4IBCA

Ebola virus vp35 bound to small molecule
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
123
structure length
123
Chain Sequence
DISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/transcription inhibitor
molecule keywords Polymerase cofactor VP35
publication title In Silico Derived Small Molecules Bind the Filovirus VP35 Protein and Inhibit Its Polymerase Cofactor Activity.
pubmed doi rcsb
source organism Ebola virus
total genus 41
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ibcA01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4ibcA02
4IJFA 4IBFA 3L26A 3L25A 3L27A 4IBDA 4IBGA 4IJEA 4IBEA 3L2AA 5BPVA 3L28A 4GHAA 4IBJA 4GH9A 3KS4A 3FKEA 4LG2A 3L29A 4IBCA 4IBKA 3KS8A 4IBIA 4IBBA 4GHLA
chains in the Genus database with same CATH superfamily
3ZQJA 2WSEF 5L8RF 1N34M 3TPZA 4MGHA 3SASA 3J81S 3ILKA 3TWMA 5FLXS 2L09A 2BJWA 3QYEA 5IT9S 1IXZA 3UK6A 1PDCA 3U6EA 1R7RA 3VK8A 2YNMD 4AKIA 3M0EA 2R45A 2UU9M 2ZBKB 1XB2B 1HQYE 3HJSA 3DFZA 1ZMUA 2DAEA 4IBGA 2FOIC 2LWXA 3U60A 4WW0A 2Y0QA 4L8RC 2EJSA 4QNLA 2VQFM 3J27B 1Z6TA 1XNRM 5FTNA 2H5XA 2EKKA 1YU0A 1N36M 4DV5M 2HWJA 4JN6A 4NZ3A 4DV4M 4NZ1A 2LVOC 4I5SA 4GIPA 3PNVA 3GO8A 3SAUA 2CUZA 1K3WA 2BWBA 3GLGA 2QBYB 3KFUG 1RU3A 1NHWC 1G41A 5E26A 4B3MM 1HNXM 4GHLA 1QAOA 3FUXA 4LJ8A 3VDPA 4G4OA 1L6JA 2ZM6M 1C1KA 3GPUA 1PRBA 2OO9A 4JI3M 1NNJA 3L25A 3WD3A 4DUYM 3K2LA 2HCBA 3V76A 5F3WA 1XNQM 1F4IA 1YE9A 1H6UA 1TH3A 2L7HA 3A42A 3GQ3A 3SATA 2XSZD 3GLHE 1ZAEA 1H8PA 3KSJA 4NYYA 3HWSA 2QENA 4CHTB 2LVPC 1TH4A 4LFBM 3MHVC 1SXJB 3L28A 1IY2A 4DV6M 2J5YA 4G3OA 1W5TA 5KPRA 1GLNA 2BJVA 4IBJA 4NXMM 4Z2IA 2VF7A 3KOWE 4AKGA 2CHGA 1E88A 1ZV1A 3EIHA 3IECA 3SFZA 4QHSA 2K6BA 4LRSA 4M9SA 3UMMA 1HNWM 3FUWA 2OPFA 3SMSA 2OQ4A 2C96A 2QZ4A 1QDRA 1IN4A 2EKFA 3BOSA 3L26A 3U6LA 1QZMA 2HKJA 3GRYA 4KO8A 2R46A 1AIWA 3WD1A 2JCHA 2F5PA 1WIVA 4MB5A 3KOXE 3W0LB 2UUCM 1D0KA 2DWLA 1O6IA 1ORYB 3GRRA 3E4RA 3L27A 2LHCA 5IWAM 1GJSA 1QO6A 1OAIA 2MJ5B 3SBJA 2D49A 2APLA 3U6MA 4NY2A 1YU2A 3K9OA 1OGGA 1UR8A 3FTCA 3GPYA 4IIWA 5EXXA 2WSFF 2XGNA 3AV0A 3FTEA 3FRIA 1D0MA 4LJAA 5EP4A 3RE8A 1FNNA 1XHBA 1S3SA 1V34A 4OU7A 4IBIA 4JI6M 5EXTA 4NRWA 1IY0A 4IBFA 2UUAM 2O01F 1KS0A 2Y2HA 3HONA 1L2DA 1IFYA 1WGNA 1Z5BA 2LNHC 2WSCF 3GLHA 4KT0F 2LTUA 4TUWA 2XFSA 1E15A 2E5LM 1QZEA 1NHGC 2JZ1A 1R5LA 4LJ6A 1EIJA 4OJ5A 4Z6YA 1IXSB 3C3EA 3PVSA 4DV0M 4NZ5A 2YFQA 4LF4M 3HSHA 1ED7A 2DZOB 2KA6B 2YQZA 5ITTA 1MJGM 1VEGA 3JR5A 4GHAA 4GEWA 4XGIA 1OIZA 3SHFA 3RGSA 1N75A 1SXJC 4GITA 1ZMVA 2W82A 3H4JA 1N33M 2FE8A 4LF9M 1OGBA 1AUAA 1OTRA 1YSYA 4DR3M 2J7OA 2Y2QA 4WP2A 4AQYM 3DOAA 4FD2A 4MB3A 2P5TA 3I4VA 3WD0A 1JR3D 2F4VM 1N77A 4JI0M 4LF6M 4X65M 3CTWB 4JI8M 5E6JA 1L1TA 2FH0A 3T38A 4HEOA 5IZ7D 2UXBM 4YHHM 3FTDA 2RGHA 4FCWA 2DWMA 1PJIA 3U6DA 3HHYA 2DAGA 1MX0A 4LZZA 4Y28F 3GLIB 2LXEA 1XXHB 2FNAA 4G4RA 2UXCM 2KRKA 3R8FA 2Y2KA 3AJIB 4L4UA 1G4AE 4OX9M 3HJQA 2JWSA 3SYKA 1GKIA 3ZC7B 1G3IA 1SXJD 1HT2E 1QDTA 3CF0A 3HGIA 3RGPA 4PCZA 3Q8XA 4G4QA 2BG1A 1VG5A 2H1RA 1OQYA 3GLFE 2Y2JA 3U61B 2QSFX 3E9SA 4XBOA 1MU5A 2Y2OA 4CISA 2CHVA 4Z2GA 1XC8A 1E6RA 5FTJA 2NQ8C 5DNYA 4NZ4A 1SG9A 5EP2A 2IOUA 2DAIA 4BLCA 1NVMA 2MH8A 3L2AA 3U5ZB 2D7HA 1T3TA 2LBCA 1TDZA 1G59A 2M60A 4JV5M 1Z5AA 4L15A 3WD2A 2X8AA 4KODA 2XZUA 1UM8A 1UR9A 4RF1A 4D82A 3A98B 1Z5CA 4OJOA 4MGYE 1IN8A 1E32A 4OW0A 4B7FA 4RF0A 4CIZA 1IM2A 2JXNA 4IBBA 2Y2NA 4TX8A 1DGFA 4LGYA 4P17A 4B7GA 3JAMS 1W5SA 4HMDA 3HU1A 2QP9X 3QWLA 2UWXA 1PM5A 3OTOM 4HMEA 2Y2IA 4OVZB 2DXIA 2V5OA 2Y2LA 1T43A 2VIIA 3AOEA 1VDDA 2XEPA 2KEBA 3GRVA 1HR0M 1E9SA 2RTSA 5ITUA 4DUZM 1Q02A 2Z7JA 5EP1A 1WXQA 1KYIA 4F2LA 2V1CA 1G8PA 3U60B 3B7QA 4HMCA 5JI3E 1DGBA 4OJPA 4I81A 4LGMA 2HAKA 3N3FA 2DHRA 3T1YM 2L7IA 3E46A 4IBCA 1WJ7A 2ERCA 2DZNB 2MROB 2QCUA 2KZSA 1D0LA 4FVMA 3ZH9B 3VLFB 4PT5A 2RGOA 4FW9A 4BBAA 3J80S 3GLFA 1XMQM 4IJFA 2WZJA 3KDSE 4AG6A 4LJ7A 1VEJA 3BBZA 1Z59A 2Z8YM 1QAMA 2XH9A 1GPFA 1PJSA 4F1IA 1EAKA 4LF5M 1NJGA 2DWZB 2KZUA 1IY1A 3MJ5A 1N32M 2C99A 4JI4M 4MGZE 4L78A 4IBDA 4Z2JA 1BVSA 2VF8A 3K8ZA 1J5EM 1IQPA 4IBEA 3MK6A 3GPXA 4DR4M 3M6AA 3B9PA 3HU3A 3TWKA 5LMNM 3VFDA 2Y2MA 3FYDA 5FTLA 1AIPC 1J7KA 4D81A 1ZQ9A 1CXWA 3GLIE 1XXHE 3BXWA 2QPAA 3AKZA 1LTMA 4LF8M 2Y20A 2Z4SA 2K47A 2XD5A 3UZUA 3W68A 1P3QQ 3I04M 2XSZA 1GVNA 3GQ5A 1IBKM 4FWDA 1A5TA 4NC6A 1IN5A 4JI1M 2JZ0A 3NWLA 3LW5F 2R62A 3A46A 4ANRA 2DENA 4DV1M 3IG8A 1PJJA 3DA1A 1IXSA 5EJCA 3M7PA 4FWGA 3GPPA 2V1UA 2CEAA 3HZJA 3LCUA 4CJ6A 1I4WA 3LVWA 1L2CA 1DGHB 1YUBA 4QOZC 1GL7A 2R0IA 2R4EA 2R6FA 2OOBA 2BNKA 3B74A 1NSFA 1NV9A 1XMOM 2F5QA 5FTKA 2JY6B 2K9DA 3W67A 2JY7A 1FJGM 3HKPA 3FUTA 4LY6A 2N35A 1YU3A 2R65A 3FKEA 1W1VA 4QOSA 4LCBA 3U6PA 4M0WA 2CV2A 3KXEC 1IBMM 4LF7M 3KS8A 4B3SM 3PNYA 2ZANA 2ZTDA 3K92A 1E6NA 5DYGA 2YR0A 4Z2HA 2EA0A 4NSRA 1JR3E 3AFHA 3PXGA 2JP7A 3NBXX 2UXDM 3KP1E 2DKLA 3VK7A 3GLHB 1NO1A 1TGUA 2D7GA 1TTEA 1YLAA 4S12A 3VDUA 1E94E 2FFJA 3MMPA 4M0DA 5DYIA 1YU1A 2Y2PA 2C9OA 2CWBA 2XFTA 4DR5M 4UN2B 3GLIA 2KNZA 3NBIA 5A2QS 3FE3A 1KSFX 2LHGA 1Q39A 1XXHA 2C9CA 5KPTA 1L2BA 1QAQA 1TH2A 1VDLA 2M5ZA 3C3DA 3FRHA 4GH9A 4II7A 1SXJE 4GRIA 4M9XA 3W0FA 3SAVA 4X62M 2CP8A 2Q2EB 2I7PA 2LH0A 3MQLA 2JY5A 3VKHA 5GKNA 4G4NA 1Y8GA 4OJLA 2CV0A 4FWHA 3U61A 2DHYA 4MB4A 4D80A 2AHMA 3JR4A 4M9ZA 3GRUA 7CATA 2VQEM 4JI5M 3A45A 3B7NA 2DAKA 4MM3B 1VQ1A 1IN6A 2EO2A 2I7NA 4Z8XA 4PDGA 3U6QA 4OJ6A 3U5ZA 1T6OA 2R4JA 3DZDA 5DFLA 1WGLA 3WHLA 3WX7A 2X4AA 1V92A 4QNMA 1OFIA 1W1YA 2QHOB 1LV7A 5FTMA 4RNAA 4NL4H 5C1BA 2XD1A 3CF2A 1QUSA 2J7NA 3Q8GA 4PD2A 3D8LA 1L8QA 2XF3A 5EXPA 4DV2M 1GL6A 1K3XA 4DBGB 4FCVA 2QBYA 4YY3M 1DV0A 2L4EA 2Y0TA 1Q3CA 3I51A 3LQQA 4GMQA 4DR7M 4B3RM 2UUBM 1JR3A 1HNZM 2F5SA 2RRUA 1QUTA 3J7AS 3K1JA 4BB9A 3WD4A 2F5OA 1J7MA 4OVZA 4QNRA 1KFVA 2DWNA 1D2NA 1H0IA 3HHXA 1E8BA 2L6OA 2JA2A 2DAMA 4KLNA 5EP3A 4A3VB 1GJTA 2VDBB 4EIWA 1OFHA 1QQWA 3KOYE 4NRVA 3HU2A 2LVAA 2CE7A 4LZJA 2GNOA 1UFZA 1SXJA 4R3DA 5EXSA 3FD9A 3LVVA 4LJ9A 1OIPA 4B7HA 2G5GX 2CRUA 3UJNA 1NNUC 1EE8A 1NV8A 4JI2M 2KXEA 3KS4A 3LQRA 4OUIA 1IXRC 3FUUA 2CFOA 3HJ8A 3F92A 4QHTA 1L1ZA 2V6ZM 4NSOB 3AOGA 1G71A 3GLGB 3T6PA 4HL4A 2LVNC 4AZFA 2QQ8A 4DR2M 1N78A 4X64M 2X49A 8CATA 3U6OA 4Z2KA 3FYCA 5EQTA 1QVRA 2Z4RA 4G6ZA 3TE6A 3LMMA 4R7GA 2CHQA 3SMPA 5ITYA 2Z3XA 4DV7M 1DO0A 3PFIA 1VEKA 1TDHA 3TQSA 4DV3M 4MGKE 4HLQA 4GKKM 1EFUB 1CUKA 3J2PB 1TF0B 4IJEA 2C5RA 3U6SA 4LJ5A 4AW4A 3T1HM 4R71A 3QAUA 4GKJM 4K0KM 3E21A 2BWEA 2OOAA 1NJFA 5C18A 2CV1A 1PJTA 4AG5A 2FFFB 3KOZE 4AI6A 1OKSA 2KDLA 1R2ZA 1E6PA 1HT1E 3B89A 3TWLA 3GLFB 1YUEA 1PGYA 2JUJA 2KRUA 2L4FA 4LRTA 4NOOB 3SYLA 2KNVA 5BR8M 4ITQA 1H0GA 5KQDA 3KSXA 3WHKA 1CK7A 2FS1A 1DGHA 3KW6A 3IHPA 1HJPA 3K9PA 5H37D 3THGA 4DR1M 1DGGA 3HY5A 4MGIE 2RKOA 2XZFA 1GO5A 3AL0C 2EUCA 3EIEA 1WHCA 2R18A 4W5WA 5ITRA 3C58A 1JQJC 1GABA 1HQCA 4LFAM 4MB7A 4NXNM 4XK8F 2MGWA 2GQFA 4PDIA 5KO3A 4B3TM 5FSWA 3R9XB 4L6V6 3SHGB 5JI2E 1WR1B 3QYBA 2G3QA 2DZLA 3SARA 5ITXE 1MN3A 3UGJA 3GQ4A 4KHPM 1YU4A 2JE5A 3KP0E 1QYRA 4JYAM 3B7ZA 1V33A 3CGWA 4MH0E 1GOIA 2L2DA 3KVWA 4FCTA 2FN2A 4ZPXA 2MR9A 3M7GA 3SC3A 3HX3A 1Q3BA 2A5YB 3H4MA 3I4YA 2JNHA 2C98A 1IN7A 2KHHA 1I94M 2KW0A 4I4LA 1IBLM 2B3TA 1NY5A 2HHHM 3AOEC 4GC9A 3VKGA 1QANA 1NY6A 1OJLA 1XWIA 4B08A 3L29A 4GC5A 4IBKA 3RFWA 2Y21A 3LCVB 3U6CA 2F5NA 4WURA 1TR8A 5ITQA 2D7EA 2R44A 5LMUM 2G8LA 2K0BX 1R6BX 2DNAA 3HHZA 1W1TA 4Z2LA 3GLGE 3ZCBB 3SAWA 1JB0F 4DR6M 3HHWA 1R2YA 2O25A 4LJ4A 3T15A 1E9RA 3CF6E 3I01M 4CGYB 1K82A 1E6ZA 4I8OA 1X37A 3J7BA 1PJQA 2XLJA 2DI0A 2JY8A 1W1PA 2O5RA 1J09A 3IG5A 4JI7M 2DVWB 2Y2GA 4AKHA 5BPVA 5KQ8A 2ZTCA 4RKUF 4LFCM 4LG2A 3D8BA 2KNAA 2ZAOA 3TL4X 4REZA 2HL7A 1ZMWA 1DO2A 3FTFA 4JXJA 2ZAMA 2LVQD 5ITXA 1R4GA 4X66M 3GP1A 4NYUA 5IREB 1OAOC 2QNJA 5KPZA 4Q7JA 3FUVA 1GXDA 4P16A 1C7YA 3C9PA 4L16A
chains in the Genus database with same CATH topology
1N34M 3TPZA 4MGHA 3SASA 3J81S 3ILKA 3TWMA 5FLXS 2L09A 2BJWA 5IT9S 1IXZA 3UK6A 3U6EA 1R7RA 3VK8A 2YNMD 4AKIA 3M0EA 2R45A 2UU9M 2ZBKB 1HQYE 3HJSA 3DFZA 4IBGA 2FOIC 2LWXA 3U60A 4WW0A 2Y0QA 4L8RC 4QNLA 2VQFM 3J27B 1Z6TA 1XNRM 5FTNA 1YU0A 1N36M 4DV5M 4JN6A 4NZ3A 4DV4M 4NZ1A 4I5SA 3SAUA 4GIPA 3PNVA 3GO8A 1K3WA 2CUZA 2QBYB 4LG2A 3GLGA 3KFUG 1NHWC 1G41A 5E26A 4B3MM 1HNXM 4GHLA 1QAOA 3FUXA 4LJ8A 3VDPA 4G4OA 2ZM6M 1C1KA 3GPUA 1NNJA 4JI3M 3L25A 4DUYM 3K2LA 2HCBA 5F3WA 1XNQM 1YE9A 1H6UA 1TH3A 2L7HA 3A42A 3GQ3A 3SATA 2XSZD 1ZAEA 3KSJA 4NYYA 3HWSA 2QENA 4CHTB 1TH4A 4LFBM 3MHVC 1SXJB 3L28A 1IY2A 4DV6M 5KPRA 4NXMM 1W5TA 1GLNA 2BJVA 4IBJA 3KOWE 4AKGA 2CHGA 3EIHA 3SFZA 4QHSA 4LRSA 4M9SA 3UMMA 1HNWM 3FUWA 2OPFA 3SMSA 2OQ4A 2C96A 2QZ4A 1IN4A 3BOSA 3L26A 3U6LA 1QZMA 2HKJA 3GRYA 4KO8A 2R46A 2JCHA 2F5PA 3KOXE 3W0LB 2UUCM 2DWLA 1ORYB 3GRRA 3L27A 3E4RA 5IWAM 3SBJA 3U6MA 4NY2A 1YU2A 3FTCA 3GPYA 4IIWA 5EXXA 2XGNA 3AV0A 3FTEA 4LJAA 5EP4A 3RE8A 1FNNA 1XHBA 1S3SA 4OU7A 4IBIA 4JI6M 5EXTA 4NRWA 1IY0A 4IBFA 2UUAM 2Y2HA 3HONA 1L2DA 1Z5BA 2LNHC 3GLHA 4TUWA 2XFSA 2E5LM 1NHGC 4LJ6A 4OJ5A 4Z6YA 1IXSB 3PVSA 4DV0M 4NZ5A 2YFQA 4LF4M 3HSHA 2DZOB 2KA6B 2YQZA 5ITTA 3JR5A 4GHAA 4XGIA 3SHFA 3RGSA 1N75A 1SXJC 4GITA 2W82A 1N33M 2FE8A 4LF9M 1YSYA 4DR3M 2J7OA 2Y2QA 4AQYM 3DOAA 4FD2A 2P5TA 3I4VA 1JR3D 2F4VM 1N77A 4JI0M 4LF6M 4X65M 3CTWB 4JI8M 5E6JA 1L1TA 3T38A 5IZ7D 2UXBM 4YHHM 3FTDA 2RGHA 4FCWA 2DWMA 1PJIA 3U6DA 3HHYA 1MX0A 4LZZA 3GLIB 2LXEA 1XXHB 2FNAA 4G4RA 2UXCM 2KRKA 3R8FA 2Y2KA 3AJIB 4L4UA 1G4AE 4OX9M 3HJQA 3SYKA 1GKIA 3ZC7B 1G3IA 1SXJD 1HT2E 3RGPA 3CF0A 3HGIA 4PCZA 4G4QA 3Q8XA 2BG1A 2H1RA 2Y2JA 3U61B 3E9SA 4XBOA 1MU5A 2Y2OA 4CISA 2CHVA 1XC8A 5FTJA 2NQ8C 5DNYA 4NZ4A 5EP2A 2IOUA 4BLCA 1NVMA 3L2AA 3U5ZB 1TDZA 2D7HA 1T3TA 1G59A 4JV5M 2Y2GA 2M60A 1Z5AA 4L15A 2X8AA 4KODA 2XZUA 1UM8A 4RF1A 4D82A 3A98B 1Z5CA 4OJOA 4MGYE 1IN8A 1E32A 4OW0A 4B7FA 4RF0A 2Y2NA 1IM2A 4IBBA 1DGFA 4LGYA 4B7GA 3JAMS 1W5SA 3HU1A 2QP9X 3QWLA 2UWXA 1PM5A 3OTOM 2Y2IA 4OVZB 2DXIA 2Y2LA 2VIIA 3AOEA 1VDDA 2XEPA 2KEBA 3GRVA 1E9SA 5ITUA 4DUZM 2Z7JA 5EP1A 1WXQA 1KYIA 2V1CA 1G8PA 3U60B 5JI3E 1DGBA 4OJPA 4I81A 4LGMA 3N3FA 2DHRA 3T1YM 2L7IA 4IBCA 1HR0M 2ERCA 2QCUA 2DZNB 3ZH9B 2F5QA 2KZSA 3GLFA 4FVMA 3VLFB 4PT5A 2RGOA 4FW9A 4BBAA 3J80S 1XMQM 4IJFA 3KDSE 4AG6A 4LJ7A 1Z59A 1QAMA 2XH9A 4LF5M 1NJGA 2DWZB 2KZUA 1IY1A 3MJ5A 1N32M 2C99A 4JI4M 4MGZE 4L78A 4IBDA 3K8ZA 1J5EM 1IQPA 4IBEA 3MK6A 3GPXA 4DR4M 3M6AA 3B9PA 3HU3A 3TWKA 5LMNM 3VFDA 2Y2MA 3FYDA 5FTLA 1J7KA 4D81A 1ZQ9A 2QPAA 3AKZA 4LF8M 2Y20A 2Z4SA 2K47A 2XD5A 3UZUA 2XSZA 1GVNA 3GQ5A 1IBKM 4FWDA 1IN5A 4JI1M 3NWLA 2R62A 3A46A 4DV1M 3IG8A 1PJJA 3DA1A 5EJCA 4FWGA 3GPPA 2V1UA 2CEAA 1I4WA 3LVWA 1L2CA 1DGHB 1YUBA 4QOZC 1GL7A 2R4EA 2BNKA 1NSFA 1XMOM 5FTKA 1FJGM 3HKPA 3FUTA 4LY6A 1YU3A 2R65A 3FKEA 4QOSA 4LCBA 3U6PA 4M0WA 2CV2A 3KXEC 1IBMM 4LF7M 3KS8A 4B3SM 3PNYA 2ZANA 3K92A 5DYGA 2YR0A 2EA0A 4NSRA 3AFHA 3PXGA 2UXDM 3KP1E 3VK7A 3GLHB 1TGUA 2D7GA 4S12A 3VDUA 1E94E 2FFJA 2Y2PA 4M0DA 5DYIA 1YU1A 2C9OA 2XFTA 4DR5M 3GLIA 3NBIA 5A2QS 1KSFX 1Q39A 1XXHA 2C9CA 5KPTA 1L2BA 1QAQA 1TH2A 2M5ZA 4M9XA 4GH9A 4II7A 3W0FA 3SAVA 1SXJE 4GRIA 4X62M 2Q2EB 2I7PA 2LH0A 3VKHA 5GKNA 4G4NA 4OJLA 2CV0A 4FWHA 3U61A 4D80A 2AHMA 3JR4A 4M9ZA 3GRUA 7CATA 2VQEM 4JI5M 3A45A 4MM3B 4OJ6A 1IN6A 2EO2A 2I7NA 4Z8XA 4PDGA 3U6QA 3U5ZA 3WHLA 2R4JA 3DZDA 3WX7A 2X4AA 4QNMA 1OFIA 5FTMA 1LV7A 4RNAA 4NL4H 5C1BA 2XD1A 3CF2A 2J7NA 4PD2A 3D8LA 1L8QA 2XF3A 5EXPA 4DV2M 1GL6A 1K3XA 4FCVA 2QBYA 4YY3M 2Y0TA 1Q3CA 3I51A 3LQQA 4GMQA 4DR7M 4B3RM 2UUBM 1JR3A 1HNZM 2F5SA 3J7AS 3K1JA 4BB9A 2F5OA 4OVZA 4QNRA 1KFVA 2DWNA 1D2NA 3HHXA 2L6OA 2JA2A 4KLNA 5EP3A 4A3VB 4EIWA 1OFHA 1QQWA 3KOYE 4NRVA 3HU2A 2CE7A 4LZJA 1SXJA 4R3DA 5EXSA 3FD9A 3LVVA 4LJ9A 4B7HA 2G5GX 3UJNA 1NNUC 1EE8A 4JI2M 2KXEA 3KS4A 3LQRA 4OUIA 1IXRC 3FUUA 2CFOA 3HJ8A 4QHTA 1L1ZA 2V6ZM 4NSOB 3AOGA 3GLGB 4DR2M 4HL4A 4AZFA 1N78A 4X64M 2X49A 8CATA 3U6OA 3FYCA 5EQTA 1QVRA 2Z4RA 4G6ZA 3TE6A 3LMMA 4R7GA 2CHQA 3SMPA 5ITYA 2Z3XA 4DV7M 1DO0A 3PFIA 3TQSA 1TDHA 4DV3M 4MGKE 4HLQA 4GKKM 3J2PB 4IJEA 2C5RA 3U6SA 4LJ5A 4AW4A 3T1HM 4GKJM 3QAUA 4K0KM 1NJFA 5C18A 2CV1A 4AG5A 2FFFB 3KOZE 4AI6A 1R2ZA 1HT1E 3TWLA 3GLFB 1YUEA 2KRUA 4ITQA 4LRTA 4NOOB 3SYLA 5BR8M 5KQDA 3KSXA 3WHKA 1DGHA 3KW6A 5H37D 3THGA 4DR1M 1DGGA 2XZFA 4MGIE 2RKOA 3AL0C 2EUCA 3EIEA 2R18A 5ITRA 4W5WA 3C58A 1JQJC 1HQCA 4LFAM 4MB7A 4NXNM 4PDIA 5KO3A 4B3TM 5FSWA 3R9XB 3SHGB 5JI2E 3SARA 4KHPM 5ITXE 3UGJA 3GQ4A 1YU4A 2JE5A 3KP0E 1QYRA 4JYAM 4MH0E 3KVWA 4FCTA 4ZPXA 3M7GA 3SC3A 1Q3BA 2A5YB 3H4MA 3I4YA 2C98A 1IN7A 1I94M 2KW0A 4I4LA 1IBLM 2HHHM 1NY5A 3AOEC 4GC9A 3VKGA 1QANA 1NY6A 1OJLA 1XWIA 4B08A 3L29A 4GC5A 4IBKA 3RFWA 2Y21A 3U6CA 2F5NA 4WURA 5ITQA 5LMUM 2D7EA 2G8LA 1R6BX 3HHZA 3ZCBB 3SAWA 4DR6M 3HHWA 1R2YA 3T15A 4LJ4A 1E9RA 3CF6E 1K82A 4CGYB 4I8OA 1X37A 3J7BA 2XLJA 2O5RA 1J09A 3IG5A 4JI7M 2DVWB 4AKHA 5BPVA 5KQ8A 4LFCM 3D8BA 2ZAOA 3TL4X 4REZA 2HL7A 3FTFA 1DO2A 4JXJA 2ZAMA 5ITXA 4X66M 3GP1A 4NYUA 5IREB 5KPZA 3FUVA 4P16A 4L16A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IJF A;  4IBF A;  3L26 A;  3L25 A;  3L27 A;  4IBD A;  4IBG A;  4IJE A;  4IBE A;  3L2A A;  5BPV A;  3L28 A;  4GHA A;  4IBJ A;  4GH9 A;  3KS4 A;  3FKE A;  4LG2 A;  3L29 A;  4IBC A;  4IBK A;  3KS8 A;  4IBI A;  4IBB A;  4GHL A; 
#chains in the Genus database with same CATH topology
 3ZQJ A;  2WSE F;  5L8R F;  1N34 M;  3TPZ A;  4MGH A;  3SAS A;  3J81 S;  3ILK A;  3TWM A;  5FLX S;  2L09 A;  2BJW A;  3QYE A;  5IT9 S;  1IXZ A;  3UK6 A;  1PDC A;  3U6E A;  1R7R A;  3VK8 A;  2YNM D;  4AKI A;  3M0E A;  2R45 A;  2UU9 M;  2ZBK B;  1XB2 B;  1HQY E;  3HJS A;  3DFZ A;  1ZMU A;  2DAE A;  4IBG A;  2FOI C;  2LWX A;  3U60 A;  4WW0 A;  2Y0Q A;  4L8R C;  2EJS A;  4QNL A;  2VQF M;  3J27 B;  1Z6T A;  1XNR M;  5FTN A;  2H5X A;  2EKK A;  1YU0 A;  1N36 M;  4DV5 M;  2HWJ A;  4JN6 A;  4NZ3 A;  4DV4 M;  4NZ1 A;  2LVO C;  4I5S A;  4GIP A;  3PNV A;  3GO8 A;  3SAU A;  2CUZ A;  1K3W A;  2BWB A;  3GLG A;  2QBY B;  3KFU G;  1RU3 A;  1NHW C;  1G41 A;  5E26 A;  4B3M M;  1HNX M;  4GHL A;  1QAO A;  3FUX A;  4LJ8 A;  3VDP A;  4G4O A;  1L6J A;  2ZM6 M;  1C1K A;  3GPU A;  1PRB A;  2OO9 A;  4JI3 M;  1NNJ A;  3L25 A;  3WD3 A;  4DUY M;  3K2L A;  2HCB A;  3V76 A;  5F3W A;  1XNQ M;  1F4I A;  1YE9 A;  1H6U A;  1TH3 A;  2L7H A;  3A42 A;  3GQ3 A;  3SAT A;  2XSZ D;  3GLH E;  1ZAE A;  1H8P A;  3KSJ A;  4NYY A;  3HWS A;  2QEN A;  4CHT B;  2LVP C;  1TH4 A;  4LFB M;  3MHV C;  1SXJ B;  3L28 A;  1IY2 A;  4DV6 M;  2J5Y A;  4G3O A;  1W5T A;  5KPR A;  1GLN A;  2BJV A;  4IBJ A;  4NXM M;  4Z2I A;  2VF7 A;  3KOW E;  4AKG A;  2CHG A;  1E88 A;  1ZV1 A;  3EIH A;  3IEC A;  3SFZ A;  4QHS A;  2K6B A;  4LRS A;  4M9S A;  3UMM A;  1HNW M;  3FUW A;  2OPF A;  3SMS A;  2OQ4 A;  2C96 A;  2QZ4 A;  1QDR A;  1IN4 A;  2EKF A;  3BOS A;  3L26 A;  3U6L A;  1QZM A;  2HKJ A;  3GRY A;  4KO8 A;  2R46 A;  1AIW A;  3WD1 A;  2JCH A;  2F5P A;  1WIV A;  4MB5 A;  3KOX E;  3W0L B;  2UUC M;  1D0K A;  2DWL A;  1O6I A;  1ORY B;  3GRR A;  3E4R A;  3L27 A;  2LHC A;  5IWA M;  1GJS A;  1QO6 A;  1OAI A;  2MJ5 B;  3SBJ A;  2D49 A;  2APL A;  3U6M A;  4NY2 A;  1YU2 A;  3K9O A;  1OGG A;  1UR8 A;  3FTC A;  3GPY A;  4IIW A;  5EXX A;  2WSF F;  2XGN A;  3AV0 A;  3FTE A;  3FRI A;  1D0M A;  4LJA A;  5EP4 A;  3RE8 A;  1FNN A;  1XHB A;  1S3S A;  1V34 A;  4OU7 A;  4IBI A;  4JI6 M;  5EXT A;  4NRW A;  1IY0 A;  4IBF A;  2UUA M;  2O01 F;  1KS0 A;  2Y2H A;  3HON A;  1L2D A;  1IFY A;  1WGN A;  1Z5B A;  2LNH C;  2WSC F;  3GLH A;  4KT0 F;  2LTU A;  4TUW A;  2XFS A;  1E15 A;  2E5L M;  1QZE A;  1NHG C;  2JZ1 A;  1R5L A;  4LJ6 A;  1EIJ A;  4OJ5 A;  4Z6Y A;  1IXS B;  3C3E A;  3PVS A;  4DV0 M;  4NZ5 A;  2YFQ A;  4LF4 M;  3HSH A;  1ED7 A;  2DZO B;  2KA6 B;  2YQZ A;  5ITT A;  1MJG M;  1VEG A;  3JR5 A;  4GHA A;  4GEW A;  4XGI A;  1OIZ A;  3SHF A;  3RGS A;  1N75 A;  1SXJ C;  4GIT A;  1ZMV A;  2W82 A;  3H4J A;  1N33 M;  2FE8 A;  4LF9 M;  1OGB A;  1AUA A;  1OTR A;  1YSY A;  4DR3 M;  2J7O A;  2Y2Q A;  4WP2 A;  4AQY M;  3DOA A;  4FD2 A;  4MB3 A;  2P5T A;  3I4V A;  3WD0 A;  1JR3 D;  2F4V M;  1N77 A;  4JI0 M;  4LF6 M;  4X65 M;  3CTW B;  4JI8 M;  5E6J A;  1L1T A;  2FH0 A;  3T38 A;  4HEO A;  5IZ7 D;  2UXB M;  4YHH M;  3FTD A;  2RGH A;  4FCW A;  2DWM A;  1PJI A;  3U6D A;  3HHY A;  2DAG A;  1MX0 A;  4LZZ A;  4Y28 F;  3GLI B;  2LXE A;  1XXH B;  2FNA A;  4G4R A;  2UXC M;  2KRK A;  3R8F A;  2Y2K A;  3AJI B;  4L4U A;  1G4A E;  4OX9 M;  3HJQ A;  2JWS A;  3SYK A;  1GKI A;  3ZC7 B;  1G3I A;  1SXJ D;  1HT2 E;  1QDT A;  3CF0 A;  3HGI A;  3RGP A;  4PCZ A;  3Q8X A;  4G4Q A;  2BG1 A;  1VG5 A;  2H1R A;  1OQY A;  3GLF E;  2Y2J A;  3U61 B;  2QSF X;  3E9S A;  4XBO A;  1MU5 A;  2Y2O A;  4CIS A;  2CHV A;  4Z2G A;  1XC8 A;  1E6R A;  5FTJ A;  2NQ8 C;  5DNY A;  4NZ4 A;  1SG9 A;  5EP2 A;  2IOU A;  2DAI A;  4BLC A;  1NVM A;  2MH8 A;  3L2A A;  3U5Z B;  2D7H A;  1T3T A;  2LBC A;  1TDZ A;  1G59 A;  2M60 A;  4JV5 M;  1Z5A A;  4L15 A;  3WD2 A;  2X8A A;  4KOD A;  2XZU A;  1UM8 A;  1UR9 A;  4RF1 A;  4D82 A;  3A98 B;  1Z5C A;  4OJO A;  4MGY E;  1IN8 A;  1E32 A;  4OW0 A;  4B7F A;  4RF0 A;  4CIZ A;  1IM2 A;  2JXN A;  4IBB A;  2Y2N A;  4TX8 A;  1DGF A;  4LGY A;  4P17 A;  4B7G A;  3JAM S;  1W5S A;  4HMD A;  3HU1 A;  2QP9 X;  3QWL A;  2UWX A;  1PM5 A;  3OTO M;  4HME A;  2Y2I A;  4OVZ B;  2DXI A;  2V5O A;  2Y2L A;  1T43 A;  2VII A;  3AOE A;  1VDD A;  2XEP A;  2KEB A;  3GRV A;  1HR0 M;  1E9S A;  2RTS A;  5ITU A;  4DUZ M;  1Q02 A;  2Z7J A;  5EP1 A;  1WXQ A;  1KYI A;  4F2L A;  2V1C A;  1G8P A;  3U60 B;  3B7Q A;  4HMC A;  5JI3 E;  1DGB A;  4OJP A;  4I81 A;  4LGM A;  2HAK A;  3N3F A;  2DHR A;  3T1Y M;  2L7I A;  3E46 A;  4IBC A;  1WJ7 A;  2ERC A;  2DZN B;  2MRO B;  2QCU A;  2KZS A;  1D0L A;  4FVM A;  3ZH9 B;  3VLF B;  4PT5 A;  2RGO A;  4FW9 A;  4BBA A;  3J80 S;  3GLF A;  1XMQ M;  4IJF A;  2WZJ A;  3KDS E;  4AG6 A;  4LJ7 A;  1VEJ A;  3BBZ A;  1Z59 A;  2Z8Y M;  1QAM A;  2XH9 A;  1GPF A;  1PJS A;  4F1I A;  1EAK A;  4LF5 M;  1NJG A;  2DWZ B;  2KZU A;  1IY1 A;  3MJ5 A;  1N32 M;  2C99 A;  4JI4 M;  4MGZ E;  4L78 A;  4IBD A;  4Z2J A;  1BVS A;  2VF8 A;  3K8Z A;  1J5E M;  1IQP A;  4IBE A;  3MK6 A;  3GPX A;  4DR4 M;  3M6A A;  3B9P A;  3HU3 A;  3TWK A;  5LMN M;  3VFD A;  2Y2M A;  3FYD A;  5FTL A;  1AIP C;  1J7K A;  4D81 A;  1ZQ9 A;  1CXW A;  3GLI E;  1XXH E;  3BXW A;  2QPA A;  3AKZ A;  1LTM A;  4LF8 M;  2Y20 A;  2Z4S A;  2K47 A;  2XD5 A;  3UZU A;  3W68 A;  1P3Q Q;  3I04 M;  2XSZ A;  1GVN A;  3GQ5 A;  1IBK M;  4FWD A;  1A5T A;  4NC6 A;  1IN5 A;  4JI1 M;  2JZ0 A;  3NWL A;  3LW5 F;  2R62 A;  3A46 A;  4ANR A;  2DEN A;  4DV1 M;  3IG8 A;  1PJJ A;  3DA1 A;  1IXS A;  5EJC A;  3M7P A;  4FWG A;  3GPP A;  2V1U A;  2CEA A;  3HZJ A;  3LCU A;  4CJ6 A;  1I4W A;  3LVW A;  1L2C A;  1DGH B;  1YUB A;  4QOZ C;  1GL7 A;  2R0I A;  2R4E A;  2R6F A;  2OOB A;  2BNK A;  3B74 A;  1NSF A;  1NV9 A;  1XMO M;  2F5Q A;  5FTK A;  2JY6 B;  2K9D A;  3W67 A;  2JY7 A;  1FJG M;  3HKP A;  3FUT A;  4LY6 A;  2N35 A;  1YU3 A;  2R65 A;  3FKE A;  1W1V A;  4QOS A;  4LCB A;  3U6P A;  4M0W A;  2CV2 A;  3KXE C;  1IBM M;  4LF7 M;  3KS8 A;  4B3S M;  3PNY A;  2ZAN A;  2ZTD A;  3K92 A;  1E6N A;  5DYG A;  2YR0 A;  4Z2H A;  2EA0 A;  4NSR A;  1JR3 E;  3AFH A;  3PXG A;  2JP7 A;  3NBX X;  2UXD M;  3KP1 E;  2DKL A;  3VK7 A;  3GLH B;  1NO1 A;  1TGU A;  2D7G A;  1TTE A;  1YLA A;  4S12 A;  3VDU A;  1E94 E;  2FFJ A;  3MMP A;  4M0D A;  5DYI A;  1YU1 A;  2Y2P A;  2C9O A;  2CWB A;  2XFT A;  4DR5 M;  4UN2 B;  3GLI A;  2KNZ A;  3NBI A;  5A2Q S;  3FE3 A;  1KSF X;  2LHG A;  1Q39 A;  1XXH A;  2C9C A;  5KPT A;  1L2B A;  1QAQ A;  1TH2 A;  1VDL A;  2M5Z A;  3C3D A;  3FRH A;  4GH9 A;  4II7 A;  1SXJ E;  4GRI A;  4M9X A;  3W0F A;  3SAV A;  4X62 M;  2CP8 A;  2Q2E B;  2I7P A;  2LH0 A;  3MQL A;  2JY5 A;  3VKH A;  5GKN A;  4G4N A;  1Y8G A;  4OJL A;  2CV0 A;  4FWH A;  3U61 A;  2DHY A;  4MB4 A;  4D80 A;  2AHM A;  3JR4 A;  4M9Z A;  3GRU A;  7CAT A;  2VQE M;  4JI5 M;  3A45 A;  3B7N A;  2DAK A;  4MM3 B;  1VQ1 A;  1IN6 A;  2EO2 A;  2I7N A;  4Z8X A;  4PDG A;  3U6Q A;  4OJ6 A;  3U5Z A;  1T6O A;  2R4J A;  3DZD A;  5DFL A;  1WGL A;  3WHL A;  3WX7 A;  2X4A A;  1V92 A;  4QNM A;  1OFI A;  1W1Y A;  2QHO B;  1LV7 A;  5FTM A;  4RNA A;  4NL4 H;  5C1B A;  2XD1 A;  3CF2 A;  1QUS A;  2J7N A;  3Q8G A;  4PD2 A;  3D8L A;  1L8Q A;  2XF3 A;  5EXP A;  4DV2 M;  1GL6 A;  1K3X A;  4DBG B;  4FCV A;  2QBY A;  4YY3 M;  1DV0 A;  2L4E A;  2Y0T A;  1Q3C A;  3I51 A;  3LQQ A;  4GMQ A;  4DR7 M;  4B3R M;  2UUB M;  1JR3 A;  1HNZ M;  2F5S A;  2RRU A;  1QUT A;  3J7A S;  3K1J A;  4BB9 A;  3WD4 A;  2F5O A;  1J7M A;  4OVZ A;  4QNR A;  1KFV A;  2DWN A;  1D2N A;  1H0I A;  3HHX A;  1E8B A;  2L6O A;  2JA2 A;  2DAM A;  4KLN A;  5EP3 A;  4A3V B;  1GJT A;  2VDB B;  4EIW A;  1OFH A;  1QQW A;  3KOY E;  4NRV A;  3HU2 A;  2LVA A;  2CE7 A;  4LZJ A;  2GNO A;  1UFZ A;  1SXJ A;  4R3D A;  5EXS A;  3FD9 A;  3LVV A;  4LJ9 A;  1OIP A;  4B7H A;  2G5G X;  2CRU A;  3UJN A;  1NNU C;  1EE8 A;  1NV8 A;  4JI2 M;  2KXE A;  3KS4 A;  3LQR A;  4OUI A;  1IXR C;  3FUU A;  2CFO A;  3HJ8 A;  3F92 A;  4QHT A;  1L1Z A;  2V6Z M;  4NSO B;  3AOG A;  1G71 A;  3GLG B;  3T6P A;  4HL4 A;  2LVN C;  4AZF A;  2QQ8 A;  4DR2 M;  1N78 A;  4X64 M;  2X49 A;  8CAT A;  3U6O A;  4Z2K A;  3FYC A;  5EQT A;  1QVR A;  2Z4R A;  4G6Z A;  3TE6 A;  3LMM A;  4R7G A;  2CHQ A;  3SMP A;  5ITY A;  2Z3X A;  4DV7 M;  1DO0 A;  3PFI A;  1VEK A;  1TDH A;  3TQS A;  4DV3 M;  4MGK E;  4HLQ A;  4GKK M;  1EFU B;  1CUK A;  3J2P B;  1TF0 B;  4IJE A;  2C5R A;  3U6S A;  4LJ5 A;  4AW4 A;  3T1H M;  4R71 A;  3QAU A;  4GKJ M;  4K0K M;  3E21 A;  2BWE A;  2OOA A;  1NJF A;  5C18 A;  2CV1 A;  1PJT A;  4AG5 A;  2FFF B;  3KOZ E;  4AI6 A;  1OKS A;  2KDL A;  1R2Z A;  1E6P A;  1HT1 E;  3B89 A;  3TWL A;  3GLF B;  1YUE A;  1PGY A;  2JUJ A;  2KRU A;  2L4F A;  4LRT A;  4NOO B;  3SYL A;  2KNV A;  5BR8 M;  4ITQ A;  1H0G A;  5KQD A;  3KSX A;  3WHK A;  1CK7 A;  2FS1 A;  1DGH A;  3KW6 A;  3IHP A;  1HJP A;  3K9P A;  5H37 D;  3THG A;  4DR1 M;  1DGG A;  3HY5 A;  4MGI E;  2RKO A;  2XZF A;  1GO5 A;  3AL0 C;  2EUC A;  3EIE A;  1WHC A;  2R18 A;  4W5W A;  5ITR A;  3C58 A;  1JQJ C;  1GAB A;  1HQC A;  4LFA M;  4MB7 A;  4NXN M;  4XK8 F;  2MGW A;  2GQF A;  4PDI A;  5KO3 A;  4B3T M;  5FSW A;  3R9X B;  4L6V 6;  3SHG B;  5JI2 E;  1WR1 B;  3QYB A;  2G3Q A;  2DZL A;  3SAR A;  5ITX E;  1MN3 A;  3UGJ A;  3GQ4 A;  4KHP M;  1YU4 A;  2JE5 A;  3KP0 E;  1QYR A;  4JYA M;  3B7Z A;  1V33 A;  3CGW A;  4MH0 E;  1GOI A;  2L2D A;  3KVW A;  4FCT A;  2FN2 A;  4ZPX A;  2MR9 A;  3M7G A;  3SC3 A;  3HX3 A;  1Q3B A;  2A5Y B;  3H4M A;  3I4Y A;  2JNH A;  2C98 A;  1IN7 A;  2KHH A;  1I94 M;  2KW0 A;  4I4L A;  1IBL M;  2B3T A;  1NY5 A;  2HHH M;  3AOE C;  4GC9 A;  3VKG A;  1QAN A;  1NY6 A;  1OJL A;  1XWI A;  4B08 A;  3L29 A;  4GC5 A;  4IBK A;  3RFW A;  2Y21 A;  3LCV B;  3U6C A;  2F5N A;  4WUR A;  1TR8 A;  5ITQ A;  2D7E A;  2R44 A;  5LMU M;  2G8L A;  2K0B X;  1R6B X;  2DNA A;  3HHZ A;  1W1T A;  4Z2L A;  3GLG E;  3ZCB B;  3SAW A;  1JB0 F;  4DR6 M;  3HHW A;  1R2Y A;  2O25 A;  4LJ4 A;  3T15 A;  1E9R A;  3CF6 E;  3I01 M;  4CGY B;  1K82 A;  1E6Z A;  4I8O A;  1X37 A;  3J7B A;  1PJQ A;  2XLJ A;  2DI0 A;  2JY8 A;  1W1P A;  2O5R A;  1J09 A;  3IG5 A;  4JI7 M;  2DVW B;  2Y2G A;  4AKH A;  5BPV A;  5KQ8 A;  2ZTC A;  4RKU F;  4LFC M;  4LG2 A;  3D8B A;  2KNA A;  2ZAO A;  3TL4 X;  4REZ A;  2HL7 A;  1ZMW A;  1DO2 A;  3FTF A;  4JXJ A;  2ZAM A;  2LVQ D;  5ITX A;  1R4G A;  4X66 M;  3GP1 A;  4NYU A;  5IRE B;  1OAO C;  2QNJ A;  5KPZ A;  4Q7J A;  3FUV A;  1GXD A;  4P16 A;  1C7Y A;  3C9P A;  4L16 A; 
#chains in the Genus database with same CATH homology
 1N34 M;  3TPZ A;  4MGH A;  3SAS A;  3J81 S;  3ILK A;  3TWM A;  5FLX S;  2L09 A;  2BJW A;  5IT9 S;  1IXZ A;  3UK6 A;  3U6E A;  1R7R A;  3VK8 A;  2YNM D;  4AKI A;  3M0E A;  2R45 A;  2UU9 M;  2ZBK B;  1HQY E;  3HJS A;  3DFZ A;  4IBG A;  2FOI C;  2LWX A;  3U60 A;  4WW0 A;  2Y0Q A;  4L8R C;  4QNL A;  2VQF M;  3J27 B;  1Z6T A;  1XNR M;  5FTN A;  1YU0 A;  1N36 M;  4DV5 M;  4JN6 A;  4NZ3 A;  4DV4 M;  4NZ1 A;  4I5S A;  3SAU A;  4GIP A;  3PNV A;  3GO8 A;  1K3W A;  2CUZ A;  2QBY B;  4LG2 A;  3GLG A;  3KFU G;  1NHW C;  1G41 A;  5E26 A;  4B3M M;  1HNX M;  4GHL A;  1QAO A;  3FUX A;  4LJ8 A;  3VDP A;  4G4O A;  2ZM6 M;  1C1K A;  3GPU A;  1NNJ A;  4JI3 M;  3L25 A;  4DUY M;  3K2L A;  2HCB A;  5F3W A;  1XNQ M;  1YE9 A;  1H6U A;  1TH3 A;  2L7H A;  3A42 A;  3GQ3 A;  3SAT A;  2XSZ D;  1ZAE A;  3KSJ A;  4NYY A;  3HWS A;  2QEN A;  4CHT B;  1TH4 A;  4LFB M;  3MHV C;  1SXJ B;  3L28 A;  1IY2 A;  4DV6 M;  5KPR A;  4NXM M;  1W5T A;  1GLN A;  2BJV A;  4IBJ A;  3KOW E;  4AKG A;  2CHG A;  3EIH A;  3SFZ A;  4QHS A;  4LRS A;  4M9S A;  3UMM A;  1HNW M;  3FUW A;  2OPF A;  3SMS A;  2OQ4 A;  2C96 A;  2QZ4 A;  1IN4 A;  3BOS A;  3L26 A;  3U6L A;  1QZM A;  2HKJ A;  3GRY A;  4KO8 A;  2R46 A;  2JCH A;  2F5P A;  3KOX E;  3W0L B;  2UUC M;  2DWL A;  1ORY B;  3GRR A;  3L27 A;  3E4R A;  5IWA M;  3SBJ A;  3U6M A;  4NY2 A;  1YU2 A;  3FTC A;  3GPY A;  4IIW A;  5EXX A;  2XGN A;  3AV0 A;  3FTE A;  4LJA A;  5EP4 A;  3RE8 A;  1FNN A;  1XHB A;  1S3S A;  4OU7 A;  4IBI A;  4JI6 M;  5EXT A;  4NRW A;  1IY0 A;  4IBF A;  2UUA M;  2Y2H A;  3HON A;  1L2D A;  1Z5B A;  2LNH C;  3GLH A;  4TUW A;  2XFS A;  2E5L M;  1NHG C;  4LJ6 A;  4OJ5 A;  4Z6Y A;  1IXS B;  3PVS A;  4DV0 M;  4NZ5 A;  2YFQ A;  4LF4 M;  3HSH A;  2DZO B;  2KA6 B;  2YQZ A;  5ITT A;  3JR5 A;  4GHA A;  4XGI A;  3SHF A;  3RGS A;  1N75 A;  1SXJ C;  4GIT A;  2W82 A;  1N33 M;  2FE8 A;  4LF9 M;  1YSY A;  4DR3 M;  2J7O A;  2Y2Q A;  4AQY M;  3DOA A;  4FD2 A;  2P5T A;  3I4V A;  1JR3 D;  2F4V M;  1N77 A;  4JI0 M;  4LF6 M;  4X65 M;  3CTW B;  4JI8 M;  5E6J A;  1L1T A;  3T38 A;  5IZ7 D;  2UXB M;  4YHH M;  3FTD A;  2RGH A;  4FCW A;  2DWM A;  1PJI A;  3U6D A;  3HHY A;  1MX0 A;  4LZZ A;  3GLI B;  2LXE A;  1XXH B;  2FNA A;  4G4R A;  2UXC M;  2KRK A;  3R8F A;  2Y2K A;  3AJI B;  4L4U A;  1G4A E;  4OX9 M;  3HJQ A;  3SYK A;  1GKI A;  3ZC7 B;  1G3I A;  1SXJ D;  1HT2 E;  3RGP A;  3CF0 A;  3HGI A;  4PCZ A;  4G4Q A;  3Q8X A;  2BG1 A;  2H1R A;  2Y2J A;  3U61 B;  3E9S A;  4XBO A;  1MU5 A;  2Y2O A;  4CIS A;  2CHV A;  1XC8 A;  5FTJ A;  2NQ8 C;  5DNY A;  4NZ4 A;  5EP2 A;  2IOU A;  4BLC A;  1NVM A;  3L2A A;  3U5Z B;  1TDZ A;  2D7H A;  1T3T A;  1G59 A;  4JV5 M;  2Y2G A;  2M60 A;  1Z5A A;  4L15 A;  2X8A A;  4KOD A;  2XZU A;  1UM8 A;  4RF1 A;  4D82 A;  3A98 B;  1Z5C A;  4OJO A;  4MGY E;  1IN8 A;  1E32 A;  4OW0 A;  4B7F A;  4RF0 A;  2Y2N A;  1IM2 A;  4IBB A;  1DGF A;  4LGY A;  4B7G A;  3JAM S;  1W5S A;  3HU1 A;  2QP9 X;  3QWL A;  2UWX A;  1PM5 A;  3OTO M;  2Y2I A;  4OVZ B;  2DXI A;  2Y2L A;  2VII A;  3AOE A;  1VDD A;  2XEP A;  2KEB A;  3GRV A;  1E9S A;  5ITU A;  4DUZ M;  2Z7J A;  5EP1 A;  1WXQ A;  1KYI A;  2V1C A;  1G8P A;  3U60 B;  5JI3 E;  1DGB A;  4OJP A;  4I81 A;  4LGM A;  3N3F A;  2DHR A;  3T1Y M;  2L7I A;  4IBC A;  1HR0 M;  2ERC A;  2QCU A;  2DZN B;  3ZH9 B;  2F5Q A;  2KZS A;  3GLF A;  4FVM A;  3VLF B;  4PT5 A;  2RGO A;  4FW9 A;  4BBA A;  3J80 S;  1XMQ M;  4IJF A;  3KDS E;  4AG6 A;  4LJ7 A;  1Z59 A;  1QAM A;  2XH9 A;  4LF5 M;  1NJG A;  2DWZ B;  2KZU A;  1IY1 A;  3MJ5 A;  1N32 M;  2C99 A;  4JI4 M;  4MGZ E;  4L78 A;  4IBD A;  3K8Z A;  1J5E M;  1IQP A;  4IBE A;  3MK6 A;  3GPX A;  4DR4 M;  3M6A A;  3B9P A;  3HU3 A;  3TWK A;  5LMN M;  3VFD A;  2Y2M A;  3FYD A;  5FTL A;  1J7K A;  4D81 A;  1ZQ9 A;  2QPA A;  3AKZ A;  4LF8 M;  2Y20 A;  2Z4S A;  2K47 A;  2XD5 A;  3UZU A;  2XSZ A;  1GVN A;  3GQ5 A;  1IBK M;  4FWD A;  1IN5 A;  4JI1 M;  3NWL A;  2R62 A;  3A46 A;  4DV1 M;  3IG8 A;  1PJJ A;  3DA1 A;  5EJC A;  4FWG A;  3GPP A;  2V1U A;  2CEA A;  1I4W A;  3LVW A;  1L2C A;  1DGH B;  1YUB A;  4QOZ C;  1GL7 A;  2R4E A;  2BNK A;  1NSF A;  1XMO M;  5FTK A;  1FJG M;  3HKP A;  3FUT A;  4LY6 A;  1YU3 A;  2R65 A;  3FKE A;  4QOS A;  4LCB A;  3U6P A;  4M0W A;  2CV2 A;  3KXE C;  1IBM M;  4LF7 M;  3KS8 A;  4B3S M;  3PNY A;  2ZAN A;  3K92 A;  5DYG A;  2YR0 A;  2EA0 A;  4NSR A;  3AFH A;  3PXG A;  2UXD M;  3KP1 E;  3VK7 A;  3GLH B;  1TGU A;  2D7G A;  4S12 A;  3VDU A;  1E94 E;  2FFJ A;  2Y2P A;  4M0D A;  5DYI A;  1YU1 A;  2C9O A;  2XFT A;  4DR5 M;  3GLI A;  3NBI A;  5A2Q S;  1KSF X;  1Q39 A;  1XXH A;  2C9C A;  5KPT A;  1L2B A;  1QAQ A;  1TH2 A;  2M5Z A;  4M9X A;  4GH9 A;  4II7 A;  3W0F A;  3SAV A;  1SXJ E;  4GRI A;  4X62 M;  2Q2E B;  2I7P A;  2LH0 A;  3VKH A;  5GKN A;  4G4N A;  4OJL A;  2CV0 A;  4FWH A;  3U61 A;  4D80 A;  2AHM A;  3JR4 A;  4M9Z A;  3GRU A;  7CAT A;  2VQE M;  4JI5 M;  3A45 A;  4MM3 B;  4OJ6 A;  1IN6 A;  2EO2 A;  2I7N A;  4Z8X A;  4PDG A;  3U6Q A;  3U5Z A;  3WHL A;  2R4J A;  3DZD A;  3WX7 A;  2X4A A;  4QNM A;  1OFI A;  5FTM A;  1LV7 A;  4RNA A;  4NL4 H;  5C1B A;  2XD1 A;  3CF2 A;  2J7N A;  4PD2 A;  3D8L A;  1L8Q A;  2XF3 A;  5EXP A;  4DV2 M;  1GL6 A;  1K3X A;  4FCV A;  2QBY A;  4YY3 M;  2Y0T A;  1Q3C A;  3I51 A;  3LQQ A;  4GMQ A;  4DR7 M;  4B3R M;  2UUB M;  1JR3 A;  1HNZ M;  2F5S A;  3J7A S;  3K1J A;  4BB9 A;  2F5O A;  4OVZ A;  4QNR A;  1KFV A;  2DWN A;  1D2N A;  3HHX A;  2L6O A;  2JA2 A;  4KLN A;  5EP3 A;  4A3V B;  4EIW A;  1OFH A;  1QQW A;  3KOY E;  4NRV A;  3HU2 A;  2CE7 A;  4LZJ A;  1SXJ A;  4R3D A;  5EXS A;  3FD9 A;  3LVV A;  4LJ9 A;  4B7H A;  2G5G X;  3UJN A;  1NNU C;  1EE8 A;  4JI2 M;  2KXE A;  3KS4 A;  3LQR A;  4OUI A;  1IXR C;  3FUU A;  2CFO A;  3HJ8 A;  4QHT A;  1L1Z A;  2V6Z M;  4NSO B;  3AOG A;  3GLG B;  4DR2 M;  4HL4 A;  4AZF A;  1N78 A;  4X64 M;  2X49 A;  8CAT A;  3U6O A;  3FYC A;  5EQT A;  1QVR A;  2Z4R A;  4G6Z A;  3TE6 A;  3LMM A;  4R7G A;  2CHQ A;  3SMP A;  5ITY A;  2Z3X A;  4DV7 M;  1DO0 A;  3PFI A;  3TQS A;  1TDH A;  4DV3 M;  4MGK E;  4HLQ A;  4GKK M;  3J2P B;  4IJE A;  2C5R A;  3U6S A;  4LJ5 A;  4AW4 A;  3T1H M;  4GKJ M;  3QAU A;  4K0K M;  1NJF A;  5C18 A;  2CV1 A;  4AG5 A;  2FFF B;  3KOZ E;  4AI6 A;  1R2Z A;  1HT1 E;  3TWL A;  3GLF B;  1YUE A;  2KRU A;  4ITQ A;  4LRT A;  4NOO B;  3SYL A;  5BR8 M;  5KQD A;  3KSX A;  3WHK A;  1DGH A;  3KW6 A;  5H37 D;  3THG A;  4DR1 M;  1DGG A;  2XZF A;  4MGI E;  2RKO A;  3AL0 C;  2EUC A;  3EIE A;  2R18 A;  5ITR A;  4W5W A;  3C58 A;  1JQJ C;  1HQC A;  4LFA M;  4MB7 A;  4NXN M;  4PDI A;  5KO3 A;  4B3T M;  5FSW A;  3R9X B;  3SHG B;  5JI2 E;  3SAR A;  4KHP M;  5ITX E;  3UGJ A;  3GQ4 A;  1YU4 A;  2JE5 A;  3KP0 E;  1QYR A;  4JYA M;  4MH0 E;  3KVW A;  4FCT A;  4ZPX A;  3M7G A;  3SC3 A;  1Q3B A;  2A5Y B;  3H4M A;  3I4Y A;  2C98 A;  1IN7 A;  1I94 M;  2KW0 A;  4I4L A;  1IBL M;  2HHH M;  1NY5 A;  3AOE C;  4GC9 A;  3VKG A;  1QAN A;  1NY6 A;  1OJL A;  1XWI A;  4B08 A;  3L29 A;  4GC5 A;  4IBK A;  3RFW A;  2Y21 A;  3U6C A;  2F5N A;  4WUR A;  5ITQ A;  5LMU M;  2D7E A;  2G8L A;  1R6B X;  3HHZ A;  3ZCB B;  3SAW A;  4DR6 M;  3HHW A;  1R2Y A;  3T15 A;  4LJ4 A;  1E9R A;  3CF6 E;  1K82 A;  4CGY B;  4I8O A;  1X37 A;  3J7B A;  2XLJ A;  2O5R A;  1J09 A;  3IG5 A;  4JI7 M;  2DVW B;  4AKH A;  5BPV A;  5KQ8 A;  4LFC M;  3D8B A;  2ZAO A;  3TL4 X;  4REZ A;  2HL7 A;  3FTF A;  1DO2 A;  4JXJ A;  2ZAM A;  5ITX A;  4X66 M;  3GP1 A;  4NYU A;  5IRE B;  5KPZ A;  3FUV A;  4P16 A;  4L16 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...