4IBIA

Ebola virus vp35 bound to small molecule
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
123
structure length
123
Chain Sequence
DISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polymerase cofactor VP35
publication title In Silico Derived Small Molecules Bind the Filovirus VP35 Protein and Inhibit Its Polymerase Cofactor Activity.
pubmed doi rcsb
source organism Ebola virus
molecule tags Transcription/transcription inhibitor
total genus 44
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ibiA01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4ibiA02
4IBBA 3L2AA 4IBJA 4IJEA 4IBKA 4GHLA 5BPVA 4IBGA 3KS4A 3L26A 4IBCA 3L29A 3FKEA 3L27A 3KS8A 4LG2A 4IBEA 4GHAA 4IBIA 4GH9A 3L28A 3L25A 4IBFA 4IBDA 4IJFA
chains in the Genus database with same CATH superfamily
4DV4M 3U61A 3H4MA 3BOSA 4FCTA 5C18A 3GLIE 4DV0M 2DI0A 4NXNM 3NBIA 2CHVA 1GVNA 2L2DA 4G4OA 2DWNA 3SMSA 3ILKA 2Y2NA 1FJGM 3WD2A 3GQ5A 4TX8A 1QAOA 4OJOA 3DZDA 2UXCM 2KNAA 5KPTA 4L6V6 2O5RA 4LJ5A 1J5EM 1N33M 2HWJA 4IBEA 4M9XA 5KPRA 2XD1A 3RGSA 2DWZB 1TR8A 2LVQD 4ANRA 3SYKA 4X65M 4XK8F 4Z2HA 4LJ7A 3WD3A 1JB0F 1HNXM 2QSFX 1DGGA 4M9SA 1QDRA 4YY3M 1E6PA 2C9OA 4DR7M 1G59A 2V5OA 4NZ4A 2QBYA 1PM5A 1XNQM 1G41A 2XSZA 3DOAA 3TPZA 1DO2A 1H6UA 3RE8A 2EA0A 4LF8M 1YUBA 2CUZA 1C1KA 3SASA 4LF9M 1W1YA 4WW0A 3HHXA 4YHHM 1NY6A 2DAGA 3B7ZA 4LCBA 3SC3A 4BLCA 3M0EA 1QZMA 4CIZA 3L26A 1V33A 1XB2B 4NXMM 2LH0A 1GKIA 1YSYA 4WP2A 1PRBA 4CHTB 2UXDM 2UWXA 3K92A 1XHBA 3PFIA 3J2PB 4L78A 4MB4A 2HCBA 1RU3A 3SAUA 2K9DA 4LF5M 1F4IA 1H0GA 1XXHB 4HL4A 3C58A 4KO8A 3M6AA 1GJSA 1UM8A 5IREB 3VK7A 3TWKA 3TWMA 1SG9A 3TE6A 1OGBA 1IY1A 4AKHA 2RTSA 3HONA 3ZC7B 1TH4A 1NJGA 2DAMA 1BVSA 2ZTCA 3H4JA 1SXJC 2YFQA 2R6FA 4B3MM 1VG5A 2AHMA 4LRSA 5IZ7D 4S12A 1ZV1A 2QNJA 3C3DA 2CV2A 4LJ9A 4AZFA 1CXWA 5EJCA 4AKGA 3SAWA 1L2DA 1R6BX 3VLFB 1E9RA 1OIZA 3HWSA 2RKOA 1DV0A 4OJ5A 3GLIA 4PT5A 3VKHA 1PJIA 2DKLA 3J27B 4NRWA 5LMNM 1Y8GA 3SHGB 1G8PA 3IECA 2FE8A 3OTOM 1L2CA 2LTUA 2UUCM 2Y2JA 3E21A 3W0FA 2BJWA 2C98A 4A3VB 4MGIE 4QNRA 2KXEA 1K3XA 1HQYE 3QAUA 4OUIA 1E88A 1PDCA 3A98B 5FTJA 1NV9A 2Y0QA 1ZAEA 4IIWA 2JXNA 1HQCA 3GLHE 1QYRA 4ZPXA 4LY6A 2XFTA 4X64M 3A46A 2JA2A 4Z8XA 2F4VM 2HL7A 2QZ4A 1J09A 2CP8A 4HLQA 4DR1M 4F1IA 2C5RA 2Y2KA 4G3OA 2ZAOA 4G6ZA 3GRRA 4Z2LA 4F2LA 1QQWA 1PJSA 1IBMM 1Q3CA 1IFYA 2MGWA 2Y0TA 2QCUA 3QYBA 3FYDA 5IT9S 4IBDA 4HMCA 4FD2A 2Y2MA 4IBBA 4XBOA 4KT0F 2ZM6M 2F5OA 3GLGE 1E6NA 4EIWA 1NSFA 2R45A 1VEKA 4MGKE 2R0IA 2JUJA 1V34A 3EIEA 4OVZB 1N32M 3GPPA 3NBXX 3SARA 4HMDA 3U6EA 3SYLA 3FUVA 3GLFA 4MB3A 2QENA 4JXJA 4REZA 3T6PA 8CATA 1H8PA 4GC9A 1Z6TA 3B9PA 4MM3B 5ITRA 4JI1M 2Z4SA 3B74A 4FCWA 4LGYA 1YU4A 2VQFM 2CV1A 3HJ8A 2F5NA 3KFUG 2F5PA 1V92A 4DV1M 2L7IA 4LF6M 4JI4M 4JI5M 4OX9M 2CFOA 2QBYB 4RF1A 1KYIA 3PVSA 1L6JA 3J81S 4G4RA 3K2LA 3W0LB 4X66M 4DR2M 4IBFA 1IN8A 1Q3BA 2FOIC 2JY5A 3L2AA 1Q02A 4IJEA 2D7GA 1DGFA 4MGZE 2HKJA 3MK6A 3THGA 4DV6M 2DWMA 1GL6A 4B3TM 3R8FA 4NZ5A 2P5TA 1O6IA 2KW0A 4KHPM 1GXDA 1NHGC 2BWEA 1TDHA 1L2BA 1UFZA 1E15A 4JI3M 1HNWM 3V76A 2CE7A 2CHQA 3KS8A 3T38A 5FLXS 3U6PA 1K3WA 1DGBA 1WJ7A 3HHWA 3MJ5A 3Q8XA 4NSRA 2VQEM 1G3IA 3R9XB 1OIPA 4GH9A 5BR8M 4FCVA 2OOAA 2BJVA 2DWLA 3FTFA 4II7A 4MB5A 1QAQA 2JY7A 1T3TA 1AUAA 4GMQA 1GLNA 1I4WA 1E9SA 1ZQ9A 2LXEA 1FNNA 3GLHA 4R3DA 1W1PA 3M7PA 1MN3A 4HMEA 1R5LA 2DVWB 4IBKA 3T1HM 2H5XA 5EXPA 2KEBA 1NJFA 2L6OA 2WSFF 1VDDA 1D2NA 1VEGA 2JNHA 4GIPA 3GQ4A 2JE5A 1GPFA 1JR3D 2X49A 2K0BX 4QHSA 3SBJA 4AI6A 1DGHA 5FTMA 1IBLM 4NYYA 1SXJB 3U5ZB 2R4EA 3EIHA 3KS4A 1YU1A 2RGHA 3AFHA 4NY2A 3MQLA 4M0DA 3UK6A 4IBCA 2Y2OA 2KRUA 2EKFA 3AV0A 3U6SA 1W5TA 2FS1A 2DZLA 5E26A 4AG5A 4LF4M 3GLFE 2APLA 4JYAM 1WGNA 4NYUA 3U60B 3GLGA 2V1UA 3AOEA 1KFVA 2LBCA 2MJ5B 4LZZA 3J7BA 3VFDA 3N3FA 1S3SA 2RGOA 2LVOC 1T43A 1JQJC 1IXSA 3FD9A 2GNOA 4KLNA 4LZJA 5JI2E 1HR0M 4JI6M 1D0MA 1IN7A 1VQ1A 2CWBA 4GHLA 1CUKA 3HGIA 1OFIA 3LCVB 3B7QA 2ERCA 1I94M 2KRKA 1KS0A 2DAEA 3J80S 2LVAA 3U6OA 1GOIA 4PDIA 2FFFB 2J7OA 3FUUA 4M0WA 1NNJA 3W68A 3KSXA 3UZUA 1TTEA 1W1VA 4I5SA 2I7PA 5ITQA 3MHVC 4GC5A 1Z5CA 1IY0A 1JR3E 3KOZE 1L8QA 3LMMA 3U6QA 4JN6A 4B3RM 4K0KM 2ZAMA 2Y2PA 4Z2GA 2DHRA 1IXZA 3HJSA 4WURA 3AL0C 2MH8A 2R4JA 2Y20A 2JCHA 3GPUA 3FTDA 3CF6E 4QOZC 2XGNA 4OJ6A 4D82A 1PJJA 3KOYE 2G5GX 3LW5F 2L4FA 4Q7JA 3SATA 4G4QA 4B3SM 4CISA 2EO2A 4KODA 4DR6M 4Y28F 4Z6YA 4OJLA 1XNRM 5ITUA 3I01M 3I4YA 3JR5A 1GABA 2DENA 4NSOB 4Z2JA 2VDBB 3VDPA 1R7RA 4G4NA 3L27A 5DFLA 1NVMA 4QNMA 4LG2A 4QNLA 3PXGA 1E6ZA 4GHAA 3U61B 2DNAA 3I04M 1W1TA 3HX3A 4R7GA 2C96A 3CTWB 2IOUA 5KQDA 4JI8M 3WX7A 1Q39A 3A42A 4DUZM 1IY2A 3WHLA 2C99A 2FH0A 2M5ZA 2L7HA 1Z5BA 4I4LA 3JR4A 2XZFA 1E32A 1XWIA 1QAMA 1D0LA 2Y2IA 1T6OA 5DYIA 3RGPA 5JI3E 2KDLA 5KO3A 3U6LA 5BPVA 2WSCF 2KHHA 2XFSA 4PCZA 1LV7A 3U6MA 4MB7A 1XMOM 4LJ6A 1A5TA 3FTCA 1XMQM 3AKZA 1ZMVA 3VDUA 2D49A 1SXJD 2Y2HA 2QP9X 3FKEA 3K9OA 1OAOC 4NL4H 4DR3M 1WGLA 1QDTA 4FWDA 4UN2B 2EJSA 4B7HA 3HY5A 3PNYA 4LRTA 2G8LA 4LJ8A 3U6CA 1N77A 2F5SA 1YU2A 4LGMA 4D80A 2DAKA 3UGJA 2HAKA 1EAKA 5LMUM 1OFHA 4LJ4A 2JY8A 3GO8A 1QO6A 5EP1A 3HU1A 3NWLA 1YU0A 4NZ1A 1TH3A 1L1TA 2LWXA 3ZQJA 3FRHA 2LHCA 4AG6A 2F5QA 4D81A 3A45A 4Z2IA 3BXWA 4B7FA 4TUWA 1CK7A 2BG1A 3K8ZA 3M7GA 2QQ8A 5ITTA 4PD2A 1HJPA 1JR3A 3GPXA 5ITXA 2KNZA 1XC8A 4JI2M 3MMPA 4JI0M 4FVMA 4B7GA 2R46A 2YQZA 2Q2EB 2X8AA 4BBAA 2CV0A 2BWBA 4AW4A 4X62M 2MR9A 2DXIA 1W5SA 3B7NA 1E94E 1IBKM 3KSJA 3FUWA 2V1CA 3LQQA 3I4VA 3LVVA 5ITYA 3SMPA 5E6JA 2WZJA 4CGYB 4LFAM 3UMMA 3SAVA 2Z3XA 2OOBA 1SXJE 2YNMD 2QPAA 3LQRA 3L25A 2X4AA 1J7MA 2JP7A 4HEOA 3T15A 2K47A 3D8BA 3SFZA 2LVNC 2XD5A 1AIPC 1GJTA 3J7AS 2BNKA 3LCUA 1EE8A 2LNHC 4QOSA 3WD1A 3FUXA 2GQFA 2KZUA 2JY6B 3E9SA 4QHTA 1IN4A 5GKNA 4OJPA 3K1JA 1OJLA 2M60A 4P17A 3GP1A 4IBGA 1G71A 3CF0A 3FYCA 4OVZA 5C1BA 4JV5M 3GPYA 2Y2LA 3AOEC 1XXHE 2R18A 3GLIB 5A2QS 3IG8A 4Z2KA 3WD0A 4DV3M 2OO9A 4DR5M 3K9PA 2OQ4A 3QWLA 4NOOB 3I51A 4P16A 4DV2M 3CGWA 2K6BA 5KQ8A 2EKKA 1IN6A 2LVPC 1NO1A 3KOWE 1IN5A 3KXEC 2DAIA 2OPFA 1QANA 2WSEF 4NC6A 1IXRC 4IJFA 2XH9A 4BB9A 2CHGA 2I7NA 4IBJA 1N75A 3KW6A 2C9CA 1Z5AA 2G3QA 2O25A 4GKKM 1HT1E 1IQPA 4L15A 3HSHA 4FWGA 4L4UA 1MU5A 1R2ZA 2FNAA 1TH2A 2L4EA 4XGIA 5EP3A 5DNYA 1YUEA 2FN2A 1NV8A 3C3EA 4DV5M 2XEPA 4LF7M 4LFBM 4RKUF 3U6DA 5EQTA 4LFCM 4CJ6A 3PNVA 3FTEA 2H1RA 1TF0B 2UU9M 1OGGA 3KP0E 1PJQA 1R4GA 5L8RF 1UR8A 5ITXE 2L09A 3B89A 2D7EA 3Q8GA 2R44A 4AQYM 3L28A 2R65A 1K82A 1YU3A 1L1ZA 3CF2A 4GRIA 2RRUA 1E6RA 5FTNA 2XSZD 4GEWA 2Y2QA 3GLFB 4GITA 3AOGA 3HKPA 5IWAM 5EXXA 3TWLA 5EP2A 1KSFX 3HU2A 1TDZA 1ZMUA 3VKGA 1EFUB 2VIIA 3ZCBB 2KZSA 1D0KA 4ITQA 3KVWA 3WD4A 3F92A 4GKJM 4L16A 1WIVA 5FTLA 1J7KA 3DFZA 1NY5A 1OAIA 2Y21A 3TQSA 1TGUA 1PJTA 1SXJA 3U5ZA 2JWSA 1NNUC 4NZ3A 2Z4RA 5H37D 1YE9A 3VK8A 2NQ8C 1QUSA 3HJQA 3KDSE 1HT2E 4MH0E 4RF0A 2XF3A 1H0IA 1QZEA 3E4RA 4NRVA 1ZMWA 2R62A 2MROB 4OU7A 2UUAM 1G4AE 1NHWC 2CRUA 5FTKA 3U60A 1X37A 4W5WA 1WHCA 2ZBKB 1WXQA 2B3TA 3KOXE 3SHFA 4DBGB 2Z7JA 4DUYM 1WR1B 1XXHA 5EXTA 1ED7A 1N78A 3IG5A 4R71A 3GRYA 1IM2A 3DA1A 3JAMS 4L8RC 5EP4A 5KPZA 2A5YB 2JZ0A 2EUCA 4RNAA 1DO0A 4FW9A 2N35A 3T1YM 3WHKA 1VEJA 2CEAA 2QHOB 4I81A 2HHHM 4JI7M 1E8BA 1PGYA 2FFJA 3FRIA 2DHYA 3KP1E 4OW0A 1R2YA 7CATA 3D8LA 3ZH9B 1OTRA 2J7NA 2VF8A 2ZTDA 1QUTA 3GRUA 4MGYE 3GLHB 3UJNA 3QYEA 2KNVA 3FE3A 1AIWA 2E5LM 5DYGA 4AKIA 5FSWA 4DV7M 3W67A 5F3WA 4MGHA 2J5YA 1DGHB 4M9ZA 2VF7A 2DZOB 1GO5A 1VDLA 1YLAA 3LVWA 1ORYB 1QVRA 2DZNB 2V6ZM 2KA6B 3IHPA 4B08A 3TL4X 4PDGA 2Y2GA 2D7HA 4LJAA 3E46A 3HZJA 2YR0A 2LHGA 1UR9A 2JZ1A 2Z8YM 3HHYA 2O01F 3AJIB 1MX0A 3GLGB 2XZUA 2UUBM 1P3QQ 3GRVA 3L29A 1N34M 1EIJA 5EXSA 1MJGM 1C7YA 4IBIA 2ZANA 3HU3A 3BBZA 1HNZM 2XLJA 1Z59A 2W82A 4I8OA 4FWHA 1IXSB 3GQ3A 1N36M 4DR4M 1OQYA 3FUTA 2UXBM 1OKSA 3RFWA 1GL7A 1LTMA 3C9PA 3HHZA
chains in the Genus database with same CATH topology
4DV4M 3U61A 3H4MA 3BOSA 4FCTA 5C18A 4DV0M 4NXNM 3NBIA 2CHVA 1GVNA 4G4OA 2DWNA 3SMSA 3ILKA 2Y2NA 1FJGM 3GQ5A 1QAOA 4OJOA 3DZDA 2UXCM 5KPTA 2O5RA 4LJ5A 1J5EM 1N33M 4IBEA 4M9XA 5KPRA 2XD1A 3RGSA 2DWZB 4X65M 3SYKA 4LJ7A 1HNXM 1DGGA 4M9SA 4YY3M 2C9OA 4DR7M 1G59A 4NZ4A 2QBYA 1PM5A 1XNQM 1G41A 2XSZA 3DOAA 3TPZA 1DO2A 1H6UA 3RE8A 2EA0A 4LF8M 1YUBA 2CUZA 1C1KA 3SASA 4LF9M 4WW0A 3HHXA 4YHHM 1NY6A 4LCBA 3SC3A 4BLCA 3M0EA 1QZMA 3L26A 4NXMM 2LH0A 1GKIA 1YSYA 4CHTB 2UXDM 2UWXA 3K92A 1XHBA 3PFIA 3J2PB 4L78A 2HCBA 3SAUA 4LF5M 1XXHB 4HL4A 3C58A 4KO8A 3M6AA 1UM8A 5IREB 3VK7A 3TWKA 3TWMA 3TE6A 1IY1A 4AKHA 3HONA 3ZC7B 1TH4A 1NJGA 1SXJC 2YFQA 4B3MM 2AHMA 4LRSA 5IZ7D 4S12A 2CV2A 4LJ9A 4AZFA 5EJCA 4AKGA 3SAWA 1L2DA 1R6BX 3VLFB 1E9RA 3HWSA 2RKOA 4OJ5A 3GLIA 4PT5A 3VKHA 1PJIA 3J27B 4NRWA 5LMNM 3SHGB 1G8PA 2FE8A 3OTOM 1L2CA 2Y2JA 2UUCM 3W0FA 2BJWA 2C98A 4A3VB 4MGIE 4QNRA 2KXEA 1K3XA 1HQYE 3QAUA 4OUIA 3A98B 5FTJA 2Y0QA 1ZAEA 4IIWA 3A46A 1HQCA 1QYRA 4ZPXA 4LY6A 2XFTA 4X64M 2JA2A 4Z8XA 2F4VM 2HL7A 2QZ4A 1J09A 4HLQA 2Y2KA 2C5RA 2ZAOA 4G6ZA 3GRRA 1QQWA 1IBMM 1Q3CA 2Y0TA 2QCUA 3FYDA 5IT9S 4IBDA 4FD2A 2Y2MA 4IBBA 4XBOA 2ZM6M 2F5OA 4EIWA 1NSFA 2R45A 4MGKE 3EIEA 4OVZB 1N32M 3GPPA 3SARA 3U6EA 3SYLA 3FUVA 3GLFA 2QENA 4JXJA 4REZA 8CATA 4GC9A 1Z6TA 3B9PA 4MM3B 5ITRA 4JI1M 2Z4SA 4FCWA 4LGYA 1YU4A 2VQFM 2CV1A 3HJ8A 2F5NA 3KFUG 2F5PA 4DV1M 2L7IA 4LF6M 4JI4M 4JI5M 4OX9M 2CFOA 2QBYB 4RF1A 1KYIA 3PVSA 3J81S 4G4RA 3K2LA 3W0LB 4DR2M 4IBFA 1IN8A 1Q3BA 2FOIC 3L2AA 4IJEA 2D7GA 1DGFA 4MGZE 2HKJA 3MK6A 3THGA 4DV6M 2DWMA 1GL6A 4B3TM 3R8FA 4NZ5A 2P5TA 2KW0A 4KHPM 1NHGC 1L2BA 1TDHA 4JI3M 1HNWM 2CE7A 2CHQA 3KS8A 3T38A 5FLXS 3U6PA 1K3WA 1DGBA 3MJ5A 3HHWA 2VQEM 3Q8XA 4NSRA 1G3IA 3R9XB 3FTFA 4GH9A 5BR8M 4FCVA 2DWLA 2BJVA 4II7A 1QAQA 1T3TA 4GMQA 1GLNA 1I4WA 1E9SA 1ZQ9A 2LXEA 1FNNA 3GLHA 4R3DA 3T1HM 2DVWB 4IBKA 5EXPA 2KEBA 1NJFA 2L6OA 4GIPA 1VDDA 1D2NA 4X66M 3GQ4A 2JE5A 1JR3D 2X49A 3SBJA 4QHSA 4AI6A 1DGHA 5FTMA 1IBLM 4NYYA 1SXJB 3U5ZB 2R4EA 3EIHA 3KS4A 1YU1A 2RGHA 3AFHA 4NY2A 4M0DA 3UK6A 4IBCA 2Y2OA 2KRUA 3AV0A 3U6SA 1W5TA 5E26A 4AG5A 4LF4M 4JYAM 4NYUA 3U60B 3GLGA 2V1UA 3AOEA 1KFVA 4LZZA 3J7BA 3VFDA 3N3FA 1S3SA 2RGOA 5JI2E 1JQJC 3FD9A 4KLNA 4LZJA 1HR0M 4JI6M 1IN7A 4GHLA 3HGIA 1OFIA 2ERCA 1I94M 2KRKA 3J80S 3U6OA 2FFFB 4PDIA 2J7OA 3FUUA 4M0WA 1NNJA 3KSXA 3UZUA 4I5SA 2I7PA 5ITQA 3MHVC 4GC5A 1Z5CA 1IY0A 3KOZE 3LMMA 1L8QA 3U6QA 4K0KM 4JN6A 4B3RM 2Y2PA 2ZAMA 2DHRA 1IXZA 3HJSA 4WURA 3AL0C 2Y20A 2R4JA 2JCHA 3GPUA 3FTDA 3CF6E 4QOZC 2XGNA 4OJ6A 4D82A 1PJJA 3KOYE 2G5GX 3SATA 4G4QA 4B3SM 4CISA 2EO2A 4KODA 4DR6M 4Z6YA 4OJLA 1XNRM 5ITUA 3I4YA 3JR5A 4NSOB 3VDPA 1R7RA 4G4NA 3L27A 4QNLA 1NVMA 4QNMA 4LG2A 3PXGA 4GHAA 3U61B 4R7GA 2C96A 3CTWB 2IOUA 5KQDA 4JI8M 3WX7A 1Q39A 3A42A 4DUZM 1IY2A 3WHLA 2C99A 2L7HA 2M5ZA 4I4LA 1Z5BA 3JR4A 2XZFA 1E32A 1XWIA 1QAMA 2Y2IA 5DYIA 3RGPA 5JI3E 5KO3A 3U6LA 5BPVA 2XFSA 4PCZA 1LV7A 3U6MA 4MB7A 1XMOM 4LJ6A 3FTCA 1XMQM 3AKZA 3VDUA 1SXJD 2Y2HA 2QP9X 3FKEA 4NL4H 4DR3M 4FWDA 4B7HA 3PNYA 1N77A 4LRTA 2G8LA 4LJ8A 3U6CA 2F5SA 1YU2A 4LGMA 4D80A 3UGJA 5LMUM 1OFHA 4LJ4A 1YU0A 3GO8A 5EP1A 3HU1A 3NWLA 4NZ1A 1TH3A 1L1TA 2LWXA 4AG6A 2F5QA 4D81A 3A45A 4B7FA 4TUWA 2BG1A 3K8ZA 3M7GA 5ITTA 4PD2A 1JR3A 3GPXA 1XC8A 5ITXA 4JI2M 4JI0M 4FVMA 4B7GA 2R46A 2YQZA 2Q2EB 2X8AA 4BBAA 2CV0A 4AW4A 4X62M 2DXIA 1W5SA 1E94E 1IBKM 3KSJA 3FUWA 2V1CA 3LQQA 3I4VA 3LVVA 5ITYA 3SMPA 5E6JA 4CGYB 4LFAM 3UMMA 3SAVA 2Z3XA 3LQRA 1SXJE 2YNMD 2QPAA 3L25A 2X4AA 3T15A 2K47A 3D8BA 3SFZA 2XD5A 3J7AS 2BNKA 1EE8A 2LNHC 4QOSA 3FUXA 2KZUA 3E9SA 4QHTA 1IN4A 5GKNA 4OJPA 3K1JA 1OJLA 2M60A 3GP1A 4IBGA 3CF0A 3FYCA 4OVZA 5C1BA 4JV5M 2Y2LA 3GPYA 3AOEC 3GLIB 2R18A 5A2QS 3IG8A 4DV3M 4DR5M 2OQ4A 3QWLA 4NOOB 3I51A 4P16A 4DV2M 5KQ8A 1IN6A 3KOWE 1IN5A 3KXEC 2OPFA 1QANA 1IXRC 4IJFA 2XH9A 4BB9A 2CHGA 2I7NA 4IBJA 1N75A 3KW6A 2C9CA 1Z5AA 4GKKM 1HT1E 1IQPA 4L15A 3HSHA 4FWGA 4L4UA 1MU5A 1R2ZA 2FNAA 1TH2A 4XGIA 5DNYA 5EP3A 1YUEA 4DV5M 2XEPA 4LF7M 4LFBM 3U6DA 5EQTA 4LFCM 3PNVA 3FTEA 2H1RA 2UU9M 3KP0E 5ITXE 2L09A 4AQYM 2D7EA 1K82A 3L28A 2R65A 1YU3A 1L1ZA 3CF2A 4GRIA 5FTNA 2XSZD 2Y2QA 3GLFB 4GITA 3AOGA 3HKPA 5IWAM 5EXXA 3TWLA 5EP2A 1KSFX 3HU2A 1TDZA 3VKGA 2VIIA 3ZCBB 2KZSA 4ITQA 3KVWA 4GKJM 4L16A 5FTLA 1J7KA 3DFZA 1NY5A 3TQSA 2Y21A 1TGUA 1SXJA 3U5ZA 1NNUC 4NZ3A 2Z4RA 5H37D 1YE9A 3VK8A 2NQ8C 3HJQA 3KDSE 1HT2E 4MH0E 4RF0A 2XF3A 3E4RA 4NRVA 4OU7A 2R62A 2UUAM 1G4AE 1NHWC 5FTKA 3U60A 1X37A 4W5WA 2ZBKB 1WXQA 3KOXE 3SHFA 4DUYM 2Z7JA 1XXHA 5EXTA 1N78A 3IG5A 3GRYA 1IM2A 3DA1A 3JAMS 4L8RC 5EP4A 5KPZA 2A5YB 2EUCA 4RNAA 1DO0A 4FW9A 3T1YM 3WHKA 2CEAA 2HHHM 4JI7M 4I81A 2FFJA 4OW0A 3KP1E 1R2YA 7CATA 3D8LA 3ZH9B 2J7NA 4DR1M 3GRUA 4MGYE 3GLHB 3UJNA 2E5LM 5DYGA 4AKIA 5FSWA 4DV7M 5F3WA 4MGHA 1DGHB 4M9ZA 2DZOB 3LVWA 1ORYB 1QVRA 2DZNB 2V6ZM 2KA6B 4B08A 3TL4X 4PDGA 2Y2GA 2D7HA 4LJAA 2YR0A 3HHYA 3AJIB 1MX0A 3GLGB 2XZUA 2UUBM 3GRVA 3L29A 1N34M 5EXSA 4IBIA 2ZANA 3HU3A 1HNZM 2XLJA 1Z59A 2W82A 4I8OA 4FWHA 1IXSB 3GQ3A 1N36M 4DR4M 3FUTA 2UXBM 3RFWA 1GL7A 3HHZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IBB A;  3L2A A;  4IBJ A;  4IJE A;  4IBK A;  4GHL A;  5BPV A;  4IBG A;  3KS4 A;  3L26 A;  4IBC A;  3L29 A;  3FKE A;  3L27 A;  3KS8 A;  4LG2 A;  4IBE A;  4GHA A;  4IBI A;  4GH9 A;  3L28 A;  3L25 A;  4IBF A;  4IBD A;  4IJF A; 
#chains in the Genus database with same CATH topology
 4DV4 M;  3U61 A;  3H4M A;  3BOS A;  4FCT A;  5C18 A;  3GLI E;  4DV0 M;  2DI0 A;  4NXN M;  3NBI A;  2CHV A;  1GVN A;  2L2D A;  4G4O A;  2DWN A;  3SMS A;  3ILK A;  2Y2N A;  1FJG M;  3WD2 A;  3GQ5 A;  4TX8 A;  1QAO A;  4OJO A;  3DZD A;  2UXC M;  2KNA A;  5KPT A;  4L6V 6;  2O5R A;  4LJ5 A;  1J5E M;  1N33 M;  2HWJ A;  4IBE A;  4M9X A;  5KPR A;  2XD1 A;  3RGS A;  2DWZ B;  1TR8 A;  2LVQ D;  4ANR A;  3SYK A;  4X65 M;  4XK8 F;  4Z2H A;  4LJ7 A;  3WD3 A;  1JB0 F;  1HNX M;  2QSF X;  1DGG A;  4M9S A;  1QDR A;  4YY3 M;  1E6P A;  2C9O A;  4DR7 M;  1G59 A;  2V5O A;  4NZ4 A;  2QBY A;  1PM5 A;  1XNQ M;  1G41 A;  2XSZ A;  3DOA A;  3TPZ A;  1DO2 A;  1H6U A;  3RE8 A;  2EA0 A;  4LF8 M;  1YUB A;  2CUZ A;  1C1K A;  3SAS A;  4LF9 M;  1W1Y A;  4WW0 A;  3HHX A;  4YHH M;  1NY6 A;  2DAG A;  3B7Z A;  4LCB A;  3SC3 A;  4BLC A;  3M0E A;  1QZM A;  4CIZ A;  3L26 A;  1V33 A;  1XB2 B;  4NXM M;  2LH0 A;  1GKI A;  1YSY A;  4WP2 A;  1PRB A;  4CHT B;  2UXD M;  2UWX A;  3K92 A;  1XHB A;  3PFI A;  3J2P B;  4L78 A;  4MB4 A;  2HCB A;  1RU3 A;  3SAU A;  2K9D A;  4LF5 M;  1F4I A;  1H0G A;  1XXH B;  4HL4 A;  3C58 A;  4KO8 A;  3M6A A;  1GJS A;  1UM8 A;  5IRE B;  3VK7 A;  3TWK A;  3TWM A;  1SG9 A;  3TE6 A;  1OGB A;  1IY1 A;  4AKH A;  2RTS A;  3HON A;  3ZC7 B;  1TH4 A;  1NJG A;  2DAM A;  1BVS A;  2ZTC A;  3H4J A;  1SXJ C;  2YFQ A;  2R6F A;  4B3M M;  1VG5 A;  2AHM A;  4LRS A;  5IZ7 D;  4S12 A;  1ZV1 A;  2QNJ A;  3C3D A;  2CV2 A;  4LJ9 A;  4AZF A;  1CXW A;  5EJC A;  4AKG A;  3SAW A;  1L2D A;  1R6B X;  3VLF B;  1E9R A;  1OIZ A;  3HWS A;  2RKO A;  1DV0 A;  4OJ5 A;  3GLI A;  4PT5 A;  3VKH A;  1PJI A;  2DKL A;  3J27 B;  4NRW A;  5LMN M;  1Y8G A;  3SHG B;  1G8P A;  3IEC A;  2FE8 A;  3OTO M;  1L2C A;  2LTU A;  2UUC M;  2Y2J A;  3E21 A;  3W0F A;  2BJW A;  2C98 A;  4A3V B;  4MGI E;  4QNR A;  2KXE A;  1K3X A;  1HQY E;  3QAU A;  4OUI A;  1E88 A;  1PDC A;  3A98 B;  5FTJ A;  1NV9 A;  2Y0Q A;  1ZAE A;  4IIW A;  2JXN A;  1HQC A;  3GLH E;  1QYR A;  4ZPX A;  4LY6 A;  2XFT A;  4X64 M;  3A46 A;  2JA2 A;  4Z8X A;  2F4V M;  2HL7 A;  2QZ4 A;  1J09 A;  2CP8 A;  4HLQ A;  4DR1 M;  4F1I A;  2C5R A;  2Y2K A;  4G3O A;  2ZAO A;  4G6Z A;  3GRR A;  4Z2L A;  4F2L A;  1QQW A;  1PJS A;  1IBM M;  1Q3C A;  1IFY A;  2MGW A;  2Y0T A;  2QCU A;  3QYB A;  3FYD A;  5IT9 S;  4IBD A;  4HMC A;  4FD2 A;  2Y2M A;  4IBB A;  4XBO A;  4KT0 F;  2ZM6 M;  2F5O A;  3GLG E;  1E6N A;  4EIW A;  1NSF A;  2R45 A;  1VEK A;  4MGK E;  2R0I A;  2JUJ A;  1V34 A;  3EIE A;  4OVZ B;  1N32 M;  3GPP A;  3NBX X;  3SAR A;  4HMD A;  3U6E A;  3SYL A;  3FUV A;  3GLF A;  4MB3 A;  2QEN A;  4JXJ A;  4REZ A;  3T6P A;  8CAT A;  1H8P A;  4GC9 A;  1Z6T A;  3B9P A;  4MM3 B;  5ITR A;  4JI1 M;  2Z4S A;  3B74 A;  4FCW A;  4LGY A;  1YU4 A;  2VQF M;  2CV1 A;  3HJ8 A;  2F5N A;  3KFU G;  2F5P A;  1V92 A;  4DV1 M;  2L7I A;  4LF6 M;  4JI4 M;  4JI5 M;  4OX9 M;  2CFO A;  2QBY B;  4RF1 A;  1KYI A;  3PVS A;  1L6J A;  3J81 S;  4G4R A;  3K2L A;  3W0L B;  4X66 M;  4DR2 M;  4IBF A;  1IN8 A;  1Q3B A;  2FOI C;  2JY5 A;  3L2A A;  1Q02 A;  4IJE A;  2D7G A;  1DGF A;  4MGZ E;  2HKJ A;  3MK6 A;  3THG A;  4DV6 M;  2DWM A;  1GL6 A;  4B3T M;  3R8F A;  4NZ5 A;  2P5T A;  1O6I A;  2KW0 A;  4KHP M;  1GXD A;  1NHG C;  2BWE A;  1TDH A;  1L2B A;  1UFZ A;  1E15 A;  4JI3 M;  1HNW M;  3V76 A;  2CE7 A;  2CHQ A;  3KS8 A;  3T38 A;  5FLX S;  3U6P A;  1K3W A;  1DGB A;  1WJ7 A;  3HHW A;  3MJ5 A;  3Q8X A;  4NSR A;  2VQE M;  1G3I A;  3R9X B;  1OIP A;  4GH9 A;  5BR8 M;  4FCV A;  2OOA A;  2BJV A;  2DWL A;  3FTF A;  4II7 A;  4MB5 A;  1QAQ A;  2JY7 A;  1T3T A;  1AUA A;  4GMQ A;  1GLN A;  1I4W A;  1E9S A;  1ZQ9 A;  2LXE A;  1FNN A;  3GLH A;  4R3D A;  1W1P A;  3M7P A;  1MN3 A;  4HME A;  1R5L A;  2DVW B;  4IBK A;  3T1H M;  2H5X A;  5EXP A;  2KEB A;  1NJF A;  2L6O A;  2WSF F;  1VDD A;  1D2N A;  1VEG A;  2JNH A;  4GIP A;  3GQ4 A;  2JE5 A;  1GPF A;  1JR3 D;  2X49 A;  2K0B X;  4QHS A;  3SBJ A;  4AI6 A;  1DGH A;  5FTM A;  1IBL M;  4NYY A;  1SXJ B;  3U5Z B;  2R4E A;  3EIH A;  3KS4 A;  1YU1 A;  2RGH A;  3AFH A;  4NY2 A;  3MQL A;  4M0D A;  3UK6 A;  4IBC A;  2Y2O A;  2KRU A;  2EKF A;  3AV0 A;  3U6S A;  1W5T A;  2FS1 A;  2DZL A;  5E26 A;  4AG5 A;  4LF4 M;  3GLF E;  2APL A;  4JYA M;  1WGN A;  4NYU A;  3U60 B;  3GLG A;  2V1U A;  3AOE A;  1KFV A;  2LBC A;  2MJ5 B;  4LZZ A;  3J7B A;  3VFD A;  3N3F A;  1S3S A;  2RGO A;  2LVO C;  1T43 A;  1JQJ C;  1IXS A;  3FD9 A;  2GNO A;  4KLN A;  4LZJ A;  5JI2 E;  1HR0 M;  4JI6 M;  1D0M A;  1IN7 A;  1VQ1 A;  2CWB A;  4GHL A;  1CUK A;  3HGI A;  1OFI A;  3LCV B;  3B7Q A;  2ERC A;  1I94 M;  2KRK A;  1KS0 A;  2DAE A;  3J80 S;  2LVA A;  3U6O A;  1GOI A;  4PDI A;  2FFF B;  2J7O A;  3FUU A;  4M0W A;  1NNJ A;  3W68 A;  3KSX A;  3UZU A;  1TTE A;  1W1V A;  4I5S A;  2I7P A;  5ITQ A;  3MHV C;  4GC5 A;  1Z5C A;  1IY0 A;  1JR3 E;  3KOZ E;  1L8Q A;  3LMM A;  3U6Q A;  4JN6 A;  4B3R M;  4K0K M;  2ZAM A;  2Y2P A;  4Z2G A;  2DHR A;  1IXZ A;  3HJS A;  4WUR A;  3AL0 C;  2MH8 A;  2R4J A;  2Y20 A;  2JCH A;  3GPU A;  3FTD A;  3CF6 E;  4QOZ C;  2XGN A;  4OJ6 A;  4D82 A;  1PJJ A;  3KOY E;  2G5G X;  3LW5 F;  2L4F A;  4Q7J A;  3SAT A;  4G4Q A;  4B3S M;  4CIS A;  2EO2 A;  4KOD A;  4DR6 M;  4Y28 F;  4Z6Y A;  4OJL A;  1XNR M;  5ITU A;  3I01 M;  3I4Y A;  3JR5 A;  1GAB A;  2DEN A;  4NSO B;  4Z2J A;  2VDB B;  3VDP A;  1R7R A;  4G4N A;  3L27 A;  5DFL A;  1NVM A;  4QNM A;  4LG2 A;  4QNL A;  3PXG A;  1E6Z A;  4GHA A;  3U61 B;  2DNA A;  3I04 M;  1W1T A;  3HX3 A;  4R7G A;  2C96 A;  3CTW B;  2IOU A;  5KQD A;  4JI8 M;  3WX7 A;  1Q39 A;  3A42 A;  4DUZ M;  1IY2 A;  3WHL A;  2C99 A;  2FH0 A;  2M5Z A;  2L7H A;  1Z5B A;  4I4L A;  3JR4 A;  2XZF A;  1E32 A;  1XWI A;  1QAM A;  1D0L A;  2Y2I A;  1T6O A;  5DYI A;  3RGP A;  5JI3 E;  2KDL A;  5KO3 A;  3U6L A;  5BPV A;  2WSC F;  2KHH A;  2XFS A;  4PCZ A;  1LV7 A;  3U6M A;  4MB7 A;  1XMO M;  4LJ6 A;  1A5T A;  3FTC A;  1XMQ M;  3AKZ A;  1ZMV A;  3VDU A;  2D49 A;  1SXJ D;  2Y2H A;  2QP9 X;  3FKE A;  3K9O A;  1OAO C;  4NL4 H;  4DR3 M;  1WGL A;  1QDT A;  4FWD A;  4UN2 B;  2EJS A;  4B7H A;  3HY5 A;  3PNY A;  4LRT A;  2G8L A;  4LJ8 A;  3U6C A;  1N77 A;  2F5S A;  1YU2 A;  4LGM A;  4D80 A;  2DAK A;  3UGJ A;  2HAK A;  1EAK A;  5LMU M;  1OFH A;  4LJ4 A;  2JY8 A;  3GO8 A;  1QO6 A;  5EP1 A;  3HU1 A;  3NWL A;  1YU0 A;  4NZ1 A;  1TH3 A;  1L1T A;  2LWX A;  3ZQJ A;  3FRH A;  2LHC A;  4AG6 A;  2F5Q A;  4D81 A;  3A45 A;  4Z2I A;  3BXW A;  4B7F A;  4TUW A;  1CK7 A;  2BG1 A;  3K8Z A;  3M7G A;  2QQ8 A;  5ITT A;  4PD2 A;  1HJP A;  1JR3 A;  3GPX A;  5ITX A;  2KNZ A;  1XC8 A;  4JI2 M;  3MMP A;  4JI0 M;  4FVM A;  4B7G A;  2R46 A;  2YQZ A;  2Q2E B;  2X8A A;  4BBA A;  2CV0 A;  2BWB A;  4AW4 A;  4X62 M;  2MR9 A;  2DXI A;  1W5S A;  3B7N A;  1E94 E;  1IBK M;  3KSJ A;  3FUW A;  2V1C A;  3LQQ A;  3I4V A;  3LVV A;  5ITY A;  3SMP A;  5E6J A;  2WZJ A;  4CGY B;  4LFA M;  3UMM A;  3SAV A;  2Z3X A;  2OOB A;  1SXJ E;  2YNM D;  2QPA A;  3LQR A;  3L25 A;  2X4A A;  1J7M A;  2JP7 A;  4HEO A;  3T15 A;  2K47 A;  3D8B A;  3SFZ A;  2LVN C;  2XD5 A;  1AIP C;  1GJT A;  3J7A S;  2BNK A;  3LCU A;  1EE8 A;  2LNH C;  4QOS A;  3WD1 A;  3FUX A;  2GQF A;  2KZU A;  2JY6 B;  3E9S A;  4QHT A;  1IN4 A;  5GKN A;  4OJP A;  3K1J A;  1OJL A;  2M60 A;  4P17 A;  3GP1 A;  4IBG A;  1G71 A;  3CF0 A;  3FYC A;  4OVZ A;  5C1B A;  4JV5 M;  3GPY A;  2Y2L A;  3AOE C;  1XXH E;  2R18 A;  3GLI B;  5A2Q S;  3IG8 A;  4Z2K A;  3WD0 A;  4DV3 M;  2OO9 A;  4DR5 M;  3K9P A;  2OQ4 A;  3QWL A;  4NOO B;  3I51 A;  4P16 A;  4DV2 M;  3CGW A;  2K6B A;  5KQ8 A;  2EKK A;  1IN6 A;  2LVP C;  1NO1 A;  3KOW E;  1IN5 A;  3KXE C;  2DAI A;  2OPF A;  1QAN A;  2WSE F;  4NC6 A;  1IXR C;  4IJF A;  2XH9 A;  4BB9 A;  2CHG A;  2I7N A;  4IBJ A;  1N75 A;  3KW6 A;  2C9C A;  1Z5A A;  2G3Q A;  2O25 A;  4GKK M;  1HT1 E;  1IQP A;  4L15 A;  3HSH A;  4FWG A;  4L4U A;  1MU5 A;  1R2Z A;  2FNA A;  1TH2 A;  2L4E A;  4XGI A;  5EP3 A;  5DNY A;  1YUE A;  2FN2 A;  1NV8 A;  3C3E A;  4DV5 M;  2XEP A;  4LF7 M;  4LFB M;  4RKU F;  3U6D A;  5EQT A;  4LFC M;  4CJ6 A;  3PNV A;  3FTE A;  2H1R A;  1TF0 B;  2UU9 M;  1OGG A;  3KP0 E;  1PJQ A;  1R4G A;  5L8R F;  1UR8 A;  5ITX E;  2L09 A;  3B89 A;  2D7E A;  3Q8G A;  2R44 A;  4AQY M;  3L28 A;  2R65 A;  1K82 A;  1YU3 A;  1L1Z A;  3CF2 A;  4GRI A;  2RRU A;  1E6R A;  5FTN A;  2XSZ D;  4GEW A;  2Y2Q A;  3GLF B;  4GIT A;  3AOG A;  3HKP A;  5IWA M;  5EXX A;  3TWL A;  5EP2 A;  1KSF X;  3HU2 A;  1TDZ A;  1ZMU A;  3VKG A;  1EFU B;  2VII A;  3ZCB B;  2KZS A;  1D0K A;  4ITQ A;  3KVW A;  3WD4 A;  3F92 A;  4GKJ M;  4L16 A;  1WIV A;  5FTL A;  1J7K A;  3DFZ A;  1NY5 A;  1OAI A;  2Y21 A;  3TQS A;  1TGU A;  1PJT A;  1SXJ A;  3U5Z A;  2JWS A;  1NNU C;  4NZ3 A;  2Z4R A;  5H37 D;  1YE9 A;  3VK8 A;  2NQ8 C;  1QUS A;  3HJQ A;  3KDS E;  1HT2 E;  4MH0 E;  4RF0 A;  2XF3 A;  1H0I A;  1QZE A;  3E4R A;  4NRV A;  1ZMW A;  2R62 A;  2MRO B;  4OU7 A;  2UUA M;  1G4A E;  1NHW C;  2CRU A;  5FTK A;  3U60 A;  1X37 A;  4W5W A;  1WHC A;  2ZBK B;  1WXQ A;  2B3T A;  3KOX E;  3SHF A;  4DBG B;  2Z7J A;  4DUY M;  1WR1 B;  1XXH A;  5EXT A;  1ED7 A;  1N78 A;  3IG5 A;  4R71 A;  3GRY A;  1IM2 A;  3DA1 A;  3JAM S;  4L8R C;  5EP4 A;  5KPZ A;  2A5Y B;  2JZ0 A;  2EUC A;  4RNA A;  1DO0 A;  4FW9 A;  2N35 A;  3T1Y M;  3WHK A;  1VEJ A;  2CEA A;  2QHO B;  4I81 A;  2HHH M;  4JI7 M;  1E8B A;  1PGY A;  2FFJ A;  3FRI A;  2DHY A;  3KP1 E;  4OW0 A;  1R2Y A;  7CAT A;  3D8L A;  3ZH9 B;  1OTR A;  2J7N A;  2VF8 A;  2ZTD A;  1QUT A;  3GRU A;  4MGY E;  3GLH B;  3UJN A;  3QYE A;  2KNV A;  3FE3 A;  1AIW A;  2E5L M;  5DYG A;  4AKI A;  5FSW A;  4DV7 M;  3W67 A;  5F3W A;  4MGH A;  2J5Y A;  1DGH B;  4M9Z A;  2VF7 A;  2DZO B;  1GO5 A;  1VDL A;  1YLA A;  3LVW A;  1ORY B;  1QVR A;  2DZN B;  2V6Z M;  2KA6 B;  3IHP A;  4B08 A;  3TL4 X;  4PDG A;  2Y2G A;  2D7H A;  4LJA A;  3E46 A;  3HZJ A;  2YR0 A;  2LHG A;  1UR9 A;  2JZ1 A;  2Z8Y M;  3HHY A;  2O01 F;  3AJI B;  1MX0 A;  3GLG B;  2XZU A;  2UUB M;  1P3Q Q;  3GRV A;  3L29 A;  1N34 M;  1EIJ A;  5EXS A;  1MJG M;  1C7Y A;  4IBI A;  2ZAN A;  3HU3 A;  3BBZ A;  1HNZ M;  2XLJ A;  1Z59 A;  2W82 A;  4I8O A;  4FWH A;  1IXS B;  3GQ3 A;  1N36 M;  4DR4 M;  1OQY A;  3FUT A;  2UXB M;  1OKS A;  3RFW A;  1GL7 A;  1LTM A;  3C9P A;  3HHZ A; 
#chains in the Genus database with same CATH homology
 4DV4 M;  3U61 A;  3H4M A;  3BOS A;  4FCT A;  5C18 A;  4DV0 M;  4NXN M;  3NBI A;  2CHV A;  1GVN A;  4G4O A;  2DWN A;  3SMS A;  3ILK A;  2Y2N A;  1FJG M;  3GQ5 A;  1QAO A;  4OJO A;  3DZD A;  2UXC M;  5KPT A;  2O5R A;  4LJ5 A;  1J5E M;  1N33 M;  4IBE A;  4M9X A;  5KPR A;  2XD1 A;  3RGS A;  2DWZ B;  4X65 M;  3SYK A;  4LJ7 A;  1HNX M;  1DGG A;  4M9S A;  4YY3 M;  2C9O A;  4DR7 M;  1G59 A;  4NZ4 A;  2QBY A;  1PM5 A;  1XNQ M;  1G41 A;  2XSZ A;  3DOA A;  3TPZ A;  1DO2 A;  1H6U A;  3RE8 A;  2EA0 A;  4LF8 M;  1YUB A;  2CUZ A;  1C1K A;  3SAS A;  4LF9 M;  4WW0 A;  3HHX A;  4YHH M;  1NY6 A;  4LCB A;  3SC3 A;  4BLC A;  3M0E A;  1QZM A;  3L26 A;  4NXM M;  2LH0 A;  1GKI A;  1YSY A;  4CHT B;  2UXD M;  2UWX A;  3K92 A;  1XHB A;  3PFI A;  3J2P B;  4L78 A;  2HCB A;  3SAU A;  4LF5 M;  1XXH B;  4HL4 A;  3C58 A;  4KO8 A;  3M6A A;  1UM8 A;  5IRE B;  3VK7 A;  3TWK A;  3TWM A;  3TE6 A;  1IY1 A;  4AKH A;  3HON A;  3ZC7 B;  1TH4 A;  1NJG A;  1SXJ C;  2YFQ A;  4B3M M;  2AHM A;  4LRS A;  5IZ7 D;  4S12 A;  2CV2 A;  4LJ9 A;  4AZF A;  5EJC A;  4AKG A;  3SAW A;  1L2D A;  1R6B X;  3VLF B;  1E9R A;  3HWS A;  2RKO A;  4OJ5 A;  3GLI A;  4PT5 A;  3VKH A;  1PJI A;  3J27 B;  4NRW A;  5LMN M;  3SHG B;  1G8P A;  2FE8 A;  3OTO M;  1L2C A;  2Y2J A;  2UUC M;  3W0F A;  2BJW A;  2C98 A;  4A3V B;  4MGI E;  4QNR A;  2KXE A;  1K3X A;  1HQY E;  3QAU A;  4OUI A;  3A98 B;  5FTJ A;  2Y0Q A;  1ZAE A;  4IIW A;  3A46 A;  1HQC A;  1QYR A;  4ZPX A;  4LY6 A;  2XFT A;  4X64 M;  2JA2 A;  4Z8X A;  2F4V M;  2HL7 A;  2QZ4 A;  1J09 A;  4HLQ A;  2Y2K A;  2C5R A;  2ZAO A;  4G6Z A;  3GRR A;  1QQW A;  1IBM M;  1Q3C A;  2Y0T A;  2QCU A;  3FYD A;  5IT9 S;  4IBD A;  4FD2 A;  2Y2M A;  4IBB A;  4XBO A;  2ZM6 M;  2F5O A;  4EIW A;  1NSF A;  2R45 A;  4MGK E;  3EIE A;  4OVZ B;  1N32 M;  3GPP A;  3SAR A;  3U6E A;  3SYL A;  3FUV A;  3GLF A;  2QEN A;  4JXJ A;  4REZ A;  8CAT A;  4GC9 A;  1Z6T A;  3B9P A;  4MM3 B;  5ITR A;  4JI1 M;  2Z4S A;  4FCW A;  4LGY A;  1YU4 A;  2VQF M;  2CV1 A;  3HJ8 A;  2F5N A;  3KFU G;  2F5P A;  4DV1 M;  2L7I A;  4LF6 M;  4JI4 M;  4JI5 M;  4OX9 M;  2CFO A;  2QBY B;  4RF1 A;  1KYI A;  3PVS A;  3J81 S;  4G4R A;  3K2L A;  3W0L B;  4DR2 M;  4IBF A;  1IN8 A;  1Q3B A;  2FOI C;  3L2A A;  4IJE A;  2D7G A;  1DGF A;  4MGZ E;  2HKJ A;  3MK6 A;  3THG A;  4DV6 M;  2DWM A;  1GL6 A;  4B3T M;  3R8F A;  4NZ5 A;  2P5T A;  2KW0 A;  4KHP M;  1NHG C;  1L2B A;  1TDH A;  4JI3 M;  1HNW M;  2CE7 A;  2CHQ A;  3KS8 A;  3T38 A;  5FLX S;  3U6P A;  1K3W A;  1DGB A;  3MJ5 A;  3HHW A;  2VQE M;  3Q8X A;  4NSR A;  1G3I A;  3R9X B;  3FTF A;  4GH9 A;  5BR8 M;  4FCV A;  2DWL A;  2BJV A;  4II7 A;  1QAQ A;  1T3T A;  4GMQ A;  1GLN A;  1I4W A;  1E9S A;  1ZQ9 A;  2LXE A;  1FNN A;  3GLH A;  4R3D A;  3T1H M;  2DVW B;  4IBK A;  5EXP A;  2KEB A;  1NJF A;  2L6O A;  4GIP A;  1VDD A;  1D2N A;  4X66 M;  3GQ4 A;  2JE5 A;  1JR3 D;  2X49 A;  3SBJ A;  4QHS A;  4AI6 A;  1DGH A;  5FTM A;  1IBL M;  4NYY A;  1SXJ B;  3U5Z B;  2R4E A;  3EIH A;  3KS4 A;  1YU1 A;  2RGH A;  3AFH A;  4NY2 A;  4M0D A;  3UK6 A;  4IBC A;  2Y2O A;  2KRU A;  3AV0 A;  3U6S A;  1W5T A;  5E26 A;  4AG5 A;  4LF4 M;  4JYA M;  4NYU A;  3U60 B;  3GLG A;  2V1U A;  3AOE A;  1KFV A;  4LZZ A;  3J7B A;  3VFD A;  3N3F A;  1S3S A;  2RGO A;  5JI2 E;  1JQJ C;  3FD9 A;  4KLN A;  4LZJ A;  1HR0 M;  4JI6 M;  1IN7 A;  4GHL A;  3HGI A;  1OFI A;  2ERC A;  1I94 M;  2KRK A;  3J80 S;  3U6O A;  2FFF B;  4PDI A;  2J7O A;  3FUU A;  4M0W A;  1NNJ A;  3KSX A;  3UZU A;  4I5S A;  2I7P A;  5ITQ A;  3MHV C;  4GC5 A;  1Z5C A;  1IY0 A;  3KOZ E;  3LMM A;  1L8Q A;  3U6Q A;  4K0K M;  4JN6 A;  4B3R M;  2Y2P A;  2ZAM A;  2DHR A;  1IXZ A;  3HJS A;  4WUR A;  3AL0 C;  2Y20 A;  2R4J A;  2JCH A;  3GPU A;  3FTD A;  3CF6 E;  4QOZ C;  2XGN A;  4OJ6 A;  4D82 A;  1PJJ A;  3KOY E;  2G5G X;  3SAT A;  4G4Q A;  4B3S M;  4CIS A;  2EO2 A;  4KOD A;  4DR6 M;  4Z6Y A;  4OJL A;  1XNR M;  5ITU A;  3I4Y A;  3JR5 A;  4NSO B;  3VDP A;  1R7R A;  4G4N A;  3L27 A;  4QNL A;  1NVM A;  4QNM A;  4LG2 A;  3PXG A;  4GHA A;  3U61 B;  4R7G A;  2C96 A;  3CTW B;  2IOU A;  5KQD A;  4JI8 M;  3WX7 A;  1Q39 A;  3A42 A;  4DUZ M;  1IY2 A;  3WHL A;  2C99 A;  2L7H A;  2M5Z A;  4I4L A;  1Z5B A;  3JR4 A;  2XZF A;  1E32 A;  1XWI A;  1QAM A;  2Y2I A;  5DYI A;  3RGP A;  5JI3 E;  5KO3 A;  3U6L A;  5BPV A;  2XFS A;  4PCZ A;  1LV7 A;  3U6M A;  4MB7 A;  1XMO M;  4LJ6 A;  3FTC A;  1XMQ M;  3AKZ A;  3VDU A;  1SXJ D;  2Y2H A;  2QP9 X;  3FKE A;  4NL4 H;  4DR3 M;  4FWD A;  4B7H A;  3PNY A;  1N77 A;  4LRT A;  2G8L A;  4LJ8 A;  3U6C A;  2F5S A;  1YU2 A;  4LGM A;  4D80 A;  3UGJ A;  5LMU M;  1OFH A;  4LJ4 A;  1YU0 A;  3GO8 A;  5EP1 A;  3HU1 A;  3NWL A;  4NZ1 A;  1TH3 A;  1L1T A;  2LWX A;  4AG6 A;  2F5Q A;  4D81 A;  3A45 A;  4B7F A;  4TUW A;  2BG1 A;  3K8Z A;  3M7G A;  5ITT A;  4PD2 A;  1JR3 A;  3GPX A;  1XC8 A;  5ITX A;  4JI2 M;  4JI0 M;  4FVM A;  4B7G A;  2R46 A;  2YQZ A;  2Q2E B;  2X8A A;  4BBA A;  2CV0 A;  4AW4 A;  4X62 M;  2DXI A;  1W5S A;  1E94 E;  1IBK M;  3KSJ A;  3FUW A;  2V1C A;  3LQQ A;  3I4V A;  3LVV A;  5ITY A;  3SMP A;  5E6J A;  4CGY B;  4LFA M;  3UMM A;  3SAV A;  2Z3X A;  3LQR A;  1SXJ E;  2YNM D;  2QPA A;  3L25 A;  2X4A A;  3T15 A;  2K47 A;  3D8B A;  3SFZ A;  2XD5 A;  3J7A S;  2BNK A;  1EE8 A;  2LNH C;  4QOS A;  3FUX A;  2KZU A;  3E9S A;  4QHT A;  1IN4 A;  5GKN A;  4OJP A;  3K1J A;  1OJL A;  2M60 A;  3GP1 A;  4IBG A;  3CF0 A;  3FYC A;  4OVZ A;  5C1B A;  4JV5 M;  2Y2L A;  3GPY A;  3AOE C;  3GLI B;  2R18 A;  5A2Q S;  3IG8 A;  4DV3 M;  4DR5 M;  2OQ4 A;  3QWL A;  4NOO B;  3I51 A;  4P16 A;  4DV2 M;  5KQ8 A;  1IN6 A;  3KOW E;  1IN5 A;  3KXE C;  2OPF A;  1QAN A;  1IXR C;  4IJF A;  2XH9 A;  4BB9 A;  2CHG A;  2I7N A;  4IBJ A;  1N75 A;  3KW6 A;  2C9C A;  1Z5A A;  4GKK M;  1HT1 E;  1IQP A;  4L15 A;  3HSH A;  4FWG A;  4L4U A;  1MU5 A;  1R2Z A;  2FNA A;  1TH2 A;  4XGI A;  5DNY A;  5EP3 A;  1YUE A;  4DV5 M;  2XEP A;  4LF7 M;  4LFB M;  3U6D A;  5EQT A;  4LFC M;  3PNV A;  3FTE A;  2H1R A;  2UU9 M;  3KP0 E;  5ITX E;  2L09 A;  4AQY M;  2D7E A;  1K82 A;  3L28 A;  2R65 A;  1YU3 A;  1L1Z A;  3CF2 A;  4GRI A;  5FTN A;  2XSZ D;  2Y2Q A;  3GLF B;  4GIT A;  3AOG A;  3HKP A;  5IWA M;  5EXX A;  3TWL A;  5EP2 A;  1KSF X;  3HU2 A;  1TDZ A;  3VKG A;  2VII A;  3ZCB B;  2KZS A;  4ITQ A;  3KVW A;  4GKJ M;  4L16 A;  5FTL A;  1J7K A;  3DFZ A;  1NY5 A;  3TQS A;  2Y21 A;  1TGU A;  1SXJ A;  3U5Z A;  1NNU C;  4NZ3 A;  2Z4R A;  5H37 D;  1YE9 A;  3VK8 A;  2NQ8 C;  3HJQ A;  3KDS E;  1HT2 E;  4MH0 E;  4RF0 A;  2XF3 A;  3E4R A;  4NRV A;  4OU7 A;  2R62 A;  2UUA M;  1G4A E;  1NHW C;  5FTK A;  3U60 A;  1X37 A;  4W5W A;  2ZBK B;  1WXQ A;  3KOX E;  3SHF A;  4DUY M;  2Z7J A;  1XXH A;  5EXT A;  1N78 A;  3IG5 A;  3GRY A;  1IM2 A;  3DA1 A;  3JAM S;  4L8R C;  5EP4 A;  5KPZ A;  2A5Y B;  2EUC A;  4RNA A;  1DO0 A;  4FW9 A;  3T1Y M;  3WHK A;  2CEA A;  2HHH M;  4JI7 M;  4I81 A;  2FFJ A;  4OW0 A;  3KP1 E;  1R2Y A;  7CAT A;  3D8L A;  3ZH9 B;  2J7N A;  4DR1 M;  3GRU A;  4MGY E;  3GLH B;  3UJN A;  2E5L M;  5DYG A;  4AKI A;  5FSW A;  4DV7 M;  5F3W A;  4MGH A;  1DGH B;  4M9Z A;  2DZO B;  3LVW A;  1ORY B;  1QVR A;  2DZN B;  2V6Z M;  2KA6 B;  4B08 A;  3TL4 X;  4PDG A;  2Y2G A;  2D7H A;  4LJA A;  2YR0 A;  3HHY A;  3AJI B;  1MX0 A;  3GLG B;  2XZU A;  2UUB M;  3GRV A;  3L29 A;  1N34 M;  5EXS A;  4IBI A;  2ZAN A;  3HU3 A;  1HNZ M;  2XLJ A;  1Z59 A;  2W82 A;  4I8O A;  4FWH A;  1IXS B;  3GQ3 A;  1N36 M;  4DR4 M;  3FUT A;  2UXB M;  3RFW A;  1GL7 A;  3HHZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...