4GH9A

Crystal structure of marburg virus vp35 rna binding domain
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
122
structure length
122
Chain Sequence
LSAKDLALLLFTHLPGNNTPFHILAQVLSKIAYKSGKSGAFLDAFHQILSEGENAQAALTRLSRTFDAFLGVVPPVIRVKNFQTVPRPCQKSLRAVPPNPTIDKGWVCVYSSEQGETRALKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein,rna binding protein
molecule keywords Polymerase cofactor VP35
publication title Marburg Virus VP35 Can Both Fully Coat the Backbone and Cap the Ends of dsRNA for Interferon Antagonism.
pubmed doi rcsb
source organism Marburg virus
total genus 42
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2012-08-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4gh9A01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4gh9A02
4GHAA 4GHLA 3L27A 4IBDA 4IBBA 4LG2A 5BPVA 4IBEA 4IBCA 4GH9A 4IBJA 3L28A 3FKEA 3L2AA 3KS4A 4IBGA 3L26A 4IBKA 3L25A 4IBIA 4IJFA 3L29A 4IBFA 4IJEA 3KS8A
chains in the Genus database with same CATH superfamily
5FTJA 1PJQA 3FUVA 2UUBM 3HSHA 1L1ZA 2VQFM 3HHYA 1QZEA 2HL7A 3FRHA 4FWHA 3RGSA 3W68A 3J81S 3GLFE 2HAKA 3UJNA 2XH9A 4LF8M 1GL7A 4B7HA 4LG2A 2RTSA 3M7PA 1QAOA 1H8PA 1KSFX 1DO0A 2DZLA 2RRUA 4B3SM 3CGWA 3EIHA 2LH0A 3VKHA 3U60A 2C96A 2DNAA 5IZ7D 3LQQA 1GKIA 1Z5BA 2LVNC 1W1TA 3I51A 1Z6TA 3E9SA 2N35A 4DV7M 1N34M 2Z4SA 1SXJA 1VQ1A 3BXWA 3HZJA 3ILKA 3SMPA 1KS0A 3J7AS 1DGFA 1TTEA 3VK8A 2XF3A 1AIWA 1S3SA 2MR9A 3MHVC 1OFIA 2C5RA 1C1KA 1H0IA 2QCUA 2KHHA 1TR8A 1XB2B 3WD0A 2JY5A 5C1BA 4CHTB 1IBKM 2DZOB 3U6QA 2OO9A 1IXRC 2M60A 4WURA 3J80S 2KEBA 4LF7M 2DWLA 3IG8A 4Z2KA 1T43A 2Z7JA 4RKUF 2L6OA 4W5WA 5ITRA 1W1YA 4FCVA 2P5TA 5GKNA 3JR5A 1GJSA 1IXSA 2R65A 3HGIA 3D8LA 3SMSA 1QQWA 5KPZA 5ITUA 3GQ5A 1HNWM 1Z5CA 3L25A 1YU2A 2DHYA 2FNAA 2QSFX 1PM5A 3PNVA 4LZZA 4DV4M 2FE8A 3T1HM 4LF6M 5H37D 4DV2M 4AI6A 3GQ4A 2D7GA 4G4QA 1JB0F 4NZ4A 4GC5A 4JI5M 4NRVA 2Z3XA 2Y2IA 1TH2A 2M5ZA 3K92A 3RFWA 3K8ZA 2Q2EB 1IXZA 1WIVA 2FOIC 2MROB 1QUTA 4FWGA 3A42A 1HT1E 2JZ1A 3HX3A 1IM2A 5IREB 3BOSA 4RF0A 1G41A 4DV5M 1OGGA 4LGYA 5ITYA 4WW0A 1R7RA 5KQDA 3T1YM 4A3VB 1DV0A 4FD2A 2UXDM 2KA6B 2LXEA 1IN4A 4B08A 3L26A 1G4AE 1QANA 2FH0A 2KNZA 2KNVA 4ANRA 2ZM6M 4P17A 3U61A 2JA2A 3WD2A 1T6OA 2VDBB 5F3WA 1A5TA 1OIZA 1XMOM 3UZUA 2DWZB 1OKSA 3PXGA 1YU4A 2J7NA 3J7BA 2DAIA 1QYRA 4OJ5A 1IN7A 1ZAEA 1H0GA 2BWBA 4OUIA 3B74A 3SBJA 4M0DA 3U6EA 1PGYA 1R4GA 5EXTA 1R6BX 4LFBM 2V6ZM 3H4JA 3KOWE 1NVMA 3GLIB 3SAWA 3VK7A 3AOGA 4Z6YA 4R71A 5ITQA 1D2NA 1XHBA 1K82A 2LHCA 4R3DA 2XLJA 2CV1A 2ZANA 5FTKA 4Z8XA 3F92A 2Y2KA 2OOAA 2QBYB 4MB3A 3C3DA 1GVNA 1IN8A 2ZTDA 3SYLA 3TPZA 4DR5M 3ZH9B 5FSWA 4JI0M 3CF0A 4JI2M 4NXNM 3R8FA 3GLFA 4MB4A 1NV9A 3SAUA 3PVSA 1VDLA 2CHGA 4IIWA 1DGHB 3QWLA 4JYAM 2Y2NA 4AQYM 4M9SA 3QAUA 2ZAMA 3H4MA 4G4NA 1VEJA 3KSJA 2QZ4A 3KS8A 2XFSA 1YSYA 1NJFA 3KW6A 4NSRA 2L4EA 4GHAA 3WD4A 5DNYA 4CGYB 4GKJM 1MN3A 1WJ7A 4AG5A 4P16A 1OGBA 1IY2A 4B7GA 2DVWB 2QENA 4XBOA 4ITQA 4OJLA 4M9XA 5C18A 4QNLA 1G3IA 2JNHA 2Y21A 1Y8GA 3NBIA 4Q7JA 4R7GA 2BJVA 4PCZA 2R18A 4NYUA 3N3FA 1G8PA 4QHSA 1W1VA 5ITXE 5ITTA 3KFUG 1HJPA 2FS1A 4G4OA 1PRBA 3GRUA 1OJLA 4I4LA 3U6PA 2O5RA 4DR1M 2CV0A 1XC8A 4MGZE 3UK6A 2UUAM 2R4EA 3K2LA 2UUCM 2JCHA 2C99A 4JI7M 1XXHE 2LBCA 2JUJA 4LJAA 1AIPC 3A45A 3GPXA 4L6V6 2QP9X 4HMDA 2R45A 1GL6A 2DHRA 2R4JA 5EP2A 4JI3M 2WSEF 4HEOA 5DFLA 4PDGA 2V1UA 1UR9A 5L8RF 2YR0A 3MQLA 1HT2E 2EKKA 3HJSA 2HWJA 3HONA 4II7A 3OTOM 8CATA 1E6ZA 4KODA 4F1IA 3B7ZA 5LMUM 3LCVB 1L1TA 1EIJA 1YU0A 4MB7A 2C98A 3ZQJA 3FTDA 3HHXA 1LV7A 2BWEA 4RF1A 4NC6A 1IBLM 4EIWA 1GOIA 2Y2MA 4IJEA 3CTWB 1QUSA 4K0KM 3HHZA 3GRVA 3FTFA 2J7OA 1Q3BA 2XZUA 2HKJA 4L78A 1L2DA 1E9RA 3U6OA 4IBBA 3GPYA 4DV0M 4OVZB 4REZA 1VG5A 1IY1A 4IBEA 4GH9A 1PJTA 4JN6A 3SHFA 2FN2A 2L2DA 1FNNA 4OX9M 3IECA 3D8BA 4LRSA 2B3TA 2G8LA 4DV1M 2Z4RA 1UM8A 3GPPA 5FTNA 3U6SA 3SARA 2KRUA 2CHQA 2LVAA 4DR2M 2H1RA 2GNOA 4DR4M 4LFAM 1YE9A 4DUZM 4GRIA 4CIZA 3GLGB 1OTRA 3HWSA 4LJ6A 4AG6A 1SG9A 2MGWA 1R2ZA 1TF0B 2LNHC 3Q8XA 3CF2A 1PJJA 3LCUA 1R5LA 2KZUA 1V34A 3HJQA 3QYBA 4GC9A 1HQYE 1IN6A 1L2BA 4GHLA 1E9SA 2FFJA 3L27A 4IBDA 1ZQ9A 2QQ8A 2ERCA 2R46A 3C3EA 4LY6A 5EXSA 2LHGA 4LF4M 2LVQD 2DI0A 4LF5M 3JR4A 2A5YB 2XSZD 4IBJA 3CF6E 1OAOC 2WSCF 4L16A 2QBYA 4L8RC 3W0LB 3I01M 1MJGM 3HHWA 2DWMA 4L4UA 4PT5A 3GRYA 3U6CA 3U60B 4JI8M 3Q8GA 4IBKA 4MB5A 3KDSE 2Y2GA 5IT9S 1NJGA 1NY5A 4GIPA 4HMEA 2R6FA 4MGKE 3TWLA 1R2YA 1SXJB 4QOSA 2Y2PA 1O6IA 3MK6A 3K9OA 4DUYM 4TX8A 2HCBA 3SYKA 1Q02A 1TDZA 2X4AA 3I4YA 4QNRA 3VKGA 3FRIA 3T15A 4G4RA 4KT0F 3KP1E 1N33M 1QO6A 1PJSA 2APLA 2F5OA 1G59A 2E5LM 2Y0QA 2L09A 4IBCA 1IFYA 5ITXA 1JR3A 1ED7A 3SFZA 2EKFA 2ZTCA 1E6NA 2CP8A 1H6UA 1ZMVA 1EE8A 2KXEA 2CV2A 1EFUB 2RKOA 1E94E 3DOAA 2F4VM 1QDTA 2MJ5B 3GLIE 1DGBA 2G3QA 3PFIA 1QZMA 3VLFB 1L6JA 4FCWA 3M0EA 3SASA 1XXHA 3GQ3A 4MGHA 4IJFA 1T3TA 1KYIA 2KDLA 4LJ8A 1DGGA 3HU2A 2F5QA 4LF9M 2JWSA 1ZMWA 4NZ5A 2F5NA 1XNRM 4GITA 3RE8A 1N32M 1CXWA 2KNAA 4FCTA 4I81A 2VIIA 5FTMA 1E15A 2G5GX 1GPFA 2Y2QA 1V33A 2C9OA 2HHHM 5BPVA 3FUXA 4BB9A 1UR8A 3UGJA 4QNMA 4X66M 1GABA 2CWBA 3L28A 4I5SA 2X49A 1YUBA 1E6RA 3GO8A 2UU9M 3AOEA 4NY2A 4JV5M 2RGOA 1K3XA 4NYYA 2I7PA 1JR3E 1N77A 5IWAM 2VQEM 2XSZA 4GEWA 4MM3B 4D80A 4M0WA 1NNJA 2X8AA 1NHGC 1W5TA 1NV8A 1Z59A 4S12A 2Y0TA 4XGIA 2R0IA 3TL4X 3AKZA 3A46A 5EXXA 1XMQM 3FTEA 3LMMA 2K47A 3FUUA 1D0LA 1JQJC 4HMCA 4OVZA 1J09A 2VF8A 3GLHB 2F5SA 4I8OA 4NZ1A 3TWKA 3KVWA 4QHTA 5E26A 4D81A 4Z2HA 1HR0M 1TDHA 5A2QS 3L2AA 1WR1B 3GLHE 3KS4A 4ZPXA 3HU1A 3BBZA 3WHLA 3GP1A 2CUZA 2Y2JA 4RNAA 2QNJA 3KOYE 4GMQA 5JI2E 1ZMUA 2JXNA 2I7NA 3DZDA 3NWLA 1IN5A 5E6JA 3L29A 5EXPA 3GLFB 3GLGA 1JR3D 2WSFF 1HNXM 3TWMA 1UFZA 5KPTA 2QPAA 3HU3A 3M6AA 2CRUA 4M9ZA 1G71A 3SATA 1J7MA 2OOBA 5KO3A 3WHKA 3IG5A 4AZFA 5JI3E 1BVSA 4FWDA 1L2CA 4LRTA 2XEPA 3QYEA 2LWXA 1IBMM 3TE6A 4AW4A 1OAIA 1TH3A 2CE7A 3KP0E 4FW9A 1YU3A 3AOEC 2VF7A 2Y2OA 1D0MA 1IQPA 2YNMD 3B89A 2LVOC 2JY8A 4CISA 2NQ8C 4B3TM 4AKGA 1L8QA 3LQRA 5EP1A 2K0BX 3A98B 3U5ZB 3KOZE 1ORYB 4JI1M 1HQCA 4FVMA 1KFVA 3RGPA 4L15A 1X37A 1ZV1A 2DAKA 3J2PB 1Q39A 3LVVA 2V1CA 5LMNM 3I04M 5KQ8A 3WX7A 1F4IA 2XFTA 1AUAA 1Q3CA 4LGMA 4UN2B 3FTCA 3I4VA 1CK7A 3AFHA 4B7FA 2L7IA 4NL4H 2KW0A 1K3WA 2Y2HA 3WD1A 4QOZC 2QHOB 2FFFB 4PD2A 5FTLA 3FE3A 2XD1A 3DFZA 3LW5F 4OJOA 4G6ZA 3E46A 3GLIA 3AV0A 2XGNA 3GLGE 1OIPA 2Z8YM 3W67A 3E21A 4DBGB 1W1PA 2KZSA 1VEGA 4Z2GA 1J7KA 3KSXA 1TH4A 4Z2IA 3U6MA 4D82A 4IBGA 3B7NA 1LTMA 2J5YA 5EP4A 2R44A 2BG1A 3TQSA 5KPRA 3U6LA 3PNYA 3SC3A 1RU3A 4IBIA 1E6PA 1EAKA 1DGHA 1YU1A 5BR8M 4OU7A 2EO2A 4DR3M 1NHWC 3K9PA 4NZ3A 2CFOA 2EJSA 3FYDA 3FUTA 3HKPA 4F2LA 3U6DA 2XD5A 5EP3A 3ZC7B 4YHHM 3C9PA 1SXJE 4Z2LA 4X64M 1NNUC 3JAMS 2R62A 4DR6M 4KLNA 1WGNA 3AJIB 3HJ8A 1I94M 1J5EM 2C9CA 2JZ0A 3K1JA 2JY7A 4B3MM 4JI4M 1SXJC 2Y20A 1YUEA 1GLNA 3FUWA 3V76A 2DAGA 2L4FA 3VFDA 2LTUA 3MMPA 4OW0A 1N78A 2JE5A 1E88A 4OJPA 2EA0A 3MJ5A 1IXSB 4AKHA 4Z2JA 2CEAA 2DAEA 2DZNB 4B3RM 2K6BA 1VDDA 3EIEA 5EJCA 4AKIA 1GXDA 3DA1A 4OJ6A 2ZAOA 2D7HA 2L7HA 4TUWA 5FLXS 4LJ5A 4CJ6A 3UMMA 1N75A 1OQYA 3THGA 1XNQM 3J27B 2DXIA 4PDIA 1TGUA 2AHMA 2YQZA 3GLHA 1QAQA 3IHPA 3B7QA 4KHPM 1PDCA 1SXJD 1QAMA 4NRWA 2OQ4A 2RGHA 2CHVA 1VEKA 2BJWA 4KO8A 4LCBA 1V92A 1MU5A 1P3QQ 3FKEA 2UXBM 1WXQA 3R9XB 1WGLA 4HL4A 1FJGM 3B9PA 2BNKA 3KXEC 2ZBKB 4HLQA 1OFHA 2WZJA 4JXJA 4GKKM 3FD9A 3GRRA 3HY5A 4MH0E 4MGYE 4DR7M 1MX0A 3T38A 7CATA 3AL0C 1NO1A 2JP7A 1PJIA 4Y28F 1HNZM 1GJTA 3LVWA 1E32A 3U61B 5EQTA 4BBAA 1W5SA 2LVPC 4X65M 2W82A 2MH8A 4DV3M 1YLAA 3M7GA 1GO5A 4DV6M 1NSFA 3KOXE 4YY3M 2UXCM 4WP2A 2V5OA 2OPFA 1E8BA 1N36M 3W0FA 1WHCA 2DWNA 3NBXX 1XWIA 5DYGA 2KRKA 2O25A 4G3OA 2DKLA 2GQFA 1Z5AA 2DENA 4LJ4A 4LZJA 1I4WA 1D0KA 3SAVA 4NXMM 3E4RA 2IOUA 4LJ9A 1CUKA 3U5ZA 4XK8F 3ZCBB 2O01F 3GPUA 1NY6A 2DAMA 3WD3A 2UWXA 1QVRA 3VDUA 5DYIA 2EUCA 4X62M 1DO2A 4BLCA 4NOOB 4MGIE 4NSOB 1XXHB 4JI6M 1QDRA 2K9DA 2H5XA 3FYCA 2Y2LA 2YFQA 2F5PA 1IY0A 4IBFA 1C7YA 3C58A 3VDPA 3T6PA 3SHGB 4LJ7A 4LFCM 2D7EA 2XZFA 2D49A 2JY6B
chains in the Genus database with same CATH topology
5FTJA 2UUBM 3FUVA 3HSHA 1L1ZA 2VQFM 3HHYA 4FWHA 2HL7A 3RGSA 3J81S 3UJNA 2XH9A 4LF8M 1GL7A 4B7HA 4LG2A 1QAOA 1KSFX 1DO0A 4B3SM 3EIHA 2LH0A 3VKHA 3U60A 2C96A 5IZ7D 3LQQA 1GKIA 1Z5BA 3I51A 1Z6TA 3E9SA 4DV7M 1N34M 2Z4SA 1SXJA 3ILKA 3SMPA 3J7AS 1DGFA 3VK8A 2XF3A 1S3SA 3MHVC 1OFIA 2C5RA 1C1KA 2QCUA 5C1BA 4CHTB 1IBKM 2DZOB 3U6QA 1IXRC 2M60A 4WURA 3J80S 2KEBA 4LF7M 2DWLA 3IG8A 2Z7JA 2L6OA 4W5WA 5ITRA 4FCVA 2P5TA 5GKNA 3JR5A 2R65A 3HGIA 3D8LA 3SMSA 1QQWA 5KPZA 5ITUA 3GQ5A 1HNWM 1Z5CA 3L25A 1YU2A 2FNAA 1PM5A 3PNVA 4LZZA 4DV4M 2FE8A 3T1HM 4LF6M 5H37D 4DV2M 4AI6A 3GQ4A 2D7GA 4G4QA 4NZ4A 4GC5A 4JI5M 4NRVA 2Z3XA 2Y2IA 1TH2A 2M5ZA 3K92A 3RFWA 3K8ZA 2Q2EB 1IXZA 2FOIC 4FWGA 3A42A 1HT1E 5IREB 4DV5M 1IM2A 3BOSA 4RF0A 1G41A 4LGYA 5ITYA 4WW0A 1R7RA 5KQDA 3T1YM 4A3VB 4FD2A 2UXDM 2KA6B 2LXEA 1IN4A 4B08A 3L26A 1G4AE 1QANA 2ZM6M 3U61A 2JA2A 5F3WA 1XMOM 3UZUA 2DWZB 3PXGA 1YU4A 2J7NA 3J7BA 1QYRA 4OJ5A 1IN7A 1ZAEA 4OUIA 3SBJA 4M0DA 3U6EA 5EXTA 1R6BX 4LFBM 2V6ZM 3KOWE 1NVMA 3GLIB 3SAWA 3VK7A 3AOGA 4Z6YA 5ITQA 1D2NA 1XHBA 1K82A 2CV1A 4R3DA 2XLJA 2Y2KA 2ZANA 5FTKA 4Z8XA 2QBYB 1GVNA 1IN8A 3SYLA 4DR5M 3TPZA 3ZH9B 5FSWA 4JI0M 3CF0A 4JI2M 4NXNM 3R8FA 3GLFA 3SAUA 3PVSA 2CHGA 4IIWA 1DGHB 3QWLA 4JYAM 4AQYM 4M9SA 3QAUA 2ZAMA 3H4MA 4G4NA 3KSJA 2QZ4A 3KS8A 2XFSA 1YSYA 1NJFA 3KW6A 4NSRA 4GHAA 5DNYA 4CGYB 4GKJM 4AG5A 4P16A 1IY2A 4B7GA 2DVWB 2QENA 4XBOA 4ITQA 4OJLA 4M9XA 5C18A 4QNLA 1G3IA 2Y21A 3NBIA 4R7GA 2BJVA 4PCZA 2R18A 4NYUA 3N3FA 1G8PA 4QHSA 5ITXE 5ITTA 3KFUG 4G4OA 3GRUA 1OJLA 4I4LA 3U6PA 2O5RA 4DR1M 2CV0A 1XC8A 4MGZE 3UK6A 2UUAM 2R4EA 3K2LA 2UUCM 2JCHA 2C99A 4JI7M 4LJAA 3GPXA 3A45A 2QP9X 2R45A 1GL6A 2DHRA 2R4JA 5EP2A 4JI3M 4PDGA 2V1UA 2YR0A 1HT2E 3HJSA 3HONA 4II7A 3OTOM 8CATA 4KODA 5LMUM 1L1TA 1YU0A 4MB7A 2C98A 3FTDA 3HHXA 1LV7A 4RF1A 1IBLM 4EIWA 2Y2MA 4IJEA 3CTWB 4K0KM 3HHZA 3GRVA 3FTFA 2J7OA 1Q3BA 2XZUA 2HKJA 4L78A 1L2DA 1E9RA 3U6OA 4IBBA 3GPYA 4DV0M 4OVZB 4REZA 4IBEA 1IY1A 4GH9A 4JN6A 3SHFA 1FNNA 4OX9M 3D8BA 4LRSA 2G8LA 4DV1M 2Z4RA 1UM8A 3GPPA 5FTNA 3U6SA 3SARA 2CHQA 2KRUA 4DR2M 2H1RA 4DR4M 4LFAM 1YE9A 4DUZM 4GRIA 3GLGB 3HWSA 4AG6A 4LJ6A 1R2ZA 2LNHC 3Q8XA 3CF2A 1PJJA 2KZUA 3HJQA 1L2BA 4GC9A 2Y2NA 1HQYE 1IN6A 4GHLA 1E9SA 2FFJA 3L27A 4IBDA 1ZQ9A 2R46A 2ERCA 5EXSA 4LF4M 4LY6A 4LF5M 3JR4A 2A5YB 2XSZD 4IBJA 3CF6E 4L16A 2QBYA 4L8RC 3W0LB 3HHWA 2DWMA 4JI8M 4L4UA 4PT5A 3GRYA 3U6CA 3U60B 4IBKA 3KDSE 2Y2GA 5IT9S 1NJGA 1NY5A 4GIPA 4MGKE 3TWLA 1R2YA 1SXJB 4QOSA 2Y2PA 3MK6A 4DUYM 2HCBA 3SYKA 1TDZA 2X4AA 3I4YA 4QNRA 3VKGA 3T15A 4G4RA 3KP1E 1N33M 2F5OA 1G59A 2E5LM 2Y0QA 2L09A 4IBCA 5ITXA 1JR3A 3SFZA 1H6UA 1EE8A 2KXEA 2CV2A 2RKOA 1E94E 3DOAA 2F4VM 1DGBA 3PFIA 1QZMA 3VLFB 4FCWA 3M0EA 3SASA 1XXHA 3GQ3A 4MGHA 4IJFA 1T3TA 1KYIA 2F5QA 4LJ8A 1DGGA 3HU2A 4LF9M 4NZ5A 2F5NA 1XNRM 4GITA 3RE8A 1N32M 4FCTA 4I81A 2VIIA 5FTMA 2G5GX 2Y2QA 2C9OA 2HHHM 5BPVA 3FUXA 4BB9A 3UGJA 4QNMA 4X66M 3L28A 4I5SA 2X49A 1YUBA 3GO8A 2UU9M 3AOEA 4NY2A 4JV5M 2RGOA 1K3XA 4NYYA 2I7PA 1N77A 5IWAM 2VQEM 2XSZA 4MM3B 4D80A 4M0WA 1NNJA 2X8AA 1NHGC 1W5TA 1Z59A 4S12A 2Y0TA 4XGIA 3TL4X 3AKZA 3A46A 5EXXA 1XMQM 3FTEA 3LMMA 2K47A 3FUUA 1JQJC 4OVZA 1J09A 3GLHB 2F5SA 4I8OA 4NZ1A 3TWKA 3KVWA 4QHTA 5E26A 4D81A 1HR0M 1TDHA 5A2QS 3L2AA 3KS4A 4ZPXA 3HU1A 3WHLA 3GP1A 2CUZA 2Y2JA 4RNAA 3KOYE 4GMQA 5JI2E 3GLFB 2I7NA 3DZDA 3NWLA 1IN5A 5E6JA 3L29A 5EXPA 3GLGA 1JR3D 1HNXM 3TWMA 5KPTA 2QPAA 3HU3A 3M6AA 4M9ZA 3SATA 5KO3A 3WHKA 3IG5A 4AZFA 5JI3E 4FWDA 1L2CA 4LRTA 2XEPA 2LWXA 1IBMM 3TE6A 4AW4A 1TH3A 2CE7A 3KP0E 4FW9A 1YU3A 2Y2OA 3AOEC 1IQPA 2YNMD 4CISA 2NQ8C 4B3TM 4AKGA 1L8QA 3LQRA 5EP1A 3U5ZB 3A98B 3KOZE 1ORYB 4JI1M 1HQCA 4FVMA 1KFVA 3RGPA 4L15A 1X37A 3J2PB 3LVVA 1Q39A 2V1CA 5LMNM 5KQ8A 2XFTA 1Q3CA 4LGMA 3FTCA 3I4VA 3AFHA 4B7FA 2L7IA 4NL4H 2KW0A 1K3WA 2Y2HA 4QOZC 2FFFB 4PD2A 5FTLA 2XD1A 3DFZA 4OJOA 4G6ZA 3GLIA 3AV0A 2XGNA 2KZSA 1J7KA 3KSXA 1TH4A 3U6MA 4D82A 4IBGA 2BG1A 5EP4A 3TQSA 5KPRA 3U6LA 3PNYA 3SC3A 4IBIA 1YU1A 1DGHA 5BR8M 4OU7A 2EO2A 4DR3M 1NHWC 4NZ3A 2CFOA 3FYDA 3HKPA 3FUTA 3U6DA 2XD5A 5EP3A 3ZC7B 4YHHM 1SXJE 4X64M 1NNUC 3JAMS 2R62A 4DR6M 4KLNA 3AJIB 3HJ8A 1I94M 1J5EM 2C9CA 3K1JA 4B3MM 4JI4M 1SXJC 2Y20A 1YUEA 1GLNA 3FUWA 2JE5A 3VFDA 4OW0A 1N78A 4OJPA 2EA0A 3MJ5A 1IXSB 4AKHA 2CEAA 2DZNB 4B3RM 1VDDA 3EIEA 5EJCA 4AKIA 4OJ6A 3DA1A 2ZAOA 2D7HA 2L7HA 4TUWA 5FLXS 4LJ5A 3UMMA 1N75A 1XNQM 3THGA 3J27B 2DXIA 4PDIA 1TGUA 2AHMA 2YQZA 3GLHA 1QAQA 4KHPM 1SXJD 1QAMA 4NRWA 2OQ4A 2RGHA 2CHVA 4KO8A 2BJWA 4LCBA 1MU5A 3FKEA 2UXBM 1WXQA 3R9XB 1FJGM 4HL4A 4GKKM 3B9PA 2BNKA 3KXEC 2ZBKB 4HLQA 1OFHA 4JXJA 3FD9A 3GRRA 4MH0E 4MGYE 4DR7M 1MX0A 3T38A 7CATA 3AL0C 1PJIA 1HNZM 3LVWA 1E32A 3U61B 5EQTA 4BBAA 1W5SA 4X65M 2W82A 4DV3M 3M7GA 4DV6M 1NSFA 3KOXE 4YY3M 2UXCM 2OPFA 1N36M 3W0FA 2DWNA 1XWIA 5DYGA 2KRKA 4LZJA 4LJ4A 4NXMM 1Z5AA 3SAVA 1I4WA 3E4RA 2IOUA 4LJ9A 3U5ZA 3ZCBB 3GPUA 1NY6A 2UWXA 1QVRA 3VDUA 5DYIA 2EUCA 4X62M 1DO2A 4BLCA 4NOOB 4MGIE 4NSOB 1XXHB 4JI6M 3FYCA 2Y2LA 2YFQA 2F5PA 1IY0A 4IBFA 3C58A 3VDPA 3SHGB 4LJ7A 4LFCM 2D7EA 2XZFA 3WX7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GHA A;  4GHL A;  3L27 A;  4IBD A;  4IBB A;  4LG2 A;  5BPV A;  4IBE A;  4IBC A;  4GH9 A;  4IBJ A;  3L28 A;  3FKE A;  3L2A A;  3KS4 A;  4IBG A;  3L26 A;  4IBK A;  3L25 A;  4IBI A;  4IJF A;  3L29 A;  4IBF A;  4IJE A;  3KS8 A; 
#chains in the Genus database with same CATH topology
 5FTJ A;  1PJQ A;  3FUV A;  2UUB M;  3HSH A;  1L1Z A;  2VQF M;  3HHY A;  1QZE A;  2HL7 A;  3FRH A;  4FWH A;  3RGS A;  3W68 A;  3J81 S;  3GLF E;  2HAK A;  3UJN A;  2XH9 A;  4LF8 M;  1GL7 A;  4B7H A;  4LG2 A;  2RTS A;  3M7P A;  1QAO A;  1H8P A;  1KSF X;  1DO0 A;  2DZL A;  2RRU A;  4B3S M;  3CGW A;  3EIH A;  2LH0 A;  3VKH A;  3U60 A;  2C96 A;  2DNA A;  5IZ7 D;  3LQQ A;  1GKI A;  1Z5B A;  2LVN C;  1W1T A;  3I51 A;  1Z6T A;  3E9S A;  2N35 A;  4DV7 M;  1N34 M;  2Z4S A;  1SXJ A;  1VQ1 A;  3BXW A;  3HZJ A;  3ILK A;  3SMP A;  1KS0 A;  3J7A S;  1DGF A;  1TTE A;  3VK8 A;  2XF3 A;  1AIW A;  1S3S A;  2MR9 A;  3MHV C;  1OFI A;  2C5R A;  1C1K A;  1H0I A;  2QCU A;  2KHH A;  1TR8 A;  1XB2 B;  3WD0 A;  2JY5 A;  5C1B A;  4CHT B;  1IBK M;  2DZO B;  3U6Q A;  2OO9 A;  1IXR C;  2M60 A;  4WUR A;  3J80 S;  2KEB A;  4LF7 M;  2DWL A;  3IG8 A;  4Z2K A;  1T43 A;  2Z7J A;  4RKU F;  2L6O A;  4W5W A;  5ITR A;  1W1Y A;  4FCV A;  2P5T A;  5GKN A;  3JR5 A;  1GJS A;  1IXS A;  2R65 A;  3HGI A;  3D8L A;  3SMS A;  1QQW A;  5KPZ A;  5ITU A;  3GQ5 A;  1HNW M;  1Z5C A;  3L25 A;  1YU2 A;  2DHY A;  2FNA A;  2QSF X;  1PM5 A;  3PNV A;  4LZZ A;  4DV4 M;  2FE8 A;  3T1H M;  4LF6 M;  5H37 D;  4DV2 M;  4AI6 A;  3GQ4 A;  2D7G A;  4G4Q A;  1JB0 F;  4NZ4 A;  4GC5 A;  4JI5 M;  4NRV A;  2Z3X A;  2Y2I A;  1TH2 A;  2M5Z A;  3K92 A;  3RFW A;  3K8Z A;  2Q2E B;  1IXZ A;  1WIV A;  2FOI C;  2MRO B;  1QUT A;  4FWG A;  3A42 A;  1HT1 E;  2JZ1 A;  3HX3 A;  1IM2 A;  5IRE B;  3BOS A;  4RF0 A;  1G41 A;  4DV5 M;  1OGG A;  4LGY A;  5ITY A;  4WW0 A;  1R7R A;  5KQD A;  3T1Y M;  4A3V B;  1DV0 A;  4FD2 A;  2UXD M;  2KA6 B;  2LXE A;  1IN4 A;  4B08 A;  3L26 A;  1G4A E;  1QAN A;  2FH0 A;  2KNZ A;  2KNV A;  4ANR A;  2ZM6 M;  4P17 A;  3U61 A;  2JA2 A;  3WD2 A;  1T6O A;  2VDB B;  5F3W A;  1A5T A;  1OIZ A;  1XMO M;  3UZU A;  2DWZ B;  1OKS A;  3PXG A;  1YU4 A;  2J7N A;  3J7B A;  2DAI A;  1QYR A;  4OJ5 A;  1IN7 A;  1ZAE A;  1H0G A;  2BWB A;  4OUI A;  3B74 A;  3SBJ A;  4M0D A;  3U6E A;  1PGY A;  1R4G A;  5EXT A;  1R6B X;  4LFB M;  2V6Z M;  3H4J A;  3KOW E;  1NVM A;  3GLI B;  3SAW A;  3VK7 A;  3AOG A;  4Z6Y A;  4R71 A;  5ITQ A;  1D2N A;  1XHB A;  1K82 A;  2LHC A;  4R3D A;  2XLJ A;  2CV1 A;  2ZAN A;  5FTK A;  4Z8X A;  3F92 A;  2Y2K A;  2OOA A;  2QBY B;  4MB3 A;  3C3D A;  1GVN A;  1IN8 A;  2ZTD A;  3SYL A;  3TPZ A;  4DR5 M;  3ZH9 B;  5FSW A;  4JI0 M;  3CF0 A;  4JI2 M;  4NXN M;  3R8F A;  3GLF A;  4MB4 A;  1NV9 A;  3SAU A;  3PVS A;  1VDL A;  2CHG A;  4IIW A;  1DGH B;  3QWL A;  4JYA M;  2Y2N A;  4AQY M;  4M9S A;  3QAU A;  2ZAM A;  3H4M A;  4G4N A;  1VEJ A;  3KSJ A;  2QZ4 A;  3KS8 A;  2XFS A;  1YSY A;  1NJF A;  3KW6 A;  4NSR A;  2L4E A;  4GHA A;  3WD4 A;  5DNY A;  4CGY B;  4GKJ M;  1MN3 A;  1WJ7 A;  4AG5 A;  4P16 A;  1OGB A;  1IY2 A;  4B7G A;  2DVW B;  2QEN A;  4XBO A;  4ITQ A;  4OJL A;  4M9X A;  5C18 A;  4QNL A;  1G3I A;  2JNH A;  2Y21 A;  1Y8G A;  3NBI A;  4Q7J A;  4R7G A;  2BJV A;  4PCZ A;  2R18 A;  4NYU A;  3N3F A;  1G8P A;  4QHS A;  1W1V A;  5ITX E;  5ITT A;  3KFU G;  1HJP A;  2FS1 A;  4G4O A;  1PRB A;  3GRU A;  1OJL A;  4I4L A;  3U6P A;  2O5R A;  4DR1 M;  2CV0 A;  1XC8 A;  4MGZ E;  3UK6 A;  2UUA M;  2R4E A;  3K2L A;  2UUC M;  2JCH A;  2C99 A;  4JI7 M;  1XXH E;  2LBC A;  2JUJ A;  4LJA A;  1AIP C;  3A45 A;  3GPX A;  4L6V 6;  2QP9 X;  4HMD A;  2R45 A;  1GL6 A;  2DHR A;  2R4J A;  5EP2 A;  4JI3 M;  2WSE F;  4HEO A;  5DFL A;  4PDG A;  2V1U A;  1UR9 A;  5L8R F;  2YR0 A;  3MQL A;  1HT2 E;  2EKK A;  3HJS A;  2HWJ A;  3HON A;  4II7 A;  3OTO M;  8CAT A;  1E6Z A;  4KOD A;  4F1I A;  3B7Z A;  5LMU M;  3LCV B;  1L1T A;  1EIJ A;  1YU0 A;  4MB7 A;  2C98 A;  3ZQJ A;  3FTD A;  3HHX A;  1LV7 A;  2BWE A;  4RF1 A;  4NC6 A;  1IBL M;  4EIW A;  1GOI A;  2Y2M A;  4IJE A;  3CTW B;  1QUS A;  4K0K M;  3HHZ A;  3GRV A;  3FTF A;  2J7O A;  1Q3B A;  2XZU A;  2HKJ A;  4L78 A;  1L2D A;  1E9R A;  3U6O A;  4IBB A;  3GPY A;  4DV0 M;  4OVZ B;  4REZ A;  1VG5 A;  1IY1 A;  4IBE A;  4GH9 A;  1PJT A;  4JN6 A;  3SHF A;  2FN2 A;  2L2D A;  1FNN A;  4OX9 M;  3IEC A;  3D8B A;  4LRS A;  2B3T A;  2G8L A;  4DV1 M;  2Z4R A;  1UM8 A;  3GPP A;  5FTN A;  3U6S A;  3SAR A;  2KRU A;  2CHQ A;  2LVA A;  4DR2 M;  2H1R A;  2GNO A;  4DR4 M;  4LFA M;  1YE9 A;  4DUZ M;  4GRI A;  4CIZ A;  3GLG B;  1OTR A;  3HWS A;  4LJ6 A;  4AG6 A;  1SG9 A;  2MGW A;  1R2Z A;  1TF0 B;  2LNH C;  3Q8X A;  3CF2 A;  1PJJ A;  3LCU A;  1R5L A;  2KZU A;  1V34 A;  3HJQ A;  3QYB A;  4GC9 A;  1HQY E;  1IN6 A;  1L2B A;  4GHL A;  1E9S A;  2FFJ A;  3L27 A;  4IBD A;  1ZQ9 A;  2QQ8 A;  2ERC A;  2R46 A;  3C3E A;  4LY6 A;  5EXS A;  2LHG A;  4LF4 M;  2LVQ D;  2DI0 A;  4LF5 M;  3JR4 A;  2A5Y B;  2XSZ D;  4IBJ A;  3CF6 E;  1OAO C;  2WSC F;  4L16 A;  2QBY A;  4L8R C;  3W0L B;  3I01 M;  1MJG M;  3HHW A;  2DWM A;  4L4U A;  4PT5 A;  3GRY A;  3U6C A;  3U60 B;  4JI8 M;  3Q8G A;  4IBK A;  4MB5 A;  3KDS E;  2Y2G A;  5IT9 S;  1NJG A;  1NY5 A;  4GIP A;  4HME A;  2R6F A;  4MGK E;  3TWL A;  1R2Y A;  1SXJ B;  4QOS A;  2Y2P A;  1O6I A;  3MK6 A;  3K9O A;  4DUY M;  4TX8 A;  2HCB A;  3SYK A;  1Q02 A;  1TDZ A;  2X4A A;  3I4Y A;  4QNR A;  3VKG A;  3FRI A;  3T15 A;  4G4R A;  4KT0 F;  3KP1 E;  1N33 M;  1QO6 A;  1PJS A;  2APL A;  2F5O A;  1G59 A;  2E5L M;  2Y0Q A;  2L09 A;  4IBC A;  1IFY A;  5ITX A;  1JR3 A;  1ED7 A;  3SFZ A;  2EKF A;  2ZTC A;  1E6N A;  2CP8 A;  1H6U A;  1ZMV A;  1EE8 A;  2KXE A;  2CV2 A;  1EFU B;  2RKO A;  1E94 E;  3DOA A;  2F4V M;  1QDT A;  2MJ5 B;  3GLI E;  1DGB A;  2G3Q A;  3PFI A;  1QZM A;  3VLF B;  1L6J A;  4FCW A;  3M0E A;  3SAS A;  1XXH A;  3GQ3 A;  4MGH A;  4IJF A;  1T3T A;  1KYI A;  2KDL A;  4LJ8 A;  1DGG A;  3HU2 A;  2F5Q A;  4LF9 M;  2JWS A;  1ZMW A;  4NZ5 A;  2F5N A;  1XNR M;  4GIT A;  3RE8 A;  1N32 M;  1CXW A;  2KNA A;  4FCT A;  4I81 A;  2VII A;  5FTM A;  1E15 A;  2G5G X;  1GPF A;  2Y2Q A;  1V33 A;  2C9O A;  2HHH M;  5BPV A;  3FUX A;  4BB9 A;  1UR8 A;  3UGJ A;  4QNM A;  4X66 M;  1GAB A;  2CWB A;  3L28 A;  4I5S A;  2X49 A;  1YUB A;  1E6R A;  3GO8 A;  2UU9 M;  3AOE A;  4NY2 A;  4JV5 M;  2RGO A;  1K3X A;  4NYY A;  2I7P A;  1JR3 E;  1N77 A;  5IWA M;  2VQE M;  2XSZ A;  4GEW A;  4MM3 B;  4D80 A;  4M0W A;  1NNJ A;  2X8A A;  1NHG C;  1W5T A;  1NV8 A;  1Z59 A;  4S12 A;  2Y0T A;  4XGI A;  2R0I A;  3TL4 X;  3AKZ A;  3A46 A;  5EXX A;  1XMQ M;  3FTE A;  3LMM A;  2K47 A;  3FUU A;  1D0L A;  1JQJ C;  4HMC A;  4OVZ A;  1J09 A;  2VF8 A;  3GLH B;  2F5S A;  4I8O A;  4NZ1 A;  3TWK A;  3KVW A;  4QHT A;  5E26 A;  4D81 A;  4Z2H A;  1HR0 M;  1TDH A;  5A2Q S;  3L2A A;  1WR1 B;  3GLH E;  3KS4 A;  4ZPX A;  3HU1 A;  3BBZ A;  3WHL A;  3GP1 A;  2CUZ A;  2Y2J A;  4RNA A;  2QNJ A;  3KOY E;  4GMQ A;  5JI2 E;  1ZMU A;  2JXN A;  2I7N A;  3DZD A;  3NWL A;  1IN5 A;  5E6J A;  3L29 A;  5EXP A;  3GLF B;  3GLG A;  1JR3 D;  2WSF F;  1HNX M;  3TWM A;  1UFZ A;  5KPT A;  2QPA A;  3HU3 A;  3M6A A;  2CRU A;  4M9Z A;  1G71 A;  3SAT A;  1J7M A;  2OOB A;  5KO3 A;  3WHK A;  3IG5 A;  4AZF A;  5JI3 E;  1BVS A;  4FWD A;  1L2C A;  4LRT A;  2XEP A;  3QYE A;  2LWX A;  1IBM M;  3TE6 A;  4AW4 A;  1OAI A;  1TH3 A;  2CE7 A;  3KP0 E;  4FW9 A;  1YU3 A;  3AOE C;  2VF7 A;  2Y2O A;  1D0M A;  1IQP A;  2YNM D;  3B89 A;  2LVO C;  2JY8 A;  4CIS A;  2NQ8 C;  4B3T M;  4AKG A;  1L8Q A;  3LQR A;  5EP1 A;  2K0B X;  3A98 B;  3U5Z B;  3KOZ E;  1ORY B;  4JI1 M;  1HQC A;  4FVM A;  1KFV A;  3RGP A;  4L15 A;  1X37 A;  1ZV1 A;  2DAK A;  3J2P B;  1Q39 A;  3LVV A;  2V1C A;  5LMN M;  3I04 M;  5KQ8 A;  3WX7 A;  1F4I A;  2XFT A;  1AUA A;  1Q3C A;  4LGM A;  4UN2 B;  3FTC A;  3I4V A;  1CK7 A;  3AFH A;  4B7F A;  2L7I A;  4NL4 H;  2KW0 A;  1K3W A;  2Y2H A;  3WD1 A;  4QOZ C;  2QHO B;  2FFF B;  4PD2 A;  5FTL A;  3FE3 A;  2XD1 A;  3DFZ A;  3LW5 F;  4OJO A;  4G6Z A;  3E46 A;  3GLI A;  3AV0 A;  2XGN A;  3GLG E;  1OIP A;  2Z8Y M;  3W67 A;  3E21 A;  4DBG B;  1W1P A;  2KZS A;  1VEG A;  4Z2G A;  1J7K A;  3KSX A;  1TH4 A;  4Z2I A;  3U6M A;  4D82 A;  4IBG A;  3B7N A;  1LTM A;  2J5Y A;  5EP4 A;  2R44 A;  2BG1 A;  3TQS A;  5KPR A;  3U6L A;  3PNY A;  3SC3 A;  1RU3 A;  4IBI A;  1E6P A;  1EAK A;  1DGH A;  1YU1 A;  5BR8 M;  4OU7 A;  2EO2 A;  4DR3 M;  1NHW C;  3K9P A;  4NZ3 A;  2CFO A;  2EJS A;  3FYD A;  3FUT A;  3HKP A;  4F2L A;  3U6D A;  2XD5 A;  5EP3 A;  3ZC7 B;  4YHH M;  3C9P A;  1SXJ E;  4Z2L A;  4X64 M;  1NNU C;  3JAM S;  2R62 A;  4DR6 M;  4KLN A;  1WGN A;  3AJI B;  3HJ8 A;  1I94 M;  1J5E M;  2C9C A;  2JZ0 A;  3K1J A;  2JY7 A;  4B3M M;  4JI4 M;  1SXJ C;  2Y20 A;  1YUE A;  1GLN A;  3FUW A;  3V76 A;  2DAG A;  2L4F A;  3VFD A;  2LTU A;  3MMP A;  4OW0 A;  1N78 A;  2JE5 A;  1E88 A;  4OJP A;  2EA0 A;  3MJ5 A;  1IXS B;  4AKH A;  4Z2J A;  2CEA A;  2DAE A;  2DZN B;  4B3R M;  2K6B A;  1VDD A;  3EIE A;  5EJC A;  4AKI A;  1GXD A;  3DA1 A;  4OJ6 A;  2ZAO A;  2D7H A;  2L7H A;  4TUW A;  5FLX S;  4LJ5 A;  4CJ6 A;  3UMM A;  1N75 A;  1OQY A;  3THG A;  1XNQ M;  3J27 B;  2DXI A;  4PDI A;  1TGU A;  2AHM A;  2YQZ A;  3GLH A;  1QAQ A;  3IHP A;  3B7Q A;  4KHP M;  1PDC A;  1SXJ D;  1QAM A;  4NRW A;  2OQ4 A;  2RGH A;  2CHV A;  1VEK A;  2BJW A;  4KO8 A;  4LCB A;  1V92 A;  1MU5 A;  1P3Q Q;  3FKE A;  2UXB M;  1WXQ A;  3R9X B;  1WGL A;  4HL4 A;  1FJG M;  3B9P A;  2BNK A;  3KXE C;  2ZBK B;  4HLQ A;  1OFH A;  2WZJ A;  4JXJ A;  4GKK M;  3FD9 A;  3GRR A;  3HY5 A;  4MH0 E;  4MGY E;  4DR7 M;  1MX0 A;  3T38 A;  7CAT A;  3AL0 C;  1NO1 A;  2JP7 A;  1PJI A;  4Y28 F;  1HNZ M;  1GJT A;  3LVW A;  1E32 A;  3U61 B;  5EQT A;  4BBA A;  1W5S A;  2LVP C;  4X65 M;  2W82 A;  2MH8 A;  4DV3 M;  1YLA A;  3M7G A;  1GO5 A;  4DV6 M;  1NSF A;  3KOX E;  4YY3 M;  2UXC M;  4WP2 A;  2V5O A;  2OPF A;  1E8B A;  1N36 M;  3W0F A;  1WHC A;  2DWN A;  3NBX X;  1XWI A;  5DYG A;  2KRK A;  2O25 A;  4G3O A;  2DKL A;  2GQF A;  1Z5A A;  2DEN A;  4LJ4 A;  4LZJ A;  1I4W A;  1D0K A;  3SAV A;  4NXM M;  3E4R A;  2IOU A;  4LJ9 A;  1CUK A;  3U5Z A;  4XK8 F;  3ZCB B;  2O01 F;  3GPU A;  1NY6 A;  2DAM A;  3WD3 A;  2UWX A;  1QVR A;  3VDU A;  5DYI A;  2EUC A;  4X62 M;  1DO2 A;  4BLC A;  4NOO B;  4MGI E;  4NSO B;  1XXH B;  4JI6 M;  1QDR A;  2K9D A;  2H5X A;  3FYC A;  2Y2L A;  2YFQ A;  2F5P A;  1IY0 A;  4IBF A;  1C7Y A;  3C58 A;  3VDP A;  3T6P A;  3SHG B;  4LJ7 A;  4LFC M;  2D7E A;  2XZF A;  2D49 A;  2JY6 B; 
#chains in the Genus database with same CATH homology
 5FTJ A;  2UUB M;  3FUV A;  3HSH A;  1L1Z A;  2VQF M;  3HHY A;  4FWH A;  2HL7 A;  3RGS A;  3J81 S;  3UJN A;  2XH9 A;  4LF8 M;  1GL7 A;  4B7H A;  4LG2 A;  1QAO A;  1KSF X;  1DO0 A;  4B3S M;  3EIH A;  2LH0 A;  3VKH A;  3U60 A;  2C96 A;  5IZ7 D;  3LQQ A;  1GKI A;  1Z5B A;  3I51 A;  1Z6T A;  3E9S A;  4DV7 M;  1N34 M;  2Z4S A;  1SXJ A;  3ILK A;  3SMP A;  3J7A S;  1DGF A;  3VK8 A;  2XF3 A;  1S3S A;  3MHV C;  1OFI A;  2C5R A;  1C1K A;  2QCU A;  5C1B A;  4CHT B;  1IBK M;  2DZO B;  3U6Q A;  1IXR C;  2M60 A;  4WUR A;  3J80 S;  2KEB A;  4LF7 M;  2DWL A;  3IG8 A;  2Z7J A;  2L6O A;  4W5W A;  5ITR A;  4FCV A;  2P5T A;  5GKN A;  3JR5 A;  2R65 A;  3HGI A;  3D8L A;  3SMS A;  1QQW A;  5KPZ A;  5ITU A;  3GQ5 A;  1HNW M;  1Z5C A;  3L25 A;  1YU2 A;  2FNA A;  1PM5 A;  3PNV A;  4LZZ A;  4DV4 M;  2FE8 A;  3T1H M;  4LF6 M;  5H37 D;  4DV2 M;  4AI6 A;  3GQ4 A;  2D7G A;  4G4Q A;  4NZ4 A;  4GC5 A;  4JI5 M;  4NRV A;  2Z3X A;  2Y2I A;  1TH2 A;  2M5Z A;  3K92 A;  3RFW A;  3K8Z A;  2Q2E B;  1IXZ A;  2FOI C;  4FWG A;  3A42 A;  1HT1 E;  5IRE B;  4DV5 M;  1IM2 A;  3BOS A;  4RF0 A;  1G41 A;  4LGY A;  5ITY A;  4WW0 A;  1R7R A;  5KQD A;  3T1Y M;  4A3V B;  4FD2 A;  2UXD M;  2KA6 B;  2LXE A;  1IN4 A;  4B08 A;  3L26 A;  1G4A E;  1QAN A;  2ZM6 M;  3U61 A;  2JA2 A;  5F3W A;  1XMO M;  3UZU A;  2DWZ B;  3PXG A;  1YU4 A;  2J7N A;  3J7B A;  1QYR A;  4OJ5 A;  1IN7 A;  1ZAE A;  4OUI A;  3SBJ A;  4M0D A;  3U6E A;  5EXT A;  1R6B X;  4LFB M;  2V6Z M;  3KOW E;  1NVM A;  3GLI B;  3SAW A;  3VK7 A;  3AOG A;  4Z6Y A;  5ITQ A;  1D2N A;  1XHB A;  1K82 A;  2CV1 A;  4R3D A;  2XLJ A;  2Y2K A;  2ZAN A;  5FTK A;  4Z8X A;  2QBY B;  1GVN A;  1IN8 A;  3SYL A;  4DR5 M;  3TPZ A;  3ZH9 B;  5FSW A;  4JI0 M;  3CF0 A;  4JI2 M;  4NXN M;  3R8F A;  3GLF A;  3SAU A;  3PVS A;  2CHG A;  4IIW A;  1DGH B;  3QWL A;  4JYA M;  4AQY M;  4M9S A;  3QAU A;  2ZAM A;  3H4M A;  4G4N A;  3KSJ A;  2QZ4 A;  3KS8 A;  2XFS A;  1YSY A;  1NJF A;  3KW6 A;  4NSR A;  4GHA A;  5DNY A;  4CGY B;  4GKJ M;  4AG5 A;  4P16 A;  1IY2 A;  4B7G A;  2DVW B;  2QEN A;  4XBO A;  4ITQ A;  4OJL A;  4M9X A;  5C18 A;  4QNL A;  1G3I A;  2Y21 A;  3NBI A;  4R7G A;  2BJV A;  4PCZ A;  2R18 A;  4NYU A;  3N3F A;  1G8P A;  4QHS A;  5ITX E;  5ITT A;  3KFU G;  4G4O A;  3GRU A;  1OJL A;  4I4L A;  3U6P A;  2O5R A;  4DR1 M;  2CV0 A;  1XC8 A;  4MGZ E;  3UK6 A;  2UUA M;  2R4E A;  3K2L A;  2UUC M;  2JCH A;  2C99 A;  4JI7 M;  4LJA A;  3GPX A;  3A45 A;  2QP9 X;  2R45 A;  1GL6 A;  2DHR A;  2R4J A;  5EP2 A;  4JI3 M;  4PDG A;  2V1U A;  2YR0 A;  1HT2 E;  3HJS A;  3HON A;  4II7 A;  3OTO M;  8CAT A;  4KOD A;  5LMU M;  1L1T A;  1YU0 A;  4MB7 A;  2C98 A;  3FTD A;  3HHX A;  1LV7 A;  4RF1 A;  1IBL M;  4EIW A;  2Y2M A;  4IJE A;  3CTW B;  4K0K M;  3HHZ A;  3GRV A;  3FTF A;  2J7O A;  1Q3B A;  2XZU A;  2HKJ A;  4L78 A;  1L2D A;  1E9R A;  3U6O A;  4IBB A;  3GPY A;  4DV0 M;  4OVZ B;  4REZ A;  4IBE A;  1IY1 A;  4GH9 A;  4JN6 A;  3SHF A;  1FNN A;  4OX9 M;  3D8B A;  4LRS A;  2G8L A;  4DV1 M;  2Z4R A;  1UM8 A;  3GPP A;  5FTN A;  3U6S A;  3SAR A;  2CHQ A;  2KRU A;  4DR2 M;  2H1R A;  4DR4 M;  4LFA M;  1YE9 A;  4DUZ M;  4GRI A;  3GLG B;  3HWS A;  4AG6 A;  4LJ6 A;  1R2Z A;  2LNH C;  3Q8X A;  3CF2 A;  1PJJ A;  2KZU A;  3HJQ A;  1L2B A;  4GC9 A;  2Y2N A;  1HQY E;  1IN6 A;  4GHL A;  1E9S A;  2FFJ A;  3L27 A;  4IBD A;  1ZQ9 A;  2R46 A;  2ERC A;  5EXS A;  4LF4 M;  4LY6 A;  4LF5 M;  3JR4 A;  2A5Y B;  2XSZ D;  4IBJ A;  3CF6 E;  4L16 A;  2QBY A;  4L8R C;  3W0L B;  3HHW A;  2DWM A;  4JI8 M;  4L4U A;  4PT5 A;  3GRY A;  3U6C A;  3U60 B;  4IBK A;  3KDS E;  2Y2G A;  5IT9 S;  1NJG A;  1NY5 A;  4GIP A;  4MGK E;  3TWL A;  1R2Y A;  1SXJ B;  4QOS A;  2Y2P A;  3MK6 A;  4DUY M;  2HCB A;  3SYK A;  1TDZ A;  2X4A A;  3I4Y A;  4QNR A;  3VKG A;  3T15 A;  4G4R A;  3KP1 E;  1N33 M;  2F5O A;  1G59 A;  2E5L M;  2Y0Q A;  2L09 A;  4IBC A;  5ITX A;  1JR3 A;  3SFZ A;  1H6U A;  1EE8 A;  2KXE A;  2CV2 A;  2RKO A;  1E94 E;  3DOA A;  2F4V M;  1DGB A;  3PFI A;  1QZM A;  3VLF B;  4FCW A;  3M0E A;  3SAS A;  1XXH A;  3GQ3 A;  4MGH A;  4IJF A;  1T3T A;  1KYI A;  2F5Q A;  4LJ8 A;  1DGG A;  3HU2 A;  4LF9 M;  4NZ5 A;  2F5N A;  1XNR M;  4GIT A;  3RE8 A;  1N32 M;  4FCT A;  4I81 A;  2VII A;  5FTM A;  2G5G X;  2Y2Q A;  2C9O A;  2HHH M;  5BPV A;  3FUX A;  4BB9 A;  3UGJ A;  4QNM A;  4X66 M;  3L28 A;  4I5S A;  2X49 A;  1YUB A;  3GO8 A;  2UU9 M;  3AOE A;  4NY2 A;  4JV5 M;  2RGO A;  1K3X A;  4NYY A;  2I7P A;  1N77 A;  5IWA M;  2VQE M;  2XSZ A;  4MM3 B;  4D80 A;  4M0W A;  1NNJ A;  2X8A A;  1NHG C;  1W5T A;  1Z59 A;  4S12 A;  2Y0T A;  4XGI A;  3TL4 X;  3AKZ A;  3A46 A;  5EXX A;  1XMQ M;  3FTE A;  3LMM A;  2K47 A;  3FUU A;  1JQJ C;  4OVZ A;  1J09 A;  3GLH B;  2F5S A;  4I8O A;  4NZ1 A;  3TWK A;  3KVW A;  4QHT A;  5E26 A;  4D81 A;  1HR0 M;  1TDH A;  5A2Q S;  3L2A A;  3KS4 A;  4ZPX A;  3HU1 A;  3WHL A;  3GP1 A;  2CUZ A;  2Y2J A;  4RNA A;  3KOY E;  4GMQ A;  5JI2 E;  3GLF B;  2I7N A;  3DZD A;  3NWL A;  1IN5 A;  5E6J A;  3L29 A;  5EXP A;  3GLG A;  1JR3 D;  1HNX M;  3TWM A;  5KPT A;  2QPA A;  3HU3 A;  3M6A A;  4M9Z A;  3SAT A;  5KO3 A;  3WHK A;  3IG5 A;  4AZF A;  5JI3 E;  4FWD A;  1L2C A;  4LRT A;  2XEP A;  2LWX A;  1IBM M;  3TE6 A;  4AW4 A;  1TH3 A;  2CE7 A;  3KP0 E;  4FW9 A;  1YU3 A;  2Y2O A;  3AOE C;  1IQP A;  2YNM D;  4CIS A;  2NQ8 C;  4B3T M;  4AKG A;  1L8Q A;  3LQR A;  5EP1 A;  3U5Z B;  3A98 B;  3KOZ E;  1ORY B;  4JI1 M;  1HQC A;  4FVM A;  1KFV A;  3RGP A;  4L15 A;  1X37 A;  3J2P B;  3LVV A;  1Q39 A;  2V1C A;  5LMN M;  5KQ8 A;  2XFT A;  1Q3C A;  4LGM A;  3FTC A;  3I4V A;  3AFH A;  4B7F A;  2L7I A;  4NL4 H;  2KW0 A;  1K3W A;  2Y2H A;  4QOZ C;  2FFF B;  4PD2 A;  5FTL A;  2XD1 A;  3DFZ A;  4OJO A;  4G6Z A;  3GLI A;  3AV0 A;  2XGN A;  2KZS A;  1J7K A;  3KSX A;  1TH4 A;  3U6M A;  4D82 A;  4IBG A;  2BG1 A;  5EP4 A;  3TQS A;  5KPR A;  3U6L A;  3PNY A;  3SC3 A;  4IBI A;  1YU1 A;  1DGH A;  5BR8 M;  4OU7 A;  2EO2 A;  4DR3 M;  1NHW C;  4NZ3 A;  2CFO A;  3FYD A;  3HKP A;  3FUT A;  3U6D A;  2XD5 A;  5EP3 A;  3ZC7 B;  4YHH M;  1SXJ E;  4X64 M;  1NNU C;  3JAM S;  2R62 A;  4DR6 M;  4KLN A;  3AJI B;  3HJ8 A;  1I94 M;  1J5E M;  2C9C A;  3K1J A;  4B3M M;  4JI4 M;  1SXJ C;  2Y20 A;  1YUE A;  1GLN A;  3FUW A;  2JE5 A;  3VFD A;  4OW0 A;  1N78 A;  4OJP A;  2EA0 A;  3MJ5 A;  1IXS B;  4AKH A;  2CEA A;  2DZN B;  4B3R M;  1VDD A;  3EIE A;  5EJC A;  4AKI A;  4OJ6 A;  3DA1 A;  2ZAO A;  2D7H A;  2L7H A;  4TUW A;  5FLX S;  4LJ5 A;  3UMM A;  1N75 A;  1XNQ M;  3THG A;  3J27 B;  2DXI A;  4PDI A;  1TGU A;  2AHM A;  2YQZ A;  3GLH A;  1QAQ A;  4KHP M;  1SXJ D;  1QAM A;  4NRW A;  2OQ4 A;  2RGH A;  2CHV A;  4KO8 A;  2BJW A;  4LCB A;  1MU5 A;  3FKE A;  2UXB M;  1WXQ A;  3R9X B;  1FJG M;  4HL4 A;  4GKK M;  3B9P A;  2BNK A;  3KXE C;  2ZBK B;  4HLQ A;  1OFH A;  4JXJ A;  3FD9 A;  3GRR A;  4MH0 E;  4MGY E;  4DR7 M;  1MX0 A;  3T38 A;  7CAT A;  3AL0 C;  1PJI A;  1HNZ M;  3LVW A;  1E32 A;  3U61 B;  5EQT A;  4BBA A;  1W5S A;  4X65 M;  2W82 A;  4DV3 M;  3M7G A;  4DV6 M;  1NSF A;  3KOX E;  4YY3 M;  2UXC M;  2OPF A;  1N36 M;  3W0F A;  2DWN A;  1XWI A;  5DYG A;  2KRK A;  4LZJ A;  4LJ4 A;  4NXM M;  1Z5A A;  3SAV A;  1I4W A;  3E4R A;  2IOU A;  4LJ9 A;  3U5Z A;  3ZCB B;  3GPU A;  1NY6 A;  2UWX A;  1QVR A;  3VDU A;  5DYI A;  2EUC A;  4X62 M;  1DO2 A;  4BLC A;  4NOO B;  4MGI E;  4NSO B;  1XXH B;  4JI6 M;  3FYC A;  2Y2L A;  2YFQ A;  2F5P A;  1IY0 A;  4IBF A;  3C58 A;  3VDP A;  3SHG B;  4LJ7 A;  4LFC M;  2D7E A;  2XZF A;  3WX7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...