4IBCA

Ebola virus vp35 bound to small molecule
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
123
structure length
123
Chain Sequence
DISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polymerase cofactor VP35
publication title In Silico Derived Small Molecules Bind the Filovirus VP35 Protein and Inhibit Its Polymerase Cofactor Activity.
pubmed doi rcsb
source organism Ebola virus
molecule tags Transcription/transcription inhibitor
total genus 41
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ibcA01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4ibcA02
4IBIA 4IBJA 3L2AA 4IJFA 3L27A 3L26A 4IBFA 3KS4A 3L28A 3L25A 3FKEA 4IBEA 4IBKA 4IBGA 5BPVA 3L29A 4IJEA 4IBBA 4LG2A 4GHLA 4GH9A 4IBCA 4GHAA 3KS8A 4IBDA
chains in the Genus database with same CATH superfamily
4NRWA 3LVWA 4S12A 5FTJA 1HNXM 1VDLA 1VEJA 1ZMWA 1H8PA 1R6BX 4NSOB 3HZJA 3D8LA 3FTEA 1SG9A 2EJSA 1PJJA 1G3IA 3DOAA 2WSFF 4IBFA 2XF3A 4HEOA 1GPFA 1O6IA 1IXZA 1YU2A 2O5RA 2Y2OA 4FVMA 2ZAOA 2DAEA 2JZ0A 1XNRM 1XHBA 4DR6M 2RRUA 3RGSA 1GL7A 1GJTA 1CUKA 1PJTA 4G4OA 5FTNA 2FFFB 5KO3A 3SARA 1GABA 2AHMA 4IBCA 3FUTA 2Y2PA 4NXNM 4DV1M 3I04M 4HMCA 3U6SA 2G5GX 3HKPA 1G8PA 4OVZB 2FH0A 5EQTA 4OU7A 4I4LA 2QQ8A 1IY0A 1VDDA 1VEGA 2UXCM 1C1KA 2CUZA 4R3DA 1WGNA 3UJNA 3GLIA 3LCVB 3U6CA 1EFUB 1GKIA 2KRKA 5EP1A 4OJPA 2FNAA 1YU1A 1XWIA 5ITQA 2MR9A 2J5YA 7CATA 2EKFA 2FFJA 4JV5M 2D49A 2CHGA 1E6RA 1XMOM 3K9OA 3N3FA 1P3QQ 2HKJA 2LTUA 2R6FA 3GRRA 1KYIA 2EKKA 3ZCBB 1WXQA 1GOIA 1HQCA 4L6V6 1VEKA 4L16A 1R5LA 2KNVA 2ZTDA 4L4UA 3GLGA 4JI7M 4PT5A 4JI8M 2VQFM 3VDPA 2UU9M 1QZMA 3GO8A 1G71A 4LZJA 2R46A 2B3TA 2BWEA 4G3OA 3PVSA 4DV7M 2F5NA 2Z7JA 3U6EA 2Y2JA 1PJIA 2F5SA 4M9XA 5KPZA 2R0IA 3B9PA 4DBGB 3VKHA 4OUIA 1UFZA 3KVWA 2JCHA 4LGMA 5C1BA 4M9SA 3UZUA 5KPTA 2FE8A 1FJGM 4X62M 1LV7A 4A3VB 4JI5M 1DO2A 4B08A 3HJSA 4CGYB 2BJVA 2R4EA 3LVVA 3FTDA 2K0BX 3A42A 2DHYA 4RKUF 1RU3A 1IBKM 2Z4RA 2RKOA 3C9PA 3J2PB 4X64M 4LJ4A 5FTMA 3HWSA 2ZTCA 3ZQJA 3IG8A 1QUTA 1ZMVA 4AQYM 3TPZA 3KOWE 4PD2A 2DXIA 3GLIB 1NY5A 2XH9A 3WD3A 1G59A 2EUCA 5EXTA 3H4JA 3C58A 3KS8A 2H5XA 1S3SA 2R18A 2DHRA 2KXEA 1DO0A 2DAIA 3E9SA 4QHSA 4Y28F 1MN3A 3E46A 4TUWA 3WD1A 2L09A 4GIPA 1OIPA 3J80S 3ZH9B 2V5OA 3HSHA 3M7PA 3GLGB 2WSEF 1BVSA 5A2QS 2JUJA 1I4WA 4FCTA 1XNQM 1UR9A 1PDCA 3HGIA 1YE9A 3KS4A 3RGPA 4DV2M 4QNLA 2YNMD 3A46A 1JR3A 2KDLA 1G4AE 1MU5A 1E6PA 1VQ1A 2C98A 3UMMA 3HU1A 8CATA 4LJ6A 1OAOC 1TH4A 1TH2A 3GP1A 1TR8A 2MJ5B 3DZDA 3QWLA 2M60A 3FUXA 4Q7JA 2F5QA 1K3XA 3SATA 3WHKA 2XFTA 1NV8A 1T6OA 2VF8A 1E6ZA 4HMEA 5ITRA 1DV0A 1GVNA 4M9ZA 1NHGC 4PDIA 1HT2E 2L2DA 3GPXA 3TWKA 3VK8A 1GO5A 4JN6A 4BBAA 1MX0A 4JYAM 2Z8YM 3M7GA 2Q2EB 3B7ZA 1L2DA 3WD4A 3HHYA 4I8OA 4KO8A 3KDSE 5ITYA 4R71A 1IQPA 1YU0A 3GLIE 3RE8A 3JR4A 1QAMA 1WJ7A 4RF0A 2L7HA 4CIZA 2O01F 3FUUA 3GRYA 4IBKA 5GKNA 2Y2MA 2CP8A 3CF0A 3L29A 4D81A 2VF7A 4Z2JA 3AJIB 3HJ8A 3U6LA 2DZNB 1J5EM 4NY2A 4NYYA 1JQJC 3FE3A 5FTLA 2LBCA 3I01M 3GPUA 2VIIA 3MJ5A 3HX3A 2QNJA 3W0LB 2K9DA 4P17A 4DR2M 1N36M 1KFVA 4LF9M 2XEPA 1H0IA 3KW6A 1Q39A 2KRUA 1ZQ9A 1PJSA 2DWLA 4QOSA 2KHHA 1SXJA 3KXEC 1QZEA 1PM5A 2DI0A 3VFDA 2CFOA 4DUYM 1N78A 4MGYE 2E5LM 2QZ4A 5EP2A 3KOZE 2CWBA 4PDGA 2DWMA 2UUCM 1K3WA 2Y2LA 3J7AS 1JB0F 1W1YA 2DAMA 3CF6E 5KQ8A 1KSFX 2DAGA 1NJGA 3AOGA 3M6AA 4GEWA 3HU3A 1SXJC 3BXWA 4I5SA 4TX8A 1Z5AA 2FOIC 2L4EA 1J09A 4AI6A 1QYRA 3KSXA 4W5WA 3TWMA 4LFCM 2D7EA 4LF7M 4WP2A 1IN6A 1QAQA 4LCBA 3ZC7B 1CK7A 3VDUA 3CTWB 3E4RA 4LZZA 1NNJA 3SMPA 4NZ5A 2KZSA 1T43A 2H1RA 2XSZD 3QYBA 5EP3A 4Z2GA 3E21A 3AV0A 3W67A 2R65A 4KLNA 1PGYA 3SASA 3AOEA 3EIHA 1E88A 1HJPA 1JR3E 4FWHA 4EIWA 4BB9A 4IJEA 1TTEA 4LRTA 3C3EA 1UM8A 1PRBA 4LJ8A 3B7QA 4B3MM 1SXJB 1W1TA 2G8LA 2KNAA 1NJFA 4LJ5A 1WHCA 2V1CA 3KOXE 1TDZA 2LVAA 2XSZA 1L1ZA 1ED7A 1Z5BA 4Z2LA 1DGHA 5EXPA 1J7KA 2LHGA 4MB3A 2JXNA 3AOEC 4HL4A 3TQSA 3W68A 2HCBA 1AUAA 4MM3B 3R8FA 3HHZA 2JY6B 3SHGB 2OO9A 2JY5A 2DWZB 3I4YA 1TF0B 2EO2A 3LCUA 2GNOA 3KFUG 2ZAMA 4LJAA 3A98B 2DVWB 2FS1A 4ZPXA 3FTCA 4G4QA 1GJSA 5BR8M 4OJ5A 3K1JA 4IBGA 2L7IA 5H37D 3ILKA 2X4AA 1YLAA 3TE6A 2W82A 3KSJA 4FD2A 4XK8F 1E8BA 1XC8A 3FYDA 3HHXA 3LQQA 1AIWA 4GHAA 5DYIA 4DR4M 1JR3D 2DENA 3FD9A 3T6PA 1IY2A 4JI0M 1LTMA 4IBDA 4OJ6A 1YUBA 2LVOC 2CHVA 3FUWA 5F3WA 3GPYA 1IXSA 1Z6TA 4MB7A 4LFAM 2C5RA 1OFIA 1IFYA 1D0LA 3L27A 4B3SM 1EAKA 4F1IA 3PNYA 1SXJE 2C9CA 2K6BA 4I81A 4BLCA 1NV9A 3KP0E 1MJGM 2X49A 2JY8A 1NO1A 3BOSA 1DGHB 1Z5CA 5E6JA 1L6JA 4OJLA 1NSFA 4RF1A 1V33A 4DV5M 1EE8A 4IBBA 3SMSA 4CJ6A 3KOYE 2LVPC 4FWGA 2BG1A 4DV6M 4MGKE 1NY6A 4Z2IA 2RGHA 1R4GA 4B3TM 2Y2HA 3U6MA 4LJ9A 2RGOA 1NNUC 4XGIA 1R2ZA 1HR0M 2Y2NA 1QQWA 1HNZM 2JE5A 1QANA 3B74A 5E26A 1QAOA 2JA2A 1NVMA 3H4MA 3UK6A 5FSWA 5ITUA 4QNMA 2XLJA 2DAKA 2QHOB 2OQ4A 3FRHA 4X65M 1QO6A 4NRVA 2LWXA 4FW9A 5FLXS 3LW5F 3PNVA 2OPFA 3SAVA 4Z6YA 4G6ZA 1L2BA 3HONA 1DGFA 3J27B 3K8ZA 1GL6A 4LY6A 2CRUA 1SXJD 2XGNA 3GLFE 2VQEM 2F5PA 1IXSB 4AKGA 2C96A 1QDTA 2BWBA 4PCZA 1N77A 4GRIA 4HMDA 2R45A 4JXJA 3GLHA 1EIJA 2HAKA 2R62A 1YU4A 2Y2QA 2JZ1A 2Z3XA 2CEAA 4MGIE 2ZBKB 4NZ3A 2QENA 2V6ZM 3D8BA 1YUEA 2V1UA 4MGHA 3U60A 1V92A 4ITQA 2DZLA 1D2NA 4AW4A 4HLQA 3R9XB 2IOUA 3JAMS 1ZMUA 2M5ZA 4REZA 3B89A 4M0DA 2G3QA 4GC9A 1OGGA 4LF6M 5JI2E 1QDRA 4JI4M 2BJWA 3U6QA 1W5SA 3V76A 3THGA 4X66M 3WD2A 3FKEA 4XBOA 1Y8GA 1G41A 2A5YB 3U6PA 3NBIA 3K2LA 3U6DA 4WURA 1IBMM 4MB4A 3SAUA 2JP7A 3C3DA 4P16A 4LJ7A 1UR8A 1R2YA 1C7YA 4LG2A 3Q8GA 1NHWC 3CGWA 1L2CA 1TGUA 2Y2GA 1E6NA 4DR3M 3AFHA 4F2LA 4GKKM 3NBXX 2KNZA 1W1VA 4KT0F 2LXEA 4FWDA 1H0GA 4JI3M 3GPPA 4AKIA 5IZ7D 1X37A 4DR7M 1OTRA 1IN7A 4IBJA 3GRVA 1D0KA 4KODA 2Y0QA 3I51A 4D82A 2QSFX 1K82A 3L26A 4LRSA 3GLHB 3RFWA 3OTOM 2ERCA 1Q3CA 5FTKA 4LF4M 4GKJM 3L25A 5LMUM 1E15A 3WX7A 3U60B 1OAIA 4LFBM 2LH0A 3FRIA 5DYGA 3GLFA 4GMQA 2KZUA 2D7GA 1YSYA 2Y0TA 3SYKA 4JI2M 1ZAEA 1XXHE 4LGYA 3T1YM 4DR1M 2MGWA 1VG5A 4JI1M 2K47A 1T3TA 4LF8M 5DFLA 5KPRA 4AG6A 3MMPA 3K9PA 3Q8XA 4NZ4A 1J7MA 1XB2B 2R4JA 2N35A 4IBIA 2ZM6M 2QBYA 3W0FA 4AG5A 3DA1A 3L2AA 5L8RF 1OQYA 1WGLA 5ITTA 2F5OA 3SYLA 1ZV1A 4YY3M 2QP9X 4UN2B 3VLFB 1HT1E 2O25A 2GQFA 2UWXA 4NYUA 1AIPC 3GRUA 1A5TA 3T1HM 1TDHA 4NSRA 1N75A 2VDBB 1L1TA 4GC5A 3LQRA 2Y21A 4KHPM 4NXMM 4DV3M 3M0EA 4GHLA 4II7A 3TL4X 1FNNA 4GITA 3J7BA 3TWLA 1OFHA 4B7HA 1W1PA 1N33M 4OJOA 3IG5A 3GQ4A 3HU2A 4MGZE 3AL0C 4QOZC 5ITXE 1W5TA 5KQDA 3GLHE 1Q02A 2UUAM 1E9RA 3VK7A 3KP1E 1GLNA 3T15A 2LVQD 2L6OA 3GLFB 4QNRA 2APLA 4JI6M 2KA6B 2DZOB 2Y2KA 3LMMA 4ANRA 5LMNM 4IJFA 4NOOB 1WR1B 4IIWA 3PFIA 1E32A 1TH3A 3DFZA 3L28A 4B7GA 5JI3E 4B3RM 2OOBA 1V34A 5EXXA 4YHHM 1KS0A 2YFQA 3BBZA 4DUZM 2P5TA 2DKLA 2KW0A 2WSCF 2XFSA 2YR0A 4CHTB 1XMQM 1OKSA 4RNAA 3U5ZA 1N34M 1IN8A 1XXHA 3SAWA 2QBYB 2UXDM 1IBLM 3MQLA 5IREB 3JR5A 4GH9A 2DWNA 2LVNC 3T38A 2WZJA 3U61A 2MROB 2YQZA 2LHCA 3NWLA 2Z4SA 4FCVA 3SFZA 2CV1A 1GXDA 4NZ1A 1QVRA 3GQ5A 2I7NA 3MHVC 5EP4A 3J81S 4K0KM 3VKGA 1DGGA 4Z2KA 1I94M 1CXWA 4MB5A 2XZUA 4M0WA 2HL7A 3FYCA 2X8AA 3F92A 3A45A 1R7RA 2C9OA 3U6OA 4WW0A 1HNWM 1OJLA 1PJQA 4DV0M 5IT9S 2HWJA 4IBEA 2XZFA 4L15A 1F4IA 3WD0A 1DGBA 1IXRC 2XD1A 2JNHA 4L8RC 3MK6A 4OW0A 1H6UA 2C99A 2XD5A 2ZANA 2CV0A 2KEBA 2Y20A 4QHTA 3CF2A 2R44A 3SHFA 3WHLA 1IM2A 5IWAM 4CISA 4Z8XA 1E9SA 2CE7A 1Q3BA 2JWSA 4NL4H 5ITXA 3FTFA 3K92A 3QAUA 4L78A 2CHQA 2FN2A 2RTSA 5EJCA 5DNYA 1D0MA 2JY7A 4OX9M 4NC6A 4Z2HA 3AKZA 1N32M 1OIZA 4G4NA 3U5ZB 1Z59A 1ORYB 1XXHB 2UXBM 3FUVA 2L4FA 5C18A 1YU3A 1WIVA 3U61B 2LNHC 2BNKA 2J7NA 2OOAA 3HHWA 3SC3A 4AKHA 2Y2IA 1IN5A 2MH8A 2J7OA 4OVZA 4D80A 5EXSA 4B7FA 3HY5A 4R7GA 5BPVA 2F4VM 2UUBM 2NQ8C 1HQYE 2DNAA 3GLGE 4G4RA 3B7NA 3IECA 4DR5M 2I7PA 2D7HA 4MH0E 1E94E 2QCUA 4DV4M 1IY1A 2HHHM 2CV2A 3QYEA 1OGBA 3UGJA 4FCWA 3GQ3A 1IN4A 3EIEA 1L8QA 3I4VA 3SBJA 4AZFA 4LF5M 3HJQA 2EA0A 1QUSA 3PXGA 2QPAA 3IHPA
chains in the Genus database with same CATH topology
4NRWA 3LVWA 4S12A 5FTJA 1HNXM 1R6BX 4NSOB 3D8LA 3FTEA 1PJJA 1G3IA 3DOAA 4IBFA 1YU2A 2XF3A 2Y2OA 1IXZA 2O5RA 4FVMA 2ZAOA 1XNRM 1XHBA 4DR6M 3RGSA 1GL7A 4G4OA 5FTNA 2FFFB 5KO3A 3SARA 2AHMA 4IBCA 3FUTA 2Y2PA 4NXNM 4DV1M 3U6SA 2G5GX 3HKPA 1G8PA 4OVZB 5EQTA 4OU7A 4I4LA 1IY0A 1VDDA 2UXCM 1C1KA 2CUZA 4R3DA 3UJNA 3GLIA 3U6CA 1GKIA 2KRKA 5EP1A 4OJPA 2FNAA 1YU1A 1XWIA 5ITQA 4JV5M 7CATA 2FFJA 2CHGA 1XMOM 3N3FA 2HKJA 3GRRA 1KYIA 3ZCBB 1WXQA 1HQCA 3GLGA 4L16A 4L4UA 4JI7M 4JI8M 4PT5A 2VQFM 3VDPA 2UU9M 1QZMA 3GO8A 4LZJA 2R46A 2F5NA 3PVSA 4DV7M 2Z7JA 3U6EA 2Y2JA 1PJIA 2F5SA 4M9XA 5KPZA 3VKHA 3B9PA 4OUIA 3KVWA 2JCHA 4LGMA 5C1BA 4M9SA 3UZUA 5KPTA 2FE8A 1FJGM 4X62M 1LV7A 4A3VB 4JI5M 1DO2A 4B08A 3HJSA 4CGYB 2BJVA 2R4EA 3LVVA 3FTDA 3A42A 1IBKM 2Z4RA 2RKOA 3J2PB 4X64M 4LJ4A 5FTMA 3HWSA 4AQYM 3IG8A 3TPZA 3KOWE 4PD2A 2DXIA 3GLIB 1NY5A 2XH9A 1G59A 2EUCA 5EXTA 3C58A 3KS8A 1S3SA 2R18A 2DHRA 2KXEA 1DO0A 3E9SA 4QHSA 4TUWA 2L09A 4GIPA 3J80S 3ZH9B 3HSHA 3GLGB 5A2QS 1I4WA 4FCTA 1XNQM 3HGIA 3KS4A 1YE9A 3RGPA 4DV2M 4QNLA 2YNMD 3A46A 1JR3A 1G4AE 1MU5A 2C98A 3UMMA 3HU1A 8CATA 4LJ6A 1TH4A 1TH2A 3GP1A 3DZDA 3QWLA 2M60A 3FUXA 2F5QA 3SATA 1K3XA 3WHKA 2XFTA 5ITRA 1GVNA 4M9ZA 1NHGC 4PDIA 1HT2E 3GPXA 3TWKA 3VK8A 4JN6A 4BBAA 1MX0A 4JYAM 3M7GA 2Q2EB 1L2DA 3HHYA 4I8OA 4KO8A 3KDSE 5ITYA 1IQPA 1YU0A 3RE8A 3JR4A 1QAMA 4RF0A 2L7HA 3FUUA 3GRYA 4IBKA 5GKNA 2Y2MA 3CF0A 3L29A 4D81A 3AJIB 3HJ8A 3U6LA 2DZNB 1J5EM 4NY2A 4NYYA 1JQJC 5FTLA 3GPUA 2VIIA 3MJ5A 3W0LB 4LF9M 4DR2M 1N36M 1KFVA 2XEPA 3KW6A 1Q39A 1ZQ9A 2KRUA 2DWLA 4QOSA 1SXJA 3KXEC 1PM5A 3VFDA 4DUYM 2CFOA 1N78A 4MGYE 2E5LM 2QZ4A 5EP2A 3KOZE 4PDGA 2DWMA 2UUCM 1K3WA 2Y2LA 3J7AS 3CF6E 5KQ8A 1KSFX 1NJGA 3AOGA 3M6AA 3HU3A 1SXJC 4I5SA 1Z5AA 2FOIC 1J09A 4AI6A 1QYRA 3KSXA 4W5WA 3TWMA 4LFCM 2D7EA 4LF7M 1IN6A 1QAQA 4LCBA 3ZC7B 3VDUA 3CTWB 3E4RA 4LZZA 1NNJA 3SMPA 4NZ5A 2KZSA 2H1RA 2XSZD 5EP3A 3AV0A 2R65A 4KLNA 3SASA 3AOEA 3EIHA 4EIWA 4FWHA 4BB9A 4IJEA 4LRTA 1UM8A 4LJ8A 4B3MM 1SXJB 2G8LA 1NJFA 4LJ5A 3KOXE 2V1CA 1TDZA 2XSZA 1L1ZA 1Z5BA 1DGHA 5EXPA 1J7KA 3AOEC 4HL4A 3TQSA 2HCBA 4MM3B 3R8FA 3HHZA 3SHGB 3I4YA 2DWZB 2EO2A 3KFUG 2ZAMA 4LJAA 3A98B 2DVWB 4ZPXA 3FTCA 4G4QA 5BR8M 4OJ5A 3K1JA 4IBGA 2L7IA 5H37D 3ILKA 2X4AA 3TE6A 2W82A 3KSJA 4FD2A 1XC8A 3FYDA 3HHXA 3LQQA 4GHAA 5DYIA 4DR4M 1JR3D 3FD9A 1IY2A 4JI0M 4IBDA 4OJ6A 1YUBA 2CHVA 3FUWA 5F3WA 3GPYA 1Z6TA 4MB7A 2C5RA 4LFAM 1OFIA 3L27A 4B3SM 3PNYA 1SXJE 2C9CA 4I81A 4BLCA 3KP0E 2X49A 3BOSA 1DGHB 1Z5CA 5E6JA 4OJLA 1NSFA 4RF1A 4DV5M 1EE8A 4IBBA 3SMSA 3KOYE 4FWGA 2BG1A 4DV6M 4MGKE 1NY6A 2RGHA 4B3TM 2Y2HA 3U6MA 4LJ9A 2RGOA 1NNUC 4XGIA 1R2ZA 1HR0M 2Y2NA 1QQWA 1HNZM 2JE5A 1QANA 5E26A 1QAOA 2JA2A 1NVMA 3H4MA 3UK6A 5FSWA 5ITUA 4QNMA 2XLJA 3SBJA 2OQ4A 4X65M 4NRVA 2LWXA 4FW9A 5FLXS 3PNVA 2OPFA 3SAVA 4Z6YA 4G6ZA 1L2BA 3HONA 1DGFA 3J27B 3K8ZA 1GL6A 4LY6A 1SXJD 2XGNA 2VQEM 2F5PA 1IXSB 4AKGA 2C96A 1N77A 4PCZA 4GRIA 2R45A 4JXJA 3GLHA 1YU4A 2R62A 2Y2QA 2Z3XA 2CEAA 4MGIE 2ZBKB 4NZ3A 2QENA 2V6ZM 3D8BA 1YUEA 2V1UA 4MGHA 3U60A 4ITQA 1D2NA 4AW4A 4HLQA 3R9XB 2IOUA 3JAMS 2M5ZA 4REZA 4M0DA 4GC9A 4LF6M 5JI2E 4JI4M 2BJWA 3U6QA 1W5SA 3THGA 4X66M 3FKEA 4XBOA 1G41A 2A5YB 3U6PA 3NBIA 3K2LA 3U6DA 4WURA 1IBMM 3SAUA 4P16A 4LJ7A 1R2YA 4LG2A 1NHWC 1L2CA 1TGUA 2Y2GA 4DR3M 3AFHA 4GKKM 2LXEA 4FWDA 4JI3M 3GPPA 4AKIA 5IZ7D 1X37A 4DR7M 1IN7A 4IBJA 3GRVA 4KODA 2Y0QA 3I51A 4D82A 1K82A 3L26A 4LRSA 3GLHB 3RFWA 3OTOM 2ERCA 1Q3CA 5FTKA 4LF4M 4GKJM 3L25A 5LMUM 3WX7A 3U60B 4LFBM 2LH0A 5DYGA 3GLFA 4GMQA 2KZUA 2D7GA 1YSYA 2Y0TA 3SYKA 4JI2M 1ZAEA 4LGYA 3T1YM 4DR1M 4JI1M 2K47A 1T3TA 4LF8M 5KPRA 4AG6A 3Q8XA 4NZ4A 2R4JA 4IBIA 2ZM6M 2QBYA 3W0FA 4AG5A 3DA1A 3L2AA 5ITTA 2F5OA 3SYLA 4YY3M 2QP9X 3VLFB 1HT1E 2UWXA 4NYUA 3GRUA 3T1HM 1TDHA 4NSRA 1N75A 1L1TA 4GC5A 3LQRA 2Y21A 4KHPM 4NXMM 4DV3M 3M0EA 4GHLA 4II7A 3TL4X 1FNNA 4GITA 3J7BA 3TWLA 1OFHA 4B7HA 4OJOA 1N33M 3IG5A 3GQ4A 3HU2A 4MGZE 3AL0C 4QOZC 5ITXE 1W5TA 5KQDA 2UUAM 1E9RA 3VK7A 3KP1E 1GLNA 3T15A 2L6OA 3GLFB 4QNRA 4JI6M 2KA6B 2DZOB 2Y2KA 3LMMA 5LMNM 4IJFA 4NOOB 4IIWA 3PFIA 1E32A 1TH3A 3DFZA 3L28A 4B7GA 5JI3E 4B3RM 4YHHM 5EXXA 2YFQA 4DUZM 2P5TA 2KW0A 2XFSA 2YR0A 4CHTB 1XMQM 3U5ZA 4RNAA 2UXDM 1N34M 1IN8A 1XXHA 3SAWA 2QBYB 1IBLM 5IREB 3JR5A 4GH9A 2DWNA 3T38A 3U61A 2YQZA 3NWLA 4FCVA 2CV1A 2Z4SA 3SFZA 4NZ1A 1QVRA 3GQ5A 2I7NA 3MHVC 5EP4A 3J81S 4K0KM 3VKGA 1DGGA 1I94M 2XZUA 4M0WA 2HL7A 3FYCA 2X8AA 3A45A 1R7RA 2C9OA 3U6OA 4WW0A 1HNWM 1OJLA 5IT9S 4DV0M 4IBEA 2XZFA 4L15A 1DGBA 1IXRC 2XD1A 4L8RC 3MK6A 4OW0A 1H6UA 2C99A 2XD5A 2ZANA 2CV0A 2KEBA 2Y20A 4QHTA 3CF2A 3SHFA 3WHLA 5IWAM 1IM2A 4CISA 4Z8XA 1E9SA 2CE7A 1Q3BA 4NL4H 3FTFA 5ITXA 3K92A 3QAUA 4L78A 2CHQA 5EJCA 5DNYA 4OX9M 3AKZA 1N32M 4G4NA 3U5ZB 1Z59A 1ORYB 1XXHB 2UXBM 3FUVA 5C18A 1YU3A 3U61B 2LNHC 2BNKA 2J7NA 3HHWA 3SC3A 4AKHA 2Y2IA 1IN5A 4D80A 2J7OA 4OVZA 5EXSA 4B7FA 4R7GA 5BPVA 2F4VM 2UUBM 2NQ8C 1HQYE 4G4RA 4DR5M 2I7PA 2D7HA 4MH0E 1E94E 2QCUA 4DV4M 1IY1A 2HHHM 2CV2A 3UGJA 4FCWA 3GQ3A 1IN4A 3EIEA 1L8QA 3I4VA 4LF5M 4AZFA 3HJQA 2EA0A 3PXGA 2QPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IBI A;  4IBJ A;  3L2A A;  4IJF A;  3L27 A;  3L26 A;  4IBF A;  3KS4 A;  3L28 A;  3L25 A;  3FKE A;  4IBE A;  4IBK A;  4IBG A;  5BPV A;  3L29 A;  4IJE A;  4IBB A;  4LG2 A;  4GHL A;  4GH9 A;  4IBC A;  4GHA A;  3KS8 A;  4IBD A; 
#chains in the Genus database with same CATH topology
 4NRW A;  3LVW A;  4S12 A;  5FTJ A;  1HNX M;  1VDL A;  1VEJ A;  1ZMW A;  1H8P A;  1R6B X;  4NSO B;  3HZJ A;  3D8L A;  3FTE A;  1SG9 A;  2EJS A;  1PJJ A;  1G3I A;  3DOA A;  2WSF F;  4IBF A;  2XF3 A;  4HEO A;  1GPF A;  1O6I A;  1IXZ A;  1YU2 A;  2O5R A;  2Y2O A;  4FVM A;  2ZAO A;  2DAE A;  2JZ0 A;  1XNR M;  1XHB A;  4DR6 M;  2RRU A;  3RGS A;  1GL7 A;  1GJT A;  1CUK A;  1PJT A;  4G4O A;  5FTN A;  2FFF B;  5KO3 A;  3SAR A;  1GAB A;  2AHM A;  4IBC A;  3FUT A;  2Y2P A;  4NXN M;  4DV1 M;  3I04 M;  4HMC A;  3U6S A;  2G5G X;  3HKP A;  1G8P A;  4OVZ B;  2FH0 A;  5EQT A;  4OU7 A;  4I4L A;  2QQ8 A;  1IY0 A;  1VDD A;  1VEG A;  2UXC M;  1C1K A;  2CUZ A;  4R3D A;  1WGN A;  3UJN A;  3GLI A;  3LCV B;  3U6C A;  1EFU B;  1GKI A;  2KRK A;  5EP1 A;  4OJP A;  2FNA A;  1YU1 A;  1XWI A;  5ITQ A;  2MR9 A;  2J5Y A;  7CAT A;  2EKF A;  2FFJ A;  4JV5 M;  2D49 A;  2CHG A;  1E6R A;  1XMO M;  3K9O A;  3N3F A;  1P3Q Q;  2HKJ A;  2LTU A;  2R6F A;  3GRR A;  1KYI A;  2EKK A;  3ZCB B;  1WXQ A;  1GOI A;  1HQC A;  4L6V 6;  1VEK A;  4L16 A;  1R5L A;  2KNV A;  2ZTD A;  4L4U A;  3GLG A;  4JI7 M;  4PT5 A;  4JI8 M;  2VQF M;  3VDP A;  2UU9 M;  1QZM A;  3GO8 A;  1G71 A;  4LZJ A;  2R46 A;  2B3T A;  2BWE A;  4G3O A;  3PVS A;  4DV7 M;  2F5N A;  2Z7J A;  3U6E A;  2Y2J A;  1PJI A;  2F5S A;  4M9X A;  5KPZ A;  2R0I A;  3B9P A;  4DBG B;  3VKH A;  4OUI A;  1UFZ A;  3KVW A;  2JCH A;  4LGM A;  5C1B A;  4M9S A;  3UZU A;  5KPT A;  2FE8 A;  1FJG M;  4X62 M;  1LV7 A;  4A3V B;  4JI5 M;  1DO2 A;  4B08 A;  3HJS A;  4CGY B;  2BJV A;  2R4E A;  3LVV A;  3FTD A;  2K0B X;  3A42 A;  2DHY A;  4RKU F;  1RU3 A;  1IBK M;  2Z4R A;  2RKO A;  3C9P A;  3J2P B;  4X64 M;  4LJ4 A;  5FTM A;  3HWS A;  2ZTC A;  3ZQJ A;  3IG8 A;  1QUT A;  1ZMV A;  4AQY M;  3TPZ A;  3KOW E;  4PD2 A;  2DXI A;  3GLI B;  1NY5 A;  2XH9 A;  3WD3 A;  1G59 A;  2EUC A;  5EXT A;  3H4J A;  3C58 A;  3KS8 A;  2H5X A;  1S3S A;  2R18 A;  2DHR A;  2KXE A;  1DO0 A;  2DAI A;  3E9S A;  4QHS A;  4Y28 F;  1MN3 A;  3E46 A;  4TUW A;  3WD1 A;  2L09 A;  4GIP A;  1OIP A;  3J80 S;  3ZH9 B;  2V5O A;  3HSH A;  3M7P A;  3GLG B;  2WSE F;  1BVS A;  5A2Q S;  2JUJ A;  1I4W A;  4FCT A;  1XNQ M;  1UR9 A;  1PDC A;  3HGI A;  1YE9 A;  3KS4 A;  3RGP A;  4DV2 M;  4QNL A;  2YNM D;  3A46 A;  1JR3 A;  2KDL A;  1G4A E;  1MU5 A;  1E6P A;  1VQ1 A;  2C98 A;  3UMM A;  3HU1 A;  8CAT A;  4LJ6 A;  1OAO C;  1TH4 A;  1TH2 A;  3GP1 A;  1TR8 A;  2MJ5 B;  3DZD A;  3QWL A;  2M60 A;  3FUX A;  4Q7J A;  2F5Q A;  1K3X A;  3SAT A;  3WHK A;  2XFT A;  1NV8 A;  1T6O A;  2VF8 A;  1E6Z A;  4HME A;  5ITR A;  1DV0 A;  1GVN A;  4M9Z A;  1NHG C;  4PDI A;  1HT2 E;  2L2D A;  3GPX A;  3TWK A;  3VK8 A;  1GO5 A;  4JN6 A;  4BBA A;  1MX0 A;  4JYA M;  2Z8Y M;  3M7G A;  2Q2E B;  3B7Z A;  1L2D A;  3WD4 A;  3HHY A;  4I8O A;  4KO8 A;  3KDS E;  5ITY A;  4R71 A;  1IQP A;  1YU0 A;  3GLI E;  3RE8 A;  3JR4 A;  1QAM A;  1WJ7 A;  4RF0 A;  2L7H A;  4CIZ A;  2O01 F;  3FUU A;  3GRY A;  4IBK A;  5GKN A;  2Y2M A;  2CP8 A;  3CF0 A;  3L29 A;  4D81 A;  2VF7 A;  4Z2J A;  3AJI B;  3HJ8 A;  3U6L A;  2DZN B;  1J5E M;  4NY2 A;  4NYY A;  1JQJ C;  3FE3 A;  5FTL A;  2LBC A;  3I01 M;  3GPU A;  2VII A;  3MJ5 A;  3HX3 A;  2QNJ A;  3W0L B;  2K9D A;  4P17 A;  4DR2 M;  1N36 M;  1KFV A;  4LF9 M;  2XEP A;  1H0I A;  3KW6 A;  1Q39 A;  2KRU A;  1ZQ9 A;  1PJS A;  2DWL A;  4QOS A;  2KHH A;  1SXJ A;  3KXE C;  1QZE A;  1PM5 A;  2DI0 A;  3VFD A;  2CFO A;  4DUY M;  1N78 A;  4MGY E;  2E5L M;  2QZ4 A;  5EP2 A;  3KOZ E;  2CWB A;  4PDG A;  2DWM A;  2UUC M;  1K3W A;  2Y2L A;  3J7A S;  1JB0 F;  1W1Y A;  2DAM A;  3CF6 E;  5KQ8 A;  1KSF X;  2DAG A;  1NJG A;  3AOG A;  3M6A A;  4GEW A;  3HU3 A;  1SXJ C;  3BXW A;  4I5S A;  4TX8 A;  1Z5A A;  2FOI C;  2L4E A;  1J09 A;  4AI6 A;  1QYR A;  3KSX A;  4W5W A;  3TWM A;  4LFC M;  2D7E A;  4LF7 M;  4WP2 A;  1IN6 A;  1QAQ A;  4LCB A;  3ZC7 B;  1CK7 A;  3VDU A;  3CTW B;  3E4R A;  4LZZ A;  1NNJ A;  3SMP A;  4NZ5 A;  2KZS A;  1T43 A;  2H1R A;  2XSZ D;  3QYB A;  5EP3 A;  4Z2G A;  3E21 A;  3AV0 A;  3W67 A;  2R65 A;  4KLN A;  1PGY A;  3SAS A;  3AOE A;  3EIH A;  1E88 A;  1HJP A;  1JR3 E;  4FWH A;  4EIW A;  4BB9 A;  4IJE A;  1TTE A;  4LRT A;  3C3E A;  1UM8 A;  1PRB A;  4LJ8 A;  3B7Q A;  4B3M M;  1SXJ B;  1W1T A;  2G8L A;  2KNA A;  1NJF A;  4LJ5 A;  1WHC A;  2V1C A;  3KOX E;  1TDZ A;  2LVA A;  2XSZ A;  1L1Z A;  1ED7 A;  1Z5B A;  4Z2L A;  1DGH A;  5EXP A;  1J7K A;  2LHG A;  4MB3 A;  2JXN A;  3AOE C;  4HL4 A;  3TQS A;  3W68 A;  2HCB A;  1AUA A;  4MM3 B;  3R8F A;  3HHZ A;  2JY6 B;  3SHG B;  2OO9 A;  2JY5 A;  2DWZ B;  3I4Y A;  1TF0 B;  2EO2 A;  3LCU A;  2GNO A;  3KFU G;  2ZAM A;  4LJA A;  3A98 B;  2DVW B;  2FS1 A;  4ZPX A;  3FTC A;  4G4Q A;  1GJS A;  5BR8 M;  4OJ5 A;  3K1J A;  4IBG A;  2L7I A;  5H37 D;  3ILK A;  2X4A A;  1YLA A;  3TE6 A;  2W82 A;  3KSJ A;  4FD2 A;  4XK8 F;  1E8B A;  1XC8 A;  3FYD A;  3HHX A;  3LQQ A;  1AIW A;  4GHA A;  5DYI A;  4DR4 M;  1JR3 D;  2DEN A;  3FD9 A;  3T6P A;  1IY2 A;  4JI0 M;  1LTM A;  4IBD A;  4OJ6 A;  1YUB A;  2LVO C;  2CHV A;  3FUW A;  5F3W A;  3GPY A;  1IXS A;  1Z6T A;  4MB7 A;  4LFA M;  2C5R A;  1OFI A;  1IFY A;  1D0L A;  3L27 A;  4B3S M;  1EAK A;  4F1I A;  3PNY A;  1SXJ E;  2C9C A;  2K6B A;  4I81 A;  4BLC A;  1NV9 A;  3KP0 E;  1MJG M;  2X49 A;  2JY8 A;  1NO1 A;  3BOS A;  1DGH B;  1Z5C A;  5E6J A;  1L6J A;  4OJL A;  1NSF A;  4RF1 A;  1V33 A;  4DV5 M;  1EE8 A;  4IBB A;  3SMS A;  4CJ6 A;  3KOY E;  2LVP C;  4FWG A;  2BG1 A;  4DV6 M;  4MGK E;  1NY6 A;  4Z2I A;  2RGH A;  1R4G A;  4B3T M;  2Y2H A;  3U6M A;  4LJ9 A;  2RGO A;  1NNU C;  4XGI A;  1R2Z A;  1HR0 M;  2Y2N A;  1QQW A;  1HNZ M;  2JE5 A;  1QAN A;  3B74 A;  5E26 A;  1QAO A;  2JA2 A;  1NVM A;  3H4M A;  3UK6 A;  5FSW A;  5ITU A;  4QNM A;  2XLJ A;  2DAK A;  2QHO B;  2OQ4 A;  3FRH A;  4X65 M;  1QO6 A;  4NRV A;  2LWX A;  4FW9 A;  5FLX S;  3LW5 F;  3PNV A;  2OPF A;  3SAV A;  4Z6Y A;  4G6Z A;  1L2B A;  3HON A;  1DGF A;  3J27 B;  3K8Z A;  1GL6 A;  4LY6 A;  2CRU A;  1SXJ D;  2XGN A;  3GLF E;  2VQE M;  2F5P A;  1IXS B;  4AKG A;  2C96 A;  1QDT A;  2BWB A;  4PCZ A;  1N77 A;  4GRI A;  4HMD A;  2R45 A;  4JXJ A;  3GLH A;  1EIJ A;  2HAK A;  2R62 A;  1YU4 A;  2Y2Q A;  2JZ1 A;  2Z3X A;  2CEA A;  4MGI E;  2ZBK B;  4NZ3 A;  2QEN A;  2V6Z M;  3D8B A;  1YUE A;  2V1U A;  4MGH A;  3U60 A;  1V92 A;  4ITQ A;  2DZL A;  1D2N A;  4AW4 A;  4HLQ A;  3R9X B;  2IOU A;  3JAM S;  1ZMU A;  2M5Z A;  4REZ A;  3B89 A;  4M0D A;  2G3Q A;  4GC9 A;  1OGG A;  4LF6 M;  5JI2 E;  1QDR A;  4JI4 M;  2BJW A;  3U6Q A;  1W5S A;  3V76 A;  3THG A;  4X66 M;  3WD2 A;  3FKE A;  4XBO A;  1Y8G A;  1G41 A;  2A5Y B;  3U6P A;  3NBI A;  3K2L A;  3U6D A;  4WUR A;  1IBM M;  4MB4 A;  3SAU A;  2JP7 A;  3C3D A;  4P16 A;  4LJ7 A;  1UR8 A;  1R2Y A;  1C7Y A;  4LG2 A;  3Q8G A;  1NHW C;  3CGW A;  1L2C A;  1TGU A;  2Y2G A;  1E6N A;  4DR3 M;  3AFH A;  4F2L A;  4GKK M;  3NBX X;  2KNZ A;  1W1V A;  4KT0 F;  2LXE A;  4FWD A;  1H0G A;  4JI3 M;  3GPP A;  4AKI A;  5IZ7 D;  1X37 A;  4DR7 M;  1OTR A;  1IN7 A;  4IBJ A;  3GRV A;  1D0K A;  4KOD A;  2Y0Q A;  3I51 A;  4D82 A;  2QSF X;  1K82 A;  3L26 A;  4LRS A;  3GLH B;  3RFW A;  3OTO M;  2ERC A;  1Q3C A;  5FTK A;  4LF4 M;  4GKJ M;  3L25 A;  5LMU M;  1E15 A;  3WX7 A;  3U60 B;  1OAI A;  4LFB M;  2LH0 A;  3FRI A;  5DYG A;  3GLF A;  4GMQ A;  2KZU A;  2D7G A;  1YSY A;  2Y0T A;  3SYK A;  4JI2 M;  1ZAE A;  1XXH E;  4LGY A;  3T1Y M;  4DR1 M;  2MGW A;  1VG5 A;  4JI1 M;  2K47 A;  1T3T A;  4LF8 M;  5DFL A;  5KPR A;  4AG6 A;  3MMP A;  3K9P A;  3Q8X A;  4NZ4 A;  1J7M A;  1XB2 B;  2R4J A;  2N35 A;  4IBI A;  2ZM6 M;  2QBY A;  3W0F A;  4AG5 A;  3DA1 A;  3L2A A;  5L8R F;  1OQY A;  1WGL A;  5ITT A;  2F5O A;  3SYL A;  1ZV1 A;  4YY3 M;  2QP9 X;  4UN2 B;  3VLF B;  1HT1 E;  2O25 A;  2GQF A;  2UWX A;  4NYU A;  1AIP C;  3GRU A;  1A5T A;  3T1H M;  1TDH A;  4NSR A;  1N75 A;  2VDB B;  1L1T A;  4GC5 A;  3LQR A;  2Y21 A;  4KHP M;  4NXM M;  4DV3 M;  3M0E A;  4GHL A;  4II7 A;  3TL4 X;  1FNN A;  4GIT A;  3J7B A;  3TWL A;  1OFH A;  4B7H A;  1W1P A;  1N33 M;  4OJO A;  3IG5 A;  3GQ4 A;  3HU2 A;  4MGZ E;  3AL0 C;  4QOZ C;  5ITX E;  1W5T A;  5KQD A;  3GLH E;  1Q02 A;  2UUA M;  1E9R A;  3VK7 A;  3KP1 E;  1GLN A;  3T15 A;  2LVQ D;  2L6O A;  3GLF B;  4QNR A;  2APL A;  4JI6 M;  2KA6 B;  2DZO B;  2Y2K A;  3LMM A;  4ANR A;  5LMN M;  4IJF A;  4NOO B;  1WR1 B;  4IIW A;  3PFI A;  1E32 A;  1TH3 A;  3DFZ A;  3L28 A;  4B7G A;  5JI3 E;  4B3R M;  2OOB A;  1V34 A;  5EXX A;  4YHH M;  1KS0 A;  2YFQ A;  3BBZ A;  4DUZ M;  2P5T A;  2DKL A;  2KW0 A;  2WSC F;  2XFS A;  2YR0 A;  4CHT B;  1XMQ M;  1OKS A;  4RNA A;  3U5Z A;  1N34 M;  1IN8 A;  1XXH A;  3SAW A;  2QBY B;  2UXD M;  1IBL M;  3MQL A;  5IRE B;  3JR5 A;  4GH9 A;  2DWN A;  2LVN C;  3T38 A;  2WZJ A;  3U61 A;  2MRO B;  2YQZ A;  2LHC A;  3NWL A;  2Z4S A;  4FCV A;  3SFZ A;  2CV1 A;  1GXD A;  4NZ1 A;  1QVR A;  3GQ5 A;  2I7N A;  3MHV C;  5EP4 A;  3J81 S;  4K0K M;  3VKG A;  1DGG A;  4Z2K A;  1I94 M;  1CXW A;  4MB5 A;  2XZU A;  4M0W A;  2HL7 A;  3FYC A;  2X8A A;  3F92 A;  3A45 A;  1R7R A;  2C9O A;  3U6O A;  4WW0 A;  1HNW M;  1OJL A;  1PJQ A;  4DV0 M;  5IT9 S;  2HWJ A;  4IBE A;  2XZF A;  4L15 A;  1F4I A;  3WD0 A;  1DGB A;  1IXR C;  2XD1 A;  2JNH A;  4L8R C;  3MK6 A;  4OW0 A;  1H6U A;  2C99 A;  2XD5 A;  2ZAN A;  2CV0 A;  2KEB A;  2Y20 A;  4QHT A;  3CF2 A;  2R44 A;  3SHF A;  3WHL A;  1IM2 A;  5IWA M;  4CIS A;  4Z8X A;  1E9S A;  2CE7 A;  1Q3B A;  2JWS A;  4NL4 H;  5ITX A;  3FTF A;  3K92 A;  3QAU A;  4L78 A;  2CHQ A;  2FN2 A;  2RTS A;  5EJC A;  5DNY A;  1D0M A;  2JY7 A;  4OX9 M;  4NC6 A;  4Z2H A;  3AKZ A;  1N32 M;  1OIZ A;  4G4N A;  3U5Z B;  1Z59 A;  1ORY B;  1XXH B;  2UXB M;  3FUV A;  2L4F A;  5C18 A;  1YU3 A;  1WIV A;  3U61 B;  2LNH C;  2BNK A;  2J7N A;  2OOA A;  3HHW A;  3SC3 A;  4AKH A;  2Y2I A;  1IN5 A;  2MH8 A;  2J7O A;  4OVZ A;  4D80 A;  5EXS A;  4B7F A;  3HY5 A;  4R7G A;  5BPV A;  2F4V M;  2UUB M;  2NQ8 C;  1HQY E;  2DNA A;  3GLG E;  4G4R A;  3B7N A;  3IEC A;  4DR5 M;  2I7P A;  2D7H A;  4MH0 E;  1E94 E;  2QCU A;  4DV4 M;  1IY1 A;  2HHH M;  2CV2 A;  3QYE A;  1OGB A;  3UGJ A;  4FCW A;  3GQ3 A;  1IN4 A;  3EIE A;  1L8Q A;  3I4V A;  3SBJ A;  4AZF A;  4LF5 M;  3HJQ A;  2EA0 A;  1QUS A;  3PXG A;  2QPA A;  3IHP A; 
#chains in the Genus database with same CATH homology
 4NRW A;  3LVW A;  4S12 A;  5FTJ A;  1HNX M;  1R6B X;  4NSO B;  3D8L A;  3FTE A;  1PJJ A;  1G3I A;  3DOA A;  4IBF A;  1YU2 A;  2XF3 A;  2Y2O A;  1IXZ A;  2O5R A;  4FVM A;  2ZAO A;  1XNR M;  1XHB A;  4DR6 M;  3RGS A;  1GL7 A;  4G4O A;  5FTN A;  2FFF B;  5KO3 A;  3SAR A;  2AHM A;  4IBC A;  3FUT A;  2Y2P A;  4NXN M;  4DV1 M;  3U6S A;  2G5G X;  3HKP A;  1G8P A;  4OVZ B;  5EQT A;  4OU7 A;  4I4L A;  1IY0 A;  1VDD A;  2UXC M;  1C1K A;  2CUZ A;  4R3D A;  3UJN A;  3GLI A;  3U6C A;  1GKI A;  2KRK A;  5EP1 A;  4OJP A;  2FNA A;  1YU1 A;  1XWI A;  5ITQ A;  4JV5 M;  7CAT A;  2FFJ A;  2CHG A;  1XMO M;  3N3F A;  2HKJ A;  3GRR A;  1KYI A;  3ZCB B;  1WXQ A;  1HQC A;  3GLG A;  4L16 A;  4L4U A;  4JI7 M;  4JI8 M;  4PT5 A;  2VQF M;  3VDP A;  2UU9 M;  1QZM A;  3GO8 A;  4LZJ A;  2R46 A;  2F5N A;  3PVS A;  4DV7 M;  2Z7J A;  3U6E A;  2Y2J A;  1PJI A;  2F5S A;  4M9X A;  5KPZ A;  3VKH A;  3B9P A;  4OUI A;  3KVW A;  2JCH A;  4LGM A;  5C1B A;  4M9S A;  3UZU A;  5KPT A;  2FE8 A;  1FJG M;  4X62 M;  1LV7 A;  4A3V B;  4JI5 M;  1DO2 A;  4B08 A;  3HJS A;  4CGY B;  2BJV A;  2R4E A;  3LVV A;  3FTD A;  3A42 A;  1IBK M;  2Z4R A;  2RKO A;  3J2P B;  4X64 M;  4LJ4 A;  5FTM A;  3HWS A;  4AQY M;  3IG8 A;  3TPZ A;  3KOW E;  4PD2 A;  2DXI A;  3GLI B;  1NY5 A;  2XH9 A;  1G59 A;  2EUC A;  5EXT A;  3C58 A;  3KS8 A;  1S3S A;  2R18 A;  2DHR A;  2KXE A;  1DO0 A;  3E9S A;  4QHS A;  4TUW A;  2L09 A;  4GIP A;  3J80 S;  3ZH9 B;  3HSH A;  3GLG B;  5A2Q S;  1I4W A;  4FCT A;  1XNQ M;  3HGI A;  3KS4 A;  1YE9 A;  3RGP A;  4DV2 M;  4QNL A;  2YNM D;  3A46 A;  1JR3 A;  1G4A E;  1MU5 A;  2C98 A;  3UMM A;  3HU1 A;  8CAT A;  4LJ6 A;  1TH4 A;  1TH2 A;  3GP1 A;  3DZD A;  3QWL A;  2M60 A;  3FUX A;  2F5Q A;  3SAT A;  1K3X A;  3WHK A;  2XFT A;  5ITR A;  1GVN A;  4M9Z A;  1NHG C;  4PDI A;  1HT2 E;  3GPX A;  3TWK A;  3VK8 A;  4JN6 A;  4BBA A;  1MX0 A;  4JYA M;  3M7G A;  2Q2E B;  1L2D A;  3HHY A;  4I8O A;  4KO8 A;  3KDS E;  5ITY A;  1IQP A;  1YU0 A;  3RE8 A;  3JR4 A;  1QAM A;  4RF0 A;  2L7H A;  3FUU A;  3GRY A;  4IBK A;  5GKN A;  2Y2M A;  3CF0 A;  3L29 A;  4D81 A;  3AJI B;  3HJ8 A;  3U6L A;  2DZN B;  1J5E M;  4NY2 A;  4NYY A;  1JQJ C;  5FTL A;  3GPU A;  2VII A;  3MJ5 A;  3W0L B;  4LF9 M;  4DR2 M;  1N36 M;  1KFV A;  2XEP A;  3KW6 A;  1Q39 A;  1ZQ9 A;  2KRU A;  2DWL A;  4QOS A;  1SXJ A;  3KXE C;  1PM5 A;  3VFD A;  4DUY M;  2CFO A;  1N78 A;  4MGY E;  2E5L M;  2QZ4 A;  5EP2 A;  3KOZ E;  4PDG A;  2DWM A;  2UUC M;  1K3W A;  2Y2L A;  3J7A S;  3CF6 E;  5KQ8 A;  1KSF X;  1NJG A;  3AOG A;  3M6A A;  3HU3 A;  1SXJ C;  4I5S A;  1Z5A A;  2FOI C;  1J09 A;  4AI6 A;  1QYR A;  3KSX A;  4W5W A;  3TWM A;  4LFC M;  2D7E A;  4LF7 M;  1IN6 A;  1QAQ A;  4LCB A;  3ZC7 B;  3VDU A;  3CTW B;  3E4R A;  4LZZ A;  1NNJ A;  3SMP A;  4NZ5 A;  2KZS A;  2H1R A;  2XSZ D;  5EP3 A;  3AV0 A;  2R65 A;  4KLN A;  3SAS A;  3AOE A;  3EIH A;  4EIW A;  4FWH A;  4BB9 A;  4IJE A;  4LRT A;  1UM8 A;  4LJ8 A;  4B3M M;  1SXJ B;  2G8L A;  1NJF A;  4LJ5 A;  3KOX E;  2V1C A;  1TDZ A;  2XSZ A;  1L1Z A;  1Z5B A;  1DGH A;  5EXP A;  1J7K A;  3AOE C;  4HL4 A;  3TQS A;  2HCB A;  4MM3 B;  3R8F A;  3HHZ A;  3SHG B;  3I4Y A;  2DWZ B;  2EO2 A;  3KFU G;  2ZAM A;  4LJA A;  3A98 B;  2DVW B;  4ZPX A;  3FTC A;  4G4Q A;  5BR8 M;  4OJ5 A;  3K1J A;  4IBG A;  2L7I A;  5H37 D;  3ILK A;  2X4A A;  3TE6 A;  2W82 A;  3KSJ A;  4FD2 A;  1XC8 A;  3FYD A;  3HHX A;  3LQQ A;  4GHA A;  5DYI A;  4DR4 M;  1JR3 D;  3FD9 A;  1IY2 A;  4JI0 M;  4IBD A;  4OJ6 A;  1YUB A;  2CHV A;  3FUW A;  5F3W A;  3GPY A;  1Z6T A;  4MB7 A;  2C5R A;  4LFA M;  1OFI A;  3L27 A;  4B3S M;  3PNY A;  1SXJ E;  2C9C A;  4I81 A;  4BLC A;  3KP0 E;  2X49 A;  3BOS A;  1DGH B;  1Z5C A;  5E6J A;  4OJL A;  1NSF A;  4RF1 A;  4DV5 M;  1EE8 A;  4IBB A;  3SMS A;  3KOY E;  4FWG A;  2BG1 A;  4DV6 M;  4MGK E;  1NY6 A;  2RGH A;  4B3T M;  2Y2H A;  3U6M A;  4LJ9 A;  2RGO A;  1NNU C;  4XGI A;  1R2Z A;  1HR0 M;  2Y2N A;  1QQW A;  1HNZ M;  2JE5 A;  1QAN A;  5E26 A;  1QAO A;  2JA2 A;  1NVM A;  3H4M A;  3UK6 A;  5FSW A;  5ITU A;  4QNM A;  2XLJ A;  3SBJ A;  2OQ4 A;  4X65 M;  4NRV A;  2LWX A;  4FW9 A;  5FLX S;  3PNV A;  2OPF A;  3SAV A;  4Z6Y A;  4G6Z A;  1L2B A;  3HON A;  1DGF A;  3J27 B;  3K8Z A;  1GL6 A;  4LY6 A;  1SXJ D;  2XGN A;  2VQE M;  2F5P A;  1IXS B;  4AKG A;  2C96 A;  1N77 A;  4PCZ A;  4GRI A;  2R45 A;  4JXJ A;  3GLH A;  1YU4 A;  2R62 A;  2Y2Q A;  2Z3X A;  2CEA A;  4MGI E;  2ZBK B;  4NZ3 A;  2QEN A;  2V6Z M;  3D8B A;  1YUE A;  2V1U A;  4MGH A;  3U60 A;  4ITQ A;  1D2N A;  4AW4 A;  4HLQ A;  3R9X B;  2IOU A;  3JAM S;  2M5Z A;  4REZ A;  4M0D A;  4GC9 A;  4LF6 M;  5JI2 E;  4JI4 M;  2BJW A;  3U6Q A;  1W5S A;  3THG A;  4X66 M;  3FKE A;  4XBO A;  1G41 A;  2A5Y B;  3U6P A;  3NBI A;  3K2L A;  3U6D A;  4WUR A;  1IBM M;  3SAU A;  4P16 A;  4LJ7 A;  1R2Y A;  4LG2 A;  1NHW C;  1L2C A;  1TGU A;  2Y2G A;  4DR3 M;  3AFH A;  4GKK M;  2LXE A;  4FWD A;  4JI3 M;  3GPP A;  4AKI A;  5IZ7 D;  1X37 A;  4DR7 M;  1IN7 A;  4IBJ A;  3GRV A;  4KOD A;  2Y0Q A;  3I51 A;  4D82 A;  1K82 A;  3L26 A;  4LRS A;  3GLH B;  3RFW A;  3OTO M;  2ERC A;  1Q3C A;  5FTK A;  4LF4 M;  4GKJ M;  3L25 A;  5LMU M;  3WX7 A;  3U60 B;  4LFB M;  2LH0 A;  5DYG A;  3GLF A;  4GMQ A;  2KZU A;  2D7G A;  1YSY A;  2Y0T A;  3SYK A;  4JI2 M;  1ZAE A;  4LGY A;  3T1Y M;  4DR1 M;  4JI1 M;  2K47 A;  1T3T A;  4LF8 M;  5KPR A;  4AG6 A;  3Q8X A;  4NZ4 A;  2R4J A;  4IBI A;  2ZM6 M;  2QBY A;  3W0F A;  4AG5 A;  3DA1 A;  3L2A A;  5ITT A;  2F5O A;  3SYL A;  4YY3 M;  2QP9 X;  3VLF B;  1HT1 E;  2UWX A;  4NYU A;  3GRU A;  3T1H M;  1TDH A;  4NSR A;  1N75 A;  1L1T A;  4GC5 A;  3LQR A;  2Y21 A;  4KHP M;  4NXM M;  4DV3 M;  3M0E A;  4GHL A;  4II7 A;  3TL4 X;  1FNN A;  4GIT A;  3J7B A;  3TWL A;  1OFH A;  4B7H A;  4OJO A;  1N33 M;  3IG5 A;  3GQ4 A;  3HU2 A;  4MGZ E;  3AL0 C;  4QOZ C;  5ITX E;  1W5T A;  5KQD A;  2UUA M;  1E9R A;  3VK7 A;  3KP1 E;  1GLN A;  3T15 A;  2L6O A;  3GLF B;  4QNR A;  4JI6 M;  2KA6 B;  2DZO B;  2Y2K A;  3LMM A;  5LMN M;  4IJF A;  4NOO B;  4IIW A;  3PFI A;  1E32 A;  1TH3 A;  3DFZ A;  3L28 A;  4B7G A;  5JI3 E;  4B3R M;  4YHH M;  5EXX A;  2YFQ A;  4DUZ M;  2P5T A;  2KW0 A;  2XFS A;  2YR0 A;  4CHT B;  1XMQ M;  3U5Z A;  4RNA A;  2UXD M;  1N34 M;  1IN8 A;  1XXH A;  3SAW A;  2QBY B;  1IBL M;  5IRE B;  3JR5 A;  4GH9 A;  2DWN A;  3T38 A;  3U61 A;  2YQZ A;  3NWL A;  4FCV A;  2CV1 A;  2Z4S A;  3SFZ A;  4NZ1 A;  1QVR A;  3GQ5 A;  2I7N A;  3MHV C;  5EP4 A;  3J81 S;  4K0K M;  3VKG A;  1DGG A;  1I94 M;  2XZU A;  4M0W A;  2HL7 A;  3FYC A;  2X8A A;  3A45 A;  1R7R A;  2C9O A;  3U6O A;  4WW0 A;  1HNW M;  1OJL A;  5IT9 S;  4DV0 M;  4IBE A;  2XZF A;  4L15 A;  1DGB A;  1IXR C;  2XD1 A;  4L8R C;  3MK6 A;  4OW0 A;  1H6U A;  2C99 A;  2XD5 A;  2ZAN A;  2CV0 A;  2KEB A;  2Y20 A;  4QHT A;  3CF2 A;  3SHF A;  3WHL A;  5IWA M;  1IM2 A;  4CIS A;  4Z8X A;  1E9S A;  2CE7 A;  1Q3B A;  4NL4 H;  3FTF A;  5ITX A;  3K92 A;  3QAU A;  4L78 A;  2CHQ A;  5EJC A;  5DNY A;  4OX9 M;  3AKZ A;  1N32 M;  4G4N A;  3U5Z B;  1Z59 A;  1ORY B;  1XXH B;  2UXB M;  3FUV A;  5C18 A;  1YU3 A;  3U61 B;  2LNH C;  2BNK A;  2J7N A;  3HHW A;  3SC3 A;  4AKH A;  2Y2I A;  1IN5 A;  4D80 A;  2J7O A;  4OVZ A;  5EXS A;  4B7F A;  4R7G A;  5BPV A;  2F4V M;  2UUB M;  2NQ8 C;  1HQY E;  4G4R A;  4DR5 M;  2I7P A;  2D7H A;  4MH0 E;  1E94 E;  2QCU A;  4DV4 M;  1IY1 A;  2HHH M;  2CV2 A;  3UGJ A;  4FCW A;  3GQ3 A;  1IN4 A;  3EIE A;  1L8Q A;  3I4V A;  4LF5 M;  4AZF A;  3HJQ A;  2EA0 A;  3PXG A;  2QPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...