2Y2QA

Penicillin-binding protein 1b (pbp-1b) in complex with an alkyl boronate (z06)
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
489
structure length
469
Chain Sequence
ISEITYSDGTVIASIDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTGQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Guided Design of Cell Wall Biosynthesis Inhibitors that Overcome Beta-Lactam Resistance in Staphylococcus Aureus (Mrsa).
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
molecule keywords PENICILLIN-BINDING PROTEIN 1B
total genus 164
structure length 469
sequence length 489
chains with identical sequence B
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2y2qA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2y2qA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2y2qA02
3VSLA 5HAPA 5CHUA 3A3DA 1E3UA 1L2SA 1NYMA 5FQJA 2Y2GA 5DF9A 2WK0A 4R0QA 2H5SA 5EVIA 4DE3A 4KQQA 3G2YA 4OP5A 2PBYA 3HUMA 3LEZA 4EV4A 2J9PA 3ZG8B 5EUAA 5FASA 4GD8A 4PPRA 3V5MA 3ZFZA 3LO7A 3RXXA 4Y0OA 4CJNA 5AQ9A 1LI0A 1K56D 3FZCA 3PAGA 2Y2NA 1O7EA 2EFXA 5IHVA 3QHYA 1TVFA 4M3KA 4E3IA 5GL9A 4GKUA 4ZBEA 1BSGA 1KDWA 3UNWA 2CC1A 4FSFA 4OOLA 5F82A 1L0DA 3GMWA 5FATA 4RVAA 3ZHHA 4FH2A 2Z2LB 4QY5A 2WZXA 3TOIA 1W5DA 2H10A 1QMEA 3DWZA 4R3BA 1XP4A 1FOFA 3SS4A 4DE2A 4WYYA 2WYXA 2DRWA 5DTSA 5FI6A 1YLWA 3IXBA 4KENB 4KQOA 2Y59A 3O87A 3GSGA 3ISGA 2P9VB 4OOYA 4BL2A 5F1FA 2I72A 3RJUA 1LHYA 4E3MA 4FH4A 1FCMA 4OPYA 1K54A 4UHUA 1K55C 2ZLYA 4WZ5C 3ZG5A 1BUEA 1IKGA 4D2OA 4JF6A 5CRFA 4KG5A 4OONA 5F1GA 3G31A 1IELA 4MEZA 1YM1A 3HLGA 1XGJA 4DDSA 1S0WA 5M1AA 4JF5A 2XH9A 3A3FA 4PM9A 1W79A 2WGVA 4KZ4A 3ZNTA 3IF6B 4S2NC 3VP2A 1I5QA 3Q82A 5D3OA 3WRTA 5TR7A 1MWTA 1YQSA 3V3SA 4OVDA 4N1XA 2Y2PA 1XGIA 4GB7A 3PBTA 2Z2MB 3C4OA 2Y2JA 2FFFB 4R4SA 1XA7A 4OPQA 2HDSA 3WS2A 1JVJA 3BFGA 4PM6A 4UA6A 5EOOA 1W7FA 2J7VA 4DKIA 1HVBA 4Z9QA 3B3XA 4S2MA 4KZ6A 5AQ7A 3VFHA 2P9VA 1JTDA 1YLJA 2XD5A 1ONHA 5A90A 3GTCA 3MKFA 1BZAA 1YMSA 4S2LA 3V50A 1ZC2A 4X56A 1M40A 4GDBA 5HARA 1YMXA 1EI5A 5EVIB 3PBSA 3VP3A 4OKPA 1CEGA 4KZAA 3W4OA 1DJBA 3LY3A 1BLSA 2A49A 2ZC6B 3O86A 4E3OA 5M19A 2ZQ9A 3UPOA 3IF5A 5AQAA 1KE0A 3IWQA 2IWCA 4HEFA 4N1HA 4GDNA 1PYYA 4R23A 1O07A 2WADA 5CTNA 3EQVA 1BTLA 1SDEA 2IWDA 3AGDA 5J8XA 3WRZA 4YFMA 4KZBA 5CEDA 4K0XA 5FAQA 1Z6FA 2WKHA 4EBPA 5F83A 3LY4A 1M6KA 3NIAA 5EE8A 1G68A 3I7JA 1PZPA 3IHAA 4JPMA 4S2JA 3W8KA 4JXSA 3Q7VA 2ZC7A 4OQ0A 2HDQA 2Y2MA 3P98A 4RX3A 3OCLA 2VGJA 4S2OA 4KG2A 3HLCA 3IQAA 1DY6A 4S2PA 1NZUA 4WELA 2RCXA 4GN2A 5TGFA 1IYSA 4MBFA 1FSYA 2ZQAA 3QNBA 3WS0A 2OLVA 2JCHA 2WGIA 4KZ5A 3MZEA 4S2IA 3BFDA 5E2EA 3E2LA 5DF7A 3HLDA 5FAOA 3FKVA 3PBOA 2BG1A 1C3BA 5HAQA 3PBNA 1S6RA 3VOZA 1TDLA 2WKIA 3A3EA 3IF6C 4KZ9A 1RCJA 5CTMA 4ZDXA 4LV3A 1ALQA 1VM1A 4QU3A 2Y2OA 3C7VA 3V3RA 1ESUA 3HBRA 3VP0A 2V1ZA 3N8SA 3LCEA 1J9MA 3MXSA 2J8YA 2Y4AA 4ID4A 4U0XA 4ZJ2A 1L0EA 2QMIA 4BD1A 4UA9A 3TG9A 3ZG0A 3VP4A 1K6RA 4S2NA 4NK3A 4GNUA 4OQGA 5HX9A 4BD0A 4L0LA 4S2KA 1PWGA 1Q2QA 3SH9A 3UDIA 5HW3A 1IKIA 4OH0A 4QB8A 1YLYA 2WAFA 4JKTA 2ZC3B 3CJMA 3O3VA 1RGZA 1MWUA 3OPLA 1CK3A 2Y91A 3MXRA 3C4PA 2ZQ8A 3AGEA 4R1GA 1MXOA 1LLBA 4E3KA 4KG6A 2EXBA 3NCKA 4EWFA 1Q2PA 4IBXA 1KDSA 2FFYA 2XDMA 5E43A 4ZTKA 3IF6A 1ONGA 5FA7A 3N7WA 4U3TA 4IVIA 4LV2A 5KSCA 3HUOA 4PM8A 4K91A 1NXYA 1SDNA 2VGKA 3UY6A 1PW8A 3G30A 5CHMA 1NRFA 3M6BA 2HP6A 3OZHA 3Q7ZA 1LL5A 2OSUA 3HLFA 4ZJ1A 5FQQA 5EECA 4X6TA 1K25A 2Y2QA 4R3JA 4LCMA 3GR2A 1FCNA 5E2FA 1EROA 1KVMA 2HP9A 2R9WA 4Y0UA 4QJGA 1WYCA 3DWKA 4Y7PA 4DRTA 1ZKJA 1OMEA 4UAAA 1XXMA 3G2ZA 3SH8A 3ZVTA 4E3JA 3UE0A 3GV9A 1YLPA 2XFSA 3RXWA 4LV0A 3OC2A 1IYOA 1XX2A 1K56A 1GCEA 1K55A 4P6BA 1YLTA 4E3NA 5GLCA 4DXBA 2A3UA 3EQUA 3NC8A 3S4XA 3IXHA 2X01A 3GQZA 1Y54A 4QHCA 4OPZA 3W4QA 2JE5A 1IYQA 3N8RA 1FR6A 4MBHA 2C6WB 4XUZA 4F94A 3BFEA 3UE3A 3PBRA 3SOIA 1GHMA 1JWPA 4QD4A 2EFUA 3IXDA 4JF4A 1CEFA 4N9KA 3ITBA 1ES2A 3BEBA 3MBZA 4QY6A 5CXWA 3AGFA 3Q07A 3ITAA 4ZAMA 2J9OA 4WBGA 1HD8A 4JBFA 3DW0A 4EBLA 2R9XA 4C6YA 2G2UA 4EBNA 1BLCA 5EVIC 4O7DA 4OP8A 3BM6A 4GD6A 1HTZA 3BYDA 2WZZA 4X69A 5CGWA 2XFTA 4DE1A 5I94A 4PM5A 1K54C 3NDGA 2XR0A 4KQRA 4H8RA 3HLWA 3HL9A 3O88A 1QMFA 2ZM0A 4BENA 3S1YA 1GHIA 3ZGAB 2EX6A 1DJAA 4X68A 1NJ4A 1HZOA 5KZHA 5HL1A 4X53A 3WWXA 2XK1A 4B4XA 1L0FA 3HUNA 1JWZA 3OPHA 4IEDA 4P85A 3N4IA 4U0TA 4WMCA 5L2FA 1SKFA 3BRMA 5JYOA 3MZFA 4Q8IA 5A91A 4IVKA 4OQIA 4OPRA 1K57C 1NZOA 1KGFA 2WGWA 3Q1FA 2Y2HA 1ERQA 1XPBA 2WAEA 3CG5A 4K0WA 1CI9A 1KVLA 2ZQDA 3IXGA 5FSRA 2QPNA 1PWDA 1ES3A 4BJPA 2P74A 2Y55A 1H8ZA 2DCFA 3ZVWA 5CERA 5FQKA 4C75A 3G35A 1SCWA 1TDGA 3BFCA 4E6XA 1IEMA 2ZQ7A 2Y2KA 2H0YA 3VFFA 4WZ5A 4PM7A 5KMWA 1MPLA 1PW1A 5FQMA 1K38A 1FQGA 1KGEA 3IWIA 4WEJA 5EPHA 1H5XA 4RX2A 4DXCA 3FWLA 4OLGA 1E3UD 3HVFA 1PIOA 5E2HA 1W8YA 2G2WA 3G32A 3ZDJA 1G6AA 3A3JA 1K4FA 5E2GA 1E25A 1KE4A 2B5RA 2EX2A 1NY0A 2XQZA 3NI9A 5HFOA 5CGXA 3C7UA 3VMAA 4BL3A 5GLDA 5M18A 5CECA 5CGSA 1BLHA 1MWSA 5GLAA 2EX9A 4E3LA 4NETA 2ZMAA 3S22A 2DNSA 3VP1A 4MLLA 1FSWA 3Q7VB 1YT4A 3BFFA 3IH8A 1TEMA 3ZCZA 2PU4A 2BLSA 5EVLA 4JXGA 5GLBA 5FAPA 4C3QA 5TFQA 1U60A 2ZD8A 4KZ8A 1AXBA 3P09A 3PAEA 3ZNYA 4MBKA 4KZ3A 3NY4A 4DE0A 4LCLA 2HPBA 4P87A 4WZ4A 2V2FF 4R4RA 3N6IA 1IYPA 5GHYA 1RP5A 3GVBA 3ZG7B 1MY8A 3UDXA 3OPRA 3MFDA 1H8YA 3SS5A 1LL9A 3A3IA 1LI9A 1MKIA 4YINA 1GA0A 3MZDA 3UE1A 1WE4A 1K4EA 1BLPA 1KGGA 3GRJA 5DVAA 4HBTA 1ZG6A 2HDRA 1N9BA 2X71A 3FKWA 3G34A 3BECA 4HESA 4XXRA 5U47A 3VOYA 4CPKA 3JYIA 2ZQCA 5GHXA 5FI2A 2ZJ9A 1ERMA 4B4ZA 2QZ6A 2JC7A 3UPPA 1ES5A 2Q9NA 3TSGA 2C5WB 3OPPA 1FR1A 3IH9A 2ZC5B 2UWXA 1ZG4A 4IBRA 1JWVA 5AQBA 1XA1A 5BOHA 5DF8A 2IWBA 3M2KA 1RGYA 4N92A 5FQIA 3W4PA 1FCOA 1I2SA 3Q81A 2ZC4B 3UN7A 1MBLA 3UPNA 1PWCA 2Y2LA 4EUZA 5HAIA 3NBLA 4XUXA 1VQQA 4P0MA 2XEPA 3E2KA 4KZ7A 4RA7A 5FQ9A 4LV1A 3CZDA 2XLNA 1PZOA 2X02A 3DTMA 3NDEA 5FDHA 5A93A 2XGNA 5DTKA 1DJCA 5KSHA 1KE3A 5CHJA 2OLUA 3WS4A 4JLFA 3N8LA 3V39A 2XD1A 2XF3A 4RYEA 3UDFA 1JTGA 3HLBA 3QNCA 4MNRA 4UA7A 4X55A 5FI7A 4GZBA 1YLZA 4BQMA 3ZG9B 1L0GA 2WUQA 2HDUA 2ZM8A 1K6SA 2WGWB 1W8QA 2E8IA 1XKZA 2PU2A 1E4DA 1PI4A 4FCFA 3C5AA 1MWRA 1CI8A 2Q9MA 4JXWA 4PMAA 4DDYA 5JYPA 3HLEA 3M6HA 1ESIA 5EOEA 2H0TA 1I2WA 4OQHA 3IHBA 3MKEA 3CMZA 4WEKA 3G4PA 3IWOA 5EVID 2HP5A 4DF6A 1GA9A 1ES4A 4A5RA 1SHVA 3D4FA 5GHZA 4EQIA 2EX8A 4OOMA 5A92A 2V20A 3WS5A 4B88A 2EXAA 4ZJ3A 3BLSA 3HREA 4BLMA 3FV7A 3M2JA 3FYZA 3PTEA 1BULA 2RL3A 2WKEA 1NYYA 1BT5A 3OCNA 4GOGA 3BLMA 4OLDA 2Y2IA 2ZM2A 4WM9A 4WMCD 3UO9A 4JXVA 3WS1A 4N9LA 5CEBA 2OV5A 2GDNA 4LENA 3IT9A 4E6WA 4FD8A 3SH7A 1PI5A 1EWZA 5DTTA 1WYBA 3VSKA 1N4OA 4HBUA 1GHPA 2JBFA 5G18A 1K57A 3SS3A 4Y0TA 3PBQA
chains in the Genus database with same CATH superfamily
3VSLA 4JJNC 3KWQB 3UT9A 1E3UA 1YU3A 4R0QA 3LIBA 3AZHC 2P08A 2J9PA 4GD8A 3AZEB 1P3OC 1PDCA 4Y0OA 4CJNA 1M18B 2OWHA 3PAGA 5B1LA 1TVFA 1F66A 2G7UA 4M3KA 2CMNA 3A1KA 4HNBA 4FH2A 1HQ3B 3O62A 2Z2LB 4QY5A 4YWZA 4UPKA 3D3OA 3WAAB 2FJ7D 4DE2A 4WYYA 2WYXA 2DRWA 1YLWA 3IXBA 4WL9A 3O87A 3GSGA 2P9VB 4R6LA 4BL2A 1E6ZA 2EWWA 4E3MA 1W1TA 4UHUA 3REIC 1KX4D 1J7MA 1K55C 1KX5D 5G4YA 4NG2A 4JF6A 5F1GA 4OONA 3TE8A 1D06A 1T18A 3HLGA 5BT1C 1P3AB 4JF5A 4PM9A 4KZ4A 3VP2A 1I5QA 4KHAB 4DMZA 5E5AC 3LIDA 3ZQ5A 3HONA 1YQSA 3M7PA 4OVDA 3V3SA 4KUOA 3WD4A 2W1TA 3EOIA 2Y2PA 3VH5T 4WNNA 1XGIA 5AV9A 4H9QB 1P3FD 2Z2MB 4IBIA 3F1OB 2HZ5A 1JVJA 3BFGA 4PM6A 2W3FA 5EV0A 4IHQA 1W7FA 4DKIA 4MB3A 1OTEA 5E5AB 2W3GA 5AQ7A 3V67A 2P9VA 4QLCC 2XD5A 3L7HA 3MKFA 1OJGA 1L6JA 1EI5A 3R45A 1S1ZA 2ZQ9A 3SW1A 1M18C 5EM1A 5B0ZD 1YAXA 3REIB 3X1UB 1QO6A 4XUJD 4R23A 4R3AA 2HJEA 2IWDA 5FAQA 3W99D 5AVBB 4Z5TC 2V8CA 5GSUC 5F83A 1P3ID 4EESA 3RH8B 2YFVA 5GT3D 3LELB 3IHAA 3W8KA 2ZC7A 3UTAB 2HDQA 4FUWA 2Z6CA 2ZBBA 3FPWA 4RX3A 2JKTM 3REKC 2VGJA 4EW7A 5HD3A 3MGSD 4J8UD 5AVEA 3AZIC 3HCYA 4CSRB 3AFAA 1FSYA 1H8PA 1KX5A 5B2IA 1U35D 5CP6B 5B24C 3X1TD 3T1RA 5B2JD 2NZDA 3UTAC 2D49A 3MZEA 4S2IA 5E2EA 3E2LA 3W97D 3HLDA 5FAOA 3FKVA 3PBOA 5B31D 3BQ8A 5KDMA 2FJ7B 5HAQA 3PBNA 4BWIA 3VOZA 1TDLA 2WKIA 3C38A 4KZ9A 3B6GD 1VM1A 2Y2OA 3AZLB 4X25A 2V1ZA 5AV9D 1P3GA 3LCEA 4BBUA 3UTBC 4U0XA 4HP9A 4ZJ2A 3VP4A 4KUDD 4OQGA 2ZY2A 4Z2MG 2GNXA 5B32C 3B6FB 4WN5A 1M1AC 2ZOIA 3W2ZA 1P9RA 4BD0A 4R8PD 4HMCA 1IKIA 5AVCA 4Q0JA 3X1SC 4R1GA 1X0OA 5G4ZA 2KDKA 3PR6A 2HIOC 3WKJA 3H82B 4MN5A 4IBJA 2QKPA 2ZM5A 2AROA 2VEAA 1UR9A 5JA4B 4GCZA 3UY6A 2LB5A 1PW8A 5CHMA 1P3KB 3M6BA 4H9QA 1S32C 1VB6A 4G91C 2Y2QA 1SKOA 1KVMA 3KUYC 4QJGA 3N3FA 1XJ6A 2QJ5A 3KO6A 1ZKJA 3H7WA 1P34A 4UAAA 3SH8A 4IBKA 5JRGB 3OC2A 1K56A 3NECA 4P6BA 4E3NA 3VH6T 5GLCA 5FUGA 3W97A 1VHMA 2X01A 5B1LC 2JE5A 4IBFA 3QP4A 4MBHA 2F8NA 5CPJA 2YFWB 3L29A 3X1TA 4NE3A 1YU1A 3SOIA 1NLYA 4PKYG 4QD4A 2EFUA 2A24A 1CEFA 3R7WB 3ITAA 5CPIA 4WBGA 4UQIM 3DW0A 4C6YA 3KWQD 3AV1B 1PFLA 3REJC 1BH9B 4GD6A 3BYDA 3C1CD 3LYXA 1P3FA 4PM5A 1K54C 3QP8A 3MNNC 4H8RA 3DBAA 3HL9A 1N9OA 2ZM0A 1GHIA 1G28A 5KZHA 4EEUA 5HL1A 3WWXA 3WTPB 4B4XA 4IEDA 4GHAA 5AV8D 1A0KA 1GSXA 4J8VA 4WMCA 1SKFA 3AYWC 3MZFA 4YM6A 1L3LA 4OQIA 2J8PA 1AOIB 1NZOA 2Y2HA 3FC7A 5CPIC 3ZNYA 3AV2C 4WV4B 1KVLA 3IXGA 1P3KA 3WTPA 4H9SC 2V5OA 3UMEA 4I3JA 2HIOD 3REJA 4C75A 1EQZC 1TDGA 4UUZA 5B32B 3B6FC 2LY8A 4PM7A 3E4OA 3WD2A 2M7UA 4WEJA 5EPHA 3F1PB 3UT9D 1E3UD 4ARZB 3A3JA 1CJFA 2OOLA 5E2GA 4UQIS 3C1BD 3T4LA 5I5LA 1YSPA 4J8WD 2XQZA 3VMAA 3LZ1C 5AV9C 5CECA 1MWSA 1P3AC 1GPFA 1P3KC 2YFWA 2DNSA 2RIQA 4HQAA 1P3BB 4LLOB 5J4EA 3Q7VB 3BFFA 5GT3B 3T4QA 5B0ZC 5EVLA 2ZD8A 5B33C 3P7NA 4LCLA 1JFIA 4P87A 3AYWD 3T4TA 1WWIA 3N6IA 3VH5W 3GVBA 2K2NA 1MY8A 3UDXA 4LFUA 3LELC 3MFDA 3AV1D 1LI9A 1DRMA 5B0ZB 3U4LP 3KSGA 2HUEB 4Z66C 3LZ1A 4EXOA 1GA0A 1ULYA 1K4EA 1WE4A 2Y79A 1KGGA 5AV8A 3F6TA 2X71A 4HESA 1WA9A 5BT1D 3E4PA 2H28A 1UGUA 5IS1A 1KX3C 1VEUA 2ZJ9A 3C1CB 4B4ZA 5B0ZA 5E5AD 3MS6A 2JC7A 5GT0D 4GHIA 3UPPA 5B31G 4TX8A 1E6PA 3AYWB 2J3WA 1FR1A 3QP2A 1ZG4A 4IBRA 1JWVA 5AQBA 3AZJB 1P3MD 4N92A 1CXWA 2XSSA 4EQ1A 1FCOA 4WUJA 4GHIB 4GS9A 5FUGB 3W97B 4XUXA 3AZEA 3RFBA 3A6NC 4P0MA 2JKGA 3IS2A 5B2IC 3OLOA 3KS8A 5A93A 1PZOA 2PAVP 4O0PA 3IX4A 2PR6A 5FDHA 2XGNA 1DJCA 2VLGA 4JLFA 4KQDA 3V39A 2XD1A 2XF3A 4H9RB 4L9EA 4RYEA 3AFAD 3W96C 3HLBA 4UA7A 1L0GA 3X1VA 4MDZA 3ZVWA 1P3LA 2ZM8A 1XKZA 2VA0A 1LT0A 1P3IA 2Q9MA 5AV6A 4YOFA 3NULA 4NZ3A 2L0WA 3W96D 2RVQD 3MKEA 3CMZA 4DF6A 4A5RA 1SHVA 5EFWA 2O0YA 5GHZA 3AN2B 3DTEA 4OOMA 5AV5A 3AZNA 4R8PC 1OPXA 3VV4A 3W96A 5AVFA 4LGWA 2PYOA 2OAP1 1BT5A 3OCNA 3AN2D 5F99A 3BLMA 2Y2IA 4GOGA 3X1VC 5CEBA 1TZYC 2GDNA 5CPJC 2V0WA 4FD8A 3SH7A 3JPUA 1K0KA 1EWZA 3VSKA 4HP4A 2YKFA 3W98B 1ID3D 1GHPA 4IUHA 4J8WB 4GHLA 5HAPA 3AN2A 5BPVA 3G6OA 3WAAA 1F66B 2H5SA 5B40D 3KUYB 4KQQA 2HF6A 3G2YA 3HUMA 3LEZA 3NQJA 3W98A 3LGOA 4P6ZS 3V5MA 3ZFZA 1K56D 3PHYA 5B1MD 3LELD 1VETA 2L4RA 5IHVA 4B9OA 4GKUA 5B40A 3UNWA 2CC1A 2ZOHA 4FSFA 5IU1A 2F8ND 5F82A 4WNNB 5B1MB 3VOLA 3KYZA 5L8MA 5HPIA 1E6NA 2H10A 2OAQ1 4R3BA 3X1VB 3SS4A 3T50A 5B40B 3KUYD 1GXDA 3AZHA 4OOYA 4JGRA 5F1FA 1MC0A 3O5YA 3RJUA 5FDSA 1FCMA 1K54A 2ZLYA 2VJWA 3UB8A 1IKGA 4D2OA 5TBMB 2CV5B 1IELA 4X23C 4DDSA 4H6JB 5M1AA 3BY8A 3A3FA 3B0DC 1OGGA 5D3OA 3W96B 5TR7A 5DNNC 3AYWA 5HD5A 3REKB 5AY8C 3LJAC 4N1XA 5DNND 4QLCD 3C4OA 2EA9A 2FFFB 3WTPC 4OPQA 3AZJC 1P3GB 1M1AB 5EOOA 2PD8A 3B3XA 1P3FC 1P3MC 4H6JA 1EQZB 1BZAA 4EU0A 2V1AA 4MN6A 1YMSA 3F1OA 4X56A 1M40A 4GDBA 3S7PA 3PBSA 2F8NH 3A0VA 3FDDA 1BLSA 2A49A 2ZC6B 3LR4A 3O86A 4E3OA 1S66L 3MNND 3MJQA 4ZRRA 4N1HA 4I39A 3LIEA 4Z66A 1PYYA 1N1JB 3AV2A 3BWLA 3EQVA 3VE3A 1BTLA 3IX3A 5JA4A 4K0XA 1Z6FA 4CAYB 2MJ6A 2WKHA 1EQZA 3KX0X 1M6KA 5EE8A 1G68A 5B33A 4H9NB 1PZPA 4JPMA 2BYKA 5C5KA 1H3OA 4JXSA 5C3IB 4M4XA 1EAKA 3C1CC 1F66C 3A0SA 2F8NK 2Y2MA 3P98A 2Y8HA 2JKTI 3REJD 3X1UA 4S2OA 4NE5A 4KG2A 1NZUA 4WELA 4LD9B 4H9NA 4HJ6A 4I3AA 5TJJA 4MBFA 5AY8D 4CAYA 1TD5A 2J80A 4KZ5A 2K31A 1MZUA 2BG1A 1YUEA 2HUEC 1C3BA 4R70A 5CTMA 4LV3A 3C7VA 1P3BD 3HBRA 3VP0A 3C1CA 3KXBA 3MF0A 2J8YA 2O99A 1L0EA 3TG9A 4S2NA 5HPFA 5E5AA 4GNUA 4H9PA 2NQBA 5AV6C 3REHA 2INWA 5HX9A 1P3FB 1OGBA 4NZ5A 1PWGA 3BJNA 1Q2QA 5MC7A 3L26A 4QB8A 1YLYA 1F1EA 2WAFA 5DNMC 3CJMA 3AZMD 2D01A 2IO5B 2Z6DA 5EVID 2Y91A 3MXRA 3C4PA 2ZQ8A 4LD9C 4KG6A 2EXBA 4XZQD 4J8VB 5B32D 1KDSA 5E43A 1P0ZA 4ZTKA 1ONGA 4DN0A 5FA7A 3N7WA 4U3TA 4IVIA 5AVCB 4K91A 1NXYA 2VGKA 5F68A 1P3LC 3SZTA 3A0RA 1TAFB 3OZHA 3Q7ZA 5FQQA 4X6TA 2KLIA 1FCNA 5B32A 5AVBC 4Q0IA 3DWKA 3AN2C 3CUEC 1P3LD 1ZLAA 3G2ZA 4E3JA 5CPIB 3X1SA 3GV9A 2XFSA 4LD9A 1IYOA 4KGCD 4RQ9A 1GCEA 1TS8A 4XUJA 2IOUA 2A3UA 3S4XA 3IXHA 3GQZA 4X1LA 1Y54A 4QHCA 4NE6A 5F99C 3WA9A 2PYOD 4F94A 3BFEA 3AV2B 3PBRA 1GHMA 5AV5D 3IBJA 4I38A 5GSUB 1ES2A 3AFAC 5CXWA 3T1XA 1P3BC 3Q07A 1S32B 2J9OA 5F99D 5BO0A 2NZDC 1AOIA 5AV6D 2XA7M 2XFTA 3NDGA 4JGPA 4KQRA 3X1SB 5GT3C 3S1YA 4GJ4A 1BH8A 1KX3B 3MGQA 3L27A 3WA9C 1HZOA 4X23A 2VZWA 4QPRA 3E98A 3HUNA 2JN7A 4DRBA 1P3PD 4LRZE 1CF0A 4GW9A 4Z2IA 4WU8C 1M1AA 2BASA 4IVKA 4UA9A 1KGFA 4K0WA 3OOVA 2M1CA 2QPNA 4Z1WA 1PWDA 5GXQC 3AZJA 5A8BA 2DCFA 5FQKA 3G35A 3LZ0A 3MSHA 4Z66D 1B67A 1PW1A 1S67L 1K38A 1FQGA 3TRCA 3IWIA 1M19D 3KSHA 1H5XA 3RELB 4OLGA 2NZDB 1PIOA 3HVFA 5E2HA 3WAAD 1P34B 1K4FA 1STZA 1E25A 2VQRA 1BH8B 1A7WA 2B5RA 2EX2A 4XUJB 5CPKC 1NY0A 5HFOA 1M19C 4EUVA 4KGCA 3MQOA 5GLDA 5M18A 3WA9B 4BBTA 1FILA 3UB9A 4E3LA 4NETA 4NZ4A 4MLLA 3AZLD 1FSWA 2B95A 3IH8A 5AJGA 1U60A 3AZIB 5AV6B 3P09A 3PAEA 4KZ3A 2QYBA 3NY4A 4WU8D 4WZ4A 3LJAD 4LRXC 4Y5FA 1H0IA 2CWEA 3AZFB 2FJ7C 1EW0A 3MZDA 3TJZC 4G3WA 4NXFA 1CQAA 2VGLM 3GRJA 1P3PA 2VV6A 4HBTA 3UT9C 4CPKA 5B31B 3JYIA 5GHXA 4X23D 4JGOA 3REHD 4OJLA 1ERMA 4PAUA 3X1TB 3MNNA 3B47A 2O9AA 2UWXA 4ZUXA 4GLQA 5BOHA 1RGYA 5HWWA 4LPZA 5FQIA 3UT9B 1R4VA 3FPVA 5FEGA 3UN7A 3LELA 1MBLA 3UPNA 3X1UD 3QP1A 4J8VC 4H9RA 5HAIA 3DAVA 4CLCE 3UE6A 4K08A 1P3IB 3CZDA 3DTMA 5AV8C 5KSHA 4DJ2A 4X1MA 5CHJA 4NYYA 2OLUA 1ID3B 5GSUA 4XZQB 5G49A 3D72A 4ZBJB 1JTGA 4MNRA 3AZMB 2M7VA 5B32G 3WTPD 5GXQB 1TS6A 2YKHA 1CI8A 4JXWA 4PMAA 4DDYA 5CPJD 2RTSA 5EOEA 1I2WA 3WA9D 4QWOA 1KOUA 4GS9B 1P3OD 3IWOA 1GA9A 3D4FA 1F9IA 2HV1A 4B88A 1M19B 3AZKB 3BLSA 2J3TD 1SZVA 5B2JA 2NZDD 1DP8A 3NQUB 1TS7A 2XA7S 3FV7A 3M2JA 3S7NA 1BULA 5HWVA 4XZQA 3UO9A 5HDDA 4JXVA 3WS1A 2W8SA 4LENA 3AZMA 1PI5A 1ZHHB 1UWNX 4ME4A 5DNMD 1N9NA 4Y0TA 3SS3A 1K57A 4Z2MH 4XT2A 1YKDA 3EPHA 5L09A 3A3DA 1L2SA 4ZUXD 1NYMA 5FQJA 2Y2GA 1VETB 5DF9A 4YS3D 1S4RA 4DE3A 4Y17A 4OP5A 2PBYA 4EV4A 3CLOA 3ZG8B 5AV5C 5EUAA 4R8PA 5DFXA 3X1SD 3LO7A 2HIOA 3WKJC 4OJ5A 3RXXA 5AQ9A 1LI0A 3FZCA 3K3DA 2W3HA 1O7EA 2EFXA 1ODVA 1OT9A 3QHYA 5CHLB 4JJNB 3UTBD 4IJGA 4E3IA 4ZBEA 3REKA 2KOIA 1P3PB 5F99B 5FATA 3H0RC 3TOIA 5HL6A 5CPJB 1QMEA 3QP6A 1FOFA 5J7EA 2CV5A 1BYWA 3C2WA 5DTSA 4DQYB 3E4QA 3B6GC 1AOIC 4KQOA 1ZLAC 2Y59A 4PKYA 3LUQA 3ISGA 1HQ3A 3O62B 1LHYA 4FH4A 4OPYA 3H0MC 3V9RB 3AZGA 1BUEA 4CQHA 3HSHA 5CRFA 4KG5A 5L10A 2BYMA 3G31A 4WF0A 5B24D 4MEZA 1YM1A 4WLAA 1XGJA 4KGCB 5CP6A 2XH9A 1PZRA 2E8JA 3ZNTA 3IF6B 1G6OA 3Q82A 3WRTA 4J8XA 4WU8A 4GB7A 1XFNA 4HH3A 2Y2JA 4O01A 4R4SA 1XA7A 2HDSA 2PR5A 3KXBB 3MMHA 1IOUA 5F69A 1CK7A 3MGPD 2WKPA 4S2MA 4KZ6A 3VFHA 3W99C 1JTDA 5A90A 1ONHA 3GTCA 5DNMB 2JHEA 2IO5C 3MGQC 4IBEA 5HARA 1YMXA 4EO5C 1S4SA 5EVIB 3VP3A 4J8WC 3VH6A 4KZAA 2BYMB 1DJBA 1DP9A 1LSWA 3LY3A 3AZND 4MMNA 1W1PA 3IBRA 4L9GA 4J8XC 2EWVA 2HIOB 3IWQA 4GDNA 4MN7A 3KFUG 2PD7A 2WADA 4JJNA 5CTNA 4H9SA 3WRZA 5CEDA 1XJ2A 3S7OA 4EBPA 3LY4A 3B0CT 4Z2GA 3W99A 4S2JA 2F2AC 1F66D 3UB5P 4WU9A 2V8FA 4CLCA 3MGRA 3C30A 3IQAA 3W98D 1DY6A 2RCXA 2PBDP 2YFVB 3P5JB 1H0GA 2FJ7A 1F5MA 1IYSA 3DTIA 4KGCC 5BNVA 3QNBA 2PYPA 1P3AA 1V9YA 2WGIA 2ZMFA 1G5UA 5BS7C 4BMWA 1LSVA 4HMDA 4HY8A 4NXEA 1KX4C 2XRNA 2AROB 4J8XB 3EGXC 2HGVA 3TW8A 5BNXA 3A3EA 5B31A 4MCWA 1ALQA 4QU3A 1KS0A 1P3AD 1ESUA 4HGAC 4CLCC 3KWQC 2Y4AA 4ID4A 1E15A 1GSVA 2VK3A 3LFVA 4NK3A 3KSYA 3F1PA 3BW6A 3T4KA 4ETXA 3HJIA 4L0LA 2PDRA 3UDIA 4OH0A 3WD0A 4X23B 2ZC3B 2NQBD 5TBMA 3MFXA 3WKJD 1MWUA 3OPLA 1CK3A 4X53A 1MXOA 1LLBA 4E3KA 1NRJA 4EWFA 1EQZD 1Q2PA 4F3LA 4QLCA 2XDMA 2ZMVA 5IT5A 4KHAA 1NWZA 5KSCA 3HUOA 4G3KA 4DJ3A 1SDNA 1E88A 4IJEA 2HP6A 4M6BA 1ZTUA 3AZMC 3HLFA 5GT0B 4NEED 4ZBJC 3NOUC 4WU9D 4QLCB 3O62C 2BTFP 2J3TC 5E2FA 1W1VA 3O62D 3A6NA 2HP9A 1OTBA 2LB9A 2R9WA 4OJOA 4CLCB 4DRTA 2PT7A 2ACGA 1NLZA 3ZVTA 2QJ7A 5B0YD 1YLPA 4CSRA 3RXWA 3CAXA 4B93A 1ACFA 4DXBA 4NZ1A 3NC8A 3T4SA 3W4QA 2B02A 3B6GB 1IYQA 3N8RA 1FR6A 5HZHA 3UE3A 5DJTA 3IXDA 5BNXB 3ITBA 5G49B 4QY6A 3X1VD 5AVBA 1D7EA 3AGFA 1UR8A 2F8NB 4JBFA 4EBLA 3MGQB 2G2UA 4EBNA 4EO5B 4O7DA 5EVIC 2G5HC 3D9YA 1HTZA 4X69A 2WZZA 5CGWA 5J3WA 3B0CW 5B0YC 3NOPC 4LRYC 2O9CA 5B2JC 4IBDA 2QWSA 3HLWA 3O88A 5FL3A 3ZGAB 1DJAA 1NJ4A 1S1YA 3BY9A 3KXBC 1YSQA 3LI9A 3UTAD 2XK1A 1L0FA 1JWZA 3OPHA 1M18A 4BBVA 4F3LB 1KX3D 3W99B 4U0TA 3BRMA 5JYOA 5A91A 4OPRA 3TU4D 1P3BA 3CG5A 1XPBA 3CI6A 2WAEA 4J8VD 4O8GA 5FSRA 1ES3A 1HTAA 2P74A 2Y55A 3WAAC 3EEHA 1H8ZA 5CERA 2R78A 3BFCA 1HQ3C 4KUKA 3H9WA 3VFFA 2ZQ7A 2H0YA 4WZ5A 5KMWA 2AROD 3AZGC 4LG2A 5HWTA 3PYPA 5GT3A 5GSUD 4RX2A 1P9WA 3FWLA 4DXCA 3C1BA 3A6ND 1ZLAB 2G2WA 3MR0A 3G32A 5B33D 1G6AA 3ZDJA 5CP6C 5B24B 1AIWA 5GXQD 4WZSB 1Y28A 2OWJA 4NYUA 3NI9A 1Q9CA 5CGXA 2ZL1B 4CLCD 2PYRA 1BLHA 5GLAA 5B24A 4HOIA 5B2ID 3VP1A 3AZLC 2ZMAA 5GXQA 4HMEA 4IBCA 1YT4A 3IX8A 2PU4A 2BLSA 3R7WA 4C3QA 5GLBA 4H9OB 5TFQA 1AWIA 4AWLC 3W97C 4MBKA 4HJ4A 2V2FF 4R4RA 5DFYA 1SKOB 1RP5A 4E04A 1KX5B 1H3QA 3ZG7B 2WKRA 3MGPA 3OPRA 2NUTC 3WKJB 1Z09A 2VGLS 3AZNB 5JRGA 2W3EA 3UE1A 1W2EA 1ZG6A 1WWSA 1N9BA 3FKWA 3G34A 5U47A 3VOYA 2K7SA 5FI2A 3UB6A 3AZJD 5EM0A 1F2KA 3VH6W 1ES5A 1P3MA 2Q9NA 3TSGA 1FIKA 2L1MA 4QNLA 3KYQA 3L28A 1XA1A 2IWBA 1AOID 3PXPA 5B40C 5F6AA 3Q81A 2F8NG 3AZGB 2QHKA 2Y2LA 4EUZA 3NBLA 3LEQA 4R8PB 3E2KA 4KZ7A 3F1NB 4RA7A 1P3KD 2XLNA 1DP6A 3NDEA 1P3PC 2B18A 5DTKA 5B1LB 1KE3A 3B6FD 3LICA 3N8LA 2A24B 3AZHD 5AV9B 1LSXA 5EVEA 5DKKA 3UDFA 5B1LD 4IBGA 5FI7A 4EERA 4GZBA 4JJND 3UTBB 1J3WA 4LD9D 5AV5B 4WU9C 3K3CA 3L2AA 2HDUA 1W8QA 1K6SA 4FCFA 3WD1A 3AZGD 1E4DA 1MWRA 4H9OA 1W63Q 3HLEA 1U35A 4Z2HA 1ESIA 2IA2A 2H0TA 1M19A 5AY8A 4WEKA 3G4PA 5CPID 3S7QA 1W1YA 1ES4A 3IS2B 4XT2B 4OUIA 2EX8A 2V20A 1P3OA 4NY2A 2VKSA 3PTEA 1OTDA 1JNUA 5LBRA 2XROA 4KUDA 1NYYA 4WMCD 3LIFA 4N9LA 4HJ3A 1XJ4A 3EPJA 3EPKA 2KX6A 3AL0C 2VV7A 4OJ6A 2NQBC 5DTTA 4WJ3C 4Z2JA 1N4OA 2GJ3A 2JBFA 4HBUA 5G18A 4Z2KA 5CHUA 1T1CA 1M1AD 2A2LA 4II7A 2WK0A 5EVIA 1KX3A 1TS0A 3A6NB 4I5SA 5FASA 4PPRA 1GSWA 4NXBA 3REIA 5B0YA 3MQ0A 2DQNC 4ZUXC 3LZ0D 4XZQC 2Y2NA 1N1JA 4HI4A 2PYOB 5GL9A 3X1UC 1BSGA 1E6RA 1KDWA 4OOLA 5AV8B 3B42A 3CPTB 1L0DA 3GMWA 3T12B 4RVAA 3ZHHA 3CHWP 2WZXA 2DF4C 3UB7A 1OT6A 4UUZB 1W5DA 3E0YA 3DWZA 1XP4A 1P3LB 3GECA 4WU9B 2GZAA 5FI6A 4KENB 2W0NA 4E44A 3RELA 2I72A 4Y15A 5AY8B 1MKMA 3OBFA 4WZ5C 4XUJC 3ZG5A 4Z5TB 3R45B 3AV1A 3KYEA 1S0WA 3MGSA 4J8UA 3F1NA 5AVCD 1W79A 2WGVA 4S2NC 3AZKA 1MWTA 4GH9A 4FTXA 3DTKA 2FZ0A 3PBTA 3K2NA 2UV0E 5C3IC 2CV5C 4Z2LA 3WS2A 5AVCC 3BQAA 3RELC 4UA6A 4Z5TA 2J7VA 2FN2A 1HVBA 4Z9QA 3AZHB 1YLJA 2PRFA 3MGQD 2W3DA 1YU2A 4S2LA 3V50A 1ZC2A 4AFIA 4OKPA 1H3OB 4MB4A 3AZID 1CEGA 3W4OA 5M19A 3MGPC 3UPOA 4G3VA 3REKD 3IF5A 5AQAA 1KE0A 2IWCA 4Y3IA 4HEFA 1GOIA 1O07A 1KX5C 2W27A 3JVVA 4YS3A 3UTAA 2AVXA 4DRAA 1SDEA 3AGDA 3CUEA 5J8XA 4YFMA 1P34C 2CV5D 5BNVB 4KZBA 2ZY3A 1ZLAD 5HSQA 3LZ0C 3W98C 3B33A 3NIAA 2VV8A 3I7JA 1LL8A 3TU4A 1OJ5A 5L07A 3Q7VA 4OQ0A 2D02A 1E8BA 3T4OA 3OCLA 4J8WA 1V9ZA 1T1AA 3HLCA 5CP6D 3U2AA 1P3IC 4S2PA 1T1BA 4NXGA 3TU4B 2DMWA 3FG8A 4GN2A 5TGFA 4Y13A 2FH5A 2ZQAA 1BFMA 4HHDA 3WS0A 1W63M 2OLVA 2JCHA 3MGSB 4J8UB 4MB5A 3EGDC 3C1BB 3AZLA 4JGQA 4ARZA 3B6GA 1TZYD 3BFDA 5DF7A 2BYKB 3AZNC 1S6RA 3TU4C 3IF6C 3MGRB 1RCJA 4G91B 4ZDXA 1VEUB 3V3RA 2JKRI 3N8SA 4R38A 1TZYA 1J9MA 3MXSA 3LR0A 4BD1A 2QMIA 3ZG0A 1HQ3D 1K6RA 1P3MB 3KXBD 5DNNA 4Q0HA 3LJAA 4S2KA 3SH9A 1PRQA 4OJPA 5HW3A 1PNEA 4JKTA 4ESPA 3AZFD 3O3VA 1RGZA 5B2IB 4P6ZM 3AGEA 5DNNB 1HLUP 2P7JA 1TF1A 3B6FA 3NCKA 5B1MC 4IBXA 2FFYA 3IF6A 4LV2A 3MVDD 3LR5A 4PM8A 4KUDC 3T1SA 3G30A 4NKPA 1NRFA 5K5BA 2HJ9C 3CITA 1LL5A 2OSUA 1Z2CB 3REID 4ZJ1A 5EECA 4UEYA 1K25A 4IUKA 3V9RA 4R3JA 3LZ0B 4LCMA 3GR2A 5CPKA 1EROA 3MVDC 4Y0UA 1WYCA 5DJUA 4Y7PA 1OMEA 3B0BA 1XXMA 2Q0OA 1H8MA 3UE0A 2PHYA 4HH2A 1XX2A 3AFAB 1K55A 1YLTA 3L25A 3EQUA 1KX4B 1YU0A 2WKQA 4OPZA 4I3IA 2C6WB 4XUZA 3H0LC 4AWLB 3QP5A 5HDSA 1JWPA 4JF4A 4ZUXB 4N9KA 1U35C 3MBZA 3BEBA 2P04A 5GT0A 4YS3C 4ZAMA 5CX7A 1TZYB 1HD8A 3T1QB 5BS7A 2R9XA 3T4JA 5F5YA 1BLCA 5JRGD 4OP8A 1YPRA 1KX4A 3BM6A 5FEFA 3MGPB 5I94A 3REHB 4DE1A 2XR0A 3AZFA 1F98A 1QMFA 2O9BA 4BENA 3AZED 2EX6A 1YU4A 4X68A 3A1IA 4Y2FA 4G92C 3MQQA 3UMDA 3MXQA 2ZL1A 4P85A 3AZKC 3N4IA 3LZ1D 5L2FA 1P3OB 5GT0C 3IP4C 4Q8IA 1K57C 3LIAA 2WGWA 3Q1FA 4PHTA 1ERQA 1CI9A 2ZQDA 4KUDB 1TAFA 1M18D 4BJPA 3ZYTA 5DNMA 3KSFA 1SCWA 4E6XA 1IEMA 2Y2KA 4YM6B 3WTPE 2JKFA 1MPLA 5FQMA 3AZFC 1KGEA 3AV1C 3EPLA 3EEAA 4L9FA 1W8YA 3H7WB 3MGSC 4J8UC 4Z66B 1JFIB 2L5AA 5B2JB 1KE4A 2JKRM 1O6IA 5KDMB 3R4KA 1T3UA 3C7UA 1P34D 4BL3A 1XJ3A 1ED7A 5CGSA 3REJB 4E45A 3WX7A 2EX9A 3S22A 4G92B 3MNNB 3MQLA 4ETZA 4IBBA 2W1TB 1XFQA 1TEMA 3ZCZA 4H9PB 2NQBB 4YS3B 4JXGA 5FAPA 3CPTA 3HJKA 4NFTA 1U35B 1OTIA 4KZ8A 1AXBA 4DE0A 1OTAA 2HPBA 3LR3A 3WD3A 3C1BC 1P3GC 1IYPA 5GHYA 4EEPA 5KIZA 4Z5TD 3NOTC 1H8YA 3SS5A 1LL9A 3AZIA 3A3IA 3REHC 2ZY5A 1MKIA 4YINA 3AZEC 2G5IC 4D60A 1BLPA 5DVAA 2W1RA 2JSSA 2HDRA 4XXRA 4YNRA 3BECA 4J8XD 4HGAB 2ZQCA 3AZKD 3EWKA 2QZ6A 5CPKB 1B6WA 4WU8B 2C5WB 3ICYA 1N9LA 2AROC 2ZC5B 3IH9A 1P3GD 3OPPA 2V0UA 3MVDB 5DF8A 2GX5A 3M2KA 3W4PA 1S32A 1I2SA 3UTBA 5B33B 3CWFA 1KU5A 3VH5A 3LZ1B 2ZC4B 3ULFA 1D1JA 1PWCA 1ID3A 3AV2D 4HIAA 3NQJB 1BH9A 1T19A 1VQQA 2XEPA 5FQ9A 4LV1A 2X02A 1P97A 3L9KA 3NQUA 3WS4A 5CPKD 2V1BA 3FKEA 3KSIA 3P01A 5B1MA 3RELD 3QNCA 4X55A 2PYOC 4BQMA 1YLZA 3ZG9B 2VX8A 3MGRD 2ZY4A 2WUQA 2WGWB 2E8IA 2PU2A 3MGRC 1PI4A 3VE4A 3C5AA 4FOFA 1IFQA 1H0MA 5JYPA 1ID3C 3M6HA 4EETB 4OQHA 3IHBA 2V9AA 3KUYA 3GDIA 3B0DB 3JVUA 2HP5A 5AVBD 2NUPC 1Y4OA 5DKLA 5HDCA 3LJAB 4EQIA 5A92A 3WS5A 2EXAA 4ZJ3A 3NHQA 2I9VA 3HREA 4BLMA 3FYZA 4YM6D 2RL3A 5B31C 2WKEA 4OLDA 4WM9A 2ZM2A 3KS4A 3KWQA 2OV5A 3IT9A 4E6WA 3EG5B 3X1TC 5BO0B 3H82A 2RVQC 3LI8A 1WYBA 1UWPX 3NJAA 3RTYA 4YM6C 5JRGC 1S32D 5B0YB 4LV0A 4IJFA 3C8CA 3PBQA 3MVDA
chains in the Genus database with same CATH topology
3VSLA 4JJNC 3KWQB 3UT9A 1E3UA 1YU3A 4R0QA 3AZHC 2J9PA 4GD8A 3AZEB 1P3OC 4Y0OA 4CJNA 1M18B 3PAGA 5B1LA 1TVFA 1F66A 4M3KA 3A1KA 4FH2A 1HQ3B 3O62A 2Z2LB 4QY5A 4UPKA 3WAAB 2FJ7D 4DE2A 4WYYA 2WYXA 2DRWA 1YLWA 3IXBA 3O87A 3GSGA 2P9VB 4BL2A 4E3MA 4UHUA 3REIC 1KX4D 1K55C 1KX5D 4JF6A 5F1GA 4OONA 3HLGA 5BT1C 1P3AB 4JF5A 4PM9A 4KZ4A 3VP2A 1I5QA 4KHAB 5E5AC 3HONA 1YQSA 3V3SA 4OVDA 2Y2PA 3VH5T 4WNNA 1XGIA 5AV9A 4H9QB 1P3FD 2Z2MB 4IBIA 1JVJA 3BFGA 4PM6A 1W7FA 4DKIA 5E5AB 5AQ7A 2P9VA 4QLCC 2XD5A 3MKFA 1EI5A 3R45A 2ZQ9A 1M18C 5B0ZD 3REIB 3X1UB 4XUJD 4R23A 2IWDA 5FAQA 3W99D 5AVBB 4Z5TC 5GSUC 5F83A 1P3ID 2YFVA 5GT3D 3LELB 3IHAA 3W8KA 2ZC7A 3UTAB 2HDQA 4RX3A 3REKC 2VGJA 3MGSD 4J8UD 3AZIC 4CSRB 3AFAA 1FSYA 1KX5A 5B2IA 1U35D 5CP6B 5B24C 3X1TD 5B2JD 2NZDA 3UTAC 3MZEA 4S2IA 5E2EA 3E2LA 3W97D 3HLDA 5FAOA 3FKVA 3PBOA 5B31D 5KDMA 2FJ7B 5HAQA 3PBNA 3VOZA 1TDLA 2WKIA 4KZ9A 3B6GD 1VM1A 2Y2OA 3AZLB 2V1ZA 5AV9D 1P3GA 3LCEA 3UTBC 4U0XA 4ZJ2A 3VP4A 4KUDD 4OQGA 2ZY2A 4Z2MG 5B32C 3B6FB 1M1AC 4BD0A 4R8PD 1IKIA 5AVCA 3X1SC 4R1GA 2HIOC 3WKJA 4IBJA 2ZM5A 2AROA 5JA4B 3UY6A 1PW8A 5CHMA 1P3KB 3M6BA 4H9QA 1S32C 4G91C 2Y2QA 1KVMA 3KUYC 4QJGA 3N3FA 1ZKJA 1P34A 4UAAA 3SH8A 4IBKA 5JRGB 3OC2A 1K56A 4P6BA 4E3NA 3VH6T 5GLCA 5FUGA 3W97A 2X01A 5B1LC 2JE5A 4IBFA 4MBHA 2F8NA 5CPJA 2YFWB 3L29A 3X1TA 4NE3A 1YU1A 3SOIA 4QD4A 2EFUA 1CEFA 3ITAA 5CPIA 4WBGA 3DW0A 4C6YA 3KWQD 3AV1B 3REJC 1BH9B 4GD6A 3BYDA 3C1CD 1P3FA 4PM5A 1K54C 3MNNC 4H8RA 3HL9A 2ZM0A 1GHIA 5KZHA 5HL1A 3WWXA 3WTPB 4B4XA 4IEDA 4GHAA 5AV8D 4WMCA 4J8VA 1SKFA 3AYWC 3MZFA 4YM6A 4OQIA 2J8PA 1AOIB 1NZOA 2Y2HA 3ZNYA 5CPIC 3AV2C 4WV4B 1KVLA 3IXGA 1P3KA 3WTPA 4H9SC 2HIOD 3REJA 4C75A 1EQZC 1TDGA 4UUZA 5B32B 3B6FC 2LY8A 4PM7A 4WEJA 5EPHA 3UT9D 1E3UD 3A3JA 5E2GA 3C1BD 4J8WD 2XQZA 3VMAA 3LZ1C 5AV9C 5CECA 1MWSA 1P3AC 1P3KC 2YFWA 2DNSA 2RIQA 1P3BB 3Q7VB 3BFFA 5GT3B 5B0ZC 5EVLA 2ZD8A 5B33C 4LCLA 1JFIA 4P87A 3AYWD 1WWIA 3N6IA 3VH5W 3GVBA 1MY8A 3UDXA 3LELC 3MFDA 3AV1D 1LI9A 5B0ZB 2HUEB 4Z66C 3LZ1A 1GA0A 1ULYA 1K4EA 1WE4A 1KGGA 5AV8A 3F6TA 2X71A 4HESA 5BT1D 1KX3C 2ZJ9A 3C1CB 4B4ZA 5B0ZA 5E5AD 2JC7A 5GT0D 3UPPA 5B31G 3AYWB 1FR1A 1ZG4A 4IBRA 1JWVA 5AQBA 3AZJB 1P3MD 4N92A 1FCOA 5FUGB 3W97B 4XUXA 3AZEA 3A6NC 4P0MA 5B2IC 3KS8A 5A93A 1PZOA 5FDHA 2XGNA 1DJCA 4JLFA 3V39A 2XD1A 2XF3A 4H9RB 4RYEA 3AFAD 3W96C 3HLBA 4UA7A 1L0GA 3X1VA 3ZVWA 2ZM8A 1P3LA 1XKZA 1P3IA 2Q9MA 5AV6A 4NZ3A 3W96D 2RVQD 3MKEA 3CMZA 4DF6A 4A5RA 1SHVA 5GHZA 3AN2B 4OOMA 5AV5A 3AZNA 4R8PC 3W96A 2PYOA 1BT5A 3OCNA 3AN2D 5F99A 3BLMA 2Y2IA 4GOGA 3X1VC 5CEBA 1TZYC 2GDNA 5CPJC 4FD8A 3SH7A 1EWZA 3VSKA 3W98B 1ID3D 1GHPA 4J8WB 4GHLA 5HAPA 3AN2A 5BPVA 3WAAA 1F66B 2H5SA 5B40D 3KUYB 4KQQA 3G2YA 3HUMA 3LEZA 3NQJA 3W98A 3V5MA 3ZFZA 1K56D 5B1MD 3LELD 5IHVA 4GKUA 5B40A 3UNWA 2CC1A 4FSFA 2F8ND 5F82A 4WNNB 5B1MB 2H10A 4R3BA 3X1VB 3SS4A 5B40B 3KUYD 3AZHA 4OOYA 5F1FA 3RJUA 1FCMA 1K54A 2ZLYA 1IKGA 4D2OA 2CV5B 1IELA 4X23C 4DDSA 5M1AA 3A3FA 3B0DC 5D3OA 3W96B 5TR7A 5DNNC 3AYWA 3REKB 5AY8C 3LJAC 4N1XA 5DNND 4QLCD 3C4OA 2FFFB 3WTPC 4OPQA 3AZJC 1P3GB 1M1AB 5EOOA 3B3XA 1P3FC 1P3MC 1EQZB 1BZAA 1YMSA 4X56A 1M40A 4GDBA 3PBSA 2F8NH 3FDDA 1BLSA 2A49A 2ZC6B 3O86A 4E3OA 3MNND 4N1HA 4Z66A 1PYYA 1N1JB 3AV2A 3EQVA 1BTLA 5JA4A 4K0XA 1Z6FA 4CAYB 2WKHA 1EQZA 1M6KA 5EE8A 1G68A 5B33A 4H9NB 1PZPA 4JPMA 2BYKA 1H3OA 4JXSA 5C3IB 3C1CC 1F66C 2F8NK 2Y2MA 3P98A 3REJD 3X1UA 4S2OA 4NE5A 4KG2A 1NZUA 4WELA 4LD9B 4H9NA 4MBFA 5AY8D 4CAYA 4KZ5A 2BG1A 1YUEA 2HUEC 1C3BA 5CTMA 4LV3A 3C7VA 1P3BD 3HBRA 3VP0A 3C1CA 3KXBA 2J8YA 1L0EA 3TG9A 4S2NA 5E5AA 4GNUA 4H9PA 2NQBA 5AV6C 3REHA 5HX9A 1P3FB 4NZ5A 1PWGA 1Q2QA 3L26A 4QB8A 1YLYA 1F1EA 2WAFA 5DNMC 3CJMA 3AZMD 2IO5B 5EVID 2Y91A 3MXRA 3C4PA 2ZQ8A 4LD9C 4KG6A 2EXBA 4XZQD 4J8VB 5B32D 1KDSA 5E43A 4ZTKA 1ONGA 5FA7A 3N7WA 4U3TA 4IVIA 5AVCB 4K91A 1NXYA 2VGKA 1P3LC 1TAFB 3OZHA 3Q7ZA 5FQQA 4X6TA 1FCNA 5B32A 5AVBC 3DWKA 3AN2C 1P3LD 1ZLAA 3G2ZA 4E3JA 5CPIB 3X1SA 3GV9A 2XFSA 4LD9A 1IYOA 4KGCD 1GCEA 4XUJA 2IOUA 2A3UA 3S4XA 3IXHA 3GQZA 1Y54A 4QHCA 4NE6A 5F99C 3WA9A 2PYOD 4F94A 3BFEA 3AV2B 3PBRA 1GHMA 5AV5D 5GSUB 1ES2A 3AFAC 5CXWA 1P3BC 3Q07A 1S32B 2J9OA 5F99D 5BO0A 2NZDC 1AOIA 5AV6D 2XFTA 4KQRA 3NDGA 3X1SB 5GT3C 3S1YA 1BH8A 1KX3B 3MGQA 3L27A 3WA9C 1HZOA 4X23A 3HUNA 4DRBA 1P3PD 4WU8C 1M1AA 4IVKA 4UA9A 1KGFA 4K0WA 2QPNA 1PWDA 5GXQC 3AZJA 2DCFA 5FQKA 3G35A 3LZ0A 4Z66D 1B67A 1PW1A 1K38A 1FQGA 3IWIA 1M19D 1H5XA 3RELB 4OLGA 3HVFA 2NZDB 1PIOA 5E2HA 3WAAD 1P34B 1K4FA 1E25A 2VQRA 1BH8B 1A7WA 2B5RA 2EX2A 4XUJB 5CPKC 1NY0A 5HFOA 1M19C 4KGCA 5GLDA 5M18A 3WA9B 4E3LA 4NETA 4NZ4A 4MLLA 3AZLD 1FSWA 3IH8A 1U60A 3AZIB 5AV6B 3P09A 3PAEA 4KZ3A 3NY4A 4WU8D 4WZ4A 3LJAD 2CWEA 3AZFB 2FJ7C 3MZDA 3GRJA 1P3PA 4HBTA 3UT9C 4CPKA 5B31B 3JYIA 5GHXA 4X23D 3REHD 4OJLA 1ERMA 3X1TB 3MNNA 2UWXA 4ZUXA 5BOHA 1RGYA 5FQIA 3UT9B 1R4VA 3UN7A 3LELA 1MBLA 3UPNA 3X1UD 4J8VC 4H9RA 5HAIA 1P3IB 3CZDA 3DTMA 5AV8C 5KSHA 5CHJA 4NYYA 2OLUA 1ID3B 5GSUA 4XZQB 5G49A 4ZBJB 1JTGA 4MNRA 3AZMB 5B32G 3WTPD 5GXQB 1CI8A 4JXWA 4PMAA 4DDYA 5CPJD 5EOEA 1I2WA 3WA9D 1P3OD 3IWOA 1GA9A 3D4FA 4B88A 1M19B 3AZKB 3BLSA 5B2JA 2NZDD 3NQUB 3FV7A 3M2JA 1BULA 4XZQA 3UO9A 4JXVA 3WS1A 2W8SA 4LENA 3AZMA 1PI5A 5DNMD 4Y0TA 3SS3A 1K57A 4Z2MH 3EPHA 3A3DA 1L2SA 4ZUXD 1NYMA 5FQJA 2Y2GA 5DF9A 4YS3D 4DE3A 4OP5A 2PBYA 4EV4A 3ZG8B 5AV5C 5EUAA 4R8PA 3X1SD 3LO7A 2HIOA 3WKJC 4OJ5A 3RXXA 5AQ9A 1LI0A 3FZCA 1O7EA 2EFXA 3QHYA 5CHLB 4JJNB 3UTBD 4E3IA 4ZBEA 3REKA 1P3PB 5F99B 5FATA 3H0RC 3TOIA 5CPJB 1QMEA 1FOFA 2CV5A 5DTSA 4DQYB 3B6GC 1AOIC 4KQOA 1ZLAC 2Y59A 3ISGA 1HQ3A 3O62B 1LHYA 4FH4A 4OPYA 3H0MC 3V9RB 3AZGA 1BUEA 3HSHA 5CRFA 4KG5A 2BYMA 3G31A 5B24D 4MEZA 1YM1A 1XGJA 4KGCB 5CP6A 2XH9A 1PZRA 3ZNTA 3IF6B 3Q82A 3WRTA 4J8XA 4WU8A 4GB7A 2Y2JA 4R4SA 1XA7A 2HDSA 3KXBB 3MGPD 4S2MA 4KZ6A 3VFHA 3W99C 1JTDA 5A90A 1ONHA 3GTCA 5DNMB 2IO5C 3MGQC 4IBEA 5HARA 1YMXA 4EO5C 5EVIB 3VP3A 4J8WC 3VH6A 4KZAA 2BYMB 1DJBA 3LY3A 3AZND 4J8XC 2HIOB 3IWQA 4GDNA 3KFUG 2WADA 4JJNA 5CTNA 4H9SA 3WRZA 5CEDA 4EBPA 3LY4A 3B0CT 3W99A 4S2JA 2F2AC 1F66D 4WU9A 3MGRA 3IQAA 3W98D 1DY6A 2RCXA 2YFVB 3P5JB 2FJ7A 1IYSA 4KGCC 5BNVA 3QNBA 1P3AA 2WGIA 5BS7C 1KX4C 2AROB 4J8XB 5BNXA 3A3EA 5B31A 1ALQA 4QU3A 1ESUA 1P3AD 4HGAC 3KWQC 2Y4AA 4ID4A 4NK3A 3KSYA 4L0LA 3UDIA 4OH0A 4X23B 2ZC3B 2NQBD 3WKJD 3OPLA 1MWUA 1CK3A 4X53A 1MXOA 1LLBA 4E3KA 4EWFA 1EQZD 1Q2PA 4QLCA 2XDMA 4KHAA 5KSCA 3HUOA 1SDNA 4IJEA 2HP6A 4M6BA 3AZMC 3HLFA 5GT0B 4ZBJC 4WU9D 4QLCB 3O62C 5E2FA 3O62D 3A6NA 2HP9A 2R9WA 4OJOA 4DRTA 3ZVTA 5B0YD 1YLPA 4CSRA 3RXWA 4DXBA 4NZ1A 3NC8A 3W4QA 3B6GB 1IYQA 3N8RA 1FR6A 3UE3A 3IXDA 5BNXB 3ITBA 5G49B 4QY6A 3X1VD 5AVBA 3AGFA 2F8NB 4JBFA 4EBLA 3MGQB 2G2UA 4EBNA 4EO5B 4O7DA 5EVIC 2G5HC 1HTZA 4X69A 2WZZA 5CGWA 3B0CW 5B0YC 5B2JC 4IBDA 3HLWA 3O88A 3ZGAB 1DJAA 1NJ4A 3KXBC 3UTAD 2XK1A 1L0FA 1JWZA 3OPHA 1M18A 1KX3D 3W99B 4U0TA 3BRMA 5JYOA 5A91A 4OPRA 3TU4D 1P3BA 3CG5A 1XPBA 2WAEA 4J8VD 5FSRA 1ES3A 1HTAA 2P74A 2Y55A 3WAAC 1H8ZA 5CERA 3BFCA 1HQ3C 3VFFA 2ZQ7A 2H0YA 4WZ5A 5KMWA 2AROD 3AZGC 4LG2A 5GT3A 5GSUD 4RX2A 3FWLA 4DXCA 3C1BA 3A6ND 1ZLAB 2G2WA 3G32A 5B33D 1G6AA 3ZDJA 5CP6C 5B24B 5GXQD 4WZSB 4NYUA 3NI9A 1Q9CA 5CGXA 1BLHA 5GLAA 5B24A 5B2ID 3VP1A 3AZLC 2ZMAA 5GXQA 4IBCA 1YT4A 2PU4A 2BLSA 4C3QA 5GLBA 4H9OB 5TFQA 4AWLC 3W97C 4MBKA 2V2FF 4R4RA 1RP5A 1KX5B 3ZG7B 3MGPA 3OPRA 3WKJB 3AZNB 5JRGA 3UE1A 1W2EA 1ZG6A 1WWSA 1N9BA 3FKWA 3G34A 5U47A 3VOYA 5FI2A 3AZJD 3VH6W 1ES5A 1P3MA 2Q9NA 3TSGA 4QNLA 3L28A 1XA1A 2IWBA 1AOID 5B40C 3Q81A 2F8NG 3AZGB 2Y2LA 4EUZA 3NBLA 4R8PB 3E2KA 4KZ7A 4RA7A 1P3KD 2XLNA 3NDEA 1P3PC 5DTKA 5B1LB 1KE3A 3B6FD 3N8LA 3AZHD 5AV9B 3UDFA 5B1LD 4IBGA 5FI7A 4GZBA 4JJND 3UTBB 4LD9D 5AV5B 4WU9C 3L2AA 2HDUA 1W8QA 4FCFA 1K6SA 3AZGD 1E4DA 1MWRA 4H9OA 3HLEA 1U35A 1ESIA 2H0TA 1M19A 5AY8A 4WEKA 3G4PA 5CPID 1ES4A 4OUIA 2EX8A 2V20A 1P3OA 4NY2A 3PTEA 4KUDA 1NYYA 4WMCD 4N9LA 3EPJA 3EPKA 3AL0C 4OJ6A 2NQBC 5DTTA 4WJ3C 1N4OA 4HBUA 2JBFA 5G18A 5CHUA 1M1AD 2WK0A 5EVIA 1KX3A 3A6NB 5FASA 4PPRA 3REIA 5B0YA 2DQNC 4ZUXC 3LZ0D 4XZQC 2Y2NA 1N1JA 2PYOB 5GL9A 3X1UC 1BSGA 1KDWA 4OOLA 5AV8B 1L0DA 3GMWA 4RVAA 3ZHHA 2WZXA 2DF4C 4UUZB 1W5DA 3DWZA 1XP4A 1P3LB 4WU9B 5FI6A 4KENB 4E44A 3RELA 2I72A 5AY8B 4WZ5C 4XUJC 3ZG5A 4Z5TB 3R45B 3AV1A 1S0WA 3MGSA 4J8UA 5AVCD 1W79A 2WGVA 4S2NC 3AZKA 1MWTA 4GH9A 3PBTA 5C3IC 2CV5C 3WS2A 5AVCC 3RELC 4UA6A 4Z5TA 2J7VA 1HVBA 4Z9QA 3AZHB 1YLJA 3MGQD 1YU2A 4S2LA 3V50A 1ZC2A 4OKPA 1H3OB 1CEGA 3AZID 3W4OA 5M19A 3MGPC 3UPOA 3REKD 3IF5A 5AQAA 1KE0A 2IWCA 4HEFA 1O07A 1KX5C 4YS3A 3UTAA 4DRAA 1SDEA 3AGDA 5J8XA 4YFMA 1P34C 2CV5D 5BNVB 4KZBA 2ZY3A 1ZLAD 3LZ0C 3W98C 3NIAA 3I7JA 3TU4A 3Q7VA 4OQ0A 3OCLA 4J8WA 3HLCA 5CP6D 1P3IC 4S2PA 3TU4B 4GN2A 5TGFA 2ZQAA 1BFMA 3WS0A 2OLVA 2JCHA 3MGSB 4J8UB 3C1BB 3AZLA 3B6GA 1TZYD 3BFDA 5DF7A 2BYKB 3AZNC 1S6RA 3TU4C 3IF6C 3MGRB 1RCJA 4G91B 4ZDXA 3V3RA 3N8SA 1TZYA 1J9MA 3MXSA 4BD1A 2QMIA 3ZG0A 1HQ3D 1K6RA 1P3MB 3KXBD 5DNNA 3LJAA 4S2KA 3SH9A 4OJPA 5HW3A 4JKTA 3AZFD 3O3VA 1RGZA 5B2IB 3AGEA 5DNNB 3B6FA 3NCKA 5B1MC 4IBXA 2FFYA 3IF6A 4LV2A 3MVDD 4PM8A 4KUDC 3G30A 1NRFA 1LL5A 2OSUA 1Z2CB 3REID 4ZJ1A 5EECA 1K25A 3V9RA 4R3JA 3LZ0B 4LCMA 3GR2A 5CPKA 1EROA 3MVDC 4Y0UA 1WYCA 4Y7PA 1OMEA 3B0BA 1XXMA 3UE0A 1XX2A 3AFAB 1K55A 1YLTA 3L25A 3EQUA 1KX4B 1YU0A 4OPZA 2C6WB 4XUZA 3H0LC 4AWLB 1JWPA 4JF4A 4ZUXB 4N9KA 1U35C 3MBZA 3BEBA 5GT0A 4YS3C 4ZAMA 1TZYB 1HD8A 5BS7A 2R9XA 1BLCA 5JRGD 4OP8A 1KX4A 3BM6A 3MGPB 5I94A 3REHB 4DE1A 2XR0A 3AZFA 1QMFA 4BENA 3AZED 2EX6A 1YU4A 4X68A 3A1IA 4G92C 4P85A 3AZKC 3N4IA 3LZ1D 5L2FA 1P3OB 5GT0C 3IP4C 4Q8IA 1K57C 2WGWA 3Q1FA 1ERQA 1CI9A 2ZQDA 4KUDB 1TAFA 1M18D 4BJPA 5DNMA 1SCWA 4E6XA 1IEMA 2Y2KA 4YM6B 3WTPE 1MPLA 5FQMA 3AZFC 1KGEA 3AV1C 3EPLA 1W8YA 3MGSC 4J8UC 4Z66B 1JFIB 2L5AA 5B2JB 1KE4A 5KDMB 1T3UA 3C7UA 1P34D 4BL3A 5CGSA 3REJB 4E45A 3WX7A 2EX9A 3S22A 4G92B 3MNNB 4IBBA 1TEMA 3ZCZA 4H9PB 2NQBB 4YS3B 4JXGA 5FAPA 4NFTA 1U35B 4KZ8A 1AXBA 4DE0A 2HPBA 3C1BC 1P3GC 1IYPA 5GHYA 4Z5TD 1H8YA 3SS5A 1LL9A 3AZIA 3A3IA 3REHC 2ZY5A 1MKIA 4YINA 3AZEC 2G5IC 1BLPA 5DVAA 2JSSA 2HDRA 4XXRA 3BECA 4J8XD 4HGAB 2ZQCA 3AZKD 2QZ6A 5CPKB 1B6WA 4WU8B 2C5WB 3OPPA 3IH9A 2AROC 2ZC5B 1P3GD 3MVDB 5DF8A 3M2KA 3W4PA 1S32A 1I2SA 3UTBA 5B33B 1KU5A 3VH5A 3LZ1B 2ZC4B 1PWCA 1ID3A 3AV2D 3NQJB 1BH9A 1VQQA 2XEPA 5FQ9A 4LV1A 2X02A 3NQUA 3WS4A 5CPKD 3FKEA 5B1MA 3RELD 3QNCA 4X55A 2PYOC 4BQMA 1YLZA 3ZG9B 3MGRD 2WUQA 2ZY4A 2WGWB 2E8IA 2PU2A 3MGRC 1PI4A 3C5AA 5JYPA 1ID3C 3M6HA 4OQHA 3IHBA 3KUYA 3B0DB 2HP5A 5AVBD 3LJAB 4EQIA 5A92A 3WS5A 2EXAA 4ZJ3A 3HREA 4BLMA 3FYZA 4YM6D 2RL3A 5B31C 2WKEA 4OLDA 4WM9A 2ZM2A 3KS4A 3KWQA 2OV5A 3IT9A 4E6WA 3EG5B 3X1TC 5BO0B 2RVQC 1WYBA 4YM6C 5JRGC 1S32D 5B0YB 4LV0A 4IJFA 3PBQA 3MVDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VSL A;  5HAP A;  5CHU A;  3A3D A;  1E3U A;  1L2S A;  1NYM A;  5FQJ A;  2Y2G A;  5DF9 A;  2WK0 A;  4R0Q A;  2H5S A;  5EVI A;  4DE3 A;  4KQQ A;  3G2Y A;  4OP5 A;  2PBY A;  3HUM A;  3LEZ A;  4EV4 A;  2J9P A;  3ZG8 B;  5EUA A;  5FAS A;  4GD8 A;  4PPR A;  3V5M A;  3ZFZ A;  3LO7 A;  3RXX A;  4Y0O A;  4CJN A;  5AQ9 A;  1LI0 A;  1K56 D;  3FZC A;  3PAG A;  2Y2N A;  1O7E A;  2EFX A;  5IHV A;  3QHY A;  1TVF A;  4M3K A;  4E3I A;  5GL9 A;  4GKU A;  4ZBE A;  1BSG A;  1KDW A;  3UNW A;  2CC1 A;  4FSF A;  4OOL A;  5F82 A;  1L0D A;  3GMW A;  5FAT A;  4RVA A;  3ZHH A;  4FH2 A;  2Z2L B;  4QY5 A;  2WZX A;  3TOI A;  1W5D A;  2H10 A;  1QME A;  3DWZ A;  4R3B A;  1XP4 A;  1FOF A;  3SS4 A;  4DE2 A;  4WYY A;  2WYX A;  2DRW A;  5DTS A;  5FI6 A;  1YLW A;  3IXB A;  4KEN B;  4KQO A;  2Y59 A;  3O87 A;  3GSG A;  3ISG A;  2P9V B;  4OOY A;  4BL2 A;  5F1F A;  2I72 A;  3RJU A;  1LHY A;  4E3M A;  4FH4 A;  1FCM A;  4OPY A;  1K54 A;  4UHU A;  1K55 C;  2ZLY A;  4WZ5 C;  3ZG5 A;  1BUE A;  1IKG A;  4D2O A;  4JF6 A;  5CRF A;  4KG5 A;  4OON A;  5F1G A;  3G31 A;  1IEL A;  4MEZ A;  1YM1 A;  3HLG A;  1XGJ A;  4DDS A;  1S0W A;  5M1A A;  4JF5 A;  2XH9 A;  3A3F A;  4PM9 A;  1W79 A;  2WGV A;  4KZ4 A;  3ZNT A;  3IF6 B;  4S2N C;  3VP2 A;  1I5Q A;  3Q82 A;  5D3O A;  3WRT A;  5TR7 A;  1MWT A;  1YQS A;  3V3S A;  4OVD A;  4N1X A;  2Y2P A;  1XGI A;  4GB7 A;  3PBT A;  2Z2M B;  3C4O A;  2Y2J A;  2FFF B;  4R4S A;  1XA7 A;  4OPQ A;  2HDS A;  3WS2 A;  1JVJ A;  3BFG A;  4PM6 A;  4UA6 A;  5EOO A;  1W7F A;  2J7V A;  4DKI A;  1HVB A;  4Z9Q A;  3B3X A;  4S2M A;  4KZ6 A;  5AQ7 A;  3VFH A;  2P9V A;  1JTD A;  1YLJ A;  2XD5 A;  1ONH A;  5A90 A;  3GTC A;  3MKF A;  1BZA A;  1YMS A;  4S2L A;  3V50 A;  1ZC2 A;  4X56 A;  1M40 A;  4GDB A;  5HAR A;  1YMX A;  1EI5 A;  5EVI B;  3PBS A;  3VP3 A;  4OKP A;  1CEG A;  4KZA A;  3W4O A;  1DJB A;  3LY3 A;  1BLS A;  2A49 A;  2ZC6 B;  3O86 A;  4E3O A;  5M19 A;  2ZQ9 A;  3UPO A;  3IF5 A;  5AQA A;  1KE0 A;  3IWQ A;  2IWC A;  4HEF A;  4N1H A;  4GDN A;  1PYY A;  4R23 A;  1O07 A;  2WAD A;  5CTN A;  3EQV A;  1BTL A;  1SDE A;  2IWD A;  3AGD A;  5J8X A;  3WRZ A;  4YFM A;  4KZB A;  5CED A;  4K0X A;  5FAQ A;  1Z6F A;  2WKH A;  4EBP A;  5F83 A;  3LY4 A;  1M6K A;  3NIA A;  5EE8 A;  1G68 A;  3I7J A;  1PZP A;  3IHA A;  4JPM A;  4S2J A;  3W8K A;  4JXS A;  3Q7V A;  2ZC7 A;  4OQ0 A;  2HDQ A;  2Y2M A;  3P98 A;  4RX3 A;  3OCL A;  2VGJ A;  4S2O A;  4KG2 A;  3HLC A;  3IQA A;  1DY6 A;  4S2P A;  1NZU A;  4WEL A;  2RCX A;  4GN2 A;  5TGF A;  1IYS A;  4MBF A;  1FSY A;  2ZQA A;  3QNB A;  3WS0 A;  2OLV A;  2JCH A;  2WGI A;  4KZ5 A;  3MZE A;  4S2I A;  3BFD A;  5E2E A;  3E2L A;  5DF7 A;  3HLD A;  5FAO A;  3FKV A;  3PBO A;  2BG1 A;  1C3B A;  5HAQ A;  3PBN A;  1S6R A;  3VOZ A;  1TDL A;  2WKI A;  3A3E A;  3IF6 C;  4KZ9 A;  1RCJ A;  5CTM A;  4ZDX A;  4LV3 A;  1ALQ A;  1VM1 A;  4QU3 A;  2Y2O A;  3C7V A;  3V3R A;  1ESU A;  3HBR A;  3VP0 A;  2V1Z A;  3N8S A;  3LCE A;  1J9M A;  3MXS A;  2J8Y A;  2Y4A A;  4ID4 A;  4U0X A;  4ZJ2 A;  1L0E A;  2QMI A;  4BD1 A;  4UA9 A;  3TG9 A;  3ZG0 A;  3VP4 A;  1K6R A;  4S2N A;  4NK3 A;  4GNU A;  4OQG A;  5HX9 A;  4BD0 A;  4L0L A;  4S2K A;  1PWG A;  1Q2Q A;  3SH9 A;  3UDI A;  5HW3 A;  1IKI A;  4OH0 A;  4QB8 A;  1YLY A;  2WAF A;  4JKT A;  2ZC3 B;  3CJM A;  3O3V A;  1RGZ A;  1MWU A;  3OPL A;  1CK3 A;  2Y91 A;  3MXR A;  3C4P A;  2ZQ8 A;  3AGE A;  4R1G A;  1MXO A;  1LLB A;  4E3K A;  4KG6 A;  2EXB A;  3NCK A;  4EWF A;  1Q2P A;  4IBX A;  1KDS A;  2FFY A;  2XDM A;  5E43 A;  4ZTK A;  3IF6 A;  1ONG A;  5FA7 A;  3N7W A;  4U3T A;  4IVI A;  4LV2 A;  5KSC A;  3HUO A;  4PM8 A;  4K91 A;  1NXY A;  1SDN A;  2VGK A;  3UY6 A;  1PW8 A;  3G30 A;  5CHM A;  1NRF A;  3M6B A;  2HP6 A;  3OZH A;  3Q7Z A;  1LL5 A;  2OSU A;  3HLF A;  4ZJ1 A;  5FQQ A;  5EEC A;  4X6T A;  1K25 A;  2Y2Q A;  4R3J A;  4LCM A;  3GR2 A;  1FCN A;  5E2F A;  1ERO A;  1KVM A;  2HP9 A;  2R9W A;  4Y0U A;  4QJG A;  1WYC A;  3DWK A;  4Y7P A;  4DRT A;  1ZKJ A;  1OME A;  4UAA A;  1XXM A;  3G2Z A;  3SH8 A;  3ZVT A;  4E3J A;  3UE0 A;  3GV9 A;  1YLP A;  2XFS A;  3RXW A;  4LV0 A;  3OC2 A;  1IYO A;  1XX2 A;  1K56 A;  1GCE A;  1K55 A;  4P6B A;  1YLT A;  4E3N A;  5GLC A;  4DXB A;  2A3U A;  3EQU A;  3NC8 A;  3S4X A;  3IXH A;  2X01 A;  3GQZ A;  1Y54 A;  4QHC A;  4OPZ A;  3W4Q A;  2JE5 A;  1IYQ A;  3N8R A;  1FR6 A;  4MBH A;  2C6W B;  4XUZ A;  4F94 A;  3BFE A;  3UE3 A;  3PBR A;  3SOI A;  1GHM A;  1JWP A;  4QD4 A;  2EFU A;  3IXD A;  4JF4 A;  1CEF A;  4N9K A;  3ITB A;  1ES2 A;  3BEB A;  3MBZ A;  4QY6 A;  5CXW A;  3AGF A;  3Q07 A;  3ITA A;  4ZAM A;  2J9O A;  4WBG A;  1HD8 A;  4JBF A;  3DW0 A;  4EBL A;  2R9X A;  4C6Y A;  2G2U A;  4EBN A;  1BLC A;  5EVI C;  4O7D A;  4OP8 A;  3BM6 A;  4GD6 A;  1HTZ A;  3BYD A;  2WZZ A;  4X69 A;  5CGW A;  2XFT A;  4DE1 A;  5I94 A;  4PM5 A;  1K54 C;  3NDG A;  2XR0 A;  4KQR A;  4H8R A;  3HLW A;  3HL9 A;  3O88 A;  1QMF A;  2ZM0 A;  4BEN A;  3S1Y A;  1GHI A;  3ZGA B;  2EX6 A;  1DJA A;  4X68 A;  1NJ4 A;  1HZO A;  5KZH A;  5HL1 A;  4X53 A;  3WWX A;  2XK1 A;  4B4X A;  1L0F A;  3HUN A;  1JWZ A;  3OPH A;  4IED A;  4P85 A;  3N4I A;  4U0T A;  4WMC A;  5L2F A;  1SKF A;  3BRM A;  5JYO A;  3MZF A;  4Q8I A;  5A91 A;  4IVK A;  4OQI A;  4OPR A;  1K57 C;  1NZO A;  1KGF A;  2WGW A;  3Q1F A;  2Y2H A;  1ERQ A;  1XPB A;  2WAE A;  3CG5 A;  4K0W A;  1CI9 A;  1KVL A;  2ZQD A;  3IXG A;  5FSR A;  2QPN A;  1PWD A;  1ES3 A;  4BJP A;  2P74 A;  2Y55 A;  1H8Z A;  2DCF A;  3ZVW A;  5CER A;  5FQK A;  4C75 A;  3G35 A;  1SCW A;  1TDG A;  3BFC A;  4E6X A;  1IEM A;  2ZQ7 A;  2Y2K A;  2H0Y A;  3VFF A;  4WZ5 A;  4PM7 A;  5KMW A;  1MPL A;  1PW1 A;  5FQM A;  1K38 A;  1FQG A;  1KGE A;  3IWI A;  4WEJ A;  5EPH A;  1H5X A;  4RX2 A;  4DXC A;  3FWL A;  4OLG A;  1E3U D;  3HVF A;  1PIO A;  5E2H A;  1W8Y A;  2G2W A;  3G32 A;  3ZDJ A;  1G6A A;  3A3J A;  1K4F A;  5E2G A;  1E25 A;  1KE4 A;  2B5R A;  2EX2 A;  1NY0 A;  2XQZ A;  3NI9 A;  5HFO A;  5CGX A;  3C7U A;  3VMA A;  4BL3 A;  5GLD A;  5M18 A;  5CEC A;  5CGS A;  1BLH A;  1MWS A;  5GLA A;  2EX9 A;  4E3L A;  4NET A;  2ZMA A;  3S22 A;  2DNS A;  3VP1 A;  4MLL A;  1FSW A;  3Q7V B;  1YT4 A;  3BFF A;  3IH8 A;  1TEM A;  3ZCZ A;  2PU4 A;  2BLS A;  5EVL A;  4JXG A;  5GLB A;  5FAP A;  4C3Q A;  5TFQ A;  1U60 A;  2ZD8 A;  4KZ8 A;  1AXB A;  3P09 A;  3PAE A;  3ZNY A;  4MBK A;  4KZ3 A;  3NY4 A;  4DE0 A;  4LCL A;  2HPB A;  4P87 A;  4WZ4 A;  2V2F F;  4R4R A;  3N6I A;  1IYP A;  5GHY A;  1RP5 A;  3GVB A;  3ZG7 B;  1MY8 A;  3UDX A;  3OPR A;  3MFD A;  1H8Y A;  3SS5 A;  1LL9 A;  3A3I A;  1LI9 A;  1MKI A;  4YIN A;  1GA0 A;  3MZD A;  3UE1 A;  1WE4 A;  1K4E A;  1BLP A;  1KGG A;  3GRJ A;  5DVA A;  4HBT A;  1ZG6 A;  2HDR A;  1N9B A;  2X71 A;  3FKW A;  3G34 A;  3BEC A;  4HES A;  4XXR A;  5U47 A;  3VOY A;  4CPK A;  3JYI A;  2ZQC A;  5GHX A;  5FI2 A;  2ZJ9 A;  1ERM A;  4B4Z A;  2QZ6 A;  2JC7 A;  3UPP A;  1ES5 A;  2Q9N A;  3TSG A;  2C5W B;  3OPP A;  1FR1 A;  3IH9 A;  2ZC5 B;  2UWX A;  1ZG4 A;  4IBR A;  1JWV A;  5AQB A;  1XA1 A;  5BOH A;  5DF8 A;  2IWB A;  3M2K A;  1RGY A;  4N92 A;  5FQI A;  3W4P A;  1FCO A;  1I2S A;  3Q81 A;  2ZC4 B;  3UN7 A;  1MBL A;  3UPN A;  1PWC A;  2Y2L A;  4EUZ A;  5HAI A;  3NBL A;  4XUX A;  1VQQ A;  4P0M A;  2XEP A;  3E2K A;  4KZ7 A;  4RA7 A;  5FQ9 A;  4LV1 A;  3CZD A;  2XLN A;  1PZO A;  2X02 A;  3DTM A;  3NDE A;  5FDH A;  5A93 A;  2XGN A;  5DTK A;  1DJC A;  5KSH A;  1KE3 A;  5CHJ A;  2OLU A;  3WS4 A;  4JLF A;  3N8L A;  3V39 A;  2XD1 A;  2XF3 A;  4RYE A;  3UDF A;  1JTG A;  3HLB A;  3QNC A;  4MNR A;  4UA7 A;  4X55 A;  5FI7 A;  4GZB A;  1YLZ A;  4BQM A;  3ZG9 B;  1L0G A;  2WUQ A;  2HDU A;  2ZM8 A;  1K6S A;  2WGW B;  1W8Q A;  2E8I A;  1XKZ A;  2PU2 A;  1E4D A;  1PI4 A;  4FCF A;  3C5A A;  1MWR A;  1CI8 A;  2Q9M A;  4JXW A;  4PMA A;  4DDY A;  5JYP A;  3HLE A;  3M6H A;  1ESI A;  5EOE A;  2H0T A;  1I2W A;  4OQH A;  3IHB A;  3MKE A;  3CMZ A;  4WEK A;  3G4P A;  3IWO A;  5EVI D;  2HP5 A;  4DF6 A;  1GA9 A;  1ES4 A;  4A5R A;  1SHV A;  3D4F A;  5GHZ A;  4EQI A;  2EX8 A;  4OOM A;  5A92 A;  2V20 A;  3WS5 A;  4B88 A;  2EXA A;  4ZJ3 A;  3BLS A;  3HRE A;  4BLM A;  3FV7 A;  3M2J A;  3FYZ A;  3PTE A;  1BUL A;  2RL3 A;  2WKE A;  1NYY A;  1BT5 A;  3OCN A;  4GOG A;  3BLM A;  4OLD A;  2Y2I A;  2ZM2 A;  4WM9 A;  4WMC D;  3UO9 A;  4JXV A;  3WS1 A;  4N9L A;  5CEB A;  2OV5 A;  2GDN A;  4LEN A;  3IT9 A;  4E6W A;  4FD8 A;  3SH7 A;  1PI5 A;  1EWZ A;  5DTT A;  1WYB A;  3VSK A;  1N4O A;  4HBU A;  1GHP A;  2JBF A;  5G18 A;  1K57 A;  3SS3 A;  4Y0T A;  3PBQ A; 
#chains in the Genus database with same CATH topology
 3VSL A;  4JJN C;  3KWQ B;  3UT9 A;  1E3U A;  1YU3 A;  4R0Q A;  3LIB A;  3AZH C;  2P08 A;  2J9P A;  4GD8 A;  3AZE B;  1P3O C;  1PDC A;  4Y0O A;  4CJN A;  1M18 B;  2OWH A;  3PAG A;  5B1L A;  1TVF A;  1F66 A;  2G7U A;  4M3K A;  2CMN A;  3A1K A;  4HNB A;  4FH2 A;  1HQ3 B;  3O62 A;  2Z2L B;  4QY5 A;  4YWZ A;  4UPK A;  3D3O A;  3WAA B;  2FJ7 D;  4DE2 A;  4WYY A;  2WYX A;  2DRW A;  1YLW A;  3IXB A;  4WL9 A;  3O87 A;  3GSG A;  2P9V B;  4R6L A;  4BL2 A;  1E6Z A;  2EWW A;  4E3M A;  1W1T A;  4UHU A;  3REI C;  1KX4 D;  1J7M A;  1K55 C;  1KX5 D;  5G4Y A;  4NG2 A;  4JF6 A;  5F1G A;  4OON A;  3TE8 A;  1D06 A;  1T18 A;  3HLG A;  5BT1 C;  1P3A B;  4JF5 A;  4PM9 A;  4KZ4 A;  3VP2 A;  1I5Q A;  4KHA B;  4DMZ A;  5E5A C;  3LID A;  3ZQ5 A;  3HON A;  1YQS A;  3M7P A;  4OVD A;  3V3S A;  4KUO A;  3WD4 A;  2W1T A;  3EOI A;  2Y2P A;  3VH5 T;  4WNN A;  1XGI A;  5AV9 A;  4H9Q B;  1P3F D;  2Z2M B;  4IBI A;  3F1O B;  2HZ5 A;  1JVJ A;  3BFG A;  4PM6 A;  2W3F A;  5EV0 A;  4IHQ A;  1W7F A;  4DKI A;  4MB3 A;  1OTE A;  5E5A B;  2W3G A;  5AQ7 A;  3V67 A;  2P9V A;  4QLC C;  2XD5 A;  3L7H A;  3MKF A;  1OJG A;  1L6J A;  1EI5 A;  3R45 A;  1S1Z A;  2ZQ9 A;  3SW1 A;  1M18 C;  5EM1 A;  5B0Z D;  1YAX A;  3REI B;  3X1U B;  1QO6 A;  4XUJ D;  4R23 A;  4R3A A;  2HJE A;  2IWD A;  5FAQ A;  3W99 D;  5AVB B;  4Z5T C;  2V8C A;  5GSU C;  5F83 A;  1P3I D;  4EES A;  3RH8 B;  2YFV A;  5GT3 D;  3LEL B;  3IHA A;  3W8K A;  2ZC7 A;  3UTA B;  2HDQ A;  4FUW A;  2Z6C A;  2ZBB A;  3FPW A;  4RX3 A;  2JKT M;  3REK C;  2VGJ A;  4EW7 A;  5HD3 A;  3MGS D;  4J8U D;  5AVE A;  3AZI C;  3HCY A;  4CSR B;  3AFA A;  1FSY A;  1H8P A;  1KX5 A;  5B2I A;  1U35 D;  5CP6 B;  5B24 C;  3X1T D;  3T1R A;  5B2J D;  2NZD A;  3UTA C;  2D49 A;  3MZE A;  4S2I A;  5E2E A;  3E2L A;  3W97 D;  3HLD A;  5FAO A;  3FKV A;  3PBO A;  5B31 D;  3BQ8 A;  5KDM A;  2FJ7 B;  5HAQ A;  3PBN A;  4BWI A;  3VOZ A;  1TDL A;  2WKI A;  3C38 A;  4KZ9 A;  3B6G D;  1VM1 A;  2Y2O A;  3AZL B;  4X25 A;  2V1Z A;  5AV9 D;  1P3G A;  3LCE A;  4BBU A;  3UTB C;  4U0X A;  4HP9 A;  4ZJ2 A;  3VP4 A;  4KUD D;  4OQG A;  2ZY2 A;  4Z2M G;  2GNX A;  5B32 C;  3B6F B;  4WN5 A;  1M1A C;  2ZOI A;  3W2Z A;  1P9R A;  4BD0 A;  4R8P D;  4HMC A;  1IKI A;  5AVC A;  4Q0J A;  3X1S C;  4R1G A;  1X0O A;  5G4Z A;  2KDK A;  3PR6 A;  2HIO C;  3WKJ A;  3H82 B;  4MN5 A;  4IBJ A;  2QKP A;  2ZM5 A;  2ARO A;  2VEA A;  1UR9 A;  5JA4 B;  4GCZ A;  3UY6 A;  2LB5 A;  1PW8 A;  5CHM A;  1P3K B;  3M6B A;  4H9Q A;  1S32 C;  1VB6 A;  4G91 C;  2Y2Q A;  1SKO A;  1KVM A;  3KUY C;  4QJG A;  3N3F A;  1XJ6 A;  2QJ5 A;  3KO6 A;  1ZKJ A;  3H7W A;  1P34 A;  4UAA A;  3SH8 A;  4IBK A;  5JRG B;  3OC2 A;  1K56 A;  3NEC A;  4P6B A;  4E3N A;  3VH6 T;  5GLC A;  5FUG A;  3W97 A;  1VHM A;  2X01 A;  5B1L C;  2JE5 A;  4IBF A;  3QP4 A;  4MBH A;  2F8N A;  5CPJ A;  2YFW B;  3L29 A;  3X1T A;  4NE3 A;  1YU1 A;  3SOI A;  1NLY A;  4PKY G;  4QD4 A;  2EFU A;  2A24 A;  1CEF A;  3R7W B;  3ITA A;  5CPI A;  4WBG A;  4UQI M;  3DW0 A;  4C6Y A;  3KWQ D;  3AV1 B;  1PFL A;  3REJ C;  1BH9 B;  4GD6 A;  3BYD A;  3C1C D;  3LYX A;  1P3F A;  4PM5 A;  1K54 C;  3QP8 A;  3MNN C;  4H8R A;  3DBA A;  3HL9 A;  1N9O A;  2ZM0 A;  1GHI A;  1G28 A;  5KZH A;  4EEU A;  5HL1 A;  3WWX A;  3WTP B;  4B4X A;  4IED A;  4GHA A;  5AV8 D;  1A0K A;  1GSX A;  4J8V A;  4WMC A;  1SKF A;  3AYW C;  3MZF A;  4YM6 A;  1L3L A;  4OQI A;  2J8P A;  1AOI B;  1NZO A;  2Y2H A;  3FC7 A;  5CPI C;  3ZNY A;  3AV2 C;  4WV4 B;  1KVL A;  3IXG A;  1P3K A;  3WTP A;  4H9S C;  2V5O A;  3UME A;  4I3J A;  2HIO D;  3REJ A;  4C75 A;  1EQZ C;  1TDG A;  4UUZ A;  5B32 B;  3B6F C;  2LY8 A;  4PM7 A;  3E4O A;  3WD2 A;  2M7U A;  4WEJ A;  5EPH A;  3F1P B;  3UT9 D;  1E3U D;  4ARZ B;  3A3J A;  1CJF A;  2OOL A;  5E2G A;  4UQI S;  3C1B D;  3T4L A;  5I5L A;  1YSP A;  4J8W D;  2XQZ A;  3VMA A;  3LZ1 C;  5AV9 C;  5CEC A;  1MWS A;  1P3A C;  1GPF A;  1P3K C;  2YFW A;  2DNS A;  2RIQ A;  4HQA A;  1P3B B;  4LLO B;  5J4E A;  3Q7V B;  3BFF A;  5GT3 B;  3T4Q A;  5B0Z C;  5EVL A;  2ZD8 A;  5B33 C;  3P7N A;  4LCL A;  1JFI A;  4P87 A;  3AYW D;  3T4T A;  1WWI A;  3N6I A;  3VH5 W;  3GVB A;  2K2N A;  1MY8 A;  3UDX A;  4LFU A;  3LEL C;  3MFD A;  3AV1 D;  1LI9 A;  1DRM A;  5B0Z B;  3U4L P;  3KSG A;  2HUE B;  4Z66 C;  3LZ1 A;  4EXO A;  1GA0 A;  1ULY A;  1K4E A;  1WE4 A;  2Y79 A;  1KGG A;  5AV8 A;  3F6T A;  2X71 A;  4HES A;  1WA9 A;  5BT1 D;  3E4P A;  2H28 A;  1UGU A;  5IS1 A;  1KX3 C;  1VEU A;  2ZJ9 A;  3C1C B;  4B4Z A;  5B0Z A;  5E5A D;  3MS6 A;  2JC7 A;  5GT0 D;  4GHI A;  3UPP A;  5B31 G;  4TX8 A;  1E6P A;  3AYW B;  2J3W A;  1FR1 A;  3QP2 A;  1ZG4 A;  4IBR A;  1JWV A;  5AQB A;  3AZJ B;  1P3M D;  4N92 A;  1CXW A;  2XSS A;  4EQ1 A;  1FCO A;  4WUJ A;  4GHI B;  4GS9 A;  5FUG B;  3W97 B;  4XUX A;  3AZE A;  3RFB A;  3A6N C;  4P0M A;  2JKG A;  3IS2 A;  5B2I C;  3OLO A;  3KS8 A;  5A93 A;  1PZO A;  2PAV P;  4O0P A;  3IX4 A;  2PR6 A;  5FDH A;  2XGN A;  1DJC A;  2VLG A;  4JLF A;  4KQD A;  3V39 A;  2XD1 A;  2XF3 A;  4H9R B;  4L9E A;  4RYE A;  3AFA D;  3W96 C;  3HLB A;  4UA7 A;  1L0G A;  3X1V A;  4MDZ A;  3ZVW A;  1P3L A;  2ZM8 A;  1XKZ A;  2VA0 A;  1LT0 A;  1P3I A;  2Q9M A;  5AV6 A;  4YOF A;  3NUL A;  4NZ3 A;  2L0W A;  3W96 D;  2RVQ D;  3MKE A;  3CMZ A;  4DF6 A;  4A5R A;  1SHV A;  5EFW A;  2O0Y A;  5GHZ A;  3AN2 B;  3DTE A;  4OOM A;  5AV5 A;  3AZN A;  4R8P C;  1OPX A;  3VV4 A;  3W96 A;  5AVF A;  4LGW A;  2PYO A;  2OAP 1;  1BT5 A;  3OCN A;  3AN2 D;  5F99 A;  3BLM A;  2Y2I A;  4GOG A;  3X1V C;  5CEB A;  1TZY C;  2GDN A;  5CPJ C;  2V0W A;  4FD8 A;  3SH7 A;  3JPU A;  1K0K A;  1EWZ A;  3VSK A;  4HP4 A;  2YKF A;  3W98 B;  1ID3 D;  1GHP A;  4IUH A;  4J8W B;  4GHL A;  5HAP A;  3AN2 A;  5BPV A;  3G6O A;  3WAA A;  1F66 B;  2H5S A;  5B40 D;  3KUY B;  4KQQ A;  2HF6 A;  3G2Y A;  3HUM A;  3LEZ A;  3NQJ A;  3W98 A;  3LGO A;  4P6Z S;  3V5M A;  3ZFZ A;  1K56 D;  3PHY A;  5B1M D;  3LEL D;  1VET A;  2L4R A;  5IHV A;  4B9O A;  4GKU A;  5B40 A;  3UNW A;  2CC1 A;  2ZOH A;  4FSF A;  5IU1 A;  2F8N D;  5F82 A;  4WNN B;  5B1M B;  3VOL A;  3KYZ A;  5L8M A;  5HPI A;  1E6N A;  2H10 A;  2OAQ 1;  4R3B A;  3X1V B;  3SS4 A;  3T50 A;  5B40 B;  3KUY D;  1GXD A;  3AZH A;  4OOY A;  4JGR A;  5F1F A;  1MC0 A;  3O5Y A;  3RJU A;  5FDS A;  1FCM A;  1K54 A;  2ZLY A;  2VJW A;  3UB8 A;  1IKG A;  4D2O A;  5TBM B;  2CV5 B;  1IEL A;  4X23 C;  4DDS A;  4H6J B;  5M1A A;  3BY8 A;  3A3F A;  3B0D C;  1OGG A;  5D3O A;  3W96 B;  5TR7 A;  5DNN C;  3AYW A;  5HD5 A;  3REK B;  5AY8 C;  3LJA C;  4N1X A;  5DNN D;  4QLC D;  3C4O A;  2EA9 A;  2FFF B;  3WTP C;  4OPQ A;  3AZJ C;  1P3G B;  1M1A B;  5EOO A;  2PD8 A;  3B3X A;  1P3F C;  1P3M C;  4H6J A;  1EQZ B;  1BZA A;  4EU0 A;  2V1A A;  4MN6 A;  1YMS A;  3F1O A;  4X56 A;  1M40 A;  4GDB A;  3S7P A;  3PBS A;  2F8N H;  3A0V A;  3FDD A;  1BLS A;  2A49 A;  2ZC6 B;  3LR4 A;  3O86 A;  4E3O A;  1S66 L;  3MNN D;  3MJQ A;  4ZRR A;  4N1H A;  4I39 A;  3LIE A;  4Z66 A;  1PYY A;  1N1J B;  3AV2 A;  3BWL A;  3EQV A;  3VE3 A;  1BTL A;  3IX3 A;  5JA4 A;  4K0X A;  1Z6F A;  4CAY B;  2MJ6 A;  2WKH A;  1EQZ A;  3KX0 X;  1M6K A;  5EE8 A;  1G68 A;  5B33 A;  4H9N B;  1PZP A;  4JPM A;  2BYK A;  5C5K A;  1H3O A;  4JXS A;  5C3I B;  4M4X A;  1EAK A;  3C1C C;  1F66 C;  3A0S A;  2F8N K;  2Y2M A;  3P98 A;  2Y8H A;  2JKT I;  3REJ D;  3X1U A;  4S2O A;  4NE5 A;  4KG2 A;  1NZU A;  4WEL A;  4LD9 B;  4H9N A;  4HJ6 A;  4I3A A;  5TJJ A;  4MBF A;  5AY8 D;  4CAY A;  1TD5 A;  2J80 A;  4KZ5 A;  2K31 A;  1MZU A;  2BG1 A;  1YUE A;  2HUE C;  1C3B A;  4R70 A;  5CTM A;  4LV3 A;  3C7V A;  1P3B D;  3HBR A;  3VP0 A;  3C1C A;  3KXB A;  3MF0 A;  2J8Y A;  2O99 A;  1L0E A;  3TG9 A;  4S2N A;  5HPF A;  5E5A A;  4GNU A;  4H9P A;  2NQB A;  5AV6 C;  3REH A;  2INW A;  5HX9 A;  1P3F B;  1OGB A;  4NZ5 A;  1PWG A;  3BJN A;  1Q2Q A;  5MC7 A;  3L26 A;  4QB8 A;  1YLY A;  1F1E A;  2WAF A;  5DNM C;  3CJM A;  3AZM D;  2D01 A;  2IO5 B;  2Z6D A;  5EVI D;  2Y91 A;  3MXR A;  3C4P A;  2ZQ8 A;  4LD9 C;  4KG6 A;  2EXB A;  4XZQ D;  4J8V B;  5B32 D;  1KDS A;  5E43 A;  1P0Z A;  4ZTK A;  1ONG A;  4DN0 A;  5FA7 A;  3N7W A;  4U3T A;  4IVI A;  5AVC B;  4K91 A;  1NXY A;  2VGK A;  5F68 A;  1P3L C;  3SZT A;  3A0R A;  1TAF B;  3OZH A;  3Q7Z A;  5FQQ A;  4X6T A;  2KLI A;  1FCN A;  5B32 A;  5AVB C;  4Q0I A;  3DWK A;  3AN2 C;  3CUE C;  1P3L D;  1ZLA A;  3G2Z A;  4E3J A;  5CPI B;  3X1S A;  3GV9 A;  2XFS A;  4LD9 A;  1IYO A;  4KGC D;  4RQ9 A;  1GCE A;  1TS8 A;  4XUJ A;  2IOU A;  2A3U A;  3S4X A;  3IXH A;  3GQZ A;  4X1L A;  1Y54 A;  4QHC A;  4NE6 A;  5F99 C;  3WA9 A;  2PYO D;  4F94 A;  3BFE A;  3AV2 B;  3PBR A;  1GHM A;  5AV5 D;  3IBJ A;  4I38 A;  5GSU B;  1ES2 A;  3AFA C;  5CXW A;  3T1X A;  1P3B C;  3Q07 A;  1S32 B;  2J9O A;  5F99 D;  5BO0 A;  2NZD C;  1AOI A;  5AV6 D;  2XA7 M;  2XFT A;  3NDG A;  4JGP A;  4KQR A;  3X1S B;  5GT3 C;  3S1Y A;  4GJ4 A;  1BH8 A;  1KX3 B;  3MGQ A;  3L27 A;  3WA9 C;  1HZO A;  4X23 A;  2VZW A;  4QPR A;  3E98 A;  3HUN A;  2JN7 A;  4DRB A;  1P3P D;  4LRZ E;  1CF0 A;  4GW9 A;  4Z2I A;  4WU8 C;  1M1A A;  2BAS A;  4IVK A;  4UA9 A;  1KGF A;  4K0W A;  3OOV A;  2M1C A;  2QPN A;  4Z1W A;  1PWD A;  5GXQ C;  3AZJ A;  5A8B A;  2DCF A;  5FQK A;  3G35 A;  3LZ0 A;  3MSH A;  4Z66 D;  1B67 A;  1PW1 A;  1S67 L;  1K38 A;  1FQG A;  3TRC A;  3IWI A;  1M19 D;  3KSH A;  1H5X A;  3REL B;  4OLG A;  2NZD B;  1PIO A;  3HVF A;  5E2H A;  3WAA D;  1P34 B;  1K4F A;  1STZ A;  1E25 A;  2VQR A;  1BH8 B;  1A7W A;  2B5R A;  2EX2 A;  4XUJ B;  5CPK C;  1NY0 A;  5HFO A;  1M19 C;  4EUV A;  4KGC A;  3MQO A;  5GLD A;  5M18 A;  3WA9 B;  4BBT A;  1FIL A;  3UB9 A;  4E3L A;  4NET A;  4NZ4 A;  4MLL A;  3AZL D;  1FSW A;  2B95 A;  3IH8 A;  5AJG A;  1U60 A;  3AZI B;  5AV6 B;  3P09 A;  3PAE A;  4KZ3 A;  2QYB A;  3NY4 A;  4WU8 D;  4WZ4 A;  3LJA D;  4LRX C;  4Y5F A;  1H0I A;  2CWE A;  3AZF B;  2FJ7 C;  1EW0 A;  3MZD A;  3TJZ C;  4G3W A;  4NXF A;  1CQA A;  2VGL M;  3GRJ A;  1P3P A;  2VV6 A;  4HBT A;  3UT9 C;  4CPK A;  5B31 B;  3JYI A;  5GHX A;  4X23 D;  4JGO A;  3REH D;  4OJL A;  1ERM A;  4PAU A;  3X1T B;  3MNN A;  3B47 A;  2O9A A;  2UWX A;  4ZUX A;  4GLQ A;  5BOH A;  1RGY A;  5HWW A;  4LPZ A;  5FQI A;  3UT9 B;  1R4V A;  3FPV A;  5FEG A;  3UN7 A;  3LEL A;  1MBL A;  3UPN A;  3X1U D;  3QP1 A;  4J8V C;  4H9R A;  5HAI A;  3DAV A;  4CLC E;  3UE6 A;  4K08 A;  1P3I B;  3CZD A;  3DTM A;  5AV8 C;  5KSH A;  4DJ2 A;  4X1M A;  5CHJ A;  4NYY A;  2OLU A;  1ID3 B;  5GSU A;  4XZQ B;  5G49 A;  3D72 A;  4ZBJ B;  1JTG A;  4MNR A;  3AZM B;  2M7V A;  5B32 G;  3WTP D;  5GXQ B;  1TS6 A;  2YKH A;  1CI8 A;  4JXW A;  4PMA A;  4DDY A;  5CPJ D;  2RTS A;  5EOE A;  1I2W A;  3WA9 D;  4QWO A;  1KOU A;  4GS9 B;  1P3O D;  3IWO A;  1GA9 A;  3D4F A;  1F9I A;  2HV1 A;  4B88 A;  1M19 B;  3AZK B;  3BLS A;  2J3T D;  1SZV A;  5B2J A;  2NZD D;  1DP8 A;  3NQU B;  1TS7 A;  2XA7 S;  3FV7 A;  3M2J A;  3S7N A;  1BUL A;  5HWV A;  4XZQ A;  3UO9 A;  5HDD A;  4JXV A;  3WS1 A;  2W8S A;  4LEN A;  3AZM A;  1PI5 A;  1ZHH B;  1UWN X;  4ME4 A;  5DNM D;  1N9N A;  4Y0T A;  3SS3 A;  1K57 A;  4Z2M H;  4XT2 A;  1YKD A;  3EPH A;  5L09 A;  3A3D A;  1L2S A;  4ZUX D;  1NYM A;  5FQJ A;  2Y2G A;  1VET B;  5DF9 A;  4YS3 D;  1S4R A;  4DE3 A;  4Y17 A;  4OP5 A;  2PBY A;  4EV4 A;  3CLO A;  3ZG8 B;  5AV5 C;  5EUA A;  4R8P A;  5DFX A;  3X1S D;  3LO7 A;  2HIO A;  3WKJ C;  4OJ5 A;  3RXX A;  5AQ9 A;  1LI0 A;  3FZC A;  3K3D A;  2W3H A;  1O7E A;  2EFX A;  1ODV A;  1OT9 A;  3QHY A;  5CHL B;  4JJN B;  3UTB D;  4IJG A;  4E3I A;  4ZBE A;  3REK A;  2KOI A;  1P3P B;  5F99 B;  5FAT A;  3H0R C;  3TOI A;  5HL6 A;  5CPJ B;  1QME A;  3QP6 A;  1FOF A;  5J7E A;  2CV5 A;  1BYW A;  3C2W A;  5DTS A;  4DQY B;  3E4Q A;  3B6G C;  1AOI C;  4KQO A;  1ZLA C;  2Y59 A;  4PKY A;  3LUQ A;  3ISG A;  1HQ3 A;  3O62 B;  1LHY A;  4FH4 A;  4OPY A;  3H0M C;  3V9R B;  3AZG A;  1BUE A;  4CQH A;  3HSH A;  5CRF A;  4KG5 A;  5L10 A;  2BYM A;  3G31 A;  4WF0 A;  5B24 D;  4MEZ A;  1YM1 A;  4WLA A;  1XGJ A;  4KGC B;  5CP6 A;  2XH9 A;  1PZR A;  2E8J A;  3ZNT A;  3IF6 B;  1G6O A;  3Q82 A;  3WRT A;  4J8X A;  4WU8 A;  4GB7 A;  1XFN A;  4HH3 A;  2Y2J A;  4O01 A;  4R4S A;  1XA7 A;  2HDS A;  2PR5 A;  3KXB B;  3MMH A;  1IOU A;  5F69 A;  1CK7 A;  3MGP D;  2WKP A;  4S2M A;  4KZ6 A;  3VFH A;  3W99 C;  1JTD A;  5A90 A;  1ONH A;  3GTC A;  5DNM B;  2JHE A;  2IO5 C;  3MGQ C;  4IBE A;  5HAR A;  1YMX A;  4EO5 C;  1S4S A;  5EVI B;  3VP3 A;  4J8W C;  3VH6 A;  4KZA A;  2BYM B;  1DJB A;  1DP9 A;  1LSW A;  3LY3 A;  3AZN D;  4MMN A;  1W1P A;  3IBR A;  4L9G A;  4J8X C;  2EWV A;  2HIO B;  3IWQ A;  4GDN A;  4MN7 A;  3KFU G;  2PD7 A;  2WAD A;  4JJN A;  5CTN A;  4H9S A;  3WRZ A;  5CED A;  1XJ2 A;  3S7O A;  4EBP A;  3LY4 A;  3B0C T;  4Z2G A;  3W99 A;  4S2J A;  2F2A C;  1F66 D;  3UB5 P;  4WU9 A;  2V8F A;  4CLC A;  3MGR A;  3C30 A;  3IQA A;  3W98 D;  1DY6 A;  2RCX A;  2PBD P;  2YFV B;  3P5J B;  1H0G A;  2FJ7 A;  1F5M A;  1IYS A;  3DTI A;  4KGC C;  5BNV A;  3QNB A;  2PYP A;  1P3A A;  1V9Y A;  2WGI A;  2ZMF A;  1G5U A;  5BS7 C;  4BMW A;  1LSV A;  4HMD A;  4HY8 A;  4NXE A;  1KX4 C;  2XRN A;  2ARO B;  4J8X B;  3EGX C;  2HGV A;  3TW8 A;  5BNX A;  3A3E A;  5B31 A;  4MCW A;  1ALQ A;  4QU3 A;  1KS0 A;  1P3A D;  1ESU A;  4HGA C;  4CLC C;  3KWQ C;  2Y4A A;  4ID4 A;  1E15 A;  1GSV A;  2VK3 A;  3LFV A;  4NK3 A;  3KSY A;  3F1P A;  3BW6 A;  3T4K A;  4ETX A;  3HJI A;  4L0L A;  2PDR A;  3UDI A;  4OH0 A;  3WD0 A;  4X23 B;  2ZC3 B;  2NQB D;  5TBM A;  3MFX A;  3WKJ D;  1MWU A;  3OPL A;  1CK3 A;  4X53 A;  1MXO A;  1LLB A;  4E3K A;  1NRJ A;  4EWF A;  1EQZ D;  1Q2P A;  4F3L A;  4QLC A;  2XDM A;  2ZMV A;  5IT5 A;  4KHA A;  1NWZ A;  5KSC A;  3HUO A;  4G3K A;  4DJ3 A;  1SDN A;  1E88 A;  4IJE A;  2HP6 A;  4M6B A;  1ZTU A;  3AZM C;  3HLF A;  5GT0 B;  4NEE D;  4ZBJ C;  3NOU C;  4WU9 D;  4QLC B;  3O62 C;  2BTF P;  2J3T C;  5E2F A;  1W1V A;  3O62 D;  3A6N A;  2HP9 A;  1OTB A;  2LB9 A;  2R9W A;  4OJO A;  4CLC B;  4DRT A;  2PT7 A;  2ACG A;  1NLZ A;  3ZVT A;  2QJ7 A;  5B0Y D;  1YLP A;  4CSR A;  3RXW A;  3CAX A;  4B93 A;  1ACF A;  4DXB A;  4NZ1 A;  3NC8 A;  3T4S A;  3W4Q A;  2B02 A;  3B6G B;  1IYQ A;  3N8R A;  1FR6 A;  5HZH A;  3UE3 A;  5DJT A;  3IXD A;  5BNX B;  3ITB A;  5G49 B;  4QY6 A;  3X1V D;  5AVB A;  1D7E A;  3AGF A;  1UR8 A;  2F8N B;  4JBF A;  4EBL A;  3MGQ B;  2G2U A;  4EBN A;  4EO5 B;  4O7D A;  5EVI C;  2G5H C;  3D9Y A;  1HTZ A;  4X69 A;  2WZZ A;  5CGW A;  5J3W A;  3B0C W;  5B0Y C;  3NOP C;  4LRY C;  2O9C A;  5B2J C;  4IBD A;  2QWS A;  3HLW A;  3O88 A;  5FL3 A;  3ZGA B;  1DJA A;  1NJ4 A;  1S1Y A;  3BY9 A;  3KXB C;  1YSQ A;  3LI9 A;  3UTA D;  2XK1 A;  1L0F A;  1JWZ A;  3OPH A;  1M18 A;  4BBV A;  4F3L B;  1KX3 D;  3W99 B;  4U0T A;  3BRM A;  5JYO A;  5A91 A;  4OPR A;  3TU4 D;  1P3B A;  3CG5 A;  1XPB A;  3CI6 A;  2WAE A;  4J8V D;  4O8G A;  5FSR A;  1ES3 A;  1HTA A;  2P74 A;  2Y55 A;  3WAA C;  3EEH A;  1H8Z A;  5CER A;  2R78 A;  3BFC A;  1HQ3 C;  4KUK A;  3H9W A;  3VFF A;  2ZQ7 A;  2H0Y A;  4WZ5 A;  5KMW A;  2ARO D;  3AZG C;  4LG2 A;  5HWT A;  3PYP A;  5GT3 A;  5GSU D;  4RX2 A;  1P9W A;  3FWL A;  4DXC A;  3C1B A;  3A6N D;  1ZLA B;  2G2W A;  3MR0 A;  3G32 A;  5B33 D;  1G6A A;  3ZDJ A;  5CP6 C;  5B24 B;  1AIW A;  5GXQ D;  4WZS B;  1Y28 A;  2OWJ A;  4NYU A;  3NI9 A;  1Q9C A;  5CGX A;  2ZL1 B;  4CLC D;  2PYR A;  1BLH A;  5GLA A;  5B24 A;  4HOI A;  5B2I D;  3VP1 A;  3AZL C;  2ZMA A;  5GXQ A;  4HME A;  4IBC A;  1YT4 A;  3IX8 A;  2PU4 A;  2BLS A;  3R7W A;  4C3Q A;  5GLB A;  4H9O B;  5TFQ A;  1AWI A;  4AWL C;  3W97 C;  4MBK A;  4HJ4 A;  2V2F F;  4R4R A;  5DFY A;  1SKO B;  1RP5 A;  4E04 A;  1KX5 B;  1H3Q A;  3ZG7 B;  2WKR A;  3MGP A;  3OPR A;  2NUT C;  3WKJ B;  1Z09 A;  2VGL S;  3AZN B;  5JRG A;  2W3E A;  3UE1 A;  1W2E A;  1ZG6 A;  1WWS A;  1N9B A;  3FKW A;  3G34 A;  5U47 A;  3VOY A;  2K7S A;  5FI2 A;  3UB6 A;  3AZJ D;  5EM0 A;  1F2K A;  3VH6 W;  1ES5 A;  1P3M A;  2Q9N A;  3TSG A;  1FIK A;  2L1M A;  4QNL A;  3KYQ A;  3L28 A;  1XA1 A;  2IWB A;  1AOI D;  3PXP A;  5B40 C;  5F6A A;  3Q81 A;  2F8N G;  3AZG B;  2QHK A;  2Y2L A;  4EUZ A;  3NBL A;  3LEQ A;  4R8P B;  3E2K A;  4KZ7 A;  3F1N B;  4RA7 A;  1P3K D;  2XLN A;  1DP6 A;  3NDE A;  1P3P C;  2B18 A;  5DTK A;  5B1L B;  1KE3 A;  3B6F D;  3LIC A;  3N8L A;  2A24 B;  3AZH D;  5AV9 B;  1LSX A;  5EVE A;  5DKK A;  3UDF A;  5B1L D;  4IBG A;  5FI7 A;  4EER A;  4GZB A;  4JJN D;  3UTB B;  1J3W A;  4LD9 D;  5AV5 B;  4WU9 C;  3K3C A;  3L2A A;  2HDU A;  1W8Q A;  1K6S A;  4FCF A;  3WD1 A;  3AZG D;  1E4D A;  1MWR A;  4H9O A;  1W63 Q;  3HLE A;  1U35 A;  4Z2H A;  1ESI A;  2IA2 A;  2H0T A;  1M19 A;  5AY8 A;  4WEK A;  3G4P A;  5CPI D;  3S7Q A;  1W1Y A;  1ES4 A;  3IS2 B;  4XT2 B;  4OUI A;  2EX8 A;  2V20 A;  1P3O A;  4NY2 A;  2VKS A;  3PTE A;  1OTD A;  1JNU A;  5LBR A;  2XRO A;  4KUD A;  1NYY A;  4WMC D;  3LIF A;  4N9L A;  4HJ3 A;  1XJ4 A;  3EPJ A;  3EPK A;  2KX6 A;  3AL0 C;  2VV7 A;  4OJ6 A;  2NQB C;  5DTT A;  4WJ3 C;  4Z2J A;  1N4O A;  2GJ3 A;  2JBF A;  4HBU A;  5G18 A;  4Z2K A;  5CHU A;  1T1C A;  1M1A D;  2A2L A;  4II7 A;  2WK0 A;  5EVI A;  1KX3 A;  1TS0 A;  3A6N B;  4I5S A;  5FAS A;  4PPR A;  1GSW A;  4NXB A;  3REI A;  5B0Y A;  3MQ0 A;  2DQN C;  4ZUX C;  3LZ0 D;  4XZQ C;  2Y2N A;  1N1J A;  4HI4 A;  2PYO B;  5GL9 A;  3X1U C;  1BSG A;  1E6R A;  1KDW A;  4OOL A;  5AV8 B;  3B42 A;  3CPT B;  1L0D A;  3GMW A;  3T12 B;  4RVA A;  3ZHH A;  3CHW P;  2WZX A;  2DF4 C;  3UB7 A;  1OT6 A;  4UUZ B;  1W5D A;  3E0Y A;  3DWZ A;  1XP4 A;  1P3L B;  3GEC A;  4WU9 B;  2GZA A;  5FI6 A;  4KEN B;  2W0N A;  4E44 A;  3REL A;  2I72 A;  4Y15 A;  5AY8 B;  1MKM A;  3OBF A;  4WZ5 C;  4XUJ C;  3ZG5 A;  4Z5T B;  3R45 B;  3AV1 A;  3KYE A;  1S0W A;  3MGS A;  4J8U A;  3F1N A;  5AVC D;  1W79 A;  2WGV A;  4S2N C;  3AZK A;  1MWT A;  4GH9 A;  4FTX A;  3DTK A;  2FZ0 A;  3PBT A;  3K2N A;  2UV0 E;  5C3I C;  2CV5 C;  4Z2L A;  3WS2 A;  5AVC C;  3BQA A;  3REL C;  4UA6 A;  4Z5T A;  2J7V A;  2FN2 A;  1HVB A;  4Z9Q A;  3AZH B;  1YLJ A;  2PRF A;  3MGQ D;  2W3D A;  1YU2 A;  4S2L A;  3V50 A;  1ZC2 A;  4AFI A;  4OKP A;  1H3O B;  4MB4 A;  3AZI D;  1CEG A;  3W4O A;  5M19 A;  3MGP C;  3UPO A;  4G3V A;  3REK D;  3IF5 A;  5AQA A;  1KE0 A;  2IWC A;  4Y3I A;  4HEF A;  1GOI A;  1O07 A;  1KX5 C;  2W27 A;  3JVV A;  4YS3 A;  3UTA A;  2AVX A;  4DRA A;  1SDE A;  3AGD A;  3CUE A;  5J8X A;  4YFM A;  1P34 C;  2CV5 D;  5BNV B;  4KZB A;  2ZY3 A;  1ZLA D;  5HSQ A;  3LZ0 C;  3W98 C;  3B33 A;  3NIA A;  2VV8 A;  3I7J A;  1LL8 A;  3TU4 A;  1OJ5 A;  5L07 A;  3Q7V A;  4OQ0 A;  2D02 A;  1E8B A;  3T4O A;  3OCL A;  4J8W A;  1V9Z A;  1T1A A;  3HLC A;  5CP6 D;  3U2A A;  1P3I C;  4S2P A;  1T1B A;  4NXG A;  3TU4 B;  2DMW A;  3FG8 A;  4GN2 A;  5TGF A;  4Y13 A;  2FH5 A;  2ZQA A;  1BFM A;  4HHD A;  3WS0 A;  1W63 M;  2OLV A;  2JCH A;  3MGS B;  4J8U B;  4MB5 A;  3EGD C;  3C1B B;  3AZL A;  4JGQ A;  4ARZ A;  3B6G A;  1TZY D;  3BFD A;  5DF7 A;  2BYK B;  3AZN C;  1S6R A;  3TU4 C;  3IF6 C;  3MGR B;  1RCJ A;  4G91 B;  4ZDX A;  1VEU B;  3V3R A;  2JKR I;  3N8S A;  4R38 A;  1TZY A;  1J9M A;  3MXS A;  3LR0 A;  4BD1 A;  2QMI A;  3ZG0 A;  1HQ3 D;  1K6R A;  1P3M B;  3KXB D;  5DNN A;  4Q0H A;  3LJA A;  4S2K A;  3SH9 A;  1PRQ A;  4OJP A;  5HW3 A;  1PNE A;  4JKT A;  4ESP A;  3AZF D;  3O3V A;  1RGZ A;  5B2I B;  4P6Z M;  3AGE A;  5DNN B;  1HLU P;  2P7J A;  1TF1 A;  3B6F A;  3NCK A;  5B1M C;  4IBX A;  2FFY A;  3IF6 A;  4LV2 A;  3MVD D;  3LR5 A;  4PM8 A;  4KUD C;  3T1S A;  3G30 A;  4NKP A;  1NRF A;  5K5B A;  2HJ9 C;  3CIT A;  1LL5 A;  2OSU A;  1Z2C B;  3REI D;  4ZJ1 A;  5EEC A;  4UEY A;  1K25 A;  4IUK A;  3V9R A;  4R3J A;  3LZ0 B;  4LCM A;  3GR2 A;  5CPK A;  1ERO A;  3MVD C;  4Y0U A;  1WYC A;  5DJU A;  4Y7P A;  1OME A;  3B0B A;  1XXM A;  2Q0O A;  1H8M A;  3UE0 A;  2PHY A;  4HH2 A;  1XX2 A;  3AFA B;  1K55 A;  1YLT A;  3L25 A;  3EQU A;  1KX4 B;  1YU0 A;  2WKQ A;  4OPZ A;  4I3I A;  2C6W B;  4XUZ A;  3H0L C;  4AWL B;  3QP5 A;  5HDS A;  1JWP A;  4JF4 A;  4ZUX B;  4N9K A;  1U35 C;  3MBZ A;  3BEB A;  2P04 A;  5GT0 A;  4YS3 C;  4ZAM A;  5CX7 A;  1TZY B;  1HD8 A;  3T1Q B;  5BS7 A;  2R9X A;  3T4J A;  5F5Y A;  1BLC A;  5JRG D;  4OP8 A;  1YPR A;  1KX4 A;  3BM6 A;  5FEF A;  3MGP B;  5I94 A;  3REH B;  4DE1 A;  2XR0 A;  3AZF A;  1F98 A;  1QMF A;  2O9B A;  4BEN A;  3AZE D;  2EX6 A;  1YU4 A;  4X68 A;  3A1I A;  4Y2F A;  4G92 C;  3MQQ A;  3UMD A;  3MXQ A;  2ZL1 A;  4P85 A;  3AZK C;  3N4I A;  3LZ1 D;  5L2F A;  1P3O B;  5GT0 C;  3IP4 C;  4Q8I A;  1K57 C;  3LIA A;  2WGW A;  3Q1F A;  4PHT A;  1ERQ A;  1CI9 A;  2ZQD A;  4KUD B;  1TAF A;  1M18 D;  4BJP A;  3ZYT A;  5DNM A;  3KSF A;  1SCW A;  4E6X A;  1IEM A;  2Y2K A;  4YM6 B;  3WTP E;  2JKF A;  1MPL A;  5FQM A;  3AZF C;  1KGE A;  3AV1 C;  3EPL A;  3EEA A;  4L9F A;  1W8Y A;  3H7W B;  3MGS C;  4J8U C;  4Z66 B;  1JFI B;  2L5A A;  5B2J B;  1KE4 A;  2JKR M;  1O6I A;  5KDM B;  3R4K A;  1T3U A;  3C7U A;  1P34 D;  4BL3 A;  1XJ3 A;  1ED7 A;  5CGS A;  3REJ B;  4E45 A;  3WX7 A;  2EX9 A;  3S22 A;  4G92 B;  3MNN B;  3MQL A;  4ETZ A;  4IBB A;  2W1T B;  1XFQ A;  1TEM A;  3ZCZ A;  4H9P B;  2NQB B;  4YS3 B;  4JXG A;  5FAP A;  3CPT A;  3HJK A;  4NFT A;  1U35 B;  1OTI A;  4KZ8 A;  1AXB A;  4DE0 A;  1OTA A;  2HPB A;  3LR3 A;  3WD3 A;  3C1B C;  1P3G C;  1IYP A;  5GHY A;  4EEP A;  5KIZ A;  4Z5T D;  3NOT C;  1H8Y A;  3SS5 A;  1LL9 A;  3AZI A;  3A3I A;  3REH C;  2ZY5 A;  1MKI A;  4YIN A;  3AZE C;  2G5I C;  4D60 A;  1BLP A;  5DVA A;  2W1R A;  2JSS A;  2HDR A;  4XXR A;  4YNR A;  3BEC A;  4J8X D;  4HGA B;  2ZQC A;  3AZK D;  3EWK A;  2QZ6 A;  5CPK B;  1B6W A;  4WU8 B;  2C5W B;  3ICY A;  1N9L A;  2ARO C;  2ZC5 B;  3IH9 A;  1P3G D;  3OPP A;  2V0U A;  3MVD B;  5DF8 A;  2GX5 A;  3M2K A;  3W4P A;  1S32 A;  1I2S A;  3UTB A;  5B33 B;  3CWF A;  1KU5 A;  3VH5 A;  3LZ1 B;  2ZC4 B;  3ULF A;  1D1J A;  1PWC A;  1ID3 A;  3AV2 D;  4HIA A;  3NQJ B;  1BH9 A;  1T19 A;  1VQQ A;  2XEP A;  5FQ9 A;  4LV1 A;  2X02 A;  1P97 A;  3L9K A;  3NQU A;  3WS4 A;  5CPK D;  2V1B A;  3FKE A;  3KSI A;  3P01 A;  5B1M A;  3REL D;  3QNC A;  4X55 A;  2PYO C;  4BQM A;  1YLZ A;  3ZG9 B;  2VX8 A;  3MGR D;  2ZY4 A;  2WUQ A;  2WGW B;  2E8I A;  2PU2 A;  3MGR C;  1PI4 A;  3VE4 A;  3C5A A;  4FOF A;  1IFQ A;  1H0M A;  5JYP A;  1ID3 C;  3M6H A;  4EET B;  4OQH A;  3IHB A;  2V9A A;  3KUY A;  3GDI A;  3B0D B;  3JVU A;  2HP5 A;  5AVB D;  2NUP C;  1Y4O A;  5DKL A;  5HDC A;  3LJA B;  4EQI A;  5A92 A;  3WS5 A;  2EXA A;  4ZJ3 A;  3NHQ A;  2I9V A;  3HRE A;  4BLM A;  3FYZ A;  4YM6 D;  2RL3 A;  5B31 C;  2WKE A;  4OLD A;  4WM9 A;  2ZM2 A;  3KS4 A;  3KWQ A;  2OV5 A;  3IT9 A;  4E6W A;  3EG5 B;  3X1T C;  5BO0 B;  3H82 A;  2RVQ C;  3LI8 A;  1WYB A;  1UWP X;  3NJA A;  3RTY A;  4YM6 C;  5JRG C;  1S32 D;  5B0Y B;  4LV0 A;  4IJF A;  3C8C A;  3PBQ A;  3MVD A; 
#chains in the Genus database with same CATH homology
 3VSL A;  4JJN C;  3KWQ B;  3UT9 A;  1E3U A;  1YU3 A;  4R0Q A;  3AZH C;  2J9P A;  4GD8 A;  3AZE B;  1P3O C;  4Y0O A;  4CJN A;  1M18 B;  3PAG A;  5B1L A;  1TVF A;  1F66 A;  4M3K A;  3A1K A;  4FH2 A;  1HQ3 B;  3O62 A;  2Z2L B;  4QY5 A;  4UPK A;  3WAA B;  2FJ7 D;  4DE2 A;  4WYY A;  2WYX A;  2DRW A;  1YLW A;  3IXB A;  3O87 A;  3GSG A;  2P9V B;  4BL2 A;  4E3M A;  4UHU A;  3REI C;  1KX4 D;  1K55 C;  1KX5 D;  4JF6 A;  5F1G A;  4OON A;  3HLG A;  5BT1 C;  1P3A B;  4JF5 A;  4PM9 A;  4KZ4 A;  3VP2 A;  1I5Q A;  4KHA B;  5E5A C;  3HON A;  1YQS A;  3V3S A;  4OVD A;  2Y2P A;  3VH5 T;  4WNN A;  1XGI A;  5AV9 A;  4H9Q B;  1P3F D;  2Z2M B;  4IBI A;  1JVJ A;  3BFG A;  4PM6 A;  1W7F A;  4DKI A;  5E5A B;  5AQ7 A;  2P9V A;  4QLC C;  2XD5 A;  3MKF A;  1EI5 A;  3R45 A;  2ZQ9 A;  1M18 C;  5B0Z D;  3REI B;  3X1U B;  4XUJ D;  4R23 A;  2IWD A;  5FAQ A;  3W99 D;  5AVB B;  4Z5T C;  5GSU C;  5F83 A;  1P3I D;  2YFV A;  5GT3 D;  3LEL B;  3IHA A;  3W8K A;  2ZC7 A;  3UTA B;  2HDQ A;  4RX3 A;  3REK C;  2VGJ A;  3MGS D;  4J8U D;  3AZI C;  4CSR B;  3AFA A;  1FSY A;  1KX5 A;  5B2I A;  1U35 D;  5CP6 B;  5B24 C;  3X1T D;  5B2J D;  2NZD A;  3UTA C;  3MZE A;  4S2I A;  5E2E A;  3E2L A;  3W97 D;  3HLD A;  5FAO A;  3FKV A;  3PBO A;  5B31 D;  5KDM A;  2FJ7 B;  5HAQ A;  3PBN A;  3VOZ A;  1TDL A;  2WKI A;  4KZ9 A;  3B6G D;  1VM1 A;  2Y2O A;  3AZL B;  2V1Z A;  5AV9 D;  1P3G A;  3LCE A;  3UTB C;  4U0X A;  4ZJ2 A;  3VP4 A;  4KUD D;  4OQG A;  2ZY2 A;  4Z2M G;  5B32 C;  3B6F B;  1M1A C;  4BD0 A;  4R8P D;  1IKI A;  5AVC A;  3X1S C;  4R1G A;  2HIO C;  3WKJ A;  4IBJ A;  2ZM5 A;  2ARO A;  5JA4 B;  3UY6 A;  1PW8 A;  5CHM A;  1P3K B;  3M6B A;  4H9Q A;  1S32 C;  4G91 C;  2Y2Q A;  1KVM A;  3KUY C;  4QJG A;  3N3F A;  1ZKJ A;  1P34 A;  4UAA A;  3SH8 A;  4IBK A;  5JRG B;  3OC2 A;  1K56 A;  4P6B A;  4E3N A;  3VH6 T;  5GLC A;  5FUG A;  3W97 A;  2X01 A;  5B1L C;  2JE5 A;  4IBF A;  4MBH A;  2F8N A;  5CPJ A;  2YFW B;  3L29 A;  3X1T A;  4NE3 A;  1YU1 A;  3SOI A;  4QD4 A;  2EFU A;  1CEF A;  3ITA A;  5CPI A;  4WBG A;  3DW0 A;  4C6Y A;  3KWQ D;  3AV1 B;  3REJ C;  1BH9 B;  4GD6 A;  3BYD A;  3C1C D;  1P3F A;  4PM5 A;  1K54 C;  3MNN C;  4H8R A;  3HL9 A;  2ZM0 A;  1GHI A;  5KZH A;  5HL1 A;  3WWX A;  3WTP B;  4B4X A;  4IED A;  4GHA A;  5AV8 D;  4WMC A;  4J8V A;  1SKF A;  3AYW C;  3MZF A;  4YM6 A;  4OQI A;  2J8P A;  1AOI B;  1NZO A;  2Y2H A;  3ZNY A;  5CPI C;  3AV2 C;  4WV4 B;  1KVL A;  3IXG A;  1P3K A;  3WTP A;  4H9S C;  2HIO D;  3REJ A;  4C75 A;  1EQZ C;  1TDG A;  4UUZ A;  5B32 B;  3B6F C;  2LY8 A;  4PM7 A;  4WEJ A;  5EPH A;  3UT9 D;  1E3U D;  3A3J A;  5E2G A;  3C1B D;  4J8W D;  2XQZ A;  3VMA A;  3LZ1 C;  5AV9 C;  5CEC A;  1MWS A;  1P3A C;  1P3K C;  2YFW A;  2DNS A;  2RIQ A;  1P3B B;  3Q7V B;  3BFF A;  5GT3 B;  5B0Z C;  5EVL A;  2ZD8 A;  5B33 C;  4LCL A;  1JFI A;  4P87 A;  3AYW D;  1WWI A;  3N6I A;  3VH5 W;  3GVB A;  1MY8 A;  3UDX A;  3LEL C;  3MFD A;  3AV1 D;  1LI9 A;  5B0Z B;  2HUE B;  4Z66 C;  3LZ1 A;  1GA0 A;  1ULY A;  1K4E A;  1WE4 A;  1KGG A;  5AV8 A;  3F6T A;  2X71 A;  4HES A;  5BT1 D;  1KX3 C;  2ZJ9 A;  3C1C B;  4B4Z A;  5B0Z A;  5E5A D;  2JC7 A;  5GT0 D;  3UPP A;  5B31 G;  3AYW B;  1FR1 A;  1ZG4 A;  4IBR A;  1JWV A;  5AQB A;  3AZJ B;  1P3M D;  4N92 A;  1FCO A;  5FUG B;  3W97 B;  4XUX A;  3AZE A;  3A6N C;  4P0M A;  5B2I C;  3KS8 A;  5A93 A;  1PZO A;  5FDH A;  2XGN A;  1DJC A;  4JLF A;  3V39 A;  2XD1 A;  2XF3 A;  4H9R B;  4RYE A;  3AFA D;  3W96 C;  3HLB A;  4UA7 A;  1L0G A;  3X1V A;  3ZVW A;  2ZM8 A;  1P3L A;  1XKZ A;  1P3I A;  2Q9M A;  5AV6 A;  4NZ3 A;  3W96 D;  2RVQ D;  3MKE A;  3CMZ A;  4DF6 A;  4A5R A;  1SHV A;  5GHZ A;  3AN2 B;  4OOM A;  5AV5 A;  3AZN A;  4R8P C;  3W96 A;  2PYO A;  1BT5 A;  3OCN A;  3AN2 D;  5F99 A;  3BLM A;  2Y2I A;  4GOG A;  3X1V C;  5CEB A;  1TZY C;  2GDN A;  5CPJ C;  4FD8 A;  3SH7 A;  1EWZ A;  3VSK A;  3W98 B;  1ID3 D;  1GHP A;  4J8W B;  4GHL A;  5HAP A;  3AN2 A;  5BPV A;  3WAA A;  1F66 B;  2H5S A;  5B40 D;  3KUY B;  4KQQ A;  3G2Y A;  3HUM A;  3LEZ A;  3NQJ A;  3W98 A;  3V5M A;  3ZFZ A;  1K56 D;  5B1M D;  3LEL D;  5IHV A;  4GKU A;  5B40 A;  3UNW A;  2CC1 A;  4FSF A;  2F8N D;  5F82 A;  4WNN B;  5B1M B;  2H10 A;  4R3B A;  3X1V B;  3SS4 A;  5B40 B;  3KUY D;  3AZH A;  4OOY A;  5F1F A;  3RJU A;  1FCM A;  1K54 A;  2ZLY A;  1IKG A;  4D2O A;  2CV5 B;  1IEL A;  4X23 C;  4DDS A;  5M1A A;  3A3F A;  3B0D C;  5D3O A;  3W96 B;  5TR7 A;  5DNN C;  3AYW A;  3REK B;  5AY8 C;  3LJA C;  4N1X A;  5DNN D;  4QLC D;  3C4O A;  2FFF B;  3WTP C;  4OPQ A;  3AZJ C;  1P3G B;  1M1A B;  5EOO A;  3B3X A;  1P3F C;  1P3M C;  1EQZ B;  1BZA A;  1YMS A;  4X56 A;  1M40 A;  4GDB A;  3PBS A;  2F8N H;  3FDD A;  1BLS A;  2A49 A;  2ZC6 B;  3O86 A;  4E3O A;  3MNN D;  4N1H A;  4Z66 A;  1PYY A;  1N1J B;  3AV2 A;  3EQV A;  1BTL A;  5JA4 A;  4K0X A;  1Z6F A;  4CAY B;  2WKH A;  1EQZ A;  1M6K A;  5EE8 A;  1G68 A;  5B33 A;  4H9N B;  1PZP A;  4JPM A;  2BYK A;  1H3O A;  4JXS A;  5C3I B;  3C1C C;  1F66 C;  2F8N K;  2Y2M A;  3P98 A;  3REJ D;  3X1U A;  4S2O A;  4NE5 A;  4KG2 A;  1NZU A;  4WEL A;  4LD9 B;  4H9N A;  4MBF A;  5AY8 D;  4CAY A;  4KZ5 A;  2BG1 A;  1YUE A;  2HUE C;  1C3B A;  5CTM A;  4LV3 A;  3C7V A;  1P3B D;  3HBR A;  3VP0 A;  3C1C A;  3KXB A;  2J8Y A;  1L0E A;  3TG9 A;  4S2N A;  5E5A A;  4GNU A;  4H9P A;  2NQB A;  5AV6 C;  3REH A;  5HX9 A;  1P3F B;  4NZ5 A;  1PWG A;  1Q2Q A;  3L26 A;  4QB8 A;  1YLY A;  1F1E A;  2WAF A;  5DNM C;  3CJM A;  3AZM D;  2IO5 B;  5EVI D;  2Y91 A;  3MXR A;  3C4P A;  2ZQ8 A;  4LD9 C;  4KG6 A;  2EXB A;  4XZQ D;  4J8V B;  5B32 D;  1KDS A;  5E43 A;  4ZTK A;  1ONG A;  5FA7 A;  3N7W A;  4U3T A;  4IVI A;  5AVC B;  4K91 A;  1NXY A;  2VGK A;  1P3L C;  1TAF B;  3OZH A;  3Q7Z A;  5FQQ A;  4X6T A;  1FCN A;  5B32 A;  5AVB C;  3DWK A;  3AN2 C;  1P3L D;  1ZLA A;  3G2Z A;  4E3J A;  5CPI B;  3X1S A;  3GV9 A;  2XFS A;  4LD9 A;  1IYO A;  4KGC D;  1GCE A;  4XUJ A;  2IOU A;  2A3U A;  3S4X A;  3IXH A;  3GQZ A;  1Y54 A;  4QHC A;  4NE6 A;  5F99 C;  3WA9 A;  2PYO D;  4F94 A;  3BFE A;  3AV2 B;  3PBR A;  1GHM A;  5AV5 D;  5GSU B;  1ES2 A;  3AFA C;  5CXW A;  1P3B C;  3Q07 A;  1S32 B;  2J9O A;  5F99 D;  5BO0 A;  2NZD C;  1AOI A;  5AV6 D;  2XFT A;  4KQR A;  3NDG A;  3X1S B;  5GT3 C;  3S1Y A;  1BH8 A;  1KX3 B;  3MGQ A;  3L27 A;  3WA9 C;  1HZO A;  4X23 A;  3HUN A;  4DRB A;  1P3P D;  4WU8 C;  1M1A A;  4IVK A;  4UA9 A;  1KGF A;  4K0W A;  2QPN A;  1PWD A;  5GXQ C;  3AZJ A;  2DCF A;  5FQK A;  3G35 A;  3LZ0 A;  4Z66 D;  1B67 A;  1PW1 A;  1K38 A;  1FQG A;  3IWI A;  1M19 D;  1H5X A;  3REL B;  4OLG A;  3HVF A;  2NZD B;  1PIO A;  5E2H A;  3WAA D;  1P34 B;  1K4F A;  1E25 A;  2VQR A;  1BH8 B;  1A7W A;  2B5R A;  2EX2 A;  4XUJ B;  5CPK C;  1NY0 A;  5HFO A;  1M19 C;  4KGC A;  5GLD A;  5M18 A;  3WA9 B;  4E3L A;  4NET A;  4NZ4 A;  4MLL A;  3AZL D;  1FSW A;  3IH8 A;  1U60 A;  3AZI B;  5AV6 B;  3P09 A;  3PAE A;  4KZ3 A;  3NY4 A;  4WU8 D;  4WZ4 A;  3LJA D;  2CWE A;  3AZF B;  2FJ7 C;  3MZD A;  3GRJ A;  1P3P A;  4HBT A;  3UT9 C;  4CPK A;  5B31 B;  3JYI A;  5GHX A;  4X23 D;  3REH D;  4OJL A;  1ERM A;  3X1T B;  3MNN A;  2UWX A;  4ZUX A;  5BOH A;  1RGY A;  5FQI A;  3UT9 B;  1R4V A;  3UN7 A;  3LEL A;  1MBL A;  3UPN A;  3X1U D;  4J8V C;  4H9R A;  5HAI A;  1P3I B;  3CZD A;  3DTM A;  5AV8 C;  5KSH A;  5CHJ A;  4NYY A;  2OLU A;  1ID3 B;  5GSU A;  4XZQ B;  5G49 A;  4ZBJ B;  1JTG A;  4MNR A;  3AZM B;  5B32 G;  3WTP D;  5GXQ B;  1CI8 A;  4JXW A;  4PMA A;  4DDY A;  5CPJ D;  5EOE A;  1I2W A;  3WA9 D;  1P3O D;  3IWO A;  1GA9 A;  3D4F A;  4B88 A;  1M19 B;  3AZK B;  3BLS A;  5B2J A;  2NZD D;  3NQU B;  3FV7 A;  3M2J A;  1BUL A;  4XZQ A;  3UO9 A;  4JXV A;  3WS1 A;  2W8S A;  4LEN A;  3AZM A;  1PI5 A;  5DNM D;  4Y0T A;  3SS3 A;  1K57 A;  4Z2M H;  3EPH A;  3A3D A;  1L2S A;  4ZUX D;  1NYM A;  5FQJ A;  2Y2G A;  5DF9 A;  4YS3 D;  4DE3 A;  4OP5 A;  2PBY A;  4EV4 A;  3ZG8 B;  5AV5 C;  5EUA A;  4R8P A;  3X1S D;  3LO7 A;  2HIO A;  3WKJ C;  4OJ5 A;  3RXX A;  5AQ9 A;  1LI0 A;  3FZC A;  1O7E A;  2EFX A;  3QHY A;  5CHL B;  4JJN B;  3UTB D;  4E3I A;  4ZBE A;  3REK A;  1P3P B;  5F99 B;  5FAT A;  3H0R C;  3TOI A;  5CPJ B;  1QME A;  1FOF A;  2CV5 A;  5DTS A;  4DQY B;  3B6G C;  1AOI C;  4KQO A;  1ZLA C;  2Y59 A;  3ISG A;  1HQ3 A;  3O62 B;  1LHY A;  4FH4 A;  4OPY A;  3H0M C;  3V9R B;  3AZG A;  1BUE A;  3HSH A;  5CRF A;  4KG5 A;  2BYM A;  3G31 A;  5B24 D;  4MEZ A;  1YM1 A;  1XGJ A;  4KGC B;  5CP6 A;  2XH9 A;  1PZR A;  3ZNT A;  3IF6 B;  3Q82 A;  3WRT A;  4J8X A;  4WU8 A;  4GB7 A;  2Y2J A;  4R4S A;  1XA7 A;  2HDS A;  3KXB B;  3MGP D;  4S2M A;  4KZ6 A;  3VFH A;  3W99 C;  1JTD A;  5A90 A;  1ONH A;  3GTC A;  5DNM B;  2IO5 C;  3MGQ C;  4IBE A;  5HAR A;  1YMX A;  4EO5 C;  5EVI B;  3VP3 A;  4J8W C;  3VH6 A;  4KZA A;  2BYM B;  1DJB A;  3LY3 A;  3AZN D;  4J8X C;  2HIO B;  3IWQ A;  4GDN A;  3KFU G;  2WAD A;  4JJN A;  5CTN A;  4H9S A;  3WRZ A;  5CED A;  4EBP A;  3LY4 A;  3B0C T;  3W99 A;  4S2J A;  2F2A C;  1F66 D;  4WU9 A;  3MGR A;  3IQA A;  3W98 D;  1DY6 A;  2RCX A;  2YFV B;  3P5J B;  2FJ7 A;  1IYS A;  4KGC C;  5BNV A;  3QNB A;  1P3A A;  2WGI A;  5BS7 C;  1KX4 C;  2ARO B;  4J8X B;  5BNX A;  3A3E A;  5B31 A;  1ALQ A;  4QU3 A;  1ESU A;  1P3A D;  4HGA C;  3KWQ C;  2Y4A A;  4ID4 A;  4NK3 A;  3KSY A;  4L0L A;  3UDI A;  4OH0 A;  4X23 B;  2ZC3 B;  2NQB D;  3WKJ D;  3OPL A;  1MWU A;  1CK3 A;  4X53 A;  1MXO A;  1LLB A;  4E3K A;  4EWF A;  1EQZ D;  1Q2P A;  4QLC A;  2XDM A;  4KHA A;  5KSC A;  3HUO A;  1SDN A;  4IJE A;  2HP6 A;  4M6B A;  3AZM C;  3HLF A;  5GT0 B;  4ZBJ C;  4WU9 D;  4QLC B;  3O62 C;  5E2F A;  3O62 D;  3A6N A;  2HP9 A;  2R9W A;  4OJO A;  4DRT A;  3ZVT A;  5B0Y D;  1YLP A;  4CSR A;  3RXW A;  4DXB A;  4NZ1 A;  3NC8 A;  3W4Q A;  3B6G B;  1IYQ A;  3N8R A;  1FR6 A;  3UE3 A;  3IXD A;  5BNX B;  3ITB A;  5G49 B;  4QY6 A;  3X1V D;  5AVB A;  3AGF A;  2F8N B;  4JBF A;  4EBL A;  3MGQ B;  2G2U A;  4EBN A;  4EO5 B;  4O7D A;  5EVI C;  2G5H C;  1HTZ A;  4X69 A;  2WZZ A;  5CGW A;  3B0C W;  5B0Y C;  5B2J C;  4IBD A;  3HLW A;  3O88 A;  3ZGA B;  1DJA A;  1NJ4 A;  3KXB C;  3UTA D;  2XK1 A;  1L0F A;  1JWZ A;  3OPH A;  1M18 A;  1KX3 D;  3W99 B;  4U0T A;  3BRM A;  5JYO A;  5A91 A;  4OPR A;  3TU4 D;  1P3B A;  3CG5 A;  1XPB A;  2WAE A;  4J8V D;  5FSR A;  1ES3 A;  1HTA A;  2P74 A;  2Y55 A;  3WAA C;  1H8Z A;  5CER A;  3BFC A;  1HQ3 C;  3VFF A;  2ZQ7 A;  2H0Y A;  4WZ5 A;  5KMW A;  2ARO D;  3AZG C;  4LG2 A;  5GT3 A;  5GSU D;  4RX2 A;  3FWL A;  4DXC A;  3C1B A;  3A6N D;  1ZLA B;  2G2W A;  3G32 A;  5B33 D;  1G6A A;  3ZDJ A;  5CP6 C;  5B24 B;  5GXQ D;  4WZS B;  4NYU A;  3NI9 A;  1Q9C A;  5CGX A;  1BLH A;  5GLA A;  5B24 A;  5B2I D;  3VP1 A;  3AZL C;  2ZMA A;  5GXQ A;  4IBC A;  1YT4 A;  2PU4 A;  2BLS A;  4C3Q A;  5GLB A;  4H9O B;  5TFQ A;  4AWL C;  3W97 C;  4MBK A;  2V2F F;  4R4R A;  1RP5 A;  1KX5 B;  3ZG7 B;  3MGP A;  3OPR A;  3WKJ B;  3AZN B;  5JRG A;  3UE1 A;  1W2E A;  1ZG6 A;  1WWS A;  1N9B A;  3FKW A;  3G34 A;  5U47 A;  3VOY A;  5FI2 A;  3AZJ D;  3VH6 W;  1ES5 A;  1P3M A;  2Q9N A;  3TSG A;  4QNL A;  3L28 A;  1XA1 A;  2IWB A;  1AOI D;  5B40 C;  3Q81 A;  2F8N G;  3AZG B;  2Y2L A;  4EUZ A;  3NBL A;  4R8P B;  3E2K A;  4KZ7 A;  4RA7 A;  1P3K D;  2XLN A;  3NDE A;  1P3P C;  5DTK A;  5B1L B;  1KE3 A;  3B6F D;  3N8L A;  3AZH D;  5AV9 B;  3UDF A;  5B1L D;  4IBG A;  5FI7 A;  4GZB A;  4JJN D;  3UTB B;  4LD9 D;  5AV5 B;  4WU9 C;  3L2A A;  2HDU A;  1W8Q A;  4FCF A;  1K6S A;  3AZG D;  1E4D A;  1MWR A;  4H9O A;  3HLE A;  1U35 A;  1ESI A;  2H0T A;  1M19 A;  5AY8 A;  4WEK A;  3G4P A;  5CPI D;  1ES4 A;  4OUI A;  2EX8 A;  2V20 A;  1P3O A;  4NY2 A;  3PTE A;  4KUD A;  1NYY A;  4WMC D;  4N9L A;  3EPJ A;  3EPK A;  3AL0 C;  4OJ6 A;  2NQB C;  5DTT A;  4WJ3 C;  1N4O A;  4HBU A;  2JBF A;  5G18 A;  5CHU A;  1M1A D;  2WK0 A;  5EVI A;  1KX3 A;  3A6N B;  5FAS A;  4PPR A;  3REI A;  5B0Y A;  2DQN C;  4ZUX C;  3LZ0 D;  4XZQ C;  2Y2N A;  1N1J A;  2PYO B;  5GL9 A;  3X1U C;  1BSG A;  1KDW A;  4OOL A;  5AV8 B;  1L0D A;  3GMW A;  4RVA A;  3ZHH A;  2WZX A;  2DF4 C;  4UUZ B;  1W5D A;  3DWZ A;  1XP4 A;  1P3L B;  4WU9 B;  5FI6 A;  4KEN B;  4E44 A;  3REL A;  2I72 A;  5AY8 B;  4WZ5 C;  4XUJ C;  3ZG5 A;  4Z5T B;  3R45 B;  3AV1 A;  1S0W A;  3MGS A;  4J8U A;  5AVC D;  1W79 A;  2WGV A;  4S2N C;  3AZK A;  1MWT A;  4GH9 A;  3PBT A;  5C3I C;  2CV5 C;  3WS2 A;  5AVC C;  3REL C;  4UA6 A;  4Z5T A;  2J7V A;  1HVB A;  4Z9Q A;  3AZH B;  1YLJ A;  3MGQ D;  1YU2 A;  4S2L A;  3V50 A;  1ZC2 A;  4OKP A;  1H3O B;  1CEG A;  3AZI D;  3W4O A;  5M19 A;  3MGP C;  3UPO A;  3REK D;  3IF5 A;  5AQA A;  1KE0 A;  2IWC A;  4HEF A;  1O07 A;  1KX5 C;  4YS3 A;  3UTA A;  4DRA A;  1SDE A;  3AGD A;  5J8X A;  4YFM A;  1P34 C;  2CV5 D;  5BNV B;  4KZB A;  2ZY3 A;  1ZLA D;  3LZ0 C;  3W98 C;  3NIA A;  3I7J A;  3TU4 A;  3Q7V A;  4OQ0 A;  3OCL A;  4J8W A;  3HLC A;  5CP6 D;  1P3I C;  4S2P A;  3TU4 B;  4GN2 A;  5TGF A;  2ZQA A;  1BFM A;  3WS0 A;  2OLV A;  2JCH A;  3MGS B;  4J8U B;  3C1B B;  3AZL A;  3B6G A;  1TZY D;  3BFD A;  5DF7 A;  2BYK B;  3AZN C;  1S6R A;  3TU4 C;  3IF6 C;  3MGR B;  1RCJ A;  4G91 B;  4ZDX A;  3V3R A;  3N8S A;  1TZY A;  1J9M A;  3MXS A;  4BD1 A;  2QMI A;  3ZG0 A;  1HQ3 D;  1K6R A;  1P3M B;  3KXB D;  5DNN A;  3LJA A;  4S2K A;  3SH9 A;  4OJP A;  5HW3 A;  4JKT A;  3AZF D;  3O3V A;  1RGZ A;  5B2I B;  3AGE A;  5DNN B;  3B6F A;  3NCK A;  5B1M C;  4IBX A;  2FFY A;  3IF6 A;  4LV2 A;  3MVD D;  4PM8 A;  4KUD C;  3G30 A;  1NRF A;  1LL5 A;  2OSU A;  1Z2C B;  3REI D;  4ZJ1 A;  5EEC A;  1K25 A;  3V9R A;  4R3J A;  3LZ0 B;  4LCM A;  3GR2 A;  5CPK A;  1ERO A;  3MVD C;  4Y0U A;  1WYC A;  4Y7P A;  1OME A;  3B0B A;  1XXM A;  3UE0 A;  1XX2 A;  3AFA B;  1K55 A;  1YLT A;  3L25 A;  3EQU A;  1KX4 B;  1YU0 A;  4OPZ A;  2C6W B;  4XUZ A;  3H0L C;  4AWL B;  1JWP A;  4JF4 A;  4ZUX B;  4N9K A;  1U35 C;  3MBZ A;  3BEB A;  5GT0 A;  4YS3 C;  4ZAM A;  1TZY B;  1HD8 A;  5BS7 A;  2R9X A;  1BLC A;  5JRG D;  4OP8 A;  1KX4 A;  3BM6 A;  3MGP B;  5I94 A;  3REH B;  4DE1 A;  2XR0 A;  3AZF A;  1QMF A;  4BEN A;  3AZE D;  2EX6 A;  1YU4 A;  4X68 A;  3A1I A;  4G92 C;  4P85 A;  3AZK C;  3N4I A;  3LZ1 D;  5L2F A;  1P3O B;  5GT0 C;  3IP4 C;  4Q8I A;  1K57 C;  2WGW A;  3Q1F A;  1ERQ A;  1CI9 A;  2ZQD A;  4KUD B;  1TAF A;  1M18 D;  4BJP A;  5DNM A;  1SCW A;  4E6X A;  1IEM A;  2Y2K A;  4YM6 B;  3WTP E;  1MPL A;  5FQM A;  3AZF C;  1KGE A;  3AV1 C;  3EPL A;  1W8Y A;  3MGS C;  4J8U C;  4Z66 B;  1JFI B;  2L5A A;  5B2J B;  1KE4 A;  5KDM B;  1T3U A;  3C7U A;  1P34 D;  4BL3 A;  5CGS A;  3REJ B;  4E45 A;  3WX7 A;  2EX9 A;  3S22 A;  4G92 B;  3MNN B;  4IBB A;  1TEM A;  3ZCZ A;  4H9P B;  2NQB B;  4YS3 B;  4JXG A;  5FAP A;  4NFT A;  1U35 B;  4KZ8 A;  1AXB A;  4DE0 A;  2HPB A;  3C1B C;  1P3G C;  1IYP A;  5GHY A;  4Z5T D;  1H8Y A;  3SS5 A;  1LL9 A;  3AZI A;  3A3I A;  3REH C;  2ZY5 A;  1MKI A;  4YIN A;  3AZE C;  2G5I C;  1BLP A;  5DVA A;  2JSS A;  2HDR A;  4XXR A;  3BEC A;  4J8X D;  4HGA B;  2ZQC A;  3AZK D;  2QZ6 A;  5CPK B;  1B6W A;  4WU8 B;  2C5W B;  3OPP A;  3IH9 A;  2ARO C;  2ZC5 B;  1P3G D;  3MVD B;  5DF8 A;  3M2K A;  3W4P A;  1S32 A;  1I2S A;  3UTB A;  5B33 B;  1KU5 A;  3VH5 A;  3LZ1 B;  2ZC4 B;  1PWC A;  1ID3 A;  3AV2 D;  3NQJ B;  1BH9 A;  1VQQ A;  2XEP A;  5FQ9 A;  4LV1 A;  2X02 A;  3NQU A;  3WS4 A;  5CPK D;  3FKE A;  5B1M A;  3REL D;  3QNC A;  4X55 A;  2PYO C;  4BQM A;  1YLZ A;  3ZG9 B;  3MGR D;  2WUQ A;  2ZY4 A;  2WGW B;  2E8I A;  2PU2 A;  3MGR C;  1PI4 A;  3C5A A;  5JYP A;  1ID3 C;  3M6H A;  4OQH A;  3IHB A;  3KUY A;  3B0D B;  2HP5 A;  5AVB D;  3LJA B;  4EQI A;  5A92 A;  3WS5 A;  2EXA A;  4ZJ3 A;  3HRE A;  4BLM A;  3FYZ A;  4YM6 D;  2RL3 A;  5B31 C;  2WKE A;  4OLD A;  4WM9 A;  2ZM2 A;  3KS4 A;  3KWQ A;  2OV5 A;  3IT9 A;  4E6W A;  3EG5 B;  3X1T C;  5BO0 B;  2RVQ C;  1WYB A;  4YM6 C;  5JRG C;  1S32 D;  5B0Y B;  4LV0 A;  4IJF A;  3PBQ A;  3MVD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...