2Y2HA

Penicillin-binding protein 1b (pbp-1b) in complex with an alkyl boronate (za2)
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
487
structure length
467
Chain Sequence
SEITYSDGTVIASIDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTGQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PENICILLIN-BINDING PROTEIN 1B
publication title Structure-Guided Design of Cell Wall Biosynthesis Inhibitors that Overcome Beta-Lactam Resistance in Staphylococcus Aureus (Mrsa).
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
total genus 159
structure length 467
sequence length 487
chains with identical sequence B
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2y2hA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2y2hA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2y2hA02
4XUXA 1DJCA 2ZC6B 1YLJA 4HBUA 1NRFA 1L0GA 4X56A 3HLCA 3TOIA 4LCLA 3PTEA 3WRZA 2ZM2A 2WKIA 1BLCA 1SHVA 3HREA 3IXGA 1W5DA 3QHYA 3UPNA 2XQZA 1N9BA 4RX2A 1HZOA 4E6WA 1CEGA 4WZ4A 3PBTA 3MZFA 3OPLA 3PBQA 2JBFA 2X02A 5CTNA 1FCNA 1ZG6A 3UE1A 3M6BA 1FR1A 4PMAA 3NI9A 4GDBA 5FQMA 1I2WA 4R3JA 5E2EA 3RXXA 4QJGA 2V1ZA 3Q7ZA 4QB8A 3HLWA 4E3OA 4C3QA 3A3FA 5HW3A 3VFHA 1W79A 5A93A 1MWSA 4X6TA 1FCMA 1SDNA 2XH9A 3O3VA 5E43A 1NYYA 1DJBA 1XPBA 2J8YA 4KZ3A 2P74A 1BTLA 3MZEA 2EXBA 3ZCZA 3ZG5A 4OP5A 1NZUA 3G2ZA 5FQJA 2P9VB 3BRMA 4D2OA 4EBNA 5KSCA 1K6RA 1PI4A 2V20A 3SH9A 5CECA 1ZG4A 2WAEA 2BG1A 2E8IA 2FFYA 1JWPA 2ZMAA 3VP3A 1JTDA 1K55A 3NC8A 1ZKJA 1ESIA 4WYYA 2H0TA 1AXBA 1GHMA 2RCXA 5DVAA 2WGVA 4QY5A 5EVIC 3UY6A 3VMAA 3VP4A 4RA7A 3UDIA 3WS4A 3Q07A 3SH7A 5FATA 5TGFA 1NXYA 3EQUA 3OCNA 3TSGA 5EECA 1PW1A 4NETA 1E4DA 1JWVA 2G2WA 1YLYA 4NK3A 4GKUA 1LHYA 3V39A 4WZ5A 4Y0TA 4CJNA 4S2JA 4UHUA 1WE4A 3GSGA 4P85A 2CC1A 3UE3A 3IH9A 1CI8A 1HVBA 2EX9A 1ES3A 5A90A 5JYOA 1E25A 1LL9A 2XD5A 3MKEA 1FR6A 3IH8A 4WMCD 4B4XA 5HL1A 3AGDA 2JC7A 2EXAA 4N9KA 1XX2A 3VFFA 2DRWA 3AGFA 4EWFA 4YFMA 4X53A 1YLWA 4PM9A 3NDEA 1ZC2A 5F82A 3HLGA 5FSRA 4KZ5A 3LY4A 1KVMA 4FH4A 3ZG0A 4EUZA 1ES5A 4P6BA 4ZBEA 5GLBA 1GA9A 2WKHA 1K38A 3N8SA 4BD1A 4BENA 4OOMA 4MNRA 3WS0A 3SH8A 3WS2A 1YQSA 2X01A 2V2FF 4DDSA 4KQQA 1KGFA 3BEBA 1L0EA 2HDSA 1MBLA 2JE5A 4E3MA 1PWGA 2HP5A 4ZDXA 1H8YA 3UDXA 4PPRA 2Y2NA 1GHPA 1K55C 4IBRA 1LI9A 4OONA 3VOZA 4DXBA 1TDGA 3D4FA 4GN2A 5KZHA 3N4IA 1IKIA 2EFUA 5FI6A 3SS4A 2EFXA 4WM9A 1QMFA 3Q1FA 1Z6FA 1K4FA 1FSWA 5EOOA 1ES4A 1MWRA 2WKEA 4E3KA 4IEDA 3IXBA 3NCKA 1G68A 4LCMA 4MLLA 1PI5A 4K0WA 4X68A 1HTZA 5CRFA 1C3BA 2C5WB 2J9OA 4WZ5C 4JF5A 2PBYA 5HAIA 4UAAA 4QHCA 4LV1A 1XA1A 3A3EA 5EOEA 3ITBA 2ZJ9A 3N6IA 1J9MA 4H8RA 4HESA 2OV5A 5EPHA 4OPRA 4S2NA 3ZHHA 4OLGA 2VGKA 1LLBA 3FZCA 3SOIA 3ZG7B 1XGJA 3HUOA 5DTTA 4RVAA 3C4PA 3SS5A 3NDGA 1O07A 2ZQ9A 2DCFA 1ERQA 3FKWA 4S2LA 3UO9A 5GL9A 4OH0A 4DXCA 1NJ4A 2Y2MA 2XGNA 3M6HA 2ZD8A 2H10A 2ZQAA 3G32A 2ZQCA 1MXOA 4JXGA 3IF5A 1SDEA 3HUMA 2WAFA 4OQGA 4ZAMA 4ZTKA 3S1YA 2FFFB 5GHXA 3GTCA 4BJPA 2IWDA 5AQAA 2HDUA 3O86A 4OKPA 1KDSA 1IYOA 4C6YA 4KQOA 4BLMA 3ZVWA 3LEZA 1H5XA 1EROA 5HX9A 1SCWA 5AQ7A 2WZZA 4S2PA 2Y2LA 1IELA 2H0YA 4FCFA 4N9LA 3MFDA 4Y0UA 5CGXA 3FYZA 5AQBA 1Q2PA 5DF7A 4KG6A 5FAQA 1CK3A 5E2GA 4JF4A 3W4QA 2Y55A 1SKFA 1BZAA 3ZNYA 4Q8IA 4FSFA 4EV4A 3BM6A 4GD8A 1W7FA 5GLAA 3I7JA 4E3IA 4DE3A 2Y2QA 1QMEA 2ZQDA 1KE0A 1ES2A 4GD6A 4KG5A 3HLFA 1PW8A 4S2NC 2Q9NA 3GRJA 4LV2A 4E3NA 4R1GA 5TR7A 3OPRA 5FDHA 4K0XA 1K4EA 4BQMA 1W8QA 3BECA 1ERMA 1FQGA 1K57A 3DWKA 2B5RA 3JYIA 3A3DA 4UA6A 1TVFA 5FI2A 4ZJ1A 3ZGAB 2PU4A 2Y2JA 3HUNA 1BLSA 4FH2A 4N1XA 1IYQA 1K56D 2OLUA 3E2KA 1KGGA 1RGYA 3BFFA 3PBRA 2ZC3B 4GNUA 3CMZA 2HP6A 1IKGA 1OMEA 3GV9A 5TFQA 5GLCA 3HL9A 4S2KA 3LO7A 2WADA 1IYSA 3UN7A 4JXWA 3PBNA 3W4OA 4IBXA 2GDNA 1LL5A 2QMIA 4OOYA 4KZ7A 3S22A 1VQQA 1PWDA 5HAQA 5FAOA 4F94A 4QD4A 1FOFA 3Q7VA 4DE2A 3ITAA 5JYPA 1BULA 1CEFA 2EX8A 4LV3A 1GCEA 3NY4A 1BT5A 4R4SA 4Y0OA 1GA0A 3GMWA 2H5SA 4JPMA 3G31A 4UA7A 5DTKA 1MKIA 1PIOA 3G35A 5DF8A 2WGWA 4DE1A 2G2UA 1NZOA 3V3SA 1GHIA 4XXRA 3N8RA 3E2LA 3S4XA 5EVID 5EUAA 3LY3A 2R9WA 5AQ9A 1ONHA 2XR0A 2Y4AA 1NYMA 2I72A 3OZHA 1TDLA 3GVBA 4MBHA 2ZM8A 5J8XA 1ESUA 3OCLA 4WELA 4GZBA 3PAGA 1I2SA 1YLZA 3FWLA 4R23A 2XD1A 2Y2KA 1K57C 5DTSA 3AGEA 3MXSA 4PM7A 1PZPA 2J9PA 4IVIA 4JBFA 4X69A 5DF9A 2Y91A 5F83A 3VP0A 3PBSA 3G34A 2ZC4B 5E2FA 3BFEA 3NIAA 2Z2MB 5G18A 4PM5A 1Q2QA 5KMWA 1RP5A 4KENB 2ZQ8A 4BL2A 1DY6A 4BL3A 3O87A 4UA9A 4WEJA 2XFTA 4MBKA 5CHUA 4Y7PA 5KSHA 2RL3A 4EBPA 1KE4A 5HFOA 3V3RA 5FQQA 4EBLA 5M18A 3CJMA 2HDRA 2A3UA 2R9XA 2BLSA 3FKVA 4OQHA 5GLDA 3PAEA 4MEZA 2JCHA 4OPYA 3ZFZA 2A49A 4WMCA 1XA7A 3C7UA 5HAPA 3V5MA 4OP8A 3VOYA 2J7VA 4Z9QA 1YM1A 4KZBA 5L2FA 2VGJA 3Q81A 1XKZA 3C4OA 4OOLA 3HLBA 2EX6A 4DKIA 4O7DA 1PZOA 4X55A 1S6RA 2XF3A 3OPPA 2ZLYA 3HBRA 3OPHA 3V50A 5A92A 4KZ9A 4GB7A 4U0TA 1BLPA 1Y54A 2HP9A 3MKFA 1XP4A 4DRTA 3OC2A 1TEMA 3ZNTA 1EWZA 3G4PA 4RYEA 1L0DA 1ONGA 4R0QA 1LI0A 4MBFA 1MWUA 4OQIA 2Y2IA 1S0WA 3IXDA 2Y59A 4LENA 5F1GA 2XEPA 1N4OA 4JXSA 4GDNA 5CHJA 2WYXA 2ZM0A 1KGEA 1MY8A 2OSUA 5U47A 3IQAA 3Q7VB 1PYYA 2HPBA 3C5AA 3BFDA 4WEKA 4B88A 2QZ6A 4OVDA 1DJAA 1YMSA 1FCOA 5CGSA 4R3BA 3N8LA 4JLFA 4DE0A 2WGWB 3DW0A 3BFGA 1YLPA 4WBGA 5D3OA 1BUEA 4OLDA 5FAPA 3P09A 1PWCA 3IWQA 1K54A 1BLHA 2XK1A 3MZDA 3WRTA 3IF6B 4A5RA 2XDMA 1L0FA 2ZQ7A 1E3UD 4BD0A 3DTMA 3IXHA 3UE0A 3WS1A 1I5QA 3BLSA 4ZJ2A 3BYDA 1W8YA 3GR2A 1WYCA 1YMXA 5FI7A 4FD8A 4HEFA 3CZDA 1RCJA 3VSKA 2UWXA 3ISGA 3B3XA 4XUZA 3BLMA 3VP2A 3EQVA 2Z2LB 3W8KA 3FV7A 1MPLA 4L0LA 3ZG9B 3BFCA 4KZ6A 5CGWA 2DNSA 4KZAA 4K91A 5IHVA 3Q82A 3NBLA 2PU2A 1M40A 3IWIA 4OPQA 3WS5A 1IEMA 5M1AA 2OLVA 4LV0A 3HLEA 4ZJ3A 3MXRA 1HD8A 2EX2A 5CXWA 1M6KA 2Y2GA 1H8ZA 2X71A 2C6WB 4OPZA 4U0XA 3IT9A 3P98A 3QNCA 4P87A 3ZG8B 5I94A 3O88A 2XFSA 4IVKA 4PM8A 4QU3A 3VSLA 1KE3A 2Y2OA 3CG5A 3W4PA 3UPOA 4CPKA 1NY0A 3IF6A 3HLDA 3IHBA 3PBOA 4OQ0A 4JXVA 1BSGA 2P9VA 1WYBA 1EI5A 1O7EA 1JVJA 4KZ4A 2Y2HA 4R4RA 4EQIA 3DWZA 4N92A 5FASA 3UPPA 1K25A 5CEDA 4KG2A 1JWZA 1K54C 5CHMA 4S2IA 4KZ8A 4QY6A 1U60A 1CI9A 5EE8A 1JTGA 4GOGA 4DDYA 4S2MA 3G2YA 2QPNA 2WK0A 5EVIB 4E3LA 3SS3A 4RX3A 1K56A 3A3JA 5E2HA 1E3UA 3M2JA 5EVLA 2WGIA 2ZC5B 3QNBA 3G30A 5A91A 4KQRA 3UNWA 3MBZA 5M19A 5HARA 5F1FA 4ID4A 1XXMA 5FQ9A 3ZVTA 1KDWA 1YT4A 3IWOA 2Y2PA 3RXWA 5BOHA 1FSYA 4YINA 4JF6A 4S2OA 4N1HA 5GHYA 2IWCA 1KVLA 4E6XA 4P0MA 5CERA 3RJUA 3LCEA 3M2KA 4E3JA 1ALQA 3TG9A 5CTMA 3UDFA 2IWBA 2Q9MA 1VM1A 4HBTA 4B4ZA 3C7VA 3GQZA 3HVFA 4C75A 5FQIA 1IYPA 1MWTA 1K6SA 2HDQA 1XGIA 3A3IA 3IF6C 2XLNA 4PM6A 1G6AA 4DF6A 2ZC7A 3N7WA 2WZXA 3IHAA 1RGZA 5FQKA 1YLTA 4M3KA 5EVIA 2WUQA 5GHZA 5FA7A 3VP1A 3WWXA 3ZDJA 4JKTA 5CEBA 1L2SA 4U3TA
chains in the Genus database with same CATH superfamily
4R8PC 1P3GC 3LYXA 3TOIA 3AZKA 2WKIA 1W5DA 3UPNA 4RX2A 5HDDA 1HZOA 1CEGA 4WZ4A 2X02A 5B0YB 3UE1A 4WU9B 3MQ0A 4GDBA 1LSWA 3UTAB 4R3JA 5B32A 5AV9D 5KDMA 4H9RA 1T3UA 4J8XA 4ARZA 5EVEA 5B31C 2J8YA 5GT0C 4KZ3A 3MGQA 3VOLA 1KX4A 2EXBA 3ZG5A 2PAVP 3G2ZA 3BRMA 5B40C 3CI6A 2V20A 3K3DA 2F8ND 5AVBC 1ZG4A 2PYRA 2WAEA 3TU4C 4ZUXD 2ZMAA 1BH9A 1JTDA 3AZNA 4WYYA 2H0TA 1F5MA 3X1UD 4YWZA 4EERA 2YFWB 4R3AA 4QY5A 4G3VA 3P5JB 3PXPA 3UDIA 5TGFA 3CUEA 3OCNA 5DNND 1EW0A 3NQUB 2G2WA 1YLYA 3V39A 3AZKC 4Y0TA 4YM6C 3CHWP 1WE4A 3GSGA 4QPRA 1ED7A 2L5AA 1CI8A 1P3ID 5A90A 5JYOA 1LL9A 1FR6A 4B4XA 3AGDA 2JC7A 2V1BA 2DRWA 2VGLS 5B32C 3NQJB 1KX5B 3TE8A 4YFMA 1YLWA 4PM9A 3MGRD 5AV8B 4J8XC 1KVMA 3ZG0A 4D60A 4ZBEA 5GLBA 3WAAB 1K38A 5HWVA 4NE3A 1WA9A 1M1AD 3MGQC 1KX4C 2YFWA 4OOMA 2NQBB 1B67A 2ZY3A 5B2IB 1KGFA 4E3MA 1H8YA 3AZNC 3T1SA 1IKIA 5FI6A 4WM9A 3UMEA 1P3FB 5AVFA 2VZWA 1P3AD 3CUEC 1R4VA 4E3KA 4HY8A 3IXBA 4G92C 3X1TB 1J7MA 3C30A 3NQJA 1KX3B 5AV8A 5CHLB 5GXQA 3MSHA 1PNEA 3MJQA 3ZHHA 3FKEA 1LLBA 3WA9D 3ZG7B 5B2IA 3B6FA 2L4RA 4RVAA 3C38A 3NDGA 1O07A 3FKWA 3AZJB 5I5LA 4OH0A 5E5AD 1NJ4A 2D49A 2H10A 2ZQAA 3TRCA 2H28A 1MXOA 3AZGD 4L9FA 3IF5A 1SDEA 3HUMA 2WAFA 3A1KA 3DBAA 3EPJA 2FFFB 1YUEA 3S1YA 1CK7A 1WWIA 1PFLA 3MXQA 3G6OA 3X1TA 1BH8A 3EOIA 1KX3A 4G91C 2F2AC 5CPJB 5HX9A 4FCFA 2HZ5A 3FYZA 4HP4A 3REIB 4YNRA 5FAQA 4X23C 1CK3A 5E2GA 1P3OB 4LRZE 4HH2A 2B95A 5AV8C 4GD8A 5GLAA 5GXQC 3KXBD 1UR9A 2YFVB 2CV5B 4BBVA 3AZHA 4E3NA 3B6FC 3BJNA 1OTIA 1P3GD 2HUEB 4KUKA 3DWKA 1G28A 2B5RA 4NXFA 1TAFB 4BWIA 2W0NA 5AY8B 2Y2JA 5CPJA 5AV6D 1BLSA 3HUNA 4NEED 3E2KA 3AYWA 4KGCA 3BFFA 4GNUA 2HP6A 4IJEA 3HL9A 3REIA 3X1TC 3UN7A 3PBNA 1P3OA 2QMIA 4OOYA 4KZ7A 4J8VB 1S32C 4MMNA 4HOIA 5F5YA 1E6ZA 4DE2A 2J8PA 3ITAA 5JYPA 1XJ3A 4GS9B 2YFVA 1CEFA 2CV5A 1GCEA 1BT5A 4Z2KA 4NZ3A 5AVBD 4I3IA 5BNXB 4JPMA 3TU4D 4WF0A 3MFXA 3KSYA 5DF8A 2ZM5A 5GSUB 1CQAA 4OJPA 4G3WA 3E2LA 3S4XA 2R9WA 5C3IB 1UWNX 1T1AA 3AZHC 3TJZC 3F1OB 3F6TA 2RIQA 5J8XA 4R23A 1VB6A 4DJ2A 3VH6A 5DF9A 3AZKD 3QP8A 3PBSA 4PM5A 4P6ZM 5CPJC 1ACFA 2FZ0A 1DY6A 4DMZA 3AYWC 3REHA 4KGCC 1G5UA 3O87A 4GS9A 5KSHA 4EBPA 1KE4A 3REIC 1P3OC 4EBLA 1P9WA 3WTPE 4NZ4A 5BNXA 4IBDA 3UB7A 1LSXA 4GHIB 4Z2LA 3PAEA 2JKTM 3CPTA 5GSUA 5FEGA 2OAP1 3MGQD 1KX4D 4GJ4A 5CPIB 2CV5C 3UB5P 4IUKA 2J7VA 2YKHA 4UUZB 1YM1A 4KZBA 1M19B 4B9OA 1XKZA 5L09A 3V67A 4OOLA 2EX6A 4DKIA 3AZND 4EW7A 3OPHA 3V50A 3DTEA 4GB7A 4U0TA 4R70A 2HP9A 4JJNC 3BQ8A 3MKFA 4H9NB 5B0YD 4R0QA 5LBRA 4GW9A 4H9SA 3EG5B 5F1GA 4GHIA 3S7PA 1EAKA 2XEPA 3HONA 3REHC 1N4OA 3KX0X 3Q7VB 1EQZB 5K5BA 1PYYA 5B1LB 3B0BA 4KQDA 3MF0A 2R78A 1S1ZA 4JLFA 4DE0A 3DW0A 3D72A 1BUEA 4H9NA 4QLCB 4LGWA 1PWCA 4H9PB 3MZDA 1BLHA 3WRTA 1TZYC 3UTBB 2XDMA 3DTMA 1Y4OA 1I5QA 4NZ5A 4CAYB 2F8NB 1D7EA 1T19A 2ZOIA 3BQAA 2VA0A 4WLAA 1BYWA 1WYCA 5FL3A 1YMXA 1FIKA 4HEFA 5BPVA 4WZ5C 1RCJA 3X1UB 3ISGA 3PHYA 3BLMA 3VP2A 3LJAA 3W8KA 3FV7A 3BFCA 2DNSA 4H9SC 3A6NB 4KZAA 2CMNA 5AV8D 1EQZA 1M40A 4Y17A 1IEMA 2ZMVA 2OLVA 3WAAD 2ACGA 1HD8A 3MMHA 2LY8A 2X71A 4OPZA 3IT9A 3P98A 1SZVA 2NQBD 3QNCA 2ZL1B 5I94A 2DF4C 5B2ID 4QLCA 4WNNA 3VSLA 3W4PA 1E6PA 1NY0A 3UTBA 4OQ0A 3MNNA 1BSGA 4CAYA 2JKRM 1O7EA 4R4RA 4Z2MH 5HDCA 4N92A 5CEDA 4KG2A 1M1AB 2F8NH 1P0ZA 5CHMA 3X1TD 1H0MA 5EE8A 3A6NA 1KX3D 4IBEA 4J8WA 2WK0A 2ZY2A 3SS3A 3IS2A 3AZFB 3M2JA 2WGIA 3JVUA 5A91A 2L1MA 3MBZA 3LJAC 5M19A 4ID4A 1P3AB 2Y2PA 1EQZC 3M7PA 4EO5B 4N1HA 2IWCA 1P34B 1KVLA 3UB9A 3AZJD 5GT3B 2G5HC 3C2WA 3TG9A 3UDFA 1ZLAA 3A0RA 3AZHD 4DRBA 3AN2B 3HVFA 4C75A 1YPRA 1XFNA 1MWTA 4M4XA 4GHAA 1H0IA 4Z2JA 3UTBC 2XLNA 2W8SA 1G6AA 4PM6A 3A0SA 4KHAB 3MNNC 3W99C 2WZXA 4NKPA 1L3LA 5FQKA 2VV8A 5CPJD 2WUQA 2XA7S 5FA7A 3VP1A 3AZFA 4KGCD 3AYWD 3V9RB 4XUXA 1DJCA 4HBUA 4HJ3A 2P04A 3REID 1L0GA 4X56A 3QP5A 3AZGB 1P3OD 5G49B 2ZM2A 1SHVA 4J8WC 3QHYA 1N9BA 5TJJA 1P34A 3MZFA 5GT3A 1FCNA 2J80A 1ZG6A 1P3PB 3WKJA 4Y15A 3AZIA 2CV5D 4QNLA 3NI9A 4PMAA 3L26A 1I2WA 5E2EA 3AN2A 1F2KA 4QJGA 1KS0A 4CLCB 3HLWA 3VFHA 5A93A 4X6TA 2JHEA 2P74A 5AY8D 3ZCZA 1ZLAC 4OP5A 5CPKA 3KXBB 2I9VA 3V9RA 4Z1WA 2P9VB 4D2OA 4EBNA 5KSCA 1P3BB 1PI4A 2BG1A 4PKYG 1ZKJA 2K7SA 1AXBA 2RCXA 4R8PB 1P3GB 2V0UA 2WGVA 3VMAA 3AZFC 3Q07A 3REHD 3SH7A 5FATA 1P3PA 3EQUA 2IO5B 1HQ3B 1PW1A 4LG2A 1JWVA 4CLCA 2VV6A 3MGSA 3ZYTA 2CC1A 3IH9A 4BBTA 1P34C 5GSUD 5GT3C 1ES3A 4L9EA 5HL1A 3WKJC 3AZIC 4MN5A 5L10A 2PYOA 4EWFA 3AN2C 5B31B 5F82A 5GT0B 3FDDA 3HLGA 5FSRA 4WU8A 4FH4A 4EUZA 2WKHA 5B40B 4BD1A 4R8PA 5AV5B 3SH8A 2X01A 5CPKC 5DNMB 4AFIA 1OTEA 4KQQA 1L0EA 2HDSA 1N9NA 3UDXA 1HQ3A 3MQLA 4J8UA 1TDGA 5KZHA 4GN2A 1OTAA 2EFXA 1WWSA 2QJ5A 1FSWA 2AVXA 5EOOA 1ES4A 1MWRA 1P3PC 4YM6B 1IFQA 4LCMA 2RVQC 1PI5A 4K0WA 4F3LA 1HTZA 5CRFA 1OT9A 2J9OA 5HAIA 3MGSC 3A3EA 5B32B 5KDMB 2ZJ9A 3N6IA 4H9RB 5B40A 4IBCA 3UB8A 1J9MA 4J8XB 2JN7A 4PHTA 4H8RA 2OV5A 4GCZA 5AV5A 1F98A 2PYOC 3ZQ5A 3SOIA 1E6NA 5DNMA 3HUOA 3REKA 3MGQB 4WU8C 4Q0IA 3NOPC 3SS5A 3LELB 4IJGA 4R38A 5GL9A 3VV4A 4DXCA 2Y2MA 1A7WA 2XGNA 1W2EA 3M6HA 2ZD8A 1BH9B 2PR6A 3AZNB 2ZQCA 3EEAA 4ZAMA 5B31G 2FJ7B 4YM6A 3GTCA 5AQAA 2IO5C 1PDCA 1HQ3C 4OKPA 4J8UC 1GPFA 4OJ6A 4C6YA 1EQZD 2Z6CA 5B1LD 3LEZA 1H5XA 4G92B 1SCWA 2WZZA 1LL8A 3B0CW 4Z66A 1GOIA 2A2LA 3MFDA 4IBBA 3KUYC 5AQBA 2WKQA 4I3AA 2JKFA 1SKFA 4QLCD 1E8BA 1BZAA 4IBKA 4FSFA 1W7FA 4Z5TB 3UTBD 2V9AA 3LELA 3MNND 2Y2QA 1QMEA 2W3GA 1H8MA 4KUDA 4KG5A 4NXBA 5AV5C 3BW6A 4LV2A 5DNMC 3REKC 2FJ7A 5TR7A 3ULFA 3OPRA 5FDHA 4IBIA 1OGGA 1OJGA 1S1YA 1ERMA 4NY2A 1K57A 5B32G 3AZMA 3F1NA 3A6ND 4XUJB 5FI2A 3ZGAB 3R7WA 3UE6A 3UB6A 3W97C 2PRFA 1IYQA 1RGYA 2XROA 3A0VA 3CMZA 1IKGA 1OMEA 3GV9A 5TFQA 1B6WA 4G91B 3FC7A 3W4OA 4IBXA 2PYPA 3LR5A 3RELB 3VE3A 1VQQA 4Z5TA 1PWDA 4X23B 3X1VA 3K3CA 4Z66C 2ZMFA 4PAUA 4QD4A 2Y79A 2EX8A 1ID3B 1ZLAD 5GXQB 3IX8A 2H5SA 1UGUA 3G31A 1PIOA 3G35A 4GLQA 2HIOA 3LELC 4DE1A 4H9OA 3L29A 4XUJA 3L25A 3B6FB 1NZOA 1IOUA 3V3SA 4FUWA 4MDZA 4KUDC 3LY3A 5EUAA 3AZFD 5G4ZA 1LT0A 1TDLA 5B33B 2ZM8A 2FJ7C 1K57C 3R4KA 3E4QA 3AZMC 3AGEA 3MXSA 4Z2GA 3UT9A 2J9PA 4IVIA 4X69A 5F83A 3LIBA 3X1SA 3RELA 3CAXA 5E2FA 1RP5A 4X23A 1BH8B 4BL2A 1P34D 2QKPA 5GT3D 3PYPA 3OBFA 2XFTA 5F69A 5DKLA 2RL3A 5HFOA 1S32B 1ID3A 5F6AA 3AN2D 4HP9A 1F9IA 2HDRA 2A3UA 4Z5TC 2BLSA 2R9XA 1VETA 4LPZA 5GLDA 3X1VC 2EWVA 4LD9B 3ZFZA 5AVCA 1AWIA 5CPKD 2NUPC 5B33A 3Q81A 3EWKA 3HLBA 4O7DA 3F1PB 3AZHB 2HIOC 1S6RA 4HIAA 4XUJC 5AVEA 2RTSA 1YU3A 4DRTA 3OC2A 2W1TA 4MB3A 1TEMA 3L28A 1P3PD 3G4PA 2PHYA 2RVQD 1S32A 5EM1A 4HMCA 3AYWB 4KGCB 3UT9C 4OQIA 4CLCD 3X1SC 1VHMA 3RELC 4LENA 3NOTC 4OJ5A 1MC0A 3WD2A 4LD9A 1ZTUA 1ID3C 2WYXA 2OSUA 1P3BD 3FG8A 3C5AA 4WU8D 3LFVA 2B18A 3BFDA 4UQIM 1CXWA 3C1BA 2QZ6A 3F1PA 4M6BA 4R8PD 1DJAA 5AVCC 1ZHHB 5CGSA 3L2AA 3AL0C 5B33C 3AZLC 1CF0A 1FILA 5FAPA 2XK1A 4JJNB 1HQ3D 4A5RA 2AROA 4J8UD 4DQYB 3AFAB 1E3UD 3UE0A 4H9QB 2YKFA 2F8NK 4ZJ2A 2KDKA 3HCYA 2GZAA 3CZDA 2E8JA 2UWXA 3B3XA 3KWQA 4HJ4A 1AIWA 5CGWA 3REHB 4K91A 5B31D 3NBLA 5GT0D 2PU2A 5DJUA 3IWIA 1HTAA 3AV2A 5FDSA 2HF6A 1YKDA 3KO6A 2NZDA 5B40D 3KSIA 3MXRA 4LD9C 5B2JA 4LLOB 2Y2GA 1H8ZA 2C6WB 2BYMA 5AV5D 3T4JA 3EPHA 4P87A 3CPTB 5DNMD 4NYUA 4IVKA 4PM8A 4QU3A 3R45A 5B0ZA 3P01A 4NXEA 3UPOA 5HZHA 4JJNA 4CPKA 3C1BC 5FUGB 3AFAA 4H9QA 1WYBA 3T4TA 4ZRRA 1W1PA 1TZYB 2XRNA 4KZ4A 2P08A 5FASA 3FPVA 1U35B 4YM6D 1JWZA 2MJ6A 2OOLA 3EEHA 4QY6A 2AROC 2DQNC 1U60A 1JTGA 4GOGA 4DDYA 2PT7A 3U2AA 4BMWA 4E3LA 4RX3A 4Z66D 5B32D 3WTPA 5E2HA 5HSQA 1LSVA 5EVLA 5JRGB 1AOIA 1N1JA 3G30A 4J8XD 5CX7A 3KWQC 3FPWA 4O01A 3IBJA 2V8FA 4YS3A 5FQ9A 1KDWA 3IWOA 5BOHA 1GSVA 4XT2A 3AV2C 3E4OA 2G5IC 4S2OA 3LELD 2NZDC 5FUGA 4P0MA 4HH3A 3MQQA 4WZSB 5B2JC 3LCEA 3M2KA 5F68A 3L27A 1TZYA 3DTIA 3GQZA 1BFMA 2FJ7D 1OJ5A 1U35A 1NRJA 1IYPA 5B0ZC 2HDQA 1OGBA 3A3IA 3AZMD 1L6JA 3S7OA 3AFAC 1ULYA 4CSRA 1YLTA 2O9BA 4NG2A 3WWXA 2O9CA 1L2SA 4MBFA 4U3TA 5JRGA 4ZBJC 1YLJA 1W1TA 1NRFA 1M18B 4LCLA 1OT6A 3PTEA 4HNBA 4NE6A 1P3LB 1BLCA 4H6JA 4Z5TD 2XQZA 3KS8A 3LJAB 3WTPC 3VH5A 4E6WA 3PBQA 3OPLA 5CTNA 3EGXC 4EUVA 1AOIC 3MGPC 4EEPA 2OWHA 5FQMA 1XJ2A 2JKTI 4YS3C 5CP6A 3Q7ZA 3T12B 3N3FA 5HW3A 4DRAA 1FCMA 4XUJD 2XH9A 3O3VA 4WNNB 3MZEA 3LZ1A 4IHQA 3MNNB 3W99B 5FQJA 1K6RA 5CECA 1U35C 5L8MA 4JGOA 2E8IA 2V1AA 2FFYA 1JWPA 3VP3A 1M18A 3NC8A 1D06A 1P3LA 3RELD 4X23D 5BS7A 3H0MC 5JRGC 4J8WB 1ID3D 3IS2B 5GXQD 4NETA 1E4DA 3B42A 3LIFA 1LHYA 4WZ5A 3PR6A 4CJNA 1PRQA 3KSHA 4S2JA 4P85A 4WV4B 3UE3A 3B6FD 1E25A 5IT5A 2XD5A 1T1CA 3IH8A 5AVCD 3W98A 1P3KB 4N9KA 2EXAA 3VFFA 1XX2A 3AGFA 5B33D 3W99A 4X53A 1ZC2A 5CP6C 3LY4A 3E4PA 1ES5A 1ZLAB 4P6BA 5AV9A 3N8SA 4BENA 2QJ7A 4MNRA 3LZ1C 2M7UA 1YQSA 3A1IA 2PD7A 4DDSA 1T1BA 3LUQA 4IBFA 2JE5A 1S32D 4PPRA 2Y2NA 1M18C 4IBRA 4DXBA 1P3LC 3N4IA 2EFUA 3SS4A 1F66B 5L07A 1QMFA 3Q1FA 5BS7C 2PBDP 1S67L 4Y2FA 4LD9D 4IEDA 5B24A 4I39A 1A0KA 1P3KA 4MLLA 4ME4A 5J3WA 3DAVA 4X68A 4IBGA 2C5WB 3WKJB 1N9OA 2PBYA 3AZIB 4JF5A 2Z6DA 4L9GA 4QHCA 4UAAA 4LV1A 5DNNA 3C1BD 4LRYC 1H8PA 4MCWA 1YU1A 4HESA 3W98C 1TD5A 4S2NA 2VGKA 3FZCA 1XGJA 2M7VA 2JKRI 3VE4A 3WX7A 3T50A 2AROD 5CPKB 5AV9C 4O0PA 2ZQ9A 1DP8A 1ERQA 4S2LA 3UO9A 2EA9A 3E0YA 1F66A 5HD5A 3G32A 4OQGA 4UPKA 5GHXA 4BJPA 2IWDA 3KWQD 3O86A 2ZY5A 4JGQA 1GSXA 1KDSA 1IYOA 1GXDA 1SKOB 2GJ3A 4KQOA 4BLMA 2HGVA 4II7A 3ZVWA 1EROA 1GSWA 4ZUXC 1MKMA 2Y2LA 1IELA 5B1MB 2NZDD 4Y0UA 5CGXA 1Q2PA 5B24C 3H0LC 3MGSB 1P3KC 2VKSA 4JF4A 2CWEA 2Y55A 4Q8IA 1DP6A 4EV4A 3BM6A 4JJND 2WKPA 5DNNC 3I7JA 4E3IA 2PYOB 3AFAD 1ES2A 4WU8B 1PW8A 2VV7A 2V0WA 4S2NC 2Q9NA 2JSSA 2PD8A 1K4EA 1W8QA 3LI9A 1SKOA 5HPFA 1F66C 4N1XA 4FH2A 3WTPD 1G6OA 5B1MA 1HLUP 1KGGA 4J8UB 2OLUA 3B0CT 1D1JA 5HDSA 3LO7A 2WADA 3MS6A 4JXWA 5EFWA 4YS3D 4Y5FA 3KUYB 2GDNA 3SZTA 2VGLM 4F3LB 2VEAA 4F94A 4X1MA 1K0KA 1BULA 4LV3A 1TZYD 2A24A 4R4SA 1U35D 2O0YA 3VH6T 3GMWA 4EXOA 4WUJA 2QHKA 4UA7A 1MKIA 4CLCE 2WGWA 2G2UA 2BYKA 3REKB 1GHIA 3N8RA 3AV1A 5AQ9A 2XR0A 1NYMA 2GNXA 3OZHA 5JRGD 2KLIA 4WELA 4GZBA 2HJ9C 1I2SA 1YLZA 3W97B 2XD1A 4JBFA 3VP0A 2Y91A 3KUYA 2Q0OA 2ZC4B 3G34A 3S7NA 1W1VA 3B33A 2GX5A 3NIAA 1Q2QA 5KMWA 4YOFA 5B1MC 3K2NA 4MB4A 4UA9A 4WEJA 4Z2HA 4Q0JA 4MBKA 5CHUA 1X0OA 1P9RA 4Y7PA 3V3RA 4Z66B 5FQQA 4JGRA 3W96B 5CP6D 5M18A 3CJMA 4I5SA 3LIAA 2B02A 3LICA 3FKVA 4OQHA 4X1LA 4MEZA 1YSPA 4IUHA 1DRMA 2QWSA 4OPYA 1TS6A 1N9LA 4WMCA 2ZY4A 4OJLA 3C7UA 5HAPA 3V5MA 3MVDA 2VGJA 4KUDB 3W97A 1PZOA 1M18D 4EESA 2XF3A 1TS8A 2ZLYA 3HBRA 1P3LD 2XSSA 4DN0A 4HMEA 3S7QA 3AV1C 3LJAD 1V9ZA 3O62A 3AZMB 3F1NB 1EWZA 3R7WB 3HJIA 1ONGA 4HGAB 3W96A 1XJ4A 3EPLA 4IJFA 2Y59A 1NLZA 4JXSA 4GDNA 3UMDA 3AZEB 1JFIB 3W98D 3TW8A 5AV6C 3B0DC 1KGEA 3X1VB 3B47A 3W99D 4JKTA 3QP1A 4WEKA 3VH6W 4OVDA 5DFXA 3LR0A 3LEQA 4ETXA 1YMSA 4XZQA 5F99B 3MVDC 3N8LA 2HIOB 1S4SA 4H9OB 3B6GA 1YLPA 3REJB 3BFGA 4J8WD 1OPXA 3CWFA 3IWQA 1K54A 3LI8A 2K2NA 2ZQ7A 3WD3A 3WS1A 4G3KA 3L7HA 1W63M 1STZA 3O62C 4E44A 3UT9B 4KUOA 1KOUA 3VSKA 3X1SB 5IU1A 3AZEA 5B24D 4XUZA 1JFIA 1P3KD 4L0LA 3OLOA 4RQ9A 3W96C 4QWOA 3EPKA 5B0YA 4OPQA 4WU9A 5M1AA 3UTAA 4LV0A 3HLEA 2VJWA 4FOFA 3T1QB 4DJ3A 5HL6A 1VETB 5F99A 3ZG8B 1Z2CB 3REJA 1KE3A 2Y2OA 5AVCB 1ODVA 3IHBA 2BTFP 4JXVA 3QP6A 1TS0A 3AZLB 1F66D 2W1RA 4XZQC 4EQIA 3DWZA 3B6GC 1K25A 3LIDA 1K54C 4HGAC 2HV1A 2W1TB 3VH5W 3IX4A 4S2MA 3G2YA 3WKJD 3AZID 5EVIB 1K56A 3NQUA 3A3JA 3QNBA 2ZC5B 4EETB 1MZUA 2W3FA 3AZEC 4KQRA 3UNWA 3OOVA 1YU4A 5F1FA 3ZVTA 3MR0A 5B0YC 3RXWA 3P7NA 4YINA 4WU9C 4JF6A 3UTAC 2K31A 4E6XA 1KX5A 5CERA 3RJUA 3AZLA 2V8CA 3C7VA 5F99C 3C1BB 2Y8HA 1E6RA 3WAAA 3REJC 5FQIA 3H9WA 2NQBA 4DF6A 2ZC7A 3N7WA 4CQHA 3IHAA 1VEUB 4LRXC 1E15A 5EVIA 5GHZA 3QP2A 3ZDJA 5B1MD 5BO0B 2AROB 2LB5A 1YAXA 5J7EA 2FN2A 2ZC6B 1P3FA 3MGSD 3LZ0B 3HLCA 2J3TC 3MQOA 3WRZA 3HREA 3IXGA 4OUIA 2VLGA 3KWQB 3LGOA 2PYOD 3PBTA 4E04A 2JBFA 5BNVB 3AV2B 3M6BA 1FR1A 4MN6A 2NZDB 3RXXA 5B2JB 2V1ZA 4QB8A 4E3OA 4C3QA 3A3FA 2BYMB 1W79A 4MN7A 1MWSA 1SDNA 1KX5C 3ICYA 5E43A 1NYYA 3C8CA 1DJBA 1XPBA 3R45B 1VEUA 5B0ZB 1BTLA 4HQAA 3AV1D 4NZ1A 5BO0A 3WAAC 1NZUA 3O5YA 3AZJA 5BT1C 3SH9A 2O99A 3LZ0A 2NQBC 1K55A 4FTXA 1ESIA 3T4OA 1GHMA 5B2IC 3KUYD 5DVAA 4ZBJB 5EVIC 3UY6A 5DFYA 3KS4A 3VP4A 4RA7A 3WS4A 5BNVA 1NXYA 5AJGA 1P3FC 3TSGA 5EECA 3WTPB 4NK3A 4GKUA 2LB9A 1AOIB 1N1JB 3MGPB 5KIZA 3GECA 4UHUA 4YS3B 1HVBA 3REKD 2EX9A 1KX3C 3MKEA 4WMCD 4XT2B 4TX8A 3MVDD 3NHQA 5IS1A 3NDEA 2ZBBA 4B93A 4Y3IA 4KZ5A 3W97D 4EQ1A 1GA9A 1Y28A 2FH5A 3WS0A 1QO6A 3WS2A 3O62D 2V2FF 3AZJC 2HJEA 3BEBA 4CSRB 5HWWA 1TAFA 1MBLA 5AY8A 1PWGA 2HP5A 4ZDXA 3LZ0C 1GHPA 1K55C 3C1CB 3W96D 1LI9A 4OONA 1UWPX 3D4FA 3VOZA 3MGPA 1P3MB 1Z6FA 1K4FA 3L9KA 3T1RA 5EV0A 1NLYA 2WKEA 3H0RC 4H6JB 3NCKA 1G68A 4J8VA 1C3BA 1YU0A 4NFTA 1E88A 2J3WA 4KUDD 2UV0E 4O8GA 4EEUA 2D01A 1XA1A 2PDRA 5EOEA 4ESPA 3ITBA 5CP6B 3LIEA 4NXGA 1H3QA 3T4KA 5EPHA 4XZQD 4OPRA 4OLGA 3B6GD 5DTTA 1T18A 3LZ1B 2XA7M 4ETZA 3C4PA 3C1CA 3RFBA 2DCFA 4OJOA 3F1OA 2HUEC 1P3MA 4JXGA 4ZTKA 2BASA 3AZED 5AY8C 1H0GA 2HDUA 3X1VD 1F1EA 4WU9D 4EU0A 5EM0A 5AQ7A 5J4EA 3UTAD 4S2PA 2H0YA 4N9LA 2VX8A 5DF7A 4J8VC 4KG6A 5F99D 4Y13A 2HIOD 4X25A 3W4QA 3REJD 3ZNYA 1H3OB 3WD1A 5CPIA 3W98B 3SW1A 3JPUA 2IA2A 4DE3A 1Q9CA 4UUZA 2ZQDA 1M19A 1KE0A 2W3DA 4GD6A 3HLFA 4UQIS 3GRJA 3LR4A 5AV9B 3UT9D 4WJ3C 5GSUC 4R1GA 3X1SD 4K0XA 5C5KA 4BQMA 3BECA 5C3IC 1FQGA 2J3TD 2QYBA 3C1CC 3JYIA 3A3DA 4UA6A 1TVFA 4ZJ1A 2INWA 2PU4A 1P3MC 1K56D 3PBRA 4WL9A 2ZC3B 3H7WB 5GLCA 4S2KA 4ZUXB 1IYSA 3BWLA 1OTDA 1LL5A 1H3OA 5B24B 3S22A 1S66L 3WD0A 3RH8B 5HAQA 1KX5D 5FAOA 1FOFA 3Q7VA 3AZLD 3KSGA 2OAQ1 5B1LA 2KX6A 5DNNB 3NY4A 4Y0OA 5BT1D 1GA0A 4UEYA 1W1YA 5CPIC 5DTKA 3E98A 3CITA 1YU2A 5FEFA 1P3IB 3KYZA 4K08A 1M19C 4XXRA 4H9PA 5EVID 5MC7A 1ONHA 2Y4AA 2I72A 3GVBA 4MBHA 3MGRB 1ESUA 3OCLA 3H7WA 2F8NA 3PAGA 4AWLB 1P3FD 4ZUXA 3FWLA 2Y2KA 5DTSA 3IP4C 3D3OA 4PM7A 3NOUC 1PZPA 3T4SA 3X1UA 5G18A 3BFEA 4HJ6A 2Z2MB 4KENB 2IOUA 4P6ZS 2ZQ8A 2PR5A 4HI4A 4BL3A 1PZRA 4E45A 3W2ZA 2KOIA 3CLOA 4Z2MG 4MB5A 2ZL1A 2JCHA 1P3IA 1P97A 4GHLA 1XFQA 2A49A 2F8NG 5B1LC 1XA7A 1TS7A 4OP8A 3VOYA 4Z9QA 4HHDA 3NULA 2P7JA 3MGRA 5TBMB 5L2FA 3C4OA 3LZ0D 4X55A 3OPPA 2ZOHA 1Z09A 4QLCC 3H82B 5A92A 1M1AA 4KZ9A 1BLPA 1Y54A 1XP4A 3DTKA 3WA9B 3ZNTA 3WD4A 3AV2D 4RYEA 1L0DA 1LI0A 1MWUA 4LFUA 5B2JD 3X1UC 5E5AB 2Y2IA 1S0WA 3IXDA 3D9YA 2O9AA 3A6NC 1P3AA 5CHJA 5B0ZD 2ZM0A 2VK3A 1MY8A 3BY9A 4PKYA 3IBRA 4BBUA 5U47A 3IQAA 5TBMA 4I38A 2HPBA 4B88A 1O6IA 1S4RA 2A24B 1P3IC 4HMDA 3H82A 3NJAA 5DJTA 1FCOA 3IX3A 2W3EA 4R3BA 1V9YA 4R6LA 2WGWB 4KHAA 3WA9A 3JVVA 2BYKB 4WBGA 2DMWA 1KU5A 4OLDA 4I3JA 5D3OA 3MGRC 3P09A 5HPIA 4AWLC 3AV1B 3IF6B 1L0FA 3KYEA 2VQRA 2D02A 4BD0A 3HJKA 3IXHA 1AOID 3MGPD 3BLSA 5E5AA 3BYDA 1M1AC 1W8YA 3GR2A 3RTYA 4WN5A 5FI7A 4FD8A 3AZGA 3KSFA 5G49A 2W27A 4IBJA 4J8VD 1NWZA 2Z2LB 3EQVA 1MPLA 3ZG9B 4KZ6A 4Q0HA 5IHVA 3Q82A 4NYYA 3NECA 3WS5A 5AV6B 3B0DB 5JA4B 4ZJ3A 4GH9A 1P3AC 2EX2A 5CXWA 1M6KA 4U0XA 4EO5C 4NE5A 1J3WA 3O88A 2XFSA 3CG5A 2WKRA 3IF6A 3MVDB 3HLDA 3PBOA 3HSHA 3C1CD 3KXBA 2P9VA 1P3BA 1UR8A 1EI5A 1XJ6A 3BY8A 1P3MD 1JVJA 2EWWA 2Y2HA 3WA9C 3EGDC 3T4LA 3UPPA 5AVBB 1P3GA 2W3HA 3GDIA 3TU4B 4S2IA 4Z2IA 4KZ8A 3O62B 1CI9A 2QPNA 5E5AC 2V5OA 3U4LP 5HWTA 5G4YA 5AV6A 1DP9A 5JA4A 1CJFA 3AZGC 1E3UA 2M1CA 5HD3A 2OWJA 5DKKA 3QP4A 2JKGA 5HARA 1XXMA 1YT4A 3AZKB 3T1XA 1FSYA 3LZ1D 5CPID 1OTBA 3KYQA 5GHYA 5B31A 1W63Q 1M19D 5GT0A 1ALQA 4E3JA 4CLCC 5CTMA 2G7UA 2IWBA 3T4QA 2Q9MA 3KFUG 1VM1A 4HBTA 4B4ZA 2L0WA 5AVBA 1K6SA 3TU4A 1XGIA 4ARZB 3LR3A 4XZQB 3IF6C 5A8BA 3KXBC 3B6GB 4JGPA 3VH5T 1TF1A 1P3BC 1RGZA 4M3KA 1KX4B 1YSQA 5CEBA 2NUTC 1JNUA
chains in the Genus database with same CATH topology
4R8PC 1P3GC 3TOIA 3AZKA 2WKIA 1W5DA 3UPNA 4RX2A 1HZOA 1CEGA 4WZ4A 2X02A 5B0YB 3UE1A 4WU9B 4GDBA 3UTAB 4R3JA 5B32A 5AV9D 5KDMA 4H9RA 1T3UA 4J8XA 5B31C 2J8YA 5GT0C 4KZ3A 3MGQA 1KX4A 2EXBA 3ZG5A 3G2ZA 3BRMA 5B40C 2V20A 2F8ND 5AVBC 1ZG4A 2WAEA 3TU4C 4ZUXD 2ZMAA 1BH9A 1JTDA 3AZNA 4WYYA 2H0TA 3X1UD 2YFWB 4QY5A 3P5JB 3UDIA 5TGFA 3OCNA 5DNND 3NQUB 2G2WA 1YLYA 3V39A 3AZKC 4Y0TA 4YM6C 1WE4A 3GSGA 2L5AA 1CI8A 1P3ID 5A90A 5JYOA 1LL9A 1FR6A 4B4XA 3AGDA 2JC7A 2DRWA 5B32C 3NQJB 1KX5B 4YFMA 1YLWA 4PM9A 3MGRD 5AV8B 4J8XC 1KVMA 3ZG0A 4ZBEA 5GLBA 3WAAB 1K38A 4NE3A 1M1AD 3MGQC 1KX4C 2YFWA 4OOMA 2NQBB 1B67A 2ZY3A 5B2IB 1KGFA 4E3MA 1H8YA 3AZNC 1IKIA 5FI6A 4WM9A 1P3FB 1P3AD 1R4VA 4E3KA 3IXBA 4G92C 3X1TB 3NQJA 1KX3B 5AV8A 5CHLB 5GXQA 3ZHHA 3FKEA 1LLBA 3WA9D 3ZG7B 5B2IA 3B6FA 4RVAA 3NDGA 1O07A 3FKWA 3AZJB 4OH0A 5E5AD 1NJ4A 2H10A 2ZQAA 1MXOA 3AZGD 3IF5A 1SDEA 3HUMA 2WAFA 3A1KA 3EPJA 2FFFB 1YUEA 3S1YA 1WWIA 3X1TA 1BH8A 1KX3A 4G91C 2F2AC 5CPJB 5HX9A 4FCFA 3FYZA 3REIB 5FAQA 4X23C 1CK3A 5E2GA 1P3OB 5AV8C 4GD8A 5GLAA 5GXQC 3KXBD 2YFVB 2CV5B 3AZHA 4E3NA 3B6FC 1P3GD 2HUEB 3DWKA 2B5RA 1TAFB 5AY8B 2Y2JA 5CPJA 5AV6D 1BLSA 3HUNA 3E2KA 3AYWA 4KGCA 3BFFA 4GNUA 2HP6A 4IJEA 3HL9A 3REIA 3X1TC 3UN7A 3PBNA 1P3OA 2QMIA 4OOYA 4KZ7A 4J8VB 1S32C 4DE2A 2J8PA 3ITAA 5JYPA 2YFVA 1CEFA 2CV5A 1GCEA 1BT5A 4NZ3A 5AVBD 5BNXB 4JPMA 3TU4D 3KSYA 5DF8A 2ZM5A 5GSUB 4OJPA 3E2LA 3S4XA 2R9WA 5C3IB 3AZHC 3F6TA 2RIQA 5J8XA 4R23A 3VH6A 5DF9A 3AZKD 3PBSA 4PM5A 5CPJC 1DY6A 3AYWC 3REHA 4KGCC 3O87A 5KSHA 4EBPA 1KE4A 3REIC 1P3OC 4EBLA 3WTPE 4NZ4A 5BNXA 4IBDA 3PAEA 5GSUA 3MGQD 1KX4D 5CPIB 2CV5C 2J7VA 4UUZB 1YM1A 4KZBA 1M19B 1XKZA 4OOLA 2EX6A 4DKIA 3AZND 3OPHA 3V50A 4GB7A 4U0TA 2HP9A 4JJNC 3MKFA 4H9NB 5B0YD 4R0QA 4H9SA 3EG5B 5F1GA 2XEPA 3HONA 3REHC 1N4OA 3Q7VB 1EQZB 1PYYA 5B1LB 3B0BA 4JLFA 4DE0A 3DW0A 1BUEA 4H9NA 4QLCB 1PWCA 4H9PB 3MZDA 1BLHA 3WRTA 1TZYC 3UTBB 2XDMA 3DTMA 1I5QA 4NZ5A 4CAYB 2F8NB 1WYCA 1YMXA 4HEFA 5BPVA 1RCJA 3X1UB 3ISGA 3BLMA 3VP2A 3LJAA 3W8KA 3FV7A 3BFCA 2DNSA 4H9SC 3A6NB 4KZAA 5AV8D 1EQZA 1M40A 1IEMA 2OLVA 3WAAD 1HD8A 2LY8A 2X71A 4OPZA 3IT9A 3P98A 3QNCA 2NQBD 5I94A 2DF4C 5B2ID 4QLCA 4WNNA 3VSLA 3W4PA 1NY0A 3UTBA 4OQ0A 3MNNA 1BSGA 4CAYA 1O7EA 4R4RA 4Z2MH 4N92A 5CEDA 4KG2A 1M1AB 2F8NH 5CHMA 3X1TD 5EE8A 3A6NA 1KX3D 4IBEA 4J8WA 2WK0A 2ZY2A 3SS3A 3AZFB 3M2JA 2WGIA 5A91A 3MBZA 3LJAC 5M19A 4ID4A 1P3AB 2Y2PA 1EQZC 4EO5B 4N1HA 2IWCA 1P34B 1KVLA 3AZJD 5GT3B 2G5HC 3TG9A 3UDFA 1ZLAA 3AZHD 4DRBA 3AN2B 3HVFA 4C75A 1MWTA 4GHAA 3UTBC 2XLNA 2W8SA 1G6AA 4PM6A 4KHAB 3MNNC 3W99C 2WZXA 5FQKA 5CPJD 2WUQA 5FA7A 3VP1A 3AZFA 4KGCD 3AYWD 3V9RB 4XUXA 1DJCA 4HBUA 3REID 1L0GA 4X56A 3AZGB 1P3OD 5G49B 2ZM2A 1SHVA 4J8WC 3QHYA 1N9BA 1P34A 3MZFA 5GT3A 1FCNA 1ZG6A 1P3PB 3WKJA 3AZIA 2CV5D 4QNLA 3NI9A 4PMAA 3L26A 1I2WA 5E2EA 3AN2A 4QJGA 3HLWA 3VFHA 5A93A 4X6TA 2P74A 5AY8D 3ZCZA 1ZLAC 4OP5A 5CPKA 3KXBB 3V9RA 4EBNA 2P9VB 4D2OA 5KSCA 1P3BB 1PI4A 2BG1A 1ZKJA 1AXBA 2RCXA 4R8PB 1P3GB 2WGVA 3VMAA 3AZFC 3Q07A 3REHD 3SH7A 5FATA 1P3PA 3EQUA 2IO5B 1HQ3B 1PW1A 4LG2A 1JWVA 3MGSA 2CC1A 3IH9A 1P34C 5GSUD 5GT3C 1ES3A 5HL1A 3WKJC 3AZIC 2PYOA 4EWFA 3AN2C 5B31B 5F82A 5GT0B 3FDDA 3HLGA 5FSRA 4WU8A 4FH4A 4EUZA 2WKHA 5B40B 4BD1A 4R8PA 5AV5B 3SH8A 2X01A 5CPKC 5DNMB 4KQQA 1L0EA 2HDSA 3UDXA 1HQ3A 4J8UA 1TDGA 5KZHA 4GN2A 2EFXA 1WWSA 1FSWA 5EOOA 1ES4A 1MWRA 1P3PC 4YM6B 4LCMA 2RVQC 1PI5A 4K0WA 1HTZA 5CRFA 2J9OA 5HAIA 3MGSC 3A3EA 5B32B 5KDMB 2ZJ9A 3N6IA 4H9RB 5B40A 4IBCA 1J9MA 4J8XB 4H8RA 2OV5A 5AV5A 2PYOC 3SOIA 5DNMA 3HUOA 3REKA 3MGQB 4WU8C 3SS5A 3LELB 5GL9A 4DXCA 2Y2MA 1A7WA 2XGNA 1W2EA 3M6HA 2ZD8A 1BH9B 3AZNB 2ZQCA 4ZAMA 5B31G 2FJ7B 4YM6A 3GTCA 5AQAA 2IO5C 1HQ3C 4OKPA 4J8UC 4OJ6A 4C6YA 1EQZD 5B1LD 3LEZA 1H5XA 4G92B 1SCWA 2WZZA 3B0CW 4Z66A 3MFDA 4IBBA 3KUYC 5AQBA 1SKFA 4QLCD 1BZAA 4IBKA 4FSFA 1W7FA 4Z5TB 3UTBD 3LELA 3MNND 2Y2QA 1QMEA 4KUDA 4KG5A 5AV5C 4LV2A 5DNMC 3REKC 2FJ7A 5TR7A 3OPRA 5FDHA 4IBIA 1ERMA 4NY2A 1K57A 5B32G 3AZMA 3A6ND 4XUJB 5FI2A 3ZGAB 3W97C 1IYQA 1RGYA 3CMZA 1IKGA 1OMEA 3GV9A 5TFQA 1B6WA 4G91B 3W4OA 4IBXA 3RELB 1VQQA 4Z5TA 1PWDA 4X23B 3X1VA 4Z66C 4QD4A 2EX8A 1ID3B 1ZLAD 5GXQB 2H5SA 3G31A 1PIOA 3G35A 2HIOA 3LELC 4DE1A 4H9OA 3L29A 4XUJA 3L25A 3B6FB 1NZOA 3V3SA 4KUDC 3LY3A 5EUAA 3AZFD 1TDLA 5B33B 2ZM8A 2FJ7C 1K57C 3AZMC 3AGEA 3MXSA 2J9PA 3UT9A 4IVIA 4X69A 5F83A 3X1SA 3RELA 5E2FA 1RP5A 4X23A 1BH8B 4BL2A 1P34D 5GT3D 2XFTA 2RL3A 5HFOA 1S32B 1ID3A 3AN2D 2HDRA 2A3UA 4Z5TC 2BLSA 2R9XA 5GLDA 3X1VC 4LD9B 3ZFZA 5AVCA 5CPKD 5B33A 3Q81A 3HLBA 4O7DA 3AZHB 2HIOC 1S6RA 4XUJC 1YU3A 4DRTA 3OC2A 1TEMA 3L28A 1P3PD 3G4PA 2RVQD 1S32A 3AYWB 4KGCB 3UT9C 4OQIA 3X1SC 3RELC 4LENA 4OJ5A 4LD9A 1ID3C 2WYXA 2OSUA 1P3BD 3C5AA 4WU8D 3BFDA 3C1BA 2QZ6A 4M6BA 4R8PD 1DJAA 5AVCC 5CGSA 3L2AA 3AL0C 5B33C 3AZLC 5FAPA 2XK1A 4JJNB 1HQ3D 4A5RA 2AROA 4J8UD 4DQYB 3AFAB 1E3UD 3UE0A 4H9QB 2F8NK 4ZJ2A 3CZDA 2UWXA 3B3XA 3KWQA 5CGWA 3REHB 4K91A 5B31D 3NBLA 5GT0D 2PU2A 3IWIA 1HTAA 3AV2A 2NZDA 5B40D 3MXRA 4LD9C 5B2JA 2Y2GA 1H8ZA 2C6WB 2BYMA 5AV5D 3EPHA 4P87A 5DNMD 4NYUA 4IVKA 4PM8A 4QU3A 3R45A 5B0ZA 3UPOA 4JJNA 4CPKA 3C1BC 5FUGB 3AFAA 4H9QA 1WYBA 1TZYB 4KZ4A 5FASA 1U35B 4YM6D 1JWZA 4QY6A 2AROC 2DQNC 1U60A 1JTGA 4GOGA 4DDYA 4E3LA 4RX3A 4Z66D 5B32D 3WTPA 5E2HA 5EVLA 5JRGB 1AOIA 1N1JA 3G30A 4J8XD 3KWQC 4YS3A 5FQ9A 1KDWA 3IWOA 5BOHA 3AV2C 2G5IC 4S2OA 3LELD 2NZDC 5FUGA 4P0MA 4WZSB 5B2JC 3LCEA 3M2KA 3L27A 1TZYA 3GQZA 1BFMA 2FJ7D 1U35A 1IYPA 5B0ZC 2HDQA 3A3IA 3AZMD 3AFAC 1ULYA 4CSRA 1YLTA 3WWXA 1L2SA 4MBFA 4U3TA 5JRGA 4ZBJC 1YLJA 1NRFA 1M18B 4LCLA 3PTEA 4NE6A 1P3LB 1BLCA 4Z5TD 2XQZA 3KS8A 3LJAB 3WTPC 3VH5A 4E6WA 3PBQA 3OPLA 5CTNA 1AOIC 3MGPC 5FQMA 4YS3C 5CP6A 3Q7ZA 3N3FA 5HW3A 4DRAA 1FCMA 4XUJD 2XH9A 3O3VA 4WNNB 3MZEA 3LZ1A 3MNNB 3W99B 5FQJA 1K6RA 5CECA 1U35C 2E8IA 2FFYA 1JWPA 3VP3A 1M18A 3NC8A 1P3LA 3RELD 4X23D 5BS7A 3H0MC 5JRGC 4J8WB 1ID3D 5GXQD 4NETA 1E4DA 1LHYA 4WZ5A 4CJNA 4S2JA 4P85A 4WV4B 3UE3A 3B6FD 1E25A 2XD5A 3IH8A 5AVCD 3W98A 1P3KB 4N9KA 2EXAA 3VFFA 1XX2A 3AGFA 5B33D 3W99A 4X53A 1ZC2A 5CP6C 3LY4A 1ES5A 1ZLAB 4P6BA 5AV9A 3N8SA 4BENA 4MNRA 3LZ1C 1YQSA 3A1IA 4DDSA 4IBFA 2JE5A 1S32D 4PPRA 2Y2NA 1M18C 4IBRA 4DXBA 1P3LC 3N4IA 2EFUA 3SS4A 1F66B 1QMFA 3Q1FA 5BS7C 4LD9D 4IEDA 5B24A 1P3KA 4MLLA 4X68A 4IBGA 2C5WB 3WKJB 4JF5A 2PBYA 3AZIB 4UAAA 4QHCA 4WZ5C 4LV1A 5DNNA 3C1BD 1YU1A 4HESA 3W98C 4S2NA 2VGKA 3FZCA 1XGJA 3WX7A 2AROD 5CPKB 5AV9C 2ZQ9A 1ERQA 4S2LA 3UO9A 1F66A 3G32A 4OQGA 4UPKA 5GHXA 4BJPA 2IWDA 3KWQD 3O86A 2ZY5A 1KDSA 1IYOA 4KQOA 4BLMA 3ZVWA 1EROA 4ZUXC 2Y2LA 1IELA 5B1MB 2NZDD 4Y0UA 5CGXA 1Q2PA 5B24C 3H0LC 3MGSB 1P3KC 4JF4A 2CWEA 2Y55A 4Q8IA 4EV4A 3BM6A 4JJND 5DNNC 3I7JA 4E3IA 2PYOB 3AFAD 1ES2A 4WU8B 1PW8A 4S2NC 2Q9NA 2JSSA 1K4EA 1W8QA 1F66C 4N1XA 4FH2A 3WTPD 2OLUA 5B1MA 1KGGA 4J8UB 3B0CT 3LO7A 2WADA 4JXWA 4YS3D 3KUYB 2GDNA 4F94A 1BULA 4LV3A 1TZYD 4R4SA 1U35D 3VH6T 3GMWA 4UA7A 1MKIA 2WGWA 2G2UA 2BYKA 3REKB 1GHIA 3N8RA 3AV1A 5AQ9A 2XR0A 1NYMA 3OZHA 5JRGD 4WELA 4GZBA 1I2SA 1YLZA 3W97B 2XD1A 4JBFA 3VP0A 2Y91A 3KUYA 3G34A 2ZC4B 3NIAA 5KMWA 1Q2QA 5B1MC 4UA9A 4WEJA 4MBKA 5CHUA 4Y7PA 3V3RA 4Z66B 5FQQA 3W96B 5CP6D 5M18A 3CJMA 3FKVA 4OQHA 4MEZA 4OPYA 4WMCA 2ZY4A 4OJLA 3C7UA 5HAPA 3V5MA 3MVDA 2VGJA 4KUDB 3W97A 1PZOA 1M18D 2XF3A 2ZLYA 3HBRA 1P3LD 3AV1C 3LJAD 3O62A 3AZMB 1EWZA 1ONGA 4HGAB 3W96A 3EPLA 4IJFA 2Y59A 4JXSA 4GDNA 3AZEB 1JFIB 3W98D 5AV6C 3B0DC 1KGEA 3X1VB 3W99D 4WEKA 3VH6W 4OVDA 1YMSA 4XZQA 5F99B 3MVDC 3N8LA 2HIOB 4H9OB 3BFGA 3B6GA 3REJB 1YLPA 4J8WD 3IWQA 1K54A 2ZQ7A 3WS1A 3O62C 4E44A 3UT9B 3VSKA 3X1SB 3AZEA 5B24D 4XUZA 1JFIA 1P3KD 4L0LA 3W96C 3EPKA 5B0YA 4OPQA 4WU9A 5M1AA 3UTAA 4LV0A 3HLEA 5F99A 3ZG8B 1Z2CB 3REJA 1KE3A 2Y2OA 5AVCB 3IHBA 4JXVA 3AZLB 1F66D 4XZQC 4EQIA 3DWZA 3B6GC 1K25A 1K54C 4HGAC 3VH5W 4S2MA 3G2YA 3WKJD 3AZID 5EVIB 1K56A 3NQUA 3A3JA 3QNBA 2ZC5B 3AZEC 4KQRA 3UNWA 1YU4A 5F1FA 3ZVTA 5B0YC 3RXWA 4YINA 4WU9C 4JF6A 3UTAC 4E6XA 1KX5A 5CERA 3RJUA 3AZLA 3C7VA 5F99C 3C1BB 3WAAA 3REJC 5FQIA 2NQBA 4DF6A 2ZC7A 3N7WA 3IHAA 5EVIA 5GHZA 3ZDJA 5B1MD 5BO0B 2AROB 2ZC6B 1P3FA 3MGSD 3LZ0B 3HLCA 3WRZA 3HREA 3IXGA 4OUIA 3KWQB 2PYOD 3PBTA 2JBFA 5BNVB 3AV2B 3M6BA 1FR1A 2NZDB 3RXXA 5B2JB 2V1ZA 4QB8A 4E3OA 4C3QA 3A3FA 2BYMB 1W79A 1MWSA 1SDNA 1KX5C 5E43A 1NYYA 1DJBA 1XPBA 3R45B 5B0ZB 1BTLA 3AV1D 4NZ1A 5BO0A 3WAAC 1NZUA 3AZJA 5BT1C 3SH9A 3LZ0A 2NQBC 1K55A 1ESIA 1GHMA 5B2IC 3KUYD 5DVAA 4ZBJB 5EVIC 3UY6A 3KS4A 3VP4A 4RA7A 3WS4A 5BNVA 1NXYA 1P3FC 3TSGA 5EECA 3WTPB 4NK3A 4GKUA 1AOIB 1N1JB 3MGPB 4UHUA 4YS3B 1HVBA 3REKD 2EX9A 1KX3C 3MKEA 4WMCD 3MVDD 3NDEA 4KZ5A 3W97D 1GA9A 3WS0A 3WS2A 3O62D 2V2FF 3AZJC 3BEBA 4CSRB 1TAFA 1MBLA 5AY8A 1PWGA 2HP5A 4ZDXA 3LZ0C 1GHPA 1K55C 3C1CB 3W96D 1LI9A 4OONA 3VOZA 3D4FA 3MGPA 1P3MB 1Z6FA 1K4FA 2WKEA 3H0RC 3NCKA 1G68A 4J8VA 1C3BA 1YU0A 4NFTA 4KUDD 1XA1A 5EOEA 3ITBA 5CP6B 5EPHA 4XZQD 4OPRA 4OLGA 3B6GD 5DTTA 3LZ1B 3C4PA 3C1CA 2DCFA 4OJOA 2HUEC 1P3MA 4JXGA 4ZTKA 3AZED 5AY8C 2HDUA 3X1VD 1F1EA 4WU9D 5AQ7A 3UTAD 4S2PA 2H0YA 4N9LA 5DF7A 4J8VC 4KG6A 5F99D 2HIOD 3W4QA 3REJD 3ZNYA 1H3OB 5CPIA 3W98B 4DE3A 1Q9CA 4UUZA 2ZQDA 1M19A 1KE0A 4GD6A 3HLFA 3GRJA 5AV9B 3UT9D 4WJ3C 5GSUC 4R1GA 3X1SD 4K0XA 4BQMA 3BECA 5C3IC 1FQGA 3C1CC 3JYIA 3A3DA 4UA6A 1TVFA 4ZJ1A 2PU4A 1P3MC 1K56D 3PBRA 2ZC3B 5GLCA 4S2KA 4ZUXB 1IYSA 1LL5A 1H3OA 5B24B 3S22A 5HAQA 1KX5D 5FAOA 1FOFA 3Q7VA 3AZLD 5B1LA 5DNNB 3NY4A 4Y0OA 5BT1D 1GA0A 5CPIC 5DTKA 1YU2A 1P3IB 1M19C 4XXRA 4H9PA 5EVID 1ONHA 2Y4AA 2I72A 3GVBA 4MBHA 3MGRB 1ESUA 3OCLA 2F8NA 3PAGA 4AWLB 1P3FD 4ZUXA 3FWLA 2Y2KA 5DTSA 3IP4C 4PM7A 1PZPA 3X1UA 5G18A 3BFEA 2Z2MB 4KENB 2IOUA 2ZQ8A 4BL3A 1PZRA 4E45A 4Z2MG 2JCHA 1P3IA 4GHLA 2A49A 2F8NG 5B1LC 1XA7A 4OP8A 3VOYA 4Z9QA 5L2FA 3MGRA 3C4OA 3LZ0D 4X55A 3OPPA 4QLCC 5A92A 1M1AA 4KZ9A 1BLPA 1Y54A 1XP4A 3WA9B 3ZNTA 3AV2D 4RYEA 1L0DA 1LI0A 1MWUA 5B2JD 3X1UC 5E5AB 2Y2IA 1S0WA 3IXDA 3A6NC 1P3AA 5CHJA 5B0ZD 2ZM0A 1MY8A 5U47A 3IQAA 2HPBA 4B88A 1P3IC 1FCOA 4R3BA 2WGWB 4KHAA 3WA9A 2BYKB 4WBGA 1KU5A 5D3OA 4OLDA 3MGRC 3P09A 4AWLC 3AV1B 3IF6B 1L0FA 2VQRA 4BD0A 3IXHA 1AOID 3MGPD 3BLSA 5E5AA 3BYDA 1M1AC 1W8YA 3GR2A 5FI7A 4FD8A 3AZGA 5G49A 4IBJA 4J8VD 3EQVA 2Z2LB 1MPLA 3ZG9B 4KZ6A 5IHVA 3Q82A 4NYYA 3WS5A 5AV6B 3B0DB 5JA4B 4ZJ3A 4GH9A 1P3AC 2EX2A 5CXWA 1M6KA 4U0XA 4EO5C 4NE5A 3O88A 2XFSA 3CG5A 3IF6A 3MVDB 3HLDA 3PBOA 3HSHA 3C1CD 3KXBA 2P9VA 1P3BA 1EI5A 1P3MD 1JVJA 2Y2HA 3WA9C 3UPPA 5AVBB 1P3GA 3TU4B 4S2IA 4KZ8A 3O62B 1CI9A 2QPNA 5E5AC 5AV6A 5JA4A 3AZGC 1E3UA 5HARA 1XXMA 1YT4A 3AZKB 1FSYA 3LZ1D 5CPID 5GHYA 5B31A 1M19D 5GT0A 1ALQA 4E3JA 5CTMA 2IWBA 2Q9MA 3KFUG 1VM1A 4HBTA 4B4ZA 5AVBA 1K6SA 3TU4A 1XGIA 4XZQB 3IF6C 3KXBC 3B6GB 3VH5T 1P3BC 1RGZA 4M3KA 1KX4B 5CEBA 4JKTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XUX A;  1DJC A;  2ZC6 B;  1YLJ A;  4HBU A;  1NRF A;  1L0G A;  4X56 A;  3HLC A;  3TOI A;  4LCL A;  3PTE A;  3WRZ A;  2ZM2 A;  2WKI A;  1BLC A;  1SHV A;  3HRE A;  3IXG A;  1W5D A;  3QHY A;  3UPN A;  2XQZ A;  1N9B A;  4RX2 A;  1HZO A;  4E6W A;  1CEG A;  4WZ4 A;  3PBT A;  3MZF A;  3OPL A;  3PBQ A;  2JBF A;  2X02 A;  5CTN A;  1FCN A;  1ZG6 A;  3UE1 A;  3M6B A;  1FR1 A;  4PMA A;  3NI9 A;  4GDB A;  5FQM A;  1I2W A;  4R3J A;  5E2E A;  3RXX A;  4QJG A;  2V1Z A;  3Q7Z A;  4QB8 A;  3HLW A;  4E3O A;  4C3Q A;  3A3F A;  5HW3 A;  3VFH A;  1W79 A;  5A93 A;  1MWS A;  4X6T A;  1FCM A;  1SDN A;  2XH9 A;  3O3V A;  5E43 A;  1NYY A;  1DJB A;  1XPB A;  2J8Y A;  4KZ3 A;  2P74 A;  1BTL A;  3MZE A;  2EXB A;  3ZCZ A;  3ZG5 A;  4OP5 A;  1NZU A;  3G2Z A;  5FQJ A;  2P9V B;  3BRM A;  4D2O A;  4EBN A;  5KSC A;  1K6R A;  1PI4 A;  2V20 A;  3SH9 A;  5CEC A;  1ZG4 A;  2WAE A;  2BG1 A;  2E8I A;  2FFY A;  1JWP A;  2ZMA A;  3VP3 A;  1JTD A;  1K55 A;  3NC8 A;  1ZKJ A;  1ESI A;  4WYY A;  2H0T A;  1AXB A;  1GHM A;  2RCX A;  5DVA A;  2WGV A;  4QY5 A;  5EVI C;  3UY6 A;  3VMA A;  3VP4 A;  4RA7 A;  3UDI A;  3WS4 A;  3Q07 A;  3SH7 A;  5FAT A;  5TGF A;  1NXY A;  3EQU A;  3OCN A;  3TSG A;  5EEC A;  1PW1 A;  4NET A;  1E4D A;  1JWV A;  2G2W A;  1YLY A;  4NK3 A;  4GKU A;  1LHY A;  3V39 A;  4WZ5 A;  4Y0T A;  4CJN A;  4S2J A;  4UHU A;  1WE4 A;  3GSG A;  4P85 A;  2CC1 A;  3UE3 A;  3IH9 A;  1CI8 A;  1HVB A;  2EX9 A;  1ES3 A;  5A90 A;  5JYO A;  1E25 A;  1LL9 A;  2XD5 A;  3MKE A;  1FR6 A;  3IH8 A;  4WMC D;  4B4X A;  5HL1 A;  3AGD A;  2JC7 A;  2EXA A;  4N9K A;  1XX2 A;  3VFF A;  2DRW A;  3AGF A;  4EWF A;  4YFM A;  4X53 A;  1YLW A;  4PM9 A;  3NDE A;  1ZC2 A;  5F82 A;  3HLG A;  5FSR A;  4KZ5 A;  3LY4 A;  1KVM A;  4FH4 A;  3ZG0 A;  4EUZ A;  1ES5 A;  4P6B A;  4ZBE A;  5GLB A;  1GA9 A;  2WKH A;  1K38 A;  3N8S A;  4BD1 A;  4BEN A;  4OOM A;  4MNR A;  3WS0 A;  3SH8 A;  3WS2 A;  1YQS A;  2X01 A;  2V2F F;  4DDS A;  4KQQ A;  1KGF A;  3BEB A;  1L0E A;  2HDS A;  1MBL A;  2JE5 A;  4E3M A;  1PWG A;  2HP5 A;  4ZDX A;  1H8Y A;  3UDX A;  4PPR A;  2Y2N A;  1GHP A;  1K55 C;  4IBR A;  1LI9 A;  4OON A;  3VOZ A;  4DXB A;  1TDG A;  3D4F A;  4GN2 A;  5KZH A;  3N4I A;  1IKI A;  2EFU A;  5FI6 A;  3SS4 A;  2EFX A;  4WM9 A;  1QMF A;  3Q1F A;  1Z6F A;  1K4F A;  1FSW A;  5EOO A;  1ES4 A;  1MWR A;  2WKE A;  4E3K A;  4IED A;  3IXB A;  3NCK A;  1G68 A;  4LCM A;  4MLL A;  1PI5 A;  4K0W A;  4X68 A;  1HTZ A;  5CRF A;  1C3B A;  2C5W B;  2J9O A;  4WZ5 C;  4JF5 A;  2PBY A;  5HAI A;  4UAA A;  4QHC A;  4LV1 A;  1XA1 A;  3A3E A;  5EOE A;  3ITB A;  2ZJ9 A;  3N6I A;  1J9M A;  4H8R A;  4HES A;  2OV5 A;  5EPH A;  4OPR A;  4S2N A;  3ZHH A;  4OLG A;  2VGK A;  1LLB A;  3FZC A;  3SOI A;  3ZG7 B;  1XGJ A;  3HUO A;  5DTT A;  4RVA A;  3C4P A;  3SS5 A;  3NDG A;  1O07 A;  2ZQ9 A;  2DCF A;  1ERQ A;  3FKW A;  4S2L A;  3UO9 A;  5GL9 A;  4OH0 A;  4DXC A;  1NJ4 A;  2Y2M A;  2XGN A;  3M6H A;  2ZD8 A;  2H10 A;  2ZQA A;  3G32 A;  2ZQC A;  1MXO A;  4JXG A;  3IF5 A;  1SDE A;  3HUM A;  2WAF A;  4OQG A;  4ZAM A;  4ZTK A;  3S1Y A;  2FFF B;  5GHX A;  3GTC A;  4BJP A;  2IWD A;  5AQA A;  2HDU A;  3O86 A;  4OKP A;  1KDS A;  1IYO A;  4C6Y A;  4KQO A;  4BLM A;  3ZVW A;  3LEZ A;  1H5X A;  1ERO A;  5HX9 A;  1SCW A;  5AQ7 A;  2WZZ A;  4S2P A;  2Y2L A;  1IEL A;  2H0Y A;  4FCF A;  4N9L A;  3MFD A;  4Y0U A;  5CGX A;  3FYZ A;  5AQB A;  1Q2P A;  5DF7 A;  4KG6 A;  5FAQ A;  1CK3 A;  5E2G A;  4JF4 A;  3W4Q A;  2Y55 A;  1SKF A;  1BZA A;  3ZNY A;  4Q8I A;  4FSF A;  4EV4 A;  3BM6 A;  4GD8 A;  1W7F A;  5GLA A;  3I7J A;  4E3I A;  4DE3 A;  2Y2Q A;  1QME A;  2ZQD A;  1KE0 A;  1ES2 A;  4GD6 A;  4KG5 A;  3HLF A;  1PW8 A;  4S2N C;  2Q9N A;  3GRJ A;  4LV2 A;  4E3N A;  4R1G A;  5TR7 A;  3OPR A;  5FDH A;  4K0X A;  1K4E A;  4BQM A;  1W8Q A;  3BEC A;  1ERM A;  1FQG A;  1K57 A;  3DWK A;  2B5R A;  3JYI A;  3A3D A;  4UA6 A;  1TVF A;  5FI2 A;  4ZJ1 A;  3ZGA B;  2PU4 A;  2Y2J A;  3HUN A;  1BLS A;  4FH2 A;  4N1X A;  1IYQ A;  1K56 D;  2OLU A;  3E2K A;  1KGG A;  1RGY A;  3BFF A;  3PBR A;  2ZC3 B;  4GNU A;  3CMZ A;  2HP6 A;  1IKG A;  1OME A;  3GV9 A;  5TFQ A;  5GLC A;  3HL9 A;  4S2K A;  3LO7 A;  2WAD A;  1IYS A;  3UN7 A;  4JXW A;  3PBN A;  3W4O A;  4IBX A;  2GDN A;  1LL5 A;  2QMI A;  4OOY A;  4KZ7 A;  3S22 A;  1VQQ A;  1PWD A;  5HAQ A;  5FAO A;  4F94 A;  4QD4 A;  1FOF A;  3Q7V A;  4DE2 A;  3ITA A;  5JYP A;  1BUL A;  1CEF A;  2EX8 A;  4LV3 A;  1GCE A;  3NY4 A;  1BT5 A;  4R4S A;  4Y0O A;  1GA0 A;  3GMW A;  2H5S A;  4JPM A;  3G31 A;  4UA7 A;  5DTK A;  1MKI A;  1PIO A;  3G35 A;  5DF8 A;  2WGW A;  4DE1 A;  2G2U A;  1NZO A;  3V3S A;  1GHI A;  4XXR A;  3N8R A;  3E2L A;  3S4X A;  5EVI D;  5EUA A;  3LY3 A;  2R9W A;  5AQ9 A;  1ONH A;  2XR0 A;  2Y4A A;  1NYM A;  2I72 A;  3OZH A;  1TDL A;  3GVB A;  4MBH A;  2ZM8 A;  5J8X A;  1ESU A;  3OCL A;  4WEL A;  4GZB A;  3PAG A;  1I2S A;  1YLZ A;  3FWL A;  4R23 A;  2XD1 A;  2Y2K A;  1K57 C;  5DTS A;  3AGE A;  3MXS A;  4PM7 A;  1PZP A;  2J9P A;  4IVI A;  4JBF A;  4X69 A;  5DF9 A;  2Y91 A;  5F83 A;  3VP0 A;  3PBS A;  3G34 A;  2ZC4 B;  5E2F A;  3BFE A;  3NIA A;  2Z2M B;  5G18 A;  4PM5 A;  1Q2Q A;  5KMW A;  1RP5 A;  4KEN B;  2ZQ8 A;  4BL2 A;  1DY6 A;  4BL3 A;  3O87 A;  4UA9 A;  4WEJ A;  2XFT A;  4MBK A;  5CHU A;  4Y7P A;  5KSH A;  2RL3 A;  4EBP A;  1KE4 A;  5HFO A;  3V3R A;  5FQQ A;  4EBL A;  5M18 A;  3CJM A;  2HDR A;  2A3U A;  2R9X A;  2BLS A;  3FKV A;  4OQH A;  5GLD A;  3PAE A;  4MEZ A;  2JCH A;  4OPY A;  3ZFZ A;  2A49 A;  4WMC A;  1XA7 A;  3C7U A;  5HAP A;  3V5M A;  4OP8 A;  3VOY A;  2J7V A;  4Z9Q A;  1YM1 A;  4KZB A;  5L2F A;  2VGJ A;  3Q81 A;  1XKZ A;  3C4O A;  4OOL A;  3HLB A;  2EX6 A;  4DKI A;  4O7D A;  1PZO A;  4X55 A;  1S6R A;  2XF3 A;  3OPP A;  2ZLY A;  3HBR A;  3OPH A;  3V50 A;  5A92 A;  4KZ9 A;  4GB7 A;  4U0T A;  1BLP A;  1Y54 A;  2HP9 A;  3MKF A;  1XP4 A;  4DRT A;  3OC2 A;  1TEM A;  3ZNT A;  1EWZ A;  3G4P A;  4RYE A;  1L0D A;  1ONG A;  4R0Q A;  1LI0 A;  4MBF A;  1MWU A;  4OQI A;  2Y2I A;  1S0W A;  3IXD A;  2Y59 A;  4LEN A;  5F1G A;  2XEP A;  1N4O A;  4JXS A;  4GDN A;  5CHJ A;  2WYX A;  2ZM0 A;  1KGE A;  1MY8 A;  2OSU A;  5U47 A;  3IQA A;  3Q7V B;  1PYY A;  2HPB A;  3C5A A;  3BFD A;  4WEK A;  4B88 A;  2QZ6 A;  4OVD A;  1DJA A;  1YMS A;  1FCO A;  5CGS A;  4R3B A;  3N8L A;  4JLF A;  4DE0 A;  2WGW B;  3DW0 A;  3BFG A;  1YLP A;  4WBG A;  5D3O A;  1BUE A;  4OLD A;  5FAP A;  3P09 A;  1PWC A;  3IWQ A;  1K54 A;  1BLH A;  2XK1 A;  3MZD A;  3WRT A;  3IF6 B;  4A5R A;  2XDM A;  1L0F A;  2ZQ7 A;  1E3U D;  4BD0 A;  3DTM A;  3IXH A;  3UE0 A;  3WS1 A;  1I5Q A;  3BLS A;  4ZJ2 A;  3BYD A;  1W8Y A;  3GR2 A;  1WYC A;  1YMX A;  5FI7 A;  4FD8 A;  4HEF A;  3CZD A;  1RCJ A;  3VSK A;  2UWX A;  3ISG A;  3B3X A;  4XUZ A;  3BLM A;  3VP2 A;  3EQV A;  2Z2L B;  3W8K A;  3FV7 A;  1MPL A;  4L0L A;  3ZG9 B;  3BFC A;  4KZ6 A;  5CGW A;  2DNS A;  4KZA A;  4K91 A;  5IHV A;  3Q82 A;  3NBL A;  2PU2 A;  1M40 A;  3IWI A;  4OPQ A;  3WS5 A;  1IEM A;  5M1A A;  2OLV A;  4LV0 A;  3HLE A;  4ZJ3 A;  3MXR A;  1HD8 A;  2EX2 A;  5CXW A;  1M6K A;  2Y2G A;  1H8Z A;  2X71 A;  2C6W B;  4OPZ A;  4U0X A;  3IT9 A;  3P98 A;  3QNC A;  4P87 A;  3ZG8 B;  5I94 A;  3O88 A;  2XFS A;  4IVK A;  4PM8 A;  4QU3 A;  3VSL A;  1KE3 A;  2Y2O A;  3CG5 A;  3W4P A;  3UPO A;  4CPK A;  1NY0 A;  3IF6 A;  3HLD A;  3IHB A;  3PBO A;  4OQ0 A;  4JXV A;  1BSG A;  2P9V A;  1WYB A;  1EI5 A;  1O7E A;  1JVJ A;  4KZ4 A;  2Y2H A;  4R4R A;  4EQI A;  3DWZ A;  4N92 A;  5FAS A;  3UPP A;  1K25 A;  5CED A;  4KG2 A;  1JWZ A;  1K54 C;  5CHM A;  4S2I A;  4KZ8 A;  4QY6 A;  1U60 A;  1CI9 A;  5EE8 A;  1JTG A;  4GOG A;  4DDY A;  4S2M A;  3G2Y A;  2QPN A;  2WK0 A;  5EVI B;  4E3L A;  3SS3 A;  4RX3 A;  1K56 A;  3A3J A;  5E2H A;  1E3U A;  3M2J A;  5EVL A;  2WGI A;  2ZC5 B;  3QNB A;  3G30 A;  5A91 A;  4KQR A;  3UNW A;  3MBZ A;  5M19 A;  5HAR A;  5F1F A;  4ID4 A;  1XXM A;  5FQ9 A;  3ZVT A;  1KDW A;  1YT4 A;  3IWO A;  2Y2P A;  3RXW A;  5BOH A;  1FSY A;  4YIN A;  4JF6 A;  4S2O A;  4N1H A;  5GHY A;  2IWC A;  1KVL A;  4E6X A;  4P0M A;  5CER A;  3RJU A;  3LCE A;  3M2K A;  4E3J A;  1ALQ A;  3TG9 A;  5CTM A;  3UDF A;  2IWB A;  2Q9M A;  1VM1 A;  4HBT A;  4B4Z A;  3C7V A;  3GQZ A;  3HVF A;  4C75 A;  5FQI A;  1IYP A;  1MWT A;  1K6S A;  2HDQ A;  1XGI A;  3A3I A;  3IF6 C;  2XLN A;  4PM6 A;  1G6A A;  4DF6 A;  2ZC7 A;  3N7W A;  2WZX A;  3IHA A;  1RGZ A;  5FQK A;  1YLT A;  4M3K A;  5EVI A;  2WUQ A;  5GHZ A;  5FA7 A;  3VP1 A;  3WWX A;  3ZDJ A;  4JKT A;  5CEB A;  1L2S A;  4U3T A; 
#chains in the Genus database with same CATH topology
 4R8P C;  1P3G C;  3LYX A;  3TOI A;  3AZK A;  2WKI A;  1W5D A;  3UPN A;  4RX2 A;  5HDD A;  1HZO A;  1CEG A;  4WZ4 A;  2X02 A;  5B0Y B;  3UE1 A;  4WU9 B;  3MQ0 A;  4GDB A;  1LSW A;  3UTA B;  4R3J A;  5B32 A;  5AV9 D;  5KDM A;  4H9R A;  1T3U A;  4J8X A;  4ARZ A;  5EVE A;  5B31 C;  2J8Y A;  5GT0 C;  4KZ3 A;  3MGQ A;  3VOL A;  1KX4 A;  2EXB A;  3ZG5 A;  2PAV P;  3G2Z A;  3BRM A;  5B40 C;  3CI6 A;  2V20 A;  3K3D A;  2F8N D;  5AVB C;  1ZG4 A;  2PYR A;  2WAE A;  3TU4 C;  4ZUX D;  2ZMA A;  1BH9 A;  1JTD A;  3AZN A;  4WYY A;  2H0T A;  1F5M A;  3X1U D;  4YWZ A;  4EER A;  2YFW B;  4R3A A;  4QY5 A;  4G3V A;  3P5J B;  3PXP A;  3UDI A;  5TGF A;  3CUE A;  3OCN A;  5DNN D;  1EW0 A;  3NQU B;  2G2W A;  1YLY A;  3V39 A;  3AZK C;  4Y0T A;  4YM6 C;  3CHW P;  1WE4 A;  3GSG A;  4QPR A;  1ED7 A;  2L5A A;  1CI8 A;  1P3I D;  5A90 A;  5JYO A;  1LL9 A;  1FR6 A;  4B4X A;  3AGD A;  2JC7 A;  2V1B A;  2DRW A;  2VGL S;  5B32 C;  3NQJ B;  1KX5 B;  3TE8 A;  4YFM A;  1YLW A;  4PM9 A;  3MGR D;  5AV8 B;  4J8X C;  1KVM A;  3ZG0 A;  4D60 A;  4ZBE A;  5GLB A;  3WAA B;  1K38 A;  5HWV A;  4NE3 A;  1WA9 A;  1M1A D;  3MGQ C;  1KX4 C;  2YFW A;  4OOM A;  2NQB B;  1B67 A;  2ZY3 A;  5B2I B;  1KGF A;  4E3M A;  1H8Y A;  3AZN C;  3T1S A;  1IKI A;  5FI6 A;  4WM9 A;  3UME A;  1P3F B;  5AVF A;  2VZW A;  1P3A D;  3CUE C;  1R4V A;  4E3K A;  4HY8 A;  3IXB A;  4G92 C;  3X1T B;  1J7M A;  3C30 A;  3NQJ A;  1KX3 B;  5AV8 A;  5CHL B;  5GXQ A;  3MSH A;  1PNE A;  3MJQ A;  3ZHH A;  3FKE A;  1LLB A;  3WA9 D;  3ZG7 B;  5B2I A;  3B6F A;  2L4R A;  4RVA A;  3C38 A;  3NDG A;  1O07 A;  3FKW A;  3AZJ B;  5I5L A;  4OH0 A;  5E5A D;  1NJ4 A;  2D49 A;  2H10 A;  2ZQA A;  3TRC A;  2H28 A;  1MXO A;  3AZG D;  4L9F A;  3IF5 A;  1SDE A;  3HUM A;  2WAF A;  3A1K A;  3DBA A;  3EPJ A;  2FFF B;  1YUE A;  3S1Y A;  1CK7 A;  1WWI A;  1PFL A;  3MXQ A;  3G6O A;  3X1T A;  1BH8 A;  3EOI A;  1KX3 A;  4G91 C;  2F2A C;  5CPJ B;  5HX9 A;  4FCF A;  2HZ5 A;  3FYZ A;  4HP4 A;  3REI B;  4YNR A;  5FAQ A;  4X23 C;  1CK3 A;  5E2G A;  1P3O B;  4LRZ E;  4HH2 A;  2B95 A;  5AV8 C;  4GD8 A;  5GLA A;  5GXQ C;  3KXB D;  1UR9 A;  2YFV B;  2CV5 B;  4BBV A;  3AZH A;  4E3N A;  3B6F C;  3BJN A;  1OTI A;  1P3G D;  2HUE B;  4KUK A;  3DWK A;  1G28 A;  2B5R A;  4NXF A;  1TAF B;  4BWI A;  2W0N A;  5AY8 B;  2Y2J A;  5CPJ A;  5AV6 D;  1BLS A;  3HUN A;  4NEE D;  3E2K A;  3AYW A;  4KGC A;  3BFF A;  4GNU A;  2HP6 A;  4IJE A;  3HL9 A;  3REI A;  3X1T C;  3UN7 A;  3PBN A;  1P3O A;  2QMI A;  4OOY A;  4KZ7 A;  4J8V B;  1S32 C;  4MMN A;  4HOI A;  5F5Y A;  1E6Z A;  4DE2 A;  2J8P A;  3ITA A;  5JYP A;  1XJ3 A;  4GS9 B;  2YFV A;  1CEF A;  2CV5 A;  1GCE A;  1BT5 A;  4Z2K A;  4NZ3 A;  5AVB D;  4I3I A;  5BNX B;  4JPM A;  3TU4 D;  4WF0 A;  3MFX A;  3KSY A;  5DF8 A;  2ZM5 A;  5GSU B;  1CQA A;  4OJP A;  4G3W A;  3E2L A;  3S4X A;  2R9W A;  5C3I B;  1UWN X;  1T1A A;  3AZH C;  3TJZ C;  3F1O B;  3F6T A;  2RIQ A;  5J8X A;  4R23 A;  1VB6 A;  4DJ2 A;  3VH6 A;  5DF9 A;  3AZK D;  3QP8 A;  3PBS A;  4PM5 A;  4P6Z M;  5CPJ C;  1ACF A;  2FZ0 A;  1DY6 A;  4DMZ A;  3AYW C;  3REH A;  4KGC C;  1G5U A;  3O87 A;  4GS9 A;  5KSH A;  4EBP A;  1KE4 A;  3REI C;  1P3O C;  4EBL A;  1P9W A;  3WTP E;  4NZ4 A;  5BNX A;  4IBD A;  3UB7 A;  1LSX A;  4GHI B;  4Z2L A;  3PAE A;  2JKT M;  3CPT A;  5GSU A;  5FEG A;  2OAP 1;  3MGQ D;  1KX4 D;  4GJ4 A;  5CPI B;  2CV5 C;  3UB5 P;  4IUK A;  2J7V A;  2YKH A;  4UUZ B;  1YM1 A;  4KZB A;  1M19 B;  4B9O A;  1XKZ A;  5L09 A;  3V67 A;  4OOL A;  2EX6 A;  4DKI A;  3AZN D;  4EW7 A;  3OPH A;  3V50 A;  3DTE A;  4GB7 A;  4U0T A;  4R70 A;  2HP9 A;  4JJN C;  3BQ8 A;  3MKF A;  4H9N B;  5B0Y D;  4R0Q A;  5LBR A;  4GW9 A;  4H9S A;  3EG5 B;  5F1G A;  4GHI A;  3S7P A;  1EAK A;  2XEP A;  3HON A;  3REH C;  1N4O A;  3KX0 X;  3Q7V B;  1EQZ B;  5K5B A;  1PYY A;  5B1L B;  3B0B A;  4KQD A;  3MF0 A;  2R78 A;  1S1Z A;  4JLF A;  4DE0 A;  3DW0 A;  3D72 A;  1BUE A;  4H9N A;  4QLC B;  4LGW A;  1PWC A;  4H9P B;  3MZD A;  1BLH A;  3WRT A;  1TZY C;  3UTB B;  2XDM A;  3DTM A;  1Y4O A;  1I5Q A;  4NZ5 A;  4CAY B;  2F8N B;  1D7E A;  1T19 A;  2ZOI A;  3BQA A;  2VA0 A;  4WLA A;  1BYW A;  1WYC A;  5FL3 A;  1YMX A;  1FIK A;  4HEF A;  5BPV A;  4WZ5 C;  1RCJ A;  3X1U B;  3ISG A;  3PHY A;  3BLM A;  3VP2 A;  3LJA A;  3W8K A;  3FV7 A;  3BFC A;  2DNS A;  4H9S C;  3A6N B;  4KZA A;  2CMN A;  5AV8 D;  1EQZ A;  1M40 A;  4Y17 A;  1IEM A;  2ZMV A;  2OLV A;  3WAA D;  2ACG A;  1HD8 A;  3MMH A;  2LY8 A;  2X71 A;  4OPZ A;  3IT9 A;  3P98 A;  1SZV A;  2NQB D;  3QNC A;  2ZL1 B;  5I94 A;  2DF4 C;  5B2I D;  4QLC A;  4WNN A;  3VSL A;  3W4P A;  1E6P A;  1NY0 A;  3UTB A;  4OQ0 A;  3MNN A;  1BSG A;  4CAY A;  2JKR M;  1O7E A;  4R4R A;  4Z2M H;  5HDC A;  4N92 A;  5CED A;  4KG2 A;  1M1A B;  2F8N H;  1P0Z A;  5CHM A;  3X1T D;  1H0M A;  5EE8 A;  3A6N A;  1KX3 D;  4IBE A;  4J8W A;  2WK0 A;  2ZY2 A;  3SS3 A;  3IS2 A;  3AZF B;  3M2J A;  2WGI A;  3JVU A;  5A91 A;  2L1M A;  3MBZ A;  3LJA C;  5M19 A;  4ID4 A;  1P3A B;  2Y2P A;  1EQZ C;  3M7P A;  4EO5 B;  4N1H A;  2IWC A;  1P34 B;  1KVL A;  3UB9 A;  3AZJ D;  5GT3 B;  2G5H C;  3C2W A;  3TG9 A;  3UDF A;  1ZLA A;  3A0R A;  3AZH D;  4DRB A;  3AN2 B;  3HVF A;  4C75 A;  1YPR A;  1XFN A;  1MWT A;  4M4X A;  4GHA A;  1H0I A;  4Z2J A;  3UTB C;  2XLN A;  2W8S A;  1G6A A;  4PM6 A;  3A0S A;  4KHA B;  3MNN C;  3W99 C;  2WZX A;  4NKP A;  1L3L A;  5FQK A;  2VV8 A;  5CPJ D;  2WUQ A;  2XA7 S;  5FA7 A;  3VP1 A;  3AZF A;  4KGC D;  3AYW D;  3V9R B;  4XUX A;  1DJC A;  4HBU A;  4HJ3 A;  2P04 A;  3REI D;  1L0G A;  4X56 A;  3QP5 A;  3AZG B;  1P3O D;  5G49 B;  2ZM2 A;  1SHV A;  4J8W C;  3QHY A;  1N9B A;  5TJJ A;  1P34 A;  3MZF A;  5GT3 A;  1FCN A;  2J80 A;  1ZG6 A;  1P3P B;  3WKJ A;  4Y15 A;  3AZI A;  2CV5 D;  4QNL A;  3NI9 A;  4PMA A;  3L26 A;  1I2W A;  5E2E A;  3AN2 A;  1F2K A;  4QJG A;  1KS0 A;  4CLC B;  3HLW A;  3VFH A;  5A93 A;  4X6T A;  2JHE A;  2P74 A;  5AY8 D;  3ZCZ A;  1ZLA C;  4OP5 A;  5CPK A;  3KXB B;  2I9V A;  3V9R A;  4Z1W A;  2P9V B;  4D2O A;  4EBN A;  5KSC A;  1P3B B;  1PI4 A;  2BG1 A;  4PKY G;  1ZKJ A;  2K7S A;  1AXB A;  2RCX A;  4R8P B;  1P3G B;  2V0U A;  2WGV A;  3VMA A;  3AZF C;  3Q07 A;  3REH D;  3SH7 A;  5FAT A;  1P3P A;  3EQU A;  2IO5 B;  1HQ3 B;  1PW1 A;  4LG2 A;  1JWV A;  4CLC A;  2VV6 A;  3MGS A;  3ZYT A;  2CC1 A;  3IH9 A;  4BBT A;  1P34 C;  5GSU D;  5GT3 C;  1ES3 A;  4L9E A;  5HL1 A;  3WKJ C;  3AZI C;  4MN5 A;  5L10 A;  2PYO A;  4EWF A;  3AN2 C;  5B31 B;  5F82 A;  5GT0 B;  3FDD A;  3HLG A;  5FSR A;  4WU8 A;  4FH4 A;  4EUZ A;  2WKH A;  5B40 B;  4BD1 A;  4R8P A;  5AV5 B;  3SH8 A;  2X01 A;  5CPK C;  5DNM B;  4AFI A;  1OTE A;  4KQQ A;  1L0E A;  2HDS A;  1N9N A;  3UDX A;  1HQ3 A;  3MQL A;  4J8U A;  1TDG A;  5KZH A;  4GN2 A;  1OTA A;  2EFX A;  1WWS A;  2QJ5 A;  1FSW A;  2AVX A;  5EOO A;  1ES4 A;  1MWR A;  1P3P C;  4YM6 B;  1IFQ A;  4LCM A;  2RVQ C;  1PI5 A;  4K0W A;  4F3L A;  1HTZ A;  5CRF A;  1OT9 A;  2J9O A;  5HAI A;  3MGS C;  3A3E A;  5B32 B;  5KDM B;  2ZJ9 A;  3N6I A;  4H9R B;  5B40 A;  4IBC A;  3UB8 A;  1J9M A;  4J8X B;  2JN7 A;  4PHT A;  4H8R A;  2OV5 A;  4GCZ A;  5AV5 A;  1F98 A;  2PYO C;  3ZQ5 A;  3SOI A;  1E6N A;  5DNM A;  3HUO A;  3REK A;  3MGQ B;  4WU8 C;  4Q0I A;  3NOP C;  3SS5 A;  3LEL B;  4IJG A;  4R38 A;  5GL9 A;  3VV4 A;  4DXC A;  2Y2M A;  1A7W A;  2XGN A;  1W2E A;  3M6H A;  2ZD8 A;  1BH9 B;  2PR6 A;  3AZN B;  2ZQC A;  3EEA A;  4ZAM A;  5B31 G;  2FJ7 B;  4YM6 A;  3GTC A;  5AQA A;  2IO5 C;  1PDC A;  1HQ3 C;  4OKP A;  4J8U C;  1GPF A;  4OJ6 A;  4C6Y A;  1EQZ D;  2Z6C A;  5B1L D;  3LEZ A;  1H5X A;  4G92 B;  1SCW A;  2WZZ A;  1LL8 A;  3B0C W;  4Z66 A;  1GOI A;  2A2L A;  3MFD A;  4IBB A;  3KUY C;  5AQB A;  2WKQ A;  4I3A A;  2JKF A;  1SKF A;  4QLC D;  1E8B A;  1BZA A;  4IBK A;  4FSF A;  1W7F A;  4Z5T B;  3UTB D;  2V9A A;  3LEL A;  3MNN D;  2Y2Q A;  1QME A;  2W3G A;  1H8M A;  4KUD A;  4KG5 A;  4NXB A;  5AV5 C;  3BW6 A;  4LV2 A;  5DNM C;  3REK C;  2FJ7 A;  5TR7 A;  3ULF A;  3OPR A;  5FDH A;  4IBI A;  1OGG A;  1OJG A;  1S1Y A;  1ERM A;  4NY2 A;  1K57 A;  5B32 G;  3AZM A;  3F1N A;  3A6N D;  4XUJ B;  5FI2 A;  3ZGA B;  3R7W A;  3UE6 A;  3UB6 A;  3W97 C;  2PRF A;  1IYQ A;  1RGY A;  2XRO A;  3A0V A;  3CMZ A;  1IKG A;  1OME A;  3GV9 A;  5TFQ A;  1B6W A;  4G91 B;  3FC7 A;  3W4O A;  4IBX A;  2PYP A;  3LR5 A;  3REL B;  3VE3 A;  1VQQ A;  4Z5T A;  1PWD A;  4X23 B;  3X1V A;  3K3C A;  4Z66 C;  2ZMF A;  4PAU A;  4QD4 A;  2Y79 A;  2EX8 A;  1ID3 B;  1ZLA D;  5GXQ B;  3IX8 A;  2H5S A;  1UGU A;  3G31 A;  1PIO A;  3G35 A;  4GLQ A;  2HIO A;  3LEL C;  4DE1 A;  4H9O A;  3L29 A;  4XUJ A;  3L25 A;  3B6F B;  1NZO A;  1IOU A;  3V3S A;  4FUW A;  4MDZ A;  4KUD C;  3LY3 A;  5EUA A;  3AZF D;  5G4Z A;  1LT0 A;  1TDL A;  5B33 B;  2ZM8 A;  2FJ7 C;  1K57 C;  3R4K A;  3E4Q A;  3AZM C;  3AGE A;  3MXS A;  4Z2G A;  3UT9 A;  2J9P A;  4IVI A;  4X69 A;  5F83 A;  3LIB A;  3X1S A;  3REL A;  3CAX A;  5E2F A;  1RP5 A;  4X23 A;  1BH8 B;  4BL2 A;  1P34 D;  2QKP A;  5GT3 D;  3PYP A;  3OBF A;  2XFT A;  5F69 A;  5DKL A;  2RL3 A;  5HFO A;  1S32 B;  1ID3 A;  5F6A A;  3AN2 D;  4HP9 A;  1F9I A;  2HDR A;  2A3U A;  4Z5T C;  2BLS A;  2R9X A;  1VET A;  4LPZ A;  5GLD A;  3X1V C;  2EWV A;  4LD9 B;  3ZFZ A;  5AVC A;  1AWI A;  5CPK D;  2NUP C;  5B33 A;  3Q81 A;  3EWK A;  3HLB A;  4O7D A;  3F1P B;  3AZH B;  2HIO C;  1S6R A;  4HIA A;  4XUJ C;  5AVE A;  2RTS A;  1YU3 A;  4DRT A;  3OC2 A;  2W1T A;  4MB3 A;  1TEM A;  3L28 A;  1P3P D;  3G4P A;  2PHY A;  2RVQ D;  1S32 A;  5EM1 A;  4HMC A;  3AYW B;  4KGC B;  3UT9 C;  4OQI A;  4CLC D;  3X1S C;  1VHM A;  3REL C;  4LEN A;  3NOT C;  4OJ5 A;  1MC0 A;  3WD2 A;  4LD9 A;  1ZTU A;  1ID3 C;  2WYX A;  2OSU A;  1P3B D;  3FG8 A;  3C5A A;  4WU8 D;  3LFV A;  2B18 A;  3BFD A;  4UQI M;  1CXW A;  3C1B A;  2QZ6 A;  3F1P A;  4M6B A;  4R8P D;  1DJA A;  5AVC C;  1ZHH B;  5CGS A;  3L2A A;  3AL0 C;  5B33 C;  3AZL C;  1CF0 A;  1FIL A;  5FAP A;  2XK1 A;  4JJN B;  1HQ3 D;  4A5R A;  2ARO A;  4J8U D;  4DQY B;  3AFA B;  1E3U D;  3UE0 A;  4H9Q B;  2YKF A;  2F8N K;  4ZJ2 A;  2KDK A;  3HCY A;  2GZA A;  3CZD A;  2E8J A;  2UWX A;  3B3X A;  3KWQ A;  4HJ4 A;  1AIW A;  5CGW A;  3REH B;  4K91 A;  5B31 D;  3NBL A;  5GT0 D;  2PU2 A;  5DJU A;  3IWI A;  1HTA A;  3AV2 A;  5FDS A;  2HF6 A;  1YKD A;  3KO6 A;  2NZD A;  5B40 D;  3KSI A;  3MXR A;  4LD9 C;  5B2J A;  4LLO B;  2Y2G A;  1H8Z A;  2C6W B;  2BYM A;  5AV5 D;  3T4J A;  3EPH A;  4P87 A;  3CPT B;  5DNM D;  4NYU A;  4IVK A;  4PM8 A;  4QU3 A;  3R45 A;  5B0Z A;  3P01 A;  4NXE A;  3UPO A;  5HZH A;  4JJN A;  4CPK A;  3C1B C;  5FUG B;  3AFA A;  4H9Q A;  1WYB A;  3T4T A;  4ZRR A;  1W1P A;  1TZY B;  2XRN A;  4KZ4 A;  2P08 A;  5FAS A;  3FPV A;  1U35 B;  4YM6 D;  1JWZ A;  2MJ6 A;  2OOL A;  3EEH A;  4QY6 A;  2ARO C;  2DQN C;  1U60 A;  1JTG A;  4GOG A;  4DDY A;  2PT7 A;  3U2A A;  4BMW A;  4E3L A;  4RX3 A;  4Z66 D;  5B32 D;  3WTP A;  5E2H A;  5HSQ A;  1LSV A;  5EVL A;  5JRG B;  1AOI A;  1N1J A;  3G30 A;  4J8X D;  5CX7 A;  3KWQ C;  3FPW A;  4O01 A;  3IBJ A;  2V8F A;  4YS3 A;  5FQ9 A;  1KDW A;  3IWO A;  5BOH A;  1GSV A;  4XT2 A;  3AV2 C;  3E4O A;  2G5I C;  4S2O A;  3LEL D;  2NZD C;  5FUG A;  4P0M A;  4HH3 A;  3MQQ A;  4WZS B;  5B2J C;  3LCE A;  3M2K A;  5F68 A;  3L27 A;  1TZY A;  3DTI A;  3GQZ A;  1BFM A;  2FJ7 D;  1OJ5 A;  1U35 A;  1NRJ A;  1IYP A;  5B0Z C;  2HDQ A;  1OGB A;  3A3I A;  3AZM D;  1L6J A;  3S7O A;  3AFA C;  1ULY A;  4CSR A;  1YLT A;  2O9B A;  4NG2 A;  3WWX A;  2O9C A;  1L2S A;  4MBF A;  4U3T A;  5JRG A;  4ZBJ C;  1YLJ A;  1W1T A;  1NRF A;  1M18 B;  4LCL A;  1OT6 A;  3PTE A;  4HNB A;  4NE6 A;  1P3L B;  1BLC A;  4H6J A;  4Z5T D;  2XQZ A;  3KS8 A;  3LJA B;  3WTP C;  3VH5 A;  4E6W A;  3PBQ A;  3OPL A;  5CTN A;  3EGX C;  4EUV A;  1AOI C;  3MGP C;  4EEP A;  2OWH A;  5FQM A;  1XJ2 A;  2JKT I;  4YS3 C;  5CP6 A;  3Q7Z A;  3T12 B;  3N3F A;  5HW3 A;  4DRA A;  1FCM A;  4XUJ D;  2XH9 A;  3O3V A;  4WNN B;  3MZE A;  3LZ1 A;  4IHQ A;  3MNN B;  3W99 B;  5FQJ A;  1K6R A;  5CEC A;  1U35 C;  5L8M A;  4JGO A;  2E8I A;  2V1A A;  2FFY A;  1JWP A;  3VP3 A;  1M18 A;  3NC8 A;  1D06 A;  1P3L A;  3REL D;  4X23 D;  5BS7 A;  3H0M C;  5JRG C;  4J8W B;  1ID3 D;  3IS2 B;  5GXQ D;  4NET A;  1E4D A;  3B42 A;  3LIF A;  1LHY A;  4WZ5 A;  3PR6 A;  4CJN A;  1PRQ A;  3KSH A;  4S2J A;  4P85 A;  4WV4 B;  3UE3 A;  3B6F D;  1E25 A;  5IT5 A;  2XD5 A;  1T1C A;  3IH8 A;  5AVC D;  3W98 A;  1P3K B;  4N9K A;  2EXA A;  3VFF A;  1XX2 A;  3AGF A;  5B33 D;  3W99 A;  4X53 A;  1ZC2 A;  5CP6 C;  3LY4 A;  3E4P A;  1ES5 A;  1ZLA B;  4P6B A;  5AV9 A;  3N8S A;  4BEN A;  2QJ7 A;  4MNR A;  3LZ1 C;  2M7U A;  1YQS A;  3A1I A;  2PD7 A;  4DDS A;  1T1B A;  3LUQ A;  4IBF A;  2JE5 A;  1S32 D;  4PPR A;  2Y2N A;  1M18 C;  4IBR A;  4DXB A;  1P3L C;  3N4I A;  2EFU A;  3SS4 A;  1F66 B;  5L07 A;  1QMF A;  3Q1F A;  5BS7 C;  2PBD P;  1S67 L;  4Y2F A;  4LD9 D;  4IED A;  5B24 A;  4I39 A;  1A0K A;  1P3K A;  4MLL A;  4ME4 A;  5J3W A;  3DAV A;  4X68 A;  4IBG A;  2C5W B;  3WKJ B;  1N9O A;  2PBY A;  3AZI B;  4JF5 A;  2Z6D A;  4L9G A;  4QHC A;  4UAA A;  4LV1 A;  5DNN A;  3C1B D;  4LRY C;  1H8P A;  4MCW A;  1YU1 A;  4HES A;  3W98 C;  1TD5 A;  4S2N A;  2VGK A;  3FZC A;  1XGJ A;  2M7V A;  2JKR I;  3VE4 A;  3WX7 A;  3T50 A;  2ARO D;  5CPK B;  5AV9 C;  4O0P A;  2ZQ9 A;  1DP8 A;  1ERQ A;  4S2L A;  3UO9 A;  2EA9 A;  3E0Y A;  1F66 A;  5HD5 A;  3G32 A;  4OQG A;  4UPK A;  5GHX A;  4BJP A;  2IWD A;  3KWQ D;  3O86 A;  2ZY5 A;  4JGQ A;  1GSX A;  1KDS A;  1IYO A;  1GXD A;  1SKO B;  2GJ3 A;  4KQO A;  4BLM A;  2HGV A;  4II7 A;  3ZVW A;  1ERO A;  1GSW A;  4ZUX C;  1MKM A;  2Y2L A;  1IEL A;  5B1M B;  2NZD D;  4Y0U A;  5CGX A;  1Q2P A;  5B24 C;  3H0L C;  3MGS B;  1P3K C;  2VKS A;  4JF4 A;  2CWE A;  2Y55 A;  4Q8I A;  1DP6 A;  4EV4 A;  3BM6 A;  4JJN D;  2WKP A;  5DNN C;  3I7J A;  4E3I A;  2PYO B;  3AFA D;  1ES2 A;  4WU8 B;  1PW8 A;  2VV7 A;  2V0W A;  4S2N C;  2Q9N A;  2JSS A;  2PD8 A;  1K4E A;  1W8Q A;  3LI9 A;  1SKO A;  5HPF A;  1F66 C;  4N1X A;  4FH2 A;  3WTP D;  1G6O A;  5B1M A;  1HLU P;  1KGG A;  4J8U B;  2OLU A;  3B0C T;  1D1J A;  5HDS A;  3LO7 A;  2WAD A;  3MS6 A;  4JXW A;  5EFW A;  4YS3 D;  4Y5F A;  3KUY B;  2GDN A;  3SZT A;  2VGL M;  4F3L B;  2VEA A;  4F94 A;  4X1M A;  1K0K A;  1BUL A;  4LV3 A;  1TZY D;  2A24 A;  4R4S A;  1U35 D;  2O0Y A;  3VH6 T;  3GMW A;  4EXO A;  4WUJ A;  2QHK A;  4UA7 A;  1MKI A;  4CLC E;  2WGW A;  2G2U A;  2BYK A;  3REK B;  1GHI A;  3N8R A;  3AV1 A;  5AQ9 A;  2XR0 A;  1NYM A;  2GNX A;  3OZH A;  5JRG D;  2KLI A;  4WEL A;  4GZB A;  2HJ9 C;  1I2S A;  1YLZ A;  3W97 B;  2XD1 A;  4JBF A;  3VP0 A;  2Y91 A;  3KUY A;  2Q0O A;  2ZC4 B;  3G34 A;  3S7N A;  1W1V A;  3B33 A;  2GX5 A;  3NIA A;  1Q2Q A;  5KMW A;  4YOF A;  5B1M C;  3K2N A;  4MB4 A;  4UA9 A;  4WEJ A;  4Z2H A;  4Q0J A;  4MBK A;  5CHU A;  1X0O A;  1P9R A;  4Y7P A;  3V3R A;  4Z66 B;  5FQQ A;  4JGR A;  3W96 B;  5CP6 D;  5M18 A;  3CJM A;  4I5S A;  3LIA A;  2B02 A;  3LIC A;  3FKV A;  4OQH A;  4X1L A;  4MEZ A;  1YSP A;  4IUH A;  1DRM A;  2QWS A;  4OPY A;  1TS6 A;  1N9L A;  4WMC A;  2ZY4 A;  4OJL A;  3C7U A;  5HAP A;  3V5M A;  3MVD A;  2VGJ A;  4KUD B;  3W97 A;  1PZO A;  1M18 D;  4EES A;  2XF3 A;  1TS8 A;  2ZLY A;  3HBR A;  1P3L D;  2XSS A;  4DN0 A;  4HME A;  3S7Q A;  3AV1 C;  3LJA D;  1V9Z A;  3O62 A;  3AZM B;  3F1N B;  1EWZ A;  3R7W B;  3HJI A;  1ONG A;  4HGA B;  3W96 A;  1XJ4 A;  3EPL A;  4IJF A;  2Y59 A;  1NLZ A;  4JXS A;  4GDN A;  3UMD A;  3AZE B;  1JFI B;  3W98 D;  3TW8 A;  5AV6 C;  3B0D C;  1KGE A;  3X1V B;  3B47 A;  3W99 D;  4JKT A;  3QP1 A;  4WEK A;  3VH6 W;  4OVD A;  5DFX A;  3LR0 A;  3LEQ A;  4ETX A;  1YMS A;  4XZQ A;  5F99 B;  3MVD C;  3N8L A;  2HIO B;  1S4S A;  4H9O B;  3B6G A;  1YLP A;  3REJ B;  3BFG A;  4J8W D;  1OPX A;  3CWF A;  3IWQ A;  1K54 A;  3LI8 A;  2K2N A;  2ZQ7 A;  3WD3 A;  3WS1 A;  4G3K A;  3L7H A;  1W63 M;  1STZ A;  3O62 C;  4E44 A;  3UT9 B;  4KUO A;  1KOU A;  3VSK A;  3X1S B;  5IU1 A;  3AZE A;  5B24 D;  4XUZ A;  1JFI A;  1P3K D;  4L0L A;  3OLO A;  4RQ9 A;  3W96 C;  4QWO A;  3EPK A;  5B0Y A;  4OPQ A;  4WU9 A;  5M1A A;  3UTA A;  4LV0 A;  3HLE A;  2VJW A;  4FOF A;  3T1Q B;  4DJ3 A;  5HL6 A;  1VET B;  5F99 A;  3ZG8 B;  1Z2C B;  3REJ A;  1KE3 A;  2Y2O A;  5AVC B;  1ODV A;  3IHB A;  2BTF P;  4JXV A;  3QP6 A;  1TS0 A;  3AZL B;  1F66 D;  2W1R A;  4XZQ C;  4EQI A;  3DWZ A;  3B6G C;  1K25 A;  3LID A;  1K54 C;  4HGA C;  2HV1 A;  2W1T B;  3VH5 W;  3IX4 A;  4S2M A;  3G2Y A;  3WKJ D;  3AZI D;  5EVI B;  1K56 A;  3NQU A;  3A3J A;  3QNB A;  2ZC5 B;  4EET B;  1MZU A;  2W3F A;  3AZE C;  4KQR A;  3UNW A;  3OOV A;  1YU4 A;  5F1F A;  3ZVT A;  3MR0 A;  5B0Y C;  3RXW A;  3P7N A;  4YIN A;  4WU9 C;  4JF6 A;  3UTA C;  2K31 A;  4E6X A;  1KX5 A;  5CER A;  3RJU A;  3AZL A;  2V8C A;  3C7V A;  5F99 C;  3C1B B;  2Y8H A;  1E6R A;  3WAA A;  3REJ C;  5FQI A;  3H9W A;  2NQB A;  4DF6 A;  2ZC7 A;  3N7W A;  4CQH A;  3IHA A;  1VEU B;  4LRX C;  1E15 A;  5EVI A;  5GHZ A;  3QP2 A;  3ZDJ A;  5B1M D;  5BO0 B;  2ARO B;  2LB5 A;  1YAX A;  5J7E A;  2FN2 A;  2ZC6 B;  1P3F A;  3MGS D;  3LZ0 B;  3HLC A;  2J3T C;  3MQO A;  3WRZ A;  3HRE A;  3IXG A;  4OUI A;  2VLG A;  3KWQ B;  3LGO A;  2PYO D;  3PBT A;  4E04 A;  2JBF A;  5BNV B;  3AV2 B;  3M6B A;  1FR1 A;  4MN6 A;  2NZD B;  3RXX A;  5B2J B;  2V1Z A;  4QB8 A;  4E3O A;  4C3Q A;  3A3F A;  2BYM B;  1W79 A;  4MN7 A;  1MWS A;  1SDN A;  1KX5 C;  3ICY A;  5E43 A;  1NYY A;  3C8C A;  1DJB A;  1XPB A;  3R45 B;  1VEU A;  5B0Z B;  1BTL A;  4HQA A;  3AV1 D;  4NZ1 A;  5BO0 A;  3WAA C;  1NZU A;  3O5Y A;  3AZJ A;  5BT1 C;  3SH9 A;  2O99 A;  3LZ0 A;  2NQB C;  1K55 A;  4FTX A;  1ESI A;  3T4O A;  1GHM A;  5B2I C;  3KUY D;  5DVA A;  4ZBJ B;  5EVI C;  3UY6 A;  5DFY A;  3KS4 A;  3VP4 A;  4RA7 A;  3WS4 A;  5BNV A;  1NXY A;  5AJG A;  1P3F C;  3TSG A;  5EEC A;  3WTP B;  4NK3 A;  4GKU A;  2LB9 A;  1AOI B;  1N1J B;  3MGP B;  5KIZ A;  3GEC A;  4UHU A;  4YS3 B;  1HVB A;  3REK D;  2EX9 A;  1KX3 C;  3MKE A;  4WMC D;  4XT2 B;  4TX8 A;  3MVD D;  3NHQ A;  5IS1 A;  3NDE A;  2ZBB A;  4B93 A;  4Y3I A;  4KZ5 A;  3W97 D;  4EQ1 A;  1GA9 A;  1Y28 A;  2FH5 A;  3WS0 A;  1QO6 A;  3WS2 A;  3O62 D;  2V2F F;  3AZJ C;  2HJE A;  3BEB A;  4CSR B;  5HWW A;  1TAF A;  1MBL A;  5AY8 A;  1PWG A;  2HP5 A;  4ZDX A;  3LZ0 C;  1GHP A;  1K55 C;  3C1C B;  3W96 D;  1LI9 A;  4OON A;  1UWP X;  3D4F A;  3VOZ A;  3MGP A;  1P3M B;  1Z6F A;  1K4F A;  3L9K A;  3T1R A;  5EV0 A;  1NLY A;  2WKE A;  3H0R C;  4H6J B;  3NCK A;  1G68 A;  4J8V A;  1C3B A;  1YU0 A;  4NFT A;  1E88 A;  2J3W A;  4KUD D;  2UV0 E;  4O8G A;  4EEU A;  2D01 A;  1XA1 A;  2PDR A;  5EOE A;  4ESP A;  3ITB A;  5CP6 B;  3LIE A;  4NXG A;  1H3Q A;  3T4K A;  5EPH A;  4XZQ D;  4OPR A;  4OLG A;  3B6G D;  5DTT A;  1T18 A;  3LZ1 B;  2XA7 M;  4ETZ A;  3C4P A;  3C1C A;  3RFB A;  2DCF A;  4OJO A;  3F1O A;  2HUE C;  1P3M A;  4JXG A;  4ZTK A;  2BAS A;  3AZE D;  5AY8 C;  1H0G A;  2HDU A;  3X1V D;  1F1E A;  4WU9 D;  4EU0 A;  5EM0 A;  5AQ7 A;  5J4E A;  3UTA D;  4S2P A;  2H0Y A;  4N9L A;  2VX8 A;  5DF7 A;  4J8V C;  4KG6 A;  5F99 D;  4Y13 A;  2HIO D;  4X25 A;  3W4Q A;  3REJ D;  3ZNY A;  1H3O B;  3WD1 A;  5CPI A;  3W98 B;  3SW1 A;  3JPU A;  2IA2 A;  4DE3 A;  1Q9C A;  4UUZ A;  2ZQD A;  1M19 A;  1KE0 A;  2W3D A;  4GD6 A;  3HLF A;  4UQI S;  3GRJ A;  3LR4 A;  5AV9 B;  3UT9 D;  4WJ3 C;  5GSU C;  4R1G A;  3X1S D;  4K0X A;  5C5K A;  4BQM A;  3BEC A;  5C3I C;  1FQG A;  2J3T D;  2QYB A;  3C1C C;  3JYI A;  3A3D A;  4UA6 A;  1TVF A;  4ZJ1 A;  2INW A;  2PU4 A;  1P3M C;  1K56 D;  3PBR A;  4WL9 A;  2ZC3 B;  3H7W B;  5GLC A;  4S2K A;  4ZUX B;  1IYS A;  3BWL A;  1OTD A;  1LL5 A;  1H3O A;  5B24 B;  3S22 A;  1S66 L;  3WD0 A;  3RH8 B;  5HAQ A;  1KX5 D;  5FAO A;  1FOF A;  3Q7V A;  3AZL D;  3KSG A;  2OAQ 1;  5B1L A;  2KX6 A;  5DNN B;  3NY4 A;  4Y0O A;  5BT1 D;  1GA0 A;  4UEY A;  1W1Y A;  5CPI C;  5DTK A;  3E98 A;  3CIT A;  1YU2 A;  5FEF A;  1P3I B;  3KYZ A;  4K08 A;  1M19 C;  4XXR A;  4H9P A;  5EVI D;  5MC7 A;  1ONH A;  2Y4A A;  2I72 A;  3GVB A;  4MBH A;  3MGR B;  1ESU A;  3OCL A;  3H7W A;  2F8N A;  3PAG A;  4AWL B;  1P3F D;  4ZUX A;  3FWL A;  2Y2K A;  5DTS A;  3IP4 C;  3D3O A;  4PM7 A;  3NOU C;  1PZP A;  3T4S A;  3X1U A;  5G18 A;  3BFE A;  4HJ6 A;  2Z2M B;  4KEN B;  2IOU A;  4P6Z S;  2ZQ8 A;  2PR5 A;  4HI4 A;  4BL3 A;  1PZR A;  4E45 A;  3W2Z A;  2KOI A;  3CLO A;  4Z2M G;  4MB5 A;  2ZL1 A;  2JCH A;  1P3I A;  1P97 A;  4GHL A;  1XFQ A;  2A49 A;  2F8N G;  5B1L C;  1XA7 A;  1TS7 A;  4OP8 A;  3VOY A;  4Z9Q A;  4HHD A;  3NUL A;  2P7J A;  3MGR A;  5TBM B;  5L2F A;  3C4O A;  3LZ0 D;  4X55 A;  3OPP A;  2ZOH A;  1Z09 A;  4QLC C;  3H82 B;  5A92 A;  1M1A A;  4KZ9 A;  1BLP A;  1Y54 A;  1XP4 A;  3DTK A;  3WA9 B;  3ZNT A;  3WD4 A;  3AV2 D;  4RYE A;  1L0D A;  1LI0 A;  1MWU A;  4LFU A;  5B2J D;  3X1U C;  5E5A B;  2Y2I A;  1S0W A;  3IXD A;  3D9Y A;  2O9A A;  3A6N C;  1P3A A;  5CHJ A;  5B0Z D;  2ZM0 A;  2VK3 A;  1MY8 A;  3BY9 A;  4PKY A;  3IBR A;  4BBU A;  5U47 A;  3IQA A;  5TBM A;  4I38 A;  2HPB A;  4B88 A;  1O6I A;  1S4R A;  2A24 B;  1P3I C;  4HMD A;  3H82 A;  3NJA A;  5DJT A;  1FCO A;  3IX3 A;  2W3E A;  4R3B A;  1V9Y A;  4R6L A;  2WGW B;  4KHA A;  3WA9 A;  3JVV A;  2BYK B;  4WBG A;  2DMW A;  1KU5 A;  4OLD A;  4I3J A;  5D3O A;  3MGR C;  3P09 A;  5HPI A;  4AWL C;  3AV1 B;  3IF6 B;  1L0F A;  3KYE A;  2VQR A;  2D02 A;  4BD0 A;  3HJK A;  3IXH A;  1AOI D;  3MGP D;  3BLS A;  5E5A A;  3BYD A;  1M1A C;  1W8Y A;  3GR2 A;  3RTY A;  4WN5 A;  5FI7 A;  4FD8 A;  3AZG A;  3KSF A;  5G49 A;  2W27 A;  4IBJ A;  4J8V D;  1NWZ A;  2Z2L B;  3EQV A;  1MPL A;  3ZG9 B;  4KZ6 A;  4Q0H A;  5IHV A;  3Q82 A;  4NYY A;  3NEC A;  3WS5 A;  5AV6 B;  3B0D B;  5JA4 B;  4ZJ3 A;  4GH9 A;  1P3A C;  2EX2 A;  5CXW A;  1M6K A;  4U0X A;  4EO5 C;  4NE5 A;  1J3W A;  3O88 A;  2XFS A;  3CG5 A;  2WKR A;  3IF6 A;  3MVD B;  3HLD A;  3PBO A;  3HSH A;  3C1C D;  3KXB A;  2P9V A;  1P3B A;  1UR8 A;  1EI5 A;  1XJ6 A;  3BY8 A;  1P3M D;  1JVJ A;  2EWW A;  2Y2H A;  3WA9 C;  3EGD C;  3T4L A;  3UPP A;  5AVB B;  1P3G A;  2W3H A;  3GDI A;  3TU4 B;  4S2I A;  4Z2I A;  4KZ8 A;  3O62 B;  1CI9 A;  2QPN A;  5E5A C;  2V5O A;  3U4L P;  5HWT A;  5G4Y A;  5AV6 A;  1DP9 A;  5JA4 A;  1CJF A;  3AZG C;  1E3U A;  2M1C A;  5HD3 A;  2OWJ A;  5DKK A;  3QP4 A;  2JKG A;  5HAR A;  1XXM A;  1YT4 A;  3AZK B;  3T1X A;  1FSY A;  3LZ1 D;  5CPI D;  1OTB A;  3KYQ A;  5GHY A;  5B31 A;  1W63 Q;  1M19 D;  5GT0 A;  1ALQ A;  4E3J A;  4CLC C;  5CTM A;  2G7U A;  2IWB A;  3T4Q A;  2Q9M A;  3KFU G;  1VM1 A;  4HBT A;  4B4Z A;  2L0W A;  5AVB A;  1K6S A;  3TU4 A;  1XGI A;  4ARZ B;  3LR3 A;  4XZQ B;  3IF6 C;  5A8B A;  3KXB C;  3B6G B;  4JGP A;  3VH5 T;  1TF1 A;  1P3B C;  1RGZ A;  4M3K A;  1KX4 B;  1YSQ A;  5CEB A;  2NUT C;  1JNU A; 
#chains in the Genus database with same CATH homology
 4R8P C;  1P3G C;  3TOI A;  3AZK A;  2WKI A;  1W5D A;  3UPN A;  4RX2 A;  1HZO A;  1CEG A;  4WZ4 A;  2X02 A;  5B0Y B;  3UE1 A;  4WU9 B;  4GDB A;  3UTA B;  4R3J A;  5B32 A;  5AV9 D;  5KDM A;  4H9R A;  1T3U A;  4J8X A;  5B31 C;  2J8Y A;  5GT0 C;  4KZ3 A;  3MGQ A;  1KX4 A;  2EXB A;  3ZG5 A;  3G2Z A;  3BRM A;  5B40 C;  2V20 A;  2F8N D;  5AVB C;  1ZG4 A;  2WAE A;  3TU4 C;  4ZUX D;  2ZMA A;  1BH9 A;  1JTD A;  3AZN A;  4WYY A;  2H0T A;  3X1U D;  2YFW B;  4QY5 A;  3P5J B;  3UDI A;  5TGF A;  3OCN A;  5DNN D;  3NQU B;  2G2W A;  1YLY A;  3V39 A;  3AZK C;  4Y0T A;  4YM6 C;  1WE4 A;  3GSG A;  2L5A A;  1CI8 A;  1P3I D;  5A90 A;  5JYO A;  1LL9 A;  1FR6 A;  4B4X A;  3AGD A;  2JC7 A;  2DRW A;  5B32 C;  3NQJ B;  1KX5 B;  4YFM A;  1YLW A;  4PM9 A;  3MGR D;  5AV8 B;  4J8X C;  1KVM A;  3ZG0 A;  4ZBE A;  5GLB A;  3WAA B;  1K38 A;  4NE3 A;  1M1A D;  3MGQ C;  1KX4 C;  2YFW A;  4OOM A;  2NQB B;  1B67 A;  2ZY3 A;  5B2I B;  1KGF A;  4E3M A;  1H8Y A;  3AZN C;  1IKI A;  5FI6 A;  4WM9 A;  1P3F B;  1P3A D;  1R4V A;  4E3K A;  3IXB A;  4G92 C;  3X1T B;  3NQJ A;  1KX3 B;  5AV8 A;  5CHL B;  5GXQ A;  3ZHH A;  3FKE A;  1LLB A;  3WA9 D;  3ZG7 B;  5B2I A;  3B6F A;  4RVA A;  3NDG A;  1O07 A;  3FKW A;  3AZJ B;  4OH0 A;  5E5A D;  1NJ4 A;  2H10 A;  2ZQA A;  1MXO A;  3AZG D;  3IF5 A;  1SDE A;  3HUM A;  2WAF A;  3A1K A;  3EPJ A;  2FFF B;  1YUE A;  3S1Y A;  1WWI A;  3X1T A;  1BH8 A;  1KX3 A;  4G91 C;  2F2A C;  5CPJ B;  5HX9 A;  4FCF A;  3FYZ A;  3REI B;  5FAQ A;  4X23 C;  1CK3 A;  5E2G A;  1P3O B;  5AV8 C;  4GD8 A;  5GLA A;  5GXQ C;  3KXB D;  2YFV B;  2CV5 B;  3AZH A;  4E3N A;  3B6F C;  1P3G D;  2HUE B;  3DWK A;  2B5R A;  1TAF B;  5AY8 B;  2Y2J A;  5CPJ A;  5AV6 D;  1BLS A;  3HUN A;  3E2K A;  3AYW A;  4KGC A;  3BFF A;  4GNU A;  2HP6 A;  4IJE A;  3HL9 A;  3REI A;  3X1T C;  3UN7 A;  3PBN A;  1P3O A;  2QMI A;  4OOY A;  4KZ7 A;  4J8V B;  1S32 C;  4DE2 A;  2J8P A;  3ITA A;  5JYP A;  2YFV A;  1CEF A;  2CV5 A;  1GCE A;  1BT5 A;  4NZ3 A;  5AVB D;  5BNX B;  4JPM A;  3TU4 D;  3KSY A;  5DF8 A;  2ZM5 A;  5GSU B;  4OJP A;  3E2L A;  3S4X A;  2R9W A;  5C3I B;  3AZH C;  3F6T A;  2RIQ A;  5J8X A;  4R23 A;  3VH6 A;  5DF9 A;  3AZK D;  3PBS A;  4PM5 A;  5CPJ C;  1DY6 A;  3AYW C;  3REH A;  4KGC C;  3O87 A;  5KSH A;  4EBP A;  1KE4 A;  3REI C;  1P3O C;  4EBL A;  3WTP E;  4NZ4 A;  5BNX A;  4IBD A;  3PAE A;  5GSU A;  3MGQ D;  1KX4 D;  5CPI B;  2CV5 C;  2J7V A;  4UUZ B;  1YM1 A;  4KZB A;  1M19 B;  1XKZ A;  4OOL A;  2EX6 A;  4DKI A;  3AZN D;  3OPH A;  3V50 A;  4GB7 A;  4U0T A;  2HP9 A;  4JJN C;  3MKF A;  4H9N B;  5B0Y D;  4R0Q A;  4H9S A;  3EG5 B;  5F1G A;  2XEP A;  3HON A;  3REH C;  1N4O A;  3Q7V B;  1EQZ B;  1PYY A;  5B1L B;  3B0B A;  4JLF A;  4DE0 A;  3DW0 A;  1BUE A;  4H9N A;  4QLC B;  1PWC A;  4H9P B;  3MZD A;  1BLH A;  3WRT A;  1TZY C;  3UTB B;  2XDM A;  3DTM A;  1I5Q A;  4NZ5 A;  4CAY B;  2F8N B;  1WYC A;  1YMX A;  4HEF A;  5BPV A;  1RCJ A;  3X1U B;  3ISG A;  3BLM A;  3VP2 A;  3LJA A;  3W8K A;  3FV7 A;  3BFC A;  2DNS A;  4H9S C;  3A6N B;  4KZA A;  5AV8 D;  1EQZ A;  1M40 A;  1IEM A;  2OLV A;  3WAA D;  1HD8 A;  2LY8 A;  2X71 A;  4OPZ A;  3IT9 A;  3P98 A;  3QNC A;  2NQB D;  5I94 A;  2DF4 C;  5B2I D;  4QLC A;  4WNN A;  3VSL A;  3W4P A;  1NY0 A;  3UTB A;  4OQ0 A;  3MNN A;  1BSG A;  4CAY A;  1O7E A;  4R4R A;  4Z2M H;  4N92 A;  5CED A;  4KG2 A;  1M1A B;  2F8N H;  5CHM A;  3X1T D;  5EE8 A;  3A6N A;  1KX3 D;  4IBE A;  4J8W A;  2WK0 A;  2ZY2 A;  3SS3 A;  3AZF B;  3M2J A;  2WGI A;  5A91 A;  3MBZ A;  3LJA C;  5M19 A;  4ID4 A;  1P3A B;  2Y2P A;  1EQZ C;  4EO5 B;  4N1H A;  2IWC A;  1P34 B;  1KVL A;  3AZJ D;  5GT3 B;  2G5H C;  3TG9 A;  3UDF A;  1ZLA A;  3AZH D;  4DRB A;  3AN2 B;  3HVF A;  4C75 A;  1MWT A;  4GHA A;  3UTB C;  2XLN A;  2W8S A;  1G6A A;  4PM6 A;  4KHA B;  3MNN C;  3W99 C;  2WZX A;  5FQK A;  5CPJ D;  2WUQ A;  5FA7 A;  3VP1 A;  3AZF A;  4KGC D;  3AYW D;  3V9R B;  4XUX A;  1DJC A;  4HBU A;  3REI D;  1L0G A;  4X56 A;  3AZG B;  1P3O D;  5G49 B;  2ZM2 A;  1SHV A;  4J8W C;  3QHY A;  1N9B A;  1P34 A;  3MZF A;  5GT3 A;  1FCN A;  1ZG6 A;  1P3P B;  3WKJ A;  3AZI A;  2CV5 D;  4QNL A;  3NI9 A;  4PMA A;  3L26 A;  1I2W A;  5E2E A;  3AN2 A;  4QJG A;  3HLW A;  3VFH A;  5A93 A;  4X6T A;  2P74 A;  5AY8 D;  3ZCZ A;  1ZLA C;  4OP5 A;  5CPK A;  3KXB B;  3V9R A;  4EBN A;  2P9V B;  4D2O A;  5KSC A;  1P3B B;  1PI4 A;  2BG1 A;  1ZKJ A;  1AXB A;  2RCX A;  4R8P B;  1P3G B;  2WGV A;  3VMA A;  3AZF C;  3Q07 A;  3REH D;  3SH7 A;  5FAT A;  1P3P A;  3EQU A;  2IO5 B;  1HQ3 B;  1PW1 A;  4LG2 A;  1JWV A;  3MGS A;  2CC1 A;  3IH9 A;  1P34 C;  5GSU D;  5GT3 C;  1ES3 A;  5HL1 A;  3WKJ C;  3AZI C;  2PYO A;  4EWF A;  3AN2 C;  5B31 B;  5F82 A;  5GT0 B;  3FDD A;  3HLG A;  5FSR A;  4WU8 A;  4FH4 A;  4EUZ A;  2WKH A;  5B40 B;  4BD1 A;  4R8P A;  5AV5 B;  3SH8 A;  2X01 A;  5CPK C;  5DNM B;  4KQQ A;  1L0E A;  2HDS A;  3UDX A;  1HQ3 A;  4J8U A;  1TDG A;  5KZH A;  4GN2 A;  2EFX A;  1WWS A;  1FSW A;  5EOO A;  1ES4 A;  1MWR A;  1P3P C;  4YM6 B;  4LCM A;  2RVQ C;  1PI5 A;  4K0W A;  1HTZ A;  5CRF A;  2J9O A;  5HAI A;  3MGS C;  3A3E A;  5B32 B;  5KDM B;  2ZJ9 A;  3N6I A;  4H9R B;  5B40 A;  4IBC A;  1J9M A;  4J8X B;  4H8R A;  2OV5 A;  5AV5 A;  2PYO C;  3SOI A;  5DNM A;  3HUO A;  3REK A;  3MGQ B;  4WU8 C;  3SS5 A;  3LEL B;  5GL9 A;  4DXC A;  2Y2M A;  1A7W A;  2XGN A;  1W2E A;  3M6H A;  2ZD8 A;  1BH9 B;  3AZN B;  2ZQC A;  4ZAM A;  5B31 G;  2FJ7 B;  4YM6 A;  3GTC A;  5AQA A;  2IO5 C;  1HQ3 C;  4OKP A;  4J8U C;  4OJ6 A;  4C6Y A;  1EQZ D;  5B1L D;  3LEZ A;  1H5X A;  4G92 B;  1SCW A;  2WZZ A;  3B0C W;  4Z66 A;  3MFD A;  4IBB A;  3KUY C;  5AQB A;  1SKF A;  4QLC D;  1BZA A;  4IBK A;  4FSF A;  1W7F A;  4Z5T B;  3UTB D;  3LEL A;  3MNN D;  2Y2Q A;  1QME A;  4KUD A;  4KG5 A;  5AV5 C;  4LV2 A;  5DNM C;  3REK C;  2FJ7 A;  5TR7 A;  3OPR A;  5FDH A;  4IBI A;  1ERM A;  4NY2 A;  1K57 A;  5B32 G;  3AZM A;  3A6N D;  4XUJ B;  5FI2 A;  3ZGA B;  3W97 C;  1IYQ A;  1RGY A;  3CMZ A;  1IKG A;  1OME A;  3GV9 A;  5TFQ A;  1B6W A;  4G91 B;  3W4O A;  4IBX A;  3REL B;  1VQQ A;  4Z5T A;  1PWD A;  4X23 B;  3X1V A;  4Z66 C;  4QD4 A;  2EX8 A;  1ID3 B;  1ZLA D;  5GXQ B;  2H5S A;  3G31 A;  1PIO A;  3G35 A;  2HIO A;  3LEL C;  4DE1 A;  4H9O A;  3L29 A;  4XUJ A;  3L25 A;  3B6F B;  1NZO A;  3V3S A;  4KUD C;  3LY3 A;  5EUA A;  3AZF D;  1TDL A;  5B33 B;  2ZM8 A;  2FJ7 C;  1K57 C;  3AZM C;  3AGE A;  3MXS A;  2J9P A;  3UT9 A;  4IVI A;  4X69 A;  5F83 A;  3X1S A;  3REL A;  5E2F A;  1RP5 A;  4X23 A;  1BH8 B;  4BL2 A;  1P34 D;  5GT3 D;  2XFT A;  2RL3 A;  5HFO A;  1S32 B;  1ID3 A;  3AN2 D;  2HDR A;  2A3U A;  4Z5T C;  2BLS A;  2R9X A;  5GLD A;  3X1V C;  4LD9 B;  3ZFZ A;  5AVC A;  5CPK D;  5B33 A;  3Q81 A;  3HLB A;  4O7D A;  3AZH B;  2HIO C;  1S6R A;  4XUJ C;  1YU3 A;  4DRT A;  3OC2 A;  1TEM A;  3L28 A;  1P3P D;  3G4P A;  2RVQ D;  1S32 A;  3AYW B;  4KGC B;  3UT9 C;  4OQI A;  3X1S C;  3REL C;  4LEN A;  4OJ5 A;  4LD9 A;  1ID3 C;  2WYX A;  2OSU A;  1P3B D;  3C5A A;  4WU8 D;  3BFD A;  3C1B A;  2QZ6 A;  4M6B A;  4R8P D;  1DJA A;  5AVC C;  5CGS A;  3L2A A;  3AL0 C;  5B33 C;  3AZL C;  5FAP A;  2XK1 A;  4JJN B;  1HQ3 D;  4A5R A;  2ARO A;  4J8U D;  4DQY B;  3AFA B;  1E3U D;  3UE0 A;  4H9Q B;  2F8N K;  4ZJ2 A;  3CZD A;  2UWX A;  3B3X A;  3KWQ A;  5CGW A;  3REH B;  4K91 A;  5B31 D;  3NBL A;  5GT0 D;  2PU2 A;  3IWI A;  1HTA A;  3AV2 A;  2NZD A;  5B40 D;  3MXR A;  4LD9 C;  5B2J A;  2Y2G A;  1H8Z A;  2C6W B;  2BYM A;  5AV5 D;  3EPH A;  4P87 A;  5DNM D;  4NYU A;  4IVK A;  4PM8 A;  4QU3 A;  3R45 A;  5B0Z A;  3UPO A;  4JJN A;  4CPK A;  3C1B C;  5FUG B;  3AFA A;  4H9Q A;  1WYB A;  1TZY B;  4KZ4 A;  5FAS A;  1U35 B;  4YM6 D;  1JWZ A;  4QY6 A;  2ARO C;  2DQN C;  1U60 A;  1JTG A;  4GOG A;  4DDY A;  4E3L A;  4RX3 A;  4Z66 D;  5B32 D;  3WTP A;  5E2H A;  5EVL A;  5JRG B;  1AOI A;  1N1J A;  3G30 A;  4J8X D;  3KWQ C;  4YS3 A;  5FQ9 A;  1KDW A;  3IWO A;  5BOH A;  3AV2 C;  2G5I C;  4S2O A;  3LEL D;  2NZD C;  5FUG A;  4P0M A;  4WZS B;  5B2J C;  3LCE A;  3M2K A;  3L27 A;  1TZY A;  3GQZ A;  1BFM A;  2FJ7 D;  1U35 A;  1IYP A;  5B0Z C;  2HDQ A;  3A3I A;  3AZM D;  3AFA C;  1ULY A;  4CSR A;  1YLT A;  3WWX A;  1L2S A;  4MBF A;  4U3T A;  5JRG A;  4ZBJ C;  1YLJ A;  1NRF A;  1M18 B;  4LCL A;  3PTE A;  4NE6 A;  1P3L B;  1BLC A;  4Z5T D;  2XQZ A;  3KS8 A;  3LJA B;  3WTP C;  3VH5 A;  4E6W A;  3PBQ A;  3OPL A;  5CTN A;  1AOI C;  3MGP C;  5FQM A;  4YS3 C;  5CP6 A;  3Q7Z A;  3N3F A;  5HW3 A;  4DRA A;  1FCM A;  4XUJ D;  2XH9 A;  3O3V A;  4WNN B;  3MZE A;  3LZ1 A;  3MNN B;  3W99 B;  5FQJ A;  1K6R A;  5CEC A;  1U35 C;  2E8I A;  2FFY A;  1JWP A;  3VP3 A;  1M18 A;  3NC8 A;  1P3L A;  3REL D;  4X23 D;  5BS7 A;  3H0M C;  5JRG C;  4J8W B;  1ID3 D;  5GXQ D;  4NET A;  1E4D A;  1LHY A;  4WZ5 A;  4CJN A;  4S2J A;  4P85 A;  4WV4 B;  3UE3 A;  3B6F D;  1E25 A;  2XD5 A;  3IH8 A;  5AVC D;  3W98 A;  1P3K B;  4N9K A;  2EXA A;  3VFF A;  1XX2 A;  3AGF A;  5B33 D;  3W99 A;  4X53 A;  1ZC2 A;  5CP6 C;  3LY4 A;  1ES5 A;  1ZLA B;  4P6B A;  5AV9 A;  3N8S A;  4BEN A;  4MNR A;  3LZ1 C;  1YQS A;  3A1I A;  4DDS A;  4IBF A;  2JE5 A;  1S32 D;  4PPR A;  2Y2N A;  1M18 C;  4IBR A;  4DXB A;  1P3L C;  3N4I A;  2EFU A;  3SS4 A;  1F66 B;  1QMF A;  3Q1F A;  5BS7 C;  4LD9 D;  4IED A;  5B24 A;  1P3K A;  4MLL A;  4X68 A;  4IBG A;  2C5W B;  3WKJ B;  4JF5 A;  2PBY A;  3AZI B;  4UAA A;  4QHC A;  4WZ5 C;  4LV1 A;  5DNN A;  3C1B D;  1YU1 A;  4HES A;  3W98 C;  4S2N A;  2VGK A;  3FZC A;  1XGJ A;  3WX7 A;  2ARO D;  5CPK B;  5AV9 C;  2ZQ9 A;  1ERQ A;  4S2L A;  3UO9 A;  1F66 A;  3G32 A;  4OQG A;  4UPK A;  5GHX A;  4BJP A;  2IWD A;  3KWQ D;  3O86 A;  2ZY5 A;  1KDS A;  1IYO A;  4KQO A;  4BLM A;  3ZVW A;  1ERO A;  4ZUX C;  2Y2L A;  1IEL A;  5B1M B;  2NZD D;  4Y0U A;  5CGX A;  1Q2P A;  5B24 C;  3H0L C;  3MGS B;  1P3K C;  4JF4 A;  2CWE A;  2Y55 A;  4Q8I A;  4EV4 A;  3BM6 A;  4JJN D;  5DNN C;  3I7J A;  4E3I A;  2PYO B;  3AFA D;  1ES2 A;  4WU8 B;  1PW8 A;  4S2N C;  2Q9N A;  2JSS A;  1K4E A;  1W8Q A;  1F66 C;  4N1X A;  4FH2 A;  3WTP D;  2OLU A;  5B1M A;  1KGG A;  4J8U B;  3B0C T;  3LO7 A;  2WAD A;  4JXW A;  4YS3 D;  3KUY B;  2GDN A;  4F94 A;  1BUL A;  4LV3 A;  1TZY D;  4R4S A;  1U35 D;  3VH6 T;  3GMW A;  4UA7 A;  1MKI A;  2WGW A;  2G2U A;  2BYK A;  3REK B;  1GHI A;  3N8R A;  3AV1 A;  5AQ9 A;  2XR0 A;  1NYM A;  3OZH A;  5JRG D;  4WEL A;  4GZB A;  1I2S A;  1YLZ A;  3W97 B;  2XD1 A;  4JBF A;  3VP0 A;  2Y91 A;  3KUY A;  3G34 A;  2ZC4 B;  3NIA A;  5KMW A;  1Q2Q A;  5B1M C;  4UA9 A;  4WEJ A;  4MBK A;  5CHU A;  4Y7P A;  3V3R A;  4Z66 B;  5FQQ A;  3W96 B;  5CP6 D;  5M18 A;  3CJM A;  3FKV A;  4OQH A;  4MEZ A;  4OPY A;  4WMC A;  2ZY4 A;  4OJL A;  3C7U A;  5HAP A;  3V5M A;  3MVD A;  2VGJ A;  4KUD B;  3W97 A;  1PZO A;  1M18 D;  2XF3 A;  2ZLY A;  3HBR A;  1P3L D;  3AV1 C;  3LJA D;  3O62 A;  3AZM B;  1EWZ A;  1ONG A;  4HGA B;  3W96 A;  3EPL A;  4IJF A;  2Y59 A;  4JXS A;  4GDN A;  3AZE B;  1JFI B;  3W98 D;  5AV6 C;  3B0D C;  1KGE A;  3X1V B;  3W99 D;  4WEK A;  3VH6 W;  4OVD A;  1YMS A;  4XZQ A;  5F99 B;  3MVD C;  3N8L A;  2HIO B;  4H9O B;  3BFG A;  3B6G A;  3REJ B;  1YLP A;  4J8W D;  3IWQ A;  1K54 A;  2ZQ7 A;  3WS1 A;  3O62 C;  4E44 A;  3UT9 B;  3VSK A;  3X1S B;  3AZE A;  5B24 D;  4XUZ A;  1JFI A;  1P3K D;  4L0L A;  3W96 C;  3EPK A;  5B0Y A;  4OPQ A;  4WU9 A;  5M1A A;  3UTA A;  4LV0 A;  3HLE A;  5F99 A;  3ZG8 B;  1Z2C B;  3REJ A;  1KE3 A;  2Y2O A;  5AVC B;  3IHB A;  4JXV A;  3AZL B;  1F66 D;  4XZQ C;  4EQI A;  3DWZ A;  3B6G C;  1K25 A;  1K54 C;  4HGA C;  3VH5 W;  4S2M A;  3G2Y A;  3WKJ D;  3AZI D;  5EVI B;  1K56 A;  3NQU A;  3A3J A;  3QNB A;  2ZC5 B;  3AZE C;  4KQR A;  3UNW A;  1YU4 A;  5F1F A;  3ZVT A;  5B0Y C;  3RXW A;  4YIN A;  4WU9 C;  4JF6 A;  3UTA C;  4E6X A;  1KX5 A;  5CER A;  3RJU A;  3AZL A;  3C7V A;  5F99 C;  3C1B B;  3WAA A;  3REJ C;  5FQI A;  2NQB A;  4DF6 A;  2ZC7 A;  3N7W A;  3IHA A;  5EVI A;  5GHZ A;  3ZDJ A;  5B1M D;  5BO0 B;  2ARO B;  2ZC6 B;  1P3F A;  3MGS D;  3LZ0 B;  3HLC A;  3WRZ A;  3HRE A;  3IXG A;  4OUI A;  3KWQ B;  2PYO D;  3PBT A;  2JBF A;  5BNV B;  3AV2 B;  3M6B A;  1FR1 A;  2NZD B;  3RXX A;  5B2J B;  2V1Z A;  4QB8 A;  4E3O A;  4C3Q A;  3A3F A;  2BYM B;  1W79 A;  1MWS A;  1SDN A;  1KX5 C;  5E43 A;  1NYY A;  1DJB A;  1XPB A;  3R45 B;  5B0Z B;  1BTL A;  3AV1 D;  4NZ1 A;  5BO0 A;  3WAA C;  1NZU A;  3AZJ A;  5BT1 C;  3SH9 A;  3LZ0 A;  2NQB C;  1K55 A;  1ESI A;  1GHM A;  5B2I C;  3KUY D;  5DVA A;  4ZBJ B;  5EVI C;  3UY6 A;  3KS4 A;  3VP4 A;  4RA7 A;  3WS4 A;  5BNV A;  1NXY A;  1P3F C;  3TSG A;  5EEC A;  3WTP B;  4NK3 A;  4GKU A;  1AOI B;  1N1J B;  3MGP B;  4UHU A;  4YS3 B;  1HVB A;  3REK D;  2EX9 A;  1KX3 C;  3MKE A;  4WMC D;  3MVD D;  3NDE A;  4KZ5 A;  3W97 D;  1GA9 A;  3WS0 A;  3WS2 A;  3O62 D;  2V2F F;  3AZJ C;  3BEB A;  4CSR B;  1TAF A;  1MBL A;  5AY8 A;  1PWG A;  2HP5 A;  4ZDX A;  3LZ0 C;  1GHP A;  1K55 C;  3C1C B;  3W96 D;  1LI9 A;  4OON A;  3VOZ A;  3D4F A;  3MGP A;  1P3M B;  1Z6F A;  1K4F A;  2WKE A;  3H0R C;  3NCK A;  1G68 A;  4J8V A;  1C3B A;  1YU0 A;  4NFT A;  4KUD D;  1XA1 A;  5EOE A;  3ITB A;  5CP6 B;  5EPH A;  4XZQ D;  4OPR A;  4OLG A;  3B6G D;  5DTT A;  3LZ1 B;  3C4P A;  3C1C A;  2DCF A;  4OJO A;  2HUE C;  1P3M A;  4JXG A;  4ZTK A;  3AZE D;  5AY8 C;  2HDU A;  3X1V D;  1F1E A;  4WU9 D;  5AQ7 A;  3UTA D;  4S2P A;  2H0Y A;  4N9L A;  5DF7 A;  4J8V C;  4KG6 A;  5F99 D;  2HIO D;  3W4Q A;  3REJ D;  3ZNY A;  1H3O B;  5CPI A;  3W98 B;  4DE3 A;  1Q9C A;  4UUZ A;  2ZQD A;  1M19 A;  1KE0 A;  4GD6 A;  3HLF A;  3GRJ A;  5AV9 B;  3UT9 D;  4WJ3 C;  5GSU C;  4R1G A;  3X1S D;  4K0X A;  4BQM A;  3BEC A;  5C3I C;  1FQG A;  3C1C C;  3JYI A;  3A3D A;  4UA6 A;  1TVF A;  4ZJ1 A;  2PU4 A;  1P3M C;  1K56 D;  3PBR A;  2ZC3 B;  5GLC A;  4S2K A;  4ZUX B;  1IYS A;  1LL5 A;  1H3O A;  5B24 B;  3S22 A;  5HAQ A;  1KX5 D;  5FAO A;  1FOF A;  3Q7V A;  3AZL D;  5B1L A;  5DNN B;  3NY4 A;  4Y0O A;  5BT1 D;  1GA0 A;  5CPI C;  5DTK A;  1YU2 A;  1P3I B;  1M19 C;  4XXR A;  4H9P A;  5EVI D;  1ONH A;  2Y4A A;  2I72 A;  3GVB A;  4MBH A;  3MGR B;  1ESU A;  3OCL A;  2F8N A;  3PAG A;  4AWL B;  1P3F D;  4ZUX A;  3FWL A;  2Y2K A;  5DTS A;  3IP4 C;  4PM7 A;  1PZP A;  3X1U A;  5G18 A;  3BFE A;  2Z2M B;  4KEN B;  2IOU A;  2ZQ8 A;  4BL3 A;  1PZR A;  4E45 A;  4Z2M G;  2JCH A;  1P3I A;  4GHL A;  2A49 A;  2F8N G;  5B1L C;  1XA7 A;  4OP8 A;  3VOY A;  4Z9Q A;  5L2F A;  3MGR A;  3C4O A;  3LZ0 D;  4X55 A;  3OPP A;  4QLC C;  5A92 A;  1M1A A;  4KZ9 A;  1BLP A;  1Y54 A;  1XP4 A;  3WA9 B;  3ZNT A;  3AV2 D;  4RYE A;  1L0D A;  1LI0 A;  1MWU A;  5B2J D;  3X1U C;  5E5A B;  2Y2I A;  1S0W A;  3IXD A;  3A6N C;  1P3A A;  5CHJ A;  5B0Z D;  2ZM0 A;  1MY8 A;  5U47 A;  3IQA A;  2HPB A;  4B88 A;  1P3I C;  1FCO A;  4R3B A;  2WGW B;  4KHA A;  3WA9 A;  2BYK B;  4WBG A;  1KU5 A;  5D3O A;  4OLD A;  3MGR C;  3P09 A;  4AWL C;  3AV1 B;  3IF6 B;  1L0F A;  2VQR A;  4BD0 A;  3IXH A;  1AOI D;  3MGP D;  3BLS A;  5E5A A;  3BYD A;  1M1A C;  1W8Y A;  3GR2 A;  5FI7 A;  4FD8 A;  3AZG A;  5G49 A;  4IBJ A;  4J8V D;  3EQV A;  2Z2L B;  1MPL A;  3ZG9 B;  4KZ6 A;  5IHV A;  3Q82 A;  4NYY A;  3WS5 A;  5AV6 B;  3B0D B;  5JA4 B;  4ZJ3 A;  4GH9 A;  1P3A C;  2EX2 A;  5CXW A;  1M6K A;  4U0X A;  4EO5 C;  4NE5 A;  3O88 A;  2XFS A;  3CG5 A;  3IF6 A;  3MVD B;  3HLD A;  3PBO A;  3HSH A;  3C1C D;  3KXB A;  2P9V A;  1P3B A;  1EI5 A;  1P3M D;  1JVJ A;  2Y2H A;  3WA9 C;  3UPP A;  5AVB B;  1P3G A;  3TU4 B;  4S2I A;  4KZ8 A;  3O62 B;  1CI9 A;  2QPN A;  5E5A C;  5AV6 A;  5JA4 A;  3AZG C;  1E3U A;  5HAR A;  1XXM A;  1YT4 A;  3AZK B;  1FSY A;  3LZ1 D;  5CPI D;  5GHY A;  5B31 A;  1M19 D;  5GT0 A;  1ALQ A;  4E3J A;  5CTM A;  2IWB A;  2Q9M A;  3KFU G;  1VM1 A;  4HBT A;  4B4Z A;  5AVB A;  1K6S A;  3TU4 A;  1XGI A;  4XZQ B;  3IF6 C;  3KXB C;  3B6G B;  3VH5 T;  1P3B C;  1RGZ A;  4M3K A;  1KX4 B;  5CEB A;  4JKT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...