4HMCA

Crystal structure of cold-adapted chitinase from moritella marina
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
528
structure length
528
Chain Sequence
GTITSQDDNVVVGYWHNWCDGRGYQGGNAPCVELKTVNPQYNVVNISFMKVYDIAEGRIPTFKLDPTIALSEAEFIAQIDTLNSQGRSVLIALGGADAHIELTRGDEDALAAEIIRLTDLYGFDGLDIDLEQAAITAKDNQFVIPAALKMVKEHYRKTGDNFMITMAPEFPYLTANGAYTPYLTELDGYYDFINPQFYNQGGDGLWIEGVGWIAQNNDALKEEFIYYIADSLINGTRNYHKIPHDKLVFGLPSNIDAAATGYIQDPQDLYKAFDRLKAQGQPLRGVMTWSVNWDMGTDAANNSYNQQFIKDYGNFIHNQLPPVTDMTPTLSGIVDTRVELDSHFDPLIGITAKDYQGNDITADVTVSGSVNTNQVGDYLLTYSVSSDDETTNQPRKITVYEILPAFTGITDTTVVIDSEFDPMQGVSASHPTQGDLTANITVTGEVDTNVVGVYELTYQLFYGQDNQQNMTDKRIVTVVTDAVSDDDWQVGSTYVKDDKVTHNGATWTAQWWTKGEEPGTTGEWGVWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chitinase 60
publication title Structure of a complete four-domain chitinase from Moritella marina, a marine psychrophilic bacterium
pubmed doi rcsb
source organism Vibrio marinus
molecule tags Hydrolase
total genus 167
structure length 528
sequence length 528
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2012-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
A PF16403 DUF5011 Domain of unknown function (DUF5011)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.20 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Carbohydrate-binding module superfamily 5/12 4hmcA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hmcA03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hmcA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4hmcA01
5TDPB 4P2CG 3T0ED 4G6MH 4G9FD 3SEPA 3GSQB 1I3GH 1LGVA 5I1CL 3WIJA 5H8DA 3ARBD 3WKNA 1OPGH 2VRKA 2DDXA 5E0FA 2FJHA 2V5CA 3T8XA 5KVFL 3REWA 2MFNA 4WF7A 4O51A 1AC6A 5F72S 4ONHA 1NAMB 4YEFA 5JBEA 1P4IL 2FGZA 1QYGH 3HKFA 2DQEL 5A6KA 4UQ3A 5IW6A 1EGJA 4PJIF 3DVFA 4ODWB 2BDNH 3O6MH 2ZZUT 5LG1A 5TE6L 1AJ7L 1CDYA 4JFXB 4X0KB 3CUGA 1X5XA 3MSDA 3SCMC 2HVMA 4PJ9A 1MCPL 1SM3H 2Z93B 3DO7A 4RGNB 5LAXB 5E99L 5EZOL 2GSIA 2HFGL 3F58L 5JORA 3DO3A 3U4AA 5IB4A 4HOXA 1OF2A 1T2QL 1MQPA 2E5EA 4F57L 2LAGB 3QG7H 3JTTB 4G8GB 4NHUB 5FYJD 1V7ML 3LPFA 5DS8A 1YJDH 4PJDF 1W2KT 4Y4HD 4LGRB 2H2SC 4HUMB 4DUVA 3UC0H 4J4PD 1CG9A 1Q6DA 2EEDA 2NY1C 3VRJB 5D71L 5TQ0L 3RWDB 2X9WA 2OJZH 5EIVA 2DOCA 1VFOA 4H20H 5HI3C 1IEAB 4UILL 1ISYA 4JO1L 3R4DA 4H1LB 5CHNB 5JW3H 2CLRB 5F7LB 2BP3A 4MQXC 1U2CA 1UWGH 3B8SA 3MLRH 5I0DA 2VERN 3N0PB 3O2DL 3PHQA 2Y2WA 2I07A 4LARH 3WFZA 1H5BB 3VWJB 1A7OL 1CNVA 1YNLL 3KG5A 5AYUH 5TE7H 1NUNB 3ARGD 3L9RB 3NCYP 1YNTB 3P4OA 5AG9A 2DI8A 3HUJF 5EBAA 3KPTA 5I75B 3VDBA 4PREA 4HWUA 2BERA 4PJIA 1C93A 3VXMA 2FO1A 1P6FA 3BWAA 1ROWA 4NQCD 1M4KA 5IBTH 4WIWA 3D85D 3B2VH 3BUTA 4FFZH 4W87A 4PYHA 1MFVA 4Y5XA 4NJAL 4HXAL 3BGFB 2F53B 3PZNA 2AJXL 1PW3A 1W32A 2VC2H 4PJDA 4Z76B 1G7PB 4JRXB 3FO9B 1DBKL 3V4UL 1FGNH 2HFFB 4Y2DD 3WNPA 4NM8L 4IOFD 3DMMA 3GKZA 2AXFA 5IESL 1QD0A 2RB8A 1M6OA 3GDBA 4Z7WF 2BMKA 1NEZB 1FV1B 2OTUB 2I60L 5E8EB 4PG9A 4YWGL 4L4JA 1QI5A 2DLFL 5FO7B 3ARPA 3WUEA 3D87B 5BQ7B 4FTVE 1MIMH 4EN3C 3A67L 3TNMA 3LRSA 2BK8A 3VFWB 4DWSA 4KJWD 4Z2HA 4CD8A 1R3HA 4IMKC 4M43L 1A6VL 5IW1B 1YN6A 1K6QH 3NCEB 3QRFM 4MA3B 4F58L 1LWJA 4V1DA 1OVZA 1JE6A 3EW3B 3KVQA 2WMGA 1G9NL 3KWXA 5TPWH 3EKCA 1CGTA 3ILQC 4XBGA 1I1YA 1P7QB 1MF2L 4HV8B 4LPWA 4XHJC 3SDYH 1VA9A 2YBTA 1Y7VA 4FABH 1SVCP 3UZVB 1E5NA 1YEEL 4OM0H 1IGFL 5EMYA 1CICC 3KYOB 3ES6A 3L5JA 2YWYA 5JQ6L 4OLZH 2VZ1A 1WBZA 2XVKA 2JK5A 5FHAL 2JB5L 2VT0A 4S2SA 1IL1A 1J18A 4YHPB 3JWDL 4ELME 1OCWL 1T66D 4MAVA 1UB5B 3QUML 1KPUA 2F74A 5JO5B 5D9OA 2X1PA 1G6RL 5B3NA 2IAMA 35C8L 1NKRA 3B9KC 4P2QD 1U8HA 3S35L 5EN2B 4Z7WA 4RA0C 3GB7A 1GORA 1BGXH 4W68A 2EDJA 5CMAB 2EDRA 4Y1AB 4CMMB 4N0FB 1G7MA 1S9WA 4KI5D 4JFYA 3S36H 4EJ1C 4C4KT 4PJXA 3P9MB 4LLMB 4KKLC 3AICA 2AQ1A 1VSCA 2DWDA 3DOSA 5K59F 1VFBA 2E8ZA 5A2JH 5F96L 2XRAL 3C5ZD 3BDYH 4NBYB 3UXFA 4QNPF 3AIWA 4XXDA 4Q58C 1MXGA 3UX9B 4GG8A 4CDHA 5D7IE 2Q3ZA 4JN2B 5I6XC 5TH2B 4CD5A 3DSFL 3SDAA 1MCDA 2ORBL 3NZHL 3AREA 3QULA 4ZAKC 3MS8A 3IJHB 4NP4L 2ITCB 3FO1B 5ITBH 5CEXA 1PX8A 3GSUB 5HGBB 4PJAE 4EOWH 5FIPA 3JWOC 4YUEH 1WLHA 1QLEH 1NCBH 3MRNB 2XJ7A 3FZUD 5EORL 1LE5B 5IT2L 4BUHA 5FUCE 1QOKA 2DGAA 4M7ZB 4L9LC 1BQHB 1ED7A 2Y1VA 2CLZB 3QQ9C 4XPBL 2B20A 4LP4A 3ZKQD 4R97B 3OG4B 1TVPA 4OCYL 5IKCA 3BRDA 1MFEH 3SGDH 2A73A 3I85A 5IMLA 3AU1B 4HWBA 1PG7H 4OAWB 2MQ0A 2R4RL 3O4OC 2J8GA 3L4YA 3QQ3A 5A6JA 3D39D 3KLAB 3VINA 5J06A 1KR1A 2AABL 4MHHI 1LLOA 1TZ7A 4DN3L 1OIMA 3QYCA 5KANI 2X10A 5GIRA 3QDJD 1MRCH 4MAYA 4PJFB 5CILL 4UI2A 5IFJB 3MKKA 2ESVB 4UDUA 1B3JA 1FA2A 1UWXK 1O7AA 1CGWA 1KEMH 2DL9A 4U6HB 3AMGA 1SY6L 4DUWA 2NY2C 1I85A 1QHOA 4OJFH 1DCLA 2A77H 5H37H 2A1WH 2UV3A 1BVZA 2Y07L 4PJ5A 2R0ZL 3MBEA 5I74B 2G9HB 3CZKA 5GGQL 4YFDB 1GZQA 1J8HB 2DM3A 3ARXA 3BIKA 1R3LB 3CK0H 2VITB 1IQWH 1NCAH 5D7LA 3O3UN 3SQOL 1K9EA 5T3ZD 1EMTH 3KNBB 3QJFB 5DTFB 3QNYB 4ODBD 5D6DA 1XIWD 5HHPB 4JY4A 1G7JA 5I1JL 4KRUA 2BJMH 3L5WA 4LNRB 1FNSL 1MNUL 3K2UL 4D6JA 1MCLA 1BWMA 2A6IB 1OGSA 1UENA 1AGCB 4MNHA 3K8LA 3WS6A 3IDXH 2PCPA 3V6BR 5CSBA 1T6VN 1FNGB 1CGUA 2ZSWB 5HDOA 1MCJA 2IJ0C 3QEQB 4M62L 4D9QE 2VX4A 3WUFA 3W4RA 1U8MB 2P48B 4QHUB 4I4WB 4UQ2A 3IAQA 4XZWA 2JJWA 5DD0H 5HDLA 3MUGA 2WUCL 4JDVA 3NIYA 4URIA 1Y18A 2VH5H 3QCUL 1L9NA 5GZNC 3QHMA 5I1LA 1A3QA 8CGTA 5HVHC 4UU9B 4PJ9C 2R9HC 3MUHL 3Q3GB 3N50A 1A7RL 3NDZA 3VG0L 2XPGB 3KPPA 3IDJA 2V7HA 4DVRL 4WUUD 1FNAA 3UP1A 4CJ0A 5M94B 1KTLA 2PR4L 5DJ8A 2UUDH 1B0GB 4JPKL 5FKPB 1E0XA 2AVGA 4TOYH 5A95A 4G7VL 2QQKL 3L7FA 4UT9L 1E4KA 4PJHB 1GPFA 1DBMH 5CSZB 3QEUA 2PF0A 4AEHH 4ZUVB 3CFJB 1KLGA 3DGGA 1KCRL 2E7CA 2QF8A 1BFTA 2AK1L 3NCMA 4YEEA 3ZDYF 2WCAA 5D9PA 4I48B 5CJQL 1QI2A 3W25A 2HJLA 5JXAL 1DE4B 4MHHG 1NGQL 5IIEA 4JHAL 1NBVL 1VGEL 3VMNA 4FZEH 3T1FA 1TZGL 1OSPL 1ZTXL 4Y4FD 2O26U 3ORJA 2AAAA 4LHUG 1JUFA 4Y19B 4R27A 4X4YA 4AQ1B 1RZKL 3IJ9A 4WHTB 4GAJH 3NIDF 2P43B 2IQAB 4U1JB 5GRUL 1ZLUH 3RGVD 3P73A 1JWMB 3UCQA 4OCSL 5GHWL 4YHML 5D96C 1G7LA 5K9JL 5K9OA 4H0IA 2NX5A 1H49A 1SQ2N 3F6LA 2CO6B 2DF3A 4J1UA 4Y5XC 3RY4A 4UOW1 3EOBB 1C8YA 3D1MC 3L3GB 4QTIH 2ZKHH 3RVWC 3PN8A 3RIKA 1RZ8A 2VL4A 1QKZH 2KQMA 3TVMA 1I9JH 1KJ2H 4NQUA 3TYFB 4BFIA 5BMFL 4QRQA 2OZ4L 2E6JA 4POUB 2HKHH 4KROC 2XXMB 4IRSB 5CPSA 4XNQB 4XMLH 3VGFA 4KUZL 3DSNA 4WCYL 1P7HL 2FNBA 3DMMC 3IETA 4EE9A 2ICWB 2DM4A 1KBKA 3DYMA 3RL1A 4PRPD 1UM5L 3M17A 1AO7E 1IGCL 4JDZA 5D72H 5FA3A 1VIWA 1CGYA 2F54A 2DBLL 3VA2C 1JYXA 1JD7A 3AI0A 4QHMA 2QSCH 1ZBCA 1FZMA 1X9QA 1G1YA 3C6SB 2B2XL 5E2VL 4YBHA 2NMSA 1IKNA 1E56A 4XPFH 4PB0L 2OSYA 3TN0D 5MEQB 4DWSC 4LL9A 2O5XL 4CVWA 2VXSH 1OQOA 4JPWH 3NGBB 3PABB 1LDPH 2NXZB 4DGYH 3WLBA 4Y16B 1Z0MA 3UESA 4AZCB 1GGCL 3QEGH 2NY7H 3IVKB 2F61A 3LH2L 1GZPB 5KSUA 5EZLB 2W9EH 1FAIH 4PJ7B 4TVPD 1ZJAA 4WV1A 2Z8RA 2X40A 1MELA 4KMTL 4PLJC 2XWJB 3OR7A 3PHAA 4NQEB 5L88H 4H8HA 3MLTA 3VIJA 1QEWA 1Q8MA 2GK0B 4P48A 3NFNB 4BQCA 3IFLH 4D0BB 1CLYH 1C12B 2D7TL 4S1RH 4BQBA 2P5WE 2X2YA 1N3NB 3HCVB 5MENB 1GHRA 4D8PA 2IAMC 1PKQE 2X4RB 4XNUL 2QQNL 2DQCH 3GBMH 4RWYL 5L9DL 3JV6A 4HMDA 1JHLH 3TFKD 3MSGA 5FB8A 4HUUA 1J0YA 4RFEA 2Q86A 3AZSA 1FIEA 1U8QB 3IDNB 4NFCA 1RHHB 3WFHA 4IS6A 4HT1H 2WMPA 5KJRH 4GIAA 3H9YA 4BQ6A 5I71B 3WUWG 5HHXL 3RUGB 5F3BB 3ZHKA 1A9BB 1AQMA 2O93L 1DJSA 4UFKA 4NKMB 1F6LL 2OR9H 1FDLH 1XMWA 1BLNB 1L6ZA 4TUKL 2BOBA 15C8L 3VXSD 3L6FA 3MRHB 2FJFA 1F2XK 4XPGL 1I8KB 5DYOB 1OTTD 2DTMH 3D0LA 3HI1A 3SDAC 5I2IB 4XVJH 3AREC 2VLME 4KVNH 2FH8A 4M1DL 1E0VA 3D2UB 3CNKA 3KLSA 2K3TA 4XX6A 4JFFB 2R0LL 4NN7B 5IGXL 4DKAA 2Y7QB 5C08B 2OJEB 3I9GH 1WZKA 1TMQA 2C3VB 3WDPP 2ZUNA 2VXVH 4N9OB 3OKEB 4PRID 5KSBB 1IGYA 2CGRH 1FO0A 3TYGL 2JIXB 2EDQA 3GYCA 1LO4L 1P7KA 4KV5F 1BJ8A 3HS0A 3IFNL 5E2WL 2GSJA 1I1XA 3MV11 1F4YL 5CZVL 1KGCD 1I1AA 5F9WB 3VIKA 3P3YA 2AJ3A 1A2YB 4Z0XB 4FLSA 5EO9A 5J8OA 1BG4A 2EDNA 5SX4I 1N6QL 2Q8AH 2QADB 3VXUD 1H41A 3ZDZF 1T21A 1AP2B 5C09A 2CKRA 1GPOH 1N0LA 1D9KA 3RHWK 5E00B 5HYJB 2OWWA 1UWUA 3CXDH 4KQ4H 3U4BL 1UXSB 2VLJD 4PMUA 2Y36H 3AHZA 4UIMB 4TSBH 2G60H 2X0HA 3CVHH 4NCC2 1FZKB 3MUAA 3FT3B 4MAYC 4BQ5A 1NDMB 1TLKA 1HDMB 2OQJA 3DC0A 2ADFH 2D31A 1HI6B 1IGJA 4M7LH 4B50A 2KPNA 4NBZB 2APWA 3QO0A 4I3SL 1I85C 4K9EL 4YZFF 5JDSA 3CFEA 3KXFE 4WWKA 4X7CC 5EBLB 4EIGB 4AZIA 2WM0A 4QEGA 4NO0B 1TCRB 4PUBH 5E6IA 1U8JB 3MTRA 4N5ED 3VXNA 4OF8A 4GMSH 3RU8L 2HG5A 4ZYKA 1AR1D 5A16B 1MFAL 2WIIA 3BO8B 5EFIA 5F9DC 3VRIA 1AE6L 1IAIM 2ZX8A 5D6DC 5DWUL 3STLA 4QY8B 3IFPA 3MXWH 5GRJH 4CNIB 3HG1E 1SJHB 4O5LL 3WS6C 2AEQL 3SDCB 1W3JA 1JHKL 3MRQB 4N0UB 4U1LA 3BLKA 4K7PL 1KPRA 3RJXA 3PHSA 5EO1B 1CBVL 2X9YA 2NY0D 5IF0B 1NCUA 1W0WA 4E8CA 5KVGL 1JNHA 4PCTA 2YRZA 1FZOA 1TJGL 3H7LA 5B39A 1G9EA 4HQQL 4E41D 3UZEA 3DYOA 5D9SA 3AHTA 2ZOLB 3N9GH 1T4KA 3DX9B 1H3GA 1EBPA 2CO7B 3S88H 5DJAA 1J1OL 5E1HB 5D8ZA 4MNGB 3PZTA 1Q9OA 4LLQA 1G0YR 3X12B 5SX5H 3JTSB 1JZ3A 5D9MA 4XCEB 1HT6A 4OI7A 1L0QA 3PIQB 3O8XA 1CFSA 3P77B 3QXVA 4PP1D 2AV7A 4EQ3A 1DQTA 4C58B 1VPOL 4F7PB 2CDFA 1E4KC 4LVHB 4CL7A 1JP5A 3S3SA 2AEPL 4XWOD 1CT8A 1YMHB 2XN9D 2IADA 3NN8B 1FL6A 4GRWB 5ACZB 1HYSD 2GCYA 3QJHA 4YHLL 4J8RB 2PTTB 3WCYA 1A6ZB 1HHKA 4HUVA 2DIEA 3WUBA 2EPNA 4YIQA 3WEXB 1MAKA 1Z9LA 5JR1H 1F4XH 5F9JB 5BYWA 2EKJA 4FQ2L 5HYFA 1CLZH 1NSNL 1QFWH 5I73C 5FYKE 3DRQA 2DTSA 1ZHBB 1WT5A 4PRDA 3U9UA 4Q9RH 1OY3B 3QUYA 4PJCF 2XGIA 4QXGL 3WH9A 5FGCE 4J3SA 2I27N 3V6FB 2DYPA 1CD0A 4C57C 1RU9L 1H8SA 2DKSA 4FQIL 3PNWA 4OCNC 3OKKA 1HOCB 5C0RH 3T2NL 5MHSE 5FM5O 4KK5C 4RFNC 1NAML 1U8OA 2XZAH 3UBXI 1QSEB 1JZ7A 2YEZB 3TVMC 3P0YH 1OGTB 1S7SB 5GS0H 2XG9A 4YE4H 2FB4L 3G9VA 7TAAA 3L1OL 1HIZA 2BFGA 3L95A 2HJFA 5BZDB 1QR4A 1SJVA 5I1HH 3MLXH 3SKMB 4H8WL 3SGJA 3AUVA 4NKIL 5JMRA 4MD5A 4BSJA 5L2JB 4FK9A 2PW1A 4UTBL 2X4OB 4X4XA 5GGTH 1RUKL 3UDWA 4C56E 4R0LA 2QJDA 4MDIA 5JIKA 4ZD3L 5J13B 1CFVH 1MYRA 1XYFA 1SEBA 4GW4A 2H26B 3L5HA 3RVXC 1IKNC 2HYMA 2J79A 4TQEH 2VZVA 1XF4A 1BVKA 5KW9H 1WIOA 4PJCA 1HNFA 4G42B 5IBLD 4L8DA 4OZFA 1CFQA 1BBJA 3MROA 1D6VH 3K1KC 4X7SL 3M8OH 3O6FB 3BD5A 2KZ1B 4PRAA 5GXBB 2OWXA 1ZOXA 4F2MB 3V7MA 2WAGA 2WNGA 1Z9OA 5EBMB 1KLUB 3RRQA 3AXLA 4JKWA 1SYSA 3AMKA 2VDLH 1J0IA 4WV1C 4GXPA 3N1PC 1FVCB 5F1KC 4KTEH 5E9DB 3DX8B 1ULVA 3SCWA 1KCVH 4D9LL 4JJ5A 1FVDB 2XQBH 2FIKA 4XVSL 4ZXBA 1U41A 2OBGA 5EO0A 3MSPA 4X8JB 3V6OE 4FQXD 5EBWA 4X80L 3GI9L 3VFVA 3EYQC 1UA3A 4RWHA 5FO9A 4PRHE 3W9DA 3WS3B 4QRRB 1FNEA 2CDGA 3U1SH 5IFAH 2LU7A 1U8LA 3P0VH 5DSCA 3LN4A 1GJUA 1LEGB 2VISA 1BFNA 1KXTB 4OM1L 3OG2A 2HMIC 3O11B 4U3HA 5D7SL 5HI5C 2JEQA 2P7TA 1BBDH 2CK2A 4G80A 2VB5A 4I5BB 2DI7A 4JHWH 4Z2KA 5D7IF 1F58H 2VZTA 1S5IL 2B5IB 2YS4A 5BVPH 1INDH 4P5TA 4YO0A 2JLLA 1C91A 3QFJA 4MD4B 1QBMH 4RE3A 2OR7A 2QHLA 5IEKA 5B4MC 1VEPA 1OAKH 5HOSA 4XH2A 3S6CA 5GISL 4XNXH 3K81A 1DVFA 3KYKH 4JFWA 4HCRH 2LE9A 4LSDA 3UJTH 1JRHL 1YYMH 1MFDH 1MVYA 3FFCE 1RSFA 4KY1H 4ZUWA 3SCMD 3T09A 4XCCH 4E8DA 4HX1A 3VH8B 2XWTB 3CDFA 4HWBH 4PS4H 1V3MA 1DQMH 1JN6A 5JUEH 4P7RA 4GI9A 4JFEB 1A7QH 4ACYA 1I1AC 4X83A 1HJWA 3KJ6H 3OB0K 3QT2A 2PNDA 5J1AA 3N18A 1U8KA 1DWHM 3QXAB 4HWEL 3RHWF 1WFTA 3TA3B 1E6XM 3VM5A 3GHBL 2PBOA 1D9KC 3UBXA 1MLCA 1T2JA 3G5VB 2CUHA 5F8RC 3BJ91 4MJID 1OGBA 4YXLL 4WW1A 3IXAA 5HI3D 2XTJC 4WKHA 3OV6A 4BQ3A 2Z8SA 4IDJL 4X0VA 2XIBA 1OD7A 1WWCA 4OB5L 1ETZB 1K4CB 4GW1A 5M3WA 1BECA 3SDDB 3U30C 4X5WA 3ZKMD 2YSSB 5SWZB 1NBYB 4OF6A 2VLRD 1EOKA 4NUGH 1VRXA 4XB8A 2EYTB 3KLDA 4WFEE 2ZNXA 4WWKC 4QHLA 2V2XA 3RWEB 4JO4H 2R0WL 1D5BB 4M7KL 3K46A 4NYLB 5E6IC 5KSVA 1CGXA 2XYCA 3HMCA 1AKJA 4LSRH 3CIVA 1K5NA 2HKFL 1WBXB 3TZVA 4PN2A 4CN4A 4Z7VF 1XGRB 4XC1L 3VI4E 2R1YA 2VR9A 1CLOL 4AD0A 1YN7A 4P2RB 1C5CL 3D3VE 2VDKH 1R85A 3VFMB 3HFMH 1DWGM 2WC4A 4PTTA 4PUEA 3RY5A 3KPOB 2X1OA 1FYTE 1H3PL 2JJUA 1JMXA 5E8PB 3LEYL 1HILA 1G1CA 3CSBA 4NRYB 3O9WB 1BEYH 4BFEA 1QVOB 1BAGA 3MPCA 1MI5D 4FFYH 3K74B 4H88H 2HTKD 3N1QC 1RZIB 4FQCL 5H2BB 1LNUA 3RTQB 3POCA 1CL7I 4QRPE 2F19H 5IUSA 3W24A 2EPMX 4GQRA 4XP6H 2EEXA 2YBUA 1U93A 5I77A 5IFPA 4P4RB 2Q6WA 2X4SB 3MLSL 4GAYA 3H9HA 1G7IA 1HSAB 3H9SE 2J6EA 2A3HA 1C16A 4EUPA 3O41B 4XP9L 3BAKA 4F7TA 1E4XH 1MJ8L 1X7QB 4OLYH 3GM8A 4GSDL 1B2WL 5IFHL 2A3BA 1HXJA 1XGYL 3C6LB 4WTZG 4KKAC 2MOVA 5FYLE 5J7CC 2BHYA 2FGWH 1RZFL 4Z7VA 4R8WL 3SCVA 3O8XC 1HEZB 4Y8DC 2G3MA 4K3DH 5L8KB 1UKSA 5EUOE 1NGXA 1WZMA 5C0BE 3MNWA 2F5AH 3C2AH 3D9AL 2R23B 3CFKA 2H41A 1PQZA 3T4YA 2WANA 1CICD 3N1AA 4R7NB 2EJ1A 2EIDA 3K2MC 3W82A 3WMBA 1Z32X 5DD1H 3BN3B 1BAFL 2HN7A 1RURH 1ZLVK 1EXUB 3O2LA 4LAQH 1WZ1L 4U33A 5ICYB 5I6SA 4G9FE 3HRZB 1AGDA 1AY1H 5D5MB 4UDTB 3P40A 5F1OB 3BPOC 4X98A 4LGXA 3QUYC 3MLVH 4N8VA 1QBBA 3OLEA 2YUXA 2EXOA 5ADPH 1JG9A 5D7KD 1ZT4A 4HPYL 4CVZA 4C59B 1NLBH 2DD8L 3SUUA 1CE1L 1KFWA 4P99A 1DBAH 5C9JB 2DLEA 2P5EB 1VBUA 1LK2B 2DWEB 2NY4C 3O6LL 5KG9A 4HUWA 1REIA 4KJQC 4EEEA 4KXZH 5DJXA 3KPRD 4P4KD 4JY5L 3FQXA 4FQHB 1WV7T 4DCQB 1KB5A 3GSVA 4JZOA 2APXA 4I2XB 3W38A 4ZUSA 2YPVL 1BPLB 3H2WA 2NT0A 4MGXA 4DQOH 3VD9A 3CZJA 2UY5A 3PV6A 4E9LA 3MBXH 3PWLB 2GK2A 3SGJC 1M7DA 1UR2A 1XF1A 4XB7A 4JFDE 1UR0A 3OAUH 4JRWA 4LOUC 5FYJE 3UDWC 3KEHA 2JALA 1FN4B 4QGYA 4R0LC 2DS4A 3FAWA 3A4AA 1A1NB 4GW5A 5KZCB 4KKBD 5F7EH 2O5ZL 3I84A 4AWEA 1CFNB 3CVIL 3DV6A 4ODTH 3O6KL 2XT1B 4L3EB 4U6TA 4JM2F 4IOIA 3O2VH 1D3CA 3IDMA 4L8CA 2EC9T 3RA7H 4LCWA 1EEYB 3BAJA 1H0IA 2VDQH 3IU4H 2WLZA 3L4UA 4M93B 2SEBA 1WE5A 5B8CB 3B6SA 4UINH 4RL3A 4RRPG 3QDMD 5HGDB 4HIIA 5DEFB 5TF1L 1CXEA 3HTLX 1WZAA 2CKSA 3W9EA 4Z78B 5I1IH 1LF1A 3TCLA 2FL5B 4AD1A 4IRJD 5D1ZD 2H3NA 4UQBA 2W9DL 1ZEAH 1UACL 5T1LB 5EBGA 3FJTA 1P4LA 1EAPA 4OFVA 3MGTA 1T5WA 2GAZB 1K4DB 3TEUA 1W1YA 2EZ0C 1E4JA 4NQCE 4L3CB 4WK9A 3L3HB 5FM4A 2WWCA 4Z2GA 4QCIB 4MWFB 1IBGL 1AO7A 4ZXBC 1KELH 4HJ0D 5M5DA 4TUOB 1KTDB 3TBWA 5MP6L 2AV1A 4AYFA 1G7QA 4KDVA 4RE2A 7FABH 4P23D 5D1XD 3WKML 4JIEA 4NM4H 4U1SB 1Y0LA 1UD5A 2VRQA 3CFCH 3IB4A 1OD0A 4PLKC 1AI1H 1A47A 1KG0B 4L4VB 5AAMA 5B22A 1HIML 1HK6A 4F9LA 2Z31A 1FCGA 5DURB 5BV7B 2V2TA 2O61B 1ZT7A 4HGWB 3EGSB 3EJJX 1UH4A 4G6AD 3ZQ9A 2Z91B 4TXEA 2ADIB 2P8MA 3TM6A 1XH1A 5EOTB 2JELL 1T20A 5KBNC 2VCAA 4M7JH 5MERB 4P5TC 2XVGA 4JM4L 3BPLB 5ESAA 1X1NA 1LP9E 5HY9A 3RWCA 3MV8D 3SOBH 5CZXC 1UYWH 2NW2B 2AGJH 5ALBH 1H0DA 1I7UB 1M7IB 2OI9B 4HHAA 4LVOC 1HQ4B 5E2UH 4OGAD 5C07B 1XSIA 5DJ2A 4F8QA 1NOWA 4PD4J 2P5WA 5E1AB 5I66B 1TJHL 5FKAA 5LGHH 3UO1H 4HOWA 4XNMA 1PKQA 1DVFC 4P5KB 4D0DA 1MY7A 1KT2B 3EZJB 1MJUL 1UZ6E 4AYSA 5DK2A 1ZHKA 1D5IL 3L3DA 5F7DB 3TPKA 2BNQB 4U1NA 5D2NB 2MCPL 3KDMB 3WH6A 3OKYA 3MLZL 3QIWD 1UM4L 3GBDA 4PGCA 4H1LG 2BNRE 4PGEA 3T4AA 2J7HA 5AZEH 5EOCL 4XMPL 3PZIA 2HT3D 5CFHA 4W93A 3QZWA 5JLZA 4LCYB 4U6XB 1E6OL 2FX7L 1O6IA 1T04B 4WFFD 5C70A 4A6YA 4P2QE 4UOW0 1OAZH 1EERB 1E4WH 4F37K 3RJYA 3LKPB 4OBRA 4X5LA 3EO9H 5J12B 5KSAC 2E0PA 3H0TA 1NAKL 1HL9A 1KB9J 5KVDH 3FB6B 1I4FB 4NWUL 3BQUA 3MRGB 3C9NA 1US2A 1JPFA 2W9LA 3ULSA 4PJGE 5ESVB 5C7XH 5DQDL 5GGRA 4WEBH 5LVEA 2XVLA 4GQ9H 4ODXA 3WD0A 3CDGB 3PGCB 2COQA 1U3ZA 3UTSD 5FUCC 1KJ3L 4NDMB 3MFGB 3CIQA 3S4SA 1QPKA 4NT6B 1R24A 3GUTB 3FOMB 4BYHA 5IK3B 2AS5M 1E1FA 3TZVC 4NUJA 1JL8A 3SIMA 3MCG1 4DWHA 3ARFA 3EJZD 4LF3B 3QUZD 4JQIL 1MJJB 3S36X 2E7HA 1WWBX 3ARVA 3ARDB 5DMJB 4JPIA 1GZJA 4V28A 1M71B 2D03L 2F9BT 2W65A 4OTXH 2CD0A 5IB3B 4K3EH 2WINA 2IUZA 3VGEA 4WTWA 1NEZG 3RP1A 5I1DA 5DGQA 1YECL 2Z9TA 3L7EB 5E0QA 3PJSB 3HZKA 3W0WA 1XV8A 2EXYC 2V2WA 2ZSVA 2YA0A 4L8SB 1U8NB 4BH8A 1KIPA 1UWXH 2Q20A 3RFZC 1NGWB 4ZFOA 4OJYA 1SYTA 5GS0D 2ZG2A 5K9KA 3ZL4H 1HJUA 5ABGA 3DI2B 1R3KB 5AWNL 4DFHA 4TYUA 3KXFA 1D6EB 4QF1A 3NSNA 1CU4H 2F5BH 1NBZB 2FEDC 5BO1H 2DPEA 1IFHH 5T1KA 1MJ7H 5FF6B 2BRRL 2BFVL 2YN5A 4BKLA 5TQ2L 1A9EA 1E4IA 4C54A 2IAND 4YGVA 4LCUB 3ALFA 4MA1C 1UYQA 2FX8H 3PTKA 2BSTB 2IMMA 3HPLB 2E9WA 1DUYB 4MB1A 4YAQB 4QHNB 3GJFK 3MLYH 2CRYA 3NCBB 2JCCB 1MQKL 4U1MA 1PG7X 4P2OD 3MJ6A 1TPXB 3VXTA 3MA9H 4X5XB 3AAZB 3BSGA 3O4LB 1JPTL 2A0LC 2CYGA 1KACB 2RCSH 5DD6B 1U3HA 3MV7B 4F15B 1NDGB 5A6BA 2VQUA 1ORQA 1I3RA 1WJ3A 5A94A 5A8MA 3REVA 5IG7B 5BRPA 2J8FA 3C5SB 2AK4B 4Y4KD 4KUCD 1FHDA 1KBGH 4MXQC 2VOTA 4U2YA 1WAAE 1IM9A 4OLWH 5JW4M 5DHVA 3H9ZA 2VUYA 4PGBA 4QXWA 3N85H 3A6BL 1EFXB 1IEBA 2FDMA 3MMWA 3WLWD 1MLBB 1YEDB 3DVNA 3L3KB 4OV5A 1RZGA 1GHFL 2G3IA 2G3NA 5IP4A 1VACA 2G5RA 4KQ3L 3BHBA 4UBDC 3AHVA 4PD4K 1MHEB 5J6HA 1W91A 3ZKXC 2YC1B 4Y2OA 5D8JL 1L7IL 2CRIA 1R5IB 4URTB 2ESCA 3CXHJ 1BQHG 3IRPX 1BD2D 3QA3B 1FVEB 4Z7UE 2WVUA 3TBYA 4O02H 5E8DL 3OLDA 4WKAA 4D0CB 4I1NB 4KHTH 4M03A 5DHYA 2JB6B 1M1SA 3BGAA 3GMOA 2MMXA 4PMXA 4PYSA 4JLRB 3VFGH 1KIQB 3KR3H 2VAJA 1J0HA 1ODAA 4NQDE 3LV3B 4BM7A 1UD3A 1ZSDB 3QUKB 5DMGC 4NNXB 1HHGA 5BJTB 3SKJL 5DK0B 2ZNWA 4Q9BA 5IV2A 5CLTA 2AOSA 2ZPKH 1FOBA 1Z3GL 1KB9K 3G5XB 1QUNA 1RIVH 3RILA 3DVGA 3X3GL 5IB5A 5EU4A 2J62A 2ID5A 3V8OA 3UTTB 5CWSB 1IC7H 3PZUA 4O2CA 1LD9B 1WNOA 4BZYA 2BOCA 4G5ZH 2DT0A 1S7VA 3FRUB 2DSKA 1ZHLA 3PTMA 1AGBB 2NY1B 3DLQR 4HIJA 1QSFB 1Q72H 2FEEI 3ZYIA 4BF7A 4RCAA 2J7CA 4C56A 1F3RB 1S7RB 1IC4L 3FOLA 5IJKA 2CXGA 3UG4A 1DWJM 4FQQB 3MNVB 1RUAL 2Y5TB 2EDEA 3MNZA 4DTGH 1FLRL 3HAEB 3MBED 3VU2A 2G5BA 4RZCA 4OT1L 1I8MB 3FQNB 5SWSB 1U91A 4JFZL 5I8KH 2W5FA 4F9LC 2Z31C 3W27A 4PGDA 5DJCB 1I9IL 1CF8L 4PJ8A 1DWIM 2CJUH 4LLVB 3NCJH 1T0MB 5A2LH 5JW5B 2APTA 1D5ZA 1JWUB 1P6WA 4XTRC 2ATKA 1CXIA 3BT2L 1F6FB 1KCKA 1IAIH 3BW9B 2H8PA 2X7LA 2MQCA 3FB5B 4YXKL 4UQ9A 5HPOA 1UWRA 3UTZB 3BZ4A 4X7TB 4TX6A 4ATLA 1OAYH 1QLFB 5I1EH 2GYSA 1CIUA 1S3KL 4U05A 5DUPL 4HWZB 1YYLH 4GKSB 3HE6D 1F6AA 1KN4H 4NZRH 4IUGA 3I2CH 1LO5B 4IBLT 4F3FB 2YD4A 1LL6A 4WI2A 4PRHA 4WNQB 5HVFB 1FORL 1NGZA 2PYEB 1P84J 4DGVL 2W4XA 1W72A 2HT2D 2VL5B 1G5AA 4KKCD 4ISVA 3DETD 4NRZA 3CZ8A 3EOYG 5C8BB 5HGAA 5I8EA 1SEQH 4O4YL 3IDYC 1XGUB 3TWCL 1MY5A 3QPXH 3VW3L 3GGWB 1KTKE 4EN3B 1JDAA 3RDKA 3TTYA 3C8KA 3HZVB 3T0WA 2ZCHL 2DQIL 4XUYA 3PQYB 5AEAA 1MQQA 2WW8A 3OAYK 2HT4D 3TH2T 5LKNA 25C8H 2XKUA 2W59A 4P9ML 4F37F 3HMXA 1A4JA 2F2HA 4JKPL 4GAGL 3KAAA 1JGUH 3WIHL 1HJQA 3BE1H 4QTHA 4HA1A 1YQVL 5HHNB 1J11A 1S78D 3M1BB 4XBEL 3BQUC 4D6CA 2GSGB 1LDSA 1EUTA 5HPCA 2NYYC 2ICEA 3QDGE 2A9NH 1ZS8A 3G9AB 3SCSA 3KLHC 3CSGA 4MB4A 5C0ND 2CIIA 3L4WA 4QOKE 4LFHD 1ZT1B 4DW2L 4OQTA 4LSVH 4WHYG 2VLKD 4N90D 3WIFA 3F5WA 3B9KB 4LRIA 5LBSL 5LXGL 4MNLA 3GIZL 3HU7A 1F4WL 2HRLA 3ARFC 1HKLH 3D0VB 1J0JA 4L4TB 4JQXA 1K6AA 1Q1JH 4XP5L 5D2LE 3CXHK 4FXKA 5KVEH 3K0WA 1UFUA 4ZFMA 2G75B 5CBEB 4B7IA 3EBAA 1XR9A 3QI9D 4ZPTA 4ZO7A 3HMWL 4PRIE 2NW3A 4NGHL 4H8VA 2J7BA 4M4RA 2R29L 5I15L 5TFSL 4MJ5A 4XAWH 3ARSA 3GHEH 4GRMB 3RL2B 4Y8AA 1QRKA 5JBFA 1IGTB 2XQYG 4R7DB 4LEXL 4F7CB 3KYNB 5GS1A 2GT9B 5I6XB 1IAKA 1YUHA 4CU7A 2QSQA 2J7FA 4ZAKB 2NY6D 3FRPG 2F54D 3QO1B 3VXUE 5DJ0B 5E08L 3QIBA 4NO2B 1ZA6A 3AMCA 3VM7A 5CS7A 4GG6E 3VJ6B 3QGVA 2ADJA 2XFXB 3OR6B 2OP4L 5GGVL 3QPQC 4DM2A 3CJJA 1TVHA 2Y6SC 5E0CA 4AW7A 4KGLA 3DX6A 3SCNA 3GNMH 4S3JA 4M81A 3D69B 1HKMA 2VZOA 1ONQA 4L9LB 4EVNA 4PRBB 5E24E 1DLFL 3D3VA 3BXNA 2XA8L 1R5WB 1QSVA 3BVNB 2UWEB 4OZHB 5GGVY 5EU7C 2AXGB 4YQXH 1H3XA 1U3YA 3HNVL 3THMH 1T0NA 1U3HC 3T77A 4RAUA 3HE7D 1GVIA 3O4OB 5ENWA 5LWYH 1GHSA 5EUKA 3BAIA 1A6PA 1C08B 1TETH 3O81A 3PE9A 4AD2A 4QRPA 4MB5A 3LPWA 4F9PA 4X4MA 3EOTL 2GKIA 4LCCA 5INCB 3RPIB 2A83A 1LG2A 3THCA 3FQTA 2PN5A 3QCVH 4M61A 4PBGA 4PSRA 4Q6IA 2ZCKL 2WC3A 4JDTH 3H9SA 1KN2L 2Q3AA 1MWAB 1NANI 2H6PB 1A6WH 2B1HL 1K8DB 4QWWD 4TRPH 4AY1A 4MXWH 4YBQC 2P45B 1Q6CA 2NY2B 4G8GE 3FTGA 4A2LA 1CTOA 1T1YB 2A3CA 5ESQA 1F90L 4JVUA 4HKZA 1KB5H 3DUSB 4ALAH 3BEWB 1ITCA 4KRPC 2ZX5A 1AGFB 4JAMA 2EH7H 4J2XA 3GJFA 4UOJA 1T1ZA 3BP5B 4EI5D 3MO4A 1Q0YL 2V3EA 1ZE3C 2NXYC 5EWIH 5C0BA 1V02E 2VE6A 1MUJA 3R06A 4PMDA 3MA7A 5CG0A 3QHZH 4Z0BH 4XMKH 3HJEA 1CXLA 3BKML 4P46D 3RM8A 5MEPA 2NLJA 3V95A 4LXFA 1P84K 4JFHD 2FJHB 5F71A 2DIAA 4H26A 1R0AL 4UQDA 2UZYB 1BREA 3T8XB 4P2YA 3REWB 2Q8XA 3T0EA 1ND0A 4O51B 4G9FA 2DAVA 4ONHB 4B7LA 5CGYD 4GBXD 4C7DA 3SPVA 1W9PA 2DSWA 2ZUMA 1TTGA 3ARBA 1EUUA 3MV9D 5TDNA 4JFVA 3WQ5A 4UQ3B 4AZGA 2AJUH 3QIUD 1HH6A 3SQBA 4OD2A 5HVHB 1BZQK 1CEOA 2WMJA 4PJ9B 3DO7B 5CP3H 1E0WA 2DQTH 2GSIB 1JPGA 1TTFA 5IB4B 1OF2B 1UM6H 5DRZB 5K9QI 2CIPA 4BK4A 1DQLL 4JRXE 2BZDA 4FN0A 1YC8A 4LDEB 2FATL 4PGZA 4ENED 2WZIA 2A9ML 4RGOL 1C5BL 5ICXA 1E6RA 4OLVH 5DS8B 4YHKH 1WUNT 4JRYD 1X4ZA 4O9HH 4WENB 8A3HA 5LYRA 4BQ9A 2FECL 4LQFL 1G0XA 1BFSA 1TCMA 1WFNA 3GSNH 4HK3N 1BF8A 4Y4HA 4LSUL 3LQZA 2VABA 5IJKC 4J4PA 2NY3C 1AQKH 2I07B 1QFOA 4NJ9H 2PWGA 1OAQL 2VI0A 2YJQA 3NAAH 1N59A 4Q9QL 1ACYH 3P4OB 3I6LD 4L5FL 3I3EA 4XX1G 1RUPH 1GUVA 4IM4A 2WUBL 4PREB 1BFVL 4PJ8C 1OQXA 1INEL 4PJIB 3WHXA 3VXMB 9CGTA 1LP9F 2C26A 1I8LA 5H35A 3VFSA 3ARGA 4CVUA 4MA7H 4ZEPA 5D96B 5I1KH 1E6JH 5L6YH 2DL2A 5A43C 4Y5XB 2D1ZA 4NPYA 5A6SA 1OWWA 4NWTL 4NQCA 2DKMA 3QAZC 1UZ6F 3D85A 2ZUSA 1H0GA 1GC1H 4PJDB 4KROB 4HK0A 3WQVA 4UZUA 1MFCH 1URLA 1X5ZA 3MJ7A 5BS0D 3DMMB 2EDFA 4YHZH 2AXFB 4Y1AE 3ZOAA 4Z7QF 2Q7YA 3RWIA 4JG1L 4PG9B 2CITA 3NFPA 2IWGA 3TGXA 1YNKH 3AFLA 3MR9A 4M7LT 5KS9F 1H3VA 4G8IA 3DJ9A 3TNMB 3LRSB 2YPLD 3NACH 4D6FA 4DWSB 3QG7L 1R3HB 1AIWA 1YN6B 4JFPA 1UJ3A 4K07A 2E7LA 3HC3H 4V1DB 1OTSC 1LP9A 5JHLL 4NNPL 4KI5F 3CCHA 3DUHA 5HGGS 4PJGF 2OTWA 4XBGB 1I1YB 2AJYH 4AEIL 4HPHA 3ARQA 3PXJA 2ZOXA 1A3RL 4UMGA 2A6KA 1EO8H 3NVQA 3WD2A 1K3IA 2GIYA 3ES6B 5BV7L 1WBZB 2JK5B 4S2SB 1IL1B 5CIPA 3V2AR 2NY5C 2IFFH 5J1SC 1QPPA 1G84A 2FBJH 2ILLA 3AQUA 2D22A 3QUYD 1KPUB 2F74B 3SO3C 2IAMB 1S7TA 1UCBH 2VDOH 4LRIC 4PEEA 3FW6A 1U8HB 3MC0A 4HS8L 1EFQA 3N1GC 4NC1E 4Z7WB 2WP3T 2X4TA 4HDIA 3QUXD 4MVBC 4JQXC 2ZUTA 3FO2A 4Z7OF 5HHVH 1UQYA 5KS9A 1I3UA 1G7MB 4BZ2L 3L2LA 4P2QA 5DT1L 1UA6H 4PJXB 3BP7A 5E09A 1T7WA 3ZSSA 2ZXQA 4MQ7A 3X14A 5AZ2H 1GNXA 1QFUH 2QMJA 3MRMA 1JAEA 4PJFE 1VFBB 2VC2L 2ESVE 4X6CE 3QXDA 1DFBH 1D5XA 5T3XL 3T0BA 4XXDB 3V5DA 2CSPA 4PJGA 5FIEA 3F7VA 4NSKA 3VIPA 4KJYA 5GS1C 2KDGA 5EZIL 2DQHL 3SDAB 3QULB 3AREB 1OGGA 4OD1L 1OGAD 3QIBC 5CEXB 4CADA 3C5ZA 5M95B 1W2VA 1J8HE 1E3XA 4MJIE 4GJTB 3KL0A 2TAAA 4APQC 2RAMA 1LO3H 1HL8A 1S7UA 3WD4A 5EZJA 4OI8A 4C7GA 1NMCC 4OGXL 1RZJC 4RMQA 4LNVA 1KJMA 3V8CA 4JJHA 3VE0A 4K2UH 2VLRE 5IKCB 1N0XH 3B43A 2DT2A 2A73B 4U6VH 3QEQE 3QB7C 4D1IA 3SDYL 2KBGA 5DRXA 3CLFH 3CSYA 5F9OH 1NCDH 3QQ3B 4NN5C 2PXYD 5HYSA 4HKBA 3GI8L 4P9HL 2HTLC 3BMWA 2EZ0D 4AIEA 2P8LA 2FD6H 3V0WH 1BIIA 3E8UL 3GJEA 1V6WA 4LCCC 2BVQA 5GIRB 1YPZE 4MAYB 2NZ9C 4Q6IC 3VMOA 1IT9L 4OF7A 4UDUB 5CD5D 4FTVD 3D39A 3LQAC 3EYSL 2WCGA 3CH9A 5KZ6A 5J3HD 1HHIA 4MS8C 1X6NA 3QDJA 5I1AA 5D1QD 4PJ5B 1UKQA 4IIQA 3OAZH 1UR4A 2VVSA 3INUH 4WJ5A 2D20A 3BIKB 5IVOA 4AY0A 4PJHE 3TA9A 4EXPX 1FL5A 2JJTA 3LRHA 3N9KA 5D7LB 3O3EA 2HA1A 5AY7A 4XWGL 4Z7UF 2EDTA 1FFPA 5FL0A 4JY4B 1G7JB 4RNRB 3L5WB 1X5KA 5FYKH 2OZ4A 4P7LA 3VH8G 4MNHB 3QSKB 3P4LA 4AISA 2PCPB 4J3WA 4M5YH 5JHDD 1GOHA 2VUOA 3T0EC 2FLRT 1MAML 5ITBL 1ZBKA 1VFMA 1XIWA 1EEZA 4KK6D 4MYWB 2J12B 3RWJA 4Y19E 5FK9A 3ARBC 4UQ2B 2VX6A 4YDKH 1V7NH 3TJHD 5L8LB 3ULVL 4IRZH 3LOWA 3MUGB 4JDVB 5DHXB 4LRNH 1J9YA 1Y18B 4JGMA 1UHVA 1SBSL 1DUZB 2LABA 3CU1A 5I1LB 4XC3H 3VFOB 3SUTA 1MREH 4AM0A 4OI9A 3RPMA 2VIRA 2WHMA 3SE9L 4YPGA 4OCWL 4UT7H 2R8SH 1I1FB 2QQLH 2GTWB 1FBIH 3KPPB 3IDJB 1ZGLP 2V7HB 5GJSL 1OIFA 2AJSH 1B4JL 1F8TH 4UZSA 1YDPA 1ADQL 1KTLB 5DJ8B 1OLZA 1QA9A 3DV4B 1VJSA 3F5LA 3KHQA 4DKDC 5D7KE 4WUUA 3L7FB 4Z7UA 3ALGA 3QEUB 4RISH 4K94C 1FRGH 4DJMA 1UH3A 3LPOA 1KLGB 3DGGB 1QTYT 4Y4HC 4JG0H 3KPRE 3IXTA 4J4PC 3TBVA 5INDB 3HLAA 1WAWA 5DJZA 2HJLB 4NHCH 5IIEB 3LN5A 4OJFL 1W3LA 1WIPA 3T1FB 4MDJA 5I73B 1CLXA 4ACZA 3WUGA 1GGIH 1VADA 3AZTA 3GMRA 4ZS6C 1TZHA 4YR6A 4RAVA 1JUFB 2R4SH 4N5UA 1O7VA 4KRLB 4X4YB 5ERWA 3VFNA 4PJ7E 3P73B 3ARGC 5GGUA 4GPNA 1G7LB 2W61A 4Y4FA 5K9OB 2VX5A 2NX5B 4QRUA 4FQJL 2YRLA 1CXKA 4J1UB 4NQEE 2Q76A 5BCAA 4JO3H 1INQA 1XFPA 1CCZA 5IMOA 4RFNB 2F8OA 1MRDH 4JO2H 1RZ8B 1BOYA 1SJEA 3TVMB 3ZDXF 3RGVA 4BFIB 4W8BA 3WD5L 2ZOKA 4M80A 2XWEA 3LKOA 5MENE 1Y6KR 3NBNA 2HVJA 4NQSA 2WBJB 1IQDB 4HZLA 3P11H 1YEGL 5BRZB 3IETB 3ISWA 2JJSA 3GK8H 4NZJA 3M17B 5FA3B 3FL7A 5JOFA 1PLGL 1A21A 4HBCH 1EHLH 3C8DA 4G8EA 3ZO9A 4QHMB 4Y2DC 3RUGE 3FN0L 1FZMB 4IOFC 1VESA 3HC4H 4P3DB 3VNZA 1IM3A 4M82A 1A5FH 1C5DA 4X7FC 5E5UB 1NC4D 3AISA 2BVPA 1TVBA 2XTLA 4GRLD 4PRPA 5ILTL 5IR1B 2ENSA 1R3IH 2F58H 1UJ3C 3AXXA 1RULL 2E7LC 3WFEH 2WVSA 3WLBB 3II1A 5IHLB 5I17A 4EKXA 1NWTA 2AQ2A 1R7AA 1S5HA 3HI5H 5KSUB 3TN0A 4D9QD 4KJWC 3IJSA 4BH7A 1I7TA 4AEHL 1H8NA 2YLLA 2D0FA 1X5LA 2NY5H 4WV1B 5E5MB 4EBQH 5CSUA 1XGZA 4OQTH 5GJTL 3ZYZA 3OR7B 5GRWA 4KTDH 2R69H 5KSBE 1C8PA 1A14H 2HH0L 4JPVH 2ARJQ 5J6GB 4ONOA 1GONA 1RH9A 2J7GA 3VOCA 1MIEL 3ABZA 1FQ9C 4GFTB 4M6NH 5ICZA 4WU7A 1DDHA 4D8PB 4R9HA 3MV8E 5D2LF 4JE4B 1WDQA 4ZXLA 3JV6B 5ID1A 4X9BA 1BQLL 4R2GD 1RAMA 5FB8B 4HUUB 1T66C 5I78A 1JNLL 4RFEB 5F93C 5F88A 5I1CH 1VFFA 3OJMB 5HYJE 2A3EA 2Q86B 1NMBL 4Y5VA 3LAFA 2YA2A 3WFHB 1F45A 4IS6B 3SKNB 1GIGL 2BC4A 1XEDA 5KVFH 3UTPD 3KZSA 5GS2H 1F2QA 4BS0A 2EDKA 4K7FA 4FNLL 1P4IH 5ANME 2WMFA 4UNUA 3TTSA 3R8QA 2AXHA 5FD0A 2DQEH 4FQPA 3NOIA 3MV01 3BSZL 4KI5C 4LVEA 4W4NA 5K93A 2BOBB 3L6FB 2FJFB 4PSPA 3D0LB 4M6OH 5TE6H 1AJ7H 4ETQA 3UMTA 4ZTOL 1MCPH 1QFPA 2ATPA 5E99H 5EZOH 5A3HA 2LAAA 3F58H 2UUDK 3C5ZC 4GZJA 2B7DT 4WFFE 1V3LA 5DRWA 1T2QH 3Q1SL 3VXSA 6CGTA 1CE6A 1RZJH 4F57H 4U7SA 2QPSA 4EDWL 4M1CD 3PZGA 1S7XA 2XZQL 4AH2A 1V7MH 4U1HA 1IGYB 1U8PA 1FO0B 3RDTD 1LDPL 5D2LA 5CJ8A 1P7KB 4W5UA 1EHNA 3HS0B 5D71H 5TQ0H 4JFQA 4XX1E 4ZNEA 5CUSL 1I1AB 4NO3A 3AMLA 3FZUC 4UILH 5AD0A 1CDHA 2AJ3B 4JO1H 3BAYA 4PRIA 5EO9B 3N13A 1DLHB 2Z35A 1WITA 2GY5A 1T21B 5C09B 5L8JB 1I1RA 1D9KB 4W81A 3O2DH 1OM3L 4DKEL 4WY7L 3QXTA 2AW2A 1UQZA 1YNLH 5L88L 1HKFA 3QDHA 3W37A 3CPLA 1DANU 2XTJB 1ZLUK 2ED8A 5DFTA 3ILPA 3VXUA 1M04A 2OQJB 4MD0A 5M7QA 5DA0B 5A8QA 3CFIC 2D31B 2YRPA 5FYLH 1GVYA 1IGJB 2VLJA 2KL6A 1F4AA 3U30B 1JXJA 2E8YA 3ZKSD 3UJIL 2F8QA 3QO0B 2DLIA 2LFGA 3RZCB 3W39A 5JDSB 2ZG1A 4WWKB 1A7NL 4CVXA 3GJFH 2BVOB 2Z31D 1KCUL 4M5ZL 1RZKC 3MZGB 4IIQC 4NJAH 4UFHA 4HXAH 2YA1A 5E6IB 4PJBE 1GOQA 2AJXH 3ZT6A 1XC6A 1SMAA 3NH7L 1I7ZA 4JM2D 4AIZA 3GSXA 5IXEA 2HG5B 1Q38A 4MX7A 3T2QA 4ZYKB 2JJTC 2W1NA 3IJ7A 2WIIB 3MRFA 2M8XA 1Q9WA 5EFIB 5IVNA 4GRWE 5E8OA 1DBKH 3VRIB 3V4UH 3AIEA 1NAMA 4TSAL 4PJEE 3STLB 4NM8H 3IFPB 5CAYB 4CKQA 5HI4D 2E4TA 5IESH 5I2UA 2OLHA 2H2PC 2R1WA 3JWOL 4YNYA 4X0KA 3VKKA 4XVJL 3BP6A 4WW2F 4U1LB 4YWGH 3L5IA 3MACL 4F7EA 2DLFH 2X41A 1XIWC 2FYYA 1S9KC 3A67H 1XF5A 1W0WB 4A3YA 1WWWX 4G43A 3SGDI 2H32H 1FZOB 5B39B 4G8GA 4M43H 1A6VH 4TVUA 5D9SB 2IH3B 4F58H 1T4KB 5C2BL 5JZ7D 5GGSY 2G4FA 2J77A 2VDNL 1G9NH 3ALXA 5EH1A 5DJAB 1QSEE 3DXAD 1WC7A 3VRJA 2JIEA 1MF2H 1Q9OB 4LLQB 3RWDA 3UEZA 4E41A 2G3JA 1V02A 3BAEL 4S1DC 1YEEH 1PGRB 1HQRB 1IGFH 2Q8AL 5C0JA 1LEKA 2D49A 1GPOL 4HC1L 3ULUD 2Y23A 3CXDL 3VXRB 5FHAH 3O8XB 2JB5H 3VWJA 2AV7B 1LEIA 5C3LD 3WFDL 3JWDH 4GKNA 5MEOA 1MWAL 5FGBC 1OCWH 3MRCA 1RK0B 3QUMH 2E6QA 1G6RH 2EH8L 1CT8B 5IMMA 5A6MA 2IADB 35C8H 1MHCA 1G94A 2GCYB 3QJHB 4CCCA 2ADFL 2BSED 2XQYK 1HHKB 4V2BA 1DSFH 4HGKC 4HUVB 5E4EC 4WW2A 1JNJA 5JIIA 3L4TA 4N8CL 2XN9A 1MHHA 3DRQB 1WWAX 3U9UB 3SUWA 3BPOB 4X7EC 4HFUL 1VCAA 1MW1A 3QQ4A 3LB6D 4XCYA 1UKPA 2H9GA 2MKWA 1BD2E 2DYPB 5BW7A 2UYLA 1L8NA 1XCTA 5D6CA 3CDCA 2XRAH 1S7QB 2GFBA 3FO9A 1J05B 1UXWB 3PNWB 3OKKB 4Y4FC 2NY4B 1FH9A 3B9DA 5IHSA 1BOGA 4R90L 4NRSA 2QMKA 3DSFH 3TJEL 2ORBH 3NZHH 1U8OB 3I6GB 1QPXA 3NSMA 1YEHL 5ETUA 3RGVC 3E3QC 3U7WL 1EGJL 1KUMA 1GAFL 3OB8A 3GMNA 2HJFB 3NABL 2IF7A 4QRRE 3MCLL 5EORH 2H1PL 1OCQA 4KPHL 5IT2H 3AHYA 1MCWM 2W67A 3CTTA 2JJSC 3PDGA 4MD5B 2PWHA 4B15A 4NZCA 3SCPA 2PW1B 4XPBH 4QXUL 4X4XB 3I02A 3O3AB 1U9KA 4MDIB 1F3JA 4R0LB 1W3HA 4OCYH 4W84A 5DO2D 3K4AA 4GW4B 3A47A 2DQUL 3DWTA 1VF8A 5HSFA 1OP9A 4LSPL 1BVKB 5E6ZA 5HHMD 3ETBF 2CXKA 1UWIA 4PJCB 1PSKL 2YDQA 4L8DB 4OZFB 3KYOA 1BBJB 3LS4L 3MROB 4A2MA 4DN3H 2IBGA 3HG1D 4PG2A 4PRAB 3DURA 4V2CB 4X99A 4AL8L 3TN0C 2XICA 3AXLB 1UB5A 5CILH 1SYSB 2VX7A 1CXFA 2OWCA 1QOXA 1V0MA 4NZTL 1SY6H 1A0QL 4ZSOB 1WFOA 1KLFA 2EIEA 4ONGL 3OHXA 4KDWA 2Y07H 5DMYA 1EJOL 5DQJA 3U5YA 2R0ZH 3PL6B 3WL1A 5GGQH 2FIKB 4WO4D 3H3KA 1EVTC 4ZXBB 5H37G 1VGKB 5EO0B 5ABFA 2XFRA 1X5HA 2KUTA 5EBWB 3VFVB 5FO9B 3P9MA 1R5VA 3W9DB 3SQOH 4C83B 1FNEB 2CDGB 3CUIA 3UJJL 3CUHA 1U8LB 4TPRL 1EX0A 3VG9C 2IQ9H 3OAYH 4Z18A 5DSCB 5C0FA 2D4DA 2VISB 2DH2A 5I1JH 3U0PA 5DR5L 1IT0A 1FNSH 5FO8A 4HS6A 1E27A 1MNUH 3K2UH 4Y5VC 3ZSTA 5C0RL 3QFDA 4PJFF 4FQXA 3QP3A 2DKUA 4F7MA 4X6CF 1OWRM 3MFFA 4JANA 2P7TB 4G80B 3TFKC 2NXYD 1X5FA 3HC0A 4M62H 4B0MM 4MNMA 4IHOA 4P5TB 2ZXAA 2WUCH 5SWZE 3QFJB 2C5DC 3SE3A 3QCUH 4LMQE 4YLQT 3T04D 3MLXL 4NCDA 5IEKB 3OKDA 3A6CL 4L4PA 2EO1A 3DIFA 1TNMA 5FYKD 2FRGP 1QI0A 3O6AA 2IXUA 3K8MA 3U2SA 1A7RH 4LVOB 3O9NA 3VG0H 4FP8H 4L1HA 2PW2A 5SX5K 4XH2B 2QL1A 3VDAA 3PP4L 1DVFB 1TQCC 5D93C 5GRVK 1OTTC 2DIJA 3T3PE 2VR4A 4MAUL 3DI3B 2PR4H 4ZUWB 5FM8A 4YHOL 1TENA 4JPKH 3TO2A 4BA8A 3G6JB 4WU5A 5MHSD 5IMKA 4HX1B 3MJGX 1JZ6A 5I5RA 5FCUL 3BRGC 5A2CA 3TTQA 4G7VH 1JAKA 1JN6B 1O5DT 2X05A 2UY3A 4H0HB 4Q0XL 4UT9H 3C08L 4UFLA 2N4IA 5J1AB 3C87A 2X09A 4PJFA 1KCRH 2QSVA 2AK1H 2ESVA 3CGTA 4X6CA 3UBXB 1MLCB 1YPZF 3HAEG 3RNKA 5CJQH 5JXAH 1NGQH 2W60A 4JHAH 4KGJA 1NBVH 3QEHA 1VGEH 5KSAB 1PYWA 1BX2A 1TZGH 3IXAB 1ZTXH 2XQBL 4DOHB 4GH7B 1J8HA 3GEWB 4OSUL 5ID0A 4GW1B 3CFBA 1RZKH 3VIGA 4MJIA 4X5WB 2P8PA 2DSZA 2VITA 1RIUL 1ZXQA 4OCSH 5KOVC 1YJDC 4YHMH 5GHWH 5DTFA 4WFHE 5K9JH 2EDWA 4QHLB 3QNYA 1HINL 1PJ9A 2QPUA 2V2XB 3RY6A 3PBGA 1GOWA 3VGAC 1EZVY 3HRPA 2DMBA 4N8PA 5KSVB 1RUQL 3LVEA 1AKJB 2VDPL 4XRCA 3TZVB 4HD9A 2KH2B 5BMFH 2VLRA 2OZ4H 3ZKNC 6FABL 1IKFL 5E7BA 1MVUA 1YN7B 2B1AL 2OS7A 3V6ZA 5JW4N 4N5EC 2DDQH 4WCYH 2DN7A 1NCWL 1ZGLA 2R2CA 3T1WA 4OD3H 4PTTB 1AR1C 1UM5H 4BQ8A 1IGCH 4P8UA 1I7RB 3WL9A 4Q6YA 4TVDA 3V52L 2DBLH 2HISA 1HILB 1YPZA 2I26N 1EQPA 4LP5A 2B2XH 1DQJA 2BVYA 4PB0H 3MJ9A 3TESA 2B8OT 1SFSA 2GJJA 2O5XH 3H42L 3HHRB 4HSQA 4U5KA 4KH2A 3ZJ7A 1A4KA 2P5EE 5A2KH 3FHQA 4ETYA 1U93B 2HWZL 3ROOA 3GRWL 2Q6WB 4GAYB 1G7IB 3H9HB 1MI5A 1QLRA 2NY0C 1GGCH 1KJ2A 1C16B 4S10A 4HWBL 4OZIE 1F3DH 4EUPB 4U1IA 3MGAA 4F7TB 1VKXA 4E42A 2WQ8A 1YY9D 5IROA 1ZBWA 2AI0L 4MA1B 1J9CT 2GVYA 3BH9A 3HR6A 4I2XE 4DKFL 5BXFA 2NSXA 4A4AA 3SHSA 4KMTH 3CH8A 4Z7VB 5HYIA 1XCQA 1ODZA 4IPLA 3HB3D 3MOAH 2DM2A 3IT8D 1E3ZA 1NC2B 1RUML 4KVCL 4ZOBA 5I24A 2D7TH 5FFLA 3MNWB 3AIQA 3EHBD 3QISA 3CFKB 4XNUH 3C8HA 2QQNH 1PQZB 4FFVC 3S98A 3M45A 3T4YB 3G5YA 1H15A 4RWYH 5L9DH 4Y19A 2ZX6A 2O9OA 4D9RD 1H9VA 5HBFA 4QXTA 1CWVA 4W7VA 4KZDL 4U1JA 3FFCD 2HN7B 2IQAA 4L3EE 4WW2C 3TO4D 1JWMA 3ELAT 2GUOA 3WDHA 2OK0L 4JAWA 3CC5A 1HYSC 1AGDB 4PJ7F 4LIQL 5ELIA 3ROLA 4X98B 3BGFC 2XVPA 4PMYA 4LSRL 3B3IA 4LHUD 5BW7C 1ZT4B 4CVZB 3RWFA 2YPKA 3C60D 4TUKH 15C8H 5KG9B 4HUWB 1AHWA 1BFOA 2FLBT 3T65A 4XPGH 2D24A 5D7JD 3QWOB 3TIEB 3MV9E 1PKOA 1NMAL 3FQXB 2IPTL 5GRZA 4M1DH 2ED9A 3QXUA 3GSVB 2R0LH 1IGIL 3BIBX 1UT9A 3R1GL 5LA2A 3EFDH 4GXVL 4HMCA 2HAZA 3PG2A 3ZKXB 2YBRA 5GS2D 1WDSA 5IGXH 2ZXDA 2E9MA 1BEYL 4ZUSB 1FFQA 5B38A 1JPST 3KPRA 4FFYL 4P4KA 3PV6B 5HD8D 5CD3A 1M7DB 4FXGA 3TYGH 1UADC 2X9XA 3QIBD 5JMOC 2V3GA 4NSBA 3IS1X 1QG3A 1KQZA 4HMEA 1LO4H 1WVZA 5E56A 1OB1A 4EQ2A 3PHOA 1F4YH 4AZCA 5CZVH 3BH4A 2GJZA 4MZ3A 3WXVL 4MAZA 4GW5B 2VO5A 3UG3A 1N6QH 3DV6B 2MNUA 1XF2A 1K9DA 1RPKA 4PJ7A 5EU5A 3RIFK 4IOIB 1TJIL 1TNNA 4QT5A 1AXSA 4U6YA 1TTUA 3IDMB 4L8CB 3U4BH 4NO5A 3H7BB 5LGJA 2XWJA 5DDHA 4LDOB 1GOFA 4NQEA 4FFWC 3VXQA 3WDQA 3FB8A 1HN1A 4LCWB 4PG2C 3L2MA 1FYTD 1ZK9A 2SEBB 4LLWB 5E8NA 3B6SB 5HJ3A 5EU6D 2A74A 5DD5H 2VVNA 1QFWI 4ZFZB 4HIIB 3CZEA 3I6LE 4AK1A 3W9EB 5T1DL 3MUZ1 3TCLB 1QNRA 3VD5A 4GO8A 2H3NB 4HZAA 4I3SH 4K9EH 1QBAA 2X1XR 4ZQKA 4LYQA 4QRPD 1EAPB 2X1QA 3TCXA 3QBTB 5T3XE 1JV5A 4AG4L 3QDMA 4LAQL 1AO7B 4G6FB 3N17A 2GJPA 1DBJH 1Q94A 3K80A 3TBWB 4UNTA 4IRJA 5D1ZA 5HHOB 1G7QB 3N1FC 3RU8H 3EDDA 3ZZ1A 4X7DC 5F3BA 1EEUA 2V38A 5CZKA 5E6YA 1AE6H 3OZ9H 1JVKA 2BXYA 4HIXL 5F6IC 2FBOJ 3WHE1 2VZSA 1W0VA 3CVHA 3RCNA 4ODHL 1MSPA 4FQXC 4LKCA 2V2TB 4D6DA 3CD4A 3QNZA 4O5LH 1ZT7B 2AEQH 3L5XL 3LEXA 5D1XA 4YDVA 1JHKH 1T5XA 1P1ZA 2R0KL 4K7PH 2WKLA 1JGEA 3O2WL 2VLLA 5DVKA 1GQKA 1CBVH 2V3DA 2X70A 2P8MB 4XVUD 4UB0L 4XPHL 1T20B 5KVGH 3DROA 4UOQA 3CSPA 3BIAX 3RWCB 3SE3C 1TJGH 5HY9B 2C3VA 1UZ8B 4DQOL 4MCZA 3AGVA 3OBAA 2YPLE 4X6DB 4FA8A 5JTWA 2EO7A 4M7ZC 2FHFA 1UWTA 4HHAB 2OLDA 4B9YA 3I6KA 5DJ2B 3OAUL 2Z8WC 2P5WB 3LD8C 5FKAB 1J1PH 1AXIB 1J1OH 2ZCLL 4XNMB 3PF2A 1PKQB 2GJXB 3U46A 4D0DB 3MV8A 5DLML 2MANA 1E9LA 1GW1A 4TN9A 1ZHKB 5L2KD 2OCFD 4CCDA 3L3DB 4ODTL 4HPGA 4CD4A 1AP2A 4U1NB 5IOPA 3LMYA 4XP4L 4ACPA 4XAKE 4JREC 2EYSB 4FRWA 1VPOH 4PLOB 3BUYA 3IDYB 4PGCB 3RZCD 1VENA 4PGEB 3T4AB 3IU3A 3TT1L 2AEPH 2N7AA 3QZWB 3IAGC 5JLZB 3F62A 4YHLH 5ANMA 1ZVYA 3MODL 4MTVA 2IPKA 5HDRA 3EYUL 1R87A 4A6YB 3QIWA 2WBWB 2G2RA 3B2UD 1JMZA 4FQ2H 1NSNH 1O7SA 3H0TB 1YEFL 4JFDD 1BGGA 5DI8A 5DRNA 3J7HA 3BQUB 2AEWA 4KHXL 1EVUA 4J6RL 2XKSA 3C9NB 4QXGH 1JPFB 4ZODA 5DVMA 1DBBH 3ULSB 3OQ3B 5GGRB 1RFDL 1W8NA 4PJBF 1WIUA 4ODXB 4R4FL 4FQIH 3NTCL 2W0PA 3WNLA 2IH1A 4MSWA 3RY6C 3T2NH 3ULVE 4QY8A 2BSSB 2EDDA 1AXTL 2JCCE 4ZS6D 4ZPVA 4MZ2A 2GJ6D 1R24B 1NAMH 2FX9H 3KJ4C 3S4SB 1LL4A 4PJEF 3ZKMC 2A6DA 5TJWK 2FGLA 1U58A 3O4LE 2FB4H 3WE6A 5F7WC 3ARFB 3L1OH 3UTSA 1OGAE 1OAUL 3MV7E 4V2XA 3MUJA 4JPIB 1N82A 2W65B 2VNCA 2D7PA 1ESWA 2WINB 4I18A 3P4NA 2N7BA 3B4NA 3RX8A 5ISZD 4NKIH 1KGXA 2AK4E 3WNOA 5JPNB 2AGJL 2W0KA 3W0WB 3HZKB 1D5MA 2V2WB 2ZSVB 3QUZA 1RUKH 3QRGL 4I0PD 3MUIA 3W29A 4OCRH 3DX9A 5C0AD 2PO6D 4QHKJ 4BH8B 4ZD3H 2E9LA 4J28A 5K33A 4M00A 4BA0A 4ZFOB 2CEQA 2XY1A 5EC1A 4M3KB 1FO0L 5DD3L 4CMHC 3S9DB 5K9KB 5FHBH 3F6IA 3NA9L 4Y0GA 1YY8B 2R1XA 3AVEA 1U8IA 3BZEA 5GSVA 4HEME 4OZGF 3DX7A 3KXFB 4QF1B 5DC0A 4G7YL 1UD4A 4H1LH 5HTSA 4KUCF 1EZVX 2QHRL 4PJBA 3T0XA 4LYPA 4HU8A 5T1KB 2HTKC 4FXLA 1H11A 3WDRA 4BKLB 3N12A 1A9EB 3VWKD 4YGVB 1GOMA 5IROC 1DEEA 4HK3J 4KTYA 2VAAA 4ODSH 2C4FU 1FG9C 4Y88A 4PJEA 2PTTA 1T0PB 1EHXA 3EAKA 3V0VA 3RVUD 2A3AA 5MI0C 4D9LH 4U1MB 2IANA 1P9MA 5GGTA 5A3ID 5H94A 1RMFL 3HUJA 3VXTB 3GKWL 4GMTL 5E4IA 3DTXA 2ZWZA 5KVDL 3B9EA 2Q8BL 1ZHBA 7A3HA 4X80H 1U3HB 3FO0L 5DT5A 2P24B 2XKNA 1ORQB 1QNPA 1I3RB 5EC2A 4P2OA 1WPCA 4WEBL 3WDJA 4OM1H 3LZFH 5IBUB 4MMXC 4ZO9A 5IW3A 5D7SH 4HKXB 4F33A 3UYRL 1UKTA 1IM9B 2BNRD 1VDGA 1QNZL 4FMFA 4OZGA 1ZA3A 5DHVB 4H0GA 3WSQL 2WVVA 1QQDA 1S7SA 1S5IH 5JHDE 3F4VA 4Y4KA 3PP3H 1L4IA 1AHWC 4NQVA 1IEBB 4WSKA 4YX2L 3Q5OA 4KRPB 3DVNB 1N7ML 4OV5B 4K71C 1RZGB 3KE0A 1V0NA 1VACB 4RMUA 3T0VA 5L2JA 2PWDA 3OX8B 1QSFE 3BHBB 3LMJL 5GISH 5J6HB 4JVWA 1A3LL 2J4WL 2X4UA 1JRHH 4P4KC 3SJVD 2J78A 1EV2E 1YA5A 3E6HA 1E4XI 2DQGL 1CD8A 3TBYB 4TSCL 4UIKL 1BVNP 3NGBC 4RX4D 5CQ1A 5LQBL 5DHYB 2WZEA 2QLVB 3RAJL 3GMOB 4CW1A 1JNEA 2XTKA 1T03L 3U4EA 1RI8A 4F9DA 4OF5A 1PDKA 1BD2A 2ITDA 4S0SD 4OGZA 3RIFF 1KLUA 1V3HA 3U5UA 1C1EL 4HWEH 4GKZA 3GHBH 2R2EA 3W2DL 1JNNL 4EDXA 2QBWA 1FVCA 2FR4A 3PWPD 1W9UA 5E7FA 1Z5LA 5IV2B 5HNNA 4KKBC 1W1TA 4E5XA 1JWSA 3PWVA 1FVDA 4G6KL 4HEPG 4LCIL 3P9LA 1ZBVA 3ALPA 4HLZH 5EU4B 5IB5B 4XNZC 2D9QB 2I5YL 1ITBB 4K23H 4OB5H 5ECJE 4O2CB 4HCRA 2WK2A 4N0YL 4AENA 3UPRA 2BOCB 5IHBA 5FUOL 1S7VB 3WS3A 3WJJA 4TNVK 1ZHLB 2PYEE 3VX1A 1CZ8L 2UY2A 4TVCA 2YWZA 3DVIA 5DT7A 2R0WH 4M7KH 5DEGA 3Q5TA 3WF2A 3U7YL 3ZT7A 2HKFH 1BIHA 4IRJC 5D1ZC 4KXZI 4C56B 3X3FL 3VUPA 4XC1H 4OLWL 4UOZA 1TDQA 2CBVA 2NY3B 1CLOH 2J8UF 3QHNA 3PQYE 3EMQA 3MNZB 4N1HB 1C5CH 2G5BB 4RZCB 1EDTA 3N85L 4HJ0C 1QHPA 1U91B 4LAJH 2K1MA 3VVGA 4PGDB 1H3PH 4OLUL 5J9PA 4N68A 4PJ8B 3MYJA 4P23C 1R7OA 5D1XC 4JGJA 1I8IA 5SV3A 1D5ZB 3LEYH 4OZ4B 4LGSB 1N5AA 2ATKB 1J12A 1IZKA 1T89A 1FHLA 4OOZA 1KC5L 12E8L 3FT4A 4WI3A 4L9DA 2VXQL 2H8PB 2X7LB 4FQCH 5TDOA 2VJXA 3BZ4B 1E28A 2H2PD 3U6RA 3KPSD 2GTZA 5HVWA 3WH7A 4G6AC 1V03A 2DEPA 4O02L 3MLSH 2R56L 3T3PF 4WDIA 1F6AB 4XP9H 3FKUS 1MJ8H 3JV4B 2Y06L 4GSDH 1B2WH 4L29A 4PRHB 1XGYH 1IGML 1NGZB 2MTPA 1W72B 3QXAA 4RMTA 2CRZA 3QWRD 3HE6A 2N1KA 1RZFH 4NRZB 4OGAC 5F7NC 4R8WH 5J57B 3VMPA 4ORZC 3DGCR 5HGAB 3JWNC 1OSZA 2J8UA 5CJOL 2ZPKL 4ONFH 5FUZL 1NUGA 4ODUA 5BXRA 2Z1KA 2EIBA 3D9AH 3MRIB 4UNVA 2CR6A 4S1DD 2RR3A 4AD3A 1JTPA 1QFHA 2CHOA 3PDOB 1BAFH 1OT1A 4G5ZL 3QIWC 1K8IA 3W11D 4ZTPL 3FHAA 2EYTA 4QTHB 2HT3C 3W26A 5FDWA 3RWEA 1W3KA 1LWRA 3QHOA 4X9FA 1CTNA 1BM3L 1IEHA 4ODVL 3RWGA 5E2TL 1JXKA 3EMZA 1QZ1A 1ZS8B 1LILA 4OIIH 2C1PA 4NQDD 4HPYH 5CXPA 5DA4A 3WF4A 3EZ8A 3UTPE 2CIIB 2DD8H 2RBLA 3U57A 1CE1H 2C7UA 4ML4A 3P4MA 1QRNB 2GI7A 4HUXA 3O6LH 2PTVA 2WHJA 3VI3F 4U1KB 5I8KL 3SO3B 4JY5H 1IC1A 1N64L 3SURA 3LPGA 3F5WB 2Y4SA 1YEJL 4QLJA 1DEDA 1WDPA 3ZM8A 1T3FA 5KANG 2XSBA 3D5OF 4NRYA 3LKRA 2YPVH 5ACLA 4MJ6A 3VX0A 2VLKA 2X4PA 4ATWA 4MNQD 4FXKB 3QOMA 1Z9MA 4I18C 3UYOD 3RWHA 3RTQA 4PP2A 3WXWH 1MW0A 1XR9B 3MJ9H 4QKXB 4U49A 4ZPTB 3EJZC 2IALB 2NW3B 3QUZC 1HXYA 4MJ5B 5I76A 1ZL1A 1TQBB 2O5ZH 3MLUL 4YHGA 2GDVA 4BQ2A 4DVBA 4PBXA 4RDQF 3CVIH 2YD5A 2Q87A 2ZUWA 3O6KH 1B6UA 2DJ4A 4PPTA 5GS1B 2YD9A 3QI9A 4X9YA 4OZIF 1YUHB 3KHOA 3OF6D 2AJVL 3BC9A 1ZA6B 1JI2A 4P3CL 2ADJB 5GS0C 1PZUB 3HNTL 4LSSL 3LN9A 3DX6B 5TF1H 5DGRA 4APQB 3PZVA 2JJVA 2UZIL 5EFDA 1NFDE 3JXAA 1BYCA 4UV7L 2W9DH 3S34L 1UACH 1ONQB 3C5JB 4EVNB 1NMCB 3D3VB 3BXNB 2HLAA 3UTOA 5I23A 5IQ9A 4QRTA 1CD1A 2YD1A 1P9MC 4MA8L 1HP5A 1PG7W 1CIDA 1IBGH 1I9RL 5MP6H 5F7UA 2YR3A 3T77B 3ZLQC 2X89D 4RAUB 5ENWB 1YMMB 4NN5B 4HIHA 3WKMH 2C4XA 4LASL 5EUKB 5I9QC 4P2OC 5BXTA 4JKMA 3KPQA 1MAJA 4WHYH 1HIMH 1A1MB 2NW0A 3BCDA 4YHNA 3PZQA 1PZ2A 4LGPB 4Q6IB 4LSVL 3HE7A 3H9SB 3CLEL 4OZIA 3GO1L 2WLYA 2W0LA 3QOKA 5M17A 1KGWA 4J12A 2JELH 4Y4KC 1H2JA 2DQDL 1KJVA 2M1KA 3AFBA 2XHYA 4JM4H 3QHFL 3IGAA 3B5TA 3FXYA 1BYBA 4RFOL 5C71A 1GJIA 4JAMB 3GJFB 3ZYJA 4QHKI 3U79A 4QRSA 4GT7A 1BZ7A 1N4XH 5C0BB 1T7ZA 4N0RA 1TJHH 3WQ4A 2VE6B 1MUJB 3R06B 3R0MA 3MA7B 3QDGD 4CKVX 2YUWA 1JF5A 1MJUH 3AIUA 3GHEL 1D5IH 4KDTA 1KCSL 3BPCA 4R96A 5MEPB 3WLWC 4UT6L 3DXAE 4QOKD 2J6EL 5A6LA 4EI5A 4H26B 5BROA 3T0EB 1MOEA 3GMMA 4G9FB 4JKKA 1G0CA 5DUBA 2MCG1 1FFOA 3MLZH 2AMGA 1UM4H 4PJIE 3SPVB 1RJCA 3ULUE 5C0CD 4P46A 5EOCH 4XMPH 3ARBB 4G6JH 5HXMA 5BXPA 3F7YA 1E6OH 1HH6B 1UR8A 1WICA 3HN3A 1OBAA 2YXMA 3BKYL 1JK8A 2BVDA 4OD2B 2FL5A 1ZMYA 4GBXA 2Y24A 3B5HA 2Z4QA 3QG6A 1JPGB 5A2BA 3RM4A 5IVXE 3MV9A 2DM7A 2VKWA 3T08A 3QIUA 2OX5A 4AJ0A 4OZOA 3UPAA 1IMHC 1H3UA 4HWNA 1OP3H 2HFEB 4OCXL 4PRNA 4BSVA 2X4NA 2YN3A 4TUOA 1LG1A 4UZGA 5ICXB 3WFCL 4HKJA 5DQDH 4TNVF 3DBXA 4O2FA 3WJJC 4MLIA 1NH6A 4U1SA 4D72A 1KJ3H 4DGIL 3S35X 3MRJA 5DMIL 1JFHA 3QCVL 1XGQB 3X11A 4TTUA 1MFBL 3RVTD 3LQZB 2VABB 1AVAA 4JRYA 4NKQB 1MEXL 2JKXA 4ZFGH 4JQIH 1TXKA 1PVHA 2H45A 2D03H 1N59B 1CDIA 4CD7A 4V1DE 2CLVB 2VXTH 4LVNB 3TONA 4KZEL 1YECH 2J74A 3ZKND 3WHXB 4X6BB 3SE8L 3X13A 1HQ4A 3MBEC 2GK1A 1T89C 3FQUB 3VFSB 3ARGB 1VHPA 1X4XA 5B39G 1H3WM 4TUFA 3JVGA 1MCWW 1B3WA 3KPLB 43CAB 1KGUA 4NQCB 3VXPA 4RGND 3D85B 4AEEA 5HHME 4HK0B 2BRRH 2BFVH 5CKGA 5DQ9A 5TQ2H 3E2HC 3MXVH 3HPJB 1H1NA 3RVVD 4PTUA 4G8GD 3MJ7B 2OR8A 4HH8A 3SCTA 2NR6D 3VXOA 1MRFL 3ZJKA 2WXDM 3LS5H 3GBNL 3HE6C 1M7XA 4W88A 5J56B 5DJ6A 2Q7YB 1JGVH 3RWIB 1MQKH 5B3JE 4HIEA 1RZ7L 4PJXE 4Y2DB 5C86A 4G8FA 3LKPA 3MR9B 4YHIA 3WF1A 4G8IB 1CDGA 5BS0A 4WIQA 3U0WL 1A02N 2PUQT 1I4FA 2HT2C 4KKCC 3DETC 4OF3A 5ABEA 1UJ3B 4G3YL 4K7PY 1ED3A 3VWJD 4IEFB 1LP9B 3BYTA 2CKBA 4KI1A 3CCHB 3RPKA 1CL7L 4U0RC 3TBSA 5F7YC 2YPLA 2OTWB 1V0LA 1TZIA 2ERJC 3DHMA 2C3XA 4UTAL 5J1TC 2HT4C 2YMXL 4FFVD 4W86A 1J0KA 2ED7A 1UWEL 3K4DA 2FHBA 2A6KB 3LDBC 2JCCF 3O3DA 3WBAA 4ORGA 3OZPA 1X5GA 3A6BH 2FH6A 1XR8A 1MXDA 5CIPB 1S78C 1KIRA 1IAII 5FCSH 3BAWA 4GS7C 3WSUA 1EOMA 2F53D 1GHFH 1S7TB 5DFAA 4P57A 4KQ3H 5C0NC 5TGBB 2X4TB 4NRRA 4JRXD 4E0RB 1DQQA 2OM5A 3MGOA 1OWQA 1T2XA 5D8JH 1L7IH 3PWNB 3FO2B 3SKUD 4K8RL 2O9TA 5KS9B 3W28A 4P2QB 5K59E 1V08A 3V4PL 4PB9H 3BP7B 5E8DH 4MJ4A 4MQ7B 3X14B 4EIZC 3W5MA 4QNPE 3QUXA 2WQRA 3MRMB 1U0QA 3V5KA 4W6WB 1DWFM 3QXDB 1D5XB 3BN9D 2QHAA 1UG9A 1KXQE 2D7MA 3FCTA 3V5DB 3M6DA 4PJGB 3F7VB 4NSKB 5TF0A 2C1OA 4ZXOA 4KJYB 4LCUA 3TLRA 3QI9C 2XWBA 1GCYA 1MCKA 4OZFG 1ES0A 4PJ5E 3E1F1 3EYFA 4DZ8A 4CADB 3EYVB 4FLRA 3CZLA 3HNSL 3C5ZB 4GRWH 3UCRA 1NFIA 1Z3GH 1U3JA 3VIFA 5DC4B 2YD6A 3X3GH 1P7QD 1NUDA 3MLWL 4I3GA 3WKZA 1B88A 4LIQE 1AD9A 4A6YL 1JCKA 3Q2CA 2NY6C 3CFDA 1OGAA 1E1EA 1PZ3A 43C9A 2J1KA 5EZJB 2RHEA 3WHE0 4NC0B 4FFWD 1HJXA 2D0HA 1HX0A 3CHDA 4PCSA 2AXJA 1KJMB 1J1XL 2YK1L 4WHCA 5IG7A 3BEVA 2BHZA 3VE0B 2HJKA 3WYRA 3G08A 1E55A 4N9GA 1MQ8A 3OKLB 1MHPL 1QACA 1IC4H 4M1RA 5FECA 5DRXB 3CSYB 1QBLL 2V5RA 1HYRC 4Q74A 5HYSB 1ZU8A 2OSWA 4M6ML 4HKBB 5E94A 1FNHA 1T6WA 1FLRH 4Y1AD 2P8LB 4OT1H 3GJEB 1U95A 5EA0L 2NT1A 3S5LA 4JFZH 1EHAA 2BVQB 1KPVA 1LL7A 4ELMF 2FZ3A 1I9IH 2E9IA 3HE7C 1CF8H 4YDJA 1UA7A 2PXYA 3D39B 2ZX9A 3BT2H 4JFOA 2VR5A 1HHIB 3MRDA 3MOQA 3A0OA 1B9ZA 3O0RH 4M8QA 3O3BA 4WVRA 3QDJB 5I1AB 4YN5A 4Z5RA 2J8OA 1OL0A 3WFLA 3BKCL 4IIQB 3PDDA 4FTVA 5T5NF 1WBYA 1S3KH 4WJ5B 3HZYA 2WP3O 4QWWC 1FH5L 2V5SA 2EYRA 4ZFOL 1Q6EA 1FL5B 3BCFA 2QKIA 1VEOA 3O3EB 3NIGE 5D1QA 2LTQC 3NCYS 5TD4A 3WJLA 1J8KA 1FFPB 4K3GA 3LIZH 4KDTC 1FORH 4DGVH 3QUKA 3BH8A 4EI5C 1KIUA 1HKIA 4JKLA 5BZWA 5FM5M 1PEWA 3MO1A 4DM1A 5ALCL 4RQQA 4O4YH 1XIWB 2OL3B 3TWCH 3VW3H 4BK5A 4PJAF 3EJYD 4P46C 1LQ0A 5FK9B 2ZCHH 4NZUH 2DQIH 4OKVA 4CAGA 4KJPD 3UBXG 4ELMA 5JHDA 4P9MH 2A2QT 4WKFA 1FIGL 3QH3B 1GXEA 5CGYC 4AM0B 4W8LA 4GBXC 2VIRB 4JKPH 4GAGH 2UVEA 4YPGB 3WIHH 4D9RE 1CI5A 1CK0L 3QIUC 4XBEH 1LJYA 3BYYA 2ESVD 5F1SA 1YDPB 3NZ8A 5C0GA 3BKJL 5IQ7H 1QA9B 2VWEE 3UR8A 4TULL 3AB0B 5F9OL 4NZDA 2XY2A 5BRZE 4Z6AT 4PMQA 2P46B 1RJYA 4WUUB 4DW2H 4Z7UB 3OPZL 2FD6L 1HZHL 1GGUA 4LYRA 4ENEC 1F00I 3LHPL 1J8HD 1YC7A 1UQSA 5LBSH 5LXGH 4XPTL 3FMGL 1L7TL 3GIZH 2XVNA 5D7IA 1F4WH 3IXTB 2DQJL 3TBVB 2XZCL 3LKSA 3DNKA 4R4BA 5E4EB 3HLAB 5DJZB 4XP5H 5LCVL 5T1MA 4PJAA 2E7BA 2ZG3A 1VADB 3CUFA 5HDQH 3GMRB 1LO0L 1TZHB 4YR6B 4RAVB 2R2BB 4NGHH 1QI3A 3QEQD 1ZANL 5I15H 5ERWB 4JL1A 5TFSH 1U92A 5GGUB 32C2A 3FN3A 8FABA 1V0KA 1E70M 4Y4FB 4LEXH 5FOBA 4QRUB 2Q76B 1INQB 5DVOA 5F3HA 4UFMA 3JVGC 5L7XL 5IMOB 4NF7A 4J23A 3F12A 4O58L 1OTUD 3SCRA 5E08H 1K3ZA 1SJEB 3V9FA 3RGVB 4EUPG 2ZOKB 3VD3A 4BZ1L 3LPPA 3S96A 2OP4H 5GGVH 3BGMB 4NQSB 4OFIA 5L0QC 1G6VK 4OGYL 1GGBH 5DVNA 5BOZG 2YL5A 5I30L 2DJSA 3HZVA