4IBIA

Ebola virus vp35 bound to small molecule
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
123
structure length
123
Chain Sequence
DISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/transcription inhibitor
molecule keywords Polymerase cofactor VP35
publication title In Silico Derived Small Molecules Bind the Filovirus VP35 Protein and Inhibit Its Polymerase Cofactor Activity.
pubmed doi rcsb
source organism Ebola virus
total genus 44
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ibiA01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4ibiA02
4IBIA 3L26A 3L28A 5BPVA 4GHLA 4IJFA 4IBFA 3L25A 4IBEA 3FKEA 4IBDA 3KS4A 4IBKA 4LG2A 4IBCA 4IBBA 4IBGA 3L2AA 4IJEA 4GH9A 4IBJA 3L27A 3L29A 3KS8A 4GHAA
chains in the Genus database with same CATH superfamily
3N3FA 1VEJA 5EJCA 4GC5A 4NZ4A 1KS0A 3L25A 4EIWA 3W67A 4LCBA 2JCHA 4HL4A 2Q2EB 2HKJA 3BOSA 3GLHE 1GJSA 5C18A 1QO6A 2RTSA 2VQEM 1DO0A 2ZTCA 4IBDA 2UXCM 2R4JA 2C9OA 1GO5A 3RE8A 1IN4A 1HNXM 3K9OA 2Y0QA 2K0BX 4LZZA 3U60B 2ZM6M 4MGZE 3MHVC 3FTFA 1H0IA 2L4EA 1IBKM 4CISA 2DWMA 2FOIC 3HY5A 2R0IA 4XK8F 8CATA 5LMNM 4M9SA 3U6EA 2Y2NA 2CWBA 3WHLA 2R62A 2Y21A 3THGA 1J09A 1TR8A 3I51A 4G4RA 2Y2OA 1FJGM 1MN3A 3U6PA 1A5TA 4YHHM 2L7IA 1XNQM 1IY0A 2OOAA 3GLFA 4CIZA 3FTDA 4LGYA 5IREB 1XNRM 2BWEA 1XXHE 1VEKA 2CRUA 1D2NA 1Q3BA 3I01M 4QOSA 2CP8A 5ITXA 2D7EA 1PJTA 3KP0E 4L4UA 4ZPXA 3FYCA 1WGNA 3A46A 3B9PA 3GLIA 4LF5M 3SFZA 3GRYA 1IN8A 4PDGA 3UGJA 1J5EM 3LVWA 4AG6A 1L2BA 4HMCA 5KPZA 2XFSA 3HX3A 5IWAM 2JZ1A 2JXNA 4LG2A 3U6SA 2WSCF 3HSHA 3SMPA 2VQFM 5JI2E 4GMQA 4IBBA 2Y2QA 5EXPA 2KW0A 4DR2M 3KDSE 2ZTDA 1OFHA 4FCVA 2UUCM 1OTRA 1L2DA 4Z2HA 1NV8A 4BB9A 3RGPA 4OVZB 4KODA 3VFDA 4IBJA 1UR9A 1VQ1A 3LW5F 4L8RC 3FUTA 2CUZA 1T43A 1E6PA 2KNAA 1DGGA 3HJQA 3PXGA 1DGHB 4CGYB 1WJ7A 2MJ5B 4AW4A 4B7HA 2R44A 5FTJA 1KFVA 4X65M 4DV2M 1PJJA 1IXZA 1ZAEA 2G8LA 2WSFF 4I8OA 2O5RA 3FKEA 4LFAM 3GO8A 3GP1A 4Y28F 3A42A 3SHFA 4FW9A 4OJOA 4X64M 3AOGA 4DV5M 1CUKA 2GNOA 3BBZA 1IBMM 3ZCBB 1HR0M 3U60A 1L6JA 3HONA 4M9ZA 1PGYA 2KDLA 4Z6YA 4NYUA 4CHTB 4M9XA 4LJ9A 4JI8M 1R2ZA 1DO2A 1XWIA 4GH9A 4KLNA 3GPUA 2LTUA 2FNAA 1N75A 3GPYA 4JI1M 2ZANA 3W68A 4DR3M 1OIZA 2X4AA 5BPVA 2ZAMA 1N33M 3K92A 1TGUA 1QYRA 1I4WA 2Z3XA 1GKIA 3JR5A 1NO1A 4JI3M 1EE8A 1E94E 4M0WA 1QQWA 2DZLA 2DHYA 5E6JA 2G3QA 2JY6B 4JI6M 2XGNA 1C1KA 2EKKA 3TPZA 4JI4M 1S3SA 1G41A 2CEAA 4Z2LA 3AKZA 4WP2A 3R9XB 1E6ZA 2JY5A 3K1JA 5FTMA 3D8LA 4JI2M 3E9SA 2G5GX 3UK6A 5C1BA 3GPXA 1R2YA 1HT1E 2RGOA 3CF6E 2N35A 2XLJA 1D0MA 1NVMA 4AQYM 1P3QQ 3DFZA 2F5SA 3SC3A 3T6PA 3LQQA 2DWZB 4OVZA 3SAVA 4KO8A 1J7MA 3MJ5A 3AOEA 2JWSA 3U5ZB 2C96A 1IN7A 2OO9A 3DA1A 3L26A 3LMMA 1X37A 2CV1A 1XHBA 4B3RM 2DXIA 1DGHA 1SXJC 2CE7A 2RGHA 2E5LM 1YU3A 2F5NA 2A5YB 3GLHB 4IBEA 3I04M 1PRBA 2O25A 1YU1A 1K82A 4QOZC 4AKHA 2XEPA 1VG5A 3KP1E 1G3IA 3WHKA 4B3TM 1JR3E 1PDCA 3HHYA 5KQDA 4PDIA 4OUIA 3KSXA 4LF8M 4L6V6 1VEGA 2DZNB 1LV7A 3K2LA 1KSFX 4IJEA 3U6QA 3VK7A 2XZUA 2ZBKB 1ZMVA 1V33A 4DV0M 4MGIE 1C7YA 3SHGB 3U61B 3TWLA 4TUWA 1OGGA 1TF0B 4HMDA 3CTWB 3FUUA 3FTEA 1T6OA 1GXDA 4XBOA 1IN6A 2BNKA 2LH0A 2OOBA 2I7PA 2M60A 3GRRA 2R65A 1XXHB 1L2CA 4OX9M 4REZA 1V92A 4S12A 2CV0A 1OGBA 1AIPC 3VDUA 1L1TA 1F4IA 2K6BA 3J2PB 2CFOA 4BLCA 4D80A 1UFZA 1N78A 1EAKA 1IQPA 2DAGA 4MM3B 2C99A 1T3TA 4JI7M 4OJ6A 2JY7A 1DGBA 2R45A 2RRUA 4MB5A 3KOXE 1D0KA 5EXSA 3T38A 4DR5M 1R7RA 3AL0C 3MK6A 3AV0A 4WURA 1SXJE 3L29A 4NC6A 3IECA 2DENA 4OW0A 4G4OA 5IZ7D 4L78A 2BG1A 3GQ4A 1IBLM 1Q39A 4LFBM 3EIEA 2Y2JA 4B3SM 1GL6A 4W5WA 3U5ZA 1IM2A 4LZJA 2J7NA 1GABA 1RU3A 4LRTA 2EKFA 3KW6A 1LTMA 1OQYA 5DNYA 1YE9A 3HKPA 4MGHA 5ITYA 3VLFB 1K3WA 1YSYA 1UR8A 1HJPA 2NQ8C 1GL7A 3J7BA 3GLHA 4IBKA 2F4VM 3PNVA 3FUXA 4NXNM 3KOZE 4NZ1A 2CHVA 5KQ8A 4FWGA 5H37D 2KZUA 3F92A 2X8AA 4GITA 4LGMA 5KO3A 4OJPA 1MJGM 5EXTA 4OJ5A 3HHXA 1E9SA 2DAEA 4G4NA 4HEOA 1OFIA 3DOAA 3FUVA 2F5OA 1HQYE 4NXMM 3M6AA 3UMMA 2V1CA 3NBIA 4X66M 2XD5A 3B74A 3H4MA 4FCWA 4I81A 3B7QA 3U61A 1AIWA 3AOEC 2LVQD 1JB0F 2XF3A 5A2QS 2CHQA 4IBFA 2XD1A 2LHCA 2I7NA 1W5TA 4F2LA 3UJNA 4KT0F 1PJQA 1XXHA 2FN2A 2L6OA 2CHGA 5EP2A 1ZV1A 3UZUA 2DZOB 2IOUA 2Y2MA 4PD2A 3Q8GA 3AJIB 4I5SA 3SYLA 1Z5BA 2MGWA 2XSZD 4LFCM 3WD0A 4MH0E 3E4RA 1NY6A 4QHTA 3VDPA 7CATA 4HMEA 4R3DA 4NZ5A 4QNRA 4ANRA 3KVWA 1AUAA 1FNNA 4CJ6A 3LCUA 2FFJA 2L7HA 3SBJA 4GIPA 4DR6M 3QYBA 5FSWA 4L16A 2R6FA 2DKLA 5ITQA 1Q3CA 4IBIA 5FLXS 5LMUM 3U6MA 2XH9A 4GHLA 4FD2A 1ZMWA 5EQTA 2VF7A 4IJFA 3KOYE 3MQLA 4MB7A 2HCBA 1YLAA 2DAMA 4NRWA 2LVNC 4X62M 1TDHA 2LBCA 1NJFA 2Y2LA 5JI3E 2BWBA 4P17A 3IG5A 2O01F 3GLGE 4JI5M 3AFHA 3SAUA 4DR1M 1Z5CA 3KOWE 2C5RA 4II7A 4LJ6A 1GPFA 1Z5AA 5BR8M 4DUYM 1N32M 3VKGA 1E8BA 1CK7A 2UU9M 2QENA 1YUEA 2QBYB 4LRSA 2Y0TA 2YNMD 4NYYA 1TDZA 2R18A 2LVPC 1VDDA 4PT5A 1DV0A 1VDLA 4NRVA 3SAWA 1GVNA 3L28A 2X49A 1PJSA 4K0KM 1QAQA 4DV6M 2LHGA 3JAMS 1E15A 2JA2A 4AZFA 4DBGB 4NY2A 3V76A 3HHZA 4DR4M 3LCVB 3PVSA 3PFIA 1NY5A 2LVOC 1NHGC 2F5QA 4JI0M 3KS4A 4OU7A 1PM5A 3H4JA 2KRUA 3FUWA 5FTKA 3TWKA 3FRHA 5EP3A 1ZMUA 2WSEF 2WZJA 3IG8A 5IT9S 2XFTA 2KXEA 1QDTA 1N77A 3FD9A 2FS1A 2Z8YM 4G6ZA 3J27B 5ITRA 1YU2A 1HQCA 3TQSA 2UXDM 3HU2A 1SXJB 2KNVA 3PNYA 2XSZA 3GRVA 1IY2A 2JY8A 2QZ4A 4GHAA 4GKKM 4B3MM 1Z6TA 3RFWA 3HWSA 5EXXA 1HNZM 2VDBB 1QZEA 1E32A 4R71A 2LNHC 3GQ5A 2ZAOA 4DV4M 1GLNA 2L2DA 3SARA 1ED7A 3T1YM 1MX0A 3KXEC 4Z8XA 2H1RA 4DV1M 3E21A 2J5YA 4MB3A 2LWXA 3EIHA 3J7AS 3ZQJA 4DR7M 1W1VA 4Z2KA 1E9RA 2DWNA 1Y8GA 3Q8XA 4AKIA 1JR3A 3TWMA 3I4VA 1H0GA 2BJWA 3HHWA 4QNMA 1V34A 1N34M 1D0LA 2Y2KA 1H8PA 5DYIA 2ERCA 2EJSA 4RF0A 3GLFE 1OJLA 1OIPA 1NNUC 3A98B 1K3XA 2Y2GA 1R5LA 3C3EA 2UUBM 4D82A 3J81S 2QBYA 5ITXE 3GLIE 1BVSA 1KYIA 3SASA 1YUBA 2Z7JA 5F3WA 1Q02A 1L1ZA 2FE8A 1Z59A 3ZH9B 4LJAA 1XC8A 1J7KA 1QVRA 2D49A 1O6IA 3HJ8A 2D7GA 4NSRA 2OQ4A 4NZ3A 4GKJM 3CF0A 2KA6B 2UUAM 2QCUA 2RKOA 3W0LB 3FE3A 3GQ3A 2MR9A 2R46A 1W1PA 3HGIA 4JYAM 1ZQ9A 1I94M 5EP4A 3RGSA 4B08A 1DGFA 4LF4M 1UM8A 3C58A 4LF7M 1JQJC 2KEBA 4UN2B 2KZSA 3SYKA 2Y20A 3VK8A 4KHPM 1OAOC 3QYEA 3KSJA 3TL4X 3JR4A 1MU5A 2QSFX 4A3VB 1HT2E 1IY1A 1SXJA 4JXJA 2XZFA 2DVWB 1QZMA 3GRUA 4I4LA 3KFUG 1E6NA 2HWJA 1CXWA 2VIIA 5DFLA 2V6ZM 1W1TA 3B7ZA 4FWDA 1SG9A 3IHPA 4AKGA 1NHWC 4BBAA 1PJIA 2EUCA 3M7GA 3GLGB 3J80S 3D8BA 4RKUF 1TH4A 5DYGA 1NV9A 3HU1A 1HNWM 3U6LA 2HAKA 1E88A 4F1IA 3GPPA 2H5XA 4LF6M 3WD2A 2K9DA 1XMOM 4PCZA 1QDRA 2Y2PA 1GOIA 2YR0A 4GRIA 1NNJA 2FH0A 3C3DA 4B7GA 1IN5A 1IXSB 2GQFA 2JZ0A 5GKNA 4ITQA 3VKHA 3WD3A 3T1HM 2V5OA 2EO2A 2L4FA 3HU3A 2MH8A 3U6OA 2Y2IA 4LJ7A 5EP1A 5L8RF 2DNAA 2MROB 2W82A 4RNAA 1JR3D 2P5TA 2HL7A 3NBXX 1R4GA 4DUZM 1QAMA 1WR1B 1IFYA 3FYDA 2DHRA 4L15A 1H6UA 4NSOB 1R6BX 4NL4H 2AHMA 1IXRC 1OAIA 3CF2A 3HJSA 4LF9M 1N36M 1QANA 4GC9A 3CGWA 4IBGA 5E26A 2LVAA 1NSFA 3M0EA 2EA0A 1QAOA 5FTLA 4G4QA 2CV2A 1GJTA 3L2AA 3SMSA 4LJ5A 4Q7JA 2HHHM 1YU0A 4IIWA 2L09A 1OKSA 3BXWA 2QNJA 4LY6A 3L27A 4G3OA 3T15A 4XGIA 1NJGA 4OJLA 1L8QA 4JN6A 2QPAA 4DV7M 4AG5A 3KS8A 4Z2GA 2KRKA 4M0DA 2DI0A 2K47A 1XB2B 1G71A 1WXQA 4QNLA 4DV3M 4FVMA 1G59A 2D7HA 5FTNA 2UXBM 2APLA 3MMPA 1E6RA 4P16A 1G4AE 2YFQA 2JP7A 4MGKE 2OPFA 3A45A 4JV5M 4Z2IA 1G8PA 2Z4SA 1QUSA 3ILKA 2QP9X 3B89A 3E46A 4TX8A 4WW0A 3WD1A 1SXJD 3LVVA 3W0FA 5KPTA 2FFFB 4FCTA 3FTCA 3SATA 3WD4A 1QUTA 3K8ZA 3GLGA 2V1UA 1TH2A 4Z2JA 2R4EA 4HLQA 3K9PA 1WIVA 4QHSA 3QAUA 3HZJA 4NOOB 3GLFB 3WX7A 1W1YA 2F5PA 3FRIA 1EIJA 3C9PA 3GLIB 2J7OA 4R7GA 2JNHA 2VF8A 2Y2HA 1IXSA 4MGYE 3DZDA 1W5SA 1ORYB 1YU4A 4B7FA 1EFUB 2QQ8A 3NWLA 4GEWA 2C9CA 5KPRA 3LQRA 3TE6A 2DWLA 1TH3A 4MB4A 3R8FA 1WGLA 4YY3M 3M7PA 2M5ZA 2QHOB 4AI6A 4RF1A 3ZC7B 4IBCA 5ITTA 3OTOM 2DAKA 2BJVA 1XMQM 4FWHA 2UWXA 3U6CA 4LJ8A 1WHCA 2C98A 2YQZA 2DAIA 3I4YA 3QWLA 3B7NA 2JE5A 2Z4RA 2JUJA 4LJ4A 2LXEA 1TTEA 2KNZA 5ITUA 2B3TA 3U6DA 4D81A 2KHHA
chains in the Genus database with same CATH topology
3N3FA 5EJCA 4GC5A 4NZ4A 3L25A 4EIWA 4LCBA 2JCHA 4HL4A 2Q2EB 2HKJA 3BOSA 5C18A 2VQEM 1DO0A 4IBDA 2UXCM 2R4JA 2C9OA 3RE8A 1IN4A 1HNXM 2Y0QA 4LZZA 3U60B 2ZM6M 4MGZE 3MHVC 3FTFA 1IBKM 4CISA 2DWMA 2FOIC 8CATA 5LMNM 4M9SA 3U6EA 2Y2NA 3WHLA 2R62A 2Y21A 3THGA 1J09A 4G4RA 3I51A 2Y2OA 1FJGM 3U6PA 4YHHM 2L7IA 1XNQM 1IY0A 3GLFA 3FTDA 4LGYA 5IREB 1XNRM 1D2NA 1Q3BA 4QOSA 3SFZA 5ITXA 2D7EA 3KP0E 4L4UA 4ZPXA 3A46A 3FYCA 3GLIA 4LF5M 3B9PA 3GRYA 1IN8A 4PDGA 3UGJA 1J5EM 3LVWA 4AG6A 1L2BA 5KPZA 2XFSA 5IWAM 4LG2A 3U6SA 3HSHA 3SMPA 2VQFM 5JI2E 4GMQA 4IBBA 2Y2QA 5EXPA 2KW0A 4DR2M 3KDSE 1OFHA 4FCVA 2UUCM 1L2DA 4BB9A 3RGPA 4OVZB 4KODA 3VFDA 4IBJA 4L8RC 3FUTA 2CUZA 3HJQA 1DGGA 3PXGA 4CGYB 1DGHB 4AW4A 4B7HA 5FTJA 1KFVA 4X65M 4DV2M 1PJJA 1IXZA 1ZAEA 2G8LA 4I8OA 2O5RA 3FKEA 4LFAM 3GO8A 3GP1A 3A42A 3SHFA 4FW9A 4OJOA 4X64M 3AOGA 4DV5M 1IBMM 3ZCBB 1HR0M 3U60A 3HONA 4M9ZA 4Z6YA 4NYUA 4CHTB 4M9XA 4LJ9A 4JI8M 1R2ZA 1DO2A 1XWIA 4GH9A 4KLNA 3GPUA 2FNAA 1N75A 3GPYA 4JI1M 2ZANA 4DR3M 2X4AA 5BPVA 2ZAMA 1N33M 3K92A 1TGUA 1QYRA 1I4WA 2Z3XA 1GKIA 3JR5A 4JI3M 1EE8A 1E94E 4M0WA 1QQWA 5E6JA 4JI6M 2XGNA 1C1KA 3TPZA 4JI4M 1S3SA 1G41A 2CEAA 3AKZA 3R9XB 3K1JA 5FTMA 3D8LA 4JI2M 3E9SA 2G5GX 3UK6A 5C1BA 3GPXA 1R2YA 1HT1E 2RGOA 3CF6E 2XLJA 1NVMA 4AQYM 3DFZA 2F5SA 3SC3A 3LQQA 2DWZB 4OVZA 3SAVA 4KO8A 3MJ5A 3AOEA 3U5ZB 2C96A 1IN7A 3DA1A 2CV1A 3L26A 3LMMA 1X37A 4B3RM 1XHBA 2DXIA 1DGHA 1SXJC 2CE7A 2RGHA 2E5LM 1YU3A 2F5NA 2A5YB 3GLHB 4IBEA 1YU1A 1K82A 4QOZC 4AKHA 2XEPA 3KP1E 1G3IA 3WHKA 4B3TM 3HHYA 5KQDA 4PDIA 4OUIA 3KSXA 4LF8M 2DZNB 1LV7A 3K2LA 1KSFX 4IJEA 3U6QA 3VK7A 2XZUA 2ZBKB 4DV0M 4MGIE 4TUWA 3SHGB 3U61B 3TWLA 3CTWB 3FUUA 3FTEA 4XBOA 1IN6A 2BNKA 2LH0A 2I7PA 2M60A 3GRRA 2R65A 1XXHB 1L2CA 4OX9M 4REZA 4S12A 2CV0A 3VDUA 1L1TA 3J2PB 2CFOA 4BLCA 4D80A 1N78A 1IQPA 4MM3B 2C99A 1T3TA 4JI7M 4OJ6A 1DGBA 2R45A 3KOXE 5EXSA 3T38A 4DR5M 3AL0C 1R7RA 3MK6A 3AV0A 4WURA 1SXJE 3L29A 4G4OA 4OW0A 2BG1A 5IZ7D 4L78A 3GQ4A 1IBLM 1Q39A 4LFBM 3EIEA 2Y2JA 4B3SM 1GL6A 4W5WA 3U5ZA 1IM2A 4LZJA 2J7NA 4LRTA 3KW6A 4OJPA 5DNYA 1YE9A 3HKPA 4MGHA 5ITYA 3VLFB 1K3WA 1YSYA 2NQ8C 3J7BA 1GL7A 4IBKA 3GLHA 2F4VM 3PNVA 3FUXA 4NXNM 3KOZE 4NZ1A 2CHVA 5KQ8A 4FWGA 5H37D 2KZUA 4LGMA 2X8AA 4GITA 5KO3A 5EXTA 4OJ5A 3HHXA 1E9SA 4G4NA 2F5OA 1OFIA 3DOAA 3FUVA 1HQYE 4NXMM 3M6AA 3UMMA 2V1CA 3NBIA 4X66M 2XD5A 3H4MA 4FCWA 4I81A 3U61A 3AOEC 2XF3A 5A2QS 2CHQA 4IBFA 2XD1A 2I7NA 1W5TA 3UJNA 1XXHA 2L6OA 2CHGA 5EP2A 3UZUA 2IOUA 2DZOB 2Y2MA 4PD2A 4I5SA 3AJIB 3SYLA 1Z5BA 4LFCM 2XSZD 4MH0E 3E4RA 1NY6A 4QHTA 3VDPA 7CATA 4NZ5A 4R3DA 4QNRA 3KVWA 1FNNA 2FFJA 2L7HA 3SBJA 4GIPA 4DR6M 5FSWA 4L16A 5ITQA 5LMUM 1Q3CA 4IBIA 5FLXS 3U6MA 2XH9A 4GHLA 4FD2A 5EQTA 4IJFA 3KOYE 4MB7A 2HCBA 4NRWA 4X62M 1TDHA 1NJFA 2Y2LA 5JI3E 3IG5A 4JI5M 3AFHA 3SAUA 4DR1M 1Z5CA 3KOWE 2C5RA 4II7A 4LJ6A 1Z5AA 5BR8M 4DUYM 1N32M 3VKGA 1YUEA 2UU9M 2QENA 2QBYB 4LRSA 2Y0TA 2YNMD 4NYYA 1TDZA 2R18A 4PT5A 1VDDA 4NRVA 3SAWA 1GVNA 3L28A 2X49A 4K0KM 1QAQA 4DV6M 3JAMS 2JA2A 4AZFA 4NY2A 3HHZA 4DR4M 3PVSA 3PFIA 1NY5A 1NHGC 2F5QA 4JI0M 3KS4A 4OU7A 1PM5A 2KRUA 3FUWA 5FTKA 3TWKA 5EP3A 3IG8A 5IT9S 2XFTA 2KXEA 1N77A 3FD9A 4G6ZA 3J27B 5ITRA 1YU2A 1HQCA 3TQSA 2UXDM 3HU2A 1SXJB 3PNYA 2XSZA 3GRVA 1IY2A 2QZ4A 4GKKM 4GHAA 4B3MM 1Z6TA 3RFWA 3HWSA 5EXXA 1HNZM 1E32A 2LNHC 3GQ5A 2ZAOA 4DV4M 1GLNA 3SARA 3T1YM 1MX0A 3KXEC 4Z8XA 2H1RA 4DV1M 2LWXA 3EIHA 3J7AS 4DR7M 1E9RA 2DWNA 3Q8XA 4AKIA 1JR3A 3TWMA 3I4VA 2BJWA 3HHWA 4QNMA 1N34M 2Y2KA 5DYIA 2ERCA 4RF0A 1OJLA 1NNUC 3A98B 1K3XA 2Y2GA 2UUBM 4D82A 3J81S 2QBYA 5ITXE 1KYIA 3SASA 1YUBA 2Z7JA 5F3WA 1L1ZA 2FE8A 1Z59A 3ZH9B 4LJAA 1XC8A 1J7KA 1QVRA 3HJ8A 2D7GA 4NSRA 2OQ4A 4NZ3A 4GKJM 3CF0A 2KA6B 2UUAM 2QCUA 2RKOA 3W0LB 3GQ3A 2R46A 3HGIA 4JYAM 1ZQ9A 1I94M 5EP4A 3RGSA 4B08A 1DGFA 4LF4M 1UM8A 3C58A 4LF7M 1JQJC 2KEBA 2KZSA 3SYKA 2Y20A 3VK8A 4KHPM 3KSJA 3TL4X 3JR4A 1MU5A 4A3VB 1HT2E 1IY1A 1SXJA 4JXJA 2XZFA 2DVWB 1QZMA 3GRUA 4I4LA 3KFUG 2VIIA 2V6ZM 4FWDA 4AKGA 1NHWC 4BBAA 1PJIA 2EUCA 3M7GA 3GLGB 3J80S 3D8BA 5DYGA 1TH4A 3HU1A 1HNWM 3U6LA 3GPPA 4LF6M 1XMOM 4PCZA 2Y2PA 2YR0A 4GRIA 1NNJA 3VKHA 4B7GA 1IN5A 1IXSB 4ITQA 5GKNA 3T1HM 2EO2A 3HU3A 3U6OA 2Y2IA 4LJ7A 5EP1A 2W82A 4RNAA 1JR3D 2P5TA 2HL7A 4DUZM 1QAMA 3FYDA 2DHRA 4L15A 1H6UA 4NSOB 1R6BX 4NL4H 2AHMA 1IXRC 3HJSA 3CF2A 4LF9M 1N36M 1QANA 4GC9A 4IBGA 5E26A 1NSFA 3M0EA 2EA0A 1QAOA 5FTLA 4G4QA 2CV2A 3L2AA 3SMSA 2HHHM 4LJ5A 1YU0A 4IIWA 2L09A 4LY6A 3L27A 3T15A 4XGIA 1NJGA 4OJLA 1L8QA 4JN6A 2QPAA 4DV7M 4AG5A 3KS8A 2KRKA 4M0DA 2K47A 1WXQA 4QNLA 4DV3M 4FVMA 1G59A 2D7HA 5FTNA 2UXBM 4P16A 1G4AE 2YFQA 4MGKE 2OPFA 3A45A 4JV5M 1G8PA 2Z4SA 3ILKA 2QP9X 4WW0A 1SXJD 3LVVA 3W0FA 5KPTA 2FFFB 4FCTA 3FTCA 3SATA 3K8ZA 3GLGA 2V1UA 1TH2A 2R4EA 4HLQA 4QHSA 3QAUA 3GLFB 4NOOB 3WX7A 2F5PA 3GLIB 2J7OA 4R7GA 2Y2HA 4MGYE 3DZDA 1W5SA 1ORYB 1YU4A 4B7FA 3NWLA 2C9CA 5KPRA 3LQRA 3TE6A 2DWLA 1TH3A 3R8FA 4YY3M 2M5ZA 4AI6A 4RF1A 3ZC7B 4IBCA 5ITTA 3OTOM 2BJVA 1XMQM 4FWHA 2UWXA 3U6CA 4LJ8A 2C98A 3QWLA 3I4YA 2JE5A 2Z4RA 4LJ4A 2LXEA 5ITUA 2YQZA 3U6DA 4D81A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IBI A;  3L26 A;  3L28 A;  5BPV A;  4GHL A;  4IJF A;  4IBF A;  3L25 A;  4IBE A;  3FKE A;  4IBD A;  3KS4 A;  4IBK A;  4LG2 A;  4IBC A;  4IBB A;  4IBG A;  3L2A A;  4IJE A;  4GH9 A;  4IBJ A;  3L27 A;  3L29 A;  3KS8 A;  4GHA A; 
#chains in the Genus database with same CATH topology
 3N3F A;  1VEJ A;  5EJC A;  4GC5 A;  4NZ4 A;  1KS0 A;  3L25 A;  4EIW A;  3W67 A;  4LCB A;  2JCH A;  4HL4 A;  2Q2E B;  2HKJ A;  3BOS A;  3GLH E;  1GJS A;  5C18 A;  1QO6 A;  2RTS A;  2VQE M;  1DO0 A;  2ZTC A;  4IBD A;  2UXC M;  2R4J A;  2C9O A;  1GO5 A;  3RE8 A;  1IN4 A;  1HNX M;  3K9O A;  2Y0Q A;  2K0B X;  4LZZ A;  3U60 B;  2ZM6 M;  4MGZ E;  3MHV C;  3FTF A;  1H0I A;  2L4E A;  1IBK M;  4CIS A;  2DWM A;  2FOI C;  3HY5 A;  2R0I A;  4XK8 F;  8CAT A;  5LMN M;  4M9S A;  3U6E A;  2Y2N A;  2CWB A;  3WHL A;  2R62 A;  2Y21 A;  3THG A;  1J09 A;  1TR8 A;  3I51 A;  4G4R A;  2Y2O A;  1FJG M;  1MN3 A;  3U6P A;  1A5T A;  4YHH M;  2L7I A;  1XNQ M;  1IY0 A;  2OOA A;  3GLF A;  4CIZ A;  3FTD A;  4LGY A;  5IRE B;  1XNR M;  2BWE A;  1XXH E;  1VEK A;  2CRU A;  1D2N A;  1Q3B A;  3I01 M;  4QOS A;  2CP8 A;  5ITX A;  2D7E A;  1PJT A;  3KP0 E;  4L4U A;  4ZPX A;  3FYC A;  1WGN A;  3A46 A;  3B9P A;  3GLI A;  4LF5 M;  3SFZ A;  3GRY A;  1IN8 A;  4PDG A;  3UGJ A;  1J5E M;  3LVW A;  4AG6 A;  1L2B A;  4HMC A;  5KPZ A;  2XFS A;  3HX3 A;  5IWA M;  2JZ1 A;  2JXN A;  4LG2 A;  3U6S A;  2WSC F;  3HSH A;  3SMP A;  2VQF M;  5JI2 E;  4GMQ A;  4IBB A;  2Y2Q A;  5EXP A;  2KW0 A;  4DR2 M;  3KDS E;  2ZTD A;  1OFH A;  4FCV A;  2UUC M;  1OTR A;  1L2D A;  4Z2H A;  1NV8 A;  4BB9 A;  3RGP A;  4OVZ B;  4KOD A;  3VFD A;  4IBJ A;  1UR9 A;  1VQ1 A;  3LW5 F;  4L8R C;  3FUT A;  2CUZ A;  1T43 A;  1E6P A;  2KNA A;  1DGG A;  3HJQ A;  3PXG A;  1DGH B;  4CGY B;  1WJ7 A;  2MJ5 B;  4AW4 A;  4B7H A;  2R44 A;  5FTJ A;  1KFV A;  4X65 M;  4DV2 M;  1PJJ A;  1IXZ A;  1ZAE A;  2G8L A;  2WSF F;  4I8O A;  2O5R A;  3FKE A;  4LFA M;  3GO8 A;  3GP1 A;  4Y28 F;  3A42 A;  3SHF A;  4FW9 A;  4OJO A;  4X64 M;  3AOG A;  4DV5 M;  1CUK A;  2GNO A;  3BBZ A;  1IBM M;  3ZCB B;  1HR0 M;  3U60 A;  1L6J A;  3HON A;  4M9Z A;  1PGY A;  2KDL A;  4Z6Y A;  4NYU A;  4CHT B;  4M9X A;  4LJ9 A;  4JI8 M;  1R2Z A;  1DO2 A;  1XWI A;  4GH9 A;  4KLN A;  3GPU A;  2LTU A;  2FNA A;  1N75 A;  3GPY A;  4JI1 M;  2ZAN A;  3W68 A;  4DR3 M;  1OIZ A;  2X4A A;  5BPV A;  2ZAM A;  1N33 M;  3K92 A;  1TGU A;  1QYR A;  1I4W A;  2Z3X A;  1GKI A;  3JR5 A;  1NO1 A;  4JI3 M;  1EE8 A;  1E94 E;  4M0W A;  1QQW A;  2DZL A;  2DHY A;  5E6J A;  2G3Q A;  2JY6 B;  4JI6 M;  2XGN A;  1C1K A;  2EKK A;  3TPZ A;  4JI4 M;  1S3S A;  1G41 A;  2CEA A;  4Z2L A;  3AKZ A;  4WP2 A;  3R9X B;  1E6Z A;  2JY5 A;  3K1J A;  5FTM A;  3D8L A;  4JI2 M;  3E9S A;  2G5G X;  3UK6 A;  5C1B A;  3GPX A;  1R2Y A;  1HT1 E;  2RGO A;  3CF6 E;  2N35 A;  2XLJ A;  1D0M A;  1NVM A;  4AQY M;  1P3Q Q;  3DFZ A;  2F5S A;  3SC3 A;  3T6P A;  3LQQ A;  2DWZ B;  4OVZ A;  3SAV A;  4KO8 A;  1J7M A;  3MJ5 A;  3AOE A;  2JWS A;  3U5Z B;  2C96 A;  1IN7 A;  2OO9 A;  3DA1 A;  3L26 A;  3LMM A;  1X37 A;  2CV1 A;  1XHB A;  4B3R M;  2DXI A;  1DGH A;  1SXJ C;  2CE7 A;  2RGH A;  2E5L M;  1YU3 A;  2F5N A;  2A5Y B;  3GLH B;  4IBE A;  3I04 M;  1PRB A;  2O25 A;  1YU1 A;  1K82 A;  4QOZ C;  4AKH A;  2XEP A;  1VG5 A;  3KP1 E;  1G3I A;  3WHK A;  4B3T M;  1JR3 E;  1PDC A;  3HHY A;  5KQD A;  4PDI A;  4OUI A;  3KSX A;  4LF8 M;  4L6V 6;  1VEG A;  2DZN B;  1LV7 A;  3K2L A;  1KSF X;  4IJE A;  3U6Q A;  3VK7 A;  2XZU A;  2ZBK B;  1ZMV A;  1V33 A;  4DV0 M;  4MGI E;  1C7Y A;  3SHG B;  3U61 B;  3TWL A;  4TUW A;  1OGG A;  1TF0 B;  4HMD A;  3CTW B;  3FUU A;  3FTE A;  1T6O A;  1GXD A;  4XBO A;  1IN6 A;  2BNK A;  2LH0 A;  2OOB A;  2I7P A;  2M60 A;  3GRR A;  2R65 A;  1XXH B;  1L2C A;  4OX9 M;  4REZ A;  1V92 A;  4S12 A;  2CV0 A;  1OGB A;  1AIP C;  3VDU A;  1L1T A;  1F4I A;  2K6B A;  3J2P B;  2CFO A;  4BLC A;  4D80 A;  1UFZ A;  1N78 A;  1EAK A;  1IQP A;  2DAG A;  4MM3 B;  2C99 A;  1T3T A;  4JI7 M;  4OJ6 A;  2JY7 A;  1DGB A;  2R45 A;  2RRU A;  4MB5 A;  3KOX E;  1D0K A;  5EXS A;  3T38 A;  4DR5 M;  1R7R A;  3AL0 C;  3MK6 A;  3AV0 A;  4WUR A;  1SXJ E;  3L29 A;  4NC6 A;  3IEC A;  2DEN A;  4OW0 A;  4G4O A;  5IZ7 D;  4L78 A;  2BG1 A;  3GQ4 A;  1IBL M;  1Q39 A;  4LFB M;  3EIE A;  2Y2J A;  4B3S M;  1GL6 A;  4W5W A;  3U5Z A;  1IM2 A;  4LZJ A;  2J7N A;  1GAB A;  1RU3 A;  4LRT A;  2EKF A;  3KW6 A;  1LTM A;  1OQY A;  5DNY A;  1YE9 A;  3HKP A;  4MGH A;  5ITY A;  3VLF B;  1K3W A;  1YSY A;  1UR8 A;  1HJP A;  2NQ8 C;  1GL7 A;  3J7B A;  3GLH A;  4IBK A;  2F4V M;  3PNV A;  3FUX A;  4NXN M;  3KOZ E;  4NZ1 A;  2CHV A;  5KQ8 A;  4FWG A;  5H37 D;  2KZU A;  3F92 A;  2X8A A;  4GIT A;  4LGM A;  5KO3 A;  4OJP A;  1MJG M;  5EXT A;  4OJ5 A;  3HHX A;  1E9S A;  2DAE A;  4G4N A;  4HEO A;  1OFI A;  3DOA A;  3FUV A;  2F5O A;  1HQY E;  4NXM M;  3M6A A;  3UMM A;  2V1C A;  3NBI A;  4X66 M;  2XD5 A;  3B74 A;  3H4M A;  4FCW A;  4I81 A;  3B7Q A;  3U61 A;  1AIW A;  3AOE C;  2LVQ D;  1JB0 F;  2XF3 A;  5A2Q S;  2CHQ A;  4IBF A;  2XD1 A;  2LHC A;  2I7N A;  1W5T A;  4F2L A;  3UJN A;  4KT0 F;  1PJQ A;  1XXH A;  2FN2 A;  2L6O A;  2CHG A;  5EP2 A;  1ZV1 A;  3UZU A;  2DZO B;  2IOU A;  2Y2M A;  4PD2 A;  3Q8G A;  3AJI B;  4I5S A;  3SYL A;  1Z5B A;  2MGW A;  2XSZ D;  4LFC M;  3WD0 A;  4MH0 E;  3E4R A;  1NY6 A;  4QHT A;  3VDP A;  7CAT A;  4HME A;  4R3D A;  4NZ5 A;  4QNR A;  4ANR A;  3KVW A;  1AUA A;  1FNN A;  4CJ6 A;  3LCU A;  2FFJ A;  2L7H A;  3SBJ A;  4GIP A;  4DR6 M;  3QYB A;  5FSW A;  4L16 A;  2R6F A;  2DKL A;  5ITQ A;  1Q3C A;  4IBI A;  5FLX S;  5LMU M;  3U6M A;  2XH9 A;  4GHL A;  4FD2 A;  1ZMW A;  5EQT A;  2VF7 A;  4IJF A;  3KOY E;  3MQL A;  4MB7 A;  2HCB A;  1YLA A;  2DAM A;  4NRW A;  2LVN C;  4X62 M;  1TDH A;  2LBC A;  1NJF A;  2Y2L A;  5JI3 E;  2BWB A;  4P17 A;  3IG5 A;  2O01 F;  3GLG E;  4JI5 M;  3AFH A;  3SAU A;  4DR1 M;  1Z5C A;  3KOW E;  2C5R A;  4II7 A;  4LJ6 A;  1GPF A;  1Z5A A;  5BR8 M;  4DUY M;  1N32 M;  3VKG A;  1E8B A;  1CK7 A;  2UU9 M;  2QEN A;  1YUE A;  2QBY B;  4LRS A;  2Y0T A;  2YNM D;  4NYY A;  1TDZ A;  2R18 A;  2LVP C;  1VDD A;  4PT5 A;  1DV0 A;  1VDL A;  4NRV A;  3SAW A;  1GVN A;  3L28 A;  2X49 A;  1PJS A;  4K0K M;  1QAQ A;  4DV6 M;  2LHG A;  3JAM S;  1E15 A;  2JA2 A;  4AZF A;  4DBG B;  4NY2 A;  3V76 A;  3HHZ A;  4DR4 M;  3LCV B;  3PVS A;  3PFI A;  1NY5 A;  2LVO C;  1NHG C;  2F5Q A;  4JI0 M;  3KS4 A;  4OU7 A;  1PM5 A;  3H4J A;  2KRU A;  3FUW A;  5FTK A;  3TWK A;  3FRH A;  5EP3 A;  1ZMU A;  2WSE F;  2WZJ A;  3IG8 A;  5IT9 S;  2XFT A;  2KXE A;  1QDT A;  1N77 A;  3FD9 A;  2FS1 A;  2Z8Y M;  4G6Z A;  3J27 B;  5ITR A;  1YU2 A;  1HQC A;  3TQS A;  2UXD M;  3HU2 A;  1SXJ B;  2KNV A;  3PNY A;  2XSZ A;  3GRV A;  1IY2 A;  2JY8 A;  2QZ4 A;  4GHA A;  4GKK M;  4B3M M;  1Z6T A;  3RFW A;  3HWS A;  5EXX A;  1HNZ M;  2VDB B;  1QZE A;  1E32 A;  4R71 A;  2LNH C;  3GQ5 A;  2ZAO A;  4DV4 M;  1GLN A;  2L2D A;  3SAR A;  1ED7 A;  3T1Y M;  1MX0 A;  3KXE C;  4Z8X A;  2H1R A;  4DV1 M;  3E21 A;  2J5Y A;  4MB3 A;  2LWX A;  3EIH A;  3J7A S;  3ZQJ A;  4DR7 M;  1W1V A;  4Z2K A;  1E9R A;  2DWN A;  1Y8G A;  3Q8X A;  4AKI A;  1JR3 A;  3TWM A;  3I4V A;  1H0G A;  2BJW A;  3HHW A;  4QNM A;  1V34 A;  1N34 M;  1D0L A;  2Y2K A;  1H8P A;  5DYI A;  2ERC A;  2EJS A;  4RF0 A;  3GLF E;  1OJL A;  1OIP A;  1NNU C;  3A98 B;  1K3X A;  2Y2G A;  1R5L A;  3C3E A;  2UUB M;  4D82 A;  3J81 S;  2QBY A;  5ITX E;  3GLI E;  1BVS A;  1KYI A;  3SAS A;  1YUB A;  2Z7J A;  5F3W A;  1Q02 A;  1L1Z A;  2FE8 A;  1Z59 A;  3ZH9 B;  4LJA A;  1XC8 A;  1J7K A;  1QVR A;  2D49 A;  1O6I A;  3HJ8 A;  2D7G A;  4NSR A;  2OQ4 A;  4NZ3 A;  4GKJ M;  3CF0 A;  2KA6 B;  2UUA M;  2QCU A;  2RKO A;  3W0L B;  3FE3 A;  3GQ3 A;  2MR9 A;  2R46 A;  1W1P A;  3HGI A;  4JYA M;  1ZQ9 A;  1I94 M;  5EP4 A;  3RGS A;  4B08 A;  1DGF A;  4LF4 M;  1UM8 A;  3C58 A;  4LF7 M;  1JQJ C;  2KEB A;  4UN2 B;  2KZS A;  3SYK A;  2Y20 A;  3VK8 A;  4KHP M;  1OAO C;  3QYE A;  3KSJ A;  3TL4 X;  3JR4 A;  1MU5 A;  2QSF X;  4A3V B;  1HT2 E;  1IY1 A;  1SXJ A;  4JXJ A;  2XZF A;  2DVW B;  1QZM A;  3GRU A;  4I4L A;  3KFU G;  1E6N A;  2HWJ A;  1CXW A;  2VII A;  5DFL A;  2V6Z M;  1W1T A;  3B7Z A;  4FWD A;  1SG9 A;  3IHP A;  4AKG A;  1NHW C;  4BBA A;  1PJI A;  2EUC A;  3M7G A;  3GLG B;  3J80 S;  3D8B A;  4RKU F;  1TH4 A;  5DYG A;  1NV9 A;  3HU1 A;  1HNW M;  3U6L A;  2HAK A;  1E88 A;  4F1I A;  3GPP A;  2H5X A;  4LF6 M;  3WD2 A;  2K9D A;  1XMO M;  4PCZ A;  1QDR A;  2Y2P A;  1GOI A;  2YR0 A;  4GRI A;  1NNJ A;  2FH0 A;  3C3D A;  4B7G A;  1IN5 A;  1IXS B;  2GQF A;  2JZ0 A;  5GKN A;  4ITQ A;  3VKH A;  3WD3 A;  3T1H M;  2V5O A;  2EO2 A;  2L4F A;  3HU3 A;  2MH8 A;  3U6O A;  2Y2I A;  4LJ7 A;  5EP1 A;  5L8R F;  2DNA A;  2MRO B;  2W82 A;  4RNA A;  1JR3 D;  2P5T A;  2HL7 A;  3NBX X;  1R4G A;  4DUZ M;  1QAM A;  1WR1 B;  1IFY A;  3FYD A;  2DHR A;  4L15 A;  1H6U A;  4NSO B;  1R6B X;  4NL4 H;  2AHM A;  1IXR C;  1OAI A;  3CF2 A;  3HJS A;  4LF9 M;  1N36 M;  1QAN A;  4GC9 A;  3CGW A;  4IBG A;  5E26 A;  2LVA A;  1NSF A;  3M0E A;  2EA0 A;  1QAO A;  5FTL A;  4G4Q A;  2CV2 A;  1GJT A;  3L2A A;  3SMS A;  4LJ5 A;  4Q7J A;  2HHH M;  1YU0 A;  4IIW A;  2L09 A;  1OKS A;  3BXW A;  2QNJ A;  4LY6 A;  3L27 A;  4G3O A;  3T15 A;  4XGI A;  1NJG A;  4OJL A;  1L8Q A;  4JN6 A;  2QPA A;  4DV7 M;  4AG5 A;  3KS8 A;  4Z2G A;  2KRK A;  4M0D A;  2DI0 A;  2K47 A;  1XB2 B;  1G71 A;  1WXQ A;  4QNL A;  4DV3 M;  4FVM A;  1G59 A;  2D7H A;  5FTN A;  2UXB M;  2APL A;  3MMP A;  1E6R A;  4P16 A;  1G4A E;  2YFQ A;  2JP7 A;  4MGK E;  2OPF A;  3A45 A;  4JV5 M;  4Z2I A;  1G8P A;  2Z4S A;  1QUS A;  3ILK A;  2QP9 X;  3B89 A;  3E46 A;  4TX8 A;  4WW0 A;  3WD1 A;  1SXJ D;  3LVV A;  3W0F A;  5KPT A;  2FFF B;  4FCT A;  3FTC A;  3SAT A;  3WD4 A;  1QUT A;  3K8Z A;  3GLG A;  2V1U A;  1TH2 A;  4Z2J A;  2R4E A;  4HLQ A;  3K9P A;  1WIV A;  4QHS A;  3QAU A;  3HZJ A;  4NOO B;  3GLF B;  3WX7 A;  1W1Y A;  2F5P A;  3FRI A;  1EIJ A;  3C9P A;  3GLI B;  2J7O A;  4R7G A;  2JNH A;  2VF8 A;  2Y2H A;  1IXS A;  4MGY E;  3DZD A;  1W5S A;  1ORY B;  1YU4 A;  4B7F A;  1EFU B;  2QQ8 A;  3NWL A;  4GEW A;  2C9C A;  5KPR A;  3LQR A;  3TE6 A;  2DWL A;  1TH3 A;  4MB4 A;  3R8F A;  1WGL A;  4YY3 M;  3M7P A;  2M5Z A;  2QHO B;  4AI6 A;  4RF1 A;  3ZC7 B;  4IBC A;  5ITT A;  3OTO M;  2DAK A;  2BJV A;  1XMQ M;  4FWH A;  2UWX A;  3U6C A;  4LJ8 A;  1WHC A;  2C98 A;  2YQZ A;  2DAI A;  3I4Y A;  3QWL A;  3B7N A;  2JE5 A;  2Z4R A;  2JUJ A;  4LJ4 A;  2LXE A;  1TTE A;  2KNZ A;  5ITU A;  2B3T A;  3U6D A;  4D81 A;  2KHH A; 
#chains in the Genus database with same CATH homology
 3N3F A;  5EJC A;  4GC5 A;  4NZ4 A;  3L25 A;  4EIW A;  4LCB A;  2JCH A;  4HL4 A;  2Q2E B;  2HKJ A;  3BOS A;  5C18 A;  2VQE M;  1DO0 A;  4IBD A;  2UXC M;  2R4J A;  2C9O A;  3RE8 A;  1IN4 A;  1HNX M;  2Y0Q A;  4LZZ A;  3U60 B;  2ZM6 M;  4MGZ E;  3MHV C;  3FTF A;  1IBK M;  4CIS A;  2DWM A;  2FOI C;  8CAT A;  5LMN M;  4M9S A;  3U6E A;  2Y2N A;  3WHL A;  2R62 A;  2Y21 A;  3THG A;  1J09 A;  4G4R A;  3I51 A;  2Y2O A;  1FJG M;  3U6P A;  4YHH M;  2L7I A;  1XNQ M;  1IY0 A;  3GLF A;  3FTD A;  4LGY A;  5IRE B;  1XNR M;  1D2N A;  1Q3B A;  4QOS A;  3SFZ A;  5ITX A;  2D7E A;  3KP0 E;  4L4U A;  4ZPX A;  3A46 A;  3FYC A;  3GLI A;  4LF5 M;  3B9P A;  3GRY A;  1IN8 A;  4PDG A;  3UGJ A;  1J5E M;  3LVW A;  4AG6 A;  1L2B A;  5KPZ A;  2XFS A;  5IWA M;  4LG2 A;  3U6S A;  3HSH A;  3SMP A;  2VQF M;  5JI2 E;  4GMQ A;  4IBB A;  2Y2Q A;  5EXP A;  2KW0 A;  4DR2 M;  3KDS E;  1OFH A;  4FCV A;  2UUC M;  1L2D A;  4BB9 A;  3RGP A;  4OVZ B;  4KOD A;  3VFD A;  4IBJ A;  4L8R C;  3FUT A;  2CUZ A;  3HJQ A;  1DGG A;  3PXG A;  4CGY B;  1DGH B;  4AW4 A;  4B7H A;  5FTJ A;  1KFV A;  4X65 M;  4DV2 M;  1PJJ A;  1IXZ A;  1ZAE A;  2G8L A;  4I8O A;  2O5R A;  3FKE A;  4LFA M;  3GO8 A;  3GP1 A;  3A42 A;  3SHF A;  4FW9 A;  4OJO A;  4X64 M;  3AOG A;  4DV5 M;  1IBM M;  3ZCB B;  1HR0 M;  3U60 A;  3HON A;  4M9Z A;  4Z6Y A;  4NYU A;  4CHT B;  4M9X A;  4LJ9 A;  4JI8 M;  1R2Z A;  1DO2 A;  1XWI A;  4GH9 A;  4KLN A;  3GPU A;  2FNA A;  1N75 A;  3GPY A;  4JI1 M;  2ZAN A;  4DR3 M;  2X4A A;  5BPV A;  2ZAM A;  1N33 M;  3K92 A;  1TGU A;  1QYR A;  1I4W A;  2Z3X A;  1GKI A;  3JR5 A;  4JI3 M;  1EE8 A;  1E94 E;  4M0W A;  1QQW A;  5E6J A;  4JI6 M;  2XGN A;  1C1K A;  3TPZ A;  4JI4 M;  1S3S A;  1G41 A;  2CEA A;  3AKZ A;  3R9X B;  3K1J A;  5FTM A;  3D8L A;  4JI2 M;  3E9S A;  2G5G X;  3UK6 A;  5C1B A;  3GPX A;  1R2Y A;  1HT1 E;  2RGO A;  3CF6 E;  2XLJ A;  1NVM A;  4AQY M;  3DFZ A;  2F5S A;  3SC3 A;  3LQQ A;  2DWZ B;  4OVZ A;  3SAV A;  4KO8 A;  3MJ5 A;  3AOE A;  3U5Z B;  2C96 A;  1IN7 A;  3DA1 A;  2CV1 A;  3L26 A;  3LMM A;  1X37 A;  4B3R M;  1XHB A;  2DXI A;  1DGH A;  1SXJ C;  2CE7 A;  2RGH A;  2E5L M;  1YU3 A;  2F5N A;  2A5Y B;  3GLH B;  4IBE A;  1YU1 A;  1K82 A;  4QOZ C;  4AKH A;  2XEP A;  3KP1 E;  1G3I A;  3WHK A;  4B3T M;  3HHY A;  5KQD A;  4PDI A;  4OUI A;  3KSX A;  4LF8 M;  2DZN B;  1LV7 A;  3K2L A;  1KSF X;  4IJE A;  3U6Q A;  3VK7 A;  2XZU A;  2ZBK B;  4DV0 M;  4MGI E;  4TUW A;  3SHG B;  3U61 B;  3TWL A;  3CTW B;  3FUU A;  3FTE A;  4XBO A;  1IN6 A;  2BNK A;  2LH0 A;  2I7P A;  2M60 A;  3GRR A;  2R65 A;  1XXH B;  1L2C A;  4OX9 M;  4REZ A;  4S12 A;  2CV0 A;  3VDU A;  1L1T A;  3J2P B;  2CFO A;  4BLC A;  4D80 A;  1N78 A;  1IQP A;  4MM3 B;  2C99 A;  1T3T A;  4JI7 M;  4OJ6 A;  1DGB A;  2R45 A;  3KOX E;  5EXS A;  3T38 A;  4DR5 M;  3AL0 C;  1R7R A;  3MK6 A;  3AV0 A;  4WUR A;  1SXJ E;  3L29 A;  4G4O A;  4OW0 A;  2BG1 A;  5IZ7 D;  4L78 A;  3GQ4 A;  1IBL M;  1Q39 A;  4LFB M;  3EIE A;  2Y2J A;  4B3S M;  1GL6 A;  4W5W A;  3U5Z A;  1IM2 A;  4LZJ A;  2J7N A;  4LRT A;  3KW6 A;  4OJP A;  5DNY A;  1YE9 A;  3HKP A;  4MGH A;  5ITY A;  3VLF B;  1K3W A;  1YSY A;  2NQ8 C;  3J7B A;  1GL7 A;  4IBK A;  3GLH A;  2F4V M;  3PNV A;  3FUX A;  4NXN M;  3KOZ E;  4NZ1 A;  2CHV A;  5KQ8 A;  4FWG A;  5H37 D;  2KZU A;  4LGM A;  2X8A A;  4GIT A;  5KO3 A;  5EXT A;  4OJ5 A;  3HHX A;  1E9S A;  4G4N A;  2F5O A;  1OFI A;  3DOA A;  3FUV A;  1HQY E;  4NXM M;  3M6A A;  3UMM A;  2V1C A;  3NBI A;  4X66 M;  2XD5 A;  3H4M A;  4FCW A;  4I81 A;  3U61 A;  3AOE C;  2XF3 A;  5A2Q S;  2CHQ A;  4IBF A;  2XD1 A;  2I7N A;  1W5T A;  3UJN A;  1XXH A;  2L6O A;  2CHG A;  5EP2 A;  3UZU A;  2IOU A;  2DZO B;  2Y2M A;  4PD2 A;  4I5S A;  3AJI B;  3SYL A;  1Z5B A;  4LFC M;  2XSZ D;  4MH0 E;  3E4R A;  1NY6 A;  4QHT A;  3VDP A;  7CAT A;  4NZ5 A;  4R3D A;  4QNR A;  3KVW A;  1FNN A;  2FFJ A;  2L7H A;  3SBJ A;  4GIP A;  4DR6 M;  5FSW A;  4L16 A;  5ITQ A;  5LMU M;  1Q3C A;  4IBI A;  5FLX S;  3U6M A;  2XH9 A;  4GHL A;  4FD2 A;  5EQT A;  4IJF A;  3KOY E;  4MB7 A;  2HCB A;  4NRW A;  4X62 M;  1TDH A;  1NJF A;  2Y2L A;  5JI3 E;  3IG5 A;  4JI5 M;  3AFH A;  3SAU A;  4DR1 M;  1Z5C A;  3KOW E;  2C5R A;  4II7 A;  4LJ6 A;  1Z5A A;  5BR8 M;  4DUY M;  1N32 M;  3VKG A;  1YUE A;  2UU9 M;  2QEN A;  2QBY B;  4LRS A;  2Y0T A;  2YNM D;  4NYY A;  1TDZ A;  2R18 A;  4PT5 A;  1VDD A;  4NRV A;  3SAW A;  1GVN A;  3L28 A;  2X49 A;  4K0K M;  1QAQ A;  4DV6 M;  3JAM S;  2JA2 A;  4AZF A;  4NY2 A;  3HHZ A;  4DR4 M;  3PVS A;  3PFI A;  1NY5 A;  1NHG C;  2F5Q A;  4JI0 M;  3KS4 A;  4OU7 A;  1PM5 A;  2KRU A;  3FUW A;  5FTK A;  3TWK A;  5EP3 A;  3IG8 A;  5IT9 S;  2XFT A;  2KXE A;  1N77 A;  3FD9 A;  4G6Z A;  3J27 B;  5ITR A;  1YU2 A;  1HQC A;  3TQS A;  2UXD M;  3HU2 A;  1SXJ B;  3PNY A;  2XSZ A;  3GRV A;  1IY2 A;  2QZ4 A;  4GKK M;  4GHA A;  4B3M M;  1Z6T A;  3RFW A;  3HWS A;  5EXX A;  1HNZ M;  1E32 A;  2LNH C;  3GQ5 A;  2ZAO A;  4DV4 M;  1GLN A;  3SAR A;  3T1Y M;  1MX0 A;  3KXE C;  4Z8X A;  2H1R A;  4DV1 M;  2LWX A;  3EIH A;  3J7A S;  4DR7 M;  1E9R A;  2DWN A;  3Q8X A;  4AKI A;  1JR3 A;  3TWM A;  3I4V A;  2BJW A;  3HHW A;  4QNM A;  1N34 M;  2Y2K A;  5DYI A;  2ERC A;  4RF0 A;  1OJL A;  1NNU C;  3A98 B;  1K3X A;  2Y2G A;  2UUB M;  4D82 A;  3J81 S;  2QBY A;  5ITX E;  1KYI A;  3SAS A;  1YUB A;  2Z7J A;  5F3W A;  1L1Z A;  2FE8 A;  1Z59 A;  3ZH9 B;  4LJA A;  1XC8 A;  1J7K A;  1QVR A;  3HJ8 A;  2D7G A;  4NSR A;  2OQ4 A;  4NZ3 A;  4GKJ M;  3CF0 A;  2KA6 B;  2UUA M;  2QCU A;  2RKO A;  3W0L B;  3GQ3 A;  2R46 A;  3HGI A;  4JYA M;  1ZQ9 A;  1I94 M;  5EP4 A;  3RGS A;  4B08 A;  1DGF A;  4LF4 M;  1UM8 A;  3C58 A;  4LF7 M;  1JQJ C;  2KEB A;  2KZS A;  3SYK A;  2Y20 A;  3VK8 A;  4KHP M;  3KSJ A;  3TL4 X;  3JR4 A;  1MU5 A;  4A3V B;  1HT2 E;  1IY1 A;  1SXJ A;  4JXJ A;  2XZF A;  2DVW B;  1QZM A;  3GRU A;  4I4L A;  3KFU G;  2VII A;  2V6Z M;  4FWD A;  4AKG A;  1NHW C;  4BBA A;  1PJI A;  2EUC A;  3M7G A;  3GLG B;  3J80 S;  3D8B A;  5DYG A;  1TH4 A;  3HU1 A;  1HNW M;  3U6L A;  3GPP A;  4LF6 M;  1XMO M;  4PCZ A;  2Y2P A;  2YR0 A;  4GRI A;  1NNJ A;  3VKH A;  4B7G A;  1IN5 A;  1IXS B;  4ITQ A;  5GKN A;  3T1H M;  2EO2 A;  3HU3 A;  3U6O A;  2Y2I A;  4LJ7 A;  5EP1 A;  2W82 A;  4RNA A;  1JR3 D;  2P5T A;  2HL7 A;  4DUZ M;  1QAM A;  3FYD A;  2DHR A;  4L15 A;  1H6U A;  4NSO B;  1R6B X;  4NL4 H;  2AHM A;  1IXR C;  3HJS A;  3CF2 A;  4LF9 M;  1N36 M;  1QAN A;  4GC9 A;  4IBG A;  5E26 A;  1NSF A;  3M0E A;  2EA0 A;  1QAO A;  5FTL A;  4G4Q A;  2CV2 A;  3L2A A;  3SMS A;  2HHH M;  4LJ5 A;  1YU0 A;  4IIW A;  2L09 A;  4LY6 A;  3L27 A;  3T15 A;  4XGI A;  1NJG A;  4OJL A;  1L8Q A;  4JN6 A;  2QPA A;  4DV7 M;  4AG5 A;  3KS8 A;  2KRK A;  4M0D A;  2K47 A;  1WXQ A;  4QNL A;  4DV3 M;  4FVM A;  1G59 A;  2D7H A;  5FTN A;  2UXB M;  4P16 A;  1G4A E;  2YFQ A;  4MGK E;  2OPF A;  3A45 A;  4JV5 M;  1G8P A;  2Z4S A;  3ILK A;  2QP9 X;  4WW0 A;  1SXJ D;  3LVV A;  3W0F A;  5KPT A;  2FFF B;  4FCT A;  3FTC A;  3SAT A;  3K8Z A;  3GLG A;  2V1U A;  1TH2 A;  2R4E A;  4HLQ A;  4QHS A;  3QAU A;  3GLF B;  4NOO B;  3WX7 A;  2F5P A;  3GLI B;  2J7O A;  4R7G A;  2Y2H A;  4MGY E;  3DZD A;  1W5S A;  1ORY B;  1YU4 A;  4B7F A;  3NWL A;  2C9C A;  5KPR A;  3LQR A;  3TE6 A;  2DWL A;  1TH3 A;  3R8F A;  4YY3 M;  2M5Z A;  4AI6 A;  4RF1 A;  3ZC7 B;  4IBC A;  5ITT A;  3OTO M;  2BJV A;  1XMQ M;  4FWH A;  2UWX A;  3U6C A;  4LJ8 A;  2C98 A;  3QWL A;  3I4Y A;  2JE5 A;  2Z4R A;  4LJ4 A;  2LXE A;  5ITU A;  2YQZ A;  3U6D A;  4D81 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...