1PC 5HPMB 1EO5A 1UM5H 2YHGA 3SCUA 5HHNB 1PFCA 2EKSA 5FA4A 1IGIL 4YK4B 3WIFA 3S97C 2BNRD 2DI7A 3BVNB 3L4ZA 5CMAA 2AQ1A 4LSSL 4NFBA 5AZ2H 4XVTH 2CBVA 1KENH 4K9EC 4JDTL 3D69A 1OWQA 4NZUH 3C8KA 1HINH 4BA8A 5MI0C 3DYOA 1WAAE 3G6JB 1ZWIB 1IQWL 1NFDA 1XAUA 2AJXL 3FO2B 1QFWH 4P5TC 5I1LB 3ULVC 2J25A 2AXFA 3VGEA 3BSZL 3GRWL 4U3XA 4PJXB 3NAAH 4Q6IB 4Q7NA 5D8WA 1XV8A 4WI5A 3TTOA 2J88L 4PBWD 3ZZ1A 5J11C 1NBYA 4J12A 1UKOA 1FZJB 1M05B 3BKCL 4ZOBA 1G0CA 4R4ND 3PZ9A 5E7BA 3WFCH 2X7LA 1YN7A 3WMBA 3O3BA 3NSMA 3VXUE 4XNZB 4NJAH 3NH7H 2VR9A 1F4XH 1YDPA 3LQAL 4YPGA 5DYOB 1HT6A 1GVYA 4L8SA 1FL3A 1LJYA 3O11A 2X4RB 1CFQB 4ZYKB 4WWKD 5LGHH 3TBSB 2HT3C 5I1CH 3CZFB 1QBML 2VURA 4JM2C 1ZT4A 2C26A 1E5NA 3MRFB 2V5YA 3ZOAA 5DD6B 5HVGB 5CBAA 1TZGL 4LP5A 4QRPA 4I0KA 5T5FL 2R9HC 3UTSD 1KGUA 1WFUA 4F2MA 5I2IA 4XHQA 2UWFA 1CBVL 4GZJA 2B0SL 1UD6A 1KIPB 4U1JB 2AV7B 5EU4B 1FLTX 1WTLA 5D93B 1JWUA 1UCTA 3VFSA 3WIHL 3OF6A 2HVMA 2VC2L 4G9FD 1GW1A 1WAAF 4OF6A 3CCHB 3I6KB 2WBJA 3GSNL 1CR9H 3HC0A 4NYLB 4XP6H 3T04D 4P8UA 3NFSL 2VAAA 6TAAA 1J8HA 4UILH 2AJYL 1WSST 2Z31D 3F6LA 1MAML 4MMXC 5F1KC 1H2JA 2I9LB 5EU6B 4JQXA 2JJWA 4PRHA 4YNYA 5FCSH 4G80B 3RPIA 4QHMB 3HNSL 3RNKB 5A3IC 1CS6A 5B38A 3B9KB 5E09A 5FGCB 1GHFH 5FM8A 5I8CB 1JIBA 4HG4J 3QNXA 5C8JB 2JB6A 4P4KB 2W9LA 1MHPL 1NAKH 1ZHLB 5CJ8A 3SUUA 2YD6A 1NEZA 3WLBA 3POCA 1TFVA 3DXAB 3IFLH 3UBXI 1V6VA 1HH6B 3BDYL 1HJVA 5FCUH 2DI8A 4FTVB 3CHDA 1VKXB 2B1AH 1XGPA 2GHWB 3VIOA 1GQIA 2R4SL 3FQRB 3MFGB 1BG4A 3DV4A 3VXMA 3MMUA 3WSQH 5TFSH 2JE8A 4HWNA 4XNXH 1FFQA 1EJOH 4KUZH 4YX2L 4XZWA 2L4OA 1EH9A 2Y24A 2F53B 4NGHH 4XPHL 2DM3A 3C09C 4D6HA 1ACYL 5C0CA 1UC6A 1UKTA 4I5BB 1YQVL 1SY6L 1V5JA 3IDIA 2XFYA 3BGMB 3RCNA 3WD0A 3QI9B 4KY1L 3FQUB 3BCFA 1N59B 2CRZA 1JZ7A 5D9SA 4KTEL 3VVGA 3CVIH 1KN4L 4K9EH 4P49A 4Y2DC 2D9CA 3DVFA 4YR6A 5E4IA 1C1EH 2YUVA 1BF2A 4PJEE 1D9KB 4ZO6A 1MJ7H 1IAOB 4HCRL 3C6LA 3FB6A 5DK2A 4YHML 4NQEB 3HI6H 1BWMA 3ULVH 1R3KB 4ZPTB 2X4UA 3EO1A 2VDQH 3VMOA 4PRPA 9CGTA 3MV7D 3IJHB 4ZUUA 2RFXB 3BZ4A 2VLLA 1FLRH 1HVXA 2X1IA 1Z5LB 3SIMA 3HS0B 2BSRB 1JWSB 2YXFA 4GLRH 2EJ1A 1ZGLP 7FABL 4P5TD 4NSKB 3ULVD 3DX8B 1KTLB 4AD4A 1OSZB 2XVGA 3MFFB 5DD1L 5DJYA 2PKDA 5ILTH 3SOBH 4OUUB 1ZB5A 2D31A 3RO8A 2HT2C 2Q6WA 3RVVC 2FB4L 1CVSC 3CU1A 4OB5L 4EZMA 3T0WA 2F8OA 2VX7A 3ESVF 3H42H 4X6EB 5EIQA 1SEQH 4LLDB 2ZXAA 3CTTA 3NZHH 4FK9A 3EJJX 3KLAA 3C5JA 4YHLL 4QTHA 2HT3D 4PGJA 4AZ8A 4NO2B 3L95B 2QPUA 4X7FC 2GQHA 3MRMB 4FXKA 2XVKA 3SURA 1BOYA 1NGXA 5HYIA 3QGVA 5DT1H 2R69H 5I17B 4Q6YA 1LEGB 1O7SA 2VMFA 3RAJH 4P46B 1A4JA 1NPUA 5ICYB 5HGAA 3O6FA 4KXZI 4U7KA 1NGZB 4FQLL 4PRAA 2EPOA 3IGAA 5HPOA 3OKEA 4KU1A 3PWPB 5IHRA 4AY0A 3PBGA 4AM0B 5KVMC 5CZVL 4E0RB 3CZKA 3WHXA 3IDYC 3TA3D 1J01A 4UTFA 3WEXB 1JUFA 5DXWA 3UO1L 1MFDL 3QDJD 3O4OB 3T0EA 2H45A