4IBIA

Ebola virus vp35 bound to small molecule
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
123
structure length
123
Chain Sequence
b'DISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polymerase cofactor VP35
molecule tags Transcription/transcription inhibitor
source organism Ebola virus
publication title In Silico Derived Small Molecules Bind the Filovirus VP35 Protein and Inhibit Its Polymerase Cofactor Activity.
pubmed doi rcsb
total genus 44
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ibiA01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4ibiA02
4IBBA 3L26A 3KS8A 4IBCA 3L28A 4IJFA 4IBIA 4LG2A 3L2AA 4GH9A 4IBDA 3L29A 5BPVA 3L25A 4GHAA 4IJEA 3L27A 4IBJA 4IBKA 4IBEA 4IBGA 3FKEA 3KS4A 4IBFA 4GHLA
chains in the Genus database with same CATH superfamily
1HR0M 1NVMA 2BJVA 2K47A 1J7KA 2L2DA 2QCUA 3HJQA 2A5YB 4JXJA 1N77A 1TDHA 1W1VA 2BNKA 4RKUF 4B7FA 2D7HA 3KDSE 4MGZE 4NZ1A 1VDDA 2L7HA 3A46A 4I5SA 2JY7A 1IN8A 3D8LA 1QANA 4B7GA 3SAUA 5FTJA 1E8BA 2Y2NA 1ZMWA 2LVAA 4KHPM 1YU4A 4P17A 2JA2A 1OFIA 3HKPA 3HSHA 3GO8A 4CISA 4AKIA 2N35A 1IN4A 3KOWE 4Z2KA 3K92A 1QAQA 3L25A 2ERCA 4Y28F 4QNLA 4I81A 1G41A 2KW0A 4CGYB 3C58A 4K0KM 1HJPA 2L7IA 3EIEA 2JZ1A 3HGIA 4IBGA 5FTNA 4JI8M 3KS4A 4LJ9A 4NOOB 1NHGC 5EXTA 2V5OA 3U5ZB 4FCWA 4REZA 4OJPA 2JY5A 4NZ3A 5EP2A 1D0KA 5L8RF 1DGGA 1PJSA 2L4FA 2XFSA 3FYDA 3GLIB 1NY5A 4FWGA 1J7MA 2QSFX 2HL7A 2R45A 1NJFA 5ITUA 2VIIA 3N3FA 1ZMUA 5DFLA 4D82A 1ORYB 3T6PA 3CF0A 1L2CA 4M0DA 2F5PA 3HU3A 2H1RA 1HT1E 3HX3A 2R44A 2DHYA 2KEBA 2ZAOA 4A3VB 1Z5AA 4Z2GA 1HT2E 2BWBA 4LZJA 5FTLA 4Z2HA 4GMQA 3KFUG 4GHLA 2W82A 4FWDA 1PJJA 3FTFA 1QYRA 1LTMA 1QZMA 1KSFX 3FTCA 3LVVA 4PCZA 5LMUM 3KS8A 3VDUA 4FVMA 3I04M 1KFVA 2JCHA 2R62A 1PRBA 3THGA 3U60A 4MGYE 5EXXA 3CGWA 3U6LA 1R5LA 4P16A 2KDLA 2EUCA 1W1YA 1TR8A 3HY5A 4X65M 4DV7M 2F5NA 4OJLA 5ITQA 2R4JA 2DXIA 1HNWM 3J81S 1Z6TA 1Q3CA 1QDRA 2EO2A 1O6IA 3Q8XA 1I94M 1E15A 4LJ5A 1AIWA 2LXEA 4DUYM 1L1TA 4AI6A 2JP7A 5LMNM 4IJEA 2KNVA 1IBLM 2QPAA 2XGNA 3JAMS 4NRWA 1NJGA 2V1CA 4MGKE 2RRUA 3TQSA 4NSOB 4LGMA 2XZFA 4AW4A 2MJ5B 4L15A 3DA1A 4M9SA 3CTWB 2KHHA 1LV7A 3SAWA 1V33A 3KW6A 3TL4X 1YLAA 3KOXE 3U6OA 2F4VM 3AOEA 1W5SA 5E26A 4YY3M 2XH9A 3KOZE 1WR1B 4CJ6A 2JXNA 2FFFB 1R7RA 3SAVA 2V6ZM 3WD1A 3FUXA 2CP8A 3L28A 1T6OA 2L09A 3J80S 3U6SA 2CV2A 3AOGA 2DKLA 2G5GX 3VFDA 4LG2A 2M60A 2JUJA 3KOYE 3L2AA 1S3SA 3QWLA 1N34M 2LNHC 1FJGM 3A42A 3WD0A 3CF6E 3U6MA 5FTKA 4DR4M 4L16A 3TWKA 2HWJA 4F2LA 1L2DA 2C9CA 1OKSA 2JZ0A 1VDLA 2F5OA 2O25A 4LFBM 1PDCA 1GXDA 4W5WA 5DNYA 4NZ4A 2DHRA 1T3TA 3GLIA 2LWXA 3I01M 1MX0A 2R46A 4G4NA 3RGSA 2MROB 2WSFF 1IBMM 1YU0A 3B9PA 4LRTA 4PDGA 3E4RA 4M9XA 4AZFA 1GL6A 2OO9A 3KSJA 3KP1E 5KPRA 3EIHA 1CXWA 2CV0A 2KXEA 2EJSA 3VK7A 2BWEA 2Y0TA 1G59A 2EA0A 4LF8M 1DGBA 3W0LB 4AKGA 4FCVA 4BLCA 1EIJA 2Y2LA 2Y0QA 4I4LA 3SFZA 1G4AE 1R4GA 2Y2GA 5BPVA 5ITRA 3IECA 1HQCA 5A2QS 4Z2IA 4FD2A 4NRVA 3TPZA 4Z6YA 1IN6A 3FTDA 4DR3M 3GLFE 1XXHE 3SHFA 2E5LM 1KYIA 2FOIC 2LVNC 3GLHA 4LJAA 3T15A 4ITQA 2JNHA 1UM8A 1H6UA 3C3DA 4DR5M 1Z5CA 1QDTA 4JI7M 4OJOA 1YSYA 1GABA 2LVOC 4R3DA 5EQTA 1ZQ9A 5EJCA 3MK6A 2XZUA 1DGFA 2EKKA 2WZJA 4I8OA 4WW0A 4D80A 1QZEA 1E6PA 3GLGE 2D7EA 3WD4A 1UR8A 2KZUA 2UUAM 4GH9A 4OVZB 2VQEM 3TWMA 2XD5A 1Q39A 1GL7A 3CF2A 1IBKM 1WHCA 4NC6A 2P5TA 3T38A 4BB9A 3AL0C 2Y2KA 1Q3BA 2Y2QA 4JYAM 2EKFA 3HHWA 1T43A 4BBAA 1N75A 2BG1A 2XSZD 4IBJA 1R2YA 4KO8A 4PD2A 4LJ6A 3BOSA 3T1YM 3M7PA 1QQWA 5C18A 3HHXA 4NYUA 4QNRA 5EXPA 1NNJA 1QUTA 2XFTA 3HHZA 3UK6A 2DVWB 2ZM6M 3B7QA 3U6EA 3GLHB 1QAOA 4DV0M 3MQLA 1YU1A 4LFAM 2VF8A 4LF4M 5E6JA 3IHPA 5KQDA 2FE8A 2BJWA 1EAKA 2F5SA 2QP9X 2Z8YM 3HWSA 3U60B 4XBOA 5IREB 2HAKA 2QHOB 3K9PA 2YR0A 4HL4A 3FE3A 1YUBA 2NQ8C 3D8BA 3HONA 1ZV1A 1JR3D 3FUUA 1XC8A 1K3XA 3BBZA 3FYCA 4CHTB 3J7BA 5ITXE 4YHHM 4L6V6 1IXZA 2L4EA 1H8PA 3C3EA 2DAGA 3K8ZA 1YE9A 3AJIB 4GRIA 1OJLA 4ZPXA 3FTEA 3GQ5A 1GLNA 1WGNA 3SMPA 3VKGA 4TX8A 2ZBKB 4JI0M 1KS0A 2K0BX 3UGJA 3OTOM 2DWLA 4G4QA 3GPPA 2B3TA 2Y2MA 2QBYA 1IY2A 2MH8A 2R65A 4II7A 2OOBA 2LHCA 3R9XB 3HJ8A 3I4VA 2Z4SA 2X4AA 3HU2A 1G8PA 5ITYA 4DV1M 3QYEA 2WSEF 2RGOA 3H4MA 2KRUA 2J7NA 2LVQD 3L29A 1UFZA 2R4EA 3PNVA 4GKKM 2DWMA 1W5TA 3NBIA 1IFYA 1I4WA 3FRIA 4GC9A 2RKOA 3SYKA 3U6PA 4IBEA 2ZAMA 2O5RA 4NL4H 4UN2B 1OGBA 4MGIE 2CHVA 1MU5A 2Z4RA 3H4JA 1OAIA 4IBBA 2QENA 5KPTA 3U61B 1N32M 1NO1A 2GQFA 2OOAA 3E9SA 1XNQM 3M6AA 2QNJA 4GKJM 1N78A 4HMCA 3FUVA 3JR5A 3W0FA 4NXNM 1GKIA 3VDPA 4DV3M 1OQYA 1VEGA 4LF7M 2KRKA 1D2NA 1TH3A 1GOIA 1Y8GA 2R18A 1IQPA 3U6DA 4FCTA 4MB5A 4GC5A 3HZJA 1SXJE 2XSZA 4IBDA 5H37D 1WJ7A 4G6ZA 4M9ZA 1XMOM 2I7NA 2CE7A 4WURA 4JV5M 5DYIA 4JI1M 2UXDM 4Z2JA 3L27A 2Y2HA 1J09A 4JN6A 4LJ4A 2Y21A 4XK8F 3RFWA 4DV6M 2J5YA 3Q8GA 4X64M 1HNZM 2LH0A 2I7PA 1CK7A 1PM5A 2Y2IA 4MB3A 3E46A 3ZC7B 1XMQM 3M7GA 1VQ1A 2JWSA 3C9PA 7CATA 4JI4M 3WX7A 5BR8M 4MM3B 4B7HA 4DV2M 4JI6M 1HNXM 3VKHA 4LFCM 3UZUA 1IXSB 4X62M 1QAMA 3I4YA 3DZDA 2UXCM 2UWXA 5IZ7D 1SG9A 1W1PA 2VF7A 1H0GA 1K82A 3SBJA 4LJ8A 2DWNA 4L78A 4HLQA 4KT0F 2K9DA 2Y2JA 4MH0E 5KQ8A 4JI5M 3HJSA 2DI0A 5KPZA 3GQ3A 1IN7A 1ZMVA 3A45A 2DZNB 2FS1A 3I51A 2XD1A 1E9RA 2CWBA 1W1TA 4OUIA 1J5EM 4PDIA 2K6BA 1DV0A 3TWLA 4AKHA 2HKJA 3KSXA 2UXBM 2UUCM 2YNMD 2JE5A 1IXRC 1GVNA 1TH4A 3A98B 2C98A 2FFJA 2AHMA 3LVWA 3MHVC 4RF0A 4X66M 3SASA 3AKZA 3WD3A 2APLA 4OW0A 1JR3A 2LVPC 3GRUA 3LCUA 1K3WA 3QAUA 4LRSA 4G3OA 3B7NA 4LY6A 1V92A 1TH2A 3AFHA 2Z3XA 4NSRA 1E6NA 2DAEA 1YU2A 1QVRA 3GLHE 4HMEA 2Y2PA 4R7GA 1YUEA 4OJ6A 1G71A 5EP1A 4B3SM 1X37A 4L4UA 4DV5M 1D0LA 2HHHM 3B7ZA 1NHWC 1YU3A 2XLJA 3J27B 5EP4A 5C1BA 1OTRA 1HQYE 3ZCBB 4G4RA 5ITTA 2Y2OA 3ZQJA 2LBCA 3SMSA 2KNZA 4F1IA 4NXMM 2GNOA 2M5ZA 2IOUA 1NY6A 2XEPA 3T1HM 4DBGB 2RTSA 3KP0E 3LQQA 2C5RA 3B74A 1EFUB 1DGHB 3W68A 1ZAEA 5JI2E 4AG6A 4IJFA 3WHKA 4IBIA 1IY0A 2CEAA 3RE8A 5FLXS 1Z59A 5DYGA 5IWAM 2C9OA 4Z2LA 4B3RM 5EXSA 4MB7A 1E6RA 2ZANA 3JR4A 4JI3M 2CHQA 4FW9A 3GLFB 1VG5A 3LCVB 3NBXX 2FH0A 3U61A 2G8LA 4NZ5A 4IBKA 3PXGA 1V34A 1SXJB 3GPXA 4OX9M 3K2LA 1Z5BA 1ED7A 4HEOA 4LF9M 3PVSA 1TGUA 5EP3A 4NY2A 3MMPA 2G3QA 4GEWA 4IIWA 4LZZA 3L26A 1Q02A 3AOEC 2UU9M 2KNAA 3U6QA 2X8AA 1G3IA 3LMMA 4IBCA 4OVZA 2DZOB 3U6CA 1E9SA 2DWZB 2CFOA 5ITXA 1GO5A 1OIPA 1E32A 3GLGA 2J7OA 4B3MM 3PFIA 1BVSA 2ZTCA 1DGHA 1EE8A 5FSWA 1H0IA 3B89A 1PJTA 1N33M 2QBYB 2Y20A 3GPUA 3BXWA 4S12A 5IT9S 4XGIA 4B08A 4LF6M 2LHGA 1XWIA 4Q7JA 3U5ZA 3VK8A 2D7GA 3GRYA 4LCBA 2Q2EB 1MN3A 3WHLA 3R8FA 1F4IA 1R2ZA 2WSCF 4LGYA 2FNAA 3UMMA 4G4OA 2DENA 3M0EA 2JY6B 4AQYM 4DR7M 3FRHA 1IN5A 4LF5M 1R6BX 1L8QA 2KA6B 2QZ4A 2KZSA 1PJIA 2V1UA 2DAKA 3AV0A 5FTMA 4CIZA 2MR9A 5KO3A 4DR6M 3ILKA 2O01F 2RGHA 2QQ8A 3LQRA 3GLIE 1TTEA 2D49A 5JI3E 4QOSA 1NV8A 2F5QA 1JB0F 1E94E 4R71A 3KVWA 1SXJC 4Z8XA 1WXQA 3IG5A 2H5XA 1TDZA 2UUBM 4OJ5A 4HMDA 2CUZA 1MJGM 2Z7JA 1GPFA 1A5TA 3PNYA 4AG5A 4NYYA 2ZTDA 4DUZM 3GQ4A 1OAOC 3IG8A 4KLNA 1L1ZA 2OPFA 3QYBA 2OQ4A 4MB4A 2CRUA 1D0MA 3DOAA 3K1JA 4RF1A 4D81A 1FNNA 4RNAA 3GP1A 1L6JA 2YFQA 1VEKA 2L6OA 1TF0B 1QUSA 4QNMA 4TUWA 4LJ7A 3SC3A 2DZLA 4ANRA 5F3WA 5GKNA 2MGWA 1QO6A 1E6ZA 1WIVA 1XXHA 3RGPA 4GITA 1DO2A 2VDBB 1C1KA 3ZH9B 4M0WA 4QHTA 3GRVA 3SATA 4L8RC 2JY8A 3SHGB 1CUKA 3GRRA 1IXSA 2CV1A 2YQZA 4QOZC 4MGHA 4OU7A 4JI2M 3MJ5A 3J7AS 4DR2M 1UR9A 1C7YA 1WGLA 2HCBA 2R0IA 4EIWA 3J2PB 1RU3A 3FUTA 1XB2B 2XF3A 1L2BA 2DAMA 3FD9A 3FKEA 1P3QQ 3VLFB 3DFZA 3HU1A 3HHYA 3UJNA 2C96A 3F92A 1JQJC 1OFHA 4FWHA 4WP2A 3W67A 1GJTA 3GLGB 3E21A 3TE6A 4DV4M 1NNUC 1VEJA 1XNRM 2CHGA 3NWLA 4QHSA 1N36M 1AIPC 4PT5A 1E88A 2DNAA 4GIPA 1PJQA 3FUWA 3SARA 1XHBA 2C99A 4KODA 3K9OA 8CATA 2LTUA 1OGGA 3GLFA 1NSFA 2X49A 1IY1A 1JR3E 1XXHB 4DR1M 1SXJA 4B3TM 3SYLA 3WD2A 3KXEC 2VQFM 1NV9A 4GHAA 1SXJD 2R6FA 3LW5F 1DO0A 1OIZA 1GJSA 3GPYA 2FN2A 4IBFA 1PGYA 2DAIA 1AUAA 3V76A 1IM2A
chains in the Genus database with same CATH topology
1HR0M 1NVMA 2BJVA 2K47A 1J7KA 2QCUA 1N77A 3HJQA 2A5YB 4JXJA 1TDHA 2BNKA 4B7FA 2D7HA 3KDSE 4MGZE 4NZ1A 1VDDA 2L7HA 3A46A 4I5SA 1IN8A 3D8LA 1QANA 4B7GA 3SAUA 5FTJA 2Y2NA 4KHPM 1YU4A 2JA2A 1OFIA 3HKPA 3HSHA 3GO8A 4CISA 4AKIA 3KOWE 1IN4A 3K92A 1QAQA 3L25A 2ERCA 4QNLA 4I81A 1G41A 2KW0A 4CGYB 3C58A 4K0KM 2L7IA 3EIEA 3HGIA 4IBGA 5FTNA 4JI8M 3KS4A 4LJ9A 4NOOB 1NHGC 5EXTA 3U5ZB 4FCWA 4REZA 4OJPA 4NZ3A 5EP2A 1DGGA 3FYDA 2XFSA 3GLIB 1NY5A 4FWGA 2HL7A 2R45A 1NJFA 5ITUA 2VIIA 3N3FA 4D82A 1ORYB 3CF0A 1L2CA 4M0DA 2F5PA 3HU3A 2H1RA 1HT1E 2KEBA 2ZAOA 4A3VB 1Z5AA 1HT2E 4LZJA 5FTLA 4GMQA 3KFUG 4GHLA 2W82A 4FWDA 1PJJA 3FTFA 1QYRA 1QZMA 1KSFX 3FTCA 3LVVA 4PCZA 5LMUM 3KS8A 3VDUA 4FVMA 2JCHA 1KFVA 2R62A 3THGA 3U60A 4MGYE 5EXXA 3U6LA 4P16A 2EUCA 4OJLA 4X65M 4DV7M 2F5NA 5ITQA 2R4JA 2DXIA 1HNWM 3J81S 1Z6TA 1Q3CA 2EO2A 3Q8XA 1I94M 4LJ5A 2LXEA 4DUYM 1L1TA 4AI6A 5LMNM 4IJEA 1IBLM 2QPAA 2XGNA 3JAMS 4NRWA 1NJGA 2V1CA 4MGKE 3TQSA 4NSOB 4LGMA 2XZFA 4AW4A 4L15A 3DA1A 4M9SA 3CTWB 3SAWA 1LV7A 3TL4X 3KW6A 3U6OA 3KOXE 2F4VM 3AOEA 1W5SA 5E26A 4YY3M 2XH9A 3KOZE 2FFFB 1R7RA 3SAVA 2V6ZM 3FUXA 3J80S 3L28A 3U6SA 2L09A 2CV2A 3AOGA 2G5GX 3VFDA 4LG2A 2M60A 3KOYE 3L2AA 1S3SA 3QWLA 1N34M 2LNHC 1FJGM 3A42A 3CF6E 3U6MA 5FTKA 4DR4M 4L16A 3TWKA 2F5OA 1L2DA 2C9CA 4LFBM 4W5WA 5DNYA 4NZ4A 2DHRA 1T3TA 3GLIA 2LWXA 1MX0A 2R46A 4G4NA 3RGSA 1IBMM 1YU0A 3B9PA 4LRTA 4PDGA 3E4RA 4M9XA 4AZFA 1GL6A 3KSJA 3KP1E 5KPRA 3EIHA 2CV0A 2KXEA 3VK7A 2Y0TA 1G59A 2EA0A 4LF8M 1DGBA 3W0LB 4AKGA 4FCVA 4BLCA 2Y2LA 2Y0QA 4I4LA 3SFZA 1G4AE 2Y2GA 5BPVA 5ITRA 5A2QS 1HQCA 4FD2A 4NRVA 3TPZA 4Z6YA 1IN6A 3FTDA 4DR3M 3SHFA 2E5LM 1KYIA 2FOIC 3T15A 3GLHA 4LJAA 4ITQA 1UM8A 1H6UA 4DR5M 4JI7M 1Z5CA 4OJOA 1YSYA 4R3DA 5EQTA 1ZQ9A 5EJCA 3MK6A 2XZUA 1DGFA 4D80A 4I8OA 4WW0A 2D7EA 2KZUA 2UUAM 4GH9A 4OVZB 2VQEM 3TWMA 2XD5A 1Q39A 1GL7A 3CF2A 1IBKM 2P5TA 3T38A 4BB9A 3AL0C 2Y2KA 1Q3BA 2Y2QA 4JYAM 3HHWA 4BBAA 1N75A 2BG1A 2XSZD 4IBJA 1R2YA 4KO8A 4PD2A 4LJ6A 3BOSA 3T1YM 1QQWA 5C18A 3HHXA 4NYUA 4QNRA 5EXPA 1NNJA 2XFTA 3HHZA 3UK6A 2DVWB 2ZM6M 3U6EA 3GLHB 1QAOA 4DV0M 1YU1A 4LFAM 4LF4M 5E6JA 5KQDA 2FE8A 2BJWA 2F5SA 2QP9X 3HWSA 3U60B 4XBOA 5IREB 2YR0A 4HL4A 1YUBA 2NQ8C 3D8BA 3HONA 1JR3D 3FUUA 1XC8A 1K3XA 3FYCA 4CHTB 3J7BA 5ITXE 4YHHM 1IXZA 3K8ZA 1YE9A 3AJIB 4GRIA 1OJLA 4ZPXA 3FTEA 3GQ5A 1GLNA 3SMPA 3VKGA 2ZBKB 4JI0M 3UGJA 3OTOM 2DWLA 4G4QA 3GPPA 2Y2MA 2QBYA 1IY2A 2R65A 4II7A 3R9XB 3HJ8A 3I4VA 2Z4SA 2X4AA 3HU2A 1G8PA 5ITYA 4DV1M 2RGOA 3H4MA 2KRUA 2J7NA 3L29A 2R4EA 3PNVA 4GKKM 2DWMA 1W5TA 3NBIA 1I4WA 4GC9A 2RKOA 3SYKA 3U6PA 4IBEA 2ZAMA 2O5RA 4NL4H 4MGIE 2CHVA 2Z4RA 1MU5A 5KPTA 4IBBA 2QENA 3U61B 1N32M 3E9SA 1XNQM 3M6AA 4GKJM 1N78A 3FUVA 3JR5A 3W0FA 4NXNM 1GKIA 3VDPA 4DV3M 4LF7M 2KRKA 1D2NA 1TH3A 2R18A 1IQPA 3U6DA 4FCTA 4GC5A 1SXJE 2XSZA 4IBDA 5H37D 1XMOM 4G6ZA 4M9ZA 4JV5M 2I7NA 2CE7A 4WURA 5DYIA 4JI1M 2UXDM 3L27A 2Y2HA 1J09A 4JN6A 4LJ4A 2Y21A 3RFWA 4DV6M 4X64M 1HNZM 2LH0A 2I7PA 1PM5A 2Y2IA 3ZC7B 1XMQM 3M7GA 7CATA 4JI4M 3WX7A 5BR8M 4MM3B 4B7HA 4DV2M 4JI6M 1HNXM 3VKHA 4LFCM 3UZUA 1IXSB 4X62M 1QAMA 3I4YA 3DZDA 2UXCM 2UWXA 5IZ7D 1K82A 3SBJA 4LJ8A 2DWNA 4L78A 4HLQA 2Y2JA 4MH0E 5KQ8A 4JI5M 3HJSA 5KPZA 3GQ3A 1IN7A 3A45A 2DZNB 3I51A 2XD1A 1E9RA 4OUIA 1J5EM 4PDIA 3TWLA 4AKHA 2HKJA 3KSXA 2UXBM 2UUCM 2YNMD 2JE5A 1IXRC 1GVNA 1TH4A 3A98B 3MHVC 2C98A 2FFJA 2AHMA 3LVWA 4RF0A 4X66M 3SASA 3AKZA 4OW0A 1JR3A 3GRUA 1K3WA 3QAUA 4LRSA 4LY6A 1TH2A 3AFHA 2Z3XA 4NSRA 1YU2A 1QVRA 2Y2PA 4R7GA 1YUEA 4OJ6A 5EP1A 4B3SM 1X37A 4L4UA 4DV5M 2HHHM 1NHWC 1YU3A 2XLJA 3J27B 5EP4A 5C1BA 3ZCBB 1HQYE 4G4RA 5ITTA 2Y2OA 3SMSA 4NXMM 2M5ZA 2IOUA 1NY6A 2XEPA 3T1HM 3KP0E 3LQQA 2C5RA 1DGHB 1ZAEA 5JI2E 4AG6A 4IJFA 3WHKA 4IBIA 1IY0A 2CEAA 3RE8A 5FLXS 1Z59A 5DYGA 5IWAM 2C9OA 4B3RM 5EXSA 4MB7A 2ZANA 3JR4A 4JI3M 2CHQA 4FW9A 3GLFB 3U61A 2G8LA 4NZ5A 4IBKA 3PXGA 3GPXA 1SXJB 4OX9M 3K2LA 1Z5BA 4LF9M 3PVSA 1TGUA 5EP3A 4NY2A 4IIWA 4LZZA 3L26A 3AOEC 2UU9M 2X8AA 1G3IA 3LMMA 4IBCA 4OVZA 2DZOB 3U6CA 1E9SA 2DWZB 2CFOA 5ITXA 1E32A 3GLGA 2J7OA 4B3MM 3PFIA 1DGHA 1EE8A 5FSWA 1N33M 2QBYB 2Y20A 3GPUA 4S12A 5IT9S 4XGIA 4B08A 4LF6M 1XWIA 3U5ZA 3VK8A 2D7GA 3GRYA 4LCBA 2Q2EB 3R8FA 3WHLA 1R2ZA 4LGYA 2FNAA 3UMMA 4G4OA 3M0EA 4AQYM 4DR7M 1IN5A 4LF5M 1R6BX 1L8QA 2KA6B 2QZ4A 2KZSA 1PJIA 2V1UA 3AV0A 5FTMA 5KO3A 4DR6M 3ILKA 2RGHA 3LQRA 5JI3E 4QOSA 2F5QA 1E94E 3KVWA 1SXJC 4Z8XA 1WXQA 3IG5A 1TDZA 2UUBM 4OJ5A 2CUZA 2Z7JA 3PNYA 4AG5A 4NYYA 4DUZM 3GQ4A 3IG8A 4KLNA 1L1ZA 2OPFA 2OQ4A 3DOAA 3K1JA 4RF1A 4D81A 1FNNA 4RNAA 3GP1A 2YFQA 2L6OA 4QNMA 4TUWA 4LJ7A 3SC3A 5F3WA 5GKNA 1XXHA 3RGPA 4GITA 1DO2A 3ZH9B 1C1KA 4L8RC 4M0WA 4QHTA 3GRVA 3SATA 3SHGB 3GRRA 2CV1A 2YQZA 4QOZC 4MGHA 4OU7A 4JI2M 3MJ5A 3J7AS 4DR2M 2HCBA 4EIWA 3J2PB 3FUTA 2XF3A 1L2BA 3FD9A 3FKEA 3VLFB 3DFZA 3HU1A 3HHYA 3UJNA 2C96A 1JQJC 1OFHA 4FWHA 3GLGB 3TE6A 4DV4M 1NNUC 1XNRM 2CHGA 3NWLA 4QHSA 1N36M 4PT5A 4GIPA 3FUWA 3SARA 1XHBA 2C99A 4KODA 8CATA 3GLFA 1NSFA 2X49A 1IY1A 1XXHB 4DR1M 1SXJA 4B3TM 3SYLA 3KXEC 2VQFM 4GHAA 1SXJD 1DO0A 3GPYA 4IBFA 3U6QA 1IM2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IBB A;  3L26 A;  3KS8 A;  4IBC A;  3L28 A;  4IJF A;  4IBI A;  4LG2 A;  3L2A A;  4GH9 A;  4IBD A;  3L29 A;  5BPV A;  3L25 A;  4GHA A;  4IJE A;  3L27 A;  4IBJ A;  4IBK A;  4IBE A;  4IBG A;  3FKE A;  3KS4 A;  4IBF A;  4GHL A; 
#chains in the Genus database with same CATH topology
 1HR0 M;  1NVM A;  2BJV A;  2K47 A;  1J7K A;  2L2D A;  2QCU A;  3HJQ A;  2A5Y B;  4JXJ A;  1N77 A;  1TDH A;  1W1V A;  2BNK A;  4RKU F;  4B7F A;  2D7H A;  3KDS E;  4MGZ E;  4NZ1 A;  1VDD A;  2L7H A;  3A46 A;  4I5S A;  2JY7 A;  1IN8 A;  3D8L A;  1QAN A;  4B7G A;  3SAU A;  5FTJ A;  1E8B A;  2Y2N A;  1ZMW A;  2LVA A;  4KHP M;  1YU4 A;  4P17 A;  2JA2 A;  1OFI A;  3HKP A;  3HSH A;  3GO8 A;  4CIS A;  4AKI A;  2N35 A;  1IN4 A;  3KOW E;  4Z2K A;  3K92 A;  1QAQ A;  3L25 A;  2ERC A;  4Y28 F;  4QNL A;  4I81 A;  1G41 A;  2KW0 A;  4CGY B;  3C58 A;  4K0K M;  1HJP A;  2L7I A;  3EIE A;  2JZ1 A;  3HGI A;  4IBG A;  5FTN A;  4JI8 M;  3KS4 A;  4LJ9 A;  4NOO B;  1NHG C;  5EXT A;  2V5O A;  3U5Z B;  4FCW A;  4REZ A;  4OJP A;  2JY5 A;  4NZ3 A;  5EP2 A;  1D0K A;  5L8R F;  1DGG A;  1PJS A;  2L4F A;  2XFS A;  3FYD A;  3GLI B;  1NY5 A;  4FWG A;  1J7M A;  2QSF X;  2HL7 A;  2R45 A;  1NJF A;  5ITU A;  2VII A;  3N3F A;  1ZMU A;  5DFL A;  4D82 A;  1ORY B;  3T6P A;  3CF0 A;  1L2C A;  4M0D A;  2F5P A;  3HU3 A;  2H1R A;  1HT1 E;  3HX3 A;  2R44 A;  2DHY A;  2KEB A;  2ZAO A;  4A3V B;  1Z5A A;  4Z2G A;  1HT2 E;  2BWB A;  4LZJ A;  5FTL A;  4Z2H A;  4GMQ A;  3KFU G;  4GHL A;  2W82 A;  4FWD A;  1PJJ A;  3FTF A;  1QYR A;  1LTM A;  1QZM A;  1KSF X;  3FTC A;  3LVV A;  4PCZ A;  5LMU M;  3KS8 A;  3VDU A;  4FVM A;  3I04 M;  1KFV A;  2JCH A;  2R62 A;  1PRB A;  3THG A;  3U60 A;  4MGY E;  5EXX A;  3CGW A;  3U6L A;  1R5L A;  4P16 A;  2KDL A;  2EUC A;  1W1Y A;  1TR8 A;  3HY5 A;  4X65 M;  4DV7 M;  2F5N A;  4OJL A;  5ITQ A;  2R4J A;  2DXI A;  1HNW M;  3J81 S;  1Z6T A;  1Q3C A;  1QDR A;  2EO2 A;  1O6I A;  3Q8X A;  1I94 M;  1E15 A;  4LJ5 A;  1AIW A;  2LXE A;  4DUY M;  1L1T A;  4AI6 A;  2JP7 A;  5LMN M;  4IJE A;  2KNV A;  1IBL M;  2QPA A;  2XGN A;  3JAM S;  4NRW A;  1NJG A;  2V1C A;  4MGK E;  2RRU A;  3TQS A;  4NSO B;  4LGM A;  2XZF A;  4AW4 A;  2MJ5 B;  4L15 A;  3DA1 A;  4M9S A;  3CTW B;  2KHH A;  1LV7 A;  3SAW A;  1V33 A;  3KW6 A;  3TL4 X;  1YLA A;  3KOX E;  3U6O A;  2F4V M;  3AOE A;  1W5S A;  5E26 A;  4YY3 M;  2XH9 A;  3KOZ E;  1WR1 B;  4CJ6 A;  2JXN A;  2FFF B;  1R7R A;  3SAV A;  2V6Z M;  3WD1 A;  3FUX A;  2CP8 A;  3L28 A;  1T6O A;  2L09 A;  3J80 S;  3U6S A;  2CV2 A;  3AOG A;  2DKL A;  2G5G X;  3VFD A;  4LG2 A;  2M60 A;  2JUJ A;  3KOY E;  3L2A A;  1S3S A;  3QWL A;  1N34 M;  2LNH C;  1FJG M;  3A42 A;  3WD0 A;  3CF6 E;  3U6M A;  5FTK A;  4DR4 M;  4L16 A;  3TWK A;  2HWJ A;  4F2L A;  1L2D A;  2C9C A;  1OKS A;  2JZ0 A;  1VDL A;  2F5O A;  2O25 A;  4LFB M;  1PDC A;  1GXD A;  4W5W A;  5DNY A;  4NZ4 A;  2DHR A;  1T3T A;  3GLI A;  2LWX A;  3I01 M;  1MX0 A;  2R46 A;  4G4N A;  3RGS A;  2MRO B;  2WSF F;  1IBM M;  1YU0 A;  3B9P A;  4LRT A;  4PDG A;  3E4R A;  4M9X A;  4AZF A;  1GL6 A;  2OO9 A;  3KSJ A;  3KP1 E;  5KPR A;  3EIH A;  1CXW A;  2CV0 A;  2KXE A;  2EJS A;  3VK7 A;  2BWE A;  2Y0T A;  1G59 A;  2EA0 A;  4LF8 M;  1DGB A;  3W0L B;  4AKG A;  4FCV A;  4BLC A;  1EIJ A;  2Y2L A;  2Y0Q A;  4I4L A;  3SFZ A;  1G4A E;  1R4G A;  2Y2G A;  5BPV A;  5ITR A;  3IEC A;  1HQC A;  5A2Q S;  4Z2I A;  4FD2 A;  4NRV A;  3TPZ A;  4Z6Y A;  1IN6 A;  3FTD A;  4DR3 M;  3GLF E;  1XXH E;  3SHF A;  2E5L M;  1KYI A;  2FOI C;  2LVN C;  3GLH A;  4LJA A;  3T15 A;  4ITQ A;  2JNH A;  1UM8 A;  1H6U A;  3C3D A;  4DR5 M;  1Z5C A;  1QDT A;  4JI7 M;  4OJO A;  1YSY A;  1GAB A;  2LVO C;  4R3D A;  5EQT A;  1ZQ9 A;  5EJC A;  3MK6 A;  2XZU A;  1DGF A;  2EKK A;  2WZJ A;  4I8O A;  4WW0 A;  4D80 A;  1QZE A;  1E6P A;  3GLG E;  2D7E A;  3WD4 A;  1UR8 A;  2KZU A;  2UUA M;  4GH9 A;  4OVZ B;  2VQE M;  3TWM A;  2XD5 A;  1Q39 A;  1GL7 A;  3CF2 A;  1IBK M;  1WHC A;  4NC6 A;  2P5T A;  3T38 A;  4BB9 A;  3AL0 C;  2Y2K A;  1Q3B A;  2Y2Q A;  4JYA M;  2EKF A;  3HHW A;  1T43 A;  4BBA A;  1N75 A;  2BG1 A;  2XSZ D;  4IBJ A;  1R2Y A;  4KO8 A;  4PD2 A;  4LJ6 A;  3BOS A;  3T1Y M;  3M7P A;  1QQW A;  5C18 A;  3HHX A;  4NYU A;  4QNR A;  5EXP A;  1NNJ A;  1QUT A;  2XFT A;  3HHZ A;  3UK6 A;  2DVW B;  2ZM6 M;  3B7Q A;  3U6E A;  3GLH B;  1QAO A;  4DV0 M;  3MQL A;  1YU1 A;  4LFA M;  2VF8 A;  4LF4 M;  5E6J A;  3IHP A;  5KQD A;  2FE8 A;  2BJW A;  1EAK A;  2F5S A;  2QP9 X;  2Z8Y M;  3HWS A;  3U60 B;  4XBO A;  5IRE B;  2HAK A;  2QHO B;  3K9P A;  2YR0 A;  4HL4 A;  3FE3 A;  1YUB A;  2NQ8 C;  3D8B A;  3HON A;  1ZV1 A;  1JR3 D;  3FUU A;  1XC8 A;  1K3X A;  3BBZ A;  3FYC A;  4CHT B;  3J7B A;  5ITX E;  4YHH M;  4L6V 6;  1IXZ A;  2L4E A;  1H8P A;  3C3E A;  2DAG A;  3K8Z A;  1YE9 A;  3AJI B;  4GRI A;  1OJL A;  4ZPX A;  3FTE A;  3GQ5 A;  1GLN A;  1WGN A;  3SMP A;  3VKG A;  4TX8 A;  2ZBK B;  4JI0 M;  1KS0 A;  2K0B X;  3UGJ A;  3OTO M;  2DWL A;  4G4Q A;  3GPP A;  2B3T A;  2Y2M A;  2QBY A;  1IY2 A;  2MH8 A;  2R65 A;  4II7 A;  2OOB A;  2LHC A;  3R9X B;  3HJ8 A;  3I4V A;  2Z4S A;  2X4A A;  3HU2 A;  1G8P A;  5ITY A;  4DV1 M;  3QYE A;  2WSE F;  2RGO A;  3H4M A;  2KRU A;  2J7N A;  2LVQ D;  3L29 A;  1UFZ A;  2R4E A;  3PNV A;  4GKK M;  2DWM A;  1W5T A;  3NBI A;  1IFY A;  1I4W A;  3FRI A;  4GC9 A;  2RKO A;  3SYK A;  3U6P A;  4IBE A;  2ZAM A;  2O5R A;  4NL4 H;  4UN2 B;  1OGB A;  4MGI E;  2CHV A;  1MU5 A;  2Z4R A;  3H4J A;  1OAI A;  4IBB A;  2QEN A;  5KPT A;  3U61 B;  1N32 M;  1NO1 A;  2GQF A;  2OOA A;  3E9S A;  1XNQ M;  3M6A A;  2QNJ A;  4GKJ M;  1N78 A;  4HMC A;  3FUV A;  3JR5 A;  3W0F A;  4NXN M;  1GKI A;  3VDP A;  4DV3 M;  1OQY A;  1VEG A;  4LF7 M;  2KRK A;  1D2N A;  1TH3 A;  1GOI A;  1Y8G A;  2R18 A;  1IQP A;  3U6D A;  4FCT A;  4MB5 A;  4GC5 A;  3HZJ A;  1SXJ E;  2XSZ A;  4IBD A;  5H37 D;  1WJ7 A;  4G6Z A;  4M9Z A;  1XMO M;  2I7N A;  2CE7 A;  4WUR A;  4JV5 M;  5DYI A;  4JI1 M;  2UXD M;  4Z2J A;  3L27 A;  2Y2H A;  1J09 A;  4JN6 A;  4LJ4 A;  2Y21 A;  4XK8 F;  3RFW A;  4DV6 M;  2J5Y A;  3Q8G A;  4X64 M;  1HNZ M;  2LH0 A;  2I7P A;  1CK7 A;  1PM5 A;  2Y2I A;  4MB3 A;  3E46 A;  3ZC7 B;  1XMQ M;  3M7G A;  1VQ1 A;  2JWS A;  3C9P A;  7CAT A;  4JI4 M;  3WX7 A;  5BR8 M;  4MM3 B;  4B7H A;  4DV2 M;  4JI6 M;  1HNX M;  3VKH A;  4LFC M;  3UZU A;  1IXS B;  4X62 M;  1QAM A;  3I4Y A;  3DZD A;  2UXC M;  2UWX A;  5IZ7 D;  1SG9 A;  1W1P A;  2VF7 A;  1H0G A;  1K82 A;  3SBJ A;  4LJ8 A;  2DWN A;  4L78 A;  4HLQ A;  4KT0 F;  2K9D A;  2Y2J A;  4MH0 E;  5KQ8 A;  4JI5 M;  3HJS A;  2DI0 A;  5KPZ A;  3GQ3 A;  1IN7 A;  1ZMV A;  3A45 A;  2DZN B;  2FS1 A;  3I51 A;  2XD1 A;  1E9R A;  2CWB A;  1W1T A;  4OUI A;  1J5E M;  4PDI A;  2K6B A;  1DV0 A;  3TWL A;  4AKH A;  2HKJ A;  3KSX A;  2UXB M;  2UUC M;  2YNM D;  2JE5 A;  1IXR C;  1GVN A;  1TH4 A;  3A98 B;  2C98 A;  2FFJ A;  2AHM A;  3LVW A;  3MHV C;  4RF0 A;  4X66 M;  3SAS A;  3AKZ A;  3WD3 A;  2APL A;  4OW0 A;  1JR3 A;  2LVP C;  3GRU A;  3LCU A;  1K3W A;  3QAU A;  4LRS A;  4G3O A;  3B7N A;  4LY6 A;  1V92 A;  1TH2 A;  3AFH A;  2Z3X A;  4NSR A;  1E6N A;  2DAE A;  1YU2 A;  1QVR A;  3GLH E;  4HME A;  2Y2P A;  4R7G A;  1YUE A;  4OJ6 A;  1G71 A;  5EP1 A;  4B3S M;  1X37 A;  4L4U A;  4DV5 M;  1D0L A;  2HHH M;  3B7Z A;  1NHW C;  1YU3 A;  2XLJ A;  3J27 B;  5EP4 A;  5C1B A;  1OTR A;  1HQY E;  3ZCB B;  4G4R A;  5ITT A;  2Y2O A;  3ZQJ A;  2LBC A;  3SMS A;  2KNZ A;  4F1I A;  4NXM M;  2GNO A;  2M5Z A;  2IOU A;  1NY6 A;  2XEP A;  3T1H M;  4DBG B;  2RTS A;  3KP0 E;  3LQQ A;  2C5R A;  3B74 A;  1EFU B;  1DGH B;  3W68 A;  1ZAE A;  5JI2 E;  4AG6 A;  4IJF A;  3WHK A;  4IBI A;  1IY0 A;  2CEA A;  3RE8 A;  5FLX S;  1Z59 A;  5DYG A;  5IWA M;  2C9O A;  4Z2L A;  4B3R M;  5EXS A;  4MB7 A;  1E6R A;  2ZAN A;  3JR4 A;  4JI3 M;  2CHQ A;  4FW9 A;  3GLF B;  1VG5 A;  3LCV B;  3NBX X;  2FH0 A;  3U61 A;  2G8L A;  4NZ5 A;  4IBK A;  3PXG A;  1V34 A;  1SXJ B;  3GPX A;  4OX9 M;  3K2L A;  1Z5B A;  1ED7 A;  4HEO A;  4LF9 M;  3PVS A;  1TGU A;  5EP3 A;  4NY2 A;  3MMP A;  2G3Q A;  4GEW A;  4IIW A;  4LZZ A;  3L26 A;  1Q02 A;  3AOE C;  2UU9 M;  2KNA A;  3U6Q A;  2X8A A;  1G3I A;  3LMM A;  4IBC A;  4OVZ A;  2DZO B;  3U6C A;  1E9S A;  2DWZ B;  2CFO A;  5ITX A;  1GO5 A;  1OIP A;  1E32 A;  3GLG A;  2J7O A;  4B3M M;  3PFI A;  1BVS A;  2ZTC A;  1DGH A;  1EE8 A;  5FSW A;  1H0I A;  3B89 A;  1PJT A;  1N33 M;  2QBY B;  2Y20 A;  3GPU A;  3BXW A;  4S12 A;  5IT9 S;  4XGI A;  4B08 A;  4LF6 M;  2LHG A;  1XWI A;  4Q7J A;  3U5Z A;  3VK8 A;  2D7G A;  3GRY A;  4LCB A;  2Q2E B;  1MN3 A;  3WHL A;  3R8F A;  1F4I A;  1R2Z A;  2WSC F;  4LGY A;  2FNA A;  3UMM A;  4G4O A;  2DEN A;  3M0E A;  2JY6 B;  4AQY M;  4DR7 M;  3FRH A;  1IN5 A;  4LF5 M;  1R6B X;  1L8Q A;  2KA6 B;  2QZ4 A;  2KZS A;  1PJI A;  2V1U A;  2DAK A;  3AV0 A;  5FTM A;  4CIZ A;  2MR9 A;  5KO3 A;  4DR6 M;  3ILK A;  2O01 F;  2RGH A;  2QQ8 A;  3LQR A;  3GLI E;  1TTE A;  2D49 A;  5JI3 E;  4QOS A;  1NV8 A;  2F5Q A;  1JB0 F;  1E94 E;  4R71 A;  3KVW A;  1SXJ C;  4Z8X A;  1WXQ A;  3IG5 A;  2H5X A;  1TDZ A;  2UUB M;  4OJ5 A;  4HMD A;  2CUZ A;  1MJG M;  2Z7J A;  1GPF A;  1A5T A;  3PNY A;  4AG5 A;  4NYY A;  2ZTD A;  4DUZ M;  3GQ4 A;  1OAO C;  3IG8 A;  4KLN A;  1L1Z A;  2OPF A;  3QYB A;  2OQ4 A;  4MB4 A;  2CRU A;  1D0M A;  3DOA A;  3K1J A;  4RF1 A;  4D81 A;  1FNN A;  4RNA A;  3GP1 A;  1L6J A;  2YFQ A;  1VEK A;  2L6O A;  1TF0 B;  1QUS A;  4QNM A;  4TUW A;  4LJ7 A;  3SC3 A;  2DZL A;  4ANR A;  5F3W A;  5GKN A;  2MGW A;  1QO6 A;  1E6Z A;  1WIV A;  1XXH A;  3RGP A;  4GIT A;  1DO2 A;  2VDB B;  1C1K A;  3ZH9 B;  4M0W A;  4QHT A;  3GRV A;  3SAT A;  4L8R C;  2JY8 A;  3SHG B;  1CUK A;  3GRR A;  1IXS A;  2CV1 A;  2YQZ A;  4QOZ C;  4MGH A;  4OU7 A;  4JI2 M;  3MJ5 A;  3J7A S;  4DR2 M;  1UR9 A;  1C7Y A;  1WGL A;  2HCB A;  2R0I A;  4EIW A;  3J2P B;  1RU3 A;  3FUT A;  1XB2 B;  2XF3 A;  1L2B A;  2DAM A;  3FD9 A;  3FKE A;  1P3Q Q;  3VLF B;  3DFZ A;  3HU1 A;  3HHY A;  3UJN A;  2C96 A;  3F92 A;  1JQJ C;  1OFH A;  4FWH A;  4WP2 A;  3W67 A;  1GJT A;  3GLG B;  3E21 A;  3TE6 A;  4DV4 M;  1NNU C;  1VEJ A;  1XNR M;  2CHG A;  3NWL A;  4QHS A;  1N36 M;  1AIP C;  4PT5 A;  1E88 A;  2DNA A;  4GIP A;  1PJQ A;  3FUW A;  3SAR A;  1XHB A;  2C99 A;  4KOD A;  3K9O A;  8CAT A;  2LTU A;  1OGG A;  3GLF A;  1NSF A;  2X49 A;  1IY1 A;  1JR3 E;  1XXH B;  4DR1 M;  1SXJ A;  4B3T M;  3SYL A;  3WD2 A;  3KXE C;  2VQF M;  1NV9 A;  4GHA A;  1SXJ D;  2R6F A;  3LW5 F;  1DO0 A;  1OIZ A;  1GJS A;  3GPY A;  2FN2 A;  4IBF A;  1PGY A;  2DAI A;  1AUA A;  3V76 A;  1IM2 A; 
#chains in the Genus database with same CATH homology
 1HR0 M;  1NVM A;  2BJV A;  2K47 A;  1J7K A;  2QCU A;  1N77 A;  3HJQ A;  2A5Y B;  4JXJ A;  1TDH A;  2BNK A;  4B7F A;  2D7H A;  3KDS E;  4MGZ E;  4NZ1 A;  1VDD A;  2L7H A;  3A46 A;  4I5S A;  1IN8 A;  3D8L A;  1QAN A;  4B7G A;  3SAU A;  5FTJ A;  2Y2N A;  4KHP M;  1YU4 A;  2JA2 A;  1OFI A;  3HKP A;  3HSH A;  3GO8 A;  4CIS A;  4AKI A;  3KOW E;  1IN4 A;  3K92 A;  1QAQ A;  3L25 A;  2ERC A;  4QNL A;  4I81 A;  1G41 A;  2KW0 A;  4CGY B;  3C58 A;  4K0K M;  2L7I A;  3EIE A;  3HGI A;  4IBG A;  5FTN A;  4JI8 M;  3KS4 A;  4LJ9 A;  4NOO B;  1NHG C;  5EXT A;  3U5Z B;  4FCW A;  4REZ A;  4OJP A;  4NZ3 A;  5EP2 A;  1DGG A;  3FYD A;  2XFS A;  3GLI B;  1NY5 A;  4FWG A;  2HL7 A;  2R45 A;  1NJF A;  5ITU A;  2VII A;  3N3F A;  4D82 A;  1ORY B;  3CF0 A;  1L2C A;  4M0D A;  2F5P A;  3HU3 A;  2H1R A;  1HT1 E;  2KEB A;  2ZAO A;  4A3V B;  1Z5A A;  1HT2 E;  4LZJ A;  5FTL A;  4GMQ A;  3KFU G;  4GHL A;  2W82 A;  4FWD A;  1PJJ A;  3FTF A;  1QYR A;  1QZM A;  1KSF X;  3FTC A;  3LVV A;  4PCZ A;  5LMU M;  3KS8 A;  3VDU A;  4FVM A;  2JCH A;  1KFV A;  2R62 A;  3THG A;  3U60 A;  4MGY E;  5EXX A;  3U6L A;  4P16 A;  2EUC A;  4OJL A;  4X65 M;  4DV7 M;  2F5N A;  5ITQ A;  2R4J A;  2DXI A;  1HNW M;  3J81 S;  1Z6T A;  1Q3C A;  2EO2 A;  3Q8X A;  1I94 M;  4LJ5 A;  2LXE A;  4DUY M;  1L1T A;  4AI6 A;  5LMN M;  4IJE A;  1IBL M;  2QPA A;  2XGN A;  3JAM S;  4NRW A;  1NJG A;  2V1C A;  4MGK E;  3TQS A;  4NSO B;  4LGM A;  2XZF A;  4AW4 A;  4L15 A;  3DA1 A;  4M9S A;  3CTW B;  3SAW A;  1LV7 A;  3TL4 X;  3KW6 A;  3U6O A;  3KOX E;  2F4V M;  3AOE A;  1W5S A;  5E26 A;  4YY3 M;  2XH9 A;  3KOZ E;  2FFF B;  1R7R A;  3SAV A;  2V6Z M;  3FUX A;  3J80 S;  3L28 A;  3U6S A;  2L09 A;  2CV2 A;  3AOG A;  2G5G X;  3VFD A;  4LG2 A;  2M60 A;  3KOY E;  3L2A A;  1S3S A;  3QWL A;  1N34 M;  2LNH C;  1FJG M;  3A42 A;  3CF6 E;  3U6M A;  5FTK A;  4DR4 M;  4L16 A;  3TWK A;  2F5O A;  1L2D A;  2C9C A;  4LFB M;  4W5W A;  5DNY A;  4NZ4 A;  2DHR A;  1T3T A;  3GLI A;  2LWX A;  1MX0 A;  2R46 A;  4G4N A;  3RGS A;  1IBM M;  1YU0 A;  3B9P A;  4LRT A;  4PDG A;  3E4R A;  4M9X A;  4AZF A;  1GL6 A;  3KSJ A;  3KP1 E;  5KPR A;  3EIH A;  2CV0 A;  2KXE A;  3VK7 A;  2Y0T A;  1G59 A;  2EA0 A;  4LF8 M;  1DGB A;  3W0L B;  4AKG A;  4FCV A;  4BLC A;  2Y2L A;  2Y0Q A;  4I4L A;  3SFZ A;  1G4A E;  2Y2G A;  5BPV A;  5ITR A;  5A2Q S;  1HQC A;  4FD2 A;  4NRV A;  3TPZ A;  4Z6Y A;  1IN6 A;  3FTD A;  4DR3 M;  3SHF A;  2E5L M;  1KYI A;  2FOI C;  3T15 A;  3GLH A;  4LJA A;  4ITQ A;  1UM8 A;  1H6U A;  4DR5 M;  4JI7 M;  1Z5C A;  4OJO A;  1YSY A;  4R3D A;  5EQT A;  1ZQ9 A;  5EJC A;  3MK6 A;  2XZU A;  1DGF A;  4D80 A;  4I8O A;  4WW0 A;  2D7E A;  2KZU A;  2UUA M;  4GH9 A;  4OVZ B;  2VQE M;  3TWM A;  2XD5 A;  1Q39 A;  1GL7 A;  3CF2 A;  1IBK M;  2P5T A;  3T38 A;  4BB9 A;  3AL0 C;  2Y2K A;  1Q3B A;  2Y2Q A;  4JYA M;  3HHW A;  4BBA A;  1N75 A;  2BG1 A;  2XSZ D;  4IBJ A;  1R2Y A;  4KO8 A;  4PD2 A;  4LJ6 A;  3BOS A;  3T1Y M;  1QQW A;  5C18 A;  3HHX A;  4NYU A;  4QNR A;  5EXP A;  1NNJ A;  2XFT A;  3HHZ A;  3UK6 A;  2DVW B;  2ZM6 M;  3U6E A;  3GLH B;  1QAO A;  4DV0 M;  1YU1 A;  4LFA M;  4LF4 M;  5E6J A;  5KQD A;  2FE8 A;  2BJW A;  2F5S A;  2QP9 X;  3HWS A;  3U60 B;  4XBO A;  5IRE B;  2YR0 A;  4HL4 A;  1YUB A;  2NQ8 C;  3D8B A;  3HON A;  1JR3 D;  3FUU A;  1XC8 A;  1K3X A;  3FYC A;  4CHT B;  3J7B A;  5ITX E;  4YHH M;  1IXZ A;  3K8Z A;  1YE9 A;  3AJI B;  4GRI A;  1OJL A;  4ZPX A;  3FTE A;  3GQ5 A;  1GLN A;  3SMP A;  3VKG A;  2ZBK B;  4JI0 M;  3UGJ A;  3OTO M;  2DWL A;  4G4Q A;  3GPP A;  2Y2M A;  2QBY A;  1IY2 A;  2R65 A;  4II7 A;  3R9X B;  3HJ8 A;  3I4V A;  2Z4S A;  2X4A A;  3HU2 A;  1G8P A;  5ITY A;  4DV1 M;  2RGO A;  3H4M A;  2KRU A;  2J7N A;  3L29 A;  2R4E A;  3PNV A;  4GKK M;  2DWM A;  1W5T A;  3NBI A;  1I4W A;  4GC9 A;  2RKO A;  3SYK A;  3U6P A;  4IBE A;  2ZAM A;  2O5R A;  4NL4 H;  4MGI E;  2CHV A;  2Z4R A;  1MU5 A;  5KPT A;  4IBB A;  2QEN A;  3U61 B;  1N32 M;  3E9S A;  1XNQ M;  3M6A A;  4GKJ M;  1N78 A;  3FUV A;  3JR5 A;  3W0F A;  4NXN M;  1GKI A;  3VDP A;  4DV3 M;  4LF7 M;  2KRK A;  1D2N A;  1TH3 A;  2R18 A;  1IQP A;  3U6D A;  4FCT A;  4GC5 A;  1SXJ E;  2XSZ A;  4IBD A;  5H37 D;  1XMO M;  4G6Z A;  4M9Z A;  4JV5 M;  2I7N A;  2CE7 A;  4WUR A;  5DYI A;  4JI1 M;  2UXD M;  3L27 A;  2Y2H A;  1J09 A;  4JN6 A;  4LJ4 A;  2Y21 A;  3RFW A;  4DV6 M;  4X64 M;  1HNZ M;  2LH0 A;  2I7P A;  1PM5 A;  2Y2I A;  3ZC7 B;  1XMQ M;  3M7G A;  7CAT A;  4JI4 M;  3WX7 A;  5BR8 M;  4MM3 B;  4B7H A;  4DV2 M;  4JI6 M;  1HNX M;  3VKH A;  4LFC M;  3UZU A;  1IXS B;  4X62 M;  1QAM A;  3I4Y A;  3DZD A;  2UXC M;  2UWX A;  5IZ7 D;  1K82 A;  3SBJ A;  4LJ8 A;  2DWN A;  4L78 A;  4HLQ A;  2Y2J A;  4MH0 E;  5KQ8 A;  4JI5 M;  3HJS A;  5KPZ A;  3GQ3 A;  1IN7 A;  3A45 A;  2DZN B;  3I51 A;  2XD1 A;  1E9R A;  4OUI A;  1J5E M;  4PDI A;  3TWL A;  4AKH A;  2HKJ A;  3KSX A;  2UXB M;  2UUC M;  2YNM D;  2JE5 A;  1IXR C;  1GVN A;  1TH4 A;  3A98 B;  3MHV C;  2C98 A;  2FFJ A;  2AHM A;  3LVW A;  4RF0 A;  4X66 M;  3SAS A;  3AKZ A;  4OW0 A;  1JR3 A;  3GRU A;  1K3W A;  3QAU A;  4LRS A;  4LY6 A;  1TH2 A;  3AFH A;  2Z3X A;  4NSR A;  1YU2 A;  1QVR A;  2Y2P A;  4R7G A;  1YUE A;  4OJ6 A;  5EP1 A;  4B3S M;  1X37 A;  4L4U A;  4DV5 M;  2HHH M;  1NHW C;  1YU3 A;  2XLJ A;  3J27 B;  5EP4 A;  5C1B A;  3ZCB B;  1HQY E;  4G4R A;  5ITT A;  2Y2O A;  3SMS A;  4NXM M;  2M5Z A;  2IOU A;  1NY6 A;  2XEP A;  3T1H M;  3KP0 E;  3LQQ A;  2C5R A;  1DGH B;  1ZAE A;  5JI2 E;  4AG6 A;  4IJF A;  3WHK A;  4IBI A;  1IY0 A;  2CEA A;  3RE8 A;  5FLX S;  1Z59 A;  5DYG A;  5IWA M;  2C9O A;  4B3R M;  5EXS A;  4MB7 A;  2ZAN A;  3JR4 A;  4JI3 M;  2CHQ A;  4FW9 A;  3GLF B;  3U61 A;  2G8L A;  4NZ5 A;  4IBK A;  3PXG A;  3GPX A;  1SXJ B;  4OX9 M;  3K2L A;  1Z5B A;  4LF9 M;  3PVS A;  1TGU A;  5EP3 A;  4NY2 A;  4IIW A;  4LZZ A;  3L26 A;  3AOE C;  2UU9 M;  2X8A A;  1G3I A;  3LMM A;  4IBC A;  4OVZ A;  2DZO B;  3U6C A;  1E9S A;  2DWZ B;  2CFO A;  5ITX A;  1E32 A;  3GLG A;  2J7O A;  4B3M M;  3PFI A;  1DGH A;  1EE8 A;  5FSW A;  1N33 M;  2QBY B;  2Y20 A;  3GPU A;  4S12 A;  5IT9 S;  4XGI A;  4B08 A;  4LF6 M;  1XWI A;  3U5Z A;  3VK8 A;  2D7G A;  3GRY A;  4LCB A;  2Q2E B;  3R8F A;  3WHL A;  1R2Z A;  4LGY A;  2FNA A;  3UMM A;  4G4O A;  3M0E A;  4AQY M;  4DR7 M;  1IN5 A;  4LF5 M;  1R6B X;  1L8Q A;  2KA6 B;  2QZ4 A;  2KZS A;  1PJI A;  2V1U A;  3AV0 A;  5FTM A;  5KO3 A;  4DR6 M;  3ILK A;  2RGH A;  3LQR A;  5JI3 E;  4QOS A;  2F5Q A;  1E94 E;  3KVW A;  1SXJ C;  4Z8X A;  1WXQ A;  3IG5 A;  1TDZ A;  2UUB M;  4OJ5 A;  2CUZ A;  2Z7J A;  3PNY A;  4AG5 A;  4NYY A;  4DUZ M;  3GQ4 A;  3IG8 A;  4KLN A;  1L1Z A;  2OPF A;  2OQ4 A;  3DOA A;  3K1J A;  4RF1 A;  4D81 A;  1FNN A;  4RNA A;  3GP1 A;  2YFQ A;  2L6O A;  4QNM A;  4TUW A;  4LJ7 A;  3SC3 A;  5F3W A;  5GKN A;  1XXH A;  3RGP A;  4GIT A;  1DO2 A;  3ZH9 B;  1C1K A;  4L8R C;  4M0W A;  4QHT A;  3GRV A;  3SAT A;  3SHG B;  3GRR A;  2CV1 A;  2YQZ A;  4QOZ C;  4MGH A;  4OU7 A;  4JI2 M;  3MJ5 A;  3J7A S;  4DR2 M;  2HCB A;  4EIW A;  3J2P B;  3FUT A;  2XF3 A;  1L2B A;  3FD9 A;  3FKE A;  3VLF B;  3DFZ A;  3HU1 A;  3HHY A;  3UJN A;  2C96 A;  1JQJ C;  1OFH A;  4FWH A;  3GLG B;  3TE6 A;  4DV4 M;  1NNU C;  1XNR M;  2CHG A;  3NWL A;  4QHS A;  1N36 M;  4PT5 A;  4GIP A;  3FUW A;  3SAR A;  1XHB A;  2C99 A;  4KOD A;  8CAT A;  3GLF A;  1NSF A;  2X49 A;  1IY1 A;  1XXH B;  4DR1 M;  1SXJ A;  4B3T M;  3SYL A;  3KXE C;  2VQF M;  4GHA A;  1SXJ D;  1DO0 A;  3GPY A;  4IBF A;  3U6Q A;  1IM2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...