2XD1A

Active site restructuring regulates ligand recognition in class a penicillin-binding proteins
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
489
structure length
469
Chain Sequence
SISEITYSDGTVIASIDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTNQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Active Site Restructuring Regulates Ligand Recognition in Class a Penicillin-Binding Proteins.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
molecule keywords PENICILLIN-BINDING PROTEIN 1B
total genus 145
structure length 469
sequence length 489
chains with identical sequence B
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2xd1A01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2xd1A03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2xd1A02
1K38A 1MXOA 1LL5A 2Z2LB 3IF5A 4FH4A 5EOEA 1XA7A 1O07A 2WKHA 5GL9A 4WEKA 4U3TA 4KG6A 2ZC3B 3IWOA 2V20A 1WYCA 3DWKA 3OPHA 4IVKA 3Q7ZA 3TOIA 3GR2A 2XK1A 2WGWB 1L0EA 3ZDJA 1KE0A 2Y2GA 3WS0A 1NXYA 4N92A 4S2OA 2A49A 2WADA 2OLUA 4XUXA 5AQAA 5CHUA 4LCLA 4N9KA 3EQUA 1W8YA 1XXMA 4P85A 5HAQA 3OPRA 1IELA 3NDEA 5F1GA 3BFFA 3FWLA 4E6XA 4GKUA 1FOFA 3WS2A 5DVAA 1XX2A 3ZNYA 1IEMA 2WGIA 3M6BA 3SS5A 3MZDA 1M6KA 1Q2QA 5CRFA 5L2FA 4UA7A 5M19A 1RGYA 5GHYA 1PW8A 3ZGAB 4Y0UA 2G2UA 4S2LA 5FQMA 1HZOA 4R3BA 1ONGA 2VGJA 4WEJA 4Y0OA 2WUQA 3UNWA 5EPHA 3VFFA 3FV7A 1VQQA 1HTZA 4JKTA 1Q2PA 5CGSA 2VGKA 1L2SA 4UAAA 5HX9A 1EROA 3IT9A 2ZQDA 1O7EA 2WYXA 5TFQA 3MZEA 4DF6A 2RCXA 3C4OA 4MEZA 1K55A 1KGFA 3LY3A 3SS3A 1IYQA 3BECA 1K57C 3BEBA 3BLSA 3NY4A 4OQ0A 4WZ4A 1FCNA 2ZQ9A 4IBXA 1PWGA 4RX2A 2QMIA 3BFGA 3PTEA 3QNCA 4KG2A 1JWVA 1C3BA 3V50A 4OPYA 3NC8A 5U47A 3IF6A 4OOMA 3N8LA 2EFXA 1YQSA 2XD5A 4S2KA 4GDBA 2IWCA 3V5MA 4U0TA 2H10A 2H0TA 3OCLA 4ZBEA 3UDIA 3SOIA 4HEFA 1KVLA 3G2ZA 3VFHA 3VSKA 1K4EA 3JYIA 1BT5A 5CGXA 1FSWA 3HVFA 1K55C 2EXAA 5TR7A 4GD6A 5F1FA 4QY5A 1PIOA 1YMSA 4QD4A 5CHMA 1FR1A 4OLGA 3SS4A 4B88A 4DE0A 4KZ5A 4DE2A 1NZUA 5BOHA 3MXSA 5IHVA 3BM6A 3SH9A 1BSGA 2B5RA 4BQMA 4R4RA 2OSUA 3VP4A 3ZVTA 3IF6C 3N7WA 3HUOA 1WYBA 4JXSA 1K4FA 2HDSA 2V2FF 4JXGA 5E2EA 5M1AA 4QJGA 4S2JA 4X6TA 4X53A 2Y2PA 2CC1A 2HDRA 2ZM0A 2HP9A 1YLZA 3MXRA 4E3IA 1E3UA 2WZXA 3ZG7B 2WGVA 4CJNA 1BULA 4KZ3A 2V1ZA 4X68A 1VM1A 1PZPA 1PZOA 2ZQCA 2HP6A 3N4IA 5DF9A 3Q7VA 5FI2A 1ONHA 2HDUA 1FR6A 2ZC6B 4LV2A 3IHBA 4BENA 5TGFA 2WKEA 3QNBA 3VOYA 3C4PA 4EQIA 1BTLA 2R9XA 5G18A 4KQRA 5A91A 3IXDA 4YFMA 4P6BA 3Q7VB 2E8IA 3HLFA 3G35A 4RA7A 4EUZA 3DTMA 5DF7A 3A3EA 3Q1FA 4XUZA 5FAOA 5KSHA 3PBQA 4PPRA 1QMFA 3A3JA 1KGEA 4FCFA 3LCEA 1TEMA 4FSFA 1YT4A 2WAFA 5E43A 1G6AA 5FQKA 2HP5A 1KGGA 5CTNA 4F94A 4P87A 1FCOA 2DCFA 3GVBA 1EWZA 3NI9A 4HBUA 3EQVA 3AGFA 1WE4A 5E2HA 2PU2A 1NZOA 4IEDA 2OLVA 4O7DA 1IYPA 2ZLYA 1YMXA 3E2LA 3VP1A 4E6WA 4BLMA 1ES5A 5DTKA 3N8SA 3G32A 3OC2A 2C6WB 4GDNA 3MKEA 3O88A 4ZJ2A 1MPLA 1W79A 5CEBA 1G68A 2Y2KA 1GHMA 5DF8A 2J9PA 2XH9A 2DRWA 4NETA 5J8XA 1K6SA 4E3JA 1ZG6A 1U60A 1TDGA 1SHVA 4EBPA 2QZ6A 4DXBA 1GA0A 4QB8A 5CERA 3MFDA 3ZG8B 1PWCA 3MKFA 2J8YA 4JF4A 4PM7A 4K91A 5F83A 1SKFA 2XEPA 5GLDA 3S4XA 1K25A 1PYYA 2Y2NA 3B3XA 3IXGA 4JF5A 2ZM2A 3RXWA 1NYMA 2RL3A 3UN7A 1I5QA 4KZBA 4EBNA 1KE4A 2EFUA 1PI4A 5FQ9A 3RXXA 2R9WA 3O87A 5CEDA 3HLCA 4MBKA 1EI5A 3W8KA 2WKIA 2XF3A 1ZC2A 2BLSA 5A93A 2Y2LA 2X71A 4B4ZA 1W8QA 3PAEA 4WM9A 3OPLA 4OPRA 4X56A 2UWXA 3MBZA 5M18A 1BLHA 3ZG9B 5HW3A 3IH9A 2I72A 1Y54A 4GB7A 1KVMA 4HBTA 3W4OA 4OP5A 5A90A 1ZG4A 2Y2OA 2JC7A 4N1HA 2Y55A 1YLPA 1DJAA 2EX9A 3PAGA 5EE8A 1I2WA 2Y2JA 5GLCA 3BRMA 1ERQA 1JVJA 1N9BA 2ZM8A 4OOLA 3G4PA 1GHPA 4R23A 3WRTA 4YINA 3WS1A 4KQQA 1CI8A 3WRZA 4FH2A 1IKGA 4S2IA 2H0YA 4R3JA 3OCNA 2ZQAA 3V39A 1M40A 1NYYA 4EWFA 3CJMA 1XPBA 5FQJA 2H5SA 3P09A 2ZQ8A 4DRTA 1KDSA 2HDQA 1CK3A 3CZDA 5E2GA 4WZ5A 2OV5A 4GD8A 4WZ5C 5A92A 4GZBA 1NJ4A 3HLBA 2FFYA 1SCWA 4JXVA 3GRJA 5FA7A 4BD1A 4H8RA 4PM6A 3D4FA 4C6YA 2EXBA 3HUNA 4KZ4A 3RJUA 3V3SA 3FYZA 4OH0A 5FATA 2P9VB 1XA1A 1E25A 3SH8A 2PU4A 4DDSA 1FCMA 2Y2MA 1XP4A 5DTSA 1DJBA 1S0WA 1YLYA 2XR0A 1RP5A 3AGEA 3BFEA 4MLLA 4PM8A 4C75A 5AQ7A 3ZHHA 2XFSA 4WBGA 3HLEA 3HLWA 4GOGA 5E2FA 4UHUA 3WS4A 3V3RA 2GDNA 4KQOA 1W7FA 3NIAA 3OZHA 4Z9QA 3W4PA 4PM5A 1NY0A 2ZD8A 4OVDA 4BJPA 1DY6A 3HLDA 3IXBA 2ZMAA 3E2KA 4B4XA 4OLDA 4ZAMA 5GHZA 1K56D 4OONA 2ZQ7A 5EOOA 3P98A 1ESIA 5HFOA 1IYSA 1RCJA 1PI5A 2WZZA 1MY8A 4X55A 1FSYA 1LL9A 2ZC7A 1JWZA 3PBSA 4KENB 4OQIA 3AGDA 3M2KA 2X02A 4WMCD 2XDMA 5EVIC 1H8YA 2JE5A 2P9VA 3TG9A 5CXWA 3IWIA 3G31A 3IWQA 3IQAA 3C7UA 4KZ9A 4WYYA 2Y91A 3A3IA 1ES4A 3FKVA 5I94A 4JBFA 2ZC4B 4L0LA 4PM9A 5D3OA 3PBOA 4OKPA 4P0MA 5FQQA 2IWDA 5AQ9A 5CTMA 1K6RA 1LHYA 2ZC5B 4N1XA 4RX3A 1BLSA 5CECA 1K57A 3UE1A 3HREA 4JXWA 3S1YA 4KZ8A 3VP3A 1LLBA 4KZAA 2G2WA 3BYDA 3UO9A 3Q81A 5FDHA 2Z2MB 4DE1A 4KG5A 4LCMA 4MBFA 5HARA 4LENA 4MBHA 2Q9NA 4Q8IA 1YLWA 2EX2A 2FFFB 5JYPA 4X69A 4E3NA 2WK0A 3VSLA 3IF6B 1PW1A 3GTCA 1HVBA 3N6IA 5EUAA 3C7VA 1MBLA 2PBYA 3G34A 3MZFA 4N9LA 1CEGA 4UA6A 2EX6A 1OMEA 3G2YA 1XGIA 5GHXA 1ES3A 3GSGA 5FI7A 1HD8A 4M3KA 2JBFA 1ES2A 1MWTA 1JTDA 4Y0TA 5HAIA 4E3KA 4E3LA 4S2NC 2Q9MA 5JYOA 3LO7A 3QHYA 1ESUA 2J9OA 4R0QA 4ZDXA 4PMAA 4JLFA 4NK3A 4QU3A 1GA9A 1YLJA 1KE3A 3VMAA 2Y2IA 3IXHA 3UE3A 5KZHA 1E4DA 3HLGA 4OPZA 1FQGA 1MWUA 3ZVWA 4KZ7A 3ITAA 3M6HA 4QHCA 3HL9A 2Y2QA 1BLPA 2C5WB 4GNUA 3S22A 3LY4A 1BZAA 3IHAA 4BL2A 1MWSA 3ITBA 1N4OA 4LV3A 3UPNA 4DE3A 3GMWA 2HPBA 3UDXA 4EBLA 5GLAA 1SDEA 1GHIA 2P74A 1AXBA 1ALQA 3DWZA 3O3VA 3UPPA 5DTTA 3OPPA 1H8ZA 1TVFA 4JF6A 5FI6A 3ZNTA 3NBLA 2A3UA 3DW0A 1NRFA 3HUMA 5GLBA 4R1GA 4DDYA 4ID4A 5FSRA 3O86A 5EVLA 1YM1A 1DJCA 5EECA 2J7VA 3PBNA 4S2NA 3UY6A 1PWDA 1ERMA 1BUEA 4RYEA 3BLMA 4A5RA 3CMZA 1QMEA 3VOZA 5KMWA 2Y59A 4WMCA 3ZFZA 1J9MA 3UDFA 1I2SA 3SH7A 4LV0A 5FQIA 3UE0A 2DNSA 3CG5A 4D2OA 4CPKA 3G30A 4OP8A 5KSCA 1KDWA 4RVAA 4ZJ1A 5FASA 4ZJ3A 4LV1A 1K56A 3C5AA 1XGJA 3WS5A 1JWPA 1CEFA 4FD8A 3ISGA 5FAQA 3Q82A 1W5DA 1JTGA 1Z6FA 3PBRA 3VP0A 1L0DA 1MWRA 2Y2HA 3BFCA 3W4QA 3IH8A 2X01A 1L0FA 1RGZA 1YLTA 1H5XA 4OPQA 3UPOA 4WELA 3A3DA 4E3MA 3NDGA 1LI9A 3BFDA 4OQGA 4QY6A 4IVIA 2WAEA 4BD0A 4HESA 2XGNA 2XD1A 1E3UD 1SDNA 2EX8A 3GQZA 2XLNA 4KZ6A 5EVIA 4U0XA 4ZTKA 4GN2A 4K0WA 3ZG0A 3N8RA 5EVID 3PBTA 4S2MA 1K54C 2WGWA 3NCKA 1CI9A 4JPMA 4UA9A 4OOYA 4C3QA 5FAPA 1BLCA 3HBRA 5EVIB 4Y7PA 3WWXA 3Q07A 4R4SA 1L0GA 5CHJA 4BL3A 2BG1A 3I7JA 3FKWA 1LI0A 3A3FA 5HL1A 1IYOA 1XKZA 3ZCZA 4OQHA 4EV4A 1MKIA 5AQBA 5CGWA 3VP2A 4E3OA 4MNRA 4IBRA 2ZJ9A 3TSGA 4DXCA 1ZKJA 5HAPA 1IKIA 1TDLA 2XFTA 3M2JA 2JCHA 3FZCA 3LEZA 4S2PA 4XXRA 2IWBA 5F82A 1GCEA 3ZG5A 2Y4AA 2XQZA 3GV9A 2QPNA 1S6RA 1K54A 4K0XA 4DKIA
chains in the Genus database with same CATH superfamily
5B2JA 1LL5A 4MN5A 3AYWC 4NYYA 5J4EA 2ZC3B 1QO6A 1WYCA 4WV4B 5BS7C 2ACGA 3ZDJA 3CAXA 4JJNB 4KGCA 3N3FA 1NLZA 3LI9A 3VV4A 3WS0A 4N92A 5BT1D 3LZ0C 3X1UC 2WADA 1KX4C 1ID3C 5HDCA 1L3LA 3KSGA 3MMHA 1W8YA 5HAQA 2INWA 3BFFA 3FWLA 3REHA 5B32D 4GKUA 4E6XA 3REHC 1FOFA 1TS8A 3WS2A 4GHLA 5I5LA 5DVAA 4EERA 2WKRA 4FUWA 1IEMA 3LR3A 3SS5A 3SW1A 1M6KA 3IS2B 3AV2B 3F1PA 3B42A 3AFAB 3X1TA 4S2LA 4R3BA 4Y0OA 2WUQA 3UNWA 1N1JA 4H9RA 1Q2PA 3A6NC 3W97B 2VGKA 5CGSA 4IJFA 2MJ6A 2ZQDA 2WYXA 5DKKA 4MN7A 3AZHA 3KO6A 3RELB 4DF6A 5KIZA 1KGFA 3AZJB 1W2EA 1IYQA 1K57C 3BEBA 3BLSA 3NY4A 1P0ZA 3MQQA 4RX2A 2J3TC 4UQIS 1C3BA 2QJ7A 1P3AA 4OPYA 5U47A 2EFXA 3NQJB 2XD5A 4S2KA 3B0DB 4HJ6A 3UDIA 2QYBA 3SOIA 4YNRA 1S1YA 1S66L 1KVLA 5FUGA 3VFHA 3O62D 2BYMB 3REKB 1T1CA 5CGXA 4Y15A 3IBJA 3AZFB 3AN2D 2J80A 1NZUA 5BOHA 3SH9A 3LJAB 5B24A 2OSUA 3ZVTA 3NQUA 1XFQA 2ZY2A 5AJGA 3HUOA 3B6FB 1WYBA 2VV7A 4EEUA 1K4FA 3FDDA 2V2FF 4QJGA 1G5UA 4S2JA 4X6TA 1KX3A 3X1VD 2HDRA 2ZM0A 3MXRA 4E3IA 4IJEA 2WZXA 4KZ3A 2V1ZA 1AOID 4AWLC 1ONHA 5B1MA 2HDUA 3C1CA 2ZC6B 3B6GB 1S4SA 2VEAA 4HHDA 4UUZA 4HMDA 3C4PA 4EQIA 1BTLA 3TRCA 5G18A 4P6BA 2E8IA 1N1JB 3E98A 3T50A 2OWJA 3CUEC 5C3IB 3UTBA 4XUZA 4PPRA 3AFAA 3A3JA 1KGEA 1F9IA 3UTAA 3LCEA 2CV5B 3K3CA 1EAKA 4MB4A 4GJ4A 1E6RA 1AWIA 1KGGA 4P87A 2P7JA 1GXDA 2YFVA 2HIOA 3MGPA 3W97D 2AROC 3NI9A 1N9NA 2HJEA 3AGFA 4HJ3A 5CPKB 2XROA 1UWPX 3AL0C 1IYPA 4NY2A 3E2LA 4E6WA 1ES5A 3TW8A 1E15A 2K2NA 1ZLAB 3IP4C 1G6OA 1JFIB 3EWKA 3O88A 2QJ5A 5CEBA 5E5AD 3EPKA 2JKTI 5DF8A 2XH9A 3REID 1U60A 1TDGA 1A7WA 2O9CA 2YFWB 3MGPC 2QZ6A 3TE8A 3MFDA 1OTDA 3MKFA 4PM7A 4ETZA 1P3LA 2B18A 5F83A 2XEPA 2O9BA 3AN2B 2ZM2A 3RXWA 3F1NB 3C1CD 4J8VB 5HWWA 1KE4A 4DJ3A 3AZHC 1EI5A 4WU9B 3W8KA 3REIC 4IUHA 2XF3A 3QP4A 2YKHA 4X56A 3BY8A 3MVDC 5HD5A 5AY8B 3W99A 4MN6A 4GB7A 1P3LC 2JC7A 3X1SA 1YLPA 1M18B 1I2WA 2Y2JA 2A24B 1P3BC 4ME4A 1VETA 5L8MA 1ERQA 4MDZA 4CSRA 5GXQC 3B0BA 4IBIA 1STZA 1UGUA 2VGLS 2VA0A 4R23A 5CPJB 1KX4A 4HJ4A 4S2IA 4Z5TD 3VH5T 3E0YA 4R3JA 4XUJB 2ZQAA 3V39A 5B31A 1BYWA 1NYYA 3C2WA 1CF0A 4X23C 2HF6A 5B32C 4EWFA 5JRGD 5HZHA 3LZ0B 3P09A 5E5AB 4GD8A 3MVDD 2CMNA 1SCWA 4G91B 4H8RA 3D4FA 3FYZA 1NWZA 4OH0A 2BYKA 4NZ3A 3WA9A 5B0YC 1XP4A 5DTSA 5B40C 1YLYA 1W1VA 3L2AA 2XR0A 4OUIA 3AGEA 3S7QA 1P3OC 5AQ7A 5G4YA 3A6NB 3ZHHA 3MNNA 4ARZA 5JRGC 4GOGA 4UHUA 1D7EA 3AZLD 3FPWA 2XA7M 4Z9QA 4WU8D 4OVDA 1F98A 4BJPA 1YSPA 5CPKC 3HLDA 2W3HA 4J8WC 3W99C 1K56D 2JKRI 3DTEA 4E44A 4DRBA 5HFOA 1PI5A 2WZZA 1JFIA 1PRQA 1FSYA 4NZ4A 3TG9A 5CXWA 3VOLA 3IWQA 4R3AA 3LZ0A 1P3KD 4WYYA 1V9ZA 2HIOB 3FKVA 1D06A 3KSFA 5I94A 4JBFA 2ZC4B 4PM9A 4ETXA 5D3OA 3REJA 3B33A 3UTAB 5B31D 4WU8C 2IWDA 3CWFA 5AQ9A 4H6JA 1LHYA 5CECA 5B32G 3S1YA 4CSRB 3VP3A 4OJPA 5EV0A 3ICYA 2G2WA 3U4LP 4GHIB 2Z2MB 4YM6A 4MBHA 5BT1C 2FFFB 3LZ0D 1P3KA 3P7NA 2D02A 1ID3D 4E3NA 3X1UB 1EQZD 3VSLA 3IF6B 1HVBA 3WTPE 3C38A 3C7VA 1KX3B 2PBYA 3MZFA 4N9LA 2F8NA 1P3PD 4YOFA 1YU2A 1MWTA 5HAIA 5B24B 4IHQA 3LO7A 1ESUA 5HWVA 4UEYA 4LG2A 5B0ZB 3B47A 4JLFA 2P08A 1YLJA 1P3BD 1KE3A 3VMAA 2W3FA 1H3QA 4Q0JA 4XUJC 3IXHA 3UE3A 2KOIA 4M4XA 1Q9CA 4R8PC 2F8NB 3RTYA 4BL2A 1MWSA 3DTKA 3UDXA 1KS0A 4LD9C 4CLCD 1AIWA 1GHIA 1AXBA 1ZLAA 1ALQA 3DWZA 4NEED 5E5AA 1KX5B 3BJNA 5B33B 4HH2A 3NBLA 3DW0A 2V9AA 3LIDA 4ID4A 5FSRA 3O86A 5B31B 5EVLA 3KS4A 4XUJA 5EECA 2BTFP 1PWDA 1ERMA 5AV6A 3C1BA 3CMZA 3V67A 2Y59A 4WMCA 1I2SA 4H6JB 3W97A 4LV0A 3UMDA 5BO0A 3W97C 4NXFA 4RVAA 3REJB 1OTAA 4DJ2A 5GT3C 2A24A 1UR9A 3EPJA 2GJ3A 3AN2C 1M18A 4EETB 3W98A 5GT0D 2KDKA 5B2ID 3GECA 5FAQA 1P3FB 4H9NA 1NRJA 3Q82A 2NQBA 4UUZB 4R70A 5DNMD 2Y2HA 3AZLA 3CPTB 1S67L 4KUKA 2JHEA 3MR0A 3NECA 1M19A 1DP9A 1LI9A 5EM0A 3MGSC 5AV5A 4UPKA 5AY8C 1AOIC 2Y79A 4FOFA 4WL9A 4ZBJB 4K0WA 3PBTA 4S2MA 1K54C 2UV0E 2V8FA 3B6GC 1P3PB 2OOLA 4KUDD 3MNNB 3RELD 1CJFA 4ARZB 5B2IC 2FZ0A 4BMWA 2HUEB 2BG1A 5AV8D 1ZHHB 2W27A 3C1CC 2YFWA 4XZQB 4OQHA 5JRGA 4EV4A 3UT9A 2BYMA 4MNRA 4DXCA 3PHYA 1IKIA 1F66D 1TDLA 3DBAA 3FZCA 4S2PA 3LEZA 4XXRA 3AZKA 3KUYD 2AROB 5EFWA 2Y4AA 2XQZA 4H9NB 2QPNA 4K0XA 3OLOA 3S7PA 1S32A 2Z2LB 2L5AA 4LPZA 5KDMA 2W1RA 4WEKA 3T12B 3IWOA 3RH8B 3DWKA 1P34C 3TOIA 4WUJA 1P3GB 1KX5D 2WGWB 5B0YB 3LFVA 2V1AA 2BASA 2G7UA 4S2OA 2NQBC 4GS9B 3AZGC 4LCLA 4N9KA 3AZGA 4X23A 3MGPD 1XXMA 4P85A 3OPRA 4J8WD 4YS3C 2O9AA 2JKTM 2Y8HA 3WD3A 4DQYB 2WGIA 3M6BA 5CRFA 3T4JA 1P9WA 3VE4A 1YU3A 3MQOA 2ZBBA 2G2UA 1HZOA 3X1TC 1T1BA 4WEJA 4II7A 3VFFA 4X1LA 1KX5C 1HTZA 3VH5W 4L9EA 4UAAA 5HX9A 3AZGD 3MZEA 3TU4B 2RCXA 4FTXA 1K55A 3IX8A 3LY3A 3EG5B 5F99D 3SS3A 3LIAA 3AZID 3BQAA 4WZ4A 1FCNA 3A0SA 4LRYC 2QMIA 3KXBA 3PTEA 3QNCA 3H82A 1ACFA 3NC8A 3IF6A 5B2JB 1P3IA 3N8LA 2Z6CA 3H7WB 4LRXC 2IWCA 2H10A 3MFXA 4ZBEA 1V9YA 2GX5A 4F3LB 4GLQA 2KLIA 3AZFD 2IO5B 1OTBA 3O62A 4OJ6A 3REIB 3MGRC 2EXAA 2VJWA 5TR7A 4K08A 5DNMC 4QY5A 1H0MA 1YMSA 5CHMA 1FR1A 2ZMFA 3AZMA 3UE6A 5AV8A 3G6OA 5DFYA 2B5RA 3AZJA 4BQMA 4R4RA 4G91C 3N7WA 2HDSA 5E2EA 5M1AA 5B0ZC 3K2NA 2Y2PA 2HP9A 4IUKA 3B6GA 1O6IA 4G3WA 3C1CB 3MSHA 3ZG7B 2PYRA 1PZPA 1UWNX 4KHAA 1BFMA 3F1PB 4BENA 3LEQA 4R6LA 3E4QA 3P01A 5A91A 5B1MB 5E5AC 3IXDA 4YFMA 3AZNB 4ZUXD 3HLFA 3G35A 3AV2D 2DMWA 1R4VA 3DTMA 5FAOA 3Q1FA 3D9YA 5KSHA 3PBQA 1QMFA 3K3DA 4FSFA 2V1BA 1G6AA 1P3GC 3L26A 4J8WA 3PR6A 3GVBA 2DCFA 2VK3A 5MC7A 5BS7A 1WE4A 1P3ID 2PU2A 3UB5P 2PT7A 3VP1A 2L0WA 4O7DA 4CQHA 4XUJD 1YMXA 4EO5C 5CP6A 3N8SA 5JRGB 3HCYA 4GDNA 3MKEA 4JGQA 1MPLA 1GHMA 2DRWA 1K6SA 4QLCD 4CLCC 1TAFB 3KWQD 1ZG6A 2W0NA 4PKYA 4EBPA 4PKYG 3LELD 1GA0A 2V8CA 4QB8A 3NOTC 3ZG8B 3WKJB 3UT9D 4JF4A 5HDDA 4K91A 3T4QA 4ZBJC 1T19A 2Y2NA 4JF5A 2NZDC 1ZTUA 2PYPA 2Q0OA 2RL3A 3A6ND 4HP9A 5AVCB 1I5QA 4XT2A 4EBNA 2EFUA 1PI4A 3AZLB 4I38A 2R9WA 4M6BA 2F8NK 5FQ9A 3RXXA 3UB8A 4Z5TC 4WU8B 1H8PA 2W1TA 3UB7A 2WKIA 4X23D 5A93A 1W8QA 3X1VB 2J3TD 3OPLA 1P3AC 3SZTA 5M18A 1BLHA 1Y54A 5L10A 1KVMA 2F2AC 5AV6C 3C1BC 5A90A 2Y2OA 2QHKA 2Y55A 4YM6D 5K5BA 1N9BA 3AV1D 4OOLA 3O62C 3PYPA 4NE3A 5AVEA 1GOIA 4EXOA 4LD9B 1CI8A 1OT9A 5FDSA 4FH2A 2H0YA 3H0LC 4QLCA 1M40A 2I9VA 2JN7A 5B24C 2HV1A 3H82B 1KDSA 1CK3A 5E2GA 3KS8A 4Z1WA 2OV5A 1E88A 1P3AD 2HGVA 1YU1A 5CX7A 5CPKD 4JXVA 5FA7A 4PM6A 4Y5FA 4C6YA 2EXBA 1UR8A 5J7EA 4IBKA 4KZ4A 5GT3D 3AYWA 1ID3B 3BY9A 1E25A 5B1MC 1B6WA 1S32C 5DFXA 2PU4A 2OAP1 1DJBA 1W1TA 3EEHA 1RP5A 5B1LA 1P34D 5B31G 4HH3A 4PM8A 3VE3A 4OJLA 4ZUXA 3AV2C 1ODVA 3R7WB 3V3RA 2WKQA 4Z2KA 3OZHA 2NQBD 1BH9B 2PD7A 3A1IA 5AV9A 1CXWA 3A0RA 3LELA 3E2KA 4YS3A 4B4XA 4I3JA 4OONA 3TJZC 1ESIA 1IYSA 2DQNC 4XT2B 5AVCA 1YU0A 1MY8A 3KSHA 1LL9A 4KENB 3D72A 3RELC 1FILA 4UQIM 3AGDA 5TBMB 2X02A 4WMCD 3HONA 5JA4A 1P3MA 2P9VA 3IWIA 4CLCB 3MGQD 3C7UA 1HLUP 3DAVA 3IX4A 2Y91A 2IO5C 2W3DA 3B6FC 3MGRB 3B6FA 2CV5D 4H9SC 4Y13A 3PBOA 1XFNA 3B0DC 3LJAA 4GCZA 4GW9A 1K6RA 5LBRA 4RX3A 1K57A 4I3IA 4JXWA 3WAAC 1SKOA 1Z2CB 4L9GA 3CI6A 4XZQA 1OJ5A 3UO9A 4DRAA 4DE1A 4KG5A 1E6NA 4KQDA 3X1SD 5B2IB 1D1JA 2WK0A 4GHAA 1PW1A 3GTCA 3N6IA 3AZIA 1CEGA 3G2YA 4J8XB 4HI4A 3S7OA 1P3PA 3GSGA 5DNNC 3WAAA 2JBFA 4JGOA 4R0QA 5AVBD 4ZDXA 1YPRA 3LR0A 1GA9A 4YM6C 1YSQA 1S4RA 5IS1A 4BBTA 2D49A 1P34B 1J3WA 5KZHA 3JVUA 4HGAB 1FQGA 3NHQA 3HL9A 1P3MC 5C3IC 1BLPA 3LY4A 3IHAA 2NQBB 5GT0C 3IS2A 4EBLA 5GLAA 4E45A 5F68A 5B33D 3WD1A 2P74A 3L25A 1XJ3A 3LICA 4MB3A 3O3VA 3UPPA 1GPFA 5DNND 4JGPA 3L27A 3REKD 3ZNTA 3HUMA 4DDYA 4R1GA 5CPJC 3JPUA 3MVDA 1YM1A 3PBNA 4S2NA 4J8VC 3BLMA 3VH5A 1P97A 1L6JA 5BPVA 2ZOIA 1P3GD 5B0YD 3UE0A 4CPKA 4QPRA 5B40D 4NXEA 5FASA 1K56A 1WWSA 2NZDB 1XGJA 5DNMB 4KUDC 3LR4A 1JWPA 4R8PA 3LGOA 2W8SA 1WA9A 3AZLC 3U2AA 3VP0A 1MWRA 3AZEC 3JVVA 1L0FA 3MF0A 4OPQA 2VGLM 3F1NA 1E6ZA 3W99D 4E3MA 5B2JC 3O5YA 4QY6A 3AYWB 1P3OB 4IVIA 1XJ2A 1AOIA 4BD0A 4Q0HA 5HDSA 3MGSA 1E3UD 2EX8A 3GQZA 3ZG0A 2DF4C 2W3GA 1VEUB 1CI9A 1BLCA 5EVIB 4QWOA 4Y7PA 3WWXA 4Z2HA 3Q07A 5CHJA 5B24D 4BL3A 1PDCA 3A3FA 1XKZA 3IBRA 1P3BB 5CGWA 5GXQB 2ZJ9A 1U35D 3AZKD 1F66A 3F1OB 5F82A 1GCEA 3ZG5A 3GV9A 3RJUA 4P6ZS 1K54A 1P3IC 4DKIA 1MXOA 5B0YA 3IF5A 3X1SC 1P3GA 5EOEA 3WA9C 1XA7A 5GL9A 2WKHA 3F1OA 3IX3A 5HD3A 2XA7S 4EESA 3Q7ZA 3GR2A 5GXQA 1S32B 4KUDA 1NXYA 3KWQC 2V5OA 5DNNA 5AQAA 5CHUA 4MMNA 5F99A 5F99C 3NDEA 5AV5D 4HGAC 1LSWA 2PR5A 3UT9C 3AFAD 5B40B 1KX3C 1F1EA 1Q2QA 3VH6T 4UA7A 3NOPC 1LL8A 5GHYA 1PW8A 4NKPA 5CPIC 2VGJA 2JKFA 2LB5A 5EPHA 2P04A 4J8XA 3AZFC 1VQQA 4JKTA 5B1MD 1M18D 3IT9A 5B40A 3LJAC 3C4OA 4MEZA 1WWIA 4BWIA 4OQ0A 4HQAA 4EU0A 2OAQ1 2ZQ9A 1GSXA 4KG2A 5GXQD 1TS6A 3LZ1C 1YQSA 3CHWP 4GDBA 2VX8A 4U0TA 3ULFA 1W1YA 4HEFA 3G2ZA 3ZYTA 4QNLA 3JYIA 3MGRA 1N9LA 2KX6A 1K55C 3MGQC 3LJAD 5TJJA 4QD4A 1SZVA 4Z66D 4OLGA 3SS4A 4DE0A 4DE2A 3B6FD 1DP8A 5IHVA 4KHAB 4WJ3C 5G4ZA 1GSVA 4NFTA 3AZJC 2FJ7D 4JXGA 3WAAD 3A1KA 2CC1A 4B9OA 1W63Q 1YLZA 5AVCD 4CJNA 1BULA 1VM1A 2ZQCA 2HP6A 3Q7VA 5B33C 3R45B 2ZL1A 3AZND 3MGSB 3IHBA 5TGFA 3BQ8A 1T1AA 4Y17A 3LI8A 2RVQC 4G92B 4LLOB 5FL3A 1MKMA 3FG8A 4CAYA 1F66C 3A3EA 1OTEA 5FQKA 5E43A 2WAFA 5AVBC 2ZY5A 4IBDA 1EWZA 2O0YA 4HBUA 4Z2IA 5E2HA 3KXBB 3C8CA 1P3KC 4IEDA 2M7UA 4LRZE 1HQ3B 3W96C 4H9PB 3G32A 3OC2A 2C6WB 5B31C 1P3MD 4ZJ2A 1W79A 3KFUG 4LD9A 1G68A 5A8BA 4BBVA 4Z2LA 4HMEA 3WTPB 5J8XA 5B2JD 2PYOB 2HJ9C 1OTIA 4CLCA 3AZEB 4X25A 1KX4D 2A2LA 4Z66B 1SHVA 5CPIB 5G49B 2VV6A 3KYQA 5AV9D 3WD2A 2W1TB 3MS6A 4G3KA 3X1TD 5CP6C 4J8UC 1EQZC 4YS3B 2FN2A 5GLDA 3B3XA 1PYYA 3IXGA 5HWTA 1P3BA 3QP2A 2G5HC 1BH8B 1P34A 4X23B 5B32B 1J7MA 2R78A 3HLCA 4MBKA 4EQ1A 1ZC2A 2F8ND 3AZIC 1N9OA 3LZ1B 3PXPA 4B4ZA 3PAEA 4D60A 5F6AA 3A0VA 4CLCE 2UWXA 2FJ7A 3MBZA 3ZG9B 5HW3A 3IH9A 4IBBA 1M19C 4OP5A 1ZG4A 4N1HA 2HUEC 5EE8A 3EPHA 2V0UA 3BRMA 2AROA 3MGQB 3HJKA 3GDIA 5HPFA 2ZM8A 3G4PA 3WA9B 2YKFA 1TZYB 4Z5TA 3V9RB 1GHPA 3MGRD 3WRTA 4EW7A 4KQQA 3UB6A 4J8XC 3AZFA 3EEAA 1IKGA 3KWQA 3NQJA 3OCNA 3T1RA 3REJD 4DRTA 3CZDA 4GZBA 3HLBA 2FFYA 3GRJA 1U35C 1HQ3D 5CPJA 1KX4B 3MVDB 5CPID 3HUNA 1EW0A 3V3SA 3T1XA 5FATA 1P3MB 2P9VB 1XA1A 1LSXA 4DDSA 2Y2MA 1FCMA 1S0WA 2PYOD 4J8XD 5CHLB 4EEPA 3BFEA 5BNXB 4WU8A 4ZUXC 3AV2A 4GH9A 2XFSA 4WBGA 3LELB 1P3FA 3HLEA 3T4TA 5E2FA 1YAXA 4AFIA 2GDNA 4KQOA 2WKPA 1W7FA 3MNND 2ZM5A 3W4PA 4PM5A 4Z2MH 1NY0A 2LB9A 3AZEA 3IXBA 4WU9A 3LZ1D 4TX8A 4OLDA 4ZAMA 2L1MA 4O01A 5GHZA 5EOOA 3S7NA 3B6GD 4X55A 1YU4A 4NYUA 2AVXA 4OQIA 1HQ3A 2CWEA 2XDMA 5EVIC 2JE5A 3KUYB 3G31A 3H0MC 2PYOC 3IQAA 1KX5A 4HNBA 4KZ9A 1OPXA 3A3IA 2W3EA 3L9KA 4Z2GA 4JJNA 4IBEA 4QLCC 4L0LA 4OKPA 4P0MA 4WF0A 5FQQA 4F3LA 1Z09A 2HIOD 4EO5B 5CTMA 5CP6B 2ZC5B 3UE1A 3UTAD 1P3IB 3HREA 4KZ8A 1LT0A 4KZAA 4H9OA 3TU4A 4IJGA 1U35A 4J8UD 1XJ6A 1OGGA 5FDHA 2NZDD 4LCMA 3AZNC 3T1SA 4Q8IA 2EX2A 3NULA 5JYPA 4X69A 1YUEA 3MJQA 1MBLA 4UA6A 3OOVA 2ZY3A 3AZHD 2VLGA 3X1UA 3AFAC 4M3KA 1BH8A 1ES2A 1JTDA 1KX3D 4E3KA 4E3LA 4S2NC 2Q9MA 5JYOA 3UTAC 4PMAA 1M19D 3UMEA 4NK3A 4QU3A 3AZJD 3QP1A 4J8VD 2VV8A 3HLGA 1P3LD 4OPZA 4J8UA 3ZVWA 3W96A 3ITAA 3S22A 1Y4OA 4GS9A 2PYOA 1BZAA 3ITBA 1N4OA 3LR5A 4LV3A 3UPNA 4DE3A 3GMWA 1NLYA 4NZ5A 1SDEA 3T4OA 4H9SA 2HZ5A 3REIA 3OPPA 1TVFA 1DP6A 5FI6A 3KX0X 1E6PA 3LIBA 4Z2JA 5KDMB 4O0PA 4I5SA 1DJCA 2J7VA 3UY6A 5CP6D 1KOUA 3H7WA 4A5RA 1BUEA 5KMWA 2O99A 1QMEA 3VOZA 4WN5A 4Z5TB 3V9RA 2QKPA 2ZY4A 1S32D 3WD4A 5FQIA 2D01A 5HL6A 4D2OA 1H0IA 5L07A 5KSCA 3KUYA 4ZJ1A 4OJOA 3KYEA 4LV1A 4CAYB 3WS5A 1X0OA 4FD8A 1P3AB 3W96D 1HTAA 4NE6A 3L29A 3W4QA 1L0DA 5EVEA 2X01A 1RGZA 1H0GA 3UPOA 3UB9A 4WELA 4AWLB 3AZHB 4WNNA 3BFDA 2K31A 5AVCC 5AVBA 2WAEA 3HSHA 5F5YA 2XGNA 2XD1A 1SDNA 4KZ6A 4IBGA 2XLNA 1M1AA 4U0XA 1M19B 4GN2A 3N8RA 5EVID 3X1VA 3CPTA 4UA9A 1VB6A 4L9FA 4MCWA 4OOYA 1EQZA 4C3QA 5FAPA 5BO0B 3HBRA 1M1AB 5BNVA 2CV5C 3REJC 5AV6B 3W98B 5GSUC 3C1BB 4KGCC 5G49A 5GSUA 4Z66A 1G28A 1OT6A 1F66B 1P3FC 3AZMD 1TF1A 2J3WA 5AV8B 4IBCA 4IBRA 3TSGA 4XZQD 5AV5C 5HAPA 2EWVA 1CQAA 3M2JA 2JCHA 1VETB 4WU9C 2H28A 1K38A 1YKDA 4FH4A 1O07A 2AROD 4U3TA 4KG6A 2V20A 4IVKA 3OPHA 2XK1A 1L0EA 3WKJD 1KE0A 2Y2GA 3MGQA 5HSQA 3MXQA 5J3WA 2A49A 2OLUA 2VKSA 4XUXA 3EQUA 2VQRA 3LELC 1IELA 5F1GA 5AV9C 2F8NG 3QP6A 1H8MA 2B02A 3LZ1A 1XX2A 3ZNYA 4WU9D 3MZDA 5FEFA 3KXBC 2ZL1B 5L2FA 3R45A 4DMZA 5M19A 3CITA 1RGYA 3EGXC 3ZGAB 1HQ3C 3W96B 2PBDP 4Y0UA 5FQMA 3C30A 1ONGA 3FV7A 3AZNA 4NG2A 4YM6B 1L2SA 3WTPC 1EROA 1KU5A 1O7EA 5B32A 5TFQA 3AV1B 4B93A 3BECA 4LD9D 5AV6D 3C1BD 3R4KA 1T3UA 5CPJD 3AZGB 4IBXA 1PWGA 3BFGA 1T18A 5CPKA 4HOIA 1JWVA 3V50A 2FJ7C 4IBFA 4LGWA 4OOMA 3WD0A 3V5MA 2EWWA 2H0TA 3OCLA 1CK7A 3RFBA 3WTPA 2J8PA 4OJ5A 3VSKA 3AZMB 1K4EA 3CLOA 4IBJA 1BT5A 3MQ0A 1FSWA 3WTPD 3HVFA 4GD6A 5F1FA 4H9OB 3AV1A 1PIOA 4H9PA 2E8JA 4HY8A 2V0WA 3WX7A 4B88A 3L28A 4KZ5A 3MXSA 3BM6A 1BSGA 3T4KA 3L7HA 3VP4A 3IF6C 4HP4A 2HIOC 2PRFA 4JXSA 4MB5A 5GT0B 3EOIA 1E3UA 2WGVA 3MGSD 4X68A 5AY8D 2XRNA 4Q0IA 2PR6A 1PZOA 1W63M 3N4IA 5DF9A 3FC7A 5FI2A 1B67A 1FR6A 4LV2A 3A6NA 2LY8A 5AV5B 2WKEA 3QNBA 3VOYA 2ZOHA 2R9XA 4NE5A 4KQRA 4R38A 5FEGA 3Q7VB 4JGRA 1SKOB 4R8PB 5DNMA 4RA7A 4H9QA 4EUZA 5FUGB 5DF7A 3AZKC 2IOUA 3H9WA 4FCFA 1TEMA 1YT4A 4WZSB 2HP5A 5CTNA 4F94A 4KUDB 3WA9D 3QP8A 1FCOA 3EQVA 3KUYC 1NZOA 2OLVA 1PZRA 2ZLYA 4BLMA 5DJTA 5DTKA 3X1SB 5EM1A 2Y2KA 2J9PA 4ESPA 4NETA 1ZLAD 3VH6A 5BNVB 4E3JA 4Y3IA 3EGDC 3OBFA 3E4PA 4O8GA 5AVFA 3DTIA 1TS0A 3KWQB 5CERA 3P5JB 1PWCA 2J8YA 1IOUA 4J8VA 3BWLA 1SKFA 3S4XA 1K25A 4H9QB 1TS7A 2M7VA 1NYMA 3UT9B 3NJAA 1XJ4A 3UN7A 3LYXA 4KZBA 1AOIB 3O87A 5CEDA 1OJGA 2FJ7B 2BLSA 2Y2LA 4KGCB 2X71A 3CUEA 1P3PC 4WM9A 5C5KA 4OPRA 2I72A 4HBTA 3W4OA 5GLCA 1DJAA 2EX9A 3H0RC 2NZDA 2QWSA 3PAGA 2OWHA 2L4RA 1JVJA 2PHYA 2NUPC 3TU4D 1ED7A 5F99B 3ZQ5A 4R8PD 4Y2FA 3WS1A 4YINA 4GHIA 2G5IC 1P9RA 3WRZA 3REKC 1JNUA 2JSSA 2PD8A 2PAVP 3CJMA 3E4OA 1XPBA 2CV5A 5FQJA 2H5SA 2ZQ8A 5GSUD 2HDQA 3W2ZA 5F69A 4WZ5A 1LSVA 3MNNC 4WZ5C 3UTBB 5IU1A 5A92A 1NJ4A 1W1PA 3KXBD 5GT3B 4BD1A 4XZQC 1MZUA 3F6TA 1ULYA 5B33A 5B0ZD 3SH8A 2JKRM 3LIFA 1F2KA 4PAUA 3AZED 4MLLA 3T1QB 4C75A 4RQ9A 4X1MA 3HLWA 4E04A 3WS4A 5B1LB 1FIKA 3WAAB 3NIAA 1VEUA 2ZD8A 3VH6W 3NOUC 1PNEA 1DY6A 2ZMAA 3T4LA 1E8BA 2RIQA 3MQLA 3REHD 3FPVA 2ZQ7A 3P98A 3LIEA 4G92C 1RCJA 5B0ZA 3NQUB 2XSSA 4HIAA 3PBSA 1A0KA 2ZC7A 1JWZA 4NXBA 1H3OB 3M2KA 1M1AC 1IFQA 4WLAA 1H8YA 2BYKB 4KGCD 5HPIA 2K7SA 3AZMC 2Z6DA 1ES4A 4I39A 3REKA 3T4SA 5AV8C 1ZLAC 4YWZA 3M7PA 1P3KB 5DKLA 1K0KA 1MC0A 3BW6A 1VHMA 4N1XA 1BLSA 2NUTC 3FKEA 1LLBA 3UTBD 3MGPB 2FH5A 3BYDA 3Q81A 1TD5A 3EPLA 4MBFA 5HARA 4LENA 5DJUA 2Q9NA 1YLWA 1OGBA 3KSYA 3RELA 5GSUB 3W98C 5EUAA 4P6ZM 5BNXA 3G34A 2EX6A 3B0CT 4H9RB 1OMEA 5L09A 3X1UD 5AV9B 1EQZB 5AVBB 1XGIA 5GHXA 1ES3A 5FI7A 1HD8A 4JJNC 1PFLA 1Y28A 4Y0TA 3X1TB 4BBUA 3B0CW 3QHYA 4YS3D 2J9OA 3HJIA 3LUQA 2Y2IA 4WNNB 3AZIB 4G3VA 3TU4C 1E4DA 2EA9A 3REHB 3AN2A 1M18C 1MWUA 4NXGA 4KZ7A 1GSWA 3M6HA 5B1LD 4Z2MG 3W98D 4QHCA 2Y2QA 1TAFA 2C5WB 4GNUA 5B2IA 2GNXA 2RTSA 5GT0A 3AV1C 2HPBA 4NZ1A 2M1CA 2JKGA 5DTTA 1H8ZA 4JJND 4JF6A 4I3AA 1TZYA 2A3UA 1NRFA 5GLBA 4EUVA 4DN0A 1H3OA 5DNNB 1S1ZA 3QP5A 2PDRA 1TZYD 4HMCA 4RYEA 4J8WB 3ZFZA 1J9MA 3UDFA 3SH7A 2VZWA 2DNSA 3CG5A 3G30A 4OP8A 5B1LC 1KDWA 5JA4B 4ZJ3A 4KUOA 3C5AA 2YFVB 5TBMA 4Z66C 1CEFA 2IA2A 3ISGA 1F5MA 1W5DA 1JTGA 1Z6FA 2ZMVA 3PBRA 3BFCA 3IH8A 1P3OD 1P3FD 2F8NH 4J8UB 1YLTA 1H5XA 3KYZA 4ZRRA 1BH9A 3A3DA 3NDGA 4OQGA 1TZYC 4PHTA 4ZUXB 3R7WA 4HESA 5AY8A 3W99B 4ZTKA 4DXBA 5EVIA 3AYWD 1M1AD 5GT3A 3X1VC 5CPIA 2WGWA 3NCKA 4JPMA 3KSIA 4LFUA 2RVQD 3WKJA 4R4SA 1L0GA 1ID3A 3WKJC 2B95A 3I7JA 5IT5A 1P3OA 3FKWA 1LI0A 1U35B 5HL1A 1IYOA 3ZCZA 3AZKB 1MKIA 3O62B 1DRMA 5AQBA 3VP2A 4E3OA 2GZAA 1ZKJA 1P3LB 3D3OA 2XFTA 2IWBA 3UTBC 4X53A 1S6RA 4QLCB
chains in the Genus database with same CATH topology
5B2JA 1LL5A 3AYWC 4NYYA 2ZC3B 1WYCA 4WV4B 5BS7C 3ZDJA 4JJNB 4KGCA 3N3FA 3WS0A 4N92A 5BT1D 3LZ0C 3X1UC 2WADA 1KX4C 1ID3C 1W8YA 5HAQA 3BFFA 3FWLA 3REHA 5B32D 4GKUA 4E6XA 3REHC 1FOFA 3WS2A 4GHLA 5DVAA 1IEMA 3SS5A 1M6KA 3AV2B 3AFAB 3X1TA 4S2LA 4R3BA 4Y0OA 2WUQA 3UNWA 1N1JA 4H9RA 1Q2PA 3A6NC 3W97B 2VGKA 5CGSA 4IJFA 2ZQDA 2WYXA 3AZHA 3RELB 4DF6A 1KGFA 3AZJB 1W2EA 1IYQA 1K57C 3BEBA 3BLSA 3NY4A 4RX2A 1C3BA 1P3AA 4OPYA 5U47A 2EFXA 3NQJB 2XD5A 4S2KA 3B0DB 3UDIA 3SOIA 1KVLA 5FUGA 3VFHA 3O62D 2BYMB 3REKB 5CGXA 3AZFB 3AN2D 1NZUA 5BOHA 3SH9A 3LJAB 5B24A 2OSUA 3ZVTA 3NQUA 2ZY2A 3HUOA 3B6FB 1WYBA 1K4FA 3FDDA 2V2FF 4QJGA 4S2JA 4X6TA 1KX3A 3X1VD 2HDRA 2ZM0A 3MXRA 4E3IA 4IJEA 2WZXA 4KZ3A 2V1ZA 1AOID 4AWLC 1ONHA 5B1MA 2HDUA 3C1CA 2ZC6B 3B6GB 4UUZA 3C4PA 4EQIA 1BTLA 5G18A 4P6BA 2E8IA 1N1JB 5C3IB 3UTBA 4XUZA 4PPRA 3AFAA 3A3JA 1KGEA 3LCEA 3UTAA 2CV5B 1KGGA 4P87A 2YFVA 2HIOA 3MGPA 3W97D 2AROC 3NI9A 3AGFA 5CPKB 3AL0C 1IYPA 4NY2A 3E2LA 4E6WA 1ES5A 1ZLAB 3IP4C 1JFIB 3O88A 5CEBA 5E5AD 3EPKA 5DF8A 2XH9A 3REID 1U60A 1TDGA 1A7WA 2YFWB 3MGPC 2QZ6A 3MFDA 3MKFA 4PM7A 1P3LA 5F83A 2XEPA 3AN2B 2ZM2A 3RXWA 3C1CD 4J8VB 1KE4A 3AZHC 1EI5A 4WU9B 3W8KA 3REIC 2XF3A 4X56A 3MVDC 5AY8B 3W99A 4GB7A 1P3LC 2JC7A 3X1SA 1YLPA 1M18B 1I2WA 2Y2JA 1P3BC 1ERQA 4CSRA 5GXQC 3B0BA 4IBIA 4R23A 5CPJB 1KX4A 4S2IA 4Z5TD 3VH5T 4R3JA 4XUJB 2ZQAA 3V39A 5B31A 1NYYA 4EWFA 4X23C 5B32C 5JRGD 3LZ0B 3P09A 5E5AB 4GD8A 3MVDD 1SCWA 4G91B 4H8RA 3D4FA 3FYZA 4OH0A 2BYKA 4NZ3A 3WA9A 5B0YC 1XP4A 5DTSA 5B40C 1YLYA 3L2AA 2XR0A 4OUIA 3AGEA 1P3OC 5AQ7A 3ZHHA 3A6NB 3MNNA 5JRGC 4GOGA 4UHUA 3AZLD 4Z9QA 4WU8D 4OVDA 4BJPA 5CPKC 3HLDA 4J8WC 3W99C 1K56D 4E44A 4DRBA 5HFOA 1PI5A 2WZZA 1JFIA 1FSYA 4NZ4A 3TG9A 5CXWA 3IWQA 4WYYA 3LZ0A 1P3KD 2HIOB 3FKVA 5I94A 4JBFA 2ZC4B 4PM9A 5D3OA 3REJA 3UTAB 5B31D 4WU8C 2IWDA 5AQ9A 1LHYA 5CECA 5B32G 3S1YA 4CSRB 3VP3A 4OJPA 2G2WA 2Z2MB 4YM6A 4MBHA 5BT1C 2FFFB 3LZ0D 1P3KA 1ID3D 4E3NA 3X1UB 1EQZD 3VSLA 3IF6B 1HVBA 3WTPE 3C7VA 1KX3B 2PBYA 3MZFA 4N9LA 2F8NA 1P3PD 1YU2A 1MWTA 5HAIA 5B24B 3LO7A 1ESUA 4LG2A 5B0ZB 4JLFA 1YLJA 1P3BD 1KE3A 3VMAA 4XUJC 3IXHA 3UE3A 1Q9CA 4R8PC 2F8NB 4BL2A 1MWSA 3UDXA 4LD9C 1GHIA 1AXBA 1ZLAA 1ALQA 3DWZA 5E5AA 1KX5B 5B33B 3NBLA 3DW0A 4ID4A 5FSRA 3O86A 5B31B 5EVLA 3KS4A 4XUJA 5EECA 1PWDA 1ERMA 5AV6A 3C1BA 3CMZA 2Y59A 4WMCA 1I2SA 3W97A 4LV0A 5BO0A 3W97C 4RVAA 3REJB 5GT3C 3EPJA 3AN2C 1M18A 3W98A 5GT0D 5B2ID 5FAQA 1P3FB 4H9NA 3Q82A 2NQBA 4UUZB 5DNMD 2Y2HA 3AZLA 1M19A 1LI9A 3MGSC 5AV5A 4UPKA 5AY8C 1AOIC 4ZBJB 4K0WA 3PBTA 4S2MA 1K54C 3B6GC 1P3PB 4KUDD 3MNNB 3RELD 5B2IC 2HUEB 2BG1A 5AV8D 3C1CC 2YFWA 4XZQB 4OQHA 5JRGA 4EV4A 3UT9A 2BYMA 4MNRA 4DXCA 1IKIA 1F66D 1TDLA 4S2PA 3FZCA 4XXRA 3LEZA 3AZKA 3KUYD 2AROB 2Y4AA 2XQZA 4H9NB 2QPNA 4K0XA 1S32A 2Z2LB 2L5AA 5KDMA 4WEKA 3IWOA 3DWKA 1P34C 3TOIA 1P3GB 1KX5D 2WGWB 5B0YB 4S2OA 2NQBC 3AZGC 4LCLA 4N9KA 3AZGA 4X23A 3MGPD 1XXMA 4P85A 3OPRA 4J8WD 4YS3C 4DQYB 2WGIA 3M6BA 5CRFA 1YU3A 2G2UA 1HZOA 3X1TC 4WEJA 3VFFA 1KX5C 1HTZA 3VH5W 4UAAA 5HX9A 3AZGD 3MZEA 3TU4B 2RCXA 1K55A 3LY3A 3EG5B 5F99D 3SS3A 3AZID 4WZ4A 1FCNA 2QMIA 3KXBA 3PTEA 3QNCA 3NC8A 3IF6A 5B2JB 1P3IA 3N8LA 2IWCA 2H10A 4ZBEA 3AZFD 2IO5B 3O62A 4OJ6A 3REIB 3MGRC 2EXAA 5TR7A 5DNMC 4QY5A 1YMSA 5CHMA 1FR1A 3AZMA 5AV8A 2B5RA 3AZJA 4BQMA 4R4RA 4G91C 3N7WA 2HDSA 5E2EA 5M1AA 5B0ZC 2Y2PA 2HP9A 3B6GA 3C1CB 3ZG7B 1PZPA 4KHAA 1BFMA 4BENA 5A91A 5B1MB 5E5AC 3IXDA 4YFMA 3AZNB 4ZUXD 3HLFA 3G35A 3AV2D 1R4VA 3DTMA 5FAOA 3Q1FA 5KSHA 3PBQA 1QMFA 4FSFA 1G6AA 1P3GC 3L26A 4J8WA 3GVBA 2DCFA 5BS7A 1WE4A 1P3ID 2PU2A 3VP1A 4O7DA 4XUJD 1YMXA 4EO5C 5CP6A 3N8SA 5JRGB 4GDNA 3MKEA 1MPLA 1GHMA 2DRWA 1K6SA 4QLCD 1TAFB 3KWQD 1ZG6A 4EBPA 3LELD 1GA0A 4QB8A 3ZG8B 3WKJB 3UT9D 4JF4A 4K91A 4ZBJC 4JF5A 2Y2NA 2NZDC 2RL3A 3A6ND 5AVCB 1I5QA 4EBNA 2EFUA 1PI4A 3AZLB 5FQ9A 2R9WA 4M6BA 2F8NK 3RXXA 4Z5TC 4WU8B 2WKIA 4X23D 5A93A 1W8QA 3X1VB 3OPLA 1P3AC 5M18A 1BLHA 1Y54A 1KVMA 2F2AC 5AV6C 3C1BC 5A90A 2Y2OA 2Y55A 4YM6D 1N9BA 3AV1D 4OOLA 3O62C 4NE3A 4LD9B 1CI8A 4FH2A 2H0YA 3H0LC 4QLCA 1M40A 5B24C 1KDSA 1CK3A 5E2GA 3KS8A 2OV5A 1P3AD 1YU1A 5CPKD 4JXVA 5FA7A 4PM6A 4C6YA 2EXBA 4IBKA 4KZ4A 5GT3D 3AYWA 1ID3B 1E25A 5B1MC 1B6WA 1S32C 2PU4A 1DJBA 1RP5A 5B1LA 1P34D 5B31G 4PM8A 4OJLA 4ZUXA 3AV2C 3V3RA 3OZHA 2NQBD 1BH9B 3A1IA 5AV9A 3LELA 3E2KA 4YS3A 4B4XA 4OONA 1ESIA 1IYSA 2DQNC 5AVCA 1YU0A 1MY8A 1LL9A 4KENB 3RELC 3AGDA 2X02A 4WMCD 3HONA 5JA4A 1P3MA 2P9VA 3IWIA 3MGQD 3C7UA 2Y91A 2IO5C 3B6FC 3MGRB 3B6FA 2CV5D 4H9SC 3PBOA 3B0DC 3LJAA 1K6RA 4RX3A 1K57A 4JXWA 3WAAC 1Z2CB 4XZQA 3UO9A 4DRAA 4DE1A 4KG5A 3X1SD 5B2IB 2WK0A 4GHAA 1PW1A 3GTCA 3N6IA 3AZIA 1CEGA 3G2YA 4J8XB 1P3PA 3GSGA 5DNNC 3WAAA 2JBFA 4R0QA 5AVBD 4ZDXA 1GA9A 4YM6C 1P34B 5KZHA 4HGAB 1FQGA 3HL9A 1P3MC 5C3IC 1BLPA 3LY4A 3IHAA 2NQBB 5GT0C 4EBLA 5GLAA 4E45A 5B33D 2P74A 3L25A 3O3VA 3UPPA 5DNND 3L27A 3REKD 3ZNTA 3HUMA 4DDYA 4R1GA 5CPJC 3MVDA 1YM1A 3PBNA 4S2NA 4J8VC 3BLMA 3VH5A 5BPVA 1P3GD 5B0YD 3UE0A 4CPKA 5B40D 5FASA 1K56A 1WWSA 2NZDB 1XGJA 5DNMB 4KUDC 1JWPA 4R8PA 2W8SA 3AZLC 3VP0A 1MWRA 3AZEC 1L0FA 4OPQA 3W99D 4E3MA 5B2JC 4QY6A 3AYWB 1P3OB 4IVIA 1AOIA 4BD0A 3MGSA 1E3UD 2EX8A 3GQZA 3ZG0A 2DF4C 1CI9A 1BLCA 5EVIB 4Y7PA 3WWXA 3Q07A 5CHJA 5B24D 4BL3A 3A3FA 1XKZA 1P3BB 5CGWA 5GXQB 2ZJ9A 1U35D 3AZKD 1F66A 5F82A 1GCEA 3ZG5A 3GV9A 3RJUA 1K54A 1P3IC 4DKIA 1MXOA 5B0YA 3IF5A 3X1SC 1P3GA 5EOEA 3WA9C 1XA7A 5GL9A 2WKHA 3Q7ZA 3GR2A 5GXQA 1S32B 4KUDA 1NXYA 3KWQC 5DNNA 5AQAA 5CHUA 5F99A 5F99C 3NDEA 5AV5D 4HGAC 3UT9C 3AFAD 5B40B 1KX3C 1F1EA 1Q2QA 3VH6T 4UA7A 5GHYA 1PW8A 5CPIC 2VGJA 5EPHA 4J8XA 3AZFC 4JKTA 1VQQA 5B1MD 1M18D 3IT9A 5B40A 3LJAC 3C4OA 4MEZA 1WWIA 4OQ0A 2ZQ9A 4KG2A 5GXQD 3LZ1C 1YQSA 4GDBA 4U0TA 4HEFA 3G2ZA 4QNLA 3JYIA 3MGRA 1K55C 3MGQC 3LJAD 4QD4A 4Z66D 4OLGA 3SS4A 4DE0A 4DE2A 3B6FD 5IHVA 4KHAB 4WJ3C 4NFTA 3AZJC 2FJ7D 4JXGA 3WAAD 3A1KA 2CC1A 1YLZA 5AVCD 4CJNA 1BULA 1VM1A 2ZQCA 2HP6A 3Q7VA 5B33C 3R45B 3AZND 3MGSB 3IHBA 5TGFA 2RVQC 4G92B 4CAYA 1F66C 3A3EA 5FQKA 5E43A 2WAFA 5AVBC 2ZY5A 4IBDA 1EWZA 4HBUA 5E2HA 3KXBB 1P3KC 4IEDA 1HQ3B 3W96C 4H9PB 3G32A 3OC2A 2C6WB 5B31C 1P3MD 4ZJ2A 1W79A 3KFUG 4LD9A 1G68A 3WTPB 5J8XA 5B2JD 2PYOB 3AZEB 1KX4D 4Z66B 1SHVA 5CPIB 5G49B 5AV9D 3X1TD 5CP6C 4J8UC 1EQZC 4YS3B 5GLDA 3B3XA 1PYYA 3IXGA 1P3BA 2G5HC 1BH8B 1P34A 4X23B 5B32B 3HLCA 4MBKA 1ZC2A 2F8ND 3AZIC 3LZ1B 4B4ZA 3PAEA 2UWXA 2FJ7A 3MBZA 3ZG9B 5HW3A 3IH9A 4IBBA 1M19C 4OP5A 1ZG4A 4N1HA 2HUEC 5EE8A 3EPHA 3BRMA 2AROA 3MGQB 2ZM8A 3G4PA 3WA9B 1TZYB 4Z5TA 3V9RB 1GHPA 3MGRD 3WRTA 4KQQA 4J8XC 3AZFA 1IKGA 3KWQA 3NQJA 3OCNA 3REJD 4DRTA 3CZDA 4GZBA 3HLBA 2FFYA 3GRJA 1U35C 1HQ3D 5CPJA 1KX4B 3MVDB 5CPID 3HUNA 3V3SA 5FATA 1P3MB 2P9VB 1XA1A 4DDSA 2Y2MA 1FCMA 2PYOD 1S0WA 4J8XD 5CHLB 3BFEA 5BNXB 4WU8A 4ZUXC 3AV2A 4GH9A 2XFSA 4WBGA 3LELB 1P3FA 3HLEA 5E2FA 2GDNA 4KQOA 1W7FA 3MNND 2ZM5A 3W4PA 4PM5A 4Z2MH 1NY0A 3AZEA 3IXBA 4WU9A 3LZ1D 4OLDA 4ZAMA 5GHZA 5EOOA 3B6GD 4X55A 1YU4A 4NYUA 4OQIA 1HQ3A 2CWEA 2XDMA 5EVIC 2JE5A 3KUYB 3G31A 3H0MC 2PYOC 3IQAA 1KX5A 4KZ9A 3A3IA 4JJNA 4IBEA 4QLCC 4L0LA 4OKPA 4P0MA 5FQQA 2HIOD 4EO5B 5CTMA 5CP6B 2ZC5B 3UE1A 3UTAD 1P3IB 3HREA 4KZ8A 4KZAA 4H9OA 3TU4A 1U35A 4J8UD 5FDHA 2NZDD 4LCMA 3AZNC 4Q8IA 2EX2A 5JYPA 4X69A 1YUEA 1MBLA 4UA6A 2ZY3A 3AZHD 3X1UA 3AFAC 4M3KA 1BH8A 1ES2A 1JTDA 1KX3D 4E3KA 4E3LA 4S2NC 2Q9MA 5JYOA 3UTAC 4PMAA 1M19D 4NK3A 4QU3A 3AZJD 4J8VD 3HLGA 1P3LD 4OPZA 4J8UA 3ZVWA 3W96A 3ITAA 3S22A 2PYOA 1BZAA 3ITBA 1N4OA 4LV3A 3UPNA 4DE3A 3GMWA 4NZ5A 1SDEA 4H9SA 3REIA 3OPPA 1TVFA 5FI6A 5KDMB 1DJCA 2J7VA 3UY6A 5CP6D 4A5RA 1BUEA 5KMWA 3VOZA 1QMEA 4Z5TB 3V9RA 2ZY4A 1S32D 5FQIA 4D2OA 5KSCA 3KUYA 4ZJ1A 4OJOA 4LV1A 4CAYB 3WS5A 4FD8A 1P3AB 3W96D 1HTAA 4NE6A 3L29A 3W4QA 1L0DA 2X01A 1RGZA 3UPOA 4WELA 4AWLB 3AZHB 4WNNA 3BFDA 5AVCC 5AVBA 2WAEA 3HSHA 2XGNA 2XD1A 1SDNA 4KZ6A 4IBGA 2XLNA 1M1AA 4U0XA 1M19B 4GN2A 3N8RA 5EVID 3X1VA 4UA9A 4OOYA 4C3QA 1EQZA 5FAPA 5BO0B 3HBRA 1M1AB 5BNVA 2CV5C 3REJC 5AV6B 3W98B 5GSUC 3C1BB 4KGCC 5G49A 5GSUA 4Z66A 1F66B 1P3FC 3AZMD 5AV8B 4IBCA 4IBRA 3TSGA 4XZQD 5AV5C 5HAPA 3M2JA 2JCHA 4WU9C 1K38A 4FH4A 1O07A 2AROD 4U3TA 4KG6A 2V20A 4IVKA 3OPHA 2XK1A 1L0EA 3WKJD 1KE0A 2Y2GA 3MGQA 2A49A 2OLUA 4XUXA 3EQUA 2VQRA 3LELC 1IELA 5F1GA 5AV9C 2F8NG 3LZ1A 1XX2A 3ZNYA 4WU9D 3MZDA 3KXBC 5L2FA 3R45A 5M19A 1RGYA 3ZGAB 1HQ3C 3W96B 4Y0UA 5FQMA 1ONGA 3FV7A 3AZNA 4YM6B 1L2SA 3WTPC 1EROA 1KU5A 1O7EA 5B32A 5TFQA 3AV1B 3BECA 4LD9D 5AV6D 3C1BD 1T3UA 5CPJD 3AZGB 4IBXA 1PWGA 3BFGA 5CPKA 1JWVA 3V50A 2FJ7C 4IBFA 4OOMA 3V5MA 2H0TA 3OCLA 3WTPA 2J8PA 4OJ5A 3VSKA 3AZMB 1K4EA 4IBJA 1BT5A 1FSWA 3WTPD 3HVFA 4GD6A 5F1FA 4H9OB 3AV1A 1PIOA 4H9PA 3WX7A 4B88A 3L28A 4KZ5A 3MXSA 3BM6A 1BSGA 3VP4A 3IF6C 2HIOC 4JXSA 5GT0B 1E3UA 2WGVA 3MGSD 4X68A 5AY8D 1PZOA 3N4IA 5DF9A 5FI2A 1B67A 1FR6A 4LV2A 3A6NA 2LY8A 5AV5B 2WKEA 3QNBA 3VOYA 2R9XA 4NE5A 4KQRA 3Q7VB 4R8PB 5DNMA 4RA7A 4H9QA 4EUZA 5FUGB 5DF7A 3AZKC 2IOUA 4FCFA 1TEMA 1YT4A 4WZSB 2HP5A 5CTNA 4F94A 4KUDB 3WA9D 1FCOA 3EQVA 3KUYC 1NZOA 2OLVA 1PZRA 2ZLYA 4BLMA 5DTKA 3X1SB 2Y2KA 2J9PA 4NETA 1ZLAD 3VH6A 5BNVB 4E3JA 3KWQB 5CERA 3P5JB 1PWCA 2J8YA 4J8VA 1SKFA 3S4XA 1K25A 4H9QB 1NYMA 3UT9B 3UN7A 4KZBA 1AOIB 3O87A 5CEDA 2FJ7B 2BLSA 2Y2LA 4KGCB 2X71A 1P3PC 4WM9A 4OPRA 2I72A 4HBTA 3W4OA 5GLCA 1DJAA 2EX9A 3PAGA 3H0RC 2NZDA 1JVJA 3TU4D 5F99B 4R8PD 3WS1A 4YINA 2G5IC 3WRZA 3REKC 2JSSA 3CJMA 1XPBA 2CV5A 5FQJA 2H5SA 2ZQ8A 5GSUD 2HDQA 4WZ5A 3MNNC 4WZ5C 3UTBB 5A92A 1NJ4A 3KXBD 5GT3B 4BD1A 4XZQC 3F6TA 1ULYA 5B33A 5B0ZD 3SH8A 3AZED 4MLLA 4C75A 3HLWA 3WS4A 5B1LB 3WAAB 3NIAA 2ZD8A 3VH6W 1DY6A 2ZMAA 2RIQA 3REHD 2ZQ7A 3P98A 4G92C 1RCJA 5B0ZA 3NQUB 3PBSA 2ZC7A 1JWZA 1H3OB 3M2KA 1M1AC 1H8YA 2BYKB 4KGCD 3AZMC 1ES4A 3REKA 5AV8C 1ZLAC 1P3KB 4N1XA 1BLSA 3FKEA 1LLBA 3UTBD 3MGPB 3BYDA 3Q81A 3EPLA 4MBFA 5HARA 4LENA 2Q9NA 1YLWA 3KSYA 3RELA 5GSUB 3W98C 5EUAA 5BNXA 3G34A 2EX6A 3B0CT 4H9RB 1OMEA 3X1UD 5AV9B 1EQZB 5AVBB 1XGIA 5GHXA 1ES3A 5FI7A 1HD8A 4JJNC 4Y0TA 3X1TB 3B0CW 3QHYA 4YS3D 2J9OA 2Y2IA 4WNNB 3AZIB 3TU4C 1E4DA 3REHB 3AN2A 1M18C 1MWUA 4KZ7A 3M6HA 5B1LD 4Z2MG 3W98D 4QHCA 4GNUA 2Y2QA 1TAFA 2C5WB 5B2IA 5GT0A 3AV1C 2HPBA 4NZ1A 5DTTA 1H8ZA 4JJND 4JF6A 1TZYA 2A3UA 1NRFA 5GLBA 1H3OA 5DNNB 1TZYD 4RYEA 4J8WB 3ZFZA 1J9MA 3UDFA 3SH7A 2DNSA 3CG5A 3G30A 4OP8A 5B1LC 1KDWA 5JA4B 4ZJ3A 3C5AA 2YFVB 4Z66C 1CEFA 3ISGA 1W5DA 1JTGA 1Z6FA 3PBRA 3BFCA 3IH8A 1P3OD 1P3FD 2F8NH 4J8UB 1YLTA 1H5XA 1BH9A 3A3DA 3NDGA 4OQGA 1TZYC 4ZUXB 4HESA 5AY8A 3W99B 4ZTKA 4DXBA 5EVIA 3AYWD 1M1AD 5GT3A 3X1VC 5CPIA 2WGWA 3NCKA 4JPMA 2RVQD 3WKJA 4R4SA 1L0GA 1ID3A 3WKJC 3I7JA 1P3OA 3FKWA 1LI0A 1U35B 5HL1A 1IYOA 3ZCZA 3AZKB 1MKIA 3O62B 5AQBA 3VP2A 4E3OA 1ZKJA 1P3LB 2XFTA 2IWBA 3UTBC 4X53A 1S6RA 4QLCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K38 A;  1MXO A;  1LL5 A;  2Z2L B;  3IF5 A;  4FH4 A;  5EOE A;  1XA7 A;  1O07 A;  2WKH A;  5GL9 A;  4WEK A;  4U3T A;  4KG6 A;  2ZC3 B;  3IWO A;  2V20 A;  1WYC A;  3DWK A;  3OPH A;  4IVK A;  3Q7Z A;  3TOI A;  3GR2 A;  2XK1 A;  2WGW B;  1L0E A;  3ZDJ A;  1KE0 A;  2Y2G A;  3WS0 A;  1NXY A;  4N92 A;  4S2O A;  2A49 A;  2WAD A;  2OLU A;  4XUX A;  5AQA A;  5CHU A;  4LCL A;  4N9K A;  3EQU A;  1W8Y A;  1XXM A;  4P85 A;  5HAQ A;  3OPR A;  1IEL A;  3NDE A;  5F1G A;  3BFF A;  3FWL A;  4E6X A;  4GKU A;  1FOF A;  3WS2 A;  5DVA A;  1XX2 A;  3ZNY A;  1IEM A;  2WGI A;  3M6B A;  3SS5 A;  3MZD A;  1M6K A;  1Q2Q A;  5CRF A;  5L2F A;  4UA7 A;  5M19 A;  1RGY A;  5GHY A;  1PW8 A;  3ZGA B;  4Y0U A;  2G2U A;  4S2L A;  5FQM A;  1HZO A;  4R3B A;  1ONG A;  2VGJ A;  4WEJ A;  4Y0O A;  2WUQ A;  3UNW A;  5EPH A;  3VFF A;  3FV7 A;  1VQQ A;  1HTZ A;  4JKT A;  1Q2P A;  5CGS A;  2VGK A;  1L2S A;  4UAA A;  5HX9 A;  1ERO A;  3IT9 A;  2ZQD A;  1O7E A;  2WYX A;  5TFQ A;  3MZE A;  4DF6 A;  2RCX A;  3C4O A;  4MEZ A;  1K55 A;  1KGF A;  3LY3 A;  3SS3 A;  1IYQ A;  3BEC A;  1K57 C;  3BEB A;  3BLS A;  3NY4 A;  4OQ0 A;  4WZ4 A;  1FCN A;  2ZQ9 A;  4IBX A;  1PWG A;  4RX2 A;  2QMI A;  3BFG A;  3PTE A;  3QNC A;  4KG2 A;  1JWV A;  1C3B A;  3V50 A;  4OPY A;  3NC8 A;  5U47 A;  3IF6 A;  4OOM A;  3N8L A;  2EFX A;  1YQS A;  2XD5 A;  4S2K A;  4GDB A;  2IWC A;  3V5M A;  4U0T A;  2H10 A;  2H0T A;  3OCL A;  4ZBE A;  3UDI A;  3SOI A;  4HEF A;  1KVL A;  3G2Z A;  3VFH A;  3VSK A;  1K4E A;  3JYI A;  1BT5 A;  5CGX A;  1FSW A;  3HVF A;  1K55 C;  2EXA A;  5TR7 A;  4GD6 A;  5F1F A;  4QY5 A;  1PIO A;  1YMS A;  4QD4 A;  5CHM A;  1FR1 A;  4OLG A;  3SS4 A;  4B88 A;  4DE0 A;  4KZ5 A;  4DE2 A;  1NZU A;  5BOH A;  3MXS A;  5IHV A;  3BM6 A;  3SH9 A;  1BSG A;  2B5R A;  4BQM A;  4R4R A;  2OSU A;  3VP4 A;  3ZVT A;  3IF6 C;  3N7W A;  3HUO A;  1WYB A;  4JXS A;  1K4F A;  2HDS A;  2V2F F;  4JXG A;  5E2E A;  5M1A A;  4QJG A;  4S2J A;  4X6T A;  4X53 A;  2Y2P A;  2CC1 A;  2HDR A;  2ZM0 A;  2HP9 A;  1YLZ A;  3MXR A;  4E3I A;  1E3U A;  2WZX A;  3ZG7 B;  2WGV A;  4CJN A;  1BUL A;  4KZ3 A;  2V1Z A;  4X68 A;  1VM1 A;  1PZP A;  1PZO A;  2ZQC A;  2HP6 A;  3N4I A;  5DF9 A;  3Q7V A;  5FI2 A;  1ONH A;  2HDU A;  1FR6 A;  2ZC6 B;  4LV2 A;  3IHB A;  4BEN A;  5TGF A;  2WKE A;  3QNB A;  3VOY A;  3C4P A;  4EQI A;  1BTL A;  2R9X A;  5G18 A;  4KQR A;  5A91 A;  3IXD A;  4YFM A;  4P6B A;  3Q7V B;  2E8I A;  3HLF A;  3G35 A;  4RA7 A;  4EUZ A;  3DTM A;  5DF7 A;  3A3E A;  3Q1F A;  4XUZ A;  5FAO A;  5KSH A;  3PBQ A;  4PPR A;  1QMF A;  3A3J A;  1KGE A;  4FCF A;  3LCE A;  1TEM A;  4FSF A;  1YT4 A;  2WAF A;  5E43 A;  1G6A A;  5FQK A;  2HP5 A;  1KGG A;  5CTN A;  4F94 A;  4P87 A;  1FCO A;  2DCF A;  3GVB A;  1EWZ A;  3NI9 A;  4HBU A;  3EQV A;  3AGF A;  1WE4 A;  5E2H A;  2PU2 A;  1NZO A;  4IED A;  2OLV A;  4O7D A;  1IYP A;  2ZLY A;  1YMX A;  3E2L A;  3VP1 A;  4E6W A;  4BLM A;  1ES5 A;  5DTK A;  3N8S A;  3G32 A;  3OC2 A;  2C6W B;  4GDN A;  3MKE A;  3O88 A;  4ZJ2 A;  1MPL A;  1W79 A;  5CEB A;  1G68 A;  2Y2K A;  1GHM A;  5DF8 A;  2J9P A;  2XH9 A;  2DRW A;  4NET A;  5J8X A;  1K6S A;  4E3J A;  1ZG6 A;  1U60 A;  1TDG A;  1SHV A;  4EBP A;  2QZ6 A;  4DXB A;  1GA0 A;  4QB8 A;  5CER A;  3MFD A;  3ZG8 B;  1PWC A;  3MKF A;  2J8Y A;  4JF4 A;  4PM7 A;  4K91 A;  5F83 A;  1SKF A;  2XEP A;  5GLD A;  3S4X A;  1K25 A;  1PYY A;  2Y2N A;  3B3X A;  3IXG A;  4JF5 A;  2ZM2 A;  3RXW A;  1NYM A;  2RL3 A;  3UN7 A;  1I5Q A;  4KZB A;  4EBN A;  1KE4 A;  2EFU A;  1PI4 A;  5FQ9 A;  3RXX A;  2R9W A;  3O87 A;  5CED A;  3HLC A;  4MBK A;  1EI5 A;  3W8K A;  2WKI A;  2XF3 A;  1ZC2 A;  2BLS A;  5A93 A;  2Y2L A;  2X71 A;  4B4Z A;  1W8Q A;  3PAE A;  4WM9 A;  3OPL A;  4OPR A;  4X56 A;  2UWX A;  3MBZ A;  5M18 A;  1BLH A;  3ZG9 B;  5HW3 A;  3IH9 A;  2I72 A;  1Y54 A;  4GB7 A;  1KVM A;  4HBT A;  3W4O A;  4OP5 A;  5A90 A;  1ZG4 A;  2Y2O A;  2JC7 A;  4N1H A;  2Y55 A;  1YLP A;  1DJA A;  2EX9 A;  3PAG A;  5EE8 A;  1I2W A;  2Y2J A;  5GLC A;  3BRM A;  1ERQ A;  1JVJ A;  1N9B A;  2ZM8 A;  4OOL A;  3G4P A;  1GHP A;  4R23 A;  3WRT A;  4YIN A;  3WS1 A;  4KQQ A;  1CI8 A;  3WRZ A;  4FH2 A;  1IKG A;  4S2I A;  2H0Y A;  4R3J A;  3OCN A;  2ZQA A;  3V39 A;  1M40 A;  1NYY A;  4EWF A;  3CJM A;  1XPB A;  5FQJ A;  2H5S A;  3P09 A;  2ZQ8 A;  4DRT A;  1KDS A;  2HDQ A;  1CK3 A;  3CZD A;  5E2G A;  4WZ5 A;  2OV5 A;  4GD8 A;  4WZ5 C;  5A92 A;  4GZB A;  1NJ4 A;  3HLB A;  2FFY A;  1SCW A;  4JXV A;  3GRJ A;  5FA7 A;  4BD1 A;  4H8R A;  4PM6 A;  3D4F A;  4C6Y A;  2EXB A;  3HUN A;  4KZ4 A;  3RJU A;  3V3S A;  3FYZ A;  4OH0 A;  5FAT A;  2P9V B;  1XA1 A;  1E25 A;  3SH8 A;  2PU4 A;  4DDS A;  1FCM A;  2Y2M A;  1XP4 A;  5DTS A;  1DJB A;  1S0W A;  1YLY A;  2XR0 A;  1RP5 A;  3AGE A;  3BFE A;  4MLL A;  4PM8 A;  4C75 A;  5AQ7 A;  3ZHH A;  2XFS A;  4WBG A;  3HLE A;  3HLW A;  4GOG A;  5E2F A;  4UHU A;  3WS4 A;  3V3R A;  2GDN A;  4KQO A;  1W7F A;  3NIA A;  3OZH A;  4Z9Q A;  3W4P A;  4PM5 A;  1NY0 A;  2ZD8 A;  4OVD A;  4BJP A;  1DY6 A;  3HLD A;  3IXB A;  2ZMA A;  3E2K A;  4B4X A;  4OLD A;  4ZAM A;  5GHZ A;  1K56 D;  4OON A;  2ZQ7 A;  5EOO A;  3P98 A;  1ESI A;  5HFO A;  1IYS A;  1RCJ A;  1PI5 A;  2WZZ A;  1MY8 A;  4X55 A;  1FSY A;  1LL9 A;  2ZC7 A;  1JWZ A;  3PBS A;  4KEN B;  4OQI A;  3AGD A;  3M2K A;  2X02 A;  4WMC D;  2XDM A;  5EVI C;  1H8Y A;  2JE5 A;  2P9V A;  3TG9 A;  5CXW A;  3IWI A;  3G31 A;  3IWQ A;  3IQA A;  3C7U A;  4KZ9 A;  4WYY A;  2Y91 A;  3A3I A;  1ES4 A;  3FKV A;  5I94 A;  4JBF A;  2ZC4 B;  4L0L A;  4PM9 A;  5D3O A;  3PBO A;  4OKP A;  4P0M A;  5FQQ A;  2IWD A;  5AQ9 A;  5CTM A;  1K6R A;  1LHY A;  2ZC5 B;  4N1X A;  4RX3 A;  1BLS A;  5CEC A;  1K57 A;  3UE1 A;  3HRE A;  4JXW A;  3S1Y A;  4KZ8 A;  3VP3 A;  1LLB A;  4KZA A;  2G2W A;  3BYD A;  3UO9 A;  3Q81 A;  5FDH A;  2Z2M B;  4DE1 A;  4KG5 A;  4LCM A;  4MBF A;  5HAR A;  4LEN A;  4MBH A;  2Q9N A;  4Q8I A;  1YLW A;  2EX2 A;  2FFF B;  5JYP A;  4X69 A;  4E3N A;  2WK0 A;  3VSL A;  3IF6 B;  1PW1 A;  3GTC A;  1HVB A;  3N6I A;  5EUA A;  3C7V A;  1MBL A;  2PBY A;  3G34 A;  3MZF A;  4N9L A;  1CEG A;  4UA6 A;  2EX6 A;  1OME A;  3G2Y A;  1XGI A;  5GHX A;  1ES3 A;  3GSG A;  5FI7 A;  1HD8 A;  4M3K A;  2JBF A;  1ES2 A;  1MWT A;  1JTD A;  4Y0T A;  5HAI A;  4E3K A;  4E3L A;  4S2N C;  2Q9M A;  5JYO A;  3LO7 A;  3QHY A;  1ESU A;  2J9O A;  4R0Q A;  4ZDX A;  4PMA A;  4JLF A;  4NK3 A;  4QU3 A;  1GA9 A;  1YLJ A;  1KE3 A;  3VMA A;  2Y2I A;  3IXH A;  3UE3 A;  5KZH A;  1E4D A;  3HLG A;  4OPZ A;  1FQG A;  1MWU A;  3ZVW A;  4KZ7 A;  3ITA A;  3M6H A;  4QHC A;  3HL9 A;  2Y2Q A;  1BLP A;  2C5W B;  4GNU A;  3S22 A;  3LY4 A;  1BZA A;  3IHA A;  4BL2 A;  1MWS A;  3ITB A;  1N4O A;  4LV3 A;  3UPN A;  4DE3 A;  3GMW A;  2HPB A;  3UDX A;  4EBL A;  5GLA A;  1SDE A;  1GHI A;  2P74 A;  1AXB A;  1ALQ A;  3DWZ A;  3O3V A;  3UPP A;  5DTT A;  3OPP A;  1H8Z A;  1TVF A;  4JF6 A;  5FI6 A;  3ZNT A;  3NBL A;  2A3U A;  3DW0 A;  1NRF A;  3HUM A;  5GLB A;  4R1G A;  4DDY A;  4ID4 A;  5FSR A;  3O86 A;  5EVL A;  1YM1 A;  1DJC A;  5EEC A;  2J7V A;  3PBN A;  4S2N A;  3UY6 A;  1PWD A;  1ERM A;  1BUE A;  4RYE A;  3BLM A;  4A5R A;  3CMZ A;  1QME A;  3VOZ A;  5KMW A;  2Y59 A;  4WMC A;  3ZFZ A;  1J9M A;  3UDF A;  1I2S A;  3SH7 A;  4LV0 A;  5FQI A;  3UE0 A;  2DNS A;  3CG5 A;  4D2O A;  4CPK A;  3G30 A;  4OP8 A;  5KSC A;  1KDW A;  4RVA A;  4ZJ1 A;  5FAS A;  4ZJ3 A;  4LV1 A;  1K56 A;  3C5A A;  1XGJ A;  3WS5 A;  1JWP A;  1CEF A;  4FD8 A;  3ISG A;  5FAQ A;  3Q82 A;  1W5D A;  1JTG A;  1Z6F A;  3PBR A;  3VP0 A;  1L0D A;  1MWR A;  2Y2H A;  3BFC A;  3W4Q A;  3IH8 A;  2X01 A;  1L0F A;  1RGZ A;  1YLT A;  1H5X A;  4OPQ A;  3UPO A;  4WEL A;  3A3D A;  4E3M A;  3NDG A;  1LI9 A;  3BFD A;  4OQG A;  4QY6 A;  4IVI A;  2WAE A;  4BD0 A;  4HES A;  2XGN A;  2XD1 A;  1E3U D;  1SDN A;  2EX8 A;  3GQZ A;  2XLN A;  4KZ6 A;  5EVI A;  4U0X A;  4ZTK A;  4GN2 A;  4K0W A;  3ZG0 A;  3N8R A;  5EVI D;  3PBT A;  4S2M A;  1K54 C;  2WGW A;  3NCK A;  1CI9 A;  4JPM A;  4UA9 A;  4OOY A;  4C3Q A;  5FAP A;  1BLC A;  3HBR A;  5EVI B;  4Y7P A;  3WWX A;  3Q07 A;  4R4S A;  1L0G A;  5CHJ A;  4BL3 A;  2BG1 A;  3I7J A;  3FKW A;  1LI0 A;  3A3F A;  5HL1 A;  1IYO A;  1XKZ A;  3ZCZ A;  4OQH A;  4EV4 A;  1MKI A;  5AQB A;  5CGW A;  3VP2 A;  4E3O A;  4MNR A;  4IBR A;  2ZJ9 A;  3TSG A;  4DXC A;  1ZKJ A;  5HAP A;  1IKI A;  1TDL A;  2XFT A;  3M2J A;  2JCH A;  3FZC A;  3LEZ A;  4S2P A;  4XXR A;  2IWB A;  5F82 A;  1GCE A;  3ZG5 A;  2Y4A A;  2XQZ A;  3GV9 A;  2QPN A;  1S6R A;  1K54 A;  4K0X A;  4DKI A; 
#chains in the Genus database with same CATH topology
 5B2J A;  1LL5 A;  4MN5 A;  3AYW C;  4NYY A;  5J4E A;  2ZC3 B;  1QO6 A;  1WYC A;  4WV4 B;  5BS7 C;  2ACG A;  3ZDJ A;  3CAX A;  4JJN B;  4KGC A;  3N3F A;  1NLZ A;  3LI9 A;  3VV4 A;  3WS0 A;  4N92 A;  5BT1 D;  3LZ0 C;  3X1U C;  2WAD A;  1KX4 C;  1ID3 C;  5HDC A;  1L3L A;  3KSG A;  3MMH A;  1W8Y A;  5HAQ A;  2INW A;  3BFF A;  3FWL A;  3REH A;  5B32 D;  4GKU A;  4E6X A;  3REH C;  1FOF A;  1TS8 A;  3WS2 A;  4GHL A;  5I5L A;  5DVA A;  4EER A;  2WKR A;  4FUW A;  1IEM A;  3LR3 A;  3SS5 A;  3SW1 A;  1M6K A;  3IS2 B;  3AV2 B;  3F1P A;  3B42 A;  3AFA B;  3X1T A;  4S2L A;  4R3B A;  4Y0O A;  2WUQ A;  3UNW A;  1N1J A;  4H9R A;  1Q2P A;  3A6N C;  3W97 B;  2VGK A;  5CGS A;  4IJF A;  2MJ6 A;  2ZQD A;  2WYX A;  5DKK A;  4MN7 A;  3AZH A;  3KO6 A;  3REL B;  4DF6 A;  5KIZ A;  1KGF A;  3AZJ B;  1W2E A;  1IYQ A;  1K57 C;  3BEB A;  3BLS A;  3NY4 A;  1P0Z A;  3MQQ A;  4RX2 A;  2J3T C;  4UQI S;  1C3B A;  2QJ7 A;  1P3A A;  4OPY A;  5U47 A;  2EFX A;  3NQJ B;  2XD5 A;  4S2K A;  3B0D B;  4HJ6 A;  3UDI A;  2QYB A;  3SOI A;  4YNR A;  1S1Y A;  1S66 L;  1KVL A;  5FUG A;  3VFH A;  3O62 D;  2BYM B;  3REK B;  1T1C A;  5CGX A;  4Y15 A;  3IBJ A;  3AZF B;  3AN2 D;  2J80 A;  1NZU A;  5BOH A;  3SH9 A;  3LJA B;  5B24 A;  2OSU A;  3ZVT A;  3NQU A;  1XFQ A;  2ZY2 A;  5AJG A;  3HUO A;  3B6F B;  1WYB A;  2VV7 A;  4EEU A;  1K4F A;  3FDD A;  2V2F F;  4QJG A;  1G5U A;  4S2J A;  4X6T A;  1KX3 A;  3X1V D;  2HDR A;  2ZM0 A;  3MXR A;  4E3I A;  4IJE A;  2WZX A;  4KZ3 A;  2V1Z A;  1AOI D;  4AWL C;  1ONH A;  5B1M A;  2HDU A;  3C1C A;  2ZC6 B;  3B6G B;  1S4S A;  2VEA A;  4HHD A;  4UUZ A;  4HMD A;  3C4P A;  4EQI A;  1BTL A;  3TRC A;  5G18 A;  4P6B A;  2E8I A;  1N1J B;  3E98 A;  3T50 A;  2OWJ A;  3CUE C;  5C3I B;  3UTB A;  4XUZ A;  4PPR A;  3AFA A;  3A3J A;  1KGE A;  1F9I A;  3UTA A;  3LCE A;  2CV5 B;  3K3C A;  1EAK A;  4MB4 A;  4GJ4 A;  1E6R A;  1AWI A;  1KGG A;  4P87 A;  2P7J A;  1GXD A;  2YFV A;  2HIO A;  3MGP A;  3W97 D;  2ARO C;  3NI9 A;  1N9N A;  2HJE A;  3AGF A;  4HJ3 A;  5CPK B;  2XRO A;  1UWP X;  3AL0 C;  1IYP A;  4NY2 A;  3E2L A;  4E6W A;  1ES5 A;  3TW8 A;  1E15 A;  2K2N A;  1ZLA B;  3IP4 C;  1G6O A;  1JFI B;  3EWK A;  3O88 A;  2QJ5 A;  5CEB A;  5E5A D;  3EPK A;  2JKT I;  5DF8 A;  2XH9 A;  3REI D;  1U60 A;  1TDG A;  1A7W A;  2O9C A;  2YFW B;  3MGP C;  2QZ6 A;  3TE8 A;  3MFD A;  1OTD A;  3MKF A;  4PM7 A;  4ETZ A;  1P3L A;  2B18 A;  5F83 A;  2XEP A;  2O9B A;  3AN2 B;  2ZM2 A;  3RXW A;  3F1N B;  3C1C D;  4J8V B;  5HWW A;  1KE4 A;  4DJ3 A;  3AZH C;  1EI5 A;  4WU9 B;  3W8K A;  3REI C;  4IUH A;  2XF3 A;  3QP4 A;  2YKH A;  4X56 A;  3BY8 A;  3MVD C;  5HD5 A;  5AY8 B;  3W99 A;  4MN6 A;  4GB7 A;  1P3L C;  2JC7 A;  3X1S A;  1YLP A;  1M18 B;  1I2W A;  2Y2J A;  2A24 B;  1P3B C;  4ME4 A;  1VET A;  5L8M A;  1ERQ A;  4MDZ A;  4CSR A;  5GXQ C;  3B0B A;  4IBI A;  1STZ A;  1UGU A;  2VGL S;  2VA0 A;  4R23 A;  5CPJ B;  1KX4 A;  4HJ4 A;  4S2I A;  4Z5T D;  3VH5 T;  3E0Y A;  4R3J A;  4XUJ B;  2ZQA A;  3V39 A;  5B31 A;  1BYW A;  1NYY A;  3C2W A;  1CF0 A;  4X23 C;  2HF6 A;  5B32 C;  4EWF A;  5JRG D;  5HZH A;  3LZ0 B;  3P09 A;  5E5A B;  4GD8 A;  3MVD D;  2CMN A;  1SCW A;  4G91 B;  4H8R A;  3D4F A;  3FYZ A;  1NWZ A;  4OH0 A;  2BYK A;  4NZ3 A;  3WA9 A;  5B0Y C;  1XP4 A;  5DTS A;  5B40 C;  1YLY A;  1W1V A;  3L2A A;  2XR0 A;  4OUI A;  3AGE A;  3S7Q A;  1P3O C;  5AQ7 A;  5G4Y A;  3A6N B;  3ZHH A;  3MNN A;  4ARZ A;  5JRG C;  4GOG A;  4UHU A;  1D7E A;  3AZL D;  3FPW A;  2XA7 M;  4Z9Q A;  4WU8 D;  4OVD A;  1F98 A;  4BJP A;  1YSP A;  5CPK C;  3HLD A;  2W3H A;  4J8W C;  3W99 C;  1K56 D;  2JKR I;  3DTE A;  4E44 A;  4DRB A;  5HFO A;  1PI5 A;  2WZZ A;  1JFI A;  1PRQ A;  1FSY A;  4NZ4 A;  3TG9 A;  5CXW A;  3VOL A;  3IWQ A;  4R3A A;  3LZ0 A;  1P3K D;  4WYY A;  1V9Z A;  2HIO B;  3FKV A;  1D06 A;  3KSF A;  5I94 A;  4JBF A;  2ZC4 B;  4PM9 A;  4ETX A;  5D3O A;  3REJ A;  3B33 A;  3UTA B;  5B31 D;  4WU8 C;  2IWD A;  3CWF A;  5AQ9 A;  4H6J A;  1LHY A;  5CEC A;  5B32 G;  3S1Y A;  4CSR B;  3VP3 A;  4OJP A;  5EV0 A;  3ICY A;  2G2W A;  3U4L P;  4GHI B;  2Z2M B;  4YM6 A;  4MBH A;  5BT1 C;  2FFF B;  3LZ0 D;  1P3K A;  3P7N A;  2D02 A;  1ID3 D;  4E3N A;  3X1U B;  1EQZ D;  3VSL A;  3IF6 B;  1HVB A;  3WTP E;  3C38 A;  3C7V A;  1KX3 B;  2PBY A;  3MZF A;  4N9L A;  2F8N A;  1P3P D;  4YOF A;  1YU2 A;  1MWT A;  5HAI A;  5B24 B;  4IHQ A;  3LO7 A;  1ESU A;  5HWV A;  4UEY A;  4LG2 A;  5B0Z B;  3B47 A;  4JLF A;  2P08 A;  1YLJ A;  1P3B D;  1KE3 A;  3VMA A;  2W3F A;  1H3Q A;  4Q0J A;  4XUJ C;  3IXH A;  3UE3 A;  2KOI A;  4M4X A;  1Q9C A;  4R8P C;  2F8N B;  3RTY A;  4BL2 A;  1MWS A;  3DTK A;  3UDX A;  1KS0 A;  4LD9 C;  4CLC D;  1AIW A;  1GHI A;  1AXB A;  1ZLA A;  1ALQ A;  3DWZ A;  4NEE D;  5E5A A;  1KX5 B;  3BJN A;  5B33 B;  4HH2 A;  3NBL A;  3DW0 A;  2V9A A;  3LID A;  4ID4 A;  5FSR A;  3O86 A;  5B31 B;  5EVL A;  3KS4 A;  4XUJ A;  5EEC A;  2BTF P;  1PWD A;  1ERM A;  5AV6 A;  3C1B A;  3CMZ A;  3V67 A;  2Y59 A;  4WMC A;  1I2S A;  4H6J B;  3W97 A;  4LV0 A;  3UMD A;  5BO0 A;  3W97 C;  4NXF A;  4RVA A;  3REJ B;  1OTA A;  4DJ2 A;  5GT3 C;  2A24 A;  1UR9 A;  3EPJ A;  2GJ3 A;  3AN2 C;  1M18 A;  4EET B;  3W98 A;  5GT0 D;  2KDK A;  5B2I D;  3GEC A;  5FAQ A;  1P3F B;  4H9N A;  1NRJ A;  3Q82 A;  2NQB A;  4UUZ B;  4R70 A;  5DNM D;  2Y2H A;  3AZL A;  3CPT B;  1S67 L;  4KUK A;  2JHE A;  3MR0 A;  3NEC A;  1M19 A;  1DP9 A;  1LI9 A;  5EM0 A;  3MGS C;  5AV5 A;  4UPK A;  5AY8 C;  1AOI C;  2Y79 A;  4FOF A;  4WL9 A;  4ZBJ B;  4K0W A;  3PBT A;  4S2M A;  1K54 C;  2UV0 E;  2V8F A;  3B6G C;  1P3P B;  2OOL A;  4KUD D;  3MNN B;  3REL D;  1CJF A;  4ARZ B;  5B2I C;  2FZ0 A;  4BMW A;  2HUE B;  2BG1 A;  5AV8 D;  1ZHH B;  2W27 A;  3C1C C;  2YFW A;  4XZQ B;  4OQH A;  5JRG A;  4EV4 A;  3UT9 A;  2BYM A;  4MNR A;  4DXC A;  3PHY A;  1IKI A;  1F66 D;  1TDL A;  3DBA A;  3FZC A;  4S2P A;  3LEZ A;  4XXR A;  3AZK A;  3KUY D;  2ARO B;  5EFW A;  2Y4A A;  2XQZ A;  4H9N B;  2QPN A;  4K0X A;  3OLO A;  3S7P A;  1S32 A;  2Z2L B;  2L5A A;  4LPZ A;  5KDM A;  2W1R A;  4WEK A;  3T12 B;  3IWO A;  3RH8 B;  3DWK A;  1P34 C;  3TOI A;  4WUJ A;  1P3G B;  1KX5 D;  2WGW B;  5B0Y B;  3LFV A;  2V1A A;  2BAS A;  2G7U A;  4S2O A;  2NQB C;  4GS9 B;  3AZG C;  4LCL A;  4N9K A;  3AZG A;  4X23 A;  3MGP D;  1XXM A;  4P85 A;  3OPR A;  4J8W D;  4YS3 C;  2O9A A;  2JKT M;  2Y8H A;  3WD3 A;  4DQY B;  2WGI A;  3M6B A;  5CRF A;  3T4J A;  1P9W A;  3VE4 A;  1YU3 A;  3MQO A;  2ZBB A;  2G2U A;  1HZO A;  3X1T C;  1T1B A;  4WEJ A;  4II7 A;  3VFF A;  4X1L A;  1KX5 C;  1HTZ A;  3VH5 W;  4L9E A;  4UAA A;  5HX9 A;  3AZG D;  3MZE A;  3TU4 B;  2RCX A;  4FTX A;  1K55 A;  3IX8 A;  3LY3 A;  3EG5 B;  5F99 D;  3SS3 A;  3LIA A;  3AZI D;  3BQA A;  4WZ4 A;  1FCN A;  3A0S A;  4LRY C;  2QMI A;  3KXB A;  3PTE A;  3QNC A;  3H82 A;  1ACF A;  3NC8 A;  3IF6 A;  5B2J B;  1P3I A;  3N8L A;  2Z6C A;  3H7W B;  4LRX C;  2IWC A;  2H10 A;  3MFX A;  4ZBE A;  1V9Y A;  2GX5 A;  4F3L B;  4GLQ A;  2KLI A;  3AZF D;  2IO5 B;  1OTB A;  3O62 A;  4OJ6 A;  3REI B;  3MGR C;  2EXA A;  2VJW A;  5TR7 A;  4K08 A;  5DNM C;  4QY5 A;  1H0M A;  1YMS A;  5CHM A;  1FR1 A;  2ZMF A;  3AZM A;  3UE6 A;  5AV8 A;  3G6O A;  5DFY A;  2B5R A;  3AZJ A;  4BQM A;  4R4R A;  4G91 C;  3N7W A;  2HDS A;  5E2E A;  5M1A A;  5B0Z C;  3K2N A;  2Y2P A;  2HP9 A;  4IUK A;  3B6G A;  1O6I A;  4G3W A;  3C1C B;  3MSH A;  3ZG7 B;  2PYR A;  1PZP A;  1UWN X;  4KHA A;  1BFM A;  3F1P B;  4BEN A;  3LEQ A;  4R6L A;  3E4Q A;  3P01 A;  5A91 A;  5B1M B;  5E5A C;  3IXD A;  4YFM A;  3AZN B;  4ZUX D;  3HLF A;  3G35 A;  3AV2 D;  2DMW A;  1R4V A;  3DTM A;  5FAO A;  3Q1F A;  3D9Y A;  5KSH A;  3PBQ A;  1QMF A;  3K3D A;  4FSF A;  2V1B A;  1G6A A;  1P3G C;  3L26 A;  4J8W A;  3PR6 A;  3GVB A;  2DCF A;  2VK3 A;  5MC7 A;  5BS7 A;  1WE4 A;  1P3I D;  2PU2 A;  3UB5 P;  2PT7 A;  3VP1 A;  2L0W A;  4O7D A;  4CQH A;  4XUJ D;  1YMX A;  4EO5 C;  5CP6 A;  3N8S A;  5JRG B;  3HCY A;  4GDN A;  3MKE A;  4JGQ A;  1MPL A;  1GHM A;  2DRW A;  1K6S A;  4QLC D;  4CLC C;  1TAF B;  3KWQ D;  1ZG6 A;  2W0N A;  4PKY A;  4EBP A;  4PKY G;  3LEL D;  1GA0 A;  2V8C A;  4QB8 A;  3NOT C;  3ZG8 B;  3WKJ B;  3UT9 D;  4JF4 A;  5HDD A;  4K91 A;  3T4Q A;  4ZBJ C;  1T19 A;  2Y2N A;  4JF5 A;  2NZD C;  1ZTU A;  2PYP A;  2Q0O A;  2RL3 A;  3A6N D;  4HP9 A;  5AVC B;  1I5Q A;  4XT2 A;  4EBN A;  2EFU A;  1PI4 A;  3AZL B;  4I38 A;  2R9W A;  4M6B A;  2F8N K;  5FQ9 A;  3RXX A;  3UB8 A;  4Z5T C;  4WU8 B;  1H8P A;  2W1T A;  3UB7 A;  2WKI A;  4X23 D;  5A93 A;  1W8Q A;  3X1V B;  2J3T D;  3OPL A;  1P3A C;  3SZT A;  5M18 A;  1BLH A;  1Y54 A;  5L10 A;  1KVM A;  2F2A C;  5AV6 C;  3C1B C;  5A90 A;  2Y2O A;  2QHK A;  2Y55 A;  4YM6 D;  5K5B A;  1N9B A;  3AV1 D;  4OOL A;  3O62 C;  3PYP A;  4NE3 A;  5AVE A;  1GOI A;  4EXO A;  4LD9 B;  1CI8 A;  1OT9 A;  5FDS A;  4FH2 A;  2H0Y A;  3H0L C;  4QLC A;  1M40 A;  2I9V A;  2JN7 A;  5B24 C;  2HV1 A;  3H82 B;  1KDS A;  1CK3 A;  5E2G A;  3KS8 A;  4Z1W A;  2OV5 A;  1E88 A;  1P3A D;  2HGV A;  1YU1 A;  5CX7 A;  5CPK D;  4JXV A;  5FA7 A;  4PM6 A;  4Y5F A;  4C6Y A;  2EXB A;  1UR8 A;  5J7E A;  4IBK A;  4KZ4 A;  5GT3 D;  3AYW A;  1ID3 B;  3BY9 A;  1E25 A;  5B1M C;  1B6W A;  1S32 C;  5DFX A;  2PU4 A;  2OAP 1;  1DJB A;  1W1T A;  3EEH A;  1RP5 A;  5B1L A;  1P34 D;  5B31 G;  4HH3 A;  4PM8 A;  3VE3 A;  4OJL A;  4ZUX A;  3AV2 C;  1ODV A;  3R7W B;  3V3R A;  2WKQ A;  4Z2K A;  3OZH A;  2NQB D;  1BH9 B;  2PD7 A;  3A1I A;  5AV9 A;  1CXW A;  3A0R A;  3LEL A;  3E2K A;  4YS3 A;  4B4X A;  4I3J A;  4OON A;  3TJZ C;  1ESI A;  1IYS A;  2DQN C;  4XT2 B;  5AVC A;  1YU0 A;  1MY8 A;  3KSH A;  1LL9 A;  4KEN B;  3D72 A;  3REL C;  1FIL A;  4UQI M;  3AGD A;  5TBM B;  2X02 A;  4WMC D;  3HON A;  5JA4 A;  1P3M A;  2P9V A;  3IWI A;  4CLC B;  3MGQ D;  3C7U A;  1HLU P;  3DAV A;  3IX4 A;  2Y91 A;  2IO5 C;  2W3D A;  3B6F C;  3MGR B;  3B6F A;  2CV5 D;  4H9S C;  4Y13 A;  3PBO A;  1XFN A;  3B0D C;  3LJA A;  4GCZ A;  4GW9 A;  1K6R A;  5LBR A;  4RX3 A;  1K57 A;  4I3I A;  4JXW A;  3WAA C;  1SKO A;  1Z2C B;  4L9G A;  3CI6 A;  4XZQ A;  1OJ5 A;  3UO9 A;  4DRA A;  4DE1 A;  4KG5 A;  1E6N A;  4KQD A;  3X1S D;  5B2I B;  1D1J A;  2WK0 A;  4GHA A;  1PW1 A;  3GTC A;  3N6I A;  3AZI A;  1CEG A;  3G2Y A;  4J8X B;  4HI4 A;  3S7O A;  1P3P A;  3GSG A;  5DNN C;  3WAA A;  2JBF A;  4JGO A;  4R0Q A;  5AVB D;  4ZDX A;  1YPR A;  3LR0 A;  1GA9 A;  4YM6 C;  1YSQ A;  1S4R A;  5IS1 A;  4BBT A;  2D49 A;  1P34 B;  1J3W A;  5KZH A;  3JVU A;  4HGA B;  1FQG A;  3NHQ A;  3HL9 A;  1P3M C;  5C3I C;  1BLP A;  3LY4 A;  3IHA A;  2NQB B;  5GT0 C;  3IS2 A;  4EBL A;  5GLA A;  4E45 A;  5F68 A;  5B33 D;  3WD1 A;  2P74 A;  3L25 A;  1XJ3 A;  3LIC A;  4MB3 A;  3O3V A;  3UPP A;  1GPF A;  5DNN D;  4JGP A;  3L27 A;  3REK D;  3ZNT A;  3HUM A;  4DDY A;  4R1G A;  5CPJ C;  3JPU A;  3MVD A;  1YM1 A;  3PBN A;  4S2N A;  4J8V C;  3BLM A;  3VH5 A;  1P97 A;  1L6J A;  5BPV A;  2ZOI A;  1P3G D;  5B0Y D;  3UE0 A;  4CPK A;  4QPR A;  5B40 D;  4NXE A;  5FAS A;  1K56 A;  1WWS A;  2NZD B;  1XGJ A;  5DNM B;  4KUD C;  3LR4 A;  1JWP A;  4R8P A;  3LGO A;  2W8S A;  1WA9 A;  3AZL C;  3U2A A;  3VP0 A;  1MWR A;  3AZE C;  3JVV A;  1L0F A;  3MF0 A;  4OPQ A;  2VGL M;  3F1N A;  1E6Z A;  3W99 D;  4E3M A;  5B2J C;  3O5Y A;  4QY6 A;  3AYW B;  1P3O B;  4IVI A;  1XJ2 A;  1AOI A;  4BD0 A;  4Q0H A;  5HDS A;  3MGS A;  1E3U D;  2EX8 A;  3GQZ A;  3ZG0 A;  2DF4 C;  2W3G A;  1VEU B;  1CI9 A;  1BLC A;  5EVI B;  4QWO A;  4Y7P A;  3WWX A;  4Z2H A;  3Q07 A;  5CHJ A;  5B24 D;  4BL3 A;  1PDC A;  3A3F A;  1XKZ A;  3IBR A;  1P3B B;  5CGW A;  5GXQ B;  2ZJ9 A;  1U35 D;  3AZK D;  1F66 A;  3F1O B;  5F82 A;  1GCE A;  3ZG5 A;  3GV9 A;  3RJU A;  4P6Z S;  1K54 A;  1P3I C;  4DKI A;  1MXO A;  5B0Y A;  3IF5 A;  3X1S C;  1P3G A;  5EOE A;  3WA9 C;  1XA7 A;  5GL9 A;  2WKH A;  3F1O A;  3IX3 A;  5HD3 A;  2XA7 S;  4EES A;  3Q7Z A;  3GR2 A;  5GXQ A;  1S32 B;  4KUD A;  1NXY A;  3KWQ C;  2V5O A;  5DNN A;  5AQA A;  5CHU A;  4MMN A;  5F99 A;  5F99 C;  3NDE A;  5AV5 D;  4HGA C;  1LSW A;  2PR5 A;  3UT9 C;  3AFA D;  5B40 B;  1KX3 C;  1F1E A;  1Q2Q A;  3VH6 T;  4UA7 A;  3NOP C;  1LL8 A;  5GHY A;  1PW8 A;  4NKP A;  5CPI C;  2VGJ A;  2JKF A;  2LB5 A;  5EPH A;  2P04 A;  4J8X A;  3AZF C;  1VQQ A;  4JKT A;  5B1M D;  1M18 D;  3IT9 A;  5B40 A;  3LJA C;  3C4O A;  4MEZ A;  1WWI A;  4BWI A;  4OQ0 A;  4HQA A;  4EU0 A;  2OAQ 1;  2ZQ9 A;  1GSX A;  4KG2 A;  5GXQ D;  1TS6 A;  3LZ1 C;  1YQS A;  3CHW P;  4GDB A;  2VX8 A;  4U0T A;  3ULF A;  1W1Y A;  4HEF A;  3G2Z A;  3ZYT A;  4QNL A;  3JYI A;  3MGR A;  1N9L A;  2KX6 A;  1K55 C;  3MGQ C;  3LJA D;  5TJJ A;  4QD4 A;  1SZV A;  4Z66 D;  4OLG A;  3SS4 A;  4DE0 A;  4DE2 A;  3B6F D;  1DP8 A;  5IHV A;  4KHA B;  4WJ3 C;  5G4Z A;  1GSV A;  4NFT A;  3AZJ C;  2FJ7 D;  4JXG A;  3WAA D;  3A1K A;  2CC1 A;  4B9O A;  1W63 Q;  1YLZ A;  5AVC D;  4CJN A;  1BUL A;  1VM1 A;  2ZQC A;  2HP6 A;  3Q7V A;  5B33 C;  3R45 B;  2ZL1 A;  3AZN D;  3MGS B;  3IHB A;  5TGF A;  3BQ8 A;  1T1A A;  4Y17 A;  3LI8 A;  2RVQ C;  4G92 B;  4LLO B;  5FL3 A;  1MKM A;  3FG8 A;  4CAY A;  1F66 C;  3A3E A;  1OTE A;  5FQK A;  5E43 A;  2WAF A;  5AVB C;  2ZY5 A;  4IBD A;  1EWZ A;  2O0Y A;  4HBU A;  4Z2I A;  5E2H A;  3KXB B;  3C8C A;  1P3K C;  4IED A;  2M7U A;  4LRZ E;  1HQ3 B;  3W96 C;  4H9P B;  3G32 A;  3OC2 A;  2C6W B;  5B31 C;  1P3M D;  4ZJ2 A;  1W79 A;  3KFU G;  4LD9 A;  1G68 A;  5A8B A;  4BBV A;  4Z2L A;  4HME A;  3WTP B;  5J8X A;  5B2J D;  2PYO B;  2HJ9 C;  1OTI A;  4CLC A;  3AZE B;  4X25 A;  1KX4 D;  2A2L A;  4Z66 B;  1SHV A;  5CPI B;  5G49 B;  2VV6 A;  3KYQ A;  5AV9 D;  3WD2 A;  2W1T B;  3MS6 A;  4G3K A;  3X1T D;  5CP6 C;  4J8U C;  1EQZ C;  4YS3 B;  2FN2 A;  5GLD A;  3B3X A;  1PYY A;  3IXG A;  5HWT A;  1P3B A;  3QP2 A;  2G5H C;  1BH8 B;  1P34 A;  4X23 B;  5B32 B;  1J7M A;  2R78 A;  3HLC A;  4MBK A;  4EQ1 A;  1ZC2 A;  2F8N D;  3AZI C;  1N9O A;  3LZ1 B;  3PXP A;  4B4Z A;  3PAE A;  4D60 A;  5F6A A;  3A0V A;  4CLC E;  2UWX A;  2FJ7 A;  3MBZ A;  3ZG9 B;  5HW3 A;  3IH9 A;  4IBB A;  1M19 C;  4OP5 A;  1ZG4 A;  4N1H A;  2HUE C;  5EE8 A;  3EPH A;  2V0U A;  3BRM A;  2ARO A;  3MGQ B;  3HJK A;  3GDI A;  5HPF A;  2ZM8 A;  3G4P A;  3WA9 B;  2YKF A;  1TZY B;  4Z5T A;  3V9R B;  1GHP A;  3MGR D;  3WRT A;  4EW7 A;  4KQQ A;  3UB6 A;  4J8X C;  3AZF A;  3EEA A;  1IKG A;  3KWQ A;  3NQJ A;  3OCN A;  3T1R A;  3REJ D;  4DRT A;  3CZD A;  4GZB A;  3HLB A;  2FFY A;  3GRJ A;  1U35 C;  1HQ3 D;  5CPJ A;  1KX4 B;  3MVD B;  5CPI D;  3HUN A;  1EW0 A;  3V3S A;  3T1X A;  5FAT A;  1P3M B;  2P9V B;  1XA1 A;  1LSX A;  4DDS A;  2Y2M A;  1FCM A;  1S0W A;  2PYO D;  4J8X D;  5CHL B;  4EEP A;  3BFE A;  5BNX B;  4WU8 A;  4ZUX C;  3AV2 A;  4GH9 A;  2XFS A;  4WBG A;  3LEL B;  1P3F A;  3HLE A;  3T4T A;  5E2F A;  1YAX A;  4AFI A;  2GDN A;  4KQO A;  2WKP A;  1W7F A;  3MNN D;  2ZM5 A;  3W4P A;  4PM5 A;  4Z2M H;  1NY0 A;  2LB9 A;  3AZE A;  3IXB A;  4WU9 A;  3LZ1 D;  4TX8 A;  4OLD A;  4ZAM A;  2L1M A;  4O01 A;  5GHZ A;  5EOO A;  3S7N A;  3B6G D;  4X55 A;  1YU4 A;  4NYU A;  2AVX A;  4OQI A;  1HQ3 A;  2CWE A;  2XDM A;  5EVI C;  2JE5 A;  3KUY B;  3G31 A;  3H0M C;  2PYO C;  3IQA A;  1KX5 A;  4HNB A;  4KZ9 A;  1OPX A;  3A3I A;  2W3E A;  3L9K A;  4Z2G A;  4JJN A;  4IBE A;  4QLC C;  4L0L A;  4OKP A;  4P0M A;  4WF0 A;  5FQQ A;  4F3L A;  1Z09 A;  2HIO D;  4EO5 B;  5CTM A;  5CP6 B;  2ZC5 B;  3UE1 A;  3UTA D;  1P3I B;  3HRE A;  4KZ8 A;  1LT0 A;  4KZA A;  4H9O A;  3TU4 A;  4IJG A;  1U35 A;  4J8U D;  1XJ6 A;  1OGG A;  5FDH A;  2NZD D;  4LCM A;  3AZN C;  3T1S A;  4Q8I A;  2EX2 A;  3NUL A;  5JYP A;  4X69 A;  1YUE A;  3MJQ A;  1MBL A;  4UA6 A;  3OOV A;  2ZY3 A;  3AZH D;  2VLG A;  3X1U A;  3AFA C;  4M3K A;  1BH8 A;  1ES2 A;  1JTD A;  1KX3 D;  4E3K A;  4E3L A;  4S2N C;  2Q9M A;  5JYO A;  3UTA C;  4PMA A;  1M19 D;  3UME A;  4NK3 A;  4QU3 A;  3AZJ D;  3QP1 A;  4J8V D;  2VV8 A;  3HLG A;  1P3L D;  4OPZ A;  4J8U A;  3ZVW A;  3W96 A;  3ITA A;  3S22 A;  1Y4O A;  4GS9 A;  2PYO A;  1BZA A;  3ITB A;  1N4O A;  3LR5 A;  4LV3 A;  3UPN A;  4DE3 A;  3GMW A;  1NLY A;  4NZ5 A;  1SDE A;  3T4O A;  4H9S A;  2HZ5 A;  3REI A;  3OPP A;  1TVF A;  1DP6 A;  5FI6 A;  3KX0 X;  1E6P A;  3LIB A;  4Z2J A;  5KDM B;  4O0P A;  4I5S A;  1DJC A;  2J7V A;  3UY6 A;  5CP6 D;  1KOU A;  3H7W A;  4A5R A;  1BUE A;  5KMW A;  2O99 A;  1QME A;  3VOZ A;  4WN5 A;  4Z5T B;  3V9R A;  2QKP A;  2ZY4 A;  1S32 D;  3WD4 A;  5FQI A;  2D01 A;  5HL6 A;  4D2O A;  1H0I A;  5L07 A;  5KSC A;  3KUY A;  4ZJ1 A;  4OJO A;  3KYE A;  4LV1 A;  4CAY B;  3WS5 A;  1X0O A;  4FD8 A;  1P3A B;  3W96 D;  1HTA A;  4NE6 A;  3L29 A;  3W4Q A;  1L0D A;  5EVE A;  2X01 A;  1RGZ A;  1H0G A;  3UPO A;  3UB9 A;  4WEL A;  4AWL B;  3AZH B;  4WNN A;  3BFD A;  2K31 A;  5AVC C;  5AVB A;  2WAE A;  3HSH A;  5F5Y A;  2XGN A;  2XD1 A;  1SDN A;  4KZ6 A;  4IBG A;  2XLN A;  1M1A A;  4U0X A;  1M19 B;  4GN2 A;  3N8R A;  5EVI D;  3X1V A;  3CPT A;  4UA9 A;  1VB6 A;  4L9F A;  4MCW A;  4OOY A;  1EQZ A;  4C3Q A;  5FAP A;  5BO0 B;  3HBR A;  1M1A B;  5BNV A;  2CV5 C;  3REJ C;  5AV6 B;  3W98 B;  5GSU C;  3C1B B;  4KGC C;  5G49 A;  5GSU A;  4Z66 A;  1G28 A;  1OT6 A;  1F66 B;  1P3F C;  3AZM D;  1TF1 A;  2J3W A;  5AV8 B;  4IBC A;  4IBR A;  3TSG A;  4XZQ D;  5AV5 C;  5HAP A;  2EWV A;  1CQA A;  3M2J A;  2JCH A;  1VET B;  4WU9 C;  2H28 A;  1K38 A;  1YKD A;  4FH4 A;  1O07 A;  2ARO D;  4U3T A;  4KG6 A;  2V20 A;  4IVK A;  3OPH A;  2XK1 A;  1L0E A;  3WKJ D;  1KE0 A;  2Y2G A;  3MGQ A;  5HSQ A;  3MXQ A;  5J3W A;  2A49 A;  2OLU A;  2VKS A;  4XUX A;  3EQU A;  2VQR A;  3LEL C;  1IEL A;  5F1G A;  5AV9 C;  2F8N G;  3QP6 A;  1H8M A;  2B02 A;  3LZ1 A;  1XX2 A;  3ZNY A;  4WU9 D;  3MZD A;  5FEF A;  3KXB C;  2ZL1 B;  5L2F A;  3R45 A;  4DMZ A;  5M19 A;  3CIT A;  1RGY A;  3EGX C;  3ZGA B;  1HQ3 C;  3W96 B;  2PBD P;  4Y0U A;  5FQM A;  3C30 A;  1ONG A;  3FV7 A;  3AZN A;  4NG2 A;  4YM6 B;  1L2S A;  3WTP C;  1ERO A;  1KU5 A;  1O7E A;  5B32 A;  5TFQ A;  3AV1 B;  4B93 A;  3BEC A;  4LD9 D;  5AV6 D;  3C1B D;  3R4K A;  1T3U A;  5CPJ D;  3AZG B;  4IBX A;  1PWG A;  3BFG A;  1T18 A;  5CPK A;  4HOI A;  1JWV A;  3V50 A;  2FJ7 C;  4IBF A;  4LGW A;  4OOM A;  3WD0 A;  3V5M A;  2EWW A;  2H0T A;  3OCL A;  1CK7 A;  3RFB A;  3WTP A;  2J8P A;  4OJ5 A;  3VSK A;  3AZM B;  1K4E A;  3CLO A;  4IBJ A;  1BT5 A;  3MQ0 A;  1FSW A;  3WTP D;  3HVF A;  4GD6 A;  5F1F A;  4H9O B;  3AV1 A;  1PIO A;  4H9P A;  2E8J A;  4HY8 A;  2V0W A;  3WX7 A;  4B88 A;  3L28 A;  4KZ5 A;  3MXS A;  3BM6 A;  1BSG A;  3T4K A;  3L7H A;  3VP4 A;  3IF6 C;  4HP4 A;  2HIO C;  2PRF A;  4JXS A;  4MB5 A;  5GT0 B;  3EOI A;  1E3U A;  2WGV A;  3MGS D;  4X68 A;  5AY8 D;  2XRN A;  4Q0I A;  2PR6 A;  1PZO A;  1W63 M;  3N4I A;  5DF9 A;  3FC7 A;  5FI2 A;  1B67 A;  1FR6 A;  4LV2 A;  3A6N A;  2LY8 A;  5AV5 B;  2WKE A;  3QNB A;  3VOY A;  2ZOH A;  2R9X A;  4NE5 A;  4KQR A;  4R38 A;  5FEG A;  3Q7V B;  4JGR A;  1SKO B;  4R8P B;  5DNM A;  4RA7 A;  4H9Q A;  4EUZ A;  5FUG B;  5DF7 A;  3AZK C;  2IOU A;  3H9W A;  4FCF A;  1TEM A;  1YT4 A;  4WZS B;  2HP5 A;  5CTN A;  4F94 A;  4KUD B;  3WA9 D;  3QP8 A;  1FCO A;  3EQV A;  3KUY C;  1NZO A;  2OLV A;  1PZR A;  2ZLY A;  4BLM A;  5DJT A;  5DTK A;  3X1S B;  5EM1 A;  2Y2K A;  2J9P A;  4ESP A;  4NET A;  1ZLA D;  3VH6 A;  5BNV B;  4E3J A;  4Y3I A;  3EGD C;  3OBF A;  3E4P A;  4O8G A;  5AVF A;  3DTI A;  1TS0 A;  3KWQ B;  5CER A;  3P5J B;  1PWC A;  2J8Y A;  1IOU A;  4J8V A;  3BWL A;  1SKF A;  3S4X A;  1K25 A;  4H9Q B;  1TS7 A;  2M7V A;  1NYM A;  3UT9 B;  3NJA A;  1XJ4 A;  3UN7 A;  3LYX A;  4KZB A;  1AOI B;  3O87 A;  5CED A;  1OJG A;  2FJ7 B;  2BLS A;  2Y2L A;  4KGC B;  2X71 A;  3CUE A;  1P3P C;  4WM9 A;  5C5K A;  4OPR A;  2I72 A;  4HBT A;  3W4O A;  5GLC A;  1DJA A;  2EX9 A;  3H0R C;  2NZD A;  2QWS A;  3PAG A;  2OWH A;  2L4R A;  1JVJ A;  2PHY A;  2NUP C;  3TU4 D;  1ED7 A;  5F99 B;  3ZQ5 A;  4R8P D;  4Y2F A;  3WS1 A;  4YIN A;  4GHI A;  2G5I C;  1P9R A;  3WRZ A;  3REK C;  1JNU A;  2JSS A;  2PD8 A;  2PAV P;  3CJM A;  3E4O A;  1XPB A;  2CV5 A;  5FQJ A;  2H5S A;  2ZQ8 A;  5GSU D;  2HDQ A;  3W2Z A;  5F69 A;  4WZ5 A;  1LSV A;  3MNN C;  4WZ5 C;  3UTB B;  5IU1 A;  5A92 A;  1NJ4 A;  1W1P A;  3KXB D;  5GT3 B;  4BD1 A;  4XZQ C;  1MZU A;  3F6T A;  1ULY A;  5B33 A;  5B0Z D;  3SH8 A;  2JKR M;  3LIF A;  1F2K A;  4PAU A;  3AZE D;  4MLL A;  3T1Q B;  4C75 A;  4RQ9 A;  4X1M A;  3HLW A;  4E04 A;  3WS4 A;  5B1L B;  1FIK A;  3WAA B;  3NIA A;  1VEU A;  2ZD8 A;  3VH6 W;  3NOU C;  1PNE A;  1DY6 A;  2ZMA A;  3T4L A;  1E8B A;  2RIQ A;  3MQL A;  3REH D;  3FPV A;  2ZQ7 A;  3P98 A;  3LIE A;  4G92 C;  1RCJ A;  5B0Z A;  3NQU B;  2XSS A;  4HIA A;  3PBS A;  1A0K A;  2ZC7 A;  1JWZ A;  4NXB A;  1H3O B;  3M2K A;  1M1A C;  1IFQ A;  4WLA A;  1H8Y A;  2BYK B;  4KGC D;  5HPI A;  2K7S A;  3AZM C;  2Z6D A;  1ES4 A;  4I39 A;  3REK A;  3T4S A;  5AV8 C;  1ZLA C;  4YWZ A;  3M7P A;  1P3K B;  5DKL A;  1K0K A;  1MC0 A;  3BW6 A;  1VHM A;  4N1X A;  1BLS A;  2NUT C;  3FKE A;  1LLB A;  3UTB D;  3MGP B;  2FH5 A;  3BYD A;  3Q81 A;  1TD5 A;  3EPL A;  4MBF A;  5HAR A;  4LEN A;  5DJU A;  2Q9N A;  1YLW A;  1OGB A;  3KSY A;  3REL A;  5GSU B;  3W98 C;  5EUA A;  4P6Z M;  5BNX A;  3G34 A;  2EX6 A;  3B0C T;  4H9R B;  1OME A;  5L09 A;  3X1U D;  5AV9 B;  1EQZ B;  5AVB B;  1XGI A;  5GHX A;  1ES3 A;  5FI7 A;  1HD8 A;  4JJN C;  1PFL A;  1Y28 A;  4Y0T A;  3X1T B;  4BBU A;  3B0C W;  3QHY A;  4YS3 D;  2J9O A;  3HJI A;  3LUQ A;  2Y2I A;  4WNN B;  3AZI B;  4G3V A;  3TU4 C;  1E4D A;  2EA9 A;  3REH B;  3AN2 A;  1M18 C;  1MWU A;  4NXG A;  4KZ7 A;  1GSW A;  3M6H A;  5B1L D;  4Z2M G;  3W98 D;  4QHC A;  2Y2Q A;  1TAF A;  2C5W B;  4GNU A;  5B2I A;  2GNX A;  2RTS A;  5GT0 A;  3AV1 C;  2HPB A;  4NZ1 A;  2M1C A;  2JKG A;  5DTT A;  1H8Z A;  4JJN D;  4JF6 A;  4I3A A;  1TZY A;  2A3U A;  1NRF A;  5GLB A;  4EUV A;  4DN0 A;  1H3O A;  5DNN B;  1S1Z A;  3QP5 A;  2PDR A;  1TZY D;  4HMC A;  4RYE A;  4J8W B;  3ZFZ A;  1J9M A;  3UDF A;  3SH7 A;  2VZW A;  2DNS A;  3CG5 A;  3G30 A;  4OP8 A;  5B1L C;  1KDW A;  5JA4 B;  4ZJ3 A;  4KUO A;  3C5A A;  2YFV B;  5TBM A;  4Z66 C;  1CEF A;  2IA2 A;  3ISG A;  1F5M A;  1W5D A;  1JTG A;  1Z6F A;  2ZMV A;  3PBR A;  3BFC A;  3IH8 A;  1P3O D;  1P3F D;  2F8N H;  4J8U B;  1YLT A;  1H5X A;  3KYZ A;  4ZRR A;  1BH9 A;  3A3D A;  3NDG A;  4OQG A;  1TZY C;  4PHT A;  4ZUX B;  3R7W A;  4HES A;  5AY8 A;  3W99 B;  4ZTK A;  4DXB A;  5EVI A;  3AYW D;  1M1A D;  5GT3 A;  3X1V C;  5CPI A;  2WGW A;  3NCK A;  4JPM A;  3KSI A;  4LFU A;  2RVQ D;  3WKJ A;  4R4S A;  1L0G A;  1ID3 A;  3WKJ C;  2B95 A;  3I7J A;  5IT5 A;  1P3O A;  3FKW A;  1LI0 A;  1U35 B;  5HL1 A;  1IYO A;  3ZCZ A;  3AZK B;  1MKI A;  3O62 B;  1DRM A;  5AQB A;  3VP2 A;  4E3O A;  2GZA A;  1ZKJ A;  1P3L B;  3D3O A;  2XFT A;  2IWB A;  3UTB C;  4X53 A;  1S6R A;  4QLC B; 
#chains in the Genus database with same CATH homology
 5B2J A;  1LL5 A;  3AYW C;  4NYY A;  2ZC3 B;  1WYC A;  4WV4 B;  5BS7 C;  3ZDJ A;  4JJN B;  4KGC A;  3N3F A;  3WS0 A;  4N92 A;  5BT1 D;  3LZ0 C;  3X1U C;  2WAD A;  1KX4 C;  1ID3 C;  1W8Y A;  5HAQ A;  3BFF A;  3FWL A;  3REH A;  5B32 D;  4GKU A;  4E6X A;  3REH C;  1FOF A;  3WS2 A;  4GHL A;  5DVA A;  1IEM A;  3SS5 A;  1M6K A;  3AV2 B;  3AFA B;  3X1T A;  4S2L A;  4R3B A;  4Y0O A;  2WUQ A;  3UNW A;  1N1J A;  4H9R A;  1Q2P A;  3A6N C;  3W97 B;  2VGK A;  5CGS A;  4IJF A;  2ZQD A;  2WYX A;  3AZH A;  3REL B;  4DF6 A;  1KGF A;  3AZJ B;  1W2E A;  1IYQ A;  1K57 C;  3BEB A;  3BLS A;  3NY4 A;  4RX2 A;  1C3B A;  1P3A A;  4OPY A;  5U47 A;  2EFX A;  3NQJ B;  2XD5 A;  4S2K A;  3B0D B;  3UDI A;  3SOI A;  1KVL A;  5FUG A;  3VFH A;  3O62 D;  2BYM B;  3REK B;  5CGX A;  3AZF B;  3AN2 D;  1NZU A;  5BOH A;  3SH9 A;  3LJA B;  5B24 A;  2OSU A;  3ZVT A;  3NQU A;  2ZY2 A;  3HUO A;  3B6F B;  1WYB A;  1K4F A;  3FDD A;  2V2F F;  4QJG A;  4S2J A;  4X6T A;  1KX3 A;  3X1V D;  2HDR A;  2ZM0 A;  3MXR A;  4E3I A;  4IJE A;  2WZX A;  4KZ3 A;  2V1Z A;  1AOI D;  4AWL C;  1ONH A;  5B1M A;  2HDU A;  3C1C A;  2ZC6 B;  3B6G B;  4UUZ A;  3C4P A;  4EQI A;  1BTL A;  5G18 A;  4P6B A;  2E8I A;  1N1J B;  5C3I B;  3UTB A;  4XUZ A;  4PPR A;  3AFA A;  3A3J A;  1KGE A;  3LCE A;  3UTA A;  2CV5 B;  1KGG A;  4P87 A;  2YFV A;  2HIO A;  3MGP A;  3W97 D;  2ARO C;  3NI9 A;  3AGF A;  5CPK B;  3AL0 C;  1IYP A;  4NY2 A;  3E2L A;  4E6W A;  1ES5 A;  1ZLA B;  3IP4 C;  1JFI B;  3O88 A;  5CEB A;  5E5A D;  3EPK A;  5DF8 A;  2XH9 A;  3REI D;  1U60 A;  1TDG A;  1A7W A;  2YFW B;  3MGP C;  2QZ6 A;  3MFD A;  3MKF A;  4PM7 A;  1P3L A;  5F83 A;  2XEP A;  3AN2 B;  2ZM2 A;  3RXW A;  3C1C D;  4J8V B;  1KE4 A;  3AZH C;  1EI5 A;  4WU9 B;  3W8K A;  3REI C;  2XF3 A;  4X56 A;  3MVD C;  5AY8 B;  3W99 A;  4GB7 A;  1P3L C;  2JC7 A;  3X1S A;  1YLP A;  1M18 B;  1I2W A;  2Y2J A;  1P3B C;  1ERQ A;  4CSR A;  5GXQ C;  3B0B A;  4IBI A;  4R23 A;  5CPJ B;  1KX4 A;  4S2I A;  4Z5T D;  3VH5 T;  4R3J A;  4XUJ B;  2ZQA A;  3V39 A;  5B31 A;  1NYY A;  4EWF A;  4X23 C;  5B32 C;  5JRG D;  3LZ0 B;  3P09 A;  5E5A B;  4GD8 A;  3MVD D;  1SCW A;  4G91 B;  4H8R A;  3D4F A;  3FYZ A;  4OH0 A;  2BYK A;  4NZ3 A;  3WA9 A;  5B0Y C;  1XP4 A;  5DTS A;  5B40 C;  1YLY A;  3L2A A;  2XR0 A;  4OUI A;  3AGE A;  1P3O C;  5AQ7 A;  3ZHH A;  3A6N B;  3MNN A;  5JRG C;  4GOG A;  4UHU A;  3AZL D;  4Z9Q A;  4WU8 D;  4OVD A;  4BJP A;  5CPK C;  3HLD A;  4J8W C;  3W99 C;  1K56 D;  4E44 A;  4DRB A;  5HFO A;  1PI5 A;  2WZZ A;  1JFI A;  1FSY A;  4NZ4 A;  3TG9 A;  5CXW A;  3IWQ A;  4WYY A;  3LZ0 A;  1P3K D;  2HIO B;  3FKV A;  5I94 A;  4JBF A;  2ZC4 B;  4PM9 A;  5D3O A;  3REJ A;  3UTA B;  5B31 D;  4WU8 C;  2IWD A;  5AQ9 A;  1LHY A;  5CEC A;  5B32 G;  3S1Y A;  4CSR B;  3VP3 A;  4OJP A;  2G2W A;  2Z2M B;  4YM6 A;  4MBH A;  5BT1 C;  2FFF B;  3LZ0 D;  1P3K A;  1ID3 D;  4E3N A;  3X1U B;  1EQZ D;  3VSL A;  3IF6 B;  1HVB A;  3WTP E;  3C7V A;  1KX3 B;  2PBY A;  3MZF A;  4N9L A;  2F8N A;  1P3P D;  1YU2 A;  1MWT A;  5HAI A;  5B24 B;  3LO7 A;  1ESU A;  4LG2 A;  5B0Z B;  4JLF A;  1YLJ A;  1P3B D;  1KE3 A;  3VMA A;  4XUJ C;  3IXH A;  3UE3 A;  1Q9C A;  4R8P C;  2F8N B;  4BL2 A;  1MWS A;  3UDX A;  4LD9 C;  1GHI A;  1AXB A;  1ZLA A;  1ALQ A;  3DWZ A;  5E5A A;  1KX5 B;  5B33 B;  3NBL A;  3DW0 A;  4ID4 A;  5FSR A;  3O86 A;  5B31 B;  5EVL A;  3KS4 A;  4XUJ A;  5EEC A;  1PWD A;  1ERM A;  5AV6 A;  3C1B A;  3CMZ A;  2Y59 A;  4WMC A;  1I2S A;  3W97 A;  4LV0 A;  5BO0 A;  3W97 C;  4RVA A;  3REJ B;  5GT3 C;  3EPJ A;  3AN2 C;  1M18 A;  3W98 A;  5GT0 D;  5B2I D;  5FAQ A;  1P3F B;  4H9N A;  3Q82 A;  2NQB A;  4UUZ B;  5DNM D;  2Y2H A;  3AZL A;  1M19 A;  1LI9 A;  3MGS C;  5AV5 A;  4UPK A;  5AY8 C;  1AOI C;  4ZBJ B;  4K0W A;  3PBT A;  4S2M A;  1K54 C;  3B6G C;  1P3P B;  4KUD D;  3MNN B;  3REL D;  5B2I C;  2HUE B;  2BG1 A;  5AV8 D;  3C1C C;  2YFW A;  4XZQ B;  4OQH A;  5JRG A;  4EV4 A;  3UT9 A;  2BYM A;  4MNR A;  4DXC A;  1IKI A;  1F66 D;  1TDL A;  4S2P A;  3FZC A;  4XXR A;  3LEZ A;  3AZK A;  3KUY D;  2ARO B;  2Y4A A;  2XQZ A;  4H9N B;  2QPN A;  4K0X A;  1S32 A;  2Z2L B;  2L5A A;  5KDM A;  4WEK A;  3IWO A;  3DWK A;  1P34 C;  3TOI A;  1P3G B;  1KX5 D;  2WGW B;  5B0Y B;  4S2O A;  2NQB C;  3AZG C;  4LCL A;  4N9K A;  3AZG A;  4X23 A;  3MGP D;  1XXM A;  4P85 A;  3OPR A;  4J8W D;  4YS3 C;  4DQY B;  2WGI A;  3M6B A;  5CRF A;  1YU3 A;  2G2U A;  1HZO A;  3X1T C;  4WEJ A;  3VFF A;  1KX5 C;  1HTZ A;  3VH5 W;  4UAA A;  5HX9 A;  3AZG D;  3MZE A;  3TU4 B;  2RCX A;  1K55 A;  3LY3 A;  3EG5 B;  5F99 D;  3SS3 A;  3AZI D;  4WZ4 A;  1FCN A;  2QMI A;  3KXB A;  3PTE A;  3QNC A;  3NC8 A;  3IF6 A;  5B2J B;  1P3I A;  3N8L A;  2IWC A;  2H10 A;  4ZBE A;  3AZF D;  2IO5 B;  3O62 A;  4OJ6 A;  3REI B;  3MGR C;  2EXA A;  5TR7 A;  5DNM C;  4QY5 A;  1YMS A;  5CHM A;  1FR1 A;  3AZM A;  5AV8 A;  2B5R A;  3AZJ A;  4BQM A;  4R4R A;  4G91 C;  3N7W A;  2HDS A;  5E2E A;  5M1A A;  5B0Z C;  2Y2P A;  2HP9 A;  3B6G A;  3C1C B;  3ZG7 B;  1PZP A;  4KHA A;  1BFM A;  4BEN A;  5A91 A;  5B1M B;  5E5A C;  3IXD A;  4YFM A;  3AZN B;  4ZUX D;  3HLF A;  3G35 A;  3AV2 D;  1R4V A;  3DTM A;  5FAO A;  3Q1F A;  5KSH A;  3PBQ A;  1QMF A;  4FSF A;  1G6A A;  1P3G C;  3L26 A;  4J8W A;  3GVB A;  2DCF A;  5BS7 A;  1WE4 A;  1P3I D;  2PU2 A;  3VP1 A;  4O7D A;  4XUJ D;  1YMX A;  4EO5 C;  5CP6 A;  3N8S A;  5JRG B;  4GDN A;  3MKE A;  1MPL A;  1GHM A;  2DRW A;  1K6S A;  4QLC D;  1TAF B;  3KWQ D;  1ZG6 A;  4EBP A;  3LEL D;  1GA0 A;  4QB8 A;  3ZG8 B;  3WKJ B;  3UT9 D;  4JF4 A;  4K91 A;  4ZBJ C;  4JF5 A;  2Y2N A;  2NZD C;  2RL3 A;  3A6N D;  5AVC B;  1I5Q A;  4EBN A;  2EFU A;  1PI4 A;  3AZL B;  5FQ9 A;  2R9W A;  4M6B A;  2F8N K;  3RXX A;  4Z5T C;  4WU8 B;  2WKI A;  4X23 D;  5A93 A;  1W8Q A;  3X1V B;  3OPL A;  1P3A C;  5M18 A;  1BLH A;  1Y54 A;  1KVM A;  2F2A C;  5AV6 C;  3C1B C;  5A90 A;  2Y2O A;  2Y55 A;  4YM6 D;  1N9B A;  3AV1 D;  4OOL A;  3O62 C;  4NE3 A;  4LD9 B;  1CI8 A;  4FH2 A;  2H0Y A;  3H0L C;  4QLC A;  1M40 A;  5B24 C;  1KDS A;  1CK3 A;  5E2G A;  3KS8 A;  2OV5 A;  1P3A D;  1YU1 A;  5CPK D;  4JXV A;  5FA7 A;  4PM6 A;  4C6Y A;  2EXB A;  4IBK A;  4KZ4 A;  5GT3 D;  3AYW A;  1ID3 B;  1E25 A;  5B1M C;  1B6W A;  1S32 C;  2PU4 A;  1DJB A;  1RP5 A;  5B1L A;  1P34 D;  5B31 G;  4PM8 A;  4OJL A;  4ZUX A;  3AV2 C;  3V3R A;  3OZH A;  2NQB D;  1BH9 B;  3A1I A;  5AV9 A;  3LEL A;  3E2K A;  4YS3 A;  4B4X A;  4OON A;  1ESI A;  1IYS A;  2DQN C;  5AVC A;  1YU0 A;  1MY8 A;  1LL9 A;  4KEN B;  3REL C;  3AGD A;  2X02 A;  4WMC D;  3HON A;  5JA4 A;  1P3M A;  2P9V A;  3IWI A;  3MGQ D;  3C7U A;  2Y91 A;  2IO5 C;  3B6F C;  3MGR B;  3B6F A;  2CV5 D;  4H9S C;  3PBO A;  3B0D C;  3LJA A;  1K6R A;  4RX3 A;  1K57 A;  4JXW A;  3WAA C;  1Z2C B;  4XZQ A;  3UO9 A;  4DRA A;  4DE1 A;  4KG5 A;  3X1S D;  5B2I B;  2WK0 A;  4GHA A;  1PW1 A;  3GTC A;  3N6I A;  3AZI A;  1CEG A;  3G2Y A;  4J8X B;  1P3P A;  3GSG A;  5DNN C;  3WAA A;  2JBF A;  4R0Q A;  5AVB D;  4ZDX A;  1GA9 A;  4YM6 C;  1P34 B;  5KZH A;  4HGA B;  1FQG A;  3HL9 A;  1P3M C;  5C3I C;  1BLP A;  3LY4 A;  3IHA A;  2NQB B;  5GT0 C;  4EBL A;  5GLA A;  4E45 A;  5B33 D;  2P74 A;  3L25 A;  3O3V A;  3UPP A;  5DNN D;  3L27 A;  3REK D;  3ZNT A;  3HUM A;  4DDY A;  4R1G A;  5CPJ C;  3MVD A;  1YM1 A;  3PBN A;  4S2N A;  4J8V C;  3BLM A;  3VH5 A;  5BPV A;  1P3G D;  5B0Y D;  3UE0 A;  4CPK A;  5B40 D;  5FAS A;  1K56 A;  1WWS A;  2NZD B;  1XGJ A;  5DNM B;  4KUD C;  1JWP A;  4R8P A;  2W8S A;  3AZL C;  3VP0 A;  1MWR A;  3AZE C;  1L0F A;  4OPQ A;  3W99 D;  4E3M A;  5B2J C;  4QY6 A;  3AYW B;  1P3O B;  4IVI A;  1AOI A;  4BD0 A;  3MGS A;  1E3U D;  2EX8 A;  3GQZ A;  3ZG0 A;  2DF4 C;  1CI9 A;  1BLC A;  5EVI B;  4Y7P A;  3WWX A;  3Q07 A;  5CHJ A;  5B24 D;  4BL3 A;  3A3F A;  1XKZ A;  1P3B B;  5CGW A;  5GXQ B;  2ZJ9 A;  1U35 D;  3AZK D;  1F66 A;  5F82 A;  1GCE A;  3ZG5 A;  3GV9 A;  3RJU A;  1K54 A;  1P3I C;  4DKI A;  1MXO A;  5B0Y A;  3IF5 A;  3X1S C;  1P3G A;  5EOE A;  3WA9 C;  1XA7 A;  5GL9 A;  2WKH A;  3Q7Z A;  3GR2 A;  5GXQ A;  1S32 B;  4KUD A;  1NXY A;  3KWQ C;  5DNN A;  5AQA A;  5CHU A;  5F99 A;  5F99 C;  3NDE A;  5AV5 D;  4HGA C;  3UT9 C;  3AFA D;  5B40 B;  1KX3 C;  1F1E A;  1Q2Q A;  3VH6 T;  4UA7 A;  5GHY A;  1PW8 A;  5CPI C;  2VGJ A;  5EPH A;  4J8X A;  3AZF C;  4JKT A;  1VQQ A;  5B1M D;  1M18 D;  3IT9 A;  5B40 A;  3LJA C;  3C4O A;  4MEZ A;  1WWI A;  4OQ0 A;  2ZQ9 A;  4KG2 A;  5GXQ D;  3LZ1 C;  1YQS A;  4GDB A;  4U0T A;  4HEF A;  3G2Z A;  4QNL A;  3JYI A;  3MGR A;  1K55 C;  3MGQ C;  3LJA D;  4QD4 A;  4Z66 D;  4OLG A;  3SS4 A;  4DE0 A;  4DE2 A;  3B6F D;  5IHV A;  4KHA B;  4WJ3 C;  4NFT A;  3AZJ C;  2FJ7 D;  4JXG A;  3WAA D;  3A1K A;  2CC1 A;  1YLZ A;  5AVC D;  4CJN A;  1BUL A;  1VM1 A;  2ZQC A;  2HP6 A;  3Q7V A;  5B33 C;  3R45 B;  3AZN D;  3MGS B;  3IHB A;  5TGF A;  2RVQ C;  4G92 B;  4CAY A;  1F66 C;  3A3E A;  5FQK A;  5E43 A;  2WAF A;  5AVB C;  2ZY5 A;  4IBD A;  1EWZ A;  4HBU A;  5E2H A;  3KXB B;  1P3K C;  4IED A;  1HQ3 B;  3W96 C;  4H9P B;  3G32 A;  3OC2 A;  2C6W B;  5B31 C;  1P3M D;  4ZJ2 A;  1W79 A;  3KFU G;  4LD9 A;  1G68 A;  3WTP B;  5J8X A;  5B2J D;  2PYO B;  3AZE B;  1KX4 D;  4Z66 B;  1SHV A;  5CPI B;  5G49 B;  5AV9 D;  3X1T D;  5CP6 C;  4J8U C;  1EQZ C;  4YS3 B;  5GLD A;  3B3X A;  1PYY A;  3IXG A;  1P3B A;  2G5H C;  1BH8 B;  1P34 A;  4X23 B;  5B32 B;  3HLC A;  4MBK A;  1ZC2 A;  2F8N D;  3AZI C;  3LZ1 B;  4B4Z A;  3PAE A;  2UWX A;  2FJ7 A;  3MBZ A;  3ZG9 B;  5HW3 A;  3IH9 A;  4IBB A;  1M19 C;  4OP5 A;  1ZG4 A;  4N1H A;  2HUE C;  5EE8 A;  3EPH A;  3BRM A;  2ARO A;  3MGQ B;  2ZM8 A;  3G4P A;  3WA9 B;  1TZY B;  4Z5T A;  3V9R B;  1GHP A;  3MGR D;  3WRT A;  4KQQ A;  4J8X C;  3AZF A;  1IKG A;  3KWQ A;  3NQJ A;  3OCN A;  3REJ D;  4DRT A;  3CZD A;  4GZB A;  3HLB A;  2FFY A;  3GRJ A;  1U35 C;  1HQ3 D;  5CPJ A;  1KX4 B;  3MVD B;  5CPI D;  3HUN A;  3V3S A;  5FAT A;  1P3M B;  2P9V B;  1XA1 A;  4DDS A;  2Y2M A;  1FCM A;  2PYO D;  1S0W A;  4J8X D;  5CHL B;  3BFE A;  5BNX B;  4WU8 A;  4ZUX C;  3AV2 A;  4GH9 A;  2XFS A;  4WBG A;  3LEL B;  1P3F A;  3HLE A;  5E2F A;  2GDN A;  4KQO A;  1W7F A;  3MNN D;  2ZM5 A;  3W4P A;  4PM5 A;  4Z2M H;  1NY0 A;  3AZE A;  3IXB A;  4WU9 A;  3LZ1 D;  4OLD A;  4ZAM A;  5GHZ A;  5EOO A;  3B6G D;  4X55 A;  1YU4 A;  4NYU A;  4OQI A;  1HQ3 A;  2CWE A;  2XDM A;  5EVI C;  2JE5 A;  3KUY B;  3G31 A;  3H0M C;  2PYO C;  3IQA A;  1KX5 A;  4KZ9 A;  3A3I A;  4JJN A;  4IBE A;  4QLC C;  4L0L A;  4OKP A;  4P0M A;  5FQQ A;  2HIO D;  4EO5 B;  5CTM A;  5CP6 B;  2ZC5 B;  3UE1 A;  3UTA D;  1P3I B;  3HRE A;  4KZ8 A;  4KZA A;  4H9O A;  3TU4 A;  1U35 A;  4J8U D;  5FDH A;  2NZD D;  4LCM A;  3AZN C;  4Q8I A;  2EX2 A;  5JYP A;  4X69 A;  1YUE A;  1MBL A;  4UA6 A;  2ZY3 A;  3AZH D;  3X1U A;  3AFA C;  4M3K A;  1BH8 A;  1ES2 A;  1JTD A;  1KX3 D;  4E3K A;  4E3L A;  4S2N C;  2Q9M A;  5JYO A;  3UTA C;  4PMA A;  1M19 D;  4NK3 A;  4QU3 A;  3AZJ D;  4J8V D;  3HLG A;  1P3L D;  4OPZ A;  4J8U A;  3ZVW A;  3W96 A;  3ITA A;  3S22 A;  2PYO A;  1BZA A;  3ITB A;  1N4O A;  4LV3 A;  3UPN A;  4DE3 A;  3GMW A;  4NZ5 A;  1SDE A;  4H9S A;  3REI A;  3OPP A;  1TVF A;  5FI6 A;  5KDM B;  1DJC A;  2J7V A;  3UY6 A;  5CP6 D;  4A5R A;  1BUE A;  5KMW A;  3VOZ A;  1QME A;  4Z5T B;  3V9R A;  2ZY4 A;  1S32 D;  5FQI A;  4D2O A;  5KSC A;  3KUY A;  4ZJ1 A;  4OJO A;  4LV1 A;  4CAY B;  3WS5 A;  4FD8 A;  1P3A B;  3W96 D;  1HTA A;  4NE6 A;  3L29 A;  3W4Q A;  1L0D A;  2X01 A;  1RGZ A;  3UPO A;  4WEL A;  4AWL B;  3AZH B;  4WNN A;  3BFD A;  5AVC C;  5AVB A;  2WAE A;  3HSH A;  2XGN A;  2XD1 A;  1SDN A;  4KZ6 A;  4IBG A;  2XLN A;  1M1A A;  4U0X A;  1M19 B;  4GN2 A;  3N8R A;  5EVI D;  3X1V A;  4UA9 A;  4OOY A;  4C3Q A;  1EQZ A;  5FAP A;  5BO0 B;  3HBR A;  1M1A B;  5BNV A;  2CV5 C;  3REJ C;  5AV6 B;  3W98 B;  5GSU C;  3C1B B;  4KGC C;  5G49 A;  5GSU A;  4Z66 A;  1F66 B;  1P3F C;  3AZM D;  5AV8 B;  4IBC A;  4IBR A;  3TSG A;  4XZQ D;  5AV5 C;  5HAP A;  3M2J A;  2JCH A;  4WU9 C;  1K38 A;  4FH4 A;  1O07 A;  2ARO D;  4U3T A;  4KG6 A;  2V20 A;  4IVK A;  3OPH A;  2XK1 A;  1L0E A;  3WKJ D;  1KE0 A;  2Y2G A;  3MGQ A;  2A49 A;  2OLU A;  4XUX A;  3EQU A;  2VQR A;  3LEL C;  1IEL A;  5F1G A;  5AV9 C;  2F8N G;  3LZ1 A;  1XX2 A;  3ZNY A;  4WU9 D;  3MZD A;  3KXB C;  5L2F A;  3R45 A;  5M19 A;  1RGY A;  3ZGA B;  1HQ3 C;  3W96 B;  4Y0U A;  5FQM A;  1ONG A;  3FV7 A;  3AZN A;  4YM6 B;  1L2S A;  3WTP C;  1ERO A;  1KU5 A;  1O7E A;  5B32 A;  5TFQ A;  3AV1 B;  3BEC A;  4LD9 D;  5AV6 D;  3C1B D;  1T3U A;  5CPJ D;  3AZG B;  4IBX A;  1PWG A;  3BFG A;  5CPK A;  1JWV A;  3V50 A;  2FJ7 C;  4IBF A;  4OOM A;  3V5M A;  2H0T A;  3OCL A;  3WTP A;  2J8P A;  4OJ5 A;  3VSK A;  3AZM B;  1K4E A;  4IBJ A;  1BT5 A;  1FSW A;  3WTP D;  3HVF A;  4GD6 A;  5F1F A;  4H9O B;  3AV1 A;  1PIO A;  4H9P A;  3WX7 A;  4B88 A;  3L28 A;  4KZ5 A;  3MXS A;  3BM6 A;  1BSG A;  3VP4 A;  3IF6 C;  2HIO C;  4JXS A;  5GT0 B;  1E3U A;  2WGV A;  3MGS D;  4X68 A;  5AY8 D;  1PZO A;  3N4I A;  5DF9 A;  5FI2 A;  1B67 A;  1FR6 A;  4LV2 A;  3A6N A;  2LY8 A;  5AV5 B;  2WKE A;  3QNB A;  3VOY A;  2R9X A;  4NE5 A;  4KQR A;  3Q7V B;  4R8P B;  5DNM A;  4RA7 A;  4H9Q A;  4EUZ A;  5FUG B;  5DF7 A;  3AZK C;  2IOU A;  4FCF A;  1TEM A;  1YT4 A;  4WZS B;  2HP5 A;  5CTN A;  4F94 A;  4KUD B;  3WA9 D;  1FCO A;  3EQV A;  3KUY C;  1NZO A;  2OLV A;  1PZR A;  2ZLY A;  4BLM A;  5DTK A;  3X1S B;  2Y2K A;  2J9P A;  4NET A;  1ZLA D;  3VH6 A;  5BNV B;  4E3J A;  3KWQ B;  5CER A;  3P5J B;  1PWC A;  2J8Y A;  4J8V A;  1SKF A;  3S4X A;  1K25 A;  4H9Q B;  1NYM A;  3UT9 B;  3UN7 A;  4KZB A;  1AOI B;  3O87 A;  5CED A;  2FJ7 B;  2BLS A;  2Y2L A;  4KGC B;  2X71 A;  1P3P C;  4WM9 A;  4OPR A;  2I72 A;  4HBT A;  3W4O A;  5GLC A;  1DJA A;  2EX9 A;  3PAG A;  3H0R C;  2NZD A;  1JVJ A;  3TU4 D;  5F99 B;  4R8P D;  3WS1 A;  4YIN A;  2G5I C;  3WRZ A;  3REK C;  2JSS A;  3CJM A;  1XPB A;  2CV5 A;  5FQJ A;  2H5S A;  2ZQ8 A;  5GSU D;  2HDQ A;  4WZ5 A;  3MNN C;  4WZ5 C;  3UTB B;  5A92 A;  1NJ4 A;  3KXB D;  5GT3 B;  4BD1 A;  4XZQ C;  3F6T A;  1ULY A;  5B33 A;  5B0Z D;  3SH8 A;  3AZE D;  4MLL A;  4C75 A;  3HLW A;  3WS4 A;  5B1L B;  3WAA B;  3NIA A;  2ZD8 A;  3VH6 W;  1DY6 A;  2ZMA A;  2RIQ A;  3REH D;  2ZQ7 A;  3P98 A;  4G92 C;  1RCJ A;  5B0Z A;  3NQU B;  3PBS A;  2ZC7 A;  1JWZ A;  1H3O B;  3M2K A;  1M1A C;  1H8Y A;  2BYK B;  4KGC D;  3AZM C;  1ES4 A;  3REK A;  5AV8 C;  1ZLA C;  1P3K B;  4N1X A;  1BLS A;  3FKE A;  1LLB A;  3UTB D;  3MGP B;  3BYD A;  3Q81 A;  3EPL A;  4MBF A;  5HAR A;  4LEN A;  2Q9N A;  1YLW A;  3KSY A;  3REL A;  5GSU B;  3W98 C;  5EUA A;  5BNX A;  3G34 A;  2EX6 A;  3B0C T;  4H9R B;  1OME A;  3X1U D;  5AV9 B;  1EQZ B;  5AVB B;  1XGI A;  5GHX A;  1ES3 A;  5FI7 A;  1HD8 A;  4JJN C;  4Y0T A;  3X1T B;  3B0C W;  3QHY A;  4YS3 D;  2J9O A;  2Y2I A;  4WNN B;  3AZI B;  3TU4 C;  1E4D A;  3REH B;  3AN2 A;  1M18 C;  1MWU A;  4KZ7 A;  3M6H A;  5B1L D;  4Z2M G;  3W98 D;  4QHC A;  4GNU A;  2Y2Q A;  1TAF A;  2C5W B;  5B2I A;  5GT0 A;  3AV1 C;  2HPB A;  4NZ1 A;  5DTT A;  1H8Z A;  4JJN D;  4JF6 A;  1TZY A;  2A3U A;  1NRF A;  5GLB A;  1H3O A;  5DNN B;  1TZY D;  4RYE A;  4J8W B;  3ZFZ A;  1J9M A;  3UDF A;  3SH7 A;  2DNS A;  3CG5 A;  3G30 A;  4OP8 A;  5B1L C;  1KDW A;  5JA4 B;  4ZJ3 A;  3C5A A;  2YFV B;  4Z66 C;  1CEF A;  3ISG A;  1W5D A;  1JTG A;  1Z6F A;  3PBR A;  3BFC A;  3IH8 A;  1P3O D;  1P3F D;  2F8N H;  4J8U B;  1YLT A;  1H5X A;  1BH9 A;  3A3D A;  3NDG A;  4OQG A;  1TZY C;  4ZUX B;  4HES A;  5AY8 A;  3W99 B;  4ZTK A;  4DXB A;  5EVI A;  3AYW D;  1M1A D;  5GT3 A;  3X1V C;  5CPI A;  2WGW A;  3NCK A;  4JPM A;  2RVQ D;  3WKJ A;  4R4S A;  1L0G A;  1ID3 A;  3WKJ C;  3I7J A;  1P3O A;  3FKW A;  1LI0 A;  1U35 B;  5HL1 A;  1IYO A;  3ZCZ A;  3AZK B;  1MKI A;  3O62 B;  5AQB A;  3VP2 A;  4E3O A;  1ZKJ A;  1P3L B;  2XFT A;  2IWB A;  3UTB C;  4X53 A;  1S6R A;  4QLC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...