2Y2IA

Penicillin-binding protein 1b (pbp-1b) in complex with an alkyl boronate (za3)
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
487
structure length
467
Chain Sequence
ISEITYSDGTVIASIDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTGQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PENICILLIN-BINDING PROTEIN 1B
publication title Structure-Guided Design of Cell Wall Biosynthesis Inhibitors that Overcome Beta-Lactam Resistance in Staphylococcus Aureus (Mrsa).
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 159
structure length 467
sequence length 487
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2y2iA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2y2iA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2y2iA02
3IXDA 3NDEA 2ZQCA 4OVDA 5CERA 4EV4A 2XEPA 3M6HA 4K91A 4P85A 3ITBA 1ZG4A 3G34A 1SCWA 3IT9A 1ESUA 1YLWA 4UA9A 3UDXA 3S4XA 3WRZA 4R0QA 4S2NC 2EFUA 1VQQA 1YMSA 1FCMA 3IH9A 4KQRA 1BLCA 5CHUA 2WADA 5M18A 2WZXA 5DF7A 1YQSA 4BLMA 1PIOA 4S2MA 3MKEA 5JYPA 4N1HA 5E2HA 3A3FA 4PMAA 3PBRA 1EROA 1ESIA 1E3UA 1K4EA 3O86A 1ONHA 1DJBA 1MY8A 2C5WB 4IVKA 5GHXA 3OPRA 2HDSA 2Y2QA 1KE3A 4RX3A 1BLHA 4KZ9A 3WS2A 1KGFA 4GN2A 5A90A 3BRMA 3ZNTA 3NIAA 1S6RA 3IXBA 4RA7A 1KGEA 5DTSA 3VP4A 3G4PA 3PAEA 3PBSA 3S1YA 3BFDA 3W4OA 4OLDA 1PI5A 4IBRA 3FYZA 5EE8A 4E6XA 3C4PA 4KQOA 1ZC2A 4KZAA 4X69A 1SKFA 5FI2A 1MPLA 1JTGA 3BYDA 4DDSA 4EWFA 4C3QA 3UPNA 3PBTA 4X6TA 5FASA 4WZ5C 3DTMA 3MZDA 4FCFA 5HARA 3ZCZA 3O88A 3A3DA 4B88A 1IYOA 2ZM0A 3NDGA 5TFQA 1JWZA 2IWDA 3ZG9B 4E3OA 2X02A 2XK1A 4PM8A 1NJ4A 3UE0A 3IHBA 4S2OA 4BENA 2Y2PA 1L0GA 4WMCA 4MBHA 4YFMA 1YLPA 2J7VA 1JWPA 2Y2NA 3FV7A 2XD1A 3UN7A 4CJNA 3D4FA 1FR1A 4XUXA 4DE0A 2XFTA 1TDLA 2ZM2A 3OPHA 3ZHHA 2Z2LB 5FI7A 3RXXA 4Y0UA 4OP5A 2XD5A 1BUEA 1O07A 2H0TA 3PAGA 4F94A 3VSKA 5E2EA 2Y55A 5DTKA 4H8RA 5CGSA 1L0DA 2WYXA 4ZBEA 1GA0A 3N4IA 4LV0A 4RVAA 2G2WA 5FQ9A 4E3JA 1QMFA 5GHYA 3MKFA 3AGEA 4S2LA 1CI9A 3O3VA 3CG5A 3A3IA 4S2PA 2X71A 4B4ZA 4DRTA 2ZQ7A 1XA1A 5FQQA 2WAFA 3A3JA 2ZC4B 5CECA 1J9MA 4OH0A 1PYYA 3Q1FA 4S2KA 4B4XA 4BJPA 4JXGA 1E4DA 3G32A 2HP9A 3PBOA 3IWIA 3ZGAB 3IF5A 2ZC3B 4KZ8A 4JKTA 4PM9A 1W5DA 3G31A 5EVLA 4P0MA 3HLWA 3N8SA 4X56A 3HLFA 1PI4A 1N4OA 4KZ4A 2RCXA 1RP5A 5HFOA 1XX2A 1LI0A 5CEBA 4ZJ2A 2WKEA 1TDGA 4FH4A 2QPNA 5U47A 4C75A 5L2FA 1YLJA 1ALQA 4KZ7A 2R9WA 4N9LA 2XLNA 3Q7ZA 3ZG0A 3A3EA 4OQ0A 1XPBA 3WWXA 3OPLA 2EX6A 3CMZA 5FQMA 3ZNYA 1NYMA 4GDNA 1GHIA 3ZVWA 1QMEA 2DRWA 5DF9A 3BFFA 4JF5A 3AGFA 4NK3A 1EWZA 4HBUA 1FCNA 4ZDXA 4ZAMA 3HLCA 1FSWA 2HDQA 1ZG6A 3NBLA 4P87A 4QY5A 5GHZA 5EOEA 3TOIA 4OPRA 1JVJA 4OONA 1AXBA 2BLSA 1W8YA 1YLZA 4FH2A 1KVLA 4WEKA 2HP6A 2WGWA 3BECA 4LENA 5EPHA 5FATA 3HVFA 4EBLA 4GZBA 3G35A 2JBFA 2JCHA 1Z6FA 2WKIA 3Q7VB 4IBXA 4WM9A 3RXWA 1XXMA 2ZC6B 4R4SA 1KE4A 1LLBA 1MWUA 4MEZA 3HLEA 4MBFA 1DY6A 3BLMA 1W7FA 1G68A 4JLFA 1BZAA 3BLSA 4KENB 5M1AA 4LCMA 3GSGA 4K0WA 5GLDA 3TG9A 5KSHA 3M6BA 4OPYA 4BD0A 4O7DA 3HLDA 4WZ4A 2OLUA 4JF4A 1NRFA 2ZC7A 2H10A 1KE0A 4A5RA 2G2UA 3FKWA 4KG2A 4UHUA 3SOIA 5TR7A 3ZDJA 4BL2A 1I2WA 4GD6A 3V3SA 3GMWA 5GLAA 3UDIA 2Z2MB 4EQIA 2ZJ9A 3AGDA 3Q07A 2OV5A 2ZQ9A 1KDSA 5AQAA 3WS1A 4DE1A 4Q8IA 1SHVA 3HLGA 1K56A 4WELA 3RJUA 3W4PA 1K25A 1C3BA 3C5AA 3NCKA 4ZJ1A 4UAAA 1W8QA 2H0YA 4R23A 5EVIA 4JXVA 5HAQA 1ONGA 5HL1A 1FQGA 2EXBA 1E3UD 5FAQA 3VFHA 3OCLA 4OOYA 2IWBA 2Y2MA 1OMEA 1K38A 4Z9QA 2JE5A 2Y2IA 2EX2A 5GL9A 3ISGA 3LY3A 3CZDA 1XGIA 3IHAA 3C7VA 3M2JA 4OPQA 4S2IA 5HAIA 1K55A 1KVMA 3MXRA 3V3RA 5HAPA 1K54A 1MWTA 3W8KA 3ZG8B 2I72A 3VSLA 3VP3A 1FOFA 1HVBA 5I94A 2HDUA 5F82A 3N6IA 4NETA 3O87A 3N8RA 1S0WA 2XFSA 5KZHA 4OQIA 4WBGA 4EBNA 2HDRA 1GA9A 1GHMA 4OOLA 3DWZA 3UNWA 4U3TA 4R1GA 5CHMA 1Y54A 3S22A 3P09A 3N8LA 3GQZA 1M6KA 3MFDA 2V1ZA 5DF8A 2Y2HA 4U0XA 1K56D 1IKIA 3EQVA 1LL5A 5F1GA 3VP0A 1EI5A 3I7JA 3IXGA 3NY4A 3VMAA 3ZFZA 5BOHA 4MLLA 3HBRA 1PWGA 3N7WA 4RYEA 3LY4A 5EOOA 5HX9A 5F1FA 3OC2A 1NY0A 1PWDA 2WGVA 2FFYA 4ZTKA 2VGKA 1K4FA 2ZC5B 3FZCA 3IF6A 3P98A 3QNCA 4HESA 1RGZA 1KDWA 2A3UA 2HPBA 2P9VB 2ZQDA 2DNSA 5AQ7A 3GTCA 4OQGA 4WMCD 3VOZA 1JWVA 2RL3A 4PPRA 3MBZA 3PTEA 1BSGA 3UY6A 3M2KA 3V39A 3ZG5A 1CEGA 4ID4A 2PU4A 1BULA 2J9PA 4KG5A 1RGYA 3VFFA 1BLPA 1Q2QA 3QHYA 4FSFA 5EVIC 1TEMA 3GRJA 3UDFA 2XDMA 2XQZA 1IYPA 3G2YA 4QB8A 5CHJA 3C4OA 2ZQ8A 2EX8A 2DCFA 4E3NA 4QHCA 5AQBA 1K55C 4E3KA 1HTZA 1U60A 2H5SA 2Y91A 5DVAA 5D3OA 3SS5A 3VOYA 4DE2A 4JXSA 5GLCA 3E2LA 4PM6A 3V5MA 3Q81A 1H8YA 2Y2OA 4RX2A 4QD4A 4EBPA 1H8ZA 2V20A 4JBFA 4MBKA 1SDNA 3PBNA 1WYBA 3OZHA 1TVFA 4OPZA 3WS0A 4D2OA 4YINA 2EXAA 1H5XA 2XGNA 4KZ6A 1NZUA 4GOGA 1GHPA 2JC7A 1L2SA 5CTNA 4L0LA 1E25A 2XR0A 4DE3A 4WZ5A 5KMWA 2IWCA 4QY6A 5KSCA 3Q7VA 3QNBA 4E3MA 3IF6C 3OPPA 3PBQA 3E2KA 4K0XA 3ZG7B 4GDBA 2ZD8A 4CPKA 3Q82A 2V2FF 4U0TA 3UE3A 1N9BA 1XA7A 3BM6A 4KG6A 4DXCA 3FWLA 2J8YA 1IYSA 4Y0OA 1MXOA 4QU3A 1LI9A 4E6WA 1RCJA 1K6SA 1HZOA 4N1XA 1DJAA 1L0EA 1WYCA 3HUMA 2CC1A 4LCLA 3LO7A 4OKPA 1MBLA 3BFEA 4DF6A 1IKGA 1MWRA 4DDYA 1XKZA 3IXHA 5FQIA 2Y2LA 5JYOA 3IQAA 2Q9MA 3BFGA 1JTDA 2WKHA 3WS5A 3HUOA 5M19A 4BQMA 4GNUA 4KZ5A 4C6YA 3OCNA 4XUZA 1K6RA 1PZOA 4E3IA 1ES5A 1FR6A 1PW8A 5CXWA 4XXRA 1ES2A 4UA7A 1BTLA 3MZFA 3WRTA 1BLSA 1K57A 4Y7PA 5CGWA 3DWKA 4OOMA 4EUZA 4BL3A 2XF3A 4IEDA 4OQHA 2X01A 2Y2JA 1CEFA 1IEMA 1FCOA 2WUQA 5A92A 1M40A 4GB7A 5E2FA 2Y2KA 2ZM8A 5FI6A 3JYIA 3MZEA 5EVIB 4KZBA 5GLBA 5A93A 3NI9A 1XGJA 2R9XA 3FKVA 4ZJ3A 5F83A 3SH9A 3DW0A 2Q9NA 1NXYA 1ES3A 2XH9A 1YLYA 5FAPA 1W79A 5G18A 3UE1A 2WZZA 3UPPA 4X55A 4LV2A 5CGXA 3IWOA 2B5RA 3UPOA 2QZ6A 1HD8A 3GV9A 3ZVTA 4S2JA 4JF6A 3V50A 4PM5A 3HREA 1I2SA 3GR2A 4IVIA 5EUAA 4DKIA 1ERMA 4DXBA 4KQQA 1G6AA 5FQKA 4HEFA 1SDEA 3G30A 4X53A 4X68A 4JPMA 1LL9A 4P6BA 5E2GA 2Y4AA 4LV1A 5TGFA 5IHVA 4WEJA 1IELA 2EFXA 4E3LA 1XP4A 3W4QA 3EQUA 3BEBA 5EVID 3HL9A 3GVBA 2OLVA 3B3XA 4M3KA 4Y0TA 2Y2GA 1NZOA 1Q2PA 1BT5A 2C6WB 1DJCA 1ZKJA 2PU2A 2VGJA 1NYYA 1WE4A 5E43A 5FQJA 5CEDA 2UWXA 4S2NA 2ZMAA 1I5QA 1YM1A 1K57C 1GCEA 1PZPA 2P9VA 2QMIA 4GKUA 4HBTA 4R3JA 5FAOA 3IF6B 4N9KA 4UA6A 5FSRA 1KGGA 3VP1A 2OSUA 4OP8A 4N92A 1MKIA 3UO9A 3BFCA 4R3BA 1YT4A 1ERQA 5A91A 1FSYA 3SS4A 4QJGA 3LEZA 3VP2A 1L0FA 3G2ZA 1PWCA 2P74A 4MNRA 4PM7A 5HW3A 5J8XA 1LHYA 4FD8A 1K54C 1ES4A 5EECA 1IYQA 3NC8A 2A49A 2E8IA 3C7UA 3WS4A 2PBYA 3MXSA 2WAEA 3ITAA 4LV3A 2EX9A 1CK3A 2J9OA 2WGIA 3SH7A 3TSGA 3CJMA 3IWQA 2GDNA 4KZ3A 3IH8A 3LCEA 5AQ9A 1O7EA 4JXWA 2FFFB 5DTTA 2ZQAA 4WYYA 2ZLYA 2Y59A 5CRFA 1VM1A 2BG1A 4OLGA 4R4RA 4GD8A 1PW1A 3HUNA 4BD1A 2WK0A 5FA7A 2HP5A 3HLBA 1YMXA 3SS3A 2WGWB 5FDHA 1YLTA 1CI8A 3SH8A 5CTMA 1MWSA
chains in the Genus database with same CATH superfamily
3IXDA 3C1BB 2AROC 1KX4B 1ZLAD 1ZG4A 4HJ3A 1P3FB 1ESUA 1YLWA 3WRZA 3AFAD 3KXBC 4LRZE 5AV5D 1FCMA 5JRGD 3A6NB 5CHUA 5DF7A 1NLZA 4TX8A 5J3WA 3O62D 1D7EA 1PIOA 3X1SC 5JYPA 5E2HA 4PMAA 1EROA 1ESIA 4WU8A 1M1AD 1GPFA 1EW0A 3O86A 4KUOA 5HDCA 1DJBA 1P3IB 4IVKA 5GHXA 5AV5C 5JRGC 4KUDB 2W1TB 3RELD 3O62C 3MNND 3QP8A 1BLHA 3WS2A 1KGFA 3BRMA 3ZNTA 4R8PB 4RA7A 1DP8A 5DTSA 1M1AC 3T1QB 2V1AA 2VGLM 3A0RA 3G4PA 3PAEA 3S1YA 2NUPC 1PI5A 3RELC 3MNNC 4JGQA 3QP5A 1P3KD 1Y28A 1MPLA 4DDSA 5B2IB 2FN2A 5G49A 1BH9B 3IP4C 3AZHB 3H9WA 3MGRB 2XSSA 2ZM0A 3ZG9B 4PM8A 1Y4OA 2V5OA 1XJ4A 2JKRM 1HQ3D 3UE0A 3GDIA 4YFMA 4MBHA 3W2ZA 1JFIA 1SKOA 4D60A 2IO5B 1FILA 3FV7A 2XD1A 5AVBD 5EM1A 4CJNA 1P3GD 4XUXA 1DRMA 3CUEA 2XFTA 4LLOB 4UUZA 2VV7A 5AV9D 3AZMB 3WTPD 2HUEB 4Y0UA 5DNNC 1JNUA 2W3FA 2XD5A 1BUEA 4CSRA 1HLUP 4HP4A 4O8GA 4IUKA 4CAYA 4NYYA 5DTKA 5AVBC 1L0DA 4ZBEA 1GA0A 4E3JA 5GHYA 4H6JB 5HD5A 2NZDB 5AV9C 5B1MD 5CPJA 4YOFA 4ZUXD 5CHLB 4HMDA 2A2LA 2WAFA 3REJA 3A3JA 2ZC4B 2AROB 3AZFC 1J9MA 4S2KA 3NOUC 4B4XA 4R38A 2CV5D 3KXBB 4I3IA 3IWIA 4H9PA 2ZC3B 3JPUA 4ZUXC 3X1SB 2EWWA 3G31A 3NQUB 3W98A 2QKPA 3HLWA 1PI4A 5BS7C 1N4OA 3IX4A 4KZ4A 1RP5A 3TJZC 5TBMB 3AZND 2CV5C 4J8VD 1KX3D 4ZJ2A 5AV5B 1TDGA 5JRGB 5L2FA 3B6FA 3O62B 3ICYA 3ZG0A 4ZBJC 4QPRA 4IBJA 4Y15A 1M1AB 1GHIA 3AZNC 4JF5A 1KX3C 4OUIA 4GW9A 4QLCA 4HBUA 4MN6A 4Y2FA 3BQAA 4Z2MH 1FSWA 3NBLA 3TOIA 5GHZA 3RELB 5EOEA 3MNNB 4LG2A 4OPRA 1JVJA 3FDDA 5FATA 1S67L 3Q7VB 1Z6FA 2XRNA 1KX4A 4HQAA 1XXMA 3A0SA 3AZIC 5AY8C 3S7QA 2OAQ1 1P3FA 3AV1A 4KGCC 1DY6A 1W7FA 3QP4A 4JLFA 3BLSA 3AZEC 5M1AA 5GLDA 3TG9A 3HJKA 3M6BA 5B1LC 2E8JA 4O7DA 3K2NA 2W0NA 2Y8HA 5DNNB 1P3IA 1DP6A 1KE0A 2H10A 4PKYA 5DNMC 5AVFA 1PDCA 4KG2A 1UR8A 5L07A 4KUDA 4UHUA 2W1TA 3SOIA 3ZDJA 3EPJA 5AVBB 3LI9A 3LELC 1N9LA 4R8PA 3N3FA 5AV9B 2ZJ9A 1ZHHB 3Q07A 5LBRA 3PXPA 1S32D 4CQHA 1KDSA 5AQAA 3WS1A 2B02A 2XROA 4Q8IA 3MQOA 4WELA 3RJUA 3AZFB 1K25A 4ZJ1A 4NZ4A 4UAAA 1W8QA 1H3QA 1S4RA 2H0YA 5B2IA 5EVIA 4Z1WA 4IBIA 3VFHA 1S4SA 1S32C 1TAFB 1CF0A 4ZUXB 5B2JD 3WD2A 1K38A 4Z9QA 3T4OA 2JE5A 2Y2IA 3LY3A 2F8NG 3CZDA 3IHAA 3C7VA 5F68A 5HAIA 1H0MA 5BO0A 1KVMA 3MXRA 1P3OC 1K54A 2CV5B 1MWTA 5B0YD 1EQZD 4CLCE 1FOFA 1HVBA 3N6IA 3UB5P 3O87A 3NECA 4ZBJB 3AZMA 2HDRA 2R78A 4HIAA 4EXOA 5HSQA 3W96D 3DWZA 1W1YA 2FH5A 3AZNB 2VLGA 3F1NB 4J8UD 1KX3B 1EQZC 1P3AD 2V1ZA 3K3DA 4U0XA 1IKIA 5KSCA 5B31G 3I7JA 4PHTA 5EOOA 2NZDA 3H7WB 3T4KA 2FFYA 3W96C 5B33D 3IF6A 4HESA 3P98A 2A3UA 1KDWA 1P0ZA 2P9VB 3CPTB 2DNSA 3VOZA 1SZVA 1P3AC 3C2WA 4MN7A 4JGRA 2VJWA 3AZIB 5AY8B 3UY6A 3NOTC 4B9OA 4KGCB 3ZG5A 3UTBA 3AZEB 5B33C 2KX6A 3LIEA 3GRJA 3UDFA 2XDMA 3MGSC 1W63Q 3NQUA 5B1LB 1ZLAA 3AN2D 4WNNB 4WLAA 1IYPA 5BNXB 4Z2GA 3AFAA 2EX8A 5AQBA 5AV5A 5DNMB 2D49A 5JRGA 4WJ3C 2H5SA 5DVAA 3SS5A 4MB5A 4JXSA 3O62A 1PNEA 1H3OB 3REID 3LELB 4H9SA 3VE3A 3T4SA 1M18D 1M1AA 1NRJA 4ESPA 4EBPA 5GT0A 2WKPA 3PBNA 4D2OA 4YINA 3REHD 3RELA 3MNNA 1H5XA 2XGNA 4J8WD 3REIC 3IBJA 2OAP1 2ZY3A 4L0LA 1M18C 2XR0A 2EA9A 3KO6A 2IWCA 3BW6A 4QY6A 4EETB 3Q7VA 1S32B 3QNBA 4E3MA 2V2FF 3REHC 3UE3A 3BM6A 4J8WC 1P3KA 3IS2A 2J8YA 1WA9A 3MR0A 1P3OB 3EEHA 4E6WA 3NOPC 3HUMA 1CK7A 4LCLA 1MBLA 4DF6A 1MWRA 5B2JB 2JN7A 3IXHA 2Y2LA 5DJTA 3WS5A 1HQ3A 5M19A 2LB5A 4GNUA 4UQIS 1EQZB 5AVBA 1P3GA 1FR6A 1A0KA 1W1PA 5AV9A 3WTPA 2RVQD 1BTLA 3W96B 5CGWA 3DWKA 1YSPA 3LZ1D 1GXDA 1T1AA 4IEDA 4BL3A 1CEFA 1P3AB 3C1CC 1FCOA 2WUQA 1UR9A 3E98A 5B1MA 2ZM8A 5B33B 4NE3A 5A93A 3OLOA 3LZ1C 2ACGA 3MGSB 3DW0A 4DJ3A 1ES3A 5BS7A 1YLYA 1P3BC 1W79A 3UE1A 2WZZA 4X55A 1YU0A 2ZY4A 2B5RA 3ZVTA 4S2JA 3V50A 2MJ6A 5CP6D 1I2SA 5J7EA 3KWQD 4DXBA 4KQQA 1F66A 3G30A 2GX5A 3HJIA 3AZNA 2Y4AA 4LV1A 5TGFA 2L5AA 1TZYC 4J8VA 1KX3A 1IELA 4HJ4A 4E3LA 5CPID 5CP6C 2OLVA 3B3XA 3UE6A 4UQIM 3REIB 1OTEA 1ZKJA 3MGQC 1M18B 2VGJA 3S7OA 5CEDA 2M7UA 2EWVA 2UWXA 4FUWA 2V9AA 4Z66D 1PZPA 2P9VA 5FAOA 3VP1A 5CPIC 4UA6A 4H9RB 3M7PA 4OP8A 3UO9A 3REHB 4R3BA 4J8WB 4QJGA 2F8NA 5KDMB 1L0FA 3KYQA 5J8XA 2I9VA 4FD8A 5EECA 1IYQA 4HI4A 2A49A 1YKDA 3AZJC 5BNXA 3U2AA 4L9EA 2B18A 2GJ3A 2ZM5A 3EPKA 1BFMA 4LV3A 1CK3A 3SH7A 3LFVA 1ODVA 2ZMFA 3IWQA 3IH8A 1H3OA 2VEAA 4JXWA 3AZKD 1NWZA 1LL8A 2ZMVA 3CLOA 2BG1A 4GD8A 1PW1A 2YKFA 4CLCD 4NKPA 5FA7A 5G4ZA 2HP5A 3SS3A 3AZKC 3C1CB 3LZ0D 1CI8A 3B0CW 5FL3A 5CTMA 3NDEA 2ZQCA 4OVDA 1MC0A 5B40D 4P85A 3ITBA 3G34A 3F6TA 3IT9A 1S32A 2V1BA 2Z6DA 3S4XA 3UDXA 3LZ1B 2KOIA 4EEUA 1VQQA 2WADA 1YQSA 1P3BB 4N1HA 1H0IA 3TW8A 3PBRA 5B40C 2INWA 1ONHA 1TF1A 1P9RA 2IOUA 3EG5B 2HDSA 5B2JA 3OPRA 2Y2QA 2BYKB 1KE3A 4RX3A 5FEFA 4KZ9A 4GN2A 1WWIA 1TZYB 5B0YA 1EQZA 3IXBA 5CP6B 1EAKA 3BFDA 3A6ND 1OTBA 4IBRA 3FYZA 4FTXA 5EE8A 4HJ6A 3MGQB 4KZAA 4X69A 4J8UA 3BYDA 4EWFA 1P3AA 3L2AA 5CPIB 1P3PC 4NG2A 5FASA 5DFXA 3C8CA 4FCFA 1GOIA 3ZCZA 4GHAA 1NLYA 4B88A 3CHWP 5IT5A 2PYOC 1JWZA 2IWDA 2L4RA 1L3LA 4E3OA 5B33A 3H82A 3X1TC 3LR5A 2Y2PA 4G3VA 1JWPA 4WN5A 4QNLA 3AZJB 3D4FA 3AZGA 1G28A 4DE0A 1TDLA 2ZM2A 3EEAA 3OPHA 4X25A 2DMWA 3CITA 1O07A 2H0TA 4XT2B 2BTFP 4OJOA 5E2EA 3AN2A 4QWOA 3AZHD 4H8RA 5CGSA 3AL0C 2JKTI 3VH6T 2G2WA 5FQ9A 1CI9A 3O3VA 2FJ7A 5C5KA 3REIA 3AZKB 2ZQ7A 1XA1A 5FQQA 3VV4A 4IBBA 3QP6A 1M18A 4OH0A 1VETA 3WAAC 1O6IA 4BJPA 4JXGA 4H9RA 2HP9A 4CLCB 3ZGAB 2YFVB 3REHA 4J8WA 4MCWA 1W5DA 4P0MA 3D3OA 3UTAC 2OWJA 5B40B 4X56A 3R7WB 2RCXA 4HMEA 4WU9A 1LI0A 4ETXA 1YLJA 4KZ7A 4N9LA 2XLNA 2AROD 3A3EA 3WWXA 3OPLA 3CMZA 3ZNYA 1NYMA 3KXBD 2DRWA 3LJAD 4NK3A 5I5LA 5GXQC 1FCNA 2KLIA 3IBRA 4Z2HA 1ZG6A 2HDQA 4P87A 4LRXC 1OGBA 1AXBA 3TRCA 1YLZA 4NZ3A 1P3PB 4EBLA 4LENA 3FC7A 4GZBA 3G35A 3LJAC 2JCHA 2JBFA 3KSYA 4GS9A 2ZC6B 4NXFA 2PYOB 3REKD 5IS1A 2A24B 4MBFA 2H28A 3X1TB 3LZ1A 3NULA 4Z2KA 4DJ2A 4HY8A 4K0WA 5E5AD 4OPYA 4ME4A 4Z2JA 1GSWA 3REKC 4JF4A 3FKWA 4DN0A 5E5AC 3F1PB 1VB6A 5AJGA 4GD6A 4I39A 5GLAA 3UDIA 2Z2MB 3LUQA 4GJ4A 5CP6A 2OV5A 3KWQA 1E6PA 3W4PA 3CI6A 3WAAB 3UT9C 5DNND 2EXBA 1E3UD 4R6LA 2K7SA 4IJEA 5DKKA 5HDDA 3UTAB 3AYWC 2EX2A 4OPQA 4Z66A 1CXWA 4EQ1A 3E4OA 1K55A 3V3RA 5FEGA 3W8KA 1XFQA 2I72A 5I94A 1UGUA 4NETA 3W97D 3N8RA 5EV0A 2XFSA 3AZFD 1MZUA 4WBGA 3UNWA 3LEQA 4U3TA 1Y54A 4XT2A 3GQZA 1M6KA 3H0LC 1E6RA 5IU1A 5B32C 5GXQB 2Y2HA 1K56D 3EQVA 4E44A 5F1GA 3VP0A 1EI5A 3R45B 3W97C 3VMAA 4MLLA 1PWGA 3LY4A 3OC2A 1NY0A 1PWDA 2VGKA 3AZKA 3QNCA 3LYXA 1RGZA 4Z2MG 3LJAB 4WMCD 2RL3A 5DFYA 3MBZA 3PTEA 2GNXA 3B0DC 1CEGA 4CLCA 2PU4A 1BULA 3RH8B 3VFFA 4YM6D 1Q2QA 4X23D 3KSHA 3LZ0A 1STZA 4JGPA 4BWIA 2XQZA 3R7WA 4YS3D 1A7WA 3G2YA 3REKB 1GSVA 4QHCA 3O5YA 1KX5C 4YM6C 1HTZA 4DE2A 4X23C 3LICA 5E5AB 3Q81A 3AZID 2Y2OA 5AY8D 5AVCA 1H8YA 4YS3C 2KDKA 4QD4A 4RX2A 4KGCD 1H8ZA 2BYMA 4MBKA 3AZED 3IX8A 2WKRA 4IJGA 3C1BA 5B1LD 1NZUA 4GOGA 2W8SA 3DBAA 3B6GC 5BNVB 2JC7A 5CTNA 3UT9B 4EW7A 5HWWA 5DNMD 3A6NA 1KOUA 3HSHA 2ZD8A 3IX3A 3AYWB 3LELD 1XA7A 4IBGA 4KG6A 3VE4A 3FWLA 1IYSA 4Y0OA 3TE8A 1LI9A 4N1XA 1HZOA 4NXGA 1DJAA 1WYCA 1IOUA 3A1IA 4EERA 3BFEA 4WV4B 1IKGA 3IQAA 2PYRA 5B32B 3EPHA 4C6YA 1K6RA 4FOFA 1LT0A 1ES5A 3LR3A 3KSGA 4R70A 3W97B 3W99D 2F8NK 1ES2A 1IFQA 5B0ZD 3MZFA 1BLSA 3PR6A 3WRTA 3VH5T 1P3OD 3KS4A 4EUZA 1BH9A 1TS6A 4OQHA 2X01A 3AZHA 3MGRA 4IBDA 3B0DB 2PBDP 3W99C 5A92A 1M40A 4GB7A 5B0ZC 2LY8A 2W27A 1AOID 5FI6A 4KZBA 1Z2CB 1XGJA 3V9RB 3FKVA 2NQBC 4RQ9A 5F83A 3SH9A 3JVUA 5FAPA 1R4VA 3LIDA 4JJND 5CPKD 3NHQA 3UPPA 4LV2A 1KX5B 3GV9A 4YM6B 2J3WA 1AOIC 4X23B 3WKJC 4PM5A 4IVIA 3KX0X 1G6AA 5FQKA 4YS3B 2J8PA 3CAXA 4JJNC 5CPKC 1LL9A 1N9OA 4H6JA 4IUHA 1F1EA 2EFXA 1XP4A 3W4QA 3EQUA 1OT9A 3HL9A 3MGSD 3R45A 2AROA 3B6GB 5FQJA 1NYYA 2XA7S 3KXBA 1I5QA 1YM1A 1K57C 3LGOA 5FSRA 1KGGA 4GH9A 3UB9A 2OSUA 3X1SA 4N92A 1MKIA 3T4JA 2VKSA 3SS4A 3LEZA 1N9NA 1ID3D 2JKTM 5TBMA 3PYPA 3G2ZA 4PM7A 3MFXA 3MGPD 3KS8A 2G7UA 1F9IA 1ES4A 2CWEA 2E8IA 3WD3A 2PBYA 1AWIA 3VH6W 2J9OA 3TSGA 1ID3C 4J8XD 3R4KA 5L8MA 4KZ3A 1O7EA 5GT3C 3MGPC 3S7PA 4WYYA 2ZLYA 3X1VD 2Y59A 4R4RA 4KHAB 1WWSA 3HUNA 4J8XC 3HLBA 1ZTUA 1YLTA 3SH8A 2PD7A 3NQJB 3W99B 3X1VC 5CERA 3M6HA 4K91A 5JA4B 5B0ZB 4H9OB 4WUJA 1SCWA 5AVEA 4UA9A 3FPVA 4S2NC 3RTYA 2EFUA 2XA7M 1YMSA 2NUTC 2NQBB 3IH9A 1BLCA 2ZOHA 4KQRA 5M18A 2WZXA 3P7NA 3MKEA 3KUYC 3A3FA 1P3LD 5B24D 5DNNA 4DRAA 1E3UA 1BH8B 1AOIB 1MY8A 3WKJB 3H0MC 2PR5A 1OJGA 5BPVA 2ZL1B 3C1CD 3JVVA 4GLQA 4JJNB 5CPKB 3LIFA 4LPZA 5A90A 1P3LC 4I3JA 3NIAA 1S6RA 5B24C 4HHDA 3T1XA 5MC7A 1P34C 1ED7A 2BASA 3PBSA 4H9QB 3WX7A 4OLDA 3AZFA 1P3BD 5F5YA 1ZC2A 1SKFA 3PBTA 4X6TA 4WZ5C 1TAFA 3FKEA 3DTMA 4ZUXA 3O88A 3A3DA 1IYOA 3NDGA 3SW1A 2XK1A 2CV5A 1TZYD 4S2OA 4BENA 4WMCA 1YLPA 1LSWA 2Y2NA 1XFNA 3UN7A 3L28A 4HGAC 2J3TD 2Z2LB 3MGQD 1YSQA 1ID3B 3RXXA 4X23A 3F1NA 3C38A 5GT3B 3MGPB 3PAGA 4L9GA 2O9BA 3VSKA 3T12B 4YS3A 4UEYA 3N4IA 3H7WA 2J3TC 4LV0A 1N1JB 4H9NB 1GSXA 3MKFA 4S2LA 4J8XB 3CG5A 3CPTA 3A3IA 4S2PA 2X71A 4O01A 4G3KA 4DRTA 1H0GA 3AZJD 3AZIA 5AY8A 3X1VB 1YAXA 3LR4A 4KGCA 1PYYA 3Q1FA 4OJLA 1G6OA 4YNRA 3AZEA 3G32A 2G5IC 3IF5A 4HOIA 5B1LA 4KZ8A 1OT6A 4WNNA 3KUYB 1FIKA 5HPFA 3N8SA 4Y17A 5HZHA 4M6BA 5DNMA 1XX2A 3FPWA 2WKEA 4NE6A 4C75A 1UWNX 3LELA 1ALQA 2VQRA 3Q7ZA 4AFIA 3CUEC 1P3LB 1XPBA 4OQ0A 5B24B 2EX6A 5FQMA 1P34B 3ZVWA 1QMEA 5K5BA 3KFUG 3BFFA 1H8PA 5DF9A 1EWZA 4ZAMA 4NE5A 4KHAA 4QY5A 3REJD 2OWHA 1P9WA 4NFTA 2P08A 4OONA 1T3UA 5EFWA 3L26A 4IBCA 4FH2A 1KVLA 4WEKA 2WKIA 5JA4A 4R4SA 3REJC 1MWUA 4MEZA 4Z5TD 1P3OA 1YU4A 1G68A 1D1JA 4KENB 4IBEA 3GSGA 1OJ5A 5KSHA 5F99D 4BD0A 4R3AA 4HGAB 3B6FD 4DRBA 2QJ5A 4WZ4A 1BH8A 2OLUA 4HH2A 1NRFA 4Z5TC 4LFUA 4A5RA 1P3PD 3WA9D 5TR7A 1I2WA 5F99C 3V3SA 2PYOD 3B6FC 2JKGA 4F3LB 3W96A 1CJFA 4NZ5A 4EQIA 3X1TD 3AGDA 4K08A 4EO5C 4NEED 4G3WA 3WA9C 3AZLD 3T1RA 1LSXA 1C3BA 1P97A 3C5AA 3NCKA 4JXVA 1ONGA 5FAQA 3MGSA 3OCLA 4OOYA 2IWBA 4MN5A 1OMEA 4GHLA 3AZLC 2LB9A 5GL9A 2V0UA 3B33A 3M2JA 3MS6A 3AV1C 3ZG8B 4LGWA 3VP3A 3D72A 2VA0A 2HDUA 1JFIB 1SKOB 1F5MA 1YPRA 1S0WA 5KZHA 1ID3A 1GHMA 4UUZB 3WAAD 5CHMA 4R1GA 3MXQA 3S22A 3MGPA 3P09A 3VH5W 5GSUD 3MFDA 5G4YA 4CSRB 5DF8A 4CAYB 2W3GA 1N1JA 3NY4A 3ZFZA 3UTAD 5F1FA 1V9ZA 1K0KA 4J8XA 2WGVA 2HJ9C 2JSSA 1K4FA 1LSVA 3FZCA 3VP4A 5GSUC 2HPBA 5AQ7A 3GTCA 4OQGA 3WD1A 3X1VA 1BSGA 3REJB 3BQ8A 5KDMA 5DKLA 2ZBBA 2IA2A 3M2KA 3V39A 4ID4A 3PHYA 1B6WA 3TU4D 1RGYA 2W3EA 3QHYA 4FSFA 5EVIC 4H9PB 3G6OA 5GXQD 1W63M 3VOLA 4Z5TB 2ZQ8A 4E3NA 2DCFA 2GZAA 3TU4C 2PDRA 4E3KA 3MVDD 1U60A 3VOYA 1QO6A 5GLCA 3A0VA 5F99B 1P3MD 1P3LA 3B6FB 5F6AA 4WZSB 1W1TA 1YU1A 1T1BA 4EO5B 4ETZA 4OPZA 1TVFA 3WA9B 3C1CA 5AV8D 3MVDC 1TS0A 1Z09A 3FG8A 4KZ6A 1P3MC 3WD0A 1L2SA 3DTEA 1E25A 3UTBD 4WL9A 4DE3A 3UMEA 4WZ5A 3IF6C 3MMHA 4Q0JA 3E2KA 3ZG7B 5AV8C 4CPKA 1P3BA 4U0TA 3AZLB 3BJNA 1PZRA 1N9BA 1F98A 1YU2A 3AV1B 1AIWA 2PYPA 3UTBC 2VV8A 3WD4A 1RCJA 2CC1A 3LO7A 4OKPA 2HJEA 2BYKA 1OTAA 4DDYA 1XKZA 2D02A 5JYOA 1ZLAC 3B47A 1JTDA 2W3DA 1TZYA 2JKFA 3HUOA 3UT9D 5GT0D 3AFAC 3MQLA 2Y79A 4WF0A 4E3IA 1KS0A 5CXWA 4F3LA 3MGQA 3AYWD 1B67A 4UA7A 4H9SC 4IHQA 4Y7PA 5CPIA 4OOMA 5GT0C 5GSUB 1XJ6A 2F2AC 2XF3A 2Y2JA 1DP9A 1KU5A 1E6NA 1L6JA 4M4XA 5E2FA 2HIOD 2Y2KA 4X1LA 3JYIA 5EVIB 3NI9A 5B32D 2VX8A 4ZJ3A 5HPIA 3AZJA 3KSFA 3LR0A 2Q9NA 1NXYA 4Q0IA 2XH9A 1M19D 1VEUB 5G18A 1G5UA 5CGXA 4ZRRA 1P3KC 3IWOA 4NXEA 3UPOA 1HD8A 5BO0B 3TU4B 2HIOC 3DTKA 3HREA 3GR2A 3KSIA 5EUAA 1ERMA 3AV2D 4HEFA 4I38A 4X53A 4X68A 1M19C 4AWLC 4MMNA 4P6BA 5E2GA 1ULYA 3L27A 1HQ3C 4LD9D 3MVDB 2Q0OA 2FZ0A 1NZOA 1P3MB 1P3GC 1BT5A 1Q2PA 2C6WB 3T50A 4XZQD 3AV2C 2QWSA 3WTPC 2HF6A 1KX5D 2YFVA 4NXBA 4LD9C 2QMIA 4MB3A 3IF6B 2DF4C 5AV8B 2RTSA 1YT4A 5A91A 1FSYA 5B40A 3MSHA 4XZQC 3VP2A 3HCYA 3UTBB 5B1MC 4MNRA 2PRFA 1LHYA 3B0CT 3BWLA 3MQ0A 2K31A 3C7UA 3WS4A 3KYZA 3MXSA 1ZLAB 1F66D 4Z5TA 3B6GD 3VH6A 4HH3A 2EX9A 3E4QA 2WGIA 1MKMA 1T1CA 3AFAB 1XJ2A 5B32G 3CJMA 3LIAA 5EVEA 2GDNA 4NYUA 3LCEA 5AQ9A 5F99A 2FFFB 2ZQAA 5CRFA 1VM1A 2V0WA 1F66C 4ARZB 1P3PA 5GT0B 3UB7A 4BD1A 3WA9A 4J8VC 2PR6A 2WK0A 3P5JB 2WGWB 5FDHA 2J80A 2PYOA 5HWTA 3E4PA 2A24A 4EV4A 2W3HA 2XEPA 3X1TA 2F8ND 1S1YA 4MB4A 2OOLA 3L7HA 4R0QA 3F1OB 2WKQA 5HDSA 3AZLA 4BLMA 4I5SA 4S2MA 2V8CA 4YWZA 2HGVA 1P3KB 2PHYA 3IS2B 5L10A 1K4EA 2HIOB 3E0YA 3BY9A 2C5WB 2O99A 3F1PA 5KIZA 5B31D 1M19B 4AWLB 1HQ3B 1KGEA 3B0BA 4GHIB 2QHKA 4P6ZS 2NQBD 3W4OA 1P3GB 3AV2B 4E6XA 3WAAA 3C4PA 5B31C 4IBKA 4OJPA 4KQOA 3WTPB 5FI2A 5GSUA 1JTGA 4LD9B 3UPNA 4C3QA 2L0WA 1S1ZA 3WKJD 3MQQA 1Q9CA 3X1UD 3MZDA 5HARA 3L29A 1U35D 3UTAA 1V9YA 5TFQA 4XZQB 2X02A 1NJ4A 5B1MB 3IHBA 1L0GA 4BMWA 2J7VA 2O0YA 3X1UC 1VEUA 1FR1A 1U35C 3ZHHA 5FI7A 3TU4A 3T4QA 4OP5A 1H8MA 5GXQA 4F94A 3H0RC 2D01A 3C30A 2Y55A 5B2JC 2WYXA 4XUJD 1VHMA 1F66B 4RVAA 2YFWB 1QMFA 3AGEA 3EWKA 1D06A 5B0YC 3MVDA 4J8VB 3LJAA 4B4ZA 1P3MA 4DQYB 4II7A 4P6ZM 5CECA 1ACFA 4XUJC 3DAVA 1E4DA 2F8NH 3PBOA 4J8UC 1UWPX 5AV8A 4GCZA 5GT3D 3ZQ5A 1OPXA 2VZWA 4BBUA 5C3IC 4OJ5A 4JKTA 4PM9A 3AZGD 3P01A 5EVLA 3REKA 3HLFA 2F8NB 5HFOA 5CEBA 2Z6CA 4FH4A 5E5AA 2QPNA 5U47A 2R9WA 3CWFA 3AZGC 3L9KA 3LI8A 1J3WA 4GDNA 4G91C 2K2NA 1T18A 2FJ7D 3AGFA 3DTIA 1TS8A 4ZDXA 3EOIA 4JGOA 2HV1A 3HLCA 3AN2C 3KUYD 1J7MA 4ARZA 5BNVA 5B31B 3UT9A 3QP2A 5HD3A 5AV6D 2BLSA 1W8YA 5EPHA 2HP6A 2CMNA 2WGWA 3BECA 3BY8A 3HVFA 4DMZA 1X0OA 2YKHA 2FJ7C 4WM9A 4IBXA 3AYWA 3RXWA 4HNBA 3UB6A 2V8FA 1KE4A 1LLBA 3GECA 3HLEA 3F1OA 3BLMA 1OTDA 5DJUA 5AV6C 4WU9D 1BZAA 1P34D 4LCMA 5FUGB 3X1UB 4IBFA 1U35B 5BT1D 3MF0A 4BBVA 3HLDA 1OTIA 2HIOA 3T1SA 3K3CA 2ZC7A 4Y3IA 5B32A 2G2UA 4WU9C 4G92C 2L1MA 2AVXA 3W97A 1M19A 2PD8A 5CX7A 4BL2A 5BT1C 2JKRI 3GMWA 2QYBA 4GHIA 2PT7A 5B0YB 2ZQ9A 4DE1A 1SHVA 3HLGA 1E6ZA 3AV2A 1K56A 1E15A 3T4LA 4XUJB 5J4EA 4LD9A 3U4LP 1T19A 5HAQA 4R23A 1E88A 3QP1A 4WU8D 4J8UB 1FQGA 5HL1A 3V9RA 2P7JA 5C3IB 2Y2MA 4XZQA 1E8BA 3ISGA 2RVQC 1XGIA 1KX5A 2HZ5A 5HAPA 4E45A 4YM6A 3H82B 3VSLA 4E04A 4WU8C 5F82A 2P04A 4MDZA 3NJAA 3AZGB 4OQIA 4EBNA 1GA9A 4EU0A 4OOLA 3VH5A 4G91B 3N8LA 4KUKA 3RFBA 2B95A 2W1RA 3UB8A 2M7VA 1LL5A 3AN2B 3B6GA 3IXGA 5BOHA 2ZY2A 2YFWA 3HBRA 3N7WA 4RYEA 5HX9A 4ZTKA 1CQAA 4S2IA 2ZC5B 4KZ5A 4PAUA 2ZQDA 2FJ7B 3KWQC 1JWVA 3EGXC 4PPRA 5A8BA 1XJ3A 1TS7A 4EUVA 3V67A 4Q0HA 1VETB 2J9PA 4KG5A 5AV6B 1BLPA 1F2KA 3MJQA 1TEMA 5FDSA 3UMDA 4QB8A 5CHJA 3C4OA 4Z66C 1K55C 4WU9B 4G92B 2Y91A 1TD5A 5D3OA 5CPJD 1OGGA 3E2LA 4PM6A 2PAVP 3V5MA 4NZ1A 2V20A 4JBFA 5HWVA 1SDNA 1WYBA 3OZHA 2O9CA 4EESA 3WS0A 3NQJA 5CPJC 5B31A 2EXAA 1W2EA 3W99A 4L9FA 1GHPA 5B0ZA 4H9OA 3W98D 5KMWA 3WTPE 4Z2IA 4HMCA 2NQBA 3OPPA 3PBQA 4K0XA 4GDBA 3Q82A 4GS9B 4BBTA 3ZYTA 1PFLA 4DXCA 3W98C 1AOIA 1MXOA 4QU3A 4CLCC 1BYWA 5FUGA 3WKJA 4WU8B 3X1UA 1K6SA 1L0EA 4EEPA 1U35A 2ZL1A 3LZ0C 1S66L 4QLCD 4X1MA 4JJNA 5CPKA 5FQIA 2VK3A 5EM0A 2Q9MA 5AVCD 2JHEA 2WKHA 3BFGA 4KQDA 1YUEA 4BQMA 4Y5FA 4H9QA 3OCNA 4XUZA 1PZOA 1PW8A 3C1BD 4XXRA 4QLCC 1KX4D 5L09A 3SZTA 5AVCC 1K57A 1P3FD 3AV1D 1W1VA 3LIBA 1PRQA 3KWQB 2ZOIA 3B42A 5G49B 4XUJA 1IEMA 4Z2LA 3C1BC 1KX4C 2DQNC 1P3FC 3MZEA 1P3ID 5GLBA 2R9XA 3EGDC 3A6NC 3A1KA 4KUDD 5F69A 3ULFA 2QJ7A 2UV0E 4R8PD 4Z66B 2QZ6A 2RIQA 4UPKA 4JF6A 5GT3A 1P3IC 4DKIA 3D9YA 3KYEA 4KUDC 1SDEA 4JPMA 4H9NA 4O0PA 5IHVA 4WEJA 4R8PC 3S7NA 5B2ID 3BEBA 5EVID 2ZY5A 3GVBA 4NY2A 5CPJB 4M3KA 3MGRD 4Y0TA 2Y2GA 1DJCA 2PU2A 3OOVA 5E43A 1WE4A 4S2NA 3T4TA 2ZMAA 1GCEA 4OJ6A 4GKUA 4HBTA 4R3JA 4N9KA 2O9AA 4I3AA 5B2IC 3KUYA 3AZHC 3BFCA 3MGRC 1ERQA 3L25A 4B93A 5AV6A 3AZMD 3W98B 2VV6A 3EPLA 3OBFA 1PWCA 4Y13A 2P74A 5HW3A 1K54C 1YU3A 4IJFA 3LZ0B 2IO5C 1HTAA 3NC8A 5HL6A 2VGLS 2WAEA 3ITAA 5B24A 2NZDD 3AZMC 1P34A 2HUEC 4PKYG 4HP9A 2G5HC 3HONA 5DTTA 4QLCB 5TJJA 4OLGA 5AVCB 2NZDC 4LRYC 2BYMB 1YMXA 3X1SD 2M1CA 1MWSA
chains in the Genus database with same CATH topology
3IXDA 3C1BB 2AROC 1KX4B 1ZLAD 1ZG4A 1P3FB 1ESUA 1YLWA 3WRZA 3AFAD 3KXBC 5AV5D 1FCMA 5JRGD 3A6NB 5CHUA 5DF7A 3O62D 1PIOA 3X1SC 5JYPA 5E2HA 4PMAA 1EROA 1ESIA 4WU8A 1M1AD 3O86A 1DJBA 1P3IB 4IVKA 5GHXA 5AV5C 5JRGC 4KUDB 3RELD 3O62C 3MNND 1BLHA 3WS2A 1KGFA 3BRMA 3ZNTA 4R8PB 4RA7A 5DTSA 1M1AC 3G4PA 3PAEA 3S1YA 1PI5A 3RELC 3MNNC 1P3KD 1MPLA 4DDSA 5B2IB 5G49A 1BH9B 3IP4C 3AZHB 3MGRB 2ZM0A 3ZG9B 4PM8A 1HQ3D 3UE0A 4YFMA 4MBHA 1JFIA 2IO5B 3FV7A 2XD1A 5AVBD 4CJNA 1P3GD 4XUXA 2XFTA 4UUZA 5AV9D 3AZMB 3WTPD 2HUEB 4Y0UA 5DNNC 2XD5A 1BUEA 4CSRA 4CAYA 4NYYA 5DTKA 5AVBC 1L0DA 4ZBEA 1GA0A 4E3JA 5GHYA 2NZDB 5AV9C 5B1MD 5CPJA 4ZUXD 5CHLB 2WAFA 3REJA 3A3JA 2ZC4B 2AROB 3AZFC 1J9MA 4S2KA 4B4XA 2CV5D 3KXBB 3IWIA 4H9PA 2ZC3B 4ZUXC 3X1SB 3G31A 3NQUB 3W98A 3HLWA 1PI4A 5BS7C 1N4OA 4KZ4A 1RP5A 3AZND 2CV5C 4J8VD 1KX3D 4ZJ2A 5AV5B 1TDGA 5JRGB 5L2FA 3B6FA 3O62B 3ZG0A 4ZBJC 4IBJA 1M1AB 1GHIA 3AZNC 4JF5A 1KX3C 4OUIA 4HBUA 4QLCA 4Z2MH 1FSWA 3NBLA 3TOIA 5GHZA 3RELB 5EOEA 3MNNB 4LG2A 4OPRA 1JVJA 3FDDA 5FATA 3Q7VB 1Z6FA 1KX4A 1XXMA 3AZIC 5AY8C 1P3FA 3AV1A 4KGCC 1DY6A 1W7FA 4JLFA 3BLSA 3AZEC 5M1AA 5GLDA 3TG9A 3M6BA 5B1LC 4O7DA 5DNNB 1P3IA 2H10A 1KE0A 5DNMC 4KG2A 4KUDA 4UHUA 3SOIA 3ZDJA 3EPJA 5AVBB 3LELC 4R8PA 3N3FA 5AV9B 2ZJ9A 3Q07A 1S32D 1KDSA 5AQAA 3WS1A 4Q8IA 4WELA 3RJUA 3AZFB 1K25A 4ZJ1A 4NZ4A 4UAAA 1W8QA 2H0YA 5B2IA 5EVIA 4IBIA 3VFHA 1S32C 1TAFB 4ZUXB 5B2JD 1K38A 4Z9QA 2JE5A 2Y2IA 3LY3A 2F8NG 3CZDA 3IHAA 3C7VA 5HAIA 5BO0A 1KVMA 3MXRA 1P3OC 1K54A 2CV5B 1MWTA 5B0YD 1EQZD 1FOFA 1HVBA 3N6IA 3O87A 4ZBJB 3AZMA 2HDRA 3W96D 3DWZA 3AZNB 4J8UD 1KX3B 1EQZC 1P3AD 2V1ZA 4U0XA 1IKIA 5KSCA 5B31G 3I7JA 5EOOA 2NZDA 2FFYA 3W96C 5B33D 3IF6A 4HESA 3P98A 2A3UA 1KDWA 2P9VB 2DNSA 3VOZA 1P3AC 3AZIB 5AY8B 3UY6A 4KGCB 3ZG5A 3UTBA 3AZEB 5B33C 3GRJA 3UDFA 2XDMA 3MGSC 3NQUA 5B1LB 1ZLAA 3AN2D 4WNNB 1IYPA 5BNXB 3AFAA 2EX8A 5AQBA 5AV5A 5DNMB 5JRGA 4WJ3C 2H5SA 5DVAA 3SS5A 4JXSA 3O62A 1H3OB 3REID 3LELB 4H9SA 1M18D 1M1AA 4EBPA 5GT0A 3PBNA 4D2OA 4YINA 3REHD 3RELA 2XGNA 3MNNA 1H5XA 4J8WD 3REIC 2ZY3A 4L0LA 1M18C 2XR0A 2IWCA 4QY6A 3Q7VA 1S32B 3QNBA 4E3MA 2V2FF 3REHC 3UE3A 3BM6A 4J8WC 1P3KA 2J8YA 1P3OB 4E6WA 3HUMA 4LCLA 1MBLA 4DF6A 1MWRA 5B2JB 3IXHA 2Y2LA 3WS5A 1HQ3A 5M19A 4GNUA 1EQZB 5AVBA 1P3GA 1FR6A 5AV9A 3WTPA 2RVQD 1BTLA 3W96B 5CGWA 3DWKA 3LZ1D 4BL3A 4IEDA 1CEFA 1P3AB 3C1CC 1FCOA 2WUQA 5B1MA 2ZM8A 5B33B 4NE3A 5A93A 3LZ1C 3MGSB 3DW0A 1ES3A 5BS7A 1YLYA 1P3BC 1W79A 3UE1A 2WZZA 4X55A 1YU0A 2ZY4A 2B5RA 3ZVTA 4S2JA 3V50A 5CP6D 1I2SA 3KWQD 4DXBA 4KQQA 1F66A 3G30A 3AZNA 2Y4AA 4LV1A 5TGFA 2L5AA 1TZYC 4J8VA 1KX3A 1IELA 4E3LA 5CPID 5CP6C 2OLVA 3B3XA 3REIB 1ZKJA 3MGQC 1M18B 2VGJA 5CEDA 2UWXA 4Z66D 1PZPA 2P9VA 5FAOA 3VP1A 5CPIC 4UA6A 4H9RB 4OP8A 3UO9A 3REHB 4R3BA 4J8WB 4QJGA 2F8NA 5KDMB 1L0FA 5J8XA 4FD8A 5EECA 1IYQA 2A49A 3AZJC 5BNXA 2ZM5A 3EPKA 1BFMA 4LV3A 1CK3A 3SH7A 3IWQA 3IH8A 1H3OA 4JXWA 3AZKD 2BG1A 4GD8A 1PW1A 5FA7A 2HP5A 3SS3A 3AZKC 3C1CB 3LZ0D 1CI8A 3B0CW 5CTMA 3NDEA 2ZQCA 4OVDA 5B40D 4P85A 3ITBA 3G34A 3F6TA 3IT9A 1S32A 3UDXA 3S4XA 3LZ1B 1VQQA 2WADA 1YQSA 1P3BB 4N1HA 3PBRA 5B40C 1ONHA 3OPRA 2IOUA 3EG5B 2HDSA 5B2JA 2Y2QA 2BYKB 1KE3A 4RX3A 4KZ9A 4GN2A 1WWIA 1TZYB 5B0YA 1EQZA 3IXBA 5CP6B 3BFDA 3A6ND 4IBRA 3FYZA 5EE8A 3MGQB 4KZAA 4X69A 4J8UA 3BYDA 4EWFA 1P3AA 3L2AA 5CPIB 1P3PC 5FASA 4FCFA 3ZCZA 4GHAA 4B88A 2PYOC 1JWZA 2IWDA 4E3OA 5B33A 3X1TC 2Y2PA 1JWPA 4QNLA 3AZJB 3D4FA 3AZGA 4DE0A 1TDLA 2ZM2A 3OPHA 1O07A 2H0TA 4OJOA 5E2EA 3AN2A 3AZHD 4H8RA 5CGSA 3AL0C 3VH6T 2G2WA 5FQ9A 1CI9A 3O3VA 2FJ7A 3REIA 3AZKB 2ZQ7A 1XA1A 5FQQA 4IBBA 1M18A 4OH0A 3WAAC 4BJPA 4JXGA 4H9RA 2HP9A 3ZGAB 2YFVB 3REHA 4J8WA 1W5DA 4P0MA 3UTAC 5B40B 4X56A 2RCXA 4WU9A 1LI0A 1YLJA 4KZ7A 4N9LA 2XLNA 2AROD 3A3EA 3WWXA 3OPLA 3CMZA 3ZNYA 1NYMA 3KXBD 2DRWA 3LJAD 4NK3A 5GXQC 1FCNA 2HDQA 1ZG6A 4P87A 1AXBA 1YLZA 4NZ3A 1P3PB 4EBLA 4LENA 4GZBA 3G35A 3LJAC 2JCHA 2JBFA 3KSYA 2ZC6B 2PYOB 3REKD 4MBFA 3X1TB 3LZ1A 4K0WA 5E5AD 4OPYA 3REKC 4JF4A 3FKWA 5E5AC 4GD6A 5GLAA 3UDIA 2Z2MB 5CP6A 2OV5A 3KWQA 3W4PA 3WAAB 3UT9C 5DNND 2EXBA 1E3UD 4IJEA 3UTAB 3AYWC 2EX2A 4OPQA 4Z66A 1K55A 3V3RA 3W8KA 2I72A 5I94A 4NETA 3W97D 3N8RA 2XFSA 3AZFD 4WBGA 3UNWA 4U3TA 1Y54A 3GQZA 1M6KA 3H0LC 5B32C 5GXQB 2Y2HA 1K56D 3EQVA 4E44A 5F1GA 3VP0A 1EI5A 3R45B 3W97C 3VMAA 4MLLA 1PWGA 3LY4A 3OC2A 1NY0A 1PWDA 2VGKA 3AZKA 3QNCA 1RGZA 4Z2MG 3LJAB 4WMCD 2RL3A 3MBZA 3PTEA 3B0DC 1CEGA 2PU4A 1BULA 3VFFA 4YM6D 1Q2QA 4X23D 3LZ0A 2XQZA 4YS3D 1A7WA 3G2YA 3REKB 4QHCA 1KX5C 4YM6C 1HTZA 4DE2A 4X23C 5E5AB 3Q81A 3AZID 2Y2OA 5AY8D 5AVCA 1H8YA 4YS3C 4QD4A 4RX2A 4KGCD 1H8ZA 2BYMA 4MBKA 3AZED 3C1BA 5B1LD 1NZUA 4GOGA 2W8SA 3B6GC 5BNVB 2JC7A 5CTNA 3UT9B 5DNMD 3A6NA 3HSHA 2ZD8A 3AYWB 3LELD 1XA7A 4IBGA 4KG6A 3FWLA 1IYSA 4Y0OA 1LI9A 4N1XA 1HZOA 1DJAA 1WYCA 3A1IA 3BFEA 4WV4B 1IKGA 3IQAA 5B32B 3EPHA 4C6YA 1K6RA 1ES5A 3W97B 3W99D 2F8NK 1ES2A 5B0ZD 3MZFA 1BLSA 3WRTA 3VH5T 1P3OD 3KS4A 4EUZA 1BH9A 4OQHA 2X01A 3AZHA 3MGRA 4IBDA 3B0DB 3W99C 5A92A 1M40A 4GB7A 5B0ZC 2LY8A 1AOID 5FI6A 4KZBA 1Z2CB 1XGJA 3V9RB 3FKVA 2NQBC 5F83A 3SH9A 5FAPA 1R4VA 4JJND 5CPKD 3UPPA 4LV2A 1KX5B 3GV9A 4YM6B 1AOIC 4X23B 3WKJC 4PM5A 4IVIA 1G6AA 5FQKA 4YS3B 2J8PA 4JJNC 5CPKC 1LL9A 1F1EA 2EFXA 1XP4A 3W4QA 3EQUA 3HL9A 3MGSD 3R45A 2AROA 3B6GB 5FQJA 1NYYA 3KXBA 1I5QA 1YM1A 1K57C 5FSRA 1KGGA 4GH9A 2OSUA 3X1SA 4N92A 1MKIA 3SS4A 3LEZA 1ID3D 3G2ZA 4PM7A 3MGPD 3KS8A 1ES4A 2CWEA 2E8IA 2PBYA 3VH6W 2J9OA 3TSGA 1ID3C 4J8XD 4KZ3A 1O7EA 5GT3C 3MGPC 4WYYA 2ZLYA 3X1VD 2Y59A 4R4RA 4KHAB 1WWSA 3HUNA 4J8XC 3HLBA 1YLTA 3SH8A 3NQJB 3W99B 3X1VC 5CERA 3M6HA 4K91A 5JA4B 5B0ZB 4H9OB 1SCWA 4UA9A 4S2NC 2EFUA 1YMSA 2NQBB 3IH9A 1BLCA 4KQRA 5M18A 2WZXA 3MKEA 3KUYC 3A3FA 1P3LD 5B24D 5DNNA 4DRAA 1E3UA 1BH8B 1AOIB 1MY8A 3WKJB 3H0MC 5BPVA 3C1CD 4JJNB 5CPKB 5A90A 1P3LC 3NIAA 1S6RA 5B24C 1P34C 3PBSA 4H9QB 3WX7A 4OLDA 3AZFA 1P3BD 1ZC2A 1SKFA 3PBTA 4X6TA 4WZ5C 1TAFA 3FKEA 3DTMA 4ZUXA 3O88A 3A3DA 1IYOA 3NDGA 2XK1A 2CV5A 1TZYD 4S2OA 4BENA 4WMCA 1YLPA 2Y2NA 3UN7A 3L28A 4HGAC 2Z2LB 3MGQD 1ID3B 3RXXA 4X23A 5GT3B 3MGPB 3PAGA 3VSKA 4YS3A 3N4IA 4LV0A 1N1JB 4H9NB 3MKFA 4S2LA 4J8XB 3CG5A 3A3IA 4S2PA 2X71A 4DRTA 3AZJD 3AZIA 5AY8A 3X1VB 4KGCA 1PYYA 3Q1FA 4OJLA 3AZEA 3G32A 2G5IC 3IF5A 5B1LA 4KZ8A 4WNNA 3KUYB 3N8SA 4M6BA 5DNMA 1XX2A 2WKEA 4NE6A 4C75A 3LELA 1ALQA 2VQRA 3Q7ZA 1P3LB 1XPBA 4OQ0A 5B24B 2EX6A 5FQMA 1P34B 3ZVWA 1QMEA 3KFUG 3BFFA 5DF9A 1EWZA 4ZAMA 4NE5A 4KHAA 4QY5A 3REJD 4NFTA 4OONA 1T3UA 3L26A 4IBCA 4FH2A 1KVLA 4WEKA 2WKIA 5JA4A 4R4SA 3REJC 1MWUA 4MEZA 4Z5TD 1P3OA 1YU4A 1G68A 4KENB 4IBEA 3GSGA 5KSHA 5F99D 4BD0A 4HGAB 3B6FD 4DRBA 4WZ4A 1BH8A 2OLUA 1NRFA 4Z5TC 4A5RA 1P3PD 3WA9D 5TR7A 1I2WA 5F99C 3V3SA 2PYOD 3B6FC 3W96A 4NZ5A 4EQIA 3X1TD 3AGDA 4EO5C 3WA9C 3AZLD 1C3BA 3C5AA 3NCKA 4JXVA 1ONGA 5FAQA 3MGSA 3OCLA 4OOYA 2IWBA 1OMEA 4GHLA 3AZLC 5GL9A 3M2JA 3AV1C 3ZG8B 3VP3A 2HDUA 1JFIB 1S0WA 5KZHA 1ID3A 1GHMA 4UUZB 3WAAD 5CHMA 4R1GA 3S22A 3MGPA 3P09A 3VH5W 5GSUD 3MFDA 4CSRB 5DF8A 4CAYB 1N1JA 3NY4A 3ZFZA 3UTAD 5F1FA 4J8XA 2WGVA 2JSSA 1K4FA 3FZCA 3VP4A 5GSUC 2HPBA 5AQ7A 3GTCA 4OQGA 3X1VA 1BSGA 3REJB 5KDMA 3M2KA 3V39A 4ID4A 1B6WA 3TU4D 1RGYA 3QHYA 4FSFA 5EVIC 4H9PB 5GXQD 4Z5TB 2ZQ8A 4E3NA 2DCFA 3TU4C 4E3KA 3MVDD 1U60A 3VOYA 5GLCA 5F99B 1P3MD 1P3LA 3B6FB 4WZSB 1YU1A 4EO5B 4OPZA 1TVFA 3WA9B 3C1CA 5AV8D 3MVDC 4KZ6A 1P3MC 1L2SA 1E25A 3UTBD 4DE3A 4WZ5A 3IF6C 3E2KA 3ZG7B 5AV8C 4CPKA 1P3BA 4U0TA 3AZLB 1PZRA 1N9BA 1YU2A 3AV1B 3UTBC 1RCJA 2CC1A 3LO7A 4OKPA 2BYKA 4DDYA 1XKZA 5JYOA 1ZLAC 1JTDA 1TZYA 3HUOA 3UT9D 5GT0D 3AFAC 4E3IA 5CXWA 3MGQA 3AYWD 1B67A 4UA7A 4H9SC 4Y7PA 5CPIA 4OOMA 5GT0C 5GSUB 2F2AC 2XF3A 2Y2JA 1KU5A 5E2FA 2HIOD 2Y2KA 3JYIA 5EVIB 3NI9A 5B32D 4ZJ3A 3AZJA 2Q9NA 1NXYA 2XH9A 1M19D 5G18A 5CGXA 1P3KC 3IWOA 3UPOA 1HD8A 5BO0B 3TU4B 2HIOC 3HREA 3GR2A 5EUAA 1ERMA 3AV2D 4HEFA 4X53A 4X68A 1M19C 4AWLC 4P6BA 5E2GA 1ULYA 3L27A 1HQ3C 4LD9D 3MVDB 1NZOA 1P3MB 1P3GC 1BT5A 1Q2PA 2C6WB 4XZQD 3AV2C 3WTPC 1KX5D 2YFVA 4LD9C 2QMIA 3IF6B 2DF4C 5AV8B 1YT4A 5A91A 1FSYA 5B40A 4XZQC 3VP2A 3UTBB 5B1MC 4MNRA 1LHYA 3B0CT 3C7UA 3WS4A 3MXSA 1ZLAB 1F66D 4Z5TA 3B6GD 3VH6A 2EX9A 2WGIA 3AFAB 3CJMA 5B32G 2GDNA 4NYUA 3LCEA 5AQ9A 5F99A 2FFFB 2ZQAA 5CRFA 1VM1A 1F66C 1P3PA 5GT0B 4BD1A 3WA9A 4J8VC 2WK0A 3P5JB 2WGWB 5FDHA 2PYOA 4EV4A 2XEPA 3X1TA 2F8ND 4R0QA 3AZLA 4BLMA 4S2MA 1P3KB 1K4EA 2HIOB 2C5WB 5B31D 1M19B 4AWLB 1HQ3B 1KGEA 3B0BA 2NQBD 3W4OA 1P3GB 3AV2B 4E6XA 3WAAA 3C4PA 5B31C 4IBKA 4OJPA 4KQOA 3WTPB 5FI2A 5GSUA 1JTGA 4LD9B 3UPNA 4C3QA 3WKJD 1Q9CA 3X1UD 3MZDA 5HARA 3L29A 1U35D 3UTAA 5TFQA 4XZQB 2X02A 1NJ4A 5B1MB 3IHBA 1L0GA 2J7VA 3X1UC 1FR1A 1U35C 3ZHHA 5FI7A 3TU4A 4OP5A 5GXQA 4F94A 3H0RC 2Y55A 5B2JC 2WYXA 4XUJD 1F66B 4RVAA 2YFWB 1QMFA 3AGEA 5B0YC 3MVDA 4J8VB 3LJAA 4B4ZA 1P3MA 4DQYB 5CECA 4XUJC 1E4DA 2F8NH 3PBOA 4J8UC 5AV8A 5GT3D 5C3IC 4OJ5A 4JKTA 4PM9A 3AZGD 5EVLA 3REKA 3HLFA 2F8NB 5HFOA 5CEBA 4FH4A 5E5AA 2QPNA 5U47A 2R9WA 3AZGC 4GDNA 4G91C 2FJ7D 3AGFA 4ZDXA 3HLCA 3AN2C 3KUYD 5BNVA 5B31B 3UT9A 5AV6D 2BLSA 1W8YA 5EPHA 2HP6A 2WGWA 3BECA 3HVFA 2FJ7C 4WM9A 4IBXA 3AYWA 3RXWA 1KE4A 1LLBA 3HLEA 3BLMA 5AV6C 4WU9D 1BZAA 1P34D 4LCMA 5FUGB 3X1UB 4IBFA 1U35B 5BT1D 3HLDA 2HIOA 2ZC7A 5B32A 2G2UA 4WU9C 4G92C 3W97A 1M19A 4BL2A 5BT1C 3GMWA 5B0YB 2ZQ9A 4DE1A 1SHVA 3HLGA 3AV2A 1K56A 4XUJB 4LD9A 5HAQA 4R23A 4WU8D 4J8UB 1FQGA 5HL1A 3V9RA 5C3IB 2Y2MA 4XZQA 3ISGA 2RVQC 1XGIA 1KX5A 5HAPA 4E45A 4YM6A 3VSLA 4WU8C 5F82A 3AZGB 4OQIA 4EBNA 1GA9A 4OOLA 3VH5A 4G91B 3N8LA 1LL5A 3AN2B 3B6GA 3IXGA 5BOHA 2ZY2A 2YFWA 3HBRA 3N7WA 4RYEA 5HX9A 4ZTKA 4S2IA 2ZC5B 4KZ5A 2ZQDA 2FJ7B 3KWQC 1JWVA 4PPRA 2J9PA 4KG5A 5AV6B 1BLPA 1TEMA 4QB8A 5CHJA 3C4OA 4Z66C 1K55C 4WU9B 4G92B 2Y91A 5D3OA 5CPJD 3E2LA 4PM6A 3V5MA 4NZ1A 2V20A 4JBFA 1SDNA 1WYBA 3OZHA 3WS0A 3NQJA 5CPJC 5B31A 2EXAA 1W2EA 3W99A 1GHPA 5B0ZA 4H9OA 3W98D 5KMWA 3WTPE 2NQBA 3OPPA 3PBQA 4K0XA 4GDBA 3Q82A 4DXCA 3W98C 1AOIA 1MXOA 4QU3A 5FUGA 3WKJA 4WU8B 3X1UA 1K6SA 1L0EA 1U35A 3LZ0C 4QLCD 4JJNA 5CPKA 5FQIA 2Q9MA 5AVCD 2WKHA 3BFGA 1YUEA 4BQMA 4H9QA 3OCNA 4XUZA 1PZOA 1PW8A 3C1BD 4XXRA 4QLCC 1KX4D 5AVCC 1K57A 1P3FD 3AV1D 3KWQB 5G49B 4XUJA 1IEMA 3C1BC 1KX4C 2DQNC 1P3FC 3MZEA 1P3ID 5GLBA 2R9XA 3A6NC 3A1KA 4KUDD 4R8PD 4Z66B 2QZ6A 2RIQA 4UPKA 4JF6A 5GT3A 1P3IC 4DKIA 4KUDC 1SDEA 4JPMA 4H9NA 5IHVA 4WEJA 4R8PC 5B2ID 3BEBA 5EVID 2ZY5A 3GVBA 4NY2A 5CPJB 4M3KA 3MGRD 4Y0TA 2Y2GA 1DJCA 2PU2A 5E43A 1WE4A 4S2NA 2ZMAA 1GCEA 4OJ6A 4GKUA 4HBTA 4R3JA 4N9KA 5B2IC 3KUYA 3AZHC 3BFCA 3MGRC 1ERQA 3L25A 5AV6A 3AZMD 3W98B 3EPLA 1PWCA 2P74A 5HW3A 1K54C 1YU3A 4IJFA 3LZ0B 2IO5C 1HTAA 3NC8A 2WAEA 3ITAA 5B24A 2NZDD 3AZMC 1P34A 2HUEC 2G5HC 3HONA 5DTTA 4QLCB 4OLGA 5AVCB 2NZDC 2BYMB 1YMXA 3X1SD 1MWSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IXD A;  3NDE A;  2ZQC A;  4OVD A;  5CER A;  4EV4 A;  2XEP A;  3M6H A;  4K91 A;  4P85 A;  3ITB A;  1ZG4 A;  3G34 A;  1SCW A;  3IT9 A;  1ESU A;  1YLW A;  4UA9 A;  3UDX A;  3S4X A;  3WRZ A;  4R0Q A;  4S2N C;  2EFU A;  1VQQ A;  1YMS A;  1FCM A;  3IH9 A;  4KQR A;  1BLC A;  5CHU A;  2WAD A;  5M18 A;  2WZX A;  5DF7 A;  1YQS A;  4BLM A;  1PIO A;  4S2M A;  3MKE A;  5JYP A;  4N1H A;  5E2H A;  3A3F A;  4PMA A;  3PBR A;  1ERO A;  1ESI A;  1E3U A;  1K4E A;  3O86 A;  1ONH A;  1DJB A;  1MY8 A;  2C5W B;  4IVK A;  5GHX A;  3OPR A;  2HDS A;  2Y2Q A;  1KE3 A;  4RX3 A;  1BLH A;  4KZ9 A;  3WS2 A;  1KGF A;  4GN2 A;  5A90 A;  3BRM A;  3ZNT A;  3NIA A;  1S6R A;  3IXB A;  4RA7 A;  1KGE A;  5DTS A;  3VP4 A;  3G4P A;  3PAE A;  3PBS A;  3S1Y A;  3BFD A;  3W4O A;  4OLD A;  1PI5 A;  4IBR A;  3FYZ A;  5EE8 A;  4E6X A;  3C4P A;  4KQO A;  1ZC2 A;  4KZA A;  4X69 A;  1SKF A;  5FI2 A;  1MPL A;  1JTG A;  3BYD A;  4DDS A;  4EWF A;  4C3Q A;  3UPN A;  3PBT A;  4X6T A;  5FAS A;  4WZ5 C;  3DTM A;  3MZD A;  4FCF A;  5HAR A;  3ZCZ A;  3O88 A;  3A3D A;  4B88 A;  1IYO A;  2ZM0 A;  3NDG A;  5TFQ A;  1JWZ A;  2IWD A;  3ZG9 B;  4E3O A;  2X02 A;  2XK1 A;  4PM8 A;  1NJ4 A;  3UE0 A;  3IHB A;  4S2O A;  4BEN A;  2Y2P A;  1L0G A;  4WMC A;  4MBH A;  4YFM A;  1YLP A;  2J7V A;  1JWP A;  2Y2N A;  3FV7 A;  2XD1 A;  3UN7 A;  4CJN A;  3D4F A;  1FR1 A;  4XUX A;  4DE0 A;  2XFT A;  1TDL A;  2ZM2 A;  3OPH A;  3ZHH A;  2Z2L B;  5FI7 A;  3RXX A;  4Y0U A;  4OP5 A;  2XD5 A;  1BUE A;  1O07 A;  2H0T A;  3PAG A;  4F94 A;  3VSK A;  5E2E A;  2Y55 A;  5DTK A;  4H8R A;  5CGS A;  1L0D A;  2WYX A;  4ZBE A;  1GA0 A;  3N4I A;  4LV0 A;  4RVA A;  2G2W A;  5FQ9 A;  4E3J A;  1QMF A;  5GHY A;  3MKF A;  3AGE A;  4S2L A;  1CI9 A;  3O3V A;  3CG5 A;  3A3I A;  4S2P A;  2X71 A;  4B4Z A;  4DRT A;  2ZQ7 A;  1XA1 A;  5FQQ A;  2WAF A;  3A3J A;  2ZC4 B;  5CEC A;  1J9M A;  4OH0 A;  1PYY A;  3Q1F A;  4S2K A;  4B4X A;  4BJP A;  4JXG A;  1E4D A;  3G32 A;  2HP9 A;  3PBO A;  3IWI A;  3ZGA B;  3IF5 A;  2ZC3 B;  4KZ8 A;  4JKT A;  4PM9 A;  1W5D A;  3G31 A;  5EVL A;  4P0M A;  3HLW A;  3N8S A;  4X56 A;  3HLF A;  1PI4 A;  1N4O A;  4KZ4 A;  2RCX A;  1RP5 A;  5HFO A;  1XX2 A;  1LI0 A;  5CEB A;  4ZJ2 A;  2WKE A;  1TDG A;  4FH4 A;  2QPN A;  5U47 A;  4C75 A;  5L2F A;  1YLJ A;  1ALQ A;  4KZ7 A;  2R9W A;  4N9L A;  2XLN A;  3Q7Z A;  3ZG0 A;  3A3E A;  4OQ0 A;  1XPB A;  3WWX A;  3OPL A;  2EX6 A;  3CMZ A;  5FQM A;  3ZNY A;  1NYM A;  4GDN A;  1GHI A;  3ZVW A;  1QME A;  2DRW A;  5DF9 A;  3BFF A;  4JF5 A;  3AGF A;  4NK3 A;  1EWZ A;  4HBU A;  1FCN A;  4ZDX A;  4ZAM A;  3HLC A;  1FSW A;  2HDQ A;  1ZG6 A;  3NBL A;  4P87 A;  4QY5 A;  5GHZ A;  5EOE A;  3TOI A;  4OPR A;  1JVJ A;  4OON A;  1AXB A;  2BLS A;  1W8Y A;  1YLZ A;  4FH2 A;  1KVL A;  4WEK A;  2HP6 A;  2WGW A;  3BEC A;  4LEN A;  5EPH A;  5FAT A;  3HVF A;  4EBL A;  4GZB A;  3G35 A;  2JBF A;  2JCH A;  1Z6F A;  2WKI A;  3Q7V B;  4IBX A;  4WM9 A;  3RXW A;  1XXM A;  2ZC6 B;  4R4S A;  1KE4 A;  1LLB A;  1MWU A;  4MEZ A;  3HLE A;  4MBF A;  1DY6 A;  3BLM A;  1W7F A;  1G68 A;  4JLF A;  1BZA A;  3BLS A;  4KEN B;  5M1A A;  4LCM A;  3GSG A;  4K0W A;  5GLD A;  3TG9 A;  5KSH A;  3M6B A;  4OPY A;  4BD0 A;  4O7D A;  3HLD A;  4WZ4 A;  2OLU A;  4JF4 A;  1NRF A;  2ZC7 A;  2H10 A;  1KE0 A;  4A5R A;  2G2U A;  3FKW A;  4KG2 A;  4UHU A;  3SOI A;  5TR7 A;  3ZDJ A;  4BL2 A;  1I2W A;  4GD6 A;  3V3S A;  3GMW A;  5GLA A;  3UDI A;  2Z2M B;  4EQI A;  2ZJ9 A;  3AGD A;  3Q07 A;  2OV5 A;  2ZQ9 A;  1KDS A;  5AQA A;  3WS1 A;  4DE1 A;  4Q8I A;  1SHV A;  3HLG A;  1K56 A;  4WEL A;  3RJU A;  3W4P A;  1K25 A;  1C3B A;  3C5A A;  3NCK A;  4ZJ1 A;  4UAA A;  1W8Q A;  2H0Y A;  4R23 A;  5EVI A;  4JXV A;  5HAQ A;  1ONG A;  5HL1 A;  1FQG A;  2EXB A;  1E3U D;  5FAQ A;  3VFH A;  3OCL A;  4OOY A;  2IWB A;  2Y2M A;  1OME A;  1K38 A;  4Z9Q A;  2JE5 A;  2Y2I A;  2EX2 A;  5GL9 A;  3ISG A;  3LY3 A;  3CZD A;  1XGI A;  3IHA A;  3C7V A;  3M2J A;  4OPQ A;  4S2I A;  5HAI A;  1K55 A;  1KVM A;  3MXR A;  3V3R A;  5HAP A;  1K54 A;  1MWT A;  3W8K A;  3ZG8 B;  2I72 A;  3VSL A;  3VP3 A;  1FOF A;  1HVB A;  5I94 A;  2HDU A;  5F82 A;  3N6I A;  4NET A;  3O87 A;  3N8R A;  1S0W A;  2XFS A;  5KZH A;  4OQI A;  4WBG A;  4EBN A;  2HDR A;  1GA9 A;  1GHM A;  4OOL A;  3DWZ A;  3UNW A;  4U3T A;  4R1G A;  5CHM A;  1Y54 A;  3S22 A;  3P09 A;  3N8L A;  3GQZ A;  1M6K A;  3MFD A;  2V1Z A;  5DF8 A;  2Y2H A;  4U0X A;  1K56 D;  1IKI A;  3EQV A;  1LL5 A;  5F1G A;  3VP0 A;  1EI5 A;  3I7J A;  3IXG A;  3NY4 A;  3VMA A;  3ZFZ A;  5BOH A;  4MLL A;  3HBR A;  1PWG A;  3N7W A;  4RYE A;  3LY4 A;  5EOO A;  5HX9 A;  5F1F A;  3OC2 A;  1NY0 A;  1PWD A;  2WGV A;  2FFY A;  4ZTK A;  2VGK A;  1K4F A;  2ZC5 B;  3FZC A;  3IF6 A;  3P98 A;  3QNC A;  4HES A;  1RGZ A;  1KDW A;  2A3U A;  2HPB A;  2P9V B;  2ZQD A;  2DNS A;  5AQ7 A;  3GTC A;  4OQG A;  4WMC D;  3VOZ A;  1JWV A;  2RL3 A;  4PPR A;  3MBZ A;  3PTE A;  1BSG A;  3UY6 A;  3M2K A;  3V39 A;  3ZG5 A;  1CEG A;  4ID4 A;  2PU4 A;  1BUL A;  2J9P A;  4KG5 A;  1RGY A;  3VFF A;  1BLP A;  1Q2Q A;  3QHY A;  4FSF A;  5EVI C;  1TEM A;  3GRJ A;  3UDF A;  2XDM A;  2XQZ A;  1IYP A;  3G2Y A;  4QB8 A;  5CHJ A;  3C4O A;  2ZQ8 A;  2EX8 A;  2DCF A;  4E3N A;  4QHC A;  5AQB A;  1K55 C;  4E3K A;  1HTZ A;  1U60 A;  2H5S A;  2Y91 A;  5DVA A;  5D3O A;  3SS5 A;  3VOY A;  4DE2 A;  4JXS A;  5GLC A;  3E2L A;  4PM6 A;  3V5M A;  3Q81 A;  1H8Y A;  2Y2O A;  4RX2 A;  4QD4 A;  4EBP A;  1H8Z A;  2V20 A;  4JBF A;  4MBK A;  1SDN A;  3PBN A;  1WYB A;  3OZH A;  1TVF A;  4OPZ A;  3WS0 A;  4D2O A;  4YIN A;  2EXA A;  1H5X A;  2XGN A;  4KZ6 A;  1NZU A;  4GOG A;  1GHP A;  2JC7 A;  1L2S A;  5CTN A;  4L0L A;  1E25 A;  2XR0 A;  4DE3 A;  4WZ5 A;  5KMW A;  2IWC A;  4QY6 A;  5KSC A;  3Q7V A;  3QNB A;  4E3M A;  3IF6 C;  3OPP A;  3PBQ A;  3E2K A;  4K0X A;  3ZG7 B;  4GDB A;  2ZD8 A;  4CPK A;  3Q82 A;  2V2F F;  4U0T A;  3UE3 A;  1N9B A;  1XA7 A;  3BM6 A;  4KG6 A;  4DXC A;  3FWL A;  2J8Y A;  1IYS A;  4Y0O A;  1MXO A;  4QU3 A;  1LI9 A;  4E6W A;  1RCJ A;  1K6S A;  1HZO A;  4N1X A;  1DJA A;  1L0E A;  1WYC A;  3HUM A;  2CC1 A;  4LCL A;  3LO7 A;  4OKP A;  1MBL A;  3BFE A;  4DF6 A;  1IKG A;  1MWR A;  4DDY A;  1XKZ A;  3IXH A;  5FQI A;  2Y2L A;  5JYO A;  3IQA A;  2Q9M A;  3BFG A;  1JTD A;  2WKH A;  3WS5 A;  3HUO A;  5M19 A;  4BQM A;  4GNU A;  4KZ5 A;  4C6Y A;  3OCN A;  4XUZ A;  1K6R A;  1PZO A;  4E3I A;  1ES5 A;  1FR6 A;  1PW8 A;  5CXW A;  4XXR A;  1ES2 A;  4UA7 A;  1BTL A;  3MZF A;  3WRT A;  1BLS A;  1K57 A;  4Y7P A;  5CGW A;  3DWK A;  4OOM A;  4EUZ A;  4BL3 A;  2XF3 A;  4IED A;  4OQH A;  2X01 A;  2Y2J A;  1CEF A;  1IEM A;  1FCO A;  2WUQ A;  5A92 A;  1M40 A;  4GB7 A;  5E2F A;  2Y2K A;  2ZM8 A;  5FI6 A;  3JYI A;  3MZE A;  5EVI B;  4KZB A;  5GLB A;  5A93 A;  3NI9 A;  1XGJ A;  2R9X A;  3FKV A;  4ZJ3 A;  5F83 A;  3SH9 A;  3DW0 A;  2Q9N A;  1NXY A;  1ES3 A;  2XH9 A;  1YLY A;  5FAP A;  1W79 A;  5G18 A;  3UE1 A;  2WZZ A;  3UPP A;  4X55 A;  4LV2 A;  5CGX A;  3IWO A;  2B5R A;  3UPO A;  2QZ6 A;  1HD8 A;  3GV9 A;  3ZVT A;  4S2J A;  4JF6 A;  3V50 A;  4PM5 A;  3HRE A;  1I2S A;  3GR2 A;  4IVI A;  5EUA A;  4DKI A;  1ERM A;  4DXB A;  4KQQ A;  1G6A A;  5FQK A;  4HEF A;  1SDE A;  3G30 A;  4X53 A;  4X68 A;  4JPM A;  1LL9 A;  4P6B A;  5E2G A;  2Y4A A;  4LV1 A;  5TGF A;  5IHV A;  4WEJ A;  1IEL A;  2EFX A;  4E3L A;  1XP4 A;  3W4Q A;  3EQU A;  3BEB A;  5EVI D;  3HL9 A;  3GVB A;  2OLV A;  3B3X A;  4M3K A;  4Y0T A;  2Y2G A;  1NZO A;  1Q2P A;  1BT5 A;  2C6W B;  1DJC A;  1ZKJ A;  2PU2 A;  2VGJ A;  1NYY A;  1WE4 A;  5E43 A;  5FQJ A;  5CED A;  2UWX A;  4S2N A;  2ZMA A;  1I5Q A;  1YM1 A;  1K57 C;  1GCE A;  1PZP A;  2P9V A;  2QMI A;  4GKU A;  4HBT A;  4R3J A;  5FAO A;  3IF6 B;  4N9K A;  4UA6 A;  5FSR A;  1KGG A;  3VP1 A;  2OSU A;  4OP8 A;  4N92 A;  1MKI A;  3UO9 A;  3BFC A;  4R3B A;  1YT4 A;  1ERQ A;  5A91 A;  1FSY A;  3SS4 A;  4QJG A;  3LEZ A;  3VP2 A;  1L0F A;  3G2Z A;  1PWC A;  2P74 A;  4MNR A;  4PM7 A;  5HW3 A;  5J8X A;  1LHY A;  4FD8 A;  1K54 C;  1ES4 A;  5EEC A;  1IYQ A;  3NC8 A;  2A49 A;  2E8I A;  3C7U A;  3WS4 A;  2PBY A;  3MXS A;  2WAE A;  3ITA A;  4LV3 A;  2EX9 A;  1CK3 A;  2J9O A;  2WGI A;  3SH7 A;  3TSG A;  3CJM A;  3IWQ A;  2GDN A;  4KZ3 A;  3IH8 A;  3LCE A;  5AQ9 A;  1O7E A;  4JXW A;  2FFF B;  5DTT A;  2ZQA A;  4WYY A;  2ZLY A;  2Y59 A;  5CRF A;  1VM1 A;  2BG1 A;  4OLG A;  4R4R A;  4GD8 A;  1PW1 A;  3HUN A;  4BD1 A;  2WK0 A;  5FA7 A;  2HP5 A;  3HLB A;  1YMX A;  3SS3 A;  2WGW B;  5FDH A;  1YLT A;  1CI8 A;  3SH8 A;  5CTM A;  1MWS A; 
#chains in the Genus database with same CATH topology
 3IXD A;  3C1B B;  2ARO C;  1KX4 B;  1ZLA D;  1ZG4 A;  4HJ3 A;  1P3F B;  1ESU A;  1YLW A;  3WRZ A;  3AFA D;  3KXB C;  4LRZ E;  5AV5 D;  1FCM A;  5JRG D;  3A6N B;  5CHU A;  5DF7 A;  1NLZ A;  4TX8 A;  5J3W A;  3O62 D;  1D7E A;  1PIO A;  3X1S C;  5JYP A;  5E2H A;  4PMA A;  1ERO A;  1ESI A;  4WU8 A;  1M1A D;  1GPF A;  1EW0 A;  3O86 A;  4KUO A;  5HDC A;  1DJB A;  1P3I B;  4IVK A;  5GHX A;  5AV5 C;  5JRG C;  4KUD B;  2W1T B;  3REL D;  3O62 C;  3MNN D;  3QP8 A;  1BLH A;  3WS2 A;  1KGF A;  3BRM A;  3ZNT A;  4R8P B;  4RA7 A;  1DP8 A;  5DTS A;  1M1A C;  3T1Q B;  2V1A A;  2VGL M;  3A0R A;  3G4P A;  3PAE A;  3S1Y A;  2NUP C;  1PI5 A;  3REL C;  3MNN C;  4JGQ A;  3QP5 A;  1P3K D;  1Y28 A;  1MPL A;  4DDS A;  5B2I B;  2FN2 A;  5G49 A;  1BH9 B;  3IP4 C;  3AZH B;  3H9W A;  3MGR B;  2XSS A;  2ZM0 A;  3ZG9 B;  4PM8 A;  1Y4O A;  2V5O A;  1XJ4 A;  2JKR M;  1HQ3 D;  3UE0 A;  3GDI A;  4YFM A;  4MBH A;  3W2Z A;  1JFI A;  1SKO A;  4D60 A;  2IO5 B;  1FIL A;  3FV7 A;  2XD1 A;  5AVB D;  5EM1 A;  4CJN A;  1P3G D;  4XUX A;  1DRM A;  3CUE A;  2XFT A;  4LLO B;  4UUZ A;  2VV7 A;  5AV9 D;  3AZM B;  3WTP D;  2HUE B;  4Y0U A;  5DNN C;  1JNU A;  2W3F A;  2XD5 A;  1BUE A;  4CSR A;  1HLU P;  4HP4 A;  4O8G A;  4IUK A;  4CAY A;  4NYY A;  5DTK A;  5AVB C;  1L0D A;  4ZBE A;  1GA0 A;  4E3J A;  5GHY A;  4H6J B;  5HD5 A;  2NZD B;  5AV9 C;  5B1M D;  5CPJ A;  4YOF A;  4ZUX D;  5CHL B;  4HMD A;  2A2L A;  2WAF A;  3REJ A;  3A3J A;  2ZC4 B;  2ARO B;  3AZF C;  1J9M A;  4S2K A;  3NOU C;  4B4X A;  4R38 A;  2CV5 D;  3KXB B;  4I3I A;  3IWI A;  4H9P A;  2ZC3 B;  3JPU A;  4ZUX C;  3X1S B;  2EWW A;  3G31 A;  3NQU B;  3W98 A;  2QKP A;  3HLW A;  1PI4 A;  5BS7 C;  1N4O A;  3IX4 A;  4KZ4 A;  1RP5 A;  3TJZ C;  5TBM B;  3AZN D;  2CV5 C;  4J8V D;  1KX3 D;  4ZJ2 A;  5AV5 B;  1TDG A;  5JRG B;  5L2F A;  3B6F A;  3O62 B;  3ICY A;  3ZG0 A;  4ZBJ C;  4QPR A;  4IBJ A;  4Y15 A;  1M1A B;  1GHI A;  3AZN C;  4JF5 A;  1KX3 C;  4OUI A;  4GW9 A;  4QLC A;  4HBU A;  4MN6 A;  4Y2F A;  3BQA A;  4Z2M H;  1FSW A;  3NBL A;  3TOI A;  5GHZ A;  3REL B;  5EOE A;  3MNN B;  4LG2 A;  4OPR A;  1JVJ A;  3FDD A;  5FAT A;  1S67 L;  3Q7V B;  1Z6F A;  2XRN A;  1KX4 A;  4HQA A;  1XXM A;  3A0S A;  3AZI C;  5AY8 C;  3S7Q A;  2OAQ 1;  1P3F A;  3AV1 A;  4KGC C;  1DY6 A;  1W7F A;  3QP4 A;  4JLF A;  3BLS A;  3AZE C;  5M1A A;  5GLD A;  3TG9 A;  3HJK A;  3M6B A;  5B1L C;  2E8J A;  4O7D A;  3K2N A;  2W0N A;  2Y8H A;  5DNN B;  1P3I A;  1DP6 A;  1KE0 A;  2H10 A;  4PKY A;  5DNM C;  5AVF A;  1PDC A;  4KG2 A;  1UR8 A;  5L07 A;  4KUD A;  4UHU A;  2W1T A;  3SOI A;  3ZDJ A;  3EPJ A;  5AVB B;  3LI9 A;  3LEL C;  1N9L A;  4R8P A;  3N3F A;  5AV9 B;  2ZJ9 A;  1ZHH B;  3Q07 A;  5LBR A;  3PXP A;  1S32 D;  4CQH A;  1KDS A;  5AQA A;  3WS1 A;  2B02 A;  2XRO A;  4Q8I A;  3MQO A;  4WEL A;  3RJU A;  3AZF B;  1K25 A;  4ZJ1 A;  4NZ4 A;  4UAA A;  1W8Q A;  1H3Q A;  1S4R A;  2H0Y A;  5B2I A;  5EVI A;  4Z1W A;  4IBI A;  3VFH A;  1S4S A;  1S32 C;  1TAF B;  1CF0 A;  4ZUX B;  5B2J D;  3WD2 A;  1K38 A;  4Z9Q A;  3T4O A;  2JE5 A;  2Y2I A;  3LY3 A;  2F8N G;  3CZD A;  3IHA A;  3C7V A;  5F68 A;  5HAI A;  1H0M A;  5BO0 A;  1KVM A;  3MXR A;  1P3O C;  1K54 A;  2CV5 B;  1MWT A;  5B0Y D;  1EQZ D;  4CLC E;  1FOF A;  1HVB A;  3N6I A;  3UB5 P;  3O87 A;  3NEC A;  4ZBJ B;  3AZM A;  2HDR A;  2R78 A;  4HIA A;  4EXO A;  5HSQ A;  3W96 D;  3DWZ A;  1W1Y A;  2FH5 A;  3AZN B;  2VLG A;  3F1N B;  4J8U D;  1KX3 B;  1EQZ C;  1P3A D;  2V1Z A;  3K3D A;  4U0X A;  1IKI A;  5KSC A;  5B31 G;  3I7J A;  4PHT A;  5EOO A;  2NZD A;  3H7W B;  3T4K A;  2FFY A;  3W96 C;  5B33 D;  3IF6 A;  4HES A;  3P98 A;  2A3U A;  1KDW A;  1P0Z A;  2P9V B;  3CPT B;  2DNS A;  3VOZ A;  1SZV A;  1P3A C;  3C2W A;  4MN7 A;  4JGR A;  2VJW A;  3AZI B;  5AY8 B;  3UY6 A;  3NOT C;  4B9O A;  4KGC B;  3ZG5 A;  3UTB A;  3AZE B;  5B33 C;  2KX6 A;  3LIE A;  3GRJ A;  3UDF A;  2XDM A;  3MGS C;  1W63 Q;  3NQU A;  5B1L B;  1ZLA A;  3AN2 D;  4WNN B;  4WLA A;  1IYP A;  5BNX B;  4Z2G A;  3AFA A;  2EX8 A;  5AQB A;  5AV5 A;  5DNM B;  2D49 A;  5JRG A;  4WJ3 C;  2H5S A;  5DVA A;  3SS5 A;  4MB5 A;  4JXS A;  3O62 A;  1PNE A;  1H3O B;  3REI D;  3LEL B;  4H9S A;  3VE3 A;  3T4S A;  1M18 D;  1M1A A;  1NRJ A;  4ESP A;  4EBP A;  5GT0 A;  2WKP A;  3PBN A;  4D2O A;  4YIN A;  3REH D;  3REL A;  3MNN A;  1H5X A;  2XGN A;  4J8W D;  3REI C;  3IBJ A;  2OAP 1;  2ZY3 A;  4L0L A;  1M18 C;  2XR0 A;  2EA9 A;  3KO6 A;  2IWC A;  3BW6 A;  4QY6 A;  4EET B;  3Q7V A;  1S32 B;  3QNB A;  4E3M A;  2V2F F;  3REH C;  3UE3 A;  3BM6 A;  4J8W C;  1P3K A;  3IS2 A;  2J8Y A;  1WA9 A;  3MR0 A;  1P3O B;  3EEH A;  4E6W A;  3NOP C;  3HUM A;  1CK7 A;  4LCL A;  1MBL A;  4DF6 A;  1MWR A;  5B2J B;  2JN7 A;  3IXH A;  2Y2L A;  5DJT A;  3WS5 A;  1HQ3 A;  5M19 A;  2LB5 A;  4GNU A;  4UQI S;  1EQZ B;  5AVB A;  1P3G A;  1FR6 A;  1A0K A;  1W1P A;  5AV9 A;  3WTP A;  2RVQ D;  1BTL A;  3W96 B;  5CGW A;  3DWK A;  1YSP A;  3LZ1 D;  1GXD A;  1T1A A;  4IED A;  4BL3 A;  1CEF A;  1P3A B;  3C1C C;  1FCO A;  2WUQ A;  1UR9 A;  3E98 A;  5B1M A;  2ZM8 A;  5B33 B;  4NE3 A;  5A93 A;  3OLO A;  3LZ1 C;  2ACG A;  3MGS B;  3DW0 A;  4DJ3 A;  1ES3 A;  5BS7 A;  1YLY A;  1P3B C;  1W79 A;  3UE1 A;  2WZZ A;  4X55 A;  1YU0 A;  2ZY4 A;  2B5R A;  3ZVT A;  4S2J A;  3V50 A;  2MJ6 A;  5CP6 D;  1I2S A;  5J7E A;  3KWQ D;  4DXB A;  4KQQ A;  1F66 A;  3G30 A;  2GX5 A;  3HJI A;  3AZN A;  2Y4A A;  4LV1 A;  5TGF A;  2L5A A;  1TZY C;  4J8V A;  1KX3 A;  1IEL A;  4HJ4 A;  4E3L A;  5CPI D;  5CP6 C;  2OLV A;  3B3X A;  3UE6 A;  4UQI M;  3REI B;  1OTE A;  1ZKJ A;  3MGQ C;  1M18 B;  2VGJ A;  3S7O A;  5CED A;  2M7U A;  2EWV A;  2UWX A;  4FUW A;  2V9A A;  4Z66 D;  1PZP A;  2P9V A;  5FAO A;  3VP1 A;  5CPI C;  4UA6 A;  4H9R B;  3M7P A;  4OP8 A;  3UO9 A;  3REH B;  4R3B A;  4J8W B;  4QJG A;  2F8N A;  5KDM B;  1L0F A;  3KYQ A;  5J8X A;  2I9V A;  4FD8 A;  5EEC A;  1IYQ A;  4HI4 A;  2A49 A;  1YKD A;  3AZJ C;  5BNX A;  3U2A A;  4L9E A;  2B18 A;  2GJ3 A;  2ZM5 A;  3EPK A;  1BFM A;  4LV3 A;  1CK3 A;  3SH7 A;  3LFV A;  1ODV A;  2ZMF A;  3IWQ A;  3IH8 A;  1H3O A;  2VEA A;  4JXW A;  3AZK D;  1NWZ A;  1LL8 A;  2ZMV A;  3CLO A;  2BG1 A;  4GD8 A;  1PW1 A;  2YKF A;  4CLC D;  4NKP A;  5FA7 A;  5G4Z A;  2HP5 A;  3SS3 A;  3AZK C;  3C1C B;  3LZ0 D;  1CI8 A;  3B0C W;  5FL3 A;  5CTM A;  3NDE A;  2ZQC A;  4OVD A;  1MC0 A;  5B40 D;  4P85 A;  3ITB A;  3G34 A;  3F6T A;  3IT9 A;  1S32 A;  2V1B A;  2Z6D A;  3S4X A;  3UDX A;  3LZ1 B;  2KOI A;  4EEU A;  1VQQ A;  2WAD A;  1YQS A;  1P3B B;  4N1H A;  1H0I A;  3TW8 A;  3PBR A;  5B40 C;  2INW A;  1ONH A;  1TF1 A;  1P9R A;  2IOU A;  3EG5 B;  2HDS A;  5B2J A;  3OPR A;  2Y2Q A;  2BYK B;  1KE3 A;  4RX3 A;  5FEF A;  4KZ9 A;  4GN2 A;  1WWI A;  1TZY B;  5B0Y A;  1EQZ A;  3IXB A;  5CP6 B;  1EAK A;  3BFD A;  3A6N D;  1OTB A;  4IBR A;  3FYZ A;  4FTX A;  5EE8 A;  4HJ6 A;  3MGQ B;  4KZA A;  4X69 A;  4J8U A;  3BYD A;  4EWF A;  1P3A A;  3L2A A;  5CPI B;  1P3P C;  4NG2 A;  5FAS A;  5DFX A;  3C8C A;  4FCF A;  1GOI A;  3ZCZ A;  4GHA A;  1NLY A;  4B88 A;  3CHW P;  5IT5 A;  2PYO C;  1JWZ A;  2IWD A;  2L4R A;  1L3L A;  4E3O A;  5B33 A;  3H82 A;  3X1T C;  3LR5 A;  2Y2P A;  4G3V A;  1JWP A;  4WN5 A;  4QNL A;  3AZJ B;  3D4F A;  3AZG A;  1G28 A;  4DE0 A;  1TDL A;  2ZM2 A;  3EEA A;  3OPH A;  4X25 A;  2DMW A;  3CIT A;  1O07 A;  2H0T A;  4XT2 B;  2BTF P;  4OJO A;  5E2E A;  3AN2 A;  4QWO A;  3AZH D;  4H8R A;  5CGS A;  3AL0 C;  2JKT I;  3VH6 T;  2G2W A;  5FQ9 A;  1CI9 A;  3O3V A;  2FJ7 A;  5C5K A;  3REI A;  3AZK B;  2ZQ7 A;  1XA1 A;  5FQQ A;  3VV4 A;  4IBB A;  3QP6 A;  1M18 A;  4OH0 A;  1VET A;  3WAA C;  1O6I A;  4BJP A;  4JXG A;  4H9R A;  2HP9 A;  4CLC B;  3ZGA B;  2YFV B;  3REH A;  4J8W A;  4MCW A;  1W5D A;  4P0M A;  3D3O A;  3UTA C;  2OWJ A;  5B40 B;  4X56 A;  3R7W B;  2RCX A;  4HME A;  4WU9 A;  1LI0 A;  4ETX A;  1YLJ A;  4KZ7 A;  4N9L A;  2XLN A;  2ARO D;  3A3E A;  3WWX A;  3OPL A;  3CMZ A;  3ZNY A;  1NYM A;  3KXB D;  2DRW A;  3LJA D;  4NK3 A;  5I5L A;  5GXQ C;  1FCN A;  2KLI A;  3IBR A;  4Z2H A;  1ZG6 A;  2HDQ A;  4P87 A;  4LRX C;  1OGB A;  1AXB A;  3TRC A;  1YLZ A;  4NZ3 A;  1P3P B;  4EBL A;  4LEN A;  3FC7 A;  4GZB A;  3G35 A;  3LJA C;  2JCH A;  2JBF A;  3KSY A;  4GS9 A;  2ZC6 B;  4NXF A;  2PYO B;  3REK D;  5IS1 A;  2A24 B;  4MBF A;  2H28 A;  3X1T B;  3LZ1 A;  3NUL A;  4Z2K A;  4DJ2 A;  4HY8 A;  4K0W A;  5E5A D;  4OPY A;  4ME4 A;  4Z2J A;  1GSW A;  3REK C;  4JF4 A;  3FKW A;  4DN0 A;  5E5A C;  3F1P B;  1VB6 A;  5AJG A;  4GD6 A;  4I39 A;  5GLA A;  3UDI A;  2Z2M B;  3LUQ A;  4GJ4 A;  5CP6 A;  2OV5 A;  3KWQ A;  1E6P A;  3W4P A;  3CI6 A;  3WAA B;  3UT9 C;  5DNN D;  2EXB A;  1E3U D;  4R6L A;  2K7S A;  4IJE A;  5DKK A;  5HDD A;  3UTA B;  3AYW C;  2EX2 A;  4OPQ A;  4Z66 A;  1CXW A;  4EQ1 A;  3E4O A;  1K55 A;  3V3R A;  5FEG A;  3W8K A;  1XFQ A;  2I72 A;  5I94 A;  1UGU A;  4NET A;  3W97 D;  3N8R A;  5EV0 A;  2XFS A;  3AZF D;  1MZU A;  4WBG A;  3UNW A;  3LEQ A;  4U3T A;  1Y54 A;  4XT2 A;  3GQZ A;  1M6K A;  3H0L C;  1E6R A;  5IU1 A;  5B32 C;  5GXQ B;  2Y2H A;  1K56 D;  3EQV A;  4E44 A;  5F1G A;  3VP0 A;  1EI5 A;  3R45 B;  3W97 C;  3VMA A;  4MLL A;  1PWG A;  3LY4 A;  3OC2 A;  1NY0 A;  1PWD A;  2VGK A;  3AZK A;  3QNC A;  3LYX A;  1RGZ A;  4Z2M G;  3LJA B;  4WMC D;  2RL3 A;  5DFY A;  3MBZ A;  3PTE A;  2GNX A;  3B0D C;  1CEG A;  4CLC A;  2PU4 A;  1BUL A;  3RH8 B;  3VFF A;  4YM6 D;  1Q2Q A;  4X23 D;  3KSH A;  3LZ0 A;  1STZ A;  4JGP A;  4BWI A;  2XQZ A;  3R7W A;  4YS3 D;  1A7W A;  3G2Y A;  3REK B;  1GSV A;  4QHC A;  3O5Y A;  1KX5 C;  4YM6 C;  1HTZ A;  4DE2 A;  4X23 C;  3LIC A;  5E5A B;  3Q81 A;  3AZI D;  2Y2O A;  5AY8 D;  5AVC A;  1H8Y A;  4YS3 C;  2KDK A;  4QD4 A;  4RX2 A;  4KGC D;  1H8Z A;  2BYM A;  4MBK A;  3AZE D;  3IX8 A;  2WKR A;  4IJG A;  3C1B A;  5B1L D;  1NZU A;  4GOG A;  2W8S A;  3DBA A;  3B6G C;  5BNV B;  2JC7 A;  5CTN A;  3UT9 B;  4EW7 A;  5HWW A;  5DNM D;  3A6N A;  1KOU A;  3HSH A;  2ZD8 A;  3IX3 A;  3AYW B;  3LEL D;  1XA7 A;  4IBG A;  4KG6 A;  3VE4 A;  3FWL A;  1IYS A;  4Y0O A;  3TE8 A;  1LI9 A;  4N1X A;  1HZO A;  4NXG A;  1DJA A;  1WYC A;  1IOU A;  3A1I A;  4EER A;  3BFE A;  4WV4 B;  1IKG A;  3IQA A;  2PYR A;  5B32 B;  3EPH A;  4C6Y A;  1K6R A;  4FOF A;  1LT0 A;  1ES5 A;  3LR3 A;  3KSG A;  4R70 A;  3W97 B;  3W99 D;  2F8N K;  1ES2 A;  1IFQ A;  5B0Z D;  3MZF A;  1BLS A;  3PR6 A;  3WRT A;  3VH5 T;  1P3O D;  3KS4 A;  4EUZ A;  1BH9 A;  1TS6 A;  4OQH A;  2X01 A;  3AZH A;  3MGR A;  4IBD A;  3B0D B;  2PBD P;  3W99 C;  5A92 A;  1M40 A;  4GB7 A;  5B0Z C;  2LY8 A;  2W27 A;  1AOI D;  5FI6 A;  4KZB A;  1Z2C B;  1XGJ A;  3V9R B;  3FKV A;  2NQB C;  4RQ9 A;  5F83 A;  3SH9 A;  3JVU A;  5FAP A;  1R4V A;  3LID A;  4JJN D;  5CPK D;  3NHQ A;  3UPP A;  4LV2 A;  1KX5 B;  3GV9 A;  4YM6 B;  2J3W A;  1AOI C;  4X23 B;  3WKJ C;  4PM5 A;  4IVI A;  3KX0 X;  1G6A A;  5FQK A;  4YS3 B;  2J8P A;  3CAX A;  4JJN C;  5CPK C;  1LL9 A;  1N9O A;  4H6J A;  4IUH A;  1F1E A;  2EFX A;  1XP4 A;  3W4Q A;  3EQU A;  1OT9 A;  3HL9 A;  3MGS D;  3R45 A;  2ARO A;  3B6G B;  5FQJ A;  1NYY A;  2XA7 S;  3KXB A;  1I5Q A;  1YM1 A;  1K57 C;  3LGO A;  5FSR A;  1KGG A;  4GH9 A;  3UB9 A;  2OSU A;  3X1S A;  4N92 A;  1MKI A;  3T4J A;  2VKS A;  3SS4 A;  3LEZ A;  1N9N A;  1ID3 D;  2JKT M;  5TBM A;  3PYP A;  3G2Z A;  4PM7 A;  3MFX A;  3MGP D;  3KS8 A;  2G7U A;  1F9I A;  1ES4 A;  2CWE A;  2E8I A;  3WD3 A;  2PBY A;  1AWI A;  3VH6 W;  2J9O A;  3TSG A;  1ID3 C;  4J8X D;  3R4K A;  5L8M A;  4KZ3 A;  1O7E A;  5GT3 C;  3MGP C;  3S7P A;  4WYY A;  2ZLY A;  3X1V D;  2Y59 A;  4R4R A;  4KHA B;  1WWS A;  3HUN A;  4J8X C;  3HLB A;  1ZTU A;  1YLT A;  3SH8 A;  2PD7 A;  3NQJ B;  3W99 B;  3X1V C;  5CER A;  3M6H A;  4K91 A;  5JA4 B;  5B0Z B;  4H9O B;  4WUJ A;  1SCW A;  5AVE A;  4UA9 A;  3FPV A;  4S2N C;  3RTY A;  2EFU A;  2XA7 M;  1YMS A;  2NUT C;  2NQB B;  3IH9 A;  1BLC A;  2ZOH A;  4KQR A;  5M18 A;  2WZX A;  3P7N A;  3MKE A;  3KUY C;  3A3F A;  1P3L D;  5B24 D;  5DNN A;  4DRA A;  1E3U A;  1BH8 B;  1AOI B;  1MY8 A;  3WKJ B;  3H0M C;  2PR5 A;  1OJG A;  5BPV A;  2ZL1 B;  3C1C D;  3JVV A;  4GLQ A;  4JJN B;  5CPK B;  3LIF A;  4LPZ A;  5A90 A;  1P3L C;  4I3J A;  3NIA A;  1S6R A;  5B24 C;  4HHD A;  3T1X A;  5MC7 A;  1P34 C;  1ED7 A;  2BAS A;  3PBS A;  4H9Q B;  3WX7 A;  4OLD A;  3AZF A;  1P3B D;  5F5Y A;  1ZC2 A;  1SKF A;  3PBT A;  4X6T A;  4WZ5 C;  1TAF A;  3FKE A;  3DTM A;  4ZUX A;  3O88 A;  3A3D A;  1IYO A;  3NDG A;  3SW1 A;  2XK1 A;  2CV5 A;  1TZY D;  4S2O A;  4BEN A;  4WMC A;  1YLP A;  1LSW A;  2Y2N A;  1XFN A;  3UN7 A;  3L28 A;  4HGA C;  2J3T D;  2Z2L B;  3MGQ D;  1YSQ A;  1ID3 B;  3RXX A;  4X23 A;  3F1N A;  3C38 A;  5GT3 B;  3MGP B;  3PAG A;  4L9G A;  2O9B A;  3VSK A;  3T12 B;  4YS3 A;  4UEY A;  3N4I A;  3H7W A;  2J3T C;  4LV0 A;  1N1J B;  4H9N B;  1GSX A;  3MKF A;  4S2L A;  4J8X B;  3CG5 A;  3CPT A;  3A3I A;  4S2P A;  2X71 A;  4O01 A;  4G3K A;  4DRT A;  1H0G A;  3AZJ D;  3AZI A;  5AY8 A;  3X1V B;  1YAX A;  3LR4 A;  4KGC A;  1PYY A;  3Q1F A;  4OJL A;  1G6O A;  4YNR A;  3AZE A;  3G32 A;  2G5I C;  3IF5 A;  4HOI A;  5B1L A;  4KZ8 A;  1OT6 A;  4WNN A;  3KUY B;  1FIK A;  5HPF A;  3N8S A;  4Y17 A;  5HZH A;  4M6B A;  5DNM A;  1XX2 A;  3FPW A;  2WKE A;  4NE6 A;  4C75 A;  1UWN X;  3LEL A;  1ALQ A;  2VQR A;  3Q7Z A;  4AFI A;  3CUE C;  1P3L B;  1XPB A;  4OQ0 A;  5B24 B;  2EX6 A;  5FQM A;  1P34 B;  3ZVW A;  1QME A;  5K5B A;  3KFU G;  3BFF A;  1H8P A;  5DF9 A;  1EWZ A;  4ZAM A;  4NE5 A;  4KHA A;  4QY5 A;  3REJ D;  2OWH A;  1P9W A;  4NFT A;  2P08 A;  4OON A;  1T3U A;  5EFW A;  3L26 A;  4IBC A;  4FH2 A;  1KVL A;  4WEK A;  2WKI A;  5JA4 A;  4R4S A;  3REJ C;  1MWU A;  4MEZ A;  4Z5T D;  1P3O A;  1YU4 A;  1G68 A;  1D1J A;  4KEN B;  4IBE A;  3GSG A;  1OJ5 A;  5KSH A;  5F99 D;  4BD0 A;  4R3A A;  4HGA B;  3B6F D;  4DRB A;  2QJ5 A;  4WZ4 A;  1BH8 A;  2OLU A;  4HH2 A;  1NRF A;  4Z5T C;  4LFU A;  4A5R A;  1P3P D;  3WA9 D;  5TR7 A;  1I2W A;  5F99 C;  3V3S A;  2PYO D;  3B6F C;  2JKG A;  4F3L B;  3W96 A;  1CJF A;  4NZ5 A;  4EQI A;  3X1T D;  3AGD A;  4K08 A;  4EO5 C;  4NEE D;  4G3W A;  3WA9 C;  3AZL D;  3T1R A;  1LSX A;  1C3B A;  1P97 A;  3C5A A;  3NCK A;  4JXV A;  1ONG A;  5FAQ A;  3MGS A;  3OCL A;  4OOY A;  2IWB A;  4MN5 A;  1OME A;  4GHL A;  3AZL C;  2LB9 A;  5GL9 A;  2V0U A;  3B33 A;  3M2J A;  3MS6 A;  3AV1 C;  3ZG8 B;  4LGW A;  3VP3 A;  3D72 A;  2VA0 A;  2HDU A;  1JFI B;  1SKO B;  1F5M A;  1YPR A;  1S0W A;  5KZH A;  1ID3 A;  1GHM A;  4UUZ B;  3WAA D;  5CHM A;  4R1G A;  3MXQ A;  3S22 A;  3MGP A;  3P09 A;  3VH5 W;  5GSU D;  3MFD A;  5G4Y A;  4CSR B;  5DF8 A;  4CAY B;  2W3G A;  1N1J A;  3NY4 A;  3ZFZ A;  3UTA D;  5F1F A;  1V9Z A;  1K0K A;  4J8X A;  2WGV A;  2HJ9 C;  2JSS A;  1K4F A;  1LSV A;  3FZC A;  3VP4 A;  5GSU C;  2HPB A;  5AQ7 A;  3GTC A;  4OQG A;  3WD1 A;  3X1V A;  1BSG A;  3REJ B;  3BQ8 A;  5KDM A;  5DKL A;  2ZBB A;  2IA2 A;  3M2K A;  3V39 A;  4ID4 A;  3PHY A;  1B6W A;  3TU4 D;  1RGY A;  2W3E A;  3QHY A;  4FSF A;  5EVI C;  4H9P B;  3G6O A;  5GXQ D;  1W63 M;  3VOL A;  4Z5T B;  2ZQ8 A;  4E3N A;  2DCF A;  2GZA A;  3TU4 C;  2PDR A;  4E3K A;  3MVD D;  1U60 A;  3VOY A;  1QO6 A;  5GLC A;  3A0V A;  5F99 B;  1P3M D;  1P3L A;  3B6F B;  5F6A A;  4WZS B;  1W1T A;  1YU1 A;  1T1B A;  4EO5 B;  4ETZ A;  4OPZ A;  1TVF A;  3WA9 B;  3C1C A;  5AV8 D;  3MVD C;  1TS0 A;  1Z09 A;  3FG8 A;  4KZ6 A;  1P3M C;  3WD0 A;  1L2S A;  3DTE A;  1E25 A;  3UTB D;  4WL9 A;  4DE3 A;  3UME A;  4WZ5 A;  3IF6 C;  3MMH A;  4Q0J A;  3E2K A;  3ZG7 B;  5AV8 C;  4CPK A;  1P3B A;  4U0T A;  3AZL B;  3BJN A;  1PZR A;  1N9B A;  1F98 A;  1YU2 A;  3AV1 B;  1AIW A;  2PYP A;  3UTB C;  2VV8 A;  3WD4 A;  1RCJ A;  2CC1 A;  3LO7 A;  4OKP A;  2HJE A;  2BYK A;  1OTA A;  4DDY A;  1XKZ A;  2D02 A;  5JYO A;  1ZLA C;  3B47 A;  1JTD A;  2W3D A;  1TZY A;  2JKF A;  3HUO A;  3UT9 D;  5GT0 D;  3AFA C;  3MQL A;  2Y79 A;  4WF0 A;  4E3I A;  1KS0 A;  5CXW A;  4F3L A;  3MGQ A;  3AYW D;  1B67 A;  4UA7 A;  4H9S C;  4IHQ A;  4Y7P A;  5CPI A;  4OOM A;  5GT0 C;  5GSU B;  1XJ6 A;  2F2A C;  2XF3 A;  2Y2J A;  1DP9 A;  1KU5 A;  1E6N A;  1L6J A;  4M4X A;  5E2F A;  2HIO D;  2Y2K A;  4X1L A;  3JYI A;  5EVI B;  3NI9 A;  5B32 D;  2VX8 A;  4ZJ3 A;  5HPI A;  3AZJ A;  3KSF A;  3LR0 A;  2Q9N A;  1NXY A;  4Q0I A;  2XH9 A;  1M19 D;  1VEU B;  5G18 A;  1G5U A;  5CGX A;  4ZRR A;  1P3K C;  3IWO A;  4NXE A;  3UPO A;  1HD8 A;  5BO0 B;  3TU4 B;  2HIO C;  3DTK A;  3HRE A;  3GR2 A;  3KSI A;  5EUA A;  1ERM A;  3AV2 D;  4HEF A;  4I38 A;  4X53 A;  4X68 A;  1M19 C;  4AWL C;  4MMN A;  4P6B A;  5E2G A;  1ULY A;  3L27 A;  1HQ3 C;  4LD9 D;  3MVD B;  2Q0O A;  2FZ0 A;  1NZO A;  1P3M B;  1P3G C;  1BT5 A;  1Q2P A;  2C6W B;  3T50 A;  4XZQ D;  3AV2 C;  2QWS A;  3WTP C;  2HF6 A;  1KX5 D;  2YFV A;  4NXB A;  4LD9 C;  2QMI A;  4MB3 A;  3IF6 B;  2DF4 C;  5AV8 B;  2RTS A;  1YT4 A;  5A91 A;  1FSY A;  5B40 A;  3MSH A;  4XZQ C;  3VP2 A;  3HCY A;  3UTB B;  5B1M C;  4MNR A;  2PRF A;  1LHY A;  3B0C T;  3BWL A;  3MQ0 A;  2K31 A;  3C7U A;  3WS4 A;  3KYZ A;  3MXS A;  1ZLA B;  1F66 D;  4Z5T A;  3B6G D;  3VH6 A;  4HH3 A;  2EX9 A;  3E4Q A;  2WGI A;  1MKM A;  1T1C A;  3AFA B;  1XJ2 A;  5B32 G;  3CJM A;  3LIA A;  5EVE A;  2GDN A;  4NYU A;  3LCE A;  5AQ9 A;  5F99 A;  2FFF B;  2ZQA A;  5CRF A;  1VM1 A;  2V0W A;  1F66 C;  4ARZ B;  1P3P A;  5GT0 B;  3UB7 A;  4BD1 A;  3WA9 A;  4J8V C;  2PR6 A;  2WK0 A;  3P5J B;  2WGW B;  5FDH A;  2J80 A;  2PYO A;  5HWT A;  3E4P A;  2A24 A;  4EV4 A;  2W3H A;  2XEP A;  3X1T A;  2F8N D;  1S1Y A;  4MB4 A;  2OOL A;  3L7H A;  4R0Q A;  3F1O B;  2WKQ A;  5HDS A;  3AZL A;  4BLM A;  4I5S A;  4S2M A;  2V8C A;  4YWZ A;  2HGV A;  1P3K B;  2PHY A;  3IS2 B;  5L10 A;  1K4E A;  2HIO B;  3E0Y A;  3BY9 A;  2C5W B;  2O99 A;  3F1P A;  5KIZ A;  5B31 D;  1M19 B;  4AWL B;  1HQ3 B;  1KGE A;  3B0B A;  4GHI B;  2QHK A;  4P6Z S;  2NQB D;  3W4O A;  1P3G B;  3AV2 B;  4E6X A;  3WAA A;  3C4P A;  5B31 C;  4IBK A;  4OJP A;  4KQO A;  3WTP B;  5FI2 A;  5GSU A;  1JTG A;  4LD9 B;  3UPN A;  4C3Q A;  2L0W A;  1S1Z A;  3WKJ D;  3MQQ A;  1Q9C A;  3X1U D;  3MZD A;  5HAR A;  3L29 A;  1U35 D;  3UTA A;  1V9Y A;  5TFQ A;  4XZQ B;  2X02 A;  1NJ4 A;  5B1M B;  3IHB A;  1L0G A;  4BMW A;  2J7V A;  2O0Y A;  3X1U C;  1VEU A;  1FR1 A;  1U35 C;  3ZHH A;  5FI7 A;  3TU4 A;  3T4Q A;  4OP5 A;  1H8M A;  5GXQ A;  4F94 A;  3H0R C;  2D01 A;  3C30 A;  2Y55 A;  5B2J C;  2WYX A;  4XUJ D;  1VHM A;  1F66 B;  4RVA A;  2YFW B;  1QMF A;  3AGE A;  3EWK A;  1D06 A;  5B0Y C;  3MVD A;  4J8V B;  3LJA A;  4B4Z A;  1P3M A;  4DQY B;  4II7 A;  4P6Z M;  5CEC A;  1ACF A;  4XUJ C;  3DAV A;  1E4D A;  2F8N H;  3PBO A;  4J8U C;  1UWP X;  5AV8 A;  4GCZ A;  5GT3 D;  3ZQ5 A;  1OPX A;  2VZW A;  4BBU A;  5C3I C;  4OJ5 A;  4JKT A;  4PM9 A;  3AZG D;  3P01 A;  5EVL A;  3REK A;  3HLF A;  2F8N B;  5HFO A;  5CEB A;  2Z6C A;  4FH4 A;  5E5A A;  2QPN A;  5U47 A;  2R9W A;  3CWF A;  3AZG C;  3L9K A;  3LI8 A;  1J3W A;  4GDN A;  4G91 C;  2K2N A;  1T18 A;  2FJ7 D;  3AGF A;  3DTI A;  1TS8 A;  4ZDX A;  3EOI A;  4JGO A;  2HV1 A;  3HLC A;  3AN2 C;  3KUY D;  1J7M A;  4ARZ A;  5BNV A;  5B31 B;  3UT9 A;  3QP2 A;  5HD3 A;  5AV6 D;  2BLS A;  1W8Y A;  5EPH A;  2HP6 A;  2CMN A;  2WGW A;  3BEC A;  3BY8 A;  3HVF A;  4DMZ A;  1X0O A;  2YKH A;  2FJ7 C;  4WM9 A;  4IBX A;  3AYW A;  3RXW A;  4HNB A;  3UB6 A;  2V8F A;  1KE4 A;  1LLB A;  3GEC A;  3HLE A;  3F1O A;  3BLM A;  1OTD A;  5DJU A;  5AV6 C;  4WU9 D;  1BZA A;  1P34 D;  4LCM A;  5FUG B;  3X1U B;  4IBF A;  1U35 B;  5BT1 D;  3MF0 A;  4BBV A;  3HLD A;  1OTI A;  2HIO A;  3T1S A;  3K3C A;  2ZC7 A;  4Y3I A;  5B32 A;  2G2U A;  4WU9 C;  4G92 C;  2L1M A;  2AVX A;  3W97 A;  1M19 A;  2PD8 A;  5CX7 A;  4BL2 A;  5BT1 C;  2JKR I;  3GMW A;  2QYB A;  4GHI A;  2PT7 A;  5B0Y B;  2ZQ9 A;  4DE1 A;  1SHV A;  3HLG A;  1E6Z A;  3AV2 A;  1K56 A;  1E15 A;  3T4L A;  4XUJ B;  5J4E A;  4LD9 A;  3U4L P;  1T19 A;  5HAQ A;  4R23 A;  1E88 A;  3QP1 A;  4WU8 D;  4J8U B;  1FQG A;  5HL1 A;  3V9R A;  2P7J A;  5C3I B;  2Y2M A;  4XZQ A;  1E8B A;  3ISG A;  2RVQ C;  1XGI A;  1KX5 A;  2HZ5 A;  5HAP A;  4E45 A;  4YM6 A;  3H82 B;  3VSL A;  4E04 A;  4WU8 C;  5F82 A;  2P04 A;  4MDZ A;  3NJA A;  3AZG B;  4OQI A;  4EBN A;  1GA9 A;  4EU0 A;  4OOL A;  3VH5 A;  4G91 B;  3N8L A;  4KUK A;  3RFB A;  2B95 A;  2W1R A;  3UB8 A;  2M7V A;  1LL5 A;  3AN2 B;  3B6G A;  3IXG A;  5BOH A;  2ZY2 A;  2YFW A;  3HBR A;  3N7W A;  4RYE A;  5HX9 A;  4ZTK A;  1CQA A;  4S2I A;  2ZC5 B;  4KZ5 A;  4PAU A;  2ZQD A;  2FJ7 B;  3KWQ C;  1JWV A;  3EGX C;  4PPR A;  5A8B A;  1XJ3 A;  1TS7 A;  4EUV A;  3V67 A;  4Q0H A;  1VET B;  2J9P A;  4KG5 A;  5AV6 B;  1BLP A;  1F2K A;  3MJQ A;  1TEM A;  5FDS A;  3UMD A;  4QB8 A;  5CHJ A;  3C4O A;  4Z66 C;  1K55 C;  4WU9 B;  4G92 B;  2Y91 A;  1TD5 A;  5D3O A;  5CPJ D;  1OGG A;  3E2L A;  4PM6 A;  2PAV P;  3V5M A;  4NZ1 A;  2V20 A;  4JBF A;  5HWV A;  1SDN A;  1WYB A;  3OZH A;  2O9C A;  4EES A;  3WS0 A;  3NQJ A;  5CPJ C;  5B31 A;  2EXA A;  1W2E A;  3W99 A;  4L9F A;  1GHP A;  5B0Z A;  4H9O A;  3W98 D;  5KMW A;  3WTP E;  4Z2I A;  4HMC A;  2NQB A;  3OPP A;  3PBQ A;  4K0X A;  4GDB A;  3Q82 A;  4GS9 B;  4BBT A;  3ZYT A;  1PFL A;  4DXC A;  3W98 C;  1AOI A;  1MXO A;  4QU3 A;  4CLC C;  1BYW A;  5FUG A;  3WKJ A;  4WU8 B;  3X1U A;  1K6S A;  1L0E A;  4EEP A;  1U35 A;  2ZL1 A;  3LZ0 C;  1S66 L;  4QLC D;  4X1M A;  4JJN A;  5CPK A;  5FQI A;  2VK3 A;  5EM0 A;  2Q9M A;  5AVC D;  2JHE A;  2WKH A;  3BFG A;  4KQD A;  1YUE A;  4BQM A;  4Y5F A;  4H9Q A;  3OCN A;  4XUZ A;  1PZO A;  1PW8 A;  3C1B D;  4XXR A;  4QLC C;  1KX4 D;  5L09 A;  3SZT A;  5AVC C;  1K57 A;  1P3F D;  3AV1 D;  1W1V A;  3LIB A;  1PRQ A;  3KWQ B;  2ZOI A;  3B42 A;  5G49 B;  4XUJ A;  1IEM A;  4Z2L A;  3C1B C;  1KX4 C;  2DQN C;  1P3F C;  3MZE A;  1P3I D;  5GLB A;  2R9X A;  3EGD C;  3A6N C;  3A1K A;  4KUD D;  5F69 A;  3ULF A;  2QJ7 A;  2UV0 E;  4R8P D;  4Z66 B;  2QZ6 A;  2RIQ A;  4UPK A;  4JF6 A;  5GT3 A;  1P3I C;  4DKI A;  3D9Y A;  3KYE A;  4KUD C;  1SDE A;  4JPM A;  4H9N A;  4O0P A;  5IHV A;  4WEJ A;  4R8P C;  3S7N A;  5B2I D;  3BEB A;  5EVI D;  2ZY5 A;  3GVB A;  4NY2 A;  5CPJ B;  4M3K A;  3MGR D;  4Y0T A;  2Y2G A;  1DJC A;  2PU2 A;  3OOV A;  5E43 A;  1WE4 A;  4S2N A;  3T4T A;  2ZMA A;  1GCE A;  4OJ6 A;  4GKU A;  4HBT A;  4R3J A;  4N9K A;  2O9A A;  4I3A A;  5B2I C;  3KUY A;  3AZH C;  3BFC A;  3MGR C;  1ERQ A;  3L25 A;  4B93 A;  5AV6 A;  3AZM D;  3W98 B;  2VV6 A;  3EPL A;  3OBF A;  1PWC A;  4Y13 A;  2P74 A;  5HW3 A;  1K54 C;  1YU3 A;  4IJF A;  3LZ0 B;  2IO5 C;  1HTA A;  3NC8 A;  5HL6 A;  2VGL S;  2WAE A;  3ITA A;  5B24 A;  2NZD D;  3AZM C;  1P34 A;  2HUE C;  4PKY G;  4HP9 A;  2G5H C;  3HON A;  5DTT A;  4QLC B;  5TJJ A;  4OLG A;  5AVC B;  2NZD C;  4LRY C;  2BYM B;  1YMX A;  3X1S D;  2M1C A;  1MWS A; 
#chains in the Genus database with same CATH homology
 3IXD A;  3C1B B;  2ARO C;  1KX4 B;  1ZLA D;  1ZG4 A;  1P3F B;  1ESU A;  1YLW A;  3WRZ A;  3AFA D;  3KXB C;  5AV5 D;  1FCM A;  5JRG D;  3A6N B;  5CHU A;  5DF7 A;  3O62 D;  1PIO A;  3X1S C;  5JYP A;  5E2H A;  4PMA A;  1ERO A;  1ESI A;  4WU8 A;  1M1A D;  3O86 A;  1DJB A;  1P3I B;  4IVK A;  5GHX A;  5AV5 C;  5JRG C;  4KUD B;  3REL D;  3O62 C;  3MNN D;  1BLH A;  3WS2 A;  1KGF A;  3BRM A;  3ZNT A;  4R8P B;  4RA7 A;  5DTS A;  1M1A C;  3G4P A;  3PAE A;  3S1Y A;  1PI5 A;  3REL C;  3MNN C;  1P3K D;  1MPL A;  4DDS A;  5B2I B;  5G49 A;  1BH9 B;  3IP4 C;  3AZH B;  3MGR B;  2ZM0 A;  3ZG9 B;  4PM8 A;  1HQ3 D;  3UE0 A;  4YFM A;  4MBH A;  1JFI A;  2IO5 B;  3FV7 A;  2XD1 A;  5AVB D;  4CJN A;  1P3G D;  4XUX A;  2XFT A;  4UUZ A;  5AV9 D;  3AZM B;  3WTP D;  2HUE B;  4Y0U A;  5DNN C;  2XD5 A;  1BUE A;  4CSR A;  4CAY A;  4NYY A;  5DTK A;  5AVB C;  1L0D A;  4ZBE A;  1GA0 A;  4E3J A;  5GHY A;  2NZD B;  5AV9 C;  5B1M D;  5CPJ A;  4ZUX D;  5CHL B;  2WAF A;  3REJ A;  3A3J A;  2ZC4 B;  2ARO B;  3AZF C;  1J9M A;  4S2K A;  4B4X A;  2CV5 D;  3KXB B;  3IWI A;  4H9P A;  2ZC3 B;  4ZUX C;  3X1S B;  3G31 A;  3NQU B;  3W98 A;  3HLW A;  1PI4 A;  5BS7 C;  1N4O A;  4KZ4 A;  1RP5 A;  3AZN D;  2CV5 C;  4J8V D;  1KX3 D;  4ZJ2 A;  5AV5 B;  1TDG A;  5JRG B;  5L2F A;  3B6F A;  3O62 B;  3ZG0 A;  4ZBJ C;  4IBJ A;  1M1A B;  1GHI A;  3AZN C;  4JF5 A;  1KX3 C;  4OUI A;  4HBU A;  4QLC A;  4Z2M H;  1FSW A;  3NBL A;  3TOI A;  5GHZ A;  3REL B;  5EOE A;  3MNN B;  4LG2 A;  4OPR A;  1JVJ A;  3FDD A;  5FAT A;  3Q7V B;  1Z6F A;  1KX4 A;  1XXM A;  3AZI C;  5AY8 C;  1P3F A;  3AV1 A;  4KGC C;  1DY6 A;  1W7F A;  4JLF A;  3BLS A;  3AZE C;  5M1A A;  5GLD A;  3TG9 A;  3M6B A;  5B1L C;  4O7D A;  5DNN B;  1P3I A;  2H10 A;  1KE0 A;  5DNM C;  4KG2 A;  4KUD A;  4UHU A;  3SOI A;  3ZDJ A;  3EPJ A;  5AVB B;  3LEL C;  4R8P A;  3N3F A;  5AV9 B;  2ZJ9 A;  3Q07 A;  1S32 D;  1KDS A;  5AQA A;  3WS1 A;  4Q8I A;  4WEL A;  3RJU A;  3AZF B;  1K25 A;  4ZJ1 A;  4NZ4 A;  4UAA A;  1W8Q A;  2H0Y A;  5B2I A;  5EVI A;  4IBI A;  3VFH A;  1S32 C;  1TAF B;  4ZUX B;  5B2J D;  1K38 A;  4Z9Q A;  2JE5 A;  2Y2I A;  3LY3 A;  2F8N G;  3CZD A;  3IHA A;  3C7V A;  5HAI A;  5BO0 A;  1KVM A;  3MXR A;  1P3O C;  1K54 A;  2CV5 B;  1MWT A;  5B0Y D;  1EQZ D;  1FOF A;  1HVB A;  3N6I A;  3O87 A;  4ZBJ B;  3AZM A;  2HDR A;  3W96 D;  3DWZ A;  3AZN B;  4J8U D;  1KX3 B;  1EQZ C;  1P3A D;  2V1Z A;  4U0X A;  1IKI A;  5KSC A;  5B31 G;  3I7J A;  5EOO A;  2NZD A;  2FFY A;  3W96 C;  5B33 D;  3IF6 A;  4HES A;  3P98 A;  2A3U A;  1KDW A;  2P9V B;  2DNS A;  3VOZ A;  1P3A C;  3AZI B;  5AY8 B;  3UY6 A;  4KGC B;  3ZG5 A;  3UTB A;  3AZE B;  5B33 C;  3GRJ A;  3UDF A;  2XDM A;  3MGS C;  3NQU A;  5B1L B;  1ZLA A;  3AN2 D;  4WNN B;  1IYP A;  5BNX B;  3AFA A;  2EX8 A;  5AQB A;  5AV5 A;  5DNM B;  5JRG A;  4WJ3 C;  2H5S A;  5DVA A;  3SS5 A;  4JXS A;  3O62 A;  1H3O B;  3REI D;  3LEL B;  4H9S A;  1M18 D;  1M1A A;  4EBP A;  5GT0 A;  3PBN A;  4D2O A;  4YIN A;  3REH D;  3REL A;  2XGN A;  3MNN A;  1H5X A;  4J8W D;  3REI C;  2ZY3 A;  4L0L A;  1M18 C;  2XR0 A;  2IWC A;  4QY6 A;  3Q7V A;  1S32 B;  3QNB A;  4E3M A;  2V2F F;  3REH C;  3UE3 A;  3BM6 A;  4J8W C;  1P3K A;  2J8Y A;  1P3O B;  4E6W A;  3HUM A;  4LCL A;  1MBL A;  4DF6 A;  1MWR A;  5B2J B;  3IXH A;  2Y2L A;  3WS5 A;  1HQ3 A;  5M19 A;  4GNU A;  1EQZ B;  5AVB A;  1P3G A;  1FR6 A;  5AV9 A;  3WTP A;  2RVQ D;  1BTL A;  3W96 B;  5CGW A;  3DWK A;  3LZ1 D;  4BL3 A;  4IED A;  1CEF A;  1P3A B;  3C1C C;  1FCO A;  2WUQ A;  5B1M A;  2ZM8 A;  5B33 B;  4NE3 A;  5A93 A;  3LZ1 C;  3MGS B;  3DW0 A;  1ES3 A;  5BS7 A;  1YLY A;  1P3B C;  1W79 A;  3UE1 A;  2WZZ A;  4X55 A;  1YU0 A;  2ZY4 A;  2B5R A;  3ZVT A;  4S2J A;  3V50 A;  5CP6 D;  1I2S A;  3KWQ D;  4DXB A;  4KQQ A;  1F66 A;  3G30 A;  3AZN A;  2Y4A A;  4LV1 A;  5TGF A;  2L5A A;  1TZY C;  4J8V A;  1KX3 A;  1IEL A;  4E3L A;  5CPI D;  5CP6 C;  2OLV A;  3B3X A;  3REI B;  1ZKJ A;  3MGQ C;  1M18 B;  2VGJ A;  5CED A;  2UWX A;  4Z66 D;  1PZP A;  2P9V A;  5FAO A;  3VP1 A;  5CPI C;  4UA6 A;  4H9R B;  4OP8 A;  3UO9 A;  3REH B;  4R3B A;  4J8W B;  4QJG A;  2F8N A;  5KDM B;  1L0F A;  5J8X A;  4FD8 A;  5EEC A;  1IYQ A;  2A49 A;  3AZJ C;  5BNX A;  2ZM5 A;  3EPK A;  1BFM A;  4LV3 A;  1CK3 A;  3SH7 A;  3IWQ A;  3IH8 A;  1H3O A;  4JXW A;  3AZK D;  2BG1 A;  4GD8 A;  1PW1 A;  5FA7 A;  2HP5 A;  3SS3 A;  3AZK C;  3C1C B;  3LZ0 D;  1CI8 A;  3B0C W;  5CTM A;  3NDE A;  2ZQC A;  4OVD A;  5B40 D;  4P85 A;  3ITB A;  3G34 A;  3F6T A;  3IT9 A;  1S32 A;  3UDX A;  3S4X A;  3LZ1 B;  1VQQ A;  2WAD A;  1YQS A;  1P3B B;  4N1H A;  3PBR A;  5B40 C;  1ONH A;  3OPR A;  2IOU A;  3EG5 B;  2HDS A;  5B2J A;  2Y2Q A;  2BYK B;  1KE3 A;  4RX3 A;  4KZ9 A;  4GN2 A;  1WWI A;  1TZY B;  5B0Y A;  1EQZ A;  3IXB A;  5CP6 B;  3BFD A;  3A6N D;  4IBR A;  3FYZ A;  5EE8 A;  3MGQ B;  4KZA A;  4X69 A;  4J8U A;  3BYD A;  4EWF A;  1P3A A;  3L2A A;  5CPI B;  1P3P C;  5FAS A;  4FCF A;  3ZCZ A;  4GHA A;  4B88 A;  2PYO C;  1JWZ A;  2IWD A;  4E3O A;  5B33 A;  3X1T C;  2Y2P A;  1JWP A;  4QNL A;  3AZJ B;  3D4F A;  3AZG A;  4DE0 A;  1TDL A;  2ZM2 A;  3OPH A;  1O07 A;  2H0T A;  4OJO A;  5E2E A;  3AN2 A;  3AZH D;  4H8R A;  5CGS A;  3AL0 C;  3VH6 T;  2G2W A;  5FQ9 A;  1CI9 A;  3O3V A;  2FJ7 A;  3REI A;  3AZK B;  2ZQ7 A;  1XA1 A;  5FQQ A;  4IBB A;  1M18 A;  4OH0 A;  3WAA C;  4BJP A;  4JXG A;  4H9R A;  2HP9 A;  3ZGA B;  2YFV B;  3REH A;  4J8W A;  1W5D A;  4P0M A;  3UTA C;  5B40 B;  4X56 A;  2RCX A;  4WU9 A;  1LI0 A;  1YLJ A;  4KZ7 A;  4N9L A;  2XLN A;  2ARO D;  3A3E A;  3WWX A;  3OPL A;  3CMZ A;  3ZNY A;  1NYM A;  3KXB D;  2DRW A;  3LJA D;  4NK3 A;  5GXQ C;  1FCN A;  2HDQ A;  1ZG6 A;  4P87 A;  1AXB A;  1YLZ A;  4NZ3 A;  1P3P B;  4EBL A;  4LEN A;  4GZB A;  3G35 A;  3LJA C;  2JCH A;  2JBF A;  3KSY A;  2ZC6 B;  2PYO B;  3REK D;  4MBF A;  3X1T B;  3LZ1 A;  4K0W A;  5E5A D;  4OPY A;  3REK C;  4JF4 A;  3FKW A;  5E5A C;  4GD6 A;  5GLA A;  3UDI A;  2Z2M B;  5CP6 A;  2OV5 A;  3KWQ A;  3W4P A;  3WAA B;  3UT9 C;  5DNN D;  2EXB A;  1E3U D;  4IJE A;  3UTA B;  3AYW C;  2EX2 A;  4OPQ A;  4Z66 A;  1K55 A;  3V3R A;  3W8K A;  2I72 A;  5I94 A;  4NET A;  3W97 D;  3N8R A;  2XFS A;  3AZF D;  4WBG A;  3UNW A;  4U3T A;  1Y54 A;  3GQZ A;  1M6K A;  3H0L C;  5B32 C;  5GXQ B;  2Y2H A;  1K56 D;  3EQV A;  4E44 A;  5F1G A;  3VP0 A;  1EI5 A;  3R45 B;  3W97 C;  3VMA A;  4MLL A;  1PWG A;  3LY4 A;  3OC2 A;  1NY0 A;  1PWD A;  2VGK A;  3AZK A;  3QNC A;  1RGZ A;  4Z2M G;  3LJA B;  4WMC D;  2RL3 A;  3MBZ A;  3PTE A;  3B0D C;  1CEG A;  2PU4 A;  1BUL A;  3VFF A;  4YM6 D;  1Q2Q A;  4X23 D;  3LZ0 A;  2XQZ A;  4YS3 D;  1A7W A;  3G2Y A;  3REK B;  4QHC A;  1KX5 C;  4YM6 C;  1HTZ A;  4DE2 A;  4X23 C;  5E5A B;  3Q81 A;  3AZI D;  2Y2O A;  5AY8 D;  5AVC A;  1H8Y A;  4YS3 C;  4QD4 A;  4RX2 A;  4KGC D;  1H8Z A;  2BYM A;  4MBK A;  3AZE D;  3C1B A;  5B1L D;  1NZU A;  4GOG A;  2W8S A;  3B6G C;  5BNV B;  2JC7 A;  5CTN A;  3UT9 B;  5DNM D;  3A6N A;  3HSH A;  2ZD8 A;  3AYW B;  3LEL D;  1XA7 A;  4IBG A;  4KG6 A;  3FWL A;  1IYS A;  4Y0O A;  1LI9 A;  4N1X A;  1HZO A;  1DJA A;  1WYC A;  3A1I A;  3BFE A;  4WV4 B;  1IKG A;  3IQA A;  5B32 B;  3EPH A;  4C6Y A;  1K6R A;  1ES5 A;  3W97 B;  3W99 D;  2F8N K;  1ES2 A;  5B0Z D;  3MZF A;  1BLS A;  3WRT A;  3VH5 T;  1P3O D;  3KS4 A;  4EUZ A;  1BH9 A;  4OQH A;  2X01 A;  3AZH A;  3MGR A;  4IBD A;  3B0D B;  3W99 C;  5A92 A;  1M40 A;  4GB7 A;  5B0Z C;  2LY8 A;  1AOI D;  5FI6 A;  4KZB A;  1Z2C B;  1XGJ A;  3V9R B;  3FKV A;  2NQB C;  5F83 A;  3SH9 A;  5FAP A;  1R4V A;  4JJN D;  5CPK D;  3UPP A;  4LV2 A;  1KX5 B;  3GV9 A;  4YM6 B;  1AOI C;  4X23 B;  3WKJ C;  4PM5 A;  4IVI A;  1G6A A;  5FQK A;  4YS3 B;  2J8P A;  4JJN C;  5CPK C;  1LL9 A;  1F1E A;  2EFX A;  1XP4 A;  3W4Q A;  3EQU A;  3HL9 A;  3MGS D;  3R45 A;  2ARO A;  3B6G B;  5FQJ A;  1NYY A;  3KXB A;  1I5Q A;  1YM1 A;  1K57 C;  5FSR A;  1KGG A;  4GH9 A;  2OSU A;  3X1S A;  4N92 A;  1MKI A;  3SS4 A;  3LEZ A;  1ID3 D;  3G2Z A;  4PM7 A;  3MGP D;  3KS8 A;  1ES4 A;  2CWE A;  2E8I A;  2PBY A;  3VH6 W;  2J9O A;  3TSG A;  1ID3 C;  4J8X D;  4KZ3 A;  1O7E A;  5GT3 C;  3MGP C;  4WYY A;  2ZLY A;  3X1V D;  2Y59 A;  4R4R A;  4KHA B;  1WWS A;  3HUN A;  4J8X C;  3HLB A;  1YLT A;  3SH8 A;  3NQJ B;  3W99 B;  3X1V C;  5CER A;  3M6H A;  4K91 A;  5JA4 B;  5B0Z B;  4H9O B;  1SCW A;  4UA9 A;  4S2N C;  2EFU A;  1YMS A;  2NQB B;  3IH9 A;  1BLC A;  4KQR A;  5M18 A;  2WZX A;  3MKE A;  3KUY C;  3A3F A;  1P3L D;  5B24 D;  5DNN A;  4DRA A;  1E3U A;  1BH8 B;  1AOI B;  1MY8 A;  3WKJ B;  3H0M C;  5BPV A;  3C1C D;  4JJN B;  5CPK B;  5A90 A;  1P3L C;  3NIA A;  1S6R A;  5B24 C;  1P34 C;  3PBS A;  4H9Q B;  3WX7 A;  4OLD A;  3AZF A;  1P3B D;  1ZC2 A;  1SKF A;  3PBT A;  4X6T A;  4WZ5 C;  1TAF A;  3FKE A;  3DTM A;  4ZUX A;  3O88 A;  3A3D A;  1IYO A;  3NDG A;  2XK1 A;  2CV5 A;  1TZY D;  4S2O A;  4BEN A;  4WMC A;  1YLP A;  2Y2N A;  3UN7 A;  3L28 A;  4HGA C;  2Z2L B;  3MGQ D;  1ID3 B;  3RXX A;  4X23 A;  5GT3 B;  3MGP B;  3PAG A;  3VSK A;  4YS3 A;  3N4I A;  4LV0 A;  1N1J B;  4H9N B;  3MKF A;  4S2L A;  4J8X B;  3CG5 A;  3A3I A;  4S2P A;  2X71 A;  4DRT A;  3AZJ D;  3AZI A;  5AY8 A;  3X1V B;  4KGC A;  1PYY A;  3Q1F A;  4OJL A;  3AZE A;  3G32 A;  2G5I C;  3IF5 A;  5B1L A;  4KZ8 A;  4WNN A;  3KUY B;  3N8S A;  4M6B A;  5DNM A;  1XX2 A;  2WKE A;  4NE6 A;  4C75 A;  3LEL A;  1ALQ A;  2VQR A;  3Q7Z A;  1P3L B;  1XPB A;  4OQ0 A;  5B24 B;  2EX6 A;  5FQM A;  1P34 B;  3ZVW A;  1QME A;  3KFU G;  3BFF A;  5DF9 A;  1EWZ A;  4ZAM A;  4NE5 A;  4KHA A;  4QY5 A;  3REJ D;  4NFT A;  4OON A;  1T3U A;  3L26 A;  4IBC A;  4FH2 A;  1KVL A;  4WEK A;  2WKI A;  5JA4 A;  4R4S A;  3REJ C;  1MWU A;  4MEZ A;  4Z5T D;  1P3O A;  1YU4 A;  1G68 A;  4KEN B;  4IBE A;  3GSG A;  5KSH A;  5F99 D;  4BD0 A;  4HGA B;  3B6F D;  4DRB A;  4WZ4 A;  1BH8 A;  2OLU A;  1NRF A;  4Z5T C;  4A5R A;  1P3P D;  3WA9 D;  5TR7 A;  1I2W A;  5F99 C;  3V3S A;  2PYO D;  3B6F C;  3W96 A;  4NZ5 A;  4EQI A;  3X1T D;  3AGD A;  4EO5 C;  3WA9 C;  3AZL D;  1C3B A;  3C5A A;  3NCK A;  4JXV A;  1ONG A;  5FAQ A;  3MGS A;  3OCL A;  4OOY A;  2IWB A;  1OME A;  4GHL A;  3AZL C;  5GL9 A;  3M2J A;  3AV1 C;  3ZG8 B;  3VP3 A;  2HDU A;  1JFI B;  1S0W A;  5KZH A;  1ID3 A;  1GHM A;  4UUZ B;  3WAA D;  5CHM A;  4R1G A;  3S22 A;  3MGP A;  3P09 A;  3VH5 W;  5GSU D;  3MFD A;  4CSR B;  5DF8 A;  4CAY B;  1N1J A;  3NY4 A;  3ZFZ A;  3UTA D;  5F1F A;  4J8X A;  2WGV A;  2JSS A;  1K4F A;  3FZC A;  3VP4 A;  5GSU C;  2HPB A;  5AQ7 A;  3GTC A;  4OQG A;  3X1V A;  1BSG A;  3REJ B;  5KDM A;  3M2K A;  3V39 A;  4ID4 A;  1B6W A;  3TU4 D;  1RGY A;  3QHY A;  4FSF A;  5EVI C;  4H9P B;  5GXQ D;  4Z5T B;  2ZQ8 A;  4E3N A;  2DCF A;  3TU4 C;  4E3K A;  3MVD D;  1U60 A;  3VOY A;  5GLC A;  5F99 B;  1P3M D;  1P3L A;  3B6F B;  4WZS B;  1YU1 A;  4EO5 B;  4OPZ A;  1TVF A;  3WA9 B;  3C1C A;  5AV8 D;  3MVD C;  4KZ6 A;  1P3M C;  1L2S A;  1E25 A;  3UTB D;  4DE3 A;  4WZ5 A;  3IF6 C;  3E2K A;  3ZG7 B;  5AV8 C;  4CPK A;  1P3B A;  4U0T A;  3AZL B;  1PZR A;  1N9B A;  1YU2 A;  3AV1 B;  3UTB C;  1RCJ A;  2CC1 A;  3LO7 A;  4OKP A;  2BYK A;  4DDY A;  1XKZ A;  5JYO A;  1ZLA C;  1JTD A;  1TZY A;  3HUO A;  3UT9 D;  5GT0 D;  3AFA C;  4E3I A;  5CXW A;  3MGQ A;  3AYW D;  1B67 A;  4UA7 A;  4H9S C;  4Y7P A;  5CPI A;  4OOM A;  5GT0 C;  5GSU B;  2F2A C;  2XF3 A;  2Y2J A;  1KU5 A;  5E2F A;  2HIO D;  2Y2K A;  3JYI A;  5EVI B;  3NI9 A;  5B32 D;  4ZJ3 A;  3AZJ A;  2Q9N A;  1NXY A;  2XH9 A;  1M19 D;  5G18 A;  5CGX A;  1P3K C;  3IWO A;  3UPO A;  1HD8 A;  5BO0 B;  3TU4 B;  2HIO C;  3HRE A;  3GR2 A;  5EUA A;  1ERM A;  3AV2 D;  4HEF A;  4X53 A;  4X68 A;  1M19 C;  4AWL C;  4P6B A;  5E2G A;  1ULY A;  3L27 A;  1HQ3 C;  4LD9 D;  3MVD B;  1NZO A;  1P3M B;  1P3G C;  1BT5 A;  1Q2P A;  2C6W B;  4XZQ D;  3AV2 C;  3WTP C;  1KX5 D;  2YFV A;  4LD9 C;  2QMI A;  3IF6 B;  2DF4 C;  5AV8 B;  1YT4 A;  5A91 A;  1FSY A;  5B40 A;  4XZQ C;  3VP2 A;  3UTB B;  5B1M C;  4MNR A;  1LHY A;  3B0C T;  3C7U A;  3WS4 A;  3MXS A;  1ZLA B;  1F66 D;  4Z5T A;  3B6G D;  3VH6 A;  2EX9 A;  2WGI A;  3AFA B;  3CJM A;  5B32 G;  2GDN A;  4NYU A;  3LCE A;  5AQ9 A;  5F99 A;  2FFF B;  2ZQA A;  5CRF A;  1VM1 A;  1F66 C;  1P3P A;  5GT0 B;  4BD1 A;  3WA9 A;  4J8V C;  2WK0 A;  3P5J B;  2WGW B;  5FDH A;  2PYO A;  4EV4 A;  2XEP A;  3X1T A;  2F8N D;  4R0Q A;  3AZL A;  4BLM A;  4S2M A;  1P3K B;  1K4E A;  2HIO B;  2C5W B;  5B31 D;  1M19 B;  4AWL B;  1HQ3 B;  1KGE A;  3B0B A;  2NQB D;  3W4O A;  1P3G B;  3AV2 B;  4E6X A;  3WAA A;  3C4P A;  5B31 C;  4IBK A;  4OJP A;  4KQO A;  3WTP B;  5FI2 A;  5GSU A;  1JTG A;  4LD9 B;  3UPN A;  4C3Q A;  3WKJ D;  1Q9C A;  3X1U D;  3MZD A;  5HAR A;  3L29 A;  1U35 D;  3UTA A;  5TFQ A;  4XZQ B;  2X02 A;  1NJ4 A;  5B1M B;  3IHB A;  1L0G A;  2J7V A;  3X1U C;  1FR1 A;  1U35 C;  3ZHH A;  5FI7 A;  3TU4 A;  4OP5 A;  5GXQ A;  4F94 A;  3H0R C;  2Y55 A;  5B2J C;  2WYX A;  4XUJ D;  1F66 B;  4RVA A;  2YFW B;  1QMF A;  3AGE A;  5B0Y C;  3MVD A;  4J8V B;  3LJA A;  4B4Z A;  1P3M A;  4DQY B;  5CEC A;  4XUJ C;  1E4D A;  2F8N H;  3PBO A;  4J8U C;  5AV8 A;  5GT3 D;  5C3I C;  4OJ5 A;  4JKT A;  4PM9 A;  3AZG D;  5EVL A;  3REK A;  3HLF A;  2F8N B;  5HFO A;  5CEB A;  4FH4 A;  5E5A A;  2QPN A;  5U47 A;  2R9W A;  3AZG C;  4GDN A;  4G91 C;  2FJ7 D;  3AGF A;  4ZDX A;  3HLC A;  3AN2 C;  3KUY D;  5BNV A;  5B31 B;  3UT9 A;  5AV6 D;  2BLS A;  1W8Y A;  5EPH A;  2HP6 A;  2WGW A;  3BEC A;  3HVF A;  2FJ7 C;  4WM9 A;  4IBX A;  3AYW A;  3RXW A;  1KE4 A;  1LLB A;  3HLE A;  3BLM A;  5AV6 C;  4WU9 D;  1BZA A;  1P34 D;  4LCM A;  5FUG B;  3X1U B;  4IBF A;  1U35 B;  5BT1 D;  3HLD A;  2HIO A;  2ZC7 A;  5B32 A;  2G2U A;  4WU9 C;  4G92 C;  3W97 A;  1M19 A;  4BL2 A;  5BT1 C;  3GMW A;  5B0Y B;  2ZQ9 A;  4DE1 A;  1SHV A;  3HLG A;  3AV2 A;  1K56 A;  4XUJ B;  4LD9 A;  5HAQ A;  4R23 A;  4WU8 D;  4J8U B;  1FQG A;  5HL1 A;  3V9R A;  5C3I B;  2Y2M A;  4XZQ A;  3ISG A;  2RVQ C;  1XGI A;  1KX5 A;  5HAP A;  4E45 A;  4YM6 A;  3VSL A;  4WU8 C;  5F82 A;  3AZG B;  4OQI A;  4EBN A;  1GA9 A;  4OOL A;  3VH5 A;  4G91 B;  3N8L A;  1LL5 A;  3AN2 B;  3B6G A;  3IXG A;  5BOH A;  2ZY2 A;  2YFW A;  3HBR A;  3N7W A;  4RYE A;  5HX9 A;  4ZTK A;  4S2I A;  2ZC5 B;  4KZ5 A;  2ZQD A;  2FJ7 B;  3KWQ C;  1JWV A;  4PPR A;  2J9P A;  4KG5 A;  5AV6 B;  1BLP A;  1TEM A;  4QB8 A;  5CHJ A;  3C4O A;  4Z66 C;  1K55 C;  4WU9 B;  4G92 B;  2Y91 A;  5D3O A;  5CPJ D;  3E2L A;  4PM6 A;  3V5M A;  4NZ1 A;  2V20 A;  4JBF A;  1SDN A;  1WYB A;  3OZH A;  3WS0 A;  3NQJ A;  5CPJ C;  5B31 A;  2EXA A;  1W2E A;  3W99 A;  1GHP A;  5B0Z A;  4H9O A;  3W98 D;  5KMW A;  3WTP E;  2NQB A;  3OPP A;  3PBQ A;  4K0X A;  4GDB A;  3Q82 A;  4DXC A;  3W98 C;  1AOI A;  1MXO A;  4QU3 A;  5FUG A;  3WKJ A;  4WU8 B;  3X1U A;  1K6S A;  1L0E A;  1U35 A;  3LZ0 C;  4QLC D;  4JJN A;  5CPK A;  5FQI A;  2Q9M A;  5AVC D;  2WKH A;  3BFG A;  1YUE A;  4BQM A;  4H9Q A;  3OCN A;  4XUZ A;  1PZO A;  1PW8 A;  3C1B D;  4XXR A;  4QLC C;  1KX4 D;  5AVC C;  1K57 A;  1P3F D;  3AV1 D;  3KWQ B;  5G49 B;  4XUJ A;  1IEM A;  3C1B C;  1KX4 C;  2DQN C;  1P3F C;  3MZE A;  1P3I D;  5GLB A;  2R9X A;  3A6N C;  3A1K A;  4KUD D;  4R8P D;  4Z66 B;  2QZ6 A;  2RIQ A;  4UPK A;  4JF6 A;  5GT3 A;  1P3I C;  4DKI A;  4KUD C;  1SDE A;  4JPM A;  4H9N A;  5IHV A;  4WEJ A;  4R8P C;  5B2I D;  3BEB A;  5EVI D;  2ZY5 A;  3GVB A;  4NY2 A;  5CPJ B;  4M3K A;  3MGR D;  4Y0T A;  2Y2G A;  1DJC A;  2PU2 A;  5E43 A;  1WE4 A;  4S2N A;  2ZMA A;  1GCE A;  4OJ6 A;  4GKU A;  4HBT A;  4R3J A;  4N9K A;  5B2I C;  3KUY A;  3AZH C;  3BFC A;  3MGR C;  1ERQ A;  3L25 A;  5AV6 A;  3AZM D;  3W98 B;  3EPL A;  1PWC A;  2P74 A;  5HW3 A;  1K54 C;  1YU3 A;  4IJF A;  3LZ0 B;  2IO5 C;  1HTA A;  3NC8 A;  2WAE A;  3ITA A;  5B24 A;  2NZD D;  3AZM C;  1P34 A;  2HUE C;  2G5H C;  3HON A;  5DTT A;  4QLC B;  4OLG A;  5AVC B;  2NZD C;  2BYM B;  1YMX A;  3X1S D;  1MWS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...