2XD1A

Active site restructuring regulates ligand recognition in class a penicillin-binding proteins
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
489
structure length
469
Chain Sequence
b'SISEITYSDGTVIASIDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTNQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PENICILLIN-BINDING PROTEIN 1B
publication title Active Site Restructuring Regulates Ligand Recognition in Class a Penicillin-Binding Proteins.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
total genus 145
structure length 469
sequence length 489
chains with identical sequence B
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2xd1A01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2xd1A03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2xd1A02
3QNCA 4DF6A 4BQMA 1BLSA 1XP4A 4WELA 3NDEA 5CHMA 3ZGAB 4DE1A 2HP6A 1CK3A 3AGEA 2WZXA 4IBRA 3IF5A 2Y2LA 3ZG9B 1ZG4A 3OPRA 1K6SA 4PM8A 1BZAA 2DNSA 5CEDA 2G2UA 4MBKA 4S2NA 3LO7A 4UA6A 4OPYA 2WGVA 1ESIA 1LHYA 1MKIA 1YLYA 1K55C 3QHYA 1FOFA 5DF7A 3E2KA 3V39A 1NRFA 5EVIB 1KGFA 5CXWA 3LY3A 3IH9A 1XA7A 2G2WA 5F82A 5HAPA 5M19A 3MBZA 3UPPA 1BLHA 4HESA 4KZ5A 5GHZA 4OQ0A 1XGIA 4GN2A 5M18A 3VOYA 3M2KA 1NZOA 3WS1A 5GLDA 5DF9A 5A93A 3ZVWA 3SS4A 1Z6FA 3HLFA 1YLJA 2I72A 1LL5A 1MWSA 4LENA 3N4IA 4DE0A 3GV9A 2HDUA 3RJUA 3VP2A 1L0FA 4JPMA 4U0XA 3ZG7B 4S2LA 1KDSA 1ERQA 1XPBA 5KZHA 2HP9A 2V20A 5BOHA 1JWPA 4GZBA 1RP5A 3HUMA 5CGWA 3LY4A 2IWCA 3CJMA 2ZQCA 3LCEA 4OQHA 1PZPA 1K25A 2EX6A 1IYSA 1EWZA 2ZC5B 3BEBA 3IH8A 1CI8A 4MNRA 3ZG0A 4DKIA 3WWXA 1ESUA 4HBTA 2XF3A 5FDHA 1FR1A 1VQQA 4GDNA 1K56D 3GTCA 4PM9A 4OQIA 2EXBA 5TR7A 4RX3A 4D2OA 3S1YA 3SS3A 2Y2KA 2ZC6B 1FQGA 3GR2A 4QHCA 3IF6B 4JKTA 3BLMA 2PU4A 3N7WA 4QY5A 1EI5A 4EBLA 4OP5A 4O7DA 4BLMA 3ISGA 3PBNA 3ZNYA 3FV7A 4EBPA 3MKFA 4UHUA 1W79A 4ZBEA 1IYPA 4ZJ1A 2DRWA 4E3LA 5GHYA 2OV5A 5FI7A 3OC2A 1TEMA 3A3DA 3BRMA 2XFSA 2XD1A 2WGWA 1MBLA 1MWTA 4LV2A 5FQIA 3P09A 4E3MA 1YMXA 3NI9A 3WS5A 2WGIA 1HVBA 4N9KA 1PI4A 2HDSA 2OLUA 4OP8A 4WEKA 3UDFA 3UE0A 4C3QA 1LI0A 1Q2PA 2V2FF 5FQJA 5GHXA 3IXHA 1QMEA 3NC8A 3HLGA 5DVAA 4RYEA 3BM6A 1O07A 3CMZA 1GHMA 1L0EA 2HDQA 4LCMA 1GHIA 1ONHA 5FQ9A 4K0XA 1Q2QA 4JXSA 2HP5A 4E6WA 3MZEA 3V3RA 1BLCA 2Y4AA 4FD8A 4KG5A 3WS0A 4U3TA 2Y2PA 2WAFA 3HBRA 3A3IA 2VGKA 1DJAA 1PW8A 2EX2A 3AGFA 3GQZA 3O88A 4B4XA 4X6TA 1M40A 2XEPA 4N1XA 4OPRA 1HTZA 3UE1A 3Q1FA 4ID4A 3HUNA 4S2OA 4Q8IA 1KVMA 4QY6A 2DCFA 2RCXA 3LEZA 5J8XA 5FAOA 1NXYA 1YM1A 1RCJA 2CC1A 2B5RA 3ZFZA 5FSRA 1K4FA 1KVLA 3A3FA 4HBUA 5AQ9A 5CGSA 2JE5A 1IYQA 5CTMA 3V5MA 3SH8A 4L0LA 3V50A 2Y2IA 5EVIC 4CJNA 1E4DA 4ZAMA 1KDWA 1SHVA 3UDXA 3IHBA 4RVAA 1W8YA 1Y54A 2WGWB 4UA7A 5DTTA 1GCEA 5FQKA 3N8LA 2WK0A 3O86A 5DTKA 1H8ZA 4JBFA 3IWQA 5EECA 1IELA 5EOEA 5I94A 1U60A 3Q7VB 4UA9A 1FCNA 4FSFA 2X71A 3W8KA 1CEFA 1ZC2A 2WUQA 3VFHA 4OOLA 4LCLA 3Q82A 4PPRA 1MPLA 3NIAA 3IXGA 1BULA 4KZ6A 3PBSA 4OVDA 1L0GA 2R9WA 3ITBA 4GB7A 3VSKA 3VP0A 1H8YA 1HZOA 3MXSA 1PWGA 3ZHHA 3B3XA 2WZZA 3GMWA 3ZDJA 3W4QA 1TVFA 5G18A 2Y2OA 1K55A 3MFDA 3HUOA 4PM7A 2VGJA 3D4FA 5E43A 5A90A 4PM6A 3IF6C 4KZ7A 5CRFA 3NBLA 4EQIA 3Q07A 1MXOA 2A49A 4LV0A 1S6RA 4BD0A 3HLBA 3UPNA 1RGYA 4X53A 2UWXA 3CZDA 3WS2A 3BFDA 5CHUA 1PYYA 2QMIA 1K54C 4MBHA 5HX9A 1W5DA 4OQGA 2ZQ8A 4JF6A 4JF4A 3WS4A 2WKEA 3HVFA 4S2IA 3SH7A 2E8IA 2Q9NA 2Z2LB 1OMEA 3DWZA 1ES2A 1IYOA 2H5SA 3FYZA 4U0TA 5E2FA 3ZG8B 2J9OA 3BFFA 4DXBA 3M6HA 3N6IA 4KG2A 3M6BA 4E3OA 5EPHA 3PBTA 4DXCA 1PI5A 1ZG6A 3PBRA 5HL1A 5IHVA 4JLFA 4X68A 1BUEA 3FKVA 5CHJA 2JCHA 4P6BA 3O87A 3ITAA 3WRZA 2Y55A 4S2PA 1ERMA 4ZTKA 1K4EA 2X02A 4DE3A 3S22A 3DWKA 4WMCD 3UN7A 2H10A 4JF5A 2EFUA 4P85A 5FAQA 5AQAA 4F94A 3RXWA 2FFYA 4QU3A 4C6YA 5CECA 4KZ8A 4WYYA 5KMWA 1YLTA 4OPZA 3TSGA 4S2MA 3Q7ZA 4GD8A 3G2YA 3W4PA 2ZM0A 2H0TA 5CTNA 2FFFB 3OZHA 5E2GA 1K56A 4BD1A 5JYOA 4OH0A 3C5AA 4NK3A 1I2WA 4OOYA 2ZC3B 2OSUA 4GDBA 4QD4A 1E25A 4EBNA 3PTEA 4R4SA 1NY0A 2ZLYA 5FASA 4NETA 4WBGA 1PWDA 2P9VA 4WMCA 4Y7PA 4MBFA 1K57C 4X56A 1JWZA 1EROA 5EVID 3IWOA 3WRTA 2Z2MB 1JTDA 2WKHA 3HREA 3PBOA 4OKPA 4KZ3A 2C5WB 3BFEA 4IEDA 1ES5A 3GRJA 3BFCA 5GLBA 2ZC7A 1FSYA 3NY4A 2Y59A 5U47A 4DE2A 4XUZA 4R4RA 4OPQA 3N8RA 2XH9A 4OLDA 2GDNA 3O3VA 1L2SA 4LV3A 3P98A 5CERA 4ZJ2A 3DW0A 5FATA 4FH2A 2ZD8A 4BENA 5TFQA 3OPHA 3PAGA 5GLCA 3VOZA 2HDRA 4IBXA 2J9PA 1FCMA 3E2LA 4JXGA 4R3JA 5A92A 1YMSA 4DDYA 4EUZA 3G2ZA 1JVJA 3DTMA 3EQVA 1PZOA 3ZG5A 1BLPA 5CEBA 1DJBA 2WADA 1GHPA 4DDSA 5EVIA 5F83A 3EQUA 4P87A 3OCNA 1CEGA 4YINA 1PW1A 2V1ZA 3HLWA 4HEFA 3HLDA 1CI9A 1K6RA 5FAPA 5GLAA 2XFTA 3NCKA 4GOGA 2H0YA 1E3UD 1WYCA 5E2HA 4KENB 2OLVA 4DRTA 4R3BA 4QB8A 4Y0OA 4BL3A 1C3BA 3I7JA 3GSGA 4PMAA 2JBFA 3UNWA 2XLNA 5L2FA 4Z9QA 1XX2A 4P0MA 3UY6A 2PU2A 1SCWA 2ZJ9A 4GNUA 4WZ5C 1GA9A 5AQBA 4RX2A 4E3NA 3UE3A 4GD6A 1JWVA 3NDGA 4ZDXA 2Y2GA 2ZC4B 5FQMA 4E3JA 5HAQA 4MEZA 4XUXA 5EOOA 3W4OA 4R1GA 4KQRA 1XA1A 5HARA 3VP1A 2XGNA 5KSHA 1E3UA 2ZQDA 4FH4A 1XGJA 3IF6A 4JXWA 3C4PA 4CPKA 4S2NC 2XQZA 1L0DA 3ZNTA 2EX8A 5A91A 4Y0TA 1N9BA 4N1HA 3VFFA 5FQQA 3C4OA 2J7VA 1W7FA 5DF8A 2X01A 3QNBA 1LLBA 1PWCA 2XK1A 5HFOA 1K54A 4E3IA 1DJCA 4M3KA 1WE4A 4A5RA 2QPNA 2Q9MA 1MWUA 3CG5A 2WKIA 3SOIA 4X69A 5GL9A 4Y0UA 2ZMAA 4RA7A 2XDMA 3BECA 5JYPA 2QZ6A 3FWLA 1FR6A 1SDNA 3PBQA 4GKUA 1G68A 2JC7A 1HD8A 1BSGA 1ONGA 3A3JA 2EX9A 3FKWA 1YQSA 4OLGA 1S0WA 1ES4A 1M6KA 1YT4A 4EV4A 4XXRA 2XD5A 3JYIA 3SS5A 4E6XA 4BL2A 3BLSA 5E2EA 3C7UA 1NJ4A 4EWFA 5DTSA 1XXMA 1IEMA 4YFMA 1LL9A 2EFXA 3UO9A 5TGFA 1NYYA 4JXVA 4KZ4A 1SKFA 3IXBA 4R0QA 5FI6A 4KQOA 4E3KA 1YLWA 1FCOA 2BLSA 1BTLA 2J8YA 1WYBA 1NZUA 2ZM8A 3OPPA 2Y2NA 1YLPA 3VP4A 1IKGA 2EXAA 5D3OA 1XKZA 5EVLA 2Y2QA 1DY6A 1ES3A 5HAIA 1YLZA 3IQAA 3C7VA 4B4ZA 5EE8A 3IWIA 3GVBA 4K0WA 4KZBA 4N9LA 3MZDA 3V3SA 1NYMA 1GA0A 4H8RA 4BJPA 4KZAA 1LI9A 3IXDA 3Q81A 2Y2MA 3VMAA 1BT5A 4PM5A 3UPOA 1K38A 3TOIA 4KQQA 3G30A 1KE4A 1K57A 3G31A 4S2KA 4UAAA 2BG1A 3VSLA 3MZFA 2A3UA 3G35A 3MKEA 4IVKA 3Q7VA 2IWDA 1MWRA 1ALQA 3TG9A 1KE0A 1O7EA 3ZCZA 3HLEA 2RL3A 3ZVTA 2P74A 4WZ4A 5M1AA 1N4OA 2ZQ7A 1I2SA 3MXRA 2ZM2A 4MLLA 1J9MA 3HL9A 2PBYA 2ZQAA 1KE3A 5F1FA 1JTGA 4WEJA 4FCFA 3G32A 4R23A 3RXXA 2XR0A 4KG6A 5FA7A 4OOMA 3BFGA 1TDLA 4WM9A 1SDEA 1TDGA 1KGGA 2Y91A 4OONA 4X55A 1I5QA 3OPLA 1KGEA 1QMFA 4K91A 4LV1A 5FI2A 2WYXA 4B88A 4N92A 3N8SA 4QJGA 3HLCA 3M2JA 2R9XA 1IKIA 2ZQ9A 4C75A 1AXBA 5KSCA 5EUAA 4IVIA 1ZKJA 3VP3A 2HPBA 3IHAA 3S4XA 2Y2HA 3UDIA 3OCLA 2C6WB 2WAEA 1PIOA 2P9VB 3G4PA 3PAEA 5AQ7A 4ZJ3A 3A3EA 2Y2JA 4S2JA 2IWBA 1VM1A 1FSWA 1G6AA 4KZ9A 5CGXA 3IT9A 3BYDA 3AGDA 1H5XA 3FZCA 1RGZA 3SH9A 5HW3A 1MY8A 3G34A 1W8QA 4WZ5A 5F1GA
chains in the Genus database with same CATH superfamily
4DF6A 4LD9A 5CHMA 1XP4A 3UTAB 3L9KA 3NDEA 1UWNX 4WELA 3ULFA 3ZGAB 2HP6A 4KUDA 3IF5A 1ZG4A 1N1JA 3REID 3IP4C 3S7NA 4MN6A 3MGSC 1XFQA 4Y3IA 5CEDA 5GSUA 5HSQA 4H9RA 2RTSA 1FOFA 3NQUB 3E2KA 3FPWA 5CP6A 3LZ1D 3IH9A 3NULA 5F82A 2VX8A 5DJUA 5L8MA 2ZY3A 2LY8A 3WTPA 4IUHA 2R78A 2OWJA 4Z2IA 2KLIA 1P3MB 3HLFA 3AN2B 2L1MA 4GCZA 1P3GC 3N4IA 1KX4D 2HIOB 2HDUA 3GV9A 3VP2A 3REHC 4J8XC 1JWPA 1RP5A 2NZDD 3HUMA 2JKRI 3IX8A 3WD4A 3LCEA 4OQHA 3EPJA 1K25A 1PZPA 2EX6A 4PAUA 3ZG0A 3W99A 1TZYA 2EWWA 4KHAA 3LJAB 4HBTA 3C1BB 1FR1A 1VQQA 1K56D 2OOLA 4HHDA 5B32D 3GR2A 4QHCA 3IF6B 3VOLA 4JKTA 4MB4A 2F8ND 4EBLA 3PBNA 2XSSA 3LR0A 4EBPA 4NXBA 4UHUA 4ZJ1A 2DRWA 1P3LA 3OC2A 3A3DA 3BRMA 2W3EA 2XD1A 5AV8A 4E3MA 1A0KA 2J3TD 1YMXA 2GX5A 3NI9A 2WGIA 4N9KA 1DRMA 3UDFA 1A7WA 2QYBA 1Q2PA 2V2FF 3IXHA 3AZMD 3LELA 2CV5A 1AWIA 3HLGA 3WAAD 4RYEA 1OJGA 4WJ3C 3REJD 1O07A 4HIAA 3AV2A 1GHMA 4UPKA 1GHIA 4K0XA 1Q2QA 4JXSA 2HP5A 3MZEA 3MVDB 3AZLB 3V3RA 5GXQC 2NQBA 2J3TC 4KG5A 2Y2PA 1ZTUA 5DNMB 3WD3A 2VGKA 3O88A 4YM6A 1M1AD 1M40A 4OPRA 3R7WB 1HTZA 3WAAC 3VH5W 3F1NB 2DMWA 3AZKA 5FSRA 3A3FA 4HBUA 4WU8A 5AQ9A 2V0UA 2JE5A 5B31D 3V5MA 5EVIC 5AY8B 2WGWB 1GCEA 1S32B 2PYPA 3N8LA 1N9OA 4OJPA 3F1OB 3WKJC 5DTKA 2M7VA 1H8ZA 4WN5A 1IELA 2ZY4A 4LFUA 5B1LC 5AVCA 4Z66D 4UA9A 2X71A 4H9OA 1P3AD 1HQ3D 3W8KA 5BO0B 3MF0A 5AV9A 3MGRC 5B31C 3CUEA 3Q82A 1MPLA 2ZL1A 3IXGA 1P3FA 2Y8HA 2R9WA 4EERA 3VP0A 1ID3D 3A6NC 3EPHA 2QJ7A 3ZHHA 3B3XA 4YS3C 4NYUA 3B47A 3W4QA 4MN5A 2PYRA 3HUOA 1M19C 5E43A 2VGJA 3D4FA 3E0YA 1P3AC 1T18A 1HQ3C 4EQIA 3Q07A 4LV0A 3ZYTA 5I5LA 3UPNA 4KGCC 3T1SA 4X53A 3CZDA 1H3OB 5CHUA 5CPKD 4MBHA 2PRFA 2ZQ8A 4JF6A 1YPRA 1P3IB 2A24B 1UR8A 1EW0A 4X25A 1OMEA 3LIEA 4WU9B 3FYZA 4U0TA 3EGDC 3ZG8B 2JSSA 1OJ5A 3IS2A 3M6HA 3N6IA 4G91B 4GH9A 3M6BA 4DXCA 3W96A 3K3DA 1PI5A 1ZLAB 1YAXA 5HWVA 4X68A 3S7OA 2XROA 3AZHD 3PYPA 3O87A 4S2PA 3AV1D 4ZUXC 1W1YA 4DE3A 3DWKA 4EU0A 4I3IA 5DNND 4P85A 5AQAA 2D02A 2PYOD 5AV5D 3RXWA 5KMWA 4KZ8A 4UEYA 2H0TA 2Z6DA 3PXPA 3OZHA 5E2GA 3X1VD 3AZHC 3UTAD 4GHLA 1I2WA 1E25A 1P9WA 4R4SA 2ZLYA 3KYEA 4NETA 4WBGA 1P34B 4Y7PA 1B67A 4X56A 2CMNA 1F66C 1JWZA 3REKA 3MQ0A 3PBOA 2C5WB 4IEDA 1FSYA 3LZ0C 4H9SA 3UE6A 2Y59A 3EEHA 4DE2A 1HLUP 4H9NB 3N8RA 5B2JB 4OLDA 4H9QA 2BYMB 1P3MD 3X1SA 4FH2A 3CITA 3OPHA 3AN2D 3PAGA 1EAKA 3VOZA 2PR6A 4R3JA 3E2LA 2D01A 5A92A 1FILA 2W1TA 3G2ZA 5L10A 1U35A 2W0NA 1P3OD 3DTMA 4I3JA 2W3HA 1DJBA 2WADA 3H7WB 3WX7A 4DDSA 2HZ5A 3RH8B 5J7EA 3OCNA 1BH9B 3LJAD 3HLDA 1Q9CA 5FAPA 1J7MA 1P3MC 2XFTA 5L07A 1P3PB 3RELA 2VJWA 1E3UD 5E2HA 4DRTA 5AV6C 4IJFA 2HIOC 4R3BA 4QB8A 4I3AA 5GT0A 3AZJB 1C3BA 4ZRRA 4PMAA 1YSQA 5C5KA 2O99A 4QWOA 1KX3C 1XX2A 1P97A 3UY6A 1S67L 3C1BC 1GA9A 1JWVA 5B0YA 3NDGA 2ZC4B 3RTYA 2KOIA 4HP9A 3W4OA 4KQRA 1XA1A 2XGNA 2ZBBA 3PR6A 1XGJA 3QP4A 4FH4A 4IBGA 2XQZA 3HCYA 5A91A 4N1HA 4Y2FA 2J7VA 1W7FA 3KX0X 3QNBA 4AWLC 3MVDD 3AZLD 5HFOA 3KYZA 4Y17A 4A5RA 2QPNA 4HMEA 3VE4A 3B6GB 1F9IA 4X69A 3UT9A 2A2LA 4M6BA 2QHKA 5JYPA 1O6IA 3FKWA 4I39A 1YQSA 4OLGA 3MVDC 2JHEA 5BPVA 2XD5A 3JYIA 3VH6T 5E2EA 2G7UA 3MGSB 5DNMC 2RVQC 5BNVB 3UB7A 5TGFA 4KZ4A 5HL6A 2FZ0A 1JFIB 3AZEA 4E3KA 4WNNB 3F1PB 4R38A 1FCOA 4PHTA 1WYBA 2Y2NA 2PAVP 5D3OA 3BQAA 1XKZA 5EVLA 2VQRA 2Y2QA 1ES3A 5JRGA 3QP8A 4I5SA 3PHYA 3C1CA 1OGBA 1YU0A 5AY8C 3IWIA 3MGQC 1S32C 3WA9A 1GA0A 2BTFP 3MR0A 3Q81A 1TAFA 3AZFC 4PM5A 3MNNB 3UPOA 1K38A 3T4SA 3G30A 3G31A 4Z5TA 3AYWC 3VSLA 3G35A 3MKEA 5AVBD 1STZA 1ALQA 4QLCB 1KE0A 2RL3A 3GDIA 1I2SA 5AVEA 3T1XA 1YUEA 4IUKA 2PBYA 1YU1A 1P3ID 3KWQA 4MB5A 3B6FB 3ZQ5A 3BFGA 4WM9A 1SDEA 2PT7A 4WU9D 3JVUA 3TU4D 2DF4C 3KFUG 3W97A 4GJ4A 5DKKA 5AJGA 4XT2A 4LV1A 4QJGA 4HQAA 4N92A 5B40A 2ZQ9A 4C75A 4E44A 5EUAA 5KSCA 5FUGA 1CJFA 4UQIS 4J8WA 3S4XA 4J8VC 4NEED 3BQ8A 1W63Q 3X1UB 2WAEA 1PIOA 4XUJD 2P9VB 2UV0E 4O0PA 4LRZE 4ZJ3A 3VE3A 4WU9C 1XJ2A 1VM1A 3AZNA 4G91C 4JGQA 4X1MA 5FDSA 1P3KA 3SH9A 4YNRA 1MY8A 1ZLAC 5CPIB 4ARZB 4HGAB 5E5AA 2ZY2A 1BLSA 5B1MA 4DE1A 1OT9A 1T1BA 5G4ZA 2PHYA 1K6SA 1BZAA 5CPJA 2DNSA 4CLCB 1OT6A 4S2NA 4BBTA 1P34D 1ESIA 1MKIA 1T3UA 4AFIA 5EVIB 3O62C 5M19A 3F6TA 3K3CA 1P3BA 5GT3D 5F99A 4OQ0A 3WKJB 1D06A 5GLDA 5IS1A 5A93A 1AOIB 3SS4A 1Z6FA 4DJ3A 1YLJA 1LL5A 4LENA 3NOPC 3REIA 4KUOA 1T1AA 2YFVA 3ZG7B 5KZHA 5BOHA 1GXDA 1TS8A 3CJMA 3KXBB 3LZ1A 1IYSA 1EWZA 3BEBA 3IH8A 4MNRA 3VH5A 3A6NB 2MJ6A 1N9NA 1ESUA 2XF3A 5FDHA 4YS3B 5B2JC 3GTCA 5TR7A 3S1YA 3E98A 1H8PA 4KUDB 1FQGA 2ZC6B 3H0LC 1BH8B 3BLMA 1N1JB 1VEUA 2PU4A 4QY5A 1EI5A 3AZJD 4KGCB 4O7DA 1KX4A 5GSUB 3ISGA 4Z1WA 3FV7A 3R4KA 5CX7A 5HPFA 3MKFA 4H9RB 1W79A 4ZBEA 5GHYA 2NZDA 5CP6B 1M18A 4LV2A 5FQIA 3P09A 4C3QA 2OLUA 1HTAA 1P3PC 1LI0A 5FQJA 3R45B 3MXQA 2V1BA 5GHXA 3WTPB 2FJ7D 5B32A 4EEUA 5K5BA 4IJGA 3LR4A 2F8NA 1L0EA 1BFMA 4JJND 5FQ9A 3AZGD 3DTEA 3T1RA 2IOUA 4ZUXB 1JNUA 3WS0A 4U3TA 3W99B 1TZYB 1W63M 4KHAB 3B6GD 4B4XA 4X6TA 3KUYD 2G5HC 4JGOA 3AZMA 4S2OA 2JKFA 1B6WA 2DCFA 2RCXA 3CHWP 5FAOA 1NXYA 3SZTA 4R6LA 1RCJA 3AL0C 3REJA 2B95A 1MC0A 1S4RA 4R3AA 1CF0A 3V50A 5HDCA 1P3LB 4ZAMA 1LL8A 3MGSD 5FL3A 3H9WA 3IHBA 1W8YA 1Y54A 4RVAA 3B6GC 1XJ6A 4UA7A 5AV8B 5FQKA 3TE8A 3T12B 1F66B 1M1AA 4JBFA 2CV5B 4Q0IA 3Q7VB 3HJIA 3LZ0B 3B0CT 3VFHA 1TF1A 1EQZA 3AV2B 4OOLA 4GS9A 4PPRA 3AFAC 1E8BA 3C2WA 3NIAA 1BULA 2O0YA 4KZ6A 3PBSA 1L0GA 4Z2MH 1P3GD 1E6ZA 2NQBB 1HZOA 3JPUA 3MXSA 4NXFA 3REHD 4NZ1A 2F8NH 4J8XD 2WZZA 3GMWA 1E88A 4YM6B 1K55A 1SKOA 1SZVA 5A90A 2V8FA 2YKFA 3NBLA 1ACFA 4Z66A 2A49A 5B0ZC 1S6RA 4WF0A 4BD0A 3HLBA 3AZKB 3LIAA 1K54C 5HX9A 3RFBA 1S1ZA 1Z2CB 4EXOA 1W5DA 3GECA 5AV6B 3AZIA 3MNNC 5HWWA 1ID3A 2Q9NA 2Z2LB 4KQDA 5JA4A 1KX3B 4H6JA 5E2FA 2B02A 2AROC 3LI9A 4KG2A 4QLCC 1N9LA 4H9OB 3G6OA 5AV9B 4CSRA 5EFWA 2VK3A 5CPKA 2ZL1B 1ERMA 4ZTKA 1K4EA 2K7SA 2VGLM 2X02A 1P3FB 3BW6A 4WMCD 3B6FC 4JGRA 4J8UC 4DRBA 5FAQA 4AWLB 2FFYA 4QU3A 4C6YA 4EQ1A 5GXQD 4S2MA 3W98C 2KDKA 3OOVA 2ZM0A 5JYOA 4BD1A 3C5AA 4NK3A 4OOYA 2ZC3B 4QD4A 3A0RA 3X1UC 5MC7A 4OJLA 3BY8A 3AV1A 3U4LP 4LG2A 1V9ZA 1PWDA 3MGPC 1K57C 5DNNA 2PYOA 5EVID 5AV5A 2W3GA 3IWOA 2Z2MB 1JTDA 2WKHA 3HREA 3WRTA 4OKPA 5CPIC 5TJJA 4LPZA 3IS2B 3BFCA 5GLBA 4HGAC 2ZC7A 1YKDA 5B33B 4XUZA 4R4RA 5J3WA 3WKJD 3LICA 4IBFA 3QP6A 3X1VA 2XH9A 3UTAA 5CERA 4ZJ2A 5B1LD 1AOID 4CLCC 4CQHA 5TFQA 3U2AA 4JXGA 5FEFA 2V8CA 4DDYA 4EUZA 3MGRD 1JVJA 4NZ3A 1ODVA 3EQVA 5CHLB 4NZ4A 1BLPA 4H9PA 3KXBD 2WKRA 3MGQB 3H82A 4KUKA 2L0WA 4P87A 4YINA 3A6ND 1PW1A 3KSFA 3HLWA 3AZFB 4HEFA 4YS3D 1CI9A 1KU5A 1AOIC 1M19D 4GOGA 4DRAA 1ZHHB 3AYWB 2M7UA 2QWSA 2OLVA 3AN2A 2K2NA 4JGPA 4KGCD 3I7JA 4R8PB 4Q0HA 3DBAA 1K0KA 2XLNA 3T4KA 1G28A 3CI6A 3KXBC 3T4OA 1P3OA 5CP6D 3REKB 3CLOA 1YU3A 2PU2A 2W3FA 4WZ5C 4RX2A 3LJAA 5FQMA 5HAQA 4XUXA 4KUDC 5HARA 4H9QB 2OAP1 2YKHA 1E3UA 3IF6A 1PDCA 5GSUC 4XZQA 3ZNTA 2EX8A 1ED7A 3MS6A 2L4RA 1VETB 5DF8A 3DTIA 5CP6C 1PWCA 1LSWA 4E3IA 4M3KA 4J8VB 4ZUXD 3TW8A 2HJEA 3W99D 3MFXA 3MSHA 1MWUA 3T4LA 2EA9A 3SOIA 3WTPC 5GL9A 2HUEC 3P5JB 5KIZA 2XDMA 2QZ6A 2DQNC 1HD8A 1TS7A 5GT0B 1ONGA 5BNXB 1H3QA 2VGLS 5B24A 4LRYC 5F6AA 1M6KA 4NKPA 4EV4A 4E6XA 3CPTB 3BLSA 3W99C 1TZYC 3AZLA 1WA9A 5AV8D 5DTSA 1L3LA 4G3VA 1KOUA 1NYYA 5B0YB 4JXVA 1F66D 5B2IA 4B93A 3O62B 5FI6A 1YLWA 2J8YA 3LZ0D 5BS7A 1YLPA 3TRCA 2EXAA 3AV2D 3LFVA 1DY6A 1YSPA 3H0RC 5HAIA 2J80A 1P3LC 4B4ZA 5EE8A 2Y79A 2VZWA 3NJAA 3GVBA 5AV8C 3MZDA 3V3SA 5BT1C 1E6RA 4BJPA 4UUZA 1BT5A 4DQYB 2P7JA 3LELC 2CV5C 2IA2A 4YM6D 2PR5A 4S2KA 2A3UA 4IVKA 2IWDA 3AV2C 4IBJA 3TG9A 3X1TA 3ZVTA 2P74A 5AVFA 3A0VA 2V1AA 3MXRA 5AV6D 2NQBC 2HIOD 4MLLA 3A1KA 2ZQAA 4FCFA 5IU1A 2XR0A 4YM6C 2PDRA 3VH6W 4MDZA 1KX3D 4QNLA 4IBKA 2Y91A 2M1CA 3C1BD 1I5QA 1KGEA 1QMFA 3AZKC 1X0OA 2GNXA 5AVBA 3N8SA 1W1TA 3M2JA 4WU8C 1IKIA 5AV9D 1ZKJA 2P04A 1H3OA 5JRGB 1GOIA 3LR5A 4UQIM 3C1CB 3LUQA 1P3FD 3D9YA 3G4PA 1P3IA 5TBMA 4ETXA 3E4PA 4KZ9A 3IT9A 4Z5TB 4WU9A 3FZCA 3TU4A 3TJZC 1F5MA 5AV9C 4IBCA 3CUEC 1UGUA 1CK3A 3AGEA 1P3FC 4IBRA 3EPLA 2Y2LA 2H28A 1XFNA 4UA6A 4XUJA 3KWQB 2GZAA 4OPYA 3BY9A 1WWSA 4K08A 3MQLA 3V39A 1NRFA 3N3FA 1KGFA 5CXWA 3LY3A 2HGVA 5HAPA 5DNMD 2RVQD 3W97B 4GW9A 1OTDA 4KZ5A 4XT2B 5EVEA 4Z2HA 5B33D 5B40B 5M18A 1NZOA 1G5UA 4WV4B 5FUGB 5DF9A 4J8WB 2I72A 3D72A 2NUPC 1T1CA 4DE0A 5EM0A 4S2LA 1KDSA 1ERQA 3UB9A 1P34A 2HP9A 3AFAB 2IWCA 5AY8D 2W8SA 3AZNB 3MGQD 1S32D 4DKIA 1CI8A 1P3KB 1Z09A 3W96C 2PD7A 5KDMA 5B33C 2JN7A 3AZFD 4ESPA 5L09A 5GT3A 4GDNA 3QP5A 4RX3A 2VKSA 5B1MB 4H9NA 3SS3A 1DP6A 3AYWD 2BYMA 1KX5A 4HP4A 5B0ZB 3SW1A 5CPJB 4WZSB 2OWHA 4OP5A 4R8PD 4BLMA 3ZNYA 3K2NA 1IYPA 4NZ5A 3L27A 4E3LA 1TEMA 3KS4A 3V9RA 3UMEA 2XFSA 4HH2A 1MBLA 1MWTA 4NXGA 1BH9A 1HVBA 1PI4A 4WEKA 3UE0A 3UTBA 3S7QA 5G49A 5DFYA 3UB8A 3T1QB 1W2EA 2AROB 1D1JA 3A0SA 1P0ZA 3A1IA 2INWA 3BJNA 4R8PC 4EESA 1H0IA 3CMZA 1OGGA 2HDQA 3AZJA 3L25A 2YFVB 1ONHA 3EEAA 3REKC 4E6WA 4NE6A 4HMCA 4J8VD 2Y4AA 4FD8A 3LZ1B 2WAFA 4H9SC 3A3IA 4J8UB 3AGFA 1DJAA 1PW8A 2EX2A 3GQZA 2XEPA 1GPFA 4N1XA 3UE1A 4CLCE 3X1SC 3Q1FA 4ID4A 5EM1A 4QY6A 2FJ7A 3W98B 3LEZA 1ZLAD 1VEUB 4ME4A 3FC7A 1U35C 1K4FA 4F3LA 1KX4B 4JJNA 4D60A 2W3DA 1UWPX 3AZGA 1NLZA 4L0LA 3MQQA 1E4DA 2NZDB 1KDWA 1M18B 1SHVA 3UDXA 4DJ2A 2LB9A 2IO5C 5DTTA 3MGPB 2RIQA 5B0YD 2WK0A 4DN0A 3RELC 3IX3A 3O62D 3KUYA 5EOEA 3JVVA 5B32B 5GT0C 4TX8A 1FCNA 4NY2A 5J4EA 2PBDP 5A8BA 2F8NB 1E6PA 4RQ9A 4LCLA 4WUJA 4PKYA 4GHIB 3VSKA 1H8MA 1H8YA 2HJ9C 4X23B 3MGSA 2FN2A 2XRNA 5B0YC 4IJEA 1TVFA 1JFIA 3FPVA 4KZ7A 2XA7S 1VB6A 5CRFA 1MXOA 3E4QA 5B2JD 3WS2A 3BFDA 2FH5A 2WKEA 1P3GA 2Z6CA 3HVFA 4S2IA 1PRQA 5F69A 3WTPE 4NXEA 3UT9C 3REHA 3DWZA 1G6OA 4J8XA 4MB3A 1IYOA 2H5SA 3BFFA 4DXBA 3BWLA 5EPHA 3PBTA 4LD9B 1P3PD 1EQZB 5IHVA 4Z2KA 5B32G 2V9AA 4Z2MG 5JRGD 1W1PA 3WRZA 3B0CW 5C3IB 2F8NG 3S22A 4Z2LA 3E4OA 3EWKA 4EO5B 2H10A 4JF5A 2EFUA 1TD5A 1SKOB 4L9FA 4Z5TD 1YLTA 3IBJA 5HWTA 4Z66B 5CTNA 1K56A 4OH0A 2HUEB 2P08A 5JRGC 4LGWA 3C1CC 4EBNA 1Y28A 1NY0A 3WA9C 3AZIB 4DMZA 1OTEA 5FASA 3LEQA 2P9VA 4WMCA 1ID3B 1W1VA 4Z5TC 1EROA 5JA4B 4BBUA 4H6JB 3S7PA 5GXQA 4KZ3A 3BFEA 1ES5A 3W97D 3MMHA 5U47A 3NOTC 3NECA 4OPQA 2GDNA 1L2SA 4LV3A 3P98A 3WAAA 4WL9A 4CSRB 4Y5FA 4BENA 1TS6A 2KX6A 5CPKB 4G3WA 4YOFA 3KWQC 1FCMA 2LB5A 3C8CA 3AFAD 3L2AA 1PZOA 3AZND 5EVIA 3W97C 3EQUA 3H0MC 1P3KD 3LGOA 5B40C 2V1ZA 4MN7A 3LELB 5GLAA 3NCKA 4J8WC 3WKJA 2H0YA 3L28A 1WYCA 1XJ4A 2BYKA 2VA0A 5B1LA 5B0ZD 5CPJD 4NYYA 3MGRA 5B31A 2WKQA 3AZNC 4Z9QA 5DNNB 1P3KC 2F8NK 3KXBA 1SCWA 4GNUA 3MNND 3A6NA 3UE3A 4GD6A 4QPRA 5E5AC 2Y2GA 4IBEA 5B1MC 4YS3A 3D3OA 5EOOA 3X1VB 5DKLA 3VP1A 1M19A 2D49A 1TS0A 5KSHA 2AROD 5CPJC 1NWZA 2ZQDA 4JXWA 4QLCD 1P3AA 1HQ3A 3C4PA 1BH8A 2K31A 4S2NC 1L0DA 4Y0TA 4WU8B 4KGCA 4O8GA 1LLBA 1BYWA 1DJCA 4H9PB 1GSVA 3H82B 1P3BC 3B6FD 4EUVA 2YFWA 5F99C 5F5YA 2O9CA 4J8UD 3R45A 2ZMAA 5AVCB 4HY8A 1OTBA 3W98D 3FWLA 3REIC 4GKUA 1G68A 2JC7A 2VV7A 2EX9A 3A3JA 4EEPA 4HJ6A 1S0WA 1F98A 3VH6A 3X1UD 4XXRA 3SS5A 1P3OB 3LZ1C 4EETB 3C7UA 1M18D 3B0DB 3MQOA 4ZUXA 4MMNA 2VV8A 4EWFA 1IEMA 3EGXC 1LL9A 2EFXA 3MGPD 2GJ3A 3WD0A 3NQJA 4NE5A 1SKFA 2BLSA 5CPID 1NZUA 2ZM8A 3OPPA 1KX4C 3VP4A 4XZQB 3L29A 1IKGA 1GSWA 3AZHA 1YLZA 3IQAA 2VLGA 2NZDC 3C7VA 4I38A 1M18C 4CLCD 4NFTA 4KZBA 1NYMA 4X23D 4KZAA 1LI9A 3IXDA 3WD2A 3DTKA 4CAYA 3KSIA 3TOIA 1KE4A 3T4QA 1F66A 4Y15A 5LBRA 5B32C 2ZOIA 2BG1A 2QJ5A 3O5YA 3W96B 3Q7VA 1DP9A 3B33A 3LZ0A 4LLOB 1O7EA 3ZCZA 3HLEA 5B24B 1N4OA 2ZQ7A 4X23C 1J9MA 3HL9A 2JKGA 4WEJA 3RXXA 2J8PA 5FA7A 1IOUA 3NQUA 4OOMA 3AZMC 5B2IB 4X55A 4FUWA 5FI2A 2WYXA 4LD9D 3REJC 1CK7A 3HLCA 2R9XA 1EQZD 1AXBA 4KUDD 4IVIA 1P3MA 4HH3A 4HJ3A 1D7EA 1IFQA 4HI4A 5AV6A 2HIOA 5GSUD 3PAEA 3A3EA 4UUZB 2Y2JA 1M1AC 2E8JA 3WD1A 5CGXA 1KX3A 1DP8A 3BYDA 4NE3A 1RGZA 5HW3A 4LD9C 2ZMVA 1W8QA 3G34A 5F1GA 1EQZC 3C1BA 3RJUA 1GSXA 3QNCA 3WTPD 4BQMA 3X1TB 3X1SB 5C3IC 2WZXA 3KSHA 3ZG9B 3OPRA 4PM8A 2G2UA 3AZID 4MBKA 4EO5C 2W1TB 1U35B 3LO7A 2WGVA 1LHYA 1YLYA 1WWIA 1K55C 3QHYA 5DF7A 2J3WA 4HMDA 4HNBA 3P7NA 1TZYD 1OTIA 1XA7A 2G2WA 3MBZA 4Z66C 2IO5B 3UPPA 1BLHA 4HESA 5GHZA 1XGIA 4GN2A 5AVBB 3VOYA 3M2KA 3RELB 3WS1A 3KYQA 3ZVWA 3AZIC 2O9BA 1MWSA 4G92B 1ID3C 1CQAA 1L0FA 4JPMA 4U0XA 3LIDA 5TBMB 1QO6A 1F1EA 1XPBA 2V20A 4GZBA 1P3LD 3MVDA 5CGWA 3LY4A 4IBBA 3EG5B 2ZQCA 2ZC5B 5BT1D 3TU4B 5DNMA 3WWXA 3B42A 3CWFA 3VH5T 3LR3A 4PM9A 3LELD 2CV5D 1PNEA 3R7WA 4OQIA 2EXBA 5B33A 4D2OA 1NRJA 4O01A 2VV6A 2Y2KA 5CPKC 3F1NA 4BWIA 3N7WA 3T4TA 4XUJB 4IHQA 2OV5A 2NQBD 3C30A 3OBFA 5FI7A 5AY8A 2WGWA 3MGQA 2V0WA 1S32A 3WS5A 2HDSA 4OP8A 3UT9B 2ZMFA 3AZFA 3F1OA 1S4SA 1E15A 4FOFA 1QMEA 3NC8A 5DVAA 5G4YA 3QP1A 1L6JA 4YWZA 3AYWA 3LYXA 3BM6A 3AV1C 3AZKD 1S1YA 5BO0A 3MJQA 4IBIA 4WU8D 4LCMA 2HF6A 4R8PA 2VEAA 4HJ4A 5DNNC 5HD5A 2ZM5A 2PYOC 5AV5C 1BLCA 4BBVA 1NLYA 3HBRA 5KDMB 5GT3B 3X1VC 3AZEB 3UTAC 3IBRA 1YU2A 5AVCD 3HUNA 2OAQ1 4Q8IA 1LSVA 1KVMA 1KX5B 5J8XA 2V5OA 2AVXA 1YM1A 2CC1A 2B5RA 3ZFZA 1KVLA 3NOUC 5CGSA 1IYQA 1VETA 2NUTC 2PD8A 5CTMA 3SH8A 4CJNA 2Y2IA 3WA9B 3V9RB 4J8VA 2A24A 3B0BA 1TAFB 3UTBB 3O86A 5AVCC 5G49B 3M7PA 3IWQA 5EECA 5I94A 2ZOHA 1U60A 3AN2C 4FSFA 3L26A 4XZQD 1ZLAA 1CEFA 1ZC2A 2WUQA 2CWEA 4P6ZM 4OUIA 5BNXA 1YU4A 3V67A 1P3OC 4ZBJB 3B0DC 4OVDA 4E45A 3ITBA 4GB7A 3CPTA 5FEGA 4MCWA 4EW7A 3L7HA 1PWGA 2W1RA 3LJAC 1XJ3A 3ZDJA 2I9VA 5G18A 2Y2OA 3MFDA 1PZRA 4PM7A 3O62A 4PM6A 3IF6C 2FJ7B 4XZQC 3W96D 3OLOA 3NHQA 2XA7M 3IX4A 1RGYA 2UWXA 5DFXA 4F3LB 5B24D 4JJNB 1PYYA 2QMIA 4OQGA 3AZGB 4JF4A 3WS4A 3SH7A 2E8IA 3LI8A 1ES2A 5B2ID 2QKPA 1OTAA 3KUYB 4OJ6A 2J9OA 4E3OA 5E5AB 2JKTM 4HOIA 1ZG6A 3PBRA 5B24C 5HL1A 5B2JA 4L9EA 4JLFA 1BUEA 3FKVA 5CHJA 2JCHA 4P6BA 3ITAA 3UMDA 1UR9A 2Y55A 3AZLC 3UN7A 5IT5A 5B2IC 3REKD 1S66L 4F94A 3H7WA 5CECA 5HPIA 4WYYA 4OPZA 3TSGA 1P3BB 3Q7ZA 4GD8A 3G2YA 3T4JA 5F99B 3W4PA 5BS7C 2FFFB 2G5IC 3QP2A 3KSYA 3X1TD 1P3PA 4M4XA 3X1SD 2OSUA 4GDBA 2EWVA 3PTEA 3REIB 4ETZA 4GHAA 1P3GB 1U35D 4MBFA 1P9RA 3REHB 4J8XB 3P01A 2F2AC 3UB6A 3GRJA 1Y4OA 4BMWA 4Z2GA 3NY4A 3X1TC 3HSHA 4IBDA 3RELD 3O3VA 3DW0A 5FATA 2ZD8A 3EOIA 5GT0D 5HD3A 5GLCA 1KS0A 2HDRA 4IBXA 2J9PA 1YMSA 3DAVA 4LRXC 4PKYG 4OJ5A 3KO6A 1F2KA 3ZG5A 5CEBA 1GHPA 4B9OA 1VHMA 5F83A 1CEGA 1CXWA 3B6GA 5AVBC 3KSGA 1K6RA 3ICYA 4FTXA 4KENB 4P6ZS 3LIFA 4G92C 4Y0OA 4BL3A 1P3IC 4L9GA 3GSGA 2JBFA 3UNWA 5L2FA 3AFAA 4P0MA 3TU4C 2B18A 2ZJ9A 5GXQB 5BNVA 5AQBA 2W27A 2L5AA 4E3NA 3UT9D 4ZDXA 3FDDA 4E3JA 3FKEA 3AZMB 4MEZA 4WNNA 3F1PA 4OJOA 4R1GA 3C38A 3WAAB 3W2ZA 1J3WA 4CPKA 1E6NA 3LIBA 5B0ZA 4XUJC 3REJB 1N9BA 3FG8A 5HDDA 3VFFA 5FQQA 3C4OA 2X01A 2JKRM 2XK1A 3KS8A 1K54A 1WE4A 2Q9MA 2HV1A 3MNNA 3CG5A 2WKIA 3AZED 1M1AB 4Y0UA 2ZY5A 4WLAA 4RA7A 3BECA 2BYKB 1FR6A 1KX5D 1SDNA 3PBQA 5B1LB 2AROA 4Q0JA 4Y13A 1BSGA 4QLCA 1P34C 1T19A 4GS9B 3MGRB 3C1CD 1ES4A 5B31B 1PFLA 1YT4A 4X1LA 4BL2A 3WA9D 1NJ4A 4NG2A 1XXMA 4YFMA 5GT3C 3UO9A 3B6FA 3AZEC 3UTBD 4J8UA 2Q0OA 2BASA 3IXBA 1MKMA 4R0QA 4KQOA 1KX5C 1BTLA 1M19B 3W98A 1ULYA 1P3AB 1HQ3B 5HZHA 1FIKA 2JKTI 4II7A 1OPXA 4N9LA 3X1UA 4K0WA 2O9AA 3KWQD 4H8RA 4Z2JA 3UTBC 2YFWB 2Y2MA 3VMAA 4KQQA 3MGPA 4R70A 1K57A 4UAAA 3MZFA 5CPIA 4ARZA 5B40D 3AZJC 1MWRA 1V9YA 4ZBJC 3HJKA 4J8WD 4WZ4A 5M1AA 5F68A 2ACGA 4GHIA 2WKPA 2ZM2A 4CLCA 1KE3A 5F1FA 1JTGA 4X23A 3G32A 3T50A 3CAXA 3HONA 4KG6A 5B31G 4R23A 1H0MA 1TDLA 1TDGA 3NQJB 1KGGA 4G3KA 5DJTA 2FJ7C 4OONA 3OPLA 1H0GA 4K91A 1R4VA 1LSXA 4B88A 1AIWA 5E5AD 5B1MD 4JJNC 3EPKA 3VP3A 5EV0A 2HPBA 3AZHB 3AZGC 3IHAA 1AOIA 2Y2HA 5HDSA 3VV4A 3UDIA 3AV1B 3OCLA 2C6WB 1LT0A 4GLQA 5AQ7A 1MZUA 4S2JA 4CAYB 2PYOB 3KUYC 5AV5B 2IWBA 1FSWA 1G6AA 3UB5P 3AGDA 1H5XA 1P3BD 4E04A 5F99D 4WZ5A
chains in the Genus database with same CATH topology
4DF6A 4LD9A 5CHMA 1XP4A 3UTAB 3NDEA 4WELA 3ZGAB 2HP6A 4KUDA 3IF5A 1ZG4A 1N1JA 3REID 3IP4C 5CEDA 3MGSC 5GSUA 4H9RA 1FOFA 3NQUB 3E2KA 5CP6A 3LZ1D 3IH9A 5F82A 2ZY3A 2LY8A 3WTPA 1P3MB 3HLFA 3AN2B 1P3GC 3N4IA 1KX4D 2HIOB 2HDUA 3GV9A 3VP2A 3REHC 4J8XC 1JWPA 1RP5A 2NZDD 3HUMA 3LCEA 4OQHA 3EPJA 1K25A 1PZPA 2EX6A 3ZG0A 3W99A 1TZYA 4KHAA 3LJAB 4HBTA 3C1BB 1FR1A 1VQQA 1K56D 5B32D 3GR2A 4QHCA 3IF6B 4JKTA 2F8ND 4EBLA 3PBNA 4EBPA 4UHUA 4ZJ1A 2DRWA 1P3LA 3OC2A 3A3DA 3BRMA 2XD1A 5AV8A 4E3MA 1YMXA 3NI9A 2WGIA 4N9KA 3UDFA 1A7WA 1Q2PA 2V2FF 3IXHA 3AZMD 3LELA 2CV5A 3HLGA 3WAAD 4RYEA 4WJ3C 3REJD 1O07A 3AV2A 1GHMA 4UPKA 1GHIA 4K0XA 1Q2QA 4JXSA 2HP5A 3MZEA 3MVDB 3AZLB 3V3RA 5GXQC 2NQBA 4KG5A 2Y2PA 5DNMB 2VGKA 3O88A 4YM6A 1M1AD 1M40A 4OPRA 1HTZA 3WAAC 3VH5W 3AZKA 5FSRA 3A3FA 4HBUA 4WU8A 5AQ9A 2JE5A 5B31D 3V5MA 5EVIC 5AY8B 2WGWB 1GCEA 1S32B 3N8LA 4OJPA 3WKJC 5DTKA 1H8ZA 1IELA 2ZY4A 5B1LC 5AVCA 4Z66D 4UA9A 2X71A 4H9OA 1P3AD 1HQ3D 3W8KA 5BO0B 5AV9A 3MGRC 5B31C 3Q82A 1MPLA 3IXGA 1P3FA 2R9WA 3VP0A 1ID3D 3A6NC 3EPHA 3ZHHA 3B3XA 4YS3C 4NYUA 3W4QA 3HUOA 1M19C 5E43A 2VGJA 3D4FA 1P3AC 1HQ3C 4EQIA 3Q07A 4LV0A 3UPNA 4KGCC 4X53A 3CZDA 1H3OB 5CHUA 5CPKD 4MBHA 2ZQ8A 4JF6A 1P3IB 1OMEA 4WU9B 3FYZA 4U0TA 3ZG8B 2JSSA 3M6HA 3N6IA 4G91B 4GH9A 3M6BA 4DXCA 3W96A 1PI5A 1ZLAB 4X68A 3AZHD 3O87A 4S2PA 3AV1D 4ZUXC 4DE3A 3DWKA 5DNND 4P85A 5AQAA 2PYOD 5AV5D 3RXWA 5KMWA 4KZ8A 2H0TA 3OZHA 5E2GA 3X1VD 3AZHC 3UTAD 4GHLA 1I2WA 1E25A 4R4SA 2ZLYA 4NETA 4WBGA 1P34B 4Y7PA 1B67A 4X56A 1F66C 1JWZA 3REKA 3PBOA 2C5WB 4IEDA 1FSYA 3LZ0C 4H9SA 2Y59A 4DE2A 4H9NB 3N8RA 5B2JB 4OLDA 4H9QA 2BYMB 1P3MD 3X1SA 4FH2A 3OPHA 3AN2D 3PAGA 3VOZA 4R3JA 3E2LA 5A92A 3G2ZA 1U35A 1P3OD 3DTMA 1DJBA 2WADA 3WX7A 4DDSA 3OCNA 1BH9B 3LJAD 3HLDA 1Q9CA 5FAPA 1P3MC 2XFTA 1P3PB 3RELA 1E3UD 5E2HA 4DRTA 5AV6C 4IJFA 2HIOC 4R3BA 4QB8A 5GT0A 3AZJB 1C3BA 4PMAA 1KX3C 1XX2A 3UY6A 3C1BC 1GA9A 1JWVA 5B0YA 3NDGA 2ZC4B 3W4OA 4KQRA 1XA1A 2XGNA 4FH4A 1XGJA 4IBGA 2XQZA 5A91A 4N1HA 2J7VA 1W7FA 3QNBA 4AWLC 3MVDD 3AZLD 5HFOA 4A5RA 2QPNA 3B6GB 4X69A 3UT9A 4M6BA 5JYPA 3FKWA 1YQSA 4OLGA 3MVDC 5BPVA 2XD5A 3JYIA 3VH6T 5E2EA 3MGSB 5DNMC 2RVQC 5BNVB 5TGFA 4KZ4A 1JFIB 3AZEA 4E3KA 4WNNB 1FCOA 1WYBA 2Y2NA 5D3OA 1XKZA 5EVLA 2VQRA 2Y2QA 1ES3A 5JRGA 3C1CA 1YU0A 5AY8C 3IWIA 3MGQC 1S32C 3WA9A 1GA0A 3Q81A 1TAFA 3AZFC 4PM5A 3MNNB 3UPOA 1K38A 3G30A 3G31A 4Z5TA 3AYWC 3VSLA 3G35A 3MKEA 5AVBD 1ALQA 4QLCB 1KE0A 2RL3A 1I2SA 1YUEA 2PBYA 1YU1A 1P3ID 3KWQA 3B6FB 3BFGA 4WM9A 1SDEA 4WU9D 3TU4D 2DF4C 3KFUG 3W97A 4LV1A 4QJGA 4N92A 5B40A 2ZQ9A 4C75A 4E44A 5EUAA 5KSCA 5FUGA 4J8WA 3S4XA 4J8VC 3X1UB 2WAEA 1PIOA 4XUJD 2P9VB 4ZJ3A 4WU9C 1VM1A 3AZNA 4G91C 1P3KA 3SH9A 1MY8A 1ZLAC 5CPIB 4HGAB 5E5AA 2ZY2A 1BLSA 5B1MA 4DE1A 1K6SA 1BZAA 5CPJA 2DNSA 4S2NA 1P34D 1ESIA 1MKIA 1T3UA 5EVIB 3O62C 5M19A 3F6TA 1P3BA 5GT3D 5F99A 4OQ0A 3WKJB 5GLDA 5A93A 1AOIB 3SS4A 1Z6FA 1YLJA 1LL5A 4LENA 3REIA 2YFVA 3ZG7B 5KZHA 5BOHA 3CJMA 3KXBB 3LZ1A 1IYSA 1EWZA 3IH8A 3BEBA 4MNRA 3VH5A 3A6NB 1ESUA 2XF3A 5FDHA 4YS3B 5B2JC 3GTCA 5TR7A 3S1YA 4KUDB 1FQGA 2ZC6B 3H0LC 1BH8B 3BLMA 1N1JB 2PU4A 4QY5A 1EI5A 3AZJD 4KGCB 4O7DA 1KX4A 5GSUB 3ISGA 3FV7A 3MKFA 4H9RB 1W79A 4ZBEA 5GHYA 2NZDA 5CP6B 1M18A 4LV2A 5FQIA 3P09A 4C3QA 2OLUA 1HTAA 1P3PC 1LI0A 5FQJA 3R45B 5GHXA 3WTPB 2FJ7D 5B32A 2F8NA 1L0EA 1BFMA 4JJND 5FQ9A 3AZGD 2IOUA 4ZUXB 3WS0A 4U3TA 3W99B 1TZYB 4KHAB 3B6GD 4B4XA 4X6TA 3KUYD 2G5HC 3AZMA 4S2OA 1B6WA 2DCFA 2RCXA 5FAOA 1NXYA 1RCJA 3AL0C 3REJA 3V50A 1P3LB 4ZAMA 3MGSD 3IHBA 4RVAA 1W8YA 1Y54A 4UA7A 3B6GC 5AV8B 5FQKA 1F66B 1M1AA 4JBFA 2CV5B 3Q7VB 3LZ0B 3B0CT 3VFHA 1EQZA 3AV2B 4OOLA 4PPRA 3AFAC 3NIAA 1BULA 4KZ6A 3PBSA 1L0GA 4Z2MH 1P3GD 2NQBB 1HZOA 3MXSA 3REHD 4NZ1A 2F8NH 4J8XD 2WZZA 3GMWA 4YM6B 1K55A 5A90A 3NBLA 4Z66A 2A49A 5B0ZC 1S6RA 4BD0A 3HLBA 3AZKB 1K54C 5HX9A 1Z2CB 1W5DA 5AV6B 3AZIA 3MNNC 1ID3A 2Q9NA 2Z2LB 5JA4A 1KX3B 5E2FA 2AROC 4KG2A 4QLCC 4H9OB 5AV9B 4CSRA 5CPKA 1ERMA 4ZTKA 1K4EA 2X02A 1P3FB 4WMCD 3B6FC 4J8UC 4DRBA 5FAQA 4AWLB 2FFYA 4QU3A 4C6YA 5GXQD 4S2MA 3W98C 2ZM0A 5JYOA 4BD1A 3C5AA 4NK3A 4OOYA 2ZC3B 4QD4A 3X1UC 4OJLA 3AV1A 4LG2A 1PWDA 3MGPC 1K57C 5DNNA 2PYOA 5EVID 5AV5A 3IWOA 3WRTA 2Z2MB 1JTDA 2WKHA 3HREA 4OKPA 5CPIC 3BFCA 5GLBA 4HGAC 2ZC7A 5B33B 4XUZA 4R4RA 3WKJD 4IBFA 3X1VA 2XH9A 3UTAA 5CERA 4ZJ2A 5B1LD 1AOID 5TFQA 4JXGA 4DDYA 4EUZA 3MGRD 1JVJA 4NZ3A 3EQVA 5CHLB 4NZ4A 1BLPA 4H9PA 3KXBD 3MGQB 4P87A 4YINA 3A6ND 1PW1A 3HLWA 3AZFB 4HEFA 4YS3D 1CI9A 1KU5A 1AOIC 1M19D 4GOGA 4DRAA 3AYWB 2OLVA 3AN2A 4KGCD 3I7JA 4R8PB 2XLNA 3KXBC 1P3OA 5CP6D 3REKB 1YU3A 2PU2A 4WZ5C 4RX2A 3LJAA 5FQMA 5HAQA 4XUXA 4KUDC 5HARA 4H9QB 1E3UA 3IF6A 5GSUC 4XZQA 3ZNTA 2EX8A 5DF8A 5CP6C 1PWCA 4E3IA 4M3KA 4J8VB 4ZUXD 3W99D 1MWUA 3SOIA 3WTPC 5GL9A 2HUEC 3P5JB 2XDMA 2QZ6A 2DQNC 1HD8A 5GT0B 1ONGA 5BNXB 5B24A 1M6KA 4EV4A 4E6XA 3BLSA 3W99C 1TZYC 3AZLA 5AV8D 5DTSA 1NYYA 5B0YB 4JXVA 1F66D 5B2IA 3O62B 5FI6A 1YLWA 2J8YA 3LZ0D 5BS7A 1YLPA 2EXAA 3AV2D 1DY6A 3H0RC 5HAIA 1P3LC 4B4ZA 5EE8A 3GVBA 5AV8C 3MZDA 3V3SA 5BT1C 4BJPA 4UUZA 1BT5A 4DQYB 3LELC 2CV5C 4YM6D 4S2KA 2A3UA 4IVKA 2IWDA 3AV2C 4IBJA 3TG9A 3X1TA 3ZVTA 2P74A 3MXRA 5AV6D 2NQBC 2HIOD 4MLLA 3A1KA 2ZQAA 4FCFA 2XR0A 4YM6C 3VH6W 1KX3D 4QNLA 4IBKA 2Y91A 3C1BD 1I5QA 1KGEA 1QMFA 3AZKC 3N8SA 5AVBA 3M2JA 4WU8C 1IKIA 5AV9D 1ZKJA 1H3OA 5JRGB 3C1CB 1P3FD 3G4PA 1P3IA 4KZ9A 3IT9A 4Z5TB 4WU9A 3FZCA 3TU4A 5AV9C 4IBCA 1CK3A 3AGEA 1P3FC 4IBRA 3EPLA 2Y2LA 4UA6A 4XUJA 3KWQB 4OPYA 1WWSA 3V39A 1NRFA 3N3FA 1KGFA 5CXWA 3LY3A 5HAPA 5DNMD 2RVQD 3W97B 4KZ5A 5B33D 5B40B 5M18A 1NZOA 4WV4B 5FUGB 5DF9A 4J8WB 2I72A 4DE0A 4S2LA 1KDSA 1ERQA 1P34A 2HP9A 3AFAB 2IWCA 5AY8D 2W8SA 3AZNB 3MGQD 1S32D 4DKIA 1CI8A 1P3KB 3W96C 5KDMA 5B33C 3AZFD 5GT3A 4GDNA 4RX3A 5B1MB 4H9NA 3SS3A 3AYWD 2BYMA 1KX5A 5B0ZB 5CPJB 4WZSB 4OP5A 4R8PD 4BLMA 3ZNYA 1IYPA 4NZ5A 3L27A 4E3LA 1TEMA 3KS4A 3V9RA 2XFSA 1MBLA 1MWTA 1BH9A 1HVBA 1PI4A 4WEKA 3UE0A 3UTBA 5G49A 1W2EA 2AROB 3A1IA 4R8PC 3CMZA 2HDQA 3AZJA 3L25A 2YFVB 1ONHA 3REKC 4E6WA 4NE6A 4J8VD 2Y4AA 4FD8A 3LZ1B 2WAFA 4H9SC 3A3IA 4J8UB 3AGFA 1DJAA 1PW8A 2EX2A 3GQZA 2XEPA 4N1XA 3UE1A 3X1SC 3Q1FA 4ID4A 4QY6A 2FJ7A 3W98B 3LEZA 1ZLAD 1U35C 1K4FA 1KX4B 4JJNA 3AZGA 4L0LA 1E4DA 2NZDB 1KDWA 1M18B 1SHVA 3UDXA 2IO5C 5DTTA 3MGPB 2RIQA 5B0YD 2WK0A 3RELC 3O62D 3KUYA 5EOEA 5B32B 5GT0C 1FCNA 4NY2A 2F8NB 4LCLA 3VSKA 1H8YA 4X23B 3MGSA 5B0YC 4IJEA 1TVFA 1JFIA 4KZ7A 5CRFA 1MXOA 5B2JD 3WS2A 3BFDA 2WKEA 1P3GA 3HVFA 4S2IA 3WTPE 3UT9C 3REHA 3DWZA 4J8XA 1IYOA 2H5SA 3BFFA 4DXBA 5EPHA 3PBTA 4LD9B 1P3PD 1EQZB 5IHVA 5B32G 4Z2MG 5JRGD 3WRZA 3B0CW 5C3IB 2F8NG 3S22A 4EO5B 2H10A 4JF5A 2EFUA 4Z5TD 1YLTA 4Z66B 5CTNA 1K56A 4OH0A 2HUEB 5JRGC 3C1CC 4EBNA 1NY0A 3WA9C 3AZIB 5FASA 2P9VA 4WMCA 1ID3B 4Z5TC 1EROA 5JA4B 5GXQA 4KZ3A 3BFEA 1ES5A 3W97D 5U47A 4OPQA 2GDNA 1L2SA 4LV3A 3P98A 3WAAA 4CSRB 4BENA 5CPKB 3KWQC 1FCMA 3AFAD 3L2AA 1PZOA 3AZND 5EVIA 3W97C 3EQUA 3H0MC 1P3KD 5B40C 2V1ZA 3LELB 5GLAA 3NCKA 4J8WC 3WKJA 2H0YA 3L28A 1WYCA 2BYKA 5B1LA 5B0ZD 5CPJD 4NYYA 3MGRA 5B31A 3AZNC 4Z9QA 5DNNB 1P3KC 2F8NK 3KXBA 1SCWA 4GNUA 3MNND 3A6NA 3UE3A 4GD6A 5E5AC 2Y2GA 4IBEA 5B1MC 4YS3A 5EOOA 3X1VB 3VP1A 1M19A 5KSHA 2AROD 5CPJC 2ZQDA 4JXWA 4QLCD 1P3AA 1HQ3A 3C4PA 1BH8A 4S2NC 1L0DA 4Y0TA 4WU8B 4KGCA 1LLBA 1DJCA 4H9PB 1P3BC 3B6FD 2YFWA 5F99C 4J8UD 3R45A 2ZMAA 5AVCB 3W98D 3FWLA 3REIC 4GKUA 1G68A 2JC7A 3A3JA 2EX9A 1S0WA 3VH6A 3X1UD 4XXRA 3SS5A 1P3OB 3LZ1C 3C7UA 1M18D 3B0DB 4ZUXA 4EWFA 1IEMA 1LL9A 2EFXA 3MGPD 3NQJA 4NE5A 1SKFA 2BLSA 5CPID 1NZUA 2ZM8A 3OPPA 1KX4C 3VP4A 4XZQB 3L29A 1IKGA 3AZHA 1YLZA 3IQAA 2NZDC 3C7VA 1M18C 4NFTA 4KZBA 1NYMA 4X23D 4KZAA 3IXDA 1LI9A 4CAYA 3TOIA 1KE4A 1F66A 5B32C 2BG1A 3W96B 3Q7VA 3LZ0A 1O7EA 3ZCZA 3HLEA 5B24B 1N4OA 2ZQ7A 4X23C 1J9MA 3HL9A 4WEJA 3RXXA 2J8PA 5FA7A 3NQUA 4OOMA 3AZMC 5B2IB 4X55A 5FI2A 2WYXA 4LD9D 3REJC 3HLCA 2R9XA 1EQZD 1AXBA 4KUDD 4IVIA 1P3MA 5AV6A 2HIOA 5GSUD 3PAEA 3A3EA 4UUZB 2Y2JA 1M1AC 5CGXA 1KX3A 3BYDA 4NE3A 1RGZA 5HW3A 4LD9C 3G34A 1W8QA 5F1GA 1EQZC 3C1BA 3RJUA 3QNCA 3WTPD 4BQMA 3X1TB 3X1SB 5C3IC 2WZXA 3ZG9B 3OPRA 4PM8A 2G2UA 3AZID 4MBKA 4EO5C 1U35B 3LO7A 2WGVA 1LHYA 1YLYA 1WWIA 1K55C 3QHYA 5DF7A 1TZYD 1XA7A 2G2WA 3MBZA 4Z66C 2IO5B 3UPPA 1BLHA 4HESA 5GHZA 1XGIA 4GN2A 5AVBB 3VOYA 3M2KA 3RELB 3WS1A 3ZVWA 3AZIC 1MWSA 4G92B 1ID3C 1L0FA 4JPMA 4U0XA 1XPBA 1F1EA 2V20A 4GZBA 1P3LD 3MVDA 5CGWA 3LY4A 4IBBA 3EG5B 2ZQCA 2ZC5B 5BT1D 3TU4B 5DNMA 3WWXA 3VH5T 4PM9A 3LELD 2CV5D 4OQIA 2EXBA 5B33A 4D2OA 2Y2KA 5CPKC 3N7WA 4XUJB 2OV5A 2NQBD 5FI7A 5AY8A 2WGWA 3MGQA 1S32A 3WS5A 2HDSA 4OP8A 3UT9B 3AZFA 1QMEA 3NC8A 5DVAA 3AYWA 3BM6A 3AV1C 3AZKD 5BO0A 4IBIA 4WU8D 4LCMA 4R8PA 5DNNC 2ZM5A 2PYOC 5AV5C 1BLCA 3HBRA 5KDMB 5GT3B 3X1VC 3AZEB 3UTAC 1YU2A 5AVCD 3HUNA 4Q8IA 1KVMA 1KX5B 5J8XA 1YM1A 2CC1A 2B5RA 3ZFZA 1KVLA 5CGSA 1IYQA 5CTMA 3SH8A 4CJNA 2Y2IA 3WA9B 3V9RB 4J8VA 3B0BA 1TAFB 3UTBB 3O86A 5AVCC 5G49B 3IWQA 5EECA 5I94A 1U60A 3AN2C 4FSFA 3L26A 4XZQD 1ZLAA 1CEFA 1ZC2A 2WUQA 2CWEA 4OUIA 5BNXA 1YU4A 1P3OC 4ZBJB 3B0DC 4OVDA 4E45A 3ITBA 4GB7A 1PWGA 3LJAC 3ZDJA 5G18A 2Y2OA 3MFDA 1PZRA 4PM7A 3O62A 4PM6A 3IF6C 2FJ7B 4XZQC 3W96D 1RGYA 2UWXA 5B24D 4JJNB 1PYYA 2QMIA 4OQGA 3AZGB 4JF4A 3WS4A 3SH7A 2E8IA 1ES2A 5B2ID 3KUYB 4OJ6A 2J9OA 4E3OA 5E5AB 1ZG6A 3PBRA 5B24C 5HL1A 5B2JA 4JLFA 1BUEA 3FKVA 5CHJA 2JCHA 4P6BA 3ITAA 2Y55A 3AZLC 3UN7A 5B2IC 3REKD 4F94A 5CECA 4WYYA 4OPZA 3TSGA 1P3BB 3Q7ZA 4GD8A 3G2YA 3W4PA 5F99B 5BS7C 2FFFB 2G5IC 3KSYA 3X1TD 1P3PA 3X1SD 2OSUA 4GDBA 3PTEA 3REIB 4GHAA 1P3GB 1U35D 4MBFA 3REHB 4J8XB 2F2AC 3GRJA 3NY4A 3X1TC 3HSHA 4IBDA 3RELD 3O3VA 3DW0A 5FATA 2ZD8A 5GT0D 5GLCA 2HDRA 4IBXA 2J9PA 1YMSA 4OJ5A 3ZG5A 5CEBA 1GHPA 5F83A 1CEGA 3B6GA 5AVBC 1K6RA 4KENB 4G92C 4Y0OA 4BL3A 1P3IC 3GSGA 2JBFA 3UNWA 5L2FA 3AFAA 4P0MA 3TU4C 2ZJ9A 5GXQB 5BNVA 5AQBA 2L5AA 4E3NA 3UT9D 4ZDXA 3FDDA 4E3JA 3FKEA 3AZMB 4MEZA 4WNNA 4OJOA 4R1GA 3WAAB 4CPKA 5B0ZA 4XUJC 3REJB 1N9BA 3VFFA 5FQQA 3C4OA 2X01A 2XK1A 3KS8A 1K54A 1WE4A 2Q9MA 3MNNA 3CG5A 2WKIA 3AZED 1M1AB 4Y0UA 2ZY5A 4RA7A 3BECA 2BYKB 1FR6A 1KX5D 1SDNA 3PBQA 5B1LB 2AROA 1BSGA 4QLCA 1P34C 3MGRB 3C1CD 1ES4A 5B31B 1YT4A 4BL2A 3WA9D 1NJ4A 1XXMA 4YFMA 5GT3C 3UO9A 3B6FA 3AZEC 3UTBD 4J8UA 3IXBA 4R0QA 4KQOA 1KX5C 1BTLA 1M19B 3W98A 1ULYA 1P3AB 1HQ3B 4N9LA 3X1UA 4K0WA 3KWQD 4H8RA 3UTBC 2YFWB 2Y2MA 3VMAA 4KQQA 3MGPA 1K57A 4UAAA 3MZFA 5CPIA 5B40D 3AZJC 1MWRA 4ZBJC 4J8WD 4WZ4A 5M1AA 2ZM2A 1KE3A 5F1FA 1JTGA 4X23A 3G32A 4R23A 3HONA 4KG6A 5B31G 1TDLA 1TDGA 3NQJB 1KGGA 2FJ7C 4OONA 3OPLA 4K91A 1R4VA 4B88A 5E5AD 5B1MD 4JJNC 3EPKA 3VP3A 2HPBA 3AZHB 3AZGC 3IHAA 1AOIA 2Y2HA 3UDIA 3AV1B 3OCLA 2C6WB 5AQ7A 4S2JA 4CAYB 2PYOB 3KUYC 5AV5B 2IWBA 1FSWA 1G6AA 3AGDA 1H5XA 1P3BD 5F99D 4WZ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QNC A;  4DF6 A;  4BQM A;  1BLS A;  1XP4 A;  4WEL A;  3NDE A;  5CHM A;  3ZGA B;  4DE1 A;  2HP6 A;  1CK3 A;  3AGE A;  2WZX A;  4IBR A;  3IF5 A;  2Y2L A;  3ZG9 B;  1ZG4 A;  3OPR A;  1K6S A;  4PM8 A;  1BZA A;  2DNS A;  5CED A;  2G2U A;  4MBK A;  4S2N A;  3LO7 A;  4UA6 A;  4OPY A;  2WGV A;  1ESI A;  1LHY A;  1MKI A;  1YLY A;  1K55 C;  3QHY A;  1FOF A;  5DF7 A;  3E2K A;  3V39 A;  1NRF A;  5EVI B;  1KGF A;  5CXW A;  3LY3 A;  3IH9 A;  1XA7 A;  2G2W A;  5F82 A;  5HAP A;  5M19 A;  3MBZ A;  3UPP A;  1BLH A;  4HES A;  4KZ5 A;  5GHZ A;  4OQ0 A;  1XGI A;  4GN2 A;  5M18 A;  3VOY A;  3M2K A;  1NZO A;  3WS1 A;  5GLD A;  5DF9 A;  5A93 A;  3ZVW A;  3SS4 A;  1Z6F A;  3HLF A;  1YLJ A;  2I72 A;  1LL5 A;  1MWS A;  4LEN A;  3N4I A;  4DE0 A;  3GV9 A;  2HDU A;  3RJU A;  3VP2 A;  1L0F A;  4JPM A;  4U0X A;  3ZG7 B;  4S2L A;  1KDS A;  1ERQ A;  1XPB A;  5KZH A;  2HP9 A;  2V20 A;  5BOH A;  1JWP A;  4GZB A;  1RP5 A;  3HUM A;  5CGW A;  3LY4 A;  2IWC A;  3CJM A;  2ZQC A;  3LCE A;  4OQH A;  1PZP A;  1K25 A;  2EX6 A;  1IYS A;  1EWZ A;  2ZC5 B;  3BEB A;  3IH8 A;  1CI8 A;  4MNR A;  3ZG0 A;  4DKI A;  3WWX A;  1ESU A;  4HBT A;  2XF3 A;  5FDH A;  1FR1 A;  1VQQ A;  4GDN A;  1K56 D;  3GTC A;  4PM9 A;  4OQI A;  2EXB A;  5TR7 A;  4RX3 A;  4D2O A;  3S1Y A;  3SS3 A;  2Y2K A;  2ZC6 B;  1FQG A;  3GR2 A;  4QHC A;  3IF6 B;  4JKT A;  3BLM A;  2PU4 A;  3N7W A;  4QY5 A;  1EI5 A;  4EBL A;  4OP5 A;  4O7D A;  4BLM A;  3ISG A;  3PBN A;  3ZNY A;  3FV7 A;  4EBP A;  3MKF A;  4UHU A;  1W79 A;  4ZBE A;  1IYP A;  4ZJ1 A;  2DRW A;  4E3L A;  5GHY A;  2OV5 A;  5FI7 A;  3OC2 A;  1TEM A;  3A3D A;  3BRM A;  2XFS A;  2XD1 A;  2WGW A;  1MBL A;  1MWT A;  4LV2 A;  5FQI A;  3P09 A;  4E3M A;  1YMX A;  3NI9 A;  3WS5 A;  2WGI A;  1HVB A;  4N9K A;  1PI4 A;  2HDS A;  2OLU A;  4OP8 A;  4WEK A;  3UDF A;  3UE0 A;  4C3Q A;  1LI0 A;  1Q2P A;  2V2F F;  5FQJ A;  5GHX A;  3IXH A;  1QME A;  3NC8 A;  3HLG A;  5DVA A;  4RYE A;  3BM6 A;  1O07 A;  3CMZ A;  1GHM A;  1L0E A;  2HDQ A;  4LCM A;  1GHI A;  1ONH A;  5FQ9 A;  4K0X A;  1Q2Q A;  4JXS A;  2HP5 A;  4E6W A;  3MZE A;  3V3R A;  1BLC A;  2Y4A A;  4FD8 A;  4KG5 A;  3WS0 A;  4U3T A;  2Y2P A;  2WAF A;  3HBR A;  3A3I A;  2VGK A;  1DJA A;  1PW8 A;  2EX2 A;  3AGF A;  3GQZ A;  3O88 A;  4B4X A;  4X6T A;  1M40 A;  2XEP A;  4N1X A;  4OPR A;  1HTZ A;  3UE1 A;  3Q1F A;  4ID4 A;  3HUN A;  4S2O A;  4Q8I A;  1KVM A;  4QY6 A;  2DCF A;  2RCX A;  3LEZ A;  5J8X A;  5FAO A;  1NXY A;  1YM1 A;  1RCJ A;  2CC1 A;  2B5R A;  3ZFZ A;  5FSR A;  1K4F A;  1KVL A;  3A3F A;  4HBU A;  5AQ9 A;  5CGS A;  2JE5 A;  1IYQ A;  5CTM A;  3V5M A;  3SH8 A;  4L0L A;  3V50 A;  2Y2I A;  5EVI C;  4CJN A;  1E4D A;  4ZAM A;  1KDW A;  1SHV A;  3UDX A;  3IHB A;  4RVA A;  1W8Y A;  1Y54 A;  2WGW B;  4UA7 A;  5DTT A;  1GCE A;  5FQK A;  3N8L A;  2WK0 A;  3O86 A;  5DTK A;  1H8Z A;  4JBF A;  3IWQ A;  5EEC A;  1IEL A;  5EOE A;  5I94 A;  1U60 A;  3Q7V B;  4UA9 A;  1FCN A;  4FSF A;  2X71 A;  3W8K A;  1CEF A;  1ZC2 A;  2WUQ A;  3VFH A;  4OOL A;  4LCL A;  3Q82 A;  4PPR A;  1MPL A;  3NIA A;  3IXG A;  1BUL A;  4KZ6 A;  3PBS A;  4OVD A;  1L0G A;  2R9W A;  3ITB A;  4GB7 A;  3VSK A;  3VP0 A;  1H8Y A;  1HZO A;  3MXS A;  1PWG A;  3ZHH A;  3B3X A;  2WZZ A;  3GMW A;  3ZDJ A;  3W4Q A;  1TVF A;  5G18 A;  2Y2O A;  1K55 A;  3MFD A;  3HUO A;  4PM7 A;  2VGJ A;  3D4F A;  5E43 A;  5A90 A;  4PM6 A;  3IF6 C;  4KZ7 A;  5CRF A;  3NBL A;  4EQI A;  3Q07 A;  1MXO A;  2A49 A;  4LV0 A;  1S6R A;  4BD0 A;  3HLB A;  3UPN A;  1RGY A;  4X53 A;  2UWX A;  3CZD A;  3WS2 A;  3BFD A;  5CHU A;  1PYY A;  2QMI A;  1K54 C;  4MBH A;  5HX9 A;  1W5D A;  4OQG A;  2ZQ8 A;  4JF6 A;  4JF4 A;  3WS4 A;  2WKE A;  3HVF A;  4S2I A;  3SH7 A;  2E8I A;  2Q9N A;  2Z2L B;  1OME A;  3DWZ A;  1ES2 A;  1IYO A;  2H5S A;  3FYZ A;  4U0T A;  5E2F A;  3ZG8 B;  2J9O A;  3BFF A;  4DXB A;  3M6H A;  3N6I A;  4KG2 A;  3M6B A;  4E3O A;  5EPH A;  3PBT A;  4DXC A;  1PI5 A;  1ZG6 A;  3PBR A;  5HL1 A;  5IHV A;  4JLF A;  4X68 A;  1BUE A;  3FKV A;  5CHJ A;  2JCH A;  4P6B A;  3O87 A;  3ITA A;  3WRZ A;  2Y55 A;  4S2P A;  1ERM A;  4ZTK A;  1K4E A;  2X02 A;  4DE3 A;  3S22 A;  3DWK A;  4WMC D;  3UN7 A;  2H10 A;  4JF5 A;  2EFU A;  4P85 A;  5FAQ A;  5AQA A;  4F94 A;  3RXW A;  2FFY A;  4QU3 A;  4C6Y A;  5CEC A;  4KZ8 A;  4WYY A;  5KMW A;  1YLT A;  4OPZ A;  3TSG A;  4S2M A;  3Q7Z A;  4GD8 A;  3G2Y A;  3W4P A;  2ZM0 A;  2H0T A;  5CTN A;  2FFF B;  3OZH A;  5E2G A;  1K56 A;  4BD1 A;  5JYO A;  4OH0 A;  3C5A A;  4NK3 A;  1I2W A;  4OOY A;  2ZC3 B;  2OSU A;  4GDB A;  4QD4 A;  1E25 A;  4EBN A;  3PTE A;  4R4S A;  1NY0 A;  2ZLY A;  5FAS A;  4NET A;  4WBG A;  1PWD A;  2P9V A;  4WMC A;  4Y7P A;  4MBF A;  1K57 C;  4X56 A;  1JWZ A;  1ERO A;  5EVI D;  3IWO A;  3WRT A;  2Z2M B;  1JTD A;  2WKH A;  3HRE A;  3PBO A;  4OKP A;  4KZ3 A;  2C5W B;  3BFE A;  4IED A;  1ES5 A;  3GRJ A;  3BFC A;  5GLB A;  2ZC7 A;  1FSY A;  3NY4 A;  2Y59 A;  5U47 A;  4DE2 A;  4XUZ A;  4R4R A;  4OPQ A;  3N8R A;  2XH9 A;  4OLD A;  2GDN A;  3O3V A;  1L2S A;  4LV3 A;  3P98 A;  5CER A;  4ZJ2 A;  3DW0 A;  5FAT A;  4FH2 A;  2ZD8 A;  4BEN A;  5TFQ A;  3OPH A;  3PAG A;  5GLC A;  3VOZ A;  2HDR A;  4IBX A;  2J9P A;  1FCM A;  3E2L A;  4JXG A;  4R3J A;  5A92 A;  1YMS A;  4DDY A;  4EUZ A;  3G2Z A;  1JVJ A;  3DTM A;  3EQV A;  1PZO A;  3ZG5 A;  1BLP A;  5CEB A;  1DJB A;  2WAD A;  1GHP A;  4DDS A;  5EVI A;  5F83 A;  3EQU A;  4P87 A;  3OCN A;  1CEG A;  4YIN A;  1PW1 A;  2V1Z A;  3HLW A;  4HEF A;  3HLD A;  1CI9 A;  1K6R A;  5FAP A;  5GLA A;  2XFT A;  3NCK A;  4GOG A;  2H0Y A;  1E3U D;  1WYC A;  5E2H A;  4KEN B;  2OLV A;  4DRT A;  4R3B A;  4QB8 A;  4Y0O A;  4BL3 A;  1C3B A;  3I7J A;  3GSG A;  4PMA A;  2JBF A;  3UNW A;  2XLN A;  5L2F A;  4Z9Q A;  1XX2 A;  4P0M A;  3UY6 A;  2PU2 A;  1SCW A;  2ZJ9 A;  4GNU A;  4WZ5 C;  1GA9 A;  5AQB A;  4RX2 A;  4E3N A;  3UE3 A;  4GD6 A;  1JWV A;  3NDG A;  4ZDX A;  2Y2G A;  2ZC4 B;  5FQM A;  4E3J A;  5HAQ A;  4MEZ A;  4XUX A;  5EOO A;  3W4O A;  4R1G A;  4KQR A;  1XA1 A;  5HAR A;  3VP1 A;  2XGN A;  5KSH A;  1E3U A;  2ZQD A;  4FH4 A;  1XGJ A;  3IF6 A;  4JXW A;  3C4P A;  4CPK A;  4S2N C;  2XQZ A;  1L0D A;  3ZNT A;  2EX8 A;  5A91 A;  4Y0T A;  1N9B A;  4N1H A;  3VFF A;  5FQQ A;  3C4O A;  2J7V A;  1W7F A;  5DF8 A;  2X01 A;  3QNB A;  1LLB A;  1PWC A;  2XK1 A;  5HFO A;  1K54 A;  4E3I A;  1DJC A;  4M3K A;  1WE4 A;  4A5R A;  2QPN A;  2Q9M A;  1MWU A;  3CG5 A;  2WKI A;  3SOI A;  4X69 A;  5GL9 A;  4Y0U A;  2ZMA A;  4RA7 A;  2XDM A;  3BEC A;  5JYP A;  2QZ6 A;  3FWL A;  1FR6 A;  1SDN A;  3PBQ A;  4GKU A;  1G68 A;  2JC7 A;  1HD8 A;  1BSG A;  1ONG A;  3A3J A;  2EX9 A;  3FKW A;  1YQS A;  4OLG A;  1S0W A;  1ES4 A;  1M6K A;  1YT4 A;  4EV4 A;  4XXR A;  2XD5 A;  3JYI A;  3SS5 A;  4E6X A;  4BL2 A;  3BLS A;  5E2E A;  3C7U A;  1NJ4 A;  4EWF A;  5DTS A;  1XXM A;  1IEM A;  4YFM A;  1LL9 A;  2EFX A;  3UO9 A;  5TGF A;  1NYY A;  4JXV A;  4KZ4 A;  1SKF A;  3IXB A;  4R0Q A;  5FI6 A;  4KQO A;  4E3K A;  1YLW A;  1FCO A;  2BLS A;  1BTL A;  2J8Y A;  1WYB A;  1NZU A;  2ZM8 A;  3OPP A;  2Y2N A;  1YLP A;  3VP4 A;  1IKG A;  2EXA A;  5D3O A;  1XKZ A;  5EVL A;  2Y2Q A;  1DY6 A;  1ES3 A;  5HAI A;  1YLZ A;  3IQA A;  3C7V A;  4B4Z A;  5EE8 A;  3IWI A;  3GVB A;  4K0W A;  4KZB A;  4N9L A;  3MZD A;  3V3S A;  1NYM A;  1GA0 A;  4H8R A;  4BJP A;  4KZA A;  1LI9 A;  3IXD A;  3Q81 A;  2Y2M A;  3VMA A;  1BT5 A;  4PM5 A;  3UPO A;  1K38 A;  3TOI A;  4KQQ A;  3G30 A;  1KE4 A;  1K57 A;  3G31 A;  4S2K A;  4UAA A;  2BG1 A;  3VSL A;  3MZF A;  2A3U A;  3G35 A;  3MKE A;  4IVK A;  3Q7V A;  2IWD A;  1MWR A;  1ALQ A;  3TG9 A;  1KE0 A;  1O7E A;  3ZCZ A;  3HLE A;  2RL3 A;  3ZVT A;  2P74 A;  4WZ4 A;  5M1A A;  1N4O A;  2ZQ7 A;  1I2S A;  3MXR A;  2ZM2 A;  4MLL A;  1J9M A;  3HL9 A;  2PBY A;  2ZQA A;  1KE3 A;  5F1F A;  1JTG A;  4WEJ A;  4FCF A;  3G32 A;  4R23 A;  3RXX A;  2XR0 A;  4KG6 A;  5FA7 A;  4OOM A;  3BFG A;  1TDL A;  4WM9 A;  1SDE A;  1TDG A;  1KGG A;  2Y91 A;  4OON A;  4X55 A;  1I5Q A;  3OPL A;  1KGE A;  1QMF A;  4K91 A;  4LV1 A;  5FI2 A;  2WYX A;  4B88 A;  4N92 A;  3N8S A;  4QJG A;  3HLC A;  3M2J A;  2R9X A;  1IKI A;  2ZQ9 A;  4C75 A;  1AXB A;  5KSC A;  5EUA A;  4IVI A;  1ZKJ A;  3VP3 A;  2HPB A;  3IHA A;  3S4X A;  2Y2H A;  3UDI A;  3OCL A;  2C6W B;  2WAE A;  1PIO A;  2P9V B;  3G4P A;  3PAE A;  5AQ7 A;  4ZJ3 A;  3A3E A;  2Y2J A;  4S2J A;  2IWB A;  1VM1 A;  1FSW A;  1G6A A;  4KZ9 A;  5CGX A;  3IT9 A;  3BYD A;  3AGD A;  1H5X A;  3FZC A;  1RGZ A;  3SH9 A;  5HW3 A;  1MY8 A;  3G34 A;  1W8Q A;  4WZ5 A;  5F1G A; 
#chains in the Genus database with same CATH topology
 4DF6 A;  4LD9 A;  5CHM A;  1XP4 A;  3UTA B;  3L9K A;  3NDE A;  1UWN X;  4WEL A;  3ULF A;  3ZGA B;  2HP6 A;  4KUD A;  3IF5 A;  1ZG4 A;  1N1J A;  3REI D;  3IP4 C;  3S7N A;  4MN6 A;  3MGS C;  1XFQ A;  4Y3I A;  5CED A;  5GSU A;  5HSQ A;  4H9R A;  2RTS A;  1FOF A;  3NQU B;  3E2K A;  3FPW A;  5CP6 A;  3LZ1 D;  3IH9 A;  3NUL A;  5F82 A;  2VX8 A;  5DJU A;  5L8M A;  2ZY3 A;  2LY8 A;  3WTP A;  4IUH A;  2R78 A;  2OWJ A;  4Z2I A;  2KLI A;  1P3M B;  3HLF A;  3AN2 B;  2L1M A;  4GCZ A;  1P3G C;  3N4I A;  1KX4 D;  2HIO B;  2HDU A;  3GV9 A;  3VP2 A;  3REH C;  4J8X C;  1JWP A;  1RP5 A;  2NZD D;  3HUM A;  2JKR I;  3IX8 A;  3WD4 A;  3LCE A;  4OQH A;  3EPJ A;  1K25 A;  1PZP A;  2EX6 A;  4PAU A;  3ZG0 A;  3W99 A;  1TZY A;  2EWW A;  4KHA A;  3LJA B;  4HBT A;  3C1B B;  1FR1 A;  1VQQ A;  1K56 D;  2OOL A;  4HHD A;  5B32 D;  3GR2 A;  4QHC A;  3IF6 B;  3VOL A;  4JKT A;  4MB4 A;  2F8N D;  4EBL A;  3PBN A;  2XSS A;  3LR0 A;  4EBP A;  4NXB A;  4UHU A;  4ZJ1 A;  2DRW A;  1P3L A;  3OC2 A;  3A3D A;  3BRM A;  2W3E A;  2XD1 A;  5AV8 A;  4E3M A;  1A0K A;  2J3T D;  1YMX A;  2GX5 A;  3NI9 A;  2WGI A;  4N9K A;  1DRM A;  3UDF A;  1A7W A;  2QYB A;  1Q2P A;  2V2F F;  3IXH A;  3AZM D;  3LEL A;  2CV5 A;  1AWI A;  3HLG A;  3WAA D;  4RYE A;  1OJG A;  4WJ3 C;  3REJ D;  1O07 A;  4HIA A;  3AV2 A;  1GHM A;  4UPK A;  1GHI A;  4K0X A;  1Q2Q A;  4JXS A;  2HP5 A;  3MZE A;  3MVD B;  3AZL B;  3V3R A;  5GXQ C;  2NQB A;  2J3T C;  4KG5 A;  2Y2P A;  1ZTU A;  5DNM B;  3WD3 A;  2VGK A;  3O88 A;  4YM6 A;  1M1A D;  1M40 A;  4OPR A;  3R7W B;  1HTZ A;  3WAA C;  3VH5 W;  3F1N B;  2DMW A;  3AZK A;  5FSR A;  3A3F A;  4HBU A;  4WU8 A;  5AQ9 A;  2V0U A;  2JE5 A;  5B31 D;  3V5M A;  5EVI C;  5AY8 B;  2WGW B;  1GCE A;  1S32 B;  2PYP A;  3N8L A;  1N9O A;  4OJP A;  3F1O B;  3WKJ C;  5DTK A;  2M7V A;  1H8Z A;  4WN5 A;  1IEL A;  2ZY4 A;  4LFU A;  5B1L C;  5AVC A;  4Z66 D;  4UA9 A;  2X71 A;  4H9O A;  1P3A D;  1HQ3 D;  3W8K A;  5BO0 B;  3MF0 A;  5AV9 A;  3MGR C;  5B31 C;  3CUE A;  3Q82 A;  1MPL A;  2ZL1 A;  3IXG A;  1P3F A;  2Y8H A;  2R9W A;  4EER A;  3VP0 A;  1ID3 D;  3A6N C;  3EPH A;  2QJ7 A;  3ZHH A;  3B3X A;  4YS3 C;  4NYU A;  3B47 A;  3W4Q A;  4MN5 A;  2PYR A;  3HUO A;  1M19 C;  5E43 A;  2VGJ A;  3D4F A;  3E0Y A;  1P3A C;  1T18 A;  1HQ3 C;  4EQI A;  3Q07 A;  4LV0 A;  3ZYT A;  5I5L A;  3UPN A;  4KGC C;  3T1S A;  4X53 A;  3CZD A;  1H3O B;  5CHU A;  5CPK D;  4MBH A;  2PRF A;  2ZQ8 A;  4JF6 A;  1YPR A;  1P3I B;  2A24 B;  1UR8 A;  1EW0 A;  4X25 A;  1OME A;  3LIE A;  4WU9 B;  3FYZ A;  4U0T A;  3EGD C;  3ZG8 B;  2JSS A;  1OJ5 A;  3IS2 A;  3M6H A;  3N6I A;  4G91 B;  4GH9 A;  3M6B A;  4DXC A;  3W96 A;  3K3D A;  1PI5 A;  1ZLA B;  1YAX A;  5HWV A;  4X68 A;  3S7O A;  2XRO A;  3AZH D;  3PYP A;  3O87 A;  4S2P A;  3AV1 D;  4ZUX C;  1W1Y A;  4DE3 A;  3DWK A;  4EU0 A;  4I3I A;  5DNN D;  4P85 A;  5AQA A;  2D02 A;  2PYO D;  5AV5 D;  3RXW A;  5KMW A;  4KZ8 A;  4UEY A;  2H0T A;  2Z6D A;  3PXP A;  3OZH A;  5E2G A;  3X1V D;  3AZH C;  3UTA D;  4GHL A;  1I2W A;  1E25 A;  1P9W A;  4R4S A;  2ZLY A;  3KYE A;  4NET A;  4WBG A;  1P34 B;  4Y7P A;  1B67 A;  4X56 A;  2CMN A;  1F66 C;  1JWZ A;  3REK A;  3MQ0 A;  3PBO A;  2C5W B;  4IED A;  1FSY A;  3LZ0 C;  4H9S A;  3UE6 A;  2Y59 A;  3EEH A;  4DE2 A;  1HLU P;  4H9N B;  3N8R A;  5B2J B;  4OLD A;  4H9Q A;  2BYM B;  1P3M D;  3X1S A;  4FH2 A;  3CIT A;  3OPH A;  3AN2 D;  3PAG A;  1EAK A;  3VOZ A;  2PR6 A;  4R3J A;  3E2L A;  2D01 A;  5A92 A;  1FIL A;  2W1T A;  3G2Z A;  5L10 A;  1U35 A;  2W0N A;  1P3O D;  3DTM A;  4I3J A;  2W3H A;  1DJB A;  2WAD A;  3H7W B;  3WX7 A;  4DDS A;  2HZ5 A;  3RH8 B;  5J7E A;  3OCN A;  1BH9 B;  3LJA D;  3HLD A;  1Q9C A;  5FAP A;  1J7M A;  1P3M C;  2XFT A;  5L07 A;  1P3P B;  3REL A;  2VJW A;  1E3U D;  5E2H A;  4DRT A;  5AV6 C;  4IJF A;  2HIO C;  4R3B A;  4QB8 A;  4I3A A;  5GT0 A;  3AZJ B;  1C3B A;  4ZRR A;  4PMA A;  1YSQ A;  5C5K A;  2O99 A;  4QWO A;  1KX3 C;  1XX2 A;  1P97 A;  3UY6 A;  1S67 L;  3C1B C;  1GA9 A;  1JWV A;  5B0Y A;  3NDG A;  2ZC4 B;  3RTY A;  2KOI A;  4HP9 A;  3W4O A;  4KQR A;  1XA1 A;  2XGN A;  2ZBB A;  3PR6 A;  1XGJ A;  3QP4 A;  4FH4 A;  4IBG A;  2XQZ A;  3HCY A;  5A91 A;  4N1H A;  4Y2F A;  2J7V A;  1W7F A;  3KX0 X;  3QNB A;  4AWL C;  3MVD D;  3AZL D;  5HFO A;  3KYZ A;  4Y17 A;  4A5R A;  2QPN A;  4HME A;  3VE4 A;  3B6G B;  1F9I A;  4X69 A;  3UT9 A;  2A2L A;  4M6B A;  2QHK A;  5JYP A;  1O6I A;  3FKW A;  4I39 A;  1YQS A;  4OLG A;  3MVD C;  2JHE A;  5BPV A;  2XD5 A;  3JYI A;  3VH6 T;  5E2E A;  2G7U A;  3MGS B;  5DNM C;  2RVQ C;  5BNV B;  3UB7 A;  5TGF A;  4KZ4 A;  5HL6 A;  2FZ0 A;  1JFI B;  3AZE A;  4E3K A;  4WNN B;  3F1P B;  4R38 A;  1FCO A;  4PHT A;  1WYB A;  2Y2N A;  2PAV P;  5D3O A;  3BQA A;  1XKZ A;  5EVL A;  2VQR A;  2Y2Q A;  1ES3 A;  5JRG A;  3QP8 A;  4I5S A;  3PHY A;  3C1C A;  1OGB A;  1YU0 A;  5AY8 C;  3IWI A;  3MGQ C;  1S32 C;  3WA9 A;  1GA0 A;  2BTF P;  3MR0 A;  3Q81 A;  1TAF A;  3AZF C;  4PM5 A;  3MNN B;  3UPO A;  1K38 A;  3T4S A;  3G30 A;  3G31 A;  4Z5T A;  3AYW C;  3VSL A;  3G35 A;  3MKE A;  5AVB D;  1STZ A;  1ALQ A;  4QLC B;  1KE0 A;  2RL3 A;  3GDI A;  1I2S A;  5AVE A;  3T1X A;  1YUE A;  4IUK A;  2PBY A;  1YU1 A;  1P3I D;  3KWQ A;  4MB5 A;  3B6F B;  3ZQ5 A;  3BFG A;  4WM9 A;  1SDE A;  2PT7 A;  4WU9 D;  3JVU A;  3TU4 D;  2DF4 C;  3KFU G;  3W97 A;  4GJ4 A;  5DKK A;  5AJG A;  4XT2 A;  4LV1 A;  4QJG A;  4HQA A;  4N92 A;  5B40 A;  2ZQ9 A;  4C75 A;  4E44 A;  5EUA A;  5KSC A;  5FUG A;  1CJF A;  4UQI S;  4J8W A;  3S4X A;  4J8V C;  4NEE D;  3BQ8 A;  1W63 Q;  3X1U B;  2WAE A;  1PIO A;  4XUJ D;  2P9V B;  2UV0 E;  4O0P A;  4LRZ E;  4ZJ3 A;  3VE3 A;  4WU9 C;  1XJ2 A;  1VM1 A;  3AZN A;  4G91 C;  4JGQ A;  4X1M A;  5FDS A;  1P3K A;  3SH9 A;  4YNR A;  1MY8 A;  1ZLA C;  5CPI B;  4ARZ B;  4HGA B;  5E5A A;  2ZY2 A;  1BLS A;  5B1M A;  4DE1 A;  1OT9 A;  1T1B A;  5G4Z A;  2PHY A;  1K6S A;  1BZA A;  5CPJ A;  2DNS A;  4CLC B;  1OT6 A;  4S2N A;  4BBT A;  1P34 D;  1ESI A;  1MKI A;  1T3U A;  4AFI A;  5EVI B;  3O62 C;  5M19 A;  3F6T A;  3K3C A;  1P3B A;  5GT3 D;  5F99 A;  4OQ0 A;  3WKJ B;  1D06 A;  5GLD A;  5IS1 A;  5A93 A;  1AOI B;  3SS4 A;  1Z6F A;  4DJ3 A;  1YLJ A;  1LL5 A;  4LEN A;  3NOP C;  3REI A;  4KUO A;  1T1A A;  2YFV A;  3ZG7 B;  5KZH A;  5BOH A;  1GXD A;  1TS8 A;  3CJM A;  3KXB B;  3LZ1 A;  1IYS A;  1EWZ A;  3BEB A;  3IH8 A;  4MNR A;  3VH5 A;  3A6N B;  2MJ6 A;  1N9N A;  1ESU A;  2XF3 A;  5FDH A;  4YS3 B;  5B2J C;  3GTC A;  5TR7 A;  3S1Y A;  3E98 A;  1H8P A;  4KUD B;  1FQG A;  2ZC6 B;  3H0L C;  1BH8 B;  3BLM A;  1N1J B;  1VEU A;  2PU4 A;  4QY5 A;  1EI5 A;  3AZJ D;  4KGC B;  4O7D A;  1KX4 A;  5GSU B;  3ISG A;  4Z1W A;  3FV7 A;  3R4K A;  5CX7 A;  5HPF A;  3MKF A;  4H9R B;  1W79 A;  4ZBE A;  5GHY A;  2NZD A;  5CP6 B;  1M18 A;  4LV2 A;  5FQI A;  3P09 A;  4C3Q A;  2OLU A;  1HTA A;  1P3P C;  1LI0 A;  5FQJ A;  3R45 B;  3MXQ A;  2V1B A;  5GHX A;  3WTP B;  2FJ7 D;  5B32 A;  4EEU A;  5K5B A;  4IJG A;  3LR4 A;  2F8N A;  1L0E A;  1BFM A;  4JJN D;  5FQ9 A;  3AZG D;  3DTE A;  3T1R A;  2IOU A;  4ZUX B;  1JNU A;  3WS0 A;  4U3T A;  3W99 B;  1TZY B;  1W63 M;  4KHA B;  3B6G D;  4B4X A;  4X6T A;  3KUY D;  2G5H C;  4JGO A;  3AZM A;  4S2O A;  2JKF A;  1B6W A;  2DCF A;  2RCX A;  3CHW P;  5FAO A;  1NXY A;  3SZT A;  4R6L A;  1RCJ A;  3AL0 C;  3REJ A;  2B95 A;  1MC0 A;  1S4R A;  4R3A A;  1CF0 A;  3V50 A;  5HDC A;  1P3L B;  4ZAM A;  1LL8 A;  3MGS D;  5FL3 A;  3H9W A;  3IHB A;  1W8Y A;  1Y54 A;  4RVA A;  3B6G C;  1XJ6 A;  4UA7 A;  5AV8 B;  5FQK A;  3TE8 A;  3T12 B;  1F66 B;  1M1A A;  4JBF A;  2CV5 B;  4Q0I A;  3Q7V B;  3HJI A;  3LZ0 B;  3B0C T;  3VFH A;  1TF1 A;  1EQZ A;  3AV2 B;  4OOL A;  4GS9 A;  4PPR A;  3AFA C;  1E8B A;  3C2W A;  3NIA A;  1BUL A;  2O0Y A;  4KZ6 A;  3PBS A;  1L0G A;  4Z2M H;  1P3G D;  1E6Z A;  2NQB B;  1HZO A;  3JPU A;  3MXS A;  4NXF A;  3REH D;  4NZ1 A;  2F8N H;  4J8X D;  2WZZ A;  3GMW A;  1E88 A;  4YM6 B;  1K55 A;  1SKO A;  1SZV A;  5A90 A;  2V8F A;  2YKF A;  3NBL A;  1ACF A;  4Z66 A;  2A49 A;  5B0Z C;  1S6R A;  4WF0 A;  4BD0 A;  3HLB A;  3AZK B;  3LIA A;  1K54 C;  5HX9 A;  3RFB A;  1S1Z A;  1Z2C B;  4EXO A;  1W5D A;  3GEC A;  5AV6 B;  3AZI A;  3MNN C;  5HWW A;  1ID3 A;  2Q9N A;  2Z2L B;  4KQD A;  5JA4 A;  1KX3 B;  4H6J A;  5E2F A;  2B02 A;  2ARO C;  3LI9 A;  4KG2 A;  4QLC C;  1N9L A;  4H9O B;  3G6O A;  5AV9 B;  4CSR A;  5EFW A;  2VK3 A;  5CPK A;  2ZL1 B;  1ERM A;  4ZTK A;  1K4E A;  2K7S A;  2VGL M;  2X02 A;  1P3F B;  3BW6 A;  4WMC D;  3B6F C;  4JGR A;  4J8U C;  4DRB A;  5FAQ A;  4AWL B;  2FFY A;  4QU3 A;  4C6Y A;  4EQ1 A;  5GXQ D;  4S2M A;  3W98 C;  2KDK A;  3OOV A;  2ZM0 A;  5JYO A;  4BD1 A;  3C5A A;  4NK3 A;  4OOY A;  2ZC3 B;  4QD4 A;  3A0R A;  3X1U C;  5MC7 A;  4OJL A;  3BY8 A;  3AV1 A;  3U4L P;  4LG2 A;  1V9Z A;  1PWD A;  3MGP C;  1K57 C;  5DNN A;  2PYO A;  5EVI D;  5AV5 A;  2W3G A;  3IWO A;  2Z2M B;  1JTD A;  2WKH A;  3HRE A;  3WRT A;  4OKP A;  5CPI C;  5TJJ A;  4LPZ A;  3IS2 B;  3BFC A;  5GLB A;  4HGA C;  2ZC7 A;  1YKD A;  5B33 B;  4XUZ A;  4R4R A;  5J3W A;  3WKJ D;  3LIC A;  4IBF A;  3QP6 A;  3X1V A;  2XH9 A;  3UTA A;  5CER A;  4ZJ2 A;  5B1L D;  1AOI D;  4CLC C;  4CQH A;  5TFQ A;  3U2A A;  4JXG A;  5FEF A;  2V8C A;  4DDY A;  4EUZ A;  3MGR D;  1JVJ A;  4NZ3 A;  1ODV A;  3EQV A;  5CHL B;  4NZ4 A;  1BLP A;  4H9P A;  3KXB D;  2WKR A;  3MGQ B;  3H82 A;  4KUK A;  2L0W A;  4P87 A;  4YIN A;  3A6N D;  1PW1 A;  3KSF A;  3HLW A;  3AZF B;  4HEF A;  4YS3 D;  1CI9 A;  1KU5 A;  1AOI C;  1M19 D;  4GOG A;  4DRA A;  1ZHH B;  3AYW B;  2M7U A;  2QWS A;  2OLV A;  3AN2 A;  2K2N A;  4JGP A;  4KGC D;  3I7J A;  4R8P B;  4Q0H A;  3DBA A;  1K0K A;  2XLN A;  3T4K A;  1G28 A;  3CI6 A;  3KXB C;  3T4O A;  1P3O A;  5CP6 D;  3REK B;  3CLO A;  1YU3 A;  2PU2 A;  2W3F A;  4WZ5 C;  4RX2 A;  3LJA A;  5FQM A;  5HAQ A;  4XUX A;  4KUD C;  5HAR A;  4H9Q B;  2OAP 1;  2YKH A;  1E3U A;  3IF6 A;  1PDC A;  5GSU C;  4XZQ A;  3ZNT A;  2EX8 A;  1ED7 A;  3MS6 A;  2L4R A;  1VET B;  5DF8 A;  3DTI A;  5CP6 C;  1PWC A;  1LSW A;  4E3I A;  4M3K A;  4J8V B;  4ZUX D;  3TW8 A;  2HJE A;  3W99 D;  3MFX A;  3MSH A;  1MWU A;  3T4L A;  2EA9 A;  3SOI A;  3WTP C;  5GL9 A;  2HUE C;  3P5J B;  5KIZ A;  2XDM A;  2QZ6 A;  2DQN C;  1HD8 A;  1TS7 A;  5GT0 B;  1ONG A;  5BNX B;  1H3Q A;  2VGL S;  5B24 A;  4LRY C;  5F6A A;  1M6K A;  4NKP A;  4EV4 A;  4E6X A;  3CPT B;  3BLS A;  3W99 C;  1TZY C;  3AZL A;  1WA9 A;  5AV8 D;  5DTS A;  1L3L A;  4G3V A;  1KOU A;  1NYY A;  5B0Y B;  4JXV A;  1F66 D;  5B2I A;  4B93 A;  3O62 B;  5FI6 A;  1YLW A;  2J8Y A;  3LZ0 D;  5BS7 A;  1YLP A;  3TRC A;  2EXA A;  3AV2 D;  3LFV A;  1DY6 A;  1YSP A;  3H0R C;  5HAI A;  2J80 A;  1P3L C;  4B4Z A;  5EE8 A;  2Y79 A;  2VZW A;  3NJA A;  3GVB A;  5AV8 C;  3MZD A;  3V3S A;  5BT1 C;  1E6R A;  4BJP A;  4UUZ A;  1BT5 A;  4DQY B;  2P7J A;  3LEL C;  2CV5 C;  2IA2 A;  4YM6 D;  2PR5 A;  4S2K A;  2A3U A;  4IVK A;  2IWD A;  3AV2 C;  4IBJ A;  3TG9 A;  3X1T A;  3ZVT A;  2P74 A;  5AVF A;  3A0V A;  2V1A A;  3MXR A;  5AV6 D;  2NQB C;  2HIO D;  4MLL A;  3A1K A;  2ZQA A;  4FCF A;  5IU1 A;  2XR0 A;  4YM6 C;  2PDR A;  3VH6 W;  4MDZ A;  1KX3 D;  4QNL A;  4IBK A;  2Y91 A;  2M1C A;  3C1B D;  1I5Q A;  1KGE A;  1QMF A;  3AZK C;  1X0O A;  2GNX A;  5AVB A;  3N8S A;  1W1T A;  3M2J A;  4WU8 C;  1IKI A;  5AV9 D;  1ZKJ A;  2P04 A;  1H3O A;  5JRG B;  1GOI A;  3LR5 A;  4UQI M;  3C1C B;  3LUQ A;  1P3F D;  3D9Y A;  3G4P A;  1P3I A;  5TBM A;  4ETX A;  3E4P A;  4KZ9 A;  3IT9 A;  4Z5T B;  4WU9 A;  3FZC A;  3TU4 A;  3TJZ C;  1F5M A;  5AV9 C;  4IBC A;  3CUE C;  1UGU A;  1CK3 A;  3AGE A;  1P3F C;  4IBR A;  3EPL A;  2Y2L A;  2H28 A;  1XFN A;  4UA6 A;  4XUJ A;  3KWQ B;  2GZA A;  4OPY A;  3BY9 A;  1WWS A;  4K08 A;  3MQL A;  3V39 A;  1NRF A;  3N3F A;  1KGF A;  5CXW A;  3LY3 A;  2HGV A;  5HAP A;  5DNM D;  2RVQ D;  3W97 B;  4GW9 A;  1OTD A;  4KZ5 A;  4XT2 B;  5EVE A;  4Z2H A;  5B33 D;  5B40 B;  5M18 A;  1NZO A;  1G5U A;  4WV4 B;  5FUG B;  5DF9 A;  4J8W B;  2I72 A;  3D72 A;  2NUP C;  1T1C A;  4DE0 A;  5EM0 A;  4S2L A;  1KDS A;  1ERQ A;  3UB9 A;  1P34 A;  2HP9 A;  3AFA B;  2IWC A;  5AY8 D;  2W8S A;  3AZN B;  3MGQ D;  1S32 D;  4DKI A;  1CI8 A;  1P3K B;  1Z09 A;  3W96 C;  2PD7 A;  5KDM A;  5B33 C;  2JN7 A;  3AZF D;  4ESP A;  5L09 A;  5GT3 A;  4GDN A;  3QP5 A;  4RX3 A;  2VKS A;  5B1M B;  4H9N A;  3SS3 A;  1DP6 A;  3AYW D;  2BYM A;  1KX5 A;  4HP4 A;  5B0Z B;  3SW1 A;  5CPJ B;  4WZS B;  2OWH A;  4OP5 A;  4R8P D;  4BLM A;  3ZNY A;  3K2N A;  1IYP A;  4NZ5 A;  3L27 A;  4E3L A;  1TEM A;  3KS4 A;  3V9R A;  3UME A;  2XFS A;  4HH2 A;  1MBL A;  1MWT A;  4NXG A;  1BH9 A;  1HVB A;  1PI4 A;  4WEK A;  3UE0 A;  3UTB A;  3S7Q A;  5G49 A;  5DFY A;  3UB8 A;  3T1Q B;  1W2E A;  2ARO B;  1D1J A;  3A0S A;  1P0Z A;  3A1I A;  2INW A;  3BJN A;  4R8P C;  4EES A;  1H0I A;  3CMZ A;  1OGG A;  2HDQ A;  3AZJ A;  3L25 A;  2YFV B;  1ONH A;  3EEA A;  3REK C;  4E6W A;  4NE6 A;  4HMC A;  4J8V D;  2Y4A A;  4FD8 A;  3LZ1 B;  2WAF A;  4H9S C;  3A3I A;  4J8U B;  3AGF A;  1DJA A;  1PW8 A;  2EX2 A;  3GQZ A;  2XEP A;  1GPF A;  4N1X A;  3UE1 A;  4CLC E;  3X1S C;  3Q1F A;  4ID4 A;  5EM1 A;  4QY6 A;  2FJ7 A;  3W98 B;  3LEZ A;  1ZLA D;  1VEU B;  4ME4 A;  3FC7 A;  1U35 C;  1K4F A;  4F3L A;  1KX4 B;  4JJN A;  4D60 A;  2W3D A;  1UWP X;  3AZG A;  1NLZ A;  4L0L A;  3MQQ A;  1E4D A;  2NZD B;  1KDW A;  1M18 B;  1SHV A;  3UDX A;  4DJ2 A;  2LB9 A;  2IO5 C;  5DTT A;  3MGP B;  2RIQ A;  5B0Y D;  2WK0 A;  4DN0 A;  3REL C;  3IX3 A;  3O62 D;  3KUY A;  5EOE A;  3JVV A;  5B32 B;  5GT0 C;  4TX8 A;  1FCN A;  4NY2 A;  5J4E A;  2PBD P;  5A8B A;  2F8N B;  1E6P A;  4RQ9 A;  4LCL A;  4WUJ A;  4PKY A;  4GHI B;  3VSK A;  1H8M A;  1H8Y A;  2HJ9 C;  4X23 B;  3MGS A;  2FN2 A;  2XRN A;  5B0Y C;  4IJE A;  1TVF A;  1JFI A;  3FPV A;  4KZ7 A;  2XA7 S;  1VB6 A;  5CRF A;  1MXO A;  3E4Q A;  5B2J D;  3WS2 A;  3BFD A;  2FH5 A;  2WKE A;  1P3G A;  2Z6C A;  3HVF A;  4S2I A;  1PRQ A;  5F69 A;  3WTP E;  4NXE A;  3UT9 C;  3REH A;  3DWZ A;  1G6O A;  4J8X A;  4MB3 A;  1IYO A;  2H5S A;  3BFF A;  4DXB A;  3BWL A;  5EPH A;  3PBT A;  4LD9 B;  1P3P D;  1EQZ B;  5IHV A;  4Z2K A;  5B32 G;  2V9A A;  4Z2M G;  5JRG D;  1W1P A;  3WRZ A;  3B0C W;  5C3I B;  2F8N G;  3S22 A;  4Z2L A;  3E4O A;  3EWK A;  4EO5 B;  2H10 A;  4JF5 A;  2EFU A;  1TD5 A;  1SKO B;  4L9F A;  4Z5T D;  1YLT A;  3IBJ A;  5HWT A;  4Z66 B;  5CTN A;  1K56 A;  4OH0 A;  2HUE B;  2P08 A;  5JRG C;  4LGW A;  3C1C C;  4EBN A;  1Y28 A;  1NY0 A;  3WA9 C;  3AZI B;  4DMZ A;  1OTE A;  5FAS A;  3LEQ A;  2P9V A;  4WMC A;  1ID3 B;  1W1V A;  4Z5T C;  1ERO A;  5JA4 B;  4BBU A;  4H6J B;  3S7P A;  5GXQ A;  4KZ3 A;  3BFE A;  1ES5 A;  3W97 D;  3MMH A;  5U47 A;  3NOT C;  3NEC A;  4OPQ A;  2GDN A;  1L2S A;  4LV3 A;  3P98 A;  3WAA A;  4WL9 A;  4CSR B;  4Y5F A;  4BEN A;  1TS6 A;  2KX6 A;  5CPK B;  4G3W A;  4YOF A;  3KWQ C;  1FCM A;  2LB5 A;  3C8C A;  3AFA D;  3L2A A;  1PZO A;  3AZN D;  5EVI A;  3W97 C;  3EQU A;  3H0M C;  1P3K D;  3LGO A;  5B40 C;  2V1Z A;  4MN7 A;  3LEL B;  5GLA A;  3NCK A;  4J8W C;  3WKJ A;  2H0Y A;  3L28 A;  1WYC A;  1XJ4 A;  2BYK A;  2VA0 A;  5B1L A;  5B0Z D;  5CPJ D;  4NYY A;  3MGR A;  5B31 A;  2WKQ A;  3AZN C;  4Z9Q A;  5DNN B;  1P3K C;  2F8N K;  3KXB A;  1SCW A;  4GNU A;  3MNN D;  3A6N A;  3UE3 A;  4GD6 A;  4QPR A;  5E5A C;  2Y2G A;  4IBE A;  5B1M C;  4YS3 A;  3D3O A;  5EOO A;  3X1V B;  5DKL A;  3VP1 A;  1M19 A;  2D49 A;  1TS0 A;  5KSH A;  2ARO D;  5CPJ C;  1NWZ A;  2ZQD A;  4JXW A;  4QLC D;  1P3A A;  1HQ3 A;  3C4P A;  1BH8 A;  2K31 A;  4S2N C;  1L0D A;  4Y0T A;  4WU8 B;  4KGC A;  4O8G A;  1LLB A;  1BYW A;  1DJC A;  4H9P B;  1GSV A;  3H82 B;  1P3B C;  3B6F D;  4EUV A;  2YFW A;  5F99 C;  5F5Y A;  2O9C A;  4J8U D;  3R45 A;  2ZMA A;  5AVC B;  4HY8 A;  1OTB A;  3W98 D;  3FWL A;  3REI C;  4GKU A;  1G68 A;  2JC7 A;  2VV7 A;  2EX9 A;  3A3J A;  4EEP A;  4HJ6 A;  1S0W A;  1F98 A;  3VH6 A;  3X1U D;  4XXR A;  3SS5 A;  1P3O B;  3LZ1 C;  4EET B;  3C7U A;  1M18 D;  3B0D B;  3MQO A;  4ZUX A;  4MMN A;  2VV8 A;  4EWF A;  1IEM A;  3EGX C;  1LL9 A;  2EFX A;  3MGP D;  2GJ3 A;  3WD0 A;  3NQJ A;  4NE5 A;  1SKF A;  2BLS A;  5CPI D;  1NZU A;  2ZM8 A;  3OPP A;  1KX4 C;  3VP4 A;  4XZQ B;  3L29 A;  1IKG A;  1GSW A;  3AZH A;  1YLZ A;  3IQA A;  2VLG A;  2NZD C;  3C7V A;  4I38 A;  1M18 C;  4CLC D;  4NFT A;  4KZB A;  1NYM A;  4X23 D;  4KZA A;  1LI9 A;  3IXD A;  3WD2 A;  3DTK A;  4CAY A;  3KSI A;  3TOI A;  1KE4 A;  3T4Q A;  1F66 A;  4Y15 A;  5LBR A;  5B32 C;  2ZOI A;  2BG1 A;  2QJ5 A;  3O5Y A;  3W96 B;  3Q7V A;  1DP9 A;  3B33 A;  3LZ0 A;  4LLO B;  1O7E A;  3ZCZ A;  3HLE A;  5B24 B;  1N4O A;  2ZQ7 A;  4X23 C;  1J9M A;  3HL9 A;  2JKG A;  4WEJ A;  3RXX A;  2J8P A;  5FA7 A;  1IOU A;  3NQU A;  4OOM A;  3AZM C;  5B2I B;  4X55 A;  4FUW A;  5FI2 A;  2WYX A;  4LD9 D;  3REJ C;  1CK7 A;  3HLC A;  2R9X A;  1EQZ D;  1AXB A;  4KUD D;  4IVI A;  1P3M A;  4HH3 A;  4HJ3 A;  1D7E A;  1IFQ A;  4HI4 A;  5AV6 A;  2HIO A;  5GSU D;  3PAE A;  3A3E A;  4UUZ B;  2Y2J A;  1M1A C;  2E8J A;  3WD1 A;  5CGX A;  1KX3 A;  1DP8 A;  3BYD A;  4NE3 A;  1RGZ A;  5HW3 A;  4LD9 C;  2ZMV A;  1W8Q A;  3G34 A;  5F1G A;  1EQZ C;  3C1B A;  3RJU A;  1GSX A;  3QNC A;  3WTP D;  4BQM A;  3X1T B;  3X1S B;  5C3I C;  2WZX A;  3KSH A;  3ZG9 B;  3OPR A;  4PM8 A;  2G2U A;  3AZI D;  4MBK A;  4EO5 C;  2W1T B;  1U35 B;  3LO7 A;  2WGV A;  1LHY A;  1YLY A;  1WWI A;  1K55 C;  3QHY A;  5DF7 A;  2J3W A;  4HMD A;  4HNB A;  3P7N A;  1TZY D;  1OTI A;  1XA7 A;  2G2W A;  3MBZ A;  4Z66 C;  2IO5 B;  3UPP A;  1BLH A;  4HES A;  5GHZ A;  1XGI A;  4GN2 A;  5AVB B;  3VOY A;  3M2K A;  3REL B;  3WS1 A;  3KYQ A;  3ZVW A;  3AZI C;  2O9B A;  1MWS A;  4G92 B;  1ID3 C;  1CQA A;  1L0F A;  4JPM A;  4U0X A;  3LID A;  5TBM B;  1QO6 A;  1F1E A;  1XPB A;  2V20 A;  4GZB A;  1P3L D;  3MVD A;  5CGW A;  3LY4 A;  4IBB A;  3EG5 B;  2ZQC A;  2ZC5 B;  5BT1 D;  3TU4 B;  5DNM A;  3WWX A;  3B42 A;  3CWF A;  3VH5 T;  3LR3 A;  4PM9 A;  3LEL D;  2CV5 D;  1PNE A;  3R7W A;  4OQI A;  2EXB A;  5B33 A;  4D2O A;  1NRJ A;  4O01 A;  2VV6 A;  2Y2K A;  5CPK C;  3F1N A;  4BWI A;  3N7W A;  3T4T A;  4XUJ B;  4IHQ A;  2OV5 A;  2NQB D;  3C30 A;  3OBF A;  5FI7 A;  5AY8 A;  2WGW A;  3MGQ A;  2V0W A;  1S32 A;  3WS5 A;  2HDS A;  4OP8 A;  3UT9 B;  2ZMF A;  3AZF A;  3F1O A;  1S4S A;  1E15 A;  4FOF A;  1QME A;  3NC8 A;  5DVA A;  5G4Y A;  3QP1 A;  1L6J A;  4YWZ A;  3AYW A;  3LYX A;  3BM6 A;  3AV1 C;  3AZK D;  1S1Y A;  5BO0 A;  3MJQ A;  4IBI A;  4WU8 D;  4LCM A;  2HF6 A;  4R8P A;  2VEA A;  4HJ4 A;  5DNN C;  5HD5 A;  2ZM5 A;  2PYO C;  5AV5 C;  1BLC A;  4BBV A;  1NLY A;  3HBR A;  5KDM B;  5GT3 B;  3X1V C;  3AZE B;  3UTA C;  3IBR A;  1YU2 A;  5AVC D;  3HUN A;  2OAQ 1;  4Q8I A;  1LSV A;  1KVM A;  1KX5 B;  5J8X A;  2V5O A;  2AVX A;  1YM1 A;  2CC1 A;  2B5R A;  3ZFZ A;  1KVL A;  3NOU C;  5CGS A;  1IYQ A;  1VET A;  2NUT C;  2PD8 A;  5CTM A;  3SH8 A;  4CJN A;  2Y2I A;  3WA9 B;  3V9R B;  4J8V A;  2A24 A;  3B0B A;  1TAF B;  3UTB B;  3O86 A;  5AVC C;  5G49 B;  3M7P A;  3IWQ A;  5EEC A;  5I94 A;  2ZOH A;  1U60 A;  3AN2 C;  4FSF A;  3L26 A;  4XZQ D;  1ZLA A;  1CEF A;  1ZC2 A;  2WUQ A;  2CWE A;  4P6Z M;  4OUI A;  5BNX A;  1YU4 A;  3V67 A;  1P3O C;  4ZBJ B;  3B0D C;  4OVD A;  4E45 A;  3ITB A;  4GB7 A;  3CPT A;  5FEG A;  4MCW A;  4EW7 A;  3L7H A;  1PWG A;  2W1R A;  3LJA C;  1XJ3 A;  3ZDJ A;  2I9V A;  5G18 A;  2Y2O A;  3MFD A;  1PZR A;  4PM7 A;  3O62 A;  4PM6 A;  3IF6 C;  2FJ7 B;  4XZQ C;  3W96 D;  3OLO A;  3NHQ A;  2XA7 M;  3IX4 A;  1RGY A;  2UWX A;  5DFX A;  4F3L B;  5B24 D;  4JJN B;  1PYY A;  2QMI A;  4OQG A;  3AZG B;  4JF4 A;  3WS4 A;  3SH7 A;  2E8I A;  3LI8 A;  1ES2 A;  5B2I D;  2QKP A;  1OTA A;  3KUY B;  4OJ6 A;  2J9O A;  4E3O A;  5E5A B;  2JKT M;  4HOI A;  1ZG6 A;  3PBR A;  5B24 C;  5HL1 A;  5B2J A;  4L9E A;  4JLF A;  1BUE A;  3FKV A;  5CHJ A;  2JCH A;  4P6B A;  3ITA A;  3UMD A;  1UR9 A;  2Y55 A;  3AZL C;  3UN7 A;  5IT5 A;  5B2I C;  3REK D;  1S66 L;  4F94 A;  3H7W A;  5CEC A;  5HPI A;  4WYY A;  4OPZ A;  3TSG A;  1P3B B;  3Q7Z A;  4GD8 A;  3G2Y A;  3T4J A;  5F99 B;  3W4P A;  5BS7 C;  2FFF B;  2G5I C;  3QP2 A;  3KSY A;  3X1T D;  1P3P A;  4M4X A;  3X1S D;  2OSU A;  4GDB A;  2EWV A;  3PTE A;  3REI B;  4ETZ A;  4GHA A;  1P3G B;  1U35 D;  4MBF A;  1P9R A;  3REH B;  4J8X B;  3P01 A;  2F2A C;  3UB6 A;  3GRJ A;  1Y4O A;  4BMW A;  4Z2G A;  3NY4 A;  3X1T C;  3HSH A;  4IBD A;  3REL D;  3O3V A;  3DW0 A;  5FAT A;  2ZD8 A;  3EOI A;  5GT0 D;  5HD3 A;  5GLC A;  1KS0 A;  2HDR A;  4IBX A;  2J9P A;  1YMS A;  3DAV A;  4LRX C;  4PKY G;  4OJ5 A;  3KO6 A;  1F2K A;  3ZG5 A;  5CEB A;  1GHP A;  4B9O A;  1VHM A;  5F83 A;  1CEG A;  1CXW A;  3B6G A;  5AVB C;  3KSG A;  1K6R A;  3ICY A;  4FTX A;  4KEN B;  4P6Z S;  3LIF A;  4G92 C;  4Y0O A;  4BL3 A;  1P3I C;  4L9G A;  3GSG A;  2JBF A;  3UNW A;  5L2F A;  3AFA A;  4P0M A;  3TU4 C;  2B18 A;  2ZJ9 A;  5GXQ B;  5BNV A;  5AQB A;  2W27 A;  2L5A A;  4E3N A;  3UT9 D;  4ZDX A;  3FDD A;  4E3J A;  3FKE A;  3AZM B;  4MEZ A;  4WNN A;  3F1P A;  4OJO A;  4R1G A;  3C38 A;  3WAA B;  3W2Z A;  1J3W A;  4CPK A;  1E6N A;  3LIB A;  5B0Z A;  4XUJ C;  3REJ B;  1N9B A;  3FG8 A;  5HDD A;  3VFF A;  5FQQ A;  3C4O A;  2X01 A;  2JKR M;  2XK1 A;  3KS8 A;  1K54 A;  1WE4 A;  2Q9M A;  2HV1 A;  3MNN A;  3CG5 A;  2WKI A;  3AZE D;  1M1A B;  4Y0U A;  2ZY5 A;  4WLA A;  4RA7 A;  3BEC A;  2BYK B;  1FR6 A;  1KX5 D;  1SDN A;  3PBQ A;  5B1L B;  2ARO A;  4Q0J A;  4Y13 A;  1BSG A;  4QLC A;  1P34 C;  1T19 A;  4GS9 B;  3MGR B;  3C1C D;  1ES4 A;  5B31 B;  1PFL A;  1YT4 A;  4X1L A;  4BL2 A;  3WA9 D;  1NJ4 A;  4NG2 A;  1XXM A;  4YFM A;  5GT3 C;  3UO9 A;  3B6F A;  3AZE C;  3UTB D;  4J8U A;  2Q0O A;  2BAS A;  3IXB A;  1MKM A;  4R0Q A;  4KQO A;  1KX5 C;  1BTL A;  1M19 B;  3W98 A;  1ULY A;  1P3A B;  1HQ3 B;  5HZH A;  1FIK A;  2JKT I;  4II7 A;  1OPX A;  4N9L A;  3X1U A;  4K0W A;  2O9A A;  3KWQ D;  4H8R A;  4Z2J A;  3UTB C;  2YFW B;  2Y2M A;  3VMA A;  4KQQ A;  3MGP A;  4R70 A;  1K57 A;  4UAA A;  3MZF A;  5CPI A;  4ARZ A;  5B40 D;  3AZJ C;  1MWR A;  1V9Y A;  4ZBJ C;  3HJK A;  4J8W D;  4WZ4 A;  5M1A A;  5F68 A;  2ACG A;  4GHI A;  2WKP A;  2ZM2 A;  4CLC A;  1KE3 A;  5F1F A;  1JTG A;  4X23 A;  3G32 A;  3T50 A;  3CAX A;  3HON A;  4KG6 A;  5B31 G;  4R23 A;  1H0M A;  1TDL A;  1TDG A;  3NQJ B;  1KGG A;  4G3K A;  5DJT A;  2FJ7 C;  4OON A;  3OPL A;  1H0G A;  4K91 A;  1R4V A;  1LSX A;  4B88 A;  1AIW A;  5E5A D;  5B1M D;  4JJN C;  3EPK A;  3VP3 A;  5EV0 A;  2HPB A;  3AZH B;  3AZG C;  3IHA A;  1AOI A;  2Y2H A;  5HDS A;  3VV4 A;  3UDI A;  3AV1 B;  3OCL A;  2C6W B;  1LT0 A;  4GLQ A;  5AQ7 A;  1MZU A;  4S2J A;  4CAY B;  2PYO B;  3KUY C;  5AV5 B;  2IWB A;  1FSW A;  1G6A A;  3UB5 P;  3AGD A;  1H5X A;  1P3B D;  4E04 A;  5F99 D;  4WZ5 A; 
#chains in the Genus database with same CATH homology
 4DF6 A;  4LD9 A;  5CHM A;  1XP4 A;  3UTA B;  3NDE A;  4WEL A;  3ZGA B;  2HP6 A;  4KUD A;  3IF5 A;  1ZG4 A;  1N1J A;  3REI D;  3IP4 C;  5CED A;  3MGS C;  5GSU A;  4H9R A;  1FOF A;  3NQU B;  3E2K A;  5CP6 A;  3LZ1 D;  3IH9 A;  5F82 A;  2ZY3 A;  2LY8 A;  3WTP A;  1P3M B;  3HLF A;  3AN2 B;  1P3G C;  3N4I A;  1KX4 D;  2HIO B;  2HDU A;  3GV9 A;  3VP2 A;  3REH C;  4J8X C;  1JWP A;  1RP5 A;  2NZD D;  3HUM A;  3LCE A;  4OQH A;  3EPJ A;  1K25 A;  1PZP A;  2EX6 A;  3ZG0 A;  3W99 A;  1TZY A;  4KHA A;  3LJA B;  4HBT A;  3C1B B;  1FR1 A;  1VQQ A;  1K56 D;  5B32 D;  3GR2 A;  4QHC A;  3IF6 B;  4JKT A;  2F8N D;  4EBL A;  3PBN A;  4EBP A;  4UHU A;  4ZJ1 A;  2DRW A;  1P3L A;  3OC2 A;  3A3D A;  3BRM A;  2XD1 A;  5AV8 A;  4E3M A;  1YMX A;  3NI9 A;  2WGI A;  4N9K A;  3UDF A;  1A7W A;  1Q2P A;  2V2F F;  3IXH A;  3AZM D;  3LEL A;  2CV5 A;  3HLG A;  3WAA D;  4RYE A;  4WJ3 C;  3REJ D;  1O07 A;  3AV2 A;  1GHM A;  4UPK A;  1GHI A;  4K0X A;  1Q2Q A;  4JXS A;  2HP5 A;  3MZE A;  3MVD B;  3AZL B;  3V3R A;  5GXQ C;  2NQB A;  4KG5 A;  2Y2P A;  5DNM B;  2VGK A;  3O88 A;  4YM6 A;  1M1A D;  1M40 A;  4OPR A;  1HTZ A;  3WAA C;  3VH5 W;  3AZK A;  5FSR A;  3A3F A;  4HBU A;  4WU8 A;  5AQ9 A;  2JE5 A;  5B31 D;  3V5M A;  5EVI C;  5AY8 B;  2WGW B;  1GCE A;  1S32 B;  3N8L A;  4OJP A;  3WKJ C;  5DTK A;  1H8Z A;  1IEL A;  2ZY4 A;  5B1L C;  5AVC A;  4Z66 D;  4UA9 A;  2X71 A;  4H9O A;  1P3A D;  1HQ3 D;  3W8K A;  5BO0 B;  5AV9 A;  3MGR C;  5B31 C;  3Q82 A;  1MPL A;  3IXG A;  1P3F A;  2R9W A;  3VP0 A;  1ID3 D;  3A6N C;  3EPH A;  3ZHH A;  3B3X A;  4YS3 C;  4NYU A;  3W4Q A;  3HUO A;  1M19 C;  5E43 A;  2VGJ A;  3D4F A;  1P3A C;  1HQ3 C;  4EQI A;  3Q07 A;  4LV0 A;  3UPN A;  4KGC C;  4X53 A;  3CZD A;  1H3O B;  5CHU A;  5CPK D;  4MBH A;  2ZQ8 A;  4JF6 A;  1P3I B;  1OME A;  4WU9 B;  3FYZ A;  4U0T A;  3ZG8 B;  2JSS A;  3M6H A;  3N6I A;  4G91 B;  4GH9 A;  3M6B A;  4DXC A;  3W96 A;  1PI5 A;  1ZLA B;  4X68 A;  3AZH D;  3O87 A;  4S2P A;  3AV1 D;  4ZUX C;  4DE3 A;  3DWK A;  5DNN D;  4P85 A;  5AQA A;  2PYO D;  5AV5 D;  3RXW A;  5KMW A;  4KZ8 A;  2H0T A;  3OZH A;  5E2G A;  3X1V D;  3AZH C;  3UTA D;  4GHL A;  1I2W A;  1E25 A;  4R4S A;  2ZLY A;  4NET A;  4WBG A;  1P34 B;  4Y7P A;  1B67 A;  4X56 A;  1F66 C;  1JWZ A;  3REK A;  3PBO A;  2C5W B;  4IED A;  1FSY A;  3LZ0 C;  4H9S A;  2Y59 A;  4DE2 A;  4H9N B;  3N8R A;  5B2J B;  4OLD A;  4H9Q A;  2BYM B;  1P3M D;  3X1S A;  4FH2 A;  3OPH A;  3AN2 D;  3PAG A;  3VOZ A;  4R3J A;  3E2L A;  5A92 A;  3G2Z A;  1U35 A;  1P3O D;  3DTM A;  1DJB A;  2WAD A;  3WX7 A;  4DDS A;  3OCN A;  1BH9 B;  3LJA D;  3HLD A;  1Q9C A;  5FAP A;  1P3M C;  2XFT A;  1P3P B;  3REL A;  1E3U D;  5E2H A;  4DRT A;  5AV6 C;  4IJF A;  2HIO C;  4R3B A;  4QB8 A;  5GT0 A;  3AZJ B;  1C3B A;  4PMA A;  1KX3 C;  1XX2 A;  3UY6 A;  3C1B C;  1GA9 A;  1JWV A;  5B0Y A;  3NDG A;  2ZC4 B;  3W4O A;  4KQR A;  1XA1 A;  2XGN A;  4FH4 A;  1XGJ A;  4IBG A;  2XQZ A;  5A91 A;  4N1H A;  2J7V A;  1W7F A;  3QNB A;  4AWL C;  3MVD D;  3AZL D;  5HFO A;  4A5R A;  2QPN A;  3B6G B;  4X69 A;  3UT9 A;  4M6B A;  5JYP A;  3FKW A;  1YQS A;  4OLG A;  3MVD C;  5BPV A;  2XD5 A;  3JYI A;  3VH6 T;  5E2E A;  3MGS B;  5DNM C;  2RVQ C;  5BNV B;  5TGF A;  4KZ4 A;  1JFI B;  3AZE A;  4E3K A;  4WNN B;  1FCO A;  1WYB A;  2Y2N A;  5D3O A;  1XKZ A;  5EVL A;  2VQR A;  2Y2Q A;  1ES3 A;  5JRG A;  3C1C A;  1YU0 A;  5AY8 C;  3IWI A;  3MGQ C;  1S32 C;  3WA9 A;  1GA0 A;  3Q81 A;  1TAF A;  3AZF C;  4PM5 A;  3MNN B;  3UPO A;  1K38 A;  3G30 A;  3G31 A;  4Z5T A;  3AYW C;  3VSL A;  3G35 A;  3MKE A;  5AVB D;  1ALQ A;  4QLC B;  1KE0 A;  2RL3 A;  1I2S A;  1YUE A;  2PBY A;  1YU1 A;  1P3I D;  3KWQ A;  3B6F B;  3BFG A;  4WM9 A;  1SDE A;  4WU9 D;  3TU4 D;  2DF4 C;  3KFU G;  3W97 A;  4LV1 A;  4QJG A;  4N92 A;  5B40 A;  2ZQ9 A;  4C75 A;  4E44 A;  5EUA A;  5KSC A;  5FUG A;  4J8W A;  3S4X A;  4J8V C;  3X1U B;  2WAE A;  1PIO A;  4XUJ D;  2P9V B;  4ZJ3 A;  4WU9 C;  1VM1 A;  3AZN A;  4G91 C;  1P3K A;  3SH9 A;  1MY8 A;  1ZLA C;  5CPI B;  4HGA B;  5E5A A;  2ZY2 A;  1BLS A;  5B1M A;  4DE1 A;  1K6S A;  1BZA A;  5CPJ A;  2DNS A;  4S2N A;  1P34 D;  1ESI A;  1MKI A;  1T3U A;  5EVI B;  3O62 C;  5M19 A;  3F6T A;  1P3B A;  5GT3 D;  5F99 A;  4OQ0 A;  3WKJ B;  5GLD A;  5A93 A;  1AOI B;  3SS4 A;  1Z6F A;  1YLJ A;  1LL5 A;  4LEN A;  3REI A;  2YFV A;  3ZG7 B;  5KZH A;  5BOH A;  3CJM A;  3KXB B;  3LZ1 A;  1IYS A;  1EWZ A;  3IH8 A;  3BEB A;  4MNR A;  3VH5 A;  3A6N B;  1ESU A;  2XF3 A;  5FDH A;  4YS3 B;  5B2J C;  3GTC A;  5TR7 A;  3S1Y A;  4KUD B;  1FQG A;  2ZC6 B;  3H0L C;  1BH8 B;  3BLM A;  1N1J B;  2PU4 A;  4QY5 A;  1EI5 A;  3AZJ D;  4KGC B;  4O7D A;  1KX4 A;  5GSU B;  3ISG A;  3FV7 A;  3MKF A;  4H9R B;  1W79 A;  4ZBE A;  5GHY A;  2NZD A;  5CP6 B;  1M18 A;  4LV2 A;  5FQI A;  3P09 A;  4C3Q A;  2OLU A;  1HTA A;  1P3P C;  1LI0 A;  5FQJ A;  3R45 B;  5GHX A;  3WTP B;  2FJ7 D;  5B32 A;  2F8N A;  1L0E A;  1BFM A;  4JJN D;  5FQ9 A;  3AZG D;  2IOU A;  4ZUX B;  3WS0 A;  4U3T A;  3W99 B;  1TZY B;  4KHA B;  3B6G D;  4B4X A;  4X6T A;  3KUY D;  2G5H C;  3AZM A;  4S2O A;  1B6W A;  2DCF A;  2RCX A;  5FAO A;  1NXY A;  1RCJ A;  3AL0 C;  3REJ A;  3V50 A;  1P3L B;  4ZAM A;  3MGS D;  3IHB A;  4RVA A;  1W8Y A;  1Y54 A;  4UA7 A;  3B6G C;  5AV8 B;  5FQK A;  1F66 B;  1M1A A;  4JBF A;  2CV5 B;  3Q7V B;  3LZ0 B;  3B0C T;  3VFH A;  1EQZ A;  3AV2 B;  4OOL A;  4PPR A;  3AFA C;  3NIA A;  1BUL A;  4KZ6 A;  3PBS A;  1L0G A;  4Z2M H;  1P3G D;  2NQB B;  1HZO A;  3MXS A;  3REH D;  4NZ1 A;  2F8N H;  4J8X D;  2WZZ A;  3GMW A;  4YM6 B;  1K55 A;  5A90 A;  3NBL A;  4Z66 A;  2A49 A;  5B0Z C;  1S6R A;  4BD0 A;  3HLB A;  3AZK B;  1K54 C;  5HX9 A;  1Z2C B;  1W5D A;  5AV6 B;  3AZI A;  3MNN C;  1ID3 A;  2Q9N A;  2Z2L B;  5JA4 A;  1KX3 B;  5E2F A;  2ARO C;  4KG2 A;  4QLC C;  4H9O B;  5AV9 B;  4CSR A;  5CPK A;  1ERM A;  4ZTK A;  1K4E A;  2X02 A;  1P3F B;  4WMC D;  3B6F C;  4J8U C;  4DRB A;  5FAQ A;  4AWL B;  2FFY A;  4QU3 A;  4C6Y A;  5GXQ D;  4S2M A;  3W98 C;  2ZM0 A;  5JYO A;  4BD1 A;  3C5A A;  4NK3 A;  4OOY A;  2ZC3 B;  4QD4 A;  3X1U C;  4OJL A;  3AV1 A;  4LG2 A;  1PWD A;  3MGP C;  1K57 C;  5DNN A;  2PYO A;  5EVI D;  5AV5 A;  3IWO A;  3WRT A;  2Z2M B;  1JTD A;  2WKH A;  3HRE A;  4OKP A;  5CPI C;  3BFC A;  5GLB A;  4HGA C;  2ZC7 A;  5B33 B;  4XUZ A;  4R4R A;  3WKJ D;  4IBF A;  3X1V A;  2XH9 A;  3UTA A;  5CER A;  4ZJ2 A;  5B1L D;  1AOI D;  5TFQ A;  4JXG A;  4DDY A;  4EUZ A;  3MGR D;  1JVJ A;  4NZ3 A;  3EQV A;  5CHL B;  4NZ4 A;  1BLP A;  4H9P A;  3KXB D;  3MGQ B;  4P87 A;  4YIN A;  3A6N D;  1PW1 A;  3HLW A;  3AZF B;  4HEF A;  4YS3 D;  1CI9 A;  1KU5 A;  1AOI C;  1M19 D;  4GOG A;  4DRA A;  3AYW B;  2OLV A;  3AN2 A;  4KGC D;  3I7J A;  4R8P B;  2XLN A;  3KXB C;  1P3O A;  5CP6 D;  3REK B;  1YU3 A;  2PU2 A;  4WZ5 C;  4RX2 A;  3LJA A;  5FQM A;  5HAQ A;  4XUX A;  4KUD C;  5HAR A;  4H9Q B;  1E3U A;  3IF6 A;  5GSU C;  4XZQ A;  3ZNT A;  2EX8 A;  5DF8 A;  5CP6 C;  1PWC A;  4E3I A;  4M3K A;  4J8V B;  4ZUX D;  3W99 D;  1MWU A;  3SOI A;  3WTP C;  5GL9 A;  2HUE C;  3P5J B;  2XDM A;  2QZ6 A;  2DQN C;  1HD8 A;  5GT0 B;  1ONG A;  5BNX B;  5B24 A;  1M6K A;  4EV4 A;  4E6X A;  3BLS A;  3W99 C;  1TZY C;  3AZL A;  5AV8 D;  5DTS A;  1NYY A;  5B0Y B;  4JXV A;  1F66 D;  5B2I A;  3O62 B;  5FI6 A;  1YLW A;  2J8Y A;  3LZ0 D;  5BS7 A;  1YLP A;  2EXA A;  3AV2 D;  1DY6 A;  3H0R C;  5HAI A;  1P3L C;  4B4Z A;  5EE8 A;  3GVB A;  5AV8 C;  3MZD A;  3V3S A;  5BT1 C;  4BJP A;  4UUZ A;  1BT5 A;  4DQY B;  3LEL C;  2CV5 C;  4YM6 D;  4S2K A;  2A3U A;  4IVK A;  2IWD A;  3AV2 C;  4IBJ A;  3TG9 A;  3X1T A;  3ZVT A;  2P74 A;  3MXR A;  5AV6 D;  2NQB C;  2HIO D;  4MLL A;  3A1K A;  2ZQA A;  4FCF A;  2XR0 A;  4YM6 C;  3VH6 W;  1KX3 D;  4QNL A;  4IBK A;  2Y91 A;  3C1B D;  1I5Q A;  1KGE A;  1QMF A;  3AZK C;  3N8S A;  5AVB A;  3M2J A;  4WU8 C;  1IKI A;  5AV9 D;  1ZKJ A;  1H3O A;  5JRG B;  3C1C B;  1P3F D;  3G4P A;  1P3I A;  4KZ9 A;  3IT9 A;  4Z5T B;  4WU9 A;  3FZC A;  3TU4 A;  5AV9 C;  4IBC A;  1CK3 A;  3AGE A;  1P3F C;  4IBR A;  3EPL A;  2Y2L A;  4UA6 A;  4XUJ A;  3KWQ B;  4OPY A;  1WWS A;  3V39 A;  1NRF A;  3N3F A;  1KGF A;  5CXW A;  3LY3 A;  5HAP A;  5DNM D;  2RVQ D;  3W97 B;  4KZ5 A;  5B33 D;  5B40 B;  5M18 A;  1NZO A;  4WV4 B;  5FUG B;  5DF9 A;  4J8W B;  2I72 A;  4DE0 A;  4S2L A;  1KDS A;  1ERQ A;  1P34 A;  2HP9 A;  3AFA B;  2IWC A;  5AY8 D;  2W8S A;  3AZN B;  3MGQ D;  1S32 D;  4DKI A;  1CI8 A;  1P3K B;  3W96 C;  5KDM A;  5B33 C;  3AZF D;  5GT3 A;  4GDN A;  4RX3 A;  5B1M B;  4H9N A;  3SS3 A;  3AYW D;  2BYM A;  1KX5 A;  5B0Z B;  5CPJ B;  4WZS B;  4OP5 A;  4R8P D;  4BLM A;  3ZNY A;  1IYP A;  4NZ5 A;  3L27 A;  4E3L A;  1TEM A;  3KS4 A;  3V9R A;  2XFS A;  1MBL A;  1MWT A;  1BH9 A;  1HVB A;  1PI4 A;  4WEK A;  3UE0 A;  3UTB A;  5G49 A;  1W2E A;  2ARO B;  3A1I A;  4R8P C;  3CMZ A;  2HDQ A;  3AZJ A;  3L25 A;  2YFV B;  1ONH A;  3REK C;  4E6W A;  4NE6 A;  4J8V D;  2Y4A A;  4FD8 A;  3LZ1 B;  2WAF A;  4H9S C;  3A3I A;  4J8U B;  3AGF A;  1DJA A;  1PW8 A;  2EX2 A;  3GQZ A;  2XEP A;  4N1X A;  3UE1 A;  3X1S C;  3Q1F A;  4ID4 A;  4QY6 A;  2FJ7 A;  3W98 B;  3LEZ A;  1ZLA D;  1U35 C;  1K4F A;  1KX4 B;  4JJN A;  3AZG A;  4L0L A;  1E4D A;  2NZD B;  1KDW A;  1M18 B;  1SHV A;  3UDX A;  2IO5 C;  5DTT A;  3MGP B;  2RIQ A;  5B0Y D;  2WK0 A;  3REL C;  3O62 D;  3KUY A;  5EOE A;  5B32 B;  5GT0 C;  1FCN A;  4NY2 A;  2F8N B;  4LCL A;  3VSK A;  1H8Y A;  4X23 B;  3MGS A;  5B0Y C;  4IJE A;  1TVF A;  1JFI A;  4KZ7 A;  5CRF A;  1MXO A;  5B2J D;  3WS2 A;  3BFD A;  2WKE A;  1P3G A;  3HVF A;  4S2I A;  3WTP E;  3UT9 C;  3REH A;  3DWZ A;  4J8X A;  1IYO A;  2H5S A;  3BFF A;  4DXB A;  5EPH A;  3PBT A;  4LD9 B;  1P3P D;  1EQZ B;  5IHV A;  5B32 G;  4Z2M G;  5JRG D;  3WRZ A;  3B0C W;  5C3I B;  2F8N G;  3S22 A;  4EO5 B;  2H10 A;  4JF5 A;  2EFU A;  4Z5T D;  1YLT A;  4Z66 B;  5CTN A;  1K56 A;  4OH0 A;  2HUE B;  5JRG C;  3C1C C;  4EBN A;  1NY0 A;  3WA9 C;  3AZI B;  5FAS A;  2P9V A;  4WMC A;  1ID3 B;  4Z5T C;  1ERO A;  5JA4 B;  5GXQ A;  4KZ3 A;  3BFE A;  1ES5 A;  3W97 D;  5U47 A;  4OPQ A;  2GDN A;  1L2S A;  4LV3 A;  3P98 A;  3WAA A;  4CSR B;  4BEN A;  5CPK B;  3KWQ C;  1FCM A;  3AFA D;  3L2A A;  1PZO A;  3AZN D;  5EVI A;  3W97 C;  3EQU A;  3H0M C;  1P3K D;  5B40 C;  2V1Z A;  3LEL B;  5GLA A;  3NCK A;  4J8W C;  3WKJ A;  2H0Y A;  3L28 A;  1WYC A;  2BYK A;  5B1L A;  5B0Z D;  5CPJ D;  4NYY A;  3MGR A;  5B31 A;  3AZN C;  4Z9Q A;  5DNN B;  1P3K C;  2F8N K;  3KXB A;  1SCW A;  4GNU A;  3MNN D;  3A6N A;  3UE3 A;  4GD6 A;  5E5A C;  2Y2G A;  4IBE A;  5B1M C;  4YS3 A;  5EOO A;  3X1V B;  3VP1 A;  1M19 A;  5KSH A;  2ARO D;  5CPJ C;  2ZQD A;  4JXW A;  4QLC D;  1P3A A;  1HQ3 A;  3C4P A;  1BH8 A;  4S2N C;  1L0D A;  4Y0T A;  4WU8 B;  4KGC A;  1LLB A;  1DJC A;  4H9P B;  1P3B C;  3B6F D;  2YFW A;  5F99 C;  4J8U D;  3R45 A;  2ZMA A;  5AVC B;  3W98 D;  3FWL A;  3REI C;  4GKU A;  1G68 A;  2JC7 A;  3A3J A;  2EX9 A;  1S0W A;  3VH6 A;  3X1U D;  4XXR A;  3SS5 A;  1P3O B;  3LZ1 C;  3C7U A;  1M18 D;  3B0D B;  4ZUX A;  4EWF A;  1IEM A;  1LL9 A;  2EFX A;  3MGP D;  3NQJ A;  4NE5 A;  1SKF A;  2BLS A;  5CPI D;  1NZU A;  2ZM8 A;  3OPP A;  1KX4 C;  3VP4 A;  4XZQ B;  3L29 A;  1IKG A;  3AZH A;  1YLZ A;  3IQA A;  2NZD C;  3C7V A;  1M18 C;  4NFT A;  4KZB A;  1NYM A;  4X23 D;  4KZA A;  3IXD A;  1LI9 A;  4CAY A;  3TOI A;  1KE4 A;  1F66 A;  5B32 C;  2BG1 A;  3W96 B;  3Q7V A;  3LZ0 A;  1O7E A;  3ZCZ A;  3HLE A;  5B24 B;  1N4O A;  2ZQ7 A;  4X23 C;  1J9M A;  3HL9 A;  4WEJ A;  3RXX A;  2J8P A;  5FA7 A;  3NQU A;  4OOM A;  3AZM C;  5B2I B;  4X55 A;  5FI2 A;  2WYX A;  4LD9 D;  3REJ C;  3HLC A;  2R9X A;  1EQZ D;  1AXB A;  4KUD D;  4IVI A;  1P3M A;  5AV6 A;  2HIO A;  5GSU D;  3PAE A;  3A3E A;  4UUZ B;  2Y2J A;  1M1A C;  5CGX A;  1KX3 A;  3BYD A;  4NE3 A;  1RGZ A;  5HW3 A;  4LD9 C;  3G34 A;  1W8Q A;  5F1G A;  1EQZ C;  3C1B A;  3RJU A;  3QNC A;  3WTP D;  4BQM A;  3X1T B;  3X1S B;  5C3I C;  2WZX A;  3ZG9 B;  3OPR A;  4PM8 A;  2G2U A;  3AZI D;  4MBK A;  4EO5 C;  1U35 B;  3LO7 A;  2WGV A;  1LHY A;  1YLY A;  1WWI A;  1K55 C;  3QHY A;  5DF7 A;  1TZY D;  1XA7 A;  2G2W A;  3MBZ A;  4Z66 C;  2IO5 B;  3UPP A;  1BLH A;  4HES A;  5GHZ A;  1XGI A;  4GN2 A;  5AVB B;  3VOY A;  3M2K A;  3REL B;  3WS1 A;  3ZVW A;  3AZI C;  1MWS A;  4G92 B;  1ID3 C;  1L0F A;  4JPM A;  4U0X A;  1XPB A;  1F1E A;  2V20 A;  4GZB A;  1P3L D;  3MVD A;  5CGW A;  3LY4 A;  4IBB A;  3EG5 B;  2ZQC A;  2ZC5 B;  5BT1 D;  3TU4 B;  5DNM A;  3WWX A;  3VH5 T;  4PM9 A;  3LEL D;  2CV5 D;  4OQI A;  2EXB A;  5B33 A;  4D2O A;  2Y2K A;  5CPK C;  3N7W A;  4XUJ B;  2OV5 A;  2NQB D;  5FI7 A;  5AY8 A;  2WGW A;  3MGQ A;  1S32 A;  3WS5 A;  2HDS A;  4OP8 A;  3UT9 B;  3AZF A;  1QME A;  3NC8 A;  5DVA A;  3AYW A;  3BM6 A;  3AV1 C;  3AZK D;  5BO0 A;  4IBI A;  4WU8 D;  4LCM A;  4R8P A;  5DNN C;  2ZM5 A;  2PYO C;  5AV5 C;  1BLC A;  3HBR A;  5KDM B;  5GT3 B;  3X1V C;  3AZE B;  3UTA C;  1YU2 A;  5AVC D;  3HUN A;  4Q8I A;  1KVM A;  1KX5 B;  5J8X A;  1YM1 A;  2CC1 A;  2B5R A;  3ZFZ A;  1KVL A;  5CGS A;  1IYQ A;  5CTM A;  3SH8 A;  4CJN A;  2Y2I A;  3WA9 B;  3V9R B;  4J8V A;  3B0B A;  1TAF B;  3UTB B;  3O86 A;  5AVC C;  5G49 B;  3IWQ A;  5EEC A;  5I94 A;  1U60 A;  3AN2 C;  4FSF A;  3L26 A;  4XZQ D;  1ZLA A;  1CEF A;  1ZC2 A;  2WUQ A;  2CWE A;  4OUI A;  5BNX A;  1YU4 A;  1P3O C;  4ZBJ B;  3B0D C;  4OVD A;  4E45 A;  3ITB A;  4GB7 A;  1PWG A;  3LJA C;  3ZDJ A;  5G18 A;  2Y2O A;  3MFD A;  1PZR A;  4PM7 A;  3O62 A;  4PM6 A;  3IF6 C;  2FJ7 B;  4XZQ C;  3W96 D;  1RGY A;  2UWX A;  5B24 D;  4JJN B;  1PYY A;  2QMI A;  4OQG A;  3AZG B;  4JF4 A;  3WS4 A;  3SH7 A;  2E8I A;  1ES2 A;  5B2I D;  3KUY B;  4OJ6 A;  2J9O A;  4E3O A;  5E5A B;  1ZG6 A;  3PBR A;  5B24 C;  5HL1 A;  5B2J A;  4JLF A;  1BUE A;  3FKV A;  5CHJ A;  2JCH A;  4P6B A;  3ITA A;  2Y55 A;  3AZL C;  3UN7 A;  5B2I C;  3REK D;  4F94 A;  5CEC A;  4WYY A;  4OPZ A;  3TSG A;  1P3B B;  3Q7Z A;  4GD8 A;  3G2Y A;  3W4P A;  5F99 B;  5BS7 C;  2FFF B;  2G5I C;  3KSY A;  3X1T D;  1P3P A;  3X1S D;  2OSU A;  4GDB A;  3PTE A;  3REI B;  4GHA A;  1P3G B;  1U35 D;  4MBF A;  3REH B;  4J8X B;  2F2A C;  3GRJ A;  3NY4 A;  3X1T C;  3HSH A;  4IBD A;  3REL D;  3O3V A;  3DW0 A;  5FAT A;  2ZD8 A;  5GT0 D;  5GLC A;  2HDR A;  4IBX A;  2J9P A;  1YMS A;  4OJ5 A;  3ZG5 A;  5CEB A;  1GHP A;  5F83 A;  1CEG A;  3B6G A;  5AVB C;  1K6R A;  4KEN B;  4G92 C;  4Y0O A;  4BL3 A;  1P3I C;  3GSG A;  2JBF A;  3UNW A;  5L2F A;  3AFA A;  4P0M A;  3TU4 C;  2ZJ9 A;  5GXQ B;  5BNV A;  5AQB A;  2L5A A;  4E3N A;  3UT9 D;  4ZDX A;  3FDD A;  4E3J A;  3FKE A;  3AZM B;  4MEZ A;  4WNN A;  4OJO A;  4R1G A;  3WAA B;  4CPK A;  5B0Z A;  4XUJ C;  3REJ B;  1N9B A;  3VFF A;  5FQQ A;  3C4O A;  2X01 A;  2XK1 A;  3KS8 A;  1K54 A;  1WE4 A;  2Q9M A;  3MNN A;  3CG5 A;  2WKI A;  3AZE D;  1M1A B;  4Y0U A;  2ZY5 A;  4RA7 A;  3BEC A;  2BYK B;  1FR6 A;  1KX5 D;  1SDN A;  3PBQ A;  5B1L B;  2ARO A;  1BSG A;  4QLC A;  1P34 C;  3MGR B;  3C1C D;  1ES4 A;  5B31 B;  1YT4 A;  4BL2 A;  3WA9 D;  1NJ4 A;  1XXM A;  4YFM A;  5GT3 C;  3UO9 A;  3B6F A;  3AZE C;  3UTB D;  4J8U A;  3IXB A;  4R0Q A;  4KQO A;  1KX5 C;  1BTL A;  1M19 B;  3W98 A;  1ULY A;  1P3A B;  1HQ3 B;  4N9L A;  3X1U A;  4K0W A;  3KWQ D;  4H8R A;  3UTB C;  2YFW B;  2Y2M A;  3VMA A;  4KQQ A;  3MGP A;  1K57 A;  4UAA A;  3MZF A;  5CPI A;  5B40 D;  3AZJ C;  1MWR A;  4ZBJ C;  4J8W D;  4WZ4 A;  5M1A A;  2ZM2 A;  1KE3 A;  5F1F A;  1JTG A;  4X23 A;  3G32 A;  4R23 A;  3HON A;  4KG6 A;  5B31 G;  1TDL A;  1TDG A;  3NQJ B;  1KGG A;  2FJ7 C;  4OON A;  3OPL A;  4K91 A;  1R4V A;  4B88 A;  5E5A D;  5B1M D;  4JJN C;  3EPK A;  3VP3 A;  2HPB A;  3AZH B;  3AZG C;  3IHA A;  1AOI A;  2Y2H A;  3UDI A;  3AV1 B;  3OCL A;  2C6W B;  5AQ7 A;  4S2J A;  4CAY B;  2PYO B;  3KUY C;  5AV5 B;  2IWB A;  1FSW A;  1G6A A;  3AGD A;  1H5X A;  1P3B D;  5F99 D;  4WZ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...