2Y2IA

Penicillin-binding protein 1b (pbp-1b) in complex with an alkyl boronate (za3)
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
487
structure length
467
Chain Sequence
ISEITYSDGTVIASIDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTGQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Guided Design of Cell Wall Biosynthesis Inhibitors that Overcome Beta-Lactam Resistance in Staphylococcus Aureus (Mrsa).
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
molecule keywords PENICILLIN-BINDING PROTEIN 1B
total genus 159
structure length 467
sequence length 487
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2y2iA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2y2iA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2y2iA02
1L0EA 2Y2NA 2I72A 4U3TA 3V3SA 4X55A 1IKIA 4OP8A 3HLGA 1MWTA 3DTMA 4E3OA 3OPRA 2WGWB 3G32A 4RX3A 3W8KA 5E2FA 2WAFA 3QHYA 1KGGA 1JVJA 5KZHA 3DWZA 3MKEA 1YLJA 2DRWA 4FH4A 1PI5A 1CEFA 2Y2JA 2EXBA 3BFEA 4A5RA 3UNWA 2Y59A 2P74A 4MBFA 3HLCA 1K4EA 3AGEA 1K56D 4OQHA 3IH9A 3M6BA 1RGYA 3PTEA 4LV1A 3VSLA 3VP0A 3FKWA 3SH8A 4OOYA 1KDSA 5CHUA 4KG6A 3ZVWA 5HAIA 4X68A 2IWBA 3ZNYA 5CHJA 3PBSA 3GRJA 5GHYA 4BLMA 4CPKA 1KGEA 2WADA 4DE2A 2IWDA 1NZUA 5DF8A 1CI8A 5BOHA 3N6IA 1K25A 3N8RA 2HDQA 2WGVA 3FZCA 1KE0A 5E43A 3N4IA 4E6WA 1PYYA 1BLSA 2X71A 1CEGA 3HLWA 2C6WB 4B4ZA 1FR6A 2EX9A 1DJAA 1ES3A 4EBPA 2ZQ8A 4E3LA 5EUAA 5A91A 4S2JA 3D4FA 3BFCA 5FQJA 4HESA 1TDLA 1XGIA 4N1HA 3V5MA 5FI7A 2J8YA 3GQZA 1W8QA 4BL3A 3TG9A 4PM5A 3LO7A 4UA6A 1L0FA 1NY0A 4ZDXA 4NETA 2H0TA 1VM1A 3IWIA 3M2KA 1YMSA 3AGDA 4OVDA 3IHAA 2Q9NA 1XA1A 4WELA 1ERQA 3OCNA 3G2ZA 2A3UA 5CGWA 3UY6A 4LV0A 4JF5A 5GLBA 3ZG0A 3SS5A 4B88A 3UE0A 1MWUA 4DXBA 4C3QA 3IXDA 5F1FA 1E3UA 4EBNA 2HP5A 4YINA 4BQMA 3IHBA 3ZG8B 3PBTA 4GD8A 5EVIB 2XGNA 1BLHA 4KZ6A 1YMXA 3IXHA 4LV3A 2XDMA 5EPHA 2HP6A 3IWQA 4OOLA 3RXWA 3NDEA 2Y55A 4E3MA 3FKVA 4WBGA 1FSWA 3VOYA 3HLDA 4R1GA 3C7VA 3FV7A 1I2WA 4B4XA 5EOEA 3VOZA 3IF6A 4KG2A 4QY5A 3WRTA 1K56A 2EFUA 3MBZA 5E2EA 3NY4A 4DKIA 4E3KA 1YLTA 3OCLA 3HLBA 5FATA 4S2MA 2Z2MB 4HBTA 5J8XA 5HAQA 2G2UA 1FR1A 4LCLA 4ZBEA 1XA7A 3MZEA 1XP4A 4P85A 3GR2A 3UDIA 4GB7A 3Q7VB 5GLCA 4KZ8A 2P9VA 3BFDA 3CMZA 2WGIA 4DE0A 3O86A 3IT9A 2HPBA 2PBYA 3A3JA 5CRFA 1EROA 1H8YA 5FAOA 5TGFA 2ZM8A 1U60A 5EE8A 4C6YA 4OPYA 4CJNA 1O7EA 1IYQA 1ALQA 3VP3A 5FAQA 4R3BA 4X6TA 3LEZA 1RP5A 1SCWA 2WUQA 2ZQ9A 4S2NC 4XXRA 3AGFA 4JLFA 5CERA 3GTCA 2ZJ9A 5DTTA 2XR0A 3MFDA 3C7UA 4JBFA 4GDBA 5DTSA 4E3IA 4X56A 3IH8A 1ESUA 1ES5A 2VGJA 4BD1A 5M19A 2ZD8A 2OV5A 3RXXA 1JWPA 3BFFA 2ZC4B 4QJGA 2EX6A 5GL9A 1NYYA 4IBRA 4K0XA 3WWXA 4GD6A 4RYEA 2ZQ7A 3G2YA 1ONGA 2HDSA 3FWLA 4OQ0A 2OLVA 2XD5A 5F1GA 3UPPA 3Q81A 1BT5A 1ESIA 3IQAA 4GN2A 2XQZA 5EVID 3A3DA 3ZCZA 1ERMA 4JKTA 1PW8A 5FI2A 3HBRA 4FH2A 4N1XA 4U0TA 3OPHA 3VP2A 1GHMA 4Y0OA 2H0YA 3E2LA 1S6RA 2H5SA 4XUZA 2VGKA 5FQMA 5FAPA 3UE1A 4H8RA 1LL5A 2ZQCA 4K91A 4QB8A 3MXRA 3ZVTA 3HUMA 3GMWA 3BLSA 4S2PA 5FQ9A 5CEBA 4QHCA 2Y2KA 2PU2A 2WKEA 3IWOA 3HUNA 3I7JA 1K38A 3ZG7B 1JTGA 1YM1A 1K6RA 4FD8A 4PM9A 4JXWA 1YLWA 2ZLYA 3NIAA 4Y7PA 3WS2A 3VFHA 2FFYA 4S2LA 4QY6A 5FQQA 5GHZA 3MZDA 4OLDA 2BLSA 2A49A 4BJPA 4PM6A 4MEZA 3WRZA 3ZHHA 1KVMA 5FDHA 3BFGA 4OOMA 1GHIA 4DE3A 4KENB 1NZOA 3A3FA 1K54C 4RX2A 1YQSA 4OPZA 5CTNA 1GA0A 1K4FA 1SDNA 2HP9A 4MNRA 5FA7A 2EX8A 4WZ5C 1CI9A 2E8IA 3NBLA 2XFSA 3N7WA 1DY6A 2DCFA 2DNSA 5EECA 2WAEA 4NK3A 4EUZA 1MBLA 3UPNA 1Q2QA 1QMEA 3BM6A 4IEDA 4S2KA 4R0QA 1ES2A 5JYOA 2OLUA 1NXYA 4O7DA 4OP5A 4WYYA 5DTKA 4WZ4A 1E3UD 1LLBA 1KE3A 5EVLA 4E3NA 3ZG9B 1Z6FA 1DJBA 3W4QA 3O88A 4GKUA 3M6HA 5EVIA 1XKZA 2EXAA 3ITBA 4R23A 1OMEA 1XX2A 3GVBA 3UDFA 4JXVA 3HUOA 4ZJ1A 4S2NA 2WGWA 2ZC5B 1PIOA 3DW0A 4ZJ3A 2X02A 4N9LA 5HAPA 3TSGA 2WYXA 1ZKJA 2ZQDA 1MWSA 2Y4AA 4DRTA 3BYDA 1J9MA 3S4XA 4GDNA 3N8SA 1YT4A 2Y2OA 3VMAA 2XD1A 3G34A 4M3KA 2ZM2A 3BLMA 3PBQA 1PZPA 4PPRA 2WKIA 2Y2PA 1IEMA 3UO9A 2WZXA 3FYZA 1SKFA 3EQUA 1K55C 1PW1A 2C5WB 4JF4A 4ZJ2A 4U0XA 3ZG5A 5FASA 4EBLA 5G18A 3N8LA 2Y91A 3PBRA 3V50A 3P09A 2UWXA 3CJMA 4LV2A 4R3JA 3W4PA 1NJ4A 1M6KA 3OPLA 4S2IA 5GLAA 3Q82A 1HZOA 1S0WA 5HX9A 5AQ9A 5FSRA 4UA7A 1SHVA 1FCNA 1K57A 4XUXA 4C75A 5TR7A 3NC8A 1L0DA 1KVLA 1MY8A 3DWKA 3MZFA 4FSFA 3SS4A 3BEBA 3VP1A 1BLPA 3ZFZA 3SH7A 2BG1A 4RVAA 1WE4A 2V2FF 1XGJA 4WEJA 3VSKA 5EOOA 2GDNA 3LY4A 1FCOA 4PM8A 2WK0A 2XH9A 3M2JA 3WS5A 4BENA 5E2GA 2Y2LA 5DVAA 4GNUA 1JWVA 1RCJA 4X69A 4GOGA 1GCEA 4P6BA 5CGXA 4ZAMA 5AQAA 2XLNA 5HFOA 4HBUA 1HTZA 1SDEA 5GHXA 2EFXA 3CZDA 4WM9A 3GSGA 2R9XA 2R9WA 1LHYA 2PU4A 4QD4A 3ZNTA 4KG5A 2X01A 3ITAA 1JWZA 3IXBA 3OC2A 1ONHA 3QNBA 4P0MA 5GLDA 4DDSA 2Y2QA 1GA9A 4KZ9A 4WEKA 2QMIA 4OKPA 3OPPA 4MBHA 1H8ZA 1YLZA 3G31A 3Q1FA 4OLGA 3SS3A 3PBOA 3WS1A 1IYSA 5A90A 1ZG4A 1DJCA 3O87A 4WZ5A 3A3IA 3V39A 2J9OA 4OQGA 2Y2HA 5IHVA 4ZTKA 5L2FA 1ZC2A 1KE4A 5FQKA 1H5XA 4E3JA 4KZ7A 1NYMA 1IYPA 4JXSA 1M40A 2Q9MA 1K55A 3MKFA 4KQQA 5FQIA 3UDXA 2OSUA 4UA9A 2FFFB 4WMCA 4X53A 5A93A 2JBFA 2XEPA 4N9KA 5M1AA 4KQOA 2WKHA 5CXWA 4BD0A 2HDRA 5DF9A 3ZGAB 1XXMA 4Q8IA 2Z2LB 4HEFA 4K0WA 2J7VA 1IYOA 2CC1A 4OH0A 1FCMA 1K57C 2JCHA 1W5DA 1MWRA 5AQBA 2XFTA 4ID4A 2ZQAA 5D3OA 4MLLA 4R4SA 5TFQA 1MPLA 2B5RA 5CECA 3UPOA 1E25A 3NCKA 5DF7A 1ZG6A 4IVKA 1K54A 5KSHA 3C5AA 1GHPA 2JE5A 2ZMAA 5I94A 1N9BA 2Y2MA 3S1YA 5CGSA 5F83A 4JPMA 4KZBA 3BRMA 1YLYA 4Y0TA 1BSGA 3EQVA 1C3BA 3S22A 2RL3A 2Y2GA 4IBXA 4EV4A 1E4DA 2V20A 4RA7A 3WS0A 1PWGA 4PM7A 5KSCA 1N4OA 4YFMA 5CEDA 2Y2IA 3NI9A 4BL2A 4EQIA 2QPNA 2ZC3B 1MXOA 3RJUA 4R4RA 1YLPA 4D2OA 1LI0A 1EI5A 2IWCA 3IF6B 3VFFA 3Q7ZA 3BECA 2ZC7A 1W8YA 4GZBA 1KDWA 3HLFA 1I2SA 4OPRA 1AXBA 1TVFA 1G68A 4P87A 2XK1A 4QU3A 1PI4A 3ISGA 4WMCD 1WYBA 3P98A 3PAEA 3V3RA 5F82A 2G2WA 3ZDJA 3G35A 4UAAA 3HVFA 4N92A 3W4OA 3G30A 5E2HA 4F94A 4KQRA 3PAGA 5HW3A 1BLCA 2V1ZA 5KMWA 3MXSA 5U47A 3HL9A 1W79A 2JC7A 1BUEA 4JXGA 5JYPA 1G6AA 1LI9A 4L0LA 5EVIC 2WZZA 3E2KA 1ES4A 1PWCA 1XPBA 4Z9QA 1VQQA 4DE1A 4KZ5A 1BULA 1FOFA 1TDGA 2RCXA 4KZAA 1KGFA 1O07A 3WS4A 1K6SA 3IF6C 1HD8A 4JF6A 3SH9A 2ZC6B 5FI6A 4OONA 1IELA 3G4PA 1BTLA 3HREA 1TEMA 1NRFA 1Y54A 1IKGA 1PZOA 1BZAA 3PBNA 4DDYA 3QNCA 4KZ4A 4PMAA 3A3EA 3C4PA 2EX2A 4S2OA 5M18A 1I5QA 3UE3A 1EWZA 5AQ7A 4E6XA 1FSYA 4KZ3A 3IXGA 5HL1A 1WYCA 3GV9A 1FQGA 1MKIA 1QMFA 3C4OA 3LCEA 4LENA 2XF3A 4Y0UA 3SOIA 1CK3A 3CG5A 2QZ6A 1PWDA 2ZM0A 4OQIA 3VP4A 5A92A 5CHMA 2HDUA 3LY3A 2J9PA 3OZHA 4FCFA 4LCMA 4DXCA 1LL9A 3TOIA 3UN7A 5HARA 3B3XA 4IVIA 3HLEA 4MBKA 2H10A 5CTMA 3Q7VA 3Q07A 1L0GA 3O3VA 2P9VB 1HVBA 1Q2PA 1JTDA 3IF5A 4EWFA 4DF6A 3NDGA 3JYIA 4UHUA 1RGZA 1L2SA 1W7FA 4OPQA
chains in the Genus database with same CATH superfamily
2AROA 4WNNB 3O62D 1L0EA 3V3SA 2W3DA 4X55A 2IA2A 4NEED 4E3OA 4WV4B 5B0YA 3AZGC 4WUJA 4J8UA 2LY8A 1KGGA 3EEAA 1G28A 5CPJB 2DRWA 1PI5A 4HH3A 4CSRA 1P3KC 2JKFA 1CK7A 2D49A 3VSLA 3VP0A 4G91C 4KG6A 3ZVWA 2JHEA 1W2EA 3X1UA 3AZNA 3AZFA 3PBSA 5CHJA 5B32G 5B1MA 4XUJB 3S7OA 3L26A 4DE2A 4YM6D 3UTAA 2IWDA 5DF8A 1M18A 1K25A 5GXQA 3N4IA 3V9RB 1CEGA 3C1BD 1BH9A 4R38A 2ZL1A 4WU8A 1VEUA 4E3LA 5EUAA 4HESA 5B32B 5FI7A 2J8YA 2J3TD 1NY0A 3A6NC 3IWIA 5FEFA 1P3OA 4Z2JA 3LZ0B 1XA1A 2KX6A 4XUJC 1ERQA 1QO6A 3LFVA 3ZG0A 3UY6A 1MWUA 5BS7C 1S1ZA 4BMWA 1U35B 5F1FA 3REIB 3UB7A 2CV5B 2HP5A 5L10A 3QP1A 2H28A 3KWQC 3LI9A 1YMXA 1OTIA 3RXWA 3NDEA 1W63M 3FKVA 3AZMA 3T4OA 5F99D 4R1GA 3MGSD 5B33D 2EFUA 5E2EA 4E3KA 5B32C 3NY4A 5DNMD 4R6LA 3T4KA 3A6NB 1XA7A 3LJAA 1XP4A 3CHWP 3GR2A 4GHIA 3W97D 3Q7VB 3UDIA 3EEHA 2WGIA 1STZA 4DE0A 3O86A 1DP9A 3IT9A 3A3JA 3H82A 4J8UC 4YM6B 4OJ6A 1M1AA 5JA4A 1GSWA 4CJNA 5CPKC 1IYQA 4DJ3A 3FPWA 4RQ9A 3AZKB 4JLFA 3GTCA 2HZ5A 5DTTA 2XR0A 3C7UA 3E4PA 5HD3A 3IH8A 4Z66B 4IBBA 2VGLM 1FIKA 2EX6A 2KOIA 4IBRA 4Z66A 4GD6A 1TZYC 4GLQA 5E5AD 2GX5A 4BBTA 2OLVA 4YM6C 4L9EA 4J8XC 3AYWD 4X1LA 4NFTA 1F1EA 5EVID 3A3DA 3ZCZA 2F8NA 1ERMA 4I38A 4JKTA 4M4XA 1IOUA 1PW8A 1VHMA 5FI2A 4N1XA 4MN7A 3SW1A 2JSSA 1GHMA 2H0YA 3MGQC 4GH9A 3E2LA 3VH5W 4XUZA 1KX3C 2VGKA 5FAPA 3GECA 2M7UA 5EV0A 1GSVA 4HHDA 1P3BD 1TS8A 1P3FC 3GMWA 4S2PA 2Y2KA 3LJAB 1P3BC 2G5HC 3LR3A 4IJGA 5J3WA 1YM1A 4FD8A 4PM9A 5B0YB 4JXWA 5EM1A 4WU9B 3WS2A 4QLCB 5KDMB 4YS3D 3MZDA 2BLSA 2A49A 4D60A 2WKQA 4DE3A 5DJUA 1YQSA 1K4FA 3MGQB 5J7EA 5AV9A 1CI9A 2E8IA 2DNSA 2XROA 2WAEA 1P3PA 3TW8A 3C8CA 1QMEA 1YPRA 5EVEA 4UUZB 2W3EA 1E3UD 5EVLA 4ARZA 1H0IA 1DJBA 1KX4C 4QLCC 3EGXC 3O88A 5EVIA 3L7HA 1L6JA 3ITBA 1XJ4A 5CPID 4JXVA 2ZC5B 3DW0A 4N9LA 1EAKA 3V9RA 5HAPA 3W99D 5FUGB 4Y13A 2RVQD 1P3LD 4WU8B 1J9MA 1YT4A 5DFYA 3M7PA 3PBQA 4E45A 5GT0D 5BPVA 5FUGA 4PPRA 3UTBA 1IEMA 3TU4C 2WZXA 1KX5A 4KGCC 2W0NA 1P3IB 1ZTUA 4H9OA 1LSWA 1K55C 5CP6A 1PW1A 2C5WB 2KDKA 3QP5A 5CP6D 4U0XA 5JRGC 3N8LA 5G18A 3PBRA 4R3JA 2UWXA 3CJMA 5B24A 2J80A 5GSUD 4CLCA 5FSRA 2CV5A 1K57A 3AZHC 4C75A 5HWWA 3NC8A 1L0DA 4X23C 4FSFA 3SS4A 3DTKA 3WTPB 2BG1A 1WE4A 4Z2MG 3AZJC 1LT0A 4ZUXC 1P3AB 3B6FC 3WS5A 5B32A 3REHD 4GNUA 1BH8B 4QLCD 4GOGA 4X69A 4HP4A 5CGXA 5B0YD 3F1NB 1SDEA 2PAVP 3MS6A 4WM9A 1E88A 3AZLA 2R9XA 5B40A 4I5SA 4JJNB 3REIA 4L9GA 1JWZA 1DP8A 2Y2QA 1GA9A 3C1BA 5CPKD 4KZ9A 4ETXA 1TS6A 3SS3A 2FJ7A 3PBOA 3CI6A 4HMDA 1ZG4A 3V39A 4OQGA 4OJPA 3L25A 3NQJB 3UTBC 4ZTKA 1ZC2A 2GJ3A 5B1MD 1P3AC 3EPLA 3B6FB 1H5XA 4E3JA 4GS9A 2L5AA 4UQIM 4GW9A 1NYMA 3AV1D 5E5AB 4PKYA 3UDXA 2XEPA 2PYPA 1UR8A 2L4RA 3W96A 2XA7M 5CXWA 2HDRA 3ZGAB 2VX8A 2F8NK 1HQ3B 4K0WA 4HEFA 3W98D 2VV8A 3VV4A 4CLCB 2J7VA 1ED7A 5CPIC 5B33C 1FCMA 3AN2D 1K57C 3AZHA 1W5DA 3T1XA 5HPIA 2XFTA 5D3OA 4R4SA 4H9PB 3MSHA 1MPLA 1JNUA 3WTPD 1NLZA 3L27A 1E25A 4NYYA 1W1PA 5HD5A 3NCKA 3NQJA 1KX3A 1K54A 2HIOD 5AV8D 1P97A 1S1YA 2JKRI 4DN0A 2AROD 1GOIA 2E8JA 3UB9A 1YLYA 4DJ2A 5JA4B 1C3BA 1AOIA 4EV4A 4X25A 3WD4A 1P34A 1OJ5A 5B40B 2XSSA 3D3OA 1N4OA 4YFMA 3NI9A 5BO0B 3RJUA 4R4RA 5B33B 1E15A 4I39A 4Z2GA 2FJ7C 2ZC7A 5DNMA 4ZBJB 3NHQA 1W8YA 3DAVA 3MR0A 3AZND 3LIAA 2P7JA 3X1TC 3L9KA 2W3GA 1TVFA 2VKSA 4QU3A 4CAYA 1PI4A 1N9LA 3ISGA 1SKOB 2G2WA 3BWLA 5F82A 5E2HA 1PNEA 5HW3A 1BLCA 4M6BA 5KMWA 3HL9A 3REIC 1W79A 2F8NG 1G6AA 4HJ6A 1M19D 3UT9A 3K3DA 1ES4A 1XPBA 4EXOA 3O5YA 4Z1WA 1VQQA 3UT9D 1TDGA 1KGFA 3X1SC 4NZ4A 3RTYA 3MGQD 3R7WB 3RELC 2HF6A 2LB9A 1P3LA 3SH9A 2XA7S 2ZMFA 3HREA 2PD7A 4AWLB 4H9NA 5HDDA 4UQIS 4HY8A 4CQHA 4DQYB 4DDYA 3QNCA 4KZ4A 4PMAA 3RELD 4HGAC 4GHIB 4XUJD 4E6XA 1JFIB 3TE8A 1YSPA 3FG8A 3UT9B 5FDSA 3T50A 1WYCA 4JGQA 3GV9A 3LCEA 3C4OA 2ZY5A 4GHAA 5GSUC 3L28A 4OQIA 1PWDA 3VP4A 3NQUB 5A92A 3LY3A 4DXCA 1P3PB 3AZMC 4XZQA 4MBKA 3Q7VA 4Q0HA 1PFLA 4G92B 1HVBA 3RFBA 4J8WD 3IF5A 3WX7A 3AZNB 3X1VB 4OPQA 3S7NA 4HGAB 2Y2NA 1S4SA 2B18A 2I72A 3CAXA 4OP8A 3O62B 3CUEA 3OPRA 2L0WA 2WGWB 3G32A 2RIQA 4J8VB 2WAFA 3WAAB 5KZHA 4KHAB 3D72A 3MKEA 5B1LD 3AZED 3BFEA 3MGQA 1H3OB 2Y59A 4Y17A 1FILA 3HLCA 4MBFA 1F66D 1K4EA 3AZIC 1N1JA 3AGEA 1RGYA 4LV1A 4E44A 5AV5A 2HGVA 1KDSA 4X1MA 5C3IC 5HAIA 4X68A 2IWBA 1M18B 2J3TC 2PHYA 1UWPX 3ZNYA 3GRJA 2HIOB 5AV8B 5DNNC 4BLMA 4CPKA 5G49A 1YU0A 1HLUP 2WADA 1L3LA 4KUOA 2IOUA 4HJ4A 1WWIA 2WGVA 2PT7A 4Z5TC 1KE0A 3W96D 2EWVA 4E6WA 1PYYA 1BLSA 2X71A 3WA9A 4J8XD 4KUDA 3HLWA 2C6WB 1FR6A 4CLCD 5B2IA 2ZM5A 3WD2A 4R8PD 3D4FA 3AFAA 3MVDD 3BFCA 3EPKA 4N1HA 3GQZA 4J8WA 1TF1A 4PM5A 5HWTA 1ID3C 4UA6A 1L0FA 3B6FD 3X1UB 3AZFB 3M2KA 2GNXA 3AGDA 1KX5B 3C30A 3LELC 4FTXA 2HIOC 5AV8C 5B0ZD 1U35D 1YSQA 5CGWA 1EQZD 4LV0A 5GLBA 3T12B 5DJTA 3O62A 4B88A 2ZBBA 3UE0A 4C3QA 3IXDA 3WKJB 2V0WA 5AY8A 2I9VA 5B1LC 3BJNA 3ZG8B 3VH6T 4KZ6A 2O99A 2XDMA 3IWQA 3F1OB 3UB6A 2Y55A 2K2NA 4WBGA 1B67A 1I2WA 3B6GD 5F99A 5B2JD 3WD0A 3IF6A 4KG2A 3NQUA 1K56A 4QY5A 3OCLA 2M1CA 2VJWA 3HLBA 5FATA 4S2MA 3REHB 4LCLA 2OWHA 1P3AD 4KGCB 5AV6D 3X1UC 3AZFC 4HNBA 3LELB 4KZ8A 5GLCA 3CMZA 2NQBC 1IFQA 1L0GA 3AZLB 2HPBA 5CRFA 1EROA 1YUEA 1U60A 3KO6A 5EE8A 4IHQA 3MQLA 5F6AA 5GXQB 4F3LB 1PDCA 1RP5A 2INWA 3MMHA 2A24B 4X23B 3MNNB 3QP6A 5DTSA 4GDBA 3WTPC 3JPUA 3AZJB 3ZYTA 4KGCD 4ZUXB 4BD1A 3AV1A 3MGRA 5M19A 2ZD8A 5A8BA 4QJGA 3AZGD 5AV5B 4K0XA 4MB5A 4HJ3A 4RYEA 5B31A 2NQBB 1M1AB 2O0YA 2W3FA 5B31D 4LD9B 1B6WA 2PYRA 4GN2A 1J3WA 2XQZA 2O9AA 1A7WA 3AYWA 2O9BA 1OJGA 3BQAA 3AZMD 4FH2A 3VP2A 1S6RA 3A1KA 4Z2IA 1YKDA 1TS0A 3UE1A 3IP4C 2J3WA 3HUMA 3ZVTA 3BLSA 3B0DC 4PHTA 5CEBA 4QHCA 2BYMA 1K38A 4NKPA 3V67A 1P34B 2WKRA 3NIAA 2ZLYA 3UB5P 5FQQA 5GHZA 4LD9C 1S4RA 2OAQ1 5L09A 4OLDA 4H9QA 4YS3A 4MEZA 3ZHHA 1ZLAC 4B93A 1NZOA 5GT3D 2GZAA 4YS3B 4EERA 4HI4A 1GA0A 4MNRA 3W99C 5HL6A 3C1CA 3NBLA 1DY6A 2V8FA 1P3OC 4S2KA 2K31A 1NXYA 4WZ4A 4GJ4A 4E3NA 1P34C 3B0CW 4NE5A 1H8MA 1Z6FA 3W4QA 2ZOHA 5DKLA 3S7PA 3AN2C 1XX2A 3WAAD 3GVBA 2WGWA 3AYWC 2Y4AA 3WTPE 2FJ7B 4ZBJC 1DP6A 4P6ZS 3VMAA 4R8PA 2Y2PA 3X1TB 3REJA 4ZUXD 1OT6A 5K5BA 1P3PD 4IBKA 3ZG5A 5B0ZC 1ODVA 1P3IA 3V50A 3P09A 5L8MA 1M6KA 3OPLA 4S2IA 3AZKD 5GLAA 3Q82A 1HZOA 5CX7A 5B24D 1D06A 4UA7A 1SHVA 3A0RA 4XUXA 1MY8A 3X1SB 3ZFZA 3RELB 4RVAA 1P3KD 4WEJA 5B31G 3W97B 1FCOA 5AV6B 3M2JA 1H8PA 4WN5A 5GT0A 1F98A 5DVAA 3UMEA 5B2JC 1JWVA 4IBCA 4H9SC 2YFWB 3MGSB 3N3FA 4P6BA 5AQAA 1YU3A 4ZAMA 5AVCB 5HFOA 3KUYC 3VE3A 3GSGA 3UTAD 5LBRA 4EW7A 3UT9C 4QD4A 4HIAA 3ZNTA 1M19B 4CSRB 4KG5A 3IXBA 5GSUA 3FKEA 1ONHA 3EG5B 4P0MA 4DDSA 3CITA 4J8XA 3X1SA 4OKPA 3VH6W 1LL8A 1YLZA 4Y2FA 1N1JB 4WZ5A 2PYOB 4IBGA 4MN6A 3T4TA 1E6ZA 2Y2HA 2AROC 1KX5D 5IHVA 5FQKA 4KZ7A 1UGUA 4EU0A 3MGRC 4JXSA 3X1VC 2Q9MA 1K55A 1AWIA 5FQIA 2PR5A 5AVCC 4X53A 4N9KA 4WU9C 3MF0A 4KQOA 2WKHA 1AOIB 5DF9A 4J8VC 4I3JA 3F1OA 4Q0IA 1OTAA 3WAAC 5B40D 3W96B 3AFAB 1Y28A 2ZQAA 5TFQA 2B5RA 5CECA 3AL0C 5I5LA 1GPFA 3UPOA 1GHPA 2AROB 3KYEA 2ZMAA 5I94A 1N9BA 3KS8A 2Y2MA 5CGSA 2VZWA 1M18C 2PDRA 4JPMA 5F83A 3A1IA 1KX4D 4WJ3C 3LI8A 3UTAC 1BSGA 1EQZC 5AY8D 3HONA 4QLCA 4J8UD 3L2AA 2RL3A 4IBXA 1Y4OA 2V20A 4RA7A 1YU1A 3AZEB 5CEDA 4LD9A 2QPNA 4D2OA 4PAUA 3MQQA 1LI0A 1EI5A 5B2IB 4WU8C 3VFFA 3C1CB 1YU2A 3Q7ZA 5GT3C 3AV1B 2VK3A 4GZBA 1P9RA 2W8SA 3X1VD 3HLFA 4QNLA 1I2SA 2K7SA 4H9OB 4J8WB 4OPRA 1G68A 3QP8A 4NXBA 2JKRM 3LEQA 3P98A 1ACFA 3R45A 4UAAA 3W4OA 1CJFA 2BYMB 1XJ3A 3W98A 2V1ZA 3H82B 5U47A 3KWQA 2JC7A 3F1NA 4JXGA 5JYPA 1LI9A 2D02A 5EVIC 2WZZA 3E2KA 3KXBB 4KHAA 2NZDA 5DNMC 1BULA 5TBMB 1FOFA 2Y79A 1H3OA 3WS4A 5B2IC 3MNNA 5F99C 3IF6C 1P3GD 4JF6A 1GSXA 2B02A 1R4VA 1BTLA 1MKMA 4LRYC 3REHC 1NRFA 2KLIA 3PBNA 1KS0A 3A3EA 4QPRA 5M18A 3LELA 3AZLC 4IBJA 1EWZA 5AQ7A 2W1TB 4DRBA 4JJNC 1UR9A 5B24B 2IO5B 1MKIA 4R3AA 2XF3A 4Y0UA 2XRNA 2QZ6A 5CHMA 2HDUA 2J9PA 4FCFA 5GT3A 5HARA 1F66C 3T4LA 3UMDA 3HLEA 3AV2D 3X1TD 3O3VA 1JTDA 4DF6A 3NDGA 4UHUA 2V8CA 5E5AC 1F2KA 3KUYD 1IKIA 2HUEB 2V1AA 1M1AC 3HLGA 1MWTA 3U4LP 2PD8A 1S32B 1TZYA 3MFXA 5FL3A 5E2FA 3QHYA 5CPIB 4IUKA 1YLJA 1P3FD 2EXBA 2P74A 4NZ3A 3LZ1B 5B33A 1H0MA 4OQHA 3M6BA 3PTEA 3MGRD 3SH8A 4OOYA 5CHUA 3B0DB 5GHYA 2J8PA 3TRCA 5AVEA 1KGEA 3IS2B 1NZUA 1CI8A 1JFIA 2HDQA 4XUJA 2QJ5A 4B4ZA 3T4SA 1DJAA 1ES3A 4H9PA 4EBPA 2ZQ8A 5A91A 4S2JA 3PR6A 5FQJA 4IJFA 1TDLA 1XGIA 4MMNA 3V5MA 4Z2MH 4EQ1A 1W8QA 3LJAD 3BY8A 3TG9A 3NJAA 3LO7A 4ZDXA 4NETA 2H0TA 3NOTC 1YMSA 4OVDA 3LUQA 4BBUA 3IHAA 4MB4A 2BYKA 3G2ZA 1Z2CB 1OGBA 4JF5A 3QP2A 1KX4A 3SS5A 4DXBA 1S32A 1E3UA 5CPKB 3NULA 5BO0A 3IHBA 3AYWB 4JJND 3IXHA 4LV3A 5EPHA 3H0MC 4LD9D 4OOLA 3WA9D 4KUDD 4E3MA 5AV9D 2PYOA 1FSWA 3VOYA 3AZID 3HLDA 2V9AA 3C7VA 5AV5D 5EOEA 3MBZA 1YLTA 2Z2MB 4HBTA 1BH8A 2G7UA 4AWLC 4P6ZM 3MZEA 3T4JA 4P85A 3UE6A 5F69A 2P9VA 3BFDA 3IS2A 4NE6A 2PBYA 1GXDA 5TGFA 4X23D 2ZM8A 4C6YA 1XJ6A 4OPYA 4X23A 2CV5C 1ALQA 5FAQA 2A2LA 2CMNA 3KWQB 4HH2A 5GXQD 3LEZA 2WUQA 4NZ1A 5G4YA 1S67L 2W3HA 5GSUB 4S2NC 4XXRA 4LGWA 2ZJ9A 4JBFA 1KX3B 3MFDA 4LRZE 5CPJA 3VH5A 4E3IA 5HWVA 3AFAD 1E6NA 1WA9A 3B6FA 3W97C 1P3FB 1KU5A 4KGCA 3G6OA 3LR5A 3RXXA 1JWPA 3BFFA 5DKKA 1T1BA 5B2JB 5GL9A 5GT0B 1NYYA 3WWXA 5B0YC 3AZGA 4NY2A 2HDSA 1SZVA 3KUYB 3O62C 4MDZA 1U35A 4IUHA 5F1GA 4BBVA 3HJKA 3LIBA 3VH5T 3UPPA 2D01A 1BT5A 1ESIA 5HDSA 4ESPA 3OLOA 3WKJD 3FC7A 1YU4A 3MGPA 3AZKC 4U0TA 2JKGA 3REKA 3A0SA 2H5SA 2PR6A 2NUTC 1E6RA 3KSYA 1Z09A 4H8RA 2ZQCA 2OAP1 3X1UD 3AZFD 2DMWA 3MGSA 4NG2A 4XZQC 3X1VA 2PU2A 2WKEA 3E4QA 1JTGA 1ZHHB 1W1VA 1TZYB 1YLWA 4II7A 3VFHA 2FFYA 3EGDC 2YKFA 4HOIA 1W1YA 4J8XB 2FH5A 4PM6A 3WRZA 1KVMA 1LSXA 3BFGA 5FDHA 4OOMA 5L07A 3AFAC 1K54C 4RX2A 1T18A 5CTNA 2HP9A 4MN5A 2CWEA 3EWKA 2XFSA 4WZSB 3N7WA 5EFWA 5TJJA 4UUZA 3KYQA 1OTDA 1TAFB 1MBLA 1Q2QA 3BM6A 4IEDA 4R0QA 3REJB 1ES2A 1P3BB 5JYOA 1EQZA 3ULFA 2BYKB 4O7DA 4JGPA 2VEAA 5DTKA 4HMCA 1J7MA 1KE3A 3R4KA 5JRGB 4MCWA 3ZG9B 5B1LB 1XKZA 4R23A 4EEUA 1OMEA 2ZY2A 3UDFA 3HUOA 4ZJ1A 4S2NA 4IBFA 4GHLA 4ZJ3A 3LICA 4J8VD 2X02A 2YKHA 3REKD 2FJ7D 1MWSA 3BYDA 3N8SA 2Y2OA 2XD1A 3G34A 1CXWA 5AVBD 4TX8A 3WD1A 4LPZA 4J8WC 3FYZA 3PXPA 1TS7A 4JF4A 3BW6A 1OTBA 3T1QB 5FASA 2FN2A 2Y91A 3IBJA 3W4PA 1G6OA 1KX4B 3SZTA 1S0WA 2M7VA 5AQ9A 2HJ9C 5CPKA 3MGPC 3AZKA 5CHLB 2WKPA 1H0GA 1FCNA 3LZ1A 1OPXA 3EPJA 3DWKA 3K2NA 3MZFA 4Q0JA 4NXEA 5J4EA 3BEBA 3VP1A 3W99A 3MQ0A 2V2FF 1XGJA 3UTBB 3B33A 5EOOA 5KIZA 2GDNA 3LY4A 3H7WB 4PM8A 3A6ND 2WK0A 2XH9A 3B42A 3S7QA 4BENA 2Y2LA 3OBFA 1P3BA 5B31C 1P3IC 4BJPA 1GCEA 2XLNA 1AOID 1TZYD 4HBUA 4WNNA 1P34D 1T1CA 4DMZA 2PU4A 2X01A 3ITAA 5HSQA 3OC2A 3QNBA 4WEKA 2CV5D 4F3LA 5G4ZA 4MBHA 4OLGA 3WD3A 2OWJA 3Q1FA 4H6JB 5A90A 3O87A 1T1AA 5FEGA 2J9OA 1NWZA 5L2FA 2O9CA 3F1PA 1IYPA 5B31B 4JGRA 5B32D 3REHA 4KQQA 2UV0E 4UA9A 2FFFB 3K3CA 4UEYA 5A93A 2JBFA 3HSHA 5M1AA 5B0ZA 4BD0A 3AZGB 1XXMA 4Q8IA 2F8NH 4Y15A 1VEUB 2CC1A 4AFIA 4OH0A 3QP4A 1PZRA 3B6GC 5AQBA 3KSIA 1P3KB 1P0ZA 4YS3C 4MLLA 5AV9C 1CQAA 4FUWA 3AZIA 1ZG6A 3A6NA 4IVKA 5B1MC 4WLAA 3C5AA 1MC0A 1P3OB 4B9OA 3BRMA 5E5AA 3S22A 3CUEC 5CPIA 2QWSA 1F5MA 1PWGA 3AN2B 5KSCA 1HQ3C 2W1TA 2Y2IA 4CLCC 1TD5A 4BL2A 4EQIA 2ZC3B 3IX4A 1K0KA 1HQ3D 1MXOA 3LR0A 1YLPA 5AVBB 3B6GB 3MVDC 4R8PC 4NYUA 5AV9B 3BECA 3OOVA 4G3VA 3R45B 1KDWA 4GCZA 5B1MB 1AIWA 3KSGA 1AXBA 2XK1A 2Y8HA 1WYBA 3PAEA 3V3RA 3ZDJA 2G5IC 3LZ0C 3HVFA 4N92A 4O0PA 4F94A 3PAGA 5JRGD 5B0ZB 3EPHA 2NZDB 3MXSA 5JRGA 1P3MD 2YFVB 1BUEA 5B40C 4L0LA 5B1LA 2R78A 1PWCA 1Q9CA 2VLGA 4KZAA 5AVBC 3MVDB 1O07A 3AZJA 4R8PB 1HD8A 3T4QA 4OONA 1ID3A 4G92C 5AV6C 3G4PA 5B2JA 1TEMA 1DRMA 1Y54A 4WF0A 1IKGA 3AZNC 1PZOA 4YWZA 3DTEA 1T3UA 1I5QA 3ICYA 1XJ2A 2NZDC 1V9ZA 4KZ3A 1M18D 1HTAA 4NE3A 5HL1A 3MGPD 1FQGA 4LENA 4OUIA 2VQRA 5F5YA 3SOIA 1P3MB 3CG5A 2ZM0A 4OJLA 2NZDD 3LZ1D 3OZHA 1G5UA 3TOIA 2ZY4A 2PYOC 3B3XA 3WTPA 1P3AA 4IVIA 4Y3IA 3LYXA 2H10A 5CTMA 4Z66C 3Q07A 5C3IB 1YAXA 3TU4D 4EWFA 2F2AC 3AV2A 5DNNB 3JYIA 4YM6A 1RGZA 4EUZA 5AVCA 3KS4A 5GT0C 2DF4C 4U3TA 3H0RC 1BYWA 1NLYA 3DTMA 1AOIC 3LGOA 3KUYA 5BNXA 4Z5TB 4RX3A 3W8KA 2JN7A 4R70A 1JVJA 3DWZA 3W96C 4FH4A 1CEFA 2Y2JA 3IBRA 4A5RA 3AZJD 1P3GC 3UNWA 4J8VA 4NXFA 1P3FA 3C38A 1KX3D 1K56D 3IH9A 4LRXC 3MNND 1P3PC 4IBIA 2BASA 1ID3B 3FKWA 4EUVA 3W97A 2LB5A 4H9NB 3LJAC 1OTEA 3F1PB 3AZLD 5BOHA 2P08A 3N6IA 1ZLAA 2V1BA 3LELD 3N8RA 3AZEC 3FZCA 5E43A 1WWSA 3MXQA 4XT2A 5BS7A 2QJ7A 3H9WA 2EX9A 1VETA 1P3GB 4HP9A 3JVVA 3AZIB 1VB6A 4EESA 1F66A 4BL3A 3TU4A 2EA9A 1O6IA 3VOLA 3D9YA 4XZQD 1VM1A 3AV2C 3X1TA 2V5OA 2Q9NA 4WELA 5BT1C 3OCNA 2A3UA 4PKYG 1M19A 4EBNA 4YINA 4BQMA 3PBTA 4GD8A 5EVIB 2OOLA 2XGNA 1BLHA 2F8NB 4NZ5A 4Z2HA 2HP6A 3MNNC 1P3GA 4HMEA 3C1CD 5B2ID 4IJEA 3FV7A 4B4XA 3VOZA 2ACGA 3WRTA 3H0LC 2QYBA 4DKIA 3C2WA 3CWFA 1UWNX 5J8XA 3P5JB 4CAYB 2G2UA 1FR1A 4Z66D 4ZBEA 5HAQA 4GB7A 1KX5C 5FAOA 1H8YA 1V9YA 5IS1A 4LG2A 1OGGA 1O7EA 3DBAA 3VP3A 1PRQA 2IO5C 4R3BA 1P3MA 4X6TA 2ZL1B 1SCWA 3P01A 2ZQ9A 3W2ZA 1P9WA 3AGFA 5CERA 5IT5A 4H9RB 4UPKA 4G3WA 5TBMA 5AVBA 4MB3A 3B47A 4X56A 1F66B 1ESUA 1ES5A 2VGJA 2QKPA 5HPFA 2OV5A 3PHYA 5F68A 2ZC4B 3ZQ5A 1S32D 2ZQ7A 4DRAA 3G2YA 1ONGA 3FWLA 4OQ0A 1S32C 2XD5A 5HDCA 1W1TA 5G49B 3C1BC 2F8ND 4QWOA 3REKB 1XFNA 4H9QB 3Q81A 3IQAA 3B0CT 2HV1A 4K08A 1ZLAB 2PYOD 3REID 3HBRA 3OPHA 4H9RA 4Y0OA 3LZ1C 1P3KA 5FQMA 3LZ0D 3LIFA 3MQOA 1LL5A 4K91A 4QB8A 3MXRA 3REJD 5FQ9A 5DNNA 3IWOA 5KDMA 3HUNA 3I7JA 4CLCE 4ETZA 3ZG7B 3TJZC 5CP6C 1N9OA 5AV5C 1K6RA 3KX0X 5EM0A 5AVCD 4Y7PA 4O01A 4S2LA 4QY6A 2PRFA 3C1BB 2VV7A 3REKC 4Z5TA 5BNXB 4OJ5A 3FDDA 1GHIA 4KENB 3R7WA 3A3FA 1TAFA 3KSFA 4OPZA 1SDNA 2P04A 5FA7A 3BY9A 3DTIA 2EX8A 3F6TA 4WZ5C 2DCFA 1OT9A 5EECA 4ZUXA 4NK3A 3E4OA 5C5KA 3UPNA 2HIOA 5AV8A 2PBDP 1ID3D 2OLUA 4WYYA 2QHKA 4OP5A 5CP6B 1LLBA 5AY8C 4FOFA 4WU9A 1U35C 3IX3A 4GKUA 3M6HA 1KOUA 2EXAA 1ZLAD 3AZEA 1PIOA 1D1JA 2Z6DA 2FZ0A 3TSGA 2WYXA 1ZKJA 2ZQDA 2AVXA 4DRTA 3CPTB 2W27A 3B6GA 4WU8D 3S4XA 4GDNA 1VETB 4H6JA 3W99B 4M3KA 2ZM2A 3BLMA 5DNND 1PZPA 3E0YA 1D7EA 2WKIA 4HQAA 3UO9A 3W98C 1SKFA 3EQUA 4Z2KA 2YFWA 4ZJ2A 3E98A 4J8UB 4EBLA 1MZUA 5AY8B 4LV2A 3A0VA 3L29A 1NJ4A 3MJQA 1HQ3A 3NECA 1M19C 5HX9A 3KWQD 4NXGA 5TR7A 1KVLA 2DQNC 1BFMA 3VH6A 1BLPA 4LFUA 1E6PA 4OJOA 3SH7A 3BQ8A 3T1SA 3GDIA 1NRJA 2B95A 5BNVB 4EO5C 3VSKA 4BWIA 3IX8A 2L1MA 4O8GA 5E2GA 4Y5FA 5AJGA 4JGOA 3W98B 3LR4A 1RCJA 4WU9D 1HTZA 3H7WA 2RTSA 5GHXA 2EFXA 3CZDA 4ZRRA 3WA9B 4KUDB 1EW0A 2Z6CA 3AZHD 2R9WA 1LHYA 3LIEA 3WKJA 3KFUG 5HZHA 5GLDA 3NOUC 1P3MC 2V0UA 1XFQA 4I3IA 2QMIA 3OPPA 1N9NA 1H8ZA 3G31A 3WS1A 1IYSA 1DJCA 3AZMB 3A3IA 5AV6A 4EO5B 1KE4A 4XZQB 4KUKA 5IU1A 3UTAB 1M40A 4IBEA 3MKFA 1A0KA 1M1AD 3MGSC 2OSUA 2NQBD 4WMCA 3WA9C 4KUDC 2Z2LB 3AN2A 3U2AA 1IYOA 3T1RA 4EEPA 2JCHA 1MWRA 4ID4A 3C1CC 2ZOIA 2RVQC 1P3LC 3X1SD 4KQDA 1LSVA 5DF7A 3CPTA 5KSHA 2VA0A 3B0BA 4LLOB 1P3OD 2JE5A 4L9FA 3S1YA 3HCYA 3REJC 4KZBA 3MGRB 1SKOA 3EQVA 2Q0OA 4Y0TA 5MC7A 2Y2GA 3WAAA 1E4DA 3WS0A 2ZY3A 4PM7A 1P3ID 3PYPA 3HJIA 2A24A 1T19A 5DNMB 2MJ6A 3KXBA 4XT2B 4G3KA 2JKTI 1BH9B 4Z5TD 3JVUA 4E04A 2VGLS 3CLOA 5F99B 2IWCA 3IF6B 4YOFA 2EWWA 4IBDA 1P3LB 3LIDA 4EETB 3P7NA 4Z2LA 3TU4B 3RELA 4P87A 4YNRA 3AV2B 2NQBA 4WMCD 2YFVA 3EOIA 3G35A 3G30A 1EQZB 3FPVA 4KQRA 4WL9A 2W1RA 1F9IA 3WKJC 2NUPC 5B24C 2JKTM 1X0OA 3MGPB 2VV6A 4Z9QA 3AZHB 2ZMVA 5AVFA 4DE1A 4KZ5A 2RCXA 3VE4A 4JJNA 1K6SA 5GT3B 2ZC6B 5FI6A 3AV1C 1IELA 3LZ0A 4I3AA 3UTBD 1BZAA 2HJEA 1W63Q 3C4PA 2EX2A 4S2OA 1S66L 2HUEC 4H9SA 4GS9B 3UE3A 5BT1D 3RH8B 4ARZB 3KSHA 1FSYA 3NOPC 5DFXA 5GXQC 3IXGA 3UB8A 3KXBD 5CPJC 1QMFA 1CF0A 3KXBC 1ULYA 1CK3A 3MVDA 4LCMA 5BNVA 1LL9A 3UN7A 1H3QA 4G91B 5CPJD 1E8BA 3KYZA 2BTFP 4ME4A 2P9VB 1Q2PA 1L2SA 1W7FA
chains in the Genus database with same CATH topology
2AROA 4WNNB 3O62D 1L0EA 3V3SA 4X55A 4E3OA 4WV4B 5B0YA 3AZGC 4J8UA 2LY8A 1KGGA 5CPJB 2DRWA 1PI5A 4CSRA 1P3KC 3VSLA 3VP0A 4G91C 4KG6A 3ZVWA 1W2EA 3X1UA 3AZNA 3AZFA 3PBSA 5CHJA 5B32G 5B1MA 4XUJB 3L26A 4DE2A 4YM6D 3UTAA 2IWDA 5DF8A 1M18A 1K25A 5GXQA 3N4IA 3V9RB 1CEGA 3C1BD 1BH9A 4WU8A 4E3LA 5EUAA 4HESA 5B32B 5FI7A 2J8YA 1NY0A 3A6NC 3IWIA 1P3OA 3LZ0B 1XA1A 4XUJC 1ERQA 3ZG0A 3UY6A 1MWUA 5BS7C 5F1FA 1U35B 3REIB 2CV5B 2HP5A 3KWQC 1YMXA 3RXWA 3NDEA 3FKVA 3AZMA 5F99D 4R1GA 3MGSD 5B33D 2EFUA 5E2EA 4E3KA 5B32C 3NY4A 5DNMD 3A6NB 1XA7A 3LJAA 1XP4A 3GR2A 3UDIA 3W97D 3Q7VB 2WGIA 4DE0A 3O86A 3IT9A 3A3JA 4J8UC 4YM6B 4OJ6A 1M1AA 5JA4A 4CJNA 5CPKC 1IYQA 3AZKB 4JLFA 3GTCA 5DTTA 2XR0A 3C7UA 3IH8A 4Z66B 4IBBA 2EX6A 4IBRA 4Z66A 4GD6A 1TZYC 5E5AD 2OLVA 4YM6C 4J8XC 3AYWD 4NFTA 1F1EA 5EVID 3A3DA 3ZCZA 2F8NA 1ERMA 4JKTA 1PW8A 5FI2A 4N1XA 2JSSA 1GHMA 2H0YA 3MGQC 4GH9A 3E2LA 3VH5W 4XUZA 1KX3C 2VGKA 5FAPA 1P3BD 1P3FC 3GMWA 4S2PA 2Y2KA 3LJAB 1P3BC 2G5HC 1YM1A 4FD8A 4PM9A 5B0YB 4JXWA 4WU9B 3WS2A 4QLCB 5KDMB 4YS3D 3MZDA 2BLSA 2A49A 4DE3A 1YQSA 1K4FA 3MGQB 5AV9A 1CI9A 2E8IA 2DNSA 2WAEA 1P3PA 1QMEA 4UUZB 1E3UD 5EVLA 1DJBA 1KX4C 4QLCC 3O88A 5EVIA 3ITBA 5CPID 4JXVA 2ZC5B 3DW0A 4N9LA 3V9RA 5HAPA 3W99D 5FUGB 2RVQD 1P3LD 4WU8B 1J9MA 1YT4A 3PBQA 4E45A 5GT0D 5BPVA 5FUGA 4PPRA 3UTBA 1IEMA 3TU4C 2WZXA 1KX5A 4KGCC 1P3IB 4H9OA 1K55C 5CP6A 1PW1A 2C5WB 4U0XA 5CP6D 5JRGC 3N8LA 5G18A 3PBRA 4R3JA 2UWXA 3CJMA 5B24A 5GSUD 5FSRA 2CV5A 1K57A 3AZHC 4C75A 3NC8A 1L0DA 4X23C 4FSFA 3SS4A 3WTPB 2BG1A 1WE4A 4Z2MG 3AZJC 4ZUXC 1P3AB 3B6FC 3WS5A 5B32A 3REHD 4GNUA 1BH8B 4QLCD 4GOGA 4X69A 5CGXA 5B0YD 1SDEA 4WM9A 3AZLA 2R9XA 5B40A 4JJNB 3REIA 1JWZA 2Y2QA 1GA9A 3C1BA 5CPKD 4KZ9A 3SS3A 2FJ7A 3PBOA 1ZG4A 3V39A 4OQGA 4OJPA 3L25A 3NQJB 3UTBC 4ZTKA 1ZC2A 5B1MD 1P3AC 3EPLA 3B6FB 1H5XA 4E3JA 2L5AA 1NYMA 3AV1D 5E5AB 3UDXA 2XEPA 5CXWA 3W96A 2HDRA 3ZGAB 2F8NK 1HQ3B 4K0WA 4HEFA 3W98D 2J7VA 5CPIC 5B33C 1FCMA 3AN2D 1K57C 3AZHA 1W5DA 2XFTA 5D3OA 4R4SA 4H9PB 1MPLA 3WTPD 3L27A 1E25A 4NYYA 3NCKA 3NQJA 1KX3A 1K54A 2HIOD 5AV8D 2AROD 1YLYA 5JA4B 1C3BA 1AOIA 4EV4A 1P34A 5B40B 1N4OA 4YFMA 3NI9A 5BO0B 3RJUA 4R4RA 5B33B 2FJ7C 2ZC7A 5DNMA 4ZBJB 1W8YA 3AZND 3X1TC 1TVFA 4QU3A 4CAYA 1PI4A 3ISGA 5F82A 2G2WA 5E2HA 5HW3A 1BLCA 4M6BA 5KMWA 3HL9A 3REIC 1W79A 2F8NG 1G6AA 1M19D 3UT9A 1ES4A 1XPBA 1VQQA 3UT9D 1TDGA 1KGFA 3X1SC 4NZ4A 3MGQD 3RELC 1P3LA 3SH9A 3HREA 4AWLB 4H9NA 4DQYB 4DDYA 3QNCA 4KZ4A 4PMAA 3RELD 4HGAC 4XUJD 4E6XA 1JFIB 3UT9B 1WYCA 3GV9A 3LCEA 3C4OA 2ZY5A 4GHAA 5GSUC 3L28A 4OQIA 1PWDA 3VP4A 3NQUB 5A92A 3LY3A 4DXCA 1P3PB 3AZMC 4XZQA 4MBKA 3Q7VA 4G92B 1HVBA 4J8WD 3IF5A 3WX7A 3AZNB 3X1VB 4OPQA 4HGAB 2Y2NA 2I72A 4OP8A 3O62B 3OPRA 2WGWB 3G32A 2RIQA 4J8VB 2WAFA 3WAAB 5KZHA 4KHAB 3MKEA 5B1LD 3AZED 3BFEA 3MGQA 1H3OB 2Y59A 4MBFA 3HLCA 1F66D 1K4EA 3AZIC 1N1JA 3AGEA 1RGYA 4LV1A 4E44A 5AV5A 1KDSA 5C3IC 5HAIA 4X68A 2IWBA 1M18B 3ZNYA 3GRJA 2HIOB 5AV8B 5DNNC 4BLMA 4CPKA 5G49A 1YU0A 2WADA 2IOUA 1WWIA 2WGVA 4Z5TC 1KE0A 3W96D 4E6WA 1PYYA 2X71A 1BLSA 3WA9A 4J8XD 4KUDA 3HLWA 2C6WB 1FR6A 5B2IA 2ZM5A 4R8PD 3D4FA 3AFAA 3MVDD 3BFCA 3EPKA 4N1HA 3GQZA 4J8WA 4PM5A 1ID3C 4UA6A 1L0FA 3B6FD 3X1UB 3AZFB 3M2KA 3AGDA 1KX5B 3LELC 2HIOC 5AV8C 5B0ZD 1U35D 5CGWA 1EQZD 4LV0A 5GLBA 3O62A 4B88A 3UE0A 4C3QA 3IXDA 3WKJB 5AY8A 5B1LC 3ZG8B 3VH6T 4KZ6A 2XDMA 3IWQA 2Y55A 4WBGA 1B67A 1I2WA 3B6GD 5F99A 5B2JD 3IF6A 4KG2A 4QY5A 3NQUA 1K56A 3OCLA 3HLBA 5FATA 4S2MA 3REHB 4LCLA 1P3AD 4KGCB 5AV6D 3X1UC 3AZFC 5GLCA 3LELB 4KZ8A 3CMZA 2NQBC 1L0GA 3AZLB 2HPBA 5CRFA 1EROA 1YUEA 1U60A 5EE8A 5GXQB 1RP5A 4X23B 3MNNB 5DTSA 4GDBA 3WTPC 3AZJB 4KGCD 4ZUXB 4BD1A 3AV1A 3MGRA 5M19A 2ZD8A 4QJGA 3AZGD 5AV5B 4K0XA 4RYEA 5B31A 2NQBB 1M1AB 5B31D 4LD9B 1B6WA 4GN2A 2XQZA 1A7WA 3AYWA 3AZMD 4FH2A 3VP2A 1S6RA 3A1KA 3UE1A 3IP4C 3ZVTA 3HUMA 3BLSA 3B0DC 5CEBA 4QHCA 2BYMA 1K38A 1P34B 3NIAA 2ZLYA 5FQQA 5GHZA 4LD9C 4OLDA 4H9QA 4YS3A 4MEZA 3ZHHA 1ZLAC 1NZOA 5GT3D 4YS3B 1GA0A 4MNRA 3W99C 3C1CA 3NBLA 1DY6A 1P3OC 4S2KA 1NXYA 4WZ4A 4E3NA 1P34C 3B0CW 4NE5A 1Z6FA 3W4QA 3AN2C 1XX2A 3WAAD 3GVBA 2WGWA 3AYWC 2Y4AA 3WTPE 2FJ7B 4ZBJC 3VMAA 4R8PA 2Y2PA 3X1TB 3REJA 4ZUXD 1P3PD 4IBKA 3ZG5A 5B0ZC 1P3IA 3V50A 3P09A 1M6KA 3OPLA 4S2IA 3AZKD 5GLAA 3Q82A 1HZOA 5B24D 4UA7A 1SHVA 4XUXA 1MY8A 3X1SB 3ZFZA 3RELB 4RVAA 1P3KD 4WEJA 5B31G 3W97B 1FCOA 5AV6B 3M2JA 5GT0A 5DVAA 5B2JC 1JWVA 4IBCA 4H9SC 2YFWB 3MGSB 3N3FA 4P6BA 5AQAA 1YU3A 4ZAMA 5AVCB 5HFOA 3KUYC 3GSGA 3UTAD 3UT9C 4QD4A 3ZNTA 1M19B 4CSRB 4KG5A 3IXBA 5GSUA 3FKEA 1ONHA 3EG5B 4P0MA 4DDSA 4J8XA 3X1SA 4OKPA 3VH6W 1YLZA 1N1JB 4WZ5A 2PYOB 4IBGA 2Y2HA 2AROC 1KX5D 5IHVA 5FQKA 4KZ7A 4JXSA 3MGRC 3X1VC 2Q9MA 1K55A 5FQIA 5AVCC 4X53A 4N9KA 4WU9C 4KQOA 2WKHA 1AOIB 5DF9A 4J8VC 3WAAC 5B40D 3W96B 3AFAB 2ZQAA 5TFQA 2B5RA 5CECA 3AL0C 3UPOA 1GHPA 2AROB 5I94A 2ZMAA 1N9BA 3KS8A 2Y2MA 5CGSA 1M18C 4JPMA 5F83A 3A1IA 1KX4D 4WJ3C 3UTAC 1BSGA 1EQZC 5AY8D 3HONA 4QLCA 4J8UD 3L2AA 2RL3A 4IBXA 2V20A 4RA7A 1YU1A 3AZEB 5CEDA 4LD9A 2QPNA 4D2OA 1LI0A 1EI5A 5B2IB 4WU8C 3VFFA 3Q7ZA 3C1CB 1YU2A 5GT3C 3AV1B 4GZBA 2W8SA 3X1VD 3HLFA 4QNLA 1I2SA 4OPRA 4H9OB 4J8WB 1G68A 3P98A 3R45A 4UAAA 3W4OA 2BYMB 2V1ZA 3W98A 5U47A 3KWQA 2JC7A 4JXGA 5JYPA 1LI9A 5EVIC 2WZZA 3E2KA 3KXBB 4KHAA 2NZDA 5DNMC 1BULA 1FOFA 1H3OA 3WS4A 5B2IC 3MNNA 5F99C 3IF6C 1P3GD 4JF6A 1R4VA 1BTLA 3REHC 1NRFA 3PBNA 3A3EA 5M18A 3LELA 3AZLC 4IBJA 1EWZA 5AQ7A 4DRBA 4JJNC 5B24B 2IO5B 1MKIA 2XF3A 4Y0UA 2QZ6A 5CHMA 2HDUA 2J9PA 4FCFA 5GT3A 5HARA 1F66C 3HLEA 3AV2D 3X1TD 3O3VA 1JTDA 4DF6A 3NDGA 4UHUA 5E5AC 3KUYD 1IKIA 2HUEB 1M1AC 3HLGA 1MWTA 1S32B 1TZYA 5E2FA 3QHYA 5CPIB 1YLJA 1P3FD 2EXBA 2P74A 4NZ3A 3LZ1B 5B33A 4OQHA 3M6BA 3PTEA 3MGRD 3SH8A 4OOYA 5CHUA 3B0DB 5GHYA 2J8PA 1KGEA 1NZUA 1CI8A 1JFIA 2HDQA 4XUJA 4B4ZA 1DJAA 1ES3A 4H9PA 4EBPA 2ZQ8A 5A91A 4S2JA 5FQJA 4IJFA 1TDLA 1XGIA 3V5MA 4Z2MH 1W8QA 3LJAD 3TG9A 3LO7A 4ZDXA 4NETA 2H0TA 1YMSA 4OVDA 3IHAA 2BYKA 3G2ZA 1Z2CB 4JF5A 1KX4A 3SS5A 4DXBA 1S32A 1E3UA 5CPKB 5BO0A 3IHBA 3AYWB 4JJND 3IXHA 4LV3A 5EPHA 3H0MC 4LD9D 4OOLA 3WA9D 4KUDD 4E3MA 5AV9D 2PYOA 1FSWA 3VOYA 3AZID 3HLDA 3C7VA 5AV5D 5EOEA 3MBZA 1YLTA 2Z2MB 4HBTA 1BH8A 4AWLC 3MZEA 4P85A 2P9VA 3BFDA 4NE6A 2PBYA 5TGFA 4X23D 2ZM8A 4C6YA 4OPYA 4X23A 2CV5C 1ALQA 5FAQA 3KWQB 5GXQD 3LEZA 2WUQA 4NZ1A 4S2NC 5GSUB 4XXRA 2ZJ9A 4JBFA 1KX3B 3MFDA 5CPJA 3VH5A 4E3IA 3AFAD 3B6FA 3W97C 1P3FB 1KU5A 4KGCA 3RXXA 1JWPA 3BFFA 5B2JB 5GL9A 5GT0B 1NYYA 3WWXA 5B0YC 3AZGA 4NY2A 2HDSA 3KUYB 3O62C 1U35A 5F1GA 3VH5T 3UPPA 1BT5A 1ESIA 3WKJD 1YU4A 3MGPA 3AZKC 4U0TA 3REKA 2H5SA 3KSYA 4H8RA 2ZQCA 3X1UD 3AZFD 3MGSA 4XZQC 3X1VA 2PU2A 2WKEA 1JTGA 1TZYB 1YLWA 3VFHA 2FFYA 4J8XB 4PM6A 3WRZA 1KVMA 5FDHA 3BFGA 4OOMA 3AFAC 1K54C 4RX2A 5CTNA 2HP9A 2CWEA 2XFSA 4WZSB 3N7WA 4UUZA 1TAFB 1MBLA 1Q2QA 3BM6A 4IEDA 4R0QA 3REJB 1ES2A 1P3BB 5JYOA 1EQZA 2BYKB 4O7DA 5DTKA 1KE3A 5JRGB 3ZG9B 5B1LB 1XKZA 4R23A 1OMEA 2ZY2A 3UDFA 3HUOA 4ZJ1A 4S2NA 4IBFA 4GHLA 4ZJ3A 4J8VD 2X02A 3REKD 2FJ7D 1MWSA 3BYDA 3N8SA 2Y2OA 2XD1A 3G34A 5AVBD 4J8WC 3FYZA 4JF4A 5FASA 2Y91A 3W4PA 1KX4B 1S0WA 5AQ9A 5CPKA 3MGPC 3AZKA 5CHLB 1FCNA 3LZ1A 3EPJA 3DWKA 3MZFA 3BEBA 3VP1A 3W99A 2V2FF 1XGJA 3UTBB 5EOOA 2GDNA 3LY4A 4PM8A 3A6ND 2WK0A 2XH9A 4BENA 2Y2LA 1P3BA 5B31C 1P3IC 4BJPA 1GCEA 2XLNA 1AOID 1TZYD 4HBUA 4WNNA 1P34D 2PU4A 2X01A 3ITAA 3OC2A 3QNBA 4WEKA 2CV5D 4MBHA 4OLGA 3Q1FA 5A90A 3O87A 2J9OA 5L2FA 1IYPA 5B31B 5B32D 3REHA 4KQQA 4UA9A 2FFFB 5A93A 2JBFA 3HSHA 5M1AA 5B0ZA 4BD0A 3AZGB 1XXMA 4Q8IA 2F8NH 2CC1A 4OH0A 1PZRA 3B6GC 5AQBA 1P3KB 4YS3C 4MLLA 5AV9C 3AZIA 1ZG6A 3A6NA 4IVKA 5B1MC 3C5AA 1P3OB 3BRMA 5E5AA 3S22A 5CPIA 1PWGA 3AN2B 5KSCA 1HQ3C 2Y2IA 4BL2A 4EQIA 2ZC3B 1HQ3D 1MXOA 1YLPA 5AVBB 3B6GB 3MVDC 4R8PC 4NYUA 5AV9B 3BECA 3R45B 1KDWA 5B1MB 1AXBA 2XK1A 1WYBA 3PAEA 3V3RA 3ZDJA 2G5IC 3LZ0C 3HVFA 4N92A 4F94A 3PAGA 5JRGD 5B0ZB 3EPHA 2NZDB 3MXSA 5JRGA 1P3MD 2YFVB 1BUEA 5B40C 4L0LA 5B1LA 1PWCA 1Q9CA 4KZAA 5AVBC 3MVDB 1O07A 3AZJA 4R8PB 1HD8A 4OONA 1ID3A 4G92C 5AV6C 3G4PA 5B2JA 1TEMA 1Y54A 1IKGA 3AZNC 1PZOA 1T3UA 1I5QA 2NZDC 4KZ3A 1M18D 1HTAA 4NE3A 5HL1A 3MGPD 1FQGA 4LENA 4OUIA 2VQRA 3SOIA 1P3MB 3CG5A 2ZM0A 4OJLA 2NZDD 3LZ1D 3OZHA 3TOIA 2ZY4A 2PYOC 3B3XA 4IVIA 3WTPA 1P3AA 2H10A 5CTMA 4Z66C 3Q07A 5C3IB 3TU4D 4EWFA 2F2AC 3AV2A 5DNNB 3JYIA 4YM6A 1RGZA 4EUZA 5AVCA 3KS4A 5GT0C 2DF4C 4U3TA 3H0RC 3DTMA 1AOIC 3KUYA 5BNXA 4Z5TB 4RX3A 3W8KA 1JVJA 3DWZA 3W96C 4FH4A 1CEFA 2Y2JA 4A5RA 3AZJD 1P3GC 3UNWA 4J8VA 1P3FA 1KX3D 1K56D 3IH9A 3MNND 1P3PC 4IBIA 1ID3B 3FKWA 3W97A 4H9NB 3LJAC 3AZLD 5BOHA 3N6IA 1ZLAA 3LELD 3N8RA 3AZEC 3FZCA 5E43A 1WWSA 5BS7A 2EX9A 1P3GB 3AZIB 1F66A 4BL3A 3TU4A 4XZQD 1VM1A 3AV2C 3X1TA 2Q9NA 4WELA 5BT1C 3OCNA 2A3UA 1M19A 4EBNA 4YINA 4BQMA 3PBTA 4GD8A 5EVIB 2XGNA 1BLHA 2F8NB 4NZ5A 2HP6A 3MNNC 1P3GA 3C1CD 5B2ID 4IJEA 3FV7A 4B4XA 3VOZA 3WRTA 3H0LC 4DKIA 5J8XA 3P5JB 4CAYB 2G2UA 1FR1A 4Z66D 4ZBEA 5HAQA 4GB7A 1KX5C 5FAOA 1H8YA 4LG2A 1O7EA 3VP3A 2IO5C 4R3BA 1P3MA 4X6TA 1SCWA 2ZQ9A 3AGFA 5CERA 4H9RB 4UPKA 5AVBA 4X56A 1F66B 1ESUA 1ES5A 2VGJA 2OV5A 2ZC4B 1S32D 2ZQ7A 4DRAA 3G2YA 1ONGA 3FWLA 4OQ0A 1S32C 2XD5A 5G49B 3C1BC 2F8ND 3REKB 3Q81A 4H9QB 3IQAA 3B0CT 1ZLAB 2PYOD 3REID 3HBRA 3OPHA 4H9RA 4Y0OA 3LZ1C 1P3KA 5FQMA 3LZ0D 1LL5A 4K91A 4QB8A 3MXRA 3REJD 5FQ9A 5DNNA 3IWOA 5KDMA 3HUNA 3I7JA 3ZG7B 5CP6C 5AV5C 1K6RA 5AVCD 4Y7PA 4S2LA 4QY6A 3C1BB 3REKC 4Z5TA 5BNXB 4OJ5A 3FDDA 1GHIA 4KENB 3A3FA 1TAFA 4OPZA 1SDNA 5FA7A 2EX8A 3F6TA 4WZ5C 2DCFA 5EECA 4ZUXA 4NK3A 3UPNA 2HIOA 5AV8A 1ID3D 2OLUA 4WYYA 4OP5A 5CP6B 1LLBA 5AY8C 4WU9A 1U35C 4GKUA 3M6HA 2EXAA 1ZLAD 3AZEA 1PIOA 3TSGA 2WYXA 1ZKJA 2ZQDA 4DRTA 3B6GA 4WU8D 3S4XA 4GDNA 3W99B 4M3KA 2ZM2A 3BLMA 5DNND 1PZPA 2WKIA 3UO9A 3W98C 1SKFA 3EQUA 2YFWA 4ZJ2A 4J8UB 4EBLA 5AY8B 4LV2A 3L29A 1NJ4A 1HQ3A 1M19C 5HX9A 3KWQD 5TR7A 1KVLA 2DQNC 1BFMA 3VH6A 1BLPA 4OJOA 3SH7A 5BNVB 4EO5C 3VSKA 5E2GA 3W98B 1RCJA 4WU9D 1HTZA 5GHXA 2EFXA 3CZDA 3WA9B 4KUDB 3AZHD 2R9WA 1LHYA 3WKJA 3KFUG 5GLDA 1P3MC 2QMIA 3OPPA 1H8ZA 3G31A 3WS1A 1IYSA 1DJCA 3AZMB 3A3IA 5AV6A 4EO5B 1KE4A 4XZQB 3UTAB 1M40A 4IBEA 3MKFA 1M1AD 3MGSC 2OSUA 2NQBD 4WMCA 3WA9C 4KUDC 2Z2LB 3AN2A 1IYOA 2JCHA 1MWRA 4ID4A 3C1CC 2RVQC 1P3LC 3X1SD 5DF7A 5KSHA 3B0BA 1P3OD 2JE5A 3S1YA 3REJC 4KZBA 3MGRB 4Y0TA 3EQVA 2Y2GA 3WAAA 1E4DA 3WS0A 2ZY3A 4PM7A 1P3ID 5DNMB 3KXBA 1BH9B 4Z5TD 5F99B 2IWCA 3IF6B 4IBDA 1P3LB 3TU4B 3RELA 4P87A 3AV2B 2NQBA 4WMCD 2YFVA 3G35A 3G30A 1EQZB 4KQRA 3WKJC 5B24C 3MGPB 4Z9QA 3AZHB 4DE1A 4KZ5A 2RCXA 4JJNA 1K6SA 5GT3B 2ZC6B 5FI6A 3AV1C 1IELA 3LZ0A 3UTBD 1BZAA 3C4PA 2EX2A 4S2OA 2HUEC 4H9SA 3UE3A 5BT1D 1FSYA 5GXQC 3IXGA 3KXBD 5CPJC 1QMFA 3KXBC 1ULYA 1CK3A 3MVDA 4LCMA 5BNVA 1LL9A 3UN7A 4G91B 5CPJD 2P9VB 1Q2PA 1L2SA 1W7FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L0E A;  2Y2N A;  2I72 A;  4U3T A;  3V3S A;  4X55 A;  1IKI A;  4OP8 A;  3HLG A;  1MWT A;  3DTM A;  4E3O A;  3OPR A;  2WGW B;  3G32 A;  4RX3 A;  3W8K A;  5E2F A;  2WAF A;  3QHY A;  1KGG A;  1JVJ A;  5KZH A;  3DWZ A;  3MKE A;  1YLJ A;  2DRW A;  4FH4 A;  1PI5 A;  1CEF A;  2Y2J A;  2EXB A;  3BFE A;  4A5R A;  3UNW A;  2Y59 A;  2P74 A;  4MBF A;  3HLC A;  1K4E A;  3AGE A;  1K56 D;  4OQH A;  3IH9 A;  3M6B A;  1RGY A;  3PTE A;  4LV1 A;  3VSL A;  3VP0 A;  3FKW A;  3SH8 A;  4OOY A;  1KDS A;  5CHU A;  4KG6 A;  3ZVW A;  5HAI A;  4X68 A;  2IWB A;  3ZNY A;  5CHJ A;  3PBS A;  3GRJ A;  5GHY A;  4BLM A;  4CPK A;  1KGE A;  2WAD A;  4DE2 A;  2IWD A;  1NZU A;  5DF8 A;  1CI8 A;  5BOH A;  3N6I A;  1K25 A;  3N8R A;  2HDQ A;  2WGV A;  3FZC A;  1KE0 A;  5E43 A;  3N4I A;  4E6W A;  1PYY A;  1BLS A;  2X71 A;  1CEG A;  3HLW A;  2C6W B;  4B4Z A;  1FR6 A;  2EX9 A;  1DJA A;  1ES3 A;  4EBP A;  2ZQ8 A;  4E3L A;  5EUA A;  5A91 A;  4S2J A;  3D4F A;  3BFC A;  5FQJ A;  4HES A;  1TDL A;  1XGI A;  4N1H A;  3V5M A;  5FI7 A;  2J8Y A;  3GQZ A;  1W8Q A;  4BL3 A;  3TG9 A;  4PM5 A;  3LO7 A;  4UA6 A;  1L0F A;  1NY0 A;  4ZDX A;  4NET A;  2H0T A;  1VM1 A;  3IWI A;  3M2K A;  1YMS A;  3AGD A;  4OVD A;  3IHA A;  2Q9N A;  1XA1 A;  4WEL A;  1ERQ A;  3OCN A;  3G2Z A;  2A3U A;  5CGW A;  3UY6 A;  4LV0 A;  4JF5 A;  5GLB A;  3ZG0 A;  3SS5 A;  4B88 A;  3UE0 A;  1MWU A;  4DXB A;  4C3Q A;  3IXD A;  5F1F A;  1E3U A;  4EBN A;  2HP5 A;  4YIN A;  4BQM A;  3IHB A;  3ZG8 B;  3PBT A;  4GD8 A;  5EVI B;  2XGN A;  1BLH A;  4KZ6 A;  1YMX A;  3IXH A;  4LV3 A;  2XDM A;  5EPH A;  2HP6 A;  3IWQ A;  4OOL A;  3RXW A;  3NDE A;  2Y55 A;  4E3M A;  3FKV A;  4WBG A;  1FSW A;  3VOY A;  3HLD A;  4R1G A;  3C7V A;  3FV7 A;  1I2W A;  4B4X A;  5EOE A;  3VOZ A;  3IF6 A;  4KG2 A;  4QY5 A;  3WRT A;  1K56 A;  2EFU A;  3MBZ A;  5E2E A;  3NY4 A;  4DKI A;  4E3K A;  1YLT A;  3OCL A;  3HLB A;  5FAT A;  4S2M A;  2Z2M B;  4HBT A;  5J8X A;  5HAQ A;  2G2U A;  1FR1 A;  4LCL A;  4ZBE A;  1XA7 A;  3MZE A;  1XP4 A;  4P85 A;  3GR2 A;  3UDI A;  4GB7 A;  3Q7V B;  5GLC A;  4KZ8 A;  2P9V A;  3BFD A;  3CMZ A;  2WGI A;  4DE0 A;  3O86 A;  3IT9 A;  2HPB A;  2PBY A;  3A3J A;  5CRF A;  1ERO A;  1H8Y A;  5FAO A;  5TGF A;  2ZM8 A;  1U60 A;  5EE8 A;  4C6Y A;  4OPY A;  4CJN A;  1O7E A;  1IYQ A;  1ALQ A;  3VP3 A;  5FAQ A;  4R3B A;  4X6T A;  3LEZ A;  1RP5 A;  1SCW A;  2WUQ A;  2ZQ9 A;  4S2N C;  4XXR A;  3AGF A;  4JLF A;  5CER A;  3GTC A;  2ZJ9 A;  5DTT A;  2XR0 A;  3MFD A;  3C7U A;  4JBF A;  4GDB A;  5DTS A;  4E3I A;  4X56 A;  3IH8 A;  1ESU A;  1ES5 A;  2VGJ A;  4BD1 A;  5M19 A;  2ZD8 A;  2OV5 A;  3RXX A;  1JWP A;  3BFF A;  2ZC4 B;  4QJG A;  2EX6 A;  5GL9 A;  1NYY A;  4IBR A;  4K0X A;  3WWX A;  4GD6 A;  4RYE A;  2ZQ7 A;  3G2Y A;  1ONG A;  2HDS A;  3FWL A;  4OQ0 A;  2OLV A;  2XD5 A;  5F1G A;  3UPP A;  3Q81 A;  1BT5 A;  1ESI A;  3IQA A;  4GN2 A;  2XQZ A;  5EVI D;  3A3D A;  3ZCZ A;  1ERM A;  4JKT A;  1PW8 A;  5FI2 A;  3HBR A;  4FH2 A;  4N1X A;  4U0T A;  3OPH A;  3VP2 A;  1GHM A;  4Y0O A;  2H0Y A;  3E2L A;  1S6R A;  2H5S A;  4XUZ A;  2VGK A;  5FQM A;  5FAP A;  3UE1 A;  4H8R A;  1LL5 A;  2ZQC A;  4K91 A;  4QB8 A;  3MXR A;  3ZVT A;  3HUM A;  3GMW A;  3BLS A;  4S2P A;  5FQ9 A;  5CEB A;  4QHC A;  2Y2K A;  2PU2 A;  2WKE A;  3IWO A;  3HUN A;  3I7J A;  1K38 A;  3ZG7 B;  1JTG A;  1YM1 A;  1K6R A;  4FD8 A;  4PM9 A;  4JXW A;  1YLW A;  2ZLY A;  3NIA A;  4Y7P A;  3WS2 A;  3VFH A;  2FFY A;  4S2L A;  4QY6 A;  5FQQ A;  5GHZ A;  3MZD A;  4OLD A;  2BLS A;  2A49 A;  4BJP A;  4PM6 A;  4MEZ A;  3WRZ A;  3ZHH A;  1KVM A;  5FDH A;  3BFG A;  4OOM A;  1GHI A;  4DE3 A;  4KEN B;  1NZO A;  3A3F A;  1K54 C;  4RX2 A;  1YQS A;  4OPZ A;  5CTN A;  1GA0 A;  1K4F A;  1SDN A;  2HP9 A;  4MNR A;  5FA7 A;  2EX8 A;  4WZ5 C;  1CI9 A;  2E8I A;  3NBL A;  2XFS A;  3N7W A;  1DY6 A;  2DCF A;  2DNS A;  5EEC A;  2WAE A;  4NK3 A;  4EUZ A;  1MBL A;  3UPN A;  1Q2Q A;  1QME A;  3BM6 A;  4IED A;  4S2K A;  4R0Q A;  1ES2 A;  5JYO A;  2OLU A;  1NXY A;  4O7D A;  4OP5 A;  4WYY A;  5DTK A;  4WZ4 A;  1E3U D;  1LLB A;  1KE3 A;  5EVL A;  4E3N A;  3ZG9 B;  1Z6F A;  1DJB A;  3W4Q A;  3O88 A;  4GKU A;  3M6H A;  5EVI A;  1XKZ A;  2EXA A;  3ITB A;  4R23 A;  1OME A;  1XX2 A;  3GVB A;  3UDF A;  4JXV A;  3HUO A;  4ZJ1 A;  4S2N A;  2WGW A;  2ZC5 B;  1PIO A;  3DW0 A;  4ZJ3 A;  2X02 A;  4N9L A;  5HAP A;  3TSG A;  2WYX A;  1ZKJ A;  2ZQD A;  1MWS A;  2Y4A A;  4DRT A;  3BYD A;  1J9M A;  3S4X A;  4GDN A;  3N8S A;  1YT4 A;  2Y2O A;  3VMA A;  2XD1 A;  3G34 A;  4M3K A;  2ZM2 A;  3BLM A;  3PBQ A;  1PZP A;  4PPR A;  2WKI A;  2Y2P A;  1IEM A;  3UO9 A;  2WZX A;  3FYZ A;  1SKF A;  3EQU A;  1K55 C;  1PW1 A;  2C5W B;  4JF4 A;  4ZJ2 A;  4U0X A;  3ZG5 A;  5FAS A;  4EBL A;  5G18 A;  3N8L A;  2Y91 A;  3PBR A;  3V50 A;  3P09 A;  2UWX A;  3CJM A;  4LV2 A;  4R3J A;  3W4P A;  1NJ4 A;  1M6K A;  3OPL A;  4S2I A;  5GLA A;  3Q82 A;  1HZO A;  1S0W A;  5HX9 A;  5AQ9 A;  5FSR A;  4UA7 A;  1SHV A;  1FCN A;  1K57 A;  4XUX A;  4C75 A;  5TR7 A;  3NC8 A;  1L0D A;  1KVL A;  1MY8 A;  3DWK A;  3MZF A;  4FSF A;  3SS4 A;  3BEB A;  3VP1 A;  1BLP A;  3ZFZ A;  3SH7 A;  2BG1 A;  4RVA A;  1WE4 A;  2V2F F;  1XGJ A;  4WEJ A;  3VSK A;  5EOO A;  2GDN A;  3LY4 A;  1FCO A;  4PM8 A;  2WK0 A;  2XH9 A;  3M2J A;  3WS5 A;  4BEN A;  5E2G A;  2Y2L A;  5DVA A;  4GNU A;  1JWV A;  1RCJ A;  4X69 A;  4GOG A;  1GCE A;  4P6B A;  5CGX A;  4ZAM A;  5AQA A;  2XLN A;  5HFO A;  4HBU A;  1HTZ A;  1SDE A;  5GHX A;  2EFX A;  3CZD A;  4WM9 A;  3GSG A;  2R9X A;  2R9W A;  1LHY A;  2PU4 A;  4QD4 A;  3ZNT A;  4KG5 A;  2X01 A;  3ITA A;  1JWZ A;  3IXB A;  3OC2 A;  1ONH A;  3QNB A;  4P0M A;  5GLD A;  4DDS A;  2Y2Q A;  1GA9 A;  4KZ9 A;  4WEK A;  2QMI A;  4OKP A;  3OPP A;  4MBH A;  1H8Z A;  1YLZ A;  3G31 A;  3Q1F A;  4OLG A;  3SS3 A;  3PBO A;  3WS1 A;  1IYS A;  5A90 A;  1ZG4 A;  1DJC A;  3O87 A;  4WZ5 A;  3A3I A;  3V39 A;  2J9O A;  4OQG A;  2Y2H A;  5IHV A;  4ZTK A;  5L2F A;  1ZC2 A;  1KE4 A;  5FQK A;  1H5X A;  4E3J A;  4KZ7 A;  1NYM A;  1IYP A;  4JXS A;  1M40 A;  2Q9M A;  1K55 A;  3MKF A;  4KQQ A;  5FQI A;  3UDX A;  2OSU A;  4UA9 A;  2FFF B;  4WMC A;  4X53 A;  5A93 A;  2JBF A;  2XEP A;  4N9K A;  5M1A A;  4KQO A;  2WKH A;  5CXW A;  4BD0 A;  2HDR A;  5DF9 A;  3ZGA B;  1XXM A;  4Q8I A;  2Z2L B;  4HEF A;  4K0W A;  2J7V A;  1IYO A;  2CC1 A;  4OH0 A;  1FCM A;  1K57 C;  2JCH A;  1W5D A;  1MWR A;  5AQB A;  2XFT A;  4ID4 A;  2ZQA A;  5D3O A;  4MLL A;  4R4S A;  5TFQ A;  1MPL A;  2B5R A;  5CEC A;  3UPO A;  1E25 A;  3NCK A;  5DF7 A;  1ZG6 A;  4IVK A;  1K54 A;  5KSH A;  3C5A A;  1GHP A;  2JE5 A;  2ZMA A;  5I94 A;  1N9B A;  2Y2M A;  3S1Y A;  5CGS A;  5F83 A;  4JPM A;  4KZB A;  3BRM A;  1YLY A;  4Y0T A;  1BSG A;  3EQV A;  1C3B A;  3S22 A;  2RL3 A;  2Y2G A;  4IBX A;  4EV4 A;  1E4D A;  2V20 A;  4RA7 A;  3WS0 A;  1PWG A;  4PM7 A;  5KSC A;  1N4O A;  4YFM A;  5CED A;  2Y2I A;  3NI9 A;  4BL2 A;  4EQI A;  2QPN A;  2ZC3 B;  1MXO A;  3RJU A;  4R4R A;  1YLP A;  4D2O A;  1LI0 A;  1EI5 A;  2IWC A;  3IF6 B;  3VFF A;  3Q7Z A;  3BEC A;  2ZC7 A;  1W8Y A;  4GZB A;  1KDW A;  3HLF A;  1I2S A;  4OPR A;  1AXB A;  1TVF A;  1G68 A;  4P87 A;  2XK1 A;  4QU3 A;  1PI4 A;  3ISG A;  4WMC D;  1WYB A;  3P98 A;  3PAE A;  3V3R A;  5F82 A;  2G2W A;  3ZDJ A;  3G35 A;  4UAA A;  3HVF A;  4N92 A;  3W4O A;  3G30 A;  5E2H A;  4F94 A;  4KQR A;  3PAG A;  5HW3 A;  1BLC A;  2V1Z A;  5KMW A;  3MXS A;  5U47 A;  3HL9 A;  1W79 A;  2JC7 A;  1BUE A;  4JXG A;  5JYP A;  1G6A A;  1LI9 A;  4L0L A;  5EVI C;  2WZZ A;  3E2K A;  1ES4 A;  1PWC A;  1XPB A;  4Z9Q A;  1VQQ A;  4DE1 A;  4KZ5 A;  1BUL A;  1FOF A;  1TDG A;  2RCX A;  4KZA A;  1KGF A;  1O07 A;  3WS4 A;  1K6S A;  3IF6 C;  1HD8 A;  4JF6 A;  3SH9 A;  2ZC6 B;  5FI6 A;  4OON A;  1IEL A;  3G4P A;  1BTL A;  3HRE A;  1TEM A;  1NRF A;  1Y54 A;  1IKG A;  1PZO A;  1BZA A;  3PBN A;  4DDY A;  3QNC A;  4KZ4 A;  4PMA A;  3A3E A;  3C4P A;  2EX2 A;  4S2O A;  5M18 A;  1I5Q A;  3UE3 A;  1EWZ A;  5AQ7 A;  4E6X A;  1FSY A;  4KZ3 A;  3IXG A;  5HL1 A;  1WYC A;  3GV9 A;  1FQG A;  1MKI A;  1QMF A;  3C4O A;  3LCE A;  4LEN A;  2XF3 A;  4Y0U A;  3SOI A;  1CK3 A;  3CG5 A;  2QZ6 A;  1PWD A;  2ZM0 A;  4OQI A;  3VP4 A;  5A92 A;  5CHM A;  2HDU A;  3LY3 A;  2J9P A;  3OZH A;  4FCF A;  4LCM A;  4DXC A;  1LL9 A;  3TOI A;  3UN7 A;  5HAR A;  3B3X A;  4IVI A;  3HLE A;  4MBK A;  2H10 A;  5CTM A;  3Q7V A;  3Q07 A;  1L0G A;  3O3V A;  2P9V B;  1HVB A;  1Q2P A;  1JTD A;  3IF5 A;  4EWF A;  4DF6 A;  3NDG A;  3JYI A;  4UHU A;  1RGZ A;  1L2S A;  1W7F A;  4OPQ A; 
#chains in the Genus database with same CATH topology
 2ARO A;  4WNN B;  3O62 D;  1L0E A;  3V3S A;  2W3D A;  4X55 A;  2IA2 A;  4NEE D;  4E3O A;  4WV4 B;  5B0Y A;  3AZG C;  4WUJ A;  4J8U A;  2LY8 A;  1KGG A;  3EEA A;  1G28 A;  5CPJ B;  2DRW A;  1PI5 A;  4HH3 A;  4CSR A;  1P3K C;  2JKF A;  1CK7 A;  2D49 A;  3VSL A;  3VP0 A;  4G91 C;  4KG6 A;  3ZVW A;  2JHE A;  1W2E A;  3X1U A;  3AZN A;  3AZF A;  3PBS A;  5CHJ A;  5B32 G;  5B1M A;  4XUJ B;  3S7O A;  3L26 A;  4DE2 A;  4YM6 D;  3UTA A;  2IWD A;  5DF8 A;  1M18 A;  1K25 A;  5GXQ A;  3N4I A;  3V9R B;  1CEG A;  3C1B D;  1BH9 A;  4R38 A;  2ZL1 A;  4WU8 A;  1VEU A;  4E3L A;  5EUA A;  4HES A;  5B32 B;  5FI7 A;  2J8Y A;  2J3T D;  1NY0 A;  3A6N C;  3IWI A;  5FEF A;  1P3O A;  4Z2J A;  3LZ0 B;  1XA1 A;  2KX6 A;  4XUJ C;  1ERQ A;  1QO6 A;  3LFV A;  3ZG0 A;  3UY6 A;  1MWU A;  5BS7 C;  1S1Z A;  4BMW A;  1U35 B;  5F1F A;  3REI B;  3UB7 A;  2CV5 B;  2HP5 A;  5L10 A;  3QP1 A;  2H28 A;  3KWQ C;  3LI9 A;  1YMX A;  1OTI A;  3RXW A;  3NDE A;  1W63 M;  3FKV A;  3AZM A;  3T4O A;  5F99 D;  4R1G A;  3MGS D;  5B33 D;  2EFU A;  5E2E A;  4E3K A;  5B32 C;  3NY4 A;  5DNM D;  4R6L A;  3T4K A;  3A6N B;  1XA7 A;  3LJA A;  1XP4 A;  3CHW P;  3GR2 A;  4GHI A;  3W97 D;  3Q7V B;  3UDI A;  3EEH A;  2WGI A;  1STZ A;  4DE0 A;  3O86 A;  1DP9 A;  3IT9 A;  3A3J A;  3H82 A;  4J8U C;  4YM6 B;  4OJ6 A;  1M1A A;  5JA4 A;  1GSW A;  4CJN A;  5CPK C;  1IYQ A;  4DJ3 A;  3FPW A;  4RQ9 A;  3AZK B;  4JLF A;  3GTC A;  2HZ5 A;  5DTT A;  2XR0 A;  3C7U A;  3E4P A;  5HD3 A;  3IH8 A;  4Z66 B;  4IBB A;  2VGL M;  1FIK A;  2EX6 A;  2KOI A;  4IBR A;  4Z66 A;  4GD6 A;  1TZY C;  4GLQ A;  5E5A D;  2GX5 A;  4BBT A;  2OLV A;  4YM6 C;  4L9E A;  4J8X C;  3AYW D;  4X1L A;  4NFT A;  1F1E A;  5EVI D;  3A3D A;  3ZCZ A;  2F8N A;  1ERM A;  4I38 A;  4JKT A;  4M4X A;  1IOU A;  1PW8 A;  1VHM A;  5FI2 A;  4N1X A;  4MN7 A;  3SW1 A;  2JSS A;  1GHM A;  2H0Y A;  3MGQ C;  4GH9 A;  3E2L A;  3VH5 W;  4XUZ A;  1KX3 C;  2VGK A;  5FAP A;  3GEC A;  2M7U A;  5EV0 A;  1GSV A;  4HHD A;  1P3B D;  1TS8 A;  1P3F C;  3GMW A;  4S2P A;  2Y2K A;  3LJA B;  1P3B C;  2G5H C;  3LR3 A;  4IJG A;  5J3W A;  1YM1 A;  4FD8 A;  4PM9 A;  5B0Y B;  4JXW A;  5EM1 A;  4WU9 B;  3WS2 A;  4QLC B;  5KDM B;  4YS3 D;  3MZD A;  2BLS A;  2A49 A;  4D60 A;  2WKQ A;  4DE3 A;  5DJU A;  1YQS A;  1K4F A;  3MGQ B;  5J7E A;  5AV9 A;  1CI9 A;  2E8I A;  2DNS A;  2XRO A;  2WAE A;  1P3P A;  3TW8 A;  3C8C A;  1QME A;  1YPR A;  5EVE A;  4UUZ B;  2W3E A;  1E3U D;  5EVL A;  4ARZ A;  1H0I A;  1DJB A;  1KX4 C;  4QLC C;  3EGX C;  3O88 A;  5EVI A;  3L7H A;  1L6J A;  3ITB A;  1XJ4 A;  5CPI D;  4JXV A;  2ZC5 B;  3DW0 A;  4N9L A;  1EAK A;  3V9R A;  5HAP A;  3W99 D;  5FUG B;  4Y13 A;  2RVQ D;  1P3L D;  4WU8 B;  1J9M A;  1YT4 A;  5DFY A;  3M7P A;  3PBQ A;  4E45 A;  5GT0 D;  5BPV A;  5FUG A;  4PPR A;  3UTB A;  1IEM A;  3TU4 C;  2WZX A;  1KX5 A;  4KGC C;  2W0N A;  1P3I B;  1ZTU A;  4H9O A;  1LSW A;  1K55 C;  5CP6 A;  1PW1 A;  2C5W B;  2KDK A;  3QP5 A;  5CP6 D;  4U0X A;  5JRG C;  3N8L A;  5G18 A;  3PBR A;  4R3J A;  2UWX A;  3CJM A;  5B24 A;  2J80 A;  5GSU D;  4CLC A;  5FSR A;  2CV5 A;  1K57 A;  3AZH C;  4C75 A;  5HWW A;  3NC8 A;  1L0D A;  4X23 C;  4FSF A;  3SS4 A;  3DTK A;  3WTP B;  2BG1 A;  1WE4 A;  4Z2M G;  3AZJ C;  1LT0 A;  4ZUX C;  1P3A B;  3B6F C;  3WS5 A;  5B32 A;  3REH D;  4GNU A;  1BH8 B;  4QLC D;  4GOG A;  4X69 A;  4HP4 A;  5CGX A;  5B0Y D;  3F1N B;  1SDE A;  2PAV P;  3MS6 A;  4WM9 A;  1E88 A;  3AZL A;  2R9X A;  5B40 A;  4I5S A;  4JJN B;  3REI A;  4L9G A;  1JWZ A;  1DP8 A;  2Y2Q A;  1GA9 A;  3C1B A;  5CPK D;  4KZ9 A;  4ETX A;  1TS6 A;  3SS3 A;  2FJ7 A;  3PBO A;  3CI6 A;  4HMD A;  1ZG4 A;  3V39 A;  4OQG A;  4OJP A;  3L25 A;  3NQJ B;  3UTB C;  4ZTK A;  1ZC2 A;  2GJ3 A;  5B1M D;  1P3A C;  3EPL A;  3B6F B;  1H5X A;  4E3J A;  4GS9 A;  2L5A A;  4UQI M;  4GW9 A;  1NYM A;  3AV1 D;  5E5A B;  4PKY A;  3UDX A;  2XEP A;  2PYP A;  1UR8 A;  2L4R A;  3W96 A;  2XA7 M;  5CXW A;  2HDR A;  3ZGA B;  2VX8 A;  2F8N K;  1HQ3 B;  4K0W A;  4HEF A;  3W98 D;  2VV8 A;  3VV4 A;  4CLC B;  2J7V A;  1ED7 A;  5CPI C;  5B33 C;  1FCM A;  3AN2 D;  1K57 C;  3AZH A;  1W5D A;  3T1X A;  5HPI A;  2XFT A;  5D3O A;  4R4S A;  4H9P B;  3MSH A;  1MPL A;  1JNU A;  3WTP D;  1NLZ A;  3L27 A;  1E25 A;  4NYY A;  1W1P A;  5HD5 A;  3NCK A;  3NQJ A;  1KX3 A;  1K54 A;  2HIO D;  5AV8 D;  1P97 A;  1S1Y A;  2JKR I;  4DN0 A;  2ARO D;  1GOI A;  2E8J A;  3UB9 A;  1YLY A;  4DJ2 A;  5JA4 B;  1C3B A;  1AOI A;  4EV4 A;  4X25 A;  3WD4 A;  1P34 A;  1OJ5 A;  5B40 B;  2XSS A;  3D3O A;  1N4O A;  4YFM A;  3NI9 A;  5BO0 B;  3RJU A;  4R4R A;  5B33 B;  1E15 A;  4I39 A;  4Z2G A;  2FJ7 C;  2ZC7 A;  5DNM A;  4ZBJ B;  3NHQ A;  1W8Y A;  3DAV A;  3MR0 A;  3AZN D;  3LIA A;  2P7J A;  3X1T C;  3L9K A;  2W3G A;  1TVF A;  2VKS A;  4QU3 A;  4CAY A;  1PI4 A;  1N9L A;  3ISG A;  1SKO B;  2G2W A;  3BWL A;  5F82 A;  5E2H A;  1PNE A;  5HW3 A;  1BLC A;  4M6B A;  5KMW A;  3HL9 A;  3REI C;  1W79 A;  2F8N G;  1G6A A;  4HJ6 A;  1M19 D;  3UT9 A;  3K3D A;  1ES4 A;  1XPB A;  4EXO A;  3O5Y A;  4Z1W A;  1VQQ A;  3UT9 D;  1TDG A;  1KGF A;  3X1S C;  4NZ4 A;  3RTY A;  3MGQ D;  3R7W B;  3REL C;  2HF6 A;  2LB9 A;  1P3L A;  3SH9 A;  2XA7 S;  2ZMF A;  3HRE A;  2PD7 A;  4AWL B;  4H9N A;  5HDD A;  4UQI S;  4HY8 A;  4CQH A;  4DQY B;  4DDY A;  3QNC A;  4KZ4 A;  4PMA A;  3REL D;  4HGA C;  4GHI B;  4XUJ D;  4E6X A;  1JFI B;  3TE8 A;  1YSP A;  3FG8 A;  3UT9 B;  5FDS A;  3T50 A;  1WYC A;  4JGQ A;  3GV9 A;  3LCE A;  3C4O A;  2ZY5 A;  4GHA A;  5GSU C;  3L28 A;  4OQI A;  1PWD A;  3VP4 A;  3NQU B;  5A92 A;  3LY3 A;  4DXC A;  1P3P B;  3AZM C;  4XZQ A;  4MBK A;  3Q7V A;  4Q0H A;  1PFL A;  4G92 B;  1HVB A;  3RFB A;  4J8W D;  3IF5 A;  3WX7 A;  3AZN B;  3X1V B;  4OPQ A;  3S7N A;  4HGA B;  2Y2N A;  1S4S A;  2B18 A;  2I72 A;  3CAX A;  4OP8 A;  3O62 B;  3CUE A;  3OPR A;  2L0W A;  2WGW B;  3G32 A;  2RIQ A;  4J8V B;  2WAF A;  3WAA B;  5KZH A;  4KHA B;  3D72 A;  3MKE A;  5B1L D;  3AZE D;  3BFE A;  3MGQ A;  1H3O B;  2Y59 A;  4Y17 A;  1FIL A;  3HLC A;  4MBF A;  1F66 D;  1K4E A;  3AZI C;  1N1J A;  3AGE A;  1RGY A;  4LV1 A;  4E44 A;  5AV5 A;  2HGV A;  1KDS A;  4X1M A;  5C3I C;  5HAI A;  4X68 A;  2IWB A;  1M18 B;  2J3T C;  2PHY A;  1UWP X;  3ZNY A;  3GRJ A;  2HIO B;  5AV8 B;  5DNN C;  4BLM A;  4CPK A;  5G49 A;  1YU0 A;  1HLU P;  2WAD A;  1L3L A;  4KUO A;  2IOU A;  4HJ4 A;  1WWI A;  2WGV A;  2PT7 A;  4Z5T C;  1KE0 A;  3W96 D;  2EWV A;  4E6W A;  1PYY A;  1BLS A;  2X71 A;  3WA9 A;  4J8X D;  4KUD A;  3HLW A;  2C6W B;  1FR6 A;  4CLC D;  5B2I A;  2ZM5 A;  3WD2 A;  4R8P D;  3D4F A;  3AFA A;  3MVD D;  3BFC A;  3EPK A;  4N1H A;  3GQZ A;  4J8W A;  1TF1 A;  4PM5 A;  5HWT A;  1ID3 C;  4UA6 A;  1L0F A;  3B6F D;  3X1U B;  3AZF B;  3M2K A;  2GNX A;  3AGD A;  1KX5 B;  3C30 A;  3LEL C;  4FTX A;  2HIO C;  5AV8 C;  5B0Z D;  1U35 D;  1YSQ A;  5CGW A;  1EQZ D;  4LV0 A;  5GLB A;  3T12 B;  5DJT A;  3O62 A;  4B88 A;  2ZBB A;  3UE0 A;  4C3Q A;  3IXD A;  3WKJ B;  2V0W A;  5AY8 A;  2I9V A;  5B1L C;  3BJN A;  3ZG8 B;  3VH6 T;  4KZ6 A;  2O99 A;  2XDM A;  3IWQ A;  3F1O B;  3UB6 A;  2Y55 A;  2K2N A;  4WBG A;  1B67 A;  1I2W A;  3B6G D;  5F99 A;  5B2J D;  3WD0 A;  3IF6 A;  4KG2 A;  3NQU A;  1K56 A;  4QY5 A;  3OCL A;  2M1C A;  2VJW A;  3HLB A;  5FAT A;  4S2M A;  3REH B;  4LCL A;  2OWH A;  1P3A D;  4KGC B;  5AV6 D;  3X1U C;  3AZF C;  4HNB A;  3LEL B;  4KZ8 A;  5GLC A;  3CMZ A;  2NQB C;  1IFQ A;  1L0G A;  3AZL B;  2HPB A;  5CRF A;  1ERO A;  1YUE A;  1U60 A;  3KO6 A;  5EE8 A;  4IHQ A;  3MQL A;  5F6A A;  5GXQ B;  4F3L B;  1PDC A;  1RP5 A;  2INW A;  3MMH A;  2A24 B;  4X23 B;  3MNN B;  3QP6 A;  5DTS A;  4GDB A;  3WTP C;  3JPU A;  3AZJ B;  3ZYT A;  4KGC D;  4ZUX B;  4BD1 A;  3AV1 A;  3MGR A;  5M19 A;  2ZD8 A;  5A8B A;  4QJG A;  3AZG D;  5AV5 B;  4K0X A;  4MB5 A;  4HJ3 A;  4RYE A;  5B31 A;  2NQB B;  1M1A B;  2O0Y A;  2W3F A;  5B31 D;  4LD9 B;  1B6W A;  2PYR A;  4GN2 A;  1J3W A;  2XQZ A;  2O9A A;  1A7W A;  3AYW A;  2O9B A;  1OJG A;  3BQA A;  3AZM D;  4FH2 A;  3VP2 A;  1S6R A;  3A1K A;  4Z2I A;  1YKD A;  1TS0 A;  3UE1 A;  3IP4 C;  2J3W A;  3HUM A;  3ZVT A;  3BLS A;  3B0D C;  4PHT A;  5CEB A;  4QHC A;  2BYM A;  1K38 A;  4NKP A;  3V67 A;  1P34 B;  2WKR A;  3NIA A;  2ZLY A;  3UB5 P;  5FQQ A;  5GHZ A;  4LD9 C;  1S4R A;  2OAQ 1;  5L09 A;  4OLD A;  4H9Q A;  4YS3 A;  4MEZ A;  3ZHH A;  1ZLA C;  4B93 A;  1NZO A;  5GT3 D;  2GZA A;  4YS3 B;  4EER A;  4HI4 A;  1GA0 A;  4MNR A;  3W99 C;  5HL6 A;  3C1C A;  3NBL A;  1DY6 A;  2V8F A;  1P3O C;  4S2K A;  2K31 A;  1NXY A;  4WZ4 A;  4GJ4 A;  4E3N A;  1P34 C;  3B0C W;  4NE5 A;  1H8M A;  1Z6F A;  3W4Q A;  2ZOH A;  5DKL A;  3S7P A;  3AN2 C;  1XX2 A;  3WAA D;  3GVB A;  2WGW A;  3AYW C;  2Y4A A;  3WTP E;  2FJ7 B;  4ZBJ C;  1DP6 A;  4P6Z S;  3VMA A;  4R8P A;  2Y2P A;  3X1T B;  3REJ A;  4ZUX D;  1OT6 A;  5K5B A;  1P3P D;  4IBK A;  3ZG5 A;  5B0Z C;  1ODV A;  1P3I A;  3V50 A;  3P09 A;  5L8M A;  1M6K A;  3OPL A;  4S2I A;  3AZK D;  5GLA A;  3Q82 A;  1HZO A;  5CX7 A;  5B24 D;  1D06 A;  4UA7 A;  1SHV A;  3A0R A;  4XUX A;  1MY8 A;  3X1S B;  3ZFZ A;  3REL B;  4RVA A;  1P3K D;  4WEJ A;  5B31 G;  3W97 B;  1FCO A;  5AV6 B;  3M2J A;  1H8P A;  4WN5 A;  5GT0 A;  1F98 A;  5DVA A;  3UME A;  5B2J C;  1JWV A;  4IBC A;  4H9S C;  2YFW B;  3MGS B;  3N3F A;  4P6B A;  5AQA A;  1YU3 A;  4ZAM A;  5AVC B;  5HFO A;  3KUY C;  3VE3 A;  3GSG A;  3UTA D;  5LBR A;  4EW7 A;  3UT9 C;  4QD4 A;  4HIA A;  3ZNT A;  1M19 B;  4CSR B;  4KG5 A;  3IXB A;  5GSU A;  3FKE A;  1ONH A;  3EG5 B;  4P0M A;  4DDS A;  3CIT A;  4J8X A;  3X1S A;  4OKP A;  3VH6 W;  1LL8 A;  1YLZ A;  4Y2F A;  1N1J B;  4WZ5 A;  2PYO B;  4IBG A;  4MN6 A;  3T4T A;  1E6Z A;  2Y2H A;  2ARO C;  1KX5 D;  5IHV A;  5FQK A;  4KZ7 A;  1UGU A;  4EU0 A;  3MGR C;  4JXS A;  3X1V C;  2Q9M A;  1K55 A;  1AWI A;  5FQI A;  2PR5 A;  5AVC C;  4X53 A;  4N9K A;  4WU9 C;  3MF0 A;  4KQO A;  2WKH A;  1AOI B;  5DF9 A;  4J8V C;  4I3J A;  3F1O A;  4Q0I A;  1OTA A;  3WAA C;  5B40 D;  3W96 B;  3AFA B;  1Y28 A;  2ZQA A;  5TFQ A;  2B5R A;  5CEC A;  3AL0 C;  5I5L A;  1GPF A;  3UPO A;  1GHP A;  2ARO B;  3KYE A;  2ZMA A;  5I94 A;  1N9B A;  3KS8 A;  2Y2M A;  5CGS A;  2VZW A;  1M18 C;  2PDR A;  4JPM A;  5F83 A;  3A1I A;  1KX4 D;  4WJ3 C;  3LI8 A;  3UTA C;  1BSG A;  1EQZ C;  5AY8 D;  3HON A;  4QLC A;  4J8U D;  3L2A A;  2RL3 A;  4IBX A;  1Y4O A;  2V20 A;  4RA7 A;  1YU1 A;  3AZE B;  5CED A;  4LD9 A;  2QPN A;  4D2O A;  4PAU A;  3MQQ A;  1LI0 A;  1EI5 A;  5B2I B;  4WU8 C;  3VFF A;  3C1C B;  1YU2 A;  3Q7Z A;  5GT3 C;  3AV1 B;  2VK3 A;  4GZB A;  1P9R A;  2W8S A;  3X1V D;  3HLF A;  4QNL A;  1I2S A;  2K7S A;  4H9O B;  4J8W B;  4OPR A;  1G68 A;  3QP8 A;  4NXB A;  2JKR M;  3LEQ A;  3P98 A;  1ACF A;  3R45 A;  4UAA A;  3W4O A;  1CJF A;  2BYM B;  1XJ3 A;  3W98 A;  2V1Z A;  3H82 B;  5U47 A;  3KWQ A;  2JC7 A;  3F1N A;  4JXG A;  5JYP A;  1LI9 A;  2D02 A;  5EVI C;  2WZZ A;  3E2K A;  3KXB B;  4KHA A;  2NZD A;  5DNM C;  1BUL A;  5TBM B;  1FOF A;  2Y79 A;  1H3O A;  3WS4 A;  5B2I C;  3MNN A;  5F99 C;  3IF6 C;  1P3G D;  4JF6 A;  1GSX A;  2B02 A;  1R4V A;  1BTL A;  1MKM A;  4LRY C;  3REH C;  1NRF A;  2KLI A;  3PBN A;  1KS0 A;  3A3E A;  4QPR A;  5M18 A;  3LEL A;  3AZL C;  4IBJ A;  1EWZ A;  5AQ7 A;  2W1T B;  4DRB A;  4JJN C;  1UR9 A;  5B24 B;  2IO5 B;  1MKI A;  4R3A A;  2XF3 A;  4Y0U A;  2XRN A;  2QZ6 A;  5CHM A;  2HDU A;  2J9P A;  4FCF A;  5GT3 A;  5HAR A;  1F66 C;  3T4L A;  3UMD A;  3HLE A;  3AV2 D;  3X1T D;  3O3V A;  1JTD A;  4DF6 A;  3NDG A;  4UHU A;  2V8C A;  5E5A C;  1F2K A;  3KUY D;  1IKI A;  2HUE B;  2V1A A;  1M1A C;  3HLG A;  1MWT A;  3U4L P;  2PD8 A;  1S32 B;  1TZY A;  3MFX A;  5FL3 A;  5E2F A;  3QHY A;  5CPI B;  4IUK A;  1YLJ A;  1P3F D;  2EXB A;  2P74 A;  4NZ3 A;  3LZ1 B;  5B33 A;  1H0M A;  4OQH A;  3M6B A;  3PTE A;  3MGR D;  3SH8 A;  4OOY A;  5CHU A;  3B0D B;  5GHY A;  2J8P A;  3TRC A;  5AVE A;  1KGE A;  3IS2 B;  1NZU A;  1CI8 A;  1JFI A;  2HDQ A;  4XUJ A;  2QJ5 A;  4B4Z A;  3T4S A;  1DJA A;  1ES3 A;  4H9P A;  4EBP A;  2ZQ8 A;  5A91 A;  4S2J A;  3PR6 A;  5FQJ A;  4IJF A;  1TDL A;  1XGI A;  4MMN A;  3V5M A;  4Z2M H;  4EQ1 A;  1W8Q A;  3LJA D;  3BY8 A;  3TG9 A;  3NJA A;  3LO7 A;  4ZDX A;  4NET A;  2H0T A;  3NOT C;  1YMS A;  4OVD A;  3LUQ A;  4BBU A;  3IHA A;  4MB4 A;  2BYK A;  3G2Z A;  1Z2C B;  1OGB A;  4JF5 A;  3QP2 A;  1KX4 A;  3SS5 A;  4DXB A;  1S32 A;  1E3U A;  5CPK B;  3NUL A;  5BO0 A;  3IHB A;  3AYW B;  4JJN D;  3IXH A;  4LV3 A;  5EPH A;  3H0M C;  4LD9 D;  4OOL A;  3WA9 D;  4KUD D;  4E3M A;  5AV9 D;  2PYO A;  1FSW A;  3VOY A;  3AZI D;  3HLD A;  2V9A A;  3C7V A;  5AV5 D;  5EOE A;  3MBZ A;  1YLT A;  2Z2M B;  4HBT A;  1BH8 A;  2G7U A;  4AWL C;  4P6Z M;  3MZE A;  3T4J A;  4P85 A;  3UE6 A;  5F69 A;  2P9V A;  3BFD A;  3IS2 A;  4NE6 A;  2PBY A;  1GXD A;  5TGF A;  4X23 D;  2ZM8 A;  4C6Y A;  1XJ6 A;  4OPY A;  4X23 A;  2CV5 C;  1ALQ A;  5FAQ A;  2A2L A;  2CMN A;  3KWQ B;  4HH2 A;  5GXQ D;  3LEZ A;  2WUQ A;  4NZ1 A;  5G4Y A;  1S67 L;  2W3H A;  5GSU B;  4S2N C;  4XXR A;  4LGW A;  2ZJ9 A;  4JBF A;  1KX3 B;  3MFD A;  4LRZ E;  5CPJ A;  3VH5 A;  4E3I A;  5HWV A;  3AFA D;  1E6N A;  1WA9 A;  3B6F A;  3W97 C;  1P3F B;  1KU5 A;  4KGC A;  3G6O A;  3LR5 A;  3RXX A;  1JWP A;  3BFF A;  5DKK A;  1T1B A;  5B2J B;  5GL9 A;  5GT0 B;  1NYY A;  3WWX A;  5B0Y C;  3AZG A;  4NY2 A;  2HDS A;  1SZV A;  3KUY B;  3O62 C;  4MDZ A;  1U35 A;  4IUH A;  5F1G A;  4BBV A;  3HJK A;  3LIB A;  3VH5 T;  3UPP A;  2D01 A;  1BT5 A;  1ESI A;  5HDS A;  4ESP A;  3OLO A;  3WKJ D;  3FC7 A;  1YU4 A;  3MGP A;  3AZK C;  4U0T A;  2JKG A;  3REK A;  3A0S A;  2H5S A;  2PR6 A;  2NUT C;  1E6R A;  3KSY A;  1Z09 A;  4H8R A;  2ZQC A;  2OAP 1;  3X1U D;  3AZF D;  2DMW A;  3MGS A;  4NG2 A;  4XZQ C;  3X1V A;  2PU2 A;  2WKE A;  3E4Q A;  1JTG A;  1ZHH B;  1W1V A;  1TZY B;  1YLW A;  4II7 A;  3VFH A;  2FFY A;  3EGD C;  2YKF A;  4HOI A;  1W1Y A;  4J8X B;  2FH5 A;  4PM6 A;  3WRZ A;  1KVM A;  1LSX A;  3BFG A;  5FDH A;  4OOM A;  5L07 A;  3AFA C;  1K54 C;  4RX2 A;  1T18 A;  5CTN A;  2HP9 A;  4MN5 A;  2CWE A;  3EWK A;  2XFS A;  4WZS B;  3N7W A;  5EFW A;  5TJJ A;  4UUZ A;  3KYQ A;  1OTD A;  1TAF B;  1MBL A;  1Q2Q A;  3BM6 A;  4IED A;  4R0Q A;  3REJ B;  1ES2 A;  1P3B B;  5JYO A;  1EQZ A;  3ULF A;  2BYK B;  4O7D A;  4JGP A;  2VEA A;  5DTK A;  4HMC A;  1J7M A;  1KE3 A;  3R4K A;  5JRG B;  4MCW A;  3ZG9 B;  5B1L B;  1XKZ A;  4R23 A;  4EEU A;  1OME A;  2ZY2 A;  3UDF A;  3HUO A;  4ZJ1 A;  4S2N A;  4IBF A;  4GHL A;  4ZJ3 A;  3LIC A;  4J8V D;  2X02 A;  2YKH A;  3REK D;  2FJ7 D;  1MWS A;  3BYD A;  3N8S A;  2Y2O A;  2XD1 A;  3G34 A;  1CXW A;  5AVB D;  4TX8 A;  3WD1 A;  4LPZ A;  4J8W C;  3FYZ A;  3PXP A;  1TS7 A;  4JF4 A;  3BW6 A;  1OTB A;  3T1Q B;  5FAS A;  2FN2 A;  2Y91 A;  3IBJ A;  3W4P A;  1G6O A;  1KX4 B;  3SZT A;  1S0W A;  2M7V A;  5AQ9 A;  2HJ9 C;  5CPK A;  3MGP C;  3AZK A;  5CHL B;  2WKP A;  1H0G A;  1FCN A;  3LZ1 A;  1OPX A;  3EPJ A;  3DWK A;  3K2N A;  3MZF A;  4Q0J A;  4NXE A;  5J4E A;  3BEB A;  3VP1 A;  3W99 A;  3MQ0 A;  2V2F F;  1XGJ A;  3UTB B;  3B33 A;  5EOO A;  5KIZ A;  2GDN A;  3LY4 A;  3H7W B;  4PM8 A;  3A6N D;  2WK0 A;  2XH9 A;  3B42 A;  3S7Q A;  4BEN A;  2Y2L A;  3OBF A;  1P3B A;  5B31 C;  1P3I C;  4BJP A;  1GCE A;  2XLN A;  1AOI D;  1TZY D;  4HBU A;  4WNN A;  1P34 D;  1T1C A;  4DMZ A;  2PU4 A;  2X01 A;  3ITA A;  5HSQ A;  3OC2 A;  3QNB A;  4WEK A;  2CV5 D;  4F3L A;  5G4Z A;  4MBH A;  4OLG A;  3WD3 A;  2OWJ A;  3Q1F A;  4H6J B;  5A90 A;  3O87 A;  1T1A A;  5FEG A;  2J9O A;  1NWZ A;  5L2F A;  2O9C A;  3F1P A;  1IYP A;  5B31 B;  4JGR A;  5B32 D;  3REH A;  4KQQ A;  2UV0 E;  4UA9 A;  2FFF B;  3K3C A;  4UEY A;  5A93 A;  2JBF A;  3HSH A;  5M1A A;  5B0Z A;  4BD0 A;  3AZG B;  1XXM A;  4Q8I A;  2F8N H;  4Y15 A;  1VEU B;  2CC1 A;  4AFI A;  4OH0 A;  3QP4 A;  1PZR A;  3B6G C;  5AQB A;  3KSI A;  1P3K B;  1P0Z A;  4YS3 C;  4MLL A;  5AV9 C;  1CQA A;  4FUW A;  3AZI A;  1ZG6 A;  3A6N A;  4IVK A;  5B1M C;  4WLA A;  3C5A A;  1MC0 A;  1P3O B;  4B9O A;  3BRM A;  5E5A A;  3S22 A;  3CUE C;  5CPI A;  2QWS A;  1F5M A;  1PWG A;  3AN2 B;  5KSC A;  1HQ3 C;  2W1T A;  2Y2I A;  4CLC C;  1TD5 A;  4BL2 A;  4EQI A;  2ZC3 B;  3IX4 A;  1K0K A;  1HQ3 D;  1MXO A;  3LR0 A;  1YLP A;  5AVB B;  3B6G B;  3MVD C;  4R8P C;  4NYU A;  5AV9 B;  3BEC A;  3OOV A;  4G3V A;  3R45 B;  1KDW A;  4GCZ A;  5B1M B;  1AIW A;  3KSG A;  1AXB A;  2XK1 A;  2Y8H A;  1WYB A;  3PAE A;  3V3R A;  3ZDJ A;  2G5I C;  3LZ0 C;  3HVF A;  4N92 A;  4O0P A;  4F94 A;  3PAG A;  5JRG D;  5B0Z B;  3EPH A;  2NZD B;  3MXS A;  5JRG A;  1P3M D;  2YFV B;  1BUE A;  5B40 C;  4L0L A;  5B1L A;  2R78 A;  1PWC A;  1Q9C A;  2VLG A;  4KZA A;  5AVB C;  3MVD B;  1O07 A;  3AZJ A;  4R8P B;  1HD8 A;  3T4Q A;  4OON A;  1ID3 A;  4G92 C;  5AV6 C;  3G4P A;  5B2J A;  1TEM A;  1DRM A;  1Y54 A;  4WF0 A;  1IKG A;  3AZN C;  1PZO A;  4YWZ A;  3DTE A;  1T3U A;  1I5Q A;  3ICY A;  1XJ2 A;  2NZD C;  1V9Z A;  4KZ3 A;  1M18 D;  1HTA A;  4NE3 A;  5HL1 A;  3MGP D;  1FQG A;  4LEN A;  4OUI A;  2VQR A;  5F5Y A;  3SOI A;  1P3M B;  3CG5 A;  2ZM0 A;  4OJL A;  2NZD D;  3LZ1 D;  3OZH A;  1G5U A;  3TOI A;  2ZY4 A;  2PYO C;  3B3X A;  3WTP A;  1P3A A;  4IVI A;  4Y3I A;  3LYX A;  2H10 A;  5CTM A;  4Z66 C;  3Q07 A;  5C3I B;  1YAX A;  3TU4 D;  4EWF A;  2F2A C;  3AV2 A;  5DNN B;  3JYI A;  4YM6 A;  1RGZ A;  4EUZ A;  5AVC A;  3KS4 A;  5GT0 C;  2DF4 C;  4U3T A;  3H0R C;  1BYW A;  1NLY A;  3DTM A;  1AOI C;  3LGO A;  3KUY A;  5BNX A;  4Z5T B;  4RX3 A;  3W8K A;  2JN7 A;  4R70 A;  1JVJ A;  3DWZ A;  3W96 C;  4FH4 A;  1CEF A;  2Y2J A;  3IBR A;  4A5R A;  3AZJ D;  1P3G C;  3UNW A;  4J8V A;  4NXF A;  1P3F A;  3C38 A;  1KX3 D;  1K56 D;  3IH9 A;  4LRX C;  3MNN D;  1P3P C;  4IBI A;  2BAS A;  1ID3 B;  3FKW A;  4EUV A;  3W97 A;  2LB5 A;  4H9N B;  3LJA C;  1OTE A;  3F1P B;  3AZL D;  5BOH A;  2P08 A;  3N6I A;  1ZLA A;  2V1B A;  3LEL D;  3N8R A;  3AZE C;  3FZC A;  5E43 A;  1WWS A;  3MXQ A;  4XT2 A;  5BS7 A;  2QJ7 A;  3H9W A;  2EX9 A;  1VET A;  1P3G B;  4HP9 A;  3JVV A;  3AZI B;  1VB6 A;  4EES A;  1F66 A;  4BL3 A;  3TU4 A;  2EA9 A;  1O6I A;  3VOL A;  3D9Y A;  4XZQ D;  1VM1 A;  3AV2 C;  3X1T A;  2V5O A;  2Q9N A;  4WEL A;  5BT1 C;  3OCN A;  2A3U A;  4PKY G;  1M19 A;  4EBN A;  4YIN A;  4BQM A;  3PBT A;  4GD8 A;  5EVI B;  2OOL A;  2XGN A;  1BLH A;  2F8N B;  4NZ5 A;  4Z2H A;  2HP6 A;  3MNN C;  1P3G A;  4HME A;  3C1C D;  5B2I D;  4IJE A;  3FV7 A;  4B4X A;  3VOZ A;  2ACG A;  3WRT A;  3H0L C;  2QYB A;  4DKI A;  3C2W A;  3CWF A;  1UWN X;  5J8X A;  3P5J B;  4CAY B;  2G2U A;  1FR1 A;  4Z66 D;  4ZBE A;  5HAQ A;  4GB7 A;  1KX5 C;  5FAO A;  1H8Y A;  1V9Y A;  5IS1 A;  4LG2 A;  1OGG A;  1O7E A;  3DBA A;  3VP3 A;  1PRQ A;  2IO5 C;  4R3B A;  1P3M A;  4X6T A;  2ZL1 B;  1SCW A;  3P01 A;  2ZQ9 A;  3W2Z A;  1P9W A;  3AGF A;  5CER A;  5IT5 A;  4H9R B;  4UPK A;  4G3W A;  5TBM A;  5AVB A;  4MB3 A;  3B47 A;  4X56 A;  1F66 B;  1ESU A;  1ES5 A;  2VGJ A;  2QKP A;  5HPF A;  2OV5 A;  3PHY A;  5F68 A;  2ZC4 B;  3ZQ5 A;  1S32 D;  2ZQ7 A;  4DRA A;  3G2Y A;  1ONG A;  3FWL A;  4OQ0 A;  1S32 C;  2XD5 A;  5HDC A;  1W1T A;  5G49 B;  3C1B C;  2F8N D;  4QWO A;  3REK B;  1XFN A;  4H9Q B;  3Q81 A;  3IQA A;  3B0C T;  2HV1 A;  4K08 A;  1ZLA B;  2PYO D;  3REI D;  3HBR A;  3OPH A;  4H9R A;  4Y0O A;  3LZ1 C;  1P3K A;  5FQM A;  3LZ0 D;  3LIF A;  3MQO A;  1LL5 A;  4K91 A;  4QB8 A;  3MXR A;  3REJ D;  5FQ9 A;  5DNN A;  3IWO A;  5KDM A;  3HUN A;  3I7J A;  4CLC E;  4ETZ A;  3ZG7 B;  3TJZ C;  5CP6 C;  1N9O A;  5AV5 C;  1K6R A;  3KX0 X;  5EM0 A;  5AVC D;  4Y7P A;  4O01 A;  4S2L A;  4QY6 A;  2PRF A;  3C1B B;  2VV7 A;  3REK C;  4Z5T A;  5BNX B;  4OJ5 A;  3FDD A;  1GHI A;  4KEN B;  3R7W A;  3A3F A;  1TAF A;  3KSF A;  4OPZ A;  1SDN A;  2P04 A;  5FA7 A;  3BY9 A;  3DTI A;  2EX8 A;  3F6T A;  4WZ5 C;  2DCF A;  1OT9 A;  5EEC A;  4ZUX A;  4NK3 A;  3E4O A;  5C5K A;  3UPN A;  2HIO A;  5AV8 A;  2PBD P;  1ID3 D;  2OLU A;  4WYY A;  2QHK A;  4OP5 A;  5CP6 B;  1LLB A;  5AY8 C;  4FOF A;  4WU9 A;  1U35 C;  3IX3 A;  4GKU A;  3M6H A;  1KOU A;  2EXA A;  1ZLA D;  3AZE A;  1PIO A;  1D1J A;  2Z6D A;  2FZ0 A;  3TSG A;  2WYX A;  1ZKJ A;  2ZQD A;  2AVX A;  4DRT A;  3CPT B;  2W27 A;  3B6G A;  4WU8 D;  3S4X A;  4GDN A;  1VET B;  4H6J A;  3W99 B;  4M3K A;  2ZM2 A;  3BLM A;  5DNN D;  1PZP A;  3E0Y A;  1D7E A;  2WKI A;  4HQA A;  3UO9 A;  3W98 C;  1SKF A;  3EQU A;  4Z2K A;  2YFW A;  4ZJ2 A;  3E98 A;  4J8U B;  4EBL A;  1MZU A;  5AY8 B;  4LV2 A;  3A0V A;  3L29 A;  1NJ4 A;  3MJQ A;  1HQ3 A;  3NEC A;  1M19 C;  5HX9 A;  3KWQ D;  4NXG A;  5TR7 A;  1KVL A;  2DQN C;  1BFM A;  3VH6 A;  1BLP A;  4LFU A;  1E6P A;  4OJO A;  3SH7 A;  3BQ8 A;  3T1S A;  3GDI A;  1NRJ A;  2B95 A;  5BNV B;  4EO5 C;  3VSK A;  4BWI A;  3IX8 A;  2L1M A;  4O8G A;  5E2G A;  4Y5F A;  5AJG A;  4JGO A;  3W98 B;  3LR4 A;  1RCJ A;  4WU9 D;  1HTZ A;  3H7W A;  2RTS A;  5GHX A;  2EFX A;  3CZD A;  4ZRR A;  3WA9 B;  4KUD B;  1EW0 A;  2Z6C A;  3AZH D;  2R9W A;  1LHY A;  3LIE A;  3WKJ A;  3KFU G;  5HZH A;  5GLD A;  3NOU C;  1P3M C;  2V0U A;  1XFQ A;  4I3I A;  2QMI A;  3OPP A;  1N9N A;  1H8Z A;  3G31 A;  3WS1 A;  1IYS A;  1DJC A;  3AZM B;  3A3I A;  5AV6 A;  4EO5 B;  1KE4 A;  4XZQ B;  4KUK A;  5IU1 A;  3UTA B;  1M40 A;  4IBE A;  3MKF A;  1A0K A;  1M1A D;  3MGS C;  2OSU A;  2NQB D;  4WMC A;  3WA9 C;  4KUD C;  2Z2L B;  3AN2 A;  3U2A A;  1IYO A;  3T1R A;  4EEP A;  2JCH A;  1MWR A;  4ID4 A;  3C1C C;  2ZOI A;  2RVQ C;  1P3L C;  3X1S D;  4KQD A;  1LSV A;  5DF7 A;  3CPT A;  5KSH A;  2VA0 A;  3B0B A;  4LLO B;  1P3O D;  2JE5 A;  4L9F A;  3S1Y A;  3HCY A;  3REJ C;  4KZB A;  3MGR B;  1SKO A;  3EQV A;  2Q0O A;  4Y0T A;  5MC7 A;  2Y2G A;  3WAA A;  1E4D A;  3WS0 A;  2ZY3 A;  4PM7 A;  1P3I D;  3PYP A;  3HJI A;  2A24 A;  1T19 A;  5DNM B;  2MJ6 A;  3KXB A;  4XT2 B;  4G3K A;  2JKT I;  1BH9 B;  4Z5T D;  3JVU A;  4E04 A;  2VGL S;  3CLO A;  5F99 B;  2IWC A;  3IF6 B;  4YOF A;  2EWW A;  4IBD A;  1P3L B;  3LID A;  4EET B;  3P7N A;  4Z2L A;  3TU4 B;  3REL A;  4P87 A;  4YNR A;  3AV2 B;  2NQB A;  4WMC D;  2YFV A;  3EOI A;  3G35 A;  3G30 A;  1EQZ B;  3FPV A;  4KQR A;  4WL9 A;  2W1R A;  1F9I A;  3WKJ C;  2NUP C;  5B24 C;  2JKT M;  1X0O A;  3MGP B;  2VV6 A;  4Z9Q A;  3AZH B;  2ZMV A;  5AVF A;  4DE1 A;  4KZ5 A;  2RCX A;  3VE4 A;  4JJN A;  1K6S A;  5GT3 B;  2ZC6 B;  5FI6 A;  3AV1 C;  1IEL A;  3LZ0 A;  4I3A A;  3UTB D;  1BZA A;  2HJE A;  1W63 Q;  3C4P A;  2EX2 A;  4S2O A;  1S66 L;  2HUE C;  4H9S A;  4GS9 B;  3UE3 A;  5BT1 D;  3RH8 B;  4ARZ B;  3KSH A;  1FSY A;  3NOP C;  5DFX A;  5GXQ C;  3IXG A;  3UB8 A;  3KXB D;  5CPJ C;  1QMF A;  1CF0 A;  3KXB C;  1ULY A;  1CK3 A;  3MVD A;  4LCM A;  5BNV A;  1LL9 A;  3UN7 A;  1H3Q A;  4G91 B;  5CPJ D;  1E8B A;  3KYZ A;  2BTF P;  4ME4 A;  2P9V B;  1Q2P A;  1L2S A;  1W7F A; 
#chains in the Genus database with same CATH homology
 2ARO A;  4WNN B;  3O62 D;  1L0E A;  3V3S A;  4X55 A;  4E3O A;  4WV4 B;  5B0Y A;  3AZG C;  4J8U A;  2LY8 A;  1KGG A;  5CPJ B;  2DRW A;  1PI5 A;  4CSR A;  1P3K C;  3VSL A;  3VP0 A;  4G91 C;  4KG6 A;  3ZVW A;  1W2E A;  3X1U A;  3AZN A;  3AZF A;  3PBS A;  5CHJ A;  5B32 G;  5B1M A;  4XUJ B;  3L26 A;  4DE2 A;  4YM6 D;  3UTA A;  2IWD A;  5DF8 A;  1M18 A;  1K25 A;  5GXQ A;  3N4I A;  3V9R B;  1CEG A;  3C1B D;  1BH9 A;  4WU8 A;  4E3L A;  5EUA A;  4HES A;  5B32 B;  5FI7 A;  2J8Y A;  1NY0 A;  3A6N C;  3IWI A;  1P3O A;  3LZ0 B;  1XA1 A;  4XUJ C;  1ERQ A;  3ZG0 A;  3UY6 A;  1MWU A;  5BS7 C;  5F1F A;  1U35 B;  3REI B;  2CV5 B;  2HP5 A;  3KWQ C;  1YMX A;  3RXW A;  3NDE A;  3FKV A;  3AZM A;  5F99 D;  4R1G A;  3MGS D;  5B33 D;  2EFU A;  5E2E A;  4E3K A;  5B32 C;  3NY4 A;  5DNM D;  3A6N B;  1XA7 A;  3LJA A;  1XP4 A;  3GR2 A;  3UDI A;  3W97 D;  3Q7V B;  2WGI A;  4DE0 A;  3O86 A;  3IT9 A;  3A3J A;  4J8U C;  4YM6 B;  4OJ6 A;  1M1A A;  5JA4 A;  4CJN A;  5CPK C;  1IYQ A;  3AZK B;  4JLF A;  3GTC A;  5DTT A;  2XR0 A;  3C7U A;  3IH8 A;  4Z66 B;  4IBB A;  2EX6 A;  4IBR A;  4Z66 A;  4GD6 A;  1TZY C;  5E5A D;  2OLV A;  4YM6 C;  4J8X C;  3AYW D;  4NFT A;  1F1E A;  5EVI D;  3A3D A;  3ZCZ A;  2F8N A;  1ERM A;  4JKT A;  1PW8 A;  5FI2 A;  4N1X A;  2JSS A;  1GHM A;  2H0Y A;  3MGQ C;  4GH9 A;  3E2L A;  3VH5 W;  4XUZ A;  1KX3 C;  2VGK A;  5FAP A;  1P3B D;  1P3F C;  3GMW A;  4S2P A;  2Y2K A;  3LJA B;  1P3B C;  2G5H C;  1YM1 A;  4FD8 A;  4PM9 A;  5B0Y B;  4JXW A;  4WU9 B;  3WS2 A;  4QLC B;  5KDM B;  4YS3 D;  3MZD A;  2BLS A;  2A49 A;  4DE3 A;  1YQS A;  1K4F A;  3MGQ B;  5AV9 A;  1CI9 A;  2E8I A;  2DNS A;  2WAE A;  1P3P A;  1QME A;  4UUZ B;  1E3U D;  5EVL A;  1DJB A;  1KX4 C;  4QLC C;  3O88 A;  5EVI A;  3ITB A;  5CPI D;  4JXV A;  2ZC5 B;  3DW0 A;  4N9L A;  3V9R A;  5HAP A;  3W99 D;  5FUG B;  2RVQ D;  1P3L D;  4WU8 B;  1J9M A;  1YT4 A;  3PBQ A;  4E45 A;  5GT0 D;  5BPV A;  5FUG A;  4PPR A;  3UTB A;  1IEM A;  3TU4 C;  2WZX A;  1KX5 A;  4KGC C;  1P3I B;  4H9O A;  1K55 C;  5CP6 A;  1PW1 A;  2C5W B;  4U0X A;  5CP6 D;  5JRG C;  3N8L A;  5G18 A;  3PBR A;  4R3J A;  2UWX A;  3CJM A;  5B24 A;  5GSU D;  5FSR A;  2CV5 A;  1K57 A;  3AZH C;  4C75 A;  3NC8 A;  1L0D A;  4X23 C;  4FSF A;  3SS4 A;  3WTP B;  2BG1 A;  1WE4 A;  4Z2M G;  3AZJ C;  4ZUX C;  1P3A B;  3B6F C;  3WS5 A;  5B32 A;  3REH D;  4GNU A;  1BH8 B;  4QLC D;  4GOG A;  4X69 A;  5CGX A;  5B0Y D;  1SDE A;  4WM9 A;  3AZL A;  2R9X A;  5B40 A;  4JJN B;  3REI A;  1JWZ A;  2Y2Q A;  1GA9 A;  3C1B A;  5CPK D;  4KZ9 A;  3SS3 A;  2FJ7 A;  3PBO A;  1ZG4 A;  3V39 A;  4OQG A;  4OJP A;  3L25 A;  3NQJ B;  3UTB C;  4ZTK A;  1ZC2 A;  5B1M D;  1P3A C;  3EPL A;  3B6F B;  1H5X A;  4E3J A;  2L5A A;  1NYM A;  3AV1 D;  5E5A B;  3UDX A;  2XEP A;  5CXW A;  3W96 A;  2HDR A;  3ZGA B;  2F8N K;  1HQ3 B;  4K0W A;  4HEF A;  3W98 D;  2J7V A;  5CPI C;  5B33 C;  1FCM A;  3AN2 D;  1K57 C;  3AZH A;  1W5D A;  2XFT A;  5D3O A;  4R4S A;  4H9P B;  1MPL A;  3WTP D;  3L27 A;  1E25 A;  4NYY A;  3NCK A;  3NQJ A;  1KX3 A;  1K54 A;  2HIO D;  5AV8 D;  2ARO D;  1YLY A;  5JA4 B;  1C3B A;  1AOI A;  4EV4 A;  1P34 A;  5B40 B;  1N4O A;  4YFM A;  3NI9 A;  5BO0 B;  3RJU A;  4R4R A;  5B33 B;  2FJ7 C;  2ZC7 A;  5DNM A;  4ZBJ B;  1W8Y A;  3AZN D;  3X1T C;  1TVF A;  4QU3 A;  4CAY A;  1PI4 A;  3ISG A;  5F82 A;  2G2W A;  5E2H A;  5HW3 A;  1BLC A;  4M6B A;  5KMW A;  3HL9 A;  3REI C;  1W79 A;  2F8N G;  1G6A A;  1M19 D;  3UT9 A;  1ES4 A;  1XPB A;  1VQQ A;  3UT9 D;  1TDG A;  1KGF A;  3X1S C;  4NZ4 A;  3MGQ D;  3REL C;  1P3L A;  3SH9 A;  3HRE A;  4AWL B;  4H9N A;  4DQY B;  4DDY A;  3QNC A;  4KZ4 A;  4PMA A;  3REL D;  4HGA C;  4XUJ D;  4E6X A;  1JFI B;  3UT9 B;  1WYC A;  3GV9 A;  3LCE A;  3C4O A;  2ZY5 A;  4GHA A;  5GSU C;  3L28 A;  4OQI A;  1PWD A;  3VP4 A;  3NQU B;  5A92 A;  3LY3 A;  4DXC A;  1P3P B;  3AZM C;  4XZQ A;  4MBK A;  3Q7V A;  4G92 B;  1HVB A;  4J8W D;  3IF5 A;  3WX7 A;  3AZN B;  3X1V B;  4OPQ A;  4HGA B;  2Y2N A;  2I72 A;  4OP8 A;  3O62 B;  3OPR A;  2WGW B;  3G32 A;  2RIQ A;  4J8V B;  2WAF A;  3WAA B;  5KZH A;  4KHA B;  3MKE A;  5B1L D;  3AZE D;  3BFE A;  3MGQ A;  1H3O B;  2Y59 A;  4MBF A;  3HLC A;  1F66 D;  1K4E A;  3AZI C;  1N1J A;  3AGE A;  1RGY A;  4LV1 A;  4E44 A;  5AV5 A;  1KDS A;  5C3I C;  5HAI A;  4X68 A;  2IWB A;  1M18 B;  3ZNY A;  3GRJ A;  2HIO B;  5AV8 B;  5DNN C;  4BLM A;  4CPK A;  5G49 A;  1YU0 A;  2WAD A;  2IOU A;  1WWI A;  2WGV A;  4Z5T C;  1KE0 A;  3W96 D;  4E6W A;  1PYY A;  2X71 A;  1BLS A;  3WA9 A;  4J8X D;  4KUD A;  3HLW A;  2C6W B;  1FR6 A;  5B2I A;  2ZM5 A;  4R8P D;  3D4F A;  3AFA A;  3MVD D;  3BFC A;  3EPK A;  4N1H A;  3GQZ A;  4J8W A;  4PM5 A;  1ID3 C;  4UA6 A;  1L0F A;  3B6F D;  3X1U B;  3AZF B;  3M2K A;  3AGD A;  1KX5 B;  3LEL C;  2HIO C;  5AV8 C;  5B0Z D;  1U35 D;  5CGW A;  1EQZ D;  4LV0 A;  5GLB A;  3O62 A;  4B88 A;  3UE0 A;  4C3Q A;  3IXD A;  3WKJ B;  5AY8 A;  5B1L C;  3ZG8 B;  3VH6 T;  4KZ6 A;  2XDM A;  3IWQ A;  2Y55 A;  4WBG A;  1B67 A;  1I2W A;  3B6G D;  5F99 A;  5B2J D;  3IF6 A;  4KG2 A;  4QY5 A;  3NQU A;  1K56 A;  3OCL A;  3HLB A;  5FAT A;  4S2M A;  3REH B;  4LCL A;  1P3A D;  4KGC B;  5AV6 D;  3X1U C;  3AZF C;  5GLC A;  3LEL B;  4KZ8 A;  3CMZ A;  2NQB C;  1L0G A;  3AZL B;  2HPB A;  5CRF A;  1ERO A;  1YUE A;  1U60 A;  5EE8 A;  5GXQ B;  1RP5 A;  4X23 B;  3MNN B;  5DTS A;  4GDB A;  3WTP C;  3AZJ B;  4KGC D;  4ZUX B;  4BD1 A;  3AV1 A;  3MGR A;  5M19 A;  2ZD8 A;  4QJG A;  3AZG D;  5AV5 B;  4K0X A;  4RYE A;  5B31 A;  2NQB B;  1M1A B;  5B31 D;  4LD9 B;  1B6W A;  4GN2 A;  2XQZ A;  1A7W A;  3AYW A;  3AZM D;  4FH2 A;  3VP2 A;  1S6R A;  3A1K A;  3UE1 A;  3IP4 C;  3ZVT A;  3HUM A;  3BLS A;  3B0D C;  5CEB A;  4QHC A;  2BYM A;  1K38 A;  1P34 B;  3NIA A;  2ZLY A;  5FQQ A;  5GHZ A;  4LD9 C;  4OLD A;  4H9Q A;  4YS3 A;  4MEZ A;  3ZHH A;  1ZLA C;  1NZO A;  5GT3 D;  4YS3 B;  1GA0 A;  4MNR A;  3W99 C;  3C1C A;  3NBL A;  1DY6 A;  1P3O C;  4S2K A;  1NXY A;  4WZ4 A;  4E3N A;  1P34 C;  3B0C W;  4NE5 A;  1Z6F A;  3W4Q A;  3AN2 C;  1XX2 A;  3WAA D;  3GVB A;  2WGW A;  3AYW C;  2Y4A A;  3WTP E;  2FJ7 B;  4ZBJ C;  3VMA A;  4R8P A;  2Y2P A;  3X1T B;  3REJ A;  4ZUX D;  1P3P D;  4IBK A;  3ZG5 A;  5B0Z C;  1P3I A;  3V50 A;  3P09 A;  1M6K A;  3OPL A;  4S2I A;  3AZK D;  5GLA A;  3Q82 A;  1HZO A;  5B24 D;  4UA7 A;  1SHV A;  4XUX A;  1MY8 A;  3X1S B;  3ZFZ A;  3REL B;  4RVA A;  1P3K D;  4WEJ A;  5B31 G;  3W97 B;  1FCO A;  5AV6 B;  3M2J A;  5GT0 A;  5DVA A;  5B2J C;  1JWV A;  4IBC A;  4H9S C;  2YFW B;  3MGS B;  3N3F A;  4P6B A;  5AQA A;  1YU3 A;  4ZAM A;  5AVC B;  5HFO A;  3KUY C;  3GSG A;  3UTA D;  3UT9 C;  4QD4 A;  3ZNT A;  1M19 B;  4CSR B;  4KG5 A;  3IXB A;  5GSU A;  3FKE A;  1ONH A;  3EG5 B;  4P0M A;  4DDS A;  4J8X A;  3X1S A;  4OKP A;  3VH6 W;  1YLZ A;  1N1J B;  4WZ5 A;  2PYO B;  4IBG A;  2Y2H A;  2ARO C;  1KX5 D;  5IHV A;  5FQK A;  4KZ7 A;  4JXS A;  3MGR C;  3X1V C;  2Q9M A;  1K55 A;  5FQI A;  5AVC C;  4X53 A;  4N9K A;  4WU9 C;  4KQO A;  2WKH A;  1AOI B;  5DF9 A;  4J8V C;  3WAA C;  5B40 D;  3W96 B;  3AFA B;  2ZQA A;  5TFQ A;  2B5R A;  5CEC A;  3AL0 C;  3UPO A;  1GHP A;  2ARO B;  5I94 A;  2ZMA A;  1N9B A;  3KS8 A;  2Y2M A;  5CGS A;  1M18 C;  4JPM A;  5F83 A;  3A1I A;  1KX4 D;  4WJ3 C;  3UTA C;  1BSG A;  1EQZ C;  5AY8 D;  3HON A;  4QLC A;  4J8U D;  3L2A A;  2RL3 A;  4IBX A;  2V20 A;  4RA7 A;  1YU1 A;  3AZE B;  5CED A;  4LD9 A;  2QPN A;  4D2O A;  1LI0 A;  1EI5 A;  5B2I B;  4WU8 C;  3VFF A;  3Q7Z A;  3C1C B;  1YU2 A;  5GT3 C;  3AV1 B;  4GZB A;  2W8S A;  3X1V D;  3HLF A;  4QNL A;  1I2S A;  4OPR A;  4H9O B;  4J8W B;  1G68 A;  3P98 A;  3R45 A;  4UAA A;  3W4O A;  2BYM B;  2V1Z A;  3W98 A;  5U47 A;  3KWQ A;  2JC7 A;  4JXG A;  5JYP A;  1LI9 A;  5EVI C;  2WZZ A;  3E2K A;  3KXB B;  4KHA A;  2NZD A;  5DNM C;  1BUL A;  1FOF A;  1H3O A;  3WS4 A;  5B2I C;  3MNN A;  5F99 C;  3IF6 C;  1P3G D;  4JF6 A;  1R4V A;  1BTL A;  3REH C;  1NRF A;  3PBN A;  3A3E A;  5M18 A;  3LEL A;  3AZL C;  4IBJ A;  1EWZ A;  5AQ7 A;  4DRB A;  4JJN C;  5B24 B;  2IO5 B;  1MKI A;  2XF3 A;  4Y0U A;  2QZ6 A;  5CHM A;  2HDU A;  2J9P A;  4FCF A;  5GT3 A;  5HAR A;  1F66 C;  3HLE A;  3AV2 D;  3X1T D;  3O3V A;  1JTD A;  4DF6 A;  3NDG A;  4UHU A;  5E5A C;  3KUY D;  1IKI A;  2HUE B;  1M1A C;  3HLG A;  1MWT A;  1S32 B;  1TZY A;  5E2F A;  3QHY A;  5CPI B;  1YLJ A;  1P3F D;  2EXB A;  2P74 A;  4NZ3 A;  3LZ1 B;  5B33 A;  4OQH A;  3M6B A;  3PTE A;  3MGR D;  3SH8 A;  4OOY A;  5CHU A;  3B0D B;  5GHY A;  2J8P A;  1KGE A;  1NZU A;  1CI8 A;  1JFI A;  2HDQ A;  4XUJ A;  4B4Z A;  1DJA A;  1ES3 A;  4H9P A;  4EBP A;  2ZQ8 A;  5A91 A;  4S2J A;  5FQJ A;  4IJF A;  1TDL A;  1XGI A;  3V5M A;  4Z2M H;  1W8Q A;  3LJA D;  3TG9 A;  3LO7 A;  4ZDX A;  4NET A;  2H0T A;  1YMS A;  4OVD A;  3IHA A;  2BYK A;  3G2Z A;  1Z2C B;  4JF5 A;  1KX4 A;  3SS5 A;  4DXB A;  1S32 A;  1E3U A;  5CPK B;  5BO0 A;  3IHB A;  3AYW B;  4JJN D;  3IXH A;  4LV3 A;  5EPH A;  3H0M C;  4LD9 D;  4OOL A;  3WA9 D;  4KUD D;  4E3M A;  5AV9 D;  2PYO A;  1FSW A;  3VOY A;  3AZI D;  3HLD A;  3C7V A;  5AV5 D;  5EOE A;  3MBZ A;  1YLT A;  2Z2M B;  4HBT A;  1BH8 A;  4AWL C;  3MZE A;  4P85 A;  2P9V A;  3BFD A;  4NE6 A;  2PBY A;  5TGF A;  4X23 D;  2ZM8 A;  4C6Y A;  4OPY A;  4X23 A;  2CV5 C;  1ALQ A;  5FAQ A;  3KWQ B;  5GXQ D;  3LEZ A;  2WUQ A;  4NZ1 A;  4S2N C;  5GSU B;  4XXR A;  2ZJ9 A;  4JBF A;  1KX3 B;  3MFD A;  5CPJ A;  3VH5 A;  4E3I A;  3AFA D;  3B6F A;  3W97 C;  1P3F B;  1KU5 A;  4KGC A;  3RXX A;  1JWP A;  3BFF A;  5B2J B;  5GL9 A;  5GT0 B;  1NYY A;  3WWX A;  5B0Y C;  3AZG A;  4NY2 A;  2HDS A;  3KUY B;  3O62 C;  1U35 A;  5F1G A;  3VH5 T;  3UPP A;  1BT5 A;  1ESI A;  3WKJ D;  1YU4 A;  3MGP A;  3AZK C;  4U0T A;  3REK A;  2H5S A;  3KSY A;  4H8R A;  2ZQC A;  3X1U D;  3AZF D;  3MGS A;  4XZQ C;  3X1V A;  2PU2 A;  2WKE A;  1JTG A;  1TZY B;  1YLW A;  3VFH A;  2FFY A;  4J8X B;  4PM6 A;  3WRZ A;  1KVM A;  5FDH A;  3BFG A;  4OOM A;  3AFA C;  1K54 C;  4RX2 A;  5CTN A;  2HP9 A;  2CWE A;  2XFS A;  4WZS B;  3N7W A;  4UUZ A;  1TAF B;  1MBL A;  1Q2Q A;  3BM6 A;  4IED A;  4R0Q A;  3REJ B;  1ES2 A;  1P3B B;  5JYO A;  1EQZ A;  2BYK B;  4O7D A;  5DTK A;  1KE3 A;  5JRG B;  3ZG9 B;  5B1L B;  1XKZ A;  4R23 A;  1OME A;  2ZY2 A;  3UDF A;  3HUO A;  4ZJ1 A;  4S2N A;  4IBF A;  4GHL A;  4ZJ3 A;  4J8V D;  2X02 A;  3REK D;  2FJ7 D;  1MWS A;  3BYD A;  3N8S A;  2Y2O A;  2XD1 A;  3G34 A;  5AVB D;  4J8W C;  3FYZ A;  4JF4 A;  5FAS A;  2Y91 A;  3W4P A;  1KX4 B;  1S0W A;  5AQ9 A;  5CPK A;  3MGP C;  3AZK A;  5CHL B;  1FCN A;  3LZ1 A;  3EPJ A;  3DWK A;  3MZF A;  3BEB A;  3VP1 A;  3W99 A;  2V2F F;  1XGJ A;  3UTB B;  5EOO A;  2GDN A;  3LY4 A;  4PM8 A;  3A6N D;  2WK0 A;  2XH9 A;  4BEN A;  2Y2L A;  1P3B A;  5B31 C;  1P3I C;  4BJP A;  1GCE A;  2XLN A;  1AOI D;  1TZY D;  4HBU A;  4WNN A;  1P34 D;  2PU4 A;  2X01 A;  3ITA A;  3OC2 A;  3QNB A;  4WEK A;  2CV5 D;  4MBH A;  4OLG A;  3Q1F A;  5A90 A;  3O87 A;  2J9O A;  5L2F A;  1IYP A;  5B31 B;  5B32 D;  3REH A;  4KQQ A;  4UA9 A;  2FFF B;  5A93 A;  2JBF A;  3HSH A;  5M1A A;  5B0Z A;  4BD0 A;  3AZG B;  1XXM A;  4Q8I A;  2F8N H;  2CC1 A;  4OH0 A;  1PZR A;  3B6G C;  5AQB A;  1P3K B;  4YS3 C;  4MLL A;  5AV9 C;  3AZI A;  1ZG6 A;  3A6N A;  4IVK A;  5B1M C;  3C5A A;  1P3O B;  3BRM A;  5E5A A;  3S22 A;  5CPI A;  1PWG A;  3AN2 B;  5KSC A;  1HQ3 C;  2Y2I A;  4BL2 A;  4EQI A;  2ZC3 B;  1HQ3 D;  1MXO A;  1YLP A;  5AVB B;  3B6G B;  3MVD C;  4R8P C;  4NYU A;  5AV9 B;  3BEC A;  3R45 B;  1KDW A;  5B1M B;  1AXB A;  2XK1 A;  1WYB A;  3PAE A;  3V3R A;  3ZDJ A;  2G5I C;  3LZ0 C;  3HVF A;  4N92 A;  4F94 A;  3PAG A;  5JRG D;  5B0Z B;  3EPH A;  2NZD B;  3MXS A;  5JRG A;  1P3M D;  2YFV B;  1BUE A;  5B40 C;  4L0L A;  5B1L A;  1PWC A;  1Q9C A;  4KZA A;  5AVB C;  3MVD B;  1O07 A;  3AZJ A;  4R8P B;  1HD8 A;  4OON A;  1ID3 A;  4G92 C;  5AV6 C;  3G4P A;  5B2J A;  1TEM A;  1Y54 A;  1IKG A;  3AZN C;  1PZO A;  1T3U A;  1I5Q A;  2NZD C;  4KZ3 A;  1M18 D;  1HTA A;  4NE3 A;  5HL1 A;  3MGP D;  1FQG A;  4LEN A;  4OUI A;  2VQR A;  3SOI A;  1P3M B;  3CG5 A;  2ZM0 A;  4OJL A;  2NZD D;  3LZ1 D;  3OZH A;  3TOI A;  2ZY4 A;  2PYO C;  3B3X A;  4IVI A;  3WTP A;  1P3A A;  2H10 A;  5CTM A;  4Z66 C;  3Q07 A;  5C3I B;  3TU4 D;  4EWF A;  2F2A C;  3AV2 A;  5DNN B;  3JYI A;  4YM6 A;  1RGZ A;  4EUZ A;  5AVC A;  3KS4 A;  5GT0 C;  2DF4 C;  4U3T A;  3H0R C;  3DTM A;  1AOI C;  3KUY A;  5BNX A;  4Z5T B;  4RX3 A;  3W8K A;  1JVJ A;  3DWZ A;  3W96 C;  4FH4 A;  1CEF A;  2Y2J A;  4A5R A;  3AZJ D;  1P3G C;  3UNW A;  4J8V A;  1P3F A;  1KX3 D;  1K56 D;  3IH9 A;  3MNN D;  1P3P C;  4IBI A;  1ID3 B;  3FKW A;  3W97 A;  4H9N B;  3LJA C;  3AZL D;  5BOH A;  3N6I A;  1ZLA A;  3LEL D;  3N8R A;  3AZE C;  3FZC A;  5E43 A;  1WWS A;  5BS7 A;  2EX9 A;  1P3G B;  3AZI B;  1F66 A;  4BL3 A;  3TU4 A;  4XZQ D;  1VM1 A;  3AV2 C;  3X1T A;  2Q9N A;  4WEL A;  5BT1 C;  3OCN A;  2A3U A;  1M19 A;  4EBN A;  4YIN A;  4BQM A;  3PBT A;  4GD8 A;  5EVI B;  2XGN A;  1BLH A;  2F8N B;  4NZ5 A;  2HP6 A;  3MNN C;  1P3G A;  3C1C D;  5B2I D;  4IJE A;  3FV7 A;  4B4X A;  3VOZ A;  3WRT A;  3H0L C;  4DKI A;  5J8X A;  3P5J B;  4CAY B;  2G2U A;  1FR1 A;  4Z66 D;  4ZBE A;  5HAQ A;  4GB7 A;  1KX5 C;  5FAO A;  1H8Y A;  4LG2 A;  1O7E A;  3VP3 A;  2IO5 C;  4R3B A;  1P3M A;  4X6T A;  1SCW A;  2ZQ9 A;  3AGF A;  5CER A;  4H9R B;  4UPK A;  5AVB A;  4X56 A;  1F66 B;  1ESU A;  1ES5 A;  2VGJ A;  2OV5 A;  2ZC4 B;  1S32 D;  2ZQ7 A;  4DRA A;  3G2Y A;  1ONG A;  3FWL A;  4OQ0 A;  1S32 C;  2XD5 A;  5G49 B;  3C1B C;  2F8N D;  3REK B;  3Q81 A;  4H9Q B;  3IQA A;  3B0C T;  1ZLA B;  2PYO D;  3REI D;  3HBR A;  3OPH A;  4H9R A;  4Y0O A;  3LZ1 C;  1P3K A;  5FQM A;  3LZ0 D;  1LL5 A;  4K91 A;  4QB8 A;  3MXR A;  3REJ D;  5FQ9 A;  5DNN A;  3IWO A;  5KDM A;  3HUN A;  3I7J A;  3ZG7 B;  5CP6 C;  5AV5 C;  1K6R A;  5AVC D;  4Y7P A;  4S2L A;  4QY6 A;  3C1B B;  3REK C;  4Z5T A;  5BNX B;  4OJ5 A;  3FDD A;  1GHI A;  4KEN B;  3A3F A;  1TAF A;  4OPZ A;  1SDN A;  5FA7 A;  2EX8 A;  3F6T A;  4WZ5 C;  2DCF A;  5EEC A;  4ZUX A;  4NK3 A;  3UPN A;  2HIO A;  5AV8 A;  1ID3 D;  2OLU A;  4WYY A;  4OP5 A;  5CP6 B;  1LLB A;  5AY8 C;  4WU9 A;  1U35 C;  4GKU A;  3M6H A;  2EXA A;  1ZLA D;  3AZE A;  1PIO A;  3TSG A;  2WYX A;  1ZKJ A;  2ZQD A;  4DRT A;  3B6G A;  4WU8 D;  3S4X A;  4GDN A;  3W99 B;  4M3K A;  2ZM2 A;  3BLM A;  5DNN D;  1PZP A;  2WKI A;  3UO9 A;  3W98 C;  1SKF A;  3EQU A;  2YFW A;  4ZJ2 A;  4J8U B;  4EBL A;  5AY8 B;  4LV2 A;  3L29 A;  1NJ4 A;  1HQ3 A;  1M19 C;  5HX9 A;  3KWQ D;  5TR7 A;  1KVL A;  2DQN C;  1BFM A;  3VH6 A;  1BLP A;  4OJO A;  3SH7 A;  5BNV B;  4EO5 C;  3VSK A;  5E2G A;  3W98 B;  1RCJ A;  4WU9 D;  1HTZ A;  5GHX A;  2EFX A;  3CZD A;  3WA9 B;  4KUD B;  3AZH D;  2R9W A;  1LHY A;  3WKJ A;  3KFU G;  5GLD A;  1P3M C;  2QMI A;  3OPP A;  1H8Z A;  3G31 A;  3WS1 A;  1IYS A;  1DJC A;  3AZM B;  3A3I A;  5AV6 A;  4EO5 B;  1KE4 A;  4XZQ B;  3UTA B;  1M40 A;  4IBE A;  3MKF A;  1M1A D;  3MGS C;  2OSU A;  2NQB D;  4WMC A;  3WA9 C;  4KUD C;  2Z2L B;  3AN2 A;  1IYO A;  2JCH A;  1MWR A;  4ID4 A;  3C1C C;  2RVQ C;  1P3L C;  3X1S D;  5DF7 A;  5KSH A;  3B0B A;  1P3O D;  2JE5 A;  3S1Y A;  3REJ C;  4KZB A;  3MGR B;  4Y0T A;  3EQV A;  2Y2G A;  3WAA A;  1E4D A;  3WS0 A;  2ZY3 A;  4PM7 A;  1P3I D;  5DNM B;  3KXB A;  1BH9 B;  4Z5T D;  5F99 B;  2IWC A;  3IF6 B;  4IBD A;  1P3L B;  3TU4 B;  3REL A;  4P87 A;  3AV2 B;  2NQB A;  4WMC D;  2YFV A;  3G35 A;  3G30 A;  1EQZ B;  4KQR A;  3WKJ C;  5B24 C;  3MGP B;  4Z9Q A;  3AZH B;  4DE1 A;  4KZ5 A;  2RCX A;  4JJN A;  1K6S A;  5GT3 B;  2ZC6 B;  5FI6 A;  3AV1 C;  1IEL A;  3LZ0 A;  3UTB D;  1BZA A;  3C4P A;  2EX2 A;  4S2O A;  2HUE C;  4H9S A;  3UE3 A;  5BT1 D;  1FSY A;  5GXQ C;  3IXG A;  3KXB D;  5CPJ C;  1QMF A;  3KXB C;  1ULY A;  1CK3 A;  3MVD A;  4LCM A;  5BNV A;  1LL9 A;  3UN7 A;  4G91 B;  5CPJ D;  2P9V B;  1Q2P A;  1L2S A;  1W7F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...