3L26A

Crystal structure of zaire ebola vp35 interferon inhibitory domain bound to 8 bp dsrna
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
123
structure length
123
Chain Sequence
DISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polymerase cofactor VP35
publication title Structural basis for dsRNA recognition and interferon antagonism by Ebola VP35.
pubmed doi rcsb
source organism Zaire ebolavirus
molecule tags Rna binding protein/rna
total genus 40
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3l26A01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 3l26A02
4LG2A 3FKEA 3L28A 4IBEA 5BPVA 4IBDA 4IBFA 4IBGA 4IBKA 4IBIA 4GHLA 3L25A 4IBBA 3L26A 4IBJA 3KS8A 3L27A 4IJEA 4IBCA 3L29A 3KS4A 4GH9A 4GHAA 3L2AA 4IJFA
chains in the Genus database with same CATH superfamily
1NJGA 3UGJA 3DZDA 2Y2QA 3B89A 3ZH9B 4I8OA 2LNHC 1N75A 2DVWB 4DUZM 3GQ3A 1HNZM 2CV0A 1OAOC 3K9OA 2KZUA 5IZ7D 4Z6YA 2R45A 2UUCM 1YLAA 2F5NA 2GNOA 2D7EA 2Q2EB 2XLJA 4NXNM 3LMMA 1N77A 5DFLA 4DV2M 1Z5AA 1IN8A 4EIWA 2UXDM 1H0IA 3NBXX 4MGIE 3JR5A 4IBBA 3VK7A 2UU9M 4JYAM 1VQ1A 3FYDA 3MMPA 2KW0A 2LXEA 3J80S 3A45A 3OTOM 1TGUA 2J7NA 1E9SA 4F2LA 5ITTA 1PJQA 5DNYA 1IY1A 1W5TA 1J7MA 1UFZA 2HKJA 3LCVB 1PJJA 1YSYA 2CUZA 2EUCA 4KLNA 1QAMA 2DZNB 4Y28F 2FS1A 3FD9A 4AZFA 1L2DA 2OOAA 4LCBA 4GC5A 3H4MA 5LMNM 4AI6A 1L1TA 2YFQA 3W0LB 4DBGB 2Y0QA 3GRUA 3RGSA 4LF4M 2DNAA 3UMMA 1MU5A 2LVPC 3IG5A 4NSRA 4IBIA 4QNMA 3T1HM 1KFVA 1L2CA 3L25A 3SAVA 1TDHA 3U6PA 2KRUA 1OFIA 1IN7A 3QYBA 3L26A 2ZTDA 4G4RA 1E6ZA 4MB5A 3KP0E 1K3XA 2XEPA 2XFTA 2KNAA 1XNQM 2ZAMA 2MROB 1QO6A 1WHCA 4XK8F 3I04M 1HQCA 4NZ1A 3A98B 2LTUA 3GRVA 2KZSA 1R7RA 4LF6M 1E94E 2F5PA 3GLHA 4P17A 5BPVA 1GL7A 3GLIA 3SAWA 2DAGA 2Y2JA 4Z2HA 3T15A 2EA0A 2C99A 1C7YA 3U5ZA 1QYRA 1TF0B 1VG5A 2N35A 1NY6A 2K47A 2X8AA 3PXGA 3VFDA 2CV1A 3T38A 4LZZA 4Z2IA 2E5LM 3K8ZA 3GQ4A 4MB4A 5FSWA 2Z8YM 1Z6TA 4QHSA 2WSEF 3HGIA 1Q3BA 3GPYA 2DENA 1QUSA 2Y2HA 1SXJA 3CGWA 3GLHB 2R4JA 5EXXA 4BB9A 1T6OA 2CWBA 3GLIB 1GXDA 2XSZA 4RNAA 2Y0TA 4LRSA 1XXHA 2RRUA 3KDSE 4M0DA 4W5WA 4CJ6A 5F3WA 4DR3M 3HJ8A 1ZAEA 2P5TA 3GQ5A 1LTMA 4MGYE 1OJLA 4IBEA 2ZANA 2BJWA 2XH9A 4NC6A 5KPTA 3GPUA 4AG5A 2JUJA 3T1YM 1AUAA 1YU3A 1OKSA 3FRIA 2BJVA 2CHVA 2VDBB 4MB7A 2QHOB 1T3TA 1CXWA 3K1JA 2EO2A 2XZFA 4G4NA 1TH4A 3SC3A 2FFFB 4PDIA 3FYCA 1NNJA 3ILKA 2FE8A 4GITA 4XGIA 1PJIA 1IN4A 3AOEC 4I5SA 3THGA 1JR3E 3SBJA 1I94M 3B7NA 1XWIA 4GIPA 1KS0A 1QZEA 1TDZA 4L16A 3KS4A 4B7HA 2ZAOA 1Z5BA 5KPRA 2FNAA 2VQEM 5IWAM 4LG2A 2DZLA 4XBOA 3L28A 3PNYA 3GLFE 4OJLA 4OJ6A 4AKHA 1WIVA 2B3TA 2G3QA 2L4EA 5KQ8A 2VIIA 1E8BA 4I4LA 1IBMM 1SXJE 2DWMA 1UM8A 3FTDA 1JB0F 1IY0A 1EE8A 3SMSA 5FLXS 1H8PA 1VDDA 1XXHE 1NVMA 4IBKA 1IBKM 1ZV1A 4REZA 5EQTA 2UUAM 2H5XA 1PRBA 4I81A 3VDPA 4OJOA 3BBZA 1PJSA 4IBJA 1J5EM 4D82A 3C3EA 4NRWA 4DV0M 3KS8A 4B7GA 1RU3A 4OJ5A 2UXBM 2C5RA 5EXPA 5EXTA 5IREB 4D80A 3KW6A 4NYYA 2X4AA 4CHTB 1G71A 3MK6A 3A42A 3KFUG 2RGOA 5ITYA 4FVMA 4GRIA 3Q8GA 3U61A 3FTEA 1GPFA 3WD1A 1OQYA 3SARA 2O01F 2DXIA 3HONA 1SG9A 2A5YB 1Q02A 4ANRA 1GL6A 4JI2M 3E46A 3EIHA 3U6SA 2JA2A 1NNUC 1MX0A 1IXZA 1VEKA 2W82A 4WURA 3HWSA 4R71A 4DV1M 4L4UA 4BLCA 1K82A 2D49A 2JCHA 4LJ4A 4DR6M 2WZJA 3GP1A 1OTRA 3J27B 1BVSA 2V1CA 1TR8A 2CRUA 1ORYB 2I7PA 4FWDA 3GPXA 4OU7A 2QBYA 2H1RA 2J5YA 1GKIA 2UWXA 4S12A 2G5GX 4CISA 4HMDA 4RKUF 1GLNA 4B08A 1OIPA 2UUBM 4JI8M 3C58A 5ITXE 3GPPA 1R6BX 3J7BA 5FTKA 3HU2A 3GLGE 3U6CA 3R9XB 1GABA 3B9PA 1ZMVA 1AIWA 5ITUA 4II7A 2J7OA 4JN6A 5EP1A 4PCZA 2CEAA 2DI0A 3W67A 2DWLA 4OVZA 4GMQA 3HKPA 4JI7M 4DR5M 3I4YA 4AG6A 2FOIC 3HU1A 4JI5M 3ZQJA 4LY6A 3IG8A 3M6AA 4YHHM 4L8RC 1UR9A 2JNHA 2R0IA 3U6EA 3WD0A 1Z5CA 2CHGA 2LH0A 3HJQA 3WHKA 1E6NA 2OPFA 8CATA 3NBIA 3KOYE 4GEWA 3MQLA 4GKKM 2KRKA 2C98A 2CP8A 4AW4A 5H37D 4B3TM 4KHPM 1N36M 4AKIA 2Y2GA 3V76A 5ITQA 4A3VB 3TQSA 1IBLM 4OVZB 3FKEA 1IXSA 1JR3A 2RKOA 1QANA 3T6PA 3U6QA 4TUWA 4G4QA 1L1ZA 4FWGA 1GO5A 3CF6E 3CTWB 1G4AE 1I4WA 1DGBA 1QQWA 1G3IA 1ZQ9A 4B3MM 1PDCA 3M7PA 4L15A 2Z3XA 2EKKA 3FTCA 2R62A 2JY5A 1IY2A 3CF0A 1L8QA 2DWNA 5KPZA 2EKFA 1D0MA 2L7HA 2JE5A 4IBGA 3KSXA 4B3SM 2FFJA 3LQRA 3TWKA 4OUIA 1NSFA 5C1BA 1YU2A 4LJ7A 2KA6B 3FUUA 3GLFA 3N3FA 4OW0A 3E21A 1IXSB 2Y2KA 1GJSA 1NV9A 2KXEA 2LBCA 4GHAA 4FD2A 4LF7M 4CIZA 3U5ZB 2YQZA 3TWMA 2DHYA 4NOOB 4LJ5A 5EP3A 1E9RA 2JZ0A 2K9DA 4FCWA 4FWHA 5FTMA 4LF8M 1H0GA 4LF5M 4LF9M 3RFWA 3E9SA 2XSZD 3WX7A 2JWSA 3M7GA 2K6BA 2QSFX 3GLFB 3RGPA 4OJPA 2YNMD 4IBDA 2R65A 3HY5A 4DR2M 1MJGM 1SXJB 4JI6M 4MB3A 4HMCA 1S3SA 1E15A 2LVOC 1R2YA 1A5TA 1XXHB 5FTJA 5KQDA 4LRTA 2CHQA 3U6DA 3DFZA 3FUWA 4G6ZA 3SHGB 1E6PA 1C1KA 4LJ6A 1HR0M 2DKLA 2VF8A 4LJAA 5LMUM 3UJNA 2V5OA 4LFBM 3L2AA 3ZCBB 3BXWA 3I51A 1XB2B 3B74A 4M9XA 3J7AS 3FUTA 1DGGA 2RGHA 3W0FA 2QPAA 2XFSA 1VEJA 1HJPA 2LVNC 4G4OA 2UXCM 1DV0A 4LGYA 3DA1A 1W1YA 4HLQA 4NSOB 2ZTCA 1WR1B 1ED7A 3TWLA 5A2QS 1VEGA 2MGWA 5EP2A 4YY3M 4Z8XA 2DAEA 1E32A 1L6JA 1YU4A 1Z59A 1W5SA 2CE7A 2JP7A 5ITXA 3K2LA 3GLGA 2Y2MA 3JAMS 2L2DA 4RF0A 3SATA 2L4FA 4QOZC 1TH2A 3LW5F 3TPZA 5E26A 2HAKA 4JI0M 1N33M 2L6OA 3GRRA 2C9CA 2WSCF 4Z2GA 2C9OA 3PFIA 3GO8A 2C96A 1HNWM 1W1TA 4DV5M 2ZBKB 4NZ4A 2JZ1A 4NXMM 5DYIA 3J2PB 5ITRA 1OAIA 2JY8A 2L09A 3GLGB 2OQ4A 2Y21A 1WXQA 2JXNA 1Y8GA 3JR4A 1DO0A 2BNKA 2O5RA 3HU3A 3HX3A 4GKJM 1ZMWA 3KSJA 1NO1A 5EJCA 2K0BX 2LHGA 1G8PA 4X65M 4WP2A 1P3QQ 1YUBA 2G8LA 4M9ZA 4B7FA 3VKGA 1NJFA 1X37A 2D7GA 2OO9A 4NRVA 2HHHM 5L8RF 1YE9A 3C9PA 2R6FA 4IJEA 4IBCA 4FCTA 4MH0E 5EP4A 3U61B 1W1PA 3HHYA 2YR0A 4X64M 3B7ZA 1PM5A 1Q3CA 2HWJA 3KP1E 4ITQA 1Q39A 4RF1A 2D7HA 3U6MA 2FN2A 2QZ4A 2RTSA 2XD5A 3EIEA 4NYUA 3SFZA 4B3RM 3MHVC 1HT2E 5JI2E 3FRHA 4HL4A 2LWXA 1UR8A 4AQYM 4AKGA 4IBFA 4KO8A 2XD1A 3AV0A 1HT1E 1FNNA 2CFOA 2MJ5B 3MJ5A 1E6RA 4X66M 3KXEC 3VK8A 4K0KM 4LGMA 3M0EA 3PNVA 5KO3A 4JI4M 1YUEA 2QBYB 4NZ5A 4DV6M 2Y2NA 2KHHA 3WHLA 4LJ9A 1SXJC 1OGGA 3K9PA 3SMPA 1IXRC 2KEBA 4GC9A 4MGZE 1HNXM 3L27A 4OX9M 1W1VA 5DYGA 1WGNA 3QYEA 3FE3A 1IFYA 3VKHA 2Y2PA 1EIJA 4Z2JA 4PD2A 4MGHA 1IN5A 1NHGC 2DZOB 4L6V6 4JXJA 4IJFA 4P16A 4D81A 2VQFM 2EJSA 3IHPA 3ZC7B 3HZJA 3U6LA 1VDLA 3U60A 2V1UA 4TX8A 2JY6B 3F92A 3W68A 4PDGA 3LCUA 4MM3B 1QVRA 2MH8A 1J7KA 2R44A 3K92A 4LZJA 2Z4RA 1F4IA 3A46A 4DV3M 1NHWC 1N34M 4BBAA 1JR3D 1L2BA 4HEOA 3UZUA 5C18A 1NY5A 3SYLA 3VDUA 4GHLA 4PT5A 4NL4H 3AKZA 2JY7A 2ERCA 1DGHA 3IECA 2F5SA 1E88A 2R18A 3SYKA 3U60B 1TTEA 3RE8A 4DR1M 2I7NA 4QOSA 1ZMUA 4QNRA 3E4RA 1EFUB 4Q7JA 1QAQA 1KYIA 2KNZA 4DR4M 4KODA 3I01M 1G41A 1QDRA 1D0KA 3GRYA 3Q8XA 3HJSA 4KT0F 2XZUA 1XMOM 4DUYM 3D8LA 1SXJD 1XHBA 1V33A 2AHMA 1PGYA 3I4VA 1OFHA 2OOBA 4JI1M 1FJGM 1YU0A 4WW0A 1DGHB 3FUVA 4X62M 2BWBA 3LQQA 1LV7A 2M5ZA 4FCVA 2QCUA 2MR9A 4FW9A 4JI3M 4DR7M 2BG1A 1WJ7A 2QENA 3SHFA 3R8FA 3AOGA 2F5OA 1JQJC 2KNVA 2XGNA 4R7GA 1IM2A 3HHWA 3FTFA 4ZPXA 2DHRA 1CK7A 2Y2OA 4LFCM 3SASA 1G59A 1V92A 4M0WA 4Z2LA 4G3OA 7CATA 1R2ZA 4QNLA 1D2NA 1DO2A 2CV2A 3WD3A 1XNRM 3UK6A 3TE6A 2Z7JA 1HQYE 1R4GA 2HCBA 2QNJA 4GH9A 1NV8A 1IQPA 3J81S 2F4VM 3AJIB 4LFAM 2IOUA 2VF7A 5FTLA 2R46A 3FUXA 5GKNA 3HHXA 3KVWA 2Y2IA 4M9SA 2FH0A 1TH3A 3QWLA 5E6JA 2DAIA 1N78A 2X49A 3LVVA 5IT9S 2QP9X 3H4JA 1GJTA 3U6OA 1OGBA 2APLA 3KOXE 3HHZA 1IN6A 2GQFA 4HMEA 4R3DA 3NWLA 3D8BA 4DV4M 1DGFA 1WGLA 2LVAA 4LJ8A 2ZM6M 3AFHA 4NZ3A 3GLHE 1XMQM 2O25A 5BR8M 3GLIE 2QQ8A 1EAKA 3SAUA 2DWZB 3L29A 2BWEA 1QDTA 1AIPC 2NQ8C 4JV5M 2LVQD 1MN3A 1CUKA 2M60A 3HSHA 1H6UA 1J09A 1R5LA 1YU1A 1XC8A 2Y20A 3DOAA 3KOWE 2DAMA 4F1IA 2DAKA 4NY2A 1T43A 4L78A 1GOIA 3PVSA 4MGKE 1D0LA 1OIZA 3TL4X 1O6IA 2F5QA 2HL7A 5EXSA 2XF3A 4QHTA 3WD2A 3AL0C 4DV7M 1N32M 4UN2B 1PJTA 3QAUA 2V6ZM 1QUTA 3C3DA 5JI3E 2Y2LA 4CGYB 2R4EA 1GVNA 2LHCA 1QZMA 4IIWA 1K3WA 2WSFF 1QAOA 3KOZE 3AOEA 3WD4A 3VLFB 3CF2A 1KSFX 2Z4SA 3B7QA 3BOSA 2KDLA 1V34A 5FTNA 4Z2KA 2L7IA 3LVWA
chains in the Genus database with same CATH topology
1NJGA 3UGJA 3DZDA 2Y2QA 3ZH9B 4I8OA 2LNHC 1N75A 2DVWB 4DUZM 3GQ3A 1HNZM 2CV0A 2KZUA 5IZ7D 4Z6YA 2R45A 2UUCM 2F5NA 2D7EA 2Q2EB 2XLJA 4NXNM 3LMMA 1N77A 4DV2M 1Z5AA 1IN8A 4EIWA 2UXDM 4MGIE 3JR5A 4IBBA 3VK7A 2UU9M 4JYAM 3FYDA 2KW0A 2LXEA 3J80S 3A45A 3OTOM 1TGUA 2J7NA 1E9SA 5ITTA 5DNYA 1IY1A 1W5TA 2HKJA 1PJJA 1YSYA 2CUZA 2EUCA 4KLNA 1QAMA 2DZNB 4AZFA 3FD9A 1L2DA 4LCBA 4GC5A 3H4MA 5LMNM 4AI6A 1L1TA 2YFQA 3W0LB 4LF4M 2Y0QA 3GRUA 3RGSA 3UMMA 1MU5A 3IG5A 4NSRA 4IBIA 4QNMA 3T1HM 1KFVA 1L2CA 3L25A 3SAVA 1TDHA 3U6PA 2KRUA 1OFIA 1IN7A 3L26A 4G4RA 3KP0E 1K3XA 2XEPA 2XFTA 1XNQM 2ZAMA 1HQCA 4NZ1A 3A98B 3GRVA 2KZSA 1R7RA 4LF6M 1E94E 2F5PA 3GLHA 5BPVA 1GL7A 3GLIA 3SAWA 2Y2JA 3T15A 2EA0A 2C99A 3U5ZA 1QYRA 2X8AA 1NY6A 2K47A 3PXGA 3VFDA 2CV1A 3T38A 4LZZA 2E5LM 3K8ZA 3GQ4A 5FSWA 1Z6TA 4QHSA 3HGIA 1Q3BA 3GPYA 2Y2HA 1SXJA 3GLHB 4BB9A 2R4JA 5EXXA 3GLIB 2XSZA 4RNAA 2Y0TA 4LRSA 1XXHA 3KDSE 4M0DA 4W5WA 5F3WA 4DR3M 3HJ8A 1ZAEA 2P5TA 3GQ5A 4MGYE 1OJLA 4IBEA 2ZANA 2BJWA 2XH9A 5KPTA 3GPUA 4AG5A 1YU3A 3T1YM 2BJVA 2CHVA 4MB7A 1T3TA 3K1JA 2EO2A 2XZFA 4G4NA 1TH4A 3SC3A 2FFFB 4PDIA 3FYCA 1NNJA 3ILKA 2FE8A 4GITA 4XGIA 1PJIA 1IN4A 3AOEC 4I5SA 3THGA 3SBJA 1I94M 4GIPA 1XWIA 1TDZA 4L16A 3KS4A 4B7HA 2ZAOA 1Z5BA 5KPRA 2FNAA 2VQEM 5IWAM 4LG2A 4XBOA 3L28A 3PNYA 4OJLA 4OJ6A 4AKHA 5KQ8A 2VIIA 4I4LA 1IBMM 1SXJE 2DWMA 1UM8A 3FTDA 1EE8A 1IY0A 3SMSA 5FLXS 1VDDA 1NVMA 4IBKA 1IBKM 4REZA 5EQTA 2UUAM 4I81A 3VDPA 4OJOA 4IBJA 3KS8A 1J5EM 4D82A 4NRWA 4DV0M 4B7GA 4OJ5A 2UXBM 2C5RA 5EXPA 5EXTA 5IREB 4D80A 3KW6A 4NYYA 2X4AA 4CHTB 3MK6A 3A42A 3KFUG 2RGOA 5ITYA 4FVMA 4GRIA 3U61A 3FTEA 3SARA 2DXIA 3HONA 2A5YB 1GL6A 4JI2M 3EIHA 3U6SA 2JA2A 1NNUC 1MX0A 1IXZA 2W82A 4DV1M 4WURA 3HWSA 1K82A 2JCHA 4L4UA 4BLCA 4LJ4A 4DR6M 3GP1A 3J27B 2V1CA 1ORYB 2I7PA 4FWDA 3GPXA 4OU7A 2QBYA 2H1RA 2UWXA 1GKIA 4S12A 2G5GX 4CISA 1GLNA 4B08A 2UUBM 4JI8M 3C58A 5ITXE 3GPPA 1R6BX 3J7BA 5FTKA 3HU2A 3U6CA 3R9XB 3B9PA 5ITUA 4II7A 2J7OA 4JN6A 5EP1A 4PCZA 2CEAA 2DWLA 4OVZA 4GMQA 3HKPA 4JI7M 4DR5M 3I4YA 4AG6A 2FOIC 3HU1A 4JI5M 4L8RC 4LY6A 3IG8A 3M6AA 4YHHM 3U6EA 1Z5CA 2CHGA 2LH0A 3HJQA 3WHKA 2OPFA 8CATA 3NBIA 3KOYE 4GKKM 2KRKA 2C98A 4AW4A 5H37D 4B3TM 4KHPM 1N36M 4AKIA 2Y2GA 5ITQA 4A3VB 3TQSA 1IBLM 4OVZB 3FKEA 2RKOA 1JR3A 4TUWA 1QANA 3U6QA 4G4QA 1L1ZA 4FWGA 3CF6E 3CTWB 1G4AE 1I4WA 1DGBA 1QQWA 1G3IA 1ZQ9A 4B3MM 4L15A 2Z3XA 3FTCA 2R62A 1IY2A 3CF0A 1L8QA 2DWNA 5KPZA 2L7HA 2JE5A 4IBGA 3KSXA 4B3SM 2FFJA 3LQRA 3TWKA 4OUIA 1NSFA 5C1BA 1YU2A 4LJ7A 2KA6B 3FUUA 3GLFA 3N3FA 4OW0A 1IXSB 2Y2KA 2KXEA 4GHAA 4FD2A 4LF7M 3U5ZB 2YQZA 3TWMA 4NOOB 4LJ5A 5EP3A 1E9RA 4FCWA 4FWHA 5FTMA 4LF8M 4LF5M 4LF9M 3RFWA 3E9SA 2XSZD 3WX7A 3M7GA 3GLFB 3RGPA 4OJPA 2YNMD 4IBDA 2R65A 4DR2M 1SXJB 4JI6M 1S3SA 1R2YA 1XXHB 5FTJA 5KQDA 4LRTA 2CHQA 3U6DA 3DFZA 3FUWA 4G6ZA 3SHGB 1C1KA 4LJ6A 1HR0M 4LJAA 5LMUM 3UJNA 4LFBM 3L2AA 3ZCBB 3I51A 4M9XA 3J7AS 3FUTA 1DGGA 2RGHA 3W0FA 2QPAA 2XFSA 4G4OA 2UXCM 4LGYA 3DA1A 4HLQA 4NSOB 3TWLA 5A2QS 5EP2A 4YY3M 4Z8XA 1E32A 1YU4A 1Z59A 1W5SA 2CE7A 5ITXA 3K2LA 3GLGA 2Y2MA 3JAMS 4RF0A 3SATA 4QOZC 1TH2A 3TPZA 5E26A 4JI0M 1N33M 2L6OA 3GRRA 2C9CA 2C9OA 3PFIA 3GO8A 2C96A 1HNWM 4NZ4A 4DV5M 2ZBKB 4NXMM 5DYIA 3J2PB 5ITRA 2L09A 3GLGB 2OQ4A 2Y21A 1WXQA 3JR4A 1DO0A 2BNKA 2O5RA 3HU3A 4GKJM 3KSJA 5EJCA 4X65M 1G8PA 1YUBA 4M9ZA 2G8LA 4B7FA 3VKGA 1NJFA 1X37A 2D7GA 4NRVA 2HHHM 1YE9A 4IJEA 4IBCA 4FCTA 4MH0E 5EP4A 3U61B 3HHYA 2YR0A 4X64M 1PM5A 1Q3CA 3KP1E 4ITQA 1Q39A 4RF1A 2D7HA 3U6MA 2QZ4A 2XD5A 3EIEA 4NYUA 3SFZA 4B3RM 3MHVC 1HT2E 5JI2E 4HL4A 2LWXA 4AQYM 4AKGA 4IBFA 4KO8A 2XD1A 3AV0A 1HT1E 1FNNA 2CFOA 3MJ5A 4X66M 3KXEC 3VK8A 4K0KM 4LGMA 3M0EA 3PNVA 5KO3A 4JI4M 1YUEA 2QBYB 4NZ5A 4DV6M 2Y2NA 3WHLA 4LJ9A 1SXJC 3SMPA 1IXRC 2KEBA 4GC9A 4MGZE 1HNXM 3L27A 4OX9M 5DYGA 3VKHA 2Y2PA 4PD2A 4MGHA 1IN5A 1NHGC 2DZOB 4P16A 4JXJA 4IJFA 4D81A 2VQFM 3ZC7B 3U6LA 3U60A 2V1UA 4PDGA 4MM3B 1QVRA 4LZJA 1J7KA 3K92A 2Z4RA 3A46A 4DV3M 1NHWC 1N34M 4BBAA 1JR3D 1L2BA 3UZUA 5C18A 1NY5A 3SYLA 3VDUA 4GHLA 4PT5A 4NL4H 3AKZA 2ERCA 1DGHA 2F5SA 2R18A 3SYKA 3U60B 3RE8A 4DR1M 2I7NA 4QOSA 4QNRA 3E4RA 1QAQA 1KYIA 4DR4M 4KODA 1G41A 3Q8XA 3GRYA 2XZUA 3HJSA 1XMOM 4DUYM 3D8LA 1SXJD 1XHBA 2AHMA 3I4VA 4JI1M 1OFHA 1FJGM 1YU0A 4WW0A 1DGHB 3FUVA 4X62M 3LQQA 4FCVA 1LV7A 2M5ZA 4FW9A 2QCUA 4JI3M 2BG1A 4DR7M 2F5OA 2QENA 3SHFA 3R8FA 3AOGA 1JQJC 2XGNA 4R7GA 1IM2A 3HHWA 3FTFA 4ZPXA 2DHRA 2Y2OA 4LFCM 3SASA 1G59A 4M0WA 7CATA 1R2ZA 4QNLA 1D2NA 1DO2A 2CV2A 1XNRM 3UK6A 3TE6A 2Z7JA 1HQYE 2HCBA 4GH9A 1IQPA 3J81S 2F4VM 3AJIB 4LFAM 2IOUA 5FTLA 2R46A 3FUXA 5GKNA 3HHXA 3KVWA 2Y2IA 4M9SA 1TH3A 3QWLA 5E6JA 1N78A 2X49A 3LVVA 5IT9S 2QP9X 3U6OA 3KOXE 3HHZA 1IN6A 4R3DA 3NWLA 3D8BA 4DV4M 1DGFA 4LJ8A 2ZM6M 3AFHA 4NZ3A 1XMQM 5BR8M 3SAUA 2DWZB 3L29A 2NQ8C 4JV5M 2M60A 3HSHA 1H6UA 1J09A 1YU1A 1XC8A 2Y20A 3DOAA 3KOWE 4NY2A 4L78A 3PVSA 4MGKE 3TL4X 2F5QA 2HL7A 5EXSA 2XF3A 4QHTA 3AL0C 4DV7M 1N32M 3QAUA 2V6ZM 5JI3E 2Y2LA 4CGYB 2R4EA 1GVNA 4IIWA 1QZMA 1K3WA 1QAOA 3KOZE 3AOEA 3VLFB 3CF2A 1KSFX 2Z4SA 3BOSA 5FTNA 2L7IA 3LVWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LG2 A;  3FKE A;  3L28 A;  4IBE A;  5BPV A;  4IBD A;  4IBF A;  4IBG A;  4IBK A;  4IBI A;  4GHL A;  3L25 A;  4IBB A;  3L26 A;  4IBJ A;  3KS8 A;  3L27 A;  4IJE A;  4IBC A;  3L29 A;  3KS4 A;  4GH9 A;  4GHA A;  3L2A A;  4IJF A; 
#chains in the Genus database with same CATH topology
 1NJG A;  3UGJ A;  3DZD A;  2Y2Q A;  3B89 A;  3ZH9 B;  4I8O A;  2LNH C;  1N75 A;  2DVW B;  4DUZ M;  3GQ3 A;  1HNZ M;  2CV0 A;  1OAO C;  3K9O A;  2KZU A;  5IZ7 D;  4Z6Y A;  2R45 A;  2UUC M;  1YLA A;  2F5N A;  2GNO A;  2D7E A;  2Q2E B;  2XLJ A;  4NXN M;  3LMM A;  1N77 A;  5DFL A;  4DV2 M;  1Z5A A;  1IN8 A;  4EIW A;  2UXD M;  1H0I A;  3NBX X;  4MGI E;  3JR5 A;  4IBB A;  3VK7 A;  2UU9 M;  4JYA M;  1VQ1 A;  3FYD A;  3MMP A;  2KW0 A;  2LXE A;  3J80 S;  3A45 A;  3OTO M;  1TGU A;  2J7N A;  1E9S A;  4F2L A;  5ITT A;  1PJQ A;  5DNY A;  1IY1 A;  1W5T A;  1J7M A;  1UFZ A;  2HKJ A;  3LCV B;  1PJJ A;  1YSY A;  2CUZ A;  2EUC A;  4KLN A;  1QAM A;  2DZN B;  4Y28 F;  2FS1 A;  3FD9 A;  4AZF A;  1L2D A;  2OOA A;  4LCB A;  4GC5 A;  3H4M A;  5LMN M;  4AI6 A;  1L1T A;  2YFQ A;  3W0L B;  4DBG B;  2Y0Q A;  3GRU A;  3RGS A;  4LF4 M;  2DNA A;  3UMM A;  1MU5 A;  2LVP C;  3IG5 A;  4NSR A;  4IBI A;  4QNM A;  3T1H M;  1KFV A;  1L2C A;  3L25 A;  3SAV A;  1TDH A;  3U6P A;  2KRU A;  1OFI A;  1IN7 A;  3QYB A;  3L26 A;  2ZTD A;  4G4R A;  1E6Z A;  4MB5 A;  3KP0 E;  1K3X A;  2XEP A;  2XFT A;  2KNA A;  1XNQ M;  2ZAM A;  2MRO B;  1QO6 A;  1WHC A;  4XK8 F;  3I04 M;  1HQC A;  4NZ1 A;  3A98 B;  2LTU A;  3GRV A;  2KZS A;  1R7R A;  4LF6 M;  1E94 E;  2F5P A;  3GLH A;  4P17 A;  5BPV A;  1GL7 A;  3GLI A;  3SAW A;  2DAG A;  2Y2J A;  4Z2H A;  3T15 A;  2EA0 A;  2C99 A;  1C7Y A;  3U5Z A;  1QYR A;  1TF0 B;  1VG5 A;  2N35 A;  1NY6 A;  2K47 A;  2X8A A;  3PXG A;  3VFD A;  2CV1 A;  3T38 A;  4LZZ A;  4Z2I A;  2E5L M;  3K8Z A;  3GQ4 A;  4MB4 A;  5FSW A;  2Z8Y M;  1Z6T A;  4QHS A;  2WSE F;  3HGI A;  1Q3B A;  3GPY A;  2DEN A;  1QUS A;  2Y2H A;  1SXJ A;  3CGW A;  3GLH B;  2R4J A;  5EXX A;  4BB9 A;  1T6O A;  2CWB A;  3GLI B;  1GXD A;  2XSZ A;  4RNA A;  2Y0T A;  4LRS A;  1XXH A;  2RRU A;  3KDS E;  4M0D A;  4W5W A;  4CJ6 A;  5F3W A;  4DR3 M;  3HJ8 A;  1ZAE A;  2P5T A;  3GQ5 A;  1LTM A;  4MGY E;  1OJL A;  4IBE A;  2ZAN A;  2BJW A;  2XH9 A;  4NC6 A;  5KPT A;  3GPU A;  4AG5 A;  2JUJ A;  3T1Y M;  1AUA A;  1YU3 A;  1OKS A;  3FRI A;  2BJV A;  2CHV A;  2VDB B;  4MB7 A;  2QHO B;  1T3T A;  1CXW A;  3K1J A;  2EO2 A;  2XZF A;  4G4N A;  1TH4 A;  3SC3 A;  2FFF B;  4PDI A;  3FYC A;  1NNJ A;  3ILK A;  2FE8 A;  4GIT A;  4XGI A;  1PJI A;  1IN4 A;  3AOE C;  4I5S A;  3THG A;  1JR3 E;  3SBJ A;  1I94 M;  3B7N A;  1XWI A;  4GIP A;  1KS0 A;  1QZE A;  1TDZ A;  4L16 A;  3KS4 A;  4B7H A;  2ZAO A;  1Z5B A;  5KPR A;  2FNA A;  2VQE M;  5IWA M;  4LG2 A;  2DZL A;  4XBO A;  3L28 A;  3PNY A;  3GLF E;  4OJL A;  4OJ6 A;  4AKH A;  1WIV A;  2B3T A;  2G3Q A;  2L4E A;  5KQ8 A;  2VII A;  1E8B A;  4I4L A;  1IBM M;  1SXJ E;  2DWM A;  1UM8 A;  3FTD A;  1JB0 F;  1IY0 A;  1EE8 A;  3SMS A;  5FLX S;  1H8P A;  1VDD A;  1XXH E;  1NVM A;  4IBK A;  1IBK M;  1ZV1 A;  4REZ A;  5EQT A;  2UUA M;  2H5X A;  1PRB A;  4I81 A;  3VDP A;  4OJO A;  3BBZ A;  1PJS A;  4IBJ A;  1J5E M;  4D82 A;  3C3E A;  4NRW A;  4DV0 M;  3KS8 A;  4B7G A;  1RU3 A;  4OJ5 A;  2UXB M;  2C5R A;  5EXP A;  5EXT A;  5IRE B;  4D80 A;  3KW6 A;  4NYY A;  2X4A A;  4CHT B;  1G71 A;  3MK6 A;  3A42 A;  3KFU G;  2RGO A;  5ITY A;  4FVM A;  4GRI A;  3Q8G A;  3U61 A;  3FTE A;  1GPF A;  3WD1 A;  1OQY A;  3SAR A;  2O01 F;  2DXI A;  3HON A;  1SG9 A;  2A5Y B;  1Q02 A;  4ANR A;  1GL6 A;  4JI2 M;  3E46 A;  3EIH A;  3U6S A;  2JA2 A;  1NNU C;  1MX0 A;  1IXZ A;  1VEK A;  2W82 A;  4WUR A;  3HWS A;  4R71 A;  4DV1 M;  4L4U A;  4BLC A;  1K82 A;  2D49 A;  2JCH A;  4LJ4 A;  4DR6 M;  2WZJ A;  3GP1 A;  1OTR A;  3J27 B;  1BVS A;  2V1C A;  1TR8 A;  2CRU A;  1ORY B;  2I7P A;  4FWD A;  3GPX A;  4OU7 A;  2QBY A;  2H1R A;  2J5Y A;  1GKI A;  2UWX A;  4S12 A;  2G5G X;  4CIS A;  4HMD A;  4RKU F;  1GLN A;  4B08 A;  1OIP A;  2UUB M;  4JI8 M;  3C58 A;  5ITX E;  3GPP A;  1R6B X;  3J7B A;  5FTK A;  3HU2 A;  3GLG E;  3U6C A;  3R9X B;  1GAB A;  3B9P A;  1ZMV A;  1AIW A;  5ITU A;  4II7 A;  2J7O A;  4JN6 A;  5EP1 A;  4PCZ A;  2CEA A;  2DI0 A;  3W67 A;  2DWL A;  4OVZ A;  4GMQ A;  3HKP A;  4JI7 M;  4DR5 M;  3I4Y A;  4AG6 A;  2FOI C;  3HU1 A;  4JI5 M;  3ZQJ A;  4LY6 A;  3IG8 A;  3M6A A;  4YHH M;  4L8R C;  1UR9 A;  2JNH A;  2R0I A;  3U6E A;  3WD0 A;  1Z5C A;  2CHG A;  2LH0 A;  3HJQ A;  3WHK A;  1E6N A;  2OPF A;  8CAT A;  3NBI A;  3KOY E;  4GEW A;  3MQL A;  4GKK M;  2KRK A;  2C98 A;  2CP8 A;  4AW4 A;  5H37 D;  4B3T M;  4KHP M;  1N36 M;  4AKI A;  2Y2G A;  3V76 A;  5ITQ A;  4A3V B;  3TQS A;  1IBL M;  4OVZ B;  3FKE A;  1IXS A;  1JR3 A;  2RKO A;  1QAN A;  3T6P A;  3U6Q A;  4TUW A;  4G4Q A;  1L1Z A;  4FWG A;  1GO5 A;  3CF6 E;  3CTW B;  1G4A E;  1I4W A;  1DGB A;  1QQW A;  1G3I A;  1ZQ9 A;  4B3M M;  1PDC A;  3M7P A;  4L15 A;  2Z3X A;  2EKK A;  3FTC A;  2R62 A;  2JY5 A;  1IY2 A;  3CF0 A;  1L8Q A;  2DWN A;  5KPZ A;  2EKF A;  1D0M A;  2L7H A;  2JE5 A;  4IBG A;  3KSX A;  4B3S M;  2FFJ A;  3LQR A;  3TWK A;  4OUI A;  1NSF A;  5C1B A;  1YU2 A;  4LJ7 A;  2KA6 B;  3FUU A;  3GLF A;  3N3F A;  4OW0 A;  3E21 A;  1IXS B;  2Y2K A;  1GJS A;  1NV9 A;  2KXE A;  2LBC A;  4GHA A;  4FD2 A;  4LF7 M;  4CIZ A;  3U5Z B;  2YQZ A;  3TWM A;  2DHY A;  4NOO B;  4LJ5 A;  5EP3 A;  1E9R A;  2JZ0 A;  2K9D A;  4FCW A;  4FWH A;  5FTM A;  4LF8 M;  1H0G A;  4LF5 M;  4LF9 M;  3RFW A;  3E9S A;  2XSZ D;  3WX7 A;  2JWS A;  3M7G A;  2K6B A;  2QSF X;  3GLF B;  3RGP A;  4OJP A;  2YNM D;  4IBD A;  2R65 A;  3HY5 A;  4DR2 M;  1MJG M;  1SXJ B;  4JI6 M;  4MB3 A;  4HMC A;  1S3S A;  1E15 A;  2LVO C;  1R2Y A;  1A5T A;  1XXH B;  5FTJ A;  5KQD A;  4LRT A;  2CHQ A;  3U6D A;  3DFZ A;  3FUW A;  4G6Z A;  3SHG B;  1E6P A;  1C1K A;  4LJ6 A;  1HR0 M;  2DKL A;  2VF8 A;  4LJA A;  5LMU M;  3UJN A;  2V5O A;  4LFB M;  3L2A A;  3ZCB B;  3BXW A;  3I51 A;  1XB2 B;  3B74 A;  4M9X A;  3J7A S;  3FUT A;  1DGG A;  2RGH A;  3W0F A;  2QPA A;  2XFS A;  1VEJ A;  1HJP A;  2LVN C;  4G4O A;  2UXC M;  1DV0 A;  4LGY A;  3DA1 A;  1W1Y A;  4HLQ A;  4NSO B;  2ZTC A;  1WR1 B;  1ED7 A;  3TWL A;  5A2Q S;  1VEG A;  2MGW A;  5EP2 A;  4YY3 M;  4Z8X A;  2DAE A;  1E32 A;  1L6J A;  1YU4 A;  1Z59 A;  1W5S A;  2CE7 A;  2JP7 A;  5ITX A;  3K2L A;  3GLG A;  2Y2M A;  3JAM S;  2L2D A;  4RF0 A;  3SAT A;  2L4F A;  4QOZ C;  1TH2 A;  3LW5 F;  3TPZ A;  5E26 A;  2HAK A;  4JI0 M;  1N33 M;  2L6O A;  3GRR A;  2C9C A;  2WSC F;  4Z2G A;  2C9O A;  3PFI A;  3GO8 A;  2C96 A;  1HNW M;  1W1T A;  4DV5 M;  2ZBK B;  4NZ4 A;  2JZ1 A;  4NXM M;  5DYI A;  3J2P B;  5ITR A;  1OAI A;  2JY8 A;  2L09 A;  3GLG B;  2OQ4 A;  2Y21 A;  1WXQ A;  2JXN A;  1Y8G A;  3JR4 A;  1DO0 A;  2BNK A;  2O5R A;  3HU3 A;  3HX3 A;  4GKJ M;  1ZMW A;  3KSJ A;  1NO1 A;  5EJC A;  2K0B X;  2LHG A;  1G8P A;  4X65 M;  4WP2 A;  1P3Q Q;  1YUB A;  2G8L A;  4M9Z A;  4B7F A;  3VKG A;  1NJF A;  1X37 A;  2D7G A;  2OO9 A;  4NRV A;  2HHH M;  5L8R F;  1YE9 A;  3C9P A;  2R6F A;  4IJE A;  4IBC A;  4FCT A;  4MH0 E;  5EP4 A;  3U61 B;  1W1P A;  3HHY A;  2YR0 A;  4X64 M;  3B7Z A;  1PM5 A;  1Q3C A;  2HWJ A;  3KP1 E;  4ITQ A;  1Q39 A;  4RF1 A;  2D7H A;  3U6M A;  2FN2 A;  2QZ4 A;  2RTS A;  2XD5 A;  3EIE A;  4NYU A;  3SFZ A;  4B3R M;  3MHV C;  1HT2 E;  5JI2 E;  3FRH A;  4HL4 A;  2LWX A;  1UR8 A;  4AQY M;  4AKG A;  4IBF A;  4KO8 A;  2XD1 A;  3AV0 A;  1HT1 E;  1FNN A;  2CFO A;  2MJ5 B;  3MJ5 A;  1E6R A;  4X66 M;  3KXE C;  3VK8 A;  4K0K M;  4LGM A;  3M0E A;  3PNV A;  5KO3 A;  4JI4 M;  1YUE A;  2QBY B;  4NZ5 A;  4DV6 M;  2Y2N A;  2KHH A;  3WHL A;  4LJ9 A;  1SXJ C;  1OGG A;  3K9P A;  3SMP A;  1IXR C;  2KEB A;  4GC9 A;  4MGZ E;  1HNX M;  3L27 A;  4OX9 M;  1W1V A;  5DYG A;  1WGN A;  3QYE A;  3FE3 A;  1IFY A;  3VKH A;  2Y2P A;  1EIJ A;  4Z2J A;  4PD2 A;  4MGH A;  1IN5 A;  1NHG C;  2DZO B;  4L6V 6;  4JXJ A;  4IJF A;  4P16 A;  4D81 A;  2VQF M;  2EJS A;  3IHP A;  3ZC7 B;  3HZJ A;  3U6L A;  1VDL A;  3U60 A;  2V1U A;  4TX8 A;  2JY6 B;  3F92 A;  3W68 A;  4PDG A;  3LCU A;  4MM3 B;  1QVR A;  2MH8 A;  1J7K A;  2R44 A;  3K92 A;  4LZJ A;  2Z4R A;  1F4I A;  3A46 A;  4DV3 M;  1NHW C;  1N34 M;  4BBA A;  1JR3 D;  1L2B A;  4HEO A;  3UZU A;  5C18 A;  1NY5 A;  3SYL A;  3VDU A;  4GHL A;  4PT5 A;  4NL4 H;  3AKZ A;  2JY7 A;  2ERC A;  1DGH A;  3IEC A;  2F5S A;  1E88 A;  2R18 A;  3SYK A;  3U60 B;  1TTE A;  3RE8 A;  4DR1 M;  2I7N A;  4QOS A;  1ZMU A;  4QNR A;  3E4R A;  1EFU B;  4Q7J A;  1QAQ A;  1KYI A;  2KNZ A;  4DR4 M;  4KOD A;  3I01 M;  1G41 A;  1QDR A;  1D0K A;  3GRY A;  3Q8X A;  3HJS A;  4KT0 F;  2XZU A;  1XMO M;  4DUY M;  3D8L A;  1SXJ D;  1XHB A;  1V33 A;  2AHM A;  1PGY A;  3I4V A;  1OFH A;  2OOB A;  4JI1 M;  1FJG M;  1YU0 A;  4WW0 A;  1DGH B;  3FUV A;  4X62 M;  2BWB A;  3LQQ A;  1LV7 A;  2M5Z A;  4FCV A;  2QCU A;  2MR9 A;  4FW9 A;  4JI3 M;  4DR7 M;  2BG1 A;  1WJ7 A;  2QEN A;  3SHF A;  3R8F A;  3AOG A;  2F5O A;  1JQJ C;  2KNV A;  2XGN A;  4R7G A;  1IM2 A;  3HHW A;  3FTF A;  4ZPX A;  2DHR A;  1CK7 A;  2Y2O A;  4LFC M;  3SAS A;  1G59 A;  1V92 A;  4M0W A;  4Z2L A;  4G3O A;  7CAT A;  1R2Z A;  4QNL A;  1D2N A;  1DO2 A;  2CV2 A;  3WD3 A;  1XNR M;  3UK6 A;  3TE6 A;  2Z7J A;  1HQY E;  1R4G A;  2HCB A;  2QNJ A;  4GH9 A;  1NV8 A;  1IQP A;  3J81 S;  2F4V M;  3AJI B;  4LFA M;  2IOU A;  2VF7 A;  5FTL A;  2R46 A;  3FUX A;  5GKN A;  3HHX A;  3KVW A;  2Y2I A;  4M9S A;  2FH0 A;  1TH3 A;  3QWL A;  5E6J A;  2DAI A;  1N78 A;  2X49 A;  3LVV A;  5IT9 S;  2QP9 X;  3H4J A;  1GJT A;  3U6O A;  1OGB A;  2APL A;  3KOX E;  3HHZ A;  1IN6 A;  2GQF A;  4HME A;  4R3D A;  3NWL A;  3D8B A;  4DV4 M;  1DGF A;  1WGL A;  2LVA A;  4LJ8 A;  2ZM6 M;  3AFH A;  4NZ3 A;  3GLH E;  1XMQ M;  2O25 A;  5BR8 M;  3GLI E;  2QQ8 A;  1EAK A;  3SAU A;  2DWZ B;  3L29 A;  2BWE A;  1QDT A;  1AIP C;  2NQ8 C;  4JV5 M;  2LVQ D;  1MN3 A;  1CUK A;  2M60 A;  3HSH A;  1H6U A;  1J09 A;  1R5L A;  1YU1 A;  1XC8 A;  2Y20 A;  3DOA A;  3KOW E;  2DAM A;  4F1I A;  2DAK A;  4NY2 A;  1T43 A;  4L78 A;  1GOI A;  3PVS A;  4MGK E;  1D0L A;  1OIZ A;  3TL4 X;  1O6I A;  2F5Q A;  2HL7 A;  5EXS A;  2XF3 A;  4QHT A;  3WD2 A;  3AL0 C;  4DV7 M;  1N32 M;  4UN2 B;  1PJT A;  3QAU A;  2V6Z M;  1QUT A;  3C3D A;  5JI3 E;  2Y2L A;  4CGY B;  2R4E A;  1GVN A;  2LHC A;  1QZM A;  4IIW A;  1K3W A;  2WSF F;  1QAO A;  3KOZ E;  3AOE A;  3WD4 A;  3VLF B;  3CF2 A;  1KSF X;  2Z4S A;  3B7Q A;  3BOS A;  2KDL A;  1V34 A;  5FTN A;  4Z2K A;  2L7I A;  3LVW A; 
#chains in the Genus database with same CATH homology
 1NJG A;  3UGJ A;  3DZD A;  2Y2Q A;  3ZH9 B;  4I8O A;  2LNH C;  1N75 A;  2DVW B;  4DUZ M;  3GQ3 A;  1HNZ M;  2CV0 A;  2KZU A;  5IZ7 D;  4Z6Y A;  2R45 A;  2UUC M;  2F5N A;  2D7E A;  2Q2E B;  2XLJ A;  4NXN M;  3LMM A;  1N77 A;  4DV2 M;  1Z5A A;  1IN8 A;  4EIW A;  2UXD M;  4MGI E;  3JR5 A;  4IBB A;  3VK7 A;  2UU9 M;  4JYA M;  3FYD A;  2KW0 A;  2LXE A;  3J80 S;  3A45 A;  3OTO M;  1TGU A;  2J7N A;  1E9S A;  5ITT A;  5DNY A;  1IY1 A;  1W5T A;  2HKJ A;  1PJJ A;  1YSY A;  2CUZ A;  2EUC A;  4KLN A;  1QAM A;  2DZN B;  4AZF A;  3FD9 A;  1L2D A;  4LCB A;  4GC5 A;  3H4M A;  5LMN M;  4AI6 A;  1L1T A;  2YFQ A;  3W0L B;  4LF4 M;  2Y0Q A;  3GRU A;  3RGS A;  3UMM A;  1MU5 A;  3IG5 A;  4NSR A;  4IBI A;  4QNM A;  3T1H M;  1KFV A;  1L2C A;  3L25 A;  3SAV A;  1TDH A;  3U6P A;  2KRU A;  1OFI A;  1IN7 A;  3L26 A;  4G4R A;  3KP0 E;  1K3X A;  2XEP A;  2XFT A;  1XNQ M;  2ZAM A;  1HQC A;  4NZ1 A;  3A98 B;  3GRV A;  2KZS A;  1R7R A;  4LF6 M;  1E94 E;  2F5P A;  3GLH A;  5BPV A;  1GL7 A;  3GLI A;  3SAW A;  2Y2J A;  3T15 A;  2EA0 A;  2C99 A;  3U5Z A;  1QYR A;  2X8A A;  1NY6 A;  2K47 A;  3PXG A;  3VFD A;  2CV1 A;  3T38 A;  4LZZ A;  2E5L M;  3K8Z A;  3GQ4 A;  5FSW A;  1Z6T A;  4QHS A;  3HGI A;  1Q3B A;  3GPY A;  2Y2H A;  1SXJ A;  3GLH B;  4BB9 A;  2R4J A;  5EXX A;  3GLI B;  2XSZ A;  4RNA A;  2Y0T A;  4LRS A;  1XXH A;  3KDS E;  4M0D A;  4W5W A;  5F3W A;  4DR3 M;  3HJ8 A;  1ZAE A;  2P5T A;  3GQ5 A;  4MGY E;  1OJL A;  4IBE A;  2ZAN A;  2BJW A;  2XH9 A;  5KPT A;  3GPU A;  4AG5 A;  1YU3 A;  3T1Y M;  2BJV A;  2CHV A;  4MB7 A;  1T3T A;  3K1J A;  2EO2 A;  2XZF A;  4G4N A;  1TH4 A;  3SC3 A;  2FFF B;  4PDI A;  3FYC A;  1NNJ A;  3ILK A;  2FE8 A;  4GIT A;  4XGI A;  1PJI A;  1IN4 A;  3AOE C;  4I5S A;  3THG A;  3SBJ A;  1I94 M;  4GIP A;  1XWI A;  1TDZ A;  4L16 A;  3KS4 A;  4B7H A;  2ZAO A;  1Z5B A;  5KPR A;  2FNA A;  2VQE M;  5IWA M;  4LG2 A;  4XBO A;  3L28 A;  3PNY A;  4OJL A;  4OJ6 A;  4AKH A;  5KQ8 A;  2VII A;  4I4L A;  1IBM M;  1SXJ E;  2DWM A;  1UM8 A;  3FTD A;  1EE8 A;  1IY0 A;  3SMS A;  5FLX S;  1VDD A;  1NVM A;  4IBK A;  1IBK M;  4REZ A;  5EQT A;  2UUA M;  4I81 A;  3VDP A;  4OJO A;  4IBJ A;  3KS8 A;  1J5E M;  4D82 A;  4NRW A;  4DV0 M;  4B7G A;  4OJ5 A;  2UXB M;  2C5R A;  5EXP A;  5EXT A;  5IRE B;  4D80 A;  3KW6 A;  4NYY A;  2X4A A;  4CHT B;  3MK6 A;  3A42 A;  3KFU G;  2RGO A;  5ITY A;  4FVM A;  4GRI A;  3U61 A;  3FTE A;  3SAR A;  2DXI A;  3HON A;  2A5Y B;  1GL6 A;  4JI2 M;  3EIH A;  3U6S A;  2JA2 A;  1NNU C;  1MX0 A;  1IXZ A;  2W82 A;  4DV1 M;  4WUR A;  3HWS A;  1K82 A;  2JCH A;  4L4U A;  4BLC A;  4LJ4 A;  4DR6 M;  3GP1 A;  3J27 B;  2V1C A;  1ORY B;  2I7P A;  4FWD A;  3GPX A;  4OU7 A;  2QBY A;  2H1R A;  2UWX A;  1GKI A;  4S12 A;  2G5G X;  4CIS A;  1GLN A;  4B08 A;  2UUB M;  4JI8 M;  3C58 A;  5ITX E;  3GPP A;  1R6B X;  3J7B A;  5FTK A;  3HU2 A;  3U6C A;  3R9X B;  3B9P A;  5ITU A;  4II7 A;  2J7O A;  4JN6 A;  5EP1 A;  4PCZ A;  2CEA A;  2DWL A;  4OVZ A;  4GMQ A;  3HKP A;  4JI7 M;  4DR5 M;  3I4Y A;  4AG6 A;  2FOI C;  3HU1 A;  4JI5 M;  4L8R C;  4LY6 A;  3IG8 A;  3M6A A;  4YHH M;  3U6E A;  1Z5C A;  2CHG A;  2LH0 A;  3HJQ A;  3WHK A;  2OPF A;  8CAT A;  3NBI A;  3KOY E;  4GKK M;  2KRK A;  2C98 A;  4AW4 A;  5H37 D;  4B3T M;  4KHP M;  1N36 M;  4AKI A;  2Y2G A;  5ITQ A;  4A3V B;  3TQS A;  1IBL M;  4OVZ B;  3FKE A;  2RKO A;  1JR3 A;  4TUW A;  1QAN A;  3U6Q A;  4G4Q A;  1L1Z A;  4FWG A;  3CF6 E;  3CTW B;  1G4A E;  1I4W A;  1DGB A;  1QQW A;  1G3I A;  1ZQ9 A;  4B3M M;  4L15 A;  2Z3X A;  3FTC A;  2R62 A;  1IY2 A;  3CF0 A;  1L8Q A;  2DWN A;  5KPZ A;  2L7H A;  2JE5 A;  4IBG A;  3KSX A;  4B3S M;  2FFJ A;  3LQR A;  3TWK A;  4OUI A;  1NSF A;  5C1B A;  1YU2 A;  4LJ7 A;  2KA6 B;  3FUU A;  3GLF A;  3N3F A;  4OW0 A;  1IXS B;  2Y2K A;  2KXE A;  4GHA A;  4FD2 A;  4LF7 M;  3U5Z B;  2YQZ A;  3TWM A;  4NOO B;  4LJ5 A;  5EP3 A;  1E9R A;  4FCW A;  4FWH A;  5FTM A;  4LF8 M;  4LF5 M;  4LF9 M;  3RFW A;  3E9S A;  2XSZ D;  3WX7 A;  3M7G A;  3GLF B;  3RGP A;  4OJP A;  2YNM D;  4IBD A;  2R65 A;  4DR2 M;  1SXJ B;  4JI6 M;  1S3S A;  1R2Y A;  1XXH B;  5FTJ A;  5KQD A;  4LRT A;  2CHQ A;  3U6D A;  3DFZ A;  3FUW A;  4G6Z A;  3SHG B;  1C1K A;  4LJ6 A;  1HR0 M;  4LJA A;  5LMU M;  3UJN A;  4LFB M;  3L2A A;  3ZCB B;  3I51 A;  4M9X A;  3J7A S;  3FUT A;  1DGG A;  2RGH A;  3W0F A;  2QPA A;  2XFS A;  4G4O A;  2UXC M;  4LGY A;  3DA1 A;  4HLQ A;  4NSO B;  3TWL A;  5A2Q S;  5EP2 A;  4YY3 M;  4Z8X A;  1E32 A;  1YU4 A;  1Z59 A;  1W5S A;  2CE7 A;  5ITX A;  3K2L A;  3GLG A;  2Y2M A;  3JAM S;  4RF0 A;  3SAT A;  4QOZ C;  1TH2 A;  3TPZ A;  5E26 A;  4JI0 M;  1N33 M;  2L6O A;  3GRR A;  2C9C A;  2C9O A;  3PFI A;  3GO8 A;  2C96 A;  1HNW M;  4NZ4 A;  4DV5 M;  2ZBK B;  4NXM M;  5DYI A;  3J2P B;  5ITR A;  2L09 A;  3GLG B;  2OQ4 A;  2Y21 A;  1WXQ A;  3JR4 A;  1DO0 A;  2BNK A;  2O5R A;  3HU3 A;  4GKJ M;  3KSJ A;  5EJC A;  4X65 M;  1G8P A;  1YUB A;  4M9Z A;  2G8L A;  4B7F A;  3VKG A;  1NJF A;  1X37 A;  2D7G A;  4NRV A;  2HHH M;  1YE9 A;  4IJE A;  4IBC A;  4FCT A;  4MH0 E;  5EP4 A;  3U61 B;  3HHY A;  2YR0 A;  4X64 M;  1PM5 A;  1Q3C A;  3KP1 E;  4ITQ A;  1Q39 A;  4RF1 A;  2D7H A;  3U6M A;  2QZ4 A;  2XD5 A;  3EIE A;  4NYU A;  3SFZ A;  4B3R M;  3MHV C;  1HT2 E;  5JI2 E;  4HL4 A;  2LWX A;  4AQY M;  4AKG A;  4IBF A;  4KO8 A;  2XD1 A;  3AV0 A;  1HT1 E;  1FNN A;  2CFO A;  3MJ5 A;  4X66 M;  3KXE C;  3VK8 A;  4K0K M;  4LGM A;  3M0E A;  3PNV A;  5KO3 A;  4JI4 M;  1YUE A;  2QBY B;  4NZ5 A;  4DV6 M;  2Y2N A;  3WHL A;  4LJ9 A;  1SXJ C;  3SMP A;  1IXR C;  2KEB A;  4GC9 A;  4MGZ E;  1HNX M;  3L27 A;  4OX9 M;  5DYG A;  3VKH A;  2Y2P A;  4PD2 A;  4MGH A;  1IN5 A;  1NHG C;  2DZO B;  4P16 A;  4JXJ A;  4IJF A;  4D81 A;  2VQF M;  3ZC7 B;  3U6L A;  3U60 A;  2V1U A;  4PDG A;  4MM3 B;  1QVR A;  4LZJ A;  1J7K A;  3K92 A;  2Z4R A;  3A46 A;  4DV3 M;  1NHW C;  1N34 M;  4BBA A;  1JR3 D;  1L2B A;  3UZU A;  5C18 A;  1NY5 A;  3SYL A;  3VDU A;  4GHL A;  4PT5 A;  4NL4 H;  3AKZ A;  2ERC A;  1DGH A;  2F5S A;  2R18 A;  3SYK A;  3U60 B;  3RE8 A;  4DR1 M;  2I7N A;  4QOS A;  4QNR A;  3E4R A;  1QAQ A;  1KYI A;  4DR4 M;  4KOD A;  1G41 A;  3Q8X A;  3GRY A;  2XZU A;  3HJS A;  1XMO M;  4DUY M;  3D8L A;  1SXJ D;  1XHB A;  2AHM A;  3I4V A;  4JI1 M;  1OFH A;  1FJG M;  1YU0 A;  4WW0 A;  1DGH B;  3FUV A;  4X62 M;  3LQQ A;  4FCV A;  1LV7 A;  2M5Z A;  4FW9 A;  2QCU A;  4JI3 M;  2BG1 A;  4DR7 M;  2F5O A;  2QEN A;  3SHF A;  3R8F A;  3AOG A;  1JQJ C;  2XGN A;  4R7G A;  1IM2 A;  3HHW A;  3FTF A;  4ZPX A;  2DHR A;  2Y2O A;  4LFC M;  3SAS A;  1G59 A;  4M0W A;  7CAT A;  1R2Z A;  4QNL A;  1D2N A;  1DO2 A;  2CV2 A;  1XNR M;  3UK6 A;  3TE6 A;  2Z7J A;  1HQY E;  2HCB A;  4GH9 A;  1IQP A;  3J81 S;  2F4V M;  3AJI B;  4LFA M;  2IOU A;  5FTL A;  2R46 A;  3FUX A;  5GKN A;  3HHX A;  3KVW A;  2Y2I A;  4M9S A;  1TH3 A;  3QWL A;  5E6J A;  1N78 A;  2X49 A;  3LVV A;  5IT9 S;  2QP9 X;  3U6O A;  3KOX E;  3HHZ A;  1IN6 A;  4R3D A;  3NWL A;  3D8B A;  4DV4 M;  1DGF A;  4LJ8 A;  2ZM6 M;  3AFH A;  4NZ3 A;  1XMQ M;  5BR8 M;  3SAU A;  2DWZ B;  3L29 A;  2NQ8 C;  4JV5 M;  2M60 A;  3HSH A;  1H6U A;  1J09 A;  1YU1 A;  1XC8 A;  2Y20 A;  3DOA A;  3KOW E;  4NY2 A;  4L78 A;  3PVS A;  4MGK E;  3TL4 X;  2F5Q A;  2HL7 A;  5EXS A;  2XF3 A;  4QHT A;  3AL0 C;  4DV7 M;  1N32 M;  3QAU A;  2V6Z M;  5JI3 E;  2Y2L A;  4CGY B;  2R4E A;  1GVN A;  4IIW A;  1QZM A;  1K3W A;  1QAO A;  3KOZ E;  3AOE A;  3VLF B;  3CF2 A;  1KSF X;  2Z4S A;  3BOS A;  5FTN A;  2L7I A;  3LVW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...