2XD1A

Active site restructuring regulates ligand recognition in class a penicillin-binding proteins
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
489
structure length
469
Chain Sequence
SISEITYSDGTVIASIDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTNQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PENICILLIN-BINDING PROTEIN 1B
publication title Active Site Restructuring Regulates Ligand Recognition in Class a Penicillin-Binding Proteins.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
total genus 145
structure length 469
sequence length 489
chains with identical sequence B
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2xd1A01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2xd1A03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2xd1A02
5EPHA 5EOEA 1DJAA 3TG9A 3HUMA 3IF6A 5J8XA 4RVAA 5FATA 1PWCA 4C3QA 3MFDA 4X56A 5DVAA 1MWTA 4HBTA 1M40A 2IWCA 4N9LA 4WBGA 4FD8A 5GHZA 2Y2IA 4KENB 2ZD8A 3NDGA 1JWVA 3DTMA 4NK3A 2WADA 3HLDA 3I7JA 4QD4A 5AQBA 2XD1A 5EE8A 3CMZA 1E25A 3AGDA 3EQUA 1YLPA 3A3JA 1PYYA 1I2SA 2Y4AA 1PI4A 4ID4A 2Y2QA 3VP2A 4LV1A 4KZBA 1KGEA 1ES3A 2WKEA 2BG1A 4E3MA 4LENA 4EWFA 3MKEA 3IH9A 4UA6A 3NC8A 3NCKA 5L2FA 4YFMA 4FSFA 3MZEA 2V2FF 5GHYA 4DKIA 1J9MA 3HUOA 4JXVA 4CJNA 1YLJA 4JBFA 1GA0A 1DJBA 3Q82A 4QU3A 1K4FA 2Y2GA 4U3TA 1U60A 5AQ7A 3V5MA 2Y2OA 1SHVA 5GHXA 5CGXA 5FQMA 2ZM2A 5A92A 1PZOA 3G34A 3RXWA 1PW8A 4KG2A 5D3OA 1OMEA 5A91A 1ONHA 3PBQA 2EX9A 1O7EA 3VP4A 4S2KA 3VP0A 3ZG0A 1CEGA 2HDUA 4BL3A 3WS4A 2ZQ7A 2Q9NA 3OZHA 4FH2A 1LI0A 3V3RA 4DE2A 3AGFA 1MXOA 1LHYA 4K0WA 4E3JA 5FDHA 3BYDA 1WYBA 4IBRA 4OKPA 5G18A 3WS2A 3B3XA 3P98A 2ZQCA 2ZM0A 4ZJ2A 3ZG9B 4S2LA 3N8SA 4IBXA 4OLGA 1PI5A 4BENA 2EXAA 2GDNA 3BFGA 5FAPA 1NZUA 4X55A 3IWQA 4P87A 5CHJA 5CXWA 5CECA 5I94A 1TDGA 1MWSA 4DE0A 2JBFA 3ISGA 3N7WA 1BT5A 1JTDA 4O7DA 3G32A 1RGYA 1FR1A 5FASA 4OOYA 5U47A 5FAOA 3UN7A 4JLFA 3ZNYA 3SOIA 5F1FA 4C6YA 2WYXA 4KZ8A 2ZQ8A 1W79A 3UPPA 1IEMA 2WZZA 3W4PA 2E8IA 4QHCA 4PPRA 5KZHA 4BQMA 1I5QA 5EVIB 2X71A 3OPLA 5E2EA 3GRJA 3RXXA 3VP1A 1K56A 3ZHHA 3QNCA 4EV4A 4GD6A 1MWUA 4GB7A 4NETA 4PMAA 5E43A 5FQQA 4D2OA 1YLZA 3BFDA 1XKZA 5TGFA 1KE3A 3FYZA 4OPQA 2XH9A 4MBFA 2HP5A 5FI7A 2JE5A 1MBLA 1M6KA 1QMFA 1BLCA 5EVIC 1NJ4A 5CGWA 4DDSA 4DRTA 4DXBA 3M2KA 3FKWA 3LY3A 1XPBA 4P0MA 5TFQA 3DWKA 3PBNA 4S2OA 4DE3A 2ZJ9A 1YMXA 3GQZA 1RCJA 4XXRA 2OLVA 3OC2A 1HVBA 4GOGA 4X6TA 1LLBA 1GA9A 3IXBA 3LY4A 3PAGA 4ZJ1A 5E2FA 2WGVA 4OOMA 1SKFA 2ZC3B 3NI9A 5EVID 3UNWA 3SS5A 1SDEA 2J9OA 2BLSA 4UA9A 1TVFA 4K91A 1W8QA 4LCMA 3WRZA 4U0XA 1L0GA 4JF6A 3ITAA 1L0EA 5EVIA 3WS5A 3HUNA 2OV5A 5HFOA 1WYCA 4X68A 4ZBEA 4B4XA 4DF6A 1IKIA 4WYYA 1PIOA 3N8LA 4FCFA 2R9WA 4QB8A 3WS0A 3ZVTA 4BJPA 1KDWA 3ZNTA 3NY4A 3S4XA 3WWXA 1HD8A 1E3UA 3VOZA 3ZCZA 4KG6A 4N9KA 4ZDXA 1YMSA 4F94A 2PBYA 1GHPA 1HTZA 1SDNA 3Q7ZA 3SS4A 3UDXA 2Y2LA 1ES2A 4OLDA 2Y91A 1ERQA 1ZG4A 4R1GA 4WM9A 3O3VA 3HREA 4OQ0A 3UDIA 1BTLA 1Y54A 1CK3A 5DF7A 2C6WB 3WRTA 1EWZA 2Y2KA 3FZCA 5M1AA 3ZFZA 1ONGA 3W8KA 4N92A 5FA7A 1NZOA 2G2UA 3HLEA 2XF3A 4N1XA 2JC7A 3SH9A 1ES5A 5CGSA 1GHMA 3HLWA 2EX8A 1L2SA 2HP6A 1YLWA 1BUEA 1XP4A 4E6WA 3PBRA 3IF5A 4KZ5A 4R4SA 2A3UA 1NYMA 2J9PA 3ITBA 3TOIA 3V3SA 4S2IA 4B88A 4DDYA 1FSYA 4LCLA 4KZAA 3GVBA 1FOFA 3ZGAB 1XGIA 2R9XA 4Z9QA 4BLMA 4R0QA 1PWDA 5M18A 1ERMA 3NBLA 4JKTA 4MBHA 5EOOA 1KGGA 4PM8A 2X02A 5GLDA 3LEZA 5CERA 1FCNA 2WGIA 1K54A 1L0FA 5A90A 4IVIA 5FSRA 3NDEA 4OVDA 4WEJA 5BOHA 3A3EA 1NY0A 2EX2A 3CG5A 4M3KA 5JYOA 1ZG6A 4EUZA 5FI2A 1XX2A 3E2KA 2XK1A 1CI8A 4E3NA 4E6XA 4JXWA 2P9VA 3UPNA 2Y2MA 3CZDA 4ZJ3A 2I72A 4R3JA 2HDSA 1RP5A 3D4FA 4IEDA 4MEZA 4RX3A 4R3BA 1YT4A 4WZ4A 3VP3A 1H8ZA 2JCHA 1JVJA 3IXGA 3S1YA 4WMCA 3GR2A 2OSUA 5EVLA 2ZC7A 2H0TA 4OQHA 5KSHA 4GZBA 1E4DA 1K6SA 3UE1A 4HBUA 1K55C 4A5RA 3A3DA 2Q9MA 2B5RA 5E2GA 5GLBA 1WE4A 4E3OA 4LV3A 1LL5A 1GHIA 4UAAA 1K38A 1K56D 3SH7A 5IHVA 4EBNA 4JXGA 1LI9A 1PWGA 2QZ6A 4OQIA 3V50A 3ZG8B 3C4PA 4Q8IA 2VGKA 1BLPA 4P6BA 1KVMA 5EUAA 3BECA 5GL9A 3GMWA 1L0DA 2WKHA 1FR6A 3IQAA 4N1HA 2QMIA 3BLSA 5DTTA 1TEMA 2Y59A 4OOLA 3CJMA 2RL3A 3HLBA 1PZPA 3UE0A 1K55A 5HAIA 1Q2PA 2G2WA 3G30A 3ZG5A 2Z2LB 1DJCA 1JTGA 1IYOA 2EFUA 1H5XA 3UO9A 5F1GA 4EQIA 4RX2A 1KGFA 1K6RA 2RCXA 3IHBA 3TSGA 5HAPA 4KZ4A 5TR7A 4GD8A 2PU4A 2WAFA 5FQ9A 2XGNA 3VMAA 2WZXA 1EROA 2WGWA 2P74A 4X69A 3E2LA 5KMWA 3IT9A 3O88A 4OQGA 4S2PA 1JWZA 4H8RA 2Y2HA 4K0XA 5CHMA 2FFYA 3DWZA 2V20A 3G2ZA 1C3BA 3BRMA 2V1ZA 5M19A 3G31A 3DW0A 3Q81A 4IVKA 5GLCA 3MXSA 3Q7VA 4DXCA 2XFTA 2FFFB 4QJGA 4RA7A 3GTCA 3Q07A 1E3UD 3SS3A 1IYPA 4GNUA 4WEKA 2EFXA 3FKVA 3G35A 3IXHA 2ZC6B 3LCEA 3O86A 5DF8A 5CTMA 5DTSA 4KZ7A 4JXSA 1IKGA 2P9VB 1H8YA 3PBTA 1K4EA 5DF9A 1PW1A 5F82A 3VOYA 4MNRA 3UPOA 1K25A 4KQRA 2OLUA 3A3FA 1GCEA 3IH8A 2XR0A 1BSGA 3IWIA 5EECA 1BLSA 1FCOA 5HX9A 3UDFA 1K54C 3VSLA 2ZMAA 4QY5A 4OP8A 3G2YA 4UA7A 5JYPA 1MWRA 1FCMA 2XLNA 3VFHA 3C5AA 3OCNA 4ZTKA 2IWDA 3QHYA 2WKIA 1IYQA 2XDMA 4KG5A 1W8YA 3OPRA 2Y2JA 3AGEA 1AXBA 1IELA 1ESUA 2HDRA 2HP9A 3FWLA 4OONA 3P09A 4U0TA 2A49A 1N9BA 3LO7A 2EX6A 1MY8A 4FH4A 4PM9A 2J8YA 3MZFA 3UE3A 3O87A 1KE0A 2ZQDA 2ZLYA 1RGZA 3MKFA 5CTNA 1W5DA 4MLLA 2UWXA 4L0LA 5CEBA 5CRFA 5DTKA 3HLFA 3V39A 3IHAA 3HL9A 4Y7PA 1O07A 2J7VA 3C7UA 3MBZA 4GN2A 1MKIA 4XUZA 2PU2A 3M6BA 4KQQA 1YM1A 2ZC5B 3IXDA 2DRWA 2ZM8A 3MZDA 4S2JA 4PM5A 1FQGA 3Q1FA 3N4IA 3PTEA 2Z2MB 2WK0A 2H0YA 3BFEA 3BLMA 4OP5A 5FQJA 3FV7A 4OPRA 4WMCD 3WS1A 4ZAMA 4BD1A 2XFSA 3OCLA 3S22A 4OH0A 1BZAA 1YLYA 4JF5A 3PBOA 2IWBA 3N6IA 1NYYA 5F83A 1XA1A 2H5SA 3OPHA 3NIAA 3HLGA 4JPMA 4E3IA 4C75A 5CEDA 5HARA 1CEFA 4Y0UA 3MXRA 5GLAA 1IYSA 4CPKA 3GSGA 3BFFA 3GV9A 4GDNA 1ZC2A 2WGWB 4KZ6A 4S2NC 3C7VA 3W4OA 3PBSA 4YINA 4RYEA 5CHUA 1K57C 2EXBA 1G68A 3BM6A 4UHUA 5HAQA 5KSCA 2Y2PA 2DNSA 1N4OA 4HESA 1BLHA 4LV2A 5FQIA 4E3KA 1KVLA 4KZ3A 3ZG7B 3RJUA 3VSKA 3ZDJA 1KE4A 3Q7VB 2HPBA 2DCFA 4GKUA 1EI5A 3BEBA 5FAQA 4OPYA 3UY6A 1ESIA 4R4RA 1XGJA 4S2MA 2ZC4B 1W7FA 2VGJA 1G6AA 4OPZA 4P85A 4PM6A 1MPLA 1Q2QA 2Y2NA 3A3IA 3ZVWA 3PAEA 3JYIA 1FSWA 4BD0A 3IF6B 4S2NA 5AQAA 1Z6FA 4R23A 2C5WB 2WAEA 2ZQ9A 3EQVA 4EBPA 5HW3A 1K57A 1KDSA 5E2HA 4E3LA 3M2JA 5A93A 5FQKA 2WUQA 1VM1A 3N8RA 4DE1A 1XA7A 2XQZA 4LV0A 1ALQA 2ZQAA 4WELA 4WZ5C 4KQOA 1I2WA 4X53A 3W4QA 4BL2A 4MBKA 1NRFA 1S6RA 3HLCA 5AQ9A 2X01A 1DY6A 4GDBA 1XXMA 1ZKJA 1BULA 3IWOA 3IF6C 3C4OA 1YQSA 3G4PA 4XUXA 1VQQA 1TDLA 4Y0TA 3SH8A 4PM7A 2HDQA 1LL9A 1ES4A 1CI9A 1NXYA 3HBRA 4KZ9A 4HEFA 2CC1A 3M6HA 1YLTA 2Y55A 1HZOA 2XD5A 3BFCA 3HVFA 5HL1A 2XEPA 4JF4A 1QMEA 5FI6A 1S0WA 4WZ5A 3QNBA 1JWPA 4B4ZA 4EBLA 2QPNA 1SCWA 3VFFA 3OPPA 4Y0OA 2H10A 4QY6A
chains in the Genus database with same CATH superfamily
3L27A 2EWWA 1DJAA 5AVBB 3HUMA 4KQDA 3IF6A 1W63M 5J8XA 1H3OA 1P3GA 4HBTA 4KENB 3IBRA 1JWVA 5AQBA 3HLDA 2JKRI 5B0ZA 1E25A 1TS6A 2Y4AA 1PI4A 1E6PA 3TU4D 4E44A 3NC8A 1BH9A 5L2FA 4FSFA 3H0LC 2V2FF 5E5AB 4DKIA 1F2KA 5B33B 3X1TB 1ID3D 3UT9C 3LI9A 1WWSA 3W99C 4U3TA 5AQ7A 3V5MA 2Y2OA 1SHVA 5GHXA 5CGXA 3W98C 5FUGA 4J8VD 5D3OA 3PBQA 4ZBJC 4JGQA 3MVDB 1P3BB 3B0DC 4DN0A 3WS4A 2ZQ7A 1IOUA 3S7PA 4KUDD 3V3RA 2W1TA 1P3FC 3AGFA 4II7A 2VV7A 3MGPD 1LHYA 2W3HA 4K0WA 4LLOB 3AYWD 2J3TC 3C38A 5FDHA 3UT9A 4XZQB 2NQBD 5EV0A 2VX8A 3W98A 3N8SA 4PKYA 4BENA 3BFGA 3UB6A 2Q0OA 1VHMA 5CHJA 3H7WB 3ISGA 3F1OA 3KS8A 1KX5D 1L6JA 4ZUXC 3AFAD 3G32A 5FASA 4HIAA 3B6FA 3MJQA 3EOIA 2K7SA 1W79A 5EM1A 1IEMA 3W4PA 4LD9B 5AV6C 4WLAA 2P7JA 4J8WB 3WKJB 4NE5A 5B2ID 3PR6A 2GX5A 1GXDA 3OPLA 4EESA 3GRJA 4HMDA 5B32B 1K56A 3ZHHA 3QNCA 4J8XC 4ZUXA 1MWUA 4BBTA 1LT0A 4PMAA 3BQ8A 2O9BA 1Y4OA 3MQQA 3UB8A 1ZLAD 2W27A 3AZGD 1QMFA 4UQIM 5EVIC 5CGWA 4DDSA 2V5OA 3M2KA 3FKWA 3O62A 5EVEA 3VH5A 3DWKA 4HP4A 1YMXA 1RCJA 5AV5D 3B0BA 2P04A 4J8XA 3AZEB 4YS3B 3PYPA 5CPKB 3L9KA 4Q0HA 4OOMA 1F66A 2F2AC 1STZA 4UA9A 1TVFA 4JGRA 4LCMA 2GJ3A 4U0XA 4IBDA 5EVIA 3W97B 3IS2A 3AZJA 2ZY4A 5B1LC 1IKIA 4WYYA 5HD3A 2R9WA 2Z6DA 4BJPA 2VEAA 1U35A 3NY4A 3QP6A 4P6ZS 1E3UA 4NZ1A 2B95A 3UTBD 3A1IA 3E4QA 2Y2LA 4CAYA 1ZG4A 4WM9A 3UDIA 3O3VA 3HREA 2F8NG 4OQ0A 4R3AA 3X1SD 1Y54A 3T4SA 3MSHA 2VLGA 3WRTA 1EWZA 3FZCA 2E8JA 5CP6C 1TD5A 5BPVA 1S1YA 4JGPA 4EUVA 4NXEA 3REHC 3MGQC 5CPIC 4N92A 3A6NB 3BQAA 1NZOA 2G2UA 5B1LA 5GT0B 3LELB 3HLWA 1GSVA 1BUEA 1XP4A 4I3JA 4MN5A 1P3PC 5HDDA 1NYMA 3BY9A 5B32G 4ETZA 3CAXA 3GVBA 3LIDA 1FOFA 3A0VA 5GT3C 3NBLA 5EOOA 3WA9C 4Q0IA 5GLDA 3LEZA 2K2NA 4QLCC 3REHA 3MGQA 1K54A 5CPIA 5CHLB 4WEJA 5AVCC 3X1VC 4Y5FA 1XX2A 4B9OA 4E6XA 5B33D 5B1MB 1P3PA 4Z2JA 3D4FA 5L09A 3AZMB 2QJ7A 2VZWA 3DAVA 2DMWA 2VV8A 1X0OA 3G6OA 3MGSB 4R3BA 3VP3A 2W1RA 3C1BC 5GT3A 4G92C 4WMCA 3WA9A 3GR2A 4LPZA 1PRQA 4QLCA 2A2LA 3LZ1B 2JHEA 4GZBA 3L7HA 4A5RA 5AVCA 3X1VA 1P3IB 3C30A 2FJ7D 5BT1C 1KX4B 1K38A 3HJKA 3SH7A 3MXQA 5IHVA 3E4PA 2QZ6A 3ZG8B 3C4PA 2VGKA 4RQ9A 3BECA 5GL9A 2XRNA 1OTDA 2QYBA 3WD1A 3R45B 1M18D 3BLSA 2PAVP 4YWZA 3CJMA 3HLBA 1Q2PA 2F8ND 1IYOA 3AZHB 4EEPA 1H5XA 5GSUC 1KGFA 1M19C 5HAPA 4KZ4A 2PU4A 5FQ9A 4H9SC 4P6ZM 4EEUA 2P74A 3IT9A 4OQGA 4S2PA 3REIA 5CHMA 3V67A 5G49B 2L1MA 2ZY5A 2V20A 3G2ZA 3BRMA 5B32D 5M19A 1ODVA 3G31A 3KX0X 3HCYA 4DXCA 4QJGA 2INWA 4RA7A 2OWJA 2YKHA 3GTCA 1IYPA 3KUYD 1H0GA 4GNUA 2PYOC 5GSUA 1M19A 4UUZB 3AZFC 1T19A 5DF8A 4NYYA 4H9SA 5CTMA 3S7OA 2PYRA 3D9YA 3ZYTA 3RELC 3X1UB 1IKGA 1K4EA 3FPVA 4KUKA 1HQ3B 4MNRA 3VOYA 1K25A 3EPKA 3AZED 2PDRA 1W1PA 4OP8A 1P97A 1G5UA 2ZMVA 1TAFA 2F8NH 3NQJA 5AVBC 2PYOA 2WKIA 4KG5A 1W8YA 3AZFA 2Y2JA 1P3MB 1PDCA 5B40B 1IELA 1KOUA 4GHLA 1VEUB 4OONA 3L26A 3UE3A 1T1CA 3MZFA 3B6GB 3WTPD 3AN2D 4HJ4A 3LJAA 1W5DA 5B0YC 3LZ0B 3AV1C 4KUOA 3HL9A 1E6ZA 4Y7PA 4GN2A 5AVBA 4EO5B 1MKIA 3EGDC 5E5AC 2ZC5B 3MZDA 4Z1WA 3N4IA 3X1TC 3H0RC 2Z2MB 4HY8A 5DFYA 3LELD 4BD1A 4J8UB 2XFSA 2HIOC 4XUJD 1N9LA 1YLYA 5JRGB 4L9EA 2IWBA 4NXBA 5F83A 4E3IA 3NIAA 1OTEA 3TJZC 2NZDC 5B0YA 4CSRB 3AV1A 3GV9A 1F9IA 4GDNA 4KZ6A 3W4OA 3PBSA 2AROC 4YINA 1O6IA 4Z2HA 4E3KA 5E5AA 4Z5TD 3AZKD 1JFIB 1EQZC 4HI4A 3VSKA 3X1TA 1F1EA 3KWQB 3T4LA 2IOUA 2G5IC 3W96D 4XZQC 4R4RA 2HIOA 5B1MD 1P3AD 3EPHA 2ZC4B 4OPZA 1G6AA 3BY8A 5AY8B 3PHYA 4R8PB 2Y2NA 3ZVWA 1KX3D 3MVDA 3MGRB 1AIWA 3JYIA 4OUIA 4BD0A 3F1NB 1J3WA 1KDSA 4OJ6A 3M2JA 1S32B 1XA7A 4LV0A 4WELA 1EQZA 2L5AA 4X1LA 3QP2A 3UTAD 3TRCA 3HLCA 1S6RA 4XZQA 3QP4A 2X01A 4D60A 2O0YA 2O9CA 1BULA 5F68A 3G4PA 1YQSA 3N3FA 5CPJD 1T1AA 3WKJC 3C1CB 2HDQA 4AFIA 3P5JB 1ES4A 1CI9A 3A0RA 3REKC 1NXYA 4KZ9A 4CLCC 4HEFA 3REJD 2IA2A 1YLTA 3TU4B 1DP9A 1HZOA 5AV8D 3BFCA 3TW8A 1E15A 1S0WA 1JWPA 4EBLA 4L9FA 5HPFA 4LG2A 1ID3B 2H10A 4G91B 4R38A 5EOEA 5DNND 4RVAA 4LD9A 5FATA 1PWCA 4C3QA 4J8VB 4J8WA 3WKJA 1FILA 5TJJA 2IWCA 5HPIA 5AV9D 5GXQD 1YAXA 3NDGA 3KYZA 5DJUA 4YS3C 2XD1A 1K0KA 3CMZA 3AGDA 5FEGA 1Q9CA 4Z2KA 1PYYA 3MGPB 3VH6W 1SZVA 2Y2QA 3AYWB 3VP2A 4AWLB 1AOIC 2OWHA 2W3EA 4KZBA 5B31G 4LENA 2NQBB 3NCKA 4YFMA 3NOTC 1J9MA 3WX7A 2D49A 3L25A 1PZRA 3DBAA 5BS7A 4JBFA 1K4FA 2RVQC 1YSPA 4GS9B 5FQMA 4YS3A 3G34A 3T1XA 1KX5B 1HQ3D 3AFAB 2NUPC 1ONHA 5CPKA 2EX9A 3F1PB 3AZIC 2PRFA 3TE8A 3VP0A 3ZG0A 3W97A 3A6NC 4IBCA 2Q9NA 3OZHA 4FH2A 3W99D 3LFVA 4DE2A 4DRAA 4H9OA 4E3JA 3BYDA 4WZSB 1WYBA 5B2IB 4IBRA 4OKPA 4NE3A 3B3XA 4ZJ2A 1LSXA 1QO6A 4OLGA 4GH9A 1WWIA 1PI5A 1S4RA 1P34D 2GDNA 1UR9A 3RH8B 3AZIA 3E98A 2Y8HA 4X55A 5CECA 5CXWA 1TDGA 1P3FD 4DE0A 3BJNA 1ZLAB 3N7WA 2M7VA 4O7DA 3A6NA 5GT0A 3IP4C 4IBFA 3AL0C 1NRJA 3A0SA 3SOIA 1B67A 4JJNC 5F1FA 3FC7A 1H8MA 5AV5B 2ZQ8A 4R70A 3WAAC 3UPPA 4HNBA 3AZMC 4H9RB 4QHCA 2YFWB 5DFXA 2X71A 5E2EA 2DF4C 2UV0E 2BYMA 4EV4A 3EWKA 3LZ1C 4NETA 5E43A 5FQQA 1YLZA 3BFDA 3QP1A 2ZY2A 2CV5C 1KE3A 5AV6D 1P3GC 2XH9A 1KX4C 2HP5A 4I3IA 2JE5A 5FI7A 5B31D 1M6KA 1ACFA 3WAAA 3D3OA 3AZMA 4DRTA 3UTBB 3AZNC 2XA7M 4HH3A 2G5HC 4P0MA 5B0ZC 3PBNA 4R8PD 3WD2A 5HWWA 3X1SB 3MQLA 2OLVA 2ZY3A 1HVBA 3LZ1A 1GA9A 2BASA 1F98A 3LY4A 3P7NA 1S32D 4EBPA 5EVID 2VQRA 4EQ1A 2CV5A 5AJGA 3AZHC 1SDEA 2J9OA 1KX4A 3GDIA 1LL8A 1OJGA 3QP8A 4JF6A 3ITAA 1L0EA 3HUNA 3AZLD 3AZNA 4ZBEA 3KXBD 1PIOA 3HSHA 3WS0A 1KDWA 3ZNTA 3C1CD 2RTSA 3S4XA 3R45A 2O9AA 4N9KA 2PBYA 5L10A 2WKPA 1HTZA 3UDXA 4OLDA 3WD4A 2C6WB 3AZHA 5M1AA 3ZFZA 2I9VA 3KSHA 1ONGA 4BMWA 3H9WA 4MN6A 4N1XA 1GHMA 2D02A 3PBRA 3CI6A 4E45A 2A3UA 3LIAA 4R6LA 3TOIA 2VV6A 4S2IA 5CP6D 4BWIA 1FSYA 4KZAA 3EPJA 4BLMA 1XGIA 2R9XA 4Z9QA 4R0QA 1PWDA 4H9NA 3VV4A 1M1AC 1LSWA 2X02A 2RIQA 3P01A 3B6FC 5CERA 2FJ7B 2WGIA 4IVIA 4UUZA 3NDEA 5FSRA 1P3MC 4Z66D 2VGLS 2HF6A 4EUZA 5FI2A 3E2KA 2XK1A 2IO5C 4E3NA 4JXWA 1D06A 3UPNA 3X1UA 3CZDA 5HDSA 4ZJ3A 3A1KA 1M18B 1RP5A 2M1CA 1P0ZA 4RX3A 1YT4A 4WZ4A 1H8ZA 4PHTA 3LZ0C 1JVJA 3IXGA 5G4ZA 2F8NB 1ZHHB 1M1AA 5LBRA 2OSUA 3LUQA 1G28A 5EVLA 2H0TA 3UB9A 1TZYC 1P3MA 2Z6CA 5B40A 1NWZA 2Q9MA 5GLBA 5E2GA 1YUEA 4LV3A 1DP8A 3ZQ5A 3O62C 3MNNC 1Z09A 5JRGC 3C1BD 3B6GA 3MF0A 1PWGA 3V50A 3V9RA 4H6JA 5HZHA 1BLPA 2ZBBA 3LZ0A 1XJ4A 3IQAA 1A7WA 3ULFA 3E0YA 1GOIA 1F66C 3KUYB 5TBMB 4H9QB 4NZ3A 1TZYA 1PZPA 5BT1D 2HZ5A 2YKFA 4WF0A 2G2WA 3ZG5A 2Z2LB 3KWQC 1JTGA 2EFUA 2KOIA 3AZJC 3B33A 4J8UA 3UO9A 3MNNA 5JRGA 1U35C 4EQIA 4RX2A 1BH8B 1SKOB 5AY8C 2RCXA 5HL6A 4GD8A 3VMAA 2WZXA 3MGRC 4HGAB 3E2LA 5KMWA 3O88A 2JKRM 4H8RA 2FFYA 3CUEC 1JFIA 3Q81A 1W2EA 3KSIA 3NECA 3KWQA 1H0MA 3Q07A 2ZOIA 3SS3A 1P3LD 3SW1A 5AY8A 3T1SA 3WTPB 4O8GA 3AN2B 2L4RA 1XJ2A 3T1RA 1H0IA 3MGRA 1D1JA 5DTSA 4JXSA 3F1NA 1H8YA 3PBTA 2ACGA 4DRBA 2CMNA 2OLUA 3CUEA 1BSGA 3IWIA 5K5BA 1FCOA 5HX9A 2R78A 1K54C 3VSLA 4QY5A 2B18A 1FCMA 4X23D 3C5AA 5C3IB 1S66L 4XUJB 4KGCD 2IWDA 3OCNA 1GPFA 4ZTKA 2VGLM 3RELD 3EEAA 4GLQA 3AGEA 3FWLA 4U0TA 2M7UA 2A49A 1N9BA 4FH4A 4PM9A 2K31A 1T18A 3O87A 2JKTI 1RGZA 4KUDC 4Z5TB 5CTNA 3AZKB 2UWXA 4WU9D 5DTKA 3V39A 3AYWC 5J7EA 3W96B 3C7UA 2NQBC 4NKPA 1P3AB 3O5YA 4KQQA 4S2JA 4J8VA 2ZM8A 4PM5A 5F99B 1FQGA 1NLYA 3Q1FA 3PTEA 5FQJA 2H0YA 3BFEA 4HJ3A 3WS1A 4GHIA 1KX3B 4OPRA 1PFLA 4Z2MG 1S67L 4Y15A 5B0YD 1NYYA 3OPHA 3AFAC 4JPMA 1UGUA 4QPRA 4KUDA 1CEFA 3MXRA 5BNXB 1IYSA 3GSGA 3AYWA 2WGWB 4S2NC 1YU1A 1UWNX 1D7EA 2WKQA 3UTAB 4RYEA 3LIBA 2EXBA 5CHUA 3BM6A 4UHUA 2NQBA 5HAQA 1BLHA 4IUKA 3IX4A 3VH5W 2HIOD 5CPJB 3L29A 5DNMB 3Q7VB 4GKUA 5B2IC 5FAQA 4OPYA 2NZDD 1XGJA 4XT2B 3REJB 2A24B 4GS9A 4P85A 2YFVA 1KX5A 5AV8B 4YM6D 3AFAA 2AROD 3REIC 4DQYB 1Q2QA 3F1PA 4BBUA 3T4JA 2KX6A 1FSWA 1F5MA 3IF6B 4S2NA 5AQAA 4R23A 3EQVA 3AZGC 4NEED 3KSFA 5DNNB 2W8SA 4KQOA 3W4QA 4BL2A 4WU8C 5B2IA 5AV9B 3WD3A 5GXQB 5AQ9A 5AV5C 1DY6A 2LB5A 1P3KD 1XXMA 3IWOA 3NOPC 4LRXC 4IBGA 3C4OA 1TDLA 4IJGA 4HMEA 1ZLAA 3VH5T 3AZGA 2Y55A 2XD5A 2HGVA 2W3GA 3CWFA 5HL1A 4JF4A 5IU1A 1QMEA 5FI6A 1VETB 4ZRRA 3KSGA 1P3OD 3LR4A 4WU8A 4F3LA 2H28A 5B24D 5BO0B 5EPHA 5AV5A 2JSSA 4H9RA 3UTBC 1CXWA 3REKD 4CLCD 1Z2CB 2YFWA 3HJIA 5DVAA 4ESPA 2EA9A 1MWTA 2HUEC 4FD8A 2Y2IA 5GHZA 4MB3A 3LJAC 4NK3A 2W1TB 2WADA 3I7JA 4QD4A 5EE8A 4M4XA 1XJ6A 3UT9B 3EQUA 3W99B 3HONA 1XFNA 1I2SA 3NQUB 4Q0JA 1GSWA 4LV1A 4E3MA 4EU0A 4KHAB 3MKEA 4UA6A 3UTBA 5GHYA 3S7QA 2BYKB 3HUOA 1P34B 3B0DB 4JXVA 4WNNB 3X1SA 1BFMA 1YLJA 1DJBA 2Y2GA 2PR5A 2OAQ1 1U60A 1P3FB 3M7PA 1PZOA 3RXWA 1AOID 4E04A 5DKKA 5A91A 1O7EA 3VP4A 1W1TA 5B33C 1CEGA 1P9WA 3AV2D 4L9GA 4NY2A 2RVQD 1MXOA 5KIZA 5DKLA 1H3QA 1UR8A 5HD5A 3AZID 3FKEA 3MVDC 3P98A 5G18A 2ZM0A 1P3BC 4IBXA 4Z2MH 5FAPA 1NZUA 2JKGA 5I94A 4P87A 2HV1A 5B33A 3LR0A 1EAKA 5AV6B 2JBFA 1BT5A 5B31B 5U47A 5FAOA 3UN7A 4JLFA 3MQ0A 3ZNYA 5F99D 5F5YA 5L8MA 1M18C 4WUJA 1P3BA 2WZZA 1CQAA 4PPRA 1I5QA 5EVIB 3LICA 1H8PA 3VP1A 2FJ7A 2OAP1 4JJND 3AZLB 4D2OA 4WN5A 1E6NA 3KXBB 4GW9A 4LD9C 3FYZA 5DNMD 4OPQA 3NOUC 4J8WC 4MBFA 1MBLA 1M18A 1BLCA 4LRZE 3RTYA 1NJ4A 4DXBA 5B32C 3H7WA 3LY3A 4QWOA 1XFQA 2PBDP 4DE3A 5B2JD 2F8NA 2ZJ9A 5EFWA 3GQZA 2EWVA 5A8BA 4GOGA 4X6TA 4TX8A 1P3GD 3C2WA 3IXBA 3JVUA 4FOFA 4ZJ1A 4B88A 5E2FA 1SKFA 3NI9A 2BLSA 4UEYA 1TS7A 1W8QA 3KFUG 5B0ZD 2J80A 2V0WA 1L0GA 5BS7C 5HFOA 4DF6A 4B4XA 5B32A 3N8LA 2W0NA 2B02A 3AZEC 4LFUA 5CP6B 4QB8A 4HGAC 3ZVTA 2XSSA 5HWTA 5CPKC 3WWXA 1HD8A 3VOZA 3KUYA 1LSVA 5TBMA 5F69A 4NFTA 1YMSA 4H9QA 1SDNA 1GHPA 3SS4A 1G6OA 2G7UA 1ES2A 1EW0A 2Y91A 4R1GA 3SZTA 3W97C 3DTKA 4Z66B 3EGXC 1V9ZA 2Y2KA 2QJ5A 3W8KA 1SKOA 3WTPC 3HLEA 5GT3B 3AN2C 3WA9B 3SH9A 3AZEA 5CGSA 2EX8A 1L2SA 2HP6A 2KLIA 1YLWA 2L0WA 4E6WA 4R4SA 2J9PA 5KDMB 2V8CA 3V3SA 2ZL1B 4LCLA 4I38A 3UT9D 2D01A 1ERMA 4JKTA 4MBHA 3R7WB 5GT0C 3LELC 4NE6A 5C3IC 3W98D 1FCNA 3C1BB 1N9OA 3WTPA 4G92B 3AN2A 4OVDA 4CQHA 5JA4B 5BOHA 3A3EA 2EX2A 3CG5A 5JYOA 1ZG6A 3DTIA 2O99A 1CI8A 3VH6T 3NHQA 2I72A 4R3JA 2HDSA 4IEDA 2JCHA 3B6FD 3ICYA 2J3TD 3VE3A 1P9RA 3W2ZA 4NZ4A 3T50A 3LELA 1DP6A 1OJ5A 4H9PB 4XUJA 2VJWA 5B1MC 1P3AC 4HHDA 5KSHA 1K6SA 4BBVA 1K55C 3A3DA 5FDSA 2B5RA 4E3OA 3MGSC 1GHIA 2NUTC 1K56D 1XJ3A 1J7MA 4ZUXD 4EBNA 4JXGA 1CJFA 4OQIA 3MFXA 4IBIA 5EUAA 3GMWA 1DRMA 2WKHA 3W96A 4N1HA 5DTTA 1P3IC 2Y59A 5B1MA 1P3AA 4OOLA 1P3LB 2LY8A 2RL3A 3O62D 3UE0A 1K55A 5HAIA 3G30A 1KX3A 1DJCA 4X1MA 3MGSA 4J8XD 4OJPA 4JGOA 3REJC 5F1GA 3B47A 5TR7A 4ME4A 2WAFA 2W3FA 1F66D 3NQJB 3FG8A 2AVXA 5BNXA 3WTPE 4HMCA 3T4OA 2PYOB 2WGWA 2FH5A 2Y2HA 4X23B 1P3IA 4K0XA 3PXPA 2MJ6A 3DWZA 3AZJD 5EM0A 4KGCB 2V1ZA 5IS1A 5CPJA 3RELB 1U35D 4IBBA 3Q7VA 2XFTA 3LIEA 1MKMA 5GXQC 1E3UD 4MB4A 3K3DA 4XT2A 3REJA 3DTEA 3FKVA 3G35A 3LCEA 3O86A 4Y17A 4WU9B 2P9VB 4K08A 2Y79A 4UQIS 5DF9A 1PW1A 5F82A 1N9NA 3A3FA 5DNNA 5B1LD 2XR0A 1BLSA 5FEFA 3B0CW 2ZMAA 4UA7A 5AV9A 1MWRA 3OLOA 5GXQA 2XLNA 4HQAA 3VFHA 3QHYA 5B0YB 3X1UC 3AV1B 4QNLA 1IYQA 1S1ZA 1HQ3C 5G49A 1ESUA 2HDRA 5HDCA 1HLUP 3U4LP 3P09A 3LO7A 2EX6A 1MY8A 3REHD 3MGQD 5CPID 3VE4A 1VETA 4MLLA 4L0LA 2HIOB 1P3PD 5BO0A 5B40C 2FN2A 1O07A 3MBZA 1MZUA 3LGOA 2NZDB 1YU0A 4XUZA 2HJ9C 2DRWA 1HQ3A 1P34C 4YM6B 3B6GC 2AROB 2V0UA 4OP5A 5GT3D 1CF0A 3BLMA 4LGWA 2PR6A 4WMCD 3WA9D 3KS4A 4QLCD 1BYWA 1EQZB 4DMZA 4JF5A 3PBOA 3N6IA 3B0CT 3UE6A 1XA1A 2H5SA 3HLGA 4EO5C 5AVCD 3X1VD 3W99A 3L2AA 4C75A 3NQUA 4Y0UA 3BFFA 1L3LA 5CX7A 3C7VA 4KHAA 4FTXA 1K57C 5KSCA 5G4YA 1VEUA 2Y2PA 1N4OA 4HESA 1P3KB 1ZTUA 4J8UC 2BYKA 4KZ3A 2P08A 1P34A 2V1BA 3RJUA 3ZG7B 4GHAA 4WNNA 2HPBA 2DCFA 2ZOHA 4WL9A 3LEQA 1P3FA 4S2MA 5L07A 1YPRA 4I3AA 2JN7A 3PAEA 3OBFA 3KYEA 1P3OB 2BTFP 2J3WA 2WAEA 5HW3A 5B24B 2F8NK 1K57A 5E2HA 5B31C 1YU2A 5A93A 5FQKA 4MMNA 3N8RA 4Y2FA 2XQZA 1ALQA 3REKB 2ZQAA 4CLCB 4WZ5C 4X53A 3T4QA 4MBKA 4R8PC 3REID 5AVFA 4CSRA 4XUXA 1VQQA 2PHYA 3SH8A 4PM7A 4M6BA 1S32C 1WA9A 3CLOA 3HBRA 4HH2A 5AV6A 3UB5P 3UB7A 3M6HA 5GSUD 2KDKA 5B31A 1M19D 2XEPA 4WU8D 3AZLC 3MMHA 3KXBC 1ED7A 3QNBA 4WZ5A 1SCWA 2JKFA 3OPPA 4Y0OA 4R8PA 4QY6A 3C1CC 2OOLA 3TG9A 1VB6A 2VKSA 3IX3A 3TU4C 3MFDA 4X56A 1AOIB 1M40A 1S32A 4N9LA 4WBGA 2ZD8A 3H82B 4EXOA 2PYOD 3DTMA 3RFBA 3AV2B 1ID3C 4H9OB 4G91C 3AZFD 2CWEA 3AZLA 3KXBA 1YLPA 3A3JA 1TS8A 4ID4A 5J3WA 4J8VC 4NYUA 3C1CA 1ES3A 1KGEA 2BG1A 2WKEA 4EWFA 3IH9A 3F6TA 3AZIB 3LJAD 3MZEA 3TU4A 4OJ5A 4ARZB 3T1QB 3CPTB 4CJNA 3LR3A 1GA0A 3Q82A 4QU3A 5AVBD 5FL3A 3MGPC 5A92A 2ZM2A 1ID3A 4AWLC 2J8PA 3FPWA 1PW8A 4KG2A 1OMEA 1TF1A 2LB9A 1OTIA 4Z66C 4S2KA 2HDUA 1CK7A 4BL3A 4Z2LA 4NG2A 5BNVB 1YU3A 1LI0A 1T1BA 2XROA 4Y13A 5CP6A 3AV1D 4FUWA 2BYMB 1KX5C 3WS2A 3MGPA 3FDDA 2ZQCA 3ZG9B 3MS6A 4S2LA 5E5AD 3L28A 4JJNB 1AWIA 3KYQA 2EXAA 3X1TD 4DJ2A 4Z66A 3KSYA 3WAAB 3IWQA 2W3DA 1MWSA 4B93A 1N1JB 1JTDA 1RGYA 1FR1A 3EEHA 4OOYA 3MVDD 1R4VA 1P3BD 4NXGA 4C6YA 2WYXA 5B2JB 4G3WA 4KZ8A 1E8BA 3LYXA 4WV4B 5KDMA 2E8IA 2CV5B 1EQZD 2ZL1A 1ZLAC 1S4SA 1H3OB 3LIFA 1P3GB 5KZHA 4BQMA 3R7WA 4XZQD 3AZNB 3RXXA 4GD6A 3C1BA 5B0ZB 4GB7A 5JA4A 1XKZA 5TGFA 2FZ0A 1KS0A 1YKDA 1BH9B 4Z2GA 3BW6A 1GSXA 1XPBA 5TFQA 1E6RA 4S2OA 1NLZA 4XXRA 1E88A 3C8CA 4H9PA 2VK3A 3OC2A 4PAUA 4LD9D 1P3LC 3U2AA 5FUGB 1LLBA 4J8WD 3WKJD 5I5LA 4IBJA 3PAGA 2WGVA 3EG5B 3UNWA 2ZC3B 3SS5A 3EPLA 3GECA 4K91A 3WRZA 5DJTA 3X1SC 3WS5A 2OV5A 1WYCA 3IBJA 1OT6A 4X68A 4H9NB 4FCFA 4IHQA 4ETXA 3ZCZA 4X23C 2JKTM 4KG6A 4ZDXA 4F94A 2QHKA 1P3LA 3W98B 4KGCC 4IBKA 3Q7ZA 2V8FA 1ERQA 3BWLA 1BTLA 4ZBJB 1CK3A 5DF7A 1PNEA 4YS3D 3F1OB 5FA7A 2XF3A 5CPKD 2JC7A 1ES5A 1M1AB 3B6FB 4WU9C 5HSQA 4X23A 3IF5A 3W97D 3E4OA 4KZ5A 1TS0A 4KGCA 5HWVA 3ITBA 2IO5B 3KO6A 3RELA 4DDYA 4IJEA 3ZGAB 5M18A 1KGGA 4PM8A 3V9RB 4IUHA 4H6JB 2PD8A 4O0PA 1L0FA 5A90A 4ZUXB 1NY0A 4M3KA 3S7NA 4WU9A 2P9VA 2Y2MA 3VH6A 3CHWP 3LI8A 1TZYB 3NULA 3A6ND 4MB5A 4MEZA 5GT0D 2FJ7C 3O62B 3MNNB 3S1YA 4YOFA 1W1YA 4DJ3A 2ZC7A 4J8XB 4OQHA 1E4DA 3UE1A 4YM6C 4HBUA 3WD0A 3IX8A 1F66B 1WE4A 1LL5A 4UAAA 3MR0A 4MDZA 1LI9A 3IS2B 4Q8IA 3AZJB 4G3VA 2PT7A 4P6BA 1Y28A 1KVMA 4PKYG 1U35B 4HJ6A 1L0DA 1FR6A 3T12B 3UMEA 5IT5A 4Z2IA 2QMIA 3WAAD 3R4KA 1TEMA 3AZMD 2NZDA 4MN7A 1P3KC 1KU5A 3MGSD 4G3KA 1A0KA 4YM6A 2AROA 4CAYB 2V9AA 3CITA 2PD7A 3LZ1D 1K6RA 5C5KA 3IHBA 4O01A 3TSGA 5B1LB 3KUYC 4Y3IA 4EETB 1P3ID 2XGNA 1UWPX 2CV5D 1P3OC 1EROA 4X69A 1KX4D 5B24C 1JWZA 4NXFA 4I39A 1P3KA 3AZND 1C3BA 3OOVA 4I5SA 1OTAA 4IVKA 3DW0A 5GLCA 3MXSA 5AVEA 2FFFB 3H0MC 1B6WA 4OJOA 4WEKA 3NJAA 2EFXA 3REHB 3MGQB 1OGGA 1OGBA 5CPIB 4MCWA 3IXHA 2ZC6B 4GCZA 3AZHD 4KZ7A 1P3OA 1IFQA 5B24A 1P3PB 2QKPA 3UPOA 4KQRA 2XA7S 1GCEA 3IH8A 4GHIB 5EECA 3REKA 4CLCA 1OT9A 3UDFA 1W63Q 1BH8A 1HTAA 3G2YA 5JYPA 1T3UA 4KUDB 4QLCB 4OJLA 2XDMA 3OPRA 4HP9A 1AXBA 5AVCB 3X1VB 1YU4A 4EERA 2HP9A 2ZMFA 3UMDA 2J8YA 4IJFA 3AV2C 3JVVA 1KE0A 2ZQDA 2ZLYA 4GJ4A 3MKFA 4XUJC 5CEBA 5CRFA 1YSQA 3HLFA 3X1UD 2GNXA 3IHAA 2V1AA 2YFVB 2J7VA 1V9YA 2PU2A 3M6BA 5F6AA 5MC7A 1YM1A 3IXDA 1AOIA 3VOLA 2WK0A 3FV7A 3H82A 1M1AD 4Z5TC 4ZAMA 3AZKC 3B42A 3OCLA 3S22A 3AV2A 1BZAA 4OH0A 1P3MD 5B40D 3W96C 1OTBA 5CEDA 4EW7A 5HARA 1ULYA 2DQNC 2VA0A 5GLAA 4CPKA 2GZAA 2ZM5A 1ZC2A 5F99C 3B6GD 3REIB 1FIKA 1G68A 2PYPA 1KX3C 3K2NA 2DNSA 3T4KA 4LV2A 3JPUA 5FQIA 4ARZA 1KVLA 4WJ3C 3LZ0D 3LR5A 3ZDJA 1KE4A 3CPTA 3AZGB 4CLCE 1EI5A 3BEBA 4Z5TA 3AZKA 3UY6A 1ESIA 3K3CA 1W7FA 2VGJA 4X25A 5GSUB 1JNUA 1TZYD 1M19B 3UTAC 4YNRA 4PM6A 4WU8B 4F3LB 1MPLA 4IBEA 3A3IA 4LRYC 4HOIA 4J8UD 3MNND 5CPJC 5F99A 1Z6FA 2C5WB 5DNMC 2QWSA 2ZQ9A 5JRGD 4E3LA 3QP5A 2WUQA 1VM1A 5BNVA 4DE1A 4UPKA 1I2WA 5AV8C 5J4EA 5B2JC 1W1VA 1NRFA 1TAFB 4GDBA 1ZKJA 2HJEA 3IF6C 4JJNA 3UTAA 4Y0TA 3AZFB 1LL9A 3KWQD 5DNNC 3T4TA 5DNMA 2CC1A 1OPXA 1N1JA 3HVFA 5AV9C 5AY8D 1MC0A 2WKRA 3D72A 2HUEB 3LJAB 4NZ5A 2A24A 4B4ZA 3MGRD 2QPNA 3VFFA 5AV8A 3MQOA 5B2JA
chains in the Genus database with same CATH topology
3L27A 1DJAA 5AVBB 3HUMA 3IF6A 5J8XA 1H3OA 1P3GA 4HBTA 4KENB 1JWVA 5AQBA 3HLDA 5B0ZA 1E25A 2Y4AA 1PI4A 3TU4D 4E44A 3NC8A 1BH9A 5L2FA 4FSFA 3H0LC 2V2FF 5E5AB 4DKIA 5B33B 3X1TB 1ID3D 3UT9C 1WWSA 3W99C 4U3TA 5AQ7A 3V5MA 2Y2OA 1SHVA 5GHXA 5CGXA 3W98C 5FUGA 4J8VD 5D3OA 3PBQA 4ZBJC 3MVDB 1P3BB 3B0DC 3WS4A 2ZQ7A 4KUDD 3V3RA 1P3FC 3AGFA 3MGPD 1LHYA 4K0WA 3AYWD 5FDHA 3UT9A 4XZQB 2NQBD 3W98A 3N8SA 4BENA 3BFGA 5CHJA 3ISGA 3KS8A 1KX5D 4ZUXC 3AFAD 3G32A 5FASA 3B6FA 1W79A 1IEMA 3W4PA 4LD9B 5AV6C 4J8WB 3WKJB 4NE5A 5B2ID 3OPLA 3GRJA 5B32B 1K56A 3ZHHA 3QNCA 4J8XC 4ZUXA 1MWUA 4PMAA 1ZLAD 3AZGD 1QMFA 5EVIC 5CGWA 4DDSA 3M2KA 3FKWA 3O62A 3VH5A 3DWKA 1YMXA 1RCJA 5AV5D 3B0BA 4J8XA 3AZEB 4YS3B 5CPKB 4OOMA 1F66A 2F2AC 4UA9A 1TVFA 4LCMA 4U0XA 4IBDA 5EVIA 3W97B 3AZJA 2ZY4A 5B1LC 1IKIA 4WYYA 2R9WA 4BJPA 1U35A 3NY4A 1E3UA 4NZ1A 3UTBD 3A1IA 2Y2LA 4CAYA 1ZG4A 4WM9A 3UDIA 3O3VA 3HREA 2F8NG 4OQ0A 3X1SD 1Y54A 3WRTA 1EWZA 3FZCA 5CP6C 5BPVA 3REHC 3MGQC 5CPIC 4N92A 3A6NB 1NZOA 2G2UA 5B1LA 5GT0B 3LELB 3HLWA 1BUEA 1XP4A 1P3PC 1NYMA 5B32G 3GVBA 1FOFA 5GT3C 3NBLA 5EOOA 3WA9C 5GLDA 3LEZA 4QLCC 3REHA 3MGQA 1K54A 5CPIA 5CHLB 4WEJA 5AVCC 3X1VC 1XX2A 4E6XA 5B33D 5B1MB 1P3PA 3D4FA 3AZMB 4R3BA 3VP3A 3MGSB 3C1BC 5GT3A 4G92C 4WMCA 3WA9A 3GR2A 4QLCA 3LZ1B 4GZBA 4A5RA 5AVCA 3X1VA 1P3IB 2FJ7D 5BT1C 1KX4B 1K38A 3SH7A 5IHVA 2QZ6A 3ZG8B 3C4PA 2VGKA 3BECA 5GL9A 3R45B 1M18D 3BLSA 3CJMA 3HLBA 1Q2PA 2F8ND 1IYOA 3AZHB 1H5XA 5GSUC 1KGFA 1M19C 5HAPA 4KZ4A 2PU4A 5FQ9A 4H9SC 2P74A 3IT9A 4OQGA 4S2PA 3REIA 5CHMA 5G49B 2ZY5A 2V20A 3G2ZA 3BRMA 5B32D 5M19A 3G31A 4DXCA 4QJGA 4RA7A 3GTCA 1IYPA 3KUYD 4GNUA 2PYOC 5GSUA 1M19A 4UUZB 3AZFC 5DF8A 4NYYA 4H9SA 5CTMA 3RELC 3X1UB 1IKGA 1K4EA 3VOYA 1HQ3B 4MNRA 1K25A 3EPKA 3AZED 4OP8A 1TAFA 2F8NH 3NQJA 5AVBC 2PYOA 2WKIA 4KG5A 1W8YA 3AZFA 2Y2JA 1P3MB 5B40B 1IELA 4GHLA 4OONA 3L26A 3UE3A 3MZFA 3B6GB 3WTPD 3AN2D 3LJAA 1W5DA 5B0YC 3LZ0B 3AV1C 3HL9A 4Y7PA 4GN2A 5AVBA 4EO5B 1MKIA 5E5AC 2ZC5B 3MZDA 3N4IA 3X1TC 3H0RC 2Z2MB 3LELD 4BD1A 4J8UB 2XFSA 2HIOC 4XUJD 1YLYA 5JRGB 2IWBA 5F83A 4E3IA 3NIAA 2NZDC 5B0YA 4CSRB 3AV1A 3GV9A 4GDNA 4KZ6A 3W4OA 3PBSA 2AROC 4YINA 4E3KA 5E5AA 4Z5TD 3AZKD 1JFIB 1EQZC 3VSKA 3X1TA 1F1EA 3KWQB 2IOUA 2G5IC 3W96D 4XZQC 4R4RA 2HIOA 5B1MD 1P3AD 3EPHA 2ZC4B 4OPZA 1G6AA 5AY8B 4R8PB 2Y2NA 3ZVWA 1KX3D 3MVDA 3MGRB 3JYIA 4OUIA 4BD0A 1KDSA 4OJ6A 3M2JA 1S32B 1XA7A 4LV0A 4WELA 1EQZA 2L5AA 3UTAD 3HLCA 1S6RA 4XZQA 2X01A 1BULA 3G4PA 1YQSA 3N3FA 5CPJD 3WKJC 3C1CB 2HDQA 3P5JB 1ES4A 1CI9A 3REKC 1NXYA 4KZ9A 4HEFA 3REJD 1YLTA 3TU4B 1HZOA 5AV8D 3BFCA 1S0WA 1JWPA 4EBLA 4LG2A 2H10A 1ID3B 4G91B 5EOEA 5DNND 4RVAA 4LD9A 5FATA 1PWCA 4C3QA 4J8VB 4J8WA 3WKJA 2IWCA 5AV9D 5GXQD 3NDGA 4YS3C 2XD1A 3CMZA 3AGDA 1Q9CA 1PYYA 3MGPB 3VH6W 2Y2QA 3AYWB 3VP2A 4AWLB 1AOIC 4KZBA 5B31G 4LENA 2NQBB 3NCKA 4YFMA 1J9MA 3WX7A 3L25A 1PZRA 5BS7A 4JBFA 1K4FA 2RVQC 5FQMA 4YS3A 3G34A 1KX5B 1HQ3D 3AFAB 1ONHA 5CPKA 2EX9A 3AZIC 3VP0A 3ZG0A 3W97A 3A6NC 4IBCA 2Q9NA 3OZHA 4FH2A 3W99D 4DE2A 4DRAA 4H9OA 4E3JA 3BYDA 4WZSB 1WYBA 5B2IB 4IBRA 4OKPA 4NE3A 3B3XA 4ZJ2A 4OLGA 4GH9A 1WWIA 1PI5A 1P34D 2GDNA 3AZIA 4X55A 5CECA 5CXWA 1TDGA 1P3FD 4DE0A 1ZLAB 3N7WA 4O7DA 3A6NA 5GT0A 3IP4C 4IBFA 3AL0C 3SOIA 1B67A 4JJNC 5F1FA 5AV5B 2ZQ8A 3WAAC 3UPPA 3AZMC 4H9RB 4QHCA 2YFWB 2X71A 5E2EA 2DF4C 2BYMA 4EV4A 3LZ1C 4NETA 5E43A 5FQQA 1YLZA 3BFDA 2ZY2A 2CV5C 1KE3A 5AV6D 1P3GC 2XH9A 1KX4C 2HP5A 5FI7A 2JE5A 5B31D 1M6KA 3WAAA 3AZMA 4DRTA 3UTBB 3AZNC 2G5HC 4P0MA 5B0ZC 3PBNA 4R8PD 3X1SB 2OLVA 2ZY3A 1HVBA 3LZ1A 1GA9A 3LY4A 1S32D 4EBPA 5EVID 2VQRA 2CV5A 3AZHC 1SDEA 2J9OA 1KX4A 4JF6A 3ITAA 1L0EA 3HUNA 3AZLD 3AZNA 4ZBEA 3KXBD 1PIOA 3HSHA 3WS0A 1KDWA 3ZNTA 3C1CD 3S4XA 3R45A 4N9KA 2PBYA 1HTZA 3UDXA 4OLDA 2C6WB 3AZHA 5M1AA 3ZFZA 1ONGA 4N1XA 1GHMA 3PBRA 4E45A 2A3UA 3TOIA 4S2IA 5CP6D 1FSYA 4KZAA 3EPJA 4BLMA 1XGIA 2R9XA 4Z9QA 4R0QA 1PWDA 4H9NA 1M1AC 2X02A 2RIQA 3B6FC 5CERA 2FJ7B 2WGIA 4IVIA 4UUZA 3NDEA 5FSRA 1P3MC 4Z66D 4EUZA 5FI2A 3E2KA 2XK1A 2IO5C 4E3NA 4JXWA 3UPNA 3X1UA 3CZDA 4ZJ3A 3A1KA 1M18B 1RP5A 4RX3A 1YT4A 4WZ4A 1H8ZA 3LZ0C 1JVJA 3IXGA 2F8NB 1M1AA 2OSUA 5EVLA 2H0TA 1TZYC 1P3MA 5B40A 2Q9MA 5GLBA 5E2GA 1YUEA 4LV3A 3O62C 3MNNC 5JRGC 3C1BD 3B6GA 1PWGA 3V50A 3V9RA 1BLPA 3LZ0A 3IQAA 1A7WA 1F66C 3KUYB 4H9QB 4NZ3A 1TZYA 1PZPA 5BT1D 2G2WA 3ZG5A 2Z2LB 3KWQC 1JTGA 2EFUA 3AZJC 4J8UA 3UO9A 3MNNA 5JRGA 1U35C 4EQIA 4RX2A 1BH8B 5AY8C 2RCXA 4GD8A 3VMAA 2WZXA 3MGRC 4HGAB 3E2LA 5KMWA 3O88A 4H8RA 2FFYA 1JFIA 3Q81A 1W2EA 3KWQA 3Q07A 3SS3A 1P3LD 5AY8A 3WTPB 3AN2B 3MGRA 5DTSA 4JXSA 1H8YA 3PBTA 2OLUA 4DRBA 1BSGA 3IWIA 1FCOA 5HX9A 1K54C 3VSLA 4QY5A 1FCMA 4X23D 3C5AA 5C3IB 4XUJB 4KGCD 2IWDA 3OCNA 4ZTKA 3RELD 3AGEA 3FWLA 4U0TA 2A49A 1N9BA 4FH4A 4PM9A 3O87A 1RGZA 4KUDC 4Z5TB 5CTNA 3AZKB 2UWXA 4WU9D 5DTKA 3V39A 3AYWC 3W96B 3C7UA 2NQBC 1P3AB 4KQQA 4S2JA 4J8VA 2ZM8A 4PM5A 5F99B 1FQGA 3Q1FA 3PTEA 5FQJA 2H0YA 3BFEA 3WS1A 1KX3B 4OPRA 4Z2MG 5B0YD 1NYYA 3OPHA 3AFAC 4JPMA 4KUDA 1CEFA 3MXRA 5BNXB 1IYSA 3GSGA 3AYWA 2WGWB 4S2NC 1YU1A 4RYEA 3UTAB 5CHUA 2EXBA 3BM6A 4UHUA 2NQBA 5HAQA 1BLHA 3VH5W 2HIOD 5CPJB 3L29A 5DNMB 3Q7VB 4GKUA 5B2IC 5FAQA 4OPYA 2NZDD 1XGJA 3REJB 4P85A 2YFVA 1KX5A 5AV8B 4YM6D 3AFAA 2AROD 3REIC 4DQYB 1Q2QA 1FSWA 3IF6B 4S2NA 5AQAA 4R23A 3EQVA 3AZGC 5DNNB 2W8SA 4KQOA 3W4QA 4BL2A 4WU8C 5B2IA 5AV9B 5GXQB 5AQ9A 5AV5C 1DY6A 1P3KD 1XXMA 3IWOA 4IBGA 3C4OA 1TDLA 1ZLAA 3VH5T 3AZGA 2Y55A 2XD5A 5HL1A 4JF4A 1QMEA 5FI6A 1P3OD 4WU8A 5B24D 5BO0B 5EPHA 5AV5A 2JSSA 4H9RA 3UTBC 3REKD 1Z2CB 2YFWA 5DVAA 1MWTA 2HUEC 4FD8A 2Y2IA 5GHZA 3LJAC 4NK3A 2WADA 3I7JA 4QD4A 5EE8A 3UT9B 3EQUA 3W99B 3HONA 1I2SA 3NQUB 4LV1A 4E3MA 4KHAB 3MKEA 4UA6A 3UTBA 5GHYA 2BYKB 3HUOA 1P34B 3B0DB 4JXVA 4WNNB 3X1SA 1BFMA 1YLJA 1DJBA 2Y2GA 1U60A 1P3FB 1PZOA 3RXWA 1AOID 5A91A 1O7EA 3VP4A 5B33C 1CEGA 3AV2D 4NY2A 2RVQD 1MXOA 3AZID 3FKEA 3MVDC 3P98A 5G18A 2ZM0A 1P3BC 4IBXA 4Z2MH 5FAPA 1NZUA 5I94A 4P87A 5B33A 5AV6B 2JBFA 1BT5A 5B31B 5U47A 5FAOA 3UN7A 4JLFA 3ZNYA 5F99D 1M18C 1P3BA 2WZZA 4PPRA 1I5QA 5EVIB 3VP1A 2FJ7A 4JJND 3AZLB 4D2OA 3KXBB 4LD9C 3FYZA 5DNMD 4OPQA 4MBFA 4J8WC 1MBLA 1M18A 1BLCA 1NJ4A 4DXBA 5B32C 3LY3A 4DE3A 5B2JD 2F8NA 2ZJ9A 3GQZA 4GOGA 4X6TA 1P3GD 3IXBA 4ZJ1A 4B88A 5E2FA 1SKFA 3NI9A 2BLSA 1W8QA 3KFUG 5B0ZD 1L0GA 5BS7C 5HFOA 4DF6A 4B4XA 5B32A 3N8LA 3AZEC 5CP6B 4QB8A 4HGAC 3ZVTA 5CPKC 3WWXA 1HD8A 3VOZA 3KUYA 4NFTA 1YMSA 4H9QA 1GHPA 1SDNA 3SS4A 1ES2A 2Y91A 4R1GA 3W97C 4Z66B 2Y2KA 3W8KA 3WTPC 3HLEA 5GT3B 3AN2C 3WA9B 3SH9A 3AZEA 5CGSA 2EX8A 1L2SA 2HP6A 1YLWA 4E6WA 4R4SA 2J9PA 5KDMB 3V3SA 4LCLA 3UT9D 1ERMA 4JKTA 4MBHA 5GT0C 3LELC 4NE6A 5C3IC 3W98D 1FCNA 3C1BB 3WTPA 4G92B 3AN2A 4OVDA 5JA4B 5BOHA 3A3EA 2EX2A 3CG5A 5JYOA 1ZG6A 1CI8A 3VH6T 2I72A 4R3JA 2HDSA 4IEDA 2JCHA 3B6FD 4NZ4A 3LELA 4H9PB 4XUJA 5B1MC 1P3AC 5KSHA 1K6SA 1K55C 3A3DA 2B5RA 4E3OA 3MGSC 1GHIA 1K56D 4ZUXD 4EBNA 4JXGA 4OQIA 4IBIA 5EUAA 3GMWA 2WKHA 3W96A 4N1HA 5DTTA 1P3IC 2Y59A 5B1MA 1P3AA 4OOLA 1P3LB 2LY8A 2RL3A 3O62D 3UE0A 1K55A 5HAIA 3G30A 1KX3A 1DJCA 3MGSA 4J8XD 4OJPA 3REJC 5F1GA 5TR7A 2WAFA 1F66D 3NQJB 5BNXA 3WTPE 2PYOB 2WGWA 2Y2HA 4X23B 1P3IA 4K0XA 3DWZA 3AZJD 4KGCB 2V1ZA 5CPJA 3RELB 1U35D 4IBBA 3Q7VA 2XFTA 5GXQC 1E3UD 3REJA 3FKVA 3G35A 3LCEA 3O86A 4WU9B 2P9VB 5DF9A 1PW1A 5F82A 3A3FA 5DNNA 5B1LD 2XR0A 1BLSA 3B0CW 2ZMAA 4UA7A 5AV9A 1MWRA 5GXQA 2XLNA 3VFHA 3QHYA 5B0YB 3X1UC 3AV1B 4QNLA 1IYQA 1HQ3C 5G49A 1ESUA 2HDRA 3P09A 3LO7A 2EX6A 1MY8A 3REHD 3MGQD 5CPID 4MLLA 4L0LA 2HIOB 1P3PD 5BO0A 5B40C 1O07A 3MBZA 4XUZA 2NZDB 1YU0A 2DRWA 1HQ3A 1P34C 4YM6B 3B6GC 2AROB 4OP5A 5GT3D 3BLMA 4WMCD 3WA9D 3KS4A 4QLCD 1EQZB 4JF5A 3PBOA 3N6IA 3B0CT 1XA1A 2H5SA 3HLGA 4EO5C 5AVCD 3X1VD 3W99A 3L2AA 4C75A 3NQUA 4Y0UA 3BFFA 3C7VA 4KHAA 1K57C 5KSCA 2Y2PA 1N4OA 4HESA 1P3KB 4J8UC 2BYKA 4KZ3A 1P34A 3ZG7B 3RJUA 4GHAA 4WNNA 2HPBA 2DCFA 1P3FA 4S2MA 3PAEA 1P3OB 2WAEA 5HW3A 5B24B 2F8NK 1K57A 5E2HA 5B31C 1YU2A 5A93A 5FQKA 3N8RA 2XQZA 1ALQA 3REKB 2ZQAA 4WZ5C 4X53A 4MBKA 4R8PC 3REID 4CSRA 4XUXA 1VQQA 3SH8A 4PM7A 4M6BA 1S32C 3HBRA 5AV6A 3M6HA 5GSUD 5B31A 1M19D 2XEPA 4WU8D 3AZLC 3KXBC 4WZ5A 3QNBA 1SCWA 3OPPA 4Y0OA 4R8PA 4QY6A 3C1CC 3TG9A 3TU4C 3MFDA 4X56A 1AOIB 1M40A 1S32A 4N9LA 4WBGA 2ZD8A 2PYOD 3DTMA 3AV2B 1ID3C 4H9OB 4G91C 3AZFD 2CWEA 3AZLA 3KXBA 1YLPA 3A3JA 4ID4A 4J8VC 4NYUA 3C1CA 1ES3A 1KGEA 2BG1A 2WKEA 4EWFA 3IH9A 3F6TA 3AZIB 3LJAD 3MZEA 3TU4A 4OJ5A 4CJNA 1GA0A 3Q82A 4QU3A 5AVBD 3MGPC 5A92A 2ZM2A 1ID3A 4AWLC 2J8PA 1PW8A 4KG2A 1OMEA 4Z66C 4S2KA 2HDUA 4BL3A 5BNVB 1YU3A 1LI0A 5CP6A 3AV1D 2BYMB 1KX5C 3WS2A 3MGPA 3FDDA 2ZQCA 3ZG9B 4S2LA 5E5AD 3L28A 4JJNB 2EXAA 3X1TD 4Z66A 3KSYA 3WAAB 3IWQA 1MWSA 1N1JB 1JTDA 1RGYA 1FR1A 4OOYA 3MVDD 1R4VA 1P3BD 4C6YA 2WYXA 5B2JB 4KZ8A 4WV4B 5KDMA 2E8IA 2CV5B 1EQZD 1ZLAC 1H3OB 1P3GB 5KZHA 4BQMA 4XZQD 3AZNB 3RXXA 4GD6A 3C1BA 5B0ZB 4GB7A 5JA4A 1XKZA 5TGFA 1BH9B 1XPBA 5TFQA 4S2OA 4XXRA 4H9PA 3OC2A 4LD9D 1P3LC 5FUGB 1LLBA 4J8WD 3WKJD 4IBJA 3PAGA 2WGVA 3EG5B 3UNWA 2ZC3B 3SS5A 3EPLA 4K91A 3WRZA 3X1SC 3WS5A 2OV5A 1WYCA 4X68A 4H9NB 4FCFA 3ZCZA 4X23C 4KG6A 4ZDXA 4F94A 1P3LA 3W98B 4KGCC 4IBKA 3Q7ZA 1ERQA 1BTLA 4ZBJB 1CK3A 5DF7A 4YS3D 5FA7A 2XF3A 5CPKD 2JC7A 1ES5A 1M1AB 3B6FB 4WU9C 4X23A 3IF5A 3W97D 4KZ5A 4KGCA 3ITBA 2IO5B 3RELA 4DDYA 4IJEA 3ZGAB 5M18A 1KGGA 4PM8A 3V9RB 1L0FA 5A90A 4ZUXB 1NY0A 4M3KA 4WU9A 2P9VA 2Y2MA 3VH6A 1TZYB 3A6ND 4MEZA 5GT0D 2FJ7C 3O62B 3MNNB 3S1YA 2ZC7A 4J8XB 4OQHA 1E4DA 3UE1A 4YM6C 4HBUA 1F66B 1WE4A 1LL5A 4UAAA 1LI9A 4Q8IA 3AZJB 4P6BA 1KVMA 1U35B 1L0DA 1FR6A 2QMIA 3WAAD 1TEMA 3AZMD 2NZDA 1P3KC 1KU5A 3MGSD 4YM6A 2AROA 4CAYB 3LZ1D 1K6RA 3IHBA 3TSGA 5B1LB 3KUYC 2XGNA 1P3ID 2CV5D 1P3OC 1EROA 4X69A 1KX4D 5B24C 1JWZA 1P3KA 3AZND 1C3BA 4IVKA 3DW0A 5GLCA 3MXSA 2FFFB 3H0MC 1B6WA 4OJOA 4WEKA 2EFXA 3REHB 3MGQB 5CPIB 3IXHA 2ZC6B 3AZHD 4KZ7A 1P3OA 5B24A 1P3PB 3UPOA 4KQRA 1GCEA 3IH8A 5EECA 3REKA 3UDFA 1BH8A 1HTAA 3G2YA 5JYPA 1T3UA 4KUDB 4QLCB 4OJLA 2XDMA 3OPRA 1AXBA 5AVCB 3X1VB 1YU4A 2HP9A 2J8YA 4IJFA 3AV2C 1KE0A 2ZQDA 2ZLYA 3MKFA 4XUJC 5CEBA 5CRFA 3HLFA 3X1UD 3IHAA 2YFVB 2J7VA 2PU2A 3M6BA 1YM1A 3IXDA 1AOIA 2WK0A 3FV7A 1M1AD 4Z5TC 4ZAMA 3AZKC 3OCLA 3S22A 3AV2A 1BZAA 4OH0A 1P3MD 5B40D 3W96C 5CEDA 5HARA 1ULYA 2DQNC 5GLAA 4CPKA 2ZM5A 1ZC2A 5F99C 3B6GD 3REIB 1G68A 1KX3C 2DNSA 4LV2A 5FQIA 1KVLA 4WJ3C 3LZ0D 3ZDJA 1KE4A 3AZGB 1EI5A 3BEBA 4Z5TA 3AZKA 3UY6A 1ESIA 1W7FA 2VGJA 5GSUB 1TZYD 1M19B 3UTAC 4PM6A 4WU8B 1MPLA 4IBEA 3A3IA 4J8UD 3MNND 5CPJC 5F99A 1Z6FA 2C5WB 5DNMC 2ZQ9A 5JRGD 4E3LA 2WUQA 1VM1A 5BNVA 4DE1A 4UPKA 1I2WA 5AV8C 5B2JC 1NRFA 1TAFB 4GDBA 1ZKJA 3IF6C 4JJNA 3UTAA 4Y0TA 3AZFB 1LL9A 3KWQD 5DNNC 5DNMA 2CC1A 1N1JA 3HVFA 5AV9C 5AY8D 2HUEB 3LJAB 4NZ5A 4B4ZA 3MGRD 2QPNA 3VFFA 5AV8A 5B2JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EPH A;  5EOE A;  1DJA A;  3TG9 A;  3HUM A;  3IF6 A;  5J8X A;  4RVA A;  5FAT A;  1PWC A;  4C3Q A;  3MFD A;  4X56 A;  5DVA A;  1MWT A;  4HBT A;  1M40 A;  2IWC A;  4N9L A;  4WBG A;  4FD8 A;  5GHZ A;  2Y2I A;  4KEN B;  2ZD8 A;  3NDG A;  1JWV A;  3DTM A;  4NK3 A;  2WAD A;  3HLD A;  3I7J A;  4QD4 A;  5AQB A;  2XD1 A;  5EE8 A;  3CMZ A;  1E25 A;  3AGD A;  3EQU A;  1YLP A;  3A3J A;  1PYY A;  1I2S A;  2Y4A A;  1PI4 A;  4ID4 A;  2Y2Q A;  3VP2 A;  4LV1 A;  4KZB A;  1KGE A;  1ES3 A;  2WKE A;  2BG1 A;  4E3M A;  4LEN A;  4EWF A;  3MKE A;  3IH9 A;  4UA6 A;  3NC8 A;  3NCK A;  5L2F A;  4YFM A;  4FSF A;  3MZE A;  2V2F F;  5GHY A;  4DKI A;  1J9M A;  3HUO A;  4JXV A;  4CJN A;  1YLJ A;  4JBF A;  1GA0 A;  1DJB A;  3Q82 A;  4QU3 A;  1K4F A;  2Y2G A;  4U3T A;  1U60 A;  5AQ7 A;  3V5M A;  2Y2O A;  1SHV A;  5GHX A;  5CGX A;  5FQM A;  2ZM2 A;  5A92 A;  1PZO A;  3G34 A;  3RXW A;  1PW8 A;  4KG2 A;  5D3O A;  1OME A;  5A91 A;  1ONH A;  3PBQ A;  2EX9 A;  1O7E A;  3VP4 A;  4S2K A;  3VP0 A;  3ZG0 A;  1CEG A;  2HDU A;  4BL3 A;  3WS4 A;  2ZQ7 A;  2Q9N A;  3OZH A;  4FH2 A;  1LI0 A;  3V3R A;  4DE2 A;  3AGF A;  1MXO A;  1LHY A;  4K0W A;  4E3J A;  5FDH A;  3BYD A;  1WYB A;  4IBR A;  4OKP A;  5G18 A;  3WS2 A;  3B3X A;  3P98 A;  2ZQC A;  2ZM0 A;  4ZJ2 A;  3ZG9 B;  4S2L A;  3N8S A;  4IBX A;  4OLG A;  1PI5 A;  4BEN A;  2EXA A;  2GDN A;  3BFG A;  5FAP A;  1NZU A;  4X55 A;  3IWQ A;  4P87 A;  5CHJ A;  5CXW A;  5CEC A;  5I94 A;  1TDG A;  1MWS A;  4DE0 A;  2JBF A;  3ISG A;  3N7W A;  1BT5 A;  1JTD A;  4O7D A;  3G32 A;  1RGY A;  1FR1 A;  5FAS A;  4OOY A;  5U47 A;  5FAO A;  3UN7 A;  4JLF A;  3ZNY A;  3SOI A;  5F1F A;  4C6Y A;  2WYX A;  4KZ8 A;  2ZQ8 A;  1W79 A;  3UPP A;  1IEM A;  2WZZ A;  3W4P A;  2E8I A;  4QHC A;  4PPR A;  5KZH A;  4BQM A;  1I5Q A;  5EVI B;  2X71 A;  3OPL A;  5E2E A;  3GRJ A;  3RXX A;  3VP1 A;  1K56 A;  3ZHH A;  3QNC A;  4EV4 A;  4GD6 A;  1MWU A;  4GB7 A;  4NET A;  4PMA A;  5E43 A;  5FQQ A;  4D2O A;  1YLZ A;  3BFD A;  1XKZ A;  5TGF A;  1KE3 A;  3FYZ A;  4OPQ A;  2XH9 A;  4MBF A;  2HP5 A;  5FI7 A;  2JE5 A;  1MBL A;  1M6K A;  1QMF A;  1BLC A;  5EVI C;  1NJ4 A;  5CGW A;  4DDS A;  4DRT A;  4DXB A;  3M2K A;  3FKW A;  3LY3 A;  1XPB A;  4P0M A;  5TFQ A;  3DWK A;  3PBN A;  4S2O A;  4DE3 A;  2ZJ9 A;  1YMX A;  3GQZ A;  1RCJ A;  4XXR A;  2OLV A;  3OC2 A;  1HVB A;  4GOG A;  4X6T A;  1LLB A;  1GA9 A;  3IXB A;  3LY4 A;  3PAG A;  4ZJ1 A;  5E2F A;  2WGV A;  4OOM A;  1SKF A;  2ZC3 B;  3NI9 A;  5EVI D;  3UNW A;  3SS5 A;  1SDE A;  2J9O A;  2BLS A;  4UA9 A;  1TVF A;  4K91 A;  1W8Q A;  4LCM A;  3WRZ A;  4U0X A;  1L0G A;  4JF6 A;  3ITA A;  1L0E A;  5EVI A;  3WS5 A;  3HUN A;  2OV5 A;  5HFO A;  1WYC A;  4X68 A;  4ZBE A;  4B4X A;  4DF6 A;  1IKI A;  4WYY A;  1PIO A;  3N8L A;  4FCF A;  2R9W A;  4QB8 A;  3WS0 A;  3ZVT A;  4BJP A;  1KDW A;  3ZNT A;  3NY4 A;  3S4X A;  3WWX A;  1HD8 A;  1E3U A;  3VOZ A;  3ZCZ A;  4KG6 A;  4N9K A;  4ZDX A;  1YMS A;  4F94 A;  2PBY A;  1GHP A;  1HTZ A;  1SDN A;  3Q7Z A;  3SS4 A;  3UDX A;  2Y2L A;  1ES2 A;  4OLD A;  2Y91 A;  1ERQ A;  1ZG4 A;  4R1G A;  4WM9 A;  3O3V A;  3HRE A;  4OQ0 A;  3UDI A;  1BTL A;  1Y54 A;  1CK3 A;  5DF7 A;  2C6W B;  3WRT A;  1EWZ A;  2Y2K A;  3FZC A;  5M1A A;  3ZFZ A;  1ONG A;  3W8K A;  4N92 A;  5FA7 A;  1NZO A;  2G2U A;  3HLE A;  2XF3 A;  4N1X A;  2JC7 A;  3SH9 A;  1ES5 A;  5CGS A;  1GHM A;  3HLW A;  2EX8 A;  1L2S A;  2HP6 A;  1YLW A;  1BUE A;  1XP4 A;  4E6W A;  3PBR A;  3IF5 A;  4KZ5 A;  4R4S A;  2A3U A;  1NYM A;  2J9P A;  3ITB A;  3TOI A;  3V3S A;  4S2I A;  4B88 A;  4DDY A;  1FSY A;  4LCL A;  4KZA A;  3GVB A;  1FOF A;  3ZGA B;  1XGI A;  2R9X A;  4Z9Q A;  4BLM A;  4R0Q A;  1PWD A;  5M18 A;  1ERM A;  3NBL A;  4JKT A;  4MBH A;  5EOO A;  1KGG A;  4PM8 A;  2X02 A;  5GLD A;  3LEZ A;  5CER A;  1FCN A;  2WGI A;  1K54 A;  1L0F A;  5A90 A;  4IVI A;  5FSR A;  3NDE A;  4OVD A;  4WEJ A;  5BOH A;  3A3E A;  1NY0 A;  2EX2 A;  3CG5 A;  4M3K A;  5JYO A;  1ZG6 A;  4EUZ A;  5FI2 A;  1XX2 A;  3E2K A;  2XK1 A;  1CI8 A;  4E3N A;  4E6X A;  4JXW A;  2P9V A;  3UPN A;  2Y2M A;  3CZD A;  4ZJ3 A;  2I72 A;  4R3J A;  2HDS A;  1RP5 A;  3D4F A;  4IED A;  4MEZ A;  4RX3 A;  4R3B A;  1YT4 A;  4WZ4 A;  3VP3 A;  1H8Z A;  2JCH A;  1JVJ A;  3IXG A;  3S1Y A;  4WMC A;  3GR2 A;  2OSU A;  5EVL A;  2ZC7 A;  2H0T A;  4OQH A;  5KSH A;  4GZB A;  1E4D A;  1K6S A;  3UE1 A;  4HBU A;  1K55 C;  4A5R A;  3A3D A;  2Q9M A;  2B5R A;  5E2G A;  5GLB A;  1WE4 A;  4E3O A;  4LV3 A;  1LL5 A;  1GHI A;  4UAA A;  1K38 A;  1K56 D;  3SH7 A;  5IHV A;  4EBN A;  4JXG A;  1LI9 A;  1PWG A;  2QZ6 A;  4OQI A;  3V50 A;  3ZG8 B;  3C4P A;  4Q8I A;  2VGK A;  1BLP A;  4P6B A;  1KVM A;  5EUA A;  3BEC A;  5GL9 A;  3GMW A;  1L0D A;  2WKH A;  1FR6 A;  3IQA A;  4N1H A;  2QMI A;  3BLS A;  5DTT A;  1TEM A;  2Y59 A;  4OOL A;  3CJM A;  2RL3 A;  3HLB A;  1PZP A;  3UE0 A;  1K55 A;  5HAI A;  1Q2P A;  2G2W A;  3G30 A;  3ZG5 A;  2Z2L B;  1DJC A;  1JTG A;  1IYO A;  2EFU A;  1H5X A;  3UO9 A;  5F1G A;  4EQI A;  4RX2 A;  1KGF A;  1K6R A;  2RCX A;  3IHB A;  3TSG A;  5HAP A;  4KZ4 A;  5TR7 A;  4GD8 A;  2PU4 A;  2WAF A;  5FQ9 A;  2XGN A;  3VMA A;  2WZX A;  1ERO A;  2WGW A;  2P74 A;  4X69 A;  3E2L A;  5KMW A;  3IT9 A;  3O88 A;  4OQG A;  4S2P A;  1JWZ A;  4H8R A;  2Y2H A;  4K0X A;  5CHM A;  2FFY A;  3DWZ A;  2V20 A;  3G2Z A;  1C3B A;  3BRM A;  2V1Z A;  5M19 A;  3G31 A;  3DW0 A;  3Q81 A;  4IVK A;  5GLC A;  3MXS A;  3Q7V A;  4DXC A;  2XFT A;  2FFF B;  4QJG A;  4RA7 A;  3GTC A;  3Q07 A;  1E3U D;  3SS3 A;  1IYP A;  4GNU A;  4WEK A;  2EFX A;  3FKV A;  3G35 A;  3IXH A;  2ZC6 B;  3LCE A;  3O86 A;  5DF8 A;  5CTM A;  5DTS A;  4KZ7 A;  4JXS A;  1IKG A;  2P9V B;  1H8Y A;  3PBT A;  1K4E A;  5DF9 A;  1PW1 A;  5F82 A;  3VOY A;  4MNR A;  3UPO A;  1K25 A;  4KQR A;  2OLU A;  3A3F A;  1GCE A;  3IH8 A;  2XR0 A;  1BSG A;  3IWI A;  5EEC A;  1BLS A;  1FCO A;  5HX9 A;  3UDF A;  1K54 C;  3VSL A;  2ZMA A;  4QY5 A;  4OP8 A;  3G2Y A;  4UA7 A;  5JYP A;  1MWR A;  1FCM A;  2XLN A;  3VFH A;  3C5A A;  3OCN A;  4ZTK A;  2IWD A;  3QHY A;  2WKI A;  1IYQ A;  2XDM A;  4KG5 A;  1W8Y A;  3OPR A;  2Y2J A;  3AGE A;  1AXB A;  1IEL A;  1ESU A;  2HDR A;  2HP9 A;  3FWL A;  4OON A;  3P09 A;  4U0T A;  2A49 A;  1N9B A;  3LO7 A;  2EX6 A;  1MY8 A;  4FH4 A;  4PM9 A;  2J8Y A;  3MZF A;  3UE3 A;  3O87 A;  1KE0 A;  2ZQD A;  2ZLY A;  1RGZ A;  3MKF A;  5CTN A;  1W5D A;  4MLL A;  2UWX A;  4L0L A;  5CEB A;  5CRF A;  5DTK A;  3HLF A;  3V39 A;  3IHA A;  3HL9 A;  4Y7P A;  1O07 A;  2J7V A;  3C7U A;  3MBZ A;  4GN2 A;  1MKI A;  4XUZ A;  2PU2 A;  3M6B A;  4KQQ A;  1YM1 A;  2ZC5 B;  3IXD A;  2DRW A;  2ZM8 A;  3MZD A;  4S2J A;  4PM5 A;  1FQG A;  3Q1F A;  3N4I A;  3PTE A;  2Z2M B;  2WK0 A;  2H0Y A;  3BFE A;  3BLM A;  4OP5 A;  5FQJ A;  3FV7 A;  4OPR A;  4WMC D;  3WS1 A;  4ZAM A;  4BD1 A;  2XFS A;  3OCL A;  3S22 A;  4OH0 A;  1BZA A;  1YLY A;  4JF5 A;  3PBO A;  2IWB A;  3N6I A;  1NYY A;  5F83 A;  1XA1 A;  2H5S A;  3OPH A;  3NIA A;  3HLG A;  4JPM A;  4E3I A;  4C75 A;  5CED A;  5HAR A;  1CEF A;  4Y0U A;  3MXR A;  5GLA A;  1IYS A;  4CPK A;  3GSG A;  3BFF A;  3GV9 A;  4GDN A;  1ZC2 A;  2WGW B;  4KZ6 A;  4S2N C;  3C7V A;  3W4O A;  3PBS A;  4YIN A;  4RYE A;  5CHU A;  1K57 C;  2EXB A;  1G68 A;  3BM6 A;  4UHU A;  5HAQ A;  5KSC A;  2Y2P A;  2DNS A;  1N4O A;  4HES A;  1BLH A;  4LV2 A;  5FQI A;  4E3K A;  1KVL A;  4KZ3 A;  3ZG7 B;  3RJU A;  3VSK A;  3ZDJ A;  1KE4 A;  3Q7V B;  2HPB A;  2DCF A;  4GKU A;  1EI5 A;  3BEB A;  5FAQ A;  4OPY A;  3UY6 A;  1ESI A;  4R4R A;  1XGJ A;  4S2M A;  2ZC4 B;  1W7F A;  2VGJ A;  1G6A A;  4OPZ A;  4P85 A;  4PM6 A;  1MPL A;  1Q2Q A;  2Y2N A;  3A3I A;  3ZVW A;  3PAE A;  3JYI A;  1FSW A;  4BD0 A;  3IF6 B;  4S2N A;  5AQA A;  1Z6F A;  4R23 A;  2C5W B;  2WAE A;  2ZQ9 A;  3EQV A;  4EBP A;  5HW3 A;  1K57 A;  1KDS A;  5E2H A;  4E3L A;  3M2J A;  5A93 A;  5FQK A;  2WUQ A;  1VM1 A;  3N8R A;  4DE1 A;  1XA7 A;  2XQZ A;  4LV0 A;  1ALQ A;  2ZQA A;  4WEL A;  4WZ5 C;  4KQO A;  1I2W A;  4X53 A;  3W4Q A;  4BL2 A;  4MBK A;  1NRF A;  1S6R A;  3HLC A;  5AQ9 A;  2X01 A;  1DY6 A;  4GDB A;  1XXM A;  1ZKJ A;  1BUL A;  3IWO A;  3IF6 C;  3C4O A;  1YQS A;  3G4P A;  4XUX A;  1VQQ A;  1TDL A;  4Y0T A;  3SH8 A;  4PM7 A;  2HDQ A;  1LL9 A;  1ES4 A;  1CI9 A;  1NXY A;  3HBR A;  4KZ9 A;  4HEF A;  2CC1 A;  3M6H A;  1YLT A;  2Y55 A;  1HZO A;  2XD5 A;  3BFC A;  3HVF A;  5HL1 A;  2XEP A;  4JF4 A;  1QME A;  5FI6 A;  1S0W A;  4WZ5 A;  3QNB A;  1JWP A;  4B4Z A;  4EBL A;  2QPN A;  1SCW A;  3VFF A;  3OPP A;  4Y0O A;  2H10 A;  4QY6 A; 
#chains in the Genus database with same CATH topology
 3L27 A;  2EWW A;  1DJA A;  5AVB B;  3HUM A;  4KQD A;  3IF6 A;  1W63 M;  5J8X A;  1H3O A;  1P3G A;  4HBT A;  4KEN B;  3IBR A;  1JWV A;  5AQB A;  3HLD A;  2JKR I;  5B0Z A;  1E25 A;  1TS6 A;  2Y4A A;  1PI4 A;  1E6P A;  3TU4 D;  4E44 A;  3NC8 A;  1BH9 A;  5L2F A;  4FSF A;  3H0L C;  2V2F F;  5E5A B;  4DKI A;  1F2K A;  5B33 B;  3X1T B;  1ID3 D;  3UT9 C;  3LI9 A;  1WWS A;  3W99 C;  4U3T A;  5AQ7 A;  3V5M A;  2Y2O A;  1SHV A;  5GHX A;  5CGX A;  3W98 C;  5FUG A;  4J8V D;  5D3O A;  3PBQ A;  4ZBJ C;  4JGQ A;  3MVD B;  1P3B B;  3B0D C;  4DN0 A;  3WS4 A;  2ZQ7 A;  1IOU A;  3S7P A;  4KUD D;  3V3R A;  2W1T A;  1P3F C;  3AGF A;  4II7 A;  2VV7 A;  3MGP D;  1LHY A;  2W3H A;  4K0W A;  4LLO B;  3AYW D;  2J3T C;  3C38 A;  5FDH A;  3UT9 A;  4XZQ B;  2NQB D;  5EV0 A;  2VX8 A;  3W98 A;  3N8S A;  4PKY A;  4BEN A;  3BFG A;  3UB6 A;  2Q0O A;  1VHM A;  5CHJ A;  3H7W B;  3ISG A;  3F1O A;  3KS8 A;  1KX5 D;  1L6J A;  4ZUX C;  3AFA D;  3G32 A;  5FAS A;  4HIA A;  3B6F A;  3MJQ A;  3EOI A;  2K7S A;  1W79 A;  5EM1 A;  1IEM A;  3W4P A;  4LD9 B;  5AV6 C;  4WLA A;  2P7J A;  4J8W B;  3WKJ B;  4NE5 A;  5B2I D;  3PR6 A;  2GX5 A;  1GXD A;  3OPL A;  4EES A;  3GRJ A;  4HMD A;  5B32 B;  1K56 A;  3ZHH A;  3QNC A;  4J8X C;  4ZUX A;  1MWU A;  4BBT A;  1LT0 A;  4PMA A;  3BQ8 A;  2O9B A;  1Y4O A;  3MQQ A;  3UB8 A;  1ZLA D;  2W27 A;  3AZG D;  1QMF A;  4UQI M;  5EVI C;  5CGW A;  4DDS A;  2V5O A;  3M2K A;  3FKW A;  3O62 A;  5EVE A;  3VH5 A;  3DWK A;  4HP4 A;  1YMX A;  1RCJ A;  5AV5 D;  3B0B A;  2P04 A;  4J8X A;  3AZE B;  4YS3 B;  3PYP A;  5CPK B;  3L9K A;  4Q0H A;  4OOM A;  1F66 A;  2F2A C;  1STZ A;  4UA9 A;  1TVF A;  4JGR A;  4LCM A;  2GJ3 A;  4U0X A;  4IBD A;  5EVI A;  3W97 B;  3IS2 A;  3AZJ A;  2ZY4 A;  5B1L C;  1IKI A;  4WYY A;  5HD3 A;  2R9W A;  2Z6D A;  4BJP A;  2VEA A;  1U35 A;  3NY4 A;  3QP6 A;  4P6Z S;  1E3U A;  4NZ1 A;  2B95 A;  3UTB D;  3A1I A;  3E4Q A;  2Y2L A;  4CAY A;  1ZG4 A;  4WM9 A;  3UDI A;  3O3V A;  3HRE A;  2F8N G;  4OQ0 A;  4R3A A;  3X1S D;  1Y54 A;  3T4S A;  3MSH A;  2VLG A;  3WRT A;  1EWZ A;  3FZC A;  2E8J A;  5CP6 C;  1TD5 A;  5BPV A;  1S1Y A;  4JGP A;  4EUV A;  4NXE A;  3REH C;  3MGQ C;  5CPI C;  4N92 A;  3A6N B;  3BQA A;  1NZO A;  2G2U A;  5B1L A;  5GT0 B;  3LEL B;  3HLW A;  1GSV A;  1BUE A;  1XP4 A;  4I3J A;  4MN5 A;  1P3P C;  5HDD A;  1NYM A;  3BY9 A;  5B32 G;  4ETZ A;  3CAX A;  3GVB A;  3LID A;  1FOF A;  3A0V A;  5GT3 C;  3NBL A;  5EOO A;  3WA9 C;  4Q0I A;  5GLD A;  3LEZ A;  2K2N A;  4QLC C;  3REH A;  3MGQ A;  1K54 A;  5CPI A;  5CHL B;  4WEJ A;  5AVC C;  3X1V C;  4Y5F A;  1XX2 A;  4B9O A;  4E6X A;  5B33 D;  5B1M B;  1P3P A;  4Z2J A;  3D4F A;  5L09 A;  3AZM B;  2QJ7 A;  2VZW A;  3DAV A;  2DMW A;  2VV8 A;  1X0O A;  3G6O A;  3MGS B;  4R3B A;  3VP3 A;  2W1R A;  3C1B C;  5GT3 A;  4G92 C;  4WMC A;  3WA9 A;  3GR2 A;  4LPZ A;  1PRQ A;  4QLC A;  2A2L A;  3LZ1 B;  2JHE A;  4GZB A;  3L7H A;  4A5R A;  5AVC A;  3X1V A;  1P3I B;  3C30 A;  2FJ7 D;  5BT1 C;  1KX4 B;  1K38 A;  3HJK A;  3SH7 A;  3MXQ A;  5IHV A;  3E4P A;  2QZ6 A;  3ZG8 B;  3C4P A;  2VGK A;  4RQ9 A;  3BEC A;  5GL9 A;  2XRN A;  1OTD A;  2QYB A;  3WD1 A;  3R45 B;  1M18 D;  3BLS A;  2PAV P;  4YWZ A;  3CJM A;  3HLB A;  1Q2P A;  2F8N D;  1IYO A;  3AZH B;  4EEP A;  1H5X A;  5GSU C;  1KGF A;  1M19 C;  5HAP A;  4KZ4 A;  2PU4 A;  5FQ9 A;  4H9S C;  4P6Z M;  4EEU A;  2P74 A;  3IT9 A;  4OQG A;  4S2P A;  3REI A;  5CHM A;  3V67 A;  5G49 B;  2L1M A;  2ZY5 A;  2V20 A;  3G2Z A;  3BRM A;  5B32 D;  5M19 A;  1ODV A;  3G31 A;  3KX0 X;  3HCY A;  4DXC A;  4QJG A;  2INW A;  4RA7 A;  2OWJ A;  2YKH A;  3GTC A;  1IYP A;  3KUY D;  1H0G A;  4GNU A;  2PYO C;  5GSU A;  1M19 A;  4UUZ B;  3AZF C;  1T19 A;  5DF8 A;  4NYY A;  4H9S A;  5CTM A;  3S7O A;  2PYR A;  3D9Y A;  3ZYT A;  3REL C;  3X1U B;  1IKG A;  1K4E A;  3FPV A;  4KUK A;  1HQ3 B;  4MNR A;  3VOY A;  1K25 A;  3EPK A;  3AZE D;  2PDR A;  1W1P A;  4OP8 A;  1P97 A;  1G5U A;  2ZMV A;  1TAF A;  2F8N H;  3NQJ A;  5AVB C;  2PYO A;  2WKI A;  4KG5 A;  1W8Y A;  3AZF A;  2Y2J A;  1P3M B;  1PDC A;  5B40 B;  1IEL A;  1KOU A;  4GHL A;  1VEU B;  4OON A;  3L26 A;  3UE3 A;  1T1C A;  3MZF A;  3B6G B;  3WTP D;  3AN2 D;  4HJ4 A;  3LJA A;  1W5D A;  5B0Y C;  3LZ0 B;  3AV1 C;  4KUO A;  3HL9 A;  1E6Z A;  4Y7P A;  4GN2 A;  5AVB A;  4EO5 B;  1MKI A;  3EGD C;  5E5A C;  2ZC5 B;  3MZD A;  4Z1W A;  3N4I A;  3X1T C;  3H0R C;  2Z2M B;  4HY8 A;  5DFY A;  3LEL D;  4BD1 A;  4J8U B;  2XFS A;  2HIO C;  4XUJ D;  1N9L A;  1YLY A;  5JRG B;  4L9E A;  2IWB A;  4NXB A;  5F83 A;  4E3I A;  3NIA A;  1OTE A;  3TJZ C;  2NZD C;  5B0Y A;  4CSR B;  3AV1 A;  3GV9 A;  1F9I A;  4GDN A;  4KZ6 A;  3W4O A;  3PBS A;  2ARO C;  4YIN A;  1O6I A;  4Z2H A;  4E3K A;  5E5A A;  4Z5T D;  3AZK D;  1JFI B;  1EQZ C;  4HI4 A;  3VSK A;  3X1T A;  1F1E A;  3KWQ B;  3T4L A;  2IOU A;  2G5I C;  3W96 D;  4XZQ C;  4R4R A;  2HIO A;  5B1M D;  1P3A D;  3EPH A;  2ZC4 B;  4OPZ A;  1G6A A;  3BY8 A;  5AY8 B;  3PHY A;  4R8P B;  2Y2N A;  3ZVW A;  1KX3 D;  3MVD A;  3MGR B;  1AIW A;  3JYI A;  4OUI A;  4BD0 A;  3F1N B;  1J3W A;  1KDS A;  4OJ6 A;  3M2J A;  1S32 B;  1XA7 A;  4LV0 A;  4WEL A;  1EQZ A;  2L5A A;  4X1L A;  3QP2 A;  3UTA D;  3TRC A;  3HLC A;  1S6R A;  4XZQ A;  3QP4 A;  2X01 A;  4D60 A;  2O0Y A;  2O9C A;  1BUL A;  5F68 A;  3G4P A;  1YQS A;  3N3F A;  5CPJ D;  1T1A A;  3WKJ C;  3C1C B;  2HDQ A;  4AFI A;  3P5J B;  1ES4 A;  1CI9 A;  3A0R A;  3REK C;  1NXY A;  4KZ9 A;  4CLC C;  4HEF A;  3REJ D;  2IA2 A;  1YLT A;  3TU4 B;  1DP9 A;  1HZO A;  5AV8 D;  3BFC A;  3TW8 A;  1E15 A;  1S0W A;  1JWP A;  4EBL A;  4L9F A;  5HPF A;  4LG2 A;  1ID3 B;  2H10 A;  4G91 B;  4R38 A;  5EOE A;  5DNN D;  4RVA A;  4LD9 A;  5FAT A;  1PWC A;  4C3Q A;  4J8V B;  4J8W A;  3WKJ A;  1FIL A;  5TJJ A;  2IWC A;  5HPI A;  5AV9 D;  5GXQ D;  1YAX A;  3NDG A;  3KYZ A;  5DJU A;  4YS3 C;  2XD1 A;  1K0K A;  3CMZ A;  3AGD A;  5FEG A;  1Q9C A;  4Z2K A;  1PYY A;  3MGP B;  3VH6 W;  1SZV A;  2Y2Q A;  3AYW B;  3VP2 A;  4AWL B;  1AOI C;  2OWH A;  2W3E A;  4KZB A;  5B31 G;  4LEN A;  2NQB B;  3NCK A;  4YFM A;  3NOT C;  1J9M A;  3WX7 A;  2D49 A;  3L25 A;  1PZR A;  3DBA A;  5BS7 A;  4JBF A;  1K4F A;  2RVQ C;  1YSP A;  4GS9 B;  5FQM A;  4YS3 A;  3G34 A;  3T1X A;  1KX5 B;  1HQ3 D;  3AFA B;  2NUP C;  1ONH A;  5CPK A;  2EX9 A;  3F1P B;  3AZI C;  2PRF A;  3TE8 A;  3VP0 A;  3ZG0 A;  3W97 A;  3A6N C;  4IBC A;  2Q9N A;  3OZH A;  4FH2 A;  3W99 D;  3LFV A;  4DE2 A;  4DRA A;  4H9O A;  4E3J A;  3BYD A;  4WZS B;  1WYB A;  5B2I B;  4IBR A;  4OKP A;  4NE3 A;  3B3X A;  4ZJ2 A;  1LSX A;  1QO6 A;  4OLG A;  4GH9 A;  1WWI A;  1PI5 A;  1S4R A;  1P34 D;  2GDN A;  1UR9 A;  3RH8 B;  3AZI A;  3E98 A;  2Y8H A;  4X55 A;  5CEC A;  5CXW A;  1TDG A;  1P3F D;  4DE0 A;  3BJN A;  1ZLA B;  3N7W A;  2M7V A;  4O7D A;  3A6N A;  5GT0 A;  3IP4 C;  4IBF A;  3AL0 C;  1NRJ A;  3A0S A;  3SOI A;  1B67 A;  4JJN C;  5F1F A;  3FC7 A;  1H8M A;  5AV5 B;  2ZQ8 A;  4R70 A;  3WAA C;  3UPP A;  4HNB A;  3AZM C;  4H9R B;  4QHC A;  2YFW B;  5DFX A;  2X71 A;  5E2E A;  2DF4 C;  2UV0 E;  2BYM A;  4EV4 A;  3EWK A;  3LZ1 C;  4NET A;  5E43 A;  5FQQ A;  1YLZ A;  3BFD A;  3QP1 A;  2ZY2 A;  2CV5 C;  1KE3 A;  5AV6 D;  1P3G C;  2XH9 A;  1KX4 C;  2HP5 A;  4I3I A;  2JE5 A;  5FI7 A;  5B31 D;  1M6K A;  1ACF A;  3WAA A;  3D3O A;  3AZM A;  4DRT A;  3UTB B;  3AZN C;  2XA7 M;  4HH3 A;  2G5H C;  4P0M A;  5B0Z C;  3PBN A;  4R8P D;  3WD2 A;  5HWW A;  3X1S B;  3MQL A;  2OLV A;  2ZY3 A;  1HVB A;  3LZ1 A;  1GA9 A;  2BAS A;  1F98 A;  3LY4 A;  3P7N A;  1S32 D;  4EBP A;  5EVI D;  2VQR A;  4EQ1 A;  2CV5 A;  5AJG A;  3AZH C;  1SDE A;  2J9O A;  1KX4 A;  3GDI A;  1LL8 A;  1OJG A;  3QP8 A;  4JF6 A;  3ITA A;  1L0E A;  3HUN A;  3AZL D;  3AZN A;  4ZBE A;  3KXB D;  1PIO A;  3HSH A;  3WS0 A;  1KDW A;  3ZNT A;  3C1C D;  2RTS A;  3S4X A;  3R45 A;  2O9A A;  4N9K A;  2PBY A;  5L10 A;  2WKP A;  1HTZ A;  3UDX A;  4OLD A;  3WD4 A;  2C6W B;  3AZH A;  5M1A A;  3ZFZ A;  2I9V A;  3KSH A;  1ONG A;  4BMW A;  3H9W A;  4MN6 A;  4N1X A;  1GHM A;  2D02 A;  3PBR A;  3CI6 A;  4E45 A;  2A3U A;  3LIA A;  4R6L A;  3TOI A;  2VV6 A;  4S2I A;  5CP6 D;  4BWI A;  1FSY A;  4KZA A;  3EPJ A;  4BLM A;  1XGI A;  2R9X A;  4Z9Q A;  4R0Q A;  1PWD A;  4H9N A;  3VV4 A;  1M1A C;  1LSW A;  2X02 A;  2RIQ A;  3P01 A;  3B6F C;  5CER A;  2FJ7 B;  2WGI A;  4IVI A;  4UUZ A;  3NDE A;  5FSR A;  1P3M C;  4Z66 D;  2VGL S;  2HF6 A;  4EUZ A;  5FI2 A;  3E2K A;  2XK1 A;  2IO5 C;  4E3N A;  4JXW A;  1D06 A;  3UPN A;  3X1U A;  3CZD A;  5HDS A;  4ZJ3 A;  3A1K A;  1M18 B;  1RP5 A;  2M1C A;  1P0Z A;  4RX3 A;  1YT4 A;  4WZ4 A;  1H8Z A;  4PHT A;  3LZ0 C;  1JVJ A;  3IXG A;  5G4Z A;  2F8N B;  1ZHH B;  1M1A A;  5LBR A;  2OSU A;  3LUQ A;  1G28 A;  5EVL A;  2H0T A;  3UB9 A;  1TZY C;  1P3M A;  2Z6C A;  5B40 A;  1NWZ A;  2Q9M A;  5GLB A;  5E2G A;  1YUE A;  4LV3 A;  1DP8 A;  3ZQ5 A;  3O62 C;  3MNN C;  1Z09 A;  5JRG C;  3C1B D;  3B6G A;  3MF0 A;  1PWG A;  3V50 A;  3V9R A;  4H6J A;  5HZH A;  1BLP A;  2ZBB A;  3LZ0 A;  1XJ4 A;  3IQA A;  1A7W A;  3ULF A;  3E0Y A;  1GOI A;  1F66 C;  3KUY B;  5TBM B;  4H9Q B;  4NZ3 A;  1TZY A;  1PZP A;  5BT1 D;  2HZ5 A;  2YKF A;  4WF0 A;  2G2W A;  3ZG5 A;  2Z2L B;  3KWQ C;  1JTG A;  2EFU A;  2KOI A;  3AZJ C;  3B33 A;  4J8U A;  3UO9 A;  3MNN A;  5JRG A;  1U35 C;  4EQI A;  4RX2 A;  1BH8 B;  1SKO B;  5AY8 C;  2RCX A;  5HL6 A;  4GD8 A;  3VMA A;  2WZX A;  3MGR C;  4HGA B;  3E2L A;  5KMW A;  3O88 A;  2JKR M;  4H8R A;  2FFY A;  3CUE C;  1JFI A;  3Q81 A;  1W2E A;  3KSI A;  3NEC A;  3KWQ A;  1H0M A;  3Q07 A;  2ZOI A;  3SS3 A;  1P3L D;  3SW1 A;  5AY8 A;  3T1S A;  3WTP B;  4O8G A;  3AN2 B;  2L4R A;  1XJ2 A;  3T1R A;  1H0I A;  3MGR A;  1D1J A;  5DTS A;  4JXS A;  3F1N A;  1H8Y A;  3PBT A;  2ACG A;  4DRB A;  2CMN A;  2OLU A;  3CUE A;  1BSG A;  3IWI A;  5K5B A;  1FCO A;  5HX9 A;  2R78 A;  1K54 C;  3VSL A;  4QY5 A;  2B18 A;  1FCM A;  4X23 D;  3C5A A;  5C3I B;  1S66 L;  4XUJ B;  4KGC D;  2IWD A;  3OCN A;  1GPF A;  4ZTK A;  2VGL M;  3REL D;  3EEA A;  4GLQ A;  3AGE A;  3FWL A;  4U0T A;  2M7U A;  2A49 A;  1N9B A;  4FH4 A;  4PM9 A;  2K31 A;  1T18 A;  3O87 A;  2JKT I;  1RGZ A;  4KUD C;  4Z5T B;  5CTN A;  3AZK B;  2UWX A;  4WU9 D;  5DTK A;  3V39 A;  3AYW C;  5J7E A;  3W96 B;  3C7U A;  2NQB C;  4NKP A;  1P3A B;  3O5Y A;  4KQQ A;  4S2J A;  4J8V A;  2ZM8 A;  4PM5 A;  5F99 B;  1FQG A;  1NLY A;  3Q1F A;  3PTE A;  5FQJ A;  2H0Y A;  3BFE A;  4HJ3 A;  3WS1 A;  4GHI A;  1KX3 B;  4OPR A;  1PFL A;  4Z2M G;  1S67 L;  4Y15 A;  5B0Y D;  1NYY A;  3OPH A;  3AFA C;  4JPM A;  1UGU A;  4QPR A;  4KUD A;  1CEF A;  3MXR A;  5BNX B;  1IYS A;  3GSG A;  3AYW A;  2WGW B;  4S2N C;  1YU1 A;  1UWN X;  1D7E A;  2WKQ A;  3UTA B;  4RYE A;  3LIB A;  2EXB A;  5CHU A;  3BM6 A;  4UHU A;  2NQB A;  5HAQ A;  1BLH A;  4IUK A;  3IX4 A;  3VH5 W;  2HIO D;  5CPJ B;  3L29 A;  5DNM B;  3Q7V B;  4GKU A;  5B2I C;  5FAQ A;  4OPY A;  2NZD D;  1XGJ A;  4XT2 B;  3REJ B;  2A24 B;  4GS9 A;  4P85 A;  2YFV A;  1KX5 A;  5AV8 B;  4YM6 D;  3AFA A;  2ARO D;  3REI C;  4DQY B;  1Q2Q A;  3F1P A;  4BBU A;  3T4J A;  2KX6 A;  1FSW A;  1F5M A;  3IF6 B;  4S2N A;  5AQA A;  4R23 A;  3EQV A;  3AZG C;  4NEE D;  3KSF A;  5DNN B;  2W8S A;  4KQO A;  3W4Q A;  4BL2 A;  4WU8 C;  5B2I A;  5AV9 B;  3WD3 A;  5GXQ B;  5AQ9 A;  5AV5 C;  1DY6 A;  2LB5 A;  1P3K D;  1XXM A;  3IWO A;  3NOP C;  4LRX C;  4IBG A;  3C4O A;  1TDL A;  4IJG A;  4HME A;  1ZLA A;  3VH5 T;  3AZG A;  2Y55 A;  2XD5 A;  2HGV A;  2W3G A;  3CWF A;  5HL1 A;  4JF4 A;  5IU1 A;  1QME A;  5FI6 A;  1VET B;  4ZRR A;  3KSG A;  1P3O D;  3LR4 A;  4WU8 A;  4F3L A;  2H28 A;  5B24 D;  5BO0 B;  5EPH A;  5AV5 A;  2JSS A;  4H9R A;  3UTB C;  1CXW A;  3REK D;  4CLC D;  1Z2C B;  2YFW A;  3HJI A;  5DVA A;  4ESP A;  2EA9 A;  1MWT A;  2HUE C;  4FD8 A;  2Y2I A;  5GHZ A;  4MB3 A;  3LJA C;  4NK3 A;  2W1T B;  2WAD A;  3I7J A;  4QD4 A;  5EE8 A;  4M4X A;  1XJ6 A;  3UT9 B;  3EQU A;  3W99 B;  3HON A;  1XFN A;  1I2S A;  3NQU B;  4Q0J A;  1GSW A;  4LV1 A;  4E3M A;  4EU0 A;  4KHA B;  3MKE A;  4UA6 A;  3UTB A;  5GHY A;  3S7Q A;  2BYK B;  3HUO A;  1P34 B;  3B0D B;  4JXV A;  4WNN B;  3X1S A;  1BFM A;  1YLJ A;  1DJB A;  2Y2G A;  2PR5 A;  2OAQ 1;  1U60 A;  1P3F B;  3M7P A;  1PZO A;  3RXW A;  1AOI D;  4E04 A;  5DKK A;  5A91 A;  1O7E A;  3VP4 A;  1W1T A;  5B33 C;  1CEG A;  1P9W A;  3AV2 D;  4L9G A;  4NY2 A;  2RVQ D;  1MXO A;  5KIZ A;  5DKL A;  1H3Q A;  1UR8 A;  5HD5 A;  3AZI D;  3FKE A;  3MVD C;  3P98 A;  5G18 A;  2ZM0 A;  1P3B C;  4IBX A;  4Z2M H;  5FAP A;  1NZU A;  2JKG A;  5I94 A;  4P87 A;  2HV1 A;  5B33 A;  3LR0 A;  1EAK A;  5AV6 B;  2JBF A;  1BT5 A;  5B31 B;  5U47 A;  5FAO A;  3UN7 A;  4JLF A;  3MQ0 A;  3ZNY A;  5F99 D;  5F5Y A;  5L8M A;  1M18 C;  4WUJ A;  1P3B A;  2WZZ A;  1CQA A;  4PPR A;  1I5Q A;  5EVI B;  3LIC A;  1H8P A;  3VP1 A;  2FJ7 A;  2OAP 1;  4JJN D;  3AZL B;  4D2O A;  4WN5 A;  1E6N A;  3KXB B;  4GW9 A;  4LD9 C;  3FYZ A;  5DNM D;  4OPQ A;  3NOU C;  4J8W C;  4MBF A;  1MBL A;  1M18 A;  1BLC A;  4LRZ E;  3RTY A;  1NJ4 A;  4DXB A;  5B32 C;  3H7W A;  3LY3 A;  4QWO A;  1XFQ A;  2PBD P;  4DE3 A;  5B2J D;  2F8N A;  2ZJ9 A;  5EFW A;  3GQZ A;  2EWV A;  5A8B A;  4GOG A;  4X6T A;  4TX8 A;  1P3G D;  3C2W A;  3IXB A;  3JVU A;  4FOF A;  4ZJ1 A;  4B88 A;  5E2F A;  1SKF A;  3NI9 A;  2BLS A;  4UEY A;  1TS7 A;  1W8Q A;  3KFU G;  5B0Z D;  2J80 A;  2V0W A;  1L0G A;  5BS7 C;  5HFO A;  4DF6 A;  4B4X A;  5B32 A;  3N8L A;  2W0N A;  2B02 A;  3AZE C;  4LFU A;  5CP6 B;  4QB8 A;  4HGA C;  3ZVT A;  2XSS A;  5HWT A;  5CPK C;  3WWX A;  1HD8 A;  3VOZ A;  3KUY A;  1LSV A;  5TBM A;  5F69 A;  4NFT A;  1YMS A;  4H9Q A;  1SDN A;  1GHP A;  3SS4 A;  1G6O A;  2G7U A;  1ES2 A;  1EW0 A;  2Y91 A;  4R1G A;  3SZT A;  3W97 C;  3DTK A;  4Z66 B;  3EGX C;  1V9Z A;  2Y2K A;  2QJ5 A;  3W8K A;  1SKO A;  3WTP C;  3HLE A;  5GT3 B;  3AN2 C;  3WA9 B;  3SH9 A;  3AZE A;  5CGS A;  2EX8 A;  1L2S A;  2HP6 A;  2KLI A;  1YLW A;  2L0W A;  4E6W A;  4R4S A;  2J9P A;  5KDM B;  2V8C A;  3V3S A;  2ZL1 B;  4LCL A;  4I38 A;  3UT9 D;  2D01 A;  1ERM A;  4JKT A;  4MBH A;  3R7W B;  5GT0 C;  3LEL C;  4NE6 A;  5C3I C;  3W98 D;  1FCN A;  3C1B B;  1N9O A;  3WTP A;  4G92 B;  3AN2 A;  4OVD A;  4CQH A;  5JA4 B;  5BOH A;  3A3E A;  2EX2 A;  3CG5 A;  5JYO A;  1ZG6 A;  3DTI A;  2O99 A;  1CI8 A;  3VH6 T;  3NHQ A;  2I72 A;  4R3J A;  2HDS A;  4IED A;  2JCH A;  3B6F D;  3ICY A;  2J3T D;  3VE3 A;  1P9R A;  3W2Z A;  4NZ4 A;  3T50 A;  3LEL A;  1DP6 A;  1OJ5 A;  4H9P B;  4XUJ A;  2VJW A;  5B1M C;  1P3A C;  4HHD A;  5KSH A;  1K6S A;  4BBV A;  1K55 C;  3A3D A;  5FDS A;  2B5R A;  4E3O A;  3MGS C;  1GHI A;  2NUT C;  1K56 D;  1XJ3 A;  1J7M A;  4ZUX D;  4EBN A;  4JXG A;  1CJF A;  4OQI A;  3MFX A;  4IBI A;  5EUA A;  3GMW A;  1DRM A;  2WKH A;  3W96 A;  4N1H A;  5DTT A;  1P3I C;  2Y59 A;  5B1M A;  1P3A A;  4OOL A;  1P3L B;  2LY8 A;  2RL3 A;  3O62 D;  3UE0 A;  1K55 A;  5HAI A;  3G30 A;  1KX3 A;  1DJC A;  4X1M A;  3MGS A;  4J8X D;  4OJP A;  4JGO A;  3REJ C;  5F1G A;  3B47 A;  5TR7 A;  4ME4 A;  2WAF A;  2W3F A;  1F66 D;  3NQJ B;  3FG8 A;  2AVX A;  5BNX A;  3WTP E;  4HMC A;  3T4O A;  2PYO B;  2WGW A;  2FH5 A;  2Y2H A;  4X23 B;  1P3I A;  4K0X A;  3PXP A;  2MJ6 A;  3DWZ A;  3AZJ D;  5EM0 A;  4KGC B;  2V1Z A;  5IS1 A;  5CPJ A;  3REL B;  1U35 D;  4IBB A;  3Q7V A;  2XFT A;  3LIE A;  1MKM A;  5GXQ C;  1E3U D;  4MB4 A;  3K3D A;  4XT2 A;  3REJ A;  3DTE A;  3FKV A;  3G35 A;  3LCE A;  3O86 A;  4Y17 A;  4WU9 B;  2P9V B;  4K08 A;  2Y79 A;  4UQI S;  5DF9 A;  1PW1 A;  5F82 A;  1N9N A;  3A3F A;  5DNN A;  5B1L D;  2XR0 A;  1BLS A;  5FEF A;  3B0C W;  2ZMA A;  4UA7 A;  5AV9 A;  1MWR A;  3OLO A;  5GXQ A;  2XLN A;  4HQA A;  3VFH A;  3QHY A;  5B0Y B;  3X1U C;  3AV1 B;  4QNL A;  1IYQ A;  1S1Z A;  1HQ3 C;  5G49 A;  1ESU A;  2HDR A;  5HDC A;  1HLU P;  3U4L P;  3P09 A;  3LO7 A;  2EX6 A;  1MY8 A;  3REH D;  3MGQ D;  5CPI D;  3VE4 A;  1VET A;  4MLL A;  4L0L A;  2HIO B;  1P3P D;  5BO0 A;  5B40 C;  2FN2 A;  1O07 A;  3MBZ A;  1MZU A;  3LGO A;  2NZD B;  1YU0 A;  4XUZ A;  2HJ9 C;  2DRW A;  1HQ3 A;  1P34 C;  4YM6 B;  3B6G C;  2ARO B;  2V0U A;  4OP5 A;  5GT3 D;  1CF0 A;  3BLM A;  4LGW A;  2PR6 A;  4WMC D;  3WA9 D;  3KS4 A;  4QLC D;  1BYW A;  1EQZ B;  4DMZ A;  4JF5 A;  3PBO A;  3N6I A;  3B0C T;  3UE6 A;  1XA1 A;  2H5S A;  3HLG A;  4EO5 C;  5AVC D;  3X1V D;  3W99 A;  3L2A A;  4C75 A;  3NQU A;  4Y0U A;  3BFF A;  1L3L A;  5CX7 A;  3C7V A;  4KHA A;  4FTX A;  1K57 C;  5KSC A;  5G4Y A;  1VEU A;  2Y2P A;  1N4O A;  4HES A;  1P3K B;  1ZTU A;  4J8U C;  2BYK A;  4KZ3 A;  2P08 A;  1P34 A;  2V1B A;  3RJU A;  3ZG7 B;  4GHA A;  4WNN A;  2HPB A;  2DCF A;  2ZOH A;  4WL9 A;  3LEQ A;  1P3F A;  4S2M A;  5L07 A;  1YPR A;  4I3A A;  2JN7 A;  3PAE A;  3OBF A;  3KYE A;  1P3O B;  2BTF P;  2J3W A;  2WAE A;  5HW3 A;  5B24 B;  2F8N K;  1K57 A;  5E2H A;  5B31 C;  1YU2 A;  5A93 A;  5FQK A;  4MMN A;  3N8R A;  4Y2F A;  2XQZ A;  1ALQ A;  3REK B;  2ZQA A;  4CLC B;  4WZ5 C;  4X53 A;  3T4Q A;  4MBK A;  4R8P C;  3REI D;  5AVF A;  4CSR A;  4XUX A;  1VQQ A;  2PHY A;  3SH8 A;  4PM7 A;  4M6B A;  1S32 C;  1WA9 A;  3CLO A;  3HBR A;  4HH2 A;  5AV6 A;  3UB5 P;  3UB7 A;  3M6H A;  5GSU D;  2KDK A;  5B31 A;  1M19 D;  2XEP A;  4WU8 D;  3AZL C;  3MMH A;  3KXB C;  1ED7 A;  3QNB A;  4WZ5 A;  1SCW A;  2JKF A;  3OPP A;  4Y0O A;  4R8P A;  4QY6 A;  3C1C C;  2OOL A;  3TG9 A;  1VB6 A;  2VKS A;  3IX3 A;  3TU4 C;  3MFD A;  4X56 A;  1AOI B;  1M40 A;  1S32 A;  4N9L A;  4WBG A;  2ZD8 A;  3H82 B;  4EXO A;  2PYO D;  3DTM A;  3RFB A;  3AV2 B;  1ID3 C;  4H9O B;  4G91 C;  3AZF D;  2CWE A;  3AZL A;  3KXB A;  1YLP A;  3A3J A;  1TS8 A;  4ID4 A;  5J3W A;  4J8V C;  4NYU A;  3C1C A;  1ES3 A;  1KGE A;  2BG1 A;  2WKE A;  4EWF A;  3IH9 A;  3F6T A;  3AZI B;  3LJA D;  3MZE A;  3TU4 A;  4OJ5 A;  4ARZ B;  3T1Q B;  3CPT B;  4CJN A;  3LR3 A;  1GA0 A;  3Q82 A;  4QU3 A;  5AVB D;  5FL3 A;  3MGP C;  5A92 A;  2ZM2 A;  1ID3 A;  4AWL C;  2J8P A;  3FPW A;  1PW8 A;  4KG2 A;  1OME A;  1TF1 A;  2LB9 A;  1OTI A;  4Z66 C;  4S2K A;  2HDU A;  1CK7 A;  4BL3 A;  4Z2L A;  4NG2 A;  5BNV B;  1YU3 A;  1LI0 A;  1T1B A;  2XRO A;  4Y13 A;  5CP6 A;  3AV1 D;  4FUW A;  2BYM B;  1KX5 C;  3WS2 A;  3MGP A;  3FDD A;  2ZQC A;  3ZG9 B;  3MS6 A;  4S2L A;  5E5A D;  3L28 A;  4JJN B;  1AWI A;  3KYQ A;  2EXA A;  3X1T D;  4DJ2 A;  4Z66 A;  3KSY A;  3WAA B;  3IWQ A;  2W3D A;  1MWS A;  4B93 A;  1N1J B;  1JTD A;  1RGY A;  1FR1 A;  3EEH A;  4OOY A;  3MVD D;  1R4V A;  1P3B D;  4NXG A;  4C6Y A;  2WYX A;  5B2J B;  4G3W A;  4KZ8 A;  1E8B A;  3LYX A;  4WV4 B;  5KDM A;  2E8I A;  2CV5 B;  1EQZ D;  2ZL1 A;  1ZLA C;  1S4S A;  1H3O B;  3LIF A;  1P3G B;  5KZH A;  4BQM A;  3R7W A;  4XZQ D;  3AZN B;  3RXX A;  4GD6 A;  3C1B A;  5B0Z B;  4GB7 A;  5JA4 A;  1XKZ A;  5TGF A;  2FZ0 A;  1KS0 A;  1YKD A;  1BH9 B;  4Z2G A;  3BW6 A;  1GSX A;  1XPB A;  5TFQ A;  1E6R A;  4S2O A;  1NLZ A;  4XXR A;  1E88 A;  3C8C A;  4H9P A;  2VK3 A;  3OC2 A;  4PAU A;  4LD9 D;  1P3L C;  3U2A A;  5FUG B;  1LLB A;  4J8W D;  3WKJ D;  5I5L A;  4IBJ A;  3PAG A;  2WGV A;  3EG5 B;  3UNW A;  2ZC3 B;  3SS5 A;  3EPL A;  3GEC A;  4K91 A;  3WRZ A;  5DJT A;  3X1S C;  3WS5 A;  2OV5 A;  1WYC A;  3IBJ A;  1OT6 A;  4X68 A;  4H9N B;  4FCF A;  4IHQ A;  4ETX A;  3ZCZ A;  4X23 C;  2JKT M;  4KG6 A;  4ZDX A;  4F94 A;  2QHK A;  1P3L A;  3W98 B;  4KGC C;  4IBK A;  3Q7Z A;  2V8F A;  1ERQ A;  3BWL A;  1BTL A;  4ZBJ B;  1CK3 A;  5DF7 A;  1PNE A;  4YS3 D;  3F1O B;  5FA7 A;  2XF3 A;  5CPK D;  2JC7 A;  1ES5 A;  1M1A B;  3B6F B;  4WU9 C;  5HSQ A;  4X23 A;  3IF5 A;  3W97 D;  3E4O A;  4KZ5 A;  1TS0 A;  4KGC A;  5HWV A;  3ITB A;  2IO5 B;  3KO6 A;  3REL A;  4DDY A;  4IJE A;  3ZGA B;  5M18 A;  1KGG A;  4PM8 A;  3V9R B;  4IUH A;  4H6J B;  2PD8 A;  4O0P A;  1L0F A;  5A90 A;  4ZUX B;  1NY0 A;  4M3K A;  3S7N A;  4WU9 A;  2P9V A;  2Y2M A;  3VH6 A;  3CHW P;  3LI8 A;  1TZY B;  3NUL A;  3A6N D;  4MB5 A;  4MEZ A;  5GT0 D;  2FJ7 C;  3O62 B;  3MNN B;  3S1Y A;  4YOF A;  1W1Y A;  4DJ3 A;  2ZC7 A;  4J8X B;  4OQH A;  1E4D A;  3UE1 A;  4YM6 C;  4HBU A;  3WD0 A;  3IX8 A;  1F66 B;  1WE4 A;  1LL5 A;  4UAA A;  3MR0 A;  4MDZ A;  1LI9 A;  3IS2 B;  4Q8I A;  3AZJ B;  4G3V A;  2PT7 A;  4P6B A;  1Y28 A;  1KVM A;  4PKY G;  1U35 B;  4HJ6 A;  1L0D A;  1FR6 A;  3T12 B;  3UME A;  5IT5 A;  4Z2I A;  2QMI A;  3WAA D;  3R4K A;  1TEM A;  3AZM D;  2NZD A;  4MN7 A;  1P3K C;  1KU5 A;  3MGS D;  4G3K A;  1A0K A;  4YM6 A;  2ARO A;  4CAY B;  2V9A A;  3CIT A;  2PD7 A;  3LZ1 D;  1K6R A;  5C5K A;  3IHB A;  4O01 A;  3TSG A;  5B1L B;  3KUY C;  4Y3I A;  4EET B;  1P3I D;  2XGN A;  1UWP X;  2CV5 D;  1P3O C;  1ERO A;  4X69 A;  1KX4 D;  5B24 C;  1JWZ A;  4NXF A;  4I39 A;  1P3K A;  3AZN D;  1C3B A;  3OOV A;  4I5S A;  1OTA A;  4IVK A;  3DW0 A;  5GLC A;  3MXS A;  5AVE A;  2FFF B;  3H0M C;  1B6W A;  4OJO A;  4WEK A;  3NJA A;  2EFX A;  3REH B;  3MGQ B;  1OGG A;  1OGB A;  5CPI B;  4MCW A;  3IXH A;  2ZC6 B;  4GCZ A;  3AZH D;  4KZ7 A;  1P3O A;  1IFQ A;  5B24 A;  1P3P B;  2QKP A;  3UPO A;  4KQR A;  2XA7 S;  1GCE A;  3IH8 A;  4GHI B;  5EEC A;  3REK A;  4CLC A;  1OT9 A;  3UDF A;  1W63 Q;  1BH8 A;  1HTA A;  3G2Y A;  5JYP A;  1T3U A;  4KUD B;  4QLC B;  4OJL A;  2XDM A;  3OPR A;  4HP9 A;  1AXB A;  5AVC B;  3X1V B;  1YU4 A;  4EER A;  2HP9 A;  2ZMF A;  3UMD A;  2J8Y A;  4IJF A;  3AV2 C;  3JVV A;  1KE0 A;  2ZQD A;  2ZLY A;  4GJ4 A;  3MKF A;  4XUJ C;  5CEB A;  5CRF A;  1YSQ A;  3HLF A;  3X1U D;  2GNX A;  3IHA A;  2V1A A;  2YFV B;  2J7V A;  1V9Y A;  2PU2 A;  3M6B A;  5F6A A;  5MC7 A;  1YM1 A;  3IXD A;  1AOI A;  3VOL A;  2WK0 A;  3FV7 A;  3H82 A;  1M1A D;  4Z5T C;  4ZAM A;  3AZK C;  3B42 A;  3OCL A;  3S22 A;  3AV2 A;  1BZA A;  4OH0 A;  1P3M D;  5B40 D;  3W96 C;  1OTB A;  5CED A;  4EW7 A;  5HAR A;  1ULY A;  2DQN C;  2VA0 A;  5GLA A;  4CPK A;  2GZA A;  2ZM5 A;  1ZC2 A;  5F99 C;  3B6G D;  3REI B;  1FIK A;  1G68 A;  2PYP A;  1KX3 C;  3K2N A;  2DNS A;  3T4K A;  4LV2 A;  3JPU A;  5FQI A;  4ARZ A;  1KVL A;  4WJ3 C;  3LZ0 D;  3LR5 A;  3ZDJ A;  1KE4 A;  3CPT A;  3AZG B;  4CLC E;  1EI5 A;  3BEB A;  4Z5T A;  3AZK A;  3UY6 A;  1ESI A;  3K3C A;  1W7F A;  2VGJ A;  4X25 A;  5GSU B;  1JNU A;  1TZY D;  1M19 B;  3UTA C;  4YNR A;  4PM6 A;  4WU8 B;  4F3L B;  1MPL A;  4IBE A;  3A3I A;  4LRY C;  4HOI A;  4J8U D;  3MNN D;  5CPJ C;  5F99 A;  1Z6F A;  2C5W B;  5DNM C;  2QWS A;  2ZQ9 A;  5JRG D;  4E3L A;  3QP5 A;  2WUQ A;  1VM1 A;  5BNV A;  4DE1 A;  4UPK A;  1I2W A;  5AV8 C;  5J4E A;  5B2J C;  1W1V A;  1NRF A;  1TAF B;  4GDB A;  1ZKJ A;  2HJE A;  3IF6 C;  4JJN A;  3UTA A;  4Y0T A;  3AZF B;  1LL9 A;  3KWQ D;  5DNN C;  3T4T A;  5DNM A;  2CC1 A;  1OPX A;  1N1J A;  3HVF A;  5AV9 C;  5AY8 D;  1MC0 A;  2WKR A;  3D72 A;  2HUE B;  3LJA B;  4NZ5 A;  2A24 A;  4B4Z A;  3MGR D;  2QPN A;  3VFF A;  5AV8 A;  3MQO A;  5B2J A; 
#chains in the Genus database with same CATH homology
 3L27 A;  1DJA A;  5AVB B;  3HUM A;  3IF6 A;  5J8X A;  1H3O A;  1P3G A;  4HBT A;  4KEN B;  1JWV A;  5AQB A;  3HLD A;  5B0Z A;  1E25 A;  2Y4A A;  1PI4 A;  3TU4 D;  4E44 A;  3NC8 A;  1BH9 A;  5L2F A;  4FSF A;  3H0L C;  2V2F F;  5E5A B;  4DKI A;  5B33 B;  3X1T B;  1ID3 D;  3UT9 C;  1WWS A;  3W99 C;  4U3T A;  5AQ7 A;  3V5M A;  2Y2O A;  1SHV A;  5GHX A;  5CGX A;  3W98 C;  5FUG A;  4J8V D;  5D3O A;  3PBQ A;  4ZBJ C;  3MVD B;  1P3B B;  3B0D C;  3WS4 A;  2ZQ7 A;  4KUD D;  3V3R A;  1P3F C;  3AGF A;  3MGP D;  1LHY A;  4K0W A;  3AYW D;  5FDH A;  3UT9 A;  4XZQ B;  2NQB D;  3W98 A;  3N8S A;  4BEN A;  3BFG A;  5CHJ A;  3ISG A;  3KS8 A;  1KX5 D;  4ZUX C;  3AFA D;  3G32 A;  5FAS A;  3B6F A;  1W79 A;  1IEM A;  3W4P A;  4LD9 B;  5AV6 C;  4J8W B;  3WKJ B;  4NE5 A;  5B2I D;  3OPL A;  3GRJ A;  5B32 B;  1K56 A;  3ZHH A;  3QNC A;  4J8X C;  4ZUX A;  1MWU A;  4PMA A;  1ZLA D;  3AZG D;  1QMF A;  5EVI C;  5CGW A;  4DDS A;  3M2K A;  3FKW A;  3O62 A;  3VH5 A;  3DWK A;  1YMX A;  1RCJ A;  5AV5 D;  3B0B A;  4J8X A;  3AZE B;  4YS3 B;  5CPK B;  4OOM A;  1F66 A;  2F2A C;  4UA9 A;  1TVF A;  4LCM A;  4U0X A;  4IBD A;  5EVI A;  3W97 B;  3AZJ A;  2ZY4 A;  5B1L C;  1IKI A;  4WYY A;  2R9W A;  4BJP A;  1U35 A;  3NY4 A;  1E3U A;  4NZ1 A;  3UTB D;  3A1I A;  2Y2L A;  4CAY A;  1ZG4 A;  4WM9 A;  3UDI A;  3O3V A;  3HRE A;  2F8N G;  4OQ0 A;  3X1S D;  1Y54 A;  3WRT A;  1EWZ A;  3FZC A;  5CP6 C;  5BPV A;  3REH C;  3MGQ C;  5CPI C;  4N92 A;  3A6N B;  1NZO A;  2G2U A;  5B1L A;  5GT0 B;  3LEL B;  3HLW A;  1BUE A;  1XP4 A;  1P3P C;  1NYM A;  5B32 G;  3GVB A;  1FOF A;  5GT3 C;  3NBL A;  5EOO A;  3WA9 C;  5GLD A;  3LEZ A;  4QLC C;  3REH A;  3MGQ A;  1K54 A;  5CPI A;  5CHL B;  4WEJ A;  5AVC C;  3X1V C;  1XX2 A;  4E6X A;  5B33 D;  5B1M B;  1P3P A;  3D4F A;  3AZM B;  4R3B A;  3VP3 A;  3MGS B;  3C1B C;  5GT3 A;  4G92 C;  4WMC A;  3WA9 A;  3GR2 A;  4QLC A;  3LZ1 B;  4GZB A;  4A5R A;  5AVC A;  3X1V A;  1P3I B;  2FJ7 D;  5BT1 C;  1KX4 B;  1K38 A;  3SH7 A;  5IHV A;  2QZ6 A;  3ZG8 B;  3C4P A;  2VGK A;  3BEC A;  5GL9 A;  3R45 B;  1M18 D;  3BLS A;  3CJM A;  3HLB A;  1Q2P A;  2F8N D;  1IYO A;  3AZH B;  1H5X A;  5GSU C;  1KGF A;  1M19 C;  5HAP A;  4KZ4 A;  2PU4 A;  5FQ9 A;  4H9S C;  2P74 A;  3IT9 A;  4OQG A;  4S2P A;  3REI A;  5CHM A;  5G49 B;  2ZY5 A;  2V20 A;  3G2Z A;  3BRM A;  5B32 D;  5M19 A;  3G31 A;  4DXC A;  4QJG A;  4RA7 A;  3GTC A;  1IYP A;  3KUY D;  4GNU A;  2PYO C;  5GSU A;  1M19 A;  4UUZ B;  3AZF C;  5DF8 A;  4NYY A;  4H9S A;  5CTM A;  3REL C;  3X1U B;  1IKG A;  1K4E A;  3VOY A;  1HQ3 B;  4MNR A;  1K25 A;  3EPK A;  3AZE D;  4OP8 A;  1TAF A;  2F8N H;  3NQJ A;  5AVB C;  2PYO A;  2WKI A;  4KG5 A;  1W8Y A;  3AZF A;  2Y2J A;  1P3M B;  5B40 B;  1IEL A;  4GHL A;  4OON A;  3L26 A;  3UE3 A;  3MZF A;  3B6G B;  3WTP D;  3AN2 D;  3LJA A;  1W5D A;  5B0Y C;  3LZ0 B;  3AV1 C;  3HL9 A;  4Y7P A;  4GN2 A;  5AVB A;  4EO5 B;  1MKI A;  5E5A C;  2ZC5 B;  3MZD A;  3N4I A;  3X1T C;  3H0R C;  2Z2M B;  3LEL D;  4BD1 A;  4J8U B;  2XFS A;  2HIO C;  4XUJ D;  1YLY A;  5JRG B;  2IWB A;  5F83 A;  4E3I A;  3NIA A;  2NZD C;  5B0Y A;  4CSR B;  3AV1 A;  3GV9 A;  4GDN A;  4KZ6 A;  3W4O A;  3PBS A;  2ARO C;  4YIN A;  4E3K A;  5E5A A;  4Z5T D;  3AZK D;  1JFI B;  1EQZ C;  3VSK A;  3X1T A;  1F1E A;  3KWQ B;  2IOU A;  2G5I C;  3W96 D;  4XZQ C;  4R4R A;  2HIO A;  5B1M D;  1P3A D;  3EPH A;  2ZC4 B;  4OPZ A;  1G6A A;  5AY8 B;  4R8P B;  2Y2N A;  3ZVW A;  1KX3 D;  3MVD A;  3MGR B;  3JYI A;  4OUI A;  4BD0 A;  1KDS A;  4OJ6 A;  3M2J A;  1S32 B;  1XA7 A;  4LV0 A;  4WEL A;  1EQZ A;  2L5A A;  3UTA D;  3HLC A;  1S6R A;  4XZQ A;  2X01 A;  1BUL A;  3G4P A;  1YQS A;  3N3F A;  5CPJ D;  3WKJ C;  3C1C B;  2HDQ A;  3P5J B;  1ES4 A;  1CI9 A;  3REK C;  1NXY A;  4KZ9 A;  4HEF A;  3REJ D;  1YLT A;  3TU4 B;  1HZO A;  5AV8 D;  3BFC A;  1S0W A;  1JWP A;  4EBL A;  4LG2 A;  2H10 A;  1ID3 B;  4G91 B;  5EOE A;  5DNN D;  4RVA A;  4LD9 A;  5FAT A;  1PWC A;  4C3Q A;  4J8V B;  4J8W A;  3WKJ A;  2IWC A;  5AV9 D;  5GXQ D;  3NDG A;  4YS3 C;  2XD1 A;  3CMZ A;  3AGD A;  1Q9C A;  1PYY A;  3MGP B;  3VH6 W;  2Y2Q A;  3AYW B;  3VP2 A;  4AWL B;  1AOI C;  4KZB A;  5B31 G;  4LEN A;  2NQB B;  3NCK A;  4YFM A;  1J9M A;  3WX7 A;  3L25 A;  1PZR A;  5BS7 A;  4JBF A;  1K4F A;  2RVQ C;  5FQM A;  4YS3 A;  3G34 A;  1KX5 B;  1HQ3 D;  3AFA B;  1ONH A;  5CPK A;  2EX9 A;  3AZI C;  3VP0 A;  3ZG0 A;  3W97 A;  3A6N C;  4IBC A;  2Q9N A;  3OZH A;  4FH2 A;  3W99 D;  4DE2 A;  4DRA A;  4H9O A;  4E3J A;  3BYD A;  4WZS B;  1WYB A;  5B2I B;  4IBR A;  4OKP A;  4NE3 A;  3B3X A;  4ZJ2 A;  4OLG A;  4GH9 A;  1WWI A;  1PI5 A;  1P34 D;  2GDN A;  3AZI A;  4X55 A;  5CEC A;  5CXW A;  1TDG A;  1P3F D;  4DE0 A;  1ZLA B;  3N7W A;  4O7D A;  3A6N A;  5GT0 A;  3IP4 C;  4IBF A;  3AL0 C;  3SOI A;  1B67 A;  4JJN C;  5F1F A;  5AV5 B;  2ZQ8 A;  3WAA C;  3UPP A;  3AZM C;  4H9R B;  4QHC A;  2YFW B;  2X71 A;  5E2E A;  2DF4 C;  2BYM A;  4EV4 A;  3LZ1 C;  4NET A;  5E43 A;  5FQQ A;  1YLZ A;  3BFD A;  2ZY2 A;  2CV5 C;  1KE3 A;  5AV6 D;  1P3G C;  2XH9 A;  1KX4 C;  2HP5 A;  5FI7 A;  2JE5 A;  5B31 D;  1M6K A;  3WAA A;  3AZM A;  4DRT A;  3UTB B;  3AZN C;  2G5H C;  4P0M A;  5B0Z C;  3PBN A;  4R8P D;  3X1S B;  2OLV A;  2ZY3 A;  1HVB A;  3LZ1 A;  1GA9 A;  3LY4 A;  1S32 D;  4EBP A;  5EVI D;  2VQR A;  2CV5 A;  3AZH C;  1SDE A;  2J9O A;  1KX4 A;  4JF6 A;  3ITA A;  1L0E A;  3HUN A;  3AZL D;  3AZN A;  4ZBE A;  3KXB D;  1PIO A;  3HSH A;  3WS0 A;  1KDW A;  3ZNT A;  3C1C D;  3S4X A;  3R45 A;  4N9K A;  2PBY A;  1HTZ A;  3UDX A;  4OLD A;  2C6W B;  3AZH A;  5M1A A;  3ZFZ A;  1ONG A;  4N1X A;  1GHM A;  3PBR A;  4E45 A;  2A3U A;  3TOI A;  4S2I A;  5CP6 D;  1FSY A;  4KZA A;  3EPJ A;  4BLM A;  1XGI A;  2R9X A;  4Z9Q A;  4R0Q A;  1PWD A;  4H9N A;  1M1A C;  2X02 A;  2RIQ A;  3B6F C;  5CER A;  2FJ7 B;  2WGI A;  4IVI A;  4UUZ A;  3NDE A;  5FSR A;  1P3M C;  4Z66 D;  4EUZ A;  5FI2 A;  3E2K A;  2XK1 A;  2IO5 C;  4E3N A;  4JXW A;  3UPN A;  3X1U A;  3CZD A;  4ZJ3 A;  3A1K A;  1M18 B;  1RP5 A;  4RX3 A;  1YT4 A;  4WZ4 A;  1H8Z A;  3LZ0 C;  1JVJ A;  3IXG A;  2F8N B;  1M1A A;  2OSU A;  5EVL A;  2H0T A;  1TZY C;  1P3M A;  5B40 A;  2Q9M A;  5GLB A;  5E2G A;  1YUE A;  4LV3 A;  3O62 C;  3MNN C;  5JRG C;  3C1B D;  3B6G A;  1PWG A;  3V50 A;  3V9R A;  1BLP A;  3LZ0 A;  3IQA A;  1A7W A;  1F66 C;  3KUY B;  4H9Q B;  4NZ3 A;  1TZY A;  1PZP A;  5BT1 D;  2G2W A;  3ZG5 A;  2Z2L B;  3KWQ C;  1JTG A;  2EFU A;  3AZJ C;  4J8U A;  3UO9 A;  3MNN A;  5JRG A;  1U35 C;  4EQI A;  4RX2 A;  1BH8 B;  5AY8 C;  2RCX A;  4GD8 A;  3VMA A;  2WZX A;  3MGR C;  4HGA B;  3E2L A;  5KMW A;  3O88 A;  4H8R A;  2FFY A;  1JFI A;  3Q81 A;  1W2E A;  3KWQ A;  3Q07 A;  3SS3 A;  1P3L D;  5AY8 A;  3WTP B;  3AN2 B;  3MGR A;  5DTS A;  4JXS A;  1H8Y A;  3PBT A;  2OLU A;  4DRB A;  1BSG A;  3IWI A;  1FCO A;  5HX9 A;  1K54 C;  3VSL A;  4QY5 A;  1FCM A;  4X23 D;  3C5A A;  5C3I B;  4XUJ B;  4KGC D;  2IWD A;  3OCN A;  4ZTK A;  3REL D;  3AGE A;  3FWL A;  4U0T A;  2A49 A;  1N9B A;  4FH4 A;  4PM9 A;  3O87 A;  1RGZ A;  4KUD C;  4Z5T B;  5CTN A;  3AZK B;  2UWX A;  4WU9 D;  5DTK A;  3V39 A;  3AYW C;  3W96 B;  3C7U A;  2NQB C;  1P3A B;  4KQQ A;  4S2J A;  4J8V A;  2ZM8 A;  4PM5 A;  5F99 B;  1FQG A;  3Q1F A;  3PTE A;  5FQJ A;  2H0Y A;  3BFE A;  3WS1 A;  1KX3 B;  4OPR A;  4Z2M G;  5B0Y D;  1NYY A;  3OPH A;  3AFA C;  4JPM A;  4KUD A;  1CEF A;  3MXR A;  5BNX B;  1IYS A;  3GSG A;  3AYW A;  2WGW B;  4S2N C;  1YU1 A;  4RYE A;  3UTA B;  5CHU A;  2EXB A;  3BM6 A;  4UHU A;  2NQB A;  5HAQ A;  1BLH A;  3VH5 W;  2HIO D;  5CPJ B;  3L29 A;  5DNM B;  3Q7V B;  4GKU A;  5B2I C;  5FAQ A;  4OPY A;  2NZD D;  1XGJ A;  3REJ B;  4P85 A;  2YFV A;  1KX5 A;  5AV8 B;  4YM6 D;  3AFA A;  2ARO D;  3REI C;  4DQY B;  1Q2Q A;  1FSW A;  3IF6 B;  4S2N A;  5AQA A;  4R23 A;  3EQV A;  3AZG C;  5DNN B;  2W8S A;  4KQO A;  3W4Q A;  4BL2 A;  4WU8 C;  5B2I A;  5AV9 B;  5GXQ B;  5AQ9 A;  5AV5 C;  1DY6 A;  1P3K D;  1XXM A;  3IWO A;  4IBG A;  3C4O A;  1TDL A;  1ZLA A;  3VH5 T;  3AZG A;  2Y55 A;  2XD5 A;  5HL1 A;  4JF4 A;  1QME A;  5FI6 A;  1P3O D;  4WU8 A;  5B24 D;  5BO0 B;  5EPH A;  5AV5 A;  2JSS A;  4H9R A;  3UTB C;  3REK D;  1Z2C B;  2YFW A;  5DVA A;  1MWT A;  2HUE C;  4FD8 A;  2Y2I A;  5GHZ A;  3LJA C;  4NK3 A;  2WAD A;  3I7J A;  4QD4 A;  5EE8 A;  3UT9 B;  3EQU A;  3W99 B;  3HON A;  1I2S A;  3NQU B;  4LV1 A;  4E3M A;  4KHA B;  3MKE A;  4UA6 A;  3UTB A;  5GHY A;  2BYK B;  3HUO A;  1P34 B;  3B0D B;  4JXV A;  4WNN B;  3X1S A;  1BFM A;  1YLJ A;  1DJB A;  2Y2G A;  1U60 A;  1P3F B;  1PZO A;  3RXW A;  1AOI D;  5A91 A;  1O7E A;  3VP4 A;  5B33 C;  1CEG A;  3AV2 D;  4NY2 A;  2RVQ D;  1MXO A;  3AZI D;  3FKE A;  3MVD C;  3P98 A;  5G18 A;  2ZM0 A;  1P3B C;  4IBX A;  4Z2M H;  5FAP A;  1NZU A;  5I94 A;  4P87 A;  5B33 A;  5AV6 B;  2JBF A;  1BT5 A;  5B31 B;  5U47 A;  5FAO A;  3UN7 A;  4JLF A;  3ZNY A;  5F99 D;  1M18 C;  1P3B A;  2WZZ A;  4PPR A;  1I5Q A;  5EVI B;  3VP1 A;  2FJ7 A;  4JJN D;  3AZL B;  4D2O A;  3KXB B;  4LD9 C;  3FYZ A;  5DNM D;  4OPQ A;  4MBF A;  4J8W C;  1MBL A;  1M18 A;  1BLC A;  1NJ4 A;  4DXB A;  5B32 C;  3LY3 A;  4DE3 A;  5B2J D;  2F8N A;  2ZJ9 A;  3GQZ A;  4GOG A;  4X6T A;  1P3G D;  3IXB A;  4ZJ1 A;  4B88 A;  5E2F A;  1SKF A;  3NI9 A;  2BLS A;  1W8Q A;  3KFU G;  5B0Z D;  1L0G A;  5BS7 C;  5HFO A;  4DF6 A;  4B4X A;  5B32 A;  3N8L A;  3AZE C;  5CP6 B;  4QB8 A;  4HGA C;  3ZVT A;  5CPK C;  3WWX A;  1HD8 A;  3VOZ A;  3KUY A;  4NFT A;  1YMS A;  4H9Q A;  1GHP A;  1SDN A;  3SS4 A;  1ES2 A;  2Y91 A;  4R1G A;  3W97 C;  4Z66 B;  2Y2K A;  3W8K A;  3WTP C;  3HLE A;  5GT3 B;  3AN2 C;  3WA9 B;  3SH9 A;  3AZE A;  5CGS A;  2EX8 A;  1L2S A;  2HP6 A;  1YLW A;  4E6W A;  4R4S A;  2J9P A;  5KDM B;  3V3S A;  4LCL A;  3UT9 D;  1ERM A;  4JKT A;  4MBH A;  5GT0 C;  3LEL C;  4NE6 A;  5C3I C;  3W98 D;  1FCN A;  3C1B B;  3WTP A;  4G92 B;  3AN2 A;  4OVD A;  5JA4 B;  5BOH A;  3A3E A;  2EX2 A;  3CG5 A;  5JYO A;  1ZG6 A;  1CI8 A;  3VH6 T;  2I72 A;  4R3J A;  2HDS A;  4IED A;  2JCH A;  3B6F D;  4NZ4 A;  3LEL A;  4H9P B;  4XUJ A;  5B1M C;  1P3A C;  5KSH A;  1K6S A;  1K55 C;  3A3D A;  2B5R A;  4E3O A;  3MGS C;  1GHI A;  1K56 D;  4ZUX D;  4EBN A;  4JXG A;  4OQI A;  4IBI A;  5EUA A;  3GMW A;  2WKH A;  3W96 A;  4N1H A;  5DTT A;  1P3I C;  2Y59 A;  5B1M A;  1P3A A;  4OOL A;  1P3L B;  2LY8 A;  2RL3 A;  3O62 D;  3UE0 A;  1K55 A;  5HAI A;  3G30 A;  1KX3 A;  1DJC A;  3MGS A;  4J8X D;  4OJP A;  3REJ C;  5F1G A;  5TR7 A;  2WAF A;  1F66 D;  3NQJ B;  5BNX A;  3WTP E;  2PYO B;  2WGW A;  2Y2H A;  4X23 B;  1P3I A;  4K0X A;  3DWZ A;  3AZJ D;  4KGC B;  2V1Z A;  5CPJ A;  3REL B;  1U35 D;  4IBB A;  3Q7V A;  2XFT A;  5GXQ C;  1E3U D;  3REJ A;  3FKV A;  3G35 A;  3LCE A;  3O86 A;  4WU9 B;  2P9V B;  5DF9 A;  1PW1 A;  5F82 A;  3A3F A;  5DNN A;  5B1L D;  2XR0 A;  1BLS A;  3B0C W;  2ZMA A;  4UA7 A;  5AV9 A;  1MWR A;  5GXQ A;  2XLN A;  3VFH A;  3QHY A;  5B0Y B;  3X1U C;  3AV1 B;  4QNL A;  1IYQ A;  1HQ3 C;  5G49 A;  1ESU A;  2HDR A;  3P09 A;  3LO7 A;  2EX6 A;  1MY8 A;  3REH D;  3MGQ D;  5CPI D;  4MLL A;  4L0L A;  2HIO B;  1P3P D;  5BO0 A;  5B40 C;  1O07 A;  3MBZ A;  4XUZ A;  2NZD B;  1YU0 A;  2DRW A;  1HQ3 A;  1P34 C;  4YM6 B;  3B6G C;  2ARO B;  4OP5 A;  5GT3 D;  3BLM A;  4WMC D;  3WA9 D;  3KS4 A;  4QLC D;  1EQZ B;  4JF5 A;  3PBO A;  3N6I A;  3B0C T;  1XA1 A;  2H5S A;  3HLG A;  4EO5 C;  5AVC D;  3X1V D;  3W99 A;  3L2A A;  4C75 A;  3NQU A;  4Y0U A;  3BFF A;  3C7V A;  4KHA A;  1K57 C;  5KSC A;  2Y2P A;  1N4O A;  4HES A;  1P3K B;  4J8U C;  2BYK A;  4KZ3 A;  1P34 A;  3ZG7 B;  3RJU A;  4GHA A;  4WNN A;  2HPB A;  2DCF A;  1P3F A;  4S2M A;  3PAE A;  1P3O B;  2WAE A;  5HW3 A;  5B24 B;  2F8N K;  1K57 A;  5E2H A;  5B31 C;  1YU2 A;  5A93 A;  5FQK A;  3N8R A;  2XQZ A;  1ALQ A;  3REK B;  2ZQA A;  4WZ5 C;  4X53 A;  4MBK A;  4R8P C;  3REI D;  4CSR A;  4XUX A;  1VQQ A;  3SH8 A;  4PM7 A;  4M6B A;  1S32 C;  3HBR A;  5AV6 A;  3M6H A;  5GSU D;  5B31 A;  1M19 D;  2XEP A;  4WU8 D;  3AZL C;  3KXB C;  4WZ5 A;  3QNB A;  1SCW A;  3OPP A;  4Y0O A;  4R8P A;  4QY6 A;  3C1C C;  3TG9 A;  3TU4 C;  3MFD A;  4X56 A;  1AOI B;  1M40 A;  1S32 A;  4N9L A;  4WBG A;  2ZD8 A;  2PYO D;  3DTM A;  3AV2 B;  1ID3 C;  4H9O B;  4G91 C;  3AZF D;  2CWE A;  3AZL A;  3KXB A;  1YLP A;  3A3J A;  4ID4 A;  4J8V C;  4NYU A;  3C1C A;  1ES3 A;  1KGE A;  2BG1 A;  2WKE A;  4EWF A;  3IH9 A;  3F6T A;  3AZI B;  3LJA D;  3MZE A;  3TU4 A;  4OJ5 A;  4CJN A;  1GA0 A;  3Q82 A;  4QU3 A;  5AVB D;  3MGP C;  5A92 A;  2ZM2 A;  1ID3 A;  4AWL C;  2J8P A;  1PW8 A;  4KG2 A;  1OME A;  4Z66 C;  4S2K A;  2HDU A;  4BL3 A;  5BNV B;  1YU3 A;  1LI0 A;  5CP6 A;  3AV1 D;  2BYM B;  1KX5 C;  3WS2 A;  3MGP A;  3FDD A;  2ZQC A;  3ZG9 B;  4S2L A;  5E5A D;  3L28 A;  4JJN B;  2EXA A;  3X1T D;  4Z66 A;  3KSY A;  3WAA B;  3IWQ A;  1MWS A;  1N1J B;  1JTD A;  1RGY A;  1FR1 A;  4OOY A;  3MVD D;  1R4V A;  1P3B D;  4C6Y A;  2WYX A;  5B2J B;  4KZ8 A;  4WV4 B;  5KDM A;  2E8I A;  2CV5 B;  1EQZ D;  1ZLA C;  1H3O B;  1P3G B;  5KZH A;  4BQM A;  4XZQ D;  3AZN B;  3RXX A;  4GD6 A;  3C1B A;  5B0Z B;  4GB7 A;  5JA4 A;  1XKZ A;  5TGF A;  1BH9 B;  1XPB A;  5TFQ A;  4S2O A;  4XXR A;  4H9P A;  3OC2 A;  4LD9 D;  1P3L C;  5FUG B;  1LLB A;  4J8W D;  3WKJ D;  4IBJ A;  3PAG A;  2WGV A;  3EG5 B;  3UNW A;  2ZC3 B;  3SS5 A;  3EPL A;  4K91 A;  3WRZ A;  3X1S C;  3WS5 A;  2OV5 A;  1WYC A;  4X68 A;  4H9N B;  4FCF A;  3ZCZ A;  4X23 C;  4KG6 A;  4ZDX A;  4F94 A;  1P3L A;  3W98 B;  4KGC C;  4IBK A;  3Q7Z A;  1ERQ A;  1BTL A;  4ZBJ B;  1CK3 A;  5DF7 A;  4YS3 D;  5FA7 A;  2XF3 A;  5CPK D;  2JC7 A;  1ES5 A;  1M1A B;  3B6F B;  4WU9 C;  4X23 A;  3IF5 A;  3W97 D;  4KZ5 A;  4KGC A;  3ITB A;  2IO5 B;  3REL A;  4DDY A;  4IJE A;  3ZGA B;  5M18 A;  1KGG A;  4PM8 A;  3V9R B;  1L0F A;  5A90 A;  4ZUX B;  1NY0 A;  4M3K A;  4WU9 A;  2P9V A;  2Y2M A;  3VH6 A;  1TZY B;  3A6N D;  4MEZ A;  5GT0 D;  2FJ7 C;  3O62 B;  3MNN B;  3S1Y A;  2ZC7 A;  4J8X B;  4OQH A;  1E4D A;  3UE1 A;  4YM6 C;  4HBU A;  1F66 B;  1WE4 A;  1LL5 A;  4UAA A;  1LI9 A;  4Q8I A;  3AZJ B;  4P6B A;  1KVM A;  1U35 B;  1L0D A;  1FR6 A;  2QMI A;  3WAA D;  1TEM A;  3AZM D;  2NZD A;  1P3K C;  1KU5 A;  3MGS D;  4YM6 A;  2ARO A;  4CAY B;  3LZ1 D;  1K6R A;  3IHB A;  3TSG A;  5B1L B;  3KUY C;  2XGN A;  1P3I D;  2CV5 D;  1P3O C;  1ERO A;  4X69 A;  1KX4 D;  5B24 C;  1JWZ A;  1P3K A;  3AZN D;  1C3B A;  4IVK A;  3DW0 A;  5GLC A;  3MXS A;  2FFF B;  3H0M C;  1B6W A;  4OJO A;  4WEK A;  2EFX A;  3REH B;  3MGQ B;  5CPI B;  3IXH A;  2ZC6 B;  3AZH D;  4KZ7 A;  1P3O A;  5B24 A;  1P3P B;  3UPO A;  4KQR A;  1GCE A;  3IH8 A;  5EEC A;  3REK A;  3UDF A;  1BH8 A;  1HTA A;  3G2Y A;  5JYP A;  1T3U A;  4KUD B;  4QLC B;  4OJL A;  2XDM A;  3OPR A;  1AXB A;  5AVC B;  3X1V B;  1YU4 A;  2HP9 A;  2J8Y A;  4IJF A;  3AV2 C;  1KE0 A;  2ZQD A;  2ZLY A;  3MKF A;  4XUJ C;  5CEB A;  5CRF A;  3HLF A;  3X1U D;  3IHA A;  2YFV B;  2J7V A;  2PU2 A;  3M6B A;  1YM1 A;  3IXD A;  1AOI A;  2WK0 A;  3FV7 A;  1M1A D;  4Z5T C;  4ZAM A;  3AZK C;  3OCL A;  3S22 A;  3AV2 A;  1BZA A;  4OH0 A;  1P3M D;  5B40 D;  3W96 C;  5CED A;  5HAR A;  1ULY A;  2DQN C;  5GLA A;  4CPK A;  2ZM5 A;  1ZC2 A;  5F99 C;  3B6G D;  3REI B;  1G68 A;  1KX3 C;  2DNS A;  4LV2 A;  5FQI A;  1KVL A;  4WJ3 C;  3LZ0 D;  3ZDJ A;  1KE4 A;  3AZG B;  1EI5 A;  3BEB A;  4Z5T A;  3AZK A;  3UY6 A;  1ESI A;  1W7F A;  2VGJ A;  5GSU B;  1TZY D;  1M19 B;  3UTA C;  4PM6 A;  4WU8 B;  1MPL A;  4IBE A;  3A3I A;  4J8U D;  3MNN D;  5CPJ C;  5F99 A;  1Z6F A;  2C5W B;  5DNM C;  2ZQ9 A;  5JRG D;  4E3L A;  2WUQ A;  1VM1 A;  5BNV A;  4DE1 A;  4UPK A;  1I2W A;  5AV8 C;  5B2J C;  1NRF A;  1TAF B;  4GDB A;  1ZKJ A;  3IF6 C;  4JJN A;  3UTA A;  4Y0T A;  3AZF B;  1LL9 A;  3KWQ D;  5DNN C;  5DNM A;  2CC1 A;  1N1J A;  3HVF A;  5AV9 C;  5AY8 D;  2HUE B;  3LJA B;  4NZ5 A;  4B4Z A;  3MGR D;  2QPN A;  3VFF A;  5AV8 A;  5B2J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...