2Y2QA

Penicillin-binding protein 1b (pbp-1b) in complex with an alkyl boronate (z06)
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
489
structure length
469
Chain Sequence
b'ISEITYSDGTVIASIDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTGQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PENICILLIN-BINDING PROTEIN 1B
publication title Structure-Guided Design of Cell Wall Biosynthesis Inhibitors that Overcome Beta-Lactam Resistance in Staphylococcus Aureus (Mrsa).
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
total genus 164
structure length 469
sequence length 489
chains with identical sequence B
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2y2qA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2y2qA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2y2qA02
1HTZA 4PM6A 1BZAA 2PU4A 2ZQAA 4Y0UA 3BFGA 3TG9A 5DF7A 4MBFA 2JC7A 2C6WB 1KE0A 1FCNA 2HDRA 1W7FA 1FCMA 3EQVA 4X6TA 1JWVA 4P85A 4U0TA 4YFMA 5KZHA 5KSCA 4KG6A 1MWRA 1FOFA 1YMSA 1LHYA 3G2YA 3HL9A 3TSGA 4E3KA 2WKIA 4FH4A 5FQJA 2RL3A 4OPYA 1PW8A 4GN2A 5FAQA 3WRZA 2WAEA 3OC2A 4O7DA 4WM9A 1L0EA 4PM5A 3CJMA 2XH9A 5E2GA 1MPLA 3GR2A 3VOZA 2Y2QA 4RX3A 3FZCA 1GA0A 1TDGA 3M2KA 4QY5A 3N8SA 4U3TA 4KQQA 5HAIA 2PBYA 1YM1A 4KZBA 1L0FA 1XGJA 3IF6B 3OPLA 1H5XA 3G4PA 4UA6A 3ZG5A 3LCEA 3G31A 2V20A 4KZ6A 3UNWA 1IYPA 3WS5A 5A90A 4R3JA 4FCFA 1K55A 1TVFA 2Y59A 3D4FA 4GD6A 2JE5A 1IEMA 1SCWA 2WGWB 4LV0A 3VOYA 4X68A 4BD1A 1NZUA 1YQSA 1PZOA 4QB8A 5TGFA 1FSWA 1I2SA 3Q7VA 4E6WA 4N9KA 2WZZA 3GMWA 4UA9A 1YLTA 1YMXA 1GHMA 1MY8A 4JXWA 3ZG0A 4DDYA 2EX2A 3IHAA 1O07A 5HFOA 1G6AA 1NJ4A 4XUZA 2ZC7A 5CGXA 1PI4A 3NC8A 4E3NA 4HEFA 4WYYA 3HLGA 1DJBA 1EI5A 4OPZA 5DF9A 1XA1A 5DTKA 3ZG8B 4CJNA 5CEBA 2CC1A 3G32A 4C3QA 3G30A 2Y2KA 2P9VA 3A3DA 4X69A 1K55C 5FI2A 3UPOA 3IXDA 1OMEA 5L2FA 5M18A 3ZVWA 2Z2LB 1SKFA 3G34A 4E3JA 3BFDA 3E2KA 5EVID 2H5SA 3BM6A 3ZNYA 1XXMA 4X53A 4JXGA 4KZ9A 4BQMA 2J8YA 2HDSA 1XP4A 1K6SA 4OP5A 1J9MA 2JBFA 4WBGA 3VFHA 2Y2PA 4R4SA 3WWXA 3V50A 5CHJA 3SOIA 4KZ7A 2HDUA 4S2KA 3PBTA 2Y2OA 3M2JA 1NRFA 5E2EA 3IF6C 1PI5A 2ZC5B 2H10A 5CTNA 4BD0A 5CEDA 4MLLA 4ZBEA 4OOMA 5F82A 1WYCA 5HL1A 5HX9A 4ZJ2A 1BLCA 5CGWA 2ZM0A 4R0QA 3VFFA 1ZG4A 2V2FF 2WUQA 2XLNA 2XFTA 3GSGA 4X56A 5F1FA 1DJCA 3PBSA 4OKPA 1MKIA 3UDXA 1Y54A 4BL2A 1KGEA 3IXGA 2ZM8A 3OPRA 4N92A 1IYOA 2GDNA 5KSHA 4DDSA 2XDMA 2ZQ8A 3C7VA 1TDLA 2Q9NA 1NYYA 3EQUA 5EVIB 4DXBA 2A49A 4JF5A 4EUZA 1L0GA 4E3LA 1XPBA 2XK1A 5J8XA 2A3UA 1JWPA 2XF3A 5CTMA 3AGFA 3E2LA 2VGKA 1RP5A 4DE3A 4UA7A 1K54A 5EUAA 2Y2HA 4HBUA 3UE3A 2Y2GA 3WRTA 5M19A 1ALQA 3PBRA 3MKEA 2E8IA 3DWKA 3IWQA 4U0XA 1W5DA 4KG5A 3V39A 1MXOA 4OP8A 4E6XA 2Q9MA 5EVIA 4P0MA 4S2LA 4E3OA 2ZC3B 4UHUA 3PBOA 1RGZA 2XR0A 4KQRA 3Q7VB 3S4XA 3RJUA 1E4DA 1H8YA 3A3IA 2Y2MA 4OPQA 1L0DA 3BFEA 5HAPA 3G35A 4JPMA 3FKWA 3JYIA 4WZ4A 5G18A 4EBPA 1K54C 1MWSA 1K57A 1YLZA 2WGIA 4OOLA 2OV5A 4MBHA 4ZDXA 3GTCA 4LV3A 3VP2A 5FQ9A 3S1YA 1YLYA 3IWIA 3NCKA 4RX2A 4S2OA 3ISGA 2Y2IA 4EBNA 5EVLA 3N8LA 1KVLA 2P9VB 4DE1A 2RCXA 1PWGA 4DKIA 1E25A 1KGGA 2HP6A 1KE4A 2EX8A 4JKTA 3O3VA 5EVIC 1ONHA 1YLJA 4S2NA 3RXWA 4KZ8A 3IQAA 5GLCA 2V1ZA 1BUEA 4R1GA 5GHZA 4PM8A 1PZPA 2X02A 3CZDA 4PPRA 5CHUA 4FD8A 5FQIA 4IVKA 3SS3A 1CEGA 3FYZA 3NDEA 4WEJA 1L2SA 5CERA 2ZJ9A 3VP4A 1BTLA 2ZLYA 1GCEA 4N9LA 1K57C 4M3KA 3N8RA 4E3IA 1FCOA 2WYXA 2IWBA 1LL5A 4JXSA 4LCLA 4PM7A 4KENB 3NY4A 3TOIA 1K4FA 3MXSA 1JWZA 1K56D 1ONGA 1FSYA 3NI9A 4BENA 1LL9A 1AXBA 5EE8A 2H0YA 4QY6A 4H8RA 1U60A 1Z6FA 4OLDA 4MEZA 3IXHA 5E2FA 4LENA 5FI6A 1RCJA 4S2MA 4D2OA 3OPPA 2Y4AA 1KE3A 1HZOA 4S2JA 5F83A 4B4XA 4OQ0A 4Y0OA 2Y91A 1CI9A 4OOYA 1PWDA 1I5QA 3SH9A 5FDHA 1RGYA 2J9PA 3I7JA 3C5AA 4OPRA 3UN7A 5EPHA 1N4OA 3IHBA 4C75A 3N6IA 5FAOA 1Q2PA 1ES2A 3PBQA 4IVIA 4Y0TA 4WMCD 3Q81A 2Y55A 4KG2A 1VQQA 3UE1A 3O86A 2H0TA 4ZTKA 4FH2A 5FSRA 2Y2JA 1BULA 4DF6A 1M6KA 5KMWA 4Z9QA 1DY6A 3WS2A 4R4RA 3G2ZA 1LI9A 4BJPA 1ZC2A 3Q07A 2XFSA 4Y7PA 5E43A 4ZAMA 2ZQ7A 4WEKA 4EWFA 3FKVA 3LEZA 3MZEA 4P87A 3VSKA 2DNSA 1SHVA 1ES4A 3BRMA 1S0WA 4S2PA 3IT9A 3N7WA 3HUOA 3QHYA 5GL9A 1MWTA 1XKZA 4RVAA 5AQAA 3HLFA 3ZG9B 2BG1A 4K0XA 5D3OA 1NXYA 3CG5A 5GHXA 1SDNA 2EX9A 5FQMA 1QMFA 4FSFA 3NDGA 5BOHA 3WS1A 3NIAA 2OSUA 4IBXA 1XX2A 3LO7A 4B88A 5HAQA 3P98A 5EOEA 3PBNA 1ERMA 1K4EA 5EOOA 1IKIA 3ZNTA 1ES3A 3HBRA 5IHVA 5I94A 3Q7ZA 1BT5A 4S2IA 4ZJ3A 3BECA 1KDSA 2WGVA 4OQIA 3OZHA 5FATA 4UAAA 5HARA 3BLMA 3GRJA 3NBLA 5A93A 3QNCA 2IWCA 4CPKA 3OCNA 4K91A 2ZQDA 3IF5A 1EWZA 1K56A 2HP9A 4OONA 5DTSA 3S22A 1KVMA 2QMIA 3W4QA 3IXBA 3LY4A 3BLSA 3RXXA 5A92A 2EXBA 3Q82A 3HLDA 1E3UD 4YINA 5EECA 1CEFA 3MZDA 2XEPA 5DTTA 3VP0A 3HLEA 4MNRA 5AQ9A 3B3XA 4C6YA 4LCMA 4EBLA 4OQGA 1YLWA 2EFUA 4K0WA 1WE4A 2ZMAA 2IWDA 5FQKA 2WKHA 2R9XA 4PM9A 1JTGA 1JTDA 2J7VA 1BLPA 3DWZA 4KQOA 5AQ7A 3SS4A 3GQZA 3IH9A 5A91A 1K6RA 3MZFA 1GHIA 1IYSA 3C4PA 4WMCA 1ESIA 1Q2QA 3V3SA 2DRWA 1PYYA 5U47A 1CK3A 4XUXA 5CECA 5TFQA 4QD4A 3W8KA 3HUNA 4R23A 3M6BA 5JYPA 4IEDA 4GNUA 4XXRA 4EQIA 1H8ZA 4BLMA 1NY0A 1W79A 3HREA 3ZFZA 3C4OA 1FR1A 2B5RA 5CRFA 1YT4A 3UDFA 3SH7A 2VGJA 4LV2A 3UPPA 3FWLA 5HW3A 4E3MA 1DJAA 3MKFA 1MBLA 3SH8A 2DCFA 3OPHA 1IELA 4JXVA 3A3JA 3ZHHA 1JVJA 2Y2LA 1XA7A 1ESUA 1W8QA 3UE0A 1K25A 3WS4A 1MWUA 4NK3A 4KZAA 5CXWA 3VSLA 1TEMA 1HD8A 2XD5A 3UO9A 4OLGA 5E2HA 4LV1A 2JCHA 3P09A 5FA7A 3MXRA 3GVBA 2HDQA 4JLFA 3QNBA 1QMEA 1IKGA 4GD8A 4RYEA 1NZOA 2G2WA 3GV9A 1W8YA 4PMAA 3UDIA 3VP3A 4S2NC 3MFDA 1PW1A 5JYOA 3HUMA 5AQBA 1BLSA 1I2WA 1GHPA 3AGEA 2FFYA 2QZ6A 2HPBA 4HBTA 3DTMA 4DXCA 2WKEA 4IBRA 1VM1A 4P6BA 3ITAA 1K38A 1C3BA 1M40A 4R3BA 2QPNA 1E3UA 2G2UA 2X71A 3IF6A 5DF8A 2PU2A 2ZC4B 3ZDJA 2EFXA 2R9WA 4EV4A 2WK0A 3A3FA 4WZ5A 2WADA 1KGFA 3BFCA 4F94A 3O88A 2I72A 3W4OA 1BLHA 3AGDA 4A5RA 3BFFA 3BYDA 1FQGA 1IYQA 3ZVTA 1G68A 5DVAA 1LI0A 1S6RA 2HP5A 1ZG6A 2WGWA 4JF4A 4WELA 4B4ZA 2FFFB 4GB7A 1XGIA 3WS0A 5FQQA 3UY6A 1O7EA 4DE0A 3OCLA 4KZ5A 2WZXA 4MBKA 4GZBA 1N9BA 5CHMA 2P74A 1PWCA 1ZKJA 3UPNA 3IH8A 3ZGAB 4GDBA 3IWOA 1LLBA 2XQZA 3DW0A 3HLCA 3M6HA 3W4PA 3PAEA 4DE2A 4DRTA 4QJGA 2J9OA 4GOGA 2EX6A 3PAGA 4WZ5C 4GKUA 3FV7A 3V5MA 5GHYA 2ZQ9A 4NETA 2ZM2A 1HVBA 1YLPA 4HESA 4L0LA 3CMZA 2Y2NA 2X01A 2WAFA 5FASA 2XGNA 4QU3A 4Q8IA 3ZG7B 3O87A 5CGSA 3VMAA 5FI7A 1ES5A 1KDWA 4KZ4A 2EXAA 1ERQA 4OQHA 5FAPA 4JBFA 4BL3A 1CI8A 1EROA 1FR6A 4N1HA 1WYBA 4OH0A 4QHCA 2ZD8A 1NYMA 2BLSA 1GA9A 5GLBA 3N4IA 3C7UA 2ZQCA 3HLBA 3SS5A 2OLUA 3Q1FA 5F1GA 3PTEA 4N1XA 3V3RA 1SDEA 4GDNA 3ZCZA 2Z2MB 2C5WB 2ZC6B 3HLWA 3A3EA 4JF6A 4ZJ1A 3ITBA 4OVDA 4KZ3A 4ID4A 1BSGA 3BEBA 4RA7A 3VP1A 2UWXA 3MBZA 2OLVA 5GLAA 5TR7A 3LY3A 4X55A 5GLDA 2XD1A 5M1AA 3HVFA 1PIOA
chains in the Genus database with same CATH superfamily
3WX7A 1BZAA 2PU4A 4P6ZM 3VH5T 4NG2A 5CPKD 1G6OA 3TG9A 1V9ZA 3T4SA 4Z66D 2AROD 3AN2C 3ULFA 3LR4A 3AZEB 3LGOA 4HJ6A 4X25A 4ARZB 2WKIA 5FQJA 3WD0A 2F2AC 2PDRA 3OC2A 4O7DA 1GSWA 4WM9A 2VJWA 3VOZA 2Y2QA 2ACGA 2W1TB 1GA0A 3FZCA 1HLUP 1G5UA 5EVEA 5B24C 3IF6B 3KSGA 5DNMD 3NHQA 4JJND 3LCEA 1N1JB 3A6NC 3UNWA 1IYPA 4R8PA 5C3IC 4IBKA 4XZQD 5E5AC 5IU1A 2Y59A 1SCWA 3IX3A 4LV0A 4UPKA 4X68A 4KGCC 1PZOA 4Z66B 3WD4A 4ARZA 1FSWA 1WA9A 1HQ3B 3KSIA 4JGRA 4N9KA 5FL3A 3L9KA 3VH6W 3AYWD 3GMWA 1YMXA 4JXWA 4CLCB 3MGQA 2EX2A 2F8ND 1IFQA 5HFOA 4NXEA 4YM6A 5AV8A 2ZC7A 2ZOHA 4KUDB 3AZKD 3T4OA 4WYYA 1OGBA 1UGUA 5DTKA 3ZG8B 3D9YA 3G30A 2Y2KA 2P9VA 1K55C 2CV5B 1OTEA 4Y3IA 1BH8A 1AWIA 3RH8B 4IUHA 5EVID 3ZNYA 3AFAD 1DP8A 3AZNB 5CPKA 3EPHA 2EWWA 1H8PA 4Z66A 4OP5A 2AROA 1KS0A 4I3JA 3V50A 3SOIA 4KZ7A 4YOFA 3FPVA 3M2JA 4HP9A 3MQLA 2VV8A 5CPID 1DP9A 3UTAB 2ZC5B 2H10A 4BD0A 5CEDA 4NXFA 4OOMA 1P3LB 5HL1A 5HX9A 3LEQA 5CGWA 1U35C 5BS7A 4R0QA 3VFFA 3C1CC 3REHC 1P3BB 3GSGA 3LYXA 3ICYA 3T4TA 5DNMA 3BW6A 3CAXA 4HY8A 4JJNA 1Y54A 1NWZA 2Y8HA 4N92A 1IYOA 2GDNA 5DNND 4XZQA 4NYYA 3REKC 3W98D 4I5SA 4IBEA 3AZJD 3EQUA 5EVIB 4DXBA 3AV2C 3LICA 1KX3C 1H3OB 4JF5A 4E3LA 1D06A 2A3UA 3AYWA 3AGFA 3VH6T 5B0YA 2QJ5A 1RP5A 2F8NA 4HBUA 4H9RA 4HIAA 3UE3A 3AZKA 1VEUB 2Y2GA 5G49A 1X0OA 5AY8C 2E8IA 3K3DA 2PT7A 3GECA 1W5DA 4KG5A 3V39A 3NJAA 4E6XA 5EVIA 4P0MA 3AFAA 1AOIC 3SZTA 2XR0A 3FC7A 4KQRA 3Q7VB 1F66D 3TU4C 3S4XA 1E4DA 5EV0A 5HAPA 1VETA 5G18A 3JYIA 1MWSA 4OOLA 2W3EA 4LV3A 5CPIA 1F98A 3X1VD 4S2OA 1P3MD 2L5AA 2HIOC 3W97B 4H9OB 2V5OA 3UT9D 3N8LA 2P04A 4TX8A 5CP6B 1E25A 3KS8A 2EX8A 1YLJA 5GLCA 2UV0E 2V1ZA 3UB5P 1M18B 1PZPA 5CHUA 4L9EA 1P3GB 1CEGA 3NDEA 4GS9A 4WEJA 3R7WA 5CERA 5DNNA 1Y4OA 3VP4A 1MKMA 3W98A 3AZJA 1K57C 3N8RA 4LD9C 3TW8A 1LL5A 4JXSA 4EO5B 4KENB 1TS0A 1JWZA 1TAFB 4DRBA 3NI9A 4BENA 3B0DC 1EQZD 5EE8A 2O99A 3X1VB 1Z6FA 4YNRA 4MEZA 3IXHA 5FI6A 3OPPA 2Y4AA 5F83A 4B9OA 4O8GA 1L3LA 2J9PA 1FIKA 5HPIA 5EPHA 1N4OA 5FAOA 4YM6C 5AV8C 2ZY2A 3X1UC 4OJPA 1NLYA 3CLOA 1F66A 4XT2B 4BMWA 4WNNB 1BFMA 2H0TA 5FSRA 4MN5A 3WS2A 3WD3A 5F99D 4BJPA 1LI9A 5F5YA 5JRGB 4WEKA 1O6IA 2HUEC 1P3MA 3VSKA 1LSXA 5AVCD 3UT9A 4Z2MH 1EQZB 3QHYA 4RVAA 1KU5A 3HLFA 3ZG9B 3QP2A 5FQMA 2V8CA 1QMFA 5BOHA 1OPXA 2OSUA 1WWIA 5HAQA 3LO7A 1CQAA 1K4EA 3ZNTA 1ES3A 3B6FC 5IHVA 2L0WA 2V9AA 4J8VB 2XRNA 1PZRA 3T4JA 1G28A 1YUEA 4L9FA 5AV5D 3NBLA 5A93A 3QNCA 3OOVA 2IWCA 4HQAA 4KHAB 4K91A 4H9NA 4NEED 2HP9A 3EGDC 3S22A 4OONA 3W4QA 3MVDD 2G5HC 2E8JA 2JKTM 2M7VA 3H0MC 5A8BA 3M7PA 2XEPA 3BY8A 2K31A 4MNRA 5AQ9A 1WWSA 1F1EA 4UUZB 5AV6C 3CI6A 4K0WA 5EM1A 3AYWC 2R9XA 2WKHA 5B0YC 1JTGA 1JTDA 2J7VA 3PHYA 3C1BB 2VV7A 3LZ1C 3IP4C 4Z5TC 3MZFA 3NOPC 4J8XB 4G92B 3C4PA 3AZKC 3MSHA 3UMEA 1ESIA 4GLQA 1P9WA 4QD4A 3HUNA 3M6BA 1KOUA 4NZ3A 4XXRA 5F99A 2XSSA 5BNXA 1W79A 3ZFZA 4CSRA 3B42A 1Y28A 5AV9D 3O62B 1TZYB 3UDFA 5HW3A 3KYEA 2LB5A 1DJAA 5AVCA 3MKFA 4JXVA 2A24A 1JVJA 2Y2LA 2FJ7B 4H9QB 1K25A 2VGLS 3WS4A 2BYMB 3LZ0D 2DQNC 3VSLA 3WKJB 3KWQB 4GHLA 1TEMA 5DFXA 1LSVA 1MZUA 3MGPD 4OLGA 4LV1A 2JCHA 3MXRA 2HDQA 2MJ6A 1QMEA 5AV5A 1W8YA 1PW1A 5B32G 3HUMA 1BLSA 1I2WA 2B18A 5HL6A 1GHPA 3A0RA 3DTMA 5DNNC 2WKEA 4IUKA 3MVDA 3TE8A 3RELC 1C3BA 4R3BA 4DQYB 1H8MA 4EW7A 3B6GB 2WK0A 2NQBC 2JN7A 3O5YA 5B31C 2WADA 4WL9A 3A6ND 3BFCA 1BLHA 2PD8A 3BYDA 4M6BA 4F3LA 5DFYA 4AFIA 1S6RA 1XGIA 4DRAA 4KGCD 2WZXA 3AN2B 4QNLA 2W27A 4GDBA 4DE2A 3DW0A 3IS2A 3M6HA 5CPJA 1DRMA 3PAEA 3R45A 3R4KA 5AV9A 4R38A 3V5MA 5GHYA 1P3FD 2ZQ9A 1HVBA 1F66C 3CMZA 2Y2NA 4QU3A 1YSPA 3AZFC 3VV4A 3O87A 5CGSA 5B24B 4H6JB 5FI7A 2EXAA 1ERQA 4NFTA 5FAPA 4BL3A 3LZ0A 1CI8A 4N1HA 1WYBA 4QHCA 5C3IB 4RQ9A 1P3MC 3C7UA 3MGPA 3HLBA 4MMNA 1A7WA 5E5AB 3Q1FA 4Z2GA 3PTEA 4N1XA 4GCZA 3VE4A 4GDNA 2ZC6B 3HLWA 2L1MA 4Y5FA 4ZJ1A 5KDMB 3ITBA 4OVDA 4KZ3A 1KX4C 1BSGA 4RA7A 4GHIB 2UWXA 1U35D 2XD1A 4NE6A 3REHD 3AV1C 4QLCC 4H6JA 1HTZA 3D3OA 3EOIA 2ZQAA 4Y0UA 4MBFA 3A6NA 2C6WB 1FCNA 1W7FA 5B40B 1JWVA 1LSWA 5KZHA 5KSCA 1P3KC 1FOFA 1T18A 5B32D 1P3AA 1D7EA 3AV2D 3HL9A 1KX3D 4KGCA 1W63M 2RL3A 4GN2A 4ZUXB 3WRZA 2BASA 4GH9A 3UTBC 2VEAA 5IS1A 3KXBD 5E2GA 3GR2A 4MN6A 4RX3A 4QY5A 4KZBA 1L0FA 1XGJA 3OPLA 1H5XA 3G4PA 1H3QA 1P3FA 2Y79A 4Q0HA 3W99B 3REJC 5AY8D 3T12B 1U35B 5AVEA 3C1CB 2JKGA 2QWSA 3LIFA 4R3JA 1K55A 3F1PB 2JE5A 1OTIA 1IEMA 2PD7A 2WGWB 4XUJC 4BD1A 1NZUA 1YQSA 4ZBJC 4QB8A 1I2SA 4E6WA 1M1AC 1AOID 3AZLB 2WZZA 3REKB 4EETB 4EERA 4UA9A 4QWOA 1MY8A 5AVCC 3IHAA 1O07A 1G6AA 2AVXA 2JKRM 4I3AA 4HEFA 4E3NA 1DJBA 1EI5A 2B95A 5CEBA 3G32A 4C3QA 2HIOD 3VOLA 4X69A 5B1MB 3UPOA 5M18A 5L2FA 3REHA 3ZVWA 2Z2LB 3G34A 3BFDA 2H5SA 1XXMA 4X53A 4KZ9A 2J8YA 2HDSA 2Q0OA 4JGOA 1K6SA 3NQUB 4WU9C 2K7SA 1J9MA 2JHEA 2PYOD 4WBGA 1W1VA 2NUPC 3CPTB 5J7EA 3CHWP 5B32A 2Y2OA 5GT0C 3AV2A 4YWZA 5E2EA 1YSQA 1KX3A 4LD9D 1PI5A 1AOIB 4IBCA 3TU4B 2D02A 1WYCA 2IO5C 3KXBA 2ZM0A 4Q0IA 2WUQA 4X56A 1EAKA 1CF0A 5F1FA 3PBSA 1MKIA 1P34C 3EPLA 1KGEA 4BL2A 2VX8A 4IBBA 5AY8A 3MQQA 3WAAC 4II7A 2ZQ8A 3C7VA 2Q9NA 5GT3C 5CPJC 4HH3A 2A49A 3QP4A 1XPBA 3X1UD 4WU8D 1AOIA 1W1PA 5J8XA 3UB8A 5L07A 2O9BA 4IBFA 4DE3A 4UA7A 5B2JA 1W2EA 2W3FA 4LD9B 5M19A 1PDCA 4DN0A 5BPVA 3LZ0C 2VKSA 2ZBBA 2ZL1A 3MKEA 3DWKA 3WD2A 4R8PB 2HIOA 3MGPC 3B0DB 1P3PC 4ETXA 3L2AA 4E3OA 2ZC3B 4UHUA 1RGZA 2PYOA 2Y2MA 3BFEA 5B31G 3B6FD 2QJ7A 4EBPA 3AL0C 3MGQB 1K54C 1K57A 2WGIA 4ZDXA 2OV5A 3RTYA 4YM6B 3GTCA 5AV8B 3VP2A 4LD9A 1YLYA 1P3OC 3WA9D 2Y2IA 5TJJA 4EBNA 4GHAA 4YS3D 2EWVA 3LIBA 1KVLA 2P9VB 2KDKA 1KGGA 1OTAA 2HP6A 1BH8B 4Z2KA 1ONHA 2YFWA 1P3AC 1XJ4A 1BUEA 2HUEB 5CPKB 1GSVA 3LI9A 2V8FA 3SS3A 3FYZA 2AROB 1L2SA 5AV6D 5B0YD 5G4YA 1J3WA 5FDSA 1TD5A 4CQHA 3LZ1D 4Z5TD 4LCLA 1K0KA 3X1UA 4WU8A 1P3FC 3KFUG 3TOIA 3T1XA 1TS8A 4G3WA 4WF0A 5AVBC 4HP4A 1LL9A 1AXBA 2GJ3A 5L10A 4EQ1A 1U60A 5DNMB 4JJNB 1T3UA 2INWA 2V1AA 1RCJA 1HZOA 4B4XA 3HONA 1I5QA 4ESPA 4XZQB 1XFQA 2JSSA 4C75A 5GXQD 3MNNC 4E44A 2W3HA 3LELD 1Q2PA 3RFBA 4Y0TA 4KG2A 1E15A 3A0VA 3AYWB 4DF6A 1M6KA 5B0YB 4O01A 2KX6A 5HDDA 5HWVA 3B6FA 4Z9QA 1DY6A 3K2NA 5CHLB 2F8NB 3G2ZA 3EG5B 4IBGA 4H9RB 3AZKB 4ZAMA 5G49B 5F69A 3WA9A 3FKVA 5GSUC 2DNSA 4YS3A 1UR9A 3HUOA 3AZMC 1XKZA 5AQAA 3RELD 2BG1A 1T1AA 2VGLM 5B32C 1S32C 3AFAB 2NQBD 1E6ZA 2IOUA 5B31D 3NIAA 4IBXA 4B88A 5AV6A 3CWFA 3PBNA 3MGSD 1IKIA 3T1SA 5HD5A 3HBRA 3KXBC 5I94A 1VETB 4EUVA 3Q7ZA 4ZRRA 2WGVA 3LZ1A 4Z5TA 5CPIB 4MN7A 4HMEA 3S7NA 4CPKA 3REID 5DTSA 2QMIA 3LY4A 3NQJA 4J8UC 2FN2A 3HLDA 3OBFA 4UEYA 3B47A 3VP0A 3D72A 4LCMA 1YLWA 2EFUA 4GS9B 3R7WB 1WE4A 2ZMAA 2IWDA 5DNNB 5FQKA 5BNVA 3W98B 3AZFD 3AZJB 3IH9A 2WKPA 5GXQA 3S7PA 1K6RA 5B2JC 3LELA 1GHIA 1IYSA 4HMCA 5B31B 4HNBA 5U47A 1CK3A 5CECA 3AZGC 4R23A 1M19C 3NULA 4IEDA 4WLAA 5L8MA 1H8ZA 4BLMA 4NZ5A 1FR1A 2JKRI 5CRFA 3H82A 2VGJA 2NZDC 1KX4D 1JFIA 3S7OA 2PYOC 3OPHA 3L27A 4HGAC 3RELA 1DP6A 3E4QA 1W8QA 3AV1D 4QLCD 1BH9A 2NQBA 4O0PA 4NK3A 5B31A 2W1RA 1F66B 3MGSA 2XROA 1P3KD 2PYRA 4JLFA 2JKFA 4GD8A 4RYEA 1NZOA 2G2WA 3GV9A 3UDIA 4LPZA 3W2ZA 3MFDA 5JYOA 1KX5C 3HJKA 1P3MB 3REIA 3UTBD 1B67A 3UT9B 1SZVA 4OUIA 1K38A 1Z2CB 1M40A 4E45A 4FTXA 3ZDJA 3KX0X 2G7UA 1KGFA 4PAUA 2RVQC 3P7NA 3REJD 4WU8C 2W3GA 3T4QA 3W4OA 3AZEC 2BTFP 3AGDA 3AZFA 3ZVTA 3AV1B 2W8SA 2HP5A 2GNXA 3S7QA 2FFFB 4XUJD 3UY6A 5HDCA 4KZ5A 1M1AD 1P3ID 4MBKA 3P01A 3F1OA 4H9NB 4Z2HA 1PWCA 3ZQ5A 3IWOA 1LLBA 3VE3A 3W4PA 1GSXA 1OJ5A 4DRTA 4BWIA 2J9OA 5EFWA 3FV7A 4NETA 3L29A 1KX4A 4HESA 4L0LA 4Z1WA 2KOIA 2WAFA 2XGNA 3PYPA 3AZID 3AV1A 4UQIS 4QLCA 3W96D 2BYKA 1NYMA 5BO0A 4Y13A 3WA9C 4WU9D 4OJLA 2OLUA 4YS3C 4CLCC 5B33C 1P3KA 5F99B 1SDEA 5BNXB 5GT0D 4CSRB 3F1NA 5HWTA 2G5IC 2ZMVA 5AJGA 3UTBA 3DTIA 5AVCB 5TR7A 5GLAA 4FOFA 3LY3A 2A24B 5F6AA 1BYWA 4PM6A 1XFNA 2HJEA 4QPRA 3KUYD 1P34D 1CXWA 2HF6A 2JC7A 1KE0A 3REJA 4E04A 1FCMA 4X6TA 3EEHA 4P85A 3WAAD 3KYZA 4U0TA 4YFMA 4OJOA 3NOTC 4KG6A 1ODVA 4I3IA 3X1SC 1YMSA 5GT3D 1LHYA 3G2YA 5CPJD 4DJ2A 4E3KA 4XUJA 5AV5B 4FH4A 5HD3A 5FAQA 1M1AA 1P3IA 1T1CA 1L0EA 4PM5A 3CJMA 4I38A 4LGWA 2XH9A 5F68A 3M2KA 3MVDB 1TDGA 5HAIA 3N8SA 2PBYA 1YM1A 5GXQC 3LELC 3G31A 4KZ6A 3HSHA 3WS5A 2IO5B 1LL8A 3LIDA 4FCFA 3D4FA 5B0ZC 1P3PD 4F3LB 3AZIA 1OTBA 4H9PB 3W96A 3H9WA 3LR3A 4G3KA 1E8BA 3IBJA 1E88A 1YU0A 2QKPA 3EPKA 3KSFA 1EW0A 2J3WA 4WU9A 3MMHA 3H0LC 3X1TD 4Z2MG 1GHMA 3IS2B 5CPJB 4XUZA 3R45B 5GT0A 5CGXA 5AV9B 4OPZA 5DF9A 1P3OD 4OJ5A 4NE5A 3L28A 4Z2JA 2HV1A 2OWJA 5FI2A 3MGSC 5LBRA 3IXDA 1OMEA 1Q9CA 4E3JA 3E2KA 4H9PA 1P3AD 2ZOIA 3KUYA 1P34A 3LZ0B 4BQMA 2JBFA 3IX8A 3REIC 3MGPB 3WAAA 4R4SA 4X1MA 3WWXA 5CHJA 2HDUA 4S2KA 5GT3A 4HH2A 2PYPA 2ZY3A 5CTNA 2V0WA 3W97C 5I5LA 3LJAD 1OT9A 5CP6C 3LUQA 5AVBD 2XFTA 4OJ6A 4NXGA 2O0YA 3UDXA 1M18C 4G91C 3IXGA 3A6NB 5G4ZA 2D49A 2XDMA 1TDLA 2HJ9C 1P3PA 1F5MA 4DJ3A 1P3AB 3MNND 4R70A 2M1CA 2OAP1 1L0GA 4KGCB 2XK1A 5CTMA 1S1ZA 3X1TA 2VGKA 1K54A 2Y2HA 3WRTA 5JA4A 3V9RA 1P3OA 1P3FB 1YPRA 1F2KA 5GSUD 1STZA 3B33A 3OLOA 4WV4B 4U0XA 2B02A 3AZMD 2H28A 1MXOA 2WKRA 4OP8A 1S32D 2Z6CA 3L7HA 2F8NH 3PBOA 4NKPA 5DJUA 3RJUA 1H8YA 4OPQA 1L0DA 3G35A 2YFVA 1YLZA 3MNNB 1E6PA 4NZ4A 3FG8A 2YKFA 5FQ9A 3S1YA 1VB6A 3IWIA 4RX2A 1YKDA 3ISGA 5EVLA 3LJAA 2QHKA 3WTPD 2HGVA 4DE1A 5AVBA 3A0SA 3REHB 4DKIA 5IT5A 4JKTA 4J8UD 1KE4A 4S2NA 3KSHA 1E6RA 4WN5A 3LIAA 1OTDA 4MB4A 2X02A 1P9RA 5FQIA 4IVKA 3WD1A 1UWNX 3EWKA 1P3IC 2ZJ9A 1BTLA 2ZLYA 4J8VC 4LFUA 5B32B 3MNNA 3AV2B 1QO6A 5B2JD 5DKKA 4J8WC 1KX3B 4Y2FA 4PM7A 3NY4A 1ZLAA 3AZHD 3AZGD 1K56D 1M19D 2ZM5A 1ONGA 3KXBB 2PR6A 5HDSA 2OAQ1 4QY6A 3AZIC 4H8RA 3TJZC 3W96C 4OLDA 4D2OA 2NZDD 1KE3A 5AY8B 5GSUA 3BQ8A 2Y91A 3SH9A 2J80A 3AZMA 1F9IA 1RGYA 3I7JA 3C5AA 3UN7A 1ID3C 3IX4A 4J8XC 1S32A 3PBQA 4WMCD 3SW1A 2Y55A 1VQQA 3O86A 1V9YA 4FH2A 4ZTKA 2Y2JA 5MC7A 4CAYA 4R4RA 5B2JB 3O62C 2JKTI 4Y7PA 1TZYC 2ZQ7A 4EWFA 3KUYC 1KX5D 5FEFA 2ZL1B 3C2WA 3BRMA 1S0WA 4S2PA 2HIOB 2NUTC 3WTPA 1Z09A 1T1BA 1FILA 1MWTA 2FJ7C 4LRYC 4J8UA 4K0XA 1GXDA 1N9OA 1NXYA 1OT6A 3CG5A 1SDNA 1PFLA 4FSFA 1IOUA 2RVQD 3P98A 2PYOB 1ERMA 2O9AA 3AZED 4EEUA 3A1IA 1KDSA 4OQIA 3OZHA 5CX7A 1L6JA 4Z2IA 3BLMA 5TBMB 2QYBA 2KLIA 3AZHA 3AZGA 2ZQDA 5B1LA 2CWEA 1K56A 1M19A 3BLSA 2EXBA 1E3UD 1VHMA 5EECA 1CEFA 2YFWB 3HLEA 3C30A 2NZDA 3B3XA 3FPWA 3IBRA 4OQGA 4WZSB 3X1TC 5AQ7A 1BLPA 3SS4A 3GQZA 4AWLC 4WMCA 5TBMA 1Q2QA 2DRWA 1HQ3D 3X1UB 4WU8B 3KS4A 1PYYA 4XUXA 5TFQA 3W8KA 1S4SA 3H7WA 2I9VA 4CLCD 3T4LA 5B33D 3PXPA 2V0UA 5B2IC 3C4OA 4KUDD 5BT1C 2GX5A 1YT4A 3T4KA 3UPPA 4LV2A 1KX5A 3FWLA 1UWPX 1D1JA 3SH8A 2CV5D 1IELA 4B93A 2WKQA 1XA7A 4UQIM 3QP8A 3DBAA 3AZND 1MWUA 3EEAA 1HD8A 2XD5A 4MB3A 3AZEA 3P09A 3LJAC 2PRFA 3GVBA 3B6FB 3X1SD 3MS6A 3VP3A 3UTAD 4S2NC 2M7UA 2W0NA 1XJ6A 3WA9B 1P3LD 2QZ6A 4YS3B 4HBTA 4ETZA 2IA2A 5B33B 4HI4A 4JGQA 2W1TA 4IBRA 1P3BD 4P6BA 3ITAA 4H9SC 2QPNA 1E3UA 3IF6A 3NOUC 5DF8A 4EV4A 2EFXA 2R9WA 4EXOA 3A3FA 1N1JA 3E98A 4HHDA 3MJQA 4G3VA 4F94A 5B40C 3O88A 5AV6B 4LLOB 1ZLAC 2VV6A 3QP1A 2J3TC 4A5RA 1FQGA 1G68A 5DVAA 1LI0A 5B0ZD 1ZG6A 4JF4A 4GB7A 3WS0A 3LZ1B 4Z5TB 1O7EA 3OCLA 4ZUXC 1HQ3A 1N9BA 5CHMA 1S66L 2P74A 1ZKJA 4CLCA 3IH8A 5B33A 3X1SB 2XQZA 5EM0A 3HLCA 5DKLA 3NQJB 3T1RA 4KUDA 4GOGA 2EX6A 3PAGA 4HJ3A 4WZ5C 2DF4C 3LR5A 4GKUA 3W99C 4BBVA 3U4LP 3K3CA 1T19A 2CV5A 5BNVB 1PRQA 2PBDP 3V67A 1ES5A 5GXQB 4KZ4A 4OQHA 3LELB 5AVFA 3AZNA 1EROA 1FR6A 1TS7A 2ZD8A 3AZLC 3JVUA 3UMDA 1R4VA 5F1GA 3V3RA 5B0ZB 3WTPC 3VH5A 3X1SA 3MGRC 1NLZA 3UTAA 3A3EA 3LIEA 4X23C 2RIQA 1UR8A 3H82B 1ULYA 1P3LA 1CJFA 4ID4A 1JFIB 3W97D 1GOIA 3VP1A 2VA0A 3MBZA 2OLVA 5B1MC 1ZHHB 1P3BA 4X55A 5CP6D 3HVFA 2EA9A 3RELB 2XA7S 1N9NA 5J4EA 1BH9B 3BFGA 4BBTA 1M18D 2NQBB 5DF7A 5HZHA 1P3GD 2HDRA 3EQVA 1E6NA 3UB6A 3AZHC 3MGSB 5B1LC 3DAVA 1MWRA 5B0ZA 1XJ3A 3TSGA 1H3OA 4OPYA 4HMDA 1PW8A 2WAEA 3REIB 5HWWA 1MPLA 4U3TA 4KQQA 1VEUA 4UA6A 3ZG5A 2V20A 2K2NA 2PR5A 4PKYG 5A90A 1S4RA 1TVFA 4DMZA 3AZFB 4GD6A 1MC0A 3CUEA 3VOYA 4G91B 4KUOA 5TGFA 3BWLA 3Q7VA 3WTPE 1LT0A 3JVVA 3F1OB 1YLTA 3ZG0A 4DDYA 4EU0A 4NXBA 1NJ4A 3B0BA 1PI4A 2LB9A 3NC8A 5JRGD 3HLGA 4R3AA 1XA1A 4MB5A 4CJNA 2CC1A 4R8PC 1KX4B 3W97A 4H9OA 3A3DA 5CP6A 3CITA 1SKFA 4QLCB 3BM6A 4JXGA 4P6ZS 1M18A 1XP4A 1P3GA 2BYKB 5BO0B 3VFHA 2Y2PA 3B0CW 3BQAA 3MGQC 2FZ0A 3P5JB 4J8VD 3JPUA 4FUWA 2RTSA 3LR0A 1P3KB 3PBTA 1NRFA 3IF6C 2J8PA 3F1NB 4J8WD 4MLLA 4ZBEA 5F82A 1J7MA 1TAFA 3UTBB 1BLCA 1SKOB 4ZJ2A 1OGGA 1ZG4A 2V2FF 2XLNA 3X1VA 5HPFA 1DJCA 5L09A 4OKPA 1XJ2A 5CPKC 1PNEA 2ZM8A 4Z66C 3VH6A 3OPRA 2AROC 1HQ3C 3REJB 5KSHA 4NZ1A 4DDSA 1YAXA 1HTAA 1NYYA 3C1BD 1ID3D 2DMWA 4J8XD 4KUDC 4Q0JA 4XUJB 2D01A 4EUZA 4LRXC 3UE6A 4ZBJB 3U2AA 4XT2A 1M1AB 1JWPA 2XF3A 4WNNA 1P3IB 3E2LA 5BS7C 1SKOA 4WUJA 1CK7A 3C38A 2CV5C 5EUAA 3T1QB 4Y15A 4IHQA 5DNMC 3O62D 3PR6A 4J8WB 4JJNC 5JRGA 1TZYD 1ALQA 3AZNC 3PBRA 3IWQA 4XZQC 1EQZA 1B6WA 2FH5A 2FJ7D 3AZIB 2Q9MA 3W96B 3BY9A 5FUGB 4S2LA 3UTAC 2VQRA 3WKJD 3KWQD 2HZ5A 1P3LC 4WU9B 1YU3A 4LG2A 3A3IA 3KYQA 4I39A 3B0CT 3H0RC 4JPMA 4J8VA 2LY8A 1ID3B 3FKWA 4WZ4A 1P3BC 3F6TA 4MBHA 1YU4A 5GT0B 1S1YA 4IJEA 2CMNA 4HOIA 5HSQA 4J8WA 3NCKA 4KHAA 2PHYA 3UB9A 4WJ3C 2RCXA 1PWGA 5EVIC 3O3VA 3AFAC 2P7JA 3B6GD 3RXWA 4KZ8A 3IQAA 5FUGA 3KUYB 1P34B 4LRZE 3CZDA 4PM8A 4PPRA 2ZMFA 4R1GA 4FD8A 5GHZA 3GDIA 4UUZA 4CLCE 4PHTA 3WAAB 1GCEA 4N9LA 4HJ4A 3C1BA 4M3KA 1ID3A 5GT3B 2P08A 2VLGA 3DTEA 4E3IA 1FCOA 2GZAA 5CPIC 4J8XA 2WYXA 3N3FA 2IWBA 4NYUA 3L26A 3AN2D 2Z6DA 4GW9A 1K4FA 3HJIA 3MXSA 1FSYA 1N9LA 5B2ID 2H0YA 2YKHA 2F8NK 3O62A 4GJ4A 4PKYA 5K5BA 3CUEC 5BT1D 1TZYA 5E2FA 4LENA 4NE3A 1H0MA 4S2MA 4S2JA 4OQ0A 4Y0OA 1CI9A 4OOYA 1PWDA 4MDZA 3W98C 2VZWA 5FDHA 3AZJC 2VK3A 4OPRA 2FJ7A 5B24D 1P3PB 4H9QA 3IHBA 3G6OA 3N6IA 2BYMA 4Y17A 1ES2A 4IVIA 3WKJA 4NY2A 3Q81A 3KWQA 5DJTA 3TRCA 3UE1A 3DTKA 1BULA 5E5AD 3X1TB 5KMWA 3FKEA 1ZC2A 3E0YA 3Q07A 4D60A 2XFSA 4Z2LA 4AWLB 5E43A 5JA4B 3V9RB 1P3OB 3LEZA 3MZEA 4P87A 1NRJA 1SHVA 1P3GC 1ES4A 3IT9A 3N7WA 5GL9A 5B2IB 5D3OA 1P97A 5GHXA 4IBJA 2EX9A 3B6GA 3NDGA 3WS1A 2OWHA 4EO5C 1XX2A 5B40D 5EOEA 5EOOA 1ZLAD 4IBDA 2J3TD 3FDDA 1BT5A 4S2IA 4ZJ3A 3BECA 2YFVB 5FATA 4UAAA 3E4OA 3X1VC 1W63Q 5HARA 3GRJA 5J3WA 4ZUXD 3AN2A 4M4XA 3OCNA 3IF5A 3E4PA 1EWZA 3UT9C 3LJAB 1KVMA 3IXBA 3RXXA 5A92A 5AVBB 3LFVA 1S67L 3Q82A 5B2IA 4YINA 4JGPA 3MZDA 3HCYA 5DTTA 4KUKA 3W99D 4C6YA 4EBLA 2PAVP 1GPFA 3C1CD 3KO6A 4PM9A 3DWZA 4KQOA 5B24A 1YU2A 5A91A 1W1YA 3EPJA 1JNUA 4IBIA 5JRGC 3V3SA 1TF1A 3MF0A 3AZLD 3REKD 1ZLAB 5JYPA 5E5AA 4GNUA 4EQIA 1EQZC 5C5KA 1NY0A 3HREA 3MGRD 1OJGA 2B5RA 5KDMA 2ZY5A 4X23D 2ZY4A 3SH7A 3ZYTA 4E3MA 4GHIA 5GSUB 3L25A 1MBLA 1H0GA 2DCFA 5B1MD 3KSYA 3A3JA 3ZHHA 3AZMB 1ESUA 4H9SA 3UE0A 1S32B 3NECA 4KZAA 5CXWA 4BBUA 5B40A 3UO9A 4ME4A 5E2HA 5FA7A 4CAYB 5B1LD 5F99C 3QNBA 1IKGA 4PMAA 4X1LA 4ZUXA 3TU4D 5AQBA 3AGEA 3MQOA 2FFYA 2HPBA 4L9GA 4EESA 4DXCA 3WTPB 1VM1A 2XA7M 3LI8A 3MGRB 2O9CA 3C1BC 4J8UB 2X71A 2G2UA 3VH5W 2PU2A 1AIWA 2ZC4B 4X23B 1TS6A 1H0IA 4G92C 3QP6A 4WZ5A 3UB7A 3W99A 1U35A 2I72A 3C1CA 3BFFA 4MCWA 3F1PA 1IYQA 1A0KA 2WGWA 4WELA 4B4ZA 5AV5C 5FQQA 2W3DA 5FEGA 4DE0A 2L4RA 3AZLA 1YU1A 4GZBA 3REKA 3AZHB 3AZGB 5B1LB 3QP5A 1M19B 3UPNA 3T50A 3MVDC 3ZGAB 4QJGA 2R78A 3C8CA 3MGRA 1P0ZA 4X23A 2F8NG 4R6LA 2ZM2A 3A1KA 2NZDB 4IJFA 4R8PD 3WKJC 1YLPA 3KWQC 1ZTUA 2X01A 5FASA 5B1MA 4Q8IA 3ZG7B 3MR0A 4HGAB 3VMAA 1KDWA 4JBFA 4OH0A 2BLSA 3NQUA 1GA9A 2OOLA 3MFXA 5GLBA 3N4IA 2ZQCA 3SS5A 1ED7A 3H7WB 3CPTA 3MGQD 1W1TA 1ACFA 4YM6D 5AV8D 3ZCZA 2Z2MB 5AV9C 2C5WB 4JF6A 3B6GC 3TU4A 4EEPA 4IJGA 2V1BA 4K08A 3EGXC 3BJNA 4KQDA 1KX5B 3BEBA 3MXQA 5KIZA 3MQ0A 5GLDA 5M1AA 2A2LA 1PIOA
chains in the Genus database with same CATH topology
3WX7A 1BZAA 2PU4A 3VH5T 5CPKD 3TG9A 4Z66D 2AROD 3AN2C 3AZEB 2WKIA 5FQJA 2F2AC 3OC2A 4O7DA 4WM9A 3VOZA 2Y2QA 3FZCA 1GA0A 5B24C 3IF6B 5DNMD 4JJND 3LCEA 1N1JB 3A6NC 3UNWA 1IYPA 4R8PA 5C3IC 4IBKA 4XZQD 5E5AC 2Y59A 1SCWA 4LV0A 4UPKA 4X68A 4KGCC 1PZOA 4Z66B 1FSWA 1HQ3B 4N9KA 3VH6W 3AYWD 3GMWA 1YMXA 4JXWA 3MGQA 2EX2A 2F8ND 5HFOA 4YM6A 5AV8A 2ZC7A 4KUDB 3AZKD 4WYYA 5DTKA 3ZG8B 3G30A 2Y2KA 2P9VA 1K55C 2CV5B 1BH8A 5EVID 3ZNYA 3AFAD 3AZNB 5CPKA 3EPHA 4Z66A 4OP5A 2AROA 3V50A 3SOIA 4KZ7A 3M2JA 5CPID 3UTAB 2ZC5B 2H10A 4BD0A 5CEDA 4OOMA 1P3LB 5HL1A 5HX9A 5CGWA 1U35C 5BS7A 4R0QA 3VFFA 3C1CC 3REHC 1P3BB 3GSGA 5DNMA 4JJNA 1Y54A 4N92A 1IYOA 2GDNA 5DNND 4XZQA 4NYYA 3REKC 3W98D 4IBEA 3AZJD 3EQUA 5EVIB 4DXBA 3AV2C 1KX3C 1H3OB 4JF5A 4E3LA 2A3UA 3AYWA 3AGFA 3VH6T 5B0YA 1RP5A 2F8NA 4HBUA 4H9RA 3UE3A 3AZKA 2Y2GA 5G49A 5AY8C 2E8IA 1W5DA 4KG5A 3V39A 4E6XA 5EVIA 4P0MA 3AFAA 1AOIC 2XR0A 4KQRA 3Q7VB 1F66D 3TU4C 3S4XA 1E4DA 5HAPA 5G18A 3JYIA 1MWSA 4OOLA 4LV3A 5CPIA 3X1VD 4S2OA 1P3MD 2L5AA 2HIOC 3W97B 4H9OB 3UT9D 3N8LA 5CP6B 1E25A 3KS8A 2EX8A 1YLJA 5GLCA 2V1ZA 1M18B 1PZPA 5CHUA 1P3GB 1CEGA 3NDEA 4WEJA 5CERA 5DNNA 3VP4A 3W98A 3AZJA 1K57C 3N8RA 4LD9C 1LL5A 4JXSA 4EO5B 4KENB 1JWZA 1TAFB 4DRBA 3NI9A 4BENA 3B0DC 1EQZD 5EE8A 3X1VB 1Z6FA 4MEZA 3IXHA 5FI6A 3OPPA 2Y4AA 5F83A 2J9PA 5EPHA 1N4OA 5FAOA 4YM6C 5AV8C 2ZY2A 3X1UC 4OJPA 1F66A 4WNNB 1BFMA 2H0TA 5FSRA 3WS2A 5F99D 4BJPA 1LI9A 5JRGB 4WEKA 2HUEC 1P3MA 3VSKA 5AVCD 3UT9A 4Z2MH 1EQZB 3QHYA 4RVAA 1KU5A 3HLFA 3ZG9B 5FQMA 1QMFA 5BOHA 2OSUA 1WWIA 5HAQA 3LO7A 1K4EA 3ZNTA 1ES3A 3B6FC 5IHVA 4J8VB 1PZRA 1YUEA 5AV5D 3NBLA 5A93A 3QNCA 2IWCA 4KHAB 4K91A 4H9NA 2HP9A 3S22A 4OONA 3W4QA 3MVDD 2G5HC 3H0MC 2XEPA 4MNRA 5AQ9A 1WWSA 1F1EA 4UUZB 5AV6C 4K0WA 3AYWC 2R9XA 2WKHA 5B0YC 1JTGA 1JTDA 2J7VA 3C1BB 3LZ1C 3IP4C 4Z5TC 3MZFA 4J8XB 4G92B 3C4PA 3AZKC 1ESIA 4QD4A 3HUNA 3M6BA 4NZ3A 4XXRA 5F99A 5BNXA 1W79A 3ZFZA 4CSRA 5AV9D 3O62B 1TZYB 3UDFA 5HW3A 1DJAA 5AVCA 3MKFA 4JXVA 1JVJA 2Y2LA 2FJ7B 4H9QB 1K25A 3WS4A 2BYMB 3LZ0D 2DQNC 3VSLA 3WKJB 3KWQB 4GHLA 1TEMA 3MGPD 4OLGA 4LV1A 2JCHA 3MXRA 2HDQA 1QMEA 5AV5A 1W8YA 1PW1A 5B32G 3HUMA 1BLSA 1I2WA 1GHPA 3DTMA 5DNNC 2WKEA 3MVDA 3RELC 1C3BA 4R3BA 4DQYB 3B6GB 2WK0A 2NQBC 5B31C 2WADA 3A6ND 3BFCA 1BLHA 3BYDA 4M6BA 1S6RA 1XGIA 4DRAA 4KGCD 2WZXA 3AN2B 4QNLA 4GDBA 4DE2A 3DW0A 3M6HA 5CPJA 3PAEA 3R45A 5AV9A 3V5MA 5GHYA 1P3FD 2ZQ9A 1HVBA 1F66C 3CMZA 2Y2NA 4QU3A 3AZFC 3O87A 5CGSA 5B24B 5FI7A 2EXAA 1ERQA 4NFTA 5FAPA 4BL3A 3LZ0A 1CI8A 4N1HA 1WYBA 4QHCA 5C3IB 1P3MC 3C7UA 3MGPA 3HLBA 1A7WA 5E5AB 3Q1FA 3PTEA 4N1XA 4GDNA 2ZC6B 3HLWA 4ZJ1A 5KDMB 3ITBA 4OVDA 4KZ3A 1KX4C 1BSGA 4RA7A 2UWXA 1U35D 2XD1A 4NE6A 3REHD 3AV1C 4QLCC 1HTZA 2ZQAA 4Y0UA 4MBFA 3A6NA 2C6WB 1FCNA 1W7FA 5B40B 1JWVA 5KZHA 5KSCA 1P3KC 1FOFA 5B32D 1P3AA 3AV2D 3HL9A 1KX3D 4KGCA 2RL3A 4GN2A 4ZUXB 3WRZA 4GH9A 3UTBC 3KXBD 5E2GA 3GR2A 4RX3A 4QY5A 4KZBA 1L0FA 1XGJA 3OPLA 1H5XA 3G4PA 1P3FA 3W99B 3REJC 5AY8D 1U35B 3C1CB 4R3JA 1K55A 2JE5A 1IEMA 2WGWB 4XUJC 4BD1A 1NZUA 1YQSA 4ZBJC 4QB8A 1I2SA 4E6WA 1M1AC 1AOID 3AZLB 2WZZA 3REKB 4UA9A 1MY8A 5AVCC 3IHAA 1O07A 1G6AA 4E3NA 4HEFA 1DJBA 1EI5A 5CEBA 3G32A 4C3QA 2HIOD 4X69A 5B1MB 3UPOA 5M18A 5L2FA 3REHA 3ZVWA 2Z2LB 3G34A 3BFDA 2H5SA 1XXMA 4X53A 4KZ9A 2J8YA 2HDSA 1K6SA 3NQUB 4WU9C 1J9MA 2PYOD 4WBGA 5B32A 2Y2OA 5GT0C 3AV2A 5E2EA 1KX3A 4LD9D 1PI5A 1AOIB 4IBCA 3TU4B 1WYCA 2IO5C 3KXBA 2ZM0A 2WUQA 4X56A 5F1FA 3PBSA 1MKIA 1P34C 3EPLA 1KGEA 4BL2A 4IBBA 5AY8A 3WAAC 2ZQ8A 3C7VA 2Q9NA 5GT3C 5CPJC 2A49A 1XPBA 3X1UD 4WU8D 1AOIA 5J8XA 4IBFA 4DE3A 4UA7A 5B2JA 1W2EA 4LD9B 5M19A 5BPVA 3LZ0C 3MKEA 3DWKA 4R8PB 2HIOA 3MGPC 3B0DB 1P3PC 3L2AA 4E3OA 2ZC3B 4UHUA 1RGZA 2PYOA 2Y2MA 3BFEA 5B31G 3B6FD 4EBPA 3AL0C 3MGQB 1K54C 1K57A 2WGIA 4ZDXA 2OV5A 4YM6B 3GTCA 5AV8B 3VP2A 4LD9A 1YLYA 1P3OC 3WA9D 2Y2IA 4EBNA 4GHAA 4YS3D 1KVLA 2P9VB 1KGGA 2HP6A 1BH8B 1ONHA 2YFWA 1P3AC 1BUEA 2HUEB 5CPKB 3SS3A 3FYZA 2AROB 1L2SA 5AV6D 5B0YD 3LZ1D 4Z5TD 4LCLA 3X1UA 4WU8A 1P3FC 3KFUG 3TOIA 5AVBC 1LL9A 1AXBA 1U60A 5DNMB 4JJNB 1T3UA 1RCJA 1HZOA 4B4XA 3HONA 1I5QA 4XZQB 2JSSA 4C75A 5GXQD 3MNNC 4E44A 3LELD 1Q2PA 4Y0TA 4KG2A 3AYWB 4DF6A 1M6KA 5B0YB 3B6FA 4Z9QA 1DY6A 5CHLB 2F8NB 3G2ZA 3EG5B 4IBGA 4H9RB 3AZKB 4ZAMA 5G49B 3WA9A 3FKVA 5GSUC 2DNSA 4YS3A 3HUOA 3AZMC 1XKZA 5AQAA 3RELD 2BG1A 5B32C 1S32C 3AFAB 2NQBD 2IOUA 5B31D 3NIAA 4IBXA 4B88A 5AV6A 3PBNA 3MGSD 1IKIA 3HBRA 3KXBC 5I94A 3Q7ZA 2WGVA 3LZ1A 4Z5TA 5CPIB 4CPKA 3REID 5DTSA 2QMIA 3LY4A 3NQJA 4J8UC 3HLDA 3VP0A 4LCMA 1YLWA 2EFUA 1WE4A 2ZMAA 2IWDA 5DNNB 5FQKA 5BNVA 3W98B 3AZFD 3AZJB 3IH9A 5GXQA 1K6RA 5B2JC 3LELA 1GHIA 1IYSA 5B31B 5U47A 1CK3A 5CECA 3AZGC 4R23A 1M19C 4IEDA 1H8ZA 4BLMA 4NZ5A 1FR1A 5CRFA 2VGJA 2NZDC 1KX4D 1JFIA 2PYOC 3OPHA 3L27A 4HGAC 3RELA 1W8QA 3AV1D 4QLCD 1BH9A 2NQBA 4NK3A 5B31A 1F66B 3MGSA 1P3KD 4JLFA 4GD8A 4RYEA 1NZOA 2G2WA 3GV9A 3UDIA 3MFDA 5JYOA 1KX5C 1P3MB 3REIA 3UTBD 1B67A 3UT9B 4OUIA 1K38A 1Z2CB 1M40A 4E45A 3ZDJA 1KGFA 2RVQC 3REJD 4WU8C 3W4OA 3AZEC 3AGDA 3AZFA 3ZVTA 3AV1B 2W8SA 2HP5A 2FFFB 4XUJD 3UY6A 4KZ5A 1M1AD 1P3ID 4MBKA 4H9NB 1PWCA 3IWOA 1LLBA 3W4PA 4DRTA 2J9OA 3FV7A 4NETA 3L29A 1KX4A 4HESA 4L0LA 2WAFA 2XGNA 3AZID 3AV1A 4QLCA 3W96D 2BYKA 1NYMA 5BO0A 3WA9C 4WU9D 4OJLA 2OLUA 4YS3C 5B33C 1P3KA 5F99B 1SDEA 5BNXB 5GT0D 4CSRB 2G5IC 3UTBA 5AVCB 5TR7A 5GLAA 3LY3A 4PM6A 3KUYD 1P34D 2JC7A 1KE0A 3REJA 1FCMA 4X6TA 4P85A 3WAAD 4U0TA 4YFMA 4OJOA 4KG6A 3X1SC 1YMSA 5GT3D 1LHYA 3G2YA 5CPJD 4E3KA 4XUJA 5AV5B 4FH4A 5FAQA 1M1AA 1P3IA 1L0EA 4PM5A 3CJMA 2XH9A 3M2KA 3MVDB 1TDGA 5HAIA 3N8SA 2PBYA 1YM1A 5GXQC 3LELC 3G31A 4KZ6A 3HSHA 3WS5A 2IO5B 4FCFA 3D4FA 5B0ZC 1P3PD 3AZIA 4H9PB 3W96A 1YU0A 3EPKA 4WU9A 3H0LC 3X1TD 4Z2MG 1GHMA 5CPJB 4XUZA 3R45B 5GT0A 5CGXA 5AV9B 4OPZA 5DF9A 1P3OD 4OJ5A 4NE5A 3L28A 5FI2A 3MGSC 3IXDA 1OMEA 1Q9CA 4E3JA 3E2KA 4H9PA 1P3AD 3KUYA 1P34A 3LZ0B 4BQMA 2JBFA 3REIC 3MGPB 3WAAA 4R4SA 3WWXA 5CHJA 2HDUA 4S2KA 5GT3A 2ZY3A 5CTNA 3W97C 3LJAD 5CP6C 5AVBD 2XFTA 4OJ6A 3UDXA 1M18C 4G91C 3IXGA 3A6NB 2XDMA 1TDLA 1P3PA 1P3AB 3MNND 1L0GA 4KGCB 2XK1A 5CTMA 3X1TA 2VGKA 1K54A 2Y2HA 3WRTA 5JA4A 3V9RA 1P3OA 1P3FB 5GSUD 4WV4B 4U0XA 3AZMD 1MXOA 4OP8A 1S32D 2F8NH 3PBOA 3RJUA 1H8YA 4OPQA 1L0DA 3G35A 2YFVA 1YLZA 3MNNB 4NZ4A 5FQ9A 3S1YA 3IWIA 4RX2A 3ISGA 5EVLA 3LJAA 3WTPD 4DE1A 5AVBA 3REHB 4DKIA 4JKTA 4J8UD 1KE4A 4S2NA 2X02A 5FQIA 4IVKA 1P3IC 2ZJ9A 1BTLA 2ZLYA 4J8VC 5B32B 3MNNA 3AV2B 5B2JD 4J8WC 1KX3B 4PM7A 3NY4A 1ZLAA 3AZHD 3AZGD 1K56D 1M19D 2ZM5A 1ONGA 3KXBB 4QY6A 3AZIC 4H8RA 3W96C 4OLDA 4D2OA 2NZDD 1KE3A 5AY8B 5GSUA 2Y91A 3SH9A 3AZMA 1RGYA 3I7JA 3UN7A 3C5AA 1ID3C 4J8XC 1S32A 3PBQA 4WMCD 2Y55A 1VQQA 3O86A 4ZTKA 4FH2A 2Y2JA 4CAYA 4R4RA 5B2JB 3O62C 4Y7PA 1TZYC 2ZQ7A 4EWFA 3KUYC 1KX5D 3BRMA 1S0WA 4S2PA 2HIOB 3WTPA 1MWTA 2FJ7C 4J8UA 4K0XA 1NXYA 3CG5A 1SDNA 4FSFA 2RVQD 3P98A 2PYOB 1ERMA 3AZED 3A1IA 1KDSA 4OQIA 3OZHA 3BLMA 3AZHA 3AZGA 2ZQDA 5B1LA 2CWEA 1K56A 1M19A 3BLSA 2EXBA 1E3UD 5EECA 1CEFA 2YFWB 3HLEA 2NZDA 3B3XA 4OQGA 4WZSB 3X1TC 5AQ7A 1BLPA 3SS4A 3GQZA 4AWLC 4WMCA 1Q2QA 2DRWA 1HQ3D 3X1UB 4WU8B 3KS4A 1PYYA 4XUXA 5TFQA 3W8KA 5B33D 5B2IC 3C4OA 4KUDD 5BT1C 1YT4A 3UPPA 4LV2A 1KX5A 3FWLA 3SH8A 2CV5D 1IELA 1XA7A 3AZND 1MWUA 1HD8A 2XD5A 3AZEA 3P09A 3LJAC 3GVBA 3B6FB 3X1SD 3VP3A 3UTAD 4S2NC 3WA9B 1P3LD 2QZ6A 4YS3B 4HBTA 5B33B 4IBRA 1P3BD 4P6BA 3ITAA 4H9SC 2QPNA 1E3UA 3IF6A 5DF8A 4EV4A 2EFXA 2R9WA 3A3FA 1N1JA 4F94A 5B40C 3O88A 5AV6B 1ZLAC 4A5RA 1FQGA 1G68A 5DVAA 1LI0A 5B0ZD 1ZG6A 4JF4A 4GB7A 3WS0A 3LZ1B 4Z5TB 1O7EA 3OCLA 4ZUXC 1HQ3A 1N9BA 5CHMA 2P74A 1ZKJA 3IH8A 5B33A 3X1SB 2XQZA 3HLCA 3NQJB 4KUDA 4GOGA 2EX6A 3PAGA 4WZ5C 2DF4C 4GKUA 3W99C 2CV5A 5BNVB 1ES5A 5GXQB 4KZ4A 4OQHA 3LELB 3AZNA 1EROA 1FR6A 2ZD8A 3AZLC 1R4VA 5F1GA 3V3RA 5B0ZB 3WTPC 3VH5A 3X1SA 3MGRC 3UTAA 3A3EA 4X23C 2RIQA 1ULYA 1P3LA 4ID4A 1JFIB 3W97D 3VP1A 3MBZA 2OLVA 5B1MC 1P3BA 4X55A 5CP6D 3HVFA 3RELB 1BH9B 3BFGA 1M18D 2NQBB 5DF7A 1P3GD 2HDRA 3EQVA 3AZHC 3MGSB 5B1LC 1MWRA 5B0ZA 3TSGA 1H3OA 4OPYA 1PW8A 2WAEA 3REIB 1MPLA 4U3TA 4KQQA 4UA6A 3ZG5A 2V20A 5A90A 1TVFA 3AZFB 4GD6A 3VOYA 4G91B 5TGFA 3Q7VA 3WTPE 1YLTA 3ZG0A 4DDYA 1NJ4A 3B0BA 1PI4A 3NC8A 5JRGD 3HLGA 1XA1A 4CJNA 2CC1A 4R8PC 1KX4B 3W97A 4H9OA 3A3DA 5CP6A 1SKFA 4QLCB 3BM6A 4JXGA 1M18A 1XP4A 1P3GA 2BYKB 5BO0B 3VFHA 2Y2PA 3B0CW 3MGQC 3P5JB 4J8VD 1P3KB 3PBTA 1NRFA 3IF6C 2J8PA 4J8WD 4MLLA 4ZBEA 5F82A 1TAFA 3UTBB 1BLCA 4ZJ2A 1ZG4A 2V2FF 2XLNA 3X1VA 1DJCA 4OKPA 5CPKC 2ZM8A 4Z66C 3VH6A 3OPRA 2AROC 1HQ3C 3REJB 5KSHA 4NZ1A 4DDSA 1HTAA 1NYYA 3C1BD 1ID3D 4J8XD 4KUDC 4XUJB 4EUZA 4ZBJB 1M1AB 1JWPA 2XF3A 4WNNA 1P3IB 3E2LA 5BS7C 2CV5C 5EUAA 5DNMC 3O62D 4J8WB 4JJNC 5JRGA 1TZYD 1ALQA 3AZNC 3PBRA 3IWQA 4XZQC 1EQZA 1B6WA 2FJ7D 3AZIB 2Q9MA 3W96B 5FUGB 4S2LA 3UTAC 2VQRA 3WKJD 3KWQD 1P3LC 4WU9B 1YU3A 4LG2A 3A3IA 3B0CT 3H0RC 4JPMA 3FKWA 4J8VA 2LY8A 1ID3B 4WZ4A 1P3BC 3F6TA 4MBHA 1YU4A 5GT0B 4IJEA 4J8WA 3NCKA 4KHAA 4WJ3C 2RCXA 1PWGA 5EVIC 3O3VA 3AFAC 3B6GD 3RXWA 4KZ8A 3IQAA 5FUGA 3KUYB 1P34B 4PM8A 3CZDA 4PPRA 4R1GA 5GHZA 4FD8A 4UUZA 3WAAB 1GCEA 4N9LA 3C1BA 4M3KA 1ID3A 5GT3B 4E3IA 1FCOA 5CPIC 4J8XA 2WYXA 3N3FA 2IWBA 4NYUA 3L26A 3AN2D 1K4FA 3MXSA 1FSYA 5B2ID 2H0YA 2F8NK 3O62A 5BT1D 1TZYA 5E2FA 4LENA 4NE3A 4S2MA 4S2JA 4OQ0A 4Y0OA 1CI9A 4OOYA 1PWDA 3W98C 5FDHA 3AZJC 4OPRA 2FJ7A 5B24D 1P3PB 4H9QA 3IHBA 3N6IA 2BYMA 1ES2A 4IVIA 3WKJA 4NY2A 3Q81A 3KWQA 3UE1A 1BULA 5E5AD 3X1TB 5KMWA 3FKEA 1ZC2A 3Q07A 2XFSA 4AWLB 5E43A 5JA4B 3V9RB 1P3OB 3LEZA 3MZEA 4P87A 1SHVA 1P3GC 1ES4A 3IT9A 3N7WA 5GL9A 5B2IB 5D3OA 5GHXA 4IBJA 2EX9A 3B6GA 3NDGA 3WS1A 4EO5C 1XX2A 5B40D 5EOEA 5EOOA 1ZLAD 4IBDA 3FDDA 1BT5A 4S2IA 4ZJ3A 3BECA 2YFVB 5FATA 4UAAA 3X1VC 5HARA 3GRJA 4ZUXD 3AN2A 3OCNA 3IF5A 1EWZA 3UT9C 3LJAB 1KVMA 3IXBA 3RXXA 5A92A 5AVBB 3Q82A 5B2IA 4YINA 3MZDA 5DTTA 3W99D 4C6YA 4EBLA 3C1CD 4PM9A 3DWZA 4KQOA 5B24A 1YU2A 5A91A 3EPJA 4IBIA 5JRGC 3V3SA 3AZLD 3REKD 1ZLAB 5JYPA 5E5AA 4GNUA 4EQIA 1EQZC 1NY0A 3HREA 3MGRD 2B5RA 5KDMA 2ZY5A 4X23D 2ZY4A 3SH7A 4E3MA 5GSUB 3L25A 1MBLA 2DCFA 5B1MD 3KSYA 3A3JA 3ZHHA 3AZMB 1ESUA 4H9SA 3UE0A 1S32B 4KZAA 5CXWA 5B40A 3UO9A 5E2HA 5FA7A 4CAYB 5B1LD 5F99C 3QNBA 1IKGA 4PMAA 4ZUXA 3TU4D 5AQBA 3AGEA 2FFYA 2HPBA 4DXCA 3WTPB 1VM1A 3MGRB 3C1BC 4J8UB 2X71A 2G2UA 3VH5W 2PU2A 2ZC4B 4X23B 4G92C 4WZ5A 3W99A 1U35A 2I72A 3C1CA 3BFFA 1IYQA 2WGWA 4WELA 4B4ZA 5AV5C 5FQQA 4DE0A 3AZLA 1YU1A 4GZBA 3REKA 3AZHB 3AZGB 5B1LB 1M19B 3UPNA 3MVDC 3ZGAB 4QJGA 3MGRA 4X23A 2F8NG 2ZM2A 3A1KA 2NZDB 4IJFA 4R8PD 3WKJC 1YLPA 3KWQC 2X01A 5FASA 5B1MA 4Q8IA 3ZG7B 4HGAB 3VMAA 1KDWA 4JBFA 4OH0A 2BLSA 3NQUA 1GA9A 5GLBA 3N4IA 2ZQCA 3SS5A 3MGQD 4YM6D 5AV8D 3ZCZA 2Z2MB 5AV9C 2C5WB 4JF6A 3B6GC 3TU4A 1KX5B 3BEBA 5GLDA 5M1AA 1PIOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HTZ A;  4PM6 A;  1BZA A;  2PU4 A;  2ZQA A;  4Y0U A;  3BFG A;  3TG9 A;  5DF7 A;  4MBF A;  2JC7 A;  2C6W B;  1KE0 A;  1FCN A;  2HDR A;  1W7F A;  1FCM A;  3EQV A;  4X6T A;  1JWV A;  4P85 A;  4U0T A;  4YFM A;  5KZH A;  5KSC A;  4KG6 A;  1MWR A;  1FOF A;  1YMS A;  1LHY A;  3G2Y A;  3HL9 A;  3TSG A;  4E3K A;  2WKI A;  4FH4 A;  5FQJ A;  2RL3 A;  4OPY A;  1PW8 A;  4GN2 A;  5FAQ A;  3WRZ A;  2WAE A;  3OC2 A;  4O7D A;  4WM9 A;  1L0E A;  4PM5 A;  3CJM A;  2XH9 A;  5E2G A;  1MPL A;  3GR2 A;  3VOZ A;  2Y2Q A;  4RX3 A;  3FZC A;  1GA0 A;  1TDG A;  3M2K A;  4QY5 A;  3N8S A;  4U3T A;  4KQQ A;  5HAI A;  2PBY A;  1YM1 A;  4KZB A;  1L0F A;  1XGJ A;  3IF6 B;  3OPL A;  1H5X A;  3G4P A;  4UA6 A;  3ZG5 A;  3LCE A;  3G31 A;  2V20 A;  4KZ6 A;  3UNW A;  1IYP A;  3WS5 A;  5A90 A;  4R3J A;  4FCF A;  1K55 A;  1TVF A;  2Y59 A;  3D4F A;  4GD6 A;  2JE5 A;  1IEM A;  1SCW A;  2WGW B;  4LV0 A;  3VOY A;  4X68 A;  4BD1 A;  1NZU A;  1YQS A;  1PZO A;  4QB8 A;  5TGF A;  1FSW A;  1I2S A;  3Q7V A;  4E6W A;  4N9K A;  2WZZ A;  3GMW A;  4UA9 A;  1YLT A;  1YMX A;  1GHM A;  1MY8 A;  4JXW A;  3ZG0 A;  4DDY A;  2EX2 A;  3IHA A;  1O07 A;  5HFO A;  1G6A A;  1NJ4 A;  4XUZ A;  2ZC7 A;  5CGX A;  1PI4 A;  3NC8 A;  4E3N A;  4HEF A;  4WYY A;  3HLG A;  1DJB A;  1EI5 A;  4OPZ A;  5DF9 A;  1XA1 A;  5DTK A;  3ZG8 B;  4CJN A;  5CEB A;  2CC1 A;  3G32 A;  4C3Q A;  3G30 A;  2Y2K A;  2P9V A;  3A3D A;  4X69 A;  1K55 C;  5FI2 A;  3UPO A;  3IXD A;  1OME A;  5L2F A;  5M18 A;  3ZVW A;  2Z2L B;  1SKF A;  3G34 A;  4E3J A;  3BFD A;  3E2K A;  5EVI D;  2H5S A;  3BM6 A;  3ZNY A;  1XXM A;  4X53 A;  4JXG A;  4KZ9 A;  4BQM A;  2J8Y A;  2HDS A;  1XP4 A;  1K6S A;  4OP5 A;  1J9M A;  2JBF A;  4WBG A;  3VFH A;  2Y2P A;  4R4S A;  3WWX A;  3V50 A;  5CHJ A;  3SOI A;  4KZ7 A;  2HDU A;  4S2K A;  3PBT A;  2Y2O A;  3M2J A;  1NRF A;  5E2E A;  3IF6 C;  1PI5 A;  2ZC5 B;  2H10 A;  5CTN A;  4BD0 A;  5CED A;  4MLL A;  4ZBE A;  4OOM A;  5F82 A;  1WYC A;  5HL1 A;  5HX9 A;  4ZJ2 A;  1BLC A;  5CGW A;  2ZM0 A;  4R0Q A;  3VFF A;  1ZG4 A;  2V2F F;  2WUQ A;  2XLN A;  2XFT A;  3GSG A;  4X56 A;  5F1F A;  1DJC A;  3PBS A;  4OKP A;  1MKI A;  3UDX A;  1Y54 A;  4BL2 A;  1KGE A;  3IXG A;  2ZM8 A;  3OPR A;  4N92 A;  1IYO A;  2GDN A;  5KSH A;  4DDS A;  2XDM A;  2ZQ8 A;  3C7V A;  1TDL A;  2Q9N A;  1NYY A;  3EQU A;  5EVI B;  4DXB A;  2A49 A;  4JF5 A;  4EUZ A;  1L0G A;  4E3L A;  1XPB A;  2XK1 A;  5J8X A;  2A3U A;  1JWP A;  2XF3 A;  5CTM A;  3AGF A;  3E2L A;  2VGK A;  1RP5 A;  4DE3 A;  4UA7 A;  1K54 A;  5EUA A;  2Y2H A;  4HBU A;  3UE3 A;  2Y2G A;  3WRT A;  5M19 A;  1ALQ A;  3PBR A;  3MKE A;  2E8I A;  3DWK A;  3IWQ A;  4U0X A;  1W5D A;  4KG5 A;  3V39 A;  1MXO A;  4OP8 A;  4E6X A;  2Q9M A;  5EVI A;  4P0M A;  4S2L A;  4E3O A;  2ZC3 B;  4UHU A;  3PBO A;  1RGZ A;  2XR0 A;  4KQR A;  3Q7V B;  3S4X A;  3RJU A;  1E4D A;  1H8Y A;  3A3I A;  2Y2M A;  4OPQ A;  1L0D A;  3BFE A;  5HAP A;  3G35 A;  4JPM A;  3FKW A;  3JYI A;  4WZ4 A;  5G18 A;  4EBP A;  1K54 C;  1MWS A;  1K57 A;  1YLZ A;  2WGI A;  4OOL A;  2OV5 A;  4MBH A;  4ZDX A;  3GTC A;  4LV3 A;  3VP2 A;  5FQ9 A;  3S1Y A;  1YLY A;  3IWI A;  3NCK A;  4RX2 A;  4S2O A;  3ISG A;  2Y2I A;  4EBN A;  5EVL A;  3N8L A;  1KVL A;  2P9V B;  4DE1 A;  2RCX A;  1PWG A;  4DKI A;  1E25 A;  1KGG A;  2HP6 A;  1KE4 A;  2EX8 A;  4JKT A;  3O3V A;  5EVI C;  1ONH A;  1YLJ A;  4S2N A;  3RXW A;  4KZ8 A;  3IQA A;  5GLC A;  2V1Z A;  1BUE A;  4R1G A;  5GHZ A;  4PM8 A;  1PZP A;  2X02 A;  3CZD A;  4PPR A;  5CHU A;  4FD8 A;  5FQI A;  4IVK A;  3SS3 A;  1CEG A;  3FYZ A;  3NDE A;  4WEJ A;  1L2S A;  5CER A;  2ZJ9 A;  3VP4 A;  1BTL A;  2ZLY A;  1GCE A;  4N9L A;  1K57 C;  4M3K A;  3N8R A;  4E3I A;  1FCO A;  2WYX A;  2IWB A;  1LL5 A;  4JXS A;  4LCL A;  4PM7 A;  4KEN B;  3NY4 A;  3TOI A;  1K4F A;  3MXS A;  1JWZ A;  1K56 D;  1ONG A;  1FSY A;  3NI9 A;  4BEN A;  1LL9 A;  1AXB A;  5EE8 A;  2H0Y A;  4QY6 A;  4H8R A;  1U60 A;  1Z6F A;  4OLD A;  4MEZ A;  3IXH A;  5E2F A;  4LEN A;  5FI6 A;  1RCJ A;  4S2M A;  4D2O A;  3OPP A;  2Y4A A;  1KE3 A;  1HZO A;  4S2J A;  5F83 A;  4B4X A;  4OQ0 A;  4Y0O A;  2Y91 A;  1CI9 A;  4OOY A;  1PWD A;  1I5Q A;  3SH9 A;  5FDH A;  1RGY A;  2J9P A;  3I7J A;  3C5A A;  4OPR A;  3UN7 A;  5EPH A;  1N4O A;  3IHB A;  4C75 A;  3N6I A;  5FAO A;  1Q2P A;  1ES2 A;  3PBQ A;  4IVI A;  4Y0T A;  4WMC D;  3Q81 A;  2Y55 A;  4KG2 A;  1VQQ A;  3UE1 A;  3O86 A;  2H0T A;  4ZTK A;  4FH2 A;  5FSR A;  2Y2J A;  1BUL A;  4DF6 A;  1M6K A;  5KMW A;  4Z9Q A;  1DY6 A;  3WS2 A;  4R4R A;  3G2Z A;  1LI9 A;  4BJP A;  1ZC2 A;  3Q07 A;  2XFS A;  4Y7P A;  5E43 A;  4ZAM A;  2ZQ7 A;  4WEK A;  4EWF A;  3FKV A;  3LEZ A;  3MZE A;  4P87 A;  3VSK A;  2DNS A;  1SHV A;  1ES4 A;  3BRM A;  1S0W A;  4S2P A;  3IT9 A;  3N7W A;  3HUO A;  3QHY A;  5GL9 A;  1MWT A;  1XKZ A;  4RVA A;  5AQA A;  3HLF A;  3ZG9 B;  2BG1 A;  4K0X A;  5D3O A;  1NXY A;  3CG5 A;  5GHX A;  1SDN A;  2EX9 A;  5FQM A;  1QMF A;  4FSF A;  3NDG A;  5BOH A;  3WS1 A;  3NIA A;  2OSU A;  4IBX A;  1XX2 A;  3LO7 A;  4B88 A;  5HAQ A;  3P98 A;  5EOE A;  3PBN A;  1ERM A;  1K4E A;  5EOO A;  1IKI A;  3ZNT A;  1ES3 A;  3HBR A;  5IHV A;  5I94 A;  3Q7Z A;  1BT5 A;  4S2I A;  4ZJ3 A;  3BEC A;  1KDS A;  2WGV A;  4OQI A;  3OZH A;  5FAT A;  4UAA A;  5HAR A;  3BLM A;  3GRJ A;  3NBL A;  5A93 A;  3QNC A;  2IWC A;  4CPK A;  3OCN A;  4K91 A;  2ZQD A;  3IF5 A;  1EWZ A;  1K56 A;  2HP9 A;  4OON A;  5DTS A;  3S22 A;  1KVM A;  2QMI A;  3W4Q A;  3IXB A;  3LY4 A;  3BLS A;  3RXX A;  5A92 A;  2EXB A;  3Q82 A;  3HLD A;  1E3U D;  4YIN A;  5EEC A;  1CEF A;  3MZD A;  2XEP A;  5DTT A;  3VP0 A;  3HLE A;  4MNR A;  5AQ9 A;  3B3X A;  4C6Y A;  4LCM A;  4EBL A;  4OQG A;  1YLW A;  2EFU A;  4K0W A;  1WE4 A;  2ZMA A;  2IWD A;  5FQK A;  2WKH A;  2R9X A;  4PM9 A;  1JTG A;  1JTD A;  2J7V A;  1BLP A;  3DWZ A;  4KQO A;  5AQ7 A;  3SS4 A;  3GQZ A;  3IH9 A;  5A91 A;  1K6R A;  3MZF A;  1GHI A;  1IYS A;  3C4P A;  4WMC A;  1ESI A;  1Q2Q A;  3V3S A;  2DRW A;  1PYY A;  5U47 A;  1CK3 A;  4XUX A;  5CEC A;  5TFQ A;  4QD4 A;  3W8K A;  3HUN A;  4R23 A;  3M6B A;  5JYP A;  4IED A;  4GNU A;  4XXR A;  4EQI A;  1H8Z A;  4BLM A;  1NY0 A;  1W79 A;  3HRE A;  3ZFZ A;  3C4O A;  1FR1 A;  2B5R A;  5CRF A;  1YT4 A;  3UDF A;  3SH7 A;  2VGJ A;  4LV2 A;  3UPP A;  3FWL A;  5HW3 A;  4E3M A;  1DJA A;  3MKF A;  1MBL A;  3SH8 A;  2DCF A;  3OPH A;  1IEL A;  4JXV A;  3A3J A;  3ZHH A;  1JVJ A;  2Y2L A;  1XA7 A;  1ESU A;  1W8Q A;  3UE0 A;  1K25 A;  3WS4 A;  1MWU A;  4NK3 A;  4KZA A;  5CXW A;  3VSL A;  1TEM A;  1HD8 A;  2XD5 A;  3UO9 A;  4OLG A;  5E2H A;  4LV1 A;  2JCH A;  3P09 A;  5FA7 A;  3MXR A;  3GVB A;  2HDQ A;  4JLF A;  3QNB A;  1QME A;  1IKG A;  4GD8 A;  4RYE A;  1NZO A;  2G2W A;  3GV9 A;  1W8Y A;  4PMA A;  3UDI A;  3VP3 A;  4S2N C;  3MFD A;  1PW1 A;  5JYO A;  3HUM A;  5AQB A;  1BLS A;  1I2W A;  1GHP A;  3AGE A;  2FFY A;  2QZ6 A;  2HPB A;  4HBT A;  3DTM A;  4DXC A;  2WKE A;  4IBR A;  1VM1 A;  4P6B A;  3ITA A;  1K38 A;  1C3B A;  1M40 A;  4R3B A;  2QPN A;  1E3U A;  2G2U A;  2X71 A;  3IF6 A;  5DF8 A;  2PU2 A;  2ZC4 B;  3ZDJ A;  2EFX A;  2R9W A;  4EV4 A;  2WK0 A;  3A3F A;  4WZ5 A;  2WAD A;  1KGF A;  3BFC A;  4F94 A;  3O88 A;  2I72 A;  3W4O A;  1BLH A;  3AGD A;  4A5R A;  3BFF A;  3BYD A;  1FQG A;  1IYQ A;  3ZVT A;  1G68 A;  5DVA A;  1LI0 A;  1S6R A;  2HP5 A;  1ZG6 A;  2WGW A;  4JF4 A;  4WEL A;  4B4Z A;  2FFF B;  4GB7 A;  1XGI A;  3WS0 A;  5FQQ A;  3UY6 A;  1O7E A;  4DE0 A;  3OCL A;  4KZ5 A;  2WZX A;  4MBK A;  4GZB A;  1N9B A;  5CHM A;  2P74 A;  1PWC A;  1ZKJ A;  3UPN A;  3IH8 A;  3ZGA B;  4GDB A;  3IWO A;  1LLB A;  2XQZ A;  3DW0 A;  3HLC A;  3M6H A;  3W4P A;  3PAE A;  4DE2 A;  4DRT A;  4QJG A;  2J9O A;  4GOG A;  2EX6 A;  3PAG A;  4WZ5 C;  4GKU A;  3FV7 A;  3V5M A;  5GHY A;  2ZQ9 A;  4NET A;  2ZM2 A;  1HVB A;  1YLP A;  4HES A;  4L0L A;  3CMZ A;  2Y2N A;  2X01 A;  2WAF A;  5FAS A;  2XGN A;  4QU3 A;  4Q8I A;  3ZG7 B;  3O87 A;  5CGS A;  3VMA A;  5FI7 A;  1ES5 A;  1KDW A;  4KZ4 A;  2EXA A;  1ERQ A;  4OQH A;  5FAP A;  4JBF A;  4BL3 A;  1CI8 A;  1ERO A;  1FR6 A;  4N1H A;  1WYB A;  4OH0 A;  4QHC A;  2ZD8 A;  1NYM A;  2BLS A;  1GA9 A;  5GLB A;  3N4I A;  3C7U A;  2ZQC A;  3HLB A;  3SS5 A;  2OLU A;  3Q1F A;  5F1G A;  3PTE A;  4N1X A;  3V3R A;  1SDE A;  4GDN A;  3ZCZ A;  2Z2M B;  2C5W B;  2ZC6 B;  3HLW A;  3A3E A;  4JF6 A;  4ZJ1 A;  3ITB A;  4OVD A;  4KZ3 A;  4ID4 A;  1BSG A;  3BEB A;  4RA7 A;  3VP1 A;  2UWX A;  3MBZ A;  2OLV A;  5GLA A;  5TR7 A;  3LY3 A;  4X55 A;  5GLD A;  2XD1 A;  5M1A A;  3HVF A;  1PIO A; 
#chains in the Genus database with same CATH topology
 3WX7 A;  1BZA A;  2PU4 A;  4P6Z M;  3VH5 T;  4NG2 A;  5CPK D;  1G6O A;  3TG9 A;  1V9Z A;  3T4S A;  4Z66 D;  2ARO D;  3AN2 C;  3ULF A;  3LR4 A;  3AZE B;  3LGO A;  4HJ6 A;  4X25 A;  4ARZ B;  2WKI A;  5FQJ A;  3WD0 A;  2F2A C;  2PDR A;  3OC2 A;  4O7D A;  1GSW A;  4WM9 A;  2VJW A;  3VOZ A;  2Y2Q A;  2ACG A;  2W1T B;  1GA0 A;  3FZC A;  1HLU P;  1G5U A;  5EVE A;  5B24 C;  3IF6 B;  3KSG A;  5DNM D;  3NHQ A;  4JJN D;  3LCE A;  1N1J B;  3A6N C;  3UNW A;  1IYP A;  4R8P A;  5C3I C;  4IBK A;  4XZQ D;  5E5A C;  5IU1 A;  2Y59 A;  1SCW A;  3IX3 A;  4LV0 A;  4UPK A;  4X68 A;  4KGC C;  1PZO A;  4Z66 B;  3WD4 A;  4ARZ A;  1FSW A;  1WA9 A;  1HQ3 B;  3KSI A;  4JGR A;  4N9K A;  5FL3 A;  3L9K A;  3VH6 W;  3AYW D;  3GMW A;  1YMX A;  4JXW A;  4CLC B;  3MGQ A;  2EX2 A;  2F8N D;  1IFQ A;  5HFO A;  4NXE A;  4YM6 A;  5AV8 A;  2ZC7 A;  2ZOH A;  4KUD B;  3AZK D;  3T4O A;  4WYY A;  1OGB A;  1UGU A;  5DTK A;  3ZG8 B;  3D9Y A;  3G30 A;  2Y2K A;  2P9V A;  1K55 C;  2CV5 B;  1OTE A;  4Y3I A;  1BH8 A;  1AWI A;  3RH8 B;  4IUH A;  5EVI D;  3ZNY A;  3AFA D;  1DP8 A;  3AZN B;  5CPK A;  3EPH A;  2EWW A;  1H8P A;  4Z66 A;  4OP5 A;  2ARO A;  1KS0 A;  4I3J A;  3V50 A;  3SOI A;  4KZ7 A;  4YOF A;  3FPV A;  3M2J A;  4HP9 A;  3MQL A;  2VV8 A;  5CPI D;  1DP9 A;  3UTA B;  2ZC5 B;  2H10 A;  4BD0 A;  5CED A;  4NXF A;  4OOM A;  1P3L B;  5HL1 A;  5HX9 A;  3LEQ A;  5CGW A;  1U35 C;  5BS7 A;  4R0Q A;  3VFF A;  3C1C C;  3REH C;  1P3B B;  3GSG A;  3LYX A;  3ICY A;  3T4T A;  5DNM A;  3BW6 A;  3CAX A;  4HY8 A;  4JJN A;  1Y54 A;  1NWZ A;  2Y8H A;  4N92 A;  1IYO A;  2GDN A;  5DNN D;  4XZQ A;  4NYY A;  3REK C;  3W98 D;  4I5S A;  4IBE A;  3AZJ D;  3EQU A;  5EVI B;  4DXB A;  3AV2 C;  3LIC A;  1KX3 C;  1H3O B;  4JF5 A;  4E3L A;  1D06 A;  2A3U A;  3AYW A;  3AGF A;  3VH6 T;  5B0Y A;  2QJ5 A;  1RP5 A;  2F8N A;  4HBU A;  4H9R A;  4HIA A;  3UE3 A;  3AZK A;  1VEU B;  2Y2G A;  5G49 A;  1X0O A;  5AY8 C;  2E8I A;  3K3D A;  2PT7 A;  3GEC A;  1W5D A;  4KG5 A;  3V39 A;  3NJA A;  4E6X A;  5EVI A;  4P0M A;  3AFA A;  1AOI C;  3SZT A;  2XR0 A;  3FC7 A;  4KQR A;  3Q7V B;  1F66 D;  3TU4 C;  3S4X A;  1E4D A;  5EV0 A;  5HAP A;  1VET A;  5G18 A;  3JYI A;  1MWS A;  4OOL A;  2W3E A;  4LV3 A;  5CPI A;  1F98 A;  3X1V D;  4S2O A;  1P3M D;  2L5A A;  2HIO C;  3W97 B;  4H9O B;  2V5O A;  3UT9 D;  3N8L A;  2P04 A;  4TX8 A;  5CP6 B;  1E25 A;  3KS8 A;  2EX8 A;  1YLJ A;  5GLC A;  2UV0 E;  2V1Z A;  3UB5 P;  1M18 B;  1PZP A;  5CHU A;  4L9E A;  1P3G B;  1CEG A;  3NDE A;  4GS9 A;  4WEJ A;  3R7W A;  5CER A;  5DNN A;  1Y4O A;  3VP4 A;  1MKM A;  3W98 A;  3AZJ A;  1K57 C;  3N8R A;  4LD9 C;  3TW8 A;  1LL5 A;  4JXS A;  4EO5 B;  4KEN B;  1TS0 A;  1JWZ A;  1TAF B;  4DRB A;  3NI9 A;  4BEN A;  3B0D C;  1EQZ D;  5EE8 A;  2O99 A;  3X1V B;  1Z6F A;  4YNR A;  4MEZ A;  3IXH A;  5FI6 A;  3OPP A;  2Y4A A;  5F83 A;  4B9O A;  4O8G A;  1L3L A;  2J9P A;  1FIK A;  5HPI A;  5EPH A;  1N4O A;  5FAO A;  4YM6 C;  5AV8 C;  2ZY2 A;  3X1U C;  4OJP A;  1NLY A;  3CLO A;  1F66 A;  4XT2 B;  4BMW A;  4WNN B;  1BFM A;  2H0T A;  5FSR A;  4MN5 A;  3WS2 A;  3WD3 A;  5F99 D;  4BJP A;  1LI9 A;  5F5Y A;  5JRG B;  4WEK A;  1O6I A;  2HUE C;  1P3M A;  3VSK A;  1LSX A;  5AVC D;  3UT9 A;  4Z2M H;  1EQZ B;  3QHY A;  4RVA A;  1KU5 A;  3HLF A;  3ZG9 B;  3QP2 A;  5FQM A;  2V8C A;  1QMF A;  5BOH A;  1OPX A;  2OSU A;  1WWI A;  5HAQ A;  3LO7 A;  1CQA A;  1K4E A;  3ZNT A;  1ES3 A;  3B6F C;  5IHV A;  2L0W A;  2V9A A;  4J8V B;  2XRN A;  1PZR A;  3T4J A;  1G28 A;  1YUE A;  4L9F A;  5AV5 D;  3NBL A;  5A93 A;  3QNC A;  3OOV A;  2IWC A;  4HQA A;  4KHA B;  4K91 A;  4H9N A;  4NEE D;  2HP9 A;  3EGD C;  3S22 A;  4OON A;  3W4Q A;  3MVD D;  2G5H C;  2E8J A;  2JKT M;  2M7V A;  3H0M C;  5A8B A;  3M7P A;  2XEP A;  3BY8 A;  2K31 A;  4MNR A;  5AQ9 A;  1WWS A;  1F1E A;  4UUZ B;  5AV6 C;  3CI6 A;  4K0W A;  5EM1 A;  3AYW C;  2R9X A;  2WKH A;  5B0Y C;  1JTG A;  1JTD A;  2J7V A;  3PHY A;  3C1B B;  2VV7 A;  3LZ1 C;  3IP4 C;  4Z5T C;  3MZF A;  3NOP C;  4J8X B;  4G92 B;  3C4P A;  3AZK C;  3MSH A;  3UME A;  1ESI A;  4GLQ A;  1P9W A;  4QD4 A;  3HUN A;  3M6B A;  1KOU A;  4NZ3 A;  4XXR A;  5F99 A;  2XSS A;  5BNX A;  1W79 A;  3ZFZ A;  4CSR A;  3B42 A;  1Y28 A;  5AV9 D;  3O62 B;  1TZY B;  3UDF A;  5HW3 A;  3KYE A;  2LB5 A;  1DJA A;  5AVC A;  3MKF A;  4JXV A;  2A24 A;  1JVJ A;  2Y2L A;  2FJ7 B;  4H9Q B;  1K25 A;  2VGL S;  3WS4 A;  2BYM B;  3LZ0 D;  2DQN C;  3VSL A;  3WKJ B;  3KWQ B;  4GHL A;  1TEM A;  5DFX A;  1LSV A;  1MZU A;  3MGP D;  4OLG A;  4LV1 A;  2JCH A;  3MXR A;  2HDQ A;  2MJ6 A;  1QME A;  5AV5 A;  1W8Y A;  1PW1 A;  5B32 G;  3HUM A;  1BLS A;  1I2W A;  2B18 A;  5HL6 A;  1GHP A;  3A0R A;  3DTM A;  5DNN C;  2WKE A;  4IUK A;  3MVD A;  3TE8 A;  3REL C;  1C3B A;  4R3B A;  4DQY B;  1H8M A;  4EW7 A;  3B6G B;  2WK0 A;  2NQB C;  2JN7 A;  3O5Y A;  5B31 C;  2WAD A;  4WL9 A;  3A6N D;  3BFC A;  1BLH A;  2PD8 A;  3BYD A;  4M6B A;  4F3L A;  5DFY A;  4AFI A;  1S6R A;  1XGI A;  4DRA A;  4KGC D;  2WZX A;  3AN2 B;  4QNL A;  2W27 A;  4GDB A;  4DE2 A;  3DW0 A;  3IS2 A;  3M6H A;  5CPJ A;  1DRM A;  3PAE A;  3R45 A;  3R4K A;  5AV9 A;  4R38 A;  3V5M A;  5GHY A;  1P3F D;  2ZQ9 A;  1HVB A;  1F66 C;  3CMZ A;  2Y2N A;  4QU3 A;  1YSP A;  3AZF C;  3VV4 A;  3O87 A;  5CGS A;  5B24 B;  4H6J B;  5FI7 A;  2EXA A;  1ERQ A;  4NFT A;  5FAP A;  4BL3 A;  3LZ0 A;  1CI8 A;  4N1H A;  1WYB A;  4QHC A;  5C3I B;  4RQ9 A;  1P3M C;  3C7U A;  3MGP A;  3HLB A;  4MMN A;  1A7W A;  5E5A B;  3Q1F A;  4Z2G A;  3PTE A;  4N1X A;  4GCZ A;  3VE4 A;  4GDN A;  2ZC6 B;  3HLW A;  2L1M A;  4Y5F A;  4ZJ1 A;  5KDM B;  3ITB A;  4OVD A;  4KZ3 A;  1KX4 C;  1BSG A;  4RA7 A;  4GHI B;  2UWX A;  1U35 D;  2XD1 A;  4NE6 A;  3REH D;  3AV1 C;  4QLC C;  4H6J A;  1HTZ A;  3D3O A;  3EOI A;  2ZQA A;  4Y0U A;  4MBF A;  3A6N A;  2C6W B;  1FCN A;  1W7F A;  5B40 B;  1JWV A;  1LSW A;  5KZH A;  5KSC A;  1P3K C;  1FOF A;  1T18 A;  5B32 D;  1P3A A;  1D7E A;  3AV2 D;  3HL9 A;  1KX3 D;  4KGC A;  1W63 M;  2RL3 A;  4GN2 A;  4ZUX B;  3WRZ A;  2BAS A;  4GH9 A;  3UTB C;  2VEA A;  5IS1 A;  3KXB D;  5E2G A;  3GR2 A;  4MN6 A;  4RX3 A;  4QY5 A;  4KZB A;  1L0F A;  1XGJ A;  3OPL A;  1H5X A;  3G4P A;  1H3Q A;  1P3F A;  2Y79 A;  4Q0H A;  3W99 B;  3REJ C;  5AY8 D;  3T12 B;  1U35 B;  5AVE A;  3C1C B;  2JKG A;  2QWS A;  3LIF A;  4R3J A;  1K55 A;  3F1P B;  2JE5 A;  1OTI A;  1IEM A;  2PD7 A;  2WGW B;  4XUJ C;  4BD1 A;  1NZU A;  1YQS A;  4ZBJ C;  4QB8 A;  1I2S A;  4E6W A;  1M1A C;  1AOI D;  3AZL B;  2WZZ A;  3REK B;  4EET B;  4EER A;  4UA9 A;  4QWO A;  1MY8 A;  5AVC C;  3IHA A;  1O07 A;  1G6A A;  2AVX A;  2JKR M;  4I3A A;  4HEF A;  4E3N A;  1DJB A;  1EI5 A;  2B95 A;  5CEB A;  3G32 A;  4C3Q A;  2HIO D;  3VOL A;  4X69 A;  5B1M B;  3UPO A;  5M18 A;  5L2F A;  3REH A;  3ZVW A;  2Z2L B;  3G34 A;  3BFD A;  2H5S A;  1XXM A;  4X53 A;  4KZ9 A;  2J8Y A;  2HDS A;  2Q0O A;  4JGO A;  1K6S A;  3NQU B;  4WU9 C;  2K7S A;  1J9M A;  2JHE A;  2PYO D;  4WBG A;  1W1V A;  2NUP C;  3CPT B;  5J7E A;  3CHW P;  5B32 A;  2Y2O A;  5GT0 C;  3AV2 A;  4YWZ A;  5E2E A;  1YSQ A;  1KX3 A;  4LD9 D;  1PI5 A;  1AOI B;  4IBC A;  3TU4 B;  2D02 A;  1WYC A;  2IO5 C;  3KXB A;  2ZM0 A;  4Q0I A;  2WUQ A;  4X56 A;  1EAK A;  1CF0 A;  5F1F A;  3PBS A;  1MKI A;  1P34 C;  3EPL A;  1KGE A;  4BL2 A;  2VX8 A;  4IBB A;  5AY8 A;  3MQQ A;  3WAA C;  4II7 A;  2ZQ8 A;  3C7V A;  2Q9N A;  5GT3 C;  5CPJ C;  4HH3 A;  2A49 A;  3QP4 A;  1XPB A;  3X1U D;  4WU8 D;  1AOI A;  1W1P A;  5J8X A;  3UB8 A;  5L07 A;  2O9B A;  4IBF A;  4DE3 A;  4UA7 A;  5B2J A;  1W2E A;  2W3F A;  4LD9 B;  5M19 A;  1PDC A;  4DN0 A;  5BPV A;  3LZ0 C;  2VKS A;  2ZBB A;  2ZL1 A;  3MKE A;  3DWK A;  3WD2 A;  4R8P B;  2HIO A;  3MGP C;  3B0D B;  1P3P C;  4ETX A;  3L2A A;  4E3O A;  2ZC3 B;  4UHU A;  1RGZ A;  2PYO A;  2Y2M A;  3BFE A;  5B31 G;  3B6F D;  2QJ7 A;  4EBP A;  3AL0 C;  3MGQ B;  1K54 C;  1K57 A;  2WGI A;  4ZDX A;  2OV5 A;  3RTY A;  4YM6 B;  3GTC A;  5AV8 B;  3VP2 A;  4LD9 A;  1YLY A;  1P3O C;  3WA9 D;  2Y2I A;  5TJJ A;  4EBN A;  4GHA A;  4YS3 D;  2EWV A;  3LIB A;  1KVL A;  2P9V B;  2KDK A;  1KGG A;  1OTA A;  2HP6 A;  1BH8 B;  4Z2K A;  1ONH A;  2YFW A;  1P3A C;  1XJ4 A;  1BUE A;  2HUE B;  5CPK B;  1GSV A;  3LI9 A;  2V8F A;  3SS3 A;  3FYZ A;  2ARO B;  1L2S A;  5AV6 D;  5B0Y D;  5G4Y A;  1J3W A;  5FDS A;  1TD5 A;  4CQH A;  3LZ1 D;  4Z5T D;  4LCL A;  1K0K A;  3X1U A;  4WU8 A;  1P3F C;  3KFU G;  3TOI A;  3T1X A;  1TS8 A;  4G3W A;  4WF0 A;  5AVB C;  4HP4 A;  1LL9 A;  1AXB A;  2GJ3 A;  5L10 A;  4EQ1 A;  1U60 A;  5DNM B;  4JJN B;  1T3U A;  2INW A;  2V1A A;  1RCJ A;  1HZO A;  4B4X A;  3HON A;  1I5Q A;  4ESP A;  4XZQ B;  1XFQ A;  2JSS A;  4C75 A;  5GXQ D;  3MNN C;  4E44 A;  2W3H A;  3LEL D;  1Q2P A;  3RFB A;  4Y0T A;  4KG2 A;  1E15 A;  3A0V A;  3AYW B;  4DF6 A;  1M6K A;  5B0Y B;  4O01 A;  2KX6 A;  5HDD A;  5HWV A;  3B6F A;  4Z9Q A;  1DY6 A;  3K2N A;  5CHL B;  2F8N B;  3G2Z A;  3EG5 B;  4IBG A;  4H9R B;  3AZK B;  4ZAM A;  5G49 B;  5F69 A;  3WA9 A;  3FKV A;  5GSU C;  2DNS A;  4YS3 A;  1UR9 A;  3HUO A;  3AZM C;  1XKZ A;  5AQA A;  3REL D;  2BG1 A;  1T1A A;  2VGL M;  5B32 C;  1S32 C;  3AFA B;  2NQB D;  1E6Z A;  2IOU A;  5B31 D;  3NIA A;  4IBX A;  4B88 A;  5AV6 A;  3CWF A;  3PBN A;  3MGS D;  1IKI A;  3T1S A;  5HD5 A;  3HBR A;  3KXB C;  5I94 A;  1VET B;  4EUV A;  3Q7Z A;  4ZRR A;  2WGV A;  3LZ1 A;  4Z5T A;  5CPI B;  4MN7 A;  4HME A;  3S7N A;  4CPK A;  3REI D;  5DTS A;  2QMI A;  3LY4 A;  3NQJ A;  4J8U C;  2FN2 A;  3HLD A;  3OBF A;  4UEY A;  3B47 A;  3VP0 A;  3D72 A;  4LCM A;  1YLW A;  2EFU A;  4GS9 B;  3R7W B;  1WE4 A;  2ZMA A;  2IWD A;  5DNN B;  5FQK A;  5BNV A;  3W98 B;  3AZF D;  3AZJ B;  3IH9 A;  2WKP A;  5GXQ A;  3S7P A;  1K6R A;  5B2J C;  3LEL A;  1GHI A;  1IYS A;  4HMC A;  5B31 B;  4HNB A;  5U47 A;  1CK3 A;  5CEC A;  3AZG C;  4R23 A;  1M19 C;  3NUL A;  4IED A;  4WLA A;  5L8M A;  1H8Z A;  4BLM A;  4NZ5 A;  1FR1 A;  2JKR I;  5CRF A;  3H82 A;  2VGJ A;  2NZD C;  1KX4 D;  1JFI A;  3S7O A;  2PYO C;  3OPH A;  3L27 A;  4HGA C;  3REL A;  1DP6 A;  3E4Q A;  1W8Q A;  3AV1 D;  4QLC D;  1BH9 A;  2NQB A;  4O0P A;  4NK3 A;  5B31 A;  2W1R A;  1F66 B;  3MGS A;  2XRO A;  1P3K D;  2PYR A;  4JLF A;  2JKF A;  4GD8 A;  4RYE A;  1NZO A;  2G2W A;  3GV9 A;  3UDI A;  4LPZ A;  3W2Z A;  3MFD A;  5JYO A;  1KX5 C;  3HJK A;  1P3M B;  3REI A;  3UTB D;  1B67 A;  3UT9 B;  1SZV A;  4OUI A;  1K38 A;  1Z2C B;  1M40 A;  4E45 A;  4FTX A;  3ZDJ A;  3KX0 X;  2G7U A;  1KGF A;  4PAU A;  2RVQ C;  3P7N A;  3REJ D;  4WU8 C;  2W3G A;  3T4Q A;  3W4O A;  3AZE C;  2BTF P;  3AGD A;  3AZF A;  3ZVT A;  3AV1 B;  2W8S A;  2HP5 A;  2GNX A;  3S7Q A;  2FFF B;  4XUJ D;  3UY6 A;  5HDC A;  4KZ5 A;  1M1A D;  1P3I D;  4MBK A;  3P01 A;  3F1O A;  4H9N B;  4Z2H A;  1PWC A;  3ZQ5 A;  3IWO A;  1LLB A;  3VE3 A;  3W4P A;  1GSX A;  1OJ5 A;  4DRT A;  4BWI A;  2J9O A;  5EFW A;  3FV7 A;  4NET A;  3L29 A;  1KX4 A;  4HES A;  4L0L A;  4Z1W A;  2KOI A;  2WAF A;  2XGN A;  3PYP A;  3AZI D;  3AV1 A;  4UQI S;  4QLC A;  3W96 D;  2BYK A;  1NYM A;  5BO0 A;  4Y13 A;  3WA9 C;  4WU9 D;  4OJL A;  2OLU A;  4YS3 C;  4CLC C;  5B33 C;  1P3K A;  5F99 B;  1SDE A;  5BNX B;  5GT0 D;  4CSR B;  3F1N A;  5HWT A;  2G5I C;  2ZMV A;  5AJG A;  3UTB A;  3DTI A;  5AVC B;  5TR7 A;  5GLA A;  4FOF A;  3LY3 A;  2A24 B;  5F6A A;  1BYW A;  4PM6 A;  1XFN A;  2HJE A;  4QPR A;  3KUY D;  1P34 D;  1CXW A;  2HF6 A;  2JC7 A;  1KE0 A;  3REJ A;  4E04 A;  1FCM A;  4X6T A;  3EEH A;  4P85 A;  3WAA D;  3KYZ A;  4U0T A;  4YFM A;  4OJO A;  3NOT C;  4KG6 A;  1ODV A;  4I3I A;  3X1S C;  1YMS A;  5GT3 D;  1LHY A;  3G2Y A;  5CPJ D;  4DJ2 A;  4E3K A;  4XUJ A;  5AV5 B;  4FH4 A;  5HD3 A;  5FAQ A;  1M1A A;  1P3I A;  1T1C A;  1L0E A;  4PM5 A;  3CJM A;  4I38 A;  4LGW A;  2XH9 A;  5F68 A;  3M2K A;  3MVD B;  1TDG A;  5HAI A;  3N8S A;  2PBY A;  1YM1 A;  5GXQ C;  3LEL C;  3G31 A;  4KZ6 A;  3HSH A;  3WS5 A;  2IO5 B;  1LL8 A;  3LID A;  4FCF A;  3D4F A;  5B0Z C;  1P3P D;  4F3L B;  3AZI A;  1OTB A;  4H9P B;  3W96 A;  3H9W A;  3LR3 A;  4G3K A;  1E8B A;  3IBJ A;  1E88 A;  1YU0 A;  2QKP A;  3EPK A;  3KSF A;  1EW0 A;  2J3W A;  4WU9 A;  3MMH A;  3H0L C;  3X1T D;  4Z2M G;  1GHM A;  3IS2 B;  5CPJ B;  4XUZ A;  3R45 B;  5GT0 A;  5CGX A;  5AV9 B;  4OPZ A;  5DF9 A;  1P3O D;  4OJ5 A;  4NE5 A;  3L28 A;  4Z2J A;  2HV1 A;  2OWJ A;  5FI2 A;  3MGS C;  5LBR A;  3IXD A;  1OME A;  1Q9C A;  4E3J A;  3E2K A;  4H9P A;  1P3A D;  2ZOI A;  3KUY A;  1P34 A;  3LZ0 B;  4BQM A;  2JBF A;  3IX8 A;  3REI C;  3MGP B;  3WAA A;  4R4S A;  4X1M A;  3WWX A;  5CHJ A;  2HDU A;  4S2K A;  5GT3 A;  4HH2 A;  2PYP A;  2ZY3 A;  5CTN A;  2V0W A;  3W97 C;  5I5L A;  3LJA D;  1OT9 A;  5CP6 C;  3LUQ A;  5AVB D;  2XFT A;  4OJ6 A;  4NXG A;  2O0Y A;  3UDX A;  1M18 C;  4G91 C;  3IXG A;  3A6N B;  5G4Z A;  2D49 A;  2XDM A;  1TDL A;  2HJ9 C;  1P3P A;  1F5M A;  4DJ3 A;  1P3A B;  3MNN D;  4R70 A;  2M1C A;  2OAP 1;  1L0G A;  4KGC B;  2XK1 A;  5CTM A;  1S1Z A;  3X1T A;  2VGK A;  1K54 A;  2Y2H A;  3WRT A;  5JA4 A;  3V9R A;  1P3O A;  1P3F B;  1YPR A;  1F2K A;  5GSU D;  1STZ A;  3B33 A;  3OLO A;  4WV4 B;  4U0X A;  2B02 A;  3AZM D;  2H28 A;  1MXO A;  2WKR A;  4OP8 A;  1S32 D;  2Z6C A;  3L7H A;  2F8N H;  3PBO A;  4NKP A;  5DJU A;  3RJU A;  1H8Y A;  4OPQ A;  1L0D A;  3G35 A;  2YFV A;  1YLZ A;  3MNN B;  1E6P A;  4NZ4 A;  3FG8 A;  2YKF A;  5FQ9 A;  3S1Y A;  1VB6 A;  3IWI A;  4RX2 A;  1YKD A;  3ISG A;  5EVL A;  3LJA A;  2QHK A;  3WTP D;  2HGV A;  4DE1 A;  5AVB A;  3A0S A;  3REH B;  4DKI A;  5IT5 A;  4JKT A;  4J8U D;  1KE4 A;  4S2N A;  3KSH A;  1E6R A;  4WN5 A;  3LIA A;  1OTD A;  4MB4 A;  2X02 A;  1P9R A;  5FQI A;  4IVK A;  3WD1 A;  1UWN X;  3EWK A;  1P3I C;  2ZJ9 A;  1BTL A;  2ZLY A;  4J8V C;  4LFU A;  5B32 B;  3MNN A;  3AV2 B;  1QO6 A;  5B2J D;  5DKK A;  4J8W C;  1KX3 B;  4Y2F A;  4PM7 A;  3NY4 A;  1ZLA A;  3AZH D;  3AZG D;  1K56 D;  1M19 D;  2ZM5 A;  1ONG A;  3KXB B;  2PR6 A;  5HDS A;  2OAQ 1;  4QY6 A;  3AZI C;  4H8R A;  3TJZ C;  3W96 C;  4OLD A;  4D2O A;  2NZD D;  1KE3 A;  5AY8 B;  5GSU A;  3BQ8 A;  2Y91 A;  3SH9 A;  2J80 A;  3AZM A;  1F9I A;  1RGY A;  3I7J A;  3C5A A;  3UN7 A;  1ID3 C;  3IX4 A;  4J8X C;  1S32 A;  3PBQ A;  4WMC D;  3SW1 A;  2Y55 A;  1VQQ A;  3O86 A;  1V9Y A;  4FH2 A;  4ZTK A;  2Y2J A;  5MC7 A;  4CAY A;  4R4R A;  5B2J B;  3O62 C;  2JKT I;  4Y7P A;  1TZY C;  2ZQ7 A;  4EWF A;  3KUY C;  1KX5 D;  5FEF A;  2ZL1 B;  3C2W A;  3BRM A;  1S0W A;  4S2P A;  2HIO B;  2NUT C;  3WTP A;  1Z09 A;  1T1B A;  1FIL A;  1MWT A;  2FJ7 C;  4LRY C;  4J8U A;  4K0X A;  1GXD A;  1N9O A;  1NXY A;  1OT6 A;  3CG5 A;  1SDN A;  1PFL A;  4FSF A;  1IOU A;  2RVQ D;  3P98 A;  2PYO B;  1ERM A;  2O9A A;  3AZE D;  4EEU A;  3A1I A;  1KDS A;  4OQI A;  3OZH A;  5CX7 A;  1L6J A;  4Z2I A;  3BLM A;  5TBM B;  2QYB A;  2KLI A;  3AZH A;  3AZG A;  2ZQD A;  5B1L A;  2CWE A;  1K56 A;  1M19 A;  3BLS A;  2EXB A;  1E3U D;  1VHM A;  5EEC A;  1CEF A;  2YFW B;  3HLE A;  3C30 A;  2NZD A;  3B3X A;  3FPW A;  3IBR A;  4OQG A;  4WZS B;  3X1T C;  5AQ7 A;  1BLP A;  3SS4 A;  3GQZ A;  4AWL C;  4WMC A;  5TBM A;  1Q2Q A;  2DRW A;  1HQ3 D;  3X1U B;  4WU8 B;  3KS4 A;  1PYY A;  4XUX A;  5TFQ A;  3W8K A;  1S4S A;  3H7W A;  2I9V A;  4CLC D;  3T4L A;  5B33 D;  3PXP A;  2V0U A;  5B2I C;  3C4O A;  4KUD D;  5BT1 C;  2GX5 A;  1YT4 A;  3T4K A;  3UPP A;  4LV2 A;  1KX5 A;  3FWL A;  1UWP X;  1D1J A;  3SH8 A;  2CV5 D;  1IEL A;  4B93 A;  2WKQ A;  1XA7 A;  4UQI M;  3QP8 A;  3DBA A;  3AZN D;  1MWU A;  3EEA A;  1HD8 A;  2XD5 A;  4MB3 A;  3AZE A;  3P09 A;  3LJA C;  2PRF A;  3GVB A;  3B6F B;  3X1S D;  3MS6 A;  3VP3 A;  3UTA D;  4S2N C;  2M7U A;  2W0N A;  1XJ6 A;  3WA9 B;  1P3L D;  2QZ6 A;  4YS3 B;  4HBT A;  4ETZ A;  2IA2 A;  5B33 B;  4HI4 A;  4JGQ A;  2W1T A;  4IBR A;  1P3B D;  4P6B A;  3ITA A;  4H9S C;  2QPN A;  1E3U A;  3IF6 A;  3NOU C;  5DF8 A;  4EV4 A;  2EFX A;  2R9W A;  4EXO A;  3A3F A;  1N1J A;  3E98 A;  4HHD A;  3MJQ A;  4G3V A;  4F94 A;  5B40 C;  3O88 A;  5AV6 B;  4LLO B;  1ZLA C;  2VV6 A;  3QP1 A;  2J3T C;  4A5R A;  1FQG A;  1G68 A;  5DVA A;  1LI0 A;  5B0Z D;  1ZG6 A;  4JF4 A;  4GB7 A;  3WS0 A;  3LZ1 B;  4Z5T B;  1O7E A;  3OCL A;  4ZUX C;  1HQ3 A;  1N9B A;  5CHM A;  1S66 L;  2P74 A;  1ZKJ A;  4CLC A;  3IH8 A;  5B33 A;  3X1S B;  2XQZ A;  5EM0 A;  3HLC A;  5DKL A;  3NQJ B;  3T1R A;  4KUD A;  4GOG A;  2EX6 A;  3PAG A;  4HJ3 A;  4WZ5 C;  2DF4 C;  3LR5 A;  4GKU A;  3W99 C;  4BBV A;  3U4L P;  3K3C A;  1T19 A;  2CV5 A;  5BNV B;  1PRQ A;  2PBD P;  3V67 A;  1ES5 A;  5GXQ B;  4KZ4 A;  4OQH A;  3LEL B;  5AVF A;  3AZN A;  1ERO A;  1FR6 A;  1TS7 A;  2ZD8 A;  3AZL C;  3JVU A;  3UMD A;  1R4V A;  5F1G A;  3V3R A;  5B0Z B;  3WTP C;  3VH5 A;  3X1S A;  3MGR C;  1NLZ A;  3UTA A;  3A3E A;  3LIE A;  4X23 C;  2RIQ A;  1UR8 A;  3H82 B;  1ULY A;  1P3L A;  1CJF A;  4ID4 A;  1JFI B;  3W97 D;  1GOI A;  3VP1 A;  2VA0 A;  3MBZ A;  2OLV A;  5B1M C;  1ZHH B;  1P3B A;  4X55 A;  5CP6 D;  3HVF A;  2EA9 A;  3REL B;  2XA7 S;  1N9N A;  5J4E A;  1BH9 B;  3BFG A;  4BBT A;  1M18 D;  2NQB B;  5DF7 A;  5HZH A;  1P3G D;  2HDR A;  3EQV A;  1E6N A;  3UB6 A;  3AZH C;  3MGS B;  5B1L C;  3DAV A;  1MWR A;  5B0Z A;  1XJ3 A;  3TSG A;  1H3O A;  4OPY A;  4HMD A;  1PW8 A;  2WAE A;  3REI B;  5HWW A;  1MPL A;  4U3T A;  4KQQ A;  1VEU A;  4UA6 A;  3ZG5 A;  2V20 A;  2K2N A;  2PR5 A;  4PKY G;  5A90 A;  1S4R A;  1TVF A;  4DMZ A;  3AZF B;  4GD6 A;  1MC0 A;  3CUE A;  3VOY A;  4G91 B;  4KUO A;  5TGF A;  3BWL A;  3Q7V A;  3WTP E;  1LT0 A;  3JVV A;  3F1O B;  1YLT A;  3ZG0 A;  4DDY A;  4EU0 A;  4NXB A;  1NJ4 A;  3B0B A;  1PI4 A;  2LB9 A;  3NC8 A;  5JRG D;  3HLG A;  4R3A A;  1XA1 A;  4MB5 A;  4CJN A;  2CC1 A;  4R8P C;  1KX4 B;  3W97 A;  4H9O A;  3A3D A;  5CP6 A;  3CIT A;  1SKF A;  4QLC B;  3BM6 A;  4JXG A;  4P6Z S;  1M18 A;  1XP4 A;  1P3G A;  2BYK B;  5BO0 B;  3VFH A;  2Y2P A;  3B0C W;  3BQA A;  3MGQ C;  2FZ0 A;  3P5J B;  4J8V D;  3JPU A;  4FUW A;  2RTS A;  3LR0 A;  1P3K B;  3PBT A;  1NRF A;  3IF6 C;  2J8P A;  3F1N B;  4J8W D;  4MLL A;  4ZBE A;  5F82 A;  1J7M A;  1TAF A;  3UTB B;  1BLC A;  1SKO B;  4ZJ2 A;  1OGG A;  1ZG4 A;  2V2F F;  2XLN A;  3X1V A;  5HPF A;  1DJC A;  5L09 A;  4OKP A;  1XJ2 A;  5CPK C;  1PNE A;  2ZM8 A;  4Z66 C;  3VH6 A;  3OPR A;  2ARO C;  1HQ3 C;  3REJ B;  5KSH A;  4NZ1 A;  4DDS A;  1YAX A;  1HTA A;  1NYY A;  3C1B D;  1ID3 D;  2DMW A;  4J8X D;  4KUD C;  4Q0J A;  4XUJ B;  2D01 A;  4EUZ A;  4LRX C;  3UE6 A;  4ZBJ B;  3U2A A;  4XT2 A;  1M1A B;  1JWP A;  2XF3 A;  4WNN A;  1P3I B;  3E2L A;  5BS7 C;  1SKO A;  4WUJ A;  1CK7 A;  3C38 A;  2CV5 C;  5EUA A;  3T1Q B;  4Y15 A;  4IHQ A;  5DNM C;  3O62 D;  3PR6 A;  4J8W B;  4JJN C;  5JRG A;  1TZY D;  1ALQ A;  3AZN C;  3PBR A;  3IWQ A;  4XZQ C;  1EQZ A;  1B6W A;  2FH5 A;  2FJ7 D;  3AZI B;  2Q9M A;  3W96 B;  3BY9 A;  5FUG B;  4S2L A;  3UTA C;  2VQR A;  3WKJ D;  3KWQ D;  2HZ5 A;  1P3L C;  4WU9 B;  1YU3 A;  4LG2 A;  3A3I A;  3KYQ A;  4I39 A;  3B0C T;  3H0R C;  4JPM A;  4J8V A;  2LY8 A;  1ID3 B;  3FKW A;  4WZ4 A;  1P3B C;  3F6T A;  4MBH A;  1YU4 A;  5GT0 B;  1S1Y A;  4IJE A;  2CMN A;  4HOI A;  5HSQ A;  4J8W A;  3NCK A;  4KHA A;  2PHY A;  3UB9 A;  4WJ3 C;  2RCX A;  1PWG A;  5EVI C;  3O3V A;  3AFA C;  2P7J A;  3B6G D;  3RXW A;  4KZ8 A;  3IQA A;  5FUG A;  3KUY B;  1P34 B;  4LRZ E;  3CZD A;  4PM8 A;  4PPR A;  2ZMF A;  4R1G A;  4FD8 A;  5GHZ A;  3GDI A;  4UUZ A;  4CLC E;  4PHT A;  3WAA B;  1GCE A;  4N9L A;  4HJ4 A;  3C1B A;  4M3K A;  1ID3 A;  5GT3 B;  2P08 A;  2VLG A;  3DTE A;  4E3I A;  1FCO A;  2GZA A;  5CPI C;  4J8X A;  2WYX A;  3N3F A;  2IWB A;  4NYU A;  3L26 A;  3AN2 D;  2Z6D A;  4GW9 A;  1K4F A;  3HJI A;  3MXS A;  1FSY A;  1N9L A;  5B2I D;  2H0Y A;  2YKH A;  2F8N K;  3O62 A;  4GJ4 A;  4PKY A;  5K5B A;  3CUE C;  5BT1 D;  1TZY A;  5E2F A;  4LEN A;  4NE3 A;  1H0M A;  4S2M A;  4S2J A;  4OQ0 A;  4Y0O A;  1CI9 A;  4OOY A;  1PWD A;  4MDZ A;  3W98 C;  2VZW A;  5FDH A;  3AZJ C;  2VK3 A;  4OPR A;  2FJ7 A;  5B24 D;  1P3P B;  4H9Q A;  3IHB A;  3G6O A;  3N6I A;  2BYM A;  4Y17 A;  1ES2 A;  4IVI A;  3WKJ A;  4NY2 A;  3Q81 A;  3KWQ A;  5DJT A;  3TRC A;  3UE1 A;  3DTK A;  1BUL A;  5E5A D;  3X1T B;  5KMW A;  3FKE A;  1ZC2 A;  3E0Y A;  3Q07 A;  4D60 A;  2XFS A;  4Z2L A;  4AWL B;  5E43 A;  5JA4 B;  3V9R B;  1P3O B;  3LEZ A;  3MZE A;  4P87 A;  1NRJ A;  1SHV A;  1P3G C;  1ES4 A;  3IT9 A;  3N7W A;  5GL9 A;  5B2I B;  5D3O A;  1P97 A;  5GHX A;  4IBJ A;  2EX9 A;  3B6G A;  3NDG A;  3WS1 A;  2OWH A;  4EO5 C;  1XX2 A;  5B40 D;  5EOE A;  5EOO A;  1ZLA D;  4IBD A;  2J3T D;  3FDD A;  1BT5 A;  4S2I A;  4ZJ3 A;  3BEC A;  2YFV B;  5FAT A;  4UAA A;  3E4O A;  3X1V C;  1W63 Q;  5HAR A;  3GRJ A;  5J3W A;  4ZUX D;  3AN2 A;  4M4X A;  3OCN A;  3IF5 A;  3E4P A;  1EWZ A;  3UT9 C;  3LJA B;  1KVM A;  3IXB A;  3RXX A;  5A92 A;  5AVB B;  3LFV A;  1S67 L;  3Q82 A;  5B2I A;  4YIN A;  4JGP A;  3MZD A;  3HCY A;  5DTT A;  4KUK A;  3W99 D;  4C6Y A;  4EBL A;  2PAV P;  1GPF A;  3C1C D;  3KO6 A;  4PM9 A;  3DWZ A;  4KQO A;  5B24 A;  1YU2 A;  5A91 A;  1W1Y A;  3EPJ A;  1JNU A;  4IBI A;  5JRG C;  3V3S A;  1TF1 A;  3MF0 A;  3AZL D;  3REK D;  1ZLA B;  5JYP A;  5E5A A;  4GNU A;  4EQI A;  1EQZ C;  5C5K A;  1NY0 A;  3HRE A;  3MGR D;  1OJG A;  2B5R A;  5KDM A;  2ZY5 A;  4X23 D;  2ZY4 A;  3SH7 A;  3ZYT A;  4E3M A;  4GHI A;  5GSU B;  3L25 A;  1MBL A;  1H0G A;  2DCF A;  5B1M D;  3KSY A;  3A3J A;  3ZHH A;  3AZM B;  1ESU A;  4H9S A;  3UE0 A;  1S32 B;  3NEC A;  4KZA A;  5CXW A;  4BBU A;  5B40 A;  3UO9 A;  4ME4 A;  5E2H A;  5FA7 A;  4CAY B;  5B1L D;  5F99 C;  3QNB A;  1IKG A;  4PMA A;  4X1L A;  4ZUX A;  3TU4 D;  5AQB A;  3AGE A;  3MQO A;  2FFY A;  2HPB A;  4L9G A;  4EES A;  4DXC A;  3WTP B;  1VM1 A;  2XA7 M;  3LI8 A;  3MGR B;  2O9C A;  3C1B C;  4J8U B;  2X71 A;  2G2U A;  3VH5 W;  2PU2 A;  1AIW A;  2ZC4 B;  4X23 B;  1TS6 A;  1H0I A;  4G92 C;  3QP6 A;  4WZ5 A;  3UB7 A;  3W99 A;  1U35 A;  2I72 A;  3C1C A;  3BFF A;  4MCW A;  3F1P A;  1IYQ A;  1A0K A;  2WGW A;  4WEL A;  4B4Z A;  5AV5 C;  5FQQ A;  2W3D A;  5FEG A;  4DE0 A;  2L4R A;  3AZL A;  1YU1 A;  4GZB A;  3REK A;  3AZH B;  3AZG B;  5B1L B;  3QP5 A;  1M19 B;  3UPN A;  3T50 A;  3MVD C;  3ZGA B;  4QJG A;  2R78 A;  3C8C A;  3MGR A;  1P0Z A;  4X23 A;  2F8N G;  4R6L A;  2ZM2 A;  3A1K A;  2NZD B;  4IJF A;  4R8P D;  3WKJ C;  1YLP A;  3KWQ C;  1ZTU A;  2X01 A;  5FAS A;  5B1M A;  4Q8I A;  3ZG7 B;  3MR0 A;  4HGA B;  3VMA A;  1KDW A;  4JBF A;  4OH0 A;  2BLS A;  3NQU A;  1GA9 A;  2OOL A;  3MFX A;  5GLB A;  3N4I A;  2ZQC A;  3SS5 A;  1ED7 A;  3H7W B;  3CPT A;  3MGQ D;  1W1T A;  1ACF A;  4YM6 D;  5AV8 D;  3ZCZ A;  2Z2M B;  5AV9 C;  2C5W B;  4JF6 A;  3B6G C;  3TU4 A;  4EEP A;  4IJG A;  2V1B A;  4K08 A;  3EGX C;  3BJN A;  4KQD A;  1KX5 B;  3BEB A;  3MXQ A;  5KIZ A;  3MQ0 A;  5GLD A;  5M1A A;  2A2L A;  1PIO A; 
#chains in the Genus database with same CATH homology
 3WX7 A;  1BZA A;  2PU4 A;  3VH5 T;  5CPK D;  3TG9 A;  4Z66 D;  2ARO D;  3AN2 C;  3AZE B;  2WKI A;  5FQJ A;  2F2A C;  3OC2 A;  4O7D A;  4WM9 A;  3VOZ A;  2Y2Q A;  3FZC A;  1GA0 A;  5B24 C;  3IF6 B;  5DNM D;  4JJN D;  3LCE A;  1N1J B;  3A6N C;  3UNW A;  1IYP A;  4R8P A;  5C3I C;  4IBK A;  4XZQ D;  5E5A C;  2Y59 A;  1SCW A;  4LV0 A;  4UPK A;  4X68 A;  4KGC C;  1PZO A;  4Z66 B;  1FSW A;  1HQ3 B;  4N9K A;  3VH6 W;  3AYW D;  3GMW A;  1YMX A;  4JXW A;  3MGQ A;  2EX2 A;  2F8N D;  5HFO A;  4YM6 A;  5AV8 A;  2ZC7 A;  4KUD B;  3AZK D;  4WYY A;  5DTK A;  3ZG8 B;  3G30 A;  2Y2K A;  2P9V A;  1K55 C;  2CV5 B;  1BH8 A;  5EVI D;  3ZNY A;  3AFA D;  3AZN B;  5CPK A;  3EPH A;  4Z66 A;  4OP5 A;  2ARO A;  3V50 A;  3SOI A;  4KZ7 A;  3M2J A;  5CPI D;  3UTA B;  2ZC5 B;  2H10 A;  4BD0 A;  5CED A;  4OOM A;  1P3L B;  5HL1 A;  5HX9 A;  5CGW A;  1U35 C;  5BS7 A;  4R0Q A;  3VFF A;  3C1C C;  3REH C;  1P3B B;  3GSG A;  5DNM A;  4JJN A;  1Y54 A;  4N92 A;  1IYO A;  2GDN A;  5DNN D;  4XZQ A;  4NYY A;  3REK C;  3W98 D;  4IBE A;  3AZJ D;  3EQU A;  5EVI B;  4DXB A;  3AV2 C;  1KX3 C;  1H3O B;  4JF5 A;  4E3L A;  2A3U A;  3AYW A;  3AGF A;  3VH6 T;  5B0Y A;  1RP5 A;  2F8N A;  4HBU A;  4H9R A;  3UE3 A;  3AZK A;  2Y2G A;  5G49 A;  5AY8 C;  2E8I A;  1W5D A;  4KG5 A;  3V39 A;  4E6X A;  5EVI A;  4P0M A;  3AFA A;  1AOI C;  2XR0 A;  4KQR A;  3Q7V B;  1F66 D;  3TU4 C;  3S4X A;  1E4D A;  5HAP A;  5G18 A;  3JYI A;  1MWS A;  4OOL A;  4LV3 A;  5CPI A;  3X1V D;  4S2O A;  1P3M D;  2L5A A;  2HIO C;  3W97 B;  4H9O B;  3UT9 D;  3N8L A;  5CP6 B;  1E25 A;  3KS8 A;  2EX8 A;  1YLJ A;  5GLC A;  2V1Z A;  1M18 B;  1PZP A;  5CHU A;  1P3G B;  1CEG A;  3NDE A;  4WEJ A;  5CER A;  5DNN A;  3VP4 A;  3W98 A;  3AZJ A;  1K57 C;  3N8R A;  4LD9 C;  1LL5 A;  4JXS A;  4EO5 B;  4KEN B;  1JWZ A;  1TAF B;  4DRB A;  3NI9 A;  4BEN A;  3B0D C;  1EQZ D;  5EE8 A;  3X1V B;  1Z6F A;  4MEZ A;  3IXH A;  5FI6 A;  3OPP A;  2Y4A A;  5F83 A;  2J9P A;  5EPH A;  1N4O A;  5FAO A;  4YM6 C;  5AV8 C;  2ZY2 A;  3X1U C;  4OJP A;  1F66 A;  4WNN B;  1BFM A;  2H0T A;  5FSR A;  3WS2 A;  5F99 D;  4BJP A;  1LI9 A;  5JRG B;  4WEK A;  2HUE C;  1P3M A;  3VSK A;  5AVC D;  3UT9 A;  4Z2M H;  1EQZ B;  3QHY A;  4RVA A;  1KU5 A;  3HLF A;  3ZG9 B;  5FQM A;  1QMF A;  5BOH A;  2OSU A;  1WWI A;  5HAQ A;  3LO7 A;  1K4E A;  3ZNT A;  1ES3 A;  3B6F C;  5IHV A;  4J8V B;  1PZR A;  1YUE A;  5AV5 D;  3NBL A;  5A93 A;  3QNC A;  2IWC A;  4KHA B;  4K91 A;  4H9N A;  2HP9 A;  3S22 A;  4OON A;  3W4Q A;  3MVD D;  2G5H C;  3H0M C;  2XEP A;  4MNR A;  5AQ9 A;  1WWS A;  1F1E A;  4UUZ B;  5AV6 C;  4K0W A;  3AYW C;  2R9X A;  2WKH A;  5B0Y C;  1JTG A;  1JTD A;  2J7V A;  3C1B B;  3LZ1 C;  3IP4 C;  4Z5T C;  3MZF A;  4J8X B;  4G92 B;  3C4P A;  3AZK C;  1ESI A;  4QD4 A;  3HUN A;  3M6B A;  4NZ3 A;  4XXR A;  5F99 A;  5BNX A;  1W79 A;  3ZFZ A;  4CSR A;  5AV9 D;  3O62 B;  1TZY B;  3UDF A;  5HW3 A;  1DJA A;  5AVC A;  3MKF A;  4JXV A;  1JVJ A;  2Y2L A;  2FJ7 B;  4H9Q B;  1K25 A;  3WS4 A;  2BYM B;  3LZ0 D;  2DQN C;  3VSL A;  3WKJ B;  3KWQ B;  4GHL A;  1TEM A;  3MGP D;  4OLG A;  4LV1 A;  2JCH A;  3MXR A;  2HDQ A;  1QME A;  5AV5 A;  1W8Y A;  1PW1 A;  5B32 G;  3HUM A;  1BLS A;  1I2W A;  1GHP A;  3DTM A;  5DNN C;  2WKE A;  3MVD A;  3REL C;  1C3B A;  4R3B A;  4DQY B;  3B6G B;  2WK0 A;  2NQB C;  5B31 C;  2WAD A;  3A6N D;  3BFC A;  1BLH A;  3BYD A;  4M6B A;  1S6R A;  1XGI A;  4DRA A;  4KGC D;  2WZX A;  3AN2 B;  4QNL A;  4GDB A;  4DE2 A;  3DW0 A;  3M6H A;  5CPJ A;  3PAE A;  3R45 A;  5AV9 A;  3V5M A;  5GHY A;  1P3F D;  2ZQ9 A;  1HVB A;  1F66 C;  3CMZ A;  2Y2N A;  4QU3 A;  3AZF C;  3O87 A;  5CGS A;  5B24 B;  5FI7 A;  2EXA A;  1ERQ A;  4NFT A;  5FAP A;  4BL3 A;  3LZ0 A;  1CI8 A;  4N1H A;  1WYB A;  4QHC A;  5C3I B;  1P3M C;  3C7U A;  3MGP A;  3HLB A;  1A7W A;  5E5A B;  3Q1F A;  3PTE A;  4N1X A;  4GDN A;  2ZC6 B;  3HLW A;  4ZJ1 A;  5KDM B;  3ITB A;  4OVD A;  4KZ3 A;  1KX4 C;  1BSG A;  4RA7 A;  2UWX A;  1U35 D;  2XD1 A;  4NE6 A;  3REH D;  3AV1 C;  4QLC C;  1HTZ A;  2ZQA A;  4Y0U A;  4MBF A;  3A6N A;  2C6W B;  1FCN A;  1W7F A;  5B40 B;  1JWV A;  5KZH A;  5KSC A;  1P3K C;  1FOF A;  5B32 D;  1P3A A;  3AV2 D;  3HL9 A;  1KX3 D;  4KGC A;  2RL3 A;  4GN2 A;  4ZUX B;  3WRZ A;  4GH9 A;  3UTB C;  3KXB D;  5E2G A;  3GR2 A;  4RX3 A;  4QY5 A;  4KZB A;  1L0F A;  1XGJ A;  3OPL A;  1H5X A;  3G4P A;  1P3F A;  3W99 B;  3REJ C;  5AY8 D;  1U35 B;  3C1C B;  4R3J A;  1K55 A;  2JE5 A;  1IEM A;  2WGW B;  4XUJ C;  4BD1 A;  1NZU A;  1YQS A;  4ZBJ C;  4QB8 A;  1I2S A;  4E6W A;  1M1A C;  1AOI D;  3AZL B;  2WZZ A;  3REK B;  4UA9 A;  1MY8 A;  5AVC C;  3IHA A;  1O07 A;  1G6A A;  4E3N A;  4HEF A;  1DJB A;  1EI5 A;  5CEB A;  3G32 A;  4C3Q A;  2HIO D;  4X69 A;  5B1M B;  3UPO A;  5M18 A;  5L2F A;  3REH A;  3ZVW A;  2Z2L B;  3G34 A;  3BFD A;  2H5S A;  1XXM A;  4X53 A;  4KZ9 A;  2J8Y A;  2HDS A;  1K6S A;  3NQU B;  4WU9 C;  1J9M A;  2PYO D;  4WBG A;  5B32 A;  2Y2O A;  5GT0 C;  3AV2 A;  5E2E A;  1KX3 A;  4LD9 D;  1PI5 A;  1AOI B;  4IBC A;  3TU4 B;  1WYC A;  2IO5 C;  3KXB A;  2ZM0 A;  2WUQ A;  4X56 A;  5F1F A;  3PBS A;  1MKI A;  1P34 C;  3EPL A;  1KGE A;  4BL2 A;  4IBB A;  5AY8 A;  3WAA C;  2ZQ8 A;  3C7V A;  2Q9N A;  5GT3 C;  5CPJ C;  2A49 A;  1XPB A;  3X1U D;  4WU8 D;  1AOI A;  5J8X A;  4IBF A;  4DE3 A;  4UA7 A;  5B2J A;  1W2E A;  4LD9 B;  5M19 A;  5BPV A;  3LZ0 C;  3MKE A;  3DWK A;  4R8P B;  2HIO A;  3MGP C;  3B0D B;  1P3P C;  3L2A A;  4E3O A;  2ZC3 B;  4UHU A;  1RGZ A;  2PYO A;  2Y2M A;  3BFE A;  5B31 G;  3B6F D;  4EBP A;  3AL0 C;  3MGQ B;  1K54 C;  1K57 A;  2WGI A;  4ZDX A;  2OV5 A;  4YM6 B;  3GTC A;  5AV8 B;  3VP2 A;  4LD9 A;  1YLY A;  1P3O C;  3WA9 D;  2Y2I A;  4EBN A;  4GHA A;  4YS3 D;  1KVL A;  2P9V B;  1KGG A;  2HP6 A;  1BH8 B;  1ONH A;  2YFW A;  1P3A C;  1BUE A;  2HUE B;  5CPK B;  3SS3 A;  3FYZ A;  2ARO B;  1L2S A;  5AV6 D;  5B0Y D;  3LZ1 D;  4Z5T D;  4LCL A;  3X1U A;  4WU8 A;  1P3F C;  3KFU G;  3TOI A;  5AVB C;  1LL9 A;  1AXB A;  1U60 A;  5DNM B;  4JJN B;  1T3U A;  1RCJ A;  1HZO A;  4B4X A;  3HON A;  1I5Q A;  4XZQ B;  2JSS A;  4C75 A;  5GXQ D;  3MNN C;  4E44 A;  3LEL D;  1Q2P A;  4Y0T A;  4KG2 A;  3AYW B;  4DF6 A;  1M6K A;  5B0Y B;  3B6F A;  4Z9Q A;  1DY6 A;  5CHL B;  2F8N B;  3G2Z A;  3EG5 B;  4IBG A;  4H9R B;  3AZK B;  4ZAM A;  5G49 B;  3WA9 A;  3FKV A;  5GSU C;  2DNS A;  4YS3 A;  3HUO A;  3AZM C;  1XKZ A;  5AQA A;  3REL D;  2BG1 A;  5B32 C;  1S32 C;  3AFA B;  2NQB D;  2IOU A;  5B31 D;  3NIA A;  4IBX A;  4B88 A;  5AV6 A;  3PBN A;  3MGS D;  1IKI A;  3HBR A;  3KXB C;  5I94 A;  3Q7Z A;  2WGV A;  3LZ1 A;  4Z5T A;  5CPI B;  4CPK A;  3REI D;  5DTS A;  2QMI A;  3LY4 A;  3NQJ A;  4J8U C;  3HLD A;  3VP0 A;  4LCM A;  1YLW A;  2EFU A;  1WE4 A;  2ZMA A;  2IWD A;  5DNN B;  5FQK A;  5BNV A;  3W98 B;  3AZF D;  3AZJ B;  3IH9 A;  5GXQ A;  1K6R A;  5B2J C;  3LEL A;  1GHI A;  1IYS A;  5B31 B;  5U47 A;  1CK3 A;  5CEC A;  3AZG C;  4R23 A;  1M19 C;  4IED A;  1H8Z A;  4BLM A;  4NZ5 A;  1FR1 A;  5CRF A;  2VGJ A;  2NZD C;  1KX4 D;  1JFI A;  2PYO C;  3OPH A;  3L27 A;  4HGA C;  3REL A;  1W8Q A;  3AV1 D;  4QLC D;  1BH9 A;  2NQB A;  4NK3 A;  5B31 A;  1F66 B;  3MGS A;  1P3K D;  4JLF A;  4GD8 A;  4RYE A;  1NZO A;  2G2W A;  3GV9 A;  3UDI A;  3MFD A;  5JYO A;  1KX5 C;  1P3M B;  3REI A;  3UTB D;  1B67 A;  3UT9 B;  4OUI A;  1K38 A;  1Z2C B;  1M40 A;  4E45 A;  3ZDJ A;  1KGF A;  2RVQ C;  3REJ D;  4WU8 C;  3W4O A;  3AZE C;  3AGD A;  3AZF A;  3ZVT A;  3AV1 B;  2W8S A;  2HP5 A;  2FFF B;  4XUJ D;  3UY6 A;  4KZ5 A;  1M1A D;  1P3I D;  4MBK A;  4H9N B;  1PWC A;  3IWO A;  1LLB A;  3W4P A;  4DRT A;  2J9O A;  3FV7 A;  4NET A;  3L29 A;  1KX4 A;  4HES A;  4L0L A;  2WAF A;  2XGN A;  3AZI D;  3AV1 A;  4QLC A;  3W96 D;  2BYK A;  1NYM A;  5BO0 A;  3WA9 C;  4WU9 D;  4OJL A;  2OLU A;  4YS3 C;  5B33 C;  1P3K A;  5F99 B;  1SDE A;  5BNX B;  5GT0 D;  4CSR B;  2G5I C;  3UTB A;  5AVC B;  5TR7 A;  5GLA A;  3LY3 A;  4PM6 A;  3KUY D;  1P34 D;  2JC7 A;  1KE0 A;  3REJ A;  1FCM A;  4X6T A;  4P85 A;  3WAA D;  4U0T A;  4YFM A;  4OJO A;  4KG6 A;  3X1S C;  1YMS A;  5GT3 D;  1LHY A;  3G2Y A;  5CPJ D;  4E3K A;  4XUJ A;  5AV5 B;  4FH4 A;  5FAQ A;  1M1A A;  1P3I A;  1L0E A;  4PM5 A;  3CJM A;  2XH9 A;  3M2K A;  3MVD B;  1TDG A;  5HAI A;  3N8S A;  2PBY A;  1YM1 A;  5GXQ C;  3LEL C;  3G31 A;  4KZ6 A;  3HSH A;  3WS5 A;  2IO5 B;  4FCF A;  3D4F A;  5B0Z C;  1P3P D;  3AZI A;  4H9P B;  3W96 A;  1YU0 A;  3EPK A;  4WU9 A;  3H0L C;  3X1T D;  4Z2M G;  1GHM A;  5CPJ B;  4XUZ A;  3R45 B;  5GT0 A;  5CGX A;  5AV9 B;  4OPZ A;  5DF9 A;  1P3O D;  4OJ5 A;  4NE5 A;  3L28 A;  5FI2 A;  3MGS C;  3IXD A;  1OME A;  1Q9C A;  4E3J A;  3E2K A;  4H9P A;  1P3A D;  3KUY A;  1P34 A;  3LZ0 B;  4BQM A;  2JBF A;  3REI C;  3MGP B;  3WAA A;  4R4S A;  3WWX A;  5CHJ A;  2HDU A;  4S2K A;  5GT3 A;  2ZY3 A;  5CTN A;  3W97 C;  3LJA D;  5CP6 C;  5AVB D;  2XFT A;  4OJ6 A;  3UDX A;  1M18 C;  4G91 C;  3IXG A;  3A6N B;  2XDM A;  1TDL A;  1P3P A;  1P3A B;  3MNN D;  1L0G A;  4KGC B;  2XK1 A;  5CTM A;  3X1T A;  2VGK A;  1K54 A;  2Y2H A;  3WRT A;  5JA4 A;  3V9R A;  1P3O A;  1P3F B;  5GSU D;  4WV4 B;  4U0X A;  3AZM D;  1MXO A;  4OP8 A;  1S32 D;  2F8N H;  3PBO A;  3RJU A;  1H8Y A;  4OPQ A;  1L0D A;  3G35 A;  2YFV A;  1YLZ A;  3MNN B;  4NZ4 A;  5FQ9 A;  3S1Y A;  3IWI A;  4RX2 A;  3ISG A;  5EVL A;  3LJA A;  3WTP D;  4DE1 A;  5AVB A;  3REH B;  4DKI A;  4JKT A;  4J8U D;  1KE4 A;  4S2N A;  2X02 A;  5FQI A;  4IVK A;  1P3I C;  2ZJ9 A;  1BTL A;  2ZLY A;  4J8V C;  5B32 B;  3MNN A;  3AV2 B;  5B2J D;  4J8W C;  1KX3 B;  4PM7 A;  3NY4 A;  1ZLA A;  3AZH D;  3AZG D;  1K56 D;  1M19 D;  2ZM5 A;  1ONG A;  3KXB B;  4QY6 A;  3AZI C;  4H8R A;  3W96 C;  4OLD A;  4D2O A;  2NZD D;  1KE3 A;  5AY8 B;  5GSU A;  2Y91 A;  3SH9 A;  3AZM A;  1RGY A;  3I7J A;  3UN7 A;  3C5A A;  1ID3 C;  4J8X C;  1S32 A;  3PBQ A;  4WMC D;  2Y55 A;  1VQQ A;  3O86 A;  4ZTK A;  4FH2 A;  2Y2J A;  4CAY A;  4R4R A;  5B2J B;  3O62 C;  4Y7P A;  1TZY C;  2ZQ7 A;  4EWF A;  3KUY C;  1KX5 D;  3BRM A;  1S0W A;  4S2P A;  2HIO B;  3WTP A;  1MWT A;  2FJ7 C;  4J8U A;  4K0X A;  1NXY A;  3CG5 A;  1SDN A;  4FSF A;  2RVQ D;  3P98 A;  2PYO B;  1ERM A;  3AZE D;  3A1I A;  1KDS A;  4OQI A;  3OZH A;  3BLM A;  3AZH A;  3AZG A;  2ZQD A;  5B1L A;  2CWE A;  1K56 A;  1M19 A;  3BLS A;  2EXB A;  1E3U D;  5EEC A;  1CEF A;  2YFW B;  3HLE A;  2NZD A;  3B3X A;  4OQG A;  4WZS B;  3X1T C;  5AQ7 A;  1BLP A;  3SS4 A;  3GQZ A;  4AWL C;  4WMC A;  1Q2Q A;  2DRW A;  1HQ3 D;  3X1U B;  4WU8 B;  3KS4 A;  1PYY A;  4XUX A;  5TFQ A;  3W8K A;  5B33 D;  5B2I C;  3C4O A;  4KUD D;  5BT1 C;  1YT4 A;  3UPP A;  4LV2 A;  1KX5 A;  3FWL A;  3SH8 A;  2CV5 D;  1IEL A;  1XA7 A;  3AZN D;  1MWU A;  1HD8 A;  2XD5 A;  3AZE A;  3P09 A;  3LJA C;  3GVB A;  3B6F B;  3X1S D;  3VP3 A;  3UTA D;  4S2N C;  3WA9 B;  1P3L D;  2QZ6 A;  4YS3 B;  4HBT A;  5B33 B;  4IBR A;  1P3B D;  4P6B A;  3ITA A;  4H9S C;  2QPN A;  1E3U A;  3IF6 A;  5DF8 A;  4EV4 A;  2EFX A;  2R9W A;  3A3F A;  1N1J A;  4F94 A;  5B40 C;  3O88 A;  5AV6 B;  1ZLA C;  4A5R A;  1FQG A;  1G68 A;  5DVA A;  1LI0 A;  5B0Z D;  1ZG6 A;  4JF4 A;  4GB7 A;  3WS0 A;  3LZ1 B;  4Z5T B;  1O7E A;  3OCL A;  4ZUX C;  1HQ3 A;  1N9B A;  5CHM A;  2P74 A;  1ZKJ A;  3IH8 A;  5B33 A;  3X1S B;  2XQZ A;  3HLC A;  3NQJ B;  4KUD A;  4GOG A;  2EX6 A;  3PAG A;  4WZ5 C;  2DF4 C;  4GKU A;  3W99 C;  2CV5 A;  5BNV B;  1ES5 A;  5GXQ B;  4KZ4 A;  4OQH A;  3LEL B;  3AZN A;  1ERO A;  1FR6 A;  2ZD8 A;  3AZL C;  1R4V A;  5F1G A;  3V3R A;  5B0Z B;  3WTP C;  3VH5 A;  3X1S A;  3MGR C;  3UTA A;  3A3E A;  4X23 C;  2RIQ A;  1ULY A;  1P3L A;  4ID4 A;  1JFI B;  3W97 D;  3VP1 A;  3MBZ A;  2OLV A;  5B1M C;  1P3B A;  4X55 A;  5CP6 D;  3HVF A;  3REL B;  1BH9 B;  3BFG A;  1M18 D;  2NQB B;  5DF7 A;  1P3G D;  2HDR A;  3EQV A;  3AZH C;  3MGS B;  5B1L C;  1MWR A;  5B0Z A;  3TSG A;  1H3O A;  4OPY A;  1PW8 A;  2WAE A;  3REI B;  1MPL A;  4U3T A;  4KQQ A;  4UA6 A;  3ZG5 A;  2V20 A;  5A90 A;  1TVF A;  3AZF B;  4GD6 A;  3VOY A;  4G91 B;  5TGF A;  3Q7V A;  3WTP E;  1YLT A;  3ZG0 A;  4DDY A;  1NJ4 A;  3B0B A;  1PI4 A;  3NC8 A;  5JRG D;  3HLG A;  1XA1 A;  4CJN A;  2CC1 A;  4R8P C;  1KX4 B;  3W97 A;  4H9O A;  3A3D A;  5CP6 A;  1SKF A;  4QLC B;  3BM6 A;  4JXG A;  1M18 A;  1XP4 A;  1P3G A;  2BYK B;  5BO0 B;  3VFH A;  2Y2P A;  3B0C W;  3MGQ C;  3P5J B;  4J8V D;  1P3K B;  3PBT A;  1NRF A;  3IF6 C;  2J8P A;  4J8W D;  4MLL A;  4ZBE A;  5F82 A;  1TAF A;  3UTB B;  1BLC A;  4ZJ2 A;  1ZG4 A;  2V2F F;  2XLN A;  3X1V A;  1DJC A;  4OKP A;  5CPK C;  2ZM8 A;  4Z66 C;  3VH6 A;  3OPR A;  2ARO C;  1HQ3 C;  3REJ B;  5KSH A;  4NZ1 A;  4DDS A;  1HTA A;  1NYY A;  3C1B D;  1ID3 D;  4J8X D;  4KUD C;  4XUJ B;  4EUZ A;  4ZBJ B;  1M1A B;  1JWP A;  2XF3 A;  4WNN A;  1P3I B;  3E2L A;  5BS7 C;  2CV5 C;  5EUA A;  5DNM C;  3O62 D;  4J8W B;  4JJN C;  5JRG A;  1TZY D;  1ALQ A;  3AZN C;  3PBR A;  3IWQ A;  4XZQ C;  1EQZ A;  1B6W A;  2FJ7 D;  3AZI B;  2Q9M A;  3W96 B;  5FUG B;  4S2L A;  3UTA C;  2VQR A;  3WKJ D;  3KWQ D;  1P3L C;  4WU9 B;  1YU3 A;  4LG2 A;  3A3I A;  3B0C T;  3H0R C;  4JPM A;  3FKW A;  4J8V A;  2LY8 A;  1ID3 B;  4WZ4 A;  1P3B C;  3F6T A;  4MBH A;  1YU4 A;  5GT0 B;  4IJE A;  4J8W A;  3NCK A;  4KHA A;  4WJ3 C;  2RCX A;  1PWG A;  5EVI C;  3O3V A;  3AFA C;  3B6G D;  3RXW A;  4KZ8 A;  3IQA A;  5FUG A;  3KUY B;  1P34 B;  4PM8 A;  3CZD A;  4PPR A;  4R1G A;  5GHZ A;  4FD8 A;  4UUZ A;  3WAA B;  1GCE A;  4N9L A;  3C1B A;  4M3K A;  1ID3 A;  5GT3 B;  4E3I A;  1FCO A;  5CPI C;  4J8X A;  2WYX A;  3N3F A;  2IWB A;  4NYU A;  3L26 A;  3AN2 D;  1K4F A;  3MXS A;  1FSY A;  5B2I D;  2H0Y A;  2F8N K;  3O62 A;  5BT1 D;  1TZY A;  5E2F A;  4LEN A;  4NE3 A;  4S2M A;  4S2J A;  4OQ0 A;  4Y0O A;  1CI9 A;  4OOY A;  1PWD A;  3W98 C;  5FDH A;  3AZJ C;  4OPR A;  2FJ7 A;  5B24 D;  1P3P B;  4H9Q A;  3IHB A;  3N6I A;  2BYM A;  1ES2 A;  4IVI A;  3WKJ A;  4NY2 A;  3Q81 A;  3KWQ A;  3UE1 A;  1BUL A;  5E5A D;  3X1T B;  5KMW A;  3FKE A;  1ZC2 A;  3Q07 A;  2XFS A;  4AWL B;  5E43 A;  5JA4 B;  3V9R B;  1P3O B;  3LEZ A;  3MZE A;  4P87 A;  1SHV A;  1P3G C;  1ES4 A;  3IT9 A;  3N7W A;  5GL9 A;  5B2I B;  5D3O A;  5GHX A;  4IBJ A;  2EX9 A;  3B6G A;  3NDG A;  3WS1 A;  4EO5 C;  1XX2 A;  5B40 D;  5EOE A;  5EOO A;  1ZLA D;  4IBD A;  3FDD A;  1BT5 A;  4S2I A;  4ZJ3 A;  3BEC A;  2YFV B;  5FAT A;  4UAA A;  3X1V C;  5HAR A;  3GRJ A;  4ZUX D;  3AN2 A;  3OCN A;  3IF5 A;  1EWZ A;  3UT9 C;  3LJA B;  1KVM A;  3IXB A;  3RXX A;  5A92 A;  5AVB B;  3Q82 A;  5B2I A;  4YIN A;  3MZD A;  5DTT A;  3W99 D;  4C6Y A;  4EBL A;  3C1C D;  4PM9 A;  3DWZ A;  4KQO A;  5B24 A;  1YU2 A;  5A91 A;  3EPJ A;  4IBI A;  5JRG C;  3V3S A;  3AZL D;  3REK D;  1ZLA B;  5JYP A;  5E5A A;  4GNU A;  4EQI A;  1EQZ C;  1NY0 A;  3HRE A;  3MGR D;  2B5R A;  5KDM A;  2ZY5 A;  4X23 D;  2ZY4 A;  3SH7 A;  4E3M A;  5GSU B;  3L25 A;  1MBL A;  2DCF A;  5B1M D;  3KSY A;  3A3J A;  3ZHH A;  3AZM B;  1ESU A;  4H9S A;  3UE0 A;  1S32 B;  4KZA A;  5CXW A;  5B40 A;  3UO9 A;  5E2H A;  5FA7 A;  4CAY B;  5B1L D;  5F99 C;  3QNB A;  1IKG A;  4PMA A;  4ZUX A;  3TU4 D;  5AQB A;  3AGE A;  2FFY A;  2HPB A;  4DXC A;  3WTP B;  1VM1 A;  3MGR B;  3C1B C;  4J8U B;  2X71 A;  2G2U A;  3VH5 W;  2PU2 A;  2ZC4 B;  4X23 B;  4G92 C;  4WZ5 A;  3W99 A;  1U35 A;  2I72 A;  3C1C A;  3BFF A;  1IYQ A;  2WGW A;  4WEL A;  4B4Z A;  5AV5 C;  5FQQ A;  4DE0 A;  3AZL A;  1YU1 A;  4GZB A;  3REK A;  3AZH B;  3AZG B;  5B1L B;  1M19 B;  3UPN A;  3MVD C;  3ZGA B;  4QJG A;  3MGR A;  4X23 A;  2F8N G;  2ZM2 A;  3A1K A;  2NZD B;  4IJF A;  4R8P D;  3WKJ C;  1YLP A;  3KWQ C;  2X01 A;  5FAS A;  5B1M A;  4Q8I A;  3ZG7 B;  4HGA B;  3VMA A;  1KDW A;  4JBF A;  4OH0 A;  2BLS A;  3NQU A;  1GA9 A;  5GLB A;  3N4I A;  2ZQC A;  3SS5 A;  3MGQ D;  4YM6 D;  5AV8 D;  3ZCZ A;  2Z2M B;  5AV9 C;  2C5W B;  4JF6 A;  3B6G C;  3TU4 A;  1KX5 B;  3BEB A;  5GLD A;  5M1A A;  1PIO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...