4HMCA

Crystal structure of cold-adapted chitinase from moritella marina
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
528
structure length
528
Chain Sequence
GTITSQDDNVVVGYWHNWCDGRGYQGGNAPCVELKTVNPQYNVVNISFMKVYDIAEGRIPTFKLDPTIALSEAEFIAQIDTLNSQGRSVLIALGGADAHIELTRGDEDALAAEIIRLTDLYGFDGLDIDLEQAAITAKDNQFVIPAALKMVKEHYRKTGDNFMITMAPEFPYLTANGAYTPYLTELDGYYDFINPQFYNQGGDGLWIEGVGWIAQNNDALKEEFIYYIADSLINGTRNYHKIPHDKLVFGLPSNIDAAATGYIQDPQDLYKAFDRLKAQGQPLRGVMTWSVNWDMGTDAANNSYNQQFIKDYGNFIHNQLPPVTDMTPTLSGIVDTRVELDSHFDPLIGITAKDYQGNDITADVTVSGSVNTNQVGDYLLTYSVSSDDETTNQPRKITVYEILPAFTGITDTTVVIDSEFDPMQGVSASHPTQGDLTANITVTGEVDTNVVGVYELTYQLFYGQDNQQNMTDKRIVTVVTDAVSDDDWQVGSTYVKDDKVTHNGATWTAQWWTKGEEPGTTGEWGVWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Chitinase 60
publication title Structure of a complete four-domain chitinase from Moritella marina, a marine psychrophilic bacterium
pubmed doi rcsb
source organism Vibrio marinus
total genus 167
structure length 528
sequence length 528
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2012-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
A PF16403 DUF5011 Domain of unknown function (DUF5011)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.20 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Carbohydrate-binding module superfamily 5/12 4hmcA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hmcA03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hmcA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4hmcA01
1LD9B 1TZGH 2ZX5A 4YDVB 5J6GB 3VJ6B 3F6IA 3WUWG 3LY6A 4DWHA 4E8CA 2UUDH 5ABFB 5FL1A 5GZNC 3DSFH 4GZIA 2YC1B 4PJ5B 3QCTL 4TVSa 4HOWA 3ULUC 5EO1A 3TBTA 1FG2A 2BNUA 4X6DA 4ZD3L 1QSFA 4YFLF 2ITCB 2VE6A 5ESQA 4HC1A 4ORZC 5I1DB 1QNZL 5AZEH 3TNMB 2NNAB 4IRJC 3PUCA 1CZ1A 1EAPB 3Q5OA 4AL8L 2EC9U 4O9HL 4F37K 4N8CH 4IOFC 5BW7A 4NQEE 2ZUWA 4KAQH 5FYJE 3TBSB 3BD3A 4ZS6C 5FD0A 2F58L 2EIBA 1EDGA 3KPSE 2H6PB 5DK0B 1F6AB 3SN6N 2C7FA 1TNNA 2DLIA 3S37L 1ZSDA 1SEBB 3PWPE 2ARWA 4L1HA 4HH9A 4APQD 3WIHA 3VXUB 3RWIB 3TVMD 4PREB 2CBIA 1HJXA 5SWZD 4CCEA 2P8LA 1E55A 4XNUL 3Q6FA 1WP6A 4KK6D 2EC9T 2GVYA 3SQOH 1JGEA 5E2VL 6FABL 3HRPA 3RVWC 4H1LA 2J79A 3AIUA 1UJ3B 2YR3A 4N9GA 2JJWA 4NJ9L 2PWGA 4HZ8A 4QGYA 4QOKA 4X6CF 4NN7C 3T0EB 4HFWB 3ZDYE 3KL5A 3ROOA 1F4XH 3EDJA 4D71A 1R0AH 3SE9L 4N5ED 4BF7A 3S36H 3MRNB 1CDJA 4AJ0A 3G6MA 4XB8A 1KT2A 2V3GA 1K3ZA 4JFED 3P4OA 3MNVA 1T5XA 2WWMD 3DYOA 2FX8H 3I6KB 4PUDA 1PGRB 2P5ED 2AEIT 4WHCA 4XRCA 1UM5L 4U1NB 3WUEA 2DH3A 3WKML 1P69B 1PQZA 4N0FA 2AJVH 4DOHE 3AIVA 3QIWB 1CD8A 1ZHBB 2VAJA 1MPAL 4UU9A 2XTLA 1BJ1J 1B3XA 1ZE3C 1YMMB 3DX7A 1UM4H 1QLRA 1F3DJ 1CEOA 2VDPL 5F6HI 3FT3B 4ONFL 4PJHB 3U1SL 5KOVC 4ZYKA 3TIDA 1TITA 1KGCE 4GW4A 4J7RA 4QHNA 4EQ2A 4DKFL 4OF8A 2HT4D 2PWEA 1N6QH 3EYPA 3RL1B 1B30A 2CMRL 3H2WA 2HKFH 4F7EA 5HDQL 1VFAB 1J8KA 3MJ7A 1U93A 1Q0XH 1QPKA 1F3RB 1DN0A 3C6LB 5J9PA 1IM9D 1S5IL 1U42A 2PC8A 5HXMA 3BEVB 1CXLA 4U1HA 1UOKA 1J8HB 1O7SA 2CRZA 1WC7B 5FCUH 4FQLH 3RM8A 1KB3A 3KZSA 1QR1B 3KVQA 1IAIL 3VXRA 4LPTA 3RY4A 3OKYA 1LG1A 3UAJD 3GZAA 3L3GB 2B5IB 4AZCA 4G42B 3QOKA 1HKLL 2UYLB 5A1AA 1WDQA 4BQ9A 3IKKA 4XCCL 2VLRA 3C09C 5D8JL 5CP3H 2IAMB 2CUHA 3EOAB 5DHVH 5IMKB 1A9BB 3IDGA 3LAFA 1KCRL 2DWDB 1ZT7B 4MNQA 3K1DA 2GDUA 1ZV5A 3QEHA 3ULUE 4AY0A 1BFOB 2BVTA 5IESH 4R96A 1OWQA 1EEQA 3ARTA 5I1EL 1BEYL 3WDHA 3WFBH 1KJMA 1U8PB 4Y16C 4P7OA 3G6AA 2MFNA 5CZVH 2A6DA 3QPQC 3L4TA 5FDWA 2E9IA 3VPLA 1A6PA 3OR7A 1BGAA 2EYTA 3MRMB 3O6FC 3LMJL 3FOMA 4FQQA 5DJZA 1QYGH 2JEPA 3F4VA 1HWHB 3LQZA 1TDQA 5F8RC 5EN2B 4UIMB 3WUWA 3ZMRA 4IM8A 3TBWA 4GBXB 1KTKE 5D8WA 3DV4B 2V9RA 5MP6L 2PNDA 2WHKA 3VXOA 1U8MA 2WMIB 3FQXA 3H9HB 3NZHH 2K7PA 4ETYA 4Q6IA 4PN2A 5D7IF 4S11A 2XKNA 3QDJD 5L7XL 1IAOA 4AXNA 1CE1H 3BXWA 5F7LB 1ED3A 3MU7A 2DL2A 3EO1A 1Q8MA 4NNPH 4APQA 3ET9F 3FN3A 2W67A 1TVBA 2UVEA 5DRNA 3TVMA 4RQQB 3LEVL 3F12B 3RP1A 1G0DA 2AQ3A 2P48B 5SWZA 2X41A 4YHKL 5BS0B 4MA3A 1IQWL 2CKBH 1I4FA 1T5WA 3L9RB 3T4YB 4M81A 1AI1H 1LGVA 4YXHH 5HDBF 3JWOH 3DRQB 3MFFA 5EBLA 1RK1A 4JO3H 5HI4C 2RAMA 1NC4B 4HC1L 4GAJL 3K2UH 5ADOH 4B3KA 2JJTA 3DGGA 1CD1B 3GHEH 3ILQD 1EA9C 2AGJH 5C0FB 4BQ3A 3MRCA 4L29A 3OGSA 3C5JB 2DPEA 3THCA 3FB6B 1NFDB 2X5PA 3FXYA 5CJXA 4WF7A 1XHGA 1OWRM 3P0VH 4JFEA 3ZKXB 1VGEL 5K9JL 2D22A 2NY3B 4ONGL 4L8DB 1JWSA 3RX7A 1KPUB 2P5EA 1H3WM 4L3EE 1KTDB 3WIHL 1TJGH 3BAKA 3FAXA 1JF6A 2YBTA 5JR1L 4FTVD 1AY1H 2A9MH 4F57L 3E2HB 4WUUB 5GGSY 2HLAA 5KVFL 3V6BR 1LE9B 1K9DA 3HI1A 3FO2A 4GOSA 5AYBA 1RURH 2WAHA 3F58H 4EXPX 1Q9KB 3STZA 1CPUA 5TPWL 1RUKL 2GAZA 4KQ3H 3AM8C 3HC3H 1F3JB 2KKQA 3GMOB 3F7VA 5HYJD 5L9DL 5KTEL 5E7FA 3ZKMD 2AV7B 2D7QA 3GXMA 1SJVA 5FO8A 3VGFA 1Q6DA 2P1YA 4LEOA 2CBUA 3MLUL 3N85H 3NIGE 1FIGH 5FO7A 4KK9C 1K5NA 3O2VL 3GIZH 3TO4D 1DVFC 3NYDA 4KY1L 1IM9A 4EZMA 1WDSA 2CLRA 1FL3A 1VFBA 4UV4L 4MZ2A 1WBXA 3MACL 1W8NA 3MO1A 1TZ7A 2WYSA 4XGZB 4RE2A 3FB7A 4LVHC 3IFOB 3V7AG 1QUNA 3S97C 1V6YA 3WQ4A 1CXEA 5T5FL 2G2RB 1C16A 1RIUH 1E3ZA 1H3TA 4O58L 2ZNXA 1JTOA 2XZAH 5GS1C 1E6ZA 2ADJA 5E6IC 1HHHA 3T3PF 2EZ0C 4JZJB 4UQ3B 3TBYB 1QVOB 3CZGA 4OCSH 4IMLB 1QTYT 1I1YB 2BY1A 3DPBA 4KJPD 3BQUD 1QD0A 4TSAL 5C0JB 3O2DH 1ETZB 5F3HB 3WS6C 4U2ZA 3IETA 3WN6A 3W0WB 3UYOD 1NEZA 4LSPH 3VXQA 4JR9H 3VFTA 1MWAA 5EC1B 2J4WL 3QZWA 1X5IA 1GC1H 4QXUH 4RX4D 2O5YL 3W39B 4N1CA 1CFQB 2ORBL 1MHEB 5DJ2B 3OJ2C 1E4XL 2OR7A 3OSKA 2C0HA 2ZCLL 3K8KA 3T0BA 2CLZB 2JJSA 2NY4D 1TTFA 3EFFA 4HUWA 4Y1AE 1UQZA 1QFPA 4M43L 3PL6D 3DUHA 1PW3A 3BOVA 4Z5RB 5C0BE 3GO1L 5ABGA 4R6UA 2CIIA 3TIEB 2OR9L 2ZOKA 3BP4A 3OKOA 2APBA 3JUGA 2NZIA 4Z7OE 1N7MH 4KI5D 1REIA 2YL6A 5FK9B 3MGTB 5HI3D 4OCNC 2Y72A 4U6HA 5GZOD 2R0KH 1H3XA 4FABL 5HGAA 1BOGA 3QDJA 1KXVC 4AMKL 4LSQH 4OLZH 2XWBA 4O51A 4U1IA 1ECEA 3KPRE 5BZWA 3U36B 1XIWB 3HE6B 2J5LB 4CD5A 1FHDA 4NYLA 4JO2L 4Z9KB 2AJUL 3KAAA 2YPKB 4KRUA 1FAKT 4M1RA 5DO2D 3MBED 1QI2A 1JNDA 4ZSOA 1T0NA 5A2CA 5C6TH 4TULL 1MI5D 5K9OA 3JXAA 2HYMA 2FJHA 5A6BA 2EIZB 5LA1A 5IHZA 4DK6A 2C3WA 1CGUA 1MCWW 3MLTB 4OD3L 1GOWA 2OYKA 4YDLC 4YHZH 3SUVA 1CDGA 1T21B 2CK0H 2EIEA 3BEWB 3HTLX 3MUZ1 4EOWH 1GOOA 1M7IB 2EDRA 3CH8A 4JKMA 3FRUA 3LV3A 3QHFH 2XWDA 2DSZA 5DUBB 3CC5A 4PRWA 1OOAA 2ZZUT 1JGVL 4GUPB 3LRSB 3TTQA 5A2LH 3I6GA 4WTZG 4NQSA 4RFEA 4ODSH 4Z7WF 2BSTB 4FTVA 1BZQK 1A4KB 2W1NA 4N8VG 3JWDC 1A1MA 5IOPA 5IEHB 5GJSL 3QCTH 2J8GA 3PHQB 1U8IB 4NCDA 5HYJA 3FN9A 2EKJA 4NQVA 3LKOB 1FA2A 1KLFA 3F6LA 3IDXL 5ICZA 2VL4A 1Q9WB 2E8YA 4O9HH 2GTWA 3ARPA 5CMAA 3TO4A 4RGND 4NM4H 5C08E 3EZ8A 3SKNB 3P0GB 4G8EB 2PR4L 3QRGL 4DZ8B 2F54E 4WW2F 5HHMD 1IC5H 3MUIA 3WD1A 4HPYH 2G3IA 5T3ZD 5DMGD 1T0MA 3VXSD 4QRRA 5EU6E 1EHXA 4WWKC 4MDIA 1PLGH 3WQWA 5F7EH 4P3WA 3POHA 5DD3L 3WLWC 3MMDA 3UERA 1AMYA 1MQKH 4OT1H 1HHGB 1R3HA 3O6LH 4NQXA 5KW9L 2P24A 3NOIA 1WZ1L 4X6BA 2VQ1A 4XX1E 1TETL 4DVRL 2HTKC 3WQ6A 4LYRA 1B2WH 3QUZD 3HE7B 1OAKL 5IF0B 4TUJA 3PV7A 2F19L 2BMKA 3ARXA 3MOBL 3B9VA 1MCJA 1V03A 1VPOH 3EOBA 3N1FC 5D9PA 4X6FB 1T2XA 4PFEA 6FABH 3BCDA 2Z91B 3ZT6A 5CSZB 3G6JB 2FO4B 2WKGA 3OZPA 2LFGA 3WHXA 1G7PB 5I6XB 5CJQL 1RP8A 5GGRB 3U0TB 5DD5L 5DQ9B 2OM5A 1N2RA 3SE9H 3WJJC 4F15B 1L6XA 3PXJA 2WMFA 4P2OC 4GMSH 4RX4A 3UJIH 1D5MB 5L6YL 3P0YL 3VRIB 2EYRB 4UOW0 1JDCA 2JF7A 1EVUA 1MQRA 4PCTA 1YNLH 4WNQB 1XGPB 3ZE0F 1CZ8H 2I07B 5C6WH 5INCA 3RTQC 3PL6A 1WKYA 2AABL 2VURA 2H2SC 1JI2A 1OQXA 3UTTE 1IM3B 5JA8B 1J11A 4WFEE 1BBDH 3WKZA 3C60D 4CN4A 5DQDH 1IC4L 4DEPB 4GG6F 4XV0A 2VDPH 1A14H 3X12A 1D6VH 2CDEA 4RBPK 3WEXA 1BG4A 1RZKC 1MCIA 3AIRA 4JY6B 2HAZA 1UZ1A 2R2EB 5I74C 2V2XA 3AS3A 4X0NA 4QFUA 2J78A 4PJBF 4TUKH 1I8LC 2FIRT 5IV2B 2CMRH 1KULA 2DT2A 1MWAL 2ZUQC 5BVPL 1F2XK 5DHYA 1BFTA 3P4NB 2YS4A 1DQTA 4HS8L 4R7NA 5HPMA 3ARYA 5HI5D 2X09A 3RGVA 4ATWA 1LNUA 1RUML 5TH2A 4D6EA 3MBEA 3S88L 2BVOA 2GSGA 4D6FA 1MI5A 1NDMA 3CZJA 1I7TA 1Y6NR 3WCYA 5E70A 3VRLF 5HGBA 2C3GA 3OKLA 4LLUA 5GIRB 2BVDA 1IAIH 3MLWH 1MJUH 1W72A 1B3ZA 4JN2B 4M24A 1DQML 4GMTH 4WU7A 3ROLB 5FHBH 4HT1H 1G7QB 1UZ4A 1HKLH 2FWOA 1TCMA 5HYSB 5ICXA 1MRCL 2FJGB 2J6EH 5HVWA 1GPFA 1YEDB 4P48A 3WNMA 2P43B 3NH7L 1VADB 3P30L 5ELIA 3RHWK 3UCRA 3DUSA 4NFDA 5FKYA 4JZNB 4PMOA 1MCOL 5A16A 4H5SA 2DMCA 4Q22A 1NEUA 3RPKA 3NZ8A 1ADQH 1KWGA 12E8H 5KSUB 5MHSE 3HCVA 4YIQA 1I1XA 1U8LA 1L8NA 5I1EH 3QGVA 1BEYH 1G7MB 4FQPA 3P4MA 2CYGA 2G60H 5TF1H 2YPLE 1F13A 5LA0A 4Y88A 4NKOB 4PP1C 3WFEL 1K8DB 1JRHL 2RIKA 3AU1B 2EDYA 3JSSA 3QXTA 4GIAA 1KEML 2SEBA 2A6IA 3BKJL 3BP7B 4WTZA 4EBQH 5IUSA 4WJ5B 4YGVB 5J3HC 5FUZH 1UA6L 1OSEA 2UWEF 2JEQA 5F7FA 5I15H 4FRWA 4N8VA 1QFOA 3V5KA 4MNGA 2OK0H 1UKQA 5IFAH 3BAJA 1C12B 5GRVK 4CKQA 5MP6H 1EFXB 4BKLB 5F3BB 1GCFA 1OIMA 1CXIA 4UQ2B 2WBGA 1HNFA 1NPUA 5IBLD 4NP4L 3SBWA 3VXSA 4NRRA 1RZGA 2VLLA 4TUOB 4JGUA 2X4OB 5L8JB 2VAAA 3UTOA 4OZFB 4OZHF 1JHLL 2VQTA 4BYHA 2XZQH 2NW2B 3TOPA 1CDCA 1UJ3C 3O4LE 3VFNA 3W2DL 4ELMA 4WI5A 1YJDL 1BYCA 3M6DA 4NPYA 5DR5L 1Q94B 3OKNA 2ARJA 3T0EC 5MEQB 3VNZA 3MROB 4OFDA 3QUZA 3HR5B 3VW3L 4LXFA 3EYVB 1RJZB 3L4WA 5FYJU 3U2SA 1AO7B 1YNTA 4KI5F 3GJEA 2D49A 4LCYB 4HC1H 3KWWB 4NNXA 5F97E 1W1YA 4ZFMA 3MZTA 1KYOK 5KSBE 3CZ8A 4G6ML 2WQRA 4PY7A 1NDGA 1ZHKB 2R1XB 4LCWB 3S3SA 1MCRA 1NANH 1WWBX 4FLQA 4LF3A 3GSWA 3VFWA 1WAAE 2ZG3A 1FH5L 1SBSH 4PB9L 2A3AA 4PGEB 4HD9A 4TPRL 3L5XL 5DC9B 5DF0A 5C9KA 3SDAB 1PVHA 1PAMA 4MJID 4UOW1 3QFJB 4Z95L 3CUIA 3LB6D 1WWCA 1KIQB 4LHUB 4F57H 4ZOEA 1R24A 5ID1A 4GXVH 2XA8L 1VFUA 2DWEA 2FLBT 1HINL 1AQDB 1UXWA 3C60A 5KVFH 1AD0A 5MERA 2B1AL 4GT7A 3OGOE 1CDHA 3C6LC 2D9CA 5F9OH 1L7IH 5L9DH 4ZG1A 3VIMA 1BVKB 2C3VB 1GGTA 5KTEH 3FJTA 4KRLB 2NYYC 4HWZB 1SM3L 3NPSB 3SDXE 3EMZA 1KR1A 4M62H 3RWGB 1TTUA 3O2VH 1M05A 3L5WA 4KY1H 1K2DA 1MVUA 2B5IC 4MWFA 1FGNL 4YFEA 3NMEA 1JF5A 1C93A 1U95A 5EA0L 1PJ9A 4WI3A 2ICWJ 5B4MD 3WUZA 2NW0A 1G7JB 1BQLH 4GO6B 1VAHA 4K94L 5CP7B 1YEEL 1NUGA 2G5BB 2X9XA 4JAWA 2WVTA 5I19H 4Z77A 1A7NL 1G1YA 3OR6A 1XYZA 1LVEA 4LAQL 3BN3B 5EU3B 4MAVA 2YDQA 3PNWB 2XUCA 4P57A 1JGIA 3RY5A 1TJIL 2EH7L 3MJ9H 4UNVA 1GW1A 3K7UA 4CCDA 3U7VA 1P4BL 1SJEA 1HHKB 5KSVA 2HMIC 3WQ8A 5A8PA 4YHYB 4LLYB 1XGYL 3KLSA 3C2AL 2Z1SA 2ZWYA 5IBTL 3TCXA 3APGA 2EJ1A 4RDQG 1ZGLM 4GBXC 1BYDA 4K68A 4WTXA 1E4XH 3PDOB 2Q3ZA 4ZENA 3VXUE 4JHZA 5TD4A 4Q7DA 4HKXA 1I7UA 1W72L 3SKMB 3M17A 4S0SD 2HVMA 4C83A 1DQLL 4TQEH 3P9LB 4JKPH 2V17L 2XTJD 1D3CA 3L3KA 3QA3B 3MS8A 2G5RA 4H26A 4JG0L 4Z0XA 5GGVL 3VGBA 1MIMH 1Y0LA 4HS3A 4EUPG 3IDJB 1GPOL 5M5DA 1T1WB 2W38A 4PV9A 1NJ9A 5D96B 3QUMB 4NWTL 4AMKH 4WDIA 1U3HB 5TJWK 3HS0B 4R26L 3WH9A 1B4RA 1WIUA 4PSPA 1CXFA 2X4RA 2WCAA 5D7KD 3WL0A 5SX5H 2R1YB 3D39D 2ZUUA 3Q3GA 5IB3A 2PF0A 4LRIA 3CZKA 1BZ9A 2E0PA 3VGHA 5L2JB 4IBLT 4F7CA 2UY2A 4QTHA 2RFXB 4OZGA 1R85A 4PJCE 4JDVB 1NGYA 4MAYD 3ZKXC 2I24N 5CKGA 1A4JB 1GGBH 4NO5A 3ZL4L 4OD3H 1NANI 2NY3C 1YMME 2FYYB 1KR0A 2JB5L 5I8EB 3QHNA 2A3CA 3N50A 3SIMA 1DJSA 1U8JB 4PJHE 5HPOA 2Y4SA 4GO8A 3THDA 5LCVH 1G5AA 4YBLB 4B3LA 4QNPF 1RVFH 3UBXB 1U30A 4NKDA 5E9DD 5IVXF 4CVXA 1OAXL 3AMLA 3WLBA 4MAZA 5T3ZL 5BOPA 1A3RL 1S7VB 2H1PL 2V9TA 4IRSB 1NMCB 3GXIA 3B3IB 3RVVC 1GVYA 4PMVA 5IM7A 1YN6B 1C5BH 5CSBA 5DJCB 2NX5E 2OI9B 3BKCH 3O6ML 2IALA 4MJIA 1YY9C 1DR9A 3RL2B 4PBVC 3FFCB 5JOPE 3FT4A 1DWFM 1E72M 1FFRA 2Q1EA 3DX9B 1LLOA 4HCRH 2E8ZA 3MJ8B 2DQUL 3KYAA 1U92A 3ZO9A 3DURA 3D48R 4ODVL 3OB8A 2FEDC 3X3FH 5GJSH 1N5YL 4OFYD 3QDGD 4LNRA 4HS6B 1AGCB 3O4OB 1R3JA 1LEGB 3N0PB 1BIHA 1LK3L 1OCWH 4HX1A 2JKXA 4W5UA 1V02E 4DJMA 1JWMA 2DN7A 5C0DA 3HI6H 5I1LA 2XIDA 3TTYA 2MHAA 4YHNB 4U5IA 5T3XE 3B2UC 3H9YA 3FO1B 2EE6A 5TGBB 3MRJB 1FL6B 2PR4H 4MCZB 3RPIA 2H9GB 1PZ2A 3H9SE 1YYML 5HYEA 1IGJA 3SPVA 3LN5B 4JZJC 5I1HL 1BBJA 1BLNA 3R1GL 1MJ8L 1BM3H 4MADA 3O3BB 1KGXA 5KZCB 1I8KB 2JIEA 3MRHA 3TGXA 5KW9H 1X7QA 4JREB 1WZ1H 43CAA 3CSGA 2YA2A 1M03A 3VG0L 5EORL 2YD5A 4ZUUB 2R0WL 2VXQL 5C0AB 3W9EB 5J11B 4S2SA 1KBGL 2WK2A 2J25A 4GZJA 4YXLH 2F19H 3H3KA 5BV7C 4K9EL 4K71B 5D7SL 3ZLQC 5JPNA 5IG7B 4X9IA 4YHIB 5CILL 1J0HA 4MXVF 4GW5A 5DD5H 2W65A 4YHOL 1E4XI 5E8OA 3S3PA 5IKCB 1V7NL 3ZTNL 5IQ9B 5TDPA 1LK2A 5LVEA 1DBBL 3VDCA 3Q2CA 5FF6A 1VRXA 5L6YH 5HGHB 2YK1L 4JPIB 3CMOL 5CD5D 2W59A 1A9EA 3QDMB 2YD9A 1RIHH 1SYVB 1EDQA 3VFVB 5ENWB 3MR9B 4OZGF 3HZMA 2V7NB 2R1WA 5BS0E 2AABH 1CFTA 4KHXL 2CJUH 5C0GB 1HH6B 2Y1VA 4U7MA 5JUEL 1T66D 1NMBL 1XIWC 2VITA 4M3KB 4MVBC 3HE6C 2J5LC 4HUMB 2MQ0A 5DGQA 5E24E 3PGFL 4HIIA 2Y23A 4XP1H 1ZLSL 1UXSB 3LEYH 2EBNA 3FY1A 1E4IA 3RVUC 4MSWB 1NFDE 4PRDB 1S7TA 1R5WB 3G08A 4WKHA 2P8MB 3VFPA 2DQDL 5L2KE 3LMYA 4EUPA 2FB4L 3TV3H 3UCQA 1MWAH 1XF5B 3O11B 2X44D 5DJYA 1JNEA 2BNRB 3D39A 3O3DA 3VWJC 4W7UA 3PGDB 4HS8H 1JZ5A 5DJ0A 1ZLWK 1CGTA 4NHUA 5JIIA 2V3FA 3ARVA 5EU5B 2KH2B 2UY4A 1AP2A 3GSOB 5CGYD 2AJYL 4ZQKB 1OD9A 2H41A 2P5WD 3BKMH 4MQSB 4NBXB 1Z9OA 4JO4H 3MXVL 3CLEL 2AI0L 3FB8B 4MAYA 3S35X 2J7GA 5K33A 2L0DA 1D5ZA 4JFFB 2AK4B 4G6KH 4ERSH 2B20A 4UFKA 1FO0H 4HV8B 1UR4A 3QPXH 2PTVA 4MA8L 3PGCB 3UTSB 3U4BL 5E9DA 1MRCH 1TQBB 3QQ9C 4LARH 1X5JA 3NH7H 3NVQA 5C0CB 5KS9F 4KDTA 1AIFA 3B9KB 3U0WL 4X7CC 3RIFF 1DL7L 1KIPA 3BSZH 3N9GL 4PRAB 3O3AB 1VB9A 3DX6A 4ZTPL 4AM0B 2IPTH 4ALAH 2NT1A 2WSPA 3S7GA 2X4QA 2ZG1A 2GFBA 3FZUD 1V6VA 4KUZH 1UENA 1JRHH 1S9WA 3SUTA 3BP6B 1F4AA 3W5NA 2W9LA 4ZPTB 1XCXA 3BKJH 4F9JA 5ABHA 2QJDA 2NY0D 4OFYA 3QDGA 3RVTC 2KQNA 4BH7B 2IQAB 2DQTL 4EI5D 2A6KB 4PJEA 4QDMA 2C1OB 1FL5A 3HPLB 3S5LB 2CITA 1J0KA 4DCQB 5AC4A 3BHBA 4GS7B 3GGWB 4TNWF 4UV7H 3IJHA 3AIBA 1N3NB 3WFCH 1UADC 3MLYH 3U7YH 5C09E 1BTCA 5HBBA 3RCNA 4NQED 5FYJD 4PG2A 4XTRC 5A6AA 2CO6B 5DI8A 3KPSD 1TVHA 5DK2A 3CMGA 3HE7C 4D1JA 1FDLH 1SVZA 3WN5B 1JV5A 4LPYA 4KMTL 5ABEA 5CBAA 5C8JB 4Q97A 2VOTA 4KPHL 4HZLB 2P47B 3PWPD 4G9FE 3MLRH 4KJWD 3QXAB 1FN4B 4K8RL 5DR5H 1KC5L 4OJFL 1H0GA 4PJIA 1ITXA 1J0YA 1J0ZA 4F15C 3VW3H 4FLRA 4J6RH 3V6ZB 1DLHB 1JHTB 4XC1H 4X8XA 3WF0A 2BVQB 1ZANH 3VMNA 5A8OA 1LO5B 2IQ9L 1A02N 2VDLL 1OGSA 5FO9B 3GSRA 2ATKA 3NIDE 4LOUD 3QEQD 3KLAA 4ISVB 1T6VN 2DYPD 4U4BA 1IV8A 5GHWH 3SJVB 5IB4B 2XFXA 2FL5A 4V27A 5IMLB 1LP9B 4RGOH 4AT6B 5IWLC 3CDFA 1FZMA 5F7WC 4KH2A 4H25B 5I18H 2CCRA 5GS0D 5GGTA 2OLHA 4P23B 2GK2A 3CFKB 5EZIH 2PWFA 1R86A 2AXFB 1FZOA 4PB9H 1S78D 4DEPC 5E5RB 1GGCH 3ELAT 5C2BL 1OP5K 3WS3B 1VKXB 3LKSB 4Z95H 4PRHB 5L0QB 2AEQH 3G5XA 3HUJF 3JVGA 2GW5A 1JWUA 1OD8A 3KS0J 3VU2A 2R8SH 5HVFB 4LLWB 2JCCB 5I1JH 3G5YB 5BXRA 1C5CL 5DD0L 1UC6A 2YHGA 3RGHA 3DO7A 4XCYB 2WIMA 2HN7B 4LSTL 4PJDA 5KG9B 1KGCD 1S9KC 1XC6A 3X3GH 3B5HA 3B2VL 1ZS8B 2J8FA 1TZIA 5DJ6A 5B39G 1W9VA 4QXGL 4XVSL 1D5XA 2LAGB 1M1SA 2DGAA 3D85D 4RISH 4W4OC 5HHNB 3OXRA 2DICA 4ODBD 1INDL 4X9YA 3EUUA 2P5WA 1E4MM 1U8HA 4DVBB 1T7ZA 1EPFA 3CLFL 4K94H 1DQJA 2BXYA 5E8EA 1YEEH 1EMTH 1FFOA 3RIAF 4PJEF 4U6XB 5D7LD 2CIKB 3KR3L 1LO3L 4C4KT 3V5DB 5D1QD 5CKAA 4GAYB 4XCFH 4P5TB 1HCFX 2VXSL 4OCWL 5HYQB 2CHNA 1TJIH 5BQ7A 1FNSL 2YMXL 1CLZH 3IRZA 1IGIL 3RY6A 1JRHI 1OSZA 2Z8WC 1J05B 2A0LC 4IIQA 3VIOA 4RMRA 4P2RE 5GZND 4JRYB 1IKNA 2IEPA 1F00I 3TTOA 4WTWA 3ULUD 2X4SB 2IH3B 5D71L 4M48L 2H45A 3MV01 1XCQA 4HXBH 4HAFA 4PLJC 4W87A 3UMTA 1UR1A 2OJEB 4ACZB 4IRJD 1RV6X 3Q1SH 1PG7L 2EDJA 5EUOF 4X0KB 3SEPA 5ACZA 4EI5A 4Q2ZB 4LK4A 1OINA 3PTQA 1BZ7A 1DE4B 1ORQA 1KELL 1WT5A 1MCDA 1E28B 2QSTA 5F89A 5IROA 1B0IA 4POZD 2FHCA 1DQLH 3O41B 2IXUA 5DDHA 3U57A 3VIGA 3GXDA 3RWHB 5CUSL 1JZ8A 5FYLH 5A3IC 1IAKB 1JTTA 5LAXA 1EH9A 1VJSA 5KVGL 3LIZH 1Z9SA 3WBEA 4NQEA 5GGVH 3UYRH 1V3LA 4UOJA 1Q9OA 4BSJA 1DSFH 4OD1L 1ZT1B 1GPOH 1JNHB 2AJXL 2X4TA 3KPSA 3QIBB 3BIKA 4BSVA 2VRQA 1YMHA 3VH8B 5JPMB 3V0VA 5C0RL 2FBOJ 3ZKQD 5E08H 4PLOB 4Y4KC 3G6DL 1KXHA 4RNRA 3PWPA 4IM4A 1JYXA 3BRFA 1GHFL 3RVWD 4OAWA 3LPOA 3P77B 5DK3A 4MA7L 4QXTA 3NFPA 5D9SA 1X5GA 5HDRA 1JCKA 3DBXA 4Y4HD 1NFIA 2B31A 3PWLB 3QIUB 1QHZA 3UROR 1IGCH 2B4CC 1EEUA 3KYMB 4JAMB 5ITBL 1OT1A 2PYFB 3U9UB 3VD7A 4HPGA 6TAAA 3QH3A 2V5CA 2DBLL 3QEQA 1HOCB 3ZL4H 1FNGA 4YDJB 2G75A 4LLVA 1UWXH 3SDAC 2CIPA 4M5ZL 1UQSA 3OAYH 4FFYL 4JANB 4JJ5A 1T83C 1FLRL 1K3IA 3IF1B 2H8PB 4XHJC 2W66A 3TBVA 4FZEL 2J62A 3Q5YA 1P53A 1I7ZB 4BELD 3VOCA 2FLRT 1HVXA 4L3ED 5I17A 2AJSL 4MNHA 2FHFA 2KPNA 1KEGL 2GUOB 5IW1B 1W1PA 1S7QA 3NPSC 2DQUH 1N5YH 1BQHG 4OIFA 3JV5A 3SGJA 1GSMA 4OTXL 2YA0A 1YY8B 4RCAA 1B0GA 1WE5A 3IDIB 4R4ND 1F11B 1HXYB 2J8OA 4CDGC 4ZXBA 4JFWA 3W11C 4LEXL 4GLRH 1PX3A 1KN2H 2CDGB 4HKBA 4GRWE 3W9DB 1JAEA 2EO7A 3FMGL 5IVZB 1FGVH 5F1OB 3BH4A 3AHXA 4BFBD 3ZDXE 1RIVL 2UWFA 4NZTH 3D85A 3OL2A 1DEEA 5GGTL 1YDPA 3QRFM 3GDBA 5KJRL 5I1HH 1NLBL 2BCKB 5TE7H 3R1GH 1MJ8H 3RFZC 4PG9B 1UZ8B 5E1HB 3B5TA 4M7LH 5B39A 2BC4A 1H5BB 5D7LA 4NKMB 4AMCA 3JTTA 4NRXA 1IFHL 1RHHB 3UG3A 5D1QA 3ARDD 4XPFL 3QBTB 4YHYC 1A1NB 1Z5LB 2XACC 4XMPL 1XGTB 2MOVA 5CPQA 1KBGH 1E9LA 2VC2L 3OGCB 3OJDB 1AH1A 3FCTB 2MPAH 4K9EH 3DOSA 4LQFL 5FA4A 4Y16D 1NBQA 1HHJA 2OXGA 3DETD 1YQVL 2D2OA 1PKQE 1ZT4A 3C8KA 1NWSA 2X70B 2FGZA 2CEQA 3FO0L 1A7OH 35C8L 4YHOH 5KAQG 3O6FD 1V7NH 5EOCJ 3PIQA 1FZJB 3G9VA 5E6ZA 1I1CA 1MAML 3FTGA 5IVNA 2RGLA 4NT6A 2N1KA 4B9ZA 4IRJA 3CMOH 4XX6A 2A1WL 4M7JH 2GJXB 3OZOA 1A6TB 4JRXB 2Q8BL 3IFNL 5DHVB 1WBYA 4P5MB 5L88L 1VACB 1X5ZA 1ZHNB 4DN3L 4LYPA 3L4VA 4Y1AD 3LPPA 4MDJB 1IC7L 1ROWA 3FQUA 5D96C 1FV1B 4KHXH 1YECH 1MH5B 1U3HC 2NTFA 2NLJA 2V5TA 4RMVA 2P49B 1DLFL 3MA9H 2EDDA 3OZ9H 4HWNA 1NMBH 4JFOB 4LPVA 4M1CC 2IMMA 1O7VA 1U8NB 3SKUD 1F58L 1ZLSH 2E9WA 2YDRA 4DGYL 3MRRB 5EZJB 3DTXB 2YL5A 2A77L 1ESWA 4F9PC 5ICYA 1H15A 2ESVB 2TAAA 4BZYA 2H3NA 3I75B 1P7QD 3PDGA 4LCWE 1ZAGA 5DJDA 1T6WA 3UZVB 1BMGA 1HSAA 1ZTXL 3D2UD 3UJJL 3DVNB 5E00B 4PJ8A 1HXMB 3GSXB 2OTWA 3KPRD 3V95A 3HZVB 4DN4H 5HI4D 2OZ4H 1S9YB 2AQ1A 2ZJSH 4XH2B 1IKFL 1H4PA 4Y4HA 1M7DA 1UWSA 2FEEI 4HEME 1OM0A 4YBLC 3QJHB 3II1A 2WZEA 4L1DA 3EMCA 4ELKB 4YFDB 2XYLA 1FE8L 4IRSC 1NMCC 1KB5A 2DQCH 4JEGB 1EO8L 1ZKAA 1EEYA 1BYBA 2EDKA 1R5VA 2OI9C 5F7NC 4OI8A 1AHWB 1IGYA 3L3HB 4MD4A 5AUMA 2AJZA 4J3VA 3U6RA 4ODXB 2VABB 5FYJL 2R0LL 3U4BH 3WFDH 2OL3B 3LQAL 3MRIA 4M61B 4JFPB 3QUKB 3DGCR 4X7FC 1ODUA 5I30H 2AJ3B 4GKLA 3HC0A 1EXUA 3D69B 4YXKL 1S9XB 4UNIA 4ZTPH 3TTSA 4L3EA 3O4OC 4HH8A 1QA9B 1LO4L 4M3JA 2DM7A 3MBXL 2EDXA 1F2QA 2FATH 4EDWH 2FSEB 4H20L 1FHLA 4NUJA 1I3GL 3WMSA 3TCLB 4MMZC 1AGBA 1U8OA 2YUXA 4KK9D 5AWNL 4ACYA 4X5WA 3QEGL 2RJMA 4U1LB 5EWIL 5EIIB 4NF7A 1UD5A 1T3FB 3GBML 4GINA 5H37G 1RULH 4M6ML 1LO2H 1BQHA 1I7RB 3T1FB 3GEWB 3L3OA 5BZDB 4KKCC 4TOYL 3ULUF 3KYNB 4JREC 5C08D 5GS0L 3BZDA 5K93A 4ZFFB 1XCWA 2F54D 4X9GA 5J11C 5E6ID 5I8OL 3D5OF 2IBZY 4JZ5A 1BREA 5EU6D 4K71C 1V8HA 3A4XA 1CICB 1V7MH 1NGWA 3MCLL 1EOMA 1MHCA 3G5ZB 4D3CL 3RMEA 1UYWH 1XGRB 2BZDA 1QOXA 1FH7A 3CPUA 4K8RH 3MOAL 3ARDA 4OJFH 3SE3A 2F53E 2L7UA 1I1FB 4HKJB 4C56E 4I3RL 5DJAA 1K4CA 4ZNCD 4NCC2 3OKMB 4B5EA 1QACA 4Z7VA 4H8WL 1TPXB 4Y16A 1T7WA 3GMNB 3MV8E 1NCBL 2VX7A 2VDLH 3BGFC 1BGGA 3RJQB 3QHOA 3QOMA 1TE1A 2GJJA 4XBGA 1KCVH 1YC7A 2PW1B 4LPCA 3GYCA 3IU4H 3O6FA 3OBAA 4M00A 1MW2A 3F5JA 5GJTH 3I50H 4YNYA 1MLBA 4XVJL 3WFHA 3LSOB 4JFDB 3S34H 5MEPA 4NCC1 1D5BA 1VBUA 2E7MA 1TR1A 1B0WA 1CVSC 3SDYH 2QR0A 3C5SA 4KQ4L 3D25B 4J1UA 3U9PH 2ZE0A 4YC2B 2IADA 3CFBB 5IBUG 3QG7L 4QYOA 4U3HA 4Y1AA 2IG2L 3VDAA 2VZSA 5EU4A 4E8DA 3ES6B 4HJGA 4P9HC 3NTCH 5DVMA 4JFZL 5HSFA 4EAMA 4YHEA 3CCHA 3ARFB 3KYKL 3BESR 4FFWC 4X5XB 1E0WA 5HYFA 3ARWA 4JGJA 2IPKB 4WFED 4KROB 3OKEA 1MAKA 3DSNA 3HG1E 1M04A 4MCYB 1T04B 5DD0H 3G04A 4PY8I 3TPKA 3IFPB 4S1SL 1P7QA 5IHRA 4QCEA 2R56L 3BZEB 2I25N 3D2UA 4HDIA 1CK0H 5JXAL 5A6LA 2E3ZA 3HHRB 3KPRA 3RNQA 2I27N 4YX2L 1HQ4B 3O3EA 1G6RB 1OTTD 3FNDA 4X4XB 4G9DB 4QXGH 5GGUA 3AFBA 4M5YH 4UMGA 3AHVA 2JJUA 2NY5C 4PRIE 3FFCE 5FKPA 2BSSA 3SCNA 1HEZB 4R2GC 5LGHL 4U0RB 2QQKH 3GMQA 3B9KC 3EGSB 2QHRL 4MAUL 1GUVA 3KR3H 1Q1JL 3AUVA 1QLEL 4GRMB 2HWZL 1AKJD 4JFUA 3CH9A 1S5HA 3ARBB 1U6AL 4V1DD 3VXMB 4UZUA 3MYZA 3H0TA 3GJFA 1QPPA 2ATPA 1IC1A 2Z35B 4L4VE 5ESAB 3TNNA 3WH8A 1TZHB 1RU9H 4U1KA 3KPLA 3L4ZA 2J88L 4ODWA 4EUPH 3AM8A 2O9TA 2YD4A 2YRPA 1D5IH 4YR6A 3IDNB 5HDBE 2Q86A 3OLDA 4HWBA 5EMYA 1FNEB 4NUGL 4WI2A 4CVUA 2YPLD 4UI2A 5SWSB 2F5AL 2MKLC 2HT3C 4GS7C 1Q72H 5F88A 3UZQA 3MNWB 2EXWC 3IGAA 4WENB 3INUL 3SCUA 2ICWA 2CK2A 1DANU 3DHPA 1U3ZA 2R2BB 5D6CB 4FFVC 4PTTA 1T1YB 2JJVA 2J3SA 1JTPA 2A9NH 1OARH 1KB5L 2AXGA 2FBJL 1MFBH 3S36X 4EDXA 3WN5C 4NHCH 2NXYB 2N7BA 4WWKD 3AZSA 5A6KA 3NIYA 3FN0L 3KPMA 3WLWD 1BJ1H 2WUCH 4LASL 2Z9TA 1VEOA 2VQUA 3N12A 5C08A 3QNZB 4L8BA 4TNVK 4WFFE 3PABA 5GGVY 4ZDHB 1UHVA 3RU8L 3IJSB 2F54A 2AJXH 2PO6B 1L9NA 3VGAB 4BA8A 1CLCA 1J7VR 1I1RA 5GS3A 2PTTB 3CZFB 5EU6A 4M7ZB 3B4NA 3V0AC 3FAWA 1S7SA 1I8IA 5JHLH 2V2TB 1DANT 1HI6B 4H0HB 3CDGB 4K7PL 3RI5K 3WS6A 3EBVA 3O4LD 2OSLB 1YQ2A 5KSAA 3QQ4B 3VXNA 4U1JB 1PFCA 3VI3F 4AZHA 1CLYH 2A3EA 1KQYA 1QSEB 2DQFB 4GKNB 3A67H 5I1AA 1KCLA 4P2OD 2XFRA 3DV6B 4Z7OF 2LU3A 5AC5A 4P23C 5C07B 4R90L 3VRJB 3RUGB 5I8KH 3L4XA 4HUXB 4BH8B 5I73B 2OYMA 3HR6A 4MHHI 1AGFA 4NM8L 3HKFA 2CGRH 3HZYA 3RTQD 5L0QC 2B39A 4FFYH 4O4YL 2DRUA 1FLRH 5ID0B 1JDDA 4PTMA 2ZOLA 1QSZA 1NGQL 5FKAB 4HF5H 5I1IH 2BNRE 1CG9A 3IXAB 1HSBB 4I1NB 1LILA 5EBMB 3T3PE 1FFPB 1JMZA 3ULSA 1NP0A 4LGPB 3A6CH 5HHVL 2EDWA 2JELH 4LLDA 3QDHA 5EBWA 1CFSA 3HC4H 2J1KA 3GBNL 3OKKA 5BRZB 43C9A 4A4AA 3LS5L 4PMXA 1VA9A 2FDMA 4JFFE 3D3VE 4XNQA 5FL0A 1I3RB 3AZTA 3ZJ8A 4OTXH 2CUMA 4U6TA 2P46B 3V4VL 3MRDA 3AB0C 4KXZI 1W9XA 3UTSE 5GRXG 3EDKA 3STLB 1V0MA 1T22A 2ADIB 5C0CE 3TYFB 1ZGLA 5ALBL 5F9AC 3UETA 3WENA 2VISB 3P40A 2UZXB 3MGOA 3KL3A 2NY2B 2HVKA 4FXGB 3V6FA 4DKEL 1O6IA 1XCTB 2V7HA 4P5TC 3BD4A 5EH1A 5IR1B 3MMUA 2QQNH 3X11B 3WDQA 1U3YA 7TAAA 1E27A 2XRAH 4CVWA 1OB1A 3FQNA 2DEPA 1IFHH 2VLJB 3TN0B 3IANA 3PZVA 5DVKA 3H6JA 3H7BA 4XMPH 1AKJA 3UO1H 3VKKA 3DYPA 5J13B 3AXXA 1A2YB 4M29A 1IGFH 2VC2H 3AMDA 3ILPB 3TF7C 1UWRA 3ZR5A 4O2CB 4LQFH 4V1DA 2HT2D 4PP1D 1WWWX 1KG0A 5GRVL 2R23A 1N5AA 3LS4H 4HPOL 4ZPVA 3DMMB 3GMLB 3JWNC 5E94A 3I02A 5J3HD 3RKPA 1WIOA 3RWCB 1K8IB 1PZ5A 2GJ6E 3HUJB 4HJ0C 4I2XB 3WL9B 4CUCA 1RHFA 3TONA 1MAMH 2YPLA 2VH5L 1XGQA 5DHXB 4WW1A 3QO1B 3DXAB 2A1WH 1PIGA 4LPUA 4HQQL 4JPVL 4K7FB 2VLME 2QSQA 1OF2B 3H42H 4HFUH 5TFSL 2Q8BH 5ECUA 4XNXH 4A6YA 3HB3C 3V79C 1JZ2A 3QIBC 1AR2A 1NBVL 2F8VA 4X98B 3S96A 5DT7A 3AXLB 3VD3A 2IBBA 4WWKA 3E1F1 5D9MA 2X8RA 2CNCA 4JCMA 1DLFH 4QRPB 3BAWA 4WHDA 5F9WB 3PWJB 4OFIA 4G8GE 1F58H 4JM2D 3GSQA 1A8JH 5M95B 3SJVE 4Z7WE 2IH1B 1LWJA 2RGMA 3WKNA 3EYQD 2AXHA 3VCLA 1U58A 2EEXA 5JDJA 5DJ8B 4WSKA 5DYOA 4WKAA 2QKIB 4XZUA 2ZCKL 2GJRA 4XC3H 1WF5A 4HWBL 1NBZA 5J6HB 3CPLA 4ORGA 3O4LA 1BWMA 2ILLA 1G9NH 5D2NB 5IB2B 1IKFH 5GGQL 2A3HA 2YL8A 5C71A 4OZOA 3WXVL 4PJ7B 4UUJA 3WJJA 5ILTL 1QRNB 2FECL 3PHAA 2VVSA 4P2OA 1KENL 1GORA 4R97B 1W0VB 1FE8H 1MHHA 1UWUA 4XI5D 3V6OC 2JCCE 4WO4C 2B2XL 3R8QA 5I77A 4PMYA 4CD4A 1YMMD 5IB1B 5KVEL 4FP8L 3VTRA 5KSBA 3GHBL 2GY7B 2XZCH 1YEJL 4YQXH 4O2EB 3RTQA 4DKDC 5I1KL 3WNPA 4MQ7A 1KLGA 3NA9L 3U4EB 2R0LH 1I75A 2ESCA 5JOFA 3IDMA 3NFNA 1NSNH 1AGDA 1S7RB 1MELA 3BN9C 5IFJB 1WAAA 3TBTB 4YXKH 1FG2B 4X6DB 2CDFA 3CGTA 1QSFB 1MFUA 5J0BA 2NX5D 4U33A 5JOPD 1DHKA 1MW0A 2NY6B 4JN1L 1KJ2A 4YBQD 2NYYD 1I8LA 4DWSA 1R3LA 1I3GH 5MEOB 1G9EA 5AWNH 3IJYA 4JO1L 4PMZA 2BHZA 2W9DL 2AV1A 3BZFA 5CEYA 4V2CB 2E6PA 5EWIH 2RCSH 1T20A 3WUGA 3MUGA 3W24A 3AICA 2G4FA 2BVPA 1DQDL 1H5BC 1AIWA 3ZE0E 1A47A 4H88H 4LL9A 1T2QL 3MREA 3UPRB 5T3XD 4OF5A 4JRYE 4OZIF 1B2YA 2P8LB 3H9SD 3KPTA 2X2YA 4BQ8A 4CRPA 1JGEB 4O02H 5KN5A 4M93B 1DWAM 3P73B 3RWDA 3EJZC 4YDVA 4QOKB 3VJ6A 1BECA 4GQ9L 2D7MA 3SO3C 2DLGA 4M6OL 1MFNA 2YC1A 4W85A 5GNZA 4PRNA 3IAGC 1OWWA 3SCRA 1AC6A 2Y24A 3QWOB 4JL1A 1KT2B 1PSKL 4H8WH 4PJBE 3A6OA 4XP4L 2XQBH 4F9DA 1T5XB 1EK3A 3OLIA 1J1OL 8A3HA 4GBXD 5I79A 4Q6YA 4G6FD 4KRTA 2VN4A 3TBSA 1S7UA 3CX2A 4XRCB 4BS0A 1A7QL 1FG9C 3RO8A 2H6PA 5DK0A 4LCCC 1F6AA 5GS2H 1PQZB 4XVJH 1UD6A 2V9QA 4UU9B 4O2FA 5I6SA 2DKUA 1QLRB 3SDCA 4LVOB 1A6AB 4MXWH 3L3DB 2OLDA 1A7RL 1DBAL 3DROA 3QG7H 1W1VA 3RWIA 5D7JD 4ZYKB 3RDTB 4JQIL 3TJHD 4F33B 4GW4B 3OQ3B 4QHNB 5BS0D 4Z7UB 4HIEA 4JFZH 4YJZL 3EMQA 3KYKH 2YD3A 3LKQA 4G5ZL 4F7EB 3K4AA 3MLXL 3MJ7B 4KJYA 4WU5A 3EYOA 4FQ1L 5KSBF 5J9PB 1UJ3A 4OQTH 4JM2A 5FGCB 2DDXA 2EXYD 4U1HB 3NCJH 4I48B 3WIIL 2VZUA 4UDTA 3MRNA 3CFIC 5ISZB 5E7BA 5D5MF 1FBIL 2APWA 3VUPA 4HJJL 3CVIL 5B38G 2WANA 4Y7EA 3VXRB 5AG8A 4GKZA 5L2KD 1HYSC 2ZCHH 3V6OE 2UWEE 1UWGL 1AC0A 2YD1A 1JGUH 4AZCB 5E95B 4JDTH 2BJMH 3VFSA 4RFNB 2Q87A 2VLRB 2IJ0C 3GB7B 4A6YL 3NGBC 4NIKB 3IDGB 4PJCA 5TE4L 1UA7A 1CWYA 3QEHB 2FD6L 4GQPH 4MAUH 2WUBL 5ABDE 1WTGT 3JWOC 3RVVD 1YMMA 1CGXA 1Q1JH 5IB5A 5DC0A 1E40A 2WBKA 1KJMB 4PJHA 3G6AB 3GRWA 2A6DB 1YY9D 5EO9B 5FDWB 2Y06H 4X6EA 1KJVA 2QHAA 3CHFA 4OZHE 4HA4A 3SDXF 3OR7B 1I9RL 3CVHA 2A6JA 4OGAC 5TE6L 2EYTB 3O3UN 3MLVL 2YUWA 2XN9A 2P44B 3LKRB 2J74A 2X0YA 3FOMB 2D7OA 5FB8A 4FQQB 4NI3A 2FEDD 2J88H 2NX5A 3V8CA 4KTDL 3LQZB 5F21B 2XWJA 1VSCA 3WUWB 1FC1A 5KVDL 1JFQL 4CVZA 1FAIL 3TBWB 5FM5M 4ZO9A 1V0LA 3ULVH 5E1AA 4JPKH 1RMFH 2F5AH 3CNKA 3DIFB 3VXOB 5JO5A 3FQXB 2I5YL 4Q9BA 1HJQA 3GNPA 4Q6IB 2K9UA 4KHTH 5AY7A 3L3GA 1IAOB 5D4QA 4G42A 3GBEA 4GRLB 2WXDM 1ED3B 2P7TA 4JHAH 5FGBC 1YC8A 1E1EA 1V02A 4NWUH 3WHE0 1CICC 1AR1D 1TVBB 1CFVL 4ZUSA 5IMKA 3EOAA 1XYFA 3PJSA 3TVMB 3T1WA 1NCWH 2MMXA 3MCG1 4LASH 2WPGA 3W28A 5E2TL 2FGWH 2DWDA 5C09D 4E5XA 3BPLB 3NAAH 5SWZB 1ITCA 4MA3B 1T5WB 4UOZA 1NUDA 3H9SA 3HPJA 4C57C 1BFOA 4BM7A 5EBLB 5CEZL 1RK1B 4GO9A 1NUFA 1U8PA 1TPXC 3VGDA 4KDWA 1QSVA 4QLRA 3DGGB 4CDHA 1I8MB 4K7PH 4G9FD 4KTEL 3MRCB 1SMAA 4G7VH 2Z1KA 2W92A 5ETUA 1Z0NA 1KJ2L 4L29B 3MRMA 2ZUNA 1UM6H 1HILA 2ZWZA 1MLCB 3OX8B 2E9MA 1INEL 1UH4A 4JFEB 2AVGA 1DUZA 3CUPA 1KTLA 1A1OA 2EDHA 4JFXB 1GAFH 4GBXA 4JQXA 1YPZB 5CFHA 2XVLA 15C8L 4P5KB 3X13A 3C87A 4F7MA 2VZ1A 2P5EB 4XBEH 4YC2C 1E4KC 1WCGA 2WMIA 3VGGA 2JF1A 4RBPH 4OLVH 5F96L 4EIGB 3I6LE 7FABH 4IHOA 1QHPA 2ESVE 4L5FL 2A83B 1SYTA 2HLAB 2BHYA 3ARFC 5BYWA 3ZM8A 2FX9L 1TCRB 3FO2B 3HI1B 5DS8B 3RVXD 2ENSA 2MCPL 3STZB 1RZFH 1NGQH 3HFMH 4KROC 4OZFH 2GAZB 2XIIA 1XIWD 1GC1C 1KJ3H 5D7JA 4GH7B 1IBGL 4RQQA 3F12A 3CFJB 4NJAL 3P3YA 4ZNEE 5BS0A 1TG7A 1AVAA 1V0NA 1T4KA 1NUNB 3V4UL 5FO8B 4MNLA 3OJVC 2P4AB 2DQXA 5FO7B 3DRQA 2XNAA 4OLEA 4YHGA 3TO2B 4Y8DC 2CLRB 1FL3B 3LS5H 1VFBB 3B5GA 3VWJD 3WY1A 1WBXB 3MO1B 5DXWA 4H8VA 1QNSA 5GRUH 5C0FA 3ECBB 1I1AB 4YWGH 1WK0A 3MANA 1MFEL 4F37F 3FB6A 1J9CT 4HG4J 1A21A 1A6VL 4U0RC 2FZ3A 4OIIH 4KMLB 1P6WA 5L2KA 1RUAH 3BMVA 4P59L 2ADJB 2NTSP 4OCXH 2OYLA 3W0KA 5D1XD 3NDYA 3T0VA 4W68A 1A6WL 7CGTA 3GSUB 4BA0A 1EBAA 1KTDA 2CRIA 3BGMA 2E27L 4P7RA 4HIJB 4S1RH 2PF6A 3TYGL 5F6HJ 2H2PC 5AEAA 3PP4H 5JTWA 3IETB 4NZCA 1Q38A 1WLHA 3VXQB 2XVGA 3VFTB 1MWAB 3S6CA 3L7EB 3QAZB 3E8UL 2BFVL 2E9BA 3GMOA 3FO9B 2ZNWA 3BAEH 2ZSVA 4JQVC 3GZKA 4JFHE 4HXAH 1NAMA 2V5MA 2VZOA 4HPOH 2VXTL 2OS7A 4JY5L 4LIQL 2W60B 1A3LL 4GKSA 4ZTOH 2DJ4A 4P2RD 3WF4A 2WLZA 2CIIB 4M7KL 3RAJL 3BP4B 2NXYC 5CJBA 4XGZA 1E6JH 3OKOB 5D70L 4HHAB 2HRLA 2F5BH 4JIEA 1FO0B 2D31B 2QTEA 4X8JA 4HQQH 2G2RA 4U6HB 3I9GL 4GKOA 5HGAB 3A4AA 1RJLA 1EHLL 2PO6C 3VGAC 2YXFA 2VMFA 4XTRD 2DIEA 4QNPE 1X1NA 1G7IB 2LE9A 2XWBB 4JZJA 4OKVA 3TBYA 4BSWB 3NSNA 4U1IB 5D8ZA 4M7ZC 3SE8L 4IMLA 5BZWB 3KPNA 4ODTL 3GRWL 4NYLB 3UG5A 1ETZA 5F3HA 1AE6L 5JIHA 3SKOA 5C09A 1K6QL 3VD9A 3CVHL 2DH2A 3WHE1 2I60H 5E8PA 1T0NB 4ZSOB 4OF0A 1FCGA 3O45B 1C1EL 5K9OB 4YEFA 2FJHB 3WD4A 4JFDE 5IHZB 3QXUA 1GOKA 2O5XL 1U91B 1E73M 4P8VA 5I5RA 1CFQA 2ZCKH 5E2UL 4G9FA 5IHUH 3TWCL 1MHEA 5DJ2A 3VIPA 2E6JA 5I73C 3GNRA 5DT5A 1AFVL 5GGQH 1BAFL 2NQCA 3VXPB 3WXVH 3LV3B 5HOSA 5DD1H 3CC5B 3TIEA 3W5MA 4QWWD 4LSSL 1DP0A 4GSDL 1BHGA 4F9LC 3I6GB 2J7FA 4NQSB 4NO0D 4RFEB 1DCLA 5FK9A 4K3DL 3MGTA 1NFDF 1VERA 1JAKA 1YEJH 4P7NA 4FTVB 4UAOB 5T3XL 2BY3A 1HVQA 4MS8C 5H37H 1I9EA 2BOBB 3THML 5IOPB 1MQPA 1T1ZA 2AEPL 5FHAH 3IVKB 1XIWA 1MCWM 4LSVL 4NDMA 4NQVB 1RZJL 1WUNT 5GRWA 4HUNB 1R3IL 3PHSA 4AEHH 5ICZB 5DD6A 4K07A 5HDOA 2GTWB 3TO4B 3VA6A 1L7TL 2VNCA 1TIUA 3VWJA 3H8NA 2NY2C 2XFFA 1B3VA 1IZJA 1T0MB 4QRRB 1T21A 4MDIB 3HMWL 4M1DL 1Q6CA 3KPQB 3QFDA 5FECA 1QW8A 3VXME 3D0LA 1CYGA 1R3HB 2DQIH 4G43B 5CJ5A 1OIFA 3KPPA 2P24B 5DUBA 1CTNA 2VQ1B 3TN0C 3O0RH 5D1XA 2Z31D 5A95A 4TUJB 4OBSA 1CGVA 2BMKB 3VMOA 4F2MA 1FVDB 3EOBB 3QHMA 3IS0X 2OP4L 1HT6A 1E6SM 1GOHA 2YD7A 5HHQA 3WHXB 2ZSWA 1BGXH 1P84K 2CPUA 5I1CH 4M6OH 1N2RB 3DMMC 5IEHA 1MJ7H 1I85A 1RZIB 4M6NH 1DZBA 1WIPA 1HCVA 3HLAA 1F5WA 1NOWA 4RL3A 4XP4H 2MJWA 1XFPA 3PE9A 4PLJD 2JFEX 2NY4B 1Q9WA 5TF0A 3P11H 3SKNA 3BZ4A 4P2RA 2EDOA 4FFZH 4OM1L 5BWFA 4L4TE 4WV1C 2J4GA 2NCMA 4PGBB 5DEFB 3R4DA 1PY9A 2PCPB 4QF1B 5KBNC 3A6BL 1OAZL 5F9WC 5A3ID 3QISA 1EHNA 1DBAH 3X12B 2G9HB 4J4PC 2I9TA 3MRPA 3AC0A 3HAEG 4DW2L 2BS9A 3AMCA 4ZE5A 2V2XB 2PUQT 4CJ0A 1MRFL 5IF0A 5KS9E 3AY4C 4YPGA 4Y4KD 3MLXH 2HFGL 4W84A 4AZ7A 5C07E 2DLHA 5CSZA 5HPMB 2FO4A 3GH4A 4TSBH 3BDYL 3RGVB 5B3JF 1J01A 3RUGE 1LNUB 5D2NC 5TH2B 4XZWA 1G7PA 2CBVA 3MBEB 1G9MH 1NAML 1X4ZA 5GGRA 3U0TA 2BVOB 3CK0L 2GSGB 3U5YA 2VDNL 4JM4L 1I7TB 2EPNA 3IJ9A 3BJ91 3HN3A 1FBIH 3IYLW 4LLUB 4LCWD 4HJJH 5HGBB 4NRSA 3GKWL 2DDQL 4R97C 3A47A 1W72B 3BH9B 5CJ8A 2EYRA 1GHSA 3WO3B 2X4NA 4IOIA 2DQGH 2EDEA 4GZEA 2FECI 1SHMA 1UWGH 5F7KC 4WU7B 4FQXB 4W6WB 3ALGA 2FWOB 5ICXB 4XMLL 2EECA 4U2YA 4W86A 5F93C 3LN4B 4P9ML 5IWLA 5CIPA 1IM3A 5A16B 4H5SB 3NZ8B 4OLUL 1QBLH 3EOYG 1UWEL 1ZLUK 3TA3D 3HCVB 4NO0A 4YIQB 1U8LB 3TLRA 5J4MA 3P4MB 3L1OL 1YEFH 2GCYA 3SKJL 1X44A 4GPNA 4B9YA 4K23H 4K3EH 3S4SG 2NY6C 2H32H 4YHMH 1CFNA 5HGGS 4AWEA 5A8QA 5EG6C 1T7XA 2A6IB 3VFOA 4P9HH 4ATDA 1YUHA 1J1XL 2ZOXA 2QSVA 3MC0A 4YHLH 5D72H 1AQKH 5HVGB 2RTSA 5BV7L 5IEKA 3VX1A 3BD5A 4XPTL 4N8VB 5EOCL 1H8SA 3V5KB 3GSNA 5KVDH 1JFQH 1FAIH 4RAVA 3ARQA 2JALA 3LPFA 2E5EA 5CXPA 4RGNB 5BXFA 4FZ8H 2DSKA 1GQKA 4BQ4A 1A0QH 5GIRA 2FX7L 3MV7D 1JYVA 3NACL 2VLJE 4CD6A 4GAGH 3UBXI 3VXSB 3GI8H 1GJUA 1RZGB 5T1DH 1JI1A 3ROLA 4Q9RL 3OB0K 4W4OA 4JFSA 1MRDL 2NY5H 1F4WH 3DUUA 5DMKB 1CR9L 4M93C 1YEDA 3VFNB 1CFVH 4ELMB 1VADA 4PMDA 2A74B 4NPYB 3OKNB 5E2TH 4AD1A 1DBJL 1WEJL 3W6LA 2Z31A 1T7VA 3QUZB 5CBEB 4MD0B 5KSUA 3C08L 1UWIA 3HUJE 4I2XE 1XZ0A 1QR4A 1YNTB 5CEZH 2CKSA 3GJEB 4P8UA 2XXCB 1EQCA 2RR3A 2BNJA 3MPCA 2OMNA 5E99L 4PTUA 4H8HA 1GZQB 2XG4A 3DXAE 4LSRL 2E9JA 4B7IA 1MFAL 1KJ2H 4D9QE 5HD8C 1KFAL 5FYKH 1NDGB 4YGVA 5AZ2H 4D1IA 1FFNB 3UX9B 2F53D 1RZ8A 4AENA 1INEH 3LOWA 5J1AA 4C56D 5BMFL 3I3EA 2GEEA 3QHTC 5FAAA 1KIUA 5JHDA 4OM0H 3G6JF 3O8XD 2DSWA 3VFWB 3VFMB 3MV8D 4QRPE 2VCAA 3E6HB 4Q9QL 4LVOC 1PKQA 2HFEB 3SHSA 1HDMA 2ZUSA 3RDTC 1T03L 1LO0L 4BKLA 5F3BA 4UQ2A 1W0WA 3CIVA 5DUMH 3CUGA 1R24B 4TUOA 2X10A 1U3HD 1UXWB 2X4OA 1QFUL 1NQBA 3C60B 2A38A 3UC0L 1V08A 3HJEA 3QQ3A 2NW2A 4M1CD 2ZKHL 1ZLWH 5D2NE 1Q94A 1MEXL 3SE4A 1MQQA 3KWXA 3V4UH 3EYVA 4HWEL 5EOQL 8CGTA 4Y4KA 3EOTH 3SY0A 4AY1A 1M05B 2WM0A 1QBML 3RM4A 3VO0A 2BVYA 1MVUB 4A2LA 2DOCA 3HG1D 4Y19B 1U95B 4QHLA 5I24A 1RZ7L 2VIRA 3N18A 4JDZB 3BW9A 1JZ7A 4XNMA 1XR8A 1T0PB 4J23A 2YOCA 4H1LG 1P4IL 5EUOE 4Z77B 4IRSD 4P59H 3OR6B 1TTGA 4EQ3A 3IFLL 3CUFA 4PGEA 4Z0BH 1CQYA 4S10A 2EPOA 4PRID 3TM6A 3FFCD 5IFHL 2E27H 1KIQA 4LLQA 1ZEAH 1F90L 1SJEB 1T83A 2GT9B 3CX5J 4S1DC 3TYGH 5KSVB 3V4PH 1AQDA 4P3DA 3TA3A 1BD2D 1YA5A 1ZBWA 3M7SA 4OUUA 1C5DB 4A2MA 3B83A 2IBZX 5IT2L 1BVKA 2C3VA 1NC2D 3RNKA 5J12B 4FQJL 2XVPA 2DSVA 1WFUA 2GTZB 4L4VD 1H3VA 4LVNC 5BXTA 4Q6IC 4LIQH 1A6ZB 1S3KL 3M17B 3REWB 3RAJH 3C8DA 3V0WH 4GRLC 4XPBH 3T3MF 4AEIH 4DGIL 4MJ2A 3L3KB 4PJ9C 3BPOB 4TN9A 5I3DA 3CSPA 4LBEA 4Z0XB 3TVMC 2V5RA 5JQ6H 5EB9A 4QOKE 1HL9A 3WH7A 3MV7A 4HS3B 4NO2A 4X6CA 2HISA 3BPLC 4XNZB 2D03L 3BYTA 5EZOL 1EHLH 4JB9L 3VMPA 1NJ9B 5D5MB 3UG4A 5K59E 2X0HA 4AIUA 1EHAA 4QHUA 3NABL 2XQYG 2Y5EA 2L4OA 3V2AR 1R5IA 5A2KH 2X4RB 4J3TA 1A7PL 4CKVX 4WHYG 3ARUA 3Q3GB 4XPAL 5IB3B 1N26A 1XF4A 1BZ9B 1WVZA 4OSUL 4WFFD 2VZVA 4F7CB 4M6AA 4LLYA 1HZHH 2XGIA 1NGYB 1V3JA 5IK3A 3U79A 4TSCL 3AYRA 4NO5B 3GSNL 1H09A 4YE4L 2WC7A 4XBPA 3TWCH 4KZDH 2ICCA 4TNWK 3R0MA 1IEHA 4Y2DB 2J8HA 4NFCA 2K7QA 4I5BA 3CFCH 4PGCA 3F5LA 1AFVH 2VDRL 4LAJH 4Y5XB 2F53A 1OP5H 5K9KB 4C56A 4OCYL 3MNZB 4AISA 4CVXB 3SKMA 3WLBB 1MJJA 1SMOA 4Z7UE 3O8XA 1FIEA 3MV8A 4LSSH 5IM7B 4GSDH 4BJLA 3EJJX 4EJ1C 2FNBA 5CHNA 1NQ6A 3MXWH 3VFGL 3RX8A 1DBKL 1FJ1B 4RMTA 4GW1A 5FGCE 2IALB 4MJIB 5EOTB 4K3DH 3ZKSD 1E15A 3FT4B 3RBSA 1WFNA 2HT4C 5HDLA 5ISZE 3QUMA 1V3HA 1U3HA 1TA3A 1MCPL 4W8AA 2VN7A 4FFWD 2AEPH 4N8PA 1J0IA 2Y8VA 4LSVH 2DQJH 1U0QA 3D3AA 2R1YA 2BNRD 1R3JB 4EK7A 4N90E 1RZJH 5H8DA 4IS6B 4HX1B 1I1AC 5I66A 5C86A 1JWMB 2VLRE 3TC9A 1JHKH 4I3GA 4F9PA 5I1LB 25C8L 3DX8B 5GISL 2MHAB 2OYPA 2XTKA 1JL8A 4JDVA 4JKLA 1HIMH 3GMRB 3LPGA 4WSJA 3RPIB 1XD1A 3VE0B 3HG1A 4P4RA 1IGJB 2ED8A 5B8CC 3SPVB 2FYYA 3ZE1E 4NQDE 4JFFD 3D3VD 1DWJM 3PZTA 2PXYD 3BKYH 3FQTA 1MNUL 4E9LA 3F5KA 1BBJB 1BLNB 3HNTH 3MYJB 4G7YL 4NZRH 4M1DH 2BSRA 4R2GD 4Z7QF 4IRSA 5C0CD 4HEPG 1T89A 3B9KD 43CAB 2FJFA 5E5MA 2GSJA 4S2SB 4JJHA 4UB0L 2D0HA 3QAZC 3RL2A 4PRIA 5JPNB 3FFCA 3S35L 1JFHA 4IJ3B 1ND0A 4D0DA 1IT9H 4KVCL 4BFIA 1LG2A 4D6IA 3MJ8A 4PCSA 3MRGB 1BD2A 2JJSC 4GW5B 5E8OB 1H9VA 5D7IA 5TDPB 5J1TC 1WB0A 1LK2B 3FRPG 4HS6A 1AGCA 1MW3A 1Q6GA 4L8SB 4Y7MA 1A9EB 5ADPL 1NC2A 1EGZA 4DTGH 1OW0A 4L3CA 3PZQA 2HT3D 2BV9A 4L4VA 4MGXA 3NFSH 5CWSA 4P99A 4EXKA 2X9YA 2R1WB 3MRJA 4MCZA 1CFTB 1CL7H 2XY1A 4FFVD 3IU3A 2GJ6D 3K80A 5A6JA 1KXTA 4Y4FD 2R4RH 3TT1L 2XTJB 3CLWA 3H9ZA 4OCRH 3LZFL 5JW4R 1RUPL 3L5HA 3O3BA 5JLZA 3HNVL 4LCIH 3A6BH 1EGJH 4HIIB 1OAZH 4TRPL 1NMAL 1N0LA 1XF1A 5E4IA 4BZ1H 2CD0A 1TVDA 5J57B 2ITDB 3TT3L 2Y36H 3WH5A 4BQ6A 4DW2H 3T8XA 3G08B 5DFAA 2R69L 3QXWA 4M8UA 1MRFH 3W27A 2QHLA 1LWHA 1Z3GL 2NXZD 4EUPB 1MUJA 2VXUH 5EO0A 3HNSL 5DJYB 2CO7B 3D39B 3O3DB 2HFGH 1YPZE 3ILQC 5I75B 5DJ0B 1B4JL 4YHIA 2P5EE 5D4YA 1WZKA 4NHUB 1BG9A 4G8GD 1AP2B 3H7LA 3FFDB 5EPMA 1FSKB 3SJVD 4IUGA 2W9EL 4MAYB 4F7PA 4JM4H 5IQ9A 1V5JA 3QCVL 4X4ZA 4Y5YB 3GKWH 2DDQH 4JPIA 5HGHA 2KZWA 1D5ZB 4URTB 1ZBCA 1KB9J 1EQPA 1PX4A 4XP6L 2N7AA 1SYSB 4P23D 2QQQA 1KCSL 1NEZG 5ENWA 3MR9A 4NQCD 2V7NA 5E9DB 4M1GH 4UAOC 4X83A 1OP3K 5AYIA 5T1KD 3QUYC 3QZWG 4P9MH 2YL9A 4YO0A 3AXIA 3OF6D 1FVCA 3SUUA 4XP9L 3BUTA 4OLUH 3DX6B 4RGMB 4CW1A 2VDQL 5TQ2L 3UP1A 3M45A 3IKCB 1JPSH 2GFBB 4XWGL 1BYAA 4NOBA 3ZKMC 1S9WB 2Y7QB 1OGGA 4PRDA 3S3JA 1B0RB 5FUCC 1J1XH 5HHPB 1XF5A 5C6PB 2J7EA 2BNRA 3KYOB 1N4XH 5J1SC 1FL5B 1KFWA 4Q58C 4KKAC 5JW5B 3QHZL 5ITFA 5EU5A 2HRPH 3BHBB 1W3LA 3FKUS 1C91A 3IJHB 2KQMA 4ZQKA 5A2JH 5BVJA 5I8CA 4OF7A 1CDYA 3MODL 5EULV 4X5LA 1AQ0A 4U5KA 3BAYA 3UEQA 4OLXL 2EEDA 2GITA 3NACH 1TMCB 4NC0B 5DI8B 4JFFA 3D3VA 5DK2B 1TVHB 1OM3L 4TTGA 2PXYA 3SCSA 4U49A 4R4FL 2HLFC 4P5TD 4ZUVB 2P45B 2DT1A 2CLVA 3PGCA 2X6MA 1EAJA 2R9HD 3OGVA 3OIHA 1K9EA 2XVKA 5C0CA 2OL3H 2VI0A 3RQ3A 3B9KA 1BVNP 5I16A 3SUWA 4XAKE 4PJIB 3QUML 3Q0HA 5EC2A 2UZIL 5IW3A 1CLOH 2EO1A 4AIZA 3EIFA 3P9MB 1YN7A 3QI9B 3F5WB 1RFDL 4JRYD 4PJGF 2VL5A 5LKNA 1C92A 4AM0A 1MFCL 1LL7A 2BNQB 2Z92A 4LFHG 3GSRB 2ATKB 3BYYA 4I3SH 3RWJB 4PSRA 4ZPTA 2NY4C 2PYEB 5LXGL 2YWYA 4KV5F 4K94C 4LFHD 3RWFA 2FGLA 4OI9A 2A6KA 1VFFA 5BMFH 3HPLA 3H3PH 5AYUL 2IBGA 2WKLA 4TVUA 1CL7I 4HIXL 3D1MC 3U83A 3GGWA 4DFIA 4FLSA 3MJGX 4Q9QH 1N3NA 3FRPA 5HI3C 1ZLVK 1MYRA 1X5XA 3NCBB 2VVNA 4FQIH 1LO0H 5GGSA 4UQ9A 3KHQA 2BOCA 2E7HA 2GJ6A 3QIBD 4Y4FA 2WVVA 4X7EC 3WN5A 1JWUB 2B0SH 1ZA6B 4FNLL 1QFUH 5C8JA 3ZR6A 5IW6A 3CXDH 5F9JB 4HZLA 4P4KD 3WSQH 3RGVC 5LQBH 5DLML 1FN4A 5DO2C 3MBEC 2HTLC 2QSCH 3ZOAA 3L3IB 1JYWA 1DBMH 1AXTL 4PR5A 4R7DA 4PJDB 1OVZA 4P46D 3C6SA 2JIXD 1JHTA 4FQCL 4HWEH 5EOQH 3REVB 1UKTA 3O9WB 1E6QM 3A3HA 3BRDA 1E71M 1OCQA 1TZIB 1CCZA 5DJ6B 4AYFA 1S7WA 1SY6A 2E7LC 4UT9L 4FQXC 4G8GA 4N0YL 3WO4C 2X1PA 4XNYL 1GHRA 2OWCA 5JBDA 5F7MC 1WFTA 4Z7WA 1RZ7H 4UDUA 3IB4A 2DQEL 3K8LA 1U8HB 4FTVE 1NAKH 1ITBB 2NSXA 4AT6A 2DLFL 1DQJB 1M7XA 5DURD 3CJJA 1LDPH 1FFOB 4NRZA 1H3UA 3NCOA 3BO8A 1P4IH 2ADGA 4H25A 5I0ZA 2XPGA 4P23A 3CFKA 4JFQA 2GSIA 1J1PH 4WO4D 4NQCA 4TVPH 5T1KA 3WS3A 1VKXA 1UQYA 5IFHH 5BQ7B 3OF6A 3O2WL 1DFBL 5FUCE 4XPGL 3HI5L 3QXVA 4ZXOA 1F90H 1H3PH 4FS0A 5JBEA 4IIQB 4ZFOA 1ONQA 4ODUB 2J47A 5ALCL 4WW2A 4JY4A 3BN9D 4EN3B 4Q7NA 4QRRE 1MIEL 5CCKL 2HFFB 1MCFA 3SCMC 4XCYA 1TJHH 3E6FA 4FLOA 5IT2H 1OBAA 4FQJH 4UT6L 4YHPA 5ACZB 1Y7VA 4EI5B 4P8XA 1ZS8A 5IFTA 5DGRA 2LV4A 2NW3B 4E2OA 1ORQB 4AD3A 1YEIH 1PBGA 5DFWH 3SBWC 3VI3E 5F89B 1G6RH 4UTBL 1CFBA 1KNOA 2DIBA 2DIJA 4IDJH 5DDHB 4QCIB 3OPZL 5CEXB 5IGXH 3WDJA 2VDOL 5LAXB 3SUSA 3NSXA 3UDWC 3IT8D 2O26U 4IRZL 5E8DH 1HH9B 1A22B 3EO0A 3TESA 2X4TB 5CIPH 3QUZC 2F8OA 2CIKA 1D2KA 5EZOH 2OSXA 1J5OL 4IEFB 1S9VB 4XP5L 2D0GA 2V2WA 4N0UE 4P5TA 4PPTA 2Z4QA 4RNRB 4XAWH 1E6OH 3PWPB 2EDTA 5HY9B 2O5ZH 4OAWB 5ERWA 1TFVA 1NBYA 4IMKA 4R4BA 1JPGA 4XPAH 4UTAH 4QXTB 1LEIA 4RRPG 5D9SB 1TVNA 3ZJ6A 4RAUA 3DBXB 4OSUH 4JRYA 3KHOA 5CINL 1SEQL 3IDUA 2MWCA 3WXWH 2F8XC 5M7QA 1CLXA 3QEQB 3GSNH 2P8PA 1QOKA 4ACZA 4YE4H 4TTDD 5D2LF 4GG6A 4RMWA 1XH1A 1BIIA 1GIGH 1VCAA 3F8UB 2W4XA 2G75B 4LLVB 2OJZH 1NCCL 4K3JL 4Q2ZA 3HZKA 3D5HA 1DE4A 5L8KB 4OCYH 4QTIL 1M4KA 1NGPL 3CFDB 3QULA 2EO9A 4JJ5B 3AHZA 1ZHLA 1KBBA 4PJBA 5FA3B 1IGMH 3O41A 3C60C 3SCWA 3DYMA 4MJ5A 2AKRA 2B7DT 1FH8A 5DWUL 4K9EC 4YUEH 1YEHH 3VFGH 1DBKH 3FL7A 3DVGA 5I17B 1LP9F 2HP4A 1IGTB 3FOLB 4Z8FL 3ZYOA 5C0EA 1ZT1A 1JNHA 2DD8L 3QIBA 5D9NA 2WCGA 3I6LD 3HRZB 3VH8A 2R29L 3QEUA 5F7DB 2ESVD 4JHOA 1S7QB 2GHWB 1XF3A 5HI5C 4P4KA 1OSPL 1X6NA 4ZD3H 1UZ6E 1XMWA 3BSGA 3CHDA 3X14A 2D3LA 4P7LA 2M1KA 3PZIA 1QNZH 5FYLE 4K3GA 3QNXB 1QO3A 4AL8H 4ZXBB 4P46A 2MANA 2EH8L 2JIXA 4J12A 1HQRA 1CDBA 1IQDA 5GISH 4HKBB 1UUQA 3MRFA 2F58H 4H41A 2HH0L 2JCCF 4JAMA 1SJHA 4NKIL 2ICEA 4WCYL 3D85B 1HOCA 4XXCC 5GSVA 2Q8AL 1H49A 3UEZA 3VILA 3S37H 1YDPB 2O9RA 4YDJA 4W8BA 4CMMB 2VXVL 4LKXA 3GMPA 5T5NF 5B39B 2BC4B 2DTSA 1BFSA 1YNKL 4JANA 5D7LB 5BOZG 2HA1A 3LH2L 3JTTB 1G84A 4NRXB 3B43A 2PW2B 3IF1A 1JGLL 1H8NA 1I9IL 4XNUH 3V6OA 2UWEA 1WZMA 4WO4A 1PG7X 3FQWB 3BQUA 3AAZA 4JPWL 5E2VH 5FA4B 1FQ9C 4NJ9H 1HHJB 2WVSA 1RUQL 4PRPE 3N1PC 4WFHE 1BJ8A 3FHQA 5J12C 3O6KL 3C8KB 1SJXA 2BHUA 4KVCH 3JBG7 4OGAD 5F6IB 1UR0A 1IJ9A 4DM1A 3PIQB 5JW3L 4LU5L 3HAEH 1SY6L 1YY8A 5B3NA 2GK1A 3R06B 2C4XA 5KANG 3M8OL 4IRJB 4FQHA 1JF1B 4OZHA 3ZE2E 4AQOA 3BPOC 5ADPH 4PMQA 4JFHD 1FORL 5LBSL 4MD5B 1BF8A 1V3MA 1WBYB 3W9DA 1UM5H 1QQDB 3KDMB 5IVZA 5IBLC 4XNZC 3WKMH 3FQUB 2MCG1 5HVHB 1P4LA 4J3UA 1ZMYA 2NLJB 1MPAH 3VGEA 1V6WA 1JNNL 4IOSD 1FNAA 1PDKA 4PB0L 4OKDA 5INDA 3N1QC 1OHQA 3HNVH 4ONFH 3U1SH 4TRPH 1W9DM 4NKMA 4CN1A 4HKZB 4R8WL 2YA1A 4DKFH 4UILL 1RHHA 2CRMA 1H15B 3B9EA 4ZFOL 1A1NA 3T0DA 2H3NB 2VR9A 5DJDB 3KXFE 3L7FA 1HSAB 3K0WA 5HDQH 3OJDA 4UZGA 3FT2A 4PJ8B 2OTWB 1S5IH 3EZJB 4PMRA 1W3KA 4PJFB 3VVGA 3EYSL 3BJLA 4E41E 4Z7NF 1RP9A 4Y2DC 4Y4HB 1E4NA 1M7DB 4OGYL 2Z8SA 4Y5XC 3U7BA 5C7XL 2W9EH 5IIEA 2XXMB 3T2NL 4MJ6B 3VI4E 1KB5B 4RRPA 4JFDD 5I76A 5IMOA 4I13B 3TZVB 1R5VB 4UQAA 2GJXA 1IGYB 4NSBA 1EUUA 5IQ7L 5CP3A 4XCCH 2AJZB 3LB6C 3U6RB 5D8JH 1UB5B 4D2NA 2VDML 4K8RC 1KCRH 3QCUL 4LCCA 3MRIB 1FV1A 4MQXC 4DGVL 1MH5A 4XP9H 3HC0B 1EXUB 1KPVA 3K3QA 1JN6A 3RPMA 4OZIE 4L3EB 3OMZA 1CGWA 5TQ2H 3LPWA 4M8VA 4F80A 4Y19E 3MRRA 1V3KA 1L4IA 3L95A 4EI6A 3W82A 2ESVA 3QO0A 3CDCA 3LMJH 3GK8L 1AGBB 1U8OB 3WD5L 3S6TA 4BZ2L 4X5WB 1LHZA 4D0CA 1UEYA 2E9LA 2VDKL 3U5UA 5B4MC 3WNKA 4ZNEA 4L9LB 3QJHA 1K4DB 1P6FA 4CMHB 2BY0A 1S8DA 4KK8C 5E09A 2Y5TA 3MLZL 3BXNA 5LWYL 4OLWL 4BFEA 4WI4A 5L7XH 3J7HA 3NCEB 3L5JA 3CU1A 1RK0A 1ACZA 2ZWLT 4R4FH 3GIVA 4J8RB 3N1MC 4AIOA 1Z32X 3LVEA 3SDDB 2YBUA 1TZGL 3C09B 4IJ3C 1AGEB 1FYTB 3LEVH 4UBDC 4M61A 3VXMD 4JFPA 2CKBA 4YHKH 4KKNA 3DSFL 3ARDB 3T4AA 4LDOB 1IQWH 1LEKB 3K81A 4NOFA 3MV9D 5D93B 1G7LA 5GNXA 3D69A 5DJAB 5GRJL 1S9XA 1K4CB 3VIHA 4TXEA 1RFDH 3LHPL 4U6YB 4Z7VB 1W2PA 1VGKB 3ZKNC 1MFCH 1QA9A 4RMUA 2Q20A 4L8SC 4MB4A 4QRSB 5AZEL 1FZKB 4GAJH 4R3SA 5BROA 4OGXL 1W9UA 4FOMA 5K9QI 1V6XA 4CD8A 4N8CL 3GJFK 3C5ZB 3NCCB 2C7UB 2FSEA 4HA1A 1V0KA 3ECQA 1KXQE 4F66A 1VGEH 4YNYB 5D5ME 5K9JH 1MLBB 3QIWC 3U7WL 3WFHB 5AYUH 5MEPB 1FVEB 1D5BB 1T3FA 5BRQA 2XTJC 5LJYH 2QR0B 4ONGH 2NXYD 4ZUWB 3C5SB 3RILA 4HIXH 4J1UB 1OTUD 1I7RA 3QR2A 2IADB 3AISA 3WIHH 4M8QA 2NT0A 1WAWA 3QG6A 4QYOB 4R0LA 3ARZA 4D8PB 4TYUA 5JR1H 5EU4B 4HJGB 4ZFFA 3RWEB 2EPKX 2PO6D 3CCHB 1XH3A 3WFLA 5A69A 4L4TD 5F8QC 4KKLC 3SQOL 4AQ1B 1UB6A 5TPWH 1RUKH 1UKSA 4ZODA 1ZA3B 2MSPA 4H1LH 5I75C 3MJ6A 4W8LA 2O61A 4QHKI 3UXFA 3AYSA 2XJ7A 1F4XL 3G04B 3PWVB 4QGTA 4FXLA 3S36L 3F62A 1FSKC 1P7QB 4HKJA 1I1FA 2GYSA 4MAYC 3MLUH 4HDIB 5IVXA 3E3QC 2OTUA 3OKMA 2X7LA 1D6EA 3MRKA 1J88A 4Y5YC 3GMNA 2GUYA 4UV4H 3T65A 1IAII 2DLTA 2FX8L 3MACH 2AXJA 5GGUB 4U1SA 5IJKC 4N0YH 2PW1A 5FKPB 2IAMC 3WF2A 4WJXA 4YEEA 1EOKA 1OL0A 2DIAA 2WNGA 1IEAA 3BWAA 5T5FH 3GMQB 5JNYA 4XXDA 2AJVL 4PJ5E 4O58H 3AROA 4JFDA 3MKKA 1OGAB 1M71B 5I1GL 3CD4A 4RGMC 1MCKA 2XVNA 4FXKA 3ZSTA 4C7DA 3O2DA 4TSAH 1QFWM 1HWGB 5MEND 4W70A 5I9QB 1S5HB 3MOQA 1JK8A 3JV4A 3GJFB 3H0TB 1XEDA 3BMWA 4XPGH 5BXPA 5E4EB 3HI5H 2HKFL 2ARJQ 1R87A 1W2VA 3F7YA 4G8IA 1EUTA 1Q0XL 5DRZB 5C3LD 5ALCH 3QDAA 4ODWB 1JXJA 2QV2A 2J4WH 3EBAA 5LGJA 4YR6B 3F65A 2WBJB 2O5YH 1MIEH 5A6SA 2ORBH 3OG6B 5TDNB 1W3HA 5FCUL 1FNLA 4PGZA 5F88B 2ZCLH 2VKXA 1NKRA 3IGAB 3L4YA 4Y5VA 2ICWB 5FCZA 1TXKA 1U9KA 4P2QB 4M43H 4PG2C 4WHYH 1X5KA 4PTTB 3GO1H 4BQCA 5E2JA 5DQJA 2OR9H 4X4XA 2NY2D 1HN1A 3CDYA 1UCBL 3OPZH 4LVHB 3KPMB 1HEZA 4KK5C 2HVJB 2W0LA 4LSDA 3T0EE 3DLQR 5C08B 2G3MA 4FABH 4L8BB 4PIRF 2JLLA 2Q6WA 2F54B 3UTZA 2GK0A 2VX6A 3WEMA 1ZU8A 3QI9C 5IESL 1T1XB 2VLJD 1F02I 5ANMB 3TN0D 1J5OH 3WFBL 5T1MA 5EU6B 2CPCA 5CZVL 1S7SB 1I8IB 1JIBA 4JO2H 2J7HA 2AJUH 3VXMA 4WFGE 4NGHL 5ESAA 4J28A 2Z35A 4B15A 5KSAB 1TZHA 1VESA 3MV9A 3VXNB 4TULH 1RJYA 1R3KB 4J3OC 1QYGL 4YBHA 1NARA 5I1AB 3ORJA 3ZYIA 2XTJE 3BVNA 3PWUB 4JQVA 4OFVA 3ARED 1P9MC 2C8NA 4CNIA 4HGMA 3DXAD 4HOXA 5H35B 3NZHL 2R2BA 3HZYB 4K3JH 4D9QD 5JMOC 3CUJA 3E2HC 1CE1L 3AGVA 3SDCD 1JGVH 1BWWA 2ZOLB 2IF7A 4NNPL 3V52L 4XB7A 2CBJA 1CG9B 2R2CA 3D39E 2BRQA 4QRPD 2VC9A 5DWUH 4UTFA 3ULSB 5F7UA 1J8HE 1ISYA 1D7FA 2CKBL 2X4PB 3HA0A 2PO6A 2DD8H 5A43C 3BRGC 4L4TA 4KC3B 4MMXC 5EBWB 5IBUB 2PWHA 5EBGA 3JWOL 1B3WA 3BC9A 4NZJA 2PBGA 3O9WC 1ES0A 3OKKB 1UVQB 3EHBC 2F9BT 43C9B 2VZ3A 3K2UL 1HI6A 3GHEL 2AGJL 5JZ7C 2Z93A 1GZPA 1GGUA 1OLLA 3MRDB