2Y2IA

Penicillin-binding protein 1b (pbp-1b) in complex with an alkyl boronate (za3)
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
487
structure length
467
Chain Sequence
ISEITYSDGTVIASIDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTGQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Guided Design of Cell Wall Biosynthesis Inhibitors that Overcome Beta-Lactam Resistance in Staphylococcus Aureus (Mrsa).
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
molecule keywords PENICILLIN-BINDING PROTEIN 1B
total genus 159
structure length 467
sequence length 487
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2y2iA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2y2iA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2y2iA02
3CJMA 3IXBA 3PAEA 3WS5A 4QHCA 4ZBEA 2Y2IA 3S1YA 2Y2GA 3P09A 5HAPA 2GDNA 4S2MA 5E2HA 4WZ5C 3C7VA 2ZLYA 3ITBA 1FCOA 3BYDA 4GN2A 1MWUA 1YT4A 2H0TA 1FSYA 3FWLA 1BLPA 3TSGA 1LI9A 1ONHA 4YINA 3P98A 1K6RA 4R0QA 2XFTA 3DWZA 4LV0A 4JPMA 2Y4AA 5TFQA 1K6SA 3GVBA 1MBLA 2IWDA 4Y0UA 4OOYA 4EUZA 1K56D 4GOGA 1ZKJA 4S2LA 3IWIA 4Y0OA 5DTTA 5CEBA 4BL2A 3IF6C 4U0XA 4OLDA 2QZ6A 4GZBA 4EWFA 2I72A 4JLFA 4LCMA 1ERMA 4WELA 4R3BA 2ZQDA 3C4OA 4WEJA 1ERQA 1S0WA 1DJAA 3TOIA 1SKFA 1BTLA 2EX9A 3G35A 3VOZA 4C75A 4E6XA 5CHUA 5CXWA 4PM7A 1JTGA 3M6HA 2P74A 1RGYA 2OV5A 1EI5A 4OH0A 3V3SA 4X6TA 2OLVA 4EBLA 4DDYA 3IXHA 4MEZA 3W4QA 5CHMA 1KVMA 2HP9A 2XD5A 4ZJ1A 3ZG8B 2Y2JA 3Q1FA 4IVKA 5AQBA 3HUMA 4GNUA 2FFYA 4KZBA 5A91A 2WYXA 2PU4A 5FQ9A 4JXVA 4WYYA 2XQZA 3N8SA 5DF8A 1XPBA 4S2JA 1ONGA 5CECA 4HBTA 3W4OA 3OZHA 3W8KA 5FQMA 4E3KA 4EBNA 4IVIA 2WZZA 5EE8A 1PI5A 3VFFA 3SH7A 3MBZA 4OLGA 1BZAA 5FAOA 4GDBA 3ZG7B 2X02A 4ZJ3A 1I2SA 3BECA 1MPLA 3IQAA 2IWCA 5FQQA 4A5RA 4KZ5A 5CGSA 4OOLA 5CERA 1HVBA 1NZOA 1XA1A 4GKUA 4PM6A 4NETA 4WM9A 3VFHA 1EROA 4DE2A 1L2SA 2ZC4B 4EBPA 4EQIA 2ZD8A 4RYEA 1IELA 1K55C 2EFXA 3HLFA 1AXBA 3BLSA 4MBFA 5FATA 1ES3A 1KGFA 1XX2A 5GHZA 2H10A 1U60A 3OCLA 4R1GA 3Q07A 5A93A 3HLEA 1K54A 5U47A 3ZVTA 2XD1A 1RCJA 1DY6A 5DF7A 4M3KA 3VP2A 4DKIA 5FSRA 1FCMA 1JVJA 2ZC7A 5EOEA 3ZCZA 3G2ZA 2XEPA 3UE1A 4E3LA 1E3UD 2DRWA 4KZ8A 4XUZA 2WUQA 2Z2MB 1ESUA 5E2FA 3VMAA 3ZG9B 1YMSA 3UY6A 4XXRA 4XUXA 2HDRA 3ZGAB 2HDSA 1MKIA 5JYPA 3SOIA 3A3DA 1BLHA 4S2KA 1W8QA 3NDGA 5M1AA 1XP4A 1GHIA 5FI2A 5KSCA 1YLYA 4JBFA 1WYBA 1TVFA 4JF5A 3Q82A 1E3UA 3C5AA 3O86A 4R4SA 3S22A 3Q7ZA 4D2OA 1H8YA 2JBFA 4O7DA 3WS2A 1XKZA 1KDWA 2CC1A 3HVFA 4JXSA 4L0LA 2Y2LA 1WE4A 3HLDA 1FOFA 2DCFA 3UE0A 3LY4A 3ZVWA 3NBLA 3SH8A 1K4FA 2G2UA 3AGFA 4WZ4A 5CHJA 3M2KA 5E2EA 3JYIA 3G2YA 1ALQA 4S2IA 5AQAA 3AGDA 5IHVA 3FKWA 2RCXA 3ZG0A 3BLMA 2EXAA 4X53A 3E2LA 1PIOA 1XXMA 1BUEA 1Z6FA 3O87A 2H5SA 5EOOA 4OKPA 1I2WA 1LLBA 4N9KA 5FQIA 1Q2QA 3RXWA 1I5QA 3VSKA 1PI4A 3BM6A 1H5XA 2WKIA 4HESA 1MWSA 3N8LA 1JWPA 3C7UA 4FH4A 2Z2LB 3SS3A 2HP6A 4N1XA 1W5DA 4FH2A 1J9MA 3OPPA 3UE3A 1NRFA 4N9LA 2WZXA 4OP5A 1FQGA 1YLWA 3A3JA 1H8ZA 5TGFA 4QU3A 3C4PA 3MFDA 3PBTA 3PTEA 1K4EA 2E8IA 3MZEA 2R9WA 2ZC3B 4PM9A 1Y54A 1NYMA 3UPPA 4PMAA 5GHXA 4NK3A 1SDNA 5KSHA 4R3JA 2XGNA 1LHYA 2ZC6B 4LV2A 1YMXA 5EVIC 5KZHA 3IXDA 5CEDA 3CZDA 3IH9A 2VGKA 3BEBA 3WWXA 1IKGA 2WKEA 4WMCD 3ZNYA 4B4ZA 2JCHA 2WGVA 4MLLA 1VQQA 2ZJ9A 3UPNA 1IYQA 1CEGA 2J7VA 1PZPA 1Q2PA 2Y55A 4R4RA 3IHBA 4DF6A 5DF9A 4KZ4A 1QMEA 4K0XA 1K38A 3FV7A 4JF4A 2ZQCA 4ZJ2A 3D4FA 4KZ9A 4UA7A 1YM1A 5HAQA 4X55A 1KVLA 2H0YA 3SH9A 4DE1A 5GLDA 5HFOA 2P9VB 4OQGA 4WZ5A 5EECA 3UNWA 1FR1A 3S4XA 1PZOA 3PBOA 4ZDXA 4F94A 5M19A 1IKIA 2WADA 2J8YA 5GLAA 2Y2QA 4S2PA 4S2NA 4KZ3A 4MNRA 1S6RA 4CPKA 4UA9A 1TEMA 4DRTA 3G30A 1NJ4A 4KZ6A 2B5RA 3QNCA 2Y2MA 1CK3A 1K57C 3OPRA 3QNBA 4JXWA 5EPHA 2A3UA 2OSUA 5FI6A 1ZC2A 2RL3A 2ZMAA 3IWQA 1PW1A 5A90A 3IXGA 1HTZA 2XDMA 3CMZA 4IBXA 4OQ0A 3N7WA 4QY6A 3WRTA 3RJUA 4E3MA 4P6BA 2HDUA 3GR2A 2Y2OA 4UAAA 1NY0A 5E43A 4U0TA 5DVAA 3V5MA 1W8YA 3ZG5A 3M2JA 1CEFA 5TR7A 1XGJA 3MKEA 5E2GA 1BULA 5J8XA 4RA7A 3HUNA 3IF6B 4CJNA 5HAIA 1L0GA 3GTCA 3IF5A 4FCFA 4QB8A 4C6YA 4Q8IA 4RX2A 3O3VA 1CI9A 1ZG6A 3FYZA 5FQJA 3LY3A 3PBRA 4U3TA 4PM5A 5HW3A 3NCKA 5CTMA 1O7EA 3G4PA 5FAQA 5I94A 3MZDA 4ZTKA 5F1GA 1JTDA 1NYYA 1NXYA 5G18A 1W79A 2Y59A 4KG5A 4OPZA 5EVLA 2ZQ7A 5GL9A 3A3IA 3WS0A 3HLCA 2XK1A 3MXRA 5CGXA 1ES5A 3BFFA 3OPHA 4E3OA 3PBNA 4KG2A 1K25A 3FZCA 2VGJA 1M40A 3A3EA 5FQKA 4BD1A 2Y91A 2HP5A 3NDEA 3VP4A 2XH9A 4DXCA 4LV3A 4WBGA 1VM1A 3IF6A 3LCEA 3VSLA 3Q81A 1LL5A 4HEFA 2PBYA 3BFCA 4E3JA 3LO7A 4DE0A 3ZDJA 4WEKA 3NY4A 3HLGA 3IHAA 3N8RA 4PM8A 3DTMA 1MXOA 1N9BA 3IWOA 1IYOA 5DTSA 2J9PA 4X68A 1G6AA 3IH8A 3A3FA 3O88A 3GMWA 1BLCA 2WK0A 4OQIA 4DE3A 1XA7A 2R9XA 5CGWA 3VP1A 5A92A 3UDXA 1RP5A 5FAPA 3MZFA 3FKVA 2HPBA 2V1ZA 2X01A 4C3QA 1MY8A 4OQHA 1E25A 5F1FA 5KMWA 1YLPA 3EQVA 2V20A 2Y2HA 3G32A 3GSGA 3Q7VA 1CI8A 4YFMA 5EVIA 1EWZA 1GCEA 2Q9NA 5FI7A 4DXBA 4Y0TA 2PU2A 4JXGA 1GHPA 3GRJA 3BFGA 1GA9A 3NC8A 4BQMA 4QD4A 1YLTA 5JYOA 2Y2KA 2DNSA 3GV9A 3UO9A 4LV1A 1JWVA 2QPNA 3VP0A 4OPQA 2JE5A 1ZG4A 5HL1A 1TDGA 3NI9A 1HD8A 4X69A 5CRFA 1DJCA 3CG5A 4GB7A 3ZHHA 5M18A 4RX3A 1IYSA 2ZQAA 4BLMA 1KE4A 1L0DA 4JF6A 4KQQA 4E6WA 2P9VA 4K91A 1SHVA 3E2KA 2XR0A 4IEDA 4OP8A 4S2NC 1L0FA 1OMEA 1E4DA 3V3RA 3RXXA 3VOYA 5GLBA 1W7FA 4MBKA 1LI0A 2UWXA 1PWDA 2XLNA 5FA7A 3MXSA 1K54C 1PWGA 3QHYA 5HX9A 1PWCA 3UDIA 3SS4A 4E3NA 2WGWB 2QMIA 1PW8A 3LEZA 2XF3A 2ZM2A 4DDSA 1SCWA 3PBQA 1KDSA 1GA0A 2EFUA 2EX6A 3BFEA 4P0MA 3PBSA 3ISGA 4KQRA 2WGWA 1DJBA 4JKTA 2Q9MA 1FSWA 4ID4A 1KGEA 4GD8A 3AGEA 3ITAA 5CTNA 3IT9A 1PYYA 4IBRA 4N92A 1RGZA 2BG1A 3MKFA 4LENA 4BENA 3PAGA 5EVIB 2X71A 3BFDA 2WAFA 2C5WB 3UN7A 5EVID 3WS4A 4P87A 2ZM8A 3B3XA 3ZFZA 2Y2PA 1MWTA 2EXBA 1SDEA 3HREA 5BOHA 4E3IA 4UA6A 1MWRA 3NIAA 2ZC5B 3VP3A 3UPOA 1C3BA 2V2FF 3SS5A 3Q7VB 2BLSA 1L0EA 5FDHA 3HLBA 5L2FA 4KENB 4BJPA 3N4IA 2ZQ8A 4EV4A 2WKHA 4MBHA 5AQ7A 3UDFA 1KE0A 4OONA 3DWKA 1YLJA 5D3OA 1YLZA 1ESIA 5AQ9A 1FR6A 4B4XA 2XFSA 2JC7A 4R23A 3DW0A 4OVDA 1M6KA 4KG6A 4K0WA 4KQOA 1GHMA 4P85A 3OCNA 3GQZA 3N6IA 2WGIA 1ES4A 3HLWA 1IYPA 1KE3A 4BL3A 1K55A 5HARA 5GLCA 3WS1A 4FSFA 1LL9A 4RVAA 4OPYA 3G31A 1JWZA 3HUOA 2OLUA 3W4PA 4ZAMA 1KGGA 1K56A 3I7JA 1N4OA 2C6WB 4H8RA 1G68A 3EQUA 2EX2A 4FD8A 4QY5A 4WMCA 4X56A 2HDQA 1K57A 2ZM0A 4OPRA 1BLSA 1BT5A 4HBUA 1HZOA 3HL9A 3OPLA 1BSGA 4OOMA 3ZNTA 2EX8A 3HBRA 4S2OA 5DTKA 2FFFB 2G2WA 1IEMA 4PPRA 3G34A 4B88A 4GDNA 4LCLA 3TG9A 2Y2NA 4KZAA 5GHYA 2ZQ9A 4KZ7A 2A49A 5EUAA 3WRZA 4QJGA 5FASA 1FCNA 1WYCA 1O07A 2WAEA 4UHUA 5F82A 5F83A 1TDLA 3V50A 4BD0A 2IWBA 4N1HA 1NZUA 3OC2A 3V39A 1ES2A 1QMFA 1XGIA 4Z9QA 1YQSA 3BRMA 2J9OA 3M6BA 4Y7PA 4GD6A
chains in the Genus database with same CATH superfamily
3PAEA 3RELA 1E6NA 2Y2IA 4J8UB 3S1YA 3P7NA 5HZHA 1HQ3B 2JKGA 1H0MA 3KS4A 2ZLYA 4DJ3A 5FL3A 3B6GA 3BYDA 3WTPC 1MKMA 1LI9A 2OAQ1 3LI9A 1F1EA 1G6OA 1K6RA 2J80A 3AZMD 2XFTA 4NY2A 4JPMA 2G7UA 1MBLA 2IWDA 4OOYA 1EW0A 1K56D 5DNMB 4JGRA 1GXDA 3IWIA 4S2LA 1G5UA 3OLOA 4F3LB 4GHIA 5CEBA 2V1AA 4WNNB 2QZ6A 4GZBA 3T4SA 4R3BA 3C4OA 4E6XA 4G91C 3VOZA 2VV7A 2CV5B 2RIQA 2XSSA 1RGYA 2CV5D 2OLVA 3T4QA 4NKPA 4J8UC 5CP6A 1P3OA 5CHMA 1VB6A 1D7EA 3CPTA 4Z5TD 5AQBA 3HUMA 4H9OB 3BQ8A 3A0RA 5AV5C 4JXVA 5B1LD 2XQZA 4ZRRA 1V9YA 5JRGB 5EM0A 1XPBA 1EQZC 4KUKA 4GJ4A 3W4OA 1ED7A 5FQMA 4H6JA 4EBNA 3DBAA 1U35D 4H9RB 5B33B 3AN2B 4OLGA 5FAOA 4GDBA 1YAXA 4ZJ3A 4YNRA 5F99D 3AZJD 3KXBA 3REKC 5CGSA 1CXWA 1L3LA 4I38A 5AY8C 1XA1A 2WKPA 4AFIA 4PM6A 2F8NH 2W1TA 5TBMB 1H0IA 1EROA 3LR5A 4DE2A 2ZC4B 3UTAC 1H0GA 4RYEA 1BH9A 3WAAB 4J8UA 4IBJA 3BLSA 4MBFA 1KGFA 3OBFA 4HQAA 4R1GA 5JRGA 3S7OA 5B24A 3VE4A 4M4XA 4M3KA 4DKIA 5FSRA 3G2ZA 1BFMA 4E3LA 2DRWA 4KZ8A 4J8XC 5CPJD 2J3TD 3MGQA 3ZG9B 3MVDD 3FKEA 1YMSA 5GXQB 3PR6A 3C1CD 3EPKA 3H82B 4HY8A 3SOIA 4NYYA 5M1AA 1GHIA 3H9WA 4ME4A 5B31A 3WAAD 1LSWA 2FJ7B 3C5AA 5DFXA 2V1BA 3UTBD 3JVUA 3HVFA 1KX4B 1XFNA 4PKYA 1YU1A 3UE0A 3UTAB 3A6NC 3UMEA 4Z66C 1K4FA 3AGFA 4WZ4A 5CHJA 5E2EA 3JYIA 4RQ9A 4S2IA 5IHVA 4BBVA 5AVBD 4G3VA 2RCXA 3KYZA 2EXAA 2HIOB 1KX3A 1I2WA 1LLBA 4N9KA 1PZRA 4J8XA 1U35B 2WKQA 4Q0HA 2IO5C 1JWPA 3X1TC 4FH4A 2ZY5A 3X1VD 2HP6A 4MMNA 5GXQC 1IOUA 3OPPA 4Z5TB 3T1RA 2K2NA 4N9LA 4WJ3C 2WZXA 4IBFA 3A3JA 3MFDA 1YUEA 3AV2C 2ZC3B 4Q0JA 3UPPA 4KGCC 2I9VA 1WWIA 2PYOD 2Y79A 3IXDA 5E5AC 3BEBA 4B4ZA 2JCHA 5B2JD 4B9OA 1A7WA 2ZJ9A 3EGDC 1IYQA 1CEGA 2J7VA 2NQBC 4ETZA 3AZGB 3KSFA 5B2ID 1ULYA 3IX3A 5GT0B 4MB5A 4K0XA 4Z2JA 3FV7A 2H0YA 1P3FD 1H8MA 3X1TA 2IO5B 2DQNC 5CPKD 4IBBA 1PZOA 2J8YA 5CX7A 3O62A 4KZ3A 4MNRA 3K3DA 2F8NG 4UA9A 4IBIA 4NEED 3AV2A 3EG5B 3AYWD 3MS6A 1HQ3C 1NJ4A 4KZ6A 2B5RA 3QNCA 2AROA 1CK3A 1K57C 3OPRA 4JXWA 2ZMAA 1PW1A 5AV9B 1P3KD 3H7WB 3WRTA 4E3MA 4MB3A 1M18C 1NY0A 1CEFA 5B0ZD 1BULA 5I5LA 5J8XA 4HJ4A 4CAYA 1Z2CB 5HAIA 1L0GA 4OJLA 3WX7A 4C6YA 3B6FA 3IX8A 4RX2A 3O3VA 3LZ0C 4U3TA 3EPHA 4HJ6A 5CTMA 4Y15A 4Z2GA 1P3BC 1MC0A 3C1BD 1JTDA 1NXYA 5G18A 4LD9D 4OPZA 2ZQ7A 3B33A 4I3IA 2YKHA 3HLCA 2XK1A 3KYQA 2VJWA 2AROC 1UR8A 3BFFA 2FJ7D 3A6NA 1K25A 1H3OB 4BD1A 5HDSA 3MQQA 4LV3A 3LCEA 3Q81A 3UE6A 3ZDJA 3QP1A 4B93A 3MVDB 1JFIB 2PD7A 5C5KA 4J8VB 1P3LA 4X23A 2L4RA 3T1SA 5GXQA 4DRBA 4JJNB 4CSRA 1BLCA 4DE3A 2R9XA 3LZ0D 5FAPA 4LRYC 5KMWA 2X01A 5F1FA 2F8ND 1ZLAA 4EO5C 5HDCA 1BYWA 4YFMA 4DXBA 3NOTC 4Y0TA 3IP4C 2AVXA 2PU2A 5AV6C 5B0ZC 3BFGA 5BS7C 2XA7M 5TBMA 3AFAA 2QWSA 4QD4A 3B47A 1M18D 2RTSA 4LV1A 3VP0A 2QPNA 3A1KA 3NI9A 5CRFA 5B24B 3ZHHA 5M18A 1ZTUA 3REKA 1YU2A 5TJJA 1BH8B 2ZQAA 1S32A 1HQ3D 2F2AC 3AYWC 3NULA 1KE4A 4JF6A 4KQQA 4BENA 4K91A 3KUYD 2JKTM 2XR0A 4S2NC 1OMEA 4Z2HA 1A0KA 5GLBA 5GSUB 4Z2IA 3T1QB 2HGVA 1LI0A 1P3IA 5HPIA 2UWXA 5F5YA 3AZMB 3OOVA 2W1TB 3TE8A 3B0CT 2PDRA 3QHYA 3UDIA 4IBDA 5B2JB 1P3GD 1W1VA 1PW8A 3MGRB 2EFUA 2EX6A 3BFEA 1PFLA 3B0BA 4H6JB 5G4ZA 1OT9A 5GT3A 2Q9MA 4ID4A 5B2IC 4GD8A 4OJPA 4ESPA 3AGEA 2VV6A 2NQBD 5CTNA 1RGZA 2BG1A 2Q0OA 3C8CA 3LIAA 5AVCD 4MN5A 3V9RB 1UWPX 3UN7A 1F66A 4KGCD 3B3XA 4EU0A 2EXBA 1SDEA 4UA6A 3NIAA 3VP3A 3AV2D 1P3OC 3UPOA 3LJAA 4H9PA 5FDHA 3HLBA 3VH5W 1UWNX 2LB9A 3AZLD 2OOLA 5GXQD 5AV5A 3X1VC 4WU9D 5DNNB 3X1TD 1ODVA 3BJNA 1FR6A 2JC7A 4ZBJB 4KQOA 1GSVA 3GDIA 5B40A 1Q9CA 2JKRI 5GT0C 2WGIA 1ES4A 3HLWA 5AVBC 5B2IB 1K55A 1XJ4A 5GLCA 4FSFA 1JWZA 3HUOA 3A6ND 4ZAMA 3I7JA 1N4OA 4WMCA 2FN2A 3EQUA 1E6RA 2HDQA 3AN2A 2HUEB 3NQJA 5CP6B 1BLSA 3F1PA 1HZOA 4QPRA 3UTBC 1EQZB 3T4LA 4WL9A 3WD0A 3WAAC 2FFFB 4PPRA 3LJAC 2QJ7A 5EFWA 4B88A 1LL8A 5GHYA 3WRZA 2ZQ9A 4G92C 1W1TA 1N9NA 2A49A 5F82A 1WYCA 5F83A 3C1CC 4BD0A 3KSHA 3X1VB 3V39A 1M19A 3OC2A 1ES2A 4YM6D 1YQSA 1STZA 1MZUA 4J8XD 4Y7PA 2CMNA 3D72A 1Y4OA 4QHCA 3WS5A 4ZBEA 1J3WA 2EA9A 3NHQA 4HI4A 2Y2GA 1XJ2A 1KX3D 2GDNA 4S2MA 5E2HA 4WZ5C 1KX5C 3HCYA 3FWLA 2UV0E 3KO6A 5B33D 5B0YC 2Y4AA 4M6BA 4WNNA 4EERA 5BT1D 3REKD 1ZKJA 1NRJA 5F99C 4BL2A 1F98A 4IHQA 4J8VC 3BY9A 2I72A 3KWQA 1S0WA 2WKRA 4MB4A 4IBCA 3G35A 4C75A 5CHUA 4PM7A 3S7PA 5B1MA 4H9NA 2P74A 4WU9A 2OV5A 4OH0A 2VA0A 5KIZA 5B1LC 4X6TA 4EBLA 5G49B 5AV5D 4R8PC 3AZLA 3A6NB 4Z5TC 4E04A 1S66L 5B2JA 2XD5A 4ZJ1A 3ZG8B 1M19B 2ZMVA 3CWFA 4IVKA 3UT9D 4GLQA 4GNUA 4J8UD 3C38A 5FQ9A 4H9SC 3AZFB 5DF8A 5HD5A 3WTPB 3K2NA 1ONGA 5CECA 1TS0A 3AZKC 3LR0A 5AVCA 3OZHA 3W8KA 3G6OA 4JGPA 2V9AA 2WZZA 5EE8A 1PI5A 4KUOA 2E8JA 1I2SA 1P3AC 2ZY3A 1MPLA 3MJQA 3IQAA 4BBUA 2IWCA 5F6AA 5DKKA 1HTAA 3A0SA 1HVBA 1NZOA 4NETA 1P9WA 3REHA 5C3IC 4EBPA 4EQIA 3AZMC 1L2SA 4XUJB 1P3LC 1IELA 2EFXA 3HLFA 1X0OA 5IS1A 2O9AA 3WTPD 2H10A 2V5OA 5A93A 3Q07A 1K54A 3AZGC 1IFQA 1RCJA 1DY6A 3VV4A 3LZ1A 2K7SA 4PKYG 4KUDA 5EOEA 2XEPA 1P3PC 2Z2MB 4HP9A 3RELC 2VKSA 3MGRA 4XUXA 2A24B 1CQAA 1YSPA 2HDSA 1CK7A 3EOIA 4CLCD 3AFAD 1BLHA 3IBJA 3E4PA 3MVDA 4JBFA 1WYBA 1TVFA 4JF5A 1P3AB 1E3UA 1H8YA 3WS2A 3LELD 1XKZA 4QWOA 3H0LC 2F8NA 3HLDA 5B24D 1S32C 4WV4B 2DCFA 3UT9B 3LY4A 3ZVWA 3LZ0A 5AJGA 4X25A 2G2UA 4CAYB 3G2YA 1ALQA 4NE6A 3B6GD 3AGDA 5BO0B 4R3AA 5DKLA 5J3WA 4IJGA 1P3IC 1Z6FA 4Q0IA 3RXWA 1SZVA 3BM6A 3M7PA 1H5XA 3MGPB 4Z2LA 3QP2A 4YS3A 1AOID 2KX6A 3KSYA 4R70A 4N1XA 3AZHB 4FH2A 5GT3C 4J8XB 1U35A 1J9MA 5CP6C 1GPFA 1YLWA 4R6LA 1H8ZA 2LB5A 5TGFA 3PBTA 1K4EA 1P3BB 4FTXA 2R9WA 2D02A 4J8WB 1Y54A 4LD9A 4PMAA 4NK3A 1SDNA 5F68A 4R3JA 1LHYA 2ZC6B 1L6JA 1S4SA 3CZDA 3IH9A 4HHDA 3R45A 3UB8A 1KX4D 1PZPA 1TD5A 2Y55A 3B6FD 1YU3A 4P6ZS 3UB9A 4KZ4A 3AZEC 3DTEA 3RTYA 4OJ6A 4KZ9A 5HAQA 1YM1A 3SH9A 5AV6B 4DE1A 5GLDA 3W98D 3W99D 4JJNC 2P9VB 5BNXA 3LYXA 4ZDXA 4F94A 3PHYA 4BWIA 2WADA 4Y5FA 4LD9B 3TU4C 4I3JA 4D60A 2Y2QA 5AVBA 4FUWA 1S6RA 1TEMA 4WU8D 3G30A 2Z6CA 3T1XA 3AYWB 1SKOB 3PXPA 5FI6A 1ZC2A 2RL3A 3NOPC 3T4OA 5B31D 3WAAA 1HTZA 3CMZA 4LGWA 4WLAA 3N7WA 4QY6A 3RJUA 4P6BA 3KWQB 5E43A 5FDSA 4HJ3A 3D3OA 3V5MA 1P3FA 3M2JA 5FEFA 3FPWA 3CUEC 3H7WA 3AZNB 5CHLB 3KXBB 3MGRC 4KHAA 5CPJA 3IF5A 5B2IA 4IBEA 3AZLB 2VX8A 4EEUA 1D1JA 3TW8A 2W3DA 4LG2A 5FQJA 4UUZB 3LY3A 3PBRA 5JRGD 2W1RA 5FAQA 2PYOA 3MZDA 4ZTKA 1NYYA 2Y59A 4KG5A 5GSUD 5GL9A 5CGXA 3WD2A 1N1JA 5L8MA 2YFVA 4XUJA 1T1BA 3OPHA 3FZCA 5B32G 2VGJA 3A3EA 3BW6A 5FQKA 3LIEA 1PNEA 2Y91A 2RVQC 1M1AC 1VM1A 3D9YA 1NLZA 4HEFA 3X1VA 4YOFA 3KWQC 1P34D 3MGSD 3REIC 3CUEA 3DTMA 4PAUA 1N9BA 1IYOA 5DTSA 3REHB 2BYMA 2J9PA 4X68A 1G6AA 3IH8A 1P3OB 3O88A 1H3QA 4OQIA 1XA7A 3WD3A 3VP1A 3AV1D 1P3PB 1RP5A 3FKVA 2V1ZA 2HPBA 3WTPE 1YLPA 3CAXA 3WA9B 5JA4A 3G32A 3GSGA 3Q7VA 3LICA 5EVIA 1GCEA 5A8BA 3MGQC 2A2LA 3GRJA 3X1UD 2HIOD 3L2AA 3AZID 1P34A 1YLTA 5JYOA 2G5HC 2DNSA 2V8FA 3UO9A 1BH8A 1ZG4A 3CI6A 2V8CA 5HL1A 1HD8A 2EWWA 5AV8C 1DJCA 3X1SA 4GB7A 4RX3A 3EGXC 3MNND 5G49A 2J3WA 3EPJA 1TZYD 5GSUA 4UQIS 1L0DA 3REHC 1S1ZA 1TS6A 1YKDA 4IEDA 3V3RA 3RXXA 1VEUA 1W7FA 2P08A 5B31B 3NQJB 4GW9A 4MBKA 3AL0C 1PWDA 2ZM5A 1WA9A 5FA7A 2ZOIA 1S4RA 4XT2A 4QLCB 5GT3B 1VETB 4F3LA 3MR0A 1N9LA 3LEZA 2XF3A 1ID3B 2ZM2A 3KXBD 3PBQA 4DDSA 5B32D 3MGQB 1GA0A 2QKPA 3PBSA 1ID3D 3VH5T 4WUJA 5CPJB 1KGEA 3U4LP 4J8WC 3T4JA 3IT9A 3WKJA 4NZ4A 1R4VA 4LENA 3PAGA 2WAFA 1OPXA 2C5WB 5EVID 2ZM8A 3SZTA 3ZFZA 1VEUB 1MWTA 5BOHA 3AZHD 2ZC5B 3AV1A 5F99B 1AOIB 3SS5A 3S7QA 2BLSA 5L2FA 3REJC 3W96C 2ZQ8A 4G3WA 2WKHA 1KE0A 4OONA 1YU4A 3DWKA 1Y28A 3W99B 1YLZA 1D06A 4NFTA 2NZDA 5HDDA 3MSHA 5CPIC 4Z2KA 5AY8A 1GHMA 4X1MA 3OCNA 3GQZA 3N6IA 1H3OA 4KQDA 1ZLAB 3B6FB 3LELB 3WS1A 1LL9A 4OPYA 2DMWA 2OLUA 1KGGA 1K56A 5DNMD 1J7MA 3AZNA 4X56A 3AZFC 4OPRA 2FZ0A 4HNBA 3B6GB 4HBUA 3AZMA 3OPLA 3TU4B 1BSGA 1P3LB 3R7WA 3HBRA 4S2OA 5AV6A 4LCLA 3WKJD 5CPKB 1FCNA 3H0RC 1O07A 4UHUA 1TDLA 4OUIA 4DRAA 4KUDC 4ARZA 3MMHA 2IWBA 4N1HA 4Z9QA 3BRMA 2J9OA 3M6BA 4P6ZM 3PYPA 1GSWA 5DNND 3X1TB 3LUQA 4JJNA 3AFAB 3C7VA 1FCOA 4GN2A 2H0TA 1YT4A 3TU4A 1P3BA 3TSGA 3SW1A 2PYOB 4YINA 3P98A 3AV2B 3W97D 3DWZA 5L10A 4WU8A 3BWLA 3W97C 3AZND 4Y0UA 4GOGA 3K3CA 4Y0OA 3L9KA 1DP8A 2HJ9C 5DTTA 3IF6C 4EWFA 4CLCA 1ERMA 1P3IB 1ERQA 1DJAA 2ACGA 2NZDD 1BTLA 1FILA 2QYBA 4G3KA 3MFXA 4X23C 5BO0A 1JTGA 3V3SA 1EI5A 1S32B 4KUDD 2VQRA 5IT5A 4MEZA 3LZ1D 4WU8B 1AIWA 2Y2JA 2NUPC 3Q1FA 3WTPA 1XJ6A 3QP8A 4WYYA 1KX5B 1YPRA 3L28A 1GOIA 4K08A 4CSRB 3AZFD 3WKJB 2BASA 5BS7A 3UB5P 4HBTA 3C2WA 3REJA 4DMZA 1E8BA 4IVIA 5B40C 4MN7A 5GT0A 1QO6A 3ZG7B 2X02A 3BECA 4YS3D 5B32B 5F69A 4XT2B 5FQQA 5CPID 3O62C 4NZ3A 4A5RA 3LI8A 5K5BA 4ZUXB 3NQUB 2KLIA 4GKUA 3AN2C 4WM9A 3VFHA 1KS0A 1AXBA 5FATA 1WWSA 5GHZA 1ES3A 3OCLA 3W96D 3A0VA 1LT0A 2D49A 3ZVTA 5DF7A 5KDMA 1TZYA 5J7EA 3VP2A 2FH5A 4EQ1A 4Z2MG 3MNNA 1JVJA 2ZC7A 3UE1A 1E3UD 1M19C 3X1SD 1W2EA 2WUQA 5HWWA 3N3FA 5B1MD 5L09A 3AZJB 3UY6A 4XXRA 4Z1WA 2HDRA 3ZGAB 3LEQA 2PRFA 3A3DA 4J8WD 4QLCC 2PT7A 1KX5A 3AZIB 1W8QA 3NDGA 2ZOHA 1XP4A 5FI2A 5KSCA 3X1UA 1ID3C 1DRMA 1F66C 4R38A 5B32C 3Q82A 3KXBC 1XFQA 4R4SA 4Y2FA 4HP4A 3S22A 3Q7ZA 4D2OA 2JBFA 2Z6DA 4JXSA 4L0LA 5E5AA 4HGAB 1XJ3A 4XZQB 3SH8A 3M2KA 3ICYA 2V0UA 1YU0A 5AQAA 4H9NB 3FKWA 3REHD 1XXMA 3O87A 2H5SA 5EOOA 4OKPA 4CLCB 1H8PA 4GH9A 5FQIA 1Q2QA 3W99A 1PI4A 4Y17A 4Z66B 2VEAA 3IBRA 2F8NK 4HESA 1MWSA 3C30A 4YM6A 5AV8D 3N8LA 3F1NB 3A1IA 5B0ZB 3C7UA 2Z2LB 3SS3A 1NRFA 4OP5A 3UMDA 1FQGA 1TAFA 3CHWP 4QU3A 3AZIC 3PTEA 4ARZB 4Y3IA 2E8IA 4XUJD 1T1AA 4OJOA 1F66B 3BQAA 3LIDA 1NYMA 1OTBA 1ZLAC 3LIBA 2XGNA 4LV2A 1YMXA 5KZHA 5CEDA 3VE3A 2NZDB 3R7WB 3WWXA 2WKEA 4WMCD 3ZNYA 4AWLB 3R4KA 4O01A 4XZQC 1Q2PA 3O5YA 3NJAA 3IHBA 4DF6A 5DF9A 1OTDA 4HH2A 4EETB 3WA9D 1VETA 1OTEA 1P3MC 4JF4A 3NECA 3D4FA 1AOIA 4X1LA 5EVEA 5HWVA 1Z09A 1O6IA 4X55A 1KVLA 3UB7A 3MGSC 1P34C 5HFOA 3KWQD 4WU9B 5AVCB 2Y8HA 4OQGA 4WZ5A 5EECA 5AVEA 3S4XA 3BY8A 3DAVA 3PBOA 3MGPC 2RVQD 1M1AD 5GLAA 4S2NA 3W97B 3L29A 2VZWA 2INWA 2O99A 1KOUA 5AV5B 2W27A 4DRTA 2B02A 3LGOA 4H9RA 5B33A 4WF0A 2Y2MA 3QNBA 3LELA 2A3UA 3IWQA 1ZHHB 2B95A 5A90A 5B1MB 4L9GA 2XDMA 2YFWB 2IOUA 4OQ0A 1F5MA 2HDUA 2NQBA 3EEAA 4DJ2A 2XROA 1LSVA 5AV8B 1XGJA 3LFVA 4RA7A 3MGRD 5AV9C 1P3MB 3IF6B 3GTCA 3VOLA 4FCFA 1V9ZA 4HOIA 4QB8A 4QLCA 1KX4A 3X1SB 1ZG6A 4ZUXD 3B42A 3FYZA 4HMCA 5B31C 4PM5A 4X23B 2GNXA 1O7EA 4E45A 1T19A 4UUZA 1W79A 2JHEA 1HQ3A 5EVLA 3AZKA 4WU8C 2HF6A 1LSXA 1M40A 3REJB 4YM6B 3NDEA 5HSQA 4DXCA 3IF6A 2BYKA 1LL5A 2PBYA 3BFCA 3LR4A 3LO7A 3W99C 3NY4A 3W98C 2ZL1B 3IHAA 3N8RA 5B40B 2PBDP 2YFWA 3AZED 4IJEA 2H28A 5B31G 2V0WA 3A3FA 3B0DB 3B6FC 2GZAA 2VK3A 3UT9A 3HSHA 5CGWA 5BNVA 4ZUXC 5JA4B 2PD8A 1UGUA 2EWVA 1MY8A 4OQHA 5BPVA 2Q9NA 5AV9D 5HPFA 1N9OA 4XZQA 2ZMFA 3NC8A 4LPZA 2QJ5A 4EO5B 3T4TA 3TRCA 3GV9A 5GT3D 3WD1A 3FDDA 4UQIM 1TDGA 3FPVA 1TS8A 4X69A 3CG5A 5HL6A 1TZYB 3F1NA 5B0YA 4BLMA 5E5AB 1P3ID 3NOUC 5DFYA 2P9VA 1SHVA 4II7A 1L0FA 1DP9A 1E4DA 1N1JB 3VOYA 4E44A 3KUYA 2KOIA 3MGPD 4ZUXA 4J8VA 1S32D 4KUDB 3SS4A 1S1YA 2WGWB 2M7UA 2QMIA 3KSIA 3RFBA 2ZY4A 1SCWA 1KDSA 1P3MD 4P0MA 1E15A 4DN0A 5DJUA 4KQRA 3WA9C 1DJBA 4JKTA 5BNXB 3AFAC 4CLCC 4R8PA 3ITAA 1PYYA 4XZQD 4N92A 4H9QB 3MKFA 4LFUA 3NQUA 1OJ5A 2X71A 4AWLC 2B18A 3WS4A 1JFIA 2M1CA 2Y2PA 1ZLAD 2VV8A 4E3IA 4NXEA 5C3IB 3AYWA 2PAVP 4IBGA 4XUJC 1C3BA 3AZGD 2V2FF 4IUHA 3Q7VB 1L0EA 4NG2A 1P3GB 2ZY2A 4KENB 4BJPA 5KDMB 4GD6A 4ZBJC 4EV4A 1M1AA 3UDFA 3AZEA 1P3LD 5D3OA 2O0YA 1P3FB 5AVBB 5AQ9A 4BBTA 4B4XA 4R23A 1M6KA 4IJFA 4K0WA 1P3AD 1CF0A 3LZ0B 5HWTA 1IYPA 1SKOA 2VGLS 5HARA 5J4EA 3UTBB 4RVAA 3G31A 2FJ7A 2EX2A 3AZGA 3AZKD 4FD8A 1E6PA 4GS9B 3C1BA 3HL9A 3C1CB 1YSQA 5FUGA 3F1OB 4OOMA 3UB6A 2EX8A 2YFVB 4KGCA 4MCWA 5DTKA 1F66D 3UT9C 4NZ5A 3TG9A 2Y2NA 4G91B 4CLCE 4KZ7A 4ETXA 4QLCD 4QJGA 1EAKA 3AV1B 4R8PD 3V50A 2K31A 3KS8A 2BTFP 3EEHA 3O62B 2VGLM 5B1MC 1QMFA 3X1SC 5B0ZA 1M19D 4G92B 3CJMA 3IXBA 2IA2A 4I39A 3P09A 4MDZA 2G5IC 5HAPA 2HJEA 2W3HA 5DJTA 3V67A 3ITBA 4J8VD 3C1BB 1MWUA 1FSYA 2JKTI 1BLPA 4OJ5A 4UPKA 1ONHA 5BT1C 4H9QA 4R0QA 4FOFA 3LIFA 4LV0A 4EUVA 4NXGA 3AN2D 5TFQA 1K6SA 5B0YD 3VH6W 5B33C 3GVBA 4EUZA 4WN5A 3O62D 3HJIA 1OT6A 4YS3C 1T3UA 3REKB 3CLOA 4MN6A 4U0XA 3MNNB 3F6TA 4OLDA 3KFUG 2CWEA 1KX5D 3TJZC 4UEYA 4JLFA 5B40D 4LCMA 4WELA 1P3AA 1KX3C 2ZQDA 3F1PB 4WEJA 1KU5A 1M18A 5EM1A 3TOIA 3AZEB 3B0DC 3EPLA 1SKFA 2EX9A 2ZL1A 5CXWA 1P97A 2W3FA 4YM6C 3H82A 3M6HA 3VH6T 5AV9A 2JKRM 3CPTB 4DDYA 3IXHA 3W4QA 1TS7A 1KVMA 1DP6A 2HP9A 3L27A 3LJAD 3LZ1C 5B1LB 4TX8A 2FFYA 4KZBA 5A91A 2WYXA 2PU4A 1CJFA 2L0WA 4Z2MH 3N8SA 1ACFA 1P3KB 4S2JA 4X23D 4YWZA 1OTAA 1OTIA 2NZDC 4O8GA 4E3KA 5FUGB 3E0YA 3F1OA 3P01A 5F99A 3VFFA 3SH7A 3MQOA 3MBZA 1BZAA 2M7VA 5GT0D 4O0PA 3AZKB 5AV8A 5BNVB 1P3MA 4KZ5A 4OOLA 1P3GA 5CERA 3AZNC 4I5SA 4HIAA 2GJ3A 2OAP1 4WU9C 2ZD8A 1K55C 3MGPA 3AZLC 1XX2A 1U60A 3HLEA 5LBRA 4KHAB 5U47A 3RELB 2XD1A 3T50A 1W63M 1P3OD 2XA7S 5DNNC 1FCMA 3ZCZA 2O9CA 4WZSB 4XUZA 1ESUA 5E2FA 3VMAA 2HZ5A 1P34B 5AVCC 2D01A 2P04A 1MKIA 5JYPA 3WKJC 4HMDA 4S2KA 3GECA 1YLYA 2PR6A 3MXQA 3O86A 2HUEC 1P3GC 4O7DA 2CC1A 1KDWA 3U2AA 3LR3A 2Y2LA 1WE4A 1FOFA 5DNMC 2QHKA 3LJAB 3NBLA 4EXOA 4CQHA 3MQ0A 2L1MA 3ZG0A 3KUYC 3IS2A 3BLMA 4X53A 3E2LA 1PIOA 4JGQA 3H0MC 1BUEA 5CPKA 1FIKA 2XRNA 3VSKA 1I5QA 5CPIA 2WKIA 2MJ6A 1P3PA 2OWJA 4IBKA 1F9IA 1W5DA 3WA9A 3UE3A 3REJD 2W3GA 3C4PA 3W98B 3MZEA 5AV6D 1PRQA 3AZHC 4PM9A 1HLUP 5B1LA 1F2KA 5GHXA 5KSHA 5EVIC 1EQZA 2VGKA 1IKGA 5DNMA 2R78A 2WGVA 4MLLA 1OGBA 1VQQA 4GHIB 3UPNA 2NUTC 4R4RA 4HGAC 3ZQ5A 4I3AA 1QMEA 1K38A 2LY8A 1T1CA 2ZQCA 4ZJ2A 4EESA 1W1PA 2PR5A 4UA7A 4LRZE 4QNLA 3UNWA 1W63Q 4NXBA 1FR1A 5M19A 1IKIA 1P3KA 4S2PA 2AROB 4CPKA 2FJ7C 1GSXA 2AROD 1TZYC 3E98A 3W97A 3MNNC 3HONA 4LD9C 5EPHA 4H9PB 3C1BC 2OSUA 4EEPA 1P3BD 3IXGA 4LRXC 2JKFA 2BYMB 4IBXA 4NE3A 4Y13A 3GR2A 5DNNA 2Y2OA 4GCZA 4UAAA 4J8WA 4U0TA 5DVAA 3ZG5A 3V9RA 1W8YA 3HJKA 4GHAA 2HIOC 3X1UC 3IS2B 5TR7A 5E2GA 3MKEA 1E6ZA 3L26A 3MGQD 3HUNA 3CITA 4CJNA 1B6WA 2PYPA 1T18A 4Q8IA 4HH3A 1CI9A 3AV1C 3L7HA 1P3KC 3MGSB 3IX4A 1B67A 3NCKA 3W96A 3G4PA 5I94A 5F1GA 4JGOA 1JNUA 4PHTA 3WS0A 5HW3A 3A3IA 5MC7A 3MXRA 3T12B 1ES5A 3REID 4E3OA 3PBNA 4KG2A 1W1YA 3B0CW 3JVVA 2HP5A 2W8SA 3VP4A 1OJGA 2XH9A 4WBGA 3VSLA 5CPKC 1P0ZA 4E3JA 4DE0A 4WEKA 1P3FC 3HLGA 3AZIA 4PM8A 4EW7A 3X1UB 2KDKA 1MXOA 1M1AB 5GSUC 1OGGA 3IWOA 4KGCB 1E88A 5JRGC 3GMWA 2WK0A 3REIB 3EWKA 5B2JC 3RH8B 5A92A 4H9OA 3VH5A 4HMEA 3UDXA 3MZFA 1TAFB 5IU1A 5E5AD 4C3QA 3R45B 2JN7A 2PYOC 2W3EA 2L5AA 1E25A 3EQVA 2YKFA 3QP4A 2V20A 2Y2HA 4H9SA 3UTBA 1CI8A 5FI7A 1EWZA 2HV1A 4DQYB 4JXGA 1GHPA 1GA9A 4L9EA 4BQMA 3W2ZA 1AWIA 4GS9A 2A24A 4L9FA 2Y2KA 3C1CA 1ID3A 1M18B 1UR9A 3DTKA 1JWVA 4OPQA 2JE5A 5B32A 3T4KA 3REIA 1IYSA 3KUYB 2F8NB 4E6WA 4Z66A 4OP8A 3E2KA 5AY8B 3TU4D 4Z66D 3DTIA 2XLNA 4NXFA 1VHMA 3MXSA 1K54C 1PWGA 4JJND 3S7NA 4NE5A 5HX9A 1PWCA 4E3NA 1G28A 3P5JB 3AZJA 3ZYTA 3FC7A 3ISGA 4YS3B 1S67L 4BMWA 1PDCA 2VLGA 2WGWA 1FSWA 5HD3A 1KX4C 4IBRA 4NZ1A 2HIOA 1KX3B 3KYEA 5EVIB 2OWHA 3BFDA 3MVDC 3AZFA 2J3TC 4P87A 5CPJC 3W96B 2O9BA 3VH6A 3MF0A 5L07A 1NWZA 3HREA 2J8PA 4NYUA 1MWRA 4Z5TA 5FEGA 2DF4C 1NLYA 3N4IA 5CP6D 4MBHA 5AQ7A 1K0KA 1TF1A 1YLJA 3UTAD 2CV5A 1ESIA 1AOIC 2W0NA 3MQLA 2PHYA 3W98A 2XFSA 4LLOB 3MGSA 5AY8D 3DW0A 4OVDA 4KG6A 3FG8A 3AZJC 4P85A 3KX0X 3UTAA 3E4QA 2PYRA 1KE3A 2JSSA 3B6GC 3QP6A 5B0YB 4BL3A 1U35C 5CPIB 3LZ1B 3W4PA 3L25A 3WD4A 2C6WB 3JPUA 1G68A 4H8RA 4QY5A 5B24C 1EQZD 2NQBB 1K57A 2ZM0A 3AZHA 3LELC 1BT5A 5EV0A 3ULFA 1BH9B 3ZNTA 2G2WA 1IEMA 3G34A 4IUKA 3QP5A 3KSGA 4GDNA 1P9RA 4KZAA 4GHLA 2ZBBA 5EUAA 5FASA 2WAEA 5AVFA 3RELD 2CV5C 2P7JA 2BYKB 4R8PB 1NZUA 2GX5A 1XGIA 1P3PD 5G4YA 3E4OA
chains in the Genus database with same CATH topology
3PAEA 3RELA 2Y2IA 4J8UB 3S1YA 1HQ3B 3KS4A 2ZLYA 3B6GA 3BYDA 3WTPC 1LI9A 1F1EA 1K6RA 3AZMD 2XFTA 4NY2A 4JPMA 1MBLA 2IWDA 4OOYA 1K56D 5DNMB 4S2LA 3IWIA 5CEBA 4WNNB 2QZ6A 4GZBA 4R3BA 3C4OA 4E6XA 4G91C 3VOZA 2CV5B 2RIQA 1RGYA 2CV5D 2OLVA 4J8UC 5CP6A 1P3OA 5CHMA 4Z5TD 5AQBA 3HUMA 4H9OB 5AV5C 4JXVA 5B1LD 2XQZA 5JRGB 1XPBA 1EQZC 3W4OA 5FQMA 4EBNA 1U35D 4H9RB 5B33B 3AN2B 4OLGA 5FAOA 4GDBA 4ZJ3A 5F99D 3AZJD 3KXBA 3REKC 5CGSA 5AY8C 1XA1A 4PM6A 2F8NH 1EROA 4DE2A 2ZC4B 3UTAC 4RYEA 1BH9A 3WAAB 4J8UA 4IBJA 3BLSA 4MBFA 1KGFA 4R1GA 5JRGA 5B24A 4M3KA 4DKIA 5FSRA 3G2ZA 1BFMA 4E3LA 2DRWA 4KZ8A 4J8XC 5CPJD 3MGQA 3ZG9B 3MVDD 3FKEA 1YMSA 5GXQB 3C1CD 3EPKA 3SOIA 4NYYA 5M1AA 1GHIA 5B31A 3WAAD 2FJ7B 3C5AA 3UTBD 3HVFA 1KX4B 1YU1A 3UE0A 3UTAB 3A6NC 4Z66C 1K4FA 3AGFA 4WZ4A 5CHJA 5E2EA 3JYIA 5IHVA 4S2IA 5AVBD 2RCXA 2EXAA 2HIOB 1KX3A 1I2WA 1LLBA 4N9KA 1PZRA 4J8XA 1U35B 2IO5C 1JWPA 3X1TC 4FH4A 2ZY5A 3X1VD 2HP6A 5GXQC 3OPPA 4Z5TB 4N9LA 4WJ3C 2WZXA 4IBFA 3A3JA 3MFDA 1YUEA 3AV2C 2ZC3B 3UPPA 4KGCC 1WWIA 2PYOD 3IXDA 5E5AC 3BEBA 4B4ZA 2JCHA 5B2JD 1A7WA 2ZJ9A 1IYQA 1CEGA 2J7VA 2NQBC 3AZGB 5B2ID 1ULYA 5GT0B 4K0XA 3FV7A 2H0YA 1P3FD 3X1TA 2IO5B 2DQNC 5CPKD 4IBBA 1PZOA 2J8YA 3O62A 4KZ3A 4MNRA 2F8NG 4UA9A 4IBIA 3AV2A 3EG5B 3AYWD 1HQ3C 1NJ4A 4KZ6A 2B5RA 3QNCA 2AROA 1CK3A 1K57C 3OPRA 4JXWA 2ZMAA 1PW1A 5AV9B 1P3KD 3WRTA 4E3MA 1M18C 1NY0A 1CEFA 5B0ZD 1BULA 5J8XA 4CAYA 1Z2CB 5HAIA 1L0GA 4OJLA 3WX7A 4C6YA 3B6FA 4RX2A 3O3VA 3LZ0C 4U3TA 3EPHA 5CTMA 1P3BC 3C1BD 1JTDA 1NXYA 5G18A 4LD9D 4OPZA 2ZQ7A 3HLCA 2XK1A 2AROC 3BFFA 2FJ7D 3A6NA 1K25A 1H3OB 4BD1A 4LV3A 3LCEA 3Q81A 3ZDJA 3MVDB 1JFIB 4J8VB 1P3LA 4X23A 5GXQA 4DRBA 4JJNB 4CSRA 1BLCA 4DE3A 2R9XA 3LZ0D 5FAPA 5KMWA 2X01A 5F1FA 2F8ND 1ZLAA 4EO5C 4YFMA 4DXBA 4Y0TA 3IP4C 2PU2A 5AV6C 5B0ZC 3BFGA 5BS7C 3AFAA 4QD4A 1M18D 4LV1A 3VP0A 2QPNA 3A1KA 3NI9A 5CRFA 5B24B 3ZHHA 5M18A 3REKA 1YU2A 1BH8B 2ZQAA 1S32A 1HQ3D 2F2AC 3AYWC 1KE4A 4JF6A 4KQQA 4BENA 4K91A 3KUYD 2XR0A 4S2NC 1OMEA 5GLBA 5GSUB 1LI0A 1P3IA 2UWXA 3AZMB 3B0CT 3QHYA 3UDIA 4IBDA 5B2JB 1P3GD 1PW8A 3MGRB 2EFUA 2EX6A 3BFEA 3B0BA 5GT3A 2Q9MA 4ID4A 5B2IC 4GD8A 4OJPA 3AGEA 2NQBD 5CTNA 1RGZA 2BG1A 5AVCD 3V9RB 3UN7A 1F66A 4KGCD 3B3XA 2EXBA 1SDEA 4UA6A 3NIAA 3VP3A 3AV2D 1P3OC 3UPOA 3LJAA 4H9PA 5FDHA 3HLBA 3VH5W 3AZLD 5GXQD 5AV5A 3X1VC 4WU9D 5DNNB 3X1TD 1FR6A 2JC7A 4ZBJB 4KQOA 5B40A 1Q9CA 5GT0C 2WGIA 1ES4A 3HLWA 5AVBC 5B2IB 1K55A 5GLCA 4FSFA 1JWZA 3HUOA 3A6ND 4ZAMA 3I7JA 1N4OA 4WMCA 3EQUA 2HDQA 3AN2A 2HUEB 3NQJA 5CP6B 1BLSA 1HZOA 3UTBC 1EQZB 3WAAC 2FFFB 4PPRA 3LJAC 4B88A 5GHYA 3WRZA 2ZQ9A 4G92C 2A49A 5F82A 1WYCA 5F83A 3C1CC 4BD0A 3X1VB 3V39A 1M19A 3OC2A 1ES2A 4YM6D 1YQSA 4J8XD 4Y7PA 3WS5A 4QHCA 4ZBEA 2Y2GA 1KX3D 2GDNA 4S2MA 5E2HA 4WZ5C 1KX5C 3FWLA 5B33D 5B0YC 2Y4AA 4M6BA 4WNNA 5BT1D 3REKD 1ZKJA 5F99C 4BL2A 4J8VC 2I72A 3KWQA 1S0WA 4IBCA 3G35A 4C75A 5CHUA 4PM7A 5B1MA 4H9NA 2P74A 4WU9A 2OV5A 4OH0A 5B1LC 4X6TA 4EBLA 5G49B 5AV5D 4R8PC 3AZLA 3A6NB 4Z5TC 5B2JA 2XD5A 4ZJ1A 3ZG8B 1M19B 4IVKA 3UT9D 4GNUA 4J8UD 5FQ9A 4H9SC 3AZFB 5DF8A 3WTPB 1ONGA 5CECA 3AZKC 5AVCA 3OZHA 3W8KA 2WZZA 5EE8A 1PI5A 1I2SA 1P3AC 2ZY3A 1MPLA 3IQAA 2IWCA 1HTAA 1HVBA 1NZOA 4NETA 3REHA 5C3IC 4EBPA 4EQIA 3AZMC 1L2SA 4XUJB 1P3LC 1IELA 2EFXA 3HLFA 3WTPD 2H10A 5A93A 3Q07A 1K54A 3AZGC 1RCJA 1DY6A 3LZ1A 4KUDA 5EOEA 2XEPA 1P3PC 2Z2MB 3RELC 3MGRA 4XUXA 2HDSA 3AFAD 1BLHA 3MVDA 4JBFA 1WYBA 1TVFA 4JF5A 1P3AB 1E3UA 1H8YA 3WS2A 3LELD 1XKZA 3H0LC 2F8NA 3HLDA 5B24D 1S32C 4WV4B 2DCFA 3UT9B 3LY4A 3ZVWA 3LZ0A 2G2UA 4CAYB 3G2YA 1ALQA 4NE6A 3B6GD 3AGDA 5BO0B 1P3IC 1Z6FA 3RXWA 3BM6A 1H5XA 3MGPB 4YS3A 1AOID 3KSYA 4N1XA 3AZHB 4FH2A 5GT3C 4J8XB 1U35A 1J9MA 5CP6C 1YLWA 1H8ZA 5TGFA 3PBTA 1K4EA 1P3BB 2R9WA 4J8WB 1Y54A 4LD9A 4PMAA 4NK3A 1SDNA 4R3JA 1LHYA 2ZC6B 3CZDA 3IH9A 3R45A 1KX4D 1PZPA 2Y55A 3B6FD 1YU3A 4KZ4A 3AZEC 4OJ6A 4KZ9A 5HAQA 1YM1A 3SH9A 5AV6B 4DE1A 5GLDA 3W98D 3W99D 4JJNC 2P9VB 5BNXA 4ZDXA 4F94A 2WADA 4LD9B 3TU4C 2Y2QA 5AVBA 1S6RA 1TEMA 4WU8D 3G30A 3AYWB 5FI6A 1ZC2A 2RL3A 5B31D 3WAAA 1HTZA 3CMZA 3N7WA 4QY6A 3RJUA 4P6BA 3KWQB 5E43A 3V5MA 1P3FA 3M2JA 3AZNB 5CHLB 3KXBB 3MGRC 4KHAA 5CPJA 3IF5A 5B2IA 4IBEA 3AZLB 4LG2A 5FQJA 4UUZB 3LY3A 3PBRA 5JRGD 5FAQA 2PYOA 3MZDA 4ZTKA 1NYYA 2Y59A 4KG5A 5GSUD 5GL9A 5CGXA 1N1JA 2YFVA 4XUJA 3OPHA 3FZCA 5B32G 2VGJA 3A3EA 5FQKA 2Y91A 2RVQC 1M1AC 1VM1A 4HEFA 3X1VA 3KWQC 1P34D 3MGSD 3REIC 3DTMA 1N9BA 1IYOA 5DTSA 3REHB 2BYMA 2J9PA 4X68A 1G6AA 3IH8A 1P3OB 3O88A 4OQIA 1XA7A 3VP1A 3AV1D 1P3PB 1RP5A 3FKVA 2HPBA 2V1ZA 3WTPE 1YLPA 3WA9B 5JA4A 3G32A 3GSGA 3Q7VA 5EVIA 1GCEA 3MGQC 3GRJA 3X1UD 2HIOD 3L2AA 3AZID 1P34A 1YLTA 5JYOA 2G5HC 2DNSA 3UO9A 1BH8A 1ZG4A 5HL1A 1HD8A 5AV8C 1DJCA 3X1SA 4GB7A 4RX3A 3MNND 5G49A 3EPJA 1TZYD 5GSUA 1L0DA 3REHC 4IEDA 3V3RA 3RXXA 1W7FA 5B31B 3NQJB 4MBKA 3AL0C 1PWDA 2ZM5A 5FA7A 4QLCB 5GT3B 3LEZA 2ZM2A 2XF3A 1ID3B 3PBQA 3KXBD 4DDSA 5B32D 3MGQB 1GA0A 3PBSA 1ID3D 3VH5T 5CPJB 1KGEA 4J8WC 3IT9A 3WKJA 4NZ4A 1R4VA 4LENA 3PAGA 2WAFA 2C5WB 5EVID 2ZM8A 3ZFZA 1MWTA 5BOHA 3AZHD 2ZC5B 3AV1A 5F99B 1AOIB 3SS5A 2BLSA 5L2FA 3REJC 3W96C 2ZQ8A 2WKHA 1KE0A 4OONA 1YU4A 3DWKA 3W99B 1YLZA 4NFTA 2NZDA 5CPIC 5AY8A 1GHMA 3OCNA 3GQZA 3N6IA 1H3OA 1ZLAB 3B6FB 3LELB 3WS1A 1LL9A 4OPYA 2OLUA 1KGGA 1K56A 5DNMD 3AZNA 4X56A 3AZFC 4OPRA 3B6GB 4HBUA 3AZMA 3OPLA 3TU4B 1BSGA 1P3LB 3HBRA 4S2OA 5AV6A 4LCLA 3WKJD 5CPKB 1FCNA 3H0RC 1O07A 4UHUA 1TDLA 4OUIA 4DRAA 4KUDC 2IWBA 4N1HA 4Z9QA 3BRMA 2J9OA 3M6BA 5DNND 3X1TB 4JJNA 3AFAB 3C7VA 1FCOA 4GN2A 2H0TA 1YT4A 3TU4A 1P3BA 3TSGA 2PYOB 4YINA 3P98A 3AV2B 3W97D 3DWZA 4WU8A 3W97C 3AZND 4Y0UA 4GOGA 4Y0OA 5DTTA 3IF6C 4EWFA 1ERMA 1P3IB 1ERQA 1DJAA 2NZDD 1BTLA 4X23C 5BO0A 1JTGA 3V3SA 1EI5A 1S32B 4KUDD 2VQRA 4MEZA 3LZ1D 4WU8B 2Y2JA 3Q1FA 3WTPA 4WYYA 1KX5B 3L28A 4CSRB 3AZFD 3WKJB 5BS7A 4HBTA 3REJA 4IVIA 5B40C 5GT0A 3ZG7B 2X02A 3BECA 4YS3D 5B32B 5FQQA 5CPID 3O62C 4NZ3A 4A5RA 4ZUXB 3NQUB 4GKUA 3AN2C 4WM9A 3VFHA 1AXBA 5FATA 1WWSA 5GHZA 1ES3A 3OCLA 3W96D 3ZVTA 5DF7A 5KDMA 1TZYA 3VP2A 4Z2MG 3MNNA 1JVJA 2ZC7A 3UE1A 1E3UD 1M19C 3X1SD 1W2EA 2WUQA 3N3FA 5B1MD 3AZJB 3UY6A 4XXRA 2HDRA 3ZGAB 3A3DA 4J8WD 4QLCC 1KX5A 3AZIB 1W8QA 3NDGA 1XP4A 5FI2A 5KSCA 3X1UA 1ID3C 1F66C 5B32C 3Q82A 3KXBC 4R4SA 3S22A 3Q7ZA 4D2OA 2JBFA 4JXSA 4L0LA 5E5AA 4HGAB 4XZQB 3SH8A 3M2KA 1YU0A 5AQAA 4H9NB 3FKWA 3REHD 1XXMA 3O87A 2H5SA 5EOOA 4OKPA 4GH9A 5FQIA 1Q2QA 3W99A 1PI4A 4Z66B 2F8NK 4HESA 1MWSA 4YM6A 5AV8D 3N8LA 3A1IA 5B0ZB 3C7UA 2Z2LB 3SS3A 1NRFA 4OP5A 1FQGA 1TAFA 4QU3A 3AZIC 3PTEA 2E8IA 4XUJD 4OJOA 1F66B 1NYMA 1ZLAC 2XGNA 4LV2A 1YMXA 5KZHA 5CEDA 2NZDB 3WWXA 2WKEA 4WMCD 3ZNYA 4AWLB 4XZQC 1Q2PA 3IHBA 4DF6A 5DF9A 3WA9D 1P3MC 4JF4A 3D4FA 1AOIA 4X55A 1KVLA 3MGSC 1P34C 5HFOA 3KWQD 4WU9B 5AVCB 4OQGA 4WZ5A 5EECA 3S4XA 3PBOA 3MGPC 2RVQD 1M1AD 5GLAA 4S2NA 3W97B 3L29A 5AV5B 4DRTA 4H9RA 5B33A 2Y2MA 3QNBA 3LELA 2A3UA 3IWQA 5A90A 5B1MB 2XDMA 2YFWB 2IOUA 4OQ0A 2HDUA 2NQBA 5AV8B 1XGJA 4RA7A 3MGRD 5AV9C 1P3MB 3IF6B 3GTCA 4FCFA 4QB8A 4QLCA 1KX4A 3X1SB 1ZG6A 4ZUXD 3FYZA 5B31C 4PM5A 4X23B 1O7EA 4E45A 4UUZA 1W79A 5EVLA 1HQ3A 3AZKA 4WU8C 1M40A 3REJB 4YM6B 3NDEA 4DXCA 3IF6A 2BYKA 1LL5A 2PBYA 3BFCA 3LO7A 3W99C 3NY4A 3W98C 3IHAA 3N8RA 5B40B 2YFWA 3AZED 4IJEA 5B31G 3A3FA 3B0DB 3B6FC 3UT9A 3HSHA 5CGWA 5BNVA 4ZUXC 5JA4B 1MY8A 4OQHA 5BPVA 2Q9NA 5AV9D 4XZQA 3NC8A 4EO5B 3GV9A 5GT3D 3FDDA 1TDGA 4X69A 3CG5A 1TZYB 5B0YA 4BLMA 5E5AB 1P3ID 2P9VA 1SHVA 1L0FA 1E4DA 1N1JB 3VOYA 4E44A 3KUYA 3MGPD 4ZUXA 4J8VA 1S32D 4KUDB 3SS4A 2WGWB 2QMIA 2ZY4A 1SCWA 1KDSA 1P3MD 4P0MA 4KQRA 3WA9C 4JKTA 1DJBA 5BNXB 3AFAC 4R8PA 3ITAA 1PYYA 4XZQD 4N92A 4H9QB 3MKFA 3NQUA 2X71A 4AWLC 3WS4A 1JFIA 2Y2PA 1ZLAD 4E3IA 5C3IB 3AYWA 4IBGA 4XUJC 1C3BA 3AZGD 2V2FF 3Q7VB 1L0EA 1P3GB 2ZY2A 4KENB 4BJPA 5KDMB 4ZBJC 4EV4A 1M1AA 3UDFA 3AZEA 1P3LD 5D3OA 1P3FB 5AVBB 5AQ9A 4B4XA 4R23A 1M6KA 4IJFA 4K0WA 1P3AD 3LZ0B 1IYPA 5HARA 3UTBB 4RVAA 3G31A 2FJ7A 2EX2A 3AZGA 3AZKD 4FD8A 3C1BA 3HL9A 3C1CB 5FUGA 4OOMA 2EX8A 2YFVB 4KGCA 5DTKA 1F66D 3UT9C 4NZ5A 3TG9A 2Y2NA 4G91B 4KZ7A 4QJGA 4QLCD 3AV1B 4R8PD 3V50A 3KS8A 3O62B 5B1MC 1QMFA 3X1SC 5B0ZA 1M19D 4G92B 3CJMA 3IXBA 3P09A 5HAPA 2G5IC 3ITBA 4J8VD 3C1BB 1MWUA 1FSYA 1BLPA 4OJ5A 4UPKA 1ONHA 5BT1C 4H9QA 4R0QA 4LV0A 3AN2D 5TFQA 1K6SA 5B0YD 3VH6W 5B33C 3GVBA 4EUZA 3O62D 4YS3C 1T3UA 3REKB 4U0XA 3MNNB 3F6TA 4OLDA 3KFUG 2CWEA 1KX5D 4JLFA 5B40D 4LCMA 4WELA 1P3AA 1KX3C 2ZQDA 4WEJA 1KU5A 1M18A 3TOIA 3AZEB 3B0DC 3EPLA 1SKFA 2EX9A 5CXWA 4YM6C 3M6HA 3VH6T 5AV9A 4DDYA 3IXHA 3W4QA 1KVMA 2HP9A 3L27A 3LJAD 3LZ1C 5B1LB 2FFYA 4KZBA 5A91A 2WYXA 2PU4A 4Z2MH 3N8SA 1P3KB 4S2JA 4X23D 2NZDC 4E3KA 5FUGB 5F99A 3VFFA 3SH7A 3MBZA 1BZAA 5GT0D 3AZKB 5AV8A 5BNVB 1P3MA 4KZ5A 4OOLA 1P3GA 5CERA 3AZNC 4WU9C 2ZD8A 1K55C 3MGPA 3AZLC 1XX2A 1U60A 3HLEA 4KHAB 5U47A 3RELB 2XD1A 1P3OD 5DNNC 1FCMA 3ZCZA 4WZSB 4XUZA 1ESUA 5E2FA 3VMAA 1P34B 5AVCC 1MKIA 5JYPA 3WKJC 4S2KA 1YLYA 3O86A 2HUEC 1P3GC 4O7DA 2CC1A 1KDWA 2Y2LA 1WE4A 1FOFA 5DNMC 3LJAB 3NBLA 3ZG0A 3KUYC 3BLMA 4X53A 3E2LA 1PIOA 3H0MC 1BUEA 5CPKA 3VSKA 1I5QA 5CPIA 2WKIA 1P3PA 4IBKA 1W5DA 3WA9A 3UE3A 3REJD 3C4PA 3W98B 3MZEA 5AV6D 3AZHC 4PM9A 5B1LA 5GHXA 5KSHA 5EVIC 1EQZA 2VGKA 1IKGA 5DNMA 2WGVA 4MLLA 1VQQA 3UPNA 4R4RA 4HGAC 1QMEA 1K38A 2LY8A 2ZQCA 4ZJ2A 4UA7A 4QNLA 3UNWA 1FR1A 5M19A 1IKIA 1P3KA 4S2PA 2AROB 4CPKA 2FJ7C 2AROD 1TZYC 3W97A 3MNNC 3HONA 4LD9C 5EPHA 4H9PB 3C1BC 2OSUA 1P3BD 3IXGA 4IBXA 2BYMB 4NE3A 3GR2A 5DNNA 2Y2OA 4UAAA 4J8WA 4U0TA 5DVAA 3ZG5A 3V9RA 1W8YA 4GHAA 2HIOC 3X1UC 5TR7A 5E2GA 3MKEA 3L26A 3MGQD 3HUNA 4CJNA 1B6WA 4Q8IA 1CI9A 3AV1C 1P3KC 3MGSB 1B67A 3NCKA 3W96A 3G4PA 5I94A 5F1GA 3WS0A 5HW3A 3A3IA 3MXRA 1ES5A 3REID 4E3OA 3PBNA 4KG2A 3B0CW 2HP5A 2W8SA 3VP4A 2XH9A 4WBGA 3VSLA 5CPKC 4E3JA 4DE0A 4WEKA 1P3FC 3HLGA 3AZIA 4PM8A 3X1UB 1MXOA 1M1AB 5GSUC 3IWOA 4KGCB 3GMWA 5JRGC 2WK0A 3REIB 5B2JC 5A92A 4H9OA 3VH5A 3UDXA 3MZFA 1TAFB 5E5AD 4C3QA 3R45B 2PYOC 2L5AA 1E25A 3EQVA 2V20A 2Y2HA 4H9SA 3UTBA 1CI8A 5FI7A 1EWZA 4DQYB 4JXGA 1GHPA 1GA9A 4BQMA 2Y2KA 3C1CA 1ID3A 1M18B 1JWVA 4OPQA 2JE5A 5B32A 3REIA 1IYSA 3KUYB 2F8NB 4E6WA 4Z66A 4OP8A 3E2KA 5AY8B 3TU4D 4Z66D 2XLNA 3MXSA 1K54C 1PWGA 4JJND 4NE5A 5HX9A 1PWCA 4E3NA 3P5JB 3AZJA 3ISGA 4YS3B 2WGWA 1FSWA 1KX4C 4IBRA 4NZ1A 2HIOA 1KX3B 5EVIB 3BFDA 3MVDC 3AZFA 4P87A 5CPJC 3W96B 3VH6A 3HREA 2J8PA 4NYUA 1MWRA 4Z5TA 2DF4C 3N4IA 5CP6D 4MBHA 5AQ7A 1YLJA 3UTAD 2CV5A 1ESIA 1AOIC 3W98A 2XFSA 3MGSA 5AY8D 3DW0A 4OVDA 4KG6A 3AZJC 4P85A 3UTAA 1KE3A 2JSSA 3B6GC 4BL3A 5B0YB 1U35C 5CPIB 3LZ1B 3W4PA 3L25A 2C6WB 4H8RA 1G68A 4QY5A 5B24C 1EQZD 2ZM0A 2NQBB 1K57A 3AZHA 3LELC 1BT5A 1BH9B 3ZNTA 2G2WA 1IEMA 3G34A 4GDNA 4KZAA 4GHLA 5EUAA 5FASA 2WAEA 3RELD 2CV5C 2BYKB 4R8PB 1NZUA 1XGIA 1P3PD 4GD6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CJM A;  3IXB A;  3PAE A;  3WS5 A;  4QHC A;  4ZBE A;  2Y2I A;  3S1Y A;  2Y2G A;  3P09 A;  5HAP A;  2GDN A;  4S2M A;  5E2H A;  4WZ5 C;  3C7V A;  2ZLY A;  3ITB A;  1FCO A;  3BYD A;  4GN2 A;  1MWU A;  1YT4 A;  2H0T A;  1FSY A;  3FWL A;  1BLP A;  3TSG A;  1LI9 A;  1ONH A;  4YIN A;  3P98 A;  1K6R A;  4R0Q A;  2XFT A;  3DWZ A;  4LV0 A;  4JPM A;  2Y4A A;  5TFQ A;  1K6S A;  3GVB A;  1MBL A;  2IWD A;  4Y0U A;  4OOY A;  4EUZ A;  1K56 D;  4GOG A;  1ZKJ A;  4S2L A;  3IWI A;  4Y0O A;  5DTT A;  5CEB A;  4BL2 A;  3IF6 C;  4U0X A;  4OLD A;  2QZ6 A;  4GZB A;  4EWF A;  2I72 A;  4JLF A;  4LCM A;  1ERM A;  4WEL A;  4R3B A;  2ZQD A;  3C4O A;  4WEJ A;  1ERQ A;  1S0W A;  1DJA A;  3TOI A;  1SKF A;  1BTL A;  2EX9 A;  3G35 A;  3VOZ A;  4C75 A;  4E6X A;  5CHU A;  5CXW A;  4PM7 A;  1JTG A;  3M6H A;  2P74 A;  1RGY A;  2OV5 A;  1EI5 A;  4OH0 A;  3V3S A;  4X6T A;  2OLV A;  4EBL A;  4DDY A;  3IXH A;  4MEZ A;  3W4Q A;  5CHM A;  1KVM A;  2HP9 A;  2XD5 A;  4ZJ1 A;  3ZG8 B;  2Y2J A;  3Q1F A;  4IVK A;  5AQB A;  3HUM A;  4GNU A;  2FFY A;  4KZB A;  5A91 A;  2WYX A;  2PU4 A;  5FQ9 A;  4JXV A;  4WYY A;  2XQZ A;  3N8S A;  5DF8 A;  1XPB A;  4S2J A;  1ONG A;  5CEC A;  4HBT A;  3W4O A;  3OZH A;  3W8K A;  5FQM A;  4E3K A;  4EBN A;  4IVI A;  2WZZ A;  5EE8 A;  1PI5 A;  3VFF A;  3SH7 A;  3MBZ A;  4OLG A;  1BZA A;  5FAO A;  4GDB A;  3ZG7 B;  2X02 A;  4ZJ3 A;  1I2S A;  3BEC A;  1MPL A;  3IQA A;  2IWC A;  5FQQ A;  4A5R A;  4KZ5 A;  5CGS A;  4OOL A;  5CER A;  1HVB A;  1NZO A;  1XA1 A;  4GKU A;  4PM6 A;  4NET A;  4WM9 A;  3VFH A;  1ERO A;  4DE2 A;  1L2S A;  2ZC4 B;  4EBP A;  4EQI A;  2ZD8 A;  4RYE A;  1IEL A;  1K55 C;  2EFX A;  3HLF A;  1AXB A;  3BLS A;  4MBF A;  5FAT A;  1ES3 A;  1KGF A;  1XX2 A;  5GHZ A;  2H10 A;  1U60 A;  3OCL A;  4R1G A;  3Q07 A;  5A93 A;  3HLE A;  1K54 A;  5U47 A;  3ZVT A;  2XD1 A;  1RCJ A;  1DY6 A;  5DF7 A;  4M3K A;  3VP2 A;  4DKI A;  5FSR A;  1FCM A;  1JVJ A;  2ZC7 A;  5EOE A;  3ZCZ A;  3G2Z A;  2XEP A;  3UE1 A;  4E3L A;  1E3U D;  2DRW A;  4KZ8 A;  4XUZ A;  2WUQ A;  2Z2M B;  1ESU A;  5E2F A;  3VMA A;  3ZG9 B;  1YMS A;  3UY6 A;  4XXR A;  4XUX A;  2HDR A;  3ZGA B;  2HDS A;  1MKI A;  5JYP A;  3SOI A;  3A3D A;  1BLH A;  4S2K A;  1W8Q A;  3NDG A;  5M1A A;  1XP4 A;  1GHI A;  5FI2 A;  5KSC A;  1YLY A;  4JBF A;  1WYB A;  1TVF A;  4JF5 A;  3Q82 A;  1E3U A;  3C5A A;  3O86 A;  4R4S A;  3S22 A;  3Q7Z A;  4D2O A;  1H8Y A;  2JBF A;  4O7D A;  3WS2 A;  1XKZ A;  1KDW A;  2CC1 A;  3HVF A;  4JXS A;  4L0L A;  2Y2L A;  1WE4 A;  3HLD A;  1FOF A;  2DCF A;  3UE0 A;  3LY4 A;  3ZVW A;  3NBL A;  3SH8 A;  1K4F A;  2G2U A;  3AGF A;  4WZ4 A;  5CHJ A;  3M2K A;  5E2E A;  3JYI A;  3G2Y A;  1ALQ A;  4S2I A;  5AQA A;  3AGD A;  5IHV A;  3FKW A;  2RCX A;  3ZG0 A;  3BLM A;  2EXA A;  4X53 A;  3E2L A;  1PIO A;  1XXM A;  1BUE A;  1Z6F A;  3O87 A;  2H5S A;  5EOO A;  4OKP A;  1I2W A;  1LLB A;  4N9K A;  5FQI A;  1Q2Q A;  3RXW A;  1I5Q A;  3VSK A;  1PI4 A;  3BM6 A;  1H5X A;  2WKI A;  4HES A;  1MWS A;  3N8L A;  1JWP A;  3C7U A;  4FH4 A;  2Z2L B;  3SS3 A;  2HP6 A;  4N1X A;  1W5D A;  4FH2 A;  1J9M A;  3OPP A;  3UE3 A;  1NRF A;  4N9L A;  2WZX A;  4OP5 A;  1FQG A;  1YLW A;  3A3J A;  1H8Z A;  5TGF A;  4QU3 A;  3C4P A;  3MFD A;  3PBT A;  3PTE A;  1K4E A;  2E8I A;  3MZE A;  2R9W A;  2ZC3 B;  4PM9 A;  1Y54 A;  1NYM A;  3UPP A;  4PMA A;  5GHX A;  4NK3 A;  1SDN A;  5KSH A;  4R3J A;  2XGN A;  1LHY A;  2ZC6 B;  4LV2 A;  1YMX A;  5EVI C;  5KZH A;  3IXD A;  5CED A;  3CZD A;  3IH9 A;  2VGK A;  3BEB A;  3WWX A;  1IKG A;  2WKE A;  4WMC D;  3ZNY A;  4B4Z A;  2JCH A;  2WGV A;  4MLL A;  1VQQ A;  2ZJ9 A;  3UPN A;  1IYQ A;  1CEG A;  2J7V A;  1PZP A;  1Q2P A;  2Y55 A;  4R4R A;  3IHB A;  4DF6 A;  5DF9 A;  4KZ4 A;  1QME A;  4K0X A;  1K38 A;  3FV7 A;  4JF4 A;  2ZQC A;  4ZJ2 A;  3D4F A;  4KZ9 A;  4UA7 A;  1YM1 A;  5HAQ A;  4X55 A;  1KVL A;  2H0Y A;  3SH9 A;  4DE1 A;  5GLD A;  5HFO A;  2P9V B;  4OQG A;  4WZ5 A;  5EEC A;  3UNW A;  1FR1 A;  3S4X A;  1PZO A;  3PBO A;  4ZDX A;  4F94 A;  5M19 A;  1IKI A;  2WAD A;  2J8Y A;  5GLA A;  2Y2Q A;  4S2P A;  4S2N A;  4KZ3 A;  4MNR A;  1S6R A;  4CPK A;  4UA9 A;  1TEM A;  4DRT A;  3G30 A;  1NJ4 A;  4KZ6 A;  2B5R A;  3QNC A;  2Y2M A;  1CK3 A;  1K57 C;  3OPR A;  3QNB A;  4JXW A;  5EPH A;  2A3U A;  2OSU A;  5FI6 A;  1ZC2 A;  2RL3 A;  2ZMA A;  3IWQ A;  1PW1 A;  5A90 A;  3IXG A;  1HTZ A;  2XDM A;  3CMZ A;  4IBX A;  4OQ0 A;  3N7W A;  4QY6 A;  3WRT A;  3RJU A;  4E3M A;  4P6B A;  2HDU A;  3GR2 A;  2Y2O A;  4UAA A;  1NY0 A;  5E43 A;  4U0T A;  5DVA A;  3V5M A;  1W8Y A;  3ZG5 A;  3M2J A;  1CEF A;  5TR7 A;  1XGJ A;  3MKE A;  5E2G A;  1BUL A;  5J8X A;  4RA7 A;  3HUN A;  3IF6 B;  4CJN A;  5HAI A;  1L0G A;  3GTC A;  3IF5 A;  4FCF A;  4QB8 A;  4C6Y A;  4Q8I A;  4RX2 A;  3O3V A;  1CI9 A;  1ZG6 A;  3FYZ A;  5FQJ A;  3LY3 A;  3PBR A;  4U3T A;  4PM5 A;  5HW3 A;  3NCK A;  5CTM A;  1O7E A;  3G4P A;  5FAQ A;  5I94 A;  3MZD A;  4ZTK A;  5F1G A;  1JTD A;  1NYY A;  1NXY A;  5G18 A;  1W79 A;  2Y59 A;  4KG5 A;  4OPZ A;  5EVL A;  2ZQ7 A;  5GL9 A;  3A3I A;  3WS0 A;  3HLC A;  2XK1 A;  3MXR A;  5CGX A;  1ES5 A;  3BFF A;  3OPH A;  4E3O A;  3PBN A;  4KG2 A;  1K25 A;  3FZC A;  2VGJ A;  1M40 A;  3A3E A;  5FQK A;  4BD1 A;  2Y91 A;  2HP5 A;  3NDE A;  3VP4 A;  2XH9 A;  4DXC A;  4LV3 A;  4WBG A;  1VM1 A;  3IF6 A;  3LCE A;  3VSL A;  3Q81 A;  1LL5 A;  4HEF A;  2PBY A;  3BFC A;  4E3J A;  3LO7 A;  4DE0 A;  3ZDJ A;  4WEK A;  3NY4 A;  3HLG A;  3IHA A;  3N8R A;  4PM8 A;  3DTM A;  1MXO A;  1N9B A;  3IWO A;  1IYO A;  5DTS A;  2J9P A;  4X68 A;  1G6A A;  3IH8 A;  3A3F A;  3O88 A;  3GMW A;  1BLC A;  2WK0 A;  4OQI A;  4DE3 A;  1XA7 A;  2R9X A;  5CGW A;  3VP1 A;  5A92 A;  3UDX A;  1RP5 A;  5FAP A;  3MZF A;  3FKV A;  2HPB A;  2V1Z A;  2X01 A;  4C3Q A;  1MY8 A;  4OQH A;  1E25 A;  5F1F A;  5KMW A;  1YLP A;  3EQV A;  2V20 A;  2Y2H A;  3G32 A;  3GSG A;  3Q7V A;  1CI8 A;  4YFM A;  5EVI A;  1EWZ A;  1GCE A;  2Q9N A;  5FI7 A;  4DXB A;  4Y0T A;  2PU2 A;  4JXG A;  1GHP A;  3GRJ A;  3BFG A;  1GA9 A;  3NC8 A;  4BQM A;  4QD4 A;  1YLT A;  5JYO A;  2Y2K A;  2DNS A;  3GV9 A;  3UO9 A;  4LV1 A;  1JWV A;  2QPN A;  3VP0 A;  4OPQ A;  2JE5 A;  1ZG4 A;  5HL1 A;  1TDG A;  3NI9 A;  1HD8 A;  4X69 A;  5CRF A;  1DJC A;  3CG5 A;  4GB7 A;  3ZHH A;  5M18 A;  4RX3 A;  1IYS A;  2ZQA A;  4BLM A;  1KE4 A;  1L0D A;  4JF6 A;  4KQQ A;  4E6W A;  2P9V A;  4K91 A;  1SHV A;  3E2K A;  2XR0 A;  4IED A;  4OP8 A;  4S2N C;  1L0F A;  1OME A;  1E4D A;  3V3R A;  3RXX A;  3VOY A;  5GLB A;  1W7F A;  4MBK A;  1LI0 A;  2UWX A;  1PWD A;  2XLN A;  5FA7 A;  3MXS A;  1K54 C;  1PWG A;  3QHY A;  5HX9 A;  1PWC A;  3UDI A;  3SS4 A;  4E3N A;  2WGW B;  2QMI A;  1PW8 A;  3LEZ A;  2XF3 A;  2ZM2 A;  4DDS A;  1SCW A;  3PBQ A;  1KDS A;  1GA0 A;  2EFU A;  2EX6 A;  3BFE A;  4P0M A;  3PBS A;  3ISG A;  4KQR A;  2WGW A;  1DJB A;  4JKT A;  2Q9M A;  1FSW A;  4ID4 A;  1KGE A;  4GD8 A;  3AGE A;  3ITA A;  5CTN A;  3IT9 A;  1PYY A;  4IBR A;  4N92 A;  1RGZ A;  2BG1 A;  3MKF A;  4LEN A;  4BEN A;  3PAG A;  5EVI B;  2X71 A;  3BFD A;  2WAF A;  2C5W B;  3UN7 A;  5EVI D;  3WS4 A;  4P87 A;  2ZM8 A;  3B3X A;  3ZFZ A;  2Y2P A;  1MWT A;  2EXB A;  1SDE A;  3HRE A;  5BOH A;  4E3I A;  4UA6 A;  1MWR A;  3NIA A;  2ZC5 B;  3VP3 A;  3UPO A;  1C3B A;  2V2F F;  3SS5 A;  3Q7V B;  2BLS A;  1L0E A;  5FDH A;  3HLB A;  5L2F A;  4KEN B;  4BJP A;  3N4I A;  2ZQ8 A;  4EV4 A;  2WKH A;  4MBH A;  5AQ7 A;  3UDF A;  1KE0 A;  4OON A;  3DWK A;  1YLJ A;  5D3O A;  1YLZ A;  1ESI A;  5AQ9 A;  1FR6 A;  4B4X A;  2XFS A;  2JC7 A;  4R23 A;  3DW0 A;  4OVD A;  1M6K A;  4KG6 A;  4K0W A;  4KQO A;  1GHM A;  4P85 A;  3OCN A;  3GQZ A;  3N6I A;  2WGI A;  1ES4 A;  3HLW A;  1IYP A;  1KE3 A;  4BL3 A;  1K55 A;  5HAR A;  5GLC A;  3WS1 A;  4FSF A;  1LL9 A;  4RVA A;  4OPY A;  3G31 A;  1JWZ A;  3HUO A;  2OLU A;  3W4P A;  4ZAM A;  1KGG A;  1K56 A;  3I7J A;  1N4O A;  2C6W B;  4H8R A;  1G68 A;  3EQU A;  2EX2 A;  4FD8 A;  4QY5 A;  4WMC A;  4X56 A;  2HDQ A;  1K57 A;  2ZM0 A;  4OPR A;  1BLS A;  1BT5 A;  4HBU A;  1HZO A;  3HL9 A;  3OPL A;  1BSG A;  4OOM A;  3ZNT A;  2EX8 A;  3HBR A;  4S2O A;  5DTK A;  2FFF B;  2G2W A;  1IEM A;  4PPR A;  3G34 A;  4B88 A;  4GDN A;  4LCL A;  3TG9 A;  2Y2N A;  4KZA A;  5GHY A;  2ZQ9 A;  4KZ7 A;  2A49 A;  5EUA A;  3WRZ A;  4QJG A;  5FAS A;  1FCN A;  1WYC A;  1O07 A;  2WAE A;  4UHU A;  5F82 A;  5F83 A;  1TDL A;  3V50 A;  4BD0 A;  2IWB A;  4N1H A;  1NZU A;  3OC2 A;  3V39 A;  1ES2 A;  1QMF A;  1XGI A;  4Z9Q A;  1YQS A;  3BRM A;  2J9O A;  3M6B A;  4Y7P A;  4GD6 A; 
#chains in the Genus database with same CATH topology
 3PAE A;  3REL A;  1E6N A;  2Y2I A;  4J8U B;  3S1Y A;  3P7N A;  5HZH A;  1HQ3 B;  2JKG A;  1H0M A;  3KS4 A;  2ZLY A;  4DJ3 A;  5FL3 A;  3B6G A;  3BYD A;  3WTP C;  1MKM A;  1LI9 A;  2OAQ 1;  3LI9 A;  1F1E A;  1G6O A;  1K6R A;  2J80 A;  3AZM D;  2XFT A;  4NY2 A;  4JPM A;  2G7U A;  1MBL A;  2IWD A;  4OOY A;  1EW0 A;  1K56 D;  5DNM B;  4JGR A;  1GXD A;  3IWI A;  4S2L A;  1G5U A;  3OLO A;  4F3L B;  4GHI A;  5CEB A;  2V1A A;  4WNN B;  2QZ6 A;  4GZB A;  3T4S A;  4R3B A;  3C4O A;  4E6X A;  4G91 C;  3VOZ A;  2VV7 A;  2CV5 B;  2RIQ A;  2XSS A;  1RGY A;  2CV5 D;  2OLV A;  3T4Q A;  4NKP A;  4J8U C;  5CP6 A;  1P3O A;  5CHM A;  1VB6 A;  1D7E A;  3CPT A;  4Z5T D;  5AQB A;  3HUM A;  4H9O B;  3BQ8 A;  3A0R A;  5AV5 C;  4JXV A;  5B1L D;  2XQZ A;  4ZRR A;  1V9Y A;  5JRG B;  5EM0 A;  1XPB A;  1EQZ C;  4KUK A;  4GJ4 A;  3W4O A;  1ED7 A;  5FQM A;  4H6J A;  4EBN A;  3DBA A;  1U35 D;  4H9R B;  5B33 B;  3AN2 B;  4OLG A;  5FAO A;  4GDB A;  1YAX A;  4ZJ3 A;  4YNR A;  5F99 D;  3AZJ D;  3KXB A;  3REK C;  5CGS A;  1CXW A;  1L3L A;  4I38 A;  5AY8 C;  1XA1 A;  2WKP A;  4AFI A;  4PM6 A;  2F8N H;  2W1T A;  5TBM B;  1H0I A;  1ERO A;  3LR5 A;  4DE2 A;  2ZC4 B;  3UTA C;  1H0G A;  4RYE A;  1BH9 A;  3WAA B;  4J8U A;  4IBJ A;  3BLS A;  4MBF A;  1KGF A;  3OBF A;  4HQA A;  4R1G A;  5JRG A;  3S7O A;  5B24 A;  3VE4 A;  4M4X A;  4M3K A;  4DKI A;  5FSR A;  3G2Z A;  1BFM A;  4E3L A;  2DRW A;  4KZ8 A;  4J8X C;  5CPJ D;  2J3T D;  3MGQ A;  3ZG9 B;  3MVD D;  3FKE A;  1YMS A;  5GXQ B;  3PR6 A;  3C1C D;  3EPK A;  3H82 B;  4HY8 A;  3SOI A;  4NYY A;  5M1A A;  1GHI A;  3H9W A;  4ME4 A;  5B31 A;  3WAA D;  1LSW A;  2FJ7 B;  3C5A A;  5DFX A;  2V1B A;  3UTB D;  3JVU A;  3HVF A;  1KX4 B;  1XFN A;  4PKY A;  1YU1 A;  3UE0 A;  3UTA B;  3A6N C;  3UME A;  4Z66 C;  1K4F A;  3AGF A;  4WZ4 A;  5CHJ A;  5E2E A;  3JYI A;  4RQ9 A;  4S2I A;  5IHV A;  4BBV A;  5AVB D;  4G3V A;  2RCX A;  3KYZ A;  2EXA A;  2HIO B;  1KX3 A;  1I2W A;  1LLB A;  4N9K A;  1PZR A;  4J8X A;  1U35 B;  2WKQ A;  4Q0H A;  2IO5 C;  1JWP A;  3X1T C;  4FH4 A;  2ZY5 A;  3X1V D;  2HP6 A;  4MMN A;  5GXQ C;  1IOU A;  3OPP A;  4Z5T B;  3T1R A;  2K2N A;  4N9L A;  4WJ3 C;  2WZX A;  4IBF A;  3A3J A;  3MFD A;  1YUE A;  3AV2 C;  2ZC3 B;  4Q0J A;  3UPP A;  4KGC C;  2I9V A;  1WWI A;  2PYO D;  2Y79 A;  3IXD A;  5E5A C;  3BEB A;  4B4Z A;  2JCH A;  5B2J D;  4B9O A;  1A7W A;  2ZJ9 A;  3EGD C;  1IYQ A;  1CEG A;  2J7V A;  2NQB C;  4ETZ A;  3AZG B;  3KSF A;  5B2I D;  1ULY A;  3IX3 A;  5GT0 B;  4MB5 A;  4K0X A;  4Z2J A;  3FV7 A;  2H0Y A;  1P3F D;  1H8M A;  3X1T A;  2IO5 B;  2DQN C;  5CPK D;  4IBB A;  1PZO A;  2J8Y A;  5CX7 A;  3O62 A;  4KZ3 A;  4MNR A;  3K3D A;  2F8N G;  4UA9 A;  4IBI A;  4NEE D;  3AV2 A;  3EG5 B;  3AYW D;  3MS6 A;  1HQ3 C;  1NJ4 A;  4KZ6 A;  2B5R A;  3QNC A;  2ARO A;  1CK3 A;  1K57 C;  3OPR A;  4JXW A;  2ZMA A;  1PW1 A;  5AV9 B;  1P3K D;  3H7W B;  3WRT A;  4E3M A;  4MB3 A;  1M18 C;  1NY0 A;  1CEF A;  5B0Z D;  1BUL A;  5I5L A;  5J8X A;  4HJ4 A;  4CAY A;  1Z2C B;  5HAI A;  1L0G A;  4OJL A;  3WX7 A;  4C6Y A;  3B6F A;  3IX8 A;  4RX2 A;  3O3V A;  3LZ0 C;  4U3T A;  3EPH A;  4HJ6 A;  5CTM A;  4Y15 A;  4Z2G A;  1P3B C;  1MC0 A;  3C1B D;  1JTD A;  1NXY A;  5G18 A;  4LD9 D;  4OPZ A;  2ZQ7 A;  3B33 A;  4I3I A;  2YKH A;  3HLC A;  2XK1 A;  3KYQ A;  2VJW A;  2ARO C;  1UR8 A;  3BFF A;  2FJ7 D;  3A6N A;  1K25 A;  1H3O B;  4BD1 A;  5HDS A;  3MQQ A;  4LV3 A;  3LCE A;  3Q81 A;  3UE6 A;  3ZDJ A;  3QP1 A;  4B93 A;  3MVD B;  1JFI B;  2PD7 A;  5C5K A;  4J8V B;  1P3L A;  4X23 A;  2L4R A;  3T1S A;  5GXQ A;  4DRB A;  4JJN B;  4CSR A;  1BLC A;  4DE3 A;  2R9X A;  3LZ0 D;  5FAP A;  4LRY C;  5KMW A;  2X01 A;  5F1F A;  2F8N D;  1ZLA A;  4EO5 C;  5HDC A;  1BYW A;  4YFM A;  4DXB A;  3NOT C;  4Y0T A;  3IP4 C;  2AVX A;  2PU2 A;  5AV6 C;  5B0Z C;  3BFG A;  5BS7 C;  2XA7 M;  5TBM A;  3AFA A;  2QWS A;  4QD4 A;  3B47 A;  1M18 D;  2RTS A;  4LV1 A;  3VP0 A;  2QPN A;  3A1K A;  3NI9 A;  5CRF A;  5B24 B;  3ZHH A;  5M18 A;  1ZTU A;  3REK A;  1YU2 A;  5TJJ A;  1BH8 B;  2ZQA A;  1S32 A;  1HQ3 D;  2F2A C;  3AYW C;  3NUL A;  1KE4 A;  4JF6 A;  4KQQ A;  4BEN A;  4K91 A;  3KUY D;  2JKT M;  2XR0 A;  4S2N C;  1OME A;  4Z2H A;  1A0K A;  5GLB A;  5GSU B;  4Z2I A;  3T1Q B;  2HGV A;  1LI0 A;  1P3I A;  5HPI A;  2UWX A;  5F5Y A;  3AZM B;  3OOV A;  2W1T B;  3TE8 A;  3B0C T;  2PDR A;  3QHY A;  3UDI A;  4IBD A;  5B2J B;  1P3G D;  1W1V A;  1PW8 A;  3MGR B;  2EFU A;  2EX6 A;  3BFE A;  1PFL A;  3B0B A;  4H6J B;  5G4Z A;  1OT9 A;  5GT3 A;  2Q9M A;  4ID4 A;  5B2I C;  4GD8 A;  4OJP A;  4ESP A;  3AGE A;  2VV6 A;  2NQB D;  5CTN A;  1RGZ A;  2BG1 A;  2Q0O A;  3C8C A;  3LIA A;  5AVC D;  4MN5 A;  3V9R B;  1UWP X;  3UN7 A;  1F66 A;  4KGC D;  3B3X A;  4EU0 A;  2EXB A;  1SDE A;  4UA6 A;  3NIA A;  3VP3 A;  3AV2 D;  1P3O C;  3UPO A;  3LJA A;  4H9P A;  5FDH A;  3HLB A;  3VH5 W;  1UWN X;  2LB9 A;  3AZL D;  2OOL A;  5GXQ D;  5AV5 A;  3X1V C;  4WU9 D;  5DNN B;  3X1T D;  1ODV A;  3BJN A;  1FR6 A;  2JC7 A;  4ZBJ B;  4KQO A;  1GSV A;  3GDI A;  5B40 A;  1Q9C A;  2JKR I;  5GT0 C;  2WGI A;  1ES4 A;  3HLW A;  5AVB C;  5B2I B;  1K55 A;  1XJ4 A;  5GLC A;  4FSF A;  1JWZ A;  3HUO A;  3A6N D;  4ZAM A;  3I7J A;  1N4O A;  4WMC A;  2FN2 A;  3EQU A;  1E6R A;  2HDQ A;  3AN2 A;  2HUE B;  3NQJ A;  5CP6 B;  1BLS A;  3F1P A;  1HZO A;  4QPR A;  3UTB C;  1EQZ B;  3T4L A;  4WL9 A;  3WD0 A;  3WAA C;  2FFF B;  4PPR A;  3LJA C;  2QJ7 A;  5EFW A;  4B88 A;  1LL8 A;  5GHY A;  3WRZ A;  2ZQ9 A;  4G92 C;  1W1T A;  1N9N A;  2A49 A;  5F82 A;  1WYC A;  5F83 A;  3C1C C;  4BD0 A;  3KSH A;  3X1V B;  3V39 A;  1M19 A;  3OC2 A;  1ES2 A;  4YM6 D;  1YQS A;  1STZ A;  1MZU A;  4J8X D;  4Y7P A;  2CMN A;  3D72 A;  1Y4O A;  4QHC A;  3WS5 A;  4ZBE A;  1J3W A;  2EA9 A;  3NHQ A;  4HI4 A;  2Y2G A;  1XJ2 A;  1KX3 D;  2GDN A;  4S2M A;  5E2H A;  4WZ5 C;  1KX5 C;  3HCY A;  3FWL A;  2UV0 E;  3KO6 A;  5B33 D;  5B0Y C;  2Y4A A;  4M6B A;  4WNN A;  4EER A;  5BT1 D;  3REK D;  1ZKJ A;  1NRJ A;  5F99 C;  4BL2 A;  1F98 A;  4IHQ A;  4J8V C;  3BY9 A;  2I72 A;  3KWQ A;  1S0W A;  2WKR A;  4MB4 A;  4IBC A;  3G35 A;  4C75 A;  5CHU A;  4PM7 A;  3S7P A;  5B1M A;  4H9N A;  2P74 A;  4WU9 A;  2OV5 A;  4OH0 A;  2VA0 A;  5KIZ A;  5B1L C;  4X6T A;  4EBL A;  5G49 B;  5AV5 D;  4R8P C;  3AZL A;  3A6N B;  4Z5T C;  4E04 A;  1S66 L;  5B2J A;  2XD5 A;  4ZJ1 A;  3ZG8 B;  1M19 B;  2ZMV A;  3CWF A;  4IVK A;  3UT9 D;  4GLQ A;  4GNU A;  4J8U D;  3C38 A;  5FQ9 A;  4H9S C;  3AZF B;  5DF8 A;  5HD5 A;  3WTP B;  3K2N A;  1ONG A;  5CEC A;  1TS0 A;  3AZK C;  3LR0 A;  5AVC A;  3OZH A;  3W8K A;  3G6O A;  4JGP A;  2V9A A;  2WZZ A;  5EE8 A;  1PI5 A;  4KUO A;  2E8J A;  1I2S A;  1P3A C;  2ZY3 A;  1MPL A;  3MJQ A;  3IQA A;  4BBU A;  2IWC A;  5F6A A;  5DKK A;  1HTA A;  3A0S A;  1HVB A;  1NZO A;  4NET A;  1P9W A;  3REH A;  5C3I C;  4EBP A;  4EQI A;  3AZM C;  1L2S A;  4XUJ B;  1P3L C;  1IEL A;  2EFX A;  3HLF A;  1X0O A;  5IS1 A;  2O9A A;  3WTP D;  2H10 A;  2V5O A;  5A93 A;  3Q07 A;  1K54 A;  3AZG C;  1IFQ A;  1RCJ A;  1DY6 A;  3VV4 A;  3LZ1 A;  2K7S A;  4PKY G;  4KUD A;  5EOE A;  2XEP A;  1P3P C;  2Z2M B;  4HP9 A;  3REL C;  2VKS A;  3MGR A;  4XUX A;  2A24 B;  1CQA A;  1YSP A;  2HDS A;  1CK7 A;  3EOI A;  4CLC D;  3AFA D;  1BLH A;  3IBJ A;  3E4P A;  3MVD A;  4JBF A;  1WYB A;  1TVF A;  4JF5 A;  1P3A B;  1E3U A;  1H8Y A;  3WS2 A;  3LEL D;  1XKZ A;  4QWO A;  3H0L C;  2F8N A;  3HLD A;  5B24 D;  1S32 C;  4WV4 B;  2DCF A;  3UT9 B;  3LY4 A;  3ZVW A;  3LZ0 A;  5AJG A;  4X25 A;  2G2U A;  4CAY B;  3G2Y A;  1ALQ A;  4NE6 A;  3B6G D;  3AGD A;  5BO0 B;  4R3A A;  5DKL A;  5J3W A;  4IJG A;  1P3I C;  1Z6F A;  4Q0I A;  3RXW A;  1SZV A;  3BM6 A;  3M7P A;  1H5X A;  3MGP B;  4Z2L A;  3QP2 A;  4YS3 A;  1AOI D;  2KX6 A;  3KSY A;  4R70 A;  4N1X A;  3AZH B;  4FH2 A;  5GT3 C;  4J8X B;  1U35 A;  1J9M A;  5CP6 C;  1GPF A;  1YLW A;  4R6L A;  1H8Z A;  2LB5 A;  5TGF A;  3PBT A;  1K4E A;  1P3B B;  4FTX A;  2R9W A;  2D02 A;  4J8W B;  1Y54 A;  4LD9 A;  4PMA A;  4NK3 A;  1SDN A;  5F68 A;  4R3J A;  1LHY A;  2ZC6 B;  1L6J A;  1S4S A;  3CZD A;  3IH9 A;  4HHD A;  3R45 A;  3UB8 A;  1KX4 D;  1PZP A;  1TD5 A;  2Y55 A;  3B6F D;  1YU3 A;  4P6Z S;  3UB9 A;  4KZ4 A;  3AZE C;  3DTE A;  3RTY A;  4OJ6 A;  4KZ9 A;  5HAQ A;  1YM1 A;  3SH9 A;  5AV6 B;  4DE1 A;  5GLD A;  3W98 D;  3W99 D;  4JJN C;  2P9V B;  5BNX A;  3LYX A;  4ZDX A;  4F94 A;  3PHY A;  4BWI A;  2WAD A;  4Y5F A;  4LD9 B;  3TU4 C;  4I3J A;  4D60 A;  2Y2Q A;  5AVB A;  4FUW A;  1S6R A;  1TEM A;  4WU8 D;  3G30 A;  2Z6C A;  3T1X A;  3AYW B;  1SKO B;  3PXP A;  5FI6 A;  1ZC2 A;  2RL3 A;  3NOP C;  3T4O A;  5B31 D;  3WAA A;  1HTZ A;  3CMZ A;  4LGW A;  4WLA A;  3N7W A;  4QY6 A;  3RJU A;  4P6B A;  3KWQ B;  5E43 A;  5FDS A;  4HJ3 A;  3D3O A;  3V5M A;  1P3F A;  3M2J A;  5FEF A;  3FPW A;  3CUE C;  3H7W A;  3AZN B;  5CHL B;  3KXB B;  3MGR C;  4KHA A;  5CPJ A;  3IF5 A;  5B2I A;  4IBE A;  3AZL B;  2VX8 A;  4EEU A;  1D1J A;  3TW8 A;  2W3D A;  4LG2 A;  5FQJ A;  4UUZ B;  3LY3 A;  3PBR A;  5JRG D;  2W1R A;  5FAQ A;  2PYO A;  3MZD A;  4ZTK A;  1NYY A;  2Y59 A;  4KG5 A;  5GSU D;  5GL9 A;  5CGX A;  3WD2 A;  1N1J A;  5L8M A;  2YFV A;  4XUJ A;  1T1B A;  3OPH A;  3FZC A;  5B32 G;  2VGJ A;  3A3E A;  3BW6 A;  5FQK A;  3LIE A;  1PNE A;  2Y91 A;  2RVQ C;  1M1A C;  1VM1 A;  3D9Y A;  1NLZ A;  4HEF A;  3X1V A;  4YOF A;  3KWQ C;  1P34 D;  3MGS D;  3REI C;  3CUE A;  3DTM A;  4PAU A;  1N9B A;  1IYO A;  5DTS A;  3REH B;  2BYM A;  2J9P A;  4X68 A;  1G6A A;  3IH8 A;  1P3O B;  3O88 A;  1H3Q A;  4OQI A;  1XA7 A;  3WD3 A;  3VP1 A;  3AV1 D;  1P3P B;  1RP5 A;  3FKV A;  2V1Z A;  2HPB A;  3WTP E;  1YLP A;  3CAX A;  3WA9 B;  5JA4 A;  3G32 A;  3GSG A;  3Q7V A;  3LIC A;  5EVI A;  1GCE A;  5A8B A;  3MGQ C;  2A2L A;  3GRJ A;  3X1U D;  2HIO D;  3L2A A;  3AZI D;  1P34 A;  1YLT A;  5JYO A;  2G5H C;  2DNS A;  2V8F A;  3UO9 A;  1BH8 A;  1ZG4 A;  3CI6 A;  2V8C A;  5HL1 A;  1HD8 A;  2EWW A;  5AV8 C;  1DJC A;  3X1S A;  4GB7 A;  4RX3 A;  3EGX C;  3MNN D;  5G49 A;  2J3W A;  3EPJ A;  1TZY D;  5GSU A;  4UQI S;  1L0D A;  3REH C;  1S1Z A;  1TS6 A;  1YKD A;  4IED A;  3V3R A;  3RXX A;  1VEU A;  1W7F A;  2P08 A;  5B31 B;  3NQJ B;  4GW9 A;  4MBK A;  3AL0 C;  1PWD A;  2ZM5 A;  1WA9 A;  5FA7 A;  2ZOI A;  1S4R A;  4XT2 A;  4QLC B;  5GT3 B;  1VET B;  4F3L A;  3MR0 A;  1N9L A;  3LEZ A;  2XF3 A;  1ID3 B;  2ZM2 A;  3KXB D;  3PBQ A;  4DDS A;  5B32 D;  3MGQ B;  1GA0 A;  2QKP A;  3PBS A;  1ID3 D;  3VH5 T;  4WUJ A;  5CPJ B;  1KGE A;  3U4L P;  4J8W C;  3T4J A;  3IT9 A;  3WKJ A;  4NZ4 A;  1R4V A;  4LEN A;  3PAG A;  2WAF A;  1OPX A;  2C5W B;  5EVI D;  2ZM8 A;  3SZT A;  3ZFZ A;  1VEU B;  1MWT A;  5BOH A;  3AZH D;  2ZC5 B;  3AV1 A;  5F99 B;  1AOI B;  3SS5 A;  3S7Q A;  2BLS A;  5L2F A;  3REJ C;  3W96 C;  2ZQ8 A;  4G3W A;  2WKH A;  1KE0 A;  4OON A;  1YU4 A;  3DWK A;  1Y28 A;  3W99 B;  1YLZ A;  1D06 A;  4NFT A;  2NZD A;  5HDD A;  3MSH A;  5CPI C;  4Z2K A;  5AY8 A;  1GHM A;  4X1M A;  3OCN A;  3GQZ A;  3N6I A;  1H3O A;  4KQD A;  1ZLA B;  3B6F B;  3LEL B;  3WS1 A;  1LL9 A;  4OPY A;  2DMW A;  2OLU A;  1KGG A;  1K56 A;  5DNM D;  1J7M A;  3AZN A;  4X56 A;  3AZF C;  4OPR A;  2FZ0 A;  4HNB A;  3B6G B;  4HBU A;  3AZM A;  3OPL A;  3TU4 B;  1BSG A;  1P3L B;  3R7W A;  3HBR A;  4S2O A;  5AV6 A;  4LCL A;  3WKJ D;  5CPK B;  1FCN A;  3H0R C;  1O07 A;  4UHU A;  1TDL A;  4OUI A;  4DRA A;  4KUD C;  4ARZ A;  3MMH A;  2IWB A;  4N1H A;  4Z9Q A;  3BRM A;  2J9O A;  3M6B A;  4P6Z M;  3PYP A;  1GSW A;  5DNN D;  3X1T B;  3LUQ A;  4JJN A;  3AFA B;  3C7V A;  1FCO A;  4GN2 A;  2H0T A;  1YT4 A;  3TU4 A;  1P3B A;  3TSG A;  3SW1 A;  2PYO B;  4YIN A;  3P98 A;  3AV2 B;  3W97 D;  3DWZ A;  5L10 A;  4WU8 A;  3BWL A;  3W97 C;  3AZN D;  4Y0U A;  4GOG A;  3K3C A;  4Y0O A;  3L9K A;  1DP8 A;  2HJ9 C;  5DTT A;  3IF6 C;  4EWF A;  4CLC A;  1ERM A;  1P3I B;  1ERQ A;  1DJA A;  2ACG A;  2NZD D;  1BTL A;  1FIL A;  2QYB A;  4G3K A;  3MFX A;  4X23 C;  5BO0 A;  1JTG A;  3V3S A;  1EI5 A;  1S32 B;  4KUD D;  2VQR A;  5IT5 A;  4MEZ A;  3LZ1 D;  4WU8 B;  1AIW A;  2Y2J A;  2NUP C;  3Q1F A;  3WTP A;  1XJ6 A;  3QP8 A;  4WYY A;  1KX5 B;  1YPR A;  3L28 A;  1GOI A;  4K08 A;  4CSR B;  3AZF D;  3WKJ B;  2BAS A;  5BS7 A;  3UB5 P;  4HBT A;  3C2W A;  3REJ A;  4DMZ A;  1E8B A;  4IVI A;  5B40 C;  4MN7 A;  5GT0 A;  1QO6 A;  3ZG7 B;  2X02 A;  3BEC A;  4YS3 D;  5B32 B;  5F69 A;  4XT2 B;  5FQQ A;  5CPI D;  3O62 C;  4NZ3 A;  4A5R A;  3LI8 A;  5K5B A;  4ZUX B;  3NQU B;  2KLI A;  4GKU A;  3AN2 C;  4WM9 A;  3VFH A;  1KS0 A;  1AXB A;  5FAT A;  1WWS A;  5GHZ A;  1ES3 A;  3OCL A;  3W96 D;  3A0V A;  1LT0 A;  2D49 A;  3ZVT A;  5DF7 A;  5KDM A;  1TZY A;  5J7E A;  3VP2 A;  2FH5 A;  4EQ1 A;  4Z2M G;  3MNN A;  1JVJ A;  2ZC7 A;  3UE1 A;  1E3U D;  1M19 C;  3X1S D;  1W2E A;  2WUQ A;  5HWW A;  3N3F A;  5B1M D;  5L09 A;  3AZJ B;  3UY6 A;  4XXR A;  4Z1W A;  2HDR A;  3ZGA B;  3LEQ A;  2PRF A;  3A3D A;  4J8W D;  4QLC C;  2PT7 A;  1KX5 A;  3AZI B;  1W8Q A;  3NDG A;  2ZOH A;  1XP4 A;  5FI2 A;  5KSC A;  3X1U A;  1ID3 C;  1DRM A;  1F66 C;  4R38 A;  5B32 C;  3Q82 A;  3KXB C;  1XFQ A;  4R4S A;  4Y2F A;  4HP4 A;  3S22 A;  3Q7Z A;  4D2O A;  2JBF A;  2Z6D A;  4JXS A;  4L0L A;  5E5A A;  4HGA B;  1XJ3 A;  4XZQ B;  3SH8 A;  3M2K A;  3ICY A;  2V0U A;  1YU0 A;  5AQA A;  4H9N B;  3FKW A;  3REH D;  1XXM A;  3O87 A;  2H5S A;  5EOO A;  4OKP A;  4CLC B;  1H8P A;  4GH9 A;  5FQI A;  1Q2Q A;  3W99 A;  1PI4 A;  4Y17 A;  4Z66 B;  2VEA A;  3IBR A;  2F8N K;  4HES A;  1MWS A;  3C30 A;  4YM6 A;  5AV8 D;  3N8L A;  3F1N B;  3A1I A;  5B0Z B;  3C7U A;  2Z2L B;  3SS3 A;  1NRF A;  4OP5 A;  3UMD A;  1FQG A;  1TAF A;  3CHW P;  4QU3 A;  3AZI C;  3PTE A;  4ARZ B;  4Y3I A;  2E8I A;  4XUJ D;  1T1A A;  4OJO A;  1F66 B;  3BQA A;  3LID A;  1NYM A;  1OTB A;  1ZLA C;  3LIB A;  2XGN A;  4LV2 A;  1YMX A;  5KZH A;  5CED A;  3VE3 A;  2NZD B;  3R7W B;  3WWX A;  2WKE A;  4WMC D;  3ZNY A;  4AWL B;  3R4K A;  4O01 A;  4XZQ C;  1Q2P A;  3O5Y A;  3NJA A;  3IHB A;  4DF6 A;  5DF9 A;  1OTD A;  4HH2 A;  4EET B;  3WA9 D;  1VET A;  1OTE A;  1P3M C;  4JF4 A;  3NEC A;  3D4F A;  1AOI A;  4X1L A;  5EVE A;  5HWV A;  1Z09 A;  1O6I A;  4X55 A;  1KVL A;  3UB7 A;  3MGS C;  1P34 C;  5HFO A;  3KWQ D;  4WU9 B;  5AVC B;  2Y8H A;  4OQG A;  4WZ5 A;  5EEC A;  5AVE A;  3S4X A;  3BY8 A;  3DAV A;  3PBO A;  3MGP C;  2RVQ D;  1M1A D;  5GLA A;  4S2N A;  3W97 B;  3L29 A;  2VZW A;  2INW A;  2O99 A;  1KOU A;  5AV5 B;  2W27 A;  4DRT A;  2B02 A;  3LGO A;  4H9R A;  5B33 A;  4WF0 A;  2Y2M A;  3QNB A;  3LEL A;  2A3U A;  3IWQ A;  1ZHH B;  2B95 A;  5A90 A;  5B1M B;  4L9G A;  2XDM A;  2YFW B;  2IOU A;  4OQ0 A;  1F5M A;  2HDU A;  2NQB A;  3EEA A;  4DJ2 A;  2XRO A;  1LSV A;  5AV8 B;  1XGJ A;  3LFV A;  4RA7 A;  3MGR D;  5AV9 C;  1P3M B;  3IF6 B;  3GTC A;  3VOL A;  4FCF A;  1V9Z A;  4HOI A;  4QB8 A;  4QLC A;  1KX4 A;  3X1S B;  1ZG6 A;  4ZUX D;  3B42 A;  3FYZ A;  4HMC A;  5B31 C;  4PM5 A;  4X23 B;  2GNX A;  1O7E A;  4E45 A;  1T19 A;  4UUZ A;  1W79 A;  2JHE A;  1HQ3 A;  5EVL A;  3AZK A;  4WU8 C;  2HF6 A;  1LSX A;  1M40 A;  3REJ B;  4YM6 B;  3NDE A;  5HSQ A;  4DXC A;  3IF6 A;  2BYK A;  1LL5 A;  2PBY A;  3BFC A;  3LR4 A;  3LO7 A;  3W99 C;  3NY4 A;  3W98 C;  2ZL1 B;  3IHA A;  3N8R A;  5B40 B;  2PBD P;  2YFW A;  3AZE D;  4IJE A;  2H28 A;  5B31 G;  2V0W A;  3A3F A;  3B0D B;  3B6F C;  2GZA A;  2VK3 A;  3UT9 A;  3HSH A;  5CGW A;  5BNV A;  4ZUX C;  5JA4 B;  2PD8 A;  1UGU A;  2EWV A;  1MY8 A;  4OQH A;  5BPV A;  2Q9N A;  5AV9 D;  5HPF A;  1N9O A;  4XZQ A;  2ZMF A;  3NC8 A;  4LPZ A;  2QJ5 A;  4EO5 B;  3T4T A;  3TRC A;  3GV9 A;  5GT3 D;  3WD1 A;  3FDD A;  4UQI M;  1TDG A;  3FPV A;  1TS8 A;  4X69 A;  3CG5 A;  5HL6 A;  1TZY B;  3F1N A;  5B0Y A;  4BLM A;  5E5A B;  1P3I D;  3NOU C;  5DFY A;  2P9V A;  1SHV A;  4II7 A;  1L0F A;  1DP9 A;  1E4D A;  1N1J B;  3VOY A;  4E44 A;  3KUY A;  2KOI A;  3MGP D;  4ZUX A;  4J8V A;  1S32 D;  4KUD B;  3SS4 A;  1S1Y A;  2WGW B;  2M7U A;  2QMI A;  3KSI A;  3RFB A;  2ZY4 A;  1SCW A;  1KDS A;  1P3M D;  4P0M A;  1E15 A;  4DN0 A;  5DJU A;  4KQR A;  3WA9 C;  1DJB A;  4JKT A;  5BNX B;  3AFA C;  4CLC C;  4R8P A;  3ITA A;  1PYY A;  4XZQ D;  4N92 A;  4H9Q B;  3MKF A;  4LFU A;  3NQU A;  1OJ5 A;  2X71 A;  4AWL C;  2B18 A;  3WS4 A;  1JFI A;  2M1C A;  2Y2P A;  1ZLA D;  2VV8 A;  4E3I A;  4NXE A;  5C3I B;  3AYW A;  2PAV P;  4IBG A;  4XUJ C;  1C3B A;  3AZG D;  2V2F F;  4IUH A;  3Q7V B;  1L0E A;  4NG2 A;  1P3G B;  2ZY2 A;  4KEN B;  4BJP A;  5KDM B;  4GD6 A;  4ZBJ C;  4EV4 A;  1M1A A;  3UDF A;  3AZE A;  1P3L D;  5D3O A;  2O0Y A;  1P3F B;  5AVB B;  5AQ9 A;  4BBT A;  4B4X A;  4R23 A;  1M6K A;  4IJF A;  4K0W A;  1P3A D;  1CF0 A;  3LZ0 B;  5HWT A;  1IYP A;  1SKO A;  2VGL S;  5HAR A;  5J4E A;  3UTB B;  4RVA A;  3G31 A;  2FJ7 A;  2EX2 A;  3AZG A;  3AZK D;  4FD8 A;  1E6P A;  4GS9 B;  3C1B A;  3HL9 A;  3C1C B;  1YSQ A;  5FUG A;  3F1O B;  4OOM A;  3UB6 A;  2EX8 A;  2YFV B;  4KGC A;  4MCW A;  5DTK A;  1F66 D;  3UT9 C;  4NZ5 A;  3TG9 A;  2Y2N A;  4G91 B;  4CLC E;  4KZ7 A;  4ETX A;  4QLC D;  4QJG A;  1EAK A;  3AV1 B;  4R8P D;  3V50 A;  2K31 A;  3KS8 A;  2BTF P;  3EEH A;  3O62 B;  2VGL M;  5B1M C;  1QMF A;  3X1S C;  5B0Z A;  1M19 D;  4G92 B;  3CJM A;  3IXB A;  2IA2 A;  4I39 A;  3P09 A;  4MDZ A;  2G5I C;  5HAP A;  2HJE A;  2W3H A;  5DJT A;  3V67 A;  3ITB A;  4J8V D;  3C1B B;  1MWU A;  1FSY A;  2JKT I;  1BLP A;  4OJ5 A;  4UPK A;  1ONH A;  5BT1 C;  4H9Q A;  4R0Q A;  4FOF A;  3LIF A;  4LV0 A;  4EUV A;  4NXG A;  3AN2 D;  5TFQ A;  1K6S A;  5B0Y D;  3VH6 W;  5B33 C;  3GVB A;  4EUZ A;  4WN5 A;  3O62 D;  3HJI A;  1OT6 A;  4YS3 C;  1T3U A;  3REK B;  3CLO A;  4MN6 A;  4U0X A;  3MNN B;  3F6T A;  4OLD A;  3KFU G;  2CWE A;  1KX5 D;  3TJZ C;  4UEY A;  4JLF A;  5B40 D;  4LCM A;  4WEL A;  1P3A A;  1KX3 C;  2ZQD A;  3F1P B;  4WEJ A;  1KU5 A;  1M18 A;  5EM1 A;  3TOI A;  3AZE B;  3B0D C;  3EPL A;  1SKF A;  2EX9 A;  2ZL1 A;  5CXW A;  1P97 A;  2W3F A;  4YM6 C;  3H82 A;  3M6H A;  3VH6 T;  5AV9 A;  2JKR M;  3CPT B;  4DDY A;  3IXH A;  3W4Q A;  1TS7 A;  1KVM A;  1DP6 A;  2HP9 A;  3L27 A;  3LJA D;  3LZ1 C;  5B1L B;  4TX8 A;  2FFY A;  4KZB A;  5A91 A;  2WYX A;  2PU4 A;  1CJF A;  2L0W A;  4Z2M H;  3N8S A;  1ACF A;  1P3K B;  4S2J A;  4X23 D;  4YWZ A;  1OTA A;  1OTI A;  2NZD C;  4O8G A;  4E3K A;  5FUG B;  3E0Y A;  3F1O A;  3P01 A;  5F99 A;  3VFF A;  3SH7 A;  3MQO A;  3MBZ A;  1BZA A;  2M7V A;  5GT0 D;  4O0P A;  3AZK B;  5AV8 A;  5BNV B;  1P3M A;  4KZ5 A;  4OOL A;  1P3G A;  5CER A;  3AZN C;  4I5S A;  4HIA A;  2GJ3 A;  2OAP 1;  4WU9 C;  2ZD8 A;  1K55 C;  3MGP A;  3AZL C;  1XX2 A;  1U60 A;  3HLE A;  5LBR A;  4KHA B;  5U47 A;  3REL B;  2XD1 A;  3T50 A;  1W63 M;  1P3O D;  2XA7 S;  5DNN C;  1FCM A;  3ZCZ A;  2O9C A;  4WZS B;  4XUZ A;  1ESU A;  5E2F A;  3VMA A;  2HZ5 A;  1P34 B;  5AVC C;  2D01 A;  2P04 A;  1MKI A;  5JYP A;  3WKJ C;  4HMD A;  4S2K A;  3GEC A;  1YLY A;  2PR6 A;  3MXQ A;  3O86 A;  2HUE C;  1P3G C;  4O7D A;  2CC1 A;  1KDW A;  3U2A A;  3LR3 A;  2Y2L A;  1WE4 A;  1FOF A;  5DNM C;  2QHK A;  3LJA B;  3NBL A;  4EXO A;  4CQH A;  3MQ0 A;  2L1M A;  3ZG0 A;  3KUY C;  3IS2 A;  3BLM A;  4X53 A;  3E2L A;  1PIO A;  4JGQ A;  3H0M C;  1BUE A;  5CPK A;  1FIK A;  2XRN A;  3VSK A;  1I5Q A;  5CPI A;  2WKI A;  2MJ6 A;  1P3P A;  2OWJ A;  4IBK A;  1F9I A;  1W5D A;  3WA9 A;  3UE3 A;  3REJ D;  2W3G A;  3C4P A;  3W98 B;  3MZE A;  5AV6 D;  1PRQ A;  3AZH C;  4PM9 A;  1HLU P;  5B1L A;  1F2K A;  5GHX A;  5KSH A;  5EVI C;  1EQZ A;  2VGK A;  1IKG A;  5DNM A;  2R78 A;  2WGV A;  4MLL A;  1OGB A;  1VQQ A;  4GHI B;  3UPN A;  2NUT C;  4R4R A;  4HGA C;  3ZQ5 A;  4I3A A;  1QME A;  1K38 A;  2LY8 A;  1T1C A;  2ZQC A;  4ZJ2 A;  4EES A;  1W1P A;  2PR5 A;  4UA7 A;  4LRZ E;  4QNL A;  3UNW A;  1W63 Q;  4NXB A;  1FR1 A;  5M19 A;  1IKI A;  1P3K A;  4S2P A;  2ARO B;  4CPK A;  2FJ7 C;  1GSX A;  2ARO D;  1TZY C;  3E98 A;  3W97 A;  3MNN C;  3HON A;  4LD9 C;  5EPH A;  4H9P B;  3C1B C;  2OSU A;  4EEP A;  1P3B D;  3IXG A;  4LRX C;  2JKF A;  2BYM B;  4IBX A;  4NE3 A;  4Y13 A;  3GR2 A;  5DNN A;  2Y2O A;  4GCZ A;  4UAA A;  4J8W A;  4U0T A;  5DVA A;  3ZG5 A;  3V9R A;  1W8Y A;  3HJK A;  4GHA A;  2HIO C;  3X1U C;  3IS2 B;  5TR7 A;  5E2G A;  3MKE A;  1E6Z A;  3L26 A;  3MGQ D;  3HUN A;  3CIT A;  4CJN A;  1B6W A;  2PYP A;  1T18 A;  4Q8I A;  4HH3 A;  1CI9 A;  3AV1 C;  3L7H A;  1P3K C;  3MGS B;  3IX4 A;  1B67 A;  3NCK A;  3W96 A;  3G4P A;  5I94 A;  5F1G A;  4JGO A;  1JNU A;  4PHT A;  3WS0 A;  5HW3 A;  3A3I A;  5MC7 A;  3MXR A;  3T12 B;  1ES5 A;  3REI D;  4E3O A;  3PBN A;  4KG2 A;  1W1Y A;  3B0C W;  3JVV A;  2HP5 A;  2W8S A;  3VP4 A;  1OJG A;  2XH9 A;  4WBG A;  3VSL A;  5CPK C;  1P0Z A;  4E3J A;  4DE0 A;  4WEK A;  1P3F C;  3HLG A;  3AZI A;  4PM8 A;  4EW7 A;  3X1U B;  2KDK A;  1MXO A;  1M1A B;  5GSU C;  1OGG A;  3IWO A;  4KGC B;  1E88 A;  5JRG C;  3GMW A;  2WK0 A;  3REI B;  3EWK A;  5B2J C;  3RH8 B;  5A92 A;  4H9O A;  3VH5 A;  4HME A;  3UDX A;  3MZF A;  1TAF B;  5IU1 A;  5E5A D;  4C3Q A;  3R45 B;  2JN7 A;  2PYO C;  2W3E A;  2L5A A;  1E25 A;  3EQV A;  2YKF A;  3QP4 A;  2V20 A;  2Y2H A;  4H9S A;  3UTB A;  1CI8 A;  5FI7 A;  1EWZ A;  2HV1 A;  4DQY B;  4JXG A;  1GHP A;  1GA9 A;  4L9E A;  4BQM A;  3W2Z A;  1AWI A;  4GS9 A;  2A24 A;  4L9F A;  2Y2K A;  3C1C A;  1ID3 A;  1M18 B;  1UR9 A;  3DTK A;  1JWV A;  4OPQ A;  2JE5 A;  5B32 A;  3T4K A;  3REI A;  1IYS A;  3KUY B;  2F8N B;  4E6W A;  4Z66 A;  4OP8 A;  3E2K A;  5AY8 B;  3TU4 D;  4Z66 D;  3DTI A;  2XLN A;  4NXF A;  1VHM A;  3MXS A;  1K54 C;  1PWG A;  4JJN D;  3S7N A;  4NE5 A;  5HX9 A;  1PWC A;  4E3N A;  1G28 A;  3P5J B;  3AZJ A;  3ZYT A;  3FC7 A;  3ISG A;  4YS3 B;  1S67 L;  4BMW A;  1PDC A;  2VLG A;  2WGW A;  1FSW A;  5HD3 A;  1KX4 C;  4IBR A;  4NZ1 A;  2HIO A;  1KX3 B;  3KYE A;  5EVI B;  2OWH A;  3BFD A;  3MVD C;  3AZF A;  2J3T C;  4P87 A;  5CPJ C;  3W96 B;  2O9B A;  3VH6 A;  3MF0 A;  5L07 A;  1NWZ A;  3HRE A;  2J8P A;  4NYU A;  1MWR A;  4Z5T A;  5FEG A;  2DF4 C;  1NLY A;  3N4I A;  5CP6 D;  4MBH A;  5AQ7 A;  1K0K A;  1TF1 A;  1YLJ A;  3UTA D;  2CV5 A;  1ESI A;  1AOI C;  2W0N A;  3MQL A;  2PHY A;  3W98 A;  2XFS A;  4LLO B;  3MGS A;  5AY8 D;  3DW0 A;  4OVD A;  4KG6 A;  3FG8 A;  3AZJ C;  4P85 A;  3KX0 X;  3UTA A;  3E4Q A;  2PYR A;  1KE3 A;  2JSS A;  3B6G C;  3QP6 A;  5B0Y B;  4BL3 A;  1U35 C;  5CPI B;  3LZ1 B;  3W4P A;  3L25 A;  3WD4 A;  2C6W B;  3JPU A;  1G68 A;  4H8R A;  4QY5 A;  5B24 C;  1EQZ D;  2NQB B;  1K57 A;  2ZM0 A;  3AZH A;  3LEL C;  1BT5 A;  5EV0 A;  3ULF A;  1BH9 B;  3ZNT A;  2G2W A;  1IEM A;  3G34 A;  4IUK A;  3QP5 A;  3KSG A;  4GDN A;  1P9R A;  4KZA A;  4GHL A;  2ZBB A;  5EUA A;  5FAS A;  2WAE A;  5AVF A;  3REL D;  2CV5 C;  2P7J A;  2BYK B;  4R8P B;  1NZU A;  2GX5 A;  1XGI A;  1P3P D;  5G4Y A;  3E4O A; 
#chains in the Genus database with same CATH homology
 3PAE A;  3REL A;  2Y2I A;  4J8U B;  3S1Y A;  1HQ3 B;  3KS4 A;  2ZLY A;  3B6G A;  3BYD A;  3WTP C;  1LI9 A;  1F1E A;  1K6R A;  3AZM D;  2XFT A;  4NY2 A;  4JPM A;  1MBL A;  2IWD A;  4OOY A;  1K56 D;  5DNM B;  4S2L A;  3IWI A;  5CEB A;  4WNN B;  2QZ6 A;  4GZB A;  4R3B A;  3C4O A;  4E6X A;  4G91 C;  3VOZ A;  2CV5 B;  2RIQ A;  1RGY A;  2CV5 D;  2OLV A;  4J8U C;  5CP6 A;  1P3O A;  5CHM A;  4Z5T D;  5AQB A;  3HUM A;  4H9O B;  5AV5 C;  4JXV A;  5B1L D;  2XQZ A;  5JRG B;  1XPB A;  1EQZ C;  3W4O A;  5FQM A;  4EBN A;  1U35 D;  4H9R B;  5B33 B;  3AN2 B;  4OLG A;  5FAO A;  4GDB A;  4ZJ3 A;  5F99 D;  3AZJ D;  3KXB A;  3REK C;  5CGS A;  5AY8 C;  1XA1 A;  4PM6 A;  2F8N H;  1ERO A;  4DE2 A;  2ZC4 B;  3UTA C;  4RYE A;  1BH9 A;  3WAA B;  4J8U A;  4IBJ A;  3BLS A;  4MBF A;  1KGF A;  4R1G A;  5JRG A;  5B24 A;  4M3K A;  4DKI A;  5FSR A;  3G2Z A;  1BFM A;  4E3L A;  2DRW A;  4KZ8 A;  4J8X C;  5CPJ D;  3MGQ A;  3ZG9 B;  3MVD D;  3FKE A;  1YMS A;  5GXQ B;  3C1C D;  3EPK A;  3SOI A;  4NYY A;  5M1A A;  1GHI A;  5B31 A;  3WAA D;  2FJ7 B;  3C5A A;  3UTB D;  3HVF A;  1KX4 B;  1YU1 A;  3UE0 A;  3UTA B;  3A6N C;  4Z66 C;  1K4F A;  3AGF A;  4WZ4 A;  5CHJ A;  5E2E A;  3JYI A;  5IHV A;  4S2I A;  5AVB D;  2RCX A;  2EXA A;  2HIO B;  1KX3 A;  1I2W A;  1LLB A;  4N9K A;  1PZR A;  4J8X A;  1U35 B;  2IO5 C;  1JWP A;  3X1T C;  4FH4 A;  2ZY5 A;  3X1V D;  2HP6 A;  5GXQ C;  3OPP A;  4Z5T B;  4N9L A;  4WJ3 C;  2WZX A;  4IBF A;  3A3J A;  3MFD A;  1YUE A;  3AV2 C;  2ZC3 B;  3UPP A;  4KGC C;  1WWI A;  2PYO D;  3IXD A;  5E5A C;  3BEB A;  4B4Z A;  2JCH A;  5B2J D;  1A7W A;  2ZJ9 A;  1IYQ A;  1CEG A;  2J7V A;  2NQB C;  3AZG B;  5B2I D;  1ULY A;  5GT0 B;  4K0X A;  3FV7 A;  2H0Y A;  1P3F D;  3X1T A;  2IO5 B;  2DQN C;  5CPK D;  4IBB A;  1PZO A;  2J8Y A;  3O62 A;  4KZ3 A;  4MNR A;  2F8N G;  4UA9 A;  4IBI A;  3AV2 A;  3EG5 B;  3AYW D;  1HQ3 C;  1NJ4 A;  4KZ6 A;  2B5R A;  3QNC A;  2ARO A;  1CK3 A;  1K57 C;  3OPR A;  4JXW A;  2ZMA A;  1PW1 A;  5AV9 B;  1P3K D;  3WRT A;  4E3M A;  1M18 C;  1NY0 A;  1CEF A;  5B0Z D;  1BUL A;  5J8X A;  4CAY A;  1Z2C B;  5HAI A;  1L0G A;  4OJL A;  3WX7 A;  4C6Y A;  3B6F A;  4RX2 A;  3O3V A;  3LZ0 C;  4U3T A;  3EPH A;  5CTM A;  1P3B C;  3C1B D;  1JTD A;  1NXY A;  5G18 A;  4LD9 D;  4OPZ A;  2ZQ7 A;  3HLC A;  2XK1 A;  2ARO C;  3BFF A;  2FJ7 D;  3A6N A;  1K25 A;  1H3O B;  4BD1 A;  4LV3 A;  3LCE A;  3Q81 A;  3ZDJ A;  3MVD B;  1JFI B;  4J8V B;  1P3L A;  4X23 A;  5GXQ A;  4DRB A;  4JJN B;  4CSR A;  1BLC A;  4DE3 A;  2R9X A;  3LZ0 D;  5FAP A;  5KMW A;  2X01 A;  5F1F A;  2F8N D;  1ZLA A;  4EO5 C;  4YFM A;  4DXB A;  4Y0T A;  3IP4 C;  2PU2 A;  5AV6 C;  5B0Z C;  3BFG A;  5BS7 C;  3AFA A;  4QD4 A;  1M18 D;  4LV1 A;  3VP0 A;  2QPN A;  3A1K A;  3NI9 A;  5CRF A;  5B24 B;  3ZHH A;  5M18 A;  3REK A;  1YU2 A;  1BH8 B;  2ZQA A;  1S32 A;  1HQ3 D;  2F2A C;  3AYW C;  1KE4 A;  4JF6 A;  4KQQ A;  4BEN A;  4K91 A;  3KUY D;  2XR0 A;  4S2N C;  1OME A;  5GLB A;  5GSU B;  1LI0 A;  1P3I A;  2UWX A;  3AZM B;  3B0C T;  3QHY A;  3UDI A;  4IBD A;  5B2J B;  1P3G D;  1PW8 A;  3MGR B;  2EFU A;  2EX6 A;  3BFE A;  3B0B A;  5GT3 A;  2Q9M A;  4ID4 A;  5B2I C;  4GD8 A;  4OJP A;  3AGE A;  2NQB D;  5CTN A;  1RGZ A;  2BG1 A;  5AVC D;  3V9R B;  3UN7 A;  1F66 A;  4KGC D;  3B3X A;  2EXB A;  1SDE A;  4UA6 A;  3NIA A;  3VP3 A;  3AV2 D;  1P3O C;  3UPO A;  3LJA A;  4H9P A;  5FDH A;  3HLB A;  3VH5 W;  3AZL D;  5GXQ D;  5AV5 A;  3X1V C;  4WU9 D;  5DNN B;  3X1T D;  1FR6 A;  2JC7 A;  4ZBJ B;  4KQO A;  5B40 A;  1Q9C A;  5GT0 C;  2WGI A;  1ES4 A;  3HLW A;  5AVB C;  5B2I B;  1K55 A;  5GLC A;  4FSF A;  1JWZ A;  3HUO A;  3A6N D;  4ZAM A;  3I7J A;  1N4O A;  4WMC A;  3EQU A;  2HDQ A;  3AN2 A;  2HUE B;  3NQJ A;  5CP6 B;  1BLS A;  1HZO A;  3UTB C;  1EQZ B;  3WAA C;  2FFF B;  4PPR A;  3LJA C;  4B88 A;  5GHY A;  3WRZ A;  2ZQ9 A;  4G92 C;  2A49 A;  5F82 A;  1WYC A;  5F83 A;  3C1C C;  4BD0 A;  3X1V B;  3V39 A;  1M19 A;  3OC2 A;  1ES2 A;  4YM6 D;  1YQS A;  4J8X D;  4Y7P A;  3WS5 A;  4QHC A;  4ZBE A;  2Y2G A;  1KX3 D;  2GDN A;  4S2M A;  5E2H A;  4WZ5 C;  1KX5 C;  3FWL A;  5B33 D;  5B0Y C;  2Y4A A;  4M6B A;  4WNN A;  5BT1 D;  3REK D;  1ZKJ A;  5F99 C;  4BL2 A;  4J8V C;  2I72 A;  3KWQ A;  1S0W A;  4IBC A;  3G35 A;  4C75 A;  5CHU A;  4PM7 A;  5B1M A;  4H9N A;  2P74 A;  4WU9 A;  2OV5 A;  4OH0 A;  5B1L C;  4X6T A;  4EBL A;  5G49 B;  5AV5 D;  4R8P C;  3AZL A;  3A6N B;  4Z5T C;  5B2J A;  2XD5 A;  4ZJ1 A;  3ZG8 B;  1M19 B;  4IVK A;  3UT9 D;  4GNU A;  4J8U D;  5FQ9 A;  4H9S C;  3AZF B;  5DF8 A;  3WTP B;  1ONG A;  5CEC A;  3AZK C;  5AVC A;  3OZH A;  3W8K A;  2WZZ A;  5EE8 A;  1PI5 A;  1I2S A;  1P3A C;  2ZY3 A;  1MPL A;  3IQA A;  2IWC A;  1HTA A;  1HVB A;  1NZO A;  4NET A;  3REH A;  5C3I C;  4EBP A;  4EQI A;  3AZM C;  1L2S A;  4XUJ B;  1P3L C;  1IEL A;  2EFX A;  3HLF A;  3WTP D;  2H10 A;  5A93 A;  3Q07 A;  1K54 A;  3AZG C;  1RCJ A;  1DY6 A;  3LZ1 A;  4KUD A;  5EOE A;  2XEP A;  1P3P C;  2Z2M B;  3REL C;  3MGR A;  4XUX A;  2HDS A;  3AFA D;  1BLH A;  3MVD A;  4JBF A;  1WYB A;  1TVF A;  4JF5 A;  1P3A B;  1E3U A;  1H8Y A;  3WS2 A;  3LEL D;  1XKZ A;  3H0L C;  2F8N A;  3HLD A;  5B24 D;  1S32 C;  4WV4 B;  2DCF A;  3UT9 B;  3LY4 A;  3ZVW A;  3LZ0 A;  2G2U A;  4CAY B;  3G2Y A;  1ALQ A;  4NE6 A;  3B6G D;  3AGD A;  5BO0 B;  1P3I C;  1Z6F A;  3RXW A;  3BM6 A;  1H5X A;  3MGP B;  4YS3 A;  1AOI D;  3KSY A;  4N1X A;  3AZH B;  4FH2 A;  5GT3 C;  4J8X B;  1U35 A;  1J9M A;  5CP6 C;  1YLW A;  1H8Z A;  5TGF A;  3PBT A;  1K4E A;  1P3B B;  2R9W A;  4J8W B;  1Y54 A;  4LD9 A;  4PMA A;  4NK3 A;  1SDN A;  4R3J A;  1LHY A;  2ZC6 B;  3CZD A;  3IH9 A;  3R45 A;  1KX4 D;  1PZP A;  2Y55 A;  3B6F D;  1YU3 A;  4KZ4 A;  3AZE C;  4OJ6 A;  4KZ9 A;  5HAQ A;  1YM1 A;  3SH9 A;  5AV6 B;  4DE1 A;  5GLD A;  3W98 D;  3W99 D;  4JJN C;  2P9V B;  5BNX A;  4ZDX A;  4F94 A;  2WAD A;  4LD9 B;  3TU4 C;  2Y2Q A;  5AVB A;  1S6R A;  1TEM A;  4WU8 D;  3G30 A;  3AYW B;  5FI6 A;  1ZC2 A;  2RL3 A;  5B31 D;  3WAA A;  1HTZ A;  3CMZ A;  3N7W A;  4QY6 A;  3RJU A;  4P6B A;  3KWQ B;  5E43 A;  3V5M A;  1P3F A;  3M2J A;  3AZN B;  5CHL B;  3KXB B;  3MGR C;  4KHA A;  5CPJ A;  3IF5 A;  5B2I A;  4IBE A;  3AZL B;  4LG2 A;  5FQJ A;  4UUZ B;  3LY3 A;  3PBR A;  5JRG D;  5FAQ A;  2PYO A;  3MZD A;  4ZTK A;  1NYY A;  2Y59 A;  4KG5 A;  5GSU D;  5GL9 A;  5CGX A;  1N1J A;  2YFV A;  4XUJ A;  3OPH A;  3FZC A;  5B32 G;  2VGJ A;  3A3E A;  5FQK A;  2Y91 A;  2RVQ C;  1M1A C;  1VM1 A;  4HEF A;  3X1V A;  3KWQ C;  1P34 D;  3MGS D;  3REI C;  3DTM A;  1N9B A;  1IYO A;  5DTS A;  3REH B;  2BYM A;  2J9P A;  4X68 A;  1G6A A;  3IH8 A;  1P3O B;  3O88 A;  4OQI A;  1XA7 A;  3VP1 A;  3AV1 D;  1P3P B;  1RP5 A;  3FKV A;  2HPB A;  2V1Z A;  3WTP E;  1YLP A;  3WA9 B;  5JA4 A;  3G32 A;  3GSG A;  3Q7V A;  5EVI A;  1GCE A;  3MGQ C;  3GRJ A;  3X1U D;  2HIO D;  3L2A A;  3AZI D;  1P34 A;  1YLT A;  5JYO A;  2G5H C;  2DNS A;  3UO9 A;  1BH8 A;  1ZG4 A;  5HL1 A;  1HD8 A;  5AV8 C;  1DJC A;  3X1S A;  4GB7 A;  4RX3 A;  3MNN D;  5G49 A;  3EPJ A;  1TZY D;  5GSU A;  1L0D A;  3REH C;  4IED A;  3V3R A;  3RXX A;  1W7F A;  5B31 B;  3NQJ B;  4MBK A;  3AL0 C;  1PWD A;  2ZM5 A;  5FA7 A;  4QLC B;  5GT3 B;  3LEZ A;  2ZM2 A;  2XF3 A;  1ID3 B;  3PBQ A;  3KXB D;  4DDS A;  5B32 D;  3MGQ B;  1GA0 A;  3PBS A;  1ID3 D;  3VH5 T;  5CPJ B;  1KGE A;  4J8W C;  3IT9 A;  3WKJ A;  4NZ4 A;  1R4V A;  4LEN A;  3PAG A;  2WAF A;  2C5W B;  5EVI D;  2ZM8 A;  3ZFZ A;  1MWT A;  5BOH A;  3AZH D;  2ZC5 B;  3AV1 A;  5F99 B;  1AOI B;  3SS5 A;  2BLS A;  5L2F A;  3REJ C;  3W96 C;  2ZQ8 A;  2WKH A;  1KE0 A;  4OON A;  1YU4 A;  3DWK A;  3W99 B;  1YLZ A;  4NFT A;  2NZD A;  5CPI C;  5AY8 A;  1GHM A;  3OCN A;  3GQZ A;  3N6I A;  1H3O A;  1ZLA B;  3B6F B;  3LEL B;  3WS1 A;  1LL9 A;  4OPY A;  2OLU A;  1KGG A;  1K56 A;  5DNM D;  3AZN A;  4X56 A;  3AZF C;  4OPR A;  3B6G B;  4HBU A;  3AZM A;  3OPL A;  3TU4 B;  1BSG A;  1P3L B;  3HBR A;  4S2O A;  5AV6 A;  4LCL A;  3WKJ D;  5CPK B;  1FCN A;  3H0R C;  1O07 A;  4UHU A;  1TDL A;  4OUI A;  4DRA A;  4KUD C;  2IWB A;  4N1H A;  4Z9Q A;  3BRM A;  2J9O A;  3M6B A;  5DNN D;  3X1T B;  4JJN A;  3AFA B;  3C7V A;  1FCO A;  4GN2 A;  2H0T A;  1YT4 A;  3TU4 A;  1P3B A;  3TSG A;  2PYO B;  4YIN A;  3P98 A;  3AV2 B;  3W97 D;  3DWZ A;  4WU8 A;  3W97 C;  3AZN D;  4Y0U A;  4GOG A;  4Y0O A;  5DTT A;  3IF6 C;  4EWF A;  1ERM A;  1P3I B;  1ERQ A;  1DJA A;  2NZD D;  1BTL A;  4X23 C;  5BO0 A;  1JTG A;  3V3S A;  1EI5 A;  1S32 B;  4KUD D;  2VQR A;  4MEZ A;  3LZ1 D;  4WU8 B;  2Y2J A;  3Q1F A;  3WTP A;  4WYY A;  1KX5 B;  3L28 A;  4CSR B;  3AZF D;  3WKJ B;  5BS7 A;  4HBT A;  3REJ A;  4IVI A;  5B40 C;  5GT0 A;  3ZG7 B;  2X02 A;  3BEC A;  4YS3 D;  5B32 B;  5FQQ A;  5CPI D;  3O62 C;  4NZ3 A;  4A5R A;  4ZUX B;  3NQU B;  4GKU A;  3AN2 C;  4WM9 A;  3VFH A;  1AXB A;  5FAT A;  1WWS A;  5GHZ A;  1ES3 A;  3OCL A;  3W96 D;  3ZVT A;  5DF7 A;  5KDM A;  1TZY A;  3VP2 A;  4Z2M G;  3MNN A;  1JVJ A;  2ZC7 A;  3UE1 A;  1E3U D;  1M19 C;  3X1S D;  1W2E A;  2WUQ A;  3N3F A;  5B1M D;  3AZJ B;  3UY6 A;  4XXR A;  2HDR A;  3ZGA B;  3A3D A;  4J8W D;  4QLC C;  1KX5 A;  3AZI B;  1W8Q A;  3NDG A;  1XP4 A;  5FI2 A;  5KSC A;  3X1U A;  1ID3 C;  1F66 C;  5B32 C;  3Q82 A;  3KXB C;  4R4S A;  3S22 A;  3Q7Z A;  4D2O A;  2JBF A;  4JXS A;  4L0L A;  5E5A A;  4HGA B;  4XZQ B;  3SH8 A;  3M2K A;  1YU0 A;  5AQA A;  4H9N B;  3FKW A;  3REH D;  1XXM A;  3O87 A;  2H5S A;  5EOO A;  4OKP A;  4GH9 A;  5FQI A;  1Q2Q A;  3W99 A;  1PI4 A;  4Z66 B;  2F8N K;  4HES A;  1MWS A;  4YM6 A;  5AV8 D;  3N8L A;  3A1I A;  5B0Z B;  3C7U A;  2Z2L B;  3SS3 A;  1NRF A;  4OP5 A;  1FQG A;  1TAF A;  4QU3 A;  3AZI C;  3PTE A;  2E8I A;  4XUJ D;  4OJO A;  1F66 B;  1NYM A;  1ZLA C;  2XGN A;  4LV2 A;  1YMX A;  5KZH A;  5CED A;  2NZD B;  3WWX A;  2WKE A;  4WMC D;  3ZNY A;  4AWL B;  4XZQ C;  1Q2P A;  3IHB A;  4DF6 A;  5DF9 A;  3WA9 D;  1P3M C;  4JF4 A;  3D4F A;  1AOI A;  4X55 A;  1KVL A;  3MGS C;  1P34 C;  5HFO A;  3KWQ D;  4WU9 B;  5AVC B;  4OQG A;  4WZ5 A;  5EEC A;  3S4X A;  3PBO A;  3MGP C;  2RVQ D;  1M1A D;  5GLA A;  4S2N A;  3W97 B;  3L29 A;  5AV5 B;  4DRT A;  4H9R A;  5B33 A;  2Y2M A;  3QNB A;  3LEL A;  2A3U A;  3IWQ A;  5A90 A;  5B1M B;  2XDM A;  2YFW B;  2IOU A;  4OQ0 A;  2HDU A;  2NQB A;  5AV8 B;  1XGJ A;  4RA7 A;  3MGR D;  5AV9 C;  1P3M B;  3IF6 B;  3GTC A;  4FCF A;  4QB8 A;  4QLC A;  1KX4 A;  3X1S B;  1ZG6 A;  4ZUX D;  3FYZ A;  5B31 C;  4PM5 A;  4X23 B;  1O7E A;  4E45 A;  4UUZ A;  1W79 A;  5EVL A;  1HQ3 A;  3AZK A;  4WU8 C;  1M40 A;  3REJ B;  4YM6 B;  3NDE A;  4DXC A;  3IF6 A;  2BYK A;  1LL5 A;  2PBY A;  3BFC A;  3LO7 A;  3W99 C;  3NY4 A;  3W98 C;  3IHA A;  3N8R A;  5B40 B;  2YFW A;  3AZE D;  4IJE A;  5B31 G;  3A3F A;  3B0D B;  3B6F C;  3UT9 A;  3HSH A;  5CGW A;  5BNV A;  4ZUX C;  5JA4 B;  1MY8 A;  4OQH A;  5BPV A;  2Q9N A;  5AV9 D;  4XZQ A;  3NC8 A;  4EO5 B;  3GV9 A;  5GT3 D;  3FDD A;  1TDG A;  4X69 A;  3CG5 A;  1TZY B;  5B0Y A;  4BLM A;  5E5A B;  1P3I D;  2P9V A;  1SHV A;  1L0F A;  1E4D A;  1N1J B;  3VOY A;  4E44 A;  3KUY A;  3MGP D;  4ZUX A;  4J8V A;  1S32 D;  4KUD B;  3SS4 A;  2WGW B;  2QMI A;  2ZY4 A;  1SCW A;  1KDS A;  1P3M D;  4P0M A;  4KQR A;  3WA9 C;  4JKT A;  1DJB A;  5BNX B;  3AFA C;  4R8P A;  3ITA A;  1PYY A;  4XZQ D;  4N92 A;  4H9Q B;  3MKF A;  3NQU A;  2X71 A;  4AWL C;  3WS4 A;  1JFI A;  2Y2P A;  1ZLA D;  4E3I A;  5C3I B;  3AYW A;  4IBG A;  4XUJ C;  1C3B A;  3AZG D;  2V2F F;  3Q7V B;  1L0E A;  1P3G B;  2ZY2 A;  4KEN B;  4BJP A;  5KDM B;  4ZBJ C;  4EV4 A;  1M1A A;  3UDF A;  3AZE A;  1P3L D;  5D3O A;  1P3F B;  5AVB B;  5AQ9 A;  4B4X A;  4R23 A;  1M6K A;  4IJF A;  4K0W A;  1P3A D;  3LZ0 B;  1IYP A;  5HAR A;  3UTB B;  4RVA A;  3G31 A;  2FJ7 A;  2EX2 A;  3AZG A;  3AZK D;  4FD8 A;  3C1B A;  3HL9 A;  3C1C B;  5FUG A;  4OOM A;  2EX8 A;  2YFV B;  4KGC A;  5DTK A;  1F66 D;  3UT9 C;  4NZ5 A;  3TG9 A;  2Y2N A;  4G91 B;  4KZ7 A;  4QJG A;  4QLC D;  3AV1 B;  4R8P D;  3V50 A;  3KS8 A;  3O62 B;  5B1M C;  1QMF A;  3X1S C;  5B0Z A;  1M19 D;  4G92 B;  3CJM A;  3IXB A;  3P09 A;  5HAP A;  2G5I C;  3ITB A;  4J8V D;  3C1B B;  1MWU A;  1FSY A;  1BLP A;  4OJ5 A;  4UPK A;  1ONH A;  5BT1 C;  4H9Q A;  4R0Q A;  4LV0 A;  3AN2 D;  5TFQ A;  1K6S A;  5B0Y D;  3VH6 W;  5B33 C;  3GVB A;  4EUZ A;  3O62 D;  4YS3 C;  1T3U A;  3REK B;  4U0X A;  3MNN B;  3F6T A;  4OLD A;  3KFU G;  2CWE A;  1KX5 D;  4JLF A;  5B40 D;  4LCM A;  4WEL A;  1P3A A;  1KX3 C;  2ZQD A;  4WEJ A;  1KU5 A;  1M18 A;  3TOI A;  3AZE B;  3B0D C;  3EPL A;  1SKF A;  2EX9 A;  5CXW A;  4YM6 C;  3M6H A;  3VH6 T;  5AV9 A;  4DDY A;  3IXH A;  3W4Q A;  1KVM A;  2HP9 A;  3L27 A;  3LJA D;  3LZ1 C;  5B1L B;  2FFY A;  4KZB A;  5A91 A;  2WYX A;  2PU4 A;  4Z2M H;  3N8S A;  1P3K B;  4S2J A;  4X23 D;  2NZD C;  4E3K A;  5FUG B;  5F99 A;  3VFF A;  3SH7 A;  3MBZ A;  1BZA A;  5GT0 D;  3AZK B;  5AV8 A;  5BNV B;  1P3M A;  4KZ5 A;  4OOL A;  1P3G A;  5CER A;  3AZN C;  4WU9 C;  2ZD8 A;  1K55 C;  3MGP A;  3AZL C;  1XX2 A;  1U60 A;  3HLE A;  4KHA B;  5U47 A;  3REL B;  2XD1 A;  1P3O D;  5DNN C;  1FCM A;  3ZCZ A;  4WZS B;  4XUZ A;  1ESU A;  5E2F A;  3VMA A;  1P34 B;  5AVC C;  1MKI A;  5JYP A;  3WKJ C;  4S2K A;  1YLY A;  3O86 A;  2HUE C;  1P3G C;  4O7D A;  2CC1 A;  1KDW A;  2Y2L A;  1WE4 A;  1FOF A;  5DNM C;  3LJA B;  3NBL A;  3ZG0 A;  3KUY C;  3BLM A;  4X53 A;  3E2L A;  1PIO A;  3H0M C;  1BUE A;  5CPK A;  3VSK A;  1I5Q A;  5CPI A;  2WKI A;  1P3P A;  4IBK A;  1W5D A;  3WA9 A;  3UE3 A;  3REJ D;  3C4P A;  3W98 B;  3MZE A;  5AV6 D;  3AZH C;  4PM9 A;  5B1L A;  5GHX A;  5KSH A;  5EVI C;  1EQZ A;  2VGK A;  1IKG A;  5DNM A;  2WGV A;  4MLL A;  1VQQ A;  3UPN A;  4R4R A;  4HGA C;  1QME A;  1K38 A;  2LY8 A;  2ZQC A;  4ZJ2 A;  4UA7 A;  4QNL A;  3UNW A;  1FR1 A;  5M19 A;  1IKI A;  1P3K A;  4S2P A;  2ARO B;  4CPK A;  2FJ7 C;  2ARO D;  1TZY C;  3W97 A;  3MNN C;  3HON A;  4LD9 C;  5EPH A;  4H9P B;  3C1B C;  2OSU A;  1P3B D;  3IXG A;  4IBX A;  2BYM B;  4NE3 A;  3GR2 A;  5DNN A;  2Y2O A;  4UAA A;  4J8W A;  4U0T A;  5DVA A;  3ZG5 A;  3V9R A;  1W8Y A;  4GHA A;  2HIO C;  3X1U C;  5TR7 A;  5E2G A;  3MKE A;  3L26 A;  3MGQ D;  3HUN A;  4CJN A;  1B6W A;  4Q8I A;  1CI9 A;  3AV1 C;  1P3K C;  3MGS B;  1B67 A;  3NCK A;  3W96 A;  3G4P A;  5I94 A;  5F1G A;  3WS0 A;  5HW3 A;  3A3I A;  3MXR A;  1ES5 A;  3REI D;  4E3O A;  3PBN A;  4KG2 A;  3B0C W;  2HP5 A;  2W8S A;  3VP4 A;  2XH9 A;  4WBG A;  3VSL A;  5CPK C;  4E3J A;  4DE0 A;  4WEK A;  1P3F C;  3HLG A;  3AZI A;  4PM8 A;  3X1U B;  1MXO A;  1M1A B;  5GSU C;  3IWO A;  4KGC B;  3GMW A;  5JRG C;  2WK0 A;  3REI B;  5B2J C;  5A92 A;  4H9O A;  3VH5 A;  3UDX A;  3MZF A;  1TAF B;  5E5A D;  4C3Q A;  3R45 B;  2PYO C;  2L5A A;  1E25 A;  3EQV A;  2V20 A;  2Y2H A;  4H9S A;  3UTB A;  1CI8 A;  5FI7 A;  1EWZ A;  4DQY B;  4JXG A;  1GHP A;  1GA9 A;  4BQM A;  2Y2K A;  3C1C A;  1ID3 A;  1M18 B;  1JWV A;  4OPQ A;  2JE5 A;  5B32 A;  3REI A;  1IYS A;  3KUY B;  2F8N B;  4E6W A;  4Z66 A;  4OP8 A;  3E2K A;  5AY8 B;  3TU4 D;  4Z66 D;  2XLN A;  3MXS A;  1K54 C;  1PWG A;  4JJN D;  4NE5 A;  5HX9 A;  1PWC A;  4E3N A;  3P5J B;  3AZJ A;  3ISG A;  4YS3 B;  2WGW A;  1FSW A;  1KX4 C;  4IBR A;  4NZ1 A;  2HIO A;  1KX3 B;  5EVI B;  3BFD A;  3MVD C;  3AZF A;  4P87 A;  5CPJ C;  3W96 B;  3VH6 A;  3HRE A;  2J8P A;  4NYU A;  1MWR A;  4Z5T A;  2DF4 C;  3N4I A;  5CP6 D;  4MBH A;  5AQ7 A;  1YLJ A;  3UTA D;  2CV5 A;  1ESI A;  1AOI C;  3W98 A;  2XFS A;  3MGS A;  5AY8 D;  3DW0 A;  4OVD A;  4KG6 A;  3AZJ C;  4P85 A;  3UTA A;  1KE3 A;  2JSS A;  3B6G C;  4BL3 A;  5B0Y B;  1U35 C;  5CPI B;  3LZ1 B;  3W4P A;  3L25 A;  2C6W B;  4H8R A;  1G68 A;  4QY5 A;  5B24 C;  1EQZ D;  2ZM0 A;  2NQB B;  1K57 A;  3AZH A;  3LEL C;  1BT5 A;  1BH9 B;  3ZNT A;  2G2W A;  1IEM A;  3G34 A;  4GDN A;  4KZA A;  4GHL A;  5EUA A;  5FAS A;  2WAE A;  3REL D;  2CV5 C;  2BYK B;  4R8P B;  1NZU A;  1XGI A;  1P3P D;  4GD6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...