4GH9A

Crystal structure of marburg virus vp35 rna binding domain
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
122
structure length
122
Chain Sequence
LSAKDLALLLFTHLPGNNTPFHILAQVLSKIAYKSGKSGAFLDAFHQILSEGENAQAALTRLSRTFDAFLGVVPPVIRVKNFQTVPRPCQKSLRAVPPNPTIDKGWVCVYSSEQGETRALKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Marburg Virus VP35 Can Both Fully Coat the Backbone and Cap the Ends of dsRNA for Interferon Antagonism.
pubmed doi rcsb
source organism Marburg virus
molecule tags Viral protein,rna binding protein
molecule keywords Polymerase cofactor VP35
total genus 42
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2012-08-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4gh9A01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4gh9A02
4IBJA 4IBEA 4IBBA 3KS8A 3L28A 3L27A 3L25A 4GH9A 4IBIA 4IBGA 5BPVA 4IJEA 4IBDA 3L29A 3L2AA 3FKEA 4IBKA 3KS4A 4IBFA 4IJFA 4GHLA 4IBCA 4LG2A 4GHAA 3L26A
chains in the Genus database with same CATH superfamily
2QZ4A 1CK7A 1PJIA 3E46A 1ZAEA 4NY2A 2WSFF 1GKIA 1HNZM 3PNVA 4OJLA 3SMSA 2Z4RA 2JXNA 1R2YA 2Y21A 4HLQA 1NNJA 4DV7M 4ZPXA 2DAEA 1D0LA 3U6CA 4XBOA 2O5RA 4RF0A 3BBZA 2L7HA 1Q39A 5KQDA 3GLFA 2DAIA 3FYCA 1TH4A 4L15A 2Y2MA 1T6OA 1W5TA 1JR3A 1XXHE 2XLJA 3GQ4A 2QBYA 1GXDA 1OJLA 4NRWA 4MGZE 2QBYB 1W5SA 2R6FA 3E4RA 3SBJA 2E5LM 3N3FA 4OUIA 4NSOB 1XHBA 4LG2A 2D49A 2UXDM 2J7OA 1OFIA 1N77A 2AHMA 2FN2A 1VEJA 4OJPA 2DENA 2M5ZA 3I4YA 4DR4M 1T3TA 2FNAA 1Z59A 3J81S 3WHLA 4JI4M 4M0WA 4AKIA 1YU0A 2Y2NA 3GLGE 3WD1A 1AIWA 3GRYA 3A46A 2F5PA 5ITXE 1GOIA 1J5EM 1J7KA 3B89A 1QANA 3EIHA 3RGSA 1NV8A 4IBIA 3FUUA 3K9OA 4MGYE 4OVZB 5ITTA 1ED7A 2X49A 4D81A 5KPZA 1HT1E 2DAKA 4G4RA 4K0KM 4HMEA 2HWJA 1E9RA 3W67A 4X62M 2YR0A 3HHXA 1V34A 1VG5A 3KP1E 4GIPA 1J09A 4Z6YA 3NBIA 5GKNA 3JR4A 2MJ5B 3TL4X 3AKZA 3KXEC 1DGBA 2CV1A 2Y2JA 2MH8A 2YQZA 4WP2A 4G4OA 2JUJA 3CTWB 1YU2A 2EUCA 1K82A 3U6SA 3VKHA 2BWEA 3BXWA 1Q02A 4LRSA 4B7GA 3VK7A 3AFHA 1IBLM 3LMMA 1L1TA 1PJJA 3DA1A 1EFUB 2LVAA 3BOSA 2Q2EB 2G3QA 1GJTA 4FWDA 1G4AE 3VK8A 5E26A 2C5RA 1R7RA 3K92A 4MB3A 4FVMA 3HKPA 1NHGC 1FNNA 1X37A 1GLNA 1OKSA 2XFSA 4FCTA 4FD2A 2KA6B 2XZFA 2FOIC 5ITQA 1UFZA 3AL0C 1KS0A 1OTRA 3D8BA 4B3RM 4LF5M 1L6JA 2OQ4A 1H6UA 3CGWA 3U6DA 2I7NA 4BBAA 4PCZA 4IBCA 2KNZA 5DYGA 1ZV1A 4B3MM 2DAGA 2JY5A 2X4AA 4QOZC 3SAVA 5C1BA 4ITQA 2B3TA 1E15A 2Y2HA 1GL6A 3PNYA 2HL7A 5JI3E 4Z2LA 2L2DA 1R2ZA 2CWBA 1IXZA 4Z2GA 3GPPA 4AG5A 1MU5A 1QZMA 1XMOM 3FTFA 2DHRA 4IIWA 4B3TM 4EIWA 2Y2LA 2Y0TA 5DNYA 4NYYA 2RGOA 4JI7M 1DO2A 4I81A 3AOEC 1T43A 4DUYM 5IT9S 4B7HA 4R71A 5EQTA 2J5YA 1HQYE 4KODA 4IBDA 4JI1M 3H4JA 7CATA 2LWXA 2BNKA 4QHTA 1VEKA 3CF0A 2YNMD 2DWNA 3T15A 4LJ9A 3KSJA 4MB5A 3HU3A 3LQRA 1G71A 1I94M 2K0BX 2Y2GA 1JQJC 2DWZB 4LZZA 1L2CA 1ORYB 2Y20A 3MMPA 2LNHC 2R4JA 4GHAA 2GNOA 1I4WA 3PVSA 3I4VA 3HY5A 1YUBA 2R4EA 4A3VB 4LFCM 3R8FA 4JI5M 3Q8XA 4W5WA 4MGHA 4PDIA 1TH2A 2JZ0A 3WD0A 1YUEA 8CATA 2FH0A 2G5GX 3GLFB 1PJTA 3J80S 1IFYA 1C7YA 2EJSA 1D0MA 1QUSA 3E9SA 2XZUA 1JB0F 2HKJA 1Q3CA 4RKUF 2OOBA 5EJCA 2ZAMA 4I5SA 3SHGB 4NZ1A 2BWBA 4QNLA 1TGUA 5DFLA 2CUZA 2DI0A 1XXHA 1QVRA 2WZJA 1YLAA 1N75A 3U6MA 2Y2KA 3E21A 3THGA 3A45A 3U5ZB 4LCBA 4NSRA 4LY6A 4NL4H 3U5ZA 2XD5A 3TWMA 3FTCA 3KVWA 2C9CA 3LW5F 2VIIA 4NZ3A 4L6V6 2RGHA 2H5XA 2DAMA 2O01F 5KPRA 1SXJC 2CHGA 2XH9A 2MR9A 3KDSE 3QYEA 4G4QA 2BJVA 1VEGA 2KEBA 4LJAA 1HR0M 1GO5A 1IN5A 2CEAA 1E8BA 1E6ZA 3A98B 3B74A 2LXEA 3KFUG 4XK8F 3U6EA 1W1PA 2L09A 4X66M 4JI3M 1IXSA 3GP1A 4LF9M 3HSHA 1WJ7A 3WD4A 3SASA 1QYRA 1GPFA 3KOZE 3VFDA 4CISA 2R44A 1XC8A 3K8ZA 2QP9X 2KW0A 2KXEA 2JY8A 1AIPC 2VF8A 2ZTCA 3KSXA 5FTKA 4F1IA 1S3SA 1AUAA 1DGHB 2JWSA 4GC9A 4Z8XA 2EO2A 4PD2A 5ITRA 4JYAM 3WHKA 5E6JA 2CHVA 4DUZM 5EXXA 2CP8A 1L8QA 1ZQ9A 4KT0F 4LJ5A 2KRUA 2DKLA 4DBGB 1K3WA 2DWLA 4OX9M 1DGHA 1XNRM 4X65M 4MB4A 3GLFE 2HCBA 4NRVA 4DV6M 2MGWA 2LVOC 1EIJA 4LJ6A 3J27B 1A5TA 4GH9A 2D7HA 2QCUA 3GLGB 5IWAM 1HJPA 2I7PA 2NQ8C 3M0EA 1PRBA 4REZA 3HHZA 3HU1A 3B7QA 1YU3A 1F4IA 5ITUA 1OQYA 2F5SA 3HWSA 2LH0A 2G8LA 4TUWA 3UK6A 3EIEA 2JY6B 5LMNM 4AW4A 3U60B 2ZTDA 1DO0A 4CHTB 3C58A 1IY2A 3J7AS 1DGFA 4FCVA 3VDPA 3GLHB 1Z5AA 1UM8A 3IHPA 2V5OA 2V1UA 3U6PA 1Q3BA 2DZNB 2R62A 3HJ8A 3Q8GA 3QWLA 4IBJA 2FE8A 2XEPA 3SAUA 4Z2HA 4L78A 1CUKA 3HHWA 1KSFX 5IZ7D 3SATA 2CV2A 1OIPA 4FWGA 3GLHA 4RF1A 3ZH9B 1PJQA 3KP0E 1IY1A 3L27A 3GPYA 1TTEA 1Z5CA 2Z4SA 3FRHA 4NXMM 5BPVA 3UGJA 1E9SA 2C9OA 1J7MA 1G59A 2XF3A 1IM2A 1Z6TA 1YU1A 2KNVA 2BJWA 1K3XA 1N33M 3L2AA 3FKEA 3GRVA 2V1CA 4LFAM 2A5YB 1WHCA 2Y2PA 3WD2A 1WR1B 4LJ8A 1NO1A 1E32A 3I01M 3RGPA 4FW9A 2JCHA 3GQ3A 3QAUA 4G6ZA 3FUVA 2Y2IA 1ZMWA 1GVNA 3F92A 2EA0A 2APLA 1NVMA 1NY6A 2VDBB 3QYBA 3SHFA 3FTEA 1NSFA 1LTMA 1PJSA 5FTJA 5L8RF 4NOOB 2DWMA 5H37D 5DYIA 3CF2A 4ANRA 1HNWM 1QAQA 4JXJA 3UZUA 3OTOM 2H1RA 2D7EA 1P3QQ 4LFBM 4B08A 2OPFA 3B7NA 3MHVC 5IREB 4JI6M 1OIZA 4QNMA 4QOSA 2Y2OA 3H4MA 1JR3E 1VDDA 1N32M 3AOEA 1QO6A 2RTSA 4OU7A 3GO8A 3AV0A 1IXSB 3NWLA 1WXQA 1VDLA 3UMMA 1D2NA 1OAOC 4OJOA 2QQ8A 5A2QS 1D0KA 4JI0M 1HNXM 1G8PA 5EP1A 5FTMA 2XD1A 4KLNA 3LVVA 4AQYM 1QZEA 3GLHE 1QAOA 2LTUA 2KZUA 1N78A 2ZAOA 1GL7A 3DFZA 3LQQA 4LGMA 1YE9A 2KHHA 4B7FA 4DV2M 2F4VM 2CFOA 2Z8YM 5BR8M 1IBKM 2UUBM 2ZM6M 2LHCA 3L28A 5C18A 1NHWC 2QSFX 2JE5A 4Z2JA 2OO9A 3NBXX 4M9XA 3GLGA 1SXJD 3VKGA 2UXBM 4BB9A 2K6BA 1GABA 3PFIA 3I51A 5ITXA 1E94E 1HQCA 2VQEM 3WD3A 1SXJA 4DV3M 1DV0A 4IBFA 4HMDA 3SFZA 2JP7A 1QAMA 1NY5A 4LZJA 5EP4A 2R45A 1W1YA 5FSWA 4M9ZA 2QENA 3C3EA 5ITYA 1XMQM 2GQFA 1EAKA 1YU4A 1R6BX 5F3WA 3U61A 2DZOB 4HL4A 4L16A 4JN6A 3VLFB 3IECA 2P5TA 4IBEA 2J7NA 3MJ5A 3KOWE 3KOXE 2DXIA 2DNAA 4DV4M 1V33A 2DHYA 1G3IA 4AKHA 2FFJA 1TR8A 1H0IA 3HX3A 3L29A 5FTLA 1L1ZA 2R18A 2X8AA 2ZBKB 1TDHA 2F5OA 1QDRA 2K47A 4MH0E 2HHHM 1H0GA 4DR3M 1R4GA 4DV5M 4GHLA 4DR7M 2M60A 4PT5A 4LRTA 1R5LA 2Z3XA 4GMQA 3K9PA 4G4NA 4GKKM 5EP3A 3M6AA 2KRKA 2QHOB 4Q7JA 1LV7A 4D82A 4JI2M 1RU3A 4YY3M 4NZ4A 4DV1M 4CGYB 1PDCA 4R7GA 2MROB 1C1KA 1Z5BA 1H8PA 2HAKA 3KS8A 5EP2A 4YHHM 5EXPA 1MN3A 1XXHB 4M9SA 4OJ6A 1WGNA 2QNJA 1OGBA 1KYIA 1NV9A 4GRIA 3TWKA 1YSYA 4IBKA 2VQFM 4L4UA 4MB7A 2VF7A 1OAIA 3GRRA 3KS4A 3B9PA 1SXJB 3FUXA 3U6LA 3HONA 5KQ8A 3FYDA 4P16A 1WGLA 1ZMUA 3W0LB 4NYUA 2FS1A 3M7PA 2LHGA 3U6QA 4L8RC 1VQ1A 2DVWB 4QHSA 4RNAA 2DZLA 4AKGA 2N35A 4GEWA 3W68A 3WX7A 3DOAA 3GPUA 4GC5A 1IY0A 4JI8M 2LVQD 2IOUA 2C96A 3DZDA 2Y0QA 3GLIA 1IXRC 3UJNA 4AZFA 3U6OA 4DR6M 3LCUA 3ILKA 3GPXA 1GJSA 4WW0A 3T1HM 1N34M 3FUWA 3FD9A 2EKKA 3LVWA 1XNQM 4DV0M 2LBCA 2K9DA 4GKJM 1MX0A 1ZMVA 4QNRA 2R0IA 4LJ4A 4LGYA 1N36M 4LJ7A 2KZSA 1KFVA 1JR3D 5EXSA 3ZC7B 2JZ1A 4CJ6A 2UXCM 1W1VA 4OW0A 2BG1A 4X64M 4I8OA 1QQWA 2JNHA 4F2LA 2CRUA 3TWLA 1QDTA 2WSEF 3L26A 2V6ZM 3VDUA 3TQSA 1IN7A 1TF0B 3J7BA 3U60A 4Z2KA 2L4EA 3A42A 3AOGA 1NNUC 5LMUM 4OJ5A 1OGGA 4LF6M 3SMPA 2UUAM 1IN4A 3J2PB 5KO3A 4LF4M 3CF6E 4JV5M 3V76A 2XSZA 3RE8A 2RRUA 4IBGA 4II7A 2O25A 4BLCA 4AI6A 1E6PA 4HMCA 4OVZA 3W0FA 4MM3B 3FUTA 4MGIE 2UU9M 5EXTA 3ZCBB 4DR5M 2D7GA 2XSZD 2Y2QA 4P17A 4UN2B 2F5QA 4KO8A 2W82A 2F5NA 3SARA 4IJFA 4NXNM 1SXJE 4HEOA 3I04M 1Y8GA 5FLXS 3T1YM 4LF8M 4NZ5A 3IG5A 1CXWA 3M7GA 3HU2A 4AG6A 1O6IA 3HHYA 3KOYE 1MJGM 1NJGA 2XFTA 3FRIA 2QPAA 1FJGM 4TX8A 5KPTA 1XB2B 3K2LA 5FTNA 4I4LA 2OOAA 4KHPM 1IN8A 2CV0A 1IQPA 3HGIA 4PDGA 1E88A 1OFHA 1G41A 2CE7A 1W1TA 3GLIE 3JR5A 3SC3A 2FFFB 3B7ZA 2ERCA 4M0DA 4NC6A 3HJSA 1V92A 4LF7M 4XGIA 1L2DA 1HT2E 4DR2M 4DR1M 3T38A 2L7IA 3IG8A 1WIVA 4G3OA 3T6PA 4B3SM 1UR8A 1E6RA 3AJIB 2L4FA 2R46A 3GQ5A 2EKFA 4WURA 3SYLA 4FWHA 5JI2E 1TH3A 3HZJA 1SG9A 4S12A 2XGNA 4FCWA 4MGKE 2LVNC 1DGGA 3TE6A 4Z2IA 3FE3A 3RFWA 4IBBA 3KW6A 4Y28F 2KNAA 3FTDA 1NJFA 3GRUA 2LVPC 3C3DA 2UWXA 1L2BA 2Z7JA 2KDLA 3MQLA 2R65A 3L25A 1QUTA 4CIZA 3LCVB 2C99A 3GLIB 1XWIA 2JY7A 3PXGA 3R9XB 2CHQA 4IJEA 3SYKA 3JAMS 1TDZA 2JA2A 2L6OA 4R3DA 1UR9A 3U61B 4D80A 1IN6A 3C9PA 3HJQA 1PGYA 1EE8A 3SAWA 1BVSA 1PM5A 2RKOA 3K1JA 2WSCF 2UUCM 3D8LA 1IBMM 1E6NA 2C98A 2YFQA 2ZANA 3ZQJA 3TPZA 4GITA 3MK6A
chains in the Genus database with same CATH topology
2QZ4A 1PJIA 1ZAEA 4NY2A 1GKIA 1HNZM 3PNVA 4OJLA 3SMSA 2Z4RA 1R2YA 2Y21A 4HLQA 1NNJA 4DV7M 4ZPXA 3U6CA 4XBOA 2O5RA 4RF0A 2L7HA 1Q39A 5KQDA 3GLFA 3FYCA 1TH4A 4L15A 2Y2MA 1W5TA 1JR3A 2XLJA 3GQ4A 2QBYA 1OJLA 4NRWA 4MGZE 2QBYB 1W5SA 3SBJA 3E4RA 2E5LM 3N3FA 4NSOB 1XHBA 4LG2A 2UXDM 2J7OA 1OFIA 1N77A 2AHMA 4OJPA 4DR4M 2M5ZA 3I4YA 1YU0A 1T3TA 2FNAA 1Z59A 3J81S 3WHLA 4JI4M 4M0WA 4AKIA 2Y2NA 3GRYA 3A46A 2F5PA 5ITXE 1J5EM 1J7KA 3EIHA 1QANA 3RGSA 4IBIA 3FUUA 4MGYE 4OVZB 5ITTA 2X49A 4D81A 5KPZA 1HT1E 4G4RA 4K0KM 4X62M 1E9RA 2YR0A 3HHXA 3KP1E 4GIPA 1J09A 4Z6YA 3NBIA 5GKNA 3JR4A 3AKZA 3TL4X 3KXEC 1DGBA 2CV1A 2Y2JA 2YQZA 4G4OA 3CTWB 1YU2A 2EUCA 1K82A 3U6SA 3VKHA 4LRSA 3VK7A 4B7GA 1IBLM 3AFHA 3LMMA 1L1TA 1PJJA 3DA1A 3BOSA 2Q2EB 4FWDA 1G4AE 3VK8A 5E26A 2C5RA 1R7RA 3K92A 4FVMA 3HKPA 1NHGC 1FNNA 1X37A 1GLNA 2XZFA 2XFSA 4FCTA 4FD2A 2KA6B 2FOIC 5ITQA 3AL0C 3D8BA 4B3RM 4LF5M 2OQ4A 1H6UA 3U6DA 2I7NA 4BBAA 4PCZA 4IBCA 5DYGA 4B3MM 4QOZC 2X4AA 3SAVA 5C1BA 4ITQA 2Y2HA 3PNYA 1GL6A 2HL7A 5JI3E 1R2ZA 1IXZA 3GPPA 4AG5A 1MU5A 1QZMA 1XMOM 3FTFA 2DHRA 4IIWA 4B3TM 4EIWA 2Y2LA 2Y0TA 5DNYA 4NYYA 2RGOA 4JI7M 1DO2A 4I81A 3AOEC 4DUYM 5IT9S 4B7HA 5EQTA 1HQYE 4KODA 4IBDA 4JI1M 7CATA 2LWXA 2BNKA 4QHTA 3CF0A 2YNMD 2DWNA 3T15A 4LJ9A 3KSJA 3HU3A 3LQRA 1I94M 2Y2GA 1JQJC 2DWZB 4LZZA 1L2CA 1ORYB 2Y20A 2LNHC 2R4JA 4GHAA 3PVSA 1I4WA 3I4VA 1YUBA 2R4EA 4A3VB 4LFCM 3R8FA 4JI5M 3Q8XA 4W5WA 4MGHA 4PDIA 1TH2A 1YUEA 8CATA 2G5GX 3GLFB 3J80S 3E9SA 2XZUA 2HKJA 1Q3CA 5EJCA 2ZAMA 4I5SA 3SHGB 4NZ1A 4QNLA 1TGUA 2CUZA 1XXHA 1QVRA 3U6MA 1N75A 2Y2KA 3THGA 3A45A 3U5ZB 4LCBA 4NSRA 4LY6A 4NL4H 3U5ZA 2XD5A 3TWMA 3FTCA 3KVWA 2C9CA 2VIIA 4NZ3A 2RGHA 5KPRA 1SXJC 2CHGA 2XH9A 4G4QA 3KDSE 4OJ6A 2BJVA 2KEBA 4LJAA 1HR0M 1IN5A 2CEAA 3A98B 2LXEA 3KFUG 3U6EA 2L09A 4X66M 4JI3M 3GP1A 4LF9M 3HSHA 3SASA 1QYRA 3KOZE 3VFDA 4CISA 1XC8A 3K8ZA 2QP9X 2KW0A 2KXEA 3KSXA 4TUWA 4OUIA 5FTKA 5ITRA 1S3SA 4GC9A 1DGHB 4PD2A 4Z8XA 2EO2A 4JYAM 3WHKA 5E6JA 2CHVA 4DUZM 5EXXA 1L8QA 1ZQ9A 4LJ5A 2KRUA 1K3WA 2DWLA 4OX9M 1DGHA 1XNRM 4X65M 2HCBA 4NRVA 4DV6M 4LJ6A 3J27B 4GH9A 2D7HA 2QCUA 3GLGB 5IWAM 2I7PA 2NQ8C 3M0EA 4REZA 3HHZA 3HU1A 1YU3A 5ITUA 2F5SA 3HWSA 2LH0A 2G8LA 3UK6A 3EIEA 5LMNM 4AW4A 3U60B 1DO0A 4CHTB 3C58A 1IY2A 3J7AS 1DGFA 4FCVA 3VDPA 3GLHB 1Z5AA 1UM8A 2V1UA 3U6PA 1Q3BA 2DZNB 2R62A 3HJ8A 4IBJA 3QWLA 3SAUA 2FE8A 2XEPA 4L78A 3HHWA 1KSFX 5IZ7D 3SATA 2CV2A 4FWGA 3GLHA 4RF1A 3ZH9B 3L27A 3KP0E 1IY1A 3GPYA 4NXMM 2Z4SA 1Z5CA 5BPVA 3UGJA 1E9SA 2C9OA 1G59A 2XF3A 1IM2A 1Z6TA 1YU1A 2BJWA 1K3XA 1N33M 3L2AA 3FKEA 3GRVA 2V1CA 4LFAM 2A5YB 2Y2PA 4LJ8A 1E32A 3RGPA 4FW9A 2JCHA 3GQ3A 3QAUA 4G6ZA 3FUVA 2Y2IA 1GVNA 3FTEA 2EA0A 1NVMA 1NY6A 3SHFA 1NSFA 5FTJA 2DWMA 4NOOB 5H37D 5DYIA 3CF2A 1HNWM 1QAQA 4JXJA 3UZUA 3OTOM 2H1RA 2D7EA 4LFBM 4B08A 2OPFA 5IREB 3MHVC 4JI6M 4QNMA 4QOSA 2Y2OA 3H4MA 1VDDA 1N32M 3AOEA 4OU7A 3GO8A 3AV0A 1IXSB 3NWLA 1WXQA 3UMMA 1D2NA 4OJOA 5A2QS 4JI0M 1HNXM 1G8PA 5EP1A 5FTMA 2XD1A 4KLNA 3LVVA 4AQYM 1QAOA 2KZUA 1N78A 2ZAOA 1GL7A 3DFZA 3LQQA 4LGMA 1YE9A 4B7FA 4DV2M 2F4VM 2CFOA 5BR8M 1IBKM 2UUBM 2ZM6M 3L28A 5C18A 1NHWC 2JE5A 4M9XA 3GLGA 1SXJD 3VKGA 2UXBM 4BB9A 3PFIA 3I51A 5ITXA 1E94E 1HQCA 2VQEM 1SXJA 4DV3M 4IBFA 3SFZA 1QAMA 1NY5A 4LZJA 5EP4A 2R45A 5FSWA 4M9ZA 2QENA 5ITYA 1XMQM 1YU4A 1R6BX 5F3WA 3U61A 2DZOB 4HL4A 4L16A 4JN6A 3VLFB 2P5TA 4IBEA 2J7NA 3MJ5A 3KOWE 3KOXE 2DXIA 4DV4M 1G3IA 4AKHA 2FFJA 3L29A 5FTLA 1L1ZA 2R18A 2X8AA 2ZBKB 1TDHA 2F5OA 2HHHM 2K47A 4MH0E 4DR3M 4DV5M 4GHLA 4DR7M 2M60A 4PT5A 4LRTA 2Z3XA 4GMQA 4G4NA 4GKKM 5EP3A 3M6AA 2KRKA 4JI2M 4NZ4A 1LV7A 4D82A 4YY3M 4DV1M 4CGYB 4R7GA 1C1KA 1Z5BA 3KS8A 5EP2A 4YHHM 5EXPA 1XXHB 4M9SA 1KYIA 4GRIA 3TWKA 1YSYA 4IBKA 2VQFM 4L4UA 4MB7A 3GRRA 3KS4A 3B9PA 1SXJB 3FUXA 3U6LA 3HONA 5KQ8A 3FYDA 4P16A 3W0LB 4NYUA 3U6QA 4L8RC 2DVWB 4QHSA 4RNAA 4AKGA 3WX7A 3DOAA 3GPUA 4GC5A 1IY0A 4JI8M 2IOUA 2C96A 3DZDA 2Y0QA 3GLIA 1IXRC 3UJNA 4AZFA 3U6OA 4DR6M 3GPXA 3ILKA 4WW0A 3T1HM 1N34M 3FUWA 3FD9A 3LVWA 1XNQM 4DV0M 4GKJM 1MX0A 4QNRA 4LJ4A 4LGYA 1N36M 4LJ7A 2KZSA 1KFVA 1JR3D 5EXSA 3ZC7B 2UXCM 4OW0A 2BG1A 4X64M 4I8OA 1QQWA 3TWLA 3L26A 2V6ZM 3VDUA 3TQSA 1IN7A 3U60A 3J7BA 3A42A 3AOGA 1NNUC 5LMUM 4OJ5A 4LF6M 3SMPA 2UUAM 1IN4A 3J2PB 5KO3A 4LF4M 3CF6E 4JV5M 4AI6A 2XSZA 3RE8A 4IBGA 4II7A 4BLCA 4OVZA 3W0FA 4MM3B 3FUTA 4MGIE 2UU9M 5EXTA 3ZCBB 4DR5M 2D7GA 2XSZD 2Y2QA 2F5QA 4KO8A 2W82A 2F5NA 3SARA 4IJFA 4NXNM 1SXJE 5FLXS 3T1YM 4LF8M 4NZ5A 3IG5A 3M7GA 3HU2A 4AG6A 3HHYA 3KOYE 2XFTA 1NJGA 2QPAA 1FJGM 5KPTA 3K2LA 5FTNA 4I4LA 4KHPM 1IN8A 2CV0A 1IQPA 3HGIA 4PDGA 1OFHA 1G41A 2CE7A 3JR5A 3SC3A 2FFFB 2ERCA 4M0DA 3HJSA 4LF7M 4XGIA 1L2DA 1HT2E 4DR2M 4DR1M 3T38A 2L7IA 3IG8A 4B3SM 3AJIB 2R46A 3GQ5A 4WURA 3SYLA 4FWHA 5JI2E 1TH3A 4S12A 2XGNA 4FCWA 4MGKE 1DGGA 3TE6A 3RFWA 4IBBA 3KW6A 2UWXA 3FTDA 1NJFA 3GRUA 1L2BA 2Z7JA 2R65A 3L25A 2C99A 3GLIB 1XWIA 3PXGA 3R9XB 2CHQA 4IJEA 3SYKA 3JAMS 1TDZA 2JA2A 2L6OA 4R3DA 3U61B 4D80A 1IN6A 3HJQA 3SAWA 1EE8A 1PM5A 2RKOA 3K1JA 2UUCM 3D8LA 1IBMM 2C98A 2YFQA 2ZANA 3TPZA 4GITA 3MK6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IBJ A;  4IBE A;  4IBB A;  3KS8 A;  3L28 A;  3L27 A;  3L25 A;  4GH9 A;  4IBI A;  4IBG A;  5BPV A;  4IJE A;  4IBD A;  3L29 A;  3L2A A;  3FKE A;  4IBK A;  3KS4 A;  4IBF A;  4IJF A;  4GHL A;  4IBC A;  4LG2 A;  4GHA A;  3L26 A; 
#chains in the Genus database with same CATH topology
 2QZ4 A;  1CK7 A;  1PJI A;  3E46 A;  1ZAE A;  4NY2 A;  2WSF F;  1GKI A;  1HNZ M;  3PNV A;  4OJL A;  3SMS A;  2Z4R A;  2JXN A;  1R2Y A;  2Y21 A;  4HLQ A;  1NNJ A;  4DV7 M;  4ZPX A;  2DAE A;  1D0L A;  3U6C A;  4XBO A;  2O5R A;  4RF0 A;  3BBZ A;  2L7H A;  1Q39 A;  5KQD A;  3GLF A;  2DAI A;  3FYC A;  1TH4 A;  4L15 A;  2Y2M A;  1T6O A;  1W5T A;  1JR3 A;  1XXH E;  2XLJ A;  3GQ4 A;  2QBY A;  1GXD A;  1OJL A;  4NRW A;  4MGZ E;  2QBY B;  1W5S A;  2R6F A;  3E4R A;  3SBJ A;  2E5L M;  3N3F A;  4OUI A;  4NSO B;  1XHB A;  4LG2 A;  2D49 A;  2UXD M;  2J7O A;  1OFI A;  1N77 A;  2AHM A;  2FN2 A;  1VEJ A;  4OJP A;  2DEN A;  2M5Z A;  3I4Y A;  4DR4 M;  1T3T A;  2FNA A;  1Z59 A;  3J81 S;  3WHL A;  4JI4 M;  4M0W A;  4AKI A;  1YU0 A;  2Y2N A;  3GLG E;  3WD1 A;  1AIW A;  3GRY A;  3A46 A;  2F5P A;  5ITX E;  1GOI A;  1J5E M;  1J7K A;  3B89 A;  1QAN A;  3EIH A;  3RGS A;  1NV8 A;  4IBI A;  3FUU A;  3K9O A;  4MGY E;  4OVZ B;  5ITT A;  1ED7 A;  2X49 A;  4D81 A;  5KPZ A;  1HT1 E;  2DAK A;  4G4R A;  4K0K M;  4HME A;  2HWJ A;  1E9R A;  3W67 A;  4X62 M;  2YR0 A;  3HHX A;  1V34 A;  1VG5 A;  3KP1 E;  4GIP A;  1J09 A;  4Z6Y A;  3NBI A;  5GKN A;  3JR4 A;  2MJ5 B;  3TL4 X;  3AKZ A;  3KXE C;  1DGB A;  2CV1 A;  2Y2J A;  2MH8 A;  2YQZ A;  4WP2 A;  4G4O A;  2JUJ A;  3CTW B;  1YU2 A;  2EUC A;  1K82 A;  3U6S A;  3VKH A;  2BWE A;  3BXW A;  1Q02 A;  4LRS A;  4B7G A;  3VK7 A;  3AFH A;  1IBL M;  3LMM A;  1L1T A;  1PJJ A;  3DA1 A;  1EFU B;  2LVA A;  3BOS A;  2Q2E B;  2G3Q A;  1GJT A;  4FWD A;  1G4A E;  3VK8 A;  5E26 A;  2C5R A;  1R7R A;  3K92 A;  4MB3 A;  4FVM A;  3HKP A;  1NHG C;  1FNN A;  1X37 A;  1GLN A;  1OKS A;  2XFS A;  4FCT A;  4FD2 A;  2KA6 B;  2XZF A;  2FOI C;  5ITQ A;  1UFZ A;  3AL0 C;  1KS0 A;  1OTR A;  3D8B A;  4B3R M;  4LF5 M;  1L6J A;  2OQ4 A;  1H6U A;  3CGW A;  3U6D A;  2I7N A;  4BBA A;  4PCZ A;  4IBC A;  2KNZ A;  5DYG A;  1ZV1 A;  4B3M M;  2DAG A;  2JY5 A;  2X4A A;  4QOZ C;  3SAV A;  5C1B A;  4ITQ A;  2B3T A;  1E15 A;  2Y2H A;  1GL6 A;  3PNY A;  2HL7 A;  5JI3 E;  4Z2L A;  2L2D A;  1R2Z A;  2CWB A;  1IXZ A;  4Z2G A;  3GPP A;  4AG5 A;  1MU5 A;  1QZM A;  1XMO M;  3FTF A;  2DHR A;  4IIW A;  4B3T M;  4EIW A;  2Y2L A;  2Y0T A;  5DNY A;  4NYY A;  2RGO A;  4JI7 M;  1DO2 A;  4I81 A;  3AOE C;  1T43 A;  4DUY M;  5IT9 S;  4B7H A;  4R71 A;  5EQT A;  2J5Y A;  1HQY E;  4KOD A;  4IBD A;  4JI1 M;  3H4J A;  7CAT A;  2LWX A;  2BNK A;  4QHT A;  1VEK A;  3CF0 A;  2YNM D;  2DWN A;  3T15 A;  4LJ9 A;  3KSJ A;  4MB5 A;  3HU3 A;  3LQR A;  1G71 A;  1I94 M;  2K0B X;  2Y2G A;  1JQJ C;  2DWZ B;  4LZZ A;  1L2C A;  1ORY B;  2Y20 A;  3MMP A;  2LNH C;  2R4J A;  4GHA A;  2GNO A;  1I4W A;  3PVS A;  3I4V A;  3HY5 A;  1YUB A;  2R4E A;  4A3V B;  4LFC M;  3R8F A;  4JI5 M;  3Q8X A;  4W5W A;  4MGH A;  4PDI A;  1TH2 A;  2JZ0 A;  3WD0 A;  1YUE A;  8CAT A;  2FH0 A;  2G5G X;  3GLF B;  1PJT A;  3J80 S;  1IFY A;  1C7Y A;  2EJS A;  1D0M A;  1QUS A;  3E9S A;  2XZU A;  1JB0 F;  2HKJ A;  1Q3C A;  4RKU F;  2OOB A;  5EJC A;  2ZAM A;  4I5S A;  3SHG B;  4NZ1 A;  2BWB A;  4QNL A;  1TGU A;  5DFL A;  2CUZ A;  2DI0 A;  1XXH A;  1QVR A;  2WZJ A;  1YLA A;  1N75 A;  3U6M A;  2Y2K A;  3E21 A;  3THG A;  3A45 A;  3U5Z B;  4LCB A;  4NSR A;  4LY6 A;  4NL4 H;  3U5Z A;  2XD5 A;  3TWM A;  3FTC A;  3KVW A;  2C9C A;  3LW5 F;  2VII A;  4NZ3 A;  4L6V 6;  2RGH A;  2H5X A;  2DAM A;  2O01 F;  5KPR A;  1SXJ C;  2CHG A;  2XH9 A;  2MR9 A;  3KDS E;  3QYE A;  4G4Q A;  2BJV A;  1VEG A;  2KEB A;  4LJA A;  1HR0 M;  1GO5 A;  1IN5 A;  2CEA A;  1E8B A;  1E6Z A;  3A98 B;  3B74 A;  2LXE A;  3KFU G;  4XK8 F;  3U6E A;  1W1P A;  2L09 A;  4X66 M;  4JI3 M;  1IXS A;  3GP1 A;  4LF9 M;  3HSH A;  1WJ7 A;  3WD4 A;  3SAS A;  1QYR A;  1GPF A;  3KOZ E;  3VFD A;  4CIS A;  2R44 A;  1XC8 A;  3K8Z A;  2QP9 X;  2KW0 A;  2KXE A;  2JY8 A;  1AIP C;  2VF8 A;  2ZTC A;  3KSX A;  5FTK A;  4F1I A;  1S3S A;  1AUA A;  1DGH B;  2JWS A;  4GC9 A;  4Z8X A;  2EO2 A;  4PD2 A;  5ITR A;  4JYA M;  3WHK A;  5E6J A;  2CHV A;  4DUZ M;  5EXX A;  2CP8 A;  1L8Q A;  1ZQ9 A;  4KT0 F;  4LJ5 A;  2KRU A;  2DKL A;  4DBG B;  1K3W A;  2DWL A;  4OX9 M;  1DGH A;  1XNR M;  4X65 M;  4MB4 A;  3GLF E;  2HCB A;  4NRV A;  4DV6 M;  2MGW A;  2LVO C;  1EIJ A;  4LJ6 A;  3J27 B;  1A5T A;  4GH9 A;  2D7H A;  2QCU A;  3GLG B;  5IWA M;  1HJP A;  2I7P A;  2NQ8 C;  3M0E A;  1PRB A;  4REZ A;  3HHZ A;  3HU1 A;  3B7Q A;  1YU3 A;  1F4I A;  5ITU A;  1OQY A;  2F5S A;  3HWS A;  2LH0 A;  2G8L A;  4TUW A;  3UK6 A;  3EIE A;  2JY6 B;  5LMN M;  4AW4 A;  3U60 B;  2ZTD A;  1DO0 A;  4CHT B;  3C58 A;  1IY2 A;  3J7A S;  1DGF A;  4FCV A;  3VDP A;  3GLH B;  1Z5A A;  1UM8 A;  3IHP A;  2V5O A;  2V1U A;  3U6P A;  1Q3B A;  2DZN B;  2R62 A;  3HJ8 A;  3Q8G A;  3QWL A;  4IBJ A;  2FE8 A;  2XEP A;  3SAU A;  4Z2H A;  4L78 A;  1CUK A;  3HHW A;  1KSF X;  5IZ7 D;  3SAT A;  2CV2 A;  1OIP A;  4FWG A;  3GLH A;  4RF1 A;  3ZH9 B;  1PJQ A;  3KP0 E;  1IY1 A;  3L27 A;  3GPY A;  1TTE A;  1Z5C A;  2Z4S A;  3FRH A;  4NXM M;  5BPV A;  3UGJ A;  1E9S A;  2C9O A;  1J7M A;  1G59 A;  2XF3 A;  1IM2 A;  1Z6T A;  1YU1 A;  2KNV A;  2BJW A;  1K3X A;  1N33 M;  3L2A A;  3FKE A;  3GRV A;  2V1C A;  4LFA M;  2A5Y B;  1WHC A;  2Y2P A;  3WD2 A;  1WR1 B;  4LJ8 A;  1NO1 A;  1E32 A;  3I01 M;  3RGP A;  4FW9 A;  2JCH A;  3GQ3 A;  3QAU A;  4G6Z A;  3FUV A;  2Y2I A;  1ZMW A;  1GVN A;  3F92 A;  2EA0 A;  2APL A;  1NVM A;  1NY6 A;  2VDB B;  3QYB A;  3SHF A;  3FTE A;  1NSF A;  1LTM A;  1PJS A;  5FTJ A;  5L8R F;  4NOO B;  2DWM A;  5H37 D;  5DYI A;  3CF2 A;  4ANR A;  1HNW M;  1QAQ A;  4JXJ A;  3UZU A;  3OTO M;  2H1R A;  2D7E A;  1P3Q Q;  4LFB M;  4B08 A;  2OPF A;  3B7N A;  3MHV C;  5IRE B;  4JI6 M;  1OIZ A;  4QNM A;  4QOS A;  2Y2O A;  3H4M A;  1JR3 E;  1VDD A;  1N32 M;  3AOE A;  1QO6 A;  2RTS A;  4OU7 A;  3GO8 A;  3AV0 A;  1IXS B;  3NWL A;  1WXQ A;  1VDL A;  3UMM A;  1D2N A;  1OAO C;  4OJO A;  2QQ8 A;  5A2Q S;  1D0K A;  4JI0 M;  1HNX M;  1G8P A;  5EP1 A;  5FTM A;  2XD1 A;  4KLN A;  3LVV A;  4AQY M;  1QZE A;  3GLH E;  1QAO A;  2LTU A;  2KZU A;  1N78 A;  2ZAO A;  1GL7 A;  3DFZ A;  3LQQ A;  4LGM A;  1YE9 A;  2KHH A;  4B7F A;  4DV2 M;  2F4V M;  2CFO A;  2Z8Y M;  5BR8 M;  1IBK M;  2UUB M;  2ZM6 M;  2LHC A;  3L28 A;  5C18 A;  1NHW C;  2QSF X;  2JE5 A;  4Z2J A;  2OO9 A;  3NBX X;  4M9X A;  3GLG A;  1SXJ D;  3VKG A;  2UXB M;  4BB9 A;  2K6B A;  1GAB A;  3PFI A;  3I51 A;  5ITX A;  1E94 E;  1HQC A;  2VQE M;  3WD3 A;  1SXJ A;  4DV3 M;  1DV0 A;  4IBF A;  4HMD A;  3SFZ A;  2JP7 A;  1QAM A;  1NY5 A;  4LZJ A;  5EP4 A;  2R45 A;  1W1Y A;  5FSW A;  4M9Z A;  2QEN A;  3C3E A;  5ITY A;  1XMQ M;  2GQF A;  1EAK A;  1YU4 A;  1R6B X;  5F3W A;  3U61 A;  2DZO B;  4HL4 A;  4L16 A;  4JN6 A;  3VLF B;  3IEC A;  2P5T A;  4IBE A;  2J7N A;  3MJ5 A;  3KOW E;  3KOX E;  2DXI A;  2DNA A;  4DV4 M;  1V33 A;  2DHY A;  1G3I A;  4AKH A;  2FFJ A;  1TR8 A;  1H0I A;  3HX3 A;  3L29 A;  5FTL A;  1L1Z A;  2R18 A;  2X8A A;  2ZBK B;  1TDH A;  2F5O A;  1QDR A;  2K47 A;  4MH0 E;  2HHH M;  1H0G A;  4DR3 M;  1R4G A;  4DV5 M;  4GHL A;  4DR7 M;  2M60 A;  4PT5 A;  4LRT A;  1R5L A;  2Z3X A;  4GMQ A;  3K9P A;  4G4N A;  4GKK M;  5EP3 A;  3M6A A;  2KRK A;  2QHO B;  4Q7J A;  1LV7 A;  4D82 A;  4JI2 M;  1RU3 A;  4YY3 M;  4NZ4 A;  4DV1 M;  4CGY B;  1PDC A;  4R7G A;  2MRO B;  1C1K A;  1Z5B A;  1H8P A;  2HAK A;  3KS8 A;  5EP2 A;  4YHH M;  5EXP A;  1MN3 A;  1XXH B;  4M9S A;  4OJ6 A;  1WGN A;  2QNJ A;  1OGB A;  1KYI A;  1NV9 A;  4GRI A;  3TWK A;  1YSY A;  4IBK A;  2VQF M;  4L4U A;  4MB7 A;  2VF7 A;  1OAI A;  3GRR A;  3KS4 A;  3B9P A;  1SXJ B;  3FUX A;  3U6L A;  3HON A;  5KQ8 A;  3FYD A;  4P16 A;  1WGL A;  1ZMU A;  3W0L B;  4NYU A;  2FS1 A;  3M7P A;  2LHG A;  3U6Q A;  4L8R C;  1VQ1 A;  2DVW B;  4QHS A;  4RNA A;  2DZL A;  4AKG A;  2N35 A;  4GEW A;  3W68 A;  3WX7 A;  3DOA A;  3GPU A;  4GC5 A;  1IY0 A;  4JI8 M;  2LVQ D;  2IOU A;  2C96 A;  3DZD A;  2Y0Q A;  3GLI A;  1IXR C;  3UJN A;  4AZF A;  3U6O A;  4DR6 M;  3LCU A;  3ILK A;  3GPX A;  1GJS A;  4WW0 A;  3T1H M;  1N34 M;  3FUW A;  3FD9 A;  2EKK A;  3LVW A;  1XNQ M;  4DV0 M;  2LBC A;  2K9D A;  4GKJ M;  1MX0 A;  1ZMV A;  4QNR A;  2R0I A;  4LJ4 A;  4LGY A;  1N36 M;  4LJ7 A;  2KZS A;  1KFV A;  1JR3 D;  5EXS A;  3ZC7 B;  2JZ1 A;  4CJ6 A;  2UXC M;  1W1V A;  4OW0 A;  2BG1 A;  4X64 M;  4I8O A;  1QQW A;  2JNH A;  4F2L A;  2CRU A;  3TWL A;  1QDT A;  2WSE F;  3L26 A;  2V6Z M;  3VDU A;  3TQS A;  1IN7 A;  1TF0 B;  3J7B A;  3U60 A;  4Z2K A;  2L4E A;  3A42 A;  3AOG A;  1NNU C;  5LMU M;  4OJ5 A;  1OGG A;  4LF6 M;  3SMP A;  2UUA M;  1IN4 A;  3J2P B;  5KO3 A;  4LF4 M;  3CF6 E;  4JV5 M;  3V76 A;  2XSZ A;  3RE8 A;  2RRU A;  4IBG A;  4II7 A;  2O25 A;  4BLC A;  4AI6 A;  1E6P A;  4HMC A;  4OVZ A;  3W0F A;  4MM3 B;  3FUT A;  4MGI E;  2UU9 M;  5EXT A;  3ZCB B;  4DR5 M;  2D7G A;  2XSZ D;  2Y2Q A;  4P17 A;  4UN2 B;  2F5Q A;  4KO8 A;  2W82 A;  2F5N A;  3SAR A;  4IJF A;  4NXN M;  1SXJ E;  4HEO A;  3I04 M;  1Y8G A;  5FLX S;  3T1Y M;  4LF8 M;  4NZ5 A;  3IG5 A;  1CXW A;  3M7G A;  3HU2 A;  4AG6 A;  1O6I A;  3HHY A;  3KOY E;  1MJG M;  1NJG A;  2XFT A;  3FRI A;  2QPA A;  1FJG M;  4TX8 A;  5KPT A;  1XB2 B;  3K2L A;  5FTN A;  4I4L A;  2OOA A;  4KHP M;  1IN8 A;  2CV0 A;  1IQP A;  3HGI A;  4PDG A;  1E88 A;  1OFH A;  1G41 A;  2CE7 A;  1W1T A;  3GLI E;  3JR5 A;  3SC3 A;  2FFF B;  3B7Z A;  2ERC A;  4M0D A;  4NC6 A;  3HJS A;  1V92 A;  4LF7 M;  4XGI A;  1L2D A;  1HT2 E;  4DR2 M;  4DR1 M;  3T38 A;  2L7I A;  3IG8 A;  1WIV A;  4G3O A;  3T6P A;  4B3S M;  1UR8 A;  1E6R A;  3AJI B;  2L4F A;  2R46 A;  3GQ5 A;  2EKF A;  4WUR A;  3SYL A;  4FWH A;  5JI2 E;  1TH3 A;  3HZJ A;  1SG9 A;  4S12 A;  2XGN A;  4FCW A;  4MGK E;  2LVN C;  1DGG A;  3TE6 A;  4Z2I A;  3FE3 A;  3RFW A;  4IBB A;  3KW6 A;  4Y28 F;  2KNA A;  3FTD A;  1NJF A;  3GRU A;  2LVP C;  3C3D A;  2UWX A;  1L2B A;  2Z7J A;  2KDL A;  3MQL A;  2R65 A;  3L25 A;  1QUT A;  4CIZ A;  3LCV B;  2C99 A;  3GLI B;  1XWI A;  2JY7 A;  3PXG A;  3R9X B;  2CHQ A;  4IJE A;  3SYK A;  3JAM S;  1TDZ A;  2JA2 A;  2L6O A;  4R3D A;  1UR9 A;  3U61 B;  4D80 A;  1IN6 A;  3C9P A;  3HJQ A;  1PGY A;  1EE8 A;  3SAW A;  1BVS A;  1PM5 A;  2RKO A;  3K1J A;  2WSC F;  2UUC M;  3D8L A;  1IBM M;  1E6N A;  2C98 A;  2YFQ A;  2ZAN A;  3ZQJ A;  3TPZ A;  4GIT A;  3MK6 A; 
#chains in the Genus database with same CATH homology
 2QZ4 A;  1PJI A;  1ZAE A;  4NY2 A;  1GKI A;  1HNZ M;  3PNV A;  4OJL A;  3SMS A;  2Z4R A;  1R2Y A;  2Y21 A;  4HLQ A;  1NNJ A;  4DV7 M;  4ZPX A;  3U6C A;  4XBO A;  2O5R A;  4RF0 A;  2L7H A;  1Q39 A;  5KQD A;  3GLF A;  3FYC A;  1TH4 A;  4L15 A;  2Y2M A;  1W5T A;  1JR3 A;  2XLJ A;  3GQ4 A;  2QBY A;  1OJL A;  4NRW A;  4MGZ E;  2QBY B;  1W5S A;  3SBJ A;  3E4R A;  2E5L M;  3N3F A;  4NSO B;  1XHB A;  4LG2 A;  2UXD M;  2J7O A;  1OFI A;  1N77 A;  2AHM A;  4OJP A;  4DR4 M;  2M5Z A;  3I4Y A;  1YU0 A;  1T3T A;  2FNA A;  1Z59 A;  3J81 S;  3WHL A;  4JI4 M;  4M0W A;  4AKI A;  2Y2N A;  3GRY A;  3A46 A;  2F5P A;  5ITX E;  1J5E M;  1J7K A;  3EIH A;  1QAN A;  3RGS A;  4IBI A;  3FUU A;  4MGY E;  4OVZ B;  5ITT A;  2X49 A;  4D81 A;  5KPZ A;  1HT1 E;  4G4R A;  4K0K M;  4X62 M;  1E9R A;  2YR0 A;  3HHX A;  3KP1 E;  4GIP A;  1J09 A;  4Z6Y A;  3NBI A;  5GKN A;  3JR4 A;  3AKZ A;  3TL4 X;  3KXE C;  1DGB A;  2CV1 A;  2Y2J A;  2YQZ A;  4G4O A;  3CTW B;  1YU2 A;  2EUC A;  1K82 A;  3U6S A;  3VKH A;  4LRS A;  3VK7 A;  4B7G A;  1IBL M;  3AFH A;  3LMM A;  1L1T A;  1PJJ A;  3DA1 A;  3BOS A;  2Q2E B;  4FWD A;  1G4A E;  3VK8 A;  5E26 A;  2C5R A;  1R7R A;  3K92 A;  4FVM A;  3HKP A;  1NHG C;  1FNN A;  1X37 A;  1GLN A;  2XZF A;  2XFS A;  4FCT A;  4FD2 A;  2KA6 B;  2FOI C;  5ITQ A;  3AL0 C;  3D8B A;  4B3R M;  4LF5 M;  2OQ4 A;  1H6U A;  3U6D A;  2I7N A;  4BBA A;  4PCZ A;  4IBC A;  5DYG A;  4B3M M;  4QOZ C;  2X4A A;  3SAV A;  5C1B A;  4ITQ A;  2Y2H A;  3PNY A;  1GL6 A;  2HL7 A;  5JI3 E;  1R2Z A;  1IXZ A;  3GPP A;  4AG5 A;  1MU5 A;  1QZM A;  1XMO M;  3FTF A;  2DHR A;  4IIW A;  4B3T M;  4EIW A;  2Y2L A;  2Y0T A;  5DNY A;  4NYY A;  2RGO A;  4JI7 M;  1DO2 A;  4I81 A;  3AOE C;  4DUY M;  5IT9 S;  4B7H A;  5EQT A;  1HQY E;  4KOD A;  4IBD A;  4JI1 M;  7CAT A;  2LWX A;  2BNK A;  4QHT A;  3CF0 A;  2YNM D;  2DWN A;  3T15 A;  4LJ9 A;  3KSJ A;  3HU3 A;  3LQR A;  1I94 M;  2Y2G A;  1JQJ C;  2DWZ B;  4LZZ A;  1L2C A;  1ORY B;  2Y20 A;  2LNH C;  2R4J A;  4GHA A;  3PVS A;  1I4W A;  3I4V A;  1YUB A;  2R4E A;  4A3V B;  4LFC M;  3R8F A;  4JI5 M;  3Q8X A;  4W5W A;  4MGH A;  4PDI A;  1TH2 A;  1YUE A;  8CAT A;  2G5G X;  3GLF B;  3J80 S;  3E9S A;  2XZU A;  2HKJ A;  1Q3C A;  5EJC A;  2ZAM A;  4I5S A;  3SHG B;  4NZ1 A;  4QNL A;  1TGU A;  2CUZ A;  1XXH A;  1QVR A;  3U6M A;  1N75 A;  2Y2K A;  3THG A;  3A45 A;  3U5Z B;  4LCB A;  4NSR A;  4LY6 A;  4NL4 H;  3U5Z A;  2XD5 A;  3TWM A;  3FTC A;  3KVW A;  2C9C A;  2VII A;  4NZ3 A;  2RGH A;  5KPR A;  1SXJ C;  2CHG A;  2XH9 A;  4G4Q A;  3KDS E;  4OJ6 A;  2BJV A;  2KEB A;  4LJA A;  1HR0 M;  1IN5 A;  2CEA A;  3A98 B;  2LXE A;  3KFU G;  3U6E A;  2L09 A;  4X66 M;  4JI3 M;  3GP1 A;  4LF9 M;  3HSH A;  3SAS A;  1QYR A;  3KOZ E;  3VFD A;  4CIS A;  1XC8 A;  3K8Z A;  2QP9 X;  2KW0 A;  2KXE A;  3KSX A;  4TUW A;  4OUI A;  5FTK A;  5ITR A;  1S3S A;  4GC9 A;  1DGH B;  4PD2 A;  4Z8X A;  2EO2 A;  4JYA M;  3WHK A;  5E6J A;  2CHV A;  4DUZ M;  5EXX A;  1L8Q A;  1ZQ9 A;  4LJ5 A;  2KRU A;  1K3W A;  2DWL A;  4OX9 M;  1DGH A;  1XNR M;  4X65 M;  2HCB A;  4NRV A;  4DV6 M;  4LJ6 A;  3J27 B;  4GH9 A;  2D7H A;  2QCU A;  3GLG B;  5IWA M;  2I7P A;  2NQ8 C;  3M0E A;  4REZ A;  3HHZ A;  3HU1 A;  1YU3 A;  5ITU A;  2F5S A;  3HWS A;  2LH0 A;  2G8L A;  3UK6 A;  3EIE A;  5LMN M;  4AW4 A;  3U60 B;  1DO0 A;  4CHT B;  3C58 A;  1IY2 A;  3J7A S;  1DGF A;  4FCV A;  3VDP A;  3GLH B;  1Z5A A;  1UM8 A;  2V1U A;  3U6P A;  1Q3B A;  2DZN B;  2R62 A;  3HJ8 A;  4IBJ A;  3QWL A;  3SAU A;  2FE8 A;  2XEP A;  4L78 A;  3HHW A;  1KSF X;  5IZ7 D;  3SAT A;  2CV2 A;  4FWG A;  3GLH A;  4RF1 A;  3ZH9 B;  3L27 A;  3KP0 E;  1IY1 A;  3GPY A;  4NXM M;  2Z4S A;  1Z5C A;  5BPV A;  3UGJ A;  1E9S A;  2C9O A;  1G59 A;  2XF3 A;  1IM2 A;  1Z6T A;  1YU1 A;  2BJW A;  1K3X A;  1N33 M;  3L2A A;  3FKE A;  3GRV A;  2V1C A;  4LFA M;  2A5Y B;  2Y2P A;  4LJ8 A;  1E32 A;  3RGP A;  4FW9 A;  2JCH A;  3GQ3 A;  3QAU A;  4G6Z A;  3FUV A;  2Y2I A;  1GVN A;  3FTE A;  2EA0 A;  1NVM A;  1NY6 A;  3SHF A;  1NSF A;  5FTJ A;  2DWM A;  4NOO B;  5H37 D;  5DYI A;  3CF2 A;  1HNW M;  1QAQ A;  4JXJ A;  3UZU A;  3OTO M;  2H1R A;  2D7E A;  4LFB M;  4B08 A;  2OPF A;  5IRE B;  3MHV C;  4JI6 M;  4QNM A;  4QOS A;  2Y2O A;  3H4M A;  1VDD A;  1N32 M;  3AOE A;  4OU7 A;  3GO8 A;  3AV0 A;  1IXS B;  3NWL A;  1WXQ A;  3UMM A;  1D2N A;  4OJO A;  5A2Q S;  4JI0 M;  1HNX M;  1G8P A;  5EP1 A;  5FTM A;  2XD1 A;  4KLN A;  3LVV A;  4AQY M;  1QAO A;  2KZU A;  1N78 A;  2ZAO A;  1GL7 A;  3DFZ A;  3LQQ A;  4LGM A;  1YE9 A;  4B7F A;  4DV2 M;  2F4V M;  2CFO A;  5BR8 M;  1IBK M;  2UUB M;  2ZM6 M;  3L28 A;  5C18 A;  1NHW C;  2JE5 A;  4M9X A;  3GLG A;  1SXJ D;  3VKG A;  2UXB M;  4BB9 A;  3PFI A;  3I51 A;  5ITX A;  1E94 E;  1HQC A;  2VQE M;  1SXJ A;  4DV3 M;  4IBF A;  3SFZ A;  1QAM A;  1NY5 A;  4LZJ A;  5EP4 A;  2R45 A;  5FSW A;  4M9Z A;  2QEN A;  5ITY A;  1XMQ M;  1YU4 A;  1R6B X;  5F3W A;  3U61 A;  2DZO B;  4HL4 A;  4L16 A;  4JN6 A;  3VLF B;  2P5T A;  4IBE A;  2J7N A;  3MJ5 A;  3KOW E;  3KOX E;  2DXI A;  4DV4 M;  1G3I A;  4AKH A;  2FFJ A;  3L29 A;  5FTL A;  1L1Z A;  2R18 A;  2X8A A;  2ZBK B;  1TDH A;  2F5O A;  2HHH M;  2K47 A;  4MH0 E;  4DR3 M;  4DV5 M;  4GHL A;  4DR7 M;  2M60 A;  4PT5 A;  4LRT A;  2Z3X A;  4GMQ A;  4G4N A;  4GKK M;  5EP3 A;  3M6A A;  2KRK A;  4JI2 M;  4NZ4 A;  1LV7 A;  4D82 A;  4YY3 M;  4DV1 M;  4CGY B;  4R7G A;  1C1K A;  1Z5B A;  3KS8 A;  5EP2 A;  4YHH M;  5EXP A;  1XXH B;  4M9S A;  1KYI A;  4GRI A;  3TWK A;  1YSY A;  4IBK A;  2VQF M;  4L4U A;  4MB7 A;  3GRR A;  3KS4 A;  3B9P A;  1SXJ B;  3FUX A;  3U6L A;  3HON A;  5KQ8 A;  3FYD A;  4P16 A;  3W0L B;  4NYU A;  3U6Q A;  4L8R C;  2DVW B;  4QHS A;  4RNA A;  4AKG A;  3WX7 A;  3DOA A;  3GPU A;  4GC5 A;  1IY0 A;  4JI8 M;  2IOU A;  2C96 A;  3DZD A;  2Y0Q A;  3GLI A;  1IXR C;  3UJN A;  4AZF A;  3U6O A;  4DR6 M;  3GPX A;  3ILK A;  4WW0 A;  3T1H M;  1N34 M;  3FUW A;  3FD9 A;  3LVW A;  1XNQ M;  4DV0 M;  4GKJ M;  1MX0 A;  4QNR A;  4LJ4 A;  4LGY A;  1N36 M;  4LJ7 A;  2KZS A;  1KFV A;  1JR3 D;  5EXS A;  3ZC7 B;  2UXC M;  4OW0 A;  2BG1 A;  4X64 M;  4I8O A;  1QQW A;  3TWL A;  3L26 A;  2V6Z M;  3VDU A;  3TQS A;  1IN7 A;  3U60 A;  3J7B A;  3A42 A;  3AOG A;  1NNU C;  5LMU M;  4OJ5 A;  4LF6 M;  3SMP A;  2UUA M;  1IN4 A;  3J2P B;  5KO3 A;  4LF4 M;  3CF6 E;  4JV5 M;  4AI6 A;  2XSZ A;  3RE8 A;  4IBG A;  4II7 A;  4BLC A;  4OVZ A;  3W0F A;  4MM3 B;  3FUT A;  4MGI E;  2UU9 M;  5EXT A;  3ZCB B;  4DR5 M;  2D7G A;  2XSZ D;  2Y2Q A;  2F5Q A;  4KO8 A;  2W82 A;  2F5N A;  3SAR A;  4IJF A;  4NXN M;  1SXJ E;  5FLX S;  3T1Y M;  4LF8 M;  4NZ5 A;  3IG5 A;  3M7G A;  3HU2 A;  4AG6 A;  3HHY A;  3KOY E;  2XFT A;  1NJG A;  2QPA A;  1FJG M;  5KPT A;  3K2L A;  5FTN A;  4I4L A;  4KHP M;  1IN8 A;  2CV0 A;  1IQP A;  3HGI A;  4PDG A;  1OFH A;  1G41 A;  2CE7 A;  3JR5 A;  3SC3 A;  2FFF B;  2ERC A;  4M0D A;  3HJS A;  4LF7 M;  4XGI A;  1L2D A;  1HT2 E;  4DR2 M;  4DR1 M;  3T38 A;  2L7I A;  3IG8 A;  4B3S M;  3AJI B;  2R46 A;  3GQ5 A;  4WUR A;  3SYL A;  4FWH A;  5JI2 E;  1TH3 A;  4S12 A;  2XGN A;  4FCW A;  4MGK E;  1DGG A;  3TE6 A;  3RFW A;  4IBB A;  3KW6 A;  2UWX A;  3FTD A;  1NJF A;  3GRU A;  1L2B A;  2Z7J A;  2R65 A;  3L25 A;  2C99 A;  3GLI B;  1XWI A;  3PXG A;  3R9X B;  2CHQ A;  4IJE A;  3SYK A;  3JAM S;  1TDZ A;  2JA2 A;  2L6O A;  4R3D A;  3U61 B;  4D80 A;  1IN6 A;  3HJQ A;  3SAW A;  1EE8 A;  1PM5 A;  2RKO A;  3K1J A;  2UUC M;  3D8L A;  1IBM M;  2C98 A;  2YFQ A;  2ZAN A;  3TPZ A;  4GIT A;  3MK6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...