3L28A

Crystal structure of zaire ebola vp35 interferon inhibitory domain k339a mutant
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
123
structure length
123
Chain Sequence
DISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for dsRNA recognition and interferon antagonism by Ebola VP35.
pubmed doi rcsb
source organism Zaire ebolavirus
molecule tags Rna binding protein
molecule keywords Polymerase cofactor VP35
total genus 37
structure length 123
sequence length 123
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3l28A01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 3l28A02
4GHAA 4IJEA 3KS8A 4IBBA 4GHLA 5BPVA 4IBCA 4IJFA 4IBDA 4IBFA 3L29A 3L25A 4LG2A 3FKEA 4GH9A 3L27A 4IBGA 4IBJA 4IBIA 3L28A 4IBKA 4IBEA 3L26A 3L2AA 3KS4A
chains in the Genus database with same CATH superfamily
1PJSA 1NV8A 4GIPA 2HCBA 4JI0M 3U6OA 1Q02A 1N33M 2CRUA 3HU2A 4FWHA 3GLFA 1NSFA 3HJQA 4IBBA 2ZANA 3C3DA 1PJJA 1R2ZA 5EP3A 3U61B 2KXEA 4LGYA 2FS1A 2KNAA 5EP4A 2F5QA 4OJ5A 4XBOA 1QVRA 4Y28F 4B7FA 5BR8M 3IECA 3KFUG 2EKKA 1PRBA 2ZBKB 4KHPM 1OJLA 1Y8GA 4CISA 2LVNC 2KW0A 2OOBA 1ORYB 4GRIA 3SATA 3WHLA 4QOZC 3E46A 3ZCBB 1XXHA 4IBKA 3Q8GA 2J7NA 3B7QA 3KP0E 3RFWA 4Z2GA 1G3IA 1YU4A 4F2LA 1QYRA 4JI6M 5ITQA 4ITQA 1DGFA 3VDPA 1VDLA 3U60A 3GPXA 1Z5CA 2LHGA 2LVQD 3UJNA 4JI4M 4JI2M 4GHAA 1VQ1A 4M0WA 2DAIA 4NZ1A 5FTKA 3EIEA 3ZC7B 3KS8A 3A45A 3GLIA 2GQFA 2L7HA 2ZTDA 1NJGA 2LXEA 4G6ZA 4GC5A 4IBDA 4HL4A 2DWLA 2F4VM 3FTEA 1YLAA 4DUZM 4PDIA 3GLGA 2L4FA 1R5LA 1TDHA 4CIZA 3K2LA 3KVWA 2UXDM 5JI3E 2CUZA 4PT5A 3IG8A 3CF2A 1YUBA 1WGNA 3QYBA 3AL0C 2FFFB 2L2DA 1OIPA 3U6EA 1PGYA 1Z5AA 3GQ3A 3AFHA 1QUSA 1AUAA 2Z4RA 4B7GA 4DBGB 3LCUA 3B74A 1IXSA 1D0KA 2QZ4A 2CP8A 4RF0A 3HJ8A 5EXXA 2LVAA 3KOXE 1DO0A 4F1IA 8CATA 3EIHA 3GQ4A 4NY2A 2NQ8C 1UM8A 3HKPA 2C5RA 4JI8M 1YUEA 3HU1A 1ED7A 1NY6A 3V76A 4AG6A 3SARA 2M60A 4AZFA 2XSZD 3FUXA 1ZMUA 2DHYA 3WD3A 4L78A 1JR3E 3U60B 4YY3M 1IY2A 1Q39A 1NNUC 1TTEA 4LJ6A 1UR8A 3HY5A 3FUUA 3GRUA 2VQFM 4NRWA 3J81S 1XNRM 1PJTA 1IN7A 5FTMA 3VDUA 3J2PB 3MQLA 2DHRA 1DGHA 4RF1A 2D7HA 2C99A 4X65M 2XD5A 1E6NA 2VF8A 2HL7A 4BB9A 3UMMA 4FW9A 4S12A 1D2NA 2YFQA 2EO2A 3U6CA 4CJ6A 4AKIA 3H4JA 3HGIA 1GKIA 2Z4SA 1RU3A 2BWBA 5C1BA 4AI6A 4K0KM 2VQEM 1TH3A 1QAOA 4Z6YA 1W1TA 3HSHA 3E21A 4AW4A 1L2BA 1OAIA 3HHZA 2Z7JA 3FKEA 1EAKA 3SMSA 3KSJA 1TH4A 2VF7A 1D0MA 4IBGA 1Z5BA 4JXJA 4NOOB 4NL4H 3SHGB 2F5PA 2HKJA 3GP1A 2DAKA 3GPUA 2OQ4A 4QNMA 1HJPA 4IIWA 3U6MA 4OJ6A 2CHQA 3T38A 4LF6M 2MJ5B 1CUKA 1YU0A 4ZPXA 1QAMA 3GPPA 2ZAOA 1T3TA 1WXQA 3WD4A 2Y2KA 4LJ7A 3MK6A 4FWGA 3TQSA 3J7BA 4KO8A 1SXJA 2Y0QA 4X62M 2APLA 4DR7M 1IBMM 1GVNA 1E6ZA 4DR4M 4I4LA 3GPYA 2JP7A 4LG2A 2DZNB 2HAKA 1IM2A 2O01F 2CHGA 2ZAMA 3E4RA 3THGA 3VKHA 2B3TA 1YU2A 2IOUA 3DZDA 3BOSA 2XZUA 1QO6A 1GLNA 1N78A 2DAMA 5DFLA 5EXTA 2A5YB 1SXJB 4TX8A 3WX7A 1E15A 5KPRA 3VKGA 1PJIA 3FD9A 1OQYA 1QZEA 1YSYA 2QPAA 4OW0A 3AKZA 1W1PA 3ZH9B 1V92A 3U5ZB 1VEGA 2MROB 4GEWA 1G4AE 3T1HM 3HONA 4NZ3A 2Y20A 1YE9A 4GHLA 4OVZA 5BPVA 2QQ8A 2RGHA 1KYIA 4R7GA 1IN6A 1NY5A 5KQ8A 5EJCA 1WGLA 2RGOA 1KS0A 2VDBB 2MR9A 1FJGM 4TUWA 4MB4A 1OGGA 3QYEA 1CK7A 4Z2JA 3SAWA 3HU3A 1QAQA 1XMQM 1VG5A 4XGIA 4IBIA 4WW0A 2DWZB 4M9SA 1R2YA 2Y2HA 4IBEA 2RRUA 2Y2IA 2M5ZA 4P16A 2KDLA 4DV4M 3KOYE 3GLIB 1TH2A 4B3TM 2UWXA 4I81A 5DYGA 3I4YA 1HNWM 2FE8A 3QAUA 1VEKA 2H1RA 3TWKA 4FCTA 1E6PA 3CF0A 2DVWB 3UZUA 2N35A 2J7OA 3FRIA 1G41A 3KP1E 1N34M 5ITXA 2J5YA 4LCBA 3VK7A 4JYAM 4GMQA 4MB5A 5DYIA 2E5LM 1IN8A 2O5RA 2YR0A 5LMNM 4FCWA 1XHBA 1E94E 1DV0A 3GRRA 3HJSA 2XFSA 1L1ZA 1IBLM 3IG5A 2OPFA 3KW6A 4LGMA 1J5EM 3HHWA 1OKSA 3L28A 2JZ1A 2D7EA 3U6LA 2CV1A 1HT2E 1XWIA 1IQPA 1IXRC 3A98B 3ZQJA 3WD1A 1LTMA 2QBYA 2QENA 4M0DA 3U5ZA 4R71A 4L15A 2MGWA 3GLGB 4DV1M 4DV6M 1GABA 2KRUA 3FUTA 5A2QS 2Y2JA 2YNMD 3RGSA 4LY6A 4NYUA 3LVWA 1YU1A 4REZA 1HQYE 2O25A 5E26A 4LJ8A 1T43A 4DV0M 3SBJA 3QWLA 1NV9A 1QDRA 4IBCA 4LRTA 3VFDA 4BLCA 3U6PA 2R45A 4DR2M 1W1VA 1VDDA 4OX9M 1H0IA 3L25A 2Y21A 2LHCA 4JI1M 5FTNA 1PM5A 1OGBA 3W0LB 1A5TA 1E9SA 3I01M 3MHVC 4QHSA 4D80A 5ITTA 4DV5M 1K3XA 4GH9A 1HNXM 4JV5M 3DFZA 4EIWA 1E6RA 3U6SA 5IT9S 5L8RF 2G5GX 4RKUF 4NC6A 2XEPA 2Y2OA 2DWMA 2LWXA 2HHHM 2QHOB 3C3EA 3KXEC 2C9OA 4KT0F 5IZ7D 1L6JA 3KS4A 1ZQ9A 4DV2M 3AOEC 1IN4A 2QCUA 4MGHA 5H37D 3HWSA 4G4QA 4YHHM 1G8PA 1CXWA 2CHVA 2HWJA 1IY0A 3HX3A 3U61A 3TWLA 1KSFX 1N75A 3MJ5A 1N77A 3IHPA 3GLFB 5F3WA 3FTDA 3J27B 1XXHB 4M9ZA 2KZSA 4DR3M 4AQYM 3R8FA 4JI7M 2FH0A 1GPFA 1H8PA 1V33A 3D8LA 1XB2B 4GKJM 3LVVA 1GXDA 2DENA 2LVOC 2UUBM 2DWNA 4Z2KA 3LW5F 2UUCM 4LF9M 4LFAM 2X4AA 3M0EA 1GJSA 2FN2A 3GRVA 4FCVA 4OVZB 4Q7JA 5KPTA 3I4VA 4UN2B 3JR5A 2UU9M 2Y2MA 1E9RA 5FSWA 2XF3A 2GNOA 3FYDA 3C9PA 1BVSA 3CTWB 2XH9A 1XXHE 3GLHE 5EQTA 3NBXX 5FLXS 3JR4A 1IBKM 1J7MA 3GLFE 1SG9A 1E88A 2DZOB 1HT1E 1IXZA 4HLQA 4QNRA 5GKNA 3BBZA 1TDZA 1K82A 2JE5A 4IJFA 1DGHB 1MX0A 1QZMA 4DR5M 4R3DA 2KHHA 2UXCM 2K47A 4I5SA 1DGBA 2DXIA 2R18A 2R44A 5ITXE 4B3MM 1GJTA 2V6ZM 1SXJD 5EXPA 1YU3A 3L27A 2BWEA 3I04M 5JI2E 4Z2LA 4DV3M 4W5WA 3B7ZA 3B9PA 4MM3B 4NSOB 3C58A 2JWSA 1N36M 3L26A 1QQWA 3M7PA 2FFJA 2R62A 3SASA 1L1TA 2F5NA 4NZ5A 2Y2PA 3MMPA 2LVPC 3TPZA 3U6DA 2UXBM 3N3FA 3W68A 1G59A 3T6PA 7CATA 4KLNA 3PFIA 4JI5M 2KRKA 2L6OA 3GLGE 3L29A 1ZV1A 4G4OA 2R65A 3CF6E 3M7GA 2BJWA 2R0IA 3SYLA 2XZFA 1ZAEA 2DZLA 4HEOA 3WD0A 4FWDA 4MGIE 1DGGA 4QHTA 1I4WA 1H6UA 2JA2A 2LH0A 1JR3A 3PNYA 4BBAA 2RTSA 2H5XA 3HHYA 3GLHB 2QBYB 1KFVA 3SAUA 2Y2QA 3T15A 1F4IA 3RE8A 1P3QQ 2BJVA 3T1YM 2F5SA 2LTUA 4P17A 3K1JA 3PNVA 2P5TA 1EFUB 3J7AS 1GL7A 3DA1A 5FTJA 4IJEA 1VEJA 2DNAA 4NYYA 2DKLA 4X66M 2JXNA 4NXMM 1W5SA 3SHFA 3SYKA 1MN3A 4GITA 4LJ5A 1T6OA 1WJ7A 1NO1A 2CEAA 2DI0A 2CV2A 3CGWA 4FD2A 1TGUA 2KNZA 4LF4M 1J09A 2Y0TA 1GO5A 2Y2LA 4PD2A 1OFIA 1H0GA 1XNQM 3TL4X 1PJQA 4A3VB 4PCZA 4HMCA 1Z59A 1XC8A 2Y2GA 4PDGA 3VLFB 1AIPC 5KQDA 2DAEA 2ZM6M 3LCVB 4M9XA 2D7GA 4WP2A 5EXSA 2QNJA 1UR9A 1OAOC 4DV7M 3K9PA 2BG1A 1AIWA 2I7NA 2K0BX 4JI3M 2F5OA 1O6IA 1WHCA 3LQRA 3A46A 2R6FA 4LRSA 2JY7A 2R46A 3FE3A 1QDTA 3E9SA 3FUVA 2FNAA 1NJFA 2OOAA 2W82A 2Z8YM 4L4UA 3W67A 5C18A 4L8RC 5ITUA 3FTFA 1GOIA 1TR8A 3ILKA 1WR1B 5ITYA 4OUIA 3WD2A 2K9DA 2DAGA 2EUCA 2XSZA 4IBJA 1R6BX 2KA6B 2RKOA 4XK8F 3PXGA 2JY5A 4LZJA 4MH0E 4DR6M 4L16A 4NZ4A 4Z2HA 2EJSA 2BNKA 1OTRA 4NSRA 4MB7A 3L2AA 4AG5A 5IWAM 4LFCM 4GKKM 3KOZE 1X37A 3LMMA 4JN6A 1N32M 4AKHA 3FUWA 2L7IA 4NXNM 3Q8XA 3J80S 5EP1A 5KPZA 3K9OA 3JAMS 4DR1M 3U6QA 3B7NA 1ZMWA 4DUYM 4LZZA 5FTLA 2Y2NA 3H4MA 4MGZE 4B7HA 1JB0F 3DOAA 2CWBA 1IN5A 5LMUM 1XMOM 1DO2A 2LNHC 1UFZA 1C7YA 3BXWA 4G4NA 3A42A 3AJIB 2KZUA 4G3OA 4L6V6 4HMEA 2WSFF 2WSEF 1WIVA 3UK6A 3M6AA 4LF7M 1HQCA 2EA0A 4LF5M 2OO9A 1S3SA 3LQQA 1MJGM 2V1CA 4X64M 3VK8A 2UUAM 4LF8M 5DNYA 1C1KA 2XFTA 4D81A 1I94M 2C96A 3AOGA 1FNNA 4MGKE 2JUJA 1OIZA 2X8AA 4D82A 1JQJC 2X49A 3AOEA 4II7A 1PDCA 3WHKA 3TWMA 1G71A 2V1UA 4Z2IA 2JNHA 3GLIE 1K3WA 4AKGA 1Q3CA 1Q3BA 4CHTB 3UGJA 1IFYA 2QP9X 3GLHA 5KO3A 3HZJA 1NHGC 4FVMA 4LJ9A 1L2DA 2K6BA 3SFZA 1HNZM 3SMPA 4HMDA 4RNAA 2ZTCA 1Z6TA 2YQZA 2I7PA 1IXSB 1D0LA 3OTOM 4OJPA 2C9CA 1MU5A 5E6JA 1SXJC 4WURA 3I51A 1V34A 3FTCA 1L8QA 4CGYB 3KDSE 2ERCA 3GQ5A 2WSCF 3FRHA 1OFHA 5IREB 4OJLA 4LJ4A 4G4RA 4MGYE 2D49A 2L09A 3NBIA 1E32A 1NVMA 1EIJA 2CV0A 4KODA 5EP2A 2G3QA 4OU7A 1R4GA 2JY6B 3K92A 1QUTA 1QANA 4B08A 2KEBA 4LJAA 3HHXA 2CFOA 2Z3XA 3KOWE 1SXJE 2G8LA 1JR3D 2JZ0A 2R4EA 1J7KA 2Q2EB 3AV0A 3F92A 2AHMA 4I8OA 3GO8A 4B3SM 1LV7A 1IY1A 1EE8A 2XGNA 2R4JA 3RGPA 5ITRA 1W5TA 2XLJA 2XD1A 4QOSA 4QNLA 2CE7A 4ANRA 1W1YA 4IBFA 4GC9A 1NNJA 2VIIA 3D8BA 4LFBM 1E8BA 3KSXA 3B89A 2EKFA 2LBCA 1TF0B 1HR0M 2JY8A 4MB3A 2C98A 3PVSA 2KNVA 1NHWC 2FOIC 4NRVA 4OJOA 4Z8XA 1GL6A 1R7RA 2WZJA 3GRYA 2V5OA 3K8ZA 3SC3A 1L2CA 2L4EA 3FYCA 3R9XB 1ZMVA 3NWLA 3SAVA 2QSFX 2JCHA 4B3RM 2MH8A 3W0FA 3TE6A
chains in the Genus database with same CATH topology
4GIPA 2HCBA 4JI0M 3U6OA 1N33M 3HU2A 4FWHA 3GLFA 1NSFA 3HJQA 4IBBA 2ZANA 1PJJA 1R2ZA 5EP3A 3U61B 2KXEA 4LGYA 5EP4A 2F5QA 4OJ5A 4XBOA 1QVRA 4B7FA 5BR8M 3KFUG 2ZBKB 4KHPM 1OJLA 4CISA 2KW0A 3SATA 1ORYB 4GRIA 3WHLA 4QOZC 3ZCBB 1XXHA 4IBKA 2J7NA 3KP0E 3RFWA 1G3IA 1YU4A 1QYRA 4JI6M 4ITQA 1DGFA 3VDPA 3U60A 3GPXA 1Z5CA 3UJNA 4JI4M 4JI2M 4GHAA 4M0WA 4NZ1A 5FTKA 3EIEA 3ZC7B 3KS8A 3A45A 3GLIA 4OJOA 2L7HA 4G6ZA 1NJGA 2LXEA 4GC5A 4IBDA 2DWLA 4HL4A 3FTEA 1YU0A 4OJLA 4DUZM 4PDIA 3GLGA 2UXDM 1TDHA 3K2LA 3KVWA 5JI3E 2CUZA 4PT5A 3IG8A 3CF2A 1YUBA 3AL0C 2FFFB 3U6EA 1Z5AA 3GQ3A 3AFHA 2Z4RA 4B7GA 2QZ4A 4RF0A 3HJ8A 5EXXA 3KOXE 1DO0A 8CATA 3EIHA 3GQ4A 4NY2A 2NQ8C 1UM8A 3HKPA 2C5RA 4JI8M 1YUEA 3HU1A 1NY6A 4AG6A 3SARA 2M60A 4AZFA 2XSZD 3FUXA 4L78A 3U60B 4YY3M 1IY2A 1Q39A 1NNUC 4LJ6A 3FUUA 3GRUA 2VQFM 4NRWA 3J81S 1XNRM 5FTMA 1IN7A 3VDUA 3J2PB 2DHRA 1DGHA 4RF1A 2D7HA 2C99A 4X65M 2XD5A 2HL7A 4BB9A 3UMMA 4FW9A 4S12A 1D2NA 2YFQA 2EO2A 3U6CA 4AKIA 3HGIA 1GKIA 2Z4SA 5C1BA 4AI6A 4K0KM 2VQEM 1TH3A 1QAOA 4Z6YA 3HSHA 1L2BA 4AW4A 3HHZA 2Z7JA 3FKEA 3SMSA 3KSJA 1TH4A 4IBGA 2F5PA 4NOOB 1Z5BA 4JXJA 4NL4H 3SHGB 2HKJA 3GP1A 3GPUA 2OQ4A 4QNMA 3U6MA 4IIWA 4OJ6A 2CHQA 3T38A 4LF6M 4ZPXA 1QAMA 3GPPA 2ZAOA 1T3TA 1WXQA 2Y2KA 4LJ7A 3MK6A 4FWGA 3TQSA 3J7BA 4KO8A 1SXJA 2Y0QA 4X62M 4DR7M 1GVNA 4DR4M 4I4LA 3GPYA 4LG2A 2DZNB 2ZAMA 1IM2A 3VKHA 2CHGA 3E4RA 3THGA 1YU2A 2IOUA 3DZDA 3BOSA 2XZUA 1GLNA 1N78A 5EXTA 2A5YB 1SXJB 5KPRA 3VKGA 1PJIA 3FD9A 1YSYA 2QPAA 3AKZA 3ZH9B 3U5ZB 4NZ3A 1G4AE 3T1HM 3HONA 2Y20A 1YE9A 4GHLA 4OVZA 5BPVA 2RGHA 1KYIA 4R7GA 1IN6A 1NY5A 5KQ8A 5EJCA 2RGOA 1FJGM 4TUWA 3SAWA 3HU3A 1QAQA 1XMQM 4XGIA 4IBIA 4WW0A 2DWZB 4M9SA 1R2YA 2Y2HA 4IBEA 2Y2IA 2M5ZA 4P16A 4B3TM 4DV4M 3KOYE 3GLIB 1TH2A 2UWXA 4I81A 5DYGA 3I4YA 1HNWM 2FE8A 3QAUA 2H1RA 3TWKA 4FCTA 3CF0A 2DVWB 3UZUA 2J7OA 1G41A 3KP1E 1N34M 5ITXA 4LCBA 3VK7A 4JYAM 4GMQA 5DYIA 2E5LM 1IN8A 2O5RA 2YR0A 5LMNM 4FCWA 1XHBA 1E94E 3GRRA 3HJSA 2XFSA 1L1ZA 1IBLM 3IG5A 2OPFA 3KW6A 4LGMA 1J5EM 3HHWA 3L28A 2D7EA 3U6LA 2CV1A 1HT2E 1XWIA 1IQPA 1IXRC 3A98B 2QBYA 2QENA 4M0DA 3U5ZA 4DV1M 4L15A 4DV6M 3GLGB 2Y2JA 2KRUA 3FUTA 5A2QS 2YNMD 3RGSA 4LY6A 4NYUA 3LVWA 1YU1A 4REZA 1HQYE 5E26A 4LJ8A 4DV0M 3SBJA 3QWLA 4IBCA 4LRTA 3VFDA 4BLCA 3U6PA 1IBMM 2R45A 4DR2M 3WX7A 1VDDA 4OX9M 3L25A 2Y21A 4JI1M 5FTNA 1PM5A 3W0LB 1E9SA 2F4VM 3MHVC 4D80A 4QHSA 5ITTA 4DV5M 1K3XA 4JV5M 4GH9A 3DFZA 4EIWA 3U6SA 5IT9S 2G5GX 2XEPA 2Y2OA 2DWMA 2LWXA 2HHHM 3KXEC 2C9OA 5IZ7D 3KS4A 1ZQ9A 4DV2M 3AOEC 1IN4A 2QCUA 4MGHA 5H37D 3HWSA 4G4QA 4YHHM 1G8PA 2CHVA 1IY0A 3U61A 3TWLA 1KSFX 1N75A 3MJ5A 1N77A 3GLFB 5F3WA 3FTDA 3J27B 1XXHB 4M9ZA 2KZSA 4DR3M 4AQYM 3R8FA 4JI7M 3D8LA 4GKJM 3LVVA 2UUBM 2DWNA 2UUCM 4LF9M 4LFAM 2X4AA 3M0EA 3GRVA 4FCVA 4OVZB 5KPTA 3I4VA 3JR5A 2UU9M 2Y2MA 1E9RA 5FSWA 2XF3A 3FYDA 5EQTA 1HNXM 3CTWB 2XH9A 1IBKM 3JR4A 5FLXS 2DZOB 1HT1E 1IXZA 4HLQA 4QNRA 5GKNA 1TDZA 1K82A 2JE5A 4IJFA 1DGHB 1MX0A 1QZMA 4DR5M 4R3DA 2UXCM 2K47A 4I5SA 1DGBA 2DXIA 2R18A 5ITXE 4B3MM 5EXPA 2V6ZM 1SXJD 1YU3A 3L27A 5JI2E 4DV3M 4W5WA 4NSOB 3B9PA 4MM3B 3C58A 1N36M 3L26A 1QQWA 2FFJA 2R62A 3SASA 1L1TA 2F5NA 4NZ5A 2Y2PA 3TPZA 3U6DA 2UXBM 3N3FA 1G59A 7CATA 4KLNA 3PFIA 4JI5M 2KRKA 2L6OA 3L29A 4G4OA 2R65A 3CF6E 3M7GA 2BJWA 3SYLA 2XZFA 1ZAEA 4FWDA 4MGIE 1DGGA 4QHTA 1I4WA 1H6UA 3PNYA 2JA2A 1JR3A 2LH0A 4BBAA 3HHYA 3GLHB 2QBYB 1KFVA 3SAUA 2Y2QA 3T15A 3RE8A 2BJVA 3T1YM 2F5SA 3K1JA 3PNVA 2P5TA 1GL7A 3DA1A 5FTJA 4IJEA 4NYYA 4X66M 4NXMM 1W5SA 3SHFA 3SYKA 4GITA 4LJ5A 2CEAA 2CV2A 4LF4M 4FD2A 1TGUA 2Y2LA 1J09A 2Y0TA 4PD2A 1OFIA 1XNQM 3TL4X 4A3VB 4PCZA 1Z59A 1XC8A 2Y2GA 4PDGA 3VLFB 5KQDA 4M9XA 2D7GA 5EXSA 4DV7M 2BG1A 2I7NA 4JI3M 2F5OA 3LQRA 3A46A 4LRSA 2R46A 3E9SA 3FUVA 4L4UA 2FNAA 1NJFA 5C18A 2W82A 4L8RC 3FTFA 5ITUA 3ILKA 5ITYA 4OUIA 4IBJA 2XSZA 2EUCA 1R6BX 2KA6B 2RKOA 3PXGA 4LZJA 4MH0E 4DR6M 4L16A 4NZ4A 2BNKA 4NSRA 4MB7A 3L2AA 4AG5A 5IWAM 4LFCM 4GKKM 3KOZE 1X37A 3LMMA 4JN6A 1N32M 4AKHA 3FUWA 2L7IA 4NXNM 3Q8XA 3J80S 5EP1A 5KPZA 3JAMS 4DR1M 3U6QA 4DUYM 4LZZA 5FTLA 2Y2NA 3H4MA 4MGZE 4B7HA 3DOAA 1XMOM 1IN5A 5LMUM 1DO2A 2LNHC 4G4NA 3A42A 3AJIB 2KZUA 3UK6A 3M6AA 4LF7M 1HQCA 2EA0A 4LF5M 1S3SA 3LQQA 4X64M 2V1CA 3VK8A 2UUAM 4LF8M 5DNYA 1C1KA 2XFTA 4D81A 1I94M 2C96A 3AOGA 1FNNA 4MGKE 4D82A 5ITQA 2X8AA 1JQJC 2X49A 3AOEA 4II7A 3WHKA 3TWMA 2V1UA 4AKGA 1K3WA 1Q3CA 1Q3BA 4CHTB 3UGJA 2QP9X 3GLHA 5KO3A 1NHGC 4FVMA 4LJ9A 1L2DA 3SFZA 1HNZM 3SMPA 4RNAA 1Z6TA 2YQZA 2I7PA 1IXSB 3OTOM 4OJPA 2C9CA 1MU5A 5E6JA 1SXJC 4WURA 3I51A 3FTCA 4CGYB 1L8QA 3GQ5A 3KDSE 2ERCA 5IREB 1OFHA 4LJ4A 4G4RA 4MGYE 2L09A 3NBIA 1E32A 1NVMA 2CV0A 4KODA 5EP2A 4OU7A 4B08A 3K92A 1QANA 2KEBA 4LJAA 3HHXA 2CFOA 2Z3XA 3KOWE 1SXJE 2G8LA 1JR3D 4OW0A 1J7KA 2Q2EB 2R4EA 3AV0A 4I8OA 2AHMA 3GO8A 3J7AS 4B3SM 1LV7A 1IY1A 1EE8A 2XGNA 2R4JA 3RGPA 5ITRA 1W5TA 2XLJA 2XD1A 4QOSA 4QNLA 2CE7A 4IBFA 4GC9A 1NNJA 2VIIA 3D8BA 4LFBM 3KSXA 1HR0M 2C98A 3PVSA 1NHWC 2FOIC 4NRVA 4Z8XA 1R7RA 1GL6A 3GRYA 3K8ZA 3SC3A 1L2CA 3FYCA 3R9XB 3NWLA 3SAVA 2JCHA 4B3RM 2ZM6M 3W0FA 3TE6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GHA A;  4IJE A;  3KS8 A;  4IBB A;  4GHL A;  5BPV A;  4IBC A;  4IJF A;  4IBD A;  4IBF A;  3L29 A;  3L25 A;  4LG2 A;  3FKE A;  4GH9 A;  3L27 A;  4IBG A;  4IBJ A;  4IBI A;  3L28 A;  4IBK A;  4IBE A;  3L26 A;  3L2A A;  3KS4 A; 
#chains in the Genus database with same CATH topology
 1PJS A;  1NV8 A;  4GIP A;  2HCB A;  4JI0 M;  3U6O A;  1Q02 A;  1N33 M;  2CRU A;  3HU2 A;  4FWH A;  3GLF A;  1NSF A;  3HJQ A;  4IBB A;  2ZAN A;  3C3D A;  1PJJ A;  1R2Z A;  5EP3 A;  3U61 B;  2KXE A;  4LGY A;  2FS1 A;  2KNA A;  5EP4 A;  2F5Q A;  4OJ5 A;  4XBO A;  1QVR A;  4Y28 F;  4B7F A;  5BR8 M;  3IEC A;  3KFU G;  2EKK A;  1PRB A;  2ZBK B;  4KHP M;  1OJL A;  1Y8G A;  4CIS A;  2LVN C;  2KW0 A;  2OOB A;  1ORY B;  4GRI A;  3SAT A;  3WHL A;  4QOZ C;  3E46 A;  3ZCB B;  1XXH A;  4IBK A;  3Q8G A;  2J7N A;  3B7Q A;  3KP0 E;  3RFW A;  4Z2G A;  1G3I A;  1YU4 A;  4F2L A;  1QYR A;  4JI6 M;  5ITQ A;  4ITQ A;  1DGF A;  3VDP A;  1VDL A;  3U60 A;  3GPX A;  1Z5C A;  2LHG A;  2LVQ D;  3UJN A;  4JI4 M;  4JI2 M;  4GHA A;  1VQ1 A;  4M0W A;  2DAI A;  4NZ1 A;  5FTK A;  3EIE A;  3ZC7 B;  3KS8 A;  3A45 A;  3GLI A;  2GQF A;  2L7H A;  2ZTD A;  1NJG A;  2LXE A;  4G6Z A;  4GC5 A;  4IBD A;  4HL4 A;  2DWL A;  2F4V M;  3FTE A;  1YLA A;  4DUZ M;  4PDI A;  3GLG A;  2L4F A;  1R5L A;  1TDH A;  4CIZ A;  3K2L A;  3KVW A;  2UXD M;  5JI3 E;  2CUZ A;  4PT5 A;  3IG8 A;  3CF2 A;  1YUB A;  1WGN A;  3QYB A;  3AL0 C;  2FFF B;  2L2D A;  1OIP A;  3U6E A;  1PGY A;  1Z5A A;  3GQ3 A;  3AFH A;  1QUS A;  1AUA A;  2Z4R A;  4B7G A;  4DBG B;  3LCU A;  3B74 A;  1IXS A;  1D0K A;  2QZ4 A;  2CP8 A;  4RF0 A;  3HJ8 A;  5EXX A;  2LVA A;  3KOX E;  1DO0 A;  4F1I A;  8CAT A;  3EIH A;  3GQ4 A;  4NY2 A;  2NQ8 C;  1UM8 A;  3HKP A;  2C5R A;  4JI8 M;  1YUE A;  3HU1 A;  1ED7 A;  1NY6 A;  3V76 A;  4AG6 A;  3SAR A;  2M60 A;  4AZF A;  2XSZ D;  3FUX A;  1ZMU A;  2DHY A;  3WD3 A;  4L78 A;  1JR3 E;  3U60 B;  4YY3 M;  1IY2 A;  1Q39 A;  1NNU C;  1TTE A;  4LJ6 A;  1UR8 A;  3HY5 A;  3FUU A;  3GRU A;  2VQF M;  4NRW A;  3J81 S;  1XNR M;  1PJT A;  1IN7 A;  5FTM A;  3VDU A;  3J2P B;  3MQL A;  2DHR A;  1DGH A;  4RF1 A;  2D7H A;  2C99 A;  4X65 M;  2XD5 A;  1E6N A;  2VF8 A;  2HL7 A;  4BB9 A;  3UMM A;  4FW9 A;  4S12 A;  1D2N A;  2YFQ A;  2EO2 A;  3U6C A;  4CJ6 A;  4AKI A;  3H4J A;  3HGI A;  1GKI A;  2Z4S A;  1RU3 A;  2BWB A;  5C1B A;  4AI6 A;  4K0K M;  2VQE M;  1TH3 A;  1QAO A;  4Z6Y A;  1W1T A;  3HSH A;  3E21 A;  4AW4 A;  1L2B A;  1OAI A;  3HHZ A;  2Z7J A;  3FKE A;  1EAK A;  3SMS A;  3KSJ A;  1TH4 A;  2VF7 A;  1D0M A;  4IBG A;  1Z5B A;  4JXJ A;  4NOO B;  4NL4 H;  3SHG B;  2F5P A;  2HKJ A;  3GP1 A;  2DAK A;  3GPU A;  2OQ4 A;  4QNM A;  1HJP A;  4IIW A;  3U6M A;  4OJ6 A;  2CHQ A;  3T38 A;  4LF6 M;  2MJ5 B;  1CUK A;  1YU0 A;  4ZPX A;  1QAM A;  3GPP A;  2ZAO A;  1T3T A;  1WXQ A;  3WD4 A;  2Y2K A;  4LJ7 A;  3MK6 A;  4FWG A;  3TQS A;  3J7B A;  4KO8 A;  1SXJ A;  2Y0Q A;  4X62 M;  2APL A;  4DR7 M;  1IBM M;  1GVN A;  1E6Z A;  4DR4 M;  4I4L A;  3GPY A;  2JP7 A;  4LG2 A;  2DZN B;  2HAK A;  1IM2 A;  2O01 F;  2CHG A;  2ZAM A;  3E4R A;  3THG A;  3VKH A;  2B3T A;  1YU2 A;  2IOU A;  3DZD A;  3BOS A;  2XZU A;  1QO6 A;  1GLN A;  1N78 A;  2DAM A;  5DFL A;  5EXT A;  2A5Y B;  1SXJ B;  4TX8 A;  3WX7 A;  1E15 A;  5KPR A;  3VKG A;  1PJI A;  3FD9 A;  1OQY A;  1QZE A;  1YSY A;  2QPA A;  4OW0 A;  3AKZ A;  1W1P A;  3ZH9 B;  1V92 A;  3U5Z B;  1VEG A;  2MRO B;  4GEW A;  1G4A E;  3T1H M;  3HON A;  4NZ3 A;  2Y20 A;  1YE9 A;  4GHL A;  4OVZ A;  5BPV A;  2QQ8 A;  2RGH A;  1KYI A;  4R7G A;  1IN6 A;  1NY5 A;  5KQ8 A;  5EJC A;  1WGL A;  2RGO A;  1KS0 A;  2VDB B;  2MR9 A;  1FJG M;  4TUW A;  4MB4 A;  1OGG A;  3QYE A;  1CK7 A;  4Z2J A;  3SAW A;  3HU3 A;  1QAQ A;  1XMQ M;  1VG5 A;  4XGI A;  4IBI A;  4WW0 A;  2DWZ B;  4M9S A;  1R2Y A;  2Y2H A;  4IBE A;  2RRU A;  2Y2I A;  2M5Z A;  4P16 A;  2KDL A;  4DV4 M;  3KOY E;  3GLI B;  1TH2 A;  4B3T M;  2UWX A;  4I81 A;  5DYG A;  3I4Y A;  1HNW M;  2FE8 A;  3QAU A;  1VEK A;  2H1R A;  3TWK A;  4FCT A;  1E6P A;  3CF0 A;  2DVW B;  3UZU A;  2N35 A;  2J7O A;  3FRI A;  1G41 A;  3KP1 E;  1N34 M;  5ITX A;  2J5Y A;  4LCB A;  3VK7 A;  4JYA M;  4GMQ A;  4MB5 A;  5DYI A;  2E5L M;  1IN8 A;  2O5R A;  2YR0 A;  5LMN M;  4FCW A;  1XHB A;  1E94 E;  1DV0 A;  3GRR A;  3HJS A;  2XFS A;  1L1Z A;  1IBL M;  3IG5 A;  2OPF A;  3KW6 A;  4LGM A;  1J5E M;  3HHW A;  1OKS A;  3L28 A;  2JZ1 A;  2D7E A;  3U6L A;  2CV1 A;  1HT2 E;  1XWI A;  1IQP A;  1IXR C;  3A98 B;  3ZQJ A;  3WD1 A;  1LTM A;  2QBY A;  2QEN A;  4M0D A;  3U5Z A;  4R71 A;  4L15 A;  2MGW A;  3GLG B;  4DV1 M;  4DV6 M;  1GAB A;  2KRU A;  3FUT A;  5A2Q S;  2Y2J A;  2YNM D;  3RGS A;  4LY6 A;  4NYU A;  3LVW A;  1YU1 A;  4REZ A;  1HQY E;  2O25 A;  5E26 A;  4LJ8 A;  1T43 A;  4DV0 M;  3SBJ A;  3QWL A;  1NV9 A;  1QDR A;  4IBC A;  4LRT A;  3VFD A;  4BLC A;  3U6P A;  2R45 A;  4DR2 M;  1W1V A;  1VDD A;  4OX9 M;  1H0I A;  3L25 A;  2Y21 A;  2LHC A;  4JI1 M;  5FTN A;  1PM5 A;  1OGB A;  3W0L B;  1A5T A;  1E9S A;  3I01 M;  3MHV C;  4QHS A;  4D80 A;  5ITT A;  4DV5 M;  1K3X A;  4GH9 A;  1HNX M;  4JV5 M;  3DFZ A;  4EIW A;  1E6R A;  3U6S A;  5IT9 S;  5L8R F;  2G5G X;  4RKU F;  4NC6 A;  2XEP A;  2Y2O A;  2DWM A;  2LWX A;  2HHH M;  2QHO B;  3C3E A;  3KXE C;  2C9O A;  4KT0 F;  5IZ7 D;  1L6J A;  3KS4 A;  1ZQ9 A;  4DV2 M;  3AOE C;  1IN4 A;  2QCU A;  4MGH A;  5H37 D;  3HWS A;  4G4Q A;  4YHH M;  1G8P A;  1CXW A;  2CHV A;  2HWJ A;  1IY0 A;  3HX3 A;  3U61 A;  3TWL A;  1KSF X;  1N75 A;  3MJ5 A;  1N77 A;  3IHP A;  3GLF B;  5F3W A;  3FTD A;  3J27 B;  1XXH B;  4M9Z A;  2KZS A;  4DR3 M;  4AQY M;  3R8F A;  4JI7 M;  2FH0 A;  1GPF A;  1H8P A;  1V33 A;  3D8L A;  1XB2 B;  4GKJ M;  3LVV A;  1GXD A;  2DEN A;  2LVO C;  2UUB M;  2DWN A;  4Z2K A;  3LW5 F;  2UUC M;  4LF9 M;  4LFA M;  2X4A A;  3M0E A;  1GJS A;  2FN2 A;  3GRV A;  4FCV A;  4OVZ B;  4Q7J A;  5KPT A;  3I4V A;  4UN2 B;  3JR5 A;  2UU9 M;  2Y2M A;  1E9R A;  5FSW A;  2XF3 A;  2GNO A;  3FYD A;  3C9P A;  1BVS A;  3CTW B;  2XH9 A;  1XXH E;  3GLH E;  5EQT A;  3NBX X;  5FLX S;  3JR4 A;  1IBK M;  1J7M A;  3GLF E;  1SG9 A;  1E88 A;  2DZO B;  1HT1 E;  1IXZ A;  4HLQ A;  4QNR A;  5GKN A;  3BBZ A;  1TDZ A;  1K82 A;  2JE5 A;  4IJF A;  1DGH B;  1MX0 A;  1QZM A;  4DR5 M;  4R3D A;  2KHH A;  2UXC M;  2K47 A;  4I5S A;  1DGB A;  2DXI A;  2R18 A;  2R44 A;  5ITX E;  4B3M M;  1GJT A;  2V6Z M;  1SXJ D;  5EXP A;  1YU3 A;  3L27 A;  2BWE A;  3I04 M;  5JI2 E;  4Z2L A;  4DV3 M;  4W5W A;  3B7Z A;  3B9P A;  4MM3 B;  4NSO B;  3C58 A;  2JWS A;  1N36 M;  3L26 A;  1QQW A;  3M7P A;  2FFJ A;  2R62 A;  3SAS A;  1L1T A;  2F5N A;  4NZ5 A;  2Y2P A;  3MMP A;  2LVP C;  3TPZ A;  3U6D A;  2UXB M;  3N3F A;  3W68 A;  1G59 A;  3T6P A;  7CAT A;  4KLN A;  3PFI A;  4JI5 M;  2KRK A;  2L6O A;  3GLG E;  3L29 A;  1ZV1 A;  4G4O A;  2R65 A;  3CF6 E;  3M7G A;  2BJW A;  2R0I A;  3SYL A;  2XZF A;  1ZAE A;  2DZL A;  4HEO A;  3WD0 A;  4FWD A;  4MGI E;  1DGG A;  4QHT A;  1I4W A;  1H6U A;  2JA2 A;  2LH0 A;  1JR3 A;  3PNY A;  4BBA A;  2RTS A;  2H5X A;  3HHY A;  3GLH B;  2QBY B;  1KFV A;  3SAU A;  2Y2Q A;  3T15 A;  1F4I A;  3RE8 A;  1P3Q Q;  2BJV A;  3T1Y M;  2F5S A;  2LTU A;  4P17 A;  3K1J A;  3PNV A;  2P5T A;  1EFU B;  3J7A S;  1GL7 A;  3DA1 A;  5FTJ A;  4IJE A;  1VEJ A;  2DNA A;  4NYY A;  2DKL A;  4X66 M;  2JXN A;  4NXM M;  1W5S A;  3SHF A;  3SYK A;  1MN3 A;  4GIT A;  4LJ5 A;  1T6O A;  1WJ7 A;  1NO1 A;  2CEA A;  2DI0 A;  2CV2 A;  3CGW A;  4FD2 A;  1TGU A;  2KNZ A;  4LF4 M;  1J09 A;  2Y0T A;  1GO5 A;  2Y2L A;  4PD2 A;  1OFI A;  1H0G A;  1XNQ M;  3TL4 X;  1PJQ A;  4A3V B;  4PCZ A;  4HMC A;  1Z59 A;  1XC8 A;  2Y2G A;  4PDG A;  3VLF B;  1AIP C;  5KQD A;  2DAE A;  2ZM6 M;  3LCV B;  4M9X A;  2D7G A;  4WP2 A;  5EXS A;  2QNJ A;  1UR9 A;  1OAO C;  4DV7 M;  3K9P A;  2BG1 A;  1AIW A;  2I7N A;  2K0B X;  4JI3 M;  2F5O A;  1O6I A;  1WHC A;  3LQR A;  3A46 A;  2R6F A;  4LRS A;  2JY7 A;  2R46 A;  3FE3 A;  1QDT A;  3E9S A;  3FUV A;  2FNA A;  1NJF A;  2OOA A;  2W82 A;  2Z8Y M;  4L4U A;  3W67 A;  5C18 A;  4L8R C;  5ITU A;  3FTF A;  1GOI A;  1TR8 A;  3ILK A;  1WR1 B;  5ITY A;  4OUI A;  3WD2 A;  2K9D A;  2DAG A;  2EUC A;  2XSZ A;  4IBJ A;  1R6B X;  2KA6 B;  2RKO A;  4XK8 F;  3PXG A;  2JY5 A;  4LZJ A;  4MH0 E;  4DR6 M;  4L16 A;  4NZ4 A;  4Z2H A;  2EJS A;  2BNK A;  1OTR A;  4NSR A;  4MB7 A;  3L2A A;  4AG5 A;  5IWA M;  4LFC M;  4GKK M;  3KOZ E;  1X37 A;  3LMM A;  4JN6 A;  1N32 M;  4AKH A;  3FUW A;  2L7I A;  4NXN M;  3Q8X A;  3J80 S;  5EP1 A;  5KPZ A;  3K9O A;  3JAM S;  4DR1 M;  3U6Q A;  3B7N A;  1ZMW A;  4DUY M;  4LZZ A;  5FTL A;  2Y2N A;  3H4M A;  4MGZ E;  4B7H A;  1JB0 F;  3DOA A;  2CWB A;  1IN5 A;  5LMU M;  1XMO M;  1DO2 A;  2LNH C;  1UFZ A;  1C7Y A;  3BXW A;  4G4N A;  3A42 A;  3AJI B;  2KZU A;  4G3O A;  4L6V 6;  4HME A;  2WSF F;  2WSE F;  1WIV A;  3UK6 A;  3M6A A;  4LF7 M;  1HQC A;  2EA0 A;  4LF5 M;  2OO9 A;  1S3S A;  3LQQ A;  1MJG M;  2V1C A;  4X64 M;  3VK8 A;  2UUA M;  4LF8 M;  5DNY A;  1C1K A;  2XFT A;  4D81 A;  1I94 M;  2C96 A;  3AOG A;  1FNN A;  4MGK E;  2JUJ A;  1OIZ A;  2X8A A;  4D82 A;  1JQJ C;  2X49 A;  3AOE A;  4II7 A;  1PDC A;  3WHK A;  3TWM A;  1G71 A;  2V1U A;  4Z2I A;  2JNH A;  3GLI E;  1K3W A;  4AKG A;  1Q3C A;  1Q3B A;  4CHT B;  3UGJ A;  1IFY A;  2QP9 X;  3GLH A;  5KO3 A;  3HZJ A;  1NHG C;  4FVM A;  4LJ9 A;  1L2D A;  2K6B A;  3SFZ A;  1HNZ M;  3SMP A;  4HMD A;  4RNA A;  2ZTC A;  1Z6T A;  2YQZ A;  2I7P A;  1IXS B;  1D0L A;  3OTO M;  4OJP A;  2C9C A;  1MU5 A;  5E6J A;  1SXJ C;  4WUR A;  3I51 A;  1V34 A;  3FTC A;  1L8Q A;  4CGY B;  3KDS E;  2ERC A;  3GQ5 A;  2WSC F;  3FRH A;  1OFH A;  5IRE B;  4OJL A;  4LJ4 A;  4G4R A;  4MGY E;  2D49 A;  2L09 A;  3NBI A;  1E32 A;  1NVM A;  1EIJ A;  2CV0 A;  4KOD A;  5EP2 A;  2G3Q A;  4OU7 A;  1R4G A;  2JY6 B;  3K92 A;  1QUT A;  1QAN A;  4B08 A;  2KEB A;  4LJA A;  3HHX A;  2CFO A;  2Z3X A;  3KOW E;  1SXJ E;  2G8L A;  1JR3 D;  2JZ0 A;  2R4E A;  1J7K A;  2Q2E B;  3AV0 A;  3F92 A;  2AHM A;  4I8O A;  3GO8 A;  4B3S M;  1LV7 A;  1IY1 A;  1EE8 A;  2XGN A;  2R4J A;  3RGP A;  5ITR A;  1W5T A;  2XLJ A;  2XD1 A;  4QOS A;  4QNL A;  2CE7 A;  4ANR A;  1W1Y A;  4IBF A;  4GC9 A;  1NNJ A;  2VII A;  3D8B A;  4LFB M;  1E8B A;  3KSX A;  3B89 A;  2EKF A;  2LBC A;  1TF0 B;  1HR0 M;  2JY8 A;  4MB3 A;  2C98 A;  3PVS A;  2KNV A;  1NHW C;  2FOI C;  4NRV A;  4OJO A;  4Z8X A;  1GL6 A;  1R7R A;  2WZJ A;  3GRY A;  2V5O A;  3K8Z A;  3SC3 A;  1L2C A;  2L4E A;  3FYC A;  3R9X B;  1ZMV A;  3NWL A;  3SAV A;  2QSF X;  2JCH A;  4B3R M;  2MH8 A;  3W0F A;  3TE6 A; 
#chains in the Genus database with same CATH homology
 4GIP A;  2HCB A;  4JI0 M;  3U6O A;  1N33 M;  3HU2 A;  4FWH A;  3GLF A;  1NSF A;  3HJQ A;  4IBB A;  2ZAN A;  1PJJ A;  1R2Z A;  5EP3 A;  3U61 B;  2KXE A;  4LGY A;  5EP4 A;  2F5Q A;  4OJ5 A;  4XBO A;  1QVR A;  4B7F A;  5BR8 M;  3KFU G;  2ZBK B;  4KHP M;  1OJL A;  4CIS A;  2KW0 A;  3SAT A;  1ORY B;  4GRI A;  3WHL A;  4QOZ C;  3ZCB B;  1XXH A;  4IBK A;  2J7N A;  3KP0 E;  3RFW A;  1G3I A;  1YU4 A;  1QYR A;  4JI6 M;  4ITQ A;  1DGF A;  3VDP A;  3U60 A;  3GPX A;  1Z5C A;  3UJN A;  4JI4 M;  4JI2 M;  4GHA A;  4M0W A;  4NZ1 A;  5FTK A;  3EIE A;  3ZC7 B;  3KS8 A;  3A45 A;  3GLI A;  4OJO A;  2L7H A;  4G6Z A;  1NJG A;  2LXE A;  4GC5 A;  4IBD A;  2DWL A;  4HL4 A;  3FTE A;  1YU0 A;  4OJL A;  4DUZ M;  4PDI A;  3GLG A;  2UXD M;  1TDH A;  3K2L A;  3KVW A;  5JI3 E;  2CUZ A;  4PT5 A;  3IG8 A;  3CF2 A;  1YUB A;  3AL0 C;  2FFF B;  3U6E A;  1Z5A A;  3GQ3 A;  3AFH A;  2Z4R A;  4B7G A;  2QZ4 A;  4RF0 A;  3HJ8 A;  5EXX A;  3KOX E;  1DO0 A;  8CAT A;  3EIH A;  3GQ4 A;  4NY2 A;  2NQ8 C;  1UM8 A;  3HKP A;  2C5R A;  4JI8 M;  1YUE A;  3HU1 A;  1NY6 A;  4AG6 A;  3SAR A;  2M60 A;  4AZF A;  2XSZ D;  3FUX A;  4L78 A;  3U60 B;  4YY3 M;  1IY2 A;  1Q39 A;  1NNU C;  4LJ6 A;  3FUU A;  3GRU A;  2VQF M;  4NRW A;  3J81 S;  1XNR M;  5FTM A;  1IN7 A;  3VDU A;  3J2P B;  2DHR A;  1DGH A;  4RF1 A;  2D7H A;  2C99 A;  4X65 M;  2XD5 A;  2HL7 A;  4BB9 A;  3UMM A;  4FW9 A;  4S12 A;  1D2N A;  2YFQ A;  2EO2 A;  3U6C A;  4AKI A;  3HGI A;  1GKI A;  2Z4S A;  5C1B A;  4AI6 A;  4K0K M;  2VQE M;  1TH3 A;  1QAO A;  4Z6Y A;  3HSH A;  1L2B A;  4AW4 A;  3HHZ A;  2Z7J A;  3FKE A;  3SMS A;  3KSJ A;  1TH4 A;  4IBG A;  2F5P A;  4NOO B;  1Z5B A;  4JXJ A;  4NL4 H;  3SHG B;  2HKJ A;  3GP1 A;  3GPU A;  2OQ4 A;  4QNM A;  3U6M A;  4IIW A;  4OJ6 A;  2CHQ A;  3T38 A;  4LF6 M;  4ZPX A;  1QAM A;  3GPP A;  2ZAO A;  1T3T A;  1WXQ A;  2Y2K A;  4LJ7 A;  3MK6 A;  4FWG A;  3TQS A;  3J7B A;  4KO8 A;  1SXJ A;  2Y0Q A;  4X62 M;  4DR7 M;  1GVN A;  4DR4 M;  4I4L A;  3GPY A;  4LG2 A;  2DZN B;  2ZAM A;  1IM2 A;  3VKH A;  2CHG A;  3E4R A;  3THG A;  1YU2 A;  2IOU A;  3DZD A;  3BOS A;  2XZU A;  1GLN A;  1N78 A;  5EXT A;  2A5Y B;  1SXJ B;  5KPR A;  3VKG A;  1PJI A;  3FD9 A;  1YSY A;  2QPA A;  3AKZ A;  3ZH9 B;  3U5Z B;  4NZ3 A;  1G4A E;  3T1H M;  3HON A;  2Y20 A;  1YE9 A;  4GHL A;  4OVZ A;  5BPV A;  2RGH A;  1KYI A;  4R7G A;  1IN6 A;  1NY5 A;  5KQ8 A;  5EJC A;  2RGO A;  1FJG M;  4TUW A;  3SAW A;  3HU3 A;  1QAQ A;  1XMQ M;  4XGI A;  4IBI A;  4WW0 A;  2DWZ B;  4M9S A;  1R2Y A;  2Y2H A;  4IBE A;  2Y2I A;  2M5Z A;  4P16 A;  4B3T M;  4DV4 M;  3KOY E;  3GLI B;  1TH2 A;  2UWX A;  4I81 A;  5DYG A;  3I4Y A;  1HNW M;  2FE8 A;  3QAU A;  2H1R A;  3TWK A;  4FCT A;  3CF0 A;  2DVW B;  3UZU A;  2J7O A;  1G41 A;  3KP1 E;  1N34 M;  5ITX A;  4LCB A;  3VK7 A;  4JYA M;  4GMQ A;  5DYI A;  2E5L M;  1IN8 A;  2O5R A;  2YR0 A;  5LMN M;  4FCW A;  1XHB A;  1E94 E;  3GRR A;  3HJS A;  2XFS A;  1L1Z A;  1IBL M;  3IG5 A;  2OPF A;  3KW6 A;  4LGM A;  1J5E M;  3HHW A;  3L28 A;  2D7E A;  3U6L A;  2CV1 A;  1HT2 E;  1XWI A;  1IQP A;  1IXR C;  3A98 B;  2QBY A;  2QEN A;  4M0D A;  3U5Z A;  4DV1 M;  4L15 A;  4DV6 M;  3GLG B;  2Y2J A;  2KRU A;  3FUT A;  5A2Q S;  2YNM D;  3RGS A;  4LY6 A;  4NYU A;  3LVW A;  1YU1 A;  4REZ A;  1HQY E;  5E26 A;  4LJ8 A;  4DV0 M;  3SBJ A;  3QWL A;  4IBC A;  4LRT A;  3VFD A;  4BLC A;  3U6P A;  1IBM M;  2R45 A;  4DR2 M;  3WX7 A;  1VDD A;  4OX9 M;  3L25 A;  2Y21 A;  4JI1 M;  5FTN A;  1PM5 A;  3W0L B;  1E9S A;  2F4V M;  3MHV C;  4D80 A;  4QHS A;  5ITT A;  4DV5 M;  1K3X A;  4JV5 M;  4GH9 A;  3DFZ A;  4EIW A;  3U6S A;  5IT9 S;  2G5G X;  2XEP A;  2Y2O A;  2DWM A;  2LWX A;  2HHH M;  3KXE C;  2C9O A;  5IZ7 D;  3KS4 A;  1ZQ9 A;  4DV2 M;  3AOE C;  1IN4 A;  2QCU A;  4MGH A;  5H37 D;  3HWS A;  4G4Q A;  4YHH M;  1G8P A;  2CHV A;  1IY0 A;  3U61 A;  3TWL A;  1KSF X;  1N75 A;  3MJ5 A;  1N77 A;  3GLF B;  5F3W A;  3FTD A;  3J27 B;  1XXH B;  4M9Z A;  2KZS A;  4DR3 M;  4AQY M;  3R8F A;  4JI7 M;  3D8L A;  4GKJ M;  3LVV A;  2UUB M;  2DWN A;  2UUC M;  4LF9 M;  4LFA M;  2X4A A;  3M0E A;  3GRV A;  4FCV A;  4OVZ B;  5KPT A;  3I4V A;  3JR5 A;  2UU9 M;  2Y2M A;  1E9R A;  5FSW A;  2XF3 A;  3FYD A;  5EQT A;  1HNX M;  3CTW B;  2XH9 A;  1IBK M;  3JR4 A;  5FLX S;  2DZO B;  1HT1 E;  1IXZ A;  4HLQ A;  4QNR A;  5GKN A;  1TDZ A;  1K82 A;  2JE5 A;  4IJF A;  1DGH B;  1MX0 A;  1QZM A;  4DR5 M;  4R3D A;  2UXC M;  2K47 A;  4I5S A;  1DGB A;  2DXI A;  2R18 A;  5ITX E;  4B3M M;  5EXP A;  2V6Z M;  1SXJ D;  1YU3 A;  3L27 A;  5JI2 E;  4DV3 M;  4W5W A;  4NSO B;  3B9P A;  4MM3 B;  3C58 A;  1N36 M;  3L26 A;  1QQW A;  2FFJ A;  2R62 A;  3SAS A;  1L1T A;  2F5N A;  4NZ5 A;  2Y2P A;  3TPZ A;  3U6D A;  2UXB M;  3N3F A;  1G59 A;  7CAT A;  4KLN A;  3PFI A;  4JI5 M;  2KRK A;  2L6O A;  3L29 A;  4G4O A;  2R65 A;  3CF6 E;  3M7G A;  2BJW A;  3SYL A;  2XZF A;  1ZAE A;  4FWD A;  4MGI E;  1DGG A;  4QHT A;  1I4W A;  1H6U A;  3PNY A;  2JA2 A;  1JR3 A;  2LH0 A;  4BBA A;  3HHY A;  3GLH B;  2QBY B;  1KFV A;  3SAU A;  2Y2Q A;  3T15 A;  3RE8 A;  2BJV A;  3T1Y M;  2F5S A;  3K1J A;  3PNV A;  2P5T A;  1GL7 A;  3DA1 A;  5FTJ A;  4IJE A;  4NYY A;  4X66 M;  4NXM M;  1W5S A;  3SHF A;  3SYK A;  4GIT A;  4LJ5 A;  2CEA A;  2CV2 A;  4LF4 M;  4FD2 A;  1TGU A;  2Y2L A;  1J09 A;  2Y0T A;  4PD2 A;  1OFI A;  1XNQ M;  3TL4 X;  4A3V B;  4PCZ A;  1Z59 A;  1XC8 A;  2Y2G A;  4PDG A;  3VLF B;  5KQD A;  4M9X A;  2D7G A;  5EXS A;  4DV7 M;  2BG1 A;  2I7N A;  4JI3 M;  2F5O A;  3LQR A;  3A46 A;  4LRS A;  2R46 A;  3E9S A;  3FUV A;  4L4U A;  2FNA A;  1NJF A;  5C18 A;  2W82 A;  4L8R C;  3FTF A;  5ITU A;  3ILK A;  5ITY A;  4OUI A;  4IBJ A;  2XSZ A;  2EUC A;  1R6B X;  2KA6 B;  2RKO A;  3PXG A;  4LZJ A;  4MH0 E;  4DR6 M;  4L16 A;  4NZ4 A;  2BNK A;  4NSR A;  4MB7 A;  3L2A A;  4AG5 A;  5IWA M;  4LFC M;  4GKK M;  3KOZ E;  1X37 A;  3LMM A;  4JN6 A;  1N32 M;  4AKH A;  3FUW A;  2L7I A;  4NXN M;  3Q8X A;  3J80 S;  5EP1 A;  5KPZ A;  3JAM S;  4DR1 M;  3U6Q A;  4DUY M;  4LZZ A;  5FTL A;  2Y2N A;  3H4M A;  4MGZ E;  4B7H A;  3DOA A;  1XMO M;  1IN5 A;  5LMU M;  1DO2 A;  2LNH C;  4G4N A;  3A42 A;  3AJI B;  2KZU A;  3UK6 A;  3M6A A;  4LF7 M;  1HQC A;  2EA0 A;  4LF5 M;  1S3S A;  3LQQ A;  4X64 M;  2V1C A;  3VK8 A;  2UUA M;  4LF8 M;  5DNY A;  1C1K A;  2XFT A;  4D81 A;  1I94 M;  2C96 A;  3AOG A;  1FNN A;  4MGK E;  4D82 A;  5ITQ A;  2X8A A;  1JQJ C;  2X49 A;  3AOE A;  4II7 A;  3WHK A;  3TWM A;  2V1U A;  4AKG A;  1K3W A;  1Q3C A;  1Q3B A;  4CHT B;  3UGJ A;  2QP9 X;  3GLH A;  5KO3 A;  1NHG C;  4FVM A;  4LJ9 A;  1L2D A;  3SFZ A;  1HNZ M;  3SMP A;  4RNA A;  1Z6T A;  2YQZ A;  2I7P A;  1IXS B;  3OTO M;  4OJP A;  2C9C A;  1MU5 A;  5E6J A;  1SXJ C;  4WUR A;  3I51 A;  3FTC A;  4CGY B;  1L8Q A;  3GQ5 A;  3KDS E;  2ERC A;  5IRE B;  1OFH A;  4LJ4 A;  4G4R A;  4MGY E;  2L09 A;  3NBI A;  1E32 A;  1NVM A;  2CV0 A;  4KOD A;  5EP2 A;  4OU7 A;  4B08 A;  3K92 A;  1QAN A;  2KEB A;  4LJA A;  3HHX A;  2CFO A;  2Z3X A;  3KOW E;  1SXJ E;  2G8L A;  1JR3 D;  4OW0 A;  1J7K A;  2Q2E B;  2R4E A;  3AV0 A;  4I8O A;  2AHM A;  3GO8 A;  3J7A S;  4B3S M;  1LV7 A;  1IY1 A;  1EE8 A;  2XGN A;  2R4J A;  3RGP A;  5ITR A;  1W5T A;  2XLJ A;  2XD1 A;  4QOS A;  4QNL A;  2CE7 A;  4IBF A;  4GC9 A;  1NNJ A;  2VII A;  3D8B A;  4LFB M;  3KSX A;  1HR0 M;  2C98 A;  3PVS A;  1NHW C;  2FOI C;  4NRV A;  4Z8X A;  1R7R A;  1GL6 A;  3GRY A;  3K8Z A;  3SC3 A;  1L2C A;  3FYC A;  3R9X B;  3NWL A;  3SAV A;  2JCH A;  4B3R M;  2ZM6 M;  3W0F A;  3TE6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...