3L28A

Crystal structure of zaire ebola vp35 interferon inhibitory domain k339a mutant
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
123
structure length
123
Chain Sequence
DISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords Polymerase cofactor VP35
publication title Structural basis for dsRNA recognition and interferon antagonism by Ebola VP35.
pubmed doi rcsb
source organism Zaire ebolavirus
total genus 37
structure length 123
sequence length 123
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3l28A01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 3l28A02
3L27A 4IBGA 3L28A 4GH9A 4LG2A 4IJEA 5BPVA 4IBCA 4IBFA 3KS4A 3L25A 4IBKA 4GHAA 4GHLA 3L2AA 4IBIA 4IBEA 3FKEA 4IJFA 3L29A 4IBBA 3L26A 3KS8A 4IBDA 4IBJA
chains in the Genus database with same CATH superfamily
1R6BX 1R2YA 3L27A 1T43A 3GLHE 1IN4A 1DO2A 1QUSA 3DOAA 3KOWE 1J7KA 1GKIA 4GITA 3TWMA 4MGIE 2KNAA 3I04M 2R6FA 3AKZA 3SAWA 2Y21A 5C1BA 2CV0A 4BB9A 1W1YA 1JR3E 1TDHA 4LF8M 4QNMA 1E9RA 2BJVA 1SG9A 2ZAMA 1DGFA 2OOBA 4GMQA 1CXWA 1DGHA 2O01F 4TX8A 3ILKA 3FUWA 1IXSA 4REZA 2Y2OA 1XHBA 3FYCA 3VKHA 3FTCA 4MGHA 2DVWB 3W67A 2Z3XA 4FD2A 1SXJB 4JXJA 1HQCA 3SATA 1N32M 1NHWC 3SFZA 2FOIC 1QZMA 2KNZA 3AOEC 3KOZE 1JQJC 3B9PA 3KP1E 4CHTB 1IBMM 3N3FA 3WD2A 3U5ZA 3WD4A 2CFOA 4NZ1A 1JB0F 4LJ5A 4GKJM 2MROB 1GL6A 4JN6A 3HJ8A 2Y0TA 4ANRA 2A5YB 2KNVA 3QAUA 4GH9A 1SXJD 3MJ5A 5KO3A 3U6QA 1Z59A 1HQYE 1IN6A 3IG8A 4M9SA 3IECA 4DV4M 4JI4M 1L6JA 1GOIA 2FFFB 4II7A 3FUTA 3TL4X 1T3TA 2DAKA 2YR0A 3WD0A 1XXHB 3C9PA 4NSOB 4OJ5A 3IG5A 3UK6A 2JY6B 1WGNA 3CTWB 4Z2LA 3KFUG 1MJGM 2C9OA 5FSWA 3C58A 4R3DA 3THGA 1WIVA 1W5TA 1R5LA 5FTLA 2FFJA 2WSEF 4QOZC 1VDLA 5EXPA 3T38A 2CE7A 2DZOB 4NL4H 1QZEA 5LMNM 4JI6M 3PXGA 3SYLA 3MHVC 3HONA 4MB5A 1ZMUA 3AOEA 2V1UA 4NSRA 4LJ6A 2EO2A 5IZ7D 2KXEA 4F1IA 2QZ4A 3SHFA 1Z5AA 5ITUA 2JWSA 4IJEA 1PJJA 4LF6M 2FN2A 4OJLA 3SARA 2GQFA 4AI6A 4NZ3A 2LVOC 4Z2IA 5FTNA 2MH8A 3GLGE 1HNZM 4LJ7A 2CV2A 1IM2A 4Z2KA 1GJTA 1V33A 3HHXA 4XK8F 3L25A 2EUCA 2CHQA 3SMPA 4IBIA 1F4IA 1E8BA 2CHGA 4DR1M 2M60A 1L2CA 2DI0A 3I4YA 1VEGA 3HKPA 1AUAA 1MU5A 2DWMA 1PJSA 4AKGA 4QNRA 4R7GA 4NYUA 4DV3M 3K9PA 4M9ZA 1XXHE 3U6LA 4CISA 2BWBA 2LNHC 1OKSA 4B7GA 1E32A 2DAMA 3FTFA 2RRUA 4K0KM 3KW6A 4Z2GA 2D7GA 1NO1A 4PD2A 4LJ9A 4JI0M 2ZANA 3D8BA 3H4MA 5KPRA 2Y2GA 1OAOC 3J7BA 1R4GA 3GLHA 2Y2JA 3SBJA 4MB3A 3K9OA 1Z5CA 4CIZA 1E6PA 3I01M 5JI3E 1QAOA 3HU1A 2K9DA 2WZJA 4JV5M 4LFCM 4NZ5A 1TGUA 3FKEA 2DKLA 1JR3A 2FH0A 4RF0A 4NZ4A 1DGBA 2LBCA 4OUIA 2YNMD 4M0DA 2R46A 2UXCM 1VG5A 4DV6M 3KDSE 1TH2A 4AQYM 3F92A 2QCUA 2QNJA 2R18A 1XC8A 4JI3M 1IY2A 1G71A 1ZMVA 4OJ6A 3WD3A 2XH9A 2F5QA 3U6SA 2J7OA 5ITRA 2BG1A 1UR9A 1R7RA 3PNYA 2P5TA 2VDBB 5BR8M 2BWEA 1I94M 3KSJA 2QPAA 1PJQA 2ZTCA 1SXJC 2DAEA 1Z5BA 3MMPA 3QYEA 3T1HM 4L15A 2EA0A 2Y2NA 3RGSA 2BJWA 4X66M 2F5PA 2JA2A 5KPZA 1A5TA 2Y2IA 2CRUA 3I51A 1NHGC 3UJNA 4B7FA 1ZQ9A 4B7HA 1JR3D 2VQFM 1ORYB 1WHCA 2QBYA 3U60B 4YY3M 2KRUA 2ERCA 2R4EA 2UUAM 4IIWA 4P17A 3VFDA 3BBZA 2R4JA 4LJ8A 1PGYA 2XF3A 2HAKA 3RE8A 4D80A 3RGPA 2K47A 1XB2B 2KEBA 2CV1A 3KS8A 2KZUA 4I4LA 4GIPA 1YU1A 1WXQA 3A45A 3M7PA 3A46A 2XD5A 1D0LA 3C3EA 4M9XA 5KQDA 4FVMA 4B08A 1L2DA 4LJAA 4S12A 5KQ8A 4F2LA 3LW5F 5DNYA 3DZDA 1SXJA 3U6PA 2L09A 5EXXA 4NY2A 2QENA 4B3MM 4NXNM 1AIPC 1NY5A 2RGHA 3T6PA 3V76A 4DR4M 5A2QS 1TH3A 3U6MA 3TWKA 3GLFB 2AHMA 3RFWA 3HJQA 4QHSA 3HHZA 5GKNA 4LGMA 1UR8A 3WHKA 1NJFA 1BVSA 4HLQA 3LQQA 3TWLA 4IJFA 4BLCA 1L2BA 3CF0A 1DO0A 1KYIA 3E21A 1IN5A 4W5WA 2Y2PA 2JY8A 1GJSA 5L8RF 1IQPA 1KS0A 2DAIA 3J80S 2I7NA 1XXHA 3D8LA 5EJCA 5FTKA 4LY6A 4L78A 3GLGB 2C5RA 2F4VM 2UWXA 4PDIA 4PT5A 1XNRM 1L8QA 3GLIE 3Q8XA 2UXBM 1E6NA 4JI5M 1IN7A 2KZSA 3GRRA 2KW0A 3JAMS 3FTEA 3KS4A 1GLNA 1PJIA 2J5YA 4X65M 4LGYA 2Y2QA 2LTUA 2XEPA 4WURA 2DZLA 1L1TA 4WP2A 3BOSA 2H5XA 4MGKE 3M0EA 1X37A 3DA1A 3SMSA 4EIWA 4YHHM 2ZM6M 3MQLA 3KVWA 4DR5M 3FUXA 1KFVA 3W0LB 2L7IA 3GLFE 1OGGA 1Q39A 1G4AE 2G5GX 1VQ1A 2V1CA 3LMMA 4IBJA 3JR4A 1NY6A 3FE3A 2XGNA 4QOSA 2UXDM 1PJTA 3LCUA 3GO8A 3E46A 2LHCA 4LCBA 2CEAA 1Z6TA 4ZPXA 2QP9X 3NBIA 2RGOA 5FTMA 5ITXE 2UU9M 4JYAM 1E15A 1QQWA 3M7GA 3GQ5A 1N34M 4TUWA 5EQTA 2XFTA 4B3RM 2Y20A 2R45A 2Y0QA 4M0WA 3FTDA 4G3OA 4Z2JA 3GPYA 2GNOA 3B89A 2DWNA 4MGZE 3HJSA 2OPFA 2F5SA 2DAGA 2DWLA 2HHHM 2JNHA 3B7QA 2DZNB 1QUTA 3L29A 4QHTA 5IREB 4DV1M 2IOUA 4OJPA 1TF0B 1ED7A 2Z4RA 3T15A 3WHLA 2E5LM 1HT1E 5ITQA 1OIPA 2JUJA 1C1KA 3HZJA 4WW0A 4PCZA 1GPFA 3UGJA 1YU4A 1Q02A 1R2ZA 4KODA 3ZH9B 5FTJA 2XD1A 3W68A 2ZAOA 4FWGA 3PVSA 2X4AA 3U6DA 3AL0C 3R9XB 3WD1A 1TR8A 3HY5A 4RKUF 4AZFA 3HU2A 2HCBA 4Q7JA 2L6OA 3ZC7B 1K82A 7CATA 4OX9M 2Y2MA 1GXDA 4XBOA 2JY7A 1YE9A 3FYDA 1IFYA 3L2AA 4AW4A 1K3XA 1TTEA 2DWZB 4HMCA 4NOOB 2LVAA 4LFAM 2MJ5B 2DHYA 4OVZB 1AIWA 2MGWA 2QSFX 2ZBKB 5ITYA 8CATA 5IT9S 3Q8GA 4IBBA 4L16A 3L26A 2LVPC 2JP7A 1VEJA 3GRVA 1G59A 2DNAA 2H1RA 3U6OA 4LF5M 3U6CA 4FW9A 1W1TA 3K1JA 3U61A 4DR3M 3U60A 2JXNA 3BXWA 4NYYA 4NC6A 1OFIA 2L4FA 3J2PB 4DUYM 1HJPA 3FUUA 3GPUA 1V92A 2FE8A 1NJGA 2R44A 4LRTA 3QYBA 1G3IA 2EJSA 2L4EA 2VQEM 4P16A 5DYIA 2LVNC 3WX7A 2DENA 4DR7M 2F5NA 3GLIA 3U6EA 1UM8A 3ZQJA 2CP8A 4LF9M 2VIIA 3VDPA 1TH4A 1UFZA 1TDZA 3SHGB 3U61B 4DBGB 1XMOM 4QNLA 4A3VB 1IBKM 1FJGM 3VK7A 3CF2A 1J7MA 3AV0A 3GLIB 2HWJA 3B74A 2M5ZA 3W0FA 3GP1A 1E94E 4MB4A 1XNQM 2FS1A 3GLFA 4DV7M 4G4RA 4LG2A 2C96A 1E9SA 3UMMA 1PRBA 2B3TA 1H0GA 1P3QQ 1HNXM 1NV8A 1NNJA 2XSZA 1OFHA 2CHVA 3C3DA 2OQ4A 5ITXA 3FRIA 4LZZA 2V5OA 1IN8A 2HL7A 4FCVA 4LFBM 2R62A 3LVWA 1YU3A 1VDDA 5ITTA 3GLGA 1PM5A 3PNVA 5DYGA 1Q3CA 1WJ7A 2C9CA 2JZ0A 2OO9A 4OW0A 4JI2M 1QAMA 2L7HA 1YSYA 3HWSA 3K8ZA 3TQSA 3A42A 4G4QA 1D2NA 1QYRA 4DV2M 3B7NA 4IBDA 4I5SA 1G41A 4D81A 4L4UA 1GO5A 1OJLA 1Q3BA 3K92A 4KLNA 3NBXX 4MM3B 4HL4A 3GQ3A 1O6IA 1S3SA 5BPVA 3OTOM 4OJOA 2XSZD 2V6ZM 5E26A 4KHPM 1ZMWA 3KOYE 4AKHA 1I4WA 1RU3A 2Q2EB 1IBLM 1Y8GA 1QO6A 1MN3A 1J09A 4FWHA 4IBEA 1D0MA 1KSFX 3KOXE 4MH0E 1OIZA 4LF4M 4PDGA 3VK8A 2KHHA 1LTMA 2FNAA 2C99A 1NNUC 2I7PA 3K2LA 4XGIA 1IY1A 2XFSA 5F3WA 4LF7M 2JZ1A 2APLA 1DGHB 1OTRA 3ZCBB 2UUCM 1IXSB 3KP0E 3SAVA 1W1VA 4KT0F 3AJIB 2Y2LA 2YFQA 1QAQA 2R65A 5IWAM 2UUBM 1YUEA 1T6OA 2RKOA 3KXEC 1ZV1A 2X49A 3E4RA 3SYKA 1WGLA 3AOGA 3M6AA 4Z8XA 2XZFA 1EAKA 2C98A 4Z2HA 1GL7A 4IBFA 1GVNA 2D49A 2KDLA 4R71A 1CUKA 3U5ZB 2Y2KA 4B3TM 1IXRC 2N35A 4UN2B 4AG6A 4GHAA 3SASA 3JR5A 1MX0A 4GC9A 1DV0A 1QVRA 1LV7A 1CK7A 1HR0M 5EP2A 3VDUA 1N78A 4X64M 2Y2HA 3KSXA 2LWXA 5LMUM 2LH0A 4HEOA 2RTSA 2OOAA 3LCVB 4GKKM 1YU0A 3HSHA 2XZUA 2CWBA 4LJ4A 4RNAA 4GC5A 1SXJE 4DV0M 2CUZA 3L28A 1IXZA 3VLFB 3B7ZA 3IHPA 4OVZA 2LXEA 3SC3A 4MB7A 3TE6A 1W1PA 4NRVA 1K3WA 1YU2A 1FNNA 2DHRA 1E88A 4FWDA 1IY0A 3PFIA 3EIEA 4BBAA 5KPTA 4DV5M 2LHGA 2G8LA 2K6BA 3AFHA 1N77A 4GHLA 2Z4SA 1G8PA 2D7EA 3A98B 4X62M 2LVQD 4DR2M 2F5OA 3FUVA 3GPXA 1WR1B 3T1YM 3VKGA 4G4NA 2DXIA 4OU7A 2EKKA 3NWLA 4KO8A 5JI2E 1OQYA 1ZAEA 2Z7JA 2ZTDA 3HHYA 2JE5A 3HGIA 1VEKA 3HX3A 1N33M 4L6V6 3QWLA 5E6JA 2D7HA 4AG5A 1OAIA 1XWIA 1L1ZA 1W5SA 3GPPA 3J27B 1YUBA 4IBGA 2KRKA 3GRUA 3HHWA 4NRWA 1N36M 4NXMM 5C18A 4CJ6A 1XMQM 3GRYA 4IBCA 4D82A 1HT2E 2NQ8C 4AKIA 3I4VA 3UZUA 2YQZA 4G6ZA 5EXTA 3LQRA 4FCWA 1EE8A 1YLAA 3FRHA 2JY5A 4Z6YA 2W82A 1QDRA 1H6UA 2R0IA 4JI7M 3EIHA 2O25A 3HU3A 1PDCA 3LVVA 2L2DA 1DGGA 2KA6B 2X8AA 3GLHB 4Y28F 4HMEA 2Z8YM 1C7YA 4I81A 5FLXS 1NV9A 2WSFF 3MK6A 2G3QA 3FD9A 4LRSA 5EP3A 4G4OA 5DFLA 1N75A 2VF8A 4MGYE 4GEWA 1HNWM 2XLJA 3CF6E 4GRIA 1V34A 3SAUA 4JI1M 3H4JA 1EIJA 4ITQA 2JCHA 4B3SM 1QDTA 2VF7A 3GQ4A 2WSCF 2K0BX 4L8RC 4DR6M 4CGYB 1NSFA 1NVMA 4FCTA 4HMDA 1D0KA 4I8OA 2J7NA 4JI8M 1E6RA 2QHOB 1EFUB 4IBKA 4DUZM 4RF1A 5H37D 2MR9A 4LZJA 1QANA 1OGBA 3DFZA 2O5RA 3CGWA 3E9SA 1H8PA 2HKJA 5EXSA 3J7AS 1GABA 1E6ZA 1H0IA 2QQ8A 3R8FA 5EP4A 1J5EM 2EKFA 3TPZA 5EP1A 2QBYB 3J81S 2BNKA
chains in the Genus database with same CATH topology
1R6BX 1R2YA 3L27A 4GITA 1IN4A 1DO2A 3DOAA 3KOWE 3U6SA 1J7KA 1GKIA 3TWMA 1J5EM 4MGIE 3AKZA 3SAWA 2Y21A 5C1BA 2CV0A 4BB9A 1TDHA 4LF8M 4QNMA 1E9RA 2BJVA 4GMQA 2ZAMA 1DGFA 1DGHA 3ILKA 3FUWA 4REZA 2Y2OA 1XHBA 3FYCA 3VKHA 3FTCA 4MGHA 2DVWB 2Z3XA 4FD2A 1SXJB 4JXJA 1HQCA 3SATA 1N32M 1NHWC 3SFZA 2FOIC 1QZMA 3AOEC 3KOZE 1JQJC 3B9PA 3KP1E 4CHTB 1IBMM 3N3FA 3U5ZA 2CFOA 4NZ1A 4LJ5A 4GKJM 1GL6A 4JN6A 3HJ8A 2Y0TA 2A5YB 3QAUA 4GH9A 1SXJD 3MJ5A 5KO3A 3U6QA 1Z59A 1HQYE 1IN6A 3IG8A 4M9SA 4DV4M 4JI4M 2FFFB 4II7A 3FUTA 3TL4X 1T3TA 2YR0A 1XXHB 4NSOB 4OJ5A 3IG5A 3UK6A 3CTWB 3KFUG 3C58A 2C9OA 5FSWA 4R3DA 3THGA 5FTLA 1W5TA 4QOZC 2FFJA 5EXPA 3T38A 2CE7A 2DZOB 4NL4H 5LMNM 4JI6M 3PXGA 3SYLA 3MHVC 3HONA 3AOEA 2V1UA 4NSRA 4LJ6A 2EO2A 5IZ7D 2KXEA 2QZ4A 3SHFA 1Z5AA 5ITUA 1PJJA 4IJEA 4LF6M 4OJLA 3SARA 4AI6A 4NZ3A 5FTNA 1HNZM 4LJ7A 2CV2A 1IM2A 3HHXA 3L25A 2EUCA 2CHQA 3SMPA 4IBIA 2CHGA 4DR1M 2M60A 1L2CA 3I4YA 3HKPA 1MU5A 2DWMA 4AKGA 4QNRA 4R7GA 4NYUA 4DV3M 4M9ZA 3U6LA 4CISA 2LNHC 4B7GA 1E32A 3FTFA 4K0KM 3KW6A 2D7GA 4PD2A 4LJ9A 4JI0M 2ZANA 3D8BA 3H4MA 5KPRA 2Y2GA 3J7BA 2Y2JA 3GLHA 3SBJA 1Z5CA 5JI3E 1QAOA 3HU1A 4JV5M 4LFCM 4NZ5A 1TGUA 3FKEA 4NZ4A 1JR3A 4RF0A 1DGBA 4OUIA 2YNMD 4M0DA 2R46A 2UXCM 4DV6M 3KDSE 1TH2A 4AQYM 2QCUA 2R18A 1XC8A 4JI3M 1IY2A 4OJ6A 2XH9A 2F5QA 2J7OA 5ITRA 2BG1A 1R7RA 3PNYA 2P5TA 5BR8M 1I94M 3KSJA 2QPAA 1SXJC 1Z5BA 3T1HM 2Y2NA 4L15A 2EA0A 3RGSA 2BJWA 4X66M 2JA2A 5KPZA 3I51A 1NHGC 3UJNA 4B7FA 1ZQ9A 4B7HA 1JR3D 2VQFM 1ORYB 2QBYA 3U60B 4YY3M 2KRUA 2ERCA 2R4EA 2UUAM 4IIWA 3VFDA 2R4JA 4LJ8A 2XF3A 4D80A 3RE8A 3RGPA 2K47A 2KEBA 2CV1A 3KS8A 2KZUA 4I4LA 4GIPA 1YU1A 1WXQA 3A45A 3A46A 2XD5A 4M9XA 5KQDA 4FVMA 4B08A 1L2DA 4LJAA 4S12A 5KQ8A 5DNYA 3DZDA 1SXJA 3U6PA 2L09A 5EXXA 4NY2A 2QENA 4B3MM 4NXNM 1NY5A 2RGHA 4DR4M 5A2QS 1TH3A 3U6MA 3TWKA 3GLFB 2AHMA 3RFWA 3HJQA 4QHSA 3HHZA 5GKNA 4LGMA 3WHKA 1NJFA 4HLQA 3LQQA 3TWLA 4IJFA 4BLCA 1L2BA 3CF0A 1DO0A 1KYIA 2Y2PA 1IN5A 4W5WA 1IQPA 3J80S 2C5RA 2I7NA 1XXHA 3D8LA 5EJCA 5FTKA 4LY6A 4L78A 3GLGB 2F4VM 2UWXA 4PDIA 4PT5A 1XNRM 1L8QA 3Q8XA 2UXBM 4JI5M 1IN7A 2KZSA 3GRRA 2KW0A 3JAMS 3FTEA 3KS4A 1GLNA 1PJIA 4X65M 2Y2QA 4LGYA 2XEPA 4WURA 1L1TA 3BOSA 4MGKE 3M0EA 1X37A 3DA1A 3SMSA 4EIWA 4YHHM 2ZM6M 3KVWA 4DR5M 3FUXA 1KFVA 3W0LB 2L7IA 1Q39A 1G4AE 2G5GX 3JR4A 2V1CA 3LMMA 4IBJA 3R8FA 1NY6A 2F5PA 2XGNA 4QOSA 2UXDM 3GO8A 4LCBA 2CEAA 1Z6TA 4ZPXA 2QP9X 3NBIA 2RGOA 5FTMA 5ITXE 2UU9M 4JYAM 1QQWA 3M7GA 3GQ5A 1N34M 4TUWA 5EQTA 2XFTA 4B3RM 2Y20A 2R45A 2Y0QA 4M0WA 3FTDA 3GPYA 2DWNA 4MGZE 3HJSA 2OPFA 2F5SA 2DWLA 2HHHM 4QHTA 5IREB 2DZNB 3L29A 2IOUA 4DV1M 4OJPA 2Z4RA 3T15A 3WHLA 2E5LM 1HT1E 5ITQA 1C1KA 4WW0A 4PCZA 3UGJA 1YU4A 1R2ZA 4KODA 3ZH9B 5FTJA 2XD1A 2ZAOA 4FWGA 3PVSA 2X4AA 3U6DA 3AL0C 3R9XB 4AZFA 3HU2A 2HCBA 3ZC7B 2L6OA 1K82A 7CATA 4OX9M 2Y2MA 4XBOA 3FYDA 1YE9A 3L2AA 4AW4A 1K3XA 2DWZB 4NOOB 4LFAM 4OVZB 2ZBKB 5ITYA 8CATA 5IT9S 4IBBA 4L16A 3L26A 3GRVA 1G59A 3U6OA 2H1RA 4LF5M 3U6CA 4FW9A 3K1JA 3U61A 4DR3M 3U60A 4NYYA 1OFIA 3J2PB 4DUYM 3FUUA 3GPUA 2FE8A 1NJGA 4LRTA 2VQEM 1G3IA 3WX7A 4P16A 5DYIA 4DR7M 2F5NA 3GLIA 3U6EA 1UM8A 4LF9M 2VIIA 3VDPA 1TH4A 1TDZA 3SHGB 3U61B 1XMOM 4QNLA 4A3VB 1IBKM 1FJGM 3VK7A 3CF2A 3AV0A 3GLIB 2M5ZA 3W0FA 3GP1A 1E94E 1XNQM 4DV7M 3GLFA 4G4RA 4LG2A 2C96A 1E9SA 3UMMA 1HNXM 1NNJA 2XSZA 1OFHA 2CHVA 2OQ4A 5ITXA 4LZZA 1IN8A 2HL7A 4FCVA 4LFBM 2R62A 3LVWA 1YU3A 1VDDA 5ITTA 3GLGA 1PM5A 3PNVA 5DYGA 1Q3CA 2C9CA 4JI2M 4OW0A 1QAMA 2L7HA 1YSYA 3HWSA 3K8ZA 3TQSA 3A42A 4G4QA 1D2NA 1QYRA 4DV2M 4IBDA 4I5SA 1G41A 4D81A 4L4UA 1OJLA 1Q3BA 3K92A 4KLNA 4MM3B 4HL4A 3GQ3A 1S3SA 5BPVA 3OTOM 4OJOA 2XSZD 2V6ZM 5E26A 4KHPM 3KOYE 4AKHA 1I4WA 2Q2EB 1IBLM 1J09A 4FWHA 4IBEA 1KSFX 3KOXE 4MH0E 4LF4M 4PDGA 3VK8A 2FNAA 2C99A 1NNUC 2I7PA 3K2LA 4XGIA 1IY1A 2XFSA 5F3WA 4LF7M 1DGHB 3ZCBB 2UUCM 1IXSB 3KP0E 3SAVA 2Y2LA 3AJIB 2YFQA 1QAQA 2R65A 5IWAM 2UUBM 1YUEA 2RKOA 3KXEC 3SYKA 2X49A 3E4RA 2Y2IA 4Z8XA 3AOGA 3M6AA 2XZFA 2C98A 1GL7A 4IBFA 1GVNA 3U5ZB 2Y2KA 4B3TM 1IXRC 4GHAA 4AG6A 3SASA 3JR5A 1MX0A 4GC9A 1QVRA 1LV7A 1HR0M 5EP2A 3VDUA 1N78A 4X64M 2Y2HA 3KSXA 2LWXA 5LMUM 2LH0A 4GKKM 1YU0A 3HSHA 2XZUA 4LJ4A 4RNAA 4GC5A 1SXJE 4DV0M 2CUZA 3L28A 1IXZA 3VLFB 4OVZA 2LXEA 3SC3A 4MB7A 3TE6A 1YU2A 4NRVA 1K3WA 1FNNA 2DHRA 4FWDA 1IY0A 3PFIA 3EIEA 4BBAA 5KPTA 4DV5M 2G8LA 3AFHA 1N77A 4GHLA 2Z4SA 1G8PA 2D7EA 3A98B 4X62M 4DR2M 2F5OA 3FUVA 3GPXA 3T1YM 3VKGA 4G4NA 2DXIA 4OU7A 3NWLA 4KO8A 5JI2E 1ZAEA 2Z7JA 3HHYA 2JE5A 3HGIA 1N33M 5E6JA 3QWLA 4AG5A 2D7HA 1XWIA 1L1ZA 1W5SA 3GPPA 3J27B 1YUBA 4IBGA 2KRKA 3GRUA 3HHWA 4NRWA 1N36M 4NXMM 5C18A 1XMQM 3GRYA 4IBCA 4D82A 1HT2E 2NQ8C 4AKIA 3I4VA 3UZUA 2YQZA 4G6ZA 5EXTA 3LQRA 4FCWA 1EE8A 4Z6YA 2W82A 1H6UA 4JI7M 3EIHA 3HU3A 3LVVA 1DGGA 2KA6B 2X8AA 3GLHB 4I81A 5FLXS 3MK6A 3FD9A 4G4OA 4LRSA 5EP3A 1N75A 4MGYE 1HNWM 2XLJA 3CF6E 4GRIA 3SAUA 4JI1M 4ITQA 2JCHA 4B3SM 3GQ4A 4L8RC 4DR6M 4CGYB 1NSFA 1NVMA 4FCTA 4I8OA 2J7NA 4JI8M 4DUZM 4IBKA 4RF1A 5H37D 4LZJA 1QANA 3DFZA 2O5RA 3E9SA 2HKJA 5EXSA 3J7AS 5EP4A 3TPZA 5EP1A 2QBYB 3J81S 2BNKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L27 A;  4IBG A;  3L28 A;  4GH9 A;  4LG2 A;  4IJE A;  5BPV A;  4IBC A;  4IBF A;  3KS4 A;  3L25 A;  4IBK A;  4GHA A;  4GHL A;  3L2A A;  4IBI A;  4IBE A;  3FKE A;  4IJF A;  3L29 A;  4IBB A;  3L26 A;  3KS8 A;  4IBD A;  4IBJ A; 
#chains in the Genus database with same CATH topology
 1R6B X;  1R2Y A;  3L27 A;  1T43 A;  3GLH E;  1IN4 A;  1DO2 A;  1QUS A;  3DOA A;  3KOW E;  1J7K A;  1GKI A;  4GIT A;  3TWM A;  4MGI E;  2KNA A;  3I04 M;  2R6F A;  3AKZ A;  3SAW A;  2Y21 A;  5C1B A;  2CV0 A;  4BB9 A;  1W1Y A;  1JR3 E;  1TDH A;  4LF8 M;  4QNM A;  1E9R A;  2BJV A;  1SG9 A;  2ZAM A;  1DGF A;  2OOB A;  4GMQ A;  1CXW A;  1DGH A;  2O01 F;  4TX8 A;  3ILK A;  3FUW A;  1IXS A;  4REZ A;  2Y2O A;  1XHB A;  3FYC A;  3VKH A;  3FTC A;  4MGH A;  2DVW B;  3W67 A;  2Z3X A;  4FD2 A;  1SXJ B;  4JXJ A;  1HQC A;  3SAT A;  1N32 M;  1NHW C;  3SFZ A;  2FOI C;  1QZM A;  2KNZ A;  3AOE C;  3KOZ E;  1JQJ C;  3B9P A;  3KP1 E;  4CHT B;  1IBM M;  3N3F A;  3WD2 A;  3U5Z A;  3WD4 A;  2CFO A;  4NZ1 A;  1JB0 F;  4LJ5 A;  4GKJ M;  2MRO B;  1GL6 A;  4JN6 A;  3HJ8 A;  2Y0T A;  4ANR A;  2A5Y B;  2KNV A;  3QAU A;  4GH9 A;  1SXJ D;  3MJ5 A;  5KO3 A;  3U6Q A;  1Z59 A;  1HQY E;  1IN6 A;  3IG8 A;  4M9S A;  3IEC A;  4DV4 M;  4JI4 M;  1L6J A;  1GOI A;  2FFF B;  4II7 A;  3FUT A;  3TL4 X;  1T3T A;  2DAK A;  2YR0 A;  3WD0 A;  1XXH B;  3C9P A;  4NSO B;  4OJ5 A;  3IG5 A;  3UK6 A;  2JY6 B;  1WGN A;  3CTW B;  4Z2L A;  3KFU G;  1MJG M;  2C9O A;  5FSW A;  3C58 A;  4R3D A;  3THG A;  1WIV A;  1W5T A;  1R5L A;  5FTL A;  2FFJ A;  2WSE F;  4QOZ C;  1VDL A;  5EXP A;  3T38 A;  2CE7 A;  2DZO B;  4NL4 H;  1QZE A;  5LMN M;  4JI6 M;  3PXG A;  3SYL A;  3MHV C;  3HON A;  4MB5 A;  1ZMU A;  3AOE A;  2V1U A;  4NSR A;  4LJ6 A;  2EO2 A;  5IZ7 D;  2KXE A;  4F1I A;  2QZ4 A;  3SHF A;  1Z5A A;  5ITU A;  2JWS A;  4IJE A;  1PJJ A;  4LF6 M;  2FN2 A;  4OJL A;  3SAR A;  2GQF A;  4AI6 A;  4NZ3 A;  2LVO C;  4Z2I A;  5FTN A;  2MH8 A;  3GLG E;  1HNZ M;  4LJ7 A;  2CV2 A;  1IM2 A;  4Z2K A;  1GJT A;  1V33 A;  3HHX A;  4XK8 F;  3L25 A;  2EUC A;  2CHQ A;  3SMP A;  4IBI A;  1F4I A;  1E8B A;  2CHG A;  4DR1 M;  2M60 A;  1L2C A;  2DI0 A;  3I4Y A;  1VEG A;  3HKP A;  1AUA A;  1MU5 A;  2DWM A;  1PJS A;  4AKG A;  4QNR A;  4R7G A;  4NYU A;  4DV3 M;  3K9P A;  4M9Z A;  1XXH E;  3U6L A;  4CIS A;  2BWB A;  2LNH C;  1OKS A;  4B7G A;  1E32 A;  2DAM A;  3FTF A;  2RRU A;  4K0K M;  3KW6 A;  4Z2G A;  2D7G A;  1NO1 A;  4PD2 A;  4LJ9 A;  4JI0 M;  2ZAN A;  3D8B A;  3H4M A;  5KPR A;  2Y2G A;  1OAO C;  3J7B A;  1R4G A;  3GLH A;  2Y2J A;  3SBJ A;  4MB3 A;  3K9O A;  1Z5C A;  4CIZ A;  1E6P A;  3I01 M;  5JI3 E;  1QAO A;  3HU1 A;  2K9D A;  2WZJ A;  4JV5 M;  4LFC M;  4NZ5 A;  1TGU A;  3FKE A;  2DKL A;  1JR3 A;  2FH0 A;  4RF0 A;  4NZ4 A;  1DGB A;  2LBC A;  4OUI A;  2YNM D;  4M0D A;  2R46 A;  2UXC M;  1VG5 A;  4DV6 M;  3KDS E;  1TH2 A;  4AQY M;  3F92 A;  2QCU A;  2QNJ A;  2R18 A;  1XC8 A;  4JI3 M;  1IY2 A;  1G71 A;  1ZMV A;  4OJ6 A;  3WD3 A;  2XH9 A;  2F5Q A;  3U6S A;  2J7O A;  5ITR A;  2BG1 A;  1UR9 A;  1R7R A;  3PNY A;  2P5T A;  2VDB B;  5BR8 M;  2BWE A;  1I94 M;  3KSJ A;  2QPA A;  1PJQ A;  2ZTC A;  1SXJ C;  2DAE A;  1Z5B A;  3MMP A;  3QYE A;  3T1H M;  4L15 A;  2EA0 A;  2Y2N A;  3RGS A;  2BJW A;  4X66 M;  2F5P A;  2JA2 A;  5KPZ A;  1A5T A;  2Y2I A;  2CRU A;  3I51 A;  1NHG C;  3UJN A;  4B7F A;  1ZQ9 A;  4B7H A;  1JR3 D;  2VQF M;  1ORY B;  1WHC A;  2QBY A;  3U60 B;  4YY3 M;  2KRU A;  2ERC A;  2R4E A;  2UUA M;  4IIW A;  4P17 A;  3VFD A;  3BBZ A;  2R4J A;  4LJ8 A;  1PGY A;  2XF3 A;  2HAK A;  3RE8 A;  4D80 A;  3RGP A;  2K47 A;  1XB2 B;  2KEB A;  2CV1 A;  3KS8 A;  2KZU A;  4I4L A;  4GIP A;  1YU1 A;  1WXQ A;  3A45 A;  3M7P A;  3A46 A;  2XD5 A;  1D0L A;  3C3E A;  4M9X A;  5KQD A;  4FVM A;  4B08 A;  1L2D A;  4LJA A;  4S12 A;  5KQ8 A;  4F2L A;  3LW5 F;  5DNY A;  3DZD A;  1SXJ A;  3U6P A;  2L09 A;  5EXX A;  4NY2 A;  2QEN A;  4B3M M;  4NXN M;  1AIP C;  1NY5 A;  2RGH A;  3T6P A;  3V76 A;  4DR4 M;  5A2Q S;  1TH3 A;  3U6M A;  3TWK A;  3GLF B;  2AHM A;  3RFW A;  3HJQ A;  4QHS A;  3HHZ A;  5GKN A;  4LGM A;  1UR8 A;  3WHK A;  1NJF A;  1BVS A;  4HLQ A;  3LQQ A;  3TWL A;  4IJF A;  4BLC A;  1L2B A;  3CF0 A;  1DO0 A;  1KYI A;  3E21 A;  1IN5 A;  4W5W A;  2Y2P A;  2JY8 A;  1GJS A;  5L8R F;  1IQP A;  1KS0 A;  2DAI A;  3J80 S;  2I7N A;  1XXH A;  3D8L A;  5EJC A;  5FTK A;  4LY6 A;  4L78 A;  3GLG B;  2C5R A;  2F4V M;  2UWX A;  4PDI A;  4PT5 A;  1XNR M;  1L8Q A;  3GLI E;  3Q8X A;  2UXB M;  1E6N A;  4JI5 M;  1IN7 A;  2KZS A;  3GRR A;  2KW0 A;  3JAM S;  3FTE A;  3KS4 A;  1GLN A;  1PJI A;  2J5Y A;  4X65 M;  4LGY A;  2Y2Q A;  2LTU A;  2XEP A;  4WUR A;  2DZL A;  1L1T A;  4WP2 A;  3BOS A;  2H5X A;  4MGK E;  3M0E A;  1X37 A;  3DA1 A;  3SMS A;  4EIW A;  4YHH M;  2ZM6 M;  3MQL A;  3KVW A;  4DR5 M;  3FUX A;  1KFV A;  3W0L B;  2L7I A;  3GLF E;  1OGG A;  1Q39 A;  1G4A E;  2G5G X;  1VQ1 A;  2V1C A;  3LMM A;  4IBJ A;  3JR4 A;  1NY6 A;  3FE3 A;  2XGN A;  4QOS A;  2UXD M;  1PJT A;  3LCU A;  3GO8 A;  3E46 A;  2LHC A;  4LCB A;  2CEA A;  1Z6T A;  4ZPX A;  2QP9 X;  3NBI A;  2RGO A;  5FTM A;  5ITX E;  2UU9 M;  4JYA M;  1E15 A;  1QQW A;  3M7G A;  3GQ5 A;  1N34 M;  4TUW A;  5EQT A;  2XFT A;  4B3R M;  2Y20 A;  2R45 A;  2Y0Q A;  4M0W A;  3FTD A;  4G3O A;  4Z2J A;  3GPY A;  2GNO A;  3B89 A;  2DWN A;  4MGZ E;  3HJS A;  2OPF A;  2F5S A;  2DAG A;  2DWL A;  2HHH M;  2JNH A;  3B7Q A;  2DZN B;  1QUT A;  3L29 A;  4QHT A;  5IRE B;  4DV1 M;  2IOU A;  4OJP A;  1TF0 B;  1ED7 A;  2Z4R A;  3T15 A;  3WHL A;  2E5L M;  1HT1 E;  5ITQ A;  1OIP A;  2JUJ A;  1C1K A;  3HZJ A;  4WW0 A;  4PCZ A;  1GPF A;  3UGJ A;  1YU4 A;  1Q02 A;  1R2Z A;  4KOD A;  3ZH9 B;  5FTJ A;  2XD1 A;  3W68 A;  2ZAO A;  4FWG A;  3PVS A;  2X4A A;  3U6D A;  3AL0 C;  3R9X B;  3WD1 A;  1TR8 A;  3HY5 A;  4RKU F;  4AZF A;  3HU2 A;  2HCB A;  4Q7J A;  2L6O A;  3ZC7 B;  1K82 A;  7CAT A;  4OX9 M;  2Y2M A;  1GXD A;  4XBO A;  2JY7 A;  1YE9 A;  3FYD A;  1IFY A;  3L2A A;  4AW4 A;  1K3X A;  1TTE A;  2DWZ B;  4HMC A;  4NOO B;  2LVA A;  4LFA M;  2MJ5 B;  2DHY A;  4OVZ B;  1AIW A;  2MGW A;  2QSF X;  2ZBK B;  5ITY A;  8CAT A;  5IT9 S;  3Q8G A;  4IBB A;  4L16 A;  3L26 A;  2LVP C;  2JP7 A;  1VEJ A;  3GRV A;  1G59 A;  2DNA A;  2H1R A;  3U6O A;  4LF5 M;  3U6C A;  4FW9 A;  1W1T A;  3K1J A;  3U61 A;  4DR3 M;  3U60 A;  2JXN A;  3BXW A;  4NYY A;  4NC6 A;  1OFI A;  2L4F A;  3J2P B;  4DUY M;  1HJP A;  3FUU A;  3GPU A;  1V92 A;  2FE8 A;  1NJG A;  2R44 A;  4LRT A;  3QYB A;  1G3I A;  2EJS A;  2L4E A;  2VQE M;  4P16 A;  5DYI A;  2LVN C;  3WX7 A;  2DEN A;  4DR7 M;  2F5N A;  3GLI A;  3U6E A;  1UM8 A;  3ZQJ A;  2CP8 A;  4LF9 M;  2VII A;  3VDP A;  1TH4 A;  1UFZ A;  1TDZ A;  3SHG B;  3U61 B;  4DBG B;  1XMO M;  4QNL A;  4A3V B;  1IBK M;  1FJG M;  3VK7 A;  3CF2 A;  1J7M A;  3AV0 A;  3GLI B;  2HWJ A;  3B74 A;  2M5Z A;  3W0F A;  3GP1 A;  1E94 E;  4MB4 A;  1XNQ M;  2FS1 A;  3GLF A;  4DV7 M;  4G4R A;  4LG2 A;  2C96 A;  1E9S A;  3UMM A;  1PRB A;  2B3T A;  1H0G A;  1P3Q Q;  1HNX M;  1NV8 A;  1NNJ A;  2XSZ A;  1OFH A;  2CHV A;  3C3D A;  2OQ4 A;  5ITX A;  3FRI A;  4LZZ A;  2V5O A;  1IN8 A;  2HL7 A;  4FCV A;  4LFB M;  2R62 A;  3LVW A;  1YU3 A;  1VDD A;  5ITT A;  3GLG A;  1PM5 A;  3PNV A;  5DYG A;  1Q3C A;  1WJ7 A;  2C9C A;  2JZ0 A;  2OO9 A;  4OW0 A;  4JI2 M;  1QAM A;  2L7H A;  1YSY A;  3HWS A;  3K8Z A;  3TQS A;  3A42 A;  4G4Q A;  1D2N A;  1QYR A;  4DV2 M;  3B7N A;  4IBD A;  4I5S A;  1G41 A;  4D81 A;  4L4U A;  1GO5 A;  1OJL A;  1Q3B A;  3K92 A;  4KLN A;  3NBX X;  4MM3 B;  4HL4 A;  3GQ3 A;  1O6I A;  1S3S A;  5BPV A;  3OTO M;  4OJO A;  2XSZ D;  2V6Z M;  5E26 A;  4KHP M;  1ZMW A;  3KOY E;  4AKH A;  1I4W A;  1RU3 A;  2Q2E B;  1IBL M;  1Y8G A;  1QO6 A;  1MN3 A;  1J09 A;  4FWH A;  4IBE A;  1D0M A;  1KSF X;  3KOX E;  4MH0 E;  1OIZ A;  4LF4 M;  4PDG A;  3VK8 A;  2KHH A;  1LTM A;  2FNA A;  2C99 A;  1NNU C;  2I7P A;  3K2L A;  4XGI A;  1IY1 A;  2XFS A;  5F3W A;  4LF7 M;  2JZ1 A;  2APL A;  1DGH B;  1OTR A;  3ZCB B;  2UUC M;  1IXS B;  3KP0 E;  3SAV A;  1W1V A;  4KT0 F;  3AJI B;  2Y2L A;  2YFQ A;  1QAQ A;  2R65 A;  5IWA M;  2UUB M;  1YUE A;  1T6O A;  2RKO A;  3KXE C;  1ZV1 A;  2X49 A;  3E4R A;  3SYK A;  1WGL A;  3AOG A;  3M6A A;  4Z8X A;  2XZF A;  1EAK A;  2C98 A;  4Z2H A;  1GL7 A;  4IBF A;  1GVN A;  2D49 A;  2KDL A;  4R71 A;  1CUK A;  3U5Z B;  2Y2K A;  4B3T M;  1IXR C;  2N35 A;  4UN2 B;  4AG6 A;  4GHA A;  3SAS A;  3JR5 A;  1MX0 A;  4GC9 A;  1DV0 A;  1QVR A;  1LV7 A;  1CK7 A;  1HR0 M;  5EP2 A;  3VDU A;  1N78 A;  4X64 M;  2Y2H A;  3KSX A;  2LWX A;  5LMU M;  2LH0 A;  4HEO A;  2RTS A;  2OOA A;  3LCV B;  4GKK M;  1YU0 A;  3HSH A;  2XZU A;  2CWB A;  4LJ4 A;  4RNA A;  4GC5 A;  1SXJ E;  4DV0 M;  2CUZ A;  3L28 A;  1IXZ A;  3VLF B;  3B7Z A;  3IHP A;  4OVZ A;  2LXE A;  3SC3 A;  4MB7 A;  3TE6 A;  1W1P A;  4NRV A;  1K3W A;  1YU2 A;  1FNN A;  2DHR A;  1E88 A;  4FWD A;  1IY0 A;  3PFI A;  3EIE A;  4BBA A;  5KPT A;  4DV5 M;  2LHG A;  2G8L A;  2K6B A;  3AFH A;  1N77 A;  4GHL A;  2Z4S A;  1G8P A;  2D7E A;  3A98 B;  4X62 M;  2LVQ D;  4DR2 M;  2F5O A;  3FUV A;  3GPX A;  1WR1 B;  3T1Y M;  3VKG A;  4G4N A;  2DXI A;  4OU7 A;  2EKK A;  3NWL A;  4KO8 A;  5JI2 E;  1OQY A;  1ZAE A;  2Z7J A;  2ZTD A;  3HHY A;  2JE5 A;  3HGI A;  1VEK A;  3HX3 A;  1N33 M;  4L6V 6;  3QWL A;  5E6J A;  2D7H A;  4AG5 A;  1OAI A;  1XWI A;  1L1Z A;  1W5S A;  3GPP A;  3J27 B;  1YUB A;  4IBG A;  2KRK A;  3GRU A;  3HHW A;  4NRW A;  1N36 M;  4NXM M;  5C18 A;  4CJ6 A;  1XMQ M;  3GRY A;  4IBC A;  4D82 A;  1HT2 E;  2NQ8 C;  4AKI A;  3I4V A;  3UZU A;  2YQZ A;  4G6Z A;  5EXT A;  3LQR A;  4FCW A;  1EE8 A;  1YLA A;  3FRH A;  2JY5 A;  4Z6Y A;  2W82 A;  1QDR A;  1H6U A;  2R0I A;  4JI7 M;  3EIH A;  2O25 A;  3HU3 A;  1PDC A;  3LVV A;  2L2D A;  1DGG A;  2KA6 B;  2X8A A;  3GLH B;  4Y28 F;  4HME A;  2Z8Y M;  1C7Y A;  4I81 A;  5FLX S;  1NV9 A;  2WSF F;  3MK6 A;  2G3Q A;  3FD9 A;  4LRS A;  5EP3 A;  4G4O A;  5DFL A;  1N75 A;  2VF8 A;  4MGY E;  4GEW A;  1HNW M;  2XLJ A;  3CF6 E;  4GRI A;  1V34 A;  3SAU A;  4JI1 M;  3H4J A;  1EIJ A;  4ITQ A;  2JCH A;  4B3S M;  1QDT A;  2VF7 A;  3GQ4 A;  2WSC F;  2K0B X;  4L8R C;  4DR6 M;  4CGY B;  1NSF A;  1NVM A;  4FCT A;  4HMD A;  1D0K A;  4I8O A;  2J7N A;  4JI8 M;  1E6R A;  2QHO B;  1EFU B;  4IBK A;  4DUZ M;  4RF1 A;  5H37 D;  2MR9 A;  4LZJ A;  1QAN A;  1OGB A;  3DFZ A;  2O5R A;  3CGW A;  3E9S A;  1H8P A;  2HKJ A;  5EXS A;  3J7A S;  1GAB A;  1E6Z A;  1H0I A;  2QQ8 A;  3R8F A;  5EP4 A;  1J5E M;  2EKF A;  3TPZ A;  5EP1 A;  2QBY B;  3J81 S;  2BNK A; 
#chains in the Genus database with same CATH homology
 1R6B X;  1R2Y A;  3L27 A;  4GIT A;  1IN4 A;  1DO2 A;  3DOA A;  3KOW E;  3U6S A;  1J7K A;  1GKI A;  3TWM A;  1J5E M;  4MGI E;  3AKZ A;  3SAW A;  2Y21 A;  5C1B A;  2CV0 A;  4BB9 A;  1TDH A;  4LF8 M;  4QNM A;  1E9R A;  2BJV A;  4GMQ A;  2ZAM A;  1DGF A;  1DGH A;  3ILK A;  3FUW A;  4REZ A;  2Y2O A;  1XHB A;  3FYC A;  3VKH A;  3FTC A;  4MGH A;  2DVW B;  2Z3X A;  4FD2 A;  1SXJ B;  4JXJ A;  1HQC A;  3SAT A;  1N32 M;  1NHW C;  3SFZ A;  2FOI C;  1QZM A;  3AOE C;  3KOZ E;  1JQJ C;  3B9P A;  3KP1 E;  4CHT B;  1IBM M;  3N3F A;  3U5Z A;  2CFO A;  4NZ1 A;  4LJ5 A;  4GKJ M;  1GL6 A;  4JN6 A;  3HJ8 A;  2Y0T A;  2A5Y B;  3QAU A;  4GH9 A;  1SXJ D;  3MJ5 A;  5KO3 A;  3U6Q A;  1Z59 A;  1HQY E;  1IN6 A;  3IG8 A;  4M9S A;  4DV4 M;  4JI4 M;  2FFF B;  4II7 A;  3FUT A;  3TL4 X;  1T3T A;  2YR0 A;  1XXH B;  4NSO B;  4OJ5 A;  3IG5 A;  3UK6 A;  3CTW B;  3KFU G;  3C58 A;  2C9O A;  5FSW A;  4R3D A;  3THG A;  5FTL A;  1W5T A;  4QOZ C;  2FFJ A;  5EXP A;  3T38 A;  2CE7 A;  2DZO B;  4NL4 H;  5LMN M;  4JI6 M;  3PXG A;  3SYL A;  3MHV C;  3HON A;  3AOE A;  2V1U A;  4NSR A;  4LJ6 A;  2EO2 A;  5IZ7 D;  2KXE A;  2QZ4 A;  3SHF A;  1Z5A A;  5ITU A;  1PJJ A;  4IJE A;  4LF6 M;  4OJL A;  3SAR A;  4AI6 A;  4NZ3 A;  5FTN A;  1HNZ M;  4LJ7 A;  2CV2 A;  1IM2 A;  3HHX A;  3L25 A;  2EUC A;  2CHQ A;  3SMP A;  4IBI A;  2CHG A;  4DR1 M;  2M60 A;  1L2C A;  3I4Y A;  3HKP A;  1MU5 A;  2DWM A;  4AKG A;  4QNR A;  4R7G A;  4NYU A;  4DV3 M;  4M9Z A;  3U6L A;  4CIS A;  2LNH C;  4B7G A;  1E32 A;  3FTF A;  4K0K M;  3KW6 A;  2D7G A;  4PD2 A;  4LJ9 A;  4JI0 M;  2ZAN A;  3D8B A;  3H4M A;  5KPR A;  2Y2G A;  3J7B A;  2Y2J A;  3GLH A;  3SBJ A;  1Z5C A;  5JI3 E;  1QAO A;  3HU1 A;  4JV5 M;  4LFC M;  4NZ5 A;  1TGU A;  3FKE A;  4NZ4 A;  1JR3 A;  4RF0 A;  1DGB A;  4OUI A;  2YNM D;  4M0D A;  2R46 A;  2UXC M;  4DV6 M;  3KDS E;  1TH2 A;  4AQY M;  2QCU A;  2R18 A;  1XC8 A;  4JI3 M;  1IY2 A;  4OJ6 A;  2XH9 A;  2F5Q A;  2J7O A;  5ITR A;  2BG1 A;  1R7R A;  3PNY A;  2P5T A;  5BR8 M;  1I94 M;  3KSJ A;  2QPA A;  1SXJ C;  1Z5B A;  3T1H M;  2Y2N A;  4L15 A;  2EA0 A;  3RGS A;  2BJW A;  4X66 M;  2JA2 A;  5KPZ A;  3I51 A;  1NHG C;  3UJN A;  4B7F A;  1ZQ9 A;  4B7H A;  1JR3 D;  2VQF M;  1ORY B;  2QBY A;  3U60 B;  4YY3 M;  2KRU A;  2ERC A;  2R4E A;  2UUA M;  4IIW A;  3VFD A;  2R4J A;  4LJ8 A;  2XF3 A;  4D80 A;  3RE8 A;  3RGP A;  2K47 A;  2KEB A;  2CV1 A;  3KS8 A;  2KZU A;  4I4L A;  4GIP A;  1YU1 A;  1WXQ A;  3A45 A;  3A46 A;  2XD5 A;  4M9X A;  5KQD A;  4FVM A;  4B08 A;  1L2D A;  4LJA A;  4S12 A;  5KQ8 A;  5DNY A;  3DZD A;  1SXJ A;  3U6P A;  2L09 A;  5EXX A;  4NY2 A;  2QEN A;  4B3M M;  4NXN M;  1NY5 A;  2RGH A;  4DR4 M;  5A2Q S;  1TH3 A;  3U6M A;  3TWK A;  3GLF B;  2AHM A;  3RFW A;  3HJQ A;  4QHS A;  3HHZ A;  5GKN A;  4LGM A;  3WHK A;  1NJF A;  4HLQ A;  3LQQ A;  3TWL A;  4IJF A;  4BLC A;  1L2B A;  3CF0 A;  1DO0 A;  1KYI A;  2Y2P A;  1IN5 A;  4W5W A;  1IQP A;  3J80 S;  2C5R A;  2I7N A;  1XXH A;  3D8L A;  5EJC A;  5FTK A;  4LY6 A;  4L78 A;  3GLG B;  2F4V M;  2UWX A;  4PDI A;  4PT5 A;  1XNR M;  1L8Q A;  3Q8X A;  2UXB M;  4JI5 M;  1IN7 A;  2KZS A;  3GRR A;  2KW0 A;  3JAM S;  3FTE A;  3KS4 A;  1GLN A;  1PJI A;  4X65 M;  2Y2Q A;  4LGY A;  2XEP A;  4WUR A;  1L1T A;  3BOS A;  4MGK E;  3M0E A;  1X37 A;  3DA1 A;  3SMS A;  4EIW A;  4YHH M;  2ZM6 M;  3KVW A;  4DR5 M;  3FUX A;  1KFV A;  3W0L B;  2L7I A;  1Q39 A;  1G4A E;  2G5G X;  3JR4 A;  2V1C A;  3LMM A;  4IBJ A;  3R8F A;  1NY6 A;  2F5P A;  2XGN A;  4QOS A;  2UXD M;  3GO8 A;  4LCB A;  2CEA A;  1Z6T A;  4ZPX A;  2QP9 X;  3NBI A;  2RGO A;  5FTM A;  5ITX E;  2UU9 M;  4JYA M;  1QQW A;  3M7G A;  3GQ5 A;  1N34 M;  4TUW A;  5EQT A;  2XFT A;  4B3R M;  2Y20 A;  2R45 A;  2Y0Q A;  4M0W A;  3FTD A;  3GPY A;  2DWN A;  4MGZ E;  3HJS A;  2OPF A;  2F5S A;  2DWL A;  2HHH M;  4QHT A;  5IRE B;  2DZN B;  3L29 A;  2IOU A;  4DV1 M;  4OJP A;  2Z4R A;  3T15 A;  3WHL A;  2E5L M;  1HT1 E;  5ITQ A;  1C1K A;  4WW0 A;  4PCZ A;  3UGJ A;  1YU4 A;  1R2Z A;  4KOD A;  3ZH9 B;  5FTJ A;  2XD1 A;  2ZAO A;  4FWG A;  3PVS A;  2X4A A;  3U6D A;  3AL0 C;  3R9X B;  4AZF A;  3HU2 A;  2HCB A;  3ZC7 B;  2L6O A;  1K82 A;  7CAT A;  4OX9 M;  2Y2M A;  4XBO A;  3FYD A;  1YE9 A;  3L2A A;  4AW4 A;  1K3X A;  2DWZ B;  4NOO B;  4LFA M;  4OVZ B;  2ZBK B;  5ITY A;  8CAT A;  5IT9 S;  4IBB A;  4L16 A;  3L26 A;  3GRV A;  1G59 A;  3U6O A;  2H1R A;  4LF5 M;  3U6C A;  4FW9 A;  3K1J A;  3U61 A;  4DR3 M;  3U60 A;  4NYY A;  1OFI A;  3J2P B;  4DUY M;  3FUU A;  3GPU A;  2FE8 A;  1NJG A;  4LRT A;  2VQE M;  1G3I A;  3WX7 A;  4P16 A;  5DYI A;  4DR7 M;  2F5N A;  3GLI A;  3U6E A;  1UM8 A;  4LF9 M;  2VII A;  3VDP A;  1TH4 A;  1TDZ A;  3SHG B;  3U61 B;  1XMO M;  4QNL A;  4A3V B;  1IBK M;  1FJG M;  3VK7 A;  3CF2 A;  3AV0 A;  3GLI B;  2M5Z A;  3W0F A;  3GP1 A;  1E94 E;  1XNQ M;  4DV7 M;  3GLF A;  4G4R A;  4LG2 A;  2C96 A;  1E9S A;  3UMM A;  1HNX M;  1NNJ A;  2XSZ A;  1OFH A;  2CHV A;  2OQ4 A;  5ITX A;  4LZZ A;  1IN8 A;  2HL7 A;  4FCV A;  4LFB M;  2R62 A;  3LVW A;  1YU3 A;  1VDD A;  5ITT A;  3GLG A;  1PM5 A;  3PNV A;  5DYG A;  1Q3C A;  2C9C A;  4JI2 M;  4OW0 A;  1QAM A;  2L7H A;  1YSY A;  3HWS A;  3K8Z A;  3TQS A;  3A42 A;  4G4Q A;  1D2N A;  1QYR A;  4DV2 M;  4IBD A;  4I5S A;  1G41 A;  4D81 A;  4L4U A;  1OJL A;  1Q3B A;  3K92 A;  4KLN A;  4MM3 B;  4HL4 A;  3GQ3 A;  1S3S A;  5BPV A;  3OTO M;  4OJO A;  2XSZ D;  2V6Z M;  5E26 A;  4KHP M;  3KOY E;  4AKH A;  1I4W A;  2Q2E B;  1IBL M;  1J09 A;  4FWH A;  4IBE A;  1KSF X;  3KOX E;  4MH0 E;  4LF4 M;  4PDG A;  3VK8 A;  2FNA A;  2C99 A;  1NNU C;  2I7P A;  3K2L A;  4XGI A;  1IY1 A;  2XFS A;  5F3W A;  4LF7 M;  1DGH B;  3ZCB B;  2UUC M;  1IXS B;  3KP0 E;  3SAV A;  2Y2L A;  3AJI B;  2YFQ A;  1QAQ A;  2R65 A;  5IWA M;  2UUB M;  1YUE A;  2RKO A;  3KXE C;  3SYK A;  2X49 A;  3E4R A;  2Y2I A;  4Z8X A;  3AOG A;  3M6A A;  2XZF A;  2C98 A;  1GL7 A;  4IBF A;  1GVN A;  3U5Z B;  2Y2K A;  4B3T M;  1IXR C;  4GHA A;  4AG6 A;  3SAS A;  3JR5 A;  1MX0 A;  4GC9 A;  1QVR A;  1LV7 A;  1HR0 M;  5EP2 A;  3VDU A;  1N78 A;  4X64 M;  2Y2H A;  3KSX A;  2LWX A;  5LMU M;  2LH0 A;  4GKK M;  1YU0 A;  3HSH A;  2XZU A;  4LJ4 A;  4RNA A;  4GC5 A;  1SXJ E;  4DV0 M;  2CUZ A;  3L28 A;  1IXZ A;  3VLF B;  4OVZ A;  2LXE A;  3SC3 A;  4MB7 A;  3TE6 A;  1YU2 A;  4NRV A;  1K3W A;  1FNN A;  2DHR A;  4FWD A;  1IY0 A;  3PFI A;  3EIE A;  4BBA A;  5KPT A;  4DV5 M;  2G8L A;  3AFH A;  1N77 A;  4GHL A;  2Z4S A;  1G8P A;  2D7E A;  3A98 B;  4X62 M;  4DR2 M;  2F5O A;  3FUV A;  3GPX A;  3T1Y M;  3VKG A;  4G4N A;  2DXI A;  4OU7 A;  3NWL A;  4KO8 A;  5JI2 E;  1ZAE A;  2Z7J A;  3HHY A;  2JE5 A;  3HGI A;  1N33 M;  5E6J A;  3QWL A;  4AG5 A;  2D7H A;  1XWI A;  1L1Z A;  1W5S A;  3GPP A;  3J27 B;  1YUB A;  4IBG A;  2KRK A;  3GRU A;  3HHW A;  4NRW A;  1N36 M;  4NXM M;  5C18 A;  1XMQ M;  3GRY A;  4IBC A;  4D82 A;  1HT2 E;  2NQ8 C;  4AKI A;  3I4V A;  3UZU A;  2YQZ A;  4G6Z A;  5EXT A;  3LQR A;  4FCW A;  1EE8 A;  4Z6Y A;  2W82 A;  1H6U A;  4JI7 M;  3EIH A;  3HU3 A;  3LVV A;  1DGG A;  2KA6 B;  2X8A A;  3GLH B;  4I81 A;  5FLX S;  3MK6 A;  3FD9 A;  4G4O A;  4LRS A;  5EP3 A;  1N75 A;  4MGY E;  1HNW M;  2XLJ A;  3CF6 E;  4GRI A;  3SAU A;  4JI1 M;  4ITQ A;  2JCH A;  4B3S M;  3GQ4 A;  4L8R C;  4DR6 M;  4CGY B;  1NSF A;  1NVM A;  4FCT A;  4I8O A;  2J7N A;  4JI8 M;  4DUZ M;  4IBK A;  4RF1 A;  5H37 D;  4LZJ A;  1QAN A;  3DFZ A;  2O5R A;  3E9S A;  2HKJ A;  5EXS A;  3J7A S;  5EP4 A;  3TPZ A;  5EP1 A;  2QBY B;  3J81 S;  2BNK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...