2Y2HA

Penicillin-binding protein 1b (pbp-1b) in complex with an alkyl boronate (za2)
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
487
structure length
467
Chain Sequence
SEITYSDGTVIASIDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTGQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Guided Design of Cell Wall Biosynthesis Inhibitors that Overcome Beta-Lactam Resistance in Staphylococcus Aureus (Mrsa).
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
molecule keywords PENICILLIN-BINDING PROTEIN 1B
total genus 159
structure length 467
sequence length 487
chains with identical sequence B
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2y2hA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2y2hA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2y2hA02
1E4DA 4JXWA 4NETA 4C75A 3NCKA 1NYMA 3A3FA 1KVMA 1M6KA 3C7VA 1JWPA 1SCWA 2ZLYA 2IWBA 2Y2QA 1K54C 4WYYA 1RGZA 1E3UD 1ZG4A 3Q7VB 5DTTA 1TVFA 4S2OA 3G4PA 4R3BA 4UA7A 5HARA 1ERMA 4BL3A 1ERQA 2BG1A 3WS0A 1Y54A 1FCOA 1BLCA 3IWOA 4GKUA 4WZ5C 5CERA 1ZKJA 1BZAA 3VSLA 5KSHA 3MKFA 4QB8A 5FDHA 5GLCA 4OPZA 3UPOA 2P9VB 2OSUA 5F1FA 2Y2OA 1O07A 3BLSA 3E2KA 3G2YA 4UA6A 1H5XA 1QMFA 3Q81A 2HP9A 1IYSA 3A3DA 3CJMA 2V1ZA 4XUZA 3OPPA 1XA7A 1PZOA 2EFXA 2XDMA 3AGDA 5F82A 2UWXA 2PU4A 3UPPA 1SHVA 3ZG7B 1BT5A 5AQAA 1Q2PA 3V50A 4EUZA 4KQRA 3WS2A 2XR0A 4S2IA 4E6WA 1MXOA 1XGIA 3HUMA 2ZM2A 5E2FA 5A91A 4MBHA 4S2JA 1PYYA 3WRZA 5FSRA 3D4FA 2Y4AA 4GZBA 5F1GA 4PM6A 5KZHA 2Y2GA 3QNBA 1E25A 1KVLA 2V20A 3GQZA 2ZC6B 3IWIA 3PBOA 1W8YA 3VSKA 2ZQ9A 4KG2A 4R4RA 4LV2A 4UA9A 3VFFA 1K6SA 4U0XA 5CGWA 4X68A 3UN7A 5HAQA 3ISGA 1ESIA 3C7UA 1BLHA 1YLTA 2EX6A 3G2ZA 1JWVA 2HP5A 3IH9A 4GB7A 4PMAA 2R9XA 3O3VA 4LENA 3UO9A 5L2FA 3S4XA 4E3IA 3LY3A 5HFOA 4CJNA 5E2EA 1FCMA 3SH9A 3ZGAB 4E3JA 2XFSA 4OPRA 1ONGA 1FR6A 4GDNA 5EUAA 2ZM0A 3BFCA 5EVID 3VP3A 4B4XA 2WYXA 3BYDA 3DTMA 3ZDJA 4WM9A 2DCFA 2WGVA 4OLGA 2EFUA 2H10A 2XH9A 1ALQA 2EXAA 3IXBA 4R4SA 3VP0A 1BLSA 3MFDA 1EWZA 4OVDA 3DWZA 4N92A 1NZUA 1FOFA 4QY6A 4RA7A 4YFMA 1K38A 2XLNA 4E3LA 1KGEA 3UY6A 3BFEA 1TDLA 1EROA 5FI2A 3N8LA 5I94A 1SDNA 4O7DA 1XX2A 2XEPA 1L2SA 2B5RA 4K91A 2Z2LB 2EX2A 4BD0A 3ZNYA 4PPRA 4E3KA 3UDIA 3HREA 3IF6C 5JYPA 5EVIB 4FH2A 1VQQA 4RX2A 1KE0A 2ZM8A 3NDEA 3V5MA 1LI0A 3VP4A 3VMAA 5FQJA 4E3MA 3ITBA 4DF6A 1XA1A 1MPLA 3CZDA 4X55A 4ZJ1A 4IBXA 2J9OA 5FQKA 3SH7A 3ZG0A 3W8KA 1WYBA 2JC7A 2Y55A 5HAPA 5CGSA 3GTCA 4RVAA 1TEMA 4A5RA 1HVBA 4OLDA 4OP8A 4OQGA 1W8QA 4HBTA 1FQGA 3UDXA 5KSCA 1I2WA 1NJ4A 1YMSA 3G31A 3HBRA 1K54A 4Y7PA 1I5QA 1KGGA 1M40A 4OONA 3V39A 2QPNA 4C3QA 1LL9A 2ZD8A 1K56D 1G6AA 2HP6A 2Y2NA 4KZ9A 3UE0A 2X02A 2EXBA 1GA0A 1NXYA 1K57A 4X56A 3IHBA 5FAPA 4GD8A 4MBFA 4N1XA 4RX3A 4QJGA 4WZ5A 2RL3A 2X71A 4KZ7A 2V2FF 3VOZA 3FYZA 4GDBA 3E2LA 1KDWA 3TOIA 2Y59A 3MBZA 2ZC7A 3BM6A 2Y2MA 1IKIA 1AXBA 1YLYA 4WEKA 5TR7A 3SOIA 1YLWA 4R23A 3PBNA 1NZOA 4DXCA 1CK3A 4EBPA 2ZQ8A 1L0DA 5E2GA 1K56A 1MKIA 1DJCA 1K55C 3BFDA 3RJUA 4DXBA 1IEMA 1DJAA 4PM8A 3Q7ZA 5CHMA 3SS4A 4BD1A 3G32A 5AQ9A 4JXVA 1PZPA 4EBLA 2Z2MB 5J8XA 2JE5A 2HPBA 1NY0A 4EWFA 5EVIC 4ID4A 3IXHA 3TG9A 2J7VA 4KG5A 5CHUA 2Y2KA 3NDGA 1YQSA 5EE8A 3IH8A 4LV3A 3NY4A 4DE2A 4X6TA 4OQ0A 3MKEA 3ZHHA 5FQ9A 4DE3A 2ZMAA 4N1HA 4OPYA 1CI9A 5HW3A 4KZ8A 3PTEA 2VGJA 5GHYA 3PBQA 1GHMA 5CGXA 4K0XA 4M3KA 2J9PA 3OCNA 1DY6A 2C6WB 3W4PA 3N8SA 1MWTA 3GR2A 4S2MA 4DKIA 1PW8A 1FSWA 2I72A 3HLBA 4QU3A 4E3OA 5M19A 4OH0A 4IBRA 1JWZA 2P74A 3N4IA 4HEFA 3C4OA 2WZZA 1ZC2A 5EVLA 3MZEA 4N9KA 5FI6A 4PM5A 4LCMA 3AGFA 4JF6A 4ZBEA 1YM1A 1JTGA 3WS4A 5GLDA 3V3SA 1MWSA 4OOLA 1XPBA 3GVBA 2ZQ7A 4EV4A 2HDQA 1ES5A 3FZCA 4L0LA 1QMEA 3GMWA 4OP5A 4X53A 1BLPA 5FATA 4B88A 4HBUA 1GA9A 5HAIA 4Y0OA 5FAOA 3MZDA 4R3JA 1LHYA 1LLBA 1ZG6A 4KQOA 2WAEA 5AQ7A 1S0WA 4P87A 5DF9A 1N4OA 4EBNA 4JPMA 2WGIA 3S22A 4ZJ2A 3G34A 4E6XA 1KE3A 2PBYA 3FWLA 1W5DA 1LI9A 5FAQA 3HLDA 3HUOA 5CRFA 2H0TA 5A92A 4JBFA 1SDEA 3SS5A 2IWCA 4JKTA 1GHPA 5CEBA 2XD5A 3N7WA 2Y2PA 3DW0A 1ES3A 2OLVA 3IHAA 4MLLA 1HTZA 3FKWA 3LY4A 2FFFB 1TDGA 3SH8A 1BTLA 1HD8A 2WKHA 4LCLA 4JLFA 4QHCA 3IXGA 3ZCZA 1ES4A 4DDSA 3QNCA 1RGYA 5EECA 3OPHA 3HLGA 2Q9NA 3IXDA 4WMCA 2XGNA 2ZC4B 3OC2A 5IHVA 3IQAA 2WGWA 3IF5A 4DDYA 1L0EA 3EQUA 2G2WA 1BSGA 3HL9A 1YLJA 2X01A 3OCLA 1VM1A 4OOYA 4WEJA 1BULA 2WZXA 2WK0A 4JXGA 3SS3A 4P85A 3LO7A 4KZ4A 5DTKA 2RCXA 3BRMA 3A3JA 1WYCA 4Z9QA 1PWDA 1ESUA 3ZG5A 2Y2JA 4GOGA 4Q8IA 2FFYA 3GSGA 5FA7A 4E3NA 3WRTA 1ONHA 5GHXA 4C6YA 4ZJ3A 4CPKA 2G2UA 5GLBA 3IF6A 1IYPA 1Z6FA 3ZFZA 2ZQAA 2Y91A 3G35A 3WWXA 3WS5A 5M18A 4B4ZA 5CTMA 1RCJA 1IYQA 4FSFA 3S1YA 4FD8A 3CG5A 5KMWA 3O88A 4S2NA 5FQQA 1K55A 1KE4A 1K4EA 4Y0UA 4BENA 2WKIA 1K4FA 1SKFA 2XFTA 2PU2A 4NK3A 4D2OA 4KZ5A 5DF8A 4F94A 2XD1A 3PAEA 3W4QA 3PBRA 3W4OA 1MWRA 2ZJ9A 3GRJA 3Q82A 4DE0A 4JF4A 3UE1A 5JYOA 4Y0TA 3WS1A 4S2LA 1CEGA 1JTDA 3O87A 4WELA 4IVKA 4XXRA 3BFFA 4KQQA 5FI7A 1KGFA 4R1GA 5E43A 4K0WA 3M6BA 3MXRA 4U0TA 1PWCA 4FCFA 1IKGA 3FKVA 4KZBA 3BEBA 5M1AA 3RXXA 5HX9A 5DF7A 4BQMA 5U47A 3OPLA 3HLFA 5GHZA 5HL1A 3Q07A 4X69A 1K57C 5A90A 3OZHA 1K6RA 4WBGA 3MZFA 2H5SA 2EX8A 5TFQA 5BOHA 3GV9A 2ZQDA 1E3UA 5CHJA 5CXWA 1PWGA 4IEDA 4S2NC 4N9LA 3HLWA 1IYOA 3FV7A 4OQIA 3IWQA 1MBLA 1JVJA 1L0GA 3V3RA 3C5AA 2JBFA 3IF6B 4OOMA 4LV0A 4YINA 2BLSA 3BFGA 3LCEA 5FQIA 5E2HA 1W7FA 3N6IA 1XKZA 4ZTKA 1EI5A 2A49A 1ES2A 3EQVA 4EQIA 2EX9A 5FASA 4UHUA 1YT4A 5EOEA 1FR1A 2QZ6A 3HLEA 1FCNA 2P9VA 1RP5A 3M6HA 1G68A 1N9BA 2WUQA 3Q1FA 2DNSA 3O86A 5CEDA 5EPHA 3C4PA 3UPNA 1CEFA 4U3TA 1XGJA 3ITAA 3UNWA 5EVIA 2IWDA 2OLUA 2ZC5B 2E8IA 2WAFA 3M2JA 3NBLA 4ZAMA 3NI9A 3VFHA 3Q7VA 4MBKA 2WGWB 2XF3A 2OV5A 2A3UA 1O7EA 2DRWA 4PM7A 4DE1A 2Y2HA 4KENB 1GHIA 4OQHA 3RXWA 3G30A 3NIAA 4WMCD 1XP4A 5GLAA 1I2SA 2QMIA 1GCEA 1NRFA 2H0YA 3LEZA 1J9MA 2XK1A 3A3EA 4HESA 3BECA 3B3XA 4BLMA 1PIOA 1K25A 1CI8A 1W79A 4S2PA 2ZQCA 4S2KA 3ZG9B 4OPQA 1FSYA 4H8RA 3TSGA 1BUEA 2XQZA 4LV1A 3QHYA 1PI4A 4P6BA 4BL2A 2WKEA 3PBTA 2Y2LA 3HVFA 4PM9A 4KG6A 3MXSA 3ZG8B 4OKPA 1Q2QA 5CECA 5GL9A 2R9WA 3HLCA 2ZC3B 4KZ3A 4GD6A 5DTSA 1IELA 2Y2IA 5G18A 1U60A 3IT9A 4P0MA 1LL5A 5AQBA 3I7JA 2WADA 1PW1A 1YMXA 3UDFA 2HDSA 1L0FA 4JF5A 3UE3A 4WZ4A 3VP2A 3ZVWA 5EOOA 1DJBA 1MY8A 1XXMA 1C3BA 5CTNA 4JXSA 2J8YA 5DVAA 1H8YA 1KDSA 1WE4A 2Q9MA 1PI5A 3NC8A 3OPRA 4IVIA 4QD4A 4QY5A 1YLZA 4XUXA 2HDRA 3ZVTA 3M2KA 5TGFA 5FQMA 4MEZA 3VP1A 1MWUA 1NYYA 4GNUA 3PAGA 3CMZA 3VOYA 3P09A 4DRTA 1OMEA 4FH4A 3DWKA 3ZNTA 4KZAA 3AGEA 2C5WB 1YLPA 4MNRA 4RYEA 1H8ZA 3N8RA 2HDUA 2GDNA 3A3IA 1S6RA 5A93A 1HZOA 2CC1A 3HUNA 2VGKA 5D3OA 3PBSA 4KZ6A 2JCHA 4BJPA 4ZDXA 3BLMA 3P98A 4GN2A 4R0QA 5F83A 4UAAA 3JYIA
chains in the Genus database with same CATH superfamily
4C75A 4NETA 3NCKA 4YS3A 1NYMA 1KVMA 3C7VA 5JA4A 2CV5D 3N3FA 1YPRA 5AVBB 1P3LC 1VETB 3Q7VB 5DTTA 4E04A 5B0ZA 4S2OA 4UA7A 5HARA 1ERMA 1P3FC 1P3MC 4ZUXC 1ZKJA 3VSLA 5KSHA 3HJIA 4XUJC 3UPOA 3D3OA 4Z2LA 2P9VB 1UWPX 2EA9A 3AZNB 1O07A 3BLSA 3KX0X 4HH3A 1QMFA 5CHLB 1IYSA 2W1RA 4G3KA 3UB6A 1MC0A 5AV6D 3OPPA 3IS2B 1P3OA 1KX4B 3AGDA 2UWXA 3HJKA 4IBEA 1Q2PA 2CV5B 2V5OA 5JA4B 5AVBD 4Z1WA 4R3AA 4R8PD 3AZHD 4S2IA 4E6WA 3T4KA 3HUMA 2ZM2A 4S2JA 3LJAD 3WD0A 4YM6B 3AZGC 3CPTA 3GQZA 3PBOA 3AZIA 3IP4C 4KG2A 4R4RA 4MB5A 4UA9A 3B6FB 4X68A 3ISGA 1BH8A 1EW0A 5GSUA 2V1BA 3G2ZA 3O3VA 4LENA 3UO9A 4JGPA 4L9GA 3S4XA 4CJNA 4H9RA 4BBVA 3AFAB 3ZGAB 2XFSA 3LJAB 5EUAA 5EVID 3VP3A 3T50A 3B33A 1KX5A 2DCFA 1JFIB 4R4SA 4WV4B 3MGQC 3WA9A 5GT3C 3AZJD 3MQQA 2PHYA 1FOFA 1K38A 4X23A 5B0ZC 4Q0JA 3P5JB 3MQ0A 1E15A 1XX2A 1U35D 5AY8B 2Y79A 3KUYC 3VH6A 4HGAC 3ZNYA 5B31C 5EVIB 2V8FA 5E5AD 1G6OA 1VQQA 3IX4A 3X1TC 4I3IA 1JFIA 1OJGA 1M19D 1F1EA 1TS7A 5FQJA 3B6GC 3TRCA 2QHKA 1IFQA 4LD9B 4NZ4A 3L9KA 4E3MA 4X55A 5EM0A 4ZJ1A 1F66C 1EQZC 3A1IA 3BQ8A 2Y55A 3MVDB 1V9ZA 4RVAA 5K5BA 3LELD 1F66D 1FQGA 3X1SD 2FJ7A 1NJ4A 3HBRA 1YMSA 5GXQD 4C3QA 4E45A 5C3IB 2ZD8A 1K56D 2Y2NA 2FZ0A 1GA0A 4MMNA 2HV1A 4YWZA 4GD8A 3AZKC 4WZ5A 4ETXA 3CUEC 4KUKA 4HJ6A 5AV5C 5AV8C 2O9AA 4GDBA 3H0LC 3TOIA 3VE3A 3F6TA 4JJND 4II7A 1IKIA 3MVDD 3B6GB 4WEKA 3SOIA 1YLWA 3L2AA 4R23A 1NZOA 1F66B 2ZQ8A 5IT5A 1K55C 2XA7S 3AV2B 1IEMA 5F5YA 5GXQB 4J8UC 4BD1A 3X1VB 3W97C 2HGVA 3O62A 5J8XA 1YAXA 4ESPA 3LR3A 1N9LA 1P34C 3AZNA 5EVIC 4ID4A 4Z66B 4KG5A 1TZYB 2Y2KA 5F99A 3NDGA 2PRFA 1P3KC 2VV6A 4DE2A 3A0VA 3QP6A 5B0ZB 4OPYA 3LFVA 5BO0A 3PTEA 1P3BD 3REIB 2JHEA 5AVBA 3H7WB 4ZRRA 3JPUA 5HWVA 2J9PA 1G28A 1DY6A 3C8CA 3N8SA 3GR2A 4S2MA 3T4LA 4IHQA 4DKIA 3X1VD 4QU3A 3KXBA 2F8ND 1P3PD 2W3GA 2P74A 4HEFA 3FKEA 1EAKA 2M1CA 1ZC2A 2W3FA 3MZEA 2KLIA 4GCZA 1S1YA 2K7SA 1JTGA 1TZYD 1Y28A 4M4XA 1XPBA 1ES5A 3FZCA 5B40C 1KU5A 4Z5TD 3WKJB 3MQLA 4MN5A 2YFVB 4B88A 5B0ZD 5HAIA 4Y0OA 5FAOA 3B6FC 3AZFA 1LLBA 2PYPA 4Y13A 3AZEA 5B33A 1N4OA 3MXQA 4XT2B 4EBNA 2W3EA 1P3PB 3PR6A 3EG5B 3LZ0B 3LELA 2JKRM 2GZAA 2YKHA 1W5DA 2AROB 1P3OC 1LI9A 4NXGA 2V0WA 1SDEA 4EO5C 3WAAA 5JRGD 3NQJB 3NULA 3WD2A 2RIQA 4MLLA 1BH9B 3WKJD 3QP2A 3W97A 1KX3D 1ID3D 3B42A 2RTSA 1OTBA 4JLFA 3ZCZA 3WD4A 3QNCA 4QLCC 2HJ9C 3IXDA 4JGQA 4NKPA 2ZC4B 1BSGA 3HL9A 2IO5B 2W1TB 3OCLA 4CQHA 1U35A 1BULA 4GJ4A 5DKLA 4UPKA 2JSSA 3A3JA 1P3AD 4WU9A 3W97B 1ESUA 4LFUA 1BH9A 4GOGA 2FFYA 4R70A 1DP6A 4E3NA 3WRTA 4C6YA 4ZJ3A 4CPKA 1ID3B 5GLBA 1P9WA 5JRGA 3T4JA 4HMCA 3RFBA 3KWQB 3REHC 2Y91A 3WS5A 1EQZD 1D7EA 3KSGA 3AN2B 1KX5C 2L4RA 5FQQA 1KE4A 1K4EA 3REJD 4Y0UA 1K4FA 1PNEA 2WKIA 5G4YA 4F94A 3PAEA 3NHQA 1MWRA 4E44A 3RELA 4JF4A 5JYOA 4GHLA 2A24A 4G92C 5GSUB 1JTDA 4XXRA 5FI7A 1BH8B 2LB5A 4YOFA 2A2LA 5E43A 3AZIC 4NXFA 3MFXA 5F6AA 1IKGA 3AZIB 3LICA 1U35C 5DF7A 4BQMA 5U47A 1EQZB 3HLFA 5GHZA 5DFYA 5HDCA 3OZHA 4NE3A 4J8VA 3O62D 3KXBB 2EX8A 4FTXA 4EETB 5CXWA 4IEDA 4N9LA 3FV7A 4Y5FA 3X1UB 3CAXA 4OQIA 4YS3D 3A1KA 1ZLAD 4KGCA 3T4OA 3UT9C 4OOMA 4YINA 2BLSA 1P34D 5B1LD 1ACFA 1AWIA 1P3IA 3BWLA 1XKZA 4ZTKA 1P3IC 2A49A 3QP8A 4EQIA 5FASA 4UHUA 3AZID 1TS0A 2DNSA 3O86A 1CEFA 5IU1A 5AV9C 2ZC5B 1P3BC 3M2JA 3NBLA 3O62B 3KXBD 1TD5A 4G91C 3VFHA 1VETA 3Q7VA 3VE4A 2KX6A 2WGWB 5DKKA 1MKMA 3RXWA 4H9NA 3NIAA 4NZ1A 4NZ5A 3KSHA 3X1UD 4I38A 4WMCD 4YS3B 2F8NG 1CK7A 1P34B 1A7WA 4WUJA 2ZOIA 1HQ3C 1W79A 3LZ1B 2NZDB 1FSYA 3QP1A 4LV1A 4KUDB 5AV5D 3UE6A 4KUDC 2Y2LA 5FEFA 3RELC 4PM9A 3VH6T 3AZLC 1M18C 2KDKA 2R9WA 4KZ3A 5CP6C 3KYEA 3TJZC 1LL5A 5AQBA 2IO5C 2WADA 1YMXA 1H3OA 3UDFA 5DNNC 2ZM5A 4JF5A 3IX3A 3UE3A 3ZVWA 3UMDA 1P3AC 4IUHA 3W99A 3LR0A 3T1SA 3L29A 5DVAA 3OPRA 1KDSA 4IVIA 4XUXA 4J8XA 4I5SA 3LZ1D 1P3MA 4QY5A 2NZDD 3FG8A 4AWLB 5CPJD 3CMZA 3PAGA 3VOYA 5GT0A 3ZNTA 3DWKA 5B40B 3WKJC 3SW1A 3H9WA 5TBMB 4EUVA 1DRMA 1KX5D 5A93A 1HZOA 4ZDXA 2JCHA 3P98A 4GN2A 3P01A 4TX8A 1LSWA 5B2IB 5F83A 1H3QA 3W96B 4H9PB 2QWSA 4IBJA 5DNMC 1J3WA 2IWBA 4PKYA 2Y2QA 1RGZA 1E3UD 4BL3A 3R45B 3WS0A 1FCOA 3IWOA 4EQ1A 4H9QA 5B31D 3MKFA 3B0DB 5BPVA 1P3KB 1LSXA 2Y2OA 3AN2C 5BNXA 1KX5B 4UA6A 2PR5A 4H9QB 3A3DA 3CJMA 4DRBA 3LJAA 3C1BB 2GX5A 5AV9D 2EFXA 2XDMA 3W96D 5F82A 2VA0A 1BT5A 3MNNA 1N9NA 3LIAA 3V9RA 4EUZA 3T1XA 5L07A 4KQRA 2XR0A 1MXOA 4MBHA 2W27A 1PYYA 1P3OD 5FSRA 3D4FA 2Y4AA 3B6FA 5BNVB 5B31B 2Y2GA 3QNBA 3UTAA 2V20A 2DMWA 2ZC6B 3VV4A 2G5HC 3IWIA 3VSKA 4LV2A 1NWZA 5B1LC 3VFFA 2HIOA 1K6SA 2GJ3A 5HAQA 5B1MC 4GHIA 2VJWA 4GB7A 2R9XA 1P3LB 5L2FA 3REJC 4E3IA 4J8UD 4BMWA 3PHYA 3F1NB 2ACGA 1WWIA 2AROC 1P3OB 3S7OA 4GDNA 5AV6A 3AZMB 4LGWA 2WYXA 3BYDA 3DTMA 4WM9A 5AV8B 2XH9A 3MFDA 1EWZA 4OVDA 1E6NA 3WTPE 3VH6W 3LUQA 2NZDA 4IBFA 2D01A 4Y2FA 5EVEA 3M7PA 3AV1A 1P3FA 1P3LD 1L2SA 5DNNA 2W3HA 4HGAB 2EX2A 3NOTC 3UTBD 4E3KA 4GHAA 3IF6C 4FH2A 1B67A 3B0BA 3KSIA 1P3FD 2B18A 3CUEA 3LR4A 2O99A 4RX2A 3MGQA 5L10A 5AV8A 1LI0A 3VP4A 5F99D 3X1TD 3EPLA 3ITBA 4DF6A 1MPLA 1P3IB 2J9OA 5FQKA 3SH7A 3ZG0A 3L28A 1V9YA 1WYBA 3F1NA 5HAPA 2NQBD 4OP8A 1W8QA 1I2WA 1L6JA 3P7NA 2QPNA 1LL9A 2O0YA 4KZ9A 3UE0A 2X02A 1T19A 4HY8A 5FAPA 4EXOA 5AJGA 5G4ZA 4F3LA 4KZ7A 2V2FF 3UTAB 5AVEA 1T18A 5BNVA 1KDWA 3E2LA 1P3ID 4WU9D 5B0YB 2PBDP 2ZC7A 3CHWP 3PBNA 1CK3A 2VLGA 5KIZA 1N1JB 3SS4A 2HUEC 4CLCA 4EBLA 3EEHA 2V8CA 3W98D 1XFQA 5B32A 3CLOA 3TG9A 4BBUA 2J7VA 2M7UA 4O0PA 5GT3A 3MGSD 2Q0OA 2XSSA 2PD7A 3VH5W 1P3AA 4WU9B 5B0YD 1SKOA 4X6TA 1OGGA 2ZMAA 5J3WA 1CI9A 3W99D 2QJ7A 4KUOA 3DTIA 4CLCD 5C3IC 5CX7A 3A0RA 4HMEA 1W1TA 1PW8A 3W96A 4E3OA 4OH0A 5B2IC 5AVFA 3N4IA 3T1RA 1LL8A 3C4OA 1GXDA 5EVLA 4PM5A 2VKSA 3OBFA 4LCMA 3MGRA 4ZBEA 4WF0A 4OJ6A 4XUJB 2LB9A 1MWSA 4EV4A 4OP5A 3WTPD 1P3MB 3WAAD 4R3JA 5CPJA 3W99B 2WAEA 5AQ7A 5AVBC 4MN7A 5DF9A 1IOUA 1XFNA 5B2JC 2WGIA 4UEYA 4K08A 1OJ5A 3X1SC 1P0ZA 3AZGD 1W1VA 1KE3A 3LJAC 2ZL1A 3KSFA 5FAQA 5HL6A 3HLDA 5CRFA 2H0TA 5A92A 3AV1D 3SS5A 2IWCA 1GHPA 2VGLM 3WKJA 3N7WA 3WA9C 1ES3A 3WTPB 3LZ1A 1P3MD 1HTZA 1CXWA 3LZ1C 3WTPC 2OWJA 2ZY3A 2EWWA 1TDGA 3SH8A 4QHCA 1RGYA 3HLGA 4H9NB 1HLUP 3QP5A 3UTBA 3OC2A 5IHVA 2WGWA 2VQRA 2G2WA 4LLOB 1H8PA 2NUPC 3AZGB 4QWOA 1VM1A 4G92B 2CWEA 4JXGA 3LO7A 3AV1B 5E5AC 3W98C 1OT9A 2RCXA 3ULFA 3AL0C 1H0MA 4Q8IA 3B0CT 3F1PA 3C1CD 1HQ3D 2HF6A 3AZND 3ZFZA 1Z6FA 4CAYB 1YSQA 4B4ZA 3MGRC 5AV6B 3AZMA 1KX4D 3BY9A 5KMWA 2PYRA 3K3CA 4HP9A 2PT7A 4BENA 1NRJA 4D2OA 4KZ5A 2CMNA 3KXBC 3W4QA 3W4OA 3AV2C 3EPKA 3FC7A 4LRYC 4X1LA 4J8VD 4DE0A 4R8PB 1F66A 1P3GC 4WN5A 4Z2MG 1F98A 1E6ZA 4S2LA 1YU2A 4IVKA 1W63Q 3MR0A 1KGFA 3H0RC 4YM6D 3C1CB 4HMDA 4OUIA 3PYPA 3O5YA 1UR9A 3DTKA 4XUJA 3T1QB 4L9FA 1AOIA 3UB9A 3RXXA 4UUZA 3AZKB 5B31A 4J8XC 3B6FD 4CSRB 1PZRA 3X1VC 4R38A 2VX8A 1W1YA 5TFQA 5BOHA 5CHJA 4S2NC 3HLWA 2ZMVA 2D02A 1MBLA 3V67A 3R7WA 3BFGA 3LCEA 1P3PC 2ZY5A 4LD9A 4DJ2A 1EI5A 1YT4A 2QZ6A 5B24B 5F99C 1RP5A 3AZJB 1G68A 1N9BA 3Q1FA 3AZKD 5CPJC 1P9RA 4DMZA 5EPHA 3C4PA 3UPNA 1VEUB 3UNWA 5IS1A 3ITAA 2E8IA 4ZAMA 5J7EA 3T4TA 2XF3A 1O7EA 2DRWA 3MF0A 4KENB 3EWKA 1N1JA 4Z2MH 1XP4A 1GCEA 3PXPA 3LEZA 4H9PA 2XK1A 4LRXC 3REHA 4IBCA 3ZG9B 4OPQA 2XQZA 4X25A 4R6LA 3QHYA 1PI4A 4P6BA 1M19C 5B24D 5B40A 1M19B 3REKD 3ZG8B 1Q2QA 5CECA 4LD9D 4JJNC 2PAVP 3HLCA 4EU0A 4GD6A 4J8XB 2O9BA 3UTBC 4NE5A 3AFAA 1P3PA 2HDSA 3AYWA 1L0FA 4H9RB 3EEAA 3X1SB 5KDMA 5B33D 1W2EA 5EOOA 3CI6A 1H3OB 3AZFB 1XXMA 1TF1A 5CTNA 4XZQD 3A6NC 1H8YA 1PI5A 5F69A 3ZVTA 5FQMA 4J8WB 3WAAC 1MWUA 1NYYA 4GNUA 4HH2A 3DBAA 1OMEA 1OTIA 3KFUG 4RYEA 3MGSC 3N8RA 4L9EA 3CPTB 1S6RA 1G5UA 1OT6A 3HUNA 2CC1A 2O9CA 2V9AA 4J8XD 2BYMA 4KZ6A 4KGCC 4R0QA 1YU4A 1P34A 3B6GD 1W1PA 3MGPA 1E4DA 4YS3C 4Z2HA 4JXWA 1M6KA 2ZLYA 3AV2D 2F8NA 1K54C 4WYYA 3B0CW 1BFMA 1ZG4A 4XZQB 1L3LA 5FUGB 1OTAA 2BG1A 3L25A 1Y54A 4J8WD 5CERA 1BLCA 5L8MA 4WZ5C 1BZAA 3KS4A 1TZYA 4QB8A 4Z66D 1TZYC 4KQDA 5FDHA 2WKPA 3BW6A 5B1LA 2OSUA 5F1FA 2V1AA 1H5XA 3Q81A 1CJFA 4I3AA 2V1ZA 1PZOA 5CP6B 3X1VA 3REID 5AQAA 3V50A 3WS2A 3B6GA 1XGIA 5E2FA 2NQBC 3AZFC 4GZBA 5F1GA 4PM6A 3CWFA 2PYOB 1E25A 1KVLA 3C1CC 2P04A 3TW8A 2BYKB 1W8YA 2WKRA 2ZQ9A 4FOFA 1M1AD 2GNXA 4EERA 5B2JB 4J8WA 1JNUA 3C7UA 5CP6D 1YLTA 1B6WA 2HUEB 3FPWA 3TU4A 4O01A 2HP5A 3IH9A 3V9RB 5KDMB 1T1BA 3X1SA 2FJ7D 3LY3A 4PKYG 2J8PA 1OTEA 3AZLA 2E8JA 2F8NK 3BFCA 3UT9B 3TE8A 4B4XA 2FH5A 5DFXA 5JRGB 2EFUA 2H10A 1ALQA 3WA9D 2EXAA 3IXBA 1ID3A 1TS8A 1BLSA 4N92A 5B32D 2VGLS 4RA7A 3LYXA 1P3GA 5TJJA 1Z2CB 1KX3B 1KGEA 1TDLA 1EROA 3N8LA 4HJ3A 1SDNA 4O7DA 4K91A 1KS0A 1Q9CA 4HP4A 1H0IA 4Z2JA 4BD0A 1GOIA 3HSHA 5B2IA 3UDIA 3MMHA 1P3GB 4H9SC 5JYPA 3UT9D 1VEUA 5GSUC 1YKDA 3WA9B 2K2NA 2XA7M 2B02A 1KE0A 2ZM8A 5GT0B 4Z5TC 3MJQA 3V5MA 3ZQ5A 1DP8A 4IBKA 5FDSA 3MGSA 4ZBJB 1XA1A 3CZDA 5CPIC 3KWQD 5CGSA 5B0YC 1HVBA 4OQGA 1ZLAC 3LI9A 4BWIA 4X1MA 1K54A 4Y7PA 2YFWB 3REJB 1I5QA 1QO6A 1M40A 1W63M 4OONA 3V39A 4CLCC 5MC7A 4J8WC 1G6AA 2HP6A 1P3GD 3JVVA 2J3TC 4CSRA 1KOUA 2JN7A 1K57A 4X56A 3IHBA 5C5KA 5GSUD 3AZJC 1AOIB 4RX3A 1TAFB 2RL3A 5GT0D 2YFVA 2X71A 2VZWA 4NY2A 2PYOA 3VOZA 5AV5A 3FYZA 4YNRA 3W96C 2XRNA 3RH8B 4H9SA 4ZBJC 5TR7A 4MB3A 3RJUA 5HSQA 4PM8A 3AZHA 3E4QA 3MGPD 1KX4A 5AQ9A 2JKFA 1GSVA 4ARZB 2NQBA 1PZPA 4WNNB 2Z2MB 3AZMC 5B33C 5B1LB 3AYWC 3IBRA 1H0GA 2JKTI 4NEED 3ZHHA 4OQ0A 2HZ5A 4DE3A 5FQ9A 4NXEA 4Z66A 5HWTA 2RVQD 4KZ8A 1S32D 2VGJA 3PBQA 5CGXA 4R8PC 3REKC 2Y8HA 3NQUA 3T4QA 2P08A 2KOIA 3W4PA 3MNNC 3AZHB 3MGPB 1FSWA 5GXQA 5M19A 2WZZA 1VHMA 1EQZA 4N9KA 5FI6A 1E8BA 2I9VA 1YM1A 4NE6A 5BT1C 4UQIM 5GLDA 1HTAA 2LY8A 3V3SA 4OOLA 3GVBA 2ZQ7A 3WTPA 4KUDD 5AV5B 5AVCB 1QMEA 5FATA 4HBUA 3GECA 4BBTA 1TAFA 4GH9A 3E0YA 1S32B 1ZG6A 2A24B 4KQOA 1LSVA 1BYWA 2ZL1B 4P87A 3T12B 4JPMA 3JVUA 3S22A 3KUYA 4PAUA 4ZJ2A 1TS6A 3G34A 2YFWA 3REJA 4E6XA 3AFAD 4D60A 1YU0A 2VV8A 2PBYA 3FWLA 4WLAA 5EFWA 4Z66C 4OJ5A 4H6JB 3E4PA 3HUOA 5B32G 2VEAA 3MVDA 4JBFA 3RTYA 1GSWA 1MZUA 4JKTA 5CEBA 2XD5A 3DW0A 5AVCD 3LY4A 5B40D 3IX8A 5L09A 4Y3IA 5LBRA 3EOIA 1HD8A 4LCLA 3IXGA 1ES4A 4DDSA 3OPHA 1U35B 2Q9NA 3LR5A 5AY8D 5B2ID 2W1TA 2XGNA 3C2WA 3IQAA 3IF5A 4Q0IA 4DDYA 3OLOA 4HQAA 2X01A 2INWA 4OOYA 2WZXA 3SS3A 5E5AB 2L0WA 2UV0E 2K31A 3TU4D 3AZJA 3BRMA 1WYCA 1D1JA 1KX3A 1PWDA 1NLZA 1ZHHB 4Z9QA 5HDSA 3ZG5A 4XZQC 5FA7A 1ONHA 5GHXA 1P3KD 3NOPC 3L7HA 3IF6A 1IYPA 2ZQAA 2Z6CA 3A6NA 5M18A 3B47A 4G3VA 1XJ3A 1RCJA 3C1BD 3LZ0A 3LELB 5FL3A 3AFAC 4FD8A 3CG5A 3O88A 4S2NA 4LD9C 1K55A 3S7QA 1S67L 1SKFA 2PU2A 2XFTA 3LIFA 1S4RA 5DF8A 4XT2A 4G91B 2ZJ9A 2JKTM 3GRJA 3E98A 4Y0TA 3TU4B 3WS1A 1GSXA 4DN0A 1CEGA 3O87A 4WELA 4WU8B 3BFFA 4KQQA 3LEQA 4R1GA 3M6BA 3MXRA 1PWCA 4FCFA 2BYKA 4KZBA 5HPFA 1OTDA 2MJ6A 4JJNB 5M1AA 5HX9A 1E88A 4M6BA 3OPLA 4JGOA 2XROA 2WKQA 4X69A 1K57C 5A90A 1K6RA 4WBGA 2H5SA 3GV9A 5DNMD 3W2ZA 5G49B 2B95A 5GXQC 4J8UB 1IYOA 3NQUB 3REIA 3H7WA 5DNND 5BT1D 5BO0B 5DJTA 2JBFA 5CP6A 5DJUA 4WU8D 3C38A 3IS2A 3AZMD 5FQIA 5E2HA 1ID3C 3EQVA 3UTAC 5AV8D 3NOUC 1FR1A 1FCNA 2P9VA 3M6HA 2HIOC 2WUQA 4AWLC 4WNNA 1P3BB 1XGJA 2IWDA 4ARZA 1S32C 5FUGA 3KS8A 3NI9A 5DNMB 4XZQA 4MBKA 4EEUA 4O8GA 3D9YA 4DE1A 2A3UA 4PM7A 4MCWA 2F8NB 1GHIA 4OQHA 4Y15A 2J3WA 1WWSA 5DNNB 1I2SA 5GLAA 2QMIA 3U4LP 3AYWD 2H0YA 1J9MA 3A3EA 4HESA 3BECA 2W8SA 3B3XA 1K25A 1CI8A 2ZQCA 4H8RA 3TSGA 1BUEA 3PBTA 4Y17A 4Z5TB 4KG6A 3MXSA 4IUKA 3X1TB 4WZSB 5DTSA 5G18A 1IELA 4EW7A 1U60A 4P0MA 4WJ3C 2P7JA 1PW1A 5CPID 2G7UA 3LZ0D 3VP2A 1P3LA 5HWWA 4KHAB 3AYWB 3NJAA 5AY8C 2AROD 1MY8A 1C3BA 4ZUXB 3F1OB 2J8YA 3IBJA 2Q9MA 4QD4A 4GHIB 4LRZE 1YLZA 4X23D 3M2KA 4GW9A 4MEZA 2HIOB 3H82B 5GT3D 4H9OA 3P09A 4FH4A 1M19A 4KZAA 5AVCC 2C5WB 1YLPA 4DQYB 4MNRA 3MGRB 4Z2KA 3C1BC 2GDNA 4DRAA 1K0KA 2VGKA 4BJPA 3G6OA 3KYZA 3S7NA 4QLCB 3KWQC 3REHB 4HJ4A 1PRQA 5CPIB 3JYIA 1T1AA 3A3FA 1JWPA 1SCWA 3MNNB 3AZHC 4Z2GA 3LIDA 4ZUXD 3H0MC 1TVFA 3G4PA 4R3BA 3KO6A 1ERQA 1P97A 1P3AB 4X23B 3UB7A 3AV1C 3W98B 3W97D 4GKUA 2HIOD 1O6IA 5GT3B 5GLCA 4OPZA 5B24A 2G5IC 3MGRD 4OJPA 4NYYA 3E2KA 3G2YA 3K3DA 2HP9A 2QYBA 3MS6A 3W98A 1UR8A 3HCYA 4QLCD 4XUZA 3AZLB 1XA7A 3REHD 3R7WB 3AN2D 3LGOA 2PU4A 1OPXA 3UPPA 3FPVA 1SHVA 3ZG7B 4P6ZS 2ZBBA 3MNND 2OWHA 5CPKA 5CPKC 2OOLA 5A91A 3WRZA 4MB4A 4QLCA 1PFLA 4HOIA 3ICYA 4HNBA 5KZHA 4UUZB 3AZKA 1M1AA 4F3LB 4XUJD 4ETZA 1VB6A 2ZMFA 3H82A 4YM6A 5CGWA 4U0XA 3AZLD 1M18B 3UN7A 5HZHA 1ESIA 1ODVA 1BLHA 2DF4C 5B1MB 2EX6A 1JWVA 1KX3C 1NLYA 4PMAA 4KHAA 2CV5A 1E6RA 5HFOA 4HHDA 1R4VA 5E2EA 3LELC 1FCMA 2JKRI 1ZLAB 4JGRA 3SH9A 4MN6A 4E3JA 3MQOA 3R4KA 5BS7A 4OPRA 1ONGA 1FR6A 3EPHA 1FILA 2ZM0A 3X1TA 3ZDJA 4CAYA 2WGVA 4OLGA 3VP0A 3L26A 4QPRA 3DWZA 2R78A 2V0UA 4KUDA 1NZUA 4QY6A 4YFMA 1M18D 5HPIA 2QKPA 2XLNA 4E3LA 5B1MD 3BFEA 3UY6A 1XJ4A 5FI2A 5I94A 2PD8A 4IBDA 2XEPA 5FEGA 2B5RA 2Z2LB 1CQAA 3E4OA 4YM6C 1LT0A 4PPRA 3HREA 2BYMB 4IJFA 3TU4C 1P3BA 3BJNA 5GT0C 2OAP1 1SZVA 3NDEA 4EO5B 2J80A 3VMAA 1FIKA 3SZTA 1HQ3B 4IBXA 3W8KA 5HD5A 3LZ0C 2JC7A 4PHTA 3UMEA 3GTCA 1TEMA 4A5RA 3X1UA 3AZNC 2VK3A 4OLDA 4J8UA 4HBTA 5G49A 3UDXA 5KSCA 3G31A 4CLCE 2L5AA 1KGGA 2HJEA 4X23C 3O62C 4J8VB 1M18A 1GPFA 1CF0A 4GLQA 4NG2A 2M7VA 2EXBA 1N9OA 1NXYA 4HI4A 4Z2IA 4MBFA 4N1XA 4QJGA 5CPJB 2F8NH 2DQNC 3REKA 3WD3A 1D06A 2D49A 4B9OA 2Y59A 1XJ6A 3MBZA 3BM6A 2Y2MA 1UGUA 1AXBA 1YLYA 4DXCA 3CITA 4UQIS 5CPKB 1YU1A 3HONA 3RELB 2NUTC 1L0DA 5E2GA 4EBPA 1K56A 1MKIA 1DJCA 3BFDA 4DXBA 3GDIA 1DJAA 5CHMA 3Q7ZA 2FJ7C 4WL9A 3G32A 2NZDC 3C1BA 3A0SA 4LPZA 4JXVA 4IJEA 2PDRA 2JE5A 2HPBA 1NY0A 5B32C 3KWQA 4EWFA 1A0KA 5AV9A 3AZEC 3IXHA 3BQAA 1SKOB 5CHUA 2PYOC 1M1AC 4GS9B 4WU8C 1YQSA 3IH8A 4LV3A 3C30A 5EE8A 3NY4A 3R45A 3MKEA 3FDDA 4N1HA 5AV9B 3WD1A 4IBIA 5HW3A 5GHYA 1J7MA 5E5AA 5CPKD 1GHMA 4K0XA 3RELD 4M3KA 3OCNA 2C6WB 1MWTA 2CV5C 4MDZA 2I72A 3HLBA 3T4SA 2BTFP 4IBRA 1JWZA 1F2KA 3L27A 1F9IA 3AGFA 4JF6A 3X1UC 5B0YA 3WS4A 1T3UA 3C1CA 2HDQA 4L0LA 3GMWA 4X53A 1BLPA 1GA9A 4NXBA 3REKB 3MZDA 1LHYA 3W99C 1S0WA 3EGXC 4R8PA 4ME4A 2QJ5A 1T1CA 3DTEA 5B33B 4I39A 3AZEB 3AZFD 1S32A 2J3TD 2IA2A 3EGDC 3VH5T 2ZOHA 5AVCA 3F1PB 2Y2PA 4P6ZM 2OLVA 3IHAA 3MSHA 1Z09A 3FKWA 3REIC 2FFFB 4EEPA 1BTLA 1DP9A 2WKHA 1YSPA 3KYQA 4KGCD 5EECA 3AZGA 4WMCA 4DJ3A 1L0EA 3EQUA 5DNMA 3LI8A 1YLJA 3UTBB 4OJOA 4WEJA 3B0DC 3AZED 2OAQ1 2WK0A 1X0OA 4P85A 2H28A 1P3FB 4KZ4A 5DTKA 4G3WA 4HIAA 2Y2JA 3GSGA 4B93A 5B24C 5F99B 2YKFA 2G2UA 3NECA 4KGCB 1ZTUA 5AV6C 3G35A 3WWXA 5CTMA 1Y4OA 2NQBB 3WX7A 1IYQA 2BASA 4FSFA 3S1YA 1ZLAA 4NK3A 3AV2A 2XD1A 3PBRA 3Q82A 3UE1A 1XJ2A 4FUWA 3A6ND 1H8MA 4Q0HA 4JJNA 5B1MA 3K2NA 3UTAD 4K0WA 2PYOD 2JKGA 4U0TA 4WU8A 1STZA 1PDCA 1S66L 2AVXA 1M1AB 3FKVA 3BEBA 3UB8A 5B2JD 1E6PA 1AOIC 3EPJA 2EWVA 5HL1A 3BY8A 3Q07A 4I3JA 3S7PA 3MZFA 2ZQDA 1E3UA 1PWGA 5EV0A 4EESA 2FJ7B 3AN2A 5JRGC 3A6NB 3IWQA 1JVJA 1L0GA 4OJLA 3V3RA 3C5AA 3IF6B 4LV0A 2W3DA 5A8BA 4QNLA 1W7FA 3N6IA 4GS9A 1ES2A 3MGSB 2EX9A 5BNXB 5EOEA 3HLEA 1P3KA 3U2AA 4NYUA 2PR6A 5B32B 4LG2A 1ULYA 5CEDA 4U3TA 2RVQC 3OOVA 1WA9A 5EVIA 2OLUA 1YUEA 3DAVA 4CLCB 1AIWA 2WAFA 4RQ9A 2ZY2A 4J8VC 4WU9C 2OV5A 3KUYD 5I5LA 2Y2HA 5B31G 5HDDA 3G30A 5AY8A 4IBBA 2FN2A 3QP4A 5EM1A 1NRFA 5CPIA 5F68A 4BLMA 1PIOA 3MGPC 4S2PA 4S2KA 3KSYA 4BL2A 1S1ZA 2IOUA 3ZYTA 2WKEA 5TBMA 3MGQD 3D72A 3NQJA 3WAAB 3HVFA 2W0NA 4H9OB 4OKPA 2F2AC 2AROA 4H6JA 5GL9A 3UT9A 2ZC3B 2Z6DA 2Y2IA 3IT9A 3LIBA 5HD3A 3F1OA 4ZUXA 3I7JA 4NZ3A 4IJGA 3KUYB 2ZY4A 4NFTA 4WZ4A 5J4EA 2L1MA 1F5MA 1DJBA 1OGBA 4JXSA 1WE4A 3NC8A 1UWNX 3VOLA 1HQ3A 2HDRA 5TGFA 3VP1A 4IBGA 5B2JA 2VV7A 1AOID 4DRTA 3MGQB 3AGEA 1H8ZA 4Z5TA 1YU3A 3VH5A 3UB5P 2HDUA 1KX4C 3LIEA 3A3IA 5BS7C 3MVDC 1S4SA 5D3OA 3PBSA 3BLMA 1ED7A 4UAAA 4AFIA
chains in the Genus database with same CATH topology
4C75A 4NETA 3NCKA 4YS3A 1NYMA 1KVMA 3C7VA 5JA4A 2CV5D 3N3FA 5AVBB 1P3LC 3Q7VB 5DTTA 5B0ZA 4S2OA 4UA7A 5HARA 1ERMA 1P3FC 1P3MC 4ZUXC 1ZKJA 3VSLA 5KSHA 4XUJC 3UPOA 2P9VB 3AZNB 1O07A 3BLSA 1QMFA 5CHLB 1IYSA 5AV6D 3OPPA 1P3OA 1KX4B 3AGDA 2UWXA 4IBEA 1Q2PA 2CV5B 5JA4B 5AVBD 4R8PD 3AZHD 4S2IA 4E6WA 3HUMA 2ZM2A 4S2JA 3LJAD 4YM6B 3AZGC 3GQZA 3PBOA 3AZIA 3IP4C 4KG2A 4R4RA 4UA9A 3B6FB 4X68A 3ISGA 1BH8A 5GSUA 3G2ZA 3O3VA 4LENA 3UO9A 3S4XA 4CJNA 4H9RA 3AFAB 3ZGAB 2XFSA 3LJAB 5EUAA 5EVID 3VP3A 1KX5A 2DCFA 1JFIB 4R4SA 4WV4B 3MGQC 3WA9A 5GT3C 3AZJD 1FOFA 1K38A 4X23A 5B0ZC 3P5JB 1XX2A 1U35D 5AY8B 3KUYC 3VH6A 4HGAC 3ZNYA 5B31C 5EVIB 5E5AD 1VQQA 3X1TC 1JFIA 1M19D 1F1EA 5FQJA 3B6GC 4E3MA 4LD9B 4NZ4A 4X55A 4ZJ1A 1F66C 1EQZC 3A1IA 2Y55A 3MVDB 4RVAA 3LELD 1F66D 1FQGA 3X1SD 2FJ7A 1NJ4A 3HBRA 1YMSA 5GXQD 4C3QA 4E45A 5C3IB 2ZD8A 1K56D 2Y2NA 1GA0A 4GD8A 3AZKC 4WZ5A 5AV5C 5AV8C 4GDBA 3H0LC 3TOIA 3F6TA 4JJND 1IKIA 3MVDD 3B6GB 4WEKA 3SOIA 1YLWA 3L2AA 4R23A 1NZOA 1F66B 2ZQ8A 1K55C 3AV2B 1IEMA 5GXQB 4J8UC 4BD1A 3X1VB 3W97C 3O62A 5J8XA 1P34C 3AZNA 5EVIC 4ID4A 4Z66B 4KG5A 1TZYB 2Y2KA 5F99A 3NDGA 1P3KC 4DE2A 5B0ZB 4OPYA 5BO0A 3PTEA 1P3BD 3REIB 5AVBA 2J9PA 1DY6A 3N8SA 3GR2A 4S2MA 4DKIA 3X1VD 4QU3A 3KXBA 2F8ND 1P3PD 2P74A 4HEFA 3FKEA 1ZC2A 3MZEA 1JTGA 1TZYD 1XPBA 1ES5A 3FZCA 5B40C 1KU5A 4Z5TD 3WKJB 2YFVB 4B88A 5B0ZD 5HAIA 4Y0OA 5FAOA 3B6FC 3AZFA 1LLBA 3AZEA 5B33A 1N4OA 4EBNA 1P3PB 3EG5B 3LZ0B 3LELA 1W5DA 2AROB 1P3OC 1LI9A 1SDEA 4EO5C 3WAAA 5JRGD 3NQJB 2RIQA 4MLLA 1BH9B 3WKJD 3W97A 1KX3D 1ID3D 4JLFA 3ZCZA 3QNCA 4QLCC 3IXDA 2ZC4B 1BSGA 3HL9A 2IO5B 3OCLA 1U35A 1BULA 4UPKA 2JSSA 3A3JA 1P3AD 4WU9A 3W97B 1ESUA 1BH9A 4GOGA 2FFYA 4E3NA 3WRTA 4C6YA 4ZJ3A 4CPKA 1ID3B 5GLBA 5JRGA 3KWQB 3REHC 2Y91A 3WS5A 1EQZD 3AN2B 1KX5C 5FQQA 1KE4A 1K4EA 3REJD 4Y0UA 1K4FA 2WKIA 4F94A 3PAEA 1MWRA 4E44A 3RELA 4JF4A 5JYOA 4GHLA 4G92C 5GSUB 1JTDA 4XXRA 5FI7A 1BH8B 5E43A 3AZIC 1IKGA 3AZIB 1U35C 5DF7A 4BQMA 5U47A 1EQZB 3HLFA 5GHZA 3OZHA 4NE3A 4J8VA 3O62D 3KXBB 2EX8A 5CXWA 4IEDA 4N9LA 3FV7A 3X1UB 4OQIA 4YS3D 3A1KA 1ZLAD 4KGCA 3UT9C 4OOMA 4YINA 2BLSA 1P34D 5B1LD 1P3IA 1XKZA 4ZTKA 1P3IC 2A49A 4EQIA 5FASA 4UHUA 3AZID 2DNSA 3O86A 1CEFA 5AV9C 2ZC5B 1P3BC 3M2JA 3NBLA 3O62B 3KXBD 4G91C 3VFHA 3Q7VA 2WGWB 3RXWA 4H9NA 3NIAA 4NZ1A 4NZ5A 4WMCD 3X1UD 4YS3B 2F8NG 1P34B 1A7WA 1HQ3C 1W79A 3LZ1B 2NZDB 1FSYA 4LV1A 4KUDB 5AV5D 4KUDC 2Y2LA 3RELC 4PM9A 3VH6T 3AZLC 1M18C 2R9WA 4KZ3A 5CP6C 1LL5A 5AQBA 2IO5C 2WADA 1YMXA 1H3OA 3UDFA 5DNNC 2ZM5A 4JF5A 3UE3A 3ZVWA 1P3AC 3W99A 3L29A 5DVAA 3OPRA 1KDSA 4IVIA 4XUXA 4J8XA 3LZ1D 1P3MA 4QY5A 2NZDD 3PAGA 4AWLB 5CPJD 3CMZA 3VOYA 5GT0A 3ZNTA 3DWKA 5B40B 3WKJC 1KX5D 5A93A 1HZOA 4ZDXA 2JCHA 3P98A 4GN2A 5B2IB 5F83A 3W96B 4H9PB 4IBJA 5DNMC 2IWBA 2Y2QA 1RGZA 1E3UD 4BL3A 3R45B 3WS0A 1FCOA 3IWOA 4H9QA 5B31D 3MKFA 3B0DB 5BPVA 1P3KB 2Y2OA 3AN2C 5BNXA 1KX5B 4UA6A 4H9QB 3A3DA 3CJMA 4DRBA 3LJAA 3C1BB 2EFXA 5AV9D 2XDMA 3W96D 5F82A 1BT5A 3MNNA 3V9RA 4EUZA 4KQRA 2XR0A 1MXOA 4MBHA 1PYYA 1P3OD 5FSRA 3D4FA 2Y4AA 3B6FA 5BNVB 5B31B 2Y2GA 3QNBA 3UTAA 2V20A 2ZC6B 2G5HC 3IWIA 3VSKA 4LV2A 5B1LC 3VFFA 2HIOA 1K6SA 5HAQA 5B1MC 4GB7A 2R9XA 1P3LB 5L2FA 3REJC 4E3IA 4J8UD 1WWIA 2AROC 1P3OB 4GDNA 5AV6A 3AZMB 2WYXA 3BYDA 3DTMA 4WM9A 5AV8B 2XH9A 3MFDA 1EWZA 4OVDA 3WTPE 3VH6W 2NZDA 4IBFA 3AV1A 1P3FA 1P3LD 1L2SA 5DNNA 4HGAB 2EX2A 3UTBD 4E3KA 4GHAA 3IF6C 4FH2A 1B67A 3B0BA 1P3FD 4RX2A 3MGQA 5AV8A 1LI0A 3VP4A 5F99D 3X1TD 3EPLA 3ITBA 4DF6A 1MPLA 1P3IB 2J9OA 5FQKA 3SH7A 3ZG0A 3L28A 1WYBA 5HAPA 2NQBD 4OP8A 1W8QA 1I2WA 2QPNA 1LL9A 4KZ9A 3UE0A 2X02A 5FAPA 4KZ7A 2V2FF 3UTAB 5BNVA 1KDWA 3E2LA 1P3ID 4WU9D 5B0YB 2ZC7A 3PBNA 1CK3A 1N1JB 3SS4A 2HUEC 4EBLA 3W98D 5B32A 3TG9A 2J7VA 5GT3A 3MGSD 3VH5W 1P3AA 4WU9B 5B0YD 4X6TA 2ZMAA 1CI9A 3W99D 5C3IC 1PW8A 3W96A 4E3OA 4OH0A 5B2IC 3N4IA 3C4OA 5EVLA 4PM5A 4LCMA 3MGRA 4ZBEA 4OJ6A 4XUJB 1MWSA 4EV4A 4OP5A 3WTPD 1P3MB 3WAAD 4R3JA 5CPJA 3W99B 2WAEA 5AQ7A 5AVBC 5DF9A 5B2JC 2WGIA 3X1SC 3AZGD 1KE3A 3LJAC 5FAQA 3HLDA 5CRFA 2H0TA 5A92A 3AV1D 3SS5A 2IWCA 1GHPA 3WKJA 3N7WA 3WA9C 1ES3A 3WTPB 3LZ1A 1P3MD 1HTZA 3LZ1C 3WTPC 2ZY3A 1TDGA 3SH8A 4QHCA 1RGYA 3HLGA 4H9NB 3UTBA 3OC2A 5IHVA 2WGWA 2VQRA 2G2WA 3AZGB 1VM1A 4G92B 2CWEA 4JXGA 3LO7A 3AV1B 5E5AC 3W98C 2RCXA 3AL0C 4Q8IA 3B0CT 3C1CD 1HQ3D 3AZND 3ZFZA 1Z6FA 4CAYB 4B4ZA 3MGRC 5AV6B 3AZMA 1KX4D 5KMWA 4BENA 4D2OA 4KZ5A 3KXBC 3W4QA 3W4OA 3AV2C 3EPKA 4DE0A 4J8VD 4R8PB 1F66A 1P3GC 4Z2MG 4S2LA 1YU2A 4IVKA 1KGFA 3H0RC 4YM6D 3C1CB 4OUIA 4XUJA 1AOIA 3RXXA 4UUZA 3AZKB 5B31A 4J8XC 3B6FD 4CSRB 1PZRA 3X1VC 5TFQA 5BOHA 5CHJA 4S2NC 3HLWA 1MBLA 3BFGA 3LCEA 1P3PC 2ZY5A 4LD9A 1EI5A 1YT4A 2QZ6A 5B24B 5F99C 1RP5A 3AZJB 1G68A 1N9BA 3Q1FA 3AZKD 5CPJC 5EPHA 3C4PA 3UPNA 3UNWA 3ITAA 2E8IA 4ZAMA 2XF3A 1O7EA 2DRWA 4KENB 1N1JA 4Z2MH 1XP4A 1GCEA 3LEZA 4H9PA 2XK1A 3REHA 4IBCA 3ZG9B 4OPQA 2XQZA 3QHYA 1PI4A 4P6BA 1M19C 5B24D 5B40A 1M19B 3REKD 3ZG8B 1Q2QA 5CECA 4LD9D 4JJNC 3HLCA 4GD6A 4J8XB 3UTBC 4NE5A 3AFAA 1P3PA 2HDSA 3AYWA 1L0FA 4H9RB 3X1SB 5KDMA 5B33D 1W2EA 5EOOA 1H3OB 3AZFB 1XXMA 5CTNA 4XZQD 3A6NC 1H8YA 1PI5A 3ZVTA 5FQMA 4J8WB 3WAAC 4GNUA 1MWUA 1NYYA 1OMEA 3KFUG 4RYEA 3MGSC 3N8RA 1S6RA 3HUNA 2CC1A 4J8XD 4KZ6A 2BYMA 4KGCC 4R0QA 1YU4A 1P34A 3B6GD 3MGPA 1E4DA 4YS3C 4JXWA 1M6KA 2ZLYA 3AV2D 2F8NA 1K54C 4WYYA 3B0CW 1BFMA 1ZG4A 4XZQB 5FUGB 2BG1A 3L25A 1Y54A 4J8WD 5CERA 1BLCA 4WZ5C 1BZAA 3KS4A 1TZYA 4QB8A 4Z66D 1TZYC 5FDHA 5B1LA 2OSUA 5F1FA 1H5XA 3Q81A 2V1ZA 1PZOA 5CP6B 3X1VA 3REID 5AQAA 3V50A 3WS2A 3B6GA 1XGIA 5E2FA 2NQBC 3AZFC 4GZBA 5F1GA 4PM6A 2PYOB 1E25A 1KVLA 3C1CC 2BYKB 1W8YA 2ZQ9A 1M1AD 5B2JB 4J8WA 3C7UA 5CP6D 1YLTA 1B6WA 2HUEB 3TU4A 2HP5A 3IH9A 3V9RB 5KDMB 3X1SA 2FJ7D 3LY3A 2J8PA 3AZLA 2F8NK 3BFCA 3UT9B 4B4XA 5JRGB 2EFUA 2H10A 1ALQA 3WA9D 2EXAA 3IXBA 1ID3A 1BLSA 4N92A 5B32D 4RA7A 1P3GA 1Z2CB 1KX3B 1KGEA 1TDLA 1EROA 3N8LA 1SDNA 4O7DA 4K91A 1Q9CA 4BD0A 3HSHA 5B2IA 3UDIA 1P3GB 4H9SC 5JYPA 3UT9D 5GSUC 3WA9B 1KE0A 2ZM8A 5GT0B 4Z5TC 3V5MA 4IBKA 3MGSA 4ZBJB 1XA1A 3CZDA 5CPIC 3KWQD 5CGSA 5B0YC 1HVBA 4OQGA 1ZLAC 1K54A 4Y7PA 2YFWB 3REJB 1I5QA 1M40A 4OONA 3V39A 4J8WC 1G6AA 2HP6A 1P3GD 4CSRA 1K57A 4X56A 3IHBA 5GSUD 3AZJC 1AOIB 4RX3A 1TAFB 2RL3A 5GT0D 2YFVA 2X71A 4NY2A 2PYOA 3VOZA 5AV5A 3FYZA 3W96C 4H9SA 4ZBJC 5TR7A 3RJUA 4PM8A 3AZHA 3MGPD 1KX4A 5AQ9A 2NQBA 1PZPA 4WNNB 2Z2MB 3AZMC 5B33C 5B1LB 3AYWC 3ZHHA 4OQ0A 4DE3A 5FQ9A 4Z66A 2RVQD 4KZ8A 1S32D 2VGJA 3PBQA 5CGXA 4R8PC 3REKC 3NQUA 3W4PA 3MNNC 3AZHB 3MGPB 1FSWA 5GXQA 5M19A 2WZZA 1EQZA 4N9KA 5FI6A 1YM1A 4NE6A 5BT1C 5GLDA 1HTAA 2LY8A 3V3SA 4OOLA 3GVBA 2ZQ7A 3WTPA 4KUDD 5AV5B 5AVCB 1QMEA 5FATA 4HBUA 1TAFA 4GH9A 1S32B 1ZG6A 4KQOA 4P87A 4JPMA 3S22A 3KUYA 4ZJ2A 3G34A 2YFWA 3REJA 4E6XA 3AFAD 1YU0A 2PBYA 3FWLA 4Z66C 4OJ5A 3HUOA 5B32G 3MVDA 4JBFA 4JKTA 5CEBA 2XD5A 3DW0A 5AVCD 3LY4A 5B40D 1HD8A 4LCLA 3IXGA 1ES4A 4DDSA 3OPHA 1U35B 2Q9NA 5AY8D 5B2ID 2XGNA 3IQAA 3IF5A 4DDYA 2X01A 4OOYA 2WZXA 3SS3A 5E5AB 3TU4D 3AZJA 3BRMA 1WYCA 1KX3A 1PWDA 4Z9QA 3ZG5A 4XZQC 5FA7A 1ONHA 5GHXA 1P3KD 3IF6A 1IYPA 2ZQAA 3A6NA 5M18A 1RCJA 3C1BD 3LZ0A 3LELB 3AFAC 4FD8A 3CG5A 3O88A 4S2NA 4LD9C 1K55A 1SKFA 2PU2A 2XFTA 5DF8A 4G91B 2ZJ9A 3GRJA 4Y0TA 3TU4B 3WS1A 1CEGA 3O87A 4WELA 4WU8B 3BFFA 4KQQA 4R1GA 3M6BA 3MXRA 1PWCA 4FCFA 2BYKA 4KZBA 5M1AA 4JJNB 5HX9A 4M6BA 3OPLA 4X69A 1K57C 5A90A 1K6RA 4WBGA 2H5SA 3GV9A 5DNMD 5G49B 5GXQC 4J8UB 1IYOA 3NQUB 3REIA 5DNND 5BT1D 5BO0B 2JBFA 5CP6A 4WU8D 3AZMD 5FQIA 5E2HA 1ID3C 3EQVA 3UTAC 5AV8D 1FR1A 1FCNA 2P9VA 3M6HA 2HIOC 2WUQA 4AWLC 4WNNA 1P3BB 1XGJA 2IWDA 1S32C 5FUGA 3KS8A 3NI9A 5DNMB 4XZQA 4MBKA 4DE1A 2A3UA 4PM7A 2F8NB 1GHIA 4OQHA 1WWSA 5DNNB 1I2SA 5GLAA 2QMIA 3AYWD 2H0YA 1J9MA 3A3EA 4HESA 3BECA 2W8SA 3B3XA 1K25A 1CI8A 2ZQCA 4H8RA 3TSGA 1BUEA 3PBTA 4Z5TB 4KG6A 3MXSA 3X1TB 4WZSB 5DTSA 5G18A 1IELA 1U60A 4P0MA 4WJ3C 1PW1A 5CPID 3LZ0D 3VP2A 1P3LA 4KHAB 3AYWB 5AY8C 2AROD 1MY8A 1C3BA 4ZUXB 2J8YA 2Q9MA 4QD4A 1YLZA 4X23D 3M2KA 4MEZA 2HIOB 5GT3D 4H9OA 3P09A 4FH4A 1M19A 4KZAA 5AVCC 2C5WB 4MNRA 4DQYB 1YLPA 3MGRB 3C1BC 2GDNA 4DRAA 2VGKA 4BJPA 4QLCB 3KWQC 3REHB 3JYIA 5CPIB 3A3FA 1JWPA 1SCWA 3MNNB 3AZHC 4ZUXD 3H0MC 1TVFA 3G4PA 4R3BA 1ERQA 1P3AB 4X23B 3AV1C 3W98B 3W97D 4GKUA 2HIOD 5GT3B 5GLCA 4OPZA 5B24A 2G5IC 3MGRD 4OJPA 4NYYA 3E2KA 3G2YA 2HP9A 3W98A 4QLCD 4XUZA 3AZLB 1XA7A 3REHD 3AN2D 2PU4A 3UPPA 1SHVA 3ZG7B 3MNND 5CPKA 5CPKC 5A91A 3WRZA 4QLCA 5KZHA 4UUZB 3AZKA 1M1AA 4XUJD 4YM6A 5CGWA 4U0XA 3AZLD 1M18B 3UN7A 1ESIA 1BLHA 2DF4C 5B1MB 2EX6A 1JWVA 1KX3C 4PMAA 4KHAA 2CV5A 5HFOA 1R4VA 5E2EA 3LELC 1FCMA 1ZLAB 3SH9A 4E3JA 4OPRA 5BS7A 1ONGA 1FR6A 3EPHA 2ZM0A 3X1TA 3ZDJA 4CAYA 2WGVA 4OLGA 3VP0A 3L26A 3DWZA 4KUDA 1NZUA 4QY6A 4YFMA 1M18D 2XLNA 4E3LA 5B1MD 3BFEA 3UY6A 5FI2A 5I94A 4IBDA 2XEPA 2B5RA 2Z2LB 4YM6C 4PPRA 3HREA 2BYMB 4IJFA 3TU4C 1P3BA 5GT0C 3NDEA 4EO5B 3VMAA 1HQ3B 4IBXA 3W8KA 3LZ0C 2JC7A 3GTCA 1TEMA 4A5RA 3X1UA 3AZNC 4OLDA 4J8UA 4HBTA 5G49A 3UDXA 5KSCA 3G31A 2L5AA 1KGGA 4X23C 3O62C 4J8VB 1M18A 2EXBA 1NXYA 4MBFA 4N1XA 4QJGA 5CPJB 2F8NH 2DQNC 3REKA 2Y59A 3MBZA 3BM6A 2Y2MA 1AXBA 1YLYA 4DXCA 5CPKB 1YU1A 3HONA 3RELB 4EBPA 1L0DA 5E2GA 1K56A 1MKIA 1DJCA 3BFDA 4DXBA 1DJAA 5CHMA 3Q7ZA 2FJ7C 3G32A 2NZDC 3C1BA 4JXVA 4IJEA 2JE5A 2HPBA 1NY0A 5B32C 3KWQA 4EWFA 5AV9A 3AZEC 3IXHA 5CHUA 2PYOC 1M1AC 4WU8C 1YQSA 3IH8A 4LV3A 5EE8A 3NY4A 3R45A 3MKEA 3FDDA 4N1HA 5AV9B 4IBIA 5HW3A 5GHYA 1GHMA 5E5AA 5CPKD 4K0XA 3RELD 4M3KA 3OCNA 2C6WB 1MWTA 2CV5C 2I72A 3HLBA 4IBRA 1JWZA 3L27A 3AGFA 4JF6A 3X1UC 5B0YA 3WS4A 1T3UA 3C1CA 2HDQA 4L0LA 3GMWA 4X53A 1BLPA 1GA9A 3REKB 3MZDA 1LHYA 3W99C 1S0WA 4R8PA 5B33B 3AZEB 3AZFD 1S32A 3VH5T 5AVCA 2Y2PA 2OLVA 3IHAA 3FKWA 3REIC 2FFFB 1BTLA 2WKHA 4KGCD 5EECA 3AZGA 4WMCA 1L0EA 3EQUA 5DNMA 1YLJA 3UTBB 4OJOA 4WEJA 3B0DC 3AZED 2WK0A 4P85A 1P3FB 4KZ4A 5DTKA 2Y2JA 3GSGA 5B24C 5F99B 2G2UA 4KGCB 5AV6C 3G35A 3WWXA 5CTMA 2NQBB 3WX7A 1IYQA 4FSFA 3S1YA 1ZLAA 4NK3A 3AV2A 2XD1A 3PBRA 3Q82A 3UE1A 3A6ND 4JJNA 5B1MA 3UTAD 4K0WA 2PYOD 4U0TA 4WU8A 3FKVA 1M1AB 3BEBA 5B2JD 1AOIC 3EPJA 5HL1A 3Q07A 3MZFA 2ZQDA 1E3UA 1PWGA 2FJ7B 3AN2A 5JRGC 3A6NB 3IWQA 1JVJA 1L0GA 4OJLA 3V3RA 3C5AA 3IF6B 4LV0A 4QNLA 1W7FA 3N6IA 1ES2A 3MGSB 2EX9A 5BNXB 5EOEA 3HLEA 1P3KA 4NYUA 4LG2A 5B32B 1ULYA 5CEDA 4U3TA 2RVQC 5EVIA 2OLUA 1YUEA 2WAFA 2ZY2A 4J8VC 4WU9C 2OV5A 3KUYD 2Y2HA 5B31G 3G30A 5AY8A 4IBBA 1NRFA 5CPIA 4BLMA 1PIOA 3MGPC 4S2PA 4S2KA 3KSYA 4BL2A 2IOUA 2WKEA 3MGQD 3NQJA 3WAAB 3HVFA 4H9OB 4OKPA 2F2AC 2AROA 5GL9A 3UT9A 2ZC3B 2Y2IA 3IT9A 4ZUXA 3I7JA 4NZ3A 3KUYB 2ZY4A 4NFTA 4WZ4A 1DJBA 4JXSA 1WE4A 3NC8A 1HQ3A 2HDRA 5TGFA 3VP1A 4IBGA 5B2JA 1AOID 4DRTA 3MGQB 3AGEA 1H8ZA 4Z5TA 1YU3A 3VH5A 1KX4C 2HDUA 3A3IA 5BS7C 3MVDC 5D3OA 3PBSA 3BLMA 4UAAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E4D A;  4JXW A;  4NET A;  4C75 A;  3NCK A;  1NYM A;  3A3F A;  1KVM A;  1M6K A;  3C7V A;  1JWP A;  1SCW A;  2ZLY A;  2IWB A;  2Y2Q A;  1K54 C;  4WYY A;  1RGZ A;  1E3U D;  1ZG4 A;  3Q7V B;  5DTT A;  1TVF A;  4S2O A;  3G4P A;  4R3B A;  4UA7 A;  5HAR A;  1ERM A;  4BL3 A;  1ERQ A;  2BG1 A;  3WS0 A;  1Y54 A;  1FCO A;  1BLC A;  3IWO A;  4GKU A;  4WZ5 C;  5CER A;  1ZKJ A;  1BZA A;  3VSL A;  5KSH A;  3MKF A;  4QB8 A;  5FDH A;  5GLC A;  4OPZ A;  3UPO A;  2P9V B;  2OSU A;  5F1F A;  2Y2O A;  1O07 A;  3BLS A;  3E2K A;  3G2Y A;  4UA6 A;  1H5X A;  1QMF A;  3Q81 A;  2HP9 A;  1IYS A;  3A3D A;  3CJM A;  2V1Z A;  4XUZ A;  3OPP A;  1XA7 A;  1PZO A;  2EFX A;  2XDM A;  3AGD A;  5F82 A;  2UWX A;  2PU4 A;  3UPP A;  1SHV A;  3ZG7 B;  1BT5 A;  5AQA A;  1Q2P A;  3V50 A;  4EUZ A;  4KQR A;  3WS2 A;  2XR0 A;  4S2I A;  4E6W A;  1MXO A;  1XGI A;  3HUM A;  2ZM2 A;  5E2F A;  5A91 A;  4MBH A;  4S2J A;  1PYY A;  3WRZ A;  5FSR A;  3D4F A;  2Y4A A;  4GZB A;  5F1G A;  4PM6 A;  5KZH A;  2Y2G A;  3QNB A;  1E25 A;  1KVL A;  2V20 A;  3GQZ A;  2ZC6 B;  3IWI A;  3PBO A;  1W8Y A;  3VSK A;  2ZQ9 A;  4KG2 A;  4R4R A;  4LV2 A;  4UA9 A;  3VFF A;  1K6S A;  4U0X A;  5CGW A;  4X68 A;  3UN7 A;  5HAQ A;  3ISG A;  1ESI A;  3C7U A;  1BLH A;  1YLT A;  2EX6 A;  3G2Z A;  1JWV A;  2HP5 A;  3IH9 A;  4GB7 A;  4PMA A;  2R9X A;  3O3V A;  4LEN A;  3UO9 A;  5L2F A;  3S4X A;  4E3I A;  3LY3 A;  5HFO A;  4CJN A;  5E2E A;  1FCM A;  3SH9 A;  3ZGA B;  4E3J A;  2XFS A;  4OPR A;  1ONG A;  1FR6 A;  4GDN A;  5EUA A;  2ZM0 A;  3BFC A;  5EVI D;  3VP3 A;  4B4X A;  2WYX A;  3BYD A;  3DTM A;  3ZDJ A;  4WM9 A;  2DCF A;  2WGV A;  4OLG A;  2EFU A;  2H10 A;  2XH9 A;  1ALQ A;  2EXA A;  3IXB A;  4R4S A;  3VP0 A;  1BLS A;  3MFD A;  1EWZ A;  4OVD A;  3DWZ A;  4N92 A;  1NZU A;  1FOF A;  4QY6 A;  4RA7 A;  4YFM A;  1K38 A;  2XLN A;  4E3L A;  1KGE A;  3UY6 A;  3BFE A;  1TDL A;  1ERO A;  5FI2 A;  3N8L A;  5I94 A;  1SDN A;  4O7D A;  1XX2 A;  2XEP A;  1L2S A;  2B5R A;  4K91 A;  2Z2L B;  2EX2 A;  4BD0 A;  3ZNY A;  4PPR A;  4E3K A;  3UDI A;  3HRE A;  3IF6 C;  5JYP A;  5EVI B;  4FH2 A;  1VQQ A;  4RX2 A;  1KE0 A;  2ZM8 A;  3NDE A;  3V5M A;  1LI0 A;  3VP4 A;  3VMA A;  5FQJ A;  4E3M A;  3ITB A;  4DF6 A;  1XA1 A;  1MPL A;  3CZD A;  4X55 A;  4ZJ1 A;  4IBX A;  2J9O A;  5FQK A;  3SH7 A;  3ZG0 A;  3W8K A;  1WYB A;  2JC7 A;  2Y55 A;  5HAP A;  5CGS A;  3GTC A;  4RVA A;  1TEM A;  4A5R A;  1HVB A;  4OLD A;  4OP8 A;  4OQG A;  1W8Q A;  4HBT A;  1FQG A;  3UDX A;  5KSC A;  1I2W A;  1NJ4 A;  1YMS A;  3G31 A;  3HBR A;  1K54 A;  4Y7P A;  1I5Q A;  1KGG A;  1M40 A;  4OON A;  3V39 A;  2QPN A;  4C3Q A;  1LL9 A;  2ZD8 A;  1K56 D;  1G6A A;  2HP6 A;  2Y2N A;  4KZ9 A;  3UE0 A;  2X02 A;  2EXB A;  1GA0 A;  1NXY A;  1K57 A;  4X56 A;  3IHB A;  5FAP A;  4GD8 A;  4MBF A;  4N1X A;  4RX3 A;  4QJG A;  4WZ5 A;  2RL3 A;  2X71 A;  4KZ7 A;  2V2F F;  3VOZ A;  3FYZ A;  4GDB A;  3E2L A;  1KDW A;  3TOI A;  2Y59 A;  3MBZ A;  2ZC7 A;  3BM6 A;  2Y2M A;  1IKI A;  1AXB A;  1YLY A;  4WEK A;  5TR7 A;  3SOI A;  1YLW A;  4R23 A;  3PBN A;  1NZO A;  4DXC A;  1CK3 A;  4EBP A;  2ZQ8 A;  1L0D A;  5E2G A;  1K56 A;  1MKI A;  1DJC A;  1K55 C;  3BFD A;  3RJU A;  4DXB A;  1IEM A;  1DJA A;  4PM8 A;  3Q7Z A;  5CHM A;  3SS4 A;  4BD1 A;  3G32 A;  5AQ9 A;  4JXV A;  1PZP A;  4EBL A;  2Z2M B;  5J8X A;  2JE5 A;  2HPB A;  1NY0 A;  4EWF A;  5EVI C;  4ID4 A;  3IXH A;  3TG9 A;  2J7V A;  4KG5 A;  5CHU A;  2Y2K A;  3NDG A;  1YQS A;  5EE8 A;  3IH8 A;  4LV3 A;  3NY4 A;  4DE2 A;  4X6T A;  4OQ0 A;  3MKE A;  3ZHH A;  5FQ9 A;  4DE3 A;  2ZMA A;  4N1H A;  4OPY A;  1CI9 A;  5HW3 A;  4KZ8 A;  3PTE A;  2VGJ A;  5GHY A;  3PBQ A;  1GHM A;  5CGX A;  4K0X A;  4M3K A;  2J9P A;  3OCN A;  1DY6 A;  2C6W B;  3W4P A;  3N8S A;  1MWT A;  3GR2 A;  4S2M A;  4DKI A;  1PW8 A;  1FSW A;  2I72 A;  3HLB A;  4QU3 A;  4E3O A;  5M19 A;  4OH0 A;  4IBR A;  1JWZ A;  2P74 A;  3N4I A;  4HEF A;  3C4O A;  2WZZ A;  1ZC2 A;  5EVL A;  3MZE A;  4N9K A;  5FI6 A;  4PM5 A;  4LCM A;  3AGF A;  4JF6 A;  4ZBE A;  1YM1 A;  1JTG A;  3WS4 A;  5GLD A;  3V3S A;  1MWS A;  4OOL A;  1XPB A;  3GVB A;  2ZQ7 A;  4EV4 A;  2HDQ A;  1ES5 A;  3FZC A;  4L0L A;  1QME A;  3GMW A;  4OP5 A;  4X53 A;  1BLP A;  5FAT A;  4B88 A;  4HBU A;  1GA9 A;  5HAI A;  4Y0O A;  5FAO A;  3MZD A;  4R3J A;  1LHY A;  1LLB A;  1ZG6 A;  4KQO A;  2WAE A;  5AQ7 A;  1S0W A;  4P87 A;  5DF9 A;  1N4O A;  4EBN A;  4JPM A;  2WGI A;  3S22 A;  4ZJ2 A;  3G34 A;  4E6X A;  1KE3 A;  2PBY A;  3FWL A;  1W5D A;  1LI9 A;  5FAQ A;  3HLD A;  3HUO A;  5CRF A;  2H0T A;  5A92 A;  4JBF A;  1SDE A;  3SS5 A;  2IWC A;  4JKT A;  1GHP A;  5CEB A;  2XD5 A;  3N7W A;  2Y2P A;  3DW0 A;  1ES3 A;  2OLV A;  3IHA A;  4MLL A;  1HTZ A;  3FKW A;  3LY4 A;  2FFF B;  1TDG A;  3SH8 A;  1BTL A;  1HD8 A;  2WKH A;  4LCL A;  4JLF A;  4QHC A;  3IXG A;  3ZCZ A;  1ES4 A;  4DDS A;  3QNC A;  1RGY A;  5EEC A;  3OPH A;  3HLG A;  2Q9N A;  3IXD A;  4WMC A;  2XGN A;  2ZC4 B;  3OC2 A;  5IHV A;  3IQA A;  2WGW A;  3IF5 A;  4DDY A;  1L0E A;  3EQU A;  2G2W A;  1BSG A;  3HL9 A;  1YLJ A;  2X01 A;  3OCL A;  1VM1 A;  4OOY A;  4WEJ A;  1BUL A;  2WZX A;  2WK0 A;  4JXG A;  3SS3 A;  4P85 A;  3LO7 A;  4KZ4 A;  5DTK A;  2RCX A;  3BRM A;  3A3J A;  1WYC A;  4Z9Q A;  1PWD A;  1ESU A;  3ZG5 A;  2Y2J A;  4GOG A;  4Q8I A;  2FFY A;  3GSG A;  5FA7 A;  4E3N A;  3WRT A;  1ONH A;  5GHX A;  4C6Y A;  4ZJ3 A;  4CPK A;  2G2U A;  5GLB A;  3IF6 A;  1IYP A;  1Z6F A;  3ZFZ A;  2ZQA A;  2Y91 A;  3G35 A;  3WWX A;  3WS5 A;  5M18 A;  4B4Z A;  5CTM A;  1RCJ A;  1IYQ A;  4FSF A;  3S1Y A;  4FD8 A;  3CG5 A;  5KMW A;  3O88 A;  4S2N A;  5FQQ A;  1K55 A;  1KE4 A;  1K4E A;  4Y0U A;  4BEN A;  2WKI A;  1K4F A;  1SKF A;  2XFT A;  2PU2 A;  4NK3 A;  4D2O A;  4KZ5 A;  5DF8 A;  4F94 A;  2XD1 A;  3PAE A;  3W4Q A;  3PBR A;  3W4O A;  1MWR A;  2ZJ9 A;  3GRJ A;  3Q82 A;  4DE0 A;  4JF4 A;  3UE1 A;  5JYO A;  4Y0T A;  3WS1 A;  4S2L A;  1CEG A;  1JTD A;  3O87 A;  4WEL A;  4IVK A;  4XXR A;  3BFF A;  4KQQ A;  5FI7 A;  1KGF A;  4R1G A;  5E43 A;  4K0W A;  3M6B A;  3MXR A;  4U0T A;  1PWC A;  4FCF A;  1IKG A;  3FKV A;  4KZB A;  3BEB A;  5M1A A;  3RXX A;  5HX9 A;  5DF7 A;  4BQM A;  5U47 A;  3OPL A;  3HLF A;  5GHZ A;  5HL1 A;  3Q07 A;  4X69 A;  1K57 C;  5A90 A;  3OZH A;  1K6R A;  4WBG A;  3MZF A;  2H5S A;  2EX8 A;  5TFQ A;  5BOH A;  3GV9 A;  2ZQD A;  1E3U A;  5CHJ A;  5CXW A;  1PWG A;  4IED A;  4S2N C;  4N9L A;  3HLW A;  1IYO A;  3FV7 A;  4OQI A;  3IWQ A;  1MBL A;  1JVJ A;  1L0G A;  3V3R A;  3C5A A;  2JBF A;  3IF6 B;  4OOM A;  4LV0 A;  4YIN A;  2BLS A;  3BFG A;  3LCE A;  5FQI A;  5E2H A;  1W7F A;  3N6I A;  1XKZ A;  4ZTK A;  1EI5 A;  2A49 A;  1ES2 A;  3EQV A;  4EQI A;  2EX9 A;  5FAS A;  4UHU A;  1YT4 A;  5EOE A;  1FR1 A;  2QZ6 A;  3HLE A;  1FCN A;  2P9V A;  1RP5 A;  3M6H A;  1G68 A;  1N9B A;  2WUQ A;  3Q1F A;  2DNS A;  3O86 A;  5CED A;  5EPH A;  3C4P A;  3UPN A;  1CEF A;  4U3T A;  1XGJ A;  3ITA A;  3UNW A;  5EVI A;  2IWD A;  2OLU A;  2ZC5 B;  2E8I A;  2WAF A;  3M2J A;  3NBL A;  4ZAM A;  3NI9 A;  3VFH A;  3Q7V A;  4MBK A;  2WGW B;  2XF3 A;  2OV5 A;  2A3U A;  1O7E A;  2DRW A;  4PM7 A;  4DE1 A;  2Y2H A;  4KEN B;  1GHI A;  4OQH A;  3RXW A;  3G30 A;  3NIA A;  4WMC D;  1XP4 A;  5GLA A;  1I2S A;  2QMI A;  1GCE A;  1NRF A;  2H0Y A;  3LEZ A;  1J9M A;  2XK1 A;  3A3E A;  4HES A;  3BEC A;  3B3X A;  4BLM A;  1PIO A;  1K25 A;  1CI8 A;  1W79 A;  4S2P A;  2ZQC A;  4S2K A;  3ZG9 B;  4OPQ A;  1FSY A;  4H8R A;  3TSG A;  1BUE A;  2XQZ A;  4LV1 A;  3QHY A;  1PI4 A;  4P6B A;  4BL2 A;  2WKE A;  3PBT A;  2Y2L A;  3HVF A;  4PM9 A;  4KG6 A;  3MXS A;  3ZG8 B;  4OKP A;  1Q2Q A;  5CEC A;  5GL9 A;  2R9W A;  3HLC A;  2ZC3 B;  4KZ3 A;  4GD6 A;  5DTS A;  1IEL A;  2Y2I A;  5G18 A;  1U60 A;  3IT9 A;  4P0M A;  1LL5 A;  5AQB A;  3I7J A;  2WAD A;  1PW1 A;  1YMX A;  3UDF A;  2HDS A;  1L0F A;  4JF5 A;  3UE3 A;  4WZ4 A;  3VP2 A;  3ZVW A;  5EOO A;  1DJB A;  1MY8 A;  1XXM A;  1C3B A;  5CTN A;  4JXS A;  2J8Y A;  5DVA A;  1H8Y A;  1KDS A;  1WE4 A;  2Q9M A;  1PI5 A;  3NC8 A;  3OPR A;  4IVI A;  4QD4 A;  4QY5 A;  1YLZ A;  4XUX A;  2HDR A;  3ZVT A;  3M2K A;  5TGF A;  5FQM A;  4MEZ A;  3VP1 A;  1MWU A;  1NYY A;  4GNU A;  3PAG A;  3CMZ A;  3VOY A;  3P09 A;  4DRT A;  1OME A;  4FH4 A;  3DWK A;  3ZNT A;  4KZA A;  3AGE A;  2C5W B;  1YLP A;  4MNR A;  4RYE A;  1H8Z A;  3N8R A;  2HDU A;  2GDN A;  3A3I A;  1S6R A;  5A93 A;  1HZO A;  2CC1 A;  3HUN A;  2VGK A;  5D3O A;  3PBS A;  4KZ6 A;  2JCH A;  4BJP A;  4ZDX A;  3BLM A;  3P98 A;  4GN2 A;  4R0Q A;  5F83 A;  4UAA A;  3JYI A; 
#chains in the Genus database with same CATH topology
 4C75 A;  4NET A;  3NCK A;  4YS3 A;  1NYM A;  1KVM A;  3C7V A;  5JA4 A;  2CV5 D;  3N3F A;  1YPR A;  5AVB B;  1P3L C;  1VET B;  3Q7V B;  5DTT A;  4E04 A;  5B0Z A;  4S2O A;  4UA7 A;  5HAR A;  1ERM A;  1P3F C;  1P3M C;  4ZUX C;  1ZKJ A;  3VSL A;  5KSH A;  3HJI A;  4XUJ C;  3UPO A;  3D3O A;  4Z2L A;  2P9V B;  1UWP X;  2EA9 A;  3AZN B;  1O07 A;  3BLS A;  3KX0 X;  4HH3 A;  1QMF A;  5CHL B;  1IYS A;  2W1R A;  4G3K A;  3UB6 A;  1MC0 A;  5AV6 D;  3OPP A;  3IS2 B;  1P3O A;  1KX4 B;  3AGD A;  2UWX A;  3HJK A;  4IBE A;  1Q2P A;  2CV5 B;  2V5O A;  5JA4 B;  5AVB D;  4Z1W A;  4R3A A;  4R8P D;  3AZH D;  4S2I A;  4E6W A;  3T4K A;  3HUM A;  2ZM2 A;  4S2J A;  3LJA D;  3WD0 A;  4YM6 B;  3AZG C;  3CPT A;  3GQZ A;  3PBO A;  3AZI A;  3IP4 C;  4KG2 A;  4R4R A;  4MB5 A;  4UA9 A;  3B6F B;  4X68 A;  3ISG A;  1BH8 A;  1EW0 A;  5GSU A;  2V1B A;  3G2Z A;  3O3V A;  4LEN A;  3UO9 A;  4JGP A;  4L9G A;  3S4X A;  4CJN A;  4H9R A;  4BBV A;  3AFA B;  3ZGA B;  2XFS A;  3LJA B;  5EUA A;  5EVI D;  3VP3 A;  3T50 A;  3B33 A;  1KX5 A;  2DCF A;  1JFI B;  4R4S A;  4WV4 B;  3MGQ C;  3WA9 A;  5GT3 C;  3AZJ D;  3MQQ A;  2PHY A;  1FOF A;  1K38 A;  4X23 A;  5B0Z C;  4Q0J A;  3P5J B;  3MQ0 A;  1E15 A;  1XX2 A;  1U35 D;  5AY8 B;  2Y79 A;  3KUY C;  3VH6 A;  4HGA C;  3ZNY A;  5B31 C;  5EVI B;  2V8F A;  5E5A D;  1G6O A;  1VQQ A;  3IX4 A;  3X1T C;  4I3I A;  1JFI A;  1OJG A;  1M19 D;  1F1E A;  1TS7 A;  5FQJ A;  3B6G C;  3TRC A;  2QHK A;  1IFQ A;  4LD9 B;  4NZ4 A;  3L9K A;  4E3M A;  4X55 A;  5EM0 A;  4ZJ1 A;  1F66 C;  1EQZ C;  3A1I A;  3BQ8 A;  2Y55 A;  3MVD B;  1V9Z A;  4RVA A;  5K5B A;  3LEL D;  1F66 D;  1FQG A;  3X1S D;  2FJ7 A;  1NJ4 A;  3HBR A;  1YMS A;  5GXQ D;  4C3Q A;  4E45 A;  5C3I B;  2ZD8 A;  1K56 D;  2Y2N A;  2FZ0 A;  1GA0 A;  4MMN A;  2HV1 A;  4YWZ A;  4GD8 A;  3AZK C;  4WZ5 A;  4ETX A;  3CUE C;  4KUK A;  4HJ6 A;  5AV5 C;  5AV8 C;  2O9A A;  4GDB A;  3H0L C;  3TOI A;  3VE3 A;  3F6T A;  4JJN D;  4II7 A;  1IKI A;  3MVD D;  3B6G B;  4WEK A;  3SOI A;  1YLW A;  3L2A A;  4R23 A;  1NZO A;  1F66 B;  2ZQ8 A;  5IT5 A;  1K55 C;  2XA7 S;  3AV2 B;  1IEM A;  5F5Y A;  5GXQ B;  4J8U C;  4BD1 A;  3X1V B;  3W97 C;  2HGV A;  3O62 A;  5J8X A;  1YAX A;  4ESP A;  3LR3 A;  1N9L A;  1P34 C;  3AZN A;  5EVI C;  4ID4 A;  4Z66 B;  4KG5 A;  1TZY B;  2Y2K A;  5F99 A;  3NDG A;  2PRF A;  1P3K C;  2VV6 A;  4DE2 A;  3A0V A;  3QP6 A;  5B0Z B;  4OPY A;  3LFV A;  5BO0 A;  3PTE A;  1P3B D;  3REI B;  2JHE A;  5AVB A;  3H7W B;  4ZRR A;  3JPU A;  5HWV A;  2J9P A;  1G28 A;  1DY6 A;  3C8C A;  3N8S A;  3GR2 A;  4S2M A;  3T4L A;  4IHQ A;  4DKI A;  3X1V D;  4QU3 A;  3KXB A;  2F8N D;  1P3P D;  2W3G A;  2P74 A;  4HEF A;  3FKE A;  1EAK A;  2M1C A;  1ZC2 A;  2W3F A;  3MZE A;  2KLI A;  4GCZ A;  1S1Y A;  2K7S A;  1JTG A;  1TZY D;  1Y28 A;  4M4X A;  1XPB A;  1ES5 A;  3FZC A;  5B40 C;  1KU5 A;  4Z5T D;  3WKJ B;  3MQL A;  4MN5 A;  2YFV B;  4B88 A;  5B0Z D;  5HAI A;  4Y0O A;  5FAO A;  3B6F C;  3AZF A;  1LLB A;  2PYP A;  4Y13 A;  3AZE A;  5B33 A;  1N4O A;  3MXQ A;  4XT2 B;  4EBN A;  2W3E A;  1P3P B;  3PR6 A;  3EG5 B;  3LZ0 B;  3LEL A;  2JKR M;  2GZA A;  2YKH A;  1W5D A;  2ARO B;  1P3O C;  1LI9 A;  4NXG A;  2V0W A;  1SDE A;  4EO5 C;  3WAA A;  5JRG D;  3NQJ B;  3NUL A;  3WD2 A;  2RIQ A;  4MLL A;  1BH9 B;  3WKJ D;  3QP2 A;  3W97 A;  1KX3 D;  1ID3 D;  3B42 A;  2RTS A;  1OTB A;  4JLF A;  3ZCZ A;  3WD4 A;  3QNC A;  4QLC C;  2HJ9 C;  3IXD A;  4JGQ A;  4NKP A;  2ZC4 B;  1BSG A;  3HL9 A;  2IO5 B;  2W1T B;  3OCL A;  4CQH A;  1U35 A;  1BUL A;  4GJ4 A;  5DKL A;  4UPK A;  2JSS A;  3A3J A;  1P3A D;  4WU9 A;  3W97 B;  1ESU A;  4LFU A;  1BH9 A;  4GOG A;  2FFY A;  4R70 A;  1DP6 A;  4E3N A;  3WRT A;  4C6Y A;  4ZJ3 A;  4CPK A;  1ID3 B;  5GLB A;  1P9W A;  5JRG A;  3T4J A;  4HMC A;  3RFB A;  3KWQ B;  3REH C;  2Y91 A;  3WS5 A;  1EQZ D;  1D7E A;  3KSG A;  3AN2 B;  1KX5 C;  2L4R A;  5FQQ A;  1KE4 A;  1K4E A;  3REJ D;  4Y0U A;  1K4F A;  1PNE A;  2WKI A;  5G4Y A;  4F94 A;  3PAE A;  3NHQ A;  1MWR A;  4E44 A;  3REL A;  4JF4 A;  5JYO A;  4GHL A;  2A24 A;  4G92 C;  5GSU B;  1JTD A;  4XXR A;  5FI7 A;  1BH8 B;  2LB5 A;  4YOF A;  2A2L A;  5E43 A;  3AZI C;  4NXF A;  3MFX A;  5F6A A;  1IKG A;  3AZI B;  3LIC A;  1U35 C;  5DF7 A;  4BQM A;  5U47 A;  1EQZ B;  3HLF A;  5GHZ A;  5DFY A;  5HDC A;  3OZH A;  4NE3 A;  4J8V A;  3O62 D;  3KXB B;  2EX8 A;  4FTX A;  4EET B;  5CXW A;  4IED A;  4N9L A;  3FV7 A;  4Y5F A;  3X1U B;  3CAX A;  4OQI A;  4YS3 D;  3A1K A;  1ZLA D;  4KGC A;  3T4O A;  3UT9 C;  4OOM A;  4YIN A;  2BLS A;  1P34 D;  5B1L D;  1ACF A;  1AWI A;  1P3I A;  3BWL A;  1XKZ A;  4ZTK A;  1P3I C;  2A49 A;  3QP8 A;  4EQI A;  5FAS A;  4UHU A;  3AZI D;  1TS0 A;  2DNS A;  3O86 A;  1CEF A;  5IU1 A;  5AV9 C;  2ZC5 B;  1P3B C;  3M2J A;  3NBL A;  3O62 B;  3KXB D;  1TD5 A;  4G91 C;  3VFH A;  1VET A;  3Q7V A;  3VE4 A;  2KX6 A;  2WGW B;  5DKK A;  1MKM A;  3RXW A;  4H9N A;  3NIA A;  4NZ1 A;  4NZ5 A;  3KSH A;  3X1U D;  4I38 A;  4WMC D;  4YS3 B;  2F8N G;  1CK7 A;  1P34 B;  1A7W A;  4WUJ A;  2ZOI A;  1HQ3 C;  1W79 A;  3LZ1 B;  2NZD B;  1FSY A;  3QP1 A;  4LV1 A;  4KUD B;  5AV5 D;  3UE6 A;  4KUD C;  2Y2L A;  5FEF A;  3REL C;  4PM9 A;  3VH6 T;  3AZL C;  1M18 C;  2KDK A;  2R9W A;  4KZ3 A;  5CP6 C;  3KYE A;  3TJZ C;  1LL5 A;  5AQB A;  2IO5 C;  2WAD A;  1YMX A;  1H3O A;  3UDF A;  5DNN C;  2ZM5 A;  4JF5 A;  3IX3 A;  3UE3 A;  3ZVW A;  3UMD A;  1P3A C;  4IUH A;  3W99 A;  3LR0 A;  3T1S A;  3L29 A;  5DVA A;  3OPR A;  1KDS A;  4IVI A;  4XUX A;  4J8X A;  4I5S A;  3LZ1 D;  1P3M A;  4QY5 A;  2NZD D;  3FG8 A;  4AWL B;  5CPJ D;  3CMZ A;  3PAG A;  3VOY A;  5GT0 A;  3ZNT A;  3DWK A;  5B40 B;  3WKJ C;  3SW1 A;  3H9W A;  5TBM B;  4EUV A;  1DRM A;  1KX5 D;  5A93 A;  1HZO A;  4ZDX A;  2JCH A;  3P98 A;  4GN2 A;  3P01 A;  4TX8 A;  1LSW A;  5B2I B;  5F83 A;  1H3Q A;  3W96 B;  4H9P B;  2QWS A;  4IBJ A;  5DNM C;  1J3W A;  2IWB A;  4PKY A;  2Y2Q A;  1RGZ A;  1E3U D;  4BL3 A;  3R45 B;  3WS0 A;  1FCO A;  3IWO A;  4EQ1 A;  4H9Q A;  5B31 D;  3MKF A;  3B0D B;  5BPV A;  1P3K B;  1LSX A;  2Y2O A;  3AN2 C;  5BNX A;  1KX5 B;  4UA6 A;  2PR5 A;  4H9Q B;  3A3D A;  3CJM A;  4DRB A;  3LJA A;  3C1B B;  2GX5 A;  5AV9 D;  2EFX A;  2XDM A;  3W96 D;  5F82 A;  2VA0 A;  1BT5 A;  3MNN A;  1N9N A;  3LIA A;  3V9R A;  4EUZ A;  3T1X A;  5L07 A;  4KQR A;  2XR0 A;  1MXO A;  4MBH A;  2W27 A;  1PYY A;  1P3O D;  5FSR A;  3D4F A;  2Y4A A;  3B6F A;  5BNV B;  5B31 B;  2Y2G A;  3QNB A;  3UTA A;  2V20 A;  2DMW A;  2ZC6 B;  3VV4 A;  2G5H C;  3IWI A;  3VSK A;  4LV2 A;  1NWZ A;  5B1L C;  3VFF A;  2HIO A;  1K6S A;  2GJ3 A;  5HAQ A;  5B1M C;  4GHI A;  2VJW A;  4GB7 A;  2R9X A;  1P3L B;  5L2F A;  3REJ C;  4E3I A;  4J8U D;  4BMW A;  3PHY A;  3F1N B;  2ACG A;  1WWI A;  2ARO C;  1P3O B;  3S7O A;  4GDN A;  5AV6 A;  3AZM B;  4LGW A;  2WYX A;  3BYD A;  3DTM A;  4WM9 A;  5AV8 B;  2XH9 A;  3MFD A;  1EWZ A;  4OVD A;  1E6N A;  3WTP E;  3VH6 W;  3LUQ A;  2NZD A;  4IBF A;  2D01 A;  4Y2F A;  5EVE A;  3M7P A;  3AV1 A;  1P3F A;  1P3L D;  1L2S A;  5DNN A;  2W3H A;  4HGA B;  2EX2 A;  3NOT C;  3UTB D;  4E3K A;  4GHA A;  3IF6 C;  4FH2 A;  1B67 A;  3B0B A;  3KSI A;  1P3F D;  2B18 A;  3CUE A;  3LR4 A;  2O99 A;  4RX2 A;  3MGQ A;  5L10 A;  5AV8 A;  1LI0 A;  3VP4 A;  5F99 D;  3X1T D;  3EPL A;  3ITB A;  4DF6 A;  1MPL A;  1P3I B;  2J9O A;  5FQK A;  3SH7 A;  3ZG0 A;  3L28 A;  1V9Y A;  1WYB A;  3F1N A;  5HAP A;  2NQB D;  4OP8 A;  1W8Q A;  1I2W A;  1L6J A;  3P7N A;  2QPN A;  1LL9 A;  2O0Y A;  4KZ9 A;  3UE0 A;  2X02 A;  1T19 A;  4HY8 A;  5FAP A;  4EXO A;  5AJG A;  5G4Z A;  4F3L A;  4KZ7 A;  2V2F F;  3UTA B;  5AVE A;  1T18 A;  5BNV A;  1KDW A;  3E2L A;  1P3I D;  4WU9 D;  5B0Y B;  2PBD P;  2ZC7 A;  3CHW P;  3PBN A;  1CK3 A;  2VLG A;  5KIZ A;  1N1J B;  3SS4 A;  2HUE C;  4CLC A;  4EBL A;  3EEH A;  2V8C A;  3W98 D;  1XFQ A;  5B32 A;  3CLO A;  3TG9 A;  4BBU A;  2J7V A;  2M7U A;  4O0P A;  5GT3 A;  3MGS D;  2Q0O A;  2XSS A;  2PD7 A;  3VH5 W;  1P3A A;  4WU9 B;  5B0Y D;  1SKO A;  4X6T A;  1OGG A;  2ZMA A;  5J3W A;  1CI9 A;  3W99 D;  2QJ7 A;  4KUO A;  3DTI A;  4CLC D;  5C3I C;  5CX7 A;  3A0R A;  4HME A;  1W1T A;  1PW8 A;  3W96 A;  4E3O A;  4OH0 A;  5B2I C;  5AVF A;  3N4I A;  3T1R A;  1LL8 A;  3C4O A;  1GXD A;  5EVL A;  4PM5 A;  2VKS A;  3OBF A;  4LCM A;  3MGR A;  4ZBE A;  4WF0 A;  4OJ6 A;  4XUJ B;  2LB9 A;  1MWS A;  4EV4 A;  4OP5 A;  3WTP D;  1P3M B;  3WAA D;  4R3J A;  5CPJ A;  3W99 B;  2WAE A;  5AQ7 A;  5AVB C;  4MN7 A;  5DF9 A;  1IOU A;  1XFN A;  5B2J C;  2WGI A;  4UEY A;  4K08 A;  1OJ5 A;  3X1S C;  1P0Z A;  3AZG D;  1W1V A;  1KE3 A;  3LJA C;  2ZL1 A;  3KSF A;  5FAQ A;  5HL6 A;  3HLD A;  5CRF A;  2H0T A;  5A92 A;  3AV1 D;  3SS5 A;  2IWC A;  1GHP A;  2VGL M;  3WKJ A;  3N7W A;  3WA9 C;  1ES3 A;  3WTP B;  3LZ1 A;  1P3M D;  1HTZ A;  1CXW A;  3LZ1 C;  3WTP C;  2OWJ A;  2ZY3 A;  2EWW A;  1TDG A;  3SH8 A;  4QHC A;  1RGY A;  3HLG A;  4H9N B;  1HLU P;  3QP5 A;  3UTB A;  3OC2 A;  5IHV A;  2WGW A;  2VQR A;  2G2W A;  4LLO B;  1H8P A;  2NUP C;  3AZG B;  4QWO A;  1VM1 A;  4G92 B;  2CWE A;  4JXG A;  3LO7 A;  3AV1 B;  5E5A C;  3W98 C;  1OT9 A;  2RCX A;  3ULF A;  3AL0 C;  1H0M A;  4Q8I A;  3B0C T;  3F1P A;  3C1C D;  1HQ3 D;  2HF6 A;  3AZN D;  3ZFZ A;  1Z6F A;  4CAY B;  1YSQ A;  4B4Z A;  3MGR C;  5AV6 B;  3AZM A;  1KX4 D;  3BY9 A;  5KMW A;  2PYR A;  3K3C A;  4HP9 A;  2PT7 A;  4BEN A;  1NRJ A;  4D2O A;  4KZ5 A;  2CMN A;  3KXB C;  3W4Q A;  3W4O A;  3AV2 C;  3EPK A;  3FC7 A;  4LRY C;  4X1L A;  4J8V D;  4DE0 A;  4R8P B;  1F66 A;  1P3G C;  4WN5 A;  4Z2M G;  1F98 A;  1E6Z A;  4S2L A;  1YU2 A;  4IVK A;  1W63 Q;  3MR0 A;  1KGF A;  3H0R C;  4YM6 D;  3C1C B;  4HMD A;  4OUI A;  3PYP A;  3O5Y A;  1UR9 A;  3DTK A;  4XUJ A;  3T1Q B;  4L9F A;  1AOI A;  3UB9 A;  3RXX A;  4UUZ A;  3AZK B;  5B31 A;  4J8X C;  3B6F D;  4CSR B;  1PZR A;  3X1V C;  4R38 A;  2VX8 A;  1W1Y A;  5TFQ A;  5BOH A;  5CHJ A;  4S2N C;  3HLW A;  2ZMV A;  2D02 A;  1MBL A;  3V67 A;  3R7W A;  3BFG A;  3LCE A;  1P3P C;  2ZY5 A;  4LD9 A;  4DJ2 A;  1EI5 A;  1YT4 A;  2QZ6 A;  5B24 B;  5F99 C;  1RP5 A;  3AZJ B;  1G68 A;  1N9B A;  3Q1F A;  3AZK D;  5CPJ C;  1P9R A;  4DMZ A;  5EPH A;  3C4P A;  3UPN A;  1VEU B;  3UNW A;  5IS1 A;  3ITA A;  2E8I A;  4ZAM A;  5J7E A;  3T4T A;  2XF3 A;  1O7E A;  2DRW A;  3MF0 A;  4KEN B;  3EWK A;  1N1J A;  4Z2M H;  1XP4 A;  1GCE A;  3PXP A;  3LEZ A;  4H9P A;  2XK1 A;  4LRX C;  3REH A;  4IBC A;  3ZG9 B;  4OPQ A;  2XQZ A;  4X25 A;  4R6L A;  3QHY A;  1PI4 A;  4P6B A;  1M19 C;  5B24 D;  5B40 A;  1M19 B;  3REK D;  3ZG8 B;  1Q2Q A;  5CEC A;  4LD9 D;  4JJN C;  2PAV P;  3HLC A;  4EU0 A;  4GD6 A;  4J8X B;  2O9B A;  3UTB C;  4NE5 A;  3AFA A;  1P3P A;  2HDS A;  3AYW A;  1L0F A;  4H9R B;  3EEA A;  3X1S B;  5KDM A;  5B33 D;  1W2E A;  5EOO A;  3CI6 A;  1H3O B;  3AZF B;  1XXM A;  1TF1 A;  5CTN A;  4XZQ D;  3A6N C;  1H8Y A;  1PI5 A;  5F69 A;  3ZVT A;  5FQM A;  4J8W B;  3WAA C;  1MWU A;  1NYY A;  4GNU A;  4HH2 A;  3DBA A;  1OME A;  1OTI A;  3KFU G;  4RYE A;  3MGS C;  3N8R A;  4L9E A;  3CPT B;  1S6R A;  1G5U A;  1OT6 A;  3HUN A;  2CC1 A;  2O9C A;  2V9A A;  4J8X D;  2BYM A;  4KZ6 A;  4KGC C;  4R0Q A;  1YU4 A;  1P34 A;  3B6G D;  1W1P A;  3MGP A;  1E4D A;  4YS3 C;  4Z2H A;  4JXW A;  1M6K A;  2ZLY A;  3AV2 D;  2F8N A;  1K54 C;  4WYY A;  3B0C W;  1BFM A;  1ZG4 A;  4XZQ B;  1L3L A;  5FUG B;  1OTA A;  2BG1 A;  3L25 A;  1Y54 A;  4J8W D;  5CER A;  1BLC A;  5L8M A;  4WZ5 C;  1BZA A;  3KS4 A;  1TZY A;  4QB8 A;  4Z66 D;  1TZY C;  4KQD A;  5FDH A;  2WKP A;  3BW6 A;  5B1L A;  2OSU A;  5F1F A;  2V1A A;  1H5X A;  3Q81 A;  1CJF A;  4I3A A;  2V1Z A;  1PZO A;  5CP6 B;  3X1V A;  3REI D;  5AQA A;  3V50 A;  3WS2 A;  3B6G A;  1XGI A;  5E2F A;  2NQB C;  3AZF C;  4GZB A;  5F1G A;  4PM6 A;  3CWF A;  2PYO B;  1E25 A;  1KVL A;  3C1C C;  2P04 A;  3TW8 A;  2BYK B;  1W8Y A;  2WKR A;  2ZQ9 A;  4FOF A;  1M1A D;  2GNX A;  4EER A;  5B2J B;  4J8W A;  1JNU A;  3C7U A;  5CP6 D;  1YLT A;  1B6W A;  2HUE B;  3FPW A;  3TU4 A;  4O01 A;  2HP5 A;  3IH9 A;  3V9R B;  5KDM B;  1T1B A;  3X1S A;  2FJ7 D;  3LY3 A;  4PKY G;  2J8P A;  1OTE A;  3AZL A;  2E8J A;  2F8N K;  3BFC A;  3UT9 B;  3TE8 A;  4B4X A;  2FH5 A;  5DFX A;  5JRG B;  2EFU A;  2H10 A;  1ALQ A;  3WA9 D;  2EXA A;  3IXB A;  1ID3 A;  1TS8 A;  1BLS A;  4N92 A;  5B32 D;  2VGL S;  4RA7 A;  3LYX A;  1P3G A;  5TJJ A;  1Z2C B;  1KX3 B;  1KGE A;  1TDL A;  1ERO A;  3N8L A;  4HJ3 A;  1SDN A;  4O7D A;  4K91 A;  1KS0 A;  1Q9C A;  4HP4 A;  1H0I A;  4Z2J A;  4BD0 A;  1GOI A;  3HSH A;  5B2I A;  3UDI A;  3MMH A;  1P3G B;  4H9S C;  5JYP A;  3UT9 D;  1VEU A;  5GSU C;  1YKD A;  3WA9 B;  2K2N A;  2XA7 M;  2B02 A;  1KE0 A;  2ZM8 A;  5GT0 B;  4Z5T C;  3MJQ A;  3V5M A;  3ZQ5 A;  1DP8 A;  4IBK A;  5FDS A;  3MGS A;  4ZBJ B;  1XA1 A;  3CZD A;  5CPI C;  3KWQ D;  5CGS A;  5B0Y C;  1HVB A;  4OQG A;  1ZLA C;  3LI9 A;  4BWI A;  4X1M A;  1K54 A;  4Y7P A;  2YFW B;  3REJ B;  1I5Q A;  1QO6 A;  1M40 A;  1W63 M;  4OON A;  3V39 A;  4CLC C;  5MC7 A;  4J8W C;  1G6A A;  2HP6 A;  1P3G D;  3JVV A;  2J3T C;  4CSR A;  1KOU A;  2JN7 A;  1K57 A;  4X56 A;  3IHB A;  5C5K A;  5GSU D;  3AZJ C;  1AOI B;  4RX3 A;  1TAF B;  2RL3 A;  5GT0 D;  2YFV A;  2X71 A;  2VZW A;  4NY2 A;  2PYO A;  3VOZ A;  5AV5 A;  3FYZ A;  4YNR A;  3W96 C;  2XRN A;  3RH8 B;  4H9S A;  4ZBJ C;  5TR7 A;  4MB3 A;  3RJU A;  5HSQ A;  4PM8 A;  3AZH A;  3E4Q A;  3MGP D;  1KX4 A;  5AQ9 A;  2JKF A;  1GSV A;  4ARZ B;  2NQB A;  1PZP A;  4WNN B;  2Z2M B;  3AZM C;  5B33 C;  5B1L B;  3AYW C;  3IBR A;  1H0G A;  2JKT I;  4NEE D;  3ZHH A;  4OQ0 A;  2HZ5 A;  4DE3 A;  5FQ9 A;  4NXE A;  4Z66 A;  5HWT A;  2RVQ D;  4KZ8 A;  1S32 D;  2VGJ A;  3PBQ A;  5CGX A;  4R8P C;  3REK C;  2Y8H A;  3NQU A;  3T4Q A;  2P08 A;  2KOI A;  3W4P A;  3MNN C;  3AZH B;  3MGP B;  1FSW A;  5GXQ A;  5M19 A;  2WZZ A;  1VHM A;  1EQZ A;  4N9K A;  5FI6 A;  1E8B A;  2I9V A;  1YM1 A;  4NE6 A;  5BT1 C;  4UQI M;  5GLD A;  1HTA A;  2LY8 A;  3V3S A;  4OOL A;  3GVB A;  2ZQ7 A;  3WTP A;  4KUD D;  5AV5 B;  5AVC B;  1QME A;  5FAT A;  4HBU A;  3GEC A;  4BBT A;  1TAF A;  4GH9 A;  3E0Y A;  1S32 B;  1ZG6 A;  2A24 B;  4KQO A;  1LSV A;  1BYW A;  2ZL1 B;  4P87 A;  3T12 B;  4JPM A;  3JVU A;  3S22 A;  3KUY A;  4PAU A;  4ZJ2 A;  1TS6 A;  3G34 A;  2YFW A;  3REJ A;  4E6X A;  3AFA D;  4D60 A;  1YU0 A;  2VV8 A;  2PBY A;  3FWL A;  4WLA A;  5EFW A;  4Z66 C;  4OJ5 A;  4H6J B;  3E4P A;  3HUO A;  5B32 G;  2VEA A;  3MVD A;  4JBF A;  3RTY A;  1GSW A;  1MZU A;  4JKT A;  5CEB A;  2XD5 A;  3DW0 A;  5AVC D;  3LY4 A;  5B40 D;  3IX8 A;  5L09 A;  4Y3I A;  5LBR A;  3EOI A;  1HD8 A;  4LCL A;  3IXG A;  1ES4 A;  4DDS A;  3OPH A;  1U35 B;  2Q9N A;  3LR5 A;  5AY8 D;  5B2I D;  2W1T A;  2XGN A;  3C2W A;  3IQA A;  3IF5 A;  4Q0I A;  4DDY A;  3OLO A;  4HQA A;  2X01 A;  2INW A;  4OOY A;  2WZX A;  3SS3 A;  5E5A B;  2L0W A;  2UV0 E;  2K31 A;  3TU4 D;  3AZJ A;  3BRM A;  1WYC A;  1D1J A;  1KX3 A;  1PWD A;  1NLZ A;  1ZHH B;  4Z9Q A;  5HDS A;  3ZG5 A;  4XZQ C;  5FA7 A;  1ONH A;  5GHX A;  1P3K D;  3NOP C;  3L7H A;  3IF6 A;  1IYP A;  2ZQA A;  2Z6C A;  3A6N A;  5M18 A;  3B47 A;  4G3V A;  1XJ3 A;  1RCJ A;  3C1B D;  3LZ0 A;  3LEL B;  5FL3 A;  3AFA C;  4FD8 A;  3CG5 A;  3O88 A;  4S2N A;  4LD9 C;  1K55 A;  3S7Q A;  1S67 L;  1SKF A;  2PU2 A;  2XFT A;  3LIF A;  1S4R A;  5DF8 A;  4XT2 A;  4G91 B;  2ZJ9 A;  2JKT M;  3GRJ A;  3E98 A;  4Y0T A;  3TU4 B;  3WS1 A;  1GSX A;  4DN0 A;  1CEG A;  3O87 A;  4WEL A;  4WU8 B;  3BFF A;  4KQQ A;  3LEQ A;  4R1G A;  3M6B A;  3MXR A;  1PWC A;  4FCF A;  2BYK A;  4KZB A;  5HPF A;  1OTD A;  2MJ6 A;  4JJN B;  5M1A A;  5HX9 A;  1E88 A;  4M6B A;  3OPL A;  4JGO A;  2XRO A;  2WKQ A;  4X69 A;  1K57 C;  5A90 A;  1K6R A;  4WBG A;  2H5S A;  3GV9 A;  5DNM D;  3W2Z A;  5G49 B;  2B95 A;  5GXQ C;  4J8U B;  1IYO A;  3NQU B;  3REI A;  3H7W A;  5DNN D;  5BT1 D;  5BO0 B;  5DJT A;  2JBF A;  5CP6 A;  5DJU A;  4WU8 D;  3C38 A;  3IS2 A;  3AZM D;  5FQI A;  5E2H A;  1ID3 C;  3EQV A;  3UTA C;  5AV8 D;  3NOU C;  1FR1 A;  1FCN A;  2P9V A;  3M6H A;  2HIO C;  2WUQ A;  4AWL C;  4WNN A;  1P3B B;  1XGJ A;  2IWD A;  4ARZ A;  1S32 C;  5FUG A;  3KS8 A;  3NI9 A;  5DNM B;  4XZQ A;  4MBK A;  4EEU A;  4O8G A;  3D9Y A;  4DE1 A;  2A3U A;  4PM7 A;  4MCW A;  2F8N B;  1GHI A;  4OQH A;  4Y15 A;  2J3W A;  1WWS A;  5DNN B;  1I2S A;  5GLA A;  2QMI A;  3U4L P;  3AYW D;  2H0Y A;  1J9M A;  3A3E A;  4HES A;  3BEC A;  2W8S A;  3B3X A;  1K25 A;  1CI8 A;  2ZQC A;  4H8R A;  3TSG A;  1BUE A;  3PBT A;  4Y17 A;  4Z5T B;  4KG6 A;  3MXS A;  4IUK A;  3X1T B;  4WZS B;  5DTS A;  5G18 A;  1IEL A;  4EW7 A;  1U60 A;  4P0M A;  4WJ3 C;  2P7J A;  1PW1 A;  5CPI D;  2G7U A;  3LZ0 D;  3VP2 A;  1P3L A;  5HWW A;  4KHA B;  3AYW B;  3NJA A;  5AY8 C;  2ARO D;  1MY8 A;  1C3B A;  4ZUX B;  3F1O B;  2J8Y A;  3IBJ A;  2Q9M A;  4QD4 A;  4GHI B;  4LRZ E;  1YLZ A;  4X23 D;  3M2K A;  4GW9 A;  4MEZ A;  2HIO B;  3H82 B;  5GT3 D;  4H9O A;  3P09 A;  4FH4 A;  1M19 A;  4KZA A;  5AVC C;  2C5W B;  1YLP A;  4DQY B;  4MNR A;  3MGR B;  4Z2K A;  3C1B C;  2GDN A;  4DRA A;  1K0K A;  2VGK A;  4BJP A;  3G6O A;  3KYZ A;  3S7N A;  4QLC B;  3KWQ C;  3REH B;  4HJ4 A;  1PRQ A;  5CPI B;  3JYI A;  1T1A A;  3A3F A;  1JWP A;  1SCW A;  3MNN B;  3AZH C;  4Z2G A;  3LID A;  4ZUX D;  3H0M C;  1TVF A;  3G4P A;  4R3B A;  3KO6 A;  1ERQ A;  1P97 A;  1P3A B;  4X23 B;  3UB7 A;  3AV1 C;  3W98 B;  3W97 D;  4GKU A;  2HIO D;  1O6I A;  5GT3 B;  5GLC A;  4OPZ A;  5B24 A;  2G5I C;  3MGR D;  4OJP A;  4NYY A;  3E2K A;  3G2Y A;  3K3D A;  2HP9 A;  2QYB A;  3MS6 A;  3W98 A;  1UR8 A;  3HCY A;  4QLC D;  4XUZ A;  3AZL B;  1XA7 A;  3REH D;  3R7W B;  3AN2 D;  3LGO A;  2PU4 A;  1OPX A;  3UPP A;  3FPV A;  1SHV A;  3ZG7 B;  4P6Z S;  2ZBB A;  3MNN D;  2OWH A;  5CPK A;  5CPK C;  2OOL A;  5A91 A;  3WRZ A;  4MB4 A;  4QLC A;  1PFL A;  4HOI A;  3ICY A;  4HNB A;  5KZH A;  4UUZ B;  3AZK A;  1M1A A;  4F3L B;  4XUJ D;  4ETZ A;  1VB6 A;  2ZMF A;  3H82 A;  4YM6 A;  5CGW A;  4U0X A;  3AZL D;  1M18 B;  3UN7 A;  5HZH A;  1ESI A;  1ODV A;  1BLH A;  2DF4 C;  5B1M B;  2EX6 A;  1JWV A;  1KX3 C;  1NLY A;  4PMA A;  4KHA A;  2CV5 A;  1E6R A;  5HFO A;  4HHD A;  1R4V A;  5E2E A;  3LEL C;  1FCM A;  2JKR I;  1ZLA B;  4JGR A;  3SH9 A;  4MN6 A;  4E3J A;  3MQO A;  3R4K A;  5BS7 A;  4OPR A;  1ONG A;  1FR6 A;  3EPH A;  1FIL A;  2ZM0 A;  3X1T A;  3ZDJ A;  4CAY A;  2WGV A;  4OLG A;  3VP0 A;  3L26 A;  4QPR A;  3DWZ A;  2R78 A;  2V0U A;  4KUD A;  1NZU A;  4QY6 A;  4YFM A;  1M18 D;  5HPI A;  2QKP A;  2XLN A;  4E3L A;  5B1M D;  3BFE A;  3UY6 A;  1XJ4 A;  5FI2 A;  5I94 A;  2PD8 A;  4IBD A;  2XEP A;  5FEG A;  2B5R A;  2Z2L B;  1CQA A;  3E4O A;  4YM6 C;  1LT0 A;  4PPR A;  3HRE A;  2BYM B;  4IJF A;  3TU4 C;  1P3B A;  3BJN A;  5GT0 C;  2OAP 1;  1SZV A;  3NDE A;  4EO5 B;  2J80 A;  3VMA A;  1FIK A;  3SZT A;  1HQ3 B;  4IBX A;  3W8K A;  5HD5 A;  3LZ0 C;  2JC7 A;  4PHT A;  3UME A;  3GTC A;  1TEM A;  4A5R A;  3X1U A;  3AZN C;  2VK3 A;  4OLD A;  4J8U A;  4HBT A;  5G49 A;  3UDX A;  5KSC A;  3G31 A;  4CLC E;  2L5A A;  1KGG A;  2HJE A;  4X23 C;  3O62 C;  4J8V B;  1M18 A;  1GPF A;  1CF0 A;  4GLQ A;  4NG2 A;  2M7V A;  2EXB A;  1N9O A;  1NXY A;  4HI4 A;  4Z2I A;  4MBF A;  4N1X A;  4QJG A;  5CPJ B;  2F8N H;  2DQN C;  3REK A;  3WD3 A;  1D06 A;  2D49 A;  4B9O A;  2Y59 A;  1XJ6 A;  3MBZ A;  3BM6 A;  2Y2M A;  1UGU A;  1AXB A;  1YLY A;  4DXC A;  3CIT A;  4UQI S;  5CPK B;  1YU1 A;  3HON A;  3REL B;  2NUT C;  1L0D A;  5E2G A;  4EBP A;  1K56 A;  1MKI A;  1DJC A;  3BFD A;  4DXB A;  3GDI A;  1DJA A;  5CHM A;  3Q7Z A;  2FJ7 C;  4WL9 A;  3G32 A;  2NZD C;  3C1B A;  3A0S A;  4LPZ A;  4JXV A;  4IJE A;  2PDR A;  2JE5 A;  2HPB A;  1NY0 A;  5B32 C;  3KWQ A;  4EWF A;  1A0K A;  5AV9 A;  3AZE C;  3IXH A;  3BQA A;  1SKO B;  5CHU A;  2PYO C;  1M1A C;  4GS9 B;  4WU8 C;  1YQS A;  3IH8 A;  4LV3 A;  3C30 A;  5EE8 A;  3NY4 A;  3R45 A;  3MKE A;  3FDD A;  4N1H A;  5AV9 B;  3WD1 A;  4IBI A;  5HW3 A;  5GHY A;  1J7M A;  5E5A A;  5CPK D;  1GHM A;  4K0X A;  3REL D;  4M3K A;  3OCN A;  2C6W B;  1MWT A;  2CV5 C;  4MDZ A;  2I72 A;  3HLB A;  3T4S A;  2BTF P;  4IBR A;  1JWZ A;  1F2K A;  3L27 A;  1F9I A;  3AGF A;  4JF6 A;  3X1U C;  5B0Y A;  3WS4 A;  1T3U A;  3C1C A;  2HDQ A;  4L0L A;  3GMW A;  4X53 A;  1BLP A;  1GA9 A;  4NXB A;  3REK B;  3MZD A;  1LHY A;  3W99 C;  1S0W A;  3EGX C;  4R8P A;  4ME4 A;  2QJ5 A;  1T1C A;  3DTE A;  5B33 B;  4I39 A;  3AZE B;  3AZF D;  1S32 A;  2J3T D;  2IA2 A;  3EGD C;  3VH5 T;  2ZOH A;  5AVC A;  3F1P B;  2Y2P A;  4P6Z M;  2OLV A;  3IHA A;  3MSH A;  1Z09 A;  3FKW A;  3REI C;  2FFF B;  4EEP A;  1BTL A;  1DP9 A;  2WKH A;  1YSP A;  3KYQ A;  4KGC D;  5EEC A;  3AZG A;  4WMC A;  4DJ3 A;  1L0E A;  3EQU A;  5DNM A;  3LI8 A;  1YLJ A;  3UTB B;  4OJO A;  4WEJ A;  3B0D C;  3AZE D;  2OAQ 1;  2WK0 A;  1X0O A;  4P85 A;  2H28 A;  1P3F B;  4KZ4 A;  5DTK A;  4G3W A;  4HIA A;  2Y2J A;  3GSG A;  4B93 A;  5B24 C;  5F99 B;  2YKF A;  2G2U A;  3NEC A;  4KGC B;  1ZTU A;  5AV6 C;  3G35 A;  3WWX A;  5CTM A;  1Y4O A;  2NQB B;  3WX7 A;  1IYQ A;  2BAS A;  4FSF A;  3S1Y A;  1ZLA A;  4NK3 A;  3AV2 A;  2XD1 A;  3PBR A;  3Q82 A;  3UE1 A;  1XJ2 A;  4FUW A;  3A6N D;  1H8M A;  4Q0H A;  4JJN A;  5B1M A;  3K2N A;  3UTA D;  4K0W A;  2PYO D;  2JKG A;  4U0T A;  4WU8 A;  1STZ A;  1PDC A;  1S66 L;  2AVX A;  1M1A B;  3FKV A;  3BEB A;  3UB8 A;  5B2J D;  1E6P A;  1AOI C;  3EPJ A;  2EWV A;  5HL1 A;  3BY8 A;  3Q07 A;  4I3J A;  3S7P A;  3MZF A;  2ZQD A;  1E3U A;  1PWG A;  5EV0 A;  4EES A;  2FJ7 B;  3AN2 A;  5JRG C;  3A6N B;  3IWQ A;  1JVJ A;  1L0G A;  4OJL A;  3V3R A;  3C5A A;  3IF6 B;  4LV0 A;  2W3D A;  5A8B A;  4QNL A;  1W7F A;  3N6I A;  4GS9 A;  1ES2 A;  3MGS B;  2EX9 A;  5BNX B;  5EOE A;  3HLE A;  1P3K A;  3U2A A;  4NYU A;  2PR6 A;  5B32 B;  4LG2 A;  1ULY A;  5CED A;  4U3T A;  2RVQ C;  3OOV A;  1WA9 A;  5EVI A;  2OLU A;  1YUE A;  3DAV A;  4CLC B;  1AIW A;  2WAF A;  4RQ9 A;  2ZY2 A;  4J8V C;  4WU9 C;  2OV5 A;  3KUY D;  5I5L A;  2Y2H A;  5B31 G;  5HDD A;  3G30 A;  5AY8 A;  4IBB A;  2FN2 A;  3QP4 A;  5EM1 A;  1NRF A;  5CPI A;  5F68 A;  4BLM A;  1PIO A;  3MGP C;  4S2P A;  4S2K A;  3KSY A;  4BL2 A;  1S1Z A;  2IOU A;  3ZYT A;  2WKE A;  5TBM A;  3MGQ D;  3D72 A;  3NQJ A;  3WAA B;  3HVF A;  2W0N A;  4H9O B;  4OKP A;  2F2A C;  2ARO A;  4H6J A;  5GL9 A;  3UT9 A;  2ZC3 B;  2Z6D A;  2Y2I A;  3IT9 A;  3LIB A;  5HD3 A;  3F1O A;  4ZUX A;  3I7J A;  4NZ3 A;  4IJG A;  3KUY B;  2ZY4 A;  4NFT A;  4WZ4 A;  5J4E A;  2L1M A;  1F5M A;  1DJB A;  1OGB A;  4JXS A;  1WE4 A;  3NC8 A;  1UWN X;  3VOL A;  1HQ3 A;  2HDR A;  5TGF A;  3VP1 A;  4IBG A;  5B2J A;  2VV7 A;  1AOI D;  4DRT A;  3MGQ B;  3AGE A;  1H8Z A;  4Z5T A;  1YU3 A;  3VH5 A;  3UB5 P;  2HDU A;  1KX4 C;  3LIE A;  3A3I A;  5BS7 C;  3MVD C;  1S4S A;  5D3O A;  3PBS A;  3BLM A;  1ED7 A;  4UAA A;  4AFI A; 
#chains in the Genus database with same CATH homology
 4C75 A;  4NET A;  3NCK A;  4YS3 A;  1NYM A;  1KVM A;  3C7V A;  5JA4 A;  2CV5 D;  3N3F A;  5AVB B;  1P3L C;  3Q7V B;  5DTT A;  5B0Z A;  4S2O A;  4UA7 A;  5HAR A;  1ERM A;  1P3F C;  1P3M C;  4ZUX C;  1ZKJ A;  3VSL A;  5KSH A;  4XUJ C;  3UPO A;  2P9V B;  3AZN B;  1O07 A;  3BLS A;  1QMF A;  5CHL B;  1IYS A;  5AV6 D;  3OPP A;  1P3O A;  1KX4 B;  3AGD A;  2UWX A;  4IBE A;  1Q2P A;  2CV5 B;  5JA4 B;  5AVB D;  4R8P D;  3AZH D;  4S2I A;  4E6W A;  3HUM A;  2ZM2 A;  4S2J A;  3LJA D;  4YM6 B;  3AZG C;  3GQZ A;  3PBO A;  3AZI A;  3IP4 C;  4KG2 A;  4R4R A;  4UA9 A;  3B6F B;  4X68 A;  3ISG A;  1BH8 A;  5GSU A;  3G2Z A;  3O3V A;  4LEN A;  3UO9 A;  3S4X A;  4CJN A;  4H9R A;  3AFA B;  3ZGA B;  2XFS A;  3LJA B;  5EUA A;  5EVI D;  3VP3 A;  1KX5 A;  2DCF A;  1JFI B;  4R4S A;  4WV4 B;  3MGQ C;  3WA9 A;  5GT3 C;  3AZJ D;  1FOF A;  1K38 A;  4X23 A;  5B0Z C;  3P5J B;  1XX2 A;  1U35 D;  5AY8 B;  3KUY C;  3VH6 A;  4HGA C;  3ZNY A;  5B31 C;  5EVI B;  5E5A D;  1VQQ A;  3X1T C;  1JFI A;  1M19 D;  1F1E A;  5FQJ A;  3B6G C;  4E3M A;  4LD9 B;  4NZ4 A;  4X55 A;  4ZJ1 A;  1F66 C;  1EQZ C;  3A1I A;  2Y55 A;  3MVD B;  4RVA A;  3LEL D;  1F66 D;  1FQG A;  3X1S D;  2FJ7 A;  1NJ4 A;  3HBR A;  1YMS A;  5GXQ D;  4C3Q A;  4E45 A;  5C3I B;  2ZD8 A;  1K56 D;  2Y2N A;  1GA0 A;  4GD8 A;  3AZK C;  4WZ5 A;  5AV5 C;  5AV8 C;  4GDB A;  3H0L C;  3TOI A;  3F6T A;  4JJN D;  1IKI A;  3MVD D;  3B6G B;  4WEK A;  3SOI A;  1YLW A;  3L2A A;  4R23 A;  1NZO A;  1F66 B;  2ZQ8 A;  1K55 C;  3AV2 B;  1IEM A;  5GXQ B;  4J8U C;  4BD1 A;  3X1V B;  3W97 C;  3O62 A;  5J8X A;  1P34 C;  3AZN A;  5EVI C;  4ID4 A;  4Z66 B;  4KG5 A;  1TZY B;  2Y2K A;  5F99 A;  3NDG A;  1P3K C;  4DE2 A;  5B0Z B;  4OPY A;  5BO0 A;  3PTE A;  1P3B D;  3REI B;  5AVB A;  2J9P A;  1DY6 A;  3N8S A;  3GR2 A;  4S2M A;  4DKI A;  3X1V D;  4QU3 A;  3KXB A;  2F8N D;  1P3P D;  2P74 A;  4HEF A;  3FKE A;  1ZC2 A;  3MZE A;  1JTG A;  1TZY D;  1XPB A;  1ES5 A;  3FZC A;  5B40 C;  1KU5 A;  4Z5T D;  3WKJ B;  2YFV B;  4B88 A;  5B0Z D;  5HAI A;  4Y0O A;  5FAO A;  3B6F C;  3AZF A;  1LLB A;  3AZE A;  5B33 A;  1N4O A;  4EBN A;  1P3P B;  3EG5 B;  3LZ0 B;  3LEL A;  1W5D A;  2ARO B;  1P3O C;  1LI9 A;  1SDE A;  4EO5 C;  3WAA A;  5JRG D;  3NQJ B;  2RIQ A;  4MLL A;  1BH9 B;  3WKJ D;  3W97 A;  1KX3 D;  1ID3 D;  4JLF A;  3ZCZ A;  3QNC A;  4QLC C;  3IXD A;  2ZC4 B;  1BSG A;  3HL9 A;  2IO5 B;  3OCL A;  1U35 A;  1BUL A;  4UPK A;  2JSS A;  3A3J A;  1P3A D;  4WU9 A;  3W97 B;  1ESU A;  1BH9 A;  4GOG A;  2FFY A;  4E3N A;  3WRT A;  4C6Y A;  4ZJ3 A;  4CPK A;  1ID3 B;  5GLB A;  5JRG A;  3KWQ B;  3REH C;  2Y91 A;  3WS5 A;  1EQZ D;  3AN2 B;  1KX5 C;  5FQQ A;  1KE4 A;  1K4E A;  3REJ D;  4Y0U A;  1K4F A;  2WKI A;  4F94 A;  3PAE A;  1MWR A;  4E44 A;  3REL A;  4JF4 A;  5JYO A;  4GHL A;  4G92 C;  5GSU B;  1JTD A;  4XXR A;  5FI7 A;  1BH8 B;  5E43 A;  3AZI C;  1IKG A;  3AZI B;  1U35 C;  5DF7 A;  4BQM A;  5U47 A;  1EQZ B;  3HLF A;  5GHZ A;  3OZH A;  4NE3 A;  4J8V A;  3O62 D;  3KXB B;  2EX8 A;  5CXW A;  4IED A;  4N9L A;  3FV7 A;  3X1U B;  4OQI A;  4YS3 D;  3A1K A;  1ZLA D;  4KGC A;  3UT9 C;  4OOM A;  4YIN A;  2BLS A;  1P34 D;  5B1L D;  1P3I A;  1XKZ A;  4ZTK A;  1P3I C;  2A49 A;  4EQI A;  5FAS A;  4UHU A;  3AZI D;  2DNS A;  3O86 A;  1CEF A;  5AV9 C;  2ZC5 B;  1P3B C;  3M2J A;  3NBL A;  3O62 B;  3KXB D;  4G91 C;  3VFH A;  3Q7V A;  2WGW B;  3RXW A;  4H9N A;  3NIA A;  4NZ1 A;  4NZ5 A;  4WMC D;  3X1U D;  4YS3 B;  2F8N G;  1P34 B;  1A7W A;  1HQ3 C;  1W79 A;  3LZ1 B;  2NZD B;  1FSY A;  4LV1 A;  4KUD B;  5AV5 D;  4KUD C;  2Y2L A;  3REL C;  4PM9 A;  3VH6 T;  3AZL C;  1M18 C;  2R9W A;  4KZ3 A;  5CP6 C;  1LL5 A;  5AQB A;  2IO5 C;  2WAD A;  1YMX A;  1H3O A;  3UDF A;  5DNN C;  2ZM5 A;  4JF5 A;  3UE3 A;  3ZVW A;  1P3A C;  3W99 A;  3L29 A;  5DVA A;  3OPR A;  1KDS A;  4IVI A;  4XUX A;  4J8X A;  3LZ1 D;  1P3M A;  4QY5 A;  2NZD D;  3PAG A;  4AWL B;  5CPJ D;  3CMZ A;  3VOY A;  5GT0 A;  3ZNT A;  3DWK A;  5B40 B;  3WKJ C;  1KX5 D;  5A93 A;  1HZO A;  4ZDX A;  2JCH A;  3P98 A;  4GN2 A;  5B2I B;  5F83 A;  3W96 B;  4H9P B;  4IBJ A;  5DNM C;  2IWB A;  2Y2Q A;  1RGZ A;  1E3U D;  4BL3 A;  3R45 B;  3WS0 A;  1FCO A;  3IWO A;  4H9Q A;  5B31 D;  3MKF A;  3B0D B;  5BPV A;  1P3K B;  2Y2O A;  3AN2 C;  5BNX A;  1KX5 B;  4UA6 A;  4H9Q B;  3A3D A;  3CJM A;  4DRB A;  3LJA A;  3C1B B;  2EFX A;  5AV9 D;  2XDM A;  3W96 D;  5F82 A;  1BT5 A;  3MNN A;  3V9R A;  4EUZ A;  4KQR A;  2XR0 A;  1MXO A;  4MBH A;  1PYY A;  1P3O D;  5FSR A;  3D4F A;  2Y4A A;  3B6F A;  5BNV B;  5B31 B;  2Y2G A;  3QNB A;  3UTA A;  2V20 A;  2ZC6 B;  2G5H C;  3IWI A;  3VSK A;  4LV2 A;  5B1L C;  3VFF A;  2HIO A;  1K6S A;  5HAQ A;  5B1M C;  4GB7 A;  2R9X A;  1P3L B;  5L2F A;  3REJ C;  4E3I A;  4J8U D;  1WWI A;  2ARO C;  1P3O B;  4GDN A;  5AV6 A;  3AZM B;  2WYX A;  3BYD A;  3DTM A;  4WM9 A;  5AV8 B;  2XH9 A;  3MFD A;  1EWZ A;  4OVD A;  3WTP E;  3VH6 W;  2NZD A;  4IBF A;  3AV1 A;  1P3F A;  1P3L D;  1L2S A;  5DNN A;  4HGA B;  2EX2 A;  3UTB D;  4E3K A;  4GHA A;  3IF6 C;  4FH2 A;  1B67 A;  3B0B A;  1P3F D;  4RX2 A;  3MGQ A;  5AV8 A;  1LI0 A;  3VP4 A;  5F99 D;  3X1T D;  3EPL A;  3ITB A;  4DF6 A;  1MPL A;  1P3I B;  2J9O A;  5FQK A;  3SH7 A;  3ZG0 A;  3L28 A;  1WYB A;  5HAP A;  2NQB D;  4OP8 A;  1W8Q A;  1I2W A;  2QPN A;  1LL9 A;  4KZ9 A;  3UE0 A;  2X02 A;  5FAP A;  4KZ7 A;  2V2F F;  3UTA B;  5BNV A;  1KDW A;  3E2L A;  1P3I D;  4WU9 D;  5B0Y B;  2ZC7 A;  3PBN A;  1CK3 A;  1N1J B;  3SS4 A;  2HUE C;  4EBL A;  3W98 D;  5B32 A;  3TG9 A;  2J7V A;  5GT3 A;  3MGS D;  3VH5 W;  1P3A A;  4WU9 B;  5B0Y D;  4X6T A;  2ZMA A;  1CI9 A;  3W99 D;  5C3I C;  1PW8 A;  3W96 A;  4E3O A;  4OH0 A;  5B2I C;  3N4I A;  3C4O A;  5EVL A;  4PM5 A;  4LCM A;  3MGR A;  4ZBE A;  4OJ6 A;  4XUJ B;  1MWS A;  4EV4 A;  4OP5 A;  3WTP D;  1P3M B;  3WAA D;  4R3J A;  5CPJ A;  3W99 B;  2WAE A;  5AQ7 A;  5AVB C;  5DF9 A;  5B2J C;  2WGI A;  3X1S C;  3AZG D;  1KE3 A;  3LJA C;  5FAQ A;  3HLD A;  5CRF A;  2H0T A;  5A92 A;  3AV1 D;  3SS5 A;  2IWC A;  1GHP A;  3WKJ A;  3N7W A;  3WA9 C;  1ES3 A;  3WTP B;  3LZ1 A;  1P3M D;  1HTZ A;  3LZ1 C;  3WTP C;  2ZY3 A;  1TDG A;  3SH8 A;  4QHC A;  1RGY A;  3HLG A;  4H9N B;  3UTB A;  3OC2 A;  5IHV A;  2WGW A;  2VQR A;  2G2W A;  3AZG B;  1VM1 A;  4G92 B;  2CWE A;  4JXG A;  3LO7 A;  3AV1 B;  5E5A C;  3W98 C;  2RCX A;  3AL0 C;  4Q8I A;  3B0C T;  3C1C D;  1HQ3 D;  3AZN D;  3ZFZ A;  1Z6F A;  4CAY B;  4B4Z A;  3MGR C;  5AV6 B;  3AZM A;  1KX4 D;  5KMW A;  4BEN A;  4D2O A;  4KZ5 A;  3KXB C;  3W4Q A;  3W4O A;  3AV2 C;  3EPK A;  4DE0 A;  4J8V D;  4R8P B;  1F66 A;  1P3G C;  4Z2M G;  4S2L A;  1YU2 A;  4IVK A;  1KGF A;  3H0R C;  4YM6 D;  3C1C B;  4OUI A;  4XUJ A;  1AOI A;  3RXX A;  4UUZ A;  3AZK B;  5B31 A;  4J8X C;  3B6F D;  4CSR B;  1PZR A;  3X1V C;  5TFQ A;  5BOH A;  5CHJ A;  4S2N C;  3HLW A;  1MBL A;  3BFG A;  3LCE A;  1P3P C;  2ZY5 A;  4LD9 A;  1EI5 A;  1YT4 A;  2QZ6 A;  5B24 B;  5F99 C;  1RP5 A;  3AZJ B;  1G68 A;  1N9B A;  3Q1F A;  3AZK D;  5CPJ C;  5EPH A;  3C4P A;  3UPN A;  3UNW A;  3ITA A;  2E8I A;  4ZAM A;  2XF3 A;  1O7E A;  2DRW A;  4KEN B;  1N1J A;  4Z2M H;  1XP4 A;  1GCE A;  3LEZ A;  4H9P A;  2XK1 A;  3REH A;  4IBC A;  3ZG9 B;  4OPQ A;  2XQZ A;  3QHY A;  1PI4 A;  4P6B A;  1M19 C;  5B24 D;  5B40 A;  1M19 B;  3REK D;  3ZG8 B;  1Q2Q A;  5CEC A;  4LD9 D;  4JJN C;  3HLC A;  4GD6 A;  4J8X B;  3UTB C;  4NE5 A;  3AFA A;  1P3P A;  2HDS A;  3AYW A;  1L0F A;  4H9R B;  3X1S B;  5KDM A;  5B33 D;  1W2E A;  5EOO A;  1H3O B;  3AZF B;  1XXM A;  5CTN A;  4XZQ D;  3A6N C;  1H8Y A;  1PI5 A;  3ZVT A;  5FQM A;  4J8W B;  3WAA C;  4GNU A;  1MWU A;  1NYY A;  1OME A;  3KFU G;  4RYE A;  3MGS C;  3N8R A;  1S6R A;  3HUN A;  2CC1 A;  4J8X D;  4KZ6 A;  2BYM A;  4KGC C;  4R0Q A;  1YU4 A;  1P34 A;  3B6G D;  3MGP A;  1E4D A;  4YS3 C;  4JXW A;  1M6K A;  2ZLY A;  3AV2 D;  2F8N A;  1K54 C;  4WYY A;  3B0C W;  1BFM A;  1ZG4 A;  4XZQ B;  5FUG B;  2BG1 A;  3L25 A;  1Y54 A;  4J8W D;  5CER A;  1BLC A;  4WZ5 C;  1BZA A;  3KS4 A;  1TZY A;  4QB8 A;  4Z66 D;  1TZY C;  5FDH A;  5B1L A;  2OSU A;  5F1F A;  1H5X A;  3Q81 A;  2V1Z A;  1PZO A;  5CP6 B;  3X1V A;  3REI D;  5AQA A;  3V50 A;  3WS2 A;  3B6G A;  1XGI A;  5E2F A;  2NQB C;  3AZF C;  4GZB A;  5F1G A;  4PM6 A;  2PYO B;  1E25 A;  1KVL A;  3C1C C;  2BYK B;  1W8Y A;  2ZQ9 A;  1M1A D;  5B2J B;  4J8W A;  3C7U A;  5CP6 D;  1YLT A;  1B6W A;  2HUE B;  3TU4 A;  2HP5 A;  3IH9 A;  3V9R B;  5KDM B;  3X1S A;  2FJ7 D;  3LY3 A;  2J8P A;  3AZL A;  2F8N K;  3BFC A;  3UT9 B;  4B4X A;  5JRG B;  2EFU A;  2H10 A;  1ALQ A;  3WA9 D;  2EXA A;  3IXB A;  1ID3 A;  1BLS A;  4N92 A;  5B32 D;  4RA7 A;  1P3G A;  1Z2C B;  1KX3 B;  1KGE A;  1TDL A;  1ERO A;  3N8L A;  1SDN A;  4O7D A;  4K91 A;  1Q9C A;  4BD0 A;  3HSH A;  5B2I A;  3UDI A;  1P3G B;  4H9S C;  5JYP A;  3UT9 D;  5GSU C;  3WA9 B;  1KE0 A;  2ZM8 A;  5GT0 B;  4Z5T C;  3V5M A;  4IBK A;  3MGS A;  4ZBJ B;  1XA1 A;  3CZD A;  5CPI C;  3KWQ D;  5CGS A;  5B0Y C;  1HVB A;  4OQG A;  1ZLA C;  1K54 A;  4Y7P A;  2YFW B;  3REJ B;  1I5Q A;  1M40 A;  4OON A;  3V39 A;  4J8W C;  1G6A A;  2HP6 A;  1P3G D;  4CSR A;  1K57 A;  4X56 A;  3IHB A;  5GSU D;  3AZJ C;  1AOI B;  4RX3 A;  1TAF B;  2RL3 A;  5GT0 D;  2YFV A;  2X71 A;  4NY2 A;  2PYO A;  3VOZ A;  5AV5 A;  3FYZ A;  3W96 C;  4H9S A;  4ZBJ C;  5TR7 A;  3RJU A;  4PM8 A;  3AZH A;  3MGP D;  1KX4 A;  5AQ9 A;  2NQB A;  1PZP A;  4WNN B;  2Z2M B;  3AZM C;  5B33 C;  5B1L B;  3AYW C;  3ZHH A;  4OQ0 A;  4DE3 A;  5FQ9 A;  4Z66 A;  2RVQ D;  4KZ8 A;  1S32 D;  2VGJ A;  3PBQ A;  5CGX A;  4R8P C;  3REK C;  3NQU A;  3W4P A;  3MNN C;  3AZH B;  3MGP B;  1FSW A;  5GXQ A;  5M19 A;  2WZZ A;  1EQZ A;  4N9K A;  5FI6 A;  1YM1 A;  4NE6 A;  5BT1 C;  5GLD A;  1HTA A;  2LY8 A;  3V3S A;  4OOL A;  3GVB A;  2ZQ7 A;  3WTP A;  4KUD D;  5AV5 B;  5AVC B;  1QME A;  5FAT A;  4HBU A;  1TAF A;  4GH9 A;  1S32 B;  1ZG6 A;  4KQO A;  4P87 A;  4JPM A;  3S22 A;  3KUY A;  4ZJ2 A;  3G34 A;  2YFW A;  3REJ A;  4E6X A;  3AFA D;  1YU0 A;  2PBY A;  3FWL A;  4Z66 C;  4OJ5 A;  3HUO A;  5B32 G;  3MVD A;  4JBF A;  4JKT A;  5CEB A;  2XD5 A;  3DW0 A;  5AVC D;  3LY4 A;  5B40 D;  1HD8 A;  4LCL A;  3IXG A;  1ES4 A;  4DDS A;  3OPH A;  1U35 B;  2Q9N A;  5AY8 D;  5B2I D;  2XGN A;  3IQA A;  3IF5 A;  4DDY A;  2X01 A;  4OOY A;  2WZX A;  3SS3 A;  5E5A B;  3TU4 D;  3AZJ A;  3BRM A;  1WYC A;  1KX3 A;  1PWD A;  4Z9Q A;  3ZG5 A;  4XZQ C;  5FA7 A;  1ONH A;  5GHX A;  1P3K D;  3IF6 A;  1IYP A;  2ZQA A;  3A6N A;  5M18 A;  1RCJ A;  3C1B D;  3LZ0 A;  3LEL B;  3AFA C;  4FD8 A;  3CG5 A;  3O88 A;  4S2N A;  4LD9 C;  1K55 A;  1SKF A;  2PU2 A;  2XFT A;  5DF8 A;  4G91 B;  2ZJ9 A;  3GRJ A;  4Y0T A;  3TU4 B;  3WS1 A;  1CEG A;  3O87 A;  4WEL A;  4WU8 B;  3BFF A;  4KQQ A;  4R1G A;  3M6B A;  3MXR A;  1PWC A;  4FCF A;  2BYK A;  4KZB A;  5M1A A;  4JJN B;  5HX9 A;  4M6B A;  3OPL A;  4X69 A;  1K57 C;  5A90 A;  1K6R A;  4WBG A;  2H5S A;  3GV9 A;  5DNM D;  5G49 B;  5GXQ C;  4J8U B;  1IYO A;  3NQU B;  3REI A;  5DNN D;  5BT1 D;  5BO0 B;  2JBF A;  5CP6 A;  4WU8 D;  3AZM D;  5FQI A;  5E2H A;  1ID3 C;  3EQV A;  3UTA C;  5AV8 D;  1FR1 A;  1FCN A;  2P9V A;  3M6H A;  2HIO C;  2WUQ A;  4AWL C;  4WNN A;  1P3B B;  1XGJ A;  2IWD A;  1S32 C;  5FUG A;  3KS8 A;  3NI9 A;  5DNM B;  4XZQ A;  4MBK A;  4DE1 A;  2A3U A;  4PM7 A;  2F8N B;  1GHI A;  4OQH A;  1WWS A;  5DNN B;  1I2S A;  5GLA A;  2QMI A;  3AYW D;  2H0Y A;  1J9M A;  3A3E A;  4HES A;  3BEC A;  2W8S A;  3B3X A;  1K25 A;  1CI8 A;  2ZQC A;  4H8R A;  3TSG A;  1BUE A;  3PBT A;  4Z5T B;  4KG6 A;  3MXS A;  3X1T B;  4WZS B;  5DTS A;  5G18 A;  1IEL A;  1U60 A;  4P0M A;  4WJ3 C;  1PW1 A;  5CPI D;  3LZ0 D;  3VP2 A;  1P3L A;  4KHA B;  3AYW B;  5AY8 C;  2ARO D;  1MY8 A;  1C3B A;  4ZUX B;  2J8Y A;  2Q9M A;  4QD4 A;  1YLZ A;  4X23 D;  3M2K A;  4MEZ A;  2HIO B;  5GT3 D;  4H9O A;  3P09 A;  4FH4 A;  1M19 A;  4KZA A;  5AVC C;  2C5W B;  4MNR A;  4DQY B;  1YLP A;  3MGR B;  3C1B C;  2GDN A;  4DRA A;  2VGK A;  4BJP A;  4QLC B;  3KWQ C;  3REH B;  3JYI A;  5CPI B;  3A3F A;  1JWP A;  1SCW A;  3MNN B;  3AZH C;  4ZUX D;  3H0M C;  1TVF A;  3G4P A;  4R3B A;  1ERQ A;  1P3A B;  4X23 B;  3AV1 C;  3W98 B;  3W97 D;  4GKU A;  2HIO D;  5GT3 B;  5GLC A;  4OPZ A;  5B24 A;  2G5I C;  3MGR D;  4OJP A;  4NYY A;  3E2K A;  3G2Y A;  2HP9 A;  3W98 A;  4QLC D;  4XUZ A;  3AZL B;  1XA7 A;  3REH D;  3AN2 D;  2PU4 A;  3UPP A;  1SHV A;  3ZG7 B;  3MNN D;  5CPK A;  5CPK C;  5A91 A;  3WRZ A;  4QLC A;  5KZH A;  4UUZ B;  3AZK A;  1M1A A;  4XUJ D;  4YM6 A;  5CGW A;  4U0X A;  3AZL D;  1M18 B;  3UN7 A;  1ESI A;  1BLH A;  2DF4 C;  5B1M B;  2EX6 A;  1JWV A;  1KX3 C;  4PMA A;  4KHA A;  2CV5 A;  5HFO A;  1R4V A;  5E2E A;  3LEL C;  1FCM A;  1ZLA B;  3SH9 A;  4E3J A;  4OPR A;  5BS7 A;  1ONG A;  1FR6 A;  3EPH A;  2ZM0 A;  3X1T A;  3ZDJ A;  4CAY A;  2WGV A;  4OLG A;  3VP0 A;  3L26 A;  3DWZ A;  4KUD A;  1NZU A;  4QY6 A;  4YFM A;  1M18 D;  2XLN A;  4E3L A;  5B1M D;  3BFE A;  3UY6 A;  5FI2 A;  5I94 A;  4IBD A;  2XEP A;  2B5R A;  2Z2L B;  4YM6 C;  4PPR A;  3HRE A;  2BYM B;  4IJF A;  3TU4 C;  1P3B A;  5GT0 C;  3NDE A;  4EO5 B;  3VMA A;  1HQ3 B;  4IBX A;  3W8K A;  3LZ0 C;  2JC7 A;  3GTC A;  1TEM A;  4A5R A;  3X1U A;  3AZN C;  4OLD A;  4J8U A;  4HBT A;  5G49 A;  3UDX A;  5KSC A;  3G31 A;  2L5A A;  1KGG A;  4X23 C;  3O62 C;  4J8V B;  1M18 A;  2EXB A;  1NXY A;  4MBF A;  4N1X A;  4QJG A;  5CPJ B;  2F8N H;  2DQN C;  3REK A;  2Y59 A;  3MBZ A;  3BM6 A;  2Y2M A;  1AXB A;  1YLY A;  4DXC A;  5CPK B;  1YU1 A;  3HON A;  3REL B;  4EBP A;  1L0D A;  5E2G A;  1K56 A;  1MKI A;  1DJC A;  3BFD A;  4DXB A;  1DJA A;  5CHM A;  3Q7Z A;  2FJ7 C;  3G32 A;  2NZD C;  3C1B A;  4JXV A;  4IJE A;  2JE5 A;  2HPB A;  1NY0 A;  5B32 C;  3KWQ A;  4EWF A;  5AV9 A;  3AZE C;  3IXH A;  5CHU A;  2PYO C;  1M1A C;  4WU8 C;  1YQS A;  3IH8 A;  4LV3 A;  5EE8 A;  3NY4 A;  3R45 A;  3MKE A;  3FDD A;  4N1H A;  5AV9 B;  4IBI A;  5HW3 A;  5GHY A;  1GHM A;  5E5A A;  5CPK D;  4K0X A;  3REL D;  4M3K A;  3OCN A;  2C6W B;  1MWT A;  2CV5 C;  2I72 A;  3HLB A;  4IBR A;  1JWZ A;  3L27 A;  3AGF A;  4JF6 A;  3X1U C;  5B0Y A;  3WS4 A;  1T3U A;  3C1C A;  2HDQ A;  4L0L A;  3GMW A;  4X53 A;  1BLP A;  1GA9 A;  3REK B;  3MZD A;  1LHY A;  3W99 C;  1S0W A;  4R8P A;  5B33 B;  3AZE B;  3AZF D;  1S32 A;  3VH5 T;  5AVC A;  2Y2P A;  2OLV A;  3IHA A;  3FKW A;  3REI C;  2FFF B;  1BTL A;  2WKH A;  4KGC D;  5EEC A;  3AZG A;  4WMC A;  1L0E A;  3EQU A;  5DNM A;  1YLJ A;  3UTB B;  4OJO A;  4WEJ A;  3B0D C;  3AZE D;  2WK0 A;  4P85 A;  1P3F B;  4KZ4 A;  5DTK A;  2Y2J A;  3GSG A;  5B24 C;  5F99 B;  2G2U A;  4KGC B;  5AV6 C;  3G35 A;  3WWX A;  5CTM A;  2NQB B;  3WX7 A;  1IYQ A;  4FSF A;  3S1Y A;  1ZLA A;  4NK3 A;  3AV2 A;  2XD1 A;  3PBR A;  3Q82 A;  3UE1 A;  3A6N D;  4JJN A;  5B1M A;  3UTA D;  4K0W A;  2PYO D;  4U0T A;  4WU8 A;  3FKV A;  1M1A B;  3BEB A;  5B2J D;  1AOI C;  3EPJ A;  5HL1 A;  3Q07 A;  3MZF A;  2ZQD A;  1E3U A;  1PWG A;  2FJ7 B;  3AN2 A;  5JRG C;  3A6N B;  3IWQ A;  1JVJ A;  1L0G A;  4OJL A;  3V3R A;  3C5A A;  3IF6 B;  4LV0 A;  4QNL A;  1W7F A;  3N6I A;  1ES2 A;  3MGS B;  2EX9 A;  5BNX B;  5EOE A;  3HLE A;  1P3K A;  4NYU A;  4LG2 A;  5B32 B;  1ULY A;  5CED A;  4U3T A;  2RVQ C;  5EVI A;  2OLU A;  1YUE A;  2WAF A;  2ZY2 A;  4J8V C;  4WU9 C;  2OV5 A;  3KUY D;  2Y2H A;  5B31 G;  3G30 A;  5AY8 A;  4IBB A;  1NRF A;  5CPI A;  4BLM A;  1PIO A;  3MGP C;  4S2P A;  4S2K A;  3KSY A;  4BL2 A;  2IOU A;  2WKE A;  3MGQ D;  3NQJ A;  3WAA B;  3HVF A;  4H9O B;  4OKP A;  2F2A C;  2ARO A;  5GL9 A;  3UT9 A;  2ZC3 B;  2Y2I A;  3IT9 A;  4ZUX A;  3I7J A;  4NZ3 A;  3KUY B;  2ZY4 A;  4NFT A;  4WZ4 A;  1DJB A;  4JXS A;  1WE4 A;  3NC8 A;  1HQ3 A;  2HDR A;  5TGF A;  3VP1 A;  4IBG A;  5B2J A;  1AOI D;  4DRT A;  3MGQ B;  3AGE A;  1H8Z A;  4Z5T A;  1YU3 A;  3VH5 A;  1KX4 C;  2HDU A;  3A3I A;  5BS7 C;  3MVD C;  5D3O A;  3PBS A;  3BLM A;  4UAA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...