2Y2HA

Penicillin-binding protein 1b (pbp-1b) in complex with an alkyl boronate (za2)
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
487
structure length
467
Chain Sequence
SEITYSDGTVIASIDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTGQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Guided Design of Cell Wall Biosynthesis Inhibitors that Overcome Beta-Lactam Resistance in Staphylococcus Aureus (Mrsa).
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
molecule keywords PENICILLIN-BINDING PROTEIN 1B
total genus 159
structure length 467
sequence length 487
chains with identical sequence B
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2y2hA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2y2hA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2y2hA02
4KZ8A 1IELA 2Y2OA 3UN7A 4GD6A 1W8YA 2Y2HA 1XXMA 3VSLA 4BL3A 5EUAA 2Y2LA 5E2FA 1SCWA 3AGDA 4K91A 3PBSA 1KE0A 4ZJ3A 1N4OA 3E2LA 1Y54A 4R1GA 3IXHA 1YLYA 4WELA 1CK3A 3FZCA 1L0EA 4X53A 3SS5A 5E43A 1BLPA 1NJ4A 5EVIB 1O07A 1Q2QA 4DE1A 2I72A 1NY0A 4WMCA 3C7VA 2XH9A 3HREA 4WZ5A 5HAIA 3W4PA 3G32A 1K55C 5FATA 4RA7A 1S0WA 1ZKJA 2R9XA 3EQVA 1QMFA 3MKEA 3N8LA 5HL1A 4MBFA 3IF5A 4OPZA 5DTSA 4UAAA 1WE4A 3Q7VA 4D2OA 5M1AA 4HESA 4DXBA 2ZC7A 2ZLYA 3G4PA 3BFEA 3IWOA 5GLAA 3S1YA 1YM1A 4S2KA 1K57C 1K4EA 4KENB 1VQQA 4KQQA 2ZD8A 5CHMA 4PM6A 2Y2MA 4X56A 3ZG5A 4BD1A 2HDRA 3VOYA 2H10A 2Y59A 4RYEA 2XR0A 1U60A 1RP5A 4UA6A 2XK1A 4WMCD 5F1GA 2X01A 3M2JA 1YLTA 1FOFA 3VFHA 3G2YA 3MZFA 1W5DA 5EECA 2ZQAA 4QD4A 4E3KA 3OPRA 3VMAA 4A5RA 1O7EA 4HEFA 4LCLA 4XXRA 4EBNA 3C7UA 4X69A 3LY3A 5HAQA 3FWLA 3MFDA 1ONHA 5TFQA 4QY6A 4KZ9A 4KQOA 1ES4A 1JTGA 4FH4A 4S2LA 5GL9A 3TSGA 5CTNA 1ERMA 3ISGA 2WGVA 2ZJ9A 4XUZA 3PAEA 4NETA 3IXGA 3UPNA 1HD8A 2EX2A 3IT9A 1HVBA 3IHBA 4IVIA 5FQ9A 5E2HA 4YINA 2Y2PA 3UE0A 3ZVTA 1KGEA 2PU2A 1H8YA 3N4IA 2QMIA 4XUXA 3ZG8B 1MWTA 3JYIA 1KE4A 2FFYA 1KE3A 3IXDA 4K0WA 5HAPA 4JXWA 2J7VA 3BRMA 1IYOA 4P0MA 2EFXA 4Y0OA 4EQIA 1YMXA 3P98A 3UY6A 1PWCA 2E8IA 3G30A 3PBOA 3IQAA 2WKIA 4FCFA 5FASA 1M40A 3B3XA 3VP3A 3OCNA 4WEJA 4U3TA 4U0XA 2ZQCA 5CTMA 2IWCA 4IVKA 3N8RA 3N8SA 4ZTKA 1GA0A 4PMAA 3UE3A 1K38A 5CRFA 3VP0A 1JVJA 2H0TA 3O86A 5U47A 3TOIA 4S2IA 4OQ0A 1K25A 4S2NA 1XA1A 1G6AA 1NYMA 4RX3A 1L2SA 1ESIA 3HLEA 2P74A 3G2ZA 1J9MA 1K55A 2ZQ9A 4KZ4A 5CHUA 2Q9MA 3DWKA 1ALQA 4X68A 4RVAA 4OLGA 4KG5A 1BZAA 3WRTA 1FSWA 4DF6A 1I5QA 5EOEA 3IXBA 4R4RA 4QB8A 1JWPA 1M6KA 1CEGA 4IBXA 3HVFA 1LL9A 4WZ4A 3DWZA 2A3UA 3VOZA 1GCEA 3ZNTA 3FV7A 3ZCZA 4WBGA 1E4DA 5EPHA 5HW3A 4R3JA 1PYYA 2JBFA 3V3RA 5L2FA 3NDEA 4JF4A 4S2PA 1EWZA 1KGFA 2EX6A 1BULA 3UPOA 3UDXA 1TEMA 4PM7A 3CMZA 3NCKA 3D4FA 3OC2A 1YT4A 2V2FF 3ZG7B 3A3FA 4RX2A 5FDHA 2XGNA 3VP4A 4E3IA 3GR2A 5CEDA 4R3BA 2XD5A 4OOYA 4WM9A 3CJMA 1FSYA 4EBPA 3MKFA 2Y2JA 5F82A 1SDNA 1WYBA 2WYXA 2C5WB 1S6RA 5J8XA 3MZEA 1QMEA 4ZBEA 3HLWA 2Z2LB 1ZC2A 1XKZA 2OSUA 3O88A 4E3MA 3ITBA 3ZHHA 4ZJ1A 3BM6A 4OP8A 4H8RA 3PAGA 4OQHA 1K4FA 5A91A 1MWRA 4E3NA 2WZZA 3HUNA 2RL3A 2FFFB 2B5RA 1Q2PA 1FCMA 4JKTA 5KSHA 2OLUA 3Q7ZA 4QU3A 5HX9A 3ZNYA 4C3QA 1LL5A 1MWSA 4KZ7A 1RCJA 3ITAA 3PBNA 3PTEA 4S2OA 3WWXA 1NZOA 1DJAA 2GDNA 4QHCA 4B88A 3MBZA 1W79A 3NBLA 1JTDA 4JPMA 3OPHA 1ES5A 2G2UA 2Z2MB 5AQ7A 1ZG6A 5EOOA 3SH9A 1WYCA 1IYQA 4P85A 4GN2A 1TDGA 3UNWA 2ZC3B 3AGEA 3Q7VB 2WK0A 4OONA 2WGWA 3NIAA 3SS3A 4O7DA 4Y7PA 2J9PA 1PI4A 4QY5A 3OZHA 2ZMAA 2Y2QA 3ZGAB 3CG5A 2ZM0A 1YLWA 3FKVA 4E3OA 2G2WA 4P87A 4C6YA 2HPBA 3GTCA 4DDYA 3A3DA 3GV9A 1BSGA 2X02A 1CI8A 4JLFA 5HARA 4N92A 1SDEA 3OPLA 3VFFA 4MLLA 1IKGA 2EXAA 1ES3A 4KZ6A 1GA9A 5G18A 3IF6B 4GDBA 4KZ5A 4KZAA 5A90A 1GHIA 4JF5A 3FKWA 1SHVA 3MZDA 4HBTA 4B4ZA 3E2KA 4BENA 2OLVA 1PWGA 3BFFA 5FI6A 5A93A 5JYOA 4LV0A 2IWBA 1DJCA 2DCFA 2IWDA 4N9KA 4GNUA 5TR7A 5GHXA 2P9VA 5GLBA 3LCEA 4GD8A 4FH2A 4HBUA 3OCLA 1IYPA 3BLMA 4Q8IA 1EROA 4WYYA 2HDQA 5KZHA 3IF6A 1IYSA 1PZPA 1PZOA 2H0YA 2WUQA 2HP6A 3HLDA 2ZC5B 3IHAA 4GOGA 5EVID 4P6BA 1PWDA 3QHYA 5EE8A 1I2SA 3BECA 3BFCA 3DTMA 4EV4A 4UA9A 3BLSA 4EUZA 1XP4A 4ZAMA 5AQ9A 3OPPA 4OP5A 4MEZA 4U0TA 2XFSA 4QJGA 4Y0TA 3GQZA 4JBFA 1OMEA 3O3VA 2Y2NA 5FQJA 4YFMA 5CEBA 1KDSA 5F83A 2Y55A 3GMWA 4E6WA 3QNCA 3UDFA 1BLHA 2X71A 4M3KA 4DRTA 3WS0A 4OPRA 5CGWA 5DTTA 2J9OA 3PBQA 1FCOA 1BLCA 3V3SA 1N9BA 3C4PA 3PBTA 3BYDA 1E3UD 1BUEA 3ZFZA 1ES2A 4GZBA 1MKIA 1NRFA 2WGIA 4K0XA 2Y4AA 5F1FA 4Z9QA 1XX2A 1YQSA 5DF9A 1YLPA 5FAQA 4OQIA 3HLGA 5HFOA 3ZDJA 1ESUA 3NY4A 1TDLA 2HP9A 1ONGA 3P09A 5FA7A 2WADA 4PM5A 3AGFA 3HUMA 1GHMA 2ZQ8A 5GHYA 1JWZA 1L0FA 5AQBA 3UE1A 3HL9A 2R9WA 1JWVA 1RGZA 2ZC6B 5FAOA 3V5MA 4CPKA 2VGJA 3A3JA 3S22A 2PU4A 5TGFA 2Q9NA 2DRWA 1E3UA 5FQIA 4DXCA 1CEFA 2UWXA 1PI5A 5E2GA 1LI9A 3WS4A 5GLDA 2ZM2A 5BOHA 2JE5A 2ZM8A 5DF7A 3SS4A 4BLMA 3LY4A 4DE3A 4JF6A 3IH9A 3Q07A 3ZVWA 3NDGA 5FQMA 4R0QA 3A3IA 5CECA 5GHZA 1PW8A 2BLSA 4PM8A 2EX9A 1KGGA 4S2JA 4OPQA 3VSKA 1LHYA 4OH0A 3Q81A 5DTKA 4N9LA 3C4OA 2WZXA 3ZG0A 2RCXA 4NK3A 5CHJA 1GHPA 5FI7A 2WGWB 4KZBA 1YMSA 1K6RA 3IWQA 2ZQDA 5KSCA 4S2MA 1DY6A 1KDWA 5EVIA 1AXBA 3G35A 4OVDA 2HP5A 1EI5A 2EX8A 2ZC4B 3HLFA 5DF8A 1RGYA 4E3LA 4FSFA 3WRZA 5FAPA 1LLBA 2Y91A 2WKHA 2WAEA 3FYZA 5M19A 4OPYA 3MXSA 2V20A 3M6BA 1SKFA 1L0GA 3HLBA 2OV5A 3UDIA 2XFTA 4CJNA 1PIOA 5IHVA 1TVFA 1Z6FA 3N7WA 1W8QA 1MPLA 1C3BA 5FSRA 3A3EA 3W4OA 2XEPA 1VM1A 1YLZA 1W7FA 4GKUA 5FQQA 1K56D 4PM9A 1K54C 1IEMA 1XPBA 2BG1A 3HUOA 5EVLA 1CI9A 1K54A 3LEZA 4DE0A 4DKIA 4ID4A 2JCHA 4LENA 3W8KA 3WS5A 3W4QA 1HZOA 3SH7A 3V50A 1BT5A 3O87A 3WS1A 3NC8A 3S4XA 1KVMA 1XGIA 3BEBA 5E2EA 2XD1A 3Q82A 1BLSA 3UO9A 1L0DA 3Q1FA 1FR6A 5EVIC 1MWUA 1K56A 3G34A 2V1ZA 3HBRA 4B4XA 1ZG4A 3BFDA 4EWFA 4JXGA 3UPPA 4PPRA 3SH8A 1MY8A 1BTLA 2HDSA 4UHUA 5CERA 4BJPA 1DJBA 2P9VB 3EQUA 3CZDA 5I94A 4OOMA 1LI0A 3WS2A 1I2WA 4R23A 4S2NC 5DVAA 2XQZA 3LO7A 3IWIA 1NZUA 4LV3A 4BQMA 1H8ZA 1KVLA 1FCNA 3QNBA 5CGXA 4LCMA 5JYPA 4N1XA 2ZQ7A 4WZ5C 4E3JA 2C6WB 2DNSA 4LV1A 4UA7A 4GB7A 3TG9A 3VP2A 3RXWA 3GSGA 2Y2GA 1NXYA 5AQAA 4F94A 1PW1A 3N6IA 4MBHA 4OQGA 3GRJA 3PBRA 3RXXA 4EBLA 3IF6C 5CGSA 2H5SA 4ZDXA 3DW0A 4BD0A 3C5AA 5D3OA 3RJUA 2JC7A 4DDSA 3ZG9B 4BL2A 4KG6A 4WEKA 4C75A 1K6SA 3M2KA 2QZ6A 2XDMA 3GVBA 4N1HA 3VP1A 1K57A 2Y2KA 3HLCA 2HDUA 1IKIA 3I7JA 4L0LA 4OLDA 3NI9A 2WKEA 2XF3A 4OOLA 4R4SA 4DE2A 1FR1A 4JXSA 2QPNA 4IEDA 1MXOA 2EXBA 2Y2IA 1H5XA 3MXRA 5KMWA 1G68A 3M6HA 4KQRA 2J8YA 4KG2A 4GDNA 3SOIA 1XGJA 2PBYA 5A92A 2WAFA 1YLJA 3V39A 4IBRA 3IH8A 1MBLA 3BFGA 5M18A 4ZJ2A 4X6TA 1NYYA 4MBKA 4Y0UA 4FD8A 2XLNA 1FQGA 2A49A 1HTZA 2VGKA 4JXVA 2EFUA 1ERQA 5CXWA 4E6XA 4X55A 2CC1A 4KZ3A 5FQKA 1E25A 4OKPA 4MNRA 4LV2A 5GLCA 1XA7A 3G31A 5FI2A
chains in the Genus database with same CATH superfamily
4KZ8A 1IELA 2HUEC 2Y2HA 1XXMA 4I3AA 2RVQD 5DFXA 4BL3A 2YFWA 1S32D 3NQUB 4R3AA 5E2FA 4J8UD 3AGDA 3C1BB 4ZJ3A 3E2LA 3R7WB 2PAVP 1AOIB 3FZCA 1E88A 3WD0A 3P01A 2AROD 1BLPA 4NEED 5EVIB 1Q2QA 4O0PA 4H9PA 2I72A 1L3LA 3C7VA 4ZUXD 3HREA 2AROB 3W4PA 3ICYA 1QMFA 1P3MC 3A6NA 4OPZA 5DTSA 4EXOA 2W3GA 1TAFA 4CLCB 1SKOB 4X1MA 2NZDA 4KUDC 1P3LC 1G5UA 3G4PA 3IWOA 3QP2A 5GLAA 4S2KA 1K57C 5LBRA 3F1NA 2ZD8A 5CHMA 4X56A 3ZG5A 3WA9B 3UT9D 3KS4A 3UE6A 2X01A 1M18B 3VH6T 5JA4A 1YLTA 1FOFA 3RTYA 3MS6A 1ZLAB 4QD4A 1P3IB 4E3KA 3VMAA 1M18D 4NZ5A 1W63Q 3AZJC 2A24A 3LY3A 3FWLA 2IO5C 1ONHA 4KZ9A 4S2LA 4J8XA 1M1AD 1YU0A 3U4LP 3TSGA 4CLCE 3REIA 4G3KA 3PAEA 4NETA 3UPNA 1AWIA 4EERA 3D9YA 3IT9A 4Z2LA 3IHBA 5FQ9A 4YINA 1P3GC 5HWWA 4JGOA 1S1YA 2LY8A 1TS6A 1LSWA 4J8XD 3K3DA 3UMDA 1MWTA 1KE4A 4GHAA 1KE3A 1TZYB 2J7VA 4JXWA 2EFXA 4LFUA 3P98A 5CPJA 3MQ0A 4FCFA 1S32A 3UB5P 1XFQA 4ARZB 2PYRA 3F1PB 2VQRA 1P3AB 2ZQCA 5CTMA 3CLOA 4ZTKA 5MC7A 4G3VA 3X1TC 3B6GD 1GA0A 3UE3A 5CRFA 3VP0A 1B67A 3KXBA 1P3AD 2WKRA 4S2IA 2W8SA 1D06A 4MB4A 1N1JA 1H3OA 2P74A 3G2ZA 4KZ4A 3W99D 3X1UA 3W98B 1BZAA 1I5QA 1XFNA 1WA9A 5EOEA 5HSQA 4Y2FA 5G4YA 1M6KA 5C3IB 1CEGA 3BWLA 3HVFA 1KX5B 4LG2A 4R38A 1S1ZA 1YAXA 3ZCZA 5AVCC 4WBGA 1E4DA 5EPHA 1PYYA 3NDEA 4JF4A 3MGRC 1E8BA 5CPIB 2RVQC 1STZA 3CMZA 2CWEA 3QP5A 4H9SA 4JGPA 4WM9A 3CJMA 1FSYA 3MKFA 3C1BC 4I3JA 1P9WA 5BNXA 3MQOA 3PHYA 5EV0A 3UTAC 2C5WB 1S6RA 5F5YA 5J8XA 1QMEA 1JFIA 1ZC2A 5EM1A 2HUEB 2OSUA 4YWZA 2W0NA 4EEPA 4TX8A 3P7NA 3ZHHA 1OPXA 3AYWA 4NYYA 4OP8A 2INWA 4NKPA 2PT7A 4MB5A 5J7EA 4E45A 3NQUA 2L1MA 2RL3A 2XRNA 4QPRA 4IBDA 2B5RA 2NZDD 5B0ZD 2PDRA 3FPVA 3Q7ZA 3ZNYA 3AZHB 4IUKA 1MWSA 1Z2CB 5B32B 3WWXA 2GDNA 4QHCA 3MGRA 3WTPE 4HMEA 4HH3A 2A24B 2G2UA 2QKPA 4XZQB 4ESPA 3A0RA 2HIOA 1WYCA 4P85A 4GN2A 1TDGA 3GECA 4Q0JA 2HJ9C 4HP4A 1F66B 1NRJA 3SZTA 4OONA 2CV5B 3T4KA 1F5MA 3MMHA 1PI4A 4QY5A 3UMEA 4P6ZM 3REID 2J3TD 1UWNX 1P97A 3CG5A 2ZM0A 2HIOD 5JRGD 3A1KA 4ZBJC 3AZNC 3GV9A 3RELB 1BSGA 1CI8A 2ZY4A 1SDEA 3OPLA 3W97A 4JF5A 5CPKC 3TU4B 1SHVA 5AY8C 3NJAA 5B1LB 5F99B 4BENA 3BFFA 1VETB 5FI6A 5A93A 2G5IC 2PR5A 4HJ3A 5GLBA 1P3PD 4FH2A 3MGQC 1M19C 1BYWA 5EFWA 2PRFA 4WYYA 3S7PA 5KZHA 2H0YA 3HSHA 4UUZA 3IHAA 4P6BA 1F98A 3BFCA 3UTAB 4YS3D 4J8WC 5J4EA 4EV4A 4UA9A 1P3PA 2I9VA 3OOVA 3QP4A 5DNMB 3K3CA 2XFSA 1HTAA 5DKLA 5C5KA 4Z5TC 1EQZD 3GQZA 4OUIA 2O9AA 5CEBA 5F83A 5E5AC 1BLHA 2X71A 3WS0A 2WKQA 2FZ0A 3V3SA 1PRQA 2YKHA 3ZFZA 1ES2A 4JGQA 1GSVA 3MGRD 2Y4AA 5F1FA 3L27A 5FAQA 3TRCA 2L4RA 3NY4A 5BNVA 2WADA 3AGFA 4MN7A 1P3LA 2ZQ8A 3IX8A 1L0FA 4EO5B 4LRYC 3AYWB 5G49B 5AV5B 2R9WA 2RIQA 5TGFA 5FQIA 5GT0D 1KX3B 1H0MA 5AVFA 2JHEA 1CEFA 1P3LD 1LI9A 3B0BA 1GSWA 3O5YA 3H82B 4IBFA 5GLDA 1KX3D 4RQ9A 4DE3A 1U35A 5F69A 4R0QA 3VOLA 5CECA 5AV8B 3AZFA 5A8BA 3Q81A 3UTBB 3AZEB 2F8NK 4R8PB 3BY9A 4NK3A 1P34D 3IX3A 5FI7A 1T3UA 2CV5A 5L8MA 2J8PA 4MCWA 3AZED 1DY6A 5DNNC 1AXBA 3G35A 2ZC4B 2EX8A 1P34B 5DF8A 4E3LA 3RH8B 5BS7C 4NYUA 1YU3A 1LLBA 1NLYA 2VLGA 4HMDA 3MXSA 1YU2A 4NY2A 2XFTA 4CJNA 1PIOA 4J8UA 3WA9D 1Q9CA 5FSRA 4J8VB 3BW6A 3EGDC 3A3EA 2XEPA 5BPVA 3LUQA 4GKUA 2YFVA 3W97D 2QHKA 5KIZA 1CI9A 2FJ7C 4ID4A 3MJQA 3W8KA 3WS5A 3LELC 3V9RB 4LD9B 3O87A 3B6FC 1KOUA 3Q82A 5B40C 1P3AC 1P9RA 5G4ZA 1P3OA 4LD9D 1L0DA 1K56A 5GT3A 4GHIB 4PAUA 1AOIC 1ZG4A 3FG8A 5IS1A 3LFVA 1EW0A 4JJNB 1O6IA 5AV8C 4BJPA 4Z5TD 3EQUA 3HONA 3LJAA 5AVCD 5HDCA 1P3KC 3VH5W 4BQMA 1M19B 3IWIA 4OJ5A 4QLCD 4WL9A 4N1XA 2VV7A 3DTIA 4E3JA 2C6WB 4GB7A 1NXYA 1WWIA 4P6ZS 1PW1A 1P3IC 3W99B 4OQGA 3AFAA 3RXXA 4EBLA 3OBFA 5CGSA 5AV5A 3C5AA 3MNNA 2JC7A 3HJKA 4KGCD 2W3FA 2QYBA 4C75A 1K6SA 5GXQB 2XDMA 2M7VA 5KDMA 3HLCA 3T4TA 1IKIA 5B2JB 4OLDA 2WKEA 2XF3A 4JGRA 4JXSA 2QPNA 3MXRA 1F66C 3REHA 3M6HA 3LGOA 3SOIA 2PBYA 1E6RA 5A92A 4MN6A 2ZM5A 3WD1A 2ZL1B 3BFGA 4IJFA 4ZJ2A 5BNVB 4LRZE 1NYYA 2XLNA 4XUJB 4JXVA 1E15A 2EFUA 5CXWA 4X55A 4R70A 4IUHA 3AZLB 3KSHA 4MNRA 1IOUA 1XA7A 2JN7A 3NQJA 2ZOIA 3LZ0A 4GD6A 3O62D 2K7SA 5AV9D 2Y2LA 3H9WA 3F1OB 1UGUA 1SCWA 3IBJA 3EPHA 4K91A 4HIAA 3AZLC 1P3FB 2ACGA 3T4SA 3LJAD 3SS5A 3O62A 3IX4A 1NJ4A 4PHTA 1P3PC 5B33B 1NY0A 1ULYA 4ZBJB 3AV2D 1OTEA 3JVVA 2XH9A 4WZ5A 4WF0A 2R9XA 4I5SA 5C3IC 3AFAD 1M18A 1T1AA 3Q7VA 4GHIA 4DRAA 3AN2A 1M1AC 2ZLYA 3AV2A 5GSUD 2O99A 4KENB 4KQQA 4H9NA 2XA7M 5AVBC 3VE3A 2HDRA 2H10A 3A6ND 1TD5A 2Y59A 4FUWA 3KFUG 3AZIA 1UWPX 2VKSA 5CP6D 5AV6C 2ZQAA 3W99C 4HI4A 3X1TB 1DRMA 4LCLA 3C7UA 1P3OB 3KWQC 3T12B 3AZHD 2P08A 4KQOA 4FH4A 2BYMB 3MNNC 1TZYA 3X1TD 3ISGA 5GT3B 3WKJA 4R8PC 2EX2A 4EETB 3UE0A 3ZVTA 4Y13A 5KDMB 5F6AA 3RELA 3JYIA 1AIWA 3IXDA 1IYOA 5GT0C 3REHB 2V8FA 3UY6A 1P3BA 3IQAA 2WKIA 3VP3A 5B24C 3OCNA 4WEJA 4U3TA 1KX3C 3N8RA 3N8SA 4PMAA 5HL6A 5CPID 4G91B 4H9SC 1JVJA 2H0TA 3O86A 5U47A 3TOIA 3REKC 1P3KA 2OAQ1 1XA1A 4RX3A 1MC0A 1L2SA 3FKEA 3TU4D 4EEUA 3HLEA 3W96D 4E44A 2ZQ9A 2Q9MA 3B6GA 1GXDA 5CPIA 4J8WA 3B6FA 1FSWA 2MJ6A 4K08A 1B6WA 4WU8B 3MFXA 3LZ0B 1JWPA 4GW9A 3S7QA 1D7EA 3W96A 4IBXA 3VH6A 4WZ4A 5L2FA 3FC7A 1EAKA 4R3JA 4UQIM 3UT9A 2F8NH 1EWZA 1KGFA 3UDXA 3REJC 4IBEA 1OGGA 5B0ZC 1TEMA 4PM7A 1T19A 3NCKA 4D60A 3OC2A 5CEDA 3GR2A 2ZOHA 2XD5A 2B02A 4EBPA 3WTPB 3MVDB 2HIOC 1DP6A 5F68A 3DTKA 2ZY2A 3NOUC 5F82A 4HJ4A 3CWFA 2OAP1 3AZHA 4OJOA 4KUDD 1M1AA 3KYEA 3T4LA 1KS0A 4E3MA 5B31G 5B0YB 5GT3C 3L25A 5DKKA 2VJWA 2FN2A 1P3MA 3G6OA 3AZGC 4ETXA 2FFFB 2O9CA 1FCMA 2OLUA 1BH9B 5B24A 3MGQD 1P3FA 4QU3A 5HX9A 3RELD 1T18A 5JRGC 2W3EA 3L7HA 1A7WA 4Z66B 2NQBA 3ITAA 4KZ7A 3PTEA 5JRGA 1NZOA 4IBJA 4ZRRA 4H9PB 3WA9C 4JPMA 1G28A 5HPFA 5AQ7A 4ETZA 2HZ5A 1IYQA 2XA7S 2H28A 1KX4A 4R8PA 2BASA 5L07A 4MMNA 2F8NB 4QNLA 1N9NA 1XJ4A 3TU4A 3SS3A 4Z1WA 4Y7PA 2J9PA 3BY8A 2CMNA 2YFWB 3VE4A 3ZGAB 1FIKA 3LELD 4H9NB 1YLWA 4P87A 2R78A 4YS3C 4J8WD 3B6FD 3A3DA 3T1RA 4JLFA 4R8PD 3X1SD 3VFFA 4MLLA 4KZ6A 1ES3A 1AOIA 4GDBA 4Z5TB 5A90A 3REJA 4Q0IA 1P3BB 4WZSB 3MZDA 3E2KA 2OLVA 3B0DC 3KSYA 5AVBA 1EQZA 2IWDA 1P3BD 4GNUA 2VV6A 5GHXA 2P9VA 4CQHA 5B1MD 1DP8A 3OCLA 4BBUA 4Q8IA 1EROA 1P3KB 5B0YC 3IF6A 1PZOA 4BWIA 2ZC5B 4GOGA 1PWDA 4WJ3C 3DTMA 1P3KD 1V9YA 3VV4A 1XP4A 4I39A 4QLCC 3AZGA 3OPPA 4KUDA 3WAAC 3TU4C 4U0TA 3TJZC 3QP8A 3U2AA 4YM6A 4Y0TA 1OMEA 3HJIA 4YS3A 1KDSA 4ARZA 1ODVA 1L6JA 4HGAB 5FEGA 1W1TA 4IJEA 1TS0A 1YPRA 4XT2A 4IBIA 3PBQA 2GX5A 1N9BA 5GT0A 1OTBA 4GZBA 1MKIA 2WGIA 3R4KA 4XUJD 1XX2A 1YQSA 5DF9A 4OQIA 2NUTC 3HLGA 3L2AA 5TBMB 4NXBA 3AZFD 3H0LC 3WD2A 4H9RB 1TF1A 5CPJB 4H6JB 4R6LA 2PU4A 3S22A 2D49A 5AV8A 3AZFB 1E3UA 5EVEA 3LIEA 3MGPB 4NE6A 1MKMA 3QP6A 5B24B 3UT9B 4DXCA 4KUKA 5E2GA 5CPKA 5HWTA 2ZM2A 3MGQA 3LY4A 4JF6A 3IH9A 3ZVWA 3F6TA 3NDGA 3A3IA 3WTPA 3MVDA 2BLSA 3X1UB 2EX9A 1KGGA 3WA9A 4S2JA 1X0OA 2M7UA 2ZL1A 1LHYA 2GNXA 4N9LA 1KX4B 2RCXA 5CHJA 1GHPA 3REIC 2J3TC 2ZQDA 5KSCA 4S2MA 4J8XC 4ME4A 4OVDA 1EI5A 3KWQB 1RGYA 4GS9B 3MGPC 5FAPA 3LIDA 3LZ1C 2W3HA 2WAEA 4EUVA 4OPYA 3M6BA 3UDIA 4LD9C 5IHVA 3AYWC 3N7WA 1UR9A 4HH2A 3EEAA 3LIAA 1K56D 4PM9A 4JJND 1AOID 1IEMA 5AVBB 5EVLA 3HUOA 4F3LA 1CJFA 3DAVA 4BBTA 4DE0A 3FDDA 4DKIA 2GZAA 4MDZA 5AVBD 1N9LA 1HZOA 3S7OA 3SH7A 1BFMA 2OWHA 4H9OB 3S4XA 3CITA 1XGIA 4JJNA 3BEBA 2XD1A 3LR4A 1BLSA 2V8CA 2DF4C 4X23C 3W96C 1F66D 3G34A 2V1ZA 5E5AD 3B47A 1H3OB 1Y28A 4JXGA 3UPPA 4NG2A 4PPRA 3SH8A 2HDSA 4HOIA 5CERA 1P3GB 4E04A 2FH5A 3LEQA 4WU9B 3SW1A 1LI0A 3WS2A 1YSPA 3IS2A 4R23A 4S2NC 2XQZA 1FCNA 1U35D 5B1LD 1P3OC 2ZQ7A 1TZYD 3X1TA 3TG9A 4G3WA 3GSGA 2Y2GA 5AQAA 3EEHA 1XJ2A 1NLZA 5DNNA 2V1BA 4XUJC 5HDSA 4KHAB 2PD7A 5D3OA 4H6JA 3ZG9B 3WAAA 4YS3B 4WEKA 3AZLD 1H8MA 3M2KA 2QZ6A 4N1HA 4EW7A 4L0LA 3NI9A 3CUEC 1LSVA 3TE8A 3CI6A 3FPWA 4KQRA 3AL0C 3AZKC 3MGSA 4KGCA 4Q0HA 3AZLA 3IH8A 1W63M 1MBLA 2PR6A 1LSXA 3NQJB 3GDIA 5DNMA 2A49A 1HTZA 1GSXA 1ERQA 1TS7A 4E6XA 2CC1A 2PYOA 5FQKA 3C1CC 5TJJA 3AV2C 3B42A 4OKPA 3BJNA 2QJ5A 5AY8D 3MQLA 2K31A 3AN2C 1OGBA 4HJ6A 2Y2OA 3MGQB 2DQNC 1OTDA 3AV1B 3IBRA 5GSUB 5K5BA 1YSQA 2JKRM 4F3LB 1YUEA 1KE0A 3PBSA 1N4OA 1KU5A 5B2IB 3D3OA 1CK3A 3REKA 4X53A 5E43A 5B40D 2E8JA 3PR6A 1PNEA 5B0ZB 1O07A 4QLCA 4GHLA 3KWQA 3F1NB 4GS9A 1G6OA 1K55C 5FATA 4RA7A 1S0WA 1ZKJA 5CHLB 3AZKB 3IF5A 4UAAA 3LELB 3H82A 1E6PA 3H0RC 3MNND 5HWVA 2ZC7A 3WAAD 1K4EA 2PBDP 2L5AA 2QJ7A 5E5AA 4BD1A 3CAXA 4PKYG 1BH9A 4WNNA 1LL8A 2XR0A 4WMCD 4HMCA 4ZUXA 1F1EA 3KX0X 4LPZA 3VFHA 2QWSA 4YNRA 5JRGB 3MZFA 1W5DA 4H9OA 3OPRA 5B31A 4G92B 4EBNA 4YOFA 4EESA 3MFDA 1YU4A 1ES4A 5DNNB 5DJTA 2HF6A 2JKFA 1TZYC 3IXGA 1OTIA 4B9OA 1HD8A 3R45B 1HVBA 3X1VA 4IVIA 2D01A 1P3AA 3X1UC 4XUXA 3REJD 3LI9A 4K0WA 5HAPA 4OJLA 3BRMA 4Y0OA 3LZ0D 1YMXA 3REJB 2LB5A 3UT9C 3B3XA 1W1VA 1EQZB 4IVKA 3B6FB 3UTAD 1HQ3C 2Z6DA 4OQ0A 4S2NA 4EO5C 1G6AA 1M18C 1F9IA 1NYMA 2V9AA 1ESIA 1J9MA 1GOIA 3E4PA 2HJEA 1ALQA 3C8CA 3CHWP 4IBCA 4KG5A 4DF6A 4KUDB 2NZDC 2RTSA 4J8VC 3IXBA 1Z09A 2BYKB 4R4RA 3MGPD 2OWJA 4QB8A 4NZ3A 4EQ1A 1ID3B 5GSUA 2A3UA 3VOZA 1GCEA 3ZNTA 4FTXA 4Z2MG 3AYWD 3V3RA 5HW3A 5B2JD 5B33C 2EX6A 1BULA 3AZID 3W99A 3HCYA 2PYPA 5B0YA 5GT0B 3REHC 5B0ZA 1YT4A 2V2FF 3ZG7B 1CF0A 2YFVB 1KX4C 2UV0E 4R3BA 3B6GC 1OT9A 1SDNA 1WYBA 4AWLB 2WYXA 4L9EA 3X1SC 2J3WA 3MZEA 4ZBEA 3HLWA 1XKZA 2YKFA 1CK7A 4DQYB 2V1AA 3ITBA 5AV8D 3WKJD 3BQAA 4OQHA 5A91A 2KX6A 2EA9A 4H9RA 5CPKD 4CLCD 3MXQA 2WKPA 4HNBA 4JKTA 4WV4B 4WNNB 5HZHA 4ZUXB 5CPKB 4LLOB 1RCJA 3PBNA 4S2OA 3O62B 1M19D 1J7MA 3MBZA 1W79A 5B33A 3NBLA 3AZNB 5HPIA 3OPHA 1ES5A 2Z2MB 4UQIS 3WX7A 5EOOA 3SH9A 3L28A 3A0SA 2ZC3B 3AGEA 3LJAB 3H7WA 3KSIA 3Q7VB 3ZQ5A 5B32A 3LYXA 3CPTA 3NIAA 4WN5A 1K0KA 3X1VB 2ZMAA 5IU1A 3C2WA 2Y2QA 4XZQC 1PFLA 5E5AB 4HGAC 3FKVA 4E3OA 4DDYA 4XZQA 2HPBA 3GTCA 3AZMB 4GH9A 5HARA 3MGSC 1IKGA 5G18A 1GA9A 4KZ5A 1GHIA 3A0VA 4I38A 4HHDA 2Z6CA 4X25A 4HBTA 3NOTC 1PWGA 4IHQA 5JYOA 4YM6D 4H9QA 1ZHHB 4LV0A 2DCFA 4N9KA 5B2JA 3ULFA 3UB6A 4GD8A 2JKTI 4HBUA 2HDQA 2V5OA 4YM6B 1IYSA 2WUQA 3AN2B 5EVID 5EE8A 3BECA 3E0YA 4AWLC 4Y3IA 3B0CT 3C1CB 3BLSA 3B0DB 4EUZA 4ZAMA 5B1LC 5AQ9A 5AV9C 4MEZA 4XUJA 4EU0A 3C1CD 4QWOA 4JBFA 2P04A 4KUOA 3KUYA 1P3MD 3O3VA 5FQJA 2Q0OA 5FDSA 3GMWA 4IBKA 3UDFA 5AVCB 1S66L 5CGWA 1FILA 2J9OA 1P3FD 3C4PA 1E3UD 3W98D 5G49A 5FL3A 3KUYD 1ZLAD 5FEFA 5B2JC 5B33D 4K0XA 4Z9QA 3KS8A 5L10A 3MSHA 1KX3A 1YLPA 1BH8A 3H0MC 1ESUA 1TDLA 2HP9A 1ONGA 3P09A 4PM5A 1P0ZA 3HUMA 1KX4D 1GHMA 2GJ3A 1JWZA 4Z2IA 2DMWA 3HL9A 3A6NC 1RGZA 5FAOA 3V5MA 1W1PA 2VGJA 3T4OA 2Q9NA 2ZBBA 3PXPA 3OLOA 3W2ZA 3AZEA 4WU8D 1TAFB 4CLCA 1DP9A 1SKOA 4GJ4A 2JE5A 2ZM8A 2NQBC 5DF7A 3V67A 3SS4A 4BLMA 3Q07A 4NE3A 5FQMA 5HDDA 4PM8A 4OPQA 3VSKA 3C1BA 4Z2HA 3WTPC 3MVDC 3B6GB 4X1LA 4JJNC 3C4OA 5B1MA 3H7WB 5JA4B 2WGWB 4KZBA 1YMSA 1K6RA 3IWQA 4HP9A 4KQDA 1H0IA 5EVIA 1KDWA 2HP5A 3HLFA 3JVUA 4X23B 5B32D 1KX5A 3KYZA 4FSFA 2WKHA 1KX5C 3UTBA 1ID3C 2V20A 1L0GA 4X23D 3HLBA 1Z6FA 4XZQD 3V9RA 4LD9A 1MPLA 1W8QA 2ZY5A 1YLZA 1W7FA 5FQQA 1K54C 3REKD 2CV5D 1K54A 2W1RA 1S32C 2JCHA 4LENA 1M1AB 1OJ5A 3REKB 3V50A 2EWVA 3CPTB 3NC8A 2V0UA 1KVMA 5E2EA 4AFIA 4WUJA 4I3IA 3MQQA 2AROC 1P3GA 2IA2A 1P34C 2HGVA 4CAYB 4J8XB 1VB6A 2J80A 1MWUA 2W3DA 3LI8A 4O01A 5EVIC 3HBRA 4B4XA 3BFDA 3UTBC 1MY8A 1S4RA 5FUGA 4J8WB 1OTAA 2P9VB 4M4XA 2KLIA 5I94A 4OOMA 4WU8A 3BQ8A 5B31D 5DVAA 4FOFA 2F8NA 3LO7A 3MNNB 1NZUA 4LV3A 1H8ZA 3T1QB 1KVLA 5BT1C 3QNBA 4LCMA 4NXGA 5CGXA 5HD5A 4WZ5C 5B31B 3F1PA 3AZJB 5GT3D 5AJGA 3REHD 4UA7A 3AZFC 3VP2A 4F94A 4G92C 1XJ6A 3N6IA 2B18A 1ZLAC 3GRJA 3AZJD 3PBRA 3IF6C 4ZDXA 3DW0A 4Z5TA 4O8GA 4WLAA 2VV8A 3RJUA 3RELC 3AZMC 1H0GA 4BL2A 4DMZA 4KG6A 1OT6A 5BS7A 5AVCA 1VETA 3GVBA 3VP1A 1K57A 2K2NA 2HDUA 3I7JA 4OOLA 4DE2A 4R4SA 2PYOD 4L9GA 4IEDA 5AV6A 4CLCC 2EXBA 1G68A 1WWSA 4NFTA 3LJAC 1XGJA 3AV1D 2HV1A 5F99D 3MR0A 5GXQC 3T4JA 3WD4A 5AV5D 4LRXC 5M18A 2VGLM 1P3PB 3EPJA 4FD8A 4Y15A 2VGKA 3AFAC 5DNMC 3AV1A 1TS8A 3RFBA 3E4QA 5BNXB 2VGLS 3MGPA 3KO6A 3G31A 3UB8A 1F66A 5FI2A 1LT0A 3IP4C 1YKDA 3UN7A 1W8YA 3VSLA 1H3QA 5EUAA 4M6BA 5B0YD 2F8NG 3MF0A 1Y54A 4R1GA 5AY8A 3IXHA 5B1MB 1YLYA 1IFQA 4WELA 3W97B 1L0EA 1HQ3A 4NE5A 4CSRB 3B33A 5DJUA 5B1LA 4DE1A 3MGRB 4WMCA 3X1UD 3EGXC 3EOIA 5CP6A 5HAIA 3G32A 3MKEA 5HL1A 3X1VC 3EQVA 3N8LA 4MBFA 1VEUB 1WE4A 3LZ0C 4D2OA 5M1AA 4HESA 4UUZB 3B0CW 3C38A 4DXBA 1QO6A 3BFEA 3S1YA 1E6NA 1YM1A 3LIFA 1VQQA 1V9ZA 4PM6A 2Y2MA 3M7PA 3VH5A 3VOYA 2O0YA 4RYEA 1U35C 1U60A 1RP5A 4UA6A 3O62C 2XK1A 5F1GA 3M2JA 3ZYTA 3WKJB 4ZUXC 3G2YA 5EECA 3C30A 3MGSD 5IT5A 3R45A 4IBBA 5F99A 4A5RA 1O7EA 4HEFA 2F8ND 4XT2B 4XXRA 4X69A 5B31C 5HAQA 5TFQA 4QY6A 3T4QA 5GL9A 1E6ZA 1JTGA 5CTNA 1ERMA 1Y4OA 2WGVA 2ZJ9A 4XUZA 3NULA 4J8VA 5CPJD 1JNUA 1P3IA 3EWKA 3X1SB 3UTAA 5E2HA 2Y2PA 1KGEA 2PU2A 1H8YA 3N4IA 2QMIA 5L09A 3ZG8B 1J3WA 2FFYA 4P0MA 3IS2B 4EQIA 1H8PA 4J8VD 1PWCA 4Z2JA 2E8IA 2W1TB 3G30A 3PBOA 5FASA 1M40A 4DJ2A 4U0XA 2IWCA 4H9QB 1K38A 2BTFP 1N9OA 3WKJC 5I5LA 1K25A 5GXQD 1U35B 1W1YA 3T1XA 1S32B 1K55A 5CHUA 2FJ7B 3KWQD 4Z2GA 3W98C 3DWKA 4X68A 4RVAA 4OLGA 1UR8A 3C1CA 3WRTA 1P3LB 1W2EA 3KXBB 1LL9A 2O9BA 3DWZA 3T50A 2W27A 1EQZC 3KXBD 3FV7A 3LR3A 2JBFA 3R7WA 3L29A 4S2PA 3UPOA 3D4FA 3QP1A 3A3FA 4RX2A 5B24D 2XGNA 5FDHA 4IBGA 3VP4A 4NZ1A 4E3IA 4OOYA 2NQBD 2AROA 2Y2JA 1S67L 2Z2LB 2NQBB 3O88A 4J8UC 4ZJ1A 3BM6A 2M1CA 3PAGA 4H8RA 5DFYA 1K4FA 1P3ID 1MWRA 4KGCB 3X1VD 4Y17A 4E3NA 2IO5B 2WZZA 3HUNA 5BO0B 1Q2PA 4UEYA 5KSHA 4WU9D 3LICA 5AY8B 2A2LA 4C3QA 1LL5A 1P3BC 1OJGA 4HY8A 3C1BD 1DJAA 4NXFA 3WD3A 3TW8A 4B88A 4NZ4A 1JTDA 5CP6B 1ZG6A 4WU9A 1CQAA 5B2ID 2D02A 3UNWA 5BT1D 1VHMA 1VEUA 2CV5C 2WK0A 1M19A 2WGWA 4BBVA 4O7DA 3OZHA 3VH5T 4X23A 2G2WA 4C6YA 2KOIA 5B32G 3S7NA 3AZKD 3T1SA 2X02A 4N92A 2VX8A 2G5HC 2EXAA 3IF6B 4KZAA 3AZGD 2W1TA 2P7JA 3LR0A 3WAAB 5AV9B 3FKWA 2XROA 4B4ZA 4DRBA 4QLCB 3UB9A 2Y79A 2IWBA 1DJCA 2LB9A 3KYQA 3AZGB 5TR7A 4Y5FA 3LCEA 3AV1C 1IYPA 3BLMA 1T1CA 3LELA 1P3GD 1PZPA 2HP6A 3HLDA 2B95A 3KUYB 3QHYA 1I2SA 3E98A 3X1SA 3AV2B 4Z2MH 3W98A 5AVEA 2JKGA 4OP5A 3AFAB 2AVXA 4QJGA 1CXWA 4Z2KA 3LIBA 2Y2NA 2PYOB 4YFMA 5CX7A 2Y55A 4E6WA 3QNCA 4M3KA 4OJ6A 4DRTA 1R4VA 4OPRA 5DTTA 1FCOA 3KSFA 1BLCA 5TBMA 3PBTA 3BYDA 3NECA 1BUEA 4IJGA 3KXBC 1NRFA 4WU8C 2VA0A 3F1OA 4GLQA 2FJ7A 5HFOA 5CP6C 3AZJA 3PYPA 3ZDJA 5B2IA 5FA7A 4HQAA 2NUPC 1JFIB 3WTPD 3LZ1D 3MVDD 2IOUA 5GHYA 1GPFA 3EG5B 1HLUP 5AQBA 2F2AC 3UE1A 1ED7A 1ID3A 1JWVA 3AZHC 1A0KA 2ZC6B 3CUEA 4CPKA 2OOLA 3A3JA 3K2NA 3LZ1B 2ZMFA 5BO0A 2DRWA 2VK3A 3AZKA 2UWXA 4KGCC 1PI5A 2Y8HA 3EPLA 3EPKA 4BMWA 1KX5D 3WS4A 5BOHA 5EM0A 1ID3D 4UPKA 3LR5A 2V0WA 4WU9C 5GHZA 4Z66D 1PW8A 4OH0A 2HIOB 3L26A 2PHYA 3P5JB 5DTKA 5J3WA 1NWZA 2WZXA 3AZIB 2EWWA 2VEAA 4L9FA 3ZG0A 4B93A 2BYKA 3W96B 5CPIC 2VZWA 2XSSA 3WRZA 5B40B 2Y91A 3FYZA 2BYMA 5M19A 5CPJC 3A6NB 2OV5A 1SKFA 1TVFA 1C3BA 4DJ3A 2NZDB 3W4OA 1VM1A 2KDKA 1XPBA 2BG1A 1HQ3D 2ZY3A 4NXEA 3LEZA 3UTBD 2PD8A 1P3OD 1ZTUA 1YU1A 4CAYA 1XJ3A 3W4QA 1HQ3B 1BT5A 4PKYA 4CSRA 1SZVA 3WS1A 1ZLAA 4G91C 3AZND 3JPUA 5FUGB 1PDCA 3UO9A 3AZMA 4GCZA 2PYOC 4OJPA 3Q1FA 1FR6A 4MN5A 3REIB 3W97C 4EWFA 1S4SA 5AV9A 3AZIC 1P3FC 3AZEC 1ACFA 3L9KA 5DNND 3VH6W 1BTLA 4UHUA 3AZMD 5GSUC 1DJBA 3CZDA 3KUYC 3A1IA 1I2WA 2G7UA 2L0WA 1MZUA 5JYPA 1F2KA 4LGWA 5AV6D 3D72A 2DNSA 4LV1A 3RXWA 5F99C 4MBHA 2FJ7D 3KSGA 5AV5C 5AV6B 2ZMVA 3UB7A 2H5SA 3AN2D 4BD0A 4II7A 3MGSB 4DDSA 3LZ1A 1D1JA 5DNMD 2JKTM 3E4OA 2Y2KA 1T1BA 3N3FA 4MB3A 1FR1A 1MXOA 2Y2IA 1H5XA 5KMWA 2J8YA 4KG2A 4KHAA 4GDNA 1P3MB 2WAFA 1YLJA 3V39A 4IBRA 1BH8B 2JSSA 5GXQA 4X6TA 4Z66A 5HD3A 4MBKA 4Y0UA 4DN0A 1FQGA 5B32C 4Z66C 5B2IC 5B1MC 3AZNA 1P34A 1N1JB 4KZ3A 1PZRA 5B40A 3NHQA 1E25A 3DBAA 4LV2A 5GLCA 3DTEA 2JKRI 3NOPC 4J8UB 4YM6C
chains in the Genus database with same CATH topology
4KZ8A 1IELA 2HUEC 2Y2HA 1XXMA 2RVQD 4BL3A 2YFWA 1S32D 3NQUB 5E2FA 4J8UD 3AGDA 3C1BB 4ZJ3A 3E2LA 1AOIB 3FZCA 2AROD 1BLPA 5EVIB 1Q2QA 4H9PA 2I72A 3C7VA 4ZUXD 3HREA 2AROB 3W4PA 1QMFA 1P3MC 3A6NA 4OPZA 5DTSA 1TAFA 2NZDA 4KUDC 1P3LC 3G4PA 3IWOA 5GLAA 4S2KA 1K57C 2ZD8A 5CHMA 4X56A 3ZG5A 3WA9B 3UT9D 3KS4A 2X01A 1M18B 3VH6T 5JA4A 1YLTA 1FOFA 1ZLAB 4QD4A 1P3IB 4E3KA 3VMAA 1M18D 4NZ5A 3AZJC 3LY3A 3FWLA 2IO5C 1ONHA 4KZ9A 4S2LA 4J8XA 1M1AD 1YU0A 3TSGA 3REIA 3PAEA 4NETA 3UPNA 3IT9A 3IHBA 5FQ9A 4YINA 1P3GC 2LY8A 4J8XD 1MWTA 1KE4A 4GHAA 1KE3A 1TZYB 2J7VA 4JXWA 2EFXA 3P98A 5CPJA 4FCFA 1S32A 2VQRA 1P3AB 2ZQCA 5CTMA 4ZTKA 3X1TC 3B6GD 1GA0A 3UE3A 5CRFA 3VP0A 1B67A 3KXBA 1P3AD 4S2IA 2W8SA 1N1JA 1H3OA 2P74A 3G2ZA 4KZ4A 3W99D 3X1UA 3W98B 1BZAA 1I5QA 5EOEA 1M6KA 5C3IB 1CEGA 3HVFA 1KX5B 4LG2A 3ZCZA 5AVCC 4WBGA 1E4DA 5EPHA 1PYYA 3NDEA 4JF4A 3MGRC 5CPIB 2RVQC 3CMZA 2CWEA 4H9SA 4WM9A 3CJMA 1FSYA 3MKFA 3C1BC 5BNXA 3UTAC 2C5WB 1S6RA 5J8XA 1QMEA 1JFIA 1ZC2A 2HUEB 2OSUA 3ZHHA 3AYWA 4NYYA 4OP8A 4E45A 3NQUA 2RL3A 4IBDA 2B5RA 2NZDD 5B0ZD 3Q7ZA 3ZNYA 3AZHB 1MWSA 1Z2CB 5B32B 3WWXA 2GDNA 4QHCA 3MGRA 3WTPE 2G2UA 4XZQB 2HIOA 1WYCA 4P85A 4GN2A 1TDGA 1F66B 4OONA 2CV5B 1PI4A 4QY5A 3REID 3CG5A 2ZM0A 2HIOD 5JRGD 3A1KA 4ZBJC 3AZNC 3GV9A 3RELB 1BSGA 1CI8A 2ZY4A 1SDEA 3OPLA 3W97A 4JF5A 5CPKC 3TU4B 1SHVA 5AY8C 5B1LB 5F99B 4BENA 3BFFA 5FI6A 5A93A 2G5IC 5GLBA 1P3PD 4FH2A 3MGQC 1M19C 4WYYA 5KZHA 2H0YA 3HSHA 4UUZA 3IHAA 4P6BA 3BFCA 3UTAB 4YS3D 4J8WC 4EV4A 4UA9A 1P3PA 5DNMB 2XFSA 1HTAA 4Z5TC 1EQZD 3GQZA 4OUIA 5CEBA 5F83A 5E5AC 1BLHA 2X71A 3WS0A 3V3SA 3ZFZA 1ES2A 3MGRD 2Y4AA 5F1FA 3L27A 5FAQA 3NY4A 5BNVA 2WADA 3AGFA 1P3LA 2ZQ8A 1L0FA 4EO5B 3AYWB 5G49B 5AV5B 2R9WA 2RIQA 5TGFA 5FQIA 5GT0D 1KX3B 1CEFA 1P3LD 1LI9A 3B0BA 4IBFA 5GLDA 1KX3D 4DE3A 1U35A 4R0QA 5CECA 5AV8B 3AZFA 3Q81A 3UTBB 3AZEB 2F8NK 4R8PB 4NK3A 1P34D 5FI7A 1T3UA 2CV5A 2J8PA 3AZED 1DY6A 5DNNC 1AXBA 3G35A 2ZC4B 2EX8A 1P34B 5DF8A 4E3LA 5BS7C 4NYUA 1YU3A 1LLBA 3MXSA 1YU2A 4NY2A 2XFTA 4CJNA 1PIOA 4J8UA 3WA9D 1Q9CA 5FSRA 4J8VB 3A3EA 2XEPA 5BPVA 4GKUA 2YFVA 3W97D 1CI9A 2FJ7C 4ID4A 3W8KA 3WS5A 3LELC 3V9RB 4LD9B 3O87A 3B6FC 3Q82A 5B40C 1P3AC 1P3OA 4LD9D 1L0DA 1K56A 5GT3A 1AOIC 1ZG4A 4JJNB 5AV8C 4BJPA 4Z5TD 3EQUA 3HONA 3LJAA 5AVCD 1P3KC 3VH5W 4BQMA 1M19B 3IWIA 4OJ5A 4QLCD 4N1XA 4E3JA 2C6WB 4GB7A 1NXYA 1WWIA 1PW1A 1P3IC 3W99B 4OQGA 3AFAA 3RXXA 4EBLA 5CGSA 5AV5A 3C5AA 3MNNA 2JC7A 4KGCD 4C75A 1K6SA 5GXQB 2XDMA 5KDMA 3HLCA 1IKIA 5B2JB 4OLDA 2WKEA 2XF3A 4JXSA 2QPNA 3MXRA 1F66C 3REHA 3M6HA 3SOIA 2PBYA 5A92A 2ZM5A 3BFGA 4IJFA 4ZJ2A 5BNVB 1NYYA 2XLNA 4XUJB 4JXVA 2EFUA 5CXWA 4X55A 3AZLB 4MNRA 1XA7A 3NQJA 3LZ0A 4GD6A 3O62D 5AV9D 2Y2LA 1SCWA 3EPHA 4K91A 3AZLC 1P3FB 3LJAD 3SS5A 3O62A 1NJ4A 1P3PC 5B33B 1NY0A 1ULYA 4ZBJB 3AV2D 2XH9A 4WZ5A 2R9XA 5C3IC 3AFAD 1M18A 3Q7VA 4DRAA 3AN2A 1M1AC 2ZLYA 3AV2A 5GSUD 4KENB 4KQQA 4H9NA 5AVBC 2HDRA 2H10A 3A6ND 2Y59A 3KFUG 3AZIA 5CP6D 5AV6C 2ZQAA 3W99C 3X1TB 4LCLA 3C7UA 1P3OB 3KWQC 3AZHD 4KQOA 4FH4A 2BYMB 3MNNC 1TZYA 3X1TD 3ISGA 5GT3B 3WKJA 4R8PC 2EX2A 3UE0A 3ZVTA 5KDMB 3RELA 3JYIA 3IXDA 1IYOA 5GT0C 3REHB 3UY6A 1P3BA 3IQAA 2WKIA 3VP3A 5B24C 3OCNA 4WEJA 4U3TA 1KX3C 3N8RA 3N8SA 4PMAA 5CPID 4G91B 4H9SC 1JVJA 2H0TA 3O86A 5U47A 3TOIA 3REKC 1P3KA 1XA1A 4RX3A 3FKEA 1L2SA 3TU4D 3HLEA 3W96D 4E44A 2ZQ9A 2Q9MA 3B6GA 5CPIA 4J8WA 3B6FA 1FSWA 1B6WA 4WU8B 3LZ0B 1JWPA 3W96A 4IBXA 3VH6A 4WZ4A 5L2FA 4R3JA 3UT9A 2F8NH 1EWZA 1KGFA 3UDXA 3REJC 4IBEA 1TEMA 5B0ZC 4PM7A 3NCKA 3OC2A 5CEDA 3GR2A 2XD5A 4EBPA 3WTPB 3MVDB 2HIOC 2ZY2A 5F82A 3AZHA 4OJOA 4KUDD 1M1AA 4E3MA 5B31G 5B0YB 5GT3C 3L25A 1P3MA 3AZGC 2FFFB 1FCMA 1BH9B 5B24A 2OLUA 3MGQD 1P3FA 4QU3A 5HX9A 3RELD 5JRGC 4KZ7A 1A7WA 4Z66B 2NQBA 3ITAA 3PTEA 5JRGA 1NZOA 4IBJA 4H9PB 3WA9C 4JPMA 5AQ7A 1IYQA 1KX4A 4R8PA 2F8NB 4QNLA 3SS3A 3TU4A 4Y7PA 2J9PA 2YFWB 3ZGAB 3LELD 4H9NB 1YLWA 4P87A 4YS3C 4J8WD 3B6FD 3A3DA 4JLFA 4R8PD 3X1SD 3VFFA 4MLLA 4KZ6A 1ES3A 1AOIA 4GDBA 4Z5TB 5A90A 3REJA 1P3BB 4WZSB 3MZDA 3E2KA 2OLVA 3B0DC 3KSYA 5AVBA 1EQZA 2IWDA 1P3BD 4GNUA 5GHXA 2P9VA 5B1MD 3OCLA 4Q8IA 1EROA 1P3KB 5B0YC 3IF6A 1PZOA 2ZC5B 4GOGA 1PWDA 4WJ3C 3DTMA 1P3KD 1XP4A 4QLCC 3AZGA 3OPPA 4KUDA 3WAAC 3TU4C 4U0TA 4YM6A 4Y0TA 1OMEA 4YS3A 1KDSA 4HGAB 4IJEA 4IBIA 3PBQA 1N9BA 5GT0A 4GZBA 1MKIA 2WGIA 4XUJD 1XX2A 1YQSA 5DF9A 4OQIA 3HLGA 3L2AA 3AZFD 3H0LC 4H9RB 5CPJB 3S22A 2PU4A 5AV8A 3AZFB 1E3UA 3MGPB 4NE6A 5B24B 3UT9B 4DXCA 5E2GA 5CPKA 2ZM2A 3MGQA 3LY4A 4JF6A 3IH9A 3ZVWA 3F6TA 3NDGA 3A3IA 3WTPA 3MVDA 2BLSA 3X1UB 2EX9A 1KGGA 3WA9A 4S2JA 1LHYA 4N9LA 1KX4B 2RCXA 5CHJA 1GHPA 3REIC 2ZQDA 5KSCA 4S2MA 4J8XC 4OVDA 1EI5A 3KWQB 1RGYA 3MGPC 5FAPA 3LZ1C 2WAEA 4OPYA 3M6BA 3UDIA 4LD9C 5IHVA 3N7WA 3AYWC 1K56D 4PM9A 4JJND 1AOID 1IEMA 5AVBB 5EVLA 3HUOA 4DE0A 3FDDA 4DKIA 5AVBD 1HZOA 3SH7A 1BFMA 4H9OB 3S4XA 1XGIA 4JJNA 3BEBA 2XD1A 1BLSA 2DF4C 4X23C 3W96C 1F66D 3G34A 2V1ZA 5E5AD 1H3OB 4JXGA 3UPPA 4PPRA 3SH8A 2HDSA 5CERA 1P3GB 4WU9B 1LI0A 3WS2A 4R23A 4S2NC 2XQZA 1FCNA 1U35D 5B1LD 1P3OC 2ZQ7A 1TZYD 3X1TA 3TG9A 3GSGA 2Y2GA 5AQAA 5DNNA 4XUJC 4KHAB 5D3OA 3ZG9B 3WAAA 4YS3B 4WEKA 3AZLD 3M2KA 2QZ6A 4N1HA 4L0LA 3NI9A 4KQRA 3AL0C 3AZKC 3MGSA 4KGCA 3AZLA 3IH8A 1MBLA 3NQJB 5DNMA 2A49A 1HTZA 1ERQA 4E6XA 2CC1A 2PYOA 5FQKA 3C1CC 3AV2C 4OKPA 5AY8D 3AN2C 2Y2OA 3MGQB 2DQNC 3AV1B 5GSUB 1YUEA 1KE0A 3PBSA 1N4OA 1KU5A 5B2IB 1CK3A 3REKA 4X53A 5E43A 5B40D 5B0ZB 1O07A 4QLCA 4GHLA 3KWQA 1K55C 5FATA 4RA7A 1S0WA 1ZKJA 5CHLB 3AZKB 3IF5A 4UAAA 3LELB 3H0RC 3MNND 2ZC7A 3WAAD 1K4EA 2L5AA 5E5AA 4BD1A 1BH9A 4WNNA 2XR0A 4WMCD 4ZUXA 1F1EA 3VFHA 5JRGB 3MZFA 1W5DA 4H9OA 3OPRA 5B31A 4G92B 4EBNA 3MFDA 1YU4A 1ES4A 5DNNB 1TZYC 3IXGA 1HD8A 3R45B 1HVBA 3X1VA 4IVIA 1P3AA 3X1UC 4XUXA 3REJD 4K0WA 5HAPA 4OJLA 3BRMA 4Y0OA 3LZ0D 1YMXA 3REJB 3UT9C 3B3XA 4IVKA 1EQZB 3B6FB 3UTAD 1HQ3C 4OQ0A 4S2NA 4EO5C 1G6AA 1M18C 1NYMA 1ESIA 1J9MA 1ALQA 4IBCA 4KG5A 4DF6A 4KUDB 2NZDC 4J8VC 3IXBA 2BYKB 4R4RA 3MGPD 4QB8A 4NZ3A 1ID3B 5GSUA 2A3UA 3VOZA 1GCEA 3ZNTA 4Z2MG 3AYWD 3V3RA 5HW3A 5B2JD 5B33C 2EX6A 1BULA 3AZID 3W99A 5B0YA 5GT0B 3REHC 5B0ZA 1YT4A 2V2FF 3ZG7B 2YFVB 1KX4C 4R3BA 3B6GC 1SDNA 1WYBA 4AWLB 2WYXA 3X1SC 3MZEA 4ZBEA 3HLWA 1XKZA 4DQYB 3ITBA 5AV8D 3WKJD 4OQHA 5A91A 4H9RA 5CPKD 4JKTA 4WV4B 4WNNB 4ZUXB 5CPKB 1RCJA 3PBNA 4S2OA 3O62B 1M19D 3MBZA 1W79A 5B33A 3NBLA 3AZNB 3OPHA 1ES5A 2Z2MB 3WX7A 5EOOA 3SH9A 3L28A 2ZC3B 3AGEA 3LJAB 3Q7VB 5B32A 3NIAA 3X1VB 2ZMAA 2Y2QA 4XZQC 5E5AB 4HGAC 3FKVA 4E3OA 4DDYA 3GTCA 4XZQA 2HPBA 3AZMB 4GH9A 5HARA 3MGSC 1IKGA 5G18A 1GA9A 4KZ5A 1GHIA 4HBTA 1PWGA 5JYOA 4YM6D 4H9QA 4LV0A 2DCFA 4N9KA 5B2JA 4GD8A 4HBUA 2HDQA 4YM6B 1IYSA 2WUQA 3AN2B 5EVID 5EE8A 3BECA 4AWLC 3B0CT 3C1CB 3BLSA 3B0DB 4EUZA 4ZAMA 5B1LC 5AQ9A 5AV9C 4MEZA 4XUJA 3C1CD 4JBFA 3KUYA 1P3MD 3O3VA 5FQJA 3GMWA 4IBKA 3UDFA 5AVCB 5CGWA 2J9OA 1P3FD 3C4PA 1E3UD 3W98D 5G49A 3KUYD 1ZLAD 5B2JC 5B33D 4K0XA 4Z9QA 3KS8A 1KX3A 1YLPA 1BH8A 3H0MC 1ESUA 1TDLA 2HP9A 1ONGA 3P09A 4PM5A 3HUMA 1KX4D 1GHMA 1JWZA 3HL9A 3A6NC 1RGZA 5FAOA 3V5MA 2VGJA 2Q9NA 3AZEA 4WU8D 1TAFB 2JE5A 2ZM8A 2NQBC 5DF7A 3SS4A 4BLMA 3Q07A 4NE3A 5FQMA 4PM8A 4OPQA 3VSKA 3C1BA 3WTPC 3MVDC 3B6GB 4JJNC 3C4OA 5B1MA 5JA4B 2WGWB 4KZBA 1YMSA 1K6RA 3IWQA 5EVIA 1KDWA 2HP5A 3HLFA 4X23B 5B32D 1KX5A 4FSFA 2WKHA 1KX5C 3UTBA 1ID3C 2V20A 1L0GA 4X23D 3HLBA 1Z6FA 4XZQD 3V9RA 4LD9A 1MPLA 1W8QA 2ZY5A 1YLZA 1W7FA 5FQQA 1K54C 3REKD 2CV5D 1K54A 1S32C 2JCHA 4LENA 1M1AB 3REKB 3V50A 3NC8A 1KVMA 5E2EA 2AROC 1P3GA 1P34C 4CAYB 4J8XB 5EVIC 1MWUA 3HBRA 4B4XA 3BFDA 3UTBC 1MY8A 5FUGA 4J8WB 2P9VB 5I94A 4OOMA 4WU8A 5B31D 5DVAA 2F8NA 3LO7A 3MNNB 1NZUA 4LV3A 1H8ZA 1KVLA 5BT1C 3QNBA 4LCMA 5CGXA 4WZ5C 5B31B 3AZJB 5GT3D 3VP2A 3REHD 4UA7A 3AZFC 4F94A 4G92C 3N6IA 1ZLAC 3GRJA 3AZJD 3PBRA 3IF6C 4ZDXA 3DW0A 4Z5TA 3RJUA 3RELC 3AZMC 4BL2A 4KG6A 5BS7A 5AVCA 3GVBA 3VP1A 1K57A 2HDUA 3I7JA 4OOLA 4DE2A 4R4SA 2PYOD 4IEDA 5AV6A 2EXBA 1G68A 1WWSA 4NFTA 3LJAC 1XGJA 3AV1D 5F99D 5GXQC 5AV5D 5M18A 1P3PB 3EPJA 4FD8A 2VGKA 3AFAC 5DNMC 3AV1A 5BNXB 3MGPA 3G31A 1F66A 5FI2A 3IP4C 3UN7A 1W8YA 3VSLA 5EUAA 4M6BA 5B0YD 2F8NG 1Y54A 4R1GA 5AY8A 3IXHA 5B1MB 1YLYA 4WELA 3W97B 1L0EA 1HQ3A 4NE5A 4CSRB 5B1LA 4DE1A 3MGRB 4WMCA 3X1UD 5CP6A 5HAIA 3G32A 3MKEA 5HL1A 3X1VC 3EQVA 3N8LA 4MBFA 1WE4A 3LZ0C 4D2OA 5M1AA 4HESA 4UUZB 3B0CW 4DXBA 3BFEA 3S1YA 1YM1A 1VQQA 4PM6A 2Y2MA 3VH5A 3VOYA 4RYEA 1U35C 1U60A 1RP5A 4UA6A 3O62C 2XK1A 5F1GA 3M2JA 3WKJB 4ZUXC 3G2YA 5EECA 3MGSD 3R45A 4IBBA 5F99A 4A5RA 1O7EA 4HEFA 2F8ND 4XXRA 5HAQA 4X69A 5B31C 5TFQA 4QY6A 5GL9A 1JTGA 5CTNA 1ERMA 2WGVA 2ZJ9A 4XUZA 4J8VA 5CPJD 1P3IA 3X1SB 3UTAA 5E2HA 2Y2PA 1KGEA 2PU2A 1H8YA 3N4IA 2QMIA 3ZG8B 2FFYA 4P0MA 4EQIA 4J8VD 1PWCA 2E8IA 3G30A 3PBOA 5FASA 1M40A 4U0XA 2IWCA 4H9QB 1K38A 3WKJC 1K25A 5GXQD 1U35B 1S32B 1K55A 5CHUA 2FJ7B 3KWQD 3W98C 3DWKA 4X68A 4RVAA 4OLGA 3C1CA 3WRTA 1P3LB 1W2EA 3KXBB 1LL9A 3DWZA 1EQZC 3KXBD 3FV7A 2JBFA 3L29A 4S2PA 3UPOA 3D4FA 3A3FA 4RX2A 5B24D 2XGNA 5FDHA 4IBGA 3VP4A 4NZ1A 4E3IA 4OOYA 2NQBD 2AROA 2Y2JA 2Z2LB 2NQBB 3O88A 4J8UC 4ZJ1A 3BM6A 4H8RA 3PAGA 1K4FA 1P3ID 1MWRA 4KGCB 3X1VD 4E3NA 2IO5B 2WZZA 3HUNA 5BO0B 1Q2PA 5KSHA 4WU9D 5AY8B 4C3QA 1LL5A 1P3BC 3C1BD 1DJAA 4B88A 4NZ4A 1JTDA 5CP6B 1ZG6A 4WU9A 5B2ID 3UNWA 5BT1D 2CV5C 2WK0A 1M19A 2WGWA 4O7DA 3OZHA 3VH5T 4X23A 2G2WA 4C6YA 5B32G 3AZKD 2X02A 4N92A 2G5HC 2EXAA 3IF6B 4KZAA 3AZGD 3WAAB 5AV9B 3FKWA 4B4ZA 4DRBA 4QLCB 2IWBA 1DJCA 3AZGB 5TR7A 3LCEA 3AV1C 1IYPA 3BLMA 3LELA 1P3GD 1PZPA 2HP6A 3HLDA 3KUYB 3QHYA 1I2SA 3X1SA 3AV2B 4Z2MH 3W98A 4OP5A 3AFAB 4QJGA 2Y2NA 2PYOB 4YFMA 2Y55A 4E6WA 3QNCA 4M3KA 4OJ6A 4DRTA 1R4VA 4OPRA 5DTTA 1FCOA 1BLCA 3PBTA 3BYDA 1BUEA 3KXBC 1NRFA 4WU8C 2FJ7A 5HFOA 5CP6C 3AZJA 3ZDJA 5B2IA 5FA7A 1JFIB 3WTPD 3LZ1D 3MVDD 2IOUA 5GHYA 3EG5B 5AQBA 2F2AC 3UE1A 1ID3A 1JWVA 3AZHC 2ZC6B 4CPKA 3A3JA 3LZ1B 5BO0A 2DRWA 3AZKA 2UWXA 4KGCC 1PI5A 3EPLA 3EPKA 1KX5D 3WS4A 5BOHA 1ID3D 4UPKA 4WU9C 5GHZA 4Z66D 1PW8A 4OH0A 2HIOB 3L26A 3P5JB 5DTKA 2WZXA 3AZIB 3ZG0A 2BYKA 3W96B 5CPIC 3WRZA 5B40B 2Y91A 3FYZA 2BYMA 5M19A 5CPJC 3A6NB 2OV5A 1SKFA 1TVFA 1C3BA 2NZDB 3W4OA 1VM1A 1XPBA 2BG1A 1HQ3D 2ZY3A 3LEZA 3UTBD 1P3OD 1YU1A 4CAYA 3W4QA 1HQ3B 1BT5A 4CSRA 3WS1A 1ZLAA 4G91C 3AZND 5FUGB 3UO9A 3AZMA 2PYOC 4OJPA 3Q1FA 1FR6A 3REIB 3W97C 4EWFA 5AV9A 3AZIC 1P3FC 3AZEC 5DNND 3VH6W 1BTLA 4UHUA 3AZMD 5GSUC 1DJBA 3CZDA 3KUYC 3A1IA 1I2WA 5JYPA 5AV6D 2DNSA 4LV1A 3RXWA 5F99C 4MBHA 2FJ7D 5AV5C 5AV6B 2H5SA 3AN2D 4BD0A 3MGSB 4DDSA 3LZ1A 5DNMD 2Y2KA 3N3FA 1FR1A 1MXOA 2Y2IA 1H5XA 5KMWA 2J8YA 4KG2A 4GDNA 4KHAA 1P3MB 2WAFA 1YLJA 3V39A 4IBRA 1BH8B 2JSSA 5GXQA 4X6TA 4Z66A 4MBKA 4Y0UA 1FQGA 5B32C 4Z66C 5B2IC 5B1MC 3AZNA 1P34A 1N1JB 4KZ3A 1PZRA 5B40A 1E25A 4LV2A 5GLCA 4J8UB 4YM6C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KZ8 A;  1IEL A;  2Y2O A;  3UN7 A;  4GD6 A;  1W8Y A;  2Y2H A;  1XXM A;  3VSL A;  4BL3 A;  5EUA A;  2Y2L A;  5E2F A;  1SCW A;  3AGD A;  4K91 A;  3PBS A;  1KE0 A;  4ZJ3 A;  1N4O A;  3E2L A;  1Y54 A;  4R1G A;  3IXH A;  1YLY A;  4WEL A;  1CK3 A;  3FZC A;  1L0E A;  4X53 A;  3SS5 A;  5E43 A;  1BLP A;  1NJ4 A;  5EVI B;  1O07 A;  1Q2Q A;  4DE1 A;  2I72 A;  1NY0 A;  4WMC A;  3C7V A;  2XH9 A;  3HRE A;  4WZ5 A;  5HAI A;  3W4P A;  3G32 A;  1K55 C;  5FAT A;  4RA7 A;  1S0W A;  1ZKJ A;  2R9X A;  3EQV A;  1QMF A;  3MKE A;  3N8L A;  5HL1 A;  4MBF A;  3IF5 A;  4OPZ A;  5DTS A;  4UAA A;  1WE4 A;  3Q7V A;  4D2O A;  5M1A A;  4HES A;  4DXB A;  2ZC7 A;  2ZLY A;  3G4P A;  3BFE A;  3IWO A;  5GLA A;  3S1Y A;  1YM1 A;  4S2K A;  1K57 C;  1K4E A;  4KEN B;  1VQQ A;  4KQQ A;  2ZD8 A;  5CHM A;  4PM6 A;  2Y2M A;  4X56 A;  3ZG5 A;  4BD1 A;  2HDR A;  3VOY A;  2H10 A;  2Y59 A;  4RYE A;  2XR0 A;  1U60 A;  1RP5 A;  4UA6 A;  2XK1 A;  4WMC D;  5F1G A;  2X01 A;  3M2J A;  1YLT A;  1FOF A;  3VFH A;  3G2Y A;  3MZF A;  1W5D A;  5EEC A;  2ZQA A;  4QD4 A;  4E3K A;  3OPR A;  3VMA A;  4A5R A;  1O7E A;  4HEF A;  4LCL A;  4XXR A;  4EBN A;  3C7U A;  4X69 A;  3LY3 A;  5HAQ A;  3FWL A;  3MFD A;  1ONH A;  5TFQ A;  4QY6 A;  4KZ9 A;  4KQO A;  1ES4 A;  1JTG A;  4FH4 A;  4S2L A;  5GL9 A;  3TSG A;  5CTN A;  1ERM A;  3ISG A;  2WGV A;  2ZJ9 A;  4XUZ A;  3PAE A;  4NET A;  3IXG A;  3UPN A;  1HD8 A;  2EX2 A;  3IT9 A;  1HVB A;  3IHB A;  4IVI A;  5FQ9 A;  5E2H A;  4YIN A;  2Y2P A;  3UE0 A;  3ZVT A;  1KGE A;  2PU2 A;  1H8Y A;  3N4I A;  2QMI A;  4XUX A;  3ZG8 B;  1MWT A;  3JYI A;  1KE4 A;  2FFY A;  1KE3 A;  3IXD A;  4K0W A;  5HAP A;  4JXW A;  2J7V A;  3BRM A;  1IYO A;  4P0M A;  2EFX A;  4Y0O A;  4EQI A;  1YMX A;  3P98 A;  3UY6 A;  1PWC A;  2E8I A;  3G30 A;  3PBO A;  3IQA A;  2WKI A;  4FCF A;  5FAS A;  1M40 A;  3B3X A;  3VP3 A;  3OCN A;  4WEJ A;  4U3T A;  4U0X A;  2ZQC A;  5CTM A;  2IWC A;  4IVK A;  3N8R A;  3N8S A;  4ZTK A;  1GA0 A;  4PMA A;  3UE3 A;  1K38 A;  5CRF A;  3VP0 A;  1JVJ A;  2H0T A;  3O86 A;  5U47 A;  3TOI A;  4S2I A;  4OQ0 A;  1K25 A;  4S2N A;  1XA1 A;  1G6A A;  1NYM A;  4RX3 A;  1L2S A;  1ESI A;  3HLE A;  2P74 A;  3G2Z A;  1J9M A;  1K55 A;  2ZQ9 A;  4KZ4 A;  5CHU A;  2Q9M A;  3DWK A;  1ALQ A;  4X68 A;  4RVA A;  4OLG A;  4KG5 A;  1BZA A;  3WRT A;  1FSW A;  4DF6 A;  1I5Q A;  5EOE A;  3IXB A;  4R4R A;  4QB8 A;  1JWP A;  1M6K A;  1CEG A;  4IBX A;  3HVF A;  1LL9 A;  4WZ4 A;  3DWZ A;  2A3U A;  3VOZ A;  1GCE A;  3ZNT A;  3FV7 A;  3ZCZ A;  4WBG A;  1E4D A;  5EPH A;  5HW3 A;  4R3J A;  1PYY A;  2JBF A;  3V3R A;  5L2F A;  3NDE A;  4JF4 A;  4S2P A;  1EWZ A;  1KGF A;  2EX6 A;  1BUL A;  3UPO A;  3UDX A;  1TEM A;  4PM7 A;  3CMZ A;  3NCK A;  3D4F A;  3OC2 A;  1YT4 A;  2V2F F;  3ZG7 B;  3A3F A;  4RX2 A;  5FDH A;  2XGN A;  3VP4 A;  4E3I A;  3GR2 A;  5CED A;  4R3B A;  2XD5 A;  4OOY A;  4WM9 A;  3CJM A;  1FSY A;  4EBP A;  3MKF A;  2Y2J A;  5F82 A;  1SDN A;  1WYB A;  2WYX A;  2C5W B;  1S6R A;  5J8X A;  3MZE A;  1QME A;  4ZBE A;  3HLW A;  2Z2L B;  1ZC2 A;  1XKZ A;  2OSU A;  3O88 A;  4E3M A;  3ITB A;  3ZHH A;  4ZJ1 A;  3BM6 A;  4OP8 A;  4H8R A;  3PAG A;  4OQH A;  1K4F A;  5A91 A;  1MWR A;  4E3N A;  2WZZ A;  3HUN A;  2RL3 A;  2FFF B;  2B5R A;  1Q2P A;  1FCM A;  4JKT A;  5KSH A;  2OLU A;  3Q7Z A;  4QU3 A;  5HX9 A;  3ZNY A;  4C3Q A;  1LL5 A;  1MWS A;  4KZ7 A;  1RCJ A;  3ITA A;  3PBN A;  3PTE A;  4S2O A;  3WWX A;  1NZO A;  1DJA A;  2GDN A;  4QHC A;  4B88 A;  3MBZ A;  1W79 A;  3NBL A;  1JTD A;  4JPM A;  3OPH A;  1ES5 A;  2G2U A;  2Z2M B;  5AQ7 A;  1ZG6 A;  5EOO A;  3SH9 A;  1WYC A;  1IYQ A;  4P85 A;  4GN2 A;  1TDG A;  3UNW A;  2ZC3 B;  3AGE A;  3Q7V B;  2WK0 A;  4OON A;  2WGW A;  3NIA A;  3SS3 A;  4O7D A;  4Y7P A;  2J9P A;  1PI4 A;  4QY5 A;  3OZH A;  2ZMA A;  2Y2Q A;  3ZGA B;  3CG5 A;  2ZM0 A;  1YLW A;  3FKV A;  4E3O A;  2G2W A;  4P87 A;  4C6Y A;  2HPB A;  3GTC A;  4DDY A;  3A3D A;  3GV9 A;  1BSG A;  2X02 A;  1CI8 A;  4JLF A;  5HAR A;  4N92 A;  1SDE A;  3OPL A;  3VFF A;  4MLL A;  1IKG A;  2EXA A;  1ES3 A;  4KZ6 A;  1GA9 A;  5G18 A;  3IF6 B;  4GDB A;  4KZ5 A;  4KZA A;  5A90 A;  1GHI A;  4JF5 A;  3FKW A;  1SHV A;  3MZD A;  4HBT A;  4B4Z A;  3E2K A;  4BEN A;  2OLV A;  1PWG A;  3BFF A;  5FI6 A;  5A93 A;  5JYO A;  4LV0 A;  2IWB A;  1DJC A;  2DCF A;  2IWD A;  4N9K A;  4GNU A;  5TR7 A;  5GHX A;  2P9V A;  5GLB A;  3LCE A;  4GD8 A;  4FH2 A;  4HBU A;  3OCL A;  1IYP A;  3BLM A;  4Q8I A;  1ERO A;  4WYY A;  2HDQ A;  5KZH A;  3IF6 A;  1IYS A;  1PZP A;  1PZO A;  2H0Y A;  2WUQ A;  2HP6 A;  3HLD A;  2ZC5 B;  3IHA A;  4GOG A;  5EVI D;  4P6B A;  1PWD A;  3QHY A;  5EE8 A;  1I2S A;  3BEC A;  3BFC A;  3DTM A;  4EV4 A;  4UA9 A;  3BLS A;  4EUZ A;  1XP4 A;  4ZAM A;  5AQ9 A;  3OPP A;  4OP5 A;  4MEZ A;  4U0T A;  2XFS A;  4QJG A;  4Y0T A;  3GQZ A;  4JBF A;  1OME A;  3O3V A;  2Y2N A;  5FQJ A;  4YFM A;  5CEB A;  1KDS A;  5F83 A;  2Y55 A;  3GMW A;  4E6W A;  3QNC A;  3UDF A;  1BLH A;  2X71 A;  4M3K A;  4DRT A;  3WS0 A;  4OPR A;  5CGW A;  5DTT A;  2J9O A;  3PBQ A;  1FCO A;  1BLC A;  3V3S A;  1N9B A;  3C4P A;  3PBT A;  3BYD A;  1E3U D;  1BUE A;  3ZFZ A;  1ES2 A;  4GZB A;  1MKI A;  1NRF A;  2WGI A;  4K0X A;  2Y4A A;  5F1F A;  4Z9Q A;  1XX2 A;  1YQS A;  5DF9 A;  1YLP A;  5FAQ A;  4OQI A;  3HLG A;  5HFO A;  3ZDJ A;  1ESU A;  3NY4 A;  1TDL A;  2HP9 A;  1ONG A;  3P09 A;  5FA7 A;  2WAD A;  4PM5 A;  3AGF A;  3HUM A;  1GHM A;  2ZQ8 A;  5GHY A;  1JWZ A;  1L0F A;  5AQB A;  3UE1 A;  3HL9 A;  2R9W A;  1JWV A;  1RGZ A;  2ZC6 B;  5FAO A;  3V5M A;  4CPK A;  2VGJ A;  3A3J A;  3S22 A;  2PU4 A;  5TGF A;  2Q9N A;  2DRW A;  1E3U A;  5FQI A;  4DXC A;  1CEF A;  2UWX A;  1PI5 A;  5E2G A;  1LI9 A;  3WS4 A;  5GLD A;  2ZM2 A;  5BOH A;  2JE5 A;  2ZM8 A;  5DF7 A;  3SS4 A;  4BLM A;  3LY4 A;  4DE3 A;  4JF6 A;  3IH9 A;  3Q07 A;  3ZVW A;  3NDG A;  5FQM A;  4R0Q A;  3A3I A;  5CEC A;  5GHZ A;  1PW8 A;  2BLS A;  4PM8 A;  2EX9 A;  1KGG A;  4S2J A;  4OPQ A;  3VSK A;  1LHY A;  4OH0 A;  3Q81 A;  5DTK A;  4N9L A;  3C4O A;  2WZX A;  3ZG0 A;  2RCX A;  4NK3 A;  5CHJ A;  1GHP A;  5FI7 A;  2WGW B;  4KZB A;  1YMS A;  1K6R A;  3IWQ A;  2ZQD A;  5KSC A;  4S2M A;  1DY6 A;  1KDW A;  5EVI A;  1AXB A;  3G35 A;  4OVD A;  2HP5 A;  1EI5 A;  2EX8 A;  2ZC4 B;  3HLF A;  5DF8 A;  1RGY A;  4E3L A;  4FSF A;  3WRZ A;  5FAP A;  1LLB A;  2Y91 A;  2WKH A;  2WAE A;  3FYZ A;  5M19 A;  4OPY A;  3MXS A;  2V20 A;  3M6B A;  1SKF A;  1L0G A;  3HLB A;  2OV5 A;  3UDI A;  2XFT A;  4CJN A;  1PIO A;  5IHV A;  1TVF A;  1Z6F A;  3N7W A;  1W8Q A;  1MPL A;  1C3B A;  5FSR A;  3A3E A;  3W4O A;  2XEP A;  1VM1 A;  1YLZ A;  1W7F A;  4GKU A;  5FQQ A;  1K56 D;  4PM9 A;  1K54 C;  1IEM A;  1XPB A;  2BG1 A;  3HUO A;  5EVL A;  1CI9 A;  1K54 A;  3LEZ A;  4DE0 A;  4DKI A;  4ID4 A;  2JCH A;  4LEN A;  3W8K A;  3WS5 A;  3W4Q A;  1HZO A;  3SH7 A;  3V50 A;  1BT5 A;  3O87 A;  3WS1 A;  3NC8 A;  3S4X A;  1KVM A;  1XGI A;  3BEB A;  5E2E A;  2XD1 A;  3Q82 A;  1BLS A;  3UO9 A;  1L0D A;  3Q1F A;  1FR6 A;  5EVI C;  1MWU A;  1K56 A;  3G34 A;  2V1Z A;  3HBR A;  4B4X A;  1ZG4 A;  3BFD A;  4EWF A;  4JXG A;  3UPP A;  4PPR A;  3SH8 A;  1MY8 A;  1BTL A;  2HDS A;  4UHU A;  5CER A;  4BJP A;  1DJB A;  2P9V B;  3EQU A;  3CZD A;  5I94 A;  4OOM A;  1LI0 A;  3WS2 A;  1I2W A;  4R23 A;  4S2N C;  5DVA A;  2XQZ A;  3LO7 A;  3IWI A;  1NZU A;  4LV3 A;  4BQM A;  1H8Z A;  1KVL A;  1FCN A;  3QNB A;  5CGX A;  4LCM A;  5JYP A;  4N1X A;  2ZQ7 A;  4WZ5 C;  4E3J A;  2C6W B;  2DNS A;  4LV1 A;  4UA7 A;  4GB7 A;  3TG9 A;  3VP2 A;  3RXW A;  3GSG A;  2Y2G A;  1NXY A;  5AQA A;  4F94 A;  1PW1 A;  3N6I A;  4MBH A;  4OQG A;  3GRJ A;  3PBR A;  3RXX A;  4EBL A;  3IF6 C;  5CGS A;  2H5S A;  4ZDX A;  3DW0 A;  4BD0 A;  3C5A A;  5D3O A;  3RJU A;  2JC7 A;  4DDS A;  3ZG9 B;  4BL2 A;  4KG6 A;  4WEK A;  4C75 A;  1K6S A;  3M2K A;  2QZ6 A;  2XDM A;  3GVB A;  4N1H A;  3VP1 A;  1K57 A;  2Y2K A;  3HLC A;  2HDU A;  1IKI A;  3I7J A;  4L0L A;  4OLD A;  3NI9 A;  2WKE A;  2XF3 A;  4OOL A;  4R4S A;  4DE2 A;  1FR1 A;  4JXS A;  2QPN A;  4IED A;  1MXO A;  2EXB A;  2Y2I A;  1H5X A;  3MXR A;  5KMW A;  1G68 A;  3M6H A;  4KQR A;  2J8Y A;  4KG2 A;  4GDN A;  3SOI A;  1XGJ A;  2PBY A;  5A92 A;  2WAF A;  1YLJ A;  3V39 A;  4IBR A;  3IH8 A;  1MBL A;  3BFG A;  5M18 A;  4ZJ2 A;  4X6T A;  1NYY A;  4MBK A;  4Y0U A;  4FD8 A;  2XLN A;  1FQG A;  2A49 A;  1HTZ A;  2VGK A;  4JXV A;  2EFU A;  1ERQ A;  5CXW A;  4E6X A;  4X55 A;  2CC1 A;  4KZ3 A;  5FQK A;  1E25 A;  4OKP A;  4MNR A;  4LV2 A;  5GLC A;  1XA7 A;  3G31 A;  5FI2 A; 
#chains in the Genus database with same CATH topology
 4KZ8 A;  1IEL A;  2HUE C;  2Y2H A;  1XXM A;  4I3A A;  2RVQ D;  5DFX A;  4BL3 A;  2YFW A;  1S32 D;  3NQU B;  4R3A A;  5E2F A;  4J8U D;  3AGD A;  3C1B B;  4ZJ3 A;  3E2L A;  3R7W B;  2PAV P;  1AOI B;  3FZC A;  1E88 A;  3WD0 A;  3P01 A;  2ARO D;  1BLP A;  4NEE D;  5EVI B;  1Q2Q A;  4O0P A;  4H9P A;  2I72 A;  1L3L A;  3C7V A;  4ZUX D;  3HRE A;  2ARO B;  3W4P A;  3ICY A;  1QMF A;  1P3M C;  3A6N A;  4OPZ A;  5DTS A;  4EXO A;  2W3G A;  1TAF A;  4CLC B;  1SKO B;  4X1M A;  2NZD A;  4KUD C;  1P3L C;  1G5U A;  3G4P A;  3IWO A;  3QP2 A;  5GLA A;  4S2K A;  1K57 C;  5LBR A;  3F1N A;  2ZD8 A;  5CHM A;  4X56 A;  3ZG5 A;  3WA9 B;  3UT9 D;  3KS4 A;  3UE6 A;  2X01 A;  1M18 B;  3VH6 T;  5JA4 A;  1YLT A;  1FOF A;  3RTY A;  3MS6 A;  1ZLA B;  4QD4 A;  1P3I B;  4E3K A;  3VMA A;  1M18 D;  4NZ5 A;  1W63 Q;  3AZJ C;  2A24 A;  3LY3 A;  3FWL A;  2IO5 C;  1ONH A;  4KZ9 A;  4S2L A;  4J8X A;  1M1A D;  1YU0 A;  3U4L P;  3TSG A;  4CLC E;  3REI A;  4G3K A;  3PAE A;  4NET A;  3UPN A;  1AWI A;  4EER A;  3D9Y A;  3IT9 A;  4Z2L A;  3IHB A;  5FQ9 A;  4YIN A;  1P3G C;  5HWW A;  4JGO A;  1S1Y A;  2LY8 A;  1TS6 A;  1LSW A;  4J8X D;  3K3D A;  3UMD A;  1MWT A;  1KE4 A;  4GHA A;  1KE3 A;  1TZY B;  2J7V A;  4JXW A;  2EFX A;  4LFU A;  3P98 A;  5CPJ A;  3MQ0 A;  4FCF A;  1S32 A;  3UB5 P;  1XFQ A;  4ARZ B;  2PYR A;  3F1P B;  2VQR A;  1P3A B;  2ZQC A;  5CTM A;  3CLO A;  4ZTK A;  5MC7 A;  4G3V A;  3X1T C;  3B6G D;  1GA0 A;  3UE3 A;  5CRF A;  3VP0 A;  1B67 A;  3KXB A;  1P3A D;  2WKR A;  4S2I A;  2W8S A;  1D06 A;  4MB4 A;  1N1J A;  1H3O A;  2P74 A;  3G2Z A;  4KZ4 A;  3W99 D;  3X1U A;  3W98 B;  1BZA A;  1I5Q A;  1XFN A;  1WA9 A;  5EOE A;  5HSQ A;  4Y2F A;  5G4Y A;  1M6K A;  5C3I B;  1CEG A;  3BWL A;  3HVF A;  1KX5 B;  4LG2 A;  4R38 A;  1S1Z A;  1YAX A;  3ZCZ A;  5AVC C;  4WBG A;  1E4D A;  5EPH A;  1PYY A;  3NDE A;  4JF4 A;  3MGR C;  1E8B A;  5CPI B;  2RVQ C;  1STZ A;  3CMZ A;  2CWE A;  3QP5 A;  4H9S A;  4JGP A;  4WM9 A;  3CJM A;  1FSY A;  3MKF A;  3C1B C;  4I3J A;  1P9W A;  5BNX A;  3MQO A;  3PHY A;  5EV0 A;  3UTA C;  2C5W B;  1S6R A;  5F5Y A;  5J8X A;  1QME A;  1JFI A;  1ZC2 A;  5EM1 A;  2HUE B;  2OSU A;  4YWZ A;  2W0N A;  4EEP A;  4TX8 A;  3P7N A;  3ZHH A;  1OPX A;  3AYW A;  4NYY A;  4OP8 A;  2INW A;  4NKP A;  2PT7 A;  4MB5 A;  5J7E A;  4E45 A;  3NQU A;  2L1M A;  2RL3 A;  2XRN A;  4QPR A;  4IBD A;  2B5R A;  2NZD D;  5B0Z D;  2PDR A;  3FPV A;  3Q7Z A;  3ZNY A;  3AZH B;  4IUK A;  1MWS A;  1Z2C B;  5B32 B;  3WWX A;  2GDN A;  4QHC A;  3MGR A;  3WTP E;  4HME A;  4HH3 A;  2A24 B;  2G2U A;  2QKP A;  4XZQ B;  4ESP A;  3A0R A;  2HIO A;  1WYC A;  4P85 A;  4GN2 A;  1TDG A;  3GEC A;  4Q0J A;  2HJ9 C;  4HP4 A;  1F66 B;  1NRJ A;  3SZT A;  4OON A;  2CV5 B;  3T4K A;  1F5M A;  3MMH A;  1PI4 A;  4QY5 A;  3UME A;  4P6Z M;  3REI D;  2J3T D;  1UWN X;  1P97 A;  3CG5 A;  2ZM0 A;  2HIO D;  5JRG D;  3A1K A;  4ZBJ C;  3AZN C;  3GV9 A;  3REL B;  1BSG A;  1CI8 A;  2ZY4 A;  1SDE A;  3OPL A;  3W97 A;  4JF5 A;  5CPK C;  3TU4 B;  1SHV A;  5AY8 C;  3NJA A;  5B1L B;  5F99 B;  4BEN A;  3BFF A;  1VET B;  5FI6 A;  5A93 A;  2G5I C;  2PR5 A;  4HJ3 A;  5GLB A;  1P3P D;  4FH2 A;  3MGQ C;  1M19 C;  1BYW A;  5EFW A;  2PRF A;  4WYY A;  3S7P A;  5KZH A;  2H0Y A;  3HSH A;  4UUZ A;  3IHA A;  4P6B A;  1F98 A;  3BFC A;  3UTA B;  4YS3 D;  4J8W C;  5J4E A;  4EV4 A;  4UA9 A;  1P3P A;  2I9V A;  3OOV A;  3QP4 A;  5DNM B;  3K3C A;  2XFS A;  1HTA A;  5DKL A;  5C5K A;  4Z5T C;  1EQZ D;  3GQZ A;  4OUI A;  2O9A A;  5CEB A;  5F83 A;  5E5A C;  1BLH A;  2X71 A;  3WS0 A;  2WKQ A;  2FZ0 A;  3V3S A;  1PRQ A;  2YKH A;  3ZFZ A;  1ES2 A;  4JGQ A;  1GSV A;  3MGR D;  2Y4A A;  5F1F A;  3L27 A;  5FAQ A;  3TRC A;  2L4R A;  3NY4 A;  5BNV A;  2WAD A;  3AGF A;  4MN7 A;  1P3L A;  2ZQ8 A;  3IX8 A;  1L0F A;  4EO5 B;  4LRY C;  3AYW B;  5G49 B;  5AV5 B;  2R9W A;  2RIQ A;  5TGF A;  5FQI A;  5GT0 D;  1KX3 B;  1H0M A;  5AVF A;  2JHE A;  1CEF A;  1P3L D;  1LI9 A;  3B0B A;  1GSW A;  3O5Y A;  3H82 B;  4IBF A;  5GLD A;  1KX3 D;  4RQ9 A;  4DE3 A;  1U35 A;  5F69 A;  4R0Q A;  3VOL A;  5CEC A;  5AV8 B;  3AZF A;  5A8B A;  3Q81 A;  3UTB B;  3AZE B;  2F8N K;  4R8P B;  3BY9 A;  4NK3 A;  1P34 D;  3IX3 A;  5FI7 A;  1T3U A;  2CV5 A;  5L8M A;  2J8P A;  4MCW A;  3AZE D;  1DY6 A;  5DNN C;  1AXB A;  3G35 A;  2ZC4 B;  2EX8 A;  1P34 B;  5DF8 A;  4E3L A;  3RH8 B;  5BS7 C;  4NYU A;  1YU3 A;  1LLB A;  1NLY A;  2VLG A;  4HMD A;  3MXS A;  1YU2 A;  4NY2 A;  2XFT A;  4CJN A;  1PIO A;  4J8U A;  3WA9 D;  1Q9C A;  5FSR A;  4J8V B;  3BW6 A;  3EGD C;  3A3E A;  2XEP A;  5BPV A;  3LUQ A;  4GKU A;  2YFV A;  3W97 D;  2QHK A;  5KIZ A;  1CI9 A;  2FJ7 C;  4ID4 A;  3MJQ A;  3W8K A;  3WS5 A;  3LEL C;  3V9R B;  4LD9 B;  3O87 A;  3B6F C;  1KOU A;  3Q82 A;  5B40 C;  1P3A C;  1P9R A;  5G4Z A;  1P3O A;  4LD9 D;  1L0D A;  1K56 A;  5GT3 A;  4GHI B;  4PAU A;  1AOI C;  1ZG4 A;  3FG8 A;  5IS1 A;  3LFV A;  1EW0 A;  4JJN B;  1O6I A;  5AV8 C;  4BJP A;  4Z5T D;  3EQU A;  3HON A;  3LJA A;  5AVC D;  5HDC A;  1P3K C;  3VH5 W;  4BQM A;  1M19 B;  3IWI A;  4OJ5 A;  4QLC D;  4WL9 A;  4N1X A;  2VV7 A;  3DTI A;  4E3J A;  2C6W B;  4GB7 A;  1NXY A;  1WWI A;  4P6Z S;  1PW1 A;  1P3I C;  3W99 B;  4OQG A;  3AFA A;  3RXX A;  4EBL A;  3OBF A;  5CGS A;  5AV5 A;  3C5A A;  3MNN A;  2JC7 A;  3HJK A;  4KGC D;  2W3F A;  2QYB A;  4C75 A;  1K6S A;  5GXQ B;  2XDM A;  2M7V A;  5KDM A;  3HLC A;  3T4T A;  1IKI A;  5B2J B;  4OLD A;  2WKE A;  2XF3 A;  4JGR A;  4JXS A;  2QPN A;  3MXR A;  1F66 C;  3REH A;  3M6H A;  3LGO A;  3SOI A;  2PBY A;  1E6R A;  5A92 A;  4MN6 A;  2ZM5 A;  3WD1 A;  2ZL1 B;  3BFG A;  4IJF A;  4ZJ2 A;  5BNV B;  4LRZ E;  1NYY A;  2XLN A;  4XUJ B;  4JXV A;  1E15 A;  2EFU A;  5CXW A;  4X55 A;  4R70 A;  4IUH A;  3AZL B;  3KSH A;  4MNR A;  1IOU A;  1XA7 A;  2JN7 A;  3NQJ A;  2ZOI A;  3LZ0 A;  4GD6 A;  3O62 D;  2K7S A;  5AV9 D;  2Y2L A;  3H9W A;  3F1O B;  1UGU A;  1SCW A;  3IBJ A;  3EPH A;  4K91 A;  4HIA A;  3AZL C;  1P3F B;  2ACG A;  3T4S A;  3LJA D;  3SS5 A;  3O62 A;  3IX4 A;  1NJ4 A;  4PHT A;  1P3P C;  5B33 B;  1NY0 A;  1ULY A;  4ZBJ B;  3AV2 D;  1OTE A;  3JVV A;  2XH9 A;  4WZ5 A;  4WF0 A;  2R9X A;  4I5S A;  5C3I C;  3AFA D;  1M18 A;  1T1A A;  3Q7V A;  4GHI A;  4DRA A;  3AN2 A;  1M1A C;  2ZLY A;  3AV2 A;  5GSU D;  2O99 A;  4KEN B;  4KQQ A;  4H9N A;  2XA7 M;  5AVB C;  3VE3 A;  2HDR A;  2H10 A;  3A6N D;  1TD5 A;  2Y59 A;  4FUW A;  3KFU G;  3AZI A;  1UWP X;  2VKS A;  5CP6 D;  5AV6 C;  2ZQA A;  3W99 C;  4HI4 A;  3X1T B;  1DRM A;  4LCL A;  3C7U A;  1P3O B;  3KWQ C;  3T12 B;  3AZH D;  2P08 A;  4KQO A;  4FH4 A;  2BYM B;  3MNN C;  1TZY A;  3X1T D;  3ISG A;  5GT3 B;  3WKJ A;  4R8P C;  2EX2 A;  4EET B;  3UE0 A;  3ZVT A;  4Y13 A;  5KDM B;  5F6A A;  3REL A;  3JYI A;  1AIW A;  3IXD A;  1IYO A;  5GT0 C;  3REH B;  2V8F A;  3UY6 A;  1P3B A;  3IQA A;  2WKI A;  3VP3 A;  5B24 C;  3OCN A;  4WEJ A;  4U3T A;  1KX3 C;  3N8R A;  3N8S A;  4PMA A;  5HL6 A;  5CPI D;  4G91 B;  4H9S C;  1JVJ A;  2H0T A;  3O86 A;  5U47 A;  3TOI A;  3REK C;  1P3K A;  2OAQ 1;  1XA1 A;  4RX3 A;  1MC0 A;  1L2S A;  3FKE A;  3TU4 D;  4EEU A;  3HLE A;  3W96 D;  4E44 A;  2ZQ9 A;  2Q9M A;  3B6G A;  1GXD A;  5CPI A;  4J8W A;  3B6F A;  1FSW A;  2MJ6 A;  4K08 A;  1B6W A;  4WU8 B;  3MFX A;  3LZ0 B;  1JWP A;  4GW9 A;  3S7Q A;  1D7E A;  3W96 A;  4IBX A;  3VH6 A;  4WZ4 A;  5L2F A;  3FC7 A;  1EAK A;  4R3J A;  4UQI M;  3UT9 A;  2F8N H;  1EWZ A;  1KGF A;  3UDX A;  3REJ C;  4IBE A;  1OGG A;  5B0Z C;  1TEM A;  4PM7 A;  1T19 A;  3NCK A;  4D60 A;  3OC2 A;  5CED A;  3GR2 A;  2ZOH A;  2XD5 A;  2B02 A;  4EBP A;  3WTP B;  3MVD B;  2HIO C;  1DP6 A;  5F68 A;  3DTK A;  2ZY2 A;  3NOU C;  5F82 A;  4HJ4 A;  3CWF A;  2OAP 1;  3AZH A;  4OJO A;  4KUD D;  1M1A A;  3KYE A;  3T4L A;  1KS0 A;  4E3M A;  5B31 G;  5B0Y B;  5GT3 C;  3L25 A;  5DKK A;  2VJW A;  2FN2 A;  1P3M A;  3G6O A;  3AZG C;  4ETX A;  2FFF B;  2O9C A;  1FCM A;  2OLU A;  1BH9 B;  5B24 A;  3MGQ D;  1P3F A;  4QU3 A;  5HX9 A;  3REL D;  1T18 A;  5JRG C;  2W3E A;  3L7H A;  1A7W A;  4Z66 B;  2NQB A;  3ITA A;  4KZ7 A;  3PTE A;  5JRG A;  1NZO A;  4IBJ A;  4ZRR A;  4H9P B;  3WA9 C;  4JPM A;  1G28 A;  5HPF A;  5AQ7 A;  4ETZ A;  2HZ5 A;  1IYQ A;  2XA7 S;  2H28 A;  1KX4 A;  4R8P A;  2BAS A;  5L07 A;  4MMN A;  2F8N B;  4QNL A;  1N9N A;  1XJ4 A;  3TU4 A;  3SS3 A;  4Z1W A;  4Y7P A;  2J9P A;  3BY8 A;  2CMN A;  2YFW B;  3VE4 A;  3ZGA B;  1FIK A;  3LEL D;  4H9N B;  1YLW A;  4P87 A;  2R78 A;  4YS3 C;  4J8W D;  3B6F D;  3A3D A;  3T1R A;  4JLF A;  4R8P D;  3X1S D;  3VFF A;  4MLL A;  4KZ6 A;  1ES3 A;  1AOI A;  4GDB A;  4Z5T B;  5A90 A;  3REJ A;  4Q0I A;  1P3B B;  4WZS B;  3MZD A;  3E2K A;  2OLV A;  3B0D C;  3KSY A;  5AVB A;  1EQZ A;  2IWD A;  1P3B D;  4GNU A;  2VV6 A;  5GHX A;  2P9V A;  4CQH A;  5B1M D;  1DP8 A;  3OCL A;  4BBU A;  4Q8I A;  1ERO A;  1P3K B;  5B0Y C;  3IF6 A;  1PZO A;  4BWI A;  2ZC5 B;  4GOG A;  1PWD A;  4WJ3 C;  3DTM A;  1P3K D;  1V9Y A;  3VV4 A;  1XP4 A;  4I39 A;  4QLC C;  3AZG A;  3OPP A;  4KUD A;  3WAA C;  3TU4 C;  4U0T A;  3TJZ C;  3QP8 A;  3U2A A;  4YM6 A;  4Y0T A;  1OME A;  3HJI A;  4YS3 A;  1KDS A;  4ARZ A;  1ODV A;  1L6J A;  4HGA B;  5FEG A;  1W1T A;  4IJE A;  1TS0 A;  1YPR A;  4XT2 A;  4IBI A;  3PBQ A;  2GX5 A;  1N9B A;  5GT0 A;  1OTB A;  4GZB A;  1MKI A;  2WGI A;  3R4K A;  4XUJ D;  1XX2 A;  1YQS A;  5DF9 A;  4OQI A;  2NUT C;  3HLG A;  3L2A A;  5TBM B;  4NXB A;  3AZF D;  3H0L C;  3WD2 A;  4H9R B;  1TF1 A;  5CPJ B;  4H6J B;  4R6L A;  2PU4 A;  3S22 A;  2D49 A;  5AV8 A;  3AZF B;  1E3U A;  5EVE A;  3LIE A;  3MGP B;  4NE6 A;  1MKM A;  3QP6 A;  5B24 B;  3UT9 B;  4DXC A;  4KUK A;  5E2G A;  5CPK A;  5HWT A;  2ZM2 A;  3MGQ A;  3LY4 A;  4JF6 A;  3IH9 A;  3ZVW A;  3F6T A;  3NDG A;  3A3I A;  3WTP A;  3MVD A;  2BLS A;  3X1U B;  2EX9 A;  1KGG A;  3WA9 A;  4S2J A;  1X0O A;  2M7U A;  2ZL1 A;  1LHY A;  2GNX A;  4N9L A;  1KX4 B;  2RCX A;  5CHJ A;  1GHP A;  3REI C;  2J3T C;  2ZQD A;  5KSC A;  4S2M A;  4J8X C;  4ME4 A;  4OVD A;  1EI5 A;  3KWQ B;  1RGY A;  4GS9 B;  3MGP C;  5FAP A;  3LID A;  3LZ1 C;  2W3H A;  2WAE A;  4EUV A;  4OPY A;  3M6B A;  3UDI A;  4LD9 C;  5IHV A;  3AYW C;  3N7W A;  1UR9 A;  4HH2 A;  3EEA A;  3LIA A;  1K56 D;  4PM9 A;  4JJN D;  1AOI D;  1IEM A;  5AVB B;  5EVL A;  3HUO A;  4F3L A;  1CJF A;  3DAV A;  4BBT A;  4DE0 A;  3FDD A;  4DKI A;  2GZA A;  4MDZ A;  5AVB D;  1N9L A;  1HZO A;  3S7O A;  3SH7 A;  1BFM A;  2OWH A;  4H9O B;  3S4X A;  3CIT A;  1XGI A;  4JJN A;  3BEB A;  2XD1 A;  3LR4 A;  1BLS A;  2V8C A;  2DF4 C;  4X23 C;  3W96 C;  1F66 D;  3G34 A;  2V1Z A;  5E5A D;  3B47 A;  1H3O B;  1Y28 A;  4JXG A;  3UPP A;  4NG2 A;  4PPR A;  3SH8 A;  2HDS A;  4HOI A;  5CER A;  1P3G B;  4E04 A;  2FH5 A;  3LEQ A;  4WU9 B;  3SW1 A;  1LI0 A;  3WS2 A;  1YSP A;  3IS2 A;  4R23 A;  4S2N C;  2XQZ A;  1FCN A;  1U35 D;  5B1L D;  1P3O C;  2ZQ7 A;  1TZY D;  3X1T A;  3TG9 A;  4G3W A;  3GSG A;  2Y2G A;  5AQA A;  3EEH A;  1XJ2 A;  1NLZ A;  5DNN A;  2V1B A;  4XUJ C;  5HDS A;  4KHA B;  2PD7 A;  5D3O A;  4H6J A;  3ZG9 B;  3WAA A;  4YS3 B;  4WEK A;  3AZL D;  1H8M A;  3M2K A;  2QZ6 A;  4N1H A;  4EW7 A;  4L0L A;  3NI9 A;  3CUE C;  1LSV A;  3TE8 A;  3CI6 A;  3FPW A;  4KQR A;  3AL0 C;  3AZK C;  3MGS A;  4KGC A;  4Q0H A;  3AZL A;  3IH8 A;  1W63 M;  1MBL A;  2PR6 A;  1LSX A;  3NQJ B;  3GDI A;  5DNM A;  2A49 A;  1HTZ A;  1GSX A;  1ERQ A;  1TS7 A;  4E6X A;  2CC1 A;  2PYO A;  5FQK A;  3C1C C;  5TJJ A;  3AV2 C;  3B42 A;  4OKP A;  3BJN A;  2QJ5 A;  5AY8 D;  3MQL A;  2K31 A;  3AN2 C;  1OGB A;  4HJ6 A;  2Y2O A;  3MGQ B;  2DQN C;  1OTD A;  3AV1 B;  3IBR A;  5GSU B;  5K5B A;  1YSQ A;  2JKR M;  4F3L B;  1YUE A;  1KE0 A;  3PBS A;  1N4O A;  1KU5 A;  5B2I B;  3D3O A;  1CK3 A;  3REK A;  4X53 A;  5E43 A;  5B40 D;  2E8J A;  3PR6 A;  1PNE A;  5B0Z B;  1O07 A;  4QLC A;  4GHL A;  3KWQ A;  3F1N B;  4GS9 A;  1G6O A;  1K55 C;  5FAT A;  4RA7 A;  1S0W A;  1ZKJ A;  5CHL B;  3AZK B;  3IF5 A;  4UAA A;  3LEL B;  3H82 A;  1E6P A;  3H0R C;  3MNN D;  5HWV A;  2ZC7 A;  3WAA D;  1K4E A;  2PBD P;  2L5A A;  2QJ7 A;  5E5A A;  4BD1 A;  3CAX A;  4PKY G;  1BH9 A;  4WNN A;  1LL8 A;  2XR0 A;  4WMC D;  4HMC A;  4ZUX A;  1F1E A;  3KX0 X;  4LPZ A;  3VFH A;  2QWS A;  4YNR A;  5JRG B;  3MZF A;  1W5D A;  4H9O A;  3OPR A;  5B31 A;  4G92 B;  4EBN A;  4YOF A;  4EES A;  3MFD A;  1YU4 A;  1ES4 A;  5DNN B;  5DJT A;  2HF6 A;  2JKF A;  1TZY C;  3IXG A;  1OTI A;  4B9O A;  1HD8 A;  3R45 B;  1HVB A;  3X1V A;  4IVI A;  2D01 A;  1P3A A;  3X1U C;  4XUX A;  3REJ D;  3LI9 A;  4K0W A;  5HAP A;  4OJL A;  3BRM A;  4Y0O A;  3LZ0 D;  1YMX A;  3REJ B;  2LB5 A;  3UT9 C;  3B3X A;  1W1V A;  1EQZ B;  4IVK A;  3B6F B;  3UTA D;  1HQ3 C;  2Z6D A;  4OQ0 A;  4S2N A;  4EO5 C;  1G6A A;  1M18 C;  1F9I A;  1NYM A;  2V9A A;  1ESI A;  1J9M A;  1GOI A;  3E4P A;  2HJE A;  1ALQ A;  3C8C A;  3CHW P;  4IBC A;  4KG5 A;  4DF6 A;  4KUD B;  2NZD C;  2RTS A;  4J8V C;  3IXB A;  1Z09 A;  2BYK B;  4R4R A;  3MGP D;  2OWJ A;  4QB8 A;  4NZ3 A;  4EQ1 A;  1ID3 B;  5GSU A;  2A3U A;  3VOZ A;  1GCE A;  3ZNT A;  4FTX A;  4Z2M G;  3AYW D;  3V3R A;  5HW3 A;  5B2J D;  5B33 C;  2EX6 A;  1BUL A;  3AZI D;  3W99 A;  3HCY A;  2PYP A;  5B0Y A;  5GT0 B;  3REH C;  5B0Z A;  1YT4 A;  2V2F F;  3ZG7 B;  1CF0 A;  2YFV B;  1KX4 C;  2UV0 E;  4R3B A;  3B6G C;  1OT9 A;  1SDN A;  1WYB A;  4AWL B;  2WYX A;  4L9E A;  3X1S C;  2J3W A;  3MZE A;  4ZBE A;  3HLW A;  1XKZ A;  2YKF A;  1CK7 A;  4DQY B;  2V1A A;  3ITB A;  5AV8 D;  3WKJ D;  3BQA A;  4OQH A;  5A91 A;  2KX6 A;  2EA9 A;  4H9R A;  5CPK D;  4CLC D;  3MXQ A;  2WKP A;  4HNB A;  4JKT A;  4WV4 B;  4WNN B;  5HZH A;  4ZUX B;  5CPK B;  4LLO B;  1RCJ A;  3PBN A;  4S2O A;  3O62 B;  1M19 D;  1J7M A;  3MBZ A;  1W79 A;  5B33 A;  3NBL A;  3AZN B;  5HPI A;  3OPH A;  1ES5 A;  2Z2M B;  4UQI S;  3WX7 A;  5EOO A;  3SH9 A;  3L28 A;  3A0S A;  2ZC3 B;  3AGE A;  3LJA B;  3H7W A;  3KSI A;  3Q7V B;  3ZQ5 A;  5B32 A;  3LYX A;  3CPT A;  3NIA A;  4WN5 A;  1K0K A;  3X1V B;  2ZMA A;  5IU1 A;  3C2W A;  2Y2Q A;  4XZQ C;  1PFL A;  5E5A B;  4HGA C;  3FKV A;  4E3O A;  4DDY A;  4XZQ A;  2HPB A;  3GTC A;  3AZM B;  4GH9 A;  5HAR A;  3MGS C;  1IKG A;  5G18 A;  1GA9 A;  4KZ5 A;  1GHI A;  3A0V A;  4I38 A;  4HHD A;  2Z6C A;  4X25 A;  4HBT A;  3NOT C;  1PWG A;  4IHQ A;  5JYO A;  4YM6 D;  4H9Q A;  1ZHH B;  4LV0 A;  2DCF A;  4N9K A;  5B2J A;  3ULF A;  3UB6 A;  4GD8 A;  2JKT I;  4HBU A;  2HDQ A;  2V5O A;  4YM6 B;  1IYS A;  2WUQ A;  3AN2 B;  5EVI D;  5EE8 A;  3BEC A;  3E0Y A;  4AWL C;  4Y3I A;  3B0C T;  3C1C B;  3BLS A;  3B0D B;  4EUZ A;  4ZAM A;  5B1L C;  5AQ9 A;  5AV9 C;  4MEZ A;  4XUJ A;  4EU0 A;  3C1C D;  4QWO A;  4JBF A;  2P04 A;  4KUO A;  3KUY A;  1P3M D;  3O3V A;  5FQJ A;  2Q0O A;  5FDS A;  3GMW A;  4IBK A;  3UDF A;  5AVC B;  1S66 L;  5CGW A;  1FIL A;  2J9O A;  1P3F D;  3C4P A;  1E3U D;  3W98 D;  5G49 A;  5FL3 A;  3KUY D;  1ZLA D;  5FEF A;  5B2J C;  5B33 D;  4K0X A;  4Z9Q A;  3KS8 A;  5L10 A;  3MSH A;  1KX3 A;  1YLP A;  1BH8 A;  3H0M C;  1ESU A;  1TDL A;  2HP9 A;  1ONG A;  3P09 A;  4PM5 A;  1P0Z A;  3HUM A;  1KX4 D;  1GHM A;  2GJ3 A;  1JWZ A;  4Z2I A;  2DMW A;  3HL9 A;  3A6N C;  1RGZ A;  5FAO A;  3V5M A;  1W1P A;  2VGJ A;  3T4O A;  2Q9N A;  2ZBB A;  3PXP A;  3OLO A;  3W2Z A;  3AZE A;  4WU8 D;  1TAF B;  4CLC A;  1DP9 A;  1SKO A;  4GJ4 A;  2JE5 A;  2ZM8 A;  2NQB C;  5DF7 A;  3V67 A;  3SS4 A;  4BLM A;  3Q07 A;  4NE3 A;  5FQM A;  5HDD A;  4PM8 A;  4OPQ A;  3VSK A;  3C1B A;  4Z2H A;  3WTP C;  3MVD C;  3B6G B;  4X1L A;  4JJN C;  3C4O A;  5B1M A;  3H7W B;  5JA4 B;  2WGW B;  4KZB A;  1YMS A;  1K6R A;  3IWQ A;  4HP9 A;  4KQD A;  1H0I A;  5EVI A;  1KDW A;  2HP5 A;  3HLF A;  3JVU A;  4X23 B;  5B32 D;  1KX5 A;  3KYZ A;  4FSF A;  2WKH A;  1KX5 C;  3UTB A;  1ID3 C;  2V20 A;  1L0G A;  4X23 D;  3HLB A;  1Z6F A;  4XZQ D;  3V9R A;  4LD9 A;  1MPL A;  1W8Q A;  2ZY5 A;  1YLZ A;  1W7F A;  5FQQ A;  1K54 C;  3REK D;  2CV5 D;  1K54 A;  2W1R A;  1S32 C;  2JCH A;  4LEN A;  1M1A B;  1OJ5 A;  3REK B;  3V50 A;  2EWV A;  3CPT B;  3NC8 A;  2V0U A;  1KVM A;  5E2E A;  4AFI A;  4WUJ A;  4I3I A;  3MQQ A;  2ARO C;  1P3G A;  2IA2 A;  1P34 C;  2HGV A;  4CAY B;  4J8X B;  1VB6 A;  2J80 A;  1MWU A;  2W3D A;  3LI8 A;  4O01 A;  5EVI C;  3HBR A;  4B4X A;  3BFD A;  3UTB C;  1MY8 A;  1S4R A;  5FUG A;  4J8W B;  1OTA A;  2P9V B;  4M4X A;  2KLI A;  5I94 A;  4OOM A;  4WU8 A;  3BQ8 A;  5B31 D;  5DVA A;  4FOF A;  2F8N A;  3LO7 A;  3MNN B;  1NZU A;  4LV3 A;  1H8Z A;  3T1Q B;  1KVL A;  5BT1 C;  3QNB A;  4LCM A;  4NXG A;  5CGX A;  5HD5 A;  4WZ5 C;  5B31 B;  3F1P A;  3AZJ B;  5GT3 D;  5AJG A;  3REH D;  4UA7 A;  3AZF C;  3VP2 A;  4F94 A;  4G92 C;  1XJ6 A;  3N6I A;  2B18 A;  1ZLA C;  3GRJ A;  3AZJ D;  3PBR A;  3IF6 C;  4ZDX A;  3DW0 A;  4Z5T A;  4O8G A;  4WLA A;  2VV8 A;  3RJU A;  3REL C;  3AZM C;  1H0G A;  4BL2 A;  4DMZ A;  4KG6 A;  1OT6 A;  5BS7 A;  5AVC A;  1VET A;  3GVB A;  3VP1 A;  1K57 A;  2K2N A;  2HDU A;  3I7J A;  4OOL A;  4DE2 A;  4R4S A;  2PYO D;  4L9G A;  4IED A;  5AV6 A;  4CLC C;  2EXB A;  1G68 A;  1WWS A;  4NFT A;  3LJA C;  1XGJ A;  3AV1 D;  2HV1 A;  5F99 D;  3MR0 A;  5GXQ C;  3T4J A;  3WD4 A;  5AV5 D;  4LRX C;  5M18 A;  2VGL M;  1P3P B;  3EPJ A;  4FD8 A;  4Y15 A;  2VGK A;  3AFA C;  5DNM C;  3AV1 A;  1TS8 A;  3RFB A;  3E4Q A;  5BNX B;  2VGL S;  3MGP A;  3KO6 A;  3G31 A;  3UB8 A;  1F66 A;  5FI2 A;  1LT0 A;  3IP4 C;  1YKD A;  3UN7 A;  1W8Y A;  3VSL A;  1H3Q A;  5EUA A;  4M6B A;  5B0Y D;  2F8N G;  3MF0 A;  1Y54 A;  4R1G A;  5AY8 A;  3IXH A;  5B1M B;  1YLY A;  1IFQ A;  4WEL A;  3W97 B;  1L0E A;  1HQ3 A;  4NE5 A;  4CSR B;  3B33 A;  5DJU A;  5B1L A;  4DE1 A;  3MGR B;  4WMC A;  3X1U D;  3EGX C;  3EOI A;  5CP6 A;  5HAI A;  3G32 A;  3MKE A;  5HL1 A;  3X1V C;  3EQV A;  3N8L A;  4MBF A;  1VEU B;  1WE4 A;  3LZ0 C;  4D2O A;  5M1A A;  4HES A;  4UUZ B;  3B0C W;  3C38 A;  4DXB A;  1QO6 A;  3BFE A;  3S1Y A;  1E6N A;  1YM1 A;  3LIF A;  1VQQ A;  1V9Z A;  4PM6 A;  2Y2M A;  3M7P A;  3VH5 A;  3VOY A;  2O0Y A;  4RYE A;  1U35 C;  1U60 A;  1RP5 A;  4UA6 A;  3O62 C;  2XK1 A;  5F1G A;  3M2J A;  3ZYT A;  3WKJ B;  4ZUX C;  3G2Y A;  5EEC A;  3C30 A;  3MGS D;  5IT5 A;  3R45 A;  4IBB A;  5F99 A;  4A5R A;  1O7E A;  4HEF A;  2F8N D;  4XT2 B;  4XXR A;  4X69 A;  5B31 C;  5HAQ A;  5TFQ A;  4QY6 A;  3T4Q A;  5GL9 A;  1E6Z A;  1JTG A;  5CTN A;  1ERM A;  1Y4O A;  2WGV A;  2ZJ9 A;  4XUZ A;  3NUL A;  4J8V A;  5CPJ D;  1JNU A;  1P3I A;  3EWK A;  3X1S B;  3UTA A;  5E2H A;  2Y2P A;  1KGE A;  2PU2 A;  1H8Y A;  3N4I A;  2QMI A;  5L09 A;  3ZG8 B;  1J3W A;  2FFY A;  4P0M A;  3IS2 B;  4EQI A;  1H8P A;  4J8V D;  1PWC A;  4Z2J A;  2E8I A;  2W1T B;  3G30 A;  3PBO A;  5FAS A;  1M40 A;  4DJ2 A;  4U0X A;  2IWC A;  4H9Q B;  1K38 A;  2BTF P;  1N9O A;  3WKJ C;  5I5L A;  1K25 A;  5GXQ D;  1U35 B;  1W1Y A;  3T1X A;  1S32 B;  1K55 A;  5CHU A;  2FJ7 B;  3KWQ D;  4Z2G A;  3W98 C;  3DWK A;  4X68 A;  4RVA A;  4OLG A;  1UR8 A;  3C1C A;  3WRT A;  1P3L B;  1W2E A;  3KXB B;  1LL9 A;  2O9B A;  3DWZ A;  3T50 A;  2W27 A;  1EQZ C;  3KXB D;  3FV7 A;  3LR3 A;  2JBF A;  3R7W A;  3L29 A;  4S2P A;  3UPO A;  3D4F A;  3QP1 A;  3A3F A;  4RX2 A;  5B24 D;  2XGN A;  5FDH A;  4IBG A;  3VP4 A;  4NZ1 A;  4E3I A;  4OOY A;  2NQB D;  2ARO A;  2Y2J A;  1S67 L;  2Z2L B;  2NQB B;  3O88 A;  4J8U C;  4ZJ1 A;  3BM6 A;  2M1C A;  3PAG A;  4H8R A;  5DFY A;  1K4F A;  1P3I D;  1MWR A;  4KGC B;  3X1V D;  4Y17 A;  4E3N A;  2IO5 B;  2WZZ A;  3HUN A;  5BO0 B;  1Q2P A;  4UEY A;  5KSH A;  4WU9 D;  3LIC A;  5AY8 B;  2A2L A;  4C3Q A;  1LL5 A;  1P3B C;  1OJG A;  4HY8 A;  3C1B D;  1DJA A;  4NXF A;  3WD3 A;  3TW8 A;  4B88 A;  4NZ4 A;  1JTD A;  5CP6 B;  1ZG6 A;  4WU9 A;  1CQA A;  5B2I D;  2D02 A;  3UNW A;  5BT1 D;  1VHM A;  1VEU A;  2CV5 C;  2WK0 A;  1M19 A;  2WGW A;  4BBV A;  4O7D A;  3OZH A;  3VH5 T;  4X23 A;  2G2W A;  4C6Y A;  2KOI A;  5B32 G;  3S7N A;  3AZK D;  3T1S A;  2X02 A;  4N92 A;  2VX8 A;  2G5H C;  2EXA A;  3IF6 B;  4KZA A;  3AZG D;  2W1T A;  2P7J A;  3LR0 A;  3WAA B;  5AV9 B;  3FKW A;  2XRO A;  4B4Z A;  4DRB A;  4QLC B;  3UB9 A;  2Y79 A;  2IWB A;  1DJC A;  2LB9 A;  3KYQ A;  3AZG B;  5TR7 A;  4Y5F A;  3LCE A;  3AV1 C;  1IYP A;  3BLM A;  1T1C A;  3LEL A;  1P3G D;  1PZP A;  2HP6 A;  3HLD A;  2B95 A;  3KUY B;  3QHY A;  1I2S A;  3E98 A;  3X1S A;  3AV2 B;  4Z2M H;  3W98 A;  5AVE A;  2JKG A;  4OP5 A;  3AFA B;  2AVX A;  4QJG A;  1CXW A;  4Z2K A;  3LIB A;  2Y2N A;  2PYO B;  4YFM A;  5CX7 A;  2Y55 A;  4E6W A;  3QNC A;  4M3K A;  4OJ6 A;  4DRT A;  1R4V A;  4OPR A;  5DTT A;  1FCO A;  3KSF A;  1BLC A;  5TBM A;  3PBT A;  3BYD A;  3NEC A;  1BUE A;  4IJG A;  3KXB C;  1NRF A;  4WU8 C;  2VA0 A;  3F1O A;  4GLQ A;  2FJ7 A;  5HFO A;  5CP6 C;  3AZJ A;  3PYP A;  3ZDJ A;  5B2I A;  5FA7 A;  4HQA A;  2NUP C;  1JFI B;  3WTP D;  3LZ1 D;  3MVD D;  2IOU A;  5GHY A;  1GPF A;  3EG5 B;  1HLU P;  5AQB A;  2F2A C;  3UE1 A;  1ED7 A;  1ID3 A;  1JWV A;  3AZH C;  1A0K A;  2ZC6 B;  3CUE A;  4CPK A;  2OOL A;  3A3J A;  3K2N A;  3LZ1 B;  2ZMF A;  5BO0 A;  2DRW A;  2VK3 A;  3AZK A;  2UWX A;  4KGC C;  1PI5 A;  2Y8H A;  3EPL A;  3EPK A;  4BMW A;  1KX5 D;  3WS4 A;  5BOH A;  5EM0 A;  1ID3 D;  4UPK A;  3LR5 A;  2V0W A;  4WU9 C;  5GHZ A;  4Z66 D;  1PW8 A;  4OH0 A;  2HIO B;  3L26 A;  2PHY A;  3P5J B;  5DTK A;  5J3W A;  1NWZ A;  2WZX A;  3AZI B;  2EWW A;  2VEA A;  4L9F A;  3ZG0 A;  4B93 A;  2BYK A;  3W96 B;  5CPI C;  2VZW A;  2XSS A;  3WRZ A;  5B40 B;  2Y91 A;  3FYZ A;  2BYM A;  5M19 A;  5CPJ C;  3A6N B;  2OV5 A;  1SKF A;  1TVF A;  1C3B A;  4DJ3 A;  2NZD B;  3W4O A;  1VM1 A;  2KDK A;  1XPB A;  2BG1 A;  1HQ3 D;  2ZY3 A;  4NXE A;  3LEZ A;  3UTB D;  2PD8 A;  1P3O D;  1ZTU A;  1YU1 A;  4CAY A;  1XJ3 A;  3W4Q A;  1HQ3 B;  1BT5 A;  4PKY A;  4CSR A;  1SZV A;  3WS1 A;  1ZLA A;  4G91 C;  3AZN D;  3JPU A;  5FUG B;  1PDC A;  3UO9 A;  3AZM A;  4GCZ A;  2PYO C;  4OJP A;  3Q1F A;  1FR6 A;  4MN5 A;  3REI B;  3W97 C;  4EWF A;  1S4S A;  5AV9 A;  3AZI C;  1P3F C;  3AZE C;  1ACF A;  3L9K A;  5DNN D;  3VH6 W;  1BTL A;  4UHU A;  3AZM D;  5GSU C;  1DJB A;  3CZD A;  3KUY C;  3A1I A;  1I2W A;  2G7U A;  2L0W A;  1MZU A;  5JYP A;  1F2K A;  4LGW A;  5AV6 D;  3D72 A;  2DNS A;  4LV1 A;  3RXW A;  5F99 C;  4MBH A;  2FJ7 D;  3KSG A;  5AV5 C;  5AV6 B;  2ZMV A;  3UB7 A;  2H5S A;  3AN2 D;  4BD0 A;  4II7 A;  3MGS B;  4DDS A;  3LZ1 A;  1D1J A;  5DNM D;  2JKT M;  3E4O A;  2Y2K A;  1T1B A;  3N3F A;  4MB3 A;  1FR1 A;  1MXO A;  2Y2I A;  1H5X A;  5KMW A;  2J8Y A;  4KG2 A;  4KHA A;  4GDN A;  1P3M B;  2WAF A;  1YLJ A;  3V39 A;  4IBR A;  1BH8 B;  2JSS A;  5GXQ A;  4X6T A;  4Z66 A;  5HD3 A;  4MBK A;  4Y0U A;  4DN0 A;  1FQG A;  5B32 C;  4Z66 C;  5B2I C;  5B1M C;  3AZN A;  1P34 A;  1N1J B;  4KZ3 A;  1PZR A;  5B40 A;  3NHQ A;  1E25 A;  3DBA A;  4LV2 A;  5GLC A;  3DTE A;  2JKR I;  3NOP C;  4J8U B;  4YM6 C; 
#chains in the Genus database with same CATH homology
 4KZ8 A;  1IEL A;  2HUE C;  2Y2H A;  1XXM A;  2RVQ D;  4BL3 A;  2YFW A;  1S32 D;  3NQU B;  5E2F A;  4J8U D;  3AGD A;  3C1B B;  4ZJ3 A;  3E2L A;  1AOI B;  3FZC A;  2ARO D;  1BLP A;  5EVI B;  1Q2Q A;  4H9P A;  2I72 A;  3C7V A;  4ZUX D;  3HRE A;  2ARO B;  3W4P A;  1QMF A;  1P3M C;  3A6N A;  4OPZ A;  5DTS A;  1TAF A;  2NZD A;  4KUD C;  1P3L C;  3G4P A;  3IWO A;  5GLA A;  4S2K A;  1K57 C;  2ZD8 A;  5CHM A;  4X56 A;  3ZG5 A;  3WA9 B;  3UT9 D;  3KS4 A;  2X01 A;  1M18 B;  3VH6 T;  5JA4 A;  1YLT A;  1FOF A;  1ZLA B;  4QD4 A;  1P3I B;  4E3K A;  3VMA A;  1M18 D;  4NZ5 A;  3AZJ C;  3LY3 A;  3FWL A;  2IO5 C;  1ONH A;  4KZ9 A;  4S2L A;  4J8X A;  1M1A D;  1YU0 A;  3TSG A;  3REI A;  3PAE A;  4NET A;  3UPN A;  3IT9 A;  3IHB A;  5FQ9 A;  4YIN A;  1P3G C;  2LY8 A;  4J8X D;  1MWT A;  1KE4 A;  4GHA A;  1KE3 A;  1TZY B;  2J7V A;  4JXW A;  2EFX A;  3P98 A;  5CPJ A;  4FCF A;  1S32 A;  2VQR A;  1P3A B;  2ZQC A;  5CTM A;  4ZTK A;  3X1T C;  3B6G D;  1GA0 A;  3UE3 A;  5CRF A;  3VP0 A;  1B67 A;  3KXB A;  1P3A D;  4S2I A;  2W8S A;  1N1J A;  1H3O A;  2P74 A;  3G2Z A;  4KZ4 A;  3W99 D;  3X1U A;  3W98 B;  1BZA A;  1I5Q A;  5EOE A;  1M6K A;  5C3I B;  1CEG A;  3HVF A;  1KX5 B;  4LG2 A;  3ZCZ A;  5AVC C;  4WBG A;  1E4D A;  5EPH A;  1PYY A;  3NDE A;  4JF4 A;  3MGR C;  5CPI B;  2RVQ C;  3CMZ A;  2CWE A;  4H9S A;  4WM9 A;  3CJM A;  1FSY A;  3MKF A;  3C1B C;  5BNX A;  3UTA C;  2C5W B;  1S6R A;  5J8X A;  1QME A;  1JFI A;  1ZC2 A;  2HUE B;  2OSU A;  3ZHH A;  3AYW A;  4NYY A;  4OP8 A;  4E45 A;  3NQU A;  2RL3 A;  4IBD A;  2B5R A;  2NZD D;  5B0Z D;  3Q7Z A;  3ZNY A;  3AZH B;  1MWS A;  1Z2C B;  5B32 B;  3WWX A;  2GDN A;  4QHC A;  3MGR A;  3WTP E;  2G2U A;  4XZQ B;  2HIO A;  1WYC A;  4P85 A;  4GN2 A;  1TDG A;  1F66 B;  4OON A;  2CV5 B;  1PI4 A;  4QY5 A;  3REI D;  3CG5 A;  2ZM0 A;  2HIO D;  5JRG D;  3A1K A;  4ZBJ C;  3AZN C;  3GV9 A;  3REL B;  1BSG A;  1CI8 A;  2ZY4 A;  1SDE A;  3OPL A;  3W97 A;  4JF5 A;  5CPK C;  3TU4 B;  1SHV A;  5AY8 C;  5B1L B;  5F99 B;  4BEN A;  3BFF A;  5FI6 A;  5A93 A;  2G5I C;  5GLB A;  1P3P D;  4FH2 A;  3MGQ C;  1M19 C;  4WYY A;  5KZH A;  2H0Y A;  3HSH A;  4UUZ A;  3IHA A;  4P6B A;  3BFC A;  3UTA B;  4YS3 D;  4J8W C;  4EV4 A;  4UA9 A;  1P3P A;  5DNM B;  2XFS A;  1HTA A;  4Z5T C;  1EQZ D;  3GQZ A;  4OUI A;  5CEB A;  5F83 A;  5E5A C;  1BLH A;  2X71 A;  3WS0 A;  3V3S A;  3ZFZ A;  1ES2 A;  3MGR D;  2Y4A A;  5F1F A;  3L27 A;  5FAQ A;  3NY4 A;  5BNV A;  2WAD A;  3AGF A;  1P3L A;  2ZQ8 A;  1L0F A;  4EO5 B;  3AYW B;  5G49 B;  5AV5 B;  2R9W A;  2RIQ A;  5TGF A;  5FQI A;  5GT0 D;  1KX3 B;  1CEF A;  1P3L D;  1LI9 A;  3B0B A;  4IBF A;  5GLD A;  1KX3 D;  4DE3 A;  1U35 A;  4R0Q A;  5CEC A;  5AV8 B;  3AZF A;  3Q81 A;  3UTB B;  3AZE B;  2F8N K;  4R8P B;  4NK3 A;  1P34 D;  5FI7 A;  1T3U A;  2CV5 A;  2J8P A;  3AZE D;  1DY6 A;  5DNN C;  1AXB A;  3G35 A;  2ZC4 B;  2EX8 A;  1P34 B;  5DF8 A;  4E3L A;  5BS7 C;  4NYU A;  1YU3 A;  1LLB A;  3MXS A;  1YU2 A;  4NY2 A;  2XFT A;  4CJN A;  1PIO A;  4J8U A;  3WA9 D;  1Q9C A;  5FSR A;  4J8V B;  3A3E A;  2XEP A;  5BPV A;  4GKU A;  2YFV A;  3W97 D;  1CI9 A;  2FJ7 C;  4ID4 A;  3W8K A;  3WS5 A;  3LEL C;  3V9R B;  4LD9 B;  3O87 A;  3B6F C;  3Q82 A;  5B40 C;  1P3A C;  1P3O A;  4LD9 D;  1L0D A;  1K56 A;  5GT3 A;  1AOI C;  1ZG4 A;  4JJN B;  5AV8 C;  4BJP A;  4Z5T D;  3EQU A;  3HON A;  3LJA A;  5AVC D;  1P3K C;  3VH5 W;  4BQM A;  1M19 B;  3IWI A;  4OJ5 A;  4QLC D;  4N1X A;  4E3J A;  2C6W B;  4GB7 A;  1NXY A;  1WWI A;  1PW1 A;  1P3I C;  3W99 B;  4OQG A;  3AFA A;  3RXX A;  4EBL A;  5CGS A;  5AV5 A;  3C5A A;  3MNN A;  2JC7 A;  4KGC D;  4C75 A;  1K6S A;  5GXQ B;  2XDM A;  5KDM A;  3HLC A;  1IKI A;  5B2J B;  4OLD A;  2WKE A;  2XF3 A;  4JXS A;  2QPN A;  3MXR A;  1F66 C;  3REH A;  3M6H A;  3SOI A;  2PBY A;  5A92 A;  2ZM5 A;  3BFG A;  4IJF A;  4ZJ2 A;  5BNV B;  1NYY A;  2XLN A;  4XUJ B;  4JXV A;  2EFU A;  5CXW A;  4X55 A;  3AZL B;  4MNR A;  1XA7 A;  3NQJ A;  3LZ0 A;  4GD6 A;  3O62 D;  5AV9 D;  2Y2L A;  1SCW A;  3EPH A;  4K91 A;  3AZL C;  1P3F B;  3LJA D;  3SS5 A;  3O62 A;  1NJ4 A;  1P3P C;  5B33 B;  1NY0 A;  1ULY A;  4ZBJ B;  3AV2 D;  2XH9 A;  4WZ5 A;  2R9X A;  5C3I C;  3AFA D;  1M18 A;  3Q7V A;  4DRA A;  3AN2 A;  1M1A C;  2ZLY A;  3AV2 A;  5GSU D;  4KEN B;  4KQQ A;  4H9N A;  5AVB C;  2HDR A;  2H10 A;  3A6N D;  2Y59 A;  3KFU G;  3AZI A;  5CP6 D;  5AV6 C;  2ZQA A;  3W99 C;  3X1T B;  4LCL A;  3C7U A;  1P3O B;  3KWQ C;  3AZH D;  4KQO A;  4FH4 A;  2BYM B;  3MNN C;  1TZY A;  3X1T D;  3ISG A;  5GT3 B;  3WKJ A;  4R8P C;  2EX2 A;  3UE0 A;  3ZVT A;  5KDM B;  3REL A;  3JYI A;  3IXD A;  1IYO A;  5GT0 C;  3REH B;  3UY6 A;  1P3B A;  3IQA A;  2WKI A;  3VP3 A;  5B24 C;  3OCN A;  4WEJ A;  4U3T A;  1KX3 C;  3N8R A;  3N8S A;  4PMA A;  5CPI D;  4G91 B;  4H9S C;  1JVJ A;  2H0T A;  3O86 A;  5U47 A;  3TOI A;  3REK C;  1P3K A;  1XA1 A;  4RX3 A;  3FKE A;  1L2S A;  3TU4 D;  3HLE A;  3W96 D;  4E44 A;  2ZQ9 A;  2Q9M A;  3B6G A;  5CPI A;  4J8W A;  3B6F A;  1FSW A;  1B6W A;  4WU8 B;  3LZ0 B;  1JWP A;  3W96 A;  4IBX A;  3VH6 A;  4WZ4 A;  5L2F A;  4R3J A;  3UT9 A;  2F8N H;  1EWZ A;  1KGF A;  3UDX A;  3REJ C;  4IBE A;  1TEM A;  5B0Z C;  4PM7 A;  3NCK A;  3OC2 A;  5CED A;  3GR2 A;  2XD5 A;  4EBP A;  3WTP B;  3MVD B;  2HIO C;  2ZY2 A;  5F82 A;  3AZH A;  4OJO A;  4KUD D;  1M1A A;  4E3M A;  5B31 G;  5B0Y B;  5GT3 C;  3L25 A;  1P3M A;  3AZG C;  2FFF B;  1FCM A;  1BH9 B;  5B24 A;  2OLU A;  3MGQ D;  1P3F A;  4QU3 A;  5HX9 A;  3REL D;  5JRG C;  4KZ7 A;  1A7W A;  4Z66 B;  2NQB A;  3ITA A;  3PTE A;  5JRG A;  1NZO A;  4IBJ A;  4H9P B;  3WA9 C;  4JPM A;  5AQ7 A;  1IYQ A;  1KX4 A;  4R8P A;  2F8N B;  4QNL A;  3SS3 A;  3TU4 A;  4Y7P A;  2J9P A;  2YFW B;  3ZGA B;  3LEL D;  4H9N B;  1YLW A;  4P87 A;  4YS3 C;  4J8W D;  3B6F D;  3A3D A;  4JLF A;  4R8P D;  3X1S D;  3VFF A;  4MLL A;  4KZ6 A;  1ES3 A;  1AOI A;  4GDB A;  4Z5T B;  5A90 A;  3REJ A;  1P3B B;  4WZS B;  3MZD A;  3E2K A;  2OLV A;  3B0D C;  3KSY A;  5AVB A;  1EQZ A;  2IWD A;  1P3B D;  4GNU A;  5GHX A;  2P9V A;  5B1M D;  3OCL A;  4Q8I A;  1ERO A;  1P3K B;  5B0Y C;  3IF6 A;  1PZO A;  2ZC5 B;  4GOG A;  1PWD A;  4WJ3 C;  3DTM A;  1P3K D;  1XP4 A;  4QLC C;  3AZG A;  3OPP A;  4KUD A;  3WAA C;  3TU4 C;  4U0T A;  4YM6 A;  4Y0T A;  1OME A;  4YS3 A;  1KDS A;  4HGA B;  4IJE A;  4IBI A;  3PBQ A;  1N9B A;  5GT0 A;  4GZB A;  1MKI A;  2WGI A;  4XUJ D;  1XX2 A;  1YQS A;  5DF9 A;  4OQI A;  3HLG A;  3L2A A;  3AZF D;  3H0L C;  4H9R B;  5CPJ B;  3S22 A;  2PU4 A;  5AV8 A;  3AZF B;  1E3U A;  3MGP B;  4NE6 A;  5B24 B;  3UT9 B;  4DXC A;  5E2G A;  5CPK A;  2ZM2 A;  3MGQ A;  3LY4 A;  4JF6 A;  3IH9 A;  3ZVW A;  3F6T A;  3NDG A;  3A3I A;  3WTP A;  3MVD A;  2BLS A;  3X1U B;  2EX9 A;  1KGG A;  3WA9 A;  4S2J A;  1LHY A;  4N9L A;  1KX4 B;  2RCX A;  5CHJ A;  1GHP A;  3REI C;  2ZQD A;  5KSC A;  4S2M A;  4J8X C;  4OVD A;  1EI5 A;  3KWQ B;  1RGY A;  3MGP C;  5FAP A;  3LZ1 C;  2WAE A;  4OPY A;  3M6B A;  3UDI A;  4LD9 C;  5IHV A;  3N7W A;  3AYW C;  1K56 D;  4PM9 A;  4JJN D;  1AOI D;  1IEM A;  5AVB B;  5EVL A;  3HUO A;  4DE0 A;  3FDD A;  4DKI A;  5AVB D;  1HZO A;  3SH7 A;  1BFM A;  4H9O B;  3S4X A;  1XGI A;  4JJN A;  3BEB A;  2XD1 A;  1BLS A;  2DF4 C;  4X23 C;  3W96 C;  1F66 D;  3G34 A;  2V1Z A;  5E5A D;  1H3O B;  4JXG A;  3UPP A;  4PPR A;  3SH8 A;  2HDS A;  5CER A;  1P3G B;  4WU9 B;  1LI0 A;  3WS2 A;  4R23 A;  4S2N C;  2XQZ A;  1FCN A;  1U35 D;  5B1L D;  1P3O C;  2ZQ7 A;  1TZY D;  3X1T A;  3TG9 A;  3GSG A;  2Y2G A;  5AQA A;  5DNN A;  4XUJ C;  4KHA B;  5D3O A;  3ZG9 B;  3WAA A;  4YS3 B;  4WEK A;  3AZL D;  3M2K A;  2QZ6 A;  4N1H A;  4L0L A;  3NI9 A;  4KQR A;  3AL0 C;  3AZK C;  3MGS A;  4KGC A;  3AZL A;  3IH8 A;  1MBL A;  3NQJ B;  5DNM A;  2A49 A;  1HTZ A;  1ERQ A;  4E6X A;  2CC1 A;  2PYO A;  5FQK A;  3C1C C;  3AV2 C;  4OKP A;  5AY8 D;  3AN2 C;  2Y2O A;  3MGQ B;  2DQN C;  3AV1 B;  5GSU B;  1YUE A;  1KE0 A;  3PBS A;  1N4O A;  1KU5 A;  5B2I B;  1CK3 A;  3REK A;  4X53 A;  5E43 A;  5B40 D;  5B0Z B;  1O07 A;  4QLC A;  4GHL A;  3KWQ A;  1K55 C;  5FAT A;  4RA7 A;  1S0W A;  1ZKJ A;  5CHL B;  3AZK B;  3IF5 A;  4UAA A;  3LEL B;  3H0R C;  3MNN D;  2ZC7 A;  3WAA D;  1K4E A;  2L5A A;  5E5A A;  4BD1 A;  1BH9 A;  4WNN A;  2XR0 A;  4WMC D;  4ZUX A;  1F1E A;  3VFH A;  5JRG B;  3MZF A;  1W5D A;  4H9O A;  3OPR A;  5B31 A;  4G92 B;  4EBN A;  3MFD A;  1YU4 A;  1ES4 A;  5DNN B;  1TZY C;  3IXG A;  1HD8 A;  3R45 B;  1HVB A;  3X1V A;  4IVI A;  1P3A A;  3X1U C;  4XUX A;  3REJ D;  4K0W A;  5HAP A;  4OJL A;  3BRM A;  4Y0O A;  3LZ0 D;  1YMX A;  3REJ B;  3UT9 C;  3B3X A;  4IVK A;  1EQZ B;  3B6F B;  3UTA D;  1HQ3 C;  4OQ0 A;  4S2N A;  4EO5 C;  1G6A A;  1M18 C;  1NYM A;  1ESI A;  1J9M A;  1ALQ A;  4IBC A;  4KG5 A;  4DF6 A;  4KUD B;  2NZD C;  4J8V C;  3IXB A;  2BYK B;  4R4R A;  3MGP D;  4QB8 A;  4NZ3 A;  1ID3 B;  5GSU A;  2A3U A;  3VOZ A;  1GCE A;  3ZNT A;  4Z2M G;  3AYW D;  3V3R A;  5HW3 A;  5B2J D;  5B33 C;  2EX6 A;  1BUL A;  3AZI D;  3W99 A;  5B0Y A;  5GT0 B;  3REH C;  5B0Z A;  1YT4 A;  2V2F F;  3ZG7 B;  2YFV B;  1KX4 C;  4R3B A;  3B6G C;  1SDN A;  1WYB A;  4AWL B;  2WYX A;  3X1S C;  3MZE A;  4ZBE A;  3HLW A;  1XKZ A;  4DQY B;  3ITB A;  5AV8 D;  3WKJ D;  4OQH A;  5A91 A;  4H9R A;  5CPK D;  4JKT A;  4WV4 B;  4WNN B;  4ZUX B;  5CPK B;  1RCJ A;  3PBN A;  4S2O A;  3O62 B;  1M19 D;  3MBZ A;  1W79 A;  5B33 A;  3NBL A;  3AZN B;  3OPH A;  1ES5 A;  2Z2M B;  3WX7 A;  5EOO A;  3SH9 A;  3L28 A;  2ZC3 B;  3AGE A;  3LJA B;  3Q7V B;  5B32 A;  3NIA A;  3X1V B;  2ZMA A;  2Y2Q A;  4XZQ C;  5E5A B;  4HGA C;  3FKV A;  4E3O A;  4DDY A;  3GTC A;  4XZQ A;  2HPB A;  3AZM B;  4GH9 A;  5HAR A;  3MGS C;  1IKG A;  5G18 A;  1GA9 A;  4KZ5 A;  1GHI A;  4HBT A;  1PWG A;  5JYO A;  4YM6 D;  4H9Q A;  4LV0 A;  2DCF A;  4N9K A;  5B2J A;  4GD8 A;  4HBU A;  2HDQ A;  4YM6 B;  1IYS A;  2WUQ A;  3AN2 B;  5EVI D;  5EE8 A;  3BEC A;  4AWL C;  3B0C T;  3C1C B;  3BLS A;  3B0D B;  4EUZ A;  4ZAM A;  5B1L C;  5AQ9 A;  5AV9 C;  4MEZ A;  4XUJ A;  3C1C D;  4JBF A;  3KUY A;  1P3M D;  3O3V A;  5FQJ A;  3GMW A;  4IBK A;  3UDF A;  5AVC B;  5CGW A;  2J9O A;  1P3F D;  3C4P A;  1E3U D;  3W98 D;  5G49 A;  3KUY D;  1ZLA D;  5B2J C;  5B33 D;  4K0X A;  4Z9Q A;  3KS8 A;  1KX3 A;  1YLP A;  1BH8 A;  3H0M C;  1ESU A;  1TDL A;  2HP9 A;  1ONG A;  3P09 A;  4PM5 A;  3HUM A;  1KX4 D;  1GHM A;  1JWZ A;  3HL9 A;  3A6N C;  1RGZ A;  5FAO A;  3V5M A;  2VGJ A;  2Q9N A;  3AZE A;  4WU8 D;  1TAF B;  2JE5 A;  2ZM8 A;  2NQB C;  5DF7 A;  3SS4 A;  4BLM A;  3Q07 A;  4NE3 A;  5FQM A;  4PM8 A;  4OPQ A;  3VSK A;  3C1B A;  3WTP C;  3MVD C;  3B6G B;  4JJN C;  3C4O A;  5B1M A;  5JA4 B;  2WGW B;  4KZB A;  1YMS A;  1K6R A;  3IWQ A;  5EVI A;  1KDW A;  2HP5 A;  3HLF A;  4X23 B;  5B32 D;  1KX5 A;  4FSF A;  2WKH A;  1KX5 C;  3UTB A;  1ID3 C;  2V20 A;  1L0G A;  4X23 D;  3HLB A;  1Z6F A;  4XZQ D;  3V9R A;  4LD9 A;  1MPL A;  1W8Q A;  2ZY5 A;  1YLZ A;  1W7F A;  5FQQ A;  1K54 C;  3REK D;  2CV5 D;  1K54 A;  1S32 C;  2JCH A;  4LEN A;  1M1A B;  3REK B;  3V50 A;  3NC8 A;  1KVM A;  5E2E A;  2ARO C;  1P3G A;  1P34 C;  4CAY B;  4J8X B;  5EVI C;  1MWU A;  3HBR A;  4B4X A;  3BFD A;  3UTB C;  1MY8 A;  5FUG A;  4J8W B;  2P9V B;  5I94 A;  4OOM A;  4WU8 A;  5B31 D;  5DVA A;  2F8N A;  3LO7 A;  3MNN B;  1NZU A;  4LV3 A;  1H8Z A;  1KVL A;  5BT1 C;  3QNB A;  4LCM A;  5CGX A;  4WZ5 C;  5B31 B;  3AZJ B;  5GT3 D;  3VP2 A;  3REH D;  4UA7 A;  3AZF C;  4F94 A;  4G92 C;  3N6I A;  1ZLA C;  3GRJ A;  3AZJ D;  3PBR A;  3IF6 C;  4ZDX A;  3DW0 A;  4Z5T A;  3RJU A;  3REL C;  3AZM C;  4BL2 A;  4KG6 A;  5BS7 A;  5AVC A;  3GVB A;  3VP1 A;  1K57 A;  2HDU A;  3I7J A;  4OOL A;  4DE2 A;  4R4S A;  2PYO D;  4IED A;  5AV6 A;  2EXB A;  1G68 A;  1WWS A;  4NFT A;  3LJA C;  1XGJ A;  3AV1 D;  5F99 D;  5GXQ C;  5AV5 D;  5M18 A;  1P3P B;  3EPJ A;  4FD8 A;  2VGK A;  3AFA C;  5DNM C;  3AV1 A;  5BNX B;  3MGP A;  3G31 A;  1F66 A;  5FI2 A;  3IP4 C;  3UN7 A;  1W8Y A;  3VSL A;  5EUA A;  4M6B A;  5B0Y D;  2F8N G;  1Y54 A;  4R1G A;  5AY8 A;  3IXH A;  5B1M B;  1YLY A;  4WEL A;  3W97 B;  1L0E A;  1HQ3 A;  4NE5 A;  4CSR B;  5B1L A;  4DE1 A;  3MGR B;  4WMC A;  3X1U D;  5CP6 A;  5HAI A;  3G32 A;  3MKE A;  5HL1 A;  3X1V C;  3EQV A;  3N8L A;  4MBF A;  1WE4 A;  3LZ0 C;  4D2O A;  5M1A A;  4HES A;  4UUZ B;  3B0C W;  4DXB A;  3BFE A;  3S1Y A;  1YM1 A;  1VQQ A;  4PM6 A;  2Y2M A;  3VH5 A;  3VOY A;  4RYE A;  1U35 C;  1U60 A;  1RP5 A;  4UA6 A;  3O62 C;  2XK1 A;  5F1G A;  3M2J A;  3WKJ B;  4ZUX C;  3G2Y A;  5EEC A;  3MGS D;  3R45 A;  4IBB A;  5F99 A;  4A5R A;  1O7E A;  4HEF A;  2F8N D;  4XXR A;  5HAQ A;  4X69 A;  5B31 C;  5TFQ A;  4QY6 A;  5GL9 A;  1JTG A;  5CTN A;  1ERM A;  2WGV A;  2ZJ9 A;  4XUZ A;  4J8V A;  5CPJ D;  1P3I A;  3X1S B;  3UTA A;  5E2H A;  2Y2P A;  1KGE A;  2PU2 A;  1H8Y A;  3N4I A;  2QMI A;  3ZG8 B;  2FFY A;  4P0M A;  4EQI A;  4J8V D;  1PWC A;  2E8I A;  3G30 A;  3PBO A;  5FAS A;  1M40 A;  4U0X A;  2IWC A;  4H9Q B;  1K38 A;  3WKJ C;  1K25 A;  5GXQ D;  1U35 B;  1S32 B;  1K55 A;  5CHU A;  2FJ7 B;  3KWQ D;  3W98 C;  3DWK A;  4X68 A;  4RVA A;  4OLG A;  3C1C A;  3WRT A;  1P3L B;  1W2E A;  3KXB B;  1LL9 A;  3DWZ A;  1EQZ C;  3KXB D;  3FV7 A;  2JBF A;  3L29 A;  4S2P A;  3UPO A;  3D4F A;  3A3F A;  4RX2 A;  5B24 D;  2XGN A;  5FDH A;  4IBG A;  3VP4 A;  4NZ1 A;  4E3I A;  4OOY A;  2NQB D;  2ARO A;  2Y2J A;  2Z2L B;  2NQB B;  3O88 A;  4J8U C;  4ZJ1 A;  3BM6 A;  4H8R A;  3PAG A;  1K4F A;  1P3I D;  1MWR A;  4KGC B;  3X1V D;  4E3N A;  2IO5 B;  2WZZ A;  3HUN A;  5BO0 B;  1Q2P A;  5KSH A;  4WU9 D;  5AY8 B;  4C3Q A;  1LL5 A;  1P3B C;  3C1B D;  1DJA A;  4B88 A;  4NZ4 A;  1JTD A;  5CP6 B;  1ZG6 A;  4WU9 A;  5B2I D;  3UNW A;  5BT1 D;  2CV5 C;  2WK0 A;  1M19 A;  2WGW A;  4O7D A;  3OZH A;  3VH5 T;  4X23 A;  2G2W A;  4C6Y A;  5B32 G;  3AZK D;  2X02 A;  4N92 A;  2G5H C;  2EXA A;  3IF6 B;  4KZA A;  3AZG D;  3WAA B;  5AV9 B;  3FKW A;  4B4Z A;  4DRB A;  4QLC B;  2IWB A;  1DJC A;  3AZG B;  5TR7 A;  3LCE A;  3AV1 C;  1IYP A;  3BLM A;  3LEL A;  1P3G D;  1PZP A;  2HP6 A;  3HLD A;  3KUY B;  3QHY A;  1I2S A;  3X1S A;  3AV2 B;  4Z2M H;  3W98 A;  4OP5 A;  3AFA B;  4QJG A;  2Y2N A;  2PYO B;  4YFM A;  2Y55 A;  4E6W A;  3QNC A;  4M3K A;  4OJ6 A;  4DRT A;  1R4V A;  4OPR A;  5DTT A;  1FCO A;  1BLC A;  3PBT A;  3BYD A;  1BUE A;  3KXB C;  1NRF A;  4WU8 C;  2FJ7 A;  5HFO A;  5CP6 C;  3AZJ A;  3ZDJ A;  5B2I A;  5FA7 A;  1JFI B;  3WTP D;  3LZ1 D;  3MVD D;  2IOU A;  5GHY A;  3EG5 B;  5AQB A;  2F2A C;  3UE1 A;  1ID3 A;  1JWV A;  3AZH C;  2ZC6 B;  4CPK A;  3A3J A;  3LZ1 B;  5BO0 A;  2DRW A;  3AZK A;  2UWX A;  4KGC C;  1PI5 A;  3EPL A;  3EPK A;  1KX5 D;  3WS4 A;  5BOH A;  1ID3 D;  4UPK A;  4WU9 C;  5GHZ A;  4Z66 D;  1PW8 A;  4OH0 A;  2HIO B;  3L26 A;  3P5J B;  5DTK A;  2WZX A;  3AZI B;  3ZG0 A;  2BYK A;  3W96 B;  5CPI C;  3WRZ A;  5B40 B;  2Y91 A;  3FYZ A;  2BYM A;  5M19 A;  5CPJ C;  3A6N B;  2OV5 A;  1SKF A;  1TVF A;  1C3B A;  2NZD B;  3W4O A;  1VM1 A;  1XPB A;  2BG1 A;  1HQ3 D;  2ZY3 A;  3LEZ A;  3UTB D;  1P3O D;  1YU1 A;  4CAY A;  3W4Q A;  1HQ3 B;  1BT5 A;  4CSR A;  3WS1 A;  1ZLA A;  4G91 C;  3AZN D;  5FUG B;  3UO9 A;  3AZM A;  2PYO C;  4OJP A;  3Q1F A;  1FR6 A;  3REI B;  3W97 C;  4EWF A;  5AV9 A;  3AZI C;  1P3F C;  3AZE C;  5DNN D;  3VH6 W;  1BTL A;  4UHU A;  3AZM D;  5GSU C;  1DJB A;  3CZD A;  3KUY C;  3A1I A;  1I2W A;  5JYP A;  5AV6 D;  2DNS A;  4LV1 A;  3RXW A;  5F99 C;  4MBH A;  2FJ7 D;  5AV5 C;  5AV6 B;  2H5S A;  3AN2 D;  4BD0 A;  3MGS B;  4DDS A;  3LZ1 A;  5DNM D;  2Y2K A;  3N3F A;  1FR1 A;  1MXO A;  2Y2I A;  1H5X A;  5KMW A;  2J8Y A;  4KG2 A;  4GDN A;  4KHA A;  1P3M B;  2WAF A;  1YLJ A;  3V39 A;  4IBR A;  1BH8 B;  2JSS A;  5GXQ A;  4X6T A;  4Z66 A;  4MBK A;  4Y0U A;  1FQG A;  5B32 C;  4Z66 C;  5B2I C;  5B1M C;  3AZN A;  1P34 A;  1N1J B;  4KZ3 A;  1PZR A;  5B40 A;  1E25 A;  4LV2 A;  5GLC A;  4J8U B;  4YM6 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...