3L28A

Crystal structure of zaire ebola vp35 interferon inhibitory domain k339a mutant
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
123
structure length
123
Chain Sequence
b'DISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polymerase cofactor VP35
publication title Structural basis for dsRNA recognition and interferon antagonism by Ebola VP35.
pubmed doi rcsb
source organism Zaire ebolavirus
molecule tags Rna binding protein
total genus 37
structure length 123
sequence length 123
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3l28A01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 3l28A02
4IBJA 4GH9A 4IBKA 4IBEA 4LG2A 3L28A 3L2AA 4GHLA 3L26A 3L27A 4IBFA 3KS8A 5BPVA 3L29A 4IJFA 4IBBA 4IBCA 4IBGA 4IBDA 3FKEA 3L25A 4IJEA 4GHAA 4IBIA 3KS4A
chains in the Genus database with same CATH superfamily
4JI6M 4DV5M 3KOXE 2KEBA 1NNJA 3A98B 2Z4SA 3LW5F 3U61B 1Q39A 1J7MA 2MH8A 2D7HA 5IWAM 2IOUA 2DVWB 2Y0QA 1PJSA 2ZTCA 3L27A 2OOAA 4R7GA 1R2ZA 3KDSE 2V1UA 1DV0A 2J7NA 1MN3A 2LH0A 4GIPA 2EA0A 1R5LA 2EO2A 4JN6A 1SXJE 1PJTA 5EXXA 1NY5A 4OU7A 4LZZA 4OW0A 1CK7A 2ZAOA 3U6LA 2DWLA 2C9CA 2VDBB 1NJFA 2LVNC 1DO0A 2UXBM 4FCWA 4HL4A 2Y2LA 4JYAM 4JI3M 4FWHA 4AKHA 3PXGA 2XFSA 3W0LB 4G4RA 4LF4M 1SXJD 2A5YB 5KPTA 1N77A 2EKFA 4FWDA 4R3DA 3MJ5A 4QNRA 4LJ8A 1G71A 4KODA 4LZJA 1XNRM 2DI0A 3VDUA 3NBXX 1IXRC 4LGMA 4LF7M 2QPAA 2UU9M 4Y28F 2JP7A 2CHGA 2Y2PA 3SHFA 3W0FA 1OKSA 1VDLA 5EXSA 3DFZA 1GOIA 2MJ5B 2J5YA 1VEKA 2DWZB 4MM3B 3U5ZB 4AKGA 4NY2A 5H37D 1IY0A 3DZDA 4JV5M 1GO5A 2KXEA 3SAUA 3KSXA 2Y0TA 1CXWA 3DA1A 2JY8A 2VQFM 1HNXM 2JZ1A 4NYYA 2BJWA 1JR3E 1A5TA 2JCHA 3I4YA 1YLAA 3I01M 2XSZD 3J7BA 1R2YA 3CF0A 3FTDA 4NSRA 3TWLA 1QO6A 3HSHA 5ITXA 1F4IA 1GJSA 4I5SA 5EP1A 1WGNA 5ITYA 2NQ8C 3AOEA 3ZC7B 2CV0A 1E6ZA 7CATA 4Z2JA 1W1TA 2D7GA 4LJ6A 4PDIA 2QHOB 3IHPA 2LVOC 3FRIA 5ITQA 3GLHA 2Y2KA 1OGGA 4LJ7A 1NHWC 1YE9A 2CHVA 3U6MA 1AIPC 1H6UA 2JNHA 1XMOM 3GPPA 4IIWA 2EUCA 3WD4A 2Z8YM 3VDPA 4A3VB 4DUYM 4LCBA 2D7EA 3K2LA 1HT2E 2Y2HA 3M7GA 3VKHA 1XXHB 1C7YA 1BVSA 4LF8M 4B3RM 3D8BA 3GRYA 4MGYE 3GLFB 2L4FA 4ANRA 5EQTA 2K6BA 1IFYA 2OO9A 3FKEA 4QHSA 4S12A 2F5SA 1IQPA 2R0IA 3F92A 1JR3A 2K9DA 3FE3A 4JI8M 4DV2M 3KOZE 2Y2GA 3SYLA 4HMEA 3HHZA 2CV1A 1DGFA 4MB3A 2LHGA 4CIZA 2DAKA 3U60B 1Z6TA 1PM5A 3SMSA 2C9OA 1NVMA 4LJ4A 1PJIA 2F5OA 3WD2A 2O01F 3GLIA 2UWXA 3JR5A 2UUBM 1E8BA 2JZ0A 4DR7M 2Q2EB 5ITUA 1TDZA 3D8LA 3WD0A 2LVQD 4PT5A 3V76A 2Y2MA 2KW0A 1I4WA 1UR9A 4OJLA 4NC6A 4UN2B 3K8ZA 5JI2E 1IN5A 3J80S 1GL6A 2OPFA 3KVWA 1SXJC 1WR1B 4B3SM 2R46A 3I51A 1W1PA 3KP0E 1IXSB 4QNLA 3HHYA 3BOSA 2KNAA 1J09A 4MB7A 3PNVA 4OJPA 1NV8A 4NRVA 1HQYE 1MU5A 3K9PA 4HLQA 2DXIA 1L2CA 1L2DA 1OQYA 2X4AA 4MGHA 2MROB 4BB9A 3HONA 3VK7A 2UUCM 4OJ6A 1E88A 1K3XA 1DO2A 1WJ7A 1W5SA 2KNVA 1AUAA 4LF6M 4L16A 5C1BA 3ILKA 2CEAA 5ITTA 3TE6A 1DGGA 5EJCA 1ZMWA 3OTOM 2DZLA 1DGHB 3DOAA 1TDHA 2BG1A 3UZUA 1D0MA 4Z2HA 1HNWM 4QHTA 1LV7A 3U61A 4X66M 4GKKM 3FTCA 3T15A 1GLNA 1IN8A 2MR9A 4GEWA 4Z6YA 4DV7M 3HY5A 1FJGM 2DAEA 2FNAA 2L7HA 4QOSA 4DV1M 1Q02A 3LQQA 2Z3XA 4GH9A 1E9SA 4I8OA 4FD2A 1Z5BA 4W5WA 2YFQA 3B7QA 3EIHA 1YUEA 1Z59A 3AV0A 5FLXS 1J5EM 5L8RF 4L8RC 2FH0A 4JI7M 4NZ3A 3VLFB 1TF0B 2FE8A 2R4EA 3MMPA 2KA6B 3KW6A 2APLA 3I04M 3GQ4A 3NBIA 3WHKA 3E46A 1PDCA 2O5RA 1C1KA 2ZTDA 4LFBM 1GJTA 5DFLA 2Y2OA 3ZCBB 2BJVA 4DV3M 3CF2A 3J81S 3L25A 2HKJA 1HQCA 2F5NA 5ITXE 1D0LA 4Z2LA 3HHXA 4LFCM 2X49A 1UR8A 3CF6E 1PJJA 4LJAA 3QYBA 3AJIB 3MQLA 1XNQM 3U5ZA 3KFUG 2I7PA 4YY3M 2ZAMA 4KO8A 1L1TA 4NZ5A 3GLHE 3SAWA 4DR2M 1EAKA 2JUJA 4LFAM 1WIVA 2KZSA 3KSJA 1DGBA 4CISA 1VQ1A 2DZOB 2RTSA 2HWJA 4GMQA 2B3TA 1EIJA 3VK8A 1MX0A 2C96A 4R71A 3KS8A 4JI4M 2HL7A 3LCUA 2D49A 2CE7A 5IREB 3CTWB 2FFFB 1Q3CA 4B3MM 3HJQA 2R45A 2LBCA 1LTMA 2YQZA 2JY5A 3M0EA 4P17A 3U6CA 3SBJA 1PJQA 1IN4A 4GHAA 4BBAA 4LY6A 4REZA 1NY6A 1GKIA 4MGZE 1O6IA 1P3QQ 4NYUA 2DHRA 4IBIA 1HNZM 4M9XA 2HAKA 4GC5A 3SMPA 1JR3D 4X65M 1XXHA 1EE8A 3GLIE 4DR4M 2R4JA 3LCVB 3L28A 3TWKA 3FRHA 1JQJC 3FD9A 3QYEA 2QBYB 3FUTA 3KOYE 3GLFA 3H4JA 3L26A 1K3WA 1QZEA 1QYRA 1KFVA 3FTFA 1G4AE 5EXPA 2JY7A 2BNKA 3PFIA 1TH3A 1E6PA 4JI1M 4DR6M 1V33A 1ZMVA 2C5RA 2Y2JA 1IY1A 3HZJA 2P5TA 2ZANA 3HX3A 5FTNA 3C58A 3GLGB 2JA2A 3T38A 4AG5A 3UJNA 4JI5M 3WD1A 1SG9A 1WGLA 2RRUA 2GQFA 4MB5A 3U60A 2H1RA 3HU3A 1XHBA 1TH2A 2G5GX 2VQEM 1KS0A 1ZMUA 2YR0A 1XC8A 3TWMA 1QUTA 4KLNA 4WURA 3KS4A 4WW0A 3RE8A 3AL0C 1SXJB 2VF8A 5FTLA 2Z4RA 1Q3BA 1QDRA 2HHHM 2L4EA 3U6QA 4LG2A 3T1YM 3BBZA 3C9PA 4GHLA 2L7IA 2CWBA 1NV9A 4RNAA 4D82A 1IXSA 2RGHA 1AIWA 3NWLA 3QAUA 2XLJA 4G4OA 3HU2A 3R9XB 3K92A 3FUVA 3I4VA 5DYIA 1ZV1A 4G4QA 3J2PB 4AI6A 5ITRA 3MK6A 1IN6A 2KDLA 2RGOA 1W5TA 3K9OA 2KHHA 4NXNM 3B9PA 1S3SA 2JY6B 4JXJA 1E6NA 2XEPA 3RFWA 1J7KA 5LMNM 3U6SA 4OVZB 3TPZA 4MGIE 2FFJA 3RGSA 3A46A 1K82A 1QUSA 1DGHA 1R4GA 2CP8A 3FUXA 4IBKA 2DNAA 5GKNA 3TL4X 3AOEC 3GP1A 1UFZA 4NRWA 1N33M 4NZ4A 3GPXA 2UUAM 3JR4A 1QQWA 3SHGB 3GQ3A 2QZ4A 1WHCA 2DZNB 3VFDA 1Y8GA 1R7RA 4II7A 1OFIA 5DYGA 1HR0M 3HGIA 4ITQA 3U6EA 3QWLA 1QDTA 3KP1E 3C3DA 1Z5AA 2R62A 5KPRA 3SATA 4NXMM 5FTMA 2H5XA 5FSWA 4CJ6A 5BR8M 8CATA 2QQ8A 4AQYM 1ZQ9A 4AKIA 4X64M 2XD5A 3M6AA 1TR8A 1ORYB 1OGBA 2KNZA 2I7NA 2KZUA 1OIPA 5FTJA 3J27B 4B7FA 4D81A 3SAVA 1KSFX 1NJGA 2QENA 2GNOA 2C99A 4LJ9A 3SC3A 2FS1A 4OUIA 1L1ZA 2F4VM 3U6DA 3FUWA 1E32A 1YU0A 1XB2B 1VEJA 1NSFA 2R44A 4IBBA 4OX9M 1N36M 5E6JA 4NL4H 4PCZA 1OAOC 1TGUA 3M7PA 4LGYA 4AG6A 2XFTA 4D80A 3LVWA 1V34A 1GXDA 2W82A 2ZBKB 4FCTA 2KRKA 2XH9A 1YSYA 4M0DA 3GQ5A 3SYKA 3UK6A 3U6PA 4HMCA 3GLGE 1H0GA 3HJ8A 4G4NA 4L6V6 3UMMA 4LF5M 1XXHE 2JE5A 2CRUA 3THGA 3N3FA 2LWXA 4KHPM 1D2NA 4IBEA 3A45A 4XGIA 3GLFE 1W1VA 4G3OA 3WHLA 2O25A 3T1HM 2LNHC 1NNUC 2HCBA 1YUBA 2YNMD 3GRRA 4L15A 3GPUA 4PDGA 1T3TA 4EIWA 3HJSA 2L09A 4Z8XA 2DAGA 2M60A 4DUZM 3L29A 2BWBA 5DNYA 1KYIA 4GC9A 4IBCA 4IBGA 2F5PA 5EP3A 2XGNA 1L8QA 1YU3A 1PGYA 5C18A 4L78A 2LXEA 3LQRA 2QBYA 4JI0M 2Y2IA 4MGKE 3SFZA 2K47A 2V1CA 1G59A 1W1YA 1GVNA 1HT1E 1VEGA 2FOIC 3A42A 4Z2IA 1E94E 3GLGA 3PVSA 5EP2A 4DBGB 4L4UA 2DKLA 4ZPXA 4XBOA 5IZ7D 1GL7A 3GO8A 5IT9S 4TUWA 1NHGC 4YHHM 1G3IA 2X8AA 2LVAA 3FYDA 4M9SA 4NZ1A 2EJSA 5F3WA 5BPVA 5LMUM 3HKPA 4FWGA 2CUZA 1X37A 2QCUA 3HWSA 2QNJA 3BXWA 4LJ5A 1SXJA 4F1IA 1IBMM 4TX8A 1QAMA 1D0KA 3CGWA 1XWIA 2QSFX 3U6OA 1ED7A 4G6ZA 1OAIA 1OFHA 1YU2A 2XF3A 4DR1M 3SASA 4MB4A 3B7ZA 1V92A 1VDDA 4B7HA 4IJEA 2DWNA 4JI2M 2L6OA 3AKZA 1ZAEA 2DENA 3Q8GA 3W68A 1N34M 3EIEA 2Y2QA 3RGPA 1EFUB 4QNMA 2XZUA 1N75A 2ERCA 2M5ZA 3IG5A 3T6PA 1H0IA 1E9RA 2V5OA 2LVPC 3UGJA 1CUKA 1TTEA 1R6BX 3L2AA 3LMMA 4XK8F 3GPYA 1YU1A 1JB0F 1I94M 3R8FA 4Q7JA 2DWMA 3PNYA 5E26A 1N78A 3VKGA 4GITA 2V6ZM 3AOGA 4IJFA 2XSZA 3E4RA 4NSOB 4OVZA 3W67A 1OTRA 5KPZA 2BWEA 4QOZC 4LF9M 3GLHB 1L2BA 4I81A 3H4MA 4HEOA 4X62M 2OQ4A 4RF0A 2CV2A 2KRUA 2XZFA 2OOBA 2XD1A 4OJOA 5FTKA 4Z2KA 2WSEF 4Z2GA 3SARA 2EKKA 2G3QA 3B89A 1WXQA 1IN7A 1QANA 4BLCA 3B74A 5EXTA 4HMDA 1QZMA 5JI3E 1IBKM 2N35A 2JWSA 2R18A 3WD3A 2WZJA 4DR5M 2LHCA 1H8PA 1YU4A 3KOWE 1NO1A 4F2LA 4P16A 4B08A 3HHWA 3Q8XA 4NOOB 5EP4A 4LRTA 1QVRA 2F5QA 1FNNA 2Y21A 4IBFA 4AZFA 5KO3A 4DR3M 2QP9X 4B3TM 2K0BX 2L2DA 2WSFF 3AFHA 1E6RA 4K0KM 1Z5CA 2JXNA 3J7AS 2VF7A 2R6FA 4CHTB 4FCVA 1N32M 2UXCM 1T6OA 4RF1A 2C98A 1MJGM 3FYCA 3GLIB 4DV4M 2UXDM 2FN2A 2DAMA 2DHYA 3HU1A 4FW9A 4CGYB 5A2QS 1E15A 5KQ8A 2VIIA 4AW4A 1QAOA 4WP2A 1GABA 3WX7A 3B7NA 4PD2A 1GPFA 1G41A 1OIZA 2WSCF 3LVVA 2G8LA 4IBJA 3ZH9B 4OJ5A 2R65A 4I4LA 3JAMS 1TH4A 2CHQA 1QAQA 2RKOA 4DV0M 4GRIA 2DAIA 4GKJM 4B7GA 3E21A 4M9ZA 3MHVC 4KT0F 5KQDA 1G8PA 1RU3A 2ZM6M 3FTEA 1IM2A 1IY2A 2MGWA 3ZQJA 3E9SA 3IG8A 1HJPA 1UM8A 1OJLA 4M0WA 1IXZA 3FUUA 1IBLM 3C3EA 2J7OA 3GRUA 3GRVA 4MH0E 4DV6M 3KXEC 1XMQM 2Y2NA 2Y20A 4IBDA 3TQSA 3K1JA 4RKUF 1L6JA 1PRBA 2Z7JA 2AHMA 2E5LM 4LRSA 2LTUA 4FVMA 2CFOA 1VG5A 1T43A 3IECA
chains in the Genus database with same CATH topology
4JI6M 4DV5M 3KOXE 2KEBA 1NNJA 3A98B 2Z4SA 3U61B 1Q39A 2D7HA 5IWAM 2IOUA 2DVWB 2Y0QA 4R7GA 3L27A 1R2ZA 3KDSE 2V1UA 2J7NA 2EA0A 2LH0A 4GIPA 4AKGA 2EO2A 4JN6A 1SXJE 4OU7A 5EXXA 1NY5A 4LZZA 4OW0A 2ZAOA 3U6LA 2DWLA 2C9CA 1NJFA 1DO0A 2UXBM 4FCWA 4HL4A 2Y2LA 4JYAM 4JI3M 4FWHA 4AKHA 3PXGA 2XFSA 3W0LB 4G4RA 4LF4M 1SXJD 2A5YB 5KPTA 1N77A 4FWDA 4R3DA 3MJ5A 4QNRA 4LJ8A 4KODA 4LZJA 1XNRM 3VDUA 1IXRC 4LGMA 4LF7M 2QPAA 2UU9M 2CHGA 2Y2PA 3SHFA 3W0FA 5EXSA 3DFZA 4MM3B 3U5ZB 4NY2A 5H37D 1IY0A 3DZDA 4JV5M 2KXEA 3SAUA 3KSXA 2Y0TA 3DA1A 1HNXM 2VQFM 4NYYA 2BJWA 2JCHA 3I4YA 2XSZD 3J7BA 1R2YA 3CF0A 3FTDA 4NSRA 3TWLA 3HSHA 5ITXA 4I5SA 5EP1A 2CV0A 5ITYA 2NQ8C 3AOEA 3ZC7B 7CATA 2D7GA 4LJ6A 4PDIA 5ITQA 3GLHA 2Y2KA 4LJ7A 1NHWC 1YE9A 2CHVA 3U6MA 1H6UA 1XMOM 3GPPA 4IIWA 2EUCA 3VDPA 4A3VB 4DUYM 4LCBA 2D7EA 3K2LA 1HT2E 2Y2HA 3M7GA 3VKHA 1XXHB 4LF8M 4B3RM 3D8BA 3GRYA 4MGYE 3GLFB 5EQTA 3FKEA 4QHSA 4S12A 2F5SA 1IQPA 1JR3A 4JI8M 4DV2M 3KOZE 2Y2GA 3SYLA 3HHZA 2CV1A 1DGFA 3U60B 1Z6TA 1PM5A 3SMSA 2C9OA 1NVMA 4LJ4A 1PJIA 2F5OA 3GLIA 2UWXA 3JR5A 2UUBM 4DR7M 2Q2EB 5ITUA 1TDZA 3D8LA 4PT5A 2Y2MA 2KW0A 1I4WA 4OJLA 3K8ZA 5JI2E 1IN5A 3J80S 1GL6A 2OPFA 3KVWA 1SXJC 4B3SM 2R46A 3I51A 4QNLA 3KP0E 1IXSB 3HHYA 3BOSA 1J09A 4MB7A 3PNVA 4OJPA 4NRVA 1HQYE 1MU5A 4HLQA 2DXIA 1L2CA 1L2DA 2X4AA 4MGHA 4BB9A 3HONA 3VK7A 2UUCM 4OJ6A 1K3XA 1DO2A 1W5SA 4LF6M 4L16A 5C1BA 3ILKA 2CEAA 5ITTA 3TE6A 1DGGA 5EJCA 3OTOM 1DGHB 3DOAA 1TDHA 2BG1A 3UZUA 1HNWM 4QHTA 1LV7A 3U61A 4X66M 4GKKM 3FTCA 3T15A 1GLNA 1IN8A 4Z6YA 4DV7M 1FJGM 2FNAA 2L7HA 4QOSA 4DV1M 3LQQA 2Z3XA 4GH9A 1E9SA 4I8OA 4FD2A 1Z5BA 4W5WA 2YFQA 1YUEA 3EIHA 1Z59A 3AV0A 5FLXS 1J5EM 4L8RC 4JI7M 4NZ3A 3VLFB 2R4EA 2FE8A 2KA6B 3KW6A 3GQ4A 3NBIA 3WHKA 2O5RA 1C1KA 4LFBM 2Y2OA 3ZCBB 2BJVA 4DV3M 3CF2A 3J81S 3L25A 2HKJA 1HQCA 2F5NA 5ITXE 3HHXA 4LFCM 2X49A 3CF6E 1PJJA 4LJAA 3AJIB 1XNQM 3U5ZA 3KFUG 2I7PA 4YY3M 2ZAMA 4KO8A 1L1TA 4NZ5A 3SAWA 4DR2M 4LFAM 2KZSA 3KSJA 1DGBA 4CISA 2DZOB 4GMQA 3VK8A 1MX0A 2C96A 3KS8A 4JI4M 2HL7A 2CE7A 5IREB 3CTWB 2FFFB 1Q3CA 4B3MM 3HJQA 2R45A 2YQZA 3U6CA 3M0EA 3SBJA 4GHAA 1IN4A 4BBAA 4LY6A 4REZA 1NY6A 1GKIA 4MGZE 4NYUA 2DHRA 4IBIA 1HNZM 4M9XA 3SMPA 4GC5A 4DR4M 1JR3D 4X65M 1XXHA 1EE8A 4OJOA 2R4JA 3L28A 3TWKA 1JQJC 3FD9A 2QBYB 3FUTA 3KOYE 3GLFA 3L26A 1K3WA 1KFVA 1QYRA 3FTFA 1G4AE 5EXPA 2BNKA 3PFIA 1TH3A 4JI1M 4DR6M 2C5RA 2Y2JA 1IY1A 2P5TA 2ZANA 3C58A 5FTNA 3GLGB 2JA2A 3T38A 4AG5A 3UJNA 4JI5M 3U60A 2H1RA 3HU3A 1XHBA 1TH2A 2G5GX 2VQEM 2YR0A 1XC8A 3TWMA 4KLNA 4WW0A 4WURA 3KS4A 3RE8A 3AL0C 1SXJB 5FTLA 2Z4RA 1Q3BA 2HHHM 3U6QA 4LG2A 3T1YM 4GHLA 2L7IA 4RNAA 4D82A 2RGHA 3NWLA 3QAUA 2XLJA 4G4OA 3HU2A 3R9XB 3K92A 3FUVA 3I4VA 5DYIA 4G4QA 3J2PB 4AI6A 5ITRA 3MK6A 1IN6A 2RGOA 1W5TA 4NXNM 3B9PA 1S3SA 4JXJA 2XEPA 3RFWA 1J7KA 5LMNM 3U6SA 4OVZB 3TPZA 4MGIE 2FFJA 3RGSA 3A46A 1K82A 4IBKA 1DGHA 3FUXA 4NRWA 3GP1A 5GKNA 1N33M 3TL4X 3AOEC 4NZ4A 3GPXA 2UUAM 3JR4A 1QQWA 3SHGB 3GQ3A 2QZ4A 2DZNB 3VFDA 1R7RA 4II7A 1OFIA 5DYGA 1HR0M 3HGIA 4ITQA 3U6EA 3QWLA 3KP1E 4NXMM 1Z5AA 2R62A 5KPRA 3SATA 5FTMA 5FSWA 5BR8M 8CATA 4AQYM 1ZQ9A 4AKIA 4X64M 2XD5A 3M6AA 1ORYB 2I7NA 2KZUA 5FTJA 3J27B 4B7FA 4D81A 3SAVA 1KSFX 1NJGA 2QENA 4LJ9A 2C99A 3SC3A 4OUIA 1L1ZA 2F4VM 3U6DA 3FUWA 1E32A 1YU0A 4IBBA 1NSFA 4OX9M 1N36M 5E6JA 4NL4H 4PCZA 1TGUA 4LGYA 4AG6A 2XFTA 4D80A 3LVWA 2W82A 2ZBKB 4FCTA 2KRKA 2XH9A 1YSYA 4M0DA 3GQ5A 3SYKA 3UK6A 3U6PA 3HJ8A 4G4NA 3UMMA 4LF5M 2JE5A 3N3FA 3THGA 2LWXA 4KHPM 1D2NA 4IBEA 3A45A 4XGIA 3WHLA 3T1HM 2LNHC 1NNUC 2HCBA 1YUBA 2YNMD 3GRRA 4L15A 3GPUA 4PDGA 1T3TA 4EIWA 3HJSA 2L09A 4Z8XA 2M60A 4DUZM 3L29A 5DNYA 1KYIA 4GC9A 4IBCA 4IBGA 2F5PA 5EP3A 2XGNA 1L8QA 1YU3A 5C18A 4L78A 2LXEA 3LQRA 2QBYA 4JI0M 2Y2IA 4MGKE 3SFZA 2K47A 2V1CA 1G59A 1GVNA 1HT1E 2FOIC 3A42A 1E94E 3GLGA 3PVSA 5EP2A 4L4UA 4ZPXA 4XBOA 5IZ7D 1GL7A 3GO8A 5IT9S 4TUWA 1NHGC 4YHHM 1G3IA 2X8AA 3FYDA 4M9SA 4NZ1A 5F3WA 5BPVA 5LMUM 3HKPA 4FWGA 2CUZA 1X37A 2QCUA 3HWSA 4LJ5A 1SXJA 1IBMM 1QAMA 1XWIA 3U6OA 4G6ZA 1OFHA 1YU2A 2XF3A 4DR1M 3SASA 1VDDA 4B7HA 4IJEA 2DWNA 4JI2M 2L6OA 3AKZA 1ZAEA 1N34M 3EIEA 2Y2QA 3RGPA 4QNMA 2XZUA 1N75A 2ERCA 2M5ZA 3IG5A 1E9RA 3UGJA 3L2AA 1R6BX 3LMMA 3GPYA 1YU1A 1I94M 3R8FA 2DWMA 3VKGA 3PNYA 5E26A 1N78A 4GITA 2V6ZM 3AOGA 4IJFA 2XSZA 3E4RA 4NSOB 4OVZA 5KPZA 4QOZC 4LF9M 3GLHB 1L2BA 4I81A 3H4MA 4X62M 2OQ4A 4RF0A 2CV2A 2KRUA 2XZFA 2XD1A 5FTKA 3SARA 1WXQA 1IN7A 1QANA 4BLCA 5EXTA 1QZMA 5JI3E 1IBKM 2R18A 4DR5M 1YU4A 3KOWE 4P16A 4B08A 3HHWA 3Q8XA 4NOOB 5EP4A 4LRTA 1QVRA 2F5QA 1FNNA 2Y21A 4IBFA 4AZFA 5KO3A 4DR3M 2QP9X 4B3TM 3AFHA 4K0KM 1Z5CA 3J7AS 4CHTB 4FCVA 1N32M 2UXCM 4RF1A 3GLIB 2C98A 3FYCA 4DV4M 2UXDM 3HU1A 4CGYB 4FW9A 5A2QS 5KQ8A 2VIIA 4AW4A 1QAOA 3WX7A 4PD2A 1G41A 3LVVA 2G8LA 4IBJA 3ZH9B 4OJ5A 2R65A 4I4LA 3JAMS 1TH4A 2CHQA 1QAQA 2RKOA 4DV0M 4GRIA 4GKJM 4B7GA 4M9ZA 3MHVC 5KQDA 1G8PA 2ZM6M 3FTEA 1IM2A 1IY2A 3E9SA 3IG8A 1UM8A 1OJLA 4M0WA 1IXZA 3FUUA 1IBLM 2J7OA 3GRUA 3GRVA 4MH0E 4DV6M 3KXEC 1XMQM 2Y2NA 2Y20A 4IBDA 3TQSA 3K1JA 2Z7JA 2AHMA 2E5LM 4LRSA 4FVMA 2CFOA 2DWZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IBJ A;  4GH9 A;  4IBK A;  4IBE A;  4LG2 A;  3L28 A;  3L2A A;  4GHL A;  3L26 A;  3L27 A;  4IBF A;  3KS8 A;  5BPV A;  3L29 A;  4IJF A;  4IBB A;  4IBC A;  4IBG A;  4IBD A;  3FKE A;  3L25 A;  4IJE A;  4GHA A;  4IBI A;  3KS4 A; 
#chains in the Genus database with same CATH topology
 4JI6 M;  4DV5 M;  3KOX E;  2KEB A;  1NNJ A;  3A98 B;  2Z4S A;  3LW5 F;  3U61 B;  1Q39 A;  1J7M A;  2MH8 A;  2D7H A;  5IWA M;  2IOU A;  2DVW B;  2Y0Q A;  1PJS A;  2ZTC A;  3L27 A;  2OOA A;  4R7G A;  1R2Z A;  3KDS E;  2V1U A;  1DV0 A;  2J7N A;  1MN3 A;  2LH0 A;  4GIP A;  2EA0 A;  1R5L A;  2EO2 A;  4JN6 A;  1SXJ E;  1PJT A;  5EXX A;  1NY5 A;  4OU7 A;  4LZZ A;  4OW0 A;  1CK7 A;  2ZAO A;  3U6L A;  2DWL A;  2C9C A;  2VDB B;  1NJF A;  2LVN C;  1DO0 A;  2UXB M;  4FCW A;  4HL4 A;  2Y2L A;  4JYA M;  4JI3 M;  4FWH A;  4AKH A;  3PXG A;  2XFS A;  3W0L B;  4G4R A;  4LF4 M;  1SXJ D;  2A5Y B;  5KPT A;  1N77 A;  2EKF A;  4FWD A;  4R3D A;  3MJ5 A;  4QNR A;  4LJ8 A;  1G71 A;  4KOD A;  4LZJ A;  1XNR M;  2DI0 A;  3VDU A;  3NBX X;  1IXR C;  4LGM A;  4LF7 M;  2QPA A;  2UU9 M;  4Y28 F;  2JP7 A;  2CHG A;  2Y2P A;  3SHF A;  3W0F A;  1OKS A;  1VDL A;  5EXS A;  3DFZ A;  1GOI A;  2MJ5 B;  2J5Y A;  1VEK A;  2DWZ B;  4MM3 B;  3U5Z B;  4AKG A;  4NY2 A;  5H37 D;  1IY0 A;  3DZD A;  4JV5 M;  1GO5 A;  2KXE A;  3SAU A;  3KSX A;  2Y0T A;  1CXW A;  3DA1 A;  2JY8 A;  2VQF M;  1HNX M;  2JZ1 A;  4NYY A;  2BJW A;  1JR3 E;  1A5T A;  2JCH A;  3I4Y A;  1YLA A;  3I01 M;  2XSZ D;  3J7B A;  1R2Y A;  3CF0 A;  3FTD A;  4NSR A;  3TWL A;  1QO6 A;  3HSH A;  5ITX A;  1F4I A;  1GJS A;  4I5S A;  5EP1 A;  1WGN A;  5ITY A;  2NQ8 C;  3AOE A;  3ZC7 B;  2CV0 A;  1E6Z A;  7CAT A;  4Z2J A;  1W1T A;  2D7G A;  4LJ6 A;  4PDI A;  2QHO B;  3IHP A;  2LVO C;  3FRI A;  5ITQ A;  3GLH A;  2Y2K A;  1OGG A;  4LJ7 A;  1NHW C;  1YE9 A;  2CHV A;  3U6M A;  1AIP C;  1H6U A;  2JNH A;  1XMO M;  3GPP A;  4IIW A;  2EUC A;  3WD4 A;  2Z8Y M;  3VDP A;  4A3V B;  4DUY M;  4LCB A;  2D7E A;  3K2L A;  1HT2 E;  2Y2H A;  3M7G A;  3VKH A;  1XXH B;  1C7Y A;  1BVS A;  4LF8 M;  4B3R M;  3D8B A;  3GRY A;  4MGY E;  3GLF B;  2L4F A;  4ANR A;  5EQT A;  2K6B A;  1IFY A;  2OO9 A;  3FKE A;  4QHS A;  4S12 A;  2F5S A;  1IQP A;  2R0I A;  3F92 A;  1JR3 A;  2K9D A;  3FE3 A;  4JI8 M;  4DV2 M;  3KOZ E;  2Y2G A;  3SYL A;  4HME A;  3HHZ A;  2CV1 A;  1DGF A;  4MB3 A;  2LHG A;  4CIZ A;  2DAK A;  3U60 B;  1Z6T A;  1PM5 A;  3SMS A;  2C9O A;  1NVM A;  4LJ4 A;  1PJI A;  2F5O A;  3WD2 A;  2O01 F;  3GLI A;  2UWX A;  3JR5 A;  2UUB M;  1E8B A;  2JZ0 A;  4DR7 M;  2Q2E B;  5ITU A;  1TDZ A;  3D8L A;  3WD0 A;  2LVQ D;  4PT5 A;  3V76 A;  2Y2M A;  2KW0 A;  1I4W A;  1UR9 A;  4OJL A;  4NC6 A;  4UN2 B;  3K8Z A;  5JI2 E;  1IN5 A;  3J80 S;  1GL6 A;  2OPF A;  3KVW A;  1SXJ C;  1WR1 B;  4B3S M;  2R46 A;  3I51 A;  1W1P A;  3KP0 E;  1IXS B;  4QNL A;  3HHY A;  3BOS A;  2KNA A;  1J09 A;  4MB7 A;  3PNV A;  4OJP A;  1NV8 A;  4NRV A;  1HQY E;  1MU5 A;  3K9P A;  4HLQ A;  2DXI A;  1L2C A;  1L2D A;  1OQY A;  2X4A A;  4MGH A;  2MRO B;  4BB9 A;  3HON A;  3VK7 A;  2UUC M;  4OJ6 A;  1E88 A;  1K3X A;  1DO2 A;  1WJ7 A;  1W5S A;  2KNV A;  1AUA A;  4LF6 M;  4L16 A;  5C1B A;  3ILK A;  2CEA A;  5ITT A;  3TE6 A;  1DGG A;  5EJC A;  1ZMW A;  3OTO M;  2DZL A;  1DGH B;  3DOA A;  1TDH A;  2BG1 A;  3UZU A;  1D0M A;  4Z2H A;  1HNW M;  4QHT A;  1LV7 A;  3U61 A;  4X66 M;  4GKK M;  3FTC A;  3T15 A;  1GLN A;  1IN8 A;  2MR9 A;  4GEW A;  4Z6Y A;  4DV7 M;  3HY5 A;  1FJG M;  2DAE A;  2FNA A;  2L7H A;  4QOS A;  4DV1 M;  1Q02 A;  3LQQ A;  2Z3X A;  4GH9 A;  1E9S A;  4I8O A;  4FD2 A;  1Z5B A;  4W5W A;  2YFQ A;  3B7Q A;  3EIH A;  1YUE A;  1Z59 A;  3AV0 A;  5FLX S;  1J5E M;  5L8R F;  4L8R C;  2FH0 A;  4JI7 M;  4NZ3 A;  3VLF B;  1TF0 B;  2FE8 A;  2R4E A;  3MMP A;  2KA6 B;  3KW6 A;  2APL A;  3I04 M;  3GQ4 A;  3NBI A;  3WHK A;  3E46 A;  1PDC A;  2O5R A;  1C1K A;  2ZTD A;  4LFB M;  1GJT A;  5DFL A;  2Y2O A;  3ZCB B;  2BJV A;  4DV3 M;  3CF2 A;  3J81 S;  3L25 A;  2HKJ A;  1HQC A;  2F5N A;  5ITX E;  1D0L A;  4Z2L A;  3HHX A;  4LFC M;  2X49 A;  1UR8 A;  3CF6 E;  1PJJ A;  4LJA A;  3QYB A;  3AJI B;  3MQL A;  1XNQ M;  3U5Z A;  3KFU G;  2I7P A;  4YY3 M;  2ZAM A;  4KO8 A;  1L1T A;  4NZ5 A;  3GLH E;  3SAW A;  4DR2 M;  1EAK A;  2JUJ A;  4LFA M;  1WIV A;  2KZS A;  3KSJ A;  1DGB A;  4CIS A;  1VQ1 A;  2DZO B;  2RTS A;  2HWJ A;  4GMQ A;  2B3T A;  1EIJ A;  3VK8 A;  1MX0 A;  2C96 A;  4R71 A;  3KS8 A;  4JI4 M;  2HL7 A;  3LCU A;  2D49 A;  2CE7 A;  5IRE B;  3CTW B;  2FFF B;  1Q3C A;  4B3M M;  3HJQ A;  2R45 A;  2LBC A;  1LTM A;  2YQZ A;  2JY5 A;  3M0E A;  4P17 A;  3U6C A;  3SBJ A;  1PJQ A;  1IN4 A;  4GHA A;  4BBA A;  4LY6 A;  4REZ A;  1NY6 A;  1GKI A;  4MGZ E;  1O6I A;  1P3Q Q;  4NYU A;  2DHR A;  4IBI A;  1HNZ M;  4M9X A;  2HAK A;  4GC5 A;  3SMP A;  1JR3 D;  4X65 M;  1XXH A;  1EE8 A;  3GLI E;  4DR4 M;  2R4J A;  3LCV B;  3L28 A;  3TWK A;  3FRH A;  1JQJ C;  3FD9 A;  3QYE A;  2QBY B;  3FUT A;  3KOY E;  3GLF A;  3H4J A;  3L26 A;  1K3W A;  1QZE A;  1QYR A;  1KFV A;  3FTF A;  1G4A E;  5EXP A;  2JY7 A;  2BNK A;  3PFI A;  1TH3 A;  1E6P A;  4JI1 M;  4DR6 M;  1V33 A;  1ZMV A;  2C5R A;  2Y2J A;  1IY1 A;  3HZJ A;  2P5T A;  2ZAN A;  3HX3 A;  5FTN A;  3C58 A;  3GLG B;  2JA2 A;  3T38 A;  4AG5 A;  3UJN A;  4JI5 M;  3WD1 A;  1SG9 A;  1WGL A;  2RRU A;  2GQF A;  4MB5 A;  3U60 A;  2H1R A;  3HU3 A;  1XHB A;  1TH2 A;  2G5G X;  2VQE M;  1KS0 A;  1ZMU A;  2YR0 A;  1XC8 A;  3TWM A;  1QUT A;  4KLN A;  4WUR A;  3KS4 A;  4WW0 A;  3RE8 A;  3AL0 C;  1SXJ B;  2VF8 A;  5FTL A;  2Z4R A;  1Q3B A;  1QDR A;  2HHH M;  2L4E A;  3U6Q A;  4LG2 A;  3T1Y M;  3BBZ A;  3C9P A;  4GHL A;  2L7I A;  2CWB A;  1NV9 A;  4RNA A;  4D82 A;  1IXS A;  2RGH A;  1AIW A;  3NWL A;  3QAU A;  2XLJ A;  4G4O A;  3HU2 A;  3R9X B;  3K92 A;  3FUV A;  3I4V A;  5DYI A;  1ZV1 A;  4G4Q A;  3J2P B;  4AI6 A;  5ITR A;  3MK6 A;  1IN6 A;  2KDL A;  2RGO A;  1W5T A;  3K9O A;  2KHH A;  4NXN M;  3B9P A;  1S3S A;  2JY6 B;  4JXJ A;  1E6N A;  2XEP A;  3RFW A;  1J7K A;  5LMN M;  3U6S A;  4OVZ B;  3TPZ A;  4MGI E;  2FFJ A;  3RGS A;  3A46 A;  1K82 A;  1QUS A;  1DGH A;  1R4G A;  2CP8 A;  3FUX A;  4IBK A;  2DNA A;  5GKN A;  3TL4 X;  3AOE C;  3GP1 A;  1UFZ A;  4NRW A;  1N33 M;  4NZ4 A;  3GPX A;  2UUA M;  3JR4 A;  1QQW A;  3SHG B;  3GQ3 A;  2QZ4 A;  1WHC A;  2DZN B;  3VFD A;  1Y8G A;  1R7R A;  4II7 A;  1OFI A;  5DYG A;  1HR0 M;  3HGI A;  4ITQ A;  3U6E A;  3QWL A;  1QDT A;  3KP1 E;  3C3D A;  1Z5A A;  2R62 A;  5KPR A;  3SAT A;  4NXM M;  5FTM A;  2H5X A;  5FSW A;  4CJ6 A;  5BR8 M;  8CAT A;  2QQ8 A;  4AQY M;  1ZQ9 A;  4AKI A;  4X64 M;  2XD5 A;  3M6A A;  1TR8 A;  1ORY B;  1OGB A;  2KNZ A;  2I7N A;  2KZU A;  1OIP A;  5FTJ A;  3J27 B;  4B7F A;  4D81 A;  3SAV A;  1KSF X;  1NJG A;  2QEN A;  2GNO A;  2C99 A;  4LJ9 A;  3SC3 A;  2FS1 A;  4OUI A;  1L1Z A;  2F4V M;  3U6D A;  3FUW A;  1E32 A;  1YU0 A;  1XB2 B;  1VEJ A;  1NSF A;  2R44 A;  4IBB A;  4OX9 M;  1N36 M;  5E6J A;  4NL4 H;  4PCZ A;  1OAO C;  1TGU A;  3M7P A;  4LGY A;  4AG6 A;  2XFT A;  4D80 A;  3LVW A;  1V34 A;  1GXD A;  2W82 A;  2ZBK B;  4FCT A;  2KRK A;  2XH9 A;  1YSY A;  4M0D A;  3GQ5 A;  3SYK A;  3UK6 A;  3U6P A;  4HMC A;  3GLG E;  1H0G A;  3HJ8 A;  4G4N A;  4L6V 6;  3UMM A;  4LF5 M;  1XXH E;  2JE5 A;  2CRU A;  3THG A;  3N3F A;  2LWX A;  4KHP M;  1D2N A;  4IBE A;  3A45 A;  4XGI A;  3GLF E;  1W1V A;  4G3O A;  3WHL A;  2O25 A;  3T1H M;  2LNH C;  1NNU C;  2HCB A;  1YUB A;  2YNM D;  3GRR A;  4L15 A;  3GPU A;  4PDG A;  1T3T A;  4EIW A;  3HJS A;  2L09 A;  4Z8X A;  2DAG A;  2M60 A;  4DUZ M;  3L29 A;  2BWB A;  5DNY A;  1KYI A;  4GC9 A;  4IBC A;  4IBG A;  2F5P A;  5EP3 A;  2XGN A;  1L8Q A;  1YU3 A;  1PGY A;  5C18 A;  4L78 A;  2LXE A;  3LQR A;  2QBY A;  4JI0 M;  2Y2I A;  4MGK E;  3SFZ A;  2K47 A;  2V1C A;  1G59 A;  1W1Y A;  1GVN A;  1HT1 E;  1VEG A;  2FOI C;  3A42 A;  4Z2I A;  1E94 E;  3GLG A;  3PVS A;  5EP2 A;  4DBG B;  4L4U A;  2DKL A;  4ZPX A;  4XBO A;  5IZ7 D;  1GL7 A;  3GO8 A;  5IT9 S;  4TUW A;  1NHG C;  4YHH M;  1G3I A;  2X8A A;  2LVA A;  3FYD A;  4M9S A;  4NZ1 A;  2EJS A;  5F3W A;  5BPV A;  5LMU M;  3HKP A;  4FWG A;  2CUZ A;  1X37 A;  2QCU A;  3HWS A;  2QNJ A;  3BXW A;  4LJ5 A;  1SXJ A;  4F1I A;  1IBM M;  4TX8 A;  1QAM A;  1D0K A;  3CGW A;  1XWI A;  2QSF X;  3U6O A;  1ED7 A;  4G6Z A;  1OAI A;  1OFH A;  1YU2 A;  2XF3 A;  4DR1 M;  3SAS A;  4MB4 A;  3B7Z A;  1V92 A;  1VDD A;  4B7H A;  4IJE A;  2DWN A;  4JI2 M;  2L6O A;  3AKZ A;  1ZAE A;  2DEN A;  3Q8G A;  3W68 A;  1N34 M;  3EIE A;  2Y2Q A;  3RGP A;  1EFU B;  4QNM A;  2XZU A;  1N75 A;  2ERC A;  2M5Z A;  3IG5 A;  3T6P A;  1H0I A;  1E9R A;  2V5O A;  2LVP C;  3UGJ A;  1CUK A;  1TTE A;  1R6B X;  3L2A A;  3LMM A;  4XK8 F;  3GPY A;  1YU1 A;  1JB0 F;  1I94 M;  3R8F A;  4Q7J A;  2DWM A;  3PNY A;  5E26 A;  1N78 A;  3VKG A;  4GIT A;  2V6Z M;  3AOG A;  4IJF A;  2XSZ A;  3E4R A;  4NSO B;  4OVZ A;  3W67 A;  1OTR A;  5KPZ A;  2BWE A;  4QOZ C;  4LF9 M;  3GLH B;  1L2B A;  4I81 A;  3H4M A;  4HEO A;  4X62 M;  2OQ4 A;  4RF0 A;  2CV2 A;  2KRU A;  2XZF A;  2OOB A;  2XD1 A;  4OJO A;  5FTK A;  4Z2K A;  2WSE F;  4Z2G A;  3SAR A;  2EKK A;  2G3Q A;  3B89 A;  1WXQ A;  1IN7 A;  1QAN A;  4BLC A;  3B74 A;  5EXT A;  4HMD A;  1QZM A;  5JI3 E;  1IBK M;  2N35 A;  2JWS A;  2R18 A;  3WD3 A;  2WZJ A;  4DR5 M;  2LHC A;  1H8P A;  1YU4 A;  3KOW E;  1NO1 A;  4F2L A;  4P16 A;  4B08 A;  3HHW A;  3Q8X A;  4NOO B;  5EP4 A;  4LRT A;  1QVR A;  2F5Q A;  1FNN A;  2Y21 A;  4IBF A;  4AZF A;  5KO3 A;  4DR3 M;  2QP9 X;  4B3T M;  2K0B X;  2L2D A;  2WSF F;  3AFH A;  1E6R A;  4K0K M;  1Z5C A;  2JXN A;  3J7A S;  2VF7 A;  2R6F A;  4CHT B;  4FCV A;  1N32 M;  2UXC M;  1T6O A;  4RF1 A;  2C98 A;  1MJG M;  3FYC A;  3GLI B;  4DV4 M;  2UXD M;  2FN2 A;  2DAM A;  2DHY A;  3HU1 A;  4FW9 A;  4CGY B;  5A2Q S;  1E15 A;  5KQ8 A;  2VII A;  4AW4 A;  1QAO A;  4WP2 A;  1GAB A;  3WX7 A;  3B7N A;  4PD2 A;  1GPF A;  1G41 A;  1OIZ A;  2WSC F;  3LVV A;  2G8L A;  4IBJ A;  3ZH9 B;  4OJ5 A;  2R65 A;  4I4L A;  3JAM S;  1TH4 A;  2CHQ A;  1QAQ A;  2RKO A;  4DV0 M;  4GRI A;  2DAI A;  4GKJ M;  4B7G A;  3E21 A;  4M9Z A;  3MHV C;  4KT0 F;  5KQD A;  1G8P A;  1RU3 A;  2ZM6 M;  3FTE A;  1IM2 A;  1IY2 A;  2MGW A;  3ZQJ A;  3E9S A;  3IG8 A;  1HJP A;  1UM8 A;  1OJL A;  4M0W A;  1IXZ A;  3FUU A;  1IBL M;  3C3E A;  2J7O A;  3GRU A;  3GRV A;  4MH0 E;  4DV6 M;  3KXE C;  1XMQ M;  2Y2N A;  2Y20 A;  4IBD A;  3TQS A;  3K1J A;  4RKU F;  1L6J A;  1PRB A;  2Z7J A;  2AHM A;  2E5L M;  4LRS A;  2LTU A;  4FVM A;  2CFO A;  1VG5 A;  1T43 A;  3IEC A; 
#chains in the Genus database with same CATH homology
 4JI6 M;  4DV5 M;  3KOX E;  2KEB A;  1NNJ A;  3A98 B;  2Z4S A;  3U61 B;  1Q39 A;  2D7H A;  5IWA M;  2IOU A;  2DVW B;  2Y0Q A;  4R7G A;  3L27 A;  1R2Z A;  3KDS E;  2V1U A;  2J7N A;  2EA0 A;  2LH0 A;  4GIP A;  4AKG A;  2EO2 A;  4JN6 A;  1SXJ E;  4OU7 A;  5EXX A;  1NY5 A;  4LZZ A;  4OW0 A;  2ZAO A;  3U6L A;  2DWL A;  2C9C A;  1NJF A;  1DO0 A;  2UXB M;  4FCW A;  4HL4 A;  2Y2L A;  4JYA M;  4JI3 M;  4FWH A;  4AKH A;  3PXG A;  2XFS A;  3W0L B;  4G4R A;  4LF4 M;  1SXJ D;  2A5Y B;  5KPT A;  1N77 A;  4FWD A;  4R3D A;  3MJ5 A;  4QNR A;  4LJ8 A;  4KOD A;  4LZJ A;  1XNR M;  3VDU A;  1IXR C;  4LGM A;  4LF7 M;  2QPA A;  2UU9 M;  2CHG A;  2Y2P A;  3SHF A;  3W0F A;  5EXS A;  3DFZ A;  4MM3 B;  3U5Z B;  4NY2 A;  5H37 D;  1IY0 A;  3DZD A;  4JV5 M;  2KXE A;  3SAU A;  3KSX A;  2Y0T A;  3DA1 A;  1HNX M;  2VQF M;  4NYY A;  2BJW A;  2JCH A;  3I4Y A;  2XSZ D;  3J7B A;  1R2Y A;  3CF0 A;  3FTD A;  4NSR A;  3TWL A;  3HSH A;  5ITX A;  4I5S A;  5EP1 A;  2CV0 A;  5ITY A;  2NQ8 C;  3AOE A;  3ZC7 B;  7CAT A;  2D7G A;  4LJ6 A;  4PDI A;  5ITQ A;  3GLH A;  2Y2K A;  4LJ7 A;  1NHW C;  1YE9 A;  2CHV A;  3U6M A;  1H6U A;  1XMO M;  3GPP A;  4IIW A;  2EUC A;  3VDP A;  4A3V B;  4DUY M;  4LCB A;  2D7E A;  3K2L A;  1HT2 E;  2Y2H A;  3M7G A;  3VKH A;  1XXH B;  4LF8 M;  4B3R M;  3D8B A;  3GRY A;  4MGY E;  3GLF B;  5EQT A;  3FKE A;  4QHS A;  4S12 A;  2F5S A;  1IQP A;  1JR3 A;  4JI8 M;  4DV2 M;  3KOZ E;  2Y2G A;  3SYL A;  3HHZ A;  2CV1 A;  1DGF A;  3U60 B;  1Z6T A;  1PM5 A;  3SMS A;  2C9O A;  1NVM A;  4LJ4 A;  1PJI A;  2F5O A;  3GLI A;  2UWX A;  3JR5 A;  2UUB M;  4DR7 M;  2Q2E B;  5ITU A;  1TDZ A;  3D8L A;  4PT5 A;  2Y2M A;  2KW0 A;  1I4W A;  4OJL A;  3K8Z A;  5JI2 E;  1IN5 A;  3J80 S;  1GL6 A;  2OPF A;  3KVW A;  1SXJ C;  4B3S M;  2R46 A;  3I51 A;  4QNL A;  3KP0 E;  1IXS B;  3HHY A;  3BOS A;  1J09 A;  4MB7 A;  3PNV A;  4OJP A;  4NRV A;  1HQY E;  1MU5 A;  4HLQ A;  2DXI A;  1L2C A;  1L2D A;  2X4A A;  4MGH A;  4BB9 A;  3HON A;  3VK7 A;  2UUC M;  4OJ6 A;  1K3X A;  1DO2 A;  1W5S A;  4LF6 M;  4L16 A;  5C1B A;  3ILK A;  2CEA A;  5ITT A;  3TE6 A;  1DGG A;  5EJC A;  3OTO M;  1DGH B;  3DOA A;  1TDH A;  2BG1 A;  3UZU A;  1HNW M;  4QHT A;  1LV7 A;  3U61 A;  4X66 M;  4GKK M;  3FTC A;  3T15 A;  1GLN A;  1IN8 A;  4Z6Y A;  4DV7 M;  1FJG M;  2FNA A;  2L7H A;  4QOS A;  4DV1 M;  3LQQ A;  2Z3X A;  4GH9 A;  1E9S A;  4I8O A;  4FD2 A;  1Z5B A;  4W5W A;  2YFQ A;  1YUE A;  3EIH A;  1Z59 A;  3AV0 A;  5FLX S;  1J5E M;  4L8R C;  4JI7 M;  4NZ3 A;  3VLF B;  2R4E A;  2FE8 A;  2KA6 B;  3KW6 A;  3GQ4 A;  3NBI A;  3WHK A;  2O5R A;  1C1K A;  4LFB M;  2Y2O A;  3ZCB B;  2BJV A;  4DV3 M;  3CF2 A;  3J81 S;  3L25 A;  2HKJ A;  1HQC A;  2F5N A;  5ITX E;  3HHX A;  4LFC M;  2X49 A;  3CF6 E;  1PJJ A;  4LJA A;  3AJI B;  1XNQ M;  3U5Z A;  3KFU G;  2I7P A;  4YY3 M;  2ZAM A;  4KO8 A;  1L1T A;  4NZ5 A;  3SAW A;  4DR2 M;  4LFA M;  2KZS A;  3KSJ A;  1DGB A;  4CIS A;  2DZO B;  4GMQ A;  3VK8 A;  1MX0 A;  2C96 A;  3KS8 A;  4JI4 M;  2HL7 A;  2CE7 A;  5IRE B;  3CTW B;  2FFF B;  1Q3C A;  4B3M M;  3HJQ A;  2R45 A;  2YQZ A;  3U6C A;  3M0E A;  3SBJ A;  4GHA A;  1IN4 A;  4BBA A;  4LY6 A;  4REZ A;  1NY6 A;  1GKI A;  4MGZ E;  4NYU A;  2DHR A;  4IBI A;  1HNZ M;  4M9X A;  3SMP A;  4GC5 A;  4DR4 M;  1JR3 D;  4X65 M;  1XXH A;  1EE8 A;  4OJO A;  2R4J A;  3L28 A;  3TWK A;  1JQJ C;  3FD9 A;  2QBY B;  3FUT A;  3KOY E;  3GLF A;  3L26 A;  1K3W A;  1KFV A;  1QYR A;  3FTF A;  1G4A E;  5EXP A;  2BNK A;  3PFI A;  1TH3 A;  4JI1 M;  4DR6 M;  2C5R A;  2Y2J A;  1IY1 A;  2P5T A;  2ZAN A;  3C58 A;  5FTN A;  3GLG B;  2JA2 A;  3T38 A;  4AG5 A;  3UJN A;  4JI5 M;  3U60 A;  2H1R A;  3HU3 A;  1XHB A;  1TH2 A;  2G5G X;  2VQE M;  2YR0 A;  1XC8 A;  3TWM A;  4KLN A;  4WW0 A;  4WUR A;  3KS4 A;  3RE8 A;  3AL0 C;  1SXJ B;  5FTL A;  2Z4R A;  1Q3B A;  2HHH M;  3U6Q A;  4LG2 A;  3T1Y M;  4GHL A;  2L7I A;  4RNA A;  4D82 A;  2RGH A;  3NWL A;  3QAU A;  2XLJ A;  4G4O A;  3HU2 A;  3R9X B;  3K92 A;  3FUV A;  3I4V A;  5DYI A;  4G4Q A;  3J2P B;  4AI6 A;  5ITR A;  3MK6 A;  1IN6 A;  2RGO A;  1W5T A;  4NXN M;  3B9P A;  1S3S A;  4JXJ A;  2XEP A;  3RFW A;  1J7K A;  5LMN M;  3U6S A;  4OVZ B;  3TPZ A;  4MGI E;  2FFJ A;  3RGS A;  3A46 A;  1K82 A;  4IBK A;  1DGH A;  3FUX A;  4NRW A;  3GP1 A;  5GKN A;  1N33 M;  3TL4 X;  3AOE C;  4NZ4 A;  3GPX A;  2UUA M;  3JR4 A;  1QQW A;  3SHG B;  3GQ3 A;  2QZ4 A;  2DZN B;  3VFD A;  1R7R A;  4II7 A;  1OFI A;  5DYG A;  1HR0 M;  3HGI A;  4ITQ A;  3U6E A;  3QWL A;  3KP1 E;  4NXM M;  1Z5A A;  2R62 A;  5KPR A;  3SAT A;  5FTM A;  5FSW A;  5BR8 M;  8CAT A;  4AQY M;  1ZQ9 A;  4AKI A;  4X64 M;  2XD5 A;  3M6A A;  1ORY B;  2I7N A;  2KZU A;  5FTJ A;  3J27 B;  4B7F A;  4D81 A;  3SAV A;  1KSF X;  1NJG A;  2QEN A;  4LJ9 A;  2C99 A;  3SC3 A;  4OUI A;  1L1Z A;  2F4V M;  3U6D A;  3FUW A;  1E32 A;  1YU0 A;  4IBB A;  1NSF A;  4OX9 M;  1N36 M;  5E6J A;  4NL4 H;  4PCZ A;  1TGU A;  4LGY A;  4AG6 A;  2XFT A;  4D80 A;  3LVW A;  2W82 A;  2ZBK B;  4FCT A;  2KRK A;  2XH9 A;  1YSY A;  4M0D A;  3GQ5 A;  3SYK A;  3UK6 A;  3U6P A;  3HJ8 A;  4G4N A;  3UMM A;  4LF5 M;  2JE5 A;  3N3F A;  3THG A;  2LWX A;  4KHP M;  1D2N A;  4IBE A;  3A45 A;  4XGI A;  3WHL A;  3T1H M;  2LNH C;  1NNU C;  2HCB A;  1YUB A;  2YNM D;  3GRR A;  4L15 A;  3GPU A;  4PDG A;  1T3T A;  4EIW A;  3HJS A;  2L09 A;  4Z8X A;  2M60 A;  4DUZ M;  3L29 A;  5DNY A;  1KYI A;  4GC9 A;  4IBC A;  4IBG A;  2F5P A;  5EP3 A;  2XGN A;  1L8Q A;  1YU3 A;  5C18 A;  4L78 A;  2LXE A;  3LQR A;  2QBY A;  4JI0 M;  2Y2I A;  4MGK E;  3SFZ A;  2K47 A;  2V1C A;  1G59 A;  1GVN A;  1HT1 E;  2FOI C;  3A42 A;  1E94 E;  3GLG A;  3PVS A;  5EP2 A;  4L4U A;  4ZPX A;  4XBO A;  5IZ7 D;  1GL7 A;  3GO8 A;  5IT9 S;  4TUW A;  1NHG C;  4YHH M;  1G3I A;  2X8A A;  3FYD A;  4M9S A;  4NZ1 A;  5F3W A;  5BPV A;  5LMU M;  3HKP A;  4FWG A;  2CUZ A;  1X37 A;  2QCU A;  3HWS A;  4LJ5 A;  1SXJ A;  1IBM M;  1QAM A;  1XWI A;  3U6O A;  4G6Z A;  1OFH A;  1YU2 A;  2XF3 A;  4DR1 M;  3SAS A;  1VDD A;  4B7H A;  4IJE A;  2DWN A;  4JI2 M;  2L6O A;  3AKZ A;  1ZAE A;  1N34 M;  3EIE A;  2Y2Q A;  3RGP A;  4QNM A;  2XZU A;  1N75 A;  2ERC A;  2M5Z A;  3IG5 A;  1E9R A;  3UGJ A;  3L2A A;  1R6B X;  3LMM A;  3GPY A;  1YU1 A;  1I94 M;  3R8F A;  2DWM A;  3VKG A;  3PNY A;  5E26 A;  1N78 A;  4GIT A;  2V6Z M;  3AOG A;  4IJF A;  2XSZ A;  3E4R A;  4NSO B;  4OVZ A;  5KPZ A;  4QOZ C;  4LF9 M;  3GLH B;  1L2B A;  4I81 A;  3H4M A;  4X62 M;  2OQ4 A;  4RF0 A;  2CV2 A;  2KRU A;  2XZF A;  2XD1 A;  5FTK A;  3SAR A;  1WXQ A;  1IN7 A;  1QAN A;  4BLC A;  5EXT A;  1QZM A;  5JI3 E;  1IBK M;  2R18 A;  4DR5 M;  1YU4 A;  3KOW E;  4P16 A;  4B08 A;  3HHW A;  3Q8X A;  4NOO B;  5EP4 A;  4LRT A;  1QVR A;  2F5Q A;  1FNN A;  2Y21 A;  4IBF A;  4AZF A;  5KO3 A;  4DR3 M;  2QP9 X;  4B3T M;  3AFH A;  4K0K M;  1Z5C A;  3J7A S;  4CHT B;  4FCV A;  1N32 M;  2UXC M;  4RF1 A;  3GLI B;  2C98 A;  3FYC A;  4DV4 M;  2UXD M;  3HU1 A;  4CGY B;  4FW9 A;  5A2Q S;  5KQ8 A;  2VII A;  4AW4 A;  1QAO A;  3WX7 A;  4PD2 A;  1G41 A;  3LVV A;  2G8L A;  4IBJ A;  3ZH9 B;  4OJ5 A;  2R65 A;  4I4L A;  3JAM S;  1TH4 A;  2CHQ A;  1QAQ A;  2RKO A;  4DV0 M;  4GRI A;  4GKJ M;  4B7G A;  4M9Z A;  3MHV C;  5KQD A;  1G8P A;  2ZM6 M;  3FTE A;  1IM2 A;  1IY2 A;  3E9S A;  3IG8 A;  1UM8 A;  1OJL A;  4M0W A;  1IXZ A;  3FUU A;  1IBL M;  2J7O A;  3GRU A;  3GRV A;  4MH0 E;  4DV6 M;  3KXE C;  1XMQ M;  2Y2N A;  2Y20 A;  4IBD A;  3TQS A;  3K1J A;  2Z7J A;  2AHM A;  2E5L M;  4LRS A;  4FVM A;  2CFO A;  2DWZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...