4LG2A

Crystal structure of reston ebola virus vp35 rna binding domain bound to 12-bp dsrna
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
122
structure length
122
Chain Sequence
b'ISAKDLKEIMYDHLPGFGTAFHQLVQVICKIGKDNNLLDTIHAEFQASLADGDSPQCALIQITKRVPIFQDVPPPIIHIRSRGDIPRACQKSLRPAPPSPKIDRGWVCLFKMQDGKTLGLKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polymerase cofactor
publication title Ebolavirus VP35 coats the backbone of double-stranded RNA for interferon antagonism.
pubmed doi rcsb
source organism Reston ebolavirus
molecule tags Rna binding protein/rna
total genus 38
structure length 122
sequence length 122
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4lg2A01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4lg2A02
4IJEA 3KS8A 3L28A 3L26A 4IBJA 3L25A 4IBEA 3FKEA 4IBCA 3L27A 3L2AA 5BPVA 4IJFA 4GH9A 4IBDA 4IBBA 4LG2A 3KS4A 4IBIA 4IBFA 4GHAA 3L29A 4IBKA 4GHLA 4IBGA
chains in the Genus database with same CATH superfamily
2G8LA 1NO1A 4AG6A 2D7HA 2DAGA 3U6OA 3SMSA 1QO6A 1VG5A 3WX7A 1WGLA 4DV3M 3HX3A 4KT0F 4LF7M 2M60A 3R9XB 3EIHA 1LTMA 1WJ7A 4LJ9A 4Z2IA 1J7KA 3GLIA 4MGZE 4DR5M 1XNQM 5ITYA 4QOSA 4RF0A 4P16A 1E9RA 5IREB 4JI0M 1HQYE 4OVZA 3GLHA 3VFDA 2R6FA 4LCBA 4L78A 4FWDA 1W1PA 3L29A 4Z2KA 3UK6A 3BXWA 3ILKA 1D0LA 4GHLA 1YU4A 2Y20A 2KRKA 4IBGA 2OPFA 3E9SA 3J2PB 4M9ZA 4PCZA 2X4AA 2H5XA 3KP0E 4MM3B 1GKIA 2FFFB 1TH3A 2D7GA 5EP4A 4IBEA 3J80S 1OQYA 4M0WA 5EP3A 4DBGB 2RTSA 2WSEF 2W82A 4AZFA 4L8RC 2G5GX 3GQ4A 3UGJA 3U6LA 4TX8A 2QBYA 3VK8A 1HT2E 3W68A 3PNVA 4CGYB 2L09A 1IN5A 2WSFF 2DWMA 1D0KA 1S3SA 3VDUA 4LJ6A 1LV7A 4NYYA 3WHKA 3U6EA 1E6ZA 1K82A 2KA6B 1DO2A 2HCBA 3VK7A 4L4UA 2VF7A 2CRUA 2QPAA 2XF3A 2KNVA 4LRTA 1L2DA 1IY0A 1N32M 2I7NA 4IJEA 3A46A 1DO0A 3SHGB 3T15A 2GNOA 2X8AA 3FYDA 5L8RF 3UMMA 1FNNA 1ZV1A 3B74A 1L1ZA 4FCVA 2JXNA 5JI2E 2LTUA 2Z7JA 1GO5A 3D8LA 1QQWA 3FD9A 1N34M 4AW4A 4OX9M 1DV0A 1QYRA 3L2AA 3RGPA 3GO8A 5FTMA 2JZ1A 4OU7A 3FE3A 2XSZA 2J7NA 4LZZA 3HKPA 2Y2JA 3CTWB 3RGSA 3LQQA 3AV0A 4D82A 4B3MM 2CE7A 1K3XA 2DENA 4LJ7A 1P3QQ 4DR7M 3M0EA 2HAKA 2F5QA 3FYCA 3ZCBB 4AQYM 4M9XA 3GLHB 3WD2A 3K2LA 4GEWA 2XLJA 1NNJA 3HHWA 3RFWA 4DUYM 1QZEA 2DHYA 4MB3A 1E32A 1Z5AA 3VLFB 2DAKA 3PFIA 1R2YA 1E15A 3N3FA 3WD4A 2LH0A 4R71A 1RU3A 3W0LB 3K1JA 2IOUA 4GC5A 2KRUA 2ERCA 1IBKM 4G3OA 2ZTDA 2Z8YM 1Q39A 2L6OA 2HKJA 2C99A 4LGMA 3AOEA 1XMQM 4OJPA 4HEOA 2M5ZA 4G4NA 3SHFA 4G4RA 3AKZA 5BPVA 2FFJA 1R5LA 5KPRA 1E6PA 1NSFA 1PJTA 2OO9A 1OFIA 1ORYB 2MR9A 4NC6A 5IZ7D 1QDRA 3GQ5A 4LG2A 1XNRM 1QAQA 3U61B 1OAIA 2DWZB 3DOAA 3T6PA 4Z2GA 1ZQ9A 2Z4RA 1E6RA 2F5OA 1PJQA 3J7BA 1N33M 2C9OA 4GITA 4L16A 1EAKA 4MGKE 4R7GA 4KLNA 4MB5A 3KSXA 2F5SA 1YLAA 3KOZE 3GLHE 1JR3E 3M6AA 4M0DA 4Z2HA 3U6QA 2KW0A 1AIPC 3ZH9B 2KNAA 8CATA 5DNYA 1PGYA 2XZFA 4AKHA 1V33A 5GKNA 1G59A 1UM8A 2EKFA 1QVRA 1I4WA 4NZ4A 1AIWA 1MX0A 2KHHA 2KXEA 2LBCA 2KZSA 4LJAA 3HWSA 1Z5CA 2FS1A 3KS4A 2C9CA 4NOOB 1QDTA 4Z8XA 2DZOB 4B3SM 1N36M 1IFYA 1UFZA 3KFUG 1KYIA 4LF4M 3C3DA 3TWMA 1ZMUA 1TH4A 3HJQA 2I7PA 1E94E 2Q2EB 3KP1E 3GQ3A 1W1TA 2Y2KA 3FUWA 1QZMA 1UR9A 3LW5F 4OW0A 3GRVA 1HT1E 1YU1A 1SXJA 3WHLA 2KDLA 3PXGA 3L28A 3I4YA 2R44A 1J5EM 5ITUA 3TWLA 3AOEC 3HJSA 1AUAA 4F2LA 1I94M 4AI6A 3TE6A 4DV2M 1OAOC 3M7PA 3K9PA 4D81A 5ITTA 4PD2A 1G4AE 1CUKA 3Q8GA 3J27B 2ZTCA 3KOWE 3SC3A 4LF5M 2CFOA 2VDBB 4JI5M 1WXQA 3JR4A 2V5OA 1QAOA 4LGYA 1Q3CA 1JR3A 5A2QS 3W67A 3CF0A 4MGYE 2H1RA 1IN6A 2MROB 1ZAEA 2JY5A 1HNXM 1PDCA 3MQLA 4FCTA 3H4JA 3SYKA 2QQ8A 4TUWA 4B3RM 4Z2LA 2JY7A 1E9SA 3NBIA 1W1YA 1QUTA 4FW9A 3WD3A 3TL4X 5E26A 2L7HA 2WSCF 1OIZA 3WD1A 2K0BX 2O01F 3ZQJA 3GLFB 2XZUA 4ANRA 4I4LA 3SMPA 1IXRC 2L2DA 3GPUA 2BWEA 4PDIA 3FTEA 2XD1A 3U61A 3VDPA 1T3TA 3HHYA 4LZJA 4K0KM 4PT5A 2UXBM 4IIWA 2JE5A 3FUTA 4DR3M 1N77A 5ITXE 1D2NA 2NQ8C 2Y2MA 4OJ5A 2BJVA 4B3TM 4ITQA 1VEJA 5EXPA 3SYLA 2QENA 1IQPA 1HNZM 4AG5A 3T1YM 2AHMA 5DYIA 1KS0A 1PJIA 4GIPA 2YNMD 2R45A 3CF2A 1SXJB 2LWXA 3IG8A 3QAUA 4DUZM 1UR8A 4LY6A 1Y8GA 2FN2A 1F4IA 2B3TA 2OOAA 1VQ1A 1W5TA 2YFQA 3L27A 2D7EA 4LJ5A 4NYUA 3U6MA 4JN6A 3GLFE 1JQJC 2DZNB 2O5RA 4NZ1A 2DVWB 5C1BA 5IWAM 3EIEA 3DZDA 4B7FA 1Q02A 1TH2A 4IBFA 4GHAA 1DGBA 2CHVA 2P5TA 3FTDA 3T38A 4PDGA 3UJNA 3K9OA 2ZBKB 5FTNA 4HMDA 4DR2M 3LCUA 2R0IA 1WHCA 4LFAM 2Y2GA 1YSYA 1YU0A 2OOBA 5EXTA 4B08A 2QSFX 4Z2JA 3QYEA 2QCUA 4QHTA 4D80A 3R8FA 1OTRA 2FNAA 4GRIA 3JR5A 4NXNM 1NV9A 1IM2A 3FRIA 4KHPM 1R6BX 2CWBA 2JCHA 3L25A 2RGHA 4DR4M 4NXMM 3B9PA 4P17A 1C7YA 2LVOC 3JAMS 5C18A 1SXJE 5JI3E 1IXZA 1MJGM 4JI2M 2E5LM 3LCVB 1G3IA 4IBBA 2EJSA 3FUXA 4BLCA 2FH0A 4A3VB 1N75A 5ITXA 2RGOA 3SFZA 2R4JA 4GMQA 2CV1A 1OFHA 2J5YA 2JWSA 5KQ8A 4M9SA 3FUUA 2C98A 3AJIB 5H37D 4CISA 4DV7M 4LF6M 2N35A 4QOZC 3U5ZB 1CK7A 1HQCA 4DR1M 2Y2PA 2CV2A 1W1VA 4X65M 2ZAOA 5EXSA 1IN7A 1GVNA 2LHGA 2QHOB 3GRRA 3GLGA 2EA0A 3KS8A 1L1TA 1XXHB 5FTJA 2EUCA 3SAWA 4KO8A 3L26A 3HSHA 4DV5M 3I51A 2DNAA 3E4RA 3GLFA 4NY2A 3C58A 4OUIA 5EP2A 5LMNM 5ITRA 1KSFX 3HJ8A 4WURA 4JI3M 1G8PA 1TF0B 4IBDA 1GLNA 4DV1M 2MGWA 3SAVA 2HL7A 1H8PA 4NZ3A 3K8ZA 1IY2A 4AKGA 4I5SA 1IN8A 2MJ5B 3H4MA 2V6ZM 3C3EA 4NL4H 1YE9A 5FTKA 1XHBA 3U6PA 1T6OA 1Z6TA 2BG1A 1HJPA 4R3DA 2JP7A 3MJ5A 4RKUF 3TPZA 1ZMVA 2UWXA 1VDLA 3J81S 2F5NA 1YU3A 1NV8A 3HU3A 1XC8A 2JY6B 5EXXA 2DHRA 2XSZD 4XK8F 1MU5A 3M7GA 2R4EA 2BNKA 2BJWA 4L15A 4DV6M 2CEAA 2FE8A 2DWNA 1XXHE 1HR0M 1IN4A 3HZJA 1GJSA 2LVPC 1EFUB 1OJLA 3SAUA 1YUEA 2R46A 4QNMA 1VEGA 3KOYE 3MHVC 3LVWA 1QUSA 3CGWA 2R62A 2Y21A 4MB7A 1EIJA 5EQTA 4REZA 1PRBA 2DAMA 2R18A 4X64M 1SG9A 1L6JA 5BR8M 3F92A 2Y2OA 4NZ5A 4G4QA 4F1IA 3T1HM 4JI6M 2DAEA 3HY5A 3SATA 1TGUA 4BB9A 3NWLA 4AKIA 2CV0A 4DR6M 4HLQA 2XGNA 1BVSA 2JUJA 1IBLM 4HMCA 3IECA 1CXWA 2QNJA 5KQDA 1X37A 2Y2QA 3Q8XA 4LJ8A 2V1CA 3HHXA 3D8BA 4RNAA 2J7OA 1W5SA 4IBJA 3GLGB 2Z3XA 2UU9M 4LFCM 4LFBM 5E6JA 3C9PA 2DAIA 1G41A 3FKEA 1Z5BA 2C5RA 1TR8A 4I8OA 1NNUC 2LXEA 4OJLA 4JI7M 2HWJA 2KNZA 1PM5A 4JI1M 1GPFA 1GL7A 1GJTA 1NHWC 2DWLA 1ZMWA 3VKGA 4Y28F 4NRWA 3E46A 3KVWA 3W0FA 2JY8A 2FOIC 3B89A 1K3WA 3U5ZA 2BWBA 4NSRA 3SASA 1GL6A 3B7ZA 3GRYA 3GPPA 4DV0M 2D49A 1Z59A 3B7QA 2Y2LA 1SXJC 3PNYA 2L4FA 4RF1A 2OQ4A 2CHQA 1XXHA 1PJSA 2V1UA 2Z4SA 3AL0C 1WR1B 2CP8A 2QZ4A 3KXEC 2XEPA 2Y0QA 2K47A 2DXIA 2WZJA 4G4OA 2G3QA 3SARA 1H0IA 2R65A 1IXSB 4MGIE 3NBXX 4B7HA 3IHPA 3GLGE 3A98B 2VQFM 4XGIA 2Y2NA 1YU2A 1GABA 2Y2IA 3SBJA 2F4VM 3U60B 2XFSA 2UUBM 2APLA 2DI0A 4FD2A 4DV4M 3KDSE 1VDDA 1OKSA 4W5WA 5KPTA 1DGFA 4GC9A 3GP1A 2EKKA 3KOXE 1SXJD 5EJCA 1QANA 1J7MA 1N78A 2JZ0A 3FRHA 4IBIA 4X66M 1EE8A 5FTLA 2VQEM 1G71A 3GRUA 3HU2A 3LVVA 5ITQA 2ZM6M 3BBZA 1XMOM 4IBKA 3HGIA 2HHHM 1TTEA 1IBMM 3FTCA 3ZC7B 2L7IA 3QYBA 3TWKA 2O25A 3GPYA 2UXCM 1ED7A 2LVQD 3A42A 3THGA 4LJ4A 4MGHA 3GPXA 1DGHA 3CF6E 4IBCA 1JR3D 4I81A 1HNWM 3HHZA 5IT9S 1L2CA 3MMPA 4KODA 1OGBA 4IJFA 4EIWA 2K6BA 1J09A 2DKLA 3KSJA 3KW6A 3QWLA 4FCWA 4FWHA 4JXJA 5KPZA 3GLIB 1MN3A 4BBAA 4GKJM 7CATA 2KZUA 4X62M 1TDZA 2L4EA 3K92A 1Q3BA 2ZAMA 4WP2A 2CUZA 3I04M 4NRVA 1IY1A 1R7RA 2EO2A 3HU1A 4OVZB 3OTOM 2UUAM 4FVMA 1OIPA 2ZANA 4JI4M 1NJFA 5KO3A 1E8BA 2XFTA 4CIZA 1YUBA 4G6ZA 4YY3M 1TDHA 1XWIA 2X49A 2Y0TA 3V76A 2RKOA 1L8QA 2LNHC 5DFLA 1R4GA 1V92A 4LRSA 4Q7JA 3RE8A 2MH8A 4HL4A 3VKHA 2XD5A 1D0MA 1E88A 2LVAA 2LHCA 1PJJA 4LF9M 1GOIA 4QNRA 4OJOA 2LVNC 2UUCM 1H0GA 5DYGA 2RRUA 4II7A 2VF8A 3A45A 2QBYB 1NHGC 1O6IA 4WW0A 1NVMA 4QHSA 3HONA 2JNHA 1GXDA 2DZLA 2YR0A 3GLIE 4JI8M 4LF8M 4CHTB 4OJ6A 2QP9X 1WIVA 3AFHA 3I4VA 3E21A 4NSOB 3DFZA 4CJ6A 2Y2HA 3BOSA 5LMUM 3LMMA 1DGGA 1R2ZA 1E6NA 2F5PA 4JYAM 1A5TA 1C1KA 2A5YB 1NJGA 3U6DA 4S12A 5EP1A 4QNLA 4B7GA 1V34A 3U6SA 1NY5A 1JB0F 3FTFA 5F3WA 4MH0E 1KFVA 1IXSA 3I01M 4UN2B 2K9DA 2C96A 1QAMA 1FJGM 3U60A 4FWGA 1DGHB 3TQSA 4L6V6 4Z6YA 3J7AS 4GKKM 4GH9A 2XH9A 4YHHM 1VEKA 3MK6A 2GQFA 4JV5M 2UXDM 1NY6A 3LQRA 4HMEA 2CHGA 1XB2B 2JA2A 3IG5A 3PVSA 4MB4A 1WGNA 3WD0A 4XBOA 3FUVA 5FSWA 1L2BA 3UZUA 2VIIA 1H6UA 3DA1A 3U6CA 2YQZA 3AOGA 1OGGA 1T43A 3B7NA 5FLXS 4ZPXA 2KEBA
chains in the Genus database with same CATH topology
2G8LA 4AG6A 2D7HA 3U6OA 3SMSA 3WX7A 4DV3M 4LF7M 3R9XB 2M60A 3EIHA 4LJ9A 1J7KA 3GLIA 4MGZE 4DR5M 1XNQM 5ITYA 4QOSA 4RF0A 4P16A 1E9RA 5IREB 4JI0M 1HQYE 4OVZA 3GLHA 3VFDA 4LCBA 4L78A 4FWDA 3L29A 3UK6A 3ILKA 4GHLA 1YU4A 2Y20A 2KRKA 4IBGA 2OPFA 3E9SA 3J2PB 4M9ZA 4PCZA 2X4AA 4MM3B 3KP0E 1GKIA 2FFFB 1TH3A 2D7GA 5EP4A 4IBEA 3J80S 4M0WA 5EP3A 2W82A 4AZFA 4L8RC 2G5GX 3GQ4A 3UGJA 3U6LA 2QBYA 3VK8A 1HT2E 3PNVA 4CGYB 2L09A 1IN5A 2DWMA 1S3SA 3VDUA 4LJ6A 1LV7A 4NYYA 3WHKA 3U6EA 1K82A 2KA6B 1DO2A 2HCBA 3VK7A 4L4UA 2QPAA 2XF3A 1L2DA 4LRTA 1N32M 1IY0A 2I7NA 4IJEA 3A46A 1DO0A 3SHGB 3T15A 2X8AA 3FYDA 3UMMA 1FNNA 1L1ZA 4FCVA 5JI2E 2Z7JA 3D8LA 1QQWA 3FD9A 1N34M 4AW4A 4OX9M 1QYRA 3L2AA 3RGPA 3GO8A 5FTMA 4OU7A 2XSZA 2J7NA 4LZZA 3HKPA 2Y2JA 3CTWB 3RGSA 3LQQA 3AV0A 4D82A 4B3MM 2CE7A 1K3XA 4LJ7A 4DR7M 3M0EA 2F5QA 3FYCA 3ZCBB 4AQYM 4M9XA 3GLHB 3K2LA 2XLJA 1NNJA 3HHWA 3RFWA 4DUYM 1E32A 1Z5AA 3VLFB 3PFIA 1R2YA 3N3FA 2LH0A 3W0LB 3K1JA 2IOUA 4GC5A 2KRUA 2ERCA 1IBKM 1Q39A 2L6OA 2HKJA 2C99A 4LGMA 3AOEA 1XMQM 4OJPA 2M5ZA 4G4NA 3SHFA 4G4RA 3AKZA 5BPVA 2FFJA 5KPRA 1NSFA 5IZ7D 4LG2A 1OFIA 1ORYB 3GQ5A 1XNRM 1QAQA 3U61B 2DWZB 3DOAA 1ZQ9A 2Z4RA 2F5OA 3J7BA 1N33M 2C9OA 4GITA 4L16A 4MGKE 4R7GA 4KLNA 3KSXA 2F5SA 3KOZE 3M6AA 4M0DA 3U6QA 2KW0A 8CATA 3ZH9B 5DNYA 2XZFA 4AKHA 5GKNA 1G59A 1UM8A 1QVRA 1I4WA 4NZ4A 1MX0A 2KXEA 2KZSA 4LJAA 3HWSA 1Z5CA 3KS4A 2C9CA 4NOOB 4Z8XA 2DZOB 4B3SM 1N36M 3KFUG 1KYIA 4LF4M 3TWMA 1TH4A 3HJQA 2I7PA 1E94E 2Q2EB 3KP1E 3GQ3A 2Y2KA 3FUWA 1QZMA 4OW0A 3GRVA 1HT1E 1YU1A 1SXJA 3WHLA 3PXGA 3L28A 3I4YA 1J5EM 5ITUA 3TWLA 3AOEC 3HJSA 1I94M 4AI6A 3TE6A 4DV2M 4D81A 5ITTA 4PD2A 1G4AE 3J27B 3KOWE 3SC3A 4LF5M 2CFOA 4JI5M 1WXQA 3JR4A 1QAOA 4LGYA 1Q3CA 1JR3A 5A2QS 3CF0A 4MGYE 2H1RA 1IN6A 1ZAEA 1HNXM 4FCTA 3SYKA 4TUWA 4B3RM 1E9SA 3NBIA 4FW9A 3TL4X 5E26A 2L7HA 3GLFB 2XZUA 4I4LA 3SMPA 1IXRC 3GPUA 4PDIA 3FTEA 2XD1A 3U61A 3VDPA 1T3TA 3HHYA 4LZJA 4K0KM 4PT5A 2UXBM 4IIWA 2JE5A 3FUTA 4DR3M 1N77A 5ITXE 1D2NA 2NQ8C 2Y2MA 4OJ5A 2BJVA 4B3TM 4ITQA 5EXPA 3SYLA 2QENA 1IQPA 1HNZM 4AG5A 3T1YM 2AHMA 5DYIA 4GIPA 2YNMD 2R45A 3CF2A 1SXJB 2LWXA 3IG8A 3QAUA 4DUZM 4LY6A 1W5TA 2YFQA 3L27A 2D7EA 4LJ5A 4NYUA 3U6MA 4JN6A 1JQJC 2DZNB 2O5RA 4NZ1A 2DVWB 5C1BA 5IWAM 3EIEA 3DZDA 4B7FA 1TH2A 4IBFA 4GHAA 1DGBA 2CHVA 2P5TA 3FTDA 3T38A 4PDGA 3UJNA 2ZBKB 5FTNA 4DR2M 4LFAM 2Y2GA 1YSYA 1YU0A 5EXTA 4B08A 4QHTA 2QCUA 4D80A 3R8FA 4GRIA 2FNAA 3JR5A 4NXNM 1IM2A 4KHPM 1R6BX 2JCHA 3L25A 2RGHA 4DR4M 4NXMM 3B9PA 3JAMS 5C18A 1SXJE 5JI3E 1IXZA 4JI2M 2E5LM 1G3IA 4IBBA 3FUXA 4BLCA 4A3VB 1N75A 5ITXA 2RGOA 3SFZA 2R4JA 4GMQA 2CV1A 1OFHA 5KQ8A 4M9SA 3FUUA 2C98A 3AJIB 5H37D 4CISA 4DV7M 4LF6M 4QOZC 3U5ZB 1HQCA 4DR1M 2Y2PA 2CV2A 4X65M 2ZAOA 5EXSA 1IN7A 1GVNA 3GRRA 3GLGA 2EA0A 3KS8A 1L1TA 1XXHB 5FTJA 2EUCA 3SAWA 4KO8A 3L26A 3HSHA 4DV5M 3I51A 3E4RA 3GLFA 4NY2A 3C58A 4OUIA 5EP2A 5LMNM 5ITRA 1KSFX 3HJ8A 4WURA 4JI3M 1G8PA 4IBDA 1GLNA 4DV1M 3SAVA 2HL7A 4NZ3A 3K8ZA 1IY2A 4AKGA 4I5SA 1IN8A 3H4MA 2V6ZM 4NL4H 1YE9A 5FTKA 1XHBA 3U6PA 2BG1A 1Z6TA 3TPZA 4R3DA 3MJ5A 2UWXA 3J81S 2F5NA 1YU3A 3HU3A 1XC8A 5EXXA 2DHRA 2XSZD 1MU5A 3M7GA 2R4EA 2BNKA 2BJWA 4L15A 4DV6M 2CEAA 2FE8A 2DWNA 1HR0M 1IN4A 1OJLA 3SAUA 1YUEA 2R46A 4QNMA 3KOYE 3MHVC 3LVWA 2R62A 2Y21A 4MB7A 5EQTA 4REZA 2R18A 4X64M 5BR8M 2Y2OA 4NZ5A 4G4QA 3T1HM 4JI6M 3SATA 1TGUA 4BB9A 3NWLA 4AKIA 2CV0A 4DR6M 4HLQA 2XGNA 1IBLM 5KQDA 1X37A 2Y2QA 3Q8XA 4LJ8A 2V1CA 3HHXA 3D8BA 4RNAA 2J7OA 1W5SA 4IBJA 3GLGB 2Z3XA 2UU9M 4LFCM 4LFBM 5E6JA 1G41A 3FKEA 1Z5BA 2C5RA 4I8OA 1NNUC 2LXEA 4OJLA 4JI7M 1PM5A 4JI1M 1GL7A 1NHWC 2DWLA 3VKGA 4NRWA 3KVWA 3W0FA 1K3WA 2FOIC 3U5ZA 3SASA 4NSRA 1GL6A 3GRYA 3GPPA 4DV0M 1Z59A 2Y2LA 1SXJC 3PNYA 2OQ4A 4RF1A 2CHQA 1XXHA 2V1UA 3AL0C 2Z4SA 3KXEC 2QZ4A 2XEPA 2Y0QA 2K47A 2DXIA 4G4OA 3SARA 2R65A 1IXSB 4MGIE 1PJIA 4B7HA 2Y2NA 3A98B 2VQFM 4XGIA 1YU2A 2Y2IA 3SBJA 2F4VM 3U60B 2XFSA 2UUBM 4FD2A 4DV4M 3KDSE 1VDDA 3GP1A 4W5WA 5KPTA 1DGFA 4GC9A 5F3WA 5EJCA 3KOXE 1SXJD 1QANA 1N78A 4IBIA 4X66M 1EE8A 5FTLA 2VQEM 3HU2A 3GRUA 3LVVA 5ITQA 2ZM6M 1XMOM 4IBKA 3HGIA 2HHHM 1IBMM 3FTCA 3ZC7B 2L7IA 3TWKA 3GPYA 2UXCM 3A42A 3THGA 4LJ4A 4MGHA 3GPXA 1DGHA 3CF6E 4IBCA 1JR3D 4I81A 1HNWM 3HHZA 5IT9S 1L2CA 4KODA 4IJFA 4EIWA 3KSJA 1J09A 3KW6A 3QWLA 4FCWA 4FWHA 4JXJA 3GLIB 5KPZA 4GKJM 4BBAA 7CATA 2KZUA 4X62M 1TDZA 3K92A 1Q3BA 2ZAMA 2CUZA 3OTOM 4NRVA 1IY1A 1R7RA 2EO2A 3HU1A 4OVZB 2UUAM 4FVMA 2ZANA 4JI4M 1NJFA 5KO3A 2XFTA 4YY3M 1YUBA 4G6ZA 1TDHA 1XWIA 2X49A 2Y0TA 2RKOA 1L8QA 2LNHC 4LRSA 3RE8A 4HL4A 3VKHA 2XD5A 1PJJA 4LF9M 4QNRA 4OJOA 2UUCM 5DYGA 4II7A 3A45A 2QBYB 1NHGC 4WW0A 1NVMA 4QHSA 3HONA 4LF8M 2YR0A 4JI8M 4CHTB 4OJ6A 2QP9X 3AFHA 3I4VA 4NSOB 3DFZA 2Y2HA 3BOSA 5LMUM 3LMMA 1DGGA 1R2ZA 2F5PA 4JYAM 1C1KA 2A5YB 1NJGA 3U6DA 4S12A 5EP1A 4QNLA 4B7GA 3U6SA 1NY5A 3FTFA 4MH0E 1KFVA 2C96A 1QAMA 1FJGM 3U60A 4FWGA 1DGHB 3TQSA 4Z6YA 3J7AS 4GKKM 4GH9A 2XH9A 4YHHM 3MK6A 4JV5M 2UXDM 1NY6A 3LQRA 2CHGA 2JA2A 3IG5A 3PVSA 4XBOA 3FUVA 5FSWA 1L2BA 3UZUA 2VIIA 1H6UA 3DA1A 3U6CA 2YQZA 3AOGA 5FLXS 4ZPXA 2KEBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IJE A;  3KS8 A;  3L28 A;  3L26 A;  4IBJ A;  3L25 A;  4IBE A;  3FKE A;  4IBC A;  3L27 A;  3L2A A;  5BPV A;  4IJF A;  4GH9 A;  4IBD A;  4IBB A;  4LG2 A;  3KS4 A;  4IBI A;  4IBF A;  4GHA A;  3L29 A;  4IBK A;  4GHL A;  4IBG A; 
#chains in the Genus database with same CATH topology
 2G8L A;  1NO1 A;  4AG6 A;  2D7H A;  2DAG A;  3U6O A;  3SMS A;  1QO6 A;  1VG5 A;  3WX7 A;  1WGL A;  4DV3 M;  3HX3 A;  4KT0 F;  4LF7 M;  2M60 A;  3R9X B;  3EIH A;  1LTM A;  1WJ7 A;  4LJ9 A;  4Z2I A;  1J7K A;  3GLI A;  4MGZ E;  4DR5 M;  1XNQ M;  5ITY A;  4QOS A;  4RF0 A;  4P16 A;  1E9R A;  5IRE B;  4JI0 M;  1HQY E;  4OVZ A;  3GLH A;  3VFD A;  2R6F A;  4LCB A;  4L78 A;  4FWD A;  1W1P A;  3L29 A;  4Z2K A;  3UK6 A;  3BXW A;  3ILK A;  1D0L A;  4GHL A;  1YU4 A;  2Y20 A;  2KRK A;  4IBG A;  2OPF A;  3E9S A;  3J2P B;  4M9Z A;  4PCZ A;  2X4A A;  2H5X A;  3KP0 E;  4MM3 B;  1GKI A;  2FFF B;  1TH3 A;  2D7G A;  5EP4 A;  4IBE A;  3J80 S;  1OQY A;  4M0W A;  5EP3 A;  4DBG B;  2RTS A;  2WSE F;  2W82 A;  4AZF A;  4L8R C;  2G5G X;  3GQ4 A;  3UGJ A;  3U6L A;  4TX8 A;  2QBY A;  3VK8 A;  1HT2 E;  3W68 A;  3PNV A;  4CGY B;  2L09 A;  1IN5 A;  2WSF F;  2DWM A;  1D0K A;  1S3S A;  3VDU A;  4LJ6 A;  1LV7 A;  4NYY A;  3WHK A;  3U6E A;  1E6Z A;  1K82 A;  2KA6 B;  1DO2 A;  2HCB A;  3VK7 A;  4L4U A;  2VF7 A;  2CRU A;  2QPA A;  2XF3 A;  2KNV A;  4LRT A;  1L2D A;  1IY0 A;  1N32 M;  2I7N A;  4IJE A;  3A46 A;  1DO0 A;  3SHG B;  3T15 A;  2GNO A;  2X8A A;  3FYD A;  5L8R F;  3UMM A;  1FNN A;  1ZV1 A;  3B74 A;  1L1Z A;  4FCV A;  2JXN A;  5JI2 E;  2LTU A;  2Z7J A;  1GO5 A;  3D8L A;  1QQW A;  3FD9 A;  1N34 M;  4AW4 A;  4OX9 M;  1DV0 A;  1QYR A;  3L2A A;  3RGP A;  3GO8 A;  5FTM A;  2JZ1 A;  4OU7 A;  3FE3 A;  2XSZ A;  2J7N A;  4LZZ A;  3HKP A;  2Y2J A;  3CTW B;  3RGS A;  3LQQ A;  3AV0 A;  4D82 A;  4B3M M;  2CE7 A;  1K3X A;  2DEN A;  4LJ7 A;  1P3Q Q;  4DR7 M;  3M0E A;  2HAK A;  2F5Q A;  3FYC A;  3ZCB B;  4AQY M;  4M9X A;  3GLH B;  3WD2 A;  3K2L A;  4GEW A;  2XLJ A;  1NNJ A;  3HHW A;  3RFW A;  4DUY M;  1QZE A;  2DHY A;  4MB3 A;  1E32 A;  1Z5A A;  3VLF B;  2DAK A;  3PFI A;  1R2Y A;  1E15 A;  3N3F A;  3WD4 A;  2LH0 A;  4R71 A;  1RU3 A;  3W0L B;  3K1J A;  2IOU A;  4GC5 A;  2KRU A;  2ERC A;  1IBK M;  4G3O A;  2ZTD A;  2Z8Y M;  1Q39 A;  2L6O A;  2HKJ A;  2C99 A;  4LGM A;  3AOE A;  1XMQ M;  4OJP A;  4HEO A;  2M5Z A;  4G4N A;  3SHF A;  4G4R A;  3AKZ A;  5BPV A;  2FFJ A;  1R5L A;  5KPR A;  1E6P A;  1NSF A;  1PJT A;  2OO9 A;  1OFI A;  1ORY B;  2MR9 A;  4NC6 A;  5IZ7 D;  1QDR A;  3GQ5 A;  4LG2 A;  1XNR M;  1QAQ A;  3U61 B;  1OAI A;  2DWZ B;  3DOA A;  3T6P A;  4Z2G A;  1ZQ9 A;  2Z4R A;  1E6R A;  2F5O A;  1PJQ A;  3J7B A;  1N33 M;  2C9O A;  4GIT A;  4L16 A;  1EAK A;  4MGK E;  4R7G A;  4KLN A;  4MB5 A;  3KSX A;  2F5S A;  1YLA A;  3KOZ E;  3GLH E;  1JR3 E;  3M6A A;  4M0D A;  4Z2H A;  3U6Q A;  2KW0 A;  1AIP C;  3ZH9 B;  2KNA A;  8CAT A;  5DNY A;  1PGY A;  2XZF A;  4AKH A;  1V33 A;  5GKN A;  1G59 A;  1UM8 A;  2EKF A;  1QVR A;  1I4W A;  4NZ4 A;  1AIW A;  1MX0 A;  2KHH A;  2KXE A;  2LBC A;  2KZS A;  4LJA A;  3HWS A;  1Z5C A;  2FS1 A;  3KS4 A;  2C9C A;  4NOO B;  1QDT A;  4Z8X A;  2DZO B;  4B3S M;  1N36 M;  1IFY A;  1UFZ A;  3KFU G;  1KYI A;  4LF4 M;  3C3D A;  3TWM A;  1ZMU A;  1TH4 A;  3HJQ A;  2I7P A;  1E94 E;  2Q2E B;  3KP1 E;  3GQ3 A;  1W1T A;  2Y2K A;  3FUW A;  1QZM A;  1UR9 A;  3LW5 F;  4OW0 A;  3GRV A;  1HT1 E;  1YU1 A;  1SXJ A;  3WHL A;  2KDL A;  3PXG A;  3L28 A;  3I4Y A;  2R44 A;  1J5E M;  5ITU A;  3TWL A;  3AOE C;  3HJS A;  1AUA A;  4F2L A;  1I94 M;  4AI6 A;  3TE6 A;  4DV2 M;  1OAO C;  3M7P A;  3K9P A;  4D81 A;  5ITT A;  4PD2 A;  1G4A E;  1CUK A;  3Q8G A;  3J27 B;  2ZTC A;  3KOW E;  3SC3 A;  4LF5 M;  2CFO A;  2VDB B;  4JI5 M;  1WXQ A;  3JR4 A;  2V5O A;  1QAO A;  4LGY A;  1Q3C A;  1JR3 A;  5A2Q S;  3W67 A;  3CF0 A;  4MGY E;  2H1R A;  1IN6 A;  2MRO B;  1ZAE A;  2JY5 A;  1HNX M;  1PDC A;  3MQL A;  4FCT A;  3H4J A;  3SYK A;  2QQ8 A;  4TUW A;  4B3R M;  4Z2L A;  2JY7 A;  1E9S A;  3NBI A;  1W1Y A;  1QUT A;  4FW9 A;  3WD3 A;  3TL4 X;  5E26 A;  2L7H A;  2WSC F;  1OIZ A;  3WD1 A;  2K0B X;  2O01 F;  3ZQJ A;  3GLF B;  2XZU A;  4ANR A;  4I4L A;  3SMP A;  1IXR C;  2L2D A;  3GPU A;  2BWE A;  4PDI A;  3FTE A;  2XD1 A;  3U61 A;  3VDP A;  1T3T A;  3HHY A;  4LZJ A;  4K0K M;  4PT5 A;  2UXB M;  4IIW A;  2JE5 A;  3FUT A;  4DR3 M;  1N77 A;  5ITX E;  1D2N A;  2NQ8 C;  2Y2M A;  4OJ5 A;  2BJV A;  4B3T M;  4ITQ A;  1VEJ A;  5EXP A;  3SYL A;  2QEN A;  1IQP A;  1HNZ M;  4AG5 A;  3T1Y M;  2AHM A;  5DYI A;  1KS0 A;  1PJI A;  4GIP A;  2YNM D;  2R45 A;  3CF2 A;  1SXJ B;  2LWX A;  3IG8 A;  3QAU A;  4DUZ M;  1UR8 A;  4LY6 A;  1Y8G A;  2FN2 A;  1F4I A;  2B3T A;  2OOA A;  1VQ1 A;  1W5T A;  2YFQ A;  3L27 A;  2D7E A;  4LJ5 A;  4NYU A;  3U6M A;  4JN6 A;  3GLF E;  1JQJ C;  2DZN B;  2O5R A;  4NZ1 A;  2DVW B;  5C1B A;  5IWA M;  3EIE A;  3DZD A;  4B7F A;  1Q02 A;  1TH2 A;  4IBF A;  4GHA A;  1DGB A;  2CHV A;  2P5T A;  3FTD A;  3T38 A;  4PDG A;  3UJN A;  3K9O A;  2ZBK B;  5FTN A;  4HMD A;  4DR2 M;  3LCU A;  2R0I A;  1WHC A;  4LFA M;  2Y2G A;  1YSY A;  1YU0 A;  2OOB A;  5EXT A;  4B08 A;  2QSF X;  4Z2J A;  3QYE A;  2QCU A;  4QHT A;  4D80 A;  3R8F A;  1OTR A;  2FNA A;  4GRI A;  3JR5 A;  4NXN M;  1NV9 A;  1IM2 A;  3FRI A;  4KHP M;  1R6B X;  2CWB A;  2JCH A;  3L25 A;  2RGH A;  4DR4 M;  4NXM M;  3B9P A;  4P17 A;  1C7Y A;  2LVO C;  3JAM S;  5C18 A;  1SXJ E;  5JI3 E;  1IXZ A;  1MJG M;  4JI2 M;  2E5L M;  3LCV B;  1G3I A;  4IBB A;  2EJS A;  3FUX A;  4BLC A;  2FH0 A;  4A3V B;  1N75 A;  5ITX A;  2RGO A;  3SFZ A;  2R4J A;  4GMQ A;  2CV1 A;  1OFH A;  2J5Y A;  2JWS A;  5KQ8 A;  4M9S A;  3FUU A;  2C98 A;  3AJI B;  5H37 D;  4CIS A;  4DV7 M;  4LF6 M;  2N35 A;  4QOZ C;  3U5Z B;  1CK7 A;  1HQC A;  4DR1 M;  2Y2P A;  2CV2 A;  1W1V A;  4X65 M;  2ZAO A;  5EXS A;  1IN7 A;  1GVN A;  2LHG A;  2QHO B;  3GRR A;  3GLG A;  2EA0 A;  3KS8 A;  1L1T A;  1XXH B;  5FTJ A;  2EUC A;  3SAW A;  4KO8 A;  3L26 A;  3HSH A;  4DV5 M;  3I51 A;  2DNA A;  3E4R A;  3GLF A;  4NY2 A;  3C58 A;  4OUI A;  5EP2 A;  5LMN M;  5ITR A;  1KSF X;  3HJ8 A;  4WUR A;  4JI3 M;  1G8P A;  1TF0 B;  4IBD A;  1GLN A;  4DV1 M;  2MGW A;  3SAV A;  2HL7 A;  1H8P A;  4NZ3 A;  3K8Z A;  1IY2 A;  4AKG A;  4I5S A;  1IN8 A;  2MJ5 B;  3H4M A;  2V6Z M;  3C3E A;  4NL4 H;  1YE9 A;  5FTK A;  1XHB A;  3U6P A;  1T6O A;  1Z6T A;  2BG1 A;  1HJP A;  4R3D A;  2JP7 A;  3MJ5 A;  4RKU F;  3TPZ A;  1ZMV A;  2UWX A;  1VDL A;  3J81 S;  2F5N A;  1YU3 A;  1NV8 A;  3HU3 A;  1XC8 A;  2JY6 B;  5EXX A;  2DHR A;  2XSZ D;  4XK8 F;  1MU5 A;  3M7G A;  2R4E A;  2BNK A;  2BJW A;  4L15 A;  4DV6 M;  2CEA A;  2FE8 A;  2DWN A;  1XXH E;  1HR0 M;  1IN4 A;  3HZJ A;  1GJS A;  2LVP C;  1EFU B;  1OJL A;  3SAU A;  1YUE A;  2R46 A;  4QNM A;  1VEG A;  3KOY E;  3MHV C;  3LVW A;  1QUS A;  3CGW A;  2R62 A;  2Y21 A;  4MB7 A;  1EIJ A;  5EQT A;  4REZ A;  1PRB A;  2DAM A;  2R18 A;  4X64 M;  1SG9 A;  1L6J A;  5BR8 M;  3F92 A;  2Y2O A;  4NZ5 A;  4G4Q A;  4F1I A;  3T1H M;  4JI6 M;  2DAE A;  3HY5 A;  3SAT A;  1TGU A;  4BB9 A;  3NWL A;  4AKI A;  2CV0 A;  4DR6 M;  4HLQ A;  2XGN A;  1BVS A;  2JUJ A;  1IBL M;  4HMC A;  3IEC A;  1CXW A;  2QNJ A;  5KQD A;  1X37 A;  2Y2Q A;  3Q8X A;  4LJ8 A;  2V1C A;  3HHX A;  3D8B A;  4RNA A;  2J7O A;  1W5S A;  4IBJ A;  3GLG B;  2Z3X A;  2UU9 M;  4LFC M;  4LFB M;  5E6J A;  3C9P A;  2DAI A;  1G41 A;  3FKE A;  1Z5B A;  2C5R A;  1TR8 A;  4I8O A;  1NNU C;  2LXE A;  4OJL A;  4JI7 M;  2HWJ A;  2KNZ A;  1PM5 A;  4JI1 M;  1GPF A;  1GL7 A;  1GJT A;  1NHW C;  2DWL A;  1ZMW A;  3VKG A;  4Y28 F;  4NRW A;  3E46 A;  3KVW A;  3W0F A;  2JY8 A;  2FOI C;  3B89 A;  1K3W A;  3U5Z A;  2BWB A;  4NSR A;  3SAS A;  1GL6 A;  3B7Z A;  3GRY A;  3GPP A;  4DV0 M;  2D49 A;  1Z59 A;  3B7Q A;  2Y2L A;  1SXJ C;  3PNY A;  2L4F A;  4RF1 A;  2OQ4 A;  2CHQ A;  1XXH A;  1PJS A;  2V1U A;  2Z4S A;  3AL0 C;  1WR1 B;  2CP8 A;  2QZ4 A;  3KXE C;  2XEP A;  2Y0Q A;  2K47 A;  2DXI A;  2WZJ A;  4G4O A;  2G3Q A;  3SAR A;  1H0I A;  2R65 A;  1IXS B;  4MGI E;  3NBX X;  4B7H A;  3IHP A;  3GLG E;  3A98 B;  2VQF M;  4XGI A;  2Y2N A;  1YU2 A;  1GAB A;  2Y2I A;  3SBJ A;  2F4V M;  3U60 B;  2XFS A;  2UUB M;  2APL A;  2DI0 A;  4FD2 A;  4DV4 M;  3KDS E;  1VDD A;  1OKS A;  4W5W A;  5KPT A;  1DGF A;  4GC9 A;  3GP1 A;  2EKK A;  3KOX E;  1SXJ D;  5EJC A;  1QAN A;  1J7M A;  1N78 A;  2JZ0 A;  3FRH A;  4IBI A;  4X66 M;  1EE8 A;  5FTL A;  2VQE M;  1G71 A;  3GRU A;  3HU2 A;  3LVV A;  5ITQ A;  2ZM6 M;  3BBZ A;  1XMO M;  4IBK A;  3HGI A;  2HHH M;  1TTE A;  1IBM M;  3FTC A;  3ZC7 B;  2L7I A;  3QYB A;  3TWK A;  2O25 A;  3GPY A;  2UXC M;  1ED7 A;  2LVQ D;  3A42 A;  3THG A;  4LJ4 A;  4MGH A;  3GPX A;  1DGH A;  3CF6 E;  4IBC A;  1JR3 D;  4I81 A;  1HNW M;  3HHZ A;  5IT9 S;  1L2C A;  3MMP A;  4KOD A;  1OGB A;  4IJF A;  4EIW A;  2K6B A;  1J09 A;  2DKL A;  3KSJ A;  3KW6 A;  3QWL A;  4FCW A;  4FWH A;  4JXJ A;  5KPZ A;  3GLI B;  1MN3 A;  4BBA A;  4GKJ M;  7CAT A;  2KZU A;  4X62 M;  1TDZ A;  2L4E A;  3K92 A;  1Q3B A;  2ZAM A;  4WP2 A;  2CUZ A;  3I04 M;  4NRV A;  1IY1 A;  1R7R A;  2EO2 A;  3HU1 A;  4OVZ B;  3OTO M;  2UUA M;  4FVM A;  1OIP A;  2ZAN A;  4JI4 M;  1NJF A;  5KO3 A;  1E8B A;  2XFT A;  4CIZ A;  1YUB A;  4G6Z A;  4YY3 M;  1TDH A;  1XWI A;  2X49 A;  2Y0T A;  3V76 A;  2RKO A;  1L8Q A;  2LNH C;  5DFL A;  1R4G A;  1V92 A;  4LRS A;  4Q7J A;  3RE8 A;  2MH8 A;  4HL4 A;  3VKH A;  2XD5 A;  1D0M A;  1E88 A;  2LVA A;  2LHC A;  1PJJ A;  4LF9 M;  1GOI A;  4QNR A;  4OJO A;  2LVN C;  2UUC M;  1H0G A;  5DYG A;  2RRU A;  4II7 A;  2VF8 A;  3A45 A;  2QBY B;  1NHG C;  1O6I A;  4WW0 A;  1NVM A;  4QHS A;  3HON A;  2JNH A;  1GXD A;  2DZL A;  2YR0 A;  3GLI E;  4JI8 M;  4LF8 M;  4CHT B;  4OJ6 A;  2QP9 X;  1WIV A;  3AFH A;  3I4V A;  3E21 A;  4NSO B;  3DFZ A;  4CJ6 A;  2Y2H A;  3BOS A;  5LMU M;  3LMM A;  1DGG A;  1R2Z A;  1E6N A;  2F5P A;  4JYA M;  1A5T A;  1C1K A;  2A5Y B;  1NJG A;  3U6D A;  4S12 A;  5EP1 A;  4QNL A;  4B7G A;  1V34 A;  3U6S A;  1NY5 A;  1JB0 F;  3FTF A;  5F3W A;  4MH0 E;  1KFV A;  1IXS A;  3I01 M;  4UN2 B;  2K9D A;  2C96 A;  1QAM A;  1FJG M;  3U60 A;  4FWG A;  1DGH B;  3TQS A;  4L6V 6;  4Z6Y A;  3J7A S;  4GKK M;  4GH9 A;  2XH9 A;  4YHH M;  1VEK A;  3MK6 A;  2GQF A;  4JV5 M;  2UXD M;  1NY6 A;  3LQR A;  4HME A;  2CHG A;  1XB2 B;  2JA2 A;  3IG5 A;  3PVS A;  4MB4 A;  1WGN A;  3WD0 A;  4XBO A;  3FUV A;  5FSW A;  1L2B A;  3UZU A;  2VII A;  1H6U A;  3DA1 A;  3U6C A;  2YQZ A;  3AOG A;  1OGG A;  1T43 A;  3B7N A;  5FLX S;  4ZPX A;  2KEB A; 
#chains in the Genus database with same CATH homology
 2G8L A;  4AG6 A;  2D7H A;  3U6O A;  3SMS A;  3WX7 A;  4DV3 M;  4LF7 M;  3R9X B;  2M60 A;  3EIH A;  4LJ9 A;  1J7K A;  3GLI A;  4MGZ E;  4DR5 M;  1XNQ M;  5ITY A;  4QOS A;  4RF0 A;  4P16 A;  1E9R A;  5IRE B;  4JI0 M;  1HQY E;  4OVZ A;  3GLH A;  3VFD A;  4LCB A;  4L78 A;  4FWD A;  3L29 A;  3UK6 A;  3ILK A;  4GHL A;  1YU4 A;  2Y20 A;  2KRK A;  4IBG A;  2OPF A;  3E9S A;  3J2P B;  4M9Z A;  4PCZ A;  2X4A A;  4MM3 B;  3KP0 E;  1GKI A;  2FFF B;  1TH3 A;  2D7G A;  5EP4 A;  4IBE A;  3J80 S;  4M0W A;  5EP3 A;  2W82 A;  4AZF A;  4L8R C;  2G5G X;  3GQ4 A;  3UGJ A;  3U6L A;  2QBY A;  3VK8 A;  1HT2 E;  3PNV A;  4CGY B;  2L09 A;  1IN5 A;  2DWM A;  1S3S A;  3VDU A;  4LJ6 A;  1LV7 A;  4NYY A;  3WHK A;  3U6E A;  1K82 A;  2KA6 B;  1DO2 A;  2HCB A;  3VK7 A;  4L4U A;  2QPA A;  2XF3 A;  1L2D A;  4LRT A;  1N32 M;  1IY0 A;  2I7N A;  4IJE A;  3A46 A;  1DO0 A;  3SHG B;  3T15 A;  2X8A A;  3FYD A;  3UMM A;  1FNN A;  1L1Z A;  4FCV A;  5JI2 E;  2Z7J A;  3D8L A;  1QQW A;  3FD9 A;  1N34 M;  4AW4 A;  4OX9 M;  1QYR A;  3L2A A;  3RGP A;  3GO8 A;  5FTM A;  4OU7 A;  2XSZ A;  2J7N A;  4LZZ A;  3HKP A;  2Y2J A;  3CTW B;  3RGS A;  3LQQ A;  3AV0 A;  4D82 A;  4B3M M;  2CE7 A;  1K3X A;  4LJ7 A;  4DR7 M;  3M0E A;  2F5Q A;  3FYC A;  3ZCB B;  4AQY M;  4M9X A;  3GLH B;  3K2L A;  2XLJ A;  1NNJ A;  3HHW A;  3RFW A;  4DUY M;  1E32 A;  1Z5A A;  3VLF B;  3PFI A;  1R2Y A;  3N3F A;  2LH0 A;  3W0L B;  3K1J A;  2IOU A;  4GC5 A;  2KRU A;  2ERC A;  1IBK M;  1Q39 A;  2L6O A;  2HKJ A;  2C99 A;  4LGM A;  3AOE A;  1XMQ M;  4OJP A;  2M5Z A;  4G4N A;  3SHF A;  4G4R A;  3AKZ A;  5BPV A;  2FFJ A;  5KPR A;  1NSF A;  5IZ7 D;  4LG2 A;  1OFI A;  1ORY B;  3GQ5 A;  1XNR M;  1QAQ A;  3U61 B;  2DWZ B;  3DOA A;  1ZQ9 A;  2Z4R A;  2F5O A;  3J7B A;  1N33 M;  2C9O A;  4GIT A;  4L16 A;  4MGK E;  4R7G A;  4KLN A;  3KSX A;  2F5S A;  3KOZ E;  3M6A A;  4M0D A;  3U6Q A;  2KW0 A;  8CAT A;  3ZH9 B;  5DNY A;  2XZF A;  4AKH A;  5GKN A;  1G59 A;  1UM8 A;  1QVR A;  1I4W A;  4NZ4 A;  1MX0 A;  2KXE A;  2KZS A;  4LJA A;  3HWS A;  1Z5C A;  3KS4 A;  2C9C A;  4NOO B;  4Z8X A;  2DZO B;  4B3S M;  1N36 M;  3KFU G;  1KYI A;  4LF4 M;  3TWM A;  1TH4 A;  3HJQ A;  2I7P A;  1E94 E;  2Q2E B;  3KP1 E;  3GQ3 A;  2Y2K A;  3FUW A;  1QZM A;  4OW0 A;  3GRV A;  1HT1 E;  1YU1 A;  1SXJ A;  3WHL A;  3PXG A;  3L28 A;  3I4Y A;  1J5E M;  5ITU A;  3TWL A;  3AOE C;  3HJS A;  1I94 M;  4AI6 A;  3TE6 A;  4DV2 M;  4D81 A;  5ITT A;  4PD2 A;  1G4A E;  3J27 B;  3KOW E;  3SC3 A;  4LF5 M;  2CFO A;  4JI5 M;  1WXQ A;  3JR4 A;  1QAO A;  4LGY A;  1Q3C A;  1JR3 A;  5A2Q S;  3CF0 A;  4MGY E;  2H1R A;  1IN6 A;  1ZAE A;  1HNX M;  4FCT A;  3SYK A;  4TUW A;  4B3R M;  1E9S A;  3NBI A;  4FW9 A;  3TL4 X;  5E26 A;  2L7H A;  3GLF B;  2XZU A;  4I4L A;  3SMP A;  1IXR C;  3GPU A;  4PDI A;  3FTE A;  2XD1 A;  3U61 A;  3VDP A;  1T3T A;  3HHY A;  4LZJ A;  4K0K M;  4PT5 A;  2UXB M;  4IIW A;  2JE5 A;  3FUT A;  4DR3 M;  1N77 A;  5ITX E;  1D2N A;  2NQ8 C;  2Y2M A;  4OJ5 A;  2BJV A;  4B3T M;  4ITQ A;  5EXP A;  3SYL A;  2QEN A;  1IQP A;  1HNZ M;  4AG5 A;  3T1Y M;  2AHM A;  5DYI A;  4GIP A;  2YNM D;  2R45 A;  3CF2 A;  1SXJ B;  2LWX A;  3IG8 A;  3QAU A;  4DUZ M;  4LY6 A;  1W5T A;  2YFQ A;  3L27 A;  2D7E A;  4LJ5 A;  4NYU A;  3U6M A;  4JN6 A;  1JQJ C;  2DZN B;  2O5R A;  4NZ1 A;  2DVW B;  5C1B A;  5IWA M;  3EIE A;  3DZD A;  4B7F A;  1TH2 A;  4IBF A;  4GHA A;  1DGB A;  2CHV A;  2P5T A;  3FTD A;  3T38 A;  4PDG A;  3UJN A;  2ZBK B;  5FTN A;  4DR2 M;  4LFA M;  2Y2G A;  1YSY A;  1YU0 A;  5EXT A;  4B08 A;  4QHT A;  2QCU A;  4D80 A;  3R8F A;  4GRI A;  2FNA A;  3JR5 A;  4NXN M;  1IM2 A;  4KHP M;  1R6B X;  2JCH A;  3L25 A;  2RGH A;  4DR4 M;  4NXM M;  3B9P A;  3JAM S;  5C18 A;  1SXJ E;  5JI3 E;  1IXZ A;  4JI2 M;  2E5L M;  1G3I A;  4IBB A;  3FUX A;  4BLC A;  4A3V B;  1N75 A;  5ITX A;  2RGO A;  3SFZ A;  2R4J A;  4GMQ A;  2CV1 A;  1OFH A;  5KQ8 A;  4M9S A;  3FUU A;  2C98 A;  3AJI B;  5H37 D;  4CIS A;  4DV7 M;  4LF6 M;  4QOZ C;  3U5Z B;  1HQC A;  4DR1 M;  2Y2P A;  2CV2 A;  4X65 M;  2ZAO A;  5EXS A;  1IN7 A;  1GVN A;  3GRR A;  3GLG A;  2EA0 A;  3KS8 A;  1L1T A;  1XXH B;  5FTJ A;  2EUC A;  3SAW A;  4KO8 A;  3L26 A;  3HSH A;  4DV5 M;  3I51 A;  3E4R A;  3GLF A;  4NY2 A;  3C58 A;  4OUI A;  5EP2 A;  5LMN M;  5ITR A;  1KSF X;  3HJ8 A;  4WUR A;  4JI3 M;  1G8P A;  4IBD A;  1GLN A;  4DV1 M;  3SAV A;  2HL7 A;  4NZ3 A;  3K8Z A;  1IY2 A;  4AKG A;  4I5S A;  1IN8 A;  3H4M A;  2V6Z M;  4NL4 H;  1YE9 A;  5FTK A;  1XHB A;  3U6P A;  2BG1 A;  1Z6T A;  3TPZ A;  4R3D A;  3MJ5 A;  2UWX A;  3J81 S;  2F5N A;  1YU3 A;  3HU3 A;  1XC8 A;  5EXX A;  2DHR A;  2XSZ D;  1MU5 A;  3M7G A;  2R4E A;  2BNK A;  2BJW A;  4L15 A;  4DV6 M;  2CEA A;  2FE8 A;  2DWN A;  1HR0 M;  1IN4 A;  1OJL A;  3SAU A;  1YUE A;  2R46 A;  4QNM A;  3KOY E;  3MHV C;  3LVW A;  2R62 A;  2Y21 A;  4MB7 A;  5EQT A;  4REZ A;  2R18 A;  4X64 M;  5BR8 M;  2Y2O A;  4NZ5 A;  4G4Q A;  3T1H M;  4JI6 M;  3SAT A;  1TGU A;  4BB9 A;  3NWL A;  4AKI A;  2CV0 A;  4DR6 M;  4HLQ A;  2XGN A;  1IBL M;  5KQD A;  1X37 A;  2Y2Q A;  3Q8X A;  4LJ8 A;  2V1C A;  3HHX A;  3D8B A;  4RNA A;  2J7O A;  1W5S A;  4IBJ A;  3GLG B;  2Z3X A;  2UU9 M;  4LFC M;  4LFB M;  5E6J A;  1G41 A;  3FKE A;  1Z5B A;  2C5R A;  4I8O A;  1NNU C;  2LXE A;  4OJL A;  4JI7 M;  1PM5 A;  4JI1 M;  1GL7 A;  1NHW C;  2DWL A;  3VKG A;  4NRW A;  3KVW A;  3W0F A;  1K3W A;  2FOI C;  3U5Z A;  3SAS A;  4NSR A;  1GL6 A;  3GRY A;  3GPP A;  4DV0 M;  1Z59 A;  2Y2L A;  1SXJ C;  3PNY A;  2OQ4 A;  4RF1 A;  2CHQ A;  1XXH A;  2V1U A;  3AL0 C;  2Z4S A;  3KXE C;  2QZ4 A;  2XEP A;  2Y0Q A;  2K47 A;  2DXI A;  4G4O A;  3SAR A;  2R65 A;  1IXS B;  4MGI E;  1PJI A;  4B7H A;  2Y2N A;  3A98 B;  2VQF M;  4XGI A;  1YU2 A;  2Y2I A;  3SBJ A;  2F4V M;  3U60 B;  2XFS A;  2UUB M;  4FD2 A;  4DV4 M;  3KDS E;  1VDD A;  3GP1 A;  4W5W A;  5KPT A;  1DGF A;  4GC9 A;  5F3W A;  5EJC A;  3KOX E;  1SXJ D;  1QAN A;  1N78 A;  4IBI A;  4X66 M;  1EE8 A;  5FTL A;  2VQE M;  3HU2 A;  3GRU A;  3LVV A;  5ITQ A;  2ZM6 M;  1XMO M;  4IBK A;  3HGI A;  2HHH M;  1IBM M;  3FTC A;  3ZC7 B;  2L7I A;  3TWK A;  3GPY A;  2UXC M;  3A42 A;  3THG A;  4LJ4 A;  4MGH A;  3GPX A;  1DGH A;  3CF6 E;  4IBC A;  1JR3 D;  4I81 A;  1HNW M;  3HHZ A;  5IT9 S;  1L2C A;  4KOD A;  4IJF A;  4EIW A;  3KSJ A;  1J09 A;  3KW6 A;  3QWL A;  4FCW A;  4FWH A;  4JXJ A;  3GLI B;  5KPZ A;  4GKJ M;  4BBA A;  7CAT A;  2KZU A;  4X62 M;  1TDZ A;  3K92 A;  1Q3B A;  2ZAM A;  2CUZ A;  3OTO M;  4NRV A;  1IY1 A;  1R7R A;  2EO2 A;  3HU1 A;  4OVZ B;  2UUA M;  4FVM A;  2ZAN A;  4JI4 M;  1NJF A;  5KO3 A;  2XFT A;  4YY3 M;  1YUB A;  4G6Z A;  1TDH A;  1XWI A;  2X49 A;  2Y0T A;  2RKO A;  1L8Q A;  2LNH C;  4LRS A;  3RE8 A;  4HL4 A;  3VKH A;  2XD5 A;  1PJJ A;  4LF9 M;  4QNR A;  4OJO A;  2UUC M;  5DYG A;  4II7 A;  3A45 A;  2QBY B;  1NHG C;  4WW0 A;  1NVM A;  4QHS A;  3HON A;  4LF8 M;  2YR0 A;  4JI8 M;  4CHT B;  4OJ6 A;  2QP9 X;  3AFH A;  3I4V A;  4NSO B;  3DFZ A;  2Y2H A;  3BOS A;  5LMU M;  3LMM A;  1DGG A;  1R2Z A;  2F5P A;  4JYA M;  1C1K A;  2A5Y B;  1NJG A;  3U6D A;  4S12 A;  5EP1 A;  4QNL A;  4B7G A;  3U6S A;  1NY5 A;  3FTF A;  4MH0 E;  1KFV A;  2C96 A;  1QAM A;  1FJG M;  3U60 A;  4FWG A;  1DGH B;  3TQS A;  4Z6Y A;  3J7A S;  4GKK M;  4GH9 A;  2XH9 A;  4YHH M;  3MK6 A;  4JV5 M;  2UXD M;  1NY6 A;  3LQR A;  2CHG A;  2JA2 A;  3IG5 A;  3PVS A;  4XBO A;  3FUV A;  5FSW A;  1L2B A;  3UZU A;  2VII A;  1H6U A;  3DA1 A;  3U6C A;  2YQZ A;  3AOG A;  5FLX S;  4ZPX A;  2KEB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...