4LG2A

Crystal structure of reston ebola virus vp35 rna binding domain bound to 12-bp dsrna
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
122
structure length
122
Chain Sequence
ISAKDLKEIMYDHLPGFGTAFHQLVQVICKIGKDNNLLDTIHAEFQASLADGDSPQCALIQITKRVPIFQDVPPPIIHIRSRGDIPRACQKSLRPAPPSPKIDRGWVCLFKMQDGKTLGLKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein/rna
molecule keywords Polymerase cofactor
publication title Ebolavirus VP35 coats the backbone of double-stranded RNA for interferon antagonism.
pubmed doi rcsb
source organism Reston ebolavirus
total genus 38
structure length 122
sequence length 122
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4lg2A01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4lg2A02
4IBGA 3KS8A 3KS4A 4LG2A 4GHLA 3L2AA 3L25A 3L27A 4IBCA 3L29A 5BPVA 4IJFA 3L28A 4IBKA 3FKEA 4IBJA 4IBFA 4GH9A 4IBEA 4GHAA 4IBDA 4IBBA 4IJEA 3L26A 4IBIA
chains in the Genus database with same CATH superfamily
3HZJA 1TDHA 4GC5A 2LWXA 3U5ZA 1HQCA 4GHLA 3UZUA 3FD9A 3L2AA 4KO8A 3T1YM 1DV0A 2EA0A 4G4OA 1LV7A 2DWNA 2UXDM 3N3FA 3WX7A 1I4WA 5ITRA 2F4VM 3U6MA 1E94E 1BVSA 3HWSA 2YR0A 3I04M 3KSXA 4FVMA 1SXJC 3W0FA 3FUVA 2EKKA 3E21A 4Z2JA 4XK8F 4JI5M 1PJIA 4JI4M 2OPFA 2IOUA 4OJ5A 1N32M 1OJLA 3A98B 4W5WA 5EP1A 4OVZA 4TX8A 4LJ9A 1QAOA 3I4YA 3B7NA 1PJQA 1NV8A 1QDRA 1QUTA 1XWIA 3K92A 2CV2A 4B3TM 1Y8GA 3SHFA 1F4IA 1IFYA 1TH4A 1G4AE 3HHXA 3CF2A 3ILKA 3HJSA 2R45A 1G59A 1N78A 1DO2A 4REZA 2L09A 2XZUA 1T6OA 2KRUA 4LFBM 4HMEA 1J5EM 4PT5A 1QYRA 2LVAA 3GLHB 4CIZA 4F2LA 4DV6M 5LMNM 4DR4M 1W1YA 1QQWA 5EXSA 1HQYE 2XGNA 3U61B 2WSEF 3U6LA 2XD5A 1HNZM 2LHCA 2P5TA 1IN5A 2XFTA 5DYGA 3AFHA 4OJPA 3H4MA 1J09A 3PNVA 2XF3A 4WW0A 4G3OA 4WURA 3AOGA 3B89A 4RKUF 5EXXA 2H5XA 4YHHM 2YNMD 4JN6A 4QNMA 3VLFB 3J81S 4IBDA 1L6JA 4L6V6 1CK7A 1KS0A 1OQYA 3L26A 3WD4A 1E15A 1YUBA 5EP4A 1GOIA 3KS4A 1D0KA 3U6OA 4R71A 3L25A 1QDTA 1SXJB 2KA6B 1UFZA 3Q8GA 2DZOB 2LXEA 1SXJD 3TWLA 3MJ5A 4M9XA 2ZTDA 3FE3A 4DUZM 3L28A 3LCUA 4DV1M 2OOBA 4DBGB 4L16A 4BB9A 1W5SA 2CHVA 2I7PA 3E9SA 5ITXE 1TH3A 2DENA 4G6ZA 1OFIA 1YU2A 2X8AA 4M0DA 5KQ8A 2JY5A 2K47A 1E8BA 4NZ3A 1GL7A 1SXJE 3CTWB 3SAUA 4Z2LA 3KXEC 2OQ4A 2OO9A 2JZ0A 2CE7A 2QNJA 2DAIA 4A3VB 1A5TA 5LMUM 3IECA 3FTFA 5EXPA 3RE8A 2QP9X 3ZCBB 1EE8A 3AL0C 1D0MA 2CHQA 5L8RF 2RGOA 1AIWA 4R7GA 3VFDA 4DR5M 3FTEA 4QHTA 3WD2A 1DGFA 3TPZA 3KW6A 3JR4A 3AOEA 2ZTCA 3GLIE 4UN2B 3GLHA 4QHSA 1G3IA 4IBKA 5EXTA 4HLQA 1ED7A 4NC6A 1ZQ9A 3U61A 1G8PA 3GQ4A 1DGHA 2MGWA 5E26A 2Z4SA 1GO5A 1XMQM 1OAOC 1XB2B 4JI0M 3WHKA 1IXSB 1NV9A 1T3TA 4RF1A 1NJFA 1N34M 1E6RA 2ZM6M 8CATA 2DHRA 3KOYE 4IJEA 2Z4RA 4D81A 2QZ4A 4B3SM 5F3WA 4OJ6A 2DWZB 2VF7A 2Y0TA 3A45A 1XNQM 1R4GA 1WJ7A 4M9SA 3GPPA 3JAMS 4LG2A 4OX9M 4FW9A 2Y2KA 4AKHA 1MX0A 1E9SA 4MGIE 2LTUA 1Q3CA 2AHMA 2F5SA 2CHGA 3HU2A 2D7GA 5EP3A 2YQZA 3KFUG 4LZJA 2APLA 2BWBA 1ZMVA 2UUBM 1Z6TA 1E32A 2HAKA 3D8LA 4QOSA 3RGPA 3U6QA 3I01M 3FKEA 3CGWA 1T43A 4Z2IA 3PFIA 2Y2NA 4MH0E 4DV5M 5KPTA 1QVRA 1Q39A 4DV0M 1PJTA 4RF0A 5IT9S 2KRKA 1GJTA 1MJGM 2FOIC 1VEJA 2V6ZM 4I81A 4IBBA 4LF7M 2WSFF 2KDLA 1HR0M 1UM8A 1GPFA 4L78A 2LNHC 3E4RA 4NSOB 2MR9A 1W1TA 4LF8M 3GP1A 4B3RM 1OTRA 1IXZA 3M7GA 1NHWC 1IXRC 3GRRA 2BJWA 5FSWA 4X62M 3TL4X 3SYKA 3T1HM 1L2DA 4KT0F 1H6UA 3LCVB 4LJ4A 4B7HA 4DV4M 2JA2A 3ZH9B 4FCWA 3T6PA 4IBCA 3L29A 2UXCM 4GITA 4KLNA 4DR3M 4B08A 2L4FA 3B9PA 4EIWA 4QOZC 5BR8M 2FFFB 2D7EA 4JV5M 2L6OA 4JYAM 3FYDA 1R6BX 3TWKA 3RGSA 5FTKA 2Y2LA 2R18A 5DFLA 4NZ4A 3W68A 3DZDA 1HNXM 2QHOB 2JE5A 4NRVA 4GHAA 1IXSA 1Q02A 2HCBA 1VEKA 4FCVA 1KFVA 3FYCA 4LJ5A 3A46A 2DXIA 1NNUC 4CGYB 1Z59A 5KPZA 2DKLA 1OIZA 1ZMUA 1IY0A 4KODA 1W1VA 2C96A 4AW4A 2Y2PA 1OFHA 4MB4A 1CUKA 2DWLA 2Y2JA 4FWGA 2DAGA 3SASA 4NYUA 1X37A 1NHGC 2BWEA 4DV2M 1LTMA 4B7FA 4FCTA 2W82A 1V92A 3I51A 2BJVA 4AKIA 2R65A 1VEGA 2XFSA 3VKGA 1PJSA 3MQLA 2Z8YM 4LZZA 2Y2GA 1NY6A 3CF0A 4WP2A 3GO8A 2VDBB 2FS1A 4MGZE 2XSZA 3B74A 1N77A 4AKGA 2QCUA 5KPRA 3KVWA 2KZUA 3MHVC 3NBXX 3SYLA 2D49A 4QNLA 3GRUA 2R0IA 2X49A 3K1JA 4IBGA 2CV1A 2ZAMA 1R2YA 3UMMA 3HU3A 4Z8XA 1GKIA 2KNZA 2C98A 1GJSA 2N35A 4GIPA 3FTCA 3UK6A 1PDCA 3VK8A 3VDPA 1EIJA 4XGIA 3HHYA 2CEAA 2JP7A 2EJSA 3OTOM 3C9PA 4RNAA 2Y21A 4OJLA 2CWBA 3J80S 1DGGA 4TUWA 3GQ5A 2C99A 3M6AA 1GABA 1GLNA 2Y2QA 2L2DA 5H37D 4JI6M 2KHHA 3K9PA 3GLIB 2JY6B 2Y2OA 4NL4H 4NZ5A 2NQ8C 4NSRA 3UGJA 3GLFB 1O6IA 1IN7A 4LGYA 1NO1A 3TQSA 2KXEA 1H8PA 5KQDA 2VF8A 3VDUA 2R62A 2R4JA 2XEPA 1NJGA 2JZ1A 1FNNA 2CP8A 2GNOA 2JUJA 1IM2A 5EP2A 1R5LA 1EAKA 4HMDA 1IN6A 4MGYE 1L2CA 4BBAA 3HX3A 3HGIA 2G8LA 3SARA 2HL7A 2HKJA 2VQEM 2DZLA 4JI3M 3SHGB 1TF0B 5BPVA 3T38A 1L2BA 1OGGA 1WR1B 4OW0A 3D8BA 2L7IA 3GLFE 3QYEA 1FJGM 5ITQA 1UR8A 3K9OA 3KOWE 2V1CA 2UU9M 4JI8M 1Z5CA 2G3QA 1ZV1A 1D0LA 3C3DA 4HEOA 3IHPA 1UR9A 4BLCA 1TH2A 1IY1A 3HHWA 4B7GA 4PDGA 4MGHA 3NWLA 4F1IA 5ITTA 5IREB 1D2NA 2G5GX 3KS8A 2C5RA 3FTDA 3J27B 2M60A 1K82A 1IN4A 1NSFA 5ITYA 1AIPC 3HKPA 5ITXA 1IBMM 2CV0A 2FN2A 3T15A 4LRTA 1PJJA 4LF6M 5FTJA 4DR7M 4K0KM 1QAMA 3HJ8A 3EIEA 1R7RA 2DVWB 1SXJA 3TE6A 2RTSA 3KOXE 1HJPA 1G71A 4I8OA 1RU3A 1GL6A 4LCBA 3U6DA 1WIVA 2Y2MA 1KYIA 1NVMA 4IIWA 1VDDA 3ZQJA 4CHTB 1E6ZA 3GRVA 3FRIA 2CRUA 4OU7A 2VIIA 4R3DA 1AUAA 1MN3A 1K3WA 2JCHA 2J7OA 1HT2E 1J7MA 2OOAA 3GPXA 4GKJM 4NZ1A 2DHYA 1EFUB 4M0WA 4M9ZA 4GH9A 2EUCA 4DR6M 3GLIA 2F5QA 2XLJA 3M0EA 3LVVA 1VDLA 4AG5A 3LQRA 2Y2IA 3GLFA 1L1ZA 3MMPA 4Y28F 3WD0A 2DAKA 4LF9M 5A2QS 4LF5M 4HL4A 1QAQA 4Z2KA 4ZPXA 3PXGA 5FTLA 2QENA 2CUZA 2HWJA 1JQJC 1W5TA 3SC3A 4DR2M 2XH9A 3NBIA 1ZAEA 1C7YA 3U6PA 1YUEA 2DAMA 3HU1A 4LJ8A 3KOZE 4X64M 1IBKM 3AOEC 1Z5BA 2O25A 2J5YA 3J7BA 2CFOA 4LY6A 2KW0A 3BBZA 1N75A 2FFJA 4AG6A 7CATA 4MGKE 3FUTA 2DWMA 4X66M 1XXHB 1GVNA 4G4NA 1V33A 2FH0A 4Z2HA 1DGBA 1JR3D 4LFCM 3VKHA 4L15A 3R8FA 1I94M 4P17A 2KNVA 3GLGB 2KZSA 4II7A 1WHCA 1YU4A 5DNYA 2V5OA 5FLXS 1CXWA 1TTEA 1WGNA 1WXQA 2ERCA 2LVQD 3H4JA 2LBCA 2Z3XA 3B7ZA 4G4RA 2RKOA 3U60A 1XC8A 5FTMA 3RFWA 3E46A 5GKNA 2HHHM 3Q8XA 2UXBM 2C9OA 3U6EA 1N33M 4GMQA 3SBJA 3FUWA 4LF4M 2F5PA 1ORYB 1XXHE 1JR3E 1OKSA 2LHGA 1Q3BA 2C9CA 3LW5F 4FWDA 1JB0F 2K0BX 1HT1E 2DAEA 2GQFA 3V76A 3LVWA 5E6JA 5IWAM 5FTNA 3GRYA 1Z5AA 2Q2EB 4LGMA 2JY8A 1HNWM 3GLGE 1L1TA 3QAUA 4LRSA 2BNKA 2F5OA 5C18A 4PDIA 5DYIA 1C1KA 2MH8A 4OUIA 3U6CA 3FRHA 4IBEA 4YY3M 4AZFA 2XD1A 1H0GA 2J7NA 2K9DA 3KDSE 3JR5A 5KO3A 4GKKM 3AV0A 4NOOB 2FNAA 4Z6YA 3DA1A 3KP0E 4AI6A 2DZNB 4FD2A 5JI2E 5IZ7D 3QYBA 2ZANA 3TWMA 1J7KA 3WD1A 2EKFA 4GEWA 2QQ8A 3I4VA 3GQ3A 3L27A 3EIHA 2ZAOA 4I4LA 2DNAA 2M5ZA 1K3XA 3HJQA 3A42A 3R9XB 2D7HA 1DGHB 4QNRA 5EJCA 1XNRM 1V34A 2L4EA 2LVOC 3IG5A 4D82A 2YFQA 2WZJA 3QWLA 1IN8A 1PGYA 2B3TA 2KEBA 3AJIB 4DV3M 2XZFA 1SG9A 1QUSA 2K6BA 3J2PB 3UJNA 3GPYA 4Z2GA 1XXHA 1JR3A 2FE8A 2JY7A 4DUYM 2UUAM 4GC9A 2KNAA 1QANA 2QPAA 1OIPA 1YU3A 1IBLM 1E88A 3GLHE 3LQQA 4MB7A 1YE9A 4B3MM 2H1RA 4D80A 2I7NA 3K8ZA 4LJ7A 1QZMA 1TR8A 4NXNM 3GLGA 4NYYA 4ANRA 4DR1M 2R4EA 3KP1E 2LVNC 3W67A 2Y0QA 4X65M 1YU0A 3M7PA 4NXMM 2QBYB 3WD3A 2V1UA 3HHZA 1YSYA 2E5LM 3SMPA 2UUCM 3W0LB 2VQFM 4LJAA 3B7QA 2JNHA 2ZBKB 1PM5A 3SAWA 4JXJA 3BXWA 2QSFX 2RRUA 1IQPA 1G41A 3WHLA 4NY2A 2Z7JA 1DO0A 3U6SA 1PRBA 3KSJA 3ZC7B 5EQTA 1WGLA 4PCZA 2L7HA 3U5ZB 2LVPC 4G4QA 4KHPM 1QO6A 4XBOA 1XMOM 4L8RC 2MJ5B 2Y2HA 4LJ6A 2JWSA 1VQ1A 4CJ6A 3MK6A 3U60B 4NRWA 1H0IA 1TGUA 3THGA 3HONA 3PVSA 3AKZA 2R46A 2F5NA 1S3SA 2JXNA 4P16A 3LMMA 1GXDA 4ITQA 1QZEA 4GRIA 5ITUA 4OVZB 1YLAA 4OJOA 4PD2A 1W1PA 4IBJA 5JI3E 1NNJA 1KSFX 4IBFA 3DFZA 4LFAM 1N36M 1MU5A 1IY2A 3SFZA 3F92A 3FUUA 4AQYM 1OGBA 1L8QA 2DI0A 4JI7M 4MB3A 3DOAA 4MM3B 4Q7JA 2LH0A 2Y20A 4L4UA 2O01F 2R44A 2X4AA 3C58A 2WSCF 3SAVA 1NY5A 3J7AS 3VK7A 3FUXA 2R6FA 1YU1A 1R2ZA 2RGHA 2QBYA 4IJFA 4S12A 3K2LA 4CISA 1E6NA 1P3QQ 4JI2M 3HY5A 3BOSA 4I5SA 1OAIA 3SMSA 3IG8A 3GPUA 1E9RA 1VG5A 3PNYA 2BG1A 1XHBA 2XSZD 4JI1M 3HSHA 1ZMWA 2MROB 4DV7M 2EO2A 3C3EA 4MB5A 1TDZA 2A5YB 2UWXA 1E6PA 5C1BA 4HMCA 4FWHA 3SATA 2O5RA 3CF6E 4IBIA
chains in the Genus database with same CATH topology
4GC5A 1TDHA 2LWXA 3U5ZA 1HQCA 4GHLA 3UZUA 3FD9A 3L2AA 4KO8A 3T1YM 2EA0A 4G4OA 1LV7A 2DWNA 2UXDM 3N3FA 3WX7A 1I4WA 5ITRA 2F4VM 3U6MA 1E94E 4FVMA 3HWSA 2YR0A 3KSXA 3U60A 1SXJC 3W0FA 3FUVA 4JI5M 1PJIA 4JI4M 2OPFA 2IOUA 4OJ5A 1N32M 1OJLA 3A98B 4W5WA 5EP1A 4OVZA 4LJ9A 1QAOA 3I4YA 3K92A 2CV2A 1XWIA 4B3TM 3SHFA 1TH4A 1G4AE 3HHXA 3CF2A 3ILKA 3HJSA 2R45A 1G59A 1N78A 1DO2A 4REZA 2L09A 2XZUA 2KRUA 4LFBM 1J5EM 4PT5A 1QYRA 3GLHB 4DV6M 5LMNM 4DR4M 1QQWA 5EXSA 1HQYE 2XGNA 3U61B 3U6LA 2XD5A 1HNZM 2P5TA 1IN5A 2XFTA 5DYGA 3AFHA 4OJPA 3H4MA 1J09A 3PNVA 2XF3A 4WW0A 4WURA 3AOGA 5EXXA 4YHHM 3J81S 2YNMD 4JN6A 4QNMA 3VLFB 4IBDA 3L26A 1YUBA 5EP4A 3KS4A 3U6OA 3L25A 1SXJB 2KA6B 2DZOB 2LXEA 1SXJD 3TWLA 3MJ5A 4M9XA 4DUZM 3L28A 4DV1M 4L16A 4BB9A 1W5SA 2CHVA 2I7PA 3E9SA 5ITXE 1TH3A 4G6ZA 1OFIA 1YU2A 2X8AA 4M0DA 5KQ8A 2K47A 4NZ3A 1GL7A 1SXJE 3CTWB 3SAUA 3KXEC 2OQ4A 2CE7A 4A3VB 5LMUM 3FTFA 5EXPA 3RE8A 2QP9X 3ZCBB 1EE8A 3AL0C 2CHQA 2RGOA 4R7GA 3VFDA 4DR5M 3FTEA 4QHTA 1DGFA 3TPZA 3KW6A 3JR4A 3AOEA 3GLHA 4QHSA 1G3IA 4IBKA 5EXTA 4HLQA 1ZQ9A 3U61A 1G8PA 3GQ4A 1DGHA 5E26A 2Z4SA 1XMQM 4JI0M 3WHKA 1IXSB 1T3TA 4RF1A 1N34M 1NJFA 2ZM6M 8CATA 2DHRA 3KOYE 4IJEA 2Z4RA 4D81A 2QZ4A 4B3SM 5F3WA 4OJ6A 2DWZB 2Y0TA 3A45A 1XNQM 4M9SA 3GPPA 3JAMS 4LG2A 4OX9M 4FW9A 2Y2KA 4AKHA 1MX0A 1E9SA 4MGIE 1Q3CA 2AHMA 2F5SA 2CHGA 3HU2A 2D7GA 5EP3A 2YQZA 3KFUG 4LZJA 2UUBM 1Z6TA 1E32A 3D8LA 4QOSA 3RGPA 3U6QA 3FKEA 3PFIA 2Y2NA 4MH0E 4DV5M 5KPTA 1QVRA 1Q39A 4DV0M 5IT9S 4RF0A 2FOIC 2KRKA 2V6ZM 4I81A 4IBBA 4LF7M 1HR0M 1UM8A 4L78A 2LNHC 3E4RA 4NSOB 4LF8M 3GP1A 4B3RM 1IXZA 3M7GA 1NHWC 1IXRC 3GRRA 2BJWA 5FSWA 4X62M 3TL4X 3SYKA 3T1HM 1L2DA 1H6UA 4LJ4A 4B7HA 4DV4M 2JA2A 3ZH9B 4FCWA 4IBCA 3L29A 2UXCM 4GITA 4KLNA 4DR3M 4B08A 3B9PA 4EIWA 4QOZC 5BR8M 2FFFB 2D7EA 4JV5M 2L6OA 4JYAM 3FYDA 1R6BX 3TWKA 3RGSA 5FTKA 2Y2LA 2R18A 4NZ4A 3DZDA 1HNXM 2JE5A 4NRVA 4GHAA 1KFVA 2HCBA 4FCVA 3FYCA 4LJ5A 3A46A 2DXIA 1NNUC 4CGYB 1Z59A 5KPZA 1IY0A 4KODA 2Y2PA 2C96A 4AW4A 1OFHA 2DWLA 2Y2JA 4FWGA 3SASA 4NYUA 1X37A 1NHGC 4DV2M 4B7FA 4FCTA 2W82A 3I51A 2BJVA 4AKIA 2R65A 2XFSA 3VKGA 4LZZA 2Y2GA 1NY6A 3CF0A 3GO8A 4MGZE 2XSZA 1N77A 4AKGA 2QCUA 5KPRA 3KVWA 2KZUA 3MHVC 3SYLA 4QNLA 3GRUA 2X49A 3K1JA 4IBGA 2CV1A 2ZAMA 1R2YA 3UMMA 3HU3A 4Z8XA 1GKIA 2C98A 4GIPA 3FTCA 3UK6A 3VK8A 3VDPA 4XGIA 3HHYA 2CEAA 3OTOM 4RNAA 2Y21A 4OJLA 3J80S 4TUWA 1DGGA 3GQ5A 2C99A 3M6AA 1GLNA 2Y2QA 5H37D 4JI6M 3GLIB 2Y2OA 4NL4H 4NZ5A 2NQ8C 4NSRA 3UGJA 3GLFB 1IN7A 4LGYA 3TQSA 2KXEA 5KQDA 3VDUA 2R62A 2R4JA 2XEPA 1NJGA 1FNNA 5EP2A 1IM2A 1IN6A 4MGYE 1L2CA 4BBAA 3HGIA 2G8LA 3SARA 2HL7A 2HKJA 2VQEM 4JI3M 3SHGB 1L2BA 5BPVA 3T38A 4OW0A 3D8BA 2L7IA 1FJGM 5ITQA 3KOWE 2V1CA 2UU9M 4JI8M 1Z5CA 4BLCA 1TH2A 1IY1A 3HHWA 4B7GA 4PDGA 4MGHA 3NWLA 5ITTA 5IREB 1D2NA 2G5GX 3KS8A 2C5RA 3FTDA 3J27B 2M60A 1K82A 1IN4A 1NSFA 5ITYA 3HKPA 5ITXA 1IBMM 2CV0A 3T15A 4LRTA 1PJJA 4LF6M 5FTJA 4DR7M 4K0KM 1QAMA 3HJ8A 3EIEA 1R7RA 2DVWB 1SXJA 3TE6A 3KOXE 4I8OA 4LCBA 1GL6A 3U6DA 2Y2MA 1KYIA 1NVMA 4IIWA 1VDDA 4CHTB 3GRVA 1K3WA 2JCHA 4OU7A 2VIIA 4R3DA 2J7OA 1HT2E 3GPXA 4GKJM 4NZ1A 4M0WA 4M9ZA 4GH9A 2EUCA 4DR6M 3GLIA 2F5QA 2XLJA 3M0EA 3LVVA 4AG5A 2Y2IA 3LQRA 3GLFA 1L1ZA 4LF9M 5A2QS 4LF5M 4HL4A 1QAQA 4ZPXA 3PXGA 5FTLA 2QENA 2CUZA 1JQJC 1W5TA 3SC3A 4DR2M 2XH9A 3NBIA 1ZAEA 3U6PA 1YUEA 3HU1A 4LJ8A 3KOZE 4X64M 1IBKM 3AOEC 1Z5BA 4LY6A 3J7BA 2CFOA 2KW0A 1N75A 2FFJA 4AG6A 7CATA 4MGKE 3FUTA 2DWMA 4X66M 1XXHB 1GVNA 4G4NA 1DGBA 1JR3D 4LFCM 3VKHA 4L15A 3R8FA 1I94M 3GLGB 2KZSA 4II7A 1YU4A 5DNYA 5FLXS 2ERCA 1WXQA 2Z3XA 4G4RA 1XC8A 2RKOA 2HHHM 5FTMA 3RFWA 2UXBM 5GKNA 3Q8XA 2C9OA 3U6EA 1N33M 4GMQA 3SBJA 3FUWA 4LF4M 2F5PA 1ORYB 4JI2M 1Q3BA 4FWDA 2C9CA 1HT1E 3LVWA 5E6JA 5IWAM 5FTNA 3GRYA 1Z5AA 2Q2EB 4LGMA 1HNWM 1L1TA 3QAUA 4LRSA 2BNKA 2F5OA 5C18A 4PDIA 5DYIA 1C1KA 4OUIA 3U6CA 4IBEA 2XD1A 4YY3M 4AZFA 2J7NA 3KDSE 3JR5A 5KO3A 4GKKM 3AV0A 4NOOB 2FNAA 4Z6YA 3DA1A 3KP0E 4AI6A 2DZNB 4FD2A 5JI2E 5IZ7D 3TWMA 2ZANA 1J7KA 3I4VA 3GQ3A 3L27A 3EIHA 2ZAOA 4I4LA 2M5ZA 1K3XA 3HJQA 3A42A 3R9XB 2D7HA 1DGHB 4QNRA 5EJCA 1XNRM 3IG5A 4D82A 2YFQA 3QWLA 1IN8A 2KEBA 4DV3M 2XZFA 3AJIB 3GPYA 3J2PB 3UJNA 1XXHA 1JR3A 2FE8A 4DUYM 2UUAM 4GC9A 1QANA 2QPAA 1YU3A 1IBLM 3LQQA 4MB7A 1YE9A 4B3MM 2H1RA 4D80A 2I7NA 3K8ZA 4LJ7A 1QZMA 3GLGA 4NXNM 4NYYA 4DR1M 2R4EA 3KP1E 2Y0QA 4X65M 1YU0A 4NXMM 2QBYB 2V1UA 3HHZA 1YSYA 2E5LM 3SMPA 2UUCM 3W0LB 2VQFM 4LJAA 2ZBKB 1PM5A 3SAWA 4JXJA 1IQPA 1G41A 3WHLA 4NY2A 2Z7JA 1DO0A 3U6SA 3KSJA 3ZC7B 5EQTA 4PCZA 2L7HA 3U5ZB 4G4QA 4KHPM 4XBOA 1XMOM 4L8RC 2Y2HA 4LJ6A 4NRWA 3U60B 3MK6A 1TGUA 3THGA 3HONA 3PVSA 3AKZA 2R46A 2F5NA 1S3SA 4P16A 3LMMA 4ITQA 4GRIA 5ITUA 4OVZB 4OJOA 4PD2A 4IBJA 5JI3E 1NNJA 1KSFX 4IBFA 3DFZA 4LFAM 1N36M 1MU5A 1IY2A 3SFZA 3FUUA 4AQYM 1L8QA 4JI7M 3DOAA 4MM3B 2LH0A 2Y20A 4L4UA 2X4AA 3C58A 3SAVA 1NY5A 3J7AS 3VK7A 3FUXA 1YU1A 1R2ZA 2RGHA 2QBYA 4IJFA 4S12A 3K2LA 4CISA 3BOSA 4I5SA 3SMSA 3IG8A 3GPUA 1E9RA 3PNYA 2BG1A 1XHBA 2XSZD 4JI1M 3HSHA 4DV7M 2EO2A 1TDZA 2A5YB 2UWXA 5C1BA 4FWHA 3SATA 2O5RA 3CF6E 4IBIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IBG A;  3KS8 A;  3KS4 A;  4LG2 A;  4GHL A;  3L2A A;  3L25 A;  3L27 A;  4IBC A;  3L29 A;  5BPV A;  4IJF A;  3L28 A;  4IBK A;  3FKE A;  4IBJ A;  4IBF A;  4GH9 A;  4IBE A;  4GHA A;  4IBD A;  4IBB A;  4IJE A;  3L26 A;  4IBI A; 
#chains in the Genus database with same CATH topology
 3HZJ A;  1TDH A;  4GC5 A;  2LWX A;  3U5Z A;  1HQC A;  4GHL A;  3UZU A;  3FD9 A;  3L2A A;  4KO8 A;  3T1Y M;  1DV0 A;  2EA0 A;  4G4O A;  1LV7 A;  2DWN A;  2UXD M;  3N3F A;  3WX7 A;  1I4W A;  5ITR A;  2F4V M;  3U6M A;  1E94 E;  1BVS A;  3HWS A;  2YR0 A;  3I04 M;  3KSX A;  4FVM A;  1SXJ C;  3W0F A;  3FUV A;  2EKK A;  3E21 A;  4Z2J A;  4XK8 F;  4JI5 M;  1PJI A;  4JI4 M;  2OPF A;  2IOU A;  4OJ5 A;  1N32 M;  1OJL A;  3A98 B;  4W5W A;  5EP1 A;  4OVZ A;  4TX8 A;  4LJ9 A;  1QAO A;  3I4Y A;  3B7N A;  1PJQ A;  1NV8 A;  1QDR A;  1QUT A;  1XWI A;  3K92 A;  2CV2 A;  4B3T M;  1Y8G A;  3SHF A;  1F4I A;  1IFY A;  1TH4 A;  1G4A E;  3HHX A;  3CF2 A;  3ILK A;  3HJS A;  2R45 A;  1G59 A;  1N78 A;  1DO2 A;  4REZ A;  2L09 A;  2XZU A;  1T6O A;  2KRU A;  4LFB M;  4HME A;  1J5E M;  4PT5 A;  1QYR A;  2LVA A;  3GLH B;  4CIZ A;  4F2L A;  4DV6 M;  5LMN M;  4DR4 M;  1W1Y A;  1QQW A;  5EXS A;  1HQY E;  2XGN A;  3U61 B;  2WSE F;  3U6L A;  2XD5 A;  1HNZ M;  2LHC A;  2P5T A;  1IN5 A;  2XFT A;  5DYG A;  3AFH A;  4OJP A;  3H4M A;  1J09 A;  3PNV A;  2XF3 A;  4WW0 A;  4G3O A;  4WUR A;  3AOG A;  3B89 A;  4RKU F;  5EXX A;  2H5X A;  4YHH M;  2YNM D;  4JN6 A;  4QNM A;  3VLF B;  3J81 S;  4IBD A;  1L6J A;  4L6V 6;  1CK7 A;  1KS0 A;  1OQY A;  3L26 A;  3WD4 A;  1E15 A;  1YUB A;  5EP4 A;  1GOI A;  3KS4 A;  1D0K A;  3U6O A;  4R71 A;  3L25 A;  1QDT A;  1SXJ B;  2KA6 B;  1UFZ A;  3Q8G A;  2DZO B;  2LXE A;  1SXJ D;  3TWL A;  3MJ5 A;  4M9X A;  2ZTD A;  3FE3 A;  4DUZ M;  3L28 A;  3LCU A;  4DV1 M;  2OOB A;  4DBG B;  4L16 A;  4BB9 A;  1W5S A;  2CHV A;  2I7P A;  3E9S A;  5ITX E;  1TH3 A;  2DEN A;  4G6Z A;  1OFI A;  1YU2 A;  2X8A A;  4M0D A;  5KQ8 A;  2JY5 A;  2K47 A;  1E8B A;  4NZ3 A;  1GL7 A;  1SXJ E;  3CTW B;  3SAU A;  4Z2L A;  3KXE C;  2OQ4 A;  2OO9 A;  2JZ0 A;  2CE7 A;  2QNJ A;  2DAI A;  4A3V B;  1A5T A;  5LMU M;  3IEC A;  3FTF A;  5EXP A;  3RE8 A;  2QP9 X;  3ZCB B;  1EE8 A;  3AL0 C;  1D0M A;  2CHQ A;  5L8R F;  2RGO A;  1AIW A;  4R7G A;  3VFD A;  4DR5 M;  3FTE A;  4QHT A;  3WD2 A;  1DGF A;  3TPZ A;  3KW6 A;  3JR4 A;  3AOE A;  2ZTC A;  3GLI E;  4UN2 B;  3GLH A;  4QHS A;  1G3I A;  4IBK A;  5EXT A;  4HLQ A;  1ED7 A;  4NC6 A;  1ZQ9 A;  3U61 A;  1G8P A;  3GQ4 A;  1DGH A;  2MGW A;  5E26 A;  2Z4S A;  1GO5 A;  1XMQ M;  1OAO C;  1XB2 B;  4JI0 M;  3WHK A;  1IXS B;  1NV9 A;  1T3T A;  4RF1 A;  1NJF A;  1N34 M;  1E6R A;  2ZM6 M;  8CAT A;  2DHR A;  3KOY E;  4IJE A;  2Z4R A;  4D81 A;  2QZ4 A;  4B3S M;  5F3W A;  4OJ6 A;  2DWZ B;  2VF7 A;  2Y0T A;  3A45 A;  1XNQ M;  1R4G A;  1WJ7 A;  4M9S A;  3GPP A;  3JAM S;  4LG2 A;  4OX9 M;  4FW9 A;  2Y2K A;  4AKH A;  1MX0 A;  1E9S A;  4MGI E;  2LTU A;  1Q3C A;  2AHM A;  2F5S A;  2CHG A;  3HU2 A;  2D7G A;  5EP3 A;  2YQZ A;  3KFU G;  4LZJ A;  2APL A;  2BWB A;  1ZMV A;  2UUB M;  1Z6T A;  1E32 A;  2HAK A;  3D8L A;  4QOS A;  3RGP A;  3U6Q A;  3I01 M;  3FKE A;  3CGW A;  1T43 A;  4Z2I A;  3PFI A;  2Y2N A;  4MH0 E;  4DV5 M;  5KPT A;  1QVR A;  1Q39 A;  4DV0 M;  1PJT A;  4RF0 A;  5IT9 S;  2KRK A;  1GJT A;  1MJG M;  2FOI C;  1VEJ A;  2V6Z M;  4I81 A;  4IBB A;  4LF7 M;  2WSF F;  2KDL A;  1HR0 M;  1UM8 A;  1GPF A;  4L78 A;  2LNH C;  3E4R A;  4NSO B;  2MR9 A;  1W1T A;  4LF8 M;  3GP1 A;  4B3R M;  1OTR A;  1IXZ A;  3M7G A;  1NHW C;  1IXR C;  3GRR A;  2BJW A;  5FSW A;  4X62 M;  3TL4 X;  3SYK A;  3T1H M;  1L2D A;  4KT0 F;  1H6U A;  3LCV B;  4LJ4 A;  4B7H A;  4DV4 M;  2JA2 A;  3ZH9 B;  4FCW A;  3T6P A;  4IBC A;  3L29 A;  2UXC M;  4GIT A;  4KLN A;  4DR3 M;  4B08 A;  2L4F A;  3B9P A;  4EIW A;  4QOZ C;  5BR8 M;  2FFF B;  2D7E A;  4JV5 M;  2L6O A;  4JYA M;  3FYD A;  1R6B X;  3TWK A;  3RGS A;  5FTK A;  2Y2L A;  2R18 A;  5DFL A;  4NZ4 A;  3W68 A;  3DZD A;  1HNX M;  2QHO B;  2JE5 A;  4NRV A;  4GHA A;  1IXS A;  1Q02 A;  2HCB A;  1VEK A;  4FCV A;  1KFV A;  3FYC A;  4LJ5 A;  3A46 A;  2DXI A;  1NNU C;  4CGY B;  1Z59 A;  5KPZ A;  2DKL A;  1OIZ A;  1ZMU A;  1IY0 A;  4KOD A;  1W1V A;  2C96 A;  4AW4 A;  2Y2P A;  1OFH A;  4MB4 A;  1CUK A;  2DWL A;  2Y2J A;  4FWG A;  2DAG A;  3SAS A;  4NYU A;  1X37 A;  1NHG C;  2BWE A;  4DV2 M;  1LTM A;  4B7F A;  4FCT A;  2W82 A;  1V92 A;  3I51 A;  2BJV A;  4AKI A;  2R65 A;  1VEG A;  2XFS A;  3VKG A;  1PJS A;  3MQL A;  2Z8Y M;  4LZZ A;  2Y2G A;  1NY6 A;  3CF0 A;  4WP2 A;  3GO8 A;  2VDB B;  2FS1 A;  4MGZ E;  2XSZ A;  3B74 A;  1N77 A;  4AKG A;  2QCU A;  5KPR A;  3KVW A;  2KZU A;  3MHV C;  3NBX X;  3SYL A;  2D49 A;  4QNL A;  3GRU A;  2R0I A;  2X49 A;  3K1J A;  4IBG A;  2CV1 A;  2ZAM A;  1R2Y A;  3UMM A;  3HU3 A;  4Z8X A;  1GKI A;  2KNZ A;  2C98 A;  1GJS A;  2N35 A;  4GIP A;  3FTC A;  3UK6 A;  1PDC A;  3VK8 A;  3VDP A;  1EIJ A;  4XGI A;  3HHY A;  2CEA A;  2JP7 A;  2EJS A;  3OTO M;  3C9P A;  4RNA A;  2Y21 A;  4OJL A;  2CWB A;  3J80 S;  1DGG A;  4TUW A;  3GQ5 A;  2C99 A;  3M6A A;  1GAB A;  1GLN A;  2Y2Q A;  2L2D A;  5H37 D;  4JI6 M;  2KHH A;  3K9P A;  3GLI B;  2JY6 B;  2Y2O A;  4NL4 H;  4NZ5 A;  2NQ8 C;  4NSR A;  3UGJ A;  3GLF B;  1O6I A;  1IN7 A;  4LGY A;  1NO1 A;  3TQS A;  2KXE A;  1H8P A;  5KQD A;  2VF8 A;  3VDU A;  2R62 A;  2R4J A;  2XEP A;  1NJG A;  2JZ1 A;  1FNN A;  2CP8 A;  2GNO A;  2JUJ A;  1IM2 A;  5EP2 A;  1R5L A;  1EAK A;  4HMD A;  1IN6 A;  4MGY E;  1L2C A;  4BBA A;  3HX3 A;  3HGI A;  2G8L A;  3SAR A;  2HL7 A;  2HKJ A;  2VQE M;  2DZL A;  4JI3 M;  3SHG B;  1TF0 B;  5BPV A;  3T38 A;  1L2B A;  1OGG A;  1WR1 B;  4OW0 A;  3D8B A;  2L7I A;  3GLF E;  3QYE A;  1FJG M;  5ITQ A;  1UR8 A;  3K9O A;  3KOW E;  2V1C A;  2UU9 M;  4JI8 M;  1Z5C A;  2G3Q A;  1ZV1 A;  1D0L A;  3C3D A;  4HEO A;  3IHP A;  1UR9 A;  4BLC A;  1TH2 A;  1IY1 A;  3HHW A;  4B7G A;  4PDG A;  4MGH A;  3NWL A;  4F1I A;  5ITT A;  5IRE B;  1D2N A;  2G5G X;  3KS8 A;  2C5R A;  3FTD A;  3J27 B;  2M60 A;  1K82 A;  1IN4 A;  1NSF A;  5ITY A;  1AIP C;  3HKP A;  5ITX A;  1IBM M;  2CV0 A;  2FN2 A;  3T15 A;  4LRT A;  1PJJ A;  4LF6 M;  5FTJ A;  4DR7 M;  4K0K M;  1QAM A;  3HJ8 A;  3EIE A;  1R7R A;  2DVW B;  1SXJ A;  3TE6 A;  2RTS A;  3KOX E;  1HJP A;  1G71 A;  4I8O A;  1RU3 A;  1GL6 A;  4LCB A;  3U6D A;  1WIV A;  2Y2M A;  1KYI A;  1NVM A;  4IIW A;  1VDD A;  3ZQJ A;  4CHT B;  1E6Z A;  3GRV A;  3FRI A;  2CRU A;  4OU7 A;  2VII A;  4R3D A;  1AUA A;  1MN3 A;  1K3W A;  2JCH A;  2J7O A;  1HT2 E;  1J7M A;  2OOA A;  3GPX A;  4GKJ M;  4NZ1 A;  2DHY A;  1EFU B;  4M0W A;  4M9Z A;  4GH9 A;  2EUC A;  4DR6 M;  3GLI A;  2F5Q A;  2XLJ A;  3M0E A;  3LVV A;  1VDL A;  4AG5 A;  3LQR A;  2Y2I A;  3GLF A;  1L1Z A;  3MMP A;  4Y28 F;  3WD0 A;  2DAK A;  4LF9 M;  5A2Q S;  4LF5 M;  4HL4 A;  1QAQ A;  4Z2K A;  4ZPX A;  3PXG A;  5FTL A;  2QEN A;  2CUZ A;  2HWJ A;  1JQJ C;  1W5T A;  3SC3 A;  4DR2 M;  2XH9 A;  3NBI A;  1ZAE A;  1C7Y A;  3U6P A;  1YUE A;  2DAM A;  3HU1 A;  4LJ8 A;  3KOZ E;  4X64 M;  1IBK M;  3AOE C;  1Z5B A;  2O25 A;  2J5Y A;  3J7B A;  2CFO A;  4LY6 A;  2KW0 A;  3BBZ A;  1N75 A;  2FFJ A;  4AG6 A;  7CAT A;  4MGK E;  3FUT A;  2DWM A;  4X66 M;  1XXH B;  1GVN A;  4G4N A;  1V33 A;  2FH0 A;  4Z2H A;  1DGB A;  1JR3 D;  4LFC M;  3VKH A;  4L15 A;  3R8F A;  1I94 M;  4P17 A;  2KNV A;  3GLG B;  2KZS A;  4II7 A;  1WHC A;  1YU4 A;  5DNY A;  2V5O A;  5FLX S;  1CXW A;  1TTE A;  1WGN A;  1WXQ A;  2ERC A;  2LVQ D;  3H4J A;  2LBC A;  2Z3X A;  3B7Z A;  4G4R A;  2RKO A;  3U60 A;  1XC8 A;  5FTM A;  3RFW A;  3E46 A;  5GKN A;  2HHH M;  3Q8X A;  2UXB M;  2C9O A;  3U6E A;  1N33 M;  4GMQ A;  3SBJ A;  3FUW A;  4LF4 M;  2F5P A;  1ORY B;  1XXH E;  1JR3 E;  1OKS A;  2LHG A;  1Q3B A;  2C9C A;  3LW5 F;  4FWD A;  1JB0 F;  2K0B X;  1HT1 E;  2DAE A;  2GQF A;  3V76 A;  3LVW A;  5E6J A;  5IWA M;  5FTN A;  3GRY A;  1Z5A A;  2Q2E B;  4LGM A;  2JY8 A;  1HNW M;  3GLG E;  1L1T A;  3QAU A;  4LRS A;  2BNK A;  2F5O A;  5C18 A;  4PDI A;  5DYI A;  1C1K A;  2MH8 A;  4OUI A;  3U6C A;  3FRH A;  4IBE A;  4YY3 M;  4AZF A;  2XD1 A;  1H0G A;  2J7N A;  2K9D A;  3KDS E;  3JR5 A;  5KO3 A;  4GKK M;  3AV0 A;  4NOO B;  2FNA A;  4Z6Y A;  3DA1 A;  3KP0 E;  4AI6 A;  2DZN B;  4FD2 A;  5JI2 E;  5IZ7 D;  3QYB A;  2ZAN A;  3TWM A;  1J7K A;  3WD1 A;  2EKF A;  4GEW A;  2QQ8 A;  3I4V A;  3GQ3 A;  3L27 A;  3EIH A;  2ZAO A;  4I4L A;  2DNA A;  2M5Z A;  1K3X A;  3HJQ A;  3A42 A;  3R9X B;  2D7H A;  1DGH B;  4QNR A;  5EJC A;  1XNR M;  1V34 A;  2L4E A;  2LVO C;  3IG5 A;  4D82 A;  2YFQ A;  2WZJ A;  3QWL A;  1IN8 A;  1PGY A;  2B3T A;  2KEB A;  3AJI B;  4DV3 M;  2XZF A;  1SG9 A;  1QUS A;  2K6B A;  3J2P B;  3UJN A;  3GPY A;  4Z2G A;  1XXH A;  1JR3 A;  2FE8 A;  2JY7 A;  4DUY M;  2UUA M;  4GC9 A;  2KNA A;  1QAN A;  2QPA A;  1OIP A;  1YU3 A;  1IBL M;  1E88 A;  3GLH E;  3LQQ A;  4MB7 A;  1YE9 A;  4B3M M;  2H1R A;  4D80 A;  2I7N A;  3K8Z A;  4LJ7 A;  1QZM A;  1TR8 A;  4NXN M;  3GLG A;  4NYY A;  4ANR A;  4DR1 M;  2R4E A;  3KP1 E;  2LVN C;  3W67 A;  2Y0Q A;  4X65 M;  1YU0 A;  3M7P A;  4NXM M;  2QBY B;  3WD3 A;  2V1U A;  3HHZ A;  1YSY A;  2E5L M;  3SMP A;  2UUC M;  3W0L B;  2VQF M;  4LJA A;  3B7Q A;  2JNH A;  2ZBK B;  1PM5 A;  3SAW A;  4JXJ A;  3BXW A;  2QSF X;  2RRU A;  1IQP A;  1G41 A;  3WHL A;  4NY2 A;  2Z7J A;  1DO0 A;  3U6S A;  1PRB A;  3KSJ A;  3ZC7 B;  5EQT A;  1WGL A;  4PCZ A;  2L7H A;  3U5Z B;  2LVP C;  4G4Q A;  4KHP M;  1QO6 A;  4XBO A;  1XMO M;  4L8R C;  2MJ5 B;  2Y2H A;  4LJ6 A;  2JWS A;  1VQ1 A;  4CJ6 A;  3MK6 A;  3U60 B;  4NRW A;  1H0I A;  1TGU A;  3THG A;  3HON A;  3PVS A;  3AKZ A;  2R46 A;  2F5N A;  1S3S A;  2JXN A;  4P16 A;  3LMM A;  1GXD A;  4ITQ A;  1QZE A;  4GRI A;  5ITU A;  4OVZ B;  1YLA A;  4OJO A;  4PD2 A;  1W1P A;  4IBJ A;  5JI3 E;  1NNJ A;  1KSF X;  4IBF A;  3DFZ A;  4LFA M;  1N36 M;  1MU5 A;  1IY2 A;  3SFZ A;  3F92 A;  3FUU A;  4AQY M;  1OGB A;  1L8Q A;  2DI0 A;  4JI7 M;  4MB3 A;  3DOA A;  4MM3 B;  4Q7J A;  2LH0 A;  2Y20 A;  4L4U A;  2O01 F;  2R44 A;  2X4A A;  3C58 A;  2WSC F;  3SAV A;  1NY5 A;  3J7A S;  3VK7 A;  3FUX A;  2R6F A;  1YU1 A;  1R2Z A;  2RGH A;  2QBY A;  4IJF A;  4S12 A;  3K2L A;  4CIS A;  1E6N A;  1P3Q Q;  4JI2 M;  3HY5 A;  3BOS A;  4I5S A;  1OAI A;  3SMS A;  3IG8 A;  3GPU A;  1E9R A;  1VG5 A;  3PNY A;  2BG1 A;  1XHB A;  2XSZ D;  4JI1 M;  3HSH A;  1ZMW A;  2MRO B;  4DV7 M;  2EO2 A;  3C3E A;  4MB5 A;  1TDZ A;  2A5Y B;  2UWX A;  1E6P A;  5C1B A;  4HMC A;  4FWH A;  3SAT A;  2O5R A;  3CF6 E;  4IBI A; 
#chains in the Genus database with same CATH homology
 4GC5 A;  1TDH A;  2LWX A;  3U5Z A;  1HQC A;  4GHL A;  3UZU A;  3FD9 A;  3L2A A;  4KO8 A;  3T1Y M;  2EA0 A;  4G4O A;  1LV7 A;  2DWN A;  2UXD M;  3N3F A;  3WX7 A;  1I4W A;  5ITR A;  2F4V M;  3U6M A;  1E94 E;  4FVM A;  3HWS A;  2YR0 A;  3KSX A;  3U60 A;  1SXJ C;  3W0F A;  3FUV A;  4JI5 M;  1PJI A;  4JI4 M;  2OPF A;  2IOU A;  4OJ5 A;  1N32 M;  1OJL A;  3A98 B;  4W5W A;  5EP1 A;  4OVZ A;  4LJ9 A;  1QAO A;  3I4Y A;  3K92 A;  2CV2 A;  1XWI A;  4B3T M;  3SHF A;  1TH4 A;  1G4A E;  3HHX A;  3CF2 A;  3ILK A;  3HJS A;  2R45 A;  1G59 A;  1N78 A;  1DO2 A;  4REZ A;  2L09 A;  2XZU A;  2KRU A;  4LFB M;  1J5E M;  4PT5 A;  1QYR A;  3GLH B;  4DV6 M;  5LMN M;  4DR4 M;  1QQW A;  5EXS A;  1HQY E;  2XGN A;  3U61 B;  3U6L A;  2XD5 A;  1HNZ M;  2P5T A;  1IN5 A;  2XFT A;  5DYG A;  3AFH A;  4OJP A;  3H4M A;  1J09 A;  3PNV A;  2XF3 A;  4WW0 A;  4WUR A;  3AOG A;  5EXX A;  4YHH M;  3J81 S;  2YNM D;  4JN6 A;  4QNM A;  3VLF B;  4IBD A;  3L26 A;  1YUB A;  5EP4 A;  3KS4 A;  3U6O A;  3L25 A;  1SXJ B;  2KA6 B;  2DZO B;  2LXE A;  1SXJ D;  3TWL A;  3MJ5 A;  4M9X A;  4DUZ M;  3L28 A;  4DV1 M;  4L16 A;  4BB9 A;  1W5S A;  2CHV A;  2I7P A;  3E9S A;  5ITX E;  1TH3 A;  4G6Z A;  1OFI A;  1YU2 A;  2X8A A;  4M0D A;  5KQ8 A;  2K47 A;  4NZ3 A;  1GL7 A;  1SXJ E;  3CTW B;  3SAU A;  3KXE C;  2OQ4 A;  2CE7 A;  4A3V B;  5LMU M;  3FTF A;  5EXP A;  3RE8 A;  2QP9 X;  3ZCB B;  1EE8 A;  3AL0 C;  2CHQ A;  2RGO A;  4R7G A;  3VFD A;  4DR5 M;  3FTE A;  4QHT A;  1DGF A;  3TPZ A;  3KW6 A;  3JR4 A;  3AOE A;  3GLH A;  4QHS A;  1G3I A;  4IBK A;  5EXT A;  4HLQ A;  1ZQ9 A;  3U61 A;  1G8P A;  3GQ4 A;  1DGH A;  5E26 A;  2Z4S A;  1XMQ M;  4JI0 M;  3WHK A;  1IXS B;  1T3T A;  4RF1 A;  1N34 M;  1NJF A;  2ZM6 M;  8CAT A;  2DHR A;  3KOY E;  4IJE A;  2Z4R A;  4D81 A;  2QZ4 A;  4B3S M;  5F3W A;  4OJ6 A;  2DWZ B;  2Y0T A;  3A45 A;  1XNQ M;  4M9S A;  3GPP A;  3JAM S;  4LG2 A;  4OX9 M;  4FW9 A;  2Y2K A;  4AKH A;  1MX0 A;  1E9S A;  4MGI E;  1Q3C A;  2AHM A;  2F5S A;  2CHG A;  3HU2 A;  2D7G A;  5EP3 A;  2YQZ A;  3KFU G;  4LZJ A;  2UUB M;  1Z6T A;  1E32 A;  3D8L A;  4QOS A;  3RGP A;  3U6Q A;  3FKE A;  3PFI A;  2Y2N A;  4MH0 E;  4DV5 M;  5KPT A;  1QVR A;  1Q39 A;  4DV0 M;  5IT9 S;  4RF0 A;  2FOI C;  2KRK A;  2V6Z M;  4I81 A;  4IBB A;  4LF7 M;  1HR0 M;  1UM8 A;  4L78 A;  2LNH C;  3E4R A;  4NSO B;  4LF8 M;  3GP1 A;  4B3R M;  1IXZ A;  3M7G A;  1NHW C;  1IXR C;  3GRR A;  2BJW A;  5FSW A;  4X62 M;  3TL4 X;  3SYK A;  3T1H M;  1L2D A;  1H6U A;  4LJ4 A;  4B7H A;  4DV4 M;  2JA2 A;  3ZH9 B;  4FCW A;  4IBC A;  3L29 A;  2UXC M;  4GIT A;  4KLN A;  4DR3 M;  4B08 A;  3B9P A;  4EIW A;  4QOZ C;  5BR8 M;  2FFF B;  2D7E A;  4JV5 M;  2L6O A;  4JYA M;  3FYD A;  1R6B X;  3TWK A;  3RGS A;  5FTK A;  2Y2L A;  2R18 A;  4NZ4 A;  3DZD A;  1HNX M;  2JE5 A;  4NRV A;  4GHA A;  1KFV A;  2HCB A;  4FCV A;  3FYC A;  4LJ5 A;  3A46 A;  2DXI A;  1NNU C;  4CGY B;  1Z59 A;  5KPZ A;  1IY0 A;  4KOD A;  2Y2P A;  2C96 A;  4AW4 A;  1OFH A;  2DWL A;  2Y2J A;  4FWG A;  3SAS A;  4NYU A;  1X37 A;  1NHG C;  4DV2 M;  4B7F A;  4FCT A;  2W82 A;  3I51 A;  2BJV A;  4AKI A;  2R65 A;  2XFS A;  3VKG A;  4LZZ A;  2Y2G A;  1NY6 A;  3CF0 A;  3GO8 A;  4MGZ E;  2XSZ A;  1N77 A;  4AKG A;  2QCU A;  5KPR A;  3KVW A;  2KZU A;  3MHV C;  3SYL A;  4QNL A;  3GRU A;  2X49 A;  3K1J A;  4IBG A;  2CV1 A;  2ZAM A;  1R2Y A;  3UMM A;  3HU3 A;  4Z8X A;  1GKI A;  2C98 A;  4GIP A;  3FTC A;  3UK6 A;  3VK8 A;  3VDP A;  4XGI A;  3HHY A;  2CEA A;  3OTO M;  4RNA A;  2Y21 A;  4OJL A;  3J80 S;  4TUW A;  1DGG A;  3GQ5 A;  2C99 A;  3M6A A;  1GLN A;  2Y2Q A;  5H37 D;  4JI6 M;  3GLI B;  2Y2O A;  4NL4 H;  4NZ5 A;  2NQ8 C;  4NSR A;  3UGJ A;  3GLF B;  1IN7 A;  4LGY A;  3TQS A;  2KXE A;  5KQD A;  3VDU A;  2R62 A;  2R4J A;  2XEP A;  1NJG A;  1FNN A;  5EP2 A;  1IM2 A;  1IN6 A;  4MGY E;  1L2C A;  4BBA A;  3HGI A;  2G8L A;  3SAR A;  2HL7 A;  2HKJ A;  2VQE M;  4JI3 M;  3SHG B;  1L2B A;  5BPV A;  3T38 A;  4OW0 A;  3D8B A;  2L7I A;  1FJG M;  5ITQ A;  3KOW E;  2V1C A;  2UU9 M;  4JI8 M;  1Z5C A;  4BLC A;  1TH2 A;  1IY1 A;  3HHW A;  4B7G A;  4PDG A;  4MGH A;  3NWL A;  5ITT A;  5IRE B;  1D2N A;  2G5G X;  3KS8 A;  2C5R A;  3FTD A;  3J27 B;  2M60 A;  1K82 A;  1IN4 A;  1NSF A;  5ITY A;  3HKP A;  5ITX A;  1IBM M;  2CV0 A;  3T15 A;  4LRT A;  1PJJ A;  4LF6 M;  5FTJ A;  4DR7 M;  4K0K M;  1QAM A;  3HJ8 A;  3EIE A;  1R7R A;  2DVW B;  1SXJ A;  3TE6 A;  3KOX E;  4I8O A;  4LCB A;  1GL6 A;  3U6D A;  2Y2M A;  1KYI A;  1NVM A;  4IIW A;  1VDD A;  4CHT B;  3GRV A;  1K3W A;  2JCH A;  4OU7 A;  2VII A;  4R3D A;  2J7O A;  1HT2 E;  3GPX A;  4GKJ M;  4NZ1 A;  4M0W A;  4M9Z A;  4GH9 A;  2EUC A;  4DR6 M;  3GLI A;  2F5Q A;  2XLJ A;  3M0E A;  3LVV A;  4AG5 A;  2Y2I A;  3LQR A;  3GLF A;  1L1Z A;  4LF9 M;  5A2Q S;  4LF5 M;  4HL4 A;  1QAQ A;  4ZPX A;  3PXG A;  5FTL A;  2QEN A;  2CUZ A;  1JQJ C;  1W5T A;  3SC3 A;  4DR2 M;  2XH9 A;  3NBI A;  1ZAE A;  3U6P A;  1YUE A;  3HU1 A;  4LJ8 A;  3KOZ E;  4X64 M;  1IBK M;  3AOE C;  1Z5B A;  4LY6 A;  3J7B A;  2CFO A;  2KW0 A;  1N75 A;  2FFJ A;  4AG6 A;  7CAT A;  4MGK E;  3FUT A;  2DWM A;  4X66 M;  1XXH B;  1GVN A;  4G4N A;  1DGB A;  1JR3 D;  4LFC M;  3VKH A;  4L15 A;  3R8F A;  1I94 M;  3GLG B;  2KZS A;  4II7 A;  1YU4 A;  5DNY A;  5FLX S;  2ERC A;  1WXQ A;  2Z3X A;  4G4R A;  1XC8 A;  2RKO A;  2HHH M;  5FTM A;  3RFW A;  2UXB M;  5GKN A;  3Q8X A;  2C9O A;  3U6E A;  1N33 M;  4GMQ A;  3SBJ A;  3FUW A;  4LF4 M;  2F5P A;  1ORY B;  4JI2 M;  1Q3B A;  4FWD A;  2C9C A;  1HT1 E;  3LVW A;  5E6J A;  5IWA M;  5FTN A;  3GRY A;  1Z5A A;  2Q2E B;  4LGM A;  1HNW M;  1L1T A;  3QAU A;  4LRS A;  2BNK A;  2F5O A;  5C18 A;  4PDI A;  5DYI A;  1C1K A;  4OUI A;  3U6C A;  4IBE A;  2XD1 A;  4YY3 M;  4AZF A;  2J7N A;  3KDS E;  3JR5 A;  5KO3 A;  4GKK M;  3AV0 A;  4NOO B;  2FNA A;  4Z6Y A;  3DA1 A;  3KP0 E;  4AI6 A;  2DZN B;  4FD2 A;  5JI2 E;  5IZ7 D;  3TWM A;  2ZAN A;  1J7K A;  3I4V A;  3GQ3 A;  3L27 A;  3EIH A;  2ZAO A;  4I4L A;  2M5Z A;  1K3X A;  3HJQ A;  3A42 A;  3R9X B;  2D7H A;  1DGH B;  4QNR A;  5EJC A;  1XNR M;  3IG5 A;  4D82 A;  2YFQ A;  3QWL A;  1IN8 A;  2KEB A;  4DV3 M;  2XZF A;  3AJI B;  3GPY A;  3J2P B;  3UJN A;  1XXH A;  1JR3 A;  2FE8 A;  4DUY M;  2UUA M;  4GC9 A;  1QAN A;  2QPA A;  1YU3 A;  1IBL M;  3LQQ A;  4MB7 A;  1YE9 A;  4B3M M;  2H1R A;  4D80 A;  2I7N A;  3K8Z A;  4LJ7 A;  1QZM A;  3GLG A;  4NXN M;  4NYY A;  4DR1 M;  2R4E A;  3KP1 E;  2Y0Q A;  4X65 M;  1YU0 A;  4NXM M;  2QBY B;  2V1U A;  3HHZ A;  1YSY A;  2E5L M;  3SMP A;  2UUC M;  3W0L B;  2VQF M;  4LJA A;  2ZBK B;  1PM5 A;  3SAW A;  4JXJ A;  1IQP A;  1G41 A;  3WHL A;  4NY2 A;  2Z7J A;  1DO0 A;  3U6S A;  3KSJ A;  3ZC7 B;  5EQT A;  4PCZ A;  2L7H A;  3U5Z B;  4G4Q A;  4KHP M;  4XBO A;  1XMO M;  4L8R C;  2Y2H A;  4LJ6 A;  4NRW A;  3U60 B;  3MK6 A;  1TGU A;  3THG A;  3HON A;  3PVS A;  3AKZ A;  2R46 A;  2F5N A;  1S3S A;  4P16 A;  3LMM A;  4ITQ A;  4GRI A;  5ITU A;  4OVZ B;  4OJO A;  4PD2 A;  4IBJ A;  5JI3 E;  1NNJ A;  1KSF X;  4IBF A;  3DFZ A;  4LFA M;  1N36 M;  1MU5 A;  1IY2 A;  3SFZ A;  3FUU A;  4AQY M;  1L8Q A;  4JI7 M;  3DOA A;  4MM3 B;  2LH0 A;  2Y20 A;  4L4U A;  2X4A A;  3C58 A;  3SAV A;  1NY5 A;  3J7A S;  3VK7 A;  3FUX A;  1YU1 A;  1R2Z A;  2RGH A;  2QBY A;  4IJF A;  4S12 A;  3K2L A;  4CIS A;  3BOS A;  4I5S A;  3SMS A;  3IG8 A;  3GPU A;  1E9R A;  3PNY A;  2BG1 A;  1XHB A;  2XSZ D;  4JI1 M;  3HSH A;  4DV7 M;  2EO2 A;  1TDZ A;  2A5Y B;  2UWX A;  5C1B A;  4FWH A;  3SAT A;  2O5R A;  3CF6 E;  4IBI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...