3L26A

Crystal structure of zaire ebola vp35 interferon inhibitory domain bound to 8 bp dsrna
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
123
structure length
123
Chain Sequence
DISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein/rna
molecule keywords Polymerase cofactor VP35
publication title Structural basis for dsRNA recognition and interferon antagonism by Ebola VP35.
pubmed doi rcsb
source organism Zaire ebolavirus
total genus 40
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3l26A01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 3l26A02
4GH9A 3L26A 3KS8A 4IBBA 4LG2A 3L28A 4IBDA 4IBKA 4IBCA 5BPVA 4IBFA 3L29A 4GHAA 3FKEA 4IJFA 4IBIA 4IBJA 4GHLA 3L25A 4IBEA 4IBGA 3L27A 3L2AA 4IJEA 3KS4A
chains in the Genus database with same CATH superfamily
3KOXE 2J7NA 2QHOB 4OX9M 3C3EA 1PDCA 3BXWA 3FUUA 3HY5A 5JI3E 1UR9A 3KSXA 3RE8A 3OTOM 4R3DA 3AOEC 4OJLA 3DA1A 4IBBA 2DZOB 5A2QS 4KT0F 4RKUF 3KVWA 2FNAA 2JY7A 1N77A 3SARA 1NSFA 5KO3A 2DENA 4FCTA 3WD0A 1XNQM 3C3DA 3IG8A 2X4AA 4NZ1A 4LRSA 4RNAA 4D81A 5KPRA 4OVZA 1TGUA 4XBOA 3M7PA 4TX8A 3WD4A 4FWDA 2Z4SA 1OFIA 4FWHA 5ITRA 2D7GA 3IG5A 3GPXA 1J5EM 2DWLA 4DUZM 1I94M 1XNRM 2XSZD 2XFTA 3AOEA 1PJTA 4Z8XA 1YU3A 3B74A 3L2AA 3SHGB 5DFLA 2XLJA 3GQ5A 3GRYA 1YU2A 4NC6A 1ED7A 4PT5A 2KZSA 3A42A 3LCVB 1D0KA 2DZNB 1G4AE 4LJ5A 2OPFA 4QNLA 4MGYE 3Q8GA 3KOYE 5EXSA 1QZEA 1ZMWA 5BPVA 2VF7A 2V5OA 2CE7A 3FKEA 4IJFA 3FD9A 1P3QQ 3PFIA 4D82A 3B89A 1NHGC 2WZJA 1XMQM 1N32M 2M60A 3VDPA 2CHGA 3GLFA 1IBLM 4FCWA 4NZ3A 2LHGA 2QCUA 1OQYA 1QANA 1TH3A 2F5OA 4JYAM 1GXDA 4GMQA 4Q7JA 1MJGM 4CHTB 4Z2IA 5JI2E 2DKLA 1G41A 4HL4A 1WHCA 4LY6A 4AKIA 4PCZA 4QHSA 2LVAA 4L15A 4EIWA 4GRIA 1C7YA 5DYIA 4X65M 3E21A 1CXWA 1KS0A 1IXZA 4L16A 2Y2NA 4A3VB 2A5YB 4II7A 2E5LM 1L1ZA 2K6BA 5DNYA 2VIIA 1QUSA 1IN4A 2DHYA 5C18A 2CV0A 4X62M 1MN3A 2J7OA 3WHKA 4BLCA 3KFUG 1IN6A 4QOSA 4QHTA 1PJQA 2JP7A 1IXSA 3SMSA 4IBEA 4AI6A 2Z8YM 2O01F 2MROB 3HGIA 2M5ZA 4OJ5A 4Z2KA 1HQCA 3K1JA 3Q8XA 1ZMUA 2BWEA 3B9PA 1VEGA 3NWLA 2XEPA 4BBAA 2R6FA 1GPFA 3HJSA 1NJGA 1QDTA 1W1VA 1X37A 5ITYA 2RRUA 1XHBA 3RGPA 3W0FA 2XZFA 3MK6A 4AQYM 2G5GX 3VKHA 2FE8A 4AKHA 1EIJA 7CATA 2CUZA 2HAKA 4JXJA 3TE6A 4LFCM 2R62A 2DVWB 2ZANA 3HWSA 1D2NA 3LCUA 3HHWA 3F92A 2F5PA 3U61B 1JR3D 2BNKA 1HQYE 2V1CA 1VDLA 3FYCA 4NRVA 3C9PA 2L7HA 1XWIA 4B3TM 3I04M 1EFUB 1H0IA 1QAOA 4G4NA 1PM5A 4DR4M 2MGWA 3TWLA 2YNMD 4DV7M 5L8RF 1PJIA 1L2BA 2CHVA 4X66M 3L26A 2DAEA 4DR5M 2L6OA 2F5SA 5EP3A 1S3SA 2OOBA 4L8RC 1PRBA 4NL4H 1AIPC 3MJ5A 4Z6YA 3UMMA 1IM2A 2L7IA 4NOOB 4ANRA 4DR3M 1R2YA 1OFHA 3SHFA 1T43A 4KO8A 5KQDA 1J7MA 4LZZA 4MGIE 3SAUA 4MGKE 5EQTA 3AJIB 1N75A 4GC5A 2VQEM 2UXBM 4CGYB 2QBYB 1PJJA 1TR8A 2L2DA 4NZ4A 2HHHM 4M9SA 1F4IA 1IN5A 2BWBA 3TPZA 3J7BA 5KPTA 1E9RA 1FJGM 2B3TA 5EP2A 3I4YA 2JY5A 4LJ7A 3HJ8A 3T38A 3M7GA 5DYGA 2EKKA 2DAKA 3GLGE 4HMCA 3J7AS 2OOAA 4OJ6A 2LWXA 2ERCA 1G59A 3GRUA 2ZTDA 4ZPXA 5EXTA 3SYKA 2R44A 4MM3B 3U6DA 1QZMA 1IXRC 3KS8A 2KRUA 4JI7M 3KOWE 4Z2LA 4KHPM 1D0LA 3N3FA 1D0MA 2Y0TA 1SXJD 2CWBA 1OAOC 3MMPA 4CJ6A 1C1KA 3H4MA 4G3OA 3U6OA 1XC8A 1N36M 1YUBA 4MB5A 3GLGB 3RGSA 1ZAEA 3SC3A 3TWKA 3MQLA 3PVSA 4G4RA 1V92A 3CF0A 2D7EA 2R4JA 4LJ6A 4JI0M 3U6CA 1QO6A 2BG1A 3WD2A 5ITXE 2JZ1A 2ZBKB 3I4VA 2O5RA 3AOGA 4FWGA 4FVMA 3UZUA 2FN2A 2JNHA 5EXXA 3TQSA 3ZH9B 3U61A 4QNRA 1IN8A 3FTFA 3E4RA 4M0DA 1G71A 3AFHA 3HU1A 2Z3XA 2DWZB 2LVOC 4MB7A 1R7RA 1DV0A 2D49A 1AIWA 3FRHA 1PJSA 1Z5AA 4HEOA 1NJFA 3PXGA 1OAIA 2C9CA 2C99A 2GNOA 3FRIA 2F4VM 4WW0A 1T6OA 1N33M 1LTMA 5ITUA 1W5SA 3FUTA 5FSWA 2JY6B 3BOSA 2UUCM 1H0GA 1YU4A 5E6JA 1DGHA 4DR1M 2C5RA 2UXDM 1Q3BA 1XXHE 3EIHA 3T1HM 4IBIA 1W1PA 4LF5M 2XSZA 2YR0A 4MGHA 1I4WA 2XH9A 5FLXS 4FCVA 1HNXM 2QBYA 3MHVC 2CV2A 4W5WA 4JI6M 4HMDA 4R71A 3DOAA 4GKJM 1JR3E 3HZJA 4I8OA 2HCBA 3QYEA 5E26A 2ZM6M 4LFAM 1XXHB 1VDDA 1IQPA 1H8PA 4PDGA 4QOZC 3VLFB 3UK6A 2C96A 1Z59A 4Z2GA 4M0WA 2Y2KA 3SAVA 3L28A 2DNAA 3HHYA 1IBKM 3I01M 2MJ5B 1TF0B 3KP1E 1IY2A 1YE9A 4QNMA 2JWSA 2LH0A 2XZUA 3HJQA 2KW0A 4MB3A 1W1YA 3HX3A 1IN7A 1J7KA 2CFOA 4RF1A 3WX7A 2QPAA 2JXNA 4YHHM 3GQ3A 1K3WA 3HHXA 2RTSA 3FUWA 3GPUA 2W82A 1E15A 4AG6A 3B7ZA 4GEWA 3ZCBB 4JN6A 3FTEA 1HR0M 3HHZA 1IFYA 4LJ9A 4LF9M 1ZQ9A 1TH2A 4DUYM 3FE3A 1R2ZA 1TH4A 1Z5CA 1AUAA 1L2DA 3CF2A 3SATA 3J81S 1GJTA 4KODA 4WURA 3GO8A 3M0EA 1GOIA 3LMMA 2Y2MA 1L8QA 4BB9A 4LF6M 2V1UA 1HJPA 2EJSA 1G8PA 1WJ7A 4IBDA 4WP2A 3T15A 1HNZM 1HNWM 4FD2A 2CRUA 2Y2GA 2NQ8C 5ITXA 3A46A 4I4LA 1SXJE 2KNVA 3KSJA 2G8LA 2KA6B 3GLHE 4Y28F 4JI2M 2XD1A 1E6PA 1E9SA 1R4GA 1WGLA 2QSFX 2Y21A 4L6V6 4DV0M 2Y2QA 1E8BA 2K47A 1JQJC 2LTUA 3L25A 3DFZA 4AW4A 4G6ZA 3T6PA 1WR1B 4CISA 3VDUA 1SXJB 3KS4A 2LHCA 4GKKM 1TDHA 3FYDA 3SYLA 2DXIA 3RFWA 3GLHB 2O25A 4OW0A 3ZQJA 4JV5M 3W67A 4B3SM 3SFZA 2X49A 2MR9A 4B08A 3VK8A 3AV0A 4CIZA 1NV8A 1XXHA 1ZV1A 3LVWA 5FTLA 4YY3M 1OGGA 2UU9M 3GQ4A 1E88A 2K0BX 2Y2PA 4G4QA 1NO1A 3DZDA 4I81A 1GABA 1IY1A 2XGNA 2BJWA 4REZA 4GHAA 5LMUM 1JR3A 4NRWA 2P5TA 2VDBB 3B7NA 1E32A 2K9DA 2RKOA 4M9XA 3QAUA 4P17A 5KQ8A 4LF4M 4IBJA 1NNJA 2WSFF 3VK7A 2Y2OA 4LGYA 2HKJA 2OO9A 4MGZE 3L27A 5IREB 3W68A 3K92A 4OU7A 2CEAA 5GKNA 3HONA 3J80S 3QYBA 4PDIA 3U6LA 2C9OA 3NBXX 4F2LA 1L2CA 4DR7M 2AHMA 3CGWA 4UN2B 3ZC7B 2N35A 3SASA 4M9ZA 3GP1A 3VKGA 2H1RA 4DR6M 5LMNM 1SG9A 3D8LA 4F1IA 3LQRA 1QUTA 1OJLA 3PNYA 1CUKA 1E94E 3AL0C 2ZTCA 3I51A 1UR8A 4DV4M 1A5TA 1XB2B 1QVRA 1Y8GA 2EKFA 2Y2LA 1GJSA 4DV5M 1OIZA 3JR4A 2XF3A 1GL6A 3HU3A 8CATA 4RF0A 3W0LB 1G3IA 1VQ1A 4LFBM 2KXEA 4DV2M 1OGBA 5C1BA 4OJOA 1N34M 4LJAA 4L4UA 2ZAOA 3LQQA 4IJEA 3NBIA 1NVMA 2R65A 3BBZA 2QP9X 1J09A 1K3XA 2Y0QA 2JCHA 2FOIC 4JI3M 2LVNC 2WSEF 3E46A 1NHWC 1PGYA 1Q39A 1NY6A 1SXJA 4GITA 2D7HA 5FTJA 4DR2M 4MB4A 1VEJA 1WIVA 3GLHA 2XD5A 1R5LA 2ZAMA 5FTNA 2MH8A 4IBKA 5KPZA 4P16A 2QENA 3FUVA 1YSYA 1IXSB 4L78A 1DGFA 2YFQA 2R4EA 4B7GA 4KLNA 3GPYA 3PNVA 1Q02A 2DHRA 2XFSA 1T3TA 2RGHA 4MH0E 1E6RA 1W1TA 2UWXA 1GVNA 1MU5A 1OIPA 3LW5F 4LRTA 4XGIA 4NYYA 1Z5BA 1ZMVA 5IT9S 1CK7A 2HL7A 1TTEA 2V6ZM 3U6SA 4AKGA 3HSHA 3GLIE 4GH9A 1BVSA 2R18A 4LCBA 1EE8A 2BJVA 3ILKA 1YUEA 1YU1A 2DWNA 1ORYB 2GQFA 3TL4X 4B7HA 2DAMA 2EA0A 1UM8A 2R0IA 4B7FA 4NYUA 4G4OA 1DGGA 4NY2A 3M6AA 2I7NA 4NXNM 3WD3A 1RU3A 3JR5A 3SMPA 5BR8M 3A98B 2Y2IA 1YU0A 3K8ZA 3WD1A 2G3QA 3SAWA 2APLA 2QQ8A 4IBCA 3UJNA 5EP4A 3KDSE 3GLIB 3U60B 1GL7A 4IBFA 2C98A 1DGBA 3D8BA 1L1TA 3EIEA 2EUCA 1UFZA 2JA2A 3R8FA 2UXCM 1JB0F 3GLGA 1Z6TA 1H6UA 3U6PA 1K82A 1E6NA 2JZ0A 4LGMA 2LXEA 2Z4RA 1OKSA 3IECA 1MX0A 3J2PB 4XK8F 3WHLA 5H37D 4K0KM 2LBCA 2LVQD 4R7GA 4DV3M 3U5ZB 2IOUA 4DV1M 2FS1A 3FTCA 3THGA 3R9XB 4FW9A 5EJCA 4NXMM 2JY8A 2J5YA 2RGOA 1WGNA 2CV1A 4B3RM 3HKPA 1HT1E 1E6ZA 1KSFX 2Y2HA 4LJ4A 1HT2E 1DO0A 3A45A 2DWMA 3SBJA 2JE5A 1W5TA 1Q3CA 3GRVA 3L29A 3LVVA 5IWAM 5FTKA 1GKIA 3QWLA 2KEBA 4NSOB 1R6BX 5FTMA 2OQ4A 2HWJA 1IBMM 2X8AA 3KP0E 2Y2JA 2JUJA 1GLNA 3E9SA 3K9PA 1QQWA 1KFVA 1VEKA 2F5NA 4OJPA 3KXEC 1KYIA 4IBGA 3FTDA 4TUWA 3CTWB 2UUBM 2KHHA 2QZ4A 4GC9A 4OUIA 2FH0A 2KNAA 4JI5M 1VG5A 4HLQA 4LG2A 5EP1A 1V33A 4I5SA 3U6EA 4LZJA 4NSRA 3GRRA 1QAQA 1N78A 4OVZB 2FFFB 5IZ7D 2H5XA 1QAMA 4Z2HA 2Z7JA 4AZFA 4JI1M 5ITQA 2L4EA 4IIWA 4AG5A 1IY0A 3KOZE 4JI8M 3GLIA 3U60A 4JI4M 3K2LA 2FFJA 2CHQA 4GHLA 3KW6A 4S12A 3UGJA 1V34A 3B7QA 4LF8M 3VFDA 2DZLA 1XMOM 2UUAM 1QYRA 3V76A 4PD2A 4LF7M 3FUXA 2L4FA 3HU2A 3C58A 2KRKA 1DO2A 1DGHB 3U6QA 3GLFE 1O6IA 3T1YM 3TWMA 1QDRA 3U5ZA 3H4JA 4DBGB 5F3WA 1GO5A 2LVPC 2DAGA 4X64M 3CF6E 3GPPA 2QNJA 2CP8A 2YQZA 1EAKA 2L09A 1YLAA 2VF8A 2KNZA 3JAMS 4NZ5A 4Z2JA 1FNNA 4GIPA 4HMEA 2DAIA 2R46A 3U6MA 1WXQA 1NNUC 1SXJC 3GLFB 4DV6M 5EXPA 1LV7A 2EO2A 5ITTA 1NV9A 2I7PA 2VQFM 2LNHC 4B3MM 2R45A 2DI0A 1NY5A 3K9OA 2Q2EB 2KDLA 3IHPA 3AKZA 4LJ8A 2Y20A 3J27B 1OTRA 1TDZA 2F5QA 1L6JA 2KZUA 4D80A 2WSCF 4ITQA
chains in the Genus database with same CATH topology
3KOXE 2J7NA 4OX9M 5JI3E 3FUUA 4OJLA 3KSXA 3RE8A 3OTOM 4R3DA 3AOEC 3DA1A 4IBBA 2DZOB 5A2QS 3KVWA 2FNAA 1N77A 3SARA 1NSFA 5KO3A 4FCTA 1XNQM 3IG8A 2X4AA 4NZ1A 4LRSA 4RNAA 4D81A 5KPRA 4OVZA 1TGUA 4XBOA 4FWDA 2Z4SA 1OFIA 4FWHA 5ITRA 2D7GA 3IG5A 3GPXA 1J5EM 2DWLA 4DUZM 1I94M 1XNRM 2XSZD 2XFTA 3AOEA 4Z8XA 1YU3A 3L2AA 3SHGB 2XLJA 3GQ5A 3GRYA 1YU2A 4PT5A 2KZSA 3A42A 2DZNB 1G4AE 4LJ5A 2OPFA 4QNLA 4MGYE 3KOYE 5EXSA 5BPVA 2CE7A 3FKEA 4IJFA 3FD9A 3PFIA 4D82A 1NHGC 1XMQM 1N32M 2KZUA 2M60A 3VDPA 2CHGA 3GLFA 1IBLM 4FCWA 4NZ3A 2QCUA 1QANA 1TH3A 2F5OA 4JYAM 4GMQA 4CHTB 5JI2E 1G41A 4HL4A 4LY6A 4AKIA 4PCZA 4QHSA 4L15A 4EIWA 4GRIA 5DYIA 4X65M 1IXZA 4L16A 2Y2NA 4A3VB 2A5YB 4II7A 2E5LM 1L1ZA 5DNYA 2VIIA 1IN4A 2CV0A 5C18A 4X62M 2J7OA 3WHKA 3KFUG 4BLCA 1IN6A 4QOSA 4QHTA 3SMSA 4IBEA 4AI6A 3HGIA 2M5ZA 4OJ5A 1HQCA 3K1JA 3Q8XA 3B9PA 3NWLA 2XEPA 4BBAA 3HJSA 1NJGA 1X37A 5ITYA 3RGPA 1XHBA 3W0FA 2XZFA 3MK6A 4AQYM 2G5GX 3VKHA 2FE8A 4AKHA 7CATA 2CUZA 3TE6A 4JXJA 4LFCM 2R62A 2DVWB 2ZANA 3HWSA 1D2NA 3HHWA 2F5PA 3U61B 1JR3D 2BNKA 1HQYE 2V1CA 3FYCA 4NRVA 2L7HA 1XWIA 4B3TM 1QAOA 4G4NA 1PM5A 4DR4M 3TWLA 2YNMD 4DV7M 1PJIA 1L2BA 2CHVA 4X66M 3L26A 4DR5M 2L6OA 2F5SA 5EP3A 1S3SA 4L8RC 3UMMA 4NL4H 4Z6YA 3MJ5A 1IM2A 2L7IA 4NOOB 4DR3M 1R2YA 1OFHA 3SHFA 4KO8A 5KQDA 4LZZA 4MGIE 3SAUA 4MGKE 5EQTA 3AJIB 1N75A 4GC5A 2VQEM 2UXBM 4CGYB 2QBYB 1PJJA 4NZ4A 2HHHM 4M9SA 1IN5A 3TPZA 3J7BA 5KPTA 1E9RA 1FJGM 5EP2A 3I4YA 4LJ7A 3T38A 3HJ8A 3M7GA 5DYGA 3J7AS 4OJ6A 2LWXA 2ERCA 1G59A 3GRUA 4ZPXA 3SYKA 5EXTA 3U6DA 4MM3B 1QZMA 1IXRC 3KS8A 2KRUA 4JI7M 3KOWE 4KHPM 3N3FA 2Y0TA 1SXJD 1C1KA 3H4MA 3U6OA 1XC8A 1N36M 1YUBA 3GLGB 3RGSA 1ZAEA 3SC3A 3TWKA 3PVSA 4G4RA 3CF0A 2D7EA 2R4JA 4LJ6A 4JI0M 3U6CA 2BG1A 5ITXE 2ZBKB 3I4VA 2O5RA 3AOGA 4FWGA 4FVMA 3UZUA 3TQSA 5EXXA 3ZH9B 3U61A 3FTFA 4QNRA 1IN8A 3E4RA 4M0DA 3AFHA 3HU1A 2Z3XA 2DWZB 4MB7A 1R7RA 1Z5AA 3PXGA 1NJFA 2C9CA 2C99A 2F4VM 4WW0A 1N33M 5ITUA 1W5SA 3FUTA 5FSWA 3BOSA 2UUCM 1YU4A 5E6JA 1DGHA 4DR1M 2C5RA 2UXDM 1Q3BA 3EIHA 3T1HM 4IBIA 4LF5M 2XSZA 2YR0A 4MGHA 1I4WA 5FLXS 1HNXM 4FCVA 2QBYA 3MHVC 2CV2A 4W5WA 4JI6M 3DOAA 4GKJM 4I8OA 2HCBA 5E26A 2ZM6M 4LFAM 1XXHB 1VDDA 1IQPA 4PDGA 4QOZC 3VLFB 3UK6A 2C96A 1Z59A 4M0WA 2Y2KA 3SAVA 3L28A 3HHYA 1IBKM 3KP1E 1IY2A 1YE9A 4QNMA 2LH0A 2XZUA 3HJQA 2KW0A 1IN7A 1J7KA 2CFOA 4RF1A 3WX7A 2QPAA 4YHHM 3GQ3A 1K3WA 3HHXA 3FUWA 3GPUA 2W82A 4AG6A 3ZCBB 4JN6A 3FTEA 1HR0M 3HHZA 4LJ9A 4LF9M 1ZQ9A 1TH2A 4DUYM 1R2ZA 1TH4A 1Z5CA 1L2DA 3CF2A 3SATA 3J81S 4KODA 4WURA 3GO8A 3M0EA 3LMMA 2Y2MA 1L8QA 4BB9A 4LF6M 2V1UA 3T15A 1G8PA 4IBDA 1HNZM 1HNWM 4FD2A 2Y2GA 2NQ8C 5ITXA 3A46A 4I4LA 1SXJE 3KSJA 2G8LA 2KA6B 4JI2M 2XD1A 1E9SA 2Y21A 4DV0M 2Y2QA 2K47A 1JQJC 3L25A 3DFZA 4AW4A 4G6ZA 4CISA 3VDUA 1SXJB 3KS4A 4GKKM 1TDHA 3FYDA 3SYLA 2DXIA 3RFWA 3GLHB 4OW0A 4JV5M 4B3SM 3SFZA 2X49A 4B08A 3VK8A 3AV0A 1XXHA 5FTLA 3LVWA 4YY3M 2UU9M 3GQ4A 2Y2PA 4G4QA 3DZDA 4I81A 1IY1A 2XGNA 2BJWA 4REZA 4GHAA 5LMUM 1JR3A 4NRWA 2P5TA 1E32A 4M9XA 2RKOA 4LF4M 3QAUA 5KQ8A 4IBJA 1NNJA 2Y2OA 3VK7A 4LGYA 2HKJA 4MGZE 3L27A 5IREB 4OU7A 3K92A 2CEAA 5GKNA 3HONA 3J80S 3U6LA 4PDIA 1L2CA 2C9OA 4DR7M 2AHMA 3ZC7B 3SASA 4M9ZA 3GP1A 3VKGA 2H1RA 4DR6M 5LMNM 3D8LA 3LQRA 1OJLA 3PNYA 1E94E 3AL0C 3I51A 4DV4M 1QVRA 2Y2LA 4DV5M 3JR4A 2XF3A 1GL6A 3HU3A 8CATA 4RF0A 3W0LB 1G3IA 4LFBM 2KXEA 4DV2M 5C1BA 4OJOA 1N34M 4LJAA 4L4UA 2ZAOA 3LQQA 4IJEA 3NBIA 1NVMA 2R65A 2JCHA 2QP9X 1J09A 1K3XA 2Y0QA 2FOIC 4JI3M 1NHWC 1Q39A 4GITA 1NY6A 1SXJA 5FTJA 2D7HA 4DR2M 3GLHA 2XD5A 2ZAMA 5FTNA 4IBKA 5KPZA 4P16A 2QENA 3FUVA 1YSYA 1IXSB 4L78A 1DGFA 2YFQA 2R4EA 4B7GA 4KLNA 3GPYA 3PNVA 2DHRA 2XFSA 1T3TA 2RGHA 4MH0E 2UWXA 1GVNA 1MU5A 4LRTA 4XGIA 4NYYA 1Z5BA 5IT9S 2HL7A 2V6ZM 3U6SA 4AKGA 3HSHA 4GH9A 2R18A 4LCBA 1EE8A 2BJVA 3ILKA 1YU1A 2DWNA 1ORYB 4B7HA 3TL4X 2EA0A 1UM8A 4B7FA 4NYUA 4G4OA 1DGGA 4NY2A 3M6AA 2I7NA 4NXNM 3JR5A 3SMPA 5BR8M 3A98B 2Y2IA 1YU0A 3K8ZA 3SAWA 3GLIB 4IBCA 3UJNA 5EP4A 3KDSE 3U60B 1GL7A 4IBFA 2C98A 1DGBA 3D8BA 1L1TA 3EIEA 2EUCA 2JA2A 3R8FA 2UXCM 3GLGA 1Z6TA 1H6UA 3U6PA 1K82A 4LGMA 2LXEA 2Z4RA 1MX0A 3J2PB 3WHLA 5H37D 4K0KM 4R7GA 4DV3M 3U5ZB 2IOUA 4DV1M 3FTCA 3THGA 3R9XB 4FW9A 5EJCA 4NXMM 2RGOA 2CV1A 4B3RM 3HKPA 1HT1E 1KSFX 2Y2HA 4LJ4A 1HT2E 1DO0A 3A45A 2DWMA 3SBJA 2JE5A 1W5TA 3GRVA 1Q3CA 3L29A 3LVVA 5IWAM 5FTKA 1GKIA 3QWLA 2KEBA 4NSOB 1R6BX 5FTMA 2OQ4A 1IBMM 1YUEA 2X8AA 3KP0E 2Y2JA 1GLNA 3E9SA 2F5NA 1QQWA 1KFVA 4OJPA 3KXEC 1KYIA 4IBGA 3FTDA 4TUWA 3CTWB 2UUBM 2QZ4A 4GC9A 4OUIA 4JI5M 4HLQA 4LG2A 5EP1A 3U6EA 4I5SA 4LZJA 4NSRA 3GRRA 1QAQA 1N78A 4OVZB 2FFFB 5IZ7D 1QAMA 2Z7JA 4AZFA 4JI1M 5ITQA 4IIWA 4AG5A 1IY0A 3KOZE 4JI8M 3GLIA 3U60A 4JI4M 3K2LA 2FFJA 2CHQA 4GHLA 3KW6A 4S12A 3UGJA 4LF8M 3VFDA 1XMOM 2UUAM 1QYRA 4PD2A 4LF7M 3FUXA 3HU2A 3C58A 2KRKA 1DO2A 1DGHB 3U6QA 3T1YM 3TWMA 3U5ZA 5F3WA 4X64M 3CF6E 3GPPA 2YQZA 2L09A 3JAMS 4NZ5A 1FNNA 4GIPA 2R46A 3U6MA 1WXQA 1NNUC 1SXJC 3GLFB 4DV6M 5EXPA 1LV7A 2EO2A 5ITTA 2I7PA 2VQFM 2LNHC 4B3MM 2R45A 1NY5A 3AKZA 2Q2EB 4LJ8A 2Y20A 3J27B 1TDZA 2F5QA 2XH9A 4D80A 4ITQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GH9 A;  3L26 A;  3KS8 A;  4IBB A;  4LG2 A;  3L28 A;  4IBD A;  4IBK A;  4IBC A;  5BPV A;  4IBF A;  3L29 A;  4GHA A;  3FKE A;  4IJF A;  4IBI A;  4IBJ A;  4GHL A;  3L25 A;  4IBE A;  4IBG A;  3L27 A;  3L2A A;  4IJE A;  3KS4 A; 
#chains in the Genus database with same CATH topology
 3KOX E;  2J7N A;  2QHO B;  4OX9 M;  3C3E A;  1PDC A;  3BXW A;  3FUU A;  3HY5 A;  5JI3 E;  1UR9 A;  3KSX A;  3RE8 A;  3OTO M;  4R3D A;  3AOE C;  4OJL A;  3DA1 A;  4IBB A;  2DZO B;  5A2Q S;  4KT0 F;  4RKU F;  3KVW A;  2FNA A;  2JY7 A;  1N77 A;  3SAR A;  1NSF A;  5KO3 A;  2DEN A;  4FCT A;  3WD0 A;  1XNQ M;  3C3D A;  3IG8 A;  2X4A A;  4NZ1 A;  4LRS A;  4RNA A;  4D81 A;  5KPR A;  4OVZ A;  1TGU A;  4XBO A;  3M7P A;  4TX8 A;  3WD4 A;  4FWD A;  2Z4S A;  1OFI A;  4FWH A;  5ITR A;  2D7G A;  3IG5 A;  3GPX A;  1J5E M;  2DWL A;  4DUZ M;  1I94 M;  1XNR M;  2XSZ D;  2XFT A;  3AOE A;  1PJT A;  4Z8X A;  1YU3 A;  3B74 A;  3L2A A;  3SHG B;  5DFL A;  2XLJ A;  3GQ5 A;  3GRY A;  1YU2 A;  4NC6 A;  1ED7 A;  4PT5 A;  2KZS A;  3A42 A;  3LCV B;  1D0K A;  2DZN B;  1G4A E;  4LJ5 A;  2OPF A;  4QNL A;  4MGY E;  3Q8G A;  3KOY E;  5EXS A;  1QZE A;  1ZMW A;  5BPV A;  2VF7 A;  2V5O A;  2CE7 A;  3FKE A;  4IJF A;  3FD9 A;  1P3Q Q;  3PFI A;  4D82 A;  3B89 A;  1NHG C;  2WZJ A;  1XMQ M;  1N32 M;  2M60 A;  3VDP A;  2CHG A;  3GLF A;  1IBL M;  4FCW A;  4NZ3 A;  2LHG A;  2QCU A;  1OQY A;  1QAN A;  1TH3 A;  2F5O A;  4JYA M;  1GXD A;  4GMQ A;  4Q7J A;  1MJG M;  4CHT B;  4Z2I A;  5JI2 E;  2DKL A;  1G41 A;  4HL4 A;  1WHC A;  4LY6 A;  4AKI A;  4PCZ A;  4QHS A;  2LVA A;  4L15 A;  4EIW A;  4GRI A;  1C7Y A;  5DYI A;  4X65 M;  3E21 A;  1CXW A;  1KS0 A;  1IXZ A;  4L16 A;  2Y2N A;  4A3V B;  2A5Y B;  4II7 A;  2E5L M;  1L1Z A;  2K6B A;  5DNY A;  2VII A;  1QUS A;  1IN4 A;  2DHY A;  5C18 A;  2CV0 A;  4X62 M;  1MN3 A;  2J7O A;  3WHK A;  4BLC A;  3KFU G;  1IN6 A;  4QOS A;  4QHT A;  1PJQ A;  2JP7 A;  1IXS A;  3SMS A;  4IBE A;  4AI6 A;  2Z8Y M;  2O01 F;  2MRO B;  3HGI A;  2M5Z A;  4OJ5 A;  4Z2K A;  1HQC A;  3K1J A;  3Q8X A;  1ZMU A;  2BWE A;  3B9P A;  1VEG A;  3NWL A;  2XEP A;  4BBA A;  2R6F A;  1GPF A;  3HJS A;  1NJG A;  1QDT A;  1W1V A;  1X37 A;  5ITY A;  2RRU A;  1XHB A;  3RGP A;  3W0F A;  2XZF A;  3MK6 A;  4AQY M;  2G5G X;  3VKH A;  2FE8 A;  4AKH A;  1EIJ A;  7CAT A;  2CUZ A;  2HAK A;  4JXJ A;  3TE6 A;  4LFC M;  2R62 A;  2DVW B;  2ZAN A;  3HWS A;  1D2N A;  3LCU A;  3HHW A;  3F92 A;  2F5P A;  3U61 B;  1JR3 D;  2BNK A;  1HQY E;  2V1C A;  1VDL A;  3FYC A;  4NRV A;  3C9P A;  2L7H A;  1XWI A;  4B3T M;  3I04 M;  1EFU B;  1H0I A;  1QAO A;  4G4N A;  1PM5 A;  4DR4 M;  2MGW A;  3TWL A;  2YNM D;  4DV7 M;  5L8R F;  1PJI A;  1L2B A;  2CHV A;  4X66 M;  3L26 A;  2DAE A;  4DR5 M;  2L6O A;  2F5S A;  5EP3 A;  1S3S A;  2OOB A;  4L8R C;  1PRB A;  4NL4 H;  1AIP C;  3MJ5 A;  4Z6Y A;  3UMM A;  1IM2 A;  2L7I A;  4NOO B;  4ANR A;  4DR3 M;  1R2Y A;  1OFH A;  3SHF A;  1T43 A;  4KO8 A;  5KQD A;  1J7M A;  4LZZ A;  4MGI E;  3SAU A;  4MGK E;  5EQT A;  3AJI B;  1N75 A;  4GC5 A;  2VQE M;  2UXB M;  4CGY B;  2QBY B;  1PJJ A;  1TR8 A;  2L2D A;  4NZ4 A;  2HHH M;  4M9S A;  1F4I A;  1IN5 A;  2BWB A;  3TPZ A;  3J7B A;  5KPT A;  1E9R A;  1FJG M;  2B3T A;  5EP2 A;  3I4Y A;  2JY5 A;  4LJ7 A;  3HJ8 A;  3T38 A;  3M7G A;  5DYG A;  2EKK A;  2DAK A;  3GLG E;  4HMC A;  3J7A S;  2OOA A;  4OJ6 A;  2LWX A;  2ERC A;  1G59 A;  3GRU A;  2ZTD A;  4ZPX A;  5EXT A;  3SYK A;  2R44 A;  4MM3 B;  3U6D A;  1QZM A;  1IXR C;  3KS8 A;  2KRU A;  4JI7 M;  3KOW E;  4Z2L A;  4KHP M;  1D0L A;  3N3F A;  1D0M A;  2Y0T A;  1SXJ D;  2CWB A;  1OAO C;  3MMP A;  4CJ6 A;  1C1K A;  3H4M A;  4G3O A;  3U6O A;  1XC8 A;  1N36 M;  1YUB A;  4MB5 A;  3GLG B;  3RGS A;  1ZAE A;  3SC3 A;  3TWK A;  3MQL A;  3PVS A;  4G4R A;  1V92 A;  3CF0 A;  2D7E A;  2R4J A;  4LJ6 A;  4JI0 M;  3U6C A;  1QO6 A;  2BG1 A;  3WD2 A;  5ITX E;  2JZ1 A;  2ZBK B;  3I4V A;  2O5R A;  3AOG A;  4FWG A;  4FVM A;  3UZU A;  2FN2 A;  2JNH A;  5EXX A;  3TQS A;  3ZH9 B;  3U61 A;  4QNR A;  1IN8 A;  3FTF A;  3E4R A;  4M0D A;  1G71 A;  3AFH A;  3HU1 A;  2Z3X A;  2DWZ B;  2LVO C;  4MB7 A;  1R7R A;  1DV0 A;  2D49 A;  1AIW A;  3FRH A;  1PJS A;  1Z5A A;  4HEO A;  1NJF A;  3PXG A;  1OAI A;  2C9C A;  2C99 A;  2GNO A;  3FRI A;  2F4V M;  4WW0 A;  1T6O A;  1N33 M;  1LTM A;  5ITU A;  1W5S A;  3FUT A;  5FSW A;  2JY6 B;  3BOS A;  2UUC M;  1H0G A;  1YU4 A;  5E6J A;  1DGH A;  4DR1 M;  2C5R A;  2UXD M;  1Q3B A;  1XXH E;  3EIH A;  3T1H M;  4IBI A;  1W1P A;  4LF5 M;  2XSZ A;  2YR0 A;  4MGH A;  1I4W A;  2XH9 A;  5FLX S;  4FCV A;  1HNX M;  2QBY A;  3MHV C;  2CV2 A;  4W5W A;  4JI6 M;  4HMD A;  4R71 A;  3DOA A;  4GKJ M;  1JR3 E;  3HZJ A;  4I8O A;  2HCB A;  3QYE A;  5E26 A;  2ZM6 M;  4LFA M;  1XXH B;  1VDD A;  1IQP A;  1H8P A;  4PDG A;  4QOZ C;  3VLF B;  3UK6 A;  2C96 A;  1Z59 A;  4Z2G A;  4M0W A;  2Y2K A;  3SAV A;  3L28 A;  2DNA A;  3HHY A;  1IBK M;  3I01 M;  2MJ5 B;  1TF0 B;  3KP1 E;  1IY2 A;  1YE9 A;  4QNM A;  2JWS A;  2LH0 A;  2XZU A;  3HJQ A;  2KW0 A;  4MB3 A;  1W1Y A;  3HX3 A;  1IN7 A;  1J7K A;  2CFO A;  4RF1 A;  3WX7 A;  2QPA A;  2JXN A;  4YHH M;  3GQ3 A;  1K3W A;  3HHX A;  2RTS A;  3FUW A;  3GPU A;  2W82 A;  1E15 A;  4AG6 A;  3B7Z A;  4GEW A;  3ZCB B;  4JN6 A;  3FTE A;  1HR0 M;  3HHZ A;  1IFY A;  4LJ9 A;  4LF9 M;  1ZQ9 A;  1TH2 A;  4DUY M;  3FE3 A;  1R2Z A;  1TH4 A;  1Z5C A;  1AUA A;  1L2D A;  3CF2 A;  3SAT A;  3J81 S;  1GJT A;  4KOD A;  4WUR A;  3GO8 A;  3M0E A;  1GOI A;  3LMM A;  2Y2M A;  1L8Q A;  4BB9 A;  4LF6 M;  2V1U A;  1HJP A;  2EJS A;  1G8P A;  1WJ7 A;  4IBD A;  4WP2 A;  3T15 A;  1HNZ M;  1HNW M;  4FD2 A;  2CRU A;  2Y2G A;  2NQ8 C;  5ITX A;  3A46 A;  4I4L A;  1SXJ E;  2KNV A;  3KSJ A;  2G8L A;  2KA6 B;  3GLH E;  4Y28 F;  4JI2 M;  2XD1 A;  1E6P A;  1E9S A;  1R4G A;  1WGL A;  2QSF X;  2Y21 A;  4L6V 6;  4DV0 M;  2Y2Q A;  1E8B A;  2K47 A;  1JQJ C;  2LTU A;  3L25 A;  3DFZ A;  4AW4 A;  4G6Z A;  3T6P A;  1WR1 B;  4CIS A;  3VDU A;  1SXJ B;  3KS4 A;  2LHC A;  4GKK M;  1TDH A;  3FYD A;  3SYL A;  2DXI A;  3RFW A;  3GLH B;  2O25 A;  4OW0 A;  3ZQJ A;  4JV5 M;  3W67 A;  4B3S M;  3SFZ A;  2X49 A;  2MR9 A;  4B08 A;  3VK8 A;  3AV0 A;  4CIZ A;  1NV8 A;  1XXH A;  1ZV1 A;  3LVW A;  5FTL A;  4YY3 M;  1OGG A;  2UU9 M;  3GQ4 A;  1E88 A;  2K0B X;  2Y2P A;  4G4Q A;  1NO1 A;  3DZD A;  4I81 A;  1GAB A;  1IY1 A;  2XGN A;  2BJW A;  4REZ A;  4GHA A;  5LMU M;  1JR3 A;  4NRW A;  2P5T A;  2VDB B;  3B7N A;  1E32 A;  2K9D A;  2RKO A;  4M9X A;  3QAU A;  4P17 A;  5KQ8 A;  4LF4 M;  4IBJ A;  1NNJ A;  2WSF F;  3VK7 A;  2Y2O A;  4LGY A;  2HKJ A;  2OO9 A;  4MGZ E;  3L27 A;  5IRE B;  3W68 A;  3K92 A;  4OU7 A;  2CEA A;  5GKN A;  3HON A;  3J80 S;  3QYB A;  4PDI A;  3U6L A;  2C9O A;  3NBX X;  4F2L A;  1L2C A;  4DR7 M;  2AHM A;  3CGW A;  4UN2 B;  3ZC7 B;  2N35 A;  3SAS A;  4M9Z A;  3GP1 A;  3VKG A;  2H1R A;  4DR6 M;  5LMN M;  1SG9 A;  3D8L A;  4F1I A;  3LQR A;  1QUT A;  1OJL A;  3PNY A;  1CUK A;  1E94 E;  3AL0 C;  2ZTC A;  3I51 A;  1UR8 A;  4DV4 M;  1A5T A;  1XB2 B;  1QVR A;  1Y8G A;  2EKF A;  2Y2L A;  1GJS A;  4DV5 M;  1OIZ A;  3JR4 A;  2XF3 A;  1GL6 A;  3HU3 A;  8CAT A;  4RF0 A;  3W0L B;  1G3I A;  1VQ1 A;  4LFB M;  2KXE A;  4DV2 M;  1OGB A;  5C1B A;  4OJO A;  1N34 M;  4LJA A;  4L4U A;  2ZAO A;  3LQQ A;  4IJE A;  3NBI A;  1NVM A;  2R65 A;  3BBZ A;  2QP9 X;  1J09 A;  1K3X A;  2Y0Q A;  2JCH A;  2FOI C;  4JI3 M;  2LVN C;  2WSE F;  3E46 A;  1NHW C;  1PGY A;  1Q39 A;  1NY6 A;  1SXJ A;  4GIT A;  2D7H A;  5FTJ A;  4DR2 M;  4MB4 A;  1VEJ A;  1WIV A;  3GLH A;  2XD5 A;  1R5L A;  2ZAM A;  5FTN A;  2MH8 A;  4IBK A;  5KPZ A;  4P16 A;  2QEN A;  3FUV A;  1YSY A;  1IXS B;  4L78 A;  1DGF A;  2YFQ A;  2R4E A;  4B7G A;  4KLN A;  3GPY A;  3PNV A;  1Q02 A;  2DHR A;  2XFS A;  1T3T A;  2RGH A;  4MH0 E;  1E6R A;  1W1T A;  2UWX A;  1GVN A;  1MU5 A;  1OIP A;  3LW5 F;  4LRT A;  4XGI A;  4NYY A;  1Z5B A;  1ZMV A;  5IT9 S;  1CK7 A;  2HL7 A;  1TTE A;  2V6Z M;  3U6S A;  4AKG A;  3HSH A;  3GLI E;  4GH9 A;  1BVS A;  2R18 A;  4LCB A;  1EE8 A;  2BJV A;  3ILK A;  1YUE A;  1YU1 A;  2DWN A;  1ORY B;  2GQF A;  3TL4 X;  4B7H A;  2DAM A;  2EA0 A;  1UM8 A;  2R0I A;  4B7F A;  4NYU A;  4G4O A;  1DGG A;  4NY2 A;  3M6A A;  2I7N A;  4NXN M;  3WD3 A;  1RU3 A;  3JR5 A;  3SMP A;  5BR8 M;  3A98 B;  2Y2I A;  1YU0 A;  3K8Z A;  3WD1 A;  2G3Q A;  3SAW A;  2APL A;  2QQ8 A;  4IBC A;  3UJN A;  5EP4 A;  3KDS E;  3GLI B;  3U60 B;  1GL7 A;  4IBF A;  2C98 A;  1DGB A;  3D8B A;  1L1T A;  3EIE A;  2EUC A;  1UFZ A;  2JA2 A;  3R8F A;  2UXC M;  1JB0 F;  3GLG A;  1Z6T A;  1H6U A;  3U6P A;  1K82 A;  1E6N A;  2JZ0 A;  4LGM A;  2LXE A;  2Z4R A;  1OKS A;  3IEC A;  1MX0 A;  3J2P B;  4XK8 F;  3WHL A;  5H37 D;  4K0K M;  2LBC A;  2LVQ D;  4R7G A;  4DV3 M;  3U5Z B;  2IOU A;  4DV1 M;  2FS1 A;  3FTC A;  3THG A;  3R9X B;  4FW9 A;  5EJC A;  4NXM M;  2JY8 A;  2J5Y A;  2RGO A;  1WGN A;  2CV1 A;  4B3R M;  3HKP A;  1HT1 E;  1E6Z A;  1KSF X;  2Y2H A;  4LJ4 A;  1HT2 E;  1DO0 A;  3A45 A;  2DWM A;  3SBJ A;  2JE5 A;  1W5T A;  1Q3C A;  3GRV A;  3L29 A;  3LVV A;  5IWA M;  5FTK A;  1GKI A;  3QWL A;  2KEB A;  4NSO B;  1R6B X;  5FTM A;  2OQ4 A;  2HWJ A;  1IBM M;  2X8A A;  3KP0 E;  2Y2J A;  2JUJ A;  1GLN A;  3E9S A;  3K9P A;  1QQW A;  1KFV A;  1VEK A;  2F5N A;  4OJP A;  3KXE C;  1KYI A;  4IBG A;  3FTD A;  4TUW A;  3CTW B;  2UUB M;  2KHH A;  2QZ4 A;  4GC9 A;  4OUI A;  2FH0 A;  2KNA A;  4JI5 M;  1VG5 A;  4HLQ A;  4LG2 A;  5EP1 A;  1V33 A;  4I5S A;  3U6E A;  4LZJ A;  4NSR A;  3GRR A;  1QAQ A;  1N78 A;  4OVZ B;  2FFF B;  5IZ7 D;  2H5X A;  1QAM A;  4Z2H A;  2Z7J A;  4AZF A;  4JI1 M;  5ITQ A;  2L4E A;  4IIW A;  4AG5 A;  1IY0 A;  3KOZ E;  4JI8 M;  3GLI A;  3U60 A;  4JI4 M;  3K2L A;  2FFJ A;  2CHQ A;  4GHL A;  3KW6 A;  4S12 A;  3UGJ A;  1V34 A;  3B7Q A;  4LF8 M;  3VFD A;  2DZL A;  1XMO M;  2UUA M;  1QYR A;  3V76 A;  4PD2 A;  4LF7 M;  3FUX A;  2L4F A;  3HU2 A;  3C58 A;  2KRK A;  1DO2 A;  1DGH B;  3U6Q A;  3GLF E;  1O6I A;  3T1Y M;  3TWM A;  1QDR A;  3U5Z A;  3H4J A;  4DBG B;  5F3W A;  1GO5 A;  2LVP C;  2DAG A;  4X64 M;  3CF6 E;  3GPP A;  2QNJ A;  2CP8 A;  2YQZ A;  1EAK A;  2L09 A;  1YLA A;  2VF8 A;  2KNZ A;  3JAM S;  4NZ5 A;  4Z2J A;  1FNN A;  4GIP A;  4HME A;  2DAI A;  2R46 A;  3U6M A;  1WXQ A;  1NNU C;  1SXJ C;  3GLF B;  4DV6 M;  5EXP A;  1LV7 A;  2EO2 A;  5ITT A;  1NV9 A;  2I7P A;  2VQF M;  2LNH C;  4B3M M;  2R45 A;  2DI0 A;  1NY5 A;  3K9O A;  2Q2E B;  2KDL A;  3IHP A;  3AKZ A;  4LJ8 A;  2Y20 A;  3J27 B;  1OTR A;  1TDZ A;  2F5Q A;  1L6J A;  2KZU A;  4D80 A;  2WSC F;  4ITQ A; 
#chains in the Genus database with same CATH homology
 3KOX E;  2J7N A;  4OX9 M;  5JI3 E;  3FUU A;  4OJL A;  3KSX A;  3RE8 A;  3OTO M;  4R3D A;  3AOE C;  3DA1 A;  4IBB A;  2DZO B;  5A2Q S;  3KVW A;  2FNA A;  1N77 A;  3SAR A;  1NSF A;  5KO3 A;  4FCT A;  1XNQ M;  3IG8 A;  2X4A A;  4NZ1 A;  4LRS A;  4RNA A;  4D81 A;  5KPR A;  4OVZ A;  1TGU A;  4XBO A;  4FWD A;  2Z4S A;  1OFI A;  4FWH A;  5ITR A;  2D7G A;  3IG5 A;  3GPX A;  1J5E M;  2DWL A;  4DUZ M;  1I94 M;  1XNR M;  2XSZ D;  2XFT A;  3AOE A;  4Z8X A;  1YU3 A;  3L2A A;  3SHG B;  2XLJ A;  3GQ5 A;  3GRY A;  1YU2 A;  4PT5 A;  2KZS A;  3A42 A;  2DZN B;  1G4A E;  4LJ5 A;  2OPF A;  4QNL A;  4MGY E;  3KOY E;  5EXS A;  5BPV A;  2CE7 A;  3FKE A;  4IJF A;  3FD9 A;  3PFI A;  4D82 A;  1NHG C;  1XMQ M;  1N32 M;  2KZU A;  2M60 A;  3VDP A;  2CHG A;  3GLF A;  1IBL M;  4FCW A;  4NZ3 A;  2QCU A;  1QAN A;  1TH3 A;  2F5O A;  4JYA M;  4GMQ A;  4CHT B;  5JI2 E;  1G41 A;  4HL4 A;  4LY6 A;  4AKI A;  4PCZ A;  4QHS A;  4L15 A;  4EIW A;  4GRI A;  5DYI A;  4X65 M;  1IXZ A;  4L16 A;  2Y2N A;  4A3V B;  2A5Y B;  4II7 A;  2E5L M;  1L1Z A;  5DNY A;  2VII A;  1IN4 A;  2CV0 A;  5C18 A;  4X62 M;  2J7O A;  3WHK A;  3KFU G;  4BLC A;  1IN6 A;  4QOS A;  4QHT A;  3SMS A;  4IBE A;  4AI6 A;  3HGI A;  2M5Z A;  4OJ5 A;  1HQC A;  3K1J A;  3Q8X A;  3B9P A;  3NWL A;  2XEP A;  4BBA A;  3HJS A;  1NJG A;  1X37 A;  5ITY A;  3RGP A;  1XHB A;  3W0F A;  2XZF A;  3MK6 A;  4AQY M;  2G5G X;  3VKH A;  2FE8 A;  4AKH A;  7CAT A;  2CUZ A;  3TE6 A;  4JXJ A;  4LFC M;  2R62 A;  2DVW B;  2ZAN A;  3HWS A;  1D2N A;  3HHW A;  2F5P A;  3U61 B;  1JR3 D;  2BNK A;  1HQY E;  2V1C A;  3FYC A;  4NRV A;  2L7H A;  1XWI A;  4B3T M;  1QAO A;  4G4N A;  1PM5 A;  4DR4 M;  3TWL A;  2YNM D;  4DV7 M;  1PJI A;  1L2B A;  2CHV A;  4X66 M;  3L26 A;  4DR5 M;  2L6O A;  2F5S A;  5EP3 A;  1S3S A;  4L8R C;  3UMM A;  4NL4 H;  4Z6Y A;  3MJ5 A;  1IM2 A;  2L7I A;  4NOO B;  4DR3 M;  1R2Y A;  1OFH A;  3SHF A;  4KO8 A;  5KQD A;  4LZZ A;  4MGI E;  3SAU A;  4MGK E;  5EQT A;  3AJI B;  1N75 A;  4GC5 A;  2VQE M;  2UXB M;  4CGY B;  2QBY B;  1PJJ A;  4NZ4 A;  2HHH M;  4M9S A;  1IN5 A;  3TPZ A;  3J7B A;  5KPT A;  1E9R A;  1FJG M;  5EP2 A;  3I4Y A;  4LJ7 A;  3T38 A;  3HJ8 A;  3M7G A;  5DYG A;  3J7A S;  4OJ6 A;  2LWX A;  2ERC A;  1G59 A;  3GRU A;  4ZPX A;  3SYK A;  5EXT A;  3U6D A;  4MM3 B;  1QZM A;  1IXR C;  3KS8 A;  2KRU A;  4JI7 M;  3KOW E;  4KHP M;  3N3F A;  2Y0T A;  1SXJ D;  1C1K A;  3H4M A;  3U6O A;  1XC8 A;  1N36 M;  1YUB A;  3GLG B;  3RGS A;  1ZAE A;  3SC3 A;  3TWK A;  3PVS A;  4G4R A;  3CF0 A;  2D7E A;  2R4J A;  4LJ6 A;  4JI0 M;  3U6C A;  2BG1 A;  5ITX E;  2ZBK B;  3I4V A;  2O5R A;  3AOG A;  4FWG A;  4FVM A;  3UZU A;  3TQS A;  5EXX A;  3ZH9 B;  3U61 A;  3FTF A;  4QNR A;  1IN8 A;  3E4R A;  4M0D A;  3AFH A;  3HU1 A;  2Z3X A;  2DWZ B;  4MB7 A;  1R7R A;  1Z5A A;  3PXG A;  1NJF A;  2C9C A;  2C99 A;  2F4V M;  4WW0 A;  1N33 M;  5ITU A;  1W5S A;  3FUT A;  5FSW A;  3BOS A;  2UUC M;  1YU4 A;  5E6J A;  1DGH A;  4DR1 M;  2C5R A;  2UXD M;  1Q3B A;  3EIH A;  3T1H M;  4IBI A;  4LF5 M;  2XSZ A;  2YR0 A;  4MGH A;  1I4W A;  5FLX S;  1HNX M;  4FCV A;  2QBY A;  3MHV C;  2CV2 A;  4W5W A;  4JI6 M;  3DOA A;  4GKJ M;  4I8O A;  2HCB A;  5E26 A;  2ZM6 M;  4LFA M;  1XXH B;  1VDD A;  1IQP A;  4PDG A;  4QOZ C;  3VLF B;  3UK6 A;  2C96 A;  1Z59 A;  4M0W A;  2Y2K A;  3SAV A;  3L28 A;  3HHY A;  1IBK M;  3KP1 E;  1IY2 A;  1YE9 A;  4QNM A;  2LH0 A;  2XZU A;  3HJQ A;  2KW0 A;  1IN7 A;  1J7K A;  2CFO A;  4RF1 A;  3WX7 A;  2QPA A;  4YHH M;  3GQ3 A;  1K3W A;  3HHX A;  3FUW A;  3GPU A;  2W82 A;  4AG6 A;  3ZCB B;  4JN6 A;  3FTE A;  1HR0 M;  3HHZ A;  4LJ9 A;  4LF9 M;  1ZQ9 A;  1TH2 A;  4DUY M;  1R2Z A;  1TH4 A;  1Z5C A;  1L2D A;  3CF2 A;  3SAT A;  3J81 S;  4KOD A;  4WUR A;  3GO8 A;  3M0E A;  3LMM A;  2Y2M A;  1L8Q A;  4BB9 A;  4LF6 M;  2V1U A;  3T15 A;  1G8P A;  4IBD A;  1HNZ M;  1HNW M;  4FD2 A;  2Y2G A;  2NQ8 C;  5ITX A;  3A46 A;  4I4L A;  1SXJ E;  3KSJ A;  2G8L A;  2KA6 B;  4JI2 M;  2XD1 A;  1E9S A;  2Y21 A;  4DV0 M;  2Y2Q A;  2K47 A;  1JQJ C;  3L25 A;  3DFZ A;  4AW4 A;  4G6Z A;  4CIS A;  3VDU A;  1SXJ B;  3KS4 A;  4GKK M;  1TDH A;  3FYD A;  3SYL A;  2DXI A;  3RFW A;  3GLH B;  4OW0 A;  4JV5 M;  4B3S M;  3SFZ A;  2X49 A;  4B08 A;  3VK8 A;  3AV0 A;  1XXH A;  5FTL A;  3LVW A;  4YY3 M;  2UU9 M;  3GQ4 A;  2Y2P A;  4G4Q A;  3DZD A;  4I81 A;  1IY1 A;  2XGN A;  2BJW A;  4REZ A;  4GHA A;  5LMU M;  1JR3 A;  4NRW A;  2P5T A;  1E32 A;  4M9X A;  2RKO A;  4LF4 M;  3QAU A;  5KQ8 A;  4IBJ A;  1NNJ A;  2Y2O A;  3VK7 A;  4LGY A;  2HKJ A;  4MGZ E;  3L27 A;  5IRE B;  4OU7 A;  3K92 A;  2CEA A;  5GKN A;  3HON A;  3J80 S;  3U6L A;  4PDI A;  1L2C A;  2C9O A;  4DR7 M;  2AHM A;  3ZC7 B;  3SAS A;  4M9Z A;  3GP1 A;  3VKG A;  2H1R A;  4DR6 M;  5LMN M;  3D8L A;  3LQR A;  1OJL A;  3PNY A;  1E94 E;  3AL0 C;  3I51 A;  4DV4 M;  1QVR A;  2Y2L A;  4DV5 M;  3JR4 A;  2XF3 A;  1GL6 A;  3HU3 A;  8CAT A;  4RF0 A;  3W0L B;  1G3I A;  4LFB M;  2KXE A;  4DV2 M;  5C1B A;  4OJO A;  1N34 M;  4LJA A;  4L4U A;  2ZAO A;  3LQQ A;  4IJE A;  3NBI A;  1NVM A;  2R65 A;  2JCH A;  2QP9 X;  1J09 A;  1K3X A;  2Y0Q A;  2FOI C;  4JI3 M;  1NHW C;  1Q39 A;  4GIT A;  1NY6 A;  1SXJ A;  5FTJ A;  2D7H A;  4DR2 M;  3GLH A;  2XD5 A;  2ZAM A;  5FTN A;  4IBK A;  5KPZ A;  4P16 A;  2QEN A;  3FUV A;  1YSY A;  1IXS B;  4L78 A;  1DGF A;  2YFQ A;  2R4E A;  4B7G A;  4KLN A;  3GPY A;  3PNV A;  2DHR A;  2XFS A;  1T3T A;  2RGH A;  4MH0 E;  2UWX A;  1GVN A;  1MU5 A;  4LRT A;  4XGI A;  4NYY A;  1Z5B A;  5IT9 S;  2HL7 A;  2V6Z M;  3U6S A;  4AKG A;  3HSH A;  4GH9 A;  2R18 A;  4LCB A;  1EE8 A;  2BJV A;  3ILK A;  1YU1 A;  2DWN A;  1ORY B;  4B7H A;  3TL4 X;  2EA0 A;  1UM8 A;  4B7F A;  4NYU A;  4G4O A;  1DGG A;  4NY2 A;  3M6A A;  2I7N A;  4NXN M;  3JR5 A;  3SMP A;  5BR8 M;  3A98 B;  2Y2I A;  1YU0 A;  3K8Z A;  3SAW A;  3GLI B;  4IBC A;  3UJN A;  5EP4 A;  3KDS E;  3U60 B;  1GL7 A;  4IBF A;  2C98 A;  1DGB A;  3D8B A;  1L1T A;  3EIE A;  2EUC A;  2JA2 A;  3R8F A;  2UXC M;  3GLG A;  1Z6T A;  1H6U A;  3U6P A;  1K82 A;  4LGM A;  2LXE A;  2Z4R A;  1MX0 A;  3J2P B;  3WHL A;  5H37 D;  4K0K M;  4R7G A;  4DV3 M;  3U5Z B;  2IOU A;  4DV1 M;  3FTC A;  3THG A;  3R9X B;  4FW9 A;  5EJC A;  4NXM M;  2RGO A;  2CV1 A;  4B3R M;  3HKP A;  1HT1 E;  1KSF X;  2Y2H A;  4LJ4 A;  1HT2 E;  1DO0 A;  3A45 A;  2DWM A;  3SBJ A;  2JE5 A;  1W5T A;  3GRV A;  1Q3C A;  3L29 A;  3LVV A;  5IWA M;  5FTK A;  1GKI A;  3QWL A;  2KEB A;  4NSO B;  1R6B X;  5FTM A;  2OQ4 A;  1IBM M;  1YUE A;  2X8A A;  3KP0 E;  2Y2J A;  1GLN A;  3E9S A;  2F5N A;  1QQW A;  1KFV A;  4OJP A;  3KXE C;  1KYI A;  4IBG A;  3FTD A;  4TUW A;  3CTW B;  2UUB M;  2QZ4 A;  4GC9 A;  4OUI A;  4JI5 M;  4HLQ A;  4LG2 A;  5EP1 A;  3U6E A;  4I5S A;  4LZJ A;  4NSR A;  3GRR A;  1QAQ A;  1N78 A;  4OVZ B;  2FFF B;  5IZ7 D;  1QAM A;  2Z7J A;  4AZF A;  4JI1 M;  5ITQ A;  4IIW A;  4AG5 A;  1IY0 A;  3KOZ E;  4JI8 M;  3GLI A;  3U60 A;  4JI4 M;  3K2L A;  2FFJ A;  2CHQ A;  4GHL A;  3KW6 A;  4S12 A;  3UGJ A;  4LF8 M;  3VFD A;  1XMO M;  2UUA M;  1QYR A;  4PD2 A;  4LF7 M;  3FUX A;  3HU2 A;  3C58 A;  2KRK A;  1DO2 A;  1DGH B;  3U6Q A;  3T1Y M;  3TWM A;  3U5Z A;  5F3W A;  4X64 M;  3CF6 E;  3GPP A;  2YQZ A;  2L09 A;  3JAM S;  4NZ5 A;  1FNN A;  4GIP A;  2R46 A;  3U6M A;  1WXQ A;  1NNU C;  1SXJ C;  3GLF B;  4DV6 M;  5EXP A;  1LV7 A;  2EO2 A;  5ITT A;  2I7P A;  2VQF M;  2LNH C;  4B3M M;  2R45 A;  1NY5 A;  3AKZ A;  2Q2E B;  4LJ8 A;  2Y20 A;  3J27 B;  1TDZ A;  2F5Q A;  2XH9 A;  4D80 A;  4ITQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...