4LG2A

Crystal structure of reston ebola virus vp35 rna binding domain bound to 12-bp dsrna
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
122
structure length
122
Chain Sequence
ISAKDLKEIMYDHLPGFGTAFHQLVQVICKIGKDNNLLDTIHAEFQASLADGDSPQCALIQITKRVPIFQDVPPPIIHIRSRGDIPRACQKSLRPAPPSPKIDRGWVCLFKMQDGKTLGLKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polymerase cofactor
publication title Ebolavirus VP35 coats the backbone of double-stranded RNA for interferon antagonism.
pubmed doi rcsb
source organism Reston ebolavirus
molecule tags Rna binding protein/rna
total genus 38
structure length 122
sequence length 122
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4lg2A01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4lg2A02
3L28A 3L25A 4IBDA 3KS8A 4IBFA 4IBJA 3L26A 4GHAA 3FKEA 4IJFA 4IBEA 4GH9A 3L27A 3KS4A 4IBCA 4LG2A 4IBIA 3L2AA 4GHLA 3L29A 4IBKA 4IBBA 4IBGA 4IJEA 5BPVA
chains in the Genus database with same CATH superfamily
1TDHA 3THGA 3CGWA 2Y2IA 2CHQA 1K3WA 4OU7A 1IQPA 3FTDA 4G4RA 1QZMA 2LH0A 1ZQ9A 1J09A 4M9ZA 2D7EA 4UN2B 1SXJA 4AKGA 2C99A 1P3QQ 1L2BA 4RF0A 3L26A 2CV1A 4MGYE 2KRKA 3U6SA 3BBZA 1SXJB 2LNHC 4M9XA 5IZ7D 3ZQJA 5ITXE 1XNRM 1PJQA 3QYEA 2UU9M 1XNQM 5IREB 4Z2LA 4FCTA 1G59A 4LF8M 3U6LA 3OTOM 4B3SM 3LW5F 4R71A 4S12A 1VEJA 1NHWC 4LFBM 2QBYA 4LGMA 1KS0A 4NRWA 2XD5A 2MH8A 4JI4M 4G3OA 4AZFA 3ZH9B 1D0MA 5F3WA 3E9SA 4Z6YA 4DR1M 1HT1E 2V6ZM 2QBYB 2JP7A 3SMSA 2JUJA 2DAKA 5H37D 3SAWA 3J7AS 3SAUA 1SXJC 3U6QA 3HX3A 3J7BA 1YU3A 1Z5BA 2JY8A 4JI7M 5EP3A 2JWSA 3K2LA 1X37A 4GRIA 2VF8A 3GPYA 2HL7A 2BJWA 3VK8A 3HU3A 2DWLA 1O6IA 4X65M 2C5RA 1FNNA 2EKFA 1E88A 5GKNA 2I7NA 2JY6B 2LHCA 1LV7A 2OPFA 2FN2A 1V92A 2KA6B 1WIVA 2Y0QA 4JI6M 3SAVA 3GLFE 4JI1M 2DAGA 2J5YA 4FCVA 5KQDA 2N35A 2XSZD 2V1UA 1TDZA 4LJ5A 4FD2A 2FS1A 3PXGA 3K92A 4MGIE 3AL0C 2W82A 2MR9A 4D82A 4HMDA 2QQ8A 3U6DA 1HNZM 1OTRA 2Y2MA 4OJLA 2QHOB 1I94M 2BWEA 1OAOC 3I51A 4LF6M 3MK6A 2EA0A 5EXPA 5KQ8A 5EXXA 1DGHB 1NHGC 1QDTA 1QAQA 2M5ZA 2QP9X 4JI8M 3GLGB 3IHPA 3K9PA 3SFZA 1K3XA 2UXBM 1G4AE 4P16A 3U6PA 1OGGA 4OVZA 1Q39A 3Q8GA 1XXHE 2HKJA 2OQ4A 3CTWB 4QNMA 4D80A 5KPTA 2OO9A 2V1CA 1PJJA 4RNAA 2BNKA 2CHGA 1RU3A 4OVZB 4IBKA 2WSFF 4IBBA 2EJSA 3F92A 4TX8A 3PVSA 1ZAEA 2BWBA 1WXQA 3W68A 2CRUA 5BPVA 5DNYA 3GO8A 2Z4SA 3GLHE 2LHGA 4FWHA 3VFDA 2CV2A 4AKIA 2CP8A 4QHSA 2Z7JA 1JB0F 1ZMWA 2DZOB 8CATA 3BXWA 1IXZA 3IG8A 1N34M 5FTNA 2KZSA 3B7QA 4F1IA 3U6OA 3A42A 4Z2KA 4G4OA 1Z6TA 3DA1A 3TWKA 3A46A 3FUXA 2H1RA 2L09A 2L4EA 2QSFX 1TH2A 2UUBM 4ZPXA 4NZ5A 4MB7A 2RTSA 2IOUA 3T1HM 1KFVA 1R5LA 5EQTA 4MB4A 2XFSA 4MH0E 2R62A 1V34A 2G3QA 3FUTA 3GRYA 4M9SA 4XGIA 4OUIA 2RGOA 2Y2PA 2XGNA 3U6MA 4MB5A 1N75A 4PDGA 3EIEA 3FUWA 4GC9A 1BVSA 3NBIA 4IJEA 3TPZA 3HJQA 3I01M 5FTJA 4AI6A 1QUSA 1GABA 2DAIA 5EP2A 3EIHA 4PCZA 3KSXA 3B9PA 1DGBA 4D81A 1OIPA 1E32A 2WSCF 3KVWA 3VDUA 2D7HA 3SHGB 3GP1A 1EFUB 1FJGM 2P5TA 3AFHA 4QNRA 1TGUA 1AUAA 3HHWA 2HAKA 1N36M 4NYYA 4IBFA 3UJNA 2X49A 2F5QA 1WGNA 2R44A 1E15A 2LVQD 3FRHA 4R3DA 2HWJA 1IN5A 1E6NA 2G5GX 3PNVA 2XLJA 4M0DA 1E6ZA 1QZEA 2A5YB 1T6OA 1L6JA 1TF0B 3FUUA 2R0IA 4GHLA 2L2DA 3U6CA 2R6FA 4FCWA 3UZUA 4NZ1A 2LVNC 5FLXS 3FTEA 3R9XB 1L2DA 4HEOA 1YU0A 3VKHA 2K0BX 1Q3BA 2QCUA 3LVVA 3IG5A 4G6ZA 5EP4A 4DUYM 3WD3A 1ZMVA 2DVWB 2Y21A 2LTUA 2JY7A 3SYKA 4NOOB 1KYIA 5C1BA 1OJLA 3GQ4A 4DR5M 1GL6A 1IXSB 3PNYA 4NSOB 4PDIA 5ITXA 3K8ZA 4F2LA 1G3IA 2YFQA 1R2ZA 1OFHA 1E9SA 3M0EA 4JI3M 1UM8A 1CK7A 2K6BA 2QENA 4DV4M 4II7A 4LRSA 1IM2A 3TL4X 2XD1A 3C3DA 4NY2A 2DAEA 2FFFB 1H8PA 1A5TA 2R45A 4PT5A 2ZM6M 3AOEA 3L29A 4OJPA 3VK7A 2XSZA 2YNMD 4K0KM 2Y2OA 4MB3A 2ZTDA 3J27B 1EAKA 1QUTA 1NV8A 3TWMA 3D8BA 4G4NA 2KHHA 3AOGA 3WHLA 3LCUA 4LJ4A 4NSRA 4MGKE 1YU2A 3M7GA 4AKHA 2FNAA 4LRTA 1WHCA 3K1JA 3SASA 2XF3A 1QO6A 4B08A 3WX7A 3GLFA 4WURA 4LJ6A 5KO3A 3HHZA 1Q02A 1JR3A 1W5SA 1SXJE 5LMUM 4DV2M 4IBCA 3GLFB 4DV5M 3KP0E 1PGYA 5C18A 3L2AA 3AOEC 2Y2GA 3C9PA 4Z8XA 4A3VB 4LJAA 3KFUG 1UR8A 2JCHA 2R18A 1SG9A 4IIWA 2OOAA 2UUCM 1F4IA 2RGHA 1C7YA 2L7HA 2OOBA 3HSHA 2I7PA 2YQZA 2XEPA 3UMMA 3MJ5A 4LFCM 1DGHA 2M60A 4KO8A 1GPFA 1AIWA 1SXJD 4DR6M 1PDCA 3I4VA 4AG5A 3GLGA 1QDRA 3TQSA 2XZFA 3KDSE 2KRUA 1OFIA 1IN7A 2UUAM 4GHAA 4KODA 4NXNM 2VF7A 4GMQA 3MQLA 3H4MA 4GKKM 1WR1B 2R65A 1IY1A 3HZJA 3U5ZA 3DZDA 4G4QA 4LCBA 5FTMA 1NO1A 1N33M 2Z8YM 3WD1A 4ITQA 1XMOM 3LMMA 5BR8M 3CF6E 3HJSA 4ANRA 3U5ZB 3SC3A 2YR0A 2FE8A 4LF9M 1DO2A 2KW0A 4WW0A 4B3TM 3A98B 4FWDA 1IN6A 3L28A 4HMCA 3DOAA 3ZCBB 4GC5A 1WJ7A 4LF7M 1HNWM 1UFZA 1OKSA 1W1YA 3TE6A 4OJ6A 3GRUA 4JN6A 4L15A 4EIWA 4LJ7A 3M6AA 3WHKA 3NBXX 3GLIA 2ZBKB 4BLCA 1KSFX 1L1TA 3QWLA 3HHYA 1NJFA 5KPZA 2DZNB 1PJIA 4KHPM 1J7KA 1DO0A 1T43A 4DV6M 3ILKA 1MX0A 3GPXA 1PJTA 3GLIB 2Y2NA 2J7OA 3W0LB 1VQ1A 1PM5A 2F5OA 3SBJA 3J80S 2FOIC 2GQFA 4I8OA 3K9OA 3WD4A 3SATA 2C9CA 3RFWA 2DWMA 2Y2QA 3MMPA 3KP1E 2DENA 1H6UA 1LTMA 5IWAM 5FTLA 1IBMM 4DV3M 1N78A 4NZ4A 3HY5A 2L7IA 3WD0A 4I5SA 1Q3CA 2Z3XA 2UXDM 3SHFA 3C3EA 1Z59A 2ZTCA 1IXRC 2Y2JA 4W5WA 1JQJC 4OX9M 2F5NA 4Z2IA 1QVRA 3HU1A 1IBKM 4JV5M 2CUZA 2R4EA 2B3TA 2LXEA 2BG1A 2XH9A 3FKEA 1WGLA 3VKGA 4IBEA 3RGPA 5EXSA 4GEWA 3W0FA 1IFYA 2ZANA 1IBLM 1Y8GA 1YU1A 1VEGA 2K9DA 2R46A 3QYBA 1MN3A 3DFZA 4NXMM 1GJTA 4AG6A 2D7GA 4CISA 4R7GA 1E8BA 2QNJA 1ZV1A 2XZUA 2LVOC 2NQ8C 1MU5A 4B7GA 1QYRA 1YLAA 4Z2GA 3JAMS 1YSYA 3E4RA 1S3SA 1XB2B 2DAMA 1G8PA 1HQCA 1IXSA 1XWIA 2GNOA 5DYGA 1L1ZA 1E6RA 1IY0A 1DGGA 4LZJA 3E21A 4IBDA 4DBGB 2LVAA 1YUBA 1W1VA 2C96A 3LQRA 3FTFA 2VQFM 1GOIA 5ITRA 3HJ8A 1K82A 1HNXM 3FD9A 2JXNA 3HGIA 4TUWA 1W1TA 4LZZA 2X8AA 3B89A 2L6OA 3RE8A 1D0LA 2MJ5B 4B7HA 1PRBA 3Q8XA 2UXCM 3L27A 2DHYA 2BJVA 4GITA 4NRVA 3ZC7B 2DKLA 4LF4M 1NY6A 4LG2A 3UK6A 1XC8A 2EO2A 2LVPC 5ITQA 1R2YA 4OJOA 1ED7A 1TH3A 4KT0F 3VDPA 4LJ8A 1R4GA 2Q2EB 1DV0A 1OIZA 1OGBA 1NV9A 1IN8A 2CFOA 5EXTA 2D49A 4DR2M 2V5OA 1J5EM 1E94E 2G8LA 1IY2A 4RKUF 2J7NA 3I04M 1D0KA 3BOSA 5FTKA 1DGFA 1W5TA 3SARA 2O25A 3CF0A 4DR3M 1GLNA 4GIPA 4L78A 1NY5A 4DUZM 3A45A 2JZ1A 5ITYA 4HMEA 5FSWA 2JA2A 2F4VM 3LVWA 5JI3E 2F5PA 3LCVB 1VEKA 2X4AA 2EKKA 4B3RM 2DWZB 4LY6A 2EUCA 3FRIA 1ORYB 4Q7JA 4RF1A 1D2NA 1I4WA 4LJ9A 2ZAMA 4CHTB 4LF5M 3KOYE 1GL7A 3HHXA 5EP1A 4QOZC 4NL4H 1E9RA 2K47A 2Y2HA 2RKOA 4I81A 4L16A 4AW4A 4X62M 1MJGM 5E6JA 4QHTA 3MHVC 1CUKA 1OAIA 1PJSA 1NSFA 4L4UA 4YY3M 2ZAOA 5ITTA 3VLFB 1N32M 2UWXA 3KS8A 4JYAM 4NC6A 3T15A 1OQYA 4Y28F 1XXHA 2F5SA 1HT2E 4HL4A 4MGHA 1J7MA 4IJFA 1TR8A 4BBAA 1HR0M 3W67A 1GVNA 3FUVA 4BB9A 2HHHM 1XXHB 2KNZA 2DWNA 1C1KA 2WZJA 3GQ3A 4FWGA 3GLHA 5L8RF 1HJPA 1JR3E 2Y20A 4LGYA 1T3TA 4LFAM 4CIZA 1GO5A 1UR9A 2C9OA 3FYDA 2Y2LA 4AQYM 2H5XA 3KOWE 4PD2A 1GKIA 2CHVA 3GLHB 3HU2A 2LBCA 1NNJA 3U60A 3UGJA 1YE9A 4OW0A 3J81S 2CWBA 2ERCA 3GRVA 4XK8F 5DYIA 1NVMA 3KOXE 3U60B 2QPAA 2JZ0A 3T1YM 2HCBA 2E5LM 1Z5AA 4P17A 1JR3D 5IT9S 2DNAA 1IN4A 2CE7A 1GJSA 1W1PA 2JNHA 3GLGE 1TTEA 3HKPA 1H0IA 1CXWA 2O5RA 4FVMA 3GPPA 2WSEF 3CF2A 1R7RA 4IBIA 2JE5A 3NWLA 4X64M 5LMNM 2KNAA 1R6BX 2KNVA 3LQQA 4MGZE 4FW9A 4IBGA 4JXJA 3SMPA 3I4YA 4DV0M 2DI0A 2KDLA 3KSJA 4NYUA 4REZA 5E26A 3RGSA 2AHMA 2FH0A 3AV0A 2C98A 4L8RC 2XFTA 2LWXA 3B7NA 4B7FA 2O01F 2DHRA 2KZUA 2VDBB 2VQEM 3L25A 1VDDA 1ZMUA 1QANA 3SYLA 3HWSA 1QQWA 2KEBA 4HLQA 1V33A 1EE8A 4B3MM 1HQYE 3H4JA 3M7PA 3WD2A 7CATA 5KPRA 1EIJA 1NJGA 1G41A 3GQ5A 5ITUA 4WP2A 3QAUA 3GLIE 4I4LA 1VDLA 3B7ZA 1G71A 4XBOA 3PFIA 5EJCA 3U6EA 1AIPC 3JR4A 4Z2JA 4DR4M 4CGYB 4X66M 2R4JA 2Y2KA 4OJ5A 3IECA 5JI2E 4QNLA 1NNUC 3KXEC 2RRUA 2Y0TA 2VIIA 3AJIB 1QAMA 4DV7M 3T38A 4NZ3A 3AKZA 1GXDA 2MROB 1L8QA 2KXEA 2DZLA 5DFLA 3T6PA 3U61A 2MGWA 4L6V6 2APLA 2CEAA 3KW6A 4YHHM 3V76A 1N77A 3GPUA 3JR5A 3GRRA 3U61B 2DXIA 4JI2M 3TWLA 1H0GA 4IBJA 4KLNA 1XHBA 5A2QS 4DV1M 1YU4A 3FYCA 4GH9A 2L4FA 3KS4A 2Z4RA 4MM3B 4JI0M 3D8LA 3FTCA 1Z5CA 4M0WA 3N3FA 4QOSA 3KOZE 1VG5A 2QZ4A 3E46A 2FFJA 4DR7M 1QAOA 3R8FA 1L2CA 4CJ6A 1YUEA 4JI5M 1E6PA 1TH4A 3C58A 4Z2HA 3J2PB 1XMQM 2CV0A 3B74A 4GKJM 3HONA 2JY5A 3FE3A
chains in the Genus database with same CATH topology
1TDHA 3THGA 2Y2IA 2CHQA 1K3WA 4OU7A 1IQPA 3FTDA 4G4RA 1QZMA 2LH0A 1ZQ9A 1J09A 4M9ZA 2D7EA 4AKGA 1SXJA 2C99A 1L2BA 4RF0A 3L26A 2CV1A 4MGYE 2KRKA 3U6SA 4M9XA 1SXJB 2LNHC 5IZ7D 1XNRM 5ITXE 2UU9M 1XNQM 5IREB 4FCTA 1G59A 4LF8M 3U6LA 3OTOM 4B3SM 4S12A 1NHWC 4LFBM 2QBYA 4LGMA 4NRWA 2XD5A 4JI4M 4AZFA 3ZH9B 5F3WA 3E9SA 4Z6YA 4DR1M 1HT1E 2V6ZM 2QBYB 3SMSA 3SAWA 5H37D 3J7AS 1YU3A 3SAUA 1SXJC 3J7BA 1Z5BA 4JI7M 5EP3A 3K2LA 1X37A 4GRIA 3GPYA 3VK8A 2HL7A 2BJWA 3HU3A 2DWLA 4X65M 2C5RA 1FNNA 5GKNA 2I7NA 1LV7A 2OPFA 2KA6B 2Y0QA 4JI6M 3SAVA 4JI1M 4FCVA 5KQDA 2XSZD 2V1UA 1TDZA 4LJ5A 4FD2A 3PXGA 3K92A 4MGIE 3AL0C 2W82A 4D82A 3U6DA 1HNZM 2Y2MA 4OJLA 1I94M 3I51A 4LF6M 3MK6A 2EA0A 5EXPA 5KQ8A 5EXXA 1DGHB 1NHGC 2QP9X 1QAQA 2M5ZA 4JI8M 3GLGB 1K3XA 3SFZA 2UXBM 1G4AE 4P16A 3U6PA 4OVZA 1Q39A 2HKJA 2OQ4A 3CTWB 4QNMA 4D80A 5KPTA 2V1CA 1PJJA 4RNAA 2BNKA 2CHGA 4OVZB 4IBKA 4IBBA 3PVSA 1ZAEA 5BPVA 1WXQA 3GO8A 5DNYA 2CV2A 2Z4SA 3VFDA 4FWHA 4AKIA 4QHSA 2Z7JA 2DZOB 8CATA 1IXZA 3IG8A 1N34M 5FTNA 2KZSA 3U6OA 3A42A 4G4OA 1Z6TA 3DA1A 3TWKA 3A46A 3FUXA 2H1RA 2L09A 1TH2A 2UUBM 4ZPXA 4NZ5A 4MB7A 2IOUA 3T1HM 1KFVA 5EQTA 2XFSA 4MH0E 2R62A 4XGIA 3FUTA 3GRYA 4M9SA 4OUIA 2RGOA 2Y2PA 2XGNA 3U6MA 1N75A 4PDGA 3EIEA 3FUWA 4GC9A 3NBIA 4IJEA 3TPZA 3HJQA 5FTJA 4AI6A 5EP2A 3EIHA 4PCZA 3KSXA 3B9PA 1DGBA 4D81A 1E32A 3GP1A 3KVWA 3VDUA 2D7HA 3SHGB 1FJGM 2P5TA 3AFHA 4QNRA 1TGUA 3HHWA 1N36M 4NYYA 4IBFA 3UJNA 2X49A 2F5QA 4R3DA 1IN5A 2G5GX 3PNVA 2XLJA 4M0DA 2A5YB 3FUUA 4GHLA 3U6CA 4FCWA 3UZUA 4NZ1A 5FLXS 3FTEA 3R9XB 1L2DA 1YU0A 3VKHA 2QCUA 1Q3BA 3LVVA 4G6ZA 3IG5A 5EP4A 4DUYM 2DVWB 2Y21A 3SYKA 3U6QA 4DR5M 4NOOB 1KYIA 5C1BA 1OJLA 3GQ4A 1GL6A 1IXSB 3PNYA 4NSOB 4PDIA 5ITXA 3K8ZA 1G3IA 2YFQA 1R2ZA 1OFHA 1E9SA 3M0EA 4JI3M 1UM8A 2QENA 4DV4M 4II7A 4LRSA 1IM2A 3TL4X 2XD1A 4NY2A 2FFFB 4PT5A 2R45A 2ZM6M 4OJPA 3AOEA 3L29A 3VK7A 2XSZA 2YNMD 4K0KM 2Y2OA 3J27B 3TWMA 3D8BA 4G4NA 3AOGA 3WHLA 4LJ4A 4NSRA 4MGKE 1YU2A 3M7GA 4AKHA 2FNAA 4LRTA 3K1JA 3SASA 2XF3A 4B08A 3WX7A 3GLFA 4WURA 4LJ6A 5KO3A 3HHZA 1JR3A 1W5SA 1SXJE 5LMUM 4DV2M 4IBCA 3GLFB 4DV5M 3KP0E 5C18A 3L2AA 3AOEC 2Y2GA 4Z8XA 4A3VB 4LJAA 3KFUG 2JCHA 2R18A 4IIWA 2UUCM 2RGHA 2L7HA 3HSHA 2I7PA 2YQZA 2XEPA 3UMMA 3MJ5A 4LFCM 1DGHA 2M60A 4KO8A 1SXJD 4DR6M 3I4VA 4AG5A 3GLGA 3TQSA 2XZFA 3KDSE 2KRUA 1OFIA 1IN7A 2UUAM 4GHAA 4KODA 4NXNM 4GMQA 3H4MA 4GKKM 2R65A 1IY1A 3U5ZA 3DZDA 4G4QA 4LCBA 5FTMA 1N33M 4ITQA 1XMOM 3LMMA 5BR8M 3CF6E 3HJSA 3U5ZB 3SC3A 2YR0A 2FE8A 4LF9M 1DO2A 2KW0A 4WW0A 4B3TM 3A98B 4FWDA 1IN6A 3L28A 3DOAA 3ZCBB 4GC5A 4LF7M 1HNWM 3TE6A 4OJ6A 3GRUA 4JN6A 4L15A 4EIWA 4LJ7A 3M6AA 3WHKA 3GLIA 4B3RM 2ZBKB 4BLCA 1KSFX 1L1TA 3QWLA 3HHYA 1NJFA 5KPZA 2DZNB 1PJIA 4KHPM 1J7KA 1DO0A 4DV6M 3ILKA 1MX0A 3GPXA 3GLIB 2Y2NA 2J7OA 3W0LB 1PM5A 2F5OA 3SBJA 3J80S 2FOIC 4I8OA 3SATA 2C9CA 3RFWA 2DWMA 2Y2QA 3KP1E 1H6UA 5IWAM 5FTLA 1IBMM 4DV3M 1N78A 4NZ4A 2L7IA 4I5SA 1Q3CA 2Z3XA 2UXDM 3SHFA 1Z59A 1IXRC 2Y2JA 4W5WA 1JQJC 4OX9M 2F5NA 1QVRA 3HU1A 1IBKM 4JV5M 2CUZA 2R4EA 2LXEA 2BG1A 2XH9A 3FKEA 3VKGA 4IBEA 3RGPA 5EXSA 3W0FA 2ZANA 1IBLM 1YU1A 2R46A 3DFZA 4NXMM 4AG6A 2D7GA 4CISA 4R7GA 2XZUA 2NQ8C 1MU5A 4B7GA 1QYRA 3JAMS 1YSYA 3E4RA 1S3SA 1G8PA 1HQCA 1XWIA 5DYGA 1L1ZA 1IY0A 1DGGA 4LZJA 4IBDA 1YUBA 2C96A 3LQRA 2VQFM 5ITRA 3HJ8A 1K82A 1HNXM 3FD9A 3HGIA 4TUWA 4LZZA 2X8AA 2L6OA 3RE8A 4B7HA 2UXCM 3Q8XA 3L27A 2BJVA 4GITA 4NRVA 3ZC7B 4LF4M 4LG2A 1NY6A 3UK6A 1XC8A 2EO2A 5ITQA 1R2YA 4OJOA 1TH3A 3VDPA 4LJ8A 2Q2EB 1IN8A 2CFOA 5EXTA 4DR2M 1J5EM 1E94E 2G8LA 1IY2A 2J7NA 3BOSA 5FTKA 1DGFA 1W5TA 3SARA 3CF0A 4DR3M 1GLNA 4GIPA 4L78A 1NY5A 4DUZM 3A45A 5ITYA 5FSWA 2JA2A 2F4VM 3LVWA 5JI3E 2F5PA 2X4AA 2DWZB 4LY6A 2EUCA 1ORYB 4RF1A 1D2NA 1I4WA 4LJ9A 2ZAMA 4CHTB 4LF5M 3KOYE 3HHXA 1GL7A 5EP1A 4QOZC 4NL4H 1E9RA 2K47A 2Y2HA 2RKOA 4I81A 4L16A 4AW4A 4X62M 5E6JA 4QHTA 3MHVC 4L4UA 1NSFA 4YY3M 2ZAOA 5ITTA 3VLFB 1N32M 2UWXA 3KS8A 4JYAM 3T15A 1XXHA 2F5SA 1HT2E 4HL4A 4MGHA 4IJFA 1HR0M 4BBAA 1GVNA 3FUVA 4BB9A 2HHHM 1XXHB 2DWNA 1C1KA 3GQ3A 4FWGA 3GLHA 2Y20A 4LGYA 4LFAM 1T3TA 2C9OA 3FYDA 2Y2LA 4AQYM 4PD2A 3KOWE 1GKIA 2CHVA 3GLHB 3HU2A 1NNJA 3U60A 3UGJA 1YE9A 4OW0A 3J81S 2ERCA 3GRVA 5DYIA 1NVMA 3KOXE 3U60B 2QPAA 3T1YM 2HCBA 2E5LM 1Z5AA 1JR3D 5IT9S 1IN4A 2CE7A 3HKPA 2O5RA 4FVMA 3GPPA 3CF2A 1R7RA 4IBIA 2JE5A 3NWLA 4X64M 5LMNM 1R6BX 4MGZE 3LQQA 3SMPA 4FW9A 4IBGA 4JXJA 4DV0M 3I4YA 3FTFA 3KSJA 4NYUA 4REZA 5E26A 3RGSA 2AHMA 3AV0A 2C98A 4L8RC 2XFTA 2LWXA 4B7FA 2DHRA 2KZUA 2VQEM 3L25A 1VDDA 1QANA 3SYLA 3HWSA 1QQWA 2KEBA 4HLQA 1EE8A 4B3MM 1HQYE 7CATA 5KPRA 1NJGA 1G41A 3GQ5A 5ITUA 3QAUA 4I4LA 4XBOA 5EJCA 3PFIA 3U6EA 3JR4A 4DR4M 4CGYB 4X66M 2R4JA 2Y2KA 4OJ5A 5JI2E 4QNLA 1NNUC 3KXEC 3AJIB 2Y0TA 2VIIA 1QAMA 4DV7M 3T38A 4NZ3A 3AKZA 1L8QA 2KXEA 3U61A 2CEAA 3KW6A 4YHHM 1N77A 3GPUA 3JR5A 3GRRA 3U61B 2DXIA 4JI2M 3TWLA 4IBJA 4KLNA 1XHBA 5A2QS 4DV1M 1YU4A 3FYCA 4GH9A 3KS4A 2Z4RA 4MM3B 4JI0M 3D8LA 3FTCA 1Z5CA 4M0WA 3N3FA 4QOSA 3KOZE 2QZ4A 2FFJA 4DR7M 1QAOA 3R8FA 1L2CA 1YUEA 4JI5M 1TH4A 3C58A 3J2PB 1XMQM 2CV0A 4GKJM 3HONA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L28 A;  3L25 A;  4IBD A;  3KS8 A;  4IBF A;  4IBJ A;  3L26 A;  4GHA A;  3FKE A;  4IJF A;  4IBE A;  4GH9 A;  3L27 A;  3KS4 A;  4IBC A;  4LG2 A;  4IBI A;  3L2A A;  4GHL A;  3L29 A;  4IBK A;  4IBB A;  4IBG A;  4IJE A;  5BPV A; 
#chains in the Genus database with same CATH topology
 1TDH A;  3THG A;  3CGW A;  2Y2I A;  2CHQ A;  1K3W A;  4OU7 A;  1IQP A;  3FTD A;  4G4R A;  1QZM A;  2LH0 A;  1ZQ9 A;  1J09 A;  4M9Z A;  2D7E A;  4UN2 B;  1SXJ A;  4AKG A;  2C99 A;  1P3Q Q;  1L2B A;  4RF0 A;  3L26 A;  2CV1 A;  4MGY E;  2KRK A;  3U6S A;  3BBZ A;  1SXJ B;  2LNH C;  4M9X A;  5IZ7 D;  3ZQJ A;  5ITX E;  1XNR M;  1PJQ A;  3QYE A;  2UU9 M;  1XNQ M;  5IRE B;  4Z2L A;  4FCT A;  1G59 A;  4LF8 M;  3U6L A;  3OTO M;  4B3S M;  3LW5 F;  4R71 A;  4S12 A;  1VEJ A;  1NHW C;  4LFB M;  2QBY A;  4LGM A;  1KS0 A;  4NRW A;  2XD5 A;  2MH8 A;  4JI4 M;  4G3O A;  4AZF A;  3ZH9 B;  1D0M A;  5F3W A;  3E9S A;  4Z6Y A;  4DR1 M;  1HT1 E;  2V6Z M;  2QBY B;  2JP7 A;  3SMS A;  2JUJ A;  2DAK A;  5H37 D;  3SAW A;  3J7A S;  3SAU A;  1SXJ C;  3U6Q A;  3HX3 A;  3J7B A;  1YU3 A;  1Z5B A;  2JY8 A;  4JI7 M;  5EP3 A;  2JWS A;  3K2L A;  1X37 A;  4GRI A;  2VF8 A;  3GPY A;  2HL7 A;  2BJW A;  3VK8 A;  3HU3 A;  2DWL A;  1O6I A;  4X65 M;  2C5R A;  1FNN A;  2EKF A;  1E88 A;  5GKN A;  2I7N A;  2JY6 B;  2LHC A;  1LV7 A;  2OPF A;  2FN2 A;  1V92 A;  2KA6 B;  1WIV A;  2Y0Q A;  4JI6 M;  3SAV A;  3GLF E;  4JI1 M;  2DAG A;  2J5Y A;  4FCV A;  5KQD A;  2N35 A;  2XSZ D;  2V1U A;  1TDZ A;  4LJ5 A;  4FD2 A;  2FS1 A;  3PXG A;  3K92 A;  4MGI E;  3AL0 C;  2W82 A;  2MR9 A;  4D82 A;  4HMD A;  2QQ8 A;  3U6D A;  1HNZ M;  1OTR A;  2Y2M A;  4OJL A;  2QHO B;  1I94 M;  2BWE A;  1OAO C;  3I51 A;  4LF6 M;  3MK6 A;  2EA0 A;  5EXP A;  5KQ8 A;  5EXX A;  1DGH B;  1NHG C;  1QDT A;  1QAQ A;  2M5Z A;  2QP9 X;  4JI8 M;  3GLG B;  3IHP A;  3K9P A;  3SFZ A;  1K3X A;  2UXB M;  1G4A E;  4P16 A;  3U6P A;  1OGG A;  4OVZ A;  1Q39 A;  3Q8G A;  1XXH E;  2HKJ A;  2OQ4 A;  3CTW B;  4QNM A;  4D80 A;  5KPT A;  2OO9 A;  2V1C A;  1PJJ A;  4RNA A;  2BNK A;  2CHG A;  1RU3 A;  4OVZ B;  4IBK A;  2WSF F;  4IBB A;  2EJS A;  3F92 A;  4TX8 A;  3PVS A;  1ZAE A;  2BWB A;  1WXQ A;  3W68 A;  2CRU A;  5BPV A;  5DNY A;  3GO8 A;  2Z4S A;  3GLH E;  2LHG A;  4FWH A;  3VFD A;  2CV2 A;  4AKI A;  2CP8 A;  4QHS A;  2Z7J A;  1JB0 F;  1ZMW A;  2DZO B;  8CAT A;  3BXW A;  1IXZ A;  3IG8 A;  1N34 M;  5FTN A;  2KZS A;  3B7Q A;  4F1I A;  3U6O A;  3A42 A;  4Z2K A;  4G4O A;  1Z6T A;  3DA1 A;  3TWK A;  3A46 A;  3FUX A;  2H1R A;  2L09 A;  2L4E A;  2QSF X;  1TH2 A;  2UUB M;  4ZPX A;  4NZ5 A;  4MB7 A;  2RTS A;  2IOU A;  3T1H M;  1KFV A;  1R5L A;  5EQT A;  4MB4 A;  2XFS A;  4MH0 E;  2R62 A;  1V34 A;  2G3Q A;  3FUT A;  3GRY A;  4M9S A;  4XGI A;  4OUI A;  2RGO A;  2Y2P A;  2XGN A;  3U6M A;  4MB5 A;  1N75 A;  4PDG A;  3EIE A;  3FUW A;  4GC9 A;  1BVS A;  3NBI A;  4IJE A;  3TPZ A;  3HJQ A;  3I01 M;  5FTJ A;  4AI6 A;  1QUS A;  1GAB A;  2DAI A;  5EP2 A;  3EIH A;  4PCZ A;  3KSX A;  3B9P A;  1DGB A;  4D81 A;  1OIP A;  1E32 A;  2WSC F;  3KVW A;  3VDU A;  2D7H A;  3SHG B;  3GP1 A;  1EFU B;  1FJG M;  2P5T A;  3AFH A;  4QNR A;  1TGU A;  1AUA A;  3HHW A;  2HAK A;  1N36 M;  4NYY A;  4IBF A;  3UJN A;  2X49 A;  2F5Q A;  1WGN A;  2R44 A;  1E15 A;  2LVQ D;  3FRH A;  4R3D A;  2HWJ A;  1IN5 A;  1E6N A;  2G5G X;  3PNV A;  2XLJ A;  4M0D A;  1E6Z A;  1QZE A;  2A5Y B;  1T6O A;  1L6J A;  1TF0 B;  3FUU A;  2R0I A;  4GHL A;  2L2D A;  3U6C A;  2R6F A;  4FCW A;  3UZU A;  4NZ1 A;  2LVN C;  5FLX S;  3FTE A;  3R9X B;  1L2D A;  4HEO A;  1YU0 A;  3VKH A;  2K0B X;  1Q3B A;  2QCU A;  3LVV A;  3IG5 A;  4G6Z A;  5EP4 A;  4DUY M;  3WD3 A;  1ZMV A;  2DVW B;  2Y21 A;  2LTU A;  2JY7 A;  3SYK A;  4NOO B;  1KYI A;  5C1B A;  1OJL A;  3GQ4 A;  4DR5 M;  1GL6 A;  1IXS B;  3PNY A;  4NSO B;  4PDI A;  5ITX A;  3K8Z A;  4F2L A;  1G3I A;  2YFQ A;  1R2Z A;  1OFH A;  1E9S A;  3M0E A;  4JI3 M;  1UM8 A;  1CK7 A;  2K6B A;  2QEN A;  4DV4 M;  4II7 A;  4LRS A;  1IM2 A;  3TL4 X;  2XD1 A;  3C3D A;  4NY2 A;  2DAE A;  2FFF B;  1H8P A;  1A5T A;  2R45 A;  4PT5 A;  2ZM6 M;  3AOE A;  3L29 A;  4OJP A;  3VK7 A;  2XSZ A;  2YNM D;  4K0K M;  2Y2O A;  4MB3 A;  2ZTD A;  3J27 B;  1EAK A;  1QUT A;  1NV8 A;  3TWM A;  3D8B A;  4G4N A;  2KHH A;  3AOG A;  3WHL A;  3LCU A;  4LJ4 A;  4NSR A;  4MGK E;  1YU2 A;  3M7G A;  4AKH A;  2FNA A;  4LRT A;  1WHC A;  3K1J A;  3SAS A;  2XF3 A;  1QO6 A;  4B08 A;  3WX7 A;  3GLF A;  4WUR A;  4LJ6 A;  5KO3 A;  3HHZ A;  1Q02 A;  1JR3 A;  1W5S A;  1SXJ E;  5LMU M;  4DV2 M;  4IBC A;  3GLF B;  4DV5 M;  3KP0 E;  1PGY A;  5C18 A;  3L2A A;  3AOE C;  2Y2G A;  3C9P A;  4Z8X A;  4A3V B;  4LJA A;  3KFU G;  1UR8 A;  2JCH A;  2R18 A;  1SG9 A;  4IIW A;  2OOA A;  2UUC M;  1F4I A;  2RGH A;  1C7Y A;  2L7H A;  2OOB A;  3HSH A;  2I7P A;  2YQZ A;  2XEP A;  3UMM A;  3MJ5 A;  4LFC M;  1DGH A;  2M60 A;  4KO8 A;  1GPF A;  1AIW A;  1SXJ D;  4DR6 M;  1PDC A;  3I4V A;  4AG5 A;  3GLG A;  1QDR A;  3TQS A;  2XZF A;  3KDS E;  2KRU A;  1OFI A;  1IN7 A;  2UUA M;  4GHA A;  4KOD A;  4NXN M;  2VF7 A;  4GMQ A;  3MQL A;  3H4M A;  4GKK M;  1WR1 B;  2R65 A;  1IY1 A;  3HZJ A;  3U5Z A;  3DZD A;  4G4Q A;  4LCB A;  5FTM A;  1NO1 A;  1N33 M;  2Z8Y M;  3WD1 A;  4ITQ A;  1XMO M;  3LMM A;  5BR8 M;  3CF6 E;  3HJS A;  4ANR A;  3U5Z B;  3SC3 A;  2YR0 A;  2FE8 A;  4LF9 M;  1DO2 A;  2KW0 A;  4WW0 A;  4B3T M;  3A98 B;  4FWD A;  1IN6 A;  3L28 A;  4HMC A;  3DOA A;  3ZCB B;  4GC5 A;  1WJ7 A;  4LF7 M;  1HNW M;  1UFZ A;  1OKS A;  1W1Y A;  3TE6 A;  4OJ6 A;  3GRU A;  4JN6 A;  4L15 A;  4EIW A;  4LJ7 A;  3M6A A;  3WHK A;  3NBX X;  3GLI A;  2ZBK B;  4BLC A;  1KSF X;  1L1T A;  3QWL A;  3HHY A;  1NJF A;  5KPZ A;  2DZN B;  1PJI A;  4KHP M;  1J7K A;  1DO0 A;  1T43 A;  4DV6 M;  3ILK A;  1MX0 A;  3GPX A;  1PJT A;  3GLI B;  2Y2N A;  2J7O A;  3W0L B;  1VQ1 A;  1PM5 A;  2F5O A;  3SBJ A;  3J80 S;  2FOI C;  2GQF A;  4I8O A;  3K9O A;  3WD4 A;  3SAT A;  2C9C A;  3RFW A;  2DWM A;  2Y2Q A;  3MMP A;  3KP1 E;  2DEN A;  1H6U A;  1LTM A;  5IWA M;  5FTL A;  1IBM M;  4DV3 M;  1N78 A;  4NZ4 A;  3HY5 A;  2L7I A;  3WD0 A;  4I5S A;  1Q3C A;  2Z3X A;  2UXD M;  3SHF A;  3C3E A;  1Z59 A;  2ZTC A;  1IXR C;  2Y2J A;  4W5W A;  1JQJ C;  4OX9 M;  2F5N A;  4Z2I A;  1QVR A;  3HU1 A;  1IBK M;  4JV5 M;  2CUZ A;  2R4E A;  2B3T A;  2LXE A;  2BG1 A;  2XH9 A;  3FKE A;  1WGL A;  3VKG A;  4IBE A;  3RGP A;  5EXS A;  4GEW A;  3W0F A;  1IFY A;  2ZAN A;  1IBL M;  1Y8G A;  1YU1 A;  1VEG A;  2K9D A;  2R46 A;  3QYB A;  1MN3 A;  3DFZ A;  4NXM M;  1GJT A;  4AG6 A;  2D7G A;  4CIS A;  4R7G A;  1E8B A;  2QNJ A;  1ZV1 A;  2XZU A;  2LVO C;  2NQ8 C;  1MU5 A;  4B7G A;  1QYR A;  1YLA A;  4Z2G A;  3JAM S;  1YSY A;  3E4R A;  1S3S A;  1XB2 B;  2DAM A;  1G8P A;  1HQC A;  1IXS A;  1XWI A;  2GNO A;  5DYG A;  1L1Z A;  1E6R A;  1IY0 A;  1DGG A;  4LZJ A;  3E21 A;  4IBD A;  4DBG B;  2LVA A;  1YUB A;  1W1V A;  2C96 A;  3LQR A;  3FTF A;  2VQF M;  1GOI A;  5ITR A;  3HJ8 A;  1K82 A;  1HNX M;  3FD9 A;  2JXN A;  3HGI A;  4TUW A;  1W1T A;  4LZZ A;  2X8A A;  3B89 A;  2L6O A;  3RE8 A;  1D0L A;  2MJ5 B;  4B7H A;  1PRB A;  3Q8X A;  2UXC M;  3L27 A;  2DHY A;  2BJV A;  4GIT A;  4NRV A;  3ZC7 B;  2DKL A;  4LF4 M;  1NY6 A;  4LG2 A;  3UK6 A;  1XC8 A;  2EO2 A;  2LVP C;  5ITQ A;  1R2Y A;  4OJO A;  1ED7 A;  1TH3 A;  4KT0 F;  3VDP A;  4LJ8 A;  1R4G A;  2Q2E B;  1DV0 A;  1OIZ A;  1OGB A;  1NV9 A;  1IN8 A;  2CFO A;  5EXT A;  2D49 A;  4DR2 M;  2V5O A;  1J5E M;  1E94 E;  2G8L A;  1IY2 A;  4RKU F;  2J7N A;  3I04 M;  1D0K A;  3BOS A;  5FTK A;  1DGF A;  1W5T A;  3SAR A;  2O25 A;  3CF0 A;  4DR3 M;  1GLN A;  4GIP A;  4L78 A;  1NY5 A;  4DUZ M;  3A45 A;  2JZ1 A;  5ITY A;  4HME A;  5FSW A;  2JA2 A;  2F4V M;  3LVW A;  5JI3 E;  2F5P A;  3LCV B;  1VEK A;  2X4A A;  2EKK A;  4B3R M;  2DWZ B;  4LY6 A;  2EUC A;  3FRI A;  1ORY B;  4Q7J A;  4RF1 A;  1D2N A;  1I4W A;  4LJ9 A;  2ZAM A;  4CHT B;  4LF5 M;  3KOY E;  1GL7 A;  3HHX A;  5EP1 A;  4QOZ C;  4NL4 H;  1E9R A;  2K47 A;  2Y2H A;  2RKO A;  4I81 A;  4L16 A;  4AW4 A;  4X62 M;  1MJG M;  5E6J A;  4QHT A;  3MHV C;  1CUK A;  1OAI A;  1PJS A;  1NSF A;  4L4U A;  4YY3 M;  2ZAO A;  5ITT A;  3VLF B;  1N32 M;  2UWX A;  3KS8 A;  4JYA M;  4NC6 A;  3T15 A;  1OQY A;  4Y28 F;  1XXH A;  2F5S A;  1HT2 E;  4HL4 A;  4MGH A;  1J7M A;  4IJF A;  1TR8 A;  4BBA A;  1HR0 M;  3W67 A;  1GVN A;  3FUV A;  4BB9 A;  2HHH M;  1XXH B;  2KNZ A;  2DWN A;  1C1K A;  2WZJ A;  3GQ3 A;  4FWG A;  3GLH A;  5L8R F;  1HJP A;  1JR3 E;  2Y20 A;  4LGY A;  1T3T A;  4LFA M;  4CIZ A;  1GO5 A;  1UR9 A;  2C9O A;  3FYD A;  2Y2L A;  4AQY M;  2H5X A;  3KOW E;  4PD2 A;  1GKI A;  2CHV A;  3GLH B;  3HU2 A;  2LBC A;  1NNJ A;  3U60 A;  3UGJ A;  1YE9 A;  4OW0 A;  3J81 S;  2CWB A;  2ERC A;  3GRV A;  4XK8 F;  5DYI A;  1NVM A;  3KOX E;  3U60 B;  2QPA A;  2JZ0 A;  3T1Y M;  2HCB A;  2E5L M;  1Z5A A;  4P17 A;  1JR3 D;  5IT9 S;  2DNA A;  1IN4 A;  2CE7 A;  1GJS A;  1W1P A;  2JNH A;  3GLG E;  1TTE A;  3HKP A;  1H0I A;  1CXW A;  2O5R A;  4FVM A;  3GPP A;  2WSE F;  3CF2 A;  1R7R A;  4IBI A;  2JE5 A;  3NWL A;  4X64 M;  5LMN M;  2KNA A;  1R6B X;  2KNV A;  3LQQ A;  4MGZ E;  4FW9 A;  4IBG A;  4JXJ A;  3SMP A;  3I4Y A;  4DV0 M;  2DI0 A;  2KDL A;  3KSJ A;  4NYU A;  4REZ A;  5E26 A;  3RGS A;  2AHM A;  2FH0 A;  3AV0 A;  2C98 A;  4L8R C;  2XFT A;  2LWX A;  3B7N A;  4B7F A;  2O01 F;  2DHR A;  2KZU A;  2VDB B;  2VQE M;  3L25 A;  1VDD A;  1ZMU A;  1QAN A;  3SYL A;  3HWS A;  1QQW A;  2KEB A;  4HLQ A;  1V33 A;  1EE8 A;  4B3M M;  1HQY E;  3H4J A;  3M7P A;  3WD2 A;  7CAT A;  5KPR A;  1EIJ A;  1NJG A;  1G41 A;  3GQ5 A;  5ITU A;  4WP2 A;  3QAU A;  3GLI E;  4I4L A;  1VDL A;  3B7Z A;  1G71 A;  4XBO A;  3PFI A;  5EJC A;  3U6E A;  1AIP C;  3JR4 A;  4Z2J A;  4DR4 M;  4CGY B;  4X66 M;  2R4J A;  2Y2K A;  4OJ5 A;  3IEC A;  5JI2 E;  4QNL A;  1NNU C;  3KXE C;  2RRU A;  2Y0T A;  2VII A;  3AJI B;  1QAM A;  4DV7 M;  3T38 A;  4NZ3 A;  3AKZ A;  1GXD A;  2MRO B;  1L8Q A;  2KXE A;  2DZL A;  5DFL A;  3T6P A;  3U61 A;  2MGW A;  4L6V 6;  2APL A;  2CEA A;  3KW6 A;  4YHH M;  3V76 A;  1N77 A;  3GPU A;  3JR5 A;  3GRR A;  3U61 B;  2DXI A;  4JI2 M;  3TWL A;  1H0G A;  4IBJ A;  4KLN A;  1XHB A;  5A2Q S;  4DV1 M;  1YU4 A;  3FYC A;  4GH9 A;  2L4F A;  3KS4 A;  2Z4R A;  4MM3 B;  4JI0 M;  3D8L A;  3FTC A;  1Z5C A;  4M0W A;  3N3F A;  4QOS A;  3KOZ E;  1VG5 A;  2QZ4 A;  3E46 A;  2FFJ A;  4DR7 M;  1QAO A;  3R8F A;  1L2C A;  4CJ6 A;  1YUE A;  4JI5 M;  1E6P A;  1TH4 A;  3C58 A;  4Z2H A;  3J2P B;  1XMQ M;  2CV0 A;  3B74 A;  4GKJ M;  3HON A;  2JY5 A;  3FE3 A; 
#chains in the Genus database with same CATH homology
 1TDH A;  3THG A;  2Y2I A;  2CHQ A;  1K3W A;  4OU7 A;  1IQP A;  3FTD A;  4G4R A;  1QZM A;  2LH0 A;  1ZQ9 A;  1J09 A;  4M9Z A;  2D7E A;  4AKG A;  1SXJ A;  2C99 A;  1L2B A;  4RF0 A;  3L26 A;  2CV1 A;  4MGY E;  2KRK A;  3U6S A;  4M9X A;  1SXJ B;  2LNH C;  5IZ7 D;  1XNR M;  5ITX E;  2UU9 M;  1XNQ M;  5IRE B;  4FCT A;  1G59 A;  4LF8 M;  3U6L A;  3OTO M;  4B3S M;  4S12 A;  1NHW C;  4LFB M;  2QBY A;  4LGM A;  4NRW A;  2XD5 A;  4JI4 M;  4AZF A;  3ZH9 B;  5F3W A;  3E9S A;  4Z6Y A;  4DR1 M;  1HT1 E;  2V6Z M;  2QBY B;  3SMS A;  3SAW A;  5H37 D;  3J7A S;  1YU3 A;  3SAU A;  1SXJ C;  3J7B A;  1Z5B A;  4JI7 M;  5EP3 A;  3K2L A;  1X37 A;  4GRI A;  3GPY A;  3VK8 A;  2HL7 A;  2BJW A;  3HU3 A;  2DWL A;  4X65 M;  2C5R A;  1FNN A;  5GKN A;  2I7N A;  1LV7 A;  2OPF A;  2KA6 B;  2Y0Q A;  4JI6 M;  3SAV A;  4JI1 M;  4FCV A;  5KQD A;  2XSZ D;  2V1U A;  1TDZ A;  4LJ5 A;  4FD2 A;  3PXG A;  3K92 A;  4MGI E;  3AL0 C;  2W82 A;  4D82 A;  3U6D A;  1HNZ M;  2Y2M A;  4OJL A;  1I94 M;  3I51 A;  4LF6 M;  3MK6 A;  2EA0 A;  5EXP A;  5KQ8 A;  5EXX A;  1DGH B;  1NHG C;  2QP9 X;  1QAQ A;  2M5Z A;  4JI8 M;  3GLG B;  1K3X A;  3SFZ A;  2UXB M;  1G4A E;  4P16 A;  3U6P A;  4OVZ A;  1Q39 A;  2HKJ A;  2OQ4 A;  3CTW B;  4QNM A;  4D80 A;  5KPT A;  2V1C A;  1PJJ A;  4RNA A;  2BNK A;  2CHG A;  4OVZ B;  4IBK A;  4IBB A;  3PVS A;  1ZAE A;  5BPV A;  1WXQ A;  3GO8 A;  5DNY A;  2CV2 A;  2Z4S A;  3VFD A;  4FWH A;  4AKI A;  4QHS A;  2Z7J A;  2DZO B;  8CAT A;  1IXZ A;  3IG8 A;  1N34 M;  5FTN A;  2KZS A;  3U6O A;  3A42 A;  4G4O A;  1Z6T A;  3DA1 A;  3TWK A;  3A46 A;  3FUX A;  2H1R A;  2L09 A;  1TH2 A;  2UUB M;  4ZPX A;  4NZ5 A;  4MB7 A;  2IOU A;  3T1H M;  1KFV A;  5EQT A;  2XFS A;  4MH0 E;  2R62 A;  4XGI A;  3FUT A;  3GRY A;  4M9S A;  4OUI A;  2RGO A;  2Y2P A;  2XGN A;  3U6M A;  1N75 A;  4PDG A;  3EIE A;  3FUW A;  4GC9 A;  3NBI A;  4IJE A;  3TPZ A;  3HJQ A;  5FTJ A;  4AI6 A;  5EP2 A;  3EIH A;  4PCZ A;  3KSX A;  3B9P A;  1DGB A;  4D81 A;  1E32 A;  3GP1 A;  3KVW A;  3VDU A;  2D7H A;  3SHG B;  1FJG M;  2P5T A;  3AFH A;  4QNR A;  1TGU A;  3HHW A;  1N36 M;  4NYY A;  4IBF A;  3UJN A;  2X49 A;  2F5Q A;  4R3D A;  1IN5 A;  2G5G X;  3PNV A;  2XLJ A;  4M0D A;  2A5Y B;  3FUU A;  4GHL A;  3U6C A;  4FCW A;  3UZU A;  4NZ1 A;  5FLX S;  3FTE A;  3R9X B;  1L2D A;  1YU0 A;  3VKH A;  2QCU A;  1Q3B A;  3LVV A;  4G6Z A;  3IG5 A;  5EP4 A;  4DUY M;  2DVW B;  2Y21 A;  3SYK A;  3U6Q A;  4DR5 M;  4NOO B;  1KYI A;  5C1B A;  1OJL A;  3GQ4 A;  1GL6 A;  1IXS B;  3PNY A;  4NSO B;  4PDI A;  5ITX A;  3K8Z A;  1G3I A;  2YFQ A;  1R2Z A;  1OFH A;  1E9S A;  3M0E A;  4JI3 M;  1UM8 A;  2QEN A;  4DV4 M;  4II7 A;  4LRS A;  1IM2 A;  3TL4 X;  2XD1 A;  4NY2 A;  2FFF B;  4PT5 A;  2R45 A;  2ZM6 M;  4OJP A;  3AOE A;  3L29 A;  3VK7 A;  2XSZ A;  2YNM D;  4K0K M;  2Y2O A;  3J27 B;  3TWM A;  3D8B A;  4G4N A;  3AOG A;  3WHL A;  4LJ4 A;  4NSR A;  4MGK E;  1YU2 A;  3M7G A;  4AKH A;  2FNA A;  4LRT A;  3K1J A;  3SAS A;  2XF3 A;  4B08 A;  3WX7 A;  3GLF A;  4WUR A;  4LJ6 A;  5KO3 A;  3HHZ A;  1JR3 A;  1W5S A;  1SXJ E;  5LMU M;  4DV2 M;  4IBC A;  3GLF B;  4DV5 M;  3KP0 E;  5C18 A;  3L2A A;  3AOE C;  2Y2G A;  4Z8X A;  4A3V B;  4LJA A;  3KFU G;  2JCH A;  2R18 A;  4IIW A;  2UUC M;  2RGH A;  2L7H A;  3HSH A;  2I7P A;  2YQZ A;  2XEP A;  3UMM A;  3MJ5 A;  4LFC M;  1DGH A;  2M60 A;  4KO8 A;  1SXJ D;  4DR6 M;  3I4V A;  4AG5 A;  3GLG A;  3TQS A;  2XZF A;  3KDS E;  2KRU A;  1OFI A;  1IN7 A;  2UUA M;  4GHA A;  4KOD A;  4NXN M;  4GMQ A;  3H4M A;  4GKK M;  2R65 A;  1IY1 A;  3U5Z A;  3DZD A;  4G4Q A;  4LCB A;  5FTM A;  1N33 M;  4ITQ A;  1XMO M;  3LMM A;  5BR8 M;  3CF6 E;  3HJS A;  3U5Z B;  3SC3 A;  2YR0 A;  2FE8 A;  4LF9 M;  1DO2 A;  2KW0 A;  4WW0 A;  4B3T M;  3A98 B;  4FWD A;  1IN6 A;  3L28 A;  3DOA A;  3ZCB B;  4GC5 A;  4LF7 M;  1HNW M;  3TE6 A;  4OJ6 A;  3GRU A;  4JN6 A;  4L15 A;  4EIW A;  4LJ7 A;  3M6A A;  3WHK A;  3GLI A;  4B3R M;  2ZBK B;  4BLC A;  1KSF X;  1L1T A;  3QWL A;  3HHY A;  1NJF A;  5KPZ A;  2DZN B;  1PJI A;  4KHP M;  1J7K A;  1DO0 A;  4DV6 M;  3ILK A;  1MX0 A;  3GPX A;  3GLI B;  2Y2N A;  2J7O A;  3W0L B;  1PM5 A;  2F5O A;  3SBJ A;  3J80 S;  2FOI C;  4I8O A;  3SAT A;  2C9C A;  3RFW A;  2DWM A;  2Y2Q A;  3KP1 E;  1H6U A;  5IWA M;  5FTL A;  1IBM M;  4DV3 M;  1N78 A;  4NZ4 A;  2L7I A;  4I5S A;  1Q3C A;  2Z3X A;  2UXD M;  3SHF A;  1Z59 A;  1IXR C;  2Y2J A;  4W5W A;  1JQJ C;  4OX9 M;  2F5N A;  1QVR A;  3HU1 A;  1IBK M;  4JV5 M;  2CUZ A;  2R4E A;  2LXE A;  2BG1 A;  2XH9 A;  3FKE A;  3VKG A;  4IBE A;  3RGP A;  5EXS A;  3W0F A;  2ZAN A;  1IBL M;  1YU1 A;  2R46 A;  3DFZ A;  4NXM M;  4AG6 A;  2D7G A;  4CIS A;  4R7G A;  2XZU A;  2NQ8 C;  1MU5 A;  4B7G A;  1QYR A;  3JAM S;  1YSY A;  3E4R A;  1S3S A;  1G8P A;  1HQC A;  1XWI A;  5DYG A;  1L1Z A;  1IY0 A;  1DGG A;  4LZJ A;  4IBD A;  1YUB A;  2C96 A;  3LQR A;  2VQF M;  5ITR A;  3HJ8 A;  1K82 A;  1HNX M;  3FD9 A;  3HGI A;  4TUW A;  4LZZ A;  2X8A A;  2L6O A;  3RE8 A;  4B7H A;  2UXC M;  3Q8X A;  3L27 A;  2BJV A;  4GIT A;  4NRV A;  3ZC7 B;  4LF4 M;  4LG2 A;  1NY6 A;  3UK6 A;  1XC8 A;  2EO2 A;  5ITQ A;  1R2Y A;  4OJO A;  1TH3 A;  3VDP A;  4LJ8 A;  2Q2E B;  1IN8 A;  2CFO A;  5EXT A;  4DR2 M;  1J5E M;  1E94 E;  2G8L A;  1IY2 A;  2J7N A;  3BOS A;  5FTK A;  1DGF A;  1W5T A;  3SAR A;  3CF0 A;  4DR3 M;  1GLN A;  4GIP A;  4L78 A;  1NY5 A;  4DUZ M;  3A45 A;  5ITY A;  5FSW A;  2JA2 A;  2F4V M;  3LVW A;  5JI3 E;  2F5P A;  2X4A A;  2DWZ B;  4LY6 A;  2EUC A;  1ORY B;  4RF1 A;  1D2N A;  1I4W A;  4LJ9 A;  2ZAM A;  4CHT B;  4LF5 M;  3KOY E;  3HHX A;  1GL7 A;  5EP1 A;  4QOZ C;  4NL4 H;  1E9R A;  2K47 A;  2Y2H A;  2RKO A;  4I81 A;  4L16 A;  4AW4 A;  4X62 M;  5E6J A;  4QHT A;  3MHV C;  4L4U A;  1NSF A;  4YY3 M;  2ZAO A;  5ITT A;  3VLF B;  1N32 M;  2UWX A;  3KS8 A;  4JYA M;  3T15 A;  1XXH A;  2F5S A;  1HT2 E;  4HL4 A;  4MGH A;  4IJF A;  1HR0 M;  4BBA A;  1GVN A;  3FUV A;  4BB9 A;  2HHH M;  1XXH B;  2DWN A;  1C1K A;  3GQ3 A;  4FWG A;  3GLH A;  2Y20 A;  4LGY A;  4LFA M;  1T3T A;  2C9O A;  3FYD A;  2Y2L A;  4AQY M;  4PD2 A;  3KOW E;  1GKI A;  2CHV A;  3GLH B;  3HU2 A;  1NNJ A;  3U60 A;  3UGJ A;  1YE9 A;  4OW0 A;  3J81 S;  2ERC A;  3GRV A;  5DYI A;  1NVM A;  3KOX E;  3U60 B;  2QPA A;  3T1Y M;  2HCB A;  2E5L M;  1Z5A A;  1JR3 D;  5IT9 S;  1IN4 A;  2CE7 A;  3HKP A;  2O5R A;  4FVM A;  3GPP A;  3CF2 A;  1R7R A;  4IBI A;  2JE5 A;  3NWL A;  4X64 M;  5LMN M;  1R6B X;  4MGZ E;  3LQQ A;  3SMP A;  4FW9 A;  4IBG A;  4JXJ A;  4DV0 M;  3I4Y A;  3FTF A;  3KSJ A;  4NYU A;  4REZ A;  5E26 A;  3RGS A;  2AHM A;  3AV0 A;  2C98 A;  4L8R C;  2XFT A;  2LWX A;  4B7F A;  2DHR A;  2KZU A;  2VQE M;  3L25 A;  1VDD A;  1QAN A;  3SYL A;  3HWS A;  1QQW A;  2KEB A;  4HLQ A;  1EE8 A;  4B3M M;  1HQY E;  7CAT A;  5KPR A;  1NJG A;  1G41 A;  3GQ5 A;  5ITU A;  3QAU A;  4I4L A;  4XBO A;  5EJC A;  3PFI A;  3U6E A;  3JR4 A;  4DR4 M;  4CGY B;  4X66 M;  2R4J A;  2Y2K A;  4OJ5 A;  5JI2 E;  4QNL A;  1NNU C;  3KXE C;  3AJI B;  2Y0T A;  2VII A;  1QAM A;  4DV7 M;  3T38 A;  4NZ3 A;  3AKZ A;  1L8Q A;  2KXE A;  3U61 A;  2CEA A;  3KW6 A;  4YHH M;  1N77 A;  3GPU A;  3JR5 A;  3GRR A;  3U61 B;  2DXI A;  4JI2 M;  3TWL A;  4IBJ A;  4KLN A;  1XHB A;  5A2Q S;  4DV1 M;  1YU4 A;  3FYC A;  4GH9 A;  3KS4 A;  2Z4R A;  4MM3 B;  4JI0 M;  3D8L A;  3FTC A;  1Z5C A;  4M0W A;  3N3F A;  4QOS A;  3KOZ E;  2QZ4 A;  2FFJ A;  4DR7 M;  1QAO A;  3R8F A;  1L2C A;  1YUE A;  4JI5 M;  1TH4 A;  3C58 A;  3J2P B;  1XMQ M;  2CV0 A;  4GKJ M;  3HON A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...