4IBIA

Ebola virus vp35 bound to small molecule
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
123
structure length
123
Chain Sequence
b'DISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polymerase cofactor VP35
publication title In Silico Derived Small Molecules Bind the Filovirus VP35 Protein and Inhibit Its Polymerase Cofactor Activity.
pubmed doi rcsb
source organism Ebola virus
molecule tags Transcription/transcription inhibitor
total genus 44
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ibiA01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4ibiA02
4IBFA 4GHLA 4GH9A 3L26A 4IBIA 3L25A 4IBEA 3L27A 3L28A 4IJFA 3KS4A 3KS8A 4IBGA 3L2AA 5BPVA 4IBDA 4IBCA 3L29A 4LG2A 4IBJA 3FKEA 4IJEA 4IBBA 4IBKA 4GHAA
chains in the Genus database with same CATH superfamily
2QHOB 3UJNA 3C58A 5KPTA 1E88A 4GH9A 2LBCA 2D7EA 5BR8M 2ZANA 5F3WA 4NXMM 5ITRA 3QYEA 4CGYB 1IXRC 3W67A 3FTFA 2Y2HA 3I4VA 2QNJA 2C9CA 4DR5M 3KOYE 5KPZA 2CRUA 3GPUA 3GLFB 3JAMS 1N75A 3J2PB 3HX3A 2FOIC 4UN2B 4AG6A 1ED7A 4D81A 4PDIA 3JR4A 1TH2A 3TWKA 4BBAA 1N77A 2KDLA 3TWLA 2Y2QA 3WD4A 1NNUC 2LVPC 3KOXE 2D49A 4WW0A 4OJ6A 4LJ5A 4MB5A 4S12A 1JR3D 4QOZC 1ORYB 2QSFX 3KDSE 3MMPA 2DXIA 2M5ZA 5FTMA 1QDRA 2BJVA 3I01M 2RGHA 4LJ4A 4JI6M 2JY6B 2RTSA 2K47A 2NQ8C 3ZH9B 5DNYA 1N32M 5EXPA 2OQ4A 1VEGA 2G5GX 1SXJB 2R4JA 2Z7JA 3FE3A 4GC5A 4G4RA 4I81A 3T1YM 3MQLA 4JI3M 5EXXA 4MB3A 1ZAEA 3EIEA 3WD1A 2JNHA 4GRIA 2HAKA 3QWLA 1R5LA 3SAUA 2F5QA 4JYAM 3HONA 1QUSA 2QBYB 2BG1A 2VQFM 3U6SA 3MK6A 4MM3B 2DI0A 3I51A 1E6PA 3M7PA 2Z4SA 3GLHB 3UMMA 3SATA 4IBDA 4IBCA 2FE8A 2HL7A 4AZFA 4DUZM 3D8BA 1C7YA 5FTLA 4HEOA 1QANA 1ZMVA 2A5YB 3KP1E 4XBOA 2YNMD 1W1TA 4I8OA 3D8LA 4GHAA 3E46A 3AV0A 1YU3A 4Z2LA 1W5SA 3LVWA 2XLJA 2F5NA 1HJPA 1DGHA 3DA1A 3AOGA 1A5TA 4M0WA 4NRWA 1QO6A 3K2LA 4LF8M 2R46A 2CV2A 1G4AE 1NSFA 4NRVA 2ZTCA 4R3DA 2Y0TA 5EP2A 1QVRA 3Q8XA 2YFQA 1J7KA 3GPYA 3FYDA 3U5ZA 1V92A 3T38A 4IBGA 3PFIA 3C9PA 4II7A 5BPVA 2OOAA 5GKNA 3HHYA 4F2LA 1MU5A 4LZJA 2D7HA 3GLFE 1PJJA 4REZA 1OKSA 2AHMA 2VF8A 1YU1A 3CF6E 1IXZA 3I04M 4OJOA 1E8BA 1QAMA 3FUXA 1PDCA 5KQ8A 4OVZB 2EKFA 2CHVA 2K0BX 2M60A 4B7HA 5H37D 4JI2M 2Z4RA 2F4VM 2Y20A 2EA0A 3AJIB 3LVVA 1H6UA 3L26A 2UXCM 1PRBA 1OTRA 2X8AA 2DAKA 2DZLA 3RGSA 3U6QA 3F92A 3L27A 1E15A 3B74A 1DO2A 2X4AA 2C98A 4Q7JA 4RF0A 3B7QA 3E21A 4QNMA 3M0EA 4XGIA 1GLNA 4DV7M 1PJTA 4NYYA 2LHCA 4OJPA 4AKIA 2LVQD 2VIIA 4DR1M 2V6ZM 1CUKA 5DYGA 2DENA 3KSJA 5EJCA 5LMUM 4FVMA 3IG5A 5IZ7D 2C9OA 4OX9M 2DWNA 3GLHE 1AIWA 2XGNA 2GQFA 2KEBA 4IBFA 7CATA 4NZ5A 1GPFA 4X65M 4JXJA 3FTEA 4AW4A 3FUVA 1J09A 2F5SA 2JZ0A 3HJQA 2Y2KA 2JE5A 1H8PA 1VG5A 4WURA 3UGJA 5ITYA 1GOIA 4NZ4A 3LQRA 1JR3E 3K9OA 4LF9M 1WXQA 1XB2B 2FS1A 3KS4A 3RE8A 3GRUA 4HLQA 3AOEA 5EP3A 4K0KM 1KS0A 4B3RM 1DGBA 4PCZA 3H4MA 3KVWA 3SFZA 3A98B 2LHGA 2MR9A 4GITA 3FTDA 4LJ8A 1I94M 1HQYE 2VQEM 4ITQA 4LF7M 1GL7A 4GKKM 2HHHM 4B3MM 2Y2PA 1IBMM 3KOZE 2C99A 5JI3E 3A46A 4DV3M 1HNXM 4LFCM 1NNJA 1QAQA 2G3QA 2XFTA 1HNZM 4LF4M 3SMSA 3GQ5A 4KHPM 3VK7A 2Y2MA 4P16A 5DYIA 4NSOB 1R6BX 2LXEA 2L4EA 1HT1E 5EP1A 4IBEA 3CTWB 3PNVA 2XSZD 4GEWA 4M9XA 4QHTA 1G71A 2YQZA 4LGMA 1IBKM 2K9DA 4GKJM 3TWMA 2ZAOA 3SHFA 5IT9S 1V33A 3TL4X 2R6FA 3FRIA 1GVNA 3L2AA 4NSRA 4CIZA 5ITUA 3GPXA 3R8FA 1OGBA 2DAMA 2JY5A 2XZFA 3J7AS 4FWHA 1WGLA 1TDHA 2R44A 2QP9X 3GLGA 2RKOA 2BWBA 1LTMA 3GRVA 3HHWA 4GMQA 4IBBA 4JI0M 4WP2A 4D80A 1L2BA 4JI5M 3UK6A 2Y2NA 4Z2GA 2KZUA 1D0KA 3T6PA 3FYCA 2Z3XA 1Q3BA 2CV1A 5E6JA 2CV0A 2L09A 1ZQ9A 1GO5A 4NY2A 3V76A 2R62A 2XSZA 3HHZA 4DV1M 4RKUF 4JI4M 1TR8A 3DOAA 1FJGM 1O6IA 1K3WA 2CHGA 4HL4A 3VDPA 1P3QQ 2O01F 5ITQA 1G59A 3SARA 4FCVA 1E6ZA 1QZEA 4AG5A 3GQ3A 3HU3A 2UXBM 3FTCA 4LFAM 2L2DA 4B7FA 4G4OA 4CISA 4OU7A 4PD2A 3U6LA 2LVNC 4LRTA 2DVWB 3SYKA 3ZC7B 1CXWA 4QHSA 5ITXE 1OQYA 2L6OA 3FD9A 1XC8A 2QZ4A 3J80S 3RFWA 4DBGB 1T3TA 1NJFA 4GC9A 3EIHA 3RGPA 4M0DA 4W5WA 1YUEA 5EXTA 2R45A 1T43A 4NXNM 1G8PA 4Z6YA 4DV6M 1E94E 2QPAA 1IY1A 1L2CA 1JB0F 4KO8A 1PJIA 1OIZA 2Y2OA 1L6JA 4FCTA 2CEAA 2LTUA 2UUAM 2V5OA 4KODA 3AKZA 3SAWA 2LVAA 2R65A 2W82A 3FUWA 5C1BA 3GLIA 4L15A 3KS8A 2LH0A 1I4WA 1ZMUA 3SHGB 3TPZA 2N35A 1N33M 2XD1A 1DGHB 2UUBM 4LG2A 2ZM6M 2OO9A 4OJ5A 3GO8A 1XXHA 4F1IA 2XZUA 3WHLA 2Y2GA 2VDBB 1XHBA 3WD3A 3HKPA 1IFYA 3MHVC 1WHCA 1EE8A 3U5ZB 1Z5CA 3M6AA 4NZ1A 3HU1A 4YY3M 4AI6A 4MH0E 1W1VA 2QQ8A 1NVMA 2DZOB 2JWSA 1F4IA 2L7IA 4G6ZA 1XXHB 3KSXA 3KXEC 3AOEC 1GJTA 2FNAA 2HWJA 1TTEA 1DV0A 2CE7A 1JQJC 4M9ZA 1IN6A 1R7RA 1Z5AA 2DAIA 3NWLA 3HJ8A 2XFSA 4LJ6A 3FUTA 1YU4A 1NO1A 3PVSA 2DWLA 2V1UA 5C18A 5LMNM 1FNNA 2O25A 1SG9A 2MROB 4D82A 2C5RA 4DR3M 3UZUA 2F5PA 4LF5M 3AFHA 4LY6A 4QNLA 1NHGC 1QUTA 2KNZA 3C3DA 3GRRA 4IJEA 3U60A 3GRYA 2YR0A 8CATA 4FCWA 1PM5A 1HR0M 2KHHA 1VDDA 1IM2A 1LV7A 2Y2JA 4LZZA 4TUWA 3VLFB 1L1ZA 3IHPA 4XK8F 2ZTDA 3C3EA 4DUYM 3L25A 2JY7A 4I5SA 2EKKA 4R7GA 4FD2A 5JI2E 3U60B 2JA2A 2GNOA 2KW0A 3FRHA 3U6DA 2G8LA 2JP7A 3GQ4A 1IQPA 4NL4H 2VF7A 4PDGA 1GJSA 1GL6A 4Z2HA 2KZSA 1NY5A 1WIVA 1WJ7A 1DGFA 4L78A 4ZPXA 3W0LB 3KP0E 1VQ1A 1XNRM 5FTKA 1EIJA 2DKLA 3FKEA 1GXDA 1HT2E 2V1CA 4RF1A 1EAKA 3ILKA 2KXEA 4BB9A 2EO2A 3B7NA 1BVSA 1H0GA 1HQCA 2I7PA 1N36M 4JV5M 3U61A 2UWXA 2ERCA 1R2ZA 1YU2A 1L1TA 3U6CA 4JI1M 1DGGA 1KSFX 2FFJA 3J7BA 1Q02A 2DWMA 4IBIA 5FTNA 1IN7A 2Y2IA 3IECA 3HGIA 5EP4A 4HMDA 4X62M 4IIWA 3R9XB 1Y8GA 1HNWM 1VEJA 2OOBA 2FN2A 2DZNB 1NY6A 2JUJA 4JN6A 1TH3A 2E5LM 1XXHE 3PXGA 3HJSA 4CJ6A 4DV5M 4JI7M 2XF3A 1YSYA 1PGYA 4Z8XA 2XEPA 5EQTA 2LVOC 1XMOM 2APLA 5KPRA 2XD5A 1Z59A 2Q2EB 1IN5A 1SXJD 2C96A 3NBIA 2HCBA 4HMCA 1Z5BA 2DHYA 2WSEF 4L4UA 1KFVA 3HSHA 3QAUA 3K1JA 1W5TA 1G41A 2BWEA 3WHKA 4AKGA 1IY0A 2FFFB 1QYRA 3HU2A 2JZ1A 2O5RA 4MB4A 3VDUA 3SASA 1K3XA 1IXSA 4MGYE 1GKIA 5EXSA 4EIWA 2DAGA 1X37A 2DAEA 5KO3A 5FSWA 1OAIA 5L8RF 3GLGB 4G4NA 2CUZA 3VKHA 2D7GA 2XH9A 2KNAA 1QZMA 1NHWC 2JXNA 3SAVA 4AQYM 4MGZE 1YU0A 4LJ9A 1GABA 1AIPC 1SXJA 5ITTA 1CK7A 3T1HM 2H1RA 4LFBM 4L6V6 1IXSB 3J27B 2EUCA 3BXWA 4M9SA 3U6PA 1UR9A 4OJLA 4MGIE 1J5EM 2UXDM 1OGGA 2QBYA 2KA6B 1PJQA 2BJWA 2R18A 3QYBA 4P17A 3W0FA 2JCHA 4DR4M 2BNKA 4HMEA 3GLHA 2R0IA 3HY5A 2L4FA 3FUUA 3N3FA 3HHXA 2DHRA 1D0MA 1R4GA 4LCBA 2Y21A 4LF6M 3MJ5A 3Q8GA 1TGUA 2WZJA 1D0LA 1IY2A 2LNHC 5IWAM 3VKGA 1XWIA 3LQQA 4NYUA 2ZAMA 3LCUA 1IN4A 3DZDA 3W68A 1JR3A 3B9PA 3K8ZA 1WR1B 2J7NA 1N34M 3WD2A 5FTJA 4R71A 1Q39A 1MJGM 2HKJA 1Z6TA 3L29A 1S3SA 4OW0A 3K9PA 3H4JA 2UUCM 3GPPA 1OJLA 2K6BA 2Z8YM 1N78A 3AL0C 4OUIA 2KRKA 4FWGA 1NJGA 2WSFF 4BLCA 2F5OA 1ZV1A 3E9SA 1TF0B 2J7OA 2QENA 1R2YA 3SMPA 4GHLA 1L8QA 2DWZB 2CFOA 4MGHA 3GLIB 3JR5A 4DR7M 1W1PA 1OIPA 2JY8A 1K82A 1IBLM 4X66M 2CP8A 4B08A 4NOOB 3DFZA 4LRSA 2MJ5B 3T15A 1E6NA 3WX7A 3NBXX 3IG8A 1ZMWA 1E9SA 1MN3A 1QDTA 4X64M 1W1YA 4OVZA 1QAOA 4QOSA 3J81S 1TH4A 4A3VB 2IOUA 4KLNA 2P5TA 2WSCF 3LCVB 3LW5F 3GLGE 1TDZA 1J7MA 1VEKA 5A2QS 1OAOC 4MGKE 1NV8A 4IBKA 4L16A 2I7NA 3BBZA 3VFDA 5KQDA 4RNAA 3TE6A 4QNRA 1C1KA 3PNYA 5DFLA 3U6OA 1OFIA 1UM8A 3HZJA 1E9RA 2RRUA 4DV4M 3WD0A 5E26A 4LGYA 4B3SM 2J5YA 4LJAA 2MH8A 3I4YA 3L28A 3BOSA 2KNVA 2FH0A 1EFUB 1SXJE 4Z2IA 1V34A 1YUBA 1PJSA 3B89A 4KT0F 4PT5A 4FWDA 3U6EA 5FLXS 4Z2JA 4DR2M 1D2NA 4IBJA 4Z2KA 1Q3CA 2ZBKB 2RGOA 3GP1A 2B3TA 4DV2M 3VK8A 1XMQM 4I4LA 3KFUG 4NC6A 3HWSA 3THGA 5ITXA 4AKHA 3CF0A 2UU9M 1YLAA 2EJSA 1XNQM 3ZQJA 1NV9A 1T6OA 2R4EA 4MB7A 3ZCBB 1QQWA 3LMMA 1RU3A 1DO0A 1E6RA 1YE9A 1E32A 4FW9A 1WGNA 2LWXA 4ANRA 2H5XA 4B3TM 5IREB 4Y28F 2OPFA 4B7GA 2X49A 3A45A 3SBJA 4DR6M 1L2DA 4L8RC 4CHTB 3GLIE 1SXJC 1IN8A 2L7HA 3M7GA 4IJFA 4YHHM 4NZ3A 4JI8M 1UFZA 4LJ7A 1G3IA 1MX0A 3OTOM 2Y2LA 3K92A 3KOWE 2DNAA 2Y0QA 2MGWA 3U61B 3A42A 4GIPA 3U6MA 3B7ZA 4G4QA 2QCUA 4G3OA 1KYIA 3E4RA 3KW6A 1VDLA 3CF2A 3SC3A 3SYLA 3TQSA 3CGWA 1UR8A 4TX8A 4DV0M 1AUAA 1OFHA 2CHQA 1H0IA 3GLFA 2KRUA 2CWBA
chains in the Genus database with same CATH topology
3UJNA 3C58A 5KPTA 4GH9A 2D7EA 5BR8M 2ZANA 5F3WA 4NXMM 5ITRA 4CGYB 1IXRC 3FTFA 2Y2HA 3I4VA 2C9CA 4DR5M 3KOYE 5KPZA 3GPUA 3GLFB 3JAMS 1N75A 3J2PB 4AG6A 2FOIC 4D81A 4PDIA 3JR4A 1TH2A 3TWKA 4BBAA 1N77A 3TWLA 2Y2QA 1NNUC 3KOXE 4WW0A 4OJ6A 4LJ5A 4S12A 1JR3D 4QOZC 1ORYB 3KDSE 2DXIA 2M5ZA 5FTMA 2BJVA 2RGHA 4LJ4A 4JI6M 2K47A 2NQ8C 3ZH9B 5DNYA 1N32M 5EXPA 2OQ4A 2G5GX 1SXJB 2R4JA 2Z7JA 4GC5A 4G4RA 3T1YM 4I81A 4JI3M 5EXXA 1ZAEA 3EIEA 3SAUA 4GRIA 3QWLA 2F5QA 3HONA 4JYAM 2QBYB 2BG1A 2VQFM 3U6SA 3MK6A 4MM3B 3I51A 2Z4SA 3GLHB 3UMMA 3SATA 4IBDA 4IBCA 2FE8A 2HL7A 4AZFA 4DUZM 3D8BA 5FTLA 1QANA 2A5YB 3KP1E 4XBOA 2YNMD 4I8OA 3D8LA 4GHAA 3AV0A 1YU3A 1W5SA 3LVWA 2XLJA 2F5NA 1DGHA 3DA1A 3AOGA 4M0WA 4NRWA 3K2LA 4LF8M 2R46A 2CV2A 1G4AE 1NSFA 4NRVA 4R3DA 2Y0TA 5EP2A 1QVRA 3Q8XA 2YFQA 1J7KA 3GPYA 3FYDA 3U5ZA 3T38A 4IBGA 3PFIA 4II7A 5BPVA 5GKNA 3HHYA 1MU5A 4LZJA 2D7HA 1PJJA 4REZA 2AHMA 1YU1A 3CF6E 1IXZA 4OJOA 1QAMA 3FUXA 5KQ8A 4OVZB 5H37D 2CHVA 4B7HA 2M60A 4JI2M 2F4VM 2Z4RA 2Y20A 2EA0A 3AJIB 3LVVA 1H6UA 3L26A 2UXCM 2X8AA 3RGSA 3U6QA 3L27A 1DO2A 2X4AA 2C98A 4RF0A 4QNMA 3M0EA 4XGIA 1GLNA 4NYYA 4OJPA 4AKIA 2VIIA 4DR1M 2V6ZM 5DYGA 3KSJA 5EJCA 5LMUM 4FVMA 3IG5A 5IZ7D 2C9OA 4OX9M 2DWNA 2XGNA 2KEBA 4IBFA 7CATA 4NZ5A 4X65M 4JXJA 3FTEA 4AW4A 3FUVA 1J09A 2F5SA 3HJQA 2Y2KA 2JE5A 4WURA 3UGJA 5ITYA 4NZ4A 3LQRA 4LF9M 1WXQA 3KS4A 3RE8A 3GRUA 4HLQA 3AOEA 5EP3A 4K0KM 4B3RM 1DGBA 4PCZA 3H4MA 3KVWA 3SFZA 3A98B 4LJ8A 1I94M 4GITA 3FTDA 4ITQA 4LF7M 1HQYE 2VQEM 4GKKM 1GL7A 2HHHM 4B3MM 2Y2PA 1IBMM 3KOZE 2C99A 5JI3E 3A46A 4DV3M 1HNXM 4LFCM 1NNJA 1QAQA 2XFTA 1HNZM 4LF4M 3SMSA 3GQ5A 4KHPM 3VK7A 2Y2MA 4P16A 5DYIA 4NSOB 1R6BX 2LXEA 1HT1E 5EP1A 4IBEA 3CTWB 3PNVA 2XSZD 4M9XA 4QHTA 2YQZA 4LGMA 1IBKM 4GKJM 3TWMA 2ZAOA 3SHFA 5IT9S 3TL4X 4DV7M 3R8FA 1GVNA 3L2AA 4NSRA 5ITUA 3GPXA 2XZFA 3J7AS 4FWHA 1TDHA 2QP9X 3GLGA 2RKOA 3GRVA 3HHWA 4IBBA 4GMQA 4JI0M 4JI5M 4D80A 1L2BA 2Y2NA 3UK6A 2KZUA 3FYCA 2Z3XA 1Q3BA 2CV1A 5E6JA 2CV0A 2L09A 1ZQ9A 4NY2A 2R62A 2XSZA 3HHZA 4DV1M 4JI4M 3DOAA 1FJGM 1K3WA 2CHGA 4HL4A 3VDPA 5ITQA 1G59A 3SARA 4FCVA 4AG5A 3GQ3A 3HU3A 2UXBM 3FTCA 4LFAM 4B7FA 4G4OA 4CISA 4OU7A 4PD2A 3U6LA 4LRTA 2DVWB 3SYKA 3ZC7B 4QHSA 5ITXE 2L6OA 3FD9A 1XC8A 2QZ4A 3J80S 3RFWA 1T3TA 1NJFA 4GC9A 3EIHA 3RGPA 4M0DA 4W5WA 1YUEA 5EXTA 2R45A 4Z6YA 4NXNM 1G8PA 4DV6M 1E94E 2QPAA 1IY1A 1L2CA 4KO8A 1PJIA 2Y2OA 4FCTA 2CEAA 2UUAM 4KODA 3AKZA 3SAWA 2R65A 2W82A 3FUWA 5C1BA 3GLIA 4L15A 3KS8A 2LH0A 1I4WA 3SHGB 1N33M 3TPZA 2XD1A 1DGHB 2UUBM 4LG2A 2ZM6M 4OJ5A 3GO8A 1XXHA 2XZUA 3WHLA 2Y2GA 1XHBA 3HKPA 3MHVC 1EE8A 3U5ZB 1Z5CA 3M6AA 4NZ1A 3HU1A 4YY3M 4AI6A 4MH0E 1NVMA 2DZOB 2L7IA 4G6ZA 1XXHB 3KSXA 3KXEC 3AOEC 2FNAA 2CE7A 1JQJC 4M9ZA 1IN6A 1R7RA 1Z5AA 4LJ6A 3NWLA 3HJ8A 2XFSA 3FUTA 1YU4A 3PVSA 2DWLA 2V1UA 5C18A 5LMNM 1FNNA 4D82A 2C5RA 4DR3M 3UZUA 2F5PA 4LF5M 3AFHA 4LY6A 4QNLA 1NHGC 3GRRA 4IJEA 3U60A 3GRYA 2YR0A 8CATA 4FCWA 1PM5A 1HR0M 1VDDA 1IM2A 1LV7A 2Y2JA 4LZZA 4TUWA 3VLFB 1L1ZA 4DUYM 3L25A 4I5SA 4R7GA 4FD2A 5JI2E 3U60B 2JA2A 2KW0A 3U6DA 2G8LA 3GQ4A 1IQPA 4NL4H 4PDGA 1GL6A 2KZSA 1NY5A 1DGFA 4L78A 4ZPXA 3W0LB 3KP0E 1XNRM 5FTKA 3FKEA 1HT2E 2V1CA 4RF1A 3ILKA 2KXEA 4BB9A 2EO2A 1HQCA 2I7PA 1N36M 4JV5M 3U61A 2UWXA 2ERCA 1R2ZA 1YU2A 1L1TA 3U6CA 4JI1M 1DGGA 1KSFX 2FFJA 3J7BA 2DWMA 4IBIA 5FTNA 1IN7A 2Y2IA 3HGIA 5EP4A 4X62M 4IIWA 3R9XB 1HNWM 2DZNB 1NY6A 4JN6A 1TH3A 2E5LM 4DV5M 3PXGA 3HJSA 4JI7M 2XF3A 1YSYA 4Z8XA 5EQTA 2XEPA 1XMOM 2XD5A 5KPRA 1Z59A 2Q2EB 1IN5A 1SXJD 2C96A 3NBIA 2HCBA 1Z5BA 4L4UA 1KFVA 3HSHA 3QAUA 3K1JA 1W5TA 1G41A 3WHKA 4AKGA 1IY0A 2FFFB 1QYRA 3HU2A 2O5RA 3VDUA 3SASA 1K3XA 4MGYE 1GKIA 5EXSA 4EIWA 1X37A 5KO3A 5FSWA 3GLGB 4G4NA 3VKHA 2CUZA 2D7GA 2XH9A 1QZMA 1NHWC 3SAVA 4AQYM 4MGZE 1YU0A 4LJ9A 1SXJA 5ITTA 3T1HM 2H1RA 4LFBM 1IXSB 3J27B 2EUCA 4M9SA 4OJLA 3U6PA 4MGIE 1J5EM 2UXDM 2QBYA 2KA6B 2R18A 2BJWA 2JCHA 3W0FA 4DR4M 2BNKA 3GLHA 3FUUA 3N3FA 3HHXA 2DHRA 4LCBA 2Y21A 4LF6M 3MJ5A 1TGUA 2LNHC 1IY2A 3VKGA 5IWAM 1XWIA 3LQQA 4NYUA 2ZAMA 1IN4A 3DZDA 1JR3A 3B9PA 3K8ZA 2J7NA 1N34M 5FTJA 1Q39A 2HKJA 1Z6TA 3L29A 1S3SA 4OW0A 2UUCM 3GPPA 1OJLA 1N78A 4OUIA 3AL0C 2KRKA 4FWGA 1NJGA 4BLCA 2F5OA 3E9SA 2J7OA 2QENA 1R2YA 3SMPA 4GHLA 1L8QA 2DWZB 2CFOA 4MGHA 3GLIB 3JR5A 4DR7M 1K82A 1IBLM 4X66M 4B08A 4NOOB 3DFZA 4LRSA 3T15A 3WX7A 3IG8A 1E9SA 4X64M 4OVZA 1QAOA 4QOSA 3J81S 1TH4A 4A3VB 2IOUA 4KLNA 2P5TA 1TDZA 5A2QS 4MGKE 4IBKA 4L16A 2I7NA 3VFDA 5KQDA 4RNAA 3TE6A 4QNRA 1C1KA 3PNYA 3U6OA 1OFIA 1UM8A 1E9RA 4DV4M 5E26A 4LGYA 4B3SM 4LJAA 3I4YA 3L28A 3BOSA 1SXJE 1YUBA 4PT5A 4FWDA 3U6EA 5FLXS 4DR2M 1D2NA 4IBJA 1Q3CA 2ZBKB 2RGOA 3GP1A 4DV2M 3VK8A 1XMQM 4I4LA 3KFUG 3HWSA 3THGA 5ITXA 4AKHA 3CF0A 2UU9M 1XNQM 2R4EA 4MB7A 3ZCBB 1QQWA 3LMMA 1DO0A 1YE9A 1E32A 4FW9A 2LWXA 4B3TM 5IREB 2OPFA 4B7GA 2X49A 3A45A 3SBJA 4DR6M 1L2DA 4L8RC 4CHTB 1SXJC 1IN8A 2L7HA 3M7GA 4IJFA 4YHHM 4NZ3A 4JI8M 4LJ7A 1G3IA 1MX0A 3OTOM 2Y2LA 3K92A 3KOWE 2Y0QA 3U61B 3A42A 4GIPA 3U6MA 4G4QA 2QCUA 1KYIA 3E4RA 3KW6A 3CF2A 3SC3A 3SYLA 3TQSA 4DV0M 1OFHA 2CHQA 3GLFA 2KRUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IBF A;  4GHL A;  4GH9 A;  3L26 A;  4IBI A;  3L25 A;  4IBE A;  3L27 A;  3L28 A;  4IJF A;  3KS4 A;  3KS8 A;  4IBG A;  3L2A A;  5BPV A;  4IBD A;  4IBC A;  3L29 A;  4LG2 A;  4IBJ A;  3FKE A;  4IJE A;  4IBB A;  4IBK A;  4GHA A; 
#chains in the Genus database with same CATH topology
 2QHO B;  3UJN A;  3C58 A;  5KPT A;  1E88 A;  4GH9 A;  2LBC A;  2D7E A;  5BR8 M;  2ZAN A;  5F3W A;  4NXM M;  5ITR A;  3QYE A;  4CGY B;  1IXR C;  3W67 A;  3FTF A;  2Y2H A;  3I4V A;  2QNJ A;  2C9C A;  4DR5 M;  3KOY E;  5KPZ A;  2CRU A;  3GPU A;  3GLF B;  3JAM S;  1N75 A;  3J2P B;  3HX3 A;  2FOI C;  4UN2 B;  4AG6 A;  1ED7 A;  4D81 A;  4PDI A;  3JR4 A;  1TH2 A;  3TWK A;  4BBA A;  1N77 A;  2KDL A;  3TWL A;  2Y2Q A;  3WD4 A;  1NNU C;  2LVP C;  3KOX E;  2D49 A;  4WW0 A;  4OJ6 A;  4LJ5 A;  4MB5 A;  4S12 A;  1JR3 D;  4QOZ C;  1ORY B;  2QSF X;  3KDS E;  3MMP A;  2DXI A;  2M5Z A;  5FTM A;  1QDR A;  2BJV A;  3I01 M;  2RGH A;  4LJ4 A;  4JI6 M;  2JY6 B;  2RTS A;  2K47 A;  2NQ8 C;  3ZH9 B;  5DNY A;  1N32 M;  5EXP A;  2OQ4 A;  1VEG A;  2G5G X;  1SXJ B;  2R4J A;  2Z7J A;  3FE3 A;  4GC5 A;  4G4R A;  4I81 A;  3T1Y M;  3MQL A;  4JI3 M;  5EXX A;  4MB3 A;  1ZAE A;  3EIE A;  3WD1 A;  2JNH A;  4GRI A;  2HAK A;  3QWL A;  1R5L A;  3SAU A;  2F5Q A;  4JYA M;  3HON A;  1QUS A;  2QBY B;  2BG1 A;  2VQF M;  3U6S A;  3MK6 A;  4MM3 B;  2DI0 A;  3I51 A;  1E6P A;  3M7P A;  2Z4S A;  3GLH B;  3UMM A;  3SAT A;  4IBD A;  4IBC A;  2FE8 A;  2HL7 A;  4AZF A;  4DUZ M;  3D8B A;  1C7Y A;  5FTL A;  4HEO A;  1QAN A;  1ZMV A;  2A5Y B;  3KP1 E;  4XBO A;  2YNM D;  1W1T A;  4I8O A;  3D8L A;  4GHA A;  3E46 A;  3AV0 A;  1YU3 A;  4Z2L A;  1W5S A;  3LVW A;  2XLJ A;  2F5N A;  1HJP A;  1DGH A;  3DA1 A;  3AOG A;  1A5T A;  4M0W A;  4NRW A;  1QO6 A;  3K2L A;  4LF8 M;  2R46 A;  2CV2 A;  1G4A E;  1NSF A;  4NRV A;  2ZTC A;  4R3D A;  2Y0T A;  5EP2 A;  1QVR A;  3Q8X A;  2YFQ A;  1J7K A;  3GPY A;  3FYD A;  3U5Z A;  1V92 A;  3T38 A;  4IBG A;  3PFI A;  3C9P A;  4II7 A;  5BPV A;  2OOA A;  5GKN A;  3HHY A;  4F2L A;  1MU5 A;  4LZJ A;  2D7H A;  3GLF E;  1PJJ A;  4REZ A;  1OKS A;  2AHM A;  2VF8 A;  1YU1 A;  3CF6 E;  1IXZ A;  3I04 M;  4OJO A;  1E8B A;  1QAM A;  3FUX A;  1PDC A;  5KQ8 A;  4OVZ B;  2EKF A;  2CHV A;  2K0B X;  2M60 A;  4B7H A;  5H37 D;  4JI2 M;  2Z4R A;  2F4V M;  2Y20 A;  2EA0 A;  3AJI B;  3LVV A;  1H6U A;  3L26 A;  2UXC M;  1PRB A;  1OTR A;  2X8A A;  2DAK A;  2DZL A;  3RGS A;  3U6Q A;  3F92 A;  3L27 A;  1E15 A;  3B74 A;  1DO2 A;  2X4A A;  2C98 A;  4Q7J A;  4RF0 A;  3B7Q A;  3E21 A;  4QNM A;  3M0E A;  4XGI A;  1GLN A;  4DV7 M;  1PJT A;  4NYY A;  2LHC A;  4OJP A;  4AKI A;  2LVQ D;  2VII A;  4DR1 M;  2V6Z M;  1CUK A;  5DYG A;  2DEN A;  3KSJ A;  5EJC A;  5LMU M;  4FVM A;  3IG5 A;  5IZ7 D;  2C9O A;  4OX9 M;  2DWN A;  3GLH E;  1AIW A;  2XGN A;  2GQF A;  2KEB A;  4IBF A;  7CAT A;  4NZ5 A;  1GPF A;  4X65 M;  4JXJ A;  3FTE A;  4AW4 A;  3FUV A;  1J09 A;  2F5S A;  2JZ0 A;  3HJQ A;  2Y2K A;  2JE5 A;  1H8P A;  1VG5 A;  4WUR A;  3UGJ A;  5ITY A;  1GOI A;  4NZ4 A;  3LQR A;  1JR3 E;  3K9O A;  4LF9 M;  1WXQ A;  1XB2 B;  2FS1 A;  3KS4 A;  3RE8 A;  3GRU A;  4HLQ A;  3AOE A;  5EP3 A;  4K0K M;  1KS0 A;  4B3R M;  1DGB A;  4PCZ A;  3H4M A;  3KVW A;  3SFZ A;  3A98 B;  2LHG A;  2MR9 A;  4GIT A;  3FTD A;  4LJ8 A;  1I94 M;  1HQY E;  2VQE M;  4ITQ A;  4LF7 M;  1GL7 A;  4GKK M;  2HHH M;  4B3M M;  2Y2P A;  1IBM M;  3KOZ E;  2C99 A;  5JI3 E;  3A46 A;  4DV3 M;  1HNX M;  4LFC M;  1NNJ A;  1QAQ A;  2G3Q A;  2XFT A;  1HNZ M;  4LF4 M;  3SMS A;  3GQ5 A;  4KHP M;  3VK7 A;  2Y2M A;  4P16 A;  5DYI A;  4NSO B;  1R6B X;  2LXE A;  2L4E A;  1HT1 E;  5EP1 A;  4IBE A;  3CTW B;  3PNV A;  2XSZ D;  4GEW A;  4M9X A;  4QHT A;  1G71 A;  2YQZ A;  4LGM A;  1IBK M;  2K9D A;  4GKJ M;  3TWM A;  2ZAO A;  3SHF A;  5IT9 S;  1V33 A;  3TL4 X;  2R6F A;  3FRI A;  1GVN A;  3L2A A;  4NSR A;  4CIZ A;  5ITU A;  3GPX A;  3R8F A;  1OGB A;  2DAM A;  2JY5 A;  2XZF A;  3J7A S;  4FWH A;  1WGL A;  1TDH A;  2R44 A;  2QP9 X;  3GLG A;  2RKO A;  2BWB A;  1LTM A;  3GRV A;  3HHW A;  4GMQ A;  4IBB A;  4JI0 M;  4WP2 A;  4D80 A;  1L2B A;  4JI5 M;  3UK6 A;  2Y2N A;  4Z2G A;  2KZU A;  1D0K A;  3T6P A;  3FYC A;  2Z3X A;  1Q3B A;  2CV1 A;  5E6J A;  2CV0 A;  2L09 A;  1ZQ9 A;  1GO5 A;  4NY2 A;  3V76 A;  2R62 A;  2XSZ A;  3HHZ A;  4DV1 M;  4RKU F;  4JI4 M;  1TR8 A;  3DOA A;  1FJG M;  1O6I A;  1K3W A;  2CHG A;  4HL4 A;  3VDP A;  1P3Q Q;  2O01 F;  5ITQ A;  1G59 A;  3SAR A;  4FCV A;  1E6Z A;  1QZE A;  4AG5 A;  3GQ3 A;  3HU3 A;  2UXB M;  3FTC A;  4LFA M;  2L2D A;  4B7F A;  4G4O A;  4CIS A;  4OU7 A;  4PD2 A;  3U6L A;  2LVN C;  4LRT A;  2DVW B;  3SYK A;  3ZC7 B;  1CXW A;  4QHS A;  5ITX E;  1OQY A;  2L6O A;  3FD9 A;  1XC8 A;  2QZ4 A;  3J80 S;  3RFW A;  4DBG B;  1T3T A;  1NJF A;  4GC9 A;  3EIH A;  3RGP A;  4M0D A;  4W5W A;  1YUE A;  5EXT A;  2R45 A;  1T43 A;  4NXN M;  1G8P A;  4Z6Y A;  4DV6 M;  1E94 E;  2QPA A;  1IY1 A;  1L2C A;  1JB0 F;  4KO8 A;  1PJI A;  1OIZ A;  2Y2O A;  1L6J A;  4FCT A;  2CEA A;  2LTU A;  2UUA M;  2V5O A;  4KOD A;  3AKZ A;  3SAW A;  2LVA A;  2R65 A;  2W82 A;  3FUW A;  5C1B A;  3GLI A;  4L15 A;  3KS8 A;  2LH0 A;  1I4W A;  1ZMU A;  3SHG B;  3TPZ A;  2N35 A;  1N33 M;  2XD1 A;  1DGH B;  2UUB M;  4LG2 A;  2ZM6 M;  2OO9 A;  4OJ5 A;  3GO8 A;  1XXH A;  4F1I A;  2XZU A;  3WHL A;  2Y2G A;  2VDB B;  1XHB A;  3WD3 A;  3HKP A;  1IFY A;  3MHV C;  1WHC A;  1EE8 A;  3U5Z B;  1Z5C A;  3M6A A;  4NZ1 A;  3HU1 A;  4YY3 M;  4AI6 A;  4MH0 E;  1W1V A;  2QQ8 A;  1NVM A;  2DZO B;  2JWS A;  1F4I A;  2L7I A;  4G6Z A;  1XXH B;  3KSX A;  3KXE C;  3AOE C;  1GJT A;  2FNA A;  2HWJ A;  1TTE A;  1DV0 A;  2CE7 A;  1JQJ C;  4M9Z A;  1IN6 A;  1R7R A;  1Z5A A;  2DAI A;  3NWL A;  3HJ8 A;  2XFS A;  4LJ6 A;  3FUT A;  1YU4 A;  1NO1 A;  3PVS A;  2DWL A;  2V1U A;  5C18 A;  5LMN M;  1FNN A;  2O25 A;  1SG9 A;  2MRO B;  4D82 A;  2C5R A;  4DR3 M;  3UZU A;  2F5P A;  4LF5 M;  3AFH A;  4LY6 A;  4QNL A;  1NHG C;  1QUT A;  2KNZ A;  3C3D A;  3GRR A;  4IJE A;  3U60 A;  3GRY A;  2YR0 A;  8CAT A;  4FCW A;  1PM5 A;  1HR0 M;  2KHH A;  1VDD A;  1IM2 A;  1LV7 A;  2Y2J A;  4LZZ A;  4TUW A;  3VLF B;  1L1Z A;  3IHP A;  4XK8 F;  2ZTD A;  3C3E A;  4DUY M;  3L25 A;  2JY7 A;  4I5S A;  2EKK A;  4R7G A;  4FD2 A;  5JI2 E;  3U60 B;  2JA2 A;  2GNO A;  2KW0 A;  3FRH A;  3U6D A;  2G8L A;  2JP7 A;  3GQ4 A;  1IQP A;  4NL4 H;  2VF7 A;  4PDG A;  1GJS A;  1GL6 A;  4Z2H A;  2KZS A;  1NY5 A;  1WIV A;  1WJ7 A;  1DGF A;  4L78 A;  4ZPX A;  3W0L B;  3KP0 E;  1VQ1 A;  1XNR M;  5FTK A;  1EIJ A;  2DKL A;  3FKE A;  1GXD A;  1HT2 E;  2V1C A;  4RF1 A;  1EAK A;  3ILK A;  2KXE A;  4BB9 A;  2EO2 A;  3B7N A;  1BVS A;  1H0G A;  1HQC A;  2I7P A;  1N36 M;  4JV5 M;  3U61 A;  2UWX A;  2ERC A;  1R2Z A;  1YU2 A;  1L1T A;  3U6C A;  4JI1 M;  1DGG A;  1KSF X;  2FFJ A;  3J7B A;  1Q02 A;  2DWM A;  4IBI A;  5FTN A;  1IN7 A;  2Y2I A;  3IEC A;  3HGI A;  5EP4 A;  4HMD A;  4X62 M;  4IIW A;  3R9X B;  1Y8G A;  1HNW M;  1VEJ A;  2OOB A;  2FN2 A;  2DZN B;  1NY6 A;  2JUJ A;  4JN6 A;  1TH3 A;  2E5L M;  1XXH E;  3PXG A;  3HJS A;  4CJ6 A;  4DV5 M;  4JI7 M;  2XF3 A;  1YSY A;  1PGY A;  4Z8X A;  2XEP A;  5EQT A;  2LVO C;  1XMO M;  2APL A;  5KPR A;  2XD5 A;  1Z59 A;  2Q2E B;  1IN5 A;  1SXJ D;  2C96 A;  3NBI A;  2HCB A;  4HMC A;  1Z5B A;  2DHY A;  2WSE F;  4L4U A;  1KFV A;  3HSH A;  3QAU A;  3K1J A;  1W5T A;  1G41 A;  2BWE A;  3WHK A;  4AKG A;  1IY0 A;  2FFF B;  1QYR A;  3HU2 A;  2JZ1 A;  2O5R A;  4MB4 A;  3VDU A;  3SAS A;  1K3X A;  1IXS A;  4MGY E;  1GKI A;  5EXS A;  4EIW A;  2DAG A;  1X37 A;  2DAE A;  5KO3 A;  5FSW A;  1OAI A;  5L8R F;  3GLG B;  4G4N A;  2CUZ A;  3VKH A;  2D7G A;  2XH9 A;  2KNA A;  1QZM A;  1NHW C;  2JXN A;  3SAV A;  4AQY M;  4MGZ E;  1YU0 A;  4LJ9 A;  1GAB A;  1AIP C;  1SXJ A;  5ITT A;  1CK7 A;  3T1H M;  2H1R A;  4LFB M;  4L6V 6;  1IXS B;  3J27 B;  2EUC A;  3BXW A;  4M9S A;  3U6P A;  1UR9 A;  4OJL A;  4MGI E;  1J5E M;  2UXD M;  1OGG A;  2QBY A;  2KA6 B;  1PJQ A;  2BJW A;  2R18 A;  3QYB A;  4P17 A;  3W0F A;  2JCH A;  4DR4 M;  2BNK A;  4HME A;  3GLH A;  2R0I A;  3HY5 A;  2L4F A;  3FUU A;  3N3F A;  3HHX A;  2DHR A;  1D0M A;  1R4G A;  4LCB A;  2Y21 A;  4LF6 M;  3MJ5 A;  3Q8G A;  1TGU A;  2WZJ A;  1D0L A;  1IY2 A;  2LNH C;  5IWA M;  3VKG A;  1XWI A;  3LQQ A;  4NYU A;  2ZAM A;  3LCU A;  1IN4 A;  3DZD A;  3W68 A;  1JR3 A;  3B9P A;  3K8Z A;  1WR1 B;  2J7N A;  1N34 M;  3WD2 A;  5FTJ A;  4R71 A;  1Q39 A;  1MJG M;  2HKJ A;  1Z6T A;  3L29 A;  1S3S A;  4OW0 A;  3K9P A;  3H4J A;  2UUC M;  3GPP A;  1OJL A;  2K6B A;  2Z8Y M;  1N78 A;  3AL0 C;  4OUI A;  2KRK A;  4FWG A;  1NJG A;  2WSF F;  4BLC A;  2F5O A;  1ZV1 A;  3E9S A;  1TF0 B;  2J7O A;  2QEN A;  1R2Y A;  3SMP A;  4GHL A;  1L8Q A;  2DWZ B;  2CFO A;  4MGH A;  3GLI B;  3JR5 A;  4DR7 M;  1W1P A;  1OIP A;  2JY8 A;  1K82 A;  1IBL M;  4X66 M;  2CP8 A;  4B08 A;  4NOO B;  3DFZ A;  4LRS A;  2MJ5 B;  3T15 A;  1E6N A;  3WX7 A;  3NBX X;  3IG8 A;  1ZMW A;  1E9S A;  1MN3 A;  1QDT A;  4X64 M;  1W1Y A;  4OVZ A;  1QAO A;  4QOS A;  3J81 S;  1TH4 A;  4A3V B;  2IOU A;  4KLN A;  2P5T A;  2WSC F;  3LCV B;  3LW5 F;  3GLG E;  1TDZ A;  1J7M A;  1VEK A;  5A2Q S;  1OAO C;  4MGK E;  1NV8 A;  4IBK A;  4L16 A;  2I7N A;  3BBZ A;  3VFD A;  5KQD A;  4RNA A;  3TE6 A;  4QNR A;  1C1K A;  3PNY A;  5DFL A;  3U6O A;  1OFI A;  1UM8 A;  3HZJ A;  1E9R A;  2RRU A;  4DV4 M;  3WD0 A;  5E26 A;  4LGY A;  4B3S M;  2J5Y A;  4LJA A;  2MH8 A;  3I4Y A;  3L28 A;  3BOS A;  2KNV A;  2FH0 A;  1EFU B;  1SXJ E;  4Z2I A;  1V34 A;  1YUB A;  1PJS A;  3B89 A;  4KT0 F;  4PT5 A;  4FWD A;  3U6E A;  5FLX S;  4Z2J A;  4DR2 M;  1D2N A;  4IBJ A;  4Z2K A;  1Q3C A;  2ZBK B;  2RGO A;  3GP1 A;  2B3T A;  4DV2 M;  3VK8 A;  1XMQ M;  4I4L A;  3KFU G;  4NC6 A;  3HWS A;  3THG A;  5ITX A;  4AKH A;  3CF0 A;  2UU9 M;  1YLA A;  2EJS A;  1XNQ M;  3ZQJ A;  1NV9 A;  1T6O A;  2R4E A;  4MB7 A;  3ZCB B;  1QQW A;  3LMM A;  1RU3 A;  1DO0 A;  1E6R A;  1YE9 A;  1E32 A;  4FW9 A;  1WGN A;  2LWX A;  4ANR A;  2H5X A;  4B3T M;  5IRE B;  4Y28 F;  2OPF A;  4B7G A;  2X49 A;  3A45 A;  3SBJ A;  4DR6 M;  1L2D A;  4L8R C;  4CHT B;  3GLI E;  1SXJ C;  1IN8 A;  2L7H A;  3M7G A;  4IJF A;  4YHH M;  4NZ3 A;  4JI8 M;  1UFZ A;  4LJ7 A;  1G3I A;  1MX0 A;  3OTO M;  2Y2L A;  3K92 A;  3KOW E;  2DNA A;  2Y0Q A;  2MGW A;  3U61 B;  3A42 A;  4GIP A;  3U6M A;  3B7Z A;  4G4Q A;  2QCU A;  4G3O A;  1KYI A;  3E4R A;  3KW6 A;  1VDL A;  3CF2 A;  3SC3 A;  3SYL A;  3TQS A;  3CGW A;  1UR8 A;  4TX8 A;  4DV0 M;  1AUA A;  1OFH A;  2CHQ A;  1H0I A;  3GLF A;  2KRU A;  2CWB A; 
#chains in the Genus database with same CATH homology
 3UJN A;  3C58 A;  5KPT A;  4GH9 A;  2D7E A;  5BR8 M;  2ZAN A;  5F3W A;  4NXM M;  5ITR A;  4CGY B;  1IXR C;  3FTF A;  2Y2H A;  3I4V A;  2C9C A;  4DR5 M;  3KOY E;  5KPZ A;  3GPU A;  3GLF B;  3JAM S;  1N75 A;  3J2P B;  4AG6 A;  2FOI C;  4D81 A;  4PDI A;  3JR4 A;  1TH2 A;  3TWK A;  4BBA A;  1N77 A;  3TWL A;  2Y2Q A;  1NNU C;  3KOX E;  4WW0 A;  4OJ6 A;  4LJ5 A;  4S12 A;  1JR3 D;  4QOZ C;  1ORY B;  3KDS E;  2DXI A;  2M5Z A;  5FTM A;  2BJV A;  2RGH A;  4LJ4 A;  4JI6 M;  2K47 A;  2NQ8 C;  3ZH9 B;  5DNY A;  1N32 M;  5EXP A;  2OQ4 A;  2G5G X;  1SXJ B;  2R4J A;  2Z7J A;  4GC5 A;  4G4R A;  3T1Y M;  4I81 A;  4JI3 M;  5EXX A;  1ZAE A;  3EIE A;  3SAU A;  4GRI A;  3QWL A;  2F5Q A;  3HON A;  4JYA M;  2QBY B;  2BG1 A;  2VQF M;  3U6S A;  3MK6 A;  4MM3 B;  3I51 A;  2Z4S A;  3GLH B;  3UMM A;  3SAT A;  4IBD A;  4IBC A;  2FE8 A;  2HL7 A;  4AZF A;  4DUZ M;  3D8B A;  5FTL A;  1QAN A;  2A5Y B;  3KP1 E;  4XBO A;  2YNM D;  4I8O A;  3D8L A;  4GHA A;  3AV0 A;  1YU3 A;  1W5S A;  3LVW A;  2XLJ A;  2F5N A;  1DGH A;  3DA1 A;  3AOG A;  4M0W A;  4NRW A;  3K2L A;  4LF8 M;  2R46 A;  2CV2 A;  1G4A E;  1NSF A;  4NRV A;  4R3D A;  2Y0T A;  5EP2 A;  1QVR A;  3Q8X A;  2YFQ A;  1J7K A;  3GPY A;  3FYD A;  3U5Z A;  3T38 A;  4IBG A;  3PFI A;  4II7 A;  5BPV A;  5GKN A;  3HHY A;  1MU5 A;  4LZJ A;  2D7H A;  1PJJ A;  4REZ A;  2AHM A;  1YU1 A;  3CF6 E;  1IXZ A;  4OJO A;  1QAM A;  3FUX A;  5KQ8 A;  4OVZ B;  5H37 D;  2CHV A;  4B7H A;  2M60 A;  4JI2 M;  2F4V M;  2Z4R A;  2Y20 A;  2EA0 A;  3AJI B;  3LVV A;  1H6U A;  3L26 A;  2UXC M;  2X8A A;  3RGS A;  3U6Q A;  3L27 A;  1DO2 A;  2X4A A;  2C98 A;  4RF0 A;  4QNM A;  3M0E A;  4XGI A;  1GLN A;  4NYY A;  4OJP A;  4AKI A;  2VII A;  4DR1 M;  2V6Z M;  5DYG A;  3KSJ A;  5EJC A;  5LMU M;  4FVM A;  3IG5 A;  5IZ7 D;  2C9O A;  4OX9 M;  2DWN A;  2XGN A;  2KEB A;  4IBF A;  7CAT A;  4NZ5 A;  4X65 M;  4JXJ A;  3FTE A;  4AW4 A;  3FUV A;  1J09 A;  2F5S A;  3HJQ A;  2Y2K A;  2JE5 A;  4WUR A;  3UGJ A;  5ITY A;  4NZ4 A;  3LQR A;  4LF9 M;  1WXQ A;  3KS4 A;  3RE8 A;  3GRU A;  4HLQ A;  3AOE A;  5EP3 A;  4K0K M;  4B3R M;  1DGB A;  4PCZ A;  3H4M A;  3KVW A;  3SFZ A;  3A98 B;  4LJ8 A;  1I94 M;  4GIT A;  3FTD A;  4ITQ A;  4LF7 M;  1HQY E;  2VQE M;  4GKK M;  1GL7 A;  2HHH M;  4B3M M;  2Y2P A;  1IBM M;  3KOZ E;  2C99 A;  5JI3 E;  3A46 A;  4DV3 M;  1HNX M;  4LFC M;  1NNJ A;  1QAQ A;  2XFT A;  1HNZ M;  4LF4 M;  3SMS A;  3GQ5 A;  4KHP M;  3VK7 A;  2Y2M A;  4P16 A;  5DYI A;  4NSO B;  1R6B X;  2LXE A;  1HT1 E;  5EP1 A;  4IBE A;  3CTW B;  3PNV A;  2XSZ D;  4M9X A;  4QHT A;  2YQZ A;  4LGM A;  1IBK M;  4GKJ M;  3TWM A;  2ZAO A;  3SHF A;  5IT9 S;  3TL4 X;  4DV7 M;  3R8F A;  1GVN A;  3L2A A;  4NSR A;  5ITU A;  3GPX A;  2XZF A;  3J7A S;  4FWH A;  1TDH A;  2QP9 X;  3GLG A;  2RKO A;  3GRV A;  3HHW A;  4IBB A;  4GMQ A;  4JI0 M;  4JI5 M;  4D80 A;  1L2B A;  2Y2N A;  3UK6 A;  2KZU A;  3FYC A;  2Z3X A;  1Q3B A;  2CV1 A;  5E6J A;  2CV0 A;  2L09 A;  1ZQ9 A;  4NY2 A;  2R62 A;  2XSZ A;  3HHZ A;  4DV1 M;  4JI4 M;  3DOA A;  1FJG M;  1K3W A;  2CHG A;  4HL4 A;  3VDP A;  5ITQ A;  1G59 A;  3SAR A;  4FCV A;  4AG5 A;  3GQ3 A;  3HU3 A;  2UXB M;  3FTC A;  4LFA M;  4B7F A;  4G4O A;  4CIS A;  4OU7 A;  4PD2 A;  3U6L A;  4LRT A;  2DVW B;  3SYK A;  3ZC7 B;  4QHS A;  5ITX E;  2L6O A;  3FD9 A;  1XC8 A;  2QZ4 A;  3J80 S;  3RFW A;  1T3T A;  1NJF A;  4GC9 A;  3EIH A;  3RGP A;  4M0D A;  4W5W A;  1YUE A;  5EXT A;  2R45 A;  4Z6Y A;  4NXN M;  1G8P A;  4DV6 M;  1E94 E;  2QPA A;  1IY1 A;  1L2C A;  4KO8 A;  1PJI A;  2Y2O A;  4FCT A;  2CEA A;  2UUA M;  4KOD A;  3AKZ A;  3SAW A;  2R65 A;  2W82 A;  3FUW A;  5C1B A;  3GLI A;  4L15 A;  3KS8 A;  2LH0 A;  1I4W A;  3SHG B;  1N33 M;  3TPZ A;  2XD1 A;  1DGH B;  2UUB M;  4LG2 A;  2ZM6 M;  4OJ5 A;  3GO8 A;  1XXH A;  2XZU A;  3WHL A;  2Y2G A;  1XHB A;  3HKP A;  3MHV C;  1EE8 A;  3U5Z B;  1Z5C A;  3M6A A;  4NZ1 A;  3HU1 A;  4YY3 M;  4AI6 A;  4MH0 E;  1NVM A;  2DZO B;  2L7I A;  4G6Z A;  1XXH B;  3KSX A;  3KXE C;  3AOE C;  2FNA A;  2CE7 A;  1JQJ C;  4M9Z A;  1IN6 A;  1R7R A;  1Z5A A;  4LJ6 A;  3NWL A;  3HJ8 A;  2XFS A;  3FUT A;  1YU4 A;  3PVS A;  2DWL A;  2V1U A;  5C18 A;  5LMN M;  1FNN A;  4D82 A;  2C5R A;  4DR3 M;  3UZU A;  2F5P A;  4LF5 M;  3AFH A;  4LY6 A;  4QNL A;  1NHG C;  3GRR A;  4IJE A;  3U60 A;  3GRY A;  2YR0 A;  8CAT A;  4FCW A;  1PM5 A;  1HR0 M;  1VDD A;  1IM2 A;  1LV7 A;  2Y2J A;  4LZZ A;  4TUW A;  3VLF B;  1L1Z A;  4DUY M;  3L25 A;  4I5S A;  4R7G A;  4FD2 A;  5JI2 E;  3U60 B;  2JA2 A;  2KW0 A;  3U6D A;  2G8L A;  3GQ4 A;  1IQP A;  4NL4 H;  4PDG A;  1GL6 A;  2KZS A;  1NY5 A;  1DGF A;  4L78 A;  4ZPX A;  3W0L B;  3KP0 E;  1XNR M;  5FTK A;  3FKE A;  1HT2 E;  2V1C A;  4RF1 A;  3ILK A;  2KXE A;  4BB9 A;  2EO2 A;  1HQC A;  2I7P A;  1N36 M;  4JV5 M;  3U61 A;  2UWX A;  2ERC A;  1R2Z A;  1YU2 A;  1L1T A;  3U6C A;  4JI1 M;  1DGG A;  1KSF X;  2FFJ A;  3J7B A;  2DWM A;  4IBI A;  5FTN A;  1IN7 A;  2Y2I A;  3HGI A;  5EP4 A;  4X62 M;  4IIW A;  3R9X B;  1HNW M;  2DZN B;  1NY6 A;  4JN6 A;  1TH3 A;  2E5L M;  4DV5 M;  3PXG A;  3HJS A;  4JI7 M;  2XF3 A;  1YSY A;  4Z8X A;  5EQT A;  2XEP A;  1XMO M;  2XD5 A;  5KPR A;  1Z59 A;  2Q2E B;  1IN5 A;  1SXJ D;  2C96 A;  3NBI A;  2HCB A;  1Z5B A;  4L4U A;  1KFV A;  3HSH A;  3QAU A;  3K1J A;  1W5T A;  1G41 A;  3WHK A;  4AKG A;  1IY0 A;  2FFF B;  1QYR A;  3HU2 A;  2O5R A;  3VDU A;  3SAS A;  1K3X A;  4MGY E;  1GKI A;  5EXS A;  4EIW A;  1X37 A;  5KO3 A;  5FSW A;  3GLG B;  4G4N A;  3VKH A;  2CUZ A;  2D7G A;  2XH9 A;  1QZM A;  1NHW C;  3SAV A;  4AQY M;  4MGZ E;  1YU0 A;  4LJ9 A;  1SXJ A;  5ITT A;  3T1H M;  2H1R A;  4LFB M;  1IXS B;  3J27 B;  2EUC A;  4M9S A;  4OJL A;  3U6P A;  4MGI E;  1J5E M;  2UXD M;  2QBY A;  2KA6 B;  2R18 A;  2BJW A;  2JCH A;  3W0F A;  4DR4 M;  2BNK A;  3GLH A;  3FUU A;  3N3F A;  3HHX A;  2DHR A;  4LCB A;  2Y21 A;  4LF6 M;  3MJ5 A;  1TGU A;  2LNH C;  1IY2 A;  3VKG A;  5IWA M;  1XWI A;  3LQQ A;  4NYU A;  2ZAM A;  1IN4 A;  3DZD A;  1JR3 A;  3B9P A;  3K8Z A;  2J7N A;  1N34 M;  5FTJ A;  1Q39 A;  2HKJ A;  1Z6T A;  3L29 A;  1S3S A;  4OW0 A;  2UUC M;  3GPP A;  1OJL A;  1N78 A;  4OUI A;  3AL0 C;  2KRK A;  4FWG A;  1NJG A;  4BLC A;  2F5O A;  3E9S A;  2J7O A;  2QEN A;  1R2Y A;  3SMP A;  4GHL A;  1L8Q A;  2DWZ B;  2CFO A;  4MGH A;  3GLI B;  3JR5 A;  4DR7 M;  1K82 A;  1IBL M;  4X66 M;  4B08 A;  4NOO B;  3DFZ A;  4LRS A;  3T15 A;  3WX7 A;  3IG8 A;  1E9S A;  4X64 M;  4OVZ A;  1QAO A;  4QOS A;  3J81 S;  1TH4 A;  4A3V B;  2IOU A;  4KLN A;  2P5T A;  1TDZ A;  5A2Q S;  4MGK E;  4IBK A;  4L16 A;  2I7N A;  3VFD A;  5KQD A;  4RNA A;  3TE6 A;  4QNR A;  1C1K A;  3PNY A;  3U6O A;  1OFI A;  1UM8 A;  1E9R A;  4DV4 M;  5E26 A;  4LGY A;  4B3S M;  4LJA A;  3I4Y A;  3L28 A;  3BOS A;  1SXJ E;  1YUB A;  4PT5 A;  4FWD A;  3U6E A;  5FLX S;  4DR2 M;  1D2N A;  4IBJ A;  1Q3C A;  2ZBK B;  2RGO A;  3GP1 A;  4DV2 M;  3VK8 A;  1XMQ M;  4I4L A;  3KFU G;  3HWS A;  3THG A;  5ITX A;  4AKH A;  3CF0 A;  2UU9 M;  1XNQ M;  2R4E A;  4MB7 A;  3ZCB B;  1QQW A;  3LMM A;  1DO0 A;  1YE9 A;  1E32 A;  4FW9 A;  2LWX A;  4B3T M;  5IRE B;  2OPF A;  4B7G A;  2X49 A;  3A45 A;  3SBJ A;  4DR6 M;  1L2D A;  4L8R C;  4CHT B;  1SXJ C;  1IN8 A;  2L7H A;  3M7G A;  4IJF A;  4YHH M;  4NZ3 A;  4JI8 M;  4LJ7 A;  1G3I A;  1MX0 A;  3OTO M;  2Y2L A;  3K92 A;  3KOW E;  2Y0Q A;  3U61 B;  3A42 A;  4GIP A;  3U6M A;  4G4Q A;  2QCU A;  1KYI A;  3E4R A;  3KW6 A;  3CF2 A;  3SC3 A;  3SYL A;  3TQS A;  4DV0 M;  1OFH A;  2CHQ A;  3GLF A;  2KRU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...