2Y2IA

Penicillin-binding protein 1b (pbp-1b) in complex with an alkyl boronate (za3)
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
487
structure length
467
Chain Sequence
ISEITYSDGTVIASIDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTGQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PENICILLIN-BINDING PROTEIN 1B
publication title Structure-Guided Design of Cell Wall Biosynthesis Inhibitors that Overcome Beta-Lactam Resistance in Staphylococcus Aureus (Mrsa).
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
total genus 159
structure length 467
sequence length 487
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2y2iA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2y2iA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2y2iA02
4QD4A 3O3VA 2CC1A 1K4EA 2ZQDA 4IBXA 1YLTA 1L0EA 4E6WA 1FOFA 4WZ4A 4OPYA 1TEMA 3Q7ZA 2B5RA 5E43A 4JXWA 4ZAMA 3VSLA 5HW3A 1E25A 5EECA 3IXGA 5EVIB 4JXGA 1QMFA 4PM8A 3ZG5A 5GLAA 4BJPA 1W79A 1J9MA 2QPNA 3ZGAB 5FQIA 3Q07A 3IF6A 4GZBA 5DVAA 1ZKJA 5JYOA 4R1GA 4WM9A 2Y2GA 2XGNA 4C3QA 2ZMAA 4MNRA 4WELA 4KG6A 3OCNA 4DF6A 4XUXA 3UY6A 3BECA 3PAEA 3IWOA 4U3TA 5GL9A 4WMCA 1LL5A 1L0FA 1ZG6A 3HLBA 3P98A 4K91A 1GHMA 3IHAA 5AQ9A 3WWXA 3FKWA 4E3IA 1MPLA 3VSKA 1JVJA 2HP5A 5TR7A 1H8ZA 5FQ9A 1PYYA 3O87A 1N4OA 4D2OA 4FH4A 3G32A 4QY5A 4MBHA 4JXVA 1JWZA 1SDEA 2Y4AA 5FQQA 1IYPA 1XP4A 5FAOA 3BEBA 1NJ4A 2P74A 4OOLA 2HPBA 4QHCA 4KZ5A 3UE3A 4PM6A 4XXRA 4GB7A 1FSYA 1FR6A 2JBFA 3OPRA 3FYZA 2JE5A 5EVLA 1XX2A 4N9KA 5JYPA 3PBQA 2A3UA 2WAEA 2P9VA 4X56A 4JLFA 3HL9A 1MBLA 5FI6A 1XXMA 4KENB 5E2HA 3HUMA 2X02A 3G35A 2XFTA 2WAFA 3FKVA 4JBFA 4ZTKA 4U0TA 3VFHA 5IHVA 1K56A 4RX2A 5E2FA 3HVFA 3M2KA 1PW1A 1FCOA 2IWDA 4WYYA 1BTLA 3VFFA 3WS4A 2ZQ7A 4EV4A 1C3BA 3AGDA 1Y54A 3HLCA 3Q7VB 5FAPA 1PW8A 3SH7A 1BSGA 3NCKA 1PZPA 4O7DA 1NY0A 1PWDA 3MXRA 5FDHA 4BENA 1CK3A 4MBFA 4DE3A 4OQ0A 1AXBA 1K6RA 3UDIA 4DXCA 2ZM8A 3JYIA 4WMCD 3AGFA 5CHJA 3ZNTA 1QMEA 2WZXA 4LCLA 2XD1A 5CECA 3QHYA 5J8XA 3ISGA 3PTEA 3VP2A 1XGIA 3UPPA 1FQGA 3ZG7B 1Z6FA 4ZJ3A 5A93A 5HAQA 3BRMA 1YLYA 3BLMA 1CEFA 1K57A 4R0QA 1YMXA 2ZD8A 5FATA 2QMIA 4RVAA 3IH9A 1K4FA 3LY4A 4IEDA 3ZHHA 1YT4A 2Q9MA 2IWCA 3UE0A 1KDWA 2PU4A 5EVIA 4CPKA 3PBNA 5HL1A 4Q8IA 1JWPA 2UWXA 4MBKA 3SOIA 2QZ6A 3IT9A 1PIOA 3ZG0A 3WS2A 1CI9A 2ZC6B 3IXHA 4GNUA 2J8YA 4QY6A 5G18A 4UA7A 2DRWA 4S2JA 1WYBA 3OCLA 2Y2NA 5EOEA 1IYSA 4ZBEA 1W8QA 4DDYA 3IWIA 4IVKA 2FFYA 1KE4A 2XDMA 1K56D 5KSCA 4LV0A 5FI2A 3OZHA 3S22A 3W4PA 3UO9A 4C6YA 1PZOA 5CEDA 2RL3A 1NYMA 4EBNA 5DTKA 3NDEA 3OPPA 2WGWB 4GN2A 3DWZA 2RCXA 2Y2PA 5GLDA 4PM7A 2X71A 2Y59A 3IXBA 3IXDA 5TFQA 3PBOA 3HLWA 3OPLA 2G2UA 4OQIA 5DF9A 1H5XA 2DCFA 5HARA 2C6WB 4OP8A 3B3XA 4EQIA 1ALQA 1I2SA 2E8IA 4ID4A 5FQMA 2WUQA 1LLBA 1O07A 1LL9A 2EX2A 1MWSA 1XPBA 3HBRA 5FAQA 4BD1A 4OOYA 3I7JA 1KDSA 1IKIA 4R3BA 4WEKA 3C4PA 3E2KA 4S2OA 1KGEA 4GD8A 5FA7A 5A91A 2HDQA 3O88A 4OVDA 3O86A 1HD8A 4RX3A 5FASA 1K6SA 5F1FA 4DE0A 3ZG9B 5EVID 1LI9A 4UHUA 2EX6A 1OMEA 3OC2A 3SS3A 2H0YA 1PWGA 1YLZA 4KQOA 1ERMA 5F1GA 4KZAA 3DWKA 4YINA 2A49A 2BLSA 3VMAA 5AQAA 4HEFA 3Q7VA 5FQJA 4OONA 4P85A 1YLJA 1ES4A 5CGXA 2XQZA 4UA9A 5CHUA 1FSWA 5EE8A 3RXXA 4ZJ1A 1TVFA 3Q1FA 3BM6A 1GA0A 1MWUA 5HAIA 2EXAA 4P87A 3UPNA 5U47A 1NYYA 4DE2A 4KG5A 4KG2A 1BT5A 1ZG4A 2XF3A 3BFEA 4KQQA 2VGJA 4S2NA 1K54C 1K57C 5AQ7A 2WKIA 2X01A 3ZDJA 4OLGA 4PM5A 3AGEA 3UDXA 4EBPA 3A3DA 1Q2PA 2ZLYA 4OQGA 3C7VA 3CJMA 3FZCA 2XK1A 5CTNA 1SHVA 2Y2IA 5HX9A 5EVIC 5EPHA 4E3MA 4WBGA 1DJBA 4X55A 4E3KA 1GCEA 2Q9NA 2Y91A 5F82A 2JC7A 3BFCA 1WE4A 2ZM2A 3NDGA 3VP4A 4LENA 4FH2A 2Y2HA 4Z9QA 1BLCA 3PBTA 4OH0A 3G2ZA 4UAAA 5AQBA 3BYDA 5KSHA 4KZ9A 4C75A 1NRFA 1KGFA 3MZEA 3SS5A 2WKHA 3PAGA 4WZ5C 4DKIA 4GD6A 3C7UA 3SH9A 5CGWA 1ES3A 2GDNA 3IWQA 3HREA 2WGWA 3NY4A 2HDRA 4LV3A 4WEJA 4PMAA 3IQAA 2I72A 3LY3A 1SKFA 1ONGA 1EI5A 3HUOA 1W7FA 1PI4A 5FQKA 3Q81A 3VOYA 3N6IA 1IYOA 4X68A 1WYCA 5D3OA 2DNSA 5DTSA 3GVBA 4BQMA 4U0XA 1XA1A 4FD8A 3RXWA 4DDSA 1YMSA 2ZC3B 3G31A 5CGSA 1O7EA 4S2LA 1HVBA 1KE3A 4M3KA 1HTZA 5BOHA 4X6TA 4JPMA 5KZHA 4KQRA 5CXWA 5CEBA 3IF6C 3P09A 3WS1A 4S2KA 5EUAA 1TDGA 1G6AA 4KZ7A 3W8KA 4BL3A 1MKIA 4E3JA 2JCHA 1KE0A 4OP5A 4DRTA 4CJNA 1KVLA 1ESIA 3GR2A 1MY8A 1I2WA 4X69A 1DY6A 3MXSA 2P9VB 4PPRA 1BUEA 3A3FA 3IHBA 4RYEA 4QJGA 4K0XA 1ES5A 1H8YA 4N92A 1ZC2A 4BD0A 3BFFA 2Y2MA 5CERA 3G30A 5F83A 4LV1A 2ZQCA 4X53A 2V2FF 4N9LA 3WS0A 3SS4A 3HUNA 3BFGA 3Q82A 1W5DA 3A3IA 2WZZA 3NBLA 4OPQA 2WK0A 4XUZA 1NZOA 3UNWA 1EROA 4HESA 4Y0TA 4E6XA 1NZUA 4EBLA 2EFUA 5M19A 2WKEA 1SCWA 3GSGA 1JWVA 5HFOA 3BLSA 4JF4A 2ZQ8A 1LHYA 1PI5A 2ZC7A 1K55A 3G34A 1HZOA 1BLHA 2XLNA 1BZAA 3LO7A 1VQQA 2Y2QA 4LCMA 3S4XA 3V39A 1YLPA 5DF7A 4KZ4A 1DJAA 2Z2MB 3TSGA 2ZM0A 1ONHA 4EWFA 1CI8A 3N4IA 5A92A 1IELA 3EQUA 3HLEA 3MKFA 4FSFA 4L0LA 1IYQA 2XD5A 3EQVA 4Y0OA 3UDFA 1M40A 4B88A 4P0MA 2OV5A 4R4SA 2XFSA 5E2EA 1XA7A 3CZDA 3QNBA 4N1HA 1Q2QA 3ZNYA 4ZDXA 1E3UA 1YLWA 3C4OA 4OKPA 4QB8A 3HLFA 1BLPA 3MZFA 4HBUA 3RJUA 3DW0A 2HDSA 1K38A 3ZVWA 1MWTA 4H8RA 1M6KA 4IBRA 2G2WA 4S2IA 5FI7A 4B4XA 3V3RA 3TOIA 3VP0A 3M6HA 5E2GA 1L2SA 3PBRA 4IVIA 1RGZA 1GHPA 4LV2A 3M2JA 4QU3A 1BULA 3LEZA 3HLDA 5FSRA 1RGYA 2OLVA 3SH8A 4MEZA 2Y2KA 3ITBA 2C5WB 5HAPA 2Y2OA 1JTDA 5GLBA 3UE1A 1L0GA 3WRZA 4OPZA 3VP1A 4R23A 4JKTA 4NETA 1K25A 1KVMA 4RA7A 4DXBA 5TGFA 3N8LA 2PBYA 4OLDA 2PU2A 1RCJA 2H10A 2BG1A 3WRTA 3GV9A 5GHYA 3M6BA 2XR0A 3MKEA 3E2LA 4K0WA 3QNCA 3GMWA 3WS5A 3C5AA 4KZBA 4OOMA 5CTMA 3VOZA 4OPRA 3GTCA 3IF6B 2EXBA 4N1XA 4UA6A 5DTTA 1LI0A 3BFDA 1L0DA 3MZDA 4B4ZA 1E3UD 2WADA 1NXYA 2Y2LA 3IH8A 1CEGA 2WGVA 3CG5A 3S1YA 1S6RA 1I5QA 1FCNA 3G2YA 3W4OA 4BL2A 1EWZA 4EUZA 1ESUA 2EFXA 3N8SA 1BLSA 3FWLA 1U60A 2Y55A 3ZCZA 1MWRA 1JTGA 2ZC5B 3FV7A 3NI9A 4S2MA 3V3SA 2J9PA 5A90A 5GHXA 1GHIA 1YM1A 2XH9A 3ZVTA 1K55C 4PM9A 2OLUA 3N8RA 3D4FA 5DF8A 3V50A 2HP6A 4GDNA 1IEMA 2R9XA 1YQSA 4NK3A 3NIAA 5CRFA 1GA9A 1W8YA 3MBZA 1KGGA 4JF6A 3ITAA 2V1ZA 4P6BA 3UPOA 3W4QA 2ZC4B 4R3JA 2V20A 2ZQAA 1K54A 1VM1A 3MFDA 3TG9A 5EOOA 4E3OA 2OSUA 4GKUA 2H0TA 4KZ6A 5I94A 1MXOA 5KMWA 2WGIA 3UN7A 4JF5A 3OPHA 4DE1A 2HP9A 1XKZA 4HBTA 4YFMA 3VP3A 3PBSA 1ES2A 1FCMA 2FFFB 1DJCA 2XEPA 2ZJ9A 3IF5A 4GDBA 4JXSA 1PWCA 1FR1A 3HLGA 4OQHA 5M1AA 5M18A 2R9WA 3NC8A 4E3NA 3A3EA 3GQZA 2ZQ9A 2IWBA 3V5MA 5CHMA 1G68A 4A5RA 2HDUA 3G4PA 4E3LA 3ZG8B 3LCEA 2VGKA 3CMZA 4R4RA 5L2FA 4FCFA 4Y7PA 4KZ8A 1ERQA 3DTMA 4Y0UA 1S0WA 4S2NC 4GOGA 1RP5A 1SDNA 1XGJA 4WZ5A 4ZJ2A 4S2PA 1E4DA 3A3JA 3N7WA 3ZFZA 1IKGA 1N9BA 2Y2JA 4KZ3A 1TDLA 2WYXA 2J7VA 2H5SA 4F94A 4BLMA 3GRJA 2Z2LB 2J9OA 4MLLA 2EX9A 5GLCA 2EX8A 5GHZA
chains in the Genus database with same CATH superfamily
2B18A 1K4EA 4E6WA 5E43A 1P3FD 3KSFA 3V9RA 3Q7ZA 5EECA 4CLCC 3LYXA 3IXGA 2F8NK 4PM8A 5L07A 3MVDC 3KX0X 1J9MA 3O62D 3UTBA 2GX5A 3REHD 3KUYD 3AL0C 1T18A 5DVAA 2F8NB 2Y2GA 3AV1C 2W3EA 4MNRA 3OCNA 1P3ID 3L25A 4XUXA 5CP6D 3B0DB 2PRFA 3PAEA 5AV9B 3CAXA 1L0FA 3LIDA 3R45A 4E3IA 3IHAA 3FKWA 4NKPA 1MPLA 1JVJA 4CAYB 4KHAA 5FQ9A 4D2OA 2EWWA 2W3DA 3OOVA 4EQ1A 5C3IB 1Q9CA 4MBHA 5EFWA 1F66D 4X1MA 5EM0A 1G28A 4IBEA 2P74A 2HPBA 1H8PA 5F6AA 1VHMA 3UE3A 4PM6A 4NE5A 4WU9B 3MNNB 1FSYA 1W1VA 3OPRA 1XX2A 3NOPC 1BYWA 1MBLA 5FI6A 2VV6A 4EXOA 3RELA 2W1TB 2P08A 3CITA 3A0RA 3FKVA 4JBFA 3VFHA 3H82A 3MGPC 5F99B 2NUTC 3WS4A 2JKRM 2ZQ7A 2IO5B 3X1UB 3AGDA 1UWPX 3HLCA 4Z66A 3SH7A 5AV5C 1J3WA 3MXRA 5FDHA 5DNNA 1Y28A 1CK3A 2F8NH 3CUEC 5F1FA 1K6RA 5B33B 4I38A 1P3AB 3DTEA 2P04A 1E6ZA 4H6JB 4XZQA 3LIBA 5B0ZC 1XGIA 1A0KA 3LZ1B 3L7HA 1BH8B 3X1VD 3BRMA 2HF6A 3BLMA 1CEFA 2ZD8A 3R7WB 5GXQB 1K4FA 5B31C 1H8MA 1KDWA 3RH8B 4GLQA 2UWXA 3U2AA 3SOIA 5B40C 3ZG0A 2ZC6B 4CQHA 3WKJA 3LIFA 3OCLA 4CLCB 2Y2NA 5EOEA 2VJWA 2B02A 4DDYA 1CJFA 3IWIA 3MVDB 2W1RA 2XDMA 5B2ID 5KSCA 5FI2A 2ZBBA 3W4PA 1TAFA 4EBNA 3C30A 2M7UA 3NDEA 2WGWB 3AV1B 4GN2A 3EPLA 3DWZA 5GLDA 5B32G 4MB4A 4X23C 2XRNA 1KOUA 5TFQA 4Q0JA 3HLWA 3OPLA 2DCFA 3LELA 4J8UD 3LJAB 4EQIA 4ID4A 4DMZA 1O6IA 2WUQA 5AVCA 1O07A 1MWSA 3HBRA 3I7JA 1KDSA 3E4QA 2LY8A 3AN2C 5HDCA 2VKSA 5FA7A 4OVDA 3WTPA 3C1BA 1W1PA 3KXBB 4L9EA 2HUEC 3EPHA 2W27A 3VH5T 1HLUP 4YM6A 3B6GC 4KQOA 4KZAA 3DWKA 3MGRA 2BLSA 3VMAA 2F8ND 1P3OA 1FILA 4P85A 3AZJA 4OJPA 5CGXA 3H0LC 3W96A 4UA9A 4XT2B 4HJ6A 2ZOHA 3JVUA 4ZJ1A 1TZYA 5AV9D 3BM6A 1GA0A 3UMDA 5L10A 5HAIA 3UPNA 5U47A 4MCWA 1GPFA 5B24C 5AV5B 1ZG4A 3AZGB 1DRMA 4S2NA 2WKIA 3ZDJA 3UDXA 1P9WA 3A3DA 5BNVA 1Q2PA 2BTFP 4OQGA 3CJMA 2XK1A 5EVIC 1U35C 5B0ZB 1YPRA 4E3MA 1DJBA 1GOIA 1GCEA 2Q9NA 2Y91A 5F82A 4WU9D 3MNND 1DP6A 3AZNA 1WE4A 1NWZA 3F1OA 5B2JC 3IBJA 5F68A 4FH2A 3T4JA 1BLCA 4OH0A 5B31B 3HJKA 1KGFA 3MZEA 2WKHA 4DKIA 3BW6A 5F99D 5FEGA 3SH9A 1JFIA 1T19A 1E6PA 5G49B 3X1UD 1XFQA 1ACFA 2FH5A 3NY4A 4WEJA 3KS8A 3LY3A 4IJGA 4IBBA 3CWFA 1YU3A 3IP4C 2P7JA 3HUOA 1PI4A 3Q81A 4X68A 5B33D 5BO0A 3LIAA 4HP9A 1ZLAA 3LZ1D 3G31A 5CGSA 4BWIA 3X1TA 2ZY5A 4LLOB 4XUJA 3IF6C 5GXQD 4H9RB 4S2KA 2ACGA 4HHDA 1YU2A 3W8KA 2JCHA 4HH2A 3WD2A 4DRTA 2NQBA 4CJNA 2KLIA 5HL6A 1MY8A 1AIWA 5LBRA 3AN2B 2K31A 3MXSA 3IHBA 3MXQA 4R38A 2Z6DA 4CLCD 1ES5A 4N92A 1KX3A 3VH6T 2HUEB 1M18A 3B0BA 3MVDD 3B6GB 1YKDA 4X53A 4N9LA 3NBLA 2WZZA 5FDSA 4H9QA 1NZOA 4AFIA 3AV1D 4EBLA 3L29A 3W98A 1GSVA 2WKEA 1SCWA 3IS2B 2A2LA 5M19A 1P3KA 5HFOA 4QLCC 3G34A 3LO7A 1BLHA 3S4XA 2ZM5A 3MQ0A 3LJAD 4KZ4A 4NE3A 2Z2MB 5B24B 4EWFA 1VB6A 3EQUA 3MKFA 3EQVA 3UDFA 1PZRA 1YUEA 3MMHA 4WU8C 2XFSA 3REKC 1B67A 3AFAA 1N1JA 3TU4A 3KXBD 1E3UA 1V9ZA 4HP4A 4OKPA 2VV7A 3RJUA 5HWWA 3DW0A 4IUHA 2HDSA 5B2JB 4PKYA 4B4XA 4KGCA 5E2GA 5B1LC 5GT0A 2W0NA 1BULA 3HLDA 1RGYA 2OLVA 1KU5A 3ITBA 2C5WB 3AZMC 5AV5D 2Y2OA 3DBAA 3MGQB 1AOIC 5GLBA 4CLCE 3AZGD 3WRZA 3E4OA 3REJC 4JKTA 4JJNC 4J8VD 4RA7A 2QJ5A 5F69A 2V1AA 3AZHA 3WD0A 4OLDA 5B0ZD 2BASA 2PD7A 3GV9A 4L9FA 2FN2A 3QNCA 3JPUA 3K3DA 1OTBA 4KZBA 3MGSC 4Y2FA 3IF6B 5DTTA 4N1XA 1T3UA 1LI0A 4H9OA 2M1CA 4YS3C 3PR6A 2J3TC 4UQIS 4B4ZA 2WADA 5B31D 1Z2CB 3CG5A 1S6RA 1I5QA 2JHEA 4IHQA 4BL2A 3C1CA 2V9AA 4O0PA 3CPTA 1P3BC 1OJGA 1AWIA 4DRBA 4NZ5A 3B33A 3O5YA 4Y15A 4G92C 3LI9A 1H0MA 2A24A 2J9PA 4Z2HA 4I5SA 1K55C 4PM9A 2INWA 2OLUA 3N8RA 1P3FA 5TBMA 2V0WA 3E98A 3T12B 1YQSA 5CRFA 4II7A 4P6BA 3W4QA 1NRJA 4R3JA 3O62A 4KZ6A 5KMWA 5CPJC 3REHA 3KUYA 1P3PD 3EGXC 1J7MA 4GHIB 5F5YA 4LRYC 1XKZA 3AZLB 4HBTA 4GDBA 2XEPA 4OQHA 4JXSA 5M18A 1P3IA 2OWHA 5CP6A 5DKKA 3AN2D 2IWBA 1XJ2A 1G68A 4A5RA 3CMZA 4R4RA 2O0YA 4FCFA 1S0WA 3H0MC 1RP5A 3H7WA 3B6GD 2AVXA 4S2PA 1IKGA 1F66A 5B0YC 2J7VA 2QWSA 2ZL1B 4BLMA 4IBCA 3GRJA 3W99C 5B1LB 1IFQA 2EX9A 5FSRA 3NQUB 4G3VA 4QD4A 5EM1A 2CC1A 3MR0A 1YLTA 1G6OA 5HW3A 2B5RA 4JXWA 3W97C 1E25A 1SZVA 1HQ3B 5B24D 5FUGB 3LZ0B 1YAXA 3REJB 4JJNB 3ZG5A 4NY2A 2JKRI 5FQIA 1P34B 2QJ7A 3AZIC 2XGNA 1TS6A 1W2EA 4YNRA 3WA9B 4WELA 3BECA 5B1MB 5DNMC 1M19C 4B9OA 4H9PA 4K91A 4YS3B 3HLBA 3P98A 1GHMA 3WWXA 1OGGA 1VETA 1N4OA 3X1VA 3AV2C 2NZDC 2O9BA 1P3BB 3AZKC 5FAOA 1NJ4A 3MGQD 3MQQA 4QHCA 4G92B 3JVVA 2L1MA 1FR6A 2JBFA 4N9KA 4Z5TC 3PBQA 3VV4A 2J80A 2WAEA 2P9VA 4X56A 4JLFA 4GS9B 3HL9A 1B6WA 3K2NA 3UT9C 4KENB 4HGAC 5DFXA 2X02A 4J8WB 2CWEA 5B2IA 5E2FA 3HVFA 3VOLA 5CPJB 2IWDA 1BTLA 4EV4A 5GT3C 2YFWB 2LB5A 1Y54A 3LR0A 1P3MB 2BYMB 4HY8A 1XJ6A 4O7DA 4EU0A 4BENA 4MBFA 4EEUA 4NZ3A 1AXBA 3UDIA 4DXCA 2ZM8A 3AGFA 3WAAB 4J8UA 2WZXA 3T4OA 2XD1A 1R4VA 1IOUA 3UPPA 2VX8A 3ZG7B 5A93A 4OUIA 1K57A 4R0QA 1YMXA 2PYRA 4RVAA 4ME4A 4IEDA 3HSHA 1W63M 2IWCA 3W99B 3UE0A 2PU4A 4CPKA 4Q8IA 4CSRB 4M6BA 2OWJA 4IJEA 3UTBC 2ZY4A 4WLAA 4QY6A 5G18A 2DRWA 3W97B 1WYBA 3AZLD 2F8NA 2R78A 1EQZB 3B0CT 2K7SA 4JGQA 4ZBEA 2HV1A 1KE4A 4B93A 3H9WA 5AV9A 4LV0A 3OZHA 3QP4A 1PZOA 1NYMA 2PYPA 4CAYA 5KIZA 2RCXA 2Y2PA 2X71A 3IBRA 3IXBA 3IXDA 1P3GC 4RQ9A 3PBOA 5DNMB 4GJ4A 4OQIA 1M19B 2WKRA 5HARA 3T1RA 5IS1A 4OP8A 3W2ZA 1I2SA 3TW8A 3KSHA 5B1LD 4P6ZS 1XPBA 4BD1A 2GJ3A 4WU9A 3MNNA 3AV2B 4WEKA 3E2KA 2NZDB 5A91A 4GW9A 2HDQA 3O88A 5AV6C 3AZKB 1HD8A 4RX3A 2EA9A 1HQ3D 3LZ0D 3EPKA 3RELC 4HOIA 2W1TA 1LI9A 3REJD 4JJND 3L26A 1MKMA 1OMEA 5F99A 1P34D 4Z5TB 1YLZA 3LR5A 5F1GA 3X1UA 4Z66C 1KX4C 4HEFA 3UT9B 3KYEA 3T4KA 1YLJA 4HGAB 1ODVA 3WA9D 1XJ4A 4G3KA 1FSWA 5CHUA 3S7NA 3T4TA 2V1BA 3LI8A 5B1MD 4KUDC 5B33A 1MWUA 5GT3B 4P87A 4YS3D 4H6JA 4ZUXC 4XZQC 4DE2A 4KG5A 3A1KA 4KG2A 3LZ1A 3OBFA 1BH8A 3BFEA 2VGJA 4KQQA 2X01A 3R7WA 1P3BD 5GXQA 3FDDA 4L9GA 3FZCA 3M7PA 4H9SA 5EPHA 3QP5A 3REIC 1KS0A 3FPVA 2AROB 2PBDP 4Y5FA 3VP4A 3BY9A 4LENA 3ZQ5A 1EW0A 3SZTA 4CLCA 4EUVA 4KZ9A 3AZEC 5EV0A 4C75A 4J8WD 1NRFA 3T4SA 3DTIA 3S7OA 3MVDA 3KWQB 3PAGA 4Z2MH 5CPJD 5AJGA 3UE6A 1ES3A 5CPKC 5BNXB 2WGWA 3AV1A 1P3MD 1E6NA 2PDRA 3F1PB 3CI6A 2XA7S 1SKFA 5HPFA 3KYQA 5CHLB 3VOYA 3N6IA 1VEUB 3LELC 4EW7A 5GSUC 2DNSA 3WAAD 3C2WA 2VK3A 3LJAA 4EETB 1XA1A 3RXWA 1TS8A 1TD5A 2ZC3B 1O7EA 1HVBA 4X6TA 4JPMA 1P3GB 3P09A 3C1BC 3U4LP 3KXBA 2O9AA 1G6AA 4KZ7A 3W99D 1MKIA 1KE0A 5AV8C 1YU1A 3D72A 4R3AA 1ESIA 3GR2A 2ZMVA 4PPRA 1G5UA 4R8PC 5AV6B 3MGRC 1BUEA 3A3FA 3AZJC 3W96C 1EQZD 4NYYA 3K3CA 4XT2A 2Y2MA 5CERA 5J7EA 1TZYC 3L27A 3SS4A 3HUNA 1DP8A 5B32C 3A3IA 4OPQA 2WK0A 4Z66B 1KX4B 2QYBA 5AV5A 1NZUA 4E6XA 5KDMB 3AZGA 5L8MA 2BYKB 3TJZC 4J8VA 4KUDB 5DNMD 1M19D 4LV2A 4IBKA 1L3LA 3UB5P 5DF7A 4ZUXB 3X1SC 5B0ZA 2VA0A 2ZM0A 1CI8A 4IUKA 1IYQA 4B88A 2NZDD 4N1HA 3AZKD 1Q2QA 3ZNYA 5B31A 1YLWA 3C4OA 3BY8A 5CX7A 4WNNB 3REIB 4QB8A 3HLFA 4NE6A 2VGLM 3MGPB 1ID3C 2VZWA 4Z5TD 5JA4B 5G49A 3BWLA 3VP0A 2XSSA 3D3OA 3UT9D 3M6HA 3NECA 3AZEB 2VLGA 1RGZA 1GHPA 3M2JA 4QU3A 3LEZA 3SH8A 5GT3D 5CPKB 3F1NB 2Y2KA 4LPZA 5HSQA 1L0GA 1SKOB 1A7WA 3VP1A 3X1TC 4NETA 1KVMA 1K0KA 1P3PA 4H9RA 5GSUB 4LD9C 4FUWA 1PRQA 2UV0E 2PBYA 2PU2A 2H10A 3WRTA 5G4YA 5GHYA 3M6BA 3LR3A 4K0WA 2AROD 1H0IA 3GMWA 3WS5A 1GSXA 3AN2A 2B95A 5B40B 4OOMA 4OPRA 3P5JB 3GTCA 1L0DA 5BPVA 3MZDA 1KX3C 3NQJA 2VV8A 5AV8B 4K08A 4MDZA 1FCNA 3KWQD 3G2YA 3FPWA 5AY8C 3B6GA 4MB3A 3EEAA 1ESUA 3LGOA 4EUZA 4R8PB 1P3AD 3FWLA 3N3FA 5AVBC 4I3JA 3F6TA 3W98C 1MWRA 1JTGA 2ZC5B 3FV7A 3IS2A 3NI9A 4NXBA 4S2MA 4BMWA 5GHXA 2E8JA 4X23B 4F3LB 3UB6A 5B32B 1IEMA 2R9XA 3NIAA 5B24A 2J3WA 3UPOA 3TG9A 3MFDA 1VM1A 4OJ6A 4J8XC 1P3GD 2OSUA 3IX8A 3QP8A 3UN7A 3TU4C 3NULA 2HP9A 3VP3A 3PBSA 1FCMA 3X1SB 1DJCA 1WWSA 1FR1A 3HLGA 5M1AA 2R9WA 4PKYG 4GH9A 1MZUA 3A3EA 3C8CA 5CHMA 2HDUA 5AV6D 3G4PA 2V8CA 4NXEA 1OGBA 4Y7PA 4ESPA 5GT0C 1SDNA 1ID3B 2CV5C 1N9BA 4KZ3A 1TDLA 3R4KA 5CPIC 4NZ1A 1KX4D 3SW1A 2Z2LB 3MGQA 2EX8A 2HJ9C 3O3VA 4KUDD 1FOFA 4WZ4A 1UWNX 2Z6CA 4R6LA 4ZUXD 3A1IA 2G5HC 2OAQ1 5EVIB 1U35B 3UB8A 4JXGA 1QMFA 5HDDA 1W79A 3UMEA 2QPNA 3ZGAB 2Q0OA 3Q07A 5E5AC 3IF6A 4HMCA 3FG8A 4LD9B 1ZKJA 4R1GA 4WM9A 1CXWA 4C3QA 2ZMAA 3B6FC 3REID 4DF6A 3MGPD 4U3TA 5GL9A 1LL5A 5AQ9A 3UTAC 1OTAA 1OJ5A 2HP5A 3AZED 1PYYA 4O01A 3O87A 1PDCA 5AY8B 4QY5A 3S7QA 2M7VA 1JWZA 5CPKD 3G6OA 2DF4C 4IBJA 5AVBB 3W98B 4KZ5A 2YKHA 3O62C 2V8FA 3AYWC 4GB7A 4XXRA 3KSGA 3FYZA 4M4XA 5EVLA 5JYPA 5GSUD 4GHIA 4X25A 3AZLA 5E2HA 1MC0A 3HUMA 3G35A 3C38A 2WAFA 4J8XB 4GHAA 2K2NA 3LEQA 4RX2A 5B40D 1PNEA 1PW1A 1STZA 3DAVA 3M2KA 4WYYA 2W8SA 2FJ7C 3VFFA 2XROA 3TU4B 4HJ3A 4NZ4A 3Q7VB 1BSGA 1S32C 3NCKA 4I3IA 5AV8D 1PFLA 3VH5W 2D49A 3JYIA 4WMCD 2YFVB 1M1AC 4R8PD 2PYOC 3CLOA 5TJJA 3H0RC 4OJLA 2JKTM 2PD8A 3QHYA 5J8XA 3PTEA 5C5KA 5B1LA 5BT1C 1P3LC 3VP2A 1GSWA 1FQGA 3NQUA 1Z6FA 5HAQA 3A6NC 1YLYA 5FATA 4X23D 2ZY3A 2CV5B 4QLCB 3IX3A 5B32D 4DJ3A 3LY4A 5CPIB 1YT4A 2FZ0A 3T50A 1HQ3A 5FUGA 3LZ0A 1KX5C 5I5LA 1L6JA 1GXDA 3REJA 1W1YA 4JJNA 4QNLA 4MBKA 1PIOA 1P34A 3IXHA 1N9LA 1OPXA 4WU8B 3REKB 4S2JA 3X1SD 1IYSA 2J8PA 3WA9A 2JN7A 4IVKA 2FFYA 1S4RA 1K56D 5B1MA 3EEHA 3LUQA 5E5AB 3S22A 4C6YA 4JGOA 2RL3A 4YS3A 5DTKA 3P01A 1F2KA 1UR9A 3B6FB 3X1VC 2QHKA 2GNXA 1ID3D 1H5XA 1P3BA 2C6WB 2HIOC 3UTAB 5FQMA 1T1AA 1LLBA 2VQRA 5JRGC 3AZMB 1LL9A 1AOIB 2GZAA 4OOYA 1IKIA 2O9CA 4ETZA 3C4PA 4ARZB 5MC7A 1H3OA 4FTXA 3O86A 4GS9A 5FASA 5AVFA 5EVID 1U35D 1P0ZA 3HJIA 4J8WA 4UHUA 5B2IC 3O62B 2JKFA 3OLOA 2EX6A 3AYWB 5CPJA 3FKEA 3MGSB 4LD9D 2YFWA 5B2JD 4YINA 5J4EA 5AQAA 1P3MA 5FQJA 2BYMA 1ES4A 2XQZA 4Q0IA 1TVFA 3Q1FA 1T1CA 1E15A 2FJ7B 1W1TA 3WAAA 1NYYA 1S32B 1BT5A 2XF3A 5AQ7A 1K54C 1K57C 2I9VA 3MF0A 3VH6W 4OLGA 3AGEA 4PM5A 5AY8D 2V5OA 1QO6A 2HJEA 4NG2A 3AZFC 2ZLYA 2PR5A 1M1AB 5DJUA 2PYOB 3C7VA 2OAP1 1SHVA 2Y2IA 3LICA 5AVBD 5HWTA 1P3LB 3W99A 4WBGA 4X55A 2ZOIA 3VE3A 4CSRA 3A6NB 2JC7A 2ZM2A 3NDGA 1UR8A 2F8NG 3E4PA 1UGUA 3A0SA 1YU4A 3G2ZA 4UAAA 5BS7C 3BYDA 1KX5B 4IBFA 1EQZA 4J8XD 2WKQA 4WZ5C 2GDNA 4I3AA 3IWQA 4EO5C 1OT6A 3HREA 4LV3A 3LR4A 1W7FA 5FQKA 5DNMA 1IYOA 1M19A 3NJAA 4UUZB 1WYCA 5D3OA 5DTSA 3T1XA 4BQMA 5B0YB 1P9RA 2DQNC 1YMSA 4S2LA 4WU9C 4M3KA 1HTZA 2F2AC 1E6RA 5CXWA 2NZDA 2CV5D 4QLCD 3WS1A 2KOIA 3AZKA 5CPID 1TDGA 2HIOB 3IX4A 1WA9A 4Y13A 4BL3A 4E3JA 4Z2KA 5JRGB 5F99C 4Q0HA 1FIKA 4X69A 1DY6A 3QP6A 2IO5C 4Z5TA 2P9VB 4WU8D 1S1ZA 1BH9B 3REKD 4RYEA 3AZIB 1H8YA 3UT9A 4HMEA 1ZC2A 3BFFA 3G30A 5F83A 1YSQA 4LV1A 3B47A 3WS0A 5E5AD 3Q82A 5GT3A 3NHQA 4XUZA 3UNWA 4Y0TA 4MN5A 3B6FD 1OTEA 4GCZA 4GHLA 1F98A 1ZTUA 1JWVA 3V67A 2ZQ8A 4X1LA 5GXQC 3QP1A 1WWIA 2ZC7A 1HZOA 4LCMA 3V39A 1BZAA 3T1QB 3UTAD 4H9NB 3AZMD 1ONHA 3N4IA 1AOID 5A92A 2AROA 3VE4A 3HLEA 4FSFA 4Y0OA 1M40A 1TF1A 4P0MA 4R4SA 3AZFB 3EPJA 3QNBA 4ZDXA 4WL9A 3MJQA 2RIQA 4LGWA 4MB5A 3MZFA 5DNNC 3KWQA 3AYWD 4PAUA 1K38A 3ZVWA 3MGSD 4H8RA 4IBRA 1P3AA 4MMNA 4UQIM 5BNXA 2J3TD 4BBTA 3ULFA 1T1BA 3F1PA 4LFUA 4HH3A 4MN7A 1VEUA 2FJ7D 3LJAC 4WN5A 2JSSA 4EO5B 3L9KA 4E44A 1S32D 2ZY2A 1JTDA 4WV4B 4OPZA 3T1SA 1K25A 4Z1WA 1P3GA 4DXBA 3V9RB 1M1AD 2W3GA 2PYOD 3KXBC 3WKJC 3N8LA 4JGPA 1RCJA 5BT1D 1P3LD 3KS4A 2BG1A 3ICYA 3A6ND 2XR0A 3E2LA 3KYZA 3PHYA 4KUOA 3UTBB 5CTMA 4NYUA 3WD4A 3UB7A 5AV6A 4OJOA 3BQAA 1NXYA 1KX5D 3WX7A 1ZHHB 1S1YA 2HGVA 4KUKA 3W4OA 3R45B 1BLSA 1KX4A 4QWOA 3AZGC 5AVCC 2Y55A 5KDMA 4KHAB 3ZCZA 4J8VC 2BYKA 1GHIA 2XH9A 4KUDA 2HP6A 3WTPC 4ZUXA 4NK3A 5B0YD 1D1JA 1GA9A 1KGGA 4JF6A 3ITAA 4IBDA 4UEYA 2V1ZA 2ZC4B 4YM6C 2H0TA 5HZHA 3UB9A 5B31G 2WGIA 1LSXA 2L4RA 2HIOD 4Y17A 4YFMA 1P3OC 3W97D 2ZJ9A 3LIEA 4Z2LA 4WNNA 5JRGD 3REIA 1PWCA 3RELB 4KQDA 2OOLA 3H82B 2PAVP 3MGPA 5JA4A 3V5MA 3E0YA 4E3LA 3LCEA 4AWLC 3AZID 3AZEA 1ERQA 3DTMA 1E8BA 1JNUA 4S2NC 5DNNB 4GOGA 1XGJA 4ZJ2A 2G7UA 3ZFZA 3N7WA 3CUEA 2WYXA 2H5SA 4F94A 5CPKA 3F1NA 4NFTA 4XZQB 4MLLA 1SKOA 4O8GA 2JKGA 3AZNC 3AV2D 2ZQDA 1P3PC 1L0EA 4IBXA 4OPYA 5GSUA 1TEMA 4ZAMA 3VSLA 5HDSA 1OTDA 5GLAA 4BJPA 3RTYA 2KDKA 5B40A 4YWZA 3AZFD 1X0OA 4GZBA 3WKJB 5JYOA 4WZSB 5G4ZA 3L28A 5AV8A 2Y8HA 4KG6A 3DTKA 3HONA 3UY6A 3IWOA 4WMCA 1TAFB 2JKTI 4R8PA 1ZG6A 4FOFA 1ZLAC 3HCYA 3VSKA 5TR7A 1H8ZA 2WKPA 3PXPA 4FH4A 3B0CW 3G32A 4XUJC 4X23A 5EVEA 4F3LA 4JXVA 5B32A 3LELB 1SDEA 2Y4AA 5FQQA 1IYPA 1XP4A 3BEBA 5AVEA 5AVCB 2V0UA 4OOLA 4J8VB 2NQBC 1D06A 2JE5A 4DQYB 2A3UA 3WTPB 4EERA 3C1BB 3TE8A 3X1SA 1XXMA 1V9YA 4LG2A 2MJ6A 2XFTA 1M18C 4YM6B 4ZTKA 4U0TA 5HWVA 5IHVA 1K56A 3PYPA 3UTBD 3MFXA 1FCOA 1N9NA 3P7NA 1S67L 3MGRB 1C3BA 1TS0A 1P3OB 5DJTA 5FAPA 1PW8A 3AZJB 1PZPA 1NY0A 3W96B 1PWDA 1P3KC 4D60A 4DE3A 3VH5A 1TZYB 4HNBA 1P97A 1ID3A 4OQ0A 5CHJA 3ZNTA 1QMEA 3A0VA 4LCLA 4AWLB 5CECA 3MGQC 3ISGA 4ZJ3A 4NXFA 2PHYA 4NXGA 2QMIA 3IH9A 5BNVB 4I39A 3ZHHA 3AFAC 2PR6A 3MSHA 2Q9MA 2EWVA 5EVIA 1U35A 4P6ZM 3PBNA 1XJ3A 5HL1A 1JWPA 3AZNB 2QZ6A 3IT9A 3WS2A 1P3PB 1CI9A 4GNUA 2J8YA 3F1OB 4LD9A 4UA7A 5B2JA 1XFNA 4KGCC 3EOIA 4DN0A 3RELD 1W8QA 4WF0A 1JFIB 3S7PA 3UO9A 5CEDA 4BBVA 2W3FA 3NQJB 3OPPA 4Z66D 4NEED 4PM7A 2Y79A 2Y59A 2RVQC 5DNND 1LT0A 1E88A 5AY8A 5DKLA 2G2UA 5DF9A 5BO0B 3AZHC 3B3XA 1ALQA 2E8IA 1ZLAB 4XZQD 5AVBA 2EX2A 1OT9A 5FAQA 2D02A 3BJNA 3X1TB 4R3BA 5HD3A 4S2OA 4XUJB 1EAKA 1KGEA 2ZMFA 4GD8A 4WJ3C 3NOUC 4G3WA 3AZLC 1K6SA 4DE0A 1OTIA 5DFYA 3ZG9B 2NQBB 4J8XA 3B42A 4YOFA 3SS3A 3OC2A 2H0YA 3C1CC 1PWGA 1ERMA 3WKJD 4HMDA 2A49A 3Q7VA 1KX3B 4OONA 1HTAA 2RTSA 1M18B 5EE8A 3RXXA 5IT5A 3ZYTA 3CHWP 4Y3IA 4HJ4A 1P3FC 2YFVA 2EXAA 5HPIA 3MQOA 2HZ5A 2NUPC 4H9QB 4OJ5A 2XA7M 4PHTA 3RFBA 1P3KB 3VH6A 2H28A 4EBPA 2CV5A 4QLCA 3REHC 3KUYC 1YSPA 3LELD 5CPIA 1HQ3C 3L2AA 4IBIA 3LZ0C 3NOTC 2CMNA 5CTNA 5HX9A 5AVCD 4E3KA 1F1EA 2LB9A 1P3IC 5CP6C 3BFCA 1P34C 4QPRA 4WU8A 3AFAB 1N1JB 2Y2HA 3WTPD 3REKA 3C1BD 3PBTA 4Z9QA 3D9YA 5AQBA 5KSHA 3WA9C 1H3QA 4YM6D 3SS5A 5B1MC 3WD1A 5E5AA 3C7UA 4GD6A 1F66C 5CGWA 3KSYA 3MGRD 3MS6A 4KGCB 4HIAA 1P3OD 2ZL1A 2HDRA 4PMAA 3IQAA 3B6FA 3AZJD 2I72A 3W96D 1ONGA 1EI5A 5GT0B 3WD3A 1TZYD 5J3WA 5IU1A 4E45A 3GVBA 3UTAA 4U0XA 4FD8A 4DDSA 3AZMA 1AOIA 1KE3A 5K5BA 5BOHA 5KZHA 3KSIA 4KQRA 5CEBA 4ARZA 1LL8A 3AZHB 5EUAA 3MQLA 4ZBJC 4J8WC 4OP5A 1KVLA 3AYWA 3AZND 1H0GA 4R70A 1I2WA 4TX8A 1YU0A 3MGSA 3FC7A 4H9OB 4QJGA 1P3MC 4K0XA 2L0WA 4HQAA 1ULYA 4LRXC 4BD0A 1Z09A 3QP2A 4UPKA 4Z2JA 2ZQCA 2V2FF 3C1CB 3WAAC 3CPTB 2FJ7A 3BFGA 3KFUG 1W5DA 3GECA 5FL3A 3WTPE 1EROA 4HESA 1S32A 1W63Q 2EFUA 1Y4OA 3GSGA 2A24B 1ED7A 3BLSA 4JF4A 2QKPA 1LHYA 1PI5A 2G5IC 1K55A 2XLNA 1P3FB 1M1AA 2Y2QA 1VQQA 2PYOA 3GDIA 5TBMB 1YLPA 3T4LA 4IJFA 4G91C 1DJAA 2KX6A 1ZLAD 3TSGA 1P3LA 4ZRRA 3LFVA 3A6NA 1IELA 1CF0A 3EG5B 3X1TD 2D01A 2XD5A 4L0LA 4XUJD 2DMWA 2OV5A 3REHB 3KUYB 5E2EA 2YKFA 1XA7A 3CZDA 1TS7A 1KX5A 1EQZC 2NQBD 4LRZE 1P3IB 1BLPA 1BFMA 4HBUA 5CP6B 4ETXA 3EWKA 2VEAA 1DP9A 1MWTA 1M6KA 4J8UC 2G2WA 4S2IA 5FI7A 3V3RA 1NLYA 3TOIA 1KX3D 1L2SA 3PBRA 4IVIA 5A8BA 1M18D 3H7WB 4UUZA 1F66B 1S66L 4MEZA 5B0YA 5HAPA 3UE1A 4BBUA 3W98D 4R23A 1P3KD 5L09A 4Z2MG 1F9IA 2IA2A 4Z2IA 5TGFA 2HIOA 3KO6A 3W97A 5JRGA 3T4QA 3MKEA 3B0DC 4DRAA 2VGLS 1H3OB 5AV9C 3C5AA 3VOZA 2EXBA 4UA6A 3AFAD 1BH9A 3BFDA 3TU4D 4WUJA 1E3UD 3AZIA 2Y2LA 4ZBJB 1CEGA 3IH8A 2WGVA 3S1YA 1CK7A 1EWZA 5C3IC 2EFXA 4EEPA 4H9PB 4EESA 3N8SA 4KGCD 2L5AA 1U60A 4DJ2A 1VETB 3X1VB 3V3SA 1S4SA 5A90A 5GT0D 3MNNC 1YM1A 3ZVTA 3AV2A 3D4FA 5DF8A 3V50A 4GDNA 4IBGA 2O99A 1W8YA 3MBZA 4MN6A 4H9NA 1NLZA 2AROC 2V20A 2ZQAA 1K54A 4E3OA 2RVQD 5EOOA 4GKUA 5I94A 5HD5A 1CQAA 1MXOA 4DE1A 4JF5A 3AZFA 3OPHA 4E04A 3AZHD 3X1UC 4G91B 2PT7A 1D7EA 1ES2A 2FFFB 1LSWA 3IF5A 3TRCA 3KWQC 5B2IB 3NC8A 4E3NA 4Z2GA 3GQZA 2ZQ9A 3EGDC 2IOUA 5B33C 1P3AC 3ZG8B 5FEFA 5BS7A 2VGKA 4JGRA 5L2FA 4KZ8A 3LZ1C 4Y0UA 1LSVA 4WZ5A 1F5MA 3C1CD 1E4DA 3A3JA 2Y2JA 4J8UB 4HI4A 4H9SC 3BQ8A 2W3HA 2J9OA 5GLCA 1N9OA 5GHZA
chains in the Genus database with same CATH topology
1K4EA 4E6WA 5E43A 1P3FD 3Q7ZA 3V9RA 5EECA 3IXGA 2F8NK 4PM8A 3MVDC 1J9MA 3O62D 3UTBA 3REHD 3KUYD 3AL0C 5DVAA 2F8NB 2Y2GA 3AV1C 4MNRA 3OCNA 1P3ID 3L25A 4XUXA 5CP6D 3B0DB 3PAEA 5AV9B 1L0FA 3R45A 4E3IA 3IHAA 3FKWA 1MPLA 1JVJA 4CAYB 4KHAA 5FQ9A 4D2OA 5C3IB 1Q9CA 4MBHA 1F66D 4IBEA 2P74A 2HPBA 3UE3A 4PM6A 4NE5A 4WU9B 3MNNB 1FSYA 3OPRA 1XX2A 1MBLA 5FI6A 3RELA 3FKVA 4JBFA 3VFHA 3MGPC 5F99B 3WS4A 2ZQ7A 2IO5B 3X1UB 3AGDA 3HLCA 4Z66A 3SH7A 5AV5C 3MXRA 5FDHA 5DNNA 1CK3A 2F8NH 5F1FA 1K6RA 5B33B 1P3AB 4XZQA 5B0ZC 1XGIA 3LZ1B 1BH8B 3X1VD 3BRMA 3BLMA 1CEFA 2ZD8A 5GXQB 1K4FA 5B31C 1KDWA 2UWXA 3SOIA 5B40C 3ZG0A 2ZC6B 3WKJA 3OCLA 2Y2NA 5EOEA 4DDYA 3IWIA 3MVDB 2XDMA 5B2ID 5KSCA 5FI2A 3W4PA 1TAFA 4EBNA 3NDEA 2WGWB 3AV1B 4GN2A 3EPLA 3DWZA 5GLDA 5B32G 4X23C 5TFQA 3HLWA 3OPLA 2DCFA 3LELA 4J8UD 3LJAB 4EQIA 4ID4A 2WUQA 5AVCA 1O07A 1MWSA 3HBRA 3I7JA 1KDSA 2LY8A 3AN2C 5FA7A 4OVDA 3WTPA 3C1BA 3KXBB 2HUEC 3EPHA 3VH5T 4YM6A 3B6GC 4KQOA 4KZAA 3DWKA 3MGRA 2BLSA 3VMAA 2F8ND 1P3OA 4P85A 3AZJA 4OJPA 5CGXA 3H0LC 3W96A 4UA9A 4ZJ1A 1TZYA 5AV9D 3BM6A 1GA0A 5HAIA 3UPNA 5U47A 5B24C 5AV5B 1ZG4A 3AZGB 4S2NA 2WKIA 3ZDJA 3UDXA 3A3DA 5BNVA 1Q2PA 4OQGA 3CJMA 2XK1A 5EVIC 1U35C 5B0ZB 4E3MA 1DJBA 1GCEA 2Q9NA 2Y91A 5F82A 4WU9D 3MNND 3AZNA 1WE4A 5B2JC 4FH2A 1BLCA 4OH0A 5B31B 1KGFA 3MZEA 2WKHA 4DKIA 5F99D 3SH9A 1JFIA 5G49B 3X1UD 3NY4A 4WEJA 3KS8A 3LY3A 4IBBA 1YU3A 3IP4C 3HUOA 1PI4A 3Q81A 4X68A 5B33D 5BO0A 1ZLAA 3LZ1D 3G31A 5CGSA 3X1TA 2ZY5A 4XUJA 3IF6C 5GXQD 4H9RB 4S2KA 1YU2A 3W8KA 2JCHA 4DRTA 2NQBA 4CJNA 1MY8A 3AN2B 3MXSA 1ES5A 4N92A 1KX3A 3VH6T 2HUEB 1M18A 3B0BA 3MVDD 3B6GB 4X53A 4N9LA 3NBLA 2WZZA 4H9QA 1NZOA 3AV1D 4EBLA 3L29A 3W98A 5M19A 2WKEA 1SCWA 1P3KA 5HFOA 4QLCC 3G34A 3LO7A 1BLHA 3S4XA 2ZM5A 3LJAD 4KZ4A 4NE3A 2Z2MB 5B24B 4EWFA 3EQUA 3MKFA 3EQVA 3UDFA 1PZRA 1YUEA 4WU8C 2XFSA 3REKC 1B67A 3AFAA 1N1JA 3TU4A 3KXBD 1E3UA 4OKPA 3RJUA 3DW0A 2HDSA 5B2JB 4B4XA 4KGCA 5E2GA 5B1LC 5GT0A 1BULA 3HLDA 1RGYA 2OLVA 1KU5A 3ITBA 2C5WB 3AZMC 5AV5D 2Y2OA 3MGQB 1AOIC 5GLBA 3AZGD 3WRZA 4JKTA 3REJC 4JJNC 4J8VD 4RA7A 3AZHA 4OLDA 5B0ZD 3GV9A 3QNCA 4KZBA 3MGSC 3IF6B 5DTTA 4N1XA 1T3UA 1LI0A 4H9OA 4YS3C 4B4ZA 2WADA 5B31D 1Z2CB 3CG5A 1S6RA 1I5QA 4BL2A 3C1CA 1P3BC 4DRBA 4NZ5A 4G92C 2J9PA 1K55C 4PM9A 2OLUA 3N8RA 1P3FA 1YQSA 5CRFA 4P6BA 3W4QA 4R3JA 3O62A 4KZ6A 5KMWA 5CPJC 3REHA 3KUYA 1P3PD 1XKZA 3AZLB 4HBTA 4GDBA 2XEPA 4OQHA 4JXSA 5M18A 1P3IA 5CP6A 3AN2D 2IWBA 1G68A 4A5RA 3CMZA 4R4RA 4FCFA 1S0WA 3H0MC 1RP5A 3B6GD 4S2PA 1IKGA 1F66A 5B0YC 2J7VA 4BLMA 4IBCA 3GRJA 3W99C 5B1LB 2EX9A 5FSRA 3NQUB 4QD4A 2CC1A 1YLTA 5HW3A 2B5RA 4JXWA 3W97C 1E25A 1HQ3B 5B24D 5FUGB 3LZ0B 3REJB 4JJNB 3ZG5A 4NY2A 5FQIA 1P34B 3AZIC 2XGNA 1W2EA 3WA9B 4WELA 3BECA 5B1MB 5DNMC 1M19C 4H9PA 4K91A 4YS3B 3HLBA 3P98A 1GHMA 3WWXA 1N4OA 3X1VA 3AV2C 2NZDC 1P3BB 3AZKC 5FAOA 1NJ4A 3MGQD 4QHCA 4G92B 1FR6A 2JBFA 4N9KA 4Z5TC 3PBQA 2WAEA 2P9VA 4X56A 4JLFA 3HL9A 1B6WA 3UT9C 4KENB 4HGAC 2X02A 4J8WB 2CWEA 5B2IA 5E2FA 3HVFA 5CPJB 2IWDA 1BTLA 4EV4A 5GT3C 2YFWB 1Y54A 1P3MB 2BYMB 4O7DA 4BENA 4MBFA 4NZ3A 1AXBA 3UDIA 4DXCA 2ZM8A 3AGFA 3WAAB 4J8UA 2WZXA 2XD1A 1R4VA 3UPPA 3ZG7B 5A93A 4OUIA 1K57A 4R0QA 1YMXA 4RVAA 4IEDA 3HSHA 2IWCA 3W99B 3UE0A 2PU4A 4CPKA 4Q8IA 4CSRB 4M6BA 4IJEA 3UTBC 2ZY4A 4QY6A 5G18A 2DRWA 3W97B 1WYBA 3AZLD 2F8NA 1EQZB 3B0CT 4ZBEA 1KE4A 5AV9A 4LV0A 3OZHA 1PZOA 1NYMA 4CAYA 2RCXA 2Y2PA 2X71A 3IXBA 3IXDA 1P3GC 3PBOA 5DNMB 4OQIA 1M19B 5HARA 4OP8A 1I2SA 5B1LD 1XPBA 4BD1A 4WU9A 3MNNA 3AV2B 4WEKA 3E2KA 2NZDB 5A91A 2HDQA 3O88A 5AV6C 3AZKB 1HD8A 4RX3A 1HQ3D 3LZ0D 3EPKA 3RELC 1LI9A 3REJD 4JJND 3L26A 1OMEA 5F99A 1P34D 4Z5TB 1YLZA 5F1GA 3X1UA 4Z66C 1KX4C 4HEFA 3UT9B 1YLJA 4HGAB 3WA9D 5CHUA 1FSWA 5B1MD 4KUDC 5B33A 1MWUA 5GT3B 4P87A 4YS3D 4ZUXC 4XZQC 4DE2A 4KG5A 3A1KA 4KG2A 3LZ1A 1BH8A 3BFEA 2VGJA 4KQQA 2X01A 1P3BD 5GXQA 3FDDA 3FZCA 4H9SA 5EPHA 3REIC 2AROB 3VP4A 4LENA 4KZ9A 3AZEC 4C75A 4J8WD 1NRFA 3MVDA 3KWQB 3PAGA 4Z2MH 5CPJD 1ES3A 5CPKC 5BNXB 2WGWA 3AV1A 1P3MD 1SKFA 5CHLB 3VOYA 3N6IA 3LELC 5GSUC 2DNSA 3WAAD 3LJAA 1XA1A 3RXWA 2ZC3B 1O7EA 1HVBA 4X6TA 4JPMA 1P3GB 3P09A 3C1BC 3KXBA 1G6AA 4KZ7A 3W99D 1MKIA 1KE0A 5AV8C 1YU1A 1ESIA 3GR2A 4PPRA 4R8PC 5AV6B 3MGRC 1BUEA 3A3FA 3AZJC 3W96C 1EQZD 4NYYA 2Y2MA 5CERA 1TZYC 3L27A 3SS4A 3HUNA 5B32C 3A3IA 4OPQA 2WK0A 4Z66B 1KX4B 5AV5A 1NZUA 4E6XA 5KDMB 3AZGA 2BYKB 4J8VA 4KUDB 5DNMD 1M19D 4LV2A 4IBKA 5DF7A 4ZUXB 3X1SC 5B0ZA 2ZM0A 1CI8A 1IYQA 4B88A 2NZDD 4N1HA 3AZKD 1Q2QA 3ZNYA 5B31A 1YLWA 3C4OA 4WNNB 3REIB 4QB8A 3HLFA 4NE6A 3MGPB 1ID3C 4Z5TD 5JA4B 5G49A 3VP0A 3M6HA 3UT9D 3AZEB 1RGZA 1GHPA 3M2JA 4QU3A 3LEZA 3SH8A 5GT3D 5CPKB 2Y2KA 1L0GA 1A7WA 3VP1A 3X1TC 4NETA 1KVMA 1P3PA 4H9RA 5GSUB 4LD9C 2PBYA 2PU2A 2H10A 3WRTA 5GHYA 3M6BA 4K0WA 2AROD 3GMWA 3WS5A 3AN2A 4OOMA 5B40B 4OPRA 3P5JB 3GTCA 1L0DA 5BPVA 3MZDA 1KX3C 3NQJA 5AV8B 1FCNA 3KWQD 3G2YA 5AY8C 3B6GA 4EUZA 1ESUA 4R8PB 1P3AD 3FWLA 3N3FA 5AVBC 3F6TA 3W98C 1MWRA 1JTGA 2ZC5B 3FV7A 3NI9A 4S2MA 5GHXA 4X23B 5B32B 1IEMA 2R9XA 3NIAA 5B24A 3UPOA 3TG9A 3MFDA 1VM1A 4OJ6A 4J8XC 1P3GD 2OSUA 3UN7A 3TU4C 2HP9A 3VP3A 3PBSA 1FCMA 3X1SB 1DJCA 1WWSA 1FR1A 3HLGA 5M1AA 2R9WA 4GH9A 3A3EA 5CHMA 2HDUA 5AV6D 3G4PA 4Y7PA 5GT0C 1SDNA 1ID3B 2CV5C 1N9BA 4KZ3A 1TDLA 5CPIC 4NZ1A 1KX4D 2Z2LB 3MGQA 2EX8A 3O3VA 4KUDD 1FOFA 4WZ4A 4ZUXD 3A1IA 2G5HC 5EVIB 1U35B 4JXGA 1QMFA 1W79A 2QPNA 3ZGAB 3Q07A 5E5AC 3IF6A 4LD9B 1ZKJA 4R1GA 4WM9A 4C3QA 2ZMAA 3B6FC 3REID 4DF6A 3MGPD 4U3TA 5GL9A 1LL5A 5AQ9A 3UTAC 2HP5A 3AZED 1PYYA 3O87A 5AY8B 4QY5A 1JWZA 5CPKD 2DF4C 4IBJA 5AVBB 3W98B 4KZ5A 3O62C 4XXRA 3AYWC 4GB7A 3FYZA 5EVLA 5JYPA 5GSUD 3AZLA 5E2HA 3HUMA 3G35A 2WAFA 4J8XB 4GHAA 4RX2A 5B40D 3M2KA 1PW1A 4WYYA 2W8SA 2FJ7C 3VFFA 3TU4B 4NZ4A 3Q7VB 1BSGA 1S32C 3NCKA 5AV8D 3VH5W 3JYIA 4WMCD 2YFVB 1M1AC 4R8PD 2PYOC 3H0RC 4OJLA 3QHYA 5J8XA 3PTEA 5B1LA 5BT1C 1P3LC 3VP2A 1FQGA 3NQUA 1Z6FA 5HAQA 3A6NC 1YLYA 5FATA 4X23D 2ZY3A 2CV5B 4QLCB 5B32D 3LY4A 5CPIB 1YT4A 1HQ3A 5FUGA 3LZ0A 1KX5C 3REJA 4QNLA 4JJNA 4MBKA 1PIOA 1P34A 3IXHA 4WU8B 3REKB 4S2JA 3X1SD 1IYSA 2J8PA 3WA9A 4IVKA 2FFYA 1K56D 5B1MA 5E5AB 3S22A 4C6YA 2RL3A 4YS3A 5DTKA 3B6FB 3X1VC 1ID3D 1H5XA 1P3BA 2C6WB 2HIOC 3UTAB 5FQMA 1LLBA 2VQRA 5JRGC 3AZMB 1LL9A 1AOIB 4OOYA 1IKIA 3C4PA 1H3OA 3O86A 5FASA 5EVID 1U35D 4J8WA 4UHUA 5B2IC 3O62B 2EX6A 3AYWB 5CPJA 3FKEA 3MGSB 4LD9D 2YFWA 5B2JD 4YINA 5AQAA 1P3MA 5FQJA 2BYMA 1ES4A 2XQZA 1TVFA 3Q1FA 2FJ7B 3WAAA 1NYYA 1S32B 1BT5A 2XF3A 5AQ7A 1K54C 1K57C 3VH6W 4OLGA 3AGEA 4PM5A 5AY8D 3AZFC 2ZLYA 1M1AB 2PYOB 3C7VA 1SHVA 2Y2IA 5AVBD 1P3LB 3W99A 4WBGA 4X55A 4CSRA 3A6NB 2JC7A 2ZM2A 3NDGA 2F8NG 1YU4A 3G2ZA 4UAAA 5BS7C 3BYDA 1KX5B 4IBFA 1EQZA 4J8XD 4WZ5C 2GDNA 3IWQA 4EO5C 3HREA 4LV3A 1W7FA 5FQKA 5DNMA 1IYOA 1M19A 4UUZB 1WYCA 5D3OA 5DTSA 4BQMA 5B0YB 2DQNC 1YMSA 4S2LA 4WU9C 4M3KA 1HTZA 2F2AC 5CXWA 2NZDA 2CV5D 4QLCD 3WS1A 3AZKA 5CPID 1TDGA 2HIOB 4BL3A 4E3JA 5JRGB 5F99C 4X69A 1DY6A 2IO5C 4Z5TA 2P9VB 4WU8D 1BH9B 3REKD 4RYEA 3AZIB 1H8YA 3UT9A 1ZC2A 3BFFA 3G30A 5F83A 4LV1A 3WS0A 5E5AD 3Q82A 5GT3A 4XUZA 3UNWA 4Y0TA 3B6FD 4GHLA 1JWVA 2ZQ8A 5GXQC 2ZC7A 1WWIA 1HZOA 4LCMA 3V39A 1BZAA 3UTAD 4H9NB 3AZMD 1ONHA 3N4IA 1AOID 5A92A 2AROA 3HLEA 4FSFA 4Y0OA 1M40A 4P0MA 4R4SA 3AZFB 3EPJA 3QNBA 4ZDXA 2RIQA 3MZFA 5DNNC 3KWQA 3AYWD 1K38A 3ZVWA 3MGSD 4H8RA 4IBRA 1P3AA 5BNXA 2FJ7D 3LJAC 2JSSA 4EO5B 4E44A 1S32D 2ZY2A 1JTDA 4WV4B 4OPZA 1K25A 1P3GA 4DXBA 3V9RB 1M1AD 2PYOD 3KXBC 3WKJC 3N8LA 1RCJA 5BT1D 1P3LD 3KS4A 2BG1A 3A6ND 2XR0A 3E2LA 3UTBB 5CTMA 4NYUA 5AV6A 4OJOA 1NXYA 1KX5D 3WX7A 3W4OA 3R45B 1BLSA 1KX4A 3AZGC 5AVCC 2Y55A 5KDMA 4KHAB 3ZCZA 4J8VC 2BYKA 1GHIA 2XH9A 4KUDA 2HP6A 3WTPC 4ZUXA 4NK3A 5B0YD 1GA9A 1KGGA 4JF6A 3ITAA 4IBDA 2V1ZA 2ZC4B 4YM6C 2H0TA 5B31G 2WGIA 2HIOD 4YFMA 1P3OC 3W97D 2ZJ9A 4WNNA 5JRGD 3REIA 1PWCA 3RELB 3MGPA 5JA4A 3V5MA 4E3LA 3LCEA 4AWLC 3AZID 3AZEA 1ERQA 3DTMA 4S2NC 5DNNB 4GOGA 1XGJA 4ZJ2A 3ZFZA 3N7WA 2WYXA 2H5SA 4F94A 5CPKA 4NFTA 4XZQB 4MLLA 3AZNC 3AV2D 2ZQDA 1P3PC 1L0EA 4IBXA 4OPYA 5GSUA 1TEMA 4ZAMA 3VSLA 5GLAA 4BJPA 5B40A 3AZFD 4GZBA 3WKJB 5JYOA 4WZSB 3L28A 5AV8A 4KG6A 3HONA 3UY6A 3IWOA 4WMCA 1TAFB 4R8PA 1ZG6A 1ZLAC 3VSKA 5TR7A 1H8ZA 4FH4A 3B0CW 3G32A 4XUJC 4X23A 4JXVA 5B32A 3LELB 1SDEA 2Y4AA 5FQQA 1IYPA 1XP4A 3BEBA 5AVCB 4OOLA 4J8VB 2NQBC 2JE5A 4DQYB 2A3UA 3WTPB 3C1BB 3X1SA 1XXMA 4LG2A 2XFTA 1M18C 4YM6B 4ZTKA 4U0TA 5IHVA 1K56A 3UTBD 1FCOA 3MGRB 1C3BA 1P3OB 5FAPA 1PW8A 3AZJB 1PZPA 1NY0A 3W96B 1PWDA 1P3KC 4DE3A 3VH5A 1TZYB 1ID3A 4OQ0A 5CHJA 3ZNTA 1QMEA 4LCLA 4AWLB 5CECA 3MGQC 3ISGA 4ZJ3A 2QMIA 3IH9A 5BNVB 3ZHHA 3AFAC 2Q9MA 5EVIA 1U35A 3PBNA 5HL1A 1JWPA 3AZNB 2QZ6A 3IT9A 3WS2A 1P3PB 1CI9A 4GNUA 2J8YA 4LD9A 4UA7A 5B2JA 4KGCC 3RELD 1W8QA 1JFIB 3UO9A 5CEDA 3OPPA 3NQJB 4Z66D 4PM7A 2Y59A 2RVQC 5DNND 5AY8A 2G2UA 5DF9A 5BO0B 3AZHC 3B3XA 1ALQA 2E8IA 1ZLAB 4XZQD 5AVBA 2EX2A 5FAQA 3X1TB 4R3BA 4S2OA 4XUJB 1KGEA 4GD8A 4WJ3C 3AZLC 1K6SA 4DE0A 3ZG9B 2NQBB 4J8XA 3SS3A 3OC2A 2H0YA 3C1CC 1PWGA 1ERMA 3WKJD 2A49A 3Q7VA 1KX3B 4OONA 1HTAA 1M18B 5EE8A 3RXXA 1P3FC 2YFVA 2EXAA 4H9QB 4OJ5A 1P3KB 3VH6A 4EBPA 2CV5A 4QLCA 3REHC 3KUYC 3LELD 5CPIA 1HQ3C 3L2AA 4IBIA 3LZ0C 5CTNA 5HX9A 5AVCD 4E3KA 1F1EA 1P3IC 5CP6C 3BFCA 1P34C 4WU8A 3AFAB 1N1JB 2Y2HA 3WTPD 3REKA 3C1BD 3PBTA 4Z9QA 5AQBA 5KSHA 3WA9C 4YM6D 3SS5A 5B1MC 5E5AA 3C7UA 4GD6A 1F66C 5CGWA 3KSYA 3MGRD 4KGCB 1P3OD 2HDRA 4PMAA 3IQAA 3B6FA 3AZJD 2I72A 3W96D 1ONGA 1EI5A 5GT0B 1TZYD 4E45A 3GVBA 3UTAA 4U0XA 4FD8A 4DDSA 3AZMA 1AOIA 1KE3A 5BOHA 5KZHA 4KQRA 5CEBA 3AZHB 5EUAA 4ZBJC 4J8WC 4OP5A 1KVLA 3AYWA 3AZND 1I2WA 1YU0A 3MGSA 4H9OB 4QJGA 1P3MC 4K0XA 1ULYA 4BD0A 4UPKA 2ZQCA 2V2FF 3C1CB 3WAAC 2FJ7A 3BFGA 3KFUG 1W5DA 3WTPE 1EROA 4HESA 1S32A 2EFUA 3GSGA 3BLSA 4JF4A 1LHYA 1PI5A 2G5IC 1K55A 2XLNA 1P3FB 1M1AA 2Y2QA 1VQQA 2PYOA 1YLPA 4IJFA 4G91C 1DJAA 1ZLAD 3TSGA 1P3LA 3A6NA 1IELA 3EG5B 3X1TD 4L0LA 2XD5A 4XUJD 2OV5A 3REHB 3KUYB 5E2EA 1XA7A 3CZDA 1KX5A 1EQZC 2NQBD 1P3IB 1BLPA 1BFMA 4HBUA 5CP6B 1MWTA 1M6KA 4J8UC 2G2WA 4S2IA 5FI7A 3V3RA 3TOIA 1KX3D 1L2SA 3PBRA 4IVIA 1M18D 4UUZA 1F66B 4MEZA 5B0YA 5HAPA 3UE1A 3W98D 4R23A 1P3KD 4Z2MG 5TGFA 2HIOA 3W97A 5JRGA 3MKEA 3B0DC 4DRAA 3C5AA 1H3OB 5AV9C 3VOZA 2EXBA 4UA6A 3AFAD 1BH9A 3BFDA 3TU4D 1E3UD 3AZIA 2Y2LA 4ZBJB 1CEGA 3IH8A 2WGVA 3S1YA 1EWZA 5C3IC 2EFXA 4H9PB 3N8SA 4KGCD 2L5AA 1U60A 3X1VB 3V3SA 5A90A 5GT0D 3MNNC 1YM1A 3ZVTA 3AV2A 3D4FA 5DF8A 3V50A 4GDNA 4IBGA 1W8YA 3MBZA 4H9NA 2AROC 2V20A 2ZQAA 1K54A 4E3OA 2RVQD 5EOOA 4GKUA 5I94A 1MXOA 4DE1A 4JF5A 3AZFA 3OPHA 3AZHD 3X1UC 4G91B 1ES2A 3IF5A 2FFFB 3KWQC 5B2IB 3NC8A 4E3NA 3GQZA 2ZQ9A 2IOUA 5B33C 1P3AC 3ZG8B 5L2FA 5BS7A 2VGKA 4KZ8A 3LZ1C 4Y0UA 4WZ5A 3C1CD 1E4DA 3A3JA 2Y2JA 4J8UB 4H9SC 2J9OA 5GLCA 3IHBA 5GHZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QD4 A;  3O3V A;  2CC1 A;  1K4E A;  2ZQD A;  4IBX A;  1YLT A;  1L0E A;  4E6W A;  1FOF A;  4WZ4 A;  4OPY A;  1TEM A;  3Q7Z A;  2B5R A;  5E43 A;  4JXW A;  4ZAM A;  3VSL A;  5HW3 A;  1E25 A;  5EEC A;  3IXG A;  5EVI B;  4JXG A;  1QMF A;  4PM8 A;  3ZG5 A;  5GLA A;  4BJP A;  1W79 A;  1J9M A;  2QPN A;  3ZGA B;  5FQI A;  3Q07 A;  3IF6 A;  4GZB A;  5DVA A;  1ZKJ A;  5JYO A;  4R1G A;  4WM9 A;  2Y2G A;  2XGN A;  4C3Q A;  2ZMA A;  4MNR A;  4WEL A;  4KG6 A;  3OCN A;  4DF6 A;  4XUX A;  3UY6 A;  3BEC A;  3PAE A;  3IWO A;  4U3T A;  5GL9 A;  4WMC A;  1LL5 A;  1L0F A;  1ZG6 A;  3HLB A;  3P98 A;  4K91 A;  1GHM A;  3IHA A;  5AQ9 A;  3WWX A;  3FKW A;  4E3I A;  1MPL A;  3VSK A;  1JVJ A;  2HP5 A;  5TR7 A;  1H8Z A;  5FQ9 A;  1PYY A;  3O87 A;  1N4O A;  4D2O A;  4FH4 A;  3G32 A;  4QY5 A;  4MBH A;  4JXV A;  1JWZ A;  1SDE A;  2Y4A A;  5FQQ A;  1IYP A;  1XP4 A;  5FAO A;  3BEB A;  1NJ4 A;  2P74 A;  4OOL A;  2HPB A;  4QHC A;  4KZ5 A;  3UE3 A;  4PM6 A;  4XXR A;  4GB7 A;  1FSY A;  1FR6 A;  2JBF A;  3OPR A;  3FYZ A;  2JE5 A;  5EVL A;  1XX2 A;  4N9K A;  5JYP A;  3PBQ A;  2A3U A;  2WAE A;  2P9V A;  4X56 A;  4JLF A;  3HL9 A;  1MBL A;  5FI6 A;  1XXM A;  4KEN B;  5E2H A;  3HUM A;  2X02 A;  3G35 A;  2XFT A;  2WAF A;  3FKV A;  4JBF A;  4ZTK A;  4U0T A;  3VFH A;  5IHV A;  1K56 A;  4RX2 A;  5E2F A;  3HVF A;  3M2K A;  1PW1 A;  1FCO A;  2IWD A;  4WYY A;  1BTL A;  3VFF A;  3WS4 A;  2ZQ7 A;  4EV4 A;  1C3B A;  3AGD A;  1Y54 A;  3HLC A;  3Q7V B;  5FAP A;  1PW8 A;  3SH7 A;  1BSG A;  3NCK A;  1PZP A;  4O7D A;  1NY0 A;  1PWD A;  3MXR A;  5FDH A;  4BEN A;  1CK3 A;  4MBF A;  4DE3 A;  4OQ0 A;  1AXB A;  1K6R A;  3UDI A;  4DXC A;  2ZM8 A;  3JYI A;  4WMC D;  3AGF A;  5CHJ A;  3ZNT A;  1QME A;  2WZX A;  4LCL A;  2XD1 A;  5CEC A;  3QHY A;  5J8X A;  3ISG A;  3PTE A;  3VP2 A;  1XGI A;  3UPP A;  1FQG A;  3ZG7 B;  1Z6F A;  4ZJ3 A;  5A93 A;  5HAQ A;  3BRM A;  1YLY A;  3BLM A;  1CEF A;  1K57 A;  4R0Q A;  1YMX A;  2ZD8 A;  5FAT A;  2QMI A;  4RVA A;  3IH9 A;  1K4F A;  3LY4 A;  4IED A;  3ZHH A;  1YT4 A;  2Q9M A;  2IWC A;  3UE0 A;  1KDW A;  2PU4 A;  5EVI A;  4CPK A;  3PBN A;  5HL1 A;  4Q8I A;  1JWP A;  2UWX A;  4MBK A;  3SOI A;  2QZ6 A;  3IT9 A;  1PIO A;  3ZG0 A;  3WS2 A;  1CI9 A;  2ZC6 B;  3IXH A;  4GNU A;  2J8Y A;  4QY6 A;  5G18 A;  4UA7 A;  2DRW A;  4S2J A;  1WYB A;  3OCL A;  2Y2N A;  5EOE A;  1IYS A;  4ZBE A;  1W8Q A;  4DDY A;  3IWI A;  4IVK A;  2FFY A;  1KE4 A;  2XDM A;  1K56 D;  5KSC A;  4LV0 A;  5FI2 A;  3OZH A;  3S22 A;  3W4P A;  3UO9 A;  4C6Y A;  1PZO A;  5CED A;  2RL3 A;  1NYM A;  4EBN A;  5DTK A;  3NDE A;  3OPP A;  2WGW B;  4GN2 A;  3DWZ A;  2RCX A;  2Y2P A;  5GLD A;  4PM7 A;  2X71 A;  2Y59 A;  3IXB A;  3IXD A;  5TFQ A;  3PBO A;  3HLW A;  3OPL A;  2G2U A;  4OQI A;  5DF9 A;  1H5X A;  2DCF A;  5HAR A;  2C6W B;  4OP8 A;  3B3X A;  4EQI A;  1ALQ A;  1I2S A;  2E8I A;  4ID4 A;  5FQM A;  2WUQ A;  1LLB A;  1O07 A;  1LL9 A;  2EX2 A;  1MWS A;  1XPB A;  3HBR A;  5FAQ A;  4BD1 A;  4OOY A;  3I7J A;  1KDS A;  1IKI A;  4R3B A;  4WEK A;  3C4P A;  3E2K A;  4S2O A;  1KGE A;  4GD8 A;  5FA7 A;  5A91 A;  2HDQ A;  3O88 A;  4OVD A;  3O86 A;  1HD8 A;  4RX3 A;  5FAS A;  1K6S A;  5F1F A;  4DE0 A;  3ZG9 B;  5EVI D;  1LI9 A;  4UHU A;  2EX6 A;  1OME A;  3OC2 A;  3SS3 A;  2H0Y A;  1PWG A;  1YLZ A;  4KQO A;  1ERM A;  5F1G A;  4KZA A;  3DWK A;  4YIN A;  2A49 A;  2BLS A;  3VMA A;  5AQA A;  4HEF A;  3Q7V A;  5FQJ A;  4OON A;  4P85 A;  1YLJ A;  1ES4 A;  5CGX A;  2XQZ A;  4UA9 A;  5CHU A;  1FSW A;  5EE8 A;  3RXX A;  4ZJ1 A;  1TVF A;  3Q1F A;  3BM6 A;  1GA0 A;  1MWU A;  5HAI A;  2EXA A;  4P87 A;  3UPN A;  5U47 A;  1NYY A;  4DE2 A;  4KG5 A;  4KG2 A;  1BT5 A;  1ZG4 A;  2XF3 A;  3BFE A;  4KQQ A;  2VGJ A;  4S2N A;  1K54 C;  1K57 C;  5AQ7 A;  2WKI A;  2X01 A;  3ZDJ A;  4OLG A;  4PM5 A;  3AGE A;  3UDX A;  4EBP A;  3A3D A;  1Q2P A;  2ZLY A;  4OQG A;  3C7V A;  3CJM A;  3FZC A;  2XK1 A;  5CTN A;  1SHV A;  2Y2I A;  5HX9 A;  5EVI C;  5EPH A;  4E3M A;  4WBG A;  1DJB A;  4X55 A;  4E3K A;  1GCE A;  2Q9N A;  2Y91 A;  5F82 A;  2JC7 A;  3BFC A;  1WE4 A;  2ZM2 A;  3NDG A;  3VP4 A;  4LEN A;  4FH2 A;  2Y2H A;  4Z9Q A;  1BLC A;  3PBT A;  4OH0 A;  3G2Z A;  4UAA A;  5AQB A;  3BYD A;  5KSH A;  4KZ9 A;  4C75 A;  1NRF A;  1KGF A;  3MZE A;  3SS5 A;  2WKH A;  3PAG A;  4WZ5 C;  4DKI A;  4GD6 A;  3C7U A;  3SH9 A;  5CGW A;  1ES3 A;  2GDN A;  3IWQ A;  3HRE A;  2WGW A;  3NY4 A;  2HDR A;  4LV3 A;  4WEJ A;  4PMA A;  3IQA A;  2I72 A;  3LY3 A;  1SKF A;  1ONG A;  1EI5 A;  3HUO A;  1W7F A;  1PI4 A;  5FQK A;  3Q81 A;  3VOY A;  3N6I A;  1IYO A;  4X68 A;  1WYC A;  5D3O A;  2DNS A;  5DTS A;  3GVB A;  4BQM A;  4U0X A;  1XA1 A;  4FD8 A;  3RXW A;  4DDS A;  1YMS A;  2ZC3 B;  3G31 A;  5CGS A;  1O7E A;  4S2L A;  1HVB A;  1KE3 A;  4M3K A;  1HTZ A;  5BOH A;  4X6T A;  4JPM A;  5KZH A;  4KQR A;  5CXW A;  5CEB A;  3IF6 C;  3P09 A;  3WS1 A;  4S2K A;  5EUA A;  1TDG A;  1G6A A;  4KZ7 A;  3W8K A;  4BL3 A;  1MKI A;  4E3J A;  2JCH A;  1KE0 A;  4OP5 A;  4DRT A;  4CJN A;  1KVL A;  1ESI A;  3GR2 A;  1MY8 A;  1I2W A;  4X69 A;  1DY6 A;  3MXS A;  2P9V B;  4PPR A;  1BUE A;  3A3F A;  3IHB A;  4RYE A;  4QJG A;  4K0X A;  1ES5 A;  1H8Y A;  4N92 A;  1ZC2 A;  4BD0 A;  3BFF A;  2Y2M A;  5CER A;  3G30 A;  5F83 A;  4LV1 A;  2ZQC A;  4X53 A;  2V2F F;  4N9L A;  3WS0 A;  3SS4 A;  3HUN A;  3BFG A;  3Q82 A;  1W5D A;  3A3I A;  2WZZ A;  3NBL A;  4OPQ A;  2WK0 A;  4XUZ A;  1NZO A;  3UNW A;  1ERO A;  4HES A;  4Y0T A;  4E6X A;  1NZU A;  4EBL A;  2EFU A;  5M19 A;  2WKE A;  1SCW A;  3GSG A;  1JWV A;  5HFO A;  3BLS A;  4JF4 A;  2ZQ8 A;  1LHY A;  1PI5 A;  2ZC7 A;  1K55 A;  3G34 A;  1HZO A;  1BLH A;  2XLN A;  1BZA A;  3LO7 A;  1VQQ A;  2Y2Q A;  4LCM A;  3S4X A;  3V39 A;  1YLP A;  5DF7 A;  4KZ4 A;  1DJA A;  2Z2M B;  3TSG A;  2ZM0 A;  1ONH A;  4EWF A;  1CI8 A;  3N4I A;  5A92 A;  1IEL A;  3EQU A;  3HLE A;  3MKF A;  4FSF A;  4L0L A;  1IYQ A;  2XD5 A;  3EQV A;  4Y0O A;  3UDF A;  1M40 A;  4B88 A;  4P0M A;  2OV5 A;  4R4S A;  2XFS A;  5E2E A;  1XA7 A;  3CZD A;  3QNB A;  4N1H A;  1Q2Q A;  3ZNY A;  4ZDX A;  1E3U A;  1YLW A;  3C4O A;  4OKP A;  4QB8 A;  3HLF A;  1BLP A;  3MZF A;  4HBU A;  3RJU A;  3DW0 A;  2HDS A;  1K38 A;  3ZVW A;  1MWT A;  4H8R A;  1M6K A;  4IBR A;  2G2W A;  4S2I A;  5FI7 A;  4B4X A;  3V3R A;  3TOI A;  3VP0 A;  3M6H A;  5E2G A;  1L2S A;  3PBR A;  4IVI A;  1RGZ A;  1GHP A;  4LV2 A;  3M2J A;  4QU3 A;  1BUL A;  3LEZ A;  3HLD A;  5FSR A;  1RGY A;  2OLV A;  3SH8 A;  4MEZ A;  2Y2K A;  3ITB A;  2C5W B;  5HAP A;  2Y2O A;  1JTD A;  5GLB A;  3UE1 A;  1L0G A;  3WRZ A;  4OPZ A;  3VP1 A;  4R23 A;  4JKT A;  4NET A;  1K25 A;  1KVM A;  4RA7 A;  4DXB A;  5TGF A;  3N8L A;  2PBY A;  4OLD A;  2PU2 A;  1RCJ A;  2H10 A;  2BG1 A;  3WRT A;  3GV9 A;  5GHY A;  3M6B A;  2XR0 A;  3MKE A;  3E2L A;  4K0W A;  3QNC A;  3GMW A;  3WS5 A;  3C5A A;  4KZB A;  4OOM A;  5CTM A;  3VOZ A;  4OPR A;  3GTC A;  3IF6 B;  2EXB A;  4N1X A;  4UA6 A;  5DTT A;  1LI0 A;  3BFD A;  1L0D A;  3MZD A;  4B4Z A;  1E3U D;  2WAD A;  1NXY A;  2Y2L A;  3IH8 A;  1CEG A;  2WGV A;  3CG5 A;  3S1Y A;  1S6R A;  1I5Q A;  1FCN A;  3G2Y A;  3W4O A;  4BL2 A;  1EWZ A;  4EUZ A;  1ESU A;  2EFX A;  3N8S A;  1BLS A;  3FWL A;  1U60 A;  2Y55 A;  3ZCZ A;  1MWR A;  1JTG A;  2ZC5 B;  3FV7 A;  3NI9 A;  4S2M A;  3V3S A;  2J9P A;  5A90 A;  5GHX A;  1GHI A;  1YM1 A;  2XH9 A;  3ZVT A;  1K55 C;  4PM9 A;  2OLU A;  3N8R A;  3D4F A;  5DF8 A;  3V50 A;  2HP6 A;  4GDN A;  1IEM A;  2R9X A;  1YQS A;  4NK3 A;  3NIA A;  5CRF A;  1GA9 A;  1W8Y A;  3MBZ A;  1KGG A;  4JF6 A;  3ITA A;  2V1Z A;  4P6B A;  3UPO A;  3W4Q A;  2ZC4 B;  4R3J A;  2V20 A;  2ZQA A;  1K54 A;  1VM1 A;  3MFD A;  3TG9 A;  5EOO A;  4E3O A;  2OSU A;  4GKU A;  2H0T A;  4KZ6 A;  5I94 A;  1MXO A;  5KMW A;  2WGI A;  3UN7 A;  4JF5 A;  3OPH A;  4DE1 A;  2HP9 A;  1XKZ A;  4HBT A;  4YFM A;  3VP3 A;  3PBS A;  1ES2 A;  1FCM A;  2FFF B;  1DJC A;  2XEP A;  2ZJ9 A;  3IF5 A;  4GDB A;  4JXS A;  1PWC A;  1FR1 A;  3HLG A;  4OQH A;  5M1A A;  5M18 A;  2R9W A;  3NC8 A;  4E3N A;  3A3E A;  3GQZ A;  2ZQ9 A;  2IWB A;  3V5M A;  5CHM A;  1G68 A;  4A5R A;  2HDU A;  3G4P A;  4E3L A;  3ZG8 B;  3LCE A;  2VGK A;  3CMZ A;  4R4R A;  5L2F A;  4FCF A;  4Y7P A;  4KZ8 A;  1ERQ A;  3DTM A;  4Y0U A;  1S0W A;  4S2N C;  4GOG A;  1RP5 A;  1SDN A;  1XGJ A;  4WZ5 A;  4ZJ2 A;  4S2P A;  1E4D A;  3A3J A;  3N7W A;  3ZFZ A;  1IKG A;  1N9B A;  2Y2J A;  4KZ3 A;  1TDL A;  2WYX A;  2J7V A;  2H5S A;  4F94 A;  4BLM A;  3GRJ A;  2Z2L B;  2J9O A;  4MLL A;  2EX9 A;  5GLC A;  2EX8 A;  5GHZ A; 
#chains in the Genus database with same CATH topology
 2B18 A;  1K4E A;  4E6W A;  5E43 A;  1P3F D;  3KSF A;  3V9R A;  3Q7Z A;  5EEC A;  4CLC C;  3LYX A;  3IXG A;  2F8N K;  4PM8 A;  5L07 A;  3MVD C;  3KX0 X;  1J9M A;  3O62 D;  3UTB A;  2GX5 A;  3REH D;  3KUY D;  3AL0 C;  1T18 A;  5DVA A;  2F8N B;  2Y2G A;  3AV1 C;  2W3E A;  4MNR A;  3OCN A;  1P3I D;  3L25 A;  4XUX A;  5CP6 D;  3B0D B;  2PRF A;  3PAE A;  5AV9 B;  3CAX A;  1L0F A;  3LID A;  3R45 A;  4E3I A;  3IHA A;  3FKW A;  4NKP A;  1MPL A;  1JVJ A;  4CAY B;  4KHA A;  5FQ9 A;  4D2O A;  2EWW A;  2W3D A;  3OOV A;  4EQ1 A;  5C3I B;  1Q9C A;  4MBH A;  5EFW A;  1F66 D;  4X1M A;  5EM0 A;  1G28 A;  4IBE A;  2P74 A;  2HPB A;  1H8P A;  5F6A A;  1VHM A;  3UE3 A;  4PM6 A;  4NE5 A;  4WU9 B;  3MNN B;  1FSY A;  1W1V A;  3OPR A;  1XX2 A;  3NOP C;  1BYW A;  1MBL A;  5FI6 A;  2VV6 A;  4EXO A;  3REL A;  2W1T B;  2P08 A;  3CIT A;  3A0R A;  3FKV A;  4JBF A;  3VFH A;  3H82 A;  3MGP C;  5F99 B;  2NUT C;  3WS4 A;  2JKR M;  2ZQ7 A;  2IO5 B;  3X1U B;  3AGD A;  1UWP X;  3HLC A;  4Z66 A;  3SH7 A;  5AV5 C;  1J3W A;  3MXR A;  5FDH A;  5DNN A;  1Y28 A;  1CK3 A;  2F8N H;  3CUE C;  5F1F A;  1K6R A;  5B33 B;  4I38 A;  1P3A B;  3DTE A;  2P04 A;  1E6Z A;  4H6J B;  4XZQ A;  3LIB A;  5B0Z C;  1XGI A;  1A0K A;  3LZ1 B;  3L7H A;  1BH8 B;  3X1V D;  3BRM A;  2HF6 A;  3BLM A;  1CEF A;  2ZD8 A;  3R7W B;  5GXQ B;  1K4F A;  5B31 C;  1H8M A;  1KDW A;  3RH8 B;  4GLQ A;  2UWX A;  3U2A A;  3SOI A;  5B40 C;  3ZG0 A;  2ZC6 B;  4CQH A;  3WKJ A;  3LIF A;  3OCL A;  4CLC B;  2Y2N A;  5EOE A;  2VJW A;  2B02 A;  4DDY A;  1CJF A;  3IWI A;  3MVD B;  2W1R A;  2XDM A;  5B2I D;  5KSC A;  5FI2 A;  2ZBB A;  3W4P A;  1TAF A;  4EBN A;  3C30 A;  2M7U A;  3NDE A;  2WGW B;  3AV1 B;  4GN2 A;  3EPL A;  3DWZ A;  5GLD A;  5B32 G;  4MB4 A;  4X23 C;  2XRN A;  1KOU A;  5TFQ A;  4Q0J A;  3HLW A;  3OPL A;  2DCF A;  3LEL A;  4J8U D;  3LJA B;  4EQI A;  4ID4 A;  4DMZ A;  1O6I A;  2WUQ A;  5AVC A;  1O07 A;  1MWS A;  3HBR A;  3I7J A;  1KDS A;  3E4Q A;  2LY8 A;  3AN2 C;  5HDC A;  2VKS A;  5FA7 A;  4OVD A;  3WTP A;  3C1B A;  1W1P A;  3KXB B;  4L9E A;  2HUE C;  3EPH A;  2W27 A;  3VH5 T;  1HLU P;  4YM6 A;  3B6G C;  4KQO A;  4KZA A;  3DWK A;  3MGR A;  2BLS A;  3VMA A;  2F8N D;  1P3O A;  1FIL A;  4P85 A;  3AZJ A;  4OJP A;  5CGX A;  3H0L C;  3W96 A;  4UA9 A;  4XT2 B;  4HJ6 A;  2ZOH A;  3JVU A;  4ZJ1 A;  1TZY A;  5AV9 D;  3BM6 A;  1GA0 A;  3UMD A;  5L10 A;  5HAI A;  3UPN A;  5U47 A;  4MCW A;  1GPF A;  5B24 C;  5AV5 B;  1ZG4 A;  3AZG B;  1DRM A;  4S2N A;  2WKI A;  3ZDJ A;  3UDX A;  1P9W A;  3A3D A;  5BNV A;  1Q2P A;  2BTF P;  4OQG A;  3CJM A;  2XK1 A;  5EVI C;  1U35 C;  5B0Z B;  1YPR A;  4E3M A;  1DJB A;  1GOI A;  1GCE A;  2Q9N A;  2Y91 A;  5F82 A;  4WU9 D;  3MNN D;  1DP6 A;  3AZN A;  1WE4 A;  1NWZ A;  3F1O A;  5B2J C;  3IBJ A;  5F68 A;  4FH2 A;  3T4J A;  1BLC A;  4OH0 A;  5B31 B;  3HJK A;  1KGF A;  3MZE A;  2WKH A;  4DKI A;  3BW6 A;  5F99 D;  5FEG A;  3SH9 A;  1JFI A;  1T19 A;  1E6P A;  5G49 B;  3X1U D;  1XFQ A;  1ACF A;  2FH5 A;  3NY4 A;  4WEJ A;  3KS8 A;  3LY3 A;  4IJG A;  4IBB A;  3CWF A;  1YU3 A;  3IP4 C;  2P7J A;  3HUO A;  1PI4 A;  3Q81 A;  4X68 A;  5B33 D;  5BO0 A;  3LIA A;  4HP9 A;  1ZLA A;  3LZ1 D;  3G31 A;  5CGS A;  4BWI A;  3X1T A;  2ZY5 A;  4LLO B;  4XUJ A;  3IF6 C;  5GXQ D;  4H9R B;  4S2K A;  2ACG A;  4HHD A;  1YU2 A;  3W8K A;  2JCH A;  4HH2 A;  3WD2 A;  4DRT A;  2NQB A;  4CJN A;  2KLI A;  5HL6 A;  1MY8 A;  1AIW A;  5LBR A;  3AN2 B;  2K31 A;  3MXS A;  3IHB A;  3MXQ A;  4R38 A;  2Z6D A;  4CLC D;  1ES5 A;  4N92 A;  1KX3 A;  3VH6 T;  2HUE B;  1M18 A;  3B0B A;  3MVD D;  3B6G B;  1YKD A;  4X53 A;  4N9L A;  3NBL A;  2WZZ A;  5FDS A;  4H9Q A;  1NZO A;  4AFI A;  3AV1 D;  4EBL A;  3L29 A;  3W98 A;  1GSV A;  2WKE A;  1SCW A;  3IS2 B;  2A2L A;  5M19 A;  1P3K A;  5HFO A;  4QLC C;  3G34 A;  3LO7 A;  1BLH A;  3S4X A;  2ZM5 A;  3MQ0 A;  3LJA D;  4KZ4 A;  4NE3 A;  2Z2M B;  5B24 B;  4EWF A;  1VB6 A;  3EQU A;  3MKF A;  3EQV A;  3UDF A;  1PZR A;  1YUE A;  3MMH A;  4WU8 C;  2XFS A;  3REK C;  1B67 A;  3AFA A;  1N1J A;  3TU4 A;  3KXB D;  1E3U A;  1V9Z A;  4HP4 A;  4OKP A;  2VV7 A;  3RJU A;  5HWW A;  3DW0 A;  4IUH A;  2HDS A;  5B2J B;  4PKY A;  4B4X A;  4KGC A;  5E2G A;  5B1L C;  5GT0 A;  2W0N A;  1BUL A;  3HLD A;  1RGY A;  2OLV A;  1KU5 A;  3ITB A;  2C5W B;  3AZM C;  5AV5 D;  2Y2O A;  3DBA A;  3MGQ B;  1AOI C;  5GLB A;  4CLC E;  3AZG D;  3WRZ A;  3E4O A;  3REJ C;  4JKT A;  4JJN C;  4J8V D;  4RA7 A;  2QJ5 A;  5F69 A;  2V1A A;  3AZH A;  3WD0 A;  4OLD A;  5B0Z D;  2BAS A;  2PD7 A;  3GV9 A;  4L9F A;  2FN2 A;  3QNC A;  3JPU A;  3K3D A;  1OTB A;  4KZB A;  3MGS C;  4Y2F A;  3IF6 B;  5DTT A;  4N1X A;  1T3U A;  1LI0 A;  4H9O A;  2M1C A;  4YS3 C;  3PR6 A;  2J3T C;  4UQI S;  4B4Z A;  2WAD A;  5B31 D;  1Z2C B;  3CG5 A;  1S6R A;  1I5Q A;  2JHE A;  4IHQ A;  4BL2 A;  3C1C A;  2V9A A;  4O0P A;  3CPT A;  1P3B C;  1OJG A;  1AWI A;  4DRB A;  4NZ5 A;  3B33 A;  3O5Y A;  4Y15 A;  4G92 C;  3LI9 A;  1H0M A;  2A24 A;  2J9P A;  4Z2H A;  4I5S A;  1K55 C;  4PM9 A;  2INW A;  2OLU A;  3N8R A;  1P3F A;  5TBM A;  2V0W A;  3E98 A;  3T12 B;  1YQS A;  5CRF A;  4II7 A;  4P6B A;  3W4Q A;  1NRJ A;  4R3J A;  3O62 A;  4KZ6 A;  5KMW A;  5CPJ C;  3REH A;  3KUY A;  1P3P D;  3EGX C;  1J7M A;  4GHI B;  5F5Y A;  4LRY C;  1XKZ A;  3AZL B;  4HBT A;  4GDB A;  2XEP A;  4OQH A;  4JXS A;  5M18 A;  1P3I A;  2OWH A;  5CP6 A;  5DKK A;  3AN2 D;  2IWB A;  1XJ2 A;  1G68 A;  4A5R A;  3CMZ A;  4R4R A;  2O0Y A;  4FCF A;  1S0W A;  3H0M C;  1RP5 A;  3H7W A;  3B6G D;  2AVX A;  4S2P A;  1IKG A;  1F66 A;  5B0Y C;  2J7V A;  2QWS A;  2ZL1 B;  4BLM A;  4IBC A;  3GRJ A;  3W99 C;  5B1L B;  1IFQ A;  2EX9 A;  5FSR A;  3NQU B;  4G3V A;  4QD4 A;  5EM1 A;  2CC1 A;  3MR0 A;  1YLT A;  1G6O A;  5HW3 A;  2B5R A;  4JXW A;  3W97 C;  1E25 A;  1SZV A;  1HQ3 B;  5B24 D;  5FUG B;  3LZ0 B;  1YAX A;  3REJ B;  4JJN B;  3ZG5 A;  4NY2 A;  2JKR I;  5FQI A;  1P34 B;  2QJ7 A;  3AZI C;  2XGN A;  1TS6 A;  1W2E A;  4YNR A;  3WA9 B;  4WEL A;  3BEC A;  5B1M B;  5DNM C;  1M19 C;  4B9O A;  4H9P A;  4K91 A;  4YS3 B;  3HLB A;  3P98 A;  1GHM A;  3WWX A;  1OGG A;  1VET A;  1N4O A;  3X1V A;  3AV2 C;  2NZD C;  2O9B A;  1P3B B;  3AZK C;  5FAO A;  1NJ4 A;  3MGQ D;  3MQQ A;  4QHC A;  4G92 B;  3JVV A;  2L1M A;  1FR6 A;  2JBF A;  4N9K A;  4Z5T C;  3PBQ A;  3VV4 A;  2J80 A;  2WAE A;  2P9V A;  4X56 A;  4JLF A;  4GS9 B;  3HL9 A;  1B6W A;  3K2N A;  3UT9 C;  4KEN B;  4HGA C;  5DFX A;  2X02 A;  4J8W B;  2CWE A;  5B2I A;  5E2F A;  3HVF A;  3VOL A;  5CPJ B;  2IWD A;  1BTL A;  4EV4 A;  5GT3 C;  2YFW B;  2LB5 A;  1Y54 A;  3LR0 A;  1P3M B;  2BYM B;  4HY8 A;  1XJ6 A;  4O7D A;  4EU0 A;  4BEN A;  4MBF A;  4EEU A;  4NZ3 A;  1AXB A;  3UDI A;  4DXC A;  2ZM8 A;  3AGF A;  3WAA B;  4J8U A;  2WZX A;  3T4O A;  2XD1 A;  1R4V A;  1IOU A;  3UPP A;  2VX8 A;  3ZG7 B;  5A93 A;  4OUI A;  1K57 A;  4R0Q A;  1YMX A;  2PYR A;  4RVA A;  4ME4 A;  4IED A;  3HSH A;  1W63 M;  2IWC A;  3W99 B;  3UE0 A;  2PU4 A;  4CPK A;  4Q8I A;  4CSR B;  4M6B A;  2OWJ A;  4IJE A;  3UTB C;  2ZY4 A;  4WLA A;  4QY6 A;  5G18 A;  2DRW A;  3W97 B;  1WYB A;  3AZL D;  2F8N A;  2R78 A;  1EQZ B;  3B0C T;  2K7S A;  4JGQ A;  4ZBE A;  2HV1 A;  1KE4 A;  4B93 A;  3H9W A;  5AV9 A;  4LV0 A;  3OZH A;  3QP4 A;  1PZO A;  1NYM A;  2PYP A;  4CAY A;  5KIZ A;  2RCX A;  2Y2P A;  2X71 A;  3IBR A;  3IXB A;  3IXD A;  1P3G C;  4RQ9 A;  3PBO A;  5DNM B;  4GJ4 A;  4OQI A;  1M19 B;  2WKR A;  5HAR A;  3T1R A;  5IS1 A;  4OP8 A;  3W2Z A;  1I2S A;  3TW8 A;  3KSH A;  5B1L D;  4P6Z S;  1XPB A;  4BD1 A;  2GJ3 A;  4WU9 A;  3MNN A;  3AV2 B;  4WEK A;  3E2K A;  2NZD B;  5A91 A;  4GW9 A;  2HDQ A;  3O88 A;  5AV6 C;  3AZK B;  1HD8 A;  4RX3 A;  2EA9 A;  1HQ3 D;  3LZ0 D;  3EPK A;  3REL C;  4HOI A;  2W1T A;  1LI9 A;  3REJ D;  4JJN D;  3L26 A;  1MKM A;  1OME A;  5F99 A;  1P34 D;  4Z5T B;  1YLZ A;  3LR5 A;  5F1G A;  3X1U A;  4Z66 C;  1KX4 C;  4HEF A;  3UT9 B;  3KYE A;  3T4K A;  1YLJ A;  4HGA B;  1ODV A;  3WA9 D;  1XJ4 A;  4G3K A;  1FSW A;  5CHU A;  3S7N A;  3T4T A;  2V1B A;  3LI8 A;  5B1M D;  4KUD C;  5B33 A;  1MWU A;  5GT3 B;  4P87 A;  4YS3 D;  4H6J A;  4ZUX C;  4XZQ C;  4DE2 A;  4KG5 A;  3A1K A;  4KG2 A;  3LZ1 A;  3OBF A;  1BH8 A;  3BFE A;  2VGJ A;  4KQQ A;  2X01 A;  3R7W A;  1P3B D;  5GXQ A;  3FDD A;  4L9G A;  3FZC A;  3M7P A;  4H9S A;  5EPH A;  3QP5 A;  3REI C;  1KS0 A;  3FPV A;  2ARO B;  2PBD P;  4Y5F A;  3VP4 A;  3BY9 A;  4LEN A;  3ZQ5 A;  1EW0 A;  3SZT A;  4CLC A;  4EUV A;  4KZ9 A;  3AZE C;  5EV0 A;  4C75 A;  4J8W D;  1NRF A;  3T4S A;  3DTI A;  3S7O A;  3MVD A;  3KWQ B;  3PAG A;  4Z2M H;  5CPJ D;  5AJG A;  3UE6 A;  1ES3 A;  5CPK C;  5BNX B;  2WGW A;  3AV1 A;  1P3M D;  1E6N A;  2PDR A;  3F1P B;  3CI6 A;  2XA7 S;  1SKF A;  5HPF A;  3KYQ A;  5CHL B;  3VOY A;  3N6I A;  1VEU B;  3LEL C;  4EW7 A;  5GSU C;  2DNS A;  3WAA D;  3C2W A;  2VK3 A;  3LJA A;  4EET B;  1XA1 A;  3RXW A;  1TS8 A;  1TD5 A;  2ZC3 B;  1O7E A;  1HVB A;  4X6T A;  4JPM A;  1P3G B;  3P09 A;  3C1B C;  3U4L P;  3KXB A;  2O9A A;  1G6A A;  4KZ7 A;  3W99 D;  1MKI A;  1KE0 A;  5AV8 C;  1YU1 A;  3D72 A;  4R3A A;  1ESI A;  3GR2 A;  2ZMV A;  4PPR A;  1G5U A;  4R8P C;  5AV6 B;  3MGR C;  1BUE A;  3A3F A;  3AZJ C;  3W96 C;  1EQZ D;  4NYY A;  3K3C A;  4XT2 A;  2Y2M A;  5CER A;  5J7E A;  1TZY C;  3L27 A;  3SS4 A;  3HUN A;  1DP8 A;  5B32 C;  3A3I A;  4OPQ A;  2WK0 A;  4Z66 B;  1KX4 B;  2QYB A;  5AV5 A;  1NZU A;  4E6X A;  5KDM B;  3AZG A;  5L8M A;  2BYK B;  3TJZ C;  4J8V A;  4KUD B;  5DNM D;  1M19 D;  4LV2 A;  4IBK A;  1L3L A;  3UB5 P;  5DF7 A;  4ZUX B;  3X1S C;  5B0Z A;  2VA0 A;  2ZM0 A;  1CI8 A;  4IUK A;  1IYQ A;  4B88 A;  2NZD D;  4N1H A;  3AZK D;  1Q2Q A;  3ZNY A;  5B31 A;  1YLW A;  3C4O A;  3BY8 A;  5CX7 A;  4WNN B;  3REI B;  4QB8 A;  3HLF A;  4NE6 A;  2VGL M;  3MGP B;  1ID3 C;  2VZW A;  4Z5T D;  5JA4 B;  5G49 A;  3BWL A;  3VP0 A;  2XSS A;  3D3O A;  3UT9 D;  3M6H A;  3NEC A;  3AZE B;  2VLG A;  1RGZ A;  1GHP A;  3M2J A;  4QU3 A;  3LEZ A;  3SH8 A;  5GT3 D;  5CPK B;  3F1N B;  2Y2K A;  4LPZ A;  5HSQ A;  1L0G A;  1SKO B;  1A7W A;  3VP1 A;  3X1T C;  4NET A;  1KVM A;  1K0K A;  1P3P A;  4H9R A;  5GSU B;  4LD9 C;  4FUW A;  1PRQ A;  2UV0 E;  2PBY A;  2PU2 A;  2H10 A;  3WRT A;  5G4Y A;  5GHY A;  3M6B A;  3LR3 A;  4K0W A;  2ARO D;  1H0I A;  3GMW A;  3WS5 A;  1GSX A;  3AN2 A;  2B95 A;  5B40 B;  4OOM A;  4OPR A;  3P5J B;  3GTC A;  1L0D A;  5BPV A;  3MZD A;  1KX3 C;  3NQJ A;  2VV8 A;  5AV8 B;  4K08 A;  4MDZ A;  1FCN A;  3KWQ D;  3G2Y A;  3FPW A;  5AY8 C;  3B6G A;  4MB3 A;  3EEA A;  1ESU A;  3LGO A;  4EUZ A;  4R8P B;  1P3A D;  3FWL A;  3N3F A;  5AVB C;  4I3J A;  3F6T A;  3W98 C;  1MWR A;  1JTG A;  2ZC5 B;  3FV7 A;  3IS2 A;  3NI9 A;  4NXB A;  4S2M A;  4BMW A;  5GHX A;  2E8J A;  4X23 B;  4F3L B;  3UB6 A;  5B32 B;  1IEM A;  2R9X A;  3NIA A;  5B24 A;  2J3W A;  3UPO A;  3TG9 A;  3MFD A;  1VM1 A;  4OJ6 A;  4J8X C;  1P3G D;  2OSU A;  3IX8 A;  3QP8 A;  3UN7 A;  3TU4 C;  3NUL A;  2HP9 A;  3VP3 A;  3PBS A;  1FCM A;  3X1S B;  1DJC A;  1WWS A;  1FR1 A;  3HLG A;  5M1A A;  2R9W A;  4PKY G;  4GH9 A;  1MZU A;  3A3E A;  3C8C A;  5CHM A;  2HDU A;  5AV6 D;  3G4P A;  2V8C A;  4NXE A;  1OGB A;  4Y7P A;  4ESP A;  5GT0 C;  1SDN A;  1ID3 B;  2CV5 C;  1N9B A;  4KZ3 A;  1TDL A;  3R4K A;  5CPI C;  4NZ1 A;  1KX4 D;  3SW1 A;  2Z2L B;  3MGQ A;  2EX8 A;  2HJ9 C;  3O3V A;  4KUD D;  1FOF A;  4WZ4 A;  1UWN X;  2Z6C A;  4R6L A;  4ZUX D;  3A1I A;  2G5H C;  2OAQ 1;  5EVI B;  1U35 B;  3UB8 A;  4JXG A;  1QMF A;  5HDD A;  1W79 A;  3UME A;  2QPN A;  3ZGA B;  2Q0O A;  3Q07 A;  5E5A C;  3IF6 A;  4HMC A;  3FG8 A;  4LD9 B;  1ZKJ A;  4R1G A;  4WM9 A;  1CXW A;  4C3Q A;  2ZMA A;  3B6F C;  3REI D;  4DF6 A;  3MGP D;  4U3T A;  5GL9 A;  1LL5 A;  5AQ9 A;  3UTA C;  1OTA A;  1OJ5 A;  2HP5 A;  3AZE D;  1PYY A;  4O01 A;  3O87 A;  1PDC A;  5AY8 B;  4QY5 A;  3S7Q A;  2M7V A;  1JWZ A;  5CPK D;  3G6O A;  2DF4 C;  4IBJ A;  5AVB B;  3W98 B;  4KZ5 A;  2YKH A;  3O62 C;  2V8F A;  3AYW C;  4GB7 A;  4XXR A;  3KSG A;  3FYZ A;  4M4X A;  5EVL A;  5JYP A;  5GSU D;  4GHI A;  4X25 A;  3AZL A;  5E2H A;  1MC0 A;  3HUM A;  3G35 A;  3C38 A;  2WAF A;  4J8X B;  4GHA A;  2K2N A;  3LEQ A;  4RX2 A;  5B40 D;  1PNE A;  1PW1 A;  1STZ A;  3DAV A;  3M2K A;  4WYY A;  2W8S A;  2FJ7 C;  3VFF A;  2XRO A;  3TU4 B;  4HJ3 A;  4NZ4 A;  3Q7V B;  1BSG A;  1S32 C;  3NCK A;  4I3I A;  5AV8 D;  1PFL A;  3VH5 W;  2D49 A;  3JYI A;  4WMC D;  2YFV B;  1M1A C;  4R8P D;  2PYO C;  3CLO A;  5TJJ A;  3H0R C;  4OJL A;  2JKT M;  2PD8 A;  3QHY A;  5J8X A;  3PTE A;  5C5K A;  5B1L A;  5BT1 C;  1P3L C;  3VP2 A;  1GSW A;  1FQG A;  3NQU A;  1Z6F A;  5HAQ A;  3A6N C;  1YLY A;  5FAT A;  4X23 D;  2ZY3 A;  2CV5 B;  4QLC B;  3IX3 A;  5B32 D;  4DJ3 A;  3LY4 A;  5CPI B;  1YT4 A;  2FZ0 A;  3T50 A;  1HQ3 A;  5FUG A;  3LZ0 A;  1KX5 C;  5I5L A;  1L6J A;  1GXD A;  3REJ A;  1W1Y A;  4JJN A;  4QNL A;  4MBK A;  1PIO A;  1P34 A;  3IXH A;  1N9L A;  1OPX A;  4WU8 B;  3REK B;  4S2J A;  3X1S D;  1IYS A;  2J8P A;  3WA9 A;  2JN7 A;  4IVK A;  2FFY A;  1S4R A;  1K56 D;  5B1M A;  3EEH A;  3LUQ A;  5E5A B;  3S22 A;  4C6Y A;  4JGO A;  2RL3 A;  4YS3 A;  5DTK A;  3P01 A;  1F2K A;  1UR9 A;  3B6F B;  3X1V C;  2QHK A;  2GNX A;  1ID3 D;  1H5X A;  1P3B A;  2C6W B;  2HIO C;  3UTA B;  5FQM A;  1T1A A;  1LLB A;  2VQR A;  5JRG C;  3AZM B;  1LL9 A;  1AOI B;  2GZA A;  4OOY A;  1IKI A;  2O9C A;  4ETZ A;  3C4P A;  4ARZ B;  5MC7 A;  1H3O A;  4FTX A;  3O86 A;  4GS9 A;  5FAS A;  5AVF A;  5EVI D;  1U35 D;  1P0Z A;  3HJI A;  4J8W A;  4UHU A;  5B2I C;  3O62 B;  2JKF A;  3OLO A;  2EX6 A;  3AYW B;  5CPJ A;  3FKE A;  3MGS B;  4LD9 D;  2YFW A;  5B2J D;  4YIN A;  5J4E A;  5AQA A;  1P3M A;  5FQJ A;  2BYM A;  1ES4 A;  2XQZ A;  4Q0I A;  1TVF A;  3Q1F A;  1T1C A;  1E15 A;  2FJ7 B;  1W1T A;  3WAA A;  1NYY A;  1S32 B;  1BT5 A;  2XF3 A;  5AQ7 A;  1K54 C;  1K57 C;  2I9V A;  3MF0 A;  3VH6 W;  4OLG A;  3AGE A;  4PM5 A;  5AY8 D;  2V5O A;  1QO6 A;  2HJE A;  4NG2 A;  3AZF C;  2ZLY A;  2PR5 A;  1M1A B;  5DJU A;  2PYO B;  3C7V A;  2OAP 1;  1SHV A;  2Y2I A;  3LIC A;  5AVB D;  5HWT A;  1P3L B;  3W99 A;  4WBG A;  4X55 A;  2ZOI A;  3VE3 A;  4CSR A;  3A6N B;  2JC7 A;  2ZM2 A;  3NDG A;  1UR8 A;  2F8N G;  3E4P A;  1UGU A;  3A0S A;  1YU4 A;  3G2Z A;  4UAA A;  5BS7 C;  3BYD A;  1KX5 B;  4IBF A;  1EQZ A;  4J8X D;  2WKQ A;  4WZ5 C;  2GDN A;  4I3A A;  3IWQ A;  4EO5 C;  1OT6 A;  3HRE A;  4LV3 A;  3LR4 A;  1W7F A;  5FQK A;  5DNM A;  1IYO A;  1M19 A;  3NJA A;  4UUZ B;  1WYC A;  5D3O A;  5DTS A;  3T1X A;  4BQM A;  5B0Y B;  1P9R A;  2DQN C;  1YMS A;  4S2L A;  4WU9 C;  4M3K A;  1HTZ A;  2F2A C;  1E6R A;  5CXW A;  2NZD A;  2CV5 D;  4QLC D;  3WS1 A;  2KOI A;  3AZK A;  5CPI D;  1TDG A;  2HIO B;  3IX4 A;  1WA9 A;  4Y13 A;  4BL3 A;  4E3J A;  4Z2K A;  5JRG B;  5F99 C;  4Q0H A;  1FIK A;  4X69 A;  1DY6 A;  3QP6 A;  2IO5 C;  4Z5T A;  2P9V B;  4WU8 D;  1S1Z A;  1BH9 B;  3REK D;  4RYE A;  3AZI B;  1H8Y A;  3UT9 A;  4HME A;  1ZC2 A;  3BFF A;  3G30 A;  5F83 A;  1YSQ A;  4LV1 A;  3B47 A;  3WS0 A;  5E5A D;  3Q82 A;  5GT3 A;  3NHQ A;  4XUZ A;  3UNW A;  4Y0T A;  4MN5 A;  3B6F D;  1OTE A;  4GCZ A;  4GHL A;  1F98 A;  1ZTU A;  1JWV A;  3V67 A;  2ZQ8 A;  4X1L A;  5GXQ C;  3QP1 A;  1WWI A;  2ZC7 A;  1HZO A;  4LCM A;  3V39 A;  1BZA A;  3T1Q B;  3UTA D;  4H9N B;  3AZM D;  1ONH A;  3N4I A;  1AOI D;  5A92 A;  2ARO A;  3VE4 A;  3HLE A;  4FSF A;  4Y0O A;  1M40 A;  1TF1 A;  4P0M A;  4R4S A;  3AZF B;  3EPJ A;  3QNB A;  4ZDX A;  4WL9 A;  3MJQ A;  2RIQ A;  4LGW A;  4MB5 A;  3MZF A;  5DNN C;  3KWQ A;  3AYW D;  4PAU A;  1K38 A;  3ZVW A;  3MGS D;  4H8R A;  4IBR A;  1P3A A;  4MMN A;  4UQI M;  5BNX A;  2J3T D;  4BBT A;  3ULF A;  1T1B A;  3F1P A;  4LFU A;  4HH3 A;  4MN7 A;  1VEU A;  2FJ7 D;  3LJA C;  4WN5 A;  2JSS A;  4EO5 B;  3L9K A;  4E44 A;  1S32 D;  2ZY2 A;  1JTD A;  4WV4 B;  4OPZ A;  3T1S A;  1K25 A;  4Z1W A;  1P3G A;  4DXB A;  3V9R B;  1M1A D;  2W3G A;  2PYO D;  3KXB C;  3WKJ C;  3N8L A;  4JGP A;  1RCJ A;  5BT1 D;  1P3L D;  3KS4 A;  2BG1 A;  3ICY A;  3A6N D;  2XR0 A;  3E2L A;  3KYZ A;  3PHY A;  4KUO A;  3UTB B;  5CTM A;  4NYU A;  3WD4 A;  3UB7 A;  5AV6 A;  4OJO A;  3BQA A;  1NXY A;  1KX5 D;  3WX7 A;  1ZHH B;  1S1Y A;  2HGV A;  4KUK A;  3W4O A;  3R45 B;  1BLS A;  1KX4 A;  4QWO A;  3AZG C;  5AVC C;  2Y55 A;  5KDM A;  4KHA B;  3ZCZ A;  4J8V C;  2BYK A;  1GHI A;  2XH9 A;  4KUD A;  2HP6 A;  3WTP C;  4ZUX A;  4NK3 A;  5B0Y D;  1D1J A;  1GA9 A;  1KGG A;  4JF6 A;  3ITA A;  4IBD A;  4UEY A;  2V1Z A;  2ZC4 B;  4YM6 C;  2H0T A;  5HZH A;  3UB9 A;  5B31 G;  2WGI A;  1LSX A;  2L4R A;  2HIO D;  4Y17 A;  4YFM A;  1P3O C;  3W97 D;  2ZJ9 A;  3LIE A;  4Z2L A;  4WNN A;  5JRG D;  3REI A;  1PWC A;  3REL B;  4KQD A;  2OOL A;  3H82 B;  2PAV P;  3MGP A;  5JA4 A;  3V5M A;  3E0Y A;  4E3L A;  3LCE A;  4AWL C;  3AZI D;  3AZE A;  1ERQ A;  3DTM A;  1E8B A;  1JNU A;  4S2N C;  5DNN B;  4GOG A;  1XGJ A;  4ZJ2 A;  2G7U A;  3ZFZ A;  3N7W A;  3CUE A;  2WYX A;  2H5S A;  4F94 A;  5CPK A;  3F1N A;  4NFT A;  4XZQ B;  4MLL A;  1SKO A;  4O8G A;  2JKG A;  3AZN C;  3AV2 D;  2ZQD A;  1P3P C;  1L0E A;  4IBX A;  4OPY A;  5GSU A;  1TEM A;  4ZAM A;  3VSL A;  5HDS A;  1OTD A;  5GLA A;  4BJP A;  3RTY A;  2KDK A;  5B40 A;  4YWZ A;  3AZF D;  1X0O A;  4GZB A;  3WKJ B;  5JYO A;  4WZS B;  5G4Z A;  3L28 A;  5AV8 A;  2Y8H A;  4KG6 A;  3DTK A;  3HON A;  3UY6 A;  3IWO A;  4WMC A;  1TAF B;  2JKT I;  4R8P A;  1ZG6 A;  4FOF A;  1ZLA C;  3HCY A;  3VSK A;  5TR7 A;  1H8Z A;  2WKP A;  3PXP A;  4FH4 A;  3B0C W;  3G32 A;  4XUJ C;  4X23 A;  5EVE A;  4F3L A;  4JXV A;  5B32 A;  3LEL B;  1SDE A;  2Y4A A;  5FQQ A;  1IYP A;  1XP4 A;  3BEB A;  5AVE A;  5AVC B;  2V0U A;  4OOL A;  4J8V B;  2NQB C;  1D06 A;  2JE5 A;  4DQY B;  2A3U A;  3WTP B;  4EER A;  3C1B B;  3TE8 A;  3X1S A;  1XXM A;  1V9Y A;  4LG2 A;  2MJ6 A;  2XFT A;  1M18 C;  4YM6 B;  4ZTK A;  4U0T A;  5HWV A;  5IHV A;  1K56 A;  3PYP A;  3UTB D;  3MFX A;  1FCO A;  1N9N A;  3P7N A;  1S67 L;  3MGR B;  1C3B A;  1TS0 A;  1P3O B;  5DJT A;  5FAP A;  1PW8 A;  3AZJ B;  1PZP A;  1NY0 A;  3W96 B;  1PWD A;  1P3K C;  4D60 A;  4DE3 A;  3VH5 A;  1TZY B;  4HNB A;  1P97 A;  1ID3 A;  4OQ0 A;  5CHJ A;  3ZNT A;  1QME A;  3A0V A;  4LCL A;  4AWL B;  5CEC A;  3MGQ C;  3ISG A;  4ZJ3 A;  4NXF A;  2PHY A;  4NXG A;  2QMI A;  3IH9 A;  5BNV B;  4I39 A;  3ZHH A;  3AFA C;  2PR6 A;  3MSH A;  2Q9M A;  2EWV A;  5EVI A;  1U35 A;  4P6Z M;  3PBN A;  1XJ3 A;  5HL1 A;  1JWP A;  3AZN B;  2QZ6 A;  3IT9 A;  3WS2 A;  1P3P B;  1CI9 A;  4GNU A;  2J8Y A;  3F1O B;  4LD9 A;  4UA7 A;  5B2J A;  1XFN A;  4KGC C;  3EOI A;  4DN0 A;  3REL D;  1W8Q A;  4WF0 A;  1JFI B;  3S7P A;  3UO9 A;  5CED A;  4BBV A;  2W3F A;  3NQJ B;  3OPP A;  4Z66 D;  4NEE D;  4PM7 A;  2Y79 A;  2Y59 A;  2RVQ C;  5DNN D;  1LT0 A;  1E88 A;  5AY8 A;  5DKL A;  2G2U A;  5DF9 A;  5BO0 B;  3AZH C;  3B3X A;  1ALQ A;  2E8I A;  1ZLA B;  4XZQ D;  5AVB A;  2EX2 A;  1OT9 A;  5FAQ A;  2D02 A;  3BJN A;  3X1T B;  4R3B A;  5HD3 A;  4S2O A;  4XUJ B;  1EAK A;  1KGE A;  2ZMF A;  4GD8 A;  4WJ3 C;  3NOU C;  4G3W A;  3AZL C;  1K6S A;  4DE0 A;  1OTI A;  5DFY A;  3ZG9 B;  2NQB B;  4J8X A;  3B42 A;  4YOF A;  3SS3 A;  3OC2 A;  2H0Y A;  3C1C C;  1PWG A;  1ERM A;  3WKJ D;  4HMD A;  2A49 A;  3Q7V A;  1KX3 B;  4OON A;  1HTA A;  2RTS A;  1M18 B;  5EE8 A;  3RXX A;  5IT5 A;  3ZYT A;  3CHW P;  4Y3I A;  4HJ4 A;  1P3F C;  2YFV A;  2EXA A;  5HPI A;  3MQO A;  2HZ5 A;  2NUP C;  4H9Q B;  4OJ5 A;  2XA7 M;  4PHT A;  3RFB A;  1P3K B;  3VH6 A;  2H28 A;  4EBP A;  2CV5 A;  4QLC A;  3REH C;  3KUY C;  1YSP A;  3LEL D;  5CPI A;  1HQ3 C;  3L2A A;  4IBI A;  3LZ0 C;  3NOT C;  2CMN A;  5CTN A;  5HX9 A;  5AVC D;  4E3K A;  1F1E A;  2LB9 A;  1P3I C;  5CP6 C;  3BFC A;  1P34 C;  4QPR A;  4WU8 A;  3AFA B;  1N1J B;  2Y2H A;  3WTP D;  3REK A;  3C1B D;  3PBT A;  4Z9Q A;  3D9Y A;  5AQB A;  5KSH A;  3WA9 C;  1H3Q A;  4YM6 D;  3SS5 A;  5B1M C;  3WD1 A;  5E5A A;  3C7U A;  4GD6 A;  1F66 C;  5CGW A;  3KSY A;  3MGR D;  3MS6 A;  4KGC B;  4HIA A;  1P3O D;  2ZL1 A;  2HDR A;  4PMA A;  3IQA A;  3B6F A;  3AZJ D;  2I72 A;  3W96 D;  1ONG A;  1EI5 A;  5GT0 B;  3WD3 A;  1TZY D;  5J3W A;  5IU1 A;  4E45 A;  3GVB A;  3UTA A;  4U0X A;  4FD8 A;  4DDS A;  3AZM A;  1AOI A;  1KE3 A;  5K5B A;  5BOH A;  5KZH A;  3KSI A;  4KQR A;  5CEB A;  4ARZ A;  1LL8 A;  3AZH B;  5EUA A;  3MQL A;  4ZBJ C;  4J8W C;  4OP5 A;  1KVL A;  3AYW A;  3AZN D;  1H0G A;  4R70 A;  1I2W A;  4TX8 A;  1YU0 A;  3MGS A;  3FC7 A;  4H9O B;  4QJG A;  1P3M C;  4K0X A;  2L0W A;  4HQA A;  1ULY A;  4LRX C;  4BD0 A;  1Z09 A;  3QP2 A;  4UPK A;  4Z2J A;  2ZQC A;  2V2F F;  3C1C B;  3WAA C;  3CPT B;  2FJ7 A;  3BFG A;  3KFU G;  1W5D A;  3GEC A;  5FL3 A;  3WTP E;  1ERO A;  4HES A;  1S32 A;  1W63 Q;  2EFU A;  1Y4O A;  3GSG A;  2A24 B;  1ED7 A;  3BLS A;  4JF4 A;  2QKP A;  1LHY A;  1PI5 A;  2G5I C;  1K55 A;  2XLN A;  1P3F B;  1M1A A;  2Y2Q A;  1VQQ A;  2PYO A;  3GDI A;  5TBM B;  1YLP A;  3T4L A;  4IJF A;  4G91 C;  1DJA A;  2KX6 A;  1ZLA D;  3TSG A;  1P3L A;  4ZRR A;  3LFV A;  3A6N A;  1IEL A;  1CF0 A;  3EG5 B;  3X1T D;  2D01 A;  2XD5 A;  4L0L A;  4XUJ D;  2DMW A;  2OV5 A;  3REH B;  3KUY B;  5E2E A;  2YKF A;  1XA7 A;  3CZD A;  1TS7 A;  1KX5 A;  1EQZ C;  2NQB D;  4LRZ E;  1P3I B;  1BLP A;  1BFM A;  4HBU A;  5CP6 B;  4ETX A;  3EWK A;  2VEA A;  1DP9 A;  1MWT A;  1M6K A;  4J8U C;  2G2W A;  4S2I A;  5FI7 A;  3V3R A;  1NLY A;  3TOI A;  1KX3 D;  1L2S A;  3PBR A;  4IVI A;  5A8B A;  1M18 D;  3H7W B;  4UUZ A;  1F66 B;  1S66 L;  4MEZ A;  5B0Y A;  5HAP A;  3UE1 A;  4BBU A;  3W98 D;  4R23 A;  1P3K D;  5L09 A;  4Z2M G;  1F9I A;  2IA2 A;  4Z2I A;  5TGF A;  2HIO A;  3KO6 A;  3W97 A;  5JRG A;  3T4Q A;  3MKE A;  3B0D C;  4DRA A;  2VGL S;  1H3O B;  5AV9 C;  3C5A A;  3VOZ A;  2EXB A;  4UA6 A;  3AFA D;  1BH9 A;  3BFD A;  3TU4 D;  4WUJ A;  1E3U D;  3AZI A;  2Y2L A;  4ZBJ B;  1CEG A;  3IH8 A;  2WGV A;  3S1Y A;  1CK7 A;  1EWZ A;  5C3I C;  2EFX A;  4EEP A;  4H9P B;  4EES A;  3N8S A;  4KGC D;  2L5A A;  1U60 A;  4DJ2 A;  1VET B;  3X1V B;  3V3S A;  1S4S A;  5A90 A;  5GT0 D;  3MNN C;  1YM1 A;  3ZVT A;  3AV2 A;  3D4F A;  5DF8 A;  3V50 A;  4GDN A;  4IBG A;  2O99 A;  1W8Y A;  3MBZ A;  4MN6 A;  4H9N A;  1NLZ A;  2ARO C;  2V20 A;  2ZQA A;  1K54 A;  4E3O A;  2RVQ D;  5EOO A;  4GKU A;  5I94 A;  5HD5 A;  1CQA A;  1MXO A;  4DE1 A;  4JF5 A;  3AZF A;  3OPH A;  4E04 A;  3AZH D;  3X1U C;  4G91 B;  2PT7 A;  1D7E A;  1ES2 A;  2FFF B;  1LSW A;  3IF5 A;  3TRC A;  3KWQ C;  5B2I B;  3NC8 A;  4E3N A;  4Z2G A;  3GQZ A;  2ZQ9 A;  3EGD C;  2IOU A;  5B33 C;  1P3A C;  3ZG8 B;  5FEF A;  5BS7 A;  2VGK A;  4JGR A;  5L2F A;  4KZ8 A;  3LZ1 C;  4Y0U A;  1LSV A;  4WZ5 A;  1F5M A;  3C1C D;  1E4D A;  3A3J A;  2Y2J A;  4J8U B;  4HI4 A;  4H9S C;  3BQ8 A;  2W3H A;  2J9O A;  5GLC A;  1N9O A;  5GHZ A; 
#chains in the Genus database with same CATH homology
 1K4E A;  4E6W A;  5E43 A;  1P3F D;  3Q7Z A;  3V9R A;  5EEC A;  3IXG A;  2F8N K;  4PM8 A;  3MVD C;  1J9M A;  3O62 D;  3UTB A;  3REH D;  3KUY D;  3AL0 C;  5DVA A;  2F8N B;  2Y2G A;  3AV1 C;  4MNR A;  3OCN A;  1P3I D;  3L25 A;  4XUX A;  5CP6 D;  3B0D B;  3PAE A;  5AV9 B;  1L0F A;  3R45 A;  4E3I A;  3IHA A;  3FKW A;  1MPL A;  1JVJ A;  4CAY B;  4KHA A;  5FQ9 A;  4D2O A;  5C3I B;  1Q9C A;  4MBH A;  1F66 D;  4IBE A;  2P74 A;  2HPB A;  3UE3 A;  4PM6 A;  4NE5 A;  4WU9 B;  3MNN B;  1FSY A;  3OPR A;  1XX2 A;  1MBL A;  5FI6 A;  3REL A;  3FKV A;  4JBF A;  3VFH A;  3MGP C;  5F99 B;  3WS4 A;  2ZQ7 A;  2IO5 B;  3X1U B;  3AGD A;  3HLC A;  4Z66 A;  3SH7 A;  5AV5 C;  3MXR A;  5FDH A;  5DNN A;  1CK3 A;  2F8N H;  5F1F A;  1K6R A;  5B33 B;  1P3A B;  4XZQ A;  5B0Z C;  1XGI A;  3LZ1 B;  1BH8 B;  3X1V D;  3BRM A;  3BLM A;  1CEF A;  2ZD8 A;  5GXQ B;  1K4F A;  5B31 C;  1KDW A;  2UWX A;  3SOI A;  5B40 C;  3ZG0 A;  2ZC6 B;  3WKJ A;  3OCL A;  2Y2N A;  5EOE A;  4DDY A;  3IWI A;  3MVD B;  2XDM A;  5B2I D;  5KSC A;  5FI2 A;  3W4P A;  1TAF A;  4EBN A;  3NDE A;  2WGW B;  3AV1 B;  4GN2 A;  3EPL A;  3DWZ A;  5GLD A;  5B32 G;  4X23 C;  5TFQ A;  3HLW A;  3OPL A;  2DCF A;  3LEL A;  4J8U D;  3LJA B;  4EQI A;  4ID4 A;  2WUQ A;  5AVC A;  1O07 A;  1MWS A;  3HBR A;  3I7J A;  1KDS A;  2LY8 A;  3AN2 C;  5FA7 A;  4OVD A;  3WTP A;  3C1B A;  3KXB B;  2HUE C;  3EPH A;  3VH5 T;  4YM6 A;  3B6G C;  4KQO A;  4KZA A;  3DWK A;  3MGR A;  2BLS A;  3VMA A;  2F8N D;  1P3O A;  4P85 A;  3AZJ A;  4OJP A;  5CGX A;  3H0L C;  3W96 A;  4UA9 A;  4ZJ1 A;  1TZY A;  5AV9 D;  3BM6 A;  1GA0 A;  5HAI A;  3UPN A;  5U47 A;  5B24 C;  5AV5 B;  1ZG4 A;  3AZG B;  4S2N A;  2WKI A;  3ZDJ A;  3UDX A;  3A3D A;  5BNV A;  1Q2P A;  4OQG A;  3CJM A;  2XK1 A;  5EVI C;  1U35 C;  5B0Z B;  4E3M A;  1DJB A;  1GCE A;  2Q9N A;  2Y91 A;  5F82 A;  4WU9 D;  3MNN D;  3AZN A;  1WE4 A;  5B2J C;  4FH2 A;  1BLC A;  4OH0 A;  5B31 B;  1KGF A;  3MZE A;  2WKH A;  4DKI A;  5F99 D;  3SH9 A;  1JFI A;  5G49 B;  3X1U D;  3NY4 A;  4WEJ A;  3KS8 A;  3LY3 A;  4IBB A;  1YU3 A;  3IP4 C;  3HUO A;  1PI4 A;  3Q81 A;  4X68 A;  5B33 D;  5BO0 A;  1ZLA A;  3LZ1 D;  3G31 A;  5CGS A;  3X1T A;  2ZY5 A;  4XUJ A;  3IF6 C;  5GXQ D;  4H9R B;  4S2K A;  1YU2 A;  3W8K A;  2JCH A;  4DRT A;  2NQB A;  4CJN A;  1MY8 A;  3AN2 B;  3MXS A;  1ES5 A;  4N92 A;  1KX3 A;  3VH6 T;  2HUE B;  1M18 A;  3B0B A;  3MVD D;  3B6G B;  4X53 A;  4N9L A;  3NBL A;  2WZZ A;  4H9Q A;  1NZO A;  3AV1 D;  4EBL A;  3L29 A;  3W98 A;  5M19 A;  2WKE A;  1SCW A;  1P3K A;  5HFO A;  4QLC C;  3G34 A;  3LO7 A;  1BLH A;  3S4X A;  2ZM5 A;  3LJA D;  4KZ4 A;  4NE3 A;  2Z2M B;  5B24 B;  4EWF A;  3EQU A;  3MKF A;  3EQV A;  3UDF A;  1PZR A;  1YUE A;  4WU8 C;  2XFS A;  3REK C;  1B67 A;  3AFA A;  1N1J A;  3TU4 A;  3KXB D;  1E3U A;  4OKP A;  3RJU A;  3DW0 A;  2HDS A;  5B2J B;  4B4X A;  4KGC A;  5E2G A;  5B1L C;  5GT0 A;  1BUL A;  3HLD A;  1RGY A;  2OLV A;  1KU5 A;  3ITB A;  2C5W B;  3AZM C;  5AV5 D;  2Y2O A;  3MGQ B;  1AOI C;  5GLB A;  3AZG D;  3WRZ A;  4JKT A;  3REJ C;  4JJN C;  4J8V D;  4RA7 A;  3AZH A;  4OLD A;  5B0Z D;  3GV9 A;  3QNC A;  4KZB A;  3MGS C;  3IF6 B;  5DTT A;  4N1X A;  1T3U A;  1LI0 A;  4H9O A;  4YS3 C;  4B4Z A;  2WAD A;  5B31 D;  1Z2C B;  3CG5 A;  1S6R A;  1I5Q A;  4BL2 A;  3C1C A;  1P3B C;  4DRB A;  4NZ5 A;  4G92 C;  2J9P A;  1K55 C;  4PM9 A;  2OLU A;  3N8R A;  1P3F A;  1YQS A;  5CRF A;  4P6B A;  3W4Q A;  4R3J A;  3O62 A;  4KZ6 A;  5KMW A;  5CPJ C;  3REH A;  3KUY A;  1P3P D;  1XKZ A;  3AZL B;  4HBT A;  4GDB A;  2XEP A;  4OQH A;  4JXS A;  5M18 A;  1P3I A;  5CP6 A;  3AN2 D;  2IWB A;  1G68 A;  4A5R A;  3CMZ A;  4R4R A;  4FCF A;  1S0W A;  3H0M C;  1RP5 A;  3B6G D;  4S2P A;  1IKG A;  1F66 A;  5B0Y C;  2J7V A;  4BLM A;  4IBC A;  3GRJ A;  3W99 C;  5B1L B;  2EX9 A;  5FSR A;  3NQU B;  4QD4 A;  2CC1 A;  1YLT A;  5HW3 A;  2B5R A;  4JXW A;  3W97 C;  1E25 A;  1HQ3 B;  5B24 D;  5FUG B;  3LZ0 B;  3REJ B;  4JJN B;  3ZG5 A;  4NY2 A;  5FQI A;  1P34 B;  3AZI C;  2XGN A;  1W2E A;  3WA9 B;  4WEL A;  3BEC A;  5B1M B;  5DNM C;  1M19 C;  4H9P A;  4K91 A;  4YS3 B;  3HLB A;  3P98 A;  1GHM A;  3WWX A;  1N4O A;  3X1V A;  3AV2 C;  2NZD C;  1P3B B;  3AZK C;  5FAO A;  1NJ4 A;  3MGQ D;  4QHC A;  4G92 B;  1FR6 A;  2JBF A;  4N9K A;  4Z5T C;  3PBQ A;  2WAE A;  2P9V A;  4X56 A;  4JLF A;  3HL9 A;  1B6W A;  3UT9 C;  4KEN B;  4HGA C;  2X02 A;  4J8W B;  2CWE A;  5B2I A;  5E2F A;  3HVF A;  5CPJ B;  2IWD A;  1BTL A;  4EV4 A;  5GT3 C;  2YFW B;  1Y54 A;  1P3M B;  2BYM B;  4O7D A;  4BEN A;  4MBF A;  4NZ3 A;  1AXB A;  3UDI A;  4DXC A;  2ZM8 A;  3AGF A;  3WAA B;  4J8U A;  2WZX A;  2XD1 A;  1R4V A;  3UPP A;  3ZG7 B;  5A93 A;  4OUI A;  1K57 A;  4R0Q A;  1YMX A;  4RVA A;  4IED A;  3HSH A;  2IWC A;  3W99 B;  3UE0 A;  2PU4 A;  4CPK A;  4Q8I A;  4CSR B;  4M6B A;  4IJE A;  3UTB C;  2ZY4 A;  4QY6 A;  5G18 A;  2DRW A;  3W97 B;  1WYB A;  3AZL D;  2F8N A;  1EQZ B;  3B0C T;  4ZBE A;  1KE4 A;  5AV9 A;  4LV0 A;  3OZH A;  1PZO A;  1NYM A;  4CAY A;  2RCX A;  2Y2P A;  2X71 A;  3IXB A;  3IXD A;  1P3G C;  3PBO A;  5DNM B;  4OQI A;  1M19 B;  5HAR A;  4OP8 A;  1I2S A;  5B1L D;  1XPB A;  4BD1 A;  4WU9 A;  3MNN A;  3AV2 B;  4WEK A;  3E2K A;  2NZD B;  5A91 A;  2HDQ A;  3O88 A;  5AV6 C;  3AZK B;  1HD8 A;  4RX3 A;  1HQ3 D;  3LZ0 D;  3EPK A;  3REL C;  1LI9 A;  3REJ D;  4JJN D;  3L26 A;  1OME A;  5F99 A;  1P34 D;  4Z5T B;  1YLZ A;  5F1G A;  3X1U A;  4Z66 C;  1KX4 C;  4HEF A;  3UT9 B;  1YLJ A;  4HGA B;  3WA9 D;  5CHU A;  1FSW A;  5B1M D;  4KUD C;  5B33 A;  1MWU A;  5GT3 B;  4P87 A;  4YS3 D;  4ZUX C;  4XZQ C;  4DE2 A;  4KG5 A;  3A1K A;  4KG2 A;  3LZ1 A;  1BH8 A;  3BFE A;  2VGJ A;  4KQQ A;  2X01 A;  1P3B D;  5GXQ A;  3FDD A;  3FZC A;  4H9S A;  5EPH A;  3REI C;  2ARO B;  3VP4 A;  4LEN A;  4KZ9 A;  3AZE C;  4C75 A;  4J8W D;  1NRF A;  3MVD A;  3KWQ B;  3PAG A;  4Z2M H;  5CPJ D;  1ES3 A;  5CPK C;  5BNX B;  2WGW A;  3AV1 A;  1P3M D;  1SKF A;  5CHL B;  3VOY A;  3N6I A;  3LEL C;  5GSU C;  2DNS A;  3WAA D;  3LJA A;  1XA1 A;  3RXW A;  2ZC3 B;  1O7E A;  1HVB A;  4X6T A;  4JPM A;  1P3G B;  3P09 A;  3C1B C;  3KXB A;  1G6A A;  4KZ7 A;  3W99 D;  1MKI A;  1KE0 A;  5AV8 C;  1YU1 A;  1ESI A;  3GR2 A;  4PPR A;  4R8P C;  5AV6 B;  3MGR C;  1BUE A;  3A3F A;  3AZJ C;  3W96 C;  1EQZ D;  4NYY A;  2Y2M A;  5CER A;  1TZY C;  3L27 A;  3SS4 A;  3HUN A;  5B32 C;  3A3I A;  4OPQ A;  2WK0 A;  4Z66 B;  1KX4 B;  5AV5 A;  1NZU A;  4E6X A;  5KDM B;  3AZG A;  2BYK B;  4J8V A;  4KUD B;  5DNM D;  1M19 D;  4LV2 A;  4IBK A;  5DF7 A;  4ZUX B;  3X1S C;  5B0Z A;  2ZM0 A;  1CI8 A;  1IYQ A;  4B88 A;  2NZD D;  4N1H A;  3AZK D;  1Q2Q A;  3ZNY A;  5B31 A;  1YLW A;  3C4O A;  4WNN B;  3REI B;  4QB8 A;  3HLF A;  4NE6 A;  3MGP B;  1ID3 C;  4Z5T D;  5JA4 B;  5G49 A;  3VP0 A;  3M6H A;  3UT9 D;  3AZE B;  1RGZ A;  1GHP A;  3M2J A;  4QU3 A;  3LEZ A;  3SH8 A;  5GT3 D;  5CPK B;  2Y2K A;  1L0G A;  1A7W A;  3VP1 A;  3X1T C;  4NET A;  1KVM A;  1P3P A;  4H9R A;  5GSU B;  4LD9 C;  2PBY A;  2PU2 A;  2H10 A;  3WRT A;  5GHY A;  3M6B A;  4K0W A;  2ARO D;  3GMW A;  3WS5 A;  3AN2 A;  4OOM A;  5B40 B;  4OPR A;  3P5J B;  3GTC A;  1L0D A;  5BPV A;  3MZD A;  1KX3 C;  3NQJ A;  5AV8 B;  1FCN A;  3KWQ D;  3G2Y A;  5AY8 C;  3B6G A;  4EUZ A;  1ESU A;  4R8P B;  1P3A D;  3FWL A;  3N3F A;  5AVB C;  3F6T A;  3W98 C;  1MWR A;  1JTG A;  2ZC5 B;  3FV7 A;  3NI9 A;  4S2M A;  5GHX A;  4X23 B;  5B32 B;  1IEM A;  2R9X A;  3NIA A;  5B24 A;  3UPO A;  3TG9 A;  3MFD A;  1VM1 A;  4OJ6 A;  4J8X C;  1P3G D;  2OSU A;  3UN7 A;  3TU4 C;  2HP9 A;  3VP3 A;  3PBS A;  1FCM A;  3X1S B;  1DJC A;  1WWS A;  1FR1 A;  3HLG A;  5M1A A;  2R9W A;  4GH9 A;  3A3E A;  5CHM A;  2HDU A;  5AV6 D;  3G4P A;  4Y7P A;  5GT0 C;  1SDN A;  1ID3 B;  2CV5 C;  1N9B A;  4KZ3 A;  1TDL A;  5CPI C;  4NZ1 A;  1KX4 D;  2Z2L B;  3MGQ A;  2EX8 A;  3O3V A;  4KUD D;  1FOF A;  4WZ4 A;  4ZUX D;  3A1I A;  2G5H C;  5EVI B;  1U35 B;  4JXG A;  1QMF A;  1W79 A;  2QPN A;  3ZGA B;  3Q07 A;  5E5A C;  3IF6 A;  4LD9 B;  1ZKJ A;  4R1G A;  4WM9 A;  4C3Q A;  2ZMA A;  3B6F C;  3REI D;  4DF6 A;  3MGP D;  4U3T A;  5GL9 A;  1LL5 A;  5AQ9 A;  3UTA C;  2HP5 A;  3AZE D;  1PYY A;  3O87 A;  5AY8 B;  4QY5 A;  1JWZ A;  5CPK D;  2DF4 C;  4IBJ A;  5AVB B;  3W98 B;  4KZ5 A;  3O62 C;  4XXR A;  3AYW C;  4GB7 A;  3FYZ A;  5EVL A;  5JYP A;  5GSU D;  3AZL A;  5E2H A;  3HUM A;  3G35 A;  2WAF A;  4J8X B;  4GHA A;  4RX2 A;  5B40 D;  3M2K A;  1PW1 A;  4WYY A;  2W8S A;  2FJ7 C;  3VFF A;  3TU4 B;  4NZ4 A;  3Q7V B;  1BSG A;  1S32 C;  3NCK A;  5AV8 D;  3VH5 W;  3JYI A;  4WMC D;  2YFV B;  1M1A C;  4R8P D;  2PYO C;  3H0R C;  4OJL A;  3QHY A;  5J8X A;  3PTE A;  5B1L A;  5BT1 C;  1P3L C;  3VP2 A;  1FQG A;  3NQU A;  1Z6F A;  5HAQ A;  3A6N C;  1YLY A;  5FAT A;  4X23 D;  2ZY3 A;  2CV5 B;  4QLC B;  5B32 D;  3LY4 A;  5CPI B;  1YT4 A;  1HQ3 A;  5FUG A;  3LZ0 A;  1KX5 C;  3REJ A;  4QNL A;  4JJN A;  4MBK A;  1PIO A;  1P34 A;  3IXH A;  4WU8 B;  3REK B;  4S2J A;  3X1S D;  1IYS A;  2J8P A;  3WA9 A;  4IVK A;  2FFY A;  1K56 D;  5B1M A;  5E5A B;  3S22 A;  4C6Y A;  2RL3 A;  4YS3 A;  5DTK A;  3B6F B;  3X1V C;  1ID3 D;  1H5X A;  1P3B A;  2C6W B;  2HIO C;  3UTA B;  5FQM A;  1LLB A;  2VQR A;  5JRG C;  3AZM B;  1LL9 A;  1AOI B;  4OOY A;  1IKI A;  3C4P A;  1H3O A;  3O86 A;  5FAS A;  5EVI D;  1U35 D;  4J8W A;  4UHU A;  5B2I C;  3O62 B;  2EX6 A;  3AYW B;  5CPJ A;  3FKE A;  3MGS B;  4LD9 D;  2YFW A;  5B2J D;  4YIN A;  5AQA A;  1P3M A;  5FQJ A;  2BYM A;  1ES4 A;  2XQZ A;  1TVF A;  3Q1F A;  2FJ7 B;  3WAA A;  1NYY A;  1S32 B;  1BT5 A;  2XF3 A;  5AQ7 A;  1K54 C;  1K57 C;  3VH6 W;  4OLG A;  3AGE A;  4PM5 A;  5AY8 D;  3AZF C;  2ZLY A;  1M1A B;  2PYO B;  3C7V A;  1SHV A;  2Y2I A;  5AVB D;  1P3L B;  3W99 A;  4WBG A;  4X55 A;  4CSR A;  3A6N B;  2JC7 A;  2ZM2 A;  3NDG A;  2F8N G;  1YU4 A;  3G2Z A;  4UAA A;  5BS7 C;  3BYD A;  1KX5 B;  4IBF A;  1EQZ A;  4J8X D;  4WZ5 C;  2GDN A;  3IWQ A;  4EO5 C;  3HRE A;  4LV3 A;  1W7F A;  5FQK A;  5DNM A;  1IYO A;  1M19 A;  4UUZ B;  1WYC A;  5D3O A;  5DTS A;  4BQM A;  5B0Y B;  2DQN C;  1YMS A;  4S2L A;  4WU9 C;  4M3K A;  1HTZ A;  2F2A C;  5CXW A;  2NZD A;  2CV5 D;  4QLC D;  3WS1 A;  3AZK A;  5CPI D;  1TDG A;  2HIO B;  4BL3 A;  4E3J A;  5JRG B;  5F99 C;  4X69 A;  1DY6 A;  2IO5 C;  4Z5T A;  2P9V B;  4WU8 D;  1BH9 B;  3REK D;  4RYE A;  3AZI B;  1H8Y A;  3UT9 A;  1ZC2 A;  3BFF A;  3G30 A;  5F83 A;  4LV1 A;  3WS0 A;  5E5A D;  3Q82 A;  5GT3 A;  4XUZ A;  3UNW A;  4Y0T A;  3B6F D;  4GHL A;  1JWV A;  2ZQ8 A;  5GXQ C;  2ZC7 A;  1WWI A;  1HZO A;  4LCM A;  3V39 A;  1BZA A;  3UTA D;  4H9N B;  3AZM D;  1ONH A;  3N4I A;  1AOI D;  5A92 A;  2ARO A;  3HLE A;  4FSF A;  4Y0O A;  1M40 A;  4P0M A;  4R4S A;  3AZF B;  3EPJ A;  3QNB A;  4ZDX A;  2RIQ A;  3MZF A;  5DNN C;  3KWQ A;  3AYW D;  1K38 A;  3ZVW A;  3MGS D;  4H8R A;  4IBR A;  1P3A A;  5BNX A;  2FJ7 D;  3LJA C;  2JSS A;  4EO5 B;  4E44 A;  1S32 D;  2ZY2 A;  1JTD A;  4WV4 B;  4OPZ A;  1K25 A;  1P3G A;  4DXB A;  3V9R B;  1M1A D;  2PYO D;  3KXB C;  3WKJ C;  3N8L A;  1RCJ A;  5BT1 D;  1P3L D;  3KS4 A;  2BG1 A;  3A6N D;  2XR0 A;  3E2L A;  3UTB B;  5CTM A;  4NYU A;  5AV6 A;  4OJO A;  1NXY A;  1KX5 D;  3WX7 A;  3W4O A;  3R45 B;  1BLS A;  1KX4 A;  3AZG C;  5AVC C;  2Y55 A;  5KDM A;  4KHA B;  3ZCZ A;  4J8V C;  2BYK A;  1GHI A;  2XH9 A;  4KUD A;  2HP6 A;  3WTP C;  4ZUX A;  4NK3 A;  5B0Y D;  1GA9 A;  1KGG A;  4JF6 A;  3ITA A;  4IBD A;  2V1Z A;  2ZC4 B;  4YM6 C;  2H0T A;  5B31 G;  2WGI A;  2HIO D;  4YFM A;  1P3O C;  3W97 D;  2ZJ9 A;  4WNN A;  5JRG D;  3REI A;  1PWC A;  3REL B;  3MGP A;  5JA4 A;  3V5M A;  4E3L A;  3LCE A;  4AWL C;  3AZI D;  3AZE A;  1ERQ A;  3DTM A;  4S2N C;  5DNN B;  4GOG A;  1XGJ A;  4ZJ2 A;  3ZFZ A;  3N7W A;  2WYX A;  2H5S A;  4F94 A;  5CPK A;  4NFT A;  4XZQ B;  4MLL A;  3AZN C;  3AV2 D;  2ZQD A;  1P3P C;  1L0E A;  4IBX A;  4OPY A;  5GSU A;  1TEM A;  4ZAM A;  3VSL A;  5GLA A;  4BJP A;  5B40 A;  3AZF D;  4GZB A;  3WKJ B;  5JYO A;  4WZS B;  3L28 A;  5AV8 A;  4KG6 A;  3HON A;  3UY6 A;  3IWO A;  4WMC A;  1TAF B;  4R8P A;  1ZG6 A;  1ZLA C;  3VSK A;  5TR7 A;  1H8Z A;  4FH4 A;  3B0C W;  3G32 A;  4XUJ C;  4X23 A;  4JXV A;  5B32 A;  3LEL B;  1SDE A;  2Y4A A;  5FQQ A;  1IYP A;  1XP4 A;  3BEB A;  5AVC B;  4OOL A;  4J8V B;  2NQB C;  2JE5 A;  4DQY B;  2A3U A;  3WTP B;  3C1B B;  3X1S A;  1XXM A;  4LG2 A;  2XFT A;  1M18 C;  4YM6 B;  4ZTK A;  4U0T A;  5IHV A;  1K56 A;  3UTB D;  1FCO A;  3MGR B;  1C3B A;  1P3O B;  5FAP A;  1PW8 A;  3AZJ B;  1PZP A;  1NY0 A;  3W96 B;  1PWD A;  1P3K C;  4DE3 A;  3VH5 A;  1TZY B;  1ID3 A;  4OQ0 A;  5CHJ A;  3ZNT A;  1QME A;  4LCL A;  4AWL B;  5CEC A;  3MGQ C;  3ISG A;  4ZJ3 A;  2QMI A;  3IH9 A;  5BNV B;  3ZHH A;  3AFA C;  2Q9M A;  5EVI A;  1U35 A;  3PBN A;  5HL1 A;  1JWP A;  3AZN B;  2QZ6 A;  3IT9 A;  3WS2 A;  1P3P B;  1CI9 A;  4GNU A;  2J8Y A;  4LD9 A;  4UA7 A;  5B2J A;  4KGC C;  3REL D;  1W8Q A;  1JFI B;  3UO9 A;  5CED A;  3OPP A;  3NQJ B;  4Z66 D;  4PM7 A;  2Y59 A;  2RVQ C;  5DNN D;  5AY8 A;  2G2U A;  5DF9 A;  5BO0 B;  3AZH C;  3B3X A;  1ALQ A;  2E8I A;  1ZLA B;  4XZQ D;  5AVB A;  2EX2 A;  5FAQ A;  3X1T B;  4R3B A;  4S2O A;  4XUJ B;  1KGE A;  4GD8 A;  4WJ3 C;  3AZL C;  1K6S A;  4DE0 A;  3ZG9 B;  2NQB B;  4J8X A;  3SS3 A;  3OC2 A;  2H0Y A;  3C1C C;  1PWG A;  1ERM A;  3WKJ D;  2A49 A;  3Q7V A;  1KX3 B;  4OON A;  1HTA A;  1M18 B;  5EE8 A;  3RXX A;  1P3F C;  2YFV A;  2EXA A;  4H9Q B;  4OJ5 A;  1P3K B;  3VH6 A;  4EBP A;  2CV5 A;  4QLC A;  3REH C;  3KUY C;  3LEL D;  5CPI A;  1HQ3 C;  3L2A A;  4IBI A;  3LZ0 C;  5CTN A;  5HX9 A;  5AVC D;  4E3K A;  1F1E A;  1P3I C;  5CP6 C;  3BFC A;  1P34 C;  4WU8 A;  3AFA B;  1N1J B;  2Y2H A;  3WTP D;  3REK A;  3C1B D;  3PBT A;  4Z9Q A;  5AQB A;  5KSH A;  3WA9 C;  4YM6 D;  3SS5 A;  5B1M C;  5E5A A;  3C7U A;  4GD6 A;  1F66 C;  5CGW A;  3KSY A;  3MGR D;  4KGC B;  1P3O D;  2HDR A;  4PMA A;  3IQA A;  3B6F A;  3AZJ D;  2I72 A;  3W96 D;  1ONG A;  1EI5 A;  5GT0 B;  1TZY D;  4E45 A;  3GVB A;  3UTA A;  4U0X A;  4FD8 A;  4DDS A;  3AZM A;  1AOI A;  1KE3 A;  5BOH A;  5KZH A;  4KQR A;  5CEB A;  3AZH B;  5EUA A;  4ZBJ C;  4J8W C;  4OP5 A;  1KVL A;  3AYW A;  3AZN D;  1I2W A;  1YU0 A;  3MGS A;  4H9O B;  4QJG A;  1P3M C;  4K0X A;  1ULY A;  4BD0 A;  4UPK A;  2ZQC A;  2V2F F;  3C1C B;  3WAA C;  2FJ7 A;  3BFG A;  3KFU G;  1W5D A;  3WTP E;  1ERO A;  4HES A;  1S32 A;  2EFU A;  3GSG A;  3BLS A;  4JF4 A;  1LHY A;  1PI5 A;  2G5I C;  1K55 A;  2XLN A;  1P3F B;  1M1A A;  2Y2Q A;  1VQQ A;  2PYO A;  1YLP A;  4IJF A;  4G91 C;  1DJA A;  1ZLA D;  3TSG A;  1P3L A;  3A6N A;  1IEL A;  3EG5 B;  3X1T D;  4L0L A;  2XD5 A;  4XUJ D;  2OV5 A;  3REH B;  3KUY B;  5E2E A;  1XA7 A;  3CZD A;  1KX5 A;  1EQZ C;  2NQB D;  1P3I B;  1BLP A;  1BFM A;  4HBU A;  5CP6 B;  1MWT A;  1M6K A;  4J8U C;  2G2W A;  4S2I A;  5FI7 A;  3V3R A;  3TOI A;  1KX3 D;  1L2S A;  3PBR A;  4IVI A;  1M18 D;  4UUZ A;  1F66 B;  4MEZ A;  5B0Y A;  5HAP A;  3UE1 A;  3W98 D;  4R23 A;  1P3K D;  4Z2M G;  5TGF A;  2HIO A;  3W97 A;  5JRG A;  3MKE A;  3B0D C;  4DRA A;  3C5A A;  1H3O B;  5AV9 C;  3VOZ A;  2EXB A;  4UA6 A;  3AFA D;  1BH9 A;  3BFD A;  3TU4 D;  1E3U D;  3AZI A;  2Y2L A;  4ZBJ B;  1CEG A;  3IH8 A;  2WGV A;  3S1Y A;  1EWZ A;  5C3I C;  2EFX A;  4H9P B;  3N8S A;  4KGC D;  2L5A A;  1U60 A;  3X1V B;  3V3S A;  5A90 A;  5GT0 D;  3MNN C;  1YM1 A;  3ZVT A;  3AV2 A;  3D4F A;  5DF8 A;  3V50 A;  4GDN A;  4IBG A;  1W8Y A;  3MBZ A;  4H9N A;  2ARO C;  2V20 A;  2ZQA A;  1K54 A;  4E3O A;  2RVQ D;  5EOO A;  4GKU A;  5I94 A;  1MXO A;  4DE1 A;  4JF5 A;  3AZF A;  3OPH A;  3AZH D;  3X1U C;  4G91 B;  1ES2 A;  3IF5 A;  2FFF B;  3KWQ C;  5B2I B;  3NC8 A;  4E3N A;  3GQZ A;  2ZQ9 A;  2IOU A;  5B33 C;  1P3A C;  3ZG8 B;  5L2F A;  5BS7 A;  2VGK A;  4KZ8 A;  3LZ1 C;  4Y0U A;  4WZ5 A;  3C1C D;  1E4D A;  3A3J A;  2Y2J A;  4J8U B;  4H9S C;  2J9O A;  5GLC A;  3IHB A;  5GHZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...