4HMCA

Crystal structure of cold-adapted chitinase from moritella marina
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
528
structure length
528
Chain Sequence
b'GTITSQDDNVVVGYWHNWCDGRGYQGGNAPCVELKTVNPQYNVVNISFMKVYDIAEGRIPTFKLDPTIALSEAEFIAQIDTLNSQGRSVLIALGGADAHIELTRGDEDALAAEIIRLTDLYGFDGLDIDLEQAAITAKDNQFVIPAALKMVKEHYRKTGDNFMITMAPEFPYLTANGAYTPYLTELDGYYDFINPQFYNQGGDGLWIEGVGWIAQNNDALKEEFIYYIADSLINGTRNYHKIPHDKLVFGLPSNIDAAATGYIQDPQDLYKAFDRLKAQGQPLRGVMTWSVNWDMGTDAANNSYNQQFIKDYGNFIHNQLPPVTDMTPTLSGIVDTRVELDSHFDPLIGITAKDYQGNDITADVTVSGSVNTNQVGDYLLTYSVSSDDETTNQPRKITVYEILPAFTGITDTTVVIDSEFDPMQGVSASHPTQGDLTANITVTGEVDTNVVGVYELTYQLFYGQDNQQNMTDKRIVTVVTDAVSDDDWQVGSTYVKDDKVTHNGATWTAQWWTKGEEPGTTGEWGVWR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chitinase 60
publication title Structure of a complete four-domain chitinase from Moritella marina, a marine psychrophilic bacterium
pubmed doi rcsb
source organism Vibrio marinus
molecule tags Hydrolase
total genus 167
structure length 528
sequence length 528
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2012-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
A PF16403 DUF5011 Domain of unknown function (DUF5011)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.20 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Carbohydrate-binding module superfamily 5/12 4hmcA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hmcA03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hmcA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4hmcA01
5KG9B 3JTTB 2VLRE 4AQOA 1QHOA 4Z78B 3N06B 2AGJL 2NY2D 3TBVA 1CPUA 4ORGA 2IGFL 2WWDA 4MQ7B 4KKBC 3JV0A 3ROLA 3VXUD 5CQ1A 4U1LA 5JA8B 1FYTD 1FNSH 2WB5A 2CKBL 3PQYA 2K9UA 3U6RA 3O4OC 1UR8A 4N8VG 4L5FH 3CZKA 2P4AB 4PMDA 1FYTB 1WF5A 1G0YR 2W9DL 3PV7A 1FNAA 5SWSE 4JAMA 4ONOA 4WI5A 3UYRL 2Z31C 3O6KH 1K4DA 4UT6L 4I9WE 5I18L 4GI6A 2C5DC 1IFHL 5JOEA 1QKZL 1E6OL 4U5KA 5FUZL 3FCTB 5DZOA 4MQSB 4QCEA 3VA2C 2KKQA 4R97C 4FZ8H 5EBMB 1MFAH 3OKLA 4JKMA 4TRPH 5TE6L 5JIWA 1MCOL 2HTLD 3PHQA 4J3SA 5IIEA 3ECQA 2NY5C 1MF2L 3NH7H 3VI3E 2YEZA 3DYMA 4ZTOH 4WI7A 1S7QA 5CEZL 3ZKMD 3M6DA 2WK2A 1OD8A 4YHGA 2KQNA 3H7LA 3IXTA 3VIFA 1OW0A 3VXRD 4W8AA 1RUAL 4N0RA 1L4IA 3BPOC 4NQXB 2WMFA 2ZWLT 4D3CH 1KF9B 4LPVA 4OLVH 3VD3A 1QBBA 3DX9A 1A64A 5B8CC 4HBQA 3VXRB 3WEOA 3V6OC 1S9VB 1YEDB 1S7RB 2B2XH 4QCIA 1ZWIB 4PRPD 5IJKA 4C83B 2Y36H 3L95B 3FRUA 5EO0A 2FBOJ 3UTQB 4Z8FH 3OZPA 5IHRA 1E0WA 4P2RE 5EUKA 3RUGA 5AD0B 4QOKE 3T0EC 2YPLE 1TCRA 1U8PA 1OVZA 3AM8C 5CIPH 1KYOJ 2OWCA 2RCSL 3THDA 1K3ZA 4F9LA 4H88H 3SO3B 5LGKA 1SJXA 1UZ8A 2AJVL 4MZ2A 5CJ5A 4WJXA 3PZNA 3DROA 3EYQC 1QP1A 2EPKX 4PSRA 4GRWB 2A77H 4ODWA 2B0SL 3NZHH 4EI6A 3C08H 4IRSA 4B5EA 5DLMH 4ZMAT 1U8NA 2PO6A 3S4SG 3HNTH 4E0RB 1HKLH 5IG7A 4L5FL 3AREA 1ISZA 1MWAB 4OBRA 4LL9A 2XFFA 2D9QB 3O6KL 2VAAA 4NQSA 1KR0A 5GGQH 5IVXE 4P8XA 4Y2OA 2MCG1 5IR1A 5CGMA 2NY4C 2V5SA 4FZ8L 4HIXH 3BX7C 4JQVC 3OJDB 3RHWF 3QGVA 1MFAL 1KJVB 1I1YA 2ZKHH 1FFNA 4TRPL 1T1XB 3RA7H 3UTZB 4HLJA 1AJ7H 1E6RA 2GW5A 1AQ0A 5IMMB 2OWWA 2B1HL 4H0IA 2G60L 3NH7L 1JWMB 3MNZA 3O0RL 4ZTOL 4KK6C 3ZDZF 4UFIA 2AABL 4R4NC 4Y5VC 3WMBA 5BRZA 4KKNA 2IAMD 3U2SB 1PKQE 2DLHA 4KK5D 2D3NA 5TDOB 4RGOL 5I16A 1X4XA 2W65A 2YKLH 3MBEC 5DF0A 4D3CL 1BQSA 1MAML 1EEZB 2WMGA 1P7KA 4KJPD 2IAMB 3ZQ9A 4JRXD 4WW2A 4AZ6A 3EYSL 2ZUQC 3UTPE 2R2EA 3T3PE 4FFWC 2Q87A 2Y9RT 3FB5B 4Z8FL 1JXJA 3DO3A 4WHDA 3NOIA 2YBTA 3NPSC 2YD2A 3W0WD 3CHFA 3FQTB 1I7UB 5EOCH 1WV7T 2CEQA 4LHQB 5I6XC 5E0QA 4NZRH 3QIUC 2YPKB 4ELMB 1D9KD 3CH1B 2VC2H 4FQHB 4WU7A 1LO5B 1OL0A 4YHOH 4H88L 1LF1A 4DFHA 4ZFOB 3W0WB 2WHLA 4P7NA 3QI9B 5KSAC 1J86A 1PX4A 4HZ8A 5K33A 1JI2A 2ARJQ 1MXDA 1D9KB 4KI5D 1I8IB 5CBAB 4OUEA 3ESUF 3U79A 3C08L 1SM3L 1ITXA 5DLML 4CGTA 5TDPA 3BP6B 3PWJA 2CBJA 3HNTL 1ETZB 1HKLL 4WJ5B 3ALFA 1OGGA 5F7KC 2X5PA 2ORBH 5DT1L 4G9FA 2J12B 1W8NA 2NTSP 2VLJE 1DBJL 2ATPB 3SY0B 3MANA 5CD5D 1ZHLB 4NPYA 4L9LC 1HNGA 5CLTA 1NGPH 1RSFA 1T66D 3H9SD 3PHAA 4NKMB 1G9MC 1BLNA 5HGHA 1MW1A 1YEKH 5GGQL 3CX5J 3UETA 12E8L 2D7TL 2J75A 3VCLB 2OR9H 3QRGH 3PZTA 4J3VA 1KJ2B 2CIIA 2A83A 1MFBH 4ODUA 3H9SB 4HIXL 3BUYA 2ZKHL 3IFOA 5EBLA 4EN3A 1LK3L 3V8OA 3IAPA 2H32B 3LKSA 2BCKA 2EKSB 2WC3A 4XB7A 3WE6A 3GNPA 1NBQA 2AJYH 1W2PA 2DI8A 1R7AA 1U3ZA 2QLVB 3QQ9C 3LQMA 2DYPD 3MV7B 1JV5B 2CD0A 1SVCP 2NYYD 2YKLL 4G43A 3TFKC 4LF3A 1TVDA 2I9LA 1FCCA 1LEGA 2J3SA 2XFXB 3EDFA 4LYPA 4HK0B 2XG4A 5M5DA 4MNQE 3NYDA 2DYPB 4JM2B 2F61A 4F58H 1X44A 2YD5A 5IW6A 5C71A 3IKKA 5EOCL 2Y7QB 2P5EA 1NGYB 4RIRA 2BS9A 3ILQC 4NZRL 2VC2L 3OG2A 4L9DA 4QNPF 3B2UD 4YHOL 1Z0NA 1GYAA 4B9ZA 3TBSA 3TIEB 2A38A 4ZUVA 3RMEA 1BFVL 2EYRA 5GRWA 4I2XE 1MCWM 4ZPVB 5LXGL 3HE7D 3ARGA 4JHAH 3PF2A 5B39A 4M8VA 5F88A 2O26U 3AXXA 3QUYA 4L8SC 1I1WA 3L3DB 1RHHA 3FQUB 4ZQKA 1F3DH 3HE7B 1H8SA 4J3WA 4S3JA 4XBGB 2ORBL 1JPFB 2WBWB 3JWOH 1VHPA 2Q76B 3CMOH 1L7TL 1QBMH 3MJGX 5FUOH 5GZOC 5CXPA 5KVMC 3O3AA 2DLFH 4HS6B 1YEHH 4L4TA 3QNZB 1NGPL 2OQJB 3PL6A 4KRNA 5BQ7B 1JDDA 4DUXA 3GNOA 4W7WA 3WFBH 3L3GA 4M8QA 4GPNA 1LD9A 2VXQL 4QWWD 4Y4FA 1YEKL 1RIVL 1U8HB 4HW6A 4P2OD 3M45A 2BVDA 2OR9L 3QRGL 4BA8A 3WF1A 1IGJB 4MZ3A 1MFBL 2BFGA 1W9VA 1NC4A 1OTUD 4Y1AA 1P6WA 3VM7A 4XPFH 2BP3A 4XI5C 1EVUA 4LOUD 1KTRL 1JRHI 5CP7B 3VXTA 2IH3B 4NO2A 3OA5A 3IXAA 3LPGA 3CVHL 3PJSA 3AB0C 3UROR 1GOWA 1JGIA 2AJYL 4Y19A 5DXWA 4YLQT 1RZFH 1ZHKA 4I9WD 1G9EA 3R1GH 1LG1A 2DB8A 1CFSB 2Z91B 3GSRA 1GJWA 2QSCH 3C6LC 4JZ5A 5EC2A 4I1NB 3UPRB 5IK3B 1E1FA 4Z76B 1QLFB 1EZVX 1WLHA 1XCXA 2WC4A 4LEOA 4OGYH 2QHRL 5BXTA 1KGXA 3PDOB 4F58L 5GRXG 5JOFB 4MDJB 1QI2A 3IETB 3IFNH 3C5SA 3RUGF 3VTRA 4OT1H 4J27A 4NM8L 1DQLH 5FYLD 3QQ3A 1E4NA 5EUOA 1V02A 2HTKC 2ZXDA 1QTYT 4N0FB 2IMNA 3RBGA 1XGRA 2BVQA 5EPMA 3VFNB 1B31A 1QLRA 5DI8B 4HULB 4JEGB 2FJHA 3QO0A 2DH2A 2D23A 3D85D 1SMDA 4LCUA 4Z7UE 3OBAA 3RIFF 2D3LA 4XCNB 3WD5L 3L2LA 1CDGA 1BQHB 5C9KA 1E15A 2WIIA 3QULB 3BP7B 3Q1SH 3KWWB 5GSRA 3EIFA 2A6JB 3HMXA 3RKPA 1HK6A 1E71M 4V28A 4YQXH 4PY8J 1DVFC 3VFSA 1C8YA 4G9DB 1NBVH 1S7VA 3LN4B 4TNWF 4OZ4A 4XNZB 5IP4A 2YPLD 1Q1JH 2FIRT 4R7NB 3CMOL 3CZFA 3BEWA 3GIZH 1QBML 4NFBA 3WUGA 4Y5XA 1IEHA 3WJLA 2DLFL 5H94B 3B9AA 2HFTA 5ISZB 2FIKA 2IADB 1YEHL 2Y06H 3ULSB 4GG6E 3GGWA 1LE5B 1KT2B 2MSPA 3N9GH 2CSPA 4JZJC 3S4SA 3WFBL 3G04A 5LVEA 5EZJB 1TQCB 1QSEE 2O5XH 3UBXI 3D3VE 1QSFE 4MADA 1ISYA 2WW5A 3VFVA 5I66B 1VBUA 4C57C 1LDPH 5LGJB 4O2EB 5DC0A 4PLJC 1P84K 3BD5A 1GOGA 1JI1A 1YYLH 3POCA 2ZJSH 3RGVD 4RMWA 4XPFL 2DQEH 3BFOA 3ALXA 3RI5K 3WF0A 4DK3A 3GMNB 1GZQB 4D6DA 1PLGH 5ILTL 3GMOB 4KFZC 2HT4C 5H2BB 2HLAB 4WTZA 1H5VA 1RZFL 4XHQA 1NBZA 2Q7NA 5D9OA 1UENA 3R1GL 4MJ6B 4NUJB 3SUSA 3B9KD 2QSCL 1FP8A 4XX1E 5DWUL 1J0YA 3RWFA 3UP1A 3SJVB 4PIRF 1VPOL 3MFGB 2WCSA 4U6XB 2GCYA 1JNHA 3MUZ1 4PJAA 3G08B 3UCQA 3B9KB 5ALCH 4GW5A 2WW8A 3WQ8A 5ELIA 3QXUA 2OSWA 3IFNL 1VKXB 2V2WB 4OT1L 2MQCA 4PJIF 4MJIA 2ZOLA 1EUTA 4PJ8D 4RQQB 4GRMB 5EBWB 4WFGE 3PZUA 1TIUA 2EE3A 3VJ6A 3ZDXE 3RZCA 1FZJB 2DQGH 3HZYB 2BOBB 5ECUA 4TTUA 4WEBH 4DZ8B 2A3HA 4PUEA 3GBLA 4M4PA 1Z3GH 4DEPC 4HBCH 5JQHC 1J18A 4IS6A 2X1IA 3HC4H 4JJHA 5BVJA 4Z7NE 3TYFA 3DVGB 1WITA 1N59B 1G7QA 1JVKA 1OGTA 3OKKB 3L3IB 3MRMB 2JALA 4R0LB 3HNSL 2NMSA 4YQXL 5EZLA 5K9OA 2BNJA 2HTLC 1KCUH 1PDKA 3IB4A 3AHYA 4K7FA 1Q1JL 4MDIA 2Z8WC 1I3RB 1DDHB 3W25A 3MLRH 3ZKMC 4JE4B 4RE4A 3GIZL 5EU6A 1FFRA 3O45B 3MNWB 1H3PH 1WBXB 3KL5A 3N1FC 2Y06L 4PR5A 5IVNA 3DUSA 2CERA 5EIIB 4QRRA 3P4OB 1DQDH 2E9IA 4OF3A 4ML4A 1CWVA 2BMKA 4BF7A 2O5XL 5LCVL 3UESA 1KTLA 4P5KB 4ETQB 3SGJA 1KNOB 2NY7H 1WCBA 1BM3H 4U33A 1JWUA 3OKEB 4P5TA 4LSSH 3FOMB 1YYLL 5CJQL 1JTOA 2ZJSL 3Q6FA 1U92B 3SO3C 5CEXA 3OLDA 2C3HA 2DMKA 4XPTL 2X40A 2QKIB 4P2QE 1GOQA 2V3GA 2VLJD 1AKJA 1DUZA 3CUPA 1E6SM 1PLGL 1LLOA 1DQQB 4CVZB 2IC2A 4JVWA 3TNMB 3U4BH 3KL0A 5AYQA 2BNQE 3P4MB 4N0CD 4BQ9A 2A6DB 4Y16A 5I8EA 5D5ME 3NCYS 1ZLSH 1V05A 2ZCLL 5D7LE 1XR9A 4X7EC 5ALCL 3DV4A 4JFOB 3JTSB 3PWNB 4D8PB 5FYJU 2DQHH 1KYOK 2J88L 1OGSA 4DQOL 1GC1C 2ZNXA 2OX5A 1K8IB 4IMLA 1MHCA 2YK1L 4LHUG 4UU9B 4WO4D 4PP2B 2XIBA 2DQGL 4H0GA 1E55A 4HCRL 5D72H 1FFPA 2BSRB 1YY9D 2O61B 1Q8MA 4J8RB 1Z3GL 2WWMD 3F7VB 3PWVA 4HBCL 4QXTA 2PYFA 4WO4B 4MNQD 3C60A 5IB2B 1KBBA 2DT2A 1BZ9A 1C12A 1I9EA 2DQTL 3NFNB 3RAJH 5BRPA 4CADA 1FH7A 4N5UA 3NZ8B 5ID0A 1KCUL 5D2NA 3B3IA 3D69A 3MV9E 5DJ8B 1FHDA 1TVBA 5E8DH 5I1CH 4H8WC 1GIGL 1IILE 3HAEA 4LU5H 4X0VA 3GO1H 3DGCR 5EB8A 2IAMC 2GUOA 5F1IB 4LLMB 1LO3H 3KWXA 3RNQA 4OZIE 4X8JB 1OQXA 5I1EH 4WKFA 3PXJA 1DQDL 4KK5C 4HPYH 3SKMB 4WI6A 3MJ6A 1F8TH 2UWEB 4KJPC 1T4KA 3DPBA 3GSOB 4KGJA 1VADB 1G6RB 1XYFA 3VXPB 1BM3L 4WLCA 4OOUA 3VXOA 3WQ5A 1NGWB 4LSSL 3SBWA 4BQ8A 4UINH 3GNRA 3RX7A 4LBEA 1L0YA 3LS4H 3QI9C 3EMCA 3WLWC 3GUTB 3RDTD 1U3HA 4MAZA 3TBTB 4P57B 2X0YA 1D9KC 1W1YA 3MROB 4AM0A 1XIWB 5E2WL 4N1HB 3K8KA 3O4LA 3OPZL 3RDTB 1B6DA 2PR4H 4NHUB 4F2MA 4KI5C 1BD2E 4Y5YB 1H3TA 5C0CD 5A6LA 3HU7A 1CFQB 2I5YH 4LASL 1ZLSL 1E72M 4H20L 4OCWH 1HCVA 1T0NA 1M7XA 4URIA 5C0CB 4J4PA 1JRHH 2CH8A 5EUOF 2RTSA 3CDYA 4DOHB 2EH8L 1CBVL 4OKVB 3I6GB 1RK0B 1JNEA 5INCA 2IPUG 3FT3A 3MC0A 4K7PY 5CD5C 4JRYE 1W3HA 2DOCA 3S35H 1BHGA 1S7XB 2CDEB 2PTUA 4TNVK 3BMWA 2AEPH 3EO1A 4M6NL 2YL9A 4MNHA 1NOUA 5D72L 3CK0H 5HGAA 2QQNH 3MS8A 1HJQA 3A4WA 2E6PA 2PWDA 5AAMA 3VD7A 4JFDE 4N1EA 4Q2ZB 4RAVB 3WFLA 1XH3B 3NCFB 3RAJL 1RUPH 3IU3B 3RVWC 3BGMA 1B88A 3L3HB 4U1SA 1Q0XL 1RQ5A 3T8XA 2B4CH 5E8DL 5I1CL 1R3KA 2V5MA 3WL1A 3FFCE 5KVFH 3GO1L 1KBGH 3DX6B 1BAFH 1LO3L 5ETUB 5KZCD 4MNGA 2XM1A 5I1EL 3F6LA 4JM2C 2R29H 4HPYL 1ZVHA 2GJZB 4LCWA 3CX5K 4R2GD 2NYYC 3JV6A 1F8TL 2ESVE 2CKBB 32C2B 2AXFB 3O11A 4ZUWB 4JO3H 3KYNB 4TSAH 3F6IA 3NFPB 1BVKA 1H4PA 2P8PB 2G41A 2WHKA 4KMTH 2A6KA 3GI9H 3OXSB 3GSUB 3LS4L 4FMKA 4YBQD 1C7SA 5DJDB 1KLUB 2FYYA 3RU8H 4EDWH 1UYQA 3BAIA 3L4UA 2X4TA 1NCAL 1H9VA 4G6MH 4JFFD 4EAMA 2PN5A 3TP4A 5A2IH 5JUVA 3ULUL 4QHLA 5CEZD 5AYBA 3PZ9A 2PR4L 2C1PB 2EDLA 1C5DB 1PG7X 4JFFB 4R26H 3D3VD 1ESWA 3HE7C 4PJXB 3I9GH 2I5YL 5IXEA 3MRGB 3D39E 3DURB 4PJAF 4QT5A 4FTVE 4OCWL 1OSEA 3E1F1 3T0XA 4UDUB 3UYOD 4W4OC 2G5RA 4UDTA 3BO8B 2D0FA 2R0KH 4H5SA 3VRIA 2ZX6A 3T2PA 1JRHL 4JHWH 1CU4H 4UT7H 2G5BB 3IRPX 1QD0A 1W91A 1J8HE 1FH8A 4NKOB 1SMOA 1PQZB 4DGIH 3S8WA 1F3JB 2W61A 3VH8B 1IKNC 5C0BB 5JW3H 5KSBF 3S35L 4JFSA 1QRKA 4I3SL 4DCQA 3GZKA 3KPTA 4X6EA 5JW4N 4I18A 4RGMB 3BDBA 5DRZA 3EOAB 4NO0A 4GKNB 3OKNA 4E5XB 4QWWC 1WBYA 2VMFA 4JPVH 2WBJD 5F89B 3IF1B 3KPQB 3MRCA 4ODHH 1KOAA 3L6FB 2BVYA 5MEND 1AGEB 1OTUC 3CDGB 3L5WA 1WAAA 4WRLA 3BP5B 1RUPL 4U5IA 3LQAH 3CCHB 2WBJB 4MB4A 1XCQA 2MNUA 4I0KA 3ROOA 4JHOA 4LOUC 4GKOA 3QXAA 2MQ3A 2VLLB 1VF8A 3WL0A 5MENB 4WFGD 4ZUTB 4MSWB 1KBGL 4KH2A 3ES6A 1BAFL 2YXFA 2FLBT 4YHLH 5I9QB 4GXVH 4BQ4A 5D93B 2D9CA 1X5LA 2R29L 5HBFA 4X83A 1EEUA 2CK2A 4B53A 1G0CA 1FV1B 3T4YA 1YJDH 4R7DA 3MXWH 5D71H 1WSST 3DGGB 2D7NA 1CBGA 1AO7B 5GRUL 4LDEB 4N8PA 1LO2L 3TGXA 2WYSA 2HFGL 2OSYA 2VCAA 4EQ3A 4U2ZA 2A3BA 1JAEA 4JHBA 3R8BB 4U7SA 4KMTL 3U46A 1WGOA 3BH4A 4QEGA 1K2DA 3GI9L 4WWKD 3VXNB 3AS0A 4XBPA 1J0JA 5GHWH 4CVXB 3RU8L 4EDWL 1GOFA 2R15A 4OD2B 5IW1B 1VENA 5FB8A 2VIRA 4G6ML 1NDGA 1H5BB 3PIQA 4PJ7A 2YBRA 1ZA6B 1LL7A 3ARFD 3EW3B 3QZWA 4HK3J 4F79A 4WWKB 2H1PH 4HC1H 3ALPA 2V7NA 5BVPH 3ZE0E 5I6SA 3KPRE 1K9TA 4R26L 4F8QA 5I1JH 3ARFB 4XNZC 3I9GL 1L0XA 4HIEA 3NA9H 2E7MA 2WVUA 1PBGA 3V9FA 3KS0J 5E6ZA 1NAKL 3WEXA 3WNMA 2JF7A 4BELD 2R0KL 1OB0A 4PLOB 5GXBB 3JVGC 4JHWL 2DKUA 1PAMA 5JDSA 3D2UD 4CDHA 4MJ5B 4F7EA 4P9MH 3D0LA 3QFDB 1V6XA 2BNUA 3MLYL 1TQCC 4DGIL 3WSQH 1HKMA 4W5UA 1HHHB 3IJHA 3ZKNC 3DTXB 3IJ9A 1XRVA 2UVEA 2X4NB 5JW3L 4D0CA 4OFVA 4GAYA 3LRHA 2PB1A 3WLBB 4R5EA 1OAZL 2R0WH 5F71A 3VI4E 5I1LA 4JPVL 4LSUL 4ODHL 3FOLA 5IM7B 3PWPA 4X6DF 3RRQA 3BWAA 5CIPB 1OB1A 3CDFA 4LHUA 4XWOD 4RFNB 3HZKA 5HHOD 3RWGA 1KXTB 1JP5A 4LKCB 3OR7B 4DVRH 3LQAL 4PJBE 2GITB 1IQDB 4HUVA 4UNVA 4MXQD 3T65A 5C7XH 2AEQL 3EDJA 4AEIH 1IGTB 3MRIB 5HHOB 4OOZA 4KPHH 1AGDA 1OD9A 1ZL1A 5K59E 4X4XA 5A8MA 1ONQB 3LKOB 5C0IB 4WDIB 3B9KC 4P5MB 3ZSSA 1CLOH 2VISA 5D71L 4QHNB 3X3GL 3T3MF 1U9KA 2ZE0A 1DZBA 4XAWL 2W66A 4XNMA 3O3BA 4PYGA 1QQDB 3PQYE 4QRSA 1MI5E 5GHWL 4Z2HA 2RJMA 4FQ1H 5HPMA 4XWGH 5J1TC 3U0TB 7CGTA 4LVNB 2PW1B 1DWFM 4DN4L 5JOPE 5A8NA 4HT1L 1QEWB 4AT6B 6FABL 2IXUA 4WUUD 3V6FB 3ZKXB 1NFKA 3WEMA 1FNFA 2H1PL 4IHOA 4HC1L 1UGNA 3NSMA 5BVPL 1A6AB 3ARSA 4R0LC 5AUMA 2OK0H 3QHMA 4FP8H 1DLFH 2XG9A 1CI5A 1IVLA 1BFSA 2X10A 4AG4H 1INDH 4WUUB 1HJXA 1YQ2A 5GGRA 2BX5A 4D9QE 4OZIB 1DLHB 3NA9L 2DF3A 4MMZC 4E42A 2D7PA 3O2LA 3FFDB 3W53A 3QWOB 4D94A 1RZKH 4NRRA 3MREA 5IESH 1S9KC 4LLDB 3CFJB 4PJHE 4OCMC 4NQEB 3WSQL 2G2RA 2Z31A 3VD4A 2WZIA 5JO5B 3CFBA 4WGVB 1ZLWK 1OPGH 4PJDB 4FNLH 1Q9OA 4FOMA 4M6AA 2A6IB 2CUIA 1KN2H 1E4JA 1BD2D 4ODSH 5FDYA 1CG9B 5TPWH 3MRKB 3VWKA 3EDEA 4WGWB 3FONB 3VINA 2P49B 4L4OA 5AZEH 4HJGA 1QSZA 4DVRL 3EZJB 3P0VH 3IAQA 5FGSA 4Y4HA 4CN1A 3MSPA 4OV6F 15C8H 5C7XL 3GIVB 4P46D 4JRYD 4AEIL 1C92A 4X4ME 3P3YA 3NCEB 4BSWA 3W81A 5D7SH 1I9RH 1HQ4B 1JPTH 4KC3B 5F1KC 5GJTL 5B8CA 1RAMA 1MCNA 4P46B 4C7FA 1KXQE 1HQRA 1N8ZA 4LLQB 3HS0A 1YA5A 4NRYA 1J7VR 2VLME 2X4OA 3L5HA 4JFDD 1KUMA 2W63A 3T0EA 3L4TA 4NQDA 3AM8A 5D9NA 4G8IB 4HGKC 3P4NB 1P2CB 1JUFB 3CHCA 4HTYA 4R96A 3I3DA 2APFA 4FQ1L 3ZKSD 2JLLA 1E6PA 1CE6B 3WS6C 2VXSH 3FFCD 3EJYC 5IB1A 4MLIA 3O8XA 1GAFH 1WZMA 3KLAB 4WO4C 1OD7A 1Z9SA 3BH9A 4TTDC 5DJXA 1DLFL 4NYLB 3SE9H 1YY9C 2AV7B 3QHTC 1HH9A 2VXUH 2WWMC 3AHTA 4AG4L 1KPRB 3T2OA 4V2BA 1GHSA 1WUNT 5FM8A 4UNUA 4U1JB 3MGTB 5CSZB 4W93A 3X14A 2PUQT 5A8PA 1G7PA 1W8OA 3CVHB 3HAEH 4RCAA 3VILA 4PGJA 3DO7B 2FWOA 1RZKL 4V1DA 5IESL 5T1MB 4XH2A 1XD0A 5E2VH 4Z0XA 4JZNA 4LAQH 3O9WD 1KCLA 1A5FH 3QEQD 1EHXA 2AV1B 2XKNB 4U1GB 1MCEA 1OY3B 1PJ9A 5DT5A 1NFIB 4WI8A 4FNLL 4HKJB 4FF5A 1KN2L 4XP6L 2FDMA 5CPQA 4DWSA 1RK1A 2H8PB 3O9WB 4U4BA 5C0EA 4O51B 3QEQB 5EZOH 3G6JB 3WXWH 1LQ0A 4UCFA 2RAMA 3D39D 2K3TA 2WV3A 4PJGA 5MEQA 1CXLA 4EDXA 3ESVF 1EGJA 2OXHA 1WAAF 1KCSH 1TETH 1JZ6A 4PV8A 5AZEL 1XIWC 4AJ0A 2A3CA 1B3VA 3HUJE 1ZT7A 1J8HD 1LE9B 3RDTC 4O2CA 4XXDA 2XWTB 3KJ4B 1N0XH 1FSKB 15C8L 1JK8B 3L7EB 3HG1B 2JB6B 1KN4H 1N2RB 3ZT6A 3LEYH 4OGXL 4Y5YC 1QO3B 5FO9A 3MBEA 1IGYA 2X4SA 5D7SL 4EBQH 1HWGB 3FQRB 3AZTA 3MGOA 2C3WA 3U7YH 1AMYA 3BVNA 4CD6A 1JHKL 5C0DA 1U8JB 1GGIH 3IDMA 2FHCA 4OZHA 5CP3H 5A16B 4LCCB 4F9PA 1C1EL 1HJUA 2AK4D 5E09A 4HIIA 1PEZA 1TVHB 4OLUH 5KBNC 3QIUA 4YPGA 1XR8A 5EO1B 3FTGB 4ZFZB 4P49A 2VXSL 3IGAB 2AK4B 5KSAA 1KB5H 1H11A 3GHBH 4QGTA 1GAFL 2ESCA 3QDJE 1AD9A 3JWDL 2W0LA 3W37A 3VOCA 1B0GA 4NI3A 2DMCA 3SE9L 4MX7B 2V7HA 5SWQB 5L2KD 3PTMA 2IPKA 4UQBA 4K7PH 1L6ZA 4O2FB 5T1KA 3BESR 3GMQB 4LCIH 5DJ0B 3UO1H 3JWNC 2BSSB 1WZ1H 5F8RC 2FJFA 2VX5A 4M9PA 4BZYA 1H15A 4PREB 5L2KB 2UV3A 2GK1A 3RL2B 1X7QA 2D7OA 2EIZB 3F7QA 4NN5B 5E2VL 3T09A 4LAQL 1XGPB 1A5FL 3THMH 2IUZA 1W32A 2C7FA 2IANB 3KHOA 1PYWB 1EMTH 2CLRB 5HYSG 4PRNB 3KPRD 4GXPA 2MHAB 4M43H 4CDGC 4R2GC 1UKTA 2WP3O 2QV2A 2ED8A 4S1SL 5EZOL 3WXWL 1P7QA 1E4WH 4QTHA 1EQCA 2XKUA 3MRPB 4YEEA 1KCSL 2WBKA 4FXKA 1IAMA 2VLKE 4HZ7A 1FVDA 3RVVD 3ZOAA 5EU4B 4F7CB 4N0UA 3ZDYE 1FHGA 2VL5B 1SY6A 4YBQC 3PZVA 2AJZB 3PDDA 1JNLL 1KTDA 1O0VA 3WH5A 4XPAL 1N0XL 2P5EE 1KN4L 5F7MC 1UWXH 3HR5B 4TOQA 3LEYL 3A6CH 3OAUL 4JKWA 4KVCH 4WTWA 3V0VA 3QEHA 1W1TA 3R06A 4BFIA 4HPGA 1LWRA 1IC5L 4LYQA 1B0WA 1I7ZA 1OF2B 5L2JB 2A2QT 4FQ2H 4X80H 3U7YL 3OGSA 2EDFA 3HZVB 4K68A 1JZ7A 5C09B 4HIHB 1KXVA 1GGIL 3RVUD 3E6HA 1VACA 3TBYB 5M7QA 1FLTX 3SCTA 4KQ3H 5T1LD 2IQAB 3NIYA 1RUKL 1LVEA 4WEUD 5CD3A 1MVUA 4RGMC 3BPNC 1ODZA 1W3LA 2QSQA 4XX6A 4NN6B 1TE1A 3RNKA 4MYWB 1KB5L 3TA3D 6A3HA 3GHBL 1YY8A 5T1LB 1R0AH 3F12B 3L4YA 3ARDD 2AK1L 3NABH 4JCMA 3IFPB 2RQ8A 1RFDL 4L4TE 3VFGL 2QQKL 4NBXB 3TA3B 5D8JL 3NIGE 5CKAA 3GBNH 2WBJC 4LMQE 1EFXB 2P8LA 3ARDB 2ICES 4X6CA 4K7PL 3BH8A 2IH1A 5GGVY 2XPGB 3KYOA 1ACYH 1ISVA 1VIWA 4A2LA 4LCIL 4OLXH 2DIJA 3UO1L 5FGRA 1WZ1L 3EYUL 5I1DA 1UQSB 1WTGT 1WWCA 3JBG7 1VFBB 5I9QC 1EAPA 4G8EB 5A6AA 5GSVA 5D93C 6TAAA 1QFWI 4HF5H 1A3QA 3QUXB 5C08B 4ACYA 1QYGL 1LDSA 5JOPD 1AP2A 4EVNA 4ZS7H 2WAGA 1GZPA 3THML 1H09A 4W89A 3I75B 4QRUB 4Y19E 2QLYA 1AGFA 1EMTL 4M7LL 4OZFH 4PRAA 4PGCA 4HKZA 5L88H 1ED3A 3QYCA 4TSCH 5EC1A 4HAFA 5ADOH 2XYCA 4FFVD 4H25A 3W9DB 1E4WL 4KQ4H 4MXVF 5EOCJ 1G6VK 3CO4A 4R4FH 1C90A 4FMFA 5E8PB 2WANA 1H5BC 3AXLA 3B2VH 4S11A 3VMOA 1RZIA 4G42A 3EBAA 5I73C 4XAKE 4ALAH 5IUSA 3GKWH 2WWCA 4WWKC 5DUBA 5D70H 4PJEB 4MD5A 5C07A 3I6LE 2BJMH 1Q6GA 4NZJA 5C0ND 1B30A 3A6CL 4KVCL 3ARFC 2HYMA 3WUFA 2OJEB 4KXZI 5ERWB 3FB8B 3OHXB 2QHAA 2ZSVB 1J5OL 4ODXA 1Q9KB 4X80L 1GGTA 3KPPB 3TEUA 3QFJA 1A7QH 2HFEA 1KULA 3RWCB 4QHMA 1BZ7B 3BMVA 1X5HA 4Z0BL 4KQ3L 3RIAK 1E56A 4JG1L 4U1IA 2ZUMA 3T1WA 3K74B 5DS8B 4AH2A 2ZUTA 4XXCC 3II1A 1HSBA 1KLGB 1YEGH 1N26A 1FZKB 1FLRH 1R0AL 3GHEH 5D1QA 1OGAE 4Z2KA 3NABL 1U33A 4QAWA 3BDYH 3U0PA 1X5ZA 1KIQB 4HXBH 4FQLH 3RZWA 4ONFL 4RFNC 4QRPA 2V3EA 1P4BH 4JPKH 1NFDE 5E6YA 5I1AA 5HYFA 2ZG1A 3GBNL 2VLMD 3QH3B 4JRWA 2E5EA 1DVFA 1JFQL 1SMAA 4XNUL 2DQDL 1ACYL 1MRFL 4YZFE 4AXNA 4OLXL 4WW1B 3QIWB 3FO0H 3GYCA 1LP9A 1M05A 4GW1A 2HH0H 1U2YA 1M03A 4HF5L 4Y4KD 3X3FH 1XSIA 5C0FB 4MXQC 5A3IC 2ARJB 5FFLA 1UVQA 1YMME 2YWYA 4JZJA 1GQJA 1IAIM 1W72B 4ZS7L 2EDJA 1QVOA 5HVGB 4ZDHA 3EYVA 5KJRH 3CIQA 4YNYA 1KGCE 4Y4KB 5L88L 4TSCL 4EZMA 2P5WD 1JTPA 4D1IA 3OJMB 1AH1A 2B5IB 3MLZH 4PJGF 4WTXA 4KQ4L 3ARBA 2O9PA 4A6YH 4NQCA 5DUPH 2QQLH 3KPLB 1ZBVA 4LVNC 3MRQB 3SGKC 5IHLB 2P5WB 1XMWA 3B2VL 1F2QA 4YBHA 3ZKXC 4ALAL 2YDQA 1YEJL 1YQVH 5CSBA 1MQQA 1ZEAH 2RBLA 4MQ7A 1S7UA 4FXGB 5A69A 1VERA 5H37G 3U5YA 1AI1L 2EC9T 3MACH 4YFDB 4OD1L 2ITCA 4KKCD 3BKYL 3HE6D 2X4QB 1BGGA 2C4XA 2H2SD 3VFWB 1I8LC 3VXUA 3NPZB 2R56H 5I76A 1F3DJ 1L8NA 1OWRM 3BAXA 1V0NA 5CINH 4OZHF 1A7QL 1DWJM 3MV8E 5JXEA 1RULH 1S3KH 3HE6B 5DJCA 2DSZA 3GXFA 3QQNA 3TO4D 2YRPA 4Z7VB 2CPCA 2O5ZH 2E4TA 3S7GA 1T21A 1JXKA 3D25B 1MCPH 3HN3A 4KDTC 4DZBB 4KUCD 3TO4B 4GZIA 3SCNA 1FLRL 2XRAL 1DBKH 3GHEL 1CDBA 4XMPH 2GJPA 4CW1A 3X17A 1AR2A 4HXBL 3ZJ7A 3LKQB 2X1PA 5CCKH 4JPKL 4WENB 3ULUD 5MERB 4YR6B 4E41B 2LFGA 2BHYA 4HS8L 1BGXH 2WPGA 1YUHB 5A6BD 2OMBA 3QNYB 3LEVL 4J6RH 3V7AE 2HH0L 3AU1B 1MOEA 4PJCF 2V9RA 5IVZA 1A6WL 1S5HB 3VXRA 3X3FL 5DMYA 4AD5A 4AMCA 1S9VA 1YEDA 1I8MB 1UKSA 1S7RA 4P46C 1CGUA 1ZWIA 4HS3B 3IFLH 4C83A 3QDJD 1V3HA 4IRJA 2EBNA 5KJRL 3MLUL 5AD0A 1T04B 2XVLA 4EUPG 4FQIL 1UYWH 1MJJB 1AHWB 2AI0L 3MLZL 4PRPA 5FCUH 3ZJKA 1VBRA 3PGDB 5C6TH 1S8DA 4I3RH 4Y2DD 5DUPL 2WZPD 3AJ7A 3MRHA 1HSAB 4L8DA 2P8MA 3LRSB 2PCPB 1OT1A 5HYSA 4ZFFA 1IL1A 4XMKH 2ILLA 1YQVL 4YAQB 3OIHA 3DUUA 2BVTA 1ZEAL 1KIPA 3VDCA 3UR7A 5DYOB 3PWUB 1RJLA 4NNYB 4WFFE 5ABFB 4QXUL 4RNRB 5BJTB 3SUTA 2YD8A 4OZGE 1RPKA 5BWFA 1U8IB 3CX2A 3DIFB 3O6LL 3W29A 4GO8A 3MFFB 1QG3A 1NJ9A 3F7PC 5CINL 5ALBH 1MWAA 3DXAE 1D6VH 3FN3A 4H1LB 1BYBA 1S3KL 2B39A 1YECL 2VLKD 5BRQA 2WBGA 5DK0B 2O5ZL 1MFDL 5IMKA 3QG6B 4U1GC 3CFKB 4HPOH 3RVTD 1ES0B 5ACLA 5D2NE 3RWHB 4G7YH 4XP5L 4FLSA 3LKPA 1TDQA 1BFTA 5GGUA 3O9WC 4KJYB 8FABB 1DBKL 4YGVA 3RKDD 2YJQA 3UTZA 4K9EL 4D9RE 5IMMA 3MMEB 3RDKA 3TIDB 3W5MA 1IGIH 1JWMA 1JGVH 5CCKL 2XN9D 4H8UA 5A8QA 3REWB 3EYOA 5DHXB 1R3LB 5SWZD 2CDGA 1Z5LA 3U2SA 2NX5D 3KJ4C 1EXPA 1UB5A 4LNRB 4AD1A 4LGXA 5FEBA 4PV9B 2GTZB 1HP5A 4Y8AA 2XN9B 4ZS6D 5DMGD 1EEZA 2C3VA 5SWZB 1ZTXH 1UQZA 1T80A 1OAYH 2IAMA 3G6AA 5F9OL 1HKKA 2VR4A 5F9JA 2NX5B 4HH8A 4GQRA 4YDVB 2LVEA 3UBXB 1NWRA 3IFLL 1PZ3A 5B38A 3WNPA 1OAKH 5MEOB 4LCCC 3I3BA 3MRJB 3EJZD 3FRPA 4JRXA 1YPZB 1J1XH 1CICB 2OZ4A 5CKGA 1UYWL 4PCTA 1FL5B 4YE4H 5D96B 3CH1A 5FCUL 4QHUB 5BXFA 1EV2E 1LO5A 4XVJH 5C6TL 8CGTA 4I3RL 3ZTNL 3W0WA 1HHIB 1II4E 1U58B 4NRXB 1OTSD 4TNVF 1EO7A 2EIDA 4KU1A 4XMKL 1D9KA 1M7DB 5FM5O 2ENYA 3IDJB 5DMKB 5AEAA 3FN9A 5A3HA 3EMQA 3O2VL 3WFHA 2XG5A 2YD4A 3BP6A 5KVGH 2DQIH 3I6KB 2HFFB 2XUCA 3I02B 3QPQD 3PNWB 1B3ZA 3LMJH 3QOKA 2VVNA 2ATPA 4MD0B 3KE0A 5ALBL 2ZUVA 1D6VL 4FLOA 4OKDA 3EMZA 4L3ED 4NN5C 5FXCH 1HKIA 3W24A 3DBXA 2ZUYA 4XAKD 2UY2A 1KG0A 4NO5B 1G9MH 4HPOL 2ZICA 1KJ2A 4H26B 4L3EB 4MA7H 3O3DB 1KCVL 3VRJB 1RH9A 1U2HA 5ANME 3C8KA 4KXZH 3MO1B 1LO4H 3DHUA 2H32A 1CLXA 2ZXAA 4CVWA 3F5WA 3G5YB 1ZJAA 1IGIL 1GPFA 2EKSA 3UTTE 3BCFA 2DMBA 2W91A 1J05A 5BMFH 5HDOA 3BIAX 3INUH 4APQD 5IFHH 5M03A 4DW2L 3RVVC 1LP9F 3DC0A 4ZYKA 3RWEB 1ZTXL 4HHAA 1OAYL 2NY6B 5D7KE 2PI6A 7A3HA 4HK0A 4N0YH 5I1GL 3EO0B 2DBLH 5GJSH 1OGAD 3DV6B 5M17A 2EH7L 1NSNH 1IM9D 5AYUH 2GSIB 3SDXB 2LU7A 4NOFA 2APVA 4YE4L 2JCCE 3RVUC 1E3ZA 4I0CC 4XVJL 4C58B 3IK2A 1UG6A 4NN6C 1Y6NR 2ADJB 4LQFH 2XICA 2J7FA 1B3XA 2VUYA 2CR3A 4R4BB 1B2YA 1QFWL 3ILPB 5C86A 3NCCB 5JIKA 4F3FA 3UAJC 1K5NA 3TA3C 3G5VB 4E2OA 5DRXB 5KVGL 2DQIL 5CWSA 1TG7A 3ARDC 5DDHA 3W9EB 3WIIH 3EO9H 1KGCD 1Q4NX 3HE7A 1N4XH 2HG5A 4XBGA 4U6YB 3AOFA 2F54E 4HGWB 2ZG3A 4PG9B 3TVMD 5I71B 2Q76A 5TJWK 1G7JB 3LMJL 1ORQB 2DDXA 1FVEA 3LN5A 4LGSB 5FCSH 4W4OA 1UWSA 3H0TB 4HS6A 4PJ9D 2GT9B 2J8UB 1C8XA 3NCBB 3VFUB 3WBEA 2AXHA 4TOYH 3H3PL 3WN5A 3UJIH 4BA0A 3TVMB 1H41A 2E9MA 4AC1X 4TUJA 3LKRA 1G9ML 1U8HA 1IKNA 5F3HB 4LVOB 1GORA 2WINB 4PJ9B 1CYGA 1H8OA 1IGJA 2R4RH 4XCCL 1MFEL 5SX4I 4OLZH 4DN3H 4KKLD 1WWAX 4RSVA 1LO4L 4S0SD 3VMPA 1B0RB 1Z6JT 4U1KB 5EFIA 3MXVL 4H0HB 4IOFD 4WU5A 2OR8A 5GISH 2NW0A 4P2OA 1EO8H 1B90A 1AGBB 3WH6A 5CP7A 4LLVB 1D5BB 2IH3A 3T08A 4JJ5A 3PN8A 5BMFL 3KPMA 3INUL 3W27A 3MV8D 1YMHA 1E6JH 2I60L 3EDKA 1ZMYA 5GIRA 3ULVF 3WDQA 4L3CB 3QT2A 5HI4D 5A6MA 1XH2A 2XFYA 1CFSA 1OSZA 4XC3H 1I75A 1UXWB 3RPIB 4UQEA 3QIBD 5IK3A 2Z8RA 4AL8H 4N0YL 4JGUA 2DBLL 4BKLB 1U8KB 5BXRA 2VZSA 4F37K 5C0NC 5HVFB 3IDYB 4JZOA 5JOFA 2J8OA 4MDJA 4O58H 1NSNL 4PJ7E 3IETA 3EHBD 3SDCA 3QIBB 4PLKD 5AYUL 4CU6A 2JB5H 2HVJB 2CRMA 1J8KA 3CUGA 3K1KC 4N0FA 3UZVB 4LARH 5KSVB 4HH9A 1EO5A 4XTRD 3CFCH 1R5IB 3VFNA 1NUFA 4FABH 1LWHA 1NAMH 5DI8A 3VIMA 1KLFA 3AIUA 3BAYA 4EQ2A 1WK0A 4QHKI 3M17B 4XCNA 3OKDA 1ZT4B 3QULA 5TDNA 1ZHNB 3BP7A 4GFTB 4POYA 1T83C 3O6AA 4LCYB 4MJ4A 3D85A 4WHYH 5D6DA 2EDNA 3AAZB 1JZ3A 3N18A 3MJ9A 4CNIB 4POUB 5JPNA 2DD8H 4G9DA 4PUBH 4Z7WB 5I0DA 3EO9L 4XRCA 2GHWB 2PWEA 2FL5B 4WY7H 1MVYA 1N7MH 1J01A 1SBBA 5D7IE 2CKNA 2J74A 3QIWC 4UILH 2UWFA 3DVNB 3CH9A 3R0NA 1CDYA 3CGTA 4XNYL 4P2RA 5H94A 1Y7VA 4K8RH 2IADA 1KT2A 3JVGA 3PWPE 4LLYA 2YPLA 5JQ6H 4TOYL 3SDYL 3QWQB 3OKMB 4XNXH 2B20A 1EHLH 1EEYB 3OR6B 3QNXB 3NVQA 2J1KA 4KTDH 4RRPG 1HDMB 4Z95H 5GS2D 1V0MA 1NGZB 4Y4KC 2F5BH 1MLCB 1SEBB 1I3GH 4L29A 1GQLA 3HFMH 2R4RL 4O2EA 5DEZA 5GGVL 2GAZB 4DN3L 4JFUA 2B5IC 5GISL 3T0AA 4U6VH 1OP9A 1HHJA 1KIRB 2Z35B 1A9BB 3DRTB 4GI8A 4YHMH 4HG4J 2KUTA 2DI7A 1TJGL 2ADGA 1GZQA 2W60B 5T3XH 1GW1A 3DXAD 4ERSH 1NUNB 3RGVA 1E6JL 5ESVB 3CZLA 4MD4A 5AC5A 3ZJ8A 3CLWA 3PTQA 3M46A 1D5XB 2PTTB 4MJ6A 4NUJA 3TOPA 4XC3L 3TC9A 3HPLA 3D87B 2O92A 4U6XA 3GSXA 5L8LB 3ME0A 5FYKU 1JF1B 3ZIZA 1R3HB 3QJHB 5IQ7H 3VGDA 2ZCKH 3MPCA 3C09B 2DWEB 3SCPA 5IVXA 5FDWA 2J7CA 4MQTB 1ODAA 4RL3A 4KKCC 3HE6C 1TQBB 2JB5L 2H2SC 1VA9A 1Y18A 3O6MH 1PZUB 1S7SB 4L4VD 4LARL 4RQQA 1HT6A 4GRMA 5EBWA 3CFCL 1U93A 3V5HB 1NP2A 2NSXA 2XM2A 1NAML 1FZJA 3IJSB 3HZYA 3TO4C 1T1WB 4XX1G 3WIFA 2NQCA 1IAOB 1UB6A 2VRKA 2DH3A 3MODL 5M3WA 1CGWA 1DP0A 4UFJA 4HKBA 4GS7B 4L4VB 4PJ8A 4DZ8A 5BZWA 1JNNH 4QP0A 1LL4A 4JG0H 1JPGA 1INQA 1N59A 1FZOB 4YGAB 3OKKA 1F6AB 3L3IA 5ECJE 4LGRB 4R0LA 5DJ6B 4KRUA 3WUBA 2BRQA 2GK0B 2DD8L 4PUBL 3EFFB 3VXSB 1V3MA 1T22B 5ABDE 3IDIA 1I3RA 1DDHA 4NKQB 1ZSDB 4G6JL 3Q5YA 3O45A 3P9MB 1REIA 2HT2D 3ULUC 2BVPB 2LU4A 4PY7B 4FQCL 4ZOBA 4LEXL 5TGBA 4WF7A 4K8RL 1G7HB 5EIIA 3P4OA 5JQ6L 2CK0L 3DX8A 4XNXL 3QDGE 3ARRA 2XYLA 5HHMD 2KBGA 3MTRA 4AIZB 1EHLL 4KTDL 4DVBB 3DMMD 2F53B 1OM3H 2IXVA 5CS7A 4XBEH 4ETQA 1OAXH 2F5BL 1KNOA 2E27H 3SCUA 3HFML 3PG2A 4OUUB 2EQDA 3OKEA 4QLRA 1AHWC 4X5XB 5HHMB 3FOMA 2D0HA 4MNMA 4R8WH 4X9FA 3DMMB 4HWUA 4U6VL 3MRNB 1V3IA 2QKIA 3LRGA 1AD0B 4X99B 1UOKA 1CK0L 3LB6D 4YHML 1UACH 2NXYD 3V6OE 4CMMB 5KZ6A 4GAGH 5T3XL 4ONHB 4ERSL 3N50A 2W0KA 4AZCA 3T0DA 3AFBA 2C7UA 4GRWH 5F1NB 4Y2DC 2SEBB 1HEZB 2AS5M 2W1NA 1DQQA 3AIEA 1DQJA 5J57B 1KB5B 3STLB 1TLKA 2AJ3B 2VLJA 4K55A 2PC8A 1RJZB 2NXYB 4TQEH 4NQDE 2EE6A 2A6DA 2CPUA 1XEDA 3CSPA 1CT8B 3OB0H 2DLEA 3CC5A 3KYKL 4XP1H 5C70A 4R6UA 4X6FB 3SQOL 5CJBA 5IQ7L 2ZCKL 5GGTA 5E4IA 1IEBB 2DS4A 4GW4B 2V5CA 2GDVA 4JFOA 1BPVA 3MLWH 3PABB 3OZOA 3BAWA 3O6ML 4PRWA 3ZYOA 5DSCB 1JN6B 1I7RA 3S35X 3GSQA 3WDHA 4PP2A 5DD0H 4CN4A 5E5RB 1IKFL 4XCYA 5BCAA 4LPXA 4GBXD 3WS6A 2DSVA 2BSRA 3P73B 5DR5H 1LEIA 1J87A 1JNNL 3DHMA 3RVTC 4J8RA 5D7KD 2JK5B 2DLGA 2OTWB 4JG0L 4V1DE 1UM5H 5E9DD 3GSNL 2LAGB 4OSUH 4QXGL 1EFQA 5DJ8A 3HB3D 1A7PH 3BYTA 4MNQA 2A3AA 1DQMH 3JXAA 4LSPH 5E9DB 4F8XA 4U1NA 5IBUG 4O5LH 4ZUUB 1UWQA 2WZEA 4XT1C 2VR5A 5IV2B 1A1MB 3KHQA 4S2SB 4X8JA 4ZG1A 2FZ3A 4E4PA 4YHKH 3SKMA 3KPSD 1KJ3L 4ZS6C 5DMGC 2QSVA 1OM3L 4XBEL 1MJUH 1OAXL 1MVFA 1VADA 4M24A 4C56D 4I2XA 3KPSB 1D5MA 1NGWA 5D96C 1UWIA 3WO4B 1KPVB 1CCZA 2WWKO 4QF1B 2VZOA 3U1SH 2F54D 2WUBL 4C56B 3H6JA 5I15H 2OJZH 1MJ7H 4P57A 4GAGL 3PWLB 4W6YB 3N85H 4H8HA 1ZVSA 4OZHE 3CXHJ 1CR9L 3BE1H 1OTSC 3RDTA 1S7TB 3CSGA 2H45A 4TQEL 5FKAB 4Y5YA 4NJAL 1CFQA 5HDLA 4LLUB 5SX4H 4XP1L 5J0BA 4NWTL 3PGCA 1SBSH 3LQAC 3OKOA 5CGTA 3MLWL 2V2XB 5C0CA 3BXNA 3QPQC 2Z93B 5A6KA 1U8OA 2C1OB 5DUML 5KW9H 3OJ2C 3WFZA 4PMUA 3AY4A 1OWWA 1A14H 1S7XA 3VI3F 4Q9CA 3BZEB 5M94B 5F7DB 1BBDL 2UUDK 2X4RA 4UQCA 1X4YA 5I30L 5IBTH 3M7SA 5FHAH 1OD0A 5E95B 2XTJB 3REVA 3MLSH 3AFLA 4Z77B 4OZFB 3ZYZA 1NQBA 4ODBD 1JPSL 1AIFB 2XSBA 2R1XB 3PP3H 4Q2ZA 1UM5L 4RAVA 5IEKA 2NLJB 3JV4B 2WKLA 1XH3A 4OCRL 1T5WA 1ZHBB 4YDLC 1QNSA 4OF6A 3IU3A 4OSUL 1VB9A 1Z2KA 4K3JH 4Z9KB 2RGLA 2QADD 1A7PL 2VDKH 4NNXB 43C9B 1RZJC 1DQML 4LSPL 1M53A 1A1OB 4O5LL 4QRTB 2NY6C 4APQC 1K85A 5HY9B 1C7TA 5ETUA 4NJ9H 1AR1D 2QADB 2B8OT 4LK4A 3P9LB 4YHKL 2GJZA 1BPLB 3SHSA 2XWEA 3E6FA 4DTGH 2BVOB 3MUGB 2XXCB 4FFYL 2CKBA 2QEJA 1PG7H 2A3EA 1MCBA 2AXFA 3WDPP 3NIFE 1A9EB 3NFPA 1CD8A 4DGVL 1A7NH 4MCYA 4XMLH 3EOTH 1A3RH 2ZX8A 2J7GA 4MCZA 3U1SL 3U36B 4ZFOL 1QNZH 1UH4A 1JGUL 3V0WH 3KL3A 4RRPA 5I15L 3TNNB 1XGYH 2LAAA 2ZWZA 1SYSB 3N85L 3VDHA 1ZBKA 1ADQH 3SCVA 4G6KH 4PRIE 3BE1L 1ND0B 1AGCB 2A0LC 3T1FA 4JFFA 3V5DB 1N3NB 3CPLA 2V2TB 4ATLA 3VVGA 4PJXA 2VX6A 1BJ8A 3UG4A 3LEXA 3S5LB 4EOWH 3MRGA 4Q9QL 5I71C 4IUGA 1QI3A 3TZVD 1U8MB 4TPRL 5D7JD 5IVXF 5LGHH 5DJZA 3RL1A 5I19H 2AEWA 1VRXA 3D3VA 4GLRI 1FVCB 4MAYB 4ISVB 4HUWB 2J6EH 1HXYA 3TVMC 1PX8A 4NKOA 1PQZA 5C8JA 2J62A 5D7JB 3RTQD 4RGNB 3VH8A 3AHXA 4CKVX 4LVOC 5CJXC 1A14L 4PJ9C 4X6CE 4ACZA 3EOAA 4GKNA 4KZEH 5IBTL 2VZTA 2XQBL 5FHAL 4E5XA 1KSRA 3MLSL 3RTQB 3G6MA 3EBVA 4V27A 1YZZA 4HJJH 4JN2B 4HJ0C 3G6DH 3QQ4B 1O7SA 2Z92B 1W9UA 3L6FA 4X5LA 1U6AL 1HXMA 2ADIB 3CDGA 3E2HB 4KKLC 3BP5A 1A21A 1CL7I 3FB6B 3SCMD 1PKOA 1S7WB 1FNLA 2NR6C 1C08B 2WBJA 4RA3A 4O02H 3T3PF 4JFEB 5J4MA 1XSKA 1NH6A 3U30B 5MENA 3C5ZD 4ZUTA 4BSJA 4RFEB 1JWSA 4MSWA 4S1DD 2X05A 2RIKA 1F6FB 2FJGA 4WVRA 1CENA 4NJ9L 1DWIM 1CDHA 3BC9A 1BFOB 5HI4C 1B2WH 2CETA 4MA8L 5EG6C 5JZ7D 3KYMA 1HNYA 4W7UA 1XGQB 3IDYC 3MCLH 4P2CG 5FV1L 4DTGL 3RM8A 3S98A 5B3JE 4JCLA 5KS9E 5CJOH 2VWEC 3QIBC 1FO0B 3MUIA 3B9DA 1DR9A 2BSED 3DGGA 4WEMB 5FO8A 5C07E 4J23A 2GUYA 3ZR5A 3VXME 4ZAKD 1O6IA 1ZS8A 1MQ8A 1A7NL 3CVIH 4XMLL 5E1HB 1A3RL 3EHBC 2NT0A 1RZKC 2WSPA 1YYMH 1QNZL 3VX1A 5FYLH 1BJ1J 4ZAKB 3V0WL 5IW1A 3BZFA 4XTRC 4LFHD 1H5BA 1XGYL 4JY6B 5DMIH 3BCDA 2F2HA 1PBYA 1GNXA 2CIPA 1KV3A 1ADQL 4WWKA 3L3KA 1OARH 3QDGD 4G6KL 1WAWA 2WMJA 4KDVA 4CAGA 3N1QC 1NBYA 2E3VA 1E4KC 2R23A 3MRRB 2YSSB 3ARFA 2ZSWA 3QCUH 4EOWL 3NMEA 4Z7OE 2EDQA 3GJEA 4ZUSA 3MRBB 4PGBA 4U0RB 4XCEA 1J10A 4I4WB 2EICA 5LGHL 1A0QL 3K8MA 3AHVA 3BPCB 5JXAH 3RWJA 3HRPA 2X9WA 1X5KA 4QY8A 2X4NA 4GKZA 2NW2A 1KR1A 1WWBX 2DQJL 4Q74A 2LU3A 4D6HA 3D2UA 2IFGA 5ITFB 4PMOA 4AZHA 5CZVH 4U2YA 1SR0A 1TA3B 4Q7DA 4HJJL 4A2MA 2GSGB 3G6DL 1J0KA 2OCFD 3BD3A 5D2LE 3WS3A 3WNLA 1C5BH 4MB5A 4PG2C 5CIPA 3Q6GH 2BNQA 4YHNA 5DD6B 4ZSOB 1KXTA 2QBWA 4LKCA 3A4AA 4I3GA 5D5MA 4O02L 1CLYH 1CGXA 5D7LA 4BUGA 4RMQA 5IROC 1KCKA 4L8CA 2V17L 3JWDC 3MRIA 3MGAA 1DEEB 3WF3A 3NUKA 1CTOA 1JCKA 2ZUNA 2F5AH 1ONQA 5C0IA 3SDAD 1JYXA 3C09C 5F70A 1QW8A 3MCLL 4U1LB 1GJUA 5T3XE 1TQBC 4OCNC 3VU2A 5DRWB 4XCFH 3SDAB 4XB3A 3RJDA 3CVIL 4LGPB 3B6SA 1GCYA 1QQDA 1MIML 2OBGA 4HG4K 5J6GA 1CZ1A 2PNDA 5HGGS 1SJVA 4HMDA 4I13B 3HI6L 2QL1A 4MMXC 5DGRA 4CJ1A 4GS7C 4JAMB 1ZJBA 2VDNH 3SGKA 1A3HA 5IWLA 5DMIL 3IKCA 4TX6A 1FYTE 5E99H 4AT6A 2WHJA 4TVPH 3V6FA 3CLFH 3MV9A 5D6CB 3ETBF 4XPBH 4UFMA 1NCTA 1OARL 1A4KB 3C2AH 4FN0A 2I9TA 3BP4B 2H3NB 4KK6D 4O9HL 1CDJA 3TN0D 3GB7A 1EOKA 1O5DT 5DZNA 1UH2A 2X1OA 4WUUA 3QCUL 4OZIA 3PHQB 3BRFA 4W4NA 5IIEB 1QLEH 35C8L 5DEGA 1IAIH 3SE4C 1I8LA 1GSMA 5A95A 1S7QB 5FIEA 3TN0B 3WXVH 2YPVL 5JXAL 1BWMA 1ZANH 1UM4L 3IXTB 5ITBH 2F19H 4LLDA 4ACPA 3TH3T 4IRZH 3VFOB 2HAZA 4PMZA 4PJDA 2COQA 1NEZB 3DX9B 4KDTA 1CDCA 1TJIH 1A7BA 1BVZA 4QCIB 3DMMC 5FA4A 2IMMA 3FRUB 5EO0B 1B4RA 4H2CA 2APBA 2CHOA 3ABZA 3VXRE 1EJOL 3G5XA 3SDDD 4Y7MA 3RUGB 5L7XH 3P9WB 1YEIH 3Q6GL 5I75B 5JW4M 4RWYH 1BD2A 5IB3A 1MIEH 1R3IH 4P4RB 4M9OA 1T0PB 3KJ6H 3LB6C 3WFEH 3SDDB 2VXVH 2NXYC 1UZ8B 5LAXA 3VIHA 3GIVA 4NQVB 2OTUB 5EORH 4HUXA 4HZ6A 1PVHA 4ODWB 1DL7H 1HQ4A 3MYJA 2APTA 4EI6B 2MMXA 4UTBH 5E94B 4IRSB 2DM7A 1A4JB 4JRYA 4P46A 5GGTH 3FO9A 3OG4B 4D0DA 4Z7UF 1U8NB 4GRWE 2NTFB 2PO6B 4X7FC 2UZYB 1VJSA 4XCFL 3S34H 4FQQA 4U6HB 5T3ZH 3VX0A 4C54A 3AREB 4CD8A 4G8IA 1LILA 1P2CA 1JFXA 2PXYA 2OM5A 4JFDA 2XZAH 1CE6A 1UWEH 4NP4H 3BLPX 2VDNL 4X98B 5J8OA 4GXUM 3VG9B 1EOMA 2CIKB 2AQ2A 5E99L 2VAAB 4WNQB 2YZ8A 3SQBA 2P48B 5I77A 1P69B 2HISA 1LL6A 5JORA 5IR1B 4X0NA 5E7BA 2XV6B 4GBXC 1W9PA 3FFCA 4UB0H 2UZIH 4GG6F 1I1YB 1FFNB 4JO2H 4RBPH 2WC7A 5DVLA 3EDDA 4ZFMA 3MGTA 5I3DA 1P9MC 5CSZA 1NL0H 1QLEL 4P7OA 3CVHA 5GRVL 3MNZB 4W81A 5CZXD 3RM9A 1FYHB 3WXVL 1ZANL 3HB3C 4Y0GA 1N6QL 3MR9B 1IAKA 2F19L 2VI0A 3KXFD 1V08A 4IRZL 1AXTL 5I16B 2W65B 3WUWG 4PRID 1NFIA 1G6RH 5EH1A 1FP9A 4HKJA 1TJIL 3WO4C 2H8PA 3ILQD 3O9WA 3KXFB 4O51A 1S9YB 3QEQA 2NXZD 2VX7A 2OI9B 2DI9A 1CQKA 2ERJC 5D8ZA 4WKHA 5L7XL 3AC0A 4PJIB 3TCLB 4RWYL 4RFOH 2G4FA 2JJUA 1R3IL 2NPLX 2NXZB 2WNWA 4WU7B 3D39A 1W0VB 1LE9A 3HI1B 3WFEL 5CHNB 2XWTA 2VXVL 3L7EA 1GVYA 5EORL 1I8KB 3BEVA 4ELME 1U8QA 1WFNA 1XD1A 1I9JH 3QWRD 5HYJD 1M04A 1DL7L 1J8HA 3W0WE 1TZ7A 2AJXH 5EU5A 4G9FD 1X5XA 3ZDXF 4L3AA 5TDPB 1JGLH 3K4ZA 4P9HH 5CPTA 3EYFA 3PWJB 1B3YA 2D03H 1OP3H 3RCNA 5HYJB 3PUCA 1L0QA 5C9JB 1CL7H 3S34L 3VG0H 5SX5H 4G9FB 4JM4H 5T3ZL 2IFFH 1QA9A 1TVHA 4X7TB 3UJJH 1NGQH 1GQIA 1N64H 4Z7NF 2MPAH 4KI5E 4RMRA 1WDQA 4ZFZA 2XZAL 3IGAA 2XTJC 2AK4A 1XT5A 2Y24A 3MCG1 3CXHK 4EN3D 1BLNB 2J7LA 5IF0A 3QOMA 1QI5A 1X6LA 2CIIB 2E7LA 1UEYA 2JIEA 3U82B 4UB0L 2UZIL 2QPSA 1QOKA 5EBLB 5SWQA 4EN3B 2NY3D 4JO2L 4YC2B 5D9SA 1GJIA 3VXMD 2C3XA 1AQHA 4O2FA 2IALB 4GMSL 1NL0L 3H9SE 1U42A 5JIIA 5DJ0A 2E9WA 3GK8L 1MHHA 1F90H 4AD4A 4YK4B 3CNKA 2KH2B 2QADC 2NY3B 1FH5H 1G9NL 5SV3A 3Q2CA 5LA0A 3H7BA 3U9UB 2EIZA 4M62H 4UTAL 1XGPA 3MRLB 1US3A 4G43B 1AR1C 4LF3B 3N9KA 2I9LB 3GSWB 1LEGB 4B3KA 1G6RL 5CSUA 1MCDA 3HHRB 3MV7E 2W4XA 4MJ2A 4ONGH 1EGZA 4U7KA 1DWGM 3NIDE 1MCSA 2AMGA 1MFUA 4BH7B 2VC9A 5IW6B 4BFGA 3C8DA 3KPRA 3RPMA 2DKMA 4G80A 4NC2B 2F8QA 5F9DC 1ORSB 5I18H 4RFOL 4PLNC 4RIRB 4UOW0 5EU4A 3P30L 1JD7A 5DK2B 5D5MF 5ABGA 5ICXB 1E6OH 3CFDB 1NMBH 4JVPA 3WV0A 4H41A 5I5RA 3TBSB 4ZUVB 2EYRB 3P0GB 4AIOA 2QF8A 3HR5A 3PXHA 5TE6H 3QUYD 1MCOH 2VKWA 1EEQA 3SCOA 1I9JL 3WJJA 1MF2H 3TLRA 5E8NA 2D31A 3LD8B 3MRFB 3HZVA 4PEEA 1JGLL 5F88B 3MBXH 3QUYB 4K8RD 4MAYC 4P9HL 1O7AA 3AICA 3KZSA 1RHHB 4ZQKB 2D03L 4LVEA 1FL3A 5I8CB 1UXSA 2BVEA 2FNBA 5IHBA 5D7JC 3A0OA 4RGNC 3U7WH 2IQAA 1CIUA 1J11A 1ZBWA 3UJJL 1NGQL 4ENED 1N64L 5DJYB 2MPAL 5LA1A 1HX0A 3O3AB 3LPWA 4FQJL 5GS3A 4JFPB 3WIJA 3RTQC 2RGSA 1DTUA 4Y1AD 5T1LA 4M8QB 4PJBA 1LD9B 4LP4A 1EX0A 4Y4FB 1KENH 1Q9LA 4N8VB 1P4LA 3E2HC 5KAQG 4RX4D 3OQ3B 3MCKA 5T3XD 2X70A 2RCSH 1F00I 3HPJA 4UUJA 4Y1AB 5B39G 3ARDA 4OZIF 5EULV 2XY2A 3K0WA 3U30C 4URTB 2AJVH 3QEUB 3C2SA 1UWGH 3VXTB 4F7MB 4NO2B 3SCMC 1F90L 4C55A 1UQSA 3PJSB 1VFBA 1FH5L 3NBNA 2B0SH 1OLZA 5JMRA 4M62L 3C5ZC 4S1DC 4BFBD 3GSRB 1MI5A 4F37F 5K9QG 4OFPA 2NNAB 3T2QA 1I4FA 3WBDA 2Y4SA 5JZ7C 1KB3A 4PMNA 1S78C 1UA6L 2BY1A 4ONGL 1F3RB 4LEOB 3W9DA 4N9GB 4Q22A 2HVKA 4YJZL 1SYVB 3O2WL 3C5SB 4EXKA 4ZAKC 1CZ8L 2DT1A 4PP1C 4HA1A 5E8PA 4D6EA 5FV2A 1QRND 5EUOB 1EGJL 4NCDA 4D2NA 4F80A 1RD6A 3S36L 1FORL 2BVQB 4K3EH 5EPMB 4PJEA 1QLRB 1CD0A 1NMBL 2ICEA 4EK7A 2GJRA 2FJHB 1OGBA 3QO0B 4HCRA 4LCUB 3LDBC 2EO7A 3ARWA 1QRNB 2GTWA 3S2CA 4K9EC 3RP1A 2BOCA 2WIIB 3FB8A 2B1HH 4U0RC 2G60H 5FYLE 4PJHA 3O0RH 5GSRB 4AY0A 5FK9B 3GSNB 1FPTL 3BSZH 1GGUA 2AABH 3MBXL 4OCYH 4GQPH 4CJ0A 3FB7B 1CLVA 3EFDH 5H35B 4B7IA 1S7VB 3GRWH 1QNQA 1BZ7A 3W39A 1MQKH 4OZ4B 3O6FA 4S10A 1G7LB 4MB3A 3A6BL 5EN2A 3U7WL 4RGOH 3CZFB 3BEWB 1MAMH 2N4IA 3BJ91 4Y5XB 3OG6B 4S0TD 2X6MA 1ZK9A 3EYSH 2FIKB 3GGWB 3O3UN 1YN7B 3UZEA 3QDAA 3S4SB 3ARQA 2VDQL 3G04B 1QFUL 1EPFA 5ISZE 1KENL 1T83A 1R3JA 3MMUA 1VFOA 1XGTB 4X4MA 2EEBA 2W92A 4YUEL 1C91A 1BSIA 1MRCH 4PTVA 3S37H 1CFTA 1YNTB 2AJSH 4OFDA 1NQ6A 2CDFA 1JD9A 2Z1SA 4WW1A 4FXLA 1UWGL 3PHOA 1KXQA 4B41A 4BH8B 4JREB 1A8JH 4U7MA 5GNZA 4OV5B 5IJVB 1UD4A 1SM3H 5C0FA 3RILA 5HPCA 2ARJA 1NBZB 5F7HA 2VZVA 3F5JA 5F3BA 2ZX9A 5DHYA 3RJYA 2E3ZA 3BKJH 3RWFB 4CD7A 5DT1H 1E0OB 4Y4KA 3SDAC 2GCYB 1ZBCA 1DBJH 4PJAB 4TSBH 4GW5B 3WHXB 1CS6A 5IFTA 3SJVE 4M3KB 2BC4A 5HYQB 3MRQA 4MJIB 4X9YA 1UADC 1S9XB 2P5WA 5D4YA 2ZOLB 3WUWA 3WSUA 1Q9WB 12E8H 2D7TH 1WBZA 4JDZA 4K3EL 3VJ6B 3L7FA 3M1BB 4LRIC 3RZCB 2WVSA 5KSBB 5BROA 3IDNB 4FXGA 4WTZG 5GRZA 2X1QA 2VDMH 4JFXA 1LK3H 4J1UB 1BYAA 1UWXK 3HC3H 3U48A 1XH0A 5A2AA 4IS6B 1TZGL 3D3AA 3LSOA 1G7IB 3TYFB 1CD9B 3BSZL 3TN0C 1OGTB 4OQ1A 1U91A 4OCYL 4M5YL 3PGFL 1JGDA 3B8SA 4LSTH 4TVPE 3EFDL 5EZLB 1UWTA 4XP9H 2CGRL 2Q8XA 3GRWL 3HE6A 1MQKL 2Q8AH 1E0XA 5DD1H 4HGMA 2EDOA 5HHNA 1UFUA 1OOAA 1VFFA 5A2CA 4PTUA 1FNGA 4DZBA 1B4JH 3QJFA 2OYPA 3TO4A 4QRRB 4OGAC 4FFZH 1KFAH 3X12A 1WO2A 1BYDA 2F58H 3HUJA 3QI9D 3QUKA 1KTLB 1NGXA 3WLWD 5I75C 1WCBB 4Q6IA 4J28A 4M29A 5EA0H 4M56A 4GRLD 3A3HA 5C3TA 3TH4T 1MY5A 2MTPA 3DETC 1MRCL 4UV7L 3Q6FB 4F9LC 5CEXB 1CIDA 3S37L 2AJSL 3SDDC 3ZTJG 1BFVH 1YUHA 2WMPA 2M1KA 4FG6D 1AKJB 4GRLB 2FX9H 3CUPB 5LXGH 3AU1A 4GKSA 4JIEA 4LSVH 2XWBA 3QAZB 5C8BB 4ZTPH 5A6BA 3MYZA 1W1PA 1V7NH 2VQ1A 3I50H 4JLRB 2CLVA 5FM5M 2R4SL 4LIQH 3IJ8A 4LSQH 5GRJH 4Y16B 5I8EB 3BKJL 2DGAA 4JQIL 1ACZA 4N9OB 1MWOA 3WELA 5T33L 3BIBX 3AREC 1L7TH 1MJJA 4UQ2B 3QDJA 4TSBL 3DV4B 4PYSA 3V7AG 3U7AA 3ZE0F 4OFYD 5B22A 2A1WL 1Q6EA 3VG9C 4HP5A 3MNVB 2PCPA 2FH8A 2VXQH 4OLYH 1RIVH 1FOBA 1E27B 4IMLB 4F9JA 3M8OH 4Y2DA 3C60D 5CLWA 4OCXH 5T3ZE 3LZFL 2VDML 2VDLL 2AW2A 3SKNB 4NNYA 3D0VA 1FFPB 3RBSA 3RVWD 3VDAA 4PMQA 5ABFA 5TQ2H 3MA7B 3AMGA 3AS2A 3HC3L 3PWVB 4ELKA 1D2KA 3WHE0 2PYFB 3C60B 3MV7D 4FRWA 1XF3A 4LYRA 2EDEA 1BZ9B 3CVHH 1C12B 3MZTA 4X6DB 3SOBH 2E40A 4LSTL 4XP9L 1HZHH 3VI4F 1TVBB 2Q8AL 3TTSA 4JM2D 5DK0A 4RMVA 5DD1L 5CZXC 1UM6H 3RQ3A 3QG6A 3CFKA 4PMVA 1NANH 1IE5A 4M7JH 3VWJA 2GUOB 4RISH 1B4JL 1HI6B 2VLKA 3RNQB 4POZC 5JDJA 2QHRH 4D1JA 1V03A 4FFZL 4KJYA 3QUMH 4PJBF 8FABA 4QFUA 1KFAL 2D3VA 2OI9C 4X6BA 5FA3B 4ZFGH 2F58L 1UR9A 1YN6B 4NM8H 1T4KB 4JKKA 2G8ZA 1LNUB 3FQWB 3TIDA 5EOTA 3QR3A 5EA0L 3VGGA 4KHXH 5CEYB 1A1NB 1UWUA 2NXZC 5CBEB 2UWEE 5K59F 1R3LA 1OWQA 4LBEB 1W0WB 1JNJA 4LNRA 1WDPA 3WD5H 3K1DA 1EIBA 4PV9A 3ULVH 4M5ZL 2FX9L 3HMWL 7FABH 1NDMA 3HAEG 5SWZA 4HDIA 3SPVB 3VA6A 4AM0B 4LSVL 1F4YL 3O4LB 4ZTPL 2NCMA 3UBXA 1V7NL 2HT3D 3I50L 1D6EA 4JAWA 2Z4QA 4P8VA 1Q38A 4LIQL 3F5LA 4LSQL 5GRJL 2WP3T 5MEOA 2XTKA 2CUHA 3BHBA 1CD1B 4FK9A 1YPZA 4KV5E 2UYLB 2ATKB 4FQXD 1FL5A 1TTUA 2XKSA 4H8VA 1UD2A 3EUUA 1U2CA 1YC7A 1KXHA 5DMJB 2IG2L 5JBEA 3HMCA 1HHIA 4NRXA 1U58A 3LAFA 5INCB 2QMKA 3FT3B 4OLYL 4FQXB 1MH5A 1U3JA 2E9BA 3N11A 1M7DA 3IDJA 5DMKA 5C0CE 2WCGA 1M6OA 3HNVH 3M8OL 4DOHE 5F6IB 3UDWC 3ZO0A 2CR6A 2QV4A 2L7UA 4UMGA 1XHGA 4OCXL 3NCOA 4EN3C 4YC2C 3I6KA 1KBKA 2Y2WA 3KR3L 4JL1A 5HGAB 1A7RH 5TQ2L 3F7YB 4PJHF 4NRSA 3PNWA 3LQZB 2VOTA 4YK4C 3SOBL 1MQPA 4HD9A 1UUQA 2IBGA 5ILTH 2NY3C 3B43A 4DUVA 1HZHL 3PZIA 1MELA 1VCAA 1XV8A 1UM6L 2Y25A 5JW4Q 4UIMB 4NO5A 4M7JL 5DWUH 1HN1A 1VPOH 4H26A 4RISL 4HU0A 4UIKH 4WI3A 3O9NA 4L3EA 4F57L 4MNGB 1U41A 3BQUD 3QUML 3MO1A 4LCWB 1EBPA 4ZFGL 5E2TL 5D1ZD 3T77A 5E24E 3HKFA 3G5YA 3O11B 1E5NA 2GJXB 4WHCA 5HGDB 4KY1L 1E40A 4KHXL 3BQUB 4XHJC 4F7PA 5D1ZB 1GHFH 2P45B 4K94L 1BWWA 4CMHB 1T2QH 4IEFB 1FNEA 1H8NA 2X4TB 3ULVL 3OB8A 3WNNA 1EDGA 7FABL 5FAAA 5J7CC 4P7QA 4HC1A 4APQA 3BSHA 1D5ZB 3LD8C 4QHLB 3HNSH 4GUPB 3QUYC 2EDRA 4AMKL 1F58H 4HZAA 5ISZD 5IFJB 1R5WA 4OIAA 5E8OB 5A2JH 5AG8A 4CCDA 1A6VH 2FEDD 1BLIA 4OM0L 1XCTB 2ZOKA 1KPUB 5IHZA 4B15A 5BYWA 1OGAA 3ZKND 4JFFE 4CCEA 4K8RC 5JBDA 3U0WH 2G75A 1IM9A 1A2YA 4PJXE 3U4EA 4UDTB 4H5SB 1UCTA 3N1GC 3BZDA 2J8FA 1NFDA 3KLSA 5CEZE 4PTMA 4A4AA 4D6GA 2HN7B 3F7RA 5TFSL 4ENEC 4HUUA 4R4BA 4Y4FC 5LCVH 3ILPA 3HNVL 4X7SH 5JMOC 3KPNA 4DCQB 4X6EB 5DRZB 1GVIA 4A3HA 1I3VA 5DRXA 4TX8A 1PW3A 2YN3A 3OKNB 5CJQH 3W9EA 5C0BE 4NDMA 1A7RL 5FGBA 1WKYA 4XPTH 1FAKT 3MRCB 1NCBL 1VEPA 1YMMA 3V0AC 1QFPA 2MFNA 4PG9A 1IQWH 4AENA 3P77B 1E6QM 2R39A 2VVSA 5D8WA 3SJVD 5FECB 3TPKA 5I24A 2J8UA 1XCQB 3ROOB 1E4IA 3QXAB 3TVMA 2DQUH 3C5JB 3DRQB 3LPFA 5FOJA 4WW2F 5L9DH 2W0FA 2HJFA 2DRUA 4FZEH 4UIKL 4UT9L 2ZCLH 2Y8VA 2YUWA 5MENE 1CDUA 1T7WA 3BW9A 3EGSB 4HOWA 3EOBA 5E7FA 1MYRA 3NFSL 3HUJF 5CMAA 3WDRA 1B0RA 1FDLH 1W9BM 3T4YB 4R7DB 2RGMA 3WKZA 1W0YT 43CAA 4KUCF 2J88H 2A74B 4ZE4A 4LLVA 4DQOH 3V7MA 4FMVA 4TVPD 2QR0B 4JY4B 2PW2B 2UUDH 1WJ3A 2YK1H 2YUVA 1GHFL 3U46B 1HVXA 2FBJH 1T2QL 1AO7E 4XBPB 4HCRH 4XZBA 5FB8B 5ESAA 1T6WA 4LQ1A 4WFEE 3H42H 3MV8A 2YBRB 5T5FH 2YMXL 5L8JB 1BAGA 1BOGB 1R6VA 4DUWA 4AWEA 3UEZA 4JPWH 4PJ5D 2DQTH 2VQUA 1G5AA 4BKLA 1U8KA 2D2OA 1F58L 4PB0L 4BQBA 2JIWA 1RMFH 5D1XD 1WC7A 3BN3B 3QIBA 1RUQH 1A6VL 3WMSA 2WNGA 4RMUA 4EIZC 1G84A 5HHPB 1W2KT 4PJ5B 1GIGH 2APWA 1KC5L 3R0MA 5IB5A 1TZIB 2OZ4L 4Y5XC 3U0WL 3ZE1E 1HOCA 2BHZA 3WJLC 5D1XB 3OX8A 4JFVA 2R0ZH 3IDGA 1A7OH 1KJMA 2D0GA 4S1RH 2DJUA 1DN2A 5JDSB 2JKXA 3M17A 1CNVA 4F7EB 5DA4A 2BNUB 4AEFA 3IJHB 4OIBA 2X7LB 1ZHNA 2XACC 4X7SL 3RIFK 3QZWG 2O5YH 3AAZA 1JNDA 4UZSA 3L4XA 3IRZA 2Q6WA 1XF4B 1GQKA 2ZXQA 4Z7WA 5I1LB 4EXPX 1E4KA 4S3KA 2L0DA 2VUOA 4E8DA 3C9NB 3FOLB 1DE4A 4LDLB 1IQWL 5CZKA 1KQZA 3BWAB 4NC1C 1OB1B 2JE8A 4JREC 4LHUB 4TNWK 1H3VA 2ZUUA 3MLXH 4R90L 5E2WH 1IV8A 4Y7EA 1E6NA 3OPZH 1I1FB 5J56B 2AOSA 2PBGA 2JTDA 4NM4H 3BN9D 1W72H 2DQUL 3T65B 3A4XA 3CXDH 1PY9A 4QHKJ 3QNXA 3OR6A 5L9DL 1HDMA 3EJJX 1NGZA 4LASH 5FOOA 3O3EB 1MLCA 4FZEL 1AGDB 1I7TB 1SEBA 4HKXA 4NGHH 4H20H 2WSKA 4X4XB 2KL6A 5T3ZD 2NW3B 5J9PB 2GAZA 3ZDYF 2G3IA 2OMNA 1FDLL 5HHOE 4HUNB 2DKSA 5I1HH 2EH8H 2Z35A 1A9BA 1CBVH 4UOQA 3DRTA 1KACB 5IDIA 2ITDB 2BV9A 3EJYD 4PG2A 4PPTA 1NWSA 4LPTA 2VNCA 3OZ9H 2W38A 4OZGA 2FBJL 4PGZA 4M6NH 4GG8B 1D5XA 4TTDD 1PIGA 4Z2GA 3H3BC 4AZBA 5IROA 1HWHB 5KAQF 1RJCA 1HHGA 3DXAA 3H42L 2WVVA 4UNIA 4J7RA 5T5FL 1OP5H 3AXIA 5F21B 1ZXQA 3LVEA 4IHOB 1FFQA 2YR3A 4JPWL 3D18A 1F11A 2EZ0D 5AUMB 5IMOA 4W86A 3GJFH 3CUIA 1QFWM 1RMFL 3WQVA 1Q0XH 1RUQL 2OSLA 3GM0A 5GGRB 4JN1L 1RPQA 1DQTA 1S7SA 3OAZH 4OAWA 3GSVB 2BDNL 1FRGH 2R0ZL 4WUUE 1A7OL 4IIQA 3ZL4H 4S1RL 5F1OB 3NIGF 5ACMA 3MREB 3SCWA 5L0QB 4M81A 1VGEL 1H0DB 4X9BA 4OBSA 4WV1B 3TPUA 3VGEA 3CFBB 1GCFA 4W7VA 4PBVC 4XVSH 5JW4R 2O5YL 4GI9A 3LIZH 2P7TB 4EUPH 1BMGA 1Q9OB 4LX4A 1F6AA 4NQEE 2GK0A 1XIWD 3EFFA 4KDWA 3VD5A 5EOQH 3TV3H 4PJDE 1A22B 2J78A 3VFPA 3VWKB 4AZ7A 1NCAH 4GRLC 4K3GA 3SE4A 2A9MH 4PY7A 3MLXL 4XGZA 4OB5L 4HJGB 3QAZC 3ULUH 1CN4A 4Y4HB 4NM4L 4Z7QE 4FG6C 3TO2A 2OSXA 1W72L 3CJJA 2BSTB 3CXDL 1ZGLM 3OF6D 1XCWA 5ESQA 2RHEA 1X5FA 4Y16C 4DVBA 4PRHD 4NGHL 1EQPA 1K8DA 1MLBA 1FL6B 1HL9A 5B8CB 2FHFA 2MKWA 1CFNB 1GPOL 1NKOA 1R5VB 1JZ2A 2CITA 3IVKA 4IOIA 5CFHA 4IJ3B 4MB1A 1T03H 1B9ZA 3DMMA 1HQRB 5I1HL 1DN0A 3MU7A 3HS0B 5CP3A 4NRYB 4PRHB 1AD0A 4YFLI 4TUFA 1RU9L 3EZ8A 3ZE2E 3VFRB 4ONHA 3T0EB 3O8XD 2AKRA 1AC6A 5I23A 5HDBE 3OZ9L 4I3SH 4HEPG 5BW7C 2SEBA 2XWJB 3QHZH 3QO1A 1HEZA 2PBOA 4R96B 2GJ6D 1KB5A 1MFVA 2DT0A 2AJ3A 3PZOA 1RJZA 5EBGA 5IB1B 3O8XB 3OLEA 4DKEL 3H8NA 4B16A 3C60C 2GJ6B 2EDWA 1VESA 4M7LT 4ZPTA 3S3JA 1IEBA 1IT9H 3IYLW 1HH9B 2J5LB 4H1LH 5J3HC 2VABA 3X11B 5ANMA 1CGTA 4LPYA 3X14B 4D6CA 1JTTA 3ZM8A 1G7PB 3GMLB 2DEPA 1T1ZB 1XZ0A 1FRGL 5EU3B 3TJHC 2EDBA 2XTLA 4ZD3H 3ZL4L 2FWOB 1NFDF 3UC0L 3QCTH 3UTTA 4RAUA 4XH2B 2EDYA 3FO2A 3P73A 4PTWA 2X9YA 4YZFF 3QR2A 2ICWI 5BOPA 1K6AA 5GRUH 1LO2H 4XVSL 2HFGH 2N56A 1CTNA 3LIZL 4YDJA 2NY4B 4GBXA 3MUHL 3SBWC 2Q3AA 3LPPA 3Q5OA 4M1GL 3MJ9L 1MJ8L 2XQYK 1RK1B 5MHSD 5C0EB 2VCCA 4DWSB 2FSEA 1T7XA 5EOQL 5A94A 4I5BB 3TV3L 5E00A 3D9AH 4PJGB 5KVDH 5MEQB 4EDXB 4GSDL 1P9MA 4OGZA 5E9DA 1C16A 4B7LA 1ULVA 2A9ML 5E8EB 2XT1B 3QEQE 3G6JE 4ZUUA 5TH2A 3X13B 1MCQA 5IV2A 3FQXB 1A1MA 4S2SA 1RUML 4PJFB 1ZT7B 1AXSA 4XC1L 4OD3H 4O2CB 3BJLA 4NRZA 2JCCA 1F2XK 1RVFH 4R3SA 2M8XA 1LEKB 3GMMB 5FO9B 2Y72A 4X0KA 4HUMB 2X4SB 1C8PA 2LTQB 2HT3C 1NAKH 3HG1E 1ZT1A 1NLDH 2VDRL 3KPSA 3MGOB 1T5XA 5C0BD 1KPVA 1T03L 5C2UB 4QF1A 2N1KA 2I07A 1P5VA 1MCIA 3MLYH 4C56A 4FQXC 4NO3B 4K3DL 3PWLA 4HIIB 3VW3H 5IOPA 2BVUA 3L3JA 5F6IC 3QIUB 4M00A 3QHZL 1OAZH 2A9NH 2F54A 4YPGB 1XR8B 1Z0MA 2I27N 1S7TA 4XZUA 4W85A 3ALGA 4W6XB 1F97A 4LSUH 1Z9OA 4M7ZB 4G6AD 4LLUA 4YBLB 3BGFB 4BK4A 1X6NA 5FIPA 1B0GB 2AK4E 3OGCB 1IT9L 1IC1A 3QHOA 2EJ1A 2IPKB 4I0PD 5DD3H 3VRLE 2MJWA 2YN5A 5T1KB 2C1OA 2AEQH 2YOCA 2ZPKH 1P6FA 5EWIH 3UJTH 1SHMA 1V3LA 1MAKA 4LLAA 1AO7D 5F7DA 4ZD3L 4I0PB 2BNRD 4PJCB 1ROWA 3QCTL 1OTTC 1X7QB 1E5JA 3HC0A 4G5ZL 4WFED 2P44B 2E7HA 4Z77A 1P7QD 4OZFA 3WL9A 5L2KE 4A3YA 3X3GH 4HWBH 2YD7A 2R1XA 2BNRB 1EK3A 3L3OA 5JNYB 1PZ5A 2NLJA 3JV4A 3BQUC 4XAWH 3PZGA 1CECA 5A6JA 1IEAB 3DARA 1V8HA 5FYJH 5D1ZC 2IANE 2EYTA 4CMHC 1P7QB 4QTHB 3WF4A 4YXKL 3NCYP 3D9AL 5KVDL 43C9A 3LS5H 4QLKA 2EE9A 1PSKH 3VD9A 4DN4H 1RZJH 2YBUA 4HT1H 4FXKB 3WN6A 3ZSTA 6FABH 4AZ8A 1A1OA 4QRTA 4PBGA 5C6WH 3TTYA 5HY9A 4N0UB 1G01A 4HZLA 5TQ0L 1OAQH 1ZA3B 3VE0A 4HWEL 4OD3L 4NT6B 2BVOA 1YNLH