3L26A

Crystal structure of zaire ebola vp35 interferon inhibitory domain bound to 8 bp dsrna
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
123
structure length
123
Chain Sequence
DISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polymerase cofactor VP35
publication title Structural basis for dsRNA recognition and interferon antagonism by Ebola VP35.
pubmed doi rcsb
source organism Zaire ebolavirus
molecule tags Rna binding protein/rna
total genus 40
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3l26A01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 3l26A02
3L26A 3L28A 3L29A 4GHLA 4IJEA 4IBDA 3KS4A 4IBGA 3L25A 4GH9A 4IBFA 3FKEA 4IBJA 3KS8A 4IBEA 4LG2A 4IBCA 4IBKA 3L2AA 3L27A 4IBBA 4GHAA 4IBIA 5BPVA 4IJFA
chains in the Genus database with same CATH superfamily
4G6ZA 4DR3M 3KSXA 4R3DA 3DZDA 1HNZM 3U6EA 4FCVA 4NRVA 4GRIA 1Z5CA 3B7ZA 3KOXE 4A3VB 4PDGA 1GKIA 2JP7A 3D8LA 4Z2LA 2CP8A 2D7GA 4FWHA 4G4QA 4MM3B 1QQWA 4B3SM 3V76A 1PRBA 1GABA 2CHQA 4NC6A 1QZMA 2XH9A 2A5YB 2QQ8A 1TTEA 3VDPA 3WD2A 2Y0QA 3FTDA 1TH2A 3K9PA 1H6UA 5KQDA 1NV9A 1N33M 4ITQA 1EAKA 4NYYA 1JB0F 4B7GA 2D49A 3W0LB 2N35A 2LTUA 1SXJC 2R18A 2CHVA 4LJAA 1NVMA 1WIVA 3LQQA 2Z7JA 5EP2A 3VK8A 3LCVB 1V92A 2V1UA 1PJIA 1ORYB 1SXJA 3WD3A 2QBYA 2CRUA 2QPAA 4FD2A 3SYKA 1E15A 1L6JA 2CHGA 2WSEF 3EIHA 4KT0F 3CF6E 1QDRA 3KOYE 1OIZA 3KXEC 4AZFA 4Z2HA 1E9SA 4B7FA 1IBKM 3JR5A 1DGBA 1WXQA 1ZMWA 2LHGA 2RRUA 4QOSA 4M9ZA 1G4AE 5EP3A 2DWLA 2QENA 1J7KA 3WHKA 2Y2JA 1WJ7A 4Z8XA 4QNLA 2P5TA 1I94M 4UN2B 4XGIA 4GKKM 1TDHA 1OKSA 1R2ZA 3WD1A 2R65A 2Q2EB 2ZTDA 3AJIB 2ZAMA 3FE3A 3FKEA 4BLCA 5EXPA 5BR8M 4I8OA 5F3WA 5ITTA 3U6SA 2NQ8C 3MMPA 3T6PA 2DWMA 3UGJA 3HONA 4F1IA 2Y0TA 3ZQJA 2HKJA 4M9SA 2EUCA 4DV3M 3T15A 2R45A 1AUAA 3PNYA 1NY6A 2KA6B 3LQRA 1TH3A 4NOOB 2V1CA 3KP1E 1O6IA 2HAKA 1PJTA 3SFZA 1R2YA 2X49A 2JWSA 4FCWA 2DZOB 2L4FA 4FWDA 2Y2LA 4LG2A 1D0KA 4X62M 2XSZD 1GJTA 2KDLA 2VF7A 1E32A 1E6ZA 2RTSA 5DYIA 3L27A 3U5ZB 3VLFB 1OGGA 4DV2M 2G3QA 4IBIA 3U6QA 1IN4A 3U6DA 1MN3A 5ITXE 4G4NA 1QUSA 4WW0A 1X37A 2LH0A 3GRRA 1DO2A 3GPUA 3IG8A 4REZA 5LMUM 1G59A 2QSFX 4X66M 4BBAA 1XB2B 2CE7A 1L1TA 4B7HA 5EXSA 5EXTA 2DWNA 2XFSA 1YUEA 3AOEC 3B7NA 3Q8XA 2BG1A 2WSFF 4L15A 4DV7M 2QNJA 4DV4M 4QOZC 2QZ4A 1Q3CA 2J7OA 2MH8A 3BBZA 3AOEA 1DGHA 3FUXA 1IXSA 3K8ZA 2L09A 1OFIA 4GMQA 4OUIA 2VF8A 1KFVA 3W68A 4D81A 3HHZA 1GPFA 3SYLA 4LRTA 2M5ZA 3L2AA 2JZ0A 1IN6A 2XD1A 1ZQ9A 2ZBKB 1HQYE 2R44A 3C3EA 4RKUF 2V6ZM 3KW6A 2F5NA 2DAGA 1LV7A 2UUBM 5KPZA 1TGUA 3SMSA 3NBXX 4LFAM 3JR4A 3GLFA 1T3TA 3AKZA 1N36M 2DZNB 4NY2A 2HCBA 3T38A 1WR1B 3SAUA 2R62A 2KNAA 4OJLA 1E88A 2J5YA 3WHLA 2L2DA 2MGWA 2Z8YM 1WGNA 1SXJB 1YUBA 5EJCA 4PDIA 2QBYB 2C5RA 3M7GA 1PJQA 2K47A 2R46A 2OOBA 3ZCBB 5KPTA 3T1HM 4I4LA 2F5QA 4JXJA 4JI6M 1QAOA 1QYRA 3K9OA 4LRSA 1DGGA 3AV0A 3HHXA 1JR3A 4FVMA 4IBKA 3HGIA 4LF5M 3NWLA 5KO3A 4LJ9A 3RE8A 5BPVA 3U61B 1K82A 1GL6A 2Y2QA 1LTMA 4R7GA 2GQFA 2K6BA 2OQ4A 3K2LA 5KQ8A 1VDDA 1IY2A 4DR5M 2Y2NA 4Z2JA 3HWSA 1N32M 2KZSA 2L7HA 4Z6YA 1BVSA 1L2DA 3VKHA 1SG9A 1C1KA 2LXEA 3E4RA 3GLIA 3EIEA 3WD0A 2HWJA 2Z4RA 5IREB 1XXHE 2F5OA 2Y2OA 1HQCA 3DOAA 4QHTA 2YNMD 3A45A 3KOZE 7CATA 2Y21A 4XK8F 1GL7A 4B3TM 3WD4A 4MB7A 4ZPXA 1ZMUA 3AFHA 3E21A 3SHGB 1E8BA 1YU4A 3H4MA 4G4RA 1R5LA 1V33A 2DHRA 5E6JA 4CGYB 2VQEM 3FTFA 3GRUA 4L78A 4HMCA 3R8FA 1WGLA 2Y2PA 4IBBA 2BJWA 2R6FA 3UMMA 1VEKA 3NBIA 3UK6A 1L2BA 3SC3A 2CV1A 2E5LM 2DAEA 4NSOB 4LF4M 3I04M 3GLHA 2G8LA 2DHYA 3A46A 2X4AA 2EJSA 1K3XA 2RGHA 3LW5F 3LVWA 1XNRM 1D0LA 3B74A 4AW4A 4PD2A 4Q7JA 2UUCM 5IZ7D 4MGZE 2CUZA 3UJNA 2MR9A 1ZV1A 1L1ZA 3FUUA 1E6PA 4AG5A 3OTOM 4LGYA 2ZTCA 3RGPA 3SATA 2C98A 4IBDA 4OJPA 4KODA 4OJ6A 3BOSA 1DV0A 3M0EA 3PFIA 4XBOA 5DYGA 4HL4A 3SBJA 2Y2MA 1IY0A 1UFZA 2LVPC 3J7BA 4LZZA 4FWGA 3GQ4A 3B89A 2WSCF 4LGMA 3C9PA 1G41A 1SXJE 3MK6A 4KO8A 1IXRC 2XZFA 1IFYA 4HMEA 1J09A 3PXGA 1DGHB 4DR4M 1IXSB 4AKGA 4L4UA 3E46A 3U6LA 4I81A 2XGNA 1R4GA 1ZAEA 3CF2A 3FTCA 4JI5M 2I7NA 3HU2A 2UXBM 4OW0A 2D7HA 2IOUA 2FOIC 3SASA 4OVZA 1IN7A 1N77A 1YSYA 3UZUA 3HZJA 2F4VM 2J7NA 4PCZA 1E9RA 4MGHA 3VDUA 3U6MA 2FE8A 3FUWA 3I01M 3L25A 2YFQA 2OOAA 1R6BX 4P16A 3GLFB 1W5SA 1Z6TA 4II7A 3MJ5A 3HU3A 4PT5A 3GQ3A 3GLGA 1F4IA 4HEOA 2K9DA 1OAOC 2JCHA 1W1TA 3H4JA 2KXEA 1QO6A 3J81S 4JN6A 1AIWA 3TWLA 3KFUG 2BWBA 2O25A 4DR6M 1ZMVA 3TPZA 3IHPA 4G3OA 2DAIA 2GNOA 4IJFA 4LFBM 2XF3A 1HNWM 4W5WA 3FTEA 1XXHB 2XFTA 1MU5A 3U6OA 3L26A 4L8RC 3QAUA 2H5XA 2JA2A 2ZANA 1L8QA 4GHLA 1QVRA 4YY3M 2YQZA 1YU2A 1IXZA 4DUZM 1IN5A 2QCUA 4WURA 2JY5A 3GLIB 3R9XB 2XEPA 5EQTA 4NL4H 3FD9A 5C1BA 1PJJA 1KS0A 1G8PA 1KYIA 1S3SA 2C99A 2V5OA 4IBCA 4NXMM 2DI0A 1PM5A 5DFLA 4D82A 2D7EA 3SAWA 4EIWA 3U60A 2UWXA 2HL7A 5FTKA 2Y2GA 1GJSA 2XLJA 4NZ1A 2JE5A 3HKPA 2CV0A 4KHPM 2F5SA 1Q3BA 1TR8A 4B08A 1XMQM 1PGYA 3D8BA 3TQSA 3GLHB 3LMMA 4JI8M 3I4VA 4FW9A 3C3DA 3MHVC 4IJEA 2KEBA 4IBGA 1G71A 5FSWA 1XHBA 1QUTA 4LY6A 3HJ8A 4IBFA 2BWEA 4LCBA 2CV2A 4I5SA 1Z5AA 1OGBA 5DNYA 1OTRA 2C9OA 3J2PB 3TE6A 3QYBA 1HT2E 3VKGA 4QNRA 2VDBB 2DAMA 1SXJD 1V34A 3GLFE 3DFZA 3K1JA 4DV1M 4K0KM 1W1VA 1Z5BA 3PVSA 4MGKE 1TH4A 1N75A 5GKNA 1Y8GA 2L7IA 3VK7A 3A98B 1N34M 4CIZA 3M6AA 1IBMM 3QWLA 1QAMA 1GOIA 2F5PA 5FLXS 1XWIA 2XSZA 1A5TA 4F2LA 3MQLA 4OU7A 4NZ4A 1G3IA 4DBGB 1VQ1A 3IECA 1D2NA 1OFHA 1IY1A 1JR3E 2JNHA 4FCTA 4LJ4A 2VQFM 2Z3XA 4JI1M 4OVZB 1MX0A 3I4YA 1NNUC 3HJQA 2DVWB 3K92A 3GPXA 4X64M 1H0GA 1JQJC 3SMPA 2I7PA 5ITRA 1EIJA 2WZJA 2DAKA 1IQPA 4P17A 3GRYA 4NXNM 4MB5A 3FUVA 4TX8A 4S12A 4NZ3A 2W82A 3GLGB 3GLIE 3TL4X 4CHTB 4RNAA 1YE9A 4GEWA 2MROB 3LCUA 1YU0A 5IWAM 4MGIE 3KP0E 1D0MA 4HLQA 4DR1M 3J7AS 4MB3A 1J7MA 4LF7M 1DGFA 2LNHC 4AG6A 1W1YA 5KPRA 2UUAM 2X8AA 2ZM6M 3KSJA 3FYCA 3Q8GA 4X65M 4NZ5A 4OJ5A 1Z59A 2BJVA 1VG5A 2OO9A 4GH9A 4DV5M 2Y20A 4LFCM 1N78A 3DA1A 3GO8A 3HJSA 5FTNA 3T1YM 2KNVA 3GLHE 1H8PA 4G4OA 2AHMA 4MH0E 1NHGC 3J80S 1ED7A 2DWZB 2EO2A 2LBCA 3W67A 2QP9X 4LJ6A 2OPFA 1E6RA 1YU3A 4M0DA 1XC8A 1W5TA 4NYUA 2FFJA 1T6OA 1NY5A 4DR7M 1T43A 2JZ1A 1OQYA 2R4EA 4CISA 4JI2M 2Z4SA 1P3QQ 2Y2IA 4QNMA 2CWBA 2BNKA 2JUJA 1QDTA 4LZJA 1EE8A 2R0IA 3FYDA 2FN2A 3TWMA 3ILKA 4D80A 4Z2GA 3U60B 1NJFA 5JI2E 2LWXA 2HHHM 1NJGA 2LVAA 1RU3A 5JI3E 1XMOM 2APLA 4OJOA 1GO5A 5ITYA 1NHWC 4AKHA 1VEJA 3ZH9B 4OX9M 2RKOA 4GKJM 3U61A 3WX7A 1CUKA 1NV8A 1H0IA 1QANA 2KW0A 1K3WA 4JV5M 4L6V6 3GQ5A 3LVVA 1CK7A 5EP4A 1AIPC 4DV6M 1OIPA 5ITQA 1L2CA 3I51A 4MB4A 3SHFA 4TUWA 4Z2IA 5E26A 1OJLA 2KRUA 5LMNM 2UXDM 4LF8M 1UR8A 3GRVA 2VIIA 4AKIA 4M0WA 3BXWA 1VDLA 4ANRA 4GIPA 5H37D 3GLGE 4RF1A 2DKLA 2O5RA 2EKKA 4BB9A 2L6OA 2XD5A 4B3MM 2QHOB 3KVWA 1JR3D 2O01F 2MJ5B 3L29A 4GC9A 3FRHA 4NSRA 5ITXA 2LVNC 2XZUA 4JYAM 2LHCA 3CGWA 2JY6B 1C7YA 2CEAA 1FNNA 3GPPA 2Y2HA 4IBJA 3TWKA 2DNAA 2K0BX 1E94E 4IBEA 4AI6A 2ERCA 3B9PA 1PDCA 2JXNA 3FRIA 2EKFA 5ITUA 1GLNA 1KSFX 3HHWA 4QHSA 1YLAA 2KZUA 2YR0A 3RFWA 5L8RF 2KRKA 4LJ8A 4LJ5A 1IN8A 1UM8A 4JI0M 4Z2KA 3IG5A 2ZAOA 1NSFA 3THGA 4Y28F 2C9CA 2H1RA 2EA0A 3U6CA 4LF6M 3AL0C 4B3RM 1EFUB 2DENA 2FFFB 3F92A 4CJ6A 4GITA 2UU9M 2Y2KA 3SAVA 2RGOA 3M7PA 5FTMA 5FTLA 1QAQA 3KS4A 4LF9M 4DV0M 1NO1A 3E9SA 3AOGA 4M9XA 3HY5A 1R7RA 4MGYE 8CATA 4RF0A 4JI4M 1HR0M 1GVNA 3J27B 3KS8A 4DR2M 1FJGM 2FNAA 4LJ7A 3HX3A 5C18A 1W1PA 1WHCA 4JI3M 3HU1A 3W0FA 1J5EM 1Q39A 4HMDA 2FS1A 4GHAA 1DO0A 1HT1E 5EXXA 3U6PA 1UR9A 3JAMS 1CXWA 2C96A 5FTJA 3FUTA 4GC5A 2G5GX 4L16A 3GPYA 3QYEA 1MJGM 1TDZA 1YU1A 3CF0A 1TF0B 2LVOC 2FH0A 2KNZA 2L4EA 3A42A 2JY8A 3L28A 3B7QA 3HHYA 3ZC7B 1E6NA 3N3FA 3VFDA 4WP2A 4NRWA 4IIWA 4R71A 3KOWE 3U5ZA 2JY7A 2KHHA 2DZLA 2M60A 1IBLM 1PJSA 2CFOA 1VEGA 1IM2A 2B3TA 4AQYM 4KLNA 3KDSE 3GP1A 5EP1A 4JI7M 4DUYM 1XNQM 3PNVA 5IT9S 2R4JA 1GXDA 1XXHA 1I4WA 5A2QS 1NNJA 4YHHM 1QZEA 3C58A 3HSHA 1OAIA 3SARA 3CTWB 3RGSA 2UXCM 1Q02A 1HJPA 2DXIA 2LVQD 1HNXM
chains in the Genus database with same CATH topology
4G6ZA 4DR3M 3KSXA 4R3DA 3DZDA 1HNZM 3U6EA 4FCVA 4NRVA 4GRIA 1Z5CA 3KOXE 4A3VB 4PDGA 1GKIA 3D8LA 2D7GA 4FWHA 4G4QA 4MM3B 1QQWA 4B3SM 2CHQA 1QZMA 2XH9A 2A5YB 3VDPA 2Y0QA 3FTDA 1TH2A 5KQDA 1H6UA 1N33M 4ITQA 4NYYA 4B7GA 3W0LB 1SXJC 2R18A 2CHVA 4LJAA 1NVMA 3LQQA 2Z7JA 5EP2A 3VK8A 2V1UA 1PJIA 1ORYB 1SXJA 2QBYA 4FD2A 2QPAA 3SYKA 2CHGA 3EIHA 3CF6E 3KOYE 3KXEC 4AZFA 1E9SA 4B7FA 1IBKM 3JR5A 1DGBA 1WXQA 4QOSA 4M9ZA 1G4AE 5EP3A 2DWLA 2QENA 1J7KA 3WHKA 2Y2JA 4Z8XA 4QNLA 2P5TA 1I94M 4XGIA 4GKKM 1TDHA 1R2ZA 2R65A 2Q2EB 3FKEA 3AJIB 2ZAMA 4BLCA 5EXPA 5BR8M 4I8OA 5F3WA 5ITTA 3U6SA 2NQ8C 2DWMA 3UGJA 3HONA 2Y0TA 2HKJA 4M9SA 2EUCA 4DV3M 3T15A 2R45A 3PNYA 4NOOB 1NY6A 2KA6B 3LQRA 1TH3A 5DYIA 2V1CA 3KP1E 3SFZA 1R2YA 2X49A 4FCWA 2DZOB 4FWDA 2Y2LA 4LG2A 4X62M 2XSZD 1E32A 3U5ZB 3L27A 3VLFB 4DV2M 4IBIA 3U6QA 1IN4A 3U6DA 5ITXE 4G4NA 4WW0A 1X37A 2LH0A 3GRRA 1DO2A 3GPUA 3IG8A 4REZA 5LMUM 1G59A 4X66M 4BBAA 2CE7A 1L1TA 4B7HA 5EXSA 5EXTA 2DWNA 2XFSA 1YUEA 3AOEC 3Q8XA 2BG1A 4L15A 4DV7M 4DV4M 4QOZC 2QZ4A 1Q3CA 2J7OA 3FUXA 3W0FA 3AOEA 1DGHA 1PM5A 3K8ZA 2L09A 1OFIA 4GMQA 4OUIA 1KFVA 4D81A 3HHZA 3SYLA 4LRTA 2M5ZA 3L2AA 1IN6A 2XD1A 1ZQ9A 2ZBKB 1HQYE 2V6ZM 3KW6A 2F5NA 1LV7A 2UUBM 5KPZA 1TGUA 3SMSA 4LFAM 3JR4A 3GLFA 1T3TA 3AKZA 1N36M 2DZNB 4NY2A 2HCBA 3T38A 3SAUA 2R62A 4OJLA 3WHLA 1SXJB 1YUBA 5EJCA 4PDIA 2QBYB 2C5RA 3M7GA 2K47A 2R46A 3ZCBB 3T1HM 5KPTA 4I4LA 2F5QA 4JXJA 4JI6M 1QAOA 1QYRA 4LRSA 1DGGA 3AV0A 3HHXA 1JR3A 4FVMA 4IBKA 3HGIA 4LF5M 3NWLA 5KO3A 4LJ9A 3RE8A 5BPVA 3U61B 2Y2QA 1GL6A 4R7GA 2OQ4A 3K2LA 5KQ8A 1VDDA 1IY2A 4DR5M 2Y2NA 3HWSA 1N32M 2KZSA 2L7HA 4Z6YA 1L2DA 3VKHA 2LXEA 1C1KA 3E4RA 3GLIA 3EIEA 2Z4RA 5IREB 2F5OA 2Y2OA 1HQCA 3DOAA 4QHTA 2YNMD 3A45A 3KOZE 7CATA 2Y21A 4B3TM 1GL7A 4MB7A 4ZPXA 3AFHA 3SHGB 1YU4A 3H4MA 4G4RA 5E6JA 2DHRA 4CGYB 2VQEM 3FTFA 3GRUA 4L78A 3R8FA 2Y2PA 4IBBA 2BJWA 3UMMA 2CV1A 3NBIA 3UK6A 1L2BA 3SC3A 2E5LM 4NSOB 4LF4M 3GLHA 2G8LA 3A46A 2X4AA 1K3XA 2RGHA 3LVWA 1XNRM 4AW4A 4PD2A 2UUCM 5IZ7D 4MGZE 2CUZA 3UJNA 1L1ZA 3FUUA 4AG5A 3OTOM 4LGYA 3RGPA 3SATA 2C98A 4IBDA 4OJPA 4KODA 4OJ6A 3BOSA 3M0EA 3PFIA 4XBOA 5DYGA 4HL4A 3SBJA 2Y2MA 1IY0A 3J7BA 4LZZA 3GQ4A 4FWGA 4LGMA 1G41A 1SXJE 3MK6A 4KO8A 1IXRC 2XZFA 1J09A 3PXGA 1DGHB 4DR4M 1IXSB 4AKGA 4L4UA 3U6LA 4I81A 2XGNA 3CF2A 1ZAEA 3FTCA 4JI5M 2I7NA 3HU2A 2UXBM 4OW0A 2D7HA 2IOUA 2FOIC 3SASA 4OVZA 1IN7A 1N77A 1YSYA 3UZUA 2F4VM 2J7NA 4PCZA 1E9RA 4MGHA 3VDUA 3U6MA 2FE8A 3FUWA 3L25A 2YFQA 4P16A 1R6BX 3GLFB 1W5SA 1Z6TA 4II7A 3MJ5A 3HU3A 4PT5A 3GQ3A 3GLGA 2JCHA 2KXEA 3J81S 4JN6A 3TWLA 3KFUG 4DR6M 3TPZA 4IJFA 4LFBM 2XF3A 1HNWM 4W5WA 3FTEA 1XXHB 2XFTA 1MU5A 3U6OA 3L26A 4L8RC 3QAUA 2JA2A 2ZANA 1L8QA 4GHLA 1QVRA 4YY3M 2YQZA 1YU2A 1IXZA 4DUZM 1IN5A 2QCUA 4WURA 3GLIB 3R9XB 2XEPA 5EQTA 4NL4H 3FD9A 5C1BA 1PJJA 1G8PA 1KYIA 1S3SA 2C99A 4IBCA 4NXMM 4D82A 2D7EA 3SAWA 4EIWA 3U60A 2UWXA 2HL7A 5FTKA 2Y2GA 2XLJA 4NZ1A 2JE5A 3HKPA 4KHPM 2F5SA 1Q3BA 4B08A 1XMQM 3D8BA 3TQSA 3GLHB 3LMMA 4JI8M 3I4VA 4FW9A 3MHVC 4IJEA 2KEBA 4IBGA 5FSWA 1XHBA 4LY6A 3HJ8A 4IBFA 4LCBA 2CV2A 4I5SA 1Z5AA 5DNYA 2C9OA 3J2PB 3TE6A 1HT2E 3VKGA 4QNRA 1SXJD 3DFZA 3K1JA 4DV1M 4K0KM 1Z5BA 3PVSA 4MGKE 1TH4A 1N75A 5GKNA 2L7IA 3VK7A 1N34M 3A98B 1IBMM 2CV0A 3M6AA 3QWLA 1QAMA 2F5PA 5FLXS 1XWIA 2XSZA 4NZ4A 4OU7A 1G3IA 4FCTA 1D2NA 1OFHA 1IY1A 4LJ4A 2Z3XA 2VQFM 4JI1M 4OVZB 1MX0A 3I4YA 1NNUC 3HJQA 2DVWB 3K92A 3GPXA 4X64M 1JQJC 3SMPA 2I7PA 5ITRA 1IQPA 3GRYA 4NXNM 3FUVA 4S12A 4NZ3A 2W82A 3GLGB 3TL4X 4CHTB 4RNAA 1YE9A 1YU0A 5IWAM 4MGIE 3KP0E 4HLQA 4DR1M 3J7AS 4LF7M 1DGFA 2LNHC 4AG6A 5KPRA 2UUAM 2X8AA 2ZM6M 3KSJA 3FYCA 4X65M 4NZ5A 4OJ5A 1Z59A 2BJVA 4GH9A 4LFCM 4DV5M 2Y20A 1N78A 3DA1A 3GO8A 3HJSA 5FTNA 3T1YM 4G4OA 2AHMA 4MH0E 1NHGC 3J80S 2DWZB 2EO2A 4NYUA 2QP9X 4LJ6A 2OPFA 1YU3A 4M0DA 1XC8A 1W5TA 2FFJA 1NY5A 4DR7M 2R4EA 4CISA 4JI2M 2Z4SA 2Y2IA 4QNMA 2BNKA 4LZJA 1EE8A 3FYDA 3TWMA 3ILKA 4D80A 3U60B 1NJFA 5JI2E 2LWXA 2HHHM 1NJGA 5JI3E 1XMOM 4OJOA 5ITYA 1NHWC 4AKHA 3ZH9B 4OX9M 2RKOA 4GKJM 3U61A 3WX7A 1QANA 2KW0A 1K3WA 4JV5M 3GQ5A 3LVVA 5EP4A 4DV6M 1L2CA 5ITQA 3I51A 3SHFA 4TUWA 5E26A 1OJLA 2KRUA 5LMNM 2UXDM 4LF8M 3GRVA 2VIIA 4AKIA 4M0WA 4GIPA 5H37D 4RF1A 2O5RA 4BB9A 2L6OA 2XD5A 4B3MM 3KVWA 1JR3D 2XZUA 3L29A 4GC9A 5ITXA 4NSRA 4JYAM 2CEAA 1FNNA 3GPPA 2Y2HA 4IBJA 3TWKA 1E94E 4IBEA 4AI6A 2ERCA 3B9PA 5ITUA 1GLNA 1KSFX 3HHWA 4QHSA 2KZUA 2YR0A 3RFWA 2KRKA 4LJ8A 4LJ5A 1IN8A 1UM8A 4JI0M 3IG5A 2ZAOA 1NSFA 3THGA 2C9CA 2H1RA 2EA0A 3U6CA 4LF6M 3AL0C 4B3RM 2FFFB 4GITA 2UU9M 2Y2KA 3SAVA 2RGOA 5FTMA 5FTLA 1QAQA 3KS4A 4LF9M 4DV0M 3E9SA 3AOGA 4M9XA 1R7RA 4MGYE 8CATA 4RF0A 4JI4M 1HR0M 1GVNA 3J27B 3KS8A 4DR2M 1FJGM 2FNAA 4LJ7A 5C18A 4JI3M 3HU1A 1J5EM 1Q39A 4GHAA 1DO0A 1HT1E 5EXXA 3U6PA 3JAMS 2C96A 5FTJA 3FUTA 4GC5A 2G5GX 4L16A 3GPYA 1TDZA 1YU1A 3CF0A 1K82A 3L28A 3N3FA 3A42A 3HHYA 3ZC7B 3VFDA 4NRWA 4IIWA 3KOWE 3U5ZA 2M60A 1IBLM 2CFOA 1IM2A 4AQYM 4KLNA 3KDSE 3GP1A 5EP1A 4JI7M 4DUYM 1XNQM 3PNVA 5IT9S 2R4JA 1XXHA 1I4WA 5A2QS 1NNJA 4YHHM 3C58A 3HSHA 3SARA 3CTWB 3RGSA 2UXCM 2DXIA 1HNXM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L26 A;  3L28 A;  3L29 A;  4GHL A;  4IJE A;  4IBD A;  3KS4 A;  4IBG A;  3L25 A;  4GH9 A;  4IBF A;  3FKE A;  4IBJ A;  3KS8 A;  4IBE A;  4LG2 A;  4IBC A;  4IBK A;  3L2A A;  3L27 A;  4IBB A;  4GHA A;  4IBI A;  5BPV A;  4IJF A; 
#chains in the Genus database with same CATH topology
 4G6Z A;  4DR3 M;  3KSX A;  4R3D A;  3DZD A;  1HNZ M;  3U6E A;  4FCV A;  4NRV A;  4GRI A;  1Z5C A;  3B7Z A;  3KOX E;  4A3V B;  4PDG A;  1GKI A;  2JP7 A;  3D8L A;  4Z2L A;  2CP8 A;  2D7G A;  4FWH A;  4G4Q A;  4MM3 B;  1QQW A;  4B3S M;  3V76 A;  1PRB A;  1GAB A;  2CHQ A;  4NC6 A;  1QZM A;  2XH9 A;  2A5Y B;  2QQ8 A;  1TTE A;  3VDP A;  3WD2 A;  2Y0Q A;  3FTD A;  1TH2 A;  3K9P A;  1H6U A;  5KQD A;  1NV9 A;  1N33 M;  4ITQ A;  1EAK A;  4NYY A;  1JB0 F;  4B7G A;  2D49 A;  3W0L B;  2N35 A;  2LTU A;  1SXJ C;  2R18 A;  2CHV A;  4LJA A;  1NVM A;  1WIV A;  3LQQ A;  2Z7J A;  5EP2 A;  3VK8 A;  3LCV B;  1V92 A;  2V1U A;  1PJI A;  1ORY B;  1SXJ A;  3WD3 A;  2QBY A;  2CRU A;  2QPA A;  4FD2 A;  3SYK A;  1E15 A;  1L6J A;  2CHG A;  2WSE F;  3EIH A;  4KT0 F;  3CF6 E;  1QDR A;  3KOY E;  1OIZ A;  3KXE C;  4AZF A;  4Z2H A;  1E9S A;  4B7F A;  1IBK M;  3JR5 A;  1DGB A;  1WXQ A;  1ZMW A;  2LHG A;  2RRU A;  4QOS A;  4M9Z A;  1G4A E;  5EP3 A;  2DWL A;  2QEN A;  1J7K A;  3WHK A;  2Y2J A;  1WJ7 A;  4Z8X A;  4QNL A;  2P5T A;  1I94 M;  4UN2 B;  4XGI A;  4GKK M;  1TDH A;  1OKS A;  1R2Z A;  3WD1 A;  2R65 A;  2Q2E B;  2ZTD A;  3AJI B;  2ZAM A;  3FE3 A;  3FKE A;  4BLC A;  5EXP A;  5BR8 M;  4I8O A;  5F3W A;  5ITT A;  3U6S A;  2NQ8 C;  3MMP A;  3T6P A;  2DWM A;  3UGJ A;  3HON A;  4F1I A;  2Y0T A;  3ZQJ A;  2HKJ A;  4M9S A;  2EUC A;  4DV3 M;  3T15 A;  2R45 A;  1AUA A;  3PNY A;  1NY6 A;  2KA6 B;  3LQR A;  1TH3 A;  4NOO B;  2V1C A;  3KP1 E;  1O6I A;  2HAK A;  1PJT A;  3SFZ A;  1R2Y A;  2X49 A;  2JWS A;  4FCW A;  2DZO B;  2L4F A;  4FWD A;  2Y2L A;  4LG2 A;  1D0K A;  4X62 M;  2XSZ D;  1GJT A;  2KDL A;  2VF7 A;  1E32 A;  1E6Z A;  2RTS A;  5DYI A;  3L27 A;  3U5Z B;  3VLF B;  1OGG A;  4DV2 M;  2G3Q A;  4IBI A;  3U6Q A;  1IN4 A;  3U6D A;  1MN3 A;  5ITX E;  4G4N A;  1QUS A;  4WW0 A;  1X37 A;  2LH0 A;  3GRR A;  1DO2 A;  3GPU A;  3IG8 A;  4REZ A;  5LMU M;  1G59 A;  2QSF X;  4X66 M;  4BBA A;  1XB2 B;  2CE7 A;  1L1T A;  4B7H A;  5EXS A;  5EXT A;  2DWN A;  2XFS A;  1YUE A;  3AOE C;  3B7N A;  3Q8X A;  2BG1 A;  2WSF F;  4L15 A;  4DV7 M;  2QNJ A;  4DV4 M;  4QOZ C;  2QZ4 A;  1Q3C A;  2J7O A;  2MH8 A;  3BBZ A;  3AOE A;  1DGH A;  3FUX A;  1IXS A;  3K8Z A;  2L09 A;  1OFI A;  4GMQ A;  4OUI A;  2VF8 A;  1KFV A;  3W68 A;  4D81 A;  3HHZ A;  1GPF A;  3SYL A;  4LRT A;  2M5Z A;  3L2A A;  2JZ0 A;  1IN6 A;  2XD1 A;  1ZQ9 A;  2ZBK B;  1HQY E;  2R44 A;  3C3E A;  4RKU F;  2V6Z M;  3KW6 A;  2F5N A;  2DAG A;  1LV7 A;  2UUB M;  5KPZ A;  1TGU A;  3SMS A;  3NBX X;  4LFA M;  3JR4 A;  3GLF A;  1T3T A;  3AKZ A;  1N36 M;  2DZN B;  4NY2 A;  2HCB A;  3T38 A;  1WR1 B;  3SAU A;  2R62 A;  2KNA A;  4OJL A;  1E88 A;  2J5Y A;  3WHL A;  2L2D A;  2MGW A;  2Z8Y M;  1WGN A;  1SXJ B;  1YUB A;  5EJC A;  4PDI A;  2QBY B;  2C5R A;  3M7G A;  1PJQ A;  2K47 A;  2R46 A;  2OOB A;  3ZCB B;  5KPT A;  3T1H M;  4I4L A;  2F5Q A;  4JXJ A;  4JI6 M;  1QAO A;  1QYR A;  3K9O A;  4LRS A;  1DGG A;  3AV0 A;  3HHX A;  1JR3 A;  4FVM A;  4IBK A;  3HGI A;  4LF5 M;  3NWL A;  5KO3 A;  4LJ9 A;  3RE8 A;  5BPV A;  3U61 B;  1K82 A;  1GL6 A;  2Y2Q A;  1LTM A;  4R7G A;  2GQF A;  2K6B A;  2OQ4 A;  3K2L A;  5KQ8 A;  1VDD A;  1IY2 A;  4DR5 M;  2Y2N A;  4Z2J A;  3HWS A;  1N32 M;  2KZS A;  2L7H A;  4Z6Y A;  1BVS A;  1L2D A;  3VKH A;  1SG9 A;  1C1K A;  2LXE A;  3E4R A;  3GLI A;  3EIE A;  3WD0 A;  2HWJ A;  2Z4R A;  5IRE B;  1XXH E;  2F5O A;  2Y2O A;  1HQC A;  3DOA A;  4QHT A;  2YNM D;  3A45 A;  3KOZ E;  7CAT A;  2Y21 A;  4XK8 F;  1GL7 A;  4B3T M;  3WD4 A;  4MB7 A;  4ZPX A;  1ZMU A;  3AFH A;  3E21 A;  3SHG B;  1E8B A;  1YU4 A;  3H4M A;  4G4R A;  1R5L A;  1V33 A;  2DHR A;  5E6J A;  4CGY B;  2VQE M;  3FTF A;  3GRU A;  4L78 A;  4HMC A;  3R8F A;  1WGL A;  2Y2P A;  4IBB A;  2BJW A;  2R6F A;  3UMM A;  1VEK A;  3NBI A;  3UK6 A;  1L2B A;  3SC3 A;  2CV1 A;  2E5L M;  2DAE A;  4NSO B;  4LF4 M;  3I04 M;  3GLH A;  2G8L A;  2DHY A;  3A46 A;  2X4A A;  2EJS A;  1K3X A;  2RGH A;  3LW5 F;  3LVW A;  1XNR M;  1D0L A;  3B74 A;  4AW4 A;  4PD2 A;  4Q7J A;  2UUC M;  5IZ7 D;  4MGZ E;  2CUZ A;  3UJN A;  2MR9 A;  1ZV1 A;  1L1Z A;  3FUU A;  1E6P A;  4AG5 A;  3OTO M;  4LGY A;  2ZTC A;  3RGP A;  3SAT A;  2C98 A;  4IBD A;  4OJP A;  4KOD A;  4OJ6 A;  3BOS A;  1DV0 A;  3M0E A;  3PFI A;  4XBO A;  5DYG A;  4HL4 A;  3SBJ A;  2Y2M A;  1IY0 A;  1UFZ A;  2LVP C;  3J7B A;  4LZZ A;  4FWG A;  3GQ4 A;  3B89 A;  2WSC F;  4LGM A;  3C9P A;  1G41 A;  1SXJ E;  3MK6 A;  4KO8 A;  1IXR C;  2XZF A;  1IFY A;  4HME A;  1J09 A;  3PXG A;  1DGH B;  4DR4 M;  1IXS B;  4AKG A;  4L4U A;  3E46 A;  3U6L A;  4I81 A;  2XGN A;  1R4G A;  1ZAE A;  3CF2 A;  3FTC A;  4JI5 M;  2I7N A;  3HU2 A;  2UXB M;  4OW0 A;  2D7H A;  2IOU A;  2FOI C;  3SAS A;  4OVZ A;  1IN7 A;  1N77 A;  1YSY A;  3UZU A;  3HZJ A;  2F4V M;  2J7N A;  4PCZ A;  1E9R A;  4MGH A;  3VDU A;  3U6M A;  2FE8 A;  3FUW A;  3I01 M;  3L25 A;  2YFQ A;  2OOA A;  1R6B X;  4P16 A;  3GLF B;  1W5S A;  1Z6T A;  4II7 A;  3MJ5 A;  3HU3 A;  4PT5 A;  3GQ3 A;  3GLG A;  1F4I A;  4HEO A;  2K9D A;  1OAO C;  2JCH A;  1W1T A;  3H4J A;  2KXE A;  1QO6 A;  3J81 S;  4JN6 A;  1AIW A;  3TWL A;  3KFU G;  2BWB A;  2O25 A;  4DR6 M;  1ZMV A;  3TPZ A;  3IHP A;  4G3O A;  2DAI A;  2GNO A;  4IJF A;  4LFB M;  2XF3 A;  1HNW M;  4W5W A;  3FTE A;  1XXH B;  2XFT A;  1MU5 A;  3U6O A;  3L26 A;  4L8R C;  3QAU A;  2H5X A;  2JA2 A;  2ZAN A;  1L8Q A;  4GHL A;  1QVR A;  4YY3 M;  2YQZ A;  1YU2 A;  1IXZ A;  4DUZ M;  1IN5 A;  2QCU A;  4WUR A;  2JY5 A;  3GLI B;  3R9X B;  2XEP A;  5EQT A;  4NL4 H;  3FD9 A;  5C1B A;  1PJJ A;  1KS0 A;  1G8P A;  1KYI A;  1S3S A;  2C99 A;  2V5O A;  4IBC A;  4NXM M;  2DI0 A;  1PM5 A;  5DFL A;  4D82 A;  2D7E A;  3SAW A;  4EIW A;  3U60 A;  2UWX A;  2HL7 A;  5FTK A;  2Y2G A;  1GJS A;  2XLJ A;  4NZ1 A;  2JE5 A;  3HKP A;  2CV0 A;  4KHP M;  2F5S A;  1Q3B A;  1TR8 A;  4B08 A;  1XMQ M;  1PGY A;  3D8B A;  3TQS A;  3GLH B;  3LMM A;  4JI8 M;  3I4V A;  4FW9 A;  3C3D A;  3MHV C;  4IJE A;  2KEB A;  4IBG A;  1G71 A;  5FSW A;  1XHB A;  1QUT A;  4LY6 A;  3HJ8 A;  4IBF A;  2BWE A;  4LCB A;  2CV2 A;  4I5S A;  1Z5A A;  1OGB A;  5DNY A;  1OTR A;  2C9O A;  3J2P B;  3TE6 A;  3QYB A;  1HT2 E;  3VKG A;  4QNR A;  2VDB B;  2DAM A;  1SXJ D;  1V34 A;  3GLF E;  3DFZ A;  3K1J A;  4DV1 M;  4K0K M;  1W1V A;  1Z5B A;  3PVS A;  4MGK E;  1TH4 A;  1N75 A;  5GKN A;  1Y8G A;  2L7I A;  3VK7 A;  3A98 B;  1N34 M;  4CIZ A;  3M6A A;  1IBM M;  3QWL A;  1QAM A;  1GOI A;  2F5P A;  5FLX S;  1XWI A;  2XSZ A;  1A5T A;  4F2L A;  3MQL A;  4OU7 A;  4NZ4 A;  1G3I A;  4DBG B;  1VQ1 A;  3IEC A;  1D2N A;  1OFH A;  1IY1 A;  1JR3 E;  2JNH A;  4FCT A;  4LJ4 A;  2VQF M;  2Z3X A;  4JI1 M;  4OVZ B;  1MX0 A;  3I4Y A;  1NNU C;  3HJQ A;  2DVW B;  3K92 A;  3GPX A;  4X64 M;  1H0G A;  1JQJ C;  3SMP A;  2I7P A;  5ITR A;  1EIJ A;  2WZJ A;  2DAK A;  1IQP A;  4P17 A;  3GRY A;  4NXN M;  4MB5 A;  3FUV A;  4TX8 A;  4S12 A;  4NZ3 A;  2W82 A;  3GLG B;  3GLI E;  3TL4 X;  4CHT B;  4RNA A;  1YE9 A;  4GEW A;  2MRO B;  3LCU A;  1YU0 A;  5IWA M;  4MGI E;  3KP0 E;  1D0M A;  4HLQ A;  4DR1 M;  3J7A S;  4MB3 A;  1J7M A;  4LF7 M;  1DGF A;  2LNH C;  4AG6 A;  1W1Y A;  5KPR A;  2UUA M;  2X8A A;  2ZM6 M;  3KSJ A;  3FYC A;  3Q8G A;  4X65 M;  4NZ5 A;  4OJ5 A;  1Z59 A;  2BJV A;  1VG5 A;  2OO9 A;  4GH9 A;  4DV5 M;  2Y20 A;  4LFC M;  1N78 A;  3DA1 A;  3GO8 A;  3HJS A;  5FTN A;  3T1Y M;  2KNV A;  3GLH E;  1H8P A;  4G4O A;  2AHM A;  4MH0 E;  1NHG C;  3J80 S;  1ED7 A;  2DWZ B;  2EO2 A;  2LBC A;  3W67 A;  2QP9 X;  4LJ6 A;  2OPF A;  1E6R A;  1YU3 A;  4M0D A;  1XC8 A;  1W5T A;  4NYU A;  2FFJ A;  1T6O A;  1NY5 A;  4DR7 M;  1T43 A;  2JZ1 A;  1OQY A;  2R4E A;  4CIS A;  4JI2 M;  2Z4S A;  1P3Q Q;  2Y2I A;  4QNM A;  2CWB A;  2BNK A;  2JUJ A;  1QDT A;  4LZJ A;  1EE8 A;  2R0I A;  3FYD A;  2FN2 A;  3TWM A;  3ILK A;  4D80 A;  4Z2G A;  3U60 B;  1NJF A;  5JI2 E;  2LWX A;  2HHH M;  1NJG A;  2LVA A;  1RU3 A;  5JI3 E;  1XMO M;  2APL A;  4OJO A;  1GO5 A;  5ITY A;  1NHW C;  4AKH A;  1VEJ A;  3ZH9 B;  4OX9 M;  2RKO A;  4GKJ M;  3U61 A;  3WX7 A;  1CUK A;  1NV8 A;  1H0I A;  1QAN A;  2KW0 A;  1K3W A;  4JV5 M;  4L6V 6;  3GQ5 A;  3LVV A;  1CK7 A;  5EP4 A;  1AIP C;  4DV6 M;  1OIP A;  5ITQ A;  1L2C A;  3I51 A;  4MB4 A;  3SHF A;  4TUW A;  4Z2I A;  5E26 A;  1OJL A;  2KRU A;  5LMN M;  2UXD M;  4LF8 M;  1UR8 A;  3GRV A;  2VII A;  4AKI A;  4M0W A;  3BXW A;  1VDL A;  4ANR A;  4GIP A;  5H37 D;  3GLG E;  4RF1 A;  2DKL A;  2O5R A;  2EKK A;  4BB9 A;  2L6O A;  2XD5 A;  4B3M M;  2QHO B;  3KVW A;  1JR3 D;  2O01 F;  2MJ5 B;  3L29 A;  4GC9 A;  3FRH A;  4NSR A;  5ITX A;  2LVN C;  2XZU A;  4JYA M;  2LHC A;  3CGW A;  2JY6 B;  1C7Y A;  2CEA A;  1FNN A;  3GPP A;  2Y2H A;  4IBJ A;  3TWK A;  2DNA A;  2K0B X;  1E94 E;  4IBE A;  4AI6 A;  2ERC A;  3B9P A;  1PDC A;  2JXN A;  3FRI A;  2EKF A;  5ITU A;  1GLN A;  1KSF X;  3HHW A;  4QHS A;  1YLA A;  2KZU A;  2YR0 A;  3RFW A;  5L8R F;  2KRK A;  4LJ8 A;  4LJ5 A;  1IN8 A;  1UM8 A;  4JI0 M;  4Z2K A;  3IG5 A;  2ZAO A;  1NSF A;  3THG A;  4Y28 F;  2C9C A;  2H1R A;  2EA0 A;  3U6C A;  4LF6 M;  3AL0 C;  4B3R M;  1EFU B;  2DEN A;  2FFF B;  3F92 A;  4CJ6 A;  4GIT A;  2UU9 M;  2Y2K A;  3SAV A;  2RGO A;  3M7P A;  5FTM A;  5FTL A;  1QAQ A;  3KS4 A;  4LF9 M;  4DV0 M;  1NO1 A;  3E9S A;  3AOG A;  4M9X A;  3HY5 A;  1R7R A;  4MGY E;  8CAT A;  4RF0 A;  4JI4 M;  1HR0 M;  1GVN A;  3J27 B;  3KS8 A;  4DR2 M;  1FJG M;  2FNA A;  4LJ7 A;  3HX3 A;  5C18 A;  1W1P A;  1WHC A;  4JI3 M;  3HU1 A;  3W0F A;  1J5E M;  1Q39 A;  4HMD A;  2FS1 A;  4GHA A;  1DO0 A;  1HT1 E;  5EXX A;  3U6P A;  1UR9 A;  3JAM S;  1CXW A;  2C96 A;  5FTJ A;  3FUT A;  4GC5 A;  2G5G X;  4L16 A;  3GPY A;  3QYE A;  1MJG M;  1TDZ A;  1YU1 A;  3CF0 A;  1TF0 B;  2LVO C;  2FH0 A;  2KNZ A;  2L4E A;  3A42 A;  2JY8 A;  3L28 A;  3B7Q A;  3HHY A;  3ZC7 B;  1E6N A;  3N3F A;  3VFD A;  4WP2 A;  4NRW A;  4IIW A;  4R71 A;  3KOW E;  3U5Z A;  2JY7 A;  2KHH A;  2DZL A;  2M60 A;  1IBL M;  1PJS A;  2CFO A;  1VEG A;  1IM2 A;  2B3T A;  4AQY M;  4KLN A;  3KDS E;  3GP1 A;  5EP1 A;  4JI7 M;  4DUY M;  1XNQ M;  3PNV A;  5IT9 S;  2R4J A;  1GXD A;  1XXH A;  1I4W A;  5A2Q S;  1NNJ A;  4YHH M;  1QZE A;  3C58 A;  3HSH A;  1OAI A;  3SAR A;  3CTW B;  3RGS A;  2UXC M;  1Q02 A;  1HJP A;  2DXI A;  2LVQ D;  1HNX M; 
#chains in the Genus database with same CATH homology
 4G6Z A;  4DR3 M;  3KSX A;  4R3D A;  3DZD A;  1HNZ M;  3U6E A;  4FCV A;  4NRV A;  4GRI A;  1Z5C A;  3KOX E;  4A3V B;  4PDG A;  1GKI A;  3D8L A;  2D7G A;  4FWH A;  4G4Q A;  4MM3 B;  1QQW A;  4B3S M;  2CHQ A;  1QZM A;  2XH9 A;  2A5Y B;  3VDP A;  2Y0Q A;  3FTD A;  1TH2 A;  5KQD A;  1H6U A;  1N33 M;  4ITQ A;  4NYY A;  4B7G A;  3W0L B;  1SXJ C;  2R18 A;  2CHV A;  4LJA A;  1NVM A;  3LQQ A;  2Z7J A;  5EP2 A;  3VK8 A;  2V1U A;  1PJI A;  1ORY B;  1SXJ A;  2QBY A;  4FD2 A;  2QPA A;  3SYK A;  2CHG A;  3EIH A;  3CF6 E;  3KOY E;  3KXE C;  4AZF A;  1E9S A;  4B7F A;  1IBK M;  3JR5 A;  1DGB A;  1WXQ A;  4QOS A;  4M9Z A;  1G4A E;  5EP3 A;  2DWL A;  2QEN A;  1J7K A;  3WHK A;  2Y2J A;  4Z8X A;  4QNL A;  2P5T A;  1I94 M;  4XGI A;  4GKK M;  1TDH A;  1R2Z A;  2R65 A;  2Q2E B;  3FKE A;  3AJI B;  2ZAM A;  4BLC A;  5EXP A;  5BR8 M;  4I8O A;  5F3W A;  5ITT A;  3U6S A;  2NQ8 C;  2DWM A;  3UGJ A;  3HON A;  2Y0T A;  2HKJ A;  4M9S A;  2EUC A;  4DV3 M;  3T15 A;  2R45 A;  3PNY A;  4NOO B;  1NY6 A;  2KA6 B;  3LQR A;  1TH3 A;  5DYI A;  2V1C A;  3KP1 E;  3SFZ A;  1R2Y A;  2X49 A;  4FCW A;  2DZO B;  4FWD A;  2Y2L A;  4LG2 A;  4X62 M;  2XSZ D;  1E32 A;  3U5Z B;  3L27 A;  3VLF B;  4DV2 M;  4IBI A;  3U6Q A;  1IN4 A;  3U6D A;  5ITX E;  4G4N A;  4WW0 A;  1X37 A;  2LH0 A;  3GRR A;  1DO2 A;  3GPU A;  3IG8 A;  4REZ A;  5LMU M;  1G59 A;  4X66 M;  4BBA A;  2CE7 A;  1L1T A;  4B7H A;  5EXS A;  5EXT A;  2DWN A;  2XFS A;  1YUE A;  3AOE C;  3Q8X A;  2BG1 A;  4L15 A;  4DV7 M;  4DV4 M;  4QOZ C;  2QZ4 A;  1Q3C A;  2J7O A;  3FUX A;  3W0F A;  3AOE A;  1DGH A;  1PM5 A;  3K8Z A;  2L09 A;  1OFI A;  4GMQ A;  4OUI A;  1KFV A;  4D81 A;  3HHZ A;  3SYL A;  4LRT A;  2M5Z A;  3L2A A;  1IN6 A;  2XD1 A;  1ZQ9 A;  2ZBK B;  1HQY E;  2V6Z M;  3KW6 A;  2F5N A;  1LV7 A;  2UUB M;  5KPZ A;  1TGU A;  3SMS A;  4LFA M;  3JR4 A;  3GLF A;  1T3T A;  3AKZ A;  1N36 M;  2DZN B;  4NY2 A;  2HCB A;  3T38 A;  3SAU A;  2R62 A;  4OJL A;  3WHL A;  1SXJ B;  1YUB A;  5EJC A;  4PDI A;  2QBY B;  2C5R A;  3M7G A;  2K47 A;  2R46 A;  3ZCB B;  3T1H M;  5KPT A;  4I4L A;  2F5Q A;  4JXJ A;  4JI6 M;  1QAO A;  1QYR A;  4LRS A;  1DGG A;  3AV0 A;  3HHX A;  1JR3 A;  4FVM A;  4IBK A;  3HGI A;  4LF5 M;  3NWL A;  5KO3 A;  4LJ9 A;  3RE8 A;  5BPV A;  3U61 B;  2Y2Q A;  1GL6 A;  4R7G A;  2OQ4 A;  3K2L A;  5KQ8 A;  1VDD A;  1IY2 A;  4DR5 M;  2Y2N A;  3HWS A;  1N32 M;  2KZS A;  2L7H A;  4Z6Y A;  1L2D A;  3VKH A;  2LXE A;  1C1K A;  3E4R A;  3GLI A;  3EIE A;  2Z4R A;  5IRE B;  2F5O A;  2Y2O A;  1HQC A;  3DOA A;  4QHT A;  2YNM D;  3A45 A;  3KOZ E;  7CAT A;  2Y21 A;  4B3T M;  1GL7 A;  4MB7 A;  4ZPX A;  3AFH A;  3SHG B;  1YU4 A;  3H4M A;  4G4R A;  5E6J A;  2DHR A;  4CGY B;  2VQE M;  3FTF A;  3GRU A;  4L78 A;  3R8F A;  2Y2P A;  4IBB A;  2BJW A;  3UMM A;  2CV1 A;  3NBI A;  3UK6 A;  1L2B A;  3SC3 A;  2E5L M;  4NSO B;  4LF4 M;  3GLH A;  2G8L A;  3A46 A;  2X4A A;  1K3X A;  2RGH A;  3LVW A;  1XNR M;  4AW4 A;  4PD2 A;  2UUC M;  5IZ7 D;  4MGZ E;  2CUZ A;  3UJN A;  1L1Z A;  3FUU A;  4AG5 A;  3OTO M;  4LGY A;  3RGP A;  3SAT A;  2C98 A;  4IBD A;  4OJP A;  4KOD A;  4OJ6 A;  3BOS A;  3M0E A;  3PFI A;  4XBO A;  5DYG A;  4HL4 A;  3SBJ A;  2Y2M A;  1IY0 A;  3J7B A;  4LZZ A;  3GQ4 A;  4FWG A;  4LGM A;  1G41 A;  1SXJ E;  3MK6 A;  4KO8 A;  1IXR C;  2XZF A;  1J09 A;  3PXG A;  1DGH B;  4DR4 M;  1IXS B;  4AKG A;  4L4U A;  3U6L A;  4I81 A;  2XGN A;  3CF2 A;  1ZAE A;  3FTC A;  4JI5 M;  2I7N A;  3HU2 A;  2UXB M;  4OW0 A;  2D7H A;  2IOU A;  2FOI C;  3SAS A;  4OVZ A;  1IN7 A;  1N77 A;  1YSY A;  3UZU A;  2F4V M;  2J7N A;  4PCZ A;  1E9R A;  4MGH A;  3VDU A;  3U6M A;  2FE8 A;  3FUW A;  3L25 A;  2YFQ A;  4P16 A;  1R6B X;  3GLF B;  1W5S A;  1Z6T A;  4II7 A;  3MJ5 A;  3HU3 A;  4PT5 A;  3GQ3 A;  3GLG A;  2JCH A;  2KXE A;  3J81 S;  4JN6 A;  3TWL A;  3KFU G;  4DR6 M;  3TPZ A;  4IJF A;  4LFB M;  2XF3 A;  1HNW M;  4W5W A;  3FTE A;  1XXH B;  2XFT A;  1MU5 A;  3U6O A;  3L26 A;  4L8R C;  3QAU A;  2JA2 A;  2ZAN A;  1L8Q A;  4GHL A;  1QVR A;  4YY3 M;  2YQZ A;  1YU2 A;  1IXZ A;  4DUZ M;  1IN5 A;  2QCU A;  4WUR A;  3GLI B;  3R9X B;  2XEP A;  5EQT A;  4NL4 H;  3FD9 A;  5C1B A;  1PJJ A;  1G8P A;  1KYI A;  1S3S A;  2C99 A;  4IBC A;  4NXM M;  4D82 A;  2D7E A;  3SAW A;  4EIW A;  3U60 A;  2UWX A;  2HL7 A;  5FTK A;  2Y2G A;  2XLJ A;  4NZ1 A;  2JE5 A;  3HKP A;  4KHP M;  2F5S A;  1Q3B A;  4B08 A;  1XMQ M;  3D8B A;  3TQS A;  3GLH B;  3LMM A;  4JI8 M;  3I4V A;  4FW9 A;  3MHV C;  4IJE A;  2KEB A;  4IBG A;  5FSW A;  1XHB A;  4LY6 A;  3HJ8 A;  4IBF A;  4LCB A;  2CV2 A;  4I5S A;  1Z5A A;  5DNY A;  2C9O A;  3J2P B;  3TE6 A;  1HT2 E;  3VKG A;  4QNR A;  1SXJ D;  3DFZ A;  3K1J A;  4DV1 M;  4K0K M;  1Z5B A;  3PVS A;  4MGK E;  1TH4 A;  1N75 A;  5GKN A;  2L7I A;  3VK7 A;  1N34 M;  3A98 B;  1IBM M;  2CV0 A;  3M6A A;  3QWL A;  1QAM A;  2F5P A;  5FLX S;  1XWI A;  2XSZ A;  4NZ4 A;  4OU7 A;  1G3I A;  4FCT A;  1D2N A;  1OFH A;  1IY1 A;  4LJ4 A;  2Z3X A;  2VQF M;  4JI1 M;  4OVZ B;  1MX0 A;  3I4Y A;  1NNU C;  3HJQ A;  2DVW B;  3K92 A;  3GPX A;  4X64 M;  1JQJ C;  3SMP A;  2I7P A;  5ITR A;  1IQP A;  3GRY A;  4NXN M;  3FUV A;  4S12 A;  4NZ3 A;  2W82 A;  3GLG B;  3TL4 X;  4CHT B;  4RNA A;  1YE9 A;  1YU0 A;  5IWA M;  4MGI E;  3KP0 E;  4HLQ A;  4DR1 M;  3J7A S;  4LF7 M;  1DGF A;  2LNH C;  4AG6 A;  5KPR A;  2UUA M;  2X8A A;  2ZM6 M;  3KSJ A;  3FYC A;  4X65 M;  4NZ5 A;  4OJ5 A;  1Z59 A;  2BJV A;  4GH9 A;  4LFC M;  4DV5 M;  2Y20 A;  1N78 A;  3DA1 A;  3GO8 A;  3HJS A;  5FTN A;  3T1Y M;  4G4O A;  2AHM A;  4MH0 E;  1NHG C;  3J80 S;  2DWZ B;  2EO2 A;  4NYU A;  2QP9 X;  4LJ6 A;  2OPF A;  1YU3 A;  4M0D A;  1XC8 A;  1W5T A;  2FFJ A;  1NY5 A;  4DR7 M;  2R4E A;  4CIS A;  4JI2 M;  2Z4S A;  2Y2I A;  4QNM A;  2BNK A;  4LZJ A;  1EE8 A;  3FYD A;  3TWM A;  3ILK A;  4D80 A;  3U60 B;  1NJF A;  5JI2 E;  2LWX A;  2HHH M;  1NJG A;  5JI3 E;  1XMO M;  4OJO A;  5ITY A;  1NHW C;  4AKH A;  3ZH9 B;  4OX9 M;  2RKO A;  4GKJ M;  3U61 A;  3WX7 A;  1QAN A;  2KW0 A;  1K3W A;  4JV5 M;  3GQ5 A;  3LVV A;  5EP4 A;  4DV6 M;  1L2C A;  5ITQ A;  3I51 A;  3SHF A;  4TUW A;  5E26 A;  1OJL A;  2KRU A;  5LMN M;  2UXD M;  4LF8 M;  3GRV A;  2VII A;  4AKI A;  4M0W A;  4GIP A;  5H37 D;  4RF1 A;  2O5R A;  4BB9 A;  2L6O A;  2XD5 A;  4B3M M;  3KVW A;  1JR3 D;  2XZU A;  3L29 A;  4GC9 A;  5ITX A;  4NSR A;  4JYA M;  2CEA A;  1FNN A;  3GPP A;  2Y2H A;  4IBJ A;  3TWK A;  1E94 E;  4IBE A;  4AI6 A;  2ERC A;  3B9P A;  5ITU A;  1GLN A;  1KSF X;  3HHW A;  4QHS A;  2KZU A;  2YR0 A;  3RFW A;  2KRK A;  4LJ8 A;  4LJ5 A;  1IN8 A;  1UM8 A;  4JI0 M;  3IG5 A;  2ZAO A;  1NSF A;  3THG A;  2C9C A;  2H1R A;  2EA0 A;  3U6C A;  4LF6 M;  3AL0 C;  4B3R M;  2FFF B;  4GIT A;  2UU9 M;  2Y2K A;  3SAV A;  2RGO A;  5FTM A;  5FTL A;  1QAQ A;  3KS4 A;  4LF9 M;  4DV0 M;  3E9S A;  3AOG A;  4M9X A;  1R7R A;  4MGY E;  8CAT A;  4RF0 A;  4JI4 M;  1HR0 M;  1GVN A;  3J27 B;  3KS8 A;  4DR2 M;  1FJG M;  2FNA A;  4LJ7 A;  5C18 A;  4JI3 M;  3HU1 A;  1J5E M;  1Q39 A;  4GHA A;  1DO0 A;  1HT1 E;  5EXX A;  3U6P A;  3JAM S;  2C96 A;  5FTJ A;  3FUT A;  4GC5 A;  2G5G X;  4L16 A;  3GPY A;  1TDZ A;  1YU1 A;  3CF0 A;  1K82 A;  3L28 A;  3N3F A;  3A42 A;  3HHY A;  3ZC7 B;  3VFD A;  4NRW A;  4IIW A;  3KOW E;  3U5Z A;  2M60 A;  1IBL M;  2CFO A;  1IM2 A;  4AQY M;  4KLN A;  3KDS E;  3GP1 A;  5EP1 A;  4JI7 M;  4DUY M;  1XNQ M;  3PNV A;  5IT9 S;  2R4J A;  1XXH A;  1I4W A;  5A2Q S;  1NNJ A;  4YHH M;  3C58 A;  3HSH A;  3SAR A;  3CTW B;  3RGS A;  2UXC M;  2DXI A;  1HNX M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...