4HMCA

Crystal structure of cold-adapted chitinase from moritella marina
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
528
structure length
528
Chain Sequence
GTITSQDDNVVVGYWHNWCDGRGYQGGNAPCVELKTVNPQYNVVNISFMKVYDIAEGRIPTFKLDPTIALSEAEFIAQIDTLNSQGRSVLIALGGADAHIELTRGDEDALAAEIIRLTDLYGFDGLDIDLEQAAITAKDNQFVIPAALKMVKEHYRKTGDNFMITMAPEFPYLTANGAYTPYLTELDGYYDFINPQFYNQGGDGLWIEGVGWIAQNNDALKEEFIYYIADSLINGTRNYHKIPHDKLVFGLPSNIDAAATGYIQDPQDLYKAFDRLKAQGQPLRGVMTWSVNWDMGTDAANNSYNQQFIKDYGNFIHNQLPPVTDMTPTLSGIVDTRVELDSHFDPLIGITAKDYQGNDITADVTVSGSVNTNQVGDYLLTYSVSSDDETTNQPRKITVYEILPAFTGITDTTVVIDSEFDPMQGVSASHPTQGDLTANITVTGEVDTNVVGVYELTYQLFYGQDNQQNMTDKRIVTVVTDAVSDDDWQVGSTYVKDDKVTHNGATWTAQWWTKGEEPGTTGEWGVWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a complete four-domain chitinase from Moritella marina, a marine psychrophilic bacterium
pubmed doi rcsb
source organism Vibrio marinus
molecule tags Hydrolase
molecule keywords Chitinase 60
total genus 167
structure length 528
sequence length 528
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2012-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
A PF16403 DUF5011 Domain of unknown function (DUF5011)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.20 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Carbohydrate-binding module superfamily 5/12 4hmcA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hmcA03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hmcA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4hmcA01
3RRQA 4KC3B 2BHZA 1PQZA 5FUZH 1YMME 1WT5C 2GAZA 3GGWB 1X5XA 3T0AA 4FP8H 1OWQA 3BAIA 2Y5TB 4O2CB 3W81A 2UWFA 1IGJB 2H26B 4TPRL 4MJ2A 3FB6A 1A6VH 2HJFA 4ZNCD 4GRMA 5BS0E 1TQBB 1JFQL 1RY7B 1PKQE 4UQBA 3QIUB 4HUMB 5L88H 1DVFC 1NMBH 2C4FT 5E5RB 4WV1B 2YLAA 5TQ0H 1CPUA 1L7IH 1UA6H 2VLRB 4WUKH 1SEQL 5T1LA 1AI1L 1Z0NA 4PTUA 1JGDB 4D0DB 4A3HA 3OAZH 1BD2A 1YMMB 2DQEH 2IAND 5HHOD 3IS1X 3T1FA 1MVFA 2NY4D 3AM8A 4Z78B 1NEZG 3MRLB 3GMNA 4JFXA 3JWNC 1PAMA 3RPKA 1CEOA 3BAEH 2ZG2A 2WB5A 1F00I 3V6OE 2P5EE 1UD5A 4WRLA 1N5YL 4AZGA 1IGFL 3W24A 3QEQA 3SY0B 1W72L 2AJUH 4NWTH 1HK6A 1HKIA 3QIWB 2XOTA 4Q22A 4PGEA 5DMYA 2YL8A 1FRGH 1YEFL 4P2OB 5IP4A 5A69A 1E4LA 4C56A 1ZHLB 4AEHL 3MRJB 1Q9OA 2WW8A 4AENB 3F7PC 5A8MA 1EK3A 1MNUH 5J4MA 4HUXA 1WEJH 5C0RH 3CFEA 3LMJL 3AUVA 3UO1L 2GTZA 3II1A 4L4PA 3SUSA 3WBEA 5K9OA 5F3BA 1AHWB 1CDUA 1RPQA 5FO9A 5EOTA 4FOMA 1S5HA 4L4JA 1R5IB 1RQ5A 1XGRB 4MX7A 1JWMA 1JHTB 2QQKL 2OM5A 3AY4C 3IJSA 3FQNB 4R96B 5F7DA 3HE6C 3QHZL 4D0DA 3FO2B 3AHTA 4ODUA 1MI5E 2AS5M 2DI8A 5M95B 4XZUA 5MERA 5F93C 3IVKA 4DGYH 1P5UA 4NO2B 5F72S 3VWJC 4I2XB 2JIWA 4WWKC 4ATWA 1W91A 4G5ZH 1GSMA 2DS4A 2D03L 1ZGLP 3DLQR 4JO1L 4QGYA 4HKJB 5I8EA 5C3TA 1XC6A 4W88A 1D5IH 1G7HA 5TE4L 1N5YH 1HXMB 4S1QL 1U0QA 3CSYA 1U2CA 3WD5H 1UM5H 4HWZB 4JO4H 2J7GA 3TYFB 3BRGC 4TVDA 1MRFH 1NFIB 4OAWB 2CH8A 4J1UA 3OWEA 4J3UA 4H8HA 3P9WB 1P9MC 2CRMA 2DQJH 4MCYB 3GBDA 1C92A 3EHBD 4X9HA 3FNDA 4LLQA 4UQAA 3FQUB 4QRUB 3TT3H 4ACZA 3GMOA 1XR9A 1UD4A 1FV1A 1EAJA 4KKBC 3VILA 5HYQB 1U3JA 5D70H 4JKLA 3P0YH 4Z2IA 3IFNL 2R8SL 3M7SA 2LVEA 1E1FA 5I66A 3QEQD 4KTDL 4RFOL 2HT2D 2DSZA 4Y4HB 3W39A 4UQ2A 4EVNB 3BZ4B 1N82A 2F54A 4XC3L 1IKNA 4GRLC 2VUOA 3K0WA 4Y5VB 1FLRH 4GT7A 3EYVB 1I8LC 5A8PA 4QXTB 3OKDB 1V3JA 4OQTH 4PGJA 4PMYA 3HHRB 3AREC 4UI2A 3BKJH 5I77A 1MHCA 3ARDD 1CR9H 5F6HI 4M1CC 4I13B 3MNWA 2D1ZA 3INUH 1JPFB 3NFNA 1SMAA 4N1CA 5KG9A 3NCCB 1UM6L 5IV2B 2W63A 3WFHB 1AH1A 3BN9D 3RTQD 2VITA 4Z7OE 3C5ZB 1MCBA 2C8NA 1KC5L 4U6TA 1OW0A 1W72B 4PJDE 4UT9L 1M71B 2J8FA 3SKNB 2WP3T 3PWPB 4MNGE 5HI3D 4M56A 2J4WL 4BCEA 1I8MA 2W91A 1Q9WB 1DVFB 1HJWA 4YIQA 4DWSA 5A2BA 3BUYB 3PJSB 3RZCC 3WYRA 4F7EB 4HKBB 4H8VA 1FPTH 1AQDB 5JA8B 5JIIA 5KVEL 4XI5C 1M04A 4L8SC 2D7NA 3Q6FA 4IRJD 3LS5L 3D25A 4EUPG 3QJFA 1FIEA 2ATPB 3EAKA 2VTFA 4ZPTB 2CIIB 4KFZC 3C60B 2J5LC 2GUOA 4Y5XB 3PL6B 1UD8A 3GHBL 4HJJL 4DVRH 4P2RA 4KTEL 4PYSA 1E4XL 4P8UA 1KCSL 4RNRA 3QQ3B 2DIEA 4HGKC 3H8NA 4N9GB 1QG3A 2CPCA 1SY6H 4HZLB 5GSRA 5KVFH 4PTUB 4UDTB 3MV9E 5LWYL 3O8XB 1XSIA 2QL1A 2NY0D 2A6DA 1TETL 3WJLC 4N0YH 1C5BL 4RNRB 3QQ3A 2WWDA 2H9GB 1DEEA 3BHBA 3RVVC 1AQMA 3PN8A 3RZCA 3UCQA 1AE6H 4XWOC 2D3VA 2MMXA 4TUOA 4OTXH 4H1LH 3WNLA 3O4OB 5D2LB 3IKCB 4MA1C 1QA9A 3L9RB 4CD4A 1P53A 1MCCA 5ABEA 2QEJA 4JHAL 1MLCA 4GO8A 4ODVL 4P2RD 3VXOA 3HCVA 3IF1A 4XGZA 2DIJA 3NPSB 4RGOH 3FQRB 1HDMB 2V3DA 1X6NA 5HHMB 1RK0B 1K3IA 1CDCA 1HZHH 3QXUA 5GXBB 3ALGA 3SJVA 2BFVH 1CTNA 4HK3J 4QOKB 2J88L 1MQRA 4GS7B 2X0YA 3HPJA 4Q7NA 3SCMD 5F7LB 3RDTC 5DSCA 4OGZA 4O9HL 1JDDA 2ZUMA 2CBVA 5I1CL 1A1OA 1HHKA 2XICA 1MCWM 1E6OH 3O6LH 5FFLA 3P11L 1CDBA 3U4BL 5JA9A 1QLFA 1OD9A 2X4OB 2AJVH 5BRZA 5BOZG 2F8XC 4YDLC 1T83A 1W0WB 4HJJH 1HHKB 3ZE0F 5E2UL 1OF2B 1MCDA 2Y23A 2YUWA 5EA0L 4MB4A 5HI4D 1QLFB 1FL6B 4M80A 2FJHA 1HKLH 3QFJD 3ZYOA 3H7LA 1J8HB 3QDAA 3KXFE 1GAFH 1P6AB 3RY6C 2AJXL 1PZUB 1X5JA 2DKMA 2UZYB 2YC1B 3UCRA 4D8PA 1HIZA 1LWHA 1CVRA 2IQAA 5F89A 4GAGL 4UAOC 3SCOA 1I3UA 2Y9RT 3QXVA 4HU0A 3IAQA 2P49B 2WMKA 2RQ8A 2YEZB 3CSPA 2XYLA 3ISWA 5C07A 4NIKB 2IH1A 5DRXB 3QCUH 3MUHL 3RAJL 1G0YR 3N85L 4ODTL 4XGZB 2J62A 1H3GA 2M8XA 3MUAA 5FKPB 1IQDA 1R6VA 5BXFA 4Y19D 2WQRA 4YDLB 3QQ9C 5KSAC 3AGVA 2Z1KA 2WANA 3MV8D 3VWKD 3NSNA 3U0TA 4JB9H 5L8JB 4KK9C 1B3WA 2WWCA 5D96C 3RWEB 3H3BC 4I0PA 4U0RB 3ARDA 4FP8L 1A6AA 5FGBA 5J13B 4LSVL 4Z7VF 2GY7B 4XXDA 1W72A 3GSRA 3E3QE 2Q86B 5AAWA 2HVMA 2XG5A 4PRNA 2LU4A 1NGXB 5FHBL 3P9LA 2F5AH 4ENEC 3LPPA 1CDGA 1RMFL 1WDQA 1AGFA 3T2PA 3HG1E 3C6SA 4CMMB 4HT1H 2IADA 1RULH 1J05B 2FZ3A 3OKOA 3U4AA 2HWZH 4CNIB 5DZLA 4CN6A 3W0WB 4MA7L 1QI3A 3BRFA 3WUGA 4BH8A 2DI7A 2VMFA 4X0VA 3VFGH 5DD5L 3O2DH 1TZIA 1IQDB 2GJ6D 4I3GA 5DEGA 4HPOH 1UEYA 3BAKA 3CDFA 1EHNA 4I0CC 1CGSL 1RURL 3QDHA 3WUWA 4EVNA 1JG9A 2CCRA 1H0IA 2E9BA 3CK0H 3PWLA 5DUMH 1JYXA 1ZA3A 4AEEA 5D1XA 4P4KC 1B4JH 3DO3A 1INEH 3FT3A 3BCFA 4NRYB 5J56B 2NXZD 4OLYL 2YD6A 2IPTH 2VLRA 2F54D 3O8XC 5E2TH 1MJJB 2JALA 3SCNA 5E94A 3UEQA 4GKNB 2XA3A 3MRCA 3GMLA 5JW3L 4M7KL 4WI6A 4XZWA 3MJ9A 4MLIA 2DD8L 3TO4D 3GSNA 5ICZB 4MJ6B 4PJCE 5I6XC 1WTLA 3CH1A 1L7TL 1BBDL 2IFFH 4ODSH 1A14L 2GSGA 2YXMA 3H3KA 2XN9B 1R7AA 1GC1C 5F3HB 4XNZC 3C08L 3EUUA 5FYJU 1Z5LB 1AI1H 4Y4KD 2G3IA 1BX2B 4NYLB 3AXHA 3NN8A 5C2BH 3IKKA 3KR3L 5JQ6H 3D1MC 1ADQL 3CDGB 2WVTA 4OGAC 3G6JA 1GQIA 3WXWH 3RGVB 2P7TB 3KWXA 2HN7B 5EOTB 4GKZB 3KPLB 4RAUB 1LE9B 1BLIA 1OPGL 4U1SA 2WCSA 3NH7L 1M7IA 5BVJB 1T04B 4WENB 5C0BA 5LWYH 5IVOA 3DX9B 3RA7L 1MJ8H 1CD1A 4P2OA 5ICZA 1NLDL 4ZXBC 4FZ8L 4NQTA 4EDWL 5FO8A 1XF2A 4YN5A 1BGXH 1F8TH 2AJ3A 3JWDC 2EPKX 5MI0B 3V7AG 3TH3T 2WIMA 3FRUA 2CGRL 3T65B 3C6LD 4BJLA 2VL4A 3H9SB 3RWJB 2MHAA 1BGGA 4G6AC 1MCQA 2VLKA 3VXMD 5BV7B 4P3DA 5CPSA 2JK5A 1G7JB 5FO7B 3G6DL 1GGBH 3BH8B 3KPSA 3QDMB 2UWEE 4RCAA 5GGRA 5JW4N 5LA0A 3QCUL 3L5XH 3SCMA 1RZKL 1FNFA 1KXQA 4WUUE 1EHAA 4MA1B 3WF3A 3O4OC 2W0PA 1Z9OA 1V6WA 3BCDA 2IANA 4KZEH 1YYMH 1DBJL 1X5IA 3U9PH 4P49A 3BT2H 2F74B 3T0XA 1I1YB 3I9GH 4K3DL 5GGQH 2MANA 4W6XB 4H20L 5EO0A 3UX9B 4GAJL 2E7CA 2C1PA 2BVOB 5CEYB 3DX8B 1UWTA 5M03A 1JHLH 2LTQB 4JFOB 3V95A 5JHDB 4JRXA 4J3SA 3HRPA 4D9RE 3V6ZB 1KTLA 4KVCL 4RGMC 4DJMA 1Q9KA 1QOKA 3QRGH 3VWJA 5F7HA 3UERA 1OARL 4WY7H 4BUHA 2XVKA 4PJ9D 4M8UA 1KLUB 1DBAH 4QAWA 4KTDH 4XB8A 5JHDA 4JDTH 5D2NE 3VOCA 3CZFB 5BROA 4NO5B 4JCLA 4PJGA 1RFDH 3KLAB 1KB5A 5HHVH 2DYPB 1QVBA 3CFCH 4W4NA 4TOYH 4W81A 1Q0XH 4NSBA 4NOBA 3SE3C 2AI0L 4XCCH 4UU9B 3IS0X 2CMRL 4PMXA 4KV5F 4AM0A 3OGRA 4K2UL 4OZ4A 1L9MA 1UH3A 2Z8SA 4M61B 1BAFH 1FC2D 2D4FA 4HGMA 4OZHF 2DT2A 1DBML 1IV8A 4KRUA 5A8OA 2X42A 4RGOL 2CMRH 3TH2T 3UAJD 4FQXB 3DV4A 4BSVA 1UQSB 1X5GA 2EDQA 3HAEA 5FCUL 4LNRA 2B39A 4N90E 4ZSOA 3K4AA 1LNUB 3EOTH 4UFLA 4JM2A 4YHOL 4MMZC 1B0RB 5D9OA 3STLB 4PRPB 4OLWH 4LVOB 3EMCA 4QXUL 4H1LA 5L8LB 4KMQA 1OL0A 1QR4A 4KDTC 3L5HA 4XNXL 4LBEB 3AVEA 1MFEL 5AD0B 3W2DL 4QY8A 1PKOA 2X4OA 1F13A 1RVFH 4NUGL 2E6JA 1FDLH 4B0MM 2QR0B 2PI6A 3D5HA 5B8CC 1MHEB 1S7XB 4YFLF 1XZ0B 3T4YB 5D7IA 5C6WH 4XCNA 2VQ1B 5IB1A 4DN4H 3GXFA 3SDCB 4NQEA 4AZ5A 3D39B 3MLWL 2O9TA 4XVTH 2FX9H 1OT2A 1SYVB 1FNEA 3HG1D 2XZQH 5FYLH 3QG6A 4EI5D 3M07A 4OCLC 4G80A 1NPUA 3L4TA 1IILE 2JB6A 4GI6A 4K7PH 3CD4A 5EBWA 1OBAA 2HFFB 3DO7A 3WFCL 2EH7H 4LU5L 4YBLB 2P5WE 4ETYA 3LS5H 2F53D 4DZ8A 3DMMA 1B0IA 2BNRD 2VIRB 2E8YA 2VERN 3BQUD 4Y89A 3P9MA 4LYPA 4G42B 4L8CB 1TMCB 2J2ZA 1KENH 2QQLL 4WI4A 4R26L 5E6IC 3V4UL 4XVUD 4QY8B 2B20A 4QHKJ 2B5IC 3FQWA 2GK1A 3P4OA 2V17H 3PGFH 4RWYH 4M62H 1S9VA 1FYTB 4ISVB 1QSFA 7FABH 1BGXL 1ONQA 1OIMA 4J8RB 5ESQA 5MENB 1FP5A 4LHUD 4L8DA 1FAIH 2DLFL 5IBTL 4D6DA 1XH1A 4WHCA 4NO2A 2CGRH 3CC5A 4AIEA 1II4E 4OCMC 3QCTL 4I18A 1Y18A 3D2UB 3OF6A 3PHQB 5C0IB 1OOAA 2A6JB 4NZUL 2PB1A 4DN3L 2BSSB 5EN2B 1NGXA 1JGLH 5HYEA 4HKZB 2ADGA 2RJMA 4K8RL 2QPUA 4P2CG 5FO9B 2GKIA 2VAAA 4XZBA 4OD3L 1NEUA 4GI9A 4KI1A 3B5TA 2AJZA 3U4EA 4OZGB 2DJUA 2MNUA 2Z4QB 4A6YH 1MQKL 3ARRA 4I3SH 1MQ8A 4TVPH 2HP4A 4JANA 3KVQA 3S36L 2ARJA 5GZNC 3EFFA 2GW5A 3ESUF 5E9DD 5E9AA 3IGAB 3TVMC 2WUCH 3KPRD 3MRHA 2HVJB 1N8ZB 2V9RA 2RAMA 2OMNA 1QR1A 1K8DB 4UR9A 2P5WA 2O5YL 5CP7A 5IT2L 1H15A 5HDQL 1ODZA 2FL5B 1KJ3L 1HIML 4P2QD 2JIXA 5HVHB 2W5FA 1W0VA 2Q8AL 4OCXH 4M29A 5JXEA 3ULVC 3JVGA 4ZQKA 4JFFE 4NQXB 4FFVC 3RWEA 4AZ8A 5LXGH 3WH9A 5L9DL 3LH2H 4U6XB 3IETB 5JW3H 1HX0A 3MBEC 1TDQA 1B3YA 5ESQB 1NUNB 2ZPKL 1YEKL 3QPXL 1PZ3A 3LQAL 3QUZB 4JQXC 5B3JE 5EB8A 2GTWA 2Y5TA 4O2CA 2J1KA 3V6FA 3TBSB 5L2KB 3TV3H 2PETA 4AD5A 4HK0B 2R4RL 5GGUA 4JQIH 4KUZL 2OSWA 5CLTA 4DAGH 3L5WB 4ZSOE 4YDJB 1FZOB 1KJ2A 1UZ6F 2Z9TA 2VDOH 3GBML 3Q1SH 5JXEC 2IBBA 3ARPA 5DJXB 3A3HA 3WUEA 4IDJL 2Y36H 2D4DA 3DBXA 4LF3A 1B3VA 2DWDB 5A6JA 3MROB 2PYFB 3MSPA 5DJ0A 3KG5A 2MCG1 2EIZA 1YEEH 2O5XL 1CIUA 2VWEC 2Y4SA 3OKKB 4J1UB 4Z8FL 1B1YA 3GUTB 1D5MB 5D2LE 3JUGA 3MGTA 4MWFA 4OF7A 1EDQA 4C55A 3WN5B 1LHZA 3OZOA 2VC2H 1UD6A 5HYJD 4ZFOL 5IMOB 3V0AC 2BC4B 5L88L 4ONFH 2EIZB 4L4VA 1HXJA 1JP5A 4HAFA 4XC1L 1E4KC 3MRCB 2NY4B 3PZMA 4QFUA 2ZUQC 3ULUF 4XNMB 4YDIL 3RGVA 4NN7C 2EXWC 4I0PC 15C8L 2BVPA 2J47A 5I23A 4KI5E 4DW2L 2X2YA 4GZIA 3WSQL 4NRYA 5CBEA 1U93B 2Q3ZA 4J4PD 4RSVA 1Y7VA 2Z31A 3FB8A 1F4WH 1KN4H 5FGRA 4ONGL 5CJ5A 2WNWA 2ZNWA 2AK4A 5DQJB 4AWEA 2OYKA 2QSTA 4Y19E 2NY2D 4M1DH 1MLCB 3DRQB 3OZ9L 5D9MA 2CSPA 1U8LB 1CXFA 3LB6C 1KIRB 1WCBA 4MQTB 4NP4H 4PG9A 1E72M 2AGJH 4TSCH 4X6BB 3BPLC 1KXQE 3VXPA 5T5NG 3TJHC 3WLWC 1YPZB 2IALB 3O2WL 5F6IC 3AHZA 2DQTH 2UWEA 3BJ91 3AJ7A 5IKCB 2FR4B 1H3XA 1XF4B 4J3WA 3DRTB 4POZC 4PBGA 1ACZA 1XIWB 4NUGH 5DQDH 1HEZA 4RMTA 3NYDA 1BYDA 5FYLE 3L3IB 4Z7VE 1DCLA 3PHQA 3O8XA 5C0IA 2Z31C 5IKCA 4Z2LA 2MPAL 4G8FA 2YK1H 4KRTA 2FO4A 3MRDA 3OXSA 2ZUQB 4YHZL 3RMEA 1K9FA 3BKYL 3M45A 5CD3B 3WFBH 5CPQA 1A6ZA 4MB3A 3IJ8A 3DMMD 4HFWB 4NKQB 4FQCL 1NCAH 4W84A 1ZHBB 4HIHA 1OHQA 1BLNA 5LXGL 3ZT5A 5CS7A 4PLKD 1INQB 5CHNA 5ESVB 1A2YB 2DTMH 4Z7WA 3HC4H 2OWWA 2B5IB 2EC9T 2I60L 5BXTA 1ZWIA 1M7XA 2JCCE 4KRPC 3SCRA 1HJQA 2IXUA 3MR9A 2F58H 4P5KB 3T3PE 5I1IL 1MXGA 2E4TA 2IQAB 3ARBD 3IDGA 1L6XA 5F89B 3WH8A 1LG2A 1WZMA 2BXZA 3UBXG 2H2PD 2J7BA 1G7JA 5FO7A 2RBLA 4CW1B 3A6CL 4Q9CA 2ZOLB 3QIBA 1R3KB 5EUKB 1PSKH 3MO1B 4ACPA 2XFRA 2ICWB 5J0BA 1Z2KA 1E0WA 1RZGB 1NBVH 5TDOA 1OAKH 2BVUA 3QJHA 2VYRE 3O6MH 4MCZB 5ANMB 2F19H 4WGWB 4QRQB 2QADD 4TRPL 3AZRA 3DSFH 4KJWC 2XTJE 1IC4L 3B9EA 4NNXB 4YWGH 3RTQB 4HV8A 3DYOA 4N0YL 3RNQA 2OS7A 3PGDB 4YHEA 4HAGA 4XCEB 5E8OB 2WMJA 4NUJA 1MOEA 3UTSD 4DVBA 2GIYA 1MFDH 3BGFC 4R97C 3I6LD 4NO3B 4QRSB 3D85A 2PWFA 4TTGA 5TF1H 3ZTNH 5JIPA 2X4QA 4KK8D 2EYSA 3V5KA 3GB7B 3HPJB 3LV3B 3U83A 4PGDB 4I8DA 1YN6A 3NSXA 1OD8A 3SDXF 1F6AB 3QO1A 4H0GA 1MI5B 4U1HA 3AHVA 2P8PB 7A3HA 3GJEB 4O4YL 4AZHA 2EDOA 4X0KB 2V2TB 2ADIB 1G7PA 3BKYH 4JPIA 1UZ6E 4OIBA 3NTCL 4JKPH 3DV4B 4PJAF 4Z76A 3RM4A 1LO4L 3ZE1E 3NA9H 4O02L 2EO7A 1BQUA 1KEGL 2EBNA 4FQXC 4QHNB 1FNLA 1ZVSB 4C58B 1YY9C 3L5IA 3U7BA 3W11C 3S5LG 3BDYH 1TFHA 1B0GB 4HIEB 1RIHL 1EX0A 4KMTH 1CXHA 4AM0B 3FFCD 2EO1A 2H3NA 4U0QB 3WN5A 2C3VA 1Q38A 2UUDK 5E1HB 1MXDA 1G6RH 3MJGX 2HAZA 2KKQA 2WBWB 4FFYL 3OLGA 3OQ3B 2DQFB 2XWTB 5TE7L 1F58H 2AJSH 4YZFF 4R4BB 1ZHNB 5MEQB 1ISVA 4BS0A 3HS0B 5JIHA 5TF1L 1K2DA 2VX4A 4UNTA 4FQJL 3VJ6A 5A2CA 2E9LA 4Q9RL 3ARVA 5CWSB 3RVTC 2O92A 3OA5A 3LHPL 3PP4L 2VXTH 1QHPA 4JFFB 2UYLA 2OWXA 4PG2A 3K3QA 3Q6GH 2HG5B 2UWEF 1UXSB 3JTSA 1RZJH 3ME0A 3NOIA 5I8KL 1NDGB 4Z18A 1RU9L 4P2RB 4HUVA 3PV6A 5ID1B 4L9LA 3WD0A 4BYHA 1QHOA 4BSWA 1A8JH 2AXFB 5EU6D 4XCFH 1RZ8B 3NA4A 3WDPP 1KNOA 2AKRA 1W9VA 1EZVX 4LLMA 4K94L 1J9CT 5DF0A 3VG9C 3WO3B 2WC4A 2X41A 1C5CL 3O41B 2CLZB 1NUFA 2K3TA 2QSCH 3O3BA 2ZUSA 2J7EA 4F8XA 5J9PA 3KR3H 5DHVH 1N2RA 2XACC 3MLVL 1S3KL 4ERSH 4U2YA 2IEPA 4WSJA 3TBTA 5DGRA 1YNLL 4RAHA 2WYSA 2UUDH 4QF1B 3MLUL 3QXDA 4JL2A 4JM2C 1MYRA 3KXFA 4TUJA 4HS6A 2BERA 1MHPH 4ZAKD 3AMGA 1E40A 3LKPA 4L8DB 1WZAA 4JRYE 4PJ5B 5GRJH 1FH5L 3BC9A 1UH4A 3QG7L 1RH9A 4PJGF 3PTQA 3WD2A 4KV5E 3QXDB 3RPIA 2Y8VA 2R1WB 5FM8A 4ZFZA 1TCRB 1G6RA 3B2UD 5BRZE 2WPGA 3AZTA 3JTTA 5JR1L 5BQ7A 1AGEA 1H09A 4GG6A 3SE9H 2QMJA 3BPCB 1MFBL 3AFLA 4KHTH 4EN3B 5A2IH 3BKML 4X80H 5D4YA 1MCKA 4MAUL 1M7IB 5BVJA 2GAZB 3GGWA 3MODH 5DJ2A 1K9DA 2AOSA 4YR6B 5GGSY 5JW4Q 5T1MA 5KEZA 4M4RA 5IVXA 3DV6B 2OZ4A 4F33B 4IRZL 3MCKB 3MNZB 2E6PA 4YAQA 2Y8KA 3K74B 3ZZ1A 1G9ML 5D1QB 2WHJA 2J78A 4BKLA 3MODL 1MRDH 2XKNB 1GRWA 5J1SC 4RFNB 3ZE2F 2P1YA 1INDL 4YXHL 3FRUB 3S6CA 5I1KL 1G6VK 3Q3GA 4LLQB 1FZJB 1U8NA 3CVHB 3HMWH 4M02A 4YDVB 5EBAA 1ZHKB 1MHCB 5JMRA 1TPXC 5K59F 3WH5A 4QP0A 5GSVB 1FVCB 4ORGA 1H0DB 4I3SL 1N6QH 2VB5A 5GRUH 1YY8A 1LJYA 3IDJB 2W0FA 2OQJA 5E5MB 4OCWH 1ZGLB 4P5MA 5ITBH 1EH9A 1CF8H 3LEYL 3RNQB 3HJEA 4KJPD 1U42A 1CLZH 3OXRA 4LSQL 4NZUH 1HI6A 4LCUB 1J0HA 1BWMA 3O9WB 3WIHH 3D85D 3MRBB 5M5DA 4PP2B 4ZE5A 1XR9B 2PWHA 1DUYB 5BZWA 3ZKND 5F21B 2VR9A 4PRPE 3SDDD 5HNNA 1PX3A 5SWZB 5D1XB 4LVHB 4OFYD 5DDHA 5I1GL 1UB5B 1AHWA 3AB0B 3DXAD 3S3SA 1A9BB 1FFNA 4QLRA 1W3HA 5FCZA 3G6JF 3ZE1F 1JZ3A 3D0VA 3PDDA 2E27L 4N9OB 1GAFL 4YHPB 4JY5L 4JPWH 4QXWA 1RZJL 1AGBB 1I1AB 3GI9L 4LLVA 4OB5L 4X7SL 1U58B 2XIIA 1EUTA 4EBQL 2NXZB 5I0DA 1F4AA 3VXME 5FK9B 3PGFL 4RWYL 4Z2JA 5F7NC 5DURB 2J8UB 1KTDA 4B7IA 5CGMA 3JSSA 3MLXL 1HH9B 1TVBB 4WU5A 4MNGA 2GDUA 5JUVA 1KCUH 2R4RH 4OFDA 3DECA 1A3HA 3QUMB 3W53A 3REVB 2WLYA 1JHKH 2BCKB 2ZKHL 3FZUD 1T5WB 2IFGA 1CIDA 4FQXA 5ADOL 8FABA 2QADC 5DEGB 3ARGA 4WLCA 3DX7B 1J1OL 2V7NB 4GRMB 1KACB 4KRPB 1MAJA 2HTKD 2B8OT 4U1NA 3DIFA 2CO6B 5GS0L 3B9KA 4EI6A 5EZJB 3UPRB 4OCSL 1AVAA 4RE4A 4OLUH 5CCKL 3FT2A 2OL3A 4FQ1L 2J88H 1TPXB 1AY1H 1FIGH 2IAMA 3U2SB 1ZLUH 3RGVC 4KZDH 4G9FB 3VI3F 3ARYA 2PW1A 2DLHA 1T6VN 3O4LB 1IGIL 5DHYA 1GCYA 3GMMA 3KNBB 1F97A 4BQ6A 5IT2H 3O3EA 3PQYE 4YH6A 1NCDL 3UP1A 1T0PB 3WKZA 3LSOA 3IDMB 4QRPB 2Z31B 3VTRA 1DQLH 1GOHA 1KFAH 4K68A 1XR8B 4MGXA 2G5BB 2I26N 4LLAA 1XIWC 3SDYH 1SJHB 3VFMA 4AYSA 4PJ9A 2VL5A 3AYRA 1TMQA 4TX8A 4WTWA 1XT5A 2ZXQA 2DPEA 5FK9A 4EQ2A 3OR6B 2R1YB 2VZUA 1CT8A 3E0GA 5MEPB 3A6CH 1LF1A 1KB9K 2E9WA 5ILTL 2FIKA 1O7AA 4POZD 3W37A 4K3EH 1XGZA 4IIQB 1HVXA 3VW3L 1IM9D 5GRZA 3QCVL 3LS4L 5C0AD 3ULVE 5C0CE 4PRPA 4P46C 4S11A 3IJYB 4I0KA 1S7WB 1QI2A 2EPLX 3T77B 3KPNB 4WW2F 1V7ML 4LCWA 4NZTL 4JQVC 5K9JH 4PRDB 1XCTB 4M5YH 3MUGA 3ZLQC 5GS0H 2BNQA 3QNXA 2WWKT 3CLFH 5ICYA 1GGIL 4G43A 3QWRD 1DLFL 3NUKA 3HC0B 4NRXB 3S3JA 3JV6A 4P2YA 4W70A 4W7UA 1H1NA 3KPQB 2EDHA 5DEFA 4FQIH 2P5EA 3I6GA 2XWEA 5JOPD 4EOWL 1I9IL 1T5XA 5F9OH 2CD0A 1NGZB 2W92A 5HYSB 5I75B 2DQHL 1VKXB 1HKLL 2J8UF 2YBRB 2FX7H 5FUOH 2B2XH 5IUSA 4WHYG 3STZB 5JO5B 3S96B 3BZEA 4HFUH 5GGSB 3LQAC 1D6EB 3S3PA 2V5RA 5EUOB 4RX4D 3KYOB 4V1DE 1UQSA 1OSPL 3BP4A 43C9B 4RAVA 2NZ9C 1J1PL 4L8BB 5IVXE 1UFUA 4BELD 4AIOA 1U30A 3SKOB 5HPOA 3RO8A 1I4FB 5BS0A 3AIUA 4QOKE 3IAPA 3HZMA 1CT8B 4JPWL 5KSUA 4TNVF 3P0YL 4N68A 3DSFL 3L3JB 3OJ2C 4A4AA 4PJCB 4WI7A 2AKRB 2F19L 3PV7A 4GG6E 3C60C 1FFPB 4I9WD 5IB3A 1MRCH 4RFOH 2O9OA 2CLZA 4AG4H 4PJXF 3BPLB 4NQVA 4YXLH 4ZXBA 3NJ3A 1RAMA 5EC1B 2WMIB 1W1VA 1J05A 2FZ3B 3W0WE 2BHYA 5HGBB 5KN5A 4RISL 4IPNB 2ZG3A 2OBGA 1XSJA 2DLGA 4N8CL 2CUIA 4JHWH 3BYTA 4HUWA 3U7YH 4H41A 4W4OA 1QLRA 1T4KA 3VDCA 4N0UA 2XZCH 4PJ5A 2OLHA 4LCCA 2EYTA 4PRNB 2R15A 3WKML 3FXYA 2ADJB 4G5ZL 5KVGH 4XB7A 1OSZA 4QO1A 1CBGA 3C5ZC 1TVDA 1L0YA 1XYZA 4D9RD 5DR5H 5I1KH 3GMPA 4HMCA 3WD5L 3OKNA 2P5EB 1WPCA 3VRJA 1Y6NR 2GSJA 1AD9B 2R9HC 4XNMA 3QDJE 4M00A 3DURA 4KHXH 1FZKB 4BH8B 3JZ7A 3EYPA 1HNYA 1DBAL 1ISXA 3EDJA 4WI2A 1F4XL 1RUKH 4NQSB 5ENWA 4FQ1H 3S37L 3REWA 1RZFL 2AXFA 1NCTA 1QPPA 2IFFL 1H5VA 1I8KA 4Y5VC 3O81A 4FZEH 1L7TH 1VEPA 4UDUA 4WUUD 4K23L 4MHHI 1KYOJ 2EDFA 2CHOA 2VXVL 2ZUWA 1A3QA 4JM4H 3OV6A 4NQCB 3LKSA 3S5LA 2GFBB 4NZCA 1I1FB 1I9EA 5J6GB 4PJHE 5E1AA 2VZOA 3BKMH 4U7SA 3M17B 4XX6A 4LFHG 3T4YA 2R29L 4NQCA 2ZPKH 1TVPA 2EE3A 3O3DB 2JEQA 5IVXB 1ZVHA 5C2UB 1ZV5A 3MYZA 5CJ8A 2Q7YB 3MOAL 1G0CA 2A0LD 1FAKT 1PPIA 1HXMA 1P9MA 5M7QA 5HGDA 3MV9D 4J2XA 5BQ7B 3VNYA 3SJVB 5MP6H 1ZLUK 2J3SA 4DKEH 1G84A 4O51B 4RMQA 2BVTA 5I19H 3MLUH 4HIIA 4WWKB 3S9DB 4K9EH 4LFHD 4JB9L 1US2A 1CFSB 5TF0A 3V5HA 1RSFA 4KY1H 4GMTH 4X5XA 4ESKA 3MRIB 3S5LB 3EGSA 3BW9B 5ERWA 3FHAA 3TN0C 3EZJB 4Y1AE 1DWJM 3SO3C 4HSQA 3VH8A 3MNZA 4K8RH 1ZA3B 3MV8E 1GHFH 5BMFH 1G1CA 1OSEA 1EERB 3BVNB 3K80A 3X12A 1T7ZA 2AABL 4YDKL 2YKLL 4FXKB 1U2YA 3L4UA 3K46A 5GGTL 3MMDA 4OFPA 3U7VA 3OAZK 1B3JA 1F2QA 3CPLB 4GKNA 3QZWG 3RY4A 3S4SB 3VGFA 3IJHB 5E6IA 5KANI 3BAWA 5E99L 5F7YC 1BLNB 2EXWD 5D1ZD 4ZO6A 1U91A 4ML4A 5H8DA 4OIIH 1AXIB 3B2VL 4LDEB 4PPTA 4Q58C 5FUOL 5TDOB 3H0TA 4DKEL 2NY1B 1CLVA 3VI4E 4L3EA 4WI9A 5FKAB 5TE7H 1PG7X 1EEZB 2HKFL 4P9HC 4Y5YB 3SBWC 1MW1A 1JN6A 3CFJA 3ES6B 2YN3A 1T5WA 3FN3A 3LPFA 4DWSC 4IM8A 1L0PA 3LPWA 1GONA 1J10A 4GZEA 3HR6A 3G5ZA 2CIIA 4K3JH 4NN7B 4JFYB 3I2CH 1CE6B 5E2WH 2AJXH 3CJJA 4Z7WE 2VZTA 3G9AB 4XNQA 5B8CA 1WLHA 1BYBA 2OJEB 1TJGH 2WBJC 4DGYL 4TSBL 4HG4K 3WN6A 1FFPA 3TOPA 1A2YA 4AMKL 4HZAA 1N26A 3RUGB 3WFDL 1IC5L 5D8ZA 5E2UH 1E6JH 4M6NH 5ILTH 4MZ3A 4X4XA 4LLVB 1NMCB 4BZYA 2Q20A 5ABHA 2HLAB 4GLRI 3OAYK 5SWQB 3CVIH 2KDGA 3BSZL 1ORSB 4C7GA 5T1KD 5DQ9B 3RHWF 4O9HH 3VX1A 4FRWA 1V3MA 3NCOA 1UB5A 1JN6B 5KTEL 4N9GA 35C8L 2VABB 5HYJB 4X7FC 2N1KA 1G7LA 1JF5A 5DD0L 5KS9F 3VNZA 2I9LB 1UR0A 3IXAA 2MHAB 3V4PL 4PJXA 4YUEH 4PJFA 3EOTL 5K33A 4LGXA 2AEQH 2J7CA 5KG9B 2GK2A 4LEOA 3VFSA 3VFUA 2BRRL 1G7QB 4M3KB 2FB4L 4R2GC 5I15L 1BVZA 2F5AL 3WDQA 1SJXA 4GW1B 1RV6X 5J11B 4UQCA 4ZD3L 4EZMA 1N4XL 3ZE2E 1HHHB 4G7YH 2NXYB 4Q9RH 1T2QH 2A3AA 2VURA 2ICEA 2DTSA 3JWDL 1W9BM 4JQXA 1FH9A 2R69L 5DMIH 4CAGA 2VL5B 3OKKA 1BOYA 2WCGA 2VDLL 4G8EA 2Q76A 2L7UA 3AXIA 1JFQH 3MJ7A 1BHGA 4LCWB 3RVXC 3UTOA 3ARTA 4NNYB 1AHWC 3FY1A 3SO5A 2OTPA 5CGTA 3WHE0 2ARWA 3WL9A 5CBAB 4X6FB 2AI0H 1S9VB 4NQDD 5KTEH 1CFTB 2M26A 4PJDF 1ITCA 3PZOA 1W8NA 4I48B 4L4VE 1V3IA 4C7FA 2JF7A 2CDEA 5E8OA 2DDQH 3EJZC 3OJDB 1IT9L 3WQ5A 4V1DD 5D2LA 4OD2B 1BM3L 2G60L 3MLXH 4JN2A 5HHNA 5E4EC 5IK3A 2DLEA 2NZ9D 5F9OL 5HGAB 3BN3B 3WJJA 4G9DB 2PWEA 1LD9A 1M1SA 1F45A 2G60H 2FX9L 1G7LB 4XPAL 3EYFB 3WO4C 5I74C 3W4RA 2VDRH 3P77B 1MSPA 2D0GA 5E2VL 2ARJQ 3IDMA 3AHYA 2Q76B 4QRPA 2PKDA 5EG6C 1UVQA 4LP4A 1XHGA 2W62A 3TTQA 4CMHC 1DN2A 2APTA 2AW2A 1CCZA 2FJGB 3DUSA 5C0BD 1C08B 2DF3A 1UADC 5EFDA 2EXYC 1FDLL 4Z7UA 3ZKNC 3P11H 3B9KC 4UNUA 5JLZB 2YKLH 4Q9BA 1VADB 5B21A 1F90L 1ETZB 1U41A 3H3PL 2GTWB 4AZCB 5ABFA 5C71A 2DICA 1T21A 3RJDA 1JI2A 2YL9A 1BWWA 5I1JL 4EN3C 2VLJD 3C8HA 3VXRB 2KL6A 3JTTB 4JREC 4LHUA 4QTHA 1YNTA 1J9YA 4FZ8H 4JFFA 5KZ6A 5J89A 4PRAA 3P4MA 4PBXA 3U0TB 4S10A 1PEZA 4Y5YA 3UJIH 1DWAM 1YNTB 1MCJA 3O3AA 5I76B 2D7MA 3UC0H 1MCIA 3O0RL 4KKLC 5CEXB 2DBJA 2PUQT 1A02N 3NCYS 4PRAB 2ZJSL 1WICA 3VXUB 1QNRA 3EYSH 1UM4L 5HGAA 1HI6B 5I71B 4P7OA 4ZTPL 2BDNH 5AZEH 1NAKH 3VIGA 1CLXA 1T21B 3OKOB 4HKXB 1IFHH 4CVXB 4CN4A 3OGOE 1E6JL 2EDBA 4GKOA 4M6NL 1YY8B 5INCB 3SOBH 1GOMA 3OLDA 3DSNA 2MWCA 1EVUA 5IROA 2DQCH 5ACZB 5EZOL 4H25B 5IW6B 1K4CA 1W3JA 3ARZA 5KJRL 3HI1A 4ONOA 1NCUA 4JFQA 1KEMH 5JHLH 2D03H 4UTBL 3IU4L 43C9A 1FVDB 4C59B 2YD1A 4XH2A 4UOJA 5EU6E 1PIGA 3UTQB 1F4XH 1RUKL 2Z8VC 4QNPE 4KJWD 5DYOB 3CC5B 1FH7A 4NI3A 4TNWF 3MLSH 3VMNA 3ILQD 4UTBH 3HNSH 3WNOA 4UTFA 3MSGA 4MCYA 1VGEH 1ZK9A 2EYSB 3V5KB 5FB8A 3MSDA 5EO9B 1EGZA 4YLQT 4L5FH 1BQLH 1I7RA 5GS1A 2W0FB 1UJ3C 5EOCH 1LP9F 2YRPA 4M8VA 4MJ6A 3QDJB 4LSRL 1DE4A 3QRFM 4HJ0D 4L9DA 3HTLX 1YEFH 1MCEA 1A4JA 2VZ1A 4X6EB 2OJZL 5L8KB 4F9DA 1GZQB 4QHNA 2ADFL 3ZHKA 1FZJA 3CVHA 4PJFE 4B3LA 2GJ6E 3LQMA 2UZXB 4JEGB 4F7TB 1OB1B 3G08B 2XG4A 1DQDH 5IW3A 4NQEE 2VAJA 3W6LA 1GGCH 1AC0A 1YHTA 5FDYA 3GNMH 4ELMB 3K81A 4NFBA 1S7QA 2Z93B 5FIEA 5IHUH 5JHDD 3UETA 4HIJA 1NWSA 3GSXA 1DQDL 4YDKH 3B9VA 1A6TB 1M05A 4NRSA 2DOCA 4NN6B 4NN5C 4BSJA 4C56B 4ZS7L 1IMHC 1ZHLA 4K9EL 4QLJA 4F15B 5HDLA 1JZ7A 4G6AD 3MRGB 1MPAL 1AQKH 4LSTL 12E8L 3QNZB 1MELA 4P46D 1AGEB 3G5YB 4OZ4B 4QT5B 1S7VA 3QEHB 5JOEA 4PRWA 1FL3A 5HGHB 3NFPB 5HI4C 5LA1A 2Y1VA 1YEDB 3H9HA 5I1LA 3PV6B 4HA1A 5BV7C 3MFGB 1QSEB 2RGSA 2BNJA 1B3XA 1YEEL 4X98A 2DQHH 2H1PL 3MCKA 2YS4A 3QUXD 4G9FA 4G6FB 3LB6D 4F8QA 3DGGA 1E55A 1JGDA 3B43A 3SCPA 1BVKA 3RVWC 4LEXH 3ARQA 3FQRA 1UR4A 4L3EE 5KOMC 1U92B 4FFWD 3F4VA 3C5SB 4HCRA 1IC1A 5D7JC 3KPSD 5KAQF 3AOFA 2C3HA 4QLLA 2E7LA 1QQDB 1WCBB 3VXQB 4AT6B 3EO0A 5ISZE 5BXFB 3EIFA 4WSKA 3NCBB 5DO2C 2K1MA 3QPQC 3PJSA 2VDNL 4BA0A 3ORJA 2R0KL 4XVSL 2GK0A 4MNMA 4MAUH 2H32B 5D2NA 1S46A 4AT6A 3RGVD 2AJVL 1AQDA 4PJGB 2XUCA 1CFNB 1DTUA 3C8KB 4HK3N 4UTAL 3CK0L 4QCIB 4M24A 2V5SA 2P48B 1QSEA 2NW3B 4NT6B 4Y1AA 2YSSB 5EORH 3MS8A 1AJ7H 4P59H 4GMSL 1FHLA 3VIHA 1UG9A 5DT5A 3WNKA 4PRIB 3IFLH 4OLVH 4R0LA 3O0RH 4OQ1A 3PUCA 5INDB 2B1HH 4Z2KA 4Q0XL 1N0LA 2ZUTA 2EE2A 1IGFH 3O9WD 1NGZA 3MQIA 3DYPA 3LPGA 4PREB 2YPLD 3LKRB 2C3VB 4X99A 3VIOA 3R8BB 2X4RA 3CUFA 1NQ6A 2E7BA 3CX5J 4BQCA 2OYMA 5LYRA 2ZXBA 1NH6A 1D5BA 1HZHL 3DHPA 3WUZA 1JPTH 4GAYA 1BP3B 3KPSE 4K2UH 1NCDH 4V27A 1F4YL 5D1ZA 1Q9LA 2HH0H 1OLZA 2VLKE 4LRIA 4ODWA 3SEPA 5DSCB 4ERSL 4NQCE 1HKMA 1JNHB 2YHGA 4H0IA 2DWEA 5I0ZA 1LK3L 3P0VH 4OZIA 3BIKB 3T2QA 2QHRL 4FTVB 1FYTD 1AXTH 4MXVF 4APQA 3NCJL 1A6VL 2ICWA 4PJHA 5EZLB 1A3LH 2V2XA 1X7QA 4S2SB 3LV3A 4PGDA 5DJAB 3MACL 1HDMA 2DTML 2NY1C 4ENED 2LFGA 1SJEB 1GZJA 4KI5D 2VUYA 3CFCL 1HN1A 4ODHL 1BECA 3LKNA 4OFVA 2ERJB 3MO4A 1NWTA 1UA3A 3VIKA 1I1RA 5HI3C 1KBGL 5AEAA 3NAAL 4N42A 2GT9A 2GSGB 5A6LA 3GK8L 3RUGA 4D3CL 3EYVA 4H8WL 4OLZH 4OJFH 3TJHD 4BK4A 1U8IA 1CD0A 2V2WA 4KQ4L 4HIHB 1CWVA 3G6JE 3GYCA 2VXSL 5D1ZC 1VGKB 1W3LA 2EYRB 1VIWA 1DBJH 4MD0A 2ZCLH 1UB6A 1XH3A 2ZX9A 4LLDB 3W38A 1CLCA 1IT9H 2DYPD 2X40A 3NGBC 4JM2B 5E9DA 1AP2B 4DN4L 1ZSDA 5HBFA 3T8XB 2NY6C 4PIRF 3IDGB 3MBXL 5F1IA 1Q9OB 1OGAB 4GRLD 4DTGH 2WC3A 2ZG1A 1K4CB 3PWUB 5BCAA 1AD0B 3GTNA 5T1DH 1RZKH 3BAYA 3W0WA 5GGVH 1I8KB 4D6HA 2NYYC 3AMKA 1HQ4A 2FGWH 1ERNA 3ZTNL 2L0DA 1YECL 4I0PD 1JPSL 4PJ7B 1XGTA 3OAUL 3PDGA 1TZHB 1MFAH 5DT7A 4WI8A 3RX7A 4QRRD 4O4YH 4ZG1A 1MCWW 4FQQB 5E2JA 3MBEB 3Q5YA 1MFEH 1V7NL 5IDIA 3VJ6B 2MJWA 4K3EL 3BRDA 2DSWA 2AEQL 2EDNA 1N2RB 3OSKA 3KZSA 1NMCC 1S7TA 1KR1A 4V1DA 1RHFA 3H2WA 2YMXL 4BA8A 2QV2A 3CUGA 2HJFB 2A6JA 1X5HA 4XPTL 2OTWB 3U5YA 3V0VA 3SCMC 5E4EB 4WV1A 1JUFB 3O6ML 4J12A 1RZIB 2R1XA 1NBVL 1N0XL 3N1MC 1GGTA 1HH6B 3K8MA 1GJWA 3KL0A 1HJVA 1FBIL 2Z1SA 3HG1A 1IJ9A 1QSFB 3HC0A 5DFTA 1XGTB 4YK4C 4E9LA 1H41A 1T0MA 1AGFB 4MD4A 4W89A 1A1MB 4XPFL 4FXGB 3QPXH 3MRMA 4KU1A 3VIMA 1I9JH 5FEBA 5IG7B 3EHBC 4S1SH 4HOXA 5CJOH 2NQCA 3MCLL 4PY8J 4FMFA 3RDTA 3FONB 4UT7H 4OGXH 2ZUVA 3OPZH 4U3CA 5CMAA 3L3HB 3QISA 3RWIA 4LHJB 2GSIA 2A73A 1BJ8A 3MNWB 4NQDA 3OX8A 1JGIA 3VFWB 5C0CA 4C54A 4LCUA 2CKNA 4F9LC 5GGUB 4PSRA 1T2JA 1T1YA 4IMLB 4OKDA 3N1FC 5KJRH 3SDAB 3DRQA 1TA3A 2HJLB 4OAWA 1VF8A 3B3IB 1OD7A 5C07E 2CKSA 5EBLB 4XWGH 4HS3A 5EFIA 1JGEA 1S8DA 1H0DA 2KH2B 4YBQD 5AZ2H 3SGEI 3ROOB 4NZRL 1AIFB 5BO1L 4TVCA 4WFGD 1FHDA 3MROA 4ZUTB 2HN7A 1T1ZA 4KHXL 4NKOB 5GRVK 4J23A 1BIIB 4TVPL 1CFSA 4Z7QF 4U7MA 2D31A 3WLWD 4XPTH 4YDJA 4EBQH 1WB0A 6TAAA 4PJ8C 4DM1A 1Z5LA 2XQYG 3I85A 3PQYA 1UWUA 5D7SL 3WDJA 4Z6AT 2WSPA 3DX6B 3MKKA 5F9WB 4E41E 2BNQD 5TPWL 1MWAL 5EZJA 3UPRA 5ECUA 1P84J 5CINL 1TA3B 1F4WL 1UWSA 1UWIA 2I5YH 1NFDB 4A6YA 5DRZB 2P8LA 2CDFA 3CHCA 4LSQH 4DCQA 4YXLL 1OAQH 1I7ZA 1RK1B 1IARB 2YOCA 3VMPA 2UV3A 2QQNH 2R56L 4HW6A 3VH8G 1KGXA 2WHMA 1P69B 5CSUA 5J12C 1RD6A 1Y0LB 3WL0A 1B0WA 2XYCA 4TOQA 1QBML 2AAAA 1NWUA 2NY6D 1R5WB 1S9XA 4PGCB 1S7UB 2W1NA 2HT2C 1I1YA 3AREB 4M03A 4B7LA 3S4SA 5HHMD 1NLBH 1HSAB 3CMJA 3GXIA 2ZSVB 3H7BA 1TNNA 2RHEA 2VLKD 3VXMA 3VFTB 2VDPH 3EYUH 4W93A 3ULUH 1E6PA 4AEIL 1V02E 1QFWL 3MRFB 4MNQE 5BO1H 3W5MA 5FA4A 4NZRH 3SCMB 2PYEB 3DOSA 4X4ZA 5C0GB 1TR1A 5GGRB 4PRHE 1JFXA 2CPUA 1EMTH 3DIFB 3LIZL 2P8MA 3AU1A 2HFEB 3SO3B 4C4KO 1OW0C 5F9WC 1YEKH 5CD3A 1LGVA 1UXSA 4PUDA 2BNUA 3MV9A 1SJVA 2AQ3A 2H2SD 4ZO9A 4P9MH 1SMDA 5F7FA 5HDOA 5EA0H 1QO3B 2FIRT 2X89D 1ROWA 4D6FA 1YEDA 3H9HB 5ESAA 4JFZL 2D3LA 4QWWD 4FMKA 3K8LA 3GRWL 4JO3L 4NWUH 4KDTA 4EUPH 4JN1H 5DK0A 1BFVH 2M2DA 3THCA 5LGJA 5L9DH 1U8MB 1CGXA 4NSKA 4MVBD 3V0WL 4ZO7A 2H2SC 4MNQA 3S97C 1J12A 4OCRL 4LAQH 4Y4FB 1CBVL 1JD7A 5LAXB 4G42A 5CP3H 5B38A 3IANA 4XV0A 2XTJB 3KDMB 3ZMRA 3TA9A 3WXVL 4U6YA 2CDGB 3CFDB 3WKNA 2C3XA 1ZT7A 4MNHB 1DDHB 4RISH 1UR1A 1U6AL 4GXUN 3MREB 1T1WA 1T7YA 2V2XB 5CSBA 4LCYA 3MYJA 4N0FA 3JUYA 3RVUC 4IM4A 1NBZB 4DQOH 1WDRA 2CRIA 2H26A 5HYSA 4LGRB 2J8GA 1JAKA 3F8UB 4NO3A 4BSVB 5I30L 1VFMA 2AK1L 4D72A 5IIEB 1AGDA 4P2OC 5T3ZE 2JCCB 1CFBA 4HEME 5HHVL 4PSPA 1PG7H 2W9DL 3RNKB 3PZVA 3JV4B 5D7LD 5BRZB 2BY1A 3SGJA 4F80A 1NFDF 4J4PA 3DPBA 2NXZC 4K07A 1UH2A 4K3GA 1XV8A 5TFSH 1Q72L 2R2EB 5IIEA 5IMLB 4IOFD 4PTVA 3H9YA 1SM3L 1L6ZA 4HJGB 1WSST 3H3PH 4AMKH 4E41A 4KKAC 5F88A 3DI2B 5CEXA 1ZT4A 5JPMA 4PUEA 5IBTH 1KCSH 5F7EH 4UZUA 4AXNA 2QSVA 3UYOD 3KPNA 3GIZH 2CHNA 1EEYA 2EYTB 4KRNA 2CKBA 5FA3A 5J3HC 5IFJA 3SUTA 1J0ZA 2C1OB 4Y16A 5ICXB 4PCSA 2X7LA 5K59E 3MREA 3RGHA 4Z7VB 1MCPH 5IB4B 2FL5A 3IDXL 4ZUVB 4M3JA 3RVWD 2G8ZA 1T0MB 3VFPA 3GMMB 4AEFA 3KLHC 5E24E 5DVOA 3TVMB 2D0FA 3D3VB 4G8IA 4M1GH 1DLFH 4M7LT 4S1RL 1FZKA 1FHGA 4M61A 2NW0A 4M1DL 2WMPA 5JW5A 4KKCC 4UT6H 5A43C 4EAMA 5CGYD 3C6SB 4CMMA 3VFUB 3L3HA 4R6UA 1WWCA 3L3JA 3FO1A 2X0HA 4KPHL 5SX5K 2W59A 1UKPA 5DRNB 5I6XB 1P4BH 4WIQA 3ET9F 4GG8A 2D0HA 1CICB 3MFFA 4OLEA 4YBQC 5T3ZD 2C4XA 4LSTH 2V3FA 2FNBA 3VRJB 4NQDE 3U6RA 1A6AB 3TO2B 5I1HL 4DKAA 1R7OA 3S88L 5I30H 5IHUL 1H3PH 4NC1C 4AZ7A 1ZEAL 1KIQA 3JBG7 2VITB 4NGHH 1KXHA 3AFBA 3ULUD 4C56E 5I15H 4ONHA 3VXTA 4WCYH 2BRRH 3G5VA 4WHYH 2P5WB 3ZKXB 3KL3A 4UOQA 5ITFA 2H3NB 3QI9A 4MB1A 3V6OA 1N4XH 2F15A 2YZ1A 4LLMB 3P0VL 4O58H 4FF5A 4IRSA 3ZSSA 5I1EH 4DZBA 3MGTB 2AJYH 4MWFB 3X3FH 3MA9H 3SE8L 4NKDB 2Z4QA 1QRND 1X5FA 2EDEA 2ENSA 2ZWLT 3HN3A 4Y2DB 2LAAA 1NFKA 5EOCL 3BP7A 4R7DA 1OB0A 4NZJA 4GQQA 3LN9A 5IFAH 4JO4L 2JB6B 5I1IH 3U46B 5TH2B 3CU1A 4BQ3A 4TULL 3GMNB 1NCCH 3MRPB 2XXMB 5FYJL 4ZFOB 5HBBA 4GQ9L 5K9QI 1H49A 1MJ7L 3BGAA 3SDCC 2COQA 4NFCA 3VCLB 1PKQA 1AJ7L 5DJDA 1BFSA 5GGSA 3MRNA 1MIMH 5L0QC 1JHKL 4R4BA 4NO0B 5L7XL 1T1XA 2B1HL 3QEUB 1AKJD 4JAWA 4JIEA 4JQIL 4KUZH 5IMOA 1GOOA 2JKXA 3VI3E 3WMBA 4R8WH 5SX5H 3UO1H 3MU7A 3DX9A 2PBOA 4FQPA 4HXBL 4HWZA 3TJEL 1A6TA 1RZFH 5HTSA 3FN0L 4NRRA 4URTB 4UFIA 1CYGA 4TSCL 3U79A 1YYML 1XR8A 5T5FH 4RFEB 5F7MC 3PWPE 1N59B 2J6EA 4GJTB 2A1WL 1K6QH 4L4TD 4K3DH 1IAII 1OB1A 3EJYD 3T65A 4MDPA 5A8NA 4ZE4A 4LRNH 4QRUA 3AICA 3I75B 2GJPA 5B3NA 4HIIB 3FOMB 5TQ2L 4Z2GA 1HKJA 2VLJB 3VXRD 3QFJE 2EDXA 3ABZA 1C8PA 4GW4B 3QHNA 1VESA 4KQ3L 3IDYC 3F7VB 3LRSA 1DE4B 3AS1A 3WQ8A 1A6WH 2JCCA 4U1GC 4OFKA 1DL7H 2PWDA 5BMFL 4FFWC 3RUGE 2YDRA 1BQSA 2Q1EA 4M7JL 4TUKL 4YE4H 2HT4D 3BX7C 5FXCH 1LDPL 3QIWA 3D69A 2PYFA 4PV8A 3KLSA 4OKVA 3QXTA 4HZ6A 2WZIA 3P73A 4BK5A 4NHUB 4JFYA 1BREA 2YD9A 2R56H 5HVGB 2XY1A 3EMZA 3QUYA 2AEPL 2XKNA 3B9KD 5DHVA 1FO0H 3ZDYE 3KNBA 5TPWH 2VH5H 3K2UL 3RDTB 4HZ8A 3IDNB 3DTXA 4OV6F 3KDMA 4OZIE 3A47A 2Y36L 3L3DA 3MZGB 4DN3H 4CVZA 4FQXD 5F44A 3TM6A 1KIUA 2YPVL 4OZFA 1J0YA 1NOFA 3T4AB 2V6HA 3FT4B 5MENE 1R3LB 4WFGE 4X8XA 4AQ1B 5BW7A 4FQLL 4NKIH 3IFOA 3KLAA 3PDOA 4AZBA 3VVGA 3KJ6L 4U7KA 3U48A 43CAA 1JNEA 4OZFB 4XPGH 1IAIH 1FJ1A 4G8FB 3F62A 2VLMD 1UM5L 4H26B 2D9QB 3C08H 2D7OA 2ZOKB 3V6ZA 5BZDB 5CZXD 5C6TL 2J77A 3F12A 2AK4E 2HFGL 4K23H 5CILL 5FKYA 1RJCA 4XUYA 4BQ8A 4GPNA 3QOKA 1QSEE 1DUZA 4OF5A 5JW4M 3ZJ6A 5JZ7C 4URIA 3FB5A 4ZAKC 1WBZA 4ZXBB 1MLBB 2XZQL 3D69B 4JG0H 4ZXOA 2VDLH 5DGQA 5C0EB 3WIFB 1VBRA 3FRPA 3O8XD 3OL2A 3VW3H 4OLYH 3MA9L 5ISZA 3GXDA 3V6BR 2F53B 2BNRB 4HXAL 1LWRA 3OKDA 4RA3A 2J75A 1OM3H 2GJRA 3RJXA 4TULH 4LPWA 2VIRA 1FBIH 1U93A 4ZTPH 4P23C 4JFHE 1ORQB 4AD0A 3TESA 4LHUG 4LSSL 5HOSA 3DVNB 1R3JA 2FJGA 2C3GA 3WO4B 3HAEH 1FNHA 3W5NA 1AE6L 4FS0A 1FNEB 5EZLA 1EBAA 1BAFL 1S5IH 3K1KC 4ETQA 4G8EB 4Q9QH 4H2CA 3SE3A 2FATL 1LD9B 4F3FB 4X6DB 5T3ZH 3T0BA 5IHSA 1Z32X 3SGDI 1RU9H 4XP9L 3ZL4H 3DWTA 2A9ML 4EN3A 3RILA 3QT2A 2WIIA 3HAEG 3CBWA 4KKNA 5D2LF 2YIHA 3OGCA 1QLEH 3J7HA 3MX0A 4IJ3B 3C2SA 4ZDHB 2ESCA 3OR6A 2XG9A 3GSQA 3O6FC 3GH4A 3ZDZE 4QRQA 2Y2WA 5TD4A 1QD0A 1YECH 2LAGB 2CUHA 3OKEA 5DRWB 1C93A 1P7QD 4JZJC 5I8EB 3S6TA 4X83A 1JHLL 4QLKA 4P4KB 2EPNA 3L3GA 4LOUC 4N0UB 3TN0A 2G3JA 5FDWA 2HT4C 3MLYL 3OKEB 3NIGE 5DRWA 3TPKA 3VXUE 4QRSA 3FO2A 4NKDA 1H8OA 4F7CB 4JHOA 5I17B 2GJXB 3HCVB 2R2HB 5DTFA 4MXWH 1FZMA 4S1RH 1T66D 2DRUA 4N0RA 3MGOB 4OT1H 4JREB 4ORZC 2P47B 5F7EL 5KZCB 5C0FA 1RIVL 2WIIB 4AENA 4ZFZB 1NMAH 3VGGA 3CXHJ 5ABGA 1F42A 5LQBH 3IETA 4EKJA 4JFQB 2Q8BL 4GH7B 5IVZB 2CR6A 3IDIA 4RL3A 3KWWB 1SVCP 3AIQA 2YA2A 3HLAB 5EU6A 4B16A 2PF6A 4I5BB 4XAKE 3AMDA 5A8QA 4HKXA 3WJLA 3CZ8A 3GIVA 5IQ9B 3BJLA 5IJKA 5I74B 4J8RA 5T33H 2A9MH 1Z6JT 1HINL 1CICC 4CCEA 1W2PA 2HVKA 3MV7E 2BVQA 2Z91A 4KY1L 3QI9B 1BIHA 3FT4A 4KROC 3GBEA 3N1AA 1VDGA 3TBVB 1QSFE 4M4PA 4XHJC 5JXED 5C0FB 2AEWA 3DVFA 4HPYL 3TBYB 1TJIL 4WO4D 1J8HE 4XMLL 3QHFH 5I1DB 4QEGA 3IRPX 3TWCH 5HD8C 1B2WL 1MF2H 2B1AH 4PLOB 4HTYA 3BE1H 1QNSA 3G5ZB 2EEXA 5AYBA 3F5JA 3CUIA 1KPUA 4B3KA 1OGTA 1GQKA 3REVA 4G7YL 3EDFA 2X7LB 2C0HA 3I02A 1XH3B 3KS0H 3DX8A 3C5ZA 4QWWC 4OGYL 1DBKH 2ZSWA 4R97B 4YHZH 4JFZH 2XPGA 1V5JA 1BIIA 3H9ZA 7CGTA 4M9OA 1GZQA 1CFVH 1ZBKA 3G5XA 2YBRA 5JW5B 3KPMB 1FL5A 3T09A 3QNZA 3RWFB 4IRZH 1H9VA 4GMSH 3VXSD 1TETH 1QZ1A 1JNNL 5EULV 3MRQA 4LASL 5HHME 2CETA 4GAFB 1CWYA 1LEIB 2R23A 2DI9A 2VISA 1ZT1B 2N7BA 1QNOA 2Z93A 4TNVK 3VE0B 3GSOA 3MMEA 5CG0A 1N59A 1OGAE 2JE8A 5C8JA 2Y25A 3TO4B 1ZS8B 1HQRB 2EDKA 3I75A 3GB7A 1RUQL 5MERB 4MAYC 1MFVA 4XPGL 1E3XA 5T3XD 5JOFB 3GI8H 4QRPE 2AV1A 3WV0A 4PB0L 2NY4C 1E1EA 2JJTC 3QG7H 4BQBA 1G7MB 2OP4H 3V5DA 4FFZL 1CXEA 3F58H 3OXRB 2Q8AH 3ROOA 1YUHA 3LD8B 3V7MA 4AZIA 3G5XB 3LN5A 3U7YL 1K4DA 4ZO8A 1HCFX 2XZAH 2PNDA 4X4ME 2JJSA 4M6ML 2XGIA 5E99H 3HE7D 4U1LB 3MLVH 4UQ2B 4GXVH 2C4FU 3A6BL 4N8PA 4YDIH 3LD8C 1JCKA 1T1XB 5HDRA 1WBZB 2V5YA 4LF3B 3I02B 1OTTD 2V3GA 1FCCA 4F79A 3TLRA 1MPAH 5KVMC 1PLGL 2CIKA 1FV1B 3TIDB 5JHDE 1VACB 3ARFB 3DGCR 4NT6A 4NQUA 5KAQG 1E6XM 2XVNA 2ILLA 3IAGC 1CR9L 1S9YA 3FOLA 3RWGB 1HQRA 1BOGA 1MAML 1DSFH 1KXTA 5F96H 4TUKH 4YE4L 4H25A 3RPMA 3PL6C 4F58L 3UTPE 5IW6A 1E6ZA 1KV3A 4JRXE 1MJ8L 1J1PH 4N0CC 4LIQL 1R24A 4EXPX 4PJIB 4X6BA 1ZA6B 2GVYA 4F58H 1BZ7A 3VFTA 2Z92B 4R7NB 3TA3D 4CKQA 4CD8A 3MPCA 2R0ZH 3FAWA 1G01A 5KVDL 4UFJA 1IGYA 1KNOB 1MCOH 3D0VB 2IANE 4XB3A 5CHNB 4GXVL 3ULSA 2VRAA 4FHBD 4PR5A 3L3DB 1UUQA 5EBGA 3N85H 4ODTH 2YEZA 4PJXE 3WH7A 2NTSP 3THMH 4Z78A 5GNYA 1YEGH 3BEVB 4O2FA 3MRDB 3A4AA 4YGVB 1UZ4A 3QZWA 4OF3A 4WKFA 2NCMA 2NMSA 1YPZA 2IALA 4RGNC 2EDRA 4GBXC 5FA4B 3IK2A 2P43B 5GZOC 3PQYD 1EGJL 2N7AA 1EHLL 2RCSH 4FNLL 1SMOA 3TBVA 2AMGA 1DFBH 3D25B 4K71B 3K4ZA 3GSXB 4OSUH 5JW4R 3MRKA 3QDMA 4JRXD 4RMSA 2DMBA 3P9LB 2DGAA 1QSVA 4WEUD 5I16A 4L3EB 1N0XH 3BH9A 2FD6L 1MWOA 2DBLL 4HQQH 3T8XA 3NDZA 4H5SA 4J6RH 5HGHA 5GZOD 2V9QA 1FRGL 1MHHB 2H8PB 5D9SB 3GJEA 2BSRB 1RK0A 2Z92A 4R7NA 1AIFA 4H8WC 1I75A 1WAWA 2I07A 4DWSD 3BGMA 5EU3B 3QUZC 4JFEB 1JGVH 4D6JA 3QYCA 3PGDA 4U3XA 1FVCA 2KZWA 4ORGB 3GSNH 2MCPL 2VJXA 4OM1L 4X6CF 3LKNB 4XAKD 5HHPA 4MJ5B 2NY6B 5I8OL 4LCYB 5AY7A 1MJJA 5DD3L 1KCRL 3NIYA 5HYQA 4XVUC 3IDUA 3ALWA 4X6DF 5SX4H 2Z35A 3TA3C 1AC6A 4BZ1H 2GFBA 3BWAA 2ADIA 4U05A 5HXMA 5GJTH 2CKRA 5C09B 4X5WB 4HK0A 3CZJA 2P45B 2YWZA 4XXCC 1KGCE 3STBA 2WKLA 1KPVA 3VA2C 2CBIA 2VNCA 1MCHA 1QRNE 4G6KH 4ZUSB 1KJ2B 1IGTA 4K7PL 2F5BH 4KROD 1XCQA 3BZFA 1WWWX 2QR0A 3TN0D 1WBYA 4WIWA 4Y16D 4K55A 4GINA 3HG1B 4GW1A 3U2SA 4DTGL 4KGLA 3QEQB 4I77L 3SY0A 2VX6A 4IS6B 1H3VA 3SDXA 1RZ8A 4WK9A 2EDTA 5FAAA 2CK0H 3G5VB 4R27A 5DD1H 3K8KA 4H8WH 1L9NA 1FGNH 2CLRA 3LCYA 3LRHA 4KDWA 1KBBA 4M9PA 5C0DA 3NFSH 1GH7A 4L29B 2V5CA 1E6SM 3POHA 3AC0A 4HP5A 5CQ1A 1JYWA 5CWSA 3MJ6A 4Y2OA 3PXHA 4YIQB 4WFFE 3RJQB 4QF1A 2YZ8A 1TVHA 4J7RA 1LEIA 4F9LA 3FQNA 5IVNA 4W5ZA 3KYMA 3PTMA 1KBGH 4L29A 4BZ2H 3M1BB 4AZ6A 4HGWB 4YHYC 1V7MH 4LHUB 3EO1A 2VQTA 3LKQA 1U8QA 4P7LA 2BSTA 4NPYA 2EECA 3DURB 5E5UB 3BXWA 2F5BL 1DQMH 1ZU8A 2VLRD 2CEQA 5HHQB 2I27N 4JG1L 2OTWA 1UWGH 4U1NB 2XQBL 4KVNL 4EK7A 4KAQH 2V7HA 1BTCA 4JFXB 2JF6A 1AO7E 2HG5A 2ADJA 4BZ1L 4DZ8B 1CQYA 5E4IA 5C08E 4OCNC 4G3YL 1OGTB 1CDIA 1U92A 4L9LB 4OD1H 4ODVH 5CZKA 3V79C 2LTQC 4PJBE 3EDEA 2DQUL 2D22A 4F57L 1EO7A 2I60H 5DD0H 4MD0B 4H88H 2GDVA 5ETUA 2Y5EA 4GO6B 1C16A 2VDOL 3KPQA 3SDAC 2FO1A 4IIQC 4YUEL 3DHMA 3O6FB 2OL3H 1LO2L 5SWZD 3MJ9L 4F37F 1YJDH 3MRGA 4G6JL 1G1YA 5EC2B 3U0PB 3IDJA 4OSUL 2ERJC 4MS8C 4RDQG 1A7QL 2ZCKH 1FFNB 2GI7A 5GNZA 5D7KD 4KXZI 4G8GD 5D7LE 4QOKA 1U3HC 1ZS8A 5CJQH 2DT1A 1P4BL 3ARWA 4XNYL 4GSDH 2UY4A 1HOCB 3VFRA 3LMJH 4BZ2L 3WF0A 5FYKH 1P7KA 1JF1B 4H8UA 5KS9B 2FSEB 3NACH 1N3NA 4HX1A 3T3PF 3VGAB 3G6LA 1Q6GA 4MDOA 2FH6A 5C07D 2PTVA 3ZQ9A 3V4VL 1A4JB 1I3GL 1D5BB 1A1NA 2RFXB 4L1HA 4IRSC 1O6IA 4E0RB 3QUXB 2E9IA 4DEPB 3RU8H 3TBSA 5JIKA 2OXGA 4YHKH 2LVCA 3BDXA 2ZKHH 4ZUUA 4MJ4A 2IBZX 4CVUA 5ANMA 1E4WL 4MTVA 4JR9L 5D8JL 5DJ6B 2ZWZA 2SEBA 4DOHB 1AR1D 3L4WA 2QSCL 4NNXA 2ZCLL 3GJFK 4NOFA 2IADB 3OZ9H 1KJMA 1P5VA 1NLDH 4OM0L 2FBJL 4AMCA 3VXUD 2BNQE 4GFTB 1A9EA 3T0ED 3C9NB 2D7TL 2Z35B 4HCRH 1LEGA 15C8H 1MAKA 5BWFA 4Y2DA 1V03A 3PZNA 1DR9A 4CU6A 2W65B 4LCWE 5BVPH 2GHWB 4Z7UF 2HLAA 3HMXA 5SWQA 2CKBH 2Y6SD 5IVXF 3N13A 1A7PL 3O4LD 1ZWIB 3BSGA 3MNVA 1K8IA 1VFOA 1IEAA 4PMDA 1XH0A 4PBWD 1QRNB 2WMGA 1SVZA 3PGCB 4ZPTA 5E95B 4P2RE 5ENWB 1URLA 5FUZL 4PREA 4JZ5A 1G5AA 1OCQA 4RDQF 1FNAA 3JV0A 4JY6B 2X70A 3QEUA 3O6KH 3FFDA 3PE9A 2DQJL 1LL6A 5JQ6L 2V38A 5MHSD 1KTRL 1RUML 2YPLB 4K7FA 1FG2A 2N56A 1UQYA 1KB5B 5DQ9A 3QH3A 4LMQI 4O2FB 1FC1A 1UD2A 2H9GA 3HB3D 2PW1B 4IOIA 3LEVH 4JO1H 1I3GH 4LVHC 1GW1A 2XGBA 1SYTA 3CUPA 4HUWB 1TVHB 2WVUA 2DMKA 4PJDA 2IJ0C 3WNMA 1BVNP 4Y5XA 2CIKB 1U91B 3QHZH 1CVSC 4PJEF 4D6IA 3PTKA 5I71C 4JN1L 2VXVH 4JO3H 4GXUM 4NWUL 5BJTA 1IGJA 1EAPB 3GM8A 4P59L 4U1LA 4XP6H 4P2QA 1WISA 4NJ9L 4L4TB 4ALAL 3WHXA 3BAJA 4ZUSA 4HXBH 5LG1A 4BSWB 2DQIH 3WS3A 4U1SB 1V6VA 4B9YA 1JDAA 3WUFA 3SKUD 1QEWA 1S7QB 5T5FL 1F4HA 2O5ZH 4K94C 3AY4A 2NLJB 3QOMA 2DKSA 4G43B 1J5OL 5I17A 1I9RH 3D5OF 3KYNA 3N18A 1V3HA 5EBWB 2EDLA 4F8TA 3WL9B 3R06B 1A0QH 4R2GD 3LPOA 3QR3A 1WFUA 1NL0L 2PTUA 5DD5H 1WVZA 3T77A 3EYUL 5DK2A 1JNDA 5D5MF 4ELME 5D6DA 4JO2H 1PG7W 1PSKL 1VKXA 2XKSA 3SDCA 1NCCL 4E41B 5FF6A 1JZ2A 3OGSA 2YD8A 1K6AA 5B3JF 3WLBA 1OF2A 3CHDA 4YNYB 3UDWC 1U8KB 3QULB 2XVLA 2ZCHH 4PYGA 5FHBH 3ULUE 1OGAD 1AQHA 2UY3A 2XT1B 4OFIA 1WITA 2XRAL 2JIXD 2WUCL 4YO0B 3W9DB 3MMUA 1E6NA 4HC1L 4HLZH 1MRCL 5IBUG 5CMAB 3RWIB 3CX5K 2R0WL 1X5YA 4LSPH 4X5WA 3CFBA 2WMHA 5FIPA 1TJHL 1BFOB 2DQGH 1F6AA 3QO1B 3A0OA 1MI5A 2UVFA 1SYSA 4M62L 2P24A 4MQSB 1S7RB 3K1DA 2XFXB 4O2EB 5FD0A 1T2XA 4WEBH 3IYLW 3O45A 4M5ZH 5L2KA 3RX8A 1JJUA 5B39A 1KG0B 3FHQA 4HS3B 3EDDA 4IIQA 5IHZB 3LKRA 4O00A 4TVUA 5I1DA 1EDTA 3EYOB 2CKBL 3QFJB 1RJLA 4L1DA 1ITBB 1Z3GH 3VXNB 4P8VA 1W32A 1MLBA 1WZ1L 1T0NB 2X4PB 3MBXH 4FQ2L 3QULA 1E15A 3ZYIA 4YHML 4ZPVB 4KK9D 3ZJKA 1INQA 2Q3AA 3BGMB 1ISZA 5ECJE 2APBA 4B15A 1W1PA 3BT2L 2EH8H 4Z0XA 2ZSWB 5EU7E 4KGJA 4EUPB 2VXQH 3MLWH 4UQDA 3FCTB 1QSFD 1ACYL 4HA3A 4MNQD 2VDQH 4H5SB 1C1EL 3GHEL 3ARSA 5SWSD 4OZHE 4DGIL 1WJ3A 3HLAA 2VLJE 4NC0B 1BD2E 1RJYA 3BEWB 5I8CA 3U6RB 1RP9A 3OG2A 5I24A 2WVVA 2WM0A 3FCTA 4ZOAA 3ZM8A 1OIFA 5E7FA 4KK5C 2CLRB 3RIAF 3VRIB 4H26A 2YBUA 3QIBD 1YY9D 2Y07L 5EO0B 2DLIA 2ZZUT 3KLHD 5FYKL 1QBLH 3MLYH 4D0BA 5FGCE 5F1SA 4B41A 1T0NA 4OJFL 1EXUB 2VDKH 2OJEA 2RGMA 1QNQA 5K9KA 3UYRH 3BFOA 4Q6IB 1I4FA 3M1BA 4FK9A 1QNPA 1YMMA 5CJXC 2X1IA 4YWGL 4JPKH 1QLRB 3VWJB 3ZHDA 1Y18B 1U8JB 2FRGP 3D2UA 3UTTD 5T3XL 4XC3H 1NJ9A 1CK0H 4WEMB 4JRYA 3JVGC 4QTHB 5CBEB 1KLGA 1I3RB 3AAZB 4WWKD 2CERA 1IAMA 5T3ZL 4PMOA 2EIBA 1OWRM 1KQZA 3HB3C 4MAYD 3I6KA 4JO2L 3U30C 3EO1B 2DQUH 4JPVL 2C7FA 3QRGL 4NQED 2IMMA 3H42L 2WZEA 4PY7A 2F54B 4KVCH 3LN5B 3TZVA 3BVNA 4S3JA 8A3HA 1UWXK 1GYAA 1LQSR 4LLWA 4QKXB 5E03A 1V6YA 1ED3B 3J8F7 2DJSA 2P7TA 1ZHNA 5KVEH 4PJAE 1YYLL 3RM8A 4A3YA 4FFVD 4FA8A 4LX4A 3NSMA 4LLUA 1PIFA 1JGEB 2YDSA 1QNZL 3PHSA 5A40E 4MVBC 4MXVE 4UOW0 2WNGA 5D8WA 4WNQB 5HSFA 4NHCL 1S5HB 2ZNXA 2A6KB 1VFBA 1U8OB 3QUXA 4KH2A 2NY7L 1XD1A 1HIMH 4K3JL 4YNYA 1YDPB 1F2XK 3AHXA 2YD4A 1XGQB 4NNPL 4J3OC 1RUPL 5IBUB 5FB8B 1HHJB 1BZQK 5D71H 4HKJA 1IEBA 1WZ1H 1NBZA 1XEDA 3QUKB 4Q2ZA 3VM5A 1IGML 3RWCA 4CJ0A 5IG7A 3BKCH 1UM6H 1B31A 1TTUA 4OZIB 1D9KC 3S36H 2EE6A 5CGYC 3QI9D 1SBSH 1W9PA 2UZIL 5A6SA 1F6FB 5A2KH 2ESVD 5DWUH 4GKLA 5EU4B 3O2DA 5D6DC 4OQTL 5I79A 5D6CA 4X6EA 2NPLX 1NFDE 4M8QA 1RHHA 4PS4L 5GHWH 5TGBB 1VAHA 1TQCC 4LSVH 4MAVA 4HMEA 4OZGE 1D2KA 3HUJA 5ESVA 3WBDA 2FATH 3MRJA 4WUKL 1MWAA 1V3KA 1OPGH 1L7IL 1FH8A 5GGTA 3UBXA 4XP5H 4HDIB 3BN9C 3IFNH 5B8CB 1I8LA 4YZFE 5DJCB 3RZCB 3N04A 3IXTB 2G75A 5FYLD 3DXAB 4U6XA 4POUB 3ELAT 5GRWA 3KJ4B 1LILA 4XBGA 1NGYB 1P84K 5E6ID 2XZAL 4YHNB 3UTQA 5JDJA 4YEEA 3P0GB 4HUKB 1B6UA 2WINA 2D20A 3ES6A 1OCWL 4FXLA 4WI3A 4E42A 3A6BH 5A1AA 5MEND 1PZ5B 3BXNA 3CU7A 3RWJA 4P2OD 3CZEA 1KPRA 4Q74A 5ISZB 1GGYA 3KYKH 4J3XA 4PRHD 1INDH 3T2OA 4XMPL 2Z8RA 4ZFGL 4UV4L 1EBPA 5BJTB 4WHTA 5KSVA 2MOVA 4U3AA 2NX5A 4X9IA 3EBAA 5C08D 3UBXB 1LMKA 4PJ8D 4D0BB 1H5BC 3RBSA 1DWIM 1I7UB 2DQIL 3SE4C 3C5SA 3TGXA 2P46B 5B39B 4JJHA 1T20B 4QRTA 5CEZL 3DNKA 1D5ZB 3PP3H 2ID5A 1BMGA 1BVLA 1A9BA 2L7JA 3CLWA 4WW2C 1NDGA 2XJ7A 1N64H 4C83A 2QKIB 5D6CB 5AAMA 1CGTA 2F53E 3T04D 3C2AH 4XXDB 4PJBF 2KUTA 1KJVA 4JDZA 3RKDC 4Z7VA 4X7EC 4I3RH 1ZLSH 3SKNA 4KI5F 1R0AH 1EGJH 4ODBD 2OR7A 4U5KA 2B31A 4WFFD 5DJCA 1NLBL 1MHPL 2DIAA 2X4QB 1N5AA 1QW8A 2CIPA 1JPGA 4AIZB 2HJKA 1A7NH 4RA0C 3AROA 5DR5L 1QUNA 1T3FA 5C70A 4I1NB 5HDQH 4YQXL 3E8UL 3OKLB 1AR2A 3FQTB 4OF6A 4IMKC 3Q5TA 5EO9A 3QB7C 3HZVB 2XNAA 1M7DA 3O6KL 1YJDL 2VOTA 1PD6A 2EKJA 5DK2B 5HYFA 4Y19A 5K9QG 4TUFA 1I3VA 2WMFA 1RULL 3NCFB 4YHIA 1X4XA 5DJDB 5FGSA 4HT1L 2QLYA 1MF2L 2B1AL 3DUUA 1G7IB 4M7ZC 2G5BA 4I18C 1TITA 4JKKA 2WVSA 4MD5B 5HYSG 1DJSA 1AQKL 4ZSOB 1QVOB 1H3PL 4KK5D 5LA2A 1OAYH 4LK4A 2NR6C 4XCNB 4Z7QE 5JZ7D 2XWJB 1S78D 5FYJE 5FYKE 1QP1A 1I7UA 1MW0A 2WBJB 3T08A 5HHPB 5FOOA 1U8HA 2EZ0C 4EI5A 3GBNH 1PDKA 3OGCB 4YK4B 1UXWA 3F65A 3GKZA 5AWNH 5D71L 2DMCA 3LHPH 3OKLA 5IWLC 3WBAA 3QIWC 4AISA 1F6LL 5EWIH 3TYFA 5T1LD 4NNPH 1MFAL 3UEZA 4JR9H 5D8JH 5J57B 1BGAA 1DVFD 1NARA 1X6LA 4JDZB 4QHKI 4YC2B 3P4LA 4ODUB 2IG2L 5IFPA 1T22B 3HNTH 4NC2B 3K2MC 3LKPB 5EDXA 3UJTH 3MRPA 2GUYA 3KJ4C 4EXKA 3ECBB 3F7RA 2FGWL 1KIPB 4TVPE 2BY2A 4UFKA 1GGBL 4OZHB 4LOUD 4A2MA 1XGPA 4WV1C 1OP3K 4XBEH 2NY3B 2YN5A 3IGAA 2YUXA 2BY0A 3BPNB 1FL5B 4XPAH 6FABH 1OAUL 1HH6A 2D7QA 5BW7C 3I50H 4U33A 1ECEA 3HR5B 3GZKA 2J7HA 3OX8B 3L3KA 3CLEH 3D48R 3JWOL 5MEOA 3VD4A 2HVKB 2NY2B 5A2AA 4HUUA 5F9AC 1C91A 1EVTC 4JPVH 3PWUA 3DTXB 4YFDB 1C3FA 1DBBL 1CFVL 4RAVB 1NJ9B 3RA7H 5F7KC 5DD3H 1CE1L 4JFDA 4JFED 1E4JA 1SYSB 4K3HA 2R0LL 4XCYB 3MXWL 3RFZC 3OHXA 4F7MB 1N8ZA 2XPKA 1IBGH 3HU7A 1IEBB 5F1NA 1YJDC 3AXLB 4PY8I 3VXRA 2JELL 3UESA 4KRMB 1EFXA 4HOZA 4Z9KB 4ZFMA 2HH0L 2DLTA 3MRFA 2X4PA 1NCWH 2PC8A 2O26U 1JIBA 3QNYB 4NRXA 5C09D 4W8AA 2CQVA 3QHFL 1AGBA 3GSNL 3V6OC 1VENA 3EGSB 4OCRH 3E8UH 1T04A 2FDBP 3N1QC 4PV9A 1KGWA 1FO0B 1NANH 3ECBA 1B2WH 1XF3A 3TO4C 2OSYA 4R0LC 4J27A 5F1OB 4EEEA 1NCAL 4LVOC 4P46A 1YN7A 3DBXB 4BFEA 1KXTB 1GOKA 5C7XH 2PW2A 3L3OA 1JXKA 4PG2C 3I3BA 2DWEB 4F7TA 4N0CD 1A0QL 1V0KA 1A9EB 4Z77B 3E6HA 3I50L 4MJ5A 1OAUH 4U31A 5EC2A 4PGBB 1IKFL 1X5ZA 5CILH 5SX4I 3RKPA 1JD9A 5IXEA 4L4VB 1NC4D 2ZUUA 3TEUA 4P4RB 2XN9A 1XF5B 3TNNB 5TDNB 1KGCD 1JV5B 2X05A 4RQQB 3E6HB 3WDIA 1X4YA 3T0EA 3FMGL 3AB0C 3QUZA 1YUHB 5KSBE 1JI1A 4IMLA 3WIIH 2YUVA 3O2DL 1MCNA 3GMLB 4X0KA 1KCUL 4MNJA 4F7MA 3HZYB 3L1OH 4U6VL 3G6JB 4GQPH 4JY5H 4J3VA 4OLZL 4X8JA 1FZOA 2D3NA 5A3HA 2VX5A 3MV9B 5E70A 3W28A 2WXDM 2HKFH 1JMZA 3QNYA 1QKZH 2BJML 1FLRL 4XNUL 4UQEA 3LAFA 3JV4A 2VH5L 1OTSD 4LDLB 4WVRA 5E0FA 2CXKA 3KGRA 5I2IB 5D7IE 5M94B 5F7UA 4HWBH 2MKWA 2XPGB 1ZHBA 1ED7A 2AP2A 1OY3B 3AS3A 3S98A 3T0EC 2IXVA 1FE8H 1DQJA 3RY5A 3QUXC 4DEPC 3L6FA 1DEEB 3BHBB 4PEEA 5DVKA 3JUZA 2VABA 5GRXG 4RE3A 1XRVA 4HWBL 3NIDF 4QGTA 5D7JB 3C6LC 4WI5A 1OWWA 3WQ6A 5D1QC 4L3CA 1QO3A 5D2NC 5GS2D 4JLRB 3VXSA 1JHTA 5F7DB 3W0WD 4IOIB 4HG4J 3POCA 3SGKA 1M01A 4X9FA 1HH9A 1TVBA 4MNGB 3EFDH 4OCWL 5FL1A 1UT9A 2IAMB 1FP9A 3X17A 4LLYB 2UWEB 1JPFA 3NFNB 4JY4A 4NCC2 3RL1A 3X13B 1FL3B 4Z7WB 1JXJA 4JFVA 5GNXA 4HCRL 3NIFF 1NAMH 1DN0A 1NKRA 4QTIH 2WAHA 1CZ1A 1PX4A 1XIWD 4XTRD 3WF1A 1OM3L 2DQDH 4CL7A 1VERA 2J79A 3GBMH 3HUJB 1NWRA 2XWJA 2PXYD 1DVFA 1HT6A 5EU6B 1V0LA 3MOAH 4F7PB 1G9NC 2QQKH 1T80A 4PB9H 1S7RA 1E3ZA 3LQAH 4MS8D 4XHQA 4GW4A 3CFJB 1KYOK 4QCIA 4PJGE 1XAUA 4CGTA 5D4QA 4XXCA 5CLWA 5BV7L 2Q6WB 3HI6H 3FRPG 2R4SL 1B88A 3FN0H 4XAWL 3SGKC 3OB0K 2DB8A 1HJSA 5M3WA 2O9PA 3WELA 1NGYA 5JOPE 1JRHL 1WBXB 2V2TA 5DA0B 1B90A 3F6LA 1EEYB 3HA0A 4JN2B 5FA3B 5HHNB 1J86A 4OKVB 4DWHA 2R4SH 1BAGA 4YFEA 4POYA 5IEKA 5KSAB 1WP6A 5SWSE 1DQJB 1INEL 1FL6A 2EYRA 5CJOL 2F8OA 2C5DC 4E8CA 5DRZA 1N64L 4PJ5D 4HWUA 3MLTB 2FHBA 5T1KB 1JRHH 1GOGA 3IRZA 3TIEA 4JJ5A 1GXEA 1KG0A 1UJ3B 5L2JB 5KVGL 4W86A 3SDAA 4AY1A 2H41A 1H3TA 1B9ZA 1KPVB 4MJID 3ZJ7A