2Y2HA

Penicillin-binding protein 1b (pbp-1b) in complex with an alkyl boronate (za2)
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
487
structure length
467
Chain Sequence
SEITYSDGTVIASIDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTGQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PENICILLIN-BINDING PROTEIN 1B
publication title Structure-Guided Design of Cell Wall Biosynthesis Inhibitors that Overcome Beta-Lactam Resistance in Staphylococcus Aureus (Mrsa).
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 159
structure length 467
sequence length 487
chains with identical sequence B
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2y2hA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2y2hA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2y2hA02
5CGWA 3G2YA 3V5MA 2ZM8A 5TFQA 3UDIA 1N4OA 4YFMA 4BENA 1HZOA 1ZC2A 3FV7A 1IYOA 4O7DA 1MPLA 4E6WA 3HUMA 5EOOA 1QMFA 3BFGA 2Y2GA 3BEBA 4P85A 1M40A 2XD5A 3RXXA 1AXBA 4OPYA 3NY4A 4DXCA 4GKUA 2XH9A 4KENB 3ZVTA 1O07A 3S22A 3ZG9B 4KG2A 2R9XA 1NRFA 3M6BA 3Q7ZA 4P87A 4ZBEA 3LY4A 1BLSA 4X68A 5E2FA 5FQMA 1K54A 4LV2A 3I7JA 5FQQA 1IEMA 3W4QA 2V1ZA 4HEFA 2OV5A 1N9BA 4E3MA 2A49A 2WKHA 4OQGA 5FQ9A 3TG9A 1S6RA 3IWIA 2ZC6B 3RJUA 1U60A 2I72A 1DJBA 3VOYA 4DXBA 3N8LA 4C3QA 1TDLA 4EBNA 3RXWA 5J8XA 1LI9A 4X69A 3QHYA 3MXSA 5A92A 1VM1A 1RCJA 1VQQA 3MZFA 5DTSA 3BFEA 1KE4A 3OZHA 4GZBA 3SS5A 3VFHA 3MKEA 1MBLA 5JYPA 2Y2OA 3GTCA 3SH7A 4PM5A 1K56A 1S0WA 5DTTA 2PU2A 4DKIA 4QU3A 1K25A 4HESA 5HL1A 4C6YA 2R9WA 3Q1FA 1K6SA 3OPRA 3EQUA 4WMCD 2J9PA 2WKIA 4MNRA 4FSFA 2HDUA 3IXBA 3Q7VA 4OOYA 2XGNA 1PZPA 1ZG6A 5CTNA 2VGKA 2ZC4B 1BULA 2ZMAA 4LENA 2X01A 5FAOA 1NXYA 4S2IA 3VP3A 3UE1A 4LV3A 1MWTA 3WS5A 5CEDA 4S2MA 3PBNA 2WADA 3Q07A 4RX2A 5A90A 4S2PA 3UPNA 1CI9A 2CC1A 1JWVA 2EFUA 5GHXA 3G2ZA 5IHVA 4BQMA 2Z2LB 2ZQ9A 2FFYA 4QY6A 3VSKA 1LLBA 2HDQA 3BLMA 3M2JA 1TVFA 3BM6A 3QNBA 4UA6A 5CTMA 4BJPA 2Y2JA 1KGFA 1O7EA 4N9LA 3HVFA 3ZGAB 1BTLA 3PBSA 1YLWA 4S2NC 5A91A 2FFFB 4K0WA 4OQHA 4B4ZA 5AQAA 4FH2A 4DRTA 3B3XA 5M18A 3C7VA 4C75A 5GLBA 3FKWA 1YLTA 1BZAA 4DDYA 2DCFA 3GRJA 1NYMA 1E3UA 3WRTA 2Y2NA 1PYYA 2H10A 2XK1A 2IWBA 3VP0A 1ESIA 3IT9A 5FA7A 4GD6A 1K55A 4KZ4A 3UPOA 1RGZA 3ZCZA 1CK3A 1XP4A 4PM8A 1ONGA 3WS2A 3E2LA 5HX9A 1RGYA 1L0DA 2EXAA 4LCMA 2ZQDA 3G4PA 3HLEA 2ZC5B 3SH8A 4EBPA 4IBRA 4OLDA 2OSUA 3IF6B 4FD8A 5EVIA 3D4FA 1KVMA 4ZAMA 4ZJ2A 3UDXA 3VP4A 1HTZA 1L0FA 4MLLA 4PM9A 3IH8A 4YINA 4KQOA 4GOGA 4OVDA 3SS3A 1MKIA 2QMIA 4GD8A 3DTMA 5G18A 2XDMA 1YMSA 2C5WB 3O86A 5HAIA 5FQIA 2Q9NA 1W7FA 1MWSA 4OH0A 5CHJA 5F82A 1YLPA 5CEBA 3C4OA 4ZTKA 1KDSA 2EFXA 1E25A 2WGWA 4WELA 2HP5A 5FI7A 1CEFA 3A3JA 1Q2QA 4OP8A 5A93A 1ES5A 1SDEA 4KZ6A 1Q2PA 1L0GA 5M19A 4E6XA 3HL9A 1IKIA 4KZ9A 3ITAA 1DY6A 2UWXA 1XPBA 1EROA 3DWZA 1MWRA 2HDSA 4QB8A 2JC7A 3ZNTA 5CHMA 3HREA 4OOMA 3LY3A 1YMXA 2EXBA 4E3NA 4JXSA 2V2FF 2XQZA 3N6IA 4WZ5A 1XX2A 5KSHA 3BECA 3Q81A 4Q8IA 2Q9MA 1JWPA 3ZG0A 2ZJ9A 3ZDJA 2OLUA 4KZAA 5FI2A 5DF9A 3VSLA 3WWXA 2JCHA 1WE4A 4OONA 2HPBA 1BSGA 2P9VB 4KG6A 1K54C 3GQZA 4DE2A 4E3OA 2X02A 2WZXA 1ERMA 4DE1A 2Y55A 3W4OA 3G32A 3BFDA 1YT4A 2RCXA 5EE8A 3O88A 4XUXA 3LO7A 4GDNA 4JF5A 5E2HA 1XA1A 1SKFA 3ZG8B 3GR2A 1PW8A 2QZ6A 5FQJA 3A3FA 2P9VA 1K56D 4PM6A 3FKVA 4JF6A 2P74A 5DVAA 5FAQA 2Y2LA 3E2KA 2GDNA 4R3JA 3ZFZA 4E3JA 3BLSA 3NIAA 4KZ3A 3UY6A 4GNUA 2HDRA 1ERQA 2BG1A 3G34A 4CJNA 3NDGA 4DDSA 3MZDA 1L2SA 4OPZA 3N7WA 3P09A 3BYDA 2HP6A 4OP5A 1L0EA 1EI5A 4S2KA 3AGDA 1JVJA 5EUAA 5KSCA 3VP1A 1PWGA 2ZC7A 1KGEA 1MXOA 2A3UA 5CGSA 1H8YA 3IXHA 3PBTA 2G2UA 5FDHA 3M2KA 3PBQA 2XFTA 3CJMA 3M6HA 1G6AA 5CXWA 4Z9QA 1K38A 4OPQA 1ZG4A 4WEJA 5HAQA 1I2WA 1LL5A 4UA7A 3ZNYA 5AQ7A 1KVLA 4HBUA 5FAPA 3WS4A 4N92A 1ZKJA 4IVKA 2OLVA 1EWZA 4XXRA 4WZ4A 1IKGA 1GA0A 4RA7A 4QHCA 4DE3A 4WEKA 3V3RA 1G68A 2ZD8A 1NJ4A 4WYYA 2IWDA 3UDFA 5F1FA 3W4PA 3MXRA 4KZ5A 5HAPA 4WM9A 4ZDXA 2JBFA 4QY5A 4X6TA 1K6RA 3Q82A 4X55A 2J8YA 2ZC3B 1SCWA 1FQGA 1K57C 3GMWA 1E3UD 3OCLA 4WMCA 4Y7PA 2Y59A 3HLWA 4EUZA 4F94A 5JYOA 1KE3A 1WYBA 1IYPA 2V20A 3V39A 3IWQA 3TSGA 3HUOA 4P6BA 3G30A 1GCEA 2EX8A 3HLFA 4N9KA 5EECA 5AQ9A 5CERA 4CPKA 5BOHA 1GHMA 3IHAA 3BRMA 3OCNA 3UNWA 3ZG5A 3PBRA 3NI9A 5AQBA 5HFOA 2WGVA 1BT5A 3O3VA 1BUEA 4R4RA 1YLZA 4D2OA 3LEZA 3ITBA 1NZUA 5EVID 3S4XA 1TEMA 1K55C 4KG5A 2Y2KA 1BLHA 4S2NA 4RX3A 3N8SA 1IYSA 3GSGA 1PI5A 1XGJA 2Y91A 2XEPA 3ZVWA 1GA9A 3UE3A 4QD4A 2Y2IA 1MWUA 2Y2MA 1PI4A 1LHYA 3OC2A 4JKTA 1XKZA 4BD1A 4Y0UA 3HUNA 3NDEA 4B88A 3UPPA 1PWCA 5EVIC 3V50A 5DF8A 3WS1A 3IF5A 4PM7A 1BLCA 4ZJ3A 5CHUA 3UO9A 4R3BA 2EX2A 5FI6A 2XLNA 4S2LA 1ONHA 2ZQCA 1YM1A 1H5XA 1KGGA 4JXVA 1K4EA 2J7VA 1IYQA 3IF6A 5CECA 2ZQAA 3C5AA 4UA9A 4L0LA 4MBFA 2XR0A 3C7UA 4EWFA 5TGFA 3SH9A 3IWOA 5EOEA 4MBHA 2PU4A 2HP9A 1HVBA 4R23A 1KE0A 1ES2A 1FCNA 1C3BA 4N1XA 1HD8A 1XA7A 2C6WB 1XXMA 1K4FA 2WZZA 3P98A 4OPRA 2H0TA 4LV0A 3DW0A 4ID4A 2IWCA 3SOIA 5KZHA 1NY0A 1PWDA 1PW1A 3MFDA 1WYCA 4RYEA 2Y2HA 2VGJA 4JXWA 3FWLA 4KZ8A 4PPRA 2EX9A 3DWKA 4XUZA 5EVLA 4EV4A 5FQKA 1FOFA 5GHZA 4KQQA 4OOLA 4K0XA 3WS0A 4JLFA 2G2WA 4GDBA 1M6KA 3ISGA 4DE0A 4H8RA 3SS4A 1ES4A 2WUQA 3HLBA 5GLDA 4JBFA 4IEDA 4HBTA 1LI0A 4LCLA 1W5DA 4UAAA 4FCFA 5GLAA 2XFSA 2XD1A 1I5QA 1GHIA 3OPHA 4N1HA 5HARA 3CZDA 1SHVA 3UN7A 1YLJA 3IXDA 3UE0A 4JXGA 4DF6A 1JTDA 2ZQ7A 1FR6A 1CEGA 1W8YA 3PAGA 4X53A 2JE5A 5I94A 3W8KA 4MBKA 3N8RA 2EX6A 4M3KA 3HLCA 3LCEA 3OPLA 2B5RA 4R4SA 3A3DA 2WGIA 3S1YA 2QPNA 2PBYA 3FZCA 5CGXA 3VFFA 3G35A 1JTGA 5DF7A 3NC8A 1FCOA 5E2GA 4BL2A 5FATA 1TDGA 1JWZA 1YLYA 4B4XA 5CRFA 3GV9A 5E43A 4E3LA 5EPHA 2Y2PA 3Q7VB 1MY8A 2Z2MB 3PTEA 1Z6FA 5D3OA 4LV1A 1Y54A 4GB7A 4OKPA 3WRZA 5F1GA 2WYXA 4A5RA 3AGEA 1LL9A 3G31A 1DJCA 3O87A 4KZ7A 4NETA 4S2JA 2ZM2A 3NCKA 1ALQA 4UHUA 3HLGA 3A3IA 4GN2A 5FASA 5M1AA 1GHPA 3VMAA 3ZHHA 5E2EA 4S2OA 1FR1A 4OQ0A 2WK0A 4RVAA 2Y2QA 2H0YA 1XGIA 2WAEA 1NZOA 3A3EA 3JYIA 3PBOA 2X71A 4X56A 4JPMA 5FSRA 2ZLYA 3MZEA 4MEZA 4IBXA 3IQAA 4NK3A 4E3IA 5L2FA 1PIOA 2Y4AA 2WKEA 3MKFA 4IVIA 5GL9A 5TR7A 1I2SA 3AGFA 4OLGA 3V3SA 4QJGA 3C4PA 4PMAA 4WBGA 2J9OA 3OPPA 4FH4A 1PZOA 1FCMA 3IH9A 3BFFA 2E8IA 1K57A 1KDWA 2DNSA 3EQVA 1E4DA 3BFCA 4U3TA 5GHYA 1DJAA 1J9MA 4U0TA 4EQIA 4R1GA 1H8ZA 3QNCA 4U0XA 3VOZA 5F83A 1NYYA 1ES3A 2ZM0A 3VP2A 1FSWA 4JF4A 4KQRA 5EVIB 2BLSA 2XF3A 4R0QA 3N4IA 3PAEA 3ZG7B 5DTKA 3CG5A 5KMWA 1OMEA 2DRWA 3GVBA 5U47A 3IXGA 3NBLA 1ESUA 3IF6C 4BL3A 1QMEA 4ZJ1A 4K91A 4KZBA 1FSYA 1BLPA 4Y0TA 3FYZA 4OQIA 3TOIA 1W8QA 2WGWB 4P0MA 2WAFA 4BD0A 3CMZA 4EBLA 5GLCA 3IHBA 1IELA 5HW3A 2ZQ8A 4Y0OA 1W79A 2H5SA 1YQSA 3HBRA 2RL3A 4BLMA 1CI8A 3MBZA 1RP5A 3HLDA 4WZ5C 4E3KA 1SDNA
chains in the Genus database with same CATH superfamily
1P3AC 4F3LB 3UDIA 3C8CA 5AV5A 1MPLA 5MC7A 3IX4A 2CV5C 3MGQB 4P85A 5FDSA 2XD5A 3AN2B 3VH6W 2BYKA 4Y17A 3B0CW 1E88A 4OJPA 4KG2A 2R9XA 1NRFA 4ZRRA 3LZ0C 3L26A 5E2FA 3LJAD 2GNXA 4LV2A 4J8WA 1IEMA 3B6GA 3CUEC 3LFVA 5B31B 2OV5A 1N9BA 4OQGA 5J3WA 2L5AA 1OTAA 2F8ND 2F8NG 1U60A 3KSIA 1DJBA 1P3GA 5DNNC 1H8MA 5CPJD 1FIKA 2FH5A 4EBNA 4YS3A 3X1SA 1U35A 2D49A 3C38A 3UMEA 1RCJA 5DTSA 5TBMB 3UT9A 1UWNX 3VFHA 4J8VA 4LRYC 3B6FD 5AVBA 4LRZE 4PM5A 5L10A 4GW9A 4HESA 4C6YA 3Q1FA 1K6SA 4H9OA 2WKIA 4OOYA 4JGRA 5CTNA 2VGKA 2W3DA 2VKSA 5FAOA 4S2IA 3O62C 3VP3A 5GT0B 5FEFA 3F6TA 1L6JA 5CEDA 1M18B 4S2MA 3Q07A 4RX2A 5AVFA 5A90A 3UPNA 5IS1A 1CI9A 2CC1A 1JWVA 2EFUA 3KXBD 4OJLA 5IHVA 4R3AA 1T1CA 2Z2LB 4QY6A 2OWJA 1LLBA 3MNNB 2A2LA 1KGFA 4N9LA 3FC7A 3HVFA 5B33C 1KS0A 2A24A 5B24C 3WD0A 1BTLA 4DMZA 1YLWA 1W63M 3MQLA 1AOIA 5F69A 5AQAA 2BYMA 4C75A 1F98A 3FKWA 3VV4A 1YLTA 4QLCC 2DCFA 3GRJA 4HIAA 3WRTA 2P08A 3W98A 5FUGA 1K55A 4KZ4A 4IBEA 3X1UB 3VE3A 1RGZA 3W99B 5HL6A 4EBPA 3G4PA 3AZFA 4YNRA 2PDRA 5JRGA 4OLDA 1P3LA 5EVIA 2JKRI 3D4FA 4WU9C 3A1KA 4ZAMA 4ZJ2A 3AZHD 4Z5TB 4HMCA 3WTPE 3H82A 1A7WA 5AVCC 3QP6A 2ZBBA 3SS3A 1LL8A 2QMIA 4NXEA 5G18A 5AVCB 1YMSA 2AROB 2Q9NA 1W7FA 5B2IB 4OH0A 5F82A 5GXQB 5CEBA 4WELA 5FI7A 1ES5A 2OAQ1 3MF0A 3IBJA 1XPBA 3UE6A 3DWZA 2HDSA 2JC7A 3LY3A 2EXBA 4MDZA 4E3NA 2XQZA 2B02A 3WTPC 3UB8A 3HCYA 1P3MC 3Q81A 4Q8IA 3AFAC 1Y28A 1TS0A 5HWVA 3ZDJA 3AFAB 2W1RA 3VSLA 2VGLM 2JCHA 5CPKA 1WE4A 4HY8A 5CPIC 2P9VB 1VEUA 3T1QB 4HJ4A 1K54C 3GQZA 1P34B 2WZXA 3WD2A 2Y55A 3MGSA 5B0YC 3BFDA 5E5AB 3LO7A 2JKTI 3GR2A 3REKC 5DNMC 5FQJA 3FKVA 3BY9A 2P74A 5GSUB 2XRNA 3ZFZA 3BLSA 1XJ2A 2AVXA 3UY6A 5B2JD 2HDRA 1ERQA 1H3QA 1N9LA 3REJA 3AZGD 1D1JA 5AV8D 2HP6A 3T4TA 3NHQA 2NQBB 4IBIA 1H8YA 5FDHA 2XFTA 3CJMA 2D02A 4KHAA 4OPQA 4WEJA 5HAQA 4UA7A 1F66A 3UTBA 3MQOA 5FAPA 1KX3D 4RA7A 4I3IA 3V3RA 1NJ4A 3DAVA 4KQDA 4GHIA 2ACGA 1K6RA 3Q82A 3AZKD 3C1CA 2J8YA 5B0ZA 4YM6D 1FQGA 3F1OB 2Y59A 3HLWA 4F94A 5JYOA 1PDCA 3T1RA 4Z66D 1T18A 3V39A 1ZLAD 3HUOA 4P6BA 5CERA 4BBVA 1A0KA 4N9KA 3E0YA 1YSQA 1GHMA 3UNWA 3BRMA 3ZG5A 1E15A 3MGPC 1WWIA 3PBRA 4JJND 4ESPA 3JVUA 4J8XA 1BUEA 3O3VA 1YLZA 1P3BA 4MB5A 3MGPB 3S7QA 4D2OA 3LEZA 3ITBA 3LZ1A 5FL3A 3S4XA 1TEMA 1FILA 4S2NA 5F68A 4LLOB 1P3OD 3N8SA 1XGJA 2W3GA 2Y91A 3WA9D 3EGDC 3ZVWA 2G7UA 3VH5W 4QD4A 2Y2IA 5J7EA 4Q0IA 1EQZD 2VGLS 4Y15A 3OC2A 4JKTA 1W1PA 4Y0UA 4J8UD 2HUEC 2VA0A 3V50A 1NLZA 2GZAA 2PT7A 1TZYC 4ZJ3A 3WD1A 5CHUA 1IFQA 4S2LA 1YM1A 2ZMFA 1K4EA 4GLQA 3IF6A 4O8GA 3C5AA 3JPUA 4UPKA 5BNVA 1M1AB 3BW6A 1YU0A 1SKOA 4MBHA 4KUOA 3TU4A 3NOTC 3H7WB 4IBFA 1YU1A 1HD8A 5BO0B 2H0TA 3DW0A 4ID4A 5AV5B 3MGQD 5A8BA 3O5YA 1PW1A 3AN2D 4WNNA 1P3AA 4X25A 4WU8A 5C5KA 2BYKB 3DWKA 1ODVA 4ARZA 3AYWB 3WAAA 4K0XA 1J7MA 2CV5A 3PYPA 1M6KA 3SS4A 5DKLA 4J8WB 5B31D 3B6GB 1W5DA 5B31G 3REHA 4UAAA 2HJ9C 5GLAA 3HJIA 3LZ0A 1I5QA 4KUDC 1GHIA 3OPHA 2IO5C 4N1HA 5HARA 3UTAA 3CZDA 5EFWA 1SHVA 1P3GB 3CUEA 1YLJA 3AZLA 4YS3B 2ZY2A 2EWVA 3X1SB 3IXDA 4DF6A 1U35B 1JTDA 1FR6A 1CEGA 2ZQ7A 4X53A 3UT9B 3WKJC 2EX6A 4J8VB 3BWLA 3HLCA 2B5RA 5DNNA 5AVBB 4HI4A 3S1YA 3FZCA 3H9WA 4G91C 5CGXA 5C3IB 4I39A 3NC8A 5CP6B 5E2GA 4IBJA 2W8SA 4NZ1A 3JVVA 4GS9A 3MVDC 3ZQ5A 1TDGA 3LELB 3KSFA 4E3LA 2EWWA 1UGUA 3SZTA 1V9ZA 5GT0D 1Y54A 1TS6A 3LUQA 3WRZA 3X1VA 3L28A 1M18D 1DJCA 2VQRA 3O87A 3WD4A 3KO6A 3NCKA 1DP6A 3H0LC 1WWSA 3NOUC 3KS4A 3MNND 2V0WA 1J3WA 1FR1A 2H0YA 1NZOA 3A3EA 2X71A 2ZLYA 3MZEA 2ZY5A 1L3LA 2A24B 3IQAA 4LG2A 2Y4AA 4IVIA 1AOIB 3V3SA 2BYMB 1OT9A 4UEYA 4WBGA 5B33A 2J9OA 2W3EA 1PZOA 5B24A 1FCMA 1K57A 3L29A 1KX4A 2J3TD 3X1UD 4ME4A 2Z6CA 3W98B 3B0DC 1E4DA 3W99D 1DJAA 3V9RB 2KOIA 4QLCA 1W1VA 2VV8A 3EWKA 4U0XA 3VOZA 1P3IC 3AZFB 1P3LC 2ZM0A 1LT0A 5JRGB 4JF4A 4Z5TD 1T19A 5EVIB 2BLSA 1BFMA 5L8MA 4R0QA 3OOVA 3N4IA 3H82B 3ZG7B 5KMWA 5AVCD 5CHLB 3UB9A 2AROD 3NBLA 4IJEA 5B2ID 1S66L 4WU9A 5GXQD 4KGCB 4OQIA 3TOIA 1Z09A 3A0VA 4BD0A 3RELC 2L0WA 3ULFA 1IELA 4CLCE 3HJKA 1P0ZA 3IBRA 3HBRA 4DJ2A 4AWLC 4BLMA 3CI6A 1OGBA 3G2YA 5G4ZA 3AFAD 4YFMA 5CPKC 5DJUA 1QMFA 2E8JA 2Y2GA 3BEBA 1M40A 1P3MA 3RXXA 1P34D 4AFIA 1VEUB 4CLCC 4DXCA 4GKUA 5B32G 5E5AD 2O0YA 3S22A 3MGSB 2HGVA 1UR8A 5BS7A 1K54A 4EU0A 5FQQA 5GSUD 3C1BC 2V1ZA 5B0YA 4X23C 4E3MA 2WKHA 4OJ5A 3REKA 1CQAA 5DNMA 4DXBA 3REJB 3N8LA 5F99C 3X1TC 3MZFA 4O01A 3NQJA 2NQBD 3SS5A 1OJGA 3W96D 3MKEA 4G92B 3CPTA 2Y2OA 3SH7A 1K56A 5G49A 1S0WA 4HH2A 5DTTA 3A6NC 3LR3A 4KHAB 1F66C 5HL1A 3AV1A 1LSVA 4WMCD 1P3PA 2J9PA 4MNRA 3DTEA 4FSFA 3UTBB 2X01A 1NXYA 4LV3A 5B1MB 1ID3A 3C1CC 5B0ZC 1Q9CA 5B0ZB 1HQ3B 3BQAA 1G28A 2ZQ9A 3BLMA 3M2JA 1TVFA 3OBFA 2HIOA 5CTMA 1XJ6A 2M1CA 1P3BC 3MGPD 2ZL1A 3ZGAB 2OOLA 4J8XB 3LZ1C 4S2NC 2W1TA 4UQIS 1TF1A 3LZ1B 1CJFA 4XZQC 4FH2A 3B3XA 5M18A 5GLBA 1BZAA 4DDYA 1NYMA 2L4RA 1E3UA 5HD5A 2Y2NA 5AV6B 3VP0A 3UPOA 3A1IA 3ZCZA 1CK3A 4PM8A 3MGRA 2CMNA 3WS2A 1T3UA 3E2LA 5HX9A 2HZ5A 1M19B 5AV9B 3KSYA 2ZQDA 4X1MA 2OSUA 3IF6B 1KVMA 2JSSA 1M1AD 3UDXA 3VP4A 4OJOA 3IH8A 4PKYG 5B1LB 4YINA 3U2AA 4KQOA 1UWPX 1SKOB 3TU4B 1MKIA 3AZIC 2XDMA 3T4QA 4GH9A 3O86A 5EM0A 2B95A 5FQIA 3LI9A 5AV5D 1MWSA 4Z2GA 4ZTKA 3T1SA 4WU8C 5KIZA 4OP8A 2J8PA 4EERA 1P3AB 4H9NA 4E6XA 3HL9A 1IKIA 4KZ9A 3LGOA 3WAAC 3AYWD 2I9VA 1EROA 2NZDC 1MWRA 4QB8A 4ARZB 3W97D 1K0KA 1CF0A 1YMXA 2V2FF 3QP2A 3REIC 4DQYB 2CV5B 4WZ5A 5KSHA 3BECA 4IJFA 4M6BA 4J8WD 3ZG0A 4M4XA 3B6GD 3REHC 4GHLA 4R38A 1WA9A 4IBDA 3MS6A 3MJQA 3UTAC 4OONA 3LZ0B 1P3GD 3EPKA 4II7A 4XT2B 1BYWA 3AZLC 4YS3D 5GT3A 3X1SD 4E3OA 1U35D 3W4OA 3G32A 3UT9D 2RCXA 2VEAA 3O88A 4XUXA 5EE8A 2JKFA 4J8VD 4JF5A 4KUDA 3ZG8B 5AVBD 3CLOA 3AZNC 5DNNB 3A3FA 4PM6A 5CP6D 5FAQA 4Y3IA 2PYPA 2QWSA 4GNUA 3WKJA 3LELD 3S7PA 3G34A 4Z2MG 4GS9B 4DDSA 4ZUXC 4HJ6A 4GCZA 4OP5A 1EI5A 3X1VC 4L9FA 3A0RA 4S2KA 4Z2LA 3VP1A 3MVDA 5CGSA 1HTAA 4WJ3C 2F8NA 3M2KA 3KYZA 1YU3A 2OWHA 3LIFA 3O62B 4NEED 3NQUA 1LL5A 5BNXA 4NXGA 2W0NA 3WX7A 4N92A 3M7PA 2RVQC 1S32D 4QHCA 4DE3A 4WEKA 3FDDA 1F9IA 1S4SA 3UDFA 5HAPA 1AOID 4MN6A 2V1BA 4ZDXA 4QY5A 2ZC3B 2KLIA 1K57C 5B33B 1KX4C 2J3WA 4CAYB 5B24B 1IYPA 3W98D 2ZOHA 3N3FA 2XROA 3OLOA 5EECA 3G30A 3HLFA 5DKKA 2K2NA 1XFQA 4LD9A 3AV2C 1STZA 2WGVA 4QLCB 3AZFD 4R4RA 5JRGD 3DTIA 3E4OA 1NZUA 4G3WA 5EVID 4KG5A 4RX3A 3KUYD 3TE8A 4D60A 1JFIA 1IYSA 3GSGA 4RQ9A 5CX7A 5HZHA 1S1ZA 2Y2MA 1LSXA 1P3IA 2VK3A 4DJ3A 4B88A 4KGCD 4WU9B 4ETXA 4NZ5A 4PM7A 1BLCA 2V1AA 2EX2A 5FI6A 1KGGA 2DMWA 4BWIA 4Y13A 1BH8A 5TGFA 4HQAA 3SH9A 4UUZA 3IWOA 3AZEA 1BH9A 2PU4A 3RELA 1KE0A 3W2ZA 1FCNA 1XXMA 4MN5A 1K4FA 3EPLA 2WZZA 3P98A 4OPRA 4LV0A 1GSXA 2IWCA 5KZHA 1PWDA 3AZHA 3WTPB 1WYCA 2PYOC 2Y2HA 1P3MB 2FJ7C 4JXWA 3FWLA 4PPRA 4X1LA 3UB5P 4XUZA 1T1BA 4EV4A 3MGSD 1D7EA 2G2WA 5BS7C 3AZJD 3EPJA 4GDBA 5CPIB 2WUQA 4CLCA 3LIDA 5GLDA 3E4PA 4JBFA 4IEDA 4YWZA 1KX5C 5B0YB 3GDIA 2XFSA 3KX0X 2XD1A 1KOUA 3LICA 3REJD 4H6JA 4H9PA 3REKB 3B47A 5DNMB 3RFBA 3C1BA 1OGGA 1JNUA 4X23A 4JXGA 2EA9A 4XUJC 3PAGA 5B32C 3NQJB 5BPVA 2KX6A 1ZHHB 1GSVA 4M3KA 3OPLA 3AZMC 5F99A 2QPNA 2WGIA 3X1TA 3CPTB 3MFXA 5F5YA 1JTGA 4LGWA 5DF7A 1ACFA 3AV1C 5HWWA 3H0MC 1P3PC 3UTBD 4BL2A 4LPZA 1JWZA 1ULYA 5EPHA 1H3OB 2JN7A 5D3OA 4LV1A 3A6NA 1ID3C 5B1MD 1SZVA 2YFVB 5B0ZD 3LYXA 2VX8A 1HQ3D 3HLGA 1O6IA 3A3IA 4GN2A 2FZ0A 5AV8A 4Y5FA 5E2EA 4S2OA 2HIOC 1P3FC 4RVAA 2Y2QA 1XGIA 2HIOB 4J8XD 4H9QA 4JPMA 5FSRA 4IBXA 4E3IA 4WN5A 3LZ1D 3MKFA 5L09A 2W1TB 2QJ7A 3H0RC 3HONA 4NYUA 4OLGA 2PBDP 2YFWA 5AV6D 3IH9A 3BFFA 2E8IA 4BMWA 2DNSA 3EQVA 3MGRC 4XZQA 2WKPA 5GHYA 3L27A 1J9MA 1M19D 5AV9D 1H8ZA 5B40C 4YM6A 1E6NA 1FSWA 1YKDA 2GX5A 2HUEB 3PXPA 1ZLAA 5B1LD 1TZYB 5J4EA 3TU4D 5DTKA 1F1EA 5I5LA 2PAVP 3GVBA 4IHQA 3IXGA 1ESUA 4R8PC 1FSYA 1W1YA 1W8QA 1P3OA 1P3AD 2WAFA 3CMZA 3AZIA 5HW3A 2ZQ8A 1W79A 4H9NB 1EQZA 4EW7A 2RL3A 2KDKA 3T4OA 1CI8A 2K31A 1PFLA 1P3KA 2CV5D 3KWQA 3HLDA 4WZ5C 3TW8A 4E3KA 5AY8C 5CGWA 3V5MA 2ZM8A 5TFQA 1ZTUA 3K3DA 4BENA 2NZDA 1ZC2A 3FV7A 1DRMA 1IYOA 2YKHA 3CITA 4P6ZS 3REIA 3LZ0D 2LB5A 5GT3C 1AXBA 4F3LA 4OPYA 3F1NA 3NY4A 3QP8A 5GT3B 3DTKA 3UB6A 4H9RA 4MB4A 3F1PA 2PHYA 3M6BA 3Q7ZA 4FUWA 3LY4A 4KUDB 2IO5B 5DNND 3MGQA 1TS7A 5FQMA 4WUJA 3I7JA 3AN2A 4NKPA 2PR6A 4HEFA 3MQQA 5FQ9A 3WKJB 4K08A 3RJUA 2I72A 3AZNA 3VOYA 1OPXA 1TDLA 3LJAC 4G91B 1S4RA 3P01A 3MXSA 5A92A 1ED7A 5EVEA 4H9OB 3OZHA 5B31A 4HOIA 1MBLA 1W63Q 3MVDB 4ZUXA 3GTCA 5CPJC 1H8PA 3O62D 2H28A 2PU2A 5IT5A 1K25A 2XA7S 2R9WA 2HJEA 3NQUB 4EEUA 5BNXB 3Q7VA 3B6FC 2XGNA 1PZPA 1ZG6A 1OTEA 2ZMAA 3T4KA 1MWTA 3IX8A 1MZUA 4EXOA 4JGQA 4S2PA 5B33D 2QKPA 4IJGA 4EO5C 5B24D 5GHXA 3G2ZA 3VSKA 2FFYA 4Q0JA 1DP9A 4LD9C 1P97A 3UMDA 5DJTA 4EETB 1M18A 4BJPA 4QLCD 2Y2JA 4NFTA 4LD9B 4QWOA 5HPFA 2P7JA 2P04A 3PBSA 5FUGB 3KXBC 5A91A 1N1JA 2FFFB 4R70A 4K0WA 3B0DB 4DRBA 4DRTA 3MNNA 3C7VA 3AV2A 1JFIB 3RH8B 2K7SA 2ZMVA 1PYYA 2H10A 2XK1A 1P3IB 2IWBA 1P3LB 4WU9D 4G3VA 1XP4A 1ONGA 1L0DA 3HLEA 3SH8A 2ZC5B 4WL9A 4NY2A 3T4JA 3R7WA 4FD8A 3AZEC 5HDCA 1HTZA 4MLLA 4PM9A 3W99A 4UUZB 3AZEB 3KSGA 4OVDA 4GD8A 3RELB 5HAIA 5HDSA 4DRAA 2WKRA 4AWLB 2IOUA 3AZHC 3C4OA 4UQIM 3WTPD 1KDSA 4Z5TA 1E25A 5F6AA 2HP5A 1B6WA 1YSPA 3A3JA 1P3MD 1Q2QA 5A93A 5M19A 1Q2PA 1L0GA 4EESA 1DY6A 2J80A 5CHMA 5CPKB 4Z2JA 4JXSA 3N6IA 5CPID 2PYOA 2FJ7A 1JWPA 4WZSB 4CLCB 5B0YD 4KZAA 5DF9A 2VV6A 4HGAC 2DQNC 2HPBA 3REKD 5DNMD 4H6JB 4H9PB 5K5BA 1ERMA 3C1BB 1KX5A 4X23B 1YT4A 1E6RA 3EGXC 4G3KA 2RIQA 1PW8A 2QZ6A 2P9VA 1YU4A 1K56D 5F99B 5DVAA 3X1TB 4JF6A 2UV0E 1P34A 4E3JA 4XUJA 5B32A 4EQ1A 2BG1A 4CJNA 5E5AA 4ETZA 3MZDA 1L2SA 3AZMA 3N7WA 4PHTA 3KFUG 1KU5A 1JVJA 4JGOA 5KSCA 3A6NB 3LR5A 1PWGA 1F66B 3LIBA 1MXOA 5B2JC 2HV1A 3NJAA 3UB7A 3L2AA 3PBTA 3IXHA 1H0MA 2QJ5A 3FKEA 3AZGC 5CXWA 5AV8C 1YAXA 4GHIB 1ZG4A 1I2WA 3C1CB 3ZNYA 1KVLA 3WS4A 4IVKA 2OLVA 3W96A 3B0BA 4WZ4A 1IKGA 1GA0A 1E8BA 3U4LP 1G68A 2ZD8A 2IWDA 4Z2IA 4KZ5A 4WM9A 1P3FA 4X6TA 4EEPA 2R78A 1KX3C 4WMCA 1P3BB 1E3UD 4EUZA 5JYPA 3MXQA 5AJGA 3TSGA 1GCEA 2EX8A 5AQ9A 2Q0OA 4XZQB 4JGPA 3OCNA 4MB3A 3AZKC 5AQBA 5HFOA 4YM6C 3NOPC 2V0UA 3F1OA 1ZLAC 1BLHA 2ZM5A 1TZYD 1PI5A 2LB9A 1GA9A 3B33A 5B40A 4JJNC 1LHYA 1PI4A 1VETA 1XKZA 4BD1A 3HUNA 3R45A 3NDEA 5BNVB 3UPPA 5DF8A 3IF5A 1P3OC 4R3BA 3WA9C 2XLNA 3K2NA 1ONHA 2ZQCA 1EQZC 5JA4A 3AZIB 5CECA 4R8PA 2ZQAA 3D9YA 1P3KC 4J8UC 4L0LA 4MBFA 3KWQC 2L1MA 1P3KB 3VH6T 4WNNB 4WU8B 3KWQB 2ZY4A 3B0CT 2F8NK 2HP9A 1HVBA 4N1XA 3WAAB 2C6WB 2NZDB 3L7HA 1GXDA 3REIB 5AY8A 4PKYA 3HSHA 1TAFA 2VGJA 5GT3D 3H7WA 4KZ8A 3F1NB 5EM1A 5FQKA 3REHB 1FOFA 5BO0A 5GHZA 4KQQA 4HMEA 5G4YA 1VB6A 4H9RB 4KUDD 3F1PB 3MGQC 1GPFA 3UTAB 3B42A 3AN2C 3ISGA 4DE0A 4NXBA 4H8RA 2VV7A 3AZLB 1MC0A 4HBTA 4LCLA 3AYWA 3WKJD 4IBCA 3FPWA 4HNBA 4MMNA 3W97A 3AZNB 4NE6A 2F8NH 3UE0A 5B31C 2G5IC 3LIAA 1W8YA 5I94A 3MVDD 3W8KA 1XJ3A 4R4SA 4ZUXB 1LSWA 3LJAA 2PBYA 3VFFA 3X1VB 4Z2MH 2D01A 1FCOA 2ZOIA 2PRFA 5FATA 1YLYA 4B4XA 3GV9A 5E43A 3Q7VB 2Z2MB 5CPJA 1Z6FA 5FEGA 4GB7A 4E45A 4OKPA 5F1GA 2WYXA 2YKFA 3AGEA 4TX8A 4Z2HA 2WKQA 5CP6A 3G31A 4E04A 4KZ7A 3LI8A 4NETA 2ZM2A 3B6FA 4UHUA 3LELA 4GJ4A 3EEAA 1YUEA 3S7OA 5GT0C 5M1AA 3R4KA 3ZHHA 1M18C 3KYEA 4OQ0A 2WK0A 4LD9D 2WAEA 5HD3A 3PBOA 3BJNA 1KX4B 4HJ3A 5L2FA 1N1JB 3MNNC 3A0SA 4HMDA 4CSRA 3NULA 4HP9A 1I2SA 4Y2FA 3C4PA 4PMAA 3AV2B 2JKGA 3VE4A 4FH4A 1P3ID 1OT6A 1P3LD 3KXBA 1S32A 4NZ4A 3MQ0A 1T1AA 3LR0A 1EW0A 1YPRA 4EQIA 3CAXA 4OUIA 3QNCA 5F83A 1NYYA 2PYRA 2JKRM 3VP2A 1PRQA 3X1UC 2J3TC 4KQRA 3R7WB 4EUVA 3W99C 1AIWA 3AZED 4QPRA 3PAEA 3V9RA 3RELD 4IBBA 1OMEA 2DRWA 1QO6A 3VOLA 3AL0C 1QMEA 4HHDA 4ZJ1A 4KZBA 4Z5TC 5AVEA 3FYZA 3VH5A 3KUYA 5GLCA 3IHBA 1PZRA 4Y0OA 2AROC 5CPKD 5B2IC 2M7VA 5GXQC 2Y79A 2RTSA 4BBTA 1RP5A 1NWZA 4KGCA 1V9YA 1Y4OA 2PYOB 3NECA 3MSHA 2FJ7B 4CLCD 1E6PA 1N4OA 2OAP1 1HZOA 3D3OA 4O7DA 4E6WA 3HUMA 5EOOA 3BFGA 1N9OA 2VJWA 3D72A 1VHMA 4ZBJC 3C1BD 4KENB 2XH9A 3ZVTA 4X23D 2JKTM 4ZBJB 1O07A 4LFUA 3ZG9B 1KX5B 1MKMA 1OTBA 3T4SA 4ZBEA 4P87A 5BT1C 1BLSA 4X68A 5F99D 2V8CA 3X1TD 1P34C 3MR0A 3W4QA 5E5AC 4XUJB 5B32B 2A49A 3TG9A 1S6RA 3IWIA 2ZC6B 1OJ5A 5G49B 3AZMB 3AZJA 4C3QA 1NRJA 3RXWA 1LI9A 4X69A 5J8XA 3A6ND 3EPHA 3QHYA 5TJJA 1HLUP 5GSUC 1VM1A 1F66D 1VQQA 3AV1B 3CHWP 3BFEA 1KE4A 4GZBA 1P3PB 2W3HA 4P6ZM 4FOFA 3C30A 1CK7A 4NG2A 1ID3B 4QU3A 4DKIA 3C1CD 5B2JA 2NQBC 3OPRA 4L9GA 3EQUA 3W96C 2MJ6A 2HDUA 3IXBA 1CXWA 5KDMA 4PAUA 2GJ3A 4Z1WA 3W96B 2ZC4B 3AZGA 1BULA 4LENA 1YU2A 4NE3A 3UE1A 4DN0A 3WS5A 3PBNA 1P3FB 2WADA 1P3BD 2ZL1B 3MMHA 2FN2A 1G6OA 4H9SC 3QP5A 2INWA 3T50A 4BQMA 1GSWA 2F2AC 4XZQD 2HDQA 3VH5T 5B1MA 3QNBA 3BM6A 4GHAA 1KX3A 4UA6A 3V67A 5HSQA 1O7EA 2O99A 4Z2KA 2B18A 1HQ3A 4OQHA 4B4ZA 3MGRB 3AZKA 3BY8A 2XA7M 3IS2A 1IOUA 1S1YA 5B40B 2VZWA 1ESIA 3IT9A 3GECA 1OTIA 1VETB 4Z66A 5FA7A 4GD6A 3R45B 1H0GA 1RGYA 3ICYA 4JJNA 2EXAA 4LCMA 4Q0HA 3AZID 4IBRA 5JA4B 5AV6A 3BQ8A 4R8PB 1P3KD 4IUKA 3T12B 3KWQD 4WU8D 1L0FA 3WA9A 1D06A 4GOGA 1M19A 3DTMA 5AV9A 3WAAD 2C5WB 2VLGA 2NZDD 4MCWA 4J8UA 1Z2CB 2IA2A 5CHJA 1M1AC 1YLPA 5HPIA 3REID 2EFXA 2WGWA 1CEFA 3LIEA 5AY8B 5B1LA 1SDEA 4KZ6A 1TAFB 3P7NA 3ITAA 3REHD 2UWXA 4E44A 3FG8A 3ZNTA 3HREA 4I3AA 5AV5C 4OOMA 4I5SA 3UTAD 5HWTA 1XX2A 3AZLD 4YOFA 2Q9MA 3C2WA 1XJ4A 2ZJ9A 3AYWC 2OLUA 5FI2A 3WWXA 3W97C 3L9KA 1BSGA 3AZND 3T4LA 3W97B 4KG6A 4NYYA 4DE2A 4J8WC 2X02A 4MN7A 4DE1A 3B6GC 3KS8A 1H0IA 4GDNA 5E2HA 1XA1A 1SKFA 4ZUXD 1P3GC 3X1VD 4XT2A 3LJAB 4YS3C 3X1SC 2Y2LA 3E2KA 2GDNA 5EV0A 1U35C 4R3JA 3NIAA 1W1TA 3L25A 4KZ3A 4WV4B 3UT9C 2PR5A 4J8VC 3NDGA 2F8NB 5AVBC 4OPZA 4QNLA 3P09A 2V5OA 3BYDA 5C3IC 1L0EA 5CPJB 3KSHA 3AGDA 5EUAA 2W27A 5CP6C 5TBMA 5IU1A 2ZC7A 2A3UA 1KGEA 3LELC 2RVQD 2G2UA 3B6FB 3PBQA 2LY8A 3M6HA 1G6AA 4Z9QA 2G5HC 1K38A 4IBGA 2PD8A 3EEHA 5AQ7A 4HBUA 1ZKJA 1EWZA 1F5MA 4XXRA 1KX4D 4EO5B 4BBUA 5GT0A 3IX3A 4WYYA 3WD3A 5F1FA 3W4PA 3O62A 3MXRA 5HDDA 2JBFA 4CSRB 2BASA 3AV2D 4FTXA 4X55A 1SCWA 3GMWA 3OCLA 4Y7PA 1S32C 1KE3A 1WYBA 2V20A 3KXBB 3IWQA 2XSSA 1S32B 3PHYA 1AOIC 5BOHA 4CPKA 3IHAA 3NI9A 4I3JA 3LR4A 1BT5A 5LBRA 4CAYA 1UR9A 2CWEA 3W98C 1K55C 2Y2KA 1X0OA 2XEPA 3UE3A 5DFYA 1MWUA 3AZFC 3IP4C 1BH8B 4L9EA 5JRGC 3X1UA 1PWCA 5EVIC 2QHKA 4NZ3A 3WS1A 3KUYC 1BH9B 3UO9A 3KUYB 1H5XA 4JXVA 3RTYA 2J7VA 1IYQA 3P5JB 3PR6A 2JHEA 4UA9A 2XR0A 3C7UA 4KGCC 4EWFA 3AZHB 5EOEA 5DFXA 4LRXC 2PYOD 2W3FA 4R6LA 2FJ7D 5AVCA 1W2EA 4R23A 1ES2A 2AROA 3TRCA 1C3BA 1XA7A 5B2IA 4B93A 5GXQA 2V8FA 1OTDA 2M7UA 3SOIA 1NY0A 4HP4A 3MFDA 1R4VA 4RYEA 3ZYTA 2BTFP 4CQHA 2EX9A 5EVLA 1KX5D 3QP1A 4OOLA 3WS0A 4JLFA 4IBKA 4IUHA 4HGAB 3QP4A 5BT1D 3WTPA 1ES4A 3HLBA 3AFAA 3KYQA 4OJ6A 2O9AA 3TJZC 4XUJD 1LI0A 5B32D 3G6OA 1F2KA 3MGSC 4FCFA 4NE5A 3VH6A 1P9WA 3AZJC 3AZMD 2HF6A 3UN7A 5CPIA 1G5UA 3AZJB 3EOIA 2O9BA 3AV1D 1P3PD 1S67L 2JE5A 2O9CA 3CWFA 4MBKA 3N8RA 3DBAA 3LCEA 2V9AA 3A3DA 3REJC 3G35A 2NUPC 5GSUA 3E4QA 1ID3D 4HH3A 1N9NA 1XFNA 5B2JB 4G92C 5CRFA 1TD5A 2Y2PA 2NUTC 1MY8A 5KDMB 3PTEA 3AZGB 5AV8B 4I38A 4A5RA 1LL9A 2NQBA 2HIOD 1P3FD 4S2JA 4WLAA 3UTBC 1ALQA 4H9QB 5L07A 3LEQA 1H3OA 5FASA 1GHPA 5B1MC 1GOIA 3VMAA 4WF0A 1E6ZA 2YFWB 2YFVA 4H9SA 1KX3B 3JYIA 1HQ3C 4X56A 1B67A 4MEZA 4NK3A 1PIOA 2WKEA 3MGRD 5GL9A 5TR7A 1NLYA 3AGFA 4QJGA 3AZKB 3IS2B 3OPPA 5B40D 4YM6B 4J8XC 1EAKA 4Z66C 3EG5B 1KDWA 2PD7A 3E98A 4Z66B 3BFCA 1ZLAB 4U3TA 2Z6DA 4U0TA 1P9RA 4R1GA 3FPVA 1DP8A 3MGPA 4JJNB 5AV6C 1ES3A 1TS8A 4R8PD 2XF3A 4NXFA 1P3OB 3SW1A 1M19C 3CG5A 5AV9C 3WA9B 3T1XA 5U47A 1EQZB 2Y8HA 1PNEA 3IF6C 4BL3A 4K91A 4J8UB 3S7NA 1BLPA 4Y0TA 4B9OA 4KUKA 5AY8D 5B1LC 2WGWB 3K3CA 1TZYA 4P0MA 3TU4C 4EBLA 2DF4C 2H5SA 1YQSA 1AWIA 2QYBA 3MBZA 1M1AA 4O0PA 2ZY3A 1SDNA
chains in the Genus database with same CATH topology
1P3AC 3UDIA 5AV5A 1MPLA 2CV5C 3MGQB 4P85A 2XD5A 3AN2B 3VH6W 2BYKA 3B0CW 4OJPA 4KG2A 2R9XA 1NRFA 3LZ0C 3L26A 5E2FA 3LJAD 4LV2A 4J8WA 1IEMA 3B6GA 5B31B 2OV5A 1N9BA 4OQGA 2L5AA 2F8ND 2F8NG 1U60A 1DJBA 1P3GA 5DNNC 5CPJD 4EBNA 4YS3A 3X1SA 1U35A 1RCJA 5DTSA 3UT9A 3VFHA 4J8VA 3B6FD 5AVBA 4PM5A 4HESA 4C6YA 3Q1FA 1K6SA 4H9OA 2WKIA 4OOYA 5CTNA 2VGKA 5FAOA 4S2IA 3O62C 3VP3A 5GT0B 3F6TA 5CEDA 1M18B 4S2MA 3Q07A 4RX2A 5A90A 3UPNA 1CI9A 2CC1A 1JWVA 2EFUA 3KXBD 4OJLA 5IHVA 2Z2LB 4QY6A 1LLBA 3MNNB 1KGFA 4N9LA 3HVFA 5B33C 5B24C 1BTLA 1YLWA 1AOIA 5AQAA 2BYMA 4C75A 3FKWA 1YLTA 4QLCC 2DCFA 3GRJA 3WRTA 3W98A 5FUGA 1K55A 4KZ4A 4IBEA 3X1UB 1RGZA 3W99B 4EBPA 3G4PA 3AZFA 5JRGA 4OLDA 1P3LA 5EVIA 3D4FA 4WU9C 3A1KA 4ZAMA 4ZJ2A 3AZHD 4Z5TB 3WTPE 1A7WA 5AVCC 3SS3A 2QMIA 5G18A 5AVCB 1YMSA 2AROB 2Q9NA 1W7FA 5B2IB 4OH0A 5F82A 5GXQB 5CEBA 4WELA 5FI7A 1ES5A 1XPBA 3DWZA 2HDSA 2JC7A 3LY3A 2EXBA 4E3NA 2XQZA 3WTPC 1P3MC 3Q81A 4Q8IA 3AFAC 3ZDJA 3AFAB 3VSLA 2JCHA 5CPKA 1WE4A 5CPIC 2P9VB 1K54C 3GQZA 1P34B 2WZXA 2Y55A 3MGSA 5B0YC 3BFDA 5E5AB 3LO7A 3GR2A 3REKC 5DNMC 5FQJA 3FKVA 2P74A 5GSUB 3ZFZA 3BLSA 3UY6A 5B2JD 2HDRA 1ERQA 3REJA 3AZGD 5AV8D 2HP6A 2NQBB 4IBIA 1H8YA 5FDHA 2XFTA 3CJMA 4KHAA 4OPQA 4WEJA 5HAQA 4UA7A 1F66A 3UTBA 5FAPA 1KX3D 4RA7A 3V3RA 1NJ4A 1K6RA 3Q82A 3AZKD 3C1CA 2J8YA 5B0ZA 4YM6D 1FQGA 2Y59A 3HLWA 4F94A 5JYOA 4Z66D 3V39A 1ZLAD 3HUOA 4P6BA 5CERA 4N9KA 1GHMA 3UNWA 3BRMA 3ZG5A 3PBRA 3MGPC 1WWIA 4JJND 4J8XA 1BUEA 3O3VA 1YLZA 1P3BA 4D2OA 3MGPB 3LEZA 3ITBA 3LZ1A 3S4XA 1TEMA 4S2NA 1P3OD 3N8SA 1XGJA 2Y91A 3WA9D 3ZVWA 3VH5W 4QD4A 2Y2IA 1EQZD 3OC2A 4JKTA 4Y0UA 4J8UD 2HUEC 3V50A 1TZYC 4ZJ3A 5CHUA 4S2LA 1YM1A 1K4EA 3IF6A 3C5AA 4UPKA 5BNVA 1M1AB 1YU0A 4MBHA 3TU4A 4IBFA 1YU1A 1HD8A 5BO0B 2H0TA 3DW0A 4ID4A 5AV5B 3MGQD 1PW1A 3AN2D 4WNNA 1P3AA 4WU8A 2BYKB 3DWKA 3AYWB 3WAAA 4K0XA 2CV5A 1M6KA 3SS4A 4J8WB 5B31D 3B6GB 1W5DA 5B31G 3REHA 4UAAA 5GLAA 3LZ0A 1I5QA 4KUDC 1GHIA 3OPHA 2IO5C 4N1HA 5HARA 3UTAA 3CZDA 1SHVA 1P3GB 1YLJA 3AZLA 4YS3B 2ZY2A 3X1SB 3IXDA 4DF6A 1U35B 2ZQ7A 1FR6A 1CEGA 1JTDA 4X53A 3UT9B 3WKJC 2EX6A 4J8VB 3HLCA 2B5RA 5DNNA 5AVBB 3S1YA 3FZCA 5CGXA 4G91C 5C3IB 3NC8A 5CP6B 5E2GA 4IBJA 2W8SA 4NZ1A 3MVDC 1TDGA 3LELB 4E3LA 5GT0D 1Y54A 3WRZA 3X1VA 3L28A 1M18D 1DJCA 2VQRA 3O87A 3NCKA 3H0LC 1WWSA 3KS4A 3MNND 1FR1A 2H0YA 1NZOA 3A3EA 2X71A 2ZLYA 3MZEA 2ZY5A 3IQAA 4LG2A 2Y4AA 4IVIA 1AOIB 3V3SA 2BYMB 4WBGA 5B33A 2J9OA 1PZOA 5B24A 1FCMA 1K57A 3L29A 1KX4A 3X1UD 3W98B 3B0DC 1E4DA 3W99D 1DJAA 3V9RB 4QLCA 4U0XA 3VOZA 1P3IC 3AZFB 1P3LC 2ZM0A 5JRGB 4JF4A 4Z5TD 5EVIB 2BLSA 1BFMA 4R0QA 3N4IA 3ZG7B 5KMWA 5AVCD 5CHLB 2AROD 3NBLA 4IJEA 5B2ID 4WU9A 5GXQD 4KGCB 4OQIA 3TOIA 4BD0A 3RELC 1IELA 3HBRA 4AWLC 4BLMA 3G2YA 3AFAD 4YFMA 5CPKC 1QMFA 2Y2GA 3BEBA 1M40A 1P3MA 3RXXA 1P34D 4DXCA 4GKUA 5B32G 5E5AD 3S22A 3MGSB 5BS7A 1K54A 5FQQA 5GSUD 3C1BC 2V1ZA 5B0YA 4X23C 4E3MA 2WKHA 4OJ5A 3REKA 5DNMA 4DXBA 3REJB 3N8LA 5F99C 3X1TC 3MZFA 3NQJA 2NQBD 3SS5A 3W96D 3MKEA 4G92B 2Y2OA 3SH7A 1K56A 5G49A 1S0WA 5DTTA 3A6NC 4KHAB 1F66C 5HL1A 3AV1A 4WMCD 1P3PA 2J9PA 4MNRA 4FSFA 3UTBB 2X01A 1NXYA 4LV3A 5B1MB 1ID3A 3C1CC 5B0ZC 1Q9CA 5B0ZB 1HQ3B 2ZQ9A 3BLMA 3M2JA 1TVFA 2HIOA 5CTMA 1P3BC 3MGPD 3ZGAB 4J8XB 3LZ1C 4S2NC 3LZ1B 4XZQC 4FH2A 3B3XA 5M18A 5GLBA 1BZAA 4DDYA 1NYMA 1E3UA 2Y2NA 5AV6B 3VP0A 3UPOA 3A1IA 3ZCZA 1CK3A 4PM8A 3MGRA 3WS2A 1T3UA 3E2LA 5HX9A 1M19B 5AV9B 3KSYA 2ZQDA 2OSUA 3IF6B 1KVMA 2JSSA 1M1AD 3UDXA 3VP4A 4OJOA 3IH8A 5B1LB 4YINA 4KQOA 3TU4B 1MKIA 3AZIC 2XDMA 4GH9A 3O86A 5FQIA 5AV5D 1MWSA 4ZTKA 4WU8C 4OP8A 2J8PA 1P3AB 4H9NA 4E6XA 3HL9A 1IKIA 4KZ9A 3WAAC 3AYWD 1EROA 2NZDC 1MWRA 4QB8A 3W97D 1YMXA 2V2FF 3REIC 4DQYB 2CV5B 4WZ5A 5KSHA 3BECA 4IJFA 4M6BA 4J8WD 3ZG0A 3B6GD 3REHC 4GHLA 4IBDA 3UTAC 4OONA 3LZ0B 1P3GD 3EPKA 3AZLC 4YS3D 5GT3A 3X1SD 4E3OA 1U35D 3W4OA 3G32A 3UT9D 2RCXA 5EE8A 3O88A 4XUXA 4J8VD 4JF5A 4KUDA 3ZG8B 5AVBD 3AZNC 5DNNB 3A3FA 4PM6A 5CP6D 5FAQA 4GNUA 3WKJA 3LELD 3G34A 4Z2MG 4DDSA 4ZUXC 4OP5A 1EI5A 3X1VC 4S2KA 3VP1A 3MVDA 5CGSA 1HTAA 4WJ3C 2F8NA 3M2KA 1YU3A 3O62B 3NQUA 1LL5A 5BNXA 3WX7A 4N92A 2RVQC 1S32D 4QHCA 4DE3A 4WEKA 3FDDA 3UDFA 5HAPA 1AOID 4ZDXA 4QY5A 2ZC3B 1K57C 5B33B 1KX4C 4CAYB 5B24B 1IYPA 3W98D 3N3FA 5EECA 3G30A 3HLFA 4LD9A 3AV2C 2WGVA 4QLCB 3AZFD 4R4RA 5JRGD 1NZUA 5EVID 4KG5A 4RX3A 3KUYD 1JFIA 1IYSA 3GSGA 2Y2MA 1P3IA 4B88A 4KGCD 4WU9B 4NZ5A 4PM7A 1BLCA 2EX2A 5FI6A 1KGGA 1BH8A 5TGFA 3SH9A 4UUZA 3IWOA 3AZEA 1BH9A 2PU4A 3RELA 1KE0A 1FCNA 1XXMA 1K4FA 3EPLA 2WZZA 3P98A 4OPRA 4LV0A 2IWCA 5KZHA 1PWDA 3AZHA 3WTPB 1WYCA 2PYOC 2Y2HA 1P3MB 2FJ7C 4JXWA 3FWLA 4PPRA 4XUZA 4EV4A 3MGSD 2G2WA 5BS7C 3AZJD 3EPJA 4GDBA 5CPIB 2WUQA 5GLDA 4JBFA 4IEDA 1KX5C 5B0YB 2XFSA 2XD1A 3REJD 4H9PA 3REKB 5DNMB 3C1BA 4X23A 4JXGA 4XUJC 3PAGA 5B32C 3NQJB 5BPVA 4M3KA 3OPLA 3AZMC 5F99A 2QPNA 2WGIA 3X1TA 1JTGA 5DF7A 3AV1C 3H0MC 1P3PC 3UTBD 4BL2A 1JWZA 1ULYA 5EPHA 1H3OB 5D3OA 4LV1A 3A6NA 1ID3C 5B1MD 2YFVB 5B0ZD 1HQ3D 3HLGA 3A3IA 4GN2A 5AV8A 5E2EA 4S2OA 2HIOC 1P3FC 4RVAA 2Y2QA 1XGIA 2HIOB 4J8XD 4H9QA 4JPMA 5FSRA 4IBXA 4E3IA 3LZ1D 3MKFA 3H0RC 3HONA 4NYUA 4OLGA 2YFWA 5AV6D 3IH9A 3BFFA 2E8IA 2DNSA 3EQVA 3MGRC 4XZQA 5GHYA 3L27A 1J9MA 1M19D 5AV9D 1H8ZA 5B40C 4YM6A 1FSWA 2HUEB 1ZLAA 5B1LD 1TZYB 3TU4D 5DTKA 1F1EA 3GVBA 3IXGA 1ESUA 4R8PC 1FSYA 1W8QA 1P3OA 1P3AD 2WAFA 3CMZA 3AZIA 5HW3A 2ZQ8A 1W79A 4H9NB 1EQZA 2RL3A 1CI8A 1P3KA 2CV5D 3KWQA 3HLDA 4WZ5C 4E3KA 5AY8C 5CGWA 3V5MA 2ZM8A 5TFQA 4BENA 2NZDA 1ZC2A 3FV7A 1IYOA 3REIA 3LZ0D 5GT3C 1AXBA 4OPYA 3NY4A 5GT3B 4H9RA 3M6BA 3Q7ZA 3LY4A 4KUDB 2IO5B 5DNND 3MGQA 5FQMA 3I7JA 3AN2A 4HEFA 5FQ9A 3WKJB 3RJUA 2I72A 3AZNA 3VOYA 1TDLA 3LJAC 4G91B 3MXSA 5A92A 4H9OB 3OZHA 5B31A 1MBLA 3MVDB 4ZUXA 3GTCA 5CPJC 3O62D 2PU2A 1K25A 2R9WA 3NQUB 5BNXB 3Q7VA 3B6FC 2XGNA 1PZPA 1ZG6A 2ZMAA 1MWTA 4S2PA 5B33D 4EO5C 5B24D 5GHXA 3G2ZA 3VSKA 2FFYA 4LD9C 1M18A 4BJPA 4QLCD 2Y2JA 4NFTA 4LD9B 3PBSA 5FUGB 3KXBC 5A91A 1N1JA 2FFFB 4K0WA 3B0DB 4DRBA 4DRTA 3MNNA 3C7VA 3AV2A 1JFIB 1PYYA 2H10A 2XK1A 1P3IB 2IWBA 1P3LB 4WU9D 1XP4A 1ONGA 1L0DA 3HLEA 3SH8A 2ZC5B 4NY2A 4FD8A 3AZEC 1HTZA 4MLLA 4PM9A 3W99A 4UUZB 3AZEB 4OVDA 4GD8A 3RELB 5HAIA 4DRAA 4AWLB 2IOUA 3AZHC 3C4OA 3WTPD 1KDSA 4Z5TA 1E25A 2HP5A 1B6WA 3A3JA 1P3MD 1Q2QA 5A93A 5M19A 1Q2PA 1L0GA 1DY6A 5CHMA 5CPKB 4JXSA 3N6IA 5CPID 2PYOA 2FJ7A 1JWPA 4WZSB 5B0YD 4KZAA 5DF9A 4HGAC 2DQNC 2HPBA 3REKD 5DNMD 4H9PB 1ERMA 3C1BB 1KX5A 4X23B 1YT4A 2RIQA 1PW8A 2QZ6A 2P9VA 1YU4A 1K56D 5F99B 5DVAA 3X1TB 4JF6A 1P34A 4E3JA 4XUJA 5B32A 2BG1A 4CJNA 5E5AA 3MZDA 1L2SA 3AZMA 3N7WA 3KFUG 1KU5A 1JVJA 5KSCA 3A6NB 1PWGA 1F66B 1MXOA 5B2JC 3L2AA 3PBTA 3IXHA 3FKEA 3AZGC 5CXWA 5AV8C 1ZG4A 1I2WA 3C1CB 3ZNYA 1KVLA 3WS4A 4IVKA 2OLVA 3W96A 3B0BA 4WZ4A 1IKGA 1GA0A 1G68A 2ZD8A 2IWDA 4KZ5A 4WM9A 1P3FA 4X6TA 1KX3C 4WMCA 1P3BB 1E3UD 4EUZA 5JYPA 3TSGA 1GCEA 2EX8A 5AQ9A 4XZQB 3OCNA 3AZKC 5AQBA 5HFOA 4YM6C 1ZLAC 1BLHA 2ZM5A 1TZYD 1PI5A 1GA9A 5B40A 4JJNC 1LHYA 1PI4A 1XKZA 4BD1A 3HUNA 3R45A 3NDEA 5BNVB 3UPPA 5DF8A 3IF5A 1P3OC 4R3BA 3WA9C 2XLNA 1ONHA 2ZQCA 1EQZC 5JA4A 3AZIB 5CECA 4R8PA 2ZQAA 1P3KC 4J8UC 4L0LA 4MBFA 3KWQC 1P3KB 3VH6T 4WNNB 4WU8B 3KWQB 2ZY4A 3B0CT 2F8NK 2HP9A 1HVBA 4N1XA 3WAAB 2C6WB 2NZDB 3REIB 5AY8A 3HSHA 1TAFA 2VGJA 5GT3D 4KZ8A 5FQKA 3REHB 1FOFA 5BO0A 5GHZA 4KQQA 4H9RB 4KUDD 3MGQC 3UTAB 3AN2C 3ISGA 4DE0A 4H8RA 3AZLB 4HBTA 4LCLA 3AYWA 3WKJD 4IBCA 3W97A 3AZNB 4NE6A 2F8NH 3UE0A 5B31C 2G5IC 1W8YA 5I94A 3MVDD 3W8KA 4R4SA 4ZUXB 3LJAA 2PBYA 3VFFA 3X1VB 4Z2MH 1FCOA 5FATA 1YLYA 4B4XA 3GV9A 5E43A 3Q7VB 2Z2MB 5CPJA 1Z6FA 4GB7A 4E45A 4OKPA 5F1GA 2WYXA 3AGEA 5CP6A 3G31A 4KZ7A 4NETA 2ZM2A 3B6FA 4UHUA 3LELA 1YUEA 5GT0C 5M1AA 3ZHHA 1M18C 4OQ0A 2WK0A 4LD9D 2WAEA 3PBOA 1KX4B 5L2FA 1N1JB 3MNNC 4CSRA 1I2SA 3C4PA 4PMAA 3AV2B 4FH4A 1P3ID 1P3LD 3KXBA 1S32A 4NZ4A 4EQIA 4OUIA 3QNCA 5F83A 1NYYA 3VP2A 3X1UC 4KQRA 3W99C 3AZED 3PAEA 3V9RA 3RELD 4IBBA 1OMEA 2DRWA 3AL0C 1QMEA 4ZJ1A 4KZBA 4Z5TC 3FYZA 3VH5A 3KUYA 5GLCA 3IHBA 1PZRA 4Y0OA 2AROC 5CPKD 5B2IC 5GXQC 1RP5A 4KGCA 2PYOB 2FJ7B 1N4OA 1HZOA 4O7DA 4E6WA 3HUMA 5EOOA 3BFGA 4ZBJC 3C1BD 4KENB 2XH9A 3ZVTA 4X23D 4ZBJB 1O07A 3ZG9B 1KX5B 4ZBEA 4P87A 5BT1C 1BLSA 4X68A 5F99D 3X1TD 1P34C 3W4QA 5E5AC 4XUJB 5B32B 2A49A 3TG9A 1S6RA 3IWIA 2ZC6B 5G49B 3AZMB 3AZJA 4C3QA 3RXWA 5J8XA 1LI9A 4X69A 3A6ND 3EPHA 3QHYA 5GSUC 1VM1A 1F66D 1VQQA 3AV1B 3BFEA 1KE4A 4GZBA 1P3PB 1ID3B 4QU3A 4DKIA 3C1CD 5B2JA 2NQBC 3OPRA 3EQUA 3W96C 2HDUA 3IXBA 5KDMA 3W96B 2ZC4B 3AZGA 1BULA 4LENA 1YU2A 4NE3A 3UE1A 3WS5A 3PBNA 1P3FB 2WADA 1P3BD 4H9SC 4BQMA 2F2AC 4XZQD 2HDQA 3VH5T 5B1MA 3QNBA 3BM6A 4GHAA 1KX3A 4UA6A 1O7EA 1HQ3A 4OQHA 4B4ZA 3MGRB 3AZKA 5B40B 1ESIA 3IT9A 4Z66A 5FA7A 4GD6A 3R45B 1RGYA 4JJNA 2EXAA 4LCMA 3AZID 4IBRA 5JA4B 5AV6A 4R8PB 1P3KD 3KWQD 4WU8D 1L0FA 3WA9A 4GOGA 1M19A 3DTMA 5AV9A 3WAAD 2C5WB 2NZDD 4J8UA 1Z2CB 5CHJA 1M1AC 1YLPA 3REID 2EFXA 2WGWA 1CEFA 5AY8B 5B1LA 1SDEA 4KZ6A 1TAFB 3ITAA 3REHD 2UWXA 4E44A 3ZNTA 3HREA 4OOMA 5AV5C 3UTAD 1XX2A 3AZLD 2Q9MA 2ZJ9A 3AYWC 2OLUA 5FI2A 3WWXA 3W97C 1BSGA 3AZND 3W97B 4KG6A 4NYYA 4DE2A 4J8WC 2X02A 4DE1A 3B6GC 3KS8A 4GDNA 5E2HA 1XA1A 1SKFA 4ZUXD 1P3GC 3X1VD 3LJAB 4YS3C 3X1SC 2Y2LA 3E2KA 2GDNA 1U35C 4R3JA 3NIAA 4KZ3A 3L25A 4WV4B 3UT9C 4J8VC 3NDGA 2F8NB 5AVBC 4OPZA 4QNLA 3P09A 3BYDA 5C3IC 1L0EA 5CPJB 3AGDA 5EUAA 5CP6C 2ZC7A 2A3UA 1KGEA 3LELC 2RVQD 2G2UA 3B6FB 3PBQA 2LY8A 3M6HA 1G6AA 4Z9QA 2G5HC 1K38A 4IBGA 5AQ7A 4HBUA 1ZKJA 1EWZA 4XXRA 1KX4D 4EO5B 5GT0A 4WYYA 5F1FA 3W4PA 3O62A 3MXRA 2JBFA 4CSRB 3AV2D 4X55A 1SCWA 3GMWA 3OCLA 4Y7PA 1S32C 1KE3A 1WYBA 2V20A 3KXBB 3IWQA 1S32B 1AOIC 5BOHA 4CPKA 3IHAA 3NI9A 1BT5A 4CAYA 2CWEA 3W98C 1K55C 2Y2KA 2XEPA 3UE3A 1MWUA 3AZFC 3IP4C 1BH8B 5JRGC 3X1UA 1PWCA 5EVIC 4NZ3A 3WS1A 3KUYC 1BH9B 3UO9A 3KUYB 1H5XA 4JXVA 2J7VA 1IYQA 3P5JB 4UA9A 2XR0A 3C7UA 4KGCC 4EWFA 3AZHB 5EOEA 2PYOD 2FJ7D 5AVCA 1W2EA 4R23A 1ES2A 2AROA 1C3BA 1XA7A 5B2IA 5GXQA 3SOIA 1NY0A 3MFDA 1R4VA 4RYEA 2EX9A 5EVLA 1KX5D 4OOLA 3WS0A 4JLFA 4IBKA 4HGAB 5BT1D 3WTPA 1ES4A 3HLBA 3AFAA 4OJ6A 4XUJD 1LI0A 5B32D 3MGSC 4FCFA 4NE5A 3VH6A 3AZJC 3AZMD 3UN7A 5CPIA 3AZJB 3AV1D 1P3PD 2JE5A 4MBKA 3N8RA 3LCEA 3A3DA 3REJC 3G35A 5GSUA 1ID3D 5B2JB 4G92C 5CRFA 2Y2PA 1MY8A 5KDMB 3PTEA 3AZGB 5AV8B 4A5RA 1LL9A 2NQBA 2HIOD 1P3FD 4S2JA 3UTBC 1ALQA 4H9QB 1H3OA 5FASA 1GHPA 5B1MC 3VMAA 2YFWB 2YFVA 4H9SA 1KX3B 3JYIA 1HQ3C 4X56A 1B67A 4MEZA 4NK3A 1PIOA 2WKEA 3MGRD 5GL9A 5TR7A 3AGFA 4QJGA 3AZKB 3OPPA 5B40D 4YM6B 4J8XC 4Z66C 3EG5B 1KDWA 4Z66B 3BFCA 1ZLAB 4U3TA 4U0TA 4R1GA 3MGPA 4JJNB 5AV6C 1ES3A 4R8PD 2XF3A 1P3OB 1M19C 3CG5A 5AV9C 3WA9B 5U47A 1EQZB 3IF6C 4BL3A 4K91A 4J8UB 1BLPA 4Y0TA 5AY8D 5B1LC 2WGWB 1TZYA 4P0MA 3TU4C 4EBLA 2DF4C 2H5SA 1YQSA 3MBZA 1M1AA 2ZY3A 1SDNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CGW A;  3G2Y A;  3V5M A;  2ZM8 A;  5TFQ A;  3UDI A;  1N4O A;  4YFM A;  4BEN A;  1HZO A;  1ZC2 A;  3FV7 A;  1IYO A;  4O7D A;  1MPL A;  4E6W A;  3HUM A;  5EOO A;  1QMF A;  3BFG A;  2Y2G A;  3BEB A;  4P85 A;  1M40 A;  2XD5 A;  3RXX A;  1AXB A;  4OPY A;  3NY4 A;  4DXC A;  4GKU A;  2XH9 A;  4KEN B;  3ZVT A;  1O07 A;  3S22 A;  3ZG9 B;  4KG2 A;  2R9X A;  1NRF A;  3M6B A;  3Q7Z A;  4P87 A;  4ZBE A;  3LY4 A;  1BLS A;  4X68 A;  5E2F A;  5FQM A;  1K54 A;  4LV2 A;  3I7J A;  5FQQ A;  1IEM A;  3W4Q A;  2V1Z A;  4HEF A;  2OV5 A;  1N9B A;  4E3M A;  2A49 A;  2WKH A;  4OQG A;  5FQ9 A;  3TG9 A;  1S6R A;  3IWI A;  2ZC6 B;  3RJU A;  1U60 A;  2I72 A;  1DJB A;  3VOY A;  4DXB A;  3N8L A;  4C3Q A;  1TDL A;  4EBN A;  3RXW A;  5J8X A;  1LI9 A;  4X69 A;  3QHY A;  3MXS A;  5A92 A;  1VM1 A;  1RCJ A;  1VQQ A;  3MZF A;  5DTS A;  3BFE A;  1KE4 A;  3OZH A;  4GZB A;  3SS5 A;  3VFH A;  3MKE A;  1MBL A;  5JYP A;  2Y2O A;  3GTC A;  3SH7 A;  4PM5 A;  1K56 A;  1S0W A;  5DTT A;  2PU2 A;  4DKI A;  4QU3 A;  1K25 A;  4HES A;  5HL1 A;  4C6Y A;  2R9W A;  3Q1F A;  1K6S A;  3OPR A;  3EQU A;  4WMC D;  2J9P A;  2WKI A;  4MNR A;  4FSF A;  2HDU A;  3IXB A;  3Q7V A;  4OOY A;  2XGN A;  1PZP A;  1ZG6 A;  5CTN A;  2VGK A;  2ZC4 B;  1BUL A;  2ZMA A;  4LEN A;  2X01 A;  5FAO A;  1NXY A;  4S2I A;  3VP3 A;  3UE1 A;  4LV3 A;  1MWT A;  3WS5 A;  5CED A;  4S2M A;  3PBN A;  2WAD A;  3Q07 A;  4RX2 A;  5A90 A;  4S2P A;  3UPN A;  1CI9 A;  2CC1 A;  1JWV A;  2EFU A;  5GHX A;  3G2Z A;  5IHV A;  4BQM A;  2Z2L B;  2ZQ9 A;  2FFY A;  4QY6 A;  3VSK A;  1LLB A;  2HDQ A;  3BLM A;  3M2J A;  1TVF A;  3BM6 A;  3QNB A;  4UA6 A;  5CTM A;  4BJP A;  2Y2J A;  1KGF A;  1O7E A;  4N9L A;  3HVF A;  3ZGA B;  1BTL A;  3PBS A;  1YLW A;  4S2N C;  5A91 A;  2FFF B;  4K0W A;  4OQH A;  4B4Z A;  5AQA A;  4FH2 A;  4DRT A;  3B3X A;  5M18 A;  3C7V A;  4C75 A;  5GLB A;  3FKW A;  1YLT A;  1BZA A;  4DDY A;  2DCF A;  3GRJ A;  1NYM A;  1E3U A;  3WRT A;  2Y2N A;  1PYY A;  2H10 A;  2XK1 A;  2IWB A;  3VP0 A;  1ESI A;  3IT9 A;  5FA7 A;  4GD6 A;  1K55 A;  4KZ4 A;  3UPO A;  1RGZ A;  3ZCZ A;  1CK3 A;  1XP4 A;  4PM8 A;  1ONG A;  3WS2 A;  3E2L A;  5HX9 A;  1RGY A;  1L0D A;  2EXA A;  4LCM A;  2ZQD A;  3G4P A;  3HLE A;  2ZC5 B;  3SH8 A;  4EBP A;  4IBR A;  4OLD A;  2OSU A;  3IF6 B;  4FD8 A;  5EVI A;  3D4F A;  1KVM A;  4ZAM A;  4ZJ2 A;  3UDX A;  3VP4 A;  1HTZ A;  1L0F A;  4MLL A;  4PM9 A;  3IH8 A;  4YIN A;  4KQO A;  4GOG A;  4OVD A;  3SS3 A;  1MKI A;  2QMI A;  4GD8 A;  3DTM A;  5G18 A;  2XDM A;  1YMS A;  2C5W B;  3O86 A;  5HAI A;  5FQI A;  2Q9N A;  1W7F A;  1MWS A;  4OH0 A;  5CHJ A;  5F82 A;  1YLP A;  5CEB A;  3C4O A;  4ZTK A;  1KDS A;  2EFX A;  1E25 A;  2WGW A;  4WEL A;  2HP5 A;  5FI7 A;  1CEF A;  3A3J A;  1Q2Q A;  4OP8 A;  5A93 A;  1ES5 A;  1SDE A;  4KZ6 A;  1Q2P A;  1L0G A;  5M19 A;  4E6X A;  3HL9 A;  1IKI A;  4KZ9 A;  3ITA A;  1DY6 A;  2UWX A;  1XPB A;  1ERO A;  3DWZ A;  1MWR A;  2HDS A;  4QB8 A;  2JC7 A;  3ZNT A;  5CHM A;  3HRE A;  4OOM A;  3LY3 A;  1YMX A;  2EXB A;  4E3N A;  4JXS A;  2V2F F;  2XQZ A;  3N6I A;  4WZ5 A;  1XX2 A;  5KSH A;  3BEC A;  3Q81 A;  4Q8I A;  2Q9M A;  1JWP A;  3ZG0 A;  2ZJ9 A;  3ZDJ A;  2OLU A;  4KZA A;  5FI2 A;  5DF9 A;  3VSL A;  3WWX A;  2JCH A;  1WE4 A;  4OON A;  2HPB A;  1BSG A;  2P9V B;  4KG6 A;  1K54 C;  3GQZ A;  4DE2 A;  4E3O A;  2X02 A;  2WZX A;  1ERM A;  4DE1 A;  2Y55 A;  3W4O A;  3G32 A;  3BFD A;  1YT4 A;  2RCX A;  5EE8 A;  3O88 A;  4XUX A;  3LO7 A;  4GDN A;  4JF5 A;  5E2H A;  1XA1 A;  1SKF A;  3ZG8 B;  3GR2 A;  1PW8 A;  2QZ6 A;  5FQJ A;  3A3F A;  2P9V A;  1K56 D;  4PM6 A;  3FKV A;  4JF6 A;  2P74 A;  5DVA A;  5FAQ A;  2Y2L A;  3E2K A;  2GDN A;  4R3J A;  3ZFZ A;  4E3J A;  3BLS A;  3NIA A;  4KZ3 A;  3UY6 A;  4GNU A;  2HDR A;  1ERQ A;  2BG1 A;  3G34 A;  4CJN A;  3NDG A;  4DDS A;  3MZD A;  1L2S A;  4OPZ A;  3N7W A;  3P09 A;  3BYD A;  2HP6 A;  4OP5 A;  1L0E A;  1EI5 A;  4S2K A;  3AGD A;  1JVJ A;  5EUA A;  5KSC A;  3VP1 A;  1PWG A;  2ZC7 A;  1KGE A;  1MXO A;  2A3U A;  5CGS A;  1H8Y A;  3IXH A;  3PBT A;  2G2U A;  5FDH A;  3M2K A;  3PBQ A;  2XFT A;  3CJM A;  3M6H A;  1G6A A;  5CXW A;  4Z9Q A;  1K38 A;  4OPQ A;  1ZG4 A;  4WEJ A;  5HAQ A;  1I2W A;  1LL5 A;  4UA7 A;  3ZNY A;  5AQ7 A;  1KVL A;  4HBU A;  5FAP A;  3WS4 A;  4N92 A;  1ZKJ A;  4IVK A;  2OLV A;  1EWZ A;  4XXR A;  4WZ4 A;  1IKG A;  1GA0 A;  4RA7 A;  4QHC A;  4DE3 A;  4WEK A;  3V3R A;  1G68 A;  2ZD8 A;  1NJ4 A;  4WYY A;  2IWD A;  3UDF A;  5F1F A;  3W4P A;  3MXR A;  4KZ5 A;  5HAP A;  4WM9 A;  4ZDX A;  2JBF A;  4QY5 A;  4X6T A;  1K6R A;  3Q82 A;  4X55 A;  2J8Y A;  2ZC3 B;  1SCW A;  1FQG A;  1K57 C;  3GMW A;  1E3U D;  3OCL A;  4WMC A;  4Y7P A;  2Y59 A;  3HLW A;  4EUZ A;  4F94 A;  5JYO A;  1KE3 A;  1WYB A;  1IYP A;  2V20 A;  3V39 A;  3IWQ A;  3TSG A;  3HUO A;  4P6B A;  3G30 A;  1GCE A;  2EX8 A;  3HLF A;  4N9K A;  5EEC A;  5AQ9 A;  5CER A;  4CPK A;  5BOH A;  1GHM A;  3IHA A;  3BRM A;  3OCN A;  3UNW A;  3ZG5 A;  3PBR A;  3NI9 A;  5AQB A;  5HFO A;  2WGV A;  1BT5 A;  3O3V A;  1BUE A;  4R4R A;  1YLZ A;  4D2O A;  3LEZ A;  3ITB A;  1NZU A;  5EVI D;  3S4X A;  1TEM A;  1K55 C;  4KG5 A;  2Y2K A;  1BLH A;  4S2N A;  4RX3 A;  3N8S A;  1IYS A;  3GSG A;  1PI5 A;  1XGJ A;  2Y91 A;  2XEP A;  3ZVW A;  1GA9 A;  3UE3 A;  4QD4 A;  2Y2I A;  1MWU A;  2Y2M A;  1PI4 A;  1LHY A;  3OC2 A;  4JKT A;  1XKZ A;  4BD1 A;  4Y0U A;  3HUN A;  3NDE A;  4B88 A;  3UPP A;  1PWC A;  5EVI C;  3V50 A;  5DF8 A;  3WS1 A;  3IF5 A;  4PM7 A;  1BLC A;  4ZJ3 A;  5CHU A;  3UO9 A;  4R3B A;  2EX2 A;  5FI6 A;  2XLN A;  4S2L A;  1ONH A;  2ZQC A;  1YM1 A;  1H5X A;  1KGG A;  4JXV A;  1K4E A;  2J7V A;  1IYQ A;  3IF6 A;  5CEC A;  2ZQA A;  3C5A A;  4UA9 A;  4L0L A;  4MBF A;  2XR0 A;  3C7U A;  4EWF A;  5TGF A;  3SH9 A;  3IWO A;  5EOE A;  4MBH A;  2PU4 A;  2HP9 A;  1HVB A;  4R23 A;  1KE0 A;  1ES2 A;  1FCN A;  1C3B A;  4N1X A;  1HD8 A;  1XA7 A;  2C6W B;  1XXM A;  1K4F A;  2WZZ A;  3P98 A;  4OPR A;  2H0T A;  4LV0 A;  3DW0 A;  4ID4 A;  2IWC A;  3SOI A;  5KZH A;  1NY0 A;  1PWD A;  1PW1 A;  3MFD A;  1WYC A;  4RYE A;  2Y2H A;  2VGJ A;  4JXW A;  3FWL A;  4KZ8 A;  4PPR A;  2EX9 A;  3DWK A;  4XUZ A;  5EVL A;  4EV4 A;  5FQK A;  1FOF A;  5GHZ A;  4KQQ A;  4OOL A;  4K0X A;  3WS0 A;  4JLF A;  2G2W A;  4GDB A;  1M6K A;  3ISG A;  4DE0 A;  4H8R A;  3SS4 A;  1ES4 A;  2WUQ A;  3HLB A;  5GLD A;  4JBF A;  4IED A;  4HBT A;  1LI0 A;  4LCL A;  1W5D A;  4UAA A;  4FCF A;  5GLA A;  2XFS A;  2XD1 A;  1I5Q A;  1GHI A;  3OPH A;  4N1H A;  5HAR A;  3CZD A;  1SHV A;  3UN7 A;  1YLJ A;  3IXD A;  3UE0 A;  4JXG A;  4DF6 A;  1JTD A;  2ZQ7 A;  1FR6 A;  1CEG A;  1W8Y A;  3PAG A;  4X53 A;  2JE5 A;  5I94 A;  3W8K A;  4MBK A;  3N8R A;  2EX6 A;  4M3K A;  3HLC A;  3LCE A;  3OPL A;  2B5R A;  4R4S A;  3A3D A;  2WGI A;  3S1Y A;  2QPN A;  2PBY A;  3FZC A;  5CGX A;  3VFF A;  3G35 A;  1JTG A;  5DF7 A;  3NC8 A;  1FCO A;  5E2G A;  4BL2 A;  5FAT A;  1TDG A;  1JWZ A;  1YLY A;  4B4X A;  5CRF A;  3GV9 A;  5E43 A;  4E3L A;  5EPH A;  2Y2P A;  3Q7V B;  1MY8 A;  2Z2M B;  3PTE A;  1Z6F A;  5D3O A;  4LV1 A;  1Y54 A;  4GB7 A;  4OKP A;  3WRZ A;  5F1G A;  2WYX A;  4A5R A;  3AGE A;  1LL9 A;  3G31 A;  1DJC A;  3O87 A;  4KZ7 A;  4NET A;  4S2J A;  2ZM2 A;  3NCK A;  1ALQ A;  4UHU A;  3HLG A;  3A3I A;  4GN2 A;  5FAS A;  5M1A A;  1GHP A;  3VMA A;  3ZHH A;  5E2E A;  4S2O A;  1FR1 A;  4OQ0 A;  2WK0 A;  4RVA A;  2Y2Q A;  2H0Y A;  1XGI A;  2WAE A;  1NZO A;  3A3E A;  3JYI A;  3PBO A;  2X71 A;  4X56 A;  4JPM A;  5FSR A;  2ZLY A;  3MZE A;  4MEZ A;  4IBX A;  3IQA A;  4NK3 A;  4E3I A;  5L2F A;  1PIO A;  2Y4A A;  2WKE A;  3MKF A;  4IVI A;  5GL9 A;  5TR7 A;  1I2S A;  3AGF A;  4OLG A;  3V3S A;  4QJG A;  3C4P A;  4PMA A;  4WBG A;  2J9O A;  3OPP A;  4FH4 A;  1PZO A;  1FCM A;  3IH9 A;  3BFF A;  2E8I A;  1K57 A;  1KDW A;  2DNS A;  3EQV A;  1E4D A;  3BFC A;  4U3T A;  5GHY A;  1DJA A;  1J9M A;  4U0T A;  4EQI A;  4R1G A;  1H8Z A;  3QNC A;  4U0X A;  3VOZ A;  5F83 A;  1NYY A;  1ES3 A;  2ZM0 A;  3VP2 A;  1FSW A;  4JF4 A;  4KQR A;  5EVI B;  2BLS A;  2XF3 A;  4R0Q A;  3N4I A;  3PAE A;  3ZG7 B;  5DTK A;  3CG5 A;  5KMW A;  1OME A;  2DRW A;  3GVB A;  5U47 A;  3IXG A;  3NBL A;  1ESU A;  3IF6 C;  4BL3 A;  1QME A;  4ZJ1 A;  4K91 A;  4KZB A;  1FSY A;  1BLP A;  4Y0T A;  3FYZ A;  4OQI A;  3TOI A;  1W8Q A;  2WGW B;  4P0M A;  2WAF A;  4BD0 A;  3CMZ A;  4EBL A;  5GLC A;  3IHB A;  1IEL A;  5HW3 A;  2ZQ8 A;  4Y0O A;  1W79 A;  2H5S A;  1YQS A;  3HBR A;  2RL3 A;  4BLM A;  1CI8 A;  3MBZ A;  1RP5 A;  3HLD A;  4WZ5 C;  4E3K A;  1SDN A; 
#chains in the Genus database with same CATH topology
 1P3A C;  4F3L B;  3UDI A;  3C8C A;  5AV5 A;  1MPL A;  5MC7 A;  3IX4 A;  2CV5 C;  3MGQ B;  4P85 A;  5FDS A;  2XD5 A;  3AN2 B;  3VH6 W;  2BYK A;  4Y17 A;  3B0C W;  1E88 A;  4OJP A;  4KG2 A;  2R9X A;  1NRF A;  4ZRR A;  3LZ0 C;  3L26 A;  5E2F A;  3LJA D;  2GNX A;  4LV2 A;  4J8W A;  1IEM A;  3B6G A;  3CUE C;  3LFV A;  5B31 B;  2OV5 A;  1N9B A;  4OQG A;  5J3W A;  2L5A A;  1OTA A;  2F8N D;  2F8N G;  1U60 A;  3KSI A;  1DJB A;  1P3G A;  5DNN C;  1H8M A;  5CPJ D;  1FIK A;  2FH5 A;  4EBN A;  4YS3 A;  3X1S A;  1U35 A;  2D49 A;  3C38 A;  3UME A;  1RCJ A;  5DTS A;  5TBM B;  3UT9 A;  1UWN X;  3VFH A;  4J8V A;  4LRY C;  3B6F D;  5AVB A;  4LRZ E;  4PM5 A;  5L10 A;  4GW9 A;  4HES A;  4C6Y A;  3Q1F A;  1K6S A;  4H9O A;  2WKI A;  4OOY A;  4JGR A;  5CTN A;  2VGK A;  2W3D A;  2VKS A;  5FAO A;  4S2I A;  3O62 C;  3VP3 A;  5GT0 B;  5FEF A;  3F6T A;  1L6J A;  5CED A;  1M18 B;  4S2M A;  3Q07 A;  4RX2 A;  5AVF A;  5A90 A;  3UPN A;  5IS1 A;  1CI9 A;  2CC1 A;  1JWV A;  2EFU A;  3KXB D;  4OJL A;  5IHV A;  4R3A A;  1T1C A;  2Z2L B;  4QY6 A;  2OWJ A;  1LLB A;  3MNN B;  2A2L A;  1KGF A;  4N9L A;  3FC7 A;  3HVF A;  5B33 C;  1KS0 A;  2A24 A;  5B24 C;  3WD0 A;  1BTL A;  4DMZ A;  1YLW A;  1W63 M;  3MQL A;  1AOI A;  5F69 A;  5AQA A;  2BYM A;  4C75 A;  1F98 A;  3FKW A;  3VV4 A;  1YLT A;  4QLC C;  2DCF A;  3GRJ A;  4HIA A;  3WRT A;  2P08 A;  3W98 A;  5FUG A;  1K55 A;  4KZ4 A;  4IBE A;  3X1U B;  3VE3 A;  1RGZ A;  3W99 B;  5HL6 A;  4EBP A;  3G4P A;  3AZF A;  4YNR A;  2PDR A;  5JRG A;  4OLD A;  1P3L A;  5EVI A;  2JKR I;  3D4F A;  4WU9 C;  3A1K A;  4ZAM A;  4ZJ2 A;  3AZH D;  4Z5T B;  4HMC A;  3WTP E;  3H82 A;  1A7W A;  5AVC C;  3QP6 A;  2ZBB A;  3SS3 A;  1LL8 A;  2QMI A;  4NXE A;  5G18 A;  5AVC B;  1YMS A;  2ARO B;  2Q9N A;  1W7F A;  5B2I B;  4OH0 A;  5F82 A;  5GXQ B;  5CEB A;  4WEL A;  5FI7 A;  1ES5 A;  2OAQ 1;  3MF0 A;  3IBJ A;  1XPB A;  3UE6 A;  3DWZ A;  2HDS A;  2JC7 A;  3LY3 A;  2EXB A;  4MDZ A;  4E3N A;  2XQZ A;  2B02 A;  3WTP C;  3UB8 A;  3HCY A;  1P3M C;  3Q81 A;  4Q8I A;  3AFA C;  1Y28 A;  1TS0 A;  5HWV A;  3ZDJ A;  3AFA B;  2W1R A;  3VSL A;  2VGL M;  2JCH A;  5CPK A;  1WE4 A;  4HY8 A;  5CPI C;  2P9V B;  1VEU A;  3T1Q B;  4HJ4 A;  1K54 C;  3GQZ A;  1P34 B;  2WZX A;  3WD2 A;  2Y55 A;  3MGS A;  5B0Y C;  3BFD A;  5E5A B;  3LO7 A;  2JKT I;  3GR2 A;  3REK C;  5DNM C;  5FQJ A;  3FKV A;  3BY9 A;  2P74 A;  5GSU B;  2XRN A;  3ZFZ A;  3BLS A;  1XJ2 A;  2AVX A;  3UY6 A;  5B2J D;  2HDR A;  1ERQ A;  1H3Q A;  1N9L A;  3REJ A;  3AZG D;  1D1J A;  5AV8 D;  2HP6 A;  3T4T A;  3NHQ A;  2NQB B;  4IBI A;  1H8Y A;  5FDH A;  2XFT A;  3CJM A;  2D02 A;  4KHA A;  4OPQ A;  4WEJ A;  5HAQ A;  4UA7 A;  1F66 A;  3UTB A;  3MQO A;  5FAP A;  1KX3 D;  4RA7 A;  4I3I A;  3V3R A;  1NJ4 A;  3DAV A;  4KQD A;  4GHI A;  2ACG A;  1K6R A;  3Q82 A;  3AZK D;  3C1C A;  2J8Y A;  5B0Z A;  4YM6 D;  1FQG A;  3F1O B;  2Y59 A;  3HLW A;  4F94 A;  5JYO A;  1PDC A;  3T1R A;  4Z66 D;  1T18 A;  3V39 A;  1ZLA D;  3HUO A;  4P6B A;  5CER A;  4BBV A;  1A0K A;  4N9K A;  3E0Y A;  1YSQ A;  1GHM A;  3UNW A;  3BRM A;  3ZG5 A;  1E15 A;  3MGP C;  1WWI A;  3PBR A;  4JJN D;  4ESP A;  3JVU A;  4J8X A;  1BUE A;  3O3V A;  1YLZ A;  1P3B A;  4MB5 A;  3MGP B;  3S7Q A;  4D2O A;  3LEZ A;  3ITB A;  3LZ1 A;  5FL3 A;  3S4X A;  1TEM A;  1FIL A;  4S2N A;  5F68 A;  4LLO B;  1P3O D;  3N8S A;  1XGJ A;  2W3G A;  2Y91 A;  3WA9 D;  3EGD C;  3ZVW A;  2G7U A;  3VH5 W;  4QD4 A;  2Y2I A;  5J7E A;  4Q0I A;  1EQZ D;  2VGL S;  4Y15 A;  3OC2 A;  4JKT A;  1W1P A;  4Y0U A;  4J8U D;  2HUE C;  2VA0 A;  3V50 A;  1NLZ A;  2GZA A;  2PT7 A;  1TZY C;  4ZJ3 A;  3WD1 A;  5CHU A;  1IFQ A;  4S2L A;  1YM1 A;  2ZMF A;  1K4E A;  4GLQ A;  3IF6 A;  4O8G A;  3C5A A;  3JPU A;  4UPK A;  5BNV A;  1M1A B;  3BW6 A;  1YU0 A;  1SKO A;  4MBH A;  4KUO A;  3TU4 A;  3NOT C;  3H7W B;  4IBF A;  1YU1 A;  1HD8 A;  5BO0 B;  2H0T A;  3DW0 A;  4ID4 A;  5AV5 B;  3MGQ D;  5A8B A;  3O5Y A;  1PW1 A;  3AN2 D;  4WNN A;  1P3A A;  4X25 A;  4WU8 A;  5C5K A;  2BYK B;  3DWK A;  1ODV A;  4ARZ A;  3AYW B;  3WAA A;  4K0X A;  1J7M A;  2CV5 A;  3PYP A;  1M6K A;  3SS4 A;  5DKL A;  4J8W B;  5B31 D;  3B6G B;  1W5D A;  5B31 G;  3REH A;  4UAA A;  2HJ9 C;  5GLA A;  3HJI A;  3LZ0 A;  1I5Q A;  4KUD C;  1GHI A;  3OPH A;  2IO5 C;  4N1H A;  5HAR A;  3UTA A;  3CZD A;  5EFW A;  1SHV A;  1P3G B;  3CUE A;  1YLJ A;  3AZL A;  4YS3 B;  2ZY2 A;  2EWV A;  3X1S B;  3IXD A;  4DF6 A;  1U35 B;  1JTD A;  1FR6 A;  1CEG A;  2ZQ7 A;  4X53 A;  3UT9 B;  3WKJ C;  2EX6 A;  4J8V B;  3BWL A;  3HLC A;  2B5R A;  5DNN A;  5AVB B;  4HI4 A;  3S1Y A;  3FZC A;  3H9W A;  4G91 C;  5CGX A;  5C3I B;  4I39 A;  3NC8 A;  5CP6 B;  5E2G A;  4IBJ A;  2W8S A;  4NZ1 A;  3JVV A;  4GS9 A;  3MVD C;  3ZQ5 A;  1TDG A;  3LEL B;  3KSF A;  4E3L A;  2EWW A;  1UGU A;  3SZT A;  1V9Z A;  5GT0 D;  1Y54 A;  1TS6 A;  3LUQ A;  3WRZ A;  3X1V A;  3L28 A;  1M18 D;  1DJC A;  2VQR A;  3O87 A;  3WD4 A;  3KO6 A;  3NCK A;  1DP6 A;  3H0L C;  1WWS A;  3NOU C;  3KS4 A;  3MNN D;  2V0W A;  1J3W A;  1FR1 A;  2H0Y A;  1NZO A;  3A3E A;  2X71 A;  2ZLY A;  3MZE A;  2ZY5 A;  1L3L A;  2A24 B;  3IQA A;  4LG2 A;  2Y4A A;  4IVI A;  1AOI B;  3V3S A;  2BYM B;  1OT9 A;  4UEY A;  4WBG A;  5B33 A;  2J9O A;  2W3E A;  1PZO A;  5B24 A;  1FCM A;  1K57 A;  3L29 A;  1KX4 A;  2J3T D;  3X1U D;  4ME4 A;  2Z6C A;  3W98 B;  3B0D C;  1E4D A;  3W99 D;  1DJA A;  3V9R B;  2KOI A;  4QLC A;  1W1V A;  2VV8 A;  3EWK A;  4U0X A;  3VOZ A;  1P3I C;  3AZF B;  1P3L C;  2ZM0 A;  1LT0 A;  5JRG B;  4JF4 A;  4Z5T D;  1T19 A;  5EVI B;  2BLS A;  1BFM A;  5L8M A;  4R0Q A;  3OOV A;  3N4I A;  3H82 B;  3ZG7 B;  5KMW A;  5AVC D;  5CHL B;  3UB9 A;  2ARO D;  3NBL A;  4IJE A;  5B2I D;  1S66 L;  4WU9 A;  5GXQ D;  4KGC B;  4OQI A;  3TOI A;  1Z09 A;  3A0V A;  4BD0 A;  3REL C;  2L0W A;  3ULF A;  1IEL A;  4CLC E;  3HJK A;  1P0Z A;  3IBR A;  3HBR A;  4DJ2 A;  4AWL C;  4BLM A;  3CI6 A;  1OGB A;  3G2Y A;  5G4Z A;  3AFA D;  4YFM A;  5CPK C;  5DJU A;  1QMF A;  2E8J A;  2Y2G A;  3BEB A;  1M40 A;  1P3M A;  3RXX A;  1P34 D;  4AFI A;  1VEU B;  4CLC C;  4DXC A;  4GKU A;  5B32 G;  5E5A D;  2O0Y A;  3S22 A;  3MGS B;  2HGV A;  1UR8 A;  5BS7 A;  1K54 A;  4EU0 A;  5FQQ A;  5GSU D;  3C1B C;  2V1Z A;  5B0Y A;  4X23 C;  4E3M A;  2WKH A;  4OJ5 A;  3REK A;  1CQA A;  5DNM A;  4DXB A;  3REJ B;  3N8L A;  5F99 C;  3X1T C;  3MZF A;  4O01 A;  3NQJ A;  2NQB D;  3SS5 A;  1OJG A;  3W96 D;  3MKE A;  4G92 B;  3CPT A;  2Y2O A;  3SH7 A;  1K56 A;  5G49 A;  1S0W A;  4HH2 A;  5DTT A;  3A6N C;  3LR3 A;  4KHA B;  1F66 C;  5HL1 A;  3AV1 A;  1LSV A;  4WMC D;  1P3P A;  2J9P A;  4MNR A;  3DTE A;  4FSF A;  3UTB B;  2X01 A;  1NXY A;  4LV3 A;  5B1M B;  1ID3 A;  3C1C C;  5B0Z C;  1Q9C A;  5B0Z B;  1HQ3 B;  3BQA A;  1G28 A;  2ZQ9 A;  3BLM A;  3M2J A;  1TVF A;  3OBF A;  2HIO A;  5CTM A;  1XJ6 A;  2M1C A;  1P3B C;  3MGP D;  2ZL1 A;  3ZGA B;  2OOL A;  4J8X B;  3LZ1 C;  4S2N C;  2W1T A;  4UQI S;  1TF1 A;  3LZ1 B;  1CJF A;  4XZQ C;  4FH2 A;  3B3X A;  5M18 A;  5GLB A;  1BZA A;  4DDY A;  1NYM A;  2L4R A;  1E3U A;  5HD5 A;  2Y2N A;  5AV6 B;  3VP0 A;  3UPO A;  3A1I A;  3ZCZ A;  1CK3 A;  4PM8 A;  3MGR A;  2CMN A;  3WS2 A;  1T3U A;  3E2L A;  5HX9 A;  2HZ5 A;  1M19 B;  5AV9 B;  3KSY A;  2ZQD A;  4X1M A;  2OSU A;  3IF6 B;  1KVM A;  2JSS A;  1M1A D;  3UDX A;  3VP4 A;  4OJO A;  3IH8 A;  4PKY G;  5B1L B;  4YIN A;  3U2A A;  4KQO A;  1UWP X;  1SKO B;  3TU4 B;  1MKI A;  3AZI C;  2XDM A;  3T4Q A;  4GH9 A;  3O86 A;  5EM0 A;  2B95 A;  5FQI A;  3LI9 A;  5AV5 D;  1MWS A;  4Z2G A;  4ZTK A;  3T1S A;  4WU8 C;  5KIZ A;  4OP8 A;  2J8P A;  4EER A;  1P3A B;  4H9N A;  4E6X A;  3HL9 A;  1IKI A;  4KZ9 A;  3LGO A;  3WAA C;  3AYW D;  2I9V A;  1ERO A;  2NZD C;  1MWR A;  4QB8 A;  4ARZ B;  3W97 D;  1K0K A;  1CF0 A;  1YMX A;  2V2F F;  3QP2 A;  3REI C;  4DQY B;  2CV5 B;  4WZ5 A;  5KSH A;  3BEC A;  4IJF A;  4M6B A;  4J8W D;  3ZG0 A;  4M4X A;  3B6G D;  3REH C;  4GHL A;  4R38 A;  1WA9 A;  4IBD A;  3MS6 A;  3MJQ A;  3UTA C;  4OON A;  3LZ0 B;  1P3G D;  3EPK A;  4II7 A;  4XT2 B;  1BYW A;  3AZL C;  4YS3 D;  5GT3 A;  3X1S D;  4E3O A;  1U35 D;  3W4O A;  3G32 A;  3UT9 D;  2RCX A;  2VEA A;  3O88 A;  4XUX A;  5EE8 A;  2JKF A;  4J8V D;  4JF5 A;  4KUD A;  3ZG8 B;  5AVB D;  3CLO A;  3AZN C;  5DNN B;  3A3F A;  4PM6 A;  5CP6 D;  5FAQ A;  4Y3I A;  2PYP A;  2QWS A;  4GNU A;  3WKJ A;  3LEL D;  3S7P A;  3G34 A;  4Z2M G;  4GS9 B;  4DDS A;  4ZUX C;  4HJ6 A;  4GCZ A;  4OP5 A;  1EI5 A;  3X1V C;  4L9F A;  3A0R A;  4S2K A;  4Z2L A;  3VP1 A;  3MVD A;  5CGS A;  1HTA A;  4WJ3 C;  2F8N A;  3M2K A;  3KYZ A;  1YU3 A;  2OWH A;  3LIF A;  3O62 B;  4NEE D;  3NQU A;  1LL5 A;  5BNX A;  4NXG A;  2W0N A;  3WX7 A;  4N92 A;  3M7P A;  2RVQ C;  1S32 D;  4QHC A;  4DE3 A;  4WEK A;  3FDD A;  1F9I A;  1S4S A;  3UDF A;  5HAP A;  1AOI D;  4MN6 A;  2V1B A;  4ZDX A;  4QY5 A;  2ZC3 B;  2KLI A;  1K57 C;  5B33 B;  1KX4 C;  2J3W A;  4CAY B;  5B24 B;  1IYP A;  3W98 D;  2ZOH A;  3N3F A;  2XRO A;  3OLO A;  5EEC A;  3G30 A;  3HLF A;  5DKK A;  2K2N A;  1XFQ A;  4LD9 A;  3AV2 C;  1STZ A;  2WGV A;  4QLC B;  3AZF D;  4R4R A;  5JRG D;  3DTI A;  3E4O A;  1NZU A;  4G3W A;  5EVI D;  4KG5 A;  4RX3 A;  3KUY D;  3TE8 A;  4D60 A;  1JFI A;  1IYS A;  3GSG A;  4RQ9 A;  5CX7 A;  5HZH A;  1S1Z A;  2Y2M A;  1LSX A;  1P3I A;  2VK3 A;  4DJ3 A;  4B88 A;  4KGC D;  4WU9 B;  4ETX A;  4NZ5 A;  4PM7 A;  1BLC A;  2V1A A;  2EX2 A;  5FI6 A;  1KGG A;  2DMW A;  4BWI A;  4Y13 A;  1BH8 A;  5TGF A;  4HQA A;  3SH9 A;  4UUZ A;  3IWO A;  3AZE A;  1BH9 A;  2PU4 A;  3REL A;  1KE0 A;  3W2Z A;  1FCN A;  1XXM A;  4MN5 A;  1K4F A;  3EPL A;  2WZZ A;  3P98 A;  4OPR A;  4LV0 A;  1GSX A;  2IWC A;  5KZH A;  1PWD A;  3AZH A;  3WTP B;  1WYC A;  2PYO C;  2Y2H A;  1P3M B;  2FJ7 C;  4JXW A;  3FWL A;  4PPR A;  4X1L A;  3UB5 P;  4XUZ A;  1T1B A;  4EV4 A;  3MGS D;  1D7E A;  2G2W A;  5BS7 C;  3AZJ D;  3EPJ A;  4GDB A;  5CPI B;  2WUQ A;  4CLC A;  3LID A;  5GLD A;  3E4P A;  4JBF A;  4IED A;  4YWZ A;  1KX5 C;  5B0Y B;  3GDI A;  2XFS A;  3KX0 X;  2XD1 A;  1KOU A;  3LIC A;  3REJ D;  4H6J A;  4H9P A;  3REK B;  3B47 A;  5DNM B;  3RFB A;  3C1B A;  1OGG A;  1JNU A;  4X23 A;  4JXG A;  2EA9 A;  4XUJ C;  3PAG A;  5B32 C;  3NQJ B;  5BPV A;  2KX6 A;  1ZHH B;  1GSV A;  4M3K A;  3OPL A;  3AZM C;  5F99 A;  2QPN A;  2WGI A;  3X1T A;  3CPT B;  3MFX A;  5F5Y A;  1JTG A;  4LGW A;  5DF7 A;  1ACF A;  3AV1 C;  5HWW A;  3H0M C;  1P3P C;  3UTB D;  4BL2 A;  4LPZ A;  1JWZ A;  1ULY A;  5EPH A;  1H3O B;  2JN7 A;  5D3O A;  4LV1 A;  3A6N A;  1ID3 C;  5B1M D;  1SZV A;  2YFV B;  5B0Z D;  3LYX A;  2VX8 A;  1HQ3 D;  3HLG A;  1O6I A;  3A3I A;  4GN2 A;  2FZ0 A;  5AV8 A;  4Y5F A;  5E2E A;  4S2O A;  2HIO C;  1P3F C;  4RVA A;  2Y2Q A;  1XGI A;  2HIO B;  4J8X D;  4H9Q A;  4JPM A;  5FSR A;  4IBX A;  4E3I A;  4WN5 A;  3LZ1 D;  3MKF A;  5L09 A;  2W1T B;  2QJ7 A;  3H0R C;  3HON A;  4NYU A;  4OLG A;  2PBD P;  2YFW A;  5AV6 D;  3IH9 A;  3BFF A;  2E8I A;  4BMW A;  2DNS A;  3EQV A;  3MGR C;  4XZQ A;  2WKP A;  5GHY A;  3L27 A;  1J9M A;  1M19 D;  5AV9 D;  1H8Z A;  5B40 C;  4YM6 A;  1E6N A;  1FSW A;  1YKD A;  2GX5 A;  2HUE B;  3PXP A;  1ZLA A;  5B1L D;  1TZY B;  5J4E A;  3TU4 D;  5DTK A;  1F1E A;  5I5L A;  2PAV P;  3GVB A;  4IHQ A;  3IXG A;  1ESU A;  4R8P C;  1FSY A;  1W1Y A;  1W8Q A;  1P3O A;  1P3A D;  2WAF A;  3CMZ A;  3AZI A;  5HW3 A;  2ZQ8 A;  1W79 A;  4H9N B;  1EQZ A;  4EW7 A;  2RL3 A;  2KDK A;  3T4O A;  1CI8 A;  2K31 A;  1PFL A;  1P3K A;  2CV5 D;  3KWQ A;  3HLD A;  4WZ5 C;  3TW8 A;  4E3K A;  5AY8 C;  5CGW A;  3V5M A;  2ZM8 A;  5TFQ A;  1ZTU A;  3K3D A;  4BEN A;  2NZD A;  1ZC2 A;  3FV7 A;  1DRM A;  1IYO A;  2YKH A;  3CIT A;  4P6Z S;  3REI A;  3LZ0 D;  2LB5 A;  5GT3 C;  1AXB A;  4F3L A;  4OPY A;  3F1N A;  3NY4 A;  3QP8 A;  5GT3 B;  3DTK A;  3UB6 A;  4H9R A;  4MB4 A;  3F1P A;  2PHY A;  3M6B A;  3Q7Z A;  4FUW A;  3LY4 A;  4KUD B;  2IO5 B;  5DNN D;  3MGQ A;  1TS7 A;  5FQM A;  4WUJ A;  3I7J A;  3AN2 A;  4NKP A;  2PR6 A;  4HEF A;  3MQQ A;  5FQ9 A;  3WKJ B;  4K08 A;  3RJU A;  2I72 A;  3AZN A;  3VOY A;  1OPX A;  1TDL A;  3LJA C;  4G91 B;  1S4R A;  3P01 A;  3MXS A;  5A92 A;  1ED7 A;  5EVE A;  4H9O B;  3OZH A;  5B31 A;  4HOI A;  1MBL A;  1W63 Q;  3MVD B;  4ZUX A;  3GTC A;  5CPJ C;  1H8P A;  3O62 D;  2H28 A;  2PU2 A;  5IT5 A;  1K25 A;  2XA7 S;  2R9W A;  2HJE A;  3NQU B;  4EEU A;  5BNX B;  3Q7V A;  3B6F C;  2XGN A;  1PZP A;  1ZG6 A;  1OTE A;  2ZMA A;  3T4K A;  1MWT A;  3IX8 A;  1MZU A;  4EXO A;  4JGQ A;  4S2P A;  5B33 D;  2QKP A;  4IJG A;  4EO5 C;  5B24 D;  5GHX A;  3G2Z A;  3VSK A;  2FFY A;  4Q0J A;  1DP9 A;  4LD9 C;  1P97 A;  3UMD A;  5DJT A;  4EET B;  1M18 A;  4BJP A;  4QLC D;  2Y2J A;  4NFT A;  4LD9 B;  4QWO A;  5HPF A;  2P7J A;  2P04 A;  3PBS A;  5FUG B;  3KXB C;  5A91 A;  1N1J A;  2FFF B;  4R70 A;  4K0W A;  3B0D B;  4DRB A;  4DRT A;  3MNN A;  3C7V A;  3AV2 A;  1JFI B;  3RH8 B;  2K7S A;  2ZMV A;  1PYY A;  2H10 A;  2XK1 A;  1P3I B;  2IWB A;  1P3L B;  4WU9 D;  4G3V A;  1XP4 A;  1ONG A;  1L0D A;  3HLE A;  3SH8 A;  2ZC5 B;  4WL9 A;  4NY2 A;  3T4J A;  3R7W A;  4FD8 A;  3AZE C;  5HDC A;  1HTZ A;  4MLL A;  4PM9 A;  3W99 A;  4UUZ B;  3AZE B;  3KSG A;  4OVD A;  4GD8 A;  3REL B;  5HAI A;  5HDS A;  4DRA A;  2WKR A;  4AWL B;  2IOU A;  3AZH C;  3C4O A;  4UQI M;  3WTP D;  1KDS A;  4Z5T A;  1E25 A;  5F6A A;  2HP5 A;  1B6W A;  1YSP A;  3A3J A;  1P3M D;  1Q2Q A;  5A93 A;  5M19 A;  1Q2P A;  1L0G A;  4EES A;  1DY6 A;  2J80 A;  5CHM A;  5CPK B;  4Z2J A;  4JXS A;  3N6I A;  5CPI D;  2PYO A;  2FJ7 A;  1JWP A;  4WZS B;  4CLC B;  5B0Y D;  4KZA A;  5DF9 A;  2VV6 A;  4HGA C;  2DQN C;  2HPB A;  3REK D;  5DNM D;  4H6J B;  4H9P B;  5K5B A;  1ERM A;  3C1B B;  1KX5 A;  4X23 B;  1YT4 A;  1E6R A;  3EGX C;  4G3K A;  2RIQ A;  1PW8 A;  2QZ6 A;  2P9V A;  1YU4 A;  1K56 D;  5F99 B;  5DVA A;  3X1T B;  4JF6 A;  2UV0 E;  1P34 A;  4E3J A;  4XUJ A;  5B32 A;  4EQ1 A;  2BG1 A;  4CJN A;  5E5A A;  4ETZ A;  3MZD A;  1L2S A;  3AZM A;  3N7W A;  4PHT A;  3KFU G;  1KU5 A;  1JVJ A;  4JGO A;  5KSC A;  3A6N B;  3LR5 A;  1PWG A;  1F66 B;  3LIB A;  1MXO A;  5B2J C;  2HV1 A;  3NJA A;  3UB7 A;  3L2A A;  3PBT A;  3IXH A;  1H0M A;  2QJ5 A;  3FKE A;  3AZG C;  5CXW A;  5AV8 C;  1YAX A;  4GHI B;  1ZG4 A;  1I2W A;  3C1C B;  3ZNY A;  1KVL A;  3WS4 A;  4IVK A;  2OLV A;  3W96 A;  3B0B A;  4WZ4 A;  1IKG A;  1GA0 A;  1E8B A;  3U4L P;  1G68 A;  2ZD8 A;  2IWD A;  4Z2I A;  4KZ5 A;  4WM9 A;  1P3F A;  4X6T A;  4EEP A;  2R78 A;  1KX3 C;  4WMC A;  1P3B B;  1E3U D;  4EUZ A;  5JYP A;  3MXQ A;  5AJG A;  3TSG A;  1GCE A;  2EX8 A;  5AQ9 A;  2Q0O A;  4XZQ B;  4JGP A;  3OCN A;  4MB3 A;  3AZK C;  5AQB A;  5HFO A;  4YM6 C;  3NOP C;  2V0U A;  3F1O A;  1ZLA C;  1BLH A;  2ZM5 A;  1TZY D;  1PI5 A;  2LB9 A;  1GA9 A;  3B33 A;  5B40 A;  4JJN C;  1LHY A;  1PI4 A;  1VET A;  1XKZ A;  4BD1 A;  3HUN A;  3R45 A;  3NDE A;  5BNV B;  3UPP A;  5DF8 A;  3IF5 A;  1P3O C;  4R3B A;  3WA9 C;  2XLN A;  3K2N A;  1ONH A;  2ZQC A;  1EQZ C;  5JA4 A;  3AZI B;  5CEC A;  4R8P A;  2ZQA A;  3D9Y A;  1P3K C;  4J8U C;  4L0L A;  4MBF A;  3KWQ C;  2L1M A;  1P3K B;  3VH6 T;  4WNN B;  4WU8 B;  3KWQ B;  2ZY4 A;  3B0C T;  2F8N K;  2HP9 A;  1HVB A;  4N1X A;  3WAA B;  2C6W B;  2NZD B;  3L7H A;  1GXD A;  3REI B;  5AY8 A;  4PKY A;  3HSH A;  1TAF A;  2VGJ A;  5GT3 D;  3H7W A;  4KZ8 A;  3F1N B;  5EM1 A;  5FQK A;  3REH B;  1FOF A;  5BO0 A;  5GHZ A;  4KQQ A;  4HME A;  5G4Y A;  1VB6 A;  4H9R B;  4KUD D;  3F1P B;  3MGQ C;  1GPF A;  3UTA B;  3B42 A;  3AN2 C;  3ISG A;  4DE0 A;  4NXB A;  4H8R A;  2VV7 A;  3AZL B;  1MC0 A;  4HBT A;  4LCL A;  3AYW A;  3WKJ D;  4IBC A;  3FPW A;  4HNB A;  4MMN A;  3W97 A;  3AZN B;  4NE6 A;  2F8N H;  3UE0 A;  5B31 C;  2G5I C;  3LIA A;  1W8Y A;  5I94 A;  3MVD D;  3W8K A;  1XJ3 A;  4R4S A;  4ZUX B;  1LSW A;  3LJA A;  2PBY A;  3VFF A;  3X1V B;  4Z2M H;  2D01 A;  1FCO A;  2ZOI A;  2PRF A;  5FAT A;  1YLY A;  4B4X A;  3GV9 A;  5E43 A;  3Q7V B;  2Z2M B;  5CPJ A;  1Z6F A;  5FEG A;  4GB7 A;  4E45 A;  4OKP A;  5F1G A;  2WYX A;  2YKF A;  3AGE A;  4TX8 A;  4Z2H A;  2WKQ A;  5CP6 A;  3G31 A;  4E04 A;  4KZ7 A;  3LI8 A;  4NET A;  2ZM2 A;  3B6F A;  4UHU A;  3LEL A;  4GJ4 A;  3EEA A;  1YUE A;  3S7O A;  5GT0 C;  5M1A A;  3R4K A;  3ZHH A;  1M18 C;  3KYE A;  4OQ0 A;  2WK0 A;  4LD9 D;  2WAE A;  5HD3 A;  3PBO A;  3BJN A;  1KX4 B;  4HJ3 A;  5L2F A;  1N1J B;  3MNN C;  3A0S A;  4HMD A;  4CSR A;  3NUL A;  4HP9 A;  1I2S A;  4Y2F A;  3C4P A;  4PMA A;  3AV2 B;  2JKG A;  3VE4 A;  4FH4 A;  1P3I D;  1OT6 A;  1P3L D;  3KXB A;  1S32 A;  4NZ4 A;  3MQ0 A;  1T1A A;  3LR0 A;  1EW0 A;  1YPR A;  4EQI A;  3CAX A;  4OUI A;  3QNC A;  5F83 A;  1NYY A;  2PYR A;  2JKR M;  3VP2 A;  1PRQ A;  3X1U C;  2J3T C;  4KQR A;  3R7W B;  4EUV A;  3W99 C;  1AIW A;  3AZE D;  4QPR A;  3PAE A;  3V9R A;  3REL D;  4IBB A;  1OME A;  2DRW A;  1QO6 A;  3VOL A;  3AL0 C;  1QME A;  4HHD A;  4ZJ1 A;  4KZB A;  4Z5T C;  5AVE A;  3FYZ A;  3VH5 A;  3KUY A;  5GLC A;  3IHB A;  1PZR A;  4Y0O A;  2ARO C;  5CPK D;  5B2I C;  2M7V A;  5GXQ C;  2Y79 A;  2RTS A;  4BBT A;  1RP5 A;  1NWZ A;  4KGC A;  1V9Y A;  1Y4O A;  2PYO B;  3NEC A;  3MSH A;  2FJ7 B;  4CLC D;  1E6P A;  1N4O A;  2OAP 1;  1HZO A;  3D3O A;  4O7D A;  4E6W A;  3HUM A;  5EOO A;  3BFG A;  1N9O A;  2VJW A;  3D72 A;  1VHM A;  4ZBJ C;  3C1B D;  4KEN B;  2XH9 A;  3ZVT A;  4X23 D;  2JKT M;  4ZBJ B;  1O07 A;  4LFU A;  3ZG9 B;  1KX5 B;  1MKM A;  1OTB A;  3T4S A;  4ZBE A;  4P87 A;  5BT1 C;  1BLS A;  4X68 A;  5F99 D;  2V8C A;  3X1T D;  1P34 C;  3MR0 A;  3W4Q A;  5E5A C;  4XUJ B;  5B32 B;  2A49 A;  3TG9 A;  1S6R A;  3IWI A;  2ZC6 B;  1OJ5 A;  5G49 B;  3AZM B;  3AZJ A;  4C3Q A;  1NRJ A;  3RXW A;  1LI9 A;  4X69 A;  5J8X A;  3A6N D;  3EPH A;  3QHY A;  5TJJ A;  1HLU P;  5GSU C;  1VM1 A;  1F66 D;  1VQQ A;  3AV1 B;  3CHW P;  3BFE A;  1KE4 A;  4GZB A;  1P3P B;  2W3H A;  4P6Z M;  4FOF A;  3C30 A;  1CK7 A;  4NG2 A;  1ID3 B;  4QU3 A;  4DKI A;  3C1C D;  5B2J A;  2NQB C;  3OPR A;  4L9G A;  3EQU A;  3W96 C;  2MJ6 A;  2HDU A;  3IXB A;  1CXW A;  5KDM A;  4PAU A;  2GJ3 A;  4Z1W A;  3W96 B;  2ZC4 B;  3AZG A;  1BUL A;  4LEN A;  1YU2 A;  4NE3 A;  3UE1 A;  4DN0 A;  3WS5 A;  3PBN A;  1P3F B;  2WAD A;  1P3B D;  2ZL1 B;  3MMH A;  2FN2 A;  1G6O A;  4H9S C;  3QP5 A;  2INW A;  3T50 A;  4BQM A;  1GSW A;  2F2A C;  4XZQ D;  2HDQ A;  3VH5 T;  5B1M A;  3QNB A;  3BM6 A;  4GHA A;  1KX3 A;  4UA6 A;  3V67 A;  5HSQ A;  1O7E A;  2O99 A;  4Z2K A;  2B18 A;  1HQ3 A;  4OQH A;  4B4Z A;  3MGR B;  3AZK A;  3BY8 A;  2XA7 M;  3IS2 A;  1IOU A;  1S1Y A;  5B40 B;  2VZW A;  1ESI A;  3IT9 A;  3GEC A;  1OTI A;  1VET B;  4Z66 A;  5FA7 A;  4GD6 A;  3R45 B;  1H0G A;  1RGY A;  3ICY A;  4JJN A;  2EXA A;  4LCM A;  4Q0H A;  3AZI D;  4IBR A;  5JA4 B;  5AV6 A;  3BQ8 A;  4R8P B;  1P3K D;  4IUK A;  3T12 B;  3KWQ D;  4WU8 D;  1L0F A;  3WA9 A;  1D06 A;  4GOG A;  1M19 A;  3DTM A;  5AV9 A;  3WAA D;  2C5W B;  2VLG A;  2NZD D;  4MCW A;  4J8U A;  1Z2C B;  2IA2 A;  5CHJ A;  1M1A C;  1YLP A;  5HPI A;  3REI D;  2EFX A;  2WGW A;  1CEF A;  3LIE A;  5AY8 B;  5B1L A;  1SDE A;  4KZ6 A;  1TAF B;  3P7N A;  3ITA A;  3REH D;  2UWX A;  4E44 A;  3FG8 A;  3ZNT A;  3HRE A;  4I3A A;  5AV5 C;  4OOM A;  4I5S A;  3UTA D;  5HWT A;  1XX2 A;  3AZL D;  4YOF A;  2Q9M A;  3C2W A;  1XJ4 A;  2ZJ9 A;  3AYW C;  2OLU A;  5FI2 A;  3WWX A;  3W97 C;  3L9K A;  1BSG A;  3AZN D;  3T4L A;  3W97 B;  4KG6 A;  4NYY A;  4DE2 A;  4J8W C;  2X02 A;  4MN7 A;  4DE1 A;  3B6G C;  3KS8 A;  1H0I A;  4GDN A;  5E2H A;  1XA1 A;  1SKF A;  4ZUX D;  1P3G C;  3X1V D;  4XT2 A;  3LJA B;  4YS3 C;  3X1S C;  2Y2L A;  3E2K A;  2GDN A;  5EV0 A;  1U35 C;  4R3J A;  3NIA A;  1W1T A;  3L25 A;  4KZ3 A;  4WV4 B;  3UT9 C;  2PR5 A;  4J8V C;  3NDG A;  2F8N B;  5AVB C;  4OPZ A;  4QNL A;  3P09 A;  2V5O A;  3BYD A;  5C3I C;  1L0E A;  5CPJ B;  3KSH A;  3AGD A;  5EUA A;  2W27 A;  5CP6 C;  5TBM A;  5IU1 A;  2ZC7 A;  2A3U A;  1KGE A;  3LEL C;  2RVQ D;  2G2U A;  3B6F B;  3PBQ A;  2LY8 A;  3M6H A;  1G6A A;  4Z9Q A;  2G5H C;  1K38 A;  4IBG A;  2PD8 A;  3EEH A;  5AQ7 A;  4HBU A;  1ZKJ A;  1EWZ A;  1F5M A;  4XXR A;  1KX4 D;  4EO5 B;  4BBU A;  5GT0 A;  3IX3 A;  4WYY A;  3WD3 A;  5F1F A;  3W4P A;  3O62 A;  3MXR A;  5HDD A;  2JBF A;  4CSR B;  2BAS A;  3AV2 D;  4FTX A;  4X55 A;  1SCW A;  3GMW A;  3OCL A;  4Y7P A;  1S32 C;  1KE3 A;  1WYB A;  2V20 A;  3KXB B;  3IWQ A;  2XSS A;  1S32 B;  3PHY A;  1AOI C;  5BOH A;  4CPK A;  3IHA A;  3NI9 A;  4I3J A;  3LR4 A;  1BT5 A;  5LBR A;  4CAY A;  1UR9 A;  2CWE A;  3W98 C;  1K55 C;  2Y2K A;  1X0O A;  2XEP A;  3UE3 A;  5DFY A;  1MWU A;  3AZF C;  3IP4 C;  1BH8 B;  4L9E A;  5JRG C;  3X1U A;  1PWC A;  5EVI C;  2QHK A;  4NZ3 A;  3WS1 A;  3KUY C;  1BH9 B;  3UO9 A;  3KUY B;  1H5X A;  4JXV A;  3RTY A;  2J7V A;  1IYQ A;  3P5J B;  3PR6 A;  2JHE A;  4UA9 A;  2XR0 A;  3C7U A;  4KGC C;  4EWF A;  3AZH B;  5EOE A;  5DFX A;  4LRX C;  2PYO D;  2W3F A;  4R6L A;  2FJ7 D;  5AVC A;  1W2E A;  4R23 A;  1ES2 A;  2ARO A;  3TRC A;  1C3B A;  1XA7 A;  5B2I A;  4B93 A;  5GXQ A;  2V8F A;  1OTD A;  2M7U A;  3SOI A;  1NY0 A;  4HP4 A;  3MFD A;  1R4V A;  4RYE A;  3ZYT A;  2BTF P;  4CQH A;  2EX9 A;  5EVL A;  1KX5 D;  3QP1 A;  4OOL A;  3WS0 A;  4JLF A;  4IBK A;  4IUH A;  4HGA B;  3QP4 A;  5BT1 D;  3WTP A;  1ES4 A;  3HLB A;  3AFA A;  3KYQ A;  4OJ6 A;  2O9A A;  3TJZ C;  4XUJ D;  1LI0 A;  5B32 D;  3G6O A;  1F2K A;  3MGS C;  4FCF A;  4NE5 A;  3VH6 A;  1P9W A;  3AZJ C;  3AZM D;  2HF6 A;  3UN7 A;  5CPI A;  1G5U A;  3AZJ B;  3EOI A;  2O9B A;  3AV1 D;  1P3P D;  1S67 L;  2JE5 A;  2O9C A;  3CWF A;  4MBK A;  3N8R A;  3DBA A;  3LCE A;  2V9A A;  3A3D A;  3REJ C;  3G35 A;  2NUP C;  5GSU A;  3E4Q A;  1ID3 D;  4HH3 A;  1N9N A;  1XFN A;  5B2J B;  4G92 C;  5CRF A;  1TD5 A;  2Y2P A;  2NUT C;  1MY8 A;  5KDM B;  3PTE A;  3AZG B;  5AV8 B;  4I38 A;  4A5R A;  1LL9 A;  2NQB A;  2HIO D;  1P3F D;  4S2J A;  4WLA A;  3UTB C;  1ALQ A;  4H9Q B;  5L07 A;  3LEQ A;  1H3O A;  5FAS A;  1GHP A;  5B1M C;  1GOI A;  3VMA A;  4WF0 A;  1E6Z A;  2YFW B;  2YFV A;  4H9S A;  1KX3 B;  3JYI A;  1HQ3 C;  4X56 A;  1B67 A;  4MEZ A;  4NK3 A;  1PIO A;  2WKE A;  3MGR D;  5GL9 A;  5TR7 A;  1NLY A;  3AGF A;  4QJG A;  3AZK B;  3IS2 B;  3OPP A;  5B40 D;  4YM6 B;  4J8X C;  1EAK A;  4Z66 C;  3EG5 B;  1KDW A;  2PD7 A;  3E98 A;  4Z66 B;  3BFC A;  1ZLA B;  4U3T A;  2Z6D A;  4U0T A;  1P9R A;  4R1G A;  3FPV A;  1DP8 A;  3MGP A;  4JJN B;  5AV6 C;  1ES3 A;  1TS8 A;  4R8P D;  2XF3 A;  4NXF A;  1P3O B;  3SW1 A;  1M19 C;  3CG5 A;  5AV9 C;  3WA9 B;  3T1X A;  5U47 A;  1EQZ B;  2Y8H A;  1PNE A;  3IF6 C;  4BL3 A;  4K91 A;  4J8U B;  3S7N A;  1BLP A;  4Y0T A;  4B9O A;  4KUK A;  5AY8 D;  5B1L C;  2WGW B;  3K3C A;  1TZY A;  4P0M A;  3TU4 C;  4EBL A;  2DF4 C;  2H5S A;  1YQS A;  1AWI A;  2QYB A;  3MBZ A;  1M1A A;  4O0P A;  2ZY3 A;  1SDN A; 
#chains in the Genus database with same CATH homology
 1P3A C;  3UDI A;  5AV5 A;  1MPL A;  2CV5 C;  3MGQ B;  4P85 A;  2XD5 A;  3AN2 B;  3VH6 W;  2BYK A;  3B0C W;  4OJP A;  4KG2 A;  2R9X A;  1NRF A;  3LZ0 C;  3L26 A;  5E2F A;  3LJA D;  4LV2 A;  4J8W A;  1IEM A;  3B6G A;  5B31 B;  2OV5 A;  1N9B A;  4OQG A;  2L5A A;  2F8N D;  2F8N G;  1U60 A;  1DJB A;  1P3G A;  5DNN C;  5CPJ D;  4EBN A;  4YS3 A;  3X1S A;  1U35 A;  1RCJ A;  5DTS A;  3UT9 A;  3VFH A;  4J8V A;  3B6F D;  5AVB A;  4PM5 A;  4HES A;  4C6Y A;  3Q1F A;  1K6S A;  4H9O A;  2WKI A;  4OOY A;  5CTN A;  2VGK A;  5FAO A;  4S2I A;  3O62 C;  3VP3 A;  5GT0 B;  3F6T A;  5CED A;  1M18 B;  4S2M A;  3Q07 A;  4RX2 A;  5A90 A;  3UPN A;  1CI9 A;  2CC1 A;  1JWV A;  2EFU A;  3KXB D;  4OJL A;  5IHV A;  2Z2L B;  4QY6 A;  1LLB A;  3MNN B;  1KGF A;  4N9L A;  3HVF A;  5B33 C;  5B24 C;  1BTL A;  1YLW A;  1AOI A;  5AQA A;  2BYM A;  4C75 A;  3FKW A;  1YLT A;  4QLC C;  2DCF A;  3GRJ A;  3WRT A;  3W98 A;  5FUG A;  1K55 A;  4KZ4 A;  4IBE A;  3X1U B;  1RGZ A;  3W99 B;  4EBP A;  3G4P A;  3AZF A;  5JRG A;  4OLD A;  1P3L A;  5EVI A;  3D4F A;  4WU9 C;  3A1K A;  4ZAM A;  4ZJ2 A;  3AZH D;  4Z5T B;  3WTP E;  1A7W A;  5AVC C;  3SS3 A;  2QMI A;  5G18 A;  5AVC B;  1YMS A;  2ARO B;  2Q9N A;  1W7F A;  5B2I B;  4OH0 A;  5F82 A;  5GXQ B;  5CEB A;  4WEL A;  5FI7 A;  1ES5 A;  1XPB A;  3DWZ A;  2HDS A;  2JC7 A;  3LY3 A;  2EXB A;  4E3N A;  2XQZ A;  3WTP C;  1P3M C;  3Q81 A;  4Q8I A;  3AFA C;  3ZDJ A;  3AFA B;  3VSL A;  2JCH A;  5CPK A;  1WE4 A;  5CPI C;  2P9V B;  1K54 C;  3GQZ A;  1P34 B;  2WZX A;  2Y55 A;  3MGS A;  5B0Y C;  3BFD A;  5E5A B;  3LO7 A;  3GR2 A;  3REK C;  5DNM C;  5FQJ A;  3FKV A;  2P74 A;  5GSU B;  3ZFZ A;  3BLS A;  3UY6 A;  5B2J D;  2HDR A;  1ERQ A;  3REJ A;  3AZG D;  5AV8 D;  2HP6 A;  2NQB B;  4IBI A;  1H8Y A;  5FDH A;  2XFT A;  3CJM A;  4KHA A;  4OPQ A;  4WEJ A;  5HAQ A;  4UA7 A;  1F66 A;  3UTB A;  5FAP A;  1KX3 D;  4RA7 A;  3V3R A;  1NJ4 A;  1K6R A;  3Q82 A;  3AZK D;  3C1C A;  2J8Y A;  5B0Z A;  4YM6 D;  1FQG A;  2Y59 A;  3HLW A;  4F94 A;  5JYO A;  4Z66 D;  3V39 A;  1ZLA D;  3HUO A;  4P6B A;  5CER A;  4N9K A;  1GHM A;  3UNW A;  3BRM A;  3ZG5 A;  3PBR A;  3MGP C;  1WWI A;  4JJN D;  4J8X A;  1BUE A;  3O3V A;  1YLZ A;  1P3B A;  4D2O A;  3MGP B;  3LEZ A;  3ITB A;  3LZ1 A;  3S4X A;  1TEM A;  4S2N A;  1P3O D;  3N8S A;  1XGJ A;  2Y91 A;  3WA9 D;  3ZVW A;  3VH5 W;  4QD4 A;  2Y2I A;  1EQZ D;  3OC2 A;  4JKT A;  4Y0U A;  4J8U D;  2HUE C;  3V50 A;  1TZY C;  4ZJ3 A;  5CHU A;  4S2L A;  1YM1 A;  1K4E A;  3IF6 A;  3C5A A;  4UPK A;  5BNV A;  1M1A B;  1YU0 A;  4MBH A;  3TU4 A;  4IBF A;  1YU1 A;  1HD8 A;  5BO0 B;  2H0T A;  3DW0 A;  4ID4 A;  5AV5 B;  3MGQ D;  1PW1 A;  3AN2 D;  4WNN A;  1P3A A;  4WU8 A;  2BYK B;  3DWK A;  3AYW B;  3WAA A;  4K0X A;  2CV5 A;  1M6K A;  3SS4 A;  4J8W B;  5B31 D;  3B6G B;  1W5D A;  5B31 G;  3REH A;  4UAA A;  5GLA A;  3LZ0 A;  1I5Q A;  4KUD C;  1GHI A;  3OPH A;  2IO5 C;  4N1H A;  5HAR A;  3UTA A;  3CZD A;  1SHV A;  1P3G B;  1YLJ A;  3AZL A;  4YS3 B;  2ZY2 A;  3X1S B;  3IXD A;  4DF6 A;  1U35 B;  2ZQ7 A;  1FR6 A;  1CEG A;  1JTD A;  4X53 A;  3UT9 B;  3WKJ C;  2EX6 A;  4J8V B;  3HLC A;  2B5R A;  5DNN A;  5AVB B;  3S1Y A;  3FZC A;  5CGX A;  4G91 C;  5C3I B;  3NC8 A;  5CP6 B;  5E2G A;  4IBJ A;  2W8S A;  4NZ1 A;  3MVD C;  1TDG A;  3LEL B;  4E3L A;  5GT0 D;  1Y54 A;  3WRZ A;  3X1V A;  3L28 A;  1M18 D;  1DJC A;  2VQR A;  3O87 A;  3NCK A;  3H0L C;  1WWS A;  3KS4 A;  3MNN D;  1FR1 A;  2H0Y A;  1NZO A;  3A3E A;  2X71 A;  2ZLY A;  3MZE A;  2ZY5 A;  3IQA A;  4LG2 A;  2Y4A A;  4IVI A;  1AOI B;  3V3S A;  2BYM B;  4WBG A;  5B33 A;  2J9O A;  1PZO A;  5B24 A;  1FCM A;  1K57 A;  3L29 A;  1KX4 A;  3X1U D;  3W98 B;  3B0D C;  1E4D A;  3W99 D;  1DJA A;  3V9R B;  4QLC A;  4U0X A;  3VOZ A;  1P3I C;  3AZF B;  1P3L C;  2ZM0 A;  5JRG B;  4JF4 A;  4Z5T D;  5EVI B;  2BLS A;  1BFM A;  4R0Q A;  3N4I A;  3ZG7 B;  5KMW A;  5AVC D;  5CHL B;  2ARO D;  3NBL A;  4IJE A;  5B2I D;  4WU9 A;  5GXQ D;  4KGC B;  4OQI A;  3TOI A;  4BD0 A;  3REL C;  1IEL A;  3HBR A;  4AWL C;  4BLM A;  3G2Y A;  3AFA D;  4YFM A;  5CPK C;  1QMF A;  2Y2G A;  3BEB A;  1M40 A;  1P3M A;  3RXX A;  1P34 D;  4DXC A;  4GKU A;  5B32 G;  5E5A D;  3S22 A;  3MGS B;  5BS7 A;  1K54 A;  5FQQ A;  5GSU D;  3C1B C;  2V1Z A;  5B0Y A;  4X23 C;  4E3M A;  2WKH A;  4OJ5 A;  3REK A;  5DNM A;  4DXB A;  3REJ B;  3N8L A;  5F99 C;  3X1T C;  3MZF A;  3NQJ A;  2NQB D;  3SS5 A;  3W96 D;  3MKE A;  4G92 B;  2Y2O A;  3SH7 A;  1K56 A;  5G49 A;  1S0W A;  5DTT A;  3A6N C;  4KHA B;  1F66 C;  5HL1 A;  3AV1 A;  4WMC D;  1P3P A;  2J9P A;  4MNR A;  4FSF A;  3UTB B;  2X01 A;  1NXY A;  4LV3 A;  5B1M B;  1ID3 A;  3C1C C;  5B0Z C;  1Q9C A;  5B0Z B;  1HQ3 B;  2ZQ9 A;  3BLM A;  3M2J A;  1TVF A;  2HIO A;  5CTM A;  1P3B C;  3MGP D;  3ZGA B;  4J8X B;  3LZ1 C;  4S2N C;  3LZ1 B;  4XZQ C;  4FH2 A;  3B3X A;  5M18 A;  5GLB A;  1BZA A;  4DDY A;  1NYM A;  1E3U A;  2Y2N A;  5AV6 B;  3VP0 A;  3UPO A;  3A1I A;  3ZCZ A;  1CK3 A;  4PM8 A;  3MGR A;  3WS2 A;  1T3U A;  3E2L A;  5HX9 A;  1M19 B;  5AV9 B;  3KSY A;  2ZQD A;  2OSU A;  3IF6 B;  1KVM A;  2JSS A;  1M1A D;  3UDX A;  3VP4 A;  4OJO A;  3IH8 A;  5B1L B;  4YIN A;  4KQO A;  3TU4 B;  1MKI A;  3AZI C;  2XDM A;  4GH9 A;  3O86 A;  5FQI A;  5AV5 D;  1MWS A;  4ZTK A;  4WU8 C;  4OP8 A;  2J8P A;  1P3A B;  4H9N A;  4E6X A;  3HL9 A;  1IKI A;  4KZ9 A;  3WAA C;  3AYW D;  1ERO A;  2NZD C;  1MWR A;  4QB8 A;  3W97 D;  1YMX A;  2V2F F;  3REI C;  4DQY B;  2CV5 B;  4WZ5 A;  5KSH A;  3BEC A;  4IJF A;  4M6B A;  4J8W D;  3ZG0 A;  3B6G D;  3REH C;  4GHL A;  4IBD A;  3UTA C;  4OON A;  3LZ0 B;  1P3G D;  3EPK A;  3AZL C;  4YS3 D;  5GT3 A;  3X1S D;  4E3O A;  1U35 D;  3W4O A;  3G32 A;  3UT9 D;  2RCX A;  5EE8 A;  3O88 A;  4XUX A;  4J8V D;  4JF5 A;  4KUD A;  3ZG8 B;  5AVB D;  3AZN C;  5DNN B;  3A3F A;  4PM6 A;  5CP6 D;  5FAQ A;  4GNU A;  3WKJ A;  3LEL D;  3G34 A;  4Z2M G;  4DDS A;  4ZUX C;  4OP5 A;  1EI5 A;  3X1V C;  4S2K A;  3VP1 A;  3MVD A;  5CGS A;  1HTA A;  4WJ3 C;  2F8N A;  3M2K A;  1YU3 A;  3O62 B;  3NQU A;  1LL5 A;  5BNX A;  3WX7 A;  4N92 A;  2RVQ C;  1S32 D;  4QHC A;  4DE3 A;  4WEK A;  3FDD A;  3UDF A;  5HAP A;  1AOI D;  4ZDX A;  4QY5 A;  2ZC3 B;  1K57 C;  5B33 B;  1KX4 C;  4CAY B;  5B24 B;  1IYP A;  3W98 D;  3N3F A;  5EEC A;  3G30 A;  3HLF A;  4LD9 A;  3AV2 C;  2WGV A;  4QLC B;  3AZF D;  4R4R A;  5JRG D;  1NZU A;  5EVI D;  4KG5 A;  4RX3 A;  3KUY D;  1JFI A;  1IYS A;  3GSG A;  2Y2M A;  1P3I A;  4B88 A;  4KGC D;  4WU9 B;  4NZ5 A;  4PM7 A;  1BLC A;  2EX2 A;  5FI6 A;  1KGG A;  1BH8 A;  5TGF A;  3SH9 A;  4UUZ A;  3IWO A;  3AZE A;  1BH9 A;  2PU4 A;  3REL A;  1KE0 A;  1FCN A;  1XXM A;  1K4F A;  3EPL A;  2WZZ A;  3P98 A;  4OPR A;  4LV0 A;  2IWC A;  5KZH A;  1PWD A;  3AZH A;  3WTP B;  1WYC A;  2PYO C;  2Y2H A;  1P3M B;  2FJ7 C;  4JXW A;  3FWL A;  4PPR A;  4XUZ A;  4EV4 A;  3MGS D;  2G2W A;  5BS7 C;  3AZJ D;  3EPJ A;  4GDB A;  5CPI B;  2WUQ A;  5GLD A;  4JBF A;  4IED A;  1KX5 C;  5B0Y B;  2XFS A;  2XD1 A;  3REJ D;  4H9P A;  3REK B;  5DNM B;  3C1B A;  4X23 A;  4JXG A;  4XUJ C;  3PAG A;  5B32 C;  3NQJ B;  5BPV A;  4M3K A;  3OPL A;  3AZM C;  5F99 A;  2QPN A;  2WGI A;  3X1T A;  1JTG A;  5DF7 A;  3AV1 C;  3H0M C;  1P3P C;  3UTB D;  4BL2 A;  1JWZ A;  1ULY A;  5EPH A;  1H3O B;  5D3O A;  4LV1 A;  3A6N A;  1ID3 C;  5B1M D;  2YFV B;  5B0Z D;  1HQ3 D;  3HLG A;  3A3I A;  4GN2 A;  5AV8 A;  5E2E A;  4S2O A;  2HIO C;  1P3F C;  4RVA A;  2Y2Q A;  1XGI A;  2HIO B;  4J8X D;  4H9Q A;  4JPM A;  5FSR A;  4IBX A;  4E3I A;  3LZ1 D;  3MKF A;  3H0R C;  3HON A;  4NYU A;  4OLG A;  2YFW A;  5AV6 D;  3IH9 A;  3BFF A;  2E8I A;  2DNS A;  3EQV A;  3MGR C;  4XZQ A;  5GHY A;  3L27 A;  1J9M A;  1M19 D;  5AV9 D;  1H8Z A;  5B40 C;  4YM6 A;  1FSW A;  2HUE B;  1ZLA A;  5B1L D;  1TZY B;  3TU4 D;  5DTK A;  1F1E A;  3GVB A;  3IXG A;  1ESU A;  4R8P C;  1FSY A;  1W8Q A;  1P3O A;  1P3A D;  2WAF A;  3CMZ A;  3AZI A;  5HW3 A;  2ZQ8 A;  1W79 A;  4H9N B;  1EQZ A;  2RL3 A;  1CI8 A;  1P3K A;  2CV5 D;  3KWQ A;  3HLD A;  4WZ5 C;  4E3K A;  5AY8 C;  5CGW A;  3V5M A;  2ZM8 A;  5TFQ A;  4BEN A;  2NZD A;  1ZC2 A;  3FV7 A;  1IYO A;  3REI A;  3LZ0 D;  5GT3 C;  1AXB A;  4OPY A;  3NY4 A;  5GT3 B;  4H9R A;  3M6B A;  3Q7Z A;  3LY4 A;  4KUD B;  2IO5 B;  5DNN D;  3MGQ A;  5FQM A;  3I7J A;  3AN2 A;  4HEF A;  5FQ9 A;  3WKJ B;  3RJU A;  2I72 A;  3AZN A;  3VOY A;  1TDL A;  3LJA C;  4G91 B;  3MXS A;  5A92 A;  4H9O B;  3OZH A;  5B31 A;  1MBL A;  3MVD B;  4ZUX A;  3GTC A;  5CPJ C;  3O62 D;  2PU2 A;  1K25 A;  2R9W A;  3NQU B;  5BNX B;  3Q7V A;  3B6F C;  2XGN A;  1PZP A;  1ZG6 A;  2ZMA A;  1MWT A;  4S2P A;  5B33 D;  4EO5 C;  5B24 D;  5GHX A;  3G2Z A;  3VSK A;  2FFY A;  4LD9 C;  1M18 A;  4BJP A;  4QLC D;  2Y2J A;  4NFT A;  4LD9 B;  3PBS A;  5FUG B;  3KXB C;  5A91 A;  1N1J A;  2FFF B;  4K0W A;  3B0D B;  4DRB A;  4DRT A;  3MNN A;  3C7V A;  3AV2 A;  1JFI B;  1PYY A;  2H10 A;  2XK1 A;  1P3I B;  2IWB A;  1P3L B;  4WU9 D;  1XP4 A;  1ONG A;  1L0D A;  3HLE A;  3SH8 A;  2ZC5 B;  4NY2 A;  4FD8 A;  3AZE C;  1HTZ A;  4MLL A;  4PM9 A;  3W99 A;  4UUZ B;  3AZE B;  4OVD A;  4GD8 A;  3REL B;  5HAI A;  4DRA A;  4AWL B;  2IOU A;  3AZH C;  3C4O A;  3WTP D;  1KDS A;  4Z5T A;  1E25 A;  2HP5 A;  1B6W A;  3A3J A;  1P3M D;  1Q2Q A;  5A93 A;  5M19 A;  1Q2P A;  1L0G A;  1DY6 A;  5CHM A;  5CPK B;  4JXS A;  3N6I A;  5CPI D;  2PYO A;  2FJ7 A;  1JWP A;  4WZS B;  5B0Y D;  4KZA A;  5DF9 A;  4HGA C;  2DQN C;  2HPB A;  3REK D;  5DNM D;  4H9P B;  1ERM A;  3C1B B;  1KX5 A;  4X23 B;  1YT4 A;  2RIQ A;  1PW8 A;  2QZ6 A;  2P9V A;  1YU4 A;  1K56 D;  5F99 B;  5DVA A;  3X1T B;  4JF6 A;  1P34 A;  4E3J A;  4XUJ A;  5B32 A;  2BG1 A;  4CJN A;  5E5A A;  3MZD A;  1L2S A;  3AZM A;  3N7W A;  3KFU G;  1KU5 A;  1JVJ A;  5KSC A;  3A6N B;  1PWG A;  1F66 B;  1MXO A;  5B2J C;  3L2A A;  3PBT A;  3IXH A;  3FKE A;  3AZG C;  5CXW A;  5AV8 C;  1ZG4 A;  1I2W A;  3C1C B;  3ZNY A;  1KVL A;  3WS4 A;  4IVK A;  2OLV A;  3W96 A;  3B0B A;  4WZ4 A;  1IKG A;  1GA0 A;  1G68 A;  2ZD8 A;  2IWD A;  4KZ5 A;  4WM9 A;  1P3F A;  4X6T A;  1KX3 C;  4WMC A;  1P3B B;  1E3U D;  4EUZ A;  5JYP A;  3TSG A;  1GCE A;  2EX8 A;  5AQ9 A;  4XZQ B;  3OCN A;  3AZK C;  5AQB A;  5HFO A;  4YM6 C;  1ZLA C;  1BLH A;  2ZM5 A;  1TZY D;  1PI5 A;  1GA9 A;  5B40 A;  4JJN C;  1LHY A;  1PI4 A;  1XKZ A;  4BD1 A;  3HUN A;  3R45 A;  3NDE A;  5BNV B;  3UPP A;  5DF8 A;  3IF5 A;  1P3O C;  4R3B A;  3WA9 C;  2XLN A;  1ONH A;  2ZQC A;  1EQZ C;  5JA4 A;  3AZI B;  5CEC A;  4R8P A;  2ZQA A;  1P3K C;  4J8U C;  4L0L A;  4MBF A;  3KWQ C;  1P3K B;  3VH6 T;  4WNN B;  4WU8 B;  3KWQ B;  2ZY4 A;  3B0C T;  2F8N K;  2HP9 A;  1HVB A;  4N1X A;  3WAA B;  2C6W B;  2NZD B;  3REI B;  5AY8 A;  3HSH A;  1TAF A;  2VGJ A;  5GT3 D;  4KZ8 A;  5FQK A;  3REH B;  1FOF A;  5BO0 A;  5GHZ A;  4KQQ A;  4H9R B;  4KUD D;  3MGQ C;  3UTA B;  3AN2 C;  3ISG A;  4DE0 A;  4H8R A;  3AZL B;  4HBT A;  4LCL A;  3AYW A;  3WKJ D;  4IBC A;  3W97 A;  3AZN B;  4NE6 A;  2F8N H;  3UE0 A;  5B31 C;  2G5I C;  1W8Y A;  5I94 A;  3MVD D;  3W8K A;  4R4S A;  4ZUX B;  3LJA A;  2PBY A;  3VFF A;  3X1V B;  4Z2M H;  1FCO A;  5FAT A;  1YLY A;  4B4X A;  3GV9 A;  5E43 A;  3Q7V B;  2Z2M B;  5CPJ A;  1Z6F A;  4GB7 A;  4E45 A;  4OKP A;  5F1G A;  2WYX A;  3AGE A;  5CP6 A;  3G31 A;  4KZ7 A;  4NET A;  2ZM2 A;  3B6F A;  4UHU A;  3LEL A;  1YUE A;  5GT0 C;  5M1A A;  3ZHH A;  1M18 C;  4OQ0 A;  2WK0 A;  4LD9 D;  2WAE A;  3PBO A;  1KX4 B;  5L2F A;  1N1J B;  3MNN C;  4CSR A;  1I2S A;  3C4P A;  4PMA A;  3AV2 B;  4FH4 A;  1P3I D;  1P3L D;  3KXB A;  1S32 A;  4NZ4 A;  4EQI A;  4OUI A;  3QNC A;  5F83 A;  1NYY A;  3VP2 A;  3X1U C;  4KQR A;  3W99 C;  3AZE D;  3PAE A;  3V9R A;  3REL D;  4IBB A;  1OME A;  2DRW A;  3AL0 C;  1QME A;  4ZJ1 A;  4KZB A;  4Z5T C;  3FYZ A;  3VH5 A;  3KUY A;  5GLC A;  3IHB A;  1PZR A;  4Y0O A;  2ARO C;  5CPK D;  5B2I C;  5GXQ C;  1RP5 A;  4KGC A;  2PYO B;  2FJ7 B;  1N4O A;  1HZO A;  4O7D A;  4E6W A;  3HUM A;  5EOO A;  3BFG A;  4ZBJ C;  3C1B D;  4KEN B;  2XH9 A;  3ZVT A;  4X23 D;  4ZBJ B;  1O07 A;  3ZG9 B;  1KX5 B;  4ZBE A;  4P87 A;  5BT1 C;  1BLS A;  4X68 A;  5F99 D;  3X1T D;  1P34 C;  3W4Q A;  5E5A C;  4XUJ B;  5B32 B;  2A49 A;  3TG9 A;  1S6R A;  3IWI A;  2ZC6 B;  5G49 B;  3AZM B;  3AZJ A;  4C3Q A;  3RXW A;  5J8X A;  1LI9 A;  4X69 A;  3A6N D;  3EPH A;  3QHY A;  5GSU C;  1VM1 A;  1F66 D;  1VQQ A;  3AV1 B;  3BFE A;  1KE4 A;  4GZB A;  1P3P B;  1ID3 B;  4QU3 A;  4DKI A;  3C1C D;  5B2J A;  2NQB C;  3OPR A;  3EQU A;  3W96 C;  2HDU A;  3IXB A;  5KDM A;  3W96 B;  2ZC4 B;  3AZG A;  1BUL A;  4LEN A;  1YU2 A;  4NE3 A;  3UE1 A;  3WS5 A;  3PBN A;  1P3F B;  2WAD A;  1P3B D;  4H9S C;  4BQM A;  2F2A C;  4XZQ D;  2HDQ A;  3VH5 T;  5B1M A;  3QNB A;  3BM6 A;  4GHA A;  1KX3 A;  4UA6 A;  1O7E A;  1HQ3 A;  4OQH A;  4B4Z A;  3MGR B;  3AZK A;  5B40 B;  1ESI A;  3IT9 A;  4Z66 A;  5FA7 A;  4GD6 A;  3R45 B;  1RGY A;  4JJN A;  2EXA A;  4LCM A;  3AZI D;  4IBR A;  5JA4 B;  5AV6 A;  4R8P B;  1P3K D;  3KWQ D;  4WU8 D;  1L0F A;  3WA9 A;  4GOG A;  1M19 A;  3DTM A;  5AV9 A;  3WAA D;  2C5W B;  2NZD D;  4J8U A;  1Z2C B;  5CHJ A;  1M1A C;  1YLP A;  3REI D;  2EFX A;  2WGW A;  1CEF A;  5AY8 B;  5B1L A;  1SDE A;  4KZ6 A;  1TAF B;  3ITA A;  3REH D;  2UWX A;  4E44 A;  3ZNT A;  3HRE A;  4OOM A;  5AV5 C;  3UTA D;  1XX2 A;  3AZL D;  2Q9M A;  2ZJ9 A;  3AYW C;  2OLU A;  5FI2 A;  3WWX A;  3W97 C;  1BSG A;  3AZN D;  3W97 B;  4KG6 A;  4NYY A;  4DE2 A;  4J8W C;  2X02 A;  4DE1 A;  3B6G C;  3KS8 A;  4GDN A;  5E2H A;  1XA1 A;  1SKF A;  4ZUX D;  1P3G C;  3X1V D;  3LJA B;  4YS3 C;  3X1S C;  2Y2L A;  3E2K A;  2GDN A;  1U35 C;  4R3J A;  3NIA A;  4KZ3 A;  3L25 A;  4WV4 B;  3UT9 C;  4J8V C;  3NDG A;  2F8N B;  5AVB C;  4OPZ A;  4QNL A;  3P09 A;  3BYD A;  5C3I C;  1L0E A;  5CPJ B;  3AGD A;  5EUA A;  5CP6 C;  2ZC7 A;  2A3U A;  1KGE A;  3LEL C;  2RVQ D;  2G2U A;  3B6F B;  3PBQ A;  2LY8 A;  3M6H A;  1G6A A;  4Z9Q A;  2G5H C;  1K38 A;  4IBG A;  5AQ7 A;  4HBU A;  1ZKJ A;  1EWZ A;  4XXR A;  1KX4 D;  4EO5 B;  5GT0 A;  4WYY A;  5F1F A;  3W4P A;  3O62 A;  3MXR A;  2JBF A;  4CSR B;  3AV2 D;  4X55 A;  1SCW A;  3GMW A;  3OCL A;  4Y7P A;  1S32 C;  1KE3 A;  1WYB A;  2V20 A;  3KXB B;  3IWQ A;  1S32 B;  1AOI C;  5BOH A;  4CPK A;  3IHA A;  3NI9 A;  1BT5 A;  4CAY A;  2CWE A;  3W98 C;  1K55 C;  2Y2K A;  2XEP A;  3UE3 A;  1MWU A;  3AZF C;  3IP4 C;  1BH8 B;  5JRG C;  3X1U A;  1PWC A;  5EVI C;  4NZ3 A;  3WS1 A;  3KUY C;  1BH9 B;  3UO9 A;  3KUY B;  1H5X A;  4JXV A;  2J7V A;  1IYQ A;  3P5J B;  4UA9 A;  2XR0 A;  3C7U A;  4KGC C;  4EWF A;  3AZH B;  5EOE A;  2PYO D;  2FJ7 D;  5AVC A;  1W2E A;  4R23 A;  1ES2 A;  2ARO A;  1C3B A;  1XA7 A;  5B2I A;  5GXQ A;  3SOI A;  1NY0 A;  3MFD A;  1R4V A;  4RYE A;  2EX9 A;  5EVL A;  1KX5 D;  4OOL A;  3WS0 A;  4JLF A;  4IBK A;  4HGA B;  5BT1 D;  3WTP A;  1ES4 A;  3HLB A;  3AFA A;  4OJ6 A;  4XUJ D;  1LI0 A;  5B32 D;  3MGS C;  4FCF A;  4NE5 A;  3VH6 A;  3AZJ C;  3AZM D;  3UN7 A;  5CPI A;  3AZJ B;  3AV1 D;  1P3P D;  2JE5 A;  4MBK A;  3N8R A;  3LCE A;  3A3D A;  3REJ C;  3G35 A;  5GSU A;  1ID3 D;  5B2J B;  4G92 C;  5CRF A;  2Y2P A;  1MY8 A;  5KDM B;  3PTE A;  3AZG B;  5AV8 B;  4A5R A;  1LL9 A;  2NQB A;  2HIO D;  1P3F D;  4S2J A;  3UTB C;  1ALQ A;  4H9Q B;  1H3O A;  5FAS A;  1GHP A;  5B1M C;  3VMA A;  2YFW B;  2YFV A;  4H9S A;  1KX3 B;  3JYI A;  1HQ3 C;  4X56 A;  1B67 A;  4MEZ A;  4NK3 A;  1PIO A;  2WKE A;  3MGR D;  5GL9 A;  5TR7 A;  3AGF A;  4QJG A;  3AZK B;  3OPP A;  5B40 D;  4YM6 B;  4J8X C;  4Z66 C;  3EG5 B;  1KDW A;  4Z66 B;  3BFC A;  1ZLA B;  4U3T A;  4U0T A;  4R1G A;  3MGP A;  4JJN B;  5AV6 C;  1ES3 A;  4R8P D;  2XF3 A;  1P3O B;  1M19 C;  3CG5 A;  5AV9 C;  3WA9 B;  5U47 A;  1EQZ B;  3IF6 C;  4BL3 A;  4K91 A;  4J8U B;  1BLP A;  4Y0T A;  5AY8 D;  5B1L C;  2WGW B;  1TZY A;  4P0M A;  3TU4 C;  4EBL A;  2DF4 C;  2H5S A;  1YQS A;  3MBZ A;  1M1A A;  2ZY3 A;  1SDN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...