2Y2HA

Penicillin-binding protein 1b (pbp-1b) in complex with an alkyl boronate (za2)
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
487
structure length
467
Chain Sequence
SEITYSDGTVIASIDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTGQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PENICILLIN-BINDING PROTEIN 1B
publication title Structure-Guided Design of Cell Wall Biosynthesis Inhibitors that Overcome Beta-Lactam Resistance in Staphylococcus Aureus (Mrsa).
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
total genus 159
structure length 467
sequence length 487
chains with identical sequence B
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2y2hA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2y2hA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2y2hA02
3HUMA 1KVMA 1MWRA 2XFTA 4K0WA 4OOMA 4KG5A 2P9VB 4QHCA 4XXRA 5E2EA 2J7VA 3HLBA 5EE8A 5JYPA 3GVBA 2V20A 4WZ5C 5CRFA 3ITAA 5HW3A 5CHMA 4GD8A 5FA7A 1TEMA 2WZZA 3C7VA 3NBLA 5TR7A 3NDGA 5FAQA 5HFOA 1W8YA 4EQIA 3VOZA 3IH9A 2ZC5B 3OPPA 2V1ZA 4U0TA 5A92A 5EVIA 4PM8A 4PM7A 5FATA 3TSGA 3UDIA 4E3LA 1VQQA 4E3NA 3W8KA 5KSCA 5CGXA 4HESA 1FCMA 2XR0A 2Z2LB 3ZNYA 3MZFA 5AQAA 4B88A 4DE2A 5EVID 1FOFA 3IWOA 4OPZA 4WMCD 4ZAMA 3M2KA 1K4EA 4KZ6A 4E3IA 2XLNA 2XDMA 1CK3A 4QU3A 4UAAA 2J9PA 4LCLA 2Y2QA 1DJAA 2ZC3B 5EUAA 1XA7A 4DDYA 1H8YA 1BT5A 2ZM0A 3N8RA 5F1GA 4X69A 4KQOA 2A3UA 3LCEA 1YM1A 4C3QA 2WGWB 3HLFA 3HUNA 3RJUA 2PBYA 5E2FA 5CEDA 5L2FA 5DF7A 3G4PA 4DXCA 4JXWA 5F83A 3ZGAB 4KG6A 1JWPA 3ZHHA 5CGWA 4R3JA 2Y91A 3A3IA 3CMZA 1PW1A 3SOIA 2ZC6B 4ZJ1A 1IYOA 3O3VA 5GLDA 2I72A 3GSGA 3FKVA 3E2LA 1GA9A 3FZCA 3HL9A 3UNWA 2Y2OA 1PWCA 3FYZA 5EOOA 1PWGA 4WZ4A 4LV2A 1CEFA 4P6BA 2Y2MA 3HLGA 3IF6C 1CI8A 4JLFA 1BSGA 4X55A 3VP4A 1IKIA 1BTLA 2P9VA 1DY6A 2C5WB 3PAGA 4NETA 3SH8A 3W4QA 3WRZA 4EV4A 3BFGA 2HPBA 4P85A 5CTMA 4GDBA 4RA7A 3HLCA 4N9LA 2V2FF 5CEBA 3HLWA 4Y0OA 3HVFA 5DTSA 3VOYA 2X71A 3OPHA 1K56A 5FDHA 3ISGA 3P98A 4UHUA 4E3OA 5CHUA 4KZ5A 1YLTA 1E4DA 5E2HA 1K56D 4OPQA 4P87A 2B5RA 1RGZA 5FASA 3GTCA 4OPRA 4X56A 1O07A 2JCHA 3N4IA 3IWIA 1FCOA 1K6SA 1I2SA 1SHVA 4S2OA 1JWVA 3E2KA 1M6KA 4E3JA 4OVDA 2Y4AA 3PBTA 4OONA 1MY8A 2ZC7A 4RX2A 1DJBA 1JWZA 3MKFA 5A90A 2J8YA 1MKIA 4PPRA 2EX9A 1BUEA 1G6AA 1LL5A 3ZNTA 1N4OA 5M19A 3IHAA 1W8QA 1XKZA 4IBXA 4S2PA 5IHVA 5FAPA 4BD1A 2HDQA 4MBKA 2WADA 2XQZA 1QMEA 4QY6A 5DTTA 2VGJA 4BL2A 1RCJA 5HX9A 4OQ0A 1L0GA 2WGIA 1PZOA 2XEPA 5FQ9A 3QNBA 4ID4A 2HP9A 5EOEA 1Q2PA 3FKWA 4WM9A 4R4RA 1O7EA 4PMAA 1KDWA 4BD0A 3V3RA 1WE4A 1ZG4A 1LI0A 4X68A 2WYXA 4OQHA 1EWZA 3GRJA 5U47A 3A3JA 5EVIC 5JYOA 4X53A 2J9OA 2GDNA 1YMXA 4Y0UA 3NDEA 4WELA 2XH9A 1E3UD 1K38A 4N1HA 2EX6A 4CPKA 3BFFA 4DDSA 3MZDA 4EBLA 4EWFA 5GHZA 2EX8A 1K25A 1ES3A 1KGGA 4KZ9A 4JF6A 5CERA 1DJCA 4YINA 5M18A 2JC7A 4QB8A 3LO7A 1J9MA 2R9WA 4N1XA 3Q7VA 4OOLA 3OPRA 4BENA 2EFUA 4LV1A 3ZVWA 3EQUA 3MZEA 2Y2KA 4U3TA 5GLAA 4Y7PA 3IQAA 4R4SA 3UPPA 4MNRA 4WMCA 2BLSA 4N9KA 2E8IA 3N6IA 3IXBA 1WYBA 1K57A 1MBLA 4IVKA 1LI9A 1ONHA 1BLCA 1BLHA 1C3BA 3HUOA 4OP5A 3NC8A 4FH2A 4S2MA 3UO9A 4E6WA 2RCXA 5GLCA 4R1GA 4Z9QA 2Y2HA 3M6BA 3HREA 4OQGA 5CGSA 1AXBA 3VSKA 2G2UA 2PU2A 5HAIA 4F94A 5EECA 1BLSA 5GLBA 4C75A 3A3EA 2IWDA 1SCWA 1BZAA 1K4FA 1RGYA 1RP5A 2ZQCA 3IF6B 3ZG0A 3ZG8B 4KZ3A 4WBGA 2R9XA 3PBNA 4EBNA 4PM5A 5TGFA 3NCKA 3HLEA 5G18A 1VM1A 3WS5A 2OLVA 5FQJA 3C5AA 5FI6A 5BOHA 2C6WB 2PU4A 1IYPA 3M6HA 4KZ4A 1QMFA 3SH9A 1BLPA 1N9BA 1CI9A 3BFEA 3LY4A 1ES4A 3O86A 3QNCA 1G68A 4XUZA 3OC2A 4KG2A 4KZ7A 1ES2A 1FSYA 1H8ZA 3W4OA 5A93A 5GHYA 1KE4A 2XK1A 3N8SA 1HD8A 2EFXA 3PBQA 4JF4A 1PI5A 4JPMA 2DCFA 3DWZA 1L0EA 2HP5A 3CG5A 1FQGA 1MPLA 4HEFA 4BL3A 1K6RA 1YLPA 2EX2A 2Y2IA 5DF8A 5HAQA 1JVJA 4EBPA 3P09A 4O7DA 1YMSA 2HDRA 3BFCA 2WK0A 3G34A 3MXRA 4OH0A 2OLUA 1FR1A 1JTGA 5DF9A 2X01A 5F1FA 1YLJA 3CZDA 4ZJ2A 3DW0A 2XD5A 3PTEA 4S2LA 1LHYA 3N7WA 3FV7A 5FAOA 1GHPA 1PWDA 1OMEA 1NXYA 3HBRA 3VP1A 5D3OA 3MBZA 1NJ4A 4Q8IA 4DRTA 3IXGA 2ZMAA 3O87A 2WGWA 4L0LA 4QY5A 3ZDJA 1HZOA 3IHBA 4OLGA 1YT4A 1IYSA 5FQMA 4U0XA 3G35A 2Y55A 1KE0A 4FSFA 5FI7A 5KSHA 1EI5A 3BFDA 3G30A 1XP4A 2OV5A 1IKGA 3Q07A 3VP3A 1KE3A 3ZG5A 2JBFA 3D4FA 1ES5A 2RL3A 4KQRA 3BRMA 4LENA 1LL9A 4LCMA 3ZVTA 3M2JA 4KENB 2ZC4B 1ZC2A 4KZBA 2ZM2A 2ZQ9A 3VSLA 2Y2NA 3SS4A 4XUXA 1ZKJA 4KZAA 2WUQA 4ZJ3A 4LV3A 3Q81A 4IBRA 3B3XA 1H5XA 1NZUA 3UPOA 1IYQA 3OZHA 1E3UA 4BQMA 5KZHA 1S0WA 3TOIA 4GN2A 4N92A 1JTDA 1K57C 1W5DA 1SDEA 3PBSA 1KDSA 1ZG6A 1ESUA 1FSWA 1I5QA 3BLSA 4S2JA 3BLMA 3MFDA 4S2IA 3S4XA 1KGEA 2WZXA 3GR2A 3UN7A 2XGNA 1BULA 3VP2A 4DE1A 2ZQAA 3QHYA 4DXBA 3ZG7B 1W79A 4PM6A 2H10A 2H0TA 4K0XA 3W4PA 4DE3A 4GOGA 2BG1A 1XGJA 1ALQA 5DTKA 1ERQA 2ZJ9A 3BYDA 1CEGA 2DRWA 3IXDA 4P0MA 3A3DA 5AQ7A 3UE3A 3RXWA 3BECA 1SKFA 5A91A 3ZFZA 4HBUA 3BEBA 1HTZA 3V50A 4DF6A 4OP8A 1PYYA 3IH8A 4UA7A 4GKUA 3G2ZA 4JKTA 1Q2QA 3EQVA 4D2OA 4RYEA 2Y2PA 2Q9NA 1WYCA 2ZQ8A 4IEDA 3S22A 4KZ8A 1YLWA 3S1YA 3WS1A 5HL1A 4S2NC 3OCNA 4GZBA 4WEJA 1K54A 1GA0A 4OQIA 4EUZA 3AGDA 5CXWA 4UA6A 1HVBA 5CHJA 1Z6FA 2WKIA 5DVAA 2XD1A 1E25A 2IWCA 2WKHA 1TDGA 3PBRA 4JBFA 2XF3A 2Y59A 3CJMA 4JXSA 1YQSA 4JXGA 1K55A 5HAPA 4JXVA 2X02A 1GCEA 3Q7ZA 3AGFA 4GD6A 5CECA 2JE5A 5I94A 2VGKA 1MWTA 4M3KA 3G2YA 5HARA 4GDNA 4OKPA 4WZ5A 3NIAA 5E43A 2QPNA 4UA9A 4DE0A 1YLYA 2G2WA 4FH4A 2Y2JA 1ESIA 1TDLA 3AGEA 3IWQA 4MEZA 1XGIA 3A3FA 4S2KA 5EPHA 4S2NA 4E6XA 3GQZA 4RVAA 1FR6A 5CTNA 3LY3A 3OCLA 3RXXA 3MXSA 2DNSA 2XFSA 3WS2A 3V39A 1KVLA 1PI4A 5FSRA 1Y54A 1TVFA 2UWXA 1NYMA 2ZQDA 4OPYA 4QJGA 5M1AA 3Q82A 2CC1A 3BM6A 3DWKA 1NRFA 4IVIA 2IWBA 1NY0A 3IF5A 4B4ZA 3MKEA 3GV9A 3JYIA 4GNUA 2WGVA 5FQQA 4JF5A 4R0QA 4CJNA 4DKIA 2Y2GA 3SS3A 2HDSA 4BJPA 4R23A 1L0DA 1SDNA 4KQQA 4MLLA 4GB7A 2Q9MA 2H5SA 3UY6A 5J8XA 1XXMA 3NI9A 1ERMA 3IXHA 4MBFA 5FQIA 3VP0A 2QZ6A 2EXBA 5TFQA 1XPBA 2OSUA 3VFFA 4E3KA 1XA1A 3PBOA 1MXOA 2Y2LA 1XX2A 2FFYA 2P74A 2ZQ7A 3C7UA 3IT9A 3V5MA 4Y0TA 1EROA 3OPLA 4H8RA 4ZTKA 3UPNA 4MBHA 3DTMA 2ZD8A 5GL9A 4WEKA 3I7JA 1PZPA 1U60A 3VMAA 3UDFA 3SS5A 3ZCZA 1MWSA 3WWXA 3IF6A 4RX3A 2ZM8A 1IELA 2WAEA 4B4XA 1KGFA 3FWLA 5E2GA 3Q7VB 1GHMA 4A5RA 1LLBA 1W7FA 5EVIB 3O88A 1NYYA 2HDUA 3NY4A 5AQ9A 5EVLA 4NK3A 4K91A 1M40A 3WS4A 2EXAA 3Q1FA 4FD8A 1MWUA 1ONGA 4ZDXA 1L0FA 4YFMA 3N8LA 3GMWA 2Z2MB 2ZLYA 3C4PA 3G31A 3C4OA 2H0YA 3WS0A 3UE1A 1PIOA 3PAEA 4WYYA 4ZBEA 1I2WA 2WAFA 1L2SA 1NZOA 1GHIA 2WKEA 4E3MA 2QMIA 4PM9A 4C6YA 3ITBA 5KMWA 4R3BA 3UDXA 4FCFA 5GHXA 3V3SA 1K54C 1S6RA 4OOYA 2HP6A 2FFFB 1IEMA 5FI2A 5FQKA 3VFHA 3SH7A 4BLMA 4X6TA 3ZG9B 5AQBA 3UE0A 5F82A 3HLDA 3LEZA 2A49A 3WRTA 4QD4A 4LV0A 4OLDA 4HBTA 3TG9A 3G32A 1K55C 1PW8A 1YLZA 1FCNA
chains in the Genus database with same CATH superfamily
4LPZA 1LL8A 1MWRA 2W1TB 4XXRA 1UWNX 3HLBA 3GVBA 4WZ5C 5HW3A 3UT9B 1M19B 1CXWA 4I39A 4JGQA 5FAQA 4ETXA 4EQIA 3LZ0C 2V1ZA 4U0TA 5EVIA 3TSGA 3LEQA 1VQQA 5KSCA 2F8ND 3W8KA 4XT2A 1W1VA 1FCMA 3AZKB 1YPRA 2XR0A 2Z2LB 4B88A 5FEGA 3NOTC 4OPZA 4KZ6A 3WD1A 2J9PA 4Z5TB 1TS0A 4ARZB 5EUAA 2VV7A 4DDYA 3N8RA 5F1GA 1X0OA 2FZ0A 3X1TD 3HLFA 1GPFA 2XRNA 3MNNB 4O8GA 3G4PA 4CLCD 4JXWA 4R3JA 4OJ6A 5FUGB 3A3IA 4H9PA 3KUYC 5HPIA 5HPFA 2PDRA 4ZJ1A 3C30A 3O3VA 4JJNA 4HJ4A 4UPKA 3T4SA 3FKVA 3UNWA 3REJC 3FYZA 5MC7A 3IX8A 3TW8A 2HUEB 3AFAC 1YSPA 3IF6C 3CITA 5HL6A 1BTLA 3RH8B 3SH8A 3BFGA 5F99C 4P85A 5CTMA 4GDBA 3HLCA 2V2FF 1VETA 3HLWA 5AV8B 2PR6A 3LIFA 4J8WC 2D49A 3OPHA 1K56A 3EGDC 3P98A 4E3OA 4DRBA 1RGZA 2RIQA 5FASA 3K3CA 1O07A 4H9SC 3IWIA 1I2SA 4J8XB 3KXBB 4S2OA 3AYWC 3DAVA 2EWWA 3MVDA 4E3JA 5AVBD 2V8FA 4OVDA 2LY8A 3AV1C 2QYBA 4OONA 4XUJB 4P6ZS 3O62C 4NZ5A 2EX9A 3ZNTA 1W8QA 5BT1D 4IBXA 4J8VC 2NQBC 4MB4A 3IX4A 2WADA 3C1CA 2RVQD 5CP6C 3REKC 1QMEA 2ZBBA 4QY6A 4EETB 1P3OA 3B6GA 1L0GA 5AV5C 1PZOA 1S32C 3R4KA 4ID4A 5EOEA 3W98A 3FKWA 2BYKA 1O7EA 1EQZA 2IA2A 3WD3A 3V3RA 1KX5C 1ZG4A 4X68A 4L9EA 2WYXA 4OQHA 3T4QA 2W3FA 5U47A 1P3IB 1K0KA 4IBIA 2J3TC 4WELA 2UV0E 1K38A 4QPRA 4N1HA 4KGCC 5CHLB 2QJ5A 3MJQA 5AV8D 3UTBA 2VA0A 1P3FD 3QP5A 4EBLA 1ES3A 1P3LC 4YINA 4QB8A 5AVCA 2R9WA 2JHEA 2Y2KA 4U3TA 5GLAA 4Y7PA 2V1BA 4Z66A 3KXBD 4J8XD 4CSRB 2BLSA 4H9OB 2ZY3A 4IBCA 4IVKA 1H3OA 3CAXA 4XUJD 3IX3A 3HUOA 1OT9A 5JRGC 3NOPC 2J8PA 5DJUA 3X1VB 3X1TA 5AV9A 5GSUA 4GJ4A 3VH5A 4JGOA 5CGSA 1AXBA 3AZLC 1LSWA 2FJ7B 5HAIA 3A1KA 3W99A 1SCWA 1RP5A 5AV6B 3IF6B 5DNMB 5TJJA 3PBNA 1W1YA 4PM5A 3WS5A 4IBJA 5FQJA 1G6OA 3C5AA 4NYYA 2C6WB 4KZ4A 3SH9A 3RFBA 2HJEA 1P3ID 3MGSA 4J8WB 4YNRA 3MR0A 2W1TA 1KX4C 4KG2A 4KZ7A 1ES2A 1FSYA 5A93A 1KE4A 4ETZA 5BO0B 3UT9A 1M19A 3PBQA 4JPMA 4X23A 4GHAA 5AJGA 4HH3A 4HEFA 2NUTC 1G28A 1K6RA 3AYWB 3LZ1B 5DFYA 3AZEB 4EBPA 1A7WA 3AZKA 2OLUA 3AZFB 1FIKA 1JTGA 5B0YB 2ZY5A 5F1FA 4ZJ2A 2XD5A 4Z5TA 5C3IB 3FV7A 1GHPA 3H0RC 5CP6B 3REKB 3MBZA 2ZMAA 1CJFA 5B1MC 3X1VD 3T4LA 3O87A 1TS6A 3ZDJA 4OLGA 2VEAA 3AZHB 3MNNA 5FQMA 2F8NG 5GT3A 1KX5B 5KSHA 2FJ7D 3BFDA 1YUEA 1XP4A 2O9AA 2OV5A 3Q07A 2HV1A 4HP4A 1OTEA 1PFLA 3GECA 1KE3A 1W63M 1ID3D 4YM6C 1ES5A 5AV6D 2RL3A 2KOIA 1E6NA 3C1BB 5DNMD 4J8UC 4LENA 3M2JA 4KENB 2ZM2A 2ZQ9A 1Z09A 4EEUA 3QP1A 1F66D 5J3WA 2WUQA 1TD5A 3B3XA 4GCZA 4HJ6A 3UPOA 3L25A 1S0WA 4KUDC 3S7PA 1K57C 1KDSA 2PYPA 3TJZC 1ZG6A 4DQYB 3MFDA 4S2IA 3GR2A 3B0BA 4Z2JA 1BULA 1EW0A 4DE1A 2QHKA 2ZQAA 3AZNB 3ZG7B 1W79A 1P3GB 3LZ1D 4DE3A 3AZED 2BG1A 1P3AA 2NZDC 2B02A 3WKJB 1XGJA 5DTKA 4G92C 4DJ3A 4J8XA 2ZJ9A 3AZFD 1H3QA 4HY8A 4NE6A 1F5MA 3H7WB 5A91A 5B0ZC 3B6FA 4HBUA 3BEBA 5B2JC 1HTZA 3KSFA 2GZAA 3IH8A 3VH5T 2Z6CA 4D2OA 2Y2PA 3AZHD 5GT0B 4KZ8A 3WS1A 4S2NC 2B18A 3AN2A 3D3OA 2YFWB 3IP4C 3HSHA 1TDGA 2Y59A 3C1BD 1GSXA 4I3AA 2AROC 4JXVA 3Q7ZA 4XZQB 1KX4B 3NJAA 2IOUA 2VGKA 4M3KA 3G2YA 1P3IA 5HARA 4WZ5A 3NIAA 3OOVA 3TRCA 4B9OA 4R8PB 2G2WA 5DNNB 3T1QB 4YWZA 2Y2JA 1TDLA 1OT6A 4R38A 1XGIA 5FL3A 3LY3A 3WS2A 3LZ0A 3UB9A 1KVLA 3KX0X 3TU4C 4KHAB 2HF6A 3AZGC 3AZND 1D7EA 1TVFA 5E5AC 2ZQDA 2OOLA 3BM6A 3WKJD 3IF5A 4HH2A 3MKEA 1Y4OA 4CSRA 3SS3A 5B1MB 1SDNA 4KQQA 4MLLA 3X1SB 4Z2MH 1XXMA 4NYUA 2PYOD 2ZMFA 4MCWA 3MS6A 2CV5C 1P3PB 1MXOA 2FFYA 2ZQ7A 1WA9A 2INWA 3V5MA 3LR0A 4YM6B 3KUYA 3IS2B 4ZTKA 4EU0A 5GT0D 2FJ7A 4WU9D 2MJ6A 2ZD8A 4EESA 1PZPA 3SS5A 3IF6A 2CWEA 3FKEA 3L27A 2W3EA 1E6PA 3Q7VB 4IBDA 2YFVB 5EVIB 3UE6A 2LB9A 3MGQC 4XZQD 5AQ9A 4K91A 3H0MC 2PT7A 4NXFA 4J8WA 3Q1FA 4R8PD 3W97D 5DNND 2P08A 4WU8C 1M1AD 3UB5P 4ZDXA 4YFMA 3N8LA 5B33B 3R45A 4MN6A 3LR3A 5BO0A 2Z2MB 1E6ZA 2NUPC 4PAUA 2NZDB 3G31A 3WS0A 2H0YA 5G4ZA 4WYYA 3AYWA 4MN5A 4ZBEA 1I2WA 2WAFA 1L2SA 3CUEA 4R70A 1CK7A 3AZEA 3AV1A 4ZUXC 4II7A 2F8NH 4O01A 5AVEA 2KDKA 3O62A 5CPKC 4H9PB 4H9RB 5GHXA 2L0WA 3V3SA 5B0YA 1ZLAC 3O5YA 1L3LA 5FI2A 4J8VA 2NQBA 2BASA 3P5JB 4GLQA 3ZG9B 4GW9A 3X1SD 4Z2KA 4E04A 4QD4A 3REKA 5CP6A 5GXQC 3L7HA 4LV0A 3RTYA 1KS0A 3G32A 4LRYC 1P3PD 2XFTA 2A24B 5EE8A 4KG5A 4HJ3A 5CRFA 1AWIA 1H8PA 1KX5A 3NBLA 5TR7A 3NDGA 2AROB 1DRMA 3IH9A 5B24B 4WNNB 4PM8A 4E3NA 4HESA 5IT5A 3ZNYA 5EVID 1T1AA 4G91C 4HOIA 2ZC3B 2H28A 3HCYA 1P3LA 3TE8A 2F2AC 5HDCA 2WGWB 3HUNA 5B31G 5L2FA 3X1UC 4IBGA 3AZNA 5HWWA 1P3GA 3JVUA 3C1CB 4BMWA 3LELC 3BWLA 3UB8A 1P3OB 1U35C 1UGUA 1PW1A 4G3WA 5JRGA 3GSGA 4IHQA 2Y2OA 3AZMB 2CV5B 4MB3A 5EOOA 1EQZB 4WZ4A 3KWQC 4LV2A 1CEFA 5B1LB 4JJND 4P6BA 2Y2MA 3H7WA 5AVBC 3LYXA 1BSGA 4JLFA 2VV6A 2K31A 2L4RA 1DY6A 3PAGA 4NETA 4EV4A 3E4QA 5DKLA 2HPBA 4N9LA 1W1TA 1S4SA 3A0RA 3HVFA 5DTSA 3WD0A 2X71A 5FDHA 4WZSB 3UTBB 2RVQC 3KYEA 4KZ5A 5CHUA 2YFWA 1E4DA 1K56D 4OPQA 1E6RA 1QO6A 4P87A 2B5RA 3GTCA 1BH9B 5AVCB 2VJWA 3N4IA 1K6SA 4EQ1A 1OTIA 1SHVA 3ZYTA 1E88A 4XZQA 1KX4A 1M6KA 3AV2B 4Z66B 1P34B 5DNNA 3MVDD 5CPJB 1MY8A 1W63Q 2ZC7A 3UMEA 4RX2A 2FN2A 1JWZA 3S7QA 3H82A 1S4RA 1N4OA 1XKZA 4JGRA 4S2PA 2HDQA 4LLOB 5B2IB 2OWHA 5CPKB 5GSUB 4IJGA 4BBUA 2VGJA 4NKPA 2W3HA 3C1CD 2IO5C 3QNBA 1P3OD 4WM9A 4R4RA 3B6GD 4QLCC 4PMAA 1KDWA 4BD0A 2ZY2A 1GXDA 3W98D 5B1MA 3AZMD 1EQZD 5B1LD 3X1SA 1NLYA 3A3JA 2W3GA 5JYOA 4X53A 3NQUB 1BYWA 1YMXA 3ICYA 1N9OA 3C8CA 3MGSB 2XH9A 4YM6A 3IS2A 3BFFA 4DDSA 1KU5A 3WX7A 4EWFA 5B32C 4KZ9A 3UTBD 3ULFA 1DJCA 4X23B 3BY8A 1PNEA 3T1XA 4HIAA 4G91B 3Q7VA 4IBEA 4LV1A 3MZEA 2YFVA 5AVCD 3UMDA 1P3KC 3UPPA 3WD4A 4PKYA 5L8MA 2E8IA 1WYBA 1K57A 1LI9A 4Z66D 1WWIA 1P34D 2L5AA 5CPJD 1BLHA 1C3BA 3X1UB 4G3VA 4S2MA 5B33A 4E6WA 3MGPC 4X1MA 4Z9QA 2AVXA 2NZDA 2Y2HA 1U35B 3HREA 4OQGA 1P3MB 3VSKA 5B2ID 5AV9D 5GSUD 2JKFA 4F94A 4C75A 2IWDA 5GT3B 3H9WA 2ZQCA 3CPTB 2E8JA 3W99D 5B0ZA 2R9XA 4H9RA 5B2JA 4NE5A 4MN7A 3HLEA 5FI6A 1P9WA 2PU4A 1Q9CA 4OJPA 3LR4A 3VH5W 1N9BA 3WA9C 1MKMA 1G68A 2A24A 3MGSD 3OC2A 3MGRB 1AOIB 3DWZA 4EO5C 1L0EA 2HP5A 2AROA 3UT9D 1M19D 1YLPA 4X23D 5DF8A 5B24A 2JKTM 1TZYC 4WNNA 3JPUA 3P09A 1OGBA 1YU2A 5B31C 1M18C 2WKRA 1P3AB 1UR9A 3REHC 3AZKD 1YLJA 3DW0A 3L2AA 1LHYA 3E4PA 1PWDA 4DRTA 5I5LA 1F2KA 4Z5TD 5E5AA 3RELC 3B6FB 5HD5A 2WGWA 4QY5A 3U4LP 1P3BC 1IYSA 1P3MD 4U0XA 5BNVB 5CX7A 5EFWA 1KE0A 1J3WA 3QP6A 4HGAC 5FI7A 3MNND 3B0DC 3AN2B 3N3FA 5GT3D 3MQLA 3A6NC 1XJ2A 4KQRA 1LL9A 4LCMA 3AZMA 2CV5A 1N9LA 3EEAA 5B1LA 3A0VA 4NXGA 4XUXA 3SS4A 3QP2A 3LJAC 3LIAA 4Y2FA 1NZUA 3BJNA 2XROA 5KZHA 1JTDA 4LGWA 1W5DA 2ZM5A 1AOID 3BLSA 2I9VA 3BLMA 3VP2A 3WD2A 3LZ0B 3OLOA 4PM6A 3MGQA 4K0XA 2W0NA 4YS3C 1HQ3C 4L9GA 1ALQA 1BH9A 2GX5A 1D1JA 4Z2LA 3BYDA 1OTAA 4WU8A 1P3AD 3MQ0A 4P0MA 1BH8B 3A3DA 5AQ7A 3AV2A 1OPXA 3UE3A 1P34A 4KUOA 3BECA 4UUZA 5CPJA 2HIOC 1SKFA 1OGGA 4FUWA 5F68A 3AZJC 3F1OB 2K7SA 4DF6A 4WJ3C 1PYYA 3WTPC 3B6FD 4M6BA 4ZUXA 3G2ZA 4JKTA 1Q2QA 4Z1WA 3S22A 5B2IA 2ZQ8A 5CPKA 3S1YA 5HL1A 4Z2GA 3KYQA 3KUYB 5AY8C 5B40C 4H9NA 4UA6A 4I38A 1Z6FA 3AN2D 3REJB 2WKHA 4JBFA 2XF3A 1L6JA 3KFUG 5GXQA 3AFAB 1YQSA 4NY2A 2X02A 5CECA 4IJEA 2JE5A 4GDNA 5E43A 5F99B 2QPNA 3E4OA 3NQUA 4EO5B 4FOFA 3HJKA 3GQZA 4RVAA 1KX3C 1FR6A 3RXXA 1XFQA 1OJGA 4I5SA 1VHMA 3R45B 1P9RA 5FSRA 1M18B 3LZ0D 1TF1A 4ESPA 4QJGA 1F9IA 2CC1A 3Q82A 3DWKA 5IS1A 1IOUA 1NRFA 1NY0A 3AV1B 4DKIA 3GV9A 4GNUA 5FQQA 4JF5A 4R0QA 3O62B 4ZBJC 2O9CA 4R23A 3DTIA 2Q9MA 2H5SA 1P3BB 3UY6A 5J8XA 3X1UA 4J8VB 2NQBB 3IXHA 4MBFA 2PHYA 2QZ6A 5FQIA 3VP0A 3MXQA 5TFQA 5HSQA 1XPBA 4HGAB 2OSUA 3W96C 5G49B 5CPIC 1M1AC 1XX2A 2Y2LA 4H6JB 4Y0TA 3LELA 3C7UA 3CI6A 3REIC 1U35A 4I3JA 1P3MA 2J3WA 5AV5B 4NZ1A 3A0SA 1S32B 1HTAA 3DTKA 3MFXA 3KUYD 3I7JA 3HONA 1U60A 4R6LA 3VMAA 1MWSA 3CPTA 4RX3A 1IELA 2WAEA 3FWLA 3AFAD 1W7FA 1NYYA 2HDUA 2HZ5A 4PHTA 2Y8HA 3EPJA 3AZIC 5F99D 4KGCB 2V0WA 1JFIB 5BS7C 3DTEA 4J8WD 3GMWA 3MGRA 1OTDA 1AOIA 1UR8A 2ZLYA 1P3LB 2BTFP 5J7EA 5J4EA 1PIOA 1NZOA 3OBFA 4F3LB 3MF0A 2WKEA 3VV4A 3AYWD 2HIOB 2ZY4A 3AV1D 1F98A 1S6RA 3O62D 5HZHA 2FFFB 5JRGB 3SH7A 5AQBA 3U2AA 1J7MA 3LEZA 5B0YD 4X1LA 3C2WA 4J8VD 2NQBD 4HBTA 1K55C 1PW8A 5AY8B 3AZLB 4QHCA 3REKD 5CP6D 4OOMA 2V0UA 2JKTI 1NWZA 2J7VA 2V20A 3VE4A 1T19A 5BNVA 4HMDA 2DMWA 5FA7A 1S32D 3MQQA 3C7VA 4KUKA 3MSHA 1V9YA 1MZUA 3UTAC 3VOZA 1KX5D 1H8MA 5A92A 4PM7A 4E3LA 3UDIA 4G3KA 5CGXA 3LICA 1W2EA 4DE2A 4FTXA 1TAFA 1FOFA 2L1MA 4WMCD 3M2KA 1K4EA 2GNXA 3CLOA 4QU3A 2O99A 3B42A 4JJNC 1MC0A 2Y2QA 1DJAA 5L07A 5B32A 4KGCD 1H8YA 1BT5A 4YOFA 4KQOA 2A3UA 3LCEA 1YM1A 5KIZA 3L9KA 3H82B 1P3LD 2PBYA 5E2FA 5CEDA 4LD9C 2VGLM 1T3UA 3EWKA 3K3DA 5DF7A 5F83A 1JWPA 4ZBJB 4IUHA 1P3GD 3SOIA 2ZC6B 1IYOA 5GLDA 3HL9A 1BH8A 1EAKA 5CPIB 3MGPA 5JRGD 3NQJB 1YAXA 3HLGA 3REIB 4X55A 3VP4A 2P9VA 3F1OA 3WRZA 1H0MA 1H0IA 1T1BA 2EWVA 4RA7A 4Q0HA 3VOYA 3T50A 3ISGA 3BQAA 4DMZA 4UHUA 1DP8A 1ZTUA 3B33A 4J8UB 3WAAC 1YLTA 5E2HA 3REJA 2JKRM 4X56A 3AFAA 2JCHA 1R4VA 3B6GC 1FCOA 2P7JA 1JWVA 4HMEA 2HGVA 3EPHA 5F99A 4KUDB 1KX4D 1MKIA 2M1CA 4PPRA 3V67A 4IBBA 1TZYA 5IHVA 5FAPA 3V9RA 4BD1A 1LSXA 2XQZA 1M18A 3KS4A 4BL2A 4H9SA 4G92B 2HJ9C 4OQ0A 2WGIA 5HX9A 3REHA 3VH6W 1W1PA 2HP9A 1Q2PA 3FPWA 1O6IA 3KSIA 3FDDA 4Y5FA 5B0ZB 1XJ4A 1EWZA 1VEUB 3WTPE 2B95A 5B2JB 1E8BA 1P3BA 2CMNA 5B1MD 4DRAA 4EERA 4R3AA 2J9OA 1H0GA 4Y0UA 3L28A 3NDEA 5G49A 2BYMB 3E0YA 1E3UD 4H6JA 3UTAB 2EX6A 4CPKA 5AV5A 3A6NA 3LI8A 1S32A 4OJOA 3MZDA 3X1TC 4YM6D 1K25A 2D02A 2EX8A 4JF6A 5CERA 4J8UD 5M18A 4CLCC 3C38A 4ME4A 1J9MA 3LJAA 4N1XA 4BENA 4AWLC 1ACFA 2EFUA 3ZVWA 3W99C 3UB7A 3IQAA 4R4SA 3VE3A 4WMCA 2J80A 4N9KA 3N6IA 2V8CA 1MBLA 4KGCA 1JFIA 4LD9B 3NC8A 3JVVA 3EOIA 3UO9A 3TU4B 4YS3A 4R1GA 3AZGB 1HQ3A 1TS8A 3M6BA 5E5AB 5B33D 4HNBA 2F8NK 2NZDD 2PU2A 4OJ5A 2DF4C 4Y13A 4F3LA 3UT9C 2WKPA 1BZAA 2HIOA 2JSSA 4M4XA 3ZG0A 4KZ3A 1V9ZA 5TGFA 3NCKA 3AZJA 5G18A 1OJ5A 5B0ZD 5B2JD 5BOHA 1IYPA 1QMFA 3AZKC 1BLPA 2XA7M 4OJLA 2XA7S 1E15A 5AY8A 3BFEA 1ES4A 3O86A 3QNCA 3AZLA 3W4OA 4Z5TC 3N8SA 5G4YA 3B0CW 1HD8A 4JF4A 5BT1C 1YU4A 1FQGA 4BL3A 3D72A 1LSVA 2EX2A 2Y2IA 3MNNC 4BBVA 5HAQA 2AROD 1JVJA 3LIBA 3MGQB 4O7DA 5L09A 2WK0A 3KS8A 3G34A 5B24D 1PRQA 4EXOA 1B6WA 2X01A 4WU8B 3CZDA 4QWOA 3VH6A 3N7WA 1STZA 4UUZB 3VP1A 4Q8IA 2HUEC 1NJ4A 1P97A 4Z2HA 4HI4A 3TU4D 4L0LA 5EV0A 1HZOA 3BQ8A 1YT4A 5E5AD 4ZUXB 4FSFA 5AV8C 1EI5A 1P3FC 4KQDA 2M7UA 2F8NB 3D4FA 1ZLAB 4H9NB 3BRMA 4UQIM 4RQ9A 1GSWA 2ZC4B 3VSLA 5CPIA 5GXQB 3NQJA 3NHQA 1ZKJA 3REIA 4ZJ3A 2CV5D 4J8XC 4WV4B 3KXBC 4CAYA 3Q81A 4IBRA 4O0PA 1IYQA 3F1PB 1E3UA 4BQMA 4XUJC 2V9AA 3BY9A 3PBSA 4CLCB 4MB5A 1I5QA 1G5UA 4IUKA 1KGEA 2WZXA 3UN7A 2XGNA 4J8UA 3QHYA 1YKDA 1HLUP 3L26A 3T4KA 1F1EA 4GOGA 1TS7A 3AZIA 3MGQD 1ERQA 1CEGA 2D01A 4KUDA 4WU8D 2VX8A 3AV2D 4Y3IA 2VK3A 4GS9A 5F5YA 4OP8A 1P3IC 4NXEA 2JKRI 4GKUA 5JA4B 4RYEA 2Q9NA 3LELB 1YLWA 1WWSA 4ZUXD 2K2NA 3OCNA 4GZBA 4WEJA 4Z2IA 4OQIA 4EUZA 3AGDA 5CPKD 1HVBA 5CHJA 2WKIA 5EVEA 2XD1A 3FG8A 1ZLAD 4EW7A 3KWQB 3CJMA 4JXSA 5AVBB 2PD8A 1K55A 5HAPA 1VEUA 3AGFA 5GXQD 3R7WA 4DE0A 4FH4A 4NXBA 2W27A 1ESIA 4WN5A 3IWQA 4MEZA 2BYMA 3A3FA 5EPHA 5F6AA 4S2NA 5HDSA 3UTAA 4E6XA 5CTNA 2XFSA 3V39A 5FEFA 3X1VC 4GH9A 1Y54A 1NYMA 4OPYA 3EGXC 2O9BA 4B4ZA 2FJ7C 3A1IA 2VQRA 5BNXB 3PR6A 4CJNA 3JYIA 4H9QB 1ID3C 2WGVA 2Y2GA 5AV6C 3VH6T 5DNMC 4GB7A 2VZWA 4LD9A 3NI9A 1F66C 1S67L 2EXBA 2A2LA 3VFFA 3TU4A 1XA1A 3PBOA 3X1UD 1P3FB 2P74A 1T18A 3AZGA 2JN7A 3IT9A 1EROA 4H8RA 3UPNA 4MBHA 4TX8A 2IO5B 3SZTA 3LELD 1U35D 5GL9A 5HDDA 4WEKA 2V5OA 4QLCB 3UDFA 3ZCZA 2PD7A 2ZM8A 4B4XA 1KGFA 4PKYG 3KWQD 3LZ1C 1GHMA 1LLBA 3CUEC 3AZEC 4P6ZM 3O88A 3NY4A 5EVLA 3MMHA 1TAFB 1M40A 3AZFC 2EXAA 4NFTA 1AIWA 5B0YC 4FD8A 1MWUA 1ONGA 3WAAA 5C3IC 5B32B 5DJTA 4HHDA 4CLCE 1DP9A 4HMCA 3MGRD 3C4OA 3PHYA 3UE1A 4K08A 3PAEA 3CHWP 5F69A 2XSSA 3AZHC 5C5KA 1GHIA 3H0LC 1P3KB 2QMIA 4PM9A 4C6YA 3ITBA 5KMWA 4R3BA 3UDXA 1S1ZA 1K54C 2HP6A 1IEMA 3VFHA 4BLMA 3C1BC 5FQKA 4I3IA 4X6TA 5F82A 3HLDA 4BBTA 3WRTA 3MGPB 4OLDA 3PYPA 2QKPA 3TG9A 4BWIA 1YLZA 1OTBA 3E2KA 2M7VA 3P7NA 3GDIA 1KVMA 3HUMA 4K0WA 5JYPA 2P9VB 5E2EA 2P04A 1GOIA 3ITAA 5CHMA 4GD8A 1TEMA 2WZZA 2W8SA 5DKKA 2ZL1A 1W8YA 4QLCD 5HFOA 2YKHA 3PXPA 2F8NA 2ZC5B 3B0CT 1ZLAA 3OPPA 3LIEA 3AZNC 2Q0OA 5FATA 1NLZA 1P3GC 2ACGA 3FC7A 3MZFA 3MQOA 5AQAA 3WKJC 3IWOA 4NE3A 4ZAMA 3WA9B 3EPKA 2XLNA 2XDMA 1CK3A 4GHIB 4UAAA 1BFMA 4E3IA 4LCLA 1SKOB 1PDCA 3F1PA 1XA7A 2ZM0A 4X69A 5B32D 2PYOC 4CLCA 4C3QA 2ZOIA 3RJUA 3KSGA 5L10A 1TZYB 4DXCA 3ZGAB 4KG6A 3V9RB 1ID3B 3ZHHA 5CGWA 2Y91A 5B31B 2EA9A 5GT0C 1P3KD 3CMZA 4WU9C 1ODVA 2DQNC 3REHB 3DBAA 4Z2MG 2I72A 1F66B 3E2LA 1GA9A 3FZCA 1GSVA 3F1NB 1PWCA 1PWGA 2Z6DA 1CI8A 3RELB 3SW1A 3MGPD 1IKIA 4XZQC 2C5WB 3W4QA 4R8PC 5JA4A 3W97C 5DNNC 3ZQ5A 5CEBA 4Y0OA 1PZRA 1CQAA 3B0DB 2PAVP 5HD3A 3A6NB 3M7PA 3KWQA 2G5HC 4OPRA 5AVBA 3REJD 4HQAA 3LJAB 3P01A 3UB6A 1T1CA 4ARZA 5EM1A 3WA9D 2Y4AA 4IJFA 3PBTA 1DJBA 3MKFA 5A90A 2J8YA 1BUEA 1G6AA 1LL5A 3X1SC 5M19A 3IHAA 3T1RA 1DP6A 4MBKA 1P3PC 5FUGA 1TZYD 4YS3B 5DTTA 1HQ3B 1RCJA 5B31D 1M18D 2XEPA 5FQ9A 3KO6A 2QWSA 5BNXA 1P0ZA 5FDSA 3REHD 4H9QA 1WE4A 3NOUC 1D06A 3E98A 1LI0A 3NECA 1B67A 2WKQA 3GRJA 1SZVA 3AZJB 3WTPB 3RELD 5EVIC 2PR5A 4LG2A 2GDNA 1P3BD 1N1JB 5AV8A 2KLIA 3G6OA 1P3FA 2QJ7A 2VLGA 5B40B 3LGOA 4WLAA 5GHZA 5K5BA 5B33C 1KGGA 5AV5D 4QLCA 3A6ND 2JC7A 3LO7A 3KXBA 4BJPA 4OOLA 3OPRA 3EQUA 4IBKA 4MNRA 5KDMB 3LJAD 4XUJA 2Y79A 3IXBA 2PYOB 1ONHA 1XJ3A 1BLCA 3EEHA 5TBMB 1KX3B 4OP5A 2J3TD 4FH2A 2ZOHA 3F6TA 2RCXA 5GLCA 2KX6A 4WU9B 4UEYA 3S7NA 4YS3D 2G2UA 1HQ3D 2G5IC 4OUIA 1BLSA 5EECA 5GLBA 1P3KA 3A3EA 2G7UA 2VGLS 4GHLA 1K4FA 1RGYA 4MDZA 1XJ6A 4LRXC 3ZG8B 4WBGA 1S1YA 3B47A 1Y28A 4EUVA 4ZRRA 4EBNA 3T4OA 2HIOD 1VM1A 5B24C 2OLVA 4NZ3A 3W97B 3M6HA 3AZJD 3W96B 1M1AB 3WTPD 1CI9A 3LY4A 4CAYB 2W3DA 4XUZA 1ULYA 3MVDC 1H8ZA 5GHYA 5AY8D 1NRJA 2XK1A 5B40D 3AZLD 2EFXA 4NZ4A 5HWVA 1PI5A 2ZMVA 2DCFA 3CG5A 1MPLA 4LFUA 1UWPX 5DFXA 1YMSA 2HDRA 3BFCA 3C1CC 3L29A 3MXRA 4H9OA 4OH0A 3AZIB 4E45A 1FR1A 1P3OC 4NEED 4HP9A 5DF9A 3WA9A 4GHIA 3BW6A 3W98C 1SKOA 3PTEA 4S2LA 3AZMC 3X1VA 5FAOA 1KX3D 1EQZC 3HBRA 1OMEA 1NXYA 4JGPA 5B1LC 5D3OA 3T1SA 3IXGA 3LR5A 4GS9B 3IHBA 2JKGA 5IU1A 4WL9A 1ID3A 2Y55A 3G35A 5B31A 5AV6A 3G30A 1IKGA 5DNMA 3VP3A 5AVFA 3ZG5A 2JBFA 3UTBC 1F66A 3ZVTA 4KZBA 1ZC2A 3F1NA 1A0KA 4XT2B 2OWJA 2Y2NA 1YU3A 4KZAA 5AVCC 4IBFA 5B32G 3RELA 3KYZA 4LV3A 3W96D 5CPID 1H5XA 1XFNA 3REID 3R7WB 3OZHA 3AV2C 4Z66C 1P34C 3TOIA 4GN2A 2V1AA 4N92A 5CPJC 1SDEA 3EG5B 4QNLA 1ESUA 1FSWA 4S2JA 3S4XA 3LZ1A 2PBDP 1N9NA 4DXBA 2H10A 2H0TA 3W4PA 4CQHA 5B2IC 5AV9C 5GSUC 3AZFA 4X25A 1VB6A 3S7OA 2RTSA 4JJNB 3IBRA 2DRWA 3CWFA 3IXDA 3AZID 3LIDA 5EM0A 3RXWA 3T4JA 3ZFZA 4Q0IA 4KUDD 3LFVA 3V50A 3AL0C 2R78A 3AZHA 4UA7A 3VOLA 3EQVA 1VETB 2OAP1 4IEDA 1WYCA 3MGSC 1ED7A 3KSYA 1K54A 1GA0A 3IBJA 3LUQA 5CXWA 2YKFA 3C1BA 2O0YA 5DVAA 1E25A 2IWCA 3PBRA 1M19C 4X23C 4JXGA 1GCEA 4GD6A 3MVDB 4WUJA 5I94A 4DJ2A 1MWTA 3WTPA 1ZHHB 4OKPA 2LB5A 4UA9A 2W1RA 3K2NA 1YLYA 3KSHA 3AGEA 1N1JA 4S2KA 2PRFA 5B40A 4LRZE 3OCLA 3MXSA 2DNSA 1S66L 3WAAB 1CF0A 3UTAD 1PI4A 3WKJA 2UWXA 1P3MC 3B6GB 5HWTA 1Z2CB 5M1AA 4IVIA 2IWBA 3W98B 2PYRA 3T4TA 2BYKB 5KDMA 5GT3C 4Q0JA 2HDSA 2PYOA 1L0DA 4B93A 1KOUA 2VKSA 5TBMA 1KX3A 4DN0A 1ERMA 3FPVA 1YU0A 4MMNA 4E3KA 4LD9D 5GT0A 4WU9A 3OPLA 4L9FA 4EEPA 2FH5A 3DTMA 3AZGD 3MGRC 1AOIC 3WWXA 4Y15A 4NG2A 2ZL1B 5E2GA 4A5RA 3NULA 1FILA 5BPVA 4UQIS 4R8PA 3W97A 1JNUA 4AFIA 4NK3A 3W96A 3WS4A 1M1AA 1P3AC 1H3OB 3EPLA 4Y17A 1L0FA 2VV8A 3D9YA 3X1TB 1LT0A 3W2ZA 4KHAA 3QP8A 5AV9B 1YU1A 1IFQA 3WAAD 3C4PA 3HJIA 3B6FC 5LBRA 4AWLB 3W99B 4E3MA 2GJ3A 3QP4A 4E44A 4FCFA 3AN2C 3T12B 2OAQ1 4OOYA 4D60A 5A8BA 5BS7A 1YSQA 3UE0A 2A49A 1P3PA 4WF0A 3LI9A 1FCNA
chains in the Genus database with same CATH topology
1MWRA 4XXRA 3HLBA 3GVBA 4WZ5C 5HW3A 3UT9B 1M19B 5FAQA 4EQIA 3LZ0C 2V1ZA 4U0TA 5EVIA 3TSGA 1VQQA 5KSCA 2F8ND 3W8KA 1FCMA 2XR0A 3AZKB 2Z2LB 4B88A 4OPZA 4KZ6A 2J9PA 4Z5TB 5EUAA 4DDYA 3N8RA 5F1GA 3X1TD 3HLFA 3MNNB 3G4PA 4JXWA 4R3JA 4OJ6A 5FUGB 3A3IA 4H9PA 3KUYC 4ZJ1A 3O3VA 4JJNA 4UPKA 3FKVA 3UNWA 3REJC 3FYZA 2HUEB 3AFAC 3IF6C 1BTLA 3SH8A 3BFGA 5F99C 4P85A 5CTMA 4GDBA 3HLCA 2V2FF 3HLWA 5AV8B 4J8WC 3OPHA 1K56A 3P98A 4E3OA 4DRBA 1RGZA 2RIQA 5FASA 1O07A 4H9SC 3IWIA 1I2SA 4J8XB 3KXBB 4S2OA 3AYWC 3MVDA 4E3JA 5AVBD 4OVDA 2LY8A 3AV1C 4OONA 4XUJB 3O62C 4NZ5A 2EX9A 3ZNTA 1W8QA 5BT1D 4IBXA 4J8VC 2NQBC 2WADA 3C1CA 2RVQD 5CP6C 3REKC 1QMEA 4QY6A 1P3OA 3B6GA 1L0GA 5AV5C 1PZOA 1S32C 4ID4A 5EOEA 3W98A 3FKWA 2BYKA 1O7EA 1EQZA 3V3RA 1KX5C 1ZG4A 4X68A 2WYXA 4OQHA 5U47A 1P3IB 4IBIA 4WELA 1K38A 4N1HA 4KGCC 5CHLB 5AV8D 3UTBA 1P3FD 4EBLA 1ES3A 1P3LC 4YINA 4QB8A 5AVCA 2R9WA 2Y2KA 4U3TA 5GLAA 4Y7PA 4Z66A 3KXBD 4J8XD 4CSRB 2BLSA 4H9OB 2ZY3A 4IBCA 4IVKA 1H3OA 4XUJD 3HUOA 5JRGC 2J8PA 3X1VB 3X1TA 5AV9A 5GSUA 3VH5A 5CGSA 1AXBA 3AZLC 2FJ7B 5HAIA 3A1KA 3W99A 1SCWA 1RP5A 5AV6B 3IF6B 5DNMB 3PBNA 4PM5A 3WS5A 4IBJA 5FQJA 3C5AA 4NYYA 2C6WB 4KZ4A 3SH9A 1P3ID 3MGSA 4J8WB 1KX4C 4KG2A 4KZ7A 1ES2A 1FSYA 5A93A 1KE4A 5BO0B 3UT9A 1M19A 3PBQA 4JPMA 4X23A 4GHAA 4HEFA 1K6RA 3AYWB 3LZ1B 3AZEB 4EBPA 1A7WA 3AZKA 2OLUA 3AZFB 1JTGA 5B0YB 2ZY5A 5F1FA 4ZJ2A 2XD5A 4Z5TA 5C3IB 3FV7A 1GHPA 3H0RC 5CP6B 3REKB 3MBZA 2ZMAA 5B1MC 3X1VD 3O87A 3ZDJA 4OLGA 3AZHB 3MNNA 5FQMA 2F8NG 5GT3A 1KX5B 5KSHA 2FJ7D 3BFDA 1YUEA 1XP4A 2OV5A 3Q07A 1KE3A 1ID3D 4YM6C 1ES5A 5AV6D 2RL3A 4LENA 3C1BB 5DNMD 4J8UC 3M2JA 4KENB 2ZM2A 2ZQ9A 1F66D 2WUQA 3B3XA 3UPOA 3L25A 1S0WA 4KUDC 1K57C 1KDSA 1ZG6A 4DQYB 3MFDA 4S2IA 3GR2A 3B0BA 1BULA 4DE1A 2ZQAA 3AZNB 3ZG7B 1W79A 1P3GB 3LZ1D 4DE3A 3AZED 2BG1A 1P3AA 2NZDC 3WKJB 1XGJA 5DTKA 4G92C 4J8XA 2ZJ9A 3AZFD 4NE6A 5A91A 5B0ZC 3B6FA 4HBUA 3BEBA 5B2JC 1HTZA 3IH8A 3VH5T 4D2OA 2Y2PA 3AZHD 5GT0B 4KZ8A 3WS1A 4S2NC 3AN2A 2YFWB 3IP4C 3HSHA 1TDGA 2Y59A 3C1BD 2AROC 4JXVA 3Q7ZA 4XZQB 1KX4B 2IOUA 2VGKA 4M3KA 3G2YA 1P3IA 5HARA 4WZ5A 3NIAA 4R8PB 2G2WA 5DNNB 2Y2JA 1TDLA 1XGIA 3LY3A 3WS2A 3LZ0A 1KVLA 3TU4C 4KHAB 3AZGC 3AZND 1TVFA 5E5AC 2ZQDA 3BM6A 3WKJD 3IF5A 3MKEA 4CSRA 3SS3A 5B1MB 1SDNA 4KQQA 4MLLA 3X1SB 4Z2MH 1XXMA 4NYUA 2PYOD 2CV5C 1P3PB 1MXOA 2FFYA 2ZQ7A 3V5MA 4YM6B 3KUYA 4ZTKA 5GT0D 2FJ7A 4WU9D 2ZD8A 1PZPA 3SS5A 3IF6A 2CWEA 3FKEA 3L27A 3Q7VB 4IBDA 2YFVB 5EVIB 3MGQC 4XZQD 5AQ9A 4K91A 3H0MC 4J8WA 3Q1FA 4R8PD 3W97D 5DNND 4WU8C 1M1AD 4ZDXA 4YFMA 3N8LA 5B33B 3R45A 5BO0A 2Z2MB 2NZDB 3G31A 3WS0A 2H0YA 4WYYA 3AYWA 4ZBEA 1I2WA 2WAFA 1L2SA 3AZEA 3AV1A 4ZUXC 2F8NH 3O62A 5CPKC 4H9PB 4H9RB 5GHXA 3V3SA 5B0YA 1ZLAC 5FI2A 4J8VA 2NQBA 3P5JB 3ZG9B 3X1SD 4QD4A 3REKA 5CP6A 5GXQC 4LV0A 3G32A 1P3PD 2XFTA 5EE8A 4KG5A 5CRFA 1KX5A 3NBLA 5TR7A 3NDGA 2AROB 3IH9A 5B24B 4WNNB 4PM8A 4E3NA 4HESA 3ZNYA 5EVID 4G91C 2ZC3B 1P3LA 2F2AC 2WGWB 3HUNA 5B31G 5L2FA 3X1UC 4IBGA 3AZNA 1P3GA 3C1CB 3LELC 1P3OB 1U35C 1PW1A 5JRGA 3GSGA 2Y2OA 3AZMB 2CV5B 5EOOA 1EQZB 4WZ4A 3KWQC 4LV2A 1CEFA 5B1LB 4JJND 4P6BA 2Y2MA 5AVBC 4JLFA 1BSGA 1DY6A 3PAGA 4NETA 4EV4A 2HPBA 4N9LA 3HVFA 5DTSA 2X71A 5FDHA 4WZSB 3UTBB 2RVQC 5CHUA 4KZ5A 2YFWA 1E4DA 1K56D 4OPQA 4P87A 2B5RA 3GTCA 1BH9B 5AVCB 3N4IA 1K6SA 1SHVA 4XZQA 1KX4A 1M6KA 3AV2B 4Z66B 1P34B 5DNNA 3MVDD 5CPJB 1MY8A 2ZC7A 4RX2A 1JWZA 1N4OA 1XKZA 4S2PA 2HDQA 5B2IB 5CPKB 5GSUB 2VGJA 3C1CD 2IO5C 3QNBA 1P3OD 4WM9A 4R4RA 3B6GD 4QLCC 4PMAA 1KDWA 4BD0A 2ZY2A 3W98D 5B1MA 3AZMD 1EQZD 5B1LD 3X1SA 3A3JA 5JYOA 4X53A 3NQUB 1YMXA 3MGSB 2XH9A 4YM6A 3BFFA 4DDSA 1KU5A 3WX7A 4EWFA 5B32C 4KZ9A 3UTBD 1DJCA 4X23B 4G91B 3Q7VA 4IBEA 4LV1A 3MZEA 2YFVA 5AVCD 3UPPA 1P3KC 2E8IA 1WYBA 1K57A 1LI9A 4Z66D 1WWIA 1P34D 2L5AA 5CPJD 1BLHA 1C3BA 3X1UB 4S2MA 5B33A 4E6WA 3MGPC 4Z9QA 2NZDA 2Y2HA 1U35B 3HREA 4OQGA 1P3MB 3VSKA 5B2ID 5AV9D 5GSUD 4F94A 4C75A 2IWDA 5GT3B 2ZQCA 3W99D 5B0ZA 2R9XA 4H9RA 5B2JA 4NE5A 3HLEA 5FI6A 2PU4A 1Q9CA 4OJPA 3VH5W 1N9BA 3WA9C 1G68A 3OC2A 3MGSD 3MGRB 1AOIB 3DWZA 4EO5C 1L0EA 2HP5A 2AROA 3UT9D 1M19D 1YLPA 4X23D 5DF8A 5B24A 1TZYC 4WNNA 3P09A 1YU2A 5B31C 1M18C 1P3AB 3REHC 3AZKD 1YLJA 3DW0A 3L2AA 1LHYA 1PWDA 4DRTA 4Z5TD 5E5AA 3RELC 3B6FB 2WGWA 4QY5A 1P3BC 1IYSA 1P3MD 4U0XA 5BNVB 1KE0A 5FI7A 4HGAC 3MNND 3B0DC 3AN2B 3N3FA 5GT3D 3A6NC 4KQRA 1LL9A 4LCMA 3AZMA 2CV5A 5B1LA 3SS4A 4XUXA 3LJAC 1NZUA 5KZHA 1JTDA 1W5DA 2ZM5A 1AOID 3BLSA 3BLMA 3VP2A 3LZ0B 4PM6A 3MGQA 4K0XA 4YS3C 1HQ3C 1ALQA 1BH9A 3BYDA 4WU8A 1P3AD 4P0MA 1BH8B 3A3DA 5AQ7A 3AV2A 3UE3A 1P34A 3BECA 4UUZA 5CPJA 2HIOC 1SKFA 3AZJC 4DF6A 4WJ3C 1PYYA 3WTPC 3B6FD 4M6BA 4ZUXA 3G2ZA 4JKTA 1Q2QA 3S22A 5B2IA 2ZQ8A 5CPKA 3S1YA 5HL1A 3KUYB 5AY8C 5B40C 4H9NA 4UA6A 1Z6FA 3AN2D 3REJB 2WKHA 4JBFA 2XF3A 3KFUG 5GXQA 3AFAB 1YQSA 4NY2A 2X02A 5CECA 4IJEA 2JE5A 4GDNA 5E43A 5F99B 2QPNA 3NQUA 4EO5B 3GQZA 4RVAA 1KX3C 1FR6A 3RXXA 3R45B 5FSRA 1M18B 3LZ0D 4QJGA 3Q82A 2CC1A 3DWKA 1NRFA 1NY0A 3AV1B 4DKIA 3GV9A 4GNUA 5FQQA 4JF5A 4R0QA 3O62B 4ZBJC 4R23A 2Q9MA 2H5SA 1P3BB 3UY6A 5J8XA 3X1UA 4J8VB 2NQBB 3IXHA 4MBFA 5FQIA 2QZ6A 3VP0A 5TFQA 1XPBA 4HGAB 2OSUA 3W96C 5G49B 5CPIC 1M1AC 1XX2A 2Y2LA 4Y0TA 3LELA 3C7UA 3REIC 1U35A 1P3MA 5AV5B 4NZ1A 1S32B 1HTAA 3KUYD 3I7JA 3HONA 1U60A 3VMAA 1MWSA 4RX3A 1IELA 2WAEA 3FWLA 3AFAD 1W7FA 1NYYA 2HDUA 3EPJA 3AZIC 5F99D 4KGCB 1JFIB 5BS7C 4J8WD 3GMWA 3MGRA 1AOIA 2ZLYA 1P3LB 1PIOA 1NZOA 2WKEA 3AYWD 2HIOB 2ZY4A 3AV1D 1S6RA 3O62D 2FFFB 5JRGB 3SH7A 5AQBA 3LEZA 5B0YD 4J8VD 2NQBD 4HBTA 1K55C 1PW8A 5AY8B 3AZLB 4QHCA 3REKD 5CP6D 4OOMA 2J7VA 2V20A 5BNVA 5FA7A 1S32D 3C7VA 3UTAC 3VOZA 1KX5D 5A92A 4PM7A 4E3LA 3UDIA 5CGXA 1W2EA 4DE2A 1TAFA 1FOFA 4WMCD 3M2KA 1K4EA 4QU3A 4JJNC 2Y2QA 1DJAA 5B32A 4KGCD 1H8YA 1BT5A 4KQOA 2A3UA 3LCEA 1YM1A 1P3LD 2PBYA 5E2FA 5CEDA 4LD9C 5DF7A 1T3UA 5F83A 1JWPA 4ZBJB 1P3GD 3SOIA 2ZC6B 1IYOA 5GLDA 3HL9A 1BH8A 5CPIB 3MGPA 5JRGD 3NQJB 3HLGA 3REIB 4X55A 3VP4A 2P9VA 3WRZA 4RA7A 3VOYA 3ISGA 4UHUA 4J8UB 3WAAC 1YLTA 5E2HA 3REJA 4X56A 3AFAA 2JCHA 1R4VA 3B6GC 1FCOA 1JWVA 3EPHA 5F99A 4KUDB 1KX4D 1MKIA 4PPRA 4IBBA 1TZYA 5IHVA 5FAPA 3V9RA 4BD1A 2XQZA 1M18A 3KS4A 4BL2A 4H9SA 4G92B 4OQ0A 5HX9A 2WGIA 3REHA 3VH6W 2HP9A 1Q2PA 3FDDA 5B0ZB 1EWZA 3WTPE 5B2JB 1P3BA 5B1MD 4DRAA 2J9OA 4Y0UA 3L28A 3NDEA 5G49A 2BYMB 1E3UD 3UTAB 2EX6A 4CPKA 5AV5A 3A6NA 1S32A 4OJOA 3MZDA 3X1TC 4YM6D 1K25A 2EX8A 4JF6A 5CERA 4J8UD 5M18A 1J9MA 3LJAA 4N1XA 4BENA 4AWLC 2EFUA 3ZVWA 3W99C 3IQAA 4R4SA 4WMCA 4N9KA 3N6IA 1MBLA 4KGCA 1JFIA 4LD9B 3NC8A 3UO9A 3TU4B 4YS3A 4R1GA 3AZGB 1HQ3A 3M6BA 5E5AB 5B33D 2F8NK 2NZDD 2PU2A 4OJ5A 2DF4C 3UT9C 1BZAA 2HIOA 2JSSA 3ZG0A 4KZ3A 5TGFA 3NCKA 3AZJA 5G18A 5B0ZD 5B2JD 5BOHA 1IYPA 1QMFA 3AZKC 1BLPA 4OJLA 3BFEA 5AY8A 1ES4A 3O86A 3QNCA 3AZLA 3W4OA 4Z5TC 3N8SA 3B0CW 1HD8A 4JF4A 5BT1C 1YU4A 1FQGA 4BL3A 2EX2A 2Y2IA 3MNNC 5HAQA 2AROD 1JVJA 3MGQB 4O7DA 2WK0A 3KS8A 3G34A 5B24D 1B6WA 2X01A 4WU8B 3CZDA 3VH6A 3N7WA 4UUZB 3VP1A 4Q8IA 2HUEC 1NJ4A 3TU4D 4L0LA 1HZOA 1YT4A 5E5AD 4ZUXB 4FSFA 5AV8C 1EI5A 1P3FC 2F8NB 3D4FA 1ZLAB 4H9NB 3BRMA 2ZC4B 3VSLA 5CPIA 5GXQB 3NQJA 1ZKJA 3REIA 4ZJ3A 2CV5D 4J8XC 4WV4B 3KXBC 4CAYA 3Q81A 4IBRA 1IYQA 1E3UA 4BQMA 4XUJC 3PBSA 1I5QA 1KGEA 2WZXA 3UN7A 2XGNA 4J8UA 3QHYA 3L26A 1F1EA 4GOGA 3AZIA 3MGQD 1ERQA 1CEGA 4KUDA 4WU8D 3AV2D 4OP8A 1P3IC 4GKUA 5JA4B 4RYEA 2Q9NA 3LELB 1YLWA 1WWSA 4ZUXD 3OCNA 4GZBA 4WEJA 4OQIA 4EUZA 3AGDA 5CPKD 1HVBA 5CHJA 2WKIA 2XD1A 1ZLAD 3KWQB 3CJMA 4JXSA 5AVBB 1K55A 5HAPA 3AGFA 5GXQD 4DE0A 4FH4A 1ESIA 3IWQA 4MEZA 2BYMA 3A3FA 5EPHA 4S2NA 3UTAA 4E6XA 5CTNA 2XFSA 3V39A 3X1VC 4GH9A 1Y54A 1NYMA 4OPYA 4B4ZA 2FJ7C 3A1IA 2VQRA 5BNXB 4CJNA 3JYIA 4H9QB 1ID3C 2WGVA 2Y2GA 5AV6C 3VH6T 5DNMC 4GB7A 4LD9A 3NI9A 1F66C 2EXBA 3VFFA 3TU4A 1XA1A 3PBOA 3X1UD 2P74A 1P3FB 3AZGA 3IT9A 1EROA 4H8RA 3UPNA 4MBHA 2IO5B 3LELD 1U35D 5GL9A 4WEKA 4QLCB 3UDFA 3ZCZA 2ZM8A 4B4XA 1KGFA 3KWQD 3LZ1C 1GHMA 1LLBA 3AZEC 3O88A 3NY4A 5EVLA 1TAFB 1M40A 3AZFC 2EXAA 4NFTA 5B0YC 4FD8A 1MWUA 1ONGA 3WAAA 5C3IC 5B32B 3MGRD 3C4OA 3UE1A 3PAEA 3AZHC 1GHIA 3H0LC 1P3KB 2QMIA 4PM9A 4C6YA 3ITBA 5KMWA 4R3BA 3UDXA 1K54C 2HP6A 1IEMA 3VFHA 4BLMA 3C1BC 5FQKA 4X6TA 5F82A 3HLDA 3WRTA 3MGPB 4OLDA 3TG9A 3E2KA 1YLZA 3HUMA 1KVMA 4K0WA 5JYPA 2P9VB 5E2EA 3ITAA 5CHMA 4GD8A 1TEMA 2WZZA 2W8SA 5HFOA 1W8YA 4QLCD 2F8NA 2ZC5B 3B0CT 1ZLAA 3OPPA 3AZNC 5FATA 1P3GC 3MZFA 5AQAA 3WKJC 3IWOA 4NE3A 4ZAMA 3WA9B 3EPKA 2XLNA 2XDMA 1CK3A 4UAAA 4E3IA 1BFMA 4LCLA 1XA7A 2ZM0A 4X69A 5B32D 2PYOC 4C3QA 3RJUA 1TZYB 4DXCA 3ZGAB 4KG6A 3V9RB 1ID3B 3ZHHA 5CGWA 2Y91A 5B31B 5GT0C 1P3KD 3CMZA 4WU9C 2DQNC 3REHB 4Z2MG 2I72A 1F66B 3E2LA 1GA9A 3FZCA 1PWCA 1PWGA 1CI8A 3RELB 3MGPD 1IKIA 4XZQC 2C5WB 3W4QA 4R8PC 5JA4A 3W97C 5DNNC 5CEBA 4Y0OA 1PZRA 3B0DB 3A6NB 3KWQA 2G5HC 4OPRA 5AVBA 3REJD 3LJAB 3WA9D 2Y4AA 4IJFA 3PBTA 1DJBA 3MKFA 5A90A 2J8YA 1BUEA 1G6AA 1LL5A 3X1SC 5M19A 3IHAA 4MBKA 1P3PC 5FUGA 1TZYD 4YS3B 5DTTA 1HQ3B 1RCJA 5B31D 1M18D 2XEPA 5FQ9A 5BNXA 3REHD 4H9QA 1WE4A 1LI0A 1B67A 3GRJA 3AZJB 3WTPB 3RELD 5EVIC 4LG2A 2GDNA 1P3BD 1N1JB 5AV8A 1P3FA 5B40B 5GHZA 5B33C 1KGGA 5AV5D 4QLCA 3A6ND 2JC7A 3LO7A 3KXBA 4BJPA 4OOLA 3OPRA 3EQUA 4IBKA 4MNRA 5KDMB 3LJAD 4XUJA 3IXBA 2PYOB 1ONHA 1BLCA 1KX3B 4OP5A 4FH2A 3F6TA 2RCXA 5GLCA 4WU9B 4YS3D 2G2UA 1HQ3D 2G5IC 4OUIA 1BLSA 5EECA 5GLBA 1P3KA 3A3EA 4GHLA 1K4FA 1RGYA 3ZG8B 4WBGA 4EBNA 2HIOD 1VM1A 5B24C 2OLVA 4NZ3A 3W97B 3M6HA 3AZJD 3W96B 1M1AB 3WTPD 1CI9A 3LY4A 4CAYB 4XUZA 1ULYA 3MVDC 1H8ZA 5GHYA 5AY8D 2XK1A 5B40D 3AZLD 2EFXA 4NZ4A 1PI5A 2DCFA 3CG5A 1MPLA 1YMSA 2HDRA 3BFCA 3C1CC 3L29A 3MXRA 4H9OA 4OH0A 3AZIB 4E45A 1FR1A 1P3OC 5DF9A 3WA9A 3W98C 3PTEA 4S2LA 3AZMC 3X1VA 5FAOA 1KX3D 1EQZC 3HBRA 1OMEA 1NXYA 5B1LC 5D3OA 3IXGA 3IHBA 1ID3A 2Y55A 3G35A 5B31A 3G30A 5AV6A 1IKGA 5DNMA 3VP3A 3ZG5A 2JBFA 3UTBC 1F66A 3ZVTA 4KZBA 1ZC2A 2Y2NA 1YU3A 4KZAA 5AVCC 4IBFA 5B32G 3RELA 4LV3A 3W96D 5CPID 1H5XA 3REID 3OZHA 3AV2C 4Z66C 1P34C 3TOIA 4GN2A 4N92A 5CPJC 1SDEA 3EG5B 4QNLA 1ESUA 1FSWA 4S2JA 3S4XA 3LZ1A 4DXBA 2H10A 2H0TA 3W4PA 5B2IC 5AV9C 5GSUC 3AZFA 4JJNB 2DRWA 3IXDA 3AZID 3RXWA 3ZFZA 4KUDD 3V50A 3AL0C 3AZHA 4UA7A 3EQVA 4IEDA 1WYCA 3MGSC 3KSYA 1K54A 1GA0A 5CXWA 3C1BA 5DVAA 1E25A 2IWCA 3PBRA 1M19C 4X23C 4JXGA 1GCEA 4GD6A 3MVDB 5I94A 1MWTA 3WTPA 4OKPA 4UA9A 1YLYA 3AGEA 1N1JA 4S2KA 5B40A 3OCLA 3MXSA 2DNSA 3WAAB 3UTAD 1PI4A 3WKJA 2UWXA 1P3MC 3B6GB 1Z2CB 5M1AA 4IVIA 2IWBA 3W98B 2BYKB 5KDMA 5GT3C 2HDSA 2PYOA 1L0DA 1KX3A 1ERMA 1YU0A 4E3KA 4LD9D 5GT0A 4WU9A 3OPLA 3DTMA 3AZGD 3MGRC 1AOIC 3WWXA 5E2GA 4A5RA 5BPVA 4R8PA 3W97A 4NK3A 3W96A 3WS4A 1M1AA 1P3AC 1H3OB 3EPLA 1L0FA 3X1TB 4KHAA 5AV9B 1YU1A 3WAAD 3C4PA 3B6FC 4AWLB 3W99B 4E3MA 4E44A 4FCFA 3AN2C 4OOYA 5BS7A 3UE0A 2A49A 1P3PA 1FCNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HUM A;  1KVM A;  1MWR A;  2XFT A;  4K0W A;  4OOM A;  4KG5 A;  2P9V B;  4QHC A;  4XXR A;  5E2E A;  2J7V A;  3HLB A;  5EE8 A;  5JYP A;  3GVB A;  2V20 A;  4WZ5 C;  5CRF A;  3ITA A;  5HW3 A;  5CHM A;  4GD8 A;  5FA7 A;  1TEM A;  2WZZ A;  3C7V A;  3NBL A;  5TR7 A;  3NDG A;  5FAQ A;  5HFO A;  1W8Y A;  4EQI A;  3VOZ A;  3IH9 A;  2ZC5 B;  3OPP A;  2V1Z A;  4U0T A;  5A92 A;  5EVI A;  4PM8 A;  4PM7 A;  5FAT A;  3TSG A;  3UDI A;  4E3L A;  1VQQ A;  4E3N A;  3W8K A;  5KSC A;  5CGX A;  4HES A;  1FCM A;  2XR0 A;  2Z2L B;  3ZNY A;  3MZF A;  5AQA A;  4B88 A;  4DE2 A;  5EVI D;  1FOF A;  3IWO A;  4OPZ A;  4WMC D;  4ZAM A;  3M2K A;  1K4E A;  4KZ6 A;  4E3I A;  2XLN A;  2XDM A;  1CK3 A;  4QU3 A;  4UAA A;  2J9P A;  4LCL A;  2Y2Q A;  1DJA A;  2ZC3 B;  5EUA A;  1XA7 A;  4DDY A;  1H8Y A;  1BT5 A;  2ZM0 A;  3N8R A;  5F1G A;  4X69 A;  4KQO A;  2A3U A;  3LCE A;  1YM1 A;  4C3Q A;  2WGW B;  3HLF A;  3HUN A;  3RJU A;  2PBY A;  5E2F A;  5CED A;  5L2F A;  5DF7 A;  3G4P A;  4DXC A;  4JXW A;  5F83 A;  3ZGA B;  4KG6 A;  1JWP A;  3ZHH A;  5CGW A;  4R3J A;  2Y91 A;  3A3I A;  3CMZ A;  1PW1 A;  3SOI A;  2ZC6 B;  4ZJ1 A;  1IYO A;  3O3V A;  5GLD A;  2I72 A;  3GSG A;  3FKV A;  3E2L A;  1GA9 A;  3FZC A;  3HL9 A;  3UNW A;  2Y2O A;  1PWC A;  3FYZ A;  5EOO A;  1PWG A;  4WZ4 A;  4LV2 A;  1CEF A;  4P6B A;  2Y2M A;  3HLG A;  3IF6 C;  1CI8 A;  4JLF A;  1BSG A;  4X55 A;  3VP4 A;  1IKI A;  1BTL A;  2P9V A;  1DY6 A;  2C5W B;  3PAG A;  4NET A;  3SH8 A;  3W4Q A;  3WRZ A;  4EV4 A;  3BFG A;  2HPB A;  4P85 A;  5CTM A;  4GDB A;  4RA7 A;  3HLC A;  4N9L A;  2V2F F;  5CEB A;  3HLW A;  4Y0O A;  3HVF A;  5DTS A;  3VOY A;  2X71 A;  3OPH A;  1K56 A;  5FDH A;  3ISG A;  3P98 A;  4UHU A;  4E3O A;  5CHU A;  4KZ5 A;  1YLT A;  1E4D A;  5E2H A;  1K56 D;  4OPQ A;  4P87 A;  2B5R A;  1RGZ A;  5FAS A;  3GTC A;  4OPR A;  4X56 A;  1O07 A;  2JCH A;  3N4I A;  3IWI A;  1FCO A;  1K6S A;  1I2S A;  1SHV A;  4S2O A;  1JWV A;  3E2K A;  1M6K A;  4E3J A;  4OVD A;  2Y4A A;  3PBT A;  4OON A;  1MY8 A;  2ZC7 A;  4RX2 A;  1DJB A;  1JWZ A;  3MKF A;  5A90 A;  2J8Y A;  1MKI A;  4PPR A;  2EX9 A;  1BUE A;  1G6A A;  1LL5 A;  3ZNT A;  1N4O A;  5M19 A;  3IHA A;  1W8Q A;  1XKZ A;  4IBX A;  4S2P A;  5IHV A;  5FAP A;  4BD1 A;  2HDQ A;  4MBK A;  2WAD A;  2XQZ A;  1QME A;  4QY6 A;  5DTT A;  2VGJ A;  4BL2 A;  1RCJ A;  5HX9 A;  4OQ0 A;  1L0G A;  2WGI A;  1PZO A;  2XEP A;  5FQ9 A;  3QNB A;  4ID4 A;  2HP9 A;  5EOE A;  1Q2P A;  3FKW A;  4WM9 A;  4R4R A;  1O7E A;  4PMA A;  1KDW A;  4BD0 A;  3V3R A;  1WE4 A;  1ZG4 A;  1LI0 A;  4X68 A;  2WYX A;  4OQH A;  1EWZ A;  3GRJ A;  5U47 A;  3A3J A;  5EVI C;  5JYO A;  4X53 A;  2J9O A;  2GDN A;  1YMX A;  4Y0U A;  3NDE A;  4WEL A;  2XH9 A;  1E3U D;  1K38 A;  4N1H A;  2EX6 A;  4CPK A;  3BFF A;  4DDS A;  3MZD A;  4EBL A;  4EWF A;  5GHZ A;  2EX8 A;  1K25 A;  1ES3 A;  1KGG A;  4KZ9 A;  4JF6 A;  5CER A;  1DJC A;  4YIN A;  5M18 A;  2JC7 A;  4QB8 A;  3LO7 A;  1J9M A;  2R9W A;  4N1X A;  3Q7V A;  4OOL A;  3OPR A;  4BEN A;  2EFU A;  4LV1 A;  3ZVW A;  3EQU A;  3MZE A;  2Y2K A;  4U3T A;  5GLA A;  4Y7P A;  3IQA A;  4R4S A;  3UPP A;  4MNR A;  4WMC A;  2BLS A;  4N9K A;  2E8I A;  3N6I A;  3IXB A;  1WYB A;  1K57 A;  1MBL A;  4IVK A;  1LI9 A;  1ONH A;  1BLC A;  1BLH A;  1C3B A;  3HUO A;  4OP5 A;  3NC8 A;  4FH2 A;  4S2M A;  3UO9 A;  4E6W A;  2RCX A;  5GLC A;  4R1G A;  4Z9Q A;  2Y2H A;  3M6B A;  3HRE A;  4OQG A;  5CGS A;  1AXB A;  3VSK A;  2G2U A;  2PU2 A;  5HAI A;  4F94 A;  5EEC A;  1BLS A;  5GLB A;  4C75 A;  3A3E A;  2IWD A;  1SCW A;  1BZA A;  1K4F A;  1RGY A;  1RP5 A;  2ZQC A;  3IF6 B;  3ZG0 A;  3ZG8 B;  4KZ3 A;  4WBG A;  2R9X A;  3PBN A;  4EBN A;  4PM5 A;  5TGF A;  3NCK A;  3HLE A;  5G18 A;  1VM1 A;  3WS5 A;  2OLV A;  5FQJ A;  3C5A A;  5FI6 A;  5BOH A;  2C6W B;  2PU4 A;  1IYP A;  3M6H A;  4KZ4 A;  1QMF A;  3SH9 A;  1BLP A;  1N9B A;  1CI9 A;  3BFE A;  3LY4 A;  1ES4 A;  3O86 A;  3QNC A;  1G68 A;  4XUZ A;  3OC2 A;  4KG2 A;  4KZ7 A;  1ES2 A;  1FSY A;  1H8Z A;  3W4O A;  5A93 A;  5GHY A;  1KE4 A;  2XK1 A;  3N8S A;  1HD8 A;  2EFX A;  3PBQ A;  4JF4 A;  1PI5 A;  4JPM A;  2DCF A;  3DWZ A;  1L0E A;  2HP5 A;  3CG5 A;  1FQG A;  1MPL A;  4HEF A;  4BL3 A;  1K6R A;  1YLP A;  2EX2 A;  2Y2I A;  5DF8 A;  5HAQ A;  1JVJ A;  4EBP A;  3P09 A;  4O7D A;  1YMS A;  2HDR A;  3BFC A;  2WK0 A;  3G34 A;  3MXR A;  4OH0 A;  2OLU A;  1FR1 A;  1JTG A;  5DF9 A;  2X01 A;  5F1F A;  1YLJ A;  3CZD A;  4ZJ2 A;  3DW0 A;  2XD5 A;  3PTE A;  4S2L A;  1LHY A;  3N7W A;  3FV7 A;  5FAO A;  1GHP A;  1PWD A;  1OME A;  1NXY A;  3HBR A;  3VP1 A;  5D3O A;  3MBZ A;  1NJ4 A;  4Q8I A;  4DRT A;  3IXG A;  2ZMA A;  3O87 A;  2WGW A;  4L0L A;  4QY5 A;  3ZDJ A;  1HZO A;  3IHB A;  4OLG A;  1YT4 A;  1IYS A;  5FQM A;  4U0X A;  3G35 A;  2Y55 A;  1KE0 A;  4FSF A;  5FI7 A;  5KSH A;  1EI5 A;  3BFD A;  3G30 A;  1XP4 A;  2OV5 A;  1IKG A;  3Q07 A;  3VP3 A;  1KE3 A;  3ZG5 A;  2JBF A;  3D4F A;  1ES5 A;  2RL3 A;  4KQR A;  3BRM A;  4LEN A;  1LL9 A;  4LCM A;  3ZVT A;  3M2J A;  4KEN B;  2ZC4 B;  1ZC2 A;  4KZB A;  2ZM2 A;  2ZQ9 A;  3VSL A;  2Y2N A;  3SS4 A;  4XUX A;  1ZKJ A;  4KZA A;  2WUQ A;  4ZJ3 A;  4LV3 A;  3Q81 A;  4IBR A;  3B3X A;  1H5X A;  1NZU A;  3UPO A;  1IYQ A;  3OZH A;  1E3U A;  4BQM A;  5KZH A;  1S0W A;  3TOI A;  4GN2 A;  4N92 A;  1JTD A;  1K57 C;  1W5D A;  1SDE A;  3PBS A;  1KDS A;  1ZG6 A;  1ESU A;  1FSW A;  1I5Q A;  3BLS A;  4S2J A;  3BLM A;  3MFD A;  4S2I A;  3S4X A;  1KGE A;  2WZX A;  3GR2 A;  3UN7 A;  2XGN A;  1BUL A;  3VP2 A;  4DE1 A;  2ZQA A;  3QHY A;  4DXB A;  3ZG7 B;  1W79 A;  4PM6 A;  2H10 A;  2H0T A;  4K0X A;  3W4P A;  4DE3 A;  4GOG A;  2BG1 A;  1XGJ A;  1ALQ A;  5DTK A;  1ERQ A;  2ZJ9 A;  3BYD A;  1CEG A;  2DRW A;  3IXD A;  4P0M A;  3A3D A;  5AQ7 A;  3UE3 A;  3RXW A;  3BEC A;  1SKF A;  5A91 A;  3ZFZ A;  4HBU A;  3BEB A;  1HTZ A;  3V50 A;  4DF6 A;  4OP8 A;  1PYY A;  3IH8 A;  4UA7 A;  4GKU A;  3G2Z A;  4JKT A;  1Q2Q A;  3EQV A;  4D2O A;  4RYE A;  2Y2P A;  2Q9N A;  1WYC A;  2ZQ8 A;  4IED A;  3S22 A;  4KZ8 A;  1YLW A;  3S1Y A;  3WS1 A;  5HL1 A;  4S2N C;  3OCN A;  4GZB A;  4WEJ A;  1K54 A;  1GA0 A;  4OQI A;  4EUZ A;  3AGD A;  5CXW A;  4UA6 A;  1HVB A;  5CHJ A;  1Z6F A;  2WKI A;  5DVA A;  2XD1 A;  1E25 A;  2IWC A;  2WKH A;  1TDG A;  3PBR A;  4JBF A;  2XF3 A;  2Y59 A;  3CJM A;  4JXS A;  1YQS A;  4JXG A;  1K55 A;  5HAP A;  4JXV A;  2X02 A;  1GCE A;  3Q7Z A;  3AGF A;  4GD6 A;  5CEC A;  2JE5 A;  5I94 A;  2VGK A;  1MWT A;  4M3K A;  3G2Y A;  5HAR A;  4GDN A;  4OKP A;  4WZ5 A;  3NIA A;  5E43 A;  2QPN A;  4UA9 A;  4DE0 A;  1YLY A;  2G2W A;  4FH4 A;  2Y2J A;  1ESI A;  1TDL A;  3AGE A;  3IWQ A;  4MEZ A;  1XGI A;  3A3F A;  4S2K A;  5EPH A;  4S2N A;  4E6X A;  3GQZ A;  4RVA A;  1FR6 A;  5CTN A;  3LY3 A;  3OCL A;  3RXX A;  3MXS A;  2DNS A;  2XFS A;  3WS2 A;  3V39 A;  1KVL A;  1PI4 A;  5FSR A;  1Y54 A;  1TVF A;  2UWX A;  1NYM A;  2ZQD A;  4OPY A;  4QJG A;  5M1A A;  3Q82 A;  2CC1 A;  3BM6 A;  3DWK A;  1NRF A;  4IVI A;  2IWB A;  1NY0 A;  3IF5 A;  4B4Z A;  3MKE A;  3GV9 A;  3JYI A;  4GNU A;  2WGV A;  5FQQ A;  4JF5 A;  4R0Q A;  4CJN A;  4DKI A;  2Y2G A;  3SS3 A;  2HDS A;  4BJP A;  4R23 A;  1L0D A;  1SDN A;  4KQQ A;  4MLL A;  4GB7 A;  2Q9M A;  2H5S A;  3UY6 A;  5J8X A;  1XXM A;  3NI9 A;  1ERM A;  3IXH A;  4MBF A;  5FQI A;  3VP0 A;  2QZ6 A;  2EXB A;  5TFQ A;  1XPB A;  2OSU A;  3VFF A;  4E3K A;  1XA1 A;  3PBO A;  1MXO A;  2Y2L A;  1XX2 A;  2FFY A;  2P74 A;  2ZQ7 A;  3C7U A;  3IT9 A;  3V5M A;  4Y0T A;  1ERO A;  3OPL A;  4H8R A;  4ZTK A;  3UPN A;  4MBH A;  3DTM A;  2ZD8 A;  5GL9 A;  4WEK A;  3I7J A;  1PZP A;  1U60 A;  3VMA A;  3UDF A;  3SS5 A;  3ZCZ A;  1MWS A;  3WWX A;  3IF6 A;  4RX3 A;  2ZM8 A;  1IEL A;  2WAE A;  4B4X A;  1KGF A;  3FWL A;  5E2G A;  3Q7V B;  1GHM A;  4A5R A;  1LLB A;  1W7F A;  5EVI B;  3O88 A;  1NYY A;  2HDU A;  3NY4 A;  5AQ9 A;  5EVL A;  4NK3 A;  4K91 A;  1M40 A;  3WS4 A;  2EXA A;  3Q1F A;  4FD8 A;  1MWU A;  1ONG A;  4ZDX A;  1L0F A;  4YFM A;  3N8L A;  3GMW A;  2Z2M B;  2ZLY A;  3C4P A;  3G31 A;  3C4O A;  2H0Y A;  3WS0 A;  3UE1 A;  1PIO A;  3PAE A;  4WYY A;  4ZBE A;  1I2W A;  2WAF A;  1L2S A;  1NZO A;  1GHI A;  2WKE A;  4E3M A;  2QMI A;  4PM9 A;  4C6Y A;  3ITB A;  5KMW A;  4R3B A;  3UDX A;  4FCF A;  5GHX A;  3V3S A;  1K54 C;  1S6R A;  4OOY A;  2HP6 A;  2FFF B;  1IEM A;  5FI2 A;  5FQK A;  3VFH A;  3SH7 A;  4BLM A;  4X6T A;  3ZG9 B;  5AQB A;  3UE0 A;  5F82 A;  3HLD A;  3LEZ A;  2A49 A;  3WRT A;  4QD4 A;  4LV0 A;  4OLD A;  4HBT A;  3TG9 A;  3G32 A;  1K55 C;  1PW8 A;  1YLZ A;  1FCN A; 
#chains in the Genus database with same CATH topology
 4LPZ A;  1LL8 A;  1MWR A;  2W1T B;  4XXR A;  1UWN X;  3HLB A;  3GVB A;  4WZ5 C;  5HW3 A;  3UT9 B;  1M19 B;  1CXW A;  4I39 A;  4JGQ A;  5FAQ A;  4ETX A;  4EQI A;  3LZ0 C;  2V1Z A;  4U0T A;  5EVI A;  3TSG A;  3LEQ A;  1VQQ A;  5KSC A;  2F8N D;  3W8K A;  4XT2 A;  1W1V A;  1FCM A;  3AZK B;  1YPR A;  2XR0 A;  2Z2L B;  4B88 A;  5FEG A;  3NOT C;  4OPZ A;  4KZ6 A;  3WD1 A;  2J9P A;  4Z5T B;  1TS0 A;  4ARZ B;  5EUA A;  2VV7 A;  4DDY A;  3N8R A;  5F1G A;  1X0O A;  2FZ0 A;  3X1T D;  3HLF A;  1GPF A;  2XRN A;  3MNN B;  4O8G A;  3G4P A;  4CLC D;  4JXW A;  4R3J A;  4OJ6 A;  5FUG B;  3A3I A;  4H9P A;  3KUY C;  5HPI A;  5HPF A;  2PDR A;  4ZJ1 A;  3C30 A;  3O3V A;  4JJN A;  4HJ4 A;  4UPK A;  3T4S A;  3FKV A;  3UNW A;  3REJ C;  3FYZ A;  5MC7 A;  3IX8 A;  3TW8 A;  2HUE B;  3AFA C;  1YSP A;  3IF6 C;  3CIT A;  5HL6 A;  1BTL A;  3RH8 B;  3SH8 A;  3BFG A;  5F99 C;  4P85 A;  5CTM A;  4GDB A;  3HLC A;  2V2F F;  1VET A;  3HLW A;  5AV8 B;  2PR6 A;  3LIF A;  4J8W C;  2D49 A;  3OPH A;  1K56 A;  3EGD C;  3P98 A;  4E3O A;  4DRB A;  1RGZ A;  2RIQ A;  5FAS A;  3K3C A;  1O07 A;  4H9S C;  3IWI A;  1I2S A;  4J8X B;  3KXB B;  4S2O A;  3AYW C;  3DAV A;  2EWW A;  3MVD A;  4E3J A;  5AVB D;  2V8F A;  4OVD A;  2LY8 A;  3AV1 C;  2QYB A;  4OON A;  4XUJ B;  4P6Z S;  3O62 C;  4NZ5 A;  2EX9 A;  3ZNT A;  1W8Q A;  5BT1 D;  4IBX A;  4J8V C;  2NQB C;  4MB4 A;  3IX4 A;  2WAD A;  3C1C A;  2RVQ D;  5CP6 C;  3REK C;  1QME A;  2ZBB A;  4QY6 A;  4EET B;  1P3O A;  3B6G A;  1L0G A;  5AV5 C;  1PZO A;  1S32 C;  3R4K A;  4ID4 A;  5EOE A;  3W98 A;  3FKW A;  2BYK A;  1O7E A;  1EQZ A;  2IA2 A;  3WD3 A;  3V3R A;  1KX5 C;  1ZG4 A;  4X68 A;  4L9E A;  2WYX A;  4OQH A;  3T4Q A;  2W3F A;  5U47 A;  1P3I B;  1K0K A;  4IBI A;  2J3T C;  4WEL A;  2UV0 E;  1K38 A;  4QPR A;  4N1H A;  4KGC C;  5CHL B;  2QJ5 A;  3MJQ A;  5AV8 D;  3UTB A;  2VA0 A;  1P3F D;  3QP5 A;  4EBL A;  1ES3 A;  1P3L C;  4YIN A;  4QB8 A;  5AVC A;  2R9W A;  2JHE A;  2Y2K A;  4U3T A;  5GLA A;  4Y7P A;  2V1B A;  4Z66 A;  3KXB D;  4J8X D;  4CSR B;  2BLS A;  4H9O B;  2ZY3 A;  4IBC A;  4IVK A;  1H3O A;  3CAX A;  4XUJ D;  3IX3 A;  3HUO A;  1OT9 A;  5JRG C;  3NOP C;  2J8P A;  5DJU A;  3X1V B;  3X1T A;  5AV9 A;  5GSU A;  4GJ4 A;  3VH5 A;  4JGO A;  5CGS A;  1AXB A;  3AZL C;  1LSW A;  2FJ7 B;  5HAI A;  3A1K A;  3W99 A;  1SCW A;  1RP5 A;  5AV6 B;  3IF6 B;  5DNM B;  5TJJ A;  3PBN A;  1W1Y A;  4PM5 A;  3WS5 A;  4IBJ A;  5FQJ A;  1G6O A;  3C5A A;  4NYY A;  2C6W B;  4KZ4 A;  3SH9 A;  3RFB A;  2HJE A;  1P3I D;  3MGS A;  4J8W B;  4YNR A;  3MR0 A;  2W1T A;  1KX4 C;  4KG2 A;  4KZ7 A;  1ES2 A;  1FSY A;  5A93 A;  1KE4 A;  4ETZ A;  5BO0 B;  3UT9 A;  1M19 A;  3PBQ A;  4JPM A;  4X23 A;  4GHA A;  5AJG A;  4HH3 A;  4HEF A;  2NUT C;  1G28 A;  1K6R A;  3AYW B;  3LZ1 B;  5DFY A;  3AZE B;  4EBP A;  1A7W A;  3AZK A;  2OLU A;  3AZF B;  1FIK A;  1JTG A;  5B0Y B;  2ZY5 A;  5F1F A;  4ZJ2 A;  2XD5 A;  4Z5T A;  5C3I B;  3FV7 A;  1GHP A;  3H0R C;  5CP6 B;  3REK B;  3MBZ A;  2ZMA A;  1CJF A;  5B1M C;  3X1V D;  3T4L A;  3O87 A;  1TS6 A;  3ZDJ A;  4OLG A;  2VEA A;  3AZH B;  3MNN A;  5FQM A;  2F8N G;  5GT3 A;  1KX5 B;  5KSH A;  2FJ7 D;  3BFD A;  1YUE A;  1XP4 A;  2O9A A;  2OV5 A;  3Q07 A;  2HV1 A;  4HP4 A;  1OTE A;  1PFL A;  3GEC A;  1KE3 A;  1W63 M;  1ID3 D;  4YM6 C;  1ES5 A;  5AV6 D;  2RL3 A;  2KOI A;  1E6N A;  3C1B B;  5DNM D;  4J8U C;  4LEN A;  3M2J A;  4KEN B;  2ZM2 A;  2ZQ9 A;  1Z09 A;  4EEU A;  3QP1 A;  1F66 D;  5J3W A;  2WUQ A;  1TD5 A;  3B3X A;  4GCZ A;  4HJ6 A;  3UPO A;  3L25 A;  1S0W A;  4KUD C;  3S7P A;  1K57 C;  1KDS A;  2PYP A;  3TJZ C;  1ZG6 A;  4DQY B;  3MFD A;  4S2I A;  3GR2 A;  3B0B A;  4Z2J A;  1BUL A;  1EW0 A;  4DE1 A;  2QHK A;  2ZQA A;  3AZN B;  3ZG7 B;  1W79 A;  1P3G B;  3LZ1 D;  4DE3 A;  3AZE D;  2BG1 A;  1P3A A;  2NZD C;  2B02 A;  3WKJ B;  1XGJ A;  5DTK A;  4G92 C;  4DJ3 A;  4J8X A;  2ZJ9 A;  3AZF D;  1H3Q A;  4HY8 A;  4NE6 A;  1F5M A;  3H7W B;  5A91 A;  5B0Z C;  3B6F A;  4HBU A;  3BEB A;  5B2J C;  1HTZ A;  3KSF A;  2GZA A;  3IH8 A;  3VH5 T;  2Z6C A;  4D2O A;  2Y2P A;  3AZH D;  5GT0 B;  4KZ8 A;  3WS1 A;  4S2N C;  2B18 A;  3AN2 A;  3D3O A;  2YFW B;  3IP4 C;  3HSH A;  1TDG A;  2Y59 A;  3C1B D;  1GSX A;  4I3A A;  2ARO C;  4JXV A;  3Q7Z A;  4XZQ B;  1KX4 B;  3NJA A;  2IOU A;  2VGK A;  4M3K A;  3G2Y A;  1P3I A;  5HAR A;  4WZ5 A;  3NIA A;  3OOV A;  3TRC A;  4B9O A;  4R8P B;  2G2W A;  5DNN B;  3T1Q B;  4YWZ A;  2Y2J A;  1TDL A;  1OT6 A;  4R38 A;  1XGI A;  5FL3 A;  3LY3 A;  3WS2 A;  3LZ0 A;  3UB9 A;  1KVL A;  3KX0 X;  3TU4 C;  4KHA B;  2HF6 A;  3AZG C;  3AZN D;  1D7E A;  1TVF A;  5E5A C;  2ZQD A;  2OOL A;  3BM6 A;  3WKJ D;  3IF5 A;  4HH2 A;  3MKE A;  1Y4O A;  4CSR A;  3SS3 A;  5B1M B;  1SDN A;  4KQQ A;  4MLL A;  3X1S B;  4Z2M H;  1XXM A;  4NYU A;  2PYO D;  2ZMF A;  4MCW A;  3MS6 A;  2CV5 C;  1P3P B;  1MXO A;  2FFY A;  2ZQ7 A;  1WA9 A;  2INW A;  3V5M A;  3LR0 A;  4YM6 B;  3KUY A;  3IS2 B;  4ZTK A;  4EU0 A;  5GT0 D;  2FJ7 A;  4WU9 D;  2MJ6 A;  2ZD8 A;  4EES A;  1PZP A;  3SS5 A;  3IF6 A;  2CWE A;  3FKE A;  3L27 A;  2W3E A;  1E6P A;  3Q7V B;  4IBD A;  2YFV B;  5EVI B;  3UE6 A;  2LB9 A;  3MGQ C;  4XZQ D;  5AQ9 A;  4K91 A;  3H0M C;  2PT7 A;  4NXF A;  4J8W A;  3Q1F A;  4R8P D;  3W97 D;  5DNN D;  2P08 A;  4WU8 C;  1M1A D;  3UB5 P;  4ZDX A;  4YFM A;  3N8L A;  5B33 B;  3R45 A;  4MN6 A;  3LR3 A;  5BO0 A;  2Z2M B;  1E6Z A;  2NUP C;  4PAU A;  2NZD B;  3G31 A;  3WS0 A;  2H0Y A;  5G4Z A;  4WYY A;  3AYW A;  4MN5 A;  4ZBE A;  1I2W A;  2WAF A;  1L2S A;  3CUE A;  4R70 A;  1CK7 A;  3AZE A;  3AV1 A;  4ZUX C;  4II7 A;  2F8N H;  4O01 A;  5AVE A;  2KDK A;  3O62 A;  5CPK C;  4H9P B;  4H9R B;  5GHX A;  2L0W A;  3V3S A;  5B0Y A;  1ZLA C;  3O5Y A;  1L3L A;  5FI2 A;  4J8V A;  2NQB A;  2BAS A;  3P5J B;  4GLQ A;  3ZG9 B;  4GW9 A;  3X1S D;  4Z2K A;  4E04 A;  4QD4 A;  3REK A;  5CP6 A;  5GXQ C;  3L7H A;  4LV0 A;  3RTY A;  1KS0 A;  3G32 A;  4LRY C;  1P3P D;  2XFT A;  2A24 B;  5EE8 A;  4KG5 A;  4HJ3 A;  5CRF A;  1AWI A;  1H8P A;  1KX5 A;  3NBL A;  5TR7 A;  3NDG A;  2ARO B;  1DRM A;  3IH9 A;  5B24 B;  4WNN B;  4PM8 A;  4E3N A;  4HES A;  5IT5 A;  3ZNY A;  5EVI D;  1T1A A;  4G91 C;  4HOI A;  2ZC3 B;  2H28 A;  3HCY A;  1P3L A;  3TE8 A;  2F2A C;  5HDC A;  2WGW B;  3HUN A;  5B31 G;  5L2F A;  3X1U C;  4IBG A;  3AZN A;  5HWW A;  1P3G A;  3JVU A;  3C1C B;  4BMW A;  3LEL C;  3BWL A;  3UB8 A;  1P3O B;  1U35 C;  1UGU A;  1PW1 A;  4G3W A;  5JRG A;  3GSG A;  4IHQ A;  2Y2O A;  3AZM B;  2CV5 B;  4MB3 A;  5EOO A;  1EQZ B;  4WZ4 A;  3KWQ C;  4LV2 A;  1CEF A;  5B1L B;  4JJN D;  4P6B A;  2Y2M A;  3H7W A;  5AVB C;  3LYX A;  1BSG A;  4JLF A;  2VV6 A;  2K31 A;  2L4R A;  1DY6 A;  3PAG A;  4NET A;  4EV4 A;  3E4Q A;  5DKL A;  2HPB A;  4N9L A;  1W1T A;  1S4S A;  3A0R A;  3HVF A;  5DTS A;  3WD0 A;  2X71 A;  5FDH A;  4WZS B;  3UTB B;  2RVQ C;  3KYE A;  4KZ5 A;  5CHU A;  2YFW A;  1E4D A;  1K56 D;  4OPQ A;  1E6R A;  1QO6 A;  4P87 A;  2B5R A;  3GTC A;  1BH9 B;  5AVC B;  2VJW A;  3N4I A;  1K6S A;  4EQ1 A;  1OTI A;  1SHV A;  3ZYT A;  1E88 A;  4XZQ A;  1KX4 A;  1M6K A;  3AV2 B;  4Z66 B;  1P34 B;  5DNN A;  3MVD D;  5CPJ B;  1MY8 A;  1W63 Q;  2ZC7 A;  3UME A;  4RX2 A;  2FN2 A;  1JWZ A;  3S7Q A;  3H82 A;  1S4R A;  1N4O A;  1XKZ A;  4JGR A;  4S2P A;  2HDQ A;  4LLO B;  5B2I B;  2OWH A;  5CPK B;  5GSU B;  4IJG A;  4BBU A;  2VGJ A;  4NKP A;  2W3H A;  3C1C D;  2IO5 C;  3QNB A;  1P3O D;  4WM9 A;  4R4R A;  3B6G D;  4QLC C;  4PMA A;  1KDW A;  4BD0 A;  2ZY2 A;  1GXD A;  3W98 D;  5B1M A;  3AZM D;  1EQZ D;  5B1L D;  3X1S A;  1NLY A;  3A3J A;  2W3G A;  5JYO A;  4X53 A;  3NQU B;  1BYW A;  1YMX A;  3ICY A;  1N9O A;  3C8C A;  3MGS B;  2XH9 A;  4YM6 A;  3IS2 A;  3BFF A;  4DDS A;  1KU5 A;  3WX7 A;  4EWF A;  5B32 C;  4KZ9 A;  3UTB D;  3ULF A;  1DJC A;  4X23 B;  3BY8 A;  1PNE A;  3T1X A;  4HIA A;  4G91 B;  3Q7V A;  4IBE A;  4LV1 A;  3MZE A;  2YFV A;  5AVC D;  3UMD A;  1P3K C;  3UPP A;  3WD4 A;  4PKY A;  5L8M A;  2E8I A;  1WYB A;  1K57 A;  1LI9 A;  4Z66 D;  1WWI A;  1P34 D;  2L5A A;  5CPJ D;  1BLH A;  1C3B A;  3X1U B;  4G3V A;  4S2M A;  5B33 A;  4E6W A;  3MGP C;  4X1M A;  4Z9Q A;  2AVX A;  2NZD A;  2Y2H A;  1U35 B;  3HRE A;  4OQG A;  1P3M B;  3VSK A;  5B2I D;  5AV9 D;  5GSU D;  2JKF A;  4F94 A;  4C75 A;  2IWD A;  5GT3 B;  3H9W A;  2ZQC A;  3CPT B;  2E8J A;  3W99 D;  5B0Z A;  2R9X A;  4H9R A;  5B2J A;  4NE5 A;  4MN7 A;  3HLE A;  5FI6 A;  1P9W A;  2PU4 A;  1Q9C A;  4OJP A;  3LR4 A;  3VH5 W;  1N9B A;  3WA9 C;  1MKM A;  1G68 A;  2A24 A;  3MGS D;  3OC2 A;  3MGR B;  1AOI B;  3DWZ A;  4EO5 C;  1L0E A;  2HP5 A;  2ARO A;  3UT9 D;  1M19 D;  1YLP A;  4X23 D;  5DF8 A;  5B24 A;  2JKT M;  1TZY C;  4WNN A;  3JPU A;  3P09 A;  1OGB A;  1YU2 A;  5B31 C;  1M18 C;  2WKR A;  1P3A B;  1UR9 A;  3REH C;  3AZK D;  1YLJ A;  3DW0 A;  3L2A A;  1LHY A;  3E4P A;  1PWD A;  4DRT A;  5I5L A;  1F2K A;  4Z5T D;  5E5A A;  3REL C;  3B6F B;  5HD5 A;  2WGW A;  4QY5 A;  3U4L P;  1P3B C;  1IYS A;  1P3M D;  4U0X A;  5BNV B;  5CX7 A;  5EFW A;  1KE0 A;  1J3W A;  3QP6 A;  4HGA C;  5FI7 A;  3MNN D;  3B0D C;  3AN2 B;  3N3F A;  5GT3 D;  3MQL A;  3A6N C;  1XJ2 A;  4KQR A;  1LL9 A;  4LCM A;  3AZM A;  2CV5 A;  1N9L A;  3EEA A;  5B1L A;  3A0V A;  4NXG A;  4XUX A;  3SS4 A;  3QP2 A;  3LJA C;  3LIA A;  4Y2F A;  1NZU A;  3BJN A;  2XRO A;  5KZH A;  1JTD A;  4LGW A;  1W5D A;  2ZM5 A;  1AOI D;  3BLS A;  2I9V A;  3BLM A;  3VP2 A;  3WD2 A;  3LZ0 B;  3OLO A;  4PM6 A;  3MGQ A;  4K0X A;  2W0N A;  4YS3 C;  1HQ3 C;  4L9G A;  1ALQ A;  1BH9 A;  2GX5 A;  1D1J A;  4Z2L A;  3BYD A;  1OTA A;  4WU8 A;  1P3A D;  3MQ0 A;  4P0M A;  1BH8 B;  3A3D A;  5AQ7 A;  3AV2 A;  1OPX A;  3UE3 A;  1P34 A;  4KUO A;  3BEC A;  4UUZ A;  5CPJ A;  2HIO C;  1SKF A;  1OGG A;  4FUW A;  5F68 A;  3AZJ C;  3F1O B;  2K7S A;  4DF6 A;  4WJ3 C;  1PYY A;  3WTP C;  3B6F D;  4M6B A;  4ZUX A;  3G2Z A;  4JKT A;  1Q2Q A;  4Z1W A;  3S22 A;  5B2I A;  2ZQ8 A;  5CPK A;  3S1Y A;  5HL1 A;  4Z2G A;  3KYQ A;  3KUY B;  5AY8 C;  5B40 C;  4H9N A;  4UA6 A;  4I38 A;  1Z6F A;  3AN2 D;  3REJ B;  2WKH A;  4JBF A;  2XF3 A;  1L6J A;  3KFU G;  5GXQ A;  3AFA B;  1YQS A;  4NY2 A;  2X02 A;  5CEC A;  4IJE A;  2JE5 A;  4GDN A;  5E43 A;  5F99 B;  2QPN A;  3E4O A;  3NQU A;  4EO5 B;  4FOF A;  3HJK A;  3GQZ A;  4RVA A;  1KX3 C;  1FR6 A;  3RXX A;  1XFQ A;  1OJG A;  4I5S A;  1VHM A;  3R45 B;  1P9R A;  5FSR A;  1M18 B;  3LZ0 D;  1TF1 A;  4ESP A;  4QJG A;  1F9I A;  2CC1 A;  3Q82 A;  3DWK A;  5IS1 A;  1IOU A;  1NRF A;  1NY0 A;  3AV1 B;  4DKI A;  3GV9 A;  4GNU A;  5FQQ A;  4JF5 A;  4R0Q A;  3O62 B;  4ZBJ C;  2O9C A;  4R23 A;  3DTI A;  2Q9M A;  2H5S A;  1P3B B;  3UY6 A;  5J8X A;  3X1U A;  4J8V B;  2NQB B;  3IXH A;  4MBF A;  2PHY A;  2QZ6 A;  5FQI A;  3VP0 A;  3MXQ A;  5TFQ A;  5HSQ A;  1XPB A;  4HGA B;  2OSU A;  3W96 C;  5G49 B;  5CPI C;  1M1A C;  1XX2 A;  2Y2L A;  4H6J B;  4Y0T A;  3LEL A;  3C7U A;  3CI6 A;  3REI C;  1U35 A;  4I3J A;  1P3M A;  2J3W A;  5AV5 B;  4NZ1 A;  3A0S A;  1S32 B;  1HTA A;  3DTK A;  3MFX A;  3KUY D;  3I7J A;  3HON A;  1U60 A;  4R6L A;  3VMA A;  1MWS A;  3CPT A;  4RX3 A;  1IEL A;  2WAE A;  3FWL A;  3AFA D;  1W7F A;  1NYY A;  2HDU A;  2HZ5 A;  4PHT A;  2Y8H A;  3EPJ A;  3AZI C;  5F99 D;  4KGC B;  2V0W A;  1JFI B;  5BS7 C;  3DTE A;  4J8W D;  3GMW A;  3MGR A;  1OTD A;  1AOI A;  1UR8 A;  2ZLY A;  1P3L B;  2BTF P;  5J7E A;  5J4E A;  1PIO A;  1NZO A;  3OBF A;  4F3L B;  3MF0 A;  2WKE A;  3VV4 A;  3AYW D;  2HIO B;  2ZY4 A;  3AV1 D;  1F98 A;  1S6R A;  3O62 D;  5HZH A;  2FFF B;  5JRG B;  3SH7 A;  5AQB A;  3U2A A;  1J7M A;  3LEZ A;  5B0Y D;  4X1L A;  3C2W A;  4J8V D;  2NQB D;  4HBT A;  1K55 C;  1PW8 A;  5AY8 B;  3AZL B;  4QHC A;  3REK D;  5CP6 D;  4OOM A;  2V0U A;  2JKT I;  1NWZ A;  2J7V A;  2V20 A;  3VE4 A;  1T19 A;  5BNV A;  4HMD A;  2DMW A;  5FA7 A;  1S32 D;  3MQQ A;  3C7V A;  4KUK A;  3MSH A;  1V9Y A;  1MZU A;  3UTA C;  3VOZ A;  1KX5 D;  1H8M A;  5A92 A;  4PM7 A;  4E3L A;  3UDI A;  4G3K A;  5CGX A;  3LIC A;  1W2E A;  4DE2 A;  4FTX A;  1TAF A;  1FOF A;  2L1M A;  4WMC D;  3M2K A;  1K4E A;  2GNX A;  3CLO A;  4QU3 A;  2O99 A;  3B42 A;  4JJN C;  1MC0 A;  2Y2Q A;  1DJA A;  5L07 A;  5B32 A;  4KGC D;  1H8Y A;  1BT5 A;  4YOF A;  4KQO A;  2A3U A;  3LCE A;  1YM1 A;  5KIZ A;  3L9K A;  3H82 B;  1P3L D;  2PBY A;  5E2F A;  5CED A;  4LD9 C;  2VGL M;  1T3U A;  3EWK A;  3K3D A;  5DF7 A;  5F83 A;  1JWP A;  4ZBJ B;  4IUH A;  1P3G D;  3SOI A;  2ZC6 B;  1IYO A;  5GLD A;  3HL9 A;  1BH8 A;  1EAK A;  5CPI B;  3MGP A;  5JRG D;  3NQJ B;  1YAX A;  3HLG A;  3REI B;  4X55 A;  3VP4 A;  2P9V A;  3F1O A;  3WRZ A;  1H0M A;  1H0I A;  1T1B A;  2EWV A;  4RA7 A;  4Q0H A;  3VOY A;  3T50 A;  3ISG A;  3BQA A;  4DMZ A;  4UHU A;  1DP8 A;  1ZTU A;  3B33 A;  4J8U B;  3WAA C;  1YLT A;  5E2H A;  3REJ A;  2JKR M;  4X56 A;  3AFA A;  2JCH A;  1R4V A;  3B6G C;  1FCO A;  2P7J A;  1JWV A;  4HME A;  2HGV A;  3EPH A;  5F99 A;  4KUD B;  1KX4 D;  1MKI A;  2M1C A;  4PPR A;  3V67 A;  4IBB A;  1TZY A;  5IHV A;  5FAP A;  3V9R A;  4BD1 A;  1LSX A;  2XQZ A;  1M18 A;  3KS4 A;  4BL2 A;  4H9S A;  4G92 B;  2HJ9 C;  4OQ0 A;  2WGI A;  5HX9 A;  3REH A;  3VH6 W;  1W1P A;  2HP9 A;  1Q2P A;  3FPW A;  1O6I A;  3KSI A;  3FDD A;  4Y5F A;  5B0Z B;  1XJ4 A;  1EWZ A;  1VEU B;  3WTP E;  2B95 A;  5B2J B;  1E8B A;  1P3B A;  2CMN A;  5B1M D;  4DRA A;  4EER A;  4R3A A;  2J9O A;  1H0G A;  4Y0U A;  3L28 A;  3NDE A;  5G49 A;  2BYM B;  3E0Y A;  1E3U D;  4H6J A;  3UTA B;  2EX6 A;  4CPK A;  5AV5 A;  3A6N A;  3LI8 A;  1S32 A;  4OJO A;  3MZD A;  3X1T C;  4YM6 D;  1K25 A;  2D02 A;  2EX8 A;  4JF6 A;  5CER A;  4J8U D;  5M18 A;  4CLC C;  3C38 A;  4ME4 A;  1J9M A;  3LJA A;  4N1X A;  4BEN A;  4AWL C;  1ACF A;  2EFU A;  3ZVW A;  3W99 C;  3UB7 A;  3IQA A;  4R4S A;  3VE3 A;  4WMC A;  2J80 A;  4N9K A;  3N6I A;  2V8C A;  1MBL A;  4KGC A;  1JFI A;  4LD9 B;  3NC8 A;  3JVV A;  3EOI A;  3UO9 A;  3TU4 B;  4YS3 A;  4R1G A;  3AZG B;  1HQ3 A;  1TS8 A;  3M6B A;  5E5A B;  5B33 D;  4HNB A;  2F8N K;  2NZD D;  2PU2 A;  4OJ5 A;  2DF4 C;  4Y13 A;  4F3L A;  3UT9 C;  2WKP A;  1BZA A;  2HIO A;  2JSS A;  4M4X A;  3ZG0 A;  4KZ3 A;  1V9Z A;  5TGF A;  3NCK A;  3AZJ A;  5G18 A;  1OJ5 A;  5B0Z D;  5B2J D;  5BOH A;  1IYP A;  1QMF A;  3AZK C;  1BLP A;  2XA7 M;  4OJL A;  2XA7 S;  1E15 A;  5AY8 A;  3BFE A;  1ES4 A;  3O86 A;  3QNC A;  3AZL A;  3W4O A;  4Z5T C;  3N8S A;  5G4Y A;  3B0C W;  1HD8 A;  4JF4 A;  5BT1 C;  1YU4 A;  1FQG A;  4BL3 A;  3D72 A;  1LSV A;  2EX2 A;  2Y2I A;  3MNN C;  4BBV A;  5HAQ A;  2ARO D;  1JVJ A;  3LIB A;  3MGQ B;  4O7D A;  5L09 A;  2WK0 A;  3KS8 A;  3G34 A;  5B24 D;  1PRQ A;  4EXO A;  1B6W A;  2X01 A;  4WU8 B;  3CZD A;  4QWO A;  3VH6 A;  3N7W A;  1STZ A;  4UUZ B;  3VP1 A;  4Q8I A;  2HUE C;  1NJ4 A;  1P97 A;  4Z2H A;  4HI4 A;  3TU4 D;  4L0L A;  5EV0 A;  1HZO A;  3BQ8 A;  1YT4 A;  5E5A D;  4ZUX B;  4FSF A;  5AV8 C;  1EI5 A;  1P3F C;  4KQD A;  2M7U A;  2F8N B;  3D4F A;  1ZLA B;  4H9N B;  3BRM A;  4UQI M;  4RQ9 A;  1GSW A;  2ZC4 B;  3VSL A;  5CPI A;  5GXQ B;  3NQJ A;  3NHQ A;  1ZKJ A;  3REI A;  4ZJ3 A;  2CV5 D;  4J8X C;  4WV4 B;  3KXB C;  4CAY A;  3Q81 A;  4IBR A;  4O0P A;  1IYQ A;  3F1P B;  1E3U A;  4BQM A;  4XUJ C;  2V9A A;  3BY9 A;  3PBS A;  4CLC B;  4MB5 A;  1I5Q A;  1G5U A;  4IUK A;  1KGE A;  2WZX A;  3UN7 A;  2XGN A;  4J8U A;  3QHY A;  1YKD A;  1HLU P;  3L26 A;  3T4K A;  1F1E A;  4GOG A;  1TS7 A;  3AZI A;  3MGQ D;  1ERQ A;  1CEG A;  2D01 A;  4KUD A;  4WU8 D;  2VX8 A;  3AV2 D;  4Y3I A;  2VK3 A;  4GS9 A;  5F5Y A;  4OP8 A;  1P3I C;  4NXE A;  2JKR I;  4GKU A;  5JA4 B;  4RYE A;  2Q9N A;  3LEL B;  1YLW A;  1WWS A;  4ZUX D;  2K2N A;  3OCN A;  4GZB A;  4WEJ A;  4Z2I A;  4OQI A;  4EUZ A;  3AGD A;  5CPK D;  1HVB A;  5CHJ A;  2WKI A;  5EVE A;  2XD1 A;  3FG8 A;  1ZLA D;  4EW7 A;  3KWQ B;  3CJM A;  4JXS A;  5AVB B;  2PD8 A;  1K55 A;  5HAP A;  1VEU A;  3AGF A;  5GXQ D;  3R7W A;  4DE0 A;  4FH4 A;  4NXB A;  2W27 A;  1ESI A;  4WN5 A;  3IWQ A;  4MEZ A;  2BYM A;  3A3F A;  5EPH A;  5F6A A;  4S2N A;  5HDS A;  3UTA A;  4E6X A;  5CTN A;  2XFS A;  3V39 A;  5FEF A;  3X1V C;  4GH9 A;  1Y54 A;  1NYM A;  4OPY A;  3EGX C;  2O9B A;  4B4Z A;  2FJ7 C;  3A1I A;  2VQR A;  5BNX B;  3PR6 A;  4CJN A;  3JYI A;  4H9Q B;  1ID3 C;  2WGV A;  2Y2G A;  5AV6 C;  3VH6 T;  5DNM C;  4GB7 A;  2VZW A;  4LD9 A;  3NI9 A;  1F66 C;  1S67 L;  2EXB A;  2A2L A;  3VFF A;  3TU4 A;  1XA1 A;  3PBO A;  3X1U D;  1P3F B;  2P74 A;  1T18 A;  3AZG A;  2JN7 A;  3IT9 A;  1ERO A;  4H8R A;  3UPN A;  4MBH A;  4TX8 A;  2IO5 B;  3SZT A;  3LEL D;  1U35 D;  5GL9 A;  5HDD A;  4WEK A;  2V5O A;  4QLC B;  3UDF A;  3ZCZ A;  2PD7 A;  2ZM8 A;  4B4X A;  1KGF A;  4PKY G;  3KWQ D;  3LZ1 C;  1GHM A;  1LLB A;  3CUE C;  3AZE C;  4P6Z M;  3O88 A;  3NY4 A;  5EVL A;  3MMH A;  1TAF B;  1M40 A;  3AZF C;  2EXA A;  4NFT A;  1AIW A;  5B0Y C;  4FD8 A;  1MWU A;  1ONG A;  3WAA A;  5C3I C;  5B32 B;  5DJT A;  4HHD A;  4CLC E;  1DP9 A;  4HMC A;  3MGR D;  3C4O A;  3PHY A;  3UE1 A;  4K08 A;  3PAE A;  3CHW P;  5F69 A;  2XSS A;  3AZH C;  5C5K A;  1GHI A;  3H0L C;  1P3K B;  2QMI A;  4PM9 A;  4C6Y A;  3ITB A;  5KMW A;  4R3B A;  3UDX A;  1S1Z A;  1K54 C;  2HP6 A;  1IEM A;  3VFH A;  4BLM A;  3C1B C;  5FQK A;  4I3I A;  4X6T A;  5F82 A;  3HLD A;  4BBT A;  3WRT A;  3MGP B;  4OLD A;  3PYP A;  2QKP A;  3TG9 A;  4BWI A;  1YLZ A;  1OTB A;  3E2K A;  2M7V A;  3P7N A;  3GDI A;  1KVM A;  3HUM A;  4K0W A;  5JYP A;  2P9V B;  5E2E A;  2P04 A;  1GOI A;  3ITA A;  5CHM A;  4GD8 A;  1TEM A;  2WZZ A;  2W8S A;  5DKK A;  2ZL1 A;  1W8Y A;  4QLC D;  5HFO A;  2YKH A;  3PXP A;  2F8N A;  2ZC5 B;  3B0C T;  1ZLA A;  3OPP A;  3LIE A;  3AZN C;  2Q0O A;  5FAT A;  1NLZ A;  1P3G C;  2ACG A;  3FC7 A;  3MZF A;  3MQO A;  5AQA A;  3WKJ C;  3IWO A;  4NE3 A;  4ZAM A;  3WA9 B;  3EPK A;  2XLN A;  2XDM A;  1CK3 A;  4GHI B;  4UAA A;  1BFM A;  4E3I A;  4LCL A;  1SKO B;  1PDC A;  3F1P A;  1XA7 A;  2ZM0 A;  4X69 A;  5B32 D;  2PYO C;  4CLC A;  4C3Q A;  2ZOI A;  3RJU A;  3KSG A;  5L10 A;  1TZY B;  4DXC A;  3ZGA B;  4KG6 A;  3V9R B;  1ID3 B;  3ZHH A;  5CGW A;  2Y91 A;  5B31 B;  2EA9 A;  5GT0 C;  1P3K D;  3CMZ A;  4WU9 C;  1ODV A;  2DQN C;  3REH B;  3DBA A;  4Z2M G;  2I72 A;  1F66 B;  3E2L A;  1GA9 A;  3FZC A;  1GSV A;  3F1N B;  1PWC A;  1PWG A;  2Z6D A;  1CI8 A;  3REL B;  3SW1 A;  3MGP D;  1IKI A;  4XZQ C;  2C5W B;  3W4Q A;  4R8P C;  5JA4 A;  3W97 C;  5DNN C;  3ZQ5 A;  5CEB A;  4Y0O A;  1PZR A;  1CQA A;  3B0D B;  2PAV P;  5HD3 A;  3A6N B;  3M7P A;  3KWQ A;  2G5H C;  4OPR A;  5AVB A;  3REJ D;  4HQA A;  3LJA B;  3P01 A;  3UB6 A;  1T1C A;  4ARZ A;  5EM1 A;  3WA9 D;  2Y4A A;  4IJF A;  3PBT A;  1DJB A;  3MKF A;  5A90 A;  2J8Y A;  1BUE A;  1G6A A;  1LL5 A;  3X1S C;  5M19 A;  3IHA A;  3T1R A;  1DP6 A;  4MBK A;  1P3P C;  5FUG A;  1TZY D;  4YS3 B;  5DTT A;  1HQ3 B;  1RCJ A;  5B31 D;  1M18 D;  2XEP A;  5FQ9 A;  3KO6 A;  2QWS A;  5BNX A;  1P0Z A;  5FDS A;  3REH D;  4H9Q A;  1WE4 A;  3NOU C;  1D06 A;  3E98 A;  1LI0 A;  3NEC A;  1B67 A;  2WKQ A;  3GRJ A;  1SZV A;  3AZJ B;  3WTP B;  3REL D;  5EVI C;  2PR5 A;  4LG2 A;  2GDN A;  1P3B D;  1N1J B;  5AV8 A;  2KLI A;  3G6O A;  1P3F A;  2QJ7 A;  2VLG A;  5B40 B;  3LGO A;  4WLA A;  5GHZ A;  5K5B A;  5B33 C;  1KGG A;  5AV5 D;  4QLC A;  3A6N D;  2JC7 A;  3LO7 A;  3KXB A;  4BJP A;  4OOL A;  3OPR A;  3EQU A;  4IBK A;  4MNR A;  5KDM B;  3LJA D;  4XUJ A;  2Y79 A;  3IXB A;  2PYO B;  1ONH A;  1XJ3 A;  1BLC A;  3EEH A;  5TBM B;  1KX3 B;  4OP5 A;  2J3T D;  4FH2 A;  2ZOH A;  3F6T A;  2RCX A;  5GLC A;  2KX6 A;  4WU9 B;  4UEY A;  3S7N A;  4YS3 D;  2G2U A;  1HQ3 D;  2G5I C;  4OUI A;  1BLS A;  5EEC A;  5GLB A;  1P3K A;  3A3E A;  2G7U A;  2VGL S;  4GHL A;  1K4F A;  1RGY A;  4MDZ A;  1XJ6 A;  4LRX C;  3ZG8 B;  4WBG A;  1S1Y A;  3B47 A;  1Y28 A;  4EUV A;  4ZRR A;  4EBN A;  3T4O A;  2HIO D;  1VM1 A;  5B24 C;  2OLV A;  4NZ3 A;  3W97 B;  3M6H A;  3AZJ D;  3W96 B;  1M1A B;  3WTP D;  1CI9 A;  3LY4 A;  4CAY B;  2W3D A;  4XUZ A;  1ULY A;  3MVD C;  1H8Z A;  5GHY A;  5AY8 D;  1NRJ A;  2XK1 A;  5B40 D;  3AZL D;  2EFX A;  4NZ4 A;  5HWV A;  1PI5 A;  2ZMV A;  2DCF A;  3CG5 A;  1MPL A;  4LFU A;  1UWP X;  5DFX A;  1YMS A;  2HDR A;  3BFC A;  3C1C C;  3L29 A;  3MXR A;  4H9O A;  4OH0 A;  3AZI B;  4E45 A;  1FR1 A;  1P3O C;  4NEE D;  4HP9 A;  5DF9 A;  3WA9 A;  4GHI A;  3BW6 A;  3W98 C;  1SKO A;  3PTE A;  4S2L A;  3AZM C;  3X1V A;  5FAO A;  1KX3 D;  1EQZ C;  3HBR A;  1OME A;  1NXY A;  4JGP A;  5B1L C;  5D3O A;  3T1S A;  3IXG A;  3LR5 A;  4GS9 B;  3IHB A;  2JKG A;  5IU1 A;  4WL9 A;  1ID3 A;  2Y55 A;  3G35 A;  5B31 A;  5AV6 A;  3G30 A;  1IKG A;  5DNM A;  3VP3 A;  5AVF A;  3ZG5 A;  2JBF A;  3UTB C;  1F66 A;  3ZVT A;  4KZB A;  1ZC2 A;  3F1N A;  1A0K A;  4XT2 B;  2OWJ A;  2Y2N A;  1YU3 A;  4KZA A;  5AVC C;  4IBF A;  5B32 G;  3REL A;  3KYZ A;  4LV3 A;  3W96 D;  5CPI D;  1H5X A;  1XFN A;  3REI D;  3R7W B;  3OZH A;  3AV2 C;  4Z66 C;  1P34 C;  3TOI A;  4GN2 A;  2V1A A;  4N92 A;  5CPJ C;  1SDE A;  3EG5 B;  4QNL A;  1ESU A;  1FSW A;  4S2J A;  3S4X A;  3LZ1 A;  2PBD P;  1N9N A;  4DXB A;  2H10 A;  2H0T A;  3W4P A;  4CQH A;  5B2I C;  5AV9 C;  5GSU C;  3AZF A;  4X25 A;  1VB6 A;  3S7O A;  2RTS A;  4JJN B;  3IBR A;  2DRW A;  3CWF A;  3IXD A;  3AZI D;  3LID A;  5EM0 A;  3RXW A;  3T4J A;  3ZFZ A;  4Q0I A;  4KUD D;  3LFV A;  3V50 A;  3AL0 C;  2R78 A;  3AZH A;  4UA7 A;  3VOL A;  3EQV A;  1VET B;  2OAP 1;  4IED A;  1WYC A;  3MGS C;  1ED7 A;  3KSY A;  1K54 A;  1GA0 A;  3IBJ A;  3LUQ A;  5CXW A;  2YKF A;  3C1B A;  2O0Y A;  5DVA A;  1E25 A;  2IWC A;  3PBR A;  1M19 C;  4X23 C;  4JXG A;  1GCE A;  4GD6 A;  3MVD B;  4WUJ A;  5I94 A;  4DJ2 A;  1MWT A;  3WTP A;  1ZHH B;  4OKP A;  2LB5 A;  4UA9 A;  2W1R A;  3K2N A;  1YLY A;  3KSH A;  3AGE A;  1N1J A;  4S2K A;  2PRF A;  5B40 A;  4LRZ E;  3OCL A;  3MXS A;  2DNS A;  1S66 L;  3WAA B;  1CF0 A;  3UTA D;  1PI4 A;  3WKJ A;  2UWX A;  1P3M C;  3B6G B;  5HWT A;  1Z2C B;  5M1A A;  4IVI A;  2IWB A;  3W98 B;  2PYR A;  3T4T A;  2BYK B;  5KDM A;  5GT3 C;  4Q0J A;  2HDS A;  2PYO A;  1L0D A;  4B93 A;  1KOU A;  2VKS A;  5TBM A;  1KX3 A;  4DN0 A;  1ERM A;  3FPV A;  1YU0 A;  4MMN A;  4E3K A;  4LD9 D;  5GT0 A;  4WU9 A;  3OPL A;  4L9F A;  4EEP A;  2FH5 A;  3DTM A;  3AZG D;  3MGR C;  1AOI C;  3WWX A;  4Y15 A;  4NG2 A;  2ZL1 B;  5E2G A;  4A5R A;  3NUL A;  1FIL A;  5BPV A;  4UQI S;  4R8P A;  3W97 A;  1JNU A;  4AFI A;  4NK3 A;  3W96 A;  3WS4 A;  1M1A A;  1P3A C;  1H3O B;  3EPL A;  4Y17 A;  1L0F A;  2VV8 A;  3D9Y A;  3X1T B;  1LT0 A;  3W2Z A;  4KHA A;  3QP8 A;  5AV9 B;  1YU1 A;  1IFQ A;  3WAA D;  3C4P A;  3HJI A;  3B6F C;  5LBR A;  4AWL B;  3W99 B;  4E3M A;  2GJ3 A;  3QP4 A;  4E44 A;  4FCF A;  3AN2 C;  3T12 B;  2OAQ 1;  4OOY A;  4D60 A;  5A8B A;  5BS7 A;  1YSQ A;  3UE0 A;  2A49 A;  1P3P A;  4WF0 A;  3LI9 A;  1FCN A; 
#chains in the Genus database with same CATH homology
 1MWR A;  4XXR A;  3HLB A;  3GVB A;  4WZ5 C;  5HW3 A;  3UT9 B;  1M19 B;  5FAQ A;  4EQI A;  3LZ0 C;  2V1Z A;  4U0T A;  5EVI A;  3TSG A;  1VQQ A;  5KSC A;  2F8N D;  3W8K A;  1FCM A;  2XR0 A;  3AZK B;  2Z2L B;  4B88 A;  4OPZ A;  4KZ6 A;  2J9P A;  4Z5T B;  5EUA A;  4DDY A;  3N8R A;  5F1G A;  3X1T D;  3HLF A;  3MNN B;  3G4P A;  4JXW A;  4R3J A;  4OJ6 A;  5FUG B;  3A3I A;  4H9P A;  3KUY C;  4ZJ1 A;  3O3V A;  4JJN A;  4UPK A;  3FKV A;  3UNW A;  3REJ C;  3FYZ A;  2HUE B;  3AFA C;  3IF6 C;  1BTL A;  3SH8 A;  3BFG A;  5F99 C;  4P85 A;  5CTM A;  4GDB A;  3HLC A;  2V2F F;  3HLW A;  5AV8 B;  4J8W C;  3OPH A;  1K56 A;  3P98 A;  4E3O A;  4DRB A;  1RGZ A;  2RIQ A;  5FAS A;  1O07 A;  4H9S C;  3IWI A;  1I2S A;  4J8X B;  3KXB B;  4S2O A;  3AYW C;  3MVD A;  4E3J A;  5AVB D;  4OVD A;  2LY8 A;  3AV1 C;  4OON A;  4XUJ B;  3O62 C;  4NZ5 A;  2EX9 A;  3ZNT A;  1W8Q A;  5BT1 D;  4IBX A;  4J8V C;  2NQB C;  2WAD A;  3C1C A;  2RVQ D;  5CP6 C;  3REK C;  1QME A;  4QY6 A;  1P3O A;  3B6G A;  1L0G A;  5AV5 C;  1PZO A;  1S32 C;  4ID4 A;  5EOE A;  3W98 A;  3FKW A;  2BYK A;  1O7E A;  1EQZ A;  3V3R A;  1KX5 C;  1ZG4 A;  4X68 A;  2WYX A;  4OQH A;  5U47 A;  1P3I B;  4IBI A;  4WEL A;  1K38 A;  4N1H A;  4KGC C;  5CHL B;  5AV8 D;  3UTB A;  1P3F D;  4EBL A;  1ES3 A;  1P3L C;  4YIN A;  4QB8 A;  5AVC A;  2R9W A;  2Y2K A;  4U3T A;  5GLA A;  4Y7P A;  4Z66 A;  3KXB D;  4J8X D;  4CSR B;  2BLS A;  4H9O B;  2ZY3 A;  4IBC A;  4IVK A;  1H3O A;  4XUJ D;  3HUO A;  5JRG C;  2J8P A;  3X1V B;  3X1T A;  5AV9 A;  5GSU A;  3VH5 A;  5CGS A;  1AXB A;  3AZL C;  2FJ7 B;  5HAI A;  3A1K A;  3W99 A;  1SCW A;  1RP5 A;  5AV6 B;  3IF6 B;  5DNM B;  3PBN A;  4PM5 A;  3WS5 A;  4IBJ A;  5FQJ A;  3C5A A;  4NYY A;  2C6W B;  4KZ4 A;  3SH9 A;  1P3I D;  3MGS A;  4J8W B;  1KX4 C;  4KG2 A;  4KZ7 A;  1ES2 A;  1FSY A;  5A93 A;  1KE4 A;  5BO0 B;  3UT9 A;  1M19 A;  3PBQ A;  4JPM A;  4X23 A;  4GHA A;  4HEF A;  1K6R A;  3AYW B;  3LZ1 B;  3AZE B;  4EBP A;  1A7W A;  3AZK A;  2OLU A;  3AZF B;  1JTG A;  5B0Y B;  2ZY5 A;  5F1F A;  4ZJ2 A;  2XD5 A;  4Z5T A;  5C3I B;  3FV7 A;  1GHP A;  3H0R C;  5CP6 B;  3REK B;  3MBZ A;  2ZMA A;  5B1M C;  3X1V D;  3O87 A;  3ZDJ A;  4OLG A;  3AZH B;  3MNN A;  5FQM A;  2F8N G;  5GT3 A;  1KX5 B;  5KSH A;  2FJ7 D;  3BFD A;  1YUE A;  1XP4 A;  2OV5 A;  3Q07 A;  1KE3 A;  1ID3 D;  4YM6 C;  1ES5 A;  5AV6 D;  2RL3 A;  4LEN A;  3C1B B;  5DNM D;  4J8U C;  3M2J A;  4KEN B;  2ZM2 A;  2ZQ9 A;  1F66 D;  2WUQ A;  3B3X A;  3UPO A;  3L25 A;  1S0W A;  4KUD C;  1K57 C;  1KDS A;  1ZG6 A;  4DQY B;  3MFD A;  4S2I A;  3GR2 A;  3B0B A;  1BUL A;  4DE1 A;  2ZQA A;  3AZN B;  3ZG7 B;  1W79 A;  1P3G B;  3LZ1 D;  4DE3 A;  3AZE D;  2BG1 A;  1P3A A;  2NZD C;  3WKJ B;  1XGJ A;  5DTK A;  4G92 C;  4J8X A;  2ZJ9 A;  3AZF D;  4NE6 A;  5A91 A;  5B0Z C;  3B6F A;  4HBU A;  3BEB A;  5B2J C;  1HTZ A;  3IH8 A;  3VH5 T;  4D2O A;  2Y2P A;  3AZH D;  5GT0 B;  4KZ8 A;  3WS1 A;  4S2N C;  3AN2 A;  2YFW B;  3IP4 C;  3HSH A;  1TDG A;  2Y59 A;  3C1B D;  2ARO C;  4JXV A;  3Q7Z A;  4XZQ B;  1KX4 B;  2IOU A;  2VGK A;  4M3K A;  3G2Y A;  1P3I A;  5HAR A;  4WZ5 A;  3NIA A;  4R8P B;  2G2W A;  5DNN B;  2Y2J A;  1TDL A;  1XGI A;  3LY3 A;  3WS2 A;  3LZ0 A;  1KVL A;  3TU4 C;  4KHA B;  3AZG C;  3AZN D;  1TVF A;  5E5A C;  2ZQD A;  3BM6 A;  3WKJ D;  3IF5 A;  3MKE A;  4CSR A;  3SS3 A;  5B1M B;  1SDN A;  4KQQ A;  4MLL A;  3X1S B;  4Z2M H;  1XXM A;  4NYU A;  2PYO D;  2CV5 C;  1P3P B;  1MXO A;  2FFY A;  2ZQ7 A;  3V5M A;  4YM6 B;  3KUY A;  4ZTK A;  5GT0 D;  2FJ7 A;  4WU9 D;  2ZD8 A;  1PZP A;  3SS5 A;  3IF6 A;  2CWE A;  3FKE A;  3L27 A;  3Q7V B;  4IBD A;  2YFV B;  5EVI B;  3MGQ C;  4XZQ D;  5AQ9 A;  4K91 A;  3H0M C;  4J8W A;  3Q1F A;  4R8P D;  3W97 D;  5DNN D;  4WU8 C;  1M1A D;  4ZDX A;  4YFM A;  3N8L A;  5B33 B;  3R45 A;  5BO0 A;  2Z2M B;  2NZD B;  3G31 A;  3WS0 A;  2H0Y A;  4WYY A;  3AYW A;  4ZBE A;  1I2W A;  2WAF A;  1L2S A;  3AZE A;  3AV1 A;  4ZUX C;  2F8N H;  3O62 A;  5CPK C;  4H9P B;  4H9R B;  5GHX A;  3V3S A;  5B0Y A;  1ZLA C;  5FI2 A;  4J8V A;  2NQB A;  3P5J B;  3ZG9 B;  3X1S D;  4QD4 A;  3REK A;  5CP6 A;  5GXQ C;  4LV0 A;  3G32 A;  1P3P D;  2XFT A;  5EE8 A;  4KG5 A;  5CRF A;  1KX5 A;  3NBL A;  5TR7 A;  3NDG A;  2ARO B;  3IH9 A;  5B24 B;  4WNN B;  4PM8 A;  4E3N A;  4HES A;  3ZNY A;  5EVI D;  4G91 C;  2ZC3 B;  1P3L A;  2F2A C;  2WGW B;  3HUN A;  5B31 G;  5L2F A;  3X1U C;  4IBG A;  3AZN A;  1P3G A;  3C1C B;  3LEL C;  1P3O B;  1U35 C;  1PW1 A;  5JRG A;  3GSG A;  2Y2O A;  3AZM B;  2CV5 B;  5EOO A;  1EQZ B;  4WZ4 A;  3KWQ C;  4LV2 A;  1CEF A;  5B1L B;  4JJN D;  4P6B A;  2Y2M A;  5AVB C;  4JLF A;  1BSG A;  1DY6 A;  3PAG A;  4NET A;  4EV4 A;  2HPB A;  4N9L A;  3HVF A;  5DTS A;  2X71 A;  5FDH A;  4WZS B;  3UTB B;  2RVQ C;  5CHU A;  4KZ5 A;  2YFW A;  1E4D A;  1K56 D;  4OPQ A;  4P87 A;  2B5R A;  3GTC A;  1BH9 B;  5AVC B;  3N4I A;  1K6S A;  1SHV A;  4XZQ A;  1KX4 A;  1M6K A;  3AV2 B;  4Z66 B;  1P34 B;  5DNN A;  3MVD D;  5CPJ B;  1MY8 A;  2ZC7 A;  4RX2 A;  1JWZ A;  1N4O A;  1XKZ A;  4S2P A;  2HDQ A;  5B2I B;  5CPK B;  5GSU B;  2VGJ A;  3C1C D;  2IO5 C;  3QNB A;  1P3O D;  4WM9 A;  4R4R A;  3B6G D;  4QLC C;  4PMA A;  1KDW A;  4BD0 A;  2ZY2 A;  3W98 D;  5B1M A;  3AZM D;  1EQZ D;  5B1L D;  3X1S A;  3A3J A;  5JYO A;  4X53 A;  3NQU B;  1YMX A;  3MGS B;  2XH9 A;  4YM6 A;  3BFF A;  4DDS A;  1KU5 A;  3WX7 A;  4EWF A;  5B32 C;  4KZ9 A;  3UTB D;  1DJC A;  4X23 B;  4G91 B;  3Q7V A;  4IBE A;  4LV1 A;  3MZE A;  2YFV A;  5AVC D;  3UPP A;  1P3K C;  2E8I A;  1WYB A;  1K57 A;  1LI9 A;  4Z66 D;  1WWI A;  1P34 D;  2L5A A;  5CPJ D;  1BLH A;  1C3B A;  3X1U B;  4S2M A;  5B33 A;  4E6W A;  3MGP C;  4Z9Q A;  2NZD A;  2Y2H A;  1U35 B;  3HRE A;  4OQG A;  1P3M B;  3VSK A;  5B2I D;  5AV9 D;  5GSU D;  4F94 A;  4C75 A;  2IWD A;  5GT3 B;  2ZQC A;  3W99 D;  5B0Z A;  2R9X A;  4H9R A;  5B2J A;  4NE5 A;  3HLE A;  5FI6 A;  2PU4 A;  1Q9C A;  4OJP A;  3VH5 W;  1N9B A;  3WA9 C;  1G68 A;  3OC2 A;  3MGS D;  3MGR B;  1AOI B;  3DWZ A;  4EO5 C;  1L0E A;  2HP5 A;  2ARO A;  3UT9 D;  1M19 D;  1YLP A;  4X23 D;  5DF8 A;  5B24 A;  1TZY C;  4WNN A;  3P09 A;  1YU2 A;  5B31 C;  1M18 C;  1P3A B;  3REH C;  3AZK D;  1YLJ A;  3DW0 A;  3L2A A;  1LHY A;  1PWD A;  4DRT A;  4Z5T D;  5E5A A;  3REL C;  3B6F B;  2WGW A;  4QY5 A;  1P3B C;  1IYS A;  1P3M D;  4U0X A;  5BNV B;  1KE0 A;  5FI7 A;  4HGA C;  3MNN D;  3B0D C;  3AN2 B;  3N3F A;  5GT3 D;  3A6N C;  4KQR A;  1LL9 A;  4LCM A;  3AZM A;  2CV5 A;  5B1L A;  3SS4 A;  4XUX A;  3LJA C;  1NZU A;  5KZH A;  1JTD A;  1W5D A;  2ZM5 A;  1AOI D;  3BLS A;  3BLM A;  3VP2 A;  3LZ0 B;  4PM6 A;  3MGQ A;  4K0X A;  4YS3 C;  1HQ3 C;  1ALQ A;  1BH9 A;  3BYD A;  4WU8 A;  1P3A D;  4P0M A;  1BH8 B;  3A3D A;  5AQ7 A;  3AV2 A;  3UE3 A;  1P34 A;  3BEC A;  4UUZ A;  5CPJ A;  2HIO C;  1SKF A;  3AZJ C;  4DF6 A;  4WJ3 C;  1PYY A;  3WTP C;  3B6F D;  4M6B A;  4ZUX A;  3G2Z A;  4JKT A;  1Q2Q A;  3S22 A;  5B2I A;  2ZQ8 A;  5CPK A;  3S1Y A;  5HL1 A;  3KUY B;  5AY8 C;  5B40 C;  4H9N A;  4UA6 A;  1Z6F A;  3AN2 D;  3REJ B;  2WKH A;  4JBF A;  2XF3 A;  3KFU G;  5GXQ A;  3AFA B;  1YQS A;  4NY2 A;  2X02 A;  5CEC A;  4IJE A;  2JE5 A;  4GDN A;  5E43 A;  5F99 B;  2QPN A;  3NQU A;  4EO5 B;  3GQZ A;  4RVA A;  1KX3 C;  1FR6 A;  3RXX A;  3R45 B;  5FSR A;  1M18 B;  3LZ0 D;  4QJG A;  3Q82 A;  2CC1 A;  3DWK A;  1NRF A;  1NY0 A;  3AV1 B;  4DKI A;  3GV9 A;  4GNU A;  5FQQ A;  4JF5 A;  4R0Q A;  3O62 B;  4ZBJ C;  4R23 A;  2Q9M A;  2H5S A;  1P3B B;  3UY6 A;  5J8X A;  3X1U A;  4J8V B;  2NQB B;  3IXH A;  4MBF A;  5FQI A;  2QZ6 A;  3VP0 A;  5TFQ A;  1XPB A;  4HGA B;  2OSU A;  3W96 C;  5G49 B;  5CPI C;  1M1A C;  1XX2 A;  2Y2L A;  4Y0T A;  3LEL A;  3C7U A;  3REI C;  1U35 A;  1P3M A;  5AV5 B;  4NZ1 A;  1S32 B;  1HTA A;  3KUY D;  3I7J A;  3HON A;  1U60 A;  3VMA A;  1MWS A;  4RX3 A;  1IEL A;  2WAE A;  3FWL A;  3AFA D;  1W7F A;  1NYY A;  2HDU A;  3EPJ A;  3AZI C;  5F99 D;  4KGC B;  1JFI B;  5BS7 C;  4J8W D;  3GMW A;  3MGR A;  1AOI A;  2ZLY A;  1P3L B;  1PIO A;  1NZO A;  2WKE A;  3AYW D;  2HIO B;  2ZY4 A;  3AV1 D;  1S6R A;  3O62 D;  2FFF B;  5JRG B;  3SH7 A;  5AQB A;  3LEZ A;  5B0Y D;  4J8V D;  2NQB D;  4HBT A;  1K55 C;  1PW8 A;  5AY8 B;  3AZL B;  4QHC A;  3REK D;  5CP6 D;  4OOM A;  2J7V A;  2V20 A;  5BNV A;  5FA7 A;  1S32 D;  3C7V A;  3UTA C;  3VOZ A;  1KX5 D;  5A92 A;  4PM7 A;  4E3L A;  3UDI A;  5CGX A;  1W2E A;  4DE2 A;  1TAF A;  1FOF A;  4WMC D;  3M2K A;  1K4E A;  4QU3 A;  4JJN C;  2Y2Q A;  1DJA A;  5B32 A;  4KGC D;  1H8Y A;  1BT5 A;  4KQO A;  2A3U A;  3LCE A;  1YM1 A;  1P3L D;  2PBY A;  5E2F A;  5CED A;  4LD9 C;  5DF7 A;  1T3U A;  5F83 A;  1JWP A;  4ZBJ B;  1P3G D;  3SOI A;  2ZC6 B;  1IYO A;  5GLD A;  3HL9 A;  1BH8 A;  5CPI B;  3MGP A;  5JRG D;  3NQJ B;  3HLG A;  3REI B;  4X55 A;  3VP4 A;  2P9V A;  3WRZ A;  4RA7 A;  3VOY A;  3ISG A;  4UHU A;  4J8U B;  3WAA C;  1YLT A;  5E2H A;  3REJ A;  4X56 A;  3AFA A;  2JCH A;  1R4V A;  3B6G C;  1FCO A;  1JWV A;  3EPH A;  5F99 A;  4KUD B;  1KX4 D;  1MKI A;  4PPR A;  4IBB A;  1TZY A;  5IHV A;  5FAP A;  3V9R A;  4BD1 A;  2XQZ A;  1M18 A;  3KS4 A;  4BL2 A;  4H9S A;  4G92 B;  4OQ0 A;  5HX9 A;  2WGI A;  3REH A;  3VH6 W;  2HP9 A;  1Q2P A;  3FDD A;  5B0Z B;  1EWZ A;  3WTP E;  5B2J B;  1P3B A;  5B1M D;  4DRA A;  2J9O A;  4Y0U A;  3L28 A;  3NDE A;  5G49 A;  2BYM B;  1E3U D;  3UTA B;  2EX6 A;  4CPK A;  5AV5 A;  3A6N A;  1S32 A;  4OJO A;  3MZD A;  3X1T C;  4YM6 D;  1K25 A;  2EX8 A;  4JF6 A;  5CER A;  4J8U D;  5M18 A;  1J9M A;  3LJA A;  4N1X A;  4BEN A;  4AWL C;  2EFU A;  3ZVW A;  3W99 C;  3IQA A;  4R4S A;  4WMC A;  4N9K A;  3N6I A;  1MBL A;  4KGC A;  1JFI A;  4LD9 B;  3NC8 A;  3UO9 A;  3TU4 B;  4YS3 A;  4R1G A;  3AZG B;  1HQ3 A;  3M6B A;  5E5A B;  5B33 D;  2F8N K;  2NZD D;  2PU2 A;  4OJ5 A;  2DF4 C;  3UT9 C;  1BZA A;  2HIO A;  2JSS A;  3ZG0 A;  4KZ3 A;  5TGF A;  3NCK A;  3AZJ A;  5G18 A;  5B0Z D;  5B2J D;  5BOH A;  1IYP A;  1QMF A;  3AZK C;  1BLP A;  4OJL A;  3BFE A;  5AY8 A;  1ES4 A;  3O86 A;  3QNC A;  3AZL A;  3W4O A;  4Z5T C;  3N8S A;  3B0C W;  1HD8 A;  4JF4 A;  5BT1 C;  1YU4 A;  1FQG A;  4BL3 A;  2EX2 A;  2Y2I A;  3MNN C;  5HAQ A;  2ARO D;  1JVJ A;  3MGQ B;  4O7D A;  2WK0 A;  3KS8 A;  3G34 A;  5B24 D;  1B6W A;  2X01 A;  4WU8 B;  3CZD A;  3VH6 A;  3N7W A;  4UUZ B;  3VP1 A;  4Q8I A;  2HUE C;  1NJ4 A;  3TU4 D;  4L0L A;  1HZO A;  1YT4 A;  5E5A D;  4ZUX B;  4FSF A;  5AV8 C;  1EI5 A;  1P3F C;  2F8N B;  3D4F A;  1ZLA B;  4H9N B;  3BRM A;  2ZC4 B;  3VSL A;  5CPI A;  5GXQ B;  3NQJ A;  1ZKJ A;  3REI A;  4ZJ3 A;  2CV5 D;  4J8X C;  4WV4 B;  3KXB C;  4CAY A;  3Q81 A;  4IBR A;  1IYQ A;  1E3U A;  4BQM A;  4XUJ C;  3PBS A;  1I5Q A;  1KGE A;  2WZX A;  3UN7 A;  2XGN A;  4J8U A;  3QHY A;  3L26 A;  1F1E A;  4GOG A;  3AZI A;  3MGQ D;  1ERQ A;  1CEG A;  4KUD A;  4WU8 D;  3AV2 D;  4OP8 A;  1P3I C;  4GKU A;  5JA4 B;  4RYE A;  2Q9N A;  3LEL B;  1YLW A;  1WWS A;  4ZUX D;  3OCN A;  4GZB A;  4WEJ A;  4OQI A;  4EUZ A;  3AGD A;  5CPK D;  1HVB A;  5CHJ A;  2WKI A;  2XD1 A;  1ZLA D;  3KWQ B;  3CJM A;  4JXS A;  5AVB B;  1K55 A;  5HAP A;  3AGF A;  5GXQ D;  4DE0 A;  4FH4 A;  1ESI A;  3IWQ A;  4MEZ A;  2BYM A;  3A3F A;  5EPH A;  4S2N A;  3UTA A;  4E6X A;  5CTN A;  2XFS A;  3V39 A;  3X1V C;  4GH9 A;  1Y54 A;  1NYM A;  4OPY A;  4B4Z A;  2FJ7 C;  3A1I A;  2VQR A;  5BNX B;  4CJN A;  3JYI A;  4H9Q B;  1ID3 C;  2WGV A;  2Y2G A;  5AV6 C;  3VH6 T;  5DNM C;  4GB7 A;  4LD9 A;  3NI9 A;  1F66 C;  2EXB A;  3VFF A;  3TU4 A;  1XA1 A;  3PBO A;  3X1U D;  2P74 A;  1P3F B;  3AZG A;  3IT9 A;  1ERO A;  4H8R A;  3UPN A;  4MBH A;  2IO5 B;  3LEL D;  1U35 D;  5GL9 A;  4WEK A;  4QLC B;  3UDF A;  3ZCZ A;  2ZM8 A;  4B4X A;  1KGF A;  3KWQ D;  3LZ1 C;  1GHM A;  1LLB A;  3AZE C;  3O88 A;  3NY4 A;  5EVL A;  1TAF B;  1M40 A;  3AZF C;  2EXA A;  4NFT A;  5B0Y C;  4FD8 A;  1MWU A;  1ONG A;  3WAA A;  5C3I C;  5B32 B;  3MGR D;  3C4O A;  3UE1 A;  3PAE A;  3AZH C;  1GHI A;  3H0L C;  1P3K B;  2QMI A;  4PM9 A;  4C6Y A;  3ITB A;  5KMW A;  4R3B A;  3UDX A;  1K54 C;  2HP6 A;  1IEM A;  3VFH A;  4BLM A;  3C1B C;  5FQK A;  4X6T A;  5F82 A;  3HLD A;  3WRT A;  3MGP B;  4OLD A;  3TG9 A;  3E2K A;  1YLZ A;  3HUM A;  1KVM A;  4K0W A;  5JYP A;  2P9V B;  5E2E A;  3ITA A;  5CHM A;  4GD8 A;  1TEM A;  2WZZ A;  2W8S A;  5HFO A;  1W8Y A;  4QLC D;  2F8N A;  2ZC5 B;  3B0C T;  1ZLA A;  3OPP A;  3AZN C;  5FAT A;  1P3G C;  3MZF A;  5AQA A;  3WKJ C;  3IWO A;  4NE3 A;  4ZAM A;  3WA9 B;  3EPK A;  2XLN A;  2XDM A;  1CK3 A;  4UAA A;  4E3I A;  1BFM A;  4LCL A;  1XA7 A;  2ZM0 A;  4X69 A;  5B32 D;  2PYO C;  4C3Q A;  3RJU A;  1TZY B;  4DXC A;  3ZGA B;  4KG6 A;  3V9R B;  1ID3 B;  3ZHH A;  5CGW A;  2Y91 A;  5B31 B;  5GT0 C;  1P3K D;  3CMZ A;  4WU9 C;  2DQN C;  3REH B;  4Z2M G;  2I72 A;  1F66 B;  3E2L A;  1GA9 A;  3FZC A;  1PWC A;  1PWG A;  1CI8 A;  3REL B;  3MGP D;  1IKI A;  4XZQ C;  2C5W B;  3W4Q A;  4R8P C;  5JA4 A;  3W97 C;  5DNN C;  5CEB A;  4Y0O A;  1PZR A;  3B0D B;  3A6N B;  3KWQ A;  2G5H C;  4OPR A;  5AVB A;  3REJ D;  3LJA B;  3WA9 D;  2Y4A A;  4IJF A;  3PBT A;  1DJB A;  3MKF A;  5A90 A;  2J8Y A;  1BUE A;  1G6A A;  1LL5 A;  3X1S C;  5M19 A;  3IHA A;  4MBK A;  1P3P C;  5FUG A;  1TZY D;  4YS3 B;  5DTT A;  1HQ3 B;  1RCJ A;  5B31 D;  1M18 D;  2XEP A;  5FQ9 A;  5BNX A;  3REH D;  4H9Q A;  1WE4 A;  1LI0 A;  1B67 A;  3GRJ A;  3AZJ B;  3WTP B;  3REL D;  5EVI C;  4LG2 A;  2GDN A;  1P3B D;  1N1J B;  5AV8 A;  1P3F A;  5B40 B;  5GHZ A;  5B33 C;  1KGG A;  5AV5 D;  4QLC A;  3A6N D;  2JC7 A;  3LO7 A;  3KXB A;  4BJP A;  4OOL A;  3OPR A;  3EQU A;  4IBK A;  4MNR A;  5KDM B;  3LJA D;  4XUJ A;  3IXB A;  2PYO B;  1ONH A;  1BLC A;  1KX3 B;  4OP5 A;  4FH2 A;  3F6T A;  2RCX A;  5GLC A;  4WU9 B;  4YS3 D;  2G2U A;  1HQ3 D;  2G5I C;  4OUI A;  1BLS A;  5EEC A;  5GLB A;  1P3K A;  3A3E A;  4GHL A;  1K4F A;  1RGY A;  3ZG8 B;  4WBG A;  4EBN A;  2HIO D;  1VM1 A;  5B24 C;  2OLV A;  4NZ3 A;  3W97 B;  3M6H A;  3AZJ D;  3W96 B;  1M1A B;  3WTP D;  1CI9 A;  3LY4 A;  4CAY B;  4XUZ A;  1ULY A;  3MVD C;  1H8Z A;  5GHY A;  5AY8 D;  2XK1 A;  5B40 D;  3AZL D;  2EFX A;  4NZ4 A;  1PI5 A;  2DCF A;  3CG5 A;  1MPL A;  1YMS A;  2HDR A;  3BFC A;  3C1C C;  3L29 A;  3MXR A;  4H9O A;  4OH0 A;  3AZI B;  4E45 A;  1FR1 A;  1P3O C;  5DF9 A;  3WA9 A;  3W98 C;  3PTE A;  4S2L A;  3AZM C;  3X1V A;  5FAO A;  1KX3 D;  1EQZ C;  3HBR A;  1OME A;  1NXY A;  5B1L C;  5D3O A;  3IXG A;  3IHB A;  1ID3 A;  2Y55 A;  3G35 A;  5B31 A;  3G30 A;  5AV6 A;  1IKG A;  5DNM A;  3VP3 A;  3ZG5 A;  2JBF A;  3UTB C;  1F66 A;  3ZVT A;  4KZB A;  1ZC2 A;  2Y2N A;  1YU3 A;  4KZA A;  5AVC C;  4IBF A;  5B32 G;  3REL A;  4LV3 A;  3W96 D;  5CPI D;  1H5X A;  3REI D;  3OZH A;  3AV2 C;  4Z66 C;  1P34 C;  3TOI A;  4GN2 A;  4N92 A;  5CPJ C;  1SDE A;  3EG5 B;  4QNL A;  1ESU A;  1FSW A;  4S2J A;  3S4X A;  3LZ1 A;  4DXB A;  2H10 A;  2H0T A;  3W4P A;  5B2I C;  5AV9 C;  5GSU C;  3AZF A;  4JJN B;  2DRW A;  3IXD A;  3AZI D;  3RXW A;  3ZFZ A;  4KUD D;  3V50 A;  3AL0 C;  3AZH A;  4UA7 A;  3EQV A;  4IED A;  1WYC A;  3MGS C;  3KSY A;  1K54 A;  1GA0 A;  5CXW A;  3C1B A;  5DVA A;  1E25 A;  2IWC A;  3PBR A;  1M19 C;  4X23 C;  4JXG A;  1GCE A;  4GD6 A;  3MVD B;  5I94 A;  1MWT A;  3WTP A;  4OKP A;  4UA9 A;  1YLY A;  3AGE A;  1N1J A;  4S2K A;  5B40 A;  3OCL A;  3MXS A;  2DNS A;  3WAA B;  3UTA D;  1PI4 A;  3WKJ A;  2UWX A;  1P3M C;  3B6G B;  1Z2C B;  5M1A A;  4IVI A;  2IWB A;  3W98 B;  2BYK B;  5KDM A;  5GT3 C;  2HDS A;  2PYO A;  1L0D A;  1KX3 A;  1ERM A;  1YU0 A;  4E3K A;  4LD9 D;  5GT0 A;  4WU9 A;  3OPL A;  3DTM A;  3AZG D;  3MGR C;  1AOI C;  3WWX A;  5E2G A;  4A5R A;  5BPV A;  4R8P A;  3W97 A;  4NK3 A;  3W96 A;  3WS4 A;  1M1A A;  1P3A C;  1H3O B;  3EPL A;  1L0F A;  3X1T B;  4KHA A;  5AV9 B;  1YU1 A;  3WAA D;  3C4P A;  3B6F C;  4AWL B;  3W99 B;  4E3M A;  4E44 A;  4FCF A;  3AN2 C;  4OOY A;  5BS7 A;  3UE0 A;  2A49 A;  1P3P A;  1FCN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...