3L28A

Crystal structure of zaire ebola vp35 interferon inhibitory domain k339a mutant
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
123
structure length
123
Chain Sequence
DISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polymerase cofactor VP35
publication title Structural basis for dsRNA recognition and interferon antagonism by Ebola VP35.
pubmed doi rcsb
source organism Zaire ebolavirus
molecule tags Rna binding protein
total genus 37
structure length 123
sequence length 123
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3l28A01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 3l28A02
3KS4A 4GHLA 3KS8A 4IBGA 3L25A 4IBDA 4GHAA 4IBEA 5BPVA 4IBCA 4IJFA 4IBKA 3L2AA 4IBBA 4IBJA 3L27A 3L26A 3L29A 3L28A 4GH9A 4LG2A 4IJEA 3FKEA 4IBFA 4IBIA
chains in the Genus database with same CATH superfamily
1DO0A 2CFOA 2KW0A 4NZ4A 3GLFE 3HHWA 3HU3A 4JI6M 2QENA 1QO6A 1YUEA 2J7OA 3GRYA 3TWLA 5FLXS 1J7KA 3SATA 2KNVA 2Z4SA 4TUWA 1R7RA 2XGNA 1IN4A 3C9PA 3KP0E 3DA1A 4NL4H 1L6JA 5ITXE 2Y21A 1GL7A 3IG8A 4RKUF 1IBKM 1R6BX 4M9XA 2E5LM 3DFZA 2Z4RA 2FH0A 2Z8YM 4CJ6A 1QUSA 2LVNC 2C99A 3L27A 4M0WA 5EXXA 1E15A 4A3VB 1AIWA 2KDLA 4MGIE 2WSCF 1D2NA 3KOXE 3ZC7B 4OJ5A 4Z2JA 1V33A 1OFHA 2LXEA 2FOIC 4IBIA 1QAMA 2R0IA 4MB7A 4P17A 4CIZA 2ZAMA 2ERCA 2H1RA 4PD2A 1DV0A 1CXWA 2BG1A 4I4LA 4Z2LA 4GKKM 1V34A 1TTEA 4Z6YA 5ITUA 3MMPA 3FTCA 2HAKA 1Z6TA 2DENA 1OGBA 2CEAA 3TWKA 2APLA 4IBDA 1E94E 3I4VA 2I7NA 4YY3M 3VKHA 2MH8A 4NOOB 4IBEA 4AG6A 4KLNA 1TDZA 1TH3A 3QYEA 2LVAA 3FTEA 3FUWA 4DV1M 3HJSA 3K8ZA 2X4AA 2L09A 3KOZE 1I94M 2L4EA 4OVZA 2DZOB 1MU5A 1IFYA 4D80A 4QHTA 1L1TA 3GLFB 1N36M 4NYYA 4OJ6A 1IN7A 2C98A 3FRHA 3WHLA 5ITRA 3J27B 1N32M 3DZDA 3CF2A 3U6DA 1R5LA 3A45A 3BXWA 3U6SA 4WP2A 4ITQA 3AKZA 1OAIA 1TH2A 1DGHA 2OOAA 3FUTA 4NY2A 3U6CA 2OQ4A 3J7BA 1G3IA 2BJVA 1MN3A 5KQ8A 4MB5A 1JR3A 1GO5A 3KDSE 1H0GA 1PDCA 2Y2JA 1YLAA 5BPVA 1LV7A 1NNJA 3U61B 3LCUA 3PNYA 4KHPM 1XHBA 3UJNA 1GL6A 4DR4M 1PJSA 2DAEA 1KYIA 1K3XA 4WW0A 1OGGA 3HWSA 1QQWA 2L2DA 3KSXA 1QDRA 2RGOA 3KXEC 1PJIA 2CUZA 1R4GA 5LMUM 3R8FA 1GVNA 1QYRA 2CRUA 3HU1A 3AFHA 4G3OA 3NBIA 2F5NA 5EQTA 3AV0A 1VQ1A 2MR9A 1S3SA 2L6OA 1JQJC 2KHHA 2ZTDA 3GRUA 4GHLA 2R4EA 2G3QA 1H6UA 4NXMM 3L25A 3MK6A 5BR8M 2CHQA 3WX7A 1NNUC 4DR2M 5E26A 1ZMUA 3HHXA 3CF0A 1Q3CA 2H5XA 3BOSA 4QHSA 2DZNB 3HY5A 4GRIA 4TX8A 3BBZA 1QAQA 1XXHA 2V1CA 4LFBM 4Z2KA 2Q2EB 3B7NA 3PNVA 8CATA 3VK8A 2K0BX 2L4FA 3LVVA 2UU9M 3FTFA 1OAOC 2KEBA 5FTMA 1SXJD 2D7HA 3SYLA 2DAIA 4GIPA 1XNRM 4OJOA 2R45A 2QNJA 1E9SA 2R62A 1WXQA 3SAWA 1XMOM 2UUAM 2KNAA 4GMQA 5DNYA 4IIWA 1IXSA 2P5TA 2Z7JA 1HR0M 1UFZA 1XC8A 5IT9S 1NJGA 1ZMWA 3GQ3A 1EE8A 4LJAA 4FCWA 5KQDA 2DXIA 1D0LA 2R18A 2EA0A 4FWDA 3GLHA 1PM5A 3A42A 4IBCA 1Y8GA 3GPYA 5L8RF 2Z3XA 4DBGB 4AQYM 1FJGM 3KP1E 5EXPA 4BBAA 4DUZM 4LJ5A 2UUBM 1VEGA 2V1UA 2WSFF 4G4QA 2M5ZA 3U5ZA 4LFCM 2VQEM 3T38A 2MROB 4D81A 2R4JA 2BWBA 1KFVA 4LJ6A 3Q8XA 2RRUA 4LJ9A 4LF4M 2ZM6M 4LJ7A 5ITTA 4QNLA 4LF9M 3C3EA 2Y0TA 2FE8A 4REZA 1Z5BA 2KNZA 4MB4A 2VF7A 1WIVA 1TH4A 1DGGA 2FS1A 3FE3A 4LZJA 3TQSA 3C58A 2DNAA 2XFSA 4LGYA 1L2CA 3GLHB 1GLNA 3HJ8A 2L7IA 4QOSA 4AI6A 3H4MA 3B74A 2LNHC 3T6PA 5E6JA 4F2LA 1K3WA 4I8OA 4JI2M 3LMMA 4FD2A 5DYGA 4B3RM 1EAKA 4PT5A 4DR5M 4ZPXA 2LVQD 3B9PA 3I01M 4L4UA 3GQ5A 4NXNM 1L2BA 1HNWM 4Z2HA 3J2PB 3SAUA 3VK7A 2W82A 3GLIB 4AG5A 4XGIA 2VQFM 1IBLM 3E9SA 3RE8A 4AKIA 3AOGA 2F4VM 3ILKA 3PXGA 1OIZA 4WURA 1GKIA 3SHFA 4MH0E 4OJLA 3CGWA 5KPTA 4LRSA 3TWMA 4L8RC 2CHGA 2VDBB 4II7A 3FRIA 1UR8A 1YU1A 5DFLA 2JZ1A 2CHVA 4AW4A 3UMMA 1PJQA 2DVWB 3M7GA 3EIEA 3D8LA 3MQLA 1JB0F 2QCUA 2ZTCA 4CISA 1NY5A 1IXZA 1YE9A 4QOZC 3L2AA 4DV7M 4FWGA 1YU0A 1DGBA 3HHYA 4M0DA 1PRBA 4B08A 1OTRA 3SHGB 2XH9A 5JI2E 1E6PA 1JR3E 2CP8A 4NSRA 3FTDA 3ZCBB 1IBMM 2QBYA 1QAOA 3HONA 2LH0A 3ZH9B 5A2QS 2QSFX 1W1YA 4NSOB 1F4IA 2V5OA 2JP7A 4LJ4A 3J7AS 2LHCA 4HEOA 2UXBM 1IY1A 1E6NA 4KT0F 2ZAOA 4LZZA 3U6MA 3U60A 4IBGA 1T6OA 4MB3A 3MHVC 1OJLA 4M9SA 1W5TA 2DWZB 4LF6M 3QWLA 2KA6B 2DAGA 1IN6A 2F5PA 1WGNA 5FTNA 2QPAA 1E32A 1OQYA 2VIIA 1PGYA 3PVSA 3VLFB 3W68A 4LCBA 1NV8A 3QYBA 2V6ZM 2DZLA 2OPFA 2DWMA 4OVZB 2JWSA 4HL4A 1YUBA 3SAVA 2VF8A 2WZJA 4JI1M 3SASA 1XXHE 4JN6A 1QZEA 4NRVA 3GLGA 1XWIA 2XF3A 1YSYA 3A98B 4JV5M 4RF1A 1T43A 1E6RA 4ANRA 5H37D 3OTOM 2Y2PA 1DGHB 4LRTA 4KODA 4S12A 4X62M 4MGHA 2JXNA 3V76A 1CK7A 2XEPA 1XMQM 1HT2E 1QVRA 2N35A 3T15A 1V92A 3SMSA 3SFZA 5KPZA 3JR5A 5KPRA 5FTKA 3N3FA 2JY5A 1D0MA 1EIJA 2XD1A 3UGJA 2JY7A 1D0KA 3Q8GA 2JUJA 1W1TA 4FCVA 1SXJA 2YFQA 2DWLA 2JY8A 3GLHE 2RTSA 3AL0C 7CATA 3B7QA 5ITYA 3CF6E 2HCBA 3FUVA 4FVMA 4NRWA 4NZ1A 1G8PA 5GKNA 3L28A 3SC3A 4B7FA 4OW0A 4HMDA 2R6FA 3E46A 3GRVA 1N34M 1NVMA 3WHKA 1QUTA 2EUCA 3D8BA 3KW6A 3KVWA 1O6IA 3GLIE 2FNAA 3M0EA 1LTMA 4FWHA 3UZUA 1GABA 1C1KA 1GJSA 4GC5A 2MGWA 4DR1M 1GPFA 2XFTA 1HJPA 1ZAEA 3E21A 1NO1A 1TF0B 2I7PA 4L15A 5DYIA 3TL4X 3GPUA 1N33M 1GXDA 2LHGA 1A5TA 3B89A 3AOEC 5EP4A 2L7HA 1E8BA 1SXJC 4QNRA 3TE6A 2C9OA 3VFDA 2DAMA 1IM2A 1XXHB 4IBJA 5IWAM 2Y2QA 2WSEF 3W0LB 1VG5A 1IXRC 1QDTA 5C1BA 1E6ZA 4L16A 1KSFX 1L8QA 4B3SM 1YU3A 4LG2A 1PJJA 4JI3M 4IJEA 3W0FA 1HT1E 2JNHA 2F5OA 3E4RA 1Z5CA 4AKGA 4G6ZA 2JA2A 3M6AA 2CWBA 4I81A 3KS8A 4MGZE 1IXSB 2KXEA 3U6EA 3F92A 4NYUA 2RKOA 1MX0A 4DV5M 3PFIA 2D49A 4YHHM 2XSZD 1IN5A 2OOBA 3IG5A 2KZUA 5ITQA 4OX9M 3SYKA 4JI0M 2QZ4A 5C18A 2B3TA 2DI0A 2R65A 2R44A 2DWNA 3SMPA 1Z59A 2Y2IA 1E9RA 2FFJA 1CUKA 1I4WA 3K1JA 1H0IA 3R9XB 4DR3M 4FCTA 3VKGA 3U5ZB 4MM3B 3T1YM 2LWXA 2FN2A 4DV3M 1DGFA 1KS0A 2CV0A 3DOAA 1VEJA 1J09A 4M9ZA 2F5SA 3QAUA 3WD1A 1TGUA 1ZV1A 4X65M 1GOIA 3FYCA 4LF5M 4PDIA 2DHYA 4G4NA 2K9DA 4K0KM 2BNKA 5FSWA 2GNOA 4X64M 1G59A 2KZSA 3K9OA 3LW5F 1NV9A 2Y0QA 2HL7A 3WD3A 2XZUA 2C9CA 4PCZA 4OU7A 4OJPA 4IJFA 1XNQM 3MJ5A 4Q7JA 1N78A 5EP3A 3IECA 3NWLA 4G4OA 3SBJA 1YU2A 4JI4M 4L78A 2YR0A 3KSJA 5JI3E 4DV6M 5EJCA 2Y2LA 4AZFA 2GQFA 4CGYB 3GP1A 4XBOA 3GLFA 3L29A 2D7EA 3JAMS 2KRUA 2QQ8A 3GO8A 4DR6M 4LF7M 3KFUG 3KS4A 1OIPA 1N77A 4DR7M 4JXJA 3I4YA 1QANA 3KOYE 2UXDM 4GEWA 3GLGE 3WD2A 5FTLA 2DAKA 5ITXA 2UUCM 1AIPC 4HMCA 3LQQA 3K92A 4NC6A 1GJTA 2J7NA 1TDHA 4LJ8A 4NZ5A 1WR1B 1XB2B 1VEKA 2C96A 4L6V6 3J80S 3U61A 4IBKA 3VDPA 1VDLA 2Y2KA 3A46A 2ZBKB 1W5SA 1T3TA 4LFAM 2G5GX 1VDDA 1NSFA 2JY6B 2X49A 3I04M 4PDGA 4DV4M 3U6QA 2QBYB 4B3MM 3ZQJA 3I51A 4GH9A 4JYAM 1YU4A 4Z2GA 2HKJA 3LCVB 1WHCA 1SXJE 3FKEA 2CV1A 3T1HM 4JI7M 1MJGM 1WGLA 2M60A 2MJ5B 2XD5A 3M7PA 1NHGC 1BVSA 1K82A 3K2LA 1X37A 3EIHA 3B7ZA 2BJWA 3U60B 2DHRA 3K9PA 2O5RA 2R46A 3HU2A 1Q3BA 3FD9A 3NBXX 3C3DA 1Q39A 2O25A 4GITA 2QP9X 3UK6A 3SARA 2G8LA 4B3TM 1QZMA 1G41A 5KO3A 4W5WA 2YNMD 1HQYE 2Y2NA 4R7GA 1L1ZA 4I5SA 1R2ZA 4OUIA 3CTWB 4NZ3A 1JR3D 1OKSA 4BB9A 3THGA 1E88A 1UM8A 4DV0M 4IBBA 3RFWA 2FFFB 4LY6A 3AOEA 4BLCA 3GPPA 2CE7A 2DKLA 3WD0A 1IY0A 4Z2IA 2LVPC 4P16A 5IZ7D 2UWXA 4RF0A 1RU3A 3W67A 2EKKA 4D82A 2C5RA 1H8PA 2JE5A 1N75A 3GLGB 1J7MA 1G71A 1SG9A 4IBFA 2NQ8C 4LGMA 2OO9A 4LF8M 1HQCA 2LBCA 3FYDA 1Q02A 5EP2A 1NY6A 5EXTA 3JR4A 1IY2A 1OFIA 3FUXA 2F5QA 4JI5M 1DO2A 4FW9A 3IHPA 5EXSA 3H4JA 4MGYE 2EO2A 2LVOC 3TPZA 3HX3A 2ZANA 4DV2M 3GRRA 1UR9A 1J5EM 3AJIB 1Z5AA 4Y28F 4QNMA 4UN2B 1IN8A 3U6OA 4HMEA 5IREB 2HHHM 4GKJM 1PJTA 3LVWA 1R2YA 1SXJB 2O01F 2XZFA 4JI8M 1NHWC 2AHMA 3L26A 1AUAA 2JZ0A 4Z8XA 3U6PA 1HNXM 3GPXA 2UXCM 2CV2A 2X8AA 4MGKE 2YQZA 2JCHA 2Y2HA 1IQPA 4R71A 2EKFA 2Y2OA 2D7GA 1ED7A 1HNZM 4EIWA 3HGIA 2XSZA 1FNNA 3J81S 2Y2GA 4X66M 2KRKA 1WJ7A 4B7HA 3HHZA 5LMNM 4DUYM 3HSHA 2K47A 2XLJA 3HJQA 3RGSA 3HKPA 3WD4A 2Y2MA 4KO8A 4G4RA 3KOWE 3LQRA 3VDUA 1L2DA 4GHAA 3RGPA 2Y20A 5EP1A 3FUUA 2IOUA 1W1PA 2A5YB 2EJSA 4XK8F 2BWEA 4RNAA 1ORYB 4AKHA 4F1IA 4B7GA 4CHTB 2RGHA 1W1VA 4GC9A 4R3DA 3GLIA 2J5YA 4HLQA 1P3QQ 3GQ4A 1ZQ9A 3HZJA 2HWJA 2LTUA 1EFUB 1NJFA 5F3WA 1C7YA 1TR8A 3U6LA 2K6BA 5FTJA 1ZMVA 2QHOB 1G4AE
chains in the Genus database with same CATH topology
1DO0A 2CFOA 2KW0A 3HHWA 3HU3A 4JI6M 2QENA 1YUEA 2J7OA 3GRYA 3TWLA 5FLXS 1J7KA 3SATA 2Z4SA 4TUWA 1R7RA 2XGNA 1IN4A 3KP0E 3DA1A 4NL4H 5ITXE 2Y21A 1GL7A 3IG8A 1IBKM 1R6BX 4M9XA 2E5LM 3DFZA 2Z4RA 2C99A 3L27A 4M0WA 5EXXA 4A3VB 4MGIE 1D2NA 3KOXE 3ZC7B 4OJ5A 1OFHA 2LXEA 2FOIC 4IBIA 1QAMA 4MB7A 2ZAMA 2ERCA 2H1RA 4PD2A 2BG1A 4I4LA 4GKKM 4Z6YA 5ITUA 3FTCA 1Z6TA 2CEAA 3TWKA 4IBDA 1E94E 3I4VA 2I7NA 4YY3M 3VKHA 4NOOB 4IBEA 4AG6A 4KLNA 1TDZA 1TH3A 3FTEA 3FUWA 4DV1M 3HJSA 3K8ZA 2X4AA 2L09A 3KOZE 1I94M 4OVZA 2DZOB 1MU5A 4D80A 4QHTA 1L1TA 3GLFB 1N36M 4NYYA 4OJ6A 1IN7A 2C98A 3WHLA 5ITRA 3J27B 1N32M 3DZDA 3CF2A 3U6DA 3A45A 3U6SA 4ITQA 3AKZA 1TH2A 1DGHA 3FUTA 4NY2A 3U6CA 2OQ4A 3J7BA 1G3IA 2BJVA 5KQ8A 1JR3A 3KDSE 2Y2JA 5BPVA 1LV7A 1NNJA 3U61B 3PNYA 4KHPM 1XHBA 3UJNA 1GL6A 4DR4M 1K3XA 1KYIA 4WW0A 3HWSA 1QQWA 3KSXA 2RGOA 3KXEC 1PJIA 2CUZA 5LMUM 3R8FA 1GVNA 1QYRA 3HU1A 3AFHA 3NBIA 2F5NA 5EQTA 3AV0A 4LFBM 1S3SA 2L6OA 1JQJC 4GHLA 3GRUA 2R4EA 1H6UA 4NXMM 3L25A 3MK6A 5BR8M 2CHQA 3WX7A 1NNUC 4DR2M 5E26A 3HHXA 3CF0A 1Q3CA 3BOSA 4QHSA 2DZNB 4GRIA 1QAQA 1XXHA 2V1CA 2Q2EB 3PNVA 8CATA 3VK8A 2UU9M 3LVVA 3FTFA 2KEBA 5FTMA 1SXJD 2D7HA 3SYLA 4GIPA 1XNRM 4OJOA 2R45A 1E9SA 2R62A 1WXQA 3SAWA 1XMOM 2UUAM 4GMQA 5DNYA 4IIWA 2P5TA 2Z7JA 1HR0M 1XC8A 5IT9S 1NJGA 3GQ3A 1EE8A 4LJAA 4FCWA 5KQDA 2DXIA 2R18A 2EA0A 4FWDA 3GLHA 1PM5A 3A42A 4IBCA 3GPYA 2Z3XA 1FJGM 4AQYM 3KP1E 5EXPA 4BBAA 4DUZM 4LJ5A 2UUBM 2V1UA 4G4QA 2M5ZA 3U5ZA 4LFCM 2VQEM 3T38A 4D81A 2R4JA 1KFVA 4LJ6A 3Q8XA 4LJ9A 4LF4M 2ZM6M 4LJ7A 5ITTA 4QNLA 4LF9M 2Y0TA 2FE8A 4REZA 1Z5BA 1TH4A 1DGGA 4LZJA 3TQSA 3C58A 2XFSA 4LGYA 1L2CA 3GLHB 1GLNA 3HJ8A 2L7IA 4QOSA 4AI6A 3H4MA 4JI2M 2LNHC 1K3WA 5E6JA 4I8OA 3LMMA 4FD2A 5DYGA 4B3RM 4PT5A 4DR5M 4ZPXA 4L4UA 3B9PA 3GQ5A 1L2BA 1HNWM 4NXNM 3J2PB 3SAUA 3VK7A 2W82A 3GLIB 4AG5A 4XGIA 2VQFM 1IBLM 3E9SA 3RE8A 4AKIA 3AOGA 2F4VM 3ILKA 3PXGA 4WURA 1GKIA 3SHFA 4MH0E 4OJLA 5KPTA 4LRSA 3TWMA 4L8RC 2CHGA 1YU1A 4II7A 2CHVA 4AW4A 3UMMA 2DVWB 3M7GA 3EIEA 3D8LA 2QCUA 4CISA 1NY5A 1IXZA 1YE9A 4QOZC 3L2AA 4DV7M 4FWGA 1YU0A 1DGBA 3HHYA 4M0DA 4B08A 5JI2E 3SHGB 2XH9A 4NSRA 3FTDA 3ZCBB 1IBMM 2QBYA 1QAOA 3HONA 2LH0A 3ZH9B 5A2QS 4NSOB 4LJ4A 3J7AS 2UXBM 1IY1A 2ZAOA 4LZZA 3U6MA 3U60A 4IBGA 3MHVC 1OJLA 4M9SA 1W5TA 2DWZB 4LF6M 3QWLA 2KA6B 2F5PA 1IN6A 5FTNA 2QPAA 1E32A 2VIIA 3PVSA 3VLFB 4LCBA 2V6ZM 2OPFA 2DWMA 4OVZB 4HL4A 1YUBA 3SAVA 4JI1M 3SASA 4JN6A 4NRVA 3GLGA 2XF3A 1XWIA 1YSYA 3A98B 4JV5M 4RF1A 5H37D 3OTOM 2Y2PA 1DGHB 4LRTA 4KODA 4S12A 4X62M 4MGHA 2XEPA 1XMQM 1HT2E 1QVRA 3T15A 3SFZA 3SMSA 5KPZA 3JR5A 5KPRA 5FTKA 3N3FA 2XD1A 3UGJA 4FCVA 1SXJA 2YFQA 2DWLA 3AL0C 7CATA 4NRWA 5ITYA 3CF6E 2HCBA 3FUVA 4FVMA 4NZ1A 1G8PA 5GKNA 3L28A 3SC3A 4B7FA 4OW0A 3GRVA 1N34M 1NVMA 3WHKA 2EUCA 3D8BA 3KW6A 3KVWA 2FNAA 3M0EA 4FWHA 3UZUA 1C1KA 4GC5A 4DR1M 2XFTA 1ZAEA 2I7PA 4L15A 5DYIA 3TL4X 4NZ4A 3GPUA 1N33M 5EP4A 3AOEC 2L7HA 1SXJC 4QNRA 3TE6A 2C9OA 3VFDA 1IM2A 1XXHB 4IBJA 5IWAM 2Y2QA 3W0LB 1IXRC 5C1BA 4L16A 1KSFX 1L8QA 4B3SM 1YU3A 4LG2A 1PJJA 4JI3M 4IJEA 3W0FA 1HT1E 2F5OA 3E4RA 1Z5CA 4AKGA 4G6ZA 2JA2A 3M6AA 4I81A 3KS8A 4MGZE 1IXSB 2KXEA 3U6EA 4NYUA 2RKOA 1MX0A 4DV5M 3PFIA 4YHHM 2XSZD 1IN5A 3IG5A 2KZUA 5ITQA 4OX9M 3SYKA 4JI0M 2QZ4A 5C18A 2DWNA 2R65A 3SMPA 1Z59A 2Y2IA 1E9RA 2FFJA 3K1JA 1I4WA 3R9XB 4DR3M 4FCTA 3VKGA 3U5ZB 4MM3B 3T1YM 2LWXA 4DV3M 1DGFA 2CV0A 3DOAA 1J09A 4M9ZA 2F5SA 3QAUA 1TGUA 4X65M 3FYCA 4LF5M 4PDIA 4G4NA 4K0KM 2BNKA 5FSWA 4X64M 1G59A 2KZSA 2Y0QA 2HL7A 2XZUA 2C9CA 4PCZA 4OU7A 4OJPA 4IJFA 1XNQM 3MJ5A 1N78A 5EP3A 4G4OA 3NWLA 3SBJA 1YU2A 4JI4M 4L78A 2YR0A 3KSJA 5JI3E 4DV6M 5EJCA 2Y2LA 4AZFA 4CGYB 3GP1A 4XBOA 3GLFA 3L29A 2D7EA 3JAMS 2KRUA 3GO8A 4DR6M 4LF7M 3KFUG 3KS4A 1N77A 4DR7M 4JXJA 3I4YA 1QANA 3KOYE 2UXDM 5FTLA 5ITXA 2UUCM 3LQQA 3K92A 2J7NA 1TDHA 4LJ8A 4NZ5A 2C96A 3J80S 3U61A 4IBKA 3VDPA 2Y2KA 3A46A 2ZBKB 1W5SA 1T3TA 4LFAM 2G5GX 1VDDA 1NSFA 2X49A 4PDGA 4DV4M 3U6QA 2QBYB 4B3MM 3I51A 4GH9A 4JYAM 1YU4A 3FKEA 1SXJE 2CV1A 4JI7M 3T1HM 2M60A 2XD5A 1NHGC 1K82A 3K2LA 1X37A 3EIHA 2BJWA 3U60B 2DHRA 2O5RA 2R46A 3HU2A 1Q3BA 3FD9A 4GITA 1Q39A 2QP9X 3UK6A 3SARA 2G8LA 4B3TM 1QZMA 1G41A 5KO3A 4W5WA 2YNMD 1HQYE 2Y2NA 4R7GA 1L1ZA 4I5SA 1R2ZA 4OUIA 3CTWB 4NZ3A 1JR3D 4BB9A 3THGA 1UM8A 4DV0M 4IBBA 3RFWA 2FFFB 4LY6A 3AOEA 4BLCA 3GPPA 2CE7A 1IY0A 4P16A 5IZ7D 2UWXA 4RF0A 4D82A 2C5RA 2JE5A 1N75A 3GLGB 4IBFA 4LGMA 2NQ8C 4LF8M 1HQCA 3FYDA 5EXTA 5EP2A 1NY6A 3JR4A 1IY2A 1OFIA 3FUXA 2F5QA 4JI5M 1DO2A 4FW9A 5EXSA 4MGYE 2EO2A 3TPZA 2ZANA 4DV2M 3GRRA 1J5EM 3AJIB 1Z5AA 4QNMA 3U6OA 1IN8A 5IREB 2HHHM 4GKJM 3LVWA 1R2YA 1SXJB 2XZFA 4JI8M 1NHWC 2AHMA 3L26A 1HNXM 4Z8XA 3U6PA 3GPXA 2UXCM 2CV2A 2X8AA 4MGKE 2YQZA 2JCHA 2Y2HA 1IQPA 2Y2OA 2D7GA 1HNZM 4EIWA 3HGIA 2XSZA 1FNNA 3J81S 2Y2GA 4X66M 2KRKA 4B7HA 3HHZA 5LMNM 4DUYM 3HSHA 2K47A 2XLJA 3HJQA 3RGSA 3HKPA 2Y2MA 4KO8A 4G4RA 3KOWE 3LQRA 3VDUA 1L2DA 4GHAA 3RGPA 2Y20A 5EP1A 3FUUA 2IOUA 2A5YB 4RNAA 1ORYB 4AKHA 4B7GA 4CHTB 2RGHA 4GC9A 4R3DA 3GLIA 3GQ4A 4HLQA 1ZQ9A 5F3WA 1NJFA 3U6LA 5FTJA 2HKJA 1G4AE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KS4 A;  4GHL A;  3KS8 A;  4IBG A;  3L25 A;  4IBD A;  4GHA A;  4IBE A;  5BPV A;  4IBC A;  4IJF A;  4IBK A;  3L2A A;  4IBB A;  4IBJ A;  3L27 A;  3L26 A;  3L29 A;  3L28 A;  4GH9 A;  4LG2 A;  4IJE A;  3FKE A;  4IBF A;  4IBI A; 
#chains in the Genus database with same CATH topology
 1DO0 A;  2CFO A;  2KW0 A;  4NZ4 A;  3GLF E;  3HHW A;  3HU3 A;  4JI6 M;  2QEN A;  1QO6 A;  1YUE A;  2J7O A;  3GRY A;  3TWL A;  5FLX S;  1J7K A;  3SAT A;  2KNV A;  2Z4S A;  4TUW A;  1R7R A;  2XGN A;  1IN4 A;  3C9P A;  3KP0 E;  3DA1 A;  4NL4 H;  1L6J A;  5ITX E;  2Y21 A;  1GL7 A;  3IG8 A;  4RKU F;  1IBK M;  1R6B X;  4M9X A;  2E5L M;  3DFZ A;  2Z4R A;  2FH0 A;  2Z8Y M;  4CJ6 A;  1QUS A;  2LVN C;  2C99 A;  3L27 A;  4M0W A;  5EXX A;  1E15 A;  4A3V B;  1AIW A;  2KDL A;  4MGI E;  2WSC F;  1D2N A;  3KOX E;  3ZC7 B;  4OJ5 A;  4Z2J A;  1V33 A;  1OFH A;  2LXE A;  2FOI C;  4IBI A;  1QAM A;  2R0I A;  4MB7 A;  4P17 A;  4CIZ A;  2ZAM A;  2ERC A;  2H1R A;  4PD2 A;  1DV0 A;  1CXW A;  2BG1 A;  4I4L A;  4Z2L A;  4GKK M;  1V34 A;  1TTE A;  4Z6Y A;  5ITU A;  3MMP A;  3FTC A;  2HAK A;  1Z6T A;  2DEN A;  1OGB A;  2CEA A;  3TWK A;  2APL A;  4IBD A;  1E94 E;  3I4V A;  2I7N A;  4YY3 M;  3VKH A;  2MH8 A;  4NOO B;  4IBE A;  4AG6 A;  4KLN A;  1TDZ A;  1TH3 A;  3QYE A;  2LVA A;  3FTE A;  3FUW A;  4DV1 M;  3HJS A;  3K8Z A;  2X4A A;  2L09 A;  3KOZ E;  1I94 M;  2L4E A;  4OVZ A;  2DZO B;  1MU5 A;  1IFY A;  4D80 A;  4QHT A;  1L1T A;  3GLF B;  1N36 M;  4NYY A;  4OJ6 A;  1IN7 A;  2C98 A;  3FRH A;  3WHL A;  5ITR A;  3J27 B;  1N32 M;  3DZD A;  3CF2 A;  3U6D A;  1R5L A;  3A45 A;  3BXW A;  3U6S A;  4WP2 A;  4ITQ A;  3AKZ A;  1OAI A;  1TH2 A;  1DGH A;  2OOA A;  3FUT A;  4NY2 A;  3U6C A;  2OQ4 A;  3J7B A;  1G3I A;  2BJV A;  1MN3 A;  5KQ8 A;  4MB5 A;  1JR3 A;  1GO5 A;  3KDS E;  1H0G A;  1PDC A;  2Y2J A;  1YLA A;  5BPV A;  1LV7 A;  1NNJ A;  3U61 B;  3LCU A;  3PNY A;  4KHP M;  1XHB A;  3UJN A;  1GL6 A;  4DR4 M;  1PJS A;  2DAE A;  1KYI A;  1K3X A;  4WW0 A;  1OGG A;  3HWS A;  1QQW A;  2L2D A;  3KSX A;  1QDR A;  2RGO A;  3KXE C;  1PJI A;  2CUZ A;  1R4G A;  5LMU M;  3R8F A;  1GVN A;  1QYR A;  2CRU A;  3HU1 A;  3AFH A;  4G3O A;  3NBI A;  2F5N A;  5EQT A;  3AV0 A;  1VQ1 A;  2MR9 A;  1S3S A;  2L6O A;  1JQJ C;  2KHH A;  2ZTD A;  3GRU A;  4GHL A;  2R4E A;  2G3Q A;  1H6U A;  4NXM M;  3L25 A;  3MK6 A;  5BR8 M;  2CHQ A;  3WX7 A;  1NNU C;  4DR2 M;  5E26 A;  1ZMU A;  3HHX A;  3CF0 A;  1Q3C A;  2H5X A;  3BOS A;  4QHS A;  2DZN B;  3HY5 A;  4GRI A;  4TX8 A;  3BBZ A;  1QAQ A;  1XXH A;  2V1C A;  4LFB M;  4Z2K A;  2Q2E B;  3B7N A;  3PNV A;  8CAT A;  3VK8 A;  2K0B X;  2L4F A;  3LVV A;  2UU9 M;  3FTF A;  1OAO C;  2KEB A;  5FTM A;  1SXJ D;  2D7H A;  3SYL A;  2DAI A;  4GIP A;  1XNR M;  4OJO A;  2R45 A;  2QNJ A;  1E9S A;  2R62 A;  1WXQ A;  3SAW A;  1XMO M;  2UUA M;  2KNA A;  4GMQ A;  5DNY A;  4IIW A;  1IXS A;  2P5T A;  2Z7J A;  1HR0 M;  1UFZ A;  1XC8 A;  5IT9 S;  1NJG A;  1ZMW A;  3GQ3 A;  1EE8 A;  4LJA A;  4FCW A;  5KQD A;  2DXI A;  1D0L A;  2R18 A;  2EA0 A;  4FWD A;  3GLH A;  1PM5 A;  3A42 A;  4IBC A;  1Y8G A;  3GPY A;  5L8R F;  2Z3X A;  4DBG B;  4AQY M;  1FJG M;  3KP1 E;  5EXP A;  4BBA A;  4DUZ M;  4LJ5 A;  2UUB M;  1VEG A;  2V1U A;  2WSF F;  4G4Q A;  2M5Z A;  3U5Z A;  4LFC M;  2VQE M;  3T38 A;  2MRO B;  4D81 A;  2R4J A;  2BWB A;  1KFV A;  4LJ6 A;  3Q8X A;  2RRU A;  4LJ9 A;  4LF4 M;  2ZM6 M;  4LJ7 A;  5ITT A;  4QNL A;  4LF9 M;  3C3E A;  2Y0T A;  2FE8 A;  4REZ A;  1Z5B A;  2KNZ A;  4MB4 A;  2VF7 A;  1WIV A;  1TH4 A;  1DGG A;  2FS1 A;  3FE3 A;  4LZJ A;  3TQS A;  3C58 A;  2DNA A;  2XFS A;  4LGY A;  1L2C A;  3GLH B;  1GLN A;  3HJ8 A;  2L7I A;  4QOS A;  4AI6 A;  3H4M A;  3B74 A;  2LNH C;  3T6P A;  5E6J A;  4F2L A;  1K3W A;  4I8O A;  4JI2 M;  3LMM A;  4FD2 A;  5DYG A;  4B3R M;  1EAK A;  4PT5 A;  4DR5 M;  4ZPX A;  2LVQ D;  3B9P A;  3I01 M;  4L4U A;  3GQ5 A;  4NXN M;  1L2B A;  1HNW M;  4Z2H A;  3J2P B;  3SAU A;  3VK7 A;  2W82 A;  3GLI B;  4AG5 A;  4XGI A;  2VQF M;  1IBL M;  3E9S A;  3RE8 A;  4AKI A;  3AOG A;  2F4V M;  3ILK A;  3PXG A;  1OIZ A;  4WUR A;  1GKI A;  3SHF A;  4MH0 E;  4OJL A;  3CGW A;  5KPT A;  4LRS A;  3TWM A;  4L8R C;  2CHG A;  2VDB B;  4II7 A;  3FRI A;  1UR8 A;  1YU1 A;  5DFL A;  2JZ1 A;  2CHV A;  4AW4 A;  3UMM A;  1PJQ A;  2DVW B;  3M7G A;  3EIE A;  3D8L A;  3MQL A;  1JB0 F;  2QCU A;  2ZTC A;  4CIS A;  1NY5 A;  1IXZ A;  1YE9 A;  4QOZ C;  3L2A A;  4DV7 M;  4FWG A;  1YU0 A;  1DGB A;  3HHY A;  4M0D A;  1PRB A;  4B08 A;  1OTR A;  3SHG B;  2XH9 A;  5JI2 E;  1E6P A;  1JR3 E;  2CP8 A;  4NSR A;  3FTD A;  3ZCB B;  1IBM M;  2QBY A;  1QAO A;  3HON A;  2LH0 A;  3ZH9 B;  5A2Q S;  2QSF X;  1W1Y A;  4NSO B;  1F4I A;  2V5O A;  2JP7 A;  4LJ4 A;  3J7A S;  2LHC A;  4HEO A;  2UXB M;  1IY1 A;  1E6N A;  4KT0 F;  2ZAO A;  4LZZ A;  3U6M A;  3U60 A;  4IBG A;  1T6O A;  4MB3 A;  3MHV C;  1OJL A;  4M9S A;  1W5T A;  2DWZ B;  4LF6 M;  3QWL A;  2KA6 B;  2DAG A;  1IN6 A;  2F5P A;  1WGN A;  5FTN A;  2QPA A;  1E32 A;  1OQY A;  2VII A;  1PGY A;  3PVS A;  3VLF B;  3W68 A;  4LCB A;  1NV8 A;  3QYB A;  2V6Z M;  2DZL A;  2OPF A;  2DWM A;  4OVZ B;  2JWS A;  4HL4 A;  1YUB A;  3SAV A;  2VF8 A;  2WZJ A;  4JI1 M;  3SAS A;  1XXH E;  4JN6 A;  1QZE A;  4NRV A;  3GLG A;  1XWI A;  2XF3 A;  1YSY A;  3A98 B;  4JV5 M;  4RF1 A;  1T43 A;  1E6R A;  4ANR A;  5H37 D;  3OTO M;  2Y2P A;  1DGH B;  4LRT A;  4KOD A;  4S12 A;  4X62 M;  4MGH A;  2JXN A;  3V76 A;  1CK7 A;  2XEP A;  1XMQ M;  1HT2 E;  1QVR A;  2N35 A;  3T15 A;  1V92 A;  3SMS A;  3SFZ A;  5KPZ A;  3JR5 A;  5KPR A;  5FTK A;  3N3F A;  2JY5 A;  1D0M A;  1EIJ A;  2XD1 A;  3UGJ A;  2JY7 A;  1D0K A;  3Q8G A;  2JUJ A;  1W1T A;  4FCV A;  1SXJ A;  2YFQ A;  2DWL A;  2JY8 A;  3GLH E;  2RTS A;  3AL0 C;  7CAT A;  3B7Q A;  5ITY A;  3CF6 E;  2HCB A;  3FUV A;  4FVM A;  4NRW A;  4NZ1 A;  1G8P A;  5GKN A;  3L28 A;  3SC3 A;  4B7F A;  4OW0 A;  4HMD A;  2R6F A;  3E46 A;  3GRV A;  1N34 M;  1NVM A;  3WHK A;  1QUT A;  2EUC A;  3D8B A;  3KW6 A;  3KVW A;  1O6I A;  3GLI E;  2FNA A;  3M0E A;  1LTM A;  4FWH A;  3UZU A;  1GAB A;  1C1K A;  1GJS A;  4GC5 A;  2MGW A;  4DR1 M;  1GPF A;  2XFT A;  1HJP A;  1ZAE A;  3E21 A;  1NO1 A;  1TF0 B;  2I7P A;  4L15 A;  5DYI A;  3TL4 X;  3GPU A;  1N33 M;  1GXD A;  2LHG A;  1A5T A;  3B89 A;  3AOE C;  5EP4 A;  2L7H A;  1E8B A;  1SXJ C;  4QNR A;  3TE6 A;  2C9O A;  3VFD A;  2DAM A;  1IM2 A;  1XXH B;  4IBJ A;  5IWA M;  2Y2Q A;  2WSE F;  3W0L B;  1VG5 A;  1IXR C;  1QDT A;  5C1B A;  1E6Z A;  4L16 A;  1KSF X;  1L8Q A;  4B3S M;  1YU3 A;  4LG2 A;  1PJJ A;  4JI3 M;  4IJE A;  3W0F A;  1HT1 E;  2JNH A;  2F5O A;  3E4R A;  1Z5C A;  4AKG A;  4G6Z A;  2JA2 A;  3M6A A;  2CWB A;  4I81 A;  3KS8 A;  4MGZ E;  1IXS B;  2KXE A;  3U6E A;  3F92 A;  4NYU A;  2RKO A;  1MX0 A;  4DV5 M;  3PFI A;  2D49 A;  4YHH M;  2XSZ D;  1IN5 A;  2OOB A;  3IG5 A;  2KZU A;  5ITQ A;  4OX9 M;  3SYK A;  4JI0 M;  2QZ4 A;  5C18 A;  2B3T A;  2DI0 A;  2R65 A;  2R44 A;  2DWN A;  3SMP A;  1Z59 A;  2Y2I A;  1E9R A;  2FFJ A;  1CUK A;  1I4W A;  3K1J A;  1H0I A;  3R9X B;  4DR3 M;  4FCT A;  3VKG A;  3U5Z B;  4MM3 B;  3T1Y M;  2LWX A;  2FN2 A;  4DV3 M;  1DGF A;  1KS0 A;  2CV0 A;  3DOA A;  1VEJ A;  1J09 A;  4M9Z A;  2F5S A;  3QAU A;  3WD1 A;  1TGU A;  1ZV1 A;  4X65 M;  1GOI A;  3FYC A;  4LF5 M;  4PDI A;  2DHY A;  4G4N A;  2K9D A;  4K0K M;  2BNK A;  5FSW A;  2GNO A;  4X64 M;  1G59 A;  2KZS A;  3K9O A;  3LW5 F;  1NV9 A;  2Y0Q A;  2HL7 A;  3WD3 A;  2XZU A;  2C9C A;  4PCZ A;  4OU7 A;  4OJP A;  4IJF A;  1XNQ M;  3MJ5 A;  4Q7J A;  1N78 A;  5EP3 A;  3IEC A;  3NWL A;  4G4O A;  3SBJ A;  1YU2 A;  4JI4 M;  4L78 A;  2YR0 A;  3KSJ A;  5JI3 E;  4DV6 M;  5EJC A;  2Y2L A;  4AZF A;  2GQF A;  4CGY B;  3GP1 A;  4XBO A;  3GLF A;  3L29 A;  2D7E A;  3JAM S;  2KRU A;  2QQ8 A;  3GO8 A;  4DR6 M;  4LF7 M;  3KFU G;  3KS4 A;  1OIP A;  1N77 A;  4DR7 M;  4JXJ A;  3I4Y A;  1QAN A;  3KOY E;  2UXD M;  4GEW A;  3GLG E;  3WD2 A;  5FTL A;  2DAK A;  5ITX A;  2UUC M;  1AIP C;  4HMC A;  3LQQ A;  3K92 A;  4NC6 A;  1GJT A;  2J7N A;  1TDH A;  4LJ8 A;  4NZ5 A;  1WR1 B;  1XB2 B;  1VEK A;  2C96 A;  4L6V 6;  3J80 S;  3U61 A;  4IBK A;  3VDP A;  1VDL A;  2Y2K A;  3A46 A;  2ZBK B;  1W5S A;  1T3T A;  4LFA M;  2G5G X;  1VDD A;  1NSF A;  2JY6 B;  2X49 A;  3I04 M;  4PDG A;  4DV4 M;  3U6Q A;  2QBY B;  4B3M M;  3ZQJ A;  3I51 A;  4GH9 A;  4JYA M;  1YU4 A;  4Z2G A;  2HKJ A;  3LCV B;  1WHC A;  1SXJ E;  3FKE A;  2CV1 A;  3T1H M;  4JI7 M;  1MJG M;  1WGL A;  2M60 A;  2MJ5 B;  2XD5 A;  3M7P A;  1NHG C;  1BVS A;  1K82 A;  3K2L A;  1X37 A;  3EIH A;  3B7Z A;  2BJW A;  3U60 B;  2DHR A;  3K9P A;  2O5R A;  2R46 A;  3HU2 A;  1Q3B A;  3FD9 A;  3NBX X;  3C3D A;  1Q39 A;  2O25 A;  4GIT A;  2QP9 X;  3UK6 A;  3SAR A;  2G8L A;  4B3T M;  1QZM A;  1G41 A;  5KO3 A;  4W5W A;  2YNM D;  1HQY E;  2Y2N A;  4R7G A;  1L1Z A;  4I5S A;  1R2Z A;  4OUI A;  3CTW B;  4NZ3 A;  1JR3 D;  1OKS A;  4BB9 A;  3THG A;  1E88 A;  1UM8 A;  4DV0 M;  4IBB A;  3RFW A;  2FFF B;  4LY6 A;  3AOE A;  4BLC A;  3GPP A;  2CE7 A;  2DKL A;  3WD0 A;  1IY0 A;  4Z2I A;  2LVP C;  4P16 A;  5IZ7 D;  2UWX A;  4RF0 A;  1RU3 A;  3W67 A;  2EKK A;  4D82 A;  2C5R A;  1H8P A;  2JE5 A;  1N75 A;  3GLG B;  1J7M A;  1G71 A;  1SG9 A;  4IBF A;  2NQ8 C;  4LGM A;  2OO9 A;  4LF8 M;  1HQC A;  2LBC A;  3FYD A;  1Q02 A;  5EP2 A;  1NY6 A;  5EXT A;  3JR4 A;  1IY2 A;  1OFI A;  3FUX A;  2F5Q A;  4JI5 M;  1DO2 A;  4FW9 A;  3IHP A;  5EXS A;  3H4J A;  4MGY E;  2EO2 A;  2LVO C;  3TPZ A;  3HX3 A;  2ZAN A;  4DV2 M;  3GRR A;  1UR9 A;  1J5E M;  3AJI B;  1Z5A A;  4Y28 F;  4QNM A;  4UN2 B;  1IN8 A;  3U6O A;  4HME A;  5IRE B;  2HHH M;  4GKJ M;  1PJT A;  3LVW A;  1R2Y A;  1SXJ B;  2O01 F;  2XZF A;  4JI8 M;  1NHW C;  2AHM A;  3L26 A;  1AUA A;  2JZ0 A;  4Z8X A;  3U6P A;  1HNX M;  3GPX A;  2UXC M;  2CV2 A;  2X8A A;  4MGK E;  2YQZ A;  2JCH A;  2Y2H A;  1IQP A;  4R71 A;  2EKF A;  2Y2O A;  2D7G A;  1ED7 A;  1HNZ M;  4EIW A;  3HGI A;  2XSZ A;  1FNN A;  3J81 S;  2Y2G A;  4X66 M;  2KRK A;  1WJ7 A;  4B7H A;  3HHZ A;  5LMN M;  4DUY M;  3HSH A;  2K47 A;  2XLJ A;  3HJQ A;  3RGS A;  3HKP A;  3WD4 A;  2Y2M A;  4KO8 A;  4G4R A;  3KOW E;  3LQR A;  3VDU A;  1L2D A;  4GHA A;  3RGP A;  2Y20 A;  5EP1 A;  3FUU A;  2IOU A;  1W1P A;  2A5Y B;  2EJS A;  4XK8 F;  2BWE A;  4RNA A;  1ORY B;  4AKH A;  4F1I A;  4B7G A;  4CHT B;  2RGH A;  1W1V A;  4GC9 A;  4R3D A;  3GLI A;  2J5Y A;  4HLQ A;  1P3Q Q;  3GQ4 A;  1ZQ9 A;  3HZJ A;  2HWJ A;  2LTU A;  1EFU B;  1NJF A;  5F3W A;  1C7Y A;  1TR8 A;  3U6L A;  2K6B A;  5FTJ A;  1ZMV A;  2QHO B;  1G4A E; 
#chains in the Genus database with same CATH homology
 1DO0 A;  2CFO A;  2KW0 A;  3HHW A;  3HU3 A;  4JI6 M;  2QEN A;  1YUE A;  2J7O A;  3GRY A;  3TWL A;  5FLX S;  1J7K A;  3SAT A;  2Z4S A;  4TUW A;  1R7R A;  2XGN A;  1IN4 A;  3KP0 E;  3DA1 A;  4NL4 H;  5ITX E;  2Y21 A;  1GL7 A;  3IG8 A;  1IBK M;  1R6B X;  4M9X A;  2E5L M;  3DFZ A;  2Z4R A;  2C99 A;  3L27 A;  4M0W A;  5EXX A;  4A3V B;  4MGI E;  1D2N A;  3KOX E;  3ZC7 B;  4OJ5 A;  1OFH A;  2LXE A;  2FOI C;  4IBI A;  1QAM A;  4MB7 A;  2ZAM A;  2ERC A;  2H1R A;  4PD2 A;  2BG1 A;  4I4L A;  4GKK M;  4Z6Y A;  5ITU A;  3FTC A;  1Z6T A;  2CEA A;  3TWK A;  4IBD A;  1E94 E;  3I4V A;  2I7N A;  4YY3 M;  3VKH A;  4NOO B;  4IBE A;  4AG6 A;  4KLN A;  1TDZ A;  1TH3 A;  3FTE A;  3FUW A;  4DV1 M;  3HJS A;  3K8Z A;  2X4A A;  2L09 A;  3KOZ E;  1I94 M;  4OVZ A;  2DZO B;  1MU5 A;  4D80 A;  4QHT A;  1L1T A;  3GLF B;  1N36 M;  4NYY A;  4OJ6 A;  1IN7 A;  2C98 A;  3WHL A;  5ITR A;  3J27 B;  1N32 M;  3DZD A;  3CF2 A;  3U6D A;  3A45 A;  3U6S A;  4ITQ A;  3AKZ A;  1TH2 A;  1DGH A;  3FUT A;  4NY2 A;  3U6C A;  2OQ4 A;  3J7B A;  1G3I A;  2BJV A;  5KQ8 A;  1JR3 A;  3KDS E;  2Y2J A;  5BPV A;  1LV7 A;  1NNJ A;  3U61 B;  3PNY A;  4KHP M;  1XHB A;  3UJN A;  1GL6 A;  4DR4 M;  1K3X A;  1KYI A;  4WW0 A;  3HWS A;  1QQW A;  3KSX A;  2RGO A;  3KXE C;  1PJI A;  2CUZ A;  5LMU M;  3R8F A;  1GVN A;  1QYR A;  3HU1 A;  3AFH A;  3NBI A;  2F5N A;  5EQT A;  3AV0 A;  4LFB M;  1S3S A;  2L6O A;  1JQJ C;  4GHL A;  3GRU A;  2R4E A;  1H6U A;  4NXM M;  3L25 A;  3MK6 A;  5BR8 M;  2CHQ A;  3WX7 A;  1NNU C;  4DR2 M;  5E26 A;  3HHX A;  3CF0 A;  1Q3C A;  3BOS A;  4QHS A;  2DZN B;  4GRI A;  1QAQ A;  1XXH A;  2V1C A;  2Q2E B;  3PNV A;  8CAT A;  3VK8 A;  2UU9 M;  3LVV A;  3FTF A;  2KEB A;  5FTM A;  1SXJ D;  2D7H A;  3SYL A;  4GIP A;  1XNR M;  4OJO A;  2R45 A;  1E9S A;  2R62 A;  1WXQ A;  3SAW A;  1XMO M;  2UUA M;  4GMQ A;  5DNY A;  4IIW A;  2P5T A;  2Z7J A;  1HR0 M;  1XC8 A;  5IT9 S;  1NJG A;  3GQ3 A;  1EE8 A;  4LJA A;  4FCW A;  5KQD A;  2DXI A;  2R18 A;  2EA0 A;  4FWD A;  3GLH A;  1PM5 A;  3A42 A;  4IBC A;  3GPY A;  2Z3X A;  1FJG M;  4AQY M;  3KP1 E;  5EXP A;  4BBA A;  4DUZ M;  4LJ5 A;  2UUB M;  2V1U A;  4G4Q A;  2M5Z A;  3U5Z A;  4LFC M;  2VQE M;  3T38 A;  4D81 A;  2R4J A;  1KFV A;  4LJ6 A;  3Q8X A;  4LJ9 A;  4LF4 M;  2ZM6 M;  4LJ7 A;  5ITT A;  4QNL A;  4LF9 M;  2Y0T A;  2FE8 A;  4REZ A;  1Z5B A;  1TH4 A;  1DGG A;  4LZJ A;  3TQS A;  3C58 A;  2XFS A;  4LGY A;  1L2C A;  3GLH B;  1GLN A;  3HJ8 A;  2L7I A;  4QOS A;  4AI6 A;  3H4M A;  4JI2 M;  2LNH C;  1K3W A;  5E6J A;  4I8O A;  3LMM A;  4FD2 A;  5DYG A;  4B3R M;  4PT5 A;  4DR5 M;  4ZPX A;  4L4U A;  3B9P A;  3GQ5 A;  1L2B A;  1HNW M;  4NXN M;  3J2P B;  3SAU A;  3VK7 A;  2W82 A;  3GLI B;  4AG5 A;  4XGI A;  2VQF M;  1IBL M;  3E9S A;  3RE8 A;  4AKI A;  3AOG A;  2F4V M;  3ILK A;  3PXG A;  4WUR A;  1GKI A;  3SHF A;  4MH0 E;  4OJL A;  5KPT A;  4LRS A;  3TWM A;  4L8R C;  2CHG A;  1YU1 A;  4II7 A;  2CHV A;  4AW4 A;  3UMM A;  2DVW B;  3M7G A;  3EIE A;  3D8L A;  2QCU A;  4CIS A;  1NY5 A;  1IXZ A;  1YE9 A;  4QOZ C;  3L2A A;  4DV7 M;  4FWG A;  1YU0 A;  1DGB A;  3HHY A;  4M0D A;  4B08 A;  5JI2 E;  3SHG B;  2XH9 A;  4NSR A;  3FTD A;  3ZCB B;  1IBM M;  2QBY A;  1QAO A;  3HON A;  2LH0 A;  3ZH9 B;  5A2Q S;  4NSO B;  4LJ4 A;  3J7A S;  2UXB M;  1IY1 A;  2ZAO A;  4LZZ A;  3U6M A;  3U60 A;  4IBG A;  3MHV C;  1OJL A;  4M9S A;  1W5T A;  2DWZ B;  4LF6 M;  3QWL A;  2KA6 B;  2F5P A;  1IN6 A;  5FTN A;  2QPA A;  1E32 A;  2VII A;  3PVS A;  3VLF B;  4LCB A;  2V6Z M;  2OPF A;  2DWM A;  4OVZ B;  4HL4 A;  1YUB A;  3SAV A;  4JI1 M;  3SAS A;  4JN6 A;  4NRV A;  3GLG A;  2XF3 A;  1XWI A;  1YSY A;  3A98 B;  4JV5 M;  4RF1 A;  5H37 D;  3OTO M;  2Y2P A;  1DGH B;  4LRT A;  4KOD A;  4S12 A;  4X62 M;  4MGH A;  2XEP A;  1XMQ M;  1HT2 E;  1QVR A;  3T15 A;  3SFZ A;  3SMS A;  5KPZ A;  3JR5 A;  5KPR A;  5FTK A;  3N3F A;  2XD1 A;  3UGJ A;  4FCV A;  1SXJ A;  2YFQ A;  2DWL A;  3AL0 C;  7CAT A;  4NRW A;  5ITY A;  3CF6 E;  2HCB A;  3FUV A;  4FVM A;  4NZ1 A;  1G8P A;  5GKN A;  3L28 A;  3SC3 A;  4B7F A;  4OW0 A;  3GRV A;  1N34 M;  1NVM A;  3WHK A;  2EUC A;  3D8B A;  3KW6 A;  3KVW A;  2FNA A;  3M0E A;  4FWH A;  3UZU A;  1C1K A;  4GC5 A;  4DR1 M;  2XFT A;  1ZAE A;  2I7P A;  4L15 A;  5DYI A;  3TL4 X;  4NZ4 A;  3GPU A;  1N33 M;  5EP4 A;  3AOE C;  2L7H A;  1SXJ C;  4QNR A;  3TE6 A;  2C9O A;  3VFD A;  1IM2 A;  1XXH B;  4IBJ A;  5IWA M;  2Y2Q A;  3W0L B;  1IXR C;  5C1B A;  4L16 A;  1KSF X;  1L8Q A;  4B3S M;  1YU3 A;  4LG2 A;  1PJJ A;  4JI3 M;  4IJE A;  3W0F A;  1HT1 E;  2F5O A;  3E4R A;  1Z5C A;  4AKG A;  4G6Z A;  2JA2 A;  3M6A A;  4I81 A;  3KS8 A;  4MGZ E;  1IXS B;  2KXE A;  3U6E A;  4NYU A;  2RKO A;  1MX0 A;  4DV5 M;  3PFI A;  4YHH M;  2XSZ D;  1IN5 A;  3IG5 A;  2KZU A;  5ITQ A;  4OX9 M;  3SYK A;  4JI0 M;  2QZ4 A;  5C18 A;  2DWN A;  2R65 A;  3SMP A;  1Z59 A;  2Y2I A;  1E9R A;  2FFJ A;  3K1J A;  1I4W A;  3R9X B;  4DR3 M;  4FCT A;  3VKG A;  3U5Z B;  4MM3 B;  3T1Y M;  2LWX A;  4DV3 M;  1DGF A;  2CV0 A;  3DOA A;  1J09 A;  4M9Z A;  2F5S A;  3QAU A;  1TGU A;  4X65 M;  3FYC A;  4LF5 M;  4PDI A;  4G4N A;  4K0K M;  2BNK A;  5FSW A;  4X64 M;  1G59 A;  2KZS A;  2Y0Q A;  2HL7 A;  2XZU A;  2C9C A;  4PCZ A;  4OU7 A;  4OJP A;  4IJF A;  1XNQ M;  3MJ5 A;  1N78 A;  5EP3 A;  4G4O A;  3NWL A;  3SBJ A;  1YU2 A;  4JI4 M;  4L78 A;  2YR0 A;  3KSJ A;  5JI3 E;  4DV6 M;  5EJC A;  2Y2L A;  4AZF A;  4CGY B;  3GP1 A;  4XBO A;  3GLF A;  3L29 A;  2D7E A;  3JAM S;  2KRU A;  3GO8 A;  4DR6 M;  4LF7 M;  3KFU G;  3KS4 A;  1N77 A;  4DR7 M;  4JXJ A;  3I4Y A;  1QAN A;  3KOY E;  2UXD M;  5FTL A;  5ITX A;  2UUC M;  3LQQ A;  3K92 A;  2J7N A;  1TDH A;  4LJ8 A;  4NZ5 A;  2C96 A;  3J80 S;  3U61 A;  4IBK A;  3VDP A;  2Y2K A;  3A46 A;  2ZBK B;  1W5S A;  1T3T A;  4LFA M;  2G5G X;  1VDD A;  1NSF A;  2X49 A;  4PDG A;  4DV4 M;  3U6Q A;  2QBY B;  4B3M M;  3I51 A;  4GH9 A;  4JYA M;  1YU4 A;  3FKE A;  1SXJ E;  2CV1 A;  4JI7 M;  3T1H M;  2M60 A;  2XD5 A;  1NHG C;  1K82 A;  3K2L A;  1X37 A;  3EIH A;  2BJW A;  3U60 B;  2DHR A;  2O5R A;  2R46 A;  3HU2 A;  1Q3B A;  3FD9 A;  4GIT A;  1Q39 A;  2QP9 X;  3UK6 A;  3SAR A;  2G8L A;  4B3T M;  1QZM A;  1G41 A;  5KO3 A;  4W5W A;  2YNM D;  1HQY E;  2Y2N A;  4R7G A;  1L1Z A;  4I5S A;  1R2Z A;  4OUI A;  3CTW B;  4NZ3 A;  1JR3 D;  4BB9 A;  3THG A;  1UM8 A;  4DV0 M;  4IBB A;  3RFW A;  2FFF B;  4LY6 A;  3AOE A;  4BLC A;  3GPP A;  2CE7 A;  1IY0 A;  4P16 A;  5IZ7 D;  2UWX A;  4RF0 A;  4D82 A;  2C5R A;  2JE5 A;  1N75 A;  3GLG B;  4IBF A;  4LGM A;  2NQ8 C;  4LF8 M;  1HQC A;  3FYD A;  5EXT A;  5EP2 A;  1NY6 A;  3JR4 A;  1IY2 A;  1OFI A;  3FUX A;  2F5Q A;  4JI5 M;  1DO2 A;  4FW9 A;  5EXS A;  4MGY E;  2EO2 A;  3TPZ A;  2ZAN A;  4DV2 M;  3GRR A;  1J5E M;  3AJI B;  1Z5A A;  4QNM A;  3U6O A;  1IN8 A;  5IRE B;  2HHH M;  4GKJ M;  3LVW A;  1R2Y A;  1SXJ B;  2XZF A;  4JI8 M;  1NHW C;  2AHM A;  3L26 A;  1HNX M;  4Z8X A;  3U6P A;  3GPX A;  2UXC M;  2CV2 A;  2X8A A;  4MGK E;  2YQZ A;  2JCH A;  2Y2H A;  1IQP A;  2Y2O A;  2D7G A;  1HNZ M;  4EIW A;  3HGI A;  2XSZ A;  1FNN A;  3J81 S;  2Y2G A;  4X66 M;  2KRK A;  4B7H A;  3HHZ A;  5LMN M;  4DUY M;  3HSH A;  2K47 A;  2XLJ A;  3HJQ A;  3RGS A;  3HKP A;  2Y2M A;  4KO8 A;  4G4R A;  3KOW E;  3LQR A;  3VDU A;  1L2D A;  4GHA A;  3RGP A;  2Y20 A;  5EP1 A;  3FUU A;  2IOU A;  2A5Y B;  4RNA A;  1ORY B;  4AKH A;  4B7G A;  4CHT B;  2RGH A;  4GC9 A;  4R3D A;  3GLI A;  3GQ4 A;  4HLQ A;  1ZQ9 A;  5F3W A;  1NJF A;  3U6L A;  5FTJ A;  2HKJ A;  1G4A E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...