3L28A

Crystal structure of zaire ebola vp35 interferon inhibitory domain k339a mutant
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
123
structure length
123
Chain Sequence
DISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polymerase cofactor VP35
publication title Structural basis for dsRNA recognition and interferon antagonism by Ebola VP35.
pubmed doi rcsb
source organism Zaire ebolavirus
molecule tags Rna binding protein
total genus 37
structure length 123
sequence length 123
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3l28A01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 3l28A02
4IBDA 3L29A 4IBGA 4GH9A 4IBJA 4IJFA 5BPVA 4IJEA 3KS4A 3L2AA 4IBFA 4IBCA 4IBBA 4IBIA 3L28A 4GHLA 4IBKA 3KS8A 3L26A 4LG2A 3L25A 4GHAA 3FKEA 3L27A 4IBEA
chains in the Genus database with same CATH superfamily
3KDSE 3PXGA 1E6PA 3TWKA 3D8LA 2ZAMA 2BJVA 4MB3A 2CHGA 2Y2MA 3ZH9B 2L4FA 3NBIA 1MJGM 4JYAM 4NXNM 2Y2IA 4OJLA 2XZUA 3PNVA 1DGGA 2C9OA 3SFZA 1E88A 3IECA 3SMSA 3E4RA 3TWLA 4TX8A 3BBZA 4IBBA 3U60B 4P16A 4NYUA 5ITYA 1IN7A 2O5RA 2LHGA 2UU9M 2RTSA 4PT5A 2XEPA 3KOZE 1L2BA 3QWLA 4DR6M 1A5TA 1JR3A 5FTKA 2OO9A 4GIPA 2DHRA 2LTUA 4L16A 1V34A 2R6FA 4OW0A 1WGLA 5ITQA 2N35A 4YY3M 2FFFB 3PFIA 4GKJM 1WXQA 3B89A 1E6ZA 3BXWA 2JNHA 2ZANA 3LVWA 4FWDA 3SYKA 4GITA 1FJGM 1WHCA 3WD2A 1L6JA 4MM3B 2O25A 4L15A 2QENA 4RNAA 1TF0B 1XWIA 3HHXA 3HWSA 3I4YA 3C58A 5BPVA 2Y2HA 2XFTA 2Y2QA 3LQRA 2KXEA 3TL4X 3HHZA 1L8QA 3FE3A 4ITQA 2JCHA 3FUUA 4B7HA 1W5TA 1Z59A 5BR8M 3RGSA 2K0BX 1G59A 4NZ3A 3HY5A 4OJ6A 3GLHA 2LVQD 4Q7JA 4CHTB 1ORYB 3B7ZA 1JR3D 3L25A 4Z2JA 4GHAA 3FKEA 2ZTCA 5KPZA 4X64M 1LTMA 3U6MA 3DA1A 2F5QA 3Q8XA 1N75A 4MB5A 4GKKM 4IBEA 3U6EA 2RRUA 4NC6A 4BLCA 3KXEC 4DUZM 1CUKA 4GMQA 4F2LA 2WSCF 3KW6A 4RF0A 3SC3A 1Q3BA 1HJPA 2HWJA 2KZUA 1YU0A 4GRIA 2QQ8A 1H6UA 4DV3M 2JY5A 2JY7A 4QNMA 1CXWA 2XSZD 3K1JA 4I81A 3HU3A 4FWGA 4MGKE 4DBGB 1JR3E 1ED7A 2XLJA 2DWNA 3TE6A 3JAMS 3U60A 1N78A 4D82A 4BBAA 5ITUA 1TDZA 3KVWA 3VK8A 1C7YA 2QHOB 5EXTA 4DV2M 1VEGA 2KA6B 3KOXE 5EP3A 2DNAA 2OQ4A 3WD0A 5KPRA 3U5ZA 3GO8A 2QCUA 2KW0A 2DAIA 5KPTA 1WR1B 1IN5A 2KHHA 3CF2A 2V1CA 1NHGC 4JI6M 3Q8GA 1P3QQ 1OGGA 1YU2A 3SHGB 4X62M 3U6OA 3DOAA 3H4JA 4LF4M 1EE8A 4LJ5A 1N33M 3GLIB 3AJIB 3SAWA 2DWMA 1QAOA 3LCUA 4G4RA 3FUXA 1WJ7A 1W5SA 1XNQM 3H4MA 1OAOC 4R71A 1TH4A 3SASA 3GLHE 4Z8XA 1K3WA 1HT2E 4REZA 4XBOA 2ERCA 1E6NA 2UWXA 2WSFF 1G4AE 1MU5A 4LF5M 1UFZA 3UGJA 3FTFA 1QDTA 3HZJA 1Y8GA 2GNOA 4G4NA 5F3WA 3R9XB 4GHLA 3QAUA 2D7HA 3U6QA 2FH0A 1T6OA 2JZ0A 1NHWC 2LHCA 4QOSA 4LJ9A 4LG2A 3UK6A 1HNZM 1NJFA 1CK7A 1E6RA 3U5ZB 3GPPA 2Y0QA 1OIZA 4NYYA 3CF6E 2Y2PA 1Q02A 4LFCM 4K0KM 4AG6A 1NSFA 3L29A 2D7GA 4LF9M 4IBGA 2YR0A 2EJSA 3CF0A 4LJ8A 4QOZC 3HKPA 4AI6A 1GO5A 1QAQA 4PCZA 1HNXM 2XZFA 2EKKA 1IN6A 1GL7A 1QAMA 1XXHE 2JZ1A 1W1YA 1AIPC 3U6PA 2KNAA 1ZAEA 4DV6M 3T1YM 3JR5A 4JI1M 4B3SM 3TPZA 1F4IA 3QYBA 2Y21A 1L1TA 4QNLA 3DFZA 2Y2NA 1KSFX 1YLAA 5ITXE 2K47A 4QHTA 4RKUF 3AOEA 2DKLA 4M9XA 4WP2A 1IXSB 4ZPXA 4MB4A 1QVRA 2D49A 3ZQJA 1I94M 1L2DA 1HR0M 2F5PA 1QZMA 5IWAM 1GVNA 5DYIA 1SXJD 3FD9A 3GLIA 1R2YA 2JUJA 2R4EA 3C3EA 3GRUA 3KSJA 2HAKA 2L2DA 3HJSA 3GLFE 4FCVA 1OFIA 4OJPA 1TDHA 4NZ4A 4OVZB 4R3DA 4DR7M 2I7PA 1NO1A 2DAMA 2CWBA 4LGYA 3FUWA 3WHKA 4IBCA 4L4UA 1PJIA 3B7QA 1XXHB 3WD3A 2MR9A 3HJQA 5EP2A 2RKOA 1XMQM 1IXZA 3M7PA 1G71A 1SXJE 2X49A 5KO3A 3MHVC 1R4GA 1QUSA 4DV5M 2VQFM 1GL6A 3T38A 3HHWA 4HEOA 2L09A 4DR1M 1ZQ9A 1C1KA 5FTLA 5JI3E 2KNZA 2Z4SA 3VLFB 1H0GA 2R18A 3NWLA 3I4VA 4M0DA 4AG5A 4TUWA 5DFLA 1NY6A 2M60A 1L2CA 4WW0A 3M7GA 2HKJA 4W5WA 2KZSA 4CISA 3SAUA 2XSZA 2IOUA 1SXJC 1TGUA 2M5ZA 1AIWA 4LY6A 1IBKM 1DGHB 4IBIA 1Q3CA 3GLFB 2JY6B 4M9ZA 3FUVA 2QBYB 4WURA 3AV0A 2WSEF 3GPYA 2LVOC 3HU2A 5LMUM 3KP1E 1XC8A 1IXSA 2RGHA 5JI2E 3GLIE 4Z2IA 3E46A 4OUIA 5EXPA 4B3RM 2R0IA 1E94E 4GC5A 3UJNA 2FN2A 3MMPA 2X4AA 4DR5M 4JXJA 5FTJA 1YE9A 3SYLA 1Z5BA 3AOEC 3RFWA 5KQDA 4DV4M 1SXJB 4OJ5A 4NY2A 4A3VB 3U6LA 2QP9X 1V33A 2XH9A 4I4LA 1XNRM 3AKZA 4NSOB 5IT9S 1GJSA 1MN3A 3R8FA 4OVZA 3WX7A 1YU4A 1H0IA 3K9OA 3ZC7B 1E9SA 1E9RA 3CGWA 3L2AA 2KRKA 3VKGA 2Z7JA 1I4WA 2FFJA 2R4JA 1E15A 1MX0A 1XXHA 3J80S 3WHLA 2C96A 4D80A 2XD1A 3HSHA 2F4VM 1G8PA 2DWLA 2FNAA 2CHVA 3EIHA 4I8OA 1D0LA 4MGZE 4Y28F 2VIIA 3B7NA 5DYGA 3GLGB 3U6DA 7CATA 1J5EM 3D8BA 2JA2A 2DAGA 1PDCA 3GP1A 1QO6A 1OQYA 5ITXA 2HHHM 2ZBKB 2DVWB 1NVMA 3T1HM 2F5SA 1HQYE 3VFDA 1R6BX 3U61B 1J7KA 2DAKA 4GH9A 1Z6TA 4II7A 5EJCA 3B9PA 2XF3A 4AKHA 1OGBA 4LF7M 2JWSA 3FYDA 4CIZA 3J7BA 3MK6A 5GKNA 1QUTA 2NQ8C 1HT1E 2EA0A 4LZJA 4KHPM 4IBFA 3DZDA 3RE8A 1DGHA 4AKIA 3GLFA 4MGYE 2BWBA 1YU1A 4JI4M 4L6V6 4IBKA 3A42A 3FRHA 2QBYA 2AHMA 3BOSA 5EQTA 2H1RA 3KOYE 2JY8A 4GEWA 2HL7A 1J09A 2QNJA 2CEAA 2MGWA 3W67A 1PJJA 3LQQA 2FE8A 4MGIE 4L8RC 4LFAM 1IXRC 5ITRA 4JI3M 1IQPA 3LVVA 2LNHC 4S12A 2Y2LA 1SXJA 4KT0F 4NSRA 3HX3A 2CV2A 3M0EA 4X66M 5DNYA 5L8RF 4DV0M 4HLQA 1QZEA 4XK8F 3I51A 2ZAOA 1EIJA 4CJ6A 2DAEA 4G4OA 1QQWA 4F1IA 5C18A 2LXEA 4B3TM 1OFHA 4G3OA 3GQ5A 1XHBA 3K2LA 1PGYA 1AUAA 3VDPA 3ZCBB 4FWHA 3GLGA 2LWXA 3W0LB 3IG5A 3UMMA 1IFYA 5FSWA 2F5NA 3WD1A 4AQYM 3L27A 5EP1A 1IBMM 4G4QA 3SBJA 2MROB 2FS1A 2LBCA 3ILKA 5EXXA 4HMCA 4Z6YA 3U61A 2BWEA 2J7NA 5IZ7D 4FCTA 3KFUG 2JE5A 2V6ZM 3KP0E 2R44A 4GC9A 2CP8A 4NL4H 4JN6A 3VK7A 4RF1A 4B7GA 2UUCM 1R7RA 4LJ4A 1T3TA 4OX9M 1FNNA 3LW5F 2G3QA 4LCBA 4PDGA 1NNUC 2UUBM 2QPAA 3FUTA 4NXMM 3W0FA 2E5LM 3QYEA 3J27B 4IIWA 2WZJA 3FYCA 4YHHM 3J7AS 4Z2KA 4Z2HA 4AZFA 1R5LA 1OJLA 2J5YA 2QSFX 4DR2M 3U6CA 1GLNA 2J7OA 2L4EA 1TH3A 2Q2EB 4ANRA 3VDUA 3GPUA 3N3FA 4X65M 4LFBM 3PVSA 4D81A 5KQ8A 3IG8A 3SMPA 3FTCA 2C9CA 2VF8A 1IN8A 2O01F 3PNYA 5FTMA 4B08A 1PJQA 2I7NA 2HCBA 1TTEA 1VQ1A 2R45A 3KOWE 4P17A 5LMNM 1N77A 4DV7M 1H8PA 3AL0C 4KODA 3GLGE 1Z5CA 4MH0E 1PJTA 1ZMWA 4OU7A 4DR4M 3TQSA 2B3TA 2L7HA 2XFSA 2Y2OA 3FTEA 1YU3A 4MB7A 1ZMVA 2DWZB 1GABA 4R7GA 3TWMA 1DO2A 1NJGA 2K6BA 1S3SA 2MH8A 2UXDM 1K3XA 4EIWA 2DZOB 2YFQA 4LF8M 4HMDA 2ZTDA 1PRBA 2C98A 2CUZA 2V1UA 4LZZA 2DI0A 3C3DA 3AFHA 1UR8A 2CHQA 4KLNA 4CGYB 3GPXA 4LRSA 2DZLA 1EFUB 2W82A 4IJFA 3V76A 4B7FA 1DV0A 5E6JA 1X37A 4LGMA 2R65A 1IN4A 2RGOA 4FD2A 3HGIA 3IHPA 4Z2GA 3B74A 3K8ZA 4FW9A 3KS4A 3LCVB 1N32M 1OIPA 2YQZA 5E26A 4JI7M 2D7EA 2KNVA 2Y2JA 1VDLA 4OJOA 1QYRA 4NRVA 2UXCM 4UN2B 3UZUA 2Z3XA 1V92A 4LJ6A 2KDLA 4DUYM 1VEKA 4M9SA 1YUEA 2F5OA 3MJ5A 2VF7A 1E32A 1JQJC 1TH2A 1DGFA 1YSYA 4PDIA 1JB0F 2Y0TA 2P5TA 1UR9A 3GRVA 2VDBB 1PJSA 2CRUA 4M0WA 1PM5A 3HONA 4JI0M 2R62A 1W1VA 1UM8A 1WIVA 3SAVA 2CV1A 1XMOM 1N36M 4IBJA 4G6ZA 3JR4A 1HQCA 2Z8YM 1GPFA 3GRRA 3I01M 1G41A 3E21A 3A46A 1GKIA 1Q39A 2JXNA 3K9PA 3M6AA 4IJEA 5ITTA 1KYIA 2Y20A 4L78A 1QANA 4XGIA 1OAIA 3T15A 1NY5A 3THGA 2OPFA 2BG1A 2XD5A 4NZ5A 5FLXS 3HJ8A 2XGNA 4LRTA 3HHYA 4B3MM 3E9SA 4NZ1A 4HMEA 4JV5M 1LV7A 2EO2A 3CTWB 3EIEA 3L26A 3K92A 1O6IA 4DV1M 3AOGA 2X8AA 2DXIA 2K9DA 3T6PA 2DHYA 3GQ4A 4HL4A 4AKGA 5A2QS 2KRUA 3C9PA 2OOAA 3WD4A 1DGBA 1NV9A 3RGPA 1W1TA 2V5OA 1D2NA 1VDDA 3I04M 2C5RA 2GQFA 1IM2A 3OTOM 2Y2GA 2KEBA 1YUBA 2BNKA 3J81S 2BJWA 1RU3A 4MGHA 2VQEM 4JI8M 4LJAA 1G3IA 4QNRA 1VG5A 1TR8A 2JP7A 2Y2KA 1K82A 2LVAA 1D0KA 1VEJA 3FTDA 4BB9A 2L7IA 2FOIC 3GQ3A 3KSXA 4JI5M 2APLA 3LMMA 1XB2B 2C99A 1SG9A 2QZ4A 5EP4A 1W1PA 1E8BA 2DENA 2MJ5B 2A5YB 3NBXX 3SATA 1ZV1A 1GXDA 1OKSA 4DR3M 2DZNB 4IBDA 1J7MA 2OOBA 2EUCA 4FCWA 1NV8A 1OTRA 4AW4A 1N34M 3U6SA 3HU1A 1BVSA 5EXSA 2G5GX 1Z5AA 1D0MA 4Z2LA 3A98B 1ZMUA 5IREB 5H37D 1EAKA 3SHFA 3W68A 4PD2A 1WGNA 4JI2M 1NNJA 4KO8A 4FVMA 3F92A 1IBLM 2H5XA 2CE7A 2UUAM 4LF6M 1GJTA 3FRIA 2UXBM 1R2ZA 2LVNC 4QHSA 5FTNA 1IY2A 2YNMD 5C1BA 2CV0A 1GOIA 3L28A 3A45A 1T43A 1HNWM 2L6OA 4LJ7A 3GLHB 2LVPC 3MQLA 1KS0A 3GRYA 3J2PB 8CATA 2EKFA 2ZM6M 3KS8A 3SARA 2G8LA 4NRWA 4I5SA 1L1ZA 1DO0A 1IY0A 2LH0A 1KFVA 1IY1A 3VKHA 1QDRA 2CFOA 2R46A 4NOOB 2Z4RA
chains in the Genus database with same CATH topology
3KDSE 3PXGA 3TWKA 3D8LA 2ZAMA 2BJVA 2CHGA 2Y2MA 3ZH9B 3NBIA 4JYAM 4NXNM 2Y2IA 4OJLA 2XZUA 3PNVA 1DGGA 2C9OA 3SFZA 3SMSA 3E4RA 3TWLA 3U60B 4IBBA 4P16A 4NYUA 5ITYA 1IN7A 2O5RA 2UU9M 4PT5A 2XEPA 3KOZE 1L2BA 3QWLA 4DR6M 1JR3A 5FTKA 1J5EM 4GIPA 2DHRA 4L16A 4OW0A 3U5ZB 5ITQA 4YY3M 2FFFB 3PFIA 4GKJM 1WXQA 2ZANA 3LVWA 4FWDA 3SYKA 4GITA 1FJGM 4MM3B 4RNAA 4L15A 2QENA 1XWIA 3HHXA 3HWSA 3I4YA 3C58A 5BPVA 2Y2HA 2XFTA 2Y2QA 3LQRA 2KXEA 3TL4X 3HHZA 1L8QA 4ITQA 2JCHA 3FUUA 4B7HA 1W5TA 1Z59A 5BR8M 3RGSA 1G59A 4NZ3A 4OJ6A 3GLHA 4CHTB 1ORYB 1JR3D 3L25A 4GHAA 3FKEA 5KPZA 4X64M 3U6MA 3DA1A 2F5QA 3Q8XA 1N75A 4GKKM 4IBEA 3U6EA 4BLCA 4DUZM 3KXEC 4GMQA 3KW6A 4RF0A 3SC3A 1Q3BA 2KZUA 1YU0A 4GRIA 1H6UA 4DV3M 4QNMA 2XSZD 3K1JA 4I81A 3HU3A 4FWGA 4MGKE 2XLJA 2DWNA 3TE6A 3JAMS 3U60A 1N78A 4D82A 4BBAA 5ITUA 1TDZA 3KVWA 3VK8A 5EXTA 4DV2M 2KA6B 3KOXE 5EP3A 2OQ4A 5KPRA 3U5ZA 3GO8A 2QCUA 2KW0A 5KPTA 1IN5A 3CF2A 2V1CA 1NHGC 4JI6M 3SHGB 4X62M 3U6OA 3DOAA 4LF4M 1EE8A 4LJ5A 1N33M 3GLIB 3AJIB 3SAWA 2DWMA 1QAOA 4G4RA 3FUXA 1W5SA 1XNQM 3H4MA 1TH4A 3SASA 4Z8XA 1K3WA 1HT2E 4REZA 4XBOA 2ERCA 2UWXA 4LF5M 1G4AE 1MU5A 3UGJA 3FTFA 4G4NA 5F3WA 3R9XB 4GHLA 3QAUA 2D7HA 3U6QA 1NHWC 4LG2A 4QOSA 4LJ9A 1YU2A 3UK6A 1HNZM 1NJFA 3GPPA 2Y0QA 4NYYA 3CF6E 2Y2PA 4LFCM 4K0KM 4AG6A 1NSFA 3L29A 2D7GA 4LF9M 4IBGA 2YR0A 4LJ8A 3CF0A 4QOZC 4AI6A 3HKPA 1QAQA 4PCZA 1HNXM 2XZFA 1IN6A 1GL7A 1QAMA 3U6PA 1ZAEA 4DV6M 3T1YM 3JR5A 4JI1M 4B3SM 3TPZA 2Y21A 1L1TA 4QNLA 3DFZA 2Y2NA 1KSFX 5ITXE 2K47A 4QHTA 3AOEA 4M9XA 1IXSB 4ZPXA 1QVRA 1I94M 1L2DA 1HR0M 2F5PA 1QZMA 5IWAM 1GVNA 5DYIA 1SXJD 3FD9A 3GLIA 1R2YA 2R4EA 3GRUA 3KSJA 3HJSA 4FCVA 1OFIA 4OJPA 1TDHA 4NZ4A 4OVZB 4R3DA 4DR7M 2I7PA 4LGYA 3FUWA 3WHKA 4IBCA 4L4UA 1PJIA 1XXHB 3HJQA 5EP2A 2RKOA 1XMQM 1IXZA 1SXJE 2X49A 5KO3A 3MHVC 4DV5M 1GL6A 3T38A 3HHWA 2L09A 4DR1M 1ZQ9A 1C1KA 5FTLA 5JI3E 2Z4SA 3VLFB 2R18A 3NWLA 3I4VA 4M0DA 4AG5A 4TUWA 1NY6A 2M60A 1L2CA 4WW0A 3M7GA 2HKJA 4W5WA 2KZSA 4CISA 3SAUA 2XSZA 2IOUA 1SXJC 1TGUA 2M5ZA 4LY6A 1IBKM 1DGHB 4IBIA 1Q3CA 3GLFB 4M9ZA 3FUVA 2QBYB 4WURA 3AV0A 3GPYA 3HU2A 5LMUM 3KP1E 1XC8A 2RGHA 5JI2E 4OUIA 5EXPA 4B3RM 1E94E 4GC5A 3UJNA 2X4AA 4DR5M 4JXJA 5FTJA 1YE9A 3SYLA 1Z5BA 3AOEC 3RFWA 5KQDA 4DV4M 1SXJB 4OJ5A 4NY2A 4A3VB 3U6LA 2QP9X 2XH9A 4I4LA 1XNRM 3AKZA 4NSOB 5IT9S 3R8FA 4OVZA 3WX7A 1YU4A 3ZC7B 1E9SA 1E9RA 3L2AA 3VKGA 2KRKA 2Z7JA 1I4WA 2FFJA 2R4JA 2XD1A 1MX0A 1XXHA 3J80S 3WHLA 2C96A 4D80A 3HSHA 2F4VM 1G8PA 2DWLA 2FNAA 2CHVA 3EIHA 4I8OA 4MGZE 3GLGB 5DYGA 2VIIA 3U6DA 7CATA 3D8BA 2JA2A 3GP1A 5ITXA 2HHHM 2ZBKB 2DVWB 1NVMA 3T1HM 2F5SA 1HQYE 3VFDA 1R6BX 3U61B 1J7KA 4GH9A 4II7A 1Z6TA 5EJCA 3B9PA 2XF3A 4AKHA 4LF7M 3FYDA 3J7BA 3MK6A 5GKNA 2EA0A 2NQ8C 1HT1E 4KHPM 4LZJA 4IBFA 3DZDA 3RE8A 1DGHA 4AKIA 3GLFA 4MGYE 1YU1A 4JI4M 4IBKA 3A42A 2QBYA 2AHMA 3BOSA 5EQTA 2H1RA 3KOYE 2HL7A 1J09A 2CEAA 1PJJA 3LQQA 2FE8A 4MGIE 4L8RC 4LFAM 1IXRC 5ITRA 4JI3M 1IQPA 3LVVA 2LNHC 4S12A 2Y2LA 1SXJA 4NSRA 2CV2A 3M0EA 4X66M 5DNYA 4DV0M 4HLQA 3I51A 2ZAOA 4G4OA 1QQWA 5C18A 2LXEA 4B3TM 1OFHA 3GQ5A 1XHBA 3K2LA 3ZCBB 3VDPA 4FWHA 3GLGA 2LWXA 3W0LB 3IG5A 3UMMA 5FSWA 2F5NA 4AQYM 3L27A 5EP1A 1IBMM 4G4QA 3SBJA 3ILKA 5EXXA 4Z6YA 3U61A 2J7NA 5IZ7D 4FCTA 3KFUG 2JE5A 2V6ZM 3KP0E 4GC9A 4NL4H 4JN6A 3VK7A 4RF1A 4B7GA 2UUCM 1R7RA 4LJ4A 1T3TA 4OX9M 1FNNA 4LCBA 4PDGA 1NNUC 2UUBM 2QPAA 3FUTA 4NXMM 3W0FA 2E5LM 3J27B 4IIWA 3FYCA 4YHHM 3J7AS 4AZFA 1OJLA 4DR2M 3U6CA 1GLNA 2J7OA 3GPUA 1TH3A 2Q2EB 3VDUA 3N3FA 4X65M 4LFBM 3PVSA 4D81A 5KQ8A 3IG8A 3SMPA 3FTCA 2C9CA 1IN8A 3PNYA 5FTMA 2VQFM 4B08A 2I7NA 2HCBA 2R45A 3KOWE 5LMNM 1N77A 4DV7M 3AL0C 4KODA 1Z5CA 4MH0E 4OU7A 4DR4M 3TQSA 2L7HA 2XFSA 2Y2OA 3FTEA 1YU3A 4MB7A 2DWZB 4R7GA 3TWMA 1DO2A 1NJGA 2UXDM 1S3SA 1K3XA 4EIWA 2DZOB 2YFQA 4LF8M 2V1UA 2C98A 2CUZA 4LZZA 3AFHA 2CHQA 4KLNA 4CGYB 3GPXA 4LRSA 2W82A 4IJFA 4B7FA 5E6JA 1X37A 4LGMA 2R65A 1IN4A 2RGOA 4FD2A 3HGIA 3K8ZA 4FW9A 3KS4A 1N32M 5E26A 2YQZA 4JI7M 2Y2JA 2D7EA 4OJOA 1QYRA 4NRVA 2UXCM 3UZUA 2Z3XA 4LJ6A 4DUYM 1YUEA 4M9SA 2F5OA 3MJ5A 1E32A 1JQJC 1TH2A 1DGFA 1YSYA 4PDIA 2Y0TA 2P5TA 3GRVA 4M0WA 1PM5A 3HONA 4JI0M 2R62A 1UM8A 3SAVA 2CV1A 1XMOM 1N36M 4IBJA 4G6ZA 3JR4A 1HQCA 3GRRA 1G41A 3A46A 1GKIA 1Q39A 4IJEA 3M6AA 5ITTA 1KYIA 2Y20A 4L78A 1QANA 4XGIA 3THGA 3T15A 1NY5A 2OPFA 2BG1A 4NZ5A 2XD5A 5FLXS 3HJ8A 2XGNA 4LRTA 3HHYA 4B3MM 3E9SA 4NZ1A 4JV5M 1LV7A 2EO2A 3CTWB 3EIEA 3L26A 3K92A 4DV1M 3AOGA 2X8AA 2DXIA 3GQ4A 4HL4A 4AKGA 5A2QS 2KRUA 1DGBA 3RGPA 1D2NA 1VDDA 2C5RA 3OTOM 1IM2A 2Y2GA 2KEBA 1YUBA 2BNKA 3J81S 2BJWA 4MGHA 2VQEM 4JI8M 4LJAA 1G3IA 4QNRA 2Y2KA 1K82A 3FTDA 4BB9A 2L7IA 2FOIC 3GQ3A 3KSXA 4JI5M 3LMMA 2C99A 2QZ4A 5EP4A 2A5YB 3SATA 4DR3M 2DZNB 4IBDA 2EUCA 4FCWA 4AW4A 1N34M 3U6SA 3HU1A 5EXSA 2G5GX 1Z5AA 3A98B 5IREB 5H37D 3SHFA 4PD2A 4JI2M 1NNJA 4KO8A 4FVMA 1IBLM 2CE7A 2UUAM 4LF6M 2UXBM 1R2ZA 4QHSA 5FTNA 1IY2A 2YNMD 5C1BA 2CV0A 3L28A 3A45A 1HNWM 2L6OA 4LJ7A 3GLHB 3GRYA 3J2PB 8CATA 2ZM6M 3KS8A 3SARA 2G8LA 4NRWA 4I5SA 1L1ZA 1DO0A 1IY0A 2LH0A 1KFVA 1IY1A 3VKHA 2CFOA 2R46A 4NOOB 2Z4RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IBD A;  3L29 A;  4IBG A;  4GH9 A;  4IBJ A;  4IJF A;  5BPV A;  4IJE A;  3KS4 A;  3L2A A;  4IBF A;  4IBC A;  4IBB A;  4IBI A;  3L28 A;  4GHL A;  4IBK A;  3KS8 A;  3L26 A;  4LG2 A;  3L25 A;  4GHA A;  3FKE A;  3L27 A;  4IBE A; 
#chains in the Genus database with same CATH topology
 3KDS E;  3PXG A;  1E6P A;  3TWK A;  3D8L A;  2ZAM A;  2BJV A;  4MB3 A;  2CHG A;  2Y2M A;  3ZH9 B;  2L4F A;  3NBI A;  1MJG M;  4JYA M;  4NXN M;  2Y2I A;  4OJL A;  2XZU A;  3PNV A;  1DGG A;  2C9O A;  3SFZ A;  1E88 A;  3IEC A;  3SMS A;  3E4R A;  3TWL A;  4TX8 A;  3BBZ A;  4IBB A;  3U60 B;  4P16 A;  4NYU A;  5ITY A;  1IN7 A;  2O5R A;  2LHG A;  2UU9 M;  2RTS A;  4PT5 A;  2XEP A;  3KOZ E;  1L2B A;  3QWL A;  4DR6 M;  1A5T A;  1JR3 A;  5FTK A;  2OO9 A;  4GIP A;  2DHR A;  2LTU A;  4L16 A;  1V34 A;  2R6F A;  4OW0 A;  1WGL A;  5ITQ A;  2N35 A;  4YY3 M;  2FFF B;  3PFI A;  4GKJ M;  1WXQ A;  3B89 A;  1E6Z A;  3BXW A;  2JNH A;  2ZAN A;  3LVW A;  4FWD A;  3SYK A;  4GIT A;  1FJG M;  1WHC A;  3WD2 A;  1L6J A;  4MM3 B;  2O25 A;  4L15 A;  2QEN A;  4RNA A;  1TF0 B;  1XWI A;  3HHX A;  3HWS A;  3I4Y A;  3C58 A;  5BPV A;  2Y2H A;  2XFT A;  2Y2Q A;  3LQR A;  2KXE A;  3TL4 X;  3HHZ A;  1L8Q A;  3FE3 A;  4ITQ A;  2JCH A;  3FUU A;  4B7H A;  1W5T A;  1Z59 A;  5BR8 M;  3RGS A;  2K0B X;  1G59 A;  4NZ3 A;  3HY5 A;  4OJ6 A;  3GLH A;  2LVQ D;  4Q7J A;  4CHT B;  1ORY B;  3B7Z A;  1JR3 D;  3L25 A;  4Z2J A;  4GHA A;  3FKE A;  2ZTC A;  5KPZ A;  4X64 M;  1LTM A;  3U6M A;  3DA1 A;  2F5Q A;  3Q8X A;  1N75 A;  4MB5 A;  4GKK M;  4IBE A;  3U6E A;  2RRU A;  4NC6 A;  4BLC A;  3KXE C;  4DUZ M;  1CUK A;  4GMQ A;  4F2L A;  2WSC F;  3KW6 A;  4RF0 A;  3SC3 A;  1Q3B A;  1HJP A;  2HWJ A;  2KZU A;  1YU0 A;  4GRI A;  2QQ8 A;  1H6U A;  4DV3 M;  2JY5 A;  2JY7 A;  4QNM A;  1CXW A;  2XSZ D;  3K1J A;  4I81 A;  3HU3 A;  4FWG A;  4MGK E;  4DBG B;  1JR3 E;  1ED7 A;  2XLJ A;  2DWN A;  3TE6 A;  3JAM S;  3U60 A;  1N78 A;  4D82 A;  4BBA A;  5ITU A;  1TDZ A;  3KVW A;  3VK8 A;  1C7Y A;  2QHO B;  5EXT A;  4DV2 M;  1VEG A;  2KA6 B;  3KOX E;  5EP3 A;  2DNA A;  2OQ4 A;  3WD0 A;  5KPR A;  3U5Z A;  3GO8 A;  2QCU A;  2KW0 A;  2DAI A;  5KPT A;  1WR1 B;  1IN5 A;  2KHH A;  3CF2 A;  2V1C A;  1NHG C;  4JI6 M;  3Q8G A;  1P3Q Q;  1OGG A;  1YU2 A;  3SHG B;  4X62 M;  3U6O A;  3DOA A;  3H4J A;  4LF4 M;  1EE8 A;  4LJ5 A;  1N33 M;  3GLI B;  3AJI B;  3SAW A;  2DWM A;  1QAO A;  3LCU A;  4G4R A;  3FUX A;  1WJ7 A;  1W5S A;  1XNQ M;  3H4M A;  1OAO C;  4R71 A;  1TH4 A;  3SAS A;  3GLH E;  4Z8X A;  1K3W A;  1HT2 E;  4REZ A;  4XBO A;  2ERC A;  1E6N A;  2UWX A;  2WSF F;  1G4A E;  1MU5 A;  4LF5 M;  1UFZ A;  3UGJ A;  3FTF A;  1QDT A;  3HZJ A;  1Y8G A;  2GNO A;  4G4N A;  5F3W A;  3R9X B;  4GHL A;  3QAU A;  2D7H A;  3U6Q A;  2FH0 A;  1T6O A;  2JZ0 A;  1NHW C;  2LHC A;  4QOS A;  4LJ9 A;  4LG2 A;  3UK6 A;  1HNZ M;  1NJF A;  1CK7 A;  1E6R A;  3U5Z B;  3GPP A;  2Y0Q A;  1OIZ A;  4NYY A;  3CF6 E;  2Y2P A;  1Q02 A;  4LFC M;  4K0K M;  4AG6 A;  1NSF A;  3L29 A;  2D7G A;  4LF9 M;  4IBG A;  2YR0 A;  2EJS A;  3CF0 A;  4LJ8 A;  4QOZ C;  3HKP A;  4AI6 A;  1GO5 A;  1QAQ A;  4PCZ A;  1HNX M;  2XZF A;  2EKK A;  1IN6 A;  1GL7 A;  1QAM A;  1XXH E;  2JZ1 A;  1W1Y A;  1AIP C;  3U6P A;  2KNA A;  1ZAE A;  4DV6 M;  3T1Y M;  3JR5 A;  4JI1 M;  4B3S M;  3TPZ A;  1F4I A;  3QYB A;  2Y21 A;  1L1T A;  4QNL A;  3DFZ A;  2Y2N A;  1KSF X;  1YLA A;  5ITX E;  2K47 A;  4QHT A;  4RKU F;  3AOE A;  2DKL A;  4M9X A;  4WP2 A;  1IXS B;  4ZPX A;  4MB4 A;  1QVR A;  2D49 A;  3ZQJ A;  1I94 M;  1L2D A;  1HR0 M;  2F5P A;  1QZM A;  5IWA M;  1GVN A;  5DYI A;  1SXJ D;  3FD9 A;  3GLI A;  1R2Y A;  2JUJ A;  2R4E A;  3C3E A;  3GRU A;  3KSJ A;  2HAK A;  2L2D A;  3HJS A;  3GLF E;  4FCV A;  1OFI A;  4OJP A;  1TDH A;  4NZ4 A;  4OVZ B;  4R3D A;  4DR7 M;  2I7P A;  1NO1 A;  2DAM A;  2CWB A;  4LGY A;  3FUW A;  3WHK A;  4IBC A;  4L4U A;  1PJI A;  3B7Q A;  1XXH B;  3WD3 A;  2MR9 A;  3HJQ A;  5EP2 A;  2RKO A;  1XMQ M;  1IXZ A;  3M7P A;  1G71 A;  1SXJ E;  2X49 A;  5KO3 A;  3MHV C;  1R4G A;  1QUS A;  4DV5 M;  2VQF M;  1GL6 A;  3T38 A;  3HHW A;  4HEO A;  2L09 A;  4DR1 M;  1ZQ9 A;  1C1K A;  5FTL A;  5JI3 E;  2KNZ A;  2Z4S A;  3VLF B;  1H0G A;  2R18 A;  3NWL A;  3I4V A;  4M0D A;  4AG5 A;  4TUW A;  5DFL A;  1NY6 A;  2M60 A;  1L2C A;  4WW0 A;  3M7G A;  2HKJ A;  4W5W A;  2KZS A;  4CIS A;  3SAU A;  2XSZ A;  2IOU A;  1SXJ C;  1TGU A;  2M5Z A;  1AIW A;  4LY6 A;  1IBK M;  1DGH B;  4IBI A;  1Q3C A;  3GLF B;  2JY6 B;  4M9Z A;  3FUV A;  2QBY B;  4WUR A;  3AV0 A;  2WSE F;  3GPY A;  2LVO C;  3HU2 A;  5LMU M;  3KP1 E;  1XC8 A;  1IXS A;  2RGH A;  5JI2 E;  3GLI E;  4Z2I A;  3E46 A;  4OUI A;  5EXP A;  4B3R M;  2R0I A;  1E94 E;  4GC5 A;  3UJN A;  2FN2 A;  3MMP A;  2X4A A;  4DR5 M;  4JXJ A;  5FTJ A;  1YE9 A;  3SYL A;  1Z5B A;  3AOE C;  3RFW A;  5KQD A;  4DV4 M;  1SXJ B;  4OJ5 A;  4NY2 A;  4A3V B;  3U6L A;  2QP9 X;  1V33 A;  2XH9 A;  4I4L A;  1XNR M;  3AKZ A;  4NSO B;  5IT9 S;  1GJS A;  1MN3 A;  3R8F A;  4OVZ A;  3WX7 A;  1YU4 A;  1H0I A;  3K9O A;  3ZC7 B;  1E9S A;  1E9R A;  3CGW A;  3L2A A;  2KRK A;  3VKG A;  2Z7J A;  1I4W A;  2FFJ A;  2R4J A;  1E15 A;  1MX0 A;  1XXH A;  3J80 S;  3WHL A;  2C96 A;  4D80 A;  2XD1 A;  3HSH A;  2F4V M;  1G8P A;  2DWL A;  2FNA A;  2CHV A;  3EIH A;  4I8O A;  1D0L A;  4MGZ E;  4Y28 F;  2VII A;  3B7N A;  5DYG A;  3GLG B;  3U6D A;  7CAT A;  1J5E M;  3D8B A;  2JA2 A;  2DAG A;  1PDC A;  3GP1 A;  1QO6 A;  1OQY A;  5ITX A;  2HHH M;  2ZBK B;  2DVW B;  1NVM A;  3T1H M;  2F5S A;  1HQY E;  3VFD A;  1R6B X;  3U61 B;  1J7K A;  2DAK A;  4GH9 A;  1Z6T A;  4II7 A;  5EJC A;  3B9P A;  2XF3 A;  4AKH A;  1OGB A;  4LF7 M;  2JWS A;  3FYD A;  4CIZ A;  3J7B A;  3MK6 A;  5GKN A;  1QUT A;  2NQ8 C;  1HT1 E;  2EA0 A;  4LZJ A;  4KHP M;  4IBF A;  3DZD A;  3RE8 A;  1DGH A;  4AKI A;  3GLF A;  4MGY E;  2BWB A;  1YU1 A;  4JI4 M;  4L6V 6;  4IBK A;  3A42 A;  3FRH A;  2QBY A;  2AHM A;  3BOS A;  5EQT A;  2H1R A;  3KOY E;  2JY8 A;  4GEW A;  2HL7 A;  1J09 A;  2QNJ A;  2CEA A;  2MGW A;  3W67 A;  1PJJ A;  3LQQ A;  2FE8 A;  4MGI E;  4L8R C;  4LFA M;  1IXR C;  5ITR A;  4JI3 M;  1IQP A;  3LVV A;  2LNH C;  4S12 A;  2Y2L A;  1SXJ A;  4KT0 F;  4NSR A;  3HX3 A;  2CV2 A;  3M0E A;  4X66 M;  5DNY A;  5L8R F;  4DV0 M;  4HLQ A;  1QZE A;  4XK8 F;  3I51 A;  2ZAO A;  1EIJ A;  4CJ6 A;  2DAE A;  4G4O A;  1QQW A;  4F1I A;  5C18 A;  2LXE A;  4B3T M;  1OFH A;  4G3O A;  3GQ5 A;  1XHB A;  3K2L A;  1PGY A;  1AUA A;  3VDP A;  3ZCB B;  4FWH A;  3GLG A;  2LWX A;  3W0L B;  3IG5 A;  3UMM A;  1IFY A;  5FSW A;  2F5N A;  3WD1 A;  4AQY M;  3L27 A;  5EP1 A;  1IBM M;  4G4Q A;  3SBJ A;  2MRO B;  2FS1 A;  2LBC A;  3ILK A;  5EXX A;  4HMC A;  4Z6Y A;  3U61 A;  2BWE A;  2J7N A;  5IZ7 D;  4FCT A;  3KFU G;  2JE5 A;  2V6Z M;  3KP0 E;  2R44 A;  4GC9 A;  2CP8 A;  4NL4 H;  4JN6 A;  3VK7 A;  4RF1 A;  4B7G A;  2UUC M;  1R7R A;  4LJ4 A;  1T3T A;  4OX9 M;  1FNN A;  3LW5 F;  2G3Q A;  4LCB A;  4PDG A;  1NNU C;  2UUB M;  2QPA A;  3FUT A;  4NXM M;  3W0F A;  2E5L M;  3QYE A;  3J27 B;  4IIW A;  2WZJ A;  3FYC A;  4YHH M;  3J7A S;  4Z2K A;  4Z2H A;  4AZF A;  1R5L A;  1OJL A;  2J5Y A;  2QSF X;  4DR2 M;  3U6C A;  1GLN A;  2J7O A;  2L4E A;  1TH3 A;  2Q2E B;  4ANR A;  3VDU A;  3GPU A;  3N3F A;  4X65 M;  4LFB M;  3PVS A;  4D81 A;  5KQ8 A;  3IG8 A;  3SMP A;  3FTC A;  2C9C A;  2VF8 A;  1IN8 A;  2O01 F;  3PNY A;  5FTM A;  4B08 A;  1PJQ A;  2I7N A;  2HCB A;  1TTE A;  1VQ1 A;  2R45 A;  3KOW E;  4P17 A;  5LMN M;  1N77 A;  4DV7 M;  1H8P A;  3AL0 C;  4KOD A;  3GLG E;  1Z5C A;  4MH0 E;  1PJT A;  1ZMW A;  4OU7 A;  4DR4 M;  3TQS A;  2B3T A;  2L7H A;  2XFS A;  2Y2O A;  3FTE A;  1YU3 A;  4MB7 A;  1ZMV A;  2DWZ B;  1GAB A;  4R7G A;  3TWM A;  1DO2 A;  1NJG A;  2K6B A;  1S3S A;  2MH8 A;  2UXD M;  1K3X A;  4EIW A;  2DZO B;  2YFQ A;  4LF8 M;  4HMD A;  2ZTD A;  1PRB A;  2C98 A;  2CUZ A;  2V1U A;  4LZZ A;  2DI0 A;  3C3D A;  3AFH A;  1UR8 A;  2CHQ A;  4KLN A;  4CGY B;  3GPX A;  4LRS A;  2DZL A;  1EFU B;  2W82 A;  4IJF A;  3V76 A;  4B7F A;  1DV0 A;  5E6J A;  1X37 A;  4LGM A;  2R65 A;  1IN4 A;  2RGO A;  4FD2 A;  3HGI A;  3IHP A;  4Z2G A;  3B74 A;  3K8Z A;  4FW9 A;  3KS4 A;  3LCV B;  1N32 M;  1OIP A;  2YQZ A;  5E26 A;  4JI7 M;  2D7E A;  2KNV A;  2Y2J A;  1VDL A;  4OJO A;  1QYR A;  4NRV A;  2UXC M;  4UN2 B;  3UZU A;  2Z3X A;  1V92 A;  4LJ6 A;  2KDL A;  4DUY M;  1VEK A;  4M9S A;  1YUE A;  2F5O A;  3MJ5 A;  2VF7 A;  1E32 A;  1JQJ C;  1TH2 A;  1DGF A;  1YSY A;  4PDI A;  1JB0 F;  2Y0T A;  2P5T A;  1UR9 A;  3GRV A;  2VDB B;  1PJS A;  2CRU A;  4M0W A;  1PM5 A;  3HON A;  4JI0 M;  2R62 A;  1W1V A;  1UM8 A;  1WIV A;  3SAV A;  2CV1 A;  1XMO M;  1N36 M;  4IBJ A;  4G6Z A;  3JR4 A;  1HQC A;  2Z8Y M;  1GPF A;  3GRR A;  3I01 M;  1G41 A;  3E21 A;  3A46 A;  1GKI A;  1Q39 A;  2JXN A;  3K9P A;  3M6A A;  4IJE A;  5ITT A;  1KYI A;  2Y20 A;  4L78 A;  1QAN A;  4XGI A;  1OAI A;  3T15 A;  1NY5 A;  3THG A;  2OPF A;  2BG1 A;  2XD5 A;  4NZ5 A;  5FLX S;  3HJ8 A;  2XGN A;  4LRT A;  3HHY A;  4B3M M;  3E9S A;  4NZ1 A;  4HME A;  4JV5 M;  1LV7 A;  2EO2 A;  3CTW B;  3EIE A;  3L26 A;  3K92 A;  1O6I A;  4DV1 M;  3AOG A;  2X8A A;  2DXI A;  2K9D A;  3T6P A;  2DHY A;  3GQ4 A;  4HL4 A;  4AKG A;  5A2Q S;  2KRU A;  3C9P A;  2OOA A;  3WD4 A;  1DGB A;  1NV9 A;  3RGP A;  1W1T A;  2V5O A;  1D2N A;  1VDD A;  3I04 M;  2C5R A;  2GQF A;  1IM2 A;  3OTO M;  2Y2G A;  2KEB A;  1YUB A;  2BNK A;  3J81 S;  2BJW A;  1RU3 A;  4MGH A;  2VQE M;  4JI8 M;  4LJA A;  1G3I A;  4QNR A;  1VG5 A;  1TR8 A;  2JP7 A;  2Y2K A;  1K82 A;  2LVA A;  1D0K A;  1VEJ A;  3FTD A;  4BB9 A;  2L7I A;  2FOI C;  3GQ3 A;  3KSX A;  4JI5 M;  2APL A;  3LMM A;  1XB2 B;  2C99 A;  1SG9 A;  2QZ4 A;  5EP4 A;  1W1P A;  1E8B A;  2DEN A;  2MJ5 B;  2A5Y B;  3NBX X;  3SAT A;  1ZV1 A;  1GXD A;  1OKS A;  4DR3 M;  2DZN B;  4IBD A;  1J7M A;  2OOB A;  2EUC A;  4FCW A;  1NV8 A;  1OTR A;  4AW4 A;  1N34 M;  3U6S A;  3HU1 A;  1BVS A;  5EXS A;  2G5G X;  1Z5A A;  1D0M A;  4Z2L A;  3A98 B;  1ZMU A;  5IRE B;  5H37 D;  1EAK A;  3SHF A;  3W68 A;  4PD2 A;  1WGN A;  4JI2 M;  1NNJ A;  4KO8 A;  4FVM A;  3F92 A;  1IBL M;  2H5X A;  2CE7 A;  2UUA M;  4LF6 M;  1GJT A;  3FRI A;  2UXB M;  1R2Z A;  2LVN C;  4QHS A;  5FTN A;  1IY2 A;  2YNM D;  5C1B A;  2CV0 A;  1GOI A;  3L28 A;  3A45 A;  1T43 A;  1HNW M;  2L6O A;  4LJ7 A;  3GLH B;  2LVP C;  3MQL A;  1KS0 A;  3GRY A;  3J2P B;  8CAT A;  2EKF A;  2ZM6 M;  3KS8 A;  3SAR A;  2G8L A;  4NRW A;  4I5S A;  1L1Z A;  1DO0 A;  1IY0 A;  2LH0 A;  1KFV A;  1IY1 A;  3VKH A;  1QDR A;  2CFO A;  2R46 A;  4NOO B;  2Z4R A; 
#chains in the Genus database with same CATH homology
 3KDS E;  3PXG A;  3TWK A;  3D8L A;  2ZAM A;  2BJV A;  2CHG A;  2Y2M A;  3ZH9 B;  3NBI A;  4JYA M;  4NXN M;  2Y2I A;  4OJL A;  2XZU A;  3PNV A;  1DGG A;  2C9O A;  3SFZ A;  3SMS A;  3E4R A;  3TWL A;  3U60 B;  4IBB A;  4P16 A;  4NYU A;  5ITY A;  1IN7 A;  2O5R A;  2UU9 M;  4PT5 A;  2XEP A;  3KOZ E;  1L2B A;  3QWL A;  4DR6 M;  1JR3 A;  5FTK A;  1J5E M;  4GIP A;  2DHR A;  4L16 A;  4OW0 A;  3U5Z B;  5ITQ A;  4YY3 M;  2FFF B;  3PFI A;  4GKJ M;  1WXQ A;  2ZAN A;  3LVW A;  4FWD A;  3SYK A;  4GIT A;  1FJG M;  4MM3 B;  4RNA A;  4L15 A;  2QEN A;  1XWI A;  3HHX A;  3HWS A;  3I4Y A;  3C58 A;  5BPV A;  2Y2H A;  2XFT A;  2Y2Q A;  3LQR A;  2KXE A;  3TL4 X;  3HHZ A;  1L8Q A;  4ITQ A;  2JCH A;  3FUU A;  4B7H A;  1W5T A;  1Z59 A;  5BR8 M;  3RGS A;  1G59 A;  4NZ3 A;  4OJ6 A;  3GLH A;  4CHT B;  1ORY B;  1JR3 D;  3L25 A;  4GHA A;  3FKE A;  5KPZ A;  4X64 M;  3U6M A;  3DA1 A;  2F5Q A;  3Q8X A;  1N75 A;  4GKK M;  4IBE A;  3U6E A;  4BLC A;  4DUZ M;  3KXE C;  4GMQ A;  3KW6 A;  4RF0 A;  3SC3 A;  1Q3B A;  2KZU A;  1YU0 A;  4GRI A;  1H6U A;  4DV3 M;  4QNM A;  2XSZ D;  3K1J A;  4I81 A;  3HU3 A;  4FWG A;  4MGK E;  2XLJ A;  2DWN A;  3TE6 A;  3JAM S;  3U60 A;  1N78 A;  4D82 A;  4BBA A;  5ITU A;  1TDZ A;  3KVW A;  3VK8 A;  5EXT A;  4DV2 M;  2KA6 B;  3KOX E;  5EP3 A;  2OQ4 A;  5KPR A;  3U5Z A;  3GO8 A;  2QCU A;  2KW0 A;  5KPT A;  1IN5 A;  3CF2 A;  2V1C A;  1NHG C;  4JI6 M;  3SHG B;  4X62 M;  3U6O A;  3DOA A;  4LF4 M;  1EE8 A;  4LJ5 A;  1N33 M;  3GLI B;  3AJI B;  3SAW A;  2DWM A;  1QAO A;  4G4R A;  3FUX A;  1W5S A;  1XNQ M;  3H4M A;  1TH4 A;  3SAS A;  4Z8X A;  1K3W A;  1HT2 E;  4REZ A;  4XBO A;  2ERC A;  2UWX A;  4LF5 M;  1G4A E;  1MU5 A;  3UGJ A;  3FTF A;  4G4N A;  5F3W A;  3R9X B;  4GHL A;  3QAU A;  2D7H A;  3U6Q A;  1NHW C;  4LG2 A;  4QOS A;  4LJ9 A;  1YU2 A;  3UK6 A;  1HNZ M;  1NJF A;  3GPP A;  2Y0Q A;  4NYY A;  3CF6 E;  2Y2P A;  4LFC M;  4K0K M;  4AG6 A;  1NSF A;  3L29 A;  2D7G A;  4LF9 M;  4IBG A;  2YR0 A;  4LJ8 A;  3CF0 A;  4QOZ C;  4AI6 A;  3HKP A;  1QAQ A;  4PCZ A;  1HNX M;  2XZF A;  1IN6 A;  1GL7 A;  1QAM A;  3U6P A;  1ZAE A;  4DV6 M;  3T1Y M;  3JR5 A;  4JI1 M;  4B3S M;  3TPZ A;  2Y21 A;  1L1T A;  4QNL A;  3DFZ A;  2Y2N A;  1KSF X;  5ITX E;  2K47 A;  4QHT A;  3AOE A;  4M9X A;  1IXS B;  4ZPX A;  1QVR A;  1I94 M;  1L2D A;  1HR0 M;  2F5P A;  1QZM A;  5IWA M;  1GVN A;  5DYI A;  1SXJ D;  3FD9 A;  3GLI A;  1R2Y A;  2R4E A;  3GRU A;  3KSJ A;  3HJS A;  4FCV A;  1OFI A;  4OJP A;  1TDH A;  4NZ4 A;  4OVZ B;  4R3D A;  4DR7 M;  2I7P A;  4LGY A;  3FUW A;  3WHK A;  4IBC A;  4L4U A;  1PJI A;  1XXH B;  3HJQ A;  5EP2 A;  2RKO A;  1XMQ M;  1IXZ A;  1SXJ E;  2X49 A;  5KO3 A;  3MHV C;  4DV5 M;  1GL6 A;  3T38 A;  3HHW A;  2L09 A;  4DR1 M;  1ZQ9 A;  1C1K A;  5FTL A;  5JI3 E;  2Z4S A;  3VLF B;  2R18 A;  3NWL A;  3I4V A;  4M0D A;  4AG5 A;  4TUW A;  1NY6 A;  2M60 A;  1L2C A;  4WW0 A;  3M7G A;  2HKJ A;  4W5W A;  2KZS A;  4CIS A;  3SAU A;  2XSZ A;  2IOU A;  1SXJ C;  1TGU A;  2M5Z A;  4LY6 A;  1IBK M;  1DGH B;  4IBI A;  1Q3C A;  3GLF B;  4M9Z A;  3FUV A;  2QBY B;  4WUR A;  3AV0 A;  3GPY A;  3HU2 A;  5LMU M;  3KP1 E;  1XC8 A;  2RGH A;  5JI2 E;  4OUI A;  5EXP A;  4B3R M;  1E94 E;  4GC5 A;  3UJN A;  2X4A A;  4DR5 M;  4JXJ A;  5FTJ A;  1YE9 A;  3SYL A;  1Z5B A;  3AOE C;  3RFW A;  5KQD A;  4DV4 M;  1SXJ B;  4OJ5 A;  4NY2 A;  4A3V B;  3U6L A;  2QP9 X;  2XH9 A;  4I4L A;  1XNR M;  3AKZ A;  4NSO B;  5IT9 S;  3R8F A;  4OVZ A;  3WX7 A;  1YU4 A;  3ZC7 B;  1E9S A;  1E9R A;  3L2A A;  3VKG A;  2KRK A;  2Z7J A;  1I4W A;  2FFJ A;  2R4J A;  2XD1 A;  1MX0 A;  1XXH A;  3J80 S;  3WHL A;  2C96 A;  4D80 A;  3HSH A;  2F4V M;  1G8P A;  2DWL A;  2FNA A;  2CHV A;  3EIH A;  4I8O A;  4MGZ E;  3GLG B;  5DYG A;  2VII A;  3U6D A;  7CAT A;  3D8B A;  2JA2 A;  3GP1 A;  5ITX A;  2HHH M;  2ZBK B;  2DVW B;  1NVM A;  3T1H M;  2F5S A;  1HQY E;  3VFD A;  1R6B X;  3U61 B;  1J7K A;  4GH9 A;  4II7 A;  1Z6T A;  5EJC A;  3B9P A;  2XF3 A;  4AKH A;  4LF7 M;  3FYD A;  3J7B A;  3MK6 A;  5GKN A;  2EA0 A;  2NQ8 C;  1HT1 E;  4KHP M;  4LZJ A;  4IBF A;  3DZD A;  3RE8 A;  1DGH A;  4AKI A;  3GLF A;  4MGY E;  1YU1 A;  4JI4 M;  4IBK A;  3A42 A;  2QBY A;  2AHM A;  3BOS A;  5EQT A;  2H1R A;  3KOY E;  2HL7 A;  1J09 A;  2CEA A;  1PJJ A;  3LQQ A;  2FE8 A;  4MGI E;  4L8R C;  4LFA M;  1IXR C;  5ITR A;  4JI3 M;  1IQP A;  3LVV A;  2LNH C;  4S12 A;  2Y2L A;  1SXJ A;  4NSR A;  2CV2 A;  3M0E A;  4X66 M;  5DNY A;  4DV0 M;  4HLQ A;  3I51 A;  2ZAO A;  4G4O A;  1QQW A;  5C18 A;  2LXE A;  4B3T M;  1OFH A;  3GQ5 A;  1XHB A;  3K2L A;  3ZCB B;  3VDP A;  4FWH A;  3GLG A;  2LWX A;  3W0L B;  3IG5 A;  3UMM A;  5FSW A;  2F5N A;  4AQY M;  3L27 A;  5EP1 A;  1IBM M;  4G4Q A;  3SBJ A;  3ILK A;  5EXX A;  4Z6Y A;  3U61 A;  2J7N A;  5IZ7 D;  4FCT A;  3KFU G;  2JE5 A;  2V6Z M;  3KP0 E;  4GC9 A;  4NL4 H;  4JN6 A;  3VK7 A;  4RF1 A;  4B7G A;  2UUC M;  1R7R A;  4LJ4 A;  1T3T A;  4OX9 M;  1FNN A;  4LCB A;  4PDG A;  1NNU C;  2UUB M;  2QPA A;  3FUT A;  4NXM M;  3W0F A;  2E5L M;  3J27 B;  4IIW A;  3FYC A;  4YHH M;  3J7A S;  4AZF A;  1OJL A;  4DR2 M;  3U6C A;  1GLN A;  2J7O A;  3GPU A;  1TH3 A;  2Q2E B;  3VDU A;  3N3F A;  4X65 M;  4LFB M;  3PVS A;  4D81 A;  5KQ8 A;  3IG8 A;  3SMP A;  3FTC A;  2C9C A;  1IN8 A;  3PNY A;  5FTM A;  2VQF M;  4B08 A;  2I7N A;  2HCB A;  2R45 A;  3KOW E;  5LMN M;  1N77 A;  4DV7 M;  3AL0 C;  4KOD A;  1Z5C A;  4MH0 E;  4OU7 A;  4DR4 M;  3TQS A;  2L7H A;  2XFS A;  2Y2O A;  3FTE A;  1YU3 A;  4MB7 A;  2DWZ B;  4R7G A;  3TWM A;  1DO2 A;  1NJG A;  2UXD M;  1S3S A;  1K3X A;  4EIW A;  2DZO B;  2YFQ A;  4LF8 M;  2V1U A;  2C98 A;  2CUZ A;  4LZZ A;  3AFH A;  2CHQ A;  4KLN A;  4CGY B;  3GPX A;  4LRS A;  2W82 A;  4IJF A;  4B7F A;  5E6J A;  1X37 A;  4LGM A;  2R65 A;  1IN4 A;  2RGO A;  4FD2 A;  3HGI A;  3K8Z A;  4FW9 A;  3KS4 A;  1N32 M;  5E26 A;  2YQZ A;  4JI7 M;  2Y2J A;  2D7E A;  4OJO A;  1QYR A;  4NRV A;  2UXC M;  3UZU A;  2Z3X A;  4LJ6 A;  4DUY M;  1YUE A;  4M9S A;  2F5O A;  3MJ5 A;  1E32 A;  1JQJ C;  1TH2 A;  1DGF A;  1YSY A;  4PDI A;  2Y0T A;  2P5T A;  3GRV A;  4M0W A;  1PM5 A;  3HON A;  4JI0 M;  2R62 A;  1UM8 A;  3SAV A;  2CV1 A;  1XMO M;  1N36 M;  4IBJ A;  4G6Z A;  3JR4 A;  1HQC A;  3GRR A;  1G41 A;  3A46 A;  1GKI A;  1Q39 A;  4IJE A;  3M6A A;  5ITT A;  1KYI A;  2Y20 A;  4L78 A;  1QAN A;  4XGI A;  3THG A;  3T15 A;  1NY5 A;  2OPF A;  2BG1 A;  4NZ5 A;  2XD5 A;  5FLX S;  3HJ8 A;  2XGN A;  4LRT A;  3HHY A;  4B3M M;  3E9S A;  4NZ1 A;  4JV5 M;  1LV7 A;  2EO2 A;  3CTW B;  3EIE A;  3L26 A;  3K92 A;  4DV1 M;  3AOG A;  2X8A A;  2DXI A;  3GQ4 A;  4HL4 A;  4AKG A;  5A2Q S;  2KRU A;  1DGB A;  3RGP A;  1D2N A;  1VDD A;  2C5R A;  3OTO M;  1IM2 A;  2Y2G A;  2KEB A;  1YUB A;  2BNK A;  3J81 S;  2BJW A;  4MGH A;  2VQE M;  4JI8 M;  4LJA A;  1G3I A;  4QNR A;  2Y2K A;  1K82 A;  3FTD A;  4BB9 A;  2L7I A;  2FOI C;  3GQ3 A;  3KSX A;  4JI5 M;  3LMM A;  2C99 A;  2QZ4 A;  5EP4 A;  2A5Y B;  3SAT A;  4DR3 M;  2DZN B;  4IBD A;  2EUC A;  4FCW A;  4AW4 A;  1N34 M;  3U6S A;  3HU1 A;  5EXS A;  2G5G X;  1Z5A A;  3A98 B;  5IRE B;  5H37 D;  3SHF A;  4PD2 A;  4JI2 M;  1NNJ A;  4KO8 A;  4FVM A;  1IBL M;  2CE7 A;  2UUA M;  4LF6 M;  2UXB M;  1R2Z A;  4QHS A;  5FTN A;  1IY2 A;  2YNM D;  5C1B A;  2CV0 A;  3L28 A;  3A45 A;  1HNW M;  2L6O A;  4LJ7 A;  3GLH B;  3GRY A;  3J2P B;  8CAT A;  2ZM6 M;  3KS8 A;  3SAR A;  2G8L A;  4NRW A;  4I5S A;  1L1Z A;  1DO0 A;  1IY0 A;  2LH0 A;  1KFV A;  1IY1 A;  3VKH A;  2CFO A;  2R46 A;  4NOO B;  2Z4R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...