4LG2A

Crystal structure of reston ebola virus vp35 rna binding domain bound to 12-bp dsrna
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
122
structure length
122
Chain Sequence
ISAKDLKEIMYDHLPGFGTAFHQLVQVICKIGKDNNLLDTIHAEFQASLADGDSPQCALIQITKRVPIFQDVPPPIIHIRSRGDIPRACQKSLRPAPPSPKIDRGWVCLFKMQDGKTLGLKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polymerase cofactor
publication title Ebolavirus VP35 coats the backbone of double-stranded RNA for interferon antagonism.
pubmed doi rcsb
source organism Reston ebolavirus
molecule tags Rna binding protein/rna
total genus 38
structure length 122
sequence length 122
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4lg2A01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4lg2A02
4IJFA 3L29A 4GHAA 4IBEA 3KS4A 4IBGA 3L26A 3L28A 5BPVA 4IBFA 3L2AA 4IBDA 4IJEA 4IBBA 4IBIA 4IBKA 4IBCA 3L25A 4GH9A 4IBJA 3L27A 3FKEA 4GHLA 3KS8A 4LG2A
chains in the Genus database with same CATH superfamily
5E26A 1WHCA 2BJVA 3Q8GA 4JI6M 4QNLA 2XZUA 2Z7JA 2DAMA 1N77A 1D2NA 1HQYE 2BWBA 2Y2KA 5L8RF 2VQFM 3L26A 1H8PA 5E6JA 2DENA 2J5YA 2F5SA 2HHHM 2DI0A 4B3TM 1J09A 4LY6A 1PRBA 5KO3A 1GOIA 2DZOB 3F92A 1W1TA 1YUEA 2XD5A 3L2AA 5IWAM 4IBDA 3TQSA 4B3MM 3LQQA 3LQRA 3C9PA 4XK8F 1EAKA 2XZFA 3JAMS 1NJGA 5FTLA 1GXDA 3PXGA 3ILKA 1ZV1A 2G3QA 2UXCM 2KRUA 2RRUA 3E46A 1MN3A 2P5TA 4AI6A 2KW0A 1YLAA 2Q2EB 3UJNA 4LCBA 1N33M 3FD9A 2Y2PA 3ZH9B 5JI2E 3IG8A 3J2PB 2V1UA 4G4OA 1NV9A 4LZJA 2MGWA 4L6V6 3W68A 4TX8A 3OTOM 4JI3M 4DR6M 3FTDA 1E8BA 4HMEA 2QQ8A 2ZBKB 4D80A 3K9OA 4NSOB 3THGA 3WX7A 1J7MA 2AHMA 2LTUA 2K0BX 4I81A 4Y28F 1IFYA 2XD1A 3KP0E 3WD3A 2LBCA 3FRIA 2YQZA 3CF0A 2ZANA 4LJ7A 2QBYA 2J7NA 3HWSA 2A5YB 3GLIB 3GRRA 2UWXA 2BWEA 1I4WA 3B89A 3LVVA 1C1KA 3WD2A 3PNYA 4LJAA 2Y2NA 3NBXX 1Q3BA 4MH0E 2V6ZM 3GPUA 2N35A 5C18A 3K92A 2F5QA 1OAIA 2K6BA 2F5OA 2XF3A 2RTSA 4G4NA 2LHGA 3GQ4A 4K0KM 7CATA 3U6DA 3IECA 3U5ZB 4HL4A 3KFUG 1E94E 1O6IA 4Z2HA 3GQ3A 3U61B 4CIZA 1D0MA 4PD2A 1AIPC 1OIZA 5FSWA 4DUZM 4NXNM 3R8FA 1GABA 1DV0A 4X62M 2F5PA 4GH9A 4S12A 4DR5M 4Z2KA 3SC3A 4B3RM 4FW9A 2OOAA 3Q8XA 3GLHB 3VK7A 3KXEC 2UXDM 2HWJA 1F4IA 2QHOB 2WZJA 1PJSA 3SAVA 2DWNA 1W5SA 4DV6M 5ITTA 2CHQA 1TH3A 1L1TA 4R7GA 4Z2GA 1R2ZA 2XSZD 5BR8M 2CEAA 1VEKA 5IT9S 3H4MA 3CF6E 3HZJA 3ZC7B 2GNOA 2RGHA 1K3WA 1IBMM 4LF7M 3H4JA 1WGLA 2DAIA 2WSEF 1QUSA 1R7RA 2X49A 3SARA 1J5EM 1SXJA 3KOXE 3FKEA 1H6UA 4M9SA 2BNKA 4HEOA 3TWKA 4X65M 3TWMA 5DYGA 4F1IA 4JV5M 4XGIA 2CRUA 3BXWA 2KHHA 1YU4A 3SYKA 3T6PA 3DFZA 4CGYB 1QUTA 3HU1A 1N34M 1Z6TA 4AG5A 3SMSA 4NZ1A 3UZUA 2DHYA 3WD4A 1VEGA 1NVMA 4MB4A 1JQJC 4OW0A 2JCHA 3WD1A 4FVMA 1PGYA 3GLFA 2EA0A 1E9SA 1XXHB 1GPFA 3K1JA 3FUTA 1QVRA 3HKPA 4UN2B 4CISA 3FYDA 5KPRA 2FN2A 3UK6A 1DGHA 4OX9M 2XFTA 4LRTA 3ZCBB 4KT0F 1IY0A 4AW4A 4MB5A 1GL7A 1SXJD 4QHSA 4JYAM 3SBJA 1Z5CA 3U60A 2G5GX 2EO2A 3L25A 3GQ5A 3T1HM 4KODA 3HHYA 1MU5A 3M7GA 2UUBM 2D7EA 4FCVA 2K47A 2YR0A 4NRVA 5EXXA 4ANRA 2GQFA 4LF9M 2YFQA 1Q02A 4OVZB 5DYIA 5EP3A 3SATA 1ZMWA 2D7GA 3FUUA 3KP1E 3ZQJA 4FWDA 2HKJA 2R44A 4RF0A 4CHTB 3E9SA 2FS1A 3RFWA 1WIVA 5ITQA 2Y2QA 2L7IA 2Y0TA 2QZ4A 4FD2A 3KVWA 3HHXA 4MGZE 1HJPA 3T1YM 3V76A 1Q3CA 4HMDA 1G3IA 2JUJA 2QCUA 4X64M 4PDIA 1IXSB 4LZZA 3GLGA 1ED7A 1EIJA 5IREB 5KPZA 1NNUC 1GKIA 2KEBA 1UR9A 3KW6A 4JI2M 1QZMA 2Y20A 3SASA 2MJ5B 3LMMA 2OOBA 5KQDA 1HR0M 2O01F 1L2BA 2CV1A 1TTEA 1Z5AA 2MR9A 4LJ6A 3N3FA 3KDSE 2OPFA 3J81S 2F5NA 4FCWA 3PNVA 2DWLA 1ZAEA 4KO8A 2DWMA 3KOWE 3JR5A 2DWZB 3L29A 1IY1A 1QDRA 1W5TA 3HONA 3K2LA 5EP4A 3BBZA 2VDBB 1OJLA 2RKOA 1NHGC 3B7QA 2CP8A 3MQLA 4OJLA 3VDUA 4G6ZA 2UUCM 1Q39A 2JY7A 4DR1M 4NZ3A 1WGNA 2Y2OA 1XNQM 4NL4H 3WHKA 1IN7A 1NSFA 3VDPA 1IY2A 4OUIA 1SXJE 1E6ZA 3D8LA 4Q7JA 3UMMA 1WJ7A 1ZQ9A 3J80S 3T38A 2DKLA 1G8PA 2LWXA 3KSJA 1TDHA 2OQ4A 4NZ4A 1UFZA 1L1ZA 3B7ZA 5FLXS 4AKGA 1JR3A 4BB9A 1Z59A 3I4YA 4ZPXA 3KS8A 4LJ5A 2Y2MA 1Z5BA 3KSXA 3A46A 1XWIA 3IG5A 1XB2B 3GLFE 2L4EA 4TUWA 3RGSA 4NSRA 4M0WA 2XEPA 1K82A 4FWGA 2KNZA 2V5OA 1ZMUA 4AZFA 1XC8A 1DO2A 1GJTA 3B9PA 4B7GA 2DAEA 2FE8A 1TGUA 2JY8A 1A5TA 3QWLA 3VKGA 1AIWA 4G3OA 1L2CA 2DAKA 3FTCA 4MB7A 4JI5M 1JB0F 4NRWA 2E5LM 1IN6A 4DR4M 2R18A 1D0LA 1EFUB 2DXIA 4MGHA 4GKJM 1C7YA 1SG9A 2VF7A 2ZAMA 4I5SA 4L78A 1KS0A 1TF0B 4GRIA 2CHVA 3NBIA 2DVWB 1R6BX 4OJ6A 3U6LA 3KOYE 2CV0A 1ORYB 2X4AA 2Y2LA 1YUBA 2EUCA 3TE6A 4LFCM 2C9CA 2C99A 2H5XA 2I7PA 2JY6B 1V33A 4X66M 2D49A 3VK8A 1PDCA 5FTKA 4REZA 3FUXA 2LH0A 5KQ8A 3GLGE 5FTMA 5DFLA 1H0IA 3U6PA 2DHRA 5JI3E 4I4LA 4B08A 4GIPA 2Y21A 3K9PA 4DV0M 4RF1A 5DNYA 3U6QA 2JE5A 1ZMVA 1E15A 2Y2JA 1RU3A 4NYUA 4M0DA 2O25A 1T43A 4IJEA 1PJQA 3HJQA 3C58A 1NV8A 1WR1B 3LCUA 5EQTA 4JI7M 4IBKA 2L6OA 2W82A 1E9RA 3UGJA 2R65A 3AL0C 3SFZA 5ITRA 1PJIA 1KFVA 2DNAA 3E21A 5ITXA 1GVNA 1VDDA 4LJ9A 2VQEM 1HQCA 2LVPC 3VLFB 4B3SM 3TWLA 4OJOA 2FFFB 3I01M 3GPYA 2XLJA 2WSFF 1XMOM 3CF2A 5FTJA 4LF5M 2DZLA 2LVNC 2LVAA 2LVOC 2YNMD 4MGKE 1OFIA 4QOZC 1OAOC 4AKHA 2LXEA 3I4VA 3MK6A 3M7PA 2QSFX 5H37D 4A3VB 4DV1M 4JI4M 4JI8M 1JR3E 3C3DA 4DV3M 1VG5A 3C3EA 1QAMA 4HMCA 1IM2A 3MJ5A 3U6SA 2QENA 3MHVC 1DO0A 2I7NA 4GEWA 4KLNA 2KA6B 4AQYM 5FTNA 1SXJB 2RGOA 4L8RC 5EXPA 1G41A 4L16A 1YU1A 2CHGA 4DR3M 3WD0A 3GP1A 2G8LA 1HT1E 1NHWC 2EJSA 1HNXM 1PM5A 2CE7A 2Y2GA 4YY3M 2R4JA 3EIHA 4MM3B 5EJCA 2X8AA 4PT5A 4DR2M 4XBOA 2Y2IA 2ZM6M 3E4RA 2M60A 3GLFB 5EXSA 5C1BA 4DUYM 1D0KA 2R6FA 4L15A 4L4UA 4DBGB 4DV7M 3VKHA 3HY5A 3KOZE 4LF4M 4NYYA 4Z2LA 2MROB 3FYCA 1IQPA 1OIPA 2B3TA 3NWLA 2FFJA 1E88A 2C96A 1KSFX 1OKSA 1QAQA 2JZ1A 3CGWA 1QDTA 3DZDA 3L27A 4RKUF 3U60B 1TDZA 1NNJA 1HNWM 4OJ5A 4LGYA 3T15A 2HAKA 3J7AS 2L09A 1UR8A 5F3WA 2JA2A 2R0IA 4R71A 4IIWA 4I8OA 5A2QS 4LF6M 2LVQD 1L8QA 3FTEA 4GHAA 4G4RA 2Z8YM 1UM8A 4P17A 4B7HA 4LFBM 1K3XA 2UU9M 4IBEA 3FRHA 2H1RA 3AOEC 3AJIB 3M0EA 1T3TA 2DAGA 2FH0A 1CUKA 3A45A 4LRSA 4WURA 4Z8XA 3TL4X 1TH4A 3WHLA 1PJJA 1E6NA 1OGBA 3J27B 1XNRM 2VIIA 1G71A 4JI1M 3GO8A 4IBFA 3HHWA 3I51A 2Z4RA 3GLGB 4II7A 5ITXE 3U6CA 1G59A 2WSCF 2KNVA 3GLIA 4IBCA 2CV2A 1S3SA 4IBJA 4GHLA 1J7KA 2J7OA 3K8ZA 1AUAA 1P3QQ 2XGNA 1YSYA 1N75A 5LMUM 1E6PA 3U6EA 4DV2M 1EE8A 1IBKM 4Z2JA 1XXHE 1QQWA 5ITYA 3VFDA 2R4EA 2F4VM 3SMPA 1L6JA 2L7HA 2ZAOA 3HGIA 4RNAA 2HCBA 2JXNA 2IOUA 1W1PA 1X37A 3RE8A 2Z3XA 4QHTA 1Y8GA 4LFAM 4Z6YA 3AKZA 1L2DA 4WP2A 1HNZM 3AFHA 4OU7A 4JXJA 4M9XA 1IN5A 3HHZA 3U5ZA 4G4QA 4LJ4A 1MX0A 4NOOB 3U61A 1VQ1A 3M6AA 1QAOA 1VEJA 1DGBA 3B74A 4EIWA 3PVSA 2MH8A 4JN6A 3QYEA 4NY2A 3GPPA 2APLA 1JR3D 2C98A 1FJGM 3BOSA 4GC9A 1GJSA 2QBYB 2C9OA 3HJSA 4GMQA 1N32M 3W0LB 2D7HA 3GLHA 1FNNA 1OTRA 3W67A 4LG2A 2OO9A 4FWHA 3IHPA 5KPTA 1YU0A 2QNJA 4M9ZA 4JI0M 4QOSA 1N36M 2DZNB 4MGIE 3FE3A 4ITQA 2KDLA 2XFSA 2FOIC 4QNMA 2VF8A 3KS4A 2L4FA 3QAUA 3HU2A 4FCTA 4IBGA 4PDGA 1T6OA 3D8BA 3J7BA 4R3DA 2KRKA 2C5RA 1R2YA 4GKKM 3HSHA 3DA1A 1QO6A 1IXRC 1TH2A 2Z4SA 2XSZA 3FUWA 4D82A 4WW0A 3FTFA 3U6MA 2QPAA 1CK7A 2JY5A 1YU2A 4OJPA 4PCZA 1QZEA 2JZ0A 1IXZA 4IBIA 1LTMA 2EKKA 3GRVA 1XHBA 2CUZA 4W5WA 1GLNA 5GKNA 3B7NA 2UUAM 1TR8A 2ERCA 1QYRA 4D81A 1MJGM 3LCVB 2KXEA 4DV4M 1R4GA 1IN4A 3A42A 1OQYA 3U6OA 3CTWB 3HU3A 4IJFA 4MGYE 3W0FA 3JR4A 1E32A 1NY6A 4GC5A 5LMNM 1YE9A 1BVSA 3AOGA 4P16A 2L2DA 4LGMA 4DV5M 2NQ8C 3SAUA 2UXBM 1XXHA 2KZSA 3GRUA 1KYIA 4LJ8A 4BLCA 3GLIE 1QANA 4F2LA 3AV0A 5IZ7D 4CJ6A 2EKFA 3A98B 4NZ5A 4BBAA 5BPVA 4Z2IA 1G4AE 1VDLA 5EXTA 2KZUA 3DOAA 2M5ZA 2JNHA 1HT2E 1R5LA 2ZTCA 3I04M 4MB3A 8CATA 1DGGA 1DGFA 2XH9A 4NXMM 4B7FA 2JWSA 3LW5F 3QYBA 3R9XB 1W1YA 3LVWA 1NY5A 1GL6A 2CWBA 2R45A 1IN8A 2LNHC 4AKIA 4OVZA 3GPXA 3HJ8A 1OGGA 1E6RA 4DR7M 1GO5A 2Y2HA 1H0GA 3EIEA 1PJTA 3SHGB 2FNAA 1IBLM 2QP9X 3SYLA 4YHHM 2CFOA 2V1CA 2K9DA 1V92A 1N78A 3AOEA 1NJFA 3HX3A 3SHFA 4AG6A 1CXWA 1NO1A 2BG1A 3PFIA 1I94M 4GITA 1IXSA 2LHCA 3L28A 1OFHA 3RGPA 3GRYA 3SAWA 5ITUA 4LF8M 1W1VA 4HLQA 2BJWA 4NC6A 2O5RA 3GLHE 1DGHB 1LV7A 3MMPA 4IBBA 5EP1A 1SXJC 3TPZA 4KHPM 2R62A 2Y0QA 4QNRA 2ZTDA 2JP7A 2R46A 1YU3A 2KNAA 3FUVA 1WXQA 1V34A 2HL7A 1XMQM 5EP2A
chains in the Genus database with same CATH topology
5E26A 2BJVA 4JI6M 4QNLA 2XZUA 2Z7JA 1N77A 1D2NA 1HQYE 2Y2KA 2VQFM 3L26A 5E6JA 2F5SA 2HHHM 4B3TM 1J09A 4LY6A 5KO3A 2DZOB 1YUEA 2XD5A 3L2AA 5IWAM 4IBDA 3TQSA 4B3MM 3LQQA 3LQRA 2XZFA 3JAMS 1NJGA 5FTLA 3PXGA 3ILKA 2UXCM 2KRUA 2P5TA 4AI6A 2KW0A 2Q2EB 3UJNA 4LCBA 1N33M 3FD9A 2Y2PA 3ZH9B 5JI2E 3IG8A 3J2PB 2V1UA 4G4OA 4LZJA 3OTOM 4JI3M 4DR6M 3FTDA 2ZBKB 4D80A 4NSOB 3THGA 3WX7A 2AHMA 4I81A 2XD1A 3KP0E 4LJ7A 2YQZA 3CF0A 2ZANA 2QBYA 2J7NA 3HWSA 2A5YB 3GLIB 3GRRA 2UWXA 1I4WA 3LVVA 1C1KA 3PNYA 4LJAA 2Y2NA 1Q3BA 4MH0E 2V6ZM 3GPUA 5C18A 3K92A 2F5QA 2F5OA 2XF3A 4G4NA 4K0KM 3GQ4A 7CATA 3U6DA 3U5ZB 4HL4A 3KFUG 1E94E 3GQ3A 3U61B 4PD2A 5FSWA 4DUZM 4NXNM 3R8FA 4X62M 2F5PA 4GH9A 4S12A 3SC3A 4B3RM 4FW9A 3Q8XA 3GLHB 3VK7A 3KXEC 2UXDM 3SAVA 2DWNA 1W5SA 4DV6M 5ITTA 2CHQA 1TH3A 1L1TA 4R7GA 1R2ZA 2XSZD 5BR8M 2CEAA 5IT9S 3H4MA 3CF6E 3ZC7B 1K3WA 4LF7M 2RGHA 1IBMM 1R7RA 2X49A 3SARA 1J5EM 1SXJA 3KOXE 3FKEA 1H6UA 4M9SA 2BNKA 3TWKA 3TWMA 4X65M 5DYGA 4JV5M 4XGIA 1YU4A 3SYKA 3DFZA 4CGYB 3HU1A 1N34M 1Z6TA 4AG5A 3SMSA 4NZ1A 3UZUA 1NVMA 1JQJC 4OW0A 2JCHA 4FVMA 3GLFA 2EA0A 1E9SA 1XXHB 3K1JA 3FUTA 1QVRA 3HKPA 4CISA 3FYDA 5KPRA 3UK6A 1DGHA 4OX9M 2XFTA 4LRTA 3ZCBB 4AW4A 1IY0A 1GL7A 1SXJD 4QHSA 4JYAM 3SBJA 1Z5CA 3U60A 2G5GX 2EO2A 3L25A 3GQ5A 3T1HM 4KODA 3HHYA 1MU5A 3M7GA 2UUBM 2D7EA 4FCVA 2K47A 2YR0A 4NRVA 5EXXA 4LF9M 2YFQA 4OVZB 5DYIA 5EP3A 3SATA 3FUUA 2D7GA 3KP1E 4CHTB 4FWDA 2HKJA 4RF0A 3E9SA 3RFWA 5ITQA 2Y2QA 2L7IA 2Y0TA 2QZ4A 4FD2A 3KVWA 3HHXA 4MGZE 3T1YM 1Q3CA 1G3IA 2QCUA 4X64M 3GLGA 4PDIA 1IXSB 4LZZA 5IREB 5KPZA 1NNUC 1GKIA 2KEBA 3KW6A 4JI2M 1QZMA 2Y20A 3SASA 3LMMA 1HR0M 5KQDA 1L2BA 2CV1A 1Z5AA 4LJ6A 3N3FA 3KDSE 2OPFA 3J81S 2F5NA 4FCWA 3PNVA 2DWLA 1ZAEA 4KO8A 2DWMA 3KOWE 3JR5A 3L29A 2DWZB 1IY1A 1W5TA 3HONA 3K2LA 5EP4A 1OJLA 2RKOA 1NHGC 4OJLA 3VDUA 4G6ZA 2UUCM 1Q39A 4DR1M 4NZ3A 2Y2OA 1XNQM 4NL4H 3WHKA 1IN7A 1NSFA 3VDPA 1IY2A 4OUIA 1SXJE 3D8LA 3UMMA 1ZQ9A 3J80S 3T38A 2LWXA 1G8PA 3KSJA 1TDHA 2OQ4A 4NZ4A 1L1ZA 4AKGA 5FLXS 1JR3A 4BB9A 1Z59A 3I4YA 4ZPXA 3KS8A 4LJ5A 2Y2MA 1Z5BA 3KSXA 3A46A 1XWIA 3IG5A 4TUWA 3RGSA 4NSRA 4M0WA 2XEPA 1K82A 4FWGA 4AZFA 1XC8A 1DO2A 3B9PA 4B7GA 3QWLA 2FE8A 1TGUA 3VKGA 1L2CA 3FTCA 4MB7A 4JI5M 4NRWA 2E5LM 1IN6A 4DR4M 2R18A 2DXIA 4MGHA 4GKJM 2ZAMA 4I5SA 4L78A 4GRIA 2CHVA 3NBIA 2DVWB 1R6BX 4OJ6A 3U6LA 3KOYE 2CV0A 1ORYB 2X4AA 2Y2LA 1YUBA 2EUCA 3TE6A 4LFCM 2C9CA 2C99A 2I7PA 4X66M 3VK8A 5FTKA 4REZA 3FUXA 2LH0A 5KQ8A 5FTMA 3U6PA 2DHRA 5JI3E 4I4LA 4B08A 4GIPA 2Y21A 4DV0M 2JE5A 4RF1A 5DNYA 3U6QA 2Y2JA 4NYUA 4M0DA 4IJEA 3HJQA 3C58A 4JI7M 5EQTA 4IBKA 2L6OA 2W82A 1E9RA 3UGJA 2R65A 3AL0C 3SFZA 5ITRA 1PJIA 1KFVA 5ITXA 1GVNA 1VDDA 4LJ9A 2VQEM 1HQCA 3VLFB 4B3SM 3TWLA 4OJOA 2FFFB 3GPYA 2XLJA 1XMOM 3CF2A 5FTJA 4LF5M 2YNMD 4MGKE 1OFIA 4QOZC 4AKHA 2LXEA 3I4VA 3MK6A 5H37D 4A3VB 4DV1M 4JI4M 4JI8M 4DV3M 1QAMA 1IM2A 3MJ5A 3U6SA 2QENA 3MHVC 1DO0A 2I7NA 4KLNA 2KA6B 4AQYM 5FTNA 1SXJB 2RGOA 4L8RC 5EXPA 1G41A 4L16A 1YU1A 2CHGA 4DR3M 3GP1A 2G8LA 1HT1E 1NHWC 1HNXM 1PM5A 2CE7A 2Y2GA 4YY3M 2R4JA 3EIHA 4MM3B 5EJCA 2X8AA 4PT5A 4DR2M 4XBOA 2Y2IA 2ZM6M 3E4RA 2M60A 3GLFB 5EXSA 5C1BA 4DUYM 4L15A 4L4UA 4DV7M 3VKHA 3KOZE 4NYYA 4LF4M 3FYCA 3NWLA 1IQPA 2FFJA 2C96A 1KSFX 1QAQA 2BG1A 1NNJA 3DZDA 3L27A 3U60B 1TDZA 1HNWM 4OJ5A 4LGYA 3T15A 3J7AS 2L09A 5F3WA 2JA2A 4IIWA 4I8OA 5A2QS 4LF6M 1L8QA 3FTEA 4GHAA 4G4RA 4LFBM 1UM8A 4B7HA 1K3XA 2UU9M 4IBEA 2H1RA 3AOEC 3AJIB 3M0EA 1T3TA 3A45A 4LRSA 4WURA 4Z8XA 3TL4X 1TH4A 3WHLA 1PJJA 3J27B 1XNRM 2VIIA 4JI1M 3GO8A 4IBFA 3HHWA 3I51A 2Z4RA 3GLGB 4II7A 5ITXE 3U6CA 1G59A 3GLIA 4IBCA 2CV2A 1S3SA 4IBJA 4GHLA 1J7KA 2J7OA 3K8ZA 2XGNA 1YSYA 1N75A 5LMUM 3U6EA 4DV2M 1EE8A 1IBKM 1QQWA 5ITYA 3VFDA 2R4EA 2F4VM 3SMPA 2L7HA 2ZAOA 3HGIA 4RNAA 2HCBA 2IOUA 1X37A 3RE8A 2Z3XA 4QHTA 1L2DA 4LFAM 4Z6YA 3AKZA 1HNZM 3AFHA 4OU7A 4JXJA 4M9XA 1IN5A 3HHZA 3U5ZA 4G4QA 4LJ4A 1MX0A 4NOOB 3U61A 3M6AA 1QAOA 1DGBA 4EIWA 3PVSA 4JN6A 4NY2A 3GPPA 2C98A 1JR3D 1FJGM 3BOSA 4GC9A 2QBYB 2C9OA 3HJSA 4GMQA 1N32M 3W0LB 2D7HA 3GLHA 1FNNA 4LG2A 4FWHA 5KPTA 1YU0A 4M9ZA 4JI0M 4QOSA 1N36M 2DZNB 4MGIE 4ITQA 2XFSA 2FOIC 4QNMA 3QAUA 3KS4A 4DR5M 4FCTA 3HU2A 4IBGA 2C5RA 4PDGA 3D8BA 3J7BA 4R3DA 3HSHA 2KRKA 1R2YA 4GKKM 3DA1A 1IXRC 1TH2A 2Z4SA 2XSZA 3FUWA 4D82A 4WW0A 3FTFA 3U6MA 2QPAA 1YU2A 4OJPA 4PCZA 1IXZA 4IBIA 3GRVA 1XHBA 2CUZA 4W5WA 1GLNA 5GKNA 2UUAM 2ERCA 1QYRA 4D81A 2KXEA 4DV4M 1IN4A 3A42A 3U6OA 3CTWB 3HU3A 4IJFA 4MGYE 3W0FA 3JR4A 1E32A 1NY6A 4GC5A 5LMNM 1YE9A 3AOGA 4P16A 4LGMA 4DV5M 3SAUA 2NQ8C 2UXBM 1XXHA 2KZSA 3GRUA 1KYIA 4LJ8A 4BLCA 1QANA 3AV0A 5IZ7D 3A98B 4NZ5A 4BBAA 5BPVA 1G4AE 5EXTA 2KZUA 3DOAA 2M5ZA 1HT2E 8CATA 1DGGA 1DGFA 2XH9A 4NXMM 4B7FA 3R9XB 3LVWA 1NY5A 1GL6A 2R45A 1IN8A 2LNHC 4AKIA 4OVZA 3GPXA 3HJ8A 2Y2HA 4DR7M 3EIEA 3SHGB 2FNAA 1IBLM 2QP9X 3SYLA 4YHHM 2CFOA 2V1CA 1N78A 3AOEA 1NJFA 3SHFA 4AG6A 3PFIA 1I94M 4GITA 3L28A 1OFHA 3RGPA 3GRYA 3SAWA 5ITUA 4LF8M 4HLQA 2BJWA 5EP1A 2O5RA 3TPZA 1DGHB 1LV7A 4KHPM 4IBBA 1SXJC 2R62A 2Y0QA 4QNRA 2R46A 1YU3A 3FUVA 1WXQA 2HL7A 1XMQM 5EP2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IJF A;  3L29 A;  4GHA A;  4IBE A;  3KS4 A;  4IBG A;  3L26 A;  3L28 A;  5BPV A;  4IBF A;  3L2A A;  4IBD A;  4IJE A;  4IBB A;  4IBI A;  4IBK A;  4IBC A;  3L25 A;  4GH9 A;  4IBJ A;  3L27 A;  3FKE A;  4GHL A;  3KS8 A;  4LG2 A; 
#chains in the Genus database with same CATH topology
 5E26 A;  1WHC A;  2BJV A;  3Q8G A;  4JI6 M;  4QNL A;  2XZU A;  2Z7J A;  2DAM A;  1N77 A;  1D2N A;  1HQY E;  2BWB A;  2Y2K A;  5L8R F;  2VQF M;  3L26 A;  1H8P A;  5E6J A;  2DEN A;  2J5Y A;  2F5S A;  2HHH M;  2DI0 A;  4B3T M;  1J09 A;  4LY6 A;  1PRB A;  5KO3 A;  1GOI A;  2DZO B;  3F92 A;  1W1T A;  1YUE A;  2XD5 A;  3L2A A;  5IWA M;  4IBD A;  3TQS A;  4B3M M;  3LQQ A;  3LQR A;  3C9P A;  4XK8 F;  1EAK A;  2XZF A;  3JAM S;  1NJG A;  5FTL A;  1GXD A;  3PXG A;  3ILK A;  1ZV1 A;  2G3Q A;  2UXC M;  2KRU A;  2RRU A;  3E46 A;  1MN3 A;  2P5T A;  4AI6 A;  2KW0 A;  1YLA A;  2Q2E B;  3UJN A;  4LCB A;  1N33 M;  3FD9 A;  2Y2P A;  3ZH9 B;  5JI2 E;  3IG8 A;  3J2P B;  2V1U A;  4G4O A;  1NV9 A;  4LZJ A;  2MGW A;  4L6V 6;  3W68 A;  4TX8 A;  3OTO M;  4JI3 M;  4DR6 M;  3FTD A;  1E8B A;  4HME A;  2QQ8 A;  2ZBK B;  4D80 A;  3K9O A;  4NSO B;  3THG A;  3WX7 A;  1J7M A;  2AHM A;  2LTU A;  2K0B X;  4I81 A;  4Y28 F;  1IFY A;  2XD1 A;  3KP0 E;  3WD3 A;  2LBC A;  3FRI A;  2YQZ A;  3CF0 A;  2ZAN A;  4LJ7 A;  2QBY A;  2J7N A;  3HWS A;  2A5Y B;  3GLI B;  3GRR A;  2UWX A;  2BWE A;  1I4W A;  3B89 A;  3LVV A;  1C1K A;  3WD2 A;  3PNY A;  4LJA A;  2Y2N A;  3NBX X;  1Q3B A;  4MH0 E;  2V6Z M;  3GPU A;  2N35 A;  5C18 A;  3K92 A;  2F5Q A;  1OAI A;  2K6B A;  2F5O A;  2XF3 A;  2RTS A;  4G4N A;  2LHG A;  3GQ4 A;  4K0K M;  7CAT A;  3U6D A;  3IEC A;  3U5Z B;  4HL4 A;  3KFU G;  1E94 E;  1O6I A;  4Z2H A;  3GQ3 A;  3U61 B;  4CIZ A;  1D0M A;  4PD2 A;  1AIP C;  1OIZ A;  5FSW A;  4DUZ M;  4NXN M;  3R8F A;  1GAB A;  1DV0 A;  4X62 M;  2F5P A;  4GH9 A;  4S12 A;  4DR5 M;  4Z2K A;  3SC3 A;  4B3R M;  4FW9 A;  2OOA A;  3Q8X A;  3GLH B;  3VK7 A;  3KXE C;  2UXD M;  2HWJ A;  1F4I A;  2QHO B;  2WZJ A;  1PJS A;  3SAV A;  2DWN A;  1W5S A;  4DV6 M;  5ITT A;  2CHQ A;  1TH3 A;  1L1T A;  4R7G A;  4Z2G A;  1R2Z A;  2XSZ D;  5BR8 M;  2CEA A;  1VEK A;  5IT9 S;  3H4M A;  3CF6 E;  3HZJ A;  3ZC7 B;  2GNO A;  2RGH A;  1K3W A;  1IBM M;  4LF7 M;  3H4J A;  1WGL A;  2DAI A;  2WSE F;  1QUS A;  1R7R A;  2X49 A;  3SAR A;  1J5E M;  1SXJ A;  3KOX E;  3FKE A;  1H6U A;  4M9S A;  2BNK A;  4HEO A;  3TWK A;  4X65 M;  3TWM A;  5DYG A;  4F1I A;  4JV5 M;  4XGI A;  2CRU A;  3BXW A;  2KHH A;  1YU4 A;  3SYK A;  3T6P A;  3DFZ A;  4CGY B;  1QUT A;  3HU1 A;  1N34 M;  1Z6T A;  4AG5 A;  3SMS A;  4NZ1 A;  3UZU A;  2DHY A;  3WD4 A;  1VEG A;  1NVM A;  4MB4 A;  1JQJ C;  4OW0 A;  2JCH A;  3WD1 A;  4FVM A;  1PGY A;  3GLF A;  2EA0 A;  1E9S A;  1XXH B;  1GPF A;  3K1J A;  3FUT A;  1QVR A;  3HKP A;  4UN2 B;  4CIS A;  3FYD A;  5KPR A;  2FN2 A;  3UK6 A;  1DGH A;  4OX9 M;  2XFT A;  4LRT A;  3ZCB B;  4KT0 F;  1IY0 A;  4AW4 A;  4MB5 A;  1GL7 A;  1SXJ D;  4QHS A;  4JYA M;  3SBJ A;  1Z5C A;  3U60 A;  2G5G X;  2EO2 A;  3L25 A;  3GQ5 A;  3T1H M;  4KOD A;  3HHY A;  1MU5 A;  3M7G A;  2UUB M;  2D7E A;  4FCV A;  2K47 A;  2YR0 A;  4NRV A;  5EXX A;  4ANR A;  2GQF A;  4LF9 M;  2YFQ A;  1Q02 A;  4OVZ B;  5DYI A;  5EP3 A;  3SAT A;  1ZMW A;  2D7G A;  3FUU A;  3KP1 E;  3ZQJ A;  4FWD A;  2HKJ A;  2R44 A;  4RF0 A;  4CHT B;  3E9S A;  2FS1 A;  3RFW A;  1WIV A;  5ITQ A;  2Y2Q A;  2L7I A;  2Y0T A;  2QZ4 A;  4FD2 A;  3KVW A;  3HHX A;  4MGZ E;  1HJP A;  3T1Y M;  3V76 A;  1Q3C A;  4HMD A;  1G3I A;  2JUJ A;  2QCU A;  4X64 M;  4PDI A;  1IXS B;  4LZZ A;  3GLG A;  1ED7 A;  1EIJ A;  5IRE B;  5KPZ A;  1NNU C;  1GKI A;  2KEB A;  1UR9 A;  3KW6 A;  4JI2 M;  1QZM A;  2Y20 A;  3SAS A;  2MJ5 B;  3LMM A;  2OOB A;  5KQD A;  1HR0 M;  2O01 F;  1L2B A;  2CV1 A;  1TTE A;  1Z5A A;  2MR9 A;  4LJ6 A;  3N3F A;  3KDS E;  2OPF A;  3J81 S;  2F5N A;  4FCW A;  3PNV A;  2DWL A;  1ZAE A;  4KO8 A;  2DWM A;  3KOW E;  3JR5 A;  2DWZ B;  3L29 A;  1IY1 A;  1QDR A;  1W5T A;  3HON A;  3K2L A;  5EP4 A;  3BBZ A;  2VDB B;  1OJL A;  2RKO A;  1NHG C;  3B7Q A;  2CP8 A;  3MQL A;  4OJL A;  3VDU A;  4G6Z A;  2UUC M;  1Q39 A;  2JY7 A;  4DR1 M;  4NZ3 A;  1WGN A;  2Y2O A;  1XNQ M;  4NL4 H;  3WHK A;  1IN7 A;  1NSF A;  3VDP A;  1IY2 A;  4OUI A;  1SXJ E;  1E6Z A;  3D8L A;  4Q7J A;  3UMM A;  1WJ7 A;  1ZQ9 A;  3J80 S;  3T38 A;  2DKL A;  1G8P A;  2LWX A;  3KSJ A;  1TDH A;  2OQ4 A;  4NZ4 A;  1UFZ A;  1L1Z A;  3B7Z A;  5FLX S;  4AKG A;  1JR3 A;  4BB9 A;  1Z59 A;  3I4Y A;  4ZPX A;  3KS8 A;  4LJ5 A;  2Y2M A;  1Z5B A;  3KSX A;  3A46 A;  1XWI A;  3IG5 A;  1XB2 B;  3GLF E;  2L4E A;  4TUW A;  3RGS A;  4NSR A;  4M0W A;  2XEP A;  1K82 A;  4FWG A;  2KNZ A;  2V5O A;  1ZMU A;  4AZF A;  1XC8 A;  1DO2 A;  1GJT A;  3B9P A;  4B7G A;  2DAE A;  2FE8 A;  1TGU A;  2JY8 A;  1A5T A;  3QWL A;  3VKG A;  1AIW A;  4G3O A;  1L2C A;  2DAK A;  3FTC A;  4MB7 A;  4JI5 M;  1JB0 F;  4NRW A;  2E5L M;  1IN6 A;  4DR4 M;  2R18 A;  1D0L A;  1EFU B;  2DXI A;  4MGH A;  4GKJ M;  1C7Y A;  1SG9 A;  2VF7 A;  2ZAM A;  4I5S A;  4L78 A;  1KS0 A;  1TF0 B;  4GRI A;  2CHV A;  3NBI A;  2DVW B;  1R6B X;  4OJ6 A;  3U6L A;  3KOY E;  2CV0 A;  1ORY B;  2X4A A;  2Y2L A;  1YUB A;  2EUC A;  3TE6 A;  4LFC M;  2C9C A;  2C99 A;  2H5X A;  2I7P A;  2JY6 B;  1V33 A;  4X66 M;  2D49 A;  3VK8 A;  1PDC A;  5FTK A;  4REZ A;  3FUX A;  2LH0 A;  5KQ8 A;  3GLG E;  5FTM A;  5DFL A;  1H0I A;  3U6P A;  2DHR A;  5JI3 E;  4I4L A;  4B08 A;  4GIP A;  2Y21 A;  3K9P A;  4DV0 M;  4RF1 A;  5DNY A;  3U6Q A;  2JE5 A;  1ZMV A;  1E15 A;  2Y2J A;  1RU3 A;  4NYU A;  4M0D A;  2O25 A;  1T43 A;  4IJE A;  1PJQ A;  3HJQ A;  3C58 A;  1NV8 A;  1WR1 B;  3LCU A;  5EQT A;  4JI7 M;  4IBK A;  2L6O A;  2W82 A;  1E9R A;  3UGJ A;  2R65 A;  3AL0 C;  3SFZ A;  5ITR A;  1PJI A;  1KFV A;  2DNA A;  3E21 A;  5ITX A;  1GVN A;  1VDD A;  4LJ9 A;  2VQE M;  1HQC A;  2LVP C;  3VLF B;  4B3S M;  3TWL A;  4OJO A;  2FFF B;  3I01 M;  3GPY A;  2XLJ A;  2WSF F;  1XMO M;  3CF2 A;  5FTJ A;  4LF5 M;  2DZL A;  2LVN C;  2LVA A;  2LVO C;  2YNM D;  4MGK E;  1OFI A;  4QOZ C;  1OAO C;  4AKH A;  2LXE A;  3I4V A;  3MK6 A;  3M7P A;  2QSF X;  5H37 D;  4A3V B;  4DV1 M;  4JI4 M;  4JI8 M;  1JR3 E;  3C3D A;  4DV3 M;  1VG5 A;  3C3E A;  1QAM A;  4HMC A;  1IM2 A;  3MJ5 A;  3U6S A;  2QEN A;  3MHV C;  1DO0 A;  2I7N A;  4GEW A;  4KLN A;  2KA6 B;  4AQY M;  5FTN A;  1SXJ B;  2RGO A;  4L8R C;  5EXP A;  1G41 A;  4L16 A;  1YU1 A;  2CHG A;  4DR3 M;  3WD0 A;  3GP1 A;  2G8L A;  1HT1 E;  1NHW C;  2EJS A;  1HNX M;  1PM5 A;  2CE7 A;  2Y2G A;  4YY3 M;  2R4J A;  3EIH A;  4MM3 B;  5EJC A;  2X8A A;  4PT5 A;  4DR2 M;  4XBO A;  2Y2I A;  2ZM6 M;  3E4R A;  2M60 A;  3GLF B;  5EXS A;  5C1B A;  4DUY M;  1D0K A;  2R6F A;  4L15 A;  4L4U A;  4DBG B;  4DV7 M;  3VKH A;  3HY5 A;  3KOZ E;  4LF4 M;  4NYY A;  4Z2L A;  2MRO B;  3FYC A;  1IQP A;  1OIP A;  2B3T A;  3NWL A;  2FFJ A;  1E88 A;  2C96 A;  1KSF X;  1OKS A;  1QAQ A;  2JZ1 A;  3CGW A;  1QDT A;  3DZD A;  3L27 A;  4RKU F;  3U60 B;  1TDZ A;  1NNJ A;  1HNW M;  4OJ5 A;  4LGY A;  3T15 A;  2HAK A;  3J7A S;  2L09 A;  1UR8 A;  5F3W A;  2JA2 A;  2R0I A;  4R71 A;  4IIW A;  4I8O A;  5A2Q S;  4LF6 M;  2LVQ D;  1L8Q A;  3FTE A;  4GHA A;  4G4R A;  2Z8Y M;  1UM8 A;  4P17 A;  4B7H A;  4LFB M;  1K3X A;  2UU9 M;  4IBE A;  3FRH A;  2H1R A;  3AOE C;  3AJI B;  3M0E A;  1T3T A;  2DAG A;  2FH0 A;  1CUK A;  3A45 A;  4LRS A;  4WUR A;  4Z8X A;  3TL4 X;  1TH4 A;  3WHL A;  1PJJ A;  1E6N A;  1OGB A;  3J27 B;  1XNR M;  2VII A;  1G71 A;  4JI1 M;  3GO8 A;  4IBF A;  3HHW A;  3I51 A;  2Z4R A;  3GLG B;  4II7 A;  5ITX E;  3U6C A;  1G59 A;  2WSC F;  2KNV A;  3GLI A;  4IBC A;  2CV2 A;  1S3S A;  4IBJ A;  4GHL A;  1J7K A;  2J7O A;  3K8Z A;  1AUA A;  1P3Q Q;  2XGN A;  1YSY A;  1N75 A;  5LMU M;  1E6P A;  3U6E A;  4DV2 M;  1EE8 A;  1IBK M;  4Z2J A;  1XXH E;  1QQW A;  5ITY A;  3VFD A;  2R4E A;  2F4V M;  3SMP A;  1L6J A;  2L7H A;  2ZAO A;  3HGI A;  4RNA A;  2HCB A;  2JXN A;  2IOU A;  1W1P A;  1X37 A;  3RE8 A;  2Z3X A;  4QHT A;  1Y8G A;  4LFA M;  4Z6Y A;  3AKZ A;  1L2D A;  4WP2 A;  1HNZ M;  3AFH A;  4OU7 A;  4JXJ A;  4M9X A;  1IN5 A;  3HHZ A;  3U5Z A;  4G4Q A;  4LJ4 A;  1MX0 A;  4NOO B;  3U61 A;  1VQ1 A;  3M6A A;  1QAO A;  1VEJ A;  1DGB A;  3B74 A;  4EIW A;  3PVS A;  2MH8 A;  4JN6 A;  3QYE A;  4NY2 A;  3GPP A;  2APL A;  1JR3 D;  2C98 A;  1FJG M;  3BOS A;  4GC9 A;  1GJS A;  2QBY B;  2C9O A;  3HJS A;  4GMQ A;  1N32 M;  3W0L B;  2D7H A;  3GLH A;  1FNN A;  1OTR A;  3W67 A;  4LG2 A;  2OO9 A;  4FWH A;  3IHP A;  5KPT A;  1YU0 A;  2QNJ A;  4M9Z A;  4JI0 M;  4QOS A;  1N36 M;  2DZN B;  4MGI E;  3FE3 A;  4ITQ A;  2KDL A;  2XFS A;  2FOI C;  4QNM A;  2VF8 A;  3KS4 A;  2L4F A;  3QAU A;  3HU2 A;  4FCT A;  4IBG A;  4PDG A;  1T6O A;  3D8B A;  3J7B A;  4R3D A;  2KRK A;  2C5R A;  1R2Y A;  4GKK M;  3HSH A;  3DA1 A;  1QO6 A;  1IXR C;  1TH2 A;  2Z4S A;  2XSZ A;  3FUW A;  4D82 A;  4WW0 A;  3FTF A;  3U6M A;  2QPA A;  1CK7 A;  2JY5 A;  1YU2 A;  4OJP A;  4PCZ A;  1QZE A;  2JZ0 A;  1IXZ A;  4IBI A;  1LTM A;  2EKK A;  3GRV A;  1XHB A;  2CUZ A;  4W5W A;  1GLN A;  5GKN A;  3B7N A;  2UUA M;  1TR8 A;  2ERC A;  1QYR A;  4D81 A;  1MJG M;  3LCV B;  2KXE A;  4DV4 M;  1R4G A;  1IN4 A;  3A42 A;  1OQY A;  3U6O A;  3CTW B;  3HU3 A;  4IJF A;  4MGY E;  3W0F A;  3JR4 A;  1E32 A;  1NY6 A;  4GC5 A;  5LMN M;  1YE9 A;  1BVS A;  3AOG A;  4P16 A;  2L2D A;  4LGM A;  4DV5 M;  2NQ8 C;  3SAU A;  2UXB M;  1XXH A;  2KZS A;  3GRU A;  1KYI A;  4LJ8 A;  4BLC A;  3GLI E;  1QAN A;  4F2L A;  3AV0 A;  5IZ7 D;  4CJ6 A;  2EKF A;  3A98 B;  4NZ5 A;  4BBA A;  5BPV A;  4Z2I A;  1G4A E;  1VDL A;  5EXT A;  2KZU A;  3DOA A;  2M5Z A;  2JNH A;  1HT2 E;  1R5L A;  2ZTC A;  3I04 M;  4MB3 A;  8CAT A;  1DGG A;  1DGF A;  2XH9 A;  4NXM M;  4B7F A;  2JWS A;  3LW5 F;  3QYB A;  3R9X B;  1W1Y A;  3LVW A;  1NY5 A;  1GL6 A;  2CWB A;  2R45 A;  1IN8 A;  2LNH C;  4AKI A;  4OVZ A;  3GPX A;  3HJ8 A;  1OGG A;  1E6R A;  4DR7 M;  1GO5 A;  2Y2H A;  1H0G A;  3EIE A;  1PJT A;  3SHG B;  2FNA A;  1IBL M;  2QP9 X;  3SYL A;  4YHH M;  2CFO A;  2V1C A;  2K9D A;  1V92 A;  1N78 A;  3AOE A;  1NJF A;  3HX3 A;  3SHF A;  4AG6 A;  1CXW A;  1NO1 A;  2BG1 A;  3PFI A;  1I94 M;  4GIT A;  1IXS A;  2LHC A;  3L28 A;  1OFH A;  3RGP A;  3GRY A;  3SAW A;  5ITU A;  4LF8 M;  1W1V A;  4HLQ A;  2BJW A;  4NC6 A;  2O5R A;  3GLH E;  1DGH B;  1LV7 A;  3MMP A;  4IBB A;  5EP1 A;  1SXJ C;  3TPZ A;  4KHP M;  2R62 A;  2Y0Q A;  4QNR A;  2ZTD A;  2JP7 A;  2R46 A;  1YU3 A;  2KNA A;  3FUV A;  1WXQ A;  1V34 A;  2HL7 A;  1XMQ M;  5EP2 A; 
#chains in the Genus database with same CATH homology
 5E26 A;  2BJV A;  4JI6 M;  4QNL A;  2XZU A;  2Z7J A;  1N77 A;  1D2N A;  1HQY E;  2Y2K A;  2VQF M;  3L26 A;  5E6J A;  2F5S A;  2HHH M;  4B3T M;  1J09 A;  4LY6 A;  5KO3 A;  2DZO B;  1YUE A;  2XD5 A;  3L2A A;  5IWA M;  4IBD A;  3TQS A;  4B3M M;  3LQQ A;  3LQR A;  2XZF A;  3JAM S;  1NJG A;  5FTL A;  3PXG A;  3ILK A;  2UXC M;  2KRU A;  2P5T A;  4AI6 A;  2KW0 A;  2Q2E B;  3UJN A;  4LCB A;  1N33 M;  3FD9 A;  2Y2P A;  3ZH9 B;  5JI2 E;  3IG8 A;  3J2P B;  2V1U A;  4G4O A;  4LZJ A;  3OTO M;  4JI3 M;  4DR6 M;  3FTD A;  2ZBK B;  4D80 A;  4NSO B;  3THG A;  3WX7 A;  2AHM A;  4I81 A;  2XD1 A;  3KP0 E;  4LJ7 A;  2YQZ A;  3CF0 A;  2ZAN A;  2QBY A;  2J7N A;  3HWS A;  2A5Y B;  3GLI B;  3GRR A;  2UWX A;  1I4W A;  3LVV A;  1C1K A;  3PNY A;  4LJA A;  2Y2N A;  1Q3B A;  4MH0 E;  2V6Z M;  3GPU A;  5C18 A;  3K92 A;  2F5Q A;  2F5O A;  2XF3 A;  4G4N A;  4K0K M;  3GQ4 A;  7CAT A;  3U6D A;  3U5Z B;  4HL4 A;  3KFU G;  1E94 E;  3GQ3 A;  3U61 B;  4PD2 A;  5FSW A;  4DUZ M;  4NXN M;  3R8F A;  4X62 M;  2F5P A;  4GH9 A;  4S12 A;  3SC3 A;  4B3R M;  4FW9 A;  3Q8X A;  3GLH B;  3VK7 A;  3KXE C;  2UXD M;  3SAV A;  2DWN A;  1W5S A;  4DV6 M;  5ITT A;  2CHQ A;  1TH3 A;  1L1T A;  4R7G A;  1R2Z A;  2XSZ D;  5BR8 M;  2CEA A;  5IT9 S;  3H4M A;  3CF6 E;  3ZC7 B;  1K3W A;  4LF7 M;  2RGH A;  1IBM M;  1R7R A;  2X49 A;  3SAR A;  1J5E M;  1SXJ A;  3KOX E;  3FKE A;  1H6U A;  4M9S A;  2BNK A;  3TWK A;  3TWM A;  4X65 M;  5DYG A;  4JV5 M;  4XGI A;  1YU4 A;  3SYK A;  3DFZ A;  4CGY B;  3HU1 A;  1N34 M;  1Z6T A;  4AG5 A;  3SMS A;  4NZ1 A;  3UZU A;  1NVM A;  1JQJ C;  4OW0 A;  2JCH A;  4FVM A;  3GLF A;  2EA0 A;  1E9S A;  1XXH B;  3K1J A;  3FUT A;  1QVR A;  3HKP A;  4CIS A;  3FYD A;  5KPR A;  3UK6 A;  1DGH A;  4OX9 M;  2XFT A;  4LRT A;  3ZCB B;  4AW4 A;  1IY0 A;  1GL7 A;  1SXJ D;  4QHS A;  4JYA M;  3SBJ A;  1Z5C A;  3U60 A;  2G5G X;  2EO2 A;  3L25 A;  3GQ5 A;  3T1H M;  4KOD A;  3HHY A;  1MU5 A;  3M7G A;  2UUB M;  2D7E A;  4FCV A;  2K47 A;  2YR0 A;  4NRV A;  5EXX A;  4LF9 M;  2YFQ A;  4OVZ B;  5DYI A;  5EP3 A;  3SAT A;  3FUU A;  2D7G A;  3KP1 E;  4CHT B;  4FWD A;  2HKJ A;  4RF0 A;  3E9S A;  3RFW A;  5ITQ A;  2Y2Q A;  2L7I A;  2Y0T A;  2QZ4 A;  4FD2 A;  3KVW A;  3HHX A;  4MGZ E;  3T1Y M;  1Q3C A;  1G3I A;  2QCU A;  4X64 M;  3GLG A;  4PDI A;  1IXS B;  4LZZ A;  5IRE B;  5KPZ A;  1NNU C;  1GKI A;  2KEB A;  3KW6 A;  4JI2 M;  1QZM A;  2Y20 A;  3SAS A;  3LMM A;  1HR0 M;  5KQD A;  1L2B A;  2CV1 A;  1Z5A A;  4LJ6 A;  3N3F A;  3KDS E;  2OPF A;  3J81 S;  2F5N A;  4FCW A;  3PNV A;  2DWL A;  1ZAE A;  4KO8 A;  2DWM A;  3KOW E;  3JR5 A;  3L29 A;  2DWZ B;  1IY1 A;  1W5T A;  3HON A;  3K2L A;  5EP4 A;  1OJL A;  2RKO A;  1NHG C;  4OJL A;  3VDU A;  4G6Z A;  2UUC M;  1Q39 A;  4DR1 M;  4NZ3 A;  2Y2O A;  1XNQ M;  4NL4 H;  3WHK A;  1IN7 A;  1NSF A;  3VDP A;  1IY2 A;  4OUI A;  1SXJ E;  3D8L A;  3UMM A;  1ZQ9 A;  3J80 S;  3T38 A;  2LWX A;  1G8P A;  3KSJ A;  1TDH A;  2OQ4 A;  4NZ4 A;  1L1Z A;  4AKG A;  5FLX S;  1JR3 A;  4BB9 A;  1Z59 A;  3I4Y A;  4ZPX A;  3KS8 A;  4LJ5 A;  2Y2M A;  1Z5B A;  3KSX A;  3A46 A;  1XWI A;  3IG5 A;  4TUW A;  3RGS A;  4NSR A;  4M0W A;  2XEP A;  1K82 A;  4FWG A;  4AZF A;  1XC8 A;  1DO2 A;  3B9P A;  4B7G A;  3QWL A;  2FE8 A;  1TGU A;  3VKG A;  1L2C A;  3FTC A;  4MB7 A;  4JI5 M;  4NRW A;  2E5L M;  1IN6 A;  4DR4 M;  2R18 A;  2DXI A;  4MGH A;  4GKJ M;  2ZAM A;  4I5S A;  4L78 A;  4GRI A;  2CHV A;  3NBI A;  2DVW B;  1R6B X;  4OJ6 A;  3U6L A;  3KOY E;  2CV0 A;  1ORY B;  2X4A A;  2Y2L A;  1YUB A;  2EUC A;  3TE6 A;  4LFC M;  2C9C A;  2C99 A;  2I7P A;  4X66 M;  3VK8 A;  5FTK A;  4REZ A;  3FUX A;  2LH0 A;  5KQ8 A;  5FTM A;  3U6P A;  2DHR A;  5JI3 E;  4I4L A;  4B08 A;  4GIP A;  2Y21 A;  4DV0 M;  2JE5 A;  4RF1 A;  5DNY A;  3U6Q A;  2Y2J A;  4NYU A;  4M0D A;  4IJE A;  3HJQ A;  3C58 A;  4JI7 M;  5EQT A;  4IBK A;  2L6O A;  2W82 A;  1E9R A;  3UGJ A;  2R65 A;  3AL0 C;  3SFZ A;  5ITR A;  1PJI A;  1KFV A;  5ITX A;  1GVN A;  1VDD A;  4LJ9 A;  2VQE M;  1HQC A;  3VLF B;  4B3S M;  3TWL A;  4OJO A;  2FFF B;  3GPY A;  2XLJ A;  1XMO M;  3CF2 A;  5FTJ A;  4LF5 M;  2YNM D;  4MGK E;  1OFI A;  4QOZ C;  4AKH A;  2LXE A;  3I4V A;  3MK6 A;  5H37 D;  4A3V B;  4DV1 M;  4JI4 M;  4JI8 M;  4DV3 M;  1QAM A;  1IM2 A;  3MJ5 A;  3U6S A;  2QEN A;  3MHV C;  1DO0 A;  2I7N A;  4KLN A;  2KA6 B;  4AQY M;  5FTN A;  1SXJ B;  2RGO A;  4L8R C;  5EXP A;  1G41 A;  4L16 A;  1YU1 A;  2CHG A;  4DR3 M;  3GP1 A;  2G8L A;  1HT1 E;  1NHW C;  1HNX M;  1PM5 A;  2CE7 A;  2Y2G A;  4YY3 M;  2R4J A;  3EIH A;  4MM3 B;  5EJC A;  2X8A A;  4PT5 A;  4DR2 M;  4XBO A;  2Y2I A;  2ZM6 M;  3E4R A;  2M60 A;  3GLF B;  5EXS A;  5C1B A;  4DUY M;  4L15 A;  4L4U A;  4DV7 M;  3VKH A;  3KOZ E;  4NYY A;  4LF4 M;  3FYC A;  3NWL A;  1IQP A;  2FFJ A;  2C96 A;  1KSF X;  1QAQ A;  2BG1 A;  1NNJ A;  3DZD A;  3L27 A;  3U60 B;  1TDZ A;  1HNW M;  4OJ5 A;  4LGY A;  3T15 A;  3J7A S;  2L09 A;  5F3W A;  2JA2 A;  4IIW A;  4I8O A;  5A2Q S;  4LF6 M;  1L8Q A;  3FTE A;  4GHA A;  4G4R A;  4LFB M;  1UM8 A;  4B7H A;  1K3X A;  2UU9 M;  4IBE A;  2H1R A;  3AOE C;  3AJI B;  3M0E A;  1T3T A;  3A45 A;  4LRS A;  4WUR A;  4Z8X A;  3TL4 X;  1TH4 A;  3WHL A;  1PJJ A;  3J27 B;  1XNR M;  2VII A;  4JI1 M;  3GO8 A;  4IBF A;  3HHW A;  3I51 A;  2Z4R A;  3GLG B;  4II7 A;  5ITX E;  3U6C A;  1G59 A;  3GLI A;  4IBC A;  2CV2 A;  1S3S A;  4IBJ A;  4GHL A;  1J7K A;  2J7O A;  3K8Z A;  2XGN A;  1YSY A;  1N75 A;  5LMU M;  3U6E A;  4DV2 M;  1EE8 A;  1IBK M;  1QQW A;  5ITY A;  3VFD A;  2R4E A;  2F4V M;  3SMP A;  2L7H A;  2ZAO A;  3HGI A;  4RNA A;  2HCB A;  2IOU A;  1X37 A;  3RE8 A;  2Z3X A;  4QHT A;  1L2D A;  4LFA M;  4Z6Y A;  3AKZ A;  1HNZ M;  3AFH A;  4OU7 A;  4JXJ A;  4M9X A;  1IN5 A;  3HHZ A;  3U5Z A;  4G4Q A;  4LJ4 A;  1MX0 A;  4NOO B;  3U61 A;  3M6A A;  1QAO A;  1DGB A;  4EIW A;  3PVS A;  4JN6 A;  4NY2 A;  3GPP A;  2C98 A;  1JR3 D;  1FJG M;  3BOS A;  4GC9 A;  2QBY B;  2C9O A;  3HJS A;  4GMQ A;  1N32 M;  3W0L B;  2D7H A;  3GLH A;  1FNN A;  4LG2 A;  4FWH A;  5KPT A;  1YU0 A;  4M9Z A;  4JI0 M;  4QOS A;  1N36 M;  2DZN B;  4MGI E;  4ITQ A;  2XFS A;  2FOI C;  4QNM A;  3QAU A;  3KS4 A;  4DR5 M;  4FCT A;  3HU2 A;  4IBG A;  2C5R A;  4PDG A;  3D8B A;  3J7B A;  4R3D A;  3HSH A;  2KRK A;  1R2Y A;  4GKK M;  3DA1 A;  1IXR C;  1TH2 A;  2Z4S A;  2XSZ A;  3FUW A;  4D82 A;  4WW0 A;  3FTF A;  3U6M A;  2QPA A;  1YU2 A;  4OJP A;  4PCZ A;  1IXZ A;  4IBI A;  3GRV A;  1XHB A;  2CUZ A;  4W5W A;  1GLN A;  5GKN A;  2UUA M;  2ERC A;  1QYR A;  4D81 A;  2KXE A;  4DV4 M;  1IN4 A;  3A42 A;  3U6O A;  3CTW B;  3HU3 A;  4IJF A;  4MGY E;  3W0F A;  3JR4 A;  1E32 A;  1NY6 A;  4GC5 A;  5LMN M;  1YE9 A;  3AOG A;  4P16 A;  4LGM A;  4DV5 M;  3SAU A;  2NQ8 C;  2UXB M;  1XXH A;  2KZS A;  3GRU A;  1KYI A;  4LJ8 A;  4BLC A;  1QAN A;  3AV0 A;  5IZ7 D;  3A98 B;  4NZ5 A;  4BBA A;  5BPV A;  1G4A E;  5EXT A;  2KZU A;  3DOA A;  2M5Z A;  1HT2 E;  8CAT A;  1DGG A;  1DGF A;  2XH9 A;  4NXM M;  4B7F A;  3R9X B;  3LVW A;  1NY5 A;  1GL6 A;  2R45 A;  1IN8 A;  2LNH C;  4AKI A;  4OVZ A;  3GPX A;  3HJ8 A;  2Y2H A;  4DR7 M;  3EIE A;  3SHG B;  2FNA A;  1IBL M;  2QP9 X;  3SYL A;  4YHH M;  2CFO A;  2V1C A;  1N78 A;  3AOE A;  1NJF A;  3SHF A;  4AG6 A;  3PFI A;  1I94 M;  4GIT A;  3L28 A;  1OFH A;  3RGP A;  3GRY A;  3SAW A;  5ITU A;  4LF8 M;  4HLQ A;  2BJW A;  5EP1 A;  2O5R A;  3TPZ A;  1DGH B;  1LV7 A;  4KHP M;  4IBB A;  1SXJ C;  2R62 A;  2Y0Q A;  4QNR A;  2R46 A;  1YU3 A;  3FUV A;  1WXQ A;  2HL7 A;  1XMQ M;  5EP2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...