2Y2QA

Penicillin-binding protein 1b (pbp-1b) in complex with an alkyl boronate (z06)
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
489
structure length
469
Chain Sequence
ISEITYSDGTVIASIDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTGQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PENICILLIN-BINDING PROTEIN 1B
publication title Structure-Guided Design of Cell Wall Biosynthesis Inhibitors that Overcome Beta-Lactam Resistance in Staphylococcus Aureus (Mrsa).
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
total genus 164
structure length 469
sequence length 489
chains with identical sequence B
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2y2qA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2y2qA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2y2qA02
2V2FF 5CECA 3HL9A 5FI7A 2Z2LB 4N1HA 5CRFA 2WADA 3ZGAB 2X02A 4Q8IA 3ITAA 1BLHA 1SKFA 2BG1A 1LHYA 3IXGA 5FDHA 4DE3A 5I94A 4WMCA 3UE1A 4P6BA 1NYYA 2EX6A 1FR6A 1K56A 1ES4A 1ONHA 2ZQCA 3FKVA 2XEPA 5F83A 4WZ5C 5EOOA 1YLJA 1QMFA 3C4PA 3BEBA 4GOGA 2VGKA 3ZHHA 3WS5A 1OMEA 3MXRA 3HVFA 3BECA 4QU3A 1ES5A 1L0DA 5CGSA 2DRWA 1NYMA 3IXBA 4LENA 1MWSA 4WBGA 3UN7A 2OSUA 1EROA 1IYOA 1GHMA 1MKIA 3SS5A 2R9XA 4OH0A 5BOHA 3VP4A 2RL3A 3OCNA 5CTMA 1G6AA 3MBZA 3S22A 4KG6A 1RCJA 2X01A 4K0WA 2ZC5B 1KGEA 4KG5A 2B5RA 4N92A 4QY5A 5A91A 3RXXA 1GA0A 1BUEA 3VP3A 1O7EA 4U3TA 3S1YA 3ZG0A 2H0TA 4ZDXA 4IBXA 3OPLA 2EX2A 3O3VA 4OQHA 4C3QA 4OPQA 1FCMA 3FYZA 1PI5A 2V1ZA 3N6IA 3DWKA 5EVLA 2XH9A 3BYDA 4LV2A 4NK3A 3OC2A 4PMAA 3ZG5A 1G68A 1SDNA 4WEJA 3HLFA 1LL5A 3MXSA 3Q7VA 3WS4A 1GCEA 2WAFA 1YLPA 2DNSA 4E3OA 3WS2A 3V50A 1S0WA 2WK0A 2XGNA 3TOIA 4OQ0A 4Z9QA 2C5WB 2P9VA 2HPBA 5CXWA 2E8IA 1FR1A 3OCLA 3OPHA 1VQQA 5GL9A 2EXAA 3PTEA 4S2IA 3SH9A 4FCFA 4ID4A 3OZHA 4JXWA 4RX2A 5FAPA 5FQJA 3HLEA 3Q82A 1PW1A 4OQIA 3IF5A 3N8LA 1PI4A 3PBOA 1BT5A 4OONA 3VMAA 4OQGA 4IVKA 1YLZA 4OKPA 5DTTA 3BRMA 3Q81A 4BD1A 1KDSA 3O87A 1EWZA 2HDRA 3UDFA 1IKIA 4PPRA 1NZOA 5HX9A 3UPNA 4F94A 5DF7A 3SS4A 1Z6FA 3CZDA 4N1XA 4YINA 2Y2NA 5CERA 1SHVA 4R0QA 4X56A 5HW3A 1ERQA 1I2WA 3BM6A 3PBNA 3JYIA 4RYEA 4O7DA 1K38A 1PZPA 3A3FA 4UA7A 2PU2A 4KQRA 4QD4A 2XFSA 5D3OA 4DRTA 1MXOA 2ZQ9A 4FH2A 4JLFA 3V39A 2G2UA 2XFTA 4P0MA 3IHBA 3E2KA 4UA9A 5EVID 3ZVTA 2XLNA 3PBQA 3OPPA 2EX9A 2OLUA 4BQMA 3G4PA 1ZG6A 4DE2A 3ITBA 4MNRA 4CPKA 3LY4A 3O86A 2JBFA 1KE4A 2WGWA 3G32A 2Y2QA 1IELA 2ZM0A 4E6WA 3NBLA 4U0TA 1PW8A 1QMEA 4LCMA 4ZJ1A 4GDNA 1K6RA 4R23A 5GLDA 2ZC6B 4E3MA 4GN2A 1ERMA 4BENA 2J7VA 2XK1A 4RA7A 4B4ZA 2Y2KA 5G18A 2Y2GA 4LV1A 4JXGA 2WKEA 5GHXA 2EX8A 4EUZA 1TDLA 1K25A 1K4FA 4HEFA 3S4XA 2ZC3B 5E2HA 4EBLA 5FASA 1KE3A 3AGFA 1PWDA 3SH7A 3ZFZA 3UNWA 3A3JA 3BFEA 3O88A 3HUOA 4OVDA 3Q1FA 4GNUA 3SS3A 4JBFA 4ZTKA 3ZDJA 1E4DA 1KDWA 4K0XA 5A92A 3N4IA 5HL1A 2XR0A 3DW0A 3N8SA 4XUXA 5GHZA 3UY6A 5KMWA 3VSLA 4MEZA 1TDGA 3IHAA 2P74A 1YT4A 3BFCA 1W79A 4UHUA 4WM9A 5M19A 1GHPA 1JVJA 1WYBA 4OOLA 2WKHA 1AXBA 4EWFA 2A49A 2HDUA 3PAGA 2J8YA 3ZG7B 4NETA 4WEKA 1L2SA 2HDQA 2UWXA 1XA1A 1YMXA 5JYOA 2XDMA 1ZC2A 4S2JA 5CGXA 5M18A 3G35A 1KGFA 5GLBA 4PM5A 2Y2IA 4MBKA 3M6BA 3Q07A 3M2JA 5GHYA 4GB7A 1PWGA 1YLTA 3BFFA 1W8YA 3G2ZA 3QHYA 5FQ9A 1M6KA 2WKIA 2WGIA 4QJGA 2EXBA 3MZEA 5AQBA 3LEZA 3BLSA 3AGDA 3FWLA 3N7WA 3WS0A 4RVAA 1CEFA 5F1FA 2ZD8A 1LL9A 1H5XA 2PU4A 1E3UD 1YM1A 1L0FA 2G2WA 2ZQAA 5CHJA 5CHMA 2ZMAA 5CTNA 2WZXA 3HLBA 1GHIA 1KGGA 4PM9A 4EQIA 3GRJA 4KQOA 1ZKJA 2RCXA 4DDYA 5FI2A 1W8QA 2HP6A 5FQMA 2ZM8A 3Q7VB 4X69A 4OPZA 1DJAA 3FZCA 3MZDA 4R3BA 3HBRA 4KZBA 3AGEA 1K55A 2XD5A 3OPRA 3GV9A 2P9VB 1N9BA 4B88A 3GTCA 5EOEA 1IYSA 3VP0A 1NXYA 3ZG8B 1TEMA 1RGZA 3IH9A 3IXHA 5DTSA 4H8RA 2ZM2A 3HREA 3BFGA 1MWTA 1NY0A 4P87A 2PBYA 4Y0OA 5EVIB 1BTLA 4GKUA 4LV0A 5EVIA 1J9MA 1KVLA 3DWZA 3G31A 4XXRA 3HLCA 5IHVA 5TR7A 1PIOA 1NZUA 1PZOA 4MBHA 5FI6A 1M40A 1BLCA 1W5DA 4S2KA 1S6RA 3MKEA 4FSFA 4EV4A 3HLDA 1YQSA 5J8XA 1WYCA 1MWRA 3P09A 2H10A 4B4XA 5AQ9A 4R4SA 4BD0A 4DXCA 2J9OA 3HUNA 2ZC7A 1MY8A 2QPNA 3BLMA 5FA7A 5DF8A 1KE0A 1CK3A 4FD8A 2WZZA 1K55C 3IH8A 2Y4AA 1E25A 1K6SA 1IEMA 3FV7A 3UPOA 4QB8A 2JC7A 4S2PA 5KSHA 3HLGA 3PAEA 5M1AA 3LCEA 1TVFA 1ESIA 1XKZA 5HARA 3NCKA 3CJMA 3TG9A 4Y0TA 1Q2PA 4KZ6A 1Y54A 3IWQA 2WGWB 3N8RA 3LY3A 4Y7PA 5EVIC 3QNBA 1CI9A 1SDEA 1MWUA 3G34A 5EPHA 1BLSA 4BLMA 4GD8A 2IWBA 4JF5A 1IKGA 1HZOA 1BULA 4ZBEA 3A3EA 4OLDA 1DJBA 4ZJ2A 2BLSA 2HP9A 4LCLA 2H5SA 4YFMA 4JF6A 1I5QA 3PBSA 1O07A 1I2SA 5HAQA 2Y55A 3V3SA 2IWCA 1CI8A 1NRFA 1KVMA 2XQZA 3UO9A 1XXMA 2XD1A 2WGVA 5E2GA 1U60A 2V20A 4QHCA 5FSRA 5KZHA 2EFUA 1H8ZA 5A90A 1L0GA 3WWXA 1L0EA 4IEDA 4E3IA 1BLPA 4R1GA 5KSCA 4XUZA 4E3NA 3VOZA 1PYYA 4M3KA 5GLCA 3NDEA 2FFYA 5FQKA 4S2LA 4HBTA 3GMWA 3UPPA 4PM6A 4UA6A 1DY6A 1JTGA 4R4RA 4DXBA 4OPYA 3V5MA 2ZC4B 1XGIA 1H8YA 2Y2PA 1FCOA 1RGYA 1Q2QA 2QZ6A 3E2LA 4GDBA 4EBNA 3ISGA 4KG2A 4DKIA 1N4OA 3IF6A 4FH4A 4X68A 1W7FA 1E3UA 3MFDA 3BFDA 1ES3A 5EUAA 3VFFA 4N9LA 2Y59A 4OOMA 5TGFA 4JF4A 3SH8A 1FSYA 1K57A 2X71A 3NIAA 4OLGA 4PM7A 3UE3A 5L2FA 4KZAA 4KQQA 2JCHA 3W4PA 4PM8A 3ZG9B 5DTKA 1XPBA 4P85A 3MZFA 2Y2JA 4LV3A 3UE0A 4ZJ3A 2GDNA 3EQVA 5AQAA 2Y2OA 1LLBA 4C75A 4E6XA 2WYXA 1IYQA 3VSKA 1XA7A 4N9KA 4DF6A 1YLWA 2C6WB 1XX2A 1SCWA 4GZBA 4S2NA 1RP5A 4C6YA 2Z2MB 3C7UA 3NDGA 1CEGA 3UDIA 3ZVWA 1HTZA 4KZ8A 3GVBA 5FAQA 4KZ4A 3IF6C 3DTMA 2FFFB 3HLWA 4HBUA 3NC8A 1MPLA 3MKFA 4K91A 4Y0UA 5CHUA 4EBPA 5JYPA 2CC1A 2ZLYA 4WELA 1FCNA 4BL2A 4WMCD 4HESA 3VOYA 1K57C 4KZ3A 4X55A 3V3RA 4CJNA 1K56D 4DE0A 3QNCA 4ZAMA 1NJ4A 3C4OA 4U0XA 2Q9NA 2Y2MA 4IVIA 3VFHA 4KZ5A 1MBLA 1FQGA 4DDSA 2DCFA 3PBTA 5E43A 1ES2A 3UDXA 2A3UA 3VP2A 3A3DA 3A3IA 1K54A 3WS1A 3CMZA 2QMIA 4S2NC 1HVBA 4S2MA 4S2OA 3M2KA 4IBRA 3IXDA 2HP5A 3G2YA 3G30A 3RJUA 1ALQA 1C3BA 5E2FA 1PWCA 3LO7A 2HDSA 3VP1A 1LI9A 5U47A 4KENB 4WZ4A 2OLVA 5DVAA 1GA9A 1VM1A 1XGJA 3GSGA 3NI9A 5HFOA 5FAOA 5HAIA 1WE4A 2ZQDA 5GLAA 5EE8A 4GD6A 1BZAA 3Q7ZA 4UAAA 3IQAA 2IWDA 2J9PA 5A93A 4OPRA 3IT9A 3D4FA 4OOYA 5CGWA 1FOFA 3PBRA 2ZQ8A 1DJCA 1FSWA 3I7JA 4KZ7A 5AQ7A 4KZ9A 5F1GA 3IWIA 5FQQA 1JTDA 2VGJA 1JWZA 4OP5A 1HD8A 4DE1A 1BSGA 3RXWA 4BL3A 1ONGA 3W4QA 1K54C 1XP4A 4E3LA 3WRZA 2EFXA 3HUMA 4JPMA 3W4OA 4MBFA 4JKTA 1ZG4A 2R9WA 5FATA 4JXSA 5DF9A 4X53A 5E2EA 4JXVA 2JE5A 4RX3A 4MLLA 2ZQ7A 2Q9MA 3C7VA 1YLYA 2I72A 3WRTA 4E3JA 3ZNYA 3GQZA 3EQUA 4D2OA 2Y2LA 4WYYA 1K4EA 2Y2HA 2Y91A 3B3XA 4OP8A 1ESUA 4L0LA 5F82A 3SOIA 3FKWA 3C5AA 2H0YA 1IYPA 4WZ5A 5HAPA 1JWVA 2WAEA 2OV5A 4R3JA 3NY4A 2ZJ9A 5CEBA 3ZNTA 4A5RA 4E3KA 2XF3A 1JWPA 3CG5A 3TSGA 4BJPA 3ZCZA 1LI0A 4X6TA 3IF6B 3M6HA 3P98A 4QY6A 5EECA 5FQIA 3W8KA 2WUQA 1EI5A 1YMSA 3GR2A 5TFQA 3IWOA 5CEDA
chains in the Genus database with same CATH superfamily
3KSIA 2V2FF 4UEYA 3HL9A 2Z2LB 3O62A 3FPVA 5CRFA 3X1SD 3ZGAB 2W27A 5B0ZD 3ITAA 3AZFD 1P3AB 5AV5D 3VH6T 3AZID 2ZQCA 4WZ5C 1QMFA 3C4PA 1M1AC 2YFWA 5CGSA 5B32A 2DRWA 1JFIB 4WBGA 1M19D 3UN7A 1MKIA 4OH0A 3FDDA 5DFXA 2NQBD 3KS4A 2PDRA 3LR0A 3S22A 2VEAA 4IBEA 1ZHHB 3MQ0A 3WD2A 5GXQB 2ZC5B 4WNNB 4XUJD 1O7EA 3S1YA 2OWJA 4ZBJB 3EPKA 3LIEA 3ZG0A 1OPXA 1DP6A 4I38A 3AV2C 1P3AC 2RTSA 4XT2B 4G3VA 2EX2A 4YOFA 5BPVA 3O3VA 4NYYA 4GHIA 2B95A 3FYZA 1PI5A 2V1ZA 4B9OA 1TS6A 4KUDB 4KGCD 4H9SA 4WEJA 4BMWA 3HLFA 1LL5A 3WD3A 3Q7VA 1H3OA 5L10A 1AOIA 4J8XA 1P3FB 3WS2A 3A0RA 1AIWA 1S0WA 2WK0A 3V50A 3TOIA 5GT3C 3UTAD 4KUKA 1FR1A 3OCLA 3OPHA 2A24B 5GL9A 1E88A 4ID4A 2O9AA 4JXWA 3Q82A 3T4JA 3PBOA 2VGLS 4IVKA 2Q0OA 1JNUA 1UR9A 3O87A 2HDRA 3UDFA 1IKIA 2VA0A 1NZOA 2IO5C 4YM6D 4YINA 2Y2NA 1OGGA 4R0QA 4X23C 3H0MC 3UTBA 3BM6A 3BY9A 4WZSB 3MMHA 4O7DA 4M4XA 3NQUB 2PYPA 2PU2A 4KQRA 1TZYC 5CHLB 1F98A 3NJAA 4DRTA 2KLIA 1T1AA 2G2UA 4P0MA 3MF0A 5JRGA 3LZ1B 3E2KA 4UA9A 3C1CB 3ZVTA 5CPKB 3BWLA 1U35B 3REIA 5AY8B 4DE2A 3WA9D 2PYOD 3LY4A 2W3GA 4MMNA 4U0TA 3UT9C 1XJ3A 2ACGA 4R23A 2F8ND 2J7VA 3AZKA 3AYWB 4RA7A 3LIDA 5GSUC 2Y2GA 4LV1A 4JXGA 5E5AC 1QO6A 2EX8A 4NXGA 1K4FA 5E2HA 1PWDA 3A3JA 2V9AA 5B1MB 2K7SA 4WU8D 4JBFA 4EW7A 4QLCD 3EPLA 4NYUA 4YS3D 3HCYA 2AROC 3SZTA 3BFCA 4WM9A 4EEPA 3LI8A 3AZGB 3UB6A 2PYRA 4WL9A 4MB4A 2QKPA 4OOLA 4EWFA 3NECA 4E44A 2J8YA 4R70A 5JYOA 2XDMA 4Q0JA 4S2JA 2FZ0A 2OWHA 4MBKA 4IHQA 3AN2C 4GB7A 1YLTA 2WKIA 3AZLA 3MGPA 3IBJA 3ZQ5A 3AV1A 2OOLA 3MZEA 1CK7A 3AGDA 3WS0A 3B6GA 2ZD8A 4H6JB 1YM1A 1L0FA 3KSGA 3W99D 2WZXA 4BBVA 4EQIA 3MNND 2D49A 1ZKJA 2W3FA 3IX4A 2Y79A 5DKLA 4ZUXD 5FQMA 3FZCA 3W96D 5K5BA 3AZMC 3AGEA 3KUYB 3B6FA 3GV9A 4EO5C 3VV4A 4EUVA 1NXYA 3LEQA 2VJWA 2ZM2A 5AVBC 4AWLB 4Y0OA 5C5KA 2EA9A 3DTIA 4NE3A 5EVIA 3DWZA 3W98C 2NZDB 1OJ5A 1PIOA 3REJA 1NZUA 1KX4A 5BO0B 5FI6A 2CV5C 5FL3A 2VV6A 5AV6B 3KWQC 3HLDA 3WKJC 1WYCA 1E6RA 4JGOA 5KDMA 1VEUA 1O6IA 2A2LA 1KE0A 1CK3A 4FD8A 2ZY4A 5BS7A 5B1LD 2Y4AA 4HP9A 1P34B 1IEMA 4L9EA 2JC7A 5KSHA 1F2KA 3MGQB 3HLGA 1XKZA 1ESIA 5HARA 3NCKA 3X1SB 4J8VD 1Q2PA 5B0ZB 5F5YA 1Y54A 4AWLC 3IWQA 2WGWB 3LELB 3AZFB 2W1TB 2V8CA 1CI9A 3G34A 5AV5B 4OJPA 1ZLAD 1HZOA 3AZIB 1OJGA 1ID3B 5AV8C 1BULA 4DJ3A 4Z66D 3X1TD 4Z2GA 4FTXA 4OLDA 4ZJ2A 2BLSA 3LZ0D 4H9PA 1I5QA 1O07A 5HAQA 4NXEA 5CPJB 4UUZA 3REKC 1S32A 4P6ZM 3UO9A 1M19B 2XD1A 3B47A 2RVQD 4HJ4A 5E2GA 4QHCA 2EFUA 2NQBB 3FKEA 1L0EA 1TD5A 1BLPA 5KIZA 3VOZA 4Y17A 1PYYA 4LD9D 4XUJB 1ED7A 5GLCA 2FFYA 2KX6A 4QWOA 3GMWA 5I5LA 4R4RA 3LELC 4EBNA 4GDBA 1N4OA 4FH4A 1W7FA 1N1JB 3AZIC 1ID3C 1E3UA 4TX8A 3ULFA 3BFDA 1ES3A 1UGUA 2Y59A 5FDSA 2M1CA 4JF4A 3SH8A 4KGCB 1K57A 2X71A 4IUHA 3UE3A 3U2AA 4Z2MG 5CPJC 3T4QA 4KZAA 4KQQA 2JCHA 4MB5A 4OJOA 2IA2A 3ZG9B 5DTKA 5HWVA 4P85A 3MZFA 1P3AA 4QNLA 2Y2JA 1M1AD 4LV3A 2V1BA 4ZJ3A 2Y2OA 3UTAB 4E6XA 1IYQA 4O8GA 3WTPC 1XA7A 2B18A 2P7JA 4MB3A 3OOVA 4C6YA 4JJNC 3C7UA 1JFIA 1HTZA 4QPRA 4PKYA 3GVBA 3DBAA 1TS7A 4K91A 5F68A 2JKRM 1GPFA 4BL2A 5GXQA 3AV2D 5MC7A 3MGSC 1UR8A 4WNNA 4HESA 5B31C 1K56D 4ZAMA 1NRJA 3VFHA 2Q9NA 3F1NB 5B31G 3PXPA 4XT2A 3UDXA 2A3UA 4FUWA 3A3DA 3A3IA 3WA9B 1K54A 2L0WA 4IUKA 2PYOB 4GH9A 4S2NC 4S2OA 3M2KA 4KUDA 3IXDA 5GT3D 3G2YA 3RJUA 3L2AA 4AFIA 2F8NB 1P3FA 1BFMA 5HDCA 5U47A 1KU5A 4KENB 2OLVA 3EPJA 1P3OC 4NZ1A 2XSSA 5HFOA 5HAIA 4D60A 2ZQDA 2WKQA 1L3LA 5B33A 1YU4A 2J9PA 2PBDP 1H0GA 3D4FA 3VH5W 3L25A 4NKPA 5CGWA 4X23D 3PBRA 1DJCA 3I7JA 4KZ7A 5F1GA 4QLCB 3IWIA 1TZYD 4E45A 4UQIS 2D01A 4YS3B 1DP8A 2PYOC 3NQUA 2JKTI 5E2EA 1YU0A 1TAFB 5J3WA 3LZ1A 4E3JA 3C1CA 5CPKA 1K4EA 3UT9D 2Y91A 4OP8A 1U35A 4Q0HA 5AY8A 3FKWA 3C5AA 3RELC 1IYPA 3T1XA 1V9ZA 5GSUD 1P9RA 5HAPA 5E5AD 2I9VA 1EAKA 5FEFA 1P3LB 3UB8A 4L9FA 3AYWA 3R4KA 3LR5A 3TSGA 3CAXA 3ZCZA 5EECA 3IF6B 3GR2A 4YS3C 3M7PA 3W99B 3IX3A 3MNNB 2HIOA 5CECA 4N1HA 1P3BC 2X02A 5B1MA 4HH3A 4Q8IA 5HPIA 1BLHA 1SKFA 2BG1A 1LHYA 4DE3A 5I94A 2AROD 2INWA 3UE1A 5HD3A 1H0MA 3AZJC 2EX6A 3GECA 3FKVA 3IBRA 5EM0A 5EOOA 3UMDA 3AZGA 1LT0A 3ZHHA 1ES5A 5HL6A 1P3LC 3IXBA 3AN2D 2J8PA 1MWSA 2OSUA 1GHMA 5BOHA 1PZRA 3WTPE 2R9XA 2G7UA 3VP4A 2RL3A 1G6AA 3MBZA 4KG6A 1P3MC 3KXBC 4QY5A 1P3KC 5AVCC 2IOUA 4Y3IA 4U3TA 2J3TC 4ZDXA 2ZOIA 1P0ZA 4NE6A 4H6JA 4NZ5A 2JKGA 2VX8A 1STZA 4J8VB 2YFVB 3AZMD 3BYDA 1WWSA 3WD4A 1G68A 1SDNA 3MXSA 4KQDA 4PAUA 1ZLAB 3EPHA 1YLPA 2DNSA 3LYXA 4Z66B 5AVBD 3X1TB 3KUYA 2C5WB 4Z9QA 3LZ0B 1OGBA 2HPBA 3W98D 3W97B 1VQQA 2EXAA 4S2IA 3SH9A 2CV5D 4IBGA 3OZHA 4RX2A 5FAPA 5FQJA 5BT1C 3HLEA 4L9GA 4Z5TC 1PI4A 3KWQD 1BT5A 3VMAA 5B40A 3WKJD 2NZDA 4LLOB 4OKPA 5DTTA 5BO0A 5DNNA 1EWZA 3VE3A 4K08A 5AV6A 3VOLA 4LD9B 3JVUA 4DRBA 3CZDA 4N1XA 4Z2IA 5HW3A 2PT7A 1ERQA 1I2WA 3LIAA 3PBNA 4H9RB 3X1UB 1CXWA 1MXOA 4HJ6A 4H9QB 3IHBA 1P34A 3MGQA 2VQRA 3X1SA 5B0ZA 3W97C 5AV8D 2JBFA 2WGWA 3G32A 2Y2QA 2QYBA 3AZFA 1F66C 2W1TA 4HMDA 3IS2B 1M1AB 4ZJ1A 5AV5A 1XFQA 5GLDA 2ZC6B 3A1KA 4GN2A 4BENA 3REKD 3MR0A 3LI9A 2HUEC 4EUZA 1P3PC 4M6BA 2ZC3B 3X1UC 4EBLA 5J7EA 1M19A 2FJ7C 2HZ5A 3EOIA 3HUOA 2NQBA 5AJGA 4OVDA 1TS0A 3ZDJA 1HQ3C 3AV2B 5A92A 3LELD 5DJTA 4XUJA 4CQHA 3N8SA 1ID3D 1VB6A 1TF1A 5B24C 1TDGA 2H28A 2P74A 4HJ3A 1YT4A 3TRCA 3QP5A 4BBTA 1GHPA 2WKHA 2HDUA 3PAGA 1PFLA 3VH6A 5CPJD 4WEKA 3ZG7B 1VETB 1LSVA 2HDQA 4LGWA 1YMXA 4HMCA 2HF6A 5M18A 3G35A 4KGCA 3M2JA 5GT3B 1PWGA 3BFFA 3QHYA 4R8PC 3G2ZA 3H7WA 5FQ9A 1J7MA 4DRAA 3WTPD 1WA9A 2DMWA 2EXBA 5AQBA 3B0CT 2G5HC 3UTAA 3CITA 4JJND 3BLSA 5DNMC 3N7WA 4HMEA 4RVAA 1LL9A 2IO5B 4ETXA 5CPIA 5CHJA 5IU1A 3HLBA 4X23B 1KGGA 4PM9A 3W2ZA 4F3LB 3MGSD 5FI2A 1P3GC 5B31D 3TU4C 3DTEA 4YM6A 5B2IC 4X69A 1TZYB 1BH8B 3LGOA 4OPZA 4HH2A 3MZDA 1K55A 2XD5A 2JSSA 2P9VB 4GJ4A 3K3CA 4B88A 3VP0A 3L28A 3ZG8B 1TEMA 3F1NA 4H8RA 3BFGA 1W63M 1D7EA 3G31A 3VH5T 4XXRA 5HDSA 4R6LA 3UT9B 5TR7A 4MBHA 2BYMB 5G4ZA 2EWWA 1BLCA 3A6NB 3WA9A 3MKEA 2PYOA 4FSFA 4EV4A 5J8XA 5GSUB 3VH5A 1YU2A 1P3OD 1MWRA 3P09A 5E5AB 2H10A 4B4XA 4BD0A 4R4SA 3G6OA 2F8NA 1MY8A 2ZY3A 3BLMA 5FA7A 1N9OA 3L7HA 2WZZA 5B2JC 1B67A 1CF0A 2PR6A 5L09A 1E25A 3UPOA 3REHC 4S2PA 4P6ZS 3S7NA 4WU9B 2M7UA 1F1EA 4G91C 4WU8A 3GDIA 3NHQA 4Y7PA 3EWKA 4QLCA 2AROB 3QNBA 5HDDA 5EPHA 4UPKA 1IKGA 3LFVA 4YS3A 4ZBEA 3A6NC 3MVDC 2HP9A 2MJ6A 4XZQB 2Y55A 3V3SA 4CLCC 3CUEA 1TAFA 3C8CA 3AN2B 1NRFA 4LRZE 3L27A 3RELD 1M18C 3E4QA 2O99A 2PR5A 2WGVA 5LBRA 2V20A 4IJGA 3IX8A 2HGVA 1L0GA 3UE6A 3WWXA 4XUZA 4WU9C 5EM1A 5FQKA 4S2LA 4HBTA 3UPPA 3KO6A 4ME4A 4OPYA 4Y2FA 1NLZA 1XGIA 1F5MA 2Y2PA 1Q2QA 3E2LA 4KG2A 1A0KA 1P3BD 3IF6A 3LIBA 5HWWA 2DQNC 3W99A 3AZMB 4N9LA 3KSYA 3MNNA 3F1PA 2P08A 4EO5B 3AZJD 4ZUXA 4XZQC 3NIAA 4OLGA 4PM8A 1P3IC 3W96A 2PRFA 5AVBB 1J3WA 3NOUC 4MN7A 3E4OA 3EQVA 5AQAA 3W98B 1LLBA 4IBFA 1P3LD 4C75A 2JN7A 5CP6B 1ACFA 1OTAA 2CV5B 2YKHA 4N9KA 3UB5P 4DF6A 4BWIA 3AZHD 1XX2A 3KWQB 3WKJB 4ZRRA 3A0SA 4G3KA 2Z2MB 3UDIA 1P3MD 3AZEC 1GSVA 3KXBD 3DTMA 2FFFB 5F99C 1P3KD 4LRXC 3HLWA 4HBUA 5JYPA 5AVCD 1MPLA 5CHUA 3H0LC 1EQZC 2CC1A 2J3TD 2ZLYA 5AV9B 4WELA 1FCNA 3FG8A 3LJAC 4NFTA 4WMCD 4X55A 4CJNA 3PR6A 3QNCA 4J8UD 3C4OA 4U0XA 3X1VC 4IBBA 4NZ4A 5B1LA 1BYWA 2HV1A 5E43A 5FEGA 1ES2A 3OLOA 1XJ4A 3VP2A 1H8MA 3UMEA 4J8VA 2YFVA 3WAAC 5AV8B 5CP6C 2VZWA 4S2MA 3VE4A 1HVBA 1ALQA 1C3BA 5E2FA 1ZLAA 3BQ8A 3D9YA 2HDSA 4Z66A 3X1TA 1LI9A 3REKB 4WZ4A 5DVAA 5HSQA 5BT1D 1VM1A 1DRMA 1KX3B 3LZ0A 4Z5TD 5FAOA 2GNXA 4DMZA 1Y28A 5EE8A 5AV9C 3Q7ZA 3V9RB 2W8SA 3IQAA 2IWDA 4BBUA 3IT9A 1W1YA 3ICYA 1YPRA 1FSWA 1FILA 1T1CA 4II7A 4KZ9A 3T1QB 4IBJA 1JTDA 3WX7A 4LD9A 1BSGA 4BL3A 2QJ7A 3W4QA 3HUMA 4JPMA 4CSRB 4H9RA 3AFAC 4JXSA 3C1BC 4MLLA 2HJ9C 5B0YD 3W97D 2Q9MA 4H9QA 1YLYA 1KX3C 1F66D 5L8MA 4NXBA 3AZNC 4CLCE 4WZ5A 1JWVA 3WTPB 5HPFA 3IS2A 1M1AA 1P3PD 2ZJ9A 2VK3A 2GX5A 3ZNTA 4A5RA 4JJNB 1HTAA 3X1UD 3CG5A 2FJ7D 2V1AA 4QY6A 5GT0C 3SW1A 2WUQA 3RH8B 3MGRC 1HQ3D 3O62B 3MGSB 2VV8A 5B31B 1F9IA 3EGXC 4EERA 5TJJA 2XROA 3LR3A 5B24D 2W3EA 3CHWP 3AV2A 1KX5C 4P6BA 4OJ5A 1K56A 5F83A 1YLJA 4GOGA 2VGKA 3WS5A 1OMEA 5JA4B 1YUEA 4KUOA 2FN2A 1OTDA 5G49B 1NYMA 4LENA 4R8PD 1VETA 1EROA 3SS5A 3OCNA 1P3OB 5TBMB 2QWSA 1P9WA 5GT3A 4K0WA 2HJEA 3O62C 2B5RA 4KG5A 5DNMD 4N92A 5A91A 5IT5A 1BUEA 3WD1A 2H0TA 4HGAC 1S1YA 3H9WA 4IBXA 1GXDA 1P3GD 3TU4D 4OQHA 5B2ID 3KYEA 2OAQ1 4I3AA 1FCMA 4X23A 3N6IA 2L1MA 3DWKA 5EVLA 4NK3A 4LV2A 3OC2A 5B32C 2M7VA 4OJLA 1TZYA 1GCEA 1BH8A 3WS4A 2WAFA 3QP6A 2XGNA 4OQ0A 5B32G 2P9VA 2E8IA 1YAXA 3KSFA 2A24A 3RELB 3IF5A 4OQGA 3HJIA 1H3QA 3UT9A 3Q81A 2BYMA 1KDSA 3UPNA 1XFNA 5HX9A 4F94A 3SS4A 5GSUA 1WWIA 4X56A 4GLQA 5B2JD 5E5AA 3TE8A 4RYEA 3JYIA 1CQAA 2ZBBA 3REHD 3HONA 4H9SC 4LG2A 1K38A 1PZPA 1G28A 2LB9A 4QD4A 1AOIC 4J8XC 2XFSA 1P3BB 4I3IA 4JLFA 3V39A 2XFTA 4H9OB 4ESPA 2ZMVA 2XLNA 3PBQA 2EX9A 2OLUA 4Z1WA 3AZJB 2JKFA 4BQMA 3G4PA 1ZG6A 3NOPC 4MNRA 1G6OA 3RFBA 3MVDD 3A6ND 1KE4A 3O86A 1IELA 2AROA 4E6WA 3NBLA 1PW8A 1YKDA 1QMEA 2V0WA 4GDNA 4CLCD 1Y4OA 4IJEA 4G3WA 2XK1A 1M18D 2PD8A 3FC7A 2V8FA 3UTBC 3AZHB 1TDLA 1K25A 4ETZA 3CI6A 3S4XA 3AN2A 1P3MB 3ZFZA 3KXBB 4WU9D 2F8NK 1P97A 1P3KB 2W1RA 5AVCB 3Q1FA 4GNUA 3SS3A 5JRGC 2KDKA 4ZTKA 1KDWA 4K0XA 3REIC 3DW0A 2P04A 4J8UB 3MQLA 5KMWA 3VSLA 4MEZA 1SKOB 3QP4A 3IHAA 1W79A 4UHUA 5M19A 1WYBA 3KS8A 2ZM5A 3B0DC 4XZQD 3AZKC 1TS8A 3A0VA 4OUIA 1LSWA 1OT6A 4LPZA 4NETA 1P3ID 3A1IA 1KOUA 3AZMA 2VLGA 2E8JA 4I5SA 3AZHC 5GLBA 2Y2IA 4B93A 3M6BA 3Q07A 5GHYA 1W8YA 1M6KA 4QJGA 3AV1B 5AVBA 2GJ3A 2L5AA 4Z5TB 4Z2LA 3LEZA 3W98A 1S4SA 3T4LA 3B6GB 3AZED 1NWZA 1Q9CA 2CV5A 1H5XA 5F99D 3KWQA 2ZQAA 1OTIA 3WKJA 4J8UC 1EQZD 3FPWA 1W63Q 4KQOA 4X1LA 3LJAD 4DDYA 2J3WA 2HP6A 3PHYA 2ZM8A 4R3BA 2CMNA 1E6ZA 4KZBA 3X1VD 4J8WD 3OPRA 1D06A 5EOEA 1RGZA 3HREA 3MGPC 5B0YB 5EVIB 5CP6D 3WAAD 3AV1C 2PBYA 4GKUA 4LV0A 1KVLA 2GZAA 4EQ1A 1F66B 5IHVA 1PZOA 4GW9A 3B6GC 1M40A 4Z2JA 1W5DA 5AV8A 1S6RA 3S7PA 3B42A 1GOIA 5KDMB 2HUEB 2F8NH 1P3PB 5AQ9A 4DXCA 4WLAA 5AV9D 3HSHA 2J9OA 3F1OB 2QPNA 3JVVA 3REKA 4MN5A 2FJ7B 2PAVP 3E98A 3IH8A 3L26A 4WV4B 3B6FC 1K6SA 2W3HA 4QB8A 3LCEA 1HQ3B 2K2NA 3V67A 1TVFA 3TG9A 2NUTC 4KZ6A 5B0YC 3HJKA 5EVIC 3N8RA 3LY3A 5B24B 3AFAD 5L07A 3LELA 3REJC 1BLSA 4LFUA 4BLMA 3C1BD 1KX4C 4GD8A 2IWBA 1E6PA 4JGRA 4CSRA 3AZIA 1ID3A 1S67L 2H5SA 4HHDA 4JF6A 1KX3D 1I2SA 2IWCA 3EEHA 1S32B 1CI8A 4G92C 3AZND 3CPTB 5CPJA 2XQZA 4R8PB 5FUGB 2K31A 1ODVA 5KZHA 5BS7C 3T1SA 1H8ZA 4IEDA 5KSCA 3IP4C 3P7NA 2VV7A 4M3KA 5DNMB 3NDEA 3WTPA 2ZY2A 5GT0D 1JTGA 1LSXA 1T18A 4JJNA 3MGRD 1FCOA 1P3GB 3TU4B 4DKIA 4X68A 5B2IB 1N1JA 1R4VA 3D72A 4OOMA 5TGFA 3MGSA 1KX5D 5B31A 5L2FA 1S32C 2PD7A 4R38A 3QP8A 2BTFP 2GDNA 1UWNX 3VSKA 4NZ3A 1NLYA 2JKRI 1YLWA 2C6WB 1YSPA 3C30A 4I3JA 5JA4A 5EV0A 4S2NA 3LR4A 3MXQA 3NDGA 4NXFA 1CEGA 5G49A 1W2EA 3ZVWA 1N9LA 4EU0A 3NQJB 5FAQA 1N9NA 3S7QA 4KZ4A 3O62D 3DAVA 3BJNA 4EBPA 1GSXA 3MKFA 4WF0A 3WD0A 1P3OA 5TBMA 5B2JB 3REHB 1K57C 4KZ3A 3V3RA 2ZOHA 3CWFA 3MS6A 1FIKA 1LL8A 1NJ4A 4YNRA 2Y2MA 1S66L 4G91B 5BNXB 3PBTA 5B32D 4JGQA 2O9BA 4O01A 3MVDB 2QMIA 4IBRA 3BQAA 3G30A 2Z6DA 1PWCA 4CLCB 1Z09A 1GA9A 3O5YA 1M18B 5C3IB 4IBCA 3NI9A 4PKYG 5GXQC 1OTBA 1WE4A 2NUPC 3UB9A 5B33B 1BZAA 4UAAA 4YWZA 5CPID 2O9CA 2ZL1B 3RELA 1T1BA 4ZBJC 1G5UA 1FOFA 3PYPA 2FH5A 2VGJA 1XJ6A 1HD8A 3LIFA 2CWEA 4DE1A 1AOID 1ONGA 3D3OA 4J8XD 1K54C 1XP4A 1ZTUA 1XJ2A 4E3LA 2EFXA 1ULYA 4GCZA 4MBFA 4KUDC 2XA7M 1ZG4A 2R9WA 5DF9A 4JXVA 1P3FC 1P3BA 4HP4A 4RX3A 3KFUG 3C7VA 4H9OA 2I72A 1P3IB 2OAP1 3EQUA 3L29A 5C3IC 2Y2LA 3T4KA 3AZJA 1ESUA 4L0LA 5F82A 2G5IC 5B33C 3RTYA 2JKTM 2H0YA 2B02A 2WAEA 4R3JA 3UTBD 1HLUP 1PNEA 5HD5A 1P3LA 4E3KA 2XF3A 3AZEB 2WKPA 1E6NA 1LI0A 1CJFA 3M6HA 1E8BA 3AZHA 3P98A 5F99B 3W8KA 1EI5A 1YMSA 4HI4A 5JRGD 1EQZB 2HIOB 3IWOA 4HQAA 5CEDA 1P3MA 3F6TA 3LJAB 5FI7A 3REID 2BYKB 3KXBA 5HWTA 2WADA 3NOTC 1P3KA 3QP2A 5BNVB 5AVCA 3LZ1C 3IXGA 5FDHA 3C1CC 3X1VB 5CPKC 4J8WB 4WMCA 1U35C 3T4TA 4CAYB 5AY8C 1NYYA 3MJQA 1FR6A 1ES4A 1ONHA 3AZKD 4J8UA 2XEPA 1B6WA 1SKOA 3BEBA 3WAAB 3MXRA 3HVFA 3BECA 4QU3A 4GHLA 4X1MA 1L0DA 3AYWC 5DKKA 1L6JA 1IYOA 4WUJA 5CTMA 2DF4C 3T50A 4HOIA 1RCJA 2X01A 2HIOC 3R7WB 1KGEA 1AWIA 1VHMA 3RXXA 5B1MC 2LY8A 4GS9B 1GA0A 3VP3A 4Z5TA 5F69A 4J8WC 3OPLA 1PDCA 4KHAB 4I39A 1W1PA 5G4YA 4C3QA 4OPQA 3S7OA 5AVEA 3LUQA 3AZGC 4H9NB 4OJ6A 4ARZB 2XH9A 3ZG5A 4E04A 3AFAB 4PMAA 3R45B 3BY8A 2QJ5A 3C1BB 4E3OA 3AZLD 1BH9B 3MGPD 1OT9A 3CLOA 3AV1D 3QP1A 2Z6CA 4O0PA 5CXWA 1V9YA 3PTEA 3AZNB 3B6GD 4FCFA 5B0YA 3W97A 5B40B 4OQIA 1PW1A 3N8LA 4Y13A 4OONA 3E0YA 1F66A 5EFWA 5DNNB 1YLZA 3BRMA 4BD1A 1H0IA 4WJ3C 4PPRA 1W1VA 5DF7A 1Z6FA 5CERA 1SHVA 2O0YA 5GT0B 1P3PA 3B6FD 3F1OA 3KYQA 3MGRB 3X1UA 2PHYA 1T19A 3A3FA 3H82B 4UA7A 2FJ7A 2R78A 5D3OA 4FH2A 2ZQ9A 5DJUA 3KUYC 4Y5FA 5EVID 3AL0C 1HQ3A 4MDZA 3OPPA 3REJD 1KX5B 2VGLM 1KX4D 1YU1A 1S4RA 3ITBA 5DFYA 3KX0X 4CPKA 5B40C 2NZDC 5B24A 2ZM0A 3KSHA 2EWVA 4LCMA 1K6RA 5HZHA 1E15A 5DNNC 4IJFA 4E3MA 1ERMA 5AV6C 4B4ZA 2Y2KA 4FOFA 5G18A 1X0OA 3T1RA 2WKEA 5GHXA 4HEFA 3CPTA 5FASA 1KE3A 3AGFA 3NULA 4NE5A 4R8PA 3SH7A 5FUGA 3UNWA 3BFEA 3O88A 1K0KA 3T12B 1P34C 4NG2A 3MGQC 1E4DA 4HGAB 3N4IA 4HNBA 5HL1A 5DNMA 3X1SC 5B0ZC 2XR0A 4XUXA 5GHZA 3UY6A 3LICA 3AZFC 5AV5C 2YFWB 1JVJA 3K3DA 1P3GA 1AXBA 3TU4A 4NY2A 5B32B 2A49A 2VKSA 1S32D 5B2IA 3N3FA 1L2SA 2UWXA 4MN6A 1XA1A 1ZC2A 2Y8HA 5CGXA 1KGFA 4PM5A 3H7WB 1M19C 3TW8A 2WGIA 5J4EA 2XRNA 2NQBC 3JPUA 4IBIA 2ZY5A 3VH6W 4XUJC 3FWLA 5CPIB 1CEFA 5F1FA 4GHIB 2PU4A 1E3UD 2G2WA 5CHMA 1PRQA 2ZMAA 5CTNA 1GHIA 3GRJA 3NQJA 3T4OA 2RCXA 4HIAA 4YM6B 1W8QA 4F3LA 3Q7VB 1H3OB 5EVEA 1AOIB 1DJAA 4J8XB 5B2JA 3HBRA 3B0BA 1P3AD 4EETB 4KGCC 3REHA 1N9BA 3GTCA 3B0CW 1IYSA 3IH9A 3IXHA 5DTSA 2ZMFA 2LB5A 2YKFA 4Q0IA 1MWTA 1NY0A 4P87A 1MKMA 1BTLA 5BNXA 1YSQA 1J9MA 3UTAC 3HLCA 1MZUA 4S2KA 3EEAA 1UWPX 5CPIC 3A6NA 3MVDA 1YQSA 3UTBB 5GXQD 3K2NA 1D1JA 3HUNA 4CLCA 4DJ2A 2ZC7A 3C38A 4PHTA 5DF8A 4YM6C 1M18A 1K55C 4NEED 5AVFA 3FV7A 5JRGB 4IBDA 1A7WA 3PAEA 5M1AA 2ZL1A 1W1TA 3REIB 1SZVA 3CJMA 4WU9A 4WU8B 4Y0TA 2J80A 2RIQA 3EGDC 4IBKA 4DN0A 4KUDD 1SDEA 3KYZA 1MWUA 3T4SA 4JF5A 3B0DB 4Z2MH 3WA9C 1P3FD 2W0NA 3AZKB 3A3EA 1DJBA 3MQQA 4YFMA 4LCLA 2D02A 3PBSA 4XZQA 5B33D 1OTEA 1KVMA 1XXMA 1P3IA 3BW6A 1U60A 5FSRA 2F8NG 5A90A 4E3IA 2AVXA 4R1GA 4E3NA 3TJZC 4Z2HA 4WU8C 2WKRA 4PM6A 4UA6A 1DY6A 4DXBA 4QLCC 3V5MA 1KS0A 2ZC4B 3C2WA 4EXOA 4R3AA 1H8YA 3AZEA 1RGYA 2QZ6A 3ISGA 4DQYB 1EW0A 1T3UA 5F99A 5CX7A 2F2AC 3MFDA 3F1PB 3LZ1D 1EQZA 5EUAA 3C1CD 3VFFA 5CPKD 3UB7A 4ZUXB 3LJAA 3EG5B 3CUEC 1U35D 2V5OA 2BYKA 1FSYA 5AY8D 4PM7A 3W96B 5BNVA 3W4PA 3AZLB 3X1VA 1XPBA 3MGPB 4J8WA 3UE0A 4CAYA 3MFXA 4Y15A 2WYXA 3AYWD 3B33A 1S1ZA 5CP6A 3WAAA 1SCWA 4GHAA 4GZBA 3U4LP 1RP5A 4KZ8A 3OBFA 2HIOD 4LRYC 3DTKA 3IF6C 1YU3A 5B1MD 2KOIA 3NC8A 4Y0UA 3W99C 3E4PA 3MNNC 3R7WA 1H8PA 3B6FB 5AV9A 3VOYA 4ZUXC 4Z2KA 4GS9A 4DE0A 4EESA 3MSHA 3W96C 5B1LB 4IVIA 4WN5A 4KZ5A 5A8BA 3P01A 1MBLA 3AZGD 1Z2CB 3AZLC 1FQGA 4DDSA 2DCFA 4KHAA 3REJB 1KX4B 3WS1A 4H9NA 4EEUA 3CMZA 4ARZA 3AFAA 3R45A 2HP5A 1VEUB 3C1BA 3LO7A 4G92B 3VP1A 1BH9A 2XA7S 2L4RA 1XGJA 3GSGA 2V0UA 1KX3A 3MQOA 5GLAA 4GD6A 3AZNA 3L9KA 3V9RA 1IFQA 4JGPA 5A93A 4OPRA 1GSWA 4OOYA 5B1LC 3P5JB 4MCWA 2ZQ8A 5AQ7A 1DP9A 5FQQA 1JWZA 4HY8A 4OP5A 3RXWA 4J8VC 4X25A 3WRZA 5GT0A 4RQ9A 3KUYD 3W4OA 4H9PB 4JKTA 5FATA 3MGRA 2W3DA 3H82A 4X53A 1ZLAC 2JE5A 2BASA 4UUZB 4Z66C 3X1TC 2ZQ7A 5F6AA 3LZ0C 3WRTA 5B40D 3GQZA 3ZNYA 2NZDD 2UV0E 4D2OA 1IOUA 4WYYA 2QHKA 3B3XA 2Y2HA 1KX5A 1MC0A 5DNND 3SOIA 5AV6D 3H0RC 2RVQC 2OV5A 2JHEA 3NY4A 4UQIM 5CEBA 5IS1A 4LD9C 1JWPA 4BJPA 4X6TA 5FQIA 1P34D 5TFQA 3MGQD 3ZYTA
chains in the Genus database with same CATH topology
2V2FF 3HL9A 2Z2LB 3O62A 5CRFA 3ZGAB 3X1SD 5B0ZD 3ITAA 3AZFD 1P3AB 5AV5D 3VH6T 3AZID 2ZQCA 4WZ5C 1QMFA 3C4PA 1M1AC 2YFWA 5CGSA 5B32A 2DRWA 1JFIB 4WBGA 1M19D 3UN7A 1MKIA 4OH0A 3FDDA 2NQBD 3KS4A 3S22A 4IBEA 5GXQB 2ZC5B 4WNNB 4XUJD 1O7EA 3S1YA 4ZBJB 3EPKA 3ZG0A 3AV2C 1P3AC 2EX2A 5BPVA 3O3VA 4NYYA 3FYZA 1PI5A 2V1ZA 4KUDB 4KGCD 4H9SA 4WEJA 3HLFA 1LL5A 3Q7VA 1H3OA 1AOIA 4J8XA 1P3FB 3WS2A 3V50A 1S0WA 2WK0A 3TOIA 5GT3C 3UTAD 1FR1A 3OCLA 3OPHA 5GL9A 4ID4A 4JXWA 3Q82A 3PBOA 4IVKA 3O87A 2HDRA 3UDFA 1IKIA 1NZOA 2IO5C 4YM6D 4YINA 2Y2NA 4R0QA 4X23C 3H0MC 3UTBA 3BM6A 4WZSB 4O7DA 3NQUB 2PU2A 4KQRA 1TZYC 5CHLB 4DRTA 2G2UA 4P0MA 5JRGA 3LZ1B 3E2KA 4UA9A 3C1CB 3ZVTA 5CPKB 1U35B 3REIA 5AY8B 4DE2A 3WA9D 2PYOD 3LY4A 4U0TA 3UT9C 4R23A 2F8ND 2J7VA 3AZKA 3AYWB 4RA7A 5GSUC 2Y2GA 4LV1A 4JXGA 5E5AC 2EX8A 1K4FA 5E2HA 1PWDA 3A3JA 5B1MB 4WU8D 4JBFA 4QLCD 3EPLA 4NYUA 4YS3D 2AROC 3BFCA 4WM9A 3AZGB 4OOLA 4EWFA 4E44A 2J8YA 5JYOA 2XDMA 4S2JA 4MBKA 3AN2C 4GB7A 1YLTA 2WKIA 3AZLA 3MGPA 3AV1A 3MZEA 3AGDA 3WS0A 3B6GA 2ZD8A 1YM1A 1L0FA 3W99D 2WZXA 4EQIA 3MNND 1ZKJA 4ZUXD 5FQMA 3FZCA 3W96D 3AZMC 3AGEA 3KUYB 3B6FA 3GV9A 4EO5C 1NXYA 2ZM2A 5AVBC 4AWLB 4Y0OA 4NE3A 5EVIA 3DWZA 3W98C 2NZDB 1PIOA 3REJA 1NZUA 1KX4A 5BO0B 5FI6A 2CV5C 5AV6B 3KWQC 3HLDA 3WKJC 1WYCA 5KDMA 1KE0A 1CK3A 4FD8A 2ZY4A 5BS7A 5B1LD 2Y4AA 1P34B 1IEMA 2JC7A 5KSHA 3MGQB 3HLGA 1XKZA 1ESIA 5HARA 3NCKA 3X1SB 4J8VD 1Q2PA 5B0ZB 1Y54A 4AWLC 3IWQA 2WGWB 3LELB 3AZFB 1CI9A 3G34A 5AV5B 4OJPA 1ZLAD 1HZOA 3AZIB 1ID3B 1BULA 5AV8C 4Z66D 3X1TD 4OLDA 4ZJ2A 2BLSA 3LZ0D 4H9PA 1I5QA 1O07A 5HAQA 5CPJB 4UUZA 3REKC 1S32A 3UO9A 1M19B 2XD1A 2RVQD 5E2GA 4QHCA 2EFUA 2NQBB 3FKEA 1L0EA 1BLPA 3VOZA 1PYYA 4LD9D 4XUJB 5GLCA 2FFYA 3GMWA 4R4RA 3LELC 4EBNA 4GDBA 1N4OA 4FH4A 1W7FA 1N1JB 3AZIC 1ID3C 1E3UA 3BFDA 1ES3A 2Y59A 4JF4A 3SH8A 4KGCB 1K57A 2X71A 3UE3A 4Z2MG 5CPJC 4KZAA 4KQQA 2JCHA 4OJOA 3ZG9B 5DTKA 4P85A 3MZFA 1P3AA 4QNLA 2Y2JA 1M1AD 4LV3A 4ZJ3A 2Y2OA 3UTAB 4E6XA 1IYQA 3WTPC 1XA7A 4C6YA 4JJNC 3C7UA 1JFIA 1HTZA 3GVBA 4K91A 4BL2A 5GXQA 3AV2D 3MGSC 4WNNA 4HESA 5B31C 1K56D 4ZAMA 3VFHA 2Q9NA 5B31G 3UDXA 2A3UA 3A3DA 3A3IA 3WA9B 1K54A 2PYOB 4GH9A 4S2NC 4S2OA 3M2KA 4KUDA 3IXDA 5GT3D 3G2YA 3RJUA 3L2AA 2F8NB 1P3FA 1BFMA 5U47A 1KU5A 4KENB 2OLVA 3EPJA 1P3OC 4NZ1A 5HFOA 5HAIA 2ZQDA 5B33A 1YU4A 2J9PA 3D4FA 3VH5W 3L25A 5CGWA 4X23D 3PBRA 1DJCA 3I7JA 4KZ7A 5F1GA 4QLCB 3IWIA 1TZYD 4E45A 4YS3B 2PYOC 3NQUA 5E2EA 1YU0A 1TAFB 3LZ1A 4E3JA 3C1CA 5CPKA 1K4EA 3UT9D 2Y91A 4OP8A 1U35A 5AY8A 3FKWA 3C5AA 3RELC 1IYPA 5GSUD 5HAPA 5E5AD 1P3LB 3AYWA 3TSGA 3ZCZA 5EECA 3IF6B 3GR2A 4YS3C 3W99B 3MNNB 2HIOA 5CECA 4N1HA 1P3BC 2X02A 5B1MA 4Q8IA 1BLHA 1SKFA 2BG1A 1LHYA 4DE3A 5I94A 2AROD 3UE1A 3AZJC 2EX6A 3FKVA 5EOOA 3AZGA 3ZHHA 1ES5A 1P3LC 3IXBA 3AN2D 2J8PA 1MWSA 2OSUA 1GHMA 5BOHA 1PZRA 3WTPE 2R9XA 3VP4A 2RL3A 1G6AA 3MBZA 4KG6A 1P3MC 3KXBC 4QY5A 1P3KC 5AVCC 2IOUA 4U3TA 4ZDXA 4NE6A 4NZ5A 4J8VB 2YFVB 3AZMD 3BYDA 1WWSA 1G68A 1SDNA 3MXSA 1ZLAB 3EPHA 1YLPA 2DNSA 4Z66B 5AVBD 3X1TB 3KUYA 2C5WB 4Z9QA 3LZ0B 2HPBA 3W98D 3W97B 1VQQA 2EXAA 4S2IA 3SH9A 2CV5D 4IBGA 3OZHA 4RX2A 5FAPA 5FQJA 5BT1C 3HLEA 4Z5TC 1PI4A 3KWQD 1BT5A 3VMAA 5B40A 3WKJD 2NZDA 4OKPA 5DTTA 5BO0A 5DNNA 1EWZA 5AV6A 4LD9B 4DRBA 3CZDA 4N1XA 5HW3A 1ERQA 1I2WA 3PBNA 4H9RB 3X1UB 1MXOA 4H9QB 3IHBA 1P34A 3MGQA 2VQRA 3X1SA 5B0ZA 3W97C 5AV8D 2WGWA 3G32A 2JBFA 2Y2QA 3AZFA 1F66C 1M1AB 4ZJ1A 5AV5A 5GLDA 2ZC6B 3A1KA 4GN2A 4BENA 3REKD 2HUEC 4EUZA 1P3PC 4M6BA 2ZC3B 3X1UC 4EBLA 1M19A 2FJ7C 3HUOA 2NQBA 4OVDA 3ZDJA 1HQ3C 3AV2B 5A92A 3LELD 4XUJA 3N8SA 1ID3D 5B24C 1TDGA 2P74A 1YT4A 1GHPA 2WKHA 2HDUA 3PAGA 3VH6A 5CPJD 4WEKA 3ZG7B 2HDQA 1YMXA 5M18A 3G35A 4KGCA 3M2JA 5GT3B 1PWGA 3BFFA 3QHYA 4R8PC 3G2ZA 5FQ9A 4DRAA 3WTPD 2EXBA 5AQBA 3B0CT 2G5HC 3UTAA 4JJND 3BLSA 5DNMC 3N7WA 4RVAA 1LL9A 2IO5B 5CPIA 5CHJA 3HLBA 4X23B 1KGGA 4PM9A 3MGSD 5FI2A 1P3GC 5B31D 3TU4C 4YM6A 5B2IC 4X69A 1TZYB 1BH8B 4OPZA 3MZDA 1K55A 2XD5A 2JSSA 2P9VB 4B88A 3VP0A 3L28A 3ZG8B 1TEMA 4H8RA 3BFGA 3G31A 3VH5T 4XXRA 5TR7A 3UT9B 4MBHA 2BYMB 1BLCA 3A6NB 3WA9A 3MKEA 2PYOA 4FSFA 4EV4A 5J8XA 5GSUB 3VH5A 1YU2A 1P3OD 1MWRA 3P09A 5E5AB 2H10A 4B4XA 4BD0A 4R4SA 2F8NA 1MY8A 2ZY3A 3BLMA 5FA7A 2WZZA 5B2JC 1B67A 1E25A 3UPOA 3REHC 4S2PA 4WU9B 1F1EA 4G91C 4WU8A 4Y7PA 4QLCA 2AROB 3QNBA 5EPHA 4UPKA 1IKGA 4YS3A 4ZBEA 3A6NC 3MVDC 2HP9A 4XZQB 2Y55A 3V3SA 1TAFA 3AN2B 1NRFA 3L27A 3RELD 1M18C 2WGVA 2V20A 1L0GA 3WWXA 4XUZA 4WU9C 5FQKA 4S2LA 4HBTA 3UPPA 4OPYA 1XGIA 2Y2PA 1Q2QA 3E2LA 4KG2A 1P3BD 3IF6A 2DQNC 3W99A 3AZMB 4N9LA 3KSYA 3MNNA 4EO5B 3AZJD 4ZUXA 4XZQC 3NIAA 4OLGA 4PM8A 1P3IC 3W96A 5AVBB 3EQVA 5AQAA 3W98B 1LLBA 4IBFA 1P3LD 4C75A 5CP6B 2CV5B 4N9KA 4DF6A 3AZHD 1XX2A 3KWQB 3WKJB 2Z2MB 3UDIA 1P3MD 3AZEC 3KXBD 3DTMA 2FFFB 5F99C 1P3KD 3HLWA 4HBUA 5JYPA 5AVCD 1MPLA 5CHUA 3H0LC 1EQZC 2CC1A 2ZLYA 5AV9B 4WELA 1FCNA 3LJAC 4NFTA 4WMCD 4X55A 4CJNA 3QNCA 4J8UD 3C4OA 4U0XA 3X1VC 4IBBA 4NZ4A 5B1LA 5E43A 1ES2A 3VP2A 4J8VA 2YFVA 3WAAC 5AV8B 5CP6C 4S2MA 1HVBA 1ALQA 1C3BA 5E2FA 1ZLAA 2HDSA 4Z66A 3X1TA 1LI9A 3REKB 4WZ4A 5DVAA 5BT1D 1VM1A 1KX3B 3LZ0A 4Z5TD 5FAOA 5EE8A 5AV9C 3Q7ZA 3V9RB 2W8SA 3IQAA 2IWDA 3IT9A 1FSWA 4KZ9A 4IBJA 1JTDA 3WX7A 4LD9A 1BSGA 4BL3A 3W4QA 3HUMA 4JPMA 4CSRB 4H9RA 3AFAC 4JXSA 3C1BC 4MLLA 5B0YD 3W97D 2Q9MA 4H9QA 1YLYA 1KX3C 1F66D 3AZNC 4WZ5A 1JWVA 3WTPB 1M1AA 1P3PD 2ZJ9A 3ZNTA 4A5RA 4JJNB 1HTAA 3X1UD 3CG5A 2FJ7D 4QY6A 5GT0C 2WUQA 3MGRC 1HQ3D 3O62B 3MGSB 5B31B 5B24D 3AV2A 1KX5C 4P6BA 4OJ5A 1K56A 5F83A 1YLJA 4GOGA 2VGKA 3WS5A 1OMEA 5JA4B 1YUEA 5G49B 1NYMA 4LENA 4R8PD 1EROA 3SS5A 3OCNA 1P3OB 5GT3A 4K0WA 3O62C 2B5RA 4KG5A 5DNMD 4N92A 5A91A 1BUEA 2H0TA 4HGAC 4IBXA 1P3GD 3TU4D 4OQHA 5B2ID 1FCMA 4X23A 3N6IA 3DWKA 5EVLA 4NK3A 4LV2A 3OC2A 5B32C 4OJLA 1TZYA 1GCEA 1BH8A 3WS4A 2WAFA 2XGNA 4OQ0A 5B32G 2P9VA 2E8IA 3RELB 3IF5A 4OQGA 3UT9A 3Q81A 2BYMA 1KDSA 3UPNA 5HX9A 4F94A 3SS4A 5GSUA 1WWIA 4X56A 5B2JD 5E5AA 4RYEA 3JYIA 3REHD 3HONA 4H9SC 4LG2A 1K38A 1PZPA 4QD4A 1AOIC 4J8XC 2XFSA 1P3BB 4JLFA 3V39A 2XFTA 4H9OB 2XLNA 3PBQA 2OLUA 2EX9A 3AZJB 4BQMA 3G4PA 1ZG6A 4MNRA 3MVDD 3A6ND 1KE4A 3O86A 1IELA 2AROA 4E6WA 3NBLA 1PW8A 1QMEA 4GDNA 4IJEA 2XK1A 1M18D 3UTBC 3AZHB 1TDLA 1K25A 3S4XA 3AN2A 1P3MB 3ZFZA 3KXBB 4WU9D 2F8NK 1P3KB 5AVCB 3Q1FA 4GNUA 3SS3A 5JRGC 4ZTKA 1KDWA 4K0XA 3REIC 3DW0A 4J8UB 5KMWA 3VSLA 4MEZA 3IHAA 1W79A 4UHUA 5M19A 1WYBA 3KS8A 2ZM5A 3B0DC 4XZQD 3AZKC 4OUIA 4NETA 1P3ID 3A1IA 3AZMA 5GLBA 3AZHC 2Y2IA 3M6BA 3Q07A 5GHYA 1W8YA 1M6KA 4QJGA 3AV1B 5AVBA 2L5AA 4Z5TB 3LEZA 3W98A 3B6GB 3AZED 1Q9CA 2CV5A 1H5XA 5F99D 3KWQA 2ZQAA 3WKJA 4J8UC 1EQZD 4KQOA 3LJAD 4DDYA 2HP6A 2ZM8A 4R3BA 4KZBA 3X1VD 4J8WD 3OPRA 5EOEA 1RGZA 3HREA 3MGPC 5B0YB 5EVIB 5CP6D 3WAAD 3AV1C 2PBYA 4GKUA 4LV0A 1KVLA 1F66B 5IHVA 1PZOA 3B6GC 1M40A 1W5DA 5AV8A 1S6RA 5KDMB 2HUEB 2F8NH 1P3PB 5AQ9A 4DXCA 5AV9D 3HSHA 2J9OA 2QPNA 3REKA 2FJ7B 3IH8A 3L26A 4WV4B 3B6FC 1K6SA 4QB8A 3LCEA 1HQ3B 1TVFA 3TG9A 4KZ6A 5B0YC 5EVIC 3N8RA 3LY3A 5B24B 3AFAD 3LELA 3REJC 1BLSA 4BLMA 3C1BD 1KX4C 4GD8A 2IWBA 4CSRA 3AZIA 1ID3A 2H5SA 4JF6A 1KX3D 1I2SA 2IWCA 1S32B 1CI8A 4G92C 3AZND 5CPJA 2XQZA 4R8PB 5FUGB 5KZHA 5BS7C 1H8ZA 4IEDA 5KSCA 3IP4C 4M3KA 5DNMB 3NDEA 3WTPA 2ZY2A 5GT0D 1JTGA 4JJNA 3MGRD 1FCOA 1P3GB 3TU4B 4DKIA 4X68A 5B2IB 1N1JA 1R4VA 4OOMA 5TGFA 3MGSA 1KX5D 5B31A 5L2FA 1S32C 2GDNA 3VSKA 4NZ3A 1YLWA 2C6WB 5JA4A 4S2NA 3NDGA 3ZVWA 1CEGA 5G49A 1W2EA 3NQJB 5FAQA 4KZ4A 3O62D 4EBPA 3MKFA 1P3OA 5B2JB 3REHB 1K57C 4KZ3A 3V3RA 1NJ4A 2Y2MA 4G91B 5BNXB 3PBTA 5B32D 3MVDB 2QMIA 4IBRA 3G30A 1PWCA 1GA9A 1M18B 5C3IB 4IBCA 3NI9A 5GXQC 1WE4A 5B33B 1BZAA 4UAAA 5CPID 3RELA 4ZBJC 1FOFA 2VGJA 1HD8A 2CWEA 4DE1A 1AOID 1ONGA 4J8XD 1K54C 1XP4A 4E3LA 2EFXA 1ULYA 4MBFA 4KUDC 1ZG4A 2R9WA 5DF9A 4JXVA 1P3FC 1P3BA 4RX3A 3KFUG 3C7VA 4H9OA 2I72A 1P3IB 3EQUA 3L29A 5C3IC 2Y2LA 3AZJA 1ESUA 4L0LA 5F82A 2G5IC 5B33C 2H0YA 2WAEA 4R3JA 3UTBD 1P3LA 4E3KA 2XF3A 3AZEB 1LI0A 3M6HA 3P98A 3W8KA 3AZHA 5F99B 1EI5A 1YMSA 5JRGD 3IWOA 1EQZB 2HIOB 5CEDA 1P3MA 3F6TA 3LJAB 5FI7A 3REID 2BYKB 3KXBA 2WADA 1P3KA 5BNVB 5AVCA 3LZ1C 3IXGA 5FDHA 3C1CC 3X1VB 5CPKC 4J8WB 4WMCA 1U35C 4CAYB 5AY8C 1NYYA 1FR6A 1ES4A 1ONHA 3AZKD 4J8UA 2XEPA 1B6WA 3BEBA 3WAAB 3MXRA 3HVFA 3BECA 4QU3A 4GHLA 1L0DA 3AYWC 1IYOA 5CTMA 2DF4C 1RCJA 2X01A 2HIOC 1KGEA 3RXXA 5B1MC 2LY8A 1GA0A 3VP3A 4Z5TA 4J8WC 3OPLA 4KHAB 4C3QA 4OPQA 3AZGC 4H9NB 4OJ6A 2XH9A 3ZG5A 3AFAB 4PMAA 3R45B 3C1BB 4E3OA 3AZLD 1BH9B 3MGPD 3AV1D 5CXWA 3PTEA 3AZNB 3B6GD 4FCFA 5B0YA 3W97A 5B40B 4OQIA 1PW1A 3N8LA 4OONA 1F66A 5DNNB 1YLZA 3BRMA 4BD1A 4WJ3C 4PPRA 5DF7A 1Z6FA 5CERA 1SHVA 5GT0B 1P3PA 3B6FD 3MGRB 3X1UA 3A3FA 4UA7A 2FJ7A 5D3OA 4FH2A 2ZQ9A 3KUYC 5EVID 3AL0C 1HQ3A 3OPPA 3REJD 1KX5B 1KX4D 1YU1A 3ITBA 4CPKA 5B40C 2NZDC 5B24A 2ZM0A 4LCMA 1K6RA 5DNNC 4IJFA 4E3MA 1ERMA 5AV6C 4B4ZA 2Y2KA 5G18A 2WKEA 5GHXA 4HEFA 5FASA 1KE3A 3AGFA 4NE5A 4R8PA 3SH7A 5FUGA 3UNWA 3BFEA 3O88A 1P34C 3MGQC 1E4DA 4HGAB 3N4IA 5HL1A 5DNMA 3X1SC 5B0ZC 2XR0A 4XUXA 5GHZA 3UY6A 3AZFC 5AV5C 2YFWB 1JVJA 1P3GA 1AXBA 3TU4A 4NY2A 5B32B 2A49A 1S32D 5B2IA 3N3FA 1L2SA 2UWXA 1XA1A 1ZC2A 5CGXA 1KGFA 4PM5A 1M19C 2WGIA 2NQBC 4IBIA 2ZY5A 3VH6W 4XUJC 3FWLA 5CPIB 1CEFA 5F1FA 2PU4A 1E3UD 2G2WA 5CHMA 2ZMAA 5CTNA 1GHIA 3GRJA 3NQJA 2RCXA 4YM6B 1W8QA 3Q7VB 1H3OB 1AOIB 1DJAA 4J8XB 5B2JA 3HBRA 3B0BA 1P3AD 4KGCC 3REHA 1N9BA 3GTCA 3B0CW 1IYSA 3IH9A 3IXHA 5DTSA 1MWTA 1NY0A 4P87A 1BTLA 5BNXA 1J9MA 3UTAC 3HLCA 4S2KA 5CPIC 3A6NA 3MVDA 1YQSA 3UTBB 5GXQD 3HUNA 2ZC7A 5DF8A 4YM6C 1M18A 1K55C 3FV7A 5JRGB 4IBDA 1A7WA 3PAEA 5M1AA 3REIB 3CJMA 4Y0TA 4WU9A 4WU8B 2RIQA 4IBKA 4KUDD 1SDEA 1MWUA 4JF5A 3B0DB 4Z2MH 3WA9C 1P3FD 3AZKB 3A3EA 1DJBA 4YFMA 4LCLA 3PBSA 4XZQA 5B33D 1KVMA 1XXMA 1P3IA 5FSRA 1U60A 2F8NG 5A90A 4E3IA 4R1GA 4E3NA 4WU8C 4PM6A 4UA6A 1DY6A 4DXBA 4QLCC 3V5MA 2ZC4B 1H8YA 3AZEA 1RGYA 2QZ6A 3ISGA 4DQYB 1T3UA 5F99A 2F2AC 3MFDA 3LZ1D 1EQZA 5EUAA 3C1CD 3VFFA 5CPKD 4ZUXB 3LJAA 3EG5B 1U35D 2BYKA 1FSYA 5AY8D 4PM7A 3W96B 5BNVA 3W4PA 3AZLB 3X1VA 1XPBA 3MGPB 4J8WA 3UE0A 4CAYA 2WYXA 3AYWD 5CP6A 3WAAA 1SCWA 4GHAA 4GZBA 1RP5A 4KZ8A 2HIOD 3IF6C 1YU3A 5B1MD 3NC8A 4Y0UA 3W99C 3MNNC 3B6FB 5AV9A 3VOYA 4ZUXC 4DE0A 3W96C 5B1LB 4IVIA 4KZ5A 1MBLA 3AZGD 1Z2CB 3AZLC 1FQGA 4DDSA 2DCFA 4KHAA 3REJB 1KX4B 3WS1A 4H9NA 3CMZA 3AFAA 3R45A 2HP5A 3C1BA 3LO7A 4G92B 3VP1A 1BH9A 1XGJA 3GSGA 1KX3A 5GLAA 4GD6A 3AZNA 3V9RA 5A93A 4OPRA 4OOYA 5B1LC 3P5JB 2ZQ8A 5AQ7A 5FQQA 1JWZA 4OP5A 3RXWA 4J8VC 3WRZA 5GT0A 3KUYD 3W4OA 4H9PB 4JKTA 5FATA 3MGRA 4X53A 1ZLAC 2JE5A 4UUZB 4Z66C 3X1TC 2ZQ7A 3LZ0C 3WRTA 5B40D 3GQZA 3ZNYA 2NZDD 4D2OA 4WYYA 3B3XA 2Y2HA 1KX5A 5DNND 3SOIA 5AV6D 3H0RC 2RVQC 2OV5A 3NY4A 5CEBA 4LD9C 1JWPA 4BJPA 4X6TA 5FQIA 1P34D 5TFQA 3MGQD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V2F F;  5CEC A;  3HL9 A;  5FI7 A;  2Z2L B;  4N1H A;  5CRF A;  2WAD A;  3ZGA B;  2X02 A;  4Q8I A;  3ITA A;  1BLH A;  1SKF A;  2BG1 A;  1LHY A;  3IXG A;  5FDH A;  4DE3 A;  5I94 A;  4WMC A;  3UE1 A;  4P6B A;  1NYY A;  2EX6 A;  1FR6 A;  1K56 A;  1ES4 A;  1ONH A;  2ZQC A;  3FKV A;  2XEP A;  5F83 A;  4WZ5 C;  5EOO A;  1YLJ A;  1QMF A;  3C4P A;  3BEB A;  4GOG A;  2VGK A;  3ZHH A;  3WS5 A;  1OME A;  3MXR A;  3HVF A;  3BEC A;  4QU3 A;  1ES5 A;  1L0D A;  5CGS A;  2DRW A;  1NYM A;  3IXB A;  4LEN A;  1MWS A;  4WBG A;  3UN7 A;  2OSU A;  1ERO A;  1IYO A;  1GHM A;  1MKI A;  3SS5 A;  2R9X A;  4OH0 A;  5BOH A;  3VP4 A;  2RL3 A;  3OCN A;  5CTM A;  1G6A A;  3MBZ A;  3S22 A;  4KG6 A;  1RCJ A;  2X01 A;  4K0W A;  2ZC5 B;  1KGE A;  4KG5 A;  2B5R A;  4N92 A;  4QY5 A;  5A91 A;  3RXX A;  1GA0 A;  1BUE A;  3VP3 A;  1O7E A;  4U3T A;  3S1Y A;  3ZG0 A;  2H0T A;  4ZDX A;  4IBX A;  3OPL A;  2EX2 A;  3O3V A;  4OQH A;  4C3Q A;  4OPQ A;  1FCM A;  3FYZ A;  1PI5 A;  2V1Z A;  3N6I A;  3DWK A;  5EVL A;  2XH9 A;  3BYD A;  4LV2 A;  4NK3 A;  3OC2 A;  4PMA A;  3ZG5 A;  1G68 A;  1SDN A;  4WEJ A;  3HLF A;  1LL5 A;  3MXS A;  3Q7V A;  3WS4 A;  1GCE A;  2WAF A;  1YLP A;  2DNS A;  4E3O A;  3WS2 A;  3V50 A;  1S0W A;  2WK0 A;  2XGN A;  3TOI A;  4OQ0 A;  4Z9Q A;  2C5W B;  2P9V A;  2HPB A;  5CXW A;  2E8I A;  1FR1 A;  3OCL A;  3OPH A;  1VQQ A;  5GL9 A;  2EXA A;  3PTE A;  4S2I A;  3SH9 A;  4FCF A;  4ID4 A;  3OZH A;  4JXW A;  4RX2 A;  5FAP A;  5FQJ A;  3HLE A;  3Q82 A;  1PW1 A;  4OQI A;  3IF5 A;  3N8L A;  1PI4 A;  3PBO A;  1BT5 A;  4OON A;  3VMA A;  4OQG A;  4IVK A;  1YLZ A;  4OKP A;  5DTT A;  3BRM A;  3Q81 A;  4BD1 A;  1KDS A;  3O87 A;  1EWZ A;  2HDR A;  3UDF A;  1IKI A;  4PPR A;  1NZO A;  5HX9 A;  3UPN A;  4F94 A;  5DF7 A;  3SS4 A;  1Z6F A;  3CZD A;  4N1X A;  4YIN A;  2Y2N A;  5CER A;  1SHV A;  4R0Q A;  4X56 A;  5HW3 A;  1ERQ A;  1I2W A;  3BM6 A;  3PBN A;  3JYI A;  4RYE A;  4O7D A;  1K38 A;  1PZP A;  3A3F A;  4UA7 A;  2PU2 A;  4KQR A;  4QD4 A;  2XFS A;  5D3O A;  4DRT A;  1MXO A;  2ZQ9 A;  4FH2 A;  4JLF A;  3V39 A;  2G2U A;  2XFT A;  4P0M A;  3IHB A;  3E2K A;  4UA9 A;  5EVI D;  3ZVT A;  2XLN A;  3PBQ A;  3OPP A;  2EX9 A;  2OLU A;  4BQM A;  3G4P A;  1ZG6 A;  4DE2 A;  3ITB A;  4MNR A;  4CPK A;  3LY4 A;  3O86 A;  2JBF A;  1KE4 A;  2WGW A;  3G32 A;  2Y2Q A;  1IEL A;  2ZM0 A;  4E6W A;  3NBL A;  4U0T A;  1PW8 A;  1QME A;  4LCM A;  4ZJ1 A;  4GDN A;  1K6R A;  4R23 A;  5GLD A;  2ZC6 B;  4E3M A;  4GN2 A;  1ERM A;  4BEN A;  2J7V A;  2XK1 A;  4RA7 A;  4B4Z A;  2Y2K A;  5G18 A;  2Y2G A;  4LV1 A;  4JXG A;  2WKE A;  5GHX A;  2EX8 A;  4EUZ A;  1TDL A;  1K25 A;  1K4F A;  4HEF A;  3S4X A;  2ZC3 B;  5E2H A;  4EBL A;  5FAS A;  1KE3 A;  3AGF A;  1PWD A;  3SH7 A;  3ZFZ A;  3UNW A;  3A3J A;  3BFE A;  3O88 A;  3HUO A;  4OVD A;  3Q1F A;  4GNU A;  3SS3 A;  4JBF A;  4ZTK A;  3ZDJ A;  1E4D A;  1KDW A;  4K0X A;  5A92 A;  3N4I A;  5HL1 A;  2XR0 A;  3DW0 A;  3N8S A;  4XUX A;  5GHZ A;  3UY6 A;  5KMW A;  3VSL A;  4MEZ A;  1TDG A;  3IHA A;  2P74 A;  1YT4 A;  3BFC A;  1W79 A;  4UHU A;  4WM9 A;  5M19 A;  1GHP A;  1JVJ A;  1WYB A;  4OOL A;  2WKH A;  1AXB A;  4EWF A;  2A49 A;  2HDU A;  3PAG A;  2J8Y A;  3ZG7 B;  4NET A;  4WEK A;  1L2S A;  2HDQ A;  2UWX A;  1XA1 A;  1YMX A;  5JYO A;  2XDM A;  1ZC2 A;  4S2J A;  5CGX A;  5M18 A;  3G35 A;  1KGF A;  5GLB A;  4PM5 A;  2Y2I A;  4MBK A;  3M6B A;  3Q07 A;  3M2J A;  5GHY A;  4GB7 A;  1PWG A;  1YLT A;  3BFF A;  1W8Y A;  3G2Z A;  3QHY A;  5FQ9 A;  1M6K A;  2WKI A;  2WGI A;  4QJG A;  2EXB A;  3MZE A;  5AQB A;  3LEZ A;  3BLS A;  3AGD A;  3FWL A;  3N7W A;  3WS0 A;  4RVA A;  1CEF A;  5F1F A;  2ZD8 A;  1LL9 A;  1H5X A;  2PU4 A;  1E3U D;  1YM1 A;  1L0F A;  2G2W A;  2ZQA A;  5CHJ A;  5CHM A;  2ZMA A;  5CTN A;  2WZX A;  3HLB A;  1GHI A;  1KGG A;  4PM9 A;  4EQI A;  3GRJ A;  4KQO A;  1ZKJ A;  2RCX A;  4DDY A;  5FI2 A;  1W8Q A;  2HP6 A;  5FQM A;  2ZM8 A;  3Q7V B;  4X69 A;  4OPZ A;  1DJA A;  3FZC A;  3MZD A;  4R3B A;  3HBR A;  4KZB A;  3AGE A;  1K55 A;  2XD5 A;  3OPR A;  3GV9 A;  2P9V B;  1N9B A;  4B88 A;  3GTC A;  5EOE A;  1IYS A;  3VP0 A;  1NXY A;  3ZG8 B;  1TEM A;  1RGZ A;  3IH9 A;  3IXH A;  5DTS A;  4H8R A;  2ZM2 A;  3HRE A;  3BFG A;  1MWT A;  1NY0 A;  4P87 A;  2PBY A;  4Y0O A;  5EVI B;  1BTL A;  4GKU A;  4LV0 A;  5EVI A;  1J9M A;  1KVL A;  3DWZ A;  3G31 A;  4XXR A;  3HLC A;  5IHV A;  5TR7 A;  1PIO A;  1NZU A;  1PZO A;  4MBH A;  5FI6 A;  1M40 A;  1BLC A;  1W5D A;  4S2K A;  1S6R A;  3MKE A;  4FSF A;  4EV4 A;  3HLD A;  1YQS A;  5J8X A;  1WYC A;  1MWR A;  3P09 A;  2H10 A;  4B4X A;  5AQ9 A;  4R4S A;  4BD0 A;  4DXC A;  2J9O A;  3HUN A;  2ZC7 A;  1MY8 A;  2QPN A;  3BLM A;  5FA7 A;  5DF8 A;  1KE0 A;  1CK3 A;  4FD8 A;  2WZZ A;  1K55 C;  3IH8 A;  2Y4A A;  1E25 A;  1K6S A;  1IEM A;  3FV7 A;  3UPO A;  4QB8 A;  2JC7 A;  4S2P A;  5KSH A;  3HLG A;  3PAE A;  5M1A A;  3LCE A;  1TVF A;  1ESI A;  1XKZ A;  5HAR A;  3NCK A;  3CJM A;  3TG9 A;  4Y0T A;  1Q2P A;  4KZ6 A;  1Y54 A;  3IWQ A;  2WGW B;  3N8R A;  3LY3 A;  4Y7P A;  5EVI C;  3QNB A;  1CI9 A;  1SDE A;  1MWU A;  3G34 A;  5EPH A;  1BLS A;  4BLM A;  4GD8 A;  2IWB A;  4JF5 A;  1IKG A;  1HZO A;  1BUL A;  4ZBE A;  3A3E A;  4OLD A;  1DJB A;  4ZJ2 A;  2BLS A;  2HP9 A;  4LCL A;  2H5S A;  4YFM A;  4JF6 A;  1I5Q A;  3PBS A;  1O07 A;  1I2S A;  5HAQ A;  2Y55 A;  3V3S A;  2IWC A;  1CI8 A;  1NRF A;  1KVM A;  2XQZ A;  3UO9 A;  1XXM A;  2XD1 A;  2WGV A;  5E2G A;  1U60 A;  2V20 A;  4QHC A;  5FSR A;  5KZH A;  2EFU A;  1H8Z A;  5A90 A;  1L0G A;  3WWX A;  1L0E A;  4IED A;  4E3I A;  1BLP A;  4R1G A;  5KSC A;  4XUZ A;  4E3N A;  3VOZ A;  1PYY A;  4M3K A;  5GLC A;  3NDE A;  2FFY A;  5FQK A;  4S2L A;  4HBT A;  3GMW A;  3UPP A;  4PM6 A;  4UA6 A;  1DY6 A;  1JTG A;  4R4R A;  4DXB A;  4OPY A;  3V5M A;  2ZC4 B;  1XGI A;  1H8Y A;  2Y2P A;  1FCO A;  1RGY A;  1Q2Q A;  2QZ6 A;  3E2L A;  4GDB A;  4EBN A;  3ISG A;  4KG2 A;  4DKI A;  1N4O A;  3IF6 A;  4FH4 A;  4X68 A;  1W7F A;  1E3U A;  3MFD A;  3BFD A;  1ES3 A;  5EUA A;  3VFF A;  4N9L A;  2Y59 A;  4OOM A;  5TGF A;  4JF4 A;  3SH8 A;  1FSY A;  1K57 A;  2X71 A;  3NIA A;  4OLG A;  4PM7 A;  3UE3 A;  5L2F A;  4KZA A;  4KQQ A;  2JCH A;  3W4P A;  4PM8 A;  3ZG9 B;  5DTK A;  1XPB A;  4P85 A;  3MZF A;  2Y2J A;  4LV3 A;  3UE0 A;  4ZJ3 A;  2GDN A;  3EQV A;  5AQA A;  2Y2O A;  1LLB A;  4C75 A;  4E6X A;  2WYX A;  1IYQ A;  3VSK A;  1XA7 A;  4N9K A;  4DF6 A;  1YLW A;  2C6W B;  1XX2 A;  1SCW A;  4GZB A;  4S2N A;  1RP5 A;  4C6Y A;  2Z2M B;  3C7U A;  3NDG A;  1CEG A;  3UDI A;  3ZVW A;  1HTZ A;  4KZ8 A;  3GVB A;  5FAQ A;  4KZ4 A;  3IF6 C;  3DTM A;  2FFF B;  3HLW A;  4HBU A;  3NC8 A;  1MPL A;  3MKF A;  4K91 A;  4Y0U A;  5CHU A;  4EBP A;  5JYP A;  2CC1 A;  2ZLY A;  4WEL A;  1FCN A;  4BL2 A;  4WMC D;  4HES A;  3VOY A;  1K57 C;  4KZ3 A;  4X55 A;  3V3R A;  4CJN A;  1K56 D;  4DE0 A;  3QNC A;  4ZAM A;  1NJ4 A;  3C4O A;  4U0X A;  2Q9N A;  2Y2M A;  4IVI A;  3VFH A;  4KZ5 A;  1MBL A;  1FQG A;  4DDS A;  2DCF A;  3PBT A;  5E43 A;  1ES2 A;  3UDX A;  2A3U A;  3VP2 A;  3A3D A;  3A3I A;  1K54 A;  3WS1 A;  3CMZ A;  2QMI A;  4S2N C;  1HVB A;  4S2M A;  4S2O A;  3M2K A;  4IBR A;  3IXD A;  2HP5 A;  3G2Y A;  3G30 A;  3RJU A;  1ALQ A;  1C3B A;  5E2F A;  1PWC A;  3LO7 A;  2HDS A;  3VP1 A;  1LI9 A;  5U47 A;  4KEN B;  4WZ4 A;  2OLV A;  5DVA A;  1GA9 A;  1VM1 A;  1XGJ A;  3GSG A;  3NI9 A;  5HFO A;  5FAO A;  5HAI A;  1WE4 A;  2ZQD A;  5GLA A;  5EE8 A;  4GD6 A;  1BZA A;  3Q7Z A;  4UAA A;  3IQA A;  2IWD A;  2J9P A;  5A93 A;  4OPR A;  3IT9 A;  3D4F A;  4OOY A;  5CGW A;  1FOF A;  3PBR A;  2ZQ8 A;  1DJC A;  1FSW A;  3I7J A;  4KZ7 A;  5AQ7 A;  4KZ9 A;  5F1G A;  3IWI A;  5FQQ A;  1JTD A;  2VGJ A;  1JWZ A;  4OP5 A;  1HD8 A;  4DE1 A;  1BSG A;  3RXW A;  4BL3 A;  1ONG A;  3W4Q A;  1K54 C;  1XP4 A;  4E3L A;  3WRZ A;  2EFX A;  3HUM A;  4JPM A;  3W4O A;  4MBF A;  4JKT A;  1ZG4 A;  2R9W A;  5FAT A;  4JXS A;  5DF9 A;  4X53 A;  5E2E A;  4JXV A;  2JE5 A;  4RX3 A;  4MLL A;  2ZQ7 A;  2Q9M A;  3C7V A;  1YLY A;  2I72 A;  3WRT A;  4E3J A;  3ZNY A;  3GQZ A;  3EQU A;  4D2O A;  2Y2L A;  4WYY A;  1K4E A;  2Y2H A;  2Y91 A;  3B3X A;  4OP8 A;  1ESU A;  4L0L A;  5F82 A;  3SOI A;  3FKW A;  3C5A A;  2H0Y A;  1IYP A;  4WZ5 A;  5HAP A;  1JWV A;  2WAE A;  2OV5 A;  4R3J A;  3NY4 A;  2ZJ9 A;  5CEB A;  3ZNT A;  4A5R A;  4E3K A;  2XF3 A;  1JWP A;  3CG5 A;  3TSG A;  4BJP A;  3ZCZ A;  1LI0 A;  4X6T A;  3IF6 B;  3M6H A;  3P98 A;  4QY6 A;  5EEC A;  5FQI A;  3W8K A;  2WUQ A;  1EI5 A;  1YMS A;  3GR2 A;  5TFQ A;  3IWO A;  5CED A; 
#chains in the Genus database with same CATH topology
 3KSI A;  2V2F F;  4UEY A;  3HL9 A;  2Z2L B;  3O62 A;  3FPV A;  5CRF A;  3X1S D;  3ZGA B;  2W27 A;  5B0Z D;  3ITA A;  3AZF D;  1P3A B;  5AV5 D;  3VH6 T;  3AZI D;  2ZQC A;  4WZ5 C;  1QMF A;  3C4P A;  1M1A C;  2YFW A;  5CGS A;  5B32 A;  2DRW A;  1JFI B;  4WBG A;  1M19 D;  3UN7 A;  1MKI A;  4OH0 A;  3FDD A;  5DFX A;  2NQB D;  3KS4 A;  2PDR A;  3LR0 A;  3S22 A;  2VEA A;  4IBE A;  1ZHH B;  3MQ0 A;  3WD2 A;  5GXQ B;  2ZC5 B;  4WNN B;  4XUJ D;  1O7E A;  3S1Y A;  2OWJ A;  4ZBJ B;  3EPK A;  3LIE A;  3ZG0 A;  1OPX A;  1DP6 A;  4I38 A;  3AV2 C;  1P3A C;  2RTS A;  4XT2 B;  4G3V A;  2EX2 A;  4YOF A;  5BPV A;  3O3V A;  4NYY A;  4GHI A;  2B95 A;  3FYZ A;  1PI5 A;  2V1Z A;  4B9O A;  1TS6 A;  4KUD B;  4KGC D;  4H9S A;  4WEJ A;  4BMW A;  3HLF A;  1LL5 A;  3WD3 A;  3Q7V A;  1H3O A;  5L10 A;  1AOI A;  4J8X A;  1P3F B;  3WS2 A;  3A0R A;  1AIW A;  1S0W A;  2WK0 A;  3V50 A;  3TOI A;  5GT3 C;  3UTA D;  4KUK A;  1FR1 A;  3OCL A;  3OPH A;  2A24 B;  5GL9 A;  1E88 A;  4ID4 A;  2O9A A;  4JXW A;  3Q82 A;  3T4J A;  3PBO A;  2VGL S;  4IVK A;  2Q0O A;  1JNU A;  1UR9 A;  3O87 A;  2HDR A;  3UDF A;  1IKI A;  2VA0 A;  1NZO A;  2IO5 C;  4YM6 D;  4YIN A;  2Y2N A;  1OGG A;  4R0Q A;  4X23 C;  3H0M C;  3UTB A;  3BM6 A;  3BY9 A;  4WZS B;  3MMH A;  4O7D A;  4M4X A;  3NQU B;  2PYP A;  2PU2 A;  4KQR A;  1TZY C;  5CHL B;  1F98 A;  3NJA A;  4DRT A;  2KLI A;  1T1A A;  2G2U A;  4P0M A;  3MF0 A;  5JRG A;  3LZ1 B;  3E2K A;  4UA9 A;  3C1C B;  3ZVT A;  5CPK B;  3BWL A;  1U35 B;  3REI A;  5AY8 B;  4DE2 A;  3WA9 D;  2PYO D;  3LY4 A;  2W3G A;  4MMN A;  4U0T A;  3UT9 C;  1XJ3 A;  2ACG A;  4R23 A;  2F8N D;  2J7V A;  3AZK A;  3AYW B;  4RA7 A;  3LID A;  5GSU C;  2Y2G A;  4LV1 A;  4JXG A;  5E5A C;  1QO6 A;  2EX8 A;  4NXG A;  1K4F A;  5E2H A;  1PWD A;  3A3J A;  2V9A A;  5B1M B;  2K7S A;  4WU8 D;  4JBF A;  4EW7 A;  4QLC D;  3EPL A;  4NYU A;  4YS3 D;  3HCY A;  2ARO C;  3SZT A;  3BFC A;  4WM9 A;  4EEP A;  3LI8 A;  3AZG B;  3UB6 A;  2PYR A;  4WL9 A;  4MB4 A;  2QKP A;  4OOL A;  4EWF A;  3NEC A;  4E44 A;  2J8Y A;  4R70 A;  5JYO A;  2XDM A;  4Q0J A;  4S2J A;  2FZ0 A;  2OWH A;  4MBK A;  4IHQ A;  3AN2 C;  4GB7 A;  1YLT A;  2WKI A;  3AZL A;  3MGP A;  3IBJ A;  3ZQ5 A;  3AV1 A;  2OOL A;  3MZE A;  1CK7 A;  3AGD A;  3WS0 A;  3B6G A;  2ZD8 A;  4H6J B;  1YM1 A;  1L0F A;  3KSG A;  3W99 D;  2WZX A;  4BBV A;  4EQI A;  3MNN D;  2D49 A;  1ZKJ A;  2W3F A;  3IX4 A;  2Y79 A;  5DKL A;  4ZUX D;  5FQM A;  3FZC A;  3W96 D;  5K5B A;  3AZM C;  3AGE A;  3KUY B;  3B6F A;  3GV9 A;  4EO5 C;  3VV4 A;  4EUV A;  1NXY A;  3LEQ A;  2VJW A;  2ZM2 A;  5AVB C;  4AWL B;  4Y0O A;  5C5K A;  2EA9 A;  3DTI A;  4NE3 A;  5EVI A;  3DWZ A;  3W98 C;  2NZD B;  1OJ5 A;  1PIO A;  3REJ A;  1NZU A;  1KX4 A;  5BO0 B;  5FI6 A;  2CV5 C;  5FL3 A;  2VV6 A;  5AV6 B;  3KWQ C;  3HLD A;  3WKJ C;  1WYC A;  1E6R A;  4JGO A;  5KDM A;  1VEU A;  1O6I A;  2A2L A;  1KE0 A;  1CK3 A;  4FD8 A;  2ZY4 A;  5BS7 A;  5B1L D;  2Y4A A;  4HP9 A;  1P34 B;  1IEM A;  4L9E A;  2JC7 A;  5KSH A;  1F2K A;  3MGQ B;  3HLG A;  1XKZ A;  1ESI A;  5HAR A;  3NCK A;  3X1S B;  4J8V D;  1Q2P A;  5B0Z B;  5F5Y A;  1Y54 A;  4AWL C;  3IWQ A;  2WGW B;  3LEL B;  3AZF B;  2W1T B;  2V8C A;  1CI9 A;  3G34 A;  5AV5 B;  4OJP A;  1ZLA D;  1HZO A;  3AZI B;  1OJG A;  1ID3 B;  5AV8 C;  1BUL A;  4DJ3 A;  4Z66 D;  3X1T D;  4Z2G A;  4FTX A;  4OLD A;  4ZJ2 A;  2BLS A;  3LZ0 D;  4H9P A;  1I5Q A;  1O07 A;  5HAQ A;  4NXE A;  5CPJ B;  4UUZ A;  3REK C;  1S32 A;  4P6Z M;  3UO9 A;  1M19 B;  2XD1 A;  3B47 A;  2RVQ D;  4HJ4 A;  5E2G A;  4QHC A;  2EFU A;  2NQB B;  3FKE A;  1L0E A;  1TD5 A;  1BLP A;  5KIZ A;  3VOZ A;  4Y17 A;  1PYY A;  4LD9 D;  4XUJ B;  1ED7 A;  5GLC A;  2FFY A;  2KX6 A;  4QWO A;  3GMW A;  5I5L A;  4R4R A;  3LEL C;  4EBN A;  4GDB A;  1N4O A;  4FH4 A;  1W7F A;  1N1J B;  3AZI C;  1ID3 C;  1E3U A;  4TX8 A;  3ULF A;  3BFD A;  1ES3 A;  1UGU A;  2Y59 A;  5FDS A;  2M1C A;  4JF4 A;  3SH8 A;  4KGC B;  1K57 A;  2X71 A;  4IUH A;  3UE3 A;  3U2A A;  4Z2M G;  5CPJ C;  3T4Q A;  4KZA A;  4KQQ A;  2JCH A;  4MB5 A;  4OJO A;  2IA2 A;  3ZG9 B;  5DTK A;  5HWV A;  4P85 A;  3MZF A;  1P3A A;  4QNL A;  2Y2J A;  1M1A D;  4LV3 A;  2V1B A;  4ZJ3 A;  2Y2O A;  3UTA B;  4E6X A;  1IYQ A;  4O8G A;  3WTP C;  1XA7 A;  2B18 A;  2P7J A;  4MB3 A;  3OOV A;  4C6Y A;  4JJN C;  3C7U A;  1JFI A;  1HTZ A;  4QPR A;  4PKY A;  3GVB A;  3DBA A;  1TS7 A;  4K91 A;  5F68 A;  2JKR M;  1GPF A;  4BL2 A;  5GXQ A;  3AV2 D;  5MC7 A;  3MGS C;  1UR8 A;  4WNN A;  4HES A;  5B31 C;  1K56 D;  4ZAM A;  1NRJ A;  3VFH A;  2Q9N A;  3F1N B;  5B31 G;  3PXP A;  4XT2 A;  3UDX A;  2A3U A;  4FUW A;  3A3D A;  3A3I A;  3WA9 B;  1K54 A;  2L0W A;  4IUK A;  2PYO B;  4GH9 A;  4S2N C;  4S2O A;  3M2K A;  4KUD A;  3IXD A;  5GT3 D;  3G2Y A;  3RJU A;  3L2A A;  4AFI A;  2F8N B;  1P3F A;  1BFM A;  5HDC A;  5U47 A;  1KU5 A;  4KEN B;  2OLV A;  3EPJ A;  1P3O C;  4NZ1 A;  2XSS A;  5HFO A;  5HAI A;  4D60 A;  2ZQD A;  2WKQ A;  1L3L A;  5B33 A;  1YU4 A;  2J9P A;  2PBD P;  1H0G A;  3D4F A;  3VH5 W;  3L25 A;  4NKP A;  5CGW A;  4X23 D;  3PBR A;  1DJC A;  3I7J A;  4KZ7 A;  5F1G A;  4QLC B;  3IWI A;  1TZY D;  4E45 A;  4UQI S;  2D01 A;  4YS3 B;  1DP8 A;  2PYO C;  3NQU A;  2JKT I;  5E2E A;  1YU0 A;  1TAF B;  5J3W A;  3LZ1 A;  4E3J A;  3C1C A;  5CPK A;  1K4E A;  3UT9 D;  2Y91 A;  4OP8 A;  1U35 A;  4Q0H A;  5AY8 A;  3FKW A;  3C5A A;  3REL C;  1IYP A;  3T1X A;  1V9Z A;  5GSU D;  1P9R A;  5HAP A;  5E5A D;  2I9V A;  1EAK A;  5FEF A;  1P3L B;  3UB8 A;  4L9F A;  3AYW A;  3R4K A;  3LR5 A;  3TSG A;  3CAX A;  3ZCZ A;  5EEC A;  3IF6 B;  3GR2 A;  4YS3 C;  3M7P A;  3W99 B;  3IX3 A;  3MNN B;  2HIO A;  5CEC A;  4N1H A;  1P3B C;  2X02 A;  5B1M A;  4HH3 A;  4Q8I A;  5HPI A;  1BLH A;  1SKF A;  2BG1 A;  1LHY A;  4DE3 A;  5I94 A;  2ARO D;  2INW A;  3UE1 A;  5HD3 A;  1H0M A;  3AZJ C;  2EX6 A;  3GEC A;  3FKV A;  3IBR A;  5EM0 A;  5EOO A;  3UMD A;  3AZG A;  1LT0 A;  3ZHH A;  1ES5 A;  5HL6 A;  1P3L C;  3IXB A;  3AN2 D;  2J8P A;  1MWS A;  2OSU A;  1GHM A;  5BOH A;  1PZR A;  3WTP E;  2R9X A;  2G7U A;  3VP4 A;  2RL3 A;  1G6A A;  3MBZ A;  4KG6 A;  1P3M C;  3KXB C;  4QY5 A;  1P3K C;  5AVC C;  2IOU A;  4Y3I A;  4U3T A;  2J3T C;  4ZDX A;  2ZOI A;  1P0Z A;  4NE6 A;  4H6J A;  4NZ5 A;  2JKG A;  2VX8 A;  1STZ A;  4J8V B;  2YFV B;  3AZM D;  3BYD A;  1WWS A;  3WD4 A;  1G68 A;  1SDN A;  3MXS A;  4KQD A;  4PAU A;  1ZLA B;  3EPH A;  1YLP A;  2DNS A;  3LYX A;  4Z66 B;  5AVB D;  3X1T B;  3KUY A;  2C5W B;  4Z9Q A;  3LZ0 B;  1OGB A;  2HPB A;  3W98 D;  3W97 B;  1VQQ A;  2EXA A;  4S2I A;  3SH9 A;  2CV5 D;  4IBG A;  3OZH A;  4RX2 A;  5FAP A;  5FQJ A;  5BT1 C;  3HLE A;  4L9G A;  4Z5T C;  1PI4 A;  3KWQ D;  1BT5 A;  3VMA A;  5B40 A;  3WKJ D;  2NZD A;  4LLO B;  4OKP A;  5DTT A;  5BO0 A;  5DNN A;  1EWZ A;  3VE3 A;  4K08 A;  5AV6 A;  3VOL A;  4LD9 B;  3JVU A;  4DRB A;  3CZD A;  4N1X A;  4Z2I A;  5HW3 A;  2PT7 A;  1ERQ A;  1I2W A;  3LIA A;  3PBN A;  4H9R B;  3X1U B;  1CXW A;  1MXO A;  4HJ6 A;  4H9Q B;  3IHB A;  1P34 A;  3MGQ A;  2VQR A;  3X1S A;  5B0Z A;  3W97 C;  5AV8 D;  2JBF A;  2WGW A;  3G32 A;  2Y2Q A;  2QYB A;  3AZF A;  1F66 C;  2W1T A;  4HMD A;  3IS2 B;  1M1A B;  4ZJ1 A;  5AV5 A;  1XFQ A;  5GLD A;  2ZC6 B;  3A1K A;  4GN2 A;  4BEN A;  3REK D;  3MR0 A;  3LI9 A;  2HUE C;  4EUZ A;  1P3P C;  4M6B A;  2ZC3 B;  3X1U C;  4EBL A;  5J7E A;  1M19 A;  2FJ7 C;  2HZ5 A;  3EOI A;  3HUO A;  2NQB A;  5AJG A;  4OVD A;  1TS0 A;  3ZDJ A;  1HQ3 C;  3AV2 B;  5A92 A;  3LEL D;  5DJT A;  4XUJ A;  4CQH A;  3N8S A;  1ID3 D;  1VB6 A;  1TF1 A;  5B24 C;  1TDG A;  2H28 A;  2P74 A;  4HJ3 A;  1YT4 A;  3TRC A;  3QP5 A;  4BBT A;  1GHP A;  2WKH A;  2HDU A;  3PAG A;  1PFL A;  3VH6 A;  5CPJ D;  4WEK A;  3ZG7 B;  1VET B;  1LSV A;  2HDQ A;  4LGW A;  1YMX A;  4HMC A;  2HF6 A;  5M18 A;  3G35 A;  4KGC A;  3M2J A;  5GT3 B;  1PWG A;  3BFF A;  3QHY A;  4R8P C;  3G2Z A;  3H7W A;  5FQ9 A;  1J7M A;  4DRA A;  3WTP D;  1WA9 A;  2DMW A;  2EXB A;  5AQB A;  3B0C T;  2G5H C;  3UTA A;  3CIT A;  4JJN D;  3BLS A;  5DNM C;  3N7W A;  4HME A;  4RVA A;  1LL9 A;  2IO5 B;  4ETX A;  5CPI A;  5CHJ A;  5IU1 A;  3HLB A;  4X23 B;  1KGG A;  4PM9 A;  3W2Z A;  4F3L B;  3MGS D;  5FI2 A;  1P3G C;  5B31 D;  3TU4 C;  3DTE A;  4YM6 A;  5B2I C;  4X69 A;  1TZY B;  1BH8 B;  3LGO A;  4OPZ A;  4HH2 A;  3MZD A;  1K55 A;  2XD5 A;  2JSS A;  2P9V B;  4GJ4 A;  3K3C A;  4B88 A;  3VP0 A;  3L28 A;  3ZG8 B;  1TEM A;  3F1N A;  4H8R A;  3BFG A;  1W63 M;  1D7E A;  3G31 A;  3VH5 T;  4XXR A;  5HDS A;  4R6L A;  3UT9 B;  5TR7 A;  4MBH A;  2BYM B;  5G4Z A;  2EWW A;  1BLC A;  3A6N B;  3WA9 A;  3MKE A;  2PYO A;  4FSF A;  4EV4 A;  5J8X A;  5GSU B;  3VH5 A;  1YU2 A;  1P3O D;  1MWR A;  3P09 A;  5E5A B;  2H10 A;  4B4X A;  4BD0 A;  4R4S A;  3G6O A;  2F8N A;  1MY8 A;  2ZY3 A;  3BLM A;  5FA7 A;  1N9O A;  3L7H A;  2WZZ A;  5B2J C;  1B67 A;  1CF0 A;  2PR6 A;  5L09 A;  1E25 A;  3UPO A;  3REH C;  4S2P A;  4P6Z S;  3S7N A;  4WU9 B;  2M7U A;  1F1E A;  4G91 C;  4WU8 A;  3GDI A;  3NHQ A;  4Y7P A;  3EWK A;  4QLC A;  2ARO B;  3QNB A;  5HDD A;  5EPH A;  4UPK A;  1IKG A;  3LFV A;  4YS3 A;  4ZBE A;  3A6N C;  3MVD C;  2HP9 A;  2MJ6 A;  4XZQ B;  2Y55 A;  3V3S A;  4CLC C;  3CUE A;  1TAF A;  3C8C A;  3AN2 B;  1NRF A;  4LRZ E;  3L27 A;  3REL D;  1M18 C;  3E4Q A;  2O99 A;  2PR5 A;  2WGV A;  5LBR A;  2V20 A;  4IJG A;  3IX8 A;  2HGV A;  1L0G A;  3UE6 A;  3WWX A;  4XUZ A;  4WU9 C;  5EM1 A;  5FQK A;  4S2L A;  4HBT A;  3UPP A;  3KO6 A;  4ME4 A;  4OPY A;  4Y2F A;  1NLZ A;  1XGI A;  1F5M A;  2Y2P A;  1Q2Q A;  3E2L A;  4KG2 A;  1A0K A;  1P3B D;  3IF6 A;  3LIB A;  5HWW A;  2DQN C;  3W99 A;  3AZM B;  4N9L A;  3KSY A;  3MNN A;  3F1P A;  2P08 A;  4EO5 B;  3AZJ D;  4ZUX A;  4XZQ C;  3NIA A;  4OLG A;  4PM8 A;  1P3I C;  3W96 A;  2PRF A;  5AVB B;  1J3W A;  3NOU C;  4MN7 A;  3E4O A;  3EQV A;  5AQA A;  3W98 B;  1LLB A;  4IBF A;  1P3L D;  4C75 A;  2JN7 A;  5CP6 B;  1ACF A;  1OTA A;  2CV5 B;  2YKH A;  4N9K A;  3UB5 P;  4DF6 A;  4BWI A;  3AZH D;  1XX2 A;  3KWQ B;  3WKJ B;  4ZRR A;  3A0S A;  4G3K A;  2Z2M B;  3UDI A;  1P3M D;  3AZE C;  1GSV A;  3KXB D;  3DTM A;  2FFF B;  5F99 C;  1P3K D;  4LRX C;  3HLW A;  4HBU A;  5JYP A;  5AVC D;  1MPL A;  5CHU A;  3H0L C;  1EQZ C;  2CC1 A;  2J3T D;  2ZLY A;  5AV9 B;  4WEL A;  1FCN A;  3FG8 A;  3LJA C;  4NFT A;  4WMC D;  4X55 A;  4CJN A;  3PR6 A;  3QNC A;  4J8U D;  3C4O A;  4U0X A;  3X1V C;  4IBB A;  4NZ4 A;  5B1L A;  1BYW A;  2HV1 A;  5E43 A;  5FEG A;  1ES2 A;  3OLO A;  1XJ4 A;  3VP2 A;  1H8M A;  3UME A;  4J8V A;  2YFV A;  3WAA C;  5AV8 B;  5CP6 C;  2VZW A;  4S2M A;  3VE4 A;  1HVB A;  1ALQ A;  1C3B A;  5E2F A;  1ZLA A;  3BQ8 A;  3D9Y A;  2HDS A;  4Z66 A;  3X1T A;  1LI9 A;  3REK B;  4WZ4 A;  5DVA A;  5HSQ A;  5BT1 D;  1VM1 A;  1DRM A;  1KX3 B;  3LZ0 A;  4Z5T D;  5FAO A;  2GNX A;  4DMZ A;  1Y28 A;  5EE8 A;  5AV9 C;  3Q7Z A;  3V9R B;  2W8S A;  3IQA A;  2IWD A;  4BBU A;  3IT9 A;  1W1Y A;  3ICY A;  1YPR A;  1FSW A;  1FIL A;  1T1C A;  4II7 A;  4KZ9 A;  3T1Q B;  4IBJ A;  1JTD A;  3WX7 A;  4LD9 A;  1BSG A;  4BL3 A;  2QJ7 A;  3W4Q A;  3HUM A;  4JPM A;  4CSR B;  4H9R A;  3AFA C;  4JXS A;  3C1B C;  4MLL A;  2HJ9 C;  5B0Y D;  3W97 D;  2Q9M A;  4H9Q A;  1YLY A;  1KX3 C;  1F66 D;  5L8M A;  4NXB A;  3AZN C;  4CLC E;  4WZ5 A;  1JWV A;  3WTP B;  5HPF A;  3IS2 A;  1M1A A;  1P3P D;  2ZJ9 A;  2VK3 A;  2GX5 A;  3ZNT A;  4A5R A;  4JJN B;  1HTA A;  3X1U D;  3CG5 A;  2FJ7 D;  2V1A A;  4QY6 A;  5GT0 C;  3SW1 A;  2WUQ A;  3RH8 B;  3MGR C;  1HQ3 D;  3O62 B;  3MGS B;  2VV8 A;  5B31 B;  1F9I A;  3EGX C;  4EER A;  5TJJ A;  2XRO A;  3LR3 A;  5B24 D;  2W3E A;  3CHW P;  3AV2 A;  1KX5 C;  4P6B A;  4OJ5 A;  1K56 A;  5F83 A;  1YLJ A;  4GOG A;  2VGK A;  3WS5 A;  1OME A;  5JA4 B;  1YUE A;  4KUO A;  2FN2 A;  1OTD A;  5G49 B;  1NYM A;  4LEN A;  4R8P D;  1VET A;  1ERO A;  3SS5 A;  3OCN A;  1P3O B;  5TBM B;  2QWS A;  1P9W A;  5GT3 A;  4K0W A;  2HJE A;  3O62 C;  2B5R A;  4KG5 A;  5DNM D;  4N92 A;  5A91 A;  5IT5 A;  1BUE A;  3WD1 A;  2H0T A;  4HGA C;  1S1Y A;  3H9W A;  4IBX A;  1GXD A;  1P3G D;  3TU4 D;  4OQH A;  5B2I D;  3KYE A;  2OAQ 1;  4I3A A;  1FCM A;  4X23 A;  3N6I A;  2L1M A;  3DWK A;  5EVL A;  4NK3 A;  4LV2 A;  3OC2 A;  5B32 C;  2M7V A;  4OJL A;  1TZY A;  1GCE A;  1BH8 A;  3WS4 A;  2WAF A;  3QP6 A;  2XGN A;  4OQ0 A;  5B32 G;  2P9V A;  2E8I A;  1YAX A;  3KSF A;  2A24 A;  3REL B;  3IF5 A;  4OQG A;  3HJI A;  1H3Q A;  3UT9 A;  3Q81 A;  2BYM A;  1KDS A;  3UPN A;  1XFN A;  5HX9 A;  4F94 A;  3SS4 A;  5GSU A;  1WWI A;  4X56 A;  4GLQ A;  5B2J D;  5E5A A;  3TE8 A;  4RYE A;  3JYI A;  1CQA A;  2ZBB A;  3REH D;  3HON A;  4H9S C;  4LG2 A;  1K38 A;  1PZP A;  1G28 A;  2LB9 A;  4QD4 A;  1AOI C;  4J8X C;  2XFS A;  1P3B B;  4I3I A;  4JLF A;  3V39 A;  2XFT A;  4H9O B;  4ESP A;  2ZMV A;  2XLN A;  3PBQ A;  2EX9 A;  2OLU A;  4Z1W A;  3AZJ B;  2JKF A;  4BQM A;  3G4P A;  1ZG6 A;  3NOP C;  4MNR A;  1G6O A;  3RFB A;  3MVD D;  3A6N D;  1KE4 A;  3O86 A;  1IEL A;  2ARO A;  4E6W A;  3NBL A;  1PW8 A;  1YKD A;  1QME A;  2V0W A;  4GDN A;  4CLC D;  1Y4O A;  4IJE A;  4G3W A;  2XK1 A;  1M18 D;  2PD8 A;  3FC7 A;  2V8F A;  3UTB C;  3AZH B;  1TDL A;  1K25 A;  4ETZ A;  3CI6 A;  3S4X A;  3AN2 A;  1P3M B;  3ZFZ A;  3KXB B;  4WU9 D;  2F8N K;  1P97 A;  1P3K B;  2W1R A;  5AVC B;  3Q1F A;  4GNU A;  3SS3 A;  5JRG C;  2KDK A;  4ZTK A;  1KDW A;  4K0X A;  3REI C;  3DW0 A;  2P04 A;  4J8U B;  3MQL A;  5KMW A;  3VSL A;  4MEZ A;  1SKO B;  3QP4 A;  3IHA A;  1W79 A;  4UHU A;  5M19 A;  1WYB A;  3KS8 A;  2ZM5 A;  3B0D C;  4XZQ D;  3AZK C;  1TS8 A;  3A0V A;  4OUI A;  1LSW A;  1OT6 A;  4LPZ A;  4NET A;  1P3I D;  3A1I A;  1KOU A;  3AZM A;  2VLG A;  2E8J A;  4I5S A;  3AZH C;  5GLB A;  2Y2I A;  4B93 A;  3M6B A;  3Q07 A;  5GHY A;  1W8Y A;  1M6K A;  4QJG A;  3AV1 B;  5AVB A;  2GJ3 A;  2L5A A;  4Z5T B;  4Z2L A;  3LEZ A;  3W98 A;  1S4S A;  3T4L A;  3B6G B;  3AZE D;  1NWZ A;  1Q9C A;  2CV5 A;  1H5X A;  5F99 D;  3KWQ A;  2ZQA A;  1OTI A;  3WKJ A;  4J8U C;  1EQZ D;  3FPW A;  1W63 Q;  4KQO A;  4X1L A;  3LJA D;  4DDY A;  2J3W A;  2HP6 A;  3PHY A;  2ZM8 A;  4R3B A;  2CMN A;  1E6Z A;  4KZB A;  3X1V D;  4J8W D;  3OPR A;  1D06 A;  5EOE A;  1RGZ A;  3HRE A;  3MGP C;  5B0Y B;  5EVI B;  5CP6 D;  3WAA D;  3AV1 C;  2PBY A;  4GKU A;  4LV0 A;  1KVL A;  2GZA A;  4EQ1 A;  1F66 B;  5IHV A;  1PZO A;  4GW9 A;  3B6G C;  1M40 A;  4Z2J A;  1W5D A;  5AV8 A;  1S6R A;  3S7P A;  3B42 A;  1GOI A;  5KDM B;  2HUE B;  2F8N H;  1P3P B;  5AQ9 A;  4DXC A;  4WLA A;  5AV9 D;  3HSH A;  2J9O A;  3F1O B;  2QPN A;  3JVV A;  3REK A;  4MN5 A;  2FJ7 B;  2PAV P;  3E98 A;  3IH8 A;  3L26 A;  4WV4 B;  3B6F C;  1K6S A;  2W3H A;  4QB8 A;  3LCE A;  1HQ3 B;  2K2N A;  3V67 A;  1TVF A;  3TG9 A;  2NUT C;  4KZ6 A;  5B0Y C;  3HJK A;  5EVI C;  3N8R A;  3LY3 A;  5B24 B;  3AFA D;  5L07 A;  3LEL A;  3REJ C;  1BLS A;  4LFU A;  4BLM A;  3C1B D;  1KX4 C;  4GD8 A;  2IWB A;  1E6P A;  4JGR A;  4CSR A;  3AZI A;  1ID3 A;  1S67 L;  2H5S A;  4HHD A;  4JF6 A;  1KX3 D;  1I2S A;  2IWC A;  3EEH A;  1S32 B;  1CI8 A;  4G92 C;  3AZN D;  3CPT B;  5CPJ A;  2XQZ A;  4R8P B;  5FUG B;  2K31 A;  1ODV A;  5KZH A;  5BS7 C;  3T1S A;  1H8Z A;  4IED A;  5KSC A;  3IP4 C;  3P7N A;  2VV7 A;  4M3K A;  5DNM B;  3NDE A;  3WTP A;  2ZY2 A;  5GT0 D;  1JTG A;  1LSX A;  1T18 A;  4JJN A;  3MGR D;  1FCO A;  1P3G B;  3TU4 B;  4DKI A;  4X68 A;  5B2I B;  1N1J A;  1R4V A;  3D72 A;  4OOM A;  5TGF A;  3MGS A;  1KX5 D;  5B31 A;  5L2F A;  1S32 C;  2PD7 A;  4R38 A;  3QP8 A;  2BTF P;  2GDN A;  1UWN X;  3VSK A;  4NZ3 A;  1NLY A;  2JKR I;  1YLW A;  2C6W B;  1YSP A;  3C30 A;  4I3J A;  5JA4 A;  5EV0 A;  4S2N A;  3LR4 A;  3MXQ A;  3NDG A;  4NXF A;  1CEG A;  5G49 A;  1W2E A;  3ZVW A;  1N9L A;  4EU0 A;  3NQJ B;  5FAQ A;  1N9N A;  3S7Q A;  4KZ4 A;  3O62 D;  3DAV A;  3BJN A;  4EBP A;  1GSX A;  3MKF A;  4WF0 A;  3WD0 A;  1P3O A;  5TBM A;  5B2J B;  3REH B;  1K57 C;  4KZ3 A;  3V3R A;  2ZOH A;  3CWF A;  3MS6 A;  1FIK A;  1LL8 A;  1NJ4 A;  4YNR A;  2Y2M A;  1S66 L;  4G91 B;  5BNX B;  3PBT A;  5B32 D;  4JGQ A;  2O9B A;  4O01 A;  3MVD B;  2QMI A;  4IBR A;  3BQA A;  3G30 A;  2Z6D A;  1PWC A;  4CLC B;  1Z09 A;  1GA9 A;  3O5Y A;  1M18 B;  5C3I B;  4IBC A;  3NI9 A;  4PKY G;  5GXQ C;  1OTB A;  1WE4 A;  2NUP C;  3UB9 A;  5B33 B;  1BZA A;  4UAA A;  4YWZ A;  5CPI D;  2O9C A;  2ZL1 B;  3REL A;  1T1B A;  4ZBJ C;  1G5U A;  1FOF A;  3PYP A;  2FH5 A;  2VGJ A;  1XJ6 A;  1HD8 A;  3LIF A;  2CWE A;  4DE1 A;  1AOI D;  1ONG A;  3D3O A;  4J8X D;  1K54 C;  1XP4 A;  1ZTU A;  1XJ2 A;  4E3L A;  2EFX A;  1ULY A;  4GCZ A;  4MBF A;  4KUD C;  2XA7 M;  1ZG4 A;  2R9W A;  5DF9 A;  4JXV A;  1P3F C;  1P3B A;  4HP4 A;  4RX3 A;  3KFU G;  3C7V A;  4H9O A;  2I72 A;  1P3I B;  2OAP 1;  3EQU A;  3L29 A;  5C3I C;  2Y2L A;  3T4K A;  3AZJ A;  1ESU A;  4L0L A;  5F82 A;  2G5I C;  5B33 C;  3RTY A;  2JKT M;  2H0Y A;  2B02 A;  2WAE A;  4R3J A;  3UTB D;  1HLU P;  1PNE A;  5HD5 A;  1P3L A;  4E3K A;  2XF3 A;  3AZE B;  2WKP A;  1E6N A;  1LI0 A;  1CJF A;  3M6H A;  1E8B A;  3AZH A;  3P98 A;  5F99 B;  3W8K A;  1EI5 A;  1YMS A;  4HI4 A;  5JRG D;  1EQZ B;  2HIO B;  3IWO A;  4HQA A;  5CED A;  1P3M A;  3F6T A;  3LJA B;  5FI7 A;  3REI D;  2BYK B;  3KXB A;  5HWT A;  2WAD A;  3NOT C;  1P3K A;  3QP2 A;  5BNV B;  5AVC A;  3LZ1 C;  3IXG A;  5FDH A;  3C1C C;  3X1V B;  5CPK C;  4J8W B;  4WMC A;  1U35 C;  3T4T A;  4CAY B;  5AY8 C;  1NYY A;  3MJQ A;  1FR6 A;  1ES4 A;  1ONH A;  3AZK D;  4J8U A;  2XEP A;  1B6W A;  1SKO A;  3BEB A;  3WAA B;  3MXR A;  3HVF A;  3BEC A;  4QU3 A;  4GHL A;  4X1M A;  1L0D A;  3AYW C;  5DKK A;  1L6J A;  1IYO A;  4WUJ A;  5CTM A;  2DF4 C;  3T50 A;  4HOI A;  1RCJ A;  2X01 A;  2HIO C;  3R7W B;  1KGE A;  1AWI A;  1VHM A;  3RXX A;  5B1M C;  2LY8 A;  4GS9 B;  1GA0 A;  3VP3 A;  4Z5T A;  5F69 A;  4J8W C;  3OPL A;  1PDC A;  4KHA B;  4I39 A;  1W1P A;  5G4Y A;  4C3Q A;  4OPQ A;  3S7O A;  5AVE A;  3LUQ A;  3AZG C;  4H9N B;  4OJ6 A;  4ARZ B;  2XH9 A;  3ZG5 A;  4E04 A;  3AFA B;  4PMA A;  3R45 B;  3BY8 A;  2QJ5 A;  3C1B B;  4E3O A;  3AZL D;  1BH9 B;  3MGP D;  1OT9 A;  3CLO A;  3AV1 D;  3QP1 A;  2Z6C A;  4O0P A;  5CXW A;  1V9Y A;  3PTE A;  3AZN B;  3B6G D;  4FCF A;  5B0Y A;  3W97 A;  5B40 B;  4OQI A;  1PW1 A;  3N8L A;  4Y13 A;  4OON A;  3E0Y A;  1F66 A;  5EFW A;  5DNN B;  1YLZ A;  3BRM A;  4BD1 A;  1H0I A;  4WJ3 C;  4PPR A;  1W1V A;  5DF7 A;  1Z6F A;  5CER A;  1SHV A;  2O0Y A;  5GT0 B;  1P3P A;  3B6F D;  3F1O A;  3KYQ A;  3MGR B;  3X1U A;  2PHY A;  1T19 A;  3A3F A;  3H82 B;  4UA7 A;  2FJ7 A;  2R78 A;  5D3O A;  4FH2 A;  2ZQ9 A;  5DJU A;  3KUY C;  4Y5F A;  5EVI D;  3AL0 C;  1HQ3 A;  4MDZ A;  3OPP A;  3REJ D;  1KX5 B;  2VGL M;  1KX4 D;  1YU1 A;  1S4R A;  3ITB A;  5DFY A;  3KX0 X;  4CPK A;  5B40 C;  2NZD C;  5B24 A;  2ZM0 A;  3KSH A;  2EWV A;  4LCM A;  1K6R A;  5HZH A;  1E15 A;  5DNN C;  4IJF A;  4E3M A;  1ERM A;  5AV6 C;  4B4Z A;  2Y2K A;  4FOF A;  5G18 A;  1X0O A;  3T1R A;  2WKE A;  5GHX A;  4HEF A;  3CPT A;  5FAS A;  1KE3 A;  3AGF A;  3NUL A;  4NE5 A;  4R8P A;  3SH7 A;  5FUG A;  3UNW A;  3BFE A;  3O88 A;  1K0K A;  3T12 B;  1P34 C;  4NG2 A;  3MGQ C;  1E4D A;  4HGA B;  3N4I A;  4HNB A;  5HL1 A;  5DNM A;  3X1S C;  5B0Z C;  2XR0 A;  4XUX A;  5GHZ A;  3UY6 A;  3LIC A;  3AZF C;  5AV5 C;  2YFW B;  1JVJ A;  3K3D A;  1P3G A;  1AXB A;  3TU4 A;  4NY2 A;  5B32 B;  2A49 A;  2VKS A;  1S32 D;  5B2I A;  3N3F A;  1L2S A;  2UWX A;  4MN6 A;  1XA1 A;  1ZC2 A;  2Y8H A;  5CGX A;  1KGF A;  4PM5 A;  3H7W B;  1M19 C;  3TW8 A;  2WGI A;  5J4E A;  2XRN A;  2NQB C;  3JPU A;  4IBI A;  2ZY5 A;  3VH6 W;  4XUJ C;  3FWL A;  5CPI B;  1CEF A;  5F1F A;  4GHI B;  2PU4 A;  1E3U D;  2G2W A;  5CHM A;  1PRQ A;  2ZMA A;  5CTN A;  1GHI A;  3GRJ A;  3NQJ A;  3T4O A;  2RCX A;  4HIA A;  4YM6 B;  1W8Q A;  4F3L A;  3Q7V B;  1H3O B;  5EVE A;  1AOI B;  1DJA A;  4J8X B;  5B2J A;  3HBR A;  3B0B A;  1P3A D;  4EET B;  4KGC C;  3REH A;  1N9B A;  3GTC A;  3B0C W;  1IYS A;  3IH9 A;  3IXH A;  5DTS A;  2ZMF A;  2LB5 A;  2YKF A;  4Q0I A;  1MWT A;  1NY0 A;  4P87 A;  1MKM A;  1BTL A;  5BNX A;  1YSQ A;  1J9M A;  3UTA C;  3HLC A;  1MZU A;  4S2K A;  3EEA A;  1UWP X;  5CPI C;  3A6N A;  3MVD A;  1YQS A;  3UTB B;  5GXQ D;  3K2N A;  1D1J A;  3HUN A;  4CLC A;  4DJ2 A;  2ZC7 A;  3C38 A;  4PHT A;  5DF8 A;  4YM6 C;  1M18 A;  1K55 C;  4NEE D;  5AVF A;  3FV7 A;  5JRG B;  4IBD A;  1A7W A;  3PAE A;  5M1A A;  2ZL1 A;  1W1T A;  3REI B;  1SZV A;  3CJM A;  4WU9 A;  4WU8 B;  4Y0T A;  2J80 A;  2RIQ A;  3EGD C;  4IBK A;  4DN0 A;  4KUD D;  1SDE A;  3KYZ A;  1MWU A;  3T4S A;  4JF5 A;  3B0D B;  4Z2M H;  3WA9 C;  1P3F D;  2W0N A;  3AZK B;  3A3E A;  1DJB A;  3MQQ A;  4YFM A;  4LCL A;  2D02 A;  3PBS A;  4XZQ A;  5B33 D;  1OTE A;  1KVM A;  1XXM A;  1P3I A;  3BW6 A;  1U60 A;  5FSR A;  2F8N G;  5A90 A;  4E3I A;  2AVX A;  4R1G A;  4E3N A;  3TJZ C;  4Z2H A;  4WU8 C;  2WKR A;  4PM6 A;  4UA6 A;  1DY6 A;  4DXB A;  4QLC C;  3V5M A;  1KS0 A;  2ZC4 B;  3C2W A;  4EXO A;  4R3A A;  1H8Y A;  3AZE A;  1RGY A;  2QZ6 A;  3ISG A;  4DQY B;  1EW0 A;  1T3U A;  5F99 A;  5CX7 A;  2F2A C;  3MFD A;  3F1P B;  3LZ1 D;  1EQZ A;  5EUA A;  3C1C D;  3VFF A;  5CPK D;  3UB7 A;  4ZUX B;  3LJA A;  3EG5 B;  3CUE C;  1U35 D;  2V5O A;  2BYK A;  1FSY A;  5AY8 D;  4PM7 A;  3W96 B;  5BNV A;  3W4P A;  3AZL B;  3X1V A;  1XPB A;  3MGP B;  4J8W A;  3UE0 A;  4CAY A;  3MFX A;  4Y15 A;  2WYX A;  3AYW D;  3B33 A;  1S1Z A;  5CP6 A;  3WAA A;  1SCW A;  4GHA A;  4GZB A;  3U4L P;  1RP5 A;  4KZ8 A;  3OBF A;  2HIO D;  4LRY C;  3DTK A;  3IF6 C;  1YU3 A;  5B1M D;  2KOI A;  3NC8 A;  4Y0U A;  3W99 C;  3E4P A;  3MNN C;  3R7W A;  1H8P A;  3B6F B;  5AV9 A;  3VOY A;  4ZUX C;  4Z2K A;  4GS9 A;  4DE0 A;  4EES A;  3MSH A;  3W96 C;  5B1L B;  4IVI A;  4WN5 A;  4KZ5 A;  5A8B A;  3P01 A;  1MBL A;  3AZG D;  1Z2C B;  3AZL C;  1FQG A;  4DDS A;  2DCF A;  4KHA A;  3REJ B;  1KX4 B;  3WS1 A;  4H9N A;  4EEU A;  3CMZ A;  4ARZ A;  3AFA A;  3R45 A;  2HP5 A;  1VEU B;  3C1B A;  3LO7 A;  4G92 B;  3VP1 A;  1BH9 A;  2XA7 S;  2L4R A;  1XGJ A;  3GSG A;  2V0U A;  1KX3 A;  3MQO A;  5GLA A;  4GD6 A;  3AZN A;  3L9K A;  3V9R A;  1IFQ A;  4JGP A;  5A93 A;  4OPR A;  1GSW A;  4OOY A;  5B1L C;  3P5J B;  4MCW A;  2ZQ8 A;  5AQ7 A;  1DP9 A;  5FQQ A;  1JWZ A;  4HY8 A;  4OP5 A;  3RXW A;  4J8V C;  4X25 A;  3WRZ A;  5GT0 A;  4RQ9 A;  3KUY D;  3W4O A;  4H9P B;  4JKT A;  5FAT A;  3MGR A;  2W3D A;  3H82 A;  4X53 A;  1ZLA C;  2JE5 A;  2BAS A;  4UUZ B;  4Z66 C;  3X1T C;  2ZQ7 A;  5F6A A;  3LZ0 C;  3WRT A;  5B40 D;  3GQZ A;  3ZNY A;  2NZD D;  2UV0 E;  4D2O A;  1IOU A;  4WYY A;  2QHK A;  3B3X A;  2Y2H A;  1KX5 A;  1MC0 A;  5DNN D;  3SOI A;  5AV6 D;  3H0R C;  2RVQ C;  2OV5 A;  2JHE A;  3NY4 A;  4UQI M;  5CEB A;  5IS1 A;  4LD9 C;  1JWP A;  4BJP A;  4X6T A;  5FQI A;  1P34 D;  5TFQ A;  3MGQ D;  3ZYT A; 
#chains in the Genus database with same CATH homology
 2V2F F;  3HL9 A;  2Z2L B;  3O62 A;  5CRF A;  3ZGA B;  3X1S D;  5B0Z D;  3ITA A;  3AZF D;  1P3A B;  5AV5 D;  3VH6 T;  3AZI D;  2ZQC A;  4WZ5 C;  1QMF A;  3C4P A;  1M1A C;  2YFW A;  5CGS A;  5B32 A;  2DRW A;  1JFI B;  4WBG A;  1M19 D;  3UN7 A;  1MKI A;  4OH0 A;  3FDD A;  2NQB D;  3KS4 A;  3S22 A;  4IBE A;  5GXQ B;  2ZC5 B;  4WNN B;  4XUJ D;  1O7E A;  3S1Y A;  4ZBJ B;  3EPK A;  3ZG0 A;  3AV2 C;  1P3A C;  2EX2 A;  5BPV A;  3O3V A;  4NYY A;  3FYZ A;  1PI5 A;  2V1Z A;  4KUD B;  4KGC D;  4H9S A;  4WEJ A;  3HLF A;  1LL5 A;  3Q7V A;  1H3O A;  1AOI A;  4J8X A;  1P3F B;  3WS2 A;  3V50 A;  1S0W A;  2WK0 A;  3TOI A;  5GT3 C;  3UTA D;  1FR1 A;  3OCL A;  3OPH A;  5GL9 A;  4ID4 A;  4JXW A;  3Q82 A;  3PBO A;  4IVK A;  3O87 A;  2HDR A;  3UDF A;  1IKI A;  1NZO A;  2IO5 C;  4YM6 D;  4YIN A;  2Y2N A;  4R0Q A;  4X23 C;  3H0M C;  3UTB A;  3BM6 A;  4WZS B;  4O7D A;  3NQU B;  2PU2 A;  4KQR A;  1TZY C;  5CHL B;  4DRT A;  2G2U A;  4P0M A;  5JRG A;  3LZ1 B;  3E2K A;  4UA9 A;  3C1C B;  3ZVT A;  5CPK B;  1U35 B;  3REI A;  5AY8 B;  4DE2 A;  3WA9 D;  2PYO D;  3LY4 A;  4U0T A;  3UT9 C;  4R23 A;  2F8N D;  2J7V A;  3AZK A;  3AYW B;  4RA7 A;  5GSU C;  2Y2G A;  4LV1 A;  4JXG A;  5E5A C;  2EX8 A;  1K4F A;  5E2H A;  1PWD A;  3A3J A;  5B1M B;  4WU8 D;  4JBF A;  4QLC D;  3EPL A;  4NYU A;  4YS3 D;  2ARO C;  3BFC A;  4WM9 A;  3AZG B;  4OOL A;  4EWF A;  4E44 A;  2J8Y A;  5JYO A;  2XDM A;  4S2J A;  4MBK A;  3AN2 C;  4GB7 A;  1YLT A;  2WKI A;  3AZL A;  3MGP A;  3AV1 A;  3MZE A;  3AGD A;  3WS0 A;  3B6G A;  2ZD8 A;  1YM1 A;  1L0F A;  3W99 D;  2WZX A;  4EQI A;  3MNN D;  1ZKJ A;  4ZUX D;  5FQM A;  3FZC A;  3W96 D;  3AZM C;  3AGE A;  3KUY B;  3B6F A;  3GV9 A;  4EO5 C;  1NXY A;  2ZM2 A;  5AVB C;  4AWL B;  4Y0O A;  4NE3 A;  5EVI A;  3DWZ A;  3W98 C;  2NZD B;  1PIO A;  3REJ A;  1NZU A;  1KX4 A;  5BO0 B;  5FI6 A;  2CV5 C;  5AV6 B;  3KWQ C;  3HLD A;  3WKJ C;  1WYC A;  5KDM A;  1KE0 A;  1CK3 A;  4FD8 A;  2ZY4 A;  5BS7 A;  5B1L D;  2Y4A A;  1P34 B;  1IEM A;  2JC7 A;  5KSH A;  3MGQ B;  3HLG A;  1XKZ A;  1ESI A;  5HAR A;  3NCK A;  3X1S B;  4J8V D;  1Q2P A;  5B0Z B;  1Y54 A;  4AWL C;  3IWQ A;  2WGW B;  3LEL B;  3AZF B;  1CI9 A;  3G34 A;  5AV5 B;  4OJP A;  1ZLA D;  1HZO A;  3AZI B;  1ID3 B;  1BUL A;  5AV8 C;  4Z66 D;  3X1T D;  4OLD A;  4ZJ2 A;  2BLS A;  3LZ0 D;  4H9P A;  1I5Q A;  1O07 A;  5HAQ A;  5CPJ B;  4UUZ A;  3REK C;  1S32 A;  3UO9 A;  1M19 B;  2XD1 A;  2RVQ D;  5E2G A;  4QHC A;  2EFU A;  2NQB B;  3FKE A;  1L0E A;  1BLP A;  3VOZ A;  1PYY A;  4LD9 D;  4XUJ B;  5GLC A;  2FFY A;  3GMW A;  4R4R A;  3LEL C;  4EBN A;  4GDB A;  1N4O A;  4FH4 A;  1W7F A;  1N1J B;  3AZI C;  1ID3 C;  1E3U A;  3BFD A;  1ES3 A;  2Y59 A;  4JF4 A;  3SH8 A;  4KGC B;  1K57 A;  2X71 A;  3UE3 A;  4Z2M G;  5CPJ C;  4KZA A;  4KQQ A;  2JCH A;  4OJO A;  3ZG9 B;  5DTK A;  4P85 A;  3MZF A;  1P3A A;  4QNL A;  2Y2J A;  1M1A D;  4LV3 A;  4ZJ3 A;  2Y2O A;  3UTA B;  4E6X A;  1IYQ A;  3WTP C;  1XA7 A;  4C6Y A;  4JJN C;  3C7U A;  1JFI A;  1HTZ A;  3GVB A;  4K91 A;  4BL2 A;  5GXQ A;  3AV2 D;  3MGS C;  4WNN A;  4HES A;  5B31 C;  1K56 D;  4ZAM A;  3VFH A;  2Q9N A;  5B31 G;  3UDX A;  2A3U A;  3A3D A;  3A3I A;  3WA9 B;  1K54 A;  2PYO B;  4GH9 A;  4S2N C;  4S2O A;  3M2K A;  4KUD A;  3IXD A;  5GT3 D;  3G2Y A;  3RJU A;  3L2A A;  2F8N B;  1P3F A;  1BFM A;  5U47 A;  1KU5 A;  4KEN B;  2OLV A;  3EPJ A;  1P3O C;  4NZ1 A;  5HFO A;  5HAI A;  2ZQD A;  5B33 A;  1YU4 A;  2J9P A;  3D4F A;  3VH5 W;  3L25 A;  5CGW A;  4X23 D;  3PBR A;  1DJC A;  3I7J A;  4KZ7 A;  5F1G A;  4QLC B;  3IWI A;  1TZY D;  4E45 A;  4YS3 B;  2PYO C;  3NQU A;  5E2E A;  1YU0 A;  1TAF B;  3LZ1 A;  4E3J A;  3C1C A;  5CPK A;  1K4E A;  3UT9 D;  2Y91 A;  4OP8 A;  1U35 A;  5AY8 A;  3FKW A;  3C5A A;  3REL C;  1IYP A;  5GSU D;  5HAP A;  5E5A D;  1P3L B;  3AYW A;  3TSG A;  3ZCZ A;  5EEC A;  3IF6 B;  3GR2 A;  4YS3 C;  3W99 B;  3MNN B;  2HIO A;  5CEC A;  4N1H A;  1P3B C;  2X02 A;  5B1M A;  4Q8I A;  1BLH A;  1SKF A;  2BG1 A;  1LHY A;  4DE3 A;  5I94 A;  2ARO D;  3UE1 A;  3AZJ C;  2EX6 A;  3FKV A;  5EOO A;  3AZG A;  3ZHH A;  1ES5 A;  1P3L C;  3IXB A;  3AN2 D;  2J8P A;  1MWS A;  2OSU A;  1GHM A;  5BOH A;  1PZR A;  3WTP E;  2R9X A;  3VP4 A;  2RL3 A;  1G6A A;  3MBZ A;  4KG6 A;  1P3M C;  3KXB C;  4QY5 A;  1P3K C;  5AVC C;  2IOU A;  4U3T A;  4ZDX A;  4NE6 A;  4NZ5 A;  4J8V B;  2YFV B;  3AZM D;  3BYD A;  1WWS A;  1G68 A;  1SDN A;  3MXS A;  1ZLA B;  3EPH A;  1YLP A;  2DNS A;  4Z66 B;  5AVB D;  3X1T B;  3KUY A;  2C5W B;  4Z9Q A;  3LZ0 B;  2HPB A;  3W98 D;  3W97 B;  1VQQ A;  2EXA A;  4S2I A;  3SH9 A;  2CV5 D;  4IBG A;  3OZH A;  4RX2 A;  5FAP A;  5FQJ A;  5BT1 C;  3HLE A;  4Z5T C;  1PI4 A;  3KWQ D;  1BT5 A;  3VMA A;  5B40 A;  3WKJ D;  2NZD A;  4OKP A;  5DTT A;  5BO0 A;  5DNN A;  1EWZ A;  5AV6 A;  4LD9 B;  4DRB A;  3CZD A;  4N1X A;  5HW3 A;  1ERQ A;  1I2W A;  3PBN A;  4H9R B;  3X1U B;  1MXO A;  4H9Q B;  3IHB A;  1P34 A;  3MGQ A;  2VQR A;  3X1S A;  5B0Z A;  3W97 C;  5AV8 D;  2WGW A;  3G32 A;  2JBF A;  2Y2Q A;  3AZF A;  1F66 C;  1M1A B;  4ZJ1 A;  5AV5 A;  5GLD A;  2ZC6 B;  3A1K A;  4GN2 A;  4BEN A;  3REK D;  2HUE C;  4EUZ A;  1P3P C;  4M6B A;  2ZC3 B;  3X1U C;  4EBL A;  1M19 A;  2FJ7 C;  3HUO A;  2NQB A;  4OVD A;  3ZDJ A;  1HQ3 C;  3AV2 B;  5A92 A;  3LEL D;  4XUJ A;  3N8S A;  1ID3 D;  5B24 C;  1TDG A;  2P74 A;  1YT4 A;  1GHP A;  2WKH A;  2HDU A;  3PAG A;  3VH6 A;  5CPJ D;  4WEK A;  3ZG7 B;  2HDQ A;  1YMX A;  5M18 A;  3G35 A;  4KGC A;  3M2J A;  5GT3 B;  1PWG A;  3BFF A;  3QHY A;  4R8P C;  3G2Z A;  5FQ9 A;  4DRA A;  3WTP D;  2EXB A;  5AQB A;  3B0C T;  2G5H C;  3UTA A;  4JJN D;  3BLS A;  5DNM C;  3N7W A;  4RVA A;  1LL9 A;  2IO5 B;  5CPI A;  5CHJ A;  3HLB A;  4X23 B;  1KGG A;  4PM9 A;  3MGS D;  5FI2 A;  1P3G C;  5B31 D;  3TU4 C;  4YM6 A;  5B2I C;  4X69 A;  1TZY B;  1BH8 B;  4OPZ A;  3MZD A;  1K55 A;  2XD5 A;  2JSS A;  2P9V B;  4B88 A;  3VP0 A;  3L28 A;  3ZG8 B;  1TEM A;  4H8R A;  3BFG A;  3G31 A;  3VH5 T;  4XXR A;  5TR7 A;  3UT9 B;  4MBH A;  2BYM B;  1BLC A;  3A6N B;  3WA9 A;  3MKE A;  2PYO A;  4FSF A;  4EV4 A;  5J8X A;  5GSU B;  3VH5 A;  1YU2 A;  1P3O D;  1MWR A;  3P09 A;  5E5A B;  2H10 A;  4B4X A;  4BD0 A;  4R4S A;  2F8N A;  1MY8 A;  2ZY3 A;  3BLM A;  5FA7 A;  2WZZ A;  5B2J C;  1B67 A;  1E25 A;  3UPO A;  3REH C;  4S2P A;  4WU9 B;  1F1E A;  4G91 C;  4WU8 A;  4Y7P A;  4QLC A;  2ARO B;  3QNB A;  5EPH A;  4UPK A;  1IKG A;  4YS3 A;  4ZBE A;  3A6N C;  3MVD C;  2HP9 A;  4XZQ B;  2Y55 A;  3V3S A;  1TAF A;  3AN2 B;  1NRF A;  3L27 A;  3REL D;  1M18 C;  2WGV A;  2V20 A;  1L0G A;  3WWX A;  4XUZ A;  4WU9 C;  5FQK A;  4S2L A;  4HBT A;  3UPP A;  4OPY A;  1XGI A;  2Y2P A;  1Q2Q A;  3E2L A;  4KG2 A;  1P3B D;  3IF6 A;  2DQN C;  3W99 A;  3AZM B;  4N9L A;  3KSY A;  3MNN A;  4EO5 B;  3AZJ D;  4ZUX A;  4XZQ C;  3NIA A;  4OLG A;  4PM8 A;  1P3I C;  3W96 A;  5AVB B;  3EQV A;  5AQA A;  3W98 B;  1LLB A;  4IBF A;  1P3L D;  4C75 A;  5CP6 B;  2CV5 B;  4N9K A;  4DF6 A;  3AZH D;  1XX2 A;  3KWQ B;  3WKJ B;  2Z2M B;  3UDI A;  1P3M D;  3AZE C;  3KXB D;  3DTM A;  2FFF B;  5F99 C;  1P3K D;  3HLW A;  4HBU A;  5JYP A;  5AVC D;  1MPL A;  5CHU A;  3H0L C;  1EQZ C;  2CC1 A;  2ZLY A;  5AV9 B;  4WEL A;  1FCN A;  3LJA C;  4NFT A;  4WMC D;  4X55 A;  4CJN A;  3QNC A;  4J8U D;  3C4O A;  4U0X A;  3X1V C;  4IBB A;  4NZ4 A;  5B1L A;  5E43 A;  1ES2 A;  3VP2 A;  4J8V A;  2YFV A;  3WAA C;  5AV8 B;  5CP6 C;  4S2M A;  1HVB A;  1ALQ A;  1C3B A;  5E2F A;  1ZLA A;  2HDS A;  4Z66 A;  3X1T A;  1LI9 A;  3REK B;  4WZ4 A;  5DVA A;  5BT1 D;  1VM1 A;  1KX3 B;  3LZ0 A;  4Z5T D;  5FAO A;  5EE8 A;  5AV9 C;  3Q7Z A;  3V9R B;  2W8S A;  3IQA A;  2IWD A;  3IT9 A;  1FSW A;  4KZ9 A;  4IBJ A;  1JTD A;  3WX7 A;  4LD9 A;  1BSG A;  4BL3 A;  3W4Q A;  3HUM A;  4JPM A;  4CSR B;  4H9R A;  3AFA C;  4JXS A;  3C1B C;  4MLL A;  5B0Y D;  3W97 D;  2Q9M A;  4H9Q A;  1YLY A;  1KX3 C;  1F66 D;  3AZN C;  4WZ5 A;  1JWV A;  3WTP B;  1M1A A;  1P3P D;  2ZJ9 A;  3ZNT A;  4A5R A;  4JJN B;  1HTA A;  3X1U D;  3CG5 A;  2FJ7 D;  4QY6 A;  5GT0 C;  2WUQ A;  3MGR C;  1HQ3 D;  3O62 B;  3MGS B;  5B31 B;  5B24 D;  3AV2 A;  1KX5 C;  4P6B A;  4OJ5 A;  1K56 A;  5F83 A;  1YLJ A;  4GOG A;  2VGK A;  3WS5 A;  1OME A;  5JA4 B;  1YUE A;  5G49 B;  1NYM A;  4LEN A;  4R8P D;  1ERO A;  3SS5 A;  3OCN A;  1P3O B;  5GT3 A;  4K0W A;  3O62 C;  2B5R A;  4KG5 A;  5DNM D;  4N92 A;  5A91 A;  1BUE A;  2H0T A;  4HGA C;  4IBX A;  1P3G D;  3TU4 D;  4OQH A;  5B2I D;  1FCM A;  4X23 A;  3N6I A;  3DWK A;  5EVL A;  4NK3 A;  4LV2 A;  3OC2 A;  5B32 C;  4OJL A;  1TZY A;  1GCE A;  1BH8 A;  3WS4 A;  2WAF A;  2XGN A;  4OQ0 A;  5B32 G;  2P9V A;  2E8I A;  3REL B;  3IF5 A;  4OQG A;  3UT9 A;  3Q81 A;  2BYM A;  1KDS A;  3UPN A;  5HX9 A;  4F94 A;  3SS4 A;  5GSU A;  1WWI A;  4X56 A;  5B2J D;  5E5A A;  4RYE A;  3JYI A;  3REH D;  3HON A;  4H9S C;  4LG2 A;  1K38 A;  1PZP A;  4QD4 A;  1AOI C;  4J8X C;  2XFS A;  1P3B B;  4JLF A;  3V39 A;  2XFT A;  4H9O B;  2XLN A;  3PBQ A;  2OLU A;  2EX9 A;  3AZJ B;  4BQM A;  3G4P A;  1ZG6 A;  4MNR A;  3MVD D;  3A6N D;  1KE4 A;  3O86 A;  1IEL A;  2ARO A;  4E6W A;  3NBL A;  1PW8 A;  1QME A;  4GDN A;  4IJE A;  2XK1 A;  1M18 D;  3UTB C;  3AZH B;  1TDL A;  1K25 A;  3S4X A;  3AN2 A;  1P3M B;  3ZFZ A;  3KXB B;  4WU9 D;  2F8N K;  1P3K B;  5AVC B;  3Q1F A;  4GNU A;  3SS3 A;  5JRG C;  4ZTK A;  1KDW A;  4K0X A;  3REI C;  3DW0 A;  4J8U B;  5KMW A;  3VSL A;  4MEZ A;  3IHA A;  1W79 A;  4UHU A;  5M19 A;  1WYB A;  3KS8 A;  2ZM5 A;  3B0D C;  4XZQ D;  3AZK C;  4OUI A;  4NET A;  1P3I D;  3A1I A;  3AZM A;  5GLB A;  3AZH C;  2Y2I A;  3M6B A;  3Q07 A;  5GHY A;  1W8Y A;  1M6K A;  4QJG A;  3AV1 B;  5AVB A;  2L5A A;  4Z5T B;  3LEZ A;  3W98 A;  3B6G B;  3AZE D;  1Q9C A;  2CV5 A;  1H5X A;  5F99 D;  3KWQ A;  2ZQA A;  3WKJ A;  4J8U C;  1EQZ D;  4KQO A;  3LJA D;  4DDY A;  2HP6 A;  2ZM8 A;  4R3B A;  4KZB A;  3X1V D;  4J8W D;  3OPR A;  5EOE A;  1RGZ A;  3HRE A;  3MGP C;  5B0Y B;  5EVI B;  5CP6 D;  3WAA D;  3AV1 C;  2PBY A;  4GKU A;  4LV0 A;  1KVL A;  1F66 B;  5IHV A;  1PZO A;  3B6G C;  1M40 A;  1W5D A;  5AV8 A;  1S6R A;  5KDM B;  2HUE B;  2F8N H;  1P3P B;  5AQ9 A;  4DXC A;  5AV9 D;  3HSH A;  2J9O A;  2QPN A;  3REK A;  2FJ7 B;  3IH8 A;  3L26 A;  4WV4 B;  3B6F C;  1K6S A;  4QB8 A;  3LCE A;  1HQ3 B;  1TVF A;  3TG9 A;  4KZ6 A;  5B0Y C;  5EVI C;  3N8R A;  3LY3 A;  5B24 B;  3AFA D;  3LEL A;  3REJ C;  1BLS A;  4BLM A;  3C1B D;  1KX4 C;  4GD8 A;  2IWB A;  4CSR A;  3AZI A;  1ID3 A;  2H5S A;  4JF6 A;  1KX3 D;  1I2S A;  2IWC A;  1S32 B;  1CI8 A;  4G92 C;  3AZN D;  5CPJ A;  2XQZ A;  4R8P B;  5FUG B;  5KZH A;  5BS7 C;  1H8Z A;  4IED A;  5KSC A;  3IP4 C;  4M3K A;  5DNM B;  3NDE A;  3WTP A;  2ZY2 A;  5GT0 D;  1JTG A;  4JJN A;  3MGR D;  1FCO A;  1P3G B;  3TU4 B;  4DKI A;  4X68 A;  5B2I B;  1N1J A;  1R4V A;  4OOM A;  5TGF A;  3MGS A;  1KX5 D;  5B31 A;  5L2F A;  1S32 C;  2GDN A;  3VSK A;  4NZ3 A;  1YLW A;  2C6W B;  5JA4 A;  4S2N A;  3NDG A;  3ZVW A;  1CEG A;  5G49 A;  1W2E A;  3NQJ B;  5FAQ A;  4KZ4 A;  3O62 D;  4EBP A;  3MKF A;  1P3O A;  5B2J B;  3REH B;  1K57 C;  4KZ3 A;  3V3R A;  1NJ4 A;  2Y2M A;  4G91 B;  5BNX B;  3PBT A;  5B32 D;  3MVD B;  2QMI A;  4IBR A;  3G30 A;  1PWC A;  1GA9 A;  1M18 B;  5C3I B;  4IBC A;  3NI9 A;  5GXQ C;  1WE4 A;  5B33 B;  1BZA A;  4UAA A;  5CPI D;  3REL A;  4ZBJ C;  1FOF A;  2VGJ A;  1HD8 A;  2CWE A;  4DE1 A;  1AOI D;  1ONG A;  4J8X D;  1K54 C;  1XP4 A;  4E3L A;  2EFX A;  1ULY A;  4MBF A;  4KUD C;  1ZG4 A;  2R9W A;  5DF9 A;  4JXV A;  1P3F C;  1P3B A;  4RX3 A;  3KFU G;  3C7V A;  4H9O A;  2I72 A;  1P3I B;  3EQU A;  3L29 A;  5C3I C;  2Y2L A;  3AZJ A;  1ESU A;  4L0L A;  5F82 A;  2G5I C;  5B33 C;  2H0Y A;  2WAE A;  4R3J A;  3UTB D;  1P3L A;  4E3K A;  2XF3 A;  3AZE B;  1LI0 A;  3M6H A;  3P98 A;  3W8K A;  3AZH A;  5F99 B;  1EI5 A;  1YMS A;  5JRG D;  3IWO A;  1EQZ B;  2HIO B;  5CED A;  1P3M A;  3F6T A;  3LJA B;  5FI7 A;  3REI D;  2BYK B;  3KXB A;  2WAD A;  1P3K A;  5BNV B;  5AVC A;  3LZ1 C;  3IXG A;  5FDH A;  3C1C C;  3X1V B;  5CPK C;  4J8W B;  4WMC A;  1U35 C;  4CAY B;  5AY8 C;  1NYY A;  1FR6 A;  1ES4 A;  1ONH A;  3AZK D;  4J8U A;  2XEP A;  1B6W A;  3BEB A;  3WAA B;  3MXR A;  3HVF A;  3BEC A;  4QU3 A;  4GHL A;  1L0D A;  3AYW C;  1IYO A;  5CTM A;  2DF4 C;  1RCJ A;  2X01 A;  2HIO C;  1KGE A;  3RXX A;  5B1M C;  2LY8 A;  1GA0 A;  3VP3 A;  4Z5T A;  4J8W C;  3OPL A;  4KHA B;  4C3Q A;  4OPQ A;  3AZG C;  4H9N B;  4OJ6 A;  2XH9 A;  3ZG5 A;  3AFA B;  4PMA A;  3R45 B;  3C1B B;  4E3O A;  3AZL D;  1BH9 B;  3MGP D;  3AV1 D;  5CXW A;  3PTE A;  3AZN B;  3B6G D;  4FCF A;  5B0Y A;  3W97 A;  5B40 B;  4OQI A;  1PW1 A;  3N8L A;  4OON A;  1F66 A;  5DNN B;  1YLZ A;  3BRM A;  4BD1 A;  4WJ3 C;  4PPR A;  5DF7 A;  1Z6F A;  5CER A;  1SHV A;  5GT0 B;  1P3P A;  3B6F D;  3MGR B;  3X1U A;  3A3F A;  4UA7 A;  2FJ7 A;  5D3O A;  4FH2 A;  2ZQ9 A;  3KUY C;  5EVI D;  3AL0 C;  1HQ3 A;  3OPP A;  3REJ D;  1KX5 B;  1KX4 D;  1YU1 A;  3ITB A;  4CPK A;  5B40 C;  2NZD C;  5B24 A;  2ZM0 A;  4LCM A;  1K6R A;  5DNN C;  4IJF A;  4E3M A;  1ERM A;  5AV6 C;  4B4Z A;  2Y2K A;  5G18 A;  2WKE A;  5GHX A;  4HEF A;  5FAS A;  1KE3 A;  3AGF A;  4NE5 A;  4R8P A;  3SH7 A;  5FUG A;  3UNW A;  3BFE A;  3O88 A;  1P34 C;  3MGQ C;  1E4D A;  4HGA B;  3N4I A;  5HL1 A;  5DNM A;  3X1S C;  5B0Z C;  2XR0 A;  4XUX A;  5GHZ A;  3UY6 A;  3AZF C;  5AV5 C;  2YFW B;  1JVJ A;  1P3G A;  1AXB A;  3TU4 A;  4NY2 A;  5B32 B;  2A49 A;  1S32 D;  5B2I A;  3N3F A;  1L2S A;  2UWX A;  1XA1 A;  1ZC2 A;  5CGX A;  1KGF A;  4PM5 A;  1M19 C;  2WGI A;  2NQB C;  4IBI A;  2ZY5 A;  3VH6 W;  4XUJ C;  3FWL A;  5CPI B;  1CEF A;  5F1F A;  2PU4 A;  1E3U D;  2G2W A;  5CHM A;  2ZMA A;  5CTN A;  1GHI A;  3GRJ A;  3NQJ A;  2RCX A;  4YM6 B;  1W8Q A;  3Q7V B;  1H3O B;  1AOI B;  1DJA A;  4J8X B;  5B2J A;  3HBR A;  3B0B A;  1P3A D;  4KGC C;  3REH A;  1N9B A;  3GTC A;  3B0C W;  1IYS A;  3IH9 A;  3IXH A;  5DTS A;  1MWT A;  1NY0 A;  4P87 A;  1BTL A;  5BNX A;  1J9M A;  3UTA C;  3HLC A;  4S2K A;  5CPI C;  3A6N A;  3MVD A;  1YQS A;  3UTB B;  5GXQ D;  3HUN A;  2ZC7 A;  5DF8 A;  4YM6 C;  1M18 A;  1K55 C;  3FV7 A;  5JRG B;  4IBD A;  1A7W A;  3PAE A;  5M1A A;  3REI B;  3CJM A;  4Y0T A;  4WU9 A;  4WU8 B;  2RIQ A;  4IBK A;  4KUD D;  1SDE A;  1MWU A;  4JF5 A;  3B0D B;  4Z2M H;  3WA9 C;  1P3F D;  3AZK B;  3A3E A;  1DJB A;  4YFM A;  4LCL A;  3PBS A;  4XZQ A;  5B33 D;  1KVM A;  1XXM A;  1P3I A;  5FSR A;  1U60 A;  2F8N G;  5A90 A;  4E3I A;  4R1G A;  4E3N A;  4WU8 C;  4PM6 A;  4UA6 A;  1DY6 A;  4DXB A;  4QLC C;  3V5M A;  2ZC4 B;  1H8Y A;  3AZE A;  1RGY A;  2QZ6 A;  3ISG A;  4DQY B;  1T3U A;  5F99 A;  2F2A C;  3MFD A;  3LZ1 D;  1EQZ A;  5EUA A;  3C1C D;  3VFF A;  5CPK D;  4ZUX B;  3LJA A;  3EG5 B;  1U35 D;  2BYK A;  1FSY A;  5AY8 D;  4PM7 A;  3W96 B;  5BNV A;  3W4P A;  3AZL B;  3X1V A;  1XPB A;  3MGP B;  4J8W A;  3UE0 A;  4CAY A;  2WYX A;  3AYW D;  5CP6 A;  3WAA A;  1SCW A;  4GHA A;  4GZB A;  1RP5 A;  4KZ8 A;  2HIO D;  3IF6 C;  1YU3 A;  5B1M D;  3NC8 A;  4Y0U A;  3W99 C;  3MNN C;  3B6F B;  5AV9 A;  3VOY A;  4ZUX C;  4DE0 A;  3W96 C;  5B1L B;  4IVI A;  4KZ5 A;  1MBL A;  3AZG D;  1Z2C B;  3AZL C;  1FQG A;  4DDS A;  2DCF A;  4KHA A;  3REJ B;  1KX4 B;  3WS1 A;  4H9N A;  3CMZ A;  3AFA A;  3R45 A;  2HP5 A;  3C1B A;  3LO7 A;  4G92 B;  3VP1 A;  1BH9 A;  1XGJ A;  3GSG A;  1KX3 A;  5GLA A;  4GD6 A;  3AZN A;  3V9R A;  5A93 A;  4OPR A;  4OOY A;  5B1L C;  3P5J B;  2ZQ8 A;  5AQ7 A;  5FQQ A;  1JWZ A;  4OP5 A;  3RXW A;  4J8V C;  3WRZ A;  5GT0 A;  3KUY D;  3W4O A;  4H9P B;  4JKT A;  5FAT A;  3MGR A;  4X53 A;  1ZLA C;  2JE5 A;  4UUZ B;  4Z66 C;  3X1T C;  2ZQ7 A;  3LZ0 C;  3WRT A;  5B40 D;  3GQZ A;  3ZNY A;  2NZD D;  4D2O A;  4WYY A;  3B3X A;  2Y2H A;  1KX5 A;  5DNN D;  3SOI A;  5AV6 D;  3H0R C;  2RVQ C;  2OV5 A;  3NY4 A;  5CEB A;  4LD9 C;  1JWP A;  4BJP A;  4X6T A;  5FQI A;  1P34 D;  5TFQ A;  3MGQ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...