2Y2QA

Penicillin-binding protein 1b (pbp-1b) in complex with an alkyl boronate (z06)
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
489
structure length
469
Chain Sequence
ISEITYSDGTVIASIDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTGQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PENICILLIN-BINDING PROTEIN 1B
publication title Structure-Guided Design of Cell Wall Biosynthesis Inhibitors that Overcome Beta-Lactam Resistance in Staphylococcus Aureus (Mrsa).
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
total genus 164
structure length 469
sequence length 489
chains with identical sequence B
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2y2qA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2y2qA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2y2qA02
3PBTA 3G30A 1LI9A 1YLYA 3SS3A 4QJGA 3ITBA 4DXCA 1I2WA 2P74A 1M6KA 2Q9MA 4WZ5C 4E6XA 3RXXA 4GOGA 1MKIA 5CEBA 2XFTA 4S2JA 4MBFA 4S2IA 2Y55A 3ZG0A 4WYYA 4UA9A 1BTLA 1PW8A 2XH9A 5FSRA 4OOYA 2XD5A 1TEMA 3IF5A 4ZJ1A 3DWKA 4UAAA 2V1ZA 2J8YA 3ZDJA 4N92A 4OVDA 4GN2A 4WZ5A 5M19A 2I72A 1BLPA 1ESIA 2RL3A 4KZ4A 4MLLA 3HLBA 2H10A 3NC8A 4S2LA 4U0XA 5GLDA 1G6AA 4PM9A 3VP4A 1TDGA 3TG9A 2A49A 4WM9A 2ZQ8A 3CMZA 1CI9A 3HUMA 1BSGA 5HARA 4OQ0A 5EVIC 1H8ZA 1K4FA 5DF9A 5JYOA 5FAQA 4X69A 3C4PA 1GHMA 2QPNA 4U3TA 2WZXA 1PZPA 3O86A 2C6WB 3Q7VB 1ES3A 1DJAA 4L0LA 5E43A 4BD1A 2Y2OA 4PM6A 2HDRA 3AGDA 5FQ9A 2DCFA 5TR7A 3WS2A 4EBLA 5M1AA 1G68A 3NDGA 1QMEA 5CTMA 4DE1A 3VSKA 4WEKA 3ZHHA 4JLFA 4WMCD 5FQIA 5GHXA 4JF6A 4P0MA 4Y0TA 3VP0A 1E3UA 1ES5A 3DW0A 3M2JA 2WZZA 4S2KA 3HVFA 3IH8A 4E3NA 4BL2A 1IKIA 2Y2MA 3PBRA 4OPQA 1SHVA 2XF3A 1KVLA 4OP8A 4QB8A 1KE3A 1S6RA 2E8IA 2HPBA 3A3EA 1K55C 4LENA 4OQIA 2H5SA 4DKIA 5CHMA 1YQSA 3MKFA 4RX3A 1ES2A 3E2LA 1I5QA 2ZMAA 1L0DA 4GD8A 3N8SA 3OZHA 5F82A 3B3XA 5EOOA 3ZG9B 4KZ8A 1CK3A 1LL5A 1W7FA 1VM1A 3ITAA 1FR1A 1K56D 1HD8A 1YLTA 4BL3A 1GHPA 3A3DA 5CTNA 3HL9A 3WRTA 2R9WA 3P09A 5GLAA 1K55A 4P85A 5E2HA 5A90A 3C4OA 1N9BA 3P98A 4X56A 2OLUA 1NJ4A 1O7EA 2Y2IA 3ZG7B 2Q9NA 3GTCA 5CECA 2Y2GA 5CHUA 4P87A 1MWUA 3GR2A 4KZ3A 1W79A 4KZ7A 5FDHA 4YINA 1XA1A 3ZCZA 1PWCA 4KG5A 4PMAA 4U0TA 1O07A 3HBRA 3BFDA 5EVLA 1KE4A 3NIAA 4DRTA 4IVKA 1FCOA 3GRJA 2ZQ9A 5EUAA 1FSWA 2Y59A 3HUNA 1Q2QA 3BLSA 3NI9A 1IELA 4N9LA 5EVIB 3TOIA 3QNBA 1SDEA 1YMSA 3IF6C 5F1GA 5FI7A 4C75A 2ZC6B 3C7UA 1KGGA 3M6BA 1ONHA 1ESUA 1FOFA 4ZDXA 4S2OA 1GHIA 1TVFA 3V5MA 4N9KA 1ZKJA 2ZD8A 4KENB 4S2MA 4FH2A 4LV2A 3UNWA 1Z6FA 1XXMA 2A3UA 3WS5A 4QY6A 3IF6A 4Y0UA 2HDQA 2WKEA 1S0WA 1YLWA 5F83A 4OKPA 1U60A 1NY0A 3NCKA 4KZBA 3GMWA 3MZFA 4FSFA 4OQGA 4E3OA 3QHYA 4WMCA 1OMEA 1XGIA 1YLPA 1BLSA 4B4XA 1NYMA 3HLEA 3NY4A 4JKTA 3IWOA 2Z2MB 4O7DA 4GDBA 4OPYA 3ZG8B 3V3SA 1NXYA 1WE4A 4GZBA 4Y7PA 4JBFA 4WEJA 3ZVWA 2WGWA 3DWZA 5FAOA 3O88A 2DNSA 3ZFZA 3VOYA 3VFFA 3SOIA 3M6HA 2HP5A 3FWLA 5AQ7A 3N8LA 3UPOA 4ZBEA 2WK0A 1FCMA 1SDNA 1BLCA 4OQHA 4PPRA 4LV0A 5U47A 1MBLA 3UE1A 5KSHA 1K56A 3IQAA 4KG2A 3G34A 4OOMA 3PBQA 4R23A 5GLCA 2J9PA 5FASA 5HAPA 2XGNA 4C3QA 4BJPA 1YT4A 1XGJA 3RJUA 1FSYA 1YLZA 5IHVA 5CXWA 2XFSA 3G32A 1K6RA 3ZNYA 4N1HA 2DRWA 3HUOA 1YM1A 3FKVA 5GHYA 2HP6A 3IXHA 2ZM8A 3Q07A 2Y2LA 4MNRA 1L0EA 3UO9A 5DTSA 4JXWA 1YMXA 3OPRA 4GNUA 4RX2A 4K0XA 1CI8A 1H5XA 2EXAA 2WAFA 4R4SA 3NBLA 4HESA 5J8XA 1RGYA 1ALQA 1PW1A 2WKIA 1K6SA 4FCFA 1PI5A 3VFHA 4QY5A 4UA7A 3W8KA 4QHCA 3OC2A 1K25A 1PIOA 2IWBA 1W5DA 4Y0OA 4PM5A 2EX8A 5FQMA 2PU4A 3HREA 4X53A 4FD8A 4ZAMA 3GV9A 1CEFA 3NDEA 3UN7A 4S2PA 1AXBA 5L2FA 3BEBA 4EBNA 3AGEA 4X6TA 2WGVA 2G2WA 2WGWB 4UA6A 3OPHA 3GQZA 1ONGA 3UE0A 3PBOA 3O3VA 4JF5A 1HZOA 4E3LA 1K54C 5FA7A 3ZG5A 3N8RA 1DJCA 1L0GA 5FQJA 2CC1A 2VGKA 4RA7A 1VQQA 1JTDA 4M3KA 3HLWA 1N4OA 2BLSA 1KGEA 1SCWA 2HDUA 5AQAA 1E25A 4KQOA 2ZC4B 3PAEA 3Q82A 2IWDA 3ZVTA 1CEGA 2XLNA 5FATA 2B5RA 3Q1FA 1PWDA 1EI5A 5GLBA 1GA0A 1K54A 2Y2JA 3GVBA 5TFQA 3W4OA 1KDSA 3FKWA 1L0FA 1JVJA 1C3BA 2ZLYA 3LO7A 4JPMA 5CGSA 3SS4A 4C6YA 5KSCA 3PBNA 3VP3A 1ES4A 1H8YA 3W4PA 3EQUA 5FI2A 4K0WA 2UWXA 4DE3A 4R3JA 4KZ6A 3VP2A 4X55A 5F1FA 4X68A 1ZG4A 4E3JA 2XDMA 2ZC3B 4GD6A 3VP1A 4B4ZA 5CHJA 1DJBA 5KZHA 1KE0A 4WBGA 3BLMA 5HL1A 3G4PA 4JXGA 5DF8A 3JYIA 1PZOA 1LHYA 5HAIA 3IHBA 3LY4A 4DE2A 2VGJA 2ZQ7A 4BD0A 3SH9A 4MEZA 1JTGA 1GA9A 2EXBA 1MWRA 3O87A 1EROA 2ZQDA 1MWTA 4KG6A 5AQ9A 4OH0A 3WS4A 4EBPA 4XXRA 4F94A 1RP5A 1IYQA 5BOHA 4BQMA 1YLJA 4PM8A 3IWIA 2QZ6A 1NRFA 3VMAA 4JXSA 3M2KA 3OCNA 3UPPA 4DDYA 4E3IA 5CGXA 2X02A 4JXVA 2IWCA 5EVID 2P9VA 5EOEA 5M18A 3GSGA 3ZNTA 1L2SA 4GKUA 3MZDA 1I2SA 1LI0A 2XK1A 2ZQCA 2Z2LB 3TSGA 4DE0A 4OOLA 4CPKA 4R1GA 5JYPA 4R4RA 3VOZA 4Q8IA 2Y2QA 2J7VA 4EQIA 4R3BA 5A92A 2WADA 3A3JA 1K38A 1XA7A 1FCNA 3A3IA 3BFEA 5HFOA 5HW3A 5E2EA 2Y2NA 2JE5A 4B88A 3UE3A 1WYBA 3BFGA 4GB7A 2X71A 2WYXA 3V3RA 3BFCA 2V2FF 3S22A 1KGFA 2WUQA 3UDFA 1MXOA 3SH7A 2OSUA 2ZC5B 1Q2PA 4HBTA 1BUEA 4MBKA 2X01A 4WZ4A 1K57C 4LV1A 3N4IA 1ZG6A 4H8RA 4KZ5A 2ZM2A 3A3FA 1LLBA 5I94A 3AGFA 5EE8A 2RCXA 5HX9A 3UDIA 3UY6A 4EUZA 2FFFB 3PAGA 1XPBA 2Y2PA 3BECA 3LY3A 4DF6A 2PBYA 3IHAA 3LEZA 4ID4A 2ZJ9A 1KDWA 3MKEA 4GDNA 1K57A 2EX9A 4PM7A 2GDNA 2OLVA 2H0TA 5DTKA 3IF6B 2PU2A 5HAQA 5A93A 1K4EA 4KQRA 1IYSA 3WS0A 3MBZA 2OV5A 2P9VB 2H0YA 5DF7A 4EWFA 1XKZA 2WGIA 1ERQA 1EWZA 3CZDA 3BYDA 4YFMA 4CJNA 3N7WA 4DDSA 4QU3A 1XX2A 4OP5A 3DTMA 3WWXA 3BFFA 2BG1A 3IWQA 4QD4A 2EX2A 4S2NC 3SH8A 4IBXA 2ZM0A 5CGWA 3PTEA 3HLDA 3S4XA 3W4QA 1ZC2A 4E3KA 1IKGA 3OPPA 2Y4AA 4RYEA 1HTZA 5EVIA 4LCMA 3MZEA 1HVBA 3WS1A 1FQGA 3UPNA 2WKHA 3IT9A 5CRFA 1FR6A 4E6WA 3BM6A 4ZTKA 3C7VA 5E2FA 4S2NA 3ISGA 3Q81A 3V39A 1J9MA 3HLFA 2FFYA 1XP4A 2G2UA 5FI6A 3EQVA 4NK3A 4OONA 4K91A 1KVMA 5FQQA 5GL9A 3C5AA 3PBSA 1SKFA 5DTTA 1PI4A 3IXBA 1BULA 1W8YA 1IYPA 4IBRA 4XUXA 3G35A 5EECA 3FZCA 1BT5A 1JWZA 4OLGA 5CEDA 3IXGA 1RGZA 3MXRA 1BLHA 2J9OA 4XUZA 5D3OA 1LL9A 2JBFA 2JC7A 1ERMA 4R0QA 4IEDA 3SS5A 1PYYA 1E4DA 4ZJ2A 4RVAA 3WRZA 1Y54A 1MPLA 2Y91A 4LCLA 5FAPA 3V50A 4BLMA 3FYZA 4LV3A 4A5RA 4ZJ3A 5KMWA 3Q7ZA 1RCJA 3LCEA 3MFDA 4WELA 2EFUA 4MBHA 4HEFA 3HLGA 3MXSA 2HDSA 3FV7A 3I7JA 3CG5A 4FH4A 1QMFA 3G31A 3N6IA 4P6BA 1M40A 3HLCA 2Y2KA 1NZUA 2XR0A 4EV4A 4OLDA 1WYCA 2WAEA 3BRMA 4KQQA 2HP9A 1DY6A 3QNCA 1MWSA 4D2OA 4E3MA 3VSLA 2V20A 1PWGA 2QMIA 5AQBA 5DVAA 3OCLA 3ZGAB 2C5WB 1NZOA 2ZQAA 1BZAA 4NETA 4OPRA 4OPZA 1MY8A 4DXBA 1IYOA 4UHUA 2XQZA 1W8QA 5FQKA 5TGFA 2JCHA 2Y2HA 1JWVA 1GCEA 3D4FA 3OPLA 3CJMA 4JF4A 2ZC7A 3E2KA 4BENA 5EPHA 1E3UD 4HBUA 5E2GA 1IEMA 4KZ9A 3G2YA 3IH9A 5G18A 5GHZA 1JWPA 3UDXA 3G2ZA 1TDLA 4KZAA 4N1XA 2XEPA 2R9XA 3RXWA 3IXDA 3Q7VA 2XD1A 4Z9QA 3S1YA 2EX6A 5CERA 2EFXA 4IVIA 1NYYA 5A91A
chains in the Genus database with same CATH superfamily
3KSIA 1LI9A 1YLYA 3W99C 4LGWA 1YU4A 4GOGA 2YKHA 5E5AC 5CEBA 4S2JA 4MBFA 2BYMB 3X1TC 1P3KC 4UA9A 5FL3A 4Z5TC 5BNVB 4H9OA 3KWQD 3IF5A 1N9OA 2V1ZA 3HJIA 5B33C 1LL8A 4N92A 4RQ9A 4WZ5A 3FC7A 4CLCC 1Y28A 4KZ4A 2W3HA 3HLBA 2H10A 4S2LA 4PM9A 4IBKA 3WTPD 3A1KA 3HUMA 5B24D 1MKMA 4OQ0A 5LBRA 1OJ5A 3O62B 3EPKA 4MB3A 5JA4A 3KXBC 4Y3IA 4U3TA 2WZXA 3LIFA 1PZPA 1DJAA 4GHIA 2Y2OA 4DJ3A 3TJZC 1TZYC 2HDRA 4EBLA 4HP9A 1QMEA 4OJPA 4JLFA 4WMCD 4JF6A 3AZKC 3VP0A 1E3UA 5AVCB 4L9FA 4S2KA 3HVFA 5GSUD 3AZHC 4E3NA 4BL2A 1S4SA 4H9PB 4OPQA 1SHVA 1M19C 4OP8A 2PYOC 3B6GB 4QB8A 1KE3A 2O9AA 1P3MA 2Q0OA 5K5BA 1H8MA 4QLCD 4MCWA 3E2LA 4R38A 4GD8A 3LZ1C 2PR6A 1VETA 5FUGB 3B3XA 4KZ8A 1CK3A 1YLTA 3A3DA 5CTNA 3HL9A 3WRTA 4HOIA 3NHQA 4P85A 3FPWA 5A90A 1N9BA 2OLUA 2VLGA 1U35D 3N3FA 4Z2MH 2F8ND 1NLYA 4J8UC 4GW9A 3AZLD 4YINA 4IJEA 1XA1A 5AY8C 3W97B 3NECA 1L3LA 1LSVA 3MVDD 5EVLA 3AN2B 3WTPA 3AZNC 1Q2QA 3BLSA 1BH8A 1OTEA 3NI9A 3QP1A 5C5KA 5B24A 3E4PA 2FZ0A 4WN5A 3BY8A 4C75A 1XJ6A 4ZDXA 4DRBA 5G49A 1M18D 2ZD8A 2AROC 4KENB 2A3UA 1ODVA 5B40C 5B31D 3REKD 4QY6A 1YLWA 2E8JA 3AZFC 3MZFA 4R70A 3QHYA 4WMCA 1OMEA 5B0ZB 2J3TC 5GSUA 3NY4A 4JKTA 2CV5B 3V3SA 1NXYA 3A6NB 4GZBA 3ZVWA 4JBFA 2WKQA 4WNNA 4J8XD 3B0DC 4LG2A 3ZFZA 4QLCA 3EPHA 1P3LB 3MGRC 3N8LA 4ZBEA 1FCMA 1BLCA 4Z2KA 3IQAA 4UQIM 4EEPA 1K0KA 4BJPA 1YT4A 3T4JA 4DN0A 4N1HA 1U35A 3LIAA 3NOPC 2F8NA 3SZTA 3MQOA 2HP6A 3IXHA 4KUKA 3AZLA 3WD4A 3Q07A 4G92C 4MNRA 3UO9A 3FDDA 3MVDA 5DFYA 4JXWA 4RX2A 3CUEA 1CI8A 2EXAA 4R4SA 4G3WA 3REHC 2B95A 1P3AB 4QHCA 4WLAA 3OC2A 3R45A 2IWBA 1P3FB 1M18A 4FD8A 1T1CA 4H9QB 5L2FA 3LR5A 3BEBA 3AGEA 1YSQA 5B31A 3REKA 2WGVA 2WGWB 1GSWA 4CSRB 3OPHA 3MNNC 3GECA 4OUIA 1K54C 3IBRA 3KWQC 2CC1A 3W99B 5HDDA 2BLSA 1SCWA 1P3OB 1E25A 4KQOA 1PRQA 2ZC4B 3C30A 3X1TB 1P3KB 1KX5B 3OOVA 3X1VC 4Z5TB 2Y2JA 4FTXA 3UMDA 4D60A 3B6GD 2ZLYA 3LO7A 4MN6A 3EPJA 5CGSA 5B33B 3VP3A 4JGPA 3W4PA 2OAQ1 5GT3D 4KZ6A 3VP2A 4IUKA 2ZMFA 3R7WB 2XDMA 2ZC3B 5AV9D 2BYMA 2GZAA 3DBAA 5HAIA 1BYWA 5BNVA 4EO5C 1YUEA 3KXBB 4G91B 4I3IA 4BD0A 1JTGA 3K2NA 2ZMVA 2EXBA 4KG6A 1MWTA 3CAXA 5GSUC 5FEGA 3WS4A 3W97D 4XXRA 4F94A 1IYQA 5J4EA 3AN2D 4BQMA 1YLJA 4PM8A 3VMAA 4WV4B 4JXSA 4GCZA 1YPRA 3AZKB 1W63M 2XRNA 3AZHB 4GKUA 3MZDA 4Q0IA 2YFVB 1BH9B 4R4RA 2BASA 4CLCE 2P7JA 4R3BA 3LZ1B 5A92A 1U35C 1XA7A 5HW3A 4JGRA 2EWVA 3BFGA 3AZLC 2WYXA 2X71A 5BT1D 3MQQA 2V2FF 4OJ6A 3UDFA 2YKFA 3MVDC 2V8CA 2CV5D 3NULA 4HBTA 4H9PA 1E6RA 3C2WA 3IX4A 3A6ND 1N9NA 3B6GA 2J8PA 3EEAA 1M1AB 4HJ3A 1P3LD 5AY8B 4O0PA 5CPIB 3PAGA 5FUGA 5GT3A 2UV0E 2QKPA 3UTAB 3LY3A 1W1YA 5DNMB 3VH6A 4WU8C 2GDNA 5AV9A 1HLUP 3KO6A 5A93A 5B31C 3REKC 4KHAB 4KQRA 3TU4C 2QJ7A 3MBZA 4YOFA 4EWFA 1XKZA 1ERQA 3LUQA 4R3AA 4YFMA 2AROB 5B32C 5B40B 3BFFA 2BG1A 3W97A 3AN2A 1W1PA 3AZFB 2ZM0A 2K7SA 4J8XC 4E3KA 3K3DA 1S32D 1KX3C 3MZEA 1OGGA 2BYKB 4NZ1A 4E45A 1P3AD 4ZTKA 4S2NA 1P3FD 3V39A 3C1CB 1XP4A 5FI6A 1DRMA 3PR6A 2HUEC 3MGRB 3PBSA 1SKFA 1IYPA 3G35A 3FZCA 3H82B 5CEDA 4ARZB 4M4XA 4XUZA 1LL9A 5B1MB 2JBFA 3IX3A 2JC7A 3ULFA 3W99D 3LR3A 4R0QA 5B0YC 4LRYC 4H9SA 1E4DA 4ZJ2A 2CV5A 3WRZA 5E5AD 3A6NA 2V9AA 3Q7ZA 3X1TD 1P3KD 1KX5D 3LCEA 4Z5TD 1P3LA 4FH4A 3G31A 5B33D 1FIKA 2PD7A 4ETZA 3T4LA 3UB7A 2LB9A 3O62C 1OTDA 2WAEA 3BRMA 1DY6A 3WD2A 3VSLA 4EQ1A 2V20A 2MJ6A 3S7NA 3L9KA 5CPKC 2FJ7B 4OPRA 4EETB 4DXBA 2O99A 2XQZA 3L26A 2GJ3A 1GCEA 5TBMA 1H3OB 4KQDA 3KXBD 2V0UA 5E2GA 1IEMA 4KZ9A 3MNNB 3IH9A 5GHZA 3UDXA 5AVCC 3G2ZA 1TDLA 2QHKA 5BO0B 3F1OB 2R9XA 3G6OA 2YFWB 2XD1A 1VEUB 3KSHA 1S32A 4R8PC 2W1TB 1P3AA 2XA7S 2CMNA 3AZKD 1P3FA 5F69A 4QJGA 3ITBA 5DJUA 3AZHD 1B67A 1I2WA 1MC0A 3PYPA 2G5IC 2ZM5A 5F68A 4Z66C 1M19D 3LIDA 1MKIA 3MQLA 2XFTA 4S2IA 4H6JA 3ZG0A 4CSRA 4WYYA 3MGQB 3T4TA 3AZIB 3LZ1D 1TEMA 1MZUA 3DWKA 4WF0A 3W99A 4ESPA 2J8YA 1P3IB 3ZDJA 2VKSA 1ESIA 5E5AA 3KX0X 4EXOA 1G6AA 3X1TA 1P3KA 1KX5A 1J7MA 4Z5TA 2A49A 3CMZA 1CI9A 3B6FB 4J8UD 1BSGA 3LR4A 3WX7A 2HGVA 5B33A 4NXEA 1M1AD 4NFTA 5B2JC 4MDZA 5AY8D 4X69A 5CPID 2L1MA 3KSFA 3UTAD 2QPNA 3AZND 5DNMD 3AZEC 4IBCA 3Q7VB 1FILA 1XJ4A 3AGDA 5HDCA 3WTPE 3AFAB 1G68A 3UT9B 5CTMA 3MR0A 3KXBA 5FQIA 1VHMA 3A1IA 5GHXA 4Y0TA 2JKRI 4J8WC 2AROD 1E6PA 3IH8A 5B0ZC 5B40D 2CV5C 1KVLA 1V9YA 4HGAC 1P3BC 3IS2B 4OQIA 3AZFD 3AZMB 4GHLA 4RX3A 5B1LB 1OGBA 3S7PA 2JHEA 2ZMAA 3AZKA 1L0DA 3MQ0A 3P01A 3OZHA 2J3TD 4LPZA 5F82A 3U4LP 3ZG9B 3AZHA 2G7UA 5EFWA 1LL5A 1V9ZA 4E44A 1FR1A 1M19A 2PYOA 3P09A 1BH9A 4PAUA 1UGUA 3C4OA 1TS0A 3O5YA 3P98A 2V1BA 3LZ1A 3MGRD 3ZG7B 2Q9NA 3C1BC 1MWUA 5DKKA 1N9LA 4FUWA 3V9RA 4KZ3A 1W79A 4KZ7A 4WU8B 4NKPA 3ZCZA 3AZJC 3KFUG 1PWCA 2HJ9C 4KG5A 4PMAA 3TE8A 2V5OA 3NIAA 3T1RA 5IS1A 3GRJA 5EUAA 3TU4B 1FSWA 5AV5C 4EERA 5EVIB 3NQUB 1SDEA 4J8UA 3IF6C 2WKPA 2VGLS 5F1GA 3M6BA 1M1AA 5B32B 1TS8A 5AY8A 5CPIA 1FOFA 3L27A 3UTAA 4YS3B 4Z2JA 2DQNC 1O6IA 1GHIA 3AZNA 3UMEA 4N9KA 3V5MA 5IT5A 4S2MA 1GOIA 3WS5A 1KX3B 4Y0UA 3S7OA 3REHD 3NCKA 2PAVP 4OQGA 3RTYA 4G3KA 3GDIA 2AROA 1S67L 1NYMA 3HLEA 1UWPX 2HUEB 4O7DA 5B40A 3W96C 3FKEA 1P3OC 4Y7PA 2ZOIA 3MNND 3AZFA 2DNSA 3O88A 1KX5C 3RELB 5GT0B 5AV6B 3X1SB 4P6ZM 4IBFA 3MS6A 2BYKA 5B0YB 1SDNA 4PPRA 5U47A 3UE1A 5DNNB 3S7QA 4OOMA 2J9PA 5HAPA 3X1VD 4NXBA 5EVEA 1XGJA 1YLZA 5MC7A 2XFSA 5CPJB 1K6RA 3ZNYA 3MGRA 2HJEA 3FKVA 3MGQD 2ZBBA 2ZM8A 3H82A 1KOUA 3AZID 2OOLA 4I5SA 4I3AA 3AV1C 4G91C 1P3ID 1YMXA 4IBGA 2JKFA 4IJFA 3IBJA 1H5XA 3NBLA 5CPKB 5J8XA 4YM6B 1HQ3C 1PW1A 2WKIA 1K6SA 4FCFA 3W8KA 1PIOA 5GXQB 1W5DA 5EV0A 3HREA 4X53A 1P9RA 4ZAMA 3GV9A 1CEFA 1XJ2A 4EBNA 1P3GC 4X6TA 2RVQC 2V0WA 2LY8A 3REHA 4R8PB 1ONGA 1Z2CB 3N8RA 1L0GA 3AV2C 3F1NB 4RA7A 1VQQA 3B47A 3T4KA 2ZOHA 3AFAD 4Z66B 1H3OA 3PAEA 2XLNA 2IA2A 4CAYB 1JNUA 3MNNA 1PWDA 1AIWA 5BO0A 3F1OA 1K54A 2CWEA 5GLBA 5TFQA 2YFWA 1L0FA 1JVJA 1VEUA 3KWQA 3W98C 4JPMA 4ETXA 5KSCA 3FPVA 4C6YA 2H28A 1F66C 2W1TA 5B1LD 4DRAA 1M1AC 1EAKA 2PBDP 5CPIC 3UTBB 3X1VA 5F1FA 1ZG4A 3UTAC 5DNMC 3NJAA 2INWA 5KZHA 3LJAB 1LSWA 1XFQA 3G4PA 5DF8A 3MGQA 5B2JB 1LHYA 4NY2A 1L6JA 3AZIA 3SH9A 3MSHA 1P3IA 2ZY5A 2VV7A 3WKJB 3AZEB 1MWRA 4WU8D 4IHQA 4HP4A 3C38A 5BOHA 5AVBC 3VH6T 3MGPB 3UPPA 3TU4D 3EGDC 4E3IA 5EM0A 2X02A 5C3IB 3QP2A 2IWCA 2D49A 5EVID 3GSGA 3ZNTA 4J8WB 1LT0A 2P08A 2VK3A 5B32D 2RTSA 3WAAC 2Z2LB 3TSGA 4CPKA 4R1GA 4HGAB 5JYPA 1P3BB 4Z1WA 4R6LA 4HJ4A 3VH6W 3C1CC 2JKTI 3B0CT 2J7VA 4WU9B 1KX3D 3TRCA 4NXFA 5CHLB 3A3JA 3A3IA 3BFEA 5HFOA 2JE5A 1E6NA 3F1PB 3L2AA 3CLOA 5FDSA 4GB7A 4QNLA 3NQJB 3V3RA 5B1MC 1MXOA 1JFIB 1F9IA 3B0CW 3C1BB 1K57C 4MB5A 3N4IA 3IS2A 4EW7A 1ZG6A 3T1XA 4NE3A 4KZ5A 5B1LA 5AV6D 3X1SD 3AZJB 3UY6A 3K3CA 4UEYA 2DMWA 1XPBA 5B0YD 5DNND 5AV5B 4J8VB 3LEZA 4ID4A 5B2IC 3ZQ5A 4PM7A 4LLOB 2OLVA 1KX4C 2H0TA 3IF6B 5JRGC 1IOUA 1N1JB 1IYSA 3WS0A 5CPJD 2P9VB 2H0YA 4IBEA 5DF7A 2FJ7C 2O0YA 3N7WA 3O62D 2KX6A 4QU3A 4WU8A 3X1UB 3DTMA 1T19A 2EX2A 4IBXA 5CGWA 3TU4A 3PTEA 3KSGA 5CPKD 1IKGA 4RYEA 5EVIA 3TW8A 1FQGA 1OTIA 3UPNA 4LD9B 2WKHA 3IT9A 5B32A 2R78A 5DKLA 3BM6A 3W96B 1E6ZA 3DTEA 2FFYA 4UPKA 5AVCD 4J8XA 3D72A 4PKYG 3EQVA 4NK3A 1ZTUA 1KVMA 5GL9A 3C5AA 1KX3A 5DTTA 3HJKA 1PI4A 4IBRA 4R8PD 1CF0A 3IXGA 3MXRA 3MGQC 1EW0A 2J9OA 5I5LA 4HY8A 5G4ZA 5D3OA 3AZIC 3T4QA 2Y79A 1ERMA 1P3IC 4Z66D 1MPLA 3F6TA 5FAPA 3V50A 4BLMA 4A5RA 3REJC 1YU2A 1OPXA 1RCJA 4OJLA 3MFDA 1YKDA 4WELA 4MBHA 5AV6A 3X1SA 2HDSA 3I7JA 4II7A 3CG5A 3AV1B 5B0YA 3B6FC 1A0KA 5DNNA 5BS7C 2XR0A 4EV4A 4Z2HA 2Y8HA 4HJ6A 1HQ3B 3AYWC 3UTBD 4D2OA 5DFXA 1PWGA 3EWKA 4Y2FA 5DVAA 5CPJA 4KUOA 2OWJA 3OCLA 4QPRA 2ZQAA 4OPZA 1ID3C 1MY8A 5FQKA 5B2JD 2JCHA 3O62A 2PYRA 4MMNA 1GSXA 1P3GB 3AFAC 3UT9C 4YNRA 4KGCC 3VOLA 5G18A 3AZED 1Q9CA 1JWPA 3V67A 3PHYA 4N1XA 3RXWA 4X25A 5CPKA 3IXDA 2W8SA 4Z9QA 3AV2B 3S1YA 3H0LC 2EX6A 3MGPD 3EOIA 4IVIA 4QWOA 1NYYA 4ME4A 3AZMC 3PBTA 5B1LC 3G30A 3SS3A 4J8WD 4DXCA 5B0ZD 5AVCA 1Y4OA 2P74A 4E6XA 3RXXA 3W98B 3A0RA 1P3BD 1S1YA 3W2ZA 4R8PA 1F66B 2Y55A 3EGXC 4YWZA 1BTLA 2XH9A 4OOYA 2JKGA 4ZUXB 4UAAA 4Y17A 3F1NA 1X0OA 2ZL1B 3NOTC 3H0MC 4OVDA 4Z66A 1BLPA 2RL3A 3NC8A 4WUJA 5F5YA 3T12B 1HTAA 1TDGA 3D9YA 3TG9A 2NZDC 2ZQ8A 4UUZB 3C1BD 1WA9A 4WM9A 5HARA 5EVIC 5IU1A 5JYOA 3AZJD 5FAQA 5AVBB 2W1RA 4MB4A 3UTBA 3C4PA 5KIZA 2Z6DA 1UR9A 1G28A 5AV5D 4YS3C 3KUYC 4J8VD 3O86A 2C6WB 1GXDA 4L0LA 5E43A 4PM6A 4BWIA 4HH3A 3WS2A 5TR7A 2DCFA 5B2JA 3WAAB 3NDGA 1TS7A 1P3PC 3VSKA 3HSHA 5DJTA 2VJWA 1P97A 1ES5A 3KYZA 3M2JA 2WZZA 4JGOA 3AZEA 3BQ8A 2Y2MA 1F5MA 3LICA 3PBRA 2XF3A 4HMDA 2E8IA 1S6RA 2O9BA 1OTAA 3A3EA 1K55C 1YQSA 3MKFA 4H9OB 1UR8A 3RELC 1AWIA 5GT0C 5AV6C 3X1SC 4J8WA 5B0ZA 3ITAA 1W7FA 3D3OA 4BL3A 5DNNC 3W96D 1GHPA 1P3OD 3P7NA 1P3BA 5GLAA 4GHAA 4H9NB 5HPFA 1OJGA 4XT2B 3CWFA 1NJ4A 5CPJC 4BBUA 2Y2GA 1TF1A 4P87A 1D7EA 3GR2A 5B2IB 5JA4B 3ICYA 3F1PA 1KX4B 5BNXB 4U0TA 5JRGB 4DRTA 1KE4A 4IVKA 1FCOA 2Y59A 4IBIA 3DTIA 4EESA 3C1BA 5A8BA 1YMSA 4YM6C 2J80A 5FI7A 3C7UA 1KGGA 4F3LB 3AZJA 1ONHA 1ED7A 1ESUA 1W2EA 4PHTA 3AV1D 5GXQC 3AZGC 1PZRA 4S2OA 1TVFA 5CP6B 5AV5A 4J8VA 1ZKJA 3UNWA 1HQ3D 3MGSC 3IF6A 2F8NG 1S0WA 5F83A 1P3MB 2EA9A 1N1JA 4KZBA 3GMWA 5EM1A 4L9EA 1PDCA 4I3JA 4H9QA 1P3GD 3ZG8B 2RVQD 1WE4A 4WEJA 1ZLAB 2HIOC 2WGWA 5FAOA 1DP9A 4GS9B 2IO5C 5HZHA 3SOIA 3LZ0B 3AV2D 3M6HA 4NE6A 4HQAA 3UPOA 2WK0A 4OQHA 4LV0A 1MBLA 3VH5A 4DMZA 4Z2GA 2VA0A 3W96A 4R23A 1P3OA 3PBQA 4IUHA 5FASA 3REJB 4LRXC 3UTBC 4H9RB 1KS0A 1FSYA 3FG8A 4GLQA 3UE6A 3VV4A 2XROA 1BH8B 3W98D 2DRWA 5B24B 3LI8A 3REIC 3HUOA 3LELC 1YM1A 5GHYA 1F66D 3LJAC 4KUDC 2NUPC 1L0EA 4UQIS 3AYWB 1YAXA 1T1AA 5DTSA 4X1MA 3R7WA 3WKJC 1ID3B 4HESA 2VQRA 1RGYA 2B18A 3VE4A 4QY5A 1S4RA 4UA7A 3MGPC 3CHWP 5C3IC 4Y0OA 4KGCB 2EX8A 4HMCA 3AV1A 5FQMA 1R4VA 3NDEA 3UN7A 1AXBA 2HF6A 1HQ3A 3BW6A 5AVBD 2G2WA 3OBFA 2JSSA 3UE0A 3GQZA 4QLCB 4JF5A 1HZOA 4E3LA 3ZG5A 3PXPA 1DJCA 2J3WA 4WU9C 2VGKA 4BBVA 1JTDA 1P34C 3HLWA 1N4OA 3WAAD 1KGEA 2HDUA 5AQAA 2JN7A 1P3GA 2WKRA 2QWSA 3T4OA 4JJNB 1EQZC 2IWDA 3ZVTA 5FATA 2YFVA 3C1CD 1G6OA 3Q1FA 1GA0A 3W4OA 4EU0A 1KDSA 2KLIA 3FKWA 3AV2A 2F8NB 4NYYA 1C3BA 4DJ2A 3PBNA 4O8GA 1ES4A 5HPIA 5FI2A 1P9WA 4K0WA 4DE3A 5B1MD 3L29A 4B93A 4Z2IA 4X68A 4E3JA 4GD6A 2NQBC 2NZDB 4B4ZA 4J8VC 3W98A 1TD5A 1P0ZA 3A0VA 4MN5A 1T1BA 5HL1A 1F66A 1J3WA 3JYIA 1PZOA 3IHBA 1E15A 2VGJA 4MEZA 2ZL1A 3BJNA 3KUYB 1GA9A 4HIAA 5B2ID 1EROA 2PD8A 2ZQDA 5DNMA 5AQ9A 4BBTA 1SKOB 1KX4D 4Z2LA 4EBPA 3X1UC 5JRGD 4PKYA 2QZ6A 1NRFA 5F99B 2IOUA 4KHAA 1ACFA 5CGXA 2D02A 1P3PB 2FJ7D 1L2SA 2XK1A 2ZQCA 4LD9C 1VB6A 2KDKA 4DE0A 1T18A 5AVBA 1A7WA 4Q8IA 2Y2QA 5CP6D 2JKRM 3WD1A 4EQIA 5AVEA 4HHDA 1FCNA 5E2EA 2Y2NA 3JVUA 3WAAA 1STZA 1WYBA 2K2NA 2KOIA 3CPTB 3BFCA 3C1CA 3E98A 2WUQA 3S22A 3DAVA 3SH7A 1BFMA 4NEED 1BUEA 4MBKA 2X01A 4LV1A 1ZLAD 2OAP1 2P04A 4H8RA 3LGOA 2ZM2A 3A3FA 5I94A 3AGFA 4ARZA 3LZ0D 2FFFB 4EUZA 5AV8C 5B1MA 4CQHA 3BECA 3IHAA 3BWLA 4GDNA 1K57A 3REJD 5HAQA 4H9NA 1K4EA 1XFNA 4XT2A 1OTBA 2OV5A 3AZGB 2WGIA 3B6FD 3CZDA 3CI6A 5B2IA 4Y13A 5HL6A 3MGSB 3WWXA 1KX4A 5BNXA 3AYWD 3IWQA 5JRGA 4QD4A 1H3QA 2L0WA 3S4XA 3W4QA 1ID3D 3OPPA 2FJ7A 1HVBA 3M7PA 1FR6A 4M6BA 4F3LA 3UT9D 5E2FA 3ISGA 4Z2MG 2F8NK 2HIOB 4KGCD 5HWTA 3P5JB 5CP6A 2RIQA 2IO5B 2FH5A 3LIEA 4OONA 4K08A 1UWNX 1S66L 4K91A 5FQQA 3T50A 4NYUA 1YU3A 3IXBA 3JPUA 4XUXA 3HCYA 3AZMD 4OLGA 1RGZA 1SZVA 2A24B 5GT3B 4ZUXC 2I9VA 4IEDA 1CQAA 4RVAA 1H0IA 2Y91A 3B0BA 4LCLA 4JJND 5AV9B 3REIB 4LV3A 1ZLAA 3LELB 4ZJ3A 4XUJC 4KUDB 3L7HA 4GS9A 4X23C 2EFUA 3HLGA 2NUTC 3KS4A 2PYPA 3LZ0A 1QMFA 3R4KA 1YSPA 4P6BA 3HLCA 2Y2KA 1NZUA 2W27A 2HP9A 3REJA 1MWSA 4E3MA 4H9RA 3LIBA 2NZDD 2XSSA 3T4SA 3WA9B 1BZAA 4NETA 3B6FA 3B42A 4XZQC 5BS7A 2Y2HA 1JWVA 2VV6A 2XA7M 3D4FA 3OPLA 4ZBJB 3AYWA 2ZC7A 4O01A 1PNEA 2ACGA 2Z6CA 4YS3D 3KUYD 3G2YA 5KDMB 3L28A 5J7EA 4KZAA 4MN7A 1ID3A 3Q7VA 1P34B 1T3UA 5F99D 3LR0A 1P3PD 3H9WA 3AFAA 3UT9A 1EQZB 1CJFA 4KGCA 1GSVA 1M6KA 2Q9MA 4WZ5C 2V1AA 3DTKA 1H8PA 3AZMA 4Y5FA 1PW8A 5FSRA 3RELD 5GT0D 1ULYA 2XD5A 4LRZE 4ZJ1A 2NQBB 4GN2A 5M19A 2I72A 2M1CA 4JJNA 4MLLA 4U0XA 5GLDA 2LB5A 3VP4A 5L09A 1H0MA 3UB5P 4L9GA 4X1LA 1H8ZA 1GPFA 1K4FA 5DF9A 1YU0A 5TBMB 4NE5A 1GHMA 5L8MA 5CP6C 2NZDA 3QP4A 1ES3A 2EWWA 1S32B 3NOUC 4BD1A 3NQUA 4YM6D 1YU1A 5FQ9A 3MFXA 4AWLB 1P3MC 5M1AA 1AOIB 4DE1A 4GH9A 4WEKA 3ZHHA 5GXQD 3AZGD 4P0MA 1S1ZA 3DW0A 3KUYA 4YS3A 1IKIA 3MGSD 1SKOA 1OT6A 4H6JB 2HPBA 1ZLAC 4LENA 5F99A 2H5SA 4DKIA 5CHMA 2W3EA 1ES2A 1P3PA 4EUVA 1I5QA 2JKTM 3N8SA 5BPVA 5EOOA 3LZ0C 2ZY3A 1VM1A 3QP6A 1K56D 1HD8A 5E5AB 3MXQA 2VEAA 3UB9A 2HIOD 2R9WA 3MJQA 1K55A 5E2HA 2ZY4A 2GX5A 3WTPC 1NRJA 3RELA 4X56A 5GT0A 1O7EA 2Y2IA 5AV8B 3GTCA 1TAFB 2M7VA 5CECA 5B24C 2VGLM 3IX8A 5CHUA 4CLCB 5FDHA 2VZWA 3H7WB 3CPTA 2A2LA 1O07A 3HBRA 1W1VA 3BFDA 3VH5T 3LI9A 2ZQ9A 3HUNA 2K31A 1IELA 3REID 4N9LA 3TOIA 3QNBA 3LELD 4IJGA 3LJAD 3KSYA 4KUDD 2ZC6B 4JGQA 3KS8A 2VV8A 3VH5W 4IBDA 3WKJD 4FH2A 3H0RC 4LV2A 5G4YA 1Z6FA 1XXMA 2PR5A 5AVFA 1TZYB 4YM6A 3T1SA 2HDQA 2WKEA 4OKPA 1U60A 1NY0A 5L07A 4FSFA 4E3OA 4QLCC 3WA9D 5GXQA 3BQAA 4WJ3C 3AZGA 2V8FA 4I38A 1XGIA 1YLPA 5HD3A 1BLSA 3WD0A 4B4XA 1M19B 3IWOA 2Z2MB 3MGSA 2PYOB 4GDBA 4OPYA 1NLZA 4Q0HA 3KYQA 4FOFA 4JJNC 4LFUA 3DWZA 3VOYA 1XJ3A 4HI4A 3VFFA 1F98A 1PFLA 4WU9D 2HP5A 3FWLA 5AQ7A 2M7UA 1P34D 2PRFA 1NWZA 3V9RB 4G3VA 5A91A 5KSHA 1K56A 4KG2A 1EQZD 3G34A 5GLCA 5TJJA 2HIOA 4WL9A 4HMEA 2XGNA 4XUJB 4C3QA 1E88A 2BTFP 4CAYA 4X23B 3RJUA 2G5HC 5IHVA 5CXWA 3CUEC 3G32A 3JVVA 4P6ZS 4J8UB 5HWVA 2Y2LA 2A24A 2FN2A 3U2AA 1WWSA 5F6AA 3AZNB 3KYEA 3OPRA 4GNUA 1M18C 4K0XA 2NQBD 1QO6A 2WAFA 3REIA 3LEQA 3LELA 4XZQB 1ALQA 3LJAA 4KUDA 1PI5A 3VFHA 5F99C 1K25A 4PM5A 2PU4A 3E4QA 3WKJA 4S2PA 3X1UD 3QP8A 4B9OA 3ZYTA 3A0SA 3VE3A 4UA6A 3MGPA 3PBOA 3HONA 3O3VA 5FA7A 3WA9A 5L10A 2ZY2A 5FQJA 4M3KA 4IBBA 3MF0A 4LD9D 3BY9A 1AOID 4OJ5A 2F2AC 1IFQA 4Y15A 3Q82A 1CEGA 1D1JA 3B0DB 2B5RA 5KDMA 1EI5A 3GVBA 4WU9A 3SS4A 1H0GA 1P34A 1G5UA 1H8YA 4Q0JA 3EQUA 1EQZA 2UWXA 2O9CA 4R3JA 3NQJA 4X55A 3SW1A 2AVXA 1TS6A 1JFIA 3VP1A 5CHJA 1DJBA 4GHIB 1KE0A 4WBGA 3BLMA 5CX7A 4JXGA 4G92B 3LY4A 4IBJA 4DE2A 1DP6A 5AV8D 2ZQ7A 4CLCD 3O87A 2NQBA 3MMHA 4OH0A 4HH2A 3EPLA 1RP5A 3OLOA 3REHB 3IWIA 4DDYA 3WD3A 3M2KA 3OCNA 4JXVA 3C8CA 2P9VA 5EOEA 5M18A 1VETB 1Z09A 1I2SA 1LI0A 3X1UA 4OOLA 3RFBA 3VOZA 4NZ5A 5J3WA 3KWQB 4DQYB 1TZYD 2WADA 1K38A 3B6GC 4LD9A 1AOIA 4B88A 3UE3A 5HDSA 3AL0C 1KU5A 3X1VB 2F8NH 5B31G 5GT3C 1KGFA 3EEHA 3WTPB 5HWWA 4TX8A 2OSUA 1Q2PA 2ZC5B 2PYOD 4WZ4A 2W3DA 5AV9C 3B33A 4NXGA 2PDRA 2L5AA 2PHYA 2W3FA 1LLBA 5B32G 5EE8A 2RCXA 5HX9A 3UDIA 4ZUXD 4HNBA 2Y2PA 5G49B 3RH8B 4DF6A 2PBYA 2ZJ9A 3CITA 1KDWA 3MKEA 2EX9A 3EG5B 5DTKA 3E4OA 4XUJD 3W97C 2PU2A 4X23D 3AN2C 2VX8A 4EO5B 1W63Q 2W3GA 5AV8A 1TAFA 3WA9C 1EWZA 3BYDA 4CLCA 4CJNA 5GSUB 1DP8A 4DDSA 1XX2A 4OP5A 3E0YA 3H7WA 4S2NC 4ZBJC 3SH8A 4WNNB 4BMWA 4NG2A 3HLDA 3QP5A 4NZ4A 1CXWA 1ZC2A 1E8BA 1ZHHB 2Y4AA 1HTZA 1LSXA 4LCMA 4XZQD 3WS1A 1D06A 3L25A 1CK7A 5CRFA 4E6WA 4E04A 5HD5A 3C7VA 2B02A 3Q81A 1J9MA 5BT1C 3HLFA 2G2UA 4I39A 4EEUA 4H9SC 1U35B 2PT7A 1TZYA 3A6NC 2OWHA 1BULA 1W8YA 5EECA 1BT5A 1JWZA 3AZLB 4NZ3A 1BLHA 1P3LC 3MVDB 1F2KA 3SS5A 1PYYA 1B6WA 3UB8A 1Y54A 3FYZA 1WWIA 5KMWA 2HV1A 2D01A 3LYXA 4HEFA 4ZRRA 3MXSA 3R45B 3FV7A 1F1EA 4ZUXA 2W0NA 4GJ4A 3N6IA 1M18B 1M40A 3T1QB 5AJGA 4OLDA 1WYCA 2HZ5A 4KQQA 3IP4C 3QNCA 5B31B 4XUJA 3REKB 4X23A 4OJOA 4AFIA 2QMIA 5AQBA 3UB6A 3ZGAB 4UUZA 1NZOA 2C5WB 1S32C 1IYOA 4UHUA 1W8QA 2QYBA 5TGFA 4AWLC 1P3AC 2QJ5A 1AOIC 3CJMA 4JF4A 3E2KA 4BENA 5EPHA 1P3FC 2L4RA 1E3UD 4HBUA 4J8XB 1OT9A 3LFVA 2XEPA 2DF4C 2GNXA 5FEFA 5HSQA 4XZQA 5CERA 1W1TA 1P3MD 2EFXA 4WZSB
chains in the Genus database with same CATH topology
1LI9A 1YLYA 3W99C 1YU4A 4GOGA 5E5AC 5CEBA 4S2JA 4MBFA 2BYMB 3X1TC 1P3KC 4UA9A 4Z5TC 5BNVB 4H9OA 3KWQD 3IF5A 2V1ZA 5B33C 4N92A 4WZ5A 4KZ4A 3HLBA 2H10A 4S2LA 4PM9A 4IBKA 3WTPD 3A1KA 3HUMA 5B24D 4OQ0A 3O62B 3EPKA 5JA4A 3KXBC 4U3TA 2WZXA 1PZPA 1DJAA 2Y2OA 1TZYC 2HDRA 4EBLA 1QMEA 4OJPA 4JLFA 4WMCD 4JF6A 3AZKC 3VP0A 1E3UA 5AVCB 4S2KA 3HVFA 5GSUD 3AZHC 4E3NA 4BL2A 4H9PB 4OPQA 1SHVA 1M19C 4OP8A 2PYOC 3B6GB 4QB8A 1KE3A 1P3MA 4QLCD 3E2LA 4GD8A 3LZ1C 5FUGB 3B3XA 4KZ8A 1CK3A 1YLTA 3A3DA 5CTNA 3HL9A 3WRTA 4P85A 5A90A 1N9BA 2OLUA 1U35D 3N3FA 4Z2MH 2F8ND 4J8UC 3AZLD 4YINA 4IJEA 1XA1A 5AY8C 3W97B 3MVDD 5EVLA 3AN2B 3WTPA 3AZNC 1Q2QA 3BLSA 1BH8A 3NI9A 5B24A 4C75A 4ZDXA 4DRBA 5G49A 1M18D 2ZD8A 2AROC 4KENB 2A3UA 5B40C 5B31D 3REKD 4QY6A 1YLWA 3AZFC 3MZFA 3QHYA 4WMCA 1OMEA 5B0ZB 5GSUA 3NY4A 4JKTA 2CV5B 3V3SA 1NXYA 3A6NB 4GZBA 3ZVWA 4JBFA 4WNNA 4J8XD 3B0DC 4LG2A 3ZFZA 4QLCA 3EPHA 1P3LB 3MGRC 3N8LA 4ZBEA 1FCMA 1BLCA 3IQAA 4BJPA 1YT4A 4N1HA 1U35A 2F8NA 2HP6A 3IXHA 3AZLA 3Q07A 4G92C 4MNRA 3UO9A 3FDDA 3MVDA 4JXWA 4RX2A 1CI8A 2EXAA 4R4SA 3REHC 1P3AB 4QHCA 3OC2A 3R45A 2IWBA 1P3FB 1M18A 4FD8A 4H9QB 5L2FA 3BEBA 3AGEA 5B31A 3REKA 2WGVA 2WGWB 4CSRB 3OPHA 3MNNC 4OUIA 1K54C 3KWQC 2CC1A 3W99B 2BLSA 1SCWA 1P3OB 1E25A 4KQOA 2ZC4B 3X1TB 1P3KB 1KX5B 3X1VC 4Z5TB 2Y2JA 3B6GD 2ZLYA 3LO7A 3EPJA 5CGSA 5B33B 3VP3A 3W4PA 5GT3D 4KZ6A 3VP2A 2XDMA 2ZC3B 5AV9D 2BYMA 5HAIA 5BNVA 4EO5C 1YUEA 3KXBB 4G91B 4BD0A 1JTGA 2EXBA 4KG6A 1MWTA 5GSUC 3WS4A 3W97D 4XXRA 4F94A 1IYQA 3AN2D 4BQMA 1YLJA 4PM8A 3VMAA 4WV4B 4JXSA 3AZKB 3AZHB 4GKUA 3MZDA 2YFVB 1BH9B 4R4RA 4R3BA 3LZ1B 5A92A 1U35C 1XA7A 5HW3A 3BFGA 3AZLC 2WYXA 2X71A 5BT1D 2V2FF 4OJ6A 3UDFA 3MVDC 2CV5D 4HBTA 4H9PA 3A6ND 3B6GA 2J8PA 1M1AB 1P3LD 5AY8B 5CPIB 3PAGA 5FUGA 5GT3A 3UTAB 3LY3A 5DNMB 3VH6A 4WU8C 2GDNA 5AV9A 5A93A 5B31C 3REKC 4KHAB 4KQRA 3TU4C 3MBZA 4EWFA 1XKZA 1ERQA 4YFMA 2AROB 5B32C 5B40B 3BFFA 2BG1A 3W97A 3AN2A 3AZFB 2ZM0A 4J8XC 4E3KA 1S32D 1KX3C 3MZEA 2BYKB 4NZ1A 4E45A 1P3AD 4ZTKA 4S2NA 1P3FD 3V39A 3C1CB 1XP4A 5FI6A 2HUEC 3MGRB 3PBSA 1SKFA 1IYPA 3G35A 3FZCA 5CEDA 4XUZA 1LL9A 5B1MB 2JBFA 2JC7A 3W99D 4R0QA 5B0YC 4H9SA 1E4DA 4ZJ2A 2CV5A 3WRZA 5E5AD 3A6NA 3Q7ZA 3X1TD 1P3KD 1KX5D 3LCEA 4Z5TD 1P3LA 4FH4A 3G31A 5B33D 3O62C 2WAEA 3BRMA 1DY6A 3VSLA 2V20A 5CPKC 2FJ7B 4OPRA 4DXBA 2XQZA 3L26A 1GCEA 1H3OB 3KXBD 5E2GA 1IEMA 4KZ9A 3MNNB 3IH9A 5GHZA 3UDXA 5AVCC 3G2ZA 1TDLA 5BO0B 2R9XA 2YFWB 2XD1A 1S32A 4R8PC 1P3AA 3AZKD 1P3FA 4QJGA 3ITBA 3AZHD 1B67A 1I2WA 2G5IC 2ZM5A 4Z66C 1M19D 1MKIA 2XFTA 4S2IA 3ZG0A 4CSRA 4WYYA 3MGQB 3AZIB 3LZ1D 1TEMA 3DWKA 3W99A 2J8YA 1P3IB 3ZDJA 1ESIA 5E5AA 1G6AA 3X1TA 1P3KA 1KX5A 4Z5TA 2A49A 3CMZA 1CI9A 3B6FB 4J8UD 1BSGA 3WX7A 5B33A 1M1AD 4NFTA 5B2JC 5AY8D 4X69A 5CPID 3UTAD 2QPNA 3AZND 5DNMD 3AZEC 4IBCA 3Q7VB 3AGDA 3WTPE 3AFAB 1G68A 3UT9B 5CTMA 3KXBA 5FQIA 5GHXA 3A1IA 4Y0TA 4J8WC 2AROD 3IH8A 5B0ZC 5B40D 2CV5C 1KVLA 4HGAC 1P3BC 4OQIA 3AZFD 3AZMB 4GHLA 4RX3A 5B1LB 2ZMAA 3AZKA 1L0DA 3OZHA 5F82A 3ZG9B 3AZHA 1LL5A 4E44A 1FR1A 1M19A 2PYOA 3P09A 1BH9A 3C4OA 3P98A 3LZ1A 3MGRD 3ZG7B 2Q9NA 3C1BC 1MWUA 3V9RA 4KZ3A 1W79A 4KZ7A 4WU8B 3ZCZA 3AZJC 3KFUG 1PWCA 4KG5A 4PMAA 3NIAA 3GRJA 5EUAA 3TU4B 1FSWA 5AV5C 5EVIB 3NQUB 1SDEA 4J8UA 3IF6C 5F1GA 3M6BA 1M1AA 5B32B 5AY8A 5CPIA 1FOFA 3L27A 3UTAA 4YS3B 2DQNC 1GHIA 3V5MA 3AZNA 4N9KA 4S2MA 3WS5A 1KX3B 4Y0UA 3REHD 3NCKA 4OQGA 2AROA 1NYMA 3HLEA 2HUEB 4O7DA 5B40A 3W96C 3FKEA 1P3OC 4Y7PA 3MNND 3AZFA 2DNSA 3O88A 1KX5C 3RELB 5GT0B 5AV6B 3X1SB 4IBFA 2BYKA 5B0YB 1SDNA 4PPRA 5U47A 3UE1A 5DNNB 4OOMA 2J9PA 5HAPA 3X1VD 1XGJA 1YLZA 2XFSA 5CPJB 1K6RA 3ZNYA 3MGRA 3FKVA 3MGQD 2ZM8A 3AZID 3AV1C 4G91C 1P3ID 1YMXA 4IBGA 4IJFA 1H5XA 3NBLA 5CPKB 5J8XA 4YM6B 1HQ3C 1PW1A 2WKIA 1K6SA 4FCFA 3W8KA 1PIOA 5GXQB 1W5DA 3HREA 4X53A 4ZAMA 3GV9A 1CEFA 4EBNA 1P3GC 4X6TA 2RVQC 2LY8A 3REHA 4R8PB 1ONGA 1Z2CB 3N8RA 1L0GA 3AV2C 4RA7A 1VQQA 3AFAD 4Z66B 1H3OA 3PAEA 2XLNA 4CAYB 3MNNA 1PWDA 5GLBA 5BO0A 1K54A 2CWEA 5TFQA 2YFWA 1L0FA 1JVJA 3KWQA 3W98C 4JPMA 5KSCA 4C6YA 1F66C 5B1LD 4DRAA 1M1AC 5CPIC 3UTBB 3X1VA 5F1FA 1ZG4A 3UTAC 5DNMC 5KZHA 3LJAB 3G4PA 5DF8A 3MGQA 5B2JB 1LHYA 4NY2A 3AZIA 3SH9A 1P3IA 2ZY5A 3WKJB 3AZEB 1MWRA 4WU8D 5BOHA 5AVBC 3VH6T 3MGPB 3UPPA 3TU4D 4E3IA 2X02A 5C3IB 2IWCA 5EVID 3GSGA 3ZNTA 4J8WB 5B32D 3WAAC 2Z2LB 3TSGA 4CPKA 4R1GA 4HGAB 5JYPA 1P3BB 3VH6W 3C1CC 3B0CT 2J7VA 4WU9B 1KX3D 5CHLB 3A3JA 3A3IA 3BFEA 5HFOA 2JE5A 3L2AA 4GB7A 4QNLA 3NQJB 3V3RA 5B1MC 1MXOA 1JFIB 3B0CW 3C1BB 1K57C 3N4IA 1ZG6A 4NE3A 4KZ5A 5B1LA 5AV6D 3X1SD 3AZJB 3UY6A 1XPBA 5B0YD 5DNND 5AV5B 4J8VB 3LEZA 4ID4A 5B2IC 4PM7A 2OLVA 1KX4C 2H0TA 3IF6B 5JRGC 1N1JB 1IYSA 3WS0A 5CPJD 2P9VB 2H0YA 4IBEA 5DF7A 2FJ7C 3N7WA 3O62D 4QU3A 4WU8A 3X1UB 3DTMA 2EX2A 4IBXA 5CGWA 3TU4A 3PTEA 5CPKD 1IKGA 4RYEA 5EVIA 1FQGA 3UPNA 4LD9B 2WKHA 3IT9A 5B32A 3BM6A 3W96B 2FFYA 4UPKA 5AVCD 4J8XA 3EQVA 4NK3A 1KVMA 5GL9A 3C5AA 1KX3A 5DTTA 1PI4A 4IBRA 4R8PD 3IXGA 3MXRA 3MGQC 2J9OA 5D3OA 3AZIC 1ERMA 1P3IC 4Z66D 1MPLA 3F6TA 5FAPA 3V50A 4BLMA 4A5RA 3REJC 1YU2A 1RCJA 4OJLA 3MFDA 4WELA 4MBHA 5AV6A 3X1SA 2HDSA 3I7JA 3CG5A 3AV1B 5B0YA 3B6FC 5DNNA 5BS7C 2XR0A 4EV4A 1HQ3B 3AYWC 3UTBD 4D2OA 1PWGA 5DVAA 5CPJA 3OCLA 2ZQAA 4OPZA 1ID3C 1MY8A 5FQKA 5B2JD 2JCHA 3O62A 1P3GB 3AFAC 3UT9C 4KGCC 5G18A 3AZED 1Q9CA 1JWPA 4N1XA 3RXWA 5CPKA 3IXDA 2W8SA 4Z9QA 3AV2B 3S1YA 3H0LC 2EX6A 3MGPD 4IVIA 1NYYA 3AZMC 3PBTA 5B1LC 3G30A 3SS3A 4J8WD 4DXCA 5B0ZD 5AVCA 2P74A 4E6XA 3RXXA 3W98B 1P3BD 4R8PA 1F66B 2Y55A 1BTLA 2XH9A 4OOYA 4ZUXB 4UAAA 3H0MC 4OVDA 4Z66A 1BLPA 2RL3A 3NC8A 1HTAA 1TDGA 3TG9A 2NZDC 2ZQ8A 4UUZB 3C1BD 4WM9A 5HARA 5EVIC 5JYOA 3AZJD 5FAQA 5AVBB 3UTBA 3C4PA 5AV5D 4YS3C 3KUYC 4J8VD 3O86A 2C6WB 4L0LA 5E43A 4PM6A 3WS2A 5TR7A 2DCFA 5B2JA 3WAAB 3NDGA 1P3PC 3VSKA 3HSHA 1ES5A 3M2JA 2WZZA 3AZEA 2Y2MA 3PBRA 2XF3A 2E8IA 1S6RA 3A3EA 1K55C 1YQSA 3MKFA 4H9OB 3RELC 5GT0C 5AV6C 3X1SC 4J8WA 5B0ZA 3ITAA 1W7FA 4BL3A 5DNNC 3W96D 1GHPA 1P3OD 1P3BA 5GLAA 4GHAA 4H9NB 1NJ4A 5CPJC 2Y2GA 4P87A 3GR2A 5B2IB 5JA4B 1KX4B 5BNXB 4U0TA 5JRGB 4DRTA 1KE4A 4IVKA 1FCOA 2Y59A 4IBIA 3C1BA 1YMSA 4YM6C 5FI7A 3C7UA 1KGGA 3AZJA 1ONHA 1ESUA 1W2EA 3AV1D 5GXQC 3AZGC 1PZRA 4S2OA 5CP6B 1TVFA 5AV5A 4J8VA 1ZKJA 3UNWA 1HQ3D 3MGSC 3IF6A 2F8NG 1S0WA 5F83A 1P3MB 1N1JA 4KZBA 3GMWA 4H9QA 1P3GD 3ZG8B 2RVQD 1WE4A 4WEJA 1ZLAB 2HIOC 2WGWA 5FAOA 2IO5C 3SOIA 3LZ0B 3AV2D 3M6HA 4NE6A 3UPOA 2WK0A 4OQHA 4LV0A 1MBLA 3VH5A 3W96A 4R23A 1P3OA 3PBQA 5FASA 3REJB 3UTBC 4H9RB 1FSYA 1BH8B 3W98D 2DRWA 5B24B 3REIC 3HUOA 3LELC 1YM1A 5GHYA 1F66D 3LJAC 4KUDC 1L0EA 3AYWB 5DTSA 3WKJC 1ID3B 4HESA 2VQRA 1RGYA 4QY5A 4UA7A 3MGPC 5C3IC 4Y0OA 4KGCB 2EX8A 5FQMA 3AV1A 1R4VA 3NDEA 3UN7A 1AXBA 1HQ3A 5AVBD 2G2WA 2JSSA 3UE0A 3GQZA 4QLCB 4JF5A 1HZOA 4E3LA 3ZG5A 1DJCA 4WU9C 2VGKA 1JTDA 1P34C 3HLWA 1N4OA 3WAAD 1KGEA 2HDUA 5AQAA 1P3GA 4JJNB 1EQZC 2IWDA 3ZVTA 5FATA 2YFVA 3C1CD 3Q1FA 1GA0A 3W4OA 1KDSA 3FKWA 3AV2A 2F8NB 4NYYA 1C3BA 3PBNA 1ES4A 5FI2A 4K0WA 4DE3A 5B1MD 3L29A 4X68A 4E3JA 4GD6A 2NQBC 2NZDB 4B4ZA 4J8VC 3W98A 5HL1A 1F66A 3JYIA 1PZOA 3IHBA 2VGJA 4MEZA 3KUYB 1GA9A 5B2ID 1EROA 2ZQDA 5DNMA 5AQ9A 1KX4D 4EBPA 3X1UC 5JRGD 2QZ6A 1NRFA 5F99B 2IOUA 4KHAA 5CGXA 1P3PB 2FJ7D 1L2SA 2XK1A 2ZQCA 4LD9C 4DE0A 5AVBA 1A7WA 4Q8IA 2Y2QA 5CP6D 4EQIA 1FCNA 5E2EA 2Y2NA 3WAAA 1WYBA 3BFCA 3C1CA 3S22A 2WUQA 3SH7A 1BFMA 1BUEA 4MBKA 2X01A 4LV1A 1ZLAD 4H8RA 2ZM2A 3A3FA 5I94A 3AGFA 3LZ0D 2FFFB 4EUZA 5AV8C 5B1MA 3BECA 3IHAA 4GDNA 1K57A 3REJD 5HAQA 4H9NA 1K4EA 2OV5A 3AZGB 2WGIA 3B6FD 3CZDA 5B2IA 3MGSB 3WWXA 1KX4A 5BNXA 3AYWD 3IWQA 5JRGA 4QD4A 3S4XA 3W4QA 1ID3D 3OPPA 2FJ7A 1HVBA 1FR6A 4M6BA 3UT9D 5E2FA 3ISGA 4Z2MG 2F8NK 2HIOB 4KGCD 3P5JB 5CP6A 2RIQA 2IO5B 4OONA 4K91A 5FQQA 4NYUA 1YU3A 3IXBA 4XUXA 3AZMD 4OLGA 1RGZA 5GT3B 4ZUXC 4IEDA 4RVAA 2Y91A 3B0BA 4LCLA 4JJND 5AV9B 3REIB 4LV3A 1ZLAA 3LELB 4ZJ3A 4XUJC 4KUDB 4X23C 2EFUA 3HLGA 3KS4A 3LZ0A 1QMFA 4P6BA 3HLCA 2Y2KA 1NZUA 2HP9A 3REJA 1MWSA 4E3MA 4H9RA 2NZDD 3WA9B 1BZAA 4NETA 3B6FA 4XZQC 5BS7A 2Y2HA 1JWVA 3D4FA 3OPLA 4ZBJB 3AYWA 2ZC7A 4YS3D 3KUYD 3G2YA 5KDMB 3L28A 4KZAA 1ID3A 3Q7VA 1P34B 1T3UA 5F99D 1P3PD 3AFAA 3UT9A 1EQZB 4KGCA 1M6KA 2Q9MA 4WZ5C 3AZMA 1PW8A 5FSRA 3RELD 5GT0D 1ULYA 2XD5A 4ZJ1A 2NQBB 4GN2A 5M19A 2I72A 4MLLA 4JJNA 4U0XA 5GLDA 3VP4A 1H8ZA 1K4FA 5DF9A 1YU0A 4NE5A 1GHMA 5CP6C 2NZDA 1ES3A 1S32B 4BD1A 3NQUA 4YM6D 1YU1A 5FQ9A 4AWLB 1P3MC 5M1AA 1AOIB 4DE1A 4GH9A 4WEKA 3ZHHA 5GXQD 3AZGD 4P0MA 3DW0A 3KUYA 4YS3A 1IKIA 3MGSD 2HPBA 1ZLAC 4LENA 5F99A 2H5SA 4DKIA 5CHMA 1ES2A 1P3PA 1I5QA 3N8SA 5BPVA 5EOOA 3LZ0C 2ZY3A 1VM1A 1K56D 1HD8A 5E5AB 2HIOD 2R9WA 1K55A 5E2HA 2ZY4A 3WTPC 3RELA 4X56A 5GT0A 1O7EA 2Y2IA 5AV8B 3GTCA 1TAFB 5CECA 5B24C 5CHUA 5FDHA 1O07A 3HBRA 3BFDA 3VH5T 2ZQ9A 3HUNA 1IELA 3REID 4N9LA 3TOIA 3QNBA 3LELD 3LJAD 3KSYA 4KUDD 2ZC6B 3KS8A 3VH5W 4IBDA 3WKJD 4FH2A 3H0RC 4LV2A 1Z6FA 1XXMA 1TZYB 4YM6A 2HDQA 2WKEA 4OKPA 1U60A 1NY0A 4FSFA 4E3OA 4QLCC 3WA9D 5GXQA 4WJ3C 3AZGA 1XGIA 1YLPA 1BLSA 4B4XA 1M19B 3IWOA 2Z2MB 3MGSA 2PYOB 4GDBA 4OPYA 4JJNC 3DWZA 3VOYA 3VFFA 4WU9D 2HP5A 3FWLA 5AQ7A 1P34D 3V9RB 5A91A 5KSHA 1K56A 4KG2A 1EQZD 3G34A 5GLCA 2HIOA 2XGNA 4XUJB 4C3QA 4CAYA 4X23B 3RJUA 2G5HC 5IHVA 5CXWA 3G32A 4J8UB 2Y2LA 1WWSA 3AZNB 3OPRA 4GNUA 1M18C 4K0XA 2NQBD 2WAFA 3REIA 3LELA 4XZQB 1ALQA 3LJAA 4KUDA 1PI5A 3VFHA 5F99C 1K25A 4PM5A 2PU4A 3WKJA 4S2PA 3X1UD 4UA6A 3MGPA 3PBOA 3HONA 3O3VA 5FA7A 3WA9A 2ZY2A 5FQJA 4M3KA 4IBBA 4LD9D 1AOID 4OJ5A 2F2AC 3Q82A 1CEGA 3B0DB 2B5RA 5KDMA 1EI5A 3GVBA 4WU9A 3SS4A 1P34A 1H8YA 3EQUA 1EQZA 2UWXA 4R3JA 3NQJA 4X55A 1JFIA 3VP1A 5CHJA 1DJBA 1KE0A 4WBGA 3BLMA 4JXGA 4G92B 3LY4A 4IBJA 4DE2A 5AV8D 2ZQ7A 3O87A 2NQBA 4OH0A 3EPLA 1RP5A 3REHB 3IWIA 4DDYA 3M2KA 3OCNA 4JXVA 2P9VA 5EOEA 5M18A 1I2SA 1LI0A 3X1UA 4OOLA 3VOZA 4NZ5A 3KWQB 4DQYB 1TZYD 2WADA 1K38A 3B6GC 4LD9A 1AOIA 4B88A 3UE3A 3AL0C 1KU5A 3X1VB 2F8NH 5B31G 5GT3C 1KGFA 3WTPB 2OSUA 2ZC5B 1Q2PA 2PYOD 4WZ4A 5AV9C 2L5AA 1LLBA 5B32G 5EE8A 2RCXA 5HX9A 3UDIA 4ZUXD 2Y2PA 5G49B 4DF6A 2PBYA 2ZJ9A 1KDWA 3MKEA 2EX9A 3EG5B 5DTKA 4XUJD 3W97C 2PU2A 4X23D 3AN2C 4EO5B 5AV8A 1TAFA 3WA9C 1EWZA 3BYDA 4CJNA 5GSUB 4DDSA 1XX2A 4OP5A 4S2NC 4ZBJC 3SH8A 4WNNB 3HLDA 4NZ4A 1ZC2A 2Y4AA 1HTZA 4LCMA 4XZQD 3WS1A 3L25A 5CRFA 4E6WA 3C7VA 3Q81A 1J9MA 5BT1C 3HLFA 2G2UA 4H9SC 1U35B 1TZYA 3A6NC 1BULA 1W8YA 5EECA 1BT5A 1JWZA 3AZLB 4NZ3A 1BLHA 1P3LC 3MVDB 3SS5A 1PYYA 1B6WA 1Y54A 3FYZA 1WWIA 5KMWA 4HEFA 3MXSA 3R45B 3FV7A 1F1EA 4ZUXA 3N6IA 1M18B 1M40A 4OLDA 1WYCA 4KQQA 3IP4C 3QNCA 5B31B 4XUJA 3REKB 4X23A 4OJOA 2QMIA 5AQBA 3ZGAB 4UUZA 1NZOA 2C5WB 1S32C 1IYOA 4UHUA 1W8QA 5TGFA 4AWLC 1P3AC 1AOIC 3CJMA 4JF4A 3E2KA 4BENA 5EPHA 1P3FC 1E3UD 4HBUA 4J8XB 2XEPA 2DF4C 4XZQA 5CERA 2EFXA 1P3MD 4WZSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PBT A;  3G30 A;  1LI9 A;  1YLY A;  3SS3 A;  4QJG A;  3ITB A;  4DXC A;  1I2W A;  2P74 A;  1M6K A;  2Q9M A;  4WZ5 C;  4E6X A;  3RXX A;  4GOG A;  1MKI A;  5CEB A;  2XFT A;  4S2J A;  4MBF A;  4S2I A;  2Y55 A;  3ZG0 A;  4WYY A;  4UA9 A;  1BTL A;  1PW8 A;  2XH9 A;  5FSR A;  4OOY A;  2XD5 A;  1TEM A;  3IF5 A;  4ZJ1 A;  3DWK A;  4UAA A;  2V1Z A;  2J8Y A;  3ZDJ A;  4N92 A;  4OVD A;  4GN2 A;  4WZ5 A;  5M19 A;  2I72 A;  1BLP A;  1ESI A;  2RL3 A;  4KZ4 A;  4MLL A;  3HLB A;  2H10 A;  3NC8 A;  4S2L A;  4U0X A;  5GLD A;  1G6A A;  4PM9 A;  3VP4 A;  1TDG A;  3TG9 A;  2A49 A;  4WM9 A;  2ZQ8 A;  3CMZ A;  1CI9 A;  3HUM A;  1BSG A;  5HAR A;  4OQ0 A;  5EVI C;  1H8Z A;  1K4F A;  5DF9 A;  5JYO A;  5FAQ A;  4X69 A;  3C4P A;  1GHM A;  2QPN A;  4U3T A;  2WZX A;  1PZP A;  3O86 A;  2C6W B;  3Q7V B;  1ES3 A;  1DJA A;  4L0L A;  5E43 A;  4BD1 A;  2Y2O A;  4PM6 A;  2HDR A;  3AGD A;  5FQ9 A;  2DCF A;  5TR7 A;  3WS2 A;  4EBL A;  5M1A A;  1G68 A;  3NDG A;  1QME A;  5CTM A;  4DE1 A;  3VSK A;  4WEK A;  3ZHH A;  4JLF A;  4WMC D;  5FQI A;  5GHX A;  4JF6 A;  4P0M A;  4Y0T A;  3VP0 A;  1E3U A;  1ES5 A;  3DW0 A;  3M2J A;  2WZZ A;  4S2K A;  3HVF A;  3IH8 A;  4E3N A;  4BL2 A;  1IKI A;  2Y2M A;  3PBR A;  4OPQ A;  1SHV A;  2XF3 A;  1KVL A;  4OP8 A;  4QB8 A;  1KE3 A;  1S6R A;  2E8I A;  2HPB A;  3A3E A;  1K55 C;  4LEN A;  4OQI A;  2H5S A;  4DKI A;  5CHM A;  1YQS A;  3MKF A;  4RX3 A;  1ES2 A;  3E2L A;  1I5Q A;  2ZMA A;  1L0D A;  4GD8 A;  3N8S A;  3OZH A;  5F82 A;  3B3X A;  5EOO A;  3ZG9 B;  4KZ8 A;  1CK3 A;  1LL5 A;  1W7F A;  1VM1 A;  3ITA A;  1FR1 A;  1K56 D;  1HD8 A;  1YLT A;  4BL3 A;  1GHP A;  3A3D A;  5CTN A;  3HL9 A;  3WRT A;  2R9W A;  3P09 A;  5GLA A;  1K55 A;  4P85 A;  5E2H A;  5A90 A;  3C4O A;  1N9B A;  3P98 A;  4X56 A;  2OLU A;  1NJ4 A;  1O7E A;  2Y2I A;  3ZG7 B;  2Q9N A;  3GTC A;  5CEC A;  2Y2G A;  5CHU A;  4P87 A;  1MWU A;  3GR2 A;  4KZ3 A;  1W79 A;  4KZ7 A;  5FDH A;  4YIN A;  1XA1 A;  3ZCZ A;  1PWC A;  4KG5 A;  4PMA A;  4U0T A;  1O07 A;  3HBR A;  3BFD A;  5EVL A;  1KE4 A;  3NIA A;  4DRT A;  4IVK A;  1FCO A;  3GRJ A;  2ZQ9 A;  5EUA A;  1FSW A;  2Y59 A;  3HUN A;  1Q2Q A;  3BLS A;  3NI9 A;  1IEL A;  4N9L A;  5EVI B;  3TOI A;  3QNB A;  1SDE A;  1YMS A;  3IF6 C;  5F1G A;  5FI7 A;  4C75 A;  2ZC6 B;  3C7U A;  1KGG A;  3M6B A;  1ONH A;  1ESU A;  1FOF A;  4ZDX A;  4S2O A;  1GHI A;  1TVF A;  3V5M A;  4N9K A;  1ZKJ A;  2ZD8 A;  4KEN B;  4S2M A;  4FH2 A;  4LV2 A;  3UNW A;  1Z6F A;  1XXM A;  2A3U A;  3WS5 A;  4QY6 A;  3IF6 A;  4Y0U A;  2HDQ A;  2WKE A;  1S0W A;  1YLW A;  5F83 A;  4OKP A;  1U60 A;  1NY0 A;  3NCK A;  4KZB A;  3GMW A;  3MZF A;  4FSF A;  4OQG A;  4E3O A;  3QHY A;  4WMC A;  1OME A;  1XGI A;  1YLP A;  1BLS A;  4B4X A;  1NYM A;  3HLE A;  3NY4 A;  4JKT A;  3IWO A;  2Z2M B;  4O7D A;  4GDB A;  4OPY A;  3ZG8 B;  3V3S A;  1NXY A;  1WE4 A;  4GZB A;  4Y7P A;  4JBF A;  4WEJ A;  3ZVW A;  2WGW A;  3DWZ A;  5FAO A;  3O88 A;  2DNS A;  3ZFZ A;  3VOY A;  3VFF A;  3SOI A;  3M6H A;  2HP5 A;  3FWL A;  5AQ7 A;  3N8L A;  3UPO A;  4ZBE A;  2WK0 A;  1FCM A;  1SDN A;  1BLC A;  4OQH A;  4PPR A;  4LV0 A;  5U47 A;  1MBL A;  3UE1 A;  5KSH A;  1K56 A;  3IQA A;  4KG2 A;  3G34 A;  4OOM A;  3PBQ A;  4R23 A;  5GLC A;  2J9P A;  5FAS A;  5HAP A;  2XGN A;  4C3Q A;  4BJP A;  1YT4 A;  1XGJ A;  3RJU A;  1FSY A;  1YLZ A;  5IHV A;  5CXW A;  2XFS A;  3G32 A;  1K6R A;  3ZNY A;  4N1H A;  2DRW A;  3HUO A;  1YM1 A;  3FKV A;  5GHY A;  2HP6 A;  3IXH A;  2ZM8 A;  3Q07 A;  2Y2L A;  4MNR A;  1L0E A;  3UO9 A;  5DTS A;  4JXW A;  1YMX A;  3OPR A;  4GNU A;  4RX2 A;  4K0X A;  1CI8 A;  1H5X A;  2EXA A;  2WAF A;  4R4S A;  3NBL A;  4HES A;  5J8X A;  1RGY A;  1ALQ A;  1PW1 A;  2WKI A;  1K6S A;  4FCF A;  1PI5 A;  3VFH A;  4QY5 A;  4UA7 A;  3W8K A;  4QHC A;  3OC2 A;  1K25 A;  1PIO A;  2IWB A;  1W5D A;  4Y0O A;  4PM5 A;  2EX8 A;  5FQM A;  2PU4 A;  3HRE A;  4X53 A;  4FD8 A;  4ZAM A;  3GV9 A;  1CEF A;  3NDE A;  3UN7 A;  4S2P A;  1AXB A;  5L2F A;  3BEB A;  4EBN A;  3AGE A;  4X6T A;  2WGV A;  2G2W A;  2WGW B;  4UA6 A;  3OPH A;  3GQZ A;  1ONG A;  3UE0 A;  3PBO A;  3O3V A;  4JF5 A;  1HZO A;  4E3L A;  1K54 C;  5FA7 A;  3ZG5 A;  3N8R A;  1DJC A;  1L0G A;  5FQJ A;  2CC1 A;  2VGK A;  4RA7 A;  1VQQ A;  1JTD A;  4M3K A;  3HLW A;  1N4O A;  2BLS A;  1KGE A;  1SCW A;  2HDU A;  5AQA A;  1E25 A;  4KQO A;  2ZC4 B;  3PAE A;  3Q82 A;  2IWD A;  3ZVT A;  1CEG A;  2XLN A;  5FAT A;  2B5R A;  3Q1F A;  1PWD A;  1EI5 A;  5GLB A;  1GA0 A;  1K54 A;  2Y2J A;  3GVB A;  5TFQ A;  3W4O A;  1KDS A;  3FKW A;  1L0F A;  1JVJ A;  1C3B A;  2ZLY A;  3LO7 A;  4JPM A;  5CGS A;  3SS4 A;  4C6Y A;  5KSC A;  3PBN A;  3VP3 A;  1ES4 A;  1H8Y A;  3W4P A;  3EQU A;  5FI2 A;  4K0W A;  2UWX A;  4DE3 A;  4R3J A;  4KZ6 A;  3VP2 A;  4X55 A;  5F1F A;  4X68 A;  1ZG4 A;  4E3J A;  2XDM A;  2ZC3 B;  4GD6 A;  3VP1 A;  4B4Z A;  5CHJ A;  1DJB A;  5KZH A;  1KE0 A;  4WBG A;  3BLM A;  5HL1 A;  3G4P A;  4JXG A;  5DF8 A;  3JYI A;  1PZO A;  1LHY A;  5HAI A;  3IHB A;  3LY4 A;  4DE2 A;  2VGJ A;  2ZQ7 A;  4BD0 A;  3SH9 A;  4MEZ A;  1JTG A;  1GA9 A;  2EXB A;  1MWR A;  3O87 A;  1ERO A;  2ZQD A;  1MWT A;  4KG6 A;  5AQ9 A;  4OH0 A;  3WS4 A;  4EBP A;  4XXR A;  4F94 A;  1RP5 A;  1IYQ A;  5BOH A;  4BQM A;  1YLJ A;  4PM8 A;  3IWI A;  2QZ6 A;  1NRF A;  3VMA A;  4JXS A;  3M2K A;  3OCN A;  3UPP A;  4DDY A;  4E3I A;  5CGX A;  2X02 A;  4JXV A;  2IWC A;  5EVI D;  2P9V A;  5EOE A;  5M18 A;  3GSG A;  3ZNT A;  1L2S A;  4GKU A;  3MZD A;  1I2S A;  1LI0 A;  2XK1 A;  2ZQC A;  2Z2L B;  3TSG A;  4DE0 A;  4OOL A;  4CPK A;  4R1G A;  5JYP A;  4R4R A;  3VOZ A;  4Q8I A;  2Y2Q A;  2J7V A;  4EQI A;  4R3B A;  5A92 A;  2WAD A;  3A3J A;  1K38 A;  1XA7 A;  1FCN A;  3A3I A;  3BFE A;  5HFO A;  5HW3 A;  5E2E A;  2Y2N A;  2JE5 A;  4B88 A;  3UE3 A;  1WYB A;  3BFG A;  4GB7 A;  2X71 A;  2WYX A;  3V3R A;  3BFC A;  2V2F F;  3S22 A;  1KGF A;  2WUQ A;  3UDF A;  1MXO A;  3SH7 A;  2OSU A;  2ZC5 B;  1Q2P A;  4HBT A;  1BUE A;  4MBK A;  2X01 A;  4WZ4 A;  1K57 C;  4LV1 A;  3N4I A;  1ZG6 A;  4H8R A;  4KZ5 A;  2ZM2 A;  3A3F A;  1LLB A;  5I94 A;  3AGF A;  5EE8 A;  2RCX A;  5HX9 A;  3UDI A;  3UY6 A;  4EUZ A;  2FFF B;  3PAG A;  1XPB A;  2Y2P A;  3BEC A;  3LY3 A;  4DF6 A;  2PBY A;  3IHA A;  3LEZ A;  4ID4 A;  2ZJ9 A;  1KDW A;  3MKE A;  4GDN A;  1K57 A;  2EX9 A;  4PM7 A;  2GDN A;  2OLV A;  2H0T A;  5DTK A;  3IF6 B;  2PU2 A;  5HAQ A;  5A93 A;  1K4E A;  4KQR A;  1IYS A;  3WS0 A;  3MBZ A;  2OV5 A;  2P9V B;  2H0Y A;  5DF7 A;  4EWF A;  1XKZ A;  2WGI A;  1ERQ A;  1EWZ A;  3CZD A;  3BYD A;  4YFM A;  4CJN A;  3N7W A;  4DDS A;  4QU3 A;  1XX2 A;  4OP5 A;  3DTM A;  3WWX A;  3BFF A;  2BG1 A;  3IWQ A;  4QD4 A;  2EX2 A;  4S2N C;  3SH8 A;  4IBX A;  2ZM0 A;  5CGW A;  3PTE A;  3HLD A;  3S4X A;  3W4Q A;  1ZC2 A;  4E3K A;  1IKG A;  3OPP A;  2Y4A A;  4RYE A;  1HTZ A;  5EVI A;  4LCM A;  3MZE A;  1HVB A;  3WS1 A;  1FQG A;  3UPN A;  2WKH A;  3IT9 A;  5CRF A;  1FR6 A;  4E6W A;  3BM6 A;  4ZTK A;  3C7V A;  5E2F A;  4S2N A;  3ISG A;  3Q81 A;  3V39 A;  1J9M A;  3HLF A;  2FFY A;  1XP4 A;  2G2U A;  5FI6 A;  3EQV A;  4NK3 A;  4OON A;  4K91 A;  1KVM A;  5FQQ A;  5GL9 A;  3C5A A;  3PBS A;  1SKF A;  5DTT A;  1PI4 A;  3IXB A;  1BUL A;  1W8Y A;  1IYP A;  4IBR A;  4XUX A;  3G35 A;  5EEC A;  3FZC A;  1BT5 A;  1JWZ A;  4OLG A;  5CED A;  3IXG A;  1RGZ A;  3MXR A;  1BLH A;  2J9O A;  4XUZ A;  5D3O A;  1LL9 A;  2JBF A;  2JC7 A;  1ERM A;  4R0Q A;  4IED A;  3SS5 A;  1PYY A;  1E4D A;  4ZJ2 A;  4RVA A;  3WRZ A;  1Y54 A;  1MPL A;  2Y91 A;  4LCL A;  5FAP A;  3V50 A;  4BLM A;  3FYZ A;  4LV3 A;  4A5R A;  4ZJ3 A;  5KMW A;  3Q7Z A;  1RCJ A;  3LCE A;  3MFD A;  4WEL A;  2EFU A;  4MBH A;  4HEF A;  3HLG A;  3MXS A;  2HDS A;  3FV7 A;  3I7J A;  3CG5 A;  4FH4 A;  1QMF A;  3G31 A;  3N6I A;  4P6B A;  1M40 A;  3HLC A;  2Y2K A;  1NZU A;  2XR0 A;  4EV4 A;  4OLD A;  1WYC A;  2WAE A;  3BRM A;  4KQQ A;  2HP9 A;  1DY6 A;  3QNC A;  1MWS A;  4D2O A;  4E3M A;  3VSL A;  2V20 A;  1PWG A;  2QMI A;  5AQB A;  5DVA A;  3OCL A;  3ZGA B;  2C5W B;  1NZO A;  2ZQA A;  1BZA A;  4NET A;  4OPR A;  4OPZ A;  1MY8 A;  4DXB A;  1IYO A;  4UHU A;  2XQZ A;  1W8Q A;  5FQK A;  5TGF A;  2JCH A;  2Y2H A;  1JWV A;  1GCE A;  3D4F A;  3OPL A;  3CJM A;  4JF4 A;  2ZC7 A;  3E2K A;  4BEN A;  5EPH A;  1E3U D;  4HBU A;  5E2G A;  1IEM A;  4KZ9 A;  3G2Y A;  3IH9 A;  5G18 A;  5GHZ A;  1JWP A;  3UDX A;  3G2Z A;  1TDL A;  4KZA A;  4N1X A;  2XEP A;  2R9X A;  3RXW A;  3IXD A;  3Q7V A;  2XD1 A;  4Z9Q A;  3S1Y A;  2EX6 A;  5CER A;  2EFX A;  4IVI A;  1NYY A;  5A91 A; 
#chains in the Genus database with same CATH topology
 3KSI A;  1LI9 A;  1YLY A;  3W99 C;  4LGW A;  1YU4 A;  4GOG A;  2YKH A;  5E5A C;  5CEB A;  4S2J A;  4MBF A;  2BYM B;  3X1T C;  1P3K C;  4UA9 A;  5FL3 A;  4Z5T C;  5BNV B;  4H9O A;  3KWQ D;  3IF5 A;  1N9O A;  2V1Z A;  3HJI A;  5B33 C;  1LL8 A;  4N92 A;  4RQ9 A;  4WZ5 A;  3FC7 A;  4CLC C;  1Y28 A;  4KZ4 A;  2W3H A;  3HLB A;  2H10 A;  4S2L A;  4PM9 A;  4IBK A;  3WTP D;  3A1K A;  3HUM A;  5B24 D;  1MKM A;  4OQ0 A;  5LBR A;  1OJ5 A;  3O62 B;  3EPK A;  4MB3 A;  5JA4 A;  3KXB C;  4Y3I A;  4U3T A;  2WZX A;  3LIF A;  1PZP A;  1DJA A;  4GHI A;  2Y2O A;  4DJ3 A;  3TJZ C;  1TZY C;  2HDR A;  4EBL A;  4HP9 A;  1QME A;  4OJP A;  4JLF A;  4WMC D;  4JF6 A;  3AZK C;  3VP0 A;  1E3U A;  5AVC B;  4L9F A;  4S2K A;  3HVF A;  5GSU D;  3AZH C;  4E3N A;  4BL2 A;  1S4S A;  4H9P B;  4OPQ A;  1SHV A;  1M19 C;  4OP8 A;  2PYO C;  3B6G B;  4QB8 A;  1KE3 A;  2O9A A;  1P3M A;  2Q0O A;  5K5B A;  1H8M A;  4QLC D;  4MCW A;  3E2L A;  4R38 A;  4GD8 A;  3LZ1 C;  2PR6 A;  1VET A;  5FUG B;  3B3X A;  4KZ8 A;  1CK3 A;  1YLT A;  3A3D A;  5CTN A;  3HL9 A;  3WRT A;  4HOI A;  3NHQ A;  4P85 A;  3FPW A;  5A90 A;  1N9B A;  2OLU A;  2VLG A;  1U35 D;  3N3F A;  4Z2M H;  2F8N D;  1NLY A;  4J8U C;  4GW9 A;  3AZL D;  4YIN A;  4IJE A;  1XA1 A;  5AY8 C;  3W97 B;  3NEC A;  1L3L A;  1LSV A;  3MVD D;  5EVL A;  3AN2 B;  3WTP A;  3AZN C;  1Q2Q A;  3BLS A;  1BH8 A;  1OTE A;  3NI9 A;  3QP1 A;  5C5K A;  5B24 A;  3E4P A;  2FZ0 A;  4WN5 A;  3BY8 A;  4C75 A;  1XJ6 A;  4ZDX A;  4DRB A;  5G49 A;  1M18 D;  2ZD8 A;  2ARO C;  4KEN B;  2A3U A;  1ODV A;  5B40 C;  5B31 D;  3REK D;  4QY6 A;  1YLW A;  2E8J A;  3AZF C;  3MZF A;  4R70 A;  3QHY A;  4WMC A;  1OME A;  5B0Z B;  2J3T C;  5GSU A;  3NY4 A;  4JKT A;  2CV5 B;  3V3S A;  1NXY A;  3A6N B;  4GZB A;  3ZVW A;  4JBF A;  2WKQ A;  4WNN A;  4J8X D;  3B0D C;  4LG2 A;  3ZFZ A;  4QLC A;  3EPH A;  1P3L B;  3MGR C;  3N8L A;  4ZBE A;  1FCM A;  1BLC A;  4Z2K A;  3IQA A;  4UQI M;  4EEP A;  1K0K A;  4BJP A;  1YT4 A;  3T4J A;  4DN0 A;  4N1H A;  1U35 A;  3LIA A;  3NOP C;  2F8N A;  3SZT A;  3MQO A;  2HP6 A;  3IXH A;  4KUK A;  3AZL A;  3WD4 A;  3Q07 A;  4G92 C;  4MNR A;  3UO9 A;  3FDD A;  3MVD A;  5DFY A;  4JXW A;  4RX2 A;  3CUE A;  1CI8 A;  2EXA A;  4R4S A;  4G3W A;  3REH C;  2B95 A;  1P3A B;  4QHC A;  4WLA A;  3OC2 A;  3R45 A;  2IWB A;  1P3F B;  1M18 A;  4FD8 A;  1T1C A;  4H9Q B;  5L2F A;  3LR5 A;  3BEB A;  3AGE A;  1YSQ A;  5B31 A;  3REK A;  2WGV A;  2WGW B;  1GSW A;  4CSR B;  3OPH A;  3MNN C;  3GEC A;  4OUI A;  1K54 C;  3IBR A;  3KWQ C;  2CC1 A;  3W99 B;  5HDD A;  2BLS A;  1SCW A;  1P3O B;  1E25 A;  4KQO A;  1PRQ A;  2ZC4 B;  3C30 A;  3X1T B;  1P3K B;  1KX5 B;  3OOV A;  3X1V C;  4Z5T B;  2Y2J A;  4FTX A;  3UMD A;  4D60 A;  3B6G D;  2ZLY A;  3LO7 A;  4MN6 A;  3EPJ A;  5CGS A;  5B33 B;  3VP3 A;  4JGP A;  3W4P A;  2OAQ 1;  5GT3 D;  4KZ6 A;  3VP2 A;  4IUK A;  2ZMF A;  3R7W B;  2XDM A;  2ZC3 B;  5AV9 D;  2BYM A;  2GZA A;  3DBA A;  5HAI A;  1BYW A;  5BNV A;  4EO5 C;  1YUE A;  3KXB B;  4G91 B;  4I3I A;  4BD0 A;  1JTG A;  3K2N A;  2ZMV A;  2EXB A;  4KG6 A;  1MWT A;  3CAX A;  5GSU C;  5FEG A;  3WS4 A;  3W97 D;  4XXR A;  4F94 A;  1IYQ A;  5J4E A;  3AN2 D;  4BQM A;  1YLJ A;  4PM8 A;  3VMA A;  4WV4 B;  4JXS A;  4GCZ A;  1YPR A;  3AZK B;  1W63 M;  2XRN A;  3AZH B;  4GKU A;  3MZD A;  4Q0I A;  2YFV B;  1BH9 B;  4R4R A;  2BAS A;  4CLC E;  2P7J A;  4R3B A;  3LZ1 B;  5A92 A;  1U35 C;  1XA7 A;  5HW3 A;  4JGR A;  2EWV A;  3BFG A;  3AZL C;  2WYX A;  2X71 A;  5BT1 D;  3MQQ A;  2V2F F;  4OJ6 A;  3UDF A;  2YKF A;  3MVD C;  2V8C A;  2CV5 D;  3NUL A;  4HBT A;  4H9P A;  1E6R A;  3C2W A;  3IX4 A;  3A6N D;  1N9N A;  3B6G A;  2J8P A;  3EEA A;  1M1A B;  4HJ3 A;  1P3L D;  5AY8 B;  4O0P A;  5CPI B;  3PAG A;  5FUG A;  5GT3 A;  2UV0 E;  2QKP A;  3UTA B;  3LY3 A;  1W1Y A;  5DNM B;  3VH6 A;  4WU8 C;  2GDN A;  5AV9 A;  1HLU P;  3KO6 A;  5A93 A;  5B31 C;  3REK C;  4KHA B;  4KQR A;  3TU4 C;  2QJ7 A;  3MBZ A;  4YOF A;  4EWF A;  1XKZ A;  1ERQ A;  3LUQ A;  4R3A A;  4YFM A;  2ARO B;  5B32 C;  5B40 B;  3BFF A;  2BG1 A;  3W97 A;  3AN2 A;  1W1P A;  3AZF B;  2ZM0 A;  2K7S A;  4J8X C;  4E3K A;  3K3D A;  1S32 D;  1KX3 C;  3MZE A;  1OGG A;  2BYK B;  4NZ1 A;  4E45 A;  1P3A D;  4ZTK A;  4S2N A;  1P3F D;  3V39 A;  3C1C B;  1XP4 A;  5FI6 A;  1DRM A;  3PR6 A;  2HUE C;  3MGR B;  3PBS A;  1SKF A;  1IYP A;  3G35 A;  3FZC A;  3H82 B;  5CED A;  4ARZ B;  4M4X A;  4XUZ A;  1LL9 A;  5B1M B;  2JBF A;  3IX3 A;  2JC7 A;  3ULF A;  3W99 D;  3LR3 A;  4R0Q A;  5B0Y C;  4LRY C;  4H9S A;  1E4D A;  4ZJ2 A;  2CV5 A;  3WRZ A;  5E5A D;  3A6N A;  2V9A A;  3Q7Z A;  3X1T D;  1P3K D;  1KX5 D;  3LCE A;  4Z5T D;  1P3L A;  4FH4 A;  3G31 A;  5B33 D;  1FIK A;  2PD7 A;  4ETZ A;  3T4L A;  3UB7 A;  2LB9 A;  3O62 C;  1OTD A;  2WAE A;  3BRM A;  1DY6 A;  3WD2 A;  3VSL A;  4EQ1 A;  2V20 A;  2MJ6 A;  3S7N A;  3L9K A;  5CPK C;  2FJ7 B;  4OPR A;  4EET B;  4DXB A;  2O99 A;  2XQZ A;  3L26 A;  2GJ3 A;  1GCE A;  5TBM A;  1H3O B;  4KQD A;  3KXB D;  2V0U A;  5E2G A;  1IEM A;  4KZ9 A;  3MNN B;  3IH9 A;  5GHZ A;  3UDX A;  5AVC C;  3G2Z A;  1TDL A;  2QHK A;  5BO0 B;  3F1O B;  2R9X A;  3G6O A;  2YFW B;  2XD1 A;  1VEU B;  3KSH A;  1S32 A;  4R8P C;  2W1T B;  1P3A A;  2XA7 S;  2CMN A;  3AZK D;  1P3F A;  5F69 A;  4QJG A;  3ITB A;  5DJU A;  3AZH D;  1B67 A;  1I2W A;  1MC0 A;  3PYP A;  2G5I C;  2ZM5 A;  5F68 A;  4Z66 C;  1M19 D;  3LID A;  1MKI A;  3MQL A;  2XFT A;  4S2I A;  4H6J A;  3ZG0 A;  4CSR A;  4WYY A;  3MGQ B;  3T4T A;  3AZI B;  3LZ1 D;  1TEM A;  1MZU A;  3DWK A;  4WF0 A;  3W99 A;  4ESP A;  2J8Y A;  1P3I B;  3ZDJ A;  2VKS A;  1ESI A;  5E5A A;  3KX0 X;  4EXO A;  1G6A A;  3X1T A;  1P3K A;  1KX5 A;  1J7M A;  4Z5T A;  2A49 A;  3CMZ A;  1CI9 A;  3B6F B;  4J8U D;  1BSG A;  3LR4 A;  3WX7 A;  2HGV A;  5B33 A;  4NXE A;  1M1A D;  4NFT A;  5B2J C;  4MDZ A;  5AY8 D;  4X69 A;  5CPI D;  2L1M A;  3KSF A;  3UTA D;  2QPN A;  3AZN D;  5DNM D;  3AZE C;  4IBC A;  3Q7V B;  1FIL A;  1XJ4 A;  3AGD A;  5HDC A;  3WTP E;  3AFA B;  1G68 A;  3UT9 B;  5CTM A;  3MR0 A;  3KXB A;  5FQI A;  1VHM A;  3A1I A;  5GHX A;  4Y0T A;  2JKR I;  4J8W C;  2ARO D;  1E6P A;  3IH8 A;  5B0Z C;  5B40 D;  2CV5 C;  1KVL A;  1V9Y A;  4HGA C;  1P3B C;  3IS2 B;  4OQI A;  3AZF D;  3AZM B;  4GHL A;  4RX3 A;  5B1L B;  1OGB A;  3S7P A;  2JHE A;  2ZMA A;  3AZK A;  1L0D A;  3MQ0 A;  3P01 A;  3OZH A;  2J3T D;  4LPZ A;  5F82 A;  3U4L P;  3ZG9 B;  3AZH A;  2G7U A;  5EFW A;  1LL5 A;  1V9Z A;  4E44 A;  1FR1 A;  1M19 A;  2PYO A;  3P09 A;  1BH9 A;  4PAU A;  1UGU A;  3C4O A;  1TS0 A;  3O5Y A;  3P98 A;  2V1B A;  3LZ1 A;  3MGR D;  3ZG7 B;  2Q9N A;  3C1B C;  1MWU A;  5DKK A;  1N9L A;  4FUW A;  3V9R A;  4KZ3 A;  1W79 A;  4KZ7 A;  4WU8 B;  4NKP A;  3ZCZ A;  3AZJ C;  3KFU G;  1PWC A;  2HJ9 C;  4KG5 A;  4PMA A;  3TE8 A;  2V5O A;  3NIA A;  3T1R A;  5IS1 A;  3GRJ A;  5EUA A;  3TU4 B;  1FSW A;  5AV5 C;  4EER A;  5EVI B;  3NQU B;  1SDE A;  4J8U A;  3IF6 C;  2WKP A;  2VGL S;  5F1G A;  3M6B A;  1M1A A;  5B32 B;  1TS8 A;  5AY8 A;  5CPI A;  1FOF A;  3L27 A;  3UTA A;  4YS3 B;  4Z2J A;  2DQN C;  1O6I A;  1GHI A;  3AZN A;  3UME A;  4N9K A;  3V5M A;  5IT5 A;  4S2M A;  1GOI A;  3WS5 A;  1KX3 B;  4Y0U A;  3S7O A;  3REH D;  3NCK A;  2PAV P;  4OQG A;  3RTY A;  4G3K A;  3GDI A;  2ARO A;  1S67 L;  1NYM A;  3HLE A;  1UWP X;  2HUE B;  4O7D A;  5B40 A;  3W96 C;  3FKE A;  1P3O C;  4Y7P A;  2ZOI A;  3MNN D;  3AZF A;  2DNS A;  3O88 A;  1KX5 C;  3REL B;  5GT0 B;  5AV6 B;  3X1S B;  4P6Z M;  4IBF A;  3MS6 A;  2BYK A;  5B0Y B;  1SDN A;  4PPR A;  5U47 A;  3UE1 A;  5DNN B;  3S7Q A;  4OOM A;  2J9P A;  5HAP A;  3X1V D;  4NXB A;  5EVE A;  1XGJ A;  1YLZ A;  5MC7 A;  2XFS A;  5CPJ B;  1K6R A;  3ZNY A;  3MGR A;  2HJE A;  3FKV A;  3MGQ D;  2ZBB A;  2ZM8 A;  3H82 A;  1KOU A;  3AZI D;  2OOL A;  4I5S A;  4I3A A;  3AV1 C;  4G91 C;  1P3I D;  1YMX A;  4IBG A;  2JKF A;  4IJF A;  3IBJ A;  1H5X A;  3NBL A;  5CPK B;  5J8X A;  4YM6 B;  1HQ3 C;  1PW1 A;  2WKI A;  1K6S A;  4FCF A;  3W8K A;  1PIO A;  5GXQ B;  1W5D A;  5EV0 A;  3HRE A;  4X53 A;  1P9R A;  4ZAM A;  3GV9 A;  1CEF A;  1XJ2 A;  4EBN A;  1P3G C;  4X6T A;  2RVQ C;  2V0W A;  2LY8 A;  3REH A;  4R8P B;  1ONG A;  1Z2C B;  3N8R A;  1L0G A;  3AV2 C;  3F1N B;  4RA7 A;  1VQQ A;  3B47 A;  3T4K A;  2ZOH A;  3AFA D;  4Z66 B;  1H3O A;  3PAE A;  2XLN A;  2IA2 A;  4CAY B;  1JNU A;  3MNN A;  1PWD A;  1AIW A;  5BO0 A;  3F1O A;  1K54 A;  2CWE A;  5GLB A;  5TFQ A;  2YFW A;  1L0F A;  1JVJ A;  1VEU A;  3KWQ A;  3W98 C;  4JPM A;  4ETX A;  5KSC A;  3FPV A;  4C6Y A;  2H28 A;  1F66 C;  2W1T A;  5B1L D;  4DRA A;  1M1A C;  1EAK A;  2PBD P;  5CPI C;  3UTB B;  3X1V A;  5F1F A;  1ZG4 A;  3UTA C;  5DNM C;  3NJA A;  2INW A;  5KZH A;  3LJA B;  1LSW A;  1XFQ A;  3G4P A;  5DF8 A;  3MGQ A;  5B2J B;  1LHY A;  4NY2 A;  1L6J A;  3AZI A;  3SH9 A;  3MSH A;  1P3I A;  2ZY5 A;  2VV7 A;  3WKJ B;  3AZE B;  1MWR A;  4WU8 D;  4IHQ A;  4HP4 A;  3C38 A;  5BOH A;  5AVB C;  3VH6 T;  3MGP B;  3UPP A;  3TU4 D;  3EGD C;  4E3I A;  5EM0 A;  2X02 A;  5C3I B;  3QP2 A;  2IWC A;  2D49 A;  5EVI D;  3GSG A;  3ZNT A;  4J8W B;  1LT0 A;  2P08 A;  2VK3 A;  5B32 D;  2RTS A;  3WAA C;  2Z2L B;  3TSG A;  4CPK A;  4R1G A;  4HGA B;  5JYP A;  1P3B B;  4Z1W A;  4R6L A;  4HJ4 A;  3VH6 W;  3C1C C;  2JKT I;  3B0C T;  2J7V A;  4WU9 B;  1KX3 D;  3TRC A;  4NXF A;  5CHL B;  3A3J A;  3A3I A;  3BFE A;  5HFO A;  2JE5 A;  1E6N A;  3F1P B;  3L2A A;  3CLO A;  5FDS A;  4GB7 A;  4QNL A;  3NQJ B;  3V3R A;  5B1M C;  1MXO A;  1JFI B;  1F9I A;  3B0C W;  3C1B B;  1K57 C;  4MB5 A;  3N4I A;  3IS2 A;  4EW7 A;  1ZG6 A;  3T1X A;  4NE3 A;  4KZ5 A;  5B1L A;  5AV6 D;  3X1S D;  3AZJ B;  3UY6 A;  3K3C A;  4UEY A;  2DMW A;  1XPB A;  5B0Y D;  5DNN D;  5AV5 B;  4J8V B;  3LEZ A;  4ID4 A;  5B2I C;  3ZQ5 A;  4PM7 A;  4LLO B;  2OLV A;  1KX4 C;  2H0T A;  3IF6 B;  5JRG C;  1IOU A;  1N1J B;  1IYS A;  3WS0 A;  5CPJ D;  2P9V B;  2H0Y A;  4IBE A;  5DF7 A;  2FJ7 C;  2O0Y A;  3N7W A;  3O62 D;  2KX6 A;  4QU3 A;  4WU8 A;  3X1U B;  3DTM A;  1T19 A;  2EX2 A;  4IBX A;  5CGW A;  3TU4 A;  3PTE A;  3KSG A;  5CPK D;  1IKG A;  4RYE A;  5EVI A;  3TW8 A;  1FQG A;  1OTI A;  3UPN A;  4LD9 B;  2WKH A;  3IT9 A;  5B32 A;  2R78 A;  5DKL A;  3BM6 A;  3W96 B;  1E6Z A;  3DTE A;  2FFY A;  4UPK A;  5AVC D;  4J8X A;  3D72 A;  4PKY G;  3EQV A;  4NK3 A;  1ZTU A;  1KVM A;  5GL9 A;  3C5A A;  1KX3 A;  5DTT A;  3HJK A;  1PI4 A;  4IBR A;  4R8P D;  1CF0 A;  3IXG A;  3MXR A;  3MGQ C;  1EW0 A;  2J9O A;  5I5L A;  4HY8 A;  5G4Z A;  5D3O A;  3AZI C;  3T4Q A;  2Y79 A;  1ERM A;  1P3I C;  4Z66 D;  1MPL A;  3F6T A;  5FAP A;  3V50 A;  4BLM A;  4A5R A;  3REJ C;  1YU2 A;  1OPX A;  1RCJ A;  4OJL A;  3MFD A;  1YKD A;  4WEL A;  4MBH A;  5AV6 A;  3X1S A;  2HDS A;  3I7J A;  4II7 A;  3CG5 A;  3AV1 B;  5B0Y A;  3B6F C;  1A0K A;  5DNN A;  5BS7 C;  2XR0 A;  4EV4 A;  4Z2H A;  2Y8H A;  4HJ6 A;  1HQ3 B;  3AYW C;  3UTB D;  4D2O A;  5DFX A;  1PWG A;  3EWK A;  4Y2F A;  5DVA A;  5CPJ A;  4KUO A;  2OWJ A;  3OCL A;  4QPR A;  2ZQA A;  4OPZ A;  1ID3 C;  1MY8 A;  5FQK A;  5B2J D;  2JCH A;  3O62 A;  2PYR A;  4MMN A;  1GSX A;  1P3G B;  3AFA C;  3UT9 C;  4YNR A;  4KGC C;  3VOL A;  5G18 A;  3AZE D;  1Q9C A;  1JWP A;  3V67 A;  3PHY A;  4N1X A;  3RXW A;  4X25 A;  5CPK A;  3IXD A;  2W8S A;  4Z9Q A;  3AV2 B;  3S1Y A;  3H0L C;  2EX6 A;  3MGP D;  3EOI A;  4IVI A;  4QWO A;  1NYY A;  4ME4 A;  3AZM C;  3PBT A;  5B1L C;  3G30 A;  3SS3 A;  4J8W D;  4DXC A;  5B0Z D;  5AVC A;  1Y4O A;  2P74 A;  4E6X A;  3RXX A;  3W98 B;  3A0R A;  1P3B D;  1S1Y A;  3W2Z A;  4R8P A;  1F66 B;  2Y55 A;  3EGX C;  4YWZ A;  1BTL A;  2XH9 A;  4OOY A;  2JKG A;  4ZUX B;  4UAA A;  4Y17 A;  3F1N A;  1X0O A;  2ZL1 B;  3NOT C;  3H0M C;  4OVD A;  4Z66 A;  1BLP A;  2RL3 A;  3NC8 A;  4WUJ A;  5F5Y A;  3T12 B;  1HTA A;  1TDG A;  3D9Y A;  3TG9 A;  2NZD C;  2ZQ8 A;  4UUZ B;  3C1B D;  1WA9 A;  4WM9 A;  5HAR A;  5EVI C;  5IU1 A;  5JYO A;  3AZJ D;  5FAQ A;  5AVB B;  2W1R A;  4MB4 A;  3UTB A;  3C4P A;  5KIZ A;  2Z6D A;  1UR9 A;  1G28 A;  5AV5 D;  4YS3 C;  3KUY C;  4J8V D;  3O86 A;  2C6W B;  1GXD A;  4L0L A;  5E43 A;  4PM6 A;  4BWI A;  4HH3 A;  3WS2 A;  5TR7 A;  2DCF A;  5B2J A;  3WAA B;  3NDG A;  1TS7 A;  1P3P C;  3VSK A;  3HSH A;  5DJT A;  2VJW A;  1P97 A;  1ES5 A;  3KYZ A;  3M2J A;  2WZZ A;  4JGO A;  3AZE A;  3BQ8 A;  2Y2M A;  1F5M A;  3LIC A;  3PBR A;  2XF3 A;  4HMD A;  2E8I A;  1S6R A;  2O9B A;  1OTA A;  3A3E A;  1K55 C;  1YQS A;  3MKF A;  4H9O B;  1UR8 A;  3REL C;  1AWI A;  5GT0 C;  5AV6 C;  3X1S C;  4J8W A;  5B0Z A;  3ITA A;  1W7F A;  3D3O A;  4BL3 A;  5DNN C;  3W96 D;  1GHP A;  1P3O D;  3P7N A;  1P3B A;  5GLA A;  4GHA A;  4H9N B;  5HPF A;  1OJG A;  4XT2 B;  3CWF A;  1NJ4 A;  5CPJ C;  4BBU A;  2Y2G A;  1TF1 A;  4P87 A;  1D7E A;  3GR2 A;  5B2I B;  5JA4 B;  3ICY A;  3F1P A;  1KX4 B;  5BNX B;  4U0T A;  5JRG B;  4DRT A;  1KE4 A;  4IVK A;  1FCO A;  2Y59 A;  4IBI A;  3DTI A;  4EES A;  3C1B A;  5A8B A;  1YMS A;  4YM6 C;  2J80 A;  5FI7 A;  3C7U A;  1KGG A;  4F3L B;  3AZJ A;  1ONH A;  1ED7 A;  1ESU A;  1W2E A;  4PHT A;  3AV1 D;  5GXQ C;  3AZG C;  1PZR A;  4S2O A;  1TVF A;  5CP6 B;  5AV5 A;  4J8V A;  1ZKJ A;  3UNW A;  1HQ3 D;  3MGS C;  3IF6 A;  2F8N G;  1S0W A;  5F83 A;  1P3M B;  2EA9 A;  1N1J A;  4KZB A;  3GMW A;  5EM1 A;  4L9E A;  1PDC A;  4I3J A;  4H9Q A;  1P3G D;  3ZG8 B;  2RVQ D;  1WE4 A;  4WEJ A;  1ZLA B;  2HIO C;  2WGW A;  5FAO A;  1DP9 A;  4GS9 B;  2IO5 C;  5HZH A;  3SOI A;  3LZ0 B;  3AV2 D;  3M6H A;  4NE6 A;  4HQA A;  3UPO A;  2WK0 A;  4OQH A;  4LV0 A;  1MBL A;  3VH5 A;  4DMZ A;  4Z2G A;  2VA0 A;  3W96 A;  4R23 A;  1P3O A;  3PBQ A;  4IUH A;  5FAS A;  3REJ B;  4LRX C;  3UTB C;  4H9R B;  1KS0 A;  1FSY A;  3FG8 A;  4GLQ A;  3UE6 A;  3VV4 A;  2XRO A;  1BH8 B;  3W98 D;  2DRW A;  5B24 B;  3LI8 A;  3REI C;  3HUO A;  3LEL C;  1YM1 A;  5GHY A;  1F66 D;  3LJA C;  4KUD C;  2NUP C;  1L0E A;  4UQI S;  3AYW B;  1YAX A;  1T1A A;  5DTS A;  4X1M A;  3R7W A;  3WKJ C;  1ID3 B;  4HES A;  2VQR A;  1RGY A;  2B18 A;  3VE4 A;  4QY5 A;  1S4R A;  4UA7 A;  3MGP C;  3CHW P;  5C3I C;  4Y0O A;  4KGC B;  2EX8 A;  4HMC A;  3AV1 A;  5FQM A;  1R4V A;  3NDE A;  3UN7 A;  1AXB A;  2HF6 A;  1HQ3 A;  3BW6 A;  5AVB D;  2G2W A;  3OBF A;  2JSS A;  3UE0 A;  3GQZ A;  4QLC B;  4JF5 A;  1HZO A;  4E3L A;  3ZG5 A;  3PXP A;  1DJC A;  2J3W A;  4WU9 C;  2VGK A;  4BBV A;  1JTD A;  1P34 C;  3HLW A;  1N4O A;  3WAA D;  1KGE A;  2HDU A;  5AQA A;  2JN7 A;  1P3G A;  2WKR A;  2QWS A;  3T4O A;  4JJN B;  1EQZ C;  2IWD A;  3ZVT A;  5FAT A;  2YFV A;  3C1C D;  1G6O A;  3Q1F A;  1GA0 A;  3W4O A;  4EU0 A;  1KDS A;  2KLI A;  3FKW A;  3AV2 A;  2F8N B;  4NYY A;  1C3B A;  4DJ2 A;  3PBN A;  4O8G A;  1ES4 A;  5HPI A;  5FI2 A;  1P9W A;  4K0W A;  4DE3 A;  5B1M D;  3L29 A;  4B93 A;  4Z2I A;  4X68 A;  4E3J A;  4GD6 A;  2NQB C;  2NZD B;  4B4Z A;  4J8V C;  3W98 A;  1TD5 A;  1P0Z A;  3A0V A;  4MN5 A;  1T1B A;  5HL1 A;  1F66 A;  1J3W A;  3JYI A;  1PZO A;  3IHB A;  1E15 A;  2VGJ A;  4MEZ A;  2ZL1 A;  3BJN A;  3KUY B;  1GA9 A;  4HIA A;  5B2I D;  1ERO A;  2PD8 A;  2ZQD A;  5DNM A;  5AQ9 A;  4BBT A;  1SKO B;  1KX4 D;  4Z2L A;  4EBP A;  3X1U C;  5JRG D;  4PKY A;  2QZ6 A;  1NRF A;  5F99 B;  2IOU A;  4KHA A;  1ACF A;  5CGX A;  2D02 A;  1P3P B;  2FJ7 D;  1L2S A;  2XK1 A;  2ZQC A;  4LD9 C;  1VB6 A;  2KDK A;  4DE0 A;  1T18 A;  5AVB A;  1A7W A;  4Q8I A;  2Y2Q A;  5CP6 D;  2JKR M;  3WD1 A;  4EQI A;  5AVE A;  4HHD A;  1FCN A;  5E2E A;  2Y2N A;  3JVU A;  3WAA A;  1STZ A;  1WYB A;  2K2N A;  2KOI A;  3CPT B;  3BFC A;  3C1C A;  3E98 A;  2WUQ A;  3S22 A;  3DAV A;  3SH7 A;  1BFM A;  4NEE D;  1BUE A;  4MBK A;  2X01 A;  4LV1 A;  1ZLA D;  2OAP 1;  2P04 A;  4H8R A;  3LGO A;  2ZM2 A;  3A3F A;  5I94 A;  3AGF A;  4ARZ A;  3LZ0 D;  2FFF B;  4EUZ A;  5AV8 C;  5B1M A;  4CQH A;  3BEC A;  3IHA A;  3BWL A;  4GDN A;  1K57 A;  3REJ D;  5HAQ A;  4H9N A;  1K4E A;  1XFN A;  4XT2 A;  1OTB A;  2OV5 A;  3AZG B;  2WGI A;  3B6F D;  3CZD A;  3CI6 A;  5B2I A;  4Y13 A;  5HL6 A;  3MGS B;  3WWX A;  1KX4 A;  5BNX A;  3AYW D;  3IWQ A;  5JRG A;  4QD4 A;  1H3Q A;  2L0W A;  3S4X A;  3W4Q A;  1ID3 D;  3OPP A;  2FJ7 A;  1HVB A;  3M7P A;  1FR6 A;  4M6B A;  4F3L A;  3UT9 D;  5E2F A;  3ISG A;  4Z2M G;  2F8N K;  2HIO B;  4KGC D;  5HWT A;  3P5J B;  5CP6 A;  2RIQ A;  2IO5 B;  2FH5 A;  3LIE A;  4OON A;  4K08 A;  1UWN X;  1S66 L;  4K91 A;  5FQQ A;  3T50 A;  4NYU A;  1YU3 A;  3IXB A;  3JPU A;  4XUX A;  3HCY A;  3AZM D;  4OLG A;  1RGZ A;  1SZV A;  2A24 B;  5GT3 B;  4ZUX C;  2I9V A;  4IED A;  1CQA A;  4RVA A;  1H0I A;  2Y91 A;  3B0B A;  4LCL A;  4JJN D;  5AV9 B;  3REI B;  4LV3 A;  1ZLA A;  3LEL B;  4ZJ3 A;  4XUJ C;  4KUD B;  3L7H A;  4GS9 A;  4X23 C;  2EFU A;  3HLG A;  2NUT C;  3KS4 A;  2PYP A;  3LZ0 A;  1QMF A;  3R4K A;  1YSP A;  4P6B A;  3HLC A;  2Y2K A;  1NZU A;  2W27 A;  2HP9 A;  3REJ A;  1MWS A;  4E3M A;  4H9R A;  3LIB A;  2NZD D;  2XSS A;  3T4S A;  3WA9 B;  1BZA A;  4NET A;  3B6F A;  3B42 A;  4XZQ C;  5BS7 A;  2Y2H A;  1JWV A;  2VV6 A;  2XA7 M;  3D4F A;  3OPL A;  4ZBJ B;  3AYW A;  2ZC7 A;  4O01 A;  1PNE A;  2ACG A;  2Z6C A;  4YS3 D;  3KUY D;  3G2Y A;  5KDM B;  3L28 A;  5J7E A;  4KZA A;  4MN7 A;  1ID3 A;  3Q7V A;  1P34 B;  1T3U A;  5F99 D;  3LR0 A;  1P3P D;  3H9W A;  3AFA A;  3UT9 A;  1EQZ B;  1CJF A;  4KGC A;  1GSV A;  1M6K A;  2Q9M A;  4WZ5 C;  2V1A A;  3DTK A;  1H8P A;  3AZM A;  4Y5F A;  1PW8 A;  5FSR A;  3REL D;  5GT0 D;  1ULY A;  2XD5 A;  4LRZ E;  4ZJ1 A;  2NQB B;  4GN2 A;  5M19 A;  2I72 A;  2M1C A;  4JJN A;  4MLL A;  4U0X A;  5GLD A;  2LB5 A;  3VP4 A;  5L09 A;  1H0M A;  3UB5 P;  4L9G A;  4X1L A;  1H8Z A;  1GPF A;  1K4F A;  5DF9 A;  1YU0 A;  5TBM B;  4NE5 A;  1GHM A;  5L8M A;  5CP6 C;  2NZD A;  3QP4 A;  1ES3 A;  2EWW A;  1S32 B;  3NOU C;  4BD1 A;  3NQU A;  4YM6 D;  1YU1 A;  5FQ9 A;  3MFX A;  4AWL B;  1P3M C;  5M1A A;  1AOI B;  4DE1 A;  4GH9 A;  4WEK A;  3ZHH A;  5GXQ D;  3AZG D;  4P0M A;  1S1Z A;  3DW0 A;  3KUY A;  4YS3 A;  1IKI A;  3MGS D;  1SKO A;  1OT6 A;  4H6J B;  2HPB A;  1ZLA C;  4LEN A;  5F99 A;  2H5S A;  4DKI A;  5CHM A;  2W3E A;  1ES2 A;  1P3P A;  4EUV A;  1I5Q A;  2JKT M;  3N8S A;  5BPV A;  5EOO A;  3LZ0 C;  2ZY3 A;  1VM1 A;  3QP6 A;  1K56 D;  1HD8 A;  5E5A B;  3MXQ A;  2VEA A;  3UB9 A;  2HIO D;  2R9W A;  3MJQ A;  1K55 A;  5E2H A;  2ZY4 A;  2GX5 A;  3WTP C;  1NRJ A;  3REL A;  4X56 A;  5GT0 A;  1O7E A;  2Y2I A;  5AV8 B;  3GTC A;  1TAF B;  2M7V A;  5CEC A;  5B24 C;  2VGL M;  3IX8 A;  5CHU A;  4CLC B;  5FDH A;  2VZW A;  3H7W B;  3CPT A;  2A2L A;  1O07 A;  3HBR A;  1W1V A;  3BFD A;  3VH5 T;  3LI9 A;  2ZQ9 A;  3HUN A;  2K31 A;  1IEL A;  3REI D;  4N9L A;  3TOI A;  3QNB A;  3LEL D;  4IJG A;  3LJA D;  3KSY A;  4KUD D;  2ZC6 B;  4JGQ A;  3KS8 A;  2VV8 A;  3VH5 W;  4IBD A;  3WKJ D;  4FH2 A;  3H0R C;  4LV2 A;  5G4Y A;  1Z6F A;  1XXM A;  2PR5 A;  5AVF A;  1TZY B;  4YM6 A;  3T1S A;  2HDQ A;  2WKE A;  4OKP A;  1U60 A;  1NY0 A;  5L07 A;  4FSF A;  4E3O A;  4QLC C;  3WA9 D;  5GXQ A;  3BQA A;  4WJ3 C;  3AZG A;  2V8F A;  4I38 A;  1XGI A;  1YLP A;  5HD3 A;  1BLS A;  3WD0 A;  4B4X A;  1M19 B;  3IWO A;  2Z2M B;  3MGS A;  2PYO B;  4GDB A;  4OPY A;  1NLZ A;  4Q0H A;  3KYQ A;  4FOF A;  4JJN C;  4LFU A;  3DWZ A;  3VOY A;  1XJ3 A;  4HI4 A;  3VFF A;  1F98 A;  1PFL A;  4WU9 D;  2HP5 A;  3FWL A;  5AQ7 A;  2M7U A;  1P34 D;  2PRF A;  1NWZ A;  3V9R B;  4G3V A;  5A91 A;  5KSH A;  1K56 A;  4KG2 A;  1EQZ D;  3G34 A;  5GLC A;  5TJJ A;  2HIO A;  4WL9 A;  4HME A;  2XGN A;  4XUJ B;  4C3Q A;  1E88 A;  2BTF P;  4CAY A;  4X23 B;  3RJU A;  2G5H C;  5IHV A;  5CXW A;  3CUE C;  3G32 A;  3JVV A;  4P6Z S;  4J8U B;  5HWV A;  2Y2L A;  2A24 A;  2FN2 A;  3U2A A;  1WWS A;  5F6A A;  3AZN B;  3KYE A;  3OPR A;  4GNU A;  1M18 C;  4K0X A;  2NQB D;  1QO6 A;  2WAF A;  3REI A;  3LEQ A;  3LEL A;  4XZQ B;  1ALQ A;  3LJA A;  4KUD A;  1PI5 A;  3VFH A;  5F99 C;  1K25 A;  4PM5 A;  2PU4 A;  3E4Q A;  3WKJ A;  4S2P A;  3X1U D;  3QP8 A;  4B9O A;  3ZYT A;  3A0S A;  3VE3 A;  4UA6 A;  3MGP A;  3PBO A;  3HON A;  3O3V A;  5FA7 A;  3WA9 A;  5L10 A;  2ZY2 A;  5FQJ A;  4M3K A;  4IBB A;  3MF0 A;  4LD9 D;  3BY9 A;  1AOI D;  4OJ5 A;  2F2A C;  1IFQ A;  4Y15 A;  3Q82 A;  1CEG A;  1D1J A;  3B0D B;  2B5R A;  5KDM A;  1EI5 A;  3GVB A;  4WU9 A;  3SS4 A;  1H0G A;  1P34 A;  1G5U A;  1H8Y A;  4Q0J A;  3EQU A;  1EQZ A;  2UWX A;  2O9C A;  4R3J A;  3NQJ A;  4X55 A;  3SW1 A;  2AVX A;  1TS6 A;  1JFI A;  3VP1 A;  5CHJ A;  1DJB A;  4GHI B;  1KE0 A;  4WBG A;  3BLM A;  5CX7 A;  4JXG A;  4G92 B;  3LY4 A;  4IBJ A;  4DE2 A;  1DP6 A;  5AV8 D;  2ZQ7 A;  4CLC D;  3O87 A;  2NQB A;  3MMH A;  4OH0 A;  4HH2 A;  3EPL A;  1RP5 A;  3OLO A;  3REH B;  3IWI A;  4DDY A;  3WD3 A;  3M2K A;  3OCN A;  4JXV A;  3C8C A;  2P9V A;  5EOE A;  5M18 A;  1VET B;  1Z09 A;  1I2S A;  1LI0 A;  3X1U A;  4OOL A;  3RFB A;  3VOZ A;  4NZ5 A;  5J3W A;  3KWQ B;  4DQY B;  1TZY D;  2WAD A;  1K38 A;  3B6G C;  4LD9 A;  1AOI A;  4B88 A;  3UE3 A;  5HDS A;  3AL0 C;  1KU5 A;  3X1V B;  2F8N H;  5B31 G;  5GT3 C;  1KGF A;  3EEH A;  3WTP B;  5HWW A;  4TX8 A;  2OSU A;  1Q2P A;  2ZC5 B;  2PYO D;  4WZ4 A;  2W3D A;  5AV9 C;  3B33 A;  4NXG A;  2PDR A;  2L5A A;  2PHY A;  2W3F A;  1LLB A;  5B32 G;  5EE8 A;  2RCX A;  5HX9 A;  3UDI A;  4ZUX D;  4HNB A;  2Y2P A;  5G49 B;  3RH8 B;  4DF6 A;  2PBY A;  2ZJ9 A;  3CIT A;  1KDW A;  3MKE A;  2EX9 A;  3EG5 B;  5DTK A;  3E4O A;  4XUJ D;  3W97 C;  2PU2 A;  4X23 D;  3AN2 C;  2VX8 A;  4EO5 B;  1W63 Q;  2W3G A;  5AV8 A;  1TAF A;  3WA9 C;  1EWZ A;  3BYD A;  4CLC A;  4CJN A;  5GSU B;  1DP8 A;  4DDS A;  1XX2 A;  4OP5 A;  3E0Y A;  3H7W A;  4S2N C;  4ZBJ C;  3SH8 A;  4WNN B;  4BMW A;  4NG2 A;  3HLD A;  3QP5 A;  4NZ4 A;  1CXW A;  1ZC2 A;  1E8B A;  1ZHH B;  2Y4A A;  1HTZ A;  1LSX A;  4LCM A;  4XZQ D;  3WS1 A;  1D06 A;  3L25 A;  1CK7 A;  5CRF A;  4E6W A;  4E04 A;  5HD5 A;  3C7V A;  2B02 A;  3Q81 A;  1J9M A;  5BT1 C;  3HLF A;  2G2U A;  4I39 A;  4EEU A;  4H9S C;  1U35 B;  2PT7 A;  1TZY A;  3A6N C;  2OWH A;  1BUL A;  1W8Y A;  5EEC A;  1BT5 A;  1JWZ A;  3AZL B;  4NZ3 A;  1BLH A;  1P3L C;  3MVD B;  1F2K A;  3SS5 A;  1PYY A;  1B6W A;  3UB8 A;  1Y54 A;  3FYZ A;  1WWI A;  5KMW A;  2HV1 A;  2D01 A;  3LYX A;  4HEF A;  4ZRR A;  3MXS A;  3R45 B;  3FV7 A;  1F1E A;  4ZUX A;  2W0N A;  4GJ4 A;  3N6I A;  1M18 B;  1M40 A;  3T1Q B;  5AJG A;  4OLD A;  1WYC A;  2HZ5 A;  4KQQ A;  3IP4 C;  3QNC A;  5B31 B;  4XUJ A;  3REK B;  4X23 A;  4OJO A;  4AFI A;  2QMI A;  5AQB A;  3UB6 A;  3ZGA B;  4UUZ A;  1NZO A;  2C5W B;  1S32 C;  1IYO A;  4UHU A;  1W8Q A;  2QYB A;  5TGF A;  4AWL C;  1P3A C;  2QJ5 A;  1AOI C;  3CJM A;  4JF4 A;  3E2K A;  4BEN A;  5EPH A;  1P3F C;  2L4R A;  1E3U D;  4HBU A;  4J8X B;  1OT9 A;  3LFV A;  2XEP A;  2DF4 C;  2GNX A;  5FEF A;  5HSQ A;  4XZQ A;  5CER A;  1W1T A;  1P3M D;  2EFX A;  4WZS B; 
#chains in the Genus database with same CATH homology
 1LI9 A;  1YLY A;  3W99 C;  1YU4 A;  4GOG A;  5E5A C;  5CEB A;  4S2J A;  4MBF A;  2BYM B;  3X1T C;  1P3K C;  4UA9 A;  4Z5T C;  5BNV B;  4H9O A;  3KWQ D;  3IF5 A;  2V1Z A;  5B33 C;  4N92 A;  4WZ5 A;  4KZ4 A;  3HLB A;  2H10 A;  4S2L A;  4PM9 A;  4IBK A;  3WTP D;  3A1K A;  3HUM A;  5B24 D;  4OQ0 A;  3O62 B;  3EPK A;  5JA4 A;  3KXB C;  4U3T A;  2WZX A;  1PZP A;  1DJA A;  2Y2O A;  1TZY C;  2HDR A;  4EBL A;  1QME A;  4OJP A;  4JLF A;  4WMC D;  4JF6 A;  3AZK C;  3VP0 A;  1E3U A;  5AVC B;  4S2K A;  3HVF A;  5GSU D;  3AZH C;  4E3N A;  4BL2 A;  4H9P B;  4OPQ A;  1SHV A;  1M19 C;  4OP8 A;  2PYO C;  3B6G B;  4QB8 A;  1KE3 A;  1P3M A;  4QLC D;  3E2L A;  4GD8 A;  3LZ1 C;  5FUG B;  3B3X A;  4KZ8 A;  1CK3 A;  1YLT A;  3A3D A;  5CTN A;  3HL9 A;  3WRT A;  4P85 A;  5A90 A;  1N9B A;  2OLU A;  1U35 D;  3N3F A;  4Z2M H;  2F8N D;  4J8U C;  3AZL D;  4YIN A;  4IJE A;  1XA1 A;  5AY8 C;  3W97 B;  3MVD D;  5EVL A;  3AN2 B;  3WTP A;  3AZN C;  1Q2Q A;  3BLS A;  1BH8 A;  3NI9 A;  5B24 A;  4C75 A;  4ZDX A;  4DRB A;  5G49 A;  1M18 D;  2ZD8 A;  2ARO C;  4KEN B;  2A3U A;  5B40 C;  5B31 D;  3REK D;  4QY6 A;  1YLW A;  3AZF C;  3MZF A;  3QHY A;  4WMC A;  1OME A;  5B0Z B;  5GSU A;  3NY4 A;  4JKT A;  2CV5 B;  3V3S A;  1NXY A;  3A6N B;  4GZB A;  3ZVW A;  4JBF A;  4WNN A;  4J8X D;  3B0D C;  4LG2 A;  3ZFZ A;  4QLC A;  3EPH A;  1P3L B;  3MGR C;  3N8L A;  4ZBE A;  1FCM A;  1BLC A;  3IQA A;  4BJP A;  1YT4 A;  4N1H A;  1U35 A;  2F8N A;  2HP6 A;  3IXH A;  3AZL A;  3Q07 A;  4G92 C;  4MNR A;  3UO9 A;  3FDD A;  3MVD A;  4JXW A;  4RX2 A;  1CI8 A;  2EXA A;  4R4S A;  3REH C;  1P3A B;  4QHC A;  3OC2 A;  3R45 A;  2IWB A;  1P3F B;  1M18 A;  4FD8 A;  4H9Q B;  5L2F A;  3BEB A;  3AGE A;  5B31 A;  3REK A;  2WGV A;  2WGW B;  4CSR B;  3OPH A;  3MNN C;  4OUI A;  1K54 C;  3KWQ C;  2CC1 A;  3W99 B;  2BLS A;  1SCW A;  1P3O B;  1E25 A;  4KQO A;  2ZC4 B;  3X1T B;  1P3K B;  1KX5 B;  3X1V C;  4Z5T B;  2Y2J A;  3B6G D;  2ZLY A;  3LO7 A;  3EPJ A;  5CGS A;  5B33 B;  3VP3 A;  3W4P A;  5GT3 D;  4KZ6 A;  3VP2 A;  2XDM A;  2ZC3 B;  5AV9 D;  2BYM A;  5HAI A;  5BNV A;  4EO5 C;  1YUE A;  3KXB B;  4G91 B;  4BD0 A;  1JTG A;  2EXB A;  4KG6 A;  1MWT A;  5GSU C;  3WS4 A;  3W97 D;  4XXR A;  4F94 A;  1IYQ A;  3AN2 D;  4BQM A;  1YLJ A;  4PM8 A;  3VMA A;  4WV4 B;  4JXS A;  3AZK B;  3AZH B;  4GKU A;  3MZD A;  2YFV B;  1BH9 B;  4R4R A;  4R3B A;  3LZ1 B;  5A92 A;  1U35 C;  1XA7 A;  5HW3 A;  3BFG A;  3AZL C;  2WYX A;  2X71 A;  5BT1 D;  2V2F F;  4OJ6 A;  3UDF A;  3MVD C;  2CV5 D;  4HBT A;  4H9P A;  3A6N D;  3B6G A;  2J8P A;  1M1A B;  1P3L D;  5AY8 B;  5CPI B;  3PAG A;  5FUG A;  5GT3 A;  3UTA B;  3LY3 A;  5DNM B;  3VH6 A;  4WU8 C;  2GDN A;  5AV9 A;  5A93 A;  5B31 C;  3REK C;  4KHA B;  4KQR A;  3TU4 C;  3MBZ A;  4EWF A;  1XKZ A;  1ERQ A;  4YFM A;  2ARO B;  5B32 C;  5B40 B;  3BFF A;  2BG1 A;  3W97 A;  3AN2 A;  3AZF B;  2ZM0 A;  4J8X C;  4E3K A;  1S32 D;  1KX3 C;  3MZE A;  2BYK B;  4NZ1 A;  4E45 A;  1P3A D;  4ZTK A;  4S2N A;  1P3F D;  3V39 A;  3C1C B;  1XP4 A;  5FI6 A;  2HUE C;  3MGR B;  3PBS A;  1SKF A;  1IYP A;  3G35 A;  3FZC A;  5CED A;  4XUZ A;  1LL9 A;  5B1M B;  2JBF A;  2JC7 A;  3W99 D;  4R0Q A;  5B0Y C;  4H9S A;  1E4D A;  4ZJ2 A;  2CV5 A;  3WRZ A;  5E5A D;  3A6N A;  3Q7Z A;  3X1T D;  1P3K D;  1KX5 D;  3LCE A;  4Z5T D;  1P3L A;  4FH4 A;  3G31 A;  5B33 D;  3O62 C;  2WAE A;  3BRM A;  1DY6 A;  3VSL A;  2V20 A;  5CPK C;  2FJ7 B;  4OPR A;  4DXB A;  2XQZ A;  3L26 A;  1GCE A;  1H3O B;  3KXB D;  5E2G A;  1IEM A;  4KZ9 A;  3MNN B;  3IH9 A;  5GHZ A;  3UDX A;  5AVC C;  3G2Z A;  1TDL A;  5BO0 B;  2R9X A;  2YFW B;  2XD1 A;  1S32 A;  4R8P C;  1P3A A;  3AZK D;  1P3F A;  4QJG A;  3ITB A;  3AZH D;  1B67 A;  1I2W A;  2G5I C;  2ZM5 A;  4Z66 C;  1M19 D;  1MKI A;  2XFT A;  4S2I A;  3ZG0 A;  4CSR A;  4WYY A;  3MGQ B;  3AZI B;  3LZ1 D;  1TEM A;  3DWK A;  3W99 A;  2J8Y A;  1P3I B;  3ZDJ A;  1ESI A;  5E5A A;  1G6A A;  3X1T A;  1P3K A;  1KX5 A;  4Z5T A;  2A49 A;  3CMZ A;  1CI9 A;  3B6F B;  4J8U D;  1BSG A;  3WX7 A;  5B33 A;  1M1A D;  4NFT A;  5B2J C;  5AY8 D;  4X69 A;  5CPI D;  3UTA D;  2QPN A;  3AZN D;  5DNM D;  3AZE C;  4IBC A;  3Q7V B;  3AGD A;  3WTP E;  3AFA B;  1G68 A;  3UT9 B;  5CTM A;  3KXB A;  5FQI A;  5GHX A;  3A1I A;  4Y0T A;  4J8W C;  2ARO D;  3IH8 A;  5B0Z C;  5B40 D;  2CV5 C;  1KVL A;  4HGA C;  1P3B C;  4OQI A;  3AZF D;  3AZM B;  4GHL A;  4RX3 A;  5B1L B;  2ZMA A;  3AZK A;  1L0D A;  3OZH A;  5F82 A;  3ZG9 B;  3AZH A;  1LL5 A;  4E44 A;  1FR1 A;  1M19 A;  2PYO A;  3P09 A;  1BH9 A;  3C4O A;  3P98 A;  3LZ1 A;  3MGR D;  3ZG7 B;  2Q9N A;  3C1B C;  1MWU A;  3V9R A;  4KZ3 A;  1W79 A;  4KZ7 A;  4WU8 B;  3ZCZ A;  3AZJ C;  3KFU G;  1PWC A;  4KG5 A;  4PMA A;  3NIA A;  3GRJ A;  5EUA A;  3TU4 B;  1FSW A;  5AV5 C;  5EVI B;  3NQU B;  1SDE A;  4J8U A;  3IF6 C;  5F1G A;  3M6B A;  1M1A A;  5B32 B;  5AY8 A;  5CPI A;  1FOF A;  3L27 A;  3UTA A;  4YS3 B;  2DQN C;  1GHI A;  3V5M A;  3AZN A;  4N9K A;  4S2M A;  3WS5 A;  1KX3 B;  4Y0U A;  3REH D;  3NCK A;  4OQG A;  2ARO A;  1NYM A;  3HLE A;  2HUE B;  4O7D A;  5B40 A;  3W96 C;  3FKE A;  1P3O C;  4Y7P A;  3MNN D;  3AZF A;  2DNS A;  3O88 A;  1KX5 C;  3REL B;  5GT0 B;  5AV6 B;  3X1S B;  4IBF A;  2BYK A;  5B0Y B;  1SDN A;  4PPR A;  5U47 A;  3UE1 A;  5DNN B;  4OOM A;  2J9P A;  5HAP A;  3X1V D;  1XGJ A;  1YLZ A;  2XFS A;  5CPJ B;  1K6R A;  3ZNY A;  3MGR A;  3FKV A;  3MGQ D;  2ZM8 A;  3AZI D;  3AV1 C;  4G91 C;  1P3I D;  1YMX A;  4IBG A;  4IJF A;  1H5X A;  3NBL A;  5CPK B;  5J8X A;  4YM6 B;  1HQ3 C;  1PW1 A;  2WKI A;  1K6S A;  4FCF A;  3W8K A;  1PIO A;  5GXQ B;  1W5D A;  3HRE A;  4X53 A;  4ZAM A;  3GV9 A;  1CEF A;  4EBN A;  1P3G C;  4X6T A;  2RVQ C;  2LY8 A;  3REH A;  4R8P B;  1ONG A;  1Z2C B;  3N8R A;  1L0G A;  3AV2 C;  4RA7 A;  1VQQ A;  3AFA D;  4Z66 B;  1H3O A;  3PAE A;  2XLN A;  4CAY B;  3MNN A;  1PWD A;  5GLB A;  5BO0 A;  1K54 A;  2CWE A;  5TFQ A;  2YFW A;  1L0F A;  1JVJ A;  3KWQ A;  3W98 C;  4JPM A;  5KSC A;  4C6Y A;  1F66 C;  5B1L D;  4DRA A;  1M1A C;  5CPI C;  3UTB B;  3X1V A;  5F1F A;  1ZG4 A;  3UTA C;  5DNM C;  5KZH A;  3LJA B;  3G4P A;  5DF8 A;  3MGQ A;  5B2J B;  1LHY A;  4NY2 A;  3AZI A;  3SH9 A;  1P3I A;  2ZY5 A;  3WKJ B;  3AZE B;  1MWR A;  4WU8 D;  5BOH A;  5AVB C;  3VH6 T;  3MGP B;  3UPP A;  3TU4 D;  4E3I A;  2X02 A;  5C3I B;  2IWC A;  5EVI D;  3GSG A;  3ZNT A;  4J8W B;  5B32 D;  3WAA C;  2Z2L B;  3TSG A;  4CPK A;  4R1G A;  4HGA B;  5JYP A;  1P3B B;  3VH6 W;  3C1C C;  3B0C T;  2J7V A;  4WU9 B;  1KX3 D;  5CHL B;  3A3J A;  3A3I A;  3BFE A;  5HFO A;  2JE5 A;  3L2A A;  4GB7 A;  4QNL A;  3NQJ B;  3V3R A;  5B1M C;  1MXO A;  1JFI B;  3B0C W;  3C1B B;  1K57 C;  3N4I A;  1ZG6 A;  4NE3 A;  4KZ5 A;  5B1L A;  5AV6 D;  3X1S D;  3AZJ B;  3UY6 A;  1XPB A;  5B0Y D;  5DNN D;  5AV5 B;  4J8V B;  3LEZ A;  4ID4 A;  5B2I C;  4PM7 A;  2OLV A;  1KX4 C;  2H0T A;  3IF6 B;  5JRG C;  1N1J B;  1IYS A;  3WS0 A;  5CPJ D;  2P9V B;  2H0Y A;  4IBE A;  5DF7 A;  2FJ7 C;  3N7W A;  3O62 D;  4QU3 A;  4WU8 A;  3X1U B;  3DTM A;  2EX2 A;  4IBX A;  5CGW A;  3TU4 A;  3PTE A;  5CPK D;  1IKG A;  4RYE A;  5EVI A;  1FQG A;  3UPN A;  4LD9 B;  2WKH A;  3IT9 A;  5B32 A;  3BM6 A;  3W96 B;  2FFY A;  4UPK A;  5AVC D;  4J8X A;  3EQV A;  4NK3 A;  1KVM A;  5GL9 A;  3C5A A;  1KX3 A;  5DTT A;  1PI4 A;  4IBR A;  4R8P D;  3IXG A;  3MXR A;  3MGQ C;  2J9O A;  5D3O A;  3AZI C;  1ERM A;  1P3I C;  4Z66 D;  1MPL A;  3F6T A;  5FAP A;  3V50 A;  4BLM A;  4A5R A;  3REJ C;  1YU2 A;  1RCJ A;  4OJL A;  3MFD A;  4WEL A;  4MBH A;  5AV6 A;  3X1S A;  2HDS A;  3I7J A;  3CG5 A;  3AV1 B;  5B0Y A;  3B6F C;  5DNN A;  5BS7 C;  2XR0 A;  4EV4 A;  1HQ3 B;  3AYW C;  3UTB D;  4D2O A;  1PWG A;  5DVA A;  5CPJ A;  3OCL A;  2ZQA A;  4OPZ A;  1ID3 C;  1MY8 A;  5FQK A;  5B2J D;  2JCH A;  3O62 A;  1P3G B;  3AFA C;  3UT9 C;  4KGC C;  5G18 A;  3AZE D;  1Q9C A;  1JWP A;  4N1X A;  3RXW A;  5CPK A;  3IXD A;  2W8S A;  4Z9Q A;  3AV2 B;  3S1Y A;  3H0L C;  2EX6 A;  3MGP D;  4IVI A;  1NYY A;  3AZM C;  3PBT A;  5B1L C;  3G30 A;  3SS3 A;  4J8W D;  4DXC A;  5B0Z D;  5AVC A;  2P74 A;  4E6X A;  3RXX A;  3W98 B;  1P3B D;  4R8P A;  1F66 B;  2Y55 A;  1BTL A;  2XH9 A;  4OOY A;  4ZUX B;  4UAA A;  3H0M C;  4OVD A;  4Z66 A;  1BLP A;  2RL3 A;  3NC8 A;  1HTA A;  1TDG A;  3TG9 A;  2NZD C;  2ZQ8 A;  4UUZ B;  3C1B D;  4WM9 A;  5HAR A;  5EVI C;  5JYO A;  3AZJ D;  5FAQ A;  5AVB B;  3UTB A;  3C4P A;  5AV5 D;  4YS3 C;  3KUY C;  4J8V D;  3O86 A;  2C6W B;  4L0L A;  5E43 A;  4PM6 A;  3WS2 A;  5TR7 A;  2DCF A;  5B2J A;  3WAA B;  3NDG A;  1P3P C;  3VSK A;  3HSH A;  1ES5 A;  3M2J A;  2WZZ A;  3AZE A;  2Y2M A;  3PBR A;  2XF3 A;  2E8I A;  1S6R A;  3A3E A;  1K55 C;  1YQS A;  3MKF A;  4H9O B;  3REL C;  5GT0 C;  5AV6 C;  3X1S C;  4J8W A;  5B0Z A;  3ITA A;  1W7F A;  4BL3 A;  5DNN C;  3W96 D;  1GHP A;  1P3O D;  1P3B A;  5GLA A;  4GHA A;  4H9N B;  1NJ4 A;  5CPJ C;  2Y2G A;  4P87 A;  3GR2 A;  5B2I B;  5JA4 B;  1KX4 B;  5BNX B;  4U0T A;  5JRG B;  4DRT A;  1KE4 A;  4IVK A;  1FCO A;  2Y59 A;  4IBI A;  3C1B A;  1YMS A;  4YM6 C;  5FI7 A;  3C7U A;  1KGG A;  3AZJ A;  1ONH A;  1ESU A;  1W2E A;  3AV1 D;  5GXQ C;  3AZG C;  1PZR A;  4S2O A;  5CP6 B;  1TVF A;  5AV5 A;  4J8V A;  1ZKJ A;  3UNW A;  1HQ3 D;  3MGS C;  3IF6 A;  2F8N G;  1S0W A;  5F83 A;  1P3M B;  1N1J A;  4KZB A;  3GMW A;  4H9Q A;  1P3G D;  3ZG8 B;  2RVQ D;  1WE4 A;  4WEJ A;  1ZLA B;  2HIO C;  2WGW A;  5FAO A;  2IO5 C;  3SOI A;  3LZ0 B;  3AV2 D;  3M6H A;  4NE6 A;  3UPO A;  2WK0 A;  4OQH A;  4LV0 A;  1MBL A;  3VH5 A;  3W96 A;  4R23 A;  1P3O A;  3PBQ A;  5FAS A;  3REJ B;  3UTB C;  4H9R B;  1FSY A;  1BH8 B;  3W98 D;  2DRW A;  5B24 B;  3REI C;  3HUO A;  3LEL C;  1YM1 A;  5GHY A;  1F66 D;  3LJA C;  4KUD C;  1L0E A;  3AYW B;  5DTS A;  3WKJ C;  1ID3 B;  4HES A;  2VQR A;  1RGY A;  4QY5 A;  4UA7 A;  3MGP C;  5C3I C;  4Y0O A;  4KGC B;  2EX8 A;  5FQM A;  3AV1 A;  1R4V A;  3NDE A;  3UN7 A;  1AXB A;  1HQ3 A;  5AVB D;  2G2W A;  2JSS A;  3UE0 A;  3GQZ A;  4QLC B;  4JF5 A;  1HZO A;  4E3L A;  3ZG5 A;  1DJC A;  4WU9 C;  2VGK A;  1JTD A;  1P34 C;  3HLW A;  1N4O A;  3WAA D;  1KGE A;  2HDU A;  5AQA A;  1P3G A;  4JJN B;  1EQZ C;  2IWD A;  3ZVT A;  5FAT A;  2YFV A;  3C1C D;  3Q1F A;  1GA0 A;  3W4O A;  1KDS A;  3FKW A;  3AV2 A;  2F8N B;  4NYY A;  1C3B A;  3PBN A;  1ES4 A;  5FI2 A;  4K0W A;  4DE3 A;  5B1M D;  3L29 A;  4X68 A;  4E3J A;  4GD6 A;  2NQB C;  2NZD B;  4B4Z A;  4J8V C;  3W98 A;  5HL1 A;  1F66 A;  3JYI A;  1PZO A;  3IHB A;  2VGJ A;  4MEZ A;  3KUY B;  1GA9 A;  5B2I D;  1ERO A;  2ZQD A;  5DNM A;  5AQ9 A;  1KX4 D;  4EBP A;  3X1U C;  5JRG D;  2QZ6 A;  1NRF A;  5F99 B;  2IOU A;  4KHA A;  5CGX A;  1P3P B;  2FJ7 D;  1L2S A;  2XK1 A;  2ZQC A;  4LD9 C;  4DE0 A;  5AVB A;  1A7W A;  4Q8I A;  2Y2Q A;  5CP6 D;  4EQI A;  1FCN A;  5E2E A;  2Y2N A;  3WAA A;  1WYB A;  3BFC A;  3C1C A;  3S22 A;  2WUQ A;  3SH7 A;  1BFM A;  1BUE A;  4MBK A;  2X01 A;  4LV1 A;  1ZLA D;  4H8R A;  2ZM2 A;  3A3F A;  5I94 A;  3AGF A;  3LZ0 D;  2FFF B;  4EUZ A;  5AV8 C;  5B1M A;  3BEC A;  3IHA A;  4GDN A;  1K57 A;  3REJ D;  5HAQ A;  4H9N A;  1K4E A;  2OV5 A;  3AZG B;  2WGI A;  3B6F D;  3CZD A;  5B2I A;  3MGS B;  3WWX A;  1KX4 A;  5BNX A;  3AYW D;  3IWQ A;  5JRG A;  4QD4 A;  3S4X A;  3W4Q A;  1ID3 D;  3OPP A;  2FJ7 A;  1HVB A;  1FR6 A;  4M6B A;  3UT9 D;  5E2F A;  3ISG A;  4Z2M G;  2F8N K;  2HIO B;  4KGC D;  3P5J B;  5CP6 A;  2RIQ A;  2IO5 B;  4OON A;  4K91 A;  5FQQ A;  4NYU A;  1YU3 A;  3IXB A;  4XUX A;  3AZM D;  4OLG A;  1RGZ A;  5GT3 B;  4ZUX C;  4IED A;  4RVA A;  2Y91 A;  3B0B A;  4LCL A;  4JJN D;  5AV9 B;  3REI B;  4LV3 A;  1ZLA A;  3LEL B;  4ZJ3 A;  4XUJ C;  4KUD B;  4X23 C;  2EFU A;  3HLG A;  3KS4 A;  3LZ0 A;  1QMF A;  4P6B A;  3HLC A;  2Y2K A;  1NZU A;  2HP9 A;  3REJ A;  1MWS A;  4E3M A;  4H9R A;  2NZD D;  3WA9 B;  1BZA A;  4NET A;  3B6F A;  4XZQ C;  5BS7 A;  2Y2H A;  1JWV A;  3D4F A;  3OPL A;  4ZBJ B;  3AYW A;  2ZC7 A;  4YS3 D;  3KUY D;  3G2Y A;  5KDM B;  3L28 A;  4KZA A;  1ID3 A;  3Q7V A;  1P34 B;  1T3U A;  5F99 D;  1P3P D;  3AFA A;  3UT9 A;  1EQZ B;  4KGC A;  1M6K A;  2Q9M A;  4WZ5 C;  3AZM A;  1PW8 A;  5FSR A;  3REL D;  5GT0 D;  1ULY A;  2XD5 A;  4ZJ1 A;  2NQB B;  4GN2 A;  5M19 A;  2I72 A;  4MLL A;  4JJN A;  4U0X A;  5GLD A;  3VP4 A;  1H8Z A;  1K4F A;  5DF9 A;  1YU0 A;  4NE5 A;  1GHM A;  5CP6 C;  2NZD A;  1ES3 A;  1S32 B;  4BD1 A;  3NQU A;  4YM6 D;  1YU1 A;  5FQ9 A;  4AWL B;  1P3M C;  5M1A A;  1AOI B;  4DE1 A;  4GH9 A;  4WEK A;  3ZHH A;  5GXQ D;  3AZG D;  4P0M A;  3DW0 A;  3KUY A;  4YS3 A;  1IKI A;  3MGS D;  2HPB A;  1ZLA C;  4LEN A;  5F99 A;  2H5S A;  4DKI A;  5CHM A;  1ES2 A;  1P3P A;  1I5Q A;  3N8S A;  5BPV A;  5EOO A;  3LZ0 C;  2ZY3 A;  1VM1 A;  1K56 D;  1HD8 A;  5E5A B;  2HIO D;  2R9W A;  1K55 A;  5E2H A;  2ZY4 A;  3WTP C;  3REL A;  4X56 A;  5GT0 A;  1O7E A;  2Y2I A;  5AV8 B;  3GTC A;  1TAF B;  5CEC A;  5B24 C;  5CHU A;  5FDH A;  1O07 A;  3HBR A;  3BFD A;  3VH5 T;  2ZQ9 A;  3HUN A;  1IEL A;  3REI D;  4N9L A;  3TOI A;  3QNB A;  3LEL D;  3LJA D;  3KSY A;  4KUD D;  2ZC6 B;  3KS8 A;  3VH5 W;  4IBD A;  3WKJ D;  4FH2 A;  3H0R C;  4LV2 A;  1Z6F A;  1XXM A;  1TZY B;  4YM6 A;  2HDQ A;  2WKE A;  4OKP A;  1U60 A;  1NY0 A;  4FSF A;  4E3O A;  4QLC C;  3WA9 D;  5GXQ A;  4WJ3 C;  3AZG A;  1XGI A;  1YLP A;  1BLS A;  4B4X A;  1M19 B;  3IWO A;  2Z2M B;  3MGS A;  2PYO B;  4GDB A;  4OPY A;  4JJN C;  3DWZ A;  3VOY A;  3VFF A;  4WU9 D;  2HP5 A;  3FWL A;  5AQ7 A;  1P34 D;  3V9R B;  5A91 A;  5KSH A;  1K56 A;  4KG2 A;  1EQZ D;  3G34 A;  5GLC A;  2HIO A;  2XGN A;  4XUJ B;  4C3Q A;  4CAY A;  4X23 B;  3RJU A;  2G5H C;  5IHV A;  5CXW A;  3G32 A;  4J8U B;  2Y2L A;  1WWS A;  3AZN B;  3OPR A;  4GNU A;  1M18 C;  4K0X A;  2NQB D;  2WAF A;  3REI A;  3LEL A;  4XZQ B;  1ALQ A;  3LJA A;  4KUD A;  1PI5 A;  3VFH A;  5F99 C;  1K25 A;  4PM5 A;  2PU4 A;  3WKJ A;  4S2P A;  3X1U D;  4UA6 A;  3MGP A;  3PBO A;  3HON A;  3O3V A;  5FA7 A;  3WA9 A;  2ZY2 A;  5FQJ A;  4M3K A;  4IBB A;  4LD9 D;  1AOI D;  4OJ5 A;  2F2A C;  3Q82 A;  1CEG A;  3B0D B;  2B5R A;  5KDM A;  1EI5 A;  3GVB A;  4WU9 A;  3SS4 A;  1P34 A;  1H8Y A;  3EQU A;  1EQZ A;  2UWX A;  4R3J A;  3NQJ A;  4X55 A;  1JFI A;  3VP1 A;  5CHJ A;  1DJB A;  1KE0 A;  4WBG A;  3BLM A;  4JXG A;  4G92 B;  3LY4 A;  4IBJ A;  4DE2 A;  5AV8 D;  2ZQ7 A;  3O87 A;  2NQB A;  4OH0 A;  3EPL A;  1RP5 A;  3REH B;  3IWI A;  4DDY A;  3M2K A;  3OCN A;  4JXV A;  2P9V A;  5EOE A;  5M18 A;  1I2S A;  1LI0 A;  3X1U A;  4OOL A;  3VOZ A;  4NZ5 A;  3KWQ B;  4DQY B;  1TZY D;  2WAD A;  1K38 A;  3B6G C;  4LD9 A;  1AOI A;  4B88 A;  3UE3 A;  3AL0 C;  1KU5 A;  3X1V B;  2F8N H;  5B31 G;  5GT3 C;  1KGF A;  3WTP B;  2OSU A;  2ZC5 B;  1Q2P A;  2PYO D;  4WZ4 A;  5AV9 C;  2L5A A;  1LLB A;  5B32 G;  5EE8 A;  2RCX A;  5HX9 A;  3UDI A;  4ZUX D;  2Y2P A;  5G49 B;  4DF6 A;  2PBY A;  2ZJ9 A;  1KDW A;  3MKE A;  2EX9 A;  3EG5 B;  5DTK A;  4XUJ D;  3W97 C;  2PU2 A;  4X23 D;  3AN2 C;  4EO5 B;  5AV8 A;  1TAF A;  3WA9 C;  1EWZ A;  3BYD A;  4CJN A;  5GSU B;  4DDS A;  1XX2 A;  4OP5 A;  4S2N C;  4ZBJ C;  3SH8 A;  4WNN B;  3HLD A;  4NZ4 A;  1ZC2 A;  2Y4A A;  1HTZ A;  4LCM A;  4XZQ D;  3WS1 A;  3L25 A;  5CRF A;  4E6W A;  3C7V A;  3Q81 A;  1J9M A;  5BT1 C;  3HLF A;  2G2U A;  4H9S C;  1U35 B;  1TZY A;  3A6N C;  1BUL A;  1W8Y A;  5EEC A;  1BT5 A;  1JWZ A;  3AZL B;  4NZ3 A;  1BLH A;  1P3L C;  3MVD B;  3SS5 A;  1PYY A;  1B6W A;  1Y54 A;  3FYZ A;  1WWI A;  5KMW A;  4HEF A;  3MXS A;  3R45 B;  3FV7 A;  1F1E A;  4ZUX A;  3N6I A;  1M18 B;  1M40 A;  4OLD A;  1WYC A;  4KQQ A;  3IP4 C;  3QNC A;  5B31 B;  4XUJ A;  3REK B;  4X23 A;  4OJO A;  2QMI A;  5AQB A;  3ZGA B;  4UUZ A;  1NZO A;  2C5W B;  1S32 C;  1IYO A;  4UHU A;  1W8Q A;  5TGF A;  4AWL C;  1P3A C;  1AOI C;  3CJM A;  4JF4 A;  3E2K A;  4BEN A;  5EPH A;  1P3F C;  1E3U D;  4HBU A;  4J8X B;  2XEP A;  2DF4 C;  4XZQ A;  5CER A;  2EFX A;  1P3M D;  4WZS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...