2Y2QA

Penicillin-binding protein 1b (pbp-1b) in complex with an alkyl boronate (z06)
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
489
structure length
469
Chain Sequence
ISEITYSDGTVIASIDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTGQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Guided Design of Cell Wall Biosynthesis Inhibitors that Overcome Beta-Lactam Resistance in Staphylococcus Aureus (Mrsa).
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
molecule keywords PENICILLIN-BINDING PROTEIN 1B
total genus 164
structure length 469
sequence length 489
chains with identical sequence B
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2y2qA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2y2qA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2y2qA02
2OSUA 1SDEA 4UA7A 1QMEA 4EQIA 3OCLA 2WADA 4PM8A 2HDRA 3W8KA 1DJCA 4HBTA 3BECA 4XUXA 4KZ9A 4KZAA 4H8RA 4WELA 3GMWA 3Q1FA 1SDNA 1K54C 4P6BA 4ZTKA 1K38A 5GL9A 4E6WA 3NCKA 4ZAMA 1IYQA 4QY6A 2WZZA 3PBOA 3SH8A 4QY5A 3LY4A 4DF6A 3ZG0A 4BD1A 2ZMAA 3SH7A 3M6HA 4X53A 1PW1A 1WYBA 5KSHA 5TR7A 4LCMA 4KG5A 4MEZA 2ZM2A 4KENB 2BLSA 1O7EA 1PWDA 3OZHA 3N4IA 3PBNA 4S2NA 3MXRA 4MLLA 4OLDA 1BUEA 4EBNA 3ZG7B 1Y54A 5I94A 2J9OA 5HAIA 3G32A 4DDYA 2H0YA 5EECA 3PBQA 4E3NA 1NY0A 4P87A 3HL9A 4JPMA 3V39A 1PZOA 3BM6A 3IF6C 1GHMA 3O86A 1PWGA 1XX2A 1C3BA 3HLGA 3BLSA 5E2HA 3SOIA 3A3DA 2WGWA 2ZC3B 5D3OA 3MXSA 2R9XA 4S2PA 3TG9A 4CJNA 5HX9A 1K6SA 5CEDA 3QHYA 5F83A 4ZBEA 5IHVA 1BLSA 3WS0A 4KZ8A 4E3LA 3S22A 5KSCA 5FA7A 2JE5A 3IXBA 3GQZA 1LI0A 3ZG8B 3DTMA 4JLFA 4WZ5C 3A3FA 4KZ7A 5CXWA 1HZOA 1G68A 1RCJA 4MBFA 4KG2A 5JYOA 3W4QA 2CC1A 3UPPA 3V5MA 1FQGA 2P9VB 4EBPA 3LO7A 3C7VA 2Y59A 4LV0A 2H5SA 1GCEA 4DE1A 3ZG9B 4WZ4A 4Y7PA 1IYPA 3HUOA 3HUNA 4P0MA 3BFGA 1L0FA 4X6TA 1W79A 5FQIA 3PAGA 4OPYA 3ZGAB 4OP8A 4F94A 1LLBA 3FZCA 5A92A 3M2KA 5FQMA 3ITAA 5EPHA 5GHXA 4S2OA 4KZ4A 2WKEA 1N4OA 4OLGA 4RVAA 2GDNA 4KZ3A 4LV1A 1WE4A 5FATA 2EX8A 2EXAA 4ZJ2A 4B88A 3IXGA 3N6IA 1BLCA 3FYZA 5J8XA 1FCNA 1PIOA 5E43A 3SS4A 2A3UA 1LL5A 5FI7A 4HBUA 4E3KA 1MWSA 3Q7ZA 3BRMA 4WEJA 4FCFA 3WS1A 3PBSA 2HDQA 1KE3A 3BFDA 3IWOA 5CRFA 3RXWA 1PI5A 3GV9A 5DF9A 5AQ9A 4JF5A 4M3KA 1SHVA 3JYIA 2JCHA 3Q07A 4IEDA 1QMFA 2WYXA 2PU4A 1BULA 3HBRA 4EBLA 5FI6A 3BFEA 2ZQAA 3CJMA 4DE3A 3ZNTA 4X55A 2P9VA 5EVIC 4GN2A 3IXDA 4KZBA 1BT5A 3Q7VA 1KDSA 3HREA 1K55C 2FFYA 1KE0A 1FCOA 1ALQA 1RP5A 1I2SA 4GDBA 1BLHA 2EXBA 2XD5A 3IWQA 3OPHA 1K56A 4QU3A 4U3TA 5G18A 1N9BA 1E25A 1LL9A 3NDEA 2JC7A 1OMEA 3LEZA 3VFHA 3HLDA 1KVLA 2WAEA 1L2SA 5FDHA 3ZNYA 2RCXA 1IKGA 2ZQDA 1E3UD 2H0TA 4X68A 4BL2A 1VQQA 2DRWA 4R23A 3MZEA 1MKIA 4XXRA 3C4PA 1BZAA 3GSGA 1BTLA 3C7UA 3M2JA 1VM1A 3QNBA 3GVBA 4GB7A 4OVDA 3HLWA 1MWRA 5AQBA 1M40A 4S2KA 2ZC5B 4Y0OA 4OPZA 4JF6A 4WM9A 4E6XA 3CMZA 5KMWA 3A3EA 2XD1A 1I5QA 3S4XA 3UDIA 5FASA 5U47A 3V3SA 3IF6A 4UA6A 3HVFA 3IHAA 1NYMA 4FH4A 3AGFA 1KGGA 2J9PA 1PWCA 3AGDA 1HTZA 4GKUA 1TDGA 2JBFA 3PTEA 4QB8A 2PU2A 4PPRA 3WRZA 2XGNA 2Z2MB 4KQRA 1FR1A 1IEMA 3E2LA 5GLBA 3WRTA 3P98A 4K0WA 3VP0A 5HAQA 1O07A 3VSLA 3Q7VB 3BFFA 3HLCA 3W4PA 5EUAA 5GLCA 3IH8A 3P09A 3NIAA 2QZ6A 2V1ZA 3VP3A 4E3MA 4YINA 1MY8A 4B4ZA 4C75A 1YLJA 4DXBA 3MKEA 1GHPA 1DJBA 1PW8A 4GDNA 4R3BA 1XP4A 4S2MA 5EVLA 1L0GA 5A91A 1S0WA 3CZDA 1XA1A 3EQVA 3IQAA 4KZ6A 4RX3A 1W7FA 4ZJ1A 3E2KA 5GHZA 4S2JA 4PM5A 2G2WA 4QJGA 1CI9A 3OC2A 1HD8A 4RA7A 1LI9A 5CECA 2EX2A 2XF3A 5GLAA 3VP1A 1SCWA 5FQ9A 1ZC2A 2X02A 2ZC7A 2A49A 5EOEA 1MPLA 1S6RA 3HLFA 3ZVWA 1ES2A 5AQ7A 4U0XA 3GR2A 1SKFA 4DE2A 2Q9NA 1L0DA 4JXSA 3G2YA 1ONGA 1G6AA 2RL3A 3Q82A 4ZDXA 4C3QA 4OOMA 5HARA 3ISGA 1K56D 3SH9A 3UE3A 4GZBA 4DRTA 3IT9A 2ZJ9A 2IWBA 1IYSA 1K57C 1MBLA 2V20A 3ZFZA 5E2GA 4P85A 5FQJA 3OPRA 3A3IA 4KZ5A 3IF5A 1YLYA 2VGKA 1TDLA 2Y2MA 2XDMA 1Q2QA 3N8LA 4OONA 4OOYA 1BLPA 1YMXA 4MBHA 4Y0TA 2XH9A 2ZQ9A 3VMAA 3PBTA 2HP9A 1YLTA 3C5AA 3UNWA 4N9LA 3NI9A 2Y2LA 1GA9A 1M6KA 4L0LA 4PMAA 3VSKA 1ONHA 2Y55A 1EWZA 2XLNA 3VFFA 1K4FA 1RGZA 4BD0A 1YM1A 1CEFA 3MKFA 5M18A 1GHIA 2OLVA 1K25A 5KZHA 2C5WB 2EFXA 5EVIA 2ZQCA 3UE0A 5DTTA 1W8YA 1K6RA 3BFCA 1HVBA 3UDXA 3GTCA 4HEFA 2IWCA 3N7WA 1Z6FA 3ZHHA 2DCFA 1J9MA 3FWLA 1ZG6A 1JVJA 3DWZA 4QD4A 1JWPA 2WGWB 5EVID 2XR0A 3QNCA 1K4EA 1MWUA 1JTGA 3G2ZA 3O3VA 1IKIA 2WUQA 2Y2KA 3FKWA 1W5DA 5FSRA 2ZD8A 2EFUA 4BL3A 5F1FA 3HUMA 2IWDA 1KGFA 4HESA 1ES3A 1W8QA 3B3XA 1JWZA 3UDFA 3SS3A 3UN7A 4DXCA 5A90A 1NZUA 4ZJ3A 5DTKA 4GNUA 2VGJA 4EUZA 2HPBA 3UPNA 4E3IA 1KE4A 2G2UA 3HLEA 5FAOA 4WMCD 1I2WA 4N1HA 4S2IA 5DF7A 3ITBA 3NY4A 4LCLA 5FQQA 4EWFA 4OP5A 4E3OA 1E4DA 1XXMA 1DY6A 3WWXA 4UAAA 3G31A 3MFDA 1FSWA 3I7JA 2V2FF 5FAQA 3IH9A 1CEGA 4PM6A 3S1YA 3UY6A 5CGWA 3ZVTA 5TGFA 5HFOA 1K54A 3G30A 1ERQA 1Q2PA 3LY3A 2XK1A 5DF8A 3VP2A 5EVIB 4OKPA 3C4OA 2EX6A 3WS2A 2WKIA 4E3JA 2Y2IA 2I72A 4OQGA 1YMSA 3FKVA 3WS5A 2WAFA 4WZ5A 4OH0A 1H5XA 3OPLA 4PM9A 4QHCA 1XGJA 1YQSA 2Q9MA 4OPQA 5M1AA 5FAPA 3PBRA 5FI2A 1TEMA 2Y2GA 3D4FA 3MBZA 4BJPA 4A5RA 4JXWA 5CERA 5E2FA 1U60A 4UHUA 1JWVA 1RGYA 3BEBA 4CPKA 2HP6A 4N9KA 2J8YA 4X56A 3WS4A 4LV3A 2UWXA 4FH2A 3G34A 1E3UA 3N8SA 4DKIA 4X69A 1ES4A 2Y4AA 2ZM0A 5HAPA 4R0QA 4OOLA 3AGEA 1NJ4A 1NXYA 4EV4A 1DJAA 4BQMA 1H8YA 1TVFA 4D2OA 2E8IA 4B4XA 4PM7A 4IBRA 2WKHA 1ZKJA 1XPBA 2DNSA 3ZDJA 3UPOA 3IXHA 3OCNA 2PBYA 2Y2QA 2XQZA 2J7VA 3PAEA 2C6WB 2Y2JA 1EROA 1MWTA 4UA9A 3UO9A 4R4SA 4JBFA 2OV5A 2HDUA 4GD6A 1CI8A 4BLMA 3RXXA 4XUZA 2XEPA 4LV2A 4OQHA 1GA0A 2ZQ7A 4WEKA 3ZG5A 3BLMA 4LENA 4BENA 5FQKA 2HDSA 4N1XA 1H8ZA 4DE0A 3O88A 5JYPA 1YLWA 2OLUA 3NDGA 4JF4A 2HP5A 5CEBA 5HW3A 1PI4A 5CTNA 4WMCA 2Y2HA 3CG5A 1LHYA 5CHMA 1KDWA 4WYYA 4K91A 2XFTA 4KQOA 4OQ0A 3NBLA 5CHUA 3RJUA 3VOZA 3Q81A 5GHYA 4KG6A 3EQUA 4NETA 5A93A 5TFQA 4GOGA 2WK0A 3GRJA 3N8RA 3O87A 4KQQA 1ES5A 1YLZA 4FSFA 1EI5A 5L2FA 4DDSA 1ESIA 4O7DA 4FD8A 3OPPA 5CGXA 2Y91A 1K55A 5E2EA 5M19A 4JXVA 1IYOA 3W4OA 2WGIA 3IF6B 3DWKA 1PYYA 2QMIA 1XA7A 3G4PA 1FCMA 2ZC6B 3NC8A 1BSGA 5CGSA 5CTMA 3IHBA 4K0XA 3MZFA 4S2LA 2ZC4B 3MZDA 4GD8A 2B5RA 3VP4A 4R3JA 5EE8A 5HL1A 4JXGA 3ZCZA 3DW0A 2BG1A 4JKTA 3IWIA 4IVIA 1NRFA 3VOYA 3V50A 1NZOA 1KGEA 2ZQ8A 3FV7A 1IELA 5F82A 1NYYA 2ZM8A 2Y2OA 1L0EA 3BYDA 3V3RA 5EOOA 2FFFB 1FR6A 3LCEA 4RX2A 4RYEA 1CK3A 1PZPA 4N92A 1ZG4A 4ID4A 4OQIA 2Y2NA 4IVKA 2EX9A 3SS5A 2X71A 2QPNA 2X01A 1XGIA 2ZLYA 2P74A 2Z2LB 4S2NC 4R4RA 5GLDA 1FSYA 1MXOA 3HLBA 1XKZA 1KVMA 4MBKA 2XFSA 4Z9QA 1K57A 3UE1A 2Y2PA 4YFMA 3G35A 4OPRA 1AXBA 1JTDA 1YT4A 5AQAA 1YLPA 1FOFA 5DTSA 5BOHA 5F1GA 3TSGA 4WBGA 2WGVA 1WYCA 3M6BA 4C6YA 4Q8IA 4R1GA 1ERMA 4IBXA 3TOIA 4MNRA 4Y0UA 1ESUA 5DVAA 2WZXA 3A3JA 2H10A 5CHJA 2R9WA 4U0TA 4NK3A
chains in the Genus database with same CATH superfamily
1SDEA 5DJUA 1QMEA 4EQIA 4XZQB 5AV9C 3AZKB 1ZLAC 2WADA 4PHTA 4Y13A 4II7A 4KGCD 3GMWA 4ZTKA 1R4VA 2ZMVA 4E6WA 1GPFA 2HUEC 3REHC 1VEUB 3L26A 4QY6A 3SH8A 3LY4A 3AZJB 3E98A 2W0NA 3UB6A 3ZG0A 4IJEA 3VE3A 3M6HA 5IU1A 3A1IA 4KENB 3PBNA 2L5AA 4E45A 2VJWA 4H9PA 5AVBB 4Z2GA 3LIEA 1KX5B 2H0YA 1OJGA 2PYPA 3WA9D 4Y3IA 3V39A 2IOUA 1PZOA 3BM6A 4R38A 5CHLB 3UTAB 3EEHA 1PWGA 1C3BA 3C1CD 1AOIC 4YWZA 3SOIA 2ZC3B 4IBBA 3WD3A 3WKJC 4S2PA 1P3BB 1P3BD 5HX9A 1K6SA 5FUGB 3QHYA 4WF0A 4ZBEA 1BLSA 5AVCB 1YKDA 5AVBC 4Z2JA 4KZ8A 4E3LA 1F66C 3A6NB 4LFUA 1LI0A 5DNMA 3CWFA 4NG2A 2ZOIA 3B0DC 1G68A 1HZOA 2BASA 4UUZA 2ACGA 3W4QA 4Q0IA 5C3IB 3V5MA 3B6FD 2FH5A 4J8XA 5B2JB 3WAAC 2WKPA 4WU8A 2HIOD 2HIOC 1GCEA 1MKMA 1IYPA 3HUOA 3HUNA 3T4OA 4X6TA 4I5SA 5L10A 2NZDC 3PAGA 3LZ0A 4F94A 4KHAA 3M2KA 5FQMA 5EPHA 2PYOA 4BMWA 1P3LC 2D49A 4HMCA 4I3AA 4OLGA 3L27A 5FATA 1SKOB 3DTIA 5GT0B 4B88A 1BLCA 3FYZA 2W27A 1PIOA 2DMWA 2A3UA 1LL5A 5FI7A 1N9NA 1EAKA 1MWSA 4GS9B 3AV1D 1KE3A 1JNUA 5CRFA 5GXQD 1SHVA 2AROC 3AZIA 1P3AB 3JYIA 3Q07A 4GHIA 4IJGA 3REIB 3AV1A 3AZGD 5FI6A 1GSXA 2BTFP 3W99D 1BT5A 3Q7VA 1M18B 1KE0A 1EQZC 1FCOA 3H7WA 1L6JA 1TZYC 4G3KA 5CPKD 2PRFA 3LZ0D 5G18A 2EXBA 2XD5A 4QU3A 1K56A 1OMEA 1UWNX 3LEZA 1EQZA 1KVLA 1B6WA 2WAEA 2RCXA 1ZHHB 1IKGA 2ZQDA 1T19A 1F98A 2V9AA 3MZEA 3UB7A 3C4PA 3GSGA 4J8WA 1BTLA 2D01A 1P3MD 3QNBA 4OVDA 1KS0A 3HLWA 5AQBA 1GOIA 3B6GA 4WM9A 1H3QA 2AROA 3AZIC 1MZUA 2XD1A 2VV6A 3TW8A 3MGQD 4UA6A 1P3IC 3HVFA 3IHAA 1NYMA 4HMEA 2GX5A 4GHAA 5GT3B 5B31B 2A24A 3LJAD 3W99B 1HTZA 5JA4B 4QB8A 4KQRA 5HD5A 5AV8A 5CPKB 3V67A 5CP6A 1FR1A 3AZNB 1P0ZA 1HTAA 4NKPA 1TZYA 3WA9B 2F8NB 3WRTA 5HAQA 1T1CA 1O07A 4Z5TB 3HLCA 5EUAA 3KXBB 5BNVA 3P09A 3NIAA 3KYZA 4E3MA 3WAAD 3L2AA 3FDDA 1GHPA 3AZFA 3H82A 1XA1A 3JVUA 1W7FA 4UEYA 3LFVA 5AV5A 1F66B 4J8VC 1CI9A 3KWQB 3WAAA 2K31A 4RA7A 4CSRB 3S7NA 3JPUA 2X02A 1XJ4A 3C1BB 2WKQA 3GR2A 1BH9A 3AV2A 4WU9C 4DE2A 1E6ZA 3B6FB 4JGRA 2CV5B 3KSHA 5F69A 4C3QA 5B32A 4H9OA 4WV4B 3ISGA 1K56D 1DP9A 1MBLA 3ZFZA 3UT9D 3UT9B 3D3OA 4HY8A 4P85A 3E0YA 3LGOA 3A3IA 5AVFA 4UQIM 3IF5A 2V8CA 2XDMA 3WD0A 1BLPA 3KYEA 4J8WD 1YMXA 4MBHA 5EM0A 4Y0TA 2XH9A 2ZQ9A 3AV2C 4WU9A 3PBTA 1YLTA 3KXBC 2VGLM 1KX5D 2RTSA 4N9LA 3NI9A 4DJ2A 2Y2LA 1M6KA 4I3JA 3VSKA 1ONHA 1N1JB 4GJ4A 1RGZA 1TS7A 1YM1A 4HP9A 1P3FD 5M18A 1KOUA 1GHIA 2OLVA 5AV5C 5KZHA 2EFXA 1F9IA 5EVIA 3NECA 4KGCC 1HVBA 3CPTA 5HD3A 3REHA 1Z6FA 2DCFA 5B1LB 3F1OB 3F1PA 1K4EA 1MWUA 2I9VA 1BYWA 2HGVA 3MGPA 2ZD8A 4L9GA 4BL3A 3HUMA 1DRMA 3W2ZA 4HESA 2KX6A 3B3XA 3UTAD 1JWZA 3UDFA 2O9CA 3EPJA 3EPLA 1KE4A 3HLEA 5FAOA 3MSHA 1P34B 3ITBA 5FQQA 3QP1A 2INWA 1YAXA 4HH3A 3I7JA 2B02A 4I3IA 5B2JA 3LIBA 5TGFA 4IUHA 3FPVA 4F3LA 2VK3A 4QWOA 4OKPA 5B32D 4WZSB 4XZQD 3WS2A 2WKIA 1ULYA 2IO5B 3MGRA 3T4QA 1VHMA 4G91B 4LPZA 3OPLA 4PM9A 4QHCA 1YQSA 2Q9MA 3RH8B 1YU4A 5FAPA 4FOFA 3LZ1D 3LZ1B 2BYKA 3JVVA 3AZEA 4A5RA 2F8NG 5E2FA 5BS7C 3BEBA 4MN5A 5G4YA 3KSFA 3KXBD 2J8YA 2VX8A 3WS4A 2NQBB 5GSUD 3MNNC 4LV3A 3AV1C 3N8SA 1TAFA 3T50A 4OOLA 3AGEA 3K2NA 1DJAA 3OLOA 3CAXA 4B4XA 3AZIB 4PM7A 1H0IA 3X1UC 1M19D 3AV1B 2VGLS 1S32B 3VH6T 1H3OA 3BY8A 3A0SA 3UO9A 1T3UA 5B2JC 3F1NA 4AWLC 3L9KA 4JBFA 1UR9A 3RXXA 2VA0A 5AV8D 1S66L 2WKRA 4WEKA 4ZUXD 2YKHA 4BENA 5FQKA 2HDSA 4EEPA 2IO5C 5B40B 4J8VD 5HW3A 2OLUA 2PT7A 4NEED 3C30A 3S7OA 1M18D 1OTBA 3CG5A 3LYXA 1LHYA 4WYYA 1W2EA 3X1SB 3T1QB 5CPIC 3UMEA 4J8WB 5A93A 4NZ3A 4Z66C 4EXOA 2G5HC 3W97A 1EI5A 3UTBD 2Y91A 5M19A 5C5KA 1ACFA 1WWIA 3W4OA 1P9WA 4NE5A 3MGSB 4XZQA 5DKLA 4D60A 3NC8A 1OTAA 2ZL1A 5CTMA 3MZDA 3CHWP 3IX4A 3AN2A 4IVIA 3V50A 4EO5B 4GCZA 4IBJA 4HNBA 4RYEA 3B0BA 4WN5A 4G3VA 4N92A 4OQIA 4EQ1A 2W1TA 2GJ3A 2QPNA 2X01A 5DNMD 1S1ZA 4H9PB 5FL3A 2HZ5A 3KWQA 3WAAB 3HCYA 4Z9QA 2Y2PA 1X0OA 1AXBA 1YT4A 1OGBA 1E6NA 3AZGB 3KO6A 5BOHA 3TSGA 4Z2KA 1HQ3B 3M6BA 4R70A 1P3PC 4C6YA 1BH9B 1ERMA 4WU8D 2HIOA 3NQJA 4IBXA 4MNRA 2JKGA 5DNNB 4R8PB 3B47A 2CV5A 3C1CA 4EU0A 1TS0A 1YU2A 1OJ5A 1NRJA 3C1BD 4IBFA 1DJCA 4HBTA 1Y4OA 5AV9A 1ZLAA 5DNMC 3MJQA 4KZAA 4NE6A 4H8RA 4XUXA 1ID3B 3Q1FA 1K38A 4H9SA 4XUJC 1AIWA 1ZTUA 1IYQA 3B33A 5F68A 1WA9A 4UUZB 5CPID 4QY5A 3VE4A 4DF6A 4XT2A 1KX5C 3SH7A 5TJJA 3E4OA 5B2ID 4LCMA 4KG5A 4Z2HA 2ZM5A 2ZM2A 1O7EA 1PWDA 2D02A 3OZHA 5CX7A 1N1JA 4QLCA 2AVXA 3MXRA 4MLLA 4JGPA 1PFLA 4KHAB 3ZG7B 4EBNA 3REKA 2PYOB 4HIAA 3X1VC 1M1AC 3PBQA 1NY0A 4P87A 2V0WA 3REHB 1GHMA 4O8GA 4QLCC 2WGWA 4Z5TC 4H6JA 5D3OA 4Z5TD 3TG9A 5CEDA 3UTBC 3AZKC 3MGQC 3T4TA 3AZEC 3CUEA 3REJC 3IXBA 3GQZA 5B2IB 3ZG8B 1KX3C 4EEUA 3IS2A 3LELC 1P34A 1RCJA 2B18A 1BFMA 3UPPA 5B0YD 2GNXA 5B32G 2B95A 2P9VB 5B2JD 1UWPX 3REJA 3LO7A 4LV0A 2Y59A 4DE1A 1D1JA 5DKKA 4WZ4A 3S7QA 4P0MA 1L0FA 3EWKA 5FQIA 3MGQA 2G7UA 1U35A 4OPYA 3T1SA 4OP8A 3LJAA 3U2AA 5L09A 1EQZB 2GDNA 5GSUB 4KZ3A 4H9NA 2EX8A 3RELD 4ZRRA 3A0VA 3IXGA 3N6IA 3P01A 3UTAA 5E5AB 3KUYB 2V1BA 2F2AC 3LZ1A 3W96C 3MQOA 4NZ1A 3FG8A 3Q7ZA 4FCFA 3WS1A 4BWIA 1FILA 3BFDA 5FEGA 4MDZA 3MGSC 1TAFB 3GV9A 3AN2C 3MGSD 4JF5A 4M3KA 4NXGA 5B24A 5B31A 3A6NA 4HMDA 1QMFA 2WYXA 1BULA 3T1RA 5AV8B 5CPKA 1SZVA 4DE3A 3ZNTA 4H9SC 4XUJA 5EVIC 3IXDA 4WU8C 1RP5A 5GT0C 1P3OC 3OPHA 3AZMD 1A0KA 2NZDD 2NZDB 5AV6B 5CPIA 4ME4A 1P3LB 4YNRA 4Z2LA 5FDHA 3NOUC 5F99B 1VETB 3S7PA 4X68A 2BYMA 1E3UD 2H0TA 4NXEA 4CQHA 1M19C 1KX4A 4XXRA 1BZAA 3H0LC 1NLZA 1P3OB 3X1SA 4EW7A 4Y0OA 5AV6C 3A6NC 4EO5C 1KX3B 3O5YA 4NY2A 5KMWA 3A3EA 3B6FA 3UDIA 5FASA 3FC7A 3IF6A 3AZKD 2G5IC 4P6ZS 3TRCA 3EOIA 3UT9C 3AGDA 5AVEA 2JBFA 5HSQA 2PU2A 4PPRA 3REIA 3P7NA 1IEMA 2XROA 4K0WA 2QYBA 3Q7VB 3W4PA 4WL9A 4WU9D 1M18A 4WU9B 3AZMA 2V1ZA 3W96B 4Y17A 4G91C 3OOVA 1CF0A 2L0WA 2QKPA 3FPWA 2NUPC 4IBIA 1P3KC 3HONA 5A91A 4NZ4A 1S0WA 1L0GA 4RX3A 4KZ6A 4ZJ1A 5B24D 4PM5A 5B24C 4LLOB 1LL8A 1LI9A 3T4JA 2XF3A 3VH5A 1ZC2A 3CPTB 3ZVWA 5CPJD 5AQ7A 1P3FB 3EGXC 4ARZB 4YS3B 2RL3A 1AWIA 3Q82A 3MGPB 3E4QA 3RELA 4P6ZM 3P5JB 3AZNC 4IBDA 2QJ5A 2V1AA 2V20A 3LJAC 1VB6A 3AZNA 4KZ5A 2VGKA 1TDLA 2JHEA 1VEUA 4OOYA 5BNVB 2HP9A 4ZBJB 2J3WA 3LR3A 3UNWA 3FKEA 1P3BC 1QO6A 3LELA 4J8UC 3M7PA 1EWZA 2P7JA 1K4FA 2QJ7A 2XLNA 4BD0A 3MKFA 1AOIB 4CLCD 3C1BC 2C5WB 2ZQCA 2HV1A 4LD9A 1K6RA 3AZLC 4TX8A 3REKB 4HEFA 3C38A 3N7WA 3MVDB 1GSWA 3C1BA 4LRZE 1ZG6A 4CAYA 3KUYC 3AV2B 1XFNA 4HI4A 3O3VA 4DMZA 5J4EA 1IKIA 4UPKA 1W5DA 2FJ7D 2J3TC 2JKRM 3AZHC 5IS1A 3UB8A 1KGFA 3MVDC 5EFWA 4J8UD 4X25A 4DXCA 2F8ND 5A90A 4ZJ3A 4Y2FA 2ZY5A 5DNMB 2W8SA 1NLYA 3UPNA 1NWZA 1I2WA 4S2IA 4WMCD 4EUVA 1ID3C 3MXQA 4BBVA 3LI8A 4IBEA 1DY6A 3WWXA 3KWQC 4HGAB 1G28A 4R6LA 2V2FF 4ZBJC 5B0ZD 1YSQA 1CEGA 4PM6A 3UY6A 3LIFA 3ZVTA 4R8PC 1K54A 3LZ0B 3G30A 4R8PD 1ERQA 2YFWA 3LY3A 3PYPA 5EVEA 5DF8A 3VOLA 3C4OA 2EX6A 1F2KA 2Y2IA 5B0ZA 2I72A 4OQGA 3LJAB 3V9RB 3MGPC 5GT0A 3DTEA 3WS5A 3AZLB 2CV5D 1H5XA 1ID3D 3D72A 1TEMA 3LIAA 2VEAA 5CERA 4UHUA 5B0YC 1RGYA 4OJ6A 2O0YA 3H9WA 3MQLA 2OOLA 4N9KA 3W98C 1P3MB 1E3UA 1H8PA 3CI6A 5TBMA 5B31C 5BO0B 2ZM0A 5HAPA 5B31D 4R0QA 1NJ4A 1W63M 1OPXA 4BQMA 1H8YA 3MGSA 1TVFA 4D2OA 2E8IA 4IBRA 1OT9A 3ZDJA 1V9YA 3L29A 3UPOA 3IXHA 2PBYA 5KIZA 3LZ1C 5L8MA 2OAP1 3B6FC 4ETXA 4EETB 4GD6A 4YS3D 2JSSA 1CXWA 2JKRI 2PR5A 2XEPA 4LENA 2OAQ1 4G3WA 2LY8A 4IHQA 4Z66B 3IBRA 5AVCD 3ZYTA 3NDGA 2HP5A 4X1LA 2OWJA 5F99A 4WMCA 2Y2HA 1TD5A 1KDWA 2BYMB 2PYRA 1KU5A 4H9RA 2XFTA 4KQOA 3NBLA 4OQ0A 3RJUA 2BYKB 4H9QB 4KUOA 2CWEA 4NETA 1P3PD 4WNNA 3N8RA 2AROB 4JGOA 5B0YB 1ES5A 1YLZA 1P34C 5L2FA 2HIOB 1ESIA 1KX3A 4FD8A 5CGXA 3C1CB 4NXBA 4CLCC 4I39A 5C3IC 3IF6B 3DWKA 2QMIA 3F6TA 4LD9C 1E8BA 1BSGA 5CGSA 3MF0A 1Y28A 3GECA 3X1UB 2ZC4B 4S2LA 3G6OA 5HL1A 4JXGA 3ZCZA 4Z5TA 3DW0A 2BG1A 4PAUA 3F1NB 1NRFA 3UE6A 2ZY2A 5B33C 3MGRC 5F82A 2ZM8A 2IA2A 3KS4A 3AYWD 3BYDA 4IBCA 5EOOA 2FFFB 1PZRA 3MNNB 1FR6A 2V0UA 3BW6A 5AV5B 2Y2NA 1W63Q 2EX9A 3SS5A 2X71A 3UTAC 2P74A 4QLCB 2AROD 4R4RA 1FSYA 2JN7A 1K57A 4MN6A 2M7UA 3B0DB 4OPRA 4L9FA 3L7HA 3O62B 5CPJC 1FOFA 5DTSA 4J8WC 4OUIA 5BS7A 3U4LP 2MJ6A 4Q8IA 4R1GA 3DBAA 5AY8B 4Y0UA 5AY8D 1ESUA 2RVQD 2WZXA 3A3JA 5DVAA 1E15A 2H10A 4Y5FA 2R9WA 2OSUA 2VZWA 3OCLA 3NJAA 5AVCC 3AZED 2HDRA 5I5LA 2Q0OA 4PKYG 4OJLA 3BECA 2ZL1B 1P3LD 1B67A 4WELA 2R78A 2CV5C 2A2LA 3CUEC 3QP4A 4P6BA 1SDNA 5GL9A 5B2IA 2WZZA 3PBOA 4QLCD 2ZMAA 4MCWA 3W97D 3RTYA 4X53A 4YM6C 5GXQA 4MEZA 3WKJA 5EM1A 1LSVA 4S2NA 2YFVA 4X1MA 3MGQB 1BUEA 1HQ3C 3AL0C 5I94A 3AZJC 2J9OA 4LD9B 2VLGA 4E3NA 3AZGA 4XUJD 3F1OA 3HL9A 4JPMA 4H9NB 3TJZC 3IF6C 1HQ3A 3O86A 3HLGA 3BLSA 5E5AA 4RQ9A 2PD8A 3MXSA 4NFTA 5DNNA 3A1KA 5B1MA 3LI9A 5F83A 3AYWC 3MS6A 5IHVA 3WS0A 3LZ0C 3EPHA 5B32C 5E5AD 4XZQC 5AV9B 1ZLAB 1YU3A 2W3FA 4HOIA 5B24B 3S22A 2JE5A 1F66D 4J8XD 3IBJA 1H8MA 4JLFA 4WZ5C 1P3KB 4KUDA 2CC1A 5G49B 5JRGC 4EBPA 1OT6A 2PD7A 3T4KA 3C7VA 2H5SA 4F3LB 1J7MA 4NXFA 3BFGA 3AZFC 1P3FC 3ZGAB 1LLBA 5A92A 3ITAA 5GHXA 5CP6D 3C2WA 3REJD 3VH5W 3X1VB 1M1AB 5DNNC 2WKEA 5B0ZB 1N4OA 1L3LA 4LRYC 1WE4A 1VETA 4ZJ2A 2EXAA 5J8XA 2QWSA 5E43A 4E3KA 4HJ4A 3ICYA 4WEJA 3AFAB 2HDQA 3AZHA 3PBSA 3AYWB 4HJ3A 3H0RC 3RXWA 5DF9A 3LUQA 1TF1A 5AV5D 3TE8A 3X1TB 3L25A 3B6GC 3AZJD 3EEAA 4QNLA 4DJ3A 3X1UD 1T1AA 3BFEA 2ZQAA 3CJMA 4X55A 2P9VA 5IT5A 3REJB 1U35D 3HREA 2W3HA 2FFYA 1TZYD 3W97C 3IX3A 3VH6A 3IWQA 5AV8C 4U3TA 1N9BA 1F1EA 3NDEA 5B40A 3NOTC 3WTPA 4I38A 3ZNYA 3B6GD 2FZ0A 1VQQA 1V9ZA 2W1RA 3O62D 4R23A 3VP3A 3C7UA 1VM1A 1D7EA 5F6AA 1MWRA 4UQIS 4H9QA 1M40A 1OTDA 3CITA 5BNXB 1BH8A 3CMZA 3AZID 3S4XA 4WLAA 5U47A 5DFYA 2E8JA 3CLOA 5LBRA 1IOUA 3AGFA 2V8FA 1KGGA 1PWCA 3UB9A 3NULA 4GKUA 1TDGA 3PTEA 2DF4C 5DNND 3REKC 2Z2MB 4DQYB 3EG5B 2PYOD 3E2LA 3IX8A 1JFIB 3PHYA 4XUJB 3AN2B 1S67L 3VP0A 4HQAA 3VSLA 3BFFA 5GLCA 2QZ6A 2FJ7A 5JRGD 4YINA 1MY8A 4B4ZA 4X23C 1YLJA 5HPFA 4PKYA 2NZDA 1PW8A 4GDNA 4R3BA 5EVLA 4S2MA 3AZMC 3IQAA 4WJ3C 3E2KA 5JRGA 4JJNC 1HD8A 3OC2A 4J8XC 1H0MA 2NQBC 2EX2A 4LD9D 5GLAA 3VP1A 3W98B 1SCWA 2ZMFA 2A49A 1MPLA 4KUDC 3UTBB 1M19B 2LB5A 3C1CC 1AOID 4U0XA 4CLCB 4Q0JA 3NQJB 5F99C 1ONGA 4R8PA 3TU4A 5HARA 3MVDD 5G4ZA 3UE3A 4DRTA 1UGUA 2IWBA 4IUKA 5AJGA 4ESPA 3MR0A 1ID3A 5FQJA 3OPRA 3R45B 3N8LA 3D9YA 4OONA 1P97A 4CLCE 1K0KA 4ZUXA 4HGAC 3AZMB 4HH2A 4ETZA 4Q0HA 3AZJA 4X23B 4X23D 3OBFA 4G92B 1GA9A 4PMAA 2JKTI 2F8NH 1CEFA 5GXQC 1K25A 3QP8A 3UE0A 5DTTA 3NQUA 5AVBA 1W8YA 3BFCA 3GTCA 4R3AA 2IWCA 3LELD 3V9RA 3KSIA 1KX3D 3ZHHA 3AZLA 3MQ0A 1JVJA 3DWZA 5F5YA 1JWPA 2WGWB 3QNCA 3BQAA 5B40D 1Q9CA 4J8VB 2P08A 1JTGA 5DJTA 4YS3A 2WUQA 4WUJA 3FKWA 4KGCB 2EFUA 5FUGA 3AZND 1GSVA 1P3MA 4ZUXC 3SS3A 5TBMB 1NZUA 2VGJA 4EUZA 2HPBA 2G2UA 4N1HA 3KS8A 5CPJA 3T4LA 4E3OA 1E4DA 4KUDB 1XXMA 1H0GA 3NOPC 4UAAA 3G31A 1LSXA 1FSWA 3REID 4OJPA 3TU4D 5FAQA 2V5OA 3MGRD 2K2NA 3TU4C 2FN2A 1XJ3A 5B2IC 4FUWA 3B0CW 5HFOA 1P3KD 1Q2PA 2XK1A 3PR6A 5HL6A 4L9EA 1YMSA 3FKVA 4JJNA 4OH0A 1XGJA 4OPQA 3WD4A 3KUYA 4H9RB 3D4FA 3MBZA 4JXWA 1JWVA 4CPKA 2HP6A 2FJ7C 1P3OD 4DRAA 3AFAA 4HJ6A 2JKTM 2Y4AA 2KDKA 3B0CT 4EV4A 5CP6C 2Z6DA 2WKHA 1ZKJA 3A0RA 2XSSA 2DNSA 3OCNA 2RIQA 2J7VA 2Y2JA 1YU0A 1EROA 3REHD 4UA9A 3EPKA 2LB9A 2OV5A 3UMDA 2HDUA 4NE3A 4XUZA 2YFWB 1N9OA 4LV2A 4OQHA 1GA0A 5GT0D 3BLMA 5AV6A 5CPIB 1W1PA 1P3LA 4LG2A 1STZA 1YLWA 5HZHA 5J7EA 1PI4A 3WTPD 3WTPC 3H0MC 1P3MC 3VOZA 3O62A 4KG6A 1P3PB 1P9RA 2HF6A 3GRJA 2ZY4A 3O87A 5EV0A 3B6GB 4IBKA 4YS3C 4DDSA 1MC0A 4O7DA 3OPPA 1K55A 4JXVA 5BO0A 1IYOA 4OJOA 1PYYA 5GT3A 1FCMA 2ZC6B 4BBUA 1UR8A 1M18C 3IHBA 3X1VD 5B1MC 1M1AD 1YPRA 2UV0E 3MZFA 4GD8A 2B5RA 1XJ6A 3VP4A 5B31G 4LGWA 3IWIA 3VOYA 1NZOA 1KGEA 5B0ZC 2ZQ8A 1IELA 3KXBA 3REIC 4YM6B 4YM6D 1L0EA 2FJ7B 3V3RA 1CK7A 1S4SA 3LCEA 5GXQB 1PZPA 4ID4A 1W1YA 3H82B 4IVKA 4MB3A 2ZLYA 3KFUG 4S2NC 1T1BA 1MXOA 3HLBA 1XKZA 4MBKA 5JRGB 3REKD 2XFSA 4MB5A 4GW9A 3W98A 3X1SC 1DP8A 4WNNB 4Z2MH 1M19A 1KX4C 2WGVA 1WYCA 5B0YA 1U35C 1ODVA 4Y15A 3WD1A 3TOIA 3RELB 2HJEA 3WX7A 3W98D 5GSUC 5CHJA 2L4RA 5B1MB 4NK3A 3LEQA 5B32B 4UA7A 3K3CA 4PM8A 1S32D 5AVCA 3W8KA 5HWTA 4KZ9A 1YSPA 1GXDA 5HDCA 3LICA 1K54C 4J8UB 1XJ2A 3WA9C 2P04A 3E4PA 3NCKA 3R45A 4ZAMA 4KUDD 2EWVA 5B33B 4BD1A 4J8XB 1PW1A 1WYBA 2PHYA 5TR7A 3LELB 1E88A 5KSHA 1TS6A 5HDDA 5KDMB 2BLSA 1P3ID 1AOIA 3R4KA 2EA9A 3N4IA 3T12B 1Z09A 4OLDA 1Y54A 4HHDA 5HAIA 3G32A 1J3WA 3AZLD 4DDYA 4JGQA 3MVDA 5EECA 3X1VA 1M1AA 4CAYB 3DAVA 5B1MD 1SKOA 5B1LA 1XX2A 5E2HA 3A3DA 1Z2CB 2R9XA 3KSGA 4CJNA 2J3TD 3K3DA 4EERA 2NQBD 1P3AA 5FA7A 5KSCA 3DTMA 3X1SD 3A3FA 4KZ7A 5CXWA 4MBFA 5A8BA 4KG2A 2JKFA 5JYOA 4GHLA 2HUEB 1FQGA 1G6OA 4B93A 1G5UA 3BWLA 5MC7A 3ZG9B 4Y7PA 2YFVB 5HWVA 1W79A 4M4XA 4QPRA 2J80A 3FZCA 4S2OA 1HQ3D 4KZ4A 1ED7A 3MGRB 3WTPB 4RVAA 4LV1A 5B1LD 2K7SA 5B1LC 2ZOHA 1S4RA 1FCNA 3SS4A 1PDCA 3AZEB 2EWWA 1PNEA 4HBUA 3UB5P 3A6ND 1PRQA 3BRMA 4GLQA 2O9AA 1OGGA 3IWOA 1WWSA 1PI5A 2O99A 5AQ9A 2JCHA 3X1TD 1P3GC 2A24B 4IEDA 1OTIA 4IBGA 2PU4A 2PYOC 1P3KA 3HBRA 4EBLA 2ZY3A 5GT3C 3QP5A 5G49A 3WA9A 4O01A 4MMNA 4DRBA 3AV2D 1D06A 4GN2A 4KZBA 3VV4A 1KDSA 1K55C 1ALQA 2M1CA 3HSHA 1I2SA 4GDBA 3MNND 1BLHA 4Z66A 3AZFD 3AZFB 1E25A 1LL9A 2JC7A 3VFHA 3HLDA 1L2SA 2J8PA 3R7WA 1F66A 4BL2A 2DRWA 5HPIA 2O9BA 1MKIA 4GB7A 3M2JA 3GVBA 4S2KA 2ZC5B 4OPZA 1CQAA 3VH6W 4JF6A 4E6XA 5B33D 3BY9A 4GS9A 3AZHD 3TU4B 1I5QA 2Y79A 2PBDP 3V3SA 4FH4A 5AVBD 4NYYA 3SZTA 3X1TA 1LSWA 2J9PA 3WRZA 2XGNA 3X1UA 5GLBA 1W1VA 3GDIA 4NYUA 2Z6CA 3P98A 2OWHA 2VV8A 4ZUXB 3IH8A 4AFIA 3H7WB 4Z66D 1IFQA 3MNNA 4C75A 1EQZD 4DXBA 5CPKC 4X23A 3MKEA 1DJBA 1P3IB 1XP4A 5J3WA 3CZDA 3EQVA 5GHZA 1P3GA 4S2JA 2G2WA 3MQQA 4QJGA 2H28A 4Z2IA 2KLIA 5CECA 4HP4A 5FQ9A 2ZC7A 5EOEA 3HLFA 1S6RA 1TS8A 1ES2A 2XRNA 5GT3D 4IJFA 3F1PB 5BNXA 1BH8B 1SKFA 2Q9NA 1L0DA 4JXSA 3G2YA 5AY8A 1G6AA 3NHQA 3L28A 4ZDXA 4NZ5A 3N3FA 4OOMA 2XA7S 3AZKA 3SH9A 2W3DA 5HDSA 4GZBA 5AV9D 1ZLAD 5JA4A 2ZJ9A 3IT9A 1IYSA 4JJND 1K57C 3T4SA 4BBTA 5E2GA 3RELC 1YLYA 3ULFA 2Y2MA 2F8NA 1Q2QA 1YUEA 3VMAA 4B9OA 5B40C 5HWWA 3KWQD 3C5AA 4O0PA 3KX0X 5B33A 3WKJD 3WKJB 4L0LA 2Y55A 1XFQA 3VFFA 1DP6A 3AFAD 4KQDA 5KDMA 1S32C 1P3AC 3SW1A 3WTPE 4CSRA 4OJ5A 1KX5A 4LRXC 3UDXA 2ZBBA 1LT0A 3UTBA 3BQ8A 1J9MA 4CLCA 3FWLA 3LR0A 1A7WA 4QD4A 3LIDA 5EVID 2XR0A 3G2ZA 2Y2KA 1P3BA 5FSRA 2RVQC 4H6JB 2QHKA 5L07A 5F1FA 2IWDA 3LR4A 1ES3A 1W8QA 3WD2A 3UN7A 3UT9A 2PAVP 3AN2D 3X1TC 1P3GD 5DTKA 4GNUA 4E3IA 5DF7A 4EWFA 3NY4A 4LCLA 3IS2B 4OP5A 3MFDA 4WU8B 4GH9A 1EW0A 1T18A 1O6IA 3IH9A 2CMNA 3S1YA 5AY8C 5CGWA 3HJIA 3MMHA 3HJKA 5BT1C 3VP2A 1N9LA 3PXPA 5EVIB 1U35B 3NQUB 4E3JA 5K5BA 4MN7A 2WAFA 2XA7M 4WZ5A 3C8CA 5GSUA 5M1AA 2GZAA 4J8VA 3PBRA 5FI2A 2Y2GA 4BJPA 2VQRA 5F99D 3W96D 1HLUP 1P3PA 1U60A 2W3EA 5BPVA 4KGCA 1W1TA 3AZHB 4X56A 5FDSA 1P34D 3W97B 2UWXA 3AYWA 4EESA 4FH2A 3G34A 4DKIA 2PDRA 4X69A 1ES4A 5BT1D 5E5AC 1NXYA 4GHIB 3EGDC 4DN0A 1F5MA 2F8NK 2VV7A 1XPBA 3O62C 5CPJB 3AZGC 4E44A 4YOFA 4Z1WA 2Y2QA 2XQZA 3PAEA 2C6WB 1MWTA 3B42A 3IP4C 2W3GA 4R4SA 4BLMA 1CI8A 2HJ9C 4YM6A 1E6PA 2ZQ7A 3ZG5A 2KOIA 3KSYA 4N1XA 3MFXA 1H8ZA 3KYQA 2W1TB 4DE0A 3O88A 5JYPA 3QP6A 3LR5A 4JF4A 4JJNB 5CEBA 3R7WB 5CTNA 5CHMA 4K91A 5CHUA 1KX4B 3Q81A 1KX4D 5GHYA 1CJFA 3EQUA 1P3OA 5TFQA 4GOGA 2WK0A 3DTKA 2PR6A 2NQBA 4KQQA 4FSFA 5E2EA 3ZQ5A 3AFAC 4MB4A 5DFXA 2WGIA 3W99A 3QP2A 1XA7A 3G4PA 3MGPD 5CP6B 1OTEA 4K0XA 1JFIA 1TZYB 3T1XA 1S32A 4R3JA 3KUYD 1H3OB 4J8UA 2Y8HA 5EE8A 4JKTA 3RFBA 2L1MA 5AV6D 3FV7A 2YKFA 1NYYA 2Y2OA 4XT2B 3W96A 4RX2A 1CK3A 1E6RA 1FIKA 1ZG4A 1P3IA 1P3AD 2NUTC 1XGIA 4AWLB 2Z2LB 5GLDA 1P3GB 4G92C 1KVMA 3UE1A 4YFMA 4FTXA 3G35A 5AQAA 1S1YA 1JTDA 1YU1A 1YLPA 5FEFA 5F1GA 4WBGA 2DQNC 1P3FA 4E04A 2VKSA 3W99C 4K08A 3VH5T 3BJNA 4Z2MG 4ARZA 4H9OB 2M7VA 4KUKA 4M6BA 4U0TA
chains in the Genus database with same CATH topology
1SDEA 1QMEA 4EQIA 4XZQB 5AV9C 3AZKB 1ZLAC 2WADA 4KGCD 3GMWA 4ZTKA 1R4VA 4E6WA 2HUEC 3REHC 3L26A 4QY6A 3SH8A 3LY4A 3AZJB 3ZG0A 4IJEA 3M6HA 3A1IA 4KENB 3PBNA 2L5AA 4E45A 4H9PA 5AVBB 1KX5B 2H0YA 3WA9D 3V39A 2IOUA 1PZOA 3BM6A 5CHLB 3UTAB 1PWGA 1C3BA 3C1CD 1AOIC 3SOIA 2ZC3B 4IBBA 3WKJC 4S2PA 1P3BB 1P3BD 5HX9A 1K6SA 5FUGB 3QHYA 4ZBEA 1BLSA 5AVCB 5AVBC 4KZ8A 4E3LA 1F66C 3A6NB 1LI0A 5DNMA 3B0DC 1G68A 1HZOA 4UUZA 3W4QA 5C3IB 3V5MA 3B6FD 4J8XA 5B2JB 3WAAC 4WU8A 2HIOD 2HIOC 1GCEA 1IYPA 3HUOA 3HUNA 4X6TA 2NZDC 3PAGA 3LZ0A 4F94A 4KHAA 3M2KA 5FQMA 5EPHA 2PYOA 1P3LC 4OLGA 3L27A 5FATA 5GT0B 4B88A 1BLCA 3FYZA 1PIOA 2A3UA 1LL5A 5FI7A 1MWSA 3AV1D 1KE3A 5CRFA 5GXQD 1SHVA 2AROC 3AZIA 1P3AB 3JYIA 3Q07A 3REIB 3AV1A 3AZGD 5FI6A 3W99D 1BT5A 3Q7VA 1M18B 1KE0A 1EQZC 1FCOA 1TZYC 5CPKD 3LZ0D 5G18A 2EXBA 2XD5A 4QU3A 1K56A 1OMEA 3LEZA 1EQZA 1KVLA 1B6WA 2WAEA 2RCXA 1IKGA 2ZQDA 3MZEA 3C4PA 3GSGA 4J8WA 1BTLA 3QNBA 1P3MD 4OVDA 3HLWA 5AQBA 3B6GA 4WM9A 2AROA 3AZIC 2XD1A 3MGQD 4UA6A 1P3IC 3HVFA 3IHAA 1NYMA 4GHAA 5GT3B 5B31B 3LJAD 3W99B 1HTZA 5JA4B 4QB8A 4KQRA 5AV8A 5CPKB 5CP6A 1FR1A 3AZNB 1HTAA 1TZYA 3WA9B 2F8NB 3WRTA 5HAQA 1O07A 4Z5TB 3HLCA 5EUAA 3KXBB 5BNVA 3P09A 3NIAA 4E3MA 3WAAD 3L2AA 3FDDA 1GHPA 3AZFA 1XA1A 1W7FA 5AV5A 1F66B 4J8VC 1CI9A 3KWQB 3WAAA 4RA7A 4CSRB 2X02A 3C1BB 3GR2A 1BH9A 3AV2A 4WU9C 4DE2A 3B6FB 2CV5B 4C3QA 5B32A 4H9OA 4WV4B 3ISGA 1K56D 1MBLA 3ZFZA 3UT9D 3UT9B 4P85A 3A3IA 3IF5A 2XDMA 1BLPA 4J8WD 1YMXA 4MBHA 4Y0TA 2XH9A 2ZQ9A 3AV2C 4WU9A 3PBTA 1YLTA 3KXBC 1KX5D 4N9LA 3NI9A 2Y2LA 1M6KA 3VSKA 1ONHA 1N1JB 1RGZA 1YM1A 1P3FD 5M18A 1GHIA 5AV5C 2OLVA 5KZHA 2EFXA 5EVIA 4KGCC 1HVBA 3REHA 1Z6FA 2DCFA 5B1LB 1K4EA 1MWUA 3MGPA 2ZD8A 4BL3A 3HUMA 4HESA 3B3XA 3UTAD 1JWZA 3UDFA 3EPJA 3EPLA 1KE4A 3HLEA 5FAOA 1P34B 3ITBA 5FQQA 3I7JA 5B2JA 5TGFA 4OKPA 5B32D 4WZSB 4XZQD 3WS2A 2WKIA 1ULYA 2IO5B 3MGRA 4G91B 3OPLA 4PM9A 4QHCA 1YQSA 2Q9MA 1YU4A 5FAPA 3LZ1D 3LZ1B 2BYKA 3AZEA 4A5RA 2F8NG 5E2FA 5BS7C 3BEBA 3KXBD 2J8YA 3WS4A 2NQBB 5GSUD 3MNNC 4LV3A 3AV1C 3N8SA 1TAFA 4OOLA 3AGEA 1DJAA 4B4XA 3AZIB 4PM7A 3X1UC 1M19D 3AV1B 1S32B 3VH6T 1H3OA 3UO9A 1T3UA 5B2JC 4AWLC 4JBFA 3RXXA 5AV8D 4WEKA 4ZUXD 4BENA 5FQKA 2HDSA 2IO5C 5B40B 4J8VD 5HW3A 2OLUA 1M18D 3CG5A 1LHYA 4WYYA 1W2EA 3X1SB 5CPIC 4J8WB 5A93A 4NZ3A 4Z66C 2G5HC 3W97A 1EI5A 3UTBD 2Y91A 5M19A 1WWIA 3W4OA 4NE5A 3MGSB 4XZQA 3NC8A 5CTMA 3MZDA 4IVIA 3AN2A 3V50A 4EO5B 4IBJA 4RYEA 3B0BA 4N92A 4OQIA 2QPNA 2X01A 5DNMD 4H9PB 3KWQA 3WAAB 4Z9QA 2Y2PA 1AXBA 1YT4A 3AZGB 5BOHA 3TSGA 1HQ3B 3M6BA 1P3PC 4C6YA 1BH9B 4IBXA 4WU8D 1ERMA 2HIOA 4MNRA 3NQJA 5DNNB 4R8PB 2CV5A 3C1CA 1YU2A 3C1BD 4IBFA 1DJCA 4HBTA 4XUXA 5AV9A 1ZLAA 5DNMC 4KZAA 4NE6A 4H8RA 1ID3B 3Q1FA 1K38A 4H9SA 4XUJC 1IYQA 4UUZB 5CPID 4QY5A 4DF6A 1KX5C 3SH7A 5B2ID 4LCMA 4KG5A 2ZM2A 2ZM5A 1O7EA 1PWDA 3OZHA 1N1JA 4QLCA 3MXRA 4MLLA 4KHAB 3ZG7B 4EBNA 3REKA 2PYOB 3X1VC 1M1AC 3PBQA 1NY0A 4P87A 3REHB 1GHMA 4QLCC 2WGWA 4Z5TC 5D3OA 4Z5TD 3TG9A 5CEDA 3UTBC 3AZKC 3MGQC 3AZEC 3REJC 3IXBA 3GQZA 5B2IB 3ZG8B 1KX3C 3LELC 1P34A 1RCJA 1BFMA 3UPPA 5B0YD 5B32G 2P9VB 5B2JD 3REJA 3LO7A 4LV0A 2Y59A 4DE1A 4WZ4A 4P0MA 1L0FA 5FQIA 3MGQA 1U35A 4OPYA 4OP8A 3LJAA 1EQZB 2GDNA 5GSUB 4KZ3A 4H9NA 2EX8A 3RELD 3IXGA 3N6IA 3UTAA 5E5AB 3KUYB 2F2AC 3LZ1A 3W96C 4NZ1A 3Q7ZA 4FCFA 3WS1A 3BFDA 3MGSC 1TAFB 3GV9A 3AN2C 3MGSD 4JF5A 4M3KA 5B24A 5B31A 3A6NA 1QMFA 2WYXA 1BULA 5AV8B 5CPKA 4DE3A 3ZNTA 4H9SC 4XUJA 5EVIC 3IXDA 4WU8C 1RP5A 5GT0C 1P3OC 3OPHA 3AZMD 2NZDD 2NZDB 5AV6B 5CPIA 1P3LB 5FDHA 5F99B 4X68A 2BYMA 1E3UD 2H0TA 1M19C 1KX4A 4XXRA 1BZAA 3H0LC 1P3OB 3X1SA 4Y0OA 5AV6C 3A6NC 4EO5C 1KX3B 4NY2A 5KMWA 3A3EA 3B6FA 3UDIA 5FASA 3IF6A 3AZKD 2G5IC 3UT9C 3AGDA 2JBFA 2PU2A 4PPRA 3REIA 1IEMA 4K0WA 3Q7VB 3W4PA 4WU9D 1M18A 4WU9B 3AZMA 2V1ZA 3W96B 4G91C 4IBIA 1P3KC 3HONA 5A91A 4NZ4A 1S0WA 1L0GA 4RX3A 4KZ6A 4ZJ1A 5B24D 4PM5A 5B24C 1LI9A 2XF3A 3VH5A 1ZC2A 3ZVWA 5CPJD 5AQ7A 1P3FB 4YS3B 2RL3A 3Q82A 3MGPB 3RELA 3P5JB 3AZNC 4IBDA 2V20A 3LJAC 3AZNA 4KZ5A 2VGKA 1TDLA 4OOYA 5BNVB 2HP9A 4ZBJB 3UNWA 3FKEA 1P3BC 3LELA 4J8UC 1EWZA 2XLNA 1K4FA 4BD0A 3MKFA 1AOIB 3C1BC 2C5WB 2ZQCA 4LD9A 1K6RA 3AZLC 3REKB 4HEFA 3N7WA 3MVDB 3C1BA 1ZG6A 4CAYA 3KUYC 3AV2B 3O3VA 1IKIA 4UPKA 1W5DA 2FJ7D 3AZHC 1KGFA 3MVDC 4J8UD 4DXCA 2F8ND 5A90A 4ZJ3A 2ZY5A 5DNMB 2W8SA 3UPNA 4WMCD 1I2WA 4S2IA 1ID3C 4IBEA 1DY6A 3WWXA 3KWQC 4HGAB 2V2FF 4ZBJC 5B0ZD 1CEGA 4PM6A 3UY6A 3ZVTA 4R8PC 1K54A 3LZ0B 3G30A 4R8PD 1ERQA 2YFWA 3LY3A 5DF8A 3C4OA 2EX6A 2Y2IA 5B0ZA 2I72A 4OQGA 3LJAB 3V9RB 3MGPC 5GT0A 3WS5A 3AZLB 2CV5D 1H5XA 1ID3D 1TEMA 5CERA 4UHUA 5B0YC 1RGYA 4OJ6A 4N9KA 3W98C 1P3MB 1E3UA 5B31C 5BO0B 2ZM0A 5HAPA 5B31D 4R0QA 1NJ4A 4BQMA 1H8YA 3MGSA 1TVFA 4D2OA 2E8IA 4IBRA 3ZDJA 3UPOA 3L29A 3IXHA 2PBYA 3LZ1C 3B6FC 4GD6A 4YS3D 2JSSA 2XEPA 4LENA 2LY8A 4Z66B 5AVCD 3NDGA 2HP5A 5F99A 4WMCA 2Y2HA 1KDWA 2BYMB 1KU5A 4H9RA 4KQOA 2XFTA 3NBLA 4OQ0A 3RJUA 2BYKB 4H9QB 2CWEA 4NETA 1P3PD 4WNNA 3N8RA 2AROB 5B0YB 1ES5A 1YLZA 1P34C 5L2FA 2HIOB 1ESIA 1KX3A 4FD8A 5CGXA 3C1CB 5C3IC 3IF6B 3DWKA 2QMIA 3F6TA 4LD9C 1BSGA 5CGSA 4S2LA 3X1UB 2ZC4B 5HL1A 4JXGA 3ZCZA 4Z5TA 3DW0A 2BG1A 1NRFA 2ZY2A 5B33C 3MGRC 5F82A 2ZM8A 3KS4A 3AYWD 3BYDA 4IBCA 5EOOA 2FFFB 1PZRA 3MNNB 1FR6A 5AV5B 2Y2NA 2EX9A 3SS5A 2X71A 3UTAC 2P74A 4QLCB 2AROD 4R4RA 1FSYA 1K57A 3B0DB 4OPRA 3O62B 5CPJC 1FOFA 5DTSA 4J8WC 4OUIA 5BS7A 4Q8IA 4R1GA 5AY8B 4Y0UA 5AY8D 1ESUA 2RVQD 3A3JA 2WZXA 5DVAA 2H10A 2R9WA 2OSUA 3OCLA 5AVCC 3AZED 2HDRA 4OJLA 3BECA 1P3LD 1B67A 4WELA 2CV5C 4P6BA 1SDNA 5GL9A 5B2IA 2WZZA 3PBOA 4QLCD 2ZMAA 3W97D 4X53A 4YM6C 5GXQA 4MEZA 3WKJA 4S2NA 2YFVA 3MGQB 1BUEA 1HQ3C 3AL0C 5I94A 3AZJC 2J9OA 4LD9B 4E3NA 3AZGA 4XUJD 3HL9A 4JPMA 4H9NB 3IF6C 1HQ3A 3O86A 3HLGA 3BLSA 5E5AA 3MXSA 4NFTA 5DNNA 3A1KA 5B1MA 5F83A 3AYWC 5IHVA 3WS0A 3LZ0C 3EPHA 5B32C 5E5AD 4XZQC 5AV9B 1ZLAB 1YU3A 3S22A 5B24B 2JE5A 1F66D 4J8XD 4JLFA 4WZ5C 1P3KB 4KUDA 2CC1A 5G49B 5JRGC 4EBPA 3C7VA 2H5SA 3BFGA 3AZFC 1P3FC 3ZGAB 1LLBA 5A92A 3ITAA 5GHXA 5CP6D 3REJD 3VH5W 3X1VB 1M1AB 5DNNC 2WKEA 5B0ZB 1N4OA 1WE4A 4ZJ2A 2EXAA 5J8XA 5E43A 4E3KA 4WEJA 3AFAB 2HDQA 3AZHA 3PBSA 3AYWB 3H0RC 3RXWA 5DF9A 5AV5D 3X1TB 3L25A 3B6GC 3AZJD 4QNLA 3X1UD 3BFEA 2ZQAA 3CJMA 4X55A 2P9VA 3REJB 1U35D 3HREA 2FFYA 1TZYD 3W97C 3VH6A 3IWQA 5AV8C 4U3TA 1N9BA 1F1EA 3NDEA 5B40A 3WTPA 3ZNYA 3B6GD 1VQQA 4R23A 3O62D 3VP3A 3C7UA 1VM1A 1MWRA 4H9QA 1M40A 5BNXB 1BH8A 3CMZA 3AZID 3S4XA 5U47A 3AGFA 1KGGA 1PWCA 4GKUA 1TDGA 3PTEA 2DF4C 5DNND 3REKC 2Z2MB 4DQYB 3EG5B 2PYOD 3E2LA 1JFIB 4XUJB 3AN2B 3VP0A 3VSLA 3BFFA 5GLCA 2QZ6A 2FJ7A 5JRGD 4YINA 1MY8A 4B4ZA 4X23C 1YLJA 2NZDA 1PW8A 4GDNA 4R3BA 5EVLA 4S2MA 3AZMC 3IQAA 4WJ3C 3E2KA 5JRGA 4JJNC 1HD8A 3OC2A 4J8XC 2NQBC 2EX2A 4LD9D 5GLAA 3VP1A 3W98B 1SCWA 2A49A 1MPLA 4KUDC 3UTBB 1M19B 3C1CC 1AOID 4U0XA 3NQJB 5F99C 1ONGA 4R8PA 3TU4A 5HARA 3MVDD 3UE3A 4DRTA 2IWBA 1ID3A 5FQJA 3OPRA 3R45B 3N8LA 4OONA 4ZUXA 4HGAC 3AZMB 3AZJA 4X23B 4X23D 4G92B 1GA9A 4PMAA 2F8NH 1CEFA 5GXQC 1K25A 3UE0A 5DTTA 3NQUA 5AVBA 1W8YA 3BFCA 3GTCA 2IWCA 3LELD 3V9RA 3ZHHA 1KX3D 3AZLA 1JVJA 3DWZA 1JWPA 2WGWB 3QNCA 5B40D 1Q9CA 4J8VB 1JTGA 4YS3A 2WUQA 3FKWA 4KGCB 2EFUA 5FUGA 3AZND 1P3MA 4ZUXC 3SS3A 1NZUA 2VGJA 4EUZA 2HPBA 2G2UA 4N1HA 3KS8A 5CPJA 4E3OA 1E4DA 4KUDB 1XXMA 4UAAA 3G31A 1FSWA 3REID 4OJPA 3TU4D 5FAQA 3MGRD 3TU4C 5B2IC 3B0CW 5HFOA 1P3KD 1Q2PA 2XK1A 1YMSA 3FKVA 4JJNA 4OH0A 1XGJA 4OPQA 3KUYA 4H9RB 3D4FA 3MBZA 4JXWA 1JWVA 4CPKA 2HP6A 2FJ7C 1P3OD 4DRAA 3AFAA 2Y4AA 3B0CT 4EV4A 5CP6C 2WKHA 1ZKJA 2DNSA 3OCNA 2RIQA 2J7VA 2Y2JA 1YU0A 1EROA 3REHD 4UA9A 3EPKA 2OV5A 2HDUA 4NE3A 4XUZA 2YFWB 4LV2A 4OQHA 1GA0A 5GT0D 3BLMA 5AV6A 5CPIB 1P3LA 4LG2A 1YLWA 1PI4A 3WTPD 3WTPC 3H0MC 1P3MC 3VOZA 3O62A 4KG6A 1P3PB 3GRJA 2ZY4A 3O87A 3B6GB 4IBKA 4YS3C 4DDSA 4O7DA 3OPPA 1K55A 4JXVA 5BO0A 1IYOA 4OJOA 1PYYA 5GT3A 1FCMA 2ZC6B 1M18C 3IHBA 3X1VD 5B1MC 1M1AD 3MZFA 4GD8A 2B5RA 3VP4A 5B31G 3IWIA 3VOYA 1NZOA 2ZQ8A 5B0ZC 1KGEA 1IELA 3KXBA 3REIC 4YM6B 4YM6D 1L0EA 2FJ7B 3V3RA 3LCEA 5GXQB 1PZPA 4ID4A 4IVKA 2ZLYA 3KFUG 4S2NC 1MXOA 3HLBA 4MBKA 1XKZA 5JRGB 3REKD 2XFSA 3W98A 3X1SC 4WNNB 4Z2MH 1M19A 1KX4C 2WGVA 1WYCA 5B0YA 1U35C 3TOIA 3RELB 3WX7A 3W98D 5GSUC 5CHJA 5B1MB 4NK3A 5B32B 4UA7A 4PM8A 1S32D 5AVCA 3W8KA 4KZ9A 1K54C 4J8UB 3WA9C 3NCKA 3R45A 4ZAMA 4KUDD 5B33B 4BD1A 4J8XB 1PW1A 1WYBA 5TR7A 5KSHA 3LELB 5KDMB 2BLSA 1P3ID 1AOIA 3N4IA 4OLDA 1Y54A 5HAIA 3G32A 4DDYA 3AZLD 3MVDA 5EECA 3X1VA 1M1AA 4CAYB 5B1MD 5B1LA 1XX2A 5E2HA 3A3DA 1Z2CB 2R9XA 4CJNA 2NQBD 1P3AA 5FA7A 5KSCA 3DTMA 3X1SD 3A3FA 4KZ7A 5CXWA 4MBFA 4KG2A 5JYOA 4GHLA 2HUEB 1FQGA 3ZG9B 4Y7PA 2YFVB 1W79A 3FZCA 4S2OA 1HQ3D 4KZ4A 3MGRB 3WTPB 4RVAA 4LV1A 5B1LD 5B1LC 1FCNA 3SS4A 3AZEB 4HBUA 3A6ND 3BRMA 3IWOA 1WWSA 1PI5A 5AQ9A 2JCHA 3X1TD 1P3GC 4IEDA 4IBGA 2PU4A 2PYOC 1P3KA 3HBRA 4EBLA 2ZY3A 5GT3C 5G49A 3WA9A 4DRBA 3AV2D 4GN2A 4KZBA 1KDSA 1K55C 1ALQA 3HSHA 1I2SA 4GDBA 3MNND 1BLHA 4Z66A 3AZFD 3AZFB 1E25A 1LL9A 2JC7A 3VFHA 3HLDA 1L2SA 2J8PA 1F66A 4BL2A 2DRWA 1MKIA 4GB7A 3M2JA 3GVBA 4S2KA 2ZC5B 4OPZA 3VH6W 4JF6A 4E6XA 5B33D 3AZHD 3TU4B 1I5QA 3V3SA 4FH4A 5AVBD 4NYYA 3X1TA 2J9PA 3WRZA 2XGNA 3X1UA 5GLBA 4NYUA 3P98A 4ZUXB 3IH8A 4Z66D 3MNNA 4C75A 1EQZD 4DXBA 5CPKC 4X23A 3MKEA 1DJBA 1P3IB 1XP4A 3CZDA 3EQVA 5GHZA 1P3GA 4S2JA 2G2WA 4QJGA 5CECA 5FQ9A 2ZC7A 5EOEA 3HLFA 1S6RA 1ES2A 5GT3D 4IJFA 5BNXA 1BH8B 1SKFA 2Q9NA 1L0DA 4JXSA 3G2YA 5AY8A 1G6AA 3L28A 4ZDXA 4NZ5A 3N3FA 4OOMA 3AZKA 3SH9A 4GZBA 5AV9D 1ZLAD 5JA4A 2ZJ9A 3IT9A 1IYSA 4JJND 1K57C 5E2GA 3RELC 1YLYA 2Y2MA 2F8NA 1Q2QA 1YUEA 3VMAA 5B40C 3KWQD 3C5AA 5B33A 3WKJD 3WKJB 4L0LA 2Y55A 3VFFA 3AFAD 5KDMA 1S32C 1P3AC 3WTPE 4CSRA 4OJ5A 1KX5A 3UDXA 3UTBA 1J9MA 3FWLA 1A7WA 4QD4A 5EVID 2XR0A 3G2ZA 2Y2KA 1P3BA 5FSRA 2RVQC 5F1FA 2IWDA 1ES3A 1W8QA 3UN7A 3UT9A 3AN2D 3X1TC 1P3GD 5DTKA 4GNUA 4E3IA 5DF7A 4EWFA 3NY4A 4LCLA 4OP5A 3MFDA 4WU8B 4GH9A 3IH9A 3S1YA 5AY8C 5CGWA 5BT1C 3VP2A 5EVIB 1U35B 3NQUB 4E3JA 2WAFA 4WZ5A 5GSUA 5M1AA 4J8VA 3PBRA 5FI2A 2Y2GA 4BJPA 2VQRA 5F99D 3W96D 1U60A 1P3PA 5BPVA 4KGCA 3AZHB 4X56A 1P34D 3W97B 2UWXA 3AYWA 4FH2A 3G34A 4DKIA 4X69A 1ES4A 5BT1D 5E5AC 1NXYA 2F8NK 1XPBA 3O62C 5CPJB 3AZGC 4E44A 2Y2QA 2XQZA 3PAEA 2C6WB 1MWTA 3IP4C 4R4SA 4BLMA 1CI8A 4YM6A 2ZQ7A 3ZG5A 3KSYA 4N1XA 1H8ZA 4DE0A 3O88A 5JYPA 4JF4A 4JJNB 5CEBA 5CTNA 5CHMA 4K91A 5CHUA 1KX4B 3Q81A 1KX4D 5GHYA 3EQUA 1P3OA 5TFQA 4GOGA 2WK0A 2NQBA 4KQQA 4FSFA 5E2EA 3AFAC 2WGIA 3W99A 1XA7A 3G4PA 3MGPD 5CP6B 4K0XA 1JFIA 1TZYB 1S32A 4R3JA 3KUYD 1H3OB 4J8UA 5EE8A 4JKTA 3FV7A 5AV6D 1NYYA 2Y2OA 3W96A 4RX2A 1CK3A 1ZG4A 1P3IA 1P3AD 1XGIA 4AWLB 2Z2LB 5GLDA 1P3GB 4G92C 1KVMA 3UE1A 4YFMA 3G35A 5AQAA 1JTDA 1YU1A 1YLPA 5F1GA 4WBGA 2DQNC 1P3FA 3W99C 3VH5T 4Z2MG 4H9OB 4M6BA 4U0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OSU A;  1SDE A;  4UA7 A;  1QME A;  4EQI A;  3OCL A;  2WAD A;  4PM8 A;  2HDR A;  3W8K A;  1DJC A;  4HBT A;  3BEC A;  4XUX A;  4KZ9 A;  4KZA A;  4H8R A;  4WEL A;  3GMW A;  3Q1F A;  1SDN A;  1K54 C;  4P6B A;  4ZTK A;  1K38 A;  5GL9 A;  4E6W A;  3NCK A;  4ZAM A;  1IYQ A;  4QY6 A;  2WZZ A;  3PBO A;  3SH8 A;  4QY5 A;  3LY4 A;  4DF6 A;  3ZG0 A;  4BD1 A;  2ZMA A;  3SH7 A;  3M6H A;  4X53 A;  1PW1 A;  1WYB A;  5KSH A;  5TR7 A;  4LCM A;  4KG5 A;  4MEZ A;  2ZM2 A;  4KEN B;  2BLS A;  1O7E A;  1PWD A;  3OZH A;  3N4I A;  3PBN A;  4S2N A;  3MXR A;  4MLL A;  4OLD A;  1BUE A;  4EBN A;  3ZG7 B;  1Y54 A;  5I94 A;  2J9O A;  5HAI A;  3G32 A;  4DDY A;  2H0Y A;  5EEC A;  3PBQ A;  4E3N A;  1NY0 A;  4P87 A;  3HL9 A;  4JPM A;  3V39 A;  1PZO A;  3BM6 A;  3IF6 C;  1GHM A;  3O86 A;  1PWG A;  1XX2 A;  1C3B A;  3HLG A;  3BLS A;  5E2H A;  3SOI A;  3A3D A;  2WGW A;  2ZC3 B;  5D3O A;  3MXS A;  2R9X A;  4S2P A;  3TG9 A;  4CJN A;  5HX9 A;  1K6S A;  5CED A;  3QHY A;  5F83 A;  4ZBE A;  5IHV A;  1BLS A;  3WS0 A;  4KZ8 A;  4E3L A;  3S22 A;  5KSC A;  5FA7 A;  2JE5 A;  3IXB A;  3GQZ A;  1LI0 A;  3ZG8 B;  3DTM A;  4JLF A;  4WZ5 C;  3A3F A;  4KZ7 A;  5CXW A;  1HZO A;  1G68 A;  1RCJ A;  4MBF A;  4KG2 A;  5JYO A;  3W4Q A;  2CC1 A;  3UPP A;  3V5M A;  1FQG A;  2P9V B;  4EBP A;  3LO7 A;  3C7V A;  2Y59 A;  4LV0 A;  2H5S A;  1GCE A;  4DE1 A;  3ZG9 B;  4WZ4 A;  4Y7P A;  1IYP A;  3HUO A;  3HUN A;  4P0M A;  3BFG A;  1L0F A;  4X6T A;  1W79 A;  5FQI A;  3PAG A;  4OPY A;  3ZGA B;  4OP8 A;  4F94 A;  1LLB A;  3FZC A;  5A92 A;  3M2K A;  5FQM A;  3ITA A;  5EPH A;  5GHX A;  4S2O A;  4KZ4 A;  2WKE A;  1N4O A;  4OLG A;  4RVA A;  2GDN A;  4KZ3 A;  4LV1 A;  1WE4 A;  5FAT A;  2EX8 A;  2EXA A;  4ZJ2 A;  4B88 A;  3IXG A;  3N6I A;  1BLC A;  3FYZ A;  5J8X A;  1FCN A;  1PIO A;  5E43 A;  3SS4 A;  2A3U A;  1LL5 A;  5FI7 A;  4HBU A;  4E3K A;  1MWS A;  3Q7Z A;  3BRM A;  4WEJ A;  4FCF A;  3WS1 A;  3PBS A;  2HDQ A;  1KE3 A;  3BFD A;  3IWO A;  5CRF A;  3RXW A;  1PI5 A;  3GV9 A;  5DF9 A;  5AQ9 A;  4JF5 A;  4M3K A;  1SHV A;  3JYI A;  2JCH A;  3Q07 A;  4IED A;  1QMF A;  2WYX A;  2PU4 A;  1BUL A;  3HBR A;  4EBL A;  5FI6 A;  3BFE A;  2ZQA A;  3CJM A;  4DE3 A;  3ZNT A;  4X55 A;  2P9V A;  5EVI C;  4GN2 A;  3IXD A;  4KZB A;  1BT5 A;  3Q7V A;  1KDS A;  3HRE A;  1K55 C;  2FFY A;  1KE0 A;  1FCO A;  1ALQ A;  1RP5 A;  1I2S A;  4GDB A;  1BLH A;  2EXB A;  2XD5 A;  3IWQ A;  3OPH A;  1K56 A;  4QU3 A;  4U3T A;  5G18 A;  1N9B A;  1E25 A;  1LL9 A;  3NDE A;  2JC7 A;  1OME A;  3LEZ A;  3VFH A;  3HLD A;  1KVL A;  2WAE A;  1L2S A;  5FDH A;  3ZNY A;  2RCX A;  1IKG A;  2ZQD A;  1E3U D;  2H0T A;  4X68 A;  4BL2 A;  1VQQ A;  2DRW A;  4R23 A;  3MZE A;  1MKI A;  4XXR A;  3C4P A;  1BZA A;  3GSG A;  1BTL A;  3C7U A;  3M2J A;  1VM1 A;  3QNB A;  3GVB A;  4GB7 A;  4OVD A;  3HLW A;  1MWR A;  5AQB A;  1M40 A;  4S2K A;  2ZC5 B;  4Y0O A;  4OPZ A;  4JF6 A;  4WM9 A;  4E6X A;  3CMZ A;  5KMW A;  3A3E A;  2XD1 A;  1I5Q A;  3S4X A;  3UDI A;  5FAS A;  5U47 A;  3V3S A;  3IF6 A;  4UA6 A;  3HVF A;  3IHA A;  1NYM A;  4FH4 A;  3AGF A;  1KGG A;  2J9P A;  1PWC A;  3AGD A;  1HTZ A;  4GKU A;  1TDG A;  2JBF A;  3PTE A;  4QB8 A;  2PU2 A;  4PPR A;  3WRZ A;  2XGN A;  2Z2M B;  4KQR A;  1FR1 A;  1IEM A;  3E2L A;  5GLB A;  3WRT A;  3P98 A;  4K0W A;  3VP0 A;  5HAQ A;  1O07 A;  3VSL A;  3Q7V B;  3BFF A;  3HLC A;  3W4P A;  5EUA A;  5GLC A;  3IH8 A;  3P09 A;  3NIA A;  2QZ6 A;  2V1Z A;  3VP3 A;  4E3M A;  4YIN A;  1MY8 A;  4B4Z A;  4C75 A;  1YLJ A;  4DXB A;  3MKE A;  1GHP A;  1DJB A;  1PW8 A;  4GDN A;  4R3B A;  1XP4 A;  4S2M A;  5EVL A;  1L0G A;  5A91 A;  1S0W A;  3CZD A;  1XA1 A;  3EQV A;  3IQA A;  4KZ6 A;  4RX3 A;  1W7F A;  4ZJ1 A;  3E2K A;  5GHZ A;  4S2J A;  4PM5 A;  2G2W A;  4QJG A;  1CI9 A;  3OC2 A;  1HD8 A;  4RA7 A;  1LI9 A;  5CEC A;  2EX2 A;  2XF3 A;  5GLA A;  3VP1 A;  1SCW A;  5FQ9 A;  1ZC2 A;  2X02 A;  2ZC7 A;  2A49 A;  5EOE A;  1MPL A;  1S6R A;  3HLF A;  3ZVW A;  1ES2 A;  5AQ7 A;  4U0X A;  3GR2 A;  1SKF A;  4DE2 A;  2Q9N A;  1L0D A;  4JXS A;  3G2Y A;  1ONG A;  1G6A A;  2RL3 A;  3Q82 A;  4ZDX A;  4C3Q A;  4OOM A;  5HAR A;  3ISG A;  1K56 D;  3SH9 A;  3UE3 A;  4GZB A;  4DRT A;  3IT9 A;  2ZJ9 A;  2IWB A;  1IYS A;  1K57 C;  1MBL A;  2V20 A;  3ZFZ A;  5E2G A;  4P85 A;  5FQJ A;  3OPR A;  3A3I A;  4KZ5 A;  3IF5 A;  1YLY A;  2VGK A;  1TDL A;  2Y2M A;  2XDM A;  1Q2Q A;  3N8L A;  4OON A;  4OOY A;  1BLP A;  1YMX A;  4MBH A;  4Y0T A;  2XH9 A;  2ZQ9 A;  3VMA A;  3PBT A;  2HP9 A;  1YLT A;  3C5A A;  3UNW A;  4N9L A;  3NI9 A;  2Y2L A;  1GA9 A;  1M6K A;  4L0L A;  4PMA A;  3VSK A;  1ONH A;  2Y55 A;  1EWZ A;  2XLN A;  3VFF A;  1K4F A;  1RGZ A;  4BD0 A;  1YM1 A;  1CEF A;  3MKF A;  5M18 A;  1GHI A;  2OLV A;  1K25 A;  5KZH A;  2C5W B;  2EFX A;  5EVI A;  2ZQC A;  3UE0 A;  5DTT A;  1W8Y A;  1K6R A;  3BFC A;  1HVB A;  3UDX A;  3GTC A;  4HEF A;  2IWC A;  3N7W A;  1Z6F A;  3ZHH A;  2DCF A;  1J9M A;  3FWL A;  1ZG6 A;  1JVJ A;  3DWZ A;  4QD4 A;  1JWP A;  2WGW B;  5EVI D;  2XR0 A;  3QNC A;  1K4E A;  1MWU A;  1JTG A;  3G2Z A;  3O3V A;  1IKI A;  2WUQ A;  2Y2K A;  3FKW A;  1W5D A;  5FSR A;  2ZD8 A;  2EFU A;  4BL3 A;  5F1F A;  3HUM A;  2IWD A;  1KGF A;  4HES A;  1ES3 A;  1W8Q A;  3B3X A;  1JWZ A;  3UDF A;  3SS3 A;  3UN7 A;  4DXC A;  5A90 A;  1NZU A;  4ZJ3 A;  5DTK A;  4GNU A;  2VGJ A;  4EUZ A;  2HPB A;  3UPN A;  4E3I A;  1KE4 A;  2G2U A;  3HLE A;  5FAO A;  4WMC D;  1I2W A;  4N1H A;  4S2I A;  5DF7 A;  3ITB A;  3NY4 A;  4LCL A;  5FQQ A;  4EWF A;  4OP5 A;  4E3O A;  1E4D A;  1XXM A;  1DY6 A;  3WWX A;  4UAA A;  3G31 A;  3MFD A;  1FSW A;  3I7J A;  2V2F F;  5FAQ A;  3IH9 A;  1CEG A;  4PM6 A;  3S1Y A;  3UY6 A;  5CGW A;  3ZVT A;  5TGF A;  5HFO A;  1K54 A;  3G30 A;  1ERQ A;  1Q2P A;  3LY3 A;  2XK1 A;  5DF8 A;  3VP2 A;  5EVI B;  4OKP A;  3C4O A;  2EX6 A;  3WS2 A;  2WKI A;  4E3J A;  2Y2I A;  2I72 A;  4OQG A;  1YMS A;  3FKV A;  3WS5 A;  2WAF A;  4WZ5 A;  4OH0 A;  1H5X A;  3OPL A;  4PM9 A;  4QHC A;  1XGJ A;  1YQS A;  2Q9M A;  4OPQ A;  5M1A A;  5FAP A;  3PBR A;  5FI2 A;  1TEM A;  2Y2G A;  3D4F A;  3MBZ A;  4BJP A;  4A5R A;  4JXW A;  5CER A;  5E2F A;  1U60 A;  4UHU A;  1JWV A;  1RGY A;  3BEB A;  4CPK A;  2HP6 A;  4N9K A;  2J8Y A;  4X56 A;  3WS4 A;  4LV3 A;  2UWX A;  4FH2 A;  3G34 A;  1E3U A;  3N8S A;  4DKI A;  4X69 A;  1ES4 A;  2Y4A A;  2ZM0 A;  5HAP A;  4R0Q A;  4OOL A;  3AGE A;  1NJ4 A;  1NXY A;  4EV4 A;  1DJA A;  4BQM A;  1H8Y A;  1TVF A;  4D2O A;  2E8I A;  4B4X A;  4PM7 A;  4IBR A;  2WKH A;  1ZKJ A;  1XPB A;  2DNS A;  3ZDJ A;  3UPO A;  3IXH A;  3OCN A;  2PBY A;  2Y2Q A;  2XQZ A;  2J7V A;  3PAE A;  2C6W B;  2Y2J A;  1ERO A;  1MWT A;  4UA9 A;  3UO9 A;  4R4S A;  4JBF A;  2OV5 A;  2HDU A;  4GD6 A;  1CI8 A;  4BLM A;  3RXX A;  4XUZ A;  2XEP A;  4LV2 A;  4OQH A;  1GA0 A;  2ZQ7 A;  4WEK A;  3ZG5 A;  3BLM A;  4LEN A;  4BEN A;  5FQK A;  2HDS A;  4N1X A;  1H8Z A;  4DE0 A;  3O88 A;  5JYP A;  1YLW A;  2OLU A;  3NDG A;  4JF4 A;  2HP5 A;  5CEB A;  5HW3 A;  1PI4 A;  5CTN A;  4WMC A;  2Y2H A;  3CG5 A;  1LHY A;  5CHM A;  1KDW A;  4WYY A;  4K91 A;  2XFT A;  4KQO A;  4OQ0 A;  3NBL A;  5CHU A;  3RJU A;  3VOZ A;  3Q81 A;  5GHY A;  4KG6 A;  3EQU A;  4NET A;  5A93 A;  5TFQ A;  4GOG A;  2WK0 A;  3GRJ A;  3N8R A;  3O87 A;  4KQQ A;  1ES5 A;  1YLZ A;  4FSF A;  1EI5 A;  5L2F A;  4DDS A;  1ESI A;  4O7D A;  4FD8 A;  3OPP A;  5CGX A;  2Y91 A;  1K55 A;  5E2E A;  5M19 A;  4JXV A;  1IYO A;  3W4O A;  2WGI A;  3IF6 B;  3DWK A;  1PYY A;  2QMI A;  1XA7 A;  3G4P A;  1FCM A;  2ZC6 B;  3NC8 A;  1BSG A;  5CGS A;  5CTM A;  3IHB A;  4K0X A;  3MZF A;  4S2L A;  2ZC4 B;  3MZD A;  4GD8 A;  2B5R A;  3VP4 A;  4R3J A;  5EE8 A;  5HL1 A;  4JXG A;  3ZCZ A;  3DW0 A;  2BG1 A;  4JKT A;  3IWI A;  4IVI A;  1NRF A;  3VOY A;  3V50 A;  1NZO A;  1KGE A;  2ZQ8 A;  3FV7 A;  1IEL A;  5F82 A;  1NYY A;  2ZM8 A;  2Y2O A;  1L0E A;  3BYD A;  3V3R A;  5EOO A;  2FFF B;  1FR6 A;  3LCE A;  4RX2 A;  4RYE A;  1CK3 A;  1PZP A;  4N92 A;  1ZG4 A;  4ID4 A;  4OQI A;  2Y2N A;  4IVK A;  2EX9 A;  3SS5 A;  2X71 A;  2QPN A;  2X01 A;  1XGI A;  2ZLY A;  2P74 A;  2Z2L B;  4S2N C;  4R4R A;  5GLD A;  1FSY A;  1MXO A;  3HLB A;  1XKZ A;  1KVM A;  4MBK A;  2XFS A;  4Z9Q A;  1K57 A;  3UE1 A;  2Y2P A;  4YFM A;  3G35 A;  4OPR A;  1AXB A;  1JTD A;  1YT4 A;  5AQA A;  1YLP A;  1FOF A;  5DTS A;  5BOH A;  5F1G A;  3TSG A;  4WBG A;  2WGV A;  1WYC A;  3M6B A;  4C6Y A;  4Q8I A;  4R1G A;  1ERM A;  4IBX A;  3TOI A;  4MNR A;  4Y0U A;  1ESU A;  5DVA A;  2WZX A;  3A3J A;  2H10 A;  5CHJ A;  2R9W A;  4U0T A;  4NK3 A; 
#chains in the Genus database with same CATH topology
 1SDE A;  5DJU A;  1QME A;  4EQI A;  4XZQ B;  5AV9 C;  3AZK B;  1ZLA C;  2WAD A;  4PHT A;  4Y13 A;  4II7 A;  4KGC D;  3GMW A;  4ZTK A;  1R4V A;  2ZMV A;  4E6W A;  1GPF A;  2HUE C;  3REH C;  1VEU B;  3L26 A;  4QY6 A;  3SH8 A;  3LY4 A;  3AZJ B;  3E98 A;  2W0N A;  3UB6 A;  3ZG0 A;  4IJE A;  3VE3 A;  3M6H A;  5IU1 A;  3A1I A;  4KEN B;  3PBN A;  2L5A A;  4E45 A;  2VJW A;  4H9P A;  5AVB B;  4Z2G A;  3LIE A;  1KX5 B;  2H0Y A;  1OJG A;  2PYP A;  3WA9 D;  4Y3I A;  3V39 A;  2IOU A;  1PZO A;  3BM6 A;  4R38 A;  5CHL B;  3UTA B;  3EEH A;  1PWG A;  1C3B A;  3C1C D;  1AOI C;  4YWZ A;  3SOI A;  2ZC3 B;  4IBB A;  3WD3 A;  3WKJ C;  4S2P A;  1P3B B;  1P3B D;  5HX9 A;  1K6S A;  5FUG B;  3QHY A;  4WF0 A;  4ZBE A;  1BLS A;  5AVC B;  1YKD A;  5AVB C;  4Z2J A;  4KZ8 A;  4E3L A;  1F66 C;  3A6N B;  4LFU A;  1LI0 A;  5DNM A;  3CWF A;  4NG2 A;  2ZOI A;  3B0D C;  1G68 A;  1HZO A;  2BAS A;  4UUZ A;  2ACG A;  3W4Q A;  4Q0I A;  5C3I B;  3V5M A;  3B6F D;  2FH5 A;  4J8X A;  5B2J B;  3WAA C;  2WKP A;  4WU8 A;  2HIO D;  2HIO C;  1GCE A;  1MKM A;  1IYP A;  3HUO A;  3HUN A;  3T4O A;  4X6T A;  4I5S A;  5L10 A;  2NZD C;  3PAG A;  3LZ0 A;  4F94 A;  4KHA A;  3M2K A;  5FQM A;  5EPH A;  2PYO A;  4BMW A;  1P3L C;  2D49 A;  4HMC A;  4I3A A;  4OLG A;  3L27 A;  5FAT A;  1SKO B;  3DTI A;  5GT0 B;  4B88 A;  1BLC A;  3FYZ A;  2W27 A;  1PIO A;  2DMW A;  2A3U A;  1LL5 A;  5FI7 A;  1N9N A;  1EAK A;  1MWS A;  4GS9 B;  3AV1 D;  1KE3 A;  1JNU A;  5CRF A;  5GXQ D;  1SHV A;  2ARO C;  3AZI A;  1P3A B;  3JYI A;  3Q07 A;  4GHI A;  4IJG A;  3REI B;  3AV1 A;  3AZG D;  5FI6 A;  1GSX A;  2BTF P;  3W99 D;  1BT5 A;  3Q7V A;  1M18 B;  1KE0 A;  1EQZ C;  1FCO A;  3H7W A;  1L6J A;  1TZY C;  4G3K A;  5CPK D;  2PRF A;  3LZ0 D;  5G18 A;  2EXB A;  2XD5 A;  4QU3 A;  1K56 A;  1OME A;  1UWN X;  3LEZ A;  1EQZ A;  1KVL A;  1B6W A;  2WAE A;  2RCX A;  1ZHH B;  1IKG A;  2ZQD A;  1T19 A;  1F98 A;  2V9A A;  3MZE A;  3UB7 A;  3C4P A;  3GSG A;  4J8W A;  1BTL A;  2D01 A;  1P3M D;  3QNB A;  4OVD A;  1KS0 A;  3HLW A;  5AQB A;  1GOI A;  3B6G A;  4WM9 A;  1H3Q A;  2ARO A;  3AZI C;  1MZU A;  2XD1 A;  2VV6 A;  3TW8 A;  3MGQ D;  4UA6 A;  1P3I C;  3HVF A;  3IHA A;  1NYM A;  4HME A;  2GX5 A;  4GHA A;  5GT3 B;  5B31 B;  2A24 A;  3LJA D;  3W99 B;  1HTZ A;  5JA4 B;  4QB8 A;  4KQR A;  5HD5 A;  5AV8 A;  5CPK B;  3V67 A;  5CP6 A;  1FR1 A;  3AZN B;  1P0Z A;  1HTA A;  4NKP A;  1TZY A;  3WA9 B;  2F8N B;  3WRT A;  5HAQ A;  1T1C A;  1O07 A;  4Z5T B;  3HLC A;  5EUA A;  3KXB B;  5BNV A;  3P09 A;  3NIA A;  3KYZ A;  4E3M A;  3WAA D;  3L2A A;  3FDD A;  1GHP A;  3AZF A;  3H82 A;  1XA1 A;  3JVU A;  1W7F A;  4UEY A;  3LFV A;  5AV5 A;  1F66 B;  4J8V C;  1CI9 A;  3KWQ B;  3WAA A;  2K31 A;  4RA7 A;  4CSR B;  3S7N A;  3JPU A;  2X02 A;  1XJ4 A;  3C1B B;  2WKQ A;  3GR2 A;  1BH9 A;  3AV2 A;  4WU9 C;  4DE2 A;  1E6Z A;  3B6F B;  4JGR A;  2CV5 B;  3KSH A;  5F69 A;  4C3Q A;  5B32 A;  4H9O A;  4WV4 B;  3ISG A;  1K56 D;  1DP9 A;  1MBL A;  3ZFZ A;  3UT9 D;  3UT9 B;  3D3O A;  4HY8 A;  4P85 A;  3E0Y A;  3LGO A;  3A3I A;  5AVF A;  4UQI M;  3IF5 A;  2V8C A;  2XDM A;  3WD0 A;  1BLP A;  3KYE A;  4J8W D;  1YMX A;  4MBH A;  5EM0 A;  4Y0T A;  2XH9 A;  2ZQ9 A;  3AV2 C;  4WU9 A;  3PBT A;  1YLT A;  3KXB C;  2VGL M;  1KX5 D;  2RTS A;  4N9L A;  3NI9 A;  4DJ2 A;  2Y2L A;  1M6K A;  4I3J A;  3VSK A;  1ONH A;  1N1J B;  4GJ4 A;  1RGZ A;  1TS7 A;  1YM1 A;  4HP9 A;  1P3F D;  5M18 A;  1KOU A;  1GHI A;  2OLV A;  5AV5 C;  5KZH A;  2EFX A;  1F9I A;  5EVI A;  3NEC A;  4KGC C;  1HVB A;  3CPT A;  5HD3 A;  3REH A;  1Z6F A;  2DCF A;  5B1L B;  3F1O B;  3F1P A;  1K4E A;  1MWU A;  2I9V A;  1BYW A;  2HGV A;  3MGP A;  2ZD8 A;  4L9G A;  4BL3 A;  3HUM A;  1DRM A;  3W2Z A;  4HES A;  2KX6 A;  3B3X A;  3UTA D;  1JWZ A;  3UDF A;  2O9C A;  3EPJ A;  3EPL A;  1KE4 A;  3HLE A;  5FAO A;  3MSH A;  1P34 B;  3ITB A;  5FQQ A;  3QP1 A;  2INW A;  1YAX A;  4HH3 A;  3I7J A;  2B02 A;  4I3I A;  5B2J A;  3LIB A;  5TGF A;  4IUH A;  3FPV A;  4F3L A;  2VK3 A;  4QWO A;  4OKP A;  5B32 D;  4WZS B;  4XZQ D;  3WS2 A;  2WKI A;  1ULY A;  2IO5 B;  3MGR A;  3T4Q A;  1VHM A;  4G91 B;  4LPZ A;  3OPL A;  4PM9 A;  4QHC A;  1YQS A;  2Q9M A;  3RH8 B;  1YU4 A;  5FAP A;  4FOF A;  3LZ1 D;  3LZ1 B;  2BYK A;  3JVV A;  3AZE A;  4A5R A;  2F8N G;  5E2F A;  5BS7 C;  3BEB A;  4MN5 A;  5G4Y A;  3KSF A;  3KXB D;  2J8Y A;  2VX8 A;  3WS4 A;  2NQB B;  5GSU D;  3MNN C;  4LV3 A;  3AV1 C;  3N8S A;  1TAF A;  3T50 A;  4OOL A;  3AGE A;  3K2N A;  1DJA A;  3OLO A;  3CAX A;  4B4X A;  3AZI B;  4PM7 A;  1H0I A;  3X1U C;  1M19 D;  3AV1 B;  2VGL S;  1S32 B;  3VH6 T;  1H3O A;  3BY8 A;  3A0S A;  3UO9 A;  1T3U A;  5B2J C;  3F1N A;  4AWL C;  3L9K A;  4JBF A;  1UR9 A;  3RXX A;  2VA0 A;  5AV8 D;  1S66 L;  2WKR A;  4WEK A;  4ZUX D;  2YKH A;  4BEN A;  5FQK A;  2HDS A;  4EEP A;  2IO5 C;  5B40 B;  4J8V D;  5HW3 A;  2OLU A;  2PT7 A;  4NEE D;  3C30 A;  3S7O A;  1M18 D;  1OTB A;  3CG5 A;  3LYX A;  1LHY A;  4WYY A;  1W2E A;  3X1S B;  3T1Q B;  5CPI C;  3UME A;  4J8W B;  5A93 A;  4NZ3 A;  4Z66 C;  4EXO A;  2G5H C;  3W97 A;  1EI5 A;  3UTB D;  2Y91 A;  5M19 A;  5C5K A;  1ACF A;  1WWI A;  3W4O A;  1P9W A;  4NE5 A;  3MGS B;  4XZQ A;  5DKL A;  4D60 A;  3NC8 A;  1OTA A;  2ZL1 A;  5CTM A;  3MZD A;  3CHW P;  3IX4 A;  3AN2 A;  4IVI A;  3V50 A;  4EO5 B;  4GCZ A;  4IBJ A;  4HNB A;  4RYE A;  3B0B A;  4WN5 A;  4G3V A;  4N92 A;  4OQI A;  4EQ1 A;  2W1T A;  2GJ3 A;  2QPN A;  2X01 A;  5DNM D;  1S1Z A;  4H9P B;  5FL3 A;  2HZ5 A;  3KWQ A;  3WAA B;  3HCY A;  4Z9Q A;  2Y2P A;  1X0O A;  1AXB A;  1YT4 A;  1OGB A;  1E6N A;  3AZG B;  3KO6 A;  5BOH A;  3TSG A;  4Z2K A;  1HQ3 B;  3M6B A;  4R70 A;  1P3P C;  4C6Y A;  1BH9 B;  1ERM A;  4WU8 D;  2HIO A;  3NQJ A;  4IBX A;  4MNR A;  2JKG A;  5DNN B;  4R8P B;  3B47 A;  2CV5 A;  3C1C A;  4EU0 A;  1TS0 A;  1YU2 A;  1OJ5 A;  1NRJ A;  3C1B D;  4IBF A;  1DJC A;  4HBT A;  1Y4O A;  5AV9 A;  1ZLA A;  5DNM C;  3MJQ A;  4KZA A;  4NE6 A;  4H8R A;  4XUX A;  1ID3 B;  3Q1F A;  1K38 A;  4H9S A;  4XUJ C;  1AIW A;  1ZTU A;  1IYQ A;  3B33 A;  5F68 A;  1WA9 A;  4UUZ B;  5CPI D;  4QY5 A;  3VE4 A;  4DF6 A;  4XT2 A;  1KX5 C;  3SH7 A;  5TJJ A;  3E4O A;  5B2I D;  4LCM A;  4KG5 A;  4Z2H A;  2ZM5 A;  2ZM2 A;  1O7E A;  1PWD A;  2D02 A;  3OZH A;  5CX7 A;  1N1J A;  4QLC A;  2AVX A;  3MXR A;  4MLL A;  4JGP A;  1PFL A;  4KHA B;  3ZG7 B;  4EBN A;  3REK A;  2PYO B;  4HIA A;  3X1V C;  1M1A C;  3PBQ A;  1NY0 A;  4P87 A;  2V0W A;  3REH B;  1GHM A;  4O8G A;  4QLC C;  2WGW A;  4Z5T C;  4H6J A;  5D3O A;  4Z5T D;  3TG9 A;  5CED A;  3UTB C;  3AZK C;  3MGQ C;  3T4T A;  3AZE C;  3CUE A;  3REJ C;  3IXB A;  3GQZ A;  5B2I B;  3ZG8 B;  1KX3 C;  4EEU A;  3IS2 A;  3LEL C;  1P34 A;  1RCJ A;  2B18 A;  1BFM A;  3UPP A;  5B0Y D;  2GNX A;  5B32 G;  2B95 A;  2P9V B;  5B2J D;  1UWP X;  3REJ A;  3LO7 A;  4LV0 A;  2Y59 A;  4DE1 A;  1D1J A;  5DKK A;  4WZ4 A;  3S7Q A;  4P0M A;  1L0F A;  3EWK A;  5FQI A;  3MGQ A;  2G7U A;  1U35 A;  4OPY A;  3T1S A;  4OP8 A;  3LJA A;  3U2A A;  5L09 A;  1EQZ B;  2GDN A;  5GSU B;  4KZ3 A;  4H9N A;  2EX8 A;  3REL D;  4ZRR A;  3A0V A;  3IXG A;  3N6I A;  3P01 A;  3UTA A;  5E5A B;  3KUY B;  2V1B A;  2F2A C;  3LZ1 A;  3W96 C;  3MQO A;  4NZ1 A;  3FG8 A;  3Q7Z A;  4FCF A;  3WS1 A;  4BWI A;  1FIL A;  3BFD A;  5FEG A;  4MDZ A;  3MGS C;  1TAF B;  3GV9 A;  3AN2 C;  3MGS D;  4JF5 A;  4M3K A;  4NXG A;  5B24 A;  5B31 A;  3A6N A;  4HMD A;  1QMF A;  2WYX A;  1BUL A;  3T1R A;  5AV8 B;  5CPK A;  1SZV A;  4DE3 A;  3ZNT A;  4H9S C;  4XUJ A;  5EVI C;  3IXD A;  4WU8 C;  1RP5 A;  5GT0 C;  1P3O C;  3OPH A;  3AZM D;  1A0K A;  2NZD D;  2NZD B;  5AV6 B;  5CPI A;  4ME4 A;  1P3L B;  4YNR A;  4Z2L A;  5FDH A;  3NOU C;  5F99 B;  1VET B;  3S7P A;  4X68 A;  2BYM A;  1E3U D;  2H0T A;  4NXE A;  4CQH A;  1M19 C;  1KX4 A;  4XXR A;  1BZA A;  3H0L C;  1NLZ A;  1P3O B;  3X1S A;  4EW7 A;  4Y0O A;  5AV6 C;  3A6N C;  4EO5 C;  1KX3 B;  3O5Y A;  4NY2 A;  5KMW A;  3A3E A;  3B6F A;  3UDI A;  5FAS A;  3FC7 A;  3IF6 A;  3AZK D;  2G5I C;  4P6Z S;  3TRC A;  3EOI A;  3UT9 C;  3AGD A;  5AVE A;  2JBF A;  5HSQ A;  2PU2 A;  4PPR A;  3REI A;  3P7N A;  1IEM A;  2XRO A;  4K0W A;  2QYB A;  3Q7V B;  3W4P A;  4WL9 A;  4WU9 D;  1M18 A;  4WU9 B;  3AZM A;  2V1Z A;  3W96 B;  4Y17 A;  4G91 C;  3OOV A;  1CF0 A;  2L0W A;  2QKP A;  3FPW A;  2NUP C;  4IBI A;  1P3K C;  3HON A;  5A91 A;  4NZ4 A;  1S0W A;  1L0G A;  4RX3 A;  4KZ6 A;  4ZJ1 A;  5B24 D;  4PM5 A;  5B24 C;  4LLO B;  1LL8 A;  1LI9 A;  3T4J A;  2XF3 A;  3VH5 A;  1ZC2 A;  3CPT B;  3ZVW A;  5CPJ D;  5AQ7 A;  1P3F B;  3EGX C;  4ARZ B;  4YS3 B;  2RL3 A;  1AWI A;  3Q82 A;  3MGP B;  3E4Q A;  3REL A;  4P6Z M;  3P5J B;  3AZN C;  4IBD A;  2QJ5 A;  2V1A A;  2V20 A;  3LJA C;  1VB6 A;  3AZN A;  4KZ5 A;  2VGK A;  1TDL A;  2JHE A;  1VEU A;  4OOY A;  5BNV B;  2HP9 A;  4ZBJ B;  2J3W A;  3LR3 A;  3UNW A;  3FKE A;  1P3B C;  1QO6 A;  3LEL A;  4J8U C;  3M7P A;  1EWZ A;  2P7J A;  1K4F A;  2QJ7 A;  2XLN A;  4BD0 A;  3MKF A;  1AOI B;  4CLC D;  3C1B C;  2C5W B;  2ZQC A;  2HV1 A;  4LD9 A;  1K6R A;  3AZL C;  4TX8 A;  3REK B;  4HEF A;  3C38 A;  3N7W A;  3MVD B;  1GSW A;  3C1B A;  4LRZ E;  1ZG6 A;  4CAY A;  3KUY C;  3AV2 B;  1XFN A;  4HI4 A;  3O3V A;  4DMZ A;  5J4E A;  1IKI A;  4UPK A;  1W5D A;  2FJ7 D;  2J3T C;  2JKR M;  3AZH C;  5IS1 A;  3UB8 A;  1KGF A;  3MVD C;  5EFW A;  4J8U D;  4X25 A;  4DXC A;  2F8N D;  5A90 A;  4ZJ3 A;  4Y2F A;  2ZY5 A;  5DNM B;  2W8S A;  1NLY A;  3UPN A;  1NWZ A;  1I2W A;  4S2I A;  4WMC D;  4EUV A;  1ID3 C;  3MXQ A;  4BBV A;  3LI8 A;  4IBE A;  1DY6 A;  3WWX A;  3KWQ C;  4HGA B;  1G28 A;  4R6L A;  2V2F F;  4ZBJ C;  5B0Z D;  1YSQ A;  1CEG A;  4PM6 A;  3UY6 A;  3LIF A;  3ZVT A;  4R8P C;  1K54 A;  3LZ0 B;  3G30 A;  4R8P D;  1ERQ A;  2YFW A;  3LY3 A;  3PYP A;  5EVE A;  5DF8 A;  3VOL A;  3C4O A;  2EX6 A;  1F2K A;  2Y2I A;  5B0Z A;  2I72 A;  4OQG A;  3LJA B;  3V9R B;  3MGP C;  5GT0 A;  3DTE A;  3WS5 A;  3AZL B;  2CV5 D;  1H5X A;  1ID3 D;  3D72 A;  1TEM A;  3LIA A;  2VEA A;  5CER A;  4UHU A;  5B0Y C;  1RGY A;  4OJ6 A;  2O0Y A;  3H9W A;  3MQL A;  2OOL A;  4N9K A;  3W98 C;  1P3M B;  1E3U A;  1H8P A;  3CI6 A;  5TBM A;  5B31 C;  5BO0 B;  2ZM0 A;  5HAP A;  5B31 D;  4R0Q A;  1NJ4 A;  1W63 M;  1OPX A;  4BQM A;  1H8Y A;  3MGS A;  1TVF A;  4D2O A;  2E8I A;  4IBR A;  1OT9 A;  3ZDJ A;  1V9Y A;  3L29 A;  3UPO A;  3IXH A;  2PBY A;  5KIZ A;  3LZ1 C;  5L8M A;  2OAP 1;  3B6F C;  4ETX A;  4EET B;  4GD6 A;  4YS3 D;  2JSS A;  1CXW A;  2JKR I;  2PR5 A;  2XEP A;  4LEN A;  2OAQ 1;  4G3W A;  2LY8 A;  4IHQ A;  4Z66 B;  3IBR A;  5AVC D;  3ZYT A;  3NDG A;  2HP5 A;  4X1L A;  2OWJ A;  5F99 A;  4WMC A;  2Y2H A;  1TD5 A;  1KDW A;  2BYM B;  2PYR A;  1KU5 A;  4H9R A;  2XFT A;  4KQO A;  3NBL A;  4OQ0 A;  3RJU A;  2BYK B;  4H9Q B;  4KUO A;  2CWE A;  4NET A;  1P3P D;  4WNN A;  3N8R A;  2ARO B;  4JGO A;  5B0Y B;  1ES5 A;  1YLZ A;  1P34 C;  5L2F A;  2HIO B;  1ESI A;  1KX3 A;  4FD8 A;  5CGX A;  3C1C B;  4NXB A;  4CLC C;  4I39 A;  5C3I C;  3IF6 B;  3DWK A;  2QMI A;  3F6T A;  4LD9 C;  1E8B A;  1BSG A;  5CGS A;  3MF0 A;  1Y28 A;  3GEC A;  3X1U B;  2ZC4 B;  4S2L A;  3G6O A;  5HL1 A;  4JXG A;  3ZCZ A;  4Z5T A;  3DW0 A;  2BG1 A;  4PAU A;  3F1N B;  1NRF A;  3UE6 A;  2ZY2 A;  5B33 C;  3MGR C;  5F82 A;  2ZM8 A;  2IA2 A;  3KS4 A;  3AYW D;  3BYD A;  4IBC A;  5EOO A;  2FFF B;  1PZR A;  3MNN B;  1FR6 A;  2V0U A;  3BW6 A;  5AV5 B;  2Y2N A;  1W63 Q;  2EX9 A;  3SS5 A;  2X71 A;  3UTA C;  2P74 A;  4QLC B;  2ARO D;  4R4R A;  1FSY A;  2JN7 A;  1K57 A;  4MN6 A;  2M7U A;  3B0D B;  4OPR A;  4L9F A;  3L7H A;  3O62 B;  5CPJ C;  1FOF A;  5DTS A;  4J8W C;  4OUI A;  5BS7 A;  3U4L P;  2MJ6 A;  4Q8I A;  4R1G A;  3DBA A;  5AY8 B;  4Y0U A;  5AY8 D;  1ESU A;  2RVQ D;  2WZX A;  3A3J A;  5DVA A;  1E15 A;  2H10 A;  4Y5F A;  2R9W A;  2OSU A;  2VZW A;  3OCL A;  3NJA A;  5AVC C;  3AZE D;  2HDR A;  5I5L A;  2Q0O A;  4PKY G;  4OJL A;  3BEC A;  2ZL1 B;  1P3L D;  1B67 A;  4WEL A;  2R78 A;  2CV5 C;  2A2L A;  3CUE C;  3QP4 A;  4P6B A;  1SDN A;  5GL9 A;  5B2I A;  2WZZ A;  3PBO A;  4QLC D;  2ZMA A;  4MCW A;  3W97 D;  3RTY A;  4X53 A;  4YM6 C;  5GXQ A;  4MEZ A;  3WKJ A;  5EM1 A;  1LSV A;  4S2N A;  2YFV A;  4X1M A;  3MGQ B;  1BUE A;  1HQ3 C;  3AL0 C;  5I94 A;  3AZJ C;  2J9O A;  4LD9 B;  2VLG A;  4E3N A;  3AZG A;  4XUJ D;  3F1O A;  3HL9 A;  4JPM A;  4H9N B;  3TJZ C;  3IF6 C;  1HQ3 A;  3O86 A;  3HLG A;  3BLS A;  5E5A A;  4RQ9 A;  2PD8 A;  3MXS A;  4NFT A;  5DNN A;  3A1K A;  5B1M A;  3LI9 A;  5F83 A;  3AYW C;  3MS6 A;  5IHV A;  3WS0 A;  3LZ0 C;  3EPH A;  5B32 C;  5E5A D;  4XZQ C;  5AV9 B;  1ZLA B;  1YU3 A;  2W3F A;  4HOI A;  5B24 B;  3S22 A;  2JE5 A;  1F66 D;  4J8X D;  3IBJ A;  1H8M A;  4JLF A;  4WZ5 C;  1P3K B;  4KUD A;  2CC1 A;  5G49 B;  5JRG C;  4EBP A;  1OT6 A;  2PD7 A;  3T4K A;  3C7V A;  2H5S A;  4F3L B;  1J7M A;  4NXF A;  3BFG A;  3AZF C;  1P3F C;  3ZGA B;  1LLB A;  5A92 A;  3ITA A;  5GHX A;  5CP6 D;  3C2W A;  3REJ D;  3VH5 W;  3X1V B;  1M1A B;  5DNN C;  2WKE A;  5B0Z B;  1N4O A;  1L3L A;  4LRY C;  1WE4 A;  1VET A;  4ZJ2 A;  2EXA A;  5J8X A;  2QWS A;  5E43 A;  4E3K A;  4HJ4 A;  3ICY A;  4WEJ A;  3AFA B;  2HDQ A;  3AZH A;  3PBS A;  3AYW B;  4HJ3 A;  3H0R C;  3RXW A;  5DF9 A;  3LUQ A;  1TF1 A;  5AV5 D;  3TE8 A;  3X1T B;  3L25 A;  3B6G C;  3AZJ D;  3EEA A;  4QNL A;  4DJ3 A;  3X1U D;  1T1A A;  3BFE A;  2ZQA A;  3CJM A;  4X55 A;  2P9V A;  5IT5 A;  3REJ B;  1U35 D;  3HRE A;  2W3H A;  2FFY A;  1TZY D;  3W97 C;  3IX3 A;  3VH6 A;  3IWQ A;  5AV8 C;  4U3T A;  1N9B A;  1F1E A;  3NDE A;  5B40 A;  3NOT C;  3WTP A;  4I38 A;  3ZNY A;  3B6G D;  2FZ0 A;  1VQQ A;  1V9Z A;  2W1R A;  3O62 D;  4R23 A;  3VP3 A;  3C7U A;  1VM1 A;  1D7E A;  5F6A A;  1MWR A;  4UQI S;  4H9Q A;  1M40 A;  1OTD A;  3CIT A;  5BNX B;  1BH8 A;  3CMZ A;  3AZI D;  3S4X A;  4WLA A;  5U47 A;  5DFY A;  2E8J A;  3CLO A;  5LBR A;  1IOU A;  3AGF A;  2V8F A;  1KGG A;  1PWC A;  3UB9 A;  3NUL A;  4GKU A;  1TDG A;  3PTE A;  2DF4 C;  5DNN D;  3REK C;  2Z2M B;  4DQY B;  3EG5 B;  2PYO D;  3E2L A;  3IX8 A;  1JFI B;  3PHY A;  4XUJ B;  3AN2 B;  1S67 L;  3VP0 A;  4HQA A;  3VSL A;  3BFF A;  5GLC A;  2QZ6 A;  2FJ7 A;  5JRG D;  4YIN A;  1MY8 A;  4B4Z A;  4X23 C;  1YLJ A;  5HPF A;  4PKY A;  2NZD A;  1PW8 A;  4GDN A;  4R3B A;  5EVL A;  4S2M A;  3AZM C;  3IQA A;  4WJ3 C;  3E2K A;  5JRG A;  4JJN C;  1HD8 A;  3OC2 A;  4J8X C;  1H0M A;  2NQB C;  2EX2 A;  4LD9 D;  5GLA A;  3VP1 A;  3W98 B;  1SCW A;  2ZMF A;  2A49 A;  1MPL A;  4KUD C;  3UTB B;  1M19 B;  2LB5 A;  3C1C C;  1AOI D;  4U0X A;  4CLC B;  4Q0J A;  3NQJ B;  5F99 C;  1ONG A;  4R8P A;  3TU4 A;  5HAR A;  3MVD D;  5G4Z A;  3UE3 A;  4DRT A;  1UGU A;  2IWB A;  4IUK A;  5AJG A;  4ESP A;  3MR0 A;  1ID3 A;  5FQJ A;  3OPR A;  3R45 B;  3N8L A;  3D9Y A;  4OON A;  1P97 A;  4CLC E;  1K0K A;  4ZUX A;  4HGA C;  3AZM B;  4HH2 A;  4ETZ A;  4Q0H A;  3AZJ A;  4X23 B;  4X23 D;  3OBF A;  4G92 B;  1GA9 A;  4PMA A;  2JKT I;  2F8N H;  1CEF A;  5GXQ C;  1K25 A;  3QP8 A;  3UE0 A;  5DTT A;  3NQU A;  5AVB A;  1W8Y A;  3BFC A;  3GTC A;  4R3A A;  2IWC A;  3LEL D;  3V9R A;  3KSI A;  1KX3 D;  3ZHH A;  3AZL A;  3MQ0 A;  1JVJ A;  3DWZ A;  5F5Y A;  1JWP A;  2WGW B;  3QNC A;  3BQA A;  5B40 D;  1Q9C A;  4J8V B;  2P08 A;  1JTG A;  5DJT A;  4YS3 A;  2WUQ A;  4WUJ A;  3FKW A;  4KGC B;  2EFU A;  5FUG A;  3AZN D;  1GSV A;  1P3M A;  4ZUX C;  3SS3 A;  5TBM B;  1NZU A;  2VGJ A;  4EUZ A;  2HPB A;  2G2U A;  4N1H A;  3KS8 A;  5CPJ A;  3T4L A;  4E3O A;  1E4D A;  4KUD B;  1XXM A;  1H0G A;  3NOP C;  4UAA A;  3G31 A;  1LSX A;  1FSW A;  3REI D;  4OJP A;  3TU4 D;  5FAQ A;  2V5O A;  3MGR D;  2K2N A;  3TU4 C;  2FN2 A;  1XJ3 A;  5B2I C;  4FUW A;  3B0C W;  5HFO A;  1P3K D;  1Q2P A;  2XK1 A;  3PR6 A;  5HL6 A;  4L9E A;  1YMS A;  3FKV A;  4JJN A;  4OH0 A;  1XGJ A;  4OPQ A;  3WD4 A;  3KUY A;  4H9R B;  3D4F A;  3MBZ A;  4JXW A;  1JWV A;  4CPK A;  2HP6 A;  2FJ7 C;  1P3O D;  4DRA A;  3AFA A;  4HJ6 A;  2JKT M;  2Y4A A;  2KDK A;  3B0C T;  4EV4 A;  5CP6 C;  2Z6D A;  2WKH A;  1ZKJ A;  3A0R A;  2XSS A;  2DNS A;  3OCN A;  2RIQ A;  2J7V A;  2Y2J A;  1YU0 A;  1ERO A;  3REH D;  4UA9 A;  3EPK A;  2LB9 A;  2OV5 A;  3UMD A;  2HDU A;  4NE3 A;  4XUZ A;  2YFW B;  1N9O A;  4LV2 A;  4OQH A;  1GA0 A;  5GT0 D;  3BLM A;  5AV6 A;  5CPI B;  1W1P A;  1P3L A;  4LG2 A;  1STZ A;  1YLW A;  5HZH A;  5J7E A;  1PI4 A;  3WTP D;  3WTP C;  3H0M C;  1P3M C;  3VOZ A;  3O62 A;  4KG6 A;  1P3P B;  1P9R A;  2HF6 A;  3GRJ A;  2ZY4 A;  3O87 A;  5EV0 A;  3B6G B;  4IBK A;  4YS3 C;  4DDS A;  1MC0 A;  4O7D A;  3OPP A;  1K55 A;  4JXV A;  5BO0 A;  1IYO A;  4OJO A;  1PYY A;  5GT3 A;  1FCM A;  2ZC6 B;  4BBU A;  1UR8 A;  1M18 C;  3IHB A;  3X1V D;  5B1M C;  1M1A D;  1YPR A;  2UV0 E;  3MZF A;  4GD8 A;  2B5R A;  1XJ6 A;  3VP4 A;  5B31 G;  4LGW A;  3IWI A;  3VOY A;  1NZO A;  1KGE A;  5B0Z C;  2ZQ8 A;  1IEL A;  3KXB A;  3REI C;  4YM6 B;  4YM6 D;  1L0E A;  2FJ7 B;  3V3R A;  1CK7 A;  1S4S A;  3LCE A;  5GXQ B;  1PZP A;  4ID4 A;  1W1Y A;  3H82 B;  4IVK A;  4MB3 A;  2ZLY A;  3KFU G;  4S2N C;  1T1B A;  1MXO A;  3HLB A;  1XKZ A;  4MBK A;  5JRG B;  3REK D;  2XFS A;  4MB5 A;  4GW9 A;  3W98 A;  3X1S C;  1DP8 A;  4WNN B;  4Z2M H;  1M19 A;  1KX4 C;  2WGV A;  1WYC A;  5B0Y A;  1U35 C;  1ODV A;  4Y15 A;  3WD1 A;  3TOI A;  3REL B;  2HJE A;  3WX7 A;  3W98 D;  5GSU C;  5CHJ A;  2L4R A;  5B1M B;  4NK3 A;  3LEQ A;  5B32 B;  4UA7 A;  3K3C A;  4PM8 A;  1S32 D;  5AVC A;  3W8K A;  5HWT A;  4KZ9 A;  1YSP A;  1GXD A;  5HDC A;  3LIC A;  1K54 C;  4J8U B;  1XJ2 A;  3WA9 C;  2P04 A;  3E4P A;  3NCK A;  3R45 A;  4ZAM A;  4KUD D;  2EWV A;  5B33 B;  4BD1 A;  4J8X B;  1PW1 A;  1WYB A;  2PHY A;  5TR7 A;  3LEL B;  1E88 A;  5KSH A;  1TS6 A;  5HDD A;  5KDM B;  2BLS A;  1P3I D;  1AOI A;  3R4K A;  2EA9 A;  3N4I A;  3T12 B;  1Z09 A;  4OLD A;  1Y54 A;  4HHD A;  5HAI A;  3G32 A;  1J3W A;  3AZL D;  4DDY A;  4JGQ A;  3MVD A;  5EEC A;  3X1V A;  1M1A A;  4CAY B;  3DAV A;  5B1M D;  1SKO A;  5B1L A;  1XX2 A;  5E2H A;  3A3D A;  1Z2C B;  2R9X A;  3KSG A;  4CJN A;  2J3T D;  3K3D A;  4EER A;  2NQB D;  1P3A A;  5FA7 A;  5KSC A;  3DTM A;  3X1S D;  3A3F A;  4KZ7 A;  5CXW A;  4MBF A;  5A8B A;  4KG2 A;  2JKF A;  5JYO A;  4GHL A;  2HUE B;  1FQG A;  1G6O A;  4B93 A;  1G5U A;  3BWL A;  5MC7 A;  3ZG9 B;  4Y7P A;  2YFV B;  5HWV A;  1W79 A;  4M4X A;  4QPR A;  2J80 A;  3FZC A;  4S2O A;  1HQ3 D;  4KZ4 A;  1ED7 A;  3MGR B;  3WTP B;  4RVA A;  4LV1 A;  5B1L D;  2K7S A;  5B1L C;  2ZOH A;  1S4R A;  1FCN A;  3SS4 A;  1PDC A;  3AZE B;  2EWW A;  1PNE A;  4HBU A;  3UB5 P;  3A6N D;  1PRQ A;  3BRM A;  4GLQ A;  2O9A A;  1OGG A;  3IWO A;  1WWS A;  1PI5 A;  2O99 A;  5AQ9 A;  2JCH A;  3X1T D;  1P3G C;  2A24 B;  4IED A;  1OTI A;  4IBG A;  2PU4 A;  2PYO C;  1P3K A;  3HBR A;  4EBL A;  2ZY3 A;  5GT3 C;  3QP5 A;  5G49 A;  3WA9 A;  4O01 A;  4MMN A;  4DRB A;  3AV2 D;  1D06 A;  4GN2 A;  4KZB A;  3VV4 A;  1KDS A;  1K55 C;  1ALQ A;  2M1C A;  3HSH A;  1I2S A;  4GDB A;  3MNN D;  1BLH A;  4Z66 A;  3AZF D;  3AZF B;  1E25 A;  1LL9 A;  2JC7 A;  3VFH A;  3HLD A;  1L2S A;  2J8P A;  3R7W A;  1F66 A;  4BL2 A;  2DRW A;  5HPI A;  2O9B A;  1MKI A;  4GB7 A;  3M2J A;  3GVB A;  4S2K A;  2ZC5 B;  4OPZ A;  1CQA A;  3VH6 W;  4JF6 A;  4E6X A;  5B33 D;  3BY9 A;  4GS9 A;  3AZH D;  3TU4 B;  1I5Q A;  2Y79 A;  2PBD P;  3V3S A;  4FH4 A;  5AVB D;  4NYY A;  3SZT A;  3X1T A;  1LSW A;  2J9P A;  3WRZ A;  2XGN A;  3X1U A;  5GLB A;  1W1V A;  3GDI A;  4NYU A;  2Z6C A;  3P98 A;  2OWH A;  2VV8 A;  4ZUX B;  3IH8 A;  4AFI A;  3H7W B;  4Z66 D;  1IFQ A;  3MNN A;  4C75 A;  1EQZ D;  4DXB A;  5CPK C;  4X23 A;  3MKE A;  1DJB A;  1P3I B;  1XP4 A;  5J3W A;  3CZD A;  3EQV A;  5GHZ A;  1P3G A;  4S2J A;  2G2W A;  3MQQ A;  4QJG A;  2H28 A;  4Z2I A;  2KLI A;  5CEC A;  4HP4 A;  5FQ9 A;  2ZC7 A;  5EOE A;  3HLF A;  1S6R A;  1TS8 A;  1ES2 A;  2XRN A;  5GT3 D;  4IJF A;  3F1P B;  5BNX A;  1BH8 B;  1SKF A;  2Q9N A;  1L0D A;  4JXS A;  3G2Y A;  5AY8 A;  1G6A A;  3NHQ A;  3L28 A;  4ZDX A;  4NZ5 A;  3N3F A;  4OOM A;  2XA7 S;  3AZK A;  3SH9 A;  2W3D A;  5HDS A;  4GZB A;  5AV9 D;  1ZLA D;  5JA4 A;  2ZJ9 A;  3IT9 A;  1IYS A;  4JJN D;  1K57 C;  3T4S A;  4BBT A;  5E2G A;  3REL C;  1YLY A;  3ULF A;  2Y2M A;  2F8N A;  1Q2Q A;  1YUE A;  3VMA A;  4B9O A;  5B40 C;  5HWW A;  3KWQ D;  3C5A A;  4O0P A;  3KX0 X;  5B33 A;  3WKJ D;  3WKJ B;  4L0L A;  2Y55 A;  1XFQ A;  3VFF A;  1DP6 A;  3AFA D;  4KQD A;  5KDM A;  1S32 C;  1P3A C;  3SW1 A;  3WTP E;  4CSR A;  4OJ5 A;  1KX5 A;  4LRX C;  3UDX A;  2ZBB A;  1LT0 A;  3UTB A;  3BQ8 A;  1J9M A;  4CLC A;  3FWL A;  3LR0 A;  1A7W A;  4QD4 A;  3LID A;  5EVI D;  2XR0 A;  3G2Z A;  2Y2K A;  1P3B A;  5FSR A;  2RVQ C;  4H6J B;  2QHK A;  5L07 A;  5F1F A;  2IWD A;  3LR4 A;  1ES3 A;  1W8Q A;  3WD2 A;  3UN7 A;  3UT9 A;  2PAV P;  3AN2 D;  3X1T C;  1P3G D;  5DTK A;  4GNU A;  4E3I A;  5DF7 A;  4EWF A;  3NY4 A;  4LCL A;  3IS2 B;  4OP5 A;  3MFD A;  4WU8 B;  4GH9 A;  1EW0 A;  1T18 A;  1O6I A;  3IH9 A;  2CMN A;  3S1Y A;  5AY8 C;  5CGW A;  3HJI A;  3MMH A;  3HJK A;  5BT1 C;  3VP2 A;  1N9L A;  3PXP A;  5EVI B;  1U35 B;  3NQU B;  4E3J A;  5K5B A;  4MN7 A;  2WAF A;  2XA7 M;  4WZ5 A;  3C8C A;  5GSU A;  5M1A A;  2GZA A;  4J8V A;  3PBR A;  5FI2 A;  2Y2G A;  4BJP A;  2VQR A;  5F99 D;  3W96 D;  1HLU P;  1P3P A;  1U60 A;  2W3E A;  5BPV A;  4KGC A;  1W1T A;  3AZH B;  4X56 A;  5FDS A;  1P34 D;  3W97 B;  2UWX A;  3AYW A;  4EES A;  4FH2 A;  3G34 A;  4DKI A;  2PDR A;  4X69 A;  1ES4 A;  5BT1 D;  5E5A C;  1NXY A;  4GHI B;  3EGD C;  4DN0 A;  1F5M A;  2F8N K;  2VV7 A;  1XPB A;  3O62 C;  5CPJ B;  3AZG C;  4E44 A;  4YOF A;  4Z1W A;  2Y2Q A;  2XQZ A;  3PAE A;  2C6W B;  1MWT A;  3B42 A;  3IP4 C;  2W3G A;  4R4S A;  4BLM A;  1CI8 A;  2HJ9 C;  4YM6 A;  1E6P A;  2ZQ7 A;  3ZG5 A;  2KOI A;  3KSY A;  4N1X A;  3MFX A;  1H8Z A;  3KYQ A;  2W1T B;  4DE0 A;  3O88 A;  5JYP A;  3QP6 A;  3LR5 A;  4JF4 A;  4JJN B;  5CEB A;  3R7W B;  5CTN A;  5CHM A;  4K91 A;  5CHU A;  1KX4 B;  3Q81 A;  1KX4 D;  5GHY A;  1CJF A;  3EQU A;  1P3O A;  5TFQ A;  4GOG A;  2WK0 A;  3DTK A;  2PR6 A;  2NQB A;  4KQQ A;  4FSF A;  5E2E A;  3ZQ5 A;  3AFA C;  4MB4 A;  5DFX A;  2WGI A;  3W99 A;  3QP2 A;  1XA7 A;  3G4P A;  3MGP D;  5CP6 B;  1OTE A;  4K0X A;  1JFI A;  1TZY B;  3T1X A;  1S32 A;  4R3J A;  3KUY D;  1H3O B;  4J8U A;  2Y8H A;  5EE8 A;  4JKT A;  3RFB A;  2L1M A;  5AV6 D;  3FV7 A;  2YKF A;  1NYY A;  2Y2O A;  4XT2 B;  3W96 A;  4RX2 A;  1CK3 A;  1E6R A;  1FIK A;  1ZG4 A;  1P3I A;  1P3A D;  2NUT C;  1XGI A;  4AWL B;  2Z2L B;  5GLD A;  1P3G B;  4G92 C;  1KVM A;  3UE1 A;  4YFM A;  4FTX A;  3G35 A;  5AQA A;  1S1Y A;  1JTD A;  1YU1 A;  1YLP A;  5FEF A;  5F1G A;  4WBG A;  2DQN C;  1P3F A;  4E04 A;  2VKS A;  3W99 C;  4K08 A;  3VH5 T;  3BJN A;  4Z2M G;  4ARZ A;  4H9O B;  2M7V A;  4KUK A;  4M6B A;  4U0T A; 
#chains in the Genus database with same CATH homology
 1SDE A;  1QME A;  4EQI A;  4XZQ B;  5AV9 C;  3AZK B;  1ZLA C;  2WAD A;  4KGC D;  3GMW A;  4ZTK A;  1R4V A;  4E6W A;  2HUE C;  3REH C;  3L26 A;  4QY6 A;  3SH8 A;  3LY4 A;  3AZJ B;  3ZG0 A;  4IJE A;  3M6H A;  3A1I A;  4KEN B;  3PBN A;  2L5A A;  4E45 A;  4H9P A;  5AVB B;  1KX5 B;  2H0Y A;  3WA9 D;  3V39 A;  2IOU A;  1PZO A;  3BM6 A;  5CHL B;  3UTA B;  1PWG A;  1C3B A;  3C1C D;  1AOI C;  3SOI A;  2ZC3 B;  4IBB A;  3WKJ C;  4S2P A;  1P3B B;  1P3B D;  5HX9 A;  1K6S A;  5FUG B;  3QHY A;  4ZBE A;  1BLS A;  5AVC B;  5AVB C;  4KZ8 A;  4E3L A;  1F66 C;  3A6N B;  1LI0 A;  5DNM A;  3B0D C;  1G68 A;  1HZO A;  4UUZ A;  3W4Q A;  5C3I B;  3V5M A;  3B6F D;  4J8X A;  5B2J B;  3WAA C;  4WU8 A;  2HIO D;  2HIO C;  1GCE A;  1IYP A;  3HUO A;  3HUN A;  4X6T A;  2NZD C;  3PAG A;  3LZ0 A;  4F94 A;  4KHA A;  3M2K A;  5FQM A;  5EPH A;  2PYO A;  1P3L C;  4OLG A;  3L27 A;  5FAT A;  5GT0 B;  4B88 A;  1BLC A;  3FYZ A;  1PIO A;  2A3U A;  1LL5 A;  5FI7 A;  1MWS A;  3AV1 D;  1KE3 A;  5CRF A;  5GXQ D;  1SHV A;  2ARO C;  3AZI A;  1P3A B;  3JYI A;  3Q07 A;  3REI B;  3AV1 A;  3AZG D;  5FI6 A;  3W99 D;  1BT5 A;  3Q7V A;  1M18 B;  1KE0 A;  1EQZ C;  1FCO A;  1TZY C;  5CPK D;  3LZ0 D;  5G18 A;  2EXB A;  2XD5 A;  4QU3 A;  1K56 A;  1OME A;  3LEZ A;  1EQZ A;  1KVL A;  1B6W A;  2WAE A;  2RCX A;  1IKG A;  2ZQD A;  3MZE A;  3C4P A;  3GSG A;  4J8W A;  1BTL A;  3QNB A;  1P3M D;  4OVD A;  3HLW A;  5AQB A;  3B6G A;  4WM9 A;  2ARO A;  3AZI C;  2XD1 A;  3MGQ D;  4UA6 A;  1P3I C;  3HVF A;  3IHA A;  1NYM A;  4GHA A;  5GT3 B;  5B31 B;  3LJA D;  3W99 B;  1HTZ A;  5JA4 B;  4QB8 A;  4KQR A;  5AV8 A;  5CPK B;  5CP6 A;  1FR1 A;  3AZN B;  1HTA A;  1TZY A;  3WA9 B;  2F8N B;  3WRT A;  5HAQ A;  1O07 A;  4Z5T B;  3HLC A;  5EUA A;  3KXB B;  5BNV A;  3P09 A;  3NIA A;  4E3M A;  3WAA D;  3L2A A;  3FDD A;  1GHP A;  3AZF A;  1XA1 A;  1W7F A;  5AV5 A;  1F66 B;  4J8V C;  1CI9 A;  3KWQ B;  3WAA A;  4RA7 A;  4CSR B;  2X02 A;  3C1B B;  3GR2 A;  1BH9 A;  3AV2 A;  4WU9 C;  4DE2 A;  3B6F B;  2CV5 B;  4C3Q A;  5B32 A;  4H9O A;  4WV4 B;  3ISG A;  1K56 D;  1MBL A;  3ZFZ A;  3UT9 D;  3UT9 B;  4P85 A;  3A3I A;  3IF5 A;  2XDM A;  1BLP A;  4J8W D;  1YMX A;  4MBH A;  4Y0T A;  2XH9 A;  2ZQ9 A;  3AV2 C;  4WU9 A;  3PBT A;  1YLT A;  3KXB C;  1KX5 D;  4N9L A;  3NI9 A;  2Y2L A;  1M6K A;  3VSK A;  1ONH A;  1N1J B;  1RGZ A;  1YM1 A;  1P3F D;  5M18 A;  1GHI A;  5AV5 C;  2OLV A;  5KZH A;  2EFX A;  5EVI A;  4KGC C;  1HVB A;  3REH A;  1Z6F A;  2DCF A;  5B1L B;  1K4E A;  1MWU A;  3MGP A;  2ZD8 A;  4BL3 A;  3HUM A;  4HES A;  3B3X A;  3UTA D;  1JWZ A;  3UDF A;  3EPJ A;  3EPL A;  1KE4 A;  3HLE A;  5FAO A;  1P34 B;  3ITB A;  5FQQ A;  3I7J A;  5B2J A;  5TGF A;  4OKP A;  5B32 D;  4WZS B;  4XZQ D;  3WS2 A;  2WKI A;  1ULY A;  2IO5 B;  3MGR A;  4G91 B;  3OPL A;  4PM9 A;  4QHC A;  1YQS A;  2Q9M A;  1YU4 A;  5FAP A;  3LZ1 D;  3LZ1 B;  2BYK A;  3AZE A;  4A5R A;  2F8N G;  5E2F A;  5BS7 C;  3BEB A;  3KXB D;  2J8Y A;  3WS4 A;  2NQB B;  5GSU D;  3MNN C;  4LV3 A;  3AV1 C;  3N8S A;  1TAF A;  4OOL A;  3AGE A;  1DJA A;  4B4X A;  3AZI B;  4PM7 A;  3X1U C;  1M19 D;  3AV1 B;  1S32 B;  3VH6 T;  1H3O A;  3UO9 A;  1T3U A;  5B2J C;  4AWL C;  4JBF A;  3RXX A;  5AV8 D;  4WEK A;  4ZUX D;  4BEN A;  5FQK A;  2HDS A;  2IO5 C;  5B40 B;  4J8V D;  5HW3 A;  2OLU A;  1M18 D;  3CG5 A;  1LHY A;  4WYY A;  1W2E A;  3X1S B;  5CPI C;  4J8W B;  5A93 A;  4NZ3 A;  4Z66 C;  2G5H C;  3W97 A;  1EI5 A;  3UTB D;  2Y91 A;  5M19 A;  1WWI A;  3W4O A;  4NE5 A;  3MGS B;  4XZQ A;  3NC8 A;  5CTM A;  3MZD A;  4IVI A;  3AN2 A;  3V50 A;  4EO5 B;  4IBJ A;  4RYE A;  3B0B A;  4N92 A;  4OQI A;  2QPN A;  2X01 A;  5DNM D;  4H9P B;  3KWQ A;  3WAA B;  4Z9Q A;  2Y2P A;  1AXB A;  1YT4 A;  3AZG B;  5BOH A;  3TSG A;  1HQ3 B;  3M6B A;  1P3P C;  4C6Y A;  1BH9 B;  4IBX A;  4WU8 D;  1ERM A;  2HIO A;  4MNR A;  3NQJ A;  5DNN B;  4R8P B;  2CV5 A;  3C1C A;  1YU2 A;  3C1B D;  4IBF A;  1DJC A;  4HBT A;  4XUX A;  5AV9 A;  1ZLA A;  5DNM C;  4KZA A;  4NE6 A;  4H8R A;  1ID3 B;  3Q1F A;  1K38 A;  4H9S A;  4XUJ C;  1IYQ A;  4UUZ B;  5CPI D;  4QY5 A;  4DF6 A;  1KX5 C;  3SH7 A;  5B2I D;  4LCM A;  4KG5 A;  2ZM2 A;  2ZM5 A;  1O7E A;  1PWD A;  3OZH A;  1N1J A;  4QLC A;  3MXR A;  4MLL A;  4KHA B;  3ZG7 B;  4EBN A;  3REK A;  2PYO B;  3X1V C;  1M1A C;  3PBQ A;  1NY0 A;  4P87 A;  3REH B;  1GHM A;  4QLC C;  2WGW A;  4Z5T C;  5D3O A;  4Z5T D;  3TG9 A;  5CED A;  3UTB C;  3AZK C;  3MGQ C;  3AZE C;  3REJ C;  3IXB A;  3GQZ A;  5B2I B;  3ZG8 B;  1KX3 C;  3LEL C;  1P34 A;  1RCJ A;  1BFM A;  3UPP A;  5B0Y D;  5B32 G;  2P9V B;  5B2J D;  3REJ A;  3LO7 A;  4LV0 A;  2Y59 A;  4DE1 A;  4WZ4 A;  4P0M A;  1L0F A;  5FQI A;  3MGQ A;  1U35 A;  4OPY A;  4OP8 A;  3LJA A;  1EQZ B;  2GDN A;  5GSU B;  4KZ3 A;  4H9N A;  2EX8 A;  3REL D;  3IXG A;  3N6I A;  3UTA A;  5E5A B;  3KUY B;  2F2A C;  3LZ1 A;  3W96 C;  4NZ1 A;  3Q7Z A;  4FCF A;  3WS1 A;  3BFD A;  3MGS C;  1TAF B;  3GV9 A;  3AN2 C;  3MGS D;  4JF5 A;  4M3K A;  5B24 A;  5B31 A;  3A6N A;  1QMF A;  2WYX A;  1BUL A;  5AV8 B;  5CPK A;  4DE3 A;  3ZNT A;  4H9S C;  4XUJ A;  5EVI C;  3IXD A;  4WU8 C;  1RP5 A;  5GT0 C;  1P3O C;  3OPH A;  3AZM D;  2NZD D;  2NZD B;  5AV6 B;  5CPI A;  1P3L B;  5FDH A;  5F99 B;  4X68 A;  2BYM A;  1E3U D;  2H0T A;  1M19 C;  1KX4 A;  4XXR A;  1BZA A;  3H0L C;  1P3O B;  3X1S A;  4Y0O A;  5AV6 C;  3A6N C;  4EO5 C;  1KX3 B;  4NY2 A;  5KMW A;  3A3E A;  3B6F A;  3UDI A;  5FAS A;  3IF6 A;  3AZK D;  2G5I C;  3UT9 C;  3AGD A;  2JBF A;  2PU2 A;  4PPR A;  3REI A;  1IEM A;  4K0W A;  3Q7V B;  3W4P A;  4WU9 D;  1M18 A;  4WU9 B;  3AZM A;  2V1Z A;  3W96 B;  4G91 C;  4IBI A;  1P3K C;  3HON A;  5A91 A;  4NZ4 A;  1S0W A;  1L0G A;  4RX3 A;  4KZ6 A;  4ZJ1 A;  5B24 D;  4PM5 A;  5B24 C;  1LI9 A;  2XF3 A;  3VH5 A;  1ZC2 A;  3ZVW A;  5CPJ D;  5AQ7 A;  1P3F B;  4YS3 B;  2RL3 A;  3Q82 A;  3MGP B;  3REL A;  3P5J B;  3AZN C;  4IBD A;  2V20 A;  3LJA C;  3AZN A;  4KZ5 A;  2VGK A;  1TDL A;  4OOY A;  5BNV B;  2HP9 A;  4ZBJ B;  3UNW A;  3FKE A;  1P3B C;  3LEL A;  4J8U C;  1EWZ A;  2XLN A;  1K4F A;  4BD0 A;  3MKF A;  1AOI B;  3C1B C;  2C5W B;  2ZQC A;  4LD9 A;  1K6R A;  3AZL C;  3REK B;  4HEF A;  3N7W A;  3MVD B;  3C1B A;  1ZG6 A;  4CAY A;  3KUY C;  3AV2 B;  3O3V A;  1IKI A;  4UPK A;  1W5D A;  2FJ7 D;  3AZH C;  1KGF A;  3MVD C;  4J8U D;  4DXC A;  2F8N D;  5A90 A;  4ZJ3 A;  2ZY5 A;  5DNM B;  2W8S A;  3UPN A;  4WMC D;  1I2W A;  4S2I A;  1ID3 C;  4IBE A;  1DY6 A;  3WWX A;  3KWQ C;  4HGA B;  2V2F F;  4ZBJ C;  5B0Z D;  1CEG A;  4PM6 A;  3UY6 A;  3ZVT A;  4R8P C;  1K54 A;  3LZ0 B;  3G30 A;  4R8P D;  1ERQ A;  2YFW A;  3LY3 A;  5DF8 A;  3C4O A;  2EX6 A;  2Y2I A;  5B0Z A;  2I72 A;  4OQG A;  3LJA B;  3V9R B;  3MGP C;  5GT0 A;  3WS5 A;  3AZL B;  2CV5 D;  1H5X A;  1ID3 D;  1TEM A;  5CER A;  4UHU A;  5B0Y C;  1RGY A;  4OJ6 A;  4N9K A;  3W98 C;  1P3M B;  1E3U A;  5B31 C;  5BO0 B;  2ZM0 A;  5HAP A;  5B31 D;  4R0Q A;  1NJ4 A;  4BQM A;  1H8Y A;  3MGS A;  1TVF A;  4D2O A;  2E8I A;  4IBR A;  3ZDJ A;  3UPO A;  3L29 A;  3IXH A;  2PBY A;  3LZ1 C;  3B6F C;  4GD6 A;  4YS3 D;  2JSS A;  2XEP A;  4LEN A;  2LY8 A;  4Z66 B;  5AVC D;  3NDG A;  2HP5 A;  5F99 A;  4WMC A;  2Y2H A;  1KDW A;  2BYM B;  1KU5 A;  4H9R A;  4KQO A;  2XFT A;  3NBL A;  4OQ0 A;  3RJU A;  2BYK B;  4H9Q B;  2CWE A;  4NET A;  1P3P D;  4WNN A;  3N8R A;  2ARO B;  5B0Y B;  1ES5 A;  1YLZ A;  1P34 C;  5L2F A;  2HIO B;  1ESI A;  1KX3 A;  4FD8 A;  5CGX A;  3C1C B;  5C3I C;  3IF6 B;  3DWK A;  2QMI A;  3F6T A;  4LD9 C;  1BSG A;  5CGS A;  4S2L A;  3X1U B;  2ZC4 B;  5HL1 A;  4JXG A;  3ZCZ A;  4Z5T A;  3DW0 A;  2BG1 A;  1NRF A;  2ZY2 A;  5B33 C;  3MGR C;  5F82 A;  2ZM8 A;  3KS4 A;  3AYW D;  3BYD A;  4IBC A;  5EOO A;  2FFF B;  1PZR A;  3MNN B;  1FR6 A;  5AV5 B;  2Y2N A;  2EX9 A;  3SS5 A;  2X71 A;  3UTA C;  2P74 A;  4QLC B;  2ARO D;  4R4R A;  1FSY A;  1K57 A;  3B0D B;  4OPR A;  3O62 B;  5CPJ C;  1FOF A;  5DTS A;  4J8W C;  4OUI A;  5BS7 A;  4Q8I A;  4R1G A;  5AY8 B;  4Y0U A;  5AY8 D;  1ESU A;  2RVQ D;  3A3J A;  2WZX A;  5DVA A;  2H10 A;  2R9W A;  2OSU A;  3OCL A;  5AVC C;  3AZE D;  2HDR A;  4OJL A;  3BEC A;  1P3L D;  1B67 A;  4WEL A;  2CV5 C;  4P6B A;  1SDN A;  5GL9 A;  5B2I A;  2WZZ A;  3PBO A;  4QLC D;  2ZMA A;  3W97 D;  4X53 A;  4YM6 C;  5GXQ A;  4MEZ A;  3WKJ A;  4S2N A;  2YFV A;  3MGQ B;  1BUE A;  1HQ3 C;  3AL0 C;  5I94 A;  3AZJ C;  2J9O A;  4LD9 B;  4E3N A;  3AZG A;  4XUJ D;  3HL9 A;  4JPM A;  4H9N B;  3IF6 C;  1HQ3 A;  3O86 A;  3HLG A;  3BLS A;  5E5A A;  3MXS A;  4NFT A;  5DNN A;  3A1K A;  5B1M A;  5F83 A;  3AYW C;  5IHV A;  3WS0 A;  3LZ0 C;  3EPH A;  5B32 C;  5E5A D;  4XZQ C;  5AV9 B;  1ZLA B;  1YU3 A;  3S22 A;  5B24 B;  2JE5 A;  1F66 D;  4J8X D;  4JLF A;  4WZ5 C;  1P3K B;  4KUD A;  2CC1 A;  5G49 B;  5JRG C;  4EBP A;  3C7V A;  2H5S A;  3BFG A;  3AZF C;  1P3F C;  3ZGA B;  1LLB A;  5A92 A;  3ITA A;  5GHX A;  5CP6 D;  3REJ D;  3VH5 W;  3X1V B;  1M1A B;  5DNN C;  2WKE A;  5B0Z B;  1N4O A;  1WE4 A;  4ZJ2 A;  2EXA A;  5J8X A;  5E43 A;  4E3K A;  4WEJ A;  3AFA B;  2HDQ A;  3AZH A;  3PBS A;  3AYW B;  3H0R C;  3RXW A;  5DF9 A;  5AV5 D;  3X1T B;  3L25 A;  3B6G C;  3AZJ D;  4QNL A;  3X1U D;  3BFE A;  2ZQA A;  3CJM A;  4X55 A;  2P9V A;  3REJ B;  1U35 D;  3HRE A;  2FFY A;  1TZY D;  3W97 C;  3VH6 A;  3IWQ A;  5AV8 C;  4U3T A;  1N9B A;  1F1E A;  3NDE A;  5B40 A;  3WTP A;  3ZNY A;  3B6G D;  1VQQ A;  4R23 A;  3O62 D;  3VP3 A;  3C7U A;  1VM1 A;  1MWR A;  4H9Q A;  1M40 A;  5BNX B;  1BH8 A;  3CMZ A;  3AZI D;  3S4X A;  5U47 A;  3AGF A;  1KGG A;  1PWC A;  4GKU A;  1TDG A;  3PTE A;  2DF4 C;  5DNN D;  3REK C;  2Z2M B;  4DQY B;  3EG5 B;  2PYO D;  3E2L A;  1JFI B;  4XUJ B;  3AN2 B;  3VP0 A;  3VSL A;  3BFF A;  5GLC A;  2QZ6 A;  2FJ7 A;  5JRG D;  4YIN A;  1MY8 A;  4B4Z A;  4X23 C;  1YLJ A;  2NZD A;  1PW8 A;  4GDN A;  4R3B A;  5EVL A;  4S2M A;  3AZM C;  3IQA A;  4WJ3 C;  3E2K A;  5JRG A;  4JJN C;  1HD8 A;  3OC2 A;  4J8X C;  2NQB C;  2EX2 A;  4LD9 D;  5GLA A;  3VP1 A;  3W98 B;  1SCW A;  2A49 A;  1MPL A;  4KUD C;  3UTB B;  1M19 B;  3C1C C;  1AOI D;  4U0X A;  3NQJ B;  5F99 C;  1ONG A;  4R8P A;  3TU4 A;  5HAR A;  3MVD D;  3UE3 A;  4DRT A;  2IWB A;  1ID3 A;  5FQJ A;  3OPR A;  3R45 B;  3N8L A;  4OON A;  4ZUX A;  4HGA C;  3AZM B;  3AZJ A;  4X23 B;  4X23 D;  4G92 B;  1GA9 A;  4PMA A;  2F8N H;  1CEF A;  5GXQ C;  1K25 A;  3UE0 A;  5DTT A;  3NQU A;  5AVB A;  1W8Y A;  3BFC A;  3GTC A;  2IWC A;  3LEL D;  3V9R A;  3ZHH A;  1KX3 D;  3AZL A;  1JVJ A;  3DWZ A;  1JWP A;  2WGW B;  3QNC A;  5B40 D;  1Q9C A;  4J8V B;  1JTG A;  4YS3 A;  2WUQ A;  3FKW A;  4KGC B;  2EFU A;  5FUG A;  3AZN D;  1P3M A;  4ZUX C;  3SS3 A;  1NZU A;  2VGJ A;  4EUZ A;  2HPB A;  2G2U A;  4N1H A;  3KS8 A;  5CPJ A;  4E3O A;  1E4D A;  4KUD B;  1XXM A;  4UAA A;  3G31 A;  1FSW A;  3REI D;  4OJP A;  3TU4 D;  5FAQ A;  3MGR D;  3TU4 C;  5B2I C;  3B0C W;  5HFO A;  1P3K D;  1Q2P A;  2XK1 A;  1YMS A;  3FKV A;  4JJN A;  4OH0 A;  1XGJ A;  4OPQ A;  3KUY A;  4H9R B;  3D4F A;  3MBZ A;  4JXW A;  1JWV A;  4CPK A;  2HP6 A;  2FJ7 C;  1P3O D;  4DRA A;  3AFA A;  2Y4A A;  3B0C T;  4EV4 A;  5CP6 C;  2WKH A;  1ZKJ A;  2DNS A;  3OCN A;  2RIQ A;  2J7V A;  2Y2J A;  1YU0 A;  1ERO A;  3REH D;  4UA9 A;  3EPK A;  2OV5 A;  2HDU A;  4NE3 A;  4XUZ A;  2YFW B;  4LV2 A;  4OQH A;  1GA0 A;  5GT0 D;  3BLM A;  5AV6 A;  5CPI B;  1P3L A;  4LG2 A;  1YLW A;  1PI4 A;  3WTP D;  3WTP C;  3H0M C;  1P3M C;  3VOZ A;  3O62 A;  4KG6 A;  1P3P B;  3GRJ A;  2ZY4 A;  3O87 A;  3B6G B;  4IBK A;  4YS3 C;  4DDS A;  4O7D A;  3OPP A;  1K55 A;  4JXV A;  5BO0 A;  1IYO A;  4OJO A;  1PYY A;  5GT3 A;  1FCM A;  2ZC6 B;  1M18 C;  3IHB A;  3X1V D;  5B1M C;  1M1A D;  3MZF A;  4GD8 A;  2B5R A;  3VP4 A;  5B31 G;  3IWI A;  3VOY A;  1NZO A;  2ZQ8 A;  5B0Z C;  1KGE A;  1IEL A;  3KXB A;  3REI C;  4YM6 B;  4YM6 D;  1L0E A;  2FJ7 B;  3V3R A;  3LCE A;  5GXQ B;  1PZP A;  4ID4 A;  4IVK A;  2ZLY A;  3KFU G;  4S2N C;  1MXO A;  3HLB A;  4MBK A;  1XKZ A;  5JRG B;  3REK D;  2XFS A;  3W98 A;  3X1S C;  4WNN B;  4Z2M H;  1M19 A;  1KX4 C;  2WGV A;  1WYC A;  5B0Y A;  1U35 C;  3TOI A;  3REL B;  3WX7 A;  3W98 D;  5GSU C;  5CHJ A;  5B1M B;  4NK3 A;  5B32 B;  4UA7 A;  4PM8 A;  1S32 D;  5AVC A;  3W8K A;  4KZ9 A;  1K54 C;  4J8U B;  3WA9 C;  3NCK A;  3R45 A;  4ZAM A;  4KUD D;  5B33 B;  4BD1 A;  4J8X B;  1PW1 A;  1WYB A;  5TR7 A;  5KSH A;  3LEL B;  5KDM B;  2BLS A;  1P3I D;  1AOI A;  3N4I A;  4OLD A;  1Y54 A;  5HAI A;  3G32 A;  4DDY A;  3AZL D;  3MVD A;  5EEC A;  3X1V A;  1M1A A;  4CAY B;  5B1M D;  5B1L A;  1XX2 A;  5E2H A;  3A3D A;  1Z2C B;  2R9X A;  4CJN A;  2NQB D;  1P3A A;  5FA7 A;  5KSC A;  3DTM A;  3X1S D;  3A3F A;  4KZ7 A;  5CXW A;  4MBF A;  4KG2 A;  5JYO A;  4GHL A;  2HUE B;  1FQG A;  3ZG9 B;  4Y7P A;  2YFV B;  1W79 A;  3FZC A;  4S2O A;  1HQ3 D;  4KZ4 A;  3MGR B;  3WTP B;  4RVA A;  4LV1 A;  5B1L D;  5B1L C;  1FCN A;  3SS4 A;  3AZE B;  4HBU A;  3A6N D;  3BRM A;  3IWO A;  1WWS A;  1PI5 A;  5AQ9 A;  2JCH A;  3X1T D;  1P3G C;  4IED A;  4IBG A;  2PU4 A;  2PYO C;  1P3K A;  3HBR A;  4EBL A;  2ZY3 A;  5GT3 C;  5G49 A;  3WA9 A;  4DRB A;  3AV2 D;  4GN2 A;  4KZB A;  1KDS A;  1K55 C;  1ALQ A;  3HSH A;  1I2S A;  4GDB A;  3MNN D;  1BLH A;  4Z66 A;  3AZF D;  3AZF B;  1E25 A;  1LL9 A;  2JC7 A;  3VFH A;  3HLD A;  1L2S A;  2J8P A;  1F66 A;  4BL2 A;  2DRW A;  1MKI A;  4GB7 A;  3M2J A;  3GVB A;  4S2K A;  2ZC5 B;  4OPZ A;  3VH6 W;  4JF6 A;  4E6X A;  5B33 D;  3AZH D;  3TU4 B;  1I5Q A;  3V3S A;  4FH4 A;  5AVB D;  4NYY A;  3X1T A;  2J9P A;  3WRZ A;  2XGN A;  3X1U A;  5GLB A;  4NYU A;  3P98 A;  4ZUX B;  3IH8 A;  4Z66 D;  3MNN A;  4C75 A;  1EQZ D;  4DXB A;  5CPK C;  4X23 A;  3MKE A;  1DJB A;  1P3I B;  1XP4 A;  3CZD A;  3EQV A;  5GHZ A;  1P3G A;  4S2J A;  2G2W A;  4QJG A;  5CEC A;  5FQ9 A;  2ZC7 A;  5EOE A;  3HLF A;  1S6R A;  1ES2 A;  5GT3 D;  4IJF A;  5BNX A;  1BH8 B;  1SKF A;  2Q9N A;  1L0D A;  4JXS A;  3G2Y A;  5AY8 A;  1G6A A;  3L28 A;  4ZDX A;  4NZ5 A;  3N3F A;  4OOM A;  3AZK A;  3SH9 A;  4GZB A;  5AV9 D;  1ZLA D;  5JA4 A;  2ZJ9 A;  3IT9 A;  1IYS A;  4JJN D;  1K57 C;  5E2G A;  3REL C;  1YLY A;  2Y2M A;  2F8N A;  1Q2Q A;  1YUE A;  3VMA A;  5B40 C;  3KWQ D;  3C5A A;  5B33 A;  3WKJ D;  3WKJ B;  4L0L A;  2Y55 A;  3VFF A;  3AFA D;  5KDM A;  1S32 C;  1P3A C;  3WTP E;  4CSR A;  4OJ5 A;  1KX5 A;  3UDX A;  3UTB A;  1J9M A;  3FWL A;  1A7W A;  4QD4 A;  5EVI D;  2XR0 A;  3G2Z A;  2Y2K A;  1P3B A;  5FSR A;  2RVQ C;  5F1F A;  2IWD A;  1ES3 A;  1W8Q A;  3UN7 A;  3UT9 A;  3AN2 D;  3X1T C;  1P3G D;  5DTK A;  4GNU A;  4E3I A;  5DF7 A;  4EWF A;  3NY4 A;  4LCL A;  4OP5 A;  3MFD A;  4WU8 B;  4GH9 A;  3IH9 A;  3S1Y A;  5AY8 C;  5CGW A;  5BT1 C;  3VP2 A;  5EVI B;  1U35 B;  3NQU B;  4E3J A;  2WAF A;  4WZ5 A;  5GSU A;  5M1A A;  4J8V A;  3PBR A;  5FI2 A;  2Y2G A;  4BJP A;  2VQR A;  5F99 D;  3W96 D;  1U60 A;  1P3P A;  5BPV A;  4KGC A;  3AZH B;  4X56 A;  1P34 D;  3W97 B;  2UWX A;  3AYW A;  4FH2 A;  3G34 A;  4DKI A;  4X69 A;  1ES4 A;  5BT1 D;  5E5A C;  1NXY A;  2F8N K;  1XPB A;  3O62 C;  5CPJ B;  3AZG C;  4E44 A;  2Y2Q A;  2XQZ A;  3PAE A;  2C6W B;  1MWT A;  3IP4 C;  4R4S A;  4BLM A;  1CI8 A;  4YM6 A;  2ZQ7 A;  3ZG5 A;  3KSY A;  4N1X A;  1H8Z A;  4DE0 A;  3O88 A;  5JYP A;  4JF4 A;  4JJN B;  5CEB A;  5CTN A;  5CHM A;  4K91 A;  5CHU A;  1KX4 B;  3Q81 A;  1KX4 D;  5GHY A;  3EQU A;  1P3O A;  5TFQ A;  4GOG A;  2WK0 A;  2NQB A;  4KQQ A;  4FSF A;  5E2E A;  3AFA C;  2WGI A;  3W99 A;  1XA7 A;  3G4P A;  3MGP D;  5CP6 B;  4K0X A;  1JFI A;  1TZY B;  1S32 A;  4R3J A;  3KUY D;  1H3O B;  4J8U A;  5EE8 A;  4JKT A;  3FV7 A;  5AV6 D;  1NYY A;  2Y2O A;  3W96 A;  4RX2 A;  1CK3 A;  1ZG4 A;  1P3I A;  1P3A D;  1XGI A;  4AWL B;  2Z2L B;  5GLD A;  1P3G B;  4G92 C;  1KVM A;  3UE1 A;  4YFM A;  3G35 A;  5AQA A;  1JTD A;  1YU1 A;  1YLP A;  5F1G A;  4WBG A;  2DQN C;  1P3F A;  3W99 C;  3VH5 T;  4Z2M G;  4H9O B;  4M6B A;  4U0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...