2Y2HA

Penicillin-binding protein 1b (pbp-1b) in complex with an alkyl boronate (za2)
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
487
structure length
467
Chain Sequence
b'SEITYSDGTVIASIDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTGQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PENICILLIN-BINDING PROTEIN 1B
publication title Structure-Guided Design of Cell Wall Biosynthesis Inhibitors that Overcome Beta-Lactam Resistance in Staphylococcus Aureus (Mrsa).
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
total genus 159
structure length 467
sequence length 487
chains with identical sequence B
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2y2hA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2y2hA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2y2hA02
3FZCA 3E2LA 1JTDA 4KZBA 1HVBA 5F83A 1KE3A 5CERA 4KQRA 4E3NA 1SDEA 4OONA 2Y59A 2ZM0A 1LI0A 4PM9A 3SS5A 4B4ZA 1CI8A 3MXSA 3NCKA 2ZC3B 1YMXA 1BULA 1G68A 2ZC4B 3ISGA 3LY4A 2ZQCA 4C3QA 2P9VA 3IF6A 4DDYA 2HDRA 3OPHA 5A92A 5JYPA 1ESIA 1ZKJA 1MWSA 1KDSA 3BRMA 4EV4A 1XGJA 3C7VA 4JF4A 2Y2MA 5CEBA 3AGDA 3HREA 4QJGA 4JPMA 3G34A 3C4PA 3GQZA 3WRZA 4QD4A 2JCHA 4BL3A 3IXHA 1KGFA 3DWZA 3TG9A 2C6WB 1FCOA 3HLFA 4ZTKA 3V39A 4JXGA 2PU2A 5GHYA 3PBTA 1K54A 1PW8A 4RVAA 2OSUA 5HAIA 1IYPA 5F1FA 5E2HA 3FWLA 2DRWA 5DF7A 5FI7A 5KMWA 1GA0A 5A91A 1QMEA 1FCNA 3P09A 1YQSA 4OLGA 5EUAA 4DE3A 3ZVWA 2ZQ8A 1NZOA 1FSYA 3BLMA 3HLDA 4OQIA 4OPRA 4PM6A 5GHZA 5TGFA 3IXDA 3WS4A 1CEFA 1XGIA 4FD8A 1Y54A 3A3IA 5FSRA 3Q1FA 3O87A 3M6HA 3EQUA 5CTNA 5D3OA 2Y2NA 1ZG6A 5CHMA 5GLAA 1K57A 1W8QA 1MWTA 3MZFA 4JXWA 4UA7A 4BLMA 4WZ4A 3ZG9B 4U0TA 4DKIA 1SCWA 3BFEA 1MPLA 1EROA 1L0GA 4EBLA 4X56A 3CJMA 5F82A 1K4EA 1YLWA 5L2FA 5HX9A 3Q07A 1KDWA 1L0EA 3A3JA 1PW1A 2EXAA 3JYIA 3FKVA 4OQGA 2WKEA 4M3KA 1W7FA 3HLBA 3MKFA 1OMEA 2XEPA 4DE1A 4MNRA 3HLWA 3HL9A 1K56A 1L0DA 3VSKA 4RX2A 3ITBA 4OOYA 3G2ZA 3AGEA 1HTZA 3OC2A 4JLFA 3NIAA 4Y0OA 4LV3A 3ZHHA 5FAQA 5HFOA 4OP5A 2FFFB 5CGWA 2JBFA 2EFXA 3WS0A 4LCMA 4P0MA 5EOOA 2ZC7A 3UO9A 3VP3A 2RL3A 2BG1A 4PM7A 4QHCA 3IWQA 1BZAA 3LEZA 1IELA 4B4XA 1DJBA 3C4OA 1ERMA 5AQBA 3ZCZA 4P85A 4OOLA 1ES3A 2WADA 4WZ5A 5M1AA 5EVIC 2Y2IA 1YT4A 3DTMA 5DF9A 1IEMA 1KE4A 4RYEA 3V3RA 3SH9A 1BSGA 2IWCA 5HW3A 2ZD8A 3PBSA 2Y4AA 1I2SA 3N4IA 2ZC5B 4DDSA 2Y2QA 1PZPA 1KGEA 2RCXA 4EUZA 2PBYA 1XA7A 1W79A 3HLEA 1ERQA 3VP1A 4N1HA 3HUMA 4DE0A 5KSCA 3OPRA 3ZFZA 1U60A 2ZQ9A 2HDQA 3C7UA 2A3UA 4WMCA 3V50A 3EQVA 2HP5A 2Q9MA 4OOMA 2WAFA 2XFSA 4PMAA 4BJPA 3VP0A 1C3BA 1YLPA 3O3VA 1K55C 3IXGA 4IBRA 2WZXA 3IWIA 1CEGA 2H0YA 4FCFA 1EI5A 2XF3A 2XDMA 3SOIA 4R23A 3A3FA 3VP4A 3UPPA 1VQQA 5AQAA 4F94A 4OPYA 4DRTA 4WBGA 3PBQA 4ZBEA 4L0LA 4E3KA 5FQIA 4EWFA 2Y55A 3PBOA 4QY5A 3IF6C 4S2JA 1PWDA 5CGSA 3RXWA 1FR6A 1JWPA 3LCEA 1IYOA 3IT9A 1GHMA 1YLTA 2J7VA 4QB8A 3Q7VA 1NRFA 4HBUA 2IWDA 4E3IA 1SKFA 3ZVTA 3Q81A 1JWVA 4U0XA 2XFTA 2ZJ9A 1FR1A 1NY0A 3W4OA 5CGXA 3MFDA 1Q2PA 3TSGA 5A93A 3UE1A 3ZG7B 2G2WA 4FSFA 2WK0A 2HP9A 5E43A 5CEDA 2WGWA 3OZHA 5HAQA 4RA7A 2XLNA 1KGGA 3ZG8B 1XKZA 3N8SA 2H5SA 3UNWA 1NYYA 3PAEA 3IHBA 5IHVA 2C5WB 1Z6FA 4K91A 4OPQA 4PPRA 1N4OA 4R4RA 3WWXA 4KENB 1WE4A 4WMCD 5FI6A 3A3DA 4GN2A 1RGYA 4LCLA 5EVID 5GL9A 2FFYA 1K57C 3NY4A 5CECA 2Z2LB 2Y2HA 3FV7A 5U47A 3RJUA 2XR0A 4S2OA 3BFGA 4ZJ2A 4E3OA 4ZJ1A 4UHUA 1DJCA 2HDSA 2Y2GA 4KZ8A 4N9LA 4S2LA 1GHPA 1YM1A 3SH7A 1LL5A 3ITAA 4IVIA 2UWXA 3ZNYA 2Y2KA 1K6RA 2J8YA 4XUZA 4S2IA 1RP5A 4WELA 1BLPA 4PM8A 1JVJA 1DJAA 1E3UD 4UA6A 5M19A 3OCLA 2OLVA 3HVFA 4N1XA 3GRJA 4XUXA 5GHXA 1GHIA 2HPBA 4EBPA 1WYBA 3UDFA 1PWCA 3UY6A 1MY8A 1TVFA 4R3JA 4NK3A 1O7EA 2IWBA 2WYXA 2BLSA 2I72A 5KSHA 4JXSA 4LENA 3BFFA 2DNSA 3QNCA 1BLHA 5EVIB 2ZC6B 3CMZA 4FH2A 4NETA 3O88A 1XPBA 3HLGA 4C75A 2ZQ7A 3OPLA 4HEFA 1MXOA 4E3LA 2E8IA 3BFCA 3SS3A 3V5MA 4Y0TA 5DTKA 4R1GA 4WZ5C 2WAEA 4O7DA 3HLCA 3W8KA 1W8YA 4GDNA 3PBRA 4OQHA 3GR2A 5FQQA 4S2MA 4A5RA 1MKIA 2R9WA 1N9BA 5HARA 5AQ7A 3G35A 3BFDA 1L2SA 3QHYA 1BUEA 1HZOA 4S2KA 1WYCA 3IH8A 3LO7A 5DVAA 3G31A 3BYDA 3WS1A 5CRFA 2HP6A 2EX9A 1FOFA 1BT5A 1FQGA 1RCJA 4P6BA 2OV5A 1ONGA 1M6KA 2Y2LA 3N8RA 4MBKA 3UN7A 3BEBA 1BTLA 4N9KA 4KG2A 3NDEA 4BQMA 1E4DA 5FDHA 3AGFA 5GLCA 5M18A 3ZG5A 4KZ9A 4EQIA 3OCNA 3ZNTA 2V2FF 2Y91A 4E3JA 5E2FA 1PYYA 2WZZA 5DF8A 4MBFA 4QY6A 4GOGA 3UE3A 5JYOA 4S2NC 2EX6A 5EVIA 4CJNA 4HBTA 5FQ9A 3WS2A 4ZAMA 2P9VB 3IF6B 1NXYA 1ONHA 3CZDA 1W5DA 4GDBA 1IKGA 3WRTA 4WEJA 1KVMA 4OP8A 1K25A 4KZ7A 3VOYA 4EBNA 1AXBA 3V3SA 1M40A 4JKTA 4KZ3A 4JXVA 1PI5A 1IYQA 1K6SA 2XH9A 5CHUA 4S2PA 1XP4A 3N6IA 1E3UA 3MBZA 1KVLA 4WEKA 3UDXA 3HBRA 4OVDA 3IWOA 3IHAA 5HAPA 3G32A 4Y7PA 4GD8A 2ZQDA 3NBLA 1K55A 4Q8IA 1IYSA 1QMFA 4E6XA 5J8XA 1ZC2A 1Q2QA 2WGVA 1I5QA 3IH9A 4WYYA 4GB7A 1DY6A 1BLSA 3S22A 5EE8A 1TEMA 4CPKA 3M2JA 4JBFA 2VGKA 3I7JA 5FQJA 3UPOA 4DXBA 1K54C 2DCFA 5FA7A 3MKEA 2P74A 1LHYA 2A49A 2Q9NA 1YMSA 1NJ4A 3C5AA 4GKUA 4BENA 1PZOA 2XGNA 3ZGAB 3VFFA 1LLBA 3OPPA 4X53A 4ZDXA 1PI4A 3M6BA 5FAPA 1RGZA 4K0XA 2ZM8A 1ES5A 2X02A 3SS4A 1H8YA 1IKIA 1EWZA 1ES4A 3QNBA 1S0WA 2WKHA 4B88A 1SDNA 4KZ6A 1ZG4A 5EECA 4GD6A 3IQAA 4KG5A 5CXWA 3IXBA 3MZEA 4DF6A 1GCEA 5TR7A 2WKIA 3M2KA 1S6RA 2ZM2A 5DTSA 2JC7A 5EPHA 5GLBA 3UDIA 2ZLYA 4UAAA 4H8RA 4X68A 5TFQA 2EX8A 3FYZA 3DWKA 3W4QA 1YLYA 5CTMA 1YLZA 3HUOA 3VMAA 2VGJA 1MWUA 4DXCA 5FQMA 4OLDA 2XK1A 4Y0UA 3VFHA 1O07A 2J9PA 2EXBA 3ZDJA 2XD1A 3E2KA 5FASA 4MEZA 1FCMA 3PBNA 2Y2PA 3N7WA 2PU4A 3GTCA 1E25A 4BL2A 3PAGA 4X6TA 4GZBA 1H5XA 4IVKA 4K0WA 3GMWA 1I2WA 1NYMA 1K4FA 4D2OA 3GSGA 4E3MA 4BD1A 3WS5A 4FH4A 1KE0A 1NZUA 1FSWA 3B3XA 3NI9A 2GDNA 2QMIA 3IF5A 2EFUA 4RX3A 2HDUA 3A3EA 3UPNA 1PWGA 4ZJ3A 3BLSA 1ALQA 1ES2A 1MWRA 3FKWA 3MXRA 3S1YA 5FATA 2OLUA 5DTTA 2H10A 4XXRA 3Q82A 4IBXA 2Y2JA 2B5RA 4JF5A 4KQOA 2Y2OA 4KQQA 4OPZA 5AQ9A 1GA9A 3G30A 4R4SA 1LI9A 2CC1A 3D4FA 4MLLA 4YINA 1SHVA 3TOIA 5E2GA 3SH8A 1K38A 3GVBA 4JF6A 3S4XA 3VOZA 1XX2A 3PTEA 3P98A 4E6WA 4UA9A 4IEDA 4KZAA 3VP2A 4R0QA 2QZ6A 5GLDA 5FQKA 3BM6A 1L0FA 4OH0A 3W4PA 1H8ZA 1MBLA 1TDGA 4N92A 3ZG0A 4QU3A 5EOEA 4GNUA 2XD5A 1BLCA 3Q7ZA 5EVLA 4KZ5A 2J9OA 1J9MA 4OKPA 4LV2A 2V20A 4R3BA 4BD0A 5HL1A 4OQ0A 2X71A 5KZHA 2H0TA 3NC8A 1VM1A 2ZQAA 3CG5A 4Z9QA 4LV0A 5I94A 1HD8A 3NDGA 3UE0A 1PIOA 1CK3A 3Q7VB 1XXMA 5BOHA 3MZDA 2X01A 2ZMAA 3BECA 4KZ4A 4ID4A 1CI9A 5A90A 1TDLA 3HUNA 2Z2MB 2WGIA 4WM9A 2XQZA 3GV9A 5FI2A 4KG6A 5G18A 5E2EA 4U3TA 4X55A 4DE2A 1JTGA 2G2UA 1XA1A 3G4PA 3N8LA 1G6AA 4X69A 4C6YA 2V1ZA 3G2YA 3O86A 2WGWB 4MBHA 1ESUA 3VSLA 2R9XA 5FAOA 2WUQA 4YFMA 4PM5A 5CHJA 3RXXA 4LV1A 5F1GA 4S2NA 2QPNA 4HESA 1YLJA 2EX2A 1LL9A 3LY3A 1JWZA 4P87A 3DW0A 2JE5A 1K56D
chains in the Genus database with same CATH superfamily
3FZCA 3CITA 1HVBA 2XSSA 1P3GC 4X25A 2ACGA 2Y59A 3SS5A 4B4ZA 1OJGA 1CI8A 3WX7A 3MGSC 5AV6D 4WUJA 1TAFB 1MWSA 2CMNA 3UT9D 1XGJA 4Z5TB 4QJGA 3G34A 3UTAD 5GSUA 2QYBA 2JCHA 4NFTA 4QD4A 5AY8A 3FC7A 3IXHA 3AV1A 3DWZA 3HLFA 2VK3A 4JXGA 2PU2A 2XA7M 3PBTA 1ULYA 4EERA 2OSUA 5CP6C 4KQDA 3FWLA 2DRWA 4J8VC 3TJZC 3W96B 1GA0A 2QJ7A 1QMEA 4OLGA 3P5JB 2ZQ8A 1NZOA 1FSYA 4EETB 4GS9A 4FD8A 3A3IA 3WAAD 5AVCB 3EPLA 3B6FA 4UA7A 2VGLS 3ZG9B 5HDCA 2JKTI 3X1SB 4Z2IA 5B0YA 4CSRB 5HSQA 4EBLA 4X56A 5F82A 1YLWA 3AZLD 3Q07A 4XUJD 1PW1A 2UV0E 2WKEA 1W7FA 3HLBA 1OMEA 1AOIC 4IJEA 2Y8HA 3W99B 1L0DA 4RQ9A 5B2ID 3MQ0A 3KWQA 4Y0OA 5HFOA 4LRXC 4OP5A 3B0BA 4J8UC 2AROB 4DRBA 3WS0A 4P0MA 3O62B 3X1VB 4Y3IA 2BG1A 3H7WB 1K0KA 3BY9A 3UT9A 5B31C 4FUWA 1Z2CB 4P85A 3UTAA 2WADA 5M1AA 3LZ0D 4BMWA 5DF9A 1L6JA 4RYEA 3V3RA 5CPID 3C1BC 2O9BA 3PBSA 3T1RA 2NUTC 2Y2QA 3B0CT 2NQBD 2RCXA 3LJAA 1P3PB 3VE3A 1S32D 5F99B 4LRYC 4N1HA 1ZHHB 4DE0A 5KSCA 3OPRA 4MN6A 2A3UA 3V50A 1UR9A 3GECA 2HIOC 4NG2A 4PMAA 2BASA 2V0WA 3WAAA 3IXGA 4IBRA 1CEGA 1EI5A 2XDMA 3VP4A 2PYOC 5BT1C 5B1MC 3P7NA 1VETB 2CWEA 5AQAA 4F94A 3PBQA 3AZLA 4L0LA 4XUJA 1P3KD 4EWFA 3LIAA 4OJLA 2ZY4A 3PBOA 4QY5A 1GSVA 4X1MA 3F1OA 3LCEA 3V9RB 1GHMA 1YPRA 1M1AD 4HBUA 5B2IA 2NZDD 4IBCA 3ZVTA 4U0XA 2ZJ9A 1FR1A 1KX5C 1NY0A 1OTIA 5CGXA 3T4JA 3ZG7B 4F3LA 4LLOB 2LB9A 4R3AA 1PNEA 4RA7A 3M7PA 2XLNA 1KGGA 1NYYA 2GX5A 4BBTA 3WTPE 3REJD 5AJGA 5IHVA 3RTYA 4LPZA 3H82A 5B1LC 2DMWA 5IS1A 4WMCD 3A3DA 3QP2A 2NQBA 1RGYA 4LCLA 1K57C 5CPJB 5B32C 2HJ9C 4H6JA 3D3OA 5U47A 3RJUA 4NKPA 1EQZD 4UHUA 4J8WD 4KUDC 1DJCA 1N9NA 2Y2GA 3MJQA 1TD5A 3SH7A 4IVIA 5AV5C 1P3LB 5IU1A 5A8BA 1J7MA 4HMEA 4LG2A 5HWTA 2KX6A 3LZ1C 1TS6A 3AZJA 3T12B 1E3UD 2B02A 5B0ZD 4XZQD 3IBRA 2HF6A 3WD0A 1H8MA 3OCLA 1H3OA 3OOVA 4N1XA 1CJFA 3UDFA 1PWCA 1TVFA 4NK3A 1O7EA 1P3KA 2BLSA 1TS7A 4LENA 3BFFA 1W2EA 1P3IB 1ZLAB 4NETA 3O88A 1XPBA 4WL9A 3OPLA 3IX8A 2F8ND 3F6TA 2PDRA 3V5MA 1P3GD 2NZDA 3K3CA 3A1IA 2R78A 2ZOIA 4ZUXC 4OQHA 3C38A 3GR2A 3MGSD 4L9EA 3LFVA 5AQ7A 3BFDA 1L2SA 3MQOA 1BUEA 2W1RA 3MS6A 3W97C 4IBKA 2F8NH 5JRGB 5CRFA 2EX9A 1FOFA 3REJA 2JKRI 4Y2FA 3O5YA 4KG2A 5KIZA 4ETZA 2PYRA 4Z2KA 3TU4C 5AV9A 3ZNTA 5F6AA 2V2FF 4KHAA 1OGBA 4H9QB 3L9KA 4S2NC 2EX6A 1A7WA 4J8VD 3MQQA 5FQ9A 4ZAMA 3WS2A 3K3DA 3MF0A 5EFWA 3MQLA 4GDBA 1IKGA 4Z2LA 4WEJA 3U4LP 1KVMA 4OP8A 2ZL1A 2FJ7D 3LICA 3V3SA 3REHA 1M19A 1ACFA 4OJ5A 3V67A 4JKTA 3TRCA 4BBVA 4IUKA 5CHUA 5AY8B 1XP4A 2W3EA 3N6IA 1E3UA 3HBRA 3REIB 3G32A 2D02A 4Y7PA 3NBLA 1K55A 4Q8IA 1DP6A 1IYSA 5GSUC 5J8XA 1ZC2A 1Q2QA 2WGVA 3QP8A 1AOID 1H0GA 3S22A 1TEMA 2F8NG 2F8NA 1BFMA 4CPKA 1UGUA 2VGKA 1P3GA 4CQHA 4GS9B 2DCFA 3A0SA 3MKEA 4CLCA 1S4RA 2A49A 3UB9A 4H9OA 4J8UD 4UEYA 1NJ4A 4GKUA 4BENA 3A6NA 5BO0B 1T19A 3OPPA 4X53A 4ZDXA 3IX4A 5FAPA 4EQ1A 4WU8B 2ZM8A 1EWZA 3QNBA 5B31D 5MC7A 2W3HA 3NULA 4GD6A 4KG5A 5GXQD 3JVUA 1HQ3B 5TR7A 3T4TA 4JGOA 1HLUP 5DTSA 4LGWA 3C1BD 4IJGA 5B0YC 2GNXA 5EPHA 1P9WA 5GLBA 2ZLYA 5TFQA 2EX8A 3FYZA 3AZMD 3DWKA 3W4QA 1MWUA 3VFHA 4J8VA 2XD1A 5AV6B 2Y2PA 3N7WA 3RELC 3KWQC 2HIOD 4H9NB 4CAYA 2FJ7A 2HV1A 3PAGA 3MGRA 1H5XA 3MXQA 2HUEC 2PBDP 4E3MA 1DRMA 4BD1A 4FH4A 2FH5A 2PYOD 2GDNA 2QMIA 3WTPB 5BT1D 4HJ6A 5B1MD 3MVDB 4EESA 4NYUA 3LR3A 1ES2A 1MWRA 2B18A 4J8XB 2V1AA 2Y2JA 2B5RA 4KQOA 2A24B 4IBJA 4R4SA 1S4SA 5G49A 2CC1A 4YINA 2VKSA 3AV2C 3TOIA 3W98D 4G92C 1XX2A 3P98A 1M18B 4E6WA 4UA9A 2K7SA 2V1BA 3LJAC 4KZAA 4R0QA 4IBIA 5GLDA 1KX5D 4J8UA 3BM6A 1L0FA 2O9CA 2P08A 3W4PA 1PZRA 3REKC 1TDGA 1U35C 1XJ3A 5C3IB 3CWFA 2NUPC 4GNUA 1BLCA 3Q7ZA 5B31G 5B31A 4XUJB 1JFIA 4LV2A 2V20A 1YKDA 1E6PA 5GXQA 4ZRRA 4KGCA 3A1KA 5KZHA 1KOUA 1MC0A 4Z9QA 5B1LD 5J3WA 3KXBB 3C1BA 3F1PB 1CK3A 1XXMA 5B2IB 4HI4A 3AZED 2GZAA 4YS3C 4I3JA 3AZLC 3AZMA 5B40D 1ZTUA 1IOUA 3KSFA 3GV9A 5B32D 5B33A 1P3FC 4LD9C 3N3FA 3UTBB 1MZUA 4ME4A 1JTGA 4KUDD 4MBHA 1ESUA 3VSLA 1LSWA 4XT2A 2HIOA 5AV5D 5F1GA 2QPNA 4HESA 1YLJA 4EO5B 4QPRA 3LY3A 3D9YA 3LZ0B 3LZ1D 5HD5A 1K56D 3E2LA 5CPIB 5B1MA 5CERA 2NQBB 4E3NA 2ZY3A 4OONA 1S32B 3KUYC 1BULA 2ZC4B 3LY4A 3OPHA 5A92A 3AFAA 5JYPA 4NZ1A 3CLOA 1ZKJA 4IJFA 3B0DB 3NQUA 3BRMA 3W98A 3KYZA 3HREA 4Y13A 4G3VA 3G6OA 1GSWA 3C4PA 4UQIS 4ZUXD 3GQZA 1BH8A 3WD3A 1KGFA 2C6WB 4BWIA 1FCOA 4GHIA 1ID3D 2PHYA 5GHYA 3W97D 1IYPA 4YNRA 1P3KB 1KU5A 5TBMB 3AZKB 5KMWA 3AZGC 3AZJC 3P09A 3R7WB 3TU4D 4DE3A 3ZVWA 2D49A 1M1AB 1WWSA 2NZDB 3WA9A 3BLMA 4OQIA 4OPRA 5GHZA 3VV4A 3SW1A 3AZEA 2G5IC 1XFNA 1Y54A 5B40A 5D3OA 1ZG6A 5CHMA 4X23D 4H9PA 4IBFA 5B32G 5B32A 1K57A 1MWTA 1W8QA 3MZFA 4BLMA 2JSSA 4AWLB 3C30A 1BH9B 4DKIA 3C1CC 1OGGA 1MPLA 3BFEA 1EROA 2INWA 5E5AD 5AV5A 1KDWA 2EXAA 4Z66C 4M3KA 4QWOA 1YU0A 4YM6C 3REJB 1V9YA 2XEPA 4MNRA 3LZ1A 1P34C 1K56A 4GHAA 4GLQA 4PKYG 4PKYA 3AGEA 1HTZA 3NIAA 5B24A 4KHAB 4LV3A 3UMEA 3ZHHA 3MGQD 1W63Q 4E44A 5AVBA 5CGWA 3T4OA 2JBFA 5GSUD 2EFXA 5EOOA 3VP3A 3AN2C 1EQZB 3S7QA 3EEAA 4QHCA 4J8WB 5AV9C 1BZAA 3IWQA 3LEZA 2ZL1B 3C4OA 1ERMA 5AQBA 3ZCZA 3LR0A 1ES3A 5DNNB 4I5SA 2V9AA 4ZUXA 1W1PA 1T1CA 3S7OA 3B6GA 5B0ZB 3SH9A 1BSGA 2IWCA 4XZQB 2BYMA 1ID3A 4UUZB 2PR5A 5DFYA 1I2SA 2ZC5B 1G28A 1P3BD 3REHC 1M19C 1F66B 1XA7A 2FZ0A 4DQYB 3VH5T 3EGDC 5HPFA 5B2JA 3TU4A 3EQVA 3EPKA 4ZBJC 4Z2HA 4R8PA 3IX3A 1C3BA 1YLPA 3O3VA 1K55C 5HDSA 4H9OB 4HHDA 4X23A 2J3WA 3MGSB 2XF3A 3SOIA 3AZFA 3A3FA 5FUGA 4HJ3A 5JA4B 3RELD 5E5AA 3KWQD 5F68A 2IA2A 4E3KA 4CLCC 2Y55A 5CGSA 1PWDA 1KS0A 4R38A 3WKJC 1JWPA 3A6NC 3IS2B 3CPTB 3IT9A 1XJ4A 1NRFA 1GSXA 3Q81A 1NLYA 2WKPA 3MGQA 2JKTM 2XFTA 5CP6B 3AZHC 3W4OA 3MFDA 3AZNA 5FEGA 3TSGA 2G2WA 4FSFA 3AV2D 5DJTA 5E43A 3OZHA 2L1MA 3BQAA 4CAYB 3E0YA 1B67A 1XKZA 1DP9A 3LJAD 3IHBA 3UE6A 1VB6A 3DTKA 3QP1A 4K91A 4R4RA 3REKD 1LT0A 5FEFA 1U35D 4WN5A 1P3BA 4DRAA 2FJ7C 3MGRC 5EVID 5GL9A 2FFYA 1A0KA 1E8BA 1TF1A 3FV7A 1AOIB 2XR0A 4E3OA 4ZJ2A 1YU2A 4Z5TC 2M7VA 5LBRA 4S2LA 1GHPA 1YM1A 4YS3D 2Y2KA 1PRQA 4NXBA 3FKEA 4XUZA 4S2IA 1RP5A 4WELA 1JVJA 1P3FD 4Y15A 4LD9D 1D1JA 5M19A 4XUXA 2OLVA 3GRJA 1Z09A 2HPBA 5GHXA 1OPXA 1WYBA 1NWZA 1TS8A 3RELA 3TW8A 3W96C 3HONA 1AIWA 2IWBA 3L27A 4JXSA 3QNCA 2F2AC 3E98A 3QP4A 2ZQ7A 2Y79A 3RH8B 3VH6A 4WZ5C 2HGVA 2WAEA 4O7DA 3C2WA 5BNXB 3PBRA 3KUYD 5GXQC 3X1UC 4KGCC 4S2MA 3AZIC 1MKIA 4H9SA 3AV2A 3QHYA 3FDDA 4S2KA 2HIOB 3ULFA 5CPKC 4BBUA 4JJNB 3AZMC 1CQAA 3WS1A 2YFWB 1ED7A 1BT5A 4P6BA 1ONGA 2Y2LA 4MBKA 5B33C 2PYOB 5GLCA 3ZG5A 4KZ9A 3REKA 2PAVP 1U35A 2Y91A 1PYYA 5DF8A 2F8NK 3UE3A 3O62C 1H0MA 5EVIA 3FPVA 3AZGD 3AZJD 3CZDA 1W5DA 3VOYA 4WU9A 1AXBA 1P3OD 4YS3A 4KZ3A 1PI5A 1IYQA 5IT5A 2CV5D 1KX5B 1P3FA 3MBZA 1H8PA 2BYKA 4LD9A 3AFAC 4WEKA 5DNMD 4WNNB 3C1CD 3UDXA 3F1NB 3W98C 4HY8A 4G3WA 4GD8A 3NECA 2ZQDA 5AV8C 4Z66D 1QMFA 4UQIM 4WYYA 4YM6D 1DY6A 1BLSA 1Y28A 2RIQA 1P34D 5B1LB 3MNNA 3L26A 3UPOA 4DXBA 4HMDA 5EM0A 2VZWA 3KUYA 5G4ZA 1PZOA 3VFFA 3AN2D 1PI4A 3S7PA 3MGPB 4KUDB 5AV9D 1ES5A 3WA9C 3VOLA 1PFLA 3AZEC 3E4QA 5AV5B 1S0WA 2WKHA 4FOFA 4HIAA 4B88A 4KZ6A 1S1ZA 3IQAA 5B40C 1KX3C 4DF6A 1G6OA 2ZM2A 4MN7A 1F5MA 1YSPA 3LELD 4X68A 2I9VA 2ZMVA 2E8JA 1S1YA 3REHD 1M19D 2VGJA 2LB5A 4L9FA 3AZGA 3CHWP 5FASA 3NQJA 4MEZA 4ETXA 5B24C 1E25A 1OTAA 1P3OA 5AVBC 4ESPA 3GSGA 4ZUXB 2CV5A 4HH2A 1KE0A 3B3XA 4IHQA 4RX3A 1PWGA 4ZJ3A 5KDMA 5DNMA 3C1CA 5DFXA 1X0OA 1W1TA 3W97B 2H10A 4M4XA 2HZ5A 4KUKA 4CLCD 3X1TA 4Z66A 2V8FA 4IBGA 4KQQA 4YM6A 5AQ9A 1GA9A 3WKJD 3A6ND 1LI9A 4H9RA 3B6GC 3D4FA 2VEAA 1P34A 3TU4B 4E45A 2DF4C 1ID3C 1K38A 3GVBA 1N1JA 4HMCA 5L10A 3SH8A 3LIBA 2P7JA 4Z1WA 2QZ6A 3AZHD 3LUQA 4OH0A 3AN2A 5B2JC 3VH5W 1T1BA 1PDCA 4QU3A 5EOEA 4R8PC 5F5YA 2OWJA 2JN7A 1P3IC 5HL1A 3A0RA 4X23C 1P3AA 2X71A 3NC8A 3AZFC 4NZ3A 2QKPA 4O8GA 1PIOA 3BECA 3LELA 4HH3A 5E5AC 3U2AA 3QP6A 3UMDA 3MGRD 2Z2MB 2XROA 2WGIA 5GSUB 3PYPA 1VEUA 4HP4A 4U3TA 3MFXA 4X55A 4DE2A 3A0VA 3AV1B 1XA1A 3G4PA 3EEHA 3N8LA 4X69A 1E88A 4Z5TD 5JRGC 3O86A 2R9XA 4FTXA 5GT0A 5CHJA 3WD1A 2YKFA 3MGQC 2EX2A 4HGAC 1QO6A 2V5OA 1JWZA 3DW0A 3AZNC 1YAXA 4QNLA 1JTDA 1KE3A 5BNVA 1CXWA 5DKLA 1SDEA 1LI0A 3W96D 4PM9A 3S7NA 3MXSA 1P9RA 2J8PA 1YMXA 4DDYA 2EWVA 3ISGA 2Z6CA 3FPWA 4MDZA 2HDRA 3T50A 3B6FB 3WKJA 5GT3C 5EV0A 4EV4A 5B0YB 3C7VA 5CEBA 3AGDA 3SZTA 1P3BC 4DN0A 4JPMA 2A2LA 1GPFA 5AVFA 3T4LA 3AZHA 3X1SD 4BL3A 3X1UD 4KGCD 4M6BA 3AZID 1K54A 5K5BA 1BYWA 1TZYA 3KWQB 5CPKD 5EM1A 5HAIA 5BS7A 2W1TA 5FI7A 2HUEB 1MKMA 2VV6A 2W3GA 5B33D 1FCNA 1YQSA 4MB5A 4HJ4A 4LRZE 3KSYA 3T1SA 3WD2A 3HLDA 4PM6A 1DP8A 3UT9B 1XGIA 4NXEA 3WS4A 5FSRA 2AROD 3Q1FA 1T3UA 3O87A 3O62D 5CTNA 3X1VD 3UTAB 4KUOA 4WZ4A 1TAFA 1SCWA 1L0GA 4Z5TA 5L2FA 3CJMA 3DAVA 4G92B 3A3JA 1HQ3C 3LJAB 4YOFA 3HLWA 3HL9A 3L25A 3VSKA 3ITBA 3AFAD 2OOLA 4OOYA 4H9SC 3G2ZA 1P3PD 1U35B 2FFFB 2H28A 4G91C 3W96A 5AV8D 3B0CW 3WAAB 4LCMA 3UO9A 3H0LC 1UWNX 3HSHA 3CUEA 1IELA 3EPJA 4B4XA 1DJBA 5AVEA 4R6LA 5G4YA 4OOLA 5AVCA 3AZLB 1NRJA 4WZ5A 2GJ3A 4TX8A 5EVIC 2Y2IA 3DTMA 1IEMA 3X1SA 3MVDC 1P3FB 3X1UA 4CSRA 3AZIA 3F1OB 3K2NA 2Y4AA 4DDSA 3BWLA 3N4IA 1PZPA 4WU9C 3WA9D 1KGEA 3KSGA 4EUZA 5CPKA 2PBYA 4WF0A 1W79A 1FIKA 3VP1A 3W99A 3HUMA 1KX3D 2KLIA 4HQAA 1M18C 2VV8A 2Q9MA 4OOMA 2WAFA 4F3LB 2IO5C 1IFQA 3VP0A 4NE3A 2AROA 4MB3A 2ZMFA 3O62A 2H0YA 3X1VA 4FCFA 3H7WA 3UPPA 2OAQ1 1VQQA 4NZ4A 3H82B 4DRTA 1J3WA 3MNNC 4ZBEA 3L29A 5B24D 3LGOA 5AVBD 3E4PA 3IF6C 3RXWA 4Z2MH 2VLGA 4H6JB 1IYOA 4D60A 2G5HC 4QB8A 1E6NA 2IWDA 2LY8A 3IBJA 1P3PA 5CPJD 1JWVA 5F99A 2OWHA 3AYWC 5AV8A 1Q2PA 5A93A 3AZJB 3B6GD 2WK0A 2HP9A 5CEDA 1H3OB 1F9IA 4EO5C 3ZG8B 2Z6DA 3UNWA 2JKGA 3PAEA 4Q0JA 2C5WB 1Z6FA 4OPQA 4PPRA 1N4OA 5KDMB 3WWXA 5B2JD 1JNUA 4KENB 4JGPA 4R8PD 3UB5P 1P3OC 1P3ID 3EGXC 5HL6A 3V9RA 4YM6B 2Z2LB 2CV5C 1KX3A 1SKOA 3AZFD 4S2OA 1P34B 2HDSA 2PT7A 3NOUC 5J7EA 4N9LA 5DNMC 3T1QB 1LL5A 4O0PA 5L07A 3B42A 1K6RA 4Z2MG 2J8YA 2PYPA 3HCYA 3X1TC 1BLPA 3EPHA 4UA6A 3LYXA 2ZY2A 3R45A 5AV9B 5JRGD 4JGRA 1KX4C 4K08A 2RTSA 1MY8A 3UY6A 1G5UA 4R3JA 3AZKC 2WYXA 2I72A 5FL3A 3L28A 4FH2A 3AZND 3CAXA 1TS0A 1MXOA 4E3LA 3MMHA 3BFCA 5J4EA 2O99A 4Y0TA 1E6ZA 3NJAA 5DTKA 3EG5B 5CPJA 1OT6A 3REHB 1M19B 4AWLC 4GDNA 1VEUB 1P3AC 2K31A 4A5RA 1N9BA 3H0RC 5GT3D 3G35A 2AVXA 1HZOA 2XRNA 3LELC 1WYCA 3LO7A 5DVAA 3G31A 5HDDA 2HP6A 1FQGA 1W1YA 3N8RA 3BEBA 1BTLA 4N9KA 1L3LA 1E4DA 5FDHA 3BQ8A 3KO6A 5M18A 4EQIA 2F8NB 3MSHA 4E3JA 5E2FA 2WZZA 5GT0C 1P3GB 1P3MC 4MBFA 4QY6A 2ZOHA 3LEQA 1P3IA 4CLCB 4HBTA 1NXYA 3A6NB 3WRTA 3LI9A 4KZ7A 4MN5A 4EBNA 1Q9CA 1EAKA 4JXVA 4HNBA 2XH9A 4S2PA 4NE6A 4EEUA 3T4QA 4QLCC 1F66C 5JRGA 5HAPA 4IBBA 1HQ3D 2W1TB 4E6XA 4DJ2A 3IH9A 1I5QA 4GB7A 2PRFA 4J8VB 5DKKA 2G7UA 3M2JA 4H9QA 3I7JA 1P0ZA 1K54C 3FG8A 1TZYC 2FJ7B 4WJ3C 2QJ5A 2Q9NA 3MGRB 5BS7C 1YMSA 3M6BA 4MCWA 1NLZA 5GT3A 1RGZA 3SS4A 1H8YA 1IKIA 1ZG4A 3OBFA 5EECA 4R70A 3VE4A 3WTPD 3MVDD 1GCEA 5DJUA 4OJ6A 2WKIA 3M2KA 4IBEA 4HP9A 5G49B 4J8XD 3REIA 3UDIA 2ZM5A 4WU9D 3JPUA 1YLYA 1S67L 3HUOA 3VMAA 5FQMA 2XK1A 4Y0UA 3BY8A 4J8UB 3E2KA 4II7A 1M18D 2PU4A 3HJKA 4K0WA 3NOPC 3GMWA 1I2WA 4D2OA 5B31B 1JFIB 5BO0A 1STZA 3WS5A 1GOIA 1FSWA 5GXQB 3X1UB 4KGCB 3IF5A 3AZIB 5HWVA 4WU8A 2HDUA 3A3EA 2B95A 3BLSA 3CUEC 3LIEA 3C1BB 3LIFA 2OLUA 4P6ZS 5FATA 3MNND 5DTTA 2VV7A 5CPKB 5AVCC 3AZMB 4IBXA 4X1LA 1HQ3A 4EXOA 4OPZA 3KXBD 3X1SC 5B33B 3G30A 1H0IA 1V9ZA 3L7HA 4IEDA 4XT2B 1OTDA 3D72A 3AYWD 3H0MC 3UTBD 5AV6A 3W99C 1E6RA 1H8ZA 2W3FA 4N92A 3ZG0A 4H9NA 5B1MB 3AL0C 4E04A 2XD5A 5EVLA 2J9OA 1J9MA 2AROC 4OKPA 4BD0A 3EWKA 3X1VC 3WTPA 4NYYA 3LR5A 3MVDA 1VM1A 1HD8A 3UE0A 3AFAB 4J8XA 2X01A 2ZMAA 3NQUB 4KZ4A 4ID4A 3W98B 1CI9A 5A90A 2VQRA 2A24A 5AV8B 4WM9A 2XQZA 3KX0X 2VJWA 5FI2A 4KG6A 1BH8B 1OJ5A 4C6YA 2G2UA 1G6AA 4GHIB 3G2YA 4JJNC 1M18A 4OJPA 1SZVA 2WUQA 2FN2A 1P3PC 4YFMA 3ZQ5A 5F99C 1YU3A 1LL9A 3X1TD 5E2HA 4KZBA 5F83A 1KX4D 1YU1A 4KQRA 3WA9B 2J80A 3AZEB 2ZM0A 3AZKD 1B6WA 4ARZA 3UB8A 3NCKA 2ZC3B 1G68A 3L2AA 5B40B 2ZQCA 4OUIA 2P9VA 3IF6A 4C3QA 4H9PB 3KXBA 1KX3B 5B32B 1VHMA 1SKOB 3F1PA 3ICYA 1ESIA 1KDSA 2OAP1 4EEPA 4JF4A 2Y2MA 4Q0HA 2RVQC 4Z2GA 1CF0A 3KYQA 3AYWA 3T1XA 3WRZA 3UTBA 3TG9A 1P3AD 2K2NA 3LZ1B 4NE5A 4ZTKA 3V39A 3R45B 4GH9A 1PW8A 4RVAA 5B24B 3QP5A 4OJOA 5F1FA 3LZ0A 1YSQA 5AVBB 5DF7A 4UPKA 5HWWA 5A91A 5CPIA 4GJ4A 5EUAA 5TGFA 3IXDA 1CEFA 1S32A 2JKRM 5GT0D 1P3MD 1YUEA 3M6HA 3EQUA 2Y2NA 5GLAA 4JXWA 4EW7A 3MGPC 4U0TA 3B6GB 2BYMB 3LR4A 1ID3B 1K4EA 2WKRA 2L5AA 5DNND 5HX9A 1AWIA 1L0EA 3JYIA 3FKVA 5CPJC 4OQGA 3MKFA 4EUVA 1OTEA 4DE1A 2YFVA 4WLAA 4RX2A 1N9LA 3B33A 5B2JB 3OC2A 3PR6A 4JLFA 4QLCD 1F66D 1P3LC 2WKQA 1KX4A 4MMNA 5FAQA 4R8PB 5TBMA 3AZKA 3R4KA 4O01A 3R7WA 2ZC7A 4I38A 2RL3A 4X23B 3AZFB 1M1AA 1CK7A 4PM7A 5FUGB 1F98A 1TZYD 5E5AB 3KYEA 3KS8A 1ZLAC 1YT4A 1KE4A 1BH9A 5HW3A 4GCZA 2ZD8A 2Q0OA 3LIDA 2PD7A 1W63M 2V0UA 3MGQB 1D7EA 1ERQA 3HLEA 1XFQA 1P97A 1T18A 3DBAA 4HGAB 1N9OA 3ZFZA 1U60A 3AZNB 3T4SA 1F1EA 2ZQ9A 2HDQA 3C7UA 5HZHA 4WMCA 3VH6T 2HP5A 3KSIA 2XFSA 4BJPA 1WA9A 5CP6D 4NZ5A 1P3MA 2WZXA 3IWIA 1EQZA 4R23A 1OT9A 4J8WA 5GT3B 4NXGA 4OPYA 4WBGA 5DNNA 5FQIA 1P3BB 2VA0A 2QWSA 2L4RA 4WZSB 4S2JA 5B0ZA 4XZQA 1FR6A 4UUZA 1YLTA 2J7VA 1ODVA 4DMZA 3Q7VA 4QLCA 1F66A 1SKFA 3H9WA 4B9OA 4E3IA 4Y17A 5AVCD 5AY8C 3OLOA 3AV1C 3LI8A 3UE1A 1S66L 2JHEA 5I5LA 2WGWA 3REIC 5HAQA 5HD3A 3N8SA 3RELB 2H5SA 3MGSA 3T4KA 2O9AA 3W99D 4I39A 5JA4A 4IBDA 1WE4A 5FI6A 4GN2A 2DQNC 4YWZA 3B6FC 4B93A 2VGLM 3IS2A 3NY4A 3CPTA 5CECA 2Y2HA 2V8CA 5EVEA 3BFGA 4AFIA 4ZJ1A 4WU8C 2XA7S 4KZ8A 2J3TC 3AV2B 4L9GA 3ITAA 3ZNYA 2UWXA 3W2ZA 5CP6A 4P6ZM 4G91B 4PM8A 2YKHA 1DJAA 4GHLA 1FILA 3HVFA 1GHIA 2W0NA 4EBPA 3UB7A 4JJND 5L09A 3REKB 4CLCE 5F99D 5KSHA 2DNSA 1BLHA 5EVIB 2ZC6B 5AV6C 3CMZA 4C75A 3HLGA 2M7UA 3RFBA 4HEFA 3UT9C 4MB4A 2E8IA 3SS3A 3VH5A 2ZY5A 2W3DA 3ZYTA 4WU9B 4R1GA 3UTAC 4DJ3A 4YS3B 4I3IA 3UB6A 3HLCA 3W8KA 1W8YA 5FQQA 1AOIA 3WTPC 2R9WA 5HARA 3KFUG 3KSHA 2D01A 2BYKB 4LD9B 4IUHA 4J8XC 3IH8A 2IO5B 2RVQD 1OTBA 3BYDA 1RCJA 2OV5A 1M6KA 3UN7A 3NDEA 1XJ2A 4BQMA 2P04A 1T1AA 3AGFA 1E15A 3OCNA 4PHTA 3DTEA 2L0WA 3MNNB 3WAAC 4GOGA 2JKFA 5JYOA 4ARZB 3KS4A 5CX7A 4CJNA 3BW6A 1HTAA 2P9VB 3IF6B 1F2KA 1ONHA 3KUYB 5C3IC 1K25A 1LL8A 4G3KA 4XUJC 4EU0A 5BNXA 1M40A 1EW0A 3AYWB 1K6SA 3EOIA 3MGPD 3KXBC 1KVLA 5B2IC 1Y4OA 3NHQA 5HPIA 1GXDA 4OVDA 3IWOA 3IHAA 4Y5FA 4JJNA 1LSVA 2YFWA 2PYOA 3UTBC 5EE8A 3HJIA 1O6IA 3AZGB 4JBFA 3NQJB 5FQJA 1P3LD 1WWIA 5FA7A 2MJ6A 1D06A 2P74A 1LHYA 1P3OB 4LFUA 5C5KA 3LZ0C 3C5AA 5CPIC 2XGNA 3ZGAB 2CV5B 5FDSA 1LLBA 1VETA 4K0XA 2NQBC 4NEED 2X02A 5DNMB 3C1CB 1ES4A 1S32C 1SDNA 1KX5A 2IOUA 2M1CA 4Z2JA 1ZLAD 3X1TB 4Z66B 5CXWA 3IXBA 3MZEA 2YFVB 2BTFP 1S6RA 4WNNA 3B0DC 3F1NA 4H9RB 2PD8A 2JC7A 2EA9A 4UAAA 4H8RA 1N1JB 1KX4B 5CTMA 1XJ6A 1YLZA 4DXCA 3DTIA 4OLDA 1R4VA 2HJEA 1O07A 2J9PA 2EXBA 3ZDJA 5B1LA 1FCMA 3IP4C 3PBNA 3AN2B 4NY2A 4WV4B 3GTCA 4BL2A 4X6TA 1P3KC 4GZBA 5TJJA 4IVKA 3WD4A 1NYMA 1K4FA 1YU4A 3P01A 2PR6A 1NZUA 3NI9A 2EFUA 3MGPA 1P3AB 4KUDA 3UPNA 1M1AC 3PHYA 2NZDC 1ALQA 3C8CA 3FKWA 3MXRA 3S1YA 3LELB 4XXRA 3Q82A 4JF5A 1H3QA 2Y2OA 3NOTC 3E4OA 4I3AA 4MLLA 5BPVA 1SHVA 5E2GA 2QHKA 4JF6A 3S4XA 3VOZA 3PTEA 1P3LA 1UWPX 5GT0B 1P3MB 4ZBJB 3VP2A 3REJC 5CHLB 5FQKA 3PXPA 5AY8D 1UR8A 3AV1D 2EWWA 1LSXA 3CI6A 1MBLA 4GW9A 3BJNA 3REID 3VH6W 5BNVB 4KZ5A 4R3BA 3TE8A 4Q0IA 4OQ0A 1ZLAA 1EQZC 2H0TA 2ZQAA 3CG5A 4J8WC 4LV0A 5I94A 3WKJB 3NDGA 5F69A 3Q7VB 2O0YA 5BOHA 3MZDA 3W97A 3B47A 2W27A 3JVVA 4NXFA 4QLCB 5DNNC 1TDLA 3HUNA 2KOIA 1W1VA 3B6FD 2VX8A 5B0ZC 5G18A 5E2EA 3AZHB 4XZQC 5B0YD 2ZBBA 2W8SA 4WU8D 2V1ZA 2WGWB 2J3TD 5FAOA 4HOIA 4PM5A 3RXXA 5L8MA 4LV1A 1TZYB 4S2NA 2KDKA 3MR0A 4P87A 3GDIA 4JGQA 4PAUA 2JE5A
chains in the Genus database with same CATH topology
3FZCA 1HVBA 1P3GC 2Y59A 3SS5A 4B4ZA 1CI8A 3WX7A 3MGSC 5AV6D 1TAFB 1MWSA 3UT9D 1XGJA 4Z5TB 4QJGA 3G34A 3UTAD 5GSUA 4QD4A 2JCHA 4NFTA 5AY8A 3IXHA 3AV1A 3DWZA 3HLFA 4JXGA 2PU2A 3PBTA 1ULYA 2OSUA 5CP6C 3FWLA 2DRWA 4J8VC 3W96B 1GA0A 1QMEA 4OLGA 3P5JB 2ZQ8A 1NZOA 1FSYA 4FD8A 3A3IA 3WAAD 5AVCB 3EPLA 3B6FA 4UA7A 3ZG9B 3X1SB 5B0YA 4CSRB 4EBLA 4X56A 5F82A 1YLWA 3AZLD 3Q07A 4XUJD 1PW1A 2WKEA 1W7FA 3HLBA 1OMEA 1AOIC 4IJEA 3W99B 1L0DA 5B2ID 3KWQA 4Y0OA 5HFOA 4OP5A 3B0BA 4J8UC 2AROB 4DRBA 3WS0A 4P0MA 3O62B 3X1VB 2BG1A 3UT9A 5B31C 1Z2CB 4P85A 3UTAA 2WADA 5M1AA 3LZ0D 5DF9A 4RYEA 3V3RA 5CPID 3C1BC 3PBSA 2Y2QA 3B0CT 2NQBD 2RCXA 3LJAA 1P3PB 1S32D 5F99B 4N1HA 4DE0A 5KSCA 3OPRA 2A3UA 3V50A 4PMAA 2HIOC 3WAAA 3IXGA 4IBRA 1CEGA 1EI5A 2XDMA 3VP4A 2PYOC 5BT1C 5B1MC 2CWEA 5AQAA 4F94A 3PBQA 3AZLA 4L0LA 4XUJA 1P3KD 4EWFA 4OJLA 2ZY4A 3PBOA 4QY5A 3LCEA 3V9RB 1GHMA 1M1AD 4HBUA 5B2IA 2NZDD 4IBCA 3ZVTA 4U0XA 2ZJ9A 1FR1A 1KX5C 1NY0A 5CGXA 3ZG7B 4RA7A 2XLNA 1KGGA 1NYYA 3WTPE 3REJD 5IHVA 5B1LC 4WMCD 3A3DA 2NQBA 1RGYA 4LCLA 1K57C 5CPJB 5B32C 5U47A 3RJUA 1EQZD 4UHUA 4J8WD 4KUDC 1DJCA 2Y2GA 3SH7A 4IVIA 5AV5C 1P3LB 4LG2A 3LZ1C 3AZJA 1E3UD 5B0ZD 4XZQD 3OCLA 1H3OA 4N1XA 3UDFA 1PWCA 1TVFA 4NK3A 1O7EA 1P3KA 2BLSA 4LENA 3BFFA 1W2EA 1P3IB 1ZLAB 4NETA 3O88A 1XPBA 3OPLA 2F8ND 3F6TA 3V5MA 1P3GD 2NZDA 3A1IA 4ZUXC 4OQHA 3GR2A 3MGSD 5AQ7A 3BFDA 1L2SA 1BUEA 3W97C 4IBKA 2F8NH 5JRGB 5CRFA 2EX9A 1FOFA 3REJA 4KG2A 3TU4C 5AV9A 3ZNTA 2V2FF 4KHAA 4H9QB 4S2NC 2EX6A 1A7WA 4J8VD 5FQ9A 3WS2A 4ZAMA 4GDBA 1IKGA 4WEJA 1KVMA 4OP8A 2FJ7D 3V3SA 3REHA 1M19A 4OJ5A 4JKTA 5CHUA 5AY8B 1XP4A 3N6IA 1E3UA 3HBRA 3REIB 3G32A 4Y7PA 3NBLA 1K55A 4Q8IA 1IYSA 5GSUC 5J8XA 1ZC2A 1Q2QA 2WGVA 1AOID 3S22A 1TEMA 2F8NG 2F8NA 1BFMA 4CPKA 2VGKA 1P3GA 2DCFA 3MKEA 2A49A 4H9OA 4J8UD 1NJ4A 4GKUA 4BENA 3A6NA 5BO0B 3OPPA 4X53A 4ZDXA 5FAPA 4WU8B 2ZM8A 1EWZA 3QNBA 5B31D 4GD6A 4KG5A 5GXQD 1HQ3B 5TR7A 5DTSA 3C1BD 5B0YC 5EPHA 5GLBA 2ZLYA 5TFQA 2EX8A 3FYZA 3AZMD 3DWKA 3W4QA 1MWUA 3VFHA 4J8VA 2XD1A 5AV6B 2Y2PA 3N7WA 3RELC 3KWQC 2HIOD 4H9NB 4CAYA 2FJ7A 3PAGA 3MGRA 1H5XA 2HUEC 4E3MA 4BD1A 4FH4A 2PYOD 2GDNA 2QMIA 3WTPB 5BT1D 5B1MD 3MVDB 4NYUA 1ES2A 1MWRA 4J8XB 2Y2JA 2B5RA 4KQOA 4IBJA 4R4SA 5G49A 2CC1A 4YINA 3AV2C 3TOIA 3W98D 4G92C 1XX2A 3P98A 1M18B 4E6WA 4UA9A 3LJAC 4KZAA 4R0QA 4IBIA 5GLDA 1KX5D 4J8UA 3BM6A 1L0FA 3W4PA 1PZRA 3REKC 1TDGA 1U35C 5C3IB 4GNUA 1BLCA 3Q7ZA 5B31G 5B31A 4XUJB 1JFIA 4LV2A 2V20A 5GXQA 4KGCA 3A1KA 5KZHA 4Z9QA 5B1LD 3KXBB 3C1BA 1CK3A 1XXMA 5B2IB 3AZED 4YS3C 3AZLC 3AZMA 5B40D 3GV9A 5B32D 5B33A 1P3FC 4LD9C 3N3FA 3UTBB 1JTGA 4KUDD 4MBHA 1ESUA 3VSLA 2HIOA 5AV5D 5F1GA 2QPNA 4HESA 1YLJA 4EO5B 3LY3A 3LZ0B 3LZ1D 1K56D 3E2LA 5CPIB 5B1MA 5CERA 2NQBB 4E3NA 2ZY3A 4OONA 1S32B 3KUYC 1BULA 2ZC4B 3LY4A 3OPHA 5A92A 3AFAA 5JYPA 4NZ1A 1ZKJA 4IJFA 3B0DB 3NQUA 3BRMA 3W98A 3HREA 3C4PA 4ZUXD 3GQZA 1BH8A 1KGFA 2C6WB 1FCOA 1ID3D 5GHYA 3W97D 1IYPA 1P3KB 1KU5A 3AZKB 5KMWA 3AZGC 3AZJC 3P09A 3TU4D 4DE3A 3ZVWA 1M1AB 1WWSA 2NZDB 3WA9A 3BLMA 4OQIA 4OPRA 5GHZA 3AZEA 2G5IC 1Y54A 5B40A 5D3OA 1ZG6A 5CHMA 4X23D 4H9PA 4IBFA 5B32G 5B32A 1K57A 1MWTA 1W8QA 3MZFA 4BLMA 2JSSA 4AWLB 1BH9B 4DKIA 3C1CC 3BFEA 1MPLA 1EROA 5E5AD 5AV5A 1KDWA 2EXAA 4Z66C 4M3KA 1YU0A 4YM6C 3REJB 2XEPA 4MNRA 3LZ1A 1P34C 1K56A 4GHAA 3AGEA 1HTZA 3NIAA 5B24A 4KHAB 4LV3A 3ZHHA 3MGQD 4E44A 5AVBA 5CGWA 2JBFA 5GSUD 2EFXA 5EOOA 3VP3A 3AN2C 1EQZB 4QHCA 4J8WB 5AV9C 1BZAA 3IWQA 3LEZA 3C4OA 1ERMA 5AQBA 3ZCZA 1ES3A 5DNNB 4ZUXA 3B6GA 5B0ZB 3SH9A 1BSGA 2IWCA 4XZQB 2BYMA 1ID3A 4UUZB 1I2SA 2ZC5B 1P3BD 3REHC 1M19C 1F66B 1XA7A 4DQYB 3VH5T 5B2JA 3TU4A 3EQVA 3EPKA 4ZBJC 4R8PA 1C3BA 1YLPA 3O3VA 1K55C 4H9OB 4X23A 3MGSB 2XF3A 3SOIA 3AZFA 3A3FA 5FUGA 5JA4B 3RELD 5E5AA 3KWQD 4E3KA 2Y55A 5CGSA 1PWDA 3WKJC 1JWPA 3A6NC 3IT9A 1NRFA 3Q81A 3MGQA 2XFTA 5CP6B 3AZHC 3W4OA 3MFDA 3AZNA 3TSGA 2G2WA 4FSFA 3AV2D 5E43A 3OZHA 4CAYB 1B67A 1XKZA 3LJAD 3IHBA 4K91A 4R4RA 3REKD 1U35D 1P3BA 4DRAA 2FJ7C 3MGRC 5EVID 5GL9A 2FFYA 3FV7A 1AOIB 2XR0A 4E3OA 4ZJ2A 1YU2A 4Z5TC 4S2LA 1GHPA 1YM1A 4YS3D 2Y2KA 4XUZA 3FKEA 4S2IA 1RP5A 4WELA 1JVJA 1P3FD 4LD9D 5M19A 4XUXA 2OLVA 3GRJA 5GHXA 2HPBA 1WYBA 3RELA 3W96C 3HONA 2IWBA 3L27A 4JXSA 3QNCA 2F2AC 2ZQ7A 3VH6A 4WZ5C 2WAEA 4O7DA 5BNXB 3PBRA 3KUYD 5GXQC 3X1UC 4KGCC 4S2MA 3AZIC 1MKIA 4H9SA 3AV2A 3QHYA 3FDDA 4S2KA 2HIOB 5CPKC 4JJNB 3AZMC 3WS1A 2YFWB 1BT5A 4P6BA 1ONGA 2Y2LA 4MBKA 5B33C 2PYOB 5GLCA 3ZG5A 4KZ9A 3REKA 1U35A 2Y91A 1PYYA 5DF8A 2F8NK 3UE3A 3O62C 5EVIA 3AZGD 3AZJD 3CZDA 1W5DA 3VOYA 4WU9A 1AXBA 1P3OD 4YS3A 4KZ3A 1PI5A 1IYQA 2CV5D 1KX5B 1P3FA 3MBZA 2BYKA 4LD9A 3AFAC 4WEKA 5DNMD 4WNNB 3C1CD 3UDXA 3W98C 4GD8A 2ZQDA 5AV8C 4Z66D 1QMFA 4WYYA 4YM6D 1DY6A 1BLSA 2RIQA 1P34D 5B1LB 3MNNA 3L26A 3UPOA 4DXBA 3KUYA 1PZOA 3VFFA 3AN2D 1PI4A 3MGPB 4KUDB 5AV9D 1ES5A 3WA9C 3AZEC 5AV5B 1S0WA 2WKHA 4B88A 4KZ6A 3IQAA 5B40C 1KX3C 4DF6A 2ZM2A 3LELD 4X68A 3REHD 1M19D 2VGJA 3AZGA 5FASA 3NQJA 4MEZA 5B24C 1E25A 1P3OA 5AVBC 3GSGA 4ZUXB 2CV5A 1KE0A 3B3XA 4RX3A 1PWGA 4ZJ3A 5KDMA 5DNMA 3C1CA 3W97B 2H10A 3X1TA 4Z66A 4IBGA 4KQQA 4YM6A 5AQ9A 1GA9A 3WKJD 3A6ND 1LI9A 4H9RA 3B6GC 3D4FA 1P34A 3TU4B 4E45A 2DF4C 1ID3C 1K38A 3GVBA 1N1JA 3SH8A 2QZ6A 3AZHD 4OH0A 3AN2A 5B2JC 3VH5W 4QU3A 5EOEA 4R8PC 1P3IC 5HL1A 4X23C 1P3AA 2X71A 3NC8A 3AZFC 4NZ3A 1PIOA 3BECA 3LELA 5E5AC 3MGRD 2Z2MB 2WGIA 5GSUB 4U3TA 4X55A 4DE2A 3AV1B 1XA1A 3G4PA 3N8LA 4X69A 4Z5TD 5JRGC 3O86A 2R9XA 5GT0A 5CHJA 3MGQC 2EX2A 4HGAC 1JWZA 3DW0A 3AZNC 4QNLA 1JTDA 1KE3A 5BNVA 1SDEA 1LI0A 3W96D 4PM9A 3MXSA 2J8PA 1YMXA 4DDYA 3ISGA 2HDRA 3B6FB 3WKJA 5GT3C 4EV4A 5B0YB 3C7VA 5CEBA 3AGDA 1P3BC 4JPMA 3AZHA 3X1SD 4BL3A 3X1UD 4KGCD 4M6BA 3AZID 1K54A 1TZYA 3KWQB 5CPKD 5HAIA 5BS7A 5FI7A 2HUEB 5B33D 1FCNA 1YQSA 3KSYA 3HLDA 4PM6A 3UT9B 1XGIA 3WS4A 5FSRA 2AROD 3Q1FA 1T3UA 3O87A 3O62D 5CTNA 3X1VD 3UTAB 4WZ4A 1TAFA 1SCWA 1L0GA 4Z5TA 5L2FA 3CJMA 4G92B 3A3JA 1HQ3C 3LJAB 3HLWA 3HL9A 3L25A 3VSKA 3ITBA 3AFAD 4OOYA 4H9SC 3G2ZA 1P3PD 1U35B 2FFFB 4G91C 3W96A 5AV8D 3B0CW 3WAAB 4LCMA 3UO9A 3H0LC 3HSHA 1IELA 3EPJA 4B4XA 1DJBA 4OOLA 5AVCA 3AZLB 4WZ5A 5EVIC 2Y2IA 3DTMA 1IEMA 3X1SA 3MVDC 1P3FB 3X1UA 4CSRA 3AZIA 2Y4AA 4DDSA 3N4IA 1PZPA 4WU9C 3WA9D 1KGEA 4EUZA 5CPKA 2PBYA 1W79A 3VP1A 3W99A 3HUMA 1KX3D 1M18C 2Q9MA 4OOMA 2WAFA 2IO5C 3VP0A 4NE3A 2AROA 3O62A 2H0YA 3X1VA 4FCFA 3UPPA 1VQQA 4NZ4A 4DRTA 3MNNC 4ZBEA 3L29A 5B24D 5AVBD 3IF6C 3RXWA 4Z2MH 1IYOA 2G5HC 4QB8A 2IWDA 2LY8A 1P3PA 5CPJD 1JWVA 5F99A 3AYWC 5AV8A 1Q2PA 5A93A 3AZJB 3B6GD 2WK0A 2HP9A 5CEDA 1H3OB 4EO5C 3ZG8B 3UNWA 3PAEA 2C5WB 1Z6FA 4OPQA 4PPRA 1N4OA 5KDMB 3WWXA 5B2JD 4KENB 4R8PD 1P3OC 1P3ID 3V9RA 4YM6B 2Z2LB 2CV5C 1KX3A 3AZFD 4S2OA 1P34B 2HDSA 4N9LA 5DNMC 1LL5A 1K6RA 4Z2MG 2J8YA 3X1TC 1BLPA 3EPHA 4UA6A 2ZY2A 3R45A 5AV9B 5JRGD 1KX4C 3UY6A 1MY8A 4R3JA 3AZKC 2WYXA 2I72A 3L28A 4FH2A 3AZND 1MXOA 4E3LA 3BFCA 4Y0TA 5DTKA 3EG5B 5CPJA 3REHB 1M19B 4AWLC 4GDNA 1P3AC 4A5RA 1N9BA 3H0RC 5GT3D 3G35A 1HZOA 3LELC 3LO7A 1WYCA 5DVAA 3G31A 2HP6A 1FQGA 3N8RA 3BEBA 1BTLA 4N9KA 1E4DA 5FDHA 5M18A 4EQIA 2F8NB 4E3JA 5E2FA 2WZZA 5GT0C 1P3GB 1P3MC 4MBFA 4QY6A 1P3IA 4HBTA 1NXYA 3A6NB 3WRTA 4KZ7A 4EBNA 1Q9CA 4JXVA 2XH9A 4S2PA 4NE6A 4QLCC 1F66C 5JRGA 5HAPA 4IBBA 1HQ3D 4E6XA 3IH9A 1I5QA 4GB7A 4J8VB 3M2JA 4H9QA 3I7JA 1K54C 1TZYC 2FJ7B 4WJ3C 2Q9NA 3MGRB 5BS7C 1YMSA 3M6BA 5GT3A 1RGZA 3SS4A 1H8YA 1IKIA 1ZG4A 5EECA 3WTPD 3MVDD 1GCEA 4OJ6A 2WKIA 3M2KA 4IBEA 5G49B 4J8XD 3REIA 3UDIA 2ZM5A 4WU9D 1YLYA 3HUOA 3VMAA 5FQMA 2XK1A 4Y0UA 4J8UB 3E2KA 1M18D 2PU4A 4K0WA 3GMWA 1I2WA 4D2OA 5B31B 1JFIB 5BO0A 3WS5A 1FSWA 5GXQB 3X1UB 4KGCB 3IF5A 3AZIB 4WU8A 2HDUA 3A3EA 3BLSA 3C1BB 5FATA 2OLUA 3MNND 5DTTA 5CPKB 5AVCC 3AZMB 4IBXA 1HQ3A 4OPZA 3KXBD 3G30A 3X1SC 5B33B 4IEDA 3AYWD 3H0MC 3UTBD 5AV6A 3W99C 1H8ZA 4N92A 3ZG0A 4H9NA 5B1MB 3AL0C 2XD5A 5EVLA 2J9OA 1J9MA 2AROC 4OKPA 4BD0A 3X1VC 3WTPA 4NYYA 3MVDA 1VM1A 1HD8A 3UE0A 3AFAB 4J8XA 2X01A 2ZMAA 3NQUB 4KZ4A 4ID4A 3W98B 1CI9A 5A90A 2VQRA 5AV8B 4WM9A 2XQZA 5FI2A 4KG6A 1BH8B 4C6YA 2G2UA 1G6AA 3G2YA 4JJNC 1M18A 4OJPA 2WUQA 4YFMA 1P3PC 5F99C 1YU3A 1LL9A 3X1TD 5E2HA 4KZBA 5F83A 1KX4D 1YU1A 4KQRA 3WA9B 3AZEB 2ZM0A 3AZKD 1B6WA 3NCKA 2ZC3B 1G68A 3L2AA 5B40B 2ZQCA 4OUIA 2P9VA 3IF6A 4C3QA 4H9PB 3KXBA 1KX3B 5B32B 1ESIA 1KDSA 4JF4A 2Y2MA 2RVQC 3AYWA 3WRZA 3UTBA 3TG9A 1P3AD 3LZ1B 4NE5A 4ZTKA 3V39A 3R45B 4GH9A 1PW8A 4RVAA 5B24B 4OJOA 5F1FA 3LZ0A 5AVBB 5DF7A 4UPKA 5A91A 5CPIA 5EUAA 5TGFA 3IXDA 1CEFA 1S32A 5GT0D 1P3MD 1YUEA 3M6HA 3EQUA 2Y2NA 5GLAA 4JXWA 3MGPC 4U0TA 3B6GB 2BYMB 1ID3B 1K4EA 2L5AA 5DNND 5HX9A 1L0EA 3JYIA 3FKVA 5CPJC 4OQGA 3MKFA 4DE1A 2YFVA 4RX2A 5B2JB 3OC2A 4JLFA 4QLCD 1F66D 1P3LC 1KX4A 5FAQA 4R8PB 3AZKA 2ZC7A 2RL3A 4X23B 3AZFB 1M1AA 4PM7A 5FUGB 1TZYD 5E5AB 3KS8A 1ZLAC 1YT4A 1KE4A 1BH9A 5HW3A 2ZD8A 3MGQB 3HLEA 1ERQA 4HGAB 3ZFZA 1U60A 3AZNB 1F1EA 2ZQ9A 2HDQA 3C7UA 4WMCA 3VH6T 2HP5A 2XFSA 4BJPA 5CP6D 4NZ5A 1P3MA 2WZXA 3IWIA 1EQZA 4R23A 4J8WA 5GT3B 4OPYA 4WBGA 5DNNA 5FQIA 1P3BB 4WZSB 4S2JA 5B0ZA 4XZQA 1FR6A 4UUZA 1YLTA 2J7VA 3Q7VA 4QLCA 1F66A 1SKFA 4E3IA 5AVCD 5AY8C 3AV1C 3UE1A 2WGWA 3REIC 5HAQA 3N8SA 3RELB 2H5SA 3MGSA 3W99D 5JA4A 4IBDA 1WE4A 5FI6A 4GN2A 2DQNC 3B6FC 3NY4A 5CECA 2Y2HA 3BFGA 4ZJ1A 4WU8C 4KZ8A 3AV2B 3ZNYA 3ITAA 2UWXA 5CP6A 4G91B 4PM8A 1DJAA 4GHLA 3HVFA 1GHIA 4EBPA 4JJND 3REKB 5F99D 5KSHA 2DNSA 1BLHA 5EVIB 2ZC6B 5AV6C 3CMZA 4C75A 3HLGA 4HEFA 3UT9C 2E8IA 3SS3A 3VH5A 2ZY5A 4WU9B 4R1GA 3UTAC 4YS3B 3HLCA 3W8KA 1W8YA 5FQQA 1AOIA 3WTPC 2R9WA 5HARA 3KFUG 2BYKB 4LD9B 4J8XC 3IH8A 2IO5B 2RVQD 3BYDA 1RCJA 2OV5A 1M6KA 3UN7A 3NDEA 4BQMA 3AGFA 3OCNA 3MNNB 3WAAC 4GOGA 5JYOA 3KS4A 4CJNA 1HTAA 2P9VB 3IF6B 1ONHA 3KUYB 5C3IC 1K25A 4XUJC 5BNXA 1M40A 3AYWB 1K6SA 3MGPD 3KXBC 1KVLA 5B2IC 4OVDA 3IWOA 3IHAA 4JJNA 2YFWA 2PYOA 3UTBC 5EE8A 3AZGB 4JBFA 3NQJB 5FQJA 1P3LD 1WWIA 5FA7A 2P74A 1LHYA 1P3OB 3LZ0C 3C5AA 5CPIC 2XGNA 3ZGAB 2CV5B 1LLBA 4K0XA 2NQBC 2X02A 5DNMB 3C1CB 1ES4A 1S32C 1SDNA 1KX5A 2IOUA 1ZLAD 3X1TB 4Z66B 5CXWA 3IXBA 3MZEA 2YFVB 1S6RA 4WNNA 3B0DC 4H9RB 2JC7A 4UAAA 4H8RA 1N1JB 1KX4B 5CTMA 1YLZA 4DXCA 4OLDA 1R4VA 1O07A 2J9PA 2EXBA 3ZDJA 5B1LA 1FCMA 3IP4C 3PBNA 3AN2B 4NY2A 4WV4B 3GTCA 4BL2A 4X6TA 1P3KC 4GZBA 4IVKA 1NYMA 1K4FA 1YU4A 1NZUA 3NI9A 2EFUA 3MGPA 1P3AB 4KUDA 3UPNA 1M1AC 2NZDC 1ALQA 3FKWA 3MXRA 3S1YA 3LELB 4XXRA 3Q82A 4JF5A 2Y2OA 4MLLA 5BPVA 1SHVA 5E2GA 4JF6A 3S4XA 3VOZA 3PTEA 1P3LA 5GT0B 1P3MB 4ZBJB 3VP2A 3REJC 5CHLB 5FQKA 5AY8D 3AV1D 1MBLA 3REID 3VH6W 5BNVB 4KZ5A 4R3BA 4OQ0A 1ZLAA 1EQZC 2H0TA 2ZQAA 3CG5A 4J8WC 4LV0A 5I94A 3WKJB 3NDGA 3Q7VB 5BOHA 3MZDA 3W97A 4QLCB 5DNNC 1TDLA 3HUNA 3B6FD 5B0ZC 5G18A 5E2EA 3AZHB 4XZQC 5B0YD 2W8SA 4WU8D 2V1ZA 2WGWB 5FAOA 4PM5A 3RXXA 4LV1A 1TZYB 4S2NA 4P87A 2JE5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FZC A;  3E2L A;  1JTD A;  4KZB A;  1HVB A;  5F83 A;  1KE3 A;  5CER A;  4KQR A;  4E3N A;  1SDE A;  4OON A;  2Y59 A;  2ZM0 A;  1LI0 A;  4PM9 A;  3SS5 A;  4B4Z A;  1CI8 A;  3MXS A;  3NCK A;  2ZC3 B;  1YMX A;  1BUL A;  1G68 A;  2ZC4 B;  3ISG A;  3LY4 A;  2ZQC A;  4C3Q A;  2P9V A;  3IF6 A;  4DDY A;  2HDR A;  3OPH A;  5A92 A;  5JYP A;  1ESI A;  1ZKJ A;  1MWS A;  1KDS A;  3BRM A;  4EV4 A;  1XGJ A;  3C7V A;  4JF4 A;  2Y2M A;  5CEB A;  3AGD A;  3HRE A;  4QJG A;  4JPM A;  3G34 A;  3C4P A;  3GQZ A;  3WRZ A;  4QD4 A;  2JCH A;  4BL3 A;  3IXH A;  1KGF A;  3DWZ A;  3TG9 A;  2C6W B;  1FCO A;  3HLF A;  4ZTK A;  3V39 A;  4JXG A;  2PU2 A;  5GHY A;  3PBT A;  1K54 A;  1PW8 A;  4RVA A;  2OSU A;  5HAI A;  1IYP A;  5F1F A;  5E2H A;  3FWL A;  2DRW A;  5DF7 A;  5FI7 A;  5KMW A;  1GA0 A;  5A91 A;  1QME A;  1FCN A;  3P09 A;  1YQS A;  4OLG A;  5EUA A;  4DE3 A;  3ZVW A;  2ZQ8 A;  1NZO A;  1FSY A;  3BLM A;  3HLD A;  4OQI A;  4OPR A;  4PM6 A;  5GHZ A;  5TGF A;  3IXD A;  3WS4 A;  1CEF A;  1XGI A;  4FD8 A;  1Y54 A;  3A3I A;  5FSR A;  3Q1F A;  3O87 A;  3M6H A;  3EQU A;  5CTN A;  5D3O A;  2Y2N A;  1ZG6 A;  5CHM A;  5GLA A;  1K57 A;  1W8Q A;  1MWT A;  3MZF A;  4JXW A;  4UA7 A;  4BLM A;  4WZ4 A;  3ZG9 B;  4U0T A;  4DKI A;  1SCW A;  3BFE A;  1MPL A;  1ERO A;  1L0G A;  4EBL A;  4X56 A;  3CJM A;  5F82 A;  1K4E A;  1YLW A;  5L2F A;  5HX9 A;  3Q07 A;  1KDW A;  1L0E A;  3A3J A;  1PW1 A;  2EXA A;  3JYI A;  3FKV A;  4OQG A;  2WKE A;  4M3K A;  1W7F A;  3HLB A;  3MKF A;  1OME A;  2XEP A;  4DE1 A;  4MNR A;  3HLW A;  3HL9 A;  1K56 A;  1L0D A;  3VSK A;  4RX2 A;  3ITB A;  4OOY A;  3G2Z A;  3AGE A;  1HTZ A;  3OC2 A;  4JLF A;  3NIA A;  4Y0O A;  4LV3 A;  3ZHH A;  5FAQ A;  5HFO A;  4OP5 A;  2FFF B;  5CGW A;  2JBF A;  2EFX A;  3WS0 A;  4LCM A;  4P0M A;  5EOO A;  2ZC7 A;  3UO9 A;  3VP3 A;  2RL3 A;  2BG1 A;  4PM7 A;  4QHC A;  3IWQ A;  1BZA A;  3LEZ A;  1IEL A;  4B4X A;  1DJB A;  3C4O A;  1ERM A;  5AQB A;  3ZCZ A;  4P85 A;  4OOL A;  1ES3 A;  2WAD A;  4WZ5 A;  5M1A A;  5EVI C;  2Y2I A;  1YT4 A;  3DTM A;  5DF9 A;  1IEM A;  1KE4 A;  4RYE A;  3V3R A;  3SH9 A;  1BSG A;  2IWC A;  5HW3 A;  2ZD8 A;  3PBS A;  2Y4A A;  1I2S A;  3N4I A;  2ZC5 B;  4DDS A;  2Y2Q A;  1PZP A;  1KGE A;  2RCX A;  4EUZ A;  2PBY A;  1XA7 A;  1W79 A;  3HLE A;  1ERQ A;  3VP1 A;  4N1H A;  3HUM A;  4DE0 A;  5KSC A;  3OPR A;  3ZFZ A;  1U60 A;  2ZQ9 A;  2HDQ A;  3C7U A;  2A3U A;  4WMC A;  3V50 A;  3EQV A;  2HP5 A;  2Q9M A;  4OOM A;  2WAF A;  2XFS A;  4PMA A;  4BJP A;  3VP0 A;  1C3B A;  1YLP A;  3O3V A;  1K55 C;  3IXG A;  4IBR A;  2WZX A;  3IWI A;  1CEG A;  2H0Y A;  4FCF A;  1EI5 A;  2XF3 A;  2XDM A;  3SOI A;  4R23 A;  3A3F A;  3VP4 A;  3UPP A;  1VQQ A;  5AQA A;  4F94 A;  4OPY A;  4DRT A;  4WBG A;  3PBQ A;  4ZBE A;  4L0L A;  4E3K A;  5FQI A;  4EWF A;  2Y55 A;  3PBO A;  4QY5 A;  3IF6 C;  4S2J A;  1PWD A;  5CGS A;  3RXW A;  1FR6 A;  1JWP A;  3LCE A;  1IYO A;  3IT9 A;  1GHM A;  1YLT A;  2J7V A;  4QB8 A;  3Q7V A;  1NRF A;  4HBU A;  2IWD A;  4E3I A;  1SKF A;  3ZVT A;  3Q81 A;  1JWV A;  4U0X A;  2XFT A;  2ZJ9 A;  1FR1 A;  1NY0 A;  3W4O A;  5CGX A;  3MFD A;  1Q2P A;  3TSG A;  5A93 A;  3UE1 A;  3ZG7 B;  2G2W A;  4FSF A;  2WK0 A;  2HP9 A;  5E43 A;  5CED A;  2WGW A;  3OZH A;  5HAQ A;  4RA7 A;  2XLN A;  1KGG A;  3ZG8 B;  1XKZ A;  3N8S A;  2H5S A;  3UNW A;  1NYY A;  3PAE A;  3IHB A;  5IHV A;  2C5W B;  1Z6F A;  4K91 A;  4OPQ A;  4PPR A;  1N4O A;  4R4R A;  3WWX A;  4KEN B;  1WE4 A;  4WMC D;  5FI6 A;  3A3D A;  4GN2 A;  1RGY A;  4LCL A;  5EVI D;  5GL9 A;  2FFY A;  1K57 C;  3NY4 A;  5CEC A;  2Z2L B;  2Y2H A;  3FV7 A;  5U47 A;  3RJU A;  2XR0 A;  4S2O A;  3BFG A;  4ZJ2 A;  4E3O A;  4ZJ1 A;  4UHU A;  1DJC A;  2HDS A;  2Y2G A;  4KZ8 A;  4N9L A;  4S2L A;  1GHP A;  1YM1 A;  3SH7 A;  1LL5 A;  3ITA A;  4IVI A;  2UWX A;  3ZNY A;  2Y2K A;  1K6R A;  2J8Y A;  4XUZ A;  4S2I A;  1RP5 A;  4WEL A;  1BLP A;  4PM8 A;  1JVJ A;  1DJA A;  1E3U D;  4UA6 A;  5M19 A;  3OCL A;  2OLV A;  3HVF A;  4N1X A;  3GRJ A;  4XUX A;  5GHX A;  1GHI A;  2HPB A;  4EBP A;  1WYB A;  3UDF A;  1PWC A;  3UY6 A;  1MY8 A;  1TVF A;  4R3J A;  4NK3 A;  1O7E A;  2IWB A;  2WYX A;  2BLS A;  2I72 A;  5KSH A;  4JXS A;  4LEN A;  3BFF A;  2DNS A;  3QNC A;  1BLH A;  5EVI B;  2ZC6 B;  3CMZ A;  4FH2 A;  4NET A;  3O88 A;  1XPB A;  3HLG A;  4C75 A;  2ZQ7 A;  3OPL A;  4HEF A;  1MXO A;  4E3L A;  2E8I A;  3BFC A;  3SS3 A;  3V5M A;  4Y0T A;  5DTK A;  4R1G A;  4WZ5 C;  2WAE A;  4O7D A;  3HLC A;  3W8K A;  1W8Y A;  4GDN A;  3PBR A;  4OQH A;  3GR2 A;  5FQQ A;  4S2M A;  4A5R A;  1MKI A;  2R9W A;  1N9B A;  5HAR A;  5AQ7 A;  3G35 A;  3BFD A;  1L2S A;  3QHY A;  1BUE A;  1HZO A;  4S2K A;  1WYC A;  3IH8 A;  3LO7 A;  5DVA A;  3G31 A;  3BYD A;  3WS1 A;  5CRF A;  2HP6 A;  2EX9 A;  1FOF A;  1BT5 A;  1FQG A;  1RCJ A;  4P6B A;  2OV5 A;  1ONG A;  1M6K A;  2Y2L A;  3N8R A;  4MBK A;  3UN7 A;  3BEB A;  1BTL A;  4N9K A;  4KG2 A;  3NDE A;  4BQM A;  1E4D A;  5FDH A;  3AGF A;  5GLC A;  5M18 A;  3ZG5 A;  4KZ9 A;  4EQI A;  3OCN A;  3ZNT A;  2V2F F;  2Y91 A;  4E3J A;  5E2F A;  1PYY A;  2WZZ A;  5DF8 A;  4MBF A;  4QY6 A;  4GOG A;  3UE3 A;  5JYO A;  4S2N C;  2EX6 A;  5EVI A;  4CJN A;  4HBT A;  5FQ9 A;  3WS2 A;  4ZAM A;  2P9V B;  3IF6 B;  1NXY A;  1ONH A;  3CZD A;  1W5D A;  4GDB A;  1IKG A;  3WRT A;  4WEJ A;  1KVM A;  4OP8 A;  1K25 A;  4KZ7 A;  3VOY A;  4EBN A;  1AXB A;  3V3S A;  1M40 A;  4JKT A;  4KZ3 A;  4JXV A;  1PI5 A;  1IYQ A;  1K6S A;  2XH9 A;  5CHU A;  4S2P A;  1XP4 A;  3N6I A;  1E3U A;  3MBZ A;  1KVL A;  4WEK A;  3UDX A;  3HBR A;  4OVD A;  3IWO A;  3IHA A;  5HAP A;  3G32 A;  4Y7P A;  4GD8 A;  2ZQD A;  3NBL A;  1K55 A;  4Q8I A;  1IYS A;  1QMF A;  4E6X A;  5J8X A;  1ZC2 A;  1Q2Q A;  2WGV A;  1I5Q A;  3IH9 A;  4WYY A;  4GB7 A;  1DY6 A;  1BLS A;  3S22 A;  5EE8 A;  1TEM A;  4CPK A;  3M2J A;  4JBF A;  2VGK A;  3I7J A;  5FQJ A;  3UPO A;  4DXB A;  1K54 C;  2DCF A;  5FA7 A;  3MKE A;  2P74 A;  1LHY A;  2A49 A;  2Q9N A;  1YMS A;  1NJ4 A;  3C5A A;  4GKU A;  4BEN A;  1PZO A;  2XGN A;  3ZGA B;  3VFF A;  1LLB A;  3OPP A;  4X53 A;  4ZDX A;  1PI4 A;  3M6B A;  5FAP A;  1RGZ A;  4K0X A;  2ZM8 A;  1ES5 A;  2X02 A;  3SS4 A;  1H8Y A;  1IKI A;  1EWZ A;  1ES4 A;  3QNB A;  1S0W A;  2WKH A;  4B88 A;  1SDN A;  4KZ6 A;  1ZG4 A;  5EEC A;  4GD6 A;  3IQA A;  4KG5 A;  5CXW A;  3IXB A;  3MZE A;  4DF6 A;  1GCE A;  5TR7 A;  2WKI A;  3M2K A;  1S6R A;  2ZM2 A;  5DTS A;  2JC7 A;  5EPH A;  5GLB A;  3UDI A;  2ZLY A;  4UAA A;  4H8R A;  4X68 A;  5TFQ A;  2EX8 A;  3FYZ A;  3DWK A;  3W4Q A;  1YLY A;  5CTM A;  1YLZ A;  3HUO A;  3VMA A;  2VGJ A;  1MWU A;  4DXC A;  5FQM A;  4OLD A;  2XK1 A;  4Y0U A;  3VFH A;  1O07 A;  2J9P A;  2EXB A;  3ZDJ A;  2XD1 A;  3E2K A;  5FAS A;  4MEZ A;  1FCM A;  3PBN A;  2Y2P A;  3N7W A;  2PU4 A;  3GTC A;  1E25 A;  4BL2 A;  3PAG A;  4X6T A;  4GZB A;  1H5X A;  4IVK A;  4K0W A;  3GMW A;  1I2W A;  1NYM A;  1K4F A;  4D2O A;  3GSG A;  4E3M A;  4BD1 A;  3WS5 A;  4FH4 A;  1KE0 A;  1NZU A;  1FSW A;  3B3X A;  3NI9 A;  2GDN A;  2QMI A;  3IF5 A;  2EFU A;  4RX3 A;  2HDU A;  3A3E A;  3UPN A;  1PWG A;  4ZJ3 A;  3BLS A;  1ALQ A;  1ES2 A;  1MWR A;  3FKW A;  3MXR A;  3S1Y A;  5FAT A;  2OLU A;  5DTT A;  2H10 A;  4XXR A;  3Q82 A;  4IBX A;  2Y2J A;  2B5R A;  4JF5 A;  4KQO A;  2Y2O A;  4KQQ A;  4OPZ A;  5AQ9 A;  1GA9 A;  3G30 A;  4R4S A;  1LI9 A;  2CC1 A;  3D4F A;  4MLL A;  4YIN A;  1SHV A;  3TOI A;  5E2G A;  3SH8 A;  1K38 A;  3GVB A;  4JF6 A;  3S4X A;  3VOZ A;  1XX2 A;  3PTE A;  3P98 A;  4E6W A;  4UA9 A;  4IED A;  4KZA A;  3VP2 A;  4R0Q A;  2QZ6 A;  5GLD A;  5FQK A;  3BM6 A;  1L0F A;  4OH0 A;  3W4P A;  1H8Z A;  1MBL A;  1TDG A;  4N92 A;  3ZG0 A;  4QU3 A;  5EOE A;  4GNU A;  2XD5 A;  1BLC A;  3Q7Z A;  5EVL A;  4KZ5 A;  2J9O A;  1J9M A;  4OKP A;  4LV2 A;  2V20 A;  4R3B A;  4BD0 A;  5HL1 A;  4OQ0 A;  2X71 A;  5KZH A;  2H0T A;  3NC8 A;  1VM1 A;  2ZQA A;  3CG5 A;  4Z9Q A;  4LV0 A;  5I94 A;  1HD8 A;  3NDG A;  3UE0 A;  1PIO A;  1CK3 A;  3Q7V B;  1XXM A;  5BOH A;  3MZD A;  2X01 A;  2ZMA A;  3BEC A;  4KZ4 A;  4ID4 A;  1CI9 A;  5A90 A;  1TDL A;  3HUN A;  2Z2M B;  2WGI A;  4WM9 A;  2XQZ A;  3GV9 A;  5FI2 A;  4KG6 A;  5G18 A;  5E2E A;  4U3T A;  4X55 A;  4DE2 A;  1JTG A;  2G2U A;  1XA1 A;  3G4P A;  3N8L A;  1G6A A;  4X69 A;  4C6Y A;  2V1Z A;  3G2Y A;  3O86 A;  2WGW B;  4MBH A;  1ESU A;  3VSL A;  2R9X A;  5FAO A;  2WUQ A;  4YFM A;  4PM5 A;  5CHJ A;  3RXX A;  4LV1 A;  5F1G A;  4S2N A;  2QPN A;  4HES A;  1YLJ A;  2EX2 A;  1LL9 A;  3LY3 A;  1JWZ A;  4P87 A;  3DW0 A;  2JE5 A;  1K56 D; 
#chains in the Genus database with same CATH topology
 3FZC A;  3CIT A;  1HVB A;  2XSS A;  1P3G C;  4X25 A;  2ACG A;  2Y59 A;  3SS5 A;  4B4Z A;  1OJG A;  1CI8 A;  3WX7 A;  3MGS C;  5AV6 D;  4WUJ A;  1TAF B;  1MWS A;  2CMN A;  3UT9 D;  1XGJ A;  4Z5T B;  4QJG A;  3G34 A;  3UTA D;  5GSU A;  2QYB A;  2JCH A;  4NFT A;  4QD4 A;  5AY8 A;  3FC7 A;  3IXH A;  3AV1 A;  3DWZ A;  3HLF A;  2VK3 A;  4JXG A;  2PU2 A;  2XA7 M;  3PBT A;  1ULY A;  4EER A;  2OSU A;  5CP6 C;  4KQD A;  3FWL A;  2DRW A;  4J8V C;  3TJZ C;  3W96 B;  1GA0 A;  2QJ7 A;  1QME A;  4OLG A;  3P5J B;  2ZQ8 A;  1NZO A;  1FSY A;  4EET B;  4GS9 A;  4FD8 A;  3A3I A;  3WAA D;  5AVC B;  3EPL A;  3B6F A;  4UA7 A;  2VGL S;  3ZG9 B;  5HDC A;  2JKT I;  3X1S B;  4Z2I A;  5B0Y A;  4CSR B;  5HSQ A;  4EBL A;  4X56 A;  5F82 A;  1YLW A;  3AZL D;  3Q07 A;  4XUJ D;  1PW1 A;  2UV0 E;  2WKE A;  1W7F A;  3HLB A;  1OME A;  1AOI C;  4IJE A;  2Y8H A;  3W99 B;  1L0D A;  4RQ9 A;  5B2I D;  3MQ0 A;  3KWQ A;  4Y0O A;  5HFO A;  4LRX C;  4OP5 A;  3B0B A;  4J8U C;  2ARO B;  4DRB A;  3WS0 A;  4P0M A;  3O62 B;  3X1V B;  4Y3I A;  2BG1 A;  3H7W B;  1K0K A;  3BY9 A;  3UT9 A;  5B31 C;  4FUW A;  1Z2C B;  4P85 A;  3UTA A;  2WAD A;  5M1A A;  3LZ0 D;  4BMW A;  5DF9 A;  1L6J A;  4RYE A;  3V3R A;  5CPI D;  3C1B C;  2O9B A;  3PBS A;  3T1R A;  2NUT C;  2Y2Q A;  3B0C T;  2NQB D;  2RCX A;  3LJA A;  1P3P B;  3VE3 A;  1S32 D;  5F99 B;  4LRY C;  4N1H A;  1ZHH B;  4DE0 A;  5KSC A;  3OPR A;  4MN6 A;  2A3U A;  3V50 A;  1UR9 A;  3GEC A;  2HIO C;  4NG2 A;  4PMA A;  2BAS A;  2V0W A;  3WAA A;  3IXG A;  4IBR A;  1CEG A;  1EI5 A;  2XDM A;  3VP4 A;  2PYO C;  5BT1 C;  5B1M C;  3P7N A;  1VET B;  2CWE A;  5AQA A;  4F94 A;  3PBQ A;  3AZL A;  4L0L A;  4XUJ A;  1P3K D;  4EWF A;  3LIA A;  4OJL A;  2ZY4 A;  3PBO A;  4QY5 A;  1GSV A;  4X1M A;  3F1O A;  3LCE A;  3V9R B;  1GHM A;  1YPR A;  1M1A D;  4HBU A;  5B2I A;  2NZD D;  4IBC A;  3ZVT A;  4U0X A;  2ZJ9 A;  1FR1 A;  1KX5 C;  1NY0 A;  1OTI A;  5CGX A;  3T4J A;  3ZG7 B;  4F3L A;  4LLO B;  2LB9 A;  4R3A A;  1PNE A;  4RA7 A;  3M7P A;  2XLN A;  1KGG A;  1NYY A;  2GX5 A;  4BBT A;  3WTP E;  3REJ D;  5AJG A;  5IHV A;  3RTY A;  4LPZ A;  3H82 A;  5B1L C;  2DMW A;  5IS1 A;  4WMC D;  3A3D A;  3QP2 A;  2NQB A;  1RGY A;  4LCL A;  1K57 C;  5CPJ B;  5B32 C;  2HJ9 C;  4H6J A;  3D3O A;  5U47 A;  3RJU A;  4NKP A;  1EQZ D;  4UHU A;  4J8W D;  4KUD C;  1DJC A;  1N9N A;  2Y2G A;  3MJQ A;  1TD5 A;  3SH7 A;  4IVI A;  5AV5 C;  1P3L B;  5IU1 A;  5A8B A;  1J7M A;  4HME A;  4LG2 A;  5HWT A;  2KX6 A;  3LZ1 C;  1TS6 A;  3AZJ A;  3T12 B;  1E3U D;  2B02 A;  5B0Z D;  4XZQ D;  3IBR A;  2HF6 A;  3WD0 A;  1H8M A;  3OCL A;  1H3O A;  3OOV A;  4N1X A;  1CJF A;  3UDF A;  1PWC A;  1TVF A;  4NK3 A;  1O7E A;  1P3K A;  2BLS A;  1TS7 A;  4LEN A;  3BFF A;  1W2E A;  1P3I B;  1ZLA B;  4NET A;  3O88 A;  1XPB A;  4WL9 A;  3OPL A;  3IX8 A;  2F8N D;  3F6T A;  2PDR A;  3V5M A;  1P3G D;  2NZD A;  3K3C A;  3A1I A;  2R78 A;  2ZOI A;  4ZUX C;  4OQH A;  3C38 A;  3GR2 A;  3MGS D;  4L9E A;  3LFV A;  5AQ7 A;  3BFD A;  1L2S A;  3MQO A;  1BUE A;  2W1R A;  3MS6 A;  3W97 C;  4IBK A;  2F8N H;  5JRG B;  5CRF A;  2EX9 A;  1FOF A;  3REJ A;  2JKR I;  4Y2F A;  3O5Y A;  4KG2 A;  5KIZ A;  4ETZ A;  2PYR A;  4Z2K A;  3TU4 C;  5AV9 A;  3ZNT A;  5F6A A;  2V2F F;  4KHA A;  1OGB A;  4H9Q B;  3L9K A;  4S2N C;  2EX6 A;  1A7W A;  4J8V D;  3MQQ A;  5FQ9 A;  4ZAM A;  3WS2 A;  3K3D A;  3MF0 A;  5EFW A;  3MQL A;  4GDB A;  1IKG A;  4Z2L A;  4WEJ A;  3U4L P;  1KVM A;  4OP8 A;  2ZL1 A;  2FJ7 D;  3LIC A;  3V3S A;  3REH A;  1M19 A;  1ACF A;  4OJ5 A;  3V67 A;  4JKT A;  3TRC A;  4BBV A;  4IUK A;  5CHU A;  5AY8 B;  1XP4 A;  2W3E A;  3N6I A;  1E3U A;  3HBR A;  3REI B;  3G32 A;  2D02 A;  4Y7P A;  3NBL A;  1K55 A;  4Q8I A;  1DP6 A;  1IYS A;  5GSU C;  5J8X A;  1ZC2 A;  1Q2Q A;  2WGV A;  3QP8 A;  1AOI D;  1H0G A;  3S22 A;  1TEM A;  2F8N G;  2F8N A;  1BFM A;  4CPK A;  1UGU A;  2VGK A;  1P3G A;  4CQH A;  4GS9 B;  2DCF A;  3A0S A;  3MKE A;  4CLC A;  1S4R A;  2A49 A;  3UB9 A;  4H9O A;  4J8U D;  4UEY A;  1NJ4 A;  4GKU A;  4BEN A;  3A6N A;  5BO0 B;  1T19 A;  3OPP A;  4X53 A;  4ZDX A;  3IX4 A;  5FAP A;  4EQ1 A;  4WU8 B;  2ZM8 A;  1EWZ A;  3QNB A;  5B31 D;  5MC7 A;  2W3H A;  3NUL A;  4GD6 A;  4KG5 A;  5GXQ D;  3JVU A;  1HQ3 B;  5TR7 A;  3T4T A;  4JGO A;  1HLU P;  5DTS A;  4LGW A;  3C1B D;  4IJG A;  5B0Y C;  2GNX A;  5EPH A;  1P9W A;  5GLB A;  2ZLY A;  5TFQ A;  2EX8 A;  3FYZ A;  3AZM D;  3DWK A;  3W4Q A;  1MWU A;  3VFH A;  4J8V A;  2XD1 A;  5AV6 B;  2Y2P A;  3N7W A;  3REL C;  3KWQ C;  2HIO D;  4H9N B;  4CAY A;  2FJ7 A;  2HV1 A;  3PAG A;  3MGR A;  1H5X A;  3MXQ A;  2HUE C;  2PBD P;  4E3M A;  1DRM A;  4BD1 A;  4FH4 A;  2FH5 A;  2PYO D;  2GDN A;  2QMI A;  3WTP B;  5BT1 D;  4HJ6 A;  5B1M D;  3MVD B;  4EES A;  4NYU A;  3LR3 A;  1ES2 A;  1MWR A;  2B18 A;  4J8X B;  2V1A A;  2Y2J A;  2B5R A;  4KQO A;  2A24 B;  4IBJ A;  4R4S A;  1S4S A;  5G49 A;  2CC1 A;  4YIN A;  2VKS A;  3AV2 C;  3TOI A;  3W98 D;  4G92 C;  1XX2 A;  3P98 A;  1M18 B;  4E6W A;  4UA9 A;  2K7S A;  2V1B A;  3LJA C;  4KZA A;  4R0Q A;  4IBI A;  5GLD A;  1KX5 D;  4J8U A;  3BM6 A;  1L0F A;  2O9C A;  2P08 A;  3W4P A;  1PZR A;  3REK C;  1TDG A;  1U35 C;  1XJ3 A;  5C3I B;  3CWF A;  2NUP C;  4GNU A;  1BLC A;  3Q7Z A;  5B31 G;  5B31 A;  4XUJ B;  1JFI A;  4LV2 A;  2V20 A;  1YKD A;  1E6P A;  5GXQ A;  4ZRR A;  4KGC A;  3A1K A;  5KZH A;  1KOU A;  1MC0 A;  4Z9Q A;  5B1L D;  5J3W A;  3KXB B;  3C1B A;  3F1P B;  1CK3 A;  1XXM A;  5B2I B;  4HI4 A;  3AZE D;  2GZA A;  4YS3 C;  4I3J A;  3AZL C;  3AZM A;  5B40 D;  1ZTU A;  1IOU A;  3KSF A;  3GV9 A;  5B32 D;  5B33 A;  1P3F C;  4LD9 C;  3N3F A;  3UTB B;  1MZU A;  4ME4 A;  1JTG A;  4KUD D;  4MBH A;  1ESU A;  3VSL A;  1LSW A;  4XT2 A;  2HIO A;  5AV5 D;  5F1G A;  2QPN A;  4HES A;  1YLJ A;  4EO5 B;  4QPR A;  3LY3 A;  3D9Y A;  3LZ0 B;  3LZ1 D;  5HD5 A;  1K56 D;  3E2L A;  5CPI B;  5B1M A;  5CER A;  2NQB B;  4E3N A;  2ZY3 A;  4OON A;  1S32 B;  3KUY C;  1BUL A;  2ZC4 B;  3LY4 A;  3OPH A;  5A92 A;  3AFA A;  5JYP A;  4NZ1 A;  3CLO A;  1ZKJ A;  4IJF A;  3B0D B;  3NQU A;  3BRM A;  3W98 A;  3KYZ A;  3HRE A;  4Y13 A;  4G3V A;  3G6O A;  1GSW A;  3C4P A;  4UQI S;  4ZUX D;  3GQZ A;  1BH8 A;  3WD3 A;  1KGF A;  2C6W B;  4BWI A;  1FCO A;  4GHI A;  1ID3 D;  2PHY A;  5GHY A;  3W97 D;  1IYP A;  4YNR A;  1P3K B;  1KU5 A;  5TBM B;  3AZK B;  5KMW A;  3AZG C;  3AZJ C;  3P09 A;  3R7W B;  3TU4 D;  4DE3 A;  3ZVW A;  2D49 A;  1M1A B;  1WWS A;  2NZD B;  3WA9 A;  3BLM A;  4OQI A;  4OPR A;  5GHZ A;  3VV4 A;  3SW1 A;  3AZE A;  2G5I C;  1XFN A;  1Y54 A;  5B40 A;  5D3O A;  1ZG6 A;  5CHM A;  4X23 D;  4H9P A;  4IBF A;  5B32 G;  5B32 A;  1K57 A;  1MWT A;  1W8Q A;  3MZF A;  4BLM A;  2JSS A;  4AWL B;  3C30 A;  1BH9 B;  4DKI A;  3C1C C;  1OGG A;  1MPL A;  3BFE A;  1ERO A;  2INW A;  5E5A D;  5AV5 A;  1KDW A;  2EXA A;  4Z66 C;  4M3K A;  4QWO A;  1YU0 A;  4YM6 C;  3REJ B;  1V9Y A;  2XEP A;  4MNR A;  3LZ1 A;  1P34 C;  1K56 A;  4GHA A;  4GLQ A;  4PKY G;  4PKY A;  3AGE A;  1HTZ A;  3NIA A;  5B24 A;  4KHA B;  4LV3 A;  3UME A;  3ZHH A;  3MGQ D;  1W63 Q;  4E44 A;  5AVB A;  5CGW A;  3T4O A;  2JBF A;  5GSU D;  2EFX A;  5EOO A;  3VP3 A;  3AN2 C;  1EQZ B;  3S7Q A;  3EEA A;  4QHC A;  4J8W B;  5AV9 C;  1BZA A;  3IWQ A;  3LEZ A;  2ZL1 B;  3C4O A;  1ERM A;  5AQB A;  3ZCZ A;  3LR0 A;  1ES3 A;  5DNN B;  4I5S A;  2V9A A;  4ZUX A;  1W1P A;  1T1C A;  3S7O A;  3B6G A;  5B0Z B;  3SH9 A;  1BSG A;  2IWC A;  4XZQ B;  2BYM A;  1ID3 A;  4UUZ B;  2PR5 A;  5DFY A;  1I2S A;  2ZC5 B;  1G28 A;  1P3B D;  3REH C;  1M19 C;  1F66 B;  1XA7 A;  2FZ0 A;  4DQY B;  3VH5 T;  3EGD C;  5HPF A;  5B2J A;  3TU4 A;  3EQV A;  3EPK A;  4ZBJ C;  4Z2H A;  4R8P A;  3IX3 A;  1C3B A;  1YLP A;  3O3V A;  1K55 C;  5HDS A;  4H9O B;  4HHD A;  4X23 A;  2J3W A;  3MGS B;  2XF3 A;  3SOI A;  3AZF A;  3A3F A;  5FUG A;  4HJ3 A;  5JA4 B;  3REL D;  5E5A A;  3KWQ D;  5F68 A;  2IA2 A;  4E3K A;  4CLC C;  2Y55 A;  5CGS A;  1PWD A;  1KS0 A;  4R38 A;  3WKJ C;  1JWP A;  3A6N C;  3IS2 B;  3CPT B;  3IT9 A;  1XJ4 A;  1NRF A;  1GSX A;  3Q81 A;  1NLY A;  2WKP A;  3MGQ A;  2JKT M;  2XFT A;  5CP6 B;  3AZH C;  3W4O A;  3MFD A;  3AZN A;  5FEG A;  3TSG A;  2G2W A;  4FSF A;  3AV2 D;  5DJT A;  5E43 A;  3OZH A;  2L1M A;  3BQA A;  4CAY B;  3E0Y A;  1B67 A;  1XKZ A;  1DP9 A;  3LJA D;  3IHB A;  3UE6 A;  1VB6 A;  3DTK A;  3QP1 A;  4K91 A;  4R4R A;  3REK D;  1LT0 A;  5FEF A;  1U35 D;  4WN5 A;  1P3B A;  4DRA A;  2FJ7 C;  3MGR C;  5EVI D;  5GL9 A;  2FFY A;  1A0K A;  1E8B A;  1TF1 A;  3FV7 A;  1AOI B;  2XR0 A;  4E3O A;  4ZJ2 A;  1YU2 A;  4Z5T C;  2M7V A;  5LBR A;  4S2L A;  1GHP A;  1YM1 A;  4YS3 D;  2Y2K A;  1PRQ A;  4NXB A;  3FKE A;  4XUZ A;  4S2I A;  1RP5 A;  4WEL A;  1JVJ A;  1P3F D;  4Y15 A;  4LD9 D;  1D1J A;  5M19 A;  4XUX A;  2OLV A;  3GRJ A;  1Z09 A;  2HPB A;  5GHX A;  1OPX A;  1WYB A;  1NWZ A;  1TS8 A;  3REL A;  3TW8 A;  3W96 C;  3HON A;  1AIW A;  2IWB A;  3L27 A;  4JXS A;  3QNC A;  2F2A C;  3E98 A;  3QP4 A;  2ZQ7 A;  2Y79 A;  3RH8 B;  3VH6 A;  4WZ5 C;  2HGV A;  2WAE A;  4O7D A;  3C2W A;  5BNX B;  3PBR A;  3KUY D;  5GXQ C;  3X1U C;  4KGC C;  4S2M A;  3AZI C;  1MKI A;  4H9S A;  3AV2 A;  3QHY A;  3FDD A;  4S2K A;  2HIO B;  3ULF A;  5CPK C;  4BBU A;  4JJN B;  3AZM C;  1CQA A;  3WS1 A;  2YFW B;  1ED7 A;  1BT5 A;  4P6B A;  1ONG A;  2Y2L A;  4MBK A;  5B33 C;  2PYO B;  5GLC A;  3ZG5 A;  4KZ9 A;  3REK A;  2PAV P;  1U35 A;  2Y91 A;  1PYY A;  5DF8 A;  2F8N K;  3UE3 A;  3O62 C;  1H0M A;  5EVI A;  3FPV A;  3AZG D;  3AZJ D;  3CZD A;  1W5D A;  3VOY A;  4WU9 A;  1AXB A;  1P3O D;  4YS3 A;  4KZ3 A;  1PI5 A;  1IYQ A;  5IT5 A;  2CV5 D;  1KX5 B;  1P3F A;  3MBZ A;  1H8P A;  2BYK A;  4LD9 A;  3AFA C;  4WEK A;  5DNM D;  4WNN B;  3C1C D;  3UDX A;  3F1N B;  3W98 C;  4HY8 A;  4G3W A;  4GD8 A;  3NEC A;  2ZQD A;  5AV8 C;  4Z66 D;  1QMF A;  4UQI M;  4WYY A;  4YM6 D;  1DY6 A;  1BLS A;  1Y28 A;  2RIQ A;  1P34 D;  5B1L B;  3MNN A;  3L26 A;  3UPO A;  4DXB A;  4HMD A;  5EM0 A;  2VZW A;  3KUY A;  5G4Z A;  1PZO A;  3VFF A;  3AN2 D;  1PI4 A;  3S7P A;  3MGP B;  4KUD B;  5AV9 D;  1ES5 A;  3WA9 C;  3VOL A;  1PFL A;  3AZE C;  3E4Q A;  5AV5 B;  1S0W A;  2WKH A;  4FOF A;  4HIA A;  4B88 A;  4KZ6 A;  1S1Z A;  3IQA A;  5B40 C;  1KX3 C;  4DF6 A;  1G6O A;  2ZM2 A;  4MN7 A;  1F5M A;  1YSP A;  3LEL D;  4X68 A;  2I9V A;  2ZMV A;  2E8J A;  1S1Y A;  3REH D;  1M19 D;  2VGJ A;  2LB5 A;  4L9F A;  3AZG A;  3CHW P;  5FAS A;  3NQJ A;  4MEZ A;  4ETX A;  5B24 C;  1E25 A;  1OTA A;  1P3O A;  5AVB C;  4ESP A;  3GSG A;  4ZUX B;  2CV5 A;  4HH2 A;  1KE0 A;  3B3X A;  4IHQ A;  4RX3 A;  1PWG A;  4ZJ3 A;  5KDM A;  5DNM A;  3C1C A;  5DFX A;  1X0O A;  1W1T A;  3W97 B;  2H10 A;  4M4X A;  2HZ5 A;  4KUK A;  4CLC D;  3X1T A;  4Z66 A;  2V8F A;  4IBG A;  4KQQ A;  4YM6 A;  5AQ9 A;  1GA9 A;  3WKJ D;  3A6N D;  1LI9 A;  4H9R A;  3B6G C;  3D4F A;  2VEA A;  1P34 A;  3TU4 B;  4E45 A;  2DF4 C;  1ID3 C;  1K38 A;  3GVB A;  1N1J A;  4HMC A;  5L10 A;  3SH8 A;  3LIB A;  2P7J A;  4Z1W A;  2QZ6 A;  3AZH D;  3LUQ A;  4OH0 A;  3AN2 A;  5B2J C;  3VH5 W;  1T1B A;  1PDC A;  4QU3 A;  5EOE A;  4R8P C;  5F5Y A;  2OWJ A;  2JN7 A;  1P3I C;  5HL1 A;  3A0R A;  4X23 C;  1P3A A;  2X71 A;  3NC8 A;  3AZF C;  4NZ3 A;  2QKP A;  4O8G A;  1PIO A;  3BEC A;  3LEL A;  4HH3 A;  5E5A C;  3U2A A;  3QP6 A;  3UMD A;  3MGR D;  2Z2M B;  2XRO A;  2WGI A;  5GSU B;  3PYP A;  1VEU A;  4HP4 A;  4U3T A;  3MFX A;  4X55 A;  4DE2 A;  3A0V A;  3AV1 B;  1XA1 A;  3G4P A;  3EEH A;  3N8L A;  4X69 A;  1E88 A;  4Z5T D;  5JRG C;  3O86 A;  2R9X A;  4FTX A;  5GT0 A;  5CHJ A;  3WD1 A;  2YKF A;  3MGQ C;  2EX2 A;  4HGA C;  1QO6 A;  2V5O A;  1JWZ A;  3DW0 A;  3AZN C;  1YAX A;  4QNL A;  1JTD A;  1KE3 A;  5BNV A;  1CXW A;  5DKL A;  1SDE A;  1LI0 A;  3W96 D;  4PM9 A;  3S7N A;  3MXS A;  1P9R A;  2J8P A;  1YMX A;  4DDY A;  2EWV A;  3ISG A;  2Z6C A;  3FPW A;  4MDZ A;  2HDR A;  3T50 A;  3B6F B;  3WKJ A;  5GT3 C;  5EV0 A;  4EV4 A;  5B0Y B;  3C7V A;  5CEB A;  3AGD A;  3SZT A;  1P3B C;  4DN0 A;  4JPM A;  2A2L A;  1GPF A;  5AVF A;  3T4L A;  3AZH A;  3X1S D;  4BL3 A;  3X1U D;  4KGC D;  4M6B A;  3AZI D;  1K54 A;  5K5B A;  1BYW A;  1TZY A;  3KWQ B;  5CPK D;  5EM1 A;  5HAI A;  5BS7 A;  2W1T A;  5FI7 A;  2HUE B;  1MKM A;  2VV6 A;  2W3G A;  5B33 D;  1FCN A;  1YQS A;  4MB5 A;  4HJ4 A;  4LRZ E;  3KSY A;  3T1S A;  3WD2 A;  3HLD A;  4PM6 A;  1DP8 A;  3UT9 B;  1XGI A;  4NXE A;  3WS4 A;  5FSR A;  2ARO D;  3Q1F A;  1T3U A;  3O87 A;  3O62 D;  5CTN A;  3X1V D;  3UTA B;  4KUO A;  4WZ4 A;  1TAF A;  1SCW A;  1L0G A;  4Z5T A;  5L2F A;  3CJM A;  3DAV A;  4G92 B;  3A3J A;  1HQ3 C;  3LJA B;  4YOF A;  3HLW A;  3HL9 A;  3L25 A;  3VSK A;  3ITB A;  3AFA D;  2OOL A;  4OOY A;  4H9S C;  3G2Z A;  1P3P D;  1U35 B;  2FFF B;  2H28 A;  4G91 C;  3W96 A;  5AV8 D;  3B0C W;  3WAA B;  4LCM A;  3UO9 A;  3H0L C;  1UWN X;  3HSH A;  3CUE A;  1IEL A;  3EPJ A;  4B4X A;  1DJB A;  5AVE A;  4R6L A;  5G4Y A;  4OOL A;  5AVC A;  3AZL B;  1NRJ A;  4WZ5 A;  2GJ3 A;  4TX8 A;  5EVI C;  2Y2I A;  3DTM A;  1IEM A;  3X1S A;  3MVD C;  1P3F B;  3X1U A;  4CSR A;  3AZI A;  3F1O B;  3K2N A;  2Y4A A;  4DDS A;  3BWL A;  3N4I A;  1PZP A;  4WU9 C;  3WA9 D;  1KGE A;  3KSG A;  4EUZ A;  5CPK A;  2PBY A;  4WF0 A;  1W79 A;  1FIK A;  3VP1 A;  3W99 A;  3HUM A;  1KX3 D;  2KLI A;  4HQA A;  1M18 C;  2VV8 A;  2Q9M A;  4OOM A;  2WAF A;  4F3L B;  2IO5 C;  1IFQ A;  3VP0 A;  4NE3 A;  2ARO A;  4MB3 A;  2ZMF A;  3O62 A;  2H0Y A;  3X1V A;  4FCF A;  3H7W A;  3UPP A;  2OAQ 1;  1VQQ A;  4NZ4 A;  3H82 B;  4DRT A;  1J3W A;  3MNN C;  4ZBE A;  3L29 A;  5B24 D;  3LGO A;  5AVB D;  3E4P A;  3IF6 C;  3RXW A;  4Z2M H;  2VLG A;  4H6J B;  1IYO A;  4D60 A;  2G5H C;  4QB8 A;  1E6N A;  2IWD A;  2LY8 A;  3IBJ A;  1P3P A;  5CPJ D;  1JWV A;  5F99 A;  2OWH A;  3AYW C;  5AV8 A;  1Q2P A;  5A93 A;  3AZJ B;  3B6G D;  2WK0 A;  2HP9 A;  5CED A;  1H3O B;  1F9I A;  4EO5 C;  3ZG8 B;  2Z6D A;  3UNW A;  2JKG A;  3PAE A;  4Q0J A;  2C5W B;  1Z6F A;  4OPQ A;  4PPR A;  1N4O A;  5KDM B;  3WWX A;  5B2J D;  1JNU A;  4KEN B;  4JGP A;  4R8P D;  3UB5 P;  1P3O C;  1P3I D;  3EGX C;  5HL6 A;  3V9R A;  4YM6 B;  2Z2L B;  2CV5 C;  1KX3 A;  1SKO A;  3AZF D;  4S2O A;  1P34 B;  2HDS A;  2PT7 A;  3NOU C;  5J7E A;  4N9L A;  5DNM C;  3T1Q B;  1LL5 A;  4O0P A;  5L07 A;  3B42 A;  1K6R A;  4Z2M G;  2J8Y A;  2PYP A;  3HCY A;  3X1T C;  1BLP A;  3EPH A;  4UA6 A;  3LYX A;  2ZY2 A;  3R45 A;  5AV9 B;  5JRG D;  4JGR A;  1KX4 C;  4K08 A;  2RTS A;  1MY8 A;  3UY6 A;  1G5U A;  4R3J A;  3AZK C;  2WYX A;  2I72 A;  5FL3 A;  3L28 A;  4FH2 A;  3AZN D;  3CAX A;  1TS0 A;  1MXO A;  4E3L A;  3MMH A;  3BFC A;  5J4E A;  2O99 A;  4Y0T A;  1E6Z A;  3NJA A;  5DTK A;  3EG5 B;  5CPJ A;  1OT6 A;  3REH B;  1M19 B;  4AWL C;  4GDN A;  1VEU B;  1P3A C;  2K31 A;  4A5R A;  1N9B A;  3H0R C;  5GT3 D;  3G35 A;  2AVX A;  1HZO A;  2XRN A;  3LEL C;  1WYC A;  3LO7 A;  5DVA A;  3G31 A;  5HDD A;  2HP6 A;  1FQG A;  1W1Y A;  3N8R A;  3BEB A;  1BTL A;  4N9K A;  1L3L A;  1E4D A;  5FDH A;  3BQ8 A;  3KO6 A;  5M18 A;  4EQI A;  2F8N B;  3MSH A;  4E3J A;  5E2F A;  2WZZ A;  5GT0 C;  1P3G B;  1P3M C;  4MBF A;  4QY6 A;  2ZOH A;  3LEQ A;  1P3I A;  4CLC B;  4HBT A;  1NXY A;  3A6N B;  3WRT A;  3LI9 A;  4KZ7 A;  4MN5 A;  4EBN A;  1Q9C A;  1EAK A;  4JXV A;  4HNB A;  2XH9 A;  4S2P A;  4NE6 A;  4EEU A;  3T4Q A;  4QLC C;  1F66 C;  5JRG A;  5HAP A;  4IBB A;  1HQ3 D;  2W1T B;  4E6X A;  4DJ2 A;  3IH9 A;  1I5Q A;  4GB7 A;  2PRF A;  4J8V B;  5DKK A;  2G7U A;  3M2J A;  4H9Q A;  3I7J A;  1P0Z A;  1K54 C;  3FG8 A;  1TZY C;  2FJ7 B;  4WJ3 C;  2QJ5 A;  2Q9N A;  3MGR B;  5BS7 C;  1YMS A;  3M6B A;  4MCW A;  1NLZ A;  5GT3 A;  1RGZ A;  3SS4 A;  1H8Y A;  1IKI A;  1ZG4 A;  3OBF A;  5EEC A;  4R70 A;  3VE4 A;  3WTP D;  3MVD D;  1GCE A;  5DJU A;  4OJ6 A;  2WKI A;  3M2K A;  4IBE A;  4HP9 A;  5G49 B;  4J8X D;  3REI A;  3UDI A;  2ZM5 A;  4WU9 D;  3JPU A;  1YLY A;  1S67 L;  3HUO A;  3VMA A;  5FQM A;  2XK1 A;  4Y0U A;  3BY8 A;  4J8U B;  3E2K A;  4II7 A;  1M18 D;  2PU4 A;  3HJK A;  4K0W A;  3NOP C;  3GMW A;  1I2W A;  4D2O A;  5B31 B;  1JFI B;  5BO0 A;  1STZ A;  3WS5 A;  1GOI A;  1FSW A;  5GXQ B;  3X1U B;  4KGC B;  3IF5 A;  3AZI B;  5HWV A;  4WU8 A;  2HDU A;  3A3E A;  2B95 A;  3BLS A;  3CUE C;  3LIE A;  3C1B B;  3LIF A;  2OLU A;  4P6Z S;  5FAT A;  3MNN D;  5DTT A;  2VV7 A;  5CPK B;  5AVC C;  3AZM B;  4IBX A;  4X1L A;  1HQ3 A;  4EXO A;  4OPZ A;  3KXB D;  3X1S C;  5B33 B;  3G30 A;  1H0I A;  1V9Z A;  3L7H A;  4IED A;  4XT2 B;  1OTD A;  3D72 A;  3AYW D;  3H0M C;  3UTB D;  5AV6 A;  3W99 C;  1E6R A;  1H8Z A;  2W3F A;  4N92 A;  3ZG0 A;  4H9N A;  5B1M B;  3AL0 C;  4E04 A;  2XD5 A;  5EVL A;  2J9O A;  1J9M A;  2ARO C;  4OKP A;  4BD0 A;  3EWK A;  3X1V C;  3WTP A;  4NYY A;  3LR5 A;  3MVD A;  1VM1 A;  1HD8 A;  3UE0 A;  3AFA B;  4J8X A;  2X01 A;  2ZMA A;  3NQU B;  4KZ4 A;  4ID4 A;  3W98 B;  1CI9 A;  5A90 A;  2VQR A;  2A24 A;  5AV8 B;  4WM9 A;  2XQZ A;  3KX0 X;  2VJW A;  5FI2 A;  4KG6 A;  1BH8 B;  1OJ5 A;  4C6Y A;  2G2U A;  1G6A A;  4GHI B;  3G2Y A;  4JJN C;  1M18 A;  4OJP A;  1SZV A;  2WUQ A;  2FN2 A;  1P3P C;  4YFM A;  3ZQ5 A;  5F99 C;  1YU3 A;  1LL9 A;  3X1T D;  5E2H A;  4KZB A;  5F83 A;  1KX4 D;  1YU1 A;  4KQR A;  3WA9 B;  2J80 A;  3AZE B;  2ZM0 A;  3AZK D;  1B6W A;  4ARZ A;  3UB8 A;  3NCK A;  2ZC3 B;  1G68 A;  3L2A A;  5B40 B;  2ZQC A;  4OUI A;  2P9V A;  3IF6 A;  4C3Q A;  4H9P B;  3KXB A;  1KX3 B;  5B32 B;  1VHM A;  1SKO B;  3F1P A;  3ICY A;  1ESI A;  1KDS A;  2OAP 1;  4EEP A;  4JF4 A;  2Y2M A;  4Q0H A;  2RVQ C;  4Z2G A;  1CF0 A;  3KYQ A;  3AYW A;  3T1X A;  3WRZ A;  3UTB A;  3TG9 A;  1P3A D;  2K2N A;  3LZ1 B;  4NE5 A;  4ZTK A;  3V39 A;  3R45 B;  4GH9 A;  1PW8 A;  4RVA A;  5B24 B;  3QP5 A;  4OJO A;  5F1F A;  3LZ0 A;  1YSQ A;  5AVB B;  5DF7 A;  4UPK A;  5HWW A;  5A91 A;  5CPI A;  4GJ4 A;  5EUA A;  5TGF A;  3IXD A;  1CEF A;  1S32 A;  2JKR M;  5GT0 D;  1P3M D;  1YUE A;  3M6H A;  3EQU A;  2Y2N A;  5GLA A;  4JXW A;  4EW7 A;  3MGP C;  4U0T A;  3B6G B;  2BYM B;  3LR4 A;  1ID3 B;  1K4E A;  2WKR A;  2L5A A;  5DNN D;  5HX9 A;  1AWI A;  1L0E A;  3JYI A;  3FKV A;  5CPJ C;  4OQG A;  3MKF A;  4EUV A;  1OTE A;  4DE1 A;  2YFV A;  4WLA A;  4RX2 A;  1N9L A;  3B33 A;  5B2J B;  3OC2 A;  3PR6 A;  4JLF A;  4QLC D;  1F66 D;  1P3L C;  2WKQ A;  1KX4 A;  4MMN A;  5FAQ A;  4R8P B;  5TBM A;  3AZK A;  3R4K A;  4O01 A;  3R7W A;  2ZC7 A;  4I38 A;  2RL3 A;  4X23 B;  3AZF B;  1M1A A;  1CK7 A;  4PM7 A;  5FUG B;  1F98 A;  1TZY D;  5E5A B;  3KYE A;  3KS8 A;  1ZLA C;  1YT4 A;  1KE4 A;  1BH9 A;  5HW3 A;  4GCZ A;  2ZD8 A;  2Q0O A;  3LID A;  2PD7 A;  1W63 M;  2V0U A;  3MGQ B;  1D7E A;  1ERQ A;  3HLE A;  1XFQ A;  1P97 A;  1T18 A;  3DBA A;  4HGA B;  1N9O A;  3ZFZ A;  1U60 A;  3AZN B;  3T4S A;  1F1E A;  2ZQ9 A;  2HDQ A;  3C7U A;  5HZH A;  4WMC A;  3VH6 T;  2HP5 A;  3KSI A;  2XFS A;  4BJP A;  1WA9 A;  5CP6 D;  4NZ5 A;  1P3M A;  2WZX A;  3IWI A;  1EQZ A;  4R23 A;  1OT9 A;  4J8W A;  5GT3 B;  4NXG A;  4OPY A;  4WBG A;  5DNN A;  5FQI A;  1P3B B;  2VA0 A;  2QWS A;  2L4R A;  4WZS B;  4S2J A;  5B0Z A;  4XZQ A;  1FR6 A;  4UUZ A;  1YLT A;  2J7V A;  1ODV A;  4DMZ A;  3Q7V A;  4QLC A;  1F66 A;  1SKF A;  3H9W A;  4B9O A;  4E3I A;  4Y17 A;  5AVC D;  5AY8 C;  3OLO A;  3AV1 C;  3LI8 A;  3UE1 A;  1S66 L;  2JHE A;  5I5L A;  2WGW A;  3REI C;  5HAQ A;  5HD3 A;  3N8S A;  3REL B;  2H5S A;  3MGS A;  3T4K A;  2O9A A;  3W99 D;  4I39 A;  5JA4 A;  4IBD A;  1WE4 A;  5FI6 A;  4GN2 A;  2DQN C;  4YWZ A;  3B6F C;  4B93 A;  2VGL M;  3IS2 A;  3NY4 A;  3CPT A;  5CEC A;  2Y2H A;  2V8C A;  5EVE A;  3BFG A;  4AFI A;  4ZJ1 A;  4WU8 C;  2XA7 S;  4KZ8 A;  2J3T C;  3AV2 B;  4L9G A;  3ITA A;  3ZNY A;  2UWX A;  3W2Z A;  5CP6 A;  4P6Z M;  4G91 B;  4PM8 A;  2YKH A;  1DJA A;  4GHL A;  1FIL A;  3HVF A;  1GHI A;  2W0N A;  4EBP A;  3UB7 A;  4JJN D;  5L09 A;  3REK B;  4CLC E;  5F99 D;  5KSH A;  2DNS A;  1BLH A;  5EVI B;  2ZC6 B;  5AV6 C;  3CMZ A;  4C75 A;  3HLG A;  2M7U A;  3RFB A;  4HEF A;  3UT9 C;  4MB4 A;  2E8I A;  3SS3 A;  3VH5 A;  2ZY5 A;  2W3D A;  3ZYT A;  4WU9 B;  4R1G A;  3UTA C;  4DJ3 A;  4YS3 B;  4I3I A;  3UB6 A;  3HLC A;  3W8K A;  1W8Y A;  5FQQ A;  1AOI A;  3WTP C;  2R9W A;  5HAR A;  3KFU G;  3KSH A;  2D01 A;  2BYK B;  4LD9 B;  4IUH A;  4J8X C;  3IH8 A;  2IO5 B;  2RVQ D;  1OTB A;  3BYD A;  1RCJ A;  2OV5 A;  1M6K A;  3UN7 A;  3NDE A;  1XJ2 A;  4BQM A;  2P04 A;  1T1A A;  3AGF A;  1E15 A;  3OCN A;  4PHT A;  3DTE A;  2L0W A;  3MNN B;  3WAA C;  4GOG A;  2JKF A;  5JYO A;  4ARZ B;  3KS4 A;  5CX7 A;  4CJN A;  3BW6 A;  1HTA A;  2P9V B;  3IF6 B;  1F2K A;  1ONH A;  3KUY B;  5C3I C;  1K25 A;  1LL8 A;  4G3K A;  4XUJ C;  4EU0 A;  5BNX A;  1M40 A;  1EW0 A;  3AYW B;  1K6S A;  3EOI A;  3MGP D;  3KXB C;  1KVL A;  5B2I C;  1Y4O A;  3NHQ A;  5HPI A;  1GXD A;  4OVD A;  3IWO A;  3IHA A;  4Y5F A;  4JJN A;  1LSV A;  2YFW A;  2PYO A;  3UTB C;  5EE8 A;  3HJI A;  1O6I A;  3AZG B;  4JBF A;  3NQJ B;  5FQJ A;  1P3L D;  1WWI A;  5FA7 A;  2MJ6 A;  1D06 A;  2P74 A;  1LHY A;  1P3O B;  4LFU A;  5C5K A;  3LZ0 C;  3C5A A;  5CPI C;  2XGN A;  3ZGA B;  2CV5 B;  5FDS A;  1LLB A;  1VET A;  4K0X A;  2NQB C;  4NEE D;  2X02 A;  5DNM B;  3C1C B;  1ES4 A;  1S32 C;  1SDN A;  1KX5 A;  2IOU A;  2M1C A;  4Z2J A;  1ZLA D;  3X1T B;  4Z66 B;  5CXW A;  3IXB A;  3MZE A;  2YFV B;  2BTF P;  1S6R A;  4WNN A;  3B0D C;  3F1N A;  4H9R B;  2PD8 A;  2JC7 A;  2EA9 A;  4UAA A;  4H8R A;  1N1J B;  1KX4 B;  5CTM A;  1XJ6 A;  1YLZ A;  4DXC A;  3DTI A;  4OLD A;  1R4V A;  2HJE A;  1O07 A;  2J9P A;  2EXB A;  3ZDJ A;  5B1L A;  1FCM A;  3IP4 C;  3PBN A;  3AN2 B;  4NY2 A;  4WV4 B;  3GTC A;  4BL2 A;  4X6T A;  1P3K C;  4GZB A;  5TJJ A;  4IVK A;  3WD4 A;  1NYM A;  1K4F A;  1YU4 A;  3P01 A;  2PR6 A;  1NZU A;  3NI9 A;  2EFU A;  3MGP A;  1P3A B;  4KUD A;  3UPN A;  1M1A C;  3PHY A;  2NZD C;  1ALQ A;  3C8C A;  3FKW A;  3MXR A;  3S1Y A;  3LEL B;  4XXR A;  3Q82 A;  4JF5 A;  1H3Q A;  2Y2O A;  3NOT C;  3E4O A;  4I3A A;  4MLL A;  5BPV A;  1SHV A;  5E2G A;  2QHK A;  4JF6 A;  3S4X A;  3VOZ A;  3PTE A;  1P3L A;  1UWP X;  5GT0 B;  1P3M B;  4ZBJ B;  3VP2 A;  3REJ C;  5CHL B;  5FQK A;  3PXP A;  5AY8 D;  1UR8 A;  3AV1 D;  2EWW A;  1LSX A;  3CI6 A;  1MBL A;  4GW9 A;  3BJN A;  3REI D;  3VH6 W;  5BNV B;  4KZ5 A;  4R3B A;  3TE8 A;  4Q0I A;  4OQ0 A;  1ZLA A;  1EQZ C;  2H0T A;  2ZQA A;  3CG5 A;  4J8W C;  4LV0 A;  5I94 A;  3WKJ B;  3NDG A;  5F69 A;  3Q7V B;  2O0Y A;  5BOH A;  3MZD A;  3W97 A;  3B47 A;  2W27 A;  3JVV A;  4NXF A;  4QLC B;  5DNN C;  1TDL A;  3HUN A;  2KOI A;  1W1V A;  3B6F D;  2VX8 A;  5B0Z C;  5G18 A;  5E2E A;  3AZH B;  4XZQ C;  5B0Y D;  2ZBB A;  2W8S A;  4WU8 D;  2V1Z A;  2WGW B;  2J3T D;  5FAO A;  4HOI A;  4PM5 A;  3RXX A;  5L8M A;  4LV1 A;  1TZY B;  4S2N A;  2KDK A;  3MR0 A;  4P87 A;  3GDI A;  4JGQ A;  4PAU A;  2JE5 A; 
#chains in the Genus database with same CATH homology
 3FZC A;  1HVB A;  1P3G C;  2Y59 A;  3SS5 A;  4B4Z A;  1CI8 A;  3WX7 A;  3MGS C;  5AV6 D;  1TAF B;  1MWS A;  3UT9 D;  1XGJ A;  4Z5T B;  4QJG A;  3G34 A;  3UTA D;  5GSU A;  4QD4 A;  2JCH A;  4NFT A;  5AY8 A;  3IXH A;  3AV1 A;  3DWZ A;  3HLF A;  4JXG A;  2PU2 A;  3PBT A;  1ULY A;  2OSU A;  5CP6 C;  3FWL A;  2DRW A;  4J8V C;  3W96 B;  1GA0 A;  1QME A;  4OLG A;  3P5J B;  2ZQ8 A;  1NZO A;  1FSY A;  4FD8 A;  3A3I A;  3WAA D;  5AVC B;  3EPL A;  3B6F A;  4UA7 A;  3ZG9 B;  3X1S B;  5B0Y A;  4CSR B;  4EBL A;  4X56 A;  5F82 A;  1YLW A;  3AZL D;  3Q07 A;  4XUJ D;  1PW1 A;  2WKE A;  1W7F A;  3HLB A;  1OME A;  1AOI C;  4IJE A;  3W99 B;  1L0D A;  5B2I D;  3KWQ A;  4Y0O A;  5HFO A;  4OP5 A;  3B0B A;  4J8U C;  2ARO B;  4DRB A;  3WS0 A;  4P0M A;  3O62 B;  3X1V B;  2BG1 A;  3UT9 A;  5B31 C;  1Z2C B;  4P85 A;  3UTA A;  2WAD A;  5M1A A;  3LZ0 D;  5DF9 A;  4RYE A;  3V3R A;  5CPI D;  3C1B C;  3PBS A;  2Y2Q A;  3B0C T;  2NQB D;  2RCX A;  3LJA A;  1P3P B;  1S32 D;  5F99 B;  4N1H A;  4DE0 A;  5KSC A;  3OPR A;  2A3U A;  3V50 A;  4PMA A;  2HIO C;  3WAA A;  3IXG A;  4IBR A;  1CEG A;  1EI5 A;  2XDM A;  3VP4 A;  2PYO C;  5BT1 C;  5B1M C;  2CWE A;  5AQA A;  4F94 A;  3PBQ A;  3AZL A;  4L0L A;  4XUJ A;  1P3K D;  4EWF A;  4OJL A;  2ZY4 A;  3PBO A;  4QY5 A;  3LCE A;  3V9R B;  1GHM A;  1M1A D;  4HBU A;  5B2I A;  2NZD D;  4IBC A;  3ZVT A;  4U0X A;  2ZJ9 A;  1FR1 A;  1KX5 C;  1NY0 A;  5CGX A;  3ZG7 B;  4RA7 A;  2XLN A;  1KGG A;  1NYY A;  3WTP E;  3REJ D;  5IHV A;  5B1L C;  4WMC D;  3A3D A;  2NQB A;  1RGY A;  4LCL A;  1K57 C;  5CPJ B;  5B32 C;  5U47 A;  3RJU A;  1EQZ D;  4UHU A;  4J8W D;  4KUD C;  1DJC A;  2Y2G A;  3SH7 A;  4IVI A;  5AV5 C;  1P3L B;  4LG2 A;  3LZ1 C;  3AZJ A;  1E3U D;  5B0Z D;  4XZQ D;  3OCL A;  1H3O A;  4N1X A;  3UDF A;  1PWC A;  1TVF A;  4NK3 A;  1O7E A;  1P3K A;  2BLS A;  4LEN A;  3BFF A;  1W2E A;  1P3I B;  1ZLA B;  4NET A;  3O88 A;  1XPB A;  3OPL A;  2F8N D;  3F6T A;  3V5M A;  1P3G D;  2NZD A;  3A1I A;  4ZUX C;  4OQH A;  3GR2 A;  3MGS D;  5AQ7 A;  3BFD A;  1L2S A;  1BUE A;  3W97 C;  4IBK A;  2F8N H;  5JRG B;  5CRF A;  2EX9 A;  1FOF A;  3REJ A;  4KG2 A;  3TU4 C;  5AV9 A;  3ZNT A;  2V2F F;  4KHA A;  4H9Q B;  4S2N C;  2EX6 A;  1A7W A;  4J8V D;  5FQ9 A;  3WS2 A;  4ZAM A;  4GDB A;  1IKG A;  4WEJ A;  1KVM A;  4OP8 A;  2FJ7 D;  3V3S A;  3REH A;  1M19 A;  4OJ5 A;  4JKT A;  5CHU A;  5AY8 B;  1XP4 A;  3N6I A;  1E3U A;  3HBR A;  3REI B;  3G32 A;  4Y7P A;  3NBL A;  1K55 A;  4Q8I A;  1IYS A;  5GSU C;  5J8X A;  1ZC2 A;  1Q2Q A;  2WGV A;  1AOI D;  3S22 A;  1TEM A;  2F8N G;  2F8N A;  1BFM A;  4CPK A;  2VGK A;  1P3G A;  2DCF A;  3MKE A;  2A49 A;  4H9O A;  4J8U D;  1NJ4 A;  4GKU A;  4BEN A;  3A6N A;  5BO0 B;  3OPP A;  4X53 A;  4ZDX A;  5FAP A;  4WU8 B;  2ZM8 A;  1EWZ A;  3QNB A;  5B31 D;  4GD6 A;  4KG5 A;  5GXQ D;  1HQ3 B;  5TR7 A;  5DTS A;  3C1B D;  5B0Y C;  5EPH A;  5GLB A;  2ZLY A;  5TFQ A;  2EX8 A;  3FYZ A;  3AZM D;  3DWK A;  3W4Q A;  1MWU A;  3VFH A;  4J8V A;  2XD1 A;  5AV6 B;  2Y2P A;  3N7W A;  3REL C;  3KWQ C;  2HIO D;  4H9N B;  4CAY A;  2FJ7 A;  3PAG A;  3MGR A;  1H5X A;  2HUE C;  4E3M A;  4BD1 A;  4FH4 A;  2PYO D;  2GDN A;  2QMI A;  3WTP B;  5BT1 D;  5B1M D;  3MVD B;  4NYU A;  1ES2 A;  1MWR A;  4J8X B;  2Y2J A;  2B5R A;  4KQO A;  4IBJ A;  4R4S A;  5G49 A;  2CC1 A;  4YIN A;  3AV2 C;  3TOI A;  3W98 D;  4G92 C;  1XX2 A;  3P98 A;  1M18 B;  4E6W A;  4UA9 A;  3LJA C;  4KZA A;  4R0Q A;  4IBI A;  5GLD A;  1KX5 D;  4J8U A;  3BM6 A;  1L0F A;  3W4P A;  1PZR A;  3REK C;  1TDG A;  1U35 C;  5C3I B;  4GNU A;  1BLC A;  3Q7Z A;  5B31 G;  5B31 A;  4XUJ B;  1JFI A;  4LV2 A;  2V20 A;  5GXQ A;  4KGC A;  3A1K A;  5KZH A;  4Z9Q A;  5B1L D;  3KXB B;  3C1B A;  1CK3 A;  1XXM A;  5B2I B;  3AZE D;  4YS3 C;  3AZL C;  3AZM A;  5B40 D;  3GV9 A;  5B32 D;  5B33 A;  1P3F C;  4LD9 C;  3N3F A;  3UTB B;  1JTG A;  4KUD D;  4MBH A;  1ESU A;  3VSL A;  2HIO A;  5AV5 D;  5F1G A;  2QPN A;  4HES A;  1YLJ A;  4EO5 B;  3LY3 A;  3LZ0 B;  3LZ1 D;  1K56 D;  3E2L A;  5CPI B;  5B1M A;  5CER A;  2NQB B;  4E3N A;  2ZY3 A;  4OON A;  1S32 B;  3KUY C;  1BUL A;  2ZC4 B;  3LY4 A;  3OPH A;  5A92 A;  3AFA A;  5JYP A;  4NZ1 A;  1ZKJ A;  4IJF A;  3B0D B;  3NQU A;  3BRM A;  3W98 A;  3HRE A;  3C4P A;  4ZUX D;  3GQZ A;  1BH8 A;  1KGF A;  2C6W B;  1FCO A;  1ID3 D;  5GHY A;  3W97 D;  1IYP A;  1P3K B;  1KU5 A;  3AZK B;  5KMW A;  3AZG C;  3AZJ C;  3P09 A;  3TU4 D;  4DE3 A;  3ZVW A;  1M1A B;  1WWS A;  2NZD B;  3WA9 A;  3BLM A;  4OQI A;  4OPR A;  5GHZ A;  3AZE A;  2G5I C;  1Y54 A;  5B40 A;  5D3O A;  1ZG6 A;  5CHM A;  4X23 D;  4H9P A;  4IBF A;  5B32 G;  5B32 A;  1K57 A;  1MWT A;  1W8Q A;  3MZF A;  4BLM A;  2JSS A;  4AWL B;  1BH9 B;  4DKI A;  3C1C C;  3BFE A;  1MPL A;  1ERO A;  5E5A D;  5AV5 A;  1KDW A;  2EXA A;  4Z66 C;  4M3K A;  1YU0 A;  4YM6 C;  3REJ B;  2XEP A;  4MNR A;  3LZ1 A;  1P34 C;  1K56 A;  4GHA A;  3AGE A;  1HTZ A;  3NIA A;  5B24 A;  4KHA B;  4LV3 A;  3ZHH A;  3MGQ D;  4E44 A;  5AVB A;  5CGW A;  2JBF A;  5GSU D;  2EFX A;  5EOO A;  3VP3 A;  3AN2 C;  1EQZ B;  4QHC A;  4J8W B;  5AV9 C;  1BZA A;  3IWQ A;  3LEZ A;  3C4O A;  1ERM A;  5AQB A;  3ZCZ A;  1ES3 A;  5DNN B;  4ZUX A;  3B6G A;  5B0Z B;  3SH9 A;  1BSG A;  2IWC A;  4XZQ B;  2BYM A;  1ID3 A;  4UUZ B;  1I2S A;  2ZC5 B;  1P3B D;  3REH C;  1M19 C;  1F66 B;  1XA7 A;  4DQY B;  3VH5 T;  5B2J A;  3TU4 A;  3EQV A;  3EPK A;  4ZBJ C;  4R8P A;  1C3B A;  1YLP A;  3O3V A;  1K55 C;  4H9O B;  4X23 A;  3MGS B;  2XF3 A;  3SOI A;  3AZF A;  3A3F A;  5FUG A;  5JA4 B;  3REL D;  5E5A A;  3KWQ D;  4E3K A;  2Y55 A;  5CGS A;  1PWD A;  3WKJ C;  1JWP A;  3A6N C;  3IT9 A;  1NRF A;  3Q81 A;  3MGQ A;  2XFT A;  5CP6 B;  3AZH C;  3W4O A;  3MFD A;  3AZN A;  3TSG A;  2G2W A;  4FSF A;  3AV2 D;  5E43 A;  3OZH A;  4CAY B;  1B67 A;  1XKZ A;  3LJA D;  3IHB A;  4K91 A;  4R4R A;  3REK D;  1U35 D;  1P3B A;  4DRA A;  2FJ7 C;  3MGR C;  5EVI D;  5GL9 A;  2FFY A;  3FV7 A;  1AOI B;  2XR0 A;  4E3O A;  4ZJ2 A;  1YU2 A;  4Z5T C;  4S2L A;  1GHP A;  1YM1 A;  4YS3 D;  2Y2K A;  4XUZ A;  3FKE A;  4S2I A;  1RP5 A;  4WEL A;  1JVJ A;  1P3F D;  4LD9 D;  5M19 A;  4XUX A;  2OLV A;  3GRJ A;  5GHX A;  2HPB A;  1WYB A;  3REL A;  3W96 C;  3HON A;  2IWB A;  3L27 A;  4JXS A;  3QNC A;  2F2A C;  2ZQ7 A;  3VH6 A;  4WZ5 C;  2WAE A;  4O7D A;  5BNX B;  3PBR A;  3KUY D;  5GXQ C;  3X1U C;  4KGC C;  4S2M A;  3AZI C;  1MKI A;  4H9S A;  3AV2 A;  3QHY A;  3FDD A;  4S2K A;  2HIO B;  5CPK C;  4JJN B;  3AZM C;  3WS1 A;  2YFW B;  1BT5 A;  4P6B A;  1ONG A;  2Y2L A;  4MBK A;  5B33 C;  2PYO B;  5GLC A;  3ZG5 A;  4KZ9 A;  3REK A;  1U35 A;  2Y91 A;  1PYY A;  5DF8 A;  2F8N K;  3UE3 A;  3O62 C;  5EVI A;  3AZG D;  3AZJ D;  3CZD A;  1W5D A;  3VOY A;  4WU9 A;  1AXB A;  1P3O D;  4YS3 A;  4KZ3 A;  1PI5 A;  1IYQ A;  2CV5 D;  1KX5 B;  1P3F A;  3MBZ A;  2BYK A;  4LD9 A;  3AFA C;  4WEK A;  5DNM D;  4WNN B;  3C1C D;  3UDX A;  3W98 C;  4GD8 A;  2ZQD A;  5AV8 C;  4Z66 D;  1QMF A;  4WYY A;  4YM6 D;  1DY6 A;  1BLS A;  2RIQ A;  1P34 D;  5B1L B;  3MNN A;  3L26 A;  3UPO A;  4DXB A;  3KUY A;  1PZO A;  3VFF A;  3AN2 D;  1PI4 A;  3MGP B;  4KUD B;  5AV9 D;  1ES5 A;  3WA9 C;  3AZE C;  5AV5 B;  1S0W A;  2WKH A;  4B88 A;  4KZ6 A;  3IQA A;  5B40 C;  1KX3 C;  4DF6 A;  2ZM2 A;  3LEL D;  4X68 A;  3REH D;  1M19 D;  2VGJ A;  3AZG A;  5FAS A;  3NQJ A;  4MEZ A;  5B24 C;  1E25 A;  1P3O A;  5AVB C;  3GSG A;  4ZUX B;  2CV5 A;  1KE0 A;  3B3X A;  4RX3 A;  1PWG A;  4ZJ3 A;  5KDM A;  5DNM A;  3C1C A;  3W97 B;  2H10 A;  3X1T A;  4Z66 A;  4IBG A;  4KQQ A;  4YM6 A;  5AQ9 A;  1GA9 A;  3WKJ D;  3A6N D;  1LI9 A;  4H9R A;  3B6G C;  3D4F A;  1P34 A;  3TU4 B;  4E45 A;  2DF4 C;  1ID3 C;  1K38 A;  3GVB A;  1N1J A;  3SH8 A;  2QZ6 A;  3AZH D;  4OH0 A;  3AN2 A;  5B2J C;  3VH5 W;  4QU3 A;  5EOE A;  4R8P C;  1P3I C;  5HL1 A;  4X23 C;  1P3A A;  2X71 A;  3NC8 A;  3AZF C;  4NZ3 A;  1PIO A;  3BEC A;  3LEL A;  5E5A C;  3MGR D;  2Z2M B;  2WGI A;  5GSU B;  4U3T A;  4X55 A;  4DE2 A;  3AV1 B;  1XA1 A;  3G4P A;  3N8L A;  4X69 A;  4Z5T D;  5JRG C;  3O86 A;  2R9X A;  5GT0 A;  5CHJ A;  3MGQ C;  2EX2 A;  4HGA C;  1JWZ A;  3DW0 A;  3AZN C;  4QNL A;  1JTD A;  1KE3 A;  5BNV A;  1SDE A;  1LI0 A;  3W96 D;  4PM9 A;  3MXS A;  2J8P A;  1YMX A;  4DDY A;  3ISG A;  2HDR A;  3B6F B;  3WKJ A;  5GT3 C;  4EV4 A;  5B0Y B;  3C7V A;  5CEB A;  3AGD A;  1P3B C;  4JPM A;  3AZH A;  3X1S D;  4BL3 A;  3X1U D;  4KGC D;  4M6B A;  3AZI D;  1K54 A;  1TZY A;  3KWQ B;  5CPK D;  5HAI A;  5BS7 A;  5FI7 A;  2HUE B;  5B33 D;  1FCN A;  1YQS A;  3KSY A;  3HLD A;  4PM6 A;  3UT9 B;  1XGI A;  3WS4 A;  5FSR A;  2ARO D;  3Q1F A;  1T3U A;  3O87 A;  3O62 D;  5CTN A;  3X1V D;  3UTA B;  4WZ4 A;  1TAF A;  1SCW A;  1L0G A;  4Z5T A;  5L2F A;  3CJM A;  4G92 B;  3A3J A;  1HQ3 C;  3LJA B;  3HLW A;  3HL9 A;  3L25 A;  3VSK A;  3ITB A;  3AFA D;  4OOY A;  4H9S C;  3G2Z A;  1P3P D;  1U35 B;  2FFF B;  4G91 C;  3W96 A;  5AV8 D;  3B0C W;  3WAA B;  4LCM A;  3UO9 A;  3H0L C;  3HSH A;  1IEL A;  3EPJ A;  4B4X A;  1DJB A;  4OOL A;  5AVC A;  3AZL B;  4WZ5 A;  5EVI C;  2Y2I A;  3DTM A;  1IEM A;  3X1S A;  3MVD C;  1P3F B;  3X1U A;  4CSR A;  3AZI A;  2Y4A A;  4DDS A;  3N4I A;  1PZP A;  4WU9 C;  3WA9 D;  1KGE A;  4EUZ A;  5CPK A;  2PBY A;  1W79 A;  3VP1 A;  3W99 A;  3HUM A;  1KX3 D;  1M18 C;  2Q9M A;  4OOM A;  2WAF A;  2IO5 C;  3VP0 A;  4NE3 A;  2ARO A;  3O62 A;  2H0Y A;  3X1V A;  4FCF A;  3UPP A;  1VQQ A;  4NZ4 A;  4DRT A;  3MNN C;  4ZBE A;  3L29 A;  5B24 D;  5AVB D;  3IF6 C;  3RXW A;  4Z2M H;  1IYO A;  2G5H C;  4QB8 A;  2IWD A;  2LY8 A;  1P3P A;  5CPJ D;  1JWV A;  5F99 A;  3AYW C;  5AV8 A;  1Q2P A;  5A93 A;  3AZJ B;  3B6G D;  2WK0 A;  2HP9 A;  5CED A;  1H3O B;  4EO5 C;  3ZG8 B;  3UNW A;  3PAE A;  2C5W B;  1Z6F A;  4OPQ A;  4PPR A;  1N4O A;  5KDM B;  3WWX A;  5B2J D;  4KEN B;  4R8P D;  1P3O C;  1P3I D;  3V9R A;  4YM6 B;  2Z2L B;  2CV5 C;  1KX3 A;  3AZF D;  4S2O A;  1P34 B;  2HDS A;  4N9L A;  5DNM C;  1LL5 A;  1K6R A;  4Z2M G;  2J8Y A;  3X1T C;  1BLP A;  3EPH A;  4UA6 A;  2ZY2 A;  3R45 A;  5AV9 B;  5JRG D;  1KX4 C;  3UY6 A;  1MY8 A;  4R3J A;  3AZK C;  2WYX A;  2I72 A;  3L28 A;  4FH2 A;  3AZN D;  1MXO A;  4E3L A;  3BFC A;  4Y0T A;  5DTK A;  3EG5 B;  5CPJ A;  3REH B;  1M19 B;  4AWL C;  4GDN A;  1P3A C;  4A5R A;  1N9B A;  3H0R C;  5GT3 D;  3G35 A;  1HZO A;  3LEL C;  3LO7 A;  1WYC A;  5DVA A;  3G31 A;  2HP6 A;  1FQG A;  3N8R A;  3BEB A;  1BTL A;  4N9K A;  1E4D A;  5FDH A;  5M18 A;  4EQI A;  2F8N B;  4E3J A;  5E2F A;  2WZZ A;  5GT0 C;  1P3G B;  1P3M C;  4MBF A;  4QY6 A;  1P3I A;  4HBT A;  1NXY A;  3A6N B;  3WRT A;  4KZ7 A;  4EBN A;  1Q9C A;  4JXV A;  2XH9 A;  4S2P A;  4NE6 A;  4QLC C;  1F66 C;  5JRG A;  5HAP A;  4IBB A;  1HQ3 D;  4E6X A;  3IH9 A;  1I5Q A;  4GB7 A;  4J8V B;  3M2J A;  4H9Q A;  3I7J A;  1K54 C;  1TZY C;  2FJ7 B;  4WJ3 C;  2Q9N A;  3MGR B;  5BS7 C;  1YMS A;  3M6B A;  5GT3 A;  1RGZ A;  3SS4 A;  1H8Y A;  1IKI A;  1ZG4 A;  5EEC A;  3WTP D;  3MVD D;  1GCE A;  4OJ6 A;  2WKI A;  3M2K A;  4IBE A;  5G49 B;  4J8X D;  3REI A;  3UDI A;  2ZM5 A;  4WU9 D;  1YLY A;  3HUO A;  3VMA A;  5FQM A;  2XK1 A;  4Y0U A;  4J8U B;  3E2K A;  1M18 D;  2PU4 A;  4K0W A;  3GMW A;  1I2W A;  4D2O A;  5B31 B;  1JFI B;  5BO0 A;  3WS5 A;  1FSW A;  5GXQ B;  3X1U B;  4KGC B;  3IF5 A;  3AZI B;  4WU8 A;  2HDU A;  3A3E A;  3BLS A;  3C1B B;  5FAT A;  2OLU A;  3MNN D;  5DTT A;  5CPK B;  5AVC C;  3AZM B;  4IBX A;  1HQ3 A;  4OPZ A;  3KXB D;  3G30 A;  3X1S C;  5B33 B;  4IED A;  3AYW D;  3H0M C;  3UTB D;  5AV6 A;  3W99 C;  1H8Z A;  4N92 A;  3ZG0 A;  4H9N A;  5B1M B;  3AL0 C;  2XD5 A;  5EVL A;  2J9O A;  1J9M A;  2ARO C;  4OKP A;  4BD0 A;  3X1V C;  3WTP A;  4NYY A;  3MVD A;  1VM1 A;  1HD8 A;  3UE0 A;  3AFA B;  4J8X A;  2X01 A;  2ZMA A;  3NQU B;  4KZ4 A;  4ID4 A;  3W98 B;  1CI9 A;  5A90 A;  2VQR A;  5AV8 B;  4WM9 A;  2XQZ A;  5FI2 A;  4KG6 A;  1BH8 B;  4C6Y A;  2G2U A;  1G6A A;  3G2Y A;  4JJN C;  1M18 A;  4OJP A;  2WUQ A;  4YFM A;  1P3P C;  5F99 C;  1YU3 A;  1LL9 A;  3X1T D;  5E2H A;  4KZB A;  5F83 A;  1KX4 D;  1YU1 A;  4KQR A;  3WA9 B;  3AZE B;  2ZM0 A;  3AZK D;  1B6W A;  3NCK A;  2ZC3 B;  1G68 A;  3L2A A;  5B40 B;  2ZQC A;  4OUI A;  2P9V A;  3IF6 A;  4C3Q A;  4H9P B;  3KXB A;  1KX3 B;  5B32 B;  1ESI A;  1KDS A;  4JF4 A;  2Y2M A;  2RVQ C;  3AYW A;  3WRZ A;  3UTB A;  3TG9 A;  1P3A D;  3LZ1 B;  4NE5 A;  4ZTK A;  3V39 A;  3R45 B;  4GH9 A;  1PW8 A;  4RVA A;  5B24 B;  4OJO A;  5F1F A;  3LZ0 A;  5AVB B;  5DF7 A;  4UPK A;  5A91 A;  5CPI A;  5EUA A;  5TGF A;  3IXD A;  1CEF A;  1S32 A;  5GT0 D;  1P3M D;  1YUE A;  3M6H A;  3EQU A;  2Y2N A;  5GLA A;  4JXW A;  3MGP C;  4U0T A;  3B6G B;  2BYM B;  1ID3 B;  1K4E A;  2L5A A;  5DNN D;  5HX9 A;  1L0E A;  3JYI A;  3FKV A;  5CPJ C;  4OQG A;  3MKF A;  4DE1 A;  2YFV A;  4RX2 A;  5B2J B;  3OC2 A;  4JLF A;  4QLC D;  1F66 D;  1P3L C;  1KX4 A;  5FAQ A;  4R8P B;  3AZK A;  2ZC7 A;  2RL3 A;  4X23 B;  3AZF B;  1M1A A;  4PM7 A;  5FUG B;  1TZY D;  5E5A B;  3KS8 A;  1ZLA C;  1YT4 A;  1KE4 A;  1BH9 A;  5HW3 A;  2ZD8 A;  3MGQ B;  3HLE A;  1ERQ A;  4HGA B;  3ZFZ A;  1U60 A;  3AZN B;  1F1E A;  2ZQ9 A;  2HDQ A;  3C7U A;  4WMC A;  3VH6 T;  2HP5 A;  2XFS A;  4BJP A;  5CP6 D;  4NZ5 A;  1P3M A;  2WZX A;  3IWI A;  1EQZ A;  4R23 A;  4J8W A;  5GT3 B;  4OPY A;  4WBG A;  5DNN A;  5FQI A;  1P3B B;  4WZS B;  4S2J A;  5B0Z A;  4XZQ A;  1FR6 A;  4UUZ A;  1YLT A;  2J7V A;  3Q7V A;  4QLC A;  1F66 A;  1SKF A;  4E3I A;  5AVC D;  5AY8 C;  3AV1 C;  3UE1 A;  2WGW A;  3REI C;  5HAQ A;  3N8S A;  3REL B;  2H5S A;  3MGS A;  3W99 D;  5JA4 A;  4IBD A;  1WE4 A;  5FI6 A;  4GN2 A;  2DQN C;  3B6F C;  3NY4 A;  5CEC A;  2Y2H A;  3BFG A;  4ZJ1 A;  4WU8 C;  4KZ8 A;  3AV2 B;  3ZNY A;  3ITA A;  2UWX A;  5CP6 A;  4G91 B;  4PM8 A;  1DJA A;  4GHL A;  3HVF A;  1GHI A;  4EBP A;  4JJN D;  3REK B;  5F99 D;  5KSH A;  2DNS A;  1BLH A;  5EVI B;  2ZC6 B;  5AV6 C;  3CMZ A;  4C75 A;  3HLG A;  4HEF A;  3UT9 C;  2E8I A;  3SS3 A;  3VH5 A;  2ZY5 A;  4WU9 B;  4R1G A;  3UTA C;  4YS3 B;  3HLC A;  3W8K A;  1W8Y A;  5FQQ A;  1AOI A;  3WTP C;  2R9W A;  5HAR A;  3KFU G;  2BYK B;  4LD9 B;  4J8X C;  3IH8 A;  2IO5 B;  2RVQ D;  3BYD A;  1RCJ A;  2OV5 A;  1M6K A;  3UN7 A;  3NDE A;  4BQM A;  3AGF A;  3OCN A;  3MNN B;  3WAA C;  4GOG A;  5JYO A;  3KS4 A;  4CJN A;  1HTA A;  2P9V B;  3IF6 B;  1ONH A;  3KUY B;  5C3I C;  1K25 A;  4XUJ C;  5BNX A;  1M40 A;  3AYW B;  1K6S A;  3MGP D;  3KXB C;  1KVL A;  5B2I C;  4OVD A;  3IWO A;  3IHA A;  4JJN A;  2YFW A;  2PYO A;  3UTB C;  5EE8 A;  3AZG B;  4JBF A;  3NQJ B;  5FQJ A;  1P3L D;  1WWI A;  5FA7 A;  2P74 A;  1LHY A;  1P3O B;  3LZ0 C;  3C5A A;  5CPI C;  2XGN A;  3ZGA B;  2CV5 B;  1LLB A;  4K0X A;  2NQB C;  2X02 A;  5DNM B;  3C1C B;  1ES4 A;  1S32 C;  1SDN A;  1KX5 A;  2IOU A;  1ZLA D;  3X1T B;  4Z66 B;  5CXW A;  3IXB A;  3MZE A;  2YFV B;  1S6R A;  4WNN A;  3B0D C;  4H9R B;  2JC7 A;  4UAA A;  4H8R A;  1N1J B;  1KX4 B;  5CTM A;  1YLZ A;  4DXC A;  4OLD A;  1R4V A;  1O07 A;  2J9P A;  2EXB A;  3ZDJ A;  5B1L A;  1FCM A;  3IP4 C;  3PBN A;  3AN2 B;  4NY2 A;  4WV4 B;  3GTC A;  4BL2 A;  4X6T A;  1P3K C;  4GZB A;  4IVK A;  1NYM A;  1K4F A;  1YU4 A;  1NZU A;  3NI9 A;  2EFU A;  3MGP A;  1P3A B;  4KUD A;  3UPN A;  1M1A C;  2NZD C;  1ALQ A;  3FKW A;  3MXR A;  3S1Y A;  3LEL B;  4XXR A;  3Q82 A;  4JF5 A;  2Y2O A;  4MLL A;  5BPV A;  1SHV A;  5E2G A;  4JF6 A;  3S4X A;  3VOZ A;  3PTE A;  1P3L A;  5GT0 B;  1P3M B;  4ZBJ B;  3VP2 A;  3REJ C;  5CHL B;  5FQK A;  5AY8 D;  3AV1 D;  1MBL A;  3REI D;  3VH6 W;  5BNV B;  4KZ5 A;  4R3B A;  4OQ0 A;  1ZLA A;  1EQZ C;  2H0T A;  2ZQA A;  3CG5 A;  4J8W C;  4LV0 A;  5I94 A;  3WKJ B;  3NDG A;  3Q7V B;  5BOH A;  3MZD A;  3W97 A;  4QLC B;  5DNN C;  1TDL A;  3HUN A;  3B6F D;  5B0Z C;  5G18 A;  5E2E A;  3AZH B;  4XZQ C;  5B0Y D;  2W8S A;  4WU8 D;  2V1Z A;  2WGW B;  5FAO A;  4PM5 A;  3RXX A;  4LV1 A;  1TZY B;  4S2N A;  4P87 A;  2JE5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...