4GH9A

Crystal structure of marburg virus vp35 rna binding domain
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
122
structure length
122
Chain Sequence
LSAKDLALLLFTHLPGNNTPFHILAQVLSKIAYKSGKSGAFLDAFHQILSEGENAQAALTRLSRTFDAFLGVVPPVIRVKNFQTVPRPCQKSLRAVPPNPTIDKGWVCVYSSEQGETRALKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polymerase cofactor VP35
publication title Marburg Virus VP35 Can Both Fully Coat the Backbone and Cap the Ends of dsRNA for Interferon Antagonism.
pubmed doi rcsb
source organism Marburg virus
molecule tags Viral protein,rna binding protein
total genus 42
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2012-08-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4gh9A01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4gh9A02
3L26A 3KS8A 4GH9A 3L25A 3FKEA 4IBKA 5BPVA 4IBEA 4IJEA 4IBFA 4IBBA 4IJFA 4LG2A 3L29A 4IBCA 3L28A 4GHAA 4IBIA 3KS4A 4GHLA 4IBDA 3L27A 4IBJA 3L2AA 4IBGA
chains in the Genus database with same CATH superfamily
2L7HA 2QQ8A 2C96A 3RE8A 3AKZA 3KS8A 4DV7M 4LF7M 1PDCA 2F5NA 4XK8F 1W1PA 4NL4H 2XSZA 4Z2IA 2GQFA 4YY3M 2XF3A 3GO8A 4R3DA 2BJWA 3U6DA 2MR9A 4DV1M 2I7PA 2CV0A 1OQYA 4KT0F 2Y2JA 2M5ZA 2ERCA 1Z6TA 1VDDA 4RKUF 4B7FA 4JI8M 5FTMA 3FTDA 2KEBA 2JNHA 1A5TA 3GRYA 3U60A 3OTOM 3C58A 2QNJA 4BBAA 3MK6A 2H1RA 3FTCA 1IXZA 1XNQM 4G3OA 1PJIA 1NJGA 1XNRM 1W1VA 2VDBB 1DGGA 2MROB 2FNAA 2ZAMA 1GVNA 3GRRA 2DHRA 4QHSA 3U5ZA 1IBLM 1WXQA 1E15A 3IECA 3GPXA 5KQ8A 1R6BX 1UM8A 2CEAA 2NQ8C 2W82A 3HX3A 3LMMA 4EIWA 2BNKA 2GNOA 5C18A 4JN6A 1YLAA 4GH9A 5BR8M 3T6PA 3V76A 2JE5A 3LW5F 3WHLA 1NV9A 3FTEA 2Y2KA 4L4UA 2HAKA 2VF7A 2DNAA 4L78A 4M0DA 2CFOA 5DFLA 3MHVC 1R4GA 3I51A 4JI1M 2LNHC 2G3QA 1VQ1A 2DZLA 5FTKA 2D7EA 1V34A 3DFZA 4OU7A 3UK6A 1XWIA 4OVZB 2R62A 5EP4A 3GQ4A 4DV6M 4R7GA 2F5SA 1PJSA 4IIWA 2Y2OA 4NZ1A 1DGHB 3NWLA 4FW9A 3SHGB 3SC3A 1SXJC 3VDPA 4RF1A 1QYRA 2LH0A 3GLIE 4KHPM 4FCVA 4IBGA 1TDHA 2XZUA 1GXDA 1OGBA 4G4NA 1YU3A 3FUTA 3QYEA 3WHKA 4I8OA 1ZMWA 1QAQA 2RGHA 3FE3A 4AG6A 1UR8A 1D2NA 1NY6A 5ITXE 2ZTCA 3W67A 4LCBA 1GPFA 2FFFB 4LFBM 2FOIC 5DYGA 4DV2M 1OTRA 1XC8A 3WX7A 4IBKA 4ZPXA 1UFZA 3LQQA 5EP3A 3HJSA 3U61A 2WSEF 3HU1A 4CJ6A 4NOOB 4L16A 4B3MM 1AUAA 3A98B 1JR3A 1IN6A 3I04M 4IBCA 4PT5A 1J5EM 3KXEC 3C3EA 4IBIA 2L6OA 3KS4A 3T15A 4QOZC 3U6PA 1IN5A 3PNYA 5FTLA 1F4IA 2XFTA 3BXWA 4DV3M 4OUIA 2OOAA 3SAUA 4LF9M 3WD2A 2CHQA 3TWLA 3L26A 2L2DA 1QAOA 1DGFA 4MGHA 3WD0A 2RGOA 3VK8A 1SXJE 2LWXA 1QZMA 2CE7A 3CTWB 4CISA 3J80S 3U60B 2QSFX 3FKEA 2JA2A 2KNZA 4TUWA 3DZDA 1JR3D 2CHVA 4S12A 3K2LA 3LCVB 1GL6A 1J09A 1ORYB 2UUCM 1YU2A 4D82A 3SYKA 4NZ3A 1V33A 1HQCA 1IXRC 2C9OA 1IY1A 4FD2A 2QPAA 3AOGA 2VQEM 1Z59A 1N36M 2UU9M 3Q8XA 5EP2A 2IOUA 2YFQA 1EE8A 1GO5A 4RF0A 2RRUA 4MM3B 2ZTDA 4JI7M 3AFHA 2J7OA 3K1JA 1HR0M 4LF4M 4OVZA 2LBCA 4LFAM 4AKGA 3TWMA 3SATA 1HNWM 4GRIA 3R8FA 3VFDA 2QCUA 1DGHA 3AOEA 2KA6B 2UUAM 1PRBA 4OJ5A 4NYUA 1X37A 4KO8A 3FUXA 4F2LA 2G8LA 2B3TA 3I4YA 1N33M 1N78A 3B7QA 1YU4A 1NJFA 3LVWA 1WR1B 4LRSA 3B74A 4IJEA 4NXNM 1XMOM 1G3IA 3TE6A 2YR0A 2K0BX 2KNAA 3KP1E 5KPZA 3E4RA 2Y0QA 1K3WA 4JI5M 1XXHE 4NYYA 3RGPA 5KQDA 2FFJA 4AKHA 2R44A 2QZ4A 1D0LA 4KODA 1YE9A 2CWBA 5E6JA 3HKPA 4LF5M 1XHBA 2CV1A 2DVWB 1IY0A 3FYDA 4M9XA 3MMPA 3U61B 4LF8M 5EXPA 4DUYM 3JR5A 1W1TA 3M6AA 3HU3A 1BVSA 3KVWA 4MGZE 4HLQA 4L6V6 3RGSA 4HMCA 2X4AA 2JY8A 4ITQA 2OOBA 4WP2A 1QUSA 3K8ZA 2OO9A 2I7NA 3GQ3A 5DNYA 1Q3BA 2WSFF 5IT9S 1QUTA 2K9DA 2QBYB 4FVMA 5GKNA 4JV5M 2EKFA 4LY6A 2J5YA 1GABA 3UGJA 2D49A 2P5TA 1G59A 3KSXA 2UXBM 3PNVA 1R2YA 1HNXM 1TH2A 2EKKA 2WZJA 1GJTA 2MGWA 2DWNA 4OJLA 3E9SA 4JI2M 3GLGA 1E32A 3PVSA 3H4JA 3UMMA 1XMQM 2F5PA 4JYAM 2QHOB 2UWXA 3U6CA 3U6MA 2HL7A 2XEPA 1E6NA 2R4EA 1AIWA 2KRUA 4AI6A 2UXDM 4TX8A 1E9SA 1I4WA 4II7A 3NBIA 3A46A 2DAEA 4WW0A 4GIPA 2JUJA 1HT2E 1XB2B 3ZQJA 1O6IA 4NSRA 2DI0A 2V1UA 2LTUA 5BPVA 4OJOA 2DKLA 2R46A 4Z6YA 3E21A 1H0GA 2L7IA 3J7BA 2DZNB 5IREB 4Z2HA 1TTEA 3L29A 3A45A 4G4RA 1NVMA 1R5LA 5LMUM 4NSOB 3GPPA 2HHHM 2O01F 2ZM6M 5EXTA 1SG9A 1OFHA 2F5QA 3I01M 1OAIA 1J7KA 1VDLA 1WGLA 3L27A 2JZ0A 2Z4RA 1QVRA 1E6ZA 1PJTA 5ITQA 5F3WA 2Z8YM 4FWDA 2Y20A 4AG5A 1PGYA 3SBJA 2KZUA 2MH8A 5ITYA 3SMSA 3LCUA 3FUWA 1MN3A 1OAOC 2KHHA 1MU5A 4QOSA 1JQJC 3GPYA 1SXJD 2VF8A 4GC5A 4GITA 5FTNA 1IN7A 4M9SA 3GLHA 4ANRA 4MGKE 3GP1A 3SARA 4LJ8A 1NY5A 3CF2A 4LRTA 3A42A 3Q8GA 4GHLA 2D7GA 2CP8A 3KOWE 1EAKA 4OJ6A 2KXEA 1Q02A 2QBYA 3MJ5A 3J2PB 1T6OA 2DWMA 4G4QA 2E5LM 3GLIB 1G4AE 3C9PA 2KW0A 5L8RF 2Y2GA 4UN2B 3LVVA 1V92A 3L25A 2K6BA 1Z5CA 1R2ZA 4AW4A 3GPUA 3U6QA 3ILKA 3GLFA 1MJGM 2M60A 4CHTB 2HKJA 3R9XB 1IN4A 3B7NA 3VK7A 4MB4A 1HT1E 4IBEA 5IWAM 2R65A 4M0WA 1G41A 2JXNA 4LZJA 4K0KM 4Z2LA 5KO3A 1OGGA 3GLGB 1NNJA 1VEGA 2LVNC 4FCTA 2BWEA 4D80A 2HWJA 3JAMS 1VEJA 1N77A 4QHTA 4PD2A 4GHAA 2V6ZM 1HJPA 2C9CA 3U6LA 4QNRA 1WJ7A 1LV7A 3KFUG 3C3DA 3VKGA 1H8PA 1YUEA 4B3TM 2C98A 4BLCA 3HJQA 1D0KA 2DWZB 2XGNA 3BBZA 4FWHA 3SHFA 4DBGB 3BOSA 1QANA 1IBKM 1E94E 4CGYB 1WHCA 2LVPC 2A5YB 1GKIA 2H5XA 2JZ1A 3EIEA 3FYCA 2G5GX 2V1CA 3HHWA 4MH0E 3VDUA 1PM5A 3QYBA 2UUBM 2BG1A 2Y2QA 3CGWA 4X62M 4Z2JA 1IY2A 1OIPA 5H37D 3SYLA 3HWSA 1LTMA 4B3RM 4IBFA 1GJSA 3SMPA 2DAGA 4MGYE 2Z7JA 4OJPA 4B08A 4LGYA 2L4FA 4LJAA 5DYIA 1CUKA 2DAMA 4LFCM 3TQSA 3SFZA 3UZUA 1OIZA 3FTFA 3HY5A 2L09A 1C1KA 2FN2A 3WD1A 5FLXS 2O25A 2LVOC 3AV0A 4LF6M 2Y0TA 3KDSE 3FUVA 2F4VM 2XLJA 2Z3XA 2YNMD 3F92A 3J7AS 3B7ZA 2V5OA 1ED7A 5ITTA 2Y2IA 1YU0A 1NNUC 5EQTA 3M7GA 5IZ7D 3GLHB 4GC9A 1NHGC 1VG5A 3ZC7B 4B3SM 4DR4M 5E26A 4HMEA 3AJIB 3VLFB 3KP0E 3AOEC 2YQZA 3GLIA 2Z4SA 1YSYA 1TDZA 3PFIA 1Q3CA 4IBBA 5A2QS 1IXSB 1GL7A 2JWSA 1QAMA 4LG2A 3K92A 4L8RC 1UR9A 3KOYE 4X64M 3KW6A 2Y2NA 5ITXA 3DA1A 3GQ5A 2DZOB 1IN8A 4PDIA 5EXSA 1XXHB 2JY5A 2FH0A 3FRIA 3QWLA 5FTJA 4LJ9A 1QZEA 1WGNA 2AHMA 2R6FA 2XH9A 5EP1A 3GLFB 4DV4M 1L1TA 1L2CA 1QO6A 1N34M 1YU1A 2J7NA 3K9OA 3L2AA 4MB3A 3FUUA 4FWGA 2RKOA 1J7MA 1Q39A 2KNVA 1E8BA 4DR2M 1L2BA 4Z8XA 2DENA 3T1HM 1N75A 2KZSA 2LXEA 1ZQ9A 2DHYA 3CF0A 3GRVA 1P3QQ 1ZMUA 3T38A 7CATA 4DR6M 1NV8A 2JY6B 1NHWC 2OPFA 2O5RA 1L2DA 3TL4X 4I81A 2Q2EB 3SAVA 2LVQD 2C99A 1NO1A 3CF6E 3JR4A 4LZZA 2EJSA 4W5WA 4X66M 3U6SA 5LMNM 4LJ4A 3HSHA 1QDTA 1SXJA 2UXCM 2L4EA 5FSWA 1W5TA 2APLA 5EJCA 1KS0A 4QNLA 2JP7A 4B7GA 2QP9X 4OW0A 5ITUA 4DV0M 2ZAOA 3LQRA 1CK7A 1G8PA 1QQWA 3IG8A 4JI3M 2R4JA 3SAWA 3MQLA 2EA0A 3N3FA 2BJVA 4QNMA 4XBOA 2MJ5B 4PCZA 1DO0A 2KRKA 2XSZD 1ZAEA 4LJ7A 2ZBKB 1QDRA 1W5SA 1FJGM 1TH3A 1YUBA 1ZV1A 2CV2A 2RTSA 3KSJA 3B89A 4MB5A 3IG5A 1GOIA 2VQFM 3KOZE 4CIZA 3PXGA 3W0LB 3HHZA 1N32M 3M7PA 3THGA 5JI3E 4NC6A 3HU2A 1T43A 2DAKA 1I94M 3D8LA 5EXXA 1K82A 4X65M 2N35A 3B9PA 3L28A 4Y28F 4B7HA 3W68A 2OQ4A 1JB0F 4NXMM 3U6EA 2X8AA 4F1IA 2Y21A 1G71A 4HEOA 2ZANA 4DR1M 3ZH9B 4NRVA 1TR8A 1IXSA 3J27B 1OJLA 2CRUA 3U6OA 2XD1A 2Y2HA 4GKKM 2DXIA 1KYIA 1TGUA 3FRHA 3W0FA 1FNNA 1XXHA 1PJQA 2C5RA 2BWBA 2K47A 3E46A 4GEWA 4I5SA 3RFWA 8CATA 3T1YM 1W1YA 1KSFX 4LGMA 1OFIA 1EFUB 3GLGE 3TPZA 1NSFA 1GLNA 4HL4A 4RNAA 3VKHA 4G6ZA 1L8QA 1Z5AA 1K3XA 4JI6M 1DV0A 1R7RA 4L15A 4Z2KA 3WD3A 4A3VB 2EUCA 4JI0M 2Y2LA 1C7YA 1H0IA 2JCHA 3J81S 2Y2MA 1D0MA 1H6UA 2HCBA 2WSCF 3K9PA 1TF0B 1E88A 3HONA 4IBJA 3HHYA 4Q7JA 4NZ5A 4AZFA 2X49A 1DGBA 2QENA 4XGIA 4OX9M 4NZ4A 4KLNA 3HJ8A 2XD5A 2JY7A 2XFSA 1OKSA 4P16A 1SXJB 1E9RA 1PJJA 1L6JA 1HQYE 2R45A 1VEKA 4DUZM 3U5ZB 4JI4M 4REZA 3AL0C 3DOAA 4MGIE 1Y8GA 4LJ6A 4NRWA 1EIJA 1E6RA 2LHGA 3EIHA 1S3SA 1CXWA 1IM2A 2CUZA 2KDLA 3HHXA 1WIVA 2R0IA 1Z5BA 3TWKA 4MB7A 4YHHM 1AIPC 2F5OA 3WD4A 4AQYM 2VIIA 4M9ZA 1HNZM 1IQPA 3FD9A 2XZFA 2DAIA 1E6PA 4Z2GA 4I4LA 4R71A 5ITRA 4AKIA 3H4MA 3GLHE 3IHPA 3NBXX 4JXJA 1JR3E 4LJ5A 1L1ZA 4GKJM 4PDGA 3KOXE 4BB9A 2LHCA 3QAUA 1IBMM 2CHGA 2EO2A 5JI2E 5KPTA 4G4OA 2FE8A 3UJNA 2Y2PA 2R18A 4IJFA 3SASA 4DR7M 1T3TA 4WURA 4DR3M 1DO2A 4DV5M 4D81A 4HMDA 1RU3A 2D7HA 3GRUA 3GLFE 1IFYA 1KFVA 2DWLA 2LVAA 1ZMVA 3HGIA 1TH4A 4IBDA 3ZCBB 5C1BA 5KPRA 3HZJA 3M0EA 4FCWA 4DR5M 4P17A 4NY2A 3D8BA 3I4VA 2FS1A 4GMQA 1MX0A
chains in the Genus database with same CATH topology
2L7HA 2C96A 3RE8A 3AKZA 3KS8A 4DV7M 4LF7M 2F5NA 4NL4H 2XSZA 4YY3M 2XF3A 3GO8A 4R3DA 2BJWA 3U6DA 4DV1M 2I7PA 2CV0A 2Y2JA 2M5ZA 2ERCA 1Z6TA 1VDDA 4B7FA 4JI8M 5FTMA 3FTDA 2KEBA 3U60A 3GRYA 3OTOM 3C58A 4BBAA 3MK6A 2H1RA 3FTCA 1IXZA 1XNQM 1PJIA 1NJGA 1XNRM 1YU4A 1DGGA 2FNAA 2ZAMA 1GVNA 3GRRA 2DHRA 4QHSA 3U5ZA 1IBLM 1WXQA 3GPXA 5KQ8A 1R6BX 1UM8A 2CEAA 2NQ8C 2W82A 3LMMA 4EIWA 5C18A 2BNKA 4JN6A 4GH9A 5BR8M 2JE5A 3WHLA 3FTEA 2Y2KA 4L4UA 4L78A 4M0DA 2CFOA 3MHVC 3I51A 4JI1M 2LNHC 5FTKA 2D7EA 3DFZA 4OU7A 3UK6A 1XWIA 4OVZB 2R62A 5EP4A 3GQ4A 4DV6M 4R7GA 2F5SA 2JCHA 4IIWA 2Y2OA 4NZ1A 1DGHB 3NWLA 4FW9A 3SHGB 3SC3A 1SXJC 3VDPA 4RF1A 1QYRA 2LH0A 4KHPM 4FCVA 4IBGA 1TDHA 2XZUA 1YU3A 4G4NA 3FUTA 3WHKA 4I8OA 1QAQA 2RGHA 4AG6A 1D2NA 1NY6A 5ITXE 4LCBA 2FFFB 4LFBM 2FOIC 5DYGA 4DV2M 1XC8A 3WX7A 4IBKA 4ZPXA 3LQQA 5EP3A 3HJSA 3U61A 3HU1A 4NOOB 4L16A 4B3MM 3A98B 1JR3A 1IN6A 4IBCA 4PT5A 1J5EM 3KXEC 4IBIA 2L6OA 3KS4A 3T15A 4QOZC 3U6PA 1IN5A 3PNYA 5FTLA 2XFTA 4DV3M 4OUIA 3SAUA 4LF9M 2CHQA 3TWLA 3L26A 1QAOA 1DGFA 4MGHA 2RGOA 3VK8A 1SXJE 2LWXA 1QZMA 2CE7A 3CTWB 4CISA 3J80S 3U60B 3FKEA 2JA2A 4TUWA 3DZDA 1JR3D 2CHVA 4S12A 3K2LA 1GL6A 1J09A 1ORYB 2UUCM 1YU2A 4D82A 3SYKA 4NZ3A 1HQCA 1IXRC 2C9OA 1IY1A 4FD2A 2QPAA 3AOGA 2VQEM 1Z59A 1N36M 2UU9M 3Q8XA 5EP2A 2IOUA 2YFQA 1EE8A 4RF0A 4MM3B 4JI7M 3AFHA 2J7OA 3K1JA 1HR0M 4LF4M 4OVZA 4LFAM 4AKGA 3TWMA 3SATA 1HNWM 4GRIA 3R8FA 3VFDA 2QCUA 1DGHA 3AOEA 2KA6B 2UUAM 4OJ5A 4NYUA 1X37A 4KO8A 3FUXA 1N33M 2G8LA 3I4YA 1N78A 1NJFA 3LVWA 4LRSA 4IJEA 4NXNM 1XMOM 1G3IA 3TE6A 2YR0A 3KP1E 5KPZA 3E4RA 2Y0QA 1K3WA 4JI5M 4NYYA 3RGPA 5KQDA 2FFJA 4AKHA 2QZ4A 4KODA 5E6JA 1YE9A 3HKPA 4LF5M 1XHBA 2CV1A 2DVWB 1IY0A 3FYDA 4M9XA 3U61B 4LF8M 5EXPA 4DUYM 3JR5A 3M6AA 3HU3A 3KVWA 4MGZE 4HLQA 3RGSA 2X4AA 4ITQA 3K8ZA 2I7NA 3GQ3A 5DNYA 1Q3BA 5IT9S 2QBYB 4FVMA 5GKNA 4JV5M 4LY6A 3UGJA 2P5TA 1G59A 3KSXA 2UXBM 3PNVA 1R2YA 1HNXM 1TH2A 4OJLA 2DWNA 3E9SA 4JI2M 3GLGA 1E32A 3PVSA 3UMMA 1XMQM 2F5PA 4JYAM 2UWXA 3U6CA 3U6MA 2HL7A 2XEPA 2R4EA 2KRUA 4AI6A 2UXDM 1E9SA 1I4WA 4II7A 3NBIA 3A46A 4WW0A 4GIPA 1HT2E 4NSRA 2V1UA 4OJOA 5BPVA 2R46A 4Z6YA 2L7IA 3J7BA 2DZNB 5IREB 3L29A 3A45A 4G4RA 1NVMA 5LMUM 4NSOB 3GPPA 2HHHM 2ZM6M 5EXTA 1OFHA 2F5QA 1J7KA 3L27A 2Z4RA 1QVRA 5ITQA 5F3WA 4FWDA 2Y20A 4AG5A 3SBJA 2KZUA 3SMSA 5ITYA 3FUWA 1MU5A 4QOSA 1JQJC 3GPYA 1SXJD 4GC5A 4GITA 5FTNA 1IN7A 4M9SA 3GLHA 4MGKE 3GP1A 3SARA 4LJ8A 1NY5A 3CF2A 4LRTA 3A42A 4GHLA 2D7GA 3KOWE 4OJ6A 2KXEA 2QBYA 3MJ5A 3J2PB 2DWMA 4G4QA 2E5LM 3GLIB 1G4AE 2KW0A 2Y2GA 3LVVA 3L25A 1R2ZA 1Z5CA 4AW4A 3GPUA 3U6QA 3ILKA 3GLFA 4CHTB 2M60A 3R9XB 2HKJA 1IN4A 3VK7A 1HT1E 4IBEA 5IWAM 2R65A 4M0WA 1G41A 4LZJA 4K0KM 5KO3A 3GLGB 1NNJA 4FCTA 4D80A 3JAMS 1N77A 4GHAA 4QHTA 4PD2A 2V6ZM 2C9CA 3U6LA 4QNRA 3VKGA 1LV7A 3KFUG 1YUEA 4B3TM 2C98A 4BLCA 3HJQA 2DWZB 2XGNA 4FWHA 3SHFA 3BOSA 1QANA 1IBKM 1E94E 4CGYB 2A5YB 1GKIA 3FYCA 3EIEA 3HHWA 4MH0E 2G5GX 2V1CA 3VDUA 1PM5A 2BG1A 2UUBM 2Y2QA 4X62M 1IY2A 5H37D 3SYLA 3HWSA 4B3RM 4IBFA 3SMPA 4MGYE 2Z7JA 4OJPA 4B08A 4LGYA 4LJAA 5DYIA 4LFCM 3TQSA 3SFZA 3UZUA 3FTFA 2L09A 1C1KA 5FLXS 3AV0A 4LF6M 2Y0TA 3KDSE 3FUVA 2F4VM 2XLJA 2Z3XA 2YNMD 3J7AS 5ITTA 2Y2IA 1YU0A 1NNUC 5EQTA 3M7GA 5IZ7D 3GLHB 4GC9A 1NHGC 3ZC7B 4B3SM 5E26A 3AJIB 3VLFB 3KP0E 3AOEC 2YQZA 3GLIA 2Z4SA 1YSYA 1TDZA 3PFIA 1Q3CA 4IBBA 5A2QS 1IXSB 1GL7A 1QAMA 4LG2A 3K92A 4L8RC 3KOYE 4X64M 3KW6A 2Y2NA 5ITXA 3DA1A 3GQ5A 2DZOB 1IN8A 4PDIA 5EXSA 1XXHB 3QWLA 5FTJA 4DR4M 4LJ9A 2XH9A 5EP1A 2AHMA 4DV4M 3GLFB 1L2CA 1L1TA 1YU1A 1N34M 2J7NA 3L2AA 3FUUA 4FWGA 2RKOA 1Q39A 4DR2M 1L2BA 4Z8XA 3T1HM 1N75A 2KZSA 2LXEA 1ZQ9A 3CF0A 3GRVA 7CATA 4DR6M 3T38A 1NHWC 2OPFA 2O5RA 1L2DA 3TL4X 4I81A 2Q2EB 3SAVA 2C99A 3CF6E 3JR4A 4LZZA 4W5WA 4X66M 3U6SA 5LMNM 4LJ4A 3HSHA 1SXJA 2UXCM 5FSWA 1W5TA 5EJCA 4QNLA 4B7GA 2QP9X 4OW0A 5ITUA 4DV0M 2ZAOA 3LQRA 1G8PA 1QQWA 3IG8A 4JI3M 2R4JA 3SAWA 2EA0A 3N3FA 2BJVA 4QNMA 4XBOA 4PCZA 1DO0A 2KRKA 2XSZD 1ZAEA 4LJ7A 2ZBKB 1W5SA 1FJGM 1TH3A 1YUBA 2CV2A 3KSJA 3IG5A 2VQFM 3KOZE 3HHZA 3PXGA 3W0LB 1N32M 3THGA 5JI3E 3HU2A 1I94M 3D8LA 5EXXA 1K82A 4X65M 3L28A 3B9PA 2OQ4A 4B7HA 4NXMM 3U6EA 2X8AA 2Y21A 2ZANA 4DR1M 3ZH9B 4NRVA 3J27B 1OJLA 2XD1A 3U6OA 2Y2HA 4GKKM 2DXIA 1KYIA 1TGUA 3W0FA 1FNNA 1XXHA 2C5RA 2K47A 3RFWA 8CATA 4I5SA 3T1YM 1KSFX 4LGMA 1OFIA 3TPZA 1NSFA 1GLNA 4HL4A 4RNAA 3VKHA 4G6ZA 1L8QA 1Z5AA 1K3XA 4JI6M 1R7RA 4L15A 4A3VB 2EUCA 4JI0M 2Y2LA 2Y2MA 3J81S 1H6UA 2HCBA 3HONA 4IBJA 3HHYA 4NZ5A 4AZFA 2X49A 1DGBA 2QENA 4XGIA 4OX9M 4NZ4A 4KLNA 3HJ8A 2XD5A 2XFSA 4P16A 1SXJB 1E9RA 1PJJA 1HQYE 2R45A 4DUZM 3U5ZB 4JI4M 4REZA 3AL0C 3DOAA 4MGIE 4NRWA 4LJ6A 3EIHA 1S3SA 1IM2A 2CUZA 3HHXA 3TWKA 1Z5BA 4YHHM 4MB7A 2F5OA 4AQYM 2VIIA 4M9ZA 1HNZM 1IQPA 3FD9A 2XZFA 4I4LA 5ITRA 4AKIA 3H4MA 4JXJA 4LJ5A 1L1ZA 4GKJM 4PDGA 3KOXE 4BB9A 3QAUA 1IBMM 2CHGA 2EO2A 5JI2E 5KPTA 4G4OA 2FE8A 3UJNA 2Y2PA 2R18A 4IJFA 3SASA 4DR7M 1T3TA 4WURA 4DR3M 1DO2A 4DV5M 4D81A 2D7HA 3GRUA 1KFVA 2DWLA 3ZCBB 3HGIA 4IBDA 1TH4A 5C1BA 4DR5M 5KPRA 4NY2A 3M0EA 4FCWA 3D8BA 3I4VA 4GMQA 1MX0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L26 A;  3KS8 A;  4GH9 A;  3L25 A;  3FKE A;  4IBK A;  5BPV A;  4IBE A;  4IJE A;  4IBF A;  4IBB A;  4IJF A;  4LG2 A;  3L29 A;  4IBC A;  3L28 A;  4GHA A;  4IBI A;  3KS4 A;  4GHL A;  4IBD A;  3L27 A;  4IBJ A;  3L2A A;  4IBG A; 
#chains in the Genus database with same CATH topology
 2L7H A;  2QQ8 A;  2C96 A;  3RE8 A;  3AKZ A;  3KS8 A;  4DV7 M;  4LF7 M;  1PDC A;  2F5N A;  4XK8 F;  1W1P A;  4NL4 H;  2XSZ A;  4Z2I A;  2GQF A;  4YY3 M;  2XF3 A;  3GO8 A;  4R3D A;  2BJW A;  3U6D A;  2MR9 A;  4DV1 M;  2I7P A;  2CV0 A;  1OQY A;  4KT0 F;  2Y2J A;  2M5Z A;  2ERC A;  1Z6T A;  1VDD A;  4RKU F;  4B7F A;  4JI8 M;  5FTM A;  3FTD A;  2KEB A;  2JNH A;  1A5T A;  3GRY A;  3U60 A;  3OTO M;  3C58 A;  2QNJ A;  4BBA A;  3MK6 A;  2H1R A;  3FTC A;  1IXZ A;  1XNQ M;  4G3O A;  1PJI A;  1NJG A;  1XNR M;  1W1V A;  2VDB B;  1DGG A;  2MRO B;  2FNA A;  2ZAM A;  1GVN A;  3GRR A;  2DHR A;  4QHS A;  3U5Z A;  1IBL M;  1WXQ A;  1E15 A;  3IEC A;  3GPX A;  5KQ8 A;  1R6B X;  1UM8 A;  2CEA A;  2NQ8 C;  2W82 A;  3HX3 A;  3LMM A;  4EIW A;  2BNK A;  2GNO A;  5C18 A;  4JN6 A;  1YLA A;  4GH9 A;  5BR8 M;  3T6P A;  3V76 A;  2JE5 A;  3LW5 F;  3WHL A;  1NV9 A;  3FTE A;  2Y2K A;  4L4U A;  2HAK A;  2VF7 A;  2DNA A;  4L78 A;  4M0D A;  2CFO A;  5DFL A;  3MHV C;  1R4G A;  3I51 A;  4JI1 M;  2LNH C;  2G3Q A;  1VQ1 A;  2DZL A;  5FTK A;  2D7E A;  1V34 A;  3DFZ A;  4OU7 A;  3UK6 A;  1XWI A;  4OVZ B;  2R62 A;  5EP4 A;  3GQ4 A;  4DV6 M;  4R7G A;  2F5S A;  1PJS A;  4IIW A;  2Y2O A;  4NZ1 A;  1DGH B;  3NWL A;  4FW9 A;  3SHG B;  3SC3 A;  1SXJ C;  3VDP A;  4RF1 A;  1QYR A;  2LH0 A;  3GLI E;  4KHP M;  4FCV A;  4IBG A;  1TDH A;  2XZU A;  1GXD A;  1OGB A;  4G4N A;  1YU3 A;  3FUT A;  3QYE A;  3WHK A;  4I8O A;  1ZMW A;  1QAQ A;  2RGH A;  3FE3 A;  4AG6 A;  1UR8 A;  1D2N A;  1NY6 A;  5ITX E;  2ZTC A;  3W67 A;  4LCB A;  1GPF A;  2FFF B;  4LFB M;  2FOI C;  5DYG A;  4DV2 M;  1OTR A;  1XC8 A;  3WX7 A;  4IBK A;  4ZPX A;  1UFZ A;  3LQQ A;  5EP3 A;  3HJS A;  3U61 A;  2WSE F;  3HU1 A;  4CJ6 A;  4NOO B;  4L16 A;  4B3M M;  1AUA A;  3A98 B;  1JR3 A;  1IN6 A;  3I04 M;  4IBC A;  4PT5 A;  1J5E M;  3KXE C;  3C3E A;  4IBI A;  2L6O A;  3KS4 A;  3T15 A;  4QOZ C;  3U6P A;  1IN5 A;  3PNY A;  5FTL A;  1F4I A;  2XFT A;  3BXW A;  4DV3 M;  4OUI A;  2OOA A;  3SAU A;  4LF9 M;  3WD2 A;  2CHQ A;  3TWL A;  3L26 A;  2L2D A;  1QAO A;  1DGF A;  4MGH A;  3WD0 A;  2RGO A;  3VK8 A;  1SXJ E;  2LWX A;  1QZM A;  2CE7 A;  3CTW B;  4CIS A;  3J80 S;  3U60 B;  2QSF X;  3FKE A;  2JA2 A;  2KNZ A;  4TUW A;  3DZD A;  1JR3 D;  2CHV A;  4S12 A;  3K2L A;  3LCV B;  1GL6 A;  1J09 A;  1ORY B;  2UUC M;  1YU2 A;  4D82 A;  3SYK A;  4NZ3 A;  1V33 A;  1HQC A;  1IXR C;  2C9O A;  1IY1 A;  4FD2 A;  2QPA A;  3AOG A;  2VQE M;  1Z59 A;  1N36 M;  2UU9 M;  3Q8X A;  5EP2 A;  2IOU A;  2YFQ A;  1EE8 A;  1GO5 A;  4RF0 A;  2RRU A;  4MM3 B;  2ZTD A;  4JI7 M;  3AFH A;  2J7O A;  3K1J A;  1HR0 M;  4LF4 M;  4OVZ A;  2LBC A;  4LFA M;  4AKG A;  3TWM A;  3SAT A;  1HNW M;  4GRI A;  3R8F A;  3VFD A;  2QCU A;  1DGH A;  3AOE A;  2KA6 B;  2UUA M;  1PRB A;  4OJ5 A;  4NYU A;  1X37 A;  4KO8 A;  3FUX A;  4F2L A;  2G8L A;  2B3T A;  3I4Y A;  1N33 M;  1N78 A;  3B7Q A;  1YU4 A;  1NJF A;  3LVW A;  1WR1 B;  4LRS A;  3B74 A;  4IJE A;  4NXN M;  1XMO M;  1G3I A;  3TE6 A;  2YR0 A;  2K0B X;  2KNA A;  3KP1 E;  5KPZ A;  3E4R A;  2Y0Q A;  1K3W A;  4JI5 M;  1XXH E;  4NYY A;  3RGP A;  5KQD A;  2FFJ A;  4AKH A;  2R44 A;  2QZ4 A;  1D0L A;  4KOD A;  1YE9 A;  2CWB A;  5E6J A;  3HKP A;  4LF5 M;  1XHB A;  2CV1 A;  2DVW B;  1IY0 A;  3FYD A;  4M9X A;  3MMP A;  3U61 B;  4LF8 M;  5EXP A;  4DUY M;  3JR5 A;  1W1T A;  3M6A A;  3HU3 A;  1BVS A;  3KVW A;  4MGZ E;  4HLQ A;  4L6V 6;  3RGS A;  4HMC A;  2X4A A;  2JY8 A;  4ITQ A;  2OOB A;  4WP2 A;  1QUS A;  3K8Z A;  2OO9 A;  2I7N A;  3GQ3 A;  5DNY A;  1Q3B A;  2WSF F;  5IT9 S;  1QUT A;  2K9D A;  2QBY B;  4FVM A;  5GKN A;  4JV5 M;  2EKF A;  4LY6 A;  2J5Y A;  1GAB A;  3UGJ A;  2D49 A;  2P5T A;  1G59 A;  3KSX A;  2UXB M;  3PNV A;  1R2Y A;  1HNX M;  1TH2 A;  2EKK A;  2WZJ A;  1GJT A;  2MGW A;  2DWN A;  4OJL A;  3E9S A;  4JI2 M;  3GLG A;  1E32 A;  3PVS A;  3H4J A;  3UMM A;  1XMQ M;  2F5P A;  4JYA M;  2QHO B;  2UWX A;  3U6C A;  3U6M A;  2HL7 A;  2XEP A;  1E6N A;  2R4E A;  1AIW A;  2KRU A;  4AI6 A;  2UXD M;  4TX8 A;  1E9S A;  1I4W A;  4II7 A;  3NBI A;  3A46 A;  2DAE A;  4WW0 A;  4GIP A;  2JUJ A;  1HT2 E;  1XB2 B;  3ZQJ A;  1O6I A;  4NSR A;  2DI0 A;  2V1U A;  2LTU A;  5BPV A;  4OJO A;  2DKL A;  2R46 A;  4Z6Y A;  3E21 A;  1H0G A;  2L7I A;  3J7B A;  2DZN B;  5IRE B;  4Z2H A;  1TTE A;  3L29 A;  3A45 A;  4G4R A;  1NVM A;  1R5L A;  5LMU M;  4NSO B;  3GPP A;  2HHH M;  2O01 F;  2ZM6 M;  5EXT A;  1SG9 A;  1OFH A;  2F5Q A;  3I01 M;  1OAI A;  1J7K A;  1VDL A;  1WGL A;  3L27 A;  2JZ0 A;  2Z4R A;  1QVR A;  1E6Z A;  1PJT A;  5ITQ A;  5F3W A;  2Z8Y M;  4FWD A;  2Y20 A;  4AG5 A;  1PGY A;  3SBJ A;  2KZU A;  2MH8 A;  5ITY A;  3SMS A;  3LCU A;  3FUW A;  1MN3 A;  1OAO C;  2KHH A;  1MU5 A;  4QOS A;  1JQJ C;  3GPY A;  1SXJ D;  2VF8 A;  4GC5 A;  4GIT A;  5FTN A;  1IN7 A;  4M9S A;  3GLH A;  4ANR A;  4MGK E;  3GP1 A;  3SAR A;  4LJ8 A;  1NY5 A;  3CF2 A;  4LRT A;  3A42 A;  3Q8G A;  4GHL A;  2D7G A;  2CP8 A;  3KOW E;  1EAK A;  4OJ6 A;  2KXE A;  1Q02 A;  2QBY A;  3MJ5 A;  3J2P B;  1T6O A;  2DWM A;  4G4Q A;  2E5L M;  3GLI B;  1G4A E;  3C9P A;  2KW0 A;  5L8R F;  2Y2G A;  4UN2 B;  3LVV A;  1V92 A;  3L25 A;  2K6B A;  1Z5C A;  1R2Z A;  4AW4 A;  3GPU A;  3U6Q A;  3ILK A;  3GLF A;  1MJG M;  2M60 A;  4CHT B;  2HKJ A;  3R9X B;  1IN4 A;  3B7N A;  3VK7 A;  4MB4 A;  1HT1 E;  4IBE A;  5IWA M;  2R65 A;  4M0W A;  1G41 A;  2JXN A;  4LZJ A;  4K0K M;  4Z2L A;  5KO3 A;  1OGG A;  3GLG B;  1NNJ A;  1VEG A;  2LVN C;  4FCT A;  2BWE A;  4D80 A;  2HWJ A;  3JAM S;  1VEJ A;  1N77 A;  4QHT A;  4PD2 A;  4GHA A;  2V6Z M;  1HJP A;  2C9C A;  3U6L A;  4QNR A;  1WJ7 A;  1LV7 A;  3KFU G;  3C3D A;  3VKG A;  1H8P A;  1YUE A;  4B3T M;  2C98 A;  4BLC A;  3HJQ A;  1D0K A;  2DWZ B;  2XGN A;  3BBZ A;  4FWH A;  3SHF A;  4DBG B;  3BOS A;  1QAN A;  1IBK M;  1E94 E;  4CGY B;  1WHC A;  2LVP C;  2A5Y B;  1GKI A;  2H5X A;  2JZ1 A;  3EIE A;  3FYC A;  2G5G X;  2V1C A;  3HHW A;  4MH0 E;  3VDU A;  1PM5 A;  3QYB A;  2UUB M;  2BG1 A;  2Y2Q A;  3CGW A;  4X62 M;  4Z2J A;  1IY2 A;  1OIP A;  5H37 D;  3SYL A;  3HWS A;  1LTM A;  4B3R M;  4IBF A;  1GJS A;  3SMP A;  2DAG A;  4MGY E;  2Z7J A;  4OJP A;  4B08 A;  4LGY A;  2L4F A;  4LJA A;  5DYI A;  1CUK A;  2DAM A;  4LFC M;  3TQS A;  3SFZ A;  3UZU A;  1OIZ A;  3FTF A;  3HY5 A;  2L09 A;  1C1K A;  2FN2 A;  3WD1 A;  5FLX S;  2O25 A;  2LVO C;  3AV0 A;  4LF6 M;  2Y0T A;  3KDS E;  3FUV A;  2F4V M;  2XLJ A;  2Z3X A;  2YNM D;  3F92 A;  3J7A S;  3B7Z A;  2V5O A;  1ED7 A;  5ITT A;  2Y2I A;  1YU0 A;  1NNU C;  5EQT A;  3M7G A;  5IZ7 D;  3GLH B;  4GC9 A;  1NHG C;  1VG5 A;  3ZC7 B;  4B3S M;  4DR4 M;  5E26 A;  4HME A;  3AJI B;  3VLF B;  3KP0 E;  3AOE C;  2YQZ A;  3GLI A;  2Z4S A;  1YSY A;  1TDZ A;  3PFI A;  1Q3C A;  4IBB A;  5A2Q S;  1IXS B;  1GL7 A;  2JWS A;  1QAM A;  4LG2 A;  3K92 A;  4L8R C;  1UR9 A;  3KOY E;  4X64 M;  3KW6 A;  2Y2N A;  5ITX A;  3DA1 A;  3GQ5 A;  2DZO B;  1IN8 A;  4PDI A;  5EXS A;  1XXH B;  2JY5 A;  2FH0 A;  3FRI A;  3QWL A;  5FTJ A;  4LJ9 A;  1QZE A;  1WGN A;  2AHM A;  2R6F A;  2XH9 A;  5EP1 A;  3GLF B;  4DV4 M;  1L1T A;  1L2C A;  1QO6 A;  1N34 M;  1YU1 A;  2J7N A;  3K9O A;  3L2A A;  4MB3 A;  3FUU A;  4FWG A;  2RKO A;  1J7M A;  1Q39 A;  2KNV A;  1E8B A;  4DR2 M;  1L2B A;  4Z8X A;  2DEN A;  3T1H M;  1N75 A;  2KZS A;  2LXE A;  1ZQ9 A;  2DHY A;  3CF0 A;  3GRV A;  1P3Q Q;  1ZMU A;  3T38 A;  7CAT A;  4DR6 M;  1NV8 A;  2JY6 B;  1NHW C;  2OPF A;  2O5R A;  1L2D A;  3TL4 X;  4I81 A;  2Q2E B;  3SAV A;  2LVQ D;  2C99 A;  1NO1 A;  3CF6 E;  3JR4 A;  4LZZ A;  2EJS A;  4W5W A;  4X66 M;  3U6S A;  5LMN M;  4LJ4 A;  3HSH A;  1QDT A;  1SXJ A;  2UXC M;  2L4E A;  5FSW A;  1W5T A;  2APL A;  5EJC A;  1KS0 A;  4QNL A;  2JP7 A;  4B7G A;  2QP9 X;  4OW0 A;  5ITU A;  4DV0 M;  2ZAO A;  3LQR A;  1CK7 A;  1G8P A;  1QQW A;  3IG8 A;  4JI3 M;  2R4J A;  3SAW A;  3MQL A;  2EA0 A;  3N3F A;  2BJV A;  4QNM A;  4XBO A;  2MJ5 B;  4PCZ A;  1DO0 A;  2KRK A;  2XSZ D;  1ZAE A;  4LJ7 A;  2ZBK B;  1QDR A;  1W5S A;  1FJG M;  1TH3 A;  1YUB A;  1ZV1 A;  2CV2 A;  2RTS A;  3KSJ A;  3B89 A;  4MB5 A;  3IG5 A;  1GOI A;  2VQF M;  3KOZ E;  4CIZ A;  3PXG A;  3W0L B;  3HHZ A;  1N32 M;  3M7P A;  3THG A;  5JI3 E;  4NC6 A;  3HU2 A;  1T43 A;  2DAK A;  1I94 M;  3D8L A;  5EXX A;  1K82 A;  4X65 M;  2N35 A;  3B9P A;  3L28 A;  4Y28 F;  4B7H A;  3W68 A;  2OQ4 A;  1JB0 F;  4NXM M;  3U6E A;  2X8A A;  4F1I A;  2Y21 A;  1G71 A;  4HEO A;  2ZAN A;  4DR1 M;  3ZH9 B;  4NRV A;  1TR8 A;  1IXS A;  3J27 B;  1OJL A;  2CRU A;  3U6O A;  2XD1 A;  2Y2H A;  4GKK M;  2DXI A;  1KYI A;  1TGU A;  3FRH A;  3W0F A;  1FNN A;  1XXH A;  1PJQ A;  2C5R A;  2BWB A;  2K47 A;  3E46 A;  4GEW A;  4I5S A;  3RFW A;  8CAT A;  3T1Y M;  1W1Y A;  1KSF X;  4LGM A;  1OFI A;  1EFU B;  3GLG E;  3TPZ A;  1NSF A;  1GLN A;  4HL4 A;  4RNA A;  3VKH A;  4G6Z A;  1L8Q A;  1Z5A A;  1K3X A;  4JI6 M;  1DV0 A;  1R7R A;  4L15 A;  4Z2K A;  3WD3 A;  4A3V B;  2EUC A;  4JI0 M;  2Y2L A;  1C7Y A;  1H0I A;  2JCH A;  3J81 S;  2Y2M A;  1D0M A;  1H6U A;  2HCB A;  2WSC F;  3K9P A;  1TF0 B;  1E88 A;  3HON A;  4IBJ A;  3HHY A;  4Q7J A;  4NZ5 A;  4AZF A;  2X49 A;  1DGB A;  2QEN A;  4XGI A;  4OX9 M;  4NZ4 A;  4KLN A;  3HJ8 A;  2XD5 A;  2JY7 A;  2XFS A;  1OKS A;  4P16 A;  1SXJ B;  1E9R A;  1PJJ A;  1L6J A;  1HQY E;  2R45 A;  1VEK A;  4DUZ M;  3U5Z B;  4JI4 M;  4REZ A;  3AL0 C;  3DOA A;  4MGI E;  1Y8G A;  4LJ6 A;  4NRW A;  1EIJ A;  1E6R A;  2LHG A;  3EIH A;  1S3S A;  1CXW A;  1IM2 A;  2CUZ A;  2KDL A;  3HHX A;  1WIV A;  2R0I A;  1Z5B A;  3TWK A;  4MB7 A;  4YHH M;  1AIP C;  2F5O A;  3WD4 A;  4AQY M;  2VII A;  4M9Z A;  1HNZ M;  1IQP A;  3FD9 A;  2XZF A;  2DAI A;  1E6P A;  4Z2G A;  4I4L A;  4R71 A;  5ITR A;  4AKI A;  3H4M A;  3GLH E;  3IHP A;  3NBX X;  4JXJ A;  1JR3 E;  4LJ5 A;  1L1Z A;  4GKJ M;  4PDG A;  3KOX E;  4BB9 A;  2LHC A;  3QAU A;  1IBM M;  2CHG A;  2EO2 A;  5JI2 E;  5KPT A;  4G4O A;  2FE8 A;  3UJN A;  2Y2P A;  2R18 A;  4IJF A;  3SAS A;  4DR7 M;  1T3T A;  4WUR A;  4DR3 M;  1DO2 A;  4DV5 M;  4D81 A;  4HMD A;  1RU3 A;  2D7H A;  3GRU A;  3GLF E;  1IFY A;  1KFV A;  2DWL A;  2LVA A;  1ZMV A;  3HGI A;  1TH4 A;  4IBD A;  3ZCB B;  5C1B A;  5KPR A;  3HZJ A;  3M0E A;  4FCW A;  4DR5 M;  4P17 A;  4NY2 A;  3D8B A;  3I4V A;  2FS1 A;  4GMQ A;  1MX0 A; 
#chains in the Genus database with same CATH homology
 2L7H A;  2C96 A;  3RE8 A;  3AKZ A;  3KS8 A;  4DV7 M;  4LF7 M;  2F5N A;  4NL4 H;  2XSZ A;  4YY3 M;  2XF3 A;  3GO8 A;  4R3D A;  2BJW A;  3U6D A;  4DV1 M;  2I7P A;  2CV0 A;  2Y2J A;  2M5Z A;  2ERC A;  1Z6T A;  1VDD A;  4B7F A;  4JI8 M;  5FTM A;  3FTD A;  2KEB A;  3U60 A;  3GRY A;  3OTO M;  3C58 A;  4BBA A;  3MK6 A;  2H1R A;  3FTC A;  1IXZ A;  1XNQ M;  1PJI A;  1NJG A;  1XNR M;  1YU4 A;  1DGG A;  2FNA A;  2ZAM A;  1GVN A;  3GRR A;  2DHR A;  4QHS A;  3U5Z A;  1IBL M;  1WXQ A;  3GPX A;  5KQ8 A;  1R6B X;  1UM8 A;  2CEA A;  2NQ8 C;  2W82 A;  3LMM A;  4EIW A;  5C18 A;  2BNK A;  4JN6 A;  4GH9 A;  5BR8 M;  2JE5 A;  3WHL A;  3FTE A;  2Y2K A;  4L4U A;  4L78 A;  4M0D A;  2CFO A;  3MHV C;  3I51 A;  4JI1 M;  2LNH C;  5FTK A;  2D7E A;  3DFZ A;  4OU7 A;  3UK6 A;  1XWI A;  4OVZ B;  2R62 A;  5EP4 A;  3GQ4 A;  4DV6 M;  4R7G A;  2F5S A;  2JCH A;  4IIW A;  2Y2O A;  4NZ1 A;  1DGH B;  3NWL A;  4FW9 A;  3SHG B;  3SC3 A;  1SXJ C;  3VDP A;  4RF1 A;  1QYR A;  2LH0 A;  4KHP M;  4FCV A;  4IBG A;  1TDH A;  2XZU A;  1YU3 A;  4G4N A;  3FUT A;  3WHK A;  4I8O A;  1QAQ A;  2RGH A;  4AG6 A;  1D2N A;  1NY6 A;  5ITX E;  4LCB A;  2FFF B;  4LFB M;  2FOI C;  5DYG A;  4DV2 M;  1XC8 A;  3WX7 A;  4IBK A;  4ZPX A;  3LQQ A;  5EP3 A;  3HJS A;  3U61 A;  3HU1 A;  4NOO B;  4L16 A;  4B3M M;  3A98 B;  1JR3 A;  1IN6 A;  4IBC A;  4PT5 A;  1J5E M;  3KXE C;  4IBI A;  2L6O A;  3KS4 A;  3T15 A;  4QOZ C;  3U6P A;  1IN5 A;  3PNY A;  5FTL A;  2XFT A;  4DV3 M;  4OUI A;  3SAU A;  4LF9 M;  2CHQ A;  3TWL A;  3L26 A;  1QAO A;  1DGF A;  4MGH A;  2RGO A;  3VK8 A;  1SXJ E;  2LWX A;  1QZM A;  2CE7 A;  3CTW B;  4CIS A;  3J80 S;  3U60 B;  3FKE A;  2JA2 A;  4TUW A;  3DZD A;  1JR3 D;  2CHV A;  4S12 A;  3K2L A;  1GL6 A;  1J09 A;  1ORY B;  2UUC M;  1YU2 A;  4D82 A;  3SYK A;  4NZ3 A;  1HQC A;  1IXR C;  2C9O A;  1IY1 A;  4FD2 A;  2QPA A;  3AOG A;  2VQE M;  1Z59 A;  1N36 M;  2UU9 M;  3Q8X A;  5EP2 A;  2IOU A;  2YFQ A;  1EE8 A;  4RF0 A;  4MM3 B;  4JI7 M;  3AFH A;  2J7O A;  3K1J A;  1HR0 M;  4LF4 M;  4OVZ A;  4LFA M;  4AKG A;  3TWM A;  3SAT A;  1HNW M;  4GRI A;  3R8F A;  3VFD A;  2QCU A;  1DGH A;  3AOE A;  2KA6 B;  2UUA M;  4OJ5 A;  4NYU A;  1X37 A;  4KO8 A;  3FUX A;  1N33 M;  2G8L A;  3I4Y A;  1N78 A;  1NJF A;  3LVW A;  4LRS A;  4IJE A;  4NXN M;  1XMO M;  1G3I A;  3TE6 A;  2YR0 A;  3KP1 E;  5KPZ A;  3E4R A;  2Y0Q A;  1K3W A;  4JI5 M;  4NYY A;  3RGP A;  5KQD A;  2FFJ A;  4AKH A;  2QZ4 A;  4KOD A;  5E6J A;  1YE9 A;  3HKP A;  4LF5 M;  1XHB A;  2CV1 A;  2DVW B;  1IY0 A;  3FYD A;  4M9X A;  3U61 B;  4LF8 M;  5EXP A;  4DUY M;  3JR5 A;  3M6A A;  3HU3 A;  3KVW A;  4MGZ E;  4HLQ A;  3RGS A;  2X4A A;  4ITQ A;  3K8Z A;  2I7N A;  3GQ3 A;  5DNY A;  1Q3B A;  5IT9 S;  2QBY B;  4FVM A;  5GKN A;  4JV5 M;  4LY6 A;  3UGJ A;  2P5T A;  1G59 A;  3KSX A;  2UXB M;  3PNV A;  1R2Y A;  1HNX M;  1TH2 A;  4OJL A;  2DWN A;  3E9S A;  4JI2 M;  3GLG A;  1E32 A;  3PVS A;  3UMM A;  1XMQ M;  2F5P A;  4JYA M;  2UWX A;  3U6C A;  3U6M A;  2HL7 A;  2XEP A;  2R4E A;  2KRU A;  4AI6 A;  2UXD M;  1E9S A;  1I4W A;  4II7 A;  3NBI A;  3A46 A;  4WW0 A;  4GIP A;  1HT2 E;  4NSR A;  2V1U A;  4OJO A;  5BPV A;  2R46 A;  4Z6Y A;  2L7I A;  3J7B A;  2DZN B;  5IRE B;  3L29 A;  3A45 A;  4G4R A;  1NVM A;  5LMU M;  4NSO B;  3GPP A;  2HHH M;  2ZM6 M;  5EXT A;  1OFH A;  2F5Q A;  1J7K A;  3L27 A;  2Z4R A;  1QVR A;  5ITQ A;  5F3W A;  4FWD A;  2Y20 A;  4AG5 A;  3SBJ A;  2KZU A;  3SMS A;  5ITY A;  3FUW A;  1MU5 A;  4QOS A;  1JQJ C;  3GPY A;  1SXJ D;  4GC5 A;  4GIT A;  5FTN A;  1IN7 A;  4M9S A;  3GLH A;  4MGK E;  3GP1 A;  3SAR A;  4LJ8 A;  1NY5 A;  3CF2 A;  4LRT A;  3A42 A;  4GHL A;  2D7G A;  3KOW E;  4OJ6 A;  2KXE A;  2QBY A;  3MJ5 A;  3J2P B;  2DWM A;  4G4Q A;  2E5L M;  3GLI B;  1G4A E;  2KW0 A;  2Y2G A;  3LVV A;  3L25 A;  1R2Z A;  1Z5C A;  4AW4 A;  3GPU A;  3U6Q A;  3ILK A;  3GLF A;  4CHT B;  2M60 A;  3R9X B;  2HKJ A;  1IN4 A;  3VK7 A;  1HT1 E;  4IBE A;  5IWA M;  2R65 A;  4M0W A;  1G41 A;  4LZJ A;  4K0K M;  5KO3 A;  3GLG B;  1NNJ A;  4FCT A;  4D80 A;  3JAM S;  1N77 A;  4GHA A;  4QHT A;  4PD2 A;  2V6Z M;  2C9C A;  3U6L A;  4QNR A;  3VKG A;  1LV7 A;  3KFU G;  1YUE A;  4B3T M;  2C98 A;  4BLC A;  3HJQ A;  2DWZ B;  2XGN A;  4FWH A;  3SHF A;  3BOS A;  1QAN A;  1IBK M;  1E94 E;  4CGY B;  2A5Y B;  1GKI A;  3FYC A;  3EIE A;  3HHW A;  4MH0 E;  2G5G X;  2V1C A;  3VDU A;  1PM5 A;  2BG1 A;  2UUB M;  2Y2Q A;  4X62 M;  1IY2 A;  5H37 D;  3SYL A;  3HWS A;  4B3R M;  4IBF A;  3SMP A;  4MGY E;  2Z7J A;  4OJP A;  4B08 A;  4LGY A;  4LJA A;  5DYI A;  4LFC M;  3TQS A;  3SFZ A;  3UZU A;  3FTF A;  2L09 A;  1C1K A;  5FLX S;  3AV0 A;  4LF6 M;  2Y0T A;  3KDS E;  3FUV A;  2F4V M;  2XLJ A;  2Z3X A;  2YNM D;  3J7A S;  5ITT A;  2Y2I A;  1YU0 A;  1NNU C;  5EQT A;  3M7G A;  5IZ7 D;  3GLH B;  4GC9 A;  1NHG C;  3ZC7 B;  4B3S M;  5E26 A;  3AJI B;  3VLF B;  3KP0 E;  3AOE C;  2YQZ A;  3GLI A;  2Z4S A;  1YSY A;  1TDZ A;  3PFI A;  1Q3C A;  4IBB A;  5A2Q S;  1IXS B;  1GL7 A;  1QAM A;  4LG2 A;  3K92 A;  4L8R C;  3KOY E;  4X64 M;  3KW6 A;  2Y2N A;  5ITX A;  3DA1 A;  3GQ5 A;  2DZO B;  1IN8 A;  4PDI A;  5EXS A;  1XXH B;  3QWL A;  5FTJ A;  4DR4 M;  4LJ9 A;  2XH9 A;  5EP1 A;  2AHM A;  4DV4 M;  3GLF B;  1L2C A;  1L1T A;  1YU1 A;  1N34 M;  2J7N A;  3L2A A;  3FUU A;  4FWG A;  2RKO A;  1Q39 A;  4DR2 M;  1L2B A;  4Z8X A;  3T1H M;  1N75 A;  2KZS A;  2LXE A;  1ZQ9 A;  3CF0 A;  3GRV A;  7CAT A;  4DR6 M;  3T38 A;  1NHW C;  2OPF A;  2O5R A;  1L2D A;  3TL4 X;  4I81 A;  2Q2E B;  3SAV A;  2C99 A;  3CF6 E;  3JR4 A;  4LZZ A;  4W5W A;  4X66 M;  3U6S A;  5LMN M;  4LJ4 A;  3HSH A;  1SXJ A;  2UXC M;  5FSW A;  1W5T A;  5EJC A;  4QNL A;  4B7G A;  2QP9 X;  4OW0 A;  5ITU A;  4DV0 M;  2ZAO A;  3LQR A;  1G8P A;  1QQW A;  3IG8 A;  4JI3 M;  2R4J A;  3SAW A;  2EA0 A;  3N3F A;  2BJV A;  4QNM A;  4XBO A;  4PCZ A;  1DO0 A;  2KRK A;  2XSZ D;  1ZAE A;  4LJ7 A;  2ZBK B;  1W5S A;  1FJG M;  1TH3 A;  1YUB A;  2CV2 A;  3KSJ A;  3IG5 A;  2VQF M;  3KOZ E;  3HHZ A;  3PXG A;  3W0L B;  1N32 M;  3THG A;  5JI3 E;  3HU2 A;  1I94 M;  3D8L A;  5EXX A;  1K82 A;  4X65 M;  3L28 A;  3B9P A;  2OQ4 A;  4B7H A;  4NXM M;  3U6E A;  2X8A A;  2Y21 A;  2ZAN A;  4DR1 M;  3ZH9 B;  4NRV A;  3J27 B;  1OJL A;  2XD1 A;  3U6O A;  2Y2H A;  4GKK M;  2DXI A;  1KYI A;  1TGU A;  3W0F A;  1FNN A;  1XXH A;  2C5R A;  2K47 A;  3RFW A;  8CAT A;  4I5S A;  3T1Y M;  1KSF X;  4LGM A;  1OFI A;  3TPZ A;  1NSF A;  1GLN A;  4HL4 A;  4RNA A;  3VKH A;  4G6Z A;  1L8Q A;  1Z5A A;  1K3X A;  4JI6 M;  1R7R A;  4L15 A;  4A3V B;  2EUC A;  4JI0 M;  2Y2L A;  2Y2M A;  3J81 S;  1H6U A;  2HCB A;  3HON A;  4IBJ A;  3HHY A;  4NZ5 A;  4AZF A;  2X49 A;  1DGB A;  2QEN A;  4XGI A;  4OX9 M;  4NZ4 A;  4KLN A;  3HJ8 A;  2XD5 A;  2XFS A;  4P16 A;  1SXJ B;  1E9R A;  1PJJ A;  1HQY E;  2R45 A;  4DUZ M;  3U5Z B;  4JI4 M;  4REZ A;  3AL0 C;  3DOA A;  4MGI E;  4NRW A;  4LJ6 A;  3EIH A;  1S3S A;  1IM2 A;  2CUZ A;  3HHX A;  3TWK A;  1Z5B A;  4YHH M;  4MB7 A;  2F5O A;  4AQY M;  2VII A;  4M9Z A;  1HNZ M;  1IQP A;  3FD9 A;  2XZF A;  4I4L A;  5ITR A;  4AKI A;  3H4M A;  4JXJ A;  4LJ5 A;  1L1Z A;  4GKJ M;  4PDG A;  3KOX E;  4BB9 A;  3QAU A;  1IBM M;  2CHG A;  2EO2 A;  5JI2 E;  5KPT A;  4G4O A;  2FE8 A;  3UJN A;  2Y2P A;  2R18 A;  4IJF A;  3SAS A;  4DR7 M;  1T3T A;  4WUR A;  4DR3 M;  1DO2 A;  4DV5 M;  4D81 A;  2D7H A;  3GRU A;  1KFV A;  2DWL A;  3ZCB B;  3HGI A;  4IBD A;  1TH4 A;  5C1B A;  4DR5 M;  5KPR A;  4NY2 A;  3M0E A;  4FCW A;  3D8B A;  3I4V A;  4GMQ A;  1MX0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...