4GH9A

Crystal structure of marburg virus vp35 rna binding domain
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
122
structure length
122
Chain Sequence
LSAKDLALLLFTHLPGNNTPFHILAQVLSKIAYKSGKSGAFLDAFHQILSEGENAQAALTRLSRTFDAFLGVVPPVIRVKNFQTVPRPCQKSLRAVPPNPTIDKGWVCVYSSEQGETRALKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polymerase cofactor VP35
publication title Marburg Virus VP35 Can Both Fully Coat the Backbone and Cap the Ends of dsRNA for Interferon Antagonism.
pubmed doi rcsb
source organism Marburg virus
molecule tags Viral protein,rna binding protein
total genus 42
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2012-08-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4gh9A01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4gh9A02
4IJEA 4GHAA 4LG2A 4GH9A 3L28A 3L2AA 4IBBA 4IBIA 3L26A 3FKEA 3L29A 4IJFA 4IBJA 3KS4A 4IBFA 3L25A 5BPVA 3L27A 3KS8A 4IBGA 4IBKA 4GHLA 4IBEA 4IBCA 4IBDA
chains in the Genus database with same CATH superfamily
3SARA 1IM2A 4CISA 4D82A 2ZANA 4JXJA 3AOGA 1K3XA 3UZUA 3K1JA 1G4AE 2YQZA 3T6PA 8CATA 3J7AS 5L8RF 4WURA 4Z2LA 4MGZE 2Y2PA 4NZ4A 4LF8M 3SYLA 3HU3A 3IHPA 2L4EA 1WJ7A 1LTMA 4IBJA 1GPFA 1WXQA 3FRHA 1G3IA 2FH0A 4OW0A 3J2PB 4MGYE 4XBOA 3VFDA 3GO8A 1YU0A 2DWNA 3SATA 4CHTB 2Z4RA 1OIPA 1TDZA 2R62A 4NZ1A 2X49A 3AV0A 1A5TA 2GQFA 1G59A 5EP3A 3B7ZA 4LRTA 1PGYA 1DO2A 5IT9S 4L8RC 2G5GX 4TUWA 1OTRA 1K82A 1SXJA 1IBMM 1W1YA 2WZJA 3VDUA 4QNRA 1BVSA 2CV2A 1R4GA 2JNHA 3K8ZA 1PJIA 1W5SA 2BWEA 2VQFM 4IBBA 3C3DA 2H1RA 3WD1A 5E26A 2FNAA 3U6DA 3WD2A 1ZMWA 2HCBA 2YFQA 1PRBA 1D0KA 1JR3E 1IN6A 1ZAEA 2DI0A 2JY5A 4G6ZA 2VQEM 2JUJA 2O25A 4DV0M 4DBGB 3KP1E 1Q39A 2MR9A 3UMMA 3GPUA 4AQYM 2OQ4A 1R2ZA 4BLCA 3L25A 4LY6A 3PVSA 4G3OA 4Y28F 2EO2A 4DV4M 3KS8A 2DAMA 2UUAM 5DYGA 2FOIC 3SAVA 1R2YA 3FTFA 1TR8A 4MGKE 4JN6A 4AKGA 3GRUA 1N33M 2DWZB 2KNZA 3KSXA 4MGHA 2Y0QA 1XMOM 1V92A 2CP8A 2CRUA 4DUYM 2FN2A 2Y20A 1NNJA 3CF2A 4DV6M 1OGBA 1HJPA 3T1HM 3LCVB 2M60A 4IBIA 4PT5A 4R71A 2DHYA 4GKKM 1HT1E 1QUTA 3DA1A 4KODA 5EXPA 2FE8A 4FWDA 1L1ZA 2RGOA 1IFYA 4XGIA 3R9XB 4M9ZA 2HWJA 1Z59A 3D8LA 3WHLA 4S12A 4IJFA 3IG5A 4JYAM 2KW0A 3PFIA 2Z4SA 2ZTCA 2APLA 4RKUF 2K6BA 1JR3A 3FE3A 1Z5BA 3AJIB 4IBGA 2FS1A 1W1VA 1TH3A 3FUTA 4GRIA 4P17A 3FUUA 1HT2E 5C1BA 1N77A 2UXCM 1OIZA 1XC8A 2R6FA 4LFAM 3GQ3A 4AG5A 4G4OA 1YSYA 3IG8A 1HNWM 2OOAA 2E5LM 2QNJA 2BG1A 4XK8F 2CFOA 3B7NA 4P16A 1HNZM 5ITUA 2UXDM 2KRUA 1XMQM 1ZMVA 2G3QA 2R0IA 1XNRM 2LHCA 4QHSA 2VIIA 1H8PA 1DV0A 1VG5A 3HY5A 3TL4X 3BBZA 4X62M 1C1KA 4OJLA 4JI1M 2BJWA 1HQYE 2RRUA 5KO3A 2F5NA 1GJSA 4NYYA 2DWLA 4HLQA 4LF6M 1T43A 4IBFA 4OX9M 2XD1A 2KXEA 1AIWA 2F5SA 5IZ7D 5KPRA 1ZQ9A 2DZLA 3FUWA 4B08A 1NO1A 3SAUA 3CGWA 3C3EA 3K2LA 3GPXA 3T1YM 2JY6B 3K9OA 1DO0A 4PDGA 4FCWA 4WP2A 3W68A 2HHHM 2RGHA 2JE5A 3M7GA 4NZ5A 2WSEF 4OJ5A 1E9SA 3KDSE 1E6ZA 4QNLA 1H0IA 1QQWA 2L4FA 2Z7JA 2XZFA 4CJ6A 4AKIA 3KOXE 1IXSB 2JA2A 1T3TA 3CTWB 3KXEC 2A5YB 2VDBB 2ZBKB 3THGA 2R18A 1EFUB 1GVNA 2ZM6M 1TTEA 2KZSA 2KDLA 2JY8A 3R8FA 2QENA 2QP9X 4AW4A 1FJGM 2HL7A 3E46A 1IY1A 4BBAA 3FTDA 2L7HA 4JV5M 3BOSA 1R7RA 1G41A 5ITTA 3HSHA 3HZJA 4M9XA 5DYIA 2RTSA 1YU1A 4NXNM 4MH0E 2VF8A 2XSZA 3L28A 4JI2M 1TF0B 4GC5A 4B7FA 3U6MA 3SASA 1R6BX 3AL0C 1GXDA 1DGFA 3Q8GA 4OVZB 4HMDA 4L6V6 1OFIA 4FW9A 1DGHB 4HEOA 5FTNA 2X4AA 2DWMA 4Z2JA 1YUEA 4CIZA 1G8PA 1NHWC 4OJPA 4LJAA 3ILKA 1Z5CA 1PM5A 1VQ1A 1E9RA 4GITA 4G4NA 1IBLM 2R65A 1NJGA 3E9SA 4LCBA 1I94M 4OU7A 4LJ4A 4NY2A 3U6EA 3U60A 4LF4M 1OQYA 3HKPA 2C96A 1R5LA 3NBIA 4IBKA 4MGIE 1NSFA 3QWLA 2QPAA 4JI0M 4LZZA 4JI8M 4REZA 2L6OA 4KO8A 4DR4M 1J7MA 1MU5A 3E4RA 2R45A 5ITYA 1PDCA 2V6ZM 3HHWA 3J27B 4L16A 1NY5A 3HJ8A 1XWIA 1UM8A 3ZH9B 1UR9A 1I4WA 4L15A 2OOBA 2BWBA 2R4EA 3KVWA 4JI6M 3GLIB 3GLIE 2QHOB 3L26A 2D7HA 3JAMS 2OO9A 3A45A 3FKEA 3W0FA 4I5SA 1YU4A 2KNVA 2LXEA 2JXNA 2EUCA 5KQ8A 3HJSA 5EXSA 3SHFA 2XD5A 2K0BX 3SYKA 3KSJA 4JI7M 2I7NA 2WSCF 1D2NA 1NNUC 3NWLA 2UUBM 1F4IA 3QYEA 1E6PA 2AHMA 2N35A 3DFZA 4LJ5A 1NV8A 4TX8A 1E94E 5KPTA 1ORYB 4IIWA 3FTEA 4PDIA 5JI2E 2XEPA 3HX3A 1MJGM 2EA0A 3U60B 3GRYA 4BB9A 4DR3M 1XB2B 1IN5A 4RF0A 1TDHA 2HKJA 2MGWA 1YLAA 1E6NA 2DVWB 2Y2HA 1Z6TA 2L2DA 2CV1A 3LQQA 4HL4A 3L29A 4R7GA 3GLHE 3GLHB 2DAGA 4CGYB 2DKLA 1GL7A 4RNAA 1Q3BA 4B3TM 3KS4A 4YY3M 5DFLA 4M0WA 2KA6B 4RF1A 2Y2KA 4OJOA 2J7OA 5BPVA 1IY0A 3U6SA 3SC3A 4KT0F 5KPZA 2CEAA 2OPFA 2L09A 2MJ5B 2XGNA 3DZDA 4DR5M 1KS0A 1XXHB 1XXHE 2R46A 3A46A 4DV3M 2FFJA 3VKHA 3EIEA 3B74A 4GMQA 1VEJA 4ANRA 5EXXA 5ITRA 3GQ4A 1E6RA 4OJ6A 1QANA 4Z2KA 1N32M 1E32A 2QQ8A 1OAIA 1V33A 4FCTA 1V34A 2JP7A 2P5TA 4MB7A 1H0GA 1S3SA 1GL6A 2F5OA 3ZC7B 3RGSA 4FVMA 2ZTDA 3TWKA 1IBKM 4QOSA 5EP2A 2IOUA 3MMPA 3U6PA 2Y2NA 3M7PA 3A98B 1VEKA 3LQRA 4NC6A 3V76A 1IY2A 1QZMA 3MHVC 1W1TA 3B9PA 1TH2A 1CXWA 2LVQD 1L2CA 3GP1A 4LRSA 5IREB 4G4RA 1QO6A 3TPZA 3IECA 4DR7M 4IBEA 2Z3XA 4LGYA 4FWHA 1IXZA 2H5XA 2DXIA 4AKHA 4GC9A 1PJSA 4GHAA 4MB3A 5F3WA 3HHZA 2UUCM 1PJJA 5FTMA 1D0LA 3AOEC 4UN2B 3U61B 4X64M 3GLFB 5EP1A 1OJLA 4X65M 4LJ9A 3CF6E 3FD9A 3NBXX 3N3FA 3QYBA 1CUKA 3TE6A 3U6OA 2Y2MA 2O5RA 3JR4A 4AI6A 2YR0A 3RGPA 3U6LA 2CHVA 2QBYB 3TWLA 1ZMUA 3D8BA 2Q2EB 2QZ4A 2KHHA 3FYCA 3RFWA 4DR2M 2CV0A 4LJ6A 5BR8M 4DUZM 4A3VB 2LHGA 2MROB 2O01F 3RE8A 4AZFA 1QUSA 1DGBA 4QOZC 4Q7JA 4GIPA 1W5TA 4JI3M 5LMUM 2YNMD 1N78A 4LF7M 4LF9M 2CHGA 2B3TA 2XZUA 1PJQA 4W5WA 4NSRA 2F5QA 2LH0A 2CUZA 3FUVA 1E8BA 2J5YA 2W82A 3DOAA 1HR0M 3L2AA 2JWSA 3SAWA 4DV2M 2LBCA 2K9DA 3GLGE 2D7EA 3GLGB 3GQ5A 4LZJA 1H6UA 3J80S 2QBYA 1QZEA 2ZAMA 2XFTA 2DENA 3U61A 1X37A 2Y2OA 3B7QA 1SXJD 3KOYE 3MQLA 1QYRA 2DAEA 1GLNA 2DHRA 1Q3CA 2ERCA 3H4JA 2KZUA 3KOZE 2F5PA 2UU9M 4K0KM 1EAKA 5LMNM 1YUBA 1SXJC 1IXSA 1FNNA 1SXJE 1SXJB 2EJSA 1WGNA 1JQJC 2NQ8C 3KOWE 1KSFX 1QAQA 1MN3A 4NRVA 4Z2GA 1WGLA 4Z2IA 3HONA 4LFBM 2CHQA 5EJCA 1OAOC 1QDRA 4EIWA 2C99A 3B89A 1GO5A 3KFUG 2D49A 3EIHA 4WW0A 4DR1M 3HU2A 3FTCA 3K92A 1WHCA 2QSFX 2LWXA 4GH9A 2JZ1A 4I8OA 3WHKA 4FD2A 3VK8A 1LV7A 4DV1M 2BJVA 2F4VM 2WSFF 1EIJA 2EKFA 1QDTA 1EE8A 2LVOC 1NVMA 2X8AA 1L8QA 3LCUA 4MM3B 2FFFB 2DNAA 2LNHC 3I51A 1QAMA 4QHTA 1L2BA 1L1TA 3GLGA 4OVZA 5FLXS 4LGMA 1DGHA 2LVNC 3W67A 4B3MM 1YE9A 4AG6A 1VEGA 3SHGB 4LJ8A 2JZ0A 5C18A 1JB0F 2QCUA 4NZ3A 4DV5M 3PNYA 4G4QA 3F92A 4D81A 4GHLA 4PD2A 4B7GA 3M0EA 4KLNA 3HGIA 3K9PA 3KW6A 1KFVA 3J81S 3VLFB 4NXMM 3WX7A 2Y0TA 3PNVA 3GRVA 1SG9A 1OFHA 3CF0A 4L78A 3VK7A 3HWSA 4I81A 4KHPM 3HHYA 1JR3D 1CK7A 1E15A 1DGGA 3UJNA 4MB5A 3U5ZB 4LF5M 1UFZA 4GEWA 5ITXE 1N36M 1NV9A 2Y2IA 5IWAM 2L7IA 3HJQA 4MB4A 2C9OA 2LVAA 4I4LA 1QVRA 2ZAOA 3BXWA 3E21A 3H4MA 3LVVA 5ITQA 1W1PA 2RKOA 1ZV1A 3GLIA 1Q02A 4OUIA 4DV7M 3GPYA 1AIPC 1NHGC 1NY6A 3C58A 1T6OA 3LVWA 5FTJA 1IN8A 1GOIA 5FSWA 4X66M 5DNYA 2DAKA 2KEBA 2Y2QA 3U6CA 2EKKA 3I01M 1VDLA 4IJEA 3FRIA 1GKIA 4Z2HA 1WR1B 3GPPA 1C7YA 2G8LA 2XFSA 2Y2GA 4HMEA 4NYUA 4B3SM 1IN4A 3WD3A 1K3WA 3SMPA 2MH8A 1OGGA 1HNXM 2GNOA 2JCHA 4F1IA 3WD0A 1RU3A 3U5ZA 3GLFA 4F2LA 2VF7A 5ITXA 3FYDA 3UGJA 1O6IA 2I7PA 2KNAA 3I4VA 4ZPXA 2UXBM 2JY7A 5FTKA 1PJTA 4JI4M 3JR5A 4JI5M 2R44A 3GLHA 1IQPA 4NL4H 2BNKA 3W0LB 1UR8A 4PCZA 4NRWA 2D7GA 5GKNA 5A2QS 4II7A 1WIVA 4IBCA 1XNQM 1GABA 3HU1A 1NJFA 3T15A 4B3RM 3AFHA 1XXHA 3LMMA 2CWBA 3GLFE 3FUXA 2V1UA 1YU3A 2R4JA 3MK6A 4QNMA 5EXTA 3VDPA 4M0DA 3OTOM 4L4UA 4LFCM 3SFZA 4ITQA 2M5ZA 1MX0A 1J7KA 1HQCA 3HHXA 2Y2LA 3LW5F 5H37D 3TWMA 3VKGA 4B7HA 2XSZD 1Y8GA 2Z8YM 3ZCBB 3M6AA 1ED7A 3I4YA 3UK6A 1VDDA 4LJ7A 1IXRC 2XLJA 2V5OA 3KP0E 1D0MA 1AUAA 1J09A 3C9PA 3A42A 4Z8XA 1L2DA 2DZNB 2C9CA 3GRRA 3SBJA 1N75A 4IBDA 1OKSA 4D80A 3PXGA 2XF3A 1TH4A 3TQSA 2C98A 4LG2A 4DR6M 1YU2A 2LVPC 2V1CA 3QAUA 1TGUA 3U6QA 2J7NA 2UWXA 4M9SA 3Q8XA 1KYIA 4GKJM 1L6JA 2KRKA 1IN7A 2CE7A 2LTUA 1XHBA 3AOEA 3MJ5A 2Y21A 4R3DA 5E6JA 3T38A 5EP4A 4Z6YA 5JI3E 2XH9A 4FWGA 2DAIA 4NSOB 1N34M 1G71A 4NOOB 3J7BA 2K47A 1GJTA 3AKZA 5KQDA 3ZQJA 2C5RA 3SMSA 1E88A 3L27A 4FCVA 1J5EM 2DZOB 1QAOA 4HMCA 5FTLA 4YHHM 5EQTA 3I04M 2Y2JA 3WD4A 1P3QQ 7CATA 2HAKA 1Z5AA
chains in the Genus database with same CATH topology
3SARA 1IM2A 4CISA 4D82A 2ZANA 4JXJA 3AOGA 1K3XA 3UZUA 3K1JA 1G4AE 2YQZA 8CATA 3J7AS 4WURA 4MGZE 2Y2PA 4NZ4A 4LF8M 3SYLA 3HU3A 4IBJA 1WXQA 4OW0A 1G3IA 4XBOA 3VFDA 3J2PB 4MGYE 1YU0A 3GO8A 2DWNA 3SATA 4CHTB 2Z4RA 1TDZA 2R62A 4NZ1A 2X49A 3AV0A 1G59A 5EP3A 4LRTA 5IT9S 1DO2A 4L8RC 2G5GX 4TUWA 1K82A 1IBMM 1SXJA 3VDUA 4QNRA 2CV2A 3K8ZA 1PJIA 1W5SA 2VQFM 4IBBA 2H1RA 5E26A 2FNAA 3U6DA 2HCBA 2YFQA 1IN6A 1ZAEA 4G6ZA 2VQEM 4DV0M 3UMMA 3KP1E 1Q39A 3GPUA 4AQYM 3L25A 2OQ4A 4BLCA 4LY6A 3PVSA 3KS8A 2EO2A 4DV4M 2UUAM 5DYGA 2FOIC 3SAVA 1R2YA 3FTFA 4AKGA 4MGKE 4JN6A 3GRUA 1N33M 2DWZB 3KSXA 4MGHA 2Y0QA 1XMOM 4DUYM 2Y20A 1NNJA 3CF2A 4DV6M 3T1HM 2M60A 4IBIA 4PT5A 4GKKM 1HT1E 3DA1A 5EXPA 4KODA 2FE8A 4FWDA 1L1ZA 2RGOA 4XGIA 3R9XB 4M9ZA 3D8LA 1Z59A 3WHLA 4S12A 4IJFA 3IG5A 4JYAM 2KW0A 3PFIA 2Z4SA 1JR3A 1Z5BA 3AJIB 4IBGA 1TH3A 3FUTA 4GRIA 2UXCM 3FUUA 1HT2E 5C1BA 1N77A 2UWXA 1XC8A 3GQ3A 4LFAM 4AG5A 4G4OA 1YSYA 3IG8A 1HNWM 2BG1A 2E5LM 2CFOA 4P16A 1HNZM 2UXDM 5ITUA 2KRUA 1XMQM 1XNRM 4QHSA 2VIIA 3TL4X 4X62M 1C1KA 4OJLA 4JI1M 2BJWA 1HQYE 2F5NA 5KO3A 4NYYA 2DWLA 4HLQA 4LF6M 4OX9M 4IBFA 2XD1A 2KXEA 2F5SA 5IZ7D 5KPRA 1ZQ9A 3FUWA 4B08A 3SAUA 3K2LA 3GPXA 3T1YM 1DO0A 4PDGA 4FCWA 2HHHM 2RGHA 2JE5A 3M7GA 4NZ5A 4OJ5A 1E9SA 3KDSE 4QNLA 1QQWA 2Z7JA 2XZFA 4AKIA 3KOXE 1IXSB 2JA2A 1T3TA 3CTWB 3KXEC 2A5YB 2ZBKB 3THGA 2R18A 1GVNA 2ZM6M 2KZSA 3R8FA 2QENA 2QP9X 4AW4A 1FJGM 2HL7A 1IY1A 4BBAA 3FTDA 2L7HA 4JV5M 3BOSA 1R7RA 1G41A 5ITTA 3HSHA 4M9XA 5DYIA 1YU1A 4NXNM 4MH0E 2XSZA 3L28A 4JI2M 4GC5A 4B7FA 3U6MA 3SASA 1R6BX 1DGFA 4OVZB 1OFIA 4FW9A 1DGHB 5FTNA 2X4AA 2DWMA 1YUEA 1G8PA 1NHWC 4OJPA 4LJAA 3ILKA 1Z5CA 1PM5A 1E9RA 4GITA 4G4NA 1IBLM 2R65A 1NJGA 3E9SA 4LCBA 1I94M 4OU7A 4LJ4A 4NY2A 3U6EA 3U60A 4LF4M 3HKPA 2C96A 3NBIA 4IBKA 4MGIE 4JI0M 1NSFA 3QWLA 2QPAA 4LZZA 4JI8M 4REZA 2L6OA 4KO8A 4DR4M 1MU5A 3E4RA 2R45A 5ITYA 2V6ZM 3HHWA 3J27B 4L16A 1NY5A 3HJ8A 1XWIA 1UM8A 3ZH9B 1I4WA 4L15A 2R4EA 3KVWA 4JI6M 3GLIB 3L26A 2D7HA 3JAMS 3A45A 3FKEA 3W0FA 4I5SA 1YU4A 2LXEA 2EUCA 5KQ8A 3HJSA 5EXSA 3SHFA 2XD5A 3SYKA 3KSJA 4JI7M 2I7NA 3NWLA 1D2NA 1NNUC 2UUBM 2AHMA 3DFZA 4LJ5A 1E94E 5KPTA 1ORYB 4IIWA 3FTEA 4PDIA 5JI2E 2XEPA 2EA0A 3GRYA 4BB9A 4DR3M 1IN5A 4RF0A 1TDHA 2HKJA 2Y2HA 2DVWB 1Z6TA 2CV1A 3LQQA 4HL4A 3L29A 4R7GA 3GLHB 1R2ZA 4CGYB 4B3TM 3AL0C 1GL7A 4RNAA 1Q3BA 3KS4A 4YY3M 4M0WA 2KA6B 4RF1A 2Y2KA 4OJOA 2J7OA 5BPVA 1IY0A 3U6SA 3SC3A 5KPZA 2CEAA 2OPFA 2L09A 2XGNA 3DZDA 4DR5M 1XXHB 2R46A 3A46A 4DV3M 2FFJA 3VKHA 3EIEA 4GMQA 5EXXA 5ITRA 3GQ4A 4OJ6A 1QANA 1N32M 1E32A 4FCTA 2P5TA 4MB7A 1S3SA 1GL6A 2F5OA 3ZC7B 3RGSA 4FVMA 3TWKA 1IBKM 4QOSA 5EP2A 2IOUA 3U6PA 2Y2NA 3A98B 3LQRA 1IY2A 1QZMA 3MHVC 3B9PA 1TH2A 1L2CA 3GP1A 4LRSA 5IREB 4G4RA 3TPZA 4DR7M 4IBEA 2Z3XA 4LGYA 4FWHA 1IXZA 2DXIA 4AKHA 4GC9A 4GHAA 5F3WA 3HHZA 2UUCM 1PJJA 5FTMA 3AOEC 3U61B 4X64M 3GLFB 5EP1A 1OJLA 4X65M 4LJ9A 3CF6E 3FD9A 3N3FA 3TE6A 3U6OA 2Y2MA 2O5RA 3JR4A 4AI6A 2YR0A 3RGPA 3U6LA 2CHVA 2QBYB 3TWLA 3D8BA 2Q2EB 2QZ4A 3RFWA 3FYCA 4DR2M 2CV0A 4LJ6A 5BR8M 4DUZM 4A3VB 3RE8A 4AZFA 1DGBA 4QOZC 4GIPA 1W5TA 4JI3M 5LMUM 2YNMD 1N78A 4LF7M 4LF9M 2CHGA 2XZUA 4W5WA 4NSRA 2F5QA 2LH0A 2CUZA 3FUVA 2W82A 3DOAA 1HR0M 3L2AA 3SAWA 4DV2M 3GLGB 2D7EA 3GQ5A 4LZJA 1H6UA 3J80S 2ZAMA 2XFTA 3U61A 1X37A 2Y2OA 1SXJD 3KOYE 1QYRA 2DHRA 1GLNA 3KOZE 1Q3CA 2ERCA 2F5PA 2KZUA 2UU9M 4K0KM 5LMNM 1YUBA 1SXJC 3KOWE 1FNNA 1SXJE 1SXJB 2QBYA 2NQ8C 1JQJC 2Y2QA 4NRVA 1KSFX 1QAQA 3HONA 4LFBM 2CHQA 5EJCA 4EIWA 2C99A 3KFUG 3EIHA 4WW0A 4DR1M 3HU2A 3FTCA 3K92A 2LWXA 4GH9A 4I8OA 3WHKA 3VK8A 4FD2A 1LV7A 4DV1M 2BJVA 2F4VM 2X8AA 1EE8A 1NVMA 1L8QA 4MM3B 2FFFB 2LNHC 3I51A 1QAMA 4QHTA 1L2BA 1L1TA 3GLGA 4OVZA 5FLXS 4LGMA 1DGHA 4B3MM 1YE9A 4AG6A 4LJ8A 5C18A 2QCUA 4NZ3A 4DV5M 3PNYA 4G4QA 4D81A 4GHLA 4PD2A 4B7GA 3M0EA 4KLNA 3HGIA 4NXMM 3KW6A 1KFVA 3J81S 3VLFB 3WX7A 2Y0TA 3PNVA 3GRVA 4L78A 1OFHA 3CF0A 3VK7A 3HWSA 4I81A 4KHPM 3HHYA 1JR3D 1DGGA 3UJNA 3U5ZB 4LF5M 5ITXE 1N36M 2Y2IA 5IWAM 2L7IA 3HJQA 2C9OA 4I4LA 1QVRA 2ZAOA 3H4MA 3LVVA 5ITQA 2RKOA 3GLIA 4OUIA 4DV7M 3GPYA 1NHGC 1NY6A 3C58A 3LVWA 5FTJA 1IN8A 5FSWA 4X66M 5DNYA 2KEBA 3U6CA 4IJEA 1GKIA 3GPPA 2Y2GA 2G8LA 2XFSA 4NYUA 4B3SM 1IN4A 1K3WA 3SMPA 1HNXM 2JCHA 3U5ZA 3GLFA 5ITXA 3FYDA 3UGJA 2I7PA 3I4VA 4ZPXA 2UXBM 5FTKA 4JI4M 3JR5A 4JI5M 3GLHA 1IQPA 4NL4H 2BNKA 3W0LB 4PCZA 4NRWA 2D7GA 5GKNA 5A2QS 4II7A 1XNQM 4IBCA 3HU1A 1NJFA 3T15A 4B3RM 3AFHA 1XXHA 3LMMA 3FUXA 2V1UA 1YU3A 2R4JA 3MK6A 4QNMA 5EXTA 3VDPA 4M0DA 3OTOM 4L4UA 4LFCM 3SFZA 4ITQA 2M5ZA 1MX0A 1J7KA 1HQCA 3HHXA 2Y2LA 5H37D 3TWMA 3VKGA 4B7HA 2XSZD 3ZCBB 3M6AA 3I4YA 3UK6A 1VDDA 4LJ7A 1IXRC 2XLJA 3KP0E 1J09A 3A42A 4Z8XA 1L2DA 2DZNB 2C9CA 3GRRA 3SBJA 1N75A 4IBDA 4D80A 3PXGA 2XF3A 1TH4A 3TQSA 2C98A 4LG2A 4DR6M 1YU2A 2V1CA 3QAUA 1TGUA 3U6QA 2J7NA 4M9SA 3Q8XA 1KYIA 4GKJM 2KRKA 1IN7A 2CE7A 3AOEA 1XHBA 3MJ5A 5E6JA 2Y21A 4R3DA 3SHGB 3T38A 5EP4A 4Z6YA 5JI3E 2XH9A 4FWGA 4NSOB 3U60B 1N34M 4NOOB 3J7BA 2K47A 3AKZA 5KQDA 2C5RA 3SMSA 3L27A 4FCVA 1J5EM 2DZOB 1QAOA 5FTLA 4YHHM 5EQTA 2Y2JA 7CATA 1Z5AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IJE A;  4GHA A;  4LG2 A;  4GH9 A;  3L28 A;  3L2A A;  4IBB A;  4IBI A;  3L26 A;  3FKE A;  3L29 A;  4IJF A;  4IBJ A;  3KS4 A;  4IBF A;  3L25 A;  5BPV A;  3L27 A;  3KS8 A;  4IBG A;  4IBK A;  4GHL A;  4IBE A;  4IBC A;  4IBD A; 
#chains in the Genus database with same CATH topology
 3SAR A;  1IM2 A;  4CIS A;  4D82 A;  2ZAN A;  4JXJ A;  3AOG A;  1K3X A;  3UZU A;  3K1J A;  1G4A E;  2YQZ A;  3T6P A;  8CAT A;  3J7A S;  5L8R F;  4WUR A;  4Z2L A;  4MGZ E;  2Y2P A;  4NZ4 A;  4LF8 M;  3SYL A;  3HU3 A;  3IHP A;  2L4E A;  1WJ7 A;  1LTM A;  4IBJ A;  1GPF A;  1WXQ A;  3FRH A;  1G3I A;  2FH0 A;  4OW0 A;  3J2P B;  4MGY E;  4XBO A;  3VFD A;  3GO8 A;  1YU0 A;  2DWN A;  3SAT A;  4CHT B;  2Z4R A;  1OIP A;  1TDZ A;  2R62 A;  4NZ1 A;  2X49 A;  3AV0 A;  1A5T A;  2GQF A;  1G59 A;  5EP3 A;  3B7Z A;  4LRT A;  1PGY A;  1DO2 A;  5IT9 S;  4L8R C;  2G5G X;  4TUW A;  1OTR A;  1K82 A;  1SXJ A;  1IBM M;  1W1Y A;  2WZJ A;  3VDU A;  4QNR A;  1BVS A;  2CV2 A;  1R4G A;  2JNH A;  3K8Z A;  1PJI A;  1W5S A;  2BWE A;  2VQF M;  4IBB A;  3C3D A;  2H1R A;  3WD1 A;  5E26 A;  2FNA A;  3U6D A;  3WD2 A;  1ZMW A;  2HCB A;  2YFQ A;  1PRB A;  1D0K A;  1JR3 E;  1IN6 A;  1ZAE A;  2DI0 A;  2JY5 A;  4G6Z A;  2VQE M;  2JUJ A;  2O25 A;  4DV0 M;  4DBG B;  3KP1 E;  1Q39 A;  2MR9 A;  3UMM A;  3GPU A;  4AQY M;  2OQ4 A;  1R2Z A;  4BLC A;  3L25 A;  4LY6 A;  3PVS A;  4G3O A;  4Y28 F;  2EO2 A;  4DV4 M;  3KS8 A;  2DAM A;  2UUA M;  5DYG A;  2FOI C;  3SAV A;  1R2Y A;  3FTF A;  1TR8 A;  4MGK E;  4JN6 A;  4AKG A;  3GRU A;  1N33 M;  2DWZ B;  2KNZ A;  3KSX A;  4MGH A;  2Y0Q A;  1XMO M;  1V92 A;  2CP8 A;  2CRU A;  4DUY M;  2FN2 A;  2Y20 A;  1NNJ A;  3CF2 A;  4DV6 M;  1OGB A;  1HJP A;  3T1H M;  3LCV B;  2M60 A;  4IBI A;  4PT5 A;  4R71 A;  2DHY A;  4GKK M;  1HT1 E;  1QUT A;  3DA1 A;  4KOD A;  5EXP A;  2FE8 A;  4FWD A;  1L1Z A;  2RGO A;  1IFY A;  4XGI A;  3R9X B;  4M9Z A;  2HWJ A;  1Z59 A;  3D8L A;  3WHL A;  4S12 A;  4IJF A;  3IG5 A;  4JYA M;  2KW0 A;  3PFI A;  2Z4S A;  2ZTC A;  2APL A;  4RKU F;  2K6B A;  1JR3 A;  3FE3 A;  1Z5B A;  3AJI B;  4IBG A;  2FS1 A;  1W1V A;  1TH3 A;  3FUT A;  4GRI A;  4P17 A;  3FUU A;  1HT2 E;  5C1B A;  1N77 A;  2UXC M;  1OIZ A;  1XC8 A;  2R6F A;  4LFA M;  3GQ3 A;  4AG5 A;  4G4O A;  1YSY A;  3IG8 A;  1HNW M;  2OOA A;  2E5L M;  2QNJ A;  2BG1 A;  4XK8 F;  2CFO A;  3B7N A;  4P16 A;  1HNZ M;  5ITU A;  2UXD M;  2KRU A;  1XMQ M;  1ZMV A;  2G3Q A;  2R0I A;  1XNR M;  2LHC A;  4QHS A;  2VII A;  1H8P A;  1DV0 A;  1VG5 A;  3HY5 A;  3TL4 X;  3BBZ A;  4X62 M;  1C1K A;  4OJL A;  4JI1 M;  2BJW A;  1HQY E;  2RRU A;  5KO3 A;  2F5N A;  1GJS A;  4NYY A;  2DWL A;  4HLQ A;  4LF6 M;  1T43 A;  4IBF A;  4OX9 M;  2XD1 A;  2KXE A;  1AIW A;  2F5S A;  5IZ7 D;  5KPR A;  1ZQ9 A;  2DZL A;  3FUW A;  4B08 A;  1NO1 A;  3SAU A;  3CGW A;  3C3E A;  3K2L A;  3GPX A;  3T1Y M;  2JY6 B;  3K9O A;  1DO0 A;  4PDG A;  4FCW A;  4WP2 A;  3W68 A;  2HHH M;  2RGH A;  2JE5 A;  3M7G A;  4NZ5 A;  2WSE F;  4OJ5 A;  1E9S A;  3KDS E;  1E6Z A;  4QNL A;  1H0I A;  1QQW A;  2L4F A;  2Z7J A;  2XZF A;  4CJ6 A;  4AKI A;  3KOX E;  1IXS B;  2JA2 A;  1T3T A;  3CTW B;  3KXE C;  2A5Y B;  2VDB B;  2ZBK B;  3THG A;  2R18 A;  1EFU B;  1GVN A;  2ZM6 M;  1TTE A;  2KZS A;  2KDL A;  2JY8 A;  3R8F A;  2QEN A;  2QP9 X;  4AW4 A;  1FJG M;  2HL7 A;  3E46 A;  1IY1 A;  4BBA A;  3FTD A;  2L7H A;  4JV5 M;  3BOS A;  1R7R A;  1G41 A;  5ITT A;  3HSH A;  3HZJ A;  4M9X A;  5DYI A;  2RTS A;  1YU1 A;  4NXN M;  4MH0 E;  2VF8 A;  2XSZ A;  3L28 A;  4JI2 M;  1TF0 B;  4GC5 A;  4B7F A;  3U6M A;  3SAS A;  1R6B X;  3AL0 C;  1GXD A;  1DGF A;  3Q8G A;  4OVZ B;  4HMD A;  4L6V 6;  1OFI A;  4FW9 A;  1DGH B;  4HEO A;  5FTN A;  2X4A A;  2DWM A;  4Z2J A;  1YUE A;  4CIZ A;  1G8P A;  1NHW C;  4OJP A;  4LJA A;  3ILK A;  1Z5C A;  1PM5 A;  1VQ1 A;  1E9R A;  4GIT A;  4G4N A;  1IBL M;  2R65 A;  1NJG A;  3E9S A;  4LCB A;  1I94 M;  4OU7 A;  4LJ4 A;  4NY2 A;  3U6E A;  3U60 A;  4LF4 M;  1OQY A;  3HKP A;  2C96 A;  1R5L A;  3NBI A;  4IBK A;  4MGI E;  1NSF A;  3QWL A;  2QPA A;  4JI0 M;  4LZZ A;  4JI8 M;  4REZ A;  2L6O A;  4KO8 A;  4DR4 M;  1J7M A;  1MU5 A;  3E4R A;  2R45 A;  5ITY A;  1PDC A;  2V6Z M;  3HHW A;  3J27 B;  4L16 A;  1NY5 A;  3HJ8 A;  1XWI A;  1UM8 A;  3ZH9 B;  1UR9 A;  1I4W A;  4L15 A;  2OOB A;  2BWB A;  2R4E A;  3KVW A;  4JI6 M;  3GLI B;  3GLI E;  2QHO B;  3L26 A;  2D7H A;  3JAM S;  2OO9 A;  3A45 A;  3FKE A;  3W0F A;  4I5S A;  1YU4 A;  2KNV A;  2LXE A;  2JXN A;  2EUC A;  5KQ8 A;  3HJS A;  5EXS A;  3SHF A;  2XD5 A;  2K0B X;  3SYK A;  3KSJ A;  4JI7 M;  2I7N A;  2WSC F;  1D2N A;  1NNU C;  3NWL A;  2UUB M;  1F4I A;  3QYE A;  1E6P A;  2AHM A;  2N35 A;  3DFZ A;  4LJ5 A;  1NV8 A;  4TX8 A;  1E94 E;  5KPT A;  1ORY B;  4IIW A;  3FTE A;  4PDI A;  5JI2 E;  2XEP A;  3HX3 A;  1MJG M;  2EA0 A;  3U60 B;  3GRY A;  4BB9 A;  4DR3 M;  1XB2 B;  1IN5 A;  4RF0 A;  1TDH A;  2HKJ A;  2MGW A;  1YLA A;  1E6N A;  2DVW B;  2Y2H A;  1Z6T A;  2L2D A;  2CV1 A;  3LQQ A;  4HL4 A;  3L29 A;  4R7G A;  3GLH E;  3GLH B;  2DAG A;  4CGY B;  2DKL A;  1GL7 A;  4RNA A;  1Q3B A;  4B3T M;  3KS4 A;  4YY3 M;  5DFL A;  4M0W A;  2KA6 B;  4RF1 A;  2Y2K A;  4OJO A;  2J7O A;  5BPV A;  1IY0 A;  3U6S A;  3SC3 A;  4KT0 F;  5KPZ A;  2CEA A;  2OPF A;  2L09 A;  2MJ5 B;  2XGN A;  3DZD A;  4DR5 M;  1KS0 A;  1XXH B;  1XXH E;  2R46 A;  3A46 A;  4DV3 M;  2FFJ A;  3VKH A;  3EIE A;  3B74 A;  4GMQ A;  1VEJ A;  4ANR A;  5EXX A;  5ITR A;  3GQ4 A;  1E6R A;  4OJ6 A;  1QAN A;  4Z2K A;  1N32 M;  1E32 A;  2QQ8 A;  1OAI A;  1V33 A;  4FCT A;  1V34 A;  2JP7 A;  2P5T A;  4MB7 A;  1H0G A;  1S3S A;  1GL6 A;  2F5O A;  3ZC7 B;  3RGS A;  4FVM A;  2ZTD A;  3TWK A;  1IBK M;  4QOS A;  5EP2 A;  2IOU A;  3MMP A;  3U6P A;  2Y2N A;  3M7P A;  3A98 B;  1VEK A;  3LQR A;  4NC6 A;  3V76 A;  1IY2 A;  1QZM A;  3MHV C;  1W1T A;  3B9P A;  1TH2 A;  1CXW A;  2LVQ D;  1L2C A;  3GP1 A;  4LRS A;  5IRE B;  4G4R A;  1QO6 A;  3TPZ A;  3IEC A;  4DR7 M;  4IBE A;  2Z3X A;  4LGY A;  4FWH A;  1IXZ A;  2H5X A;  2DXI A;  4AKH A;  4GC9 A;  1PJS A;  4GHA A;  4MB3 A;  5F3W A;  3HHZ A;  2UUC M;  1PJJ A;  5FTM A;  1D0L A;  3AOE C;  4UN2 B;  3U61 B;  4X64 M;  3GLF B;  5EP1 A;  1OJL A;  4X65 M;  4LJ9 A;  3CF6 E;  3FD9 A;  3NBX X;  3N3F A;  3QYB A;  1CUK A;  3TE6 A;  3U6O A;  2Y2M A;  2O5R A;  3JR4 A;  4AI6 A;  2YR0 A;  3RGP A;  3U6L A;  2CHV A;  2QBY B;  3TWL A;  1ZMU A;  3D8B A;  2Q2E B;  2QZ4 A;  2KHH A;  3FYC A;  3RFW A;  4DR2 M;  2CV0 A;  4LJ6 A;  5BR8 M;  4DUZ M;  4A3V B;  2LHG A;  2MRO B;  2O01 F;  3RE8 A;  4AZF A;  1QUS A;  1DGB A;  4QOZ C;  4Q7J A;  4GIP A;  1W5T A;  4JI3 M;  5LMU M;  2YNM D;  1N78 A;  4LF7 M;  4LF9 M;  2CHG A;  2B3T A;  2XZU A;  1PJQ A;  4W5W A;  4NSR A;  2F5Q A;  2LH0 A;  2CUZ A;  3FUV A;  1E8B A;  2J5Y A;  2W82 A;  3DOA A;  1HR0 M;  3L2A A;  2JWS A;  3SAW A;  4DV2 M;  2LBC A;  2K9D A;  3GLG E;  2D7E A;  3GLG B;  3GQ5 A;  4LZJ A;  1H6U A;  3J80 S;  2QBY A;  1QZE A;  2ZAM A;  2XFT A;  2DEN A;  3U61 A;  1X37 A;  2Y2O A;  3B7Q A;  1SXJ D;  3KOY E;  3MQL A;  1QYR A;  2DAE A;  1GLN A;  2DHR A;  1Q3C A;  2ERC A;  3H4J A;  2KZU A;  3KOZ E;  2F5P A;  2UU9 M;  4K0K M;  1EAK A;  5LMN M;  1YUB A;  1SXJ C;  1IXS A;  1FNN A;  1SXJ E;  1SXJ B;  2EJS A;  1WGN A;  1JQJ C;  2NQ8 C;  3KOW E;  1KSF X;  1QAQ A;  1MN3 A;  4NRV A;  4Z2G A;  1WGL A;  4Z2I A;  3HON A;  4LFB M;  2CHQ A;  5EJC A;  1OAO C;  1QDR A;  4EIW A;  2C99 A;  3B89 A;  1GO5 A;  3KFU G;  2D49 A;  3EIH A;  4WW0 A;  4DR1 M;  3HU2 A;  3FTC A;  3K92 A;  1WHC A;  2QSF X;  2LWX A;  4GH9 A;  2JZ1 A;  4I8O A;  3WHK A;  4FD2 A;  3VK8 A;  1LV7 A;  4DV1 M;  2BJV A;  2F4V M;  2WSF F;  1EIJ A;  2EKF A;  1QDT A;  1EE8 A;  2LVO C;  1NVM A;  2X8A A;  1L8Q A;  3LCU A;  4MM3 B;  2FFF B;  2DNA A;  2LNH C;  3I51 A;  1QAM A;  4QHT A;  1L2B A;  1L1T A;  3GLG A;  4OVZ A;  5FLX S;  4LGM A;  1DGH A;  2LVN C;  3W67 A;  4B3M M;  1YE9 A;  4AG6 A;  1VEG A;  3SHG B;  4LJ8 A;  2JZ0 A;  5C18 A;  1JB0 F;  2QCU A;  4NZ3 A;  4DV5 M;  3PNY A;  4G4Q A;  3F92 A;  4D81 A;  4GHL A;  4PD2 A;  4B7G A;  3M0E A;  4KLN A;  3HGI A;  3K9P A;  3KW6 A;  1KFV A;  3J81 S;  3VLF B;  4NXM M;  3WX7 A;  2Y0T A;  3PNV A;  3GRV A;  1SG9 A;  1OFH A;  3CF0 A;  4L78 A;  3VK7 A;  3HWS A;  4I81 A;  4KHP M;  3HHY A;  1JR3 D;  1CK7 A;  1E15 A;  1DGG A;  3UJN A;  4MB5 A;  3U5Z B;  4LF5 M;  1UFZ A;  4GEW A;  5ITX E;  1N36 M;  1NV9 A;  2Y2I A;  5IWA M;  2L7I A;  3HJQ A;  4MB4 A;  2C9O A;  2LVA A;  4I4L A;  1QVR A;  2ZAO A;  3BXW A;  3E21 A;  3H4M A;  3LVV A;  5ITQ A;  1W1P A;  2RKO A;  1ZV1 A;  3GLI A;  1Q02 A;  4OUI A;  4DV7 M;  3GPY A;  1AIP C;  1NHG C;  1NY6 A;  3C58 A;  1T6O A;  3LVW A;  5FTJ A;  1IN8 A;  1GOI A;  5FSW A;  4X66 M;  5DNY A;  2DAK A;  2KEB A;  2Y2Q A;  3U6C A;  2EKK A;  3I01 M;  1VDL A;  4IJE A;  3FRI A;  1GKI A;  4Z2H A;  1WR1 B;  3GPP A;  1C7Y A;  2G8L A;  2XFS A;  2Y2G A;  4HME A;  4NYU A;  4B3S M;  1IN4 A;  3WD3 A;  1K3W A;  3SMP A;  2MH8 A;  1OGG A;  1HNX M;  2GNO A;  2JCH A;  4F1I A;  3WD0 A;  1RU3 A;  3U5Z A;  3GLF A;  4F2L A;  2VF7 A;  5ITX A;  3FYD A;  3UGJ A;  1O6I A;  2I7P A;  2KNA A;  3I4V A;  4ZPX A;  2UXB M;  2JY7 A;  5FTK A;  1PJT A;  4JI4 M;  3JR5 A;  4JI5 M;  2R44 A;  3GLH A;  1IQP A;  4NL4 H;  2BNK A;  3W0L B;  1UR8 A;  4PCZ A;  4NRW A;  2D7G A;  5GKN A;  5A2Q S;  4II7 A;  1WIV A;  4IBC A;  1XNQ M;  1GAB A;  3HU1 A;  1NJF A;  3T15 A;  4B3R M;  3AFH A;  1XXH A;  3LMM A;  2CWB A;  3GLF E;  3FUX A;  2V1U A;  1YU3 A;  2R4J A;  3MK6 A;  4QNM A;  5EXT A;  3VDP A;  4M0D A;  3OTO M;  4L4U A;  4LFC M;  3SFZ A;  4ITQ A;  2M5Z A;  1MX0 A;  1J7K A;  1HQC A;  3HHX A;  2Y2L A;  3LW5 F;  5H37 D;  3TWM A;  3VKG A;  4B7H A;  2XSZ D;  1Y8G A;  2Z8Y M;  3ZCB B;  3M6A A;  1ED7 A;  3I4Y A;  3UK6 A;  1VDD A;  4LJ7 A;  1IXR C;  2XLJ A;  2V5O A;  3KP0 E;  1D0M A;  1AUA A;  1J09 A;  3C9P A;  3A42 A;  4Z8X A;  1L2D A;  2DZN B;  2C9C A;  3GRR A;  3SBJ A;  1N75 A;  4IBD A;  1OKS A;  4D80 A;  3PXG A;  2XF3 A;  1TH4 A;  3TQS A;  2C98 A;  4LG2 A;  4DR6 M;  1YU2 A;  2LVP C;  2V1C A;  3QAU A;  1TGU A;  3U6Q A;  2J7N A;  2UWX A;  4M9S A;  3Q8X A;  1KYI A;  4GKJ M;  1L6J A;  2KRK A;  1IN7 A;  2CE7 A;  2LTU A;  1XHB A;  3AOE A;  3MJ5 A;  2Y21 A;  4R3D A;  5E6J A;  3T38 A;  5EP4 A;  4Z6Y A;  5JI3 E;  2XH9 A;  4FWG A;  2DAI A;  4NSO B;  1N34 M;  1G71 A;  4NOO B;  3J7B A;  2K47 A;  1GJT A;  3AKZ A;  5KQD A;  3ZQJ A;  2C5R A;  3SMS A;  1E88 A;  3L27 A;  4FCV A;  1J5E M;  2DZO B;  1QAO A;  4HMC A;  5FTL A;  4YHH M;  5EQT A;  3I04 M;  2Y2J A;  3WD4 A;  1P3Q Q;  7CAT A;  2HAK A;  1Z5A A; 
#chains in the Genus database with same CATH homology
 3SAR A;  1IM2 A;  4CIS A;  4D82 A;  2ZAN A;  4JXJ A;  3AOG A;  1K3X A;  3UZU A;  3K1J A;  1G4A E;  2YQZ A;  8CAT A;  3J7A S;  4WUR A;  4MGZ E;  2Y2P A;  4NZ4 A;  4LF8 M;  3SYL A;  3HU3 A;  4IBJ A;  1WXQ A;  4OW0 A;  1G3I A;  4XBO A;  3VFD A;  3J2P B;  4MGY E;  1YU0 A;  3GO8 A;  2DWN A;  3SAT A;  4CHT B;  2Z4R A;  1TDZ A;  2R62 A;  4NZ1 A;  2X49 A;  3AV0 A;  1G59 A;  5EP3 A;  4LRT A;  5IT9 S;  1DO2 A;  4L8R C;  2G5G X;  4TUW A;  1K82 A;  1IBM M;  1SXJ A;  3VDU A;  4QNR A;  2CV2 A;  3K8Z A;  1PJI A;  1W5S A;  2VQF M;  4IBB A;  2H1R A;  5E26 A;  2FNA A;  3U6D A;  2HCB A;  2YFQ A;  1IN6 A;  1ZAE A;  4G6Z A;  2VQE M;  4DV0 M;  3UMM A;  3KP1 E;  1Q39 A;  3GPU A;  4AQY M;  3L25 A;  2OQ4 A;  4BLC A;  4LY6 A;  3PVS A;  3KS8 A;  2EO2 A;  4DV4 M;  2UUA M;  5DYG A;  2FOI C;  3SAV A;  1R2Y A;  3FTF A;  4AKG A;  4MGK E;  4JN6 A;  3GRU A;  1N33 M;  2DWZ B;  3KSX A;  4MGH A;  2Y0Q A;  1XMO M;  4DUY M;  2Y20 A;  1NNJ A;  3CF2 A;  4DV6 M;  3T1H M;  2M60 A;  4IBI A;  4PT5 A;  4GKK M;  1HT1 E;  3DA1 A;  5EXP A;  4KOD A;  2FE8 A;  4FWD A;  1L1Z A;  2RGO A;  4XGI A;  3R9X B;  4M9Z A;  3D8L A;  1Z59 A;  3WHL A;  4S12 A;  4IJF A;  3IG5 A;  4JYA M;  2KW0 A;  3PFI A;  2Z4S A;  1JR3 A;  1Z5B A;  3AJI B;  4IBG A;  1TH3 A;  3FUT A;  4GRI A;  2UXC M;  3FUU A;  1HT2 E;  5C1B A;  1N77 A;  2UWX A;  1XC8 A;  3GQ3 A;  4LFA M;  4AG5 A;  4G4O A;  1YSY A;  3IG8 A;  1HNW M;  2BG1 A;  2E5L M;  2CFO A;  4P16 A;  1HNZ M;  2UXD M;  5ITU A;  2KRU A;  1XMQ M;  1XNR M;  4QHS A;  2VII A;  3TL4 X;  4X62 M;  1C1K A;  4OJL A;  4JI1 M;  2BJW A;  1HQY E;  2F5N A;  5KO3 A;  4NYY A;  2DWL A;  4HLQ A;  4LF6 M;  4OX9 M;  4IBF A;  2XD1 A;  2KXE A;  2F5S A;  5IZ7 D;  5KPR A;  1ZQ9 A;  3FUW A;  4B08 A;  3SAU A;  3K2L A;  3GPX A;  3T1Y M;  1DO0 A;  4PDG A;  4FCW A;  2HHH M;  2RGH A;  2JE5 A;  3M7G A;  4NZ5 A;  4OJ5 A;  1E9S A;  3KDS E;  4QNL A;  1QQW A;  2Z7J A;  2XZF A;  4AKI A;  3KOX E;  1IXS B;  2JA2 A;  1T3T A;  3CTW B;  3KXE C;  2A5Y B;  2ZBK B;  3THG A;  2R18 A;  1GVN A;  2ZM6 M;  2KZS A;  3R8F A;  2QEN A;  2QP9 X;  4AW4 A;  1FJG M;  2HL7 A;  1IY1 A;  4BBA A;  3FTD A;  2L7H A;  4JV5 M;  3BOS A;  1R7R A;  1G41 A;  5ITT A;  3HSH A;  4M9X A;  5DYI A;  1YU1 A;  4NXN M;  4MH0 E;  2XSZ A;  3L28 A;  4JI2 M;  4GC5 A;  4B7F A;  3U6M A;  3SAS A;  1R6B X;  1DGF A;  4OVZ B;  1OFI A;  4FW9 A;  1DGH B;  5FTN A;  2X4A A;  2DWM A;  1YUE A;  1G8P A;  1NHW C;  4OJP A;  4LJA A;  3ILK A;  1Z5C A;  1PM5 A;  1E9R A;  4GIT A;  4G4N A;  1IBL M;  2R65 A;  1NJG A;  3E9S A;  4LCB A;  1I94 M;  4OU7 A;  4LJ4 A;  4NY2 A;  3U6E A;  3U60 A;  4LF4 M;  3HKP A;  2C96 A;  3NBI A;  4IBK A;  4MGI E;  4JI0 M;  1NSF A;  3QWL A;  2QPA A;  4LZZ A;  4JI8 M;  4REZ A;  2L6O A;  4KO8 A;  4DR4 M;  1MU5 A;  3E4R A;  2R45 A;  5ITY A;  2V6Z M;  3HHW A;  3J27 B;  4L16 A;  1NY5 A;  3HJ8 A;  1XWI A;  1UM8 A;  3ZH9 B;  1I4W A;  4L15 A;  2R4E A;  3KVW A;  4JI6 M;  3GLI B;  3L26 A;  2D7H A;  3JAM S;  3A45 A;  3FKE A;  3W0F A;  4I5S A;  1YU4 A;  2LXE A;  2EUC A;  5KQ8 A;  3HJS A;  5EXS A;  3SHF A;  2XD5 A;  3SYK A;  3KSJ A;  4JI7 M;  2I7N A;  3NWL A;  1D2N A;  1NNU C;  2UUB M;  2AHM A;  3DFZ A;  4LJ5 A;  1E94 E;  5KPT A;  1ORY B;  4IIW A;  3FTE A;  4PDI A;  5JI2 E;  2XEP A;  2EA0 A;  3GRY A;  4BB9 A;  4DR3 M;  1IN5 A;  4RF0 A;  1TDH A;  2HKJ A;  2Y2H A;  2DVW B;  1Z6T A;  2CV1 A;  3LQQ A;  4HL4 A;  3L29 A;  4R7G A;  3GLH B;  1R2Z A;  4CGY B;  4B3T M;  3AL0 C;  1GL7 A;  4RNA A;  1Q3B A;  3KS4 A;  4YY3 M;  4M0W A;  2KA6 B;  4RF1 A;  2Y2K A;  4OJO A;  2J7O A;  5BPV A;  1IY0 A;  3U6S A;  3SC3 A;  5KPZ A;  2CEA A;  2OPF A;  2L09 A;  2XGN A;  3DZD A;  4DR5 M;  1XXH B;  2R46 A;  3A46 A;  4DV3 M;  2FFJ A;  3VKH A;  3EIE A;  4GMQ A;  5EXX A;  5ITR A;  3GQ4 A;  4OJ6 A;  1QAN A;  1N32 M;  1E32 A;  4FCT A;  2P5T A;  4MB7 A;  1S3S A;  1GL6 A;  2F5O A;  3ZC7 B;  3RGS A;  4FVM A;  3TWK A;  1IBK M;  4QOS A;  5EP2 A;  2IOU A;  3U6P A;  2Y2N A;  3A98 B;  3LQR A;  1IY2 A;  1QZM A;  3MHV C;  3B9P A;  1TH2 A;  1L2C A;  3GP1 A;  4LRS A;  5IRE B;  4G4R A;  3TPZ A;  4DR7 M;  4IBE A;  2Z3X A;  4LGY A;  4FWH A;  1IXZ A;  2DXI A;  4AKH A;  4GC9 A;  4GHA A;  5F3W A;  3HHZ A;  2UUC M;  1PJJ A;  5FTM A;  3AOE C;  3U61 B;  4X64 M;  3GLF B;  5EP1 A;  1OJL A;  4X65 M;  4LJ9 A;  3CF6 E;  3FD9 A;  3N3F A;  3TE6 A;  3U6O A;  2Y2M A;  2O5R A;  3JR4 A;  4AI6 A;  2YR0 A;  3RGP A;  3U6L A;  2CHV A;  2QBY B;  3TWL A;  3D8B A;  2Q2E B;  2QZ4 A;  3RFW A;  3FYC A;  4DR2 M;  2CV0 A;  4LJ6 A;  5BR8 M;  4DUZ M;  4A3V B;  3RE8 A;  4AZF A;  1DGB A;  4QOZ C;  4GIP A;  1W5T A;  4JI3 M;  5LMU M;  2YNM D;  1N78 A;  4LF7 M;  4LF9 M;  2CHG A;  2XZU A;  4W5W A;  4NSR A;  2F5Q A;  2LH0 A;  2CUZ A;  3FUV A;  2W82 A;  3DOA A;  1HR0 M;  3L2A A;  3SAW A;  4DV2 M;  3GLG B;  2D7E A;  3GQ5 A;  4LZJ A;  1H6U A;  3J80 S;  2ZAM A;  2XFT A;  3U61 A;  1X37 A;  2Y2O A;  1SXJ D;  3KOY E;  1QYR A;  2DHR A;  1GLN A;  3KOZ E;  1Q3C A;  2ERC A;  2F5P A;  2KZU A;  2UU9 M;  4K0K M;  5LMN M;  1YUB A;  1SXJ C;  3KOW E;  1FNN A;  1SXJ E;  1SXJ B;  2QBY A;  2NQ8 C;  1JQJ C;  2Y2Q A;  4NRV A;  1KSF X;  1QAQ A;  3HON A;  4LFB M;  2CHQ A;  5EJC A;  4EIW A;  2C99 A;  3KFU G;  3EIH A;  4WW0 A;  4DR1 M;  3HU2 A;  3FTC A;  3K92 A;  2LWX A;  4GH9 A;  4I8O A;  3WHK A;  3VK8 A;  4FD2 A;  1LV7 A;  4DV1 M;  2BJV A;  2F4V M;  2X8A A;  1EE8 A;  1NVM A;  1L8Q A;  4MM3 B;  2FFF B;  2LNH C;  3I51 A;  1QAM A;  4QHT A;  1L2B A;  1L1T A;  3GLG A;  4OVZ A;  5FLX S;  4LGM A;  1DGH A;  4B3M M;  1YE9 A;  4AG6 A;  4LJ8 A;  5C18 A;  2QCU A;  4NZ3 A;  4DV5 M;  3PNY A;  4G4Q A;  4D81 A;  4GHL A;  4PD2 A;  4B7G A;  3M0E A;  4KLN A;  3HGI A;  4NXM M;  3KW6 A;  1KFV A;  3J81 S;  3VLF B;  3WX7 A;  2Y0T A;  3PNV A;  3GRV A;  4L78 A;  1OFH A;  3CF0 A;  3VK7 A;  3HWS A;  4I81 A;  4KHP M;  3HHY A;  1JR3 D;  1DGG A;  3UJN A;  3U5Z B;  4LF5 M;  5ITX E;  1N36 M;  2Y2I A;  5IWA M;  2L7I A;  3HJQ A;  2C9O A;  4I4L A;  1QVR A;  2ZAO A;  3H4M A;  3LVV A;  5ITQ A;  2RKO A;  3GLI A;  4OUI A;  4DV7 M;  3GPY A;  1NHG C;  1NY6 A;  3C58 A;  3LVW A;  5FTJ A;  1IN8 A;  5FSW A;  4X66 M;  5DNY A;  2KEB A;  3U6C A;  4IJE A;  1GKI A;  3GPP A;  2Y2G A;  2G8L A;  2XFS A;  4NYU A;  4B3S M;  1IN4 A;  1K3W A;  3SMP A;  1HNX M;  2JCH A;  3U5Z A;  3GLF A;  5ITX A;  3FYD A;  3UGJ A;  2I7P A;  3I4V A;  4ZPX A;  2UXB M;  5FTK A;  4JI4 M;  3JR5 A;  4JI5 M;  3GLH A;  1IQP A;  4NL4 H;  2BNK A;  3W0L B;  4PCZ A;  4NRW A;  2D7G A;  5GKN A;  5A2Q S;  4II7 A;  1XNQ M;  4IBC A;  3HU1 A;  1NJF A;  3T15 A;  4B3R M;  3AFH A;  1XXH A;  3LMM A;  3FUX A;  2V1U A;  1YU3 A;  2R4J A;  3MK6 A;  4QNM A;  5EXT A;  3VDP A;  4M0D A;  3OTO M;  4L4U A;  4LFC M;  3SFZ A;  4ITQ A;  2M5Z A;  1MX0 A;  1J7K A;  1HQC A;  3HHX A;  2Y2L A;  5H37 D;  3TWM A;  3VKG A;  4B7H A;  2XSZ D;  3ZCB B;  3M6A A;  3I4Y A;  3UK6 A;  1VDD A;  4LJ7 A;  1IXR C;  2XLJ A;  3KP0 E;  1J09 A;  3A42 A;  4Z8X A;  1L2D A;  2DZN B;  2C9C A;  3GRR A;  3SBJ A;  1N75 A;  4IBD A;  4D80 A;  3PXG A;  2XF3 A;  1TH4 A;  3TQS A;  2C98 A;  4LG2 A;  4DR6 M;  1YU2 A;  2V1C A;  3QAU A;  1TGU A;  3U6Q A;  2J7N A;  4M9S A;  3Q8X A;  1KYI A;  4GKJ M;  2KRK A;  1IN7 A;  2CE7 A;  3AOE A;  1XHB A;  3MJ5 A;  5E6J A;  2Y21 A;  4R3D A;  3SHG B;  3T38 A;  5EP4 A;  4Z6Y A;  5JI3 E;  2XH9 A;  4FWG A;  4NSO B;  3U60 B;  1N34 M;  4NOO B;  3J7B A;  2K47 A;  3AKZ A;  5KQD A;  2C5R A;  3SMS A;  3L27 A;  4FCV A;  1J5E M;  2DZO B;  1QAO A;  5FTL A;  4YHH M;  5EQT A;  2Y2J A;  7CAT A;  1Z5A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...