2XD1A

Active site restructuring regulates ligand recognition in class a penicillin-binding proteins
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
489
structure length
469
Chain Sequence
SISEITYSDGTVIASIDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTNQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PENICILLIN-BINDING PROTEIN 1B
publication title Active Site Restructuring Regulates Ligand Recognition in Class a Penicillin-Binding Proteins.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
total genus 145
structure length 469
sequence length 489
chains with identical sequence B
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2xd1A01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2xd1A03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2xd1A02
1PI4A 2XK1A 3PBSA 2UWXA 3CG5A 5AQBA 1XPBA 3CMZA 5EVLA 5EVIA 5HAQA 3HVFA 1ES4A 3N8LA 3BLSA 5TGFA 4EV4A 5GLCA 4QB8A 5M1AA 4P0MA 1MWTA 4BL3A 2WUQA 4IVKA 1LL9A 3IT9A 4Y0TA 1S0WA 4JXGA 2Y2IA 2XDMA 3A3DA 3W4OA 5KZHA 4MBFA 4OOMA 4C3QA 3BFDA 5IHVA 4JXSA 4U0TA 5E2FA 2WK0A 5EVID 1L0EA 2Y2NA 1MXOA 3QHYA 1K57C 4H8RA 1SHVA 4OOYA 1K4EA 4GB7A 1KGEA 4BENA 5G18A 1LHYA 1OMEA 3MKEA 3GSGA 3N8RA 2EX9A 5FQMA 5JYPA 2X71A 3HUOA 3Q07A 4N1HA 5EVIB 3MBZA 3LCEA 1NRFA 2EFXA 3C4OA 3MZDA 2RCXA 4KZ7A 4PMAA 3IXDA 3BECA 1GHMA 5A90A 4FCFA 1Z6FA 4ID4A 4R0QA 1I2WA 1LI9A 2IWDA 3HBRA 3Q7ZA 4B4ZA 3NC8A 3TG9A 4WZ5C 4P85A 1EROA 2HPBA 5DTKA 5AQAA 1PWGA 3N8SA 1KDSA 2DNSA 3VSLA 3BFFA 4IEDA 4PM8A 3O87A 3EQUA 1YQSA 1ZKJA 3VFHA 3MXRA 2G2UA 3DTMA 2Y55A 4DE0A 3MKFA 4N9LA 1GCEA 3OPRA 3Q81A 5TFQA 1CK3A 3TSGA 4QY6A 4LENA 4OPQA 1IKIA 2WAFA 1L0FA 3VSKA 3IXGA 5AQ9A 3O86A 4PPRA 3P98A 5FI6A 3EQVA 1PWCA 4E3LA 1XGJA 4KZ5A 2H0TA 5CRFA 3M2JA 4OP8A 1E4DA 4U3TA 3QNBA 5GL9A 3MXSA 2HP6A 3UE1A 3W4QA 3ZVTA 1JTDA 4FH2A 4ZTKA 1W7FA 3IF5A 3OPLA 4QD4A 3C7VA 5DF9A 1NJ4A 2ZQ8A 5EOOA 4ZBEA 4P87A 5FAQA 1YLYA 3C4PA 4X53A 3ZHHA 4KG2A 4MBHA 3V39A 4OQGA 5A92A 4PM6A 3FKVA 4QU3A 3Q7VA 1KVMA 3S4XA 1MBLA 4N1XA 4UHUA 2JC7A 4WYYA 1MKIA 1KE0A 1O7EA 2H10A 5U47A 5CGXA 3S1YA 1WE4A 3DW0A 1ERQA 2Y2HA 3A3FA 3OC2A 3VMAA 3WWXA 2WADA 3ZG5A 3N4IA 2OLUA 2R9XA 4WBGA 3SS5A 4KZ3A 2ZC5B 1Y54A 1WYCA 4EQIA 5KSHA 1SCWA 3RXXA 3LY3A 3G31A 2WGWA 4WEJA 1PWDA 1G6AA 2VGJA 1BSGA 5HARA 1TEMA 4GD8A 1CEGA 4ZDXA 2WKIA 2ZM8A 3PBNA 3OPHA 1H5XA 5CTMA 1BZAA 1ALQA 3O88A 3MZFA 3Q7VB 4E3NA 5EUAA 3PBTA 1ES5A 2ZJ9A 5EPHA 2EXAA 3E2LA 4OPRA 2RL3A 1E25A 4NETA 5GLDA 4MNRA 1MPLA 2BG1A 4R4RA 3B3XA 1N4OA 3NCKA 1Q2PA 4S2LA 5F83A 4GOGA 1IKGA 1FR6A 3IXHA 4DDSA 5A93A 5F1GA 5F1FA 3G4PA 1XX2A 1DJBA 1KE3A 4KQQA 2DRWA 4OQHA 3PBRA 3HUNA 1YLZA 3ZGAB 4GDBA 4R4SA 2J9PA 2WGWB 2PU4A 1XXMA 5CEDA 4KQOA 4BD1A 1EI5A 1RP5A 1KVLA 1CEFA 3C7UA 4UAAA 4Y0OA 1NXYA 2V1ZA 2OLVA 1PZPA 2JCHA 3V50A 4GDNA 4KZBA 3VFFA 4P6BA 2J8YA 4MBKA 3NI9A 3LO7A 5EVIC 4KZ4A 3UE0A 3W8KA 4JKTA 4X55A 4CJNA 4S2PA 1XA1A 2ZM0A 2ZD8A 4R23A 3IQAA 1K25A 1TDLA 4FSFA 1G68A 1Q2QA 2Y2LA 3SS4A 2X02A 1K56A 4YFMA 1QMFA 1PW1A 4HEFA 3NY4A 4ZJ2A 5CEBA 1ESUA 4OP5A 4KZ8A 5TR7A 3G2ZA 2ZMAA 3W4PA 1NY0A 2QMIA 4KZ6A 4BD0A 3G2YA 4LCLA 2H0YA 1TVFA 3WS5A 3HLEA 3UE3A 1RGYA 3UDFA 2V2FF 5AQ7A 3A3EA 4OOLA 4WELA 4B88A 2XLNA 3UPPA 4PM9A 2WKEA 1XP4A 1S6RA 3NDEA 1K54A 1K56D 3IWQA 4JXWA 4JF5A 1KGGA 3GR2A 2Q9MA 2FFFB 4RX2A 1SKFA 1U60A 3HLGA 2ZQDA 4S2OA 2J7VA 1QMEA 4A5RA 2DCFA 1GA0A 3BFCA 1PZOA 4E6XA 3HLFA 1EWZA 3GQZA 3IHAA 2GDNA 5FQJA 5GLBA 3SH8A 5EECA 3NIAA 3PBOA 4E3IA 1TDGA 1K55A 2OSUA 1YLTA 4X56A 1FSWA 5I94A 3V5MA 3WS1A 1MWSA 5CTNA 5DF7A 3G30A 1MWRA 3ISGA 1JWZA 1GHIA 3OZHA 4WM9A 4S2IA 5FAOA 5E43A 4XUZA 2XR0A 3BRMA 3DWKA 4BL2A 2V20A 1C3BA 3A3IA 4EBNA 4M3KA 1XGIA 4OONA 3FYZA 3SS3A 4BQMA 1LI0A 3PTEA 3NDGA 5GLAA 4XXRA 2CC1A 3AGDA 4KZ9A 3WRZA 4C75A 1YMXA 3LY4A 3ZFZA 4CPKA 4UA7A 1ERMA 3FKWA 4WZ4A 5FQQA 2EX6A 2Y2PA 5J8XA 2ZQ7A 3AGEA 1FR1A 2WYXA 3IH9A 4DE1A 3PBQA 2XGNA 1VQQA 1JTGA 2G2WA 2ZC4B 5HW3A 1GHPA 3BEBA 4IBXA 1NYYA 1N9BA 2Y59A 3IXBA 4OKPA 1YMSA 4OQ0A 2ZQ9A 5E2EA 4E3MA 4PM7A 1IYSA 3G35A 2WGVA 3GMWA 1IEMA 2ZC7A 3VP3A 2XH9A 2P9VA 5FSRA 1JWVA 1YT4A 3VP4A 3VP2A 4MLLA 5JYOA 3RXWA 1KE4A 4OPYA 3ZVWA 4EWFA 4S2MA 1LL5A 1CI8A 3ZG7B 1L0GA 4DXCA 3UPOA 5FASA 4R1GA 4QJGA 2Y2MA 2Z2LB 3UN7A 5KSCA 1DJCA 4RYEA 3ZDJA 1YLPA 1BLCA 1E3UD 2XFSA 1ES2A 1PIOA 2A3UA 4D2OA 4E6WA 4R3JA 5CHMA 2EFUA 1I2SA 5FA7A 1O07A 5E2HA 4FH4A 3WS2A 4O7DA 3V3RA 1MWUA 2WKHA 3DWZA 2J9OA 3PAEA 3IF6A 3VP1A 2P9VB 3G32A 2IWBA 5F82A 5CERA 1DJAA 3HLWA 1LLBA 3IHBA 2XEPA 4S2NA 1IYOA 1K38A 3MZEA 1FCMA 3A3JA 1ONHA 4EBPA 1NZUA 5CGSA 4BJPA 5DVAA 2WZZA 4DXBA 2H5SA 3SOIA 1NZOA 3CJMA 1FSYA 1M40A 3Q82A 4ZJ1A 3M6HA 2WAEA 3RJUA 4GD6A 2HDRA 4C6YA 3SH9A 1BLPA 2HP5A 3IWOA 2Y91A 4Y7PA 1YLWA 3S22A 1I5QA 1ZC2A 4DKIA 4F94A 3WRTA 2Z2MB 4GNUA 4K0WA 5HX9A 3ZG9B 4OPZA 5A91A 4R3BA 5HAPA 1ZG6A 2ZQAA 2QZ6A 3G34A 1ONGA 1HVBA 2Y2QA 2HP9A 4JBFA 4OLGA 3IF6B 3BYDA 5CXWA 4EUZA 2ZM2A 5EE8A 3O3VA 1SDEA 4RX3A 3TOIA 3ITBA 4GN2A 4LV2A 1BLHA 5DF8A 5EOEA 4X68A 4QHCA 4KG5A 3ZCZA 3GVBA 2IWCA 2JBFA 4HBUA 4WMCA 5CGWA 5BOHA 3BFGA 3JYIA 3OCLA 4N9KA 1J9MA 1W5DA 3UDXA 4DE2A 3M2KA 4JXVA 4GKUA 3HREA 2Y2GA 3BFEA 4S2KA 1K57A 5FI7A 4OLDA 3FZCA 3FV7A 5FATA 1KDWA 4K0XA 2PBYA 4DDYA 3ZG0A 4HESA 2QPNA 3Q1FA 4YINA 5FQ9A 4E3KA 2XD1A 3WS4A 3UPNA 2Y2JA 3ZG8B 5GHYA 1FCOA 1YLJA 4WMCD 2BLSA 3ZNTA 1BUEA 1H8ZA 4X69A 3LEZA 4ZAMA 1K54C 1IYPA 1HD8A 4DRTA 3HUMA 2ZC3B 4XUXA 4LV3A 4E3OA 1XKZA 5CECA 3GTCA 1HZOA 3PAGA 4WZ5A 4N92A 3WS0A 3BLMA 1FCNA 2C5WB 4BLMA 2Y4AA 1K6RA 2EX2A 5KMWA 4GZBA 2I72A 5GHXA 1W8YA 1ES3A 4RVAA 1GA9A 1K55C 3GV9A 2WGIA 1VM1A 2ZQCA 4IVIA 5FAPA 2JE5A 2EXBA 1AXBA 4FD8A 5L2FA 2C6WB 4DF6A 4JLFA 1KGFA 1SDNA 4IBRA 2Y2OA 4L0LA 4OVDA 3UO9A 1PI5A 4U0XA 2HDUA 1IELA 2E8IA 3I7JA 3P09A 2EX8A 2X01A 2PU2A 3N6IA 3HLCA 3BM6A 3QNCA 5E2GA 4KZAA 5HFOA 4LV0A 4DE3A 3IH8A 5M18A 1E3UA 3CZDA 1ESIA 3OCNA 5DTTA 4EBLA 1XA7A 4KQRA 1PW8A 5FQKA 2FFYA 1K4FA 3ZNYA 4RA7A 1IYQA 5FDHA 4Z9QA 3MFDA 4KENB 4Y0UA 2VGKA 3ITAA 2P74A 3V3SA 1BLSA 4K91A 3UNWA 3IWIA 4OQIA 1K6SA 3AGFA 1FOFA 2XQZA 4WEKA 3SH7A 1RCJA 3UY6A 3GRJA 1YM1A 5FQIA 1PYYA 4LV1A 1BULA 4QY5A 1CI9A 3C5AA 4JPMA 1JWPA 2HDSA 1HTZA 3FWLA 2XD5A 2ZLYA 3VOZA 4OH0A 2XFTA 3OPPA 4ZJ3A 1BTLA 3VP0A 2WZXA 5HAIA 4UA6A 3N7WA 3D4FA 4Q8IA 2ZC6B 4HBTA 3M6BA 5GHZA 1M6KA 5M19A 3HL9A 1MY8A 3HLDA 1RGZA 3HLBA 1JVJA 3IF6C 4LCMA 4UA9A 4X6TA 5DTSA 4JF4A 3VOYA 4PM5A 5D3OA 5CHJA 2OV5A 4S2NC 5HL1A 2A49A 3E2KA 4NK3A 2XF3A 4JF6A 1FQGA 1NYMA 1WYBA 3NBLA 4E3JA 3UDIA 4MEZA 1W8QA 4B4XA 2R9WA 4KG6A 2B5RA 1L2SA 2Q9NA 5FI2A 4S2JA 1ZG4A 1DY6A 2HDQA 1L0DA 2Y2KA 1W79A 5CHUA 1H8YA 1BT5A
chains in the Genus database with same CATH superfamily
4E04A 2NQBA 3LJAB 2OAP1 4OJLA 5EVLA 1ES4A 4FUWA 5GT0D 3NULA 5F6AA 4BL3A 4Z5TB 5CP6A 3AZNC 2JKTI 4HNBA 2WUQA 3K3CA 3ZYTA 4IVKA 1LL9A 1S0WA 2NQBD 2OWJA 4Z2KA 1P34C 1KGEA 3CUEC 3GSGA 5CP6D 5FQMA 4N1HA 3AZNB 2DMWA 5EVIB 3LCEA 2EFXA 4PKYG 2D49A 2Z6DA 3CLOA 1NLYA 2W3EA 1XFNA 1LI9A 3HBRA 1DRMA 3Q7ZA 3NC8A 2G7UA 1EROA 5DTKA 5GT3C 1KDSA 3LR5A 1GPFA 1K0KA 4P6ZS 3MMHA 2JKRI 4ESPA 5BT1C 3EQUA 2V8CA 1WWIA 1OT6A 2VV6A 1VETA 2Y55A 2BTFP 1M1AB 1GCEA 5TFQA 3TSGA 2WAFA 3REKD 1W63M 5L09A 1T18A 2B18A 3AZIC 3P98A 5FI6A 1BH8B 2H0TA 3AV2A 3M2JA 4OP8A 1ID3A 4LD9B 1VEUA 3EOIA 4ZTKA 3MQLA 4JGRA 3C7VA 5DF9A 2ZQ8A 4H9NB 4P87A 4NG2A 2WKRA 1TAFB 5B1LB 4LRXC 5AV5C 4CQHA 3AV2D 1P3KB 4N1XA 4J8UA 2ZY2A 3EG5B 4WYYA 1KE0A 5CGXA 1XFQA 3OC2A 3A3FA 3ZG5A 1Y28A 3N4IA 3REHC 4JGPA 5B32G 1OTAA 3SS5A 1S32C 4PAUA 3KYEA 1Y54A 4EQIA 3RXXA 5C3IB 5AV5B 4J8UD 2VGJA 3R7WB 4YS3B 1TEMA 4ZDXA 1P3PA 2WKIA 3CWFA 3OPHA 3A1KA 1G5UA 5CTMA 3LI8A 3EPLA 5BS7C 1G28A 2G5HC 1P3FA 2ZOIA 3E2LA 3NOUC 1E6ZA 2BG1A 2DF4C 3NCKA 3KUYA 1IKGA 3IXHA 4KUDC 4DDSA 5F1FA 4ZUXC 1HQ3A 1P3PD 1DJBA 2DRWA 3S7NA 3HUNA 1E6NA 3ZGAB 2J3TD 4GDBA 4BBUA 2WGWB 1P3FD 2PU4A 3REID 3LR3A 4GLQA 4UAAA 3C1BA 2FJ7D 3KUYD 2OLVA 1PZPA 3W8KA 3B0BA 3LO7A 3UE0A 1EQZB 1HQ3D 4EU0A 2ZD8A 4WJ3C 2PYOC 5HZHA 3SS4A 1P3BA 3T1SA 1PW1A 1S4RA 4ZJ2A 3C1BD 4H9OB 1STZA 1XJ6A 2NUTC 1TVFA 3HLEA 4FOFA 3G6OA 2V2FF 4G3WA 4WELA 4B88A 2K31A 3UPPA 5CPKC 1P3BD 4JXWA 1KGGA 3W97B 2YFWA 2FFFB 4RX2A 2AROC 3HLGA 2ZQDA 4Y13A 3BFCA 1T3UA 1PZOA 3VOLA 3ICYA 2W1TB 4R8PC 1KX4B 3SW1A 3LZ0B 2W1RA 1FSWA 4G3KA 3V5MA 1MWSA 5CTNA 1GHIA 3CITA 4WM9A 5FAOA 3KSGA 3BRMA 3DWKA 3W99A 2XA7M 4OONA 4OJ5A 1LI0A 4XXRA 3IX4A 1YMXA 3ZFZA 3T4JA 5FQQA 5EM0A 2UV0E 5J8XA 3V9RA 1M19C 1JTGA 5BNXB 2O99A 3W99D 3BEBA 1NYYA 1N9BA 1YMSA 5F99B 3KYZA 4PM7A 3X1VC 2WGVA 2ZC7A 2XH9A 2P9VA 3IX8A 5FSRA 4DJ3A 1R4VA 2ZY3A 4S2MA 3W96B 3LELC 2O0YA 3MGRB 4QPRA 1L0GA 4DXCA 5FASA 1M19B 1IFQA 4R1GA 2Z2LB 4HMDA 4NFTA 1P3AA 3KXBC 4R3JA 3AZMA 5CHMA 2VGLS 4FH4A 3LELB 4IBDA 1MWUA 1V9YA 5FEFA 3G32A 5F82A 1DJAA 3AZGB 3IHBA 1P3AD 1K38A 1FCMA 3E4PA 5GSUB 3AZMD 5DVAA 3H82B 3SOIA 5B0ZB 2QWSA 3L7HA 5BO0A 4YM6A 1F66A 4OJOA 1M40A 4Z5TA 5FEGA 1P3IB 2INWA 1W1YA 2WAEA 3LJAD 2HDRA 4X23B 4C6YA 4EQ1A 3IWOA 3MSHA 4Y7PA 1YLWA 4DKIA 3KS8A 2Z2MB 4OPZA 5A91A 3AZKC 4JBFA 4YM6D 1F66D 1L6JA 4Z5TD 5AY8C 3AZNA 1N9LA 3CI6A 4RX3A 3ITBA 4GN2A 1BLHA 4CLCC 4X68A 3NOTC 3GVBA 4O01A 4GHAA 2JBFA 4HBUA 4WMCA 5CGWA 5BOHA 3LGOA 3HREA 3SZTA 2Y2GA 3RELC 4K0XA 2PBYA 1KU5A 1P34A 3CUEA 5E5AB 3AZND 1UR9A 4WLAA 3UPNA 3WA9B 4WMCD 2BLSA 1BUEA 4X69A 2JN7A 3U4LP 4DRTA 3HUMA 3LEQA 4J8WC 1VHMA 2ZC3B 3REKC 1P34D 1ZLAB 4LV3A 3RELB 4MN6A 2Y4AA 5GT3A 5GHXA 1W8YA 3T4SA 4HP9A 3AFAB 1OTEA 3M7PA 3AZFB 1VM1A 2ZQCA 1CQAA 5CPIC 5L2FA 4J8WB 3F1PA 5DFXA 4NE5A 3WKJC 5GT3D 4L0LA 4OVDA 5DJTA 3AZIA 4Y2FA 4EEUA 2QJ7A 1PI5A 4U0XA 5KDMA 5BT1D 5JRGB 3T1XA 4KUOA 2L1MA 2ZM5A 1CXWA 2EX8A 1D7EA 4J8XB 2X01A 3HLCA 4UQIS 4XT2A 4MB5A 3LICA 1LSVA 4KZAA 5CPIB 4LV0A 4DE3A 1E3UA 3CZDA 3AZJB 1E8BA 4K08A 4KQRA 2Q0OA 2FFYA 3QP4A 4CSRB 1K4FA 2A24B 5AV5A 3ZNYA 1P3KD 3E4QA 3ULFA 3MQOA 1IYQA 2M7VA 3D72A 4GS9A 4KENB 5TJJA 2VGKA 3ITAA 2P74A 3UNWA 1TS7A 3SH7A 2PYRA 2AVXA 3REHA 1NRJA 1YM1A 2H28A 4P6ZM 2YKFA 4LV1A 1BULA 1S32A 1CI9A 4JPMA 5AV5D 1S1ZA 3LR4A 1DP9A 2ZLYA 4E44A 4NZ3A 3AN2C 4BWIA 2ZOHA 5B31C 3D4FA 2ZC6B 3REHD 1M6KA 3REIC 2JHEA 5BS7A 3HLDA 1S32D 5L07A 3AZLB 3VOYA 4JF4A 4XZQB 2FJ7C 5CHJA 4S2NC 2O9CA 3NBLA 4KUDA 3AN2B 4Q0HA 1W8QA 4ZUXA 4B4XA 2P04A 2R9WA 4KG6A 1L2SA 3L28A 4S2JA 3NQJB 2HDQA 2Y2KA 4G92C 2O9BA 3LUQA 3GECA 5CHUA 3S7QA 5DNMB 2XK1A 3C38A 4HQAA 2UWXA 3AL0C 2VX8A 3KS4A 4LPZA 3D9YA 4KUDD 3HVFA 5GXQC 5TGFA 4H9RB 4QB8A 3EGDC 2PYOA 4DJ2A 3VH5A 4MB3A 3HONA 3WTPB 1EW0A 3F1OB 2Y2IA 2OAQ1 2XDMA 2CV5C 3KFUG 5AV9C 1HLUP 4WU8C 3CPTB 4JGOA 4U0TA 5E2FA 1L0EA 3OOVA 3QHYA 1K57C 1SHVA 2W1TA 3C8CA 4OOYA 4X1MA 1OGBA 2J80A 2PYOD 2EX9A 1B6WA 3VH6A 5CPKA 1LSXA 4EW7A 3KWQB 2AROA 3C4OA 4IHQA 5AV9B 3IXDA 1GHMA 4I38A 1PZRA 2EWVA 1H3OA 3B6FC 1Z6FA 4NXEA 4ID4A 3WAAC 4R0QA 2IWDA 4B4ZA 4R8PA 1TZYB 3TG9A 4P85A 5B33B 5CPKD 4EXOA 3VSLA 3BFFA 4IEDA 3LFVA 5G4ZA 2AROD 4MMNA 1YQSA 4OJPA 3MXRA 4QLCB 4IBFA 4QY6A 4LENA 4OPQA 3CAXA 3WAAB 4R8PD 3VSKA 1ZTUA 3IXGA 5B2IC 4PPRA 1MKMA 3AV1C 1PWCA 1XGJA 4KZ5A 4J8VC 4DMZA 5AVBC 3LIEA 4Z66C 1M19A 4AFIA 1UGUA 1W7FA 3IF5A 3MVDC 1T1CA 3HSHA 3FPVA 5A8BA 3X1VA 1X0OA 3C4PA 4X53A 3V39A 1KX5C 5A92A 4PM6A 3FKVA 4QU3A 4ARZA 3S4XA 3AV1B 1MBLA 4UHUA 3LELA 3C1CC 1M19D 2H10A 5AVBB 4KGCC 4WUJA 3S1YA 3WWXA 2Y2HA 4Z2HA 3L29A 4LRZE 5HL6A 3MVDB 4WF0A 2OLUA 2VJWA 5B2JC 4I3AA 3X1VD 3L27A 4KZ3A 3KXBA 1KX5B 3LELD 1G6AA 3C1CB 3W98B 4GD8A 4KGCB 3LJAC 2ZM8A 3MGQB 3PBNA 3TU4B 1H5XA 2G5IC 1BZAA 1Q9CA 1ALQA 3O88A 3MZFA 2K7SA 3Q7VB 5EUAA 3PBTA 1CF0A 3F1NA 2EXAA 3KXBD 3MGPB 4MNRA 4R4RA 3B3XA 1KX3C 3MS6A 3A0VA 1FR6A 2NZDB 2P08A 1KE3A 3PHYA 1YLZA 4R4SA 2J9PA 5EFWA 4CLCE 1OTBA 3AZKA 1KX3B 1NXYA 2V1ZA 2JCHA 5B24B 5AY8A 5EVIC 4GW9A 4X55A 4S2PA 4NXBA 1XA1A 4CLCA 3IQAA 1G68A 2VGLM 4JJNC 1K56A 1QMFA 3UMDA 3CHWP 3AZKD 4HEFA 2ZY4A 1ESUA 1P9WA 4KZ8A 5TR7A 3RELA 3W4PA 5AVCB 4KZ6A 4LCLA 5E5AD 2H0YA 5AY8D 2VKSA 3PR6A 3WA9D 3UE3A 4EO5C 4CLCD 4OOLA 2F8NG 1H0IA 2WKEA 3X1TB 1M1AC 1S6RA 3A0SA 3NDEA 1K56D 1KOUA 1P3GC 2F2AC 4JJNB 1P3OB 4RQ9A 4MDZA 4J8WA 3RELD 4HP4A 3REKA 4S2OA 2J7VA 4EESA 2LY8A 2YFVB 4E6XA 3S7OA 2GDNA 1SKOA 5GLBA 4EO5B 1M18B 4LD9C 3AFAD 1E6PA 5EECA 3NIAA 3PBOA 4H9PB 4IBGA 4E3IA 1O6IA 2EWWA 3G30A 1P3GB 3B33A 4J8WD 3ISGA 5CPIA 5HSQA 3UB8A 3H0MC 4Y3IA 3OZHA 3AYWB 4NXFA 5E43A 5B1LC 3WKJA 2V20A 1C3BA 4EBNA 4M3KA 1P3KC 3FYZA 4BQMA 3AZHB 4DRAA 3AGDA 5BNVB 3LY4A 3L26A 2L4RA 5DKKA 3H7WB 1TS6A 1P97A 2ZQ7A 5CPID 3AGEA 1FR1A 3D3OA 1VQQA 3WKJD 2G2WA 5C3IC 4IBXA 4OKPA 4WU9B 2ZQ9A 3KYQA 2B95A 3G35A 4YS3C 3GMWA 1YT4A 3VP2A 1KE4A 2RIQA 3TRCA 1LL5A 1CI8A 3ZG7B 3UN7A 5EM1A 4IJEA 3ZDJA 3AN2A 2XFSA 2HIOC 5B31A 5E2HA 2V1BA 3WS2A 1G6OA 3REIA 4L9GA 4O7DA 1CK7A 1F1EA 3V3RA 5G49A 4IBIA 2FJ7A 1YAXA 3BY9A 4HH3A 3HLWA 4UQIM 5HPIA 1EQZC 2XEPA 4S2NA 3A3JA 3AN2D 1MC0A 4BJPA 2HIOB 2H5SA 5B31D 3CJMA 2BYKA 3T4OA 1XJ2A 1AOIC 5AV6C 2O9AA 1BLPA 2HP5A 4ZRRA 3JPUA 1I5QA 5J3WA 2W3HA 4Z2MG 4K0WA 5HX9A 5HAPA 1ZG6A 1DP6A 2ZQAA 5CPJB 1ONGA 1HVBA 2Y2QA 5GXQA 4F3LA 3IF6B 3BYDA 1UWNX 2ZM2A 3UTBB 5EE8A 3W97C 3MXQA 2ZL1A 4LV2A 5DF8A 3ZCZA 1AOIB 4KG5A 5AV6B 2BYMA 2CV5A 5AV9A 2K2NA 4WU8A 4N9KA 1J9MA 1W5DA 3BWLA 4JXVA 4GKUA 4S2KA 1KX4C 1K57A 5GXQD 3LZ0C 5FATA 1TS8A 3ZG0A 4HESA 3OBFA 2VLGA 4GHIA 3VE4A 2FH5A 4YINA 4KHAB 3VV4A 4E3KA 3WS4A 3B6GB 3ZG8B 2CV5D 1YLJA 5AV9D 4WU8D 2ZY5A 3DBAA 1N1JB 2M1CA 3EGXC 1KS0A 3B6FA 4IBEA 3LYXA 4UPKA 5B33D 2BASA 4EUVA 5CECA 3GTCA 2YKHA 4N92A 3BLMA 2C5WB 1LT0A 1K6RA 5KMWA 4GZBA 1PFLA 1GA9A 5F99C 2WGIA 3B6FD 2JE5A 3WAAD 2EXBA 4WNNB 1AXBA 5I5LA 2C6WB 4DF6A 4JLFA 2JKFA 5B2IA 5AV8B 3W96C 3AV1A 3MGRC 4R70A 4J8VA 3P09A 2F8NB 5AVBA 4Z66A 3MVDA 5E2GA 2E8JA 5HFOA 4LG2A 3IH8A 2VQRA 3OCNA 4BMWA 5B2ID 1XA7A 5B1MB 2OOLA 3B0DB 3AV1D 1KX5A 1GOIA 1YKDA 3DTEA 4J8VD 5FDHA 3R45A 5AVBD 1H8MA 3C1CA 4Z66D 1BH9B 3V3SA 1BLSA 1U35B 4KGCA 4K91A 4UUZA 3AZGC 3MVDD 2XQZA 4CAYA 5K5BA 4WEKA 2CMNA 1RCJA 5B2JA 5GSUC 5B0YB 5B0ZC 4QY5A 2HUEB 2W3GA 1KX5D 3FWLA 2XD5A 4XUJB 1P3IC 3MGSB 4HOIA 4OH0A 3C1CD 4GCZA 4KGCD 4ZJ3A 4X23C 1BTLA 3VP0A 3O62B 2WZXA 3EPJA 3LJAA 4IJGA 4YOFA 4NXGA 4UA6A 5HDSA 4Q8IA 3M6BA 5B2JD 3PXPA 3HL9A 3MGPD 1RGZA 3KSHA 1FILA 4LCMA 2P7JA 4PM5A 1JFIB 1YU2A 3TW8A 3X1UC 1P3LB 5D3OA 4LGWA 1KX3A 1Z2CB 2A49A 2XF3A 2JKGA 1FQGA 3UTAB 3UDIA 4MEZA 1S66L 2Q9NA 1T19A 1ZG4A 5B32B 2XSSA 1W79A 3DAVA 1H8YA 1PI4A 3RFBA 1KX3D 3NQUB 5E5AC 5IT5A 5B24D 3CG5A 3X1UB 3WA9C 3CMZA 5EVIA 4TX8A 3N8LA 3KSYA 4H9QB 5GLCA 5M1AA 1ULYA 4P0MA 1MWTA 5F69A 3MF0A 1ZLAC 3A0RA 4Y0TA 4JXGA 4G3VA 3W4OA 3A3DA 5KZHA 2Y8HA 4Y15A 2YFVA 5AVFA 4UEYA 4O0PA 5EVID 2WK0A 1MXOA 3AFAC 2NUPC 1K4EA 4BENA 5G18A 3AZFC 3N8RA 4NKPA 1M1AA 5HWVA 2NQBB 4JJND 1YU3A 3Q07A 1P3GA 4Z2LA 3MBZA 1NRFA 1YU0A 2RCXA 4PMAA 2V5OA 1YUEA 5A90A 3FC7A 1BH8A 5CP6B 4FCFA 5HDCA 5JRGC 1I2WA 1J7MA 4LD9A 2Z6CA 4J8XC 1M1AD 1LSWA 5AQAA 1PWGA 2F8NH 1P3GD 4H9NA 3HCYA 3O87A 3AYWD 3AZJC 4Z2GA 1TAFA 3C30A 2G2UA 5B1LA 4DE0A 2ZMFA 3MKFA 3OPRA 1P3KA 1CK3A 4Y5FA 4LD9D 3IBJA 1IKIA 5AQ9A 1A7WA 2JKRM 5CRFA 5GL9A 3MXSA 5B1LD 2HP6A 3UE1A 3ZVTA 1JTDA 2HJEA 4FH2A 4HJ4A 3OPLA 3H0LC 5EOOA 4ZBEA 3R7WA 4GH9A 4YS3A 1ID3C 3P7NA 4DRBA 1YLYA 3ZHHA 4KG2A 4MBHA 1VETB 1MZUA 1KVMA 3B47A 3AZLC 4XZQC 2HGVA 1MKIA 1O7EA 5U47A 1WE4A 3VMAA 2WADA 3B0CW 2L0WA 4YS3D 2R9XA 3LZ1C 1CJFA 3AV2B 1ID3B 1VEUB 2HIOA 1D1JA 5KSHA 3G31A 2WGWA 4WEJA 3X1SC 4MN5A 3PYPA 5B40C 1PWDA 4B93A 5DNMC 3WD3A 1BSGA 5HARA 1CEGA 2VV7A 1N9OA 3T50A 4HY8A 2QKPA 1EQZA 3B0CT 1ES5A 4J8UB 3LZ1B 2RL3A 2HIOD 4Z2IA 2W0NA 3NJAA 3DTIA 5DFYA 1N4OA 4S2LA 4I3IA 4O8GA 4GOGA 4NZ1A 3WTPC 4GHLA 3X1SB 5B40B 5A93A 3EPKA 3G4PA 4H9OA 5AV6A 1OT9A 5MC7A 3UB9A 4OQHA 3PBRA 1EQZD 1XXMA 4KQOA 4HHDA 1Y4OA 5HDDA 1CEFA 3B42A 1P3PB 3VFFA 3V50A 3KWQC 3W97A 3NI9A 1AOID 2W3FA 5AV6D 1P3FB 3IP4C 4R23A 2W8SA 2X02A 3KUYB 3WD4A 1KX4A 1TZYC 3NY4A 3LZ0A 5CEBA 4LLOB 4Z2MH 4Q0JA 2ZMAA 5B33C 3UT9C 2RTSA 1NY0A 2QMIA 3G2YA 3W97D 2FN2A 3UDFA 2PT7A 3A3EA 1ACFA 4QLCC 2XLNA 5J7EA 4PM9A 3C1BB 2PR5A 1YU4A 3LIAA 4I39A 3E0YA 4JF5A 3GR2A 2Q9MA 1KX4D 3LZ0D 1SKFA 1U60A 3S7PA 3UT9B 4A5RA 2DCFA 1JNUA 1GA0A 1PRQA 3GQZA 3IHAA 1P3BB 5FQJA 3SH8A 4HJ6A 4PKYA 3BQ8A 3MFXA 4H6JB 1TDGA 2OSUA 2KLIA 5BNXA 3WD2A 2HV1A 4X56A 4B9OA 5F99A 2WKPA 3WS1A 5DF7A 1MWRA 1JWZA 4S2IA 4X1LA 4XUZA 3T4KA 3A3IA 1D06A 1XGIA 3SS3A 3W96A 4II7A 5C5KA 2YFWB 2PR6A 3MGRA 3NDGA 5GLAA 2CC1A 1EAKA 3WRZA 5F99D 1ERMA 4WN5A 5HD3A 2WYXA 1N9NA 4DE1A 2XGNA 1BYWA 5HW3A 2Y59A 3IXBA 3W96D 1OPXA 4MB4A 3MGRD 1F98A 1GXDA 3W98C 1IYSA 3UB6A 1IEMA 3MGQC 3TU4C 5JYOA 3AZGA 4EWFA 3MGPC 1H8PA 5GSUA 4ETXA 2V0WA 1JFIA 3UPOA 3H82A 5B0ZA 3MGSD 5KSCA 1P3IA 1YLPA 1UR8A 2NZDC 2FZ0A 2CWEA 2A3UA 3AZGD 4X23A 3V9RB 2EFUA 1I2SA 3MNNC 5GSUD 3FG8A 3ZQ5A 2DQNC 5B0ZD 2J9OA 3PAEA 4DQYB 1YPRA 2P9VB 2IWBA 5B24C 3X1UA 1P3ID 1LLBA 4HMCA 2W27A 3MZEA 4EBPA 2IA2A 4H9QA 4X23D 2OWHA 5BPVA 4M4XA 3AZEC 4DXBA 1NZOA 3UB5P 1FSYA 3Q82A 4Y17A 4G91C 3MNNB 3M6HA 3RJUA 5AVCC 3REJC 2L5AA 3X1UD 4GD6A 5HD5A 3SH9A 3AZMB 5E5AA 3S22A 3IX3A 1XJ4A 3WA9A 3WRTA 4GNUA 4IBCA 4R3BA 2QZ6A 4FTXA 4HIAA 3X1TC 2HP9A 5CXWA 4EUZA 1A0KA 3AZEB 1WWSA 5DNNC 5FL3A 3T12B 1P3OC 3MJQA 4G91B 1ZLAA 4NE3A 5EOEA 2JSSA 3REJB 2IWCA 2RVQC 3BFGA 3JYIA 3OCLA 3UDXA 5BO0B 4YM6B 1F66B 3M2KA 1M18C 5FUGB 2PDRA 3AFAA 3A6NC 1KDWA 4DDYA 2B02A 3Q1FA 3AZFA 5DNNB 3RH8B 1W63Q 3EPHA 5FQ9A 3U2AA 1ZLAD 2HF6A 1S1YA 3AYWC 3ZNTA 1H8ZA 4ZAMA 1K54C 3WX7A 3AZHC 1GSWA 5JRGA 4XUXA 4E3OA 3A6NB 4J8XA 1XKZA 3AZFD 1HZOA 1J3WA 1FCNA 3W2ZA 2I72A 3A1IA 1ES3A 1K55C 3AZJA 4HI4A 3GV9A 1P34B 4WU9C 4CSRA 2A24A 4KQDA 4IVIA 5JRGD 5FAPA 4FD8A 4J8XD 3V67A 2V9AA 1SDNA 3UO9A 1TS0A 4E45A 3AZJD 1IELA 3N6IA 5GT3B 3K2NA 5M18A 4EBLA 1PW8A 5FQKA 4RA7A 5EV0A 3NHQA 2D01A 1P0ZA 4Z9QA 2EA9A 4I5SA 3AZLA 3MFDA 3KO6A 4Y0UA 4XZQA 3F1PB 4OQIA 1K6SA 3AGFA 1FOFA 2PBDP 3AZIB 3UY6A 3GRJA 5KDMB 1PYYA 1ID3D 3H9WA 3LZ1A 1P3MC 1S4SA 4XT2B 1HTZA 3NQJA 1W1VA 5CX7A 3VOZA 4L9EA 3X1SA 3AZLD 5B40A 4XZQD 1DP8A 5DNMA 5HAIA 3N7WA 1WA9A 4HBTA 5GHZA 3WTPE 4HJ3A 3LZ1D 5CPJC 3UB7A 4H9RA 4GS9B 1JVJA 3IF6C 4UA9A 1H3QA 4X6TA 5DTSA 1P3MB 3UTBC 3P01A 2OV5A 2GNXA 1B67A 3X1SD 5HL1A 5B40D 4NK3A 3WTPA 3F1OA 5DNMD 3REHB 1E88A 1W2EA 3CPTA 5JA4B 1S32B 2B5RA 5FI2A 1AWIA 1DY6A 1L0DA 5G4YA 1H0GA 1BT5A 3PBSA 5AQBA 3B6GC 3WTPD 3KWQA 1XPBA 3GDIA 5HAQA 3R4KA 4EV4A 3BLSA 1SZVA 2PYPA 3IT9A 2GX5A 4D60A 3UE6A 1TZYA 4KUDB 4MBFA 4OOMA 4NY2A 5B33A 4ZUXB 3UT9A 1OGGA 1F2KA 4C3QA 3KWQD 3BFDA 5IHVA 4JXSA 2Y2NA 4H8RA 3FPWA 2PD7A 4L9FA 4GB7A 4H6JA 4DN0A 4QLCA 1LHYA 1OMEA 3MKEA 5IS1A 5TBMB 5JYPA 2X71A 3HUOA 3WAAA 1TZYD 2PAVP 4NYUA 2J3WA 3UT9D 3MZDA 4KZ7A 2IOUA 5AV8C 1T1BA 3BECA 2PYOB 4QLCD 4WZ5C 2HPBA 2MJ6A 3N8SA 2DNSA 1HTAA 4PM8A 3WD1A 1ZKJA 5L8MA 5B1MC 3VFHA 3B0DC 1GSVA 3DTMA 4N9LA 5EVEA 5CPKB 3Q81A 3QP5A 4HGAC 1L0FA 1U35C 3BY8A 2AROB 2A2LA 3O86A 1OJGA 4X25A 3MR0A 3EQVA 5HPFA 1H3OB 4E3LA 1P9RA 5B0YC 4H9SC 4U3TA 1E4DA 2HUEC 3QNBA 3VE3A 4R8PB 3W4QA 3NECA 4XUJC 3MGSC 4QD4A 1NJ4A 2KOIA 4KUKA 4HGAB 5FAQA 3W98A 3O62C 2XRNA 3MGQA 3TU4A 1YSPA 4OQGA 3Q7VA 2JC7A 3NOPC 3MGPA 1P3LC 4IBBA 3DW0A 1ERQA 1W1PA 1AIWA 3UTAC 5B31G 3MQQA 3W98D 3IS2B 3QP1A 2NZDA 4WBGA 3MGQD 2ZC5B 3TU4D 1WYCA 1QO6A 5B32C 1SCWA 3LY3A 3MNNA 3TE8A 2Y79A 1VB6A 3X1VB 5B24A 2GJ3A 4E3NA 4ARZB 5KIZA 2NZDD 2ZJ9A 3C2WA 5EPHA 5AVEA 4OPRA 1E25A 4NETA 4QWOA 5GLDA 1MPLA 3AZEA 4NEED 1Q2PA 5F83A 2XROA 3N3FA 3MNND 2PRFA 2I9VA 5F1GA 2D02A 1ODVA 1XX2A 1BFMA 3T1QB 5AVCA 3REJA 5GT0C 4KQQA 3KXBB 2J8PA 1V9ZA 1YU1A 5CEDA 5FUGA 4BD1A 1EI5A 3AZED 3LIFA 5CHLB 3X1TA 1RP5A 1KVLA 3C7UA 3QP2A 4Y0OA 2NQBC 5DNNA 1OJ5A 4GDNA 4KZBA 4JJNA 1P3OA 4P6BA 4Q0IA 5HWTA 2J8YA 4MBKA 3WD0A 4KZ4A 3F1NB 4JKTA 5AVCD 3REJD 2QYBA 4MCWA 4CJNA 3UMEA 2ZM0A 4JGQA 5GT0B 1K25A 3FDDA 1TDLA 4FSFA 1Q2QA 5CP6C 2Y2LA 4YFMA 5F68A 1M18A 4H9PA 3X1TD 2R78A 4OP5A 3G2ZA 3A6NA 2V8FA 2JKTM 4BD0A 4ETZA 4ZBJC 5DNND 2V1AA 1P3OD 3T1RA 3WS5A 4BBVA 1RGYA 1OTIA 5AQ7A 3L2AA 3AYWA 3AZKB 2RVQD 1XP4A 1K54A 3IWQA 1M18D 5AY8B 3AZHA 3A6ND 5BNVA 4CLCB 1TD5A 1QMEA 3T4QA 4ZBJB 3BJNA 3H7WA 5DJUA 1FIKA 3KX0X 3HLFA 4IUKA 1EWZA 1XJ3A 2F8NK 3BW6A 1K55A 4AWLC 1YLTA 4IUHA 4WU9A 4Z1WA 5I94A 3O5YA 3AZHD 2KDKA 2VV8A 2XR0A 4BL2A 4BBTA 3PTEA 3E98A 4KZ9A 4C75A 3REKB 3EWKA 4CPKA 4WU9D 1NWZA 4UA7A 4LFUA 4AWLB 3FKWA 4WZ4A 2EX6A 2Y2PA 3QP8A 2KX6A 3AV2C 1SKOB 4WV4B 3IH9A 3PBQA 5FDSA 5J4EA 4ME4A 2ZC4B 1GHPA 3LIBA 4YNRA 4OQ0A 2PD8A 5E2EA 3T4LA 4E3MA 3VP3A 1TF1A 1JWVA 3VP4A 3LR0A 4MLLA 3WKJB 3AZID 3RXWA 4OPYA 3K3DA 3ZVWA 3MQ0A 4J8UC 3FKEA 1OTDA 3P5JB 4WL9A 3OLOA 1P3MA 4QJGA 2Y2MA 1DJCA 4Z2JA 4RYEA 1BLCA 1E3UD 2PHYA 1ES2A 1PIOA 1PDCA 4D2OA 5JA4A 4E6WA 5FA7A 1O07A 3KSIA 5CPJA 2WKHA 3DWZA 1P3MD 3VP1A 3IF6A 1P3PC 5L10A 3UTBA 5CERA 4NYYA 1GSXA 3KSFA 2J3TC 1IYOA 1P3FC 1AOIA 1ONHA 4OUIA 1NZUA 5CGSA 2WZZA 4OJ6A 4IJFA 3KUYC 1LL8A 4ZJ1A 2ZMVA 5CPJD 1E15A 3BQAA 1HQ3C 2ACGA 3UTBD 2HZ5A 4KHAA 3VH5W 2Y91A 4NZ5A 3DTKA 3B6GA 5B31B 1ZC2A 4F94A 2GZAA 3ZG9B 3REIB 2VZWA 2V0UA 3G34A 5G49B 4OLGA 3C1BC 2QJ5A 1N1JA 3O3VA 5TBMA 2FJ7B 1Z09A 2LB5A 3E4OA 4EERA 1SDEA 1W1TA 3TOIA 4QHCA 1HQ3B 4ZUXD 1S67L 1L3LA 2HJ9C 2XA7S 3H0RC 3B6GD 3LIDA 3VH6W 3HJIA 3TJZC 1P3BC 4DE2A 3VH5T 2BYKB 3BFEA 5FI7A 4OLDA 4G92B 3FV7A 3FZCA 3HJKA 2QPNA 2XD1A 2VA0A 4WNNA 2Y2JA 3IBRA 5GHYA 1FCOA 4F3LB 5GXQB 5AV8A 3LEZA 1F5MA 1IYPA 1HD8A 3VH6T 4R38A 4MN7A 2ZL1B 3QP6A 2F8NA 1ED7A 2BYMB 3PAGA 2CV5B 4WZ5A 4WU8B 1NLZA 3WS0A 4BLMA 2EX2A 5IU1A 2VEAA 1E6RA 2WKQA 4RVAA 5AV8D 5AJGA 2LB9A 4HMEA 5B1MA 4GHIB 3RTYA 2F8ND 2W3DA 4IBJA 3EEAA 3L9KA 1BH9A 5F5YA 1U35A 1IOUA 1KGFA 3W99C 4IBRA 2Y2OA 2HDUA 3B6FB 3I7JA 2E8IA 5B0YA 4H9SA 2M7UA 2QHKA 5B1MD 2PU2A 4NZ4A 4XUJA 3MGSA 4QNLA 3BM6A 3JVVA 3QNCA 3IS2A 1H0MA 1U35D 4NE6A 1ESIA 3O62A 5DTTA 4R3AA 3W99B 4YWZA 5B0YD 3L25A 5DKLA 4XUJD 1P3LA 3IWIA 5B2IB 4I3JA 4EETB 3UTAA 5FQIA 5LBRA 3O62D 1PNEA 4J8VB 1ZHHB 4R6LA 3C5AA 1JWPA 4Z66B 2HDSA 3LI9A 4M6BA 2ZBBA 5B32A 2IO5C 3F6TA 3T4TA 4HH2A 1P3AC 2XFTA 1P3LD 3OPPA 3NQUA 3AZMC 4PHTA 3UTAD 5M19A 1MY8A 3HLBA 3R45B 5HWWA 1YSQA 5B32D 4UUZB 4WZSB 1F9IA 4CAYB 2IO5B 3E2KA 3EEHA 4JF6A 4LRYC 1P3AB 1NYMA 2VK3A 1WYBA 5B2JB 4E3JA 4EEPA 5GT0A 4GJ4A 4YM6C 1F66C 4IBKA 1UWPX 4Z5TC 1T1AA 3JVUA
chains in the Genus database with same CATH topology
2NQBA 3LJAB 4OJLA 5EVLA 1ES4A 5GT0D 4BL3A 4Z5TB 5CP6A 3AZNC 2WUQA 4IVKA 1LL9A 1S0WA 2NQBD 1P34C 1KGEA 3GSGA 5CP6D 5FQMA 4N1HA 3AZNB 5EVIB 3LCEA 2EFXA 1LI9A 3HBRA 3Q7ZA 3NC8A 1EROA 5DTKA 5GT3C 1KDSA 5BT1C 3EQUA 1WWIA 2Y55A 1M1AB 1GCEA 5TFQA 3TSGA 2WAFA 3REKD 3AZIC 3P98A 5FI6A 1BH8B 2H0TA 3AV2A 3M2JA 4OP8A 1ID3A 4LD9B 4ZTKA 3C7VA 5DF9A 2ZQ8A 4H9NB 4P87A 1TAFB 5B1LB 5AV5C 3AV2D 1P3KB 4N1XA 4J8UA 2ZY2A 3EG5B 4WYYA 1KE0A 5CGXA 3OC2A 3A3FA 3ZG5A 3N4IA 3REHC 5B32G 3SS5A 1S32C 1Y54A 4EQIA 3RXXA 5C3IB 5AV5B 4J8UD 2VGJA 4YS3B 1TEMA 4ZDXA 1P3PA 2WKIA 3OPHA 3A1KA 5CTMA 3EPLA 5BS7C 2G5HC 1P3FA 3E2LA 2BG1A 2DF4C 3NCKA 3KUYA 1IKGA 3IXHA 4KUDC 4DDSA 5F1FA 4ZUXC 1HQ3A 1P3PD 1DJBA 2DRWA 3HUNA 3ZGAB 4GDBA 2WGWB 1P3FD 2PU4A 3REID 4UAAA 3C1BA 2FJ7D 3KUYD 2OLVA 1PZPA 3W8KA 3B0BA 3LO7A 3UE0A 1EQZB 1HQ3D 2ZD8A 4WJ3C 2PYOC 3SS4A 1P3BA 1PW1A 4ZJ2A 3C1BD 4H9OB 1TVFA 3HLEA 2V2FF 4WELA 4B88A 3UPPA 5CPKC 1P3BD 4JXWA 1KGGA 3W97B 2YFWA 2FFFB 4RX2A 2AROC 3HLGA 2ZQDA 3BFCA 1T3UA 1PZOA 4R8PC 1KX4B 3LZ0B 1FSWA 3V5MA 1MWSA 5CTNA 1GHIA 4WM9A 5FAOA 3BRMA 3DWKA 3W99A 4OONA 4OJ5A 1LI0A 4XXRA 1YMXA 3ZFZA 5FQQA 5J8XA 3V9RA 1M19C 1JTGA 5BNXB 3BEBA 3W99D 1NYYA 1N9BA 1YMSA 5F99B 4PM7A 3X1VC 2WGVA 2ZC7A 2XH9A 2P9VA 5FSRA 1R4VA 2ZY3A 4S2MA 3W96B 3LELC 3MGRB 1L0GA 4DXCA 5FASA 1M19B 4R1GA 2Z2LB 4NFTA 1P3AA 3KXBC 4R3JA 3AZMA 5CHMA 4FH4A 3LELB 4IBDA 1MWUA 3G32A 5F82A 1DJAA 3AZGB 3IHBA 1P3AD 1K38A 1FCMA 5GSUB 3AZMD 5DVAA 3SOIA 5B0ZB 5BO0A 4YM6A 1F66A 4OJOA 1M40A 4Z5TA 1P3IB 2WAEA 3LJAD 2HDRA 4X23B 4C6YA 3IWOA 4Y7PA 1YLWA 4DKIA 3KS8A 2Z2MB 4OPZA 5A91A 3AZKC 4JBFA 4YM6D 1F66D 4Z5TD 5AY8C 3AZNA 4RX3A 3ITBA 4GN2A 1BLHA 4X68A 3GVBA 4GHAA 2JBFA 4HBUA 4WMCA 5CGWA 5BOHA 3HREA 2Y2GA 3RELC 4K0XA 2PBYA 1KU5A 1P34A 5E5AB 3AZND 3UPNA 3WA9B 4WMCD 2BLSA 1BUEA 4X69A 4DRTA 3HUMA 4J8WC 2ZC3B 3REKC 1P34D 1ZLAB 4LV3A 3RELB 2Y4AA 5GT3A 5GHXA 1W8YA 3AFAB 3AZFB 1VM1A 2ZQCA 5CPIC 5L2FA 4J8WB 4NE5A 3WKJC 5GT3D 4L0LA 4OVDA 3AZIA 1PI5A 4U0XA 5KDMA 5BT1D 5JRGB 2ZM5A 2EX8A 2X01A 4J8XB 3HLCA 4KZAA 5CPIB 4LV0A 4DE3A 1E3UA 3CZDA 3AZJB 4KQRA 2FFYA 4CSRB 1K4FA 5AV5A 3ZNYA 1P3KD 1IYQA 4KENB 2VGKA 3ITAA 2P74A 3UNWA 3SH7A 3REHA 1YM1A 4LV1A 1BULA 1S32A 1CI9A 4JPMA 5AV5D 2ZLYA 4E44A 4NZ3A 3AN2C 5B31C 3D4FA 2ZC6B 3REHD 1M6KA 3REIC 5BS7A 3HLDA 1S32D 3AZLB 3VOYA 4JF4A 4XZQB 2FJ7C 5CHJA 4S2NC 3NBLA 4KUDA 3AN2B 1W8QA 4ZUXA 4B4XA 2R9WA 4KG6A 1L2SA 3L28A 4S2JA 3NQJB 2HDQA 2Y2KA 4G92C 5CHUA 5DNMB 2XK1A 2UWXA 3AL0C 3KS4A 4KUDD 3HVFA 5GXQC 5TGFA 4H9RB 4QB8A 2PYOA 3VH5A 3HONA 3WTPB 2Y2IA 2XDMA 2CV5C 3KFUG 5AV9C 4WU8C 4U0TA 5E2FA 1L0EA 3QHYA 1K57C 1SHVA 4OOYA 2PYOD 2EX9A 1B6WA 3VH6A 5CPKA 3KWQB 2AROA 3C4OA 5AV9B 3IXDA 1GHMA 1PZRA 1H3OA 3B6FC 1Z6FA 4ID4A 3WAAC 4R0QA 2IWDA 4B4ZA 4R8PA 1TZYB 3TG9A 4P85A 5B33B 5CPKD 3VSLA 3BFFA 4IEDA 2AROD 1YQSA 4OJPA 3MXRA 4QLCB 4IBFA 4QY6A 4LENA 4OPQA 3WAAB 4R8PD 3VSKA 3IXGA 5B2IC 4PPRA 3AV1C 1PWCA 1XGJA 4KZ5A 4J8VC 5AVBC 4Z66C 1M19A 1W7FA 3IF5A 3MVDC 3HSHA 3X1VA 3C4PA 4X53A 3V39A 1KX5C 5A92A 4PM6A 3FKVA 4QU3A 3S4XA 3AV1B 1MBLA 4UHUA 3LELA 3C1CC 1M19D 2H10A 5AVBB 4KGCC 3S1YA 3WWXA 2Y2HA 3L29A 3MVDB 2OLUA 5B2JC 3X1VD 3L27A 4KZ3A 3KXBA 1KX5B 3LELD 1G6AA 3C1CB 3W98B 4GD8A 4KGCB 3LJAC 2ZM8A 3MGQB 3PBNA 3TU4B 1H5XA 2G5IC 1BZAA 1Q9CA 1ALQA 3O88A 3MZFA 3Q7VB 5EUAA 3PBTA 2EXAA 3KXBD 3MGPB 4MNRA 4R4RA 3B3XA 1KX3C 1FR6A 2NZDB 1KE3A 1YLZA 4R4SA 2J9PA 3AZKA 1KX3B 1NXYA 2V1ZA 2JCHA 5B24B 5AY8A 5EVIC 4X55A 4S2PA 1XA1A 3IQAA 1G68A 4JJNC 1K56A 1QMFA 3AZKD 4HEFA 2ZY4A 1ESUA 4KZ8A 5TR7A 3RELA 3W4PA 5AVCB 4KZ6A 4LCLA 5E5AD 2H0YA 5AY8D 3WA9D 3UE3A 4EO5C 4OOLA 2F8NG 2WKEA 3X1TB 1M1AC 1S6RA 3NDEA 1K56D 1P3GC 2F2AC 4JJNB 1P3OB 4J8WA 3RELD 3REKA 4S2OA 2J7VA 2LY8A 2YFVB 4E6XA 2GDNA 5GLBA 4EO5B 1M18B 4LD9C 3AFAD 5EECA 3NIAA 3PBOA 4H9PB 4IBGA 4E3IA 3G30A 1P3GB 4J8WD 3ISGA 5CPIA 3H0MC 3OZHA 3AYWB 5E43A 5B1LC 3WKJA 2V20A 1C3BA 4EBNA 4M3KA 1P3KC 3FYZA 4BQMA 3AZHB 4DRAA 3AGDA 5BNVB 3LY4A 3L26A 2ZQ7A 3AGEA 5CPID 1FR1A 1VQQA 3WKJD 2G2WA 5C3IC 4IBXA 4OKPA 4WU9B 2ZQ9A 3G35A 4YS3C 3GMWA 1YT4A 3VP2A 1KE4A 2RIQA 1LL5A 1CI8A 3ZG7B 3UN7A 4IJEA 3ZDJA 3AN2A 2XFSA 2HIOC 5B31A 5E2HA 3WS2A 4O7DA 3REIA 1F1EA 3V3RA 5G49A 4IBIA 2FJ7A 3HLWA 1EQZC 2XEPA 4S2NA 3A3JA 3AN2D 4BJPA 2HIOB 2H5SA 5B31D 3CJMA 2BYKA 1AOIC 5AV6C 1BLPA 2HP5A 1I5QA 4Z2MG 4K0WA 5HX9A 5HAPA 1ZG6A 2ZQAA 5CPJB 1ONGA 1HVBA 2Y2QA 5GXQA 3IF6B 3BYDA 2ZM2A 3UTBB 5EE8A 3W97C 4LV2A 5DF8A 3ZCZA 1AOIB 4KG5A 5AV6B 2BYMA 2CV5A 5AV9A 4WU8A 4N9KA 1J9MA 1W5DA 4JXVA 4GKUA 4S2KA 1KX4C 1K57A 5GXQD 3LZ0C 5FATA 3ZG0A 4HESA 4YINA 4KHAB 4E3KA 3WS4A 3B6GB 3ZG8B 2CV5D 1YLJA 5AV9D 4WU8D 2ZY5A 1N1JB 3B6FA 4IBEA 4UPKA 5B33D 5CECA 3GTCA 4N92A 3BLMA 2C5WB 1K6RA 5KMWA 4GZBA 1GA9A 5F99C 2WGIA 3B6FD 2JE5A 3WAAD 2EXBA 4WNNB 1AXBA 2C6WB 4DF6A 4JLFA 5B2IA 5AV8B 3W96C 3AV1A 3MGRC 4J8VA 3P09A 2F8NB 5AVBA 4Z66A 3MVDA 5E2GA 5HFOA 4LG2A 3IH8A 2VQRA 3OCNA 5B2ID 1XA7A 5B1MB 3B0DB 3AV1D 1KX5A 4J8VD 5FDHA 3R45A 5AVBD 3C1CA 4Z66D 1BH9B 3V3SA 1BLSA 1U35B 4KGCA 4K91A 4UUZA 3AZGC 3MVDD 2XQZA 4CAYA 4WEKA 1RCJA 5B2JA 5GSUC 5B0YB 5B0ZC 4QY5A 2HUEB 1KX5D 3FWLA 2XD5A 4XUJB 1P3IC 3MGSB 4OH0A 3C1CD 4KGCD 4ZJ3A 4X23C 1BTLA 3VP0A 3O62B 2WZXA 3EPJA 3LJAA 4UA6A 4Q8IA 3M6BA 5B2JD 3HL9A 3MGPD 1RGZA 4LCMA 4PM5A 1JFIB 1YU2A 3X1UC 1P3LB 5D3OA 1KX3A 1Z2CB 2A49A 2XF3A 1FQGA 3UTAB 3UDIA 4MEZA 2Q9NA 1ZG4A 5B32B 1W79A 1H8YA 1PI4A 1KX3D 3NQUB 5E5AC 5B24D 3CG5A 3X1UB 3WA9C 3CMZA 5EVIA 3N8LA 3KSYA 4H9QB 5GLCA 5M1AA 1ULYA 4P0MA 1MWTA 1ZLAC 4Y0TA 4JXGA 5KZHA 3W4OA 3A3DA 2YFVA 5EVID 2WK0A 1MXOA 3AFAC 1K4EA 4BENA 5G18A 3AZFC 3N8RA 1M1AA 2NQBB 4JJND 1YU3A 3Q07A 1P3GA 3MBZA 1NRFA 1YU0A 2RCXA 4PMAA 1YUEA 5A90A 1BH8A 5CP6B 4FCFA 5JRGC 1I2WA 4LD9A 4J8XC 1M1AD 5AQAA 1PWGA 2F8NH 1P3GD 4H9NA 3O87A 3AYWD 3AZJC 1TAFA 2G2UA 5B1LA 4DE0A 3MKFA 3OPRA 1P3KA 1CK3A 4LD9D 1IKIA 5AQ9A 1A7WA 5CRFA 5GL9A 3MXSA 5B1LD 2HP6A 3UE1A 3ZVTA 1JTDA 4FH2A 3OPLA 3H0LC 5EOOA 4ZBEA 4GH9A 4YS3A 1ID3C 4DRBA 1YLYA 3ZHHA 4KG2A 4MBHA 1KVMA 3AZLC 4XZQC 1MKIA 1O7EA 5U47A 1WE4A 3VMAA 2WADA 3B0CW 4YS3D 2R9XA 3LZ1C 3AV2B 1ID3B 2HIOA 5KSHA 3G31A 2WGWA 4WEJA 3X1SC 5B40C 1PWDA 5DNMC 1BSGA 5HARA 1CEGA 1EQZA 3B0CT 1ES5A 4J8UB 3LZ1B 2RL3A 2HIOD 1N4OA 4S2LA 4GOGA 4NZ1A 3WTPC 4GHLA 3X1SB 5B40B 5A93A 3EPKA 3G4PA 4H9OA 5AV6A 4OQHA 3PBRA 1EQZD 1XXMA 4KQOA 1CEFA 1P3PB 3VFFA 3V50A 3KWQC 3W97A 3NI9A 1AOID 5AV6D 1P3FB 3IP4C 4R23A 2W8SA 2X02A 3KUYB 1KX4A 1TZYC 3NY4A 3LZ0A 5CEBA 4Z2MH 2ZMAA 5B33C 3UT9C 1NY0A 2QMIA 3G2YA 3W97D 3UDFA 3A3EA 4QLCC 2XLNA 4PM9A 3C1BB 1YU4A 4JF5A 3GR2A 2Q9MA 1KX4D 3LZ0D 1SKFA 1U60A 3UT9B 4A5RA 2DCFA 1GA0A 3GQZA 3IHAA 1P3BB 5FQJA 3SH8A 1TDGA 2OSUA 5BNXA 4X56A 5F99A 3WS1A 5DF7A 1MWRA 1JWZA 4S2IA 4XUZA 3A3IA 1XGIA 3SS3A 3W96A 2YFWB 3MGRA 3NDGA 5GLAA 2CC1A 3WRZA 5F99D 1ERMA 2WYXA 4DE1A 2XGNA 5HW3A 2Y59A 3IXBA 3W96D 3MGRD 3W98C 1IYSA 1IEMA 3MGQC 3TU4C 5JYOA 3AZGA 4EWFA 3MGPC 5GSUA 1JFIA 3UPOA 5B0ZA 3MGSD 5KSCA 1P3IA 1YLPA 2NZDC 2CWEA 2A3UA 3AZGD 4X23A 3V9RB 2EFUA 1I2SA 3MNNC 5GSUD 2DQNC 5B0ZD 2J9OA 3PAEA 4DQYB 2P9VB 2IWBA 5B24C 3X1UA 1P3ID 1LLBA 3MZEA 4EBPA 4H9QA 4X23D 5BPVA 3AZEC 4DXBA 1NZOA 1FSYA 3Q82A 4G91C 3MNNB 3M6HA 3RJUA 5AVCC 3REJC 2L5AA 3X1UD 4GD6A 3SH9A 3AZMB 5E5AA 3S22A 3WA9A 3WRTA 4GNUA 4IBCA 4R3BA 2QZ6A 3X1TC 2HP9A 5CXWA 4EUZA 3AZEB 1WWSA 5DNNC 1P3OC 4G91B 1ZLAA 4NE3A 5EOEA 2JSSA 3REJB 2IWCA 2RVQC 3BFGA 3JYIA 3OCLA 3UDXA 5BO0B 4YM6B 1F66B 3M2KA 1M18C 5FUGB 3AFAA 3A6NC 1KDWA 4DDYA 3Q1FA 3AZFA 5DNNB 3EPHA 5FQ9A 1ZLAD 3AYWC 3ZNTA 1H8ZA 4ZAMA 1K54C 3WX7A 3AZHC 5JRGA 4XUXA 4E3OA 3A6NB 4J8XA 1XKZA 3AZFD 1HZOA 1FCNA 2I72A 3A1IA 1ES3A 1K55C 3AZJA 3GV9A 1P34B 4WU9C 4CSRA 4IVIA 5JRGD 5FAPA 4FD8A 4J8XD 1SDNA 3UO9A 4E45A 3AZJD 1IELA 3N6IA 5GT3B 5M18A 4EBLA 1PW8A 5FQKA 4RA7A 4Z9QA 3AZLA 3MFDA 4Y0UA 4XZQA 4OQIA 1K6SA 3AGFA 1FOFA 3AZIB 3UY6A 3GRJA 5KDMB 1PYYA 1ID3D 3LZ1A 1P3MC 1HTZA 3NQJA 3VOZA 3X1SA 3AZLD 5B40A 4XZQD 5DNMA 5HAIA 3N7WA 4HBTA 5GHZA 3WTPE 3LZ1D 5CPJC 4H9RA 4UA9A 1JVJA 3IF6C 4X6TA 5DTSA 1P3MB 3UTBC 2OV5A 1B67A 3X1SD 5HL1A 5B40D 4NK3A 3WTPA 5DNMD 3REHB 1W2EA 5JA4B 1S32B 2B5RA 5FI2A 1DY6A 1L0DA 1BT5A 3PBSA 5AQBA 3B6GC 3WTPD 3KWQA 1XPBA 5HAQA 4EV4A 3BLSA 3IT9A 1TZYA 4KUDB 4MBFA 4OOMA 4NY2A 5B33A 4ZUXB 3UT9A 4C3QA 3KWQD 3BFDA 5IHVA 4JXSA 2Y2NA 4H8RA 4GB7A 4QLCA 1LHYA 1OMEA 3MKEA 5JYPA 2X71A 3HUOA 3WAAA 1TZYD 4NYUA 3UT9D 3MZDA 4KZ7A 2IOUA 5AV8C 3BECA 2PYOB 4QLCD 4WZ5C 2HPBA 3N8SA 2DNSA 1HTAA 4PM8A 1ZKJA 5B1MC 3VFHA 3B0DC 3DTMA 4N9LA 5CPKB 3Q81A 4HGAC 1L0FA 1U35C 2AROB 3O86A 3EQVA 1H3OB 4E3LA 5B0YC 4H9SC 4U3TA 1E4DA 2HUEC 3QNBA 4R8PB 3W4QA 4XUJC 3MGSC 4QD4A 1NJ4A 4HGAB 5FAQA 3W98A 3O62C 3MGQA 3TU4A 4OQGA 3Q7VA 2JC7A 3MGPA 1P3LC 4IBBA 3DW0A 1ERQA 3UTAC 5B31G 3W98D 4WBGA 2NZDA 3MGQD 2ZC5B 3TU4D 1WYCA 5B32C 1SCWA 3LY3A 3MNNA 3X1VB 5B24A 4E3NA 2NZDD 2ZJ9A 5EPHA 4OPRA 1E25A 4NETA 5GLDA 1MPLA 3AZEA 1Q2PA 5F83A 3N3FA 3MNND 5F1GA 1XX2A 1BFMA 5AVCA 3REJA 5GT0C 4KQQA 3KXBB 2J8PA 1YU1A 5CEDA 5FUGA 4BD1A 1EI5A 3AZED 5CHLB 3X1TA 1RP5A 1KVLA 3C7UA 4Y0OA 2NQBC 5DNNA 4GDNA 4KZBA 4JJNA 1P3OA 4P6BA 2J8YA 4MBKA 4KZ4A 4JKTA 5AVCD 3REJD 4CJNA 2ZM0A 5GT0B 1K25A 3FDDA 1TDLA 4FSFA 1Q2QA 5CP6C 2Y2LA 4YFMA 1M18A 4H9PA 3X1TD 4OP5A 3G2ZA 3A6NA 4BD0A 4ZBJC 5DNND 1P3OD 3WS5A 1RGYA 5AQ7A 3L2AA 3AYWA 3AZKB 2RVQD 1XP4A 1K54A 3IWQA 1M18D 5AY8B 3AZHA 3A6ND 5BNVA 1QMEA 4ZBJB 3HLFA 1EWZA 2F8NK 1K55A 4AWLC 1YLTA 4WU9A 5I94A 3AZHD 2XR0A 4BL2A 3PTEA 4KZ9A 4C75A 3REKB 4CPKA 4WU9D 4UA7A 4AWLB 3FKWA 4WZ4A 2EX6A 2Y2PA 3AV2C 4WV4B 3IH9A 3PBQA 2ZC4B 1GHPA 4OQ0A 5E2EA 4E3MA 3VP3A 1JWVA 3VP4A 4MLLA 3WKJB 3AZID 3RXWA 4OPYA 3ZVWA 4J8UC 3FKEA 3P5JB 1P3MA 4QJGA 2Y2MA 1DJCA 4RYEA 1BLCA 1E3UD 1ES2A 1PIOA 4D2OA 5JA4A 4E6WA 5FA7A 1O07A 5CPJA 2WKHA 3DWZA 1P3MD 3VP1A 3IF6A 1P3PC 3UTBA 5CERA 4NYYA 1IYOA 1P3FC 1AOIA 1ONHA 4OUIA 1NZUA 5CGSA 2WZZA 4OJ6A 4IJFA 3KUYC 4ZJ1A 5CPJD 1HQ3C 3UTBD 4KHAA 3VH5W 2Y91A 4NZ5A 3B6GA 5B31B 1ZC2A 4F94A 3ZG9B 3REIB 3G34A 5G49B 4OLGA 3C1BC 1N1JA 3O3VA 2FJ7B 1SDEA 3TOIA 4QHCA 1HQ3B 4ZUXD 3H0RC 3B6GD 3VH6W 4DE2A 1P3BC 3VH5T 2BYKB 3BFEA 5FI7A 4OLDA 3FZCA 4G92B 3FV7A 2QPNA 2XD1A 4WNNA 2Y2JA 5GHYA 1FCOA 5GXQB 5AV8A 3LEZA 1IYPA 1HD8A 3VH6T 2F8NA 2BYMB 3PAGA 2CV5B 4WZ5A 4WU8B 3WS0A 4BLMA 2EX2A 4RVAA 5AV8D 5B1MA 2F8ND 4IBJA 1BH9A 1U35A 1KGFA 3W99C 4IBRA 2Y2OA 2HDUA 3B6FB 3I7JA 2E8IA 5B0YA 4H9SA 5B1MD 2PU2A 4NZ4A 4XUJA 3MGSA 4QNLA 3BM6A 3QNCA 1U35D 4NE6A 1ESIA 3O62A 5DTTA 3W99B 5B0YD 3L25A 4XUJD 1P3LA 3IWIA 5B2IB 3UTAA 5FQIA 3O62D 4J8VB 3C5AA 1JWPA 4Z66B 2HDSA 4M6BA 5B32A 2IO5C 3F6TA 1P3AC 2XFTA 1P3LD 3OPPA 3NQUA 3AZMC 3UTAD 5M19A 1MY8A 3HLBA 3R45B 5B32D 4UUZB 4WZSB 4CAYB 2IO5B 3E2KA 4JF6A 1P3AB 1NYMA 1WYBA 5B2JB 4E3JA 5GT0A 4YM6C 1F66C 4IBKA 4Z5TC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PI4 A;  2XK1 A;  3PBS A;  2UWX A;  3CG5 A;  5AQB A;  1XPB A;  3CMZ A;  5EVL A;  5EVI A;  5HAQ A;  3HVF A;  1ES4 A;  3N8L A;  3BLS A;  5TGF A;  4EV4 A;  5GLC A;  4QB8 A;  5M1A A;  4P0M A;  1MWT A;  4BL3 A;  2WUQ A;  4IVK A;  1LL9 A;  3IT9 A;  4Y0T A;  1S0W A;  4JXG A;  2Y2I A;  2XDM A;  3A3D A;  3W4O A;  5KZH A;  4MBF A;  4OOM A;  4C3Q A;  3BFD A;  5IHV A;  4JXS A;  4U0T A;  5E2F A;  2WK0 A;  5EVI D;  1L0E A;  2Y2N A;  1MXO A;  3QHY A;  1K57 C;  4H8R A;  1SHV A;  4OOY A;  1K4E A;  4GB7 A;  1KGE A;  4BEN A;  5G18 A;  1LHY A;  1OME A;  3MKE A;  3GSG A;  3N8R A;  2EX9 A;  5FQM A;  5JYP A;  2X71 A;  3HUO A;  3Q07 A;  4N1H A;  5EVI B;  3MBZ A;  3LCE A;  1NRF A;  2EFX A;  3C4O A;  3MZD A;  2RCX A;  4KZ7 A;  4PMA A;  3IXD A;  3BEC A;  1GHM A;  5A90 A;  4FCF A;  1Z6F A;  4ID4 A;  4R0Q A;  1I2W A;  1LI9 A;  2IWD A;  3HBR A;  3Q7Z A;  4B4Z A;  3NC8 A;  3TG9 A;  4WZ5 C;  4P85 A;  1ERO A;  2HPB A;  5DTK A;  5AQA A;  1PWG A;  3N8S A;  1KDS A;  2DNS A;  3VSL A;  3BFF A;  4IED A;  4PM8 A;  3O87 A;  3EQU A;  1YQS A;  1ZKJ A;  3VFH A;  3MXR A;  2G2U A;  3DTM A;  2Y55 A;  4DE0 A;  3MKF A;  4N9L A;  1GCE A;  3OPR A;  3Q81 A;  5TFQ A;  1CK3 A;  3TSG A;  4QY6 A;  4LEN A;  4OPQ A;  1IKI A;  2WAF A;  1L0F A;  3VSK A;  3IXG A;  5AQ9 A;  3O86 A;  4PPR A;  3P98 A;  5FI6 A;  3EQV A;  1PWC A;  4E3L A;  1XGJ A;  4KZ5 A;  2H0T A;  5CRF A;  3M2J A;  4OP8 A;  1E4D A;  4U3T A;  3QNB A;  5GL9 A;  3MXS A;  2HP6 A;  3UE1 A;  3W4Q A;  3ZVT A;  1JTD A;  4FH2 A;  4ZTK A;  1W7F A;  3IF5 A;  3OPL A;  4QD4 A;  3C7V A;  5DF9 A;  1NJ4 A;  2ZQ8 A;  5EOO A;  4ZBE A;  4P87 A;  5FAQ A;  1YLY A;  3C4P A;  4X53 A;  3ZHH A;  4KG2 A;  4MBH A;  3V39 A;  4OQG A;  5A92 A;  4PM6 A;  3FKV A;  4QU3 A;  3Q7V A;  1KVM A;  3S4X A;  1MBL A;  4N1X A;  4UHU A;  2JC7 A;  4WYY A;  1MKI A;  1KE0 A;  1O7E A;  2H10 A;  5U47 A;  5CGX A;  3S1Y A;  1WE4 A;  3DW0 A;  1ERQ A;  2Y2H A;  3A3F A;  3OC2 A;  3VMA A;  3WWX A;  2WAD A;  3ZG5 A;  3N4I A;  2OLU A;  2R9X A;  4WBG A;  3SS5 A;  4KZ3 A;  2ZC5 B;  1Y54 A;  1WYC A;  4EQI A;  5KSH A;  1SCW A;  3RXX A;  3LY3 A;  3G31 A;  2WGW A;  4WEJ A;  1PWD A;  1G6A A;  2VGJ A;  1BSG A;  5HAR A;  1TEM A;  4GD8 A;  1CEG A;  4ZDX A;  2WKI A;  2ZM8 A;  3PBN A;  3OPH A;  1H5X A;  5CTM A;  1BZA A;  1ALQ A;  3O88 A;  3MZF A;  3Q7V B;  4E3N A;  5EUA A;  3PBT A;  1ES5 A;  2ZJ9 A;  5EPH A;  2EXA A;  3E2L A;  4OPR A;  2RL3 A;  1E25 A;  4NET A;  5GLD A;  4MNR A;  1MPL A;  2BG1 A;  4R4R A;  3B3X A;  1N4O A;  3NCK A;  1Q2P A;  4S2L A;  5F83 A;  4GOG A;  1IKG A;  1FR6 A;  3IXH A;  4DDS A;  5A93 A;  5F1G A;  5F1F A;  3G4P A;  1XX2 A;  1DJB A;  1KE3 A;  4KQQ A;  2DRW A;  4OQH A;  3PBR A;  3HUN A;  1YLZ A;  3ZGA B;  4GDB A;  4R4S A;  2J9P A;  2WGW B;  2PU4 A;  1XXM A;  5CED A;  4KQO A;  4BD1 A;  1EI5 A;  1RP5 A;  1KVL A;  1CEF A;  3C7U A;  4UAA A;  4Y0O A;  1NXY A;  2V1Z A;  2OLV A;  1PZP A;  2JCH A;  3V50 A;  4GDN A;  4KZB A;  3VFF A;  4P6B A;  2J8Y A;  4MBK A;  3NI9 A;  3LO7 A;  5EVI C;  4KZ4 A;  3UE0 A;  3W8K A;  4JKT A;  4X55 A;  4CJN A;  4S2P A;  1XA1 A;  2ZM0 A;  2ZD8 A;  4R23 A;  3IQA A;  1K25 A;  1TDL A;  4FSF A;  1G68 A;  1Q2Q A;  2Y2L A;  3SS4 A;  2X02 A;  1K56 A;  4YFM A;  1QMF A;  1PW1 A;  4HEF A;  3NY4 A;  4ZJ2 A;  5CEB A;  1ESU A;  4OP5 A;  4KZ8 A;  5TR7 A;  3G2Z A;  2ZMA A;  3W4P A;  1NY0 A;  2QMI A;  4KZ6 A;  4BD0 A;  3G2Y A;  4LCL A;  2H0Y A;  1TVF A;  3WS5 A;  3HLE A;  3UE3 A;  1RGY A;  3UDF A;  2V2F F;  5AQ7 A;  3A3E A;  4OOL A;  4WEL A;  4B88 A;  2XLN A;  3UPP A;  4PM9 A;  2WKE A;  1XP4 A;  1S6R A;  3NDE A;  1K54 A;  1K56 D;  3IWQ A;  4JXW A;  4JF5 A;  1KGG A;  3GR2 A;  2Q9M A;  2FFF B;  4RX2 A;  1SKF A;  1U60 A;  3HLG A;  2ZQD A;  4S2O A;  2J7V A;  1QME A;  4A5R A;  2DCF A;  1GA0 A;  3BFC A;  1PZO A;  4E6X A;  3HLF A;  1EWZ A;  3GQZ A;  3IHA A;  2GDN A;  5FQJ A;  5GLB A;  3SH8 A;  5EEC A;  3NIA A;  3PBO A;  4E3I A;  1TDG A;  1K55 A;  2OSU A;  1YLT A;  4X56 A;  1FSW A;  5I94 A;  3V5M A;  3WS1 A;  1MWS A;  5CTN A;  5DF7 A;  3G30 A;  1MWR A;  3ISG A;  1JWZ A;  1GHI A;  3OZH A;  4WM9 A;  4S2I A;  5FAO A;  5E43 A;  4XUZ A;  2XR0 A;  3BRM A;  3DWK A;  4BL2 A;  2V20 A;  1C3B A;  3A3I A;  4EBN A;  4M3K A;  1XGI A;  4OON A;  3FYZ A;  3SS3 A;  4BQM A;  1LI0 A;  3PTE A;  3NDG A;  5GLA A;  4XXR A;  2CC1 A;  3AGD A;  4KZ9 A;  3WRZ A;  4C75 A;  1YMX A;  3LY4 A;  3ZFZ A;  4CPK A;  4UA7 A;  1ERM A;  3FKW A;  4WZ4 A;  5FQQ A;  2EX6 A;  2Y2P A;  5J8X A;  2ZQ7 A;  3AGE A;  1FR1 A;  2WYX A;  3IH9 A;  4DE1 A;  3PBQ A;  2XGN A;  1VQQ A;  1JTG A;  2G2W A;  2ZC4 B;  5HW3 A;  1GHP A;  3BEB A;  4IBX A;  1NYY A;  1N9B A;  2Y59 A;  3IXB A;  4OKP A;  1YMS A;  4OQ0 A;  2ZQ9 A;  5E2E A;  4E3M A;  4PM7 A;  1IYS A;  3G35 A;  2WGV A;  3GMW A;  1IEM A;  2ZC7 A;  3VP3 A;  2XH9 A;  2P9V A;  5FSR A;  1JWV A;  1YT4 A;  3VP4 A;  3VP2 A;  4MLL A;  5JYO A;  3RXW A;  1KE4 A;  4OPY A;  3ZVW A;  4EWF A;  4S2M A;  1LL5 A;  1CI8 A;  3ZG7 B;  1L0G A;  4DXC A;  3UPO A;  5FAS A;  4R1G A;  4QJG A;  2Y2M A;  2Z2L B;  3UN7 A;  5KSC A;  1DJC A;  4RYE A;  3ZDJ A;  1YLP A;  1BLC A;  1E3U D;  2XFS A;  1ES2 A;  1PIO A;  2A3U A;  4D2O A;  4E6W A;  4R3J A;  5CHM A;  2EFU A;  1I2S A;  5FA7 A;  1O07 A;  5E2H A;  4FH4 A;  3WS2 A;  4O7D A;  3V3R A;  1MWU A;  2WKH A;  3DWZ A;  2J9O A;  3PAE A;  3IF6 A;  3VP1 A;  2P9V B;  3G32 A;  2IWB A;  5F82 A;  5CER A;  1DJA A;  3HLW A;  1LLB A;  3IHB A;  2XEP A;  4S2N A;  1IYO A;  1K38 A;  3MZE A;  1FCM A;  3A3J A;  1ONH A;  4EBP A;  1NZU A;  5CGS A;  4BJP A;  5DVA A;  2WZZ A;  4DXB A;  2H5S A;  3SOI A;  1NZO A;  3CJM A;  1FSY A;  1M40 A;  3Q82 A;  4ZJ1 A;  3M6H A;  2WAE A;  3RJU A;  4GD6 A;  2HDR A;  4C6Y A;  3SH9 A;  1BLP A;  2HP5 A;  3IWO A;  2Y91 A;  4Y7P A;  1YLW A;  3S22 A;  1I5Q A;  1ZC2 A;  4DKI A;  4F94 A;  3WRT A;  2Z2M B;  4GNU A;  4K0W A;  5HX9 A;  3ZG9 B;  4OPZ A;  5A91 A;  4R3B A;  5HAP A;  1ZG6 A;  2ZQA A;  2QZ6 A;  3G34 A;  1ONG A;  1HVB A;  2Y2Q A;  2HP9 A;  4JBF A;  4OLG A;  3IF6 B;  3BYD A;  5CXW A;  4EUZ A;  2ZM2 A;  5EE8 A;  3O3V A;  1SDE A;  4RX3 A;  3TOI A;  3ITB A;  4GN2 A;  4LV2 A;  1BLH A;  5DF8 A;  5EOE A;  4X68 A;  4QHC A;  4KG5 A;  3ZCZ A;  3GVB A;  2IWC A;  2JBF A;  4HBU A;  4WMC A;  5CGW A;  5BOH A;  3BFG A;  3JYI A;  3OCL A;  4N9K A;  1J9M A;  1W5D A;  3UDX A;  4DE2 A;  3M2K A;  4JXV A;  4GKU A;  3HRE A;  2Y2G A;  3BFE A;  4S2K A;  1K57 A;  5FI7 A;  4OLD A;  3FZC A;  3FV7 A;  5FAT A;  1KDW A;  4K0X A;  2PBY A;  4DDY A;  3ZG0 A;  4HES A;  2QPN A;  3Q1F A;  4YIN A;  5FQ9 A;  4E3K A;  2XD1 A;  3WS4 A;  3UPN A;  2Y2J A;  3ZG8 B;  5GHY A;  1FCO A;  1YLJ A;  4WMC D;  2BLS A;  3ZNT A;  1BUE A;  1H8Z A;  4X69 A;  3LEZ A;  4ZAM A;  1K54 C;  1IYP A;  1HD8 A;  4DRT A;  3HUM A;  2ZC3 B;  4XUX A;  4LV3 A;  4E3O A;  1XKZ A;  5CEC A;  3GTC A;  1HZO A;  3PAG A;  4WZ5 A;  4N92 A;  3WS0 A;  3BLM A;  1FCN A;  2C5W B;  4BLM A;  2Y4A A;  1K6R A;  2EX2 A;  5KMW A;  4GZB A;  2I72 A;  5GHX A;  1W8Y A;  1ES3 A;  4RVA A;  1GA9 A;  1K55 C;  3GV9 A;  2WGI A;  1VM1 A;  2ZQC A;  4IVI A;  5FAP A;  2JE5 A;  2EXB A;  1AXB A;  4FD8 A;  5L2F A;  2C6W B;  4DF6 A;  4JLF A;  1KGF A;  1SDN A;  4IBR A;  2Y2O A;  4L0L A;  4OVD A;  3UO9 A;  1PI5 A;  4U0X A;  2HDU A;  1IEL A;  2E8I A;  3I7J A;  3P09 A;  2EX8 A;  2X01 A;  2PU2 A;  3N6I A;  3HLC A;  3BM6 A;  3QNC A;  5E2G A;  4KZA A;  5HFO A;  4LV0 A;  4DE3 A;  3IH8 A;  5M18 A;  1E3U A;  3CZD A;  1ESI A;  3OCN A;  5DTT A;  4EBL A;  1XA7 A;  4KQR A;  1PW8 A;  5FQK A;  2FFY A;  1K4F A;  3ZNY A;  4RA7 A;  1IYQ A;  5FDH A;  4Z9Q A;  3MFD A;  4KEN B;  4Y0U A;  2VGK A;  3ITA A;  2P74 A;  3V3S A;  1BLS A;  4K91 A;  3UNW A;  3IWI A;  4OQI A;  1K6S A;  3AGF A;  1FOF A;  2XQZ A;  4WEK A;  3SH7 A;  1RCJ A;  3UY6 A;  3GRJ A;  1YM1 A;  5FQI A;  1PYY A;  4LV1 A;  1BUL A;  4QY5 A;  1CI9 A;  3C5A A;  4JPM A;  1JWP A;  2HDS A;  1HTZ A;  3FWL A;  2XD5 A;  2ZLY A;  3VOZ A;  4OH0 A;  2XFT A;  3OPP A;  4ZJ3 A;  1BTL A;  3VP0 A;  2WZX A;  5HAI A;  4UA6 A;  3N7W A;  3D4F A;  4Q8I A;  2ZC6 B;  4HBT A;  3M6B A;  5GHZ A;  1M6K A;  5M19 A;  3HL9 A;  1MY8 A;  3HLD A;  1RGZ A;  3HLB A;  1JVJ A;  3IF6 C;  4LCM A;  4UA9 A;  4X6T A;  5DTS A;  4JF4 A;  3VOY A;  4PM5 A;  5D3O A;  5CHJ A;  2OV5 A;  4S2N C;  5HL1 A;  2A49 A;  3E2K A;  4NK3 A;  2XF3 A;  4JF6 A;  1FQG A;  1NYM A;  1WYB A;  3NBL A;  4E3J A;  3UDI A;  4MEZ A;  1W8Q A;  4B4X A;  2R9W A;  4KG6 A;  2B5R A;  1L2S A;  2Q9N A;  5FI2 A;  4S2J A;  1ZG4 A;  1DY6 A;  2HDQ A;  1L0D A;  2Y2K A;  1W79 A;  5CHU A;  1H8Y A;  1BT5 A; 
#chains in the Genus database with same CATH topology
 4E04 A;  2NQB A;  3LJA B;  2OAP 1;  4OJL A;  5EVL A;  1ES4 A;  4FUW A;  5GT0 D;  3NUL A;  5F6A A;  4BL3 A;  4Z5T B;  5CP6 A;  3AZN C;  2JKT I;  4HNB A;  2WUQ A;  3K3C A;  3ZYT A;  4IVK A;  1LL9 A;  1S0W A;  2NQB D;  2OWJ A;  4Z2K A;  1P34 C;  1KGE A;  3CUE C;  3GSG A;  5CP6 D;  5FQM A;  4N1H A;  3AZN B;  2DMW A;  5EVI B;  3LCE A;  2EFX A;  4PKY G;  2D49 A;  2Z6D A;  3CLO A;  1NLY A;  2W3E A;  1XFN A;  1LI9 A;  3HBR A;  1DRM A;  3Q7Z A;  3NC8 A;  2G7U A;  1ERO A;  5DTK A;  5GT3 C;  1KDS A;  3LR5 A;  1GPF A;  1K0K A;  4P6Z S;  3MMH A;  2JKR I;  4ESP A;  5BT1 C;  3EQU A;  2V8C A;  1WWI A;  1OT6 A;  2VV6 A;  1VET A;  2Y55 A;  2BTF P;  1M1A B;  1GCE A;  5TFQ A;  3TSG A;  2WAF A;  3REK D;  1W63 M;  5L09 A;  1T18 A;  2B18 A;  3AZI C;  3P98 A;  5FI6 A;  1BH8 B;  2H0T A;  3AV2 A;  3M2J A;  4OP8 A;  1ID3 A;  4LD9 B;  1VEU A;  3EOI A;  4ZTK A;  3MQL A;  4JGR A;  3C7V A;  5DF9 A;  2ZQ8 A;  4H9N B;  4P87 A;  4NG2 A;  2WKR A;  1TAF B;  5B1L B;  4LRX C;  5AV5 C;  4CQH A;  3AV2 D;  1P3K B;  4N1X A;  4J8U A;  2ZY2 A;  3EG5 B;  4WYY A;  1KE0 A;  5CGX A;  1XFQ A;  3OC2 A;  3A3F A;  3ZG5 A;  1Y28 A;  3N4I A;  3REH C;  4JGP A;  5B32 G;  1OTA A;  3SS5 A;  1S32 C;  4PAU A;  3KYE A;  1Y54 A;  4EQI A;  3RXX A;  5C3I B;  5AV5 B;  4J8U D;  2VGJ A;  3R7W B;  4YS3 B;  1TEM A;  4ZDX A;  1P3P A;  2WKI A;  3CWF A;  3OPH A;  3A1K A;  1G5U A;  5CTM A;  3LI8 A;  3EPL A;  5BS7 C;  1G28 A;  2G5H C;  1P3F A;  2ZOI A;  3E2L A;  3NOU C;  1E6Z A;  2BG1 A;  2DF4 C;  3NCK A;  3KUY A;  1IKG A;  3IXH A;  4KUD C;  4DDS A;  5F1F A;  4ZUX C;  1HQ3 A;  1P3P D;  1DJB A;  2DRW A;  3S7N A;  3HUN A;  1E6N A;  3ZGA B;  2J3T D;  4GDB A;  4BBU A;  2WGW B;  1P3F D;  2PU4 A;  3REI D;  3LR3 A;  4GLQ A;  4UAA A;  3C1B A;  2FJ7 D;  3KUY D;  2OLV A;  1PZP A;  3W8K A;  3B0B A;  3LO7 A;  3UE0 A;  1EQZ B;  1HQ3 D;  4EU0 A;  2ZD8 A;  4WJ3 C;  2PYO C;  5HZH A;  3SS4 A;  1P3B A;  3T1S A;  1PW1 A;  1S4R A;  4ZJ2 A;  3C1B D;  4H9O B;  1STZ A;  1XJ6 A;  2NUT C;  1TVF A;  3HLE A;  4FOF A;  3G6O A;  2V2F F;  4G3W A;  4WEL A;  4B88 A;  2K31 A;  3UPP A;  5CPK C;  1P3B D;  4JXW A;  1KGG A;  3W97 B;  2YFW A;  2FFF B;  4RX2 A;  2ARO C;  3HLG A;  2ZQD A;  4Y13 A;  3BFC A;  1T3U A;  1PZO A;  3VOL A;  3ICY A;  2W1T B;  4R8P C;  1KX4 B;  3SW1 A;  3LZ0 B;  2W1R A;  1FSW A;  4G3K A;  3V5M A;  1MWS A;  5CTN A;  1GHI A;  3CIT A;  4WM9 A;  5FAO A;  3KSG A;  3BRM A;  3DWK A;  3W99 A;  2XA7 M;  4OON A;  4OJ5 A;  1LI0 A;  4XXR A;  3IX4 A;  1YMX A;  3ZFZ A;  3T4J A;  5FQQ A;  5EM0 A;  2UV0 E;  5J8X A;  3V9R A;  1M19 C;  1JTG A;  5BNX B;  2O99 A;  3W99 D;  3BEB A;  1NYY A;  1N9B A;  1YMS A;  5F99 B;  3KYZ A;  4PM7 A;  3X1V C;  2WGV A;  2ZC7 A;  2XH9 A;  2P9V A;  3IX8 A;  5FSR A;  4DJ3 A;  1R4V A;  2ZY3 A;  4S2M A;  3W96 B;  3LEL C;  2O0Y A;  3MGR B;  4QPR A;  1L0G A;  4DXC A;  5FAS A;  1M19 B;  1IFQ A;  4R1G A;  2Z2L B;  4HMD A;  4NFT A;  1P3A A;  3KXB C;  4R3J A;  3AZM A;  5CHM A;  2VGL S;  4FH4 A;  3LEL B;  4IBD A;  1MWU A;  1V9Y A;  5FEF A;  3G32 A;  5F82 A;  1DJA A;  3AZG B;  3IHB A;  1P3A D;  1K38 A;  1FCM A;  3E4P A;  5GSU B;  3AZM D;  5DVA A;  3H82 B;  3SOI A;  5B0Z B;  2QWS A;  3L7H A;  5BO0 A;  4YM6 A;  1F66 A;  4OJO A;  1M40 A;  4Z5T A;  5FEG A;  1P3I B;  2INW A;  1W1Y A;  2WAE A;  3LJA D;  2HDR A;  4X23 B;  4C6Y A;  4EQ1 A;  3IWO A;  3MSH A;  4Y7P A;  1YLW A;  4DKI A;  3KS8 A;  2Z2M B;  4OPZ A;  5A91 A;  3AZK C;  4JBF A;  4YM6 D;  1F66 D;  1L6J A;  4Z5T D;  5AY8 C;  3AZN A;  1N9L A;  3CI6 A;  4RX3 A;  3ITB A;  4GN2 A;  1BLH A;  4CLC C;  4X68 A;  3NOT C;  3GVB A;  4O01 A;  4GHA A;  2JBF A;  4HBU A;  4WMC A;  5CGW A;  5BOH A;  3LGO A;  3HRE A;  3SZT A;  2Y2G A;  3REL C;  4K0X A;  2PBY A;  1KU5 A;  1P34 A;  3CUE A;  5E5A B;  3AZN D;  1UR9 A;  4WLA A;  3UPN A;  3WA9 B;  4WMC D;  2BLS A;  1BUE A;  4X69 A;  2JN7 A;  3U4L P;  4DRT A;  3HUM A;  3LEQ A;  4J8W C;  1VHM A;  2ZC3 B;  3REK C;  1P34 D;  1ZLA B;  4LV3 A;  3REL B;  4MN6 A;  2Y4A A;  5GT3 A;  5GHX A;  1W8Y A;  3T4S A;  4HP9 A;  3AFA B;  1OTE A;  3M7P A;  3AZF B;  1VM1 A;  2ZQC A;  1CQA A;  5CPI C;  5L2F A;  4J8W B;  3F1P A;  5DFX A;  4NE5 A;  3WKJ C;  5GT3 D;  4L0L A;  4OVD A;  5DJT A;  3AZI A;  4Y2F A;  4EEU A;  2QJ7 A;  1PI5 A;  4U0X A;  5KDM A;  5BT1 D;  5JRG B;  3T1X A;  4KUO A;  2L1M A;  2ZM5 A;  1CXW A;  2EX8 A;  1D7E A;  4J8X B;  2X01 A;  3HLC A;  4UQI S;  4XT2 A;  4MB5 A;  3LIC A;  1LSV A;  4KZA A;  5CPI B;  4LV0 A;  4DE3 A;  1E3U A;  3CZD A;  3AZJ B;  1E8B A;  4K08 A;  4KQR A;  2Q0O A;  2FFY A;  3QP4 A;  4CSR B;  1K4F A;  2A24 B;  5AV5 A;  3ZNY A;  1P3K D;  3E4Q A;  3ULF A;  3MQO A;  1IYQ A;  2M7V A;  3D72 A;  4GS9 A;  4KEN B;  5TJJ A;  2VGK A;  3ITA A;  2P74 A;  3UNW A;  1TS7 A;  3SH7 A;  2PYR A;  2AVX A;  3REH A;  1NRJ A;  1YM1 A;  2H28 A;  4P6Z M;  2YKF A;  4LV1 A;  1BUL A;  1S32 A;  1CI9 A;  4JPM A;  5AV5 D;  1S1Z A;  3LR4 A;  1DP9 A;  2ZLY A;  4E44 A;  4NZ3 A;  3AN2 C;  4BWI A;  2ZOH A;  5B31 C;  3D4F A;  2ZC6 B;  3REH D;  1M6K A;  3REI C;  2JHE A;  5BS7 A;  3HLD A;  1S32 D;  5L07 A;  3AZL B;  3VOY A;  4JF4 A;  4XZQ B;  2FJ7 C;  5CHJ A;  4S2N C;  2O9C A;  3NBL A;  4KUD A;  3AN2 B;  4Q0H A;  1W8Q A;  4ZUX A;  4B4X A;  2P04 A;  2R9W A;  4KG6 A;  1L2S A;  3L28 A;  4S2J A;  3NQJ B;  2HDQ A;  2Y2K A;  4G92 C;  2O9B A;  3LUQ A;  3GEC A;  5CHU A;  3S7Q A;  5DNM B;  2XK1 A;  3C38 A;  4HQA A;  2UWX A;  3AL0 C;  2VX8 A;  3KS4 A;  4LPZ A;  3D9Y A;  4KUD D;  3HVF A;  5GXQ C;  5TGF A;  4H9R B;  4QB8 A;  3EGD C;  2PYO A;  4DJ2 A;  3VH5 A;  4MB3 A;  3HON A;  3WTP B;  1EW0 A;  3F1O B;  2Y2I A;  2OAQ 1;  2XDM A;  2CV5 C;  3KFU G;  5AV9 C;  1HLU P;  4WU8 C;  3CPT B;  4JGO A;  4U0T A;  5E2F A;  1L0E A;  3OOV A;  3QHY A;  1K57 C;  1SHV A;  2W1T A;  3C8C A;  4OOY A;  4X1M A;  1OGB A;  2J80 A;  2PYO D;  2EX9 A;  1B6W A;  3VH6 A;  5CPK A;  1LSX A;  4EW7 A;  3KWQ B;  2ARO A;  3C4O A;  4IHQ A;  5AV9 B;  3IXD A;  1GHM A;  4I38 A;  1PZR A;  2EWV A;  1H3O A;  3B6F C;  1Z6F A;  4NXE A;  4ID4 A;  3WAA C;  4R0Q A;  2IWD A;  4B4Z A;  4R8P A;  1TZY B;  3TG9 A;  4P85 A;  5B33 B;  5CPK D;  4EXO A;  3VSL A;  3BFF A;  4IED A;  3LFV A;  5G4Z A;  2ARO D;  4MMN A;  1YQS A;  4OJP A;  3MXR A;  4QLC B;  4IBF A;  4QY6 A;  4LEN A;  4OPQ A;  3CAX A;  3WAA B;  4R8P D;  3VSK A;  1ZTU A;  3IXG A;  5B2I C;  4PPR A;  1MKM A;  3AV1 C;  1PWC A;  1XGJ A;  4KZ5 A;  4J8V C;  4DMZ A;  5AVB C;  3LIE A;  4Z66 C;  1M19 A;  4AFI A;  1UGU A;  1W7F A;  3IF5 A;  3MVD C;  1T1C A;  3HSH A;  3FPV A;  5A8B A;  3X1V A;  1X0O A;  3C4P A;  4X53 A;  3V39 A;  1KX5 C;  5A92 A;  4PM6 A;  3FKV A;  4QU3 A;  4ARZ A;  3S4X A;  3AV1 B;  1MBL A;  4UHU A;  3LEL A;  3C1C C;  1M19 D;  2H10 A;  5AVB B;  4KGC C;  4WUJ A;  3S1Y A;  3WWX A;  2Y2H A;  4Z2H A;  3L29 A;  4LRZ E;  5HL6 A;  3MVD B;  4WF0 A;  2OLU A;  2VJW A;  5B2J C;  4I3A A;  3X1V D;  3L27 A;  4KZ3 A;  3KXB A;  1KX5 B;  3LEL D;  1G6A A;  3C1C B;  3W98 B;  4GD8 A;  4KGC B;  3LJA C;  2ZM8 A;  3MGQ B;  3PBN A;  3TU4 B;  1H5X A;  2G5I C;  1BZA A;  1Q9C A;  1ALQ A;  3O88 A;  3MZF A;  2K7S A;  3Q7V B;  5EUA A;  3PBT A;  1CF0 A;  3F1N A;  2EXA A;  3KXB D;  3MGP B;  4MNR A;  4R4R A;  3B3X A;  1KX3 C;  3MS6 A;  3A0V A;  1FR6 A;  2NZD B;  2P08 A;  1KE3 A;  3PHY A;  1YLZ A;  4R4S A;  2J9P A;  5EFW A;  4CLC E;  1OTB A;  3AZK A;  1KX3 B;  1NXY A;  2V1Z A;  2JCH A;  5B24 B;  5AY8 A;  5EVI C;  4GW9 A;  4X55 A;  4S2P A;  4NXB A;  1XA1 A;  4CLC A;  3IQA A;  1G68 A;  2VGL M;  4JJN C;  1K56 A;  1QMF A;  3UMD A;  3CHW P;  3AZK D;  4HEF A;  2ZY4 A;  1ESU A;  1P9W A;  4KZ8 A;  5TR7 A;  3REL A;  3W4P A;  5AVC B;  4KZ6 A;  4LCL A;  5E5A D;  2H0Y A;  5AY8 D;  2VKS A;  3PR6 A;  3WA9 D;  3UE3 A;  4EO5 C;  4CLC D;  4OOL A;  2F8N G;  1H0I A;  2WKE A;  3X1T B;  1M1A C;  1S6R A;  3A0S A;  3NDE A;  1K56 D;  1KOU A;  1P3G C;  2F2A C;  4JJN B;  1P3O B;  4RQ9 A;  4MDZ A;  4J8W A;  3REL D;  4HP4 A;  3REK A;  4S2O A;  2J7V A;  4EES A;  2LY8 A;  2YFV B;  4E6X A;  3S7O A;  2GDN A;  1SKO A;  5GLB A;  4EO5 B;  1M18 B;  4LD9 C;  3AFA D;  1E6P A;  5EEC A;  3NIA A;  3PBO A;  4H9P B;  4IBG A;  4E3I A;  1O6I A;  2EWW A;  3G30 A;  1P3G B;  3B33 A;  4J8W D;  3ISG A;  5CPI A;  5HSQ A;  3UB8 A;  3H0M C;  4Y3I A;  3OZH A;  3AYW B;  4NXF A;  5E43 A;  5B1L C;  3WKJ A;  2V20 A;  1C3B A;  4EBN A;  4M3K A;  1P3K C;  3FYZ A;  4BQM A;  3AZH B;  4DRA A;  3AGD A;  5BNV B;  3LY4 A;  3L26 A;  2L4R A;  5DKK A;  3H7W B;  1TS6 A;  1P97 A;  2ZQ7 A;  5CPI D;  3AGE A;  1FR1 A;  3D3O A;  1VQQ A;  3WKJ D;  2G2W A;  5C3I C;  4IBX A;  4OKP A;  4WU9 B;  2ZQ9 A;  3KYQ A;  2B95 A;  3G35 A;  4YS3 C;  3GMW A;  1YT4 A;  3VP2 A;  1KE4 A;  2RIQ A;  3TRC A;  1LL5 A;  1CI8 A;  3ZG7 B;  3UN7 A;  5EM1 A;  4IJE A;  3ZDJ A;  3AN2 A;  2XFS A;  2HIO C;  5B31 A;  5E2H A;  2V1B A;  3WS2 A;  1G6O A;  3REI A;  4L9G A;  4O7D A;  1CK7 A;  1F1E A;  3V3R A;  5G49 A;  4IBI A;  2FJ7 A;  1YAX A;  3BY9 A;  4HH3 A;  3HLW A;  4UQI M;  5HPI A;  1EQZ C;  2XEP A;  4S2N A;  3A3J A;  3AN2 D;  1MC0 A;  4BJP A;  2HIO B;  2H5S A;  5B31 D;  3CJM A;  2BYK A;  3T4O A;  1XJ2 A;  1AOI C;  5AV6 C;  2O9A A;  1BLP A;  2HP5 A;  4ZRR A;  3JPU A;  1I5Q A;  5J3W A;  2W3H A;  4Z2M G;  4K0W A;  5HX9 A;  5HAP A;  1ZG6 A;  1DP6 A;  2ZQA A;  5CPJ B;  1ONG A;  1HVB A;  2Y2Q A;  5GXQ A;  4F3L A;  3IF6 B;  3BYD A;  1UWN X;  2ZM2 A;  3UTB B;  5EE8 A;  3W97 C;  3MXQ A;  2ZL1 A;  4LV2 A;  5DF8 A;  3ZCZ A;  1AOI B;  4KG5 A;  5AV6 B;  2BYM A;  2CV5 A;  5AV9 A;  2K2N A;  4WU8 A;  4N9K A;  1J9M A;  1W5D A;  3BWL A;  4JXV A;  4GKU A;  4S2K A;  1KX4 C;  1K57 A;  5GXQ D;  3LZ0 C;  5FAT A;  1TS8 A;  3ZG0 A;  4HES A;  3OBF A;  2VLG A;  4GHI A;  3VE4 A;  2FH5 A;  4YIN A;  4KHA B;  3VV4 A;  4E3K A;  3WS4 A;  3B6G B;  3ZG8 B;  2CV5 D;  1YLJ A;  5AV9 D;  4WU8 D;  2ZY5 A;  3DBA A;  1N1J B;  2M1C A;  3EGX C;  1KS0 A;  3B6F A;  4IBE A;  3LYX A;  4UPK A;  5B33 D;  2BAS A;  4EUV A;  5CEC A;  3GTC A;  2YKH A;  4N92 A;  3BLM A;  2C5W B;  1LT0 A;  1K6R A;  5KMW A;  4GZB A;  1PFL A;  1GA9 A;  5F99 C;  2WGI A;  3B6F D;  2JE5 A;  3WAA D;  2EXB A;  4WNN B;  1AXB A;  5I5L A;  2C6W B;  4DF6 A;  4JLF A;  2JKF A;  5B2I A;  5AV8 B;  3W96 C;  3AV1 A;  3MGR C;  4R70 A;  4J8V A;  3P09 A;  2F8N B;  5AVB A;  4Z66 A;  3MVD A;  5E2G A;  2E8J A;  5HFO A;  4LG2 A;  3IH8 A;  2VQR A;  3OCN A;  4BMW A;  5B2I D;  1XA7 A;  5B1M B;  2OOL A;  3B0D B;  3AV1 D;  1KX5 A;  1GOI A;  1YKD A;  3DTE A;  4J8V D;  5FDH A;  3R45 A;  5AVB D;  1H8M A;  3C1C A;  4Z66 D;  1BH9 B;  3V3S A;  1BLS A;  1U35 B;  4KGC A;  4K91 A;  4UUZ A;  3AZG C;  3MVD D;  2XQZ A;  4CAY A;  5K5B A;  4WEK A;  2CMN A;  1RCJ A;  5B2J A;  5GSU C;  5B0Y B;  5B0Z C;  4QY5 A;  2HUE B;  2W3G A;  1KX5 D;  3FWL A;  2XD5 A;  4XUJ B;  1P3I C;  3MGS B;  4HOI A;  4OH0 A;  3C1C D;  4GCZ A;  4KGC D;  4ZJ3 A;  4X23 C;  1BTL A;  3VP0 A;  3O62 B;  2WZX A;  3EPJ A;  3LJA A;  4IJG A;  4YOF A;  4NXG A;  4UA6 A;  5HDS A;  4Q8I A;  3M6B A;  5B2J D;  3PXP A;  3HL9 A;  3MGP D;  1RGZ A;  3KSH A;  1FIL A;  4LCM A;  2P7J A;  4PM5 A;  1JFI B;  1YU2 A;  3TW8 A;  3X1U C;  1P3L B;  5D3O A;  4LGW A;  1KX3 A;  1Z2C B;  2A49 A;  2XF3 A;  2JKG A;  1FQG A;  3UTA B;  3UDI A;  4MEZ A;  1S66 L;  2Q9N A;  1T19 A;  1ZG4 A;  5B32 B;  2XSS A;  1W79 A;  3DAV A;  1H8Y A;  1PI4 A;  3RFB A;  1KX3 D;  3NQU B;  5E5A C;  5IT5 A;  5B24 D;  3CG5 A;  3X1U B;  3WA9 C;  3CMZ A;  5EVI A;  4TX8 A;  3N8L A;  3KSY A;  4H9Q B;  5GLC A;  5M1A A;  1ULY A;  4P0M A;  1MWT A;  5F69 A;  3MF0 A;  1ZLA C;  3A0R A;  4Y0T A;  4JXG A;  4G3V A;  3W4O A;  3A3D A;  5KZH A;  2Y8H A;  4Y15 A;  2YFV A;  5AVF A;  4UEY A;  4O0P A;  5EVI D;  2WK0 A;  1MXO A;  3AFA C;  2NUP C;  1K4E A;  4BEN A;  5G18 A;  3AZF C;  3N8R A;  4NKP A;  1M1A A;  5HWV A;  2NQB B;  4JJN D;  1YU3 A;  3Q07 A;  1P3G A;  4Z2L A;  3MBZ A;  1NRF A;  1YU0 A;  2RCX A;  4PMA A;  2V5O A;  1YUE A;  5A90 A;  3FC7 A;  1BH8 A;  5CP6 B;  4FCF A;  5HDC A;  5JRG C;  1I2W A;  1J7M A;  4LD9 A;  2Z6C A;  4J8X C;  1M1A D;  1LSW A;  5AQA A;  1PWG A;  2F8N H;  1P3G D;  4H9N A;  3HCY A;  3O87 A;  3AYW D;  3AZJ C;  4Z2G A;  1TAF A;  3C30 A;  2G2U A;  5B1L A;  4DE0 A;  2ZMF A;  3MKF A;  3OPR A;  1P3K A;  1CK3 A;  4Y5F A;  4LD9 D;  3IBJ A;  1IKI A;  5AQ9 A;  1A7W A;  2JKR M;  5CRF A;  5GL9 A;  3MXS A;  5B1L D;  2HP6 A;  3UE1 A;  3ZVT A;  1JTD A;  2HJE A;  4FH2 A;  4HJ4 A;  3OPL A;  3H0L C;  5EOO A;  4ZBE A;  3R7W A;  4GH9 A;  4YS3 A;  1ID3 C;  3P7N A;  4DRB A;  1YLY A;  3ZHH A;  4KG2 A;  4MBH A;  1VET B;  1MZU A;  1KVM A;  3B47 A;  3AZL C;  4XZQ C;  2HGV A;  1MKI A;  1O7E A;  5U47 A;  1WE4 A;  3VMA A;  2WAD A;  3B0C W;  2L0W A;  4YS3 D;  2R9X A;  3LZ1 C;  1CJF A;  3AV2 B;  1ID3 B;  1VEU B;  2HIO A;  1D1J A;  5KSH A;  3G31 A;  2WGW A;  4WEJ A;  3X1S C;  4MN5 A;  3PYP A;  5B40 C;  1PWD A;  4B93 A;  5DNM C;  3WD3 A;  1BSG A;  5HAR A;  1CEG A;  2VV7 A;  1N9O A;  3T50 A;  4HY8 A;  2QKP A;  1EQZ A;  3B0C T;  1ES5 A;  4J8U B;  3LZ1 B;  2RL3 A;  2HIO D;  4Z2I A;  2W0N A;  3NJA A;  3DTI A;  5DFY A;  1N4O A;  4S2L A;  4I3I A;  4O8G A;  4GOG A;  4NZ1 A;  3WTP C;  4GHL A;  3X1S B;  5B40 B;  5A93 A;  3EPK A;  3G4P A;  4H9O A;  5AV6 A;  1OT9 A;  5MC7 A;  3UB9 A;  4OQH A;  3PBR A;  1EQZ D;  1XXM A;  4KQO A;  4HHD A;  1Y4O A;  5HDD A;  1CEF A;  3B42 A;  1P3P B;  3VFF A;  3V50 A;  3KWQ C;  3W97 A;  3NI9 A;  1AOI D;  2W3F A;  5AV6 D;  1P3F B;  3IP4 C;  4R23 A;  2W8S A;  2X02 A;  3KUY B;  3WD4 A;  1KX4 A;  1TZY C;  3NY4 A;  3LZ0 A;  5CEB A;  4LLO B;  4Z2M H;  4Q0J A;  2ZMA A;  5B33 C;  3UT9 C;  2RTS A;  1NY0 A;  2QMI A;  3G2Y A;  3W97 D;  2FN2 A;  3UDF A;  2PT7 A;  3A3E A;  1ACF A;  4QLC C;  2XLN A;  5J7E A;  4PM9 A;  3C1B B;  2PR5 A;  1YU4 A;  3LIA A;  4I39 A;  3E0Y A;  4JF5 A;  3GR2 A;  2Q9M A;  1KX4 D;  3LZ0 D;  1SKF A;  1U60 A;  3S7P A;  3UT9 B;  4A5R A;  2DCF A;  1JNU A;  1GA0 A;  1PRQ A;  3GQZ A;  3IHA A;  1P3B B;  5FQJ A;  3SH8 A;  4HJ6 A;  4PKY A;  3BQ8 A;  3MFX A;  4H6J B;  1TDG A;  2OSU A;  2KLI A;  5BNX A;  3WD2 A;  2HV1 A;  4X56 A;  4B9O A;  5F99 A;  2WKP A;  3WS1 A;  5DF7 A;  1MWR A;  1JWZ A;  4S2I A;  4X1L A;  4XUZ A;  3T4K A;  3A3I A;  1D06 A;  1XGI A;  3SS3 A;  3W96 A;  4II7 A;  5C5K A;  2YFW B;  2PR6 A;  3MGR A;  3NDG A;  5GLA A;  2CC1 A;  1EAK A;  3WRZ A;  5F99 D;  1ERM A;  4WN5 A;  5HD3 A;  2WYX A;  1N9N A;  4DE1 A;  2XGN A;  1BYW A;  5HW3 A;  2Y59 A;  3IXB A;  3W96 D;  1OPX A;  4MB4 A;  3MGR D;  1F98 A;  1GXD A;  3W98 C;  1IYS A;  3UB6 A;  1IEM A;  3MGQ C;  3TU4 C;  5JYO A;  3AZG A;  4EWF A;  3MGP C;  1H8P A;  5GSU A;  4ETX A;  2V0W A;  1JFI A;  3UPO A;  3H82 A;  5B0Z A;  3MGS D;  5KSC A;  1P3I A;  1YLP A;  1UR8 A;  2NZD C;  2FZ0 A;  2CWE A;  2A3U A;  3AZG D;  4X23 A;  3V9R B;  2EFU A;  1I2S A;  3MNN C;  5GSU D;  3FG8 A;  3ZQ5 A;  2DQN C;  5B0Z D;  2J9O A;  3PAE A;  4DQY B;  1YPR A;  2P9V B;  2IWB A;  5B24 C;  3X1U A;  1P3I D;  1LLB A;  4HMC A;  2W27 A;  3MZE A;  4EBP A;  2IA2 A;  4H9Q A;  4X23 D;  2OWH A;  5BPV A;  4M4X A;  3AZE C;  4DXB A;  1NZO A;  3UB5 P;  1FSY A;  3Q82 A;  4Y17 A;  4G91 C;  3MNN B;  3M6H A;  3RJU A;  5AVC C;  3REJ C;  2L5A A;  3X1U D;  4GD6 A;  5HD5 A;  3SH9 A;  3AZM B;  5E5A A;  3S22 A;  3IX3 A;  1XJ4 A;  3WA9 A;  3WRT A;  4GNU A;  4IBC A;  4R3B A;  2QZ6 A;  4FTX A;  4HIA A;  3X1T C;  2HP9 A;  5CXW A;  4EUZ A;  1A0K A;  3AZE B;  1WWS A;  5DNN C;  5FL3 A;  3T12 B;  1P3O C;  3MJQ A;  4G91 B;  1ZLA A;  4NE3 A;  5EOE A;  2JSS A;  3REJ B;  2IWC A;  2RVQ C;  3BFG A;  3JYI A;  3OCL A;  3UDX A;  5BO0 B;  4YM6 B;  1F66 B;  3M2K A;  1M18 C;  5FUG B;  2PDR A;  3AFA A;  3A6N C;  1KDW A;  4DDY A;  2B02 A;  3Q1F A;  3AZF A;  5DNN B;  3RH8 B;  1W63 Q;  3EPH A;  5FQ9 A;  3U2A A;  1ZLA D;  2HF6 A;  1S1Y A;  3AYW C;  3ZNT A;  1H8Z A;  4ZAM A;  1K54 C;  3WX7 A;  3AZH C;  1GSW A;  5JRG A;  4XUX A;  4E3O A;  3A6N B;  4J8X A;  1XKZ A;  3AZF D;  1HZO A;  1J3W A;  1FCN A;  3W2Z A;  2I72 A;  3A1I A;  1ES3 A;  1K55 C;  3AZJ A;  4HI4 A;  3GV9 A;  1P34 B;  4WU9 C;  4CSR A;  2A24 A;  4KQD A;  4IVI A;  5JRG D;  5FAP A;  4FD8 A;  4J8X D;  3V67 A;  2V9A A;  1SDN A;  3UO9 A;  1TS0 A;  4E45 A;  3AZJ D;  1IEL A;  3N6I A;  5GT3 B;  3K2N A;  5M18 A;  4EBL A;  1PW8 A;  5FQK A;  4RA7 A;  5EV0 A;  3NHQ A;  2D01 A;  1P0Z A;  4Z9Q A;  2EA9 A;  4I5S A;  3AZL A;  3MFD A;  3KO6 A;  4Y0U A;  4XZQ A;  3F1P B;  4OQI A;  1K6S A;  3AGF A;  1FOF A;  2PBD P;  3AZI B;  3UY6 A;  3GRJ A;  5KDM B;  1PYY A;  1ID3 D;  3H9W A;  3LZ1 A;  1P3M C;  1S4S A;  4XT2 B;  1HTZ A;  3NQJ A;  1W1V A;  5CX7 A;  3VOZ A;  4L9E A;  3X1S A;  3AZL D;  5B40 A;  4XZQ D;  1DP8 A;  5DNM A;  5HAI A;  3N7W A;  1WA9 A;  4HBT A;  5GHZ A;  3WTP E;  4HJ3 A;  3LZ1 D;  5CPJ C;  3UB7 A;  4H9R A;  4GS9 B;  1JVJ A;  3IF6 C;  4UA9 A;  1H3Q A;  4X6T A;  5DTS A;  1P3M B;  3UTB C;  3P01 A;  2OV5 A;  2GNX A;  1B67 A;  3X1S D;  5HL1 A;  5B40 D;  4NK3 A;  3WTP A;  3F1O A;  5DNM D;  3REH B;  1E88 A;  1W2E A;  3CPT A;  5JA4 B;  1S32 B;  2B5R A;  5FI2 A;  1AWI A;  1DY6 A;  1L0D A;  5G4Y A;  1H0G A;  1BT5 A;  3PBS A;  5AQB A;  3B6G C;  3WTP D;  3KWQ A;  1XPB A;  3GDI A;  5HAQ A;  3R4K A;  4EV4 A;  3BLS A;  1SZV A;  2PYP A;  3IT9 A;  2GX5 A;  4D60 A;  3UE6 A;  1TZY A;  4KUD B;  4MBF A;  4OOM A;  4NY2 A;  5B33 A;  4ZUX B;  3UT9 A;  1OGG A;  1F2K A;  4C3Q A;  3KWQ D;  3BFD A;  5IHV A;  4JXS A;  2Y2N A;  4H8R A;  3FPW A;  2PD7 A;  4L9F A;  4GB7 A;  4H6J A;  4DN0 A;  4QLC A;  1LHY A;  1OME A;  3MKE A;  5IS1 A;  5TBM B;  5JYP A;  2X71 A;  3HUO A;  3WAA A;  1TZY D;  2PAV P;  4NYU A;  2J3W A;  3UT9 D;  3MZD A;  4KZ7 A;  2IOU A;  5AV8 C;  1T1B A;  3BEC A;  2PYO B;  4QLC D;  4WZ5 C;  2HPB A;  2MJ6 A;  3N8S A;  2DNS A;  1HTA A;  4PM8 A;  3WD1 A;  1ZKJ A;  5L8M A;  5B1M C;  3VFH A;  3B0D C;  1GSV A;  3DTM A;  4N9L A;  5EVE A;  5CPK B;  3Q81 A;  3QP5 A;  4HGA C;  1L0F A;  1U35 C;  3BY8 A;  2ARO B;  2A2L A;  3O86 A;  1OJG A;  4X25 A;  3MR0 A;  3EQV A;  5HPF A;  1H3O B;  4E3L A;  1P9R A;  5B0Y C;  4H9S C;  4U3T A;  1E4D A;  2HUE C;  3QNB A;  3VE3 A;  4R8P B;  3W4Q A;  3NEC A;  4XUJ C;  3MGS C;  4QD4 A;  1NJ4 A;  2KOI A;  4KUK A;  4HGA B;  5FAQ A;  3W98 A;  3O62 C;  2XRN A;  3MGQ A;  3TU4 A;  1YSP A;  4OQG A;  3Q7V A;  2JC7 A;  3NOP C;  3MGP A;  1P3L C;  4IBB A;  3DW0 A;  1ERQ A;  1W1P A;  1AIW A;  3UTA C;  5B31 G;  3MQQ A;  3W98 D;  3IS2 B;  3QP1 A;  2NZD A;  4WBG A;  3MGQ D;  2ZC5 B;  3TU4 D;  1WYC A;  1QO6 A;  5B32 C;  1SCW A;  3LY3 A;  3MNN A;  3TE8 A;  2Y79 A;  1VB6 A;  3X1V B;  5B24 A;  2GJ3 A;  4E3N A;  4ARZ B;  5KIZ A;  2NZD D;  2ZJ9 A;  3C2W A;  5EPH A;  5AVE A;  4OPR A;  1E25 A;  4NET A;  4QWO A;  5GLD A;  1MPL A;  3AZE A;  4NEE D;  1Q2P A;  5F83 A;  2XRO A;  3N3F A;  3MNN D;  2PRF A;  2I9V A;  5F1G A;  2D02 A;  1ODV A;  1XX2 A;  1BFM A;  3T1Q B;  5AVC A;  3REJ A;  5GT0 C;  4KQQ A;  3KXB B;  2J8P A;  1V9Z A;  1YU1 A;  5CED A;  5FUG A;  4BD1 A;  1EI5 A;  3AZE D;  3LIF A;  5CHL B;  3X1T A;  1RP5 A;  1KVL A;  3C7U A;  3QP2 A;  4Y0O A;  2NQB C;  5DNN A;  1OJ5 A;  4GDN A;  4KZB A;  4JJN A;  1P3O A;  4P6B A;  4Q0I A;  5HWT A;  2J8Y A;  4MBK A;  3WD0 A;  4KZ4 A;  3F1N B;  4JKT A;  5AVC D;  3REJ D;  2QYB A;  4MCW A;  4CJN A;  3UME A;  2ZM0 A;  4JGQ A;  5GT0 B;  1K25 A;  3FDD A;  1TDL A;  4FSF A;  1Q2Q A;  5CP6 C;  2Y2L A;  4YFM A;  5F68 A;  1M18 A;  4H9P A;  3X1T D;  2R78 A;  4OP5 A;  3G2Z A;  3A6N A;  2V8F A;  2JKT M;  4BD0 A;  4ETZ A;  4ZBJ C;  5DNN D;  2V1A A;  1P3O D;  3T1R A;  3WS5 A;  4BBV A;  1RGY A;  1OTI A;  5AQ7 A;  3L2A A;  3AYW A;  3AZK B;  2RVQ D;  1XP4 A;  1K54 A;  3IWQ A;  1M18 D;  5AY8 B;  3AZH A;  3A6N D;  5BNV A;  4CLC B;  1TD5 A;  1QME A;  3T4Q A;  4ZBJ B;  3BJN A;  3H7W A;  5DJU A;  1FIK A;  3KX0 X;  3HLF A;  4IUK A;  1EWZ A;  1XJ3 A;  2F8N K;  3BW6 A;  1K55 A;  4AWL C;  1YLT A;  4IUH A;  4WU9 A;  4Z1W A;  5I94 A;  3O5Y A;  3AZH D;  2KDK A;  2VV8 A;  2XR0 A;  4BL2 A;  4BBT A;  3PTE A;  3E98 A;  4KZ9 A;  4C75 A;  3REK B;  3EWK A;  4CPK A;  4WU9 D;  1NWZ A;  4UA7 A;  4LFU A;  4AWL B;  3FKW A;  4WZ4 A;  2EX6 A;  2Y2P A;  3QP8 A;  2KX6 A;  3AV2 C;  1SKO B;  4WV4 B;  3IH9 A;  3PBQ A;  5FDS A;  5J4E A;  4ME4 A;  2ZC4 B;  1GHP A;  3LIB A;  4YNR A;  4OQ0 A;  2PD8 A;  5E2E A;  3T4L A;  4E3M A;  3VP3 A;  1TF1 A;  1JWV A;  3VP4 A;  3LR0 A;  4MLL A;  3WKJ B;  3AZI D;  3RXW A;  4OPY A;  3K3D A;  3ZVW A;  3MQ0 A;  4J8U C;  3FKE A;  1OTD A;  3P5J B;  4WL9 A;  3OLO A;  1P3M A;  4QJG A;  2Y2M A;  1DJC A;  4Z2J A;  4RYE A;  1BLC A;  1E3U D;  2PHY A;  1ES2 A;  1PIO A;  1PDC A;  4D2O A;  5JA4 A;  4E6W A;  5FA7 A;  1O07 A;  3KSI A;  5CPJ A;  2WKH A;  3DWZ A;  1P3M D;  3VP1 A;  3IF6 A;  1P3P C;  5L10 A;  3UTB A;  5CER A;  4NYY A;  1GSX A;  3KSF A;  2J3T C;  1IYO A;  1P3F C;  1AOI A;  1ONH A;  4OUI A;  1NZU A;  5CGS A;  2WZZ A;  4OJ6 A;  4IJF A;  3KUY C;  1LL8 A;  4ZJ1 A;  2ZMV A;  5CPJ D;  1E15 A;  3BQA A;  1HQ3 C;  2ACG A;  3UTB D;  2HZ5 A;  4KHA A;  3VH5 W;  2Y91 A;  4NZ5 A;  3DTK A;  3B6G A;  5B31 B;  1ZC2 A;  4F94 A;  2GZA A;  3ZG9 B;  3REI B;  2VZW A;  2V0U A;  3G34 A;  5G49 B;  4OLG A;  3C1B C;  2QJ5 A;  1N1J A;  3O3V A;  5TBM A;  2FJ7 B;  1Z09 A;  2LB5 A;  3E4O A;  4EER A;  1SDE A;  1W1T A;  3TOI A;  4QHC A;  1HQ3 B;  4ZUX D;  1S67 L;  1L3L A;  2HJ9 C;  2XA7 S;  3H0R C;  3B6G D;  3LID A;  3VH6 W;  3HJI A;  3TJZ C;  1P3B C;  4DE2 A;  3VH5 T;  2BYK B;  3BFE A;  5FI7 A;  4OLD A;  4G92 B;  3FV7 A;  3FZC A;  3HJK A;  2QPN A;  2XD1 A;  2VA0 A;  4WNN A;  2Y2J A;  3IBR A;  5GHY A;  1FCO A;  4F3L B;  5GXQ B;  5AV8 A;  3LEZ A;  1F5M A;  1IYP A;  1HD8 A;  3VH6 T;  4R38 A;  4MN7 A;  2ZL1 B;  3QP6 A;  2F8N A;  1ED7 A;  2BYM B;  3PAG A;  2CV5 B;  4WZ5 A;  4WU8 B;  1NLZ A;  3WS0 A;  4BLM A;  2EX2 A;  5IU1 A;  2VEA A;  1E6R A;  2WKQ A;  4RVA A;  5AV8 D;  5AJG A;  2LB9 A;  4HME A;  5B1M A;  4GHI B;  3RTY A;  2F8N D;  2W3D A;  4IBJ A;  3EEA A;  3L9K A;  1BH9 A;  5F5Y A;  1U35 A;  1IOU A;  1KGF A;  3W99 C;  4IBR A;  2Y2O A;  2HDU A;  3B6F B;  3I7J A;  2E8I A;  5B0Y A;  4H9S A;  2M7U A;  2QHK A;  5B1M D;  2PU2 A;  4NZ4 A;  4XUJ A;  3MGS A;  4QNL A;  3BM6 A;  3JVV A;  3QNC A;  3IS2 A;  1H0M A;  1U35 D;  4NE6 A;  1ESI A;  3O62 A;  5DTT A;  4R3A A;  3W99 B;  4YWZ A;  5B0Y D;  3L25 A;  5DKL A;  4XUJ D;  1P3L A;  3IWI A;  5B2I B;  4I3J A;  4EET B;  3UTA A;  5FQI A;  5LBR A;  3O62 D;  1PNE A;  4J8V B;  1ZHH B;  4R6L A;  3C5A A;  1JWP A;  4Z66 B;  2HDS A;  3LI9 A;  4M6B A;  2ZBB A;  5B32 A;  2IO5 C;  3F6T A;  3T4T A;  4HH2 A;  1P3A C;  2XFT A;  1P3L D;  3OPP A;  3NQU A;  3AZM C;  4PHT A;  3UTA D;  5M19 A;  1MY8 A;  3HLB A;  3R45 B;  5HWW A;  1YSQ A;  5B32 D;  4UUZ B;  4WZS B;  1F9I A;  4CAY B;  2IO5 B;  3E2K A;  3EEH A;  4JF6 A;  4LRY C;  1P3A B;  1NYM A;  2VK3 A;  1WYB A;  5B2J B;  4E3J A;  4EEP A;  5GT0 A;  4GJ4 A;  4YM6 C;  1F66 C;  4IBK A;  1UWP X;  4Z5T C;  1T1A A;  3JVU A; 
#chains in the Genus database with same CATH homology
 2NQB A;  3LJA B;  4OJL A;  5EVL A;  1ES4 A;  5GT0 D;  4BL3 A;  4Z5T B;  5CP6 A;  3AZN C;  2WUQ A;  4IVK A;  1LL9 A;  1S0W A;  2NQB D;  1P34 C;  1KGE A;  3GSG A;  5CP6 D;  5FQM A;  4N1H A;  3AZN B;  5EVI B;  3LCE A;  2EFX A;  1LI9 A;  3HBR A;  3Q7Z A;  3NC8 A;  1ERO A;  5DTK A;  5GT3 C;  1KDS A;  5BT1 C;  3EQU A;  1WWI A;  2Y55 A;  1M1A B;  1GCE A;  5TFQ A;  3TSG A;  2WAF A;  3REK D;  3AZI C;  3P98 A;  5FI6 A;  1BH8 B;  2H0T A;  3AV2 A;  3M2J A;  4OP8 A;  1ID3 A;  4LD9 B;  4ZTK A;  3C7V A;  5DF9 A;  2ZQ8 A;  4H9N B;  4P87 A;  1TAF B;  5B1L B;  5AV5 C;  3AV2 D;  1P3K B;  4N1X A;  4J8U A;  2ZY2 A;  3EG5 B;  4WYY A;  1KE0 A;  5CGX A;  3OC2 A;  3A3F A;  3ZG5 A;  3N4I A;  3REH C;  5B32 G;  3SS5 A;  1S32 C;  1Y54 A;  4EQI A;  3RXX A;  5C3I B;  5AV5 B;  4J8U D;  2VGJ A;  4YS3 B;  1TEM A;  4ZDX A;  1P3P A;  2WKI A;  3OPH A;  3A1K A;  5CTM A;  3EPL A;  5BS7 C;  2G5H C;  1P3F A;  3E2L A;  2BG1 A;  2DF4 C;  3NCK A;  3KUY A;  1IKG A;  3IXH A;  4KUD C;  4DDS A;  5F1F A;  4ZUX C;  1HQ3 A;  1P3P D;  1DJB A;  2DRW A;  3HUN A;  3ZGA B;  4GDB A;  2WGW B;  1P3F D;  2PU4 A;  3REI D;  4UAA A;  3C1B A;  2FJ7 D;  3KUY D;  2OLV A;  1PZP A;  3W8K A;  3B0B A;  3LO7 A;  3UE0 A;  1EQZ B;  1HQ3 D;  2ZD8 A;  4WJ3 C;  2PYO C;  3SS4 A;  1P3B A;  1PW1 A;  4ZJ2 A;  3C1B D;  4H9O B;  1TVF A;  3HLE A;  2V2F F;  4WEL A;  4B88 A;  3UPP A;  5CPK C;  1P3B D;  4JXW A;  1KGG A;  3W97 B;  2YFW A;  2FFF B;  4RX2 A;  2ARO C;  3HLG A;  2ZQD A;  3BFC A;  1T3U A;  1PZO A;  4R8P C;  1KX4 B;  3LZ0 B;  1FSW A;  3V5M A;  1MWS A;  5CTN A;  1GHI A;  4WM9 A;  5FAO A;  3BRM A;  3DWK A;  3W99 A;  4OON A;  4OJ5 A;  1LI0 A;  4XXR A;  1YMX A;  3ZFZ A;  5FQQ A;  5J8X A;  3V9R A;  1M19 C;  1JTG A;  5BNX B;  3BEB A;  3W99 D;  1NYY A;  1N9B A;  1YMS A;  5F99 B;  4PM7 A;  3X1V C;  2WGV A;  2ZC7 A;  2XH9 A;  2P9V A;  5FSR A;  1R4V A;  2ZY3 A;  4S2M A;  3W96 B;  3LEL C;  3MGR B;  1L0G A;  4DXC A;  5FAS A;  1M19 B;  4R1G A;  2Z2L B;  4NFT A;  1P3A A;  3KXB C;  4R3J A;  3AZM A;  5CHM A;  4FH4 A;  3LEL B;  4IBD A;  1MWU A;  3G32 A;  5F82 A;  1DJA A;  3AZG B;  3IHB A;  1P3A D;  1K38 A;  1FCM A;  5GSU B;  3AZM D;  5DVA A;  3SOI A;  5B0Z B;  5BO0 A;  4YM6 A;  1F66 A;  4OJO A;  1M40 A;  4Z5T A;  1P3I B;  2WAE A;  3LJA D;  2HDR A;  4X23 B;  4C6Y A;  3IWO A;  4Y7P A;  1YLW A;  4DKI A;  3KS8 A;  2Z2M B;  4OPZ A;  5A91 A;  3AZK C;  4JBF A;  4YM6 D;  1F66 D;  4Z5T D;  5AY8 C;  3AZN A;  4RX3 A;  3ITB A;  4GN2 A;  1BLH A;  4X68 A;  3GVB A;  4GHA A;  2JBF A;  4HBU A;  4WMC A;  5CGW A;  5BOH A;  3HRE A;  2Y2G A;  3REL C;  4K0X A;  2PBY A;  1KU5 A;  1P34 A;  5E5A B;  3AZN D;  3UPN A;  3WA9 B;  4WMC D;  2BLS A;  1BUE A;  4X69 A;  4DRT A;  3HUM A;  4J8W C;  2ZC3 B;  3REK C;  1P34 D;  1ZLA B;  4LV3 A;  3REL B;  2Y4A A;  5GT3 A;  5GHX A;  1W8Y A;  3AFA B;  3AZF B;  1VM1 A;  2ZQC A;  5CPI C;  5L2F A;  4J8W B;  4NE5 A;  3WKJ C;  5GT3 D;  4L0L A;  4OVD A;  3AZI A;  1PI5 A;  4U0X A;  5KDM A;  5BT1 D;  5JRG B;  2ZM5 A;  2EX8 A;  2X01 A;  4J8X B;  3HLC A;  4KZA A;  5CPI B;  4LV0 A;  4DE3 A;  1E3U A;  3CZD A;  3AZJ B;  4KQR A;  2FFY A;  4CSR B;  1K4F A;  5AV5 A;  3ZNY A;  1P3K D;  1IYQ A;  4KEN B;  2VGK A;  3ITA A;  2P74 A;  3UNW A;  3SH7 A;  3REH A;  1YM1 A;  4LV1 A;  1BUL A;  1S32 A;  1CI9 A;  4JPM A;  5AV5 D;  2ZLY A;  4E44 A;  4NZ3 A;  3AN2 C;  5B31 C;  3D4F A;  2ZC6 B;  3REH D;  1M6K A;  3REI C;  5BS7 A;  3HLD A;  1S32 D;  3AZL B;  3VOY A;  4JF4 A;  4XZQ B;  2FJ7 C;  5CHJ A;  4S2N C;  3NBL A;  4KUD A;  3AN2 B;  1W8Q A;  4ZUX A;  4B4X A;  2R9W A;  4KG6 A;  1L2S A;  3L28 A;  4S2J A;  3NQJ B;  2HDQ A;  2Y2K A;  4G92 C;  5CHU A;  5DNM B;  2XK1 A;  2UWX A;  3AL0 C;  3KS4 A;  4KUD D;  3HVF A;  5GXQ C;  5TGF A;  4H9R B;  4QB8 A;  2PYO A;  3VH5 A;  3HON A;  3WTP B;  2Y2I A;  2XDM A;  2CV5 C;  3KFU G;  5AV9 C;  4WU8 C;  4U0T A;  5E2F A;  1L0E A;  3QHY A;  1K57 C;  1SHV A;  4OOY A;  2PYO D;  2EX9 A;  1B6W A;  3VH6 A;  5CPK A;  3KWQ B;  2ARO A;  3C4O A;  5AV9 B;  3IXD A;  1GHM A;  1PZR A;  1H3O A;  3B6F C;  1Z6F A;  4ID4 A;  3WAA C;  4R0Q A;  2IWD A;  4B4Z A;  4R8P A;  1TZY B;  3TG9 A;  4P85 A;  5B33 B;  5CPK D;  3VSL A;  3BFF A;  4IED A;  2ARO D;  1YQS A;  4OJP A;  3MXR A;  4QLC B;  4IBF A;  4QY6 A;  4LEN A;  4OPQ A;  3WAA B;  4R8P D;  3VSK A;  3IXG A;  5B2I C;  4PPR A;  3AV1 C;  1PWC A;  1XGJ A;  4KZ5 A;  4J8V C;  5AVB C;  4Z66 C;  1M19 A;  1W7F A;  3IF5 A;  3MVD C;  3HSH A;  3X1V A;  3C4P A;  4X53 A;  3V39 A;  1KX5 C;  5A92 A;  4PM6 A;  3FKV A;  4QU3 A;  3S4X A;  3AV1 B;  1MBL A;  4UHU A;  3LEL A;  3C1C C;  1M19 D;  2H10 A;  5AVB B;  4KGC C;  3S1Y A;  3WWX A;  2Y2H A;  3L29 A;  3MVD B;  2OLU A;  5B2J C;  3X1V D;  3L27 A;  4KZ3 A;  3KXB A;  1KX5 B;  3LEL D;  1G6A A;  3C1C B;  3W98 B;  4GD8 A;  4KGC B;  3LJA C;  2ZM8 A;  3MGQ B;  3PBN A;  3TU4 B;  1H5X A;  2G5I C;  1BZA A;  1Q9C A;  1ALQ A;  3O88 A;  3MZF A;  3Q7V B;  5EUA A;  3PBT A;  2EXA A;  3KXB D;  3MGP B;  4MNR A;  4R4R A;  3B3X A;  1KX3 C;  1FR6 A;  2NZD B;  1KE3 A;  1YLZ A;  4R4S A;  2J9P A;  3AZK A;  1KX3 B;  1NXY A;  2V1Z A;  2JCH A;  5B24 B;  5AY8 A;  5EVI C;  4X55 A;  4S2P A;  1XA1 A;  3IQA A;  1G68 A;  4JJN C;  1K56 A;  1QMF A;  3AZK D;  4HEF A;  2ZY4 A;  1ESU A;  4KZ8 A;  5TR7 A;  3REL A;  3W4P A;  5AVC B;  4KZ6 A;  4LCL A;  5E5A D;  2H0Y A;  5AY8 D;  3WA9 D;  3UE3 A;  4EO5 C;  4OOL A;  2F8N G;  2WKE A;  3X1T B;  1M1A C;  1S6R A;  3NDE A;  1K56 D;  1P3G C;  2F2A C;  4JJN B;  1P3O B;  4J8W A;  3REL D;  3REK A;  4S2O A;  2J7V A;  2LY8 A;  2YFV B;  4E6X A;  2GDN A;  5GLB A;  4EO5 B;  1M18 B;  4LD9 C;  3AFA D;  5EEC A;  3NIA A;  3PBO A;  4H9P B;  4IBG A;  4E3I A;  3G30 A;  1P3G B;  4J8W D;  3ISG A;  5CPI A;  3H0M C;  3OZH A;  3AYW B;  5E43 A;  5B1L C;  3WKJ A;  2V20 A;  1C3B A;  4EBN A;  4M3K A;  1P3K C;  3FYZ A;  4BQM A;  3AZH B;  4DRA A;  3AGD A;  5BNV B;  3LY4 A;  3L26 A;  2ZQ7 A;  3AGE A;  5CPI D;  1FR1 A;  1VQQ A;  3WKJ D;  2G2W A;  5C3I C;  4IBX A;  4OKP A;  4WU9 B;  2ZQ9 A;  3G35 A;  4YS3 C;  3GMW A;  1YT4 A;  3VP2 A;  1KE4 A;  2RIQ A;  1LL5 A;  1CI8 A;  3ZG7 B;  3UN7 A;  4IJE A;  3ZDJ A;  3AN2 A;  2XFS A;  2HIO C;  5B31 A;  5E2H A;  3WS2 A;  4O7D A;  3REI A;  1F1E A;  3V3R A;  5G49 A;  4IBI A;  2FJ7 A;  3HLW A;  1EQZ C;  2XEP A;  4S2N A;  3A3J A;  3AN2 D;  4BJP A;  2HIO B;  2H5S A;  5B31 D;  3CJM A;  2BYK A;  1AOI C;  5AV6 C;  1BLP A;  2HP5 A;  1I5Q A;  4Z2M G;  4K0W A;  5HX9 A;  5HAP A;  1ZG6 A;  2ZQA A;  5CPJ B;  1ONG A;  1HVB A;  2Y2Q A;  5GXQ A;  3IF6 B;  3BYD A;  2ZM2 A;  3UTB B;  5EE8 A;  3W97 C;  4LV2 A;  5DF8 A;  3ZCZ A;  1AOI B;  4KG5 A;  5AV6 B;  2BYM A;  2CV5 A;  5AV9 A;  4WU8 A;  4N9K A;  1J9M A;  1W5D A;  4JXV A;  4GKU A;  4S2K A;  1KX4 C;  1K57 A;  5GXQ D;  3LZ0 C;  5FAT A;  3ZG0 A;  4HES A;  4YIN A;  4KHA B;  4E3K A;  3WS4 A;  3B6G B;  3ZG8 B;  2CV5 D;  1YLJ A;  5AV9 D;  4WU8 D;  2ZY5 A;  1N1J B;  3B6F A;  4IBE A;  4UPK A;  5B33 D;  5CEC A;  3GTC A;  4N92 A;  3BLM A;  2C5W B;  1K6R A;  5KMW A;  4GZB A;  1GA9 A;  5F99 C;  2WGI A;  3B6F D;  2JE5 A;  3WAA D;  2EXB A;  4WNN B;  1AXB A;  2C6W B;  4DF6 A;  4JLF A;  5B2I A;  5AV8 B;  3W96 C;  3AV1 A;  3MGR C;  4J8V A;  3P09 A;  2F8N B;  5AVB A;  4Z66 A;  3MVD A;  5E2G A;  5HFO A;  4LG2 A;  3IH8 A;  2VQR A;  3OCN A;  5B2I D;  1XA7 A;  5B1M B;  3B0D B;  3AV1 D;  1KX5 A;  4J8V D;  5FDH A;  3R45 A;  5AVB D;  3C1C A;  4Z66 D;  1BH9 B;  3V3S A;  1BLS A;  1U35 B;  4KGC A;  4K91 A;  4UUZ A;  3AZG C;  3MVD D;  2XQZ A;  4CAY A;  4WEK A;  1RCJ A;  5B2J A;  5GSU C;  5B0Y B;  5B0Z C;  4QY5 A;  2HUE B;  1KX5 D;  3FWL A;  2XD5 A;  4XUJ B;  1P3I C;  3MGS B;  4OH0 A;  3C1C D;  4KGC D;  4ZJ3 A;  4X23 C;  1BTL A;  3VP0 A;  3O62 B;  2WZX A;  3EPJ A;  3LJA A;  4UA6 A;  4Q8I A;  3M6B A;  5B2J D;  3HL9 A;  3MGP D;  1RGZ A;  4LCM A;  4PM5 A;  1JFI B;  1YU2 A;  3X1U C;  1P3L B;  5D3O A;  1KX3 A;  1Z2C B;  2A49 A;  2XF3 A;  1FQG A;  3UTA B;  3UDI A;  4MEZ A;  2Q9N A;  1ZG4 A;  5B32 B;  1W79 A;  1H8Y A;  1PI4 A;  1KX3 D;  3NQU B;  5E5A C;  5B24 D;  3CG5 A;  3X1U B;  3WA9 C;  3CMZ A;  5EVI A;  3N8L A;  3KSY A;  4H9Q B;  5GLC A;  5M1A A;  1ULY A;  4P0M A;  1MWT A;  1ZLA C;  4Y0T A;  4JXG A;  5KZH A;  3W4O A;  3A3D A;  2YFV A;  5EVI D;  2WK0 A;  1MXO A;  3AFA C;  1K4E A;  4BEN A;  5G18 A;  3AZF C;  3N8R A;  1M1A A;  2NQB B;  4JJN D;  1YU3 A;  3Q07 A;  1P3G A;  3MBZ A;  1NRF A;  1YU0 A;  2RCX A;  4PMA A;  1YUE A;  5A90 A;  1BH8 A;  5CP6 B;  4FCF A;  5JRG C;  1I2W A;  4LD9 A;  4J8X C;  1M1A D;  5AQA A;  1PWG A;  2F8N H;  1P3G D;  4H9N A;  3O87 A;  3AYW D;  3AZJ C;  1TAF A;  2G2U A;  5B1L A;  4DE0 A;  3MKF A;  3OPR A;  1P3K A;  1CK3 A;  4LD9 D;  1IKI A;  5AQ9 A;  1A7W A;  5CRF A;  5GL9 A;  3MXS A;  5B1L D;  2HP6 A;  3UE1 A;  3ZVT A;  1JTD A;  4FH2 A;  3OPL A;  3H0L C;  5EOO A;  4ZBE A;  4GH9 A;  4YS3 A;  1ID3 C;  4DRB A;  1YLY A;  3ZHH A;  4KG2 A;  4MBH A;  1KVM A;  3AZL C;  4XZQ C;  1MKI A;  1O7E A;  5U47 A;  1WE4 A;  3VMA A;  2WAD A;  3B0C W;  4YS3 D;  2R9X A;  3LZ1 C;  3AV2 B;  1ID3 B;  2HIO A;  5KSH A;  3G31 A;  2WGW A;  4WEJ A;  3X1S C;  5B40 C;  1PWD A;  5DNM C;  1BSG A;  5HAR A;  1CEG A;  1EQZ A;  3B0C T;  1ES5 A;  4J8U B;  3LZ1 B;  2RL3 A;  2HIO D;  1N4O A;  4S2L A;  4GOG A;  4NZ1 A;  3WTP C;  4GHL A;  3X1S B;  5B40 B;  5A93 A;  3EPK A;  3G4P A;  4H9O A;  5AV6 A;  4OQH A;  3PBR A;  1EQZ D;  1XXM A;  4KQO A;  1CEF A;  1P3P B;  3VFF A;  3V50 A;  3KWQ C;  3W97 A;  3NI9 A;  1AOI D;  5AV6 D;  1P3F B;  3IP4 C;  4R23 A;  2W8S A;  2X02 A;  3KUY B;  1KX4 A;  1TZY C;  3NY4 A;  3LZ0 A;  5CEB A;  4Z2M H;  2ZMA A;  5B33 C;  3UT9 C;  1NY0 A;  2QMI A;  3G2Y A;  3W97 D;  3UDF A;  3A3E A;  4QLC C;  2XLN A;  4PM9 A;  3C1B B;  1YU4 A;  4JF5 A;  3GR2 A;  2Q9M A;  1KX4 D;  3LZ0 D;  1SKF A;  1U60 A;  3UT9 B;  4A5R A;  2DCF A;  1GA0 A;  3GQZ A;  3IHA A;  1P3B B;  5FQJ A;  3SH8 A;  1TDG A;  2OSU A;  5BNX A;  4X56 A;  5F99 A;  3WS1 A;  5DF7 A;  1MWR A;  1JWZ A;  4S2I A;  4XUZ A;  3A3I A;  1XGI A;  3SS3 A;  3W96 A;  2YFW B;  3MGR A;  3NDG A;  5GLA A;  2CC1 A;  3WRZ A;  5F99 D;  1ERM A;  2WYX A;  4DE1 A;  2XGN A;  5HW3 A;  2Y59 A;  3IXB A;  3W96 D;  3MGR D;  3W98 C;  1IYS A;  1IEM A;  3MGQ C;  3TU4 C;  5JYO A;  3AZG A;  4EWF A;  3MGP C;  5GSU A;  1JFI A;  3UPO A;  5B0Z A;  3MGS D;  5KSC A;  1P3I A;  1YLP A;  2NZD C;  2CWE A;  2A3U A;  3AZG D;  4X23 A;  3V9R B;  2EFU A;  1I2S A;  3MNN C;  5GSU D;  2DQN C;  5B0Z D;  2J9O A;  3PAE A;  4DQY B;  2P9V B;  2IWB A;  5B24 C;  3X1U A;  1P3I D;  1LLB A;  3MZE A;  4EBP A;  4H9Q A;  4X23 D;  5BPV A;  3AZE C;  4DXB A;  1NZO A;  1FSY A;  3Q82 A;  4G91 C;  3MNN B;  3M6H A;  3RJU A;  5AVC C;  3REJ C;  2L5A A;  3X1U D;  4GD6 A;  3SH9 A;  3AZM B;  5E5A A;  3S22 A;  3WA9 A;  3WRT A;  4GNU A;  4IBC A;  4R3B A;  2QZ6 A;  3X1T C;  2HP9 A;  5CXW A;  4EUZ A;  3AZE B;  1WWS A;  5DNN C;  1P3O C;  4G91 B;  1ZLA A;  4NE3 A;  5EOE A;  2JSS A;  3REJ B;  2IWC A;  2RVQ C;  3BFG A;  3JYI A;  3OCL A;  3UDX A;  5BO0 B;  4YM6 B;  1F66 B;  3M2K A;  1M18 C;  5FUG B;  3AFA A;  3A6N C;  1KDW A;  4DDY A;  3Q1F A;  3AZF A;  5DNN B;  3EPH A;  5FQ9 A;  1ZLA D;  3AYW C;  3ZNT A;  1H8Z A;  4ZAM A;  1K54 C;  3WX7 A;  3AZH C;  5JRG A;  4XUX A;  4E3O A;  3A6N B;  4J8X A;  1XKZ A;  3AZF D;  1HZO A;  1FCN A;  2I72 A;  3A1I A;  1ES3 A;  1K55 C;  3AZJ A;  3GV9 A;  1P34 B;  4WU9 C;  4CSR A;  4IVI A;  5JRG D;  5FAP A;  4FD8 A;  4J8X D;  1SDN A;  3UO9 A;  4E45 A;  3AZJ D;  1IEL A;  3N6I A;  5GT3 B;  5M18 A;  4EBL A;  1PW8 A;  5FQK A;  4RA7 A;  4Z9Q A;  3AZL A;  3MFD A;  4Y0U A;  4XZQ A;  4OQI A;  1K6S A;  3AGF A;  1FOF A;  3AZI B;  3UY6 A;  3GRJ A;  5KDM B;  1PYY A;  1ID3 D;  3LZ1 A;  1P3M C;  1HTZ A;  3NQJ A;  3VOZ A;  3X1S A;  3AZL D;  5B40 A;  4XZQ D;  5DNM A;  5HAI A;  3N7W A;  4HBT A;  5GHZ A;  3WTP E;  3LZ1 D;  5CPJ C;  4H9R A;  4UA9 A;  1JVJ A;  3IF6 C;  4X6T A;  5DTS A;  1P3M B;  3UTB C;  2OV5 A;  1B67 A;  3X1S D;  5HL1 A;  5B40 D;  4NK3 A;  3WTP A;  5DNM D;  3REH B;  1W2E A;  5JA4 B;  1S32 B;  2B5R A;  5FI2 A;  1DY6 A;  1L0D A;  1BT5 A;  3PBS A;  5AQB A;  3B6G C;  3WTP D;  3KWQ A;  1XPB A;  5HAQ A;  4EV4 A;  3BLS A;  3IT9 A;  1TZY A;  4KUD B;  4MBF A;  4OOM A;  4NY2 A;  5B33 A;  4ZUX B;  3UT9 A;  4C3Q A;  3KWQ D;  3BFD A;  5IHV A;  4JXS A;  2Y2N A;  4H8R A;  4GB7 A;  4QLC A;  1LHY A;  1OME A;  3MKE A;  5JYP A;  2X71 A;  3HUO A;  3WAA A;  1TZY D;  4NYU A;  3UT9 D;  3MZD A;  4KZ7 A;  2IOU A;  5AV8 C;  3BEC A;  2PYO B;  4QLC D;  4WZ5 C;  2HPB A;  3N8S A;  2DNS A;  1HTA A;  4PM8 A;  1ZKJ A;  5B1M C;  3VFH A;  3B0D C;  3DTM A;  4N9L A;  5CPK B;  3Q81 A;  4HGA C;  1L0F A;  1U35 C;  2ARO B;  3O86 A;  3EQV A;  1H3O B;  4E3L A;  5B0Y C;  4H9S C;  4U3T A;  1E4D A;  2HUE C;  3QNB A;  4R8P B;  3W4Q A;  4XUJ C;  3MGS C;  4QD4 A;  1NJ4 A;  4HGA B;  5FAQ A;  3W98 A;  3O62 C;  3MGQ A;  3TU4 A;  4OQG A;  3Q7V A;  2JC7 A;  3MGP A;  1P3L C;  4IBB A;  3DW0 A;  1ERQ A;  3UTA C;  5B31 G;  3W98 D;  4WBG A;  2NZD A;  3MGQ D;  2ZC5 B;  3TU4 D;  1WYC A;  5B32 C;  1SCW A;  3LY3 A;  3MNN A;  3X1V B;  5B24 A;  4E3N A;  2NZD D;  2ZJ9 A;  5EPH A;  4OPR A;  1E25 A;  4NET A;  5GLD A;  1MPL A;  3AZE A;  1Q2P A;  5F83 A;  3N3F A;  3MNN D;  5F1G A;  1XX2 A;  1BFM A;  5AVC A;  3REJ A;  5GT0 C;  4KQQ A;  3KXB B;  2J8P A;  1YU1 A;  5CED A;  5FUG A;  4BD1 A;  1EI5 A;  3AZE D;  5CHL B;  3X1T A;  1RP5 A;  1KVL A;  3C7U A;  4Y0O A;  2NQB C;  5DNN A;  4GDN A;  4KZB A;  4JJN A;  1P3O A;  4P6B A;  2J8Y A;  4MBK A;  4KZ4 A;  4JKT A;  5AVC D;  3REJ D;  4CJN A;  2ZM0 A;  5GT0 B;  1K25 A;  3FDD A;  1TDL A;  4FSF A;  1Q2Q A;  5CP6 C;  2Y2L A;  4YFM A;  1M18 A;  4H9P A;  3X1T D;  4OP5 A;  3G2Z A;  3A6N A;  4BD0 A;  4ZBJ C;  5DNN D;  1P3O D;  3WS5 A;  1RGY A;  5AQ7 A;  3L2A A;  3AYW A;  3AZK B;  2RVQ D;  1XP4 A;  1K54 A;  3IWQ A;  1M18 D;  5AY8 B;  3AZH A;  3A6N D;  5BNV A;  1QME A;  4ZBJ B;  3HLF A;  1EWZ A;  2F8N K;  1K55 A;  4AWL C;  1YLT A;  4WU9 A;  5I94 A;  3AZH D;  2XR0 A;  4BL2 A;  3PTE A;  4KZ9 A;  4C75 A;  3REK B;  4CPK A;  4WU9 D;  4UA7 A;  4AWL B;  3FKW A;  4WZ4 A;  2EX6 A;  2Y2P A;  3AV2 C;  4WV4 B;  3IH9 A;  3PBQ A;  2ZC4 B;  1GHP A;  4OQ0 A;  5E2E A;  4E3M A;  3VP3 A;  1JWV A;  3VP4 A;  4MLL A;  3WKJ B;  3AZI D;  3RXW A;  4OPY A;  3ZVW A;  4J8U C;  3FKE A;  3P5J B;  1P3M A;  4QJG A;  2Y2M A;  1DJC A;  4RYE A;  1BLC A;  1E3U D;  1ES2 A;  1PIO A;  4D2O A;  5JA4 A;  4E6W A;  5FA7 A;  1O07 A;  5CPJ A;  2WKH A;  3DWZ A;  1P3M D;  3VP1 A;  3IF6 A;  1P3P C;  3UTB A;  5CER A;  4NYY A;  1IYO A;  1P3F C;  1AOI A;  1ONH A;  4OUI A;  1NZU A;  5CGS A;  2WZZ A;  4OJ6 A;  4IJF A;  3KUY C;  4ZJ1 A;  5CPJ D;  1HQ3 C;  3UTB D;  4KHA A;  3VH5 W;  2Y91 A;  4NZ5 A;  3B6G A;  5B31 B;  1ZC2 A;  4F94 A;  3ZG9 B;  3REI B;  3G34 A;  5G49 B;  4OLG A;  3C1B C;  1N1J A;  3O3V A;  2FJ7 B;  1SDE A;  3TOI A;  4QHC A;  1HQ3 B;  4ZUX D;  3H0R C;  3B6G D;  3VH6 W;  4DE2 A;  1P3B C;  3VH5 T;  2BYK B;  3BFE A;  5FI7 A;  4OLD A;  3FZC A;  4G92 B;  3FV7 A;  2QPN A;  2XD1 A;  4WNN A;  2Y2J A;  5GHY A;  1FCO A;  5GXQ B;  5AV8 A;  3LEZ A;  1IYP A;  1HD8 A;  3VH6 T;  2F8N A;  2BYM B;  3PAG A;  2CV5 B;  4WZ5 A;  4WU8 B;  3WS0 A;  4BLM A;  2EX2 A;  4RVA A;  5AV8 D;  5B1M A;  2F8N D;  4IBJ A;  1BH9 A;  1U35 A;  1KGF A;  3W99 C;  4IBR A;  2Y2O A;  2HDU A;  3B6F B;  3I7J A;  2E8I A;  5B0Y A;  4H9S A;  5B1M D;  2PU2 A;  4NZ4 A;  4XUJ A;  3MGS A;  4QNL A;  3BM6 A;  3QNC A;  1U35 D;  4NE6 A;  1ESI A;  3O62 A;  5DTT A;  3W99 B;  5B0Y D;  3L25 A;  4XUJ D;  1P3L A;  3IWI A;  5B2I B;  3UTA A;  5FQI A;  3O62 D;  4J8V B;  3C5A A;  1JWP A;  4Z66 B;  2HDS A;  4M6B A;  5B32 A;  2IO5 C;  3F6T A;  1P3A C;  2XFT A;  1P3L D;  3OPP A;  3NQU A;  3AZM C;  3UTA D;  5M19 A;  1MY8 A;  3HLB A;  3R45 B;  5B32 D;  4UUZ B;  4WZS B;  4CAY B;  2IO5 B;  3E2K A;  4JF6 A;  1P3A B;  1NYM A;  1WYB A;  5B2J B;  4E3J A;  5GT0 A;  4YM6 C;  1F66 C;  4IBK A;  4Z5T C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...