2Y2QA

Penicillin-binding protein 1b (pbp-1b) in complex with an alkyl boronate (z06)
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
489
structure length
469
Chain Sequence
ISEITYSDGTVIASIDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTGQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PENICILLIN-BINDING PROTEIN 1B
publication title Structure-Guided Design of Cell Wall Biosynthesis Inhibitors that Overcome Beta-Lactam Resistance in Staphylococcus Aureus (Mrsa).
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 164
structure length 469
sequence length 489
chains with identical sequence B
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2y2qA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2y2qA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2y2qA02
2C5WB 1H8YA 4DKIA 4QJGA 1FR1A 3VFFA 3WS4A 3UE0A 2I72A 5CRFA 4JBFA 2Q9MA 4GD6A 3VP4A 3BFCA 5E43A 4C3QA 1K56D 3FYZA 2Y2LA 1K57C 4B4ZA 3ZNTA 4P85A 4C6YA 4S2IA 3LEZA 2VGJA 5DVAA 4PPRA 4S2KA 5FI6A 5CGXA 2WKIA 4N9KA 5GLAA 3PBRA 1ES5A 4E3MA 3WS1A 1NRFA 1XKZA 3Q7ZA 3S4XA 4JF4A 1IEMA 1BT5A 1K6SA 4PM7A 3ZHHA 1DJCA 4PMAA 4X6TA 4EQIA 5DTSA 4WBGA 1K4EA 3IXGA 2V2FF 3UN7A 3A3DA 3NDGA 3PTEA 1GHPA 4UA7A 1PZPA 2ZM0A 1IYPA 1AXBA 1XGJA 2DCFA 4M3KA 3S22A 2IWBA 1GA0A 3FV7A 3VOZA 4WMCD 3BM6A 2ZQ9A 5FATA 3OPPA 3AGEA 2ZMAA 3C7VA 4S2NC 3HUNA 3M6BA 1ZG6A 2HP5A 4E3NA 4R4RA 3MKFA 3W4OA 2FFFB 3PBQA 4UA9A 5FAQA 4XUZA 4GZBA 3O88A 2Y91A 4ZAMA 2HP6A 4OOYA 2XH9A 4JXVA 4BD1A 3HLBA 1XGIA 5E2HA 5EOEA 5EVLA 4A5RA 5KZHA 1FOFA 1K55A 3WS5A 2DNSA 3MXRA 2UWXA 1H5XA 1XP4A 1IYSA 5FQIA 3JYIA 3MBZA 3AGDA 1PIOA 4YFMA 4GN2A 2XGNA 5EUAA 3V39A 1MBLA 3VP0A 2JCHA 4R3JA 4FH2A 5GL9A 3HLFA 1K6RA 4UA6A 4HBTA 3ZG5A 1ALQA 1CI9A 3RXWA 3HREA 3ISGA 4JXSA 3QHYA 3A3FA 5KMWA 3LY3A 1DY6A 3V5MA 4S2OA 3CMZA 5BOHA 2PU4A 2WZXA 5CEBA 2WAFA 5CGWA 2JBFA 5CTMA 4KZAA 3FZCA 2G2UA 1K25A 1FQGA 5FSRA 1N4OA 5GLDA 1FCMA 3IF6B 5FQQA 1KE3A 3P98A 5IHVA 5KSHA 4WYYA 1E3UD 2J9PA 4H8RA 1RP5A 4WM9A 1LHYA 2WADA 3IHAA 3HLGA 2DRWA 4IEDA 4N92A 5U47A 1U60A 3GVBA 4X53A 3UDFA 3Q07A 4BENA 2QPNA 3D4FA 3HLDA 3N8LA 3IF6A 1BSGA 3Q82A 4GD8A 1BLHA 4N1HA 4WZ5C 1L2SA 5F1GA 4LV1A 3LY4A 4JF5A 5HAQA 5HAIA 4U3TA 3IH8A 4OPRA 5DF8A 2HP9A 1K54A 1RCJA 3ZG0A 4BL2A 2Y2IA 3GQZA 1PW8A 3V50A 3NBLA 4PM8A 4ZTKA 4NETA 3WS0A 4BD0A 3W8KA 1SKFA 4E3JA 2HDUA 3ZCZA 3WWXA 4DE1A 4FD8A 4EV4A 3VMAA 5AQ9A 5G18A 1NZUA 2GDNA 3VSKA 2G2WA 1G68A 4BL3A 1K57A 4KZBA 5FQJA 5FQ9A 3RXXA 3C4OA 3ZVTA 2BG1A 4MBKA 3OZHA 5EVID 2Y55A 1GHMA 4EWFA 1JWZA 1K4FA 3MZEA 4R1GA 4E3IA 4ZDXA 3MFDA 4ZJ2A 3A3JA 3V3RA 4XUXA 4ZBEA 2WKEA 4FCFA 4HESA 2JC7A 2WAEA 5E2FA 1HVBA 4OLGA 2ZC6B 2ZC5B 1ONGA 2HPBA 1VQQA 2XFSA 3BFGA 4JXWA 4Y0TA 4KZ6A 5FQKA 1W8QA 2HDRA 5EECA 1ESIA 2XLNA 1K56A 4MBHA 2EXBA 3DW0A 1WE4A 4LCLA 4F94A 5A93A 4KQOA 1SHVA 5EVIC 2XFTA 3G35A 4R23A 4OP5A 4WELA 3O86A 1ES3A 1Q2QA 4IVKA 4S2NA 1S6RA 3EQVA 4HBUA 3VP1A 4E3KA 4E3LA 3A3IA 1EROA 1LL5A 3O3VA 4JXGA 1LL9A 1KE4A 4DDSA 3IWQA 3ITAA 5DF7A 4HEFA 4OONA 4JLFA 2OLUA 1M40A 2Z2MB 4E6XA 3SH8A 4K91A 5CHJA 5HARA 5CECA 1KDWA 3N6IA 4L0LA 4X69A 4OVDA 5FA7A 4QHCA 3UO9A 3HLEA 4DXCA 4DXBA 3IXDA 4UHUA 5GHYA 3ZNYA 4EBLA 3MZDA 1ZKJA 3HL9A 1Q2PA 4LENA 4OOLA 4RA7A 2WGWB 5GLCA 3VP2A 1LI9A 4DRTA 3NI9A 3ZG8B 4OPQA 1YLTA 4WZ4A 2J8YA 2QZ6A 4EBNA 1ZG4A 3VFHA 3ZVWA 1H8ZA 3WRZA 2H10A 1PI5A 2Y2JA 1XA7A 1BTLA 3HVFA 3UE3A 2WGVA 1TDLA 2BLSA 2WGWA 4D2OA 4GB7A 3VOYA 4NK3A 3CZDA 2Q9NA 4OH0A 5E2GA 4LCMA 3V3SA 5A92A 2EXAA 3BFDA 2V1ZA 1EWZA 1FCNA 1YLPA 4PM9A 3W4QA 1HD8A 2CC1A 3N7WA 5E2EA 3QNCA 3OCLA 3PBOA 1PWGA 2ZQCA 3BRMA 1MXOA 3WRTA 1QMFA 2WKHA 1YQSA 3QNBA 1GA9A 2ZQAA 3Q7VB 4WZ5A 5CHMA 1SDNA 4MEZA 4ID4A 2XDMA 3S1YA 2QMIA 4U0XA 4E3OA 4OQ0A 4RX2A 5A91A 3HLCA 4QD4A 2XF3A 3Q7VA 1I5QA 2A3UA 4JPMA 4GDNA 5D3OA 1NYMA 2ZLYA 4IBXA 4RVAA 4RX3A 4KZ7A 4P87A 2HDQA 3BECA 1E25A 4N9LA 1E3UA 1RGZA 4Z9QA 1JTDA 2H0TA 3P09A 4KENB 4WEKA 4KZ5A 4DF6A 4KZ3A 4PM6A 5GHZA 4MLLA 2J9OA 2FFYA 4EUZA 3M6HA 2EX9A 2Y2PA 1ERQA 1L0GA 4JKTA 1IKIA 5KSCA 2A49A 4KG5A 1JTGA 3OPHA 4GDBA 1PW1A 2RCXA 2X71A 2ZC7A 1ES2A 3NIAA 3OC2A 3N8RA 2WUQA 3PBSA 5CGSA 5GLBA 1JWPA 5A90A 5M19A 1BLCA 3FWLA 3MZFA 1XX2A 1KGGA 3G34A 3O87A 5HAPA 4Q8IA 1JWVA 1EI5A 1PZOA 3G4PA 4OQGA 5I94A 1TVFA 2V20A 1IYQA 4LV2A 3NCKA 1J9MA 3BFFA 1PWCA 4P0MA 4MBFA 5FDHA 1FCOA 1ZC2A 4EBPA 5AQAA 5EVIA 5FASA 1NY0A 3E2KA 1XXMA 1L0DA 5EOOA 5EE8A 5F83A 3TOIA 3HLWA 3GTCA 1BZAA 1PWDA 4KZ8A 4OOMA 3IQAA 4YINA 4UAAA 1RGYA 4DE3A 1XA1A 2RL3A 4KG2A 1MWRA 3UPNA 3Q81A 2EFUA 5CXWA 2ZC3B 2Y2MA 1GCEA 3BFEA 1YT4A 1HTZA 3G32A 3GSGA 3UE1A 3UDIA 4BLMA 1E4DA 1C3BA 1L0FA 4FSFA 1FSYA 4K0XA 2EX2A 3DTMA 4ZJ3A 5JYOA 1W5DA 2ZQ7A 1VM1A 4S2LA 3GRJA 4WEJA 2EX8A 2WGIA 5HX9A 5F1FA 3VSLA 2PU2A 4Y0OA 3G30A 2Y2NA 1S0WA 3IT9A 2P74A 3BLSA 2ZJ9A 3FKWA 4MNRA 3IXHA 5GHXA 2XD1A 1BLSA 2ZM8A 2ZQ8A 5FAPA 3N8SA 3GR2A 2ZM2A 5AQ7A 4R0QA 3OCNA 2Z2LB 3SS3A 1MWUA 4RYEA 4IBRA 4GNUA 3NY4A 1MY8A 4XXRA 3UNWA 1CI8A 2OSUA 2OLVA 2VGKA 3C7UA 2Y59A 2XR0A 3M2KA 1K38A 1NYYA 2IWCA 3SS4A 2J7VA 3EQUA 4ZJ1A 5DTTA 1SDEA 1ES4A 3PAEA 3SS5A 4WMCA 1BUEA 3DWKA 1BLPA 4OQIA 4X55A 5DF9A 1MWTA 5TFQA 5EPHA 1NZOA 4GOGA 2H0YA 2Y2GA 2B5RA 5HW3A 4C75A 3N4IA 1W7FA 2WZZA 2XK1A 4S2JA 4S2MA 2Y2OA 3TSGA 5FQMA 3LCEA 4U0TA 1MPLA 4CPKA 3IWIA 3WS2A 3E2LA 1OMEA 4B4XA 1G6AA 3CG5A 2E8IA 4B88A 4OPYA 2XEPA 1KE0A 1FR6A 4LV3A 4N1XA 1YMXA 4OPZA 4QY5A 3W4PA 3IF5A 3MKEA 3M2JA 3NC8A 4KQRA 1MWSA 2ZD8A 3BLMA 1PI4A 3I7JA 4R3BA 5CHUA 4KG6A 5FI7A 1GHIA 3G31A 3ZG9B 2WK0A 1ERMA 3HUMA 2XD5A 2JE5A 2Y4AA 5AQBA 5F82A 2X02A 1HZOA 4GKUA 1YLJA 1SCWA 3B3XA 1TDGA 3IXBA 1YLWA 4JF6A 3SH9A 3ITBA 5FI2A 2Y2KA 4P6BA 1CK3A 5CEDA 1DJBA 1NXYA 1KGFA 2XQZA 2PBYA 1O07A 1O7EA 1CEGA 1NJ4A 1YMSA 3CJMA 3PBNA 4OQHA 2C6WB 2EFXA 2HDSA 3OPRA 1WYCA 1IELA 3UPOA 1KDSA 1N9BA 1CEFA 4OLDA 2ZC4B 1I2SA 4E6WA 4KZ4A 3VP3A 4KQQA 1FSWA 3GMWA 3C4PA 3PBTA 1JVJA 2H5SA 2Y2HA 3SOIA 5J8XA 3OPLA 1TEMA 3PAGA 3LO7A 4Y0UA 4CJNA 1K55C 3IWOA 2WYXA 5FAOA 1LI0A 4QU3A 2OV5A 3FKVA 4PM5A 3AGFA 3C5AA 3MXSA 4X56A 4QB8A 4BQMA 3DWZA 5JYPA 4OP8A 1WYBA 4OKPA 5TR7A 3IHBA 1W79A 3IH9A 5EVIB 3G2ZA 3G2YA 4O7DA 4R4SA 4X68A 4FH4A 1IKGA 3HUOA 4IVIA 4S2PA 5CTNA 1ESUA 2ZQDA 4QY6A 3ZG7B 3GV9A 1YM1A 3Q1FA 5L2FA 5M1AA 1XPBA 5HL1A 3A3EA 4K0WA 3UPPA 1L0EA 3ZFZA 2R9XA 1KVLA 1M6KA 1W8YA 4KZ9A 3BYDA 1MKIA 5DTKA 5HFOA 5CERA 3TG9A 2X01A 1KGEA 2EX6A 3ZDJA 1Z6FA 4BJPA 2IWDA 3NDEA 3HBRA 3IF6C 3ZGAB 1LLBA 1IYOA 1Y54A 4Y7PA 4LV0A 4DE2A 3SH7A 1YLZA 1I2WA 1KVMA 2P9VB 5TGFA 4DE0A 2Y2QA 3UY6A 1K54C 5M18A 3UDXA 3BEBA 1BULA 1DJAA 1QMEA 2R9WA 1YLYA 4DDYA 1ONHA 3RJUA 2P9VA 1PYYA
chains in the Genus database with same CATH superfamily
5B40A 2C5WB 1PZRA 3IBRA 4DKIA 4QJGA 4IBJA 3UE0A 3MR0A 2I72A 4JBFA 1P3AD 3B6FD 3BFCA 4MDZA 1K56D 4G3VA 3REHB 3W98D 4B4ZA 1P9RA 4P85A 1N9LA 5FI6A 2WKIA 4N9KA 4J8XD 3PBRA 4E3MA 3WS1A 1NRFA 3REHA 1K6SA 4Z2KA 4PM7A 3ZHHA 4PMAA 4EQIA 5DTSA 4MB4A 1P3LB 1YUEA 2JKGA 1K4EA 5B2IC 2FZ0A 4O01A 2ZY5A 3VH5T 3PTEA 3CUEC 1P3GC 1PZPA 4QLCC 4OJPA 4WU9D 2ZM0A 4BBVA 4J8UC 1P3LA 1AXBA 5K5BA 3CLOA 1GA0A 4EO5C 3FV7A 2ZQ9A 3S7NA 2W3GA 2M1CA 2PYRA 3C7VA 4Y2FA 3M6BA 4J8WD 3MKFA 4UA9A 5CPKB 3M7PA 2ZMVA 2HP6A 5BNVB 2GX5A 2XH9A 4BD1A 1F1EA 1P3MA 2HIOB 3KSIA 5E2HA 3NOPC 4H6JB 2FJ7D 1K55A 2DNSA 3MXRA 5CPKA 1KX3C 3MVDC 1L6JA 1IYSA 2HJ9C 4ETZA 5EUAA 5BNVA 3GDIA 4H6JA 2W3FA 4UA6A 3R7WB 3UMEA 3AZND 2PHYA 3NHQA 4HP4A 5DNMD 4D60A 3UT9C 2ZY4A 1HQ3C 3QHYA 3A3FA 5BNXA 3CMZA 2WZXA 2WAFA 5CGWA 3R7WA 5CTMA 4IBFA 1FCMA 3LIDA 3AZGD 4DMZA 4WYYA 4Y15A 4MN6A 1RP5A 4WM9A 1LHYA 5U47A 1OJ5A 4IEDA 3PR6A 3MQ0A 5M19A 3Q07A 3B0DB 3D4FA 4G92C 4H9PB 1BSGA 4GD8A 4N1HA 5F1GA 2F8NB 3O62D 3LELB 4IJFA 4NZ3A 5DF8A 2MJ6A 1L3LA 4H9PA 1RCJA 4BL2A 3GQZA 4NETA 3LELA 1SKFA 3MGPC 4CLCD 4EV4A 1PRQA 3VMAA 2FH5A 3D9YA 4EEPA 5G18A 1NZUA 3RELD 2W8SA 2G2WA 2G5HC 1GHMA 5B2IB 4R1GA 1EW0A 3A3JA 3V3RA 5B1MB 1P3GB 4QLCB 4FCFA 2WAEA 4J8UB 3REJB 5B2IA 2JN7A 1YAXA 3KS4A 1VQQA 2XFSA 3BFGA 5B1MA 2V9AA 3CUEA 1P3GA 4QLCA 2PD8A 4J8UA 3LR0A 5HPFA 5B2JD 5CPJC 2A24B 2PYOC 4F94A 2VQRA 2VZWA 4KQOA 2XFTA 1S32C 4Z2MH 4X23D 3EQVA 4HBUA 2A24A 1EROA 1LL5A 1IOUA 3IWQA 5AV5D 3C38A 2Z6CA 2V0UA 1KX3B 3MVDB 1V9YA 1YPRA 4E45A 1H0GA 4X69A 1J3WA 1WA9A 1AIWA 3KUYD 4DXCA 3HLEA 4DXBA 2PDRA 1KX3A 3MVDA 1H0MA 1HQ3B 4J8XC 1ZKJA 2J3TD 3T12B 1B67A 3ZG8B 1U35D 3AZEC 2QZ6A 1M18D 2JKTM 5B33C 3C1BD 3UT9A 1HQ3A 1PI5A 4HHDA 4O0PA 2KLIA 2WGVA 2BLSA 1G5UA 3VOYA 4NK3A 5E2GA 4FUWA 4PAUA 5JRGD 5GSUD 1F5MA 3BRMA 3LIEA 4AWLB 2A2LA 1YQSA 3QNBA 4IHQA 4Q0HA 3NQUB 2ZQAA 3Q7VB 5CHMA 1SDNA 1XFNA 4ID4A 1G6OA 1XJ3A 5GXQC 4QD4A 1P34D 3Q7VA 4HH2A 2F8NG 1GSXA 1UR9A 4JPMA 1ZLAD 1M19C 2FJ7C 2ZLYA 4B93A 4KZ7A 4IBBA 4M6BA 3MGPA 2CV5C 1E3UA 4LRZE 5AV8B 1KX5D 4KZ3A 4PM6A 2V1AA 5GHZA 3ZQ5A 3M6HA 3AZNC 2QKPA 3QP1A 5FDSA 4GHLA 5KSCA 4KG5A 3B42A 5AVCD 4GDBA 3UTBD 1E6RA 1ES2A 3NIAA 1BLCA 1UGUA 3FWLA 1VHMA 4K08A 5CPJB 5HAPA 2PYOB 4HIAA 3TRCA 5B31C 3AZHC 1S32B 1OTBA 3NCKA 4ZBJC 4WZSB 5CPJA 4MBFA 2PYOA 4EBPA 3MMHA 1S32A 5FASA 4LGWA 5EOOA 4MB3A 4KZ8A 4OOMA 2W27A 3B6FB 2RL3A 4DQYB 3MSHA 1GCEA 3BFEA 2OWHA 5CPID 1E6NA 3G32A 4J8XB 1E4DA 1L0FA 4K0XA 1P3FD 1VM1A 3AZEB 3OLOA 2EX8A 3F1PB 5B33B 4J8XA 3IT9A 5B40D 3BLSA 3FKWA 4MNRA 2D02A 2GZAA 5FAPA 3AZEA 3N8SA 2ZM2A 3F1PA 3WD4A 5B33A 4GH9A 2HGVA 3KX0X 1CI8A 5F69A 3EGDC 3EPJA 1K38A 3K2NA 1FIKA 3EQUA 4ZJ1A 2EWVA 3AL0C 3BJNA 4J8WB 4X55A 1MWTA 3AZMD 1NZOA 1M19B 3QP5A 3N4IA 2FJ7B 2XK1A 2D01A 4EXOA 5FQMA 1P3LD 5GXQA 3IWIA 2CV5B 2IA2A 3TJZC 3WD0A 4Z2GA 2E8IA 2R78A 1M19A 2FJ7A 4NYUA 4N1XA 3AZNB 4OPZA 4QY5A 3MGQC 3IF5A 2ZL1B 3MKEA 3NC8A 2CV5A 1P3OD 2J3TC 4KQRA 4O8GA 2ZD8A 3BLMA 5HPIA 2IO5C 1YU4A 3AZNA 1U35C 2KX6A 2WK0A 3C1BC 1P3MD 2ZL1A 3VH5A 5AY8D 3AZGB 2PT7A 1YLWA 5CPKD 3WD2A 3SH9A 2Y2KA 2JKRM 5DKKA 1NXYA 3U4LP 2XQZA 2P08A 2PAVP 4FTXA 2PBYA 1O07A 1NJ4A 1TS0A 3NOUC 5B31B 3AZHB 3CJMA 2C6WB 1EAKA 3OPRA 5JRGC 3O62B 1IELA 5EM0A 2GNXA 1N9BA 1I2SA 2XROA 4KZ4A 4KQQA 4JGQA 3AZIC 2V5OA 5B31A 3AZHA 2H28A 3SOIA 2EWWA 4KUDC 1JNUA 4XUJC 1BFMA 4YS3C 1Y28A 3FKEA 1LI0A 4II7A 4X1LA 1F66D 3AGFA 5AV9D 3RELB 2K2NA 1E15A 1W79A 3IH9A 1KX5C 3G2YA 4KUOA 3B47A 3RELA 3KSFA 2YFWB 4S2PA 3ZG7B 3LELD 3UTAC 1TS6A 4I3IA 1XPBA 5M1AA 5AVCC 2K7SA 2YKHA 5B1LD 3UTBC 1M6KA 2YFWA 4KZ9A 5DTKA 5HWWA 1KGEA 3ZDJA 4LD9C 3IF6C 3LZ0C 3VH5W 4WU8D 2CMNA 3T1QB 4DE2A 2P9VB 5TGFA 2Y2QA 5G49A 4X23B 2WKQA 1DJAA 3W99C 4R8PC 2M7UA 2UV0E 5AV5B 2XA7S 2NZDC 4NE3A 2P9VA 3DAVA 4DRAA 4UUZB 2VX8A 1H8YA 3A6NC 2HV1A 4CQHA 4QLCD 4KGCC 3KUYB 3VP4A 4J8UD 1IFQA 4UUZA 3FYZA 3MGQB 1K57C 4Z66C 4S2IA 2VGJA 4PPRA 4S2KA 2IO5B 1QO6A 1N9OA 1U35B 3S4XA 3Q7ZA 1M18B 3MGQA 3BW6A 3C1BB 5B0YC 4TX8A 1MKMA 4I5SA 3IXGA 2PYPA 3A3DA 1U35A 3NDGA 4R70A 5EM1A 1GHPA 3C1BA 3W97C 1P9WA 4L9FA 5GSUB 5JRGB 3KYZA 3LI9A 3MVDD 3S22A 4Z2JA 1ED7A 3VOZA 3IX8A 2P7JA 3AZIB 5FATA 3AZFC 4ME4A 3IX3A 5JRGA 1KX4C 4EESA 3HSHA 4KUDB 5HWTA 2HP5A 4E3NA 3UT9D 3AZMC 4XUJB 2FFFB 5B31G 3PBQA 3AZIA 4YS3B 4XUZA 5FAQA 4GZBA 1P3BD 3O88A 2Y91A 4JXVA 4KUDA 3HLBA 1W2EA 4LRXC 4A5RA 4XUJA 4YS3A 3AZJC 4OJLA 1XP4A 2GJ3A 3AGDA 1PIOA 5AVFA 4GN2A 1KX5B 2JCHA 1UWNX 3WD1A 3ZYTA 5GL9A 4HBTA 3VOLA 1ALQA 1KX5A 2VGLM 1MC0A 5AVCB 2AROC 3UTBB 5BOHA 1J7MA 3JVVA 2JBFA 4KZAA 5AY8C 1H0IA 2G2UA 1W1TA 4LD9B 5GLDA 5AV6D 2BASA 3IF6B 5AVCA 3LZ0B 1KE3A 3UTBA 3MGPD 1E3UD 3LICA 5G4ZA 4LD9A 1AOIC 4NEED 4X53A 4L9GA 3IF6A 3LZ0A 3AYWD 4LV1A 1W63Q 2JKRI 4R8PB 3LY4A 4H9RB 2NZDB 1OTEA 3MGRD 1ZHHB 3IH8A 2W3EA 2HP9A 2HJEA 3NBLA 3W99A 3W8KA 4R8PA 3A6NB 4E3JA 4KGCB 2NZDA 3WWXA 3QP2A 1F66C 5CPIB 3T1XA 4WV4B 5AV9C 4FD8A 3LJAD 4Z66B 4HMEA 3LFVA 3W96C 3A6NA 4CLCE 1ZTUA 4KGCA 2I9VA 3VSKA 1LSVA 5CPJD 5CPIA 1K57A 2QJ5A 4KZBA 2PYOD 5B0YB 4Z66A 3C4OA 3ZVTA 3OZHA 4LRYC 3AFAD 4EWFA 4HY8A 4E3IA 2VJWA 5BT1D 1KOUA 3MFDA 1E6ZA 4XUXA 3W97B 5B0YA 1ULYA 1OPXA 5B1LC 3C30A 4HESA 2JC7A 4GW9A 1GSVA 3KO6A 1HVBA 4OLGA 5L09A 3HONA 4EETB 4Y0TA 3IP4C 3W97A 1Z09A 3AZFB 4QNLA 1KX4B 1ID3D 4WU8C 3DW0A 5A93A 3AZMB 5EVIC 1LSWA 3G35A 3AZFA 3O86A 1Q2QA 1KX4A 1S6RA 4QPRA 4E3LA 2AVXA 3AZED 3A3IA 4CAYB 4JXGA 5B33D 1LL9A 4DDSA 3AZMA 5TBMB 5DF7A 3AZJB 4OONA 4E6XA 2Z2MB 3GECA 5HARA 5CECA 3N6IA 3A0VA 4CAYA 5FL3A 5TBMA 3AZJA 4QHCA 1P3OB 4UHUA 5GHYA 5EV0A 2AROB 4RA7A 2WGWB 1LI9A 3NI9A 1P3MB 4OPQA 1P3OA 1YLTA 2PRFA 5AY8B 4EBNA 1ZG4A 3ZVWA 3WRZA 3REKC 3E4QA 4HGAB 5GXQD 2AROA 1TDLA 2WGWA 5AY8A 1M19D 1AOIB 3V3SA 4IJGA 2Z6DA 5A92A 2V1ZA 1YLPA 1YSPA 2CC1A 3PBOA 1F98A 5FUGB 3X1VC 2CV5D 2L4RA 2ZQCA 3MXQA 4ZUXC 5BNXB 1AOIA 3HJIA 4JGRA 4J8VC 1T1AA 5CX7A 4LLOB 5FUGA 4GLQA 5HL6A 2HUEC 2O9BA 2Q0OA 4E3OA 1P3BC 2D49A 1F66B 1I5QA 2A3UA 5HWVA 5AV9B 4GS9B 3W96B 3NQJB 4OJ5A 5FEFA 3OBFA 2INWA 5KDMA 1F66A 5HD5A 1RGZA 4Z9QA 5AV9A 2H0TA 4GS9A 3W96A 3NQJA 5B31D 3AZHD 2J9OA 3P7NA 1T1BA 1IKIA 3WX7A 5MC7A 2A49A 5B1LB 2PD7A 2E8JA 2RCXA 2IOUA 1SZVA 5AV6C 4H9SC 3PBSA 5GT0C 3N8RA 5GLBA 3FC7A 5B0ZC 4IBDA 5B1LA 2L0WA 1XJ6A 4WU8B 3LZ1D 4Q8IA 3LIFA 4HP9A 3G4PA 3AYWC 5I94A 3R4KA 4DN0A 4P0MA 4WU8A 3WTPD 3WKJD 1FCOA 3MGRC 1ZC2A 5AQAA 5EVIA 3E2KA 4UQIS 3EWKA 4I39A 3HLWA 3IQAA 1RGYA 4KG2A 3UPNA 3Q81A 2W0NA 4EO5B 1O6IA 3LJAC 2ZY3A 3UDIA 1YT4A 1HTZA 1VEUB 5JYOA 3DTMA 2K31A 1W5DA 4S2LA 4WEJA 3EEHA 4WN5A 3C1CC 5HX9A 5DFYA 3AFAC 3VSLA 3TW8A 2RVQD 2Y2NA 1VEUA 3F1NA 1S0WA 3G30A 3OOVA 5BT1C 2ZJ9A 1UWPX 5DJTA 1Z2CB 3IXHA 4Q0JA 1BLSA 2ZQ8A 2W3DA 3GR2A 3CPTB 1WWIA 4R0QA 3REKA 3OCNA 4PHTA 3RTYA 3SS3A 1MWUA 1D1JA 3X1VB 3UNWA 3VE4A 4ZUXB 3C7UA 3CPTA 2Y59A 3M2KA 4J8VB 3AV2C 1ID3C 1NYYA 5DTTA 1SDEA 3MGQD 1YKDA 3UT9B 3X1VA 4YM6D 1BUEA 2HUEB 1BLPA 4OQIA 4ZUXA 1P3BB 2ZY2A 5EPHA 4J8VA 5BS7C 2Y2GA 3D72A 3TSGA 2G5IC 1PFLA 4I38A 1P3BA 5IS1A 1MPLA 3H7WB 4CPKA 5J3WA 1P3ID 3CG5A 1VETB 4G92B 2XSSA 3TU4D 2DMWA 1FR6A 2XEPA 3LUQA 3H7WA 2JKFA 4LV3A 4AFIA 3KWQD 1VETA 4R3BA 5CHUA 3AZID 4KG6A 1V9ZA 4HMDA 1GHIA 3MF0A 5HSQA 2VV7A 5AQBA 5F82A 3LEQA 4KUDD 5I5LA 5AV6B 3QP6A 1HZOA 5CHLB 5GT0B 4GKUA 1OTIA 4XUJD 5B0ZB 1NLZA 3B3XA 4YS3D 3N3FA 5CEDA 3MGPB 4CSRB 4MCWA 2YFVB 4E04A 1O7EA 5AV6A 4H9SA 1CEGA 1E8BA 5GT0A 1T3UA 4IUHA 4OQHA 3AYWB 5B0ZA 2EFXA 2FN2A 4BWIA 4HH3A 4CSRA 4OLDA 3UB8A 2YFVA 2ZC4B 3MGRB 2ZOHA 3VP3A 4WJ3C 3C4PA 3PBTA 3AYWA 2H5SA 4I3JA 3UTAD 3PAGA 4ZRRA 3MGRA 4CJNA 2WYXA 4QU3A 3LJAB 4ARZB 1CF0A 4LD9D 4X56A 2J80A 4QB8A 4EEUA 1XJ2A 5JYPA 3S7QA 3LZ0D 4NXBA 5A8BA 3LJAA 3IHBA 4ARZA 1M1AC 3G2ZA 3IX4A 3AFAB 1E88A 4R4SA 3T4LA 4EERA 4OJOA 1ESUA 3W99D 3Q1FA 1YM1A 4HMCA 4R8PD 5HL1A 3C1CA 2NZDD 3AFAA 3LR3A 1TF1A 4IBGA 4K0WA 1TAFB 2R9XA 1W8YA 5CERA 3F1OB 4HNBA 3TG9A 4BMWA 1P3KC 3A6ND 4KGCD 1DP9A 4RQ9A 1ID3B 5DJUA 1TAFA 1LLBA 4EQ1A 3LZ1C 1IYOA 1PNEA 3F1OA 4Z66D 1KVMA 3O5YA 4G91C 5M18A 1K54C 3L9KA 1ID3A 3UDXA 3WTPC 1BULA 3WKJC 5B0YD 1ONHA 1SKOB 5BS7A 1FR1A 3S7OA 3WS4A 3W97D 2J3WA 2Q9MA 5E43A 4C3QA 1SKOA 3X1SC 4C6YA 3SW1A 3LEZA 5C3IC 5CGXA 4JGOA 3AZFD 5GLAA 3DBAA 4P6ZM 1ES5A 1KX4D 1XKZA 4JF4A 1IEMA 2RVQC 5GXQB 1DJCA 2QHKA 4HQAA 4DJ3A 1H3OB 4UA7A 3AZJD 2DCFA 1H3OA 3L25A 3BM6A 1NRJA 3OPPA 1E6PA 3AGEA 2ZMAA 5F6AA 3HUNA 4YM6C 4HJ6A 5AVEA 3BWLA 1ZG6A 2AROD 5DFXA 4OOYA 1K0KA 4WLAA 1XGIA 5EOEA 5EVLA 1AWIA 3WS5A 2UWXA 3QP8A 1P3IC 1H5XA 5FQIA 3B6GC 3JYIA 3MBZA 3V39A 2PR6A 3VP0A 1AOID 2JKTI 3TU4C 4R3JA 3PHYA 4FH2A 4ZBJB 1K6RA 2B95A 3KWQC 3UB9A 5CP6C 1M1AA 3HREA 4JXSA 5KMWA 1F9IA 3LY3A 1DY6A 3V5MA 4S2OA 2PU4A 2CWEA 2W1TB 3MJQA 1P3KB 1K25A 1N4OA 4M4XA 1GSWA 3LZ1B 5KSHA 1EQZC 2W1TA 4QWOA 4H8RA 2WADA 3IHAA 3HLGA 1P3KA 2DRWA 3UDFA 3W96D 3GVBA 1S1ZA 4BENA 2BYKA 4G91B 2QPNA 3HLDA 3N8LA 3NECA 4WZ5C 5AQ9A 1BLHA 3WTPB 3WKJB 4WL9A 3LYXA 3LZ1A 4JF5A 5HAQA 5HAIA 4IBIA 4IBKA 1K54A 3WTPA 3H9WA 3WKJA 4BD0A 3A0SA 1S4RA 3T4JA 4DE1A 3X1SB 2G7UA 1NWZA 5G49B 5C3IB 3L27A 4R38A 2GDNA 3EEAA 3EOIA 3NOTC 2KOIA 1G68A 4BL3A 3AN2D 3X1SA 5FQ9A 3WAAD 4MBKA 5EVID 2DF4C 2Y55A 1K4FA 3MZEA 4ZDXA 1S66L 4ZJ2A 3VV4A 4LG2A 4ZBEA 2WKEA 4KUKA 2ZBBA 4ETXA 3LIBA 3QP4A 3IS2B 1OJGA 4JXWA 4KZ6A 5FQKA 5EECA 1ESIA 2XLNA 4YM6B 4OJ6A 2EXBA 1WE4A 3IS2A 1H8PA 1LL8A 4E3KA 1FILA 3C8CA 3VP1A 4YM6A 2WKRA 4NFTA 3O3VA 5B32D 3REKD 1S67L 3ITAA 5L8MA 5TJJA 4HEFA 4Y5FA 1P3IB 5B24C 1M40A 1YU3A 4K91A 4WNNB 5CHJA 3T1RA 4L0LA 3TU4B 1BYWA 2VKSA 2HF6A 1P3IA 3KWQB 3X1VD 3B6GA 4WNNA 5CP6B 4JJNC 2YKFA 3MZDA 4ZUXD 3HL9A 4LENA 3TU4A 4J8VD 4E44A 3PYPA 5GLCA 4H9QB 3KWQA 2J8YA 3MGSC 5CP6A 5AVBD 3X1TD 3VFHA 1H8ZA 1NLYA 5DNNC 2Y2JA 1OTDA 1BTLA 5HDDA 4D2OA 4H9QA 2B18A 2PR5A 2Q9NA 4OH0A 4NZ4A 4LCMA 2EXAA 1KU5A 3LR4A 4IBCA 3W4QA 1HD8A 5E2EA 3OCLA 3A1IA 1EQZA 3REHC 1MXOA 3B0CT 4EUVA 1A0KA 3WRTA 2WKHA 3D3OA 3E0YA 4WZ5A 3UTAB 2W3HA 2QMIA 5G4YA 1OTAA 3DTEA 4RX2A 2L5AA 3JPUA 3UTAA 4GDNA 5D3OA 4Z2HA 5GT0D 1NYMA 3MS6A 5B0ZD 3L7HA 3BECA 1E25A 3H0MC 4N9LA 4WEKA 3P09A 4KENB 3EPLA 3W99B 2Y2PA 1ERQA 4JKTA 3RFBA 1HTAA 3R45B 3BQ8A 1OGGA 4HJ3A 4X25A 2LB9A 2HIOC 4HJ4A 3AZLD 3CAXA 1KGGA 1CQAA 4FOFA 3O87A 3R45A 1JWVA 4NYYA 2V20A 3EPHA 4LV2A 2KDKA 1J9MA 5FDHA 3AZKD 4WUJA 3C1CD 3WTPE 1G28A 3EGXC 1NY0A 5EE8A 5F83A 3E98A 3GTCA 4DE3A 4YINA 1MWRA 4R3AA 2EFUA 5CXWA 3P5JB 5B24A 3E4OA 4GCZA 4JJNB 4Y3IA 4BLMA 3UE1A 4H9NB 3AV2D 4IUKA 2ZQ7A 3AN2C 3UMDA 3GRJA 3ULFA 3WAAC 3MGSB 4JJNA 5AJGA 2WGIA 4H9NA 2PU2A 4Y0OA 4MN7A 2P74A 5GT3C 2ZM8A 1OT6A 3HCYA 3S7PA 3MGSA 5AQ7A 5JA4B 5DNNA 2Z2LB 5HDCA 1MY8A 4XXRA 2OLVA 2VGKA 3EG5B 2XR0A 2IWCA 5JA4A 2J7VA 3SS4A 1GOIA 3T4QA 3MQOA 3SS5A 3DWKA 3B33A 5L07A 2H0YA 1LSXA 2B5RA 5HW3A 4C75A 5B32C 1W7FA 1H3QA 4GHAA 2WZZA 4S2JA 5B1MC 5IU1A 4U0TA 3X1UC 2J8PA 2O0YA 3L26A 3REJC 3E2LA 4B4XA 1G6AA 1R4VA 4Z5TC 4B88A 4OPYA 1KE0A 3UB7A 3I7JA 3G31A 3ZG9B 1ERMA 5AVBC 4IJEA 3X1TC 3REIC 3CI6A 1YLJA 1SCWA 1TDGA 2VEAA 5KDMB 5FI2A 1CK3A 3DTKA 1DJBA 4PKYA 3H0RC 1PDCA 4KQDA 3PBNA 4HI4A 2HIOA 3U2AA 1WYCA 3UPOA 1M1AD 3VH6T 2JSSA 4XZQC 1CEFA 1D7EA 4E6WA 1YU1A 1FSWA 2OOLA 3GMWA 3JVUA 1JVJA 4NXEA 2Y2HA 1T1CA 1YU2A 3OPLA 1Q9CA 1TEMA 3LO7A 4Y0UA 5F99C 3IWOA 5HD3A 3F6TA 1XJ4A 3FKVA 2NUPC 4PM5A 1VB6A 1P3KD 1KS0A 3C5AA 1W1PA 3ICYA 1TS7A 3BY8A 4Z2MG 3AN2B 2RIQA 3WAAB 4BBUA 5EVIB 4O7DA 3B0BA 4X68A 4FH4A 5LBRA 4AWLC 3IBJA 1IKGA 3HUOA 5CTNA 3MNNC 3AN2A 5GT3B 4QY6A 3GV9A 4Z2IA 2F8NA 3WAAA 3A3EA 1L0EA 3ZFZA 4NG2A 1MKIA 1S4SA 5HFOA 5GT3A 2F2AC 4JGPA 2X01A 1P3PD 2L1MA 3AZLC 2W1RA 1TZYD 5HDSA 3ZGAB 1X0OA 3X1SD 3KXBC 1XFQA 3F1NB 4LV0A 3UE6A 3SH7A 1YLZA 4ESPA 4DE0A 3UY6A 3LIAA 5AV8C 3A1KA 3AV1C 2EA9A 1QMEA 3AZKC 4B9OA 5B32B 3REKB 1DP6A 4DDYA 3RJUA 1PYYA 1IYPA 3X1UB 3NY4A 4NKPA 2V1BA 5KIZA 5E5AD 3VFFA 5CRFA 4Z5TB 5B32A 3BQAA 4GD6A 3X1UA 3C2WA 2Y2LA 3L2AA 3REJA 3ZNTA 4X1MA 5DVAA 4Z5TA 2NQBD 5AVBB 3X1TB 4WF0A 3REIB 1BT5A 1LT0A 4X6TA 3MFXA 4WBGA 2XA7M 2OAP1 2V2FF 3UN7A 5AVBA 3X1TA 3CHWP 3REIA 1P3AC 3DTIA 3B6FC 1D06A 1XGJA 4PKYG 3W98C 4M3KA 5IT5A 2IWBA 3B6GD 2ACGA 4XZQB 4DRBA 4WMCD 1B6WA 3L29A 3KSHA 4S2NC 1STZA 2VGLS 1P97A 5EVEA 5CP6D 4XZQA 4R4RA 3W4OA 5F99B 4NXFA 1UR8A 4ZAMA 3WA9D 4Z2LA 5KZHA 4WU9C 1FOFA 5F99A 4EW7A 1H8MA 2QYBA 1ACFA 1EQZD 4YFMA 2XGNA 3UB6A 1MBLA 2RTSA 1CK7A 3HLFA 3T50A 3MNNB 3ZG5A 3KYEA 1OGBA 1CI9A 3RXWA 3ISGA 4J8WC 2VV8A 5CEBA 4H9OB 3MNNA 3NQUA 3FZCA 1FQGA 5FSRA 3AZLB 1DP8A 1GXDA 2O9CA 5FQQA 4IBEA 3P98A 5IHVA 4H9OA 2J9PA 2V8CA 3KXBB 4N92A 1U60A 3AZLA 3Q82A 3SZTA 3AV1B 1L2SA 2QJ7A 3MQQA 3AZKB 5DNMC 3C1CB 3KXBA 1Y4OA 4U3TA 4OPRA 5AV8A 3ZG0A 2Y2IA 3VE3A 3AV1A 1PW8A 3V50A 4PM8A 4ZTKA 3AZKA 3WS0A 4G3WA 2LB5A 3T4OA 4HOIA 2HDUA 3ZCZA 3AZGC 3WD3A 4Y17A 5B32G 3NJAA 3AV2B 2F8NH 2BYMB 3O62C 2DQNC 5FQJA 3RXXA 1JFIB 2BG1A 1YU0A 3AV2A 2F8NK 1T18A 1JWZA 2BYMA 2LY8A 1P3AB 1JFIA 3K3DA 5E2FA 1T19A 3KSYA 5B24D 3W98B 4CLCC 1P3PC 2ZC6B 2ZC5B 1ONGA 1TZYC 2HPBA 1P3AA 1W8QA 3B6FA 2HDRA 3RELC 4MB5A 1K56A 4MBHA 3W98A 4LCLA 4JJND 1SHVA 4R23A 4OP5A 4WELA 1ES3A 4IVKA 4S2NA 5DKLA 3B0CW 3MGSD 1KE4A 3V9RB 5DNND 4WU9B 4JLFA 5E5AC 2OLUA 2O99A 3SH8A 1KDWA 3V67A 3T1SA 4OVDA 3V9RA 4WU9A 3A0RA 5FA7A 3UO9A 5B2JC 3IXDA 3ZNYA 1BH9B 3REHD 4EBLA 2NQBC 1Q2PA 4OOLA 2VV6A 2VA0A 4DRTA 3VP2A 4X23C 2QWSA 4WZ4A 1BH9A 2H10A 5AV5C 4J8WA 1XA7A 3HVFA 3CITA 3UE3A 4GB7A 3CZDA 3BFDA 1EWZA 1FCNA 4PM9A 3N7WA 3KUYC 2ZM5A 1M1AB 3QNCA 1PWGA 5DNMB 4Y13A 1QMFA 4UPKA 1GA9A 3PXPA 3KS8A 2JHEA 4MEZA 3E4PA 2XDMA 5DNMA 1M18C 3S1YA 4U0XA 4OQ0A 5A91A 3HLCA 3WA9C 2XF3A 2B02A 5HZHA 2BYKB 4IBXA 2HIOD 4RVAA 4RX3A 4P87A 3AZGA 1S1YA 2HDQA 1W1VA 4YOFA 5GSUC 2OAQ1 1JTDA 4F3LB 3LGOA 4KZ5A 4DF6A 2VLGA 3KFUG 4MLLA 2FFYA 4EUZA 2EX9A 5EFWA 1L0GA 3O62A 4Z1WA 4F3LA 1JTGA 1OT9A 1P34C 3OPHA 5FEGA 1PW1A 4NE5A 4CLCB 2X71A 1P3PB 3NULA 1ZLAC 2ZC7A 3OC2A 5CGSA 1TZYB 2WUQA 4I3AA 2WKPA 3KSGA 1JWPA 5A90A 3MZFA 3EPKA 1XX2A 3G34A 1N9NA 4CLCA 1P3PA 1CXWA 3VH6A 1EI5A 1PZOA 1TZYA 4L9EA 4OQGA 3G6OA 1TVFA 1IYQA 3BFFA 1PWCA 4YWZA 1DRMA 2F8ND 2P04A 1XXMA 1L0DA 5E5AB 3TOIA 5GT3D 1BZAA 1PWDA 2V0WA 4UAAA 1XA1A 1CJFA 4NY2A 4NE6A 5B2JB 3FG8A 3T4SA 5E5AA 2ZC3B 1TS8A 2Y2MA 2NQBB 3GSGA 1C3BA 1MZUA 4FSFA 1FSYA 2EX2A 1YSQA 3BY9A 4ZJ3A 4KHAB 5B2JA 4EU0A 3H82B 1HLUP 2NQBA 5F1FA 4KHAA 3LR5A 4X23A 5B2ID 5GHXA 2O9AA 2XD1A 4UQIM 2V8FA 3H82A 3FPVA 5B1MD 4OUIA 5AV5A 1P3GD 2NUTC 3X1UD 3B6GB 1F2KA 4RYEA 3REJD 2ZOIA 4GNUA 4IBRA 5CPIC 2OSUA 4Z5TD 1GPFA 1P0ZA 4G3KA 1P3FC 3KUYA 1ES4A 3PAEA 4WMCA 3W2ZA 5DF9A 5TFQA 5B40C 3WA9B 1W1YA 4GOGA 3VH6W 3REID 1M18A 4S2MA 2Y2OA 3KYQA 3LCEA 1WWSA 1EQZB 3WA9A 3TE8A 3HJKA 3WS2A 1OMEA 1KX3D 4GHIB 3UB5P 3P01A 1YMXA 3W4PA 5GSUA 3M2JA 3CWFA 4XZQD 1MWSA 4LFUA 1PI4A 4GHIA 5BO0B 5L10A 1HQ3D 5BPVA 1P34B 5FI7A 3HUMA 2XD5A 2JE5A 1ZLAB 2Y4AA 2ZMFA 2X02A 3MQLA 4UEYA 5F99D 3IXBA 5BO0A 1P3LC 4JF6A 3FPWA 3ITBA 4P6BA 2BTFP 1P34A 4DJ2A 1KGFA 1ZLAA 3T4KA 1YMSA 5J7EA 2HDSA 3T4TA 5F5YA 4NZ5A 1P3OC 1KDSA 4NXGA 1TD5A 4GJ4A 5J8XA 3MNND 1ODVA 1P3MC 3FDDA 1K55C 4YNRA 5CPKC 5FAOA 4HGAC 4NZ1A 2OV5A 2XRNA 3L28A 4MN5A 3MXSA 4BQMA 2VK3A 3DWZA 3RH8B 4OP8A 1WYBA 4OKPA 5TR7A 3KXBD 2HZ5A 2M7VA 4XT2B 5AV8D 3H0LC 4IVIA 3AV1D 2ZQDA 5L2FA 1BH8B 3UPPA 2Y79A 3K3CA 5B24B 4H9RA 1KVLA 4XT2A 3BYDA 4MMNA 4R6LA 2EX6A 1BH8A 1Z6FA 4BJPA 2IWDA 5C5KA 2PBDP 3NDEA 1W63M 3HBRA 5F68A 1P3FB 5J4EA 1Y54A 2OWJA 4Y7PA 2Y8HA 4P6ZS 1I2WA 4LPZA 1N1JB 3B0DC 5B40B 4BBTA 4Q0IA 1S32D 1P3FA 3BEBA 2R9WA 3LELC 1A7WA 1YLYA 5DNNB 3LI8A 1N1JA
chains in the Genus database with same CATH topology
5B40A 2C5WB 1PZRA 4DKIA 4QJGA 4IBJA 3UE0A 2I72A 4JBFA 1P3AD 3B6FD 3BFCA 1K56D 3REHB 3W98D 4B4ZA 4P85A 5FI6A 2WKIA 4N9KA 4J8XD 3PBRA 4E3MA 3WS1A 1NRFA 3REHA 1K6SA 4PM7A 3ZHHA 4PMAA 4EQIA 5DTSA 1P3LB 1YUEA 1K4EA 5B2IC 2ZY5A 3VH5T 3PTEA 1P3GC 1PZPA 4QLCC 4OJPA 4WU9D 2ZM0A 4J8UC 1P3LA 1AXBA 1GA0A 4EO5C 3FV7A 2ZQ9A 3C7VA 3M6BA 4J8WD 3MKFA 4UA9A 5CPKB 2HP6A 5BNVB 2XH9A 4BD1A 1F1EA 1P3MA 2HIOB 5E2HA 2FJ7D 1K55A 2DNSA 3MXRA 5CPKA 1KX3C 3MVDC 1IYSA 5EUAA 5BNVA 4UA6A 3AZND 5DNMD 3UT9C 2ZY4A 1HQ3C 3QHYA 3A3FA 5BNXA 3CMZA 2WZXA 2WAFA 5CGWA 5CTMA 4IBFA 1FCMA 3AZGD 4WYYA 1RP5A 4WM9A 1LHYA 5U47A 4IEDA 5M19A 3Q07A 3B0DB 3D4FA 4G92C 4H9PB 1BSGA 4GD8A 4N1HA 5F1GA 2F8NB 3O62D 3LELB 4IJFA 4NZ3A 5DF8A 4H9PA 1RCJA 4BL2A 3GQZA 4NETA 3LELA 1SKFA 3MGPC 4EV4A 3VMAA 5G18A 1NZUA 3RELD 2W8SA 2G2WA 2G5HC 1GHMA 5B2IB 4R1GA 3A3JA 3V3RA 5B1MB 1P3GB 4QLCB 4FCFA 2WAEA 4J8UB 3REJB 5B2IA 3KS4A 1VQQA 2XFSA 3BFGA 5B1MA 1P3GA 4QLCA 4J8UA 5B2JD 5CPJC 2PYOC 4F94A 2VQRA 4KQOA 2XFTA 1S32C 4Z2MH 4X23D 3EQVA 4HBUA 1EROA 1LL5A 3IWQA 5AV5D 1KX3B 3MVDB 4E45A 4X69A 3KUYD 4DXCA 3HLEA 4DXBA 1KX3A 3MVDA 1HQ3B 4J8XC 1ZKJA 1B67A 3ZG8B 1U35D 2QZ6A 3AZEC 1M18D 5B33C 3C1BD 3UT9A 1HQ3A 1PI5A 2WGVA 2BLSA 3VOYA 4NK3A 5E2GA 5JRGD 5GSUD 3BRMA 4AWLB 1YQSA 3QNBA 3NQUB 2ZQAA 3Q7VB 5CHMA 1SDNA 4ID4A 5GXQC 4QD4A 1P34D 3Q7VA 2F8NG 4JPMA 1ZLAD 1M19C 2FJ7C 2ZLYA 4KZ7A 4IBBA 4M6BA 3MGPA 2CV5C 1E3UA 5AV8B 1KX5D 4KZ3A 4PM6A 5GHZA 3M6HA 3AZNC 4GHLA 5KSCA 4KG5A 5AVCD 4GDBA 3UTBD 1ES2A 3NIAA 1BLCA 3FWLA 5CPJB 5HAPA 2PYOB 5B31C 3AZHC 1S32B 3NCKA 4ZBJC 4WZSB 5CPJA 4MBFA 2PYOA 4EBPA 5FASA 1S32A 5EOOA 4KZ8A 4OOMA 3B6FB 2RL3A 4DQYB 1GCEA 3BFEA 3G32A 5CPID 4J8XB 1E4DA 1L0FA 4K0XA 1P3FD 1VM1A 3AZEB 2EX8A 5B33B 4J8XA 3IT9A 5B40D 3BLSA 3FKWA 4MNRA 5FAPA 3AZEA 3N8SA 2ZM2A 5B33A 4GH9A 1CI8A 3EPJA 1K38A 3EQUA 4ZJ1A 3AL0C 4J8WB 4X55A 1MWTA 3AZMD 1NZOA 1M19B 3N4IA 2FJ7B 2XK1A 5FQMA 1P3LD 5GXQA 3IWIA 2CV5B 2E8IA 1M19A 2FJ7A 4NYUA 4N1XA 3AZNB 4OPZA 4QY5A 3MGQC 3IF5A 3MKEA 3NC8A 2CV5A 1P3OD 4KQRA 2ZD8A 3BLMA 2IO5C 1YU4A 3AZNA 1U35C 2WK0A 3C1BC 1P3MD 3VH5A 5AY8D 3AZGB 1YLWA 5CPKD 3SH9A 2Y2KA 1NXYA 2XQZA 2PBYA 1O07A 1NJ4A 5B31B 3AZHB 3CJMA 2C6WB 3OPRA 5JRGC 3O62B 1IELA 1N9BA 1I2SA 4KZ4A 4KQQA 3AZIC 5B31A 3AZHA 3SOIA 4KUDC 4XUJC 1BFMA 4YS3C 3FKEA 1LI0A 1F66D 3AGFA 5AV9D 3RELB 1W79A 3IH9A 1KX5C 3G2YA 3RELA 2YFWB 4S2PA 3ZG7B 3LELD 3UTAC 5M1AA 1XPBA 5AVCC 5B1LD 3UTBC 1M6KA 2YFWA 4KZ9A 5DTKA 1KGEA 3ZDJA 4LD9C 3IF6C 3LZ0C 3VH5W 4WU8D 4DE2A 2P9VB 5TGFA 2Y2QA 5G49A 4X23B 1DJAA 3W99C 4R8PC 5AV5B 2NZDC 4NE3A 2P9VA 4DRAA 4UUZB 1H8YA 3A6NC 4QLCD 4KGCC 3KUYB 3VP4A 4J8UD 4UUZA 3FYZA 3MGQB 1K57C 4Z66C 4S2IA 2VGJA 4PPRA 4S2KA 2IO5B 1U35B 3S4XA 3Q7ZA 1M18B 3MGQA 3C1BB 5B0YC 3IXGA 3A3DA 1U35A 3NDGA 1GHPA 3C1BA 3W97C 5GSUB 5JRGB 3MVDD 3S22A 3VOZA 3AZIB 5FATA 3AZFC 5JRGA 1KX4C 3HSHA 4KUDB 2HP5A 4E3NA 3UT9D 3AZMC 4XUJB 2FFFB 5B31G 3PBQA 3AZIA 4YS3B 4XUZA 5FAQA 4GZBA 1P3BD 3O88A 2Y91A 4JXVA 4KUDA 3HLBA 1W2EA 4A5RA 4XUJA 4YS3A 3AZJC 4OJLA 1XP4A 3AGDA 1PIOA 4GN2A 1KX5B 2JCHA 5GL9A 4HBTA 1ALQA 1KX5A 5AVCB 2AROC 3UTBB 5BOHA 2JBFA 4KZAA 5AY8C 2G2UA 4LD9B 5GLDA 5AV6D 3IF6B 5AVCA 3LZ0B 1KE3A 3UTBA 3MGPD 1E3UD 4LD9A 1AOIC 4X53A 3IF6A 3LZ0A 3AYWD 4LV1A 4R8PB 3LY4A 4H9RB 2NZDB 3MGRD 3IH8A 2HP9A 3NBLA 3W99A 3W8KA 4R8PA 3A6NB 4E3JA 4KGCB 2NZDA 3WWXA 1F66C 5CPIB 4WV4B 5AV9C 4FD8A 3LJAD 4Z66B 3W96C 3A6NA 4KGCA 3VSKA 5CPJD 5CPIA 1K57A 4KZBA 2PYOD 5B0YB 4Z66A 3C4OA 3ZVTA 3OZHA 3AFAD 4EWFA 4E3IA 5BT1D 3MFDA 4XUXA 3W97B 5B0YA 1ULYA 5B1LC 4HESA 2JC7A 1HVBA 4OLGA 3HONA 4Y0TA 3IP4C 3W97A 3AZFB 4QNLA 1KX4B 1ID3D 4WU8C 3DW0A 5A93A 3AZMB 5EVIC 3G35A 3AZFA 3O86A 1Q2QA 1KX4A 1S6RA 4E3LA 3AZED 3A3IA 4CAYB 4JXGA 5B33D 1LL9A 4DDSA 3AZMA 5DF7A 3AZJB 4OONA 4E6XA 2Z2MB 5HARA 5CECA 3N6IA 4CAYA 3AZJA 4QHCA 1P3OB 4UHUA 5GHYA 2AROB 4RA7A 2WGWB 1LI9A 3NI9A 1P3MB 4OPQA 1P3OA 1YLTA 5AY8B 4EBNA 1ZG4A 3ZVWA 3WRZA 3REKC 4HGAB 5GXQD 2AROA 1TDLA 2WGWA 5AY8A 1M19D 1AOIB 3V3SA 5A92A 2V1ZA 1YLPA 2CC1A 3PBOA 5FUGB 3X1VC 2CV5D 2ZQCA 4ZUXC 5BNXB 1AOIA 4J8VC 5FUGA 2HUEC 4E3OA 1P3BC 1F66B 1I5QA 2A3UA 5AV9B 3W96B 3NQJB 4OJ5A 5KDMA 1F66A 1RGZA 4Z9QA 5AV9A 2H0TA 3W96A 3NQJA 5B31D 3AZHD 2J9OA 1IKIA 3WX7A 2A49A 5B1LB 2RCXA 2IOUA 5AV6C 4H9SC 3PBSA 5GT0C 3N8RA 5GLBA 5B0ZC 4IBDA 5B1LA 4WU8B 3LZ1D 4Q8IA 3G4PA 3AYWC 5I94A 4P0MA 4WU8A 3WTPD 3WKJD 1FCOA 3MGRC 1ZC2A 5AQAA 5EVIA 3E2KA 3HLWA 3IQAA 1RGYA 4KG2A 3UPNA 3Q81A 4EO5B 3LJAC 2ZY3A 3UDIA 1YT4A 1HTZA 5JYOA 3DTMA 1W5DA 4S2LA 4WEJA 3C1CC 5HX9A 3AFAC 3VSLA 2RVQD 2Y2NA 3G30A 1S0WA 5BT1C 2ZJ9A 1Z2CB 3IXHA 1BLSA 2ZQ8A 3GR2A 1WWIA 4R0QA 3REKA 3OCNA 3SS3A 1MWUA 3X1VB 3UNWA 4ZUXB 3C7UA 3M2KA 2Y59A 4J8VB 3AV2C 1ID3C 1NYYA 5DTTA 1SDEA 3MGQD 3UT9B 3X1VA 4YM6D 1BUEA 2HUEB 1BLPA 4OQIA 4ZUXA 1P3BB 2ZY2A 5EPHA 4J8VA 5BS7C 2Y2GA 3TSGA 2G5IC 1P3BA 1MPLA 4CPKA 1P3ID 3CG5A 4G92B 3TU4D 2XEPA 1FR6A 4LV3A 3KWQD 4R3BA 5CHUA 3AZID 4KG6A 1GHIA 5AQBA 5F82A 4KUDD 5AV6B 1HZOA 5CHLB 5GT0B 4GKUA 4XUJD 5B0ZB 3B3XA 4YS3D 3N3FA 5CEDA 3MGPB 4CSRB 2YFVB 1O7EA 5AV6A 4H9SA 1CEGA 5GT0A 1T3UA 4OQHA 3AYWB 5B0ZA 2EFXA 4CSRA 4OLDA 2YFVA 2ZC4B 3MGRB 3VP3A 4WJ3C 3C4PA 3PBTA 3AYWA 2H5SA 3UTAD 3PAGA 3MGRA 4CJNA 2WYXA 4QU3A 3LJAB 4LD9D 4X56A 4QB8A 5JYPA 3LZ0D 3LJAA 3IHBA 1M1AC 3G2ZA 3AFAB 4R4SA 4OJOA 1ESUA 3W99D 3Q1FA 1YM1A 4R8PD 5HL1A 3C1CA 2NZDD 3AFAA 4K0WA 4IBGA 1TAFB 2R9XA 1W8YA 5CERA 3TG9A 1P3KC 3A6ND 4KGCD 1ID3B 1TAFA 1LLBA 3LZ1C 1IYOA 4Z66D 1KVMA 4G91C 5M18A 1K54C 1ID3A 3UDXA 3WTPC 1BULA 3WKJC 5B0YD 1ONHA 5BS7A 1FR1A 3WS4A 3W97D 2Q9MA 5E43A 4C3QA 3X1SC 4C6YA 3LEZA 5C3IC 5CGXA 3AZFD 5GLAA 1ES5A 1KX4D 1XKZA 4JF4A 1IEMA 2RVQC 5GXQB 1DJCA 1H3OB 4UA7A 3AZJD 2DCFA 1H3OA 3L25A 3BM6A 3OPPA 3AGEA 2ZMAA 3HUNA 4YM6C 1ZG6A 2AROD 4OOYA 1XGIA 5EOEA 5EVLA 3WS5A 2UWXA 1P3IC 1H5XA 5FQIA 3B6GC 3JYIA 3MBZA 3V39A 3VP0A 1AOID 3TU4C 4R3JA 4FH2A 4ZBJB 1K6RA 3KWQC 5CP6C 1M1AA 3HREA 4JXSA 5KMWA 3LY3A 1DY6A 3V5MA 4S2OA 2PU4A 2CWEA 1P3KB 1K25A 1N4OA 3LZ1B 5KSHA 1EQZC 4H8RA 2WADA 3IHAA 3HLGA 1P3KA 2DRWA 3UDFA 3W96D 3GVBA 4BENA 2BYKA 4G91B 2QPNA 3HLDA 3N8LA 5AQ9A 4WZ5C 1BLHA 3WTPB 3WKJB 3LZ1A 4JF5A 5HAQA 5HAIA 4IBIA 4IBKA 1K54A 3WTPA 3WKJA 4BD0A 4DE1A 3X1SB 5G49B 5C3IB 3L27A 2GDNA 1G68A 4BL3A 3AN2D 3X1SA 5FQ9A 3WAAD 4MBKA 5EVID 2DF4C 2Y55A 1K4FA 3MZEA 4ZDXA 4ZJ2A 4LG2A 4ZBEA 2WKEA 4JXWA 4KZ6A 5FQKA 5EECA 1ESIA 2XLNA 4YM6B 4OJ6A 2EXBA 1WE4A 4E3KA 3VP1A 4YM6A 4NFTA 3O3VA 5B32D 3REKD 3ITAA 4HEFA 1P3IB 5B24C 1M40A 1YU3A 4K91A 4WNNB 5CHJA 4L0LA 3TU4B 1P3IA 3KWQB 3X1VD 3B6GA 4WNNA 5CP6B 4JJNC 3MZDA 4ZUXD 3HL9A 4LENA 3TU4A 4J8VD 4E44A 5GLCA 4H9QB 3KWQA 2J8YA 3MGSC 5CP6A 5AVBD 3X1TD 3VFHA 1H8ZA 5DNNC 2Y2JA 1BTLA 4D2OA 4H9QA 2Q9NA 4OH0A 4NZ4A 4LCMA 2EXAA 1KU5A 4IBCA 3W4QA 1HD8A 5E2EA 3OCLA 3A1IA 1EQZA 3REHC 1MXOA 3B0CT 3WRTA 2WKHA 4WZ5A 3UTAB 2QMIA 4RX2A 2L5AA 3UTAA 4GDNA 5D3OA 5GT0D 1NYMA 5B0ZD 3BECA 1E25A 3H0MC 4N9LA 4WEKA 3P09A 4KENB 3EPLA 3W99B 2Y2PA 1ERQA 4JKTA 1HTAA 3R45B 2HIOC 3AZLD 1KGGA 3O87A 3R45A 1JWVA 4NYYA 2V20A 3EPHA 4LV2A 1J9MA 5FDHA 3AZKD 3C1CD 3WTPE 1NY0A 5EE8A 5F83A 3GTCA 4DE3A 4YINA 1MWRA 2EFUA 5CXWA 3P5JB 5B24A 4JJNB 4BLMA 3UE1A 4H9NB 3AV2D 2ZQ7A 3AN2C 3GRJA 3WAAC 3MGSB 4JJNA 2WGIA 4H9NA 2PU2A 4Y0OA 2P74A 5GT3C 2ZM8A 3MGSA 5AQ7A 5JA4B 5DNNA 2Z2LB 1MY8A 4XXRA 2OLVA 2VGKA 3EG5B 2XR0A 2IWCA 5JA4A 2J7VA 3SS4A 3SS5A 3DWKA 2H0YA 2B5RA 5HW3A 4C75A 5B32C 1W7FA 2WZZA 4GHAA 4S2JA 5B1MC 4U0TA 3X1UC 2J8PA 3L26A 3REJC 3E2LA 4B4XA 1G6AA 1R4VA 4Z5TC 4B88A 4OPYA 1KE0A 3I7JA 3G31A 3ZG9B 1ERMA 5AVBC 4IJEA 3X1TC 3REIC 1YLJA 1SCWA 1TDGA 5KDMB 5FI2A 1CK3A 1DJBA 3H0RC 3PBNA 2HIOA 1WYCA 3UPOA 1M1AD 3VH6T 2JSSA 4XZQC 1CEFA 4E6WA 1YU1A 1FSWA 3GMWA 1JVJA 2Y2HA 1YU2A 3OPLA 1Q9CA 1TEMA 3LO7A 4Y0UA 5F99C 3IWOA 3F6TA 3FKVA 4PM5A 1P3KD 3C5AA 4Z2MG 3AN2B 2RIQA 3WAAB 5EVIB 4O7DA 3B0BA 4X68A 4FH4A 4AWLC 1IKGA 3HUOA 5CTNA 3MNNC 3AN2A 5GT3B 4QY6A 3GV9A 2F8NA 3WAAA 3A3EA 1L0EA 3ZFZA 1MKIA 5HFOA 5GT3A 2F2AC 2X01A 1P3PD 3AZLC 1TZYD 3ZGAB 3X1SD 3KXBC 4LV0A 3SH7A 1YLZA 4DE0A 3UY6A 5AV8C 3A1KA 3AV1C 1QMEA 3AZKC 5B32B 3REKB 4DDYA 3RJUA 1PYYA 1IYPA 3X1UB 3NY4A 5E5AD 3VFFA 5CRFA 4Z5TB 5B32A 4GD6A 3X1UA 2Y2LA 3L2AA 3REJA 3ZNTA 5DVAA 4Z5TA 2NQBD 5AVBB 3X1TB 3REIB 1BT5A 4X6TA 4WBGA 2V2FF 3UN7A 5AVBA 3X1TA 3REIA 1P3AC 3B6FC 1XGJA 3W98C 4M3KA 2IWBA 3B6GD 4XZQB 4DRBA 4WMCD 1B6WA 3L29A 4S2NC 5CP6D 4XZQA 4R4RA 3W4OA 5F99B 4ZAMA 3WA9D 5KZHA 4WU9C 1FOFA 5F99A 1EQZD 4YFMA 2XGNA 1MBLA 3HLFA 3MNNB 3ZG5A 1CI9A 3RXWA 3ISGA 4J8WC 5CEBA 4H9OB 3MNNA 3NQUA 3FZCA 1FQGA 5FSRA 3AZLB 5FQQA 4IBEA 3P98A 5IHVA 4H9OA 2J9PA 3KXBB 4N92A 1U60A 3AZLA 3Q82A 3AV1B 1L2SA 3AZKB 5DNMC 3C1CB 3KXBA 4U3TA 4OPRA 5AV8A 3ZG0A 2Y2IA 3AV1A 1PW8A 3V50A 4PM8A 4ZTKA 3AZKA 3WS0A 2HDUA 3ZCZA 3AZGC 5B32G 3AV2B 2F8NH 2BYMB 3O62C 2DQNC 5FQJA 3RXXA 1JFIB 2BG1A 1YU0A 3AV2A 2F8NK 1JWZA 2BYMA 2LY8A 1P3AB 1JFIA 5E2FA 3KSYA 5B24D 3W98B 1P3PC 2ZC6B 2ZC5B 1ONGA 1TZYC 2HPBA 1P3AA 1W8QA 3B6FA 2HDRA 3RELC 1K56A 4MBHA 3W98A 4LCLA 4JJND 1SHVA 4R23A 4OP5A 4WELA 1ES3A 4IVKA 4S2NA 3B0CW 3MGSD 1KE4A 3V9RB 5DNND 4WU9B 4JLFA 5E5AC 2OLUA 3SH8A 1KDWA 4OVDA 3V9RA 4WU9A 5FA7A 3UO9A 5B2JC 3IXDA 3ZNYA 1BH9B 3REHD 4EBLA 2NQBC 1Q2PA 4OOLA 4DRTA 3VP2A 4X23C 4WZ4A 1BH9A 2H10A 5AV5C 4J8WA 1XA7A 3HVFA 3UE3A 4GB7A 3CZDA 3BFDA 1EWZA 1FCNA 4PM9A 3N7WA 3KUYC 2ZM5A 1M1AB 3QNCA 1PWGA 5DNMB 1QMFA 4UPKA 1GA9A 3KS8A 4MEZA 2XDMA 5DNMA 1M18C 3S1YA 4U0XA 4OQ0A 5A91A 3HLCA 3WA9C 2XF3A 2BYKB 4IBXA 2HIOD 4RVAA 4RX3A 4P87A 3AZGA 2HDQA 5GSUC 1JTDA 4KZ5A 4DF6A 3KFUG 4MLLA 2FFYA 4EUZA 2EX9A 1L0GA 3O62A 1JTGA 1P34C 3OPHA 1PW1A 4NE5A 2X71A 1P3PB 1ZLAC 2ZC7A 3OC2A 5CGSA 1TZYB 2WUQA 5A90A 1JWPA 3MZFA 3EPKA 1XX2A 3G34A 1P3PA 3VH6A 1EI5A 1PZOA 1TZYA 4OQGA 1TVFA 1IYQA 3BFFA 1PWCA 2F8ND 1XXMA 1L0DA 5E5AB 3TOIA 5GT3D 1BZAA 1PWDA 4UAAA 1XA1A 4NY2A 4NE6A 5B2JB 5E5AA 2ZC3B 2Y2MA 2NQBB 3GSGA 1C3BA 4FSFA 1FSYA 2EX2A 4ZJ3A 4KHAB 5B2JA 2NQBA 5F1FA 4KHAA 4X23A 5B2ID 5GHXA 2XD1A 5B1MD 4OUIA 5AV5A 1P3GD 3X1UD 3B6GB 4RYEA 3REJD 4GNUA 4IBRA 5CPIC 2OSUA 4Z5TD 1P3FC 3KUYA 1ES4A 3PAEA 4WMCA 5DF9A 5TFQA 5B40C 3WA9B 4GOGA 3VH6W 3REID 1M18A 4S2MA 2Y2OA 3LCEA 1WWSA 1EQZB 3WA9A 3WS2A 1OMEA 1KX3D 1YMXA 3W4PA 5GSUA 3M2JA 4XZQD 1MWSA 1PI4A 5BO0B 1HQ3D 5BPVA 1P34B 5FI7A 3HUMA 2XD5A 2Y4AA 2JE5A 1ZLAB 2X02A 5F99D 3IXBA 5BO0A 1P3LC 4JF6A 3ITBA 4P6BA 1P34A 1KGFA 1ZLAA 1YMSA 2HDSA 4NZ5A 1P3OC 1KDSA 5J8XA 3MNND 1P3MC 3FDDA 1K55C 5CPKC 5FAOA 4HGAC 4NZ1A 2OV5A 3L28A 3MXSA 4BQMA 3DWZA 4OP8A 1WYBA 4OKPA 5TR7A 3KXBD 5AV8D 3H0LC 4IVIA 3AV1D 2ZQDA 5L2FA 1BH8B 3UPPA 5B24B 4H9RA 1KVLA 3BYDA 2EX6A 1BH8A 1Z6FA 4BJPA 2IWDA 3NDEA 3HBRA 1P3FB 1Y54A 4Y7PA 1I2WA 1N1JB 3B0DC 5B40B 1S32D 1P3FA 3BEBA 2R9WA 3LELC 1A7WA 1YLYA 5DNNB 1N1JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C5W B;  1H8Y A;  4DKI A;  4QJG A;  1FR1 A;  3VFF A;  3WS4 A;  3UE0 A;  2I72 A;  5CRF A;  4JBF A;  2Q9M A;  4GD6 A;  3VP4 A;  3BFC A;  5E43 A;  4C3Q A;  1K56 D;  3FYZ A;  2Y2L A;  1K57 C;  4B4Z A;  3ZNT A;  4P85 A;  4C6Y A;  4S2I A;  3LEZ A;  2VGJ A;  5DVA A;  4PPR A;  4S2K A;  5FI6 A;  5CGX A;  2WKI A;  4N9K A;  5GLA A;  3PBR A;  1ES5 A;  4E3M A;  3WS1 A;  1NRF A;  1XKZ A;  3Q7Z A;  3S4X A;  4JF4 A;  1IEM A;  1BT5 A;  1K6S A;  4PM7 A;  3ZHH A;  1DJC A;  4PMA A;  4X6T A;  4EQI A;  5DTS A;  4WBG A;  1K4E A;  3IXG A;  2V2F F;  3UN7 A;  3A3D A;  3NDG A;  3PTE A;  1GHP A;  4UA7 A;  1PZP A;  2ZM0 A;  1IYP A;  1AXB A;  1XGJ A;  2DCF A;  4M3K A;  3S22 A;  2IWB A;  1GA0 A;  3FV7 A;  3VOZ A;  4WMC D;  3BM6 A;  2ZQ9 A;  5FAT A;  3OPP A;  3AGE A;  2ZMA A;  3C7V A;  4S2N C;  3HUN A;  3M6B A;  1ZG6 A;  2HP5 A;  4E3N A;  4R4R A;  3MKF A;  3W4O A;  2FFF B;  3PBQ A;  4UA9 A;  5FAQ A;  4XUZ A;  4GZB A;  3O88 A;  2Y91 A;  4ZAM A;  2HP6 A;  4OOY A;  2XH9 A;  4JXV A;  4BD1 A;  3HLB A;  1XGI A;  5E2H A;  5EOE A;  5EVL A;  4A5R A;  5KZH A;  1FOF A;  1K55 A;  3WS5 A;  2DNS A;  3MXR A;  2UWX A;  1H5X A;  1XP4 A;  1IYS A;  5FQI A;  3JYI A;  3MBZ A;  3AGD A;  1PIO A;  4YFM A;  4GN2 A;  2XGN A;  5EUA A;  3V39 A;  1MBL A;  3VP0 A;  2JCH A;  4R3J A;  4FH2 A;  5GL9 A;  3HLF A;  1K6R A;  4UA6 A;  4HBT A;  3ZG5 A;  1ALQ A;  1CI9 A;  3RXW A;  3HRE A;  3ISG A;  4JXS A;  3QHY A;  3A3F A;  5KMW A;  3LY3 A;  1DY6 A;  3V5M A;  4S2O A;  3CMZ A;  5BOH A;  2PU4 A;  2WZX A;  5CEB A;  2WAF A;  5CGW A;  2JBF A;  5CTM A;  4KZA A;  3FZC A;  2G2U A;  1K25 A;  1FQG A;  5FSR A;  1N4O A;  5GLD A;  1FCM A;  3IF6 B;  5FQQ A;  1KE3 A;  3P98 A;  5IHV A;  5KSH A;  4WYY A;  1E3U D;  2J9P A;  4H8R A;  1RP5 A;  4WM9 A;  1LHY A;  2WAD A;  3IHA A;  3HLG A;  2DRW A;  4IED A;  4N92 A;  5U47 A;  1U60 A;  3GVB A;  4X53 A;  3UDF A;  3Q07 A;  4BEN A;  2QPN A;  3D4F A;  3HLD A;  3N8L A;  3IF6 A;  1BSG A;  3Q82 A;  4GD8 A;  1BLH A;  4N1H A;  4WZ5 C;  1L2S A;  5F1G A;  4LV1 A;  3LY4 A;  4JF5 A;  5HAQ A;  5HAI A;  4U3T A;  3IH8 A;  4OPR A;  5DF8 A;  2HP9 A;  1K54 A;  1RCJ A;  3ZG0 A;  4BL2 A;  2Y2I A;  3GQZ A;  1PW8 A;  3V50 A;  3NBL A;  4PM8 A;  4ZTK A;  4NET A;  3WS0 A;  4BD0 A;  3W8K A;  1SKF A;  4E3J A;  2HDU A;  3ZCZ A;  3WWX A;  4DE1 A;  4FD8 A;  4EV4 A;  3VMA A;  5AQ9 A;  5G18 A;  1NZU A;  2GDN A;  3VSK A;  2G2W A;  1G68 A;  4BL3 A;  1K57 A;  4KZB A;  5FQJ A;  5FQ9 A;  3RXX A;  3C4O A;  3ZVT A;  2BG1 A;  4MBK A;  3OZH A;  5EVI D;  2Y55 A;  1GHM A;  4EWF A;  1JWZ A;  1K4F A;  3MZE A;  4R1G A;  4E3I A;  4ZDX A;  3MFD A;  4ZJ2 A;  3A3J A;  3V3R A;  4XUX A;  4ZBE A;  2WKE A;  4FCF A;  4HES A;  2JC7 A;  2WAE A;  5E2F A;  1HVB A;  4OLG A;  2ZC6 B;  2ZC5 B;  1ONG A;  2HPB A;  1VQQ A;  2XFS A;  3BFG A;  4JXW A;  4Y0T A;  4KZ6 A;  5FQK A;  1W8Q A;  2HDR A;  5EEC A;  1ESI A;  2XLN A;  1K56 A;  4MBH A;  2EXB A;  3DW0 A;  1WE4 A;  4LCL A;  4F94 A;  5A93 A;  4KQO A;  1SHV A;  5EVI C;  2XFT A;  3G35 A;  4R23 A;  4OP5 A;  4WEL A;  3O86 A;  1ES3 A;  1Q2Q A;  4IVK A;  4S2N A;  1S6R A;  3EQV A;  4HBU A;  3VP1 A;  4E3K A;  4E3L A;  3A3I A;  1ERO A;  1LL5 A;  3O3V A;  4JXG A;  1LL9 A;  1KE4 A;  4DDS A;  3IWQ A;  3ITA A;  5DF7 A;  4HEF A;  4OON A;  4JLF A;  2OLU A;  1M40 A;  2Z2M B;  4E6X A;  3SH8 A;  4K91 A;  5CHJ A;  5HAR A;  5CEC A;  1KDW A;  3N6I A;  4L0L A;  4X69 A;  4OVD A;  5FA7 A;  4QHC A;  3UO9 A;  3HLE A;  4DXC A;  4DXB A;  3IXD A;  4UHU A;  5GHY A;  3ZNY A;  4EBL A;  3MZD A;  1ZKJ A;  3HL9 A;  1Q2P A;  4LEN A;  4OOL A;  4RA7 A;  2WGW B;  5GLC A;  3VP2 A;  1LI9 A;  4DRT A;  3NI9 A;  3ZG8 B;  4OPQ A;  1YLT A;  4WZ4 A;  2J8Y A;  2QZ6 A;  4EBN A;  1ZG4 A;  3VFH A;  3ZVW A;  1H8Z A;  3WRZ A;  2H10 A;  1PI5 A;  2Y2J A;  1XA7 A;  1BTL A;  3HVF A;  3UE3 A;  2WGV A;  1TDL A;  2BLS A;  2WGW A;  4D2O A;  4GB7 A;  3VOY A;  4NK3 A;  3CZD A;  2Q9N A;  4OH0 A;  5E2G A;  4LCM A;  3V3S A;  5A92 A;  2EXA A;  3BFD A;  2V1Z A;  1EWZ A;  1FCN A;  1YLP A;  4PM9 A;  3W4Q A;  1HD8 A;  2CC1 A;  3N7W A;  5E2E A;  3QNC A;  3OCL A;  3PBO A;  1PWG A;  2ZQC A;  3BRM A;  1MXO A;  3WRT A;  1QMF A;  2WKH A;  1YQS A;  3QNB A;  1GA9 A;  2ZQA A;  3Q7V B;  4WZ5 A;  5CHM A;  1SDN A;  4MEZ A;  4ID4 A;  2XDM A;  3S1Y A;  2QMI A;  4U0X A;  4E3O A;  4OQ0 A;  4RX2 A;  5A91 A;  3HLC A;  4QD4 A;  2XF3 A;  3Q7V A;  1I5Q A;  2A3U A;  4JPM A;  4GDN A;  5D3O A;  1NYM A;  2ZLY A;  4IBX A;  4RVA A;  4RX3 A;  4KZ7 A;  4P87 A;  2HDQ A;  3BEC A;  1E25 A;  4N9L A;  1E3U A;  1RGZ A;  4Z9Q A;  1JTD A;  2H0T A;  3P09 A;  4KEN B;  4WEK A;  4KZ5 A;  4DF6 A;  4KZ3 A;  4PM6 A;  5GHZ A;  4MLL A;  2J9O A;  2FFY A;  4EUZ A;  3M6H A;  2EX9 A;  2Y2P A;  1ERQ A;  1L0G A;  4JKT A;  1IKI A;  5KSC A;  2A49 A;  4KG5 A;  1JTG A;  3OPH A;  4GDB A;  1PW1 A;  2RCX A;  2X71 A;  2ZC7 A;  1ES2 A;  3NIA A;  3OC2 A;  3N8R A;  2WUQ A;  3PBS A;  5CGS A;  5GLB A;  1JWP A;  5A90 A;  5M19 A;  1BLC A;  3FWL A;  3MZF A;  1XX2 A;  1KGG A;  3G34 A;  3O87 A;  5HAP A;  4Q8I A;  1JWV A;  1EI5 A;  1PZO A;  3G4P A;  4OQG A;  5I94 A;  1TVF A;  2V20 A;  1IYQ A;  4LV2 A;  3NCK A;  1J9M A;  3BFF A;  1PWC A;  4P0M A;  4MBF A;  5FDH A;  1FCO A;  1ZC2 A;  4EBP A;  5AQA A;  5EVI A;  5FAS A;  1NY0 A;  3E2K A;  1XXM A;  1L0D A;  5EOO A;  5EE8 A;  5F83 A;  3TOI A;  3HLW A;  3GTC A;  1BZA A;  1PWD A;  4KZ8 A;  4OOM A;  3IQA A;  4YIN A;  4UAA A;  1RGY A;  4DE3 A;  1XA1 A;  2RL3 A;  4KG2 A;  1MWR A;  3UPN A;  3Q81 A;  2EFU A;  5CXW A;  2ZC3 B;  2Y2M A;  1GCE A;  3BFE A;  1YT4 A;  1HTZ A;  3G32 A;  3GSG A;  3UE1 A;  3UDI A;  4BLM A;  1E4D A;  1C3B A;  1L0F A;  4FSF A;  1FSY A;  4K0X A;  2EX2 A;  3DTM A;  4ZJ3 A;  5JYO A;  1W5D A;  2ZQ7 A;  1VM1 A;  4S2L A;  3GRJ A;  4WEJ A;  2EX8 A;  2WGI A;  5HX9 A;  5F1F A;  3VSL A;  2PU2 A;  4Y0O A;  3G30 A;  2Y2N A;  1S0W A;  3IT9 A;  2P74 A;  3BLS A;  2ZJ9 A;  3FKW A;  4MNR A;  3IXH A;  5GHX A;  2XD1 A;  1BLS A;  2ZM8 A;  2ZQ8 A;  5FAP A;  3N8S A;  3GR2 A;  2ZM2 A;  5AQ7 A;  4R0Q A;  3OCN A;  2Z2L B;  3SS3 A;  1MWU A;  4RYE A;  4IBR A;  4GNU A;  3NY4 A;  1MY8 A;  4XXR A;  3UNW A;  1CI8 A;  2OSU A;  2OLV A;  2VGK A;  3C7U A;  2Y59 A;  2XR0 A;  3M2K A;  1K38 A;  1NYY A;  2IWC A;  3SS4 A;  2J7V A;  3EQU A;  4ZJ1 A;  5DTT A;  1SDE A;  1ES4 A;  3PAE A;  3SS5 A;  4WMC A;  1BUE A;  3DWK A;  1BLP A;  4OQI A;  4X55 A;  5DF9 A;  1MWT A;  5TFQ A;  5EPH A;  1NZO A;  4GOG A;  2H0Y A;  2Y2G A;  2B5R A;  5HW3 A;  4C75 A;  3N4I A;  1W7F A;  2WZZ A;  2XK1 A;  4S2J A;  4S2M A;  2Y2O A;  3TSG A;  5FQM A;  3LCE A;  4U0T A;  1MPL A;  4CPK A;  3IWI A;  3WS2 A;  3E2L A;  1OME A;  4B4X A;  1G6A A;  3CG5 A;  2E8I A;  4B88 A;  4OPY A;  2XEP A;  1KE0 A;  1FR6 A;  4LV3 A;  4N1X A;  1YMX A;  4OPZ A;  4QY5 A;  3W4P A;  3IF5 A;  3MKE A;  3M2J A;  3NC8 A;  4KQR A;  1MWS A;  2ZD8 A;  3BLM A;  1PI4 A;  3I7J A;  4R3B A;  5CHU A;  4KG6 A;  5FI7 A;  1GHI A;  3G31 A;  3ZG9 B;  2WK0 A;  1ERM A;  3HUM A;  2XD5 A;  2JE5 A;  2Y4A A;  5AQB A;  5F82 A;  2X02 A;  1HZO A;  4GKU A;  1YLJ A;  1SCW A;  3B3X A;  1TDG A;  3IXB A;  1YLW A;  4JF6 A;  3SH9 A;  3ITB A;  5FI2 A;  2Y2K A;  4P6B A;  1CK3 A;  5CED A;  1DJB A;  1NXY A;  1KGF A;  2XQZ A;  2PBY A;  1O07 A;  1O7E A;  1CEG A;  1NJ4 A;  1YMS A;  3CJM A;  3PBN A;  4OQH A;  2C6W B;  2EFX A;  2HDS A;  3OPR A;  1WYC A;  1IEL A;  3UPO A;  1KDS A;  1N9B A;  1CEF A;  4OLD A;  2ZC4 B;  1I2S A;  4E6W A;  4KZ4 A;  3VP3 A;  4KQQ A;  1FSW A;  3GMW A;  3C4P A;  3PBT A;  1JVJ A;  2H5S A;  2Y2H A;  3SOI A;  5J8X A;  3OPL A;  1TEM A;  3PAG A;  3LO7 A;  4Y0U A;  4CJN A;  1K55 C;  3IWO A;  2WYX A;  5FAO A;  1LI0 A;  4QU3 A;  2OV5 A;  3FKV A;  4PM5 A;  3AGF A;  3C5A A;  3MXS A;  4X56 A;  4QB8 A;  4BQM A;  3DWZ A;  5JYP A;  4OP8 A;  1WYB A;  4OKP A;  5TR7 A;  3IHB A;  1W79 A;  3IH9 A;  5EVI B;  3G2Z A;  3G2Y A;  4O7D A;  4R4S A;  4X68 A;  4FH4 A;  1IKG A;  3HUO A;  4IVI A;  4S2P A;  5CTN A;  1ESU A;  2ZQD A;  4QY6 A;  3ZG7 B;  3GV9 A;  1YM1 A;  3Q1F A;  5L2F A;  5M1A A;  1XPB A;  5HL1 A;  3A3E A;  4K0W A;  3UPP A;  1L0E A;  3ZFZ A;  2R9X A;  1KVL A;  1M6K A;  1W8Y A;  4KZ9 A;  3BYD A;  1MKI A;  5DTK A;  5HFO A;  5CER A;  3TG9 A;  2X01 A;  1KGE A;  2EX6 A;  3ZDJ A;  1Z6F A;  4BJP A;  2IWD A;  3NDE A;  3HBR A;  3IF6 C;  3ZGA B;  1LLB A;  1IYO A;  1Y54 A;  4Y7P A;  4LV0 A;  4DE2 A;  3SH7 A;  1YLZ A;  1I2W A;  1KVM A;  2P9V B;  5TGF A;  4DE0 A;  2Y2Q A;  3UY6 A;  1K54 C;  5M18 A;  3UDX A;  3BEB A;  1BUL A;  1DJA A;  1QME A;  2R9W A;  1YLY A;  4DDY A;  1ONH A;  3RJU A;  2P9V A;  1PYY A; 
#chains in the Genus database with same CATH topology
 5B40 A;  2C5W B;  1PZR A;  3IBR A;  4DKI A;  4QJG A;  4IBJ A;  3UE0 A;  3MR0 A;  2I72 A;  4JBF A;  1P3A D;  3B6F D;  3BFC A;  4MDZ A;  1K56 D;  4G3V A;  3REH B;  3W98 D;  4B4Z A;  1P9R A;  4P85 A;  1N9L A;  5FI6 A;  2WKI A;  4N9K A;  4J8X D;  3PBR A;  4E3M A;  3WS1 A;  1NRF A;  3REH A;  1K6S A;  4Z2K A;  4PM7 A;  3ZHH A;  4PMA A;  4EQI A;  5DTS A;  4MB4 A;  1P3L B;  1YUE A;  2JKG A;  1K4E A;  5B2I C;  2FZ0 A;  4O01 A;  2ZY5 A;  3VH5 T;  3PTE A;  3CUE C;  1P3G C;  1PZP A;  4QLC C;  4OJP A;  4WU9 D;  2ZM0 A;  4BBV A;  4J8U C;  1P3L A;  1AXB A;  5K5B A;  3CLO A;  1GA0 A;  4EO5 C;  3FV7 A;  2ZQ9 A;  3S7N A;  2W3G A;  2M1C A;  2PYR A;  3C7V A;  4Y2F A;  3M6B A;  4J8W D;  3MKF A;  4UA9 A;  5CPK B;  3M7P A;  2ZMV A;  2HP6 A;  5BNV B;  2GX5 A;  2XH9 A;  4BD1 A;  1F1E A;  1P3M A;  2HIO B;  3KSI A;  5E2H A;  3NOP C;  4H6J B;  2FJ7 D;  1K55 A;  2DNS A;  3MXR A;  5CPK A;  1KX3 C;  3MVD C;  1L6J A;  1IYS A;  2HJ9 C;  4ETZ A;  5EUA A;  5BNV A;  3GDI A;  4H6J A;  2W3F A;  4UA6 A;  3R7W B;  3UME A;  3AZN D;  2PHY A;  3NHQ A;  4HP4 A;  5DNM D;  4D60 A;  3UT9 C;  2ZY4 A;  1HQ3 C;  3QHY A;  3A3F A;  5BNX A;  3CMZ A;  2WZX A;  2WAF A;  5CGW A;  3R7W A;  5CTM A;  4IBF A;  1FCM A;  3LID A;  3AZG D;  4DMZ A;  4WYY A;  4Y15 A;  4MN6 A;  1RP5 A;  4WM9 A;  1LHY A;  5U47 A;  1OJ5 A;  4IED A;  3PR6 A;  3MQ0 A;  5M19 A;  3Q07 A;  3B0D B;  3D4F A;  4G92 C;  4H9P B;  1BSG A;  4GD8 A;  4N1H A;  5F1G A;  2F8N B;  3O62 D;  3LEL B;  4IJF A;  4NZ3 A;  5DF8 A;  2MJ6 A;  1L3L A;  4H9P A;  1RCJ A;  4BL2 A;  3GQZ A;  4NET A;  3LEL A;  1SKF A;  3MGP C;  4CLC D;  4EV4 A;  1PRQ A;  3VMA A;  2FH5 A;  3D9Y A;  4EEP A;  5G18 A;  1NZU A;  3REL D;  2W8S A;  2G2W A;  2G5H C;  1GHM A;  5B2I B;  4R1G A;  1EW0 A;  3A3J A;  3V3R A;  5B1M B;  1P3G B;  4QLC B;  4FCF A;  2WAE A;  4J8U B;  3REJ B;  5B2I A;  2JN7 A;  1YAX A;  3KS4 A;  1VQQ A;  2XFS A;  3BFG A;  5B1M A;  2V9A A;  3CUE A;  1P3G A;  4QLC A;  2PD8 A;  4J8U A;  3LR0 A;  5HPF A;  5B2J D;  5CPJ C;  2A24 B;  2PYO C;  4F94 A;  2VQR A;  2VZW A;  4KQO A;  2XFT A;  1S32 C;  4Z2M H;  4X23 D;  3EQV A;  4HBU A;  2A24 A;  1ERO A;  1LL5 A;  1IOU A;  3IWQ A;  5AV5 D;  3C38 A;  2Z6C A;  2V0U A;  1KX3 B;  3MVD B;  1V9Y A;  1YPR A;  4E45 A;  1H0G A;  4X69 A;  1J3W A;  1WA9 A;  1AIW A;  3KUY D;  4DXC A;  3HLE A;  4DXB A;  2PDR A;  1KX3 A;  3MVD A;  1H0M A;  1HQ3 B;  4J8X C;  1ZKJ A;  2J3T D;  3T12 B;  1B67 A;  3ZG8 B;  1U35 D;  3AZE C;  2QZ6 A;  1M18 D;  2JKT M;  5B33 C;  3C1B D;  3UT9 A;  1HQ3 A;  1PI5 A;  4HHD A;  4O0P A;  2KLI A;  2WGV A;  2BLS A;  1G5U A;  3VOY A;  4NK3 A;  5E2G A;  4FUW A;  4PAU A;  5JRG D;  5GSU D;  1F5M A;  3BRM A;  3LIE A;  4AWL B;  2A2L A;  1YQS A;  3QNB A;  4IHQ A;  4Q0H A;  3NQU B;  2ZQA A;  3Q7V B;  5CHM A;  1SDN A;  1XFN A;  4ID4 A;  1G6O A;  1XJ3 A;  5GXQ C;  4QD4 A;  1P34 D;  3Q7V A;  4HH2 A;  2F8N G;  1GSX A;  1UR9 A;  4JPM A;  1ZLA D;  1M19 C;  2FJ7 C;  2ZLY A;  4B93 A;  4KZ7 A;  4IBB A;  4M6B A;  3MGP A;  2CV5 C;  1E3U A;  4LRZ E;  5AV8 B;  1KX5 D;  4KZ3 A;  4PM6 A;  2V1A A;  5GHZ A;  3ZQ5 A;  3M6H A;  3AZN C;  2QKP A;  3QP1 A;  5FDS A;  4GHL A;  5KSC A;  4KG5 A;  3B42 A;  5AVC D;  4GDB A;  3UTB D;  1E6R A;  1ES2 A;  3NIA A;  1BLC A;  1UGU A;  3FWL A;  1VHM A;  4K08 A;  5CPJ B;  5HAP A;  2PYO B;  4HIA A;  3TRC A;  5B31 C;  3AZH C;  1S32 B;  1OTB A;  3NCK A;  4ZBJ C;  4WZS B;  5CPJ A;  4MBF A;  2PYO A;  4EBP A;  3MMH A;  1S32 A;  5FAS A;  4LGW A;  5EOO A;  4MB3 A;  4KZ8 A;  4OOM A;  2W27 A;  3B6F B;  2RL3 A;  4DQY B;  3MSH A;  1GCE A;  3BFE A;  2OWH A;  5CPI D;  1E6N A;  3G32 A;  4J8X B;  1E4D A;  1L0F A;  4K0X A;  1P3F D;  1VM1 A;  3AZE B;  3OLO A;  2EX8 A;  3F1P B;  5B33 B;  4J8X A;  3IT9 A;  5B40 D;  3BLS A;  3FKW A;  4MNR A;  2D02 A;  2GZA A;  5FAP A;  3AZE A;  3N8S A;  2ZM2 A;  3F1P A;  3WD4 A;  5B33 A;  4GH9 A;  2HGV A;  3KX0 X;  1CI8 A;  5F69 A;  3EGD C;  3EPJ A;  1K38 A;  3K2N A;  1FIK A;  3EQU A;  4ZJ1 A;  2EWV A;  3AL0 C;  3BJN A;  4J8W B;  4X55 A;  1MWT A;  3AZM D;  1NZO A;  1M19 B;  3QP5 A;  3N4I A;  2FJ7 B;  2XK1 A;  2D01 A;  4EXO A;  5FQM A;  1P3L D;  5GXQ A;  3IWI A;  2CV5 B;  2IA2 A;  3TJZ C;  3WD0 A;  4Z2G A;  2E8I A;  2R78 A;  1M19 A;  2FJ7 A;  4NYU A;  4N1X A;  3AZN B;  4OPZ A;  4QY5 A;  3MGQ C;  3IF5 A;  2ZL1 B;  3MKE A;  3NC8 A;  2CV5 A;  1P3O D;  2J3T C;  4KQR A;  4O8G A;  2ZD8 A;  3BLM A;  5HPI A;  2IO5 C;  1YU4 A;  3AZN A;  1U35 C;  2KX6 A;  2WK0 A;  3C1B C;  1P3M D;  2ZL1 A;  3VH5 A;  5AY8 D;  3AZG B;  2PT7 A;  1YLW A;  5CPK D;  3WD2 A;  3SH9 A;  2Y2K A;  2JKR M;  5DKK A;  1NXY A;  3U4L P;  2XQZ A;  2P08 A;  2PAV P;  4FTX A;  2PBY A;  1O07 A;  1NJ4 A;  1TS0 A;  3NOU C;  5B31 B;  3AZH B;  3CJM A;  2C6W B;  1EAK A;  3OPR A;  5JRG C;  3O62 B;  1IEL A;  5EM0 A;  2GNX A;  1N9B A;  1I2S A;  2XRO A;  4KZ4 A;  4KQQ A;  4JGQ A;  3AZI C;  2V5O A;  5B31 A;  3AZH A;  2H28 A;  3SOI A;  2EWW A;  4KUD C;  1JNU A;  4XUJ C;  1BFM A;  4YS3 C;  1Y28 A;  3FKE A;  1LI0 A;  4II7 A;  4X1L A;  1F66 D;  3AGF A;  5AV9 D;  3REL B;  2K2N A;  1E15 A;  1W79 A;  3IH9 A;  1KX5 C;  3G2Y A;  4KUO A;  3B47 A;  3REL A;  3KSF A;  2YFW B;  4S2P A;  3ZG7 B;  3LEL D;  3UTA C;  1TS6 A;  4I3I A;  1XPB A;  5M1A A;  5AVC C;  2K7S A;  2YKH A;  5B1L D;  3UTB C;  1M6K A;  2YFW A;  4KZ9 A;  5DTK A;  5HWW A;  1KGE A;  3ZDJ A;  4LD9 C;  3IF6 C;  3LZ0 C;  3VH5 W;  4WU8 D;  2CMN A;  3T1Q B;  4DE2 A;  2P9V B;  5TGF A;  2Y2Q A;  5G49 A;  4X23 B;  2WKQ A;  1DJA A;  3W99 C;  4R8P C;  2M7U A;  2UV0 E;  5AV5 B;  2XA7 S;  2NZD C;  4NE3 A;  2P9V A;  3DAV A;  4DRA A;  4UUZ B;  2VX8 A;  1H8Y A;  3A6N C;  2HV1 A;  4CQH A;  4QLC D;  4KGC C;  3KUY B;  3VP4 A;  4J8U D;  1IFQ A;  4UUZ A;  3FYZ A;  3MGQ B;  1K57 C;  4Z66 C;  4S2I A;  2VGJ A;  4PPR A;  4S2K A;  2IO5 B;  1QO6 A;  1N9O A;  1U35 B;  3S4X A;  3Q7Z A;  1M18 B;  3MGQ A;  3BW6 A;  3C1B B;  5B0Y C;  4TX8 A;  1MKM A;  4I5S A;  3IXG A;  2PYP A;  3A3D A;  1U35 A;  3NDG A;  4R70 A;  5EM1 A;  1GHP A;  3C1B A;  3W97 C;  1P9W A;  4L9F A;  5GSU B;  5JRG B;  3KYZ A;  3LI9 A;  3MVD D;  3S22 A;  4Z2J A;  1ED7 A;  3VOZ A;  3IX8 A;  2P7J A;  3AZI B;  5FAT A;  3AZF C;  4ME4 A;  3IX3 A;  5JRG A;  1KX4 C;  4EES A;  3HSH A;  4KUD B;  5HWT A;  2HP5 A;  4E3N A;  3UT9 D;  3AZM C;  4XUJ B;  2FFF B;  5B31 G;  3PBQ A;  3AZI A;  4YS3 B;  4XUZ A;  5FAQ A;  4GZB A;  1P3B D;  3O88 A;  2Y91 A;  4JXV A;  4KUD A;  3HLB A;  1W2E A;  4LRX C;  4A5R A;  4XUJ A;  4YS3 A;  3AZJ C;  4OJL A;  1XP4 A;  2GJ3 A;  3AGD A;  1PIO A;  5AVF A;  4GN2 A;  1KX5 B;  2JCH A;  1UWN X;  3WD1 A;  3ZYT A;  5GL9 A;  4HBT A;  3VOL A;  1ALQ A;  1KX5 A;  2VGL M;  1MC0 A;  5AVC B;  2ARO C;  3UTB B;  5BOH A;  1J7M A;  3JVV A;  2JBF A;  4KZA A;  5AY8 C;  1H0I A;  2G2U A;  1W1T A;  4LD9 B;  5GLD A;  5AV6 D;  2BAS A;  3IF6 B;  5AVC A;  3LZ0 B;  1KE3 A;  3UTB A;  3MGP D;  1E3U D;  3LIC A;  5G4Z A;  4LD9 A;  1AOI C;  4NEE D;  4X53 A;  4L9G A;  3IF6 A;  3LZ0 A;  3AYW D;  4LV1 A;  1W63 Q;  2JKR I;  4R8P B;  3LY4 A;  4H9R B;  2NZD B;  1OTE A;  3MGR D;  1ZHH B;  3IH8 A;  2W3E A;  2HP9 A;  2HJE A;  3NBL A;  3W99 A;  3W8K A;  4R8P A;  3A6N B;  4E3J A;  4KGC B;  2NZD A;  3WWX A;  3QP2 A;  1F66 C;  5CPI B;  3T1X A;  4WV4 B;  5AV9 C;  4FD8 A;  3LJA D;  4Z66 B;  4HME A;  3LFV A;  3W96 C;  3A6N A;  4CLC E;  1ZTU A;  4KGC A;  2I9V A;  3VSK A;  1LSV A;  5CPJ D;  5CPI A;  1K57 A;  2QJ5 A;  4KZB A;  2PYO D;  5B0Y B;  4Z66 A;  3C4O A;  3ZVT A;  3OZH A;  4LRY C;  3AFA D;  4EWF A;  4HY8 A;  4E3I A;  2VJW A;  5BT1 D;  1KOU A;  3MFD A;  1E6Z A;  4XUX A;  3W97 B;  5B0Y A;  1ULY A;  1OPX A;  5B1L C;  3C30 A;  4HES A;  2JC7 A;  4GW9 A;  1GSV A;  3KO6 A;  1HVB A;  4OLG A;  5L09 A;  3HON A;  4EET B;  4Y0T A;  3IP4 C;  3W97 A;  1Z09 A;  3AZF B;  4QNL A;  1KX4 B;  1ID3 D;  4WU8 C;  3DW0 A;  5A93 A;  3AZM B;  5EVI C;  1LSW A;  3G35 A;  3AZF A;  3O86 A;  1Q2Q A;  1KX4 A;  1S6R A;  4QPR A;  4E3L A;  2AVX A;  3AZE D;  3A3I A;  4CAY B;  4JXG A;  5B33 D;  1LL9 A;  4DDS A;  3AZM A;  5TBM B;  5DF7 A;  3AZJ B;  4OON A;  4E6X A;  2Z2M B;  3GEC A;  5HAR A;  5CEC A;  3N6I A;  3A0V A;  4CAY A;  5FL3 A;  5TBM A;  3AZJ A;  4QHC A;  1P3O B;  4UHU A;  5GHY A;  5EV0 A;  2ARO B;  4RA7 A;  2WGW B;  1LI9 A;  3NI9 A;  1P3M B;  4OPQ A;  1P3O A;  1YLT A;  2PRF A;  5AY8 B;  4EBN A;  1ZG4 A;  3ZVW A;  3WRZ A;  3REK C;  3E4Q A;  4HGA B;  5GXQ D;  2ARO A;  1TDL A;  2WGW A;  5AY8 A;  1M19 D;  1AOI B;  3V3S A;  4IJG A;  2Z6D A;  5A92 A;  2V1Z A;  1YLP A;  1YSP A;  2CC1 A;  3PBO A;  1F98 A;  5FUG B;  3X1V C;  2CV5 D;  2L4R A;  2ZQC A;  3MXQ A;  4ZUX C;  5BNX B;  1AOI A;  3HJI A;  4JGR A;  4J8V C;  1T1A A;  5CX7 A;  4LLO B;  5FUG A;  4GLQ A;  5HL6 A;  2HUE C;  2O9B A;  2Q0O A;  4E3O A;  1P3B C;  2D49 A;  1F66 B;  1I5Q A;  2A3U A;  5HWV A;  5AV9 B;  4GS9 B;  3W96 B;  3NQJ B;  4OJ5 A;  5FEF A;  3OBF A;  2INW A;  5KDM A;  1F66 A;  5HD5 A;  1RGZ A;  4Z9Q A;  5AV9 A;  2H0T A;  4GS9 A;  3W96 A;  3NQJ A;  5B31 D;  3AZH D;  2J9O A;  3P7N A;  1T1B A;  1IKI A;  3WX7 A;  5MC7 A;  2A49 A;  5B1L B;  2PD7 A;  2E8J A;  2RCX A;  2IOU A;  1SZV A;  5AV6 C;  4H9S C;  3PBS A;  5GT0 C;  3N8R A;  5GLB A;  3FC7 A;  5B0Z C;  4IBD A;  5B1L A;  2L0W A;  1XJ6 A;  4WU8 B;  3LZ1 D;  4Q8I A;  3LIF A;  4HP9 A;  3G4P A;  3AYW C;  5I94 A;  3R4K A;  4DN0 A;  4P0M A;  4WU8 A;  3WTP D;  3WKJ D;  1FCO A;  3MGR C;  1ZC2 A;  5AQA A;  5EVI A;  3E2K A;  4UQI S;  3EWK A;  4I39 A;  3HLW A;  3IQA A;  1RGY A;  4KG2 A;  3UPN A;  3Q81 A;  2W0N A;  4EO5 B;  1O6I A;  3LJA C;  2ZY3 A;  3UDI A;  1YT4 A;  1HTZ A;  1VEU B;  5JYO A;  3DTM A;  2K31 A;  1W5D A;  4S2L A;  4WEJ A;  3EEH A;  4WN5 A;  3C1C C;  5HX9 A;  5DFY A;  3AFA C;  3VSL A;  3TW8 A;  2RVQ D;  2Y2N A;  1VEU A;  3F1N A;  1S0W A;  3G30 A;  3OOV A;  5BT1 C;  2ZJ9 A;  1UWP X;  5DJT A;  1Z2C B;  3IXH A;  4Q0J A;  1BLS A;  2ZQ8 A;  2W3D A;  3GR2 A;  3CPT B;  1WWI A;  4R0Q A;  3REK A;  3OCN A;  4PHT A;  3RTY A;  3SS3 A;  1MWU A;  1D1J A;  3X1V B;  3UNW A;  3VE4 A;  4ZUX B;  3C7U A;  3CPT A;  2Y59 A;  3M2K A;  4J8V B;  3AV2 C;  1ID3 C;  1NYY A;  5DTT A;  1SDE A;  3MGQ D;  1YKD A;  3UT9 B;  3X1V A;  4YM6 D;  1BUE A;  2HUE B;  1BLP A;  4OQI A;  4ZUX A;  1P3B B;  2ZY2 A;  5EPH A;  4J8V A;  5BS7 C;  2Y2G A;  3D72 A;  3TSG A;  2G5I C;  1PFL A;  4I38 A;  1P3B A;  5IS1 A;  1MPL A;  3H7W B;  4CPK A;  5J3W A;  1P3I D;  3CG5 A;  1VET B;  4G92 B;  2XSS A;  3TU4 D;  2DMW A;  1FR6 A;  2XEP A;  3LUQ A;  3H7W A;  2JKF A;  4LV3 A;  4AFI A;  3KWQ D;  1VET A;  4R3B A;  5CHU A;  3AZI D;  4KG6 A;  1V9Z A;  4HMD A;  1GHI A;  3MF0 A;  5HSQ A;  2VV7 A;  5AQB A;  5F82 A;  3LEQ A;  4KUD D;  5I5L A;  5AV6 B;  3QP6 A;  1HZO A;  5CHL B;  5GT0 B;  4GKU A;  1OTI A;  4XUJ D;  5B0Z B;  1NLZ A;  3B3X A;  4YS3 D;  3N3F A;  5CED A;  3MGP B;  4CSR B;  4MCW A;  2YFV B;  4E04 A;  1O7E A;  5AV6 A;  4H9S A;  1CEG A;  1E8B A;  5GT0 A;  1T3U A;  4IUH A;  4OQH A;  3AYW B;  5B0Z A;  2EFX A;  2FN2 A;  4BWI A;  4HH3 A;  4CSR A;  4OLD A;  3UB8 A;  2YFV A;  2ZC4 B;  3MGR B;  2ZOH A;  3VP3 A;  4WJ3 C;  3C4P A;  3PBT A;  3AYW A;  2H5S A;  4I3J A;  3UTA D;  3PAG A;  4ZRR A;  3MGR A;  4CJN A;  2WYX A;  4QU3 A;  3LJA B;  4ARZ B;  1CF0 A;  4LD9 D;  4X56 A;  2J80 A;  4QB8 A;  4EEU A;  1XJ2 A;  5JYP A;  3S7Q A;  3LZ0 D;  4NXB A;  5A8B A;  3LJA A;  3IHB A;  4ARZ A;  1M1A C;  3G2Z A;  3IX4 A;  3AFA B;  1E88 A;  4R4S A;  3T4L A;  4EER A;  4OJO A;  1ESU A;  3W99 D;  3Q1F A;  1YM1 A;  4HMC A;  4R8P D;  5HL1 A;  3C1C A;  2NZD D;  3AFA A;  3LR3 A;  1TF1 A;  4IBG A;  4K0W A;  1TAF B;  2R9X A;  1W8Y A;  5CER A;  3F1O B;  4HNB A;  3TG9 A;  4BMW A;  1P3K C;  3A6N D;  4KGC D;  1DP9 A;  4RQ9 A;  1ID3 B;  5DJU A;  1TAF A;  1LLB A;  4EQ1 A;  3LZ1 C;  1IYO A;  1PNE A;  3F1O A;  4Z66 D;  1KVM A;  3O5Y A;  4G91 C;  5M18 A;  1K54 C;  3L9K A;  1ID3 A;  3UDX A;  3WTP C;  1BUL A;  3WKJ C;  5B0Y D;  1ONH A;  1SKO B;  5BS7 A;  1FR1 A;  3S7O A;  3WS4 A;  3W97 D;  2J3W A;  2Q9M A;  5E43 A;  4C3Q A;  1SKO A;  3X1S C;  4C6Y A;  3SW1 A;  3LEZ A;  5C3I C;  5CGX A;  4JGO A;  3AZF D;  5GLA A;  3DBA A;  4P6Z M;  1ES5 A;  1KX4 D;  1XKZ A;  4JF4 A;  1IEM A;  2RVQ C;  5GXQ B;  1DJC A;  2QHK A;  4HQA A;  4DJ3 A;  1H3O B;  4UA7 A;  3AZJ D;  2DCF A;  1H3O A;  3L25 A;  3BM6 A;  1NRJ A;  3OPP A;  1E6P A;  3AGE A;  2ZMA A;  5F6A A;  3HUN A;  4YM6 C;  4HJ6 A;  5AVE A;  3BWL A;  1ZG6 A;  2ARO D;  5DFX A;  4OOY A;  1K0K A;  4WLA A;  1XGI A;  5EOE A;  5EVL A;  1AWI A;  3WS5 A;  2UWX A;  3QP8 A;  1P3I C;  1H5X A;  5FQI A;  3B6G C;  3JYI A;  3MBZ A;  3V39 A;  2PR6 A;  3VP0 A;  1AOI D;  2JKT I;  3TU4 C;  4R3J A;  3PHY A;  4FH2 A;  4ZBJ B;  1K6R A;  2B95 A;  3KWQ C;  3UB9 A;  5CP6 C;  1M1A A;  3HRE A;  4JXS A;  5KMW A;  1F9I A;  3LY3 A;  1DY6 A;  3V5M A;  4S2O A;  2PU4 A;  2CWE A;  2W1T B;  3MJQ A;  1P3K B;  1K25 A;  1N4O A;  4M4X A;  1GSW A;  3LZ1 B;  5KSH A;  1EQZ C;  2W1T A;  4QWO A;  4H8R A;  2WAD A;  3IHA A;  3HLG A;  1P3K A;  2DRW A;  3UDF A;  3W96 D;  3GVB A;  1S1Z A;  4BEN A;  2BYK A;  4G91 B;  2QPN A;  3HLD A;  3N8L A;  3NEC A;  4WZ5 C;  5AQ9 A;  1BLH A;  3WTP B;  3WKJ B;  4WL9 A;  3LYX A;  3LZ1 A;  4JF5 A;  5HAQ A;  5HAI A;  4IBI A;  4IBK A;  1K54 A;  3WTP A;  3H9W A;  3WKJ A;  4BD0 A;  3A0S A;  1S4R A;  3T4J A;  4DE1 A;  3X1S B;  2G7U A;  1NWZ A;  5G49 B;  5C3I B;  3L27 A;  4R38 A;  2GDN A;  3EEA A;  3EOI A;  3NOT C;  2KOI A;  1G68 A;  4BL3 A;  3AN2 D;  3X1S A;  5FQ9 A;  3WAA D;  4MBK A;  5EVI D;  2DF4 C;  2Y55 A;  1K4F A;  3MZE A;  4ZDX A;  1S66 L;  4ZJ2 A;  3VV4 A;  4LG2 A;  4ZBE A;  2WKE A;  4KUK A;  2ZBB A;  4ETX A;  3LIB A;  3QP4 A;  3IS2 B;  1OJG A;  4JXW A;  4KZ6 A;  5FQK A;  5EEC A;  1ESI A;  2XLN A;  4YM6 B;  4OJ6 A;  2EXB A;  1WE4 A;  3IS2 A;  1H8P A;  1LL8 A;  4E3K A;  1FIL A;  3C8C A;  3VP1 A;  4YM6 A;  2WKR A;  4NFT A;  3O3V A;  5B32 D;  3REK D;  1S67 L;  3ITA A;  5L8M A;  5TJJ A;  4HEF A;  4Y5F A;  1P3I B;  5B24 C;  1M40 A;  1YU3 A;  4K91 A;  4WNN B;  5CHJ A;  3T1R A;  4L0L A;  3TU4 B;  1BYW A;  2VKS A;  2HF6 A;  1P3I A;  3KWQ B;  3X1V D;  3B6G A;  4WNN A;  5CP6 B;  4JJN C;  2YKF A;  3MZD A;  4ZUX D;  3HL9 A;  4LEN A;  3TU4 A;  4J8V D;  4E44 A;  3PYP A;  5GLC A;  4H9Q B;  3KWQ A;  2J8Y A;  3MGS C;  5CP6 A;  5AVB D;  3X1T D;  3VFH A;  1H8Z A;  1NLY A;  5DNN C;  2Y2J A;  1OTD A;  1BTL A;  5HDD A;  4D2O A;  4H9Q A;  2B18 A;  2PR5 A;  2Q9N A;  4OH0 A;  4NZ4 A;  4LCM A;  2EXA A;  1KU5 A;  3LR4 A;  4IBC A;  3W4Q A;  1HD8 A;  5E2E A;  3OCL A;  3A1I A;  1EQZ A;  3REH C;  1MXO A;  3B0C T;  4EUV A;  1A0K A;  3WRT A;  2WKH A;  3D3O A;  3E0Y A;  4WZ5 A;  3UTA B;  2W3H A;  2QMI A;  5G4Y A;  1OTA A;  3DTE A;  4RX2 A;  2L5A A;  3JPU A;  3UTA A;  4GDN A;  5D3O A;  4Z2H A;  5GT0 D;  1NYM A;  3MS6 A;  5B0Z D;  3L7H A;  3BEC A;  1E25 A;  3H0M C;  4N9L A;  4WEK A;  3P09 A;  4KEN B;  3EPL A;  3W99 B;  2Y2P A;  1ERQ A;  4JKT A;  3RFB A;  1HTA A;  3R45 B;  3BQ8 A;  1OGG A;  4HJ3 A;  4X25 A;  2LB9 A;  2HIO C;  4HJ4 A;  3AZL D;  3CAX A;  1KGG A;  1CQA A;  4FOF A;  3O87 A;  3R45 A;  1JWV A;  4NYY A;  2V20 A;  3EPH A;  4LV2 A;  2KDK A;  1J9M A;  5FDH A;  3AZK D;  4WUJ A;  3C1C D;  3WTP E;  1G28 A;  3EGX C;  1NY0 A;  5EE8 A;  5F83 A;  3E98 A;  3GTC A;  4DE3 A;  4YIN A;  1MWR A;  4R3A A;  2EFU A;  5CXW A;  3P5J B;  5B24 A;  3E4O A;  4GCZ A;  4JJN B;  4Y3I A;  4BLM A;  3UE1 A;  4H9N B;  3AV2 D;  4IUK A;  2ZQ7 A;  3AN2 C;  3UMD A;  3GRJ A;  3ULF A;  3WAA C;  3MGS B;  4JJN A;  5AJG A;  2WGI A;  4H9N A;  2PU2 A;  4Y0O A;  4MN7 A;  2P74 A;  5GT3 C;  2ZM8 A;  1OT6 A;  3HCY A;  3S7P A;  3MGS A;  5AQ7 A;  5JA4 B;  5DNN A;  2Z2L B;  5HDC A;  1MY8 A;  4XXR A;  2OLV A;  2VGK A;  3EG5 B;  2XR0 A;  2IWC A;  5JA4 A;  2J7V A;  3SS4 A;  1GOI A;  3T4Q A;  3MQO A;  3SS5 A;  3DWK A;  3B33 A;  5L07 A;  2H0Y A;  1LSX A;  2B5R A;  5HW3 A;  4C75 A;  5B32 C;  1W7F A;  1H3Q A;  4GHA A;  2WZZ A;  4S2J A;  5B1M C;  5IU1 A;  4U0T A;  3X1U C;  2J8P A;  2O0Y A;  3L26 A;  3REJ C;  3E2L A;  4B4X A;  1G6A A;  1R4V A;  4Z5T C;  4B88 A;  4OPY A;  1KE0 A;  3UB7 A;  3I7J A;  3G31 A;  3ZG9 B;  1ERM A;  5AVB C;  4IJE A;  3X1T C;  3REI C;  3CI6 A;  1YLJ A;  1SCW A;  1TDG A;  2VEA A;  5KDM B;  5FI2 A;  1CK3 A;  3DTK A;  1DJB A;  4PKY A;  3H0R C;  1PDC A;  4KQD A;  3PBN A;  4HI4 A;  2HIO A;  3U2A A;  1WYC A;  3UPO A;  1M1A D;  3VH6 T;  2JSS A;  4XZQ C;  1CEF A;  1D7E A;  4E6W A;  1YU1 A;  1FSW A;  2OOL A;  3GMW A;  3JVU A;  1JVJ A;  4NXE A;  2Y2H A;  1T1C A;  1YU2 A;  3OPL A;  1Q9C A;  1TEM A;  3LO7 A;  4Y0U A;  5F99 C;  3IWO A;  5HD3 A;  3F6T A;  1XJ4 A;  3FKV A;  2NUP C;  4PM5 A;  1VB6 A;  1P3K D;  1KS0 A;  3C5A A;  1W1P A;  3ICY A;  1TS7 A;  3BY8 A;  4Z2M G;  3AN2 B;  2RIQ A;  3WAA B;  4BBU A;  5EVI B;  4O7D A;  3B0B A;  4X68 A;  4FH4 A;  5LBR A;  4AWL C;  3IBJ A;  1IKG A;  3HUO A;  5CTN A;  3MNN C;  3AN2 A;  5GT3 B;  4QY6 A;  3GV9 A;  4Z2I A;  2F8N A;  3WAA A;  3A3E A;  1L0E A;  3ZFZ A;  4NG2 A;  1MKI A;  1S4S A;  5HFO A;  5GT3 A;  2F2A C;  4JGP A;  2X01 A;  1P3P D;  2L1M A;  3AZL C;  2W1R A;  1TZY D;  5HDS A;  3ZGA B;  1X0O A;  3X1S D;  3KXB C;  1XFQ A;  3F1N B;  4LV0 A;  3UE6 A;  3SH7 A;  1YLZ A;  4ESP A;  4DE0 A;  3UY6 A;  3LIA A;  5AV8 C;  3A1K A;  3AV1 C;  2EA9 A;  1QME A;  3AZK C;  4B9O A;  5B32 B;  3REK B;  1DP6 A;  4DDY A;  3RJU A;  1PYY A;  1IYP A;  3X1U B;  3NY4 A;  4NKP A;  2V1B A;  5KIZ A;  5E5A D;  3VFF A;  5CRF A;  4Z5T B;  5B32 A;  3BQA A;  4GD6 A;  3X1U A;  3C2W A;  2Y2L A;  3L2A A;  3REJ A;  3ZNT A;  4X1M A;  5DVA A;  4Z5T A;  2NQB D;  5AVB B;  3X1T B;  4WF0 A;  3REI B;  1BT5 A;  1LT0 A;  4X6T A;  3MFX A;  4WBG A;  2XA7 M;  2OAP 1;  2V2F F;  3UN7 A;  5AVB A;  3X1T A;  3CHW P;  3REI A;  1P3A C;  3DTI A;  3B6F C;  1D06 A;  1XGJ A;  4PKY G;  3W98 C;  4M3K A;  5IT5 A;  2IWB A;  3B6G D;  2ACG A;  4XZQ B;  4DRB A;  4WMC D;  1B6W A;  3L29 A;  3KSH A;  4S2N C;  1STZ A;  2VGL S;  1P97 A;  5EVE A;  5CP6 D;  4XZQ A;  4R4R A;  3W4O A;  5F99 B;  4NXF A;  1UR8 A;  4ZAM A;  3WA9 D;  4Z2L A;  5KZH A;  4WU9 C;  1FOF A;  5F99 A;  4EW7 A;  1H8M A;  2QYB A;  1ACF A;  1EQZ D;  4YFM A;  2XGN A;  3UB6 A;  1MBL A;  2RTS A;  1CK7 A;  3HLF A;  3T50 A;  3MNN B;  3ZG5 A;  3KYE A;  1OGB A;  1CI9 A;  3RXW A;  3ISG A;  4J8W C;  2VV8 A;  5CEB A;  4H9O B;  3MNN A;  3NQU A;  3FZC A;  1FQG A;  5FSR A;  3AZL B;  1DP8 A;  1GXD A;  2O9C A;  5FQQ A;  4IBE A;  3P98 A;  5IHV A;  4H9O A;  2J9P A;  2V8C A;  3KXB B;  4N92 A;  1U60 A;  3AZL A;  3Q82 A;  3SZT A;  3AV1 B;  1L2S A;  2QJ7 A;  3MQQ A;  3AZK B;  5DNM C;  3C1C B;  3KXB A;  1Y4O A;  4U3T A;  4OPR A;  5AV8 A;  3ZG0 A;  2Y2I A;  3VE3 A;  3AV1 A;  1PW8 A;  3V50 A;  4PM8 A;  4ZTK A;  3AZK A;  3WS0 A;  4G3W A;  2LB5 A;  3T4O A;  4HOI A;  2HDU A;  3ZCZ A;  3AZG C;  3WD3 A;  4Y17 A;  5B32 G;  3NJA A;  3AV2 B;  2F8N H;  2BYM B;  3O62 C;  2DQN C;  5FQJ A;  3RXX A;  1JFI B;  2BG1 A;  1YU0 A;  3AV2 A;  2F8N K;  1T18 A;  1JWZ A;  2BYM A;  2LY8 A;  1P3A B;  1JFI A;  3K3D A;  5E2F A;  1T19 A;  3KSY A;  5B24 D;  3W98 B;  4CLC C;  1P3P C;  2ZC6 B;  2ZC5 B;  1ONG A;  1TZY C;  2HPB A;  1P3A A;  1W8Q A;  3B6F A;  2HDR A;  3REL C;  4MB5 A;  1K56 A;  4MBH A;  3W98 A;  4LCL A;  4JJN D;  1SHV A;  4R23 A;  4OP5 A;  4WEL A;  1ES3 A;  4IVK A;  4S2N A;  5DKL A;  3B0C W;  3MGS D;  1KE4 A;  3V9R B;  5DNN D;  4WU9 B;  4JLF A;  5E5A C;  2OLU A;  2O99 A;  3SH8 A;  1KDW A;  3V67 A;  3T1S A;  4OVD A;  3V9R A;  4WU9 A;  3A0R A;  5FA7 A;  3UO9 A;  5B2J C;  3IXD A;  3ZNY A;  1BH9 B;  3REH D;  4EBL A;  2NQB C;  1Q2P A;  4OOL A;  2VV6 A;  2VA0 A;  4DRT A;  3VP2 A;  4X23 C;  2QWS A;  4WZ4 A;  1BH9 A;  2H10 A;  5AV5 C;  4J8W A;  1XA7 A;  3HVF A;  3CIT A;  3UE3 A;  4GB7 A;  3CZD A;  3BFD A;  1EWZ A;  1FCN A;  4PM9 A;  3N7W A;  3KUY C;  2ZM5 A;  1M1A B;  3QNC A;  1PWG A;  5DNM B;  4Y13 A;  1QMF A;  4UPK A;  1GA9 A;  3PXP A;  3KS8 A;  2JHE A;  4MEZ A;  3E4P A;  2XDM A;  5DNM A;  1M18 C;  3S1Y A;  4U0X A;  4OQ0 A;  5A91 A;  3HLC A;  3WA9 C;  2XF3 A;  2B02 A;  5HZH A;  2BYK B;  4IBX A;  2HIO D;  4RVA A;  4RX3 A;  4P87 A;  3AZG A;  1S1Y A;  2HDQ A;  1W1V A;  4YOF A;  5GSU C;  2OAQ 1;  1JTD A;  4F3L B;  3LGO A;  4KZ5 A;  4DF6 A;  2VLG A;  3KFU G;  4MLL A;  2FFY A;  4EUZ A;  2EX9 A;  5EFW A;  1L0G A;  3O62 A;  4Z1W A;  4F3L A;  1JTG A;  1OT9 A;  1P34 C;  3OPH A;  5FEG A;  1PW1 A;  4NE5 A;  4CLC B;  2X71 A;  1P3P B;  3NUL A;  1ZLA C;  2ZC7 A;  3OC2 A;  5CGS A;  1TZY B;  2WUQ A;  4I3A A;  2WKP A;  3KSG A;  1JWP A;  5A90 A;  3MZF A;  3EPK A;  1XX2 A;  3G34 A;  1N9N A;  4CLC A;  1P3P A;  1CXW A;  3VH6 A;  1EI5 A;  1PZO A;  1TZY A;  4L9E A;  4OQG A;  3G6O A;  1TVF A;  1IYQ A;  3BFF A;  1PWC A;  4YWZ A;  1DRM A;  2F8N D;  2P04 A;  1XXM A;  1L0D A;  5E5A B;  3TOI A;  5GT3 D;  1BZA A;  1PWD A;  2V0W A;  4UAA A;  1XA1 A;  1CJF A;  4NY2 A;  4NE6 A;  5B2J B;  3FG8 A;  3T4S A;  5E5A A;  2ZC3 B;  1TS8 A;  2Y2M A;  2NQB B;  3GSG A;  1C3B A;  1MZU A;  4FSF A;  1FSY A;  2EX2 A;  1YSQ A;  3BY9 A;  4ZJ3 A;  4KHA B;  5B2J A;  4EU0 A;  3H82 B;  1HLU P;  2NQB A;  5F1F A;  4KHA A;  3LR5 A;  4X23 A;  5B2I D;  5GHX A;  2O9A A;  2XD1 A;  4UQI M;  2V8F A;  3H82 A;  3FPV A;  5B1M D;  4OUI A;  5AV5 A;  1P3G D;  2NUT C;  3X1U D;  3B6G B;  1F2K A;  4RYE A;  3REJ D;  2ZOI A;  4GNU A;  4IBR A;  5CPI C;  2OSU A;  4Z5T D;  1GPF A;  1P0Z A;  4G3K A;  1P3F C;  3KUY A;  1ES4 A;  3PAE A;  4WMC A;  3W2Z A;  5DF9 A;  5TFQ A;  5B40 C;  3WA9 B;  1W1Y A;  4GOG A;  3VH6 W;  3REI D;  1M18 A;  4S2M A;  2Y2O A;  3KYQ A;  3LCE A;  1WWS A;  1EQZ B;  3WA9 A;  3TE8 A;  3HJK A;  3WS2 A;  1OME A;  1KX3 D;  4GHI B;  3UB5 P;  3P01 A;  1YMX A;  3W4P A;  5GSU A;  3M2J A;  3CWF A;  4XZQ D;  1MWS A;  4LFU A;  1PI4 A;  4GHI A;  5BO0 B;  5L10 A;  1HQ3 D;  5BPV A;  1P34 B;  5FI7 A;  3HUM A;  2XD5 A;  2JE5 A;  1ZLA B;  2Y4A A;  2ZMF A;  2X02 A;  3MQL A;  4UEY A;  5F99 D;  3IXB A;  5BO0 A;  1P3L C;  4JF6 A;  3FPW A;  3ITB A;  4P6B A;  2BTF P;  1P34 A;  4DJ2 A;  1KGF A;  1ZLA A;  3T4K A;  1YMS A;  5J7E A;  2HDS A;  3T4T A;  5F5Y A;  4NZ5 A;  1P3O C;  1KDS A;  4NXG A;  1TD5 A;  4GJ4 A;  5J8X A;  3MNN D;  1ODV A;  1P3M C;  3FDD A;  1K55 C;  4YNR A;  5CPK C;  5FAO A;  4HGA C;  4NZ1 A;  2OV5 A;  2XRN A;  3L28 A;  4MN5 A;  3MXS A;  4BQM A;  2VK3 A;  3DWZ A;  3RH8 B;  4OP8 A;  1WYB A;  4OKP A;  5TR7 A;  3KXB D;  2HZ5 A;  2M7V A;  4XT2 B;  5AV8 D;  3H0L C;  4IVI A;  3AV1 D;  2ZQD A;  5L2F A;  1BH8 B;  3UPP A;  2Y79 A;  3K3C A;  5B24 B;  4H9R A;  1KVL A;  4XT2 A;  3BYD A;  4MMN A;  4R6L A;  2EX6 A;  1BH8 A;  1Z6F A;  4BJP A;  2IWD A;  5C5K A;  2PBD P;  3NDE A;  1W63 M;  3HBR A;  5F68 A;  1P3F B;  5J4E A;  1Y54 A;  2OWJ A;  4Y7P A;  2Y8H A;  4P6Z S;  1I2W A;  4LPZ A;  1N1J B;  3B0D C;  5B40 B;  4BBT A;  4Q0I A;  1S32 D;  1P3F A;  3BEB A;  2R9W A;  3LEL C;  1A7W A;  1YLY A;  5DNN B;  3LI8 A;  1N1J A; 
#chains in the Genus database with same CATH homology
 5B40 A;  2C5W B;  1PZR A;  4DKI A;  4QJG A;  4IBJ A;  3UE0 A;  2I72 A;  4JBF A;  1P3A D;  3B6F D;  3BFC A;  1K56 D;  3REH B;  3W98 D;  4B4Z A;  4P85 A;  5FI6 A;  2WKI A;  4N9K A;  4J8X D;  3PBR A;  4E3M A;  3WS1 A;  1NRF A;  3REH A;  1K6S A;  4PM7 A;  3ZHH A;  4PMA A;  4EQI A;  5DTS A;  1P3L B;  1YUE A;  1K4E A;  5B2I C;  2ZY5 A;  3VH5 T;  3PTE A;  1P3G C;  1PZP A;  4QLC C;  4OJP A;  4WU9 D;  2ZM0 A;  4J8U C;  1P3L A;  1AXB A;  1GA0 A;  4EO5 C;  3FV7 A;  2ZQ9 A;  3C7V A;  3M6B A;  4J8W D;  3MKF A;  4UA9 A;  5CPK B;  2HP6 A;  5BNV B;  2XH9 A;  4BD1 A;  1F1E A;  1P3M A;  2HIO B;  5E2H A;  2FJ7 D;  1K55 A;  2DNS A;  3MXR A;  5CPK A;  1KX3 C;  3MVD C;  1IYS A;  5EUA A;  5BNV A;  4UA6 A;  3AZN D;  5DNM D;  3UT9 C;  2ZY4 A;  1HQ3 C;  3QHY A;  3A3F A;  5BNX A;  3CMZ A;  2WZX A;  2WAF A;  5CGW A;  5CTM A;  4IBF A;  1FCM A;  3AZG D;  4WYY A;  1RP5 A;  4WM9 A;  1LHY A;  5U47 A;  4IED A;  5M19 A;  3Q07 A;  3B0D B;  3D4F A;  4G92 C;  4H9P B;  1BSG A;  4GD8 A;  4N1H A;  5F1G A;  2F8N B;  3O62 D;  3LEL B;  4IJF A;  4NZ3 A;  5DF8 A;  4H9P A;  1RCJ A;  4BL2 A;  3GQZ A;  4NET A;  3LEL A;  1SKF A;  3MGP C;  4EV4 A;  3VMA A;  5G18 A;  1NZU A;  3REL D;  2W8S A;  2G2W A;  2G5H C;  1GHM A;  5B2I B;  4R1G A;  3A3J A;  3V3R A;  5B1M B;  1P3G B;  4QLC B;  4FCF A;  2WAE A;  4J8U B;  3REJ B;  5B2I A;  3KS4 A;  1VQQ A;  2XFS A;  3BFG A;  5B1M A;  1P3G A;  4QLC A;  4J8U A;  5B2J D;  5CPJ C;  2PYO C;  4F94 A;  2VQR A;  4KQO A;  2XFT A;  1S32 C;  4Z2M H;  4X23 D;  3EQV A;  4HBU A;  1ERO A;  1LL5 A;  3IWQ A;  5AV5 D;  1KX3 B;  3MVD B;  4E45 A;  4X69 A;  3KUY D;  4DXC A;  3HLE A;  4DXB A;  1KX3 A;  3MVD A;  1HQ3 B;  4J8X C;  1ZKJ A;  1B67 A;  3ZG8 B;  1U35 D;  2QZ6 A;  3AZE C;  1M18 D;  5B33 C;  3C1B D;  3UT9 A;  1HQ3 A;  1PI5 A;  2WGV A;  2BLS A;  3VOY A;  4NK3 A;  5E2G A;  5JRG D;  5GSU D;  3BRM A;  4AWL B;  1YQS A;  3QNB A;  3NQU B;  2ZQA A;  3Q7V B;  5CHM A;  1SDN A;  4ID4 A;  5GXQ C;  4QD4 A;  1P34 D;  3Q7V A;  2F8N G;  4JPM A;  1ZLA D;  1M19 C;  2FJ7 C;  2ZLY A;  4KZ7 A;  4IBB A;  4M6B A;  3MGP A;  2CV5 C;  1E3U A;  5AV8 B;  1KX5 D;  4KZ3 A;  4PM6 A;  5GHZ A;  3M6H A;  3AZN C;  4GHL A;  5KSC A;  4KG5 A;  5AVC D;  4GDB A;  3UTB D;  1ES2 A;  3NIA A;  1BLC A;  3FWL A;  5CPJ B;  5HAP A;  2PYO B;  5B31 C;  3AZH C;  1S32 B;  3NCK A;  4ZBJ C;  4WZS B;  5CPJ A;  4MBF A;  2PYO A;  4EBP A;  5FAS A;  1S32 A;  5EOO A;  4KZ8 A;  4OOM A;  3B6F B;  2RL3 A;  4DQY B;  1GCE A;  3BFE A;  3G32 A;  5CPI D;  4J8X B;  1E4D A;  1L0F A;  4K0X A;  1P3F D;  1VM1 A;  3AZE B;  2EX8 A;  5B33 B;  4J8X A;  3IT9 A;  5B40 D;  3BLS A;  3FKW A;  4MNR A;  5FAP A;  3AZE A;  3N8S A;  2ZM2 A;  5B33 A;  4GH9 A;  1CI8 A;  3EPJ A;  1K38 A;  3EQU A;  4ZJ1 A;  3AL0 C;  4J8W B;  4X55 A;  1MWT A;  3AZM D;  1NZO A;  1M19 B;  3N4I A;  2FJ7 B;  2XK1 A;  5FQM A;  1P3L D;  5GXQ A;  3IWI A;  2CV5 B;  2E8I A;  1M19 A;  2FJ7 A;  4NYU A;  4N1X A;  3AZN B;  4OPZ A;  4QY5 A;  3MGQ C;  3IF5 A;  3MKE A;  3NC8 A;  2CV5 A;  1P3O D;  4KQR A;  2ZD8 A;  3BLM A;  2IO5 C;  1YU4 A;  3AZN A;  1U35 C;  2WK0 A;  3C1B C;  1P3M D;  3VH5 A;  5AY8 D;  3AZG B;  1YLW A;  5CPK D;  3SH9 A;  2Y2K A;  1NXY A;  2XQZ A;  2PBY A;  1O07 A;  1NJ4 A;  5B31 B;  3AZH B;  3CJM A;  2C6W B;  3OPR A;  5JRG C;  3O62 B;  1IEL A;  1N9B A;  1I2S A;  4KZ4 A;  4KQQ A;  3AZI C;  5B31 A;  3AZH A;  3SOI A;  4KUD C;  4XUJ C;  1BFM A;  4YS3 C;  3FKE A;  1LI0 A;  1F66 D;  3AGF A;  5AV9 D;  3REL B;  1W79 A;  3IH9 A;  1KX5 C;  3G2Y A;  3REL A;  2YFW B;  4S2P A;  3ZG7 B;  3LEL D;  3UTA C;  5M1A A;  1XPB A;  5AVC C;  5B1L D;  3UTB C;  1M6K A;  2YFW A;  4KZ9 A;  5DTK A;  1KGE A;  3ZDJ A;  4LD9 C;  3IF6 C;  3LZ0 C;  3VH5 W;  4WU8 D;  4DE2 A;  2P9V B;  5TGF A;  2Y2Q A;  5G49 A;  4X23 B;  1DJA A;  3W99 C;  4R8P C;  5AV5 B;  2NZD C;  4NE3 A;  2P9V A;  4DRA A;  4UUZ B;  1H8Y A;  3A6N C;  4QLC D;  4KGC C;  3KUY B;  3VP4 A;  4J8U D;  4UUZ A;  3FYZ A;  3MGQ B;  1K57 C;  4Z66 C;  4S2I A;  2VGJ A;  4PPR A;  4S2K A;  2IO5 B;  1U35 B;  3S4X A;  3Q7Z A;  1M18 B;  3MGQ A;  3C1B B;  5B0Y C;  3IXG A;  3A3D A;  1U35 A;  3NDG A;  1GHP A;  3C1B A;  3W97 C;  5GSU B;  5JRG B;  3MVD D;  3S22 A;  3VOZ A;  3AZI B;  5FAT A;  3AZF C;  5JRG A;  1KX4 C;  3HSH A;  4KUD B;  2HP5 A;  4E3N A;  3UT9 D;  3AZM C;  4XUJ B;  2FFF B;  5B31 G;  3PBQ A;  3AZI A;  4YS3 B;  4XUZ A;  5FAQ A;  4GZB A;  1P3B D;  3O88 A;  2Y91 A;  4JXV A;  4KUD A;  3HLB A;  1W2E A;  4A5R A;  4XUJ A;  4YS3 A;  3AZJ C;  4OJL A;  1XP4 A;  3AGD A;  1PIO A;  4GN2 A;  1KX5 B;  2JCH A;  5GL9 A;  4HBT A;  1ALQ A;  1KX5 A;  5AVC B;  2ARO C;  3UTB B;  5BOH A;  2JBF A;  4KZA A;  5AY8 C;  2G2U A;  4LD9 B;  5GLD A;  5AV6 D;  3IF6 B;  5AVC A;  3LZ0 B;  1KE3 A;  3UTB A;  3MGP D;  1E3U D;  4LD9 A;  1AOI C;  4X53 A;  3IF6 A;  3LZ0 A;  3AYW D;  4LV1 A;  4R8P B;  3LY4 A;  4H9R B;  2NZD B;  3MGR D;  3IH8 A;  2HP9 A;  3NBL A;  3W99 A;  3W8K A;  4R8P A;  3A6N B;  4E3J A;  4KGC B;  2NZD A;  3WWX A;  1F66 C;  5CPI B;  4WV4 B;  5AV9 C;  4FD8 A;  3LJA D;  4Z66 B;  3W96 C;  3A6N A;  4KGC A;  3VSK A;  5CPJ D;  5CPI A;  1K57 A;  4KZB A;  2PYO D;  5B0Y B;  4Z66 A;  3C4O A;  3ZVT A;  3OZH A;  3AFA D;  4EWF A;  4E3I A;  5BT1 D;  3MFD A;  4XUX A;  3W97 B;  5B0Y A;  1ULY A;  5B1L C;  4HES A;  2JC7 A;  1HVB A;  4OLG A;  3HON A;  4Y0T A;  3IP4 C;  3W97 A;  3AZF B;  4QNL A;  1KX4 B;  1ID3 D;  4WU8 C;  3DW0 A;  5A93 A;  3AZM B;  5EVI C;  3G35 A;  3AZF A;  3O86 A;  1Q2Q A;  1KX4 A;  1S6R A;  4E3L A;  3AZE D;  3A3I A;  4CAY B;  4JXG A;  5B33 D;  1LL9 A;  4DDS A;  3AZM A;  5DF7 A;  3AZJ B;  4OON A;  4E6X A;  2Z2M B;  5HAR A;  5CEC A;  3N6I A;  4CAY A;  3AZJ A;  4QHC A;  1P3O B;  4UHU A;  5GHY A;  2ARO B;  4RA7 A;  2WGW B;  1LI9 A;  3NI9 A;  1P3M B;  4OPQ A;  1P3O A;  1YLT A;  5AY8 B;  4EBN A;  1ZG4 A;  3ZVW A;  3WRZ A;  3REK C;  4HGA B;  5GXQ D;  2ARO A;  1TDL A;  2WGW A;  5AY8 A;  1M19 D;  1AOI B;  3V3S A;  5A92 A;  2V1Z A;  1YLP A;  2CC1 A;  3PBO A;  5FUG B;  3X1V C;  2CV5 D;  2ZQC A;  4ZUX C;  5BNX B;  1AOI A;  4J8V C;  5FUG A;  2HUE C;  4E3O A;  1P3B C;  1F66 B;  1I5Q A;  2A3U A;  5AV9 B;  3W96 B;  3NQJ B;  4OJ5 A;  5KDM A;  1F66 A;  1RGZ A;  4Z9Q A;  5AV9 A;  2H0T A;  3W96 A;  3NQJ A;  5B31 D;  3AZH D;  2J9O A;  1IKI A;  3WX7 A;  2A49 A;  5B1L B;  2RCX A;  2IOU A;  5AV6 C;  4H9S C;  3PBS A;  5GT0 C;  3N8R A;  5GLB A;  5B0Z C;  4IBD A;  5B1L A;  4WU8 B;  3LZ1 D;  4Q8I A;  3G4P A;  3AYW C;  5I94 A;  4P0M A;  4WU8 A;  3WTP D;  3WKJ D;  1FCO A;  3MGR C;  1ZC2 A;  5AQA A;  5EVI A;  3E2K A;  3HLW A;  3IQA A;  1RGY A;  4KG2 A;  3UPN A;  3Q81 A;  4EO5 B;  3LJA C;  2ZY3 A;  3UDI A;  1YT4 A;  1HTZ A;  5JYO A;  3DTM A;  1W5D A;  4S2L A;  4WEJ A;  3C1C C;  5HX9 A;  3AFA C;  3VSL A;  2RVQ D;  2Y2N A;  3G30 A;  1S0W A;  5BT1 C;  2ZJ9 A;  1Z2C B;  3IXH A;  1BLS A;  2ZQ8 A;  3GR2 A;  1WWI A;  4R0Q A;  3REK A;  3OCN A;  3SS3 A;  1MWU A;  3X1V B;  3UNW A;  4ZUX B;  3C7U A;  3M2K A;  2Y59 A;  4J8V B;  3AV2 C;  1ID3 C;  1NYY A;  5DTT A;  1SDE A;  3MGQ D;  3UT9 B;  3X1V A;  4YM6 D;  1BUE A;  2HUE B;  1BLP A;  4OQI A;  4ZUX A;  1P3B B;  2ZY2 A;  5EPH A;  4J8V A;  5BS7 C;  2Y2G A;  3TSG A;  2G5I C;  1P3B A;  1MPL A;  4CPK A;  1P3I D;  3CG5 A;  4G92 B;  3TU4 D;  2XEP A;  1FR6 A;  4LV3 A;  3KWQ D;  4R3B A;  5CHU A;  3AZI D;  4KG6 A;  1GHI A;  5AQB A;  5F82 A;  4KUD D;  5AV6 B;  1HZO A;  5CHL B;  5GT0 B;  4GKU A;  4XUJ D;  5B0Z B;  3B3X A;  4YS3 D;  3N3F A;  5CED A;  3MGP B;  4CSR B;  2YFV B;  1O7E A;  5AV6 A;  4H9S A;  1CEG A;  5GT0 A;  1T3U A;  4OQH A;  3AYW B;  5B0Z A;  2EFX A;  4CSR A;  4OLD A;  2YFV A;  2ZC4 B;  3MGR B;  3VP3 A;  4WJ3 C;  3C4P A;  3PBT A;  3AYW A;  2H5S A;  3UTA D;  3PAG A;  3MGR A;  4CJN A;  2WYX A;  4QU3 A;  3LJA B;  4LD9 D;  4X56 A;  4QB8 A;  5JYP A;  3LZ0 D;  3LJA A;  3IHB A;  1M1A C;  3G2Z A;  3AFA B;  4R4S A;  4OJO A;  1ESU A;  3W99 D;  3Q1F A;  1YM1 A;  4R8P D;  5HL1 A;  3C1C A;  2NZD D;  3AFA A;  4K0W A;  4IBG A;  1TAF B;  2R9X A;  1W8Y A;  5CER A;  3TG9 A;  1P3K C;  3A6N D;  4KGC D;  1ID3 B;  1TAF A;  1LLB A;  3LZ1 C;  1IYO A;  4Z66 D;  1KVM A;  4G91 C;  5M18 A;  1K54 C;  1ID3 A;  3UDX A;  3WTP C;  1BUL A;  3WKJ C;  5B0Y D;  1ONH A;  5BS7 A;  1FR1 A;  3WS4 A;  3W97 D;  2Q9M A;  5E43 A;  4C3Q A;  3X1S C;  4C6Y A;  3LEZ A;  5C3I C;  5CGX A;  3AZF D;  5GLA A;  1ES5 A;  1KX4 D;  1XKZ A;  4JF4 A;  1IEM A;  2RVQ C;  5GXQ B;  1DJC A;  1H3O B;  4UA7 A;  3AZJ D;  2DCF A;  1H3O A;  3L25 A;  3BM6 A;  3OPP A;  3AGE A;  2ZMA A;  3HUN A;  4YM6 C;  1ZG6 A;  2ARO D;  4OOY A;  1XGI A;  5EOE A;  5EVL A;  3WS5 A;  2UWX A;  1P3I C;  1H5X A;  5FQI A;  3B6G C;  3JYI A;  3MBZ A;  3V39 A;  3VP0 A;  1AOI D;  3TU4 C;  4R3J A;  4FH2 A;  4ZBJ B;  1K6R A;  3KWQ C;  5CP6 C;  1M1A A;  3HRE A;  4JXS A;  5KMW A;  3LY3 A;  1DY6 A;  3V5M A;  4S2O A;  2PU4 A;  2CWE A;  1P3K B;  1K25 A;  1N4O A;  3LZ1 B;  5KSH A;  1EQZ C;  4H8R A;  2WAD A;  3IHA A;  3HLG A;  1P3K A;  2DRW A;  3UDF A;  3W96 D;  3GVB A;  4BEN A;  2BYK A;  4G91 B;  2QPN A;  3HLD A;  3N8L A;  5AQ9 A;  4WZ5 C;  1BLH A;  3WTP B;  3WKJ B;  3LZ1 A;  4JF5 A;  5HAQ A;  5HAI A;  4IBI A;  4IBK A;  1K54 A;  3WTP A;  3WKJ A;  4BD0 A;  4DE1 A;  3X1S B;  5G49 B;  5C3I B;  3L27 A;  2GDN A;  1G68 A;  4BL3 A;  3AN2 D;  3X1S A;  5FQ9 A;  3WAA D;  4MBK A;  5EVI D;  2DF4 C;  2Y55 A;  1K4F A;  3MZE A;  4ZDX A;  4ZJ2 A;  4LG2 A;  4ZBE A;  2WKE A;  4JXW A;  4KZ6 A;  5FQK A;  5EEC A;  1ESI A;  2XLN A;  4YM6 B;  4OJ6 A;  2EXB A;  1WE4 A;  4E3K A;  3VP1 A;  4YM6 A;  4NFT A;  3O3V A;  5B32 D;  3REK D;  3ITA A;  4HEF A;  1P3I B;  5B24 C;  1M40 A;  1YU3 A;  4K91 A;  4WNN B;  5CHJ A;  4L0L A;  3TU4 B;  1P3I A;  3KWQ B;  3X1V D;  3B6G A;  4WNN A;  5CP6 B;  4JJN C;  3MZD A;  4ZUX D;  3HL9 A;  4LEN A;  3TU4 A;  4J8V D;  4E44 A;  5GLC A;  4H9Q B;  3KWQ A;  2J8Y A;  3MGS C;  5CP6 A;  5AVB D;  3X1T D;  3VFH A;  1H8Z A;  5DNN C;  2Y2J A;  1BTL A;  4D2O A;  4H9Q A;  2Q9N A;  4OH0 A;  4NZ4 A;  4LCM A;  2EXA A;  1KU5 A;  4IBC A;  3W4Q A;  1HD8 A;  5E2E A;  3OCL A;  3A1I A;  1EQZ A;  3REH C;  1MXO A;  3B0C T;  3WRT A;  2WKH A;  4WZ5 A;  3UTA B;  2QMI A;  4RX2 A;  2L5A A;  3UTA A;  4GDN A;  5D3O A;  5GT0 D;  1NYM A;  5B0Z D;  3BEC A;  1E25 A;  3H0M C;  4N9L A;  4WEK A;  3P09 A;  4KEN B;  3EPL A;  3W99 B;  2Y2P A;  1ERQ A;  4JKT A;  1HTA A;  3R45 B;  2HIO C;  3AZL D;  1KGG A;  3O87 A;  3R45 A;  1JWV A;  4NYY A;  2V20 A;  3EPH A;  4LV2 A;  1J9M A;  5FDH A;  3AZK D;  3C1C D;  3WTP E;  1NY0 A;  5EE8 A;  5F83 A;  3GTC A;  4DE3 A;  4YIN A;  1MWR A;  2EFU A;  5CXW A;  3P5J B;  5B24 A;  4JJN B;  4BLM A;  3UE1 A;  4H9N B;  3AV2 D;  2ZQ7 A;  3AN2 C;  3GRJ A;  3WAA C;  3MGS B;  4JJN A;  2WGI A;  4H9N A;  2PU2 A;  4Y0O A;  2P74 A;  5GT3 C;  2ZM8 A;  3MGS A;  5AQ7 A;  5JA4 B;  5DNN A;  2Z2L B;  1MY8 A;  4XXR A;  2OLV A;  2VGK A;  3EG5 B;  2XR0 A;  2IWC A;  5JA4 A;  2J7V A;  3SS4 A;  3SS5 A;  3DWK A;  2H0Y A;  2B5R A;  5HW3 A;  4C75 A;  5B32 C;  1W7F A;  2WZZ A;  4GHA A;  4S2J A;  5B1M C;  4U0T A;  3X1U C;  2J8P A;  3L26 A;  3REJ C;  3E2L A;  4B4X A;  1G6A A;  1R4V A;  4Z5T C;  4B88 A;  4OPY A;  1KE0 A;  3I7J A;  3G31 A;  3ZG9 B;  1ERM A;  5AVB C;  4IJE A;  3X1T C;  3REI C;  1YLJ A;  1SCW A;  1TDG A;  5KDM B;  5FI2 A;  1CK3 A;  1DJB A;  3H0R C;  3PBN A;  2HIO A;  1WYC A;  3UPO A;  1M1A D;  3VH6 T;  2JSS A;  4XZQ C;  1CEF A;  4E6W A;  1YU1 A;  1FSW A;  3GMW A;  1JVJ A;  2Y2H A;  1YU2 A;  3OPL A;  1Q9C A;  1TEM A;  3LO7 A;  4Y0U A;  5F99 C;  3IWO A;  3F6T A;  3FKV A;  4PM5 A;  1P3K D;  3C5A A;  4Z2M G;  3AN2 B;  2RIQ A;  3WAA B;  5EVI B;  4O7D A;  3B0B A;  4X68 A;  4FH4 A;  4AWL C;  1IKG A;  3HUO A;  5CTN A;  3MNN C;  3AN2 A;  5GT3 B;  4QY6 A;  3GV9 A;  2F8N A;  3WAA A;  3A3E A;  1L0E A;  3ZFZ A;  1MKI A;  5HFO A;  5GT3 A;  2F2A C;  2X01 A;  1P3P D;  3AZL C;  1TZY D;  3ZGA B;  3X1S D;  3KXB C;  4LV0 A;  3SH7 A;  1YLZ A;  4DE0 A;  3UY6 A;  5AV8 C;  3A1K A;  3AV1 C;  1QME A;  3AZK C;  5B32 B;  3REK B;  4DDY A;  3RJU A;  1PYY A;  1IYP A;  3X1U B;  3NY4 A;  5E5A D;  3VFF A;  5CRF A;  4Z5T B;  5B32 A;  4GD6 A;  3X1U A;  2Y2L A;  3L2A A;  3REJ A;  3ZNT A;  5DVA A;  4Z5T A;  2NQB D;  5AVB B;  3X1T B;  3REI B;  1BT5 A;  4X6T A;  4WBG A;  2V2F F;  3UN7 A;  5AVB A;  3X1T A;  3REI A;  1P3A C;  3B6F C;  1XGJ A;  3W98 C;  4M3K A;  2IWB A;  3B6G D;  4XZQ B;  4DRB A;  4WMC D;  1B6W A;  3L29 A;  4S2N C;  5CP6 D;  4XZQ A;  4R4R A;  3W4O A;  5F99 B;  4ZAM A;  3WA9 D;  5KZH A;  4WU9 C;  1FOF A;  5F99 A;  1EQZ D;  4YFM A;  2XGN A;  1MBL A;  3HLF A;  3MNN B;  3ZG5 A;  1CI9 A;  3RXW A;  3ISG A;  4J8W C;  5CEB A;  4H9O B;  3MNN A;  3NQU A;  3FZC A;  1FQG A;  5FSR A;  3AZL B;  5FQQ A;  4IBE A;  3P98 A;  5IHV A;  4H9O A;  2J9P A;  3KXB B;  4N92 A;  1U60 A;  3AZL A;  3Q82 A;  3AV1 B;  1L2S A;  3AZK B;  5DNM C;  3C1C B;  3KXB A;  4U3T A;  4OPR A;  5AV8 A;  3ZG0 A;  2Y2I A;  3AV1 A;  1PW8 A;  3V50 A;  4PM8 A;  4ZTK A;  3AZK A;  3WS0 A;  2HDU A;  3ZCZ A;  3AZG C;  5B32 G;  3AV2 B;  2F8N H;  2BYM B;  3O62 C;  2DQN C;  5FQJ A;  3RXX A;  1JFI B;  2BG1 A;  1YU0 A;  3AV2 A;  2F8N K;  1JWZ A;  2BYM A;  2LY8 A;  1P3A B;  1JFI A;  5E2F A;  3KSY A;  5B24 D;  3W98 B;  1P3P C;  2ZC6 B;  2ZC5 B;  1ONG A;  1TZY C;  2HPB A;  1P3A A;  1W8Q A;  3B6F A;  2HDR A;  3REL C;  1K56 A;  4MBH A;  3W98 A;  4LCL A;  4JJN D;  1SHV A;  4R23 A;  4OP5 A;  4WEL A;  1ES3 A;  4IVK A;  4S2N A;  3B0C W;  3MGS D;  1KE4 A;  3V9R B;  5DNN D;  4WU9 B;  4JLF A;  5E5A C;  2OLU A;  3SH8 A;  1KDW A;  4OVD A;  3V9R A;  4WU9 A;  5FA7 A;  3UO9 A;  5B2J C;  3IXD A;  3ZNY A;  1BH9 B;  3REH D;  4EBL A;  2NQB C;  1Q2P A;  4OOL A;  4DRT A;  3VP2 A;  4X23 C;  4WZ4 A;  1BH9 A;  2H10 A;  5AV5 C;  4J8W A;  1XA7 A;  3HVF A;  3UE3 A;  4GB7 A;  3CZD A;  3BFD A;  1EWZ A;  1FCN A;  4PM9 A;  3N7W A;  3KUY C;  2ZM5 A;  1M1A B;  3QNC A;  1PWG A;  5DNM B;  1QMF A;  4UPK A;  1GA9 A;  3KS8 A;  4MEZ A;  2XDM A;  5DNM A;  1M18 C;  3S1Y A;  4U0X A;  4OQ0 A;  5A91 A;  3HLC A;  3WA9 C;  2XF3 A;  2BYK B;  4IBX A;  2HIO D;  4RVA A;  4RX3 A;  4P87 A;  3AZG A;  2HDQ A;  5GSU C;  1JTD A;  4KZ5 A;  4DF6 A;  3KFU G;  4MLL A;  2FFY A;  4EUZ A;  2EX9 A;  1L0G A;  3O62 A;  1JTG A;  1P34 C;  3OPH A;  1PW1 A;  4NE5 A;  2X71 A;  1P3P B;  1ZLA C;  2ZC7 A;  3OC2 A;  5CGS A;  1TZY B;  2WUQ A;  5A90 A;  1JWP A;  3MZF A;  3EPK A;  1XX2 A;  3G34 A;  1P3P A;  3VH6 A;  1EI5 A;  1PZO A;  1TZY A;  4OQG A;  1TVF A;  1IYQ A;  3BFF A;  1PWC A;  2F8N D;  1XXM A;  1L0D A;  5E5A B;  3TOI A;  5GT3 D;  1BZA A;  1PWD A;  4UAA A;  1XA1 A;  4NY2 A;  4NE6 A;  5B2J B;  5E5A A;  2ZC3 B;  2Y2M A;  2NQB B;  3GSG A;  1C3B A;  4FSF A;  1FSY A;  2EX2 A;  4ZJ3 A;  4KHA B;  5B2J A;  2NQB A;  5F1F A;  4KHA A;  4X23 A;  5B2I D;  5GHX A;  2XD1 A;  5B1M D;  4OUI A;  5AV5 A;  1P3G D;  3X1U D;  3B6G B;  4RYE A;  3REJ D;  4GNU A;  4IBR A;  5CPI C;  2OSU A;  4Z5T D;  1P3F C;  3KUY A;  1ES4 A;  3PAE A;  4WMC A;  5DF9 A;  5TFQ A;  5B40 C;  3WA9 B;  4GOG A;  3VH6 W;  3REI D;  1M18 A;  4S2M A;  2Y2O A;  3LCE A;  1WWS A;  1EQZ B;  3WA9 A;  3WS2 A;  1OME A;  1KX3 D;  1YMX A;  3W4P A;  5GSU A;  3M2J A;  4XZQ D;  1MWS A;  1PI4 A;  5BO0 B;  1HQ3 D;  5BPV A;  1P34 B;  5FI7 A;  3HUM A;  2XD5 A;  2Y4A A;  2JE5 A;  1ZLA B;  2X02 A;  5F99 D;  3IXB A;  5BO0 A;  1P3L C;  4JF6 A;  3ITB A;  4P6B A;  1P34 A;  1KGF A;  1ZLA A;  1YMS A;  2HDS A;  4NZ5 A;  1P3O C;  1KDS A;  5J8X A;  3MNN D;  1P3M C;  3FDD A;  1K55 C;  5CPK C;  5FAO A;  4HGA C;  4NZ1 A;  2OV5 A;  3L28 A;  3MXS A;  4BQM A;  3DWZ A;  4OP8 A;  1WYB A;  4OKP A;  5TR7 A;  3KXB D;  5AV8 D;  3H0L C;  4IVI A;  3AV1 D;  2ZQD A;  5L2F A;  1BH8 B;  3UPP A;  5B24 B;  4H9R A;  1KVL A;  3BYD A;  2EX6 A;  1BH8 A;  1Z6F A;  4BJP A;  2IWD A;  3NDE A;  3HBR A;  1P3F B;  1Y54 A;  4Y7P A;  1I2W A;  1N1J B;  3B0D C;  5B40 B;  1S32 D;  1P3F A;  3BEB A;  2R9W A;  3LEL C;  1A7W A;  1YLY A;  5DNN B;  1N1J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...