2XD1A

Active site restructuring regulates ligand recognition in class a penicillin-binding proteins
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
489
structure length
469
Chain Sequence
SISEITYSDGTVIASIDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTNQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PENICILLIN-BINDING PROTEIN 1B
publication title Active Site Restructuring Regulates Ligand Recognition in Class a Penicillin-Binding Proteins.
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 145
structure length 469
sequence length 489
chains with identical sequence B
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2xd1A01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2xd1A03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2xd1A02
1CK3A 4LCLA 4B88A 4QJGA 4S2MA 1XKZA 3ZG9B 4KENB 3BFGA 1IKGA 3UPPA 2WAFA 3M6BA 5CHJA 4OOMA 5TGFA 3HUOA 1MPLA 4KZ8A 4WYYA 3PBQA 2EXBA 1YLPA 3IF6A 1BT5A 1JWPA 3QNCA 1BULA 2XQZA 1W5DA 1YLTA 3LY3A 3OPLA 3UE3A 3IF6C 2HP6A 2A49A 1W8YA 2EX6A 4KG2A 2HPBA 4E3JA 2WKIA 2OV5A 4OPQA 1JWVA 2B5RA 4PM9A 3LO7A 4E3MA 2OSUA 5HAIA 3IHAA 4E6XA 3N4IA 3HBRA 4Y0OA 5AQ7A 2Y2QA 1U60A 3Q7VB 3ZHHA 3BECA 3PAEA 3GR2A 2P9VB 1KVMA 3UPNA 1XGJA 4LV1A 3BFEA 4OVDA 3GSGA 4NETA 3ZGAB 1OMEA 3GV9A 5EVIA 4N92A 3HLWA 4Q8IA 3HUMA 4FD8A 4Y0UA 1BLSA 4IVIA 3IXGA 1JWZA 1ALQA 1L2SA 2G2WA 5CEBA 3V3RA 3G35A 3IH8A 3W8KA 2WAEA 3VFFA 1FOFA 2BLSA 4RVAA 1PWGA 4QB8A 4U3TA 4X53A 3GMWA 4S2KA 4KQQA 5J8XA 5TFQA 3EQVA 2BG1A 5A93A 1K54A 3M2JA 5EVLA 5FDHA 3NBLA 3IH9A 5HAQA 1MXOA 2WK0A 5FQKA 1N9BA 3C4PA 4JF6A 1Z6FA 1AXBA 1K54C 2JC7A 1TDLA 2WYXA 1CI8A 1IYSA 2JE5A 1EWZA 1KVLA 1W7FA 1K56A 3O88A 1YLWA 3IXBA 1MWSA 5G18A 3S22A 2J7VA 3VP4A 2A3UA 2UWXA 4GZBA 4L0LA 4RYEA 1LLBA 5CRFA 3ZNTA 1ZG4A 3PBNA 4OLDA 1Q2QA 2WGVA 3FV7A 1NYYA 3HLDA 4ZBEA 2PBYA 5CGWA 3UDIA 1YMXA 2XFSA 3HLGA 2ZC6B 2G2UA 4WBGA 3VMAA 4OKPA 3VOZA 1XGIA 4P0MA 3VP3A 3OZHA 2XDMA 2HP9A 5DF8A 1G6AA 4OOLA 3HL9A 1WYCA 4UA7A 4BD1A 3SH9A 4DDYA 3SS4A 4Y0TA 2ZLYA 4KZ6A 3CZDA 3EQUA 2ZM2A 1BZAA 4HEFA 5M1AA 3P98A 3O87A 4R1GA 5F1GA 4MBFA 5IHVA 3D4FA 4QHCA 5HW3A 4FH4A 4OPRA 3BFCA 3UNWA 4LV0A 5CGXA 4S2NA 5GHXA 2EXAA 1HZOA 1M6KA 1CEGA 1FR1A 4DDSA 3GVBA 1IEMA 4EV4A 3S4XA 3UN7A 2ZC5B 4S2NC 4FCFA 4S2LA 3AGFA 3OPRA 3PBSA 5DTTA 1FCNA 4IEDA 2Y2GA 5GHYA 2ZD8A 2XR0A 5KSHA 4EUZA 5F1FA 3MBZA 5BOHA 4F94A 3O86A 4PM7A 1XA7A 2WGWA 4MNRA 1NYMA 1FSWA 4XXRA 2DCFA 3N6IA 4BQMA 5KSCA 1GHPA 4WZ5A 1PZPA 2IWDA 3NDEA 3PAGA 3LY4A 1JTDA 2J8YA 1RGZA 3IHBA 4KZ3A 4WZ5C 4E3KA 3IT9A 1ESIA 1ONGA 2ZQCA 5EVIB 4M3KA 3ZVWA 4LV3A 2H0TA 2Y2OA 1GHIA 2XLNA 5L2FA 2H5SA 1GA9A 1YMSA 1BTLA 4S2IA 3BYDA 4X6TA 3G32A 3CJMA 3NI9A 4N1HA 3BFDA 3O3VA 1ERQA 2E8IA 4XUZA 2Z2MB 5D3OA 1PI5A 1WYBA 3UE1A 1ES3A 4GDNA 3TG9A 2Y55A 3G4PA 2I72A 3FZCA 3A3JA 1CI9A 1KGEA 3GRJA 3IWIA 4KZBA 2WADA 4OQGA 1KE3A 1IELA 5FQIA 3Q82A 3SH8A 2ZC3B 2EX2A 4OQ0A 4YINA 4OOYA 5A91A 4LCMA 1LL5A 1TEMA 4OQHA 1J9MA 4PMAA 1RGYA 5FA7A 2OLVA 3WRTA 3ZG8B 3E2KA 5CHUA 3A3IA 5EOOA 2Y2JA 1XPBA 3IF5A 2Y4AA 4OONA 4R4SA 4GOGA 4KZ7A 2PU4A 1BLHA 3VSKA 1ZC2A 2XFTA 4JBFA 4R0QA 1RP5A 4UA6A 3DWZA 3I7JA 5FI6A 3BM6A 3RXWA 4C75A 2X01A 3IWQA 3A3EA 4DKIA 2DNSA 3OCLA 1XA1A 5E2EA 4X68A 2J9OA 4R4RA 4ID4A 5CGSA 1MY8A 4LENA 5U47A 2R9WA 3ZCZA 2Y2PA 3RXXA 1IKIA 1NZUA 3N7WA 4JF4A 1O7EA 4S2JA 3ZVTA 2JBFA 3LEZA 1ESUA 3B3XA 4FSFA 1H8ZA 4UHUA 2RCXA 1KGFA 4JXSA 3PBOA 1K38A 5F82A 3UO9A 2ZM0A 3Q07A 3N8SA 1SDEA 3VP1A 1YT4A 2Y2IA 1KDSA 3A3FA 2ZJ9A 4WMCD 5CECA 3DWKA 5E43A 3VP2A 1K57C 2WGWB 1DJAA 3C7UA 4GB7A 1PWDA 3SOIA 4DE3A 3V5MA 1I2SA 1Q2PA 5M19A 4E3IA 5A92A 4D2OA 2OLUA 2Z2LB 2IWCA 1GHMA 1BUEA 3ZDJA 1VQQA 2GDNA 3MZEA 4Z9QA 4BLMA 1NZOA 1N4OA 4GDBA 5DF9A 5FASA 2HDSA 3C7VA 4RX3A 3BEBA 4HESA 3W4QA 1H8YA 3VSLA 4R3BA 2EX9A 3QHYA 4HBUA 5HL1A 3HLEA 3MZFA 2C5WB 5FQ9A 4E3NA 3FYZA 2RL3A 1EI5A 4JXGA 3OPHA 1MWRA 3GTCA 4ZJ2A 2QMIA 1M40A 4HBTA 4PM6A 5HAPA 2Y2KA 3C5AA 3IF6B 4FH2A 4GD6A 1FQGA 3DW0A 1ERMA 1WE4A 4QY5A 4WM9A 4ZAMA 3V50A 1FSYA 1MWUA 2ZC7A 4EWFA 4MBHA 1I2WA 3UPOA 2CC1A 5HFOA 4GNUA 4ZDXA 3WS2A 4P6BA 2EFXA 1EROA 4OQIA 1K6RA 4U0XA 3IXDA 4R23A 3P09A 4GD8A 4OLGA 4MEZA 5GHZA 1PZOA 3V39A 4QY6A 3BFFA 2WZZA 1KDWA 1ZG6A 2V20A 4GN2A 5FAPA 3IXHA 5AQAA 3WS5A 5GLAA 4WEKA 1KE4A 4WZ4A 4EQIA 1K55C 1XX2A 1PIOA 1YQSA 5DTSA 3UDXA 4RX2A 3MZDA 3VP0A 1ES5A 2XF3A 2XD1A 4DE0A 4NK3A 4JLFA 2Q9NA 3NIAA 3BLMA 3S1YA 4BJPA 3N8LA 1QMFA 4DXBA 2XH9A 2XGNA 1FCMA 1BLCA 4N9LA 2DRWA 2J9PA 4OPZA 2ZM8A 4DRTA 5TR7A 3E2LA 4CJNA 1NY0A 3OPPA 3OCNA 3VFHA 1GA0A 1H5XA 5FQJA 1L0EA 2C6WB 3N8RA 4H8RA 1W8QA 4IVKA 1IYPA 4X55A 5DVAA 3WS1A 1PW8A 1FCOA 3SH7A 5GLBA 2QZ6A 3RJUA 4X69A 2FFFB 3TSGA 3PTEA 1MWTA 4KZ4A 3Q7ZA 3M6HA 1E25A 5CTNA 3SS5A 2Y2NA 4B4XA 2HDQA 4EBNA 1E3UD 4C3QA 4KZ5A 5DF7A 3G2YA 3IQAA 4QU3A 5HARA 5E2GA 3QNBA 3AGDA 1ZKJA 1L0FA 4UA9A 3HREA 3DTMA 4JF5A 4JKTA 4BL2A 1NXYA 2V2FF 1TDGA 1IYOA 4K0WA 1QMEA 5FAQA 2X71A 2XK1A 4O7DA 5CEDA 3FKVA 2R9XA 3MKEA 3Q1FA 4DXCA 3HLFA 4WELA 1DY6A 4EBLA 4EBPA 4WMCA 3ZG0A 3MXSA 3G31A 1W79A 3MFDA 5EECA 5FSRA 2VGKA 5FI7A 3ISGA 4U0TA 3MXRA 1YLYA 1KE0A 4OP5A 3NDGA 2QPNA 4B4ZA 2ZQ8A 2XEPA 4MBKA 1ONHA 1NJ4A 1TVFA 4XUXA 3NY4A 1IYQA 5FQMA 3WWXA 1K57A 3FWLA 1LHYA 4E6WA 2WKHA 2Y2LA 1ES2A 1C3BA 3ZNYA 4A5RA 5EVIC 1BLPA 1HD8A 1Y54A 4R3JA 2Q9MA 4KZAA 3WRZA 1MBLA 2VGJA 3ZG5A 5DTKA 4MLLA 5A90A 4K91A 1BSGA 3JYIA 3AGEA 3PBTA 3W4PA 4N1XA 4QD4A 4WEJA 2ZQ9A 5KZHA 2H10A 1SDNA 5E2HA 4DE2A 1I5QA 1ES4A 4KG5A 4JPMA 5AQ9A 5GLCA 3SS3A 5EUAA 5EVID 1YM1A 2ZQAA 4GKUA 4RA7A 4PM8A 3ZFZA 1CEFA 1JVJA 3GQZA 4K0XA 2WGIA 5EOEA 5CXWA 4KG6A 2Y91A 3HLCA 2H0YA 2HDRA 1K4FA 2Y59A 4OH0A 1SCWA 4DE1A 5FAOA 1HTZA 3MKFA 5JYOA 1MKIA 4PM5A 5CERA 2EX8A 3ITBA 1GCEA 3TOIA 3WS0A 3UE0A 5M18A 3Q7VA 5FI2A 1E4DA 1HVBA 2P9VA 3A3DA 1SHVA 1JTGA 3UY6A 5HX9A 4BENA 1DJBA 1LI0A 3V3SA 1S0WA 3W4OA 5KMWA 1K56D 3ITAA 4ZJ3A 2P74A 2X02A 1S6RA 3IWOA 5EE8A 4YFMA 4P85A 2IWBA 4E3LA 4BL3A 2HP5A 4X56A 5FATA 3G30A 2PU2A 2HDUA 4KQOA 5FQQA 4ZJ1A 3HLBA 5I94A 1SKFA 1O07A 3HUNA 3LCEA 1K4EA 1PWCA 1XXMA 1K55A 4KZ9A 1YLZA 3VOYA 3C4OA 4DF6A 4JXWA 4CPKA 4P87A 4IBRA 4OPYA 1LI9A 4S2PA 4S2OA 1K25A 4C6YA 2Y2MA 4JXVA 2FFYA 2Y2HA 1PYYA 4Y7PA 3ZG7B 5EPHA 2WZXA 3CMZA 3HVFA 2WUQA 4N9KA 2ZQDA 1K6SA 3NC8A 4IBXA 5GLDA 1YLJA 2EFUA 3G34A 3NCKA 1XP4A 4OP8A 2V1ZA 1E3UA 1DJCA 3G2ZA 5GL9A 5JYPA 3PBRA 1G68A 1LL9A 4PPRA 4BD0A 1NRFA 4LV2A 4E3OA 1PW1A 5E2FA 4UAAA 1KGGA 1FR6A 2WKEA 1L0DA 3BRMA 4KQRA 2XD5A 5CHMA 5CTMA 5F83A 3WS4A 3BLSA 3UDFA 1VM1A 1RCJA 2ZQ7A 2ZC4B 2ZMAA 4ZTKA 3CG5A 3Q81A 3FKWA 3OC2A 1L0GA 5AQBA 1PI4A 3M2KA 2JCHA
chains in the Genus database with same CATH superfamily
2D02A 4S2MA 1F98A 4R8PC 3ZG9B 1T19A 2J3TC 2WAFA 5TGFA 3LYXA 1MPLA 3B0CW 3K3CA 3OPLA 3H7WA 3IF6C 2A49A 2L0WA 4KG2A 2HPBA 4E3JA 3T1XA 1JWVA 2OSUA 3HBRA 1SKOB 4DMZA 1F66C 4O0PA 3B42A 4D60A 3UPNA 1XGJA 3X1UD 5B1MC 5JRGB 3GSGA 3L7HA 1PZRA 4IBDA 4QLCC 2W8SA 3V67A 3GV9A 5EVIA 1UWPX 4N92A 3W97B 4Q8IA 3UT9C 3F1PB 1JWZA 5F5YA 5DNNA 3G35A 1FOFA 1P3FC 2BLSA 3T12B 1PWGA 4QB8A 3F1OB 1M1AB 4S2KA 3EGXC 3CITA 4ETXA 1GOIA 3KXBC 1ZLAB 1EW0A 2NZDC 5EVLA 5FDHA 1TS0A 3IH9A 3AV1B 5HAQA 1YKDA 5BO0A 4JF6A 2JC7A 2JKTI 1EWZA 1KVLA 1YLWA 3WD4A 3AZLB 5G18A 2J7VA 3W98C 5G4ZA 3AZFA 1LLBA 3PBNA 4OLDA 3HLDA 1KX4D 1NYYA 4ZBEA 3MGPC 2PBYA 3UDIA 3MR0A 1YU0A 1S1YA 3LZ1A 3HLGA 4CAYB 4OKPA 1XGIA 1Z09A 4P0MA 3VP3A 2XDMA 4GH9A 2HP9A 1EQZA 4BD1A 5CP6A 3SH9A 3AZIA 1UR9A 3X1TB 4NXGA 3SS4A 1NLZA 4Y0TA 3LELB 2ZLYA 3CZDA 3EQUA 2ZM2A 3P98A 4R1GA 1P3OA 1FIKA 3KSFA 3CWFA 4J8XC 2GJ3A 5CGXA 5GHXA 2EXAA 4Z2MG 3MQLA 3S4XA 3UN7A 5B31B 3AZEA 4S2NC 4FCFA 3WKJD 3OPRA 4LD9C 2CV5C 2HIOC 4I3AA 2Y2GA 1E15A 2ZD8A 5GSUC 3B6GA 4M4XA 2GNXA 4ZUXC 3W96D 1E6NA 1IFQA 1GXDA 3O86A 4PM7A 3NJAA 1NYMA 1YAXA 4BQMA 5AV8A 4XUJC 2VV6A 3IT9A 2PHYA 5EVIB 1TS6A 3QP5A 3W97D 2Z6CA 4I3IA 4G92B 2XLNA 1GA9A 5DNNB 4LLOB 4GHIA 2BYKA 4X1LA 5GT0B 3BYDA 3G32A 1P3LB 3H0LC 3NI9A 1P3PA 3RFBA 1ERQA 3OOVA 5D3OA 3UE1A 5BS7C 3A3JA 3GRJA 2KLIA 4OQGA 2WADA 1BH9A 3LI9A 3X1UC 5AV6B 2VV8A 1VEUB 3SH8A 4OQ0A 3AZLD 1OT6A 5A91A 3LJAA 1TEMA 3B33A 3ZG8B 1S1ZA 1E6ZA 1E88A 4IBJA 4H9PA 4OONA 5E5AD 4R4SA 4KZ7A 2PU4A 1BLHA 3VSKA 1ZC2A 4YS3A 2XFTA 5F99D 4UA6A 5CP6B 5EM1A 3X1TD 3KSYA 3A0SA 4DKIA 3LELD 4XZQB 1XA1A 4NZ4A 2EWVA 4IUKA 3CAXA 5B24A 4G3WA 3AV2A 1MY8A 4LENA 5BT1D 2V1AA 4FUWA 3ZCZA 2Y2PA 1IKIA 1NZUA 5B33B 5KDMA 4OJLA 5B31D 4ZRRA 3B3XA 1H8ZA 2RCXA 1KX4C 1KGFA 1K38A 3UO9A 3Q07A 3A3FA 5AVFA 1XFNA 1PWDA 1LSXA 4JGPA 5AV8B 3GDIA 2KX6A 3UB6A 4E3IA 1OTDA 2Z2LB 4Y2FA 1GHMA 2ZOIA 2GDNA 3MZEA 1NZOA 3MQ0A 4GDBA 3B0DB 3BEBA 4HESA 3W4QA 1TZYA 2YKFA 2VGLS 2EX9A 3DTEA 5AVBA 3AYWA 4GHIB 4Q0JA 3MZFA 4IBFA 2BYKB 4E3NA 4EXOA 3FYZA 3WKJC 2RL3A 5GT0D 2L1MA 5G49B 4NZ3A 1P3LD 1MZUA 1P3PB 1M19B 1MWRA 4ZJ2A 3KYEA 3T4TA 4FH2A 4GD6A 5BNVA 3IX3A 4JGQA 1FSYA 1MWUA 2QJ7A 4EWFA 2G7UA 5DJTA 5AV6D 5JRGC 4H9OA 4GNUA 2HZ5A 3JPUA 4P6BA 1EROA 1K6RA 3W97C 3IXDA 4P6ZM 3P09A 4OLGA 1PZOA 1TAFA 4H9PB 2WZZA 4BBVA 4YS3B 2V20A 4XT2A 3IXHA 3MGRA 5GLAA 2VLGA 1AIWA 1M1AC 5G4YA 4WEKA 1KE4A 1K55C 3S7PA 1XX2A 1ZLAC 2AVXA 4RX2A 4XZQD 3AV1C 3A6NB 5B1LB 1E6RA 3WTPB 4NK3A 2F2AC 4BJPA 1QMFA 3UB7A 1FCMA 3AZLC 1V9ZA 4NEED 5KDMB 5B33D 2DRWA 3DBAA 3IBRA 3WA9A 1JFIB 1H5XA 4IVKA 1IYPA 5DVAA 2PDRA 4UEYA 2GZAA 1PW8A 3OLOA 3RJUA 4X69A 1S4RA 1MWTA 3PTEA 5E5AC 2FH5A 1Y28A 3SS5A 3C1BB 3NOTC 4WU8B 3AZJA 3LUQA 1E3UD 4FTXA 3X1TC 3LELC 3D3OA 1GSVA 4J8WA 3QNBA 1WWIA 2W3HA 3AGDA 5B31G 1ACFA 4UA9A 3MMHA 1TDGA 4WV4B 2X71A 3MSHA 4X23A 1W2EA 4CLCE 2R9XA 4TX8A 5AY8A 2XA7S 5B31C 4G3VA 4DXCA 5DKKA 3WD1A 4EBLA 2VEAA 3MXSA 5FI7A 5C5KA 1KU5A 1LSVA 1HLUP 1H3OA 3WAAD 3IS2A 4MBKA 5AV5A 1NJ4A 4HOIA 3EPKA 4J8UD 3MVDA 5EVIC 2DQNC 2HJ9C 4R3JA 2Q9MA 2W3EA 4KZAA 5B2JB 2FJ7A 2VGJA 3ZG5A 4G92C 2NQBA 3W4PA 3VOLA 5DNNC 2LB5A 5CPKA 1ES4A 4X25A 3SS3A 5GT0C 3MGRB 4GKUA 4RA7A 1P3LC 3AN2B 3C30A 1CJFA 4K0XA 3A6ND 5B1LD 4OH0A 1KX5A 3WTPD 1HTZA 5CERA 2EX8A 5AV6C 1GCEA 3UTAD 4GHAA 4YM6B 1SHVA 3UTBB 3AZNA 1DJBA 1S0WA 2XRNA 4X1MA 3W4OA 3CHWP 4E04A 2X02A 5EE8A 3IP4C 3W2ZA 3C1BD 4WU8D 4LRZE 4WNNA 1HQ3B 5CP6C 5FATA 3C1CD 4KQOA 5FQQA 4XZQC 1O07A 3HUNA 1K4EA 1PWCA 1XXMA 4X23B 2PRFA 2F8NK 3KSHA 4OPYA 4P87A 4NXFA 4S2PA 3UB9A 2CMNA 5AY8B 5B33C 4JXVA 2Y2HA 1PYYA 4WU9A 3KX0X 3UE6A 4OUIA 4UUZB 3NC8A 5GLDA 1N9OA 2V1ZA 3G6OA 4Y5FA 4J8VB 1G68A 5AV5B 1LL9A 5AV8C 2RVQD 3QP4A 4UAAA 2WKEA 1Z2CB 2IO5B 1M18B 3MVDB 5IS1A 5CTMA 3B0DC 3X1SD 1RCJA 5B2JD 3KWQD 1DP8A 1U35A 1L0GA 1YU3A 3M2KA 2JCHA 3IXBA 1CK3A 4Z66A 5CPKB 1IKGA 3UPPA 3M6BA 3LIBA 4AWLB 4QNLA 2EXBA 1YLPA 3PBQA 4ME4A 3AN2D 1P3PC 1M19C 2K31A 1YLTA 3UE3A 3AZMB 2HP6A 1A7WA 4H9QA 1KX5B 5HD3A 4EQ1A 5AV9B 3KFUG 3CUEA 4PM9A 4E6XA 2M1CA 5AQ7A 4Z2GA 3BECA 5DNMA 3GR2A 3VH6A 4YM6D 3BFEA 3UTBD 2A24A 2PYOB 3O5YA 4GLQA 3C8CA 3UMEA 1W1PA 2Y8HA 1ODVA 1BLSA 4YS3C 5B40B 1ALQA 2G2WA 2BTFP 5CEBA 1HQ3D 3IH8A 2WAEA 4BBTA 5LBRA 4QLCD 2Z6DA 3A6NC 5B2IB 5B1LC 4I5SA 4KQQA 5J8XA 3WTPC 1NWZA 2XSSA 3UT9D 3TE8A 3EQVA 5HD5A 1K54A 3FKEA 3NBLA 3SZTA 2WK0A 4OJ5A 1N9BA 5FQKA 1AXBA 2W3GA 4UQIM 4WU9B 2WYXA 4Q0IA 1KS0A 4DRBA 1MWSA 1Y4OA 4Y13A 3KXBD 3VP4A 5CRFA 1ZG4A 4IHQA 3C1BC 4J8VD 4WU8C 4ETZA 2XFSA 4WBGA 3VOZA 2ZY3A 1BYWA 3C1CC 3SW1A 1M18D 3W98D 1WYCA 4UA7A 1U35B 4KZ6A 2PD7A 4HEFA 5F1GA 3L25A 4UQIS 5IHVA 3D4FA 5HW3A 4OPRA 4HMEA 5AVEA 3HONA 1PDCA 4DDSA 1DP6A 3B6FA 3REKA 3PBSA 3AZMD 1FCNA 5DTTA 5CPJB 1YSPA 3IBJA 2F8NB 2XR0A 5KSHA 4EUZA 2RVQC 5F1FA 3CPTB 5AV9D 2VA0A 4F94A 1XJ2A 2WGWA 2DCFA 2ZY4A 3N6IA 5KSCA 4WZ5A 1PZPA 4HMCA 4LD9D 1G28A 1P3AA 2HIOD 5B2JC 3NDEA 1RGZA 3IHBA 4KZ3A 3VH6T 4E3KA 1ESIA 2PYOD 1P3IB 4Y3IA 3LFVA 4LV3A 2H0TA 3MGRC 1GHIA 3O62B 3AN2C 4WJ3C 3MGSA 4KQDA 3EPJA 4HH2A 3F6TA 5B2ID 1P3KA 3O3VA 3NHQA 2E8IA 2Z2MB 2Y55A 3FZCA 5JA4A 1KGEA 2K7SA 3IWIA 1OTAA 3T4SA 1S32A 4YM6C 1IELA 1LSWA 3Q82A 3KYQA 3UTBC 1LL5A 1J9MA 2FN2A 2DF4C 1P34A 3E2KA 1AOIB 3ICYA 1HQ3C 2Y2JA 1P3MA 2Y4AA 4NXBA 4R0QA 2ZY5A 2O9AA 4KGCA 1VETB 5BNXA 3DWZA 2X01A 4X23C 2JKRI 2HUEB 3LZ0B 4X68A 5AY8C 4Z5TB 2J9OA 4ID4A 2YFWA 3W99B 1W1YA 2VZWA 3REKB 1O7EA 3ZVTA 2JBFA 4HGAB 4FSFA 4UHUA 4Y15A 5CPJD 3PBOA 4J8VC 5F82A 5AV5C 3AZKA 2F8ND 1SDEA 4DJ3A 3MF0A 2J80A 4WMCD 4BMWA 3DWKA 2WGWB 1DJAA 3C7UA 2IO5C 4HJ4A 1M18C 4H9RA 3V5MA 3MVDC 1I2SA 1Q2PA 5M19A 5A92A 3EEHA 2IWCA 3AZGA 1ULYA 5HWTA 3ZDJA 3AL0C 3AFAA 2O0YA 5GT3B 1P3ID 5CPKC 5FUGA 4R3BA 4AWLC 3O62D 5HWWA 4KHAA 4RQ9A 1P97A 2C5WB 5C3IB 4L9FA 4HHDA 3AZMC 3QP6A 3VH5T 3JVVA 4JXGA 3OPHA 1KX5C 4HY8A 2QMIA 3D72A 4HBTA 5HAPA 5AV9C 2VK3A 1P3GA 5GXQA 1ERMA 5JA4B 1WE4A 4ZAMA 3H7WB 2ZC7A 3L27A 3REHA 3KSIA 1I2WA 3UPOA 2CC1A 4ZDXA 2V9AA 2PYOC 3TU4A 2EFXA 4H9SA 2JKTM 3QP1A 5HWVA 2VKSA 4HP9A 4GD8A 5B40C 4MEZA 3H0RC 1AOID 3V39A 3AZHA 1P3MB 3BFFA 2KOIA 5JRGD 3MQQA 1GSXA 5AQAA 4KGCB 5B2IC 4EQIA 1PIOA 3UDXA 5DTSA 3D9YA 3MZDA 3M7PA 1ES5A 2XD1A 4DE0A 3LZ0D 4CLCA 4JLFA 3U2AA 4Z5TD 3NIAA 4WU9C 3S1YA 1QO6A 3W99D 1M1AD 4OJOA 4E45A 1ZLAD 4CJNA 1NY0A 3C38A 3AV1D 3OPPA 4MCWA 5BO0B 1L0EA 2GX5A 5TJJA 3AZKB 4ZBJB 1XFQA 5GLBA 3L9KA 2K2NA 3M6HA 5B32A 4LG2A 1KX3A 2QYBA 3AZFB 1T1AA 4EBNA 2ZOHA 4C3QA 4KZ5A 5DF7A 3G2YA 4Z2KA 4QU3A 1U35C 4R70A 4HMDA 3LR0A 5B0ZA 5E2GA 3LZ1B 5GT3D 5FUGB 3WAAA 4JF5A 4JKTA 3C2WA 1EQZB 1NXYA 2F8NG 3AZIB 4WN5A 1S4SA 2B02A 4MN5A 1H0IA 3HLFA 2AROA 4WELA 1DY6A 1P3OB 1PRQA 5CPJC 5AVCA 1DP9A 3MXRA 3R45A 1KE0A 2V0UA 1B6WA 3NDGA 3NOUC 5GXQB 2QPNA 4B4ZA 3AZEB 2P7JA 4IJFA 4XUXA 5FQMA 1ZHHB 3FWLA 3B6GB 2A2LA 2WKHA 3MGQA 1ES2A 3ZNYA 3TU4B 1P3IC 1OTEA 3WRZA 1MBLA 4K91A 3AGEA 3PBTA 3AZHB 3QP8A 4WEJA 3O62C 2ZQ9A 2H10A 3RTYA 3H82A 2LB9A 5GLCA 1ID3A 5EVID 1CEFA 3GQZA 2WGIA 5DNND 2Y59A 3N3FA 1BFMA 3MKFA 4F3LA 3ITBA 3TOIA 3WS0A 3E4OA 4PKYG 5DFXA 3WD3A 3Q7VA 4NYUA 5FI2A 3KUYA 5CPIA 3A3DA 4JJNA 1JTGA 3UY6A 5HX9A 4BENA 3E4PA 1BH9B 1AOIC 5KMWA 3ITAA 2JKFA 1S6RA 3IWOA 2NUPC 1KX3B 4YFMA 3LJAB 3EWKA 1FILA 3AZFD 4P85A 4LFUA 2V0WA 4E3LA 1B67A 2HDUA 3LZ1D 4FOFA 1XJ6A 5FEGA 3REIA 2HUEC 3LZ0C 1OPXA 4Z5TC 3X1VA 4KZ9A 3VOYA 1EQZD 3W99C 2B95A 5CP6D 3S7QA 4R3AA 3AZID 2JSSA 2W1RA 3REKC 3MS6A 4NZ1A 1OJ5A 1UR8A 4HGAC 1P3OD 2WZXA 2LY8A 2YFVA 3X1SA 5B24B 2Y79A 3AV2B 4IBXA 3G34A 3NCKA 1P3BA 3FPVA 3G2ZA 5JYPA 3PBRA 3AZED 4P6ZS 4MDZA 1Q9CA 4BD0A 4GS9A 1PW1A 3WX7A 3HJIA 3TRCA 1H0MA 1FR6A 3MGQB 3B6GD 3BRMA 2V1BA 2XD5A 1IOUA 5GT3C 3BLSA 3VE4A 3UDFA 4JGOA 4OJPA 4IJGA 2ZMAA 4WUJA 2VQRA 4R8PA 5AV8D 4E44A 5AQBA 4LCLA 4QJGA 1F2KA 4NG2A 4KENB 5C3IC 3BFGA 2P04A 5CHJA 1ID3B 4KZ8A 4WYYA 3IF6A 1TZYB 1BT5A 1JWPA 2OOLA 3LY3A 5AVBB 3T4QA 3AYWB 2G5HC 2EX6A 5EM0A 2OV5A 4F3LB 4OPQA 4LRXC 1F66A 2B5RA 4Z2JA 3JVUA 3LO7A 4E3MA 3IHAA 3N4IA 2Y2QA 5B1MA 1P3PD 1M19D 2IOUA 1U60A 3Q7VB 4EUVA 3ZHHA 5BNVB 3KUYB 5CPIB 1CF0A 2WKRA 4LV1A 1OGGA 4NETA 3ZGAB 3EEAA 1UGUA 1P3MC 5F69A 4H9OB 4Y0UA 5B0YA 1P3FA 1L2SA 3VH6W 4KGCC 3LEQA 4KUDA 5HL6A 3VFFA 4U3TA 1TAFB 3REIB 3FPWA 2NZDA 4X53A 2ZMFA 3L29A 3WD2A 5TFQA 1PFLA 4XT2B 4YS3D 4H6JA 5A93A 3M2JA 3KS4A 2XROA 3REJA 2W0NA 2J3WA 3C4PA 1BH8A 1CI8A 2JE5A 1W7FA 3O88A 1K56A 3AZKC 3S22A 2RIQA 5B24D 4ZBJC 3AV2D 4GZBA 3MGPA 4RYEA 1D06A 1Q2QA 2WGVA 3FV7A 5CGWA 3AZFC 3WA9B 2PR6A 3VMAA 2G2UA 3RELA 3FC7A 1YU2A 2OWJA 5L07A 3OZHA 5DF8A 1G6AA 3LZ1C 4OOLA 3UB8A 3HL9A 2PD8A 1YU4A 4GJ4A 4DDYA 3MNNA 3OBFA 3AZJB 3WTPE 1EQZC 1BZAA 4NXEA 5M1AA 4J8XA 1TS8A 3AZIC 5FL3A 4J8WB 4LV0A 1P3OC 4S2NA 1M6KA 1FR1A 2CV5A 1TZYD 1IEMA 4IBGA 3T4KA 5GSUA 2B18A 4S2LA 5AVBD 3AGFA 3EPLA 4ZUXA 4DJ2A 5GXQC 3AYWD 2MJ6A 3AZEC 2PBDP 4XUJA 3MBZA 5BOHA 3BY8A 3B6GC 4GHLA 1XA7A 1FSWA 4XXRA 3TU4C 1GHPA 4Y17A 1H3OB 3IS2B 2ZQCA 3AZHC 2INWA 4GW9A 3ZVWA 3P5JB 2L4RA 4Z2HA 4EW7A 5B0YB 2Y2OA 5A8BA 2V8CA 2FJ7B 4KUDB 2Q0OA 2NQBB 1BTLA 1F9IA 3MQOA 1H0GA 3CJMA 4N1HA 2YKHA 3BWLA 5BS7A 3MGRD 1WYBA 3REJB 4GDNA 3X1UA 3VH5W 3G4PA 4WL9A 2I72A 4WF0A 1CI9A 4M6BA 1P0ZA 2ZC3B 4EETB 4YINA 2WKPA 4OOYA 1OTBA 4LCMA 4OQHA 2OLVA 3WRTA 1KX3C 3LJAC 3EGDC 5EOOA 3RELB 3ULFA 3WA9D 3AZNB 3IF5A 4Q0HA 3BQAA 4I3JA 1HTAA 1EAKA 2H28A 3I7JA 5FI6A 3MNNB 4C75A 1KOUA 4WNNB 3AZJD 3EOIA 1VB6A 3OCLA 5E2EA 3TJZC 4Z2LA 3T50A 5J3WA 4L9EA 4R4RA 5CGSA 4J8WD 5U47A 5J7EA 2R9WA 1N1JA 3CLOA 5B24C 2O99A 3AV2C 1KX4A 3N7WA 4JF4A 3LEZA 4X23D 5J4EA 3KS8A 4JXSA 5AY8D 3N8SA 3VP1A 2Y2IA 1KDSA 2ZJ9A 3A0VA 4DE3A 3MGQC 3SOIA 4GCZA 3PHYA 1VQQA 5AV5D 4Z9QA 4BLMA 5DF9A 5FASA 2HDSA 3C7VA 4KUOA 4RX3A 4NZ5A 3VSLA 5L8MA 3MVDD 1ID3C 2UV0E 1AWIA 3WKJA 5DKLA 4HBUA 3LR5A 2FJ7D 1TZYC 3HLEA 3R7WA 2NQBD 5EV0A 5AVBC 3W96A 1EI5A 3BQ8A 4Z66B 3AYWC 3FDDA 5CPKD 1SKOA 4PM6A 4EEPA 3X1UB 1FQGA 4WM9A 3V50A 3B0BA 4CSRA 2ACGA 3E0YA 4G91B 3KUYC 5CPIC 4H9QB 2O9BA 1KX5D 4NE3A 3W97A 3LIAA 4IUHA 3WS2A 4U0XA 4Z2MH 4R23A 1CXWA 2P08A 3T4OA 5DNMB 5GHZA 4QY6A 3AZND 1OT9A 3F1OA 2A24B 1T3UA 4L9GA 5FAPA 3WS5A 3REIC 3LI8A 3HSHA 5DJUA 1P9WA 1YQSA 5B40D 2JN7A 2XF3A 1W63Q 3AZLA 3BLMA 3IX4A 3N8LA 1N1JB 1BLCA 4QWOA 2J9PA 4OPZA 4DRTA 5TR7A 3KO6A 4PAUA 3VFHA 1GA0A 2QJ5A 4CAYA 1W8QA 3MJQA 4X55A 5E5AA 3L28A 3SH7A 4WU9D 1FCOA 3WA9C 5F99A 1YPRA 4KZ4A 1E25A 5CTNA 2PYRA 3X1TA 2JHEA 3LELA 3AZJC 1G5UA 3HJKA 1L0FA 4BL2A 4J8WC 3WKJB 5B31A 1QMEA 4K0WA 5FAQA 4O7DA 4R38A 5CEDA 1U35D 3R7WB 4NKPA 1LT0A 3W96B 4LPZA 4Z66D 3ZG0A 2PT7A 3EPHA 1W79A 3MFDA 5EECA 2HGVA 3ISGA 3NQJA 1YLYA 4OP5A 2DMWA 2F8NH 3B6FB 5K5BA 2ZQ8A 2XEPA 1ONHA 4CSRB 2E8JA 4LGWA 4YOFA 3NY4A 1IYQA 1ED7A 1K57A 2Y2LA 1WWSA 1C3BA 4NY2A 1BLPA 1HD8A 4MLLA 5A90A 5B0YC 5DNMD 3JYIA 1P3AB 4N1XA 5GT0A 2FJ7C 4HI4A 2RTSA 5KZHA 4KUDC 4DE2A 1P3LA 1I5QA 2NQBC 2BASA 4PHTA 5HDDA 3ZFZA 1JVJA 3BW6A 5EOEA 5CXWA 1GSWA 4KG6A 1XJ4A 2H0YA 3REJC 1J3WA 3MGSB 1SCWA 5AV6A 1VEUA 3MFXA 1K0KA 5JYOA 4HNBA 1MKIA 4PM5A 1P3KB 3ZYTA 1P9RA 2JKRM 5M18A 1HVBA 2R78A 2P9VA 2J8PA 4HP4A 5AJGA 3GECA 5E5AB 3U4LP 1LI0A 1S32B 1H8PA 3NECA 5F99B 3RELC 4ZJ3A 3AZNC 2ZM5A 1CK7A 2ZBBA 2V5OA 3CI6A 2IWBA 4XZQA 2VV7A 2HP5A 1P34B 4X56A 3MNNC 3DAVA 3G30A 2PU2A 5L10A 4ZJ1A 3LICA 3HLBA 5I94A 1W1VA 5B33A 1E8BA 1E6PA 5BNXB 4CPKA 4IBRA 3T4LA 1K25A 2FFYA 5EPHA 3CMZA 1ZTUA 4N9KA 3NQJB 2YFWB 1XP4A 1E3UA 1S66L 5GL9A 3B6FD 3REKD 2W1TA 3NOPC 3VV4A 5TBMA 1L0DA 4HIAA 3E4QA 2KDKA 5F83A 3WS4A 4B9OA 5HPFA 4H9RB 2EWWA 2JKGA 3Q81A 2QWSA 1D1JA 1P3AD 4B88A 3AZGB 1XKZA 5G49A 3AFAB 1M19A 2IA2A 4OOMA 3HUOA 4Z66C 4IBIA 2G5IC 3QNCA 1BULA 2XQZA 1W5DA 4KHAB 1L6JA 1N9NA 1W8YA 4NE6A 3MGSD 3KYZA 4J8UA 1R4VA 2WKIA 4NFTA 4G91C 3L26A 5FEFA 1P3KD 5HAIA 4Y0OA 5HSQA 3PR6A 2BYMA 3PAEA 3CUEC 1P3GB 2P9VB 5IT5A 1KVMA 4OVDA 5DNMC 1S32D 1T18A 1OMEA 3REHB 3HLWA 2QHKA 3PYPA 3HUMA 4MB5A 4FD8A 5KIZA 4IVIA 3IXGA 3BY9A 3V3RA 3A6NA 1D7EA 5B1LA 1P34D 3W8KA 3WTPA 4RVAA 3T1QB 2VGLM 3GMWA 1P3MD 4HQAA 2BG1A 3UTAA 5CHLB 4KGCD 1MXOA 1JFIA 1T1CA 1Z6FA 3H9WA 1K54C 4EESA 1TDLA 4QPRA 1IYSA 1NLYA 3NQUA 4CLCB 4EO5B 2O9CA 5FDSA 2ZY2A 2A3UA 2UWXA 4L0LA 5EFWA 3C1BA 4WU8A 4I38A 3ZNTA 5HDSA 3V9RA 2W1TB 1F1EA 3C1CA 5IU1A 1YMXA 2ZC6B 5TBMB 4EU0A 3AZKD 5B32B 3O87A 4MBFA 3B0CT 3AZGD 4QHCA 5B0ZB 4FH4A 3BFCA 3UNWA 3AFAD 3W96C 4K08A 1HZOA 3WAAB 1CEGA 5HZHA 3GVBA 4DRAA 4EV4A 2ZC5B 2D01A 1GPFA 3B6FC 4IEDA 2ZMVA 5GHYA 4J8UB 2AROB 5EVEA 1MC0A 5AVCB 1YUEA 4ARZA 4BWIA 1JNUA 2BYMB 5B2JA 3R45B 3KWQA 1V9YA 4MNRA 4IBKA 4LRYC 1P3GD 2IWDA 3A1IA 5GXQD 3PAGA 3LY4A 1JTDA 2J8YA 2W3FA 4WZ5C 1ONGA 1P3AC 3REHD 4M3KA 1H3QA 3DTIA 3AN2A 1CQAA 4O8GA 3TU4D 5L2FA 2H5SA 1YMSA 4S2IA 3AZHD 4X6TA 3H82B 3MGSC 3VE3A 3UTAB 3BFDA 3LR4A 4XUZA 1PI5A 1P3KC 1ES3A 2XA7M 4YM6A 3TG9A 3UTBA 4KZBA 3NQUB 1KE3A 5FQIA 4CLCD 3PXPA 2EX2A 1S32C 5F99C 5DFYA 3LGOA 4CQHA 3V9RB 3L2AA 4PMAA 1RGYA 1HQ3A 5FA7A 2VX8A 5CHUA 3C1CB 3A3IA 4QLCA 5HDCA 4JJNB 3WD0A 1P34C 1XPBA 1X0OA 1VHMA 2PYPA 4GOGA 3UT9A 4Z1WA 4JBFA 1RP5A 5BT1C 2V8FA 3RH8B 4UPKA 3E98A 2VJWA 5B32D 1WA9A 2PAVP 3BM6A 1KX3D 3R4KA 3LJAD 3RXWA 3IWQA 3A3EA 2DNSA 4H9NA 1F5MA 5B0ZD 1SZVA 3LIDA 3KXBA 4UUZA 1OJGA 3X1VB 3RXXA 3QP2A 4J8VA 4S2JA 1XJ3A 2OWHA 1ESUA 1J7MA 2ZM0A 2AROD 1M18A 3W98A 3NULA 1YT4A 5CECA 2YFVB 5E43A 3X1SB 3VP2A 1K57C 5AVCD 4ARZB 5MC7A 3KWQB 4GB7A 1P3BB 4HJ6A 4D2OA 2OLUA 3B47A 2HJEA 1BUEA 5F6AA 1DRMA 4GS9B 3A1KA 1N4OA 4II7A 3AZGC 2W27A 1H8YA 3MGQD 3AFAC 5BPVA 3QHYA 3AZMA 5HL1A 2FZ0A 4KUKA 5FQ9A 4R8PB 2W3DA 3IX8A 1O6IA 5AV9A 4MMNA 3GTCA 1M40A 3MXQA 1ID3D 2Y2KA 3C5AA 3IF6B 3LIFA 1L3LA 4LD9A 1T1BA 4WZSB 2HIOA 3DW0A 3K3DA 3DTKA 4QY5A 3HCYA 1TF1A 1P3GC 2PYOA 4MB3A 1STZA 2QKPA 4MBHA 1W1TA 5HFOA 1F66B 3REHC 5B40A 4OQIA 5B1MB 3F1NA 2L5AA 4H9SC 4QLCB 2OAP1 3KUYD 5CPID 4JJND 4IJEA 5B2IA 1KDWA 3UT9B 1ZG6A 5F68A 4GN2A 4WZ4A 1P3FB 3VP0A 4H9NB 1OTIA 3BJNA 2Q9NA 3KXBB 4DXBA 2NZDB 3REID 2XH9A 2XGNA 4CLCC 4MN6A 4EO5C 3P01A 3X1VD 4Z2IA 4N9LA 4H6JB 2ZM8A 3E2LA 2I9VA 2ZL1A 3OCNA 5FQJA 1BH8B 2C6WB 3N8RA 4H8RA 4NE5A 3TW8A 3WS1A 3W98B 5B32G 2QZ6A 2FFFB 3TSGA 4MN7A 3Q7ZA 4OJ6A 1NRJA 3MGPB 2Y2NA 4B4XA 2HDQA 1P3BD 3ZQ5A 4R6LA 5B32C 3IQAA 5HARA 1H8MA 3LIEA 4HJ3A 2PR5A 3H0MC 1N9LA 1ZKJA 4MB4A 5B0ZC 3HREA 3DTMA 2V2FF 5L09A 1IYOA 2XK1A 2D49A 4WLAA 3WAAC 3FKVA 5CPJA 3MKEA 3Q1FA 4R8PD 2F8NA 4J8XB 1TD5A 2J3TD 4EBPA 4WMCA 3G31A 3CPTA 4IBEA 5FSRA 4J8UC 2VGKA 2AROC 4IBCA 4U0TA 1TS7A 4LD9B 2CWEA 2CV5B 5AVCC 2HIOB 4YWZA 5GSUB 3LR3A 4ZUXB 2OAQ1 1TVFA 1A0KA 1P3IA 3WWXA 3EG5B 1LHYA 4E6WA 4A5RA 1F66D 4XUJB 3K2NA 1Y54A 4NYYA 3F1NB 3O62A 5B1MD 5DTKA 5HPIA 1BSGA 1YSQA 4QD4A 1S67L 4ESPA 1SDNA 5E2HA 3A0RA 4KG5A 4JPMA 5AQ9A 5EUAA 1YU1A 3S7NA 4BBUA 1YM1A 2ZQAA 4PM8A 5CX7A 3UTAC 5B0YD 1P3FD 2Y91A 3HLCA 2EA9A 2HDRA 4B93A 1K4FA 4KUDD 4DE1A 5FAOA 2NZDD 4G3KA 1MKMA 4I39A 3UE0A 1E4DA 1AOIA 2ZL1B 4PKYA 3REJD 2NUTC 5JRGA 3V3SA 4AFIA 1K56D 4JJNC 1UWNX 3KSGA 2P74A 4DQYB 3T4JA 1VETA 4EEUA 3MGPD 3F1PA 4BL3A 1W63M 3S7OA 3UMDA 3LZ0A 1G6OA 1PNEA 4Z5TA 4YNRA 3RELD 1SKFA 3T1RA 1M1AA 3W99A 3LCEA 1K55A 1YLZA 1ZLAA 3C4OA 4DF6A 4JXWA 4DN0A 3AV1A 1LI9A 3X1VC 4S2OA 3MNND 4JGRA 4C6YA 2Y2MA 4Y7PA 4J8XD 3ZG7B 5I5LA 3HVFA 4O01A 2WUQA 2ZQDA 1K6SA 3UB5P 1YLJA 2EFUA 4OP8A 4EERA 3X1SC 1DJCA 2CV5D 3FG8A 3KWQC 1KX4B 5GSUD 4PPRA 2HF6A 1P3BC 1NRFA 4LV2A 4HH3A 4ZUXD 5E2FA 4E3OA 2M7VA 1LL8A 5GT3A 1KGGA 2WKQA 4KQRA 3T1SA 5CHMA 4XUJD 2HV1A 1VM1A 1OGBA 3P7NA 2ZQ7A 3VH5A 2ZC4B 4IBBA 4ZTKA 3CG5A 3FKWA 3OC2A 1PI4A 2M7UA
chains in the Genus database with same CATH topology
4S2MA 4R8PC 3ZG9B 2WAFA 5TGFA 1MPLA 3B0CW 3OPLA 3IF6C 2A49A 4KG2A 2HPBA 4E3JA 1JWVA 2OSUA 3HBRA 1F66C 3UPNA 1XGJA 3X1UD 5B1MC 5JRGB 3GSGA 1PZRA 4IBDA 4QLCC 2W8SA 3GV9A 5EVIA 4N92A 3W97B 4Q8IA 3UT9C 1JWZA 5DNNA 3G35A 1FOFA 1P3FC 2BLSA 1PWGA 4QB8A 1M1AB 4S2KA 3KXBC 1ZLAB 2NZDC 5EVLA 5FDHA 5HAQA 3IH9A 3AV1B 5BO0A 4JF6A 2JC7A 1EWZA 1KVLA 1YLWA 3AZLB 5G18A 2J7VA 3W98C 3AZFA 1LLBA 3PBNA 4OLDA 3HLDA 1KX4D 1NYYA 4ZBEA 3MGPC 2PBYA 3UDIA 1YU0A 3HLGA 3LZ1A 4CAYB 4OKPA 1XGIA 4P0MA 3VP3A 2XDMA 4GH9A 2HP9A 1EQZA 4BD1A 5CP6A 3SH9A 3AZIA 3X1TB 3SS4A 4Y0TA 3LELB 2ZLYA 3CZDA 3EQUA 2ZM2A 3P98A 4R1GA 1P3OA 4J8XC 5CGXA 5GHXA 2EXAA 4Z2MG 3S4XA 3UN7A 5B31B 3AZEA 4S2NC 4FCFA 3WKJD 3OPRA 4LD9C 2CV5C 2HIOC 2Y2GA 2ZD8A 5GSUC 3B6GA 4ZUXC 3W96D 3O86A 4PM7A 1NYMA 4BQMA 5AV8A 4XUJC 3IT9A 5EVIB 3W97D 4G92B 2XLNA 1GA9A 5DNNB 2BYKA 5GT0B 3BYDA 3G32A 1P3LB 3H0LC 3NI9A 1P3PA 1ERQA 5D3OA 3UE1A 5BS7C 3A3JA 3GRJA 4OQGA 2WADA 1BH9A 3X1UC 5AV6B 3SH8A 4OQ0A 3AZLD 5A91A 3LJAA 1TEMA 3ZG8B 4IBJA 4H9PA 4OONA 5E5AD 4R4SA 4KZ7A 2PU4A 1BLHA 3VSKA 1ZC2A 4YS3A 2XFTA 5F99D 4UA6A 5CP6B 3X1TD 3KSYA 4DKIA 3LELD 4XZQB 1XA1A 4NZ4A 5B24A 3AV2A 1MY8A 4LENA 5BT1D 3ZCZA 2Y2PA 1IKIA 1NZUA 5B33B 5KDMA 4OJLA 5B31D 3B3XA 1H8ZA 2RCXA 1KX4C 1KGFA 1K38A 3UO9A 3Q07A 3A3FA 1PWDA 5AV8B 4E3IA 2Z2LB 1GHMA 2GDNA 3MZEA 1NZOA 4GDBA 3B0DB 3BEBA 4HESA 3W4QA 1TZYA 2EX9A 5AVBA 3AYWA 3MZFA 4IBFA 2BYKB 4E3NA 3FYZA 3WKJC 2RL3A 5GT0D 5G49B 4NZ3A 1P3LD 1P3PB 1M19B 1MWRA 4ZJ2A 4FH2A 4GD6A 5BNVA 1FSYA 1MWUA 4EWFA 5AV6D 5JRGC 4H9OA 4GNUA 4P6BA 1EROA 1K6RA 3W97C 3IXDA 3P09A 4OLGA 1PZOA 1TAFA 4H9PB 2WZZA 4YS3B 2V20A 3IXHA 3MGRA 5GLAA 1M1AC 4WEKA 1KE4A 1K55C 1XX2A 1ZLAC 4RX2A 4XZQD 3AV1C 3A6NB 5B1LB 3WTPB 4NK3A 2F2AC 4BJPA 1QMFA 1FCMA 3AZLC 5KDMB 5B33D 2DRWA 3WA9A 1JFIB 1H5XA 4IVKA 1IYPA 5DVAA 1PW8A 3RJUA 4X69A 3PTEA 1MWTA 5E5AC 3SS5A 3C1BB 4WU8B 3AZJA 1E3UD 3X1TC 3LELC 4J8WA 3QNBA 1WWIA 3AGDA 5B31G 4UA9A 1TDGA 4WV4B 2X71A 4X23A 1W2EA 2R9XA 5AY8A 4DXCA 5B31C 4EBLA 3MXSA 5FI7A 1KU5A 1H3OA 3WAAD 4MBKA 5AV5A 1NJ4A 3EPKA 4J8UD 3MVDA 5EVIC 2DQNC 4R3JA 2Q9MA 4KZAA 5B2JB 2FJ7A 2VGJA 3ZG5A 4G92C 2NQBA 3W4PA 5DNNC 5CPKA 1ES4A 3SS3A 5GT0C 3MGRB 4GKUA 4RA7A 1P3LC 3AN2B 4K0XA 3A6ND 5B1LD 4OH0A 1KX5A 3WTPD 1HTZA 5CERA 2EX8A 5AV6C 1GCEA 3UTAD 4GHAA 4YM6B 1SHVA 3UTBB 3AZNA 1DJBA 1S0WA 3W4OA 2X02A 5EE8A 3IP4C 3C1BD 4WU8D 4WNNA 1HQ3B 5CP6C 5FATA 3C1CD 4KQOA 5FQQA 4XZQC 1O07A 3HUNA 1K4EA 1PWCA 1XXMA 4X23B 4P87A 2F8NK 4OPYA 4S2PA 5AY8B 5B33C 4JXVA 2Y2HA 1PYYA 4WU9A 4OUIA 4UUZB 3NC8A 5GLDA 2V1ZA 4J8VB 1G68A 5AV5B 1LL9A 5AV8C 2RVQD 4UAAA 2WKEA 1Z2CB 2IO5B 1M18B 3MVDB 5CTMA 3B0DC 3X1SD 1RCJA 5B2JD 3KWQD 1U35A 1L0GA 1YU3A 3M2KA 3IXBA 2JCHA 1CK3A 4Z66A 5CPKB 1IKGA 3UPPA 3M6BA 4AWLB 4QNLA 2EXBA 1YLPA 3PBQA 3AN2D 1P3PC 1M19C 1YLTA 3UE3A 3AZMB 2HP6A 1A7WA 4H9QA 1KX5B 5AV9B 3KFUG 4PM9A 4E6XA 5AQ7A 3BECA 5DNMA 3GR2A 3VH6A 4YM6D 3BFEA 3UTBD 2PYOB 1BLSA 4YS3C 5B40B 1ALQA 2G2WA 5CEBA 1HQ3D 3IH8A 2WAEA 4QLCD 3A6NC 5B2IB 5B1LC 4KQQA 5J8XA 3WTPC 3UT9D 3EQVA 1K54A 3FKEA 3NBLA 2WK0A 4OJ5A 1N9BA 5FQKA 1AXBA 4WU9B 2WYXA 4DRBA 1MWSA 3KXBD 3VP4A 5CRFA 1ZG4A 3C1BC 4J8VD 4WU8C 2XFSA 4WBGA 3VOZA 2ZY3A 3C1CC 1M18D 3W98D 1WYCA 4UA7A 1U35B 4KZ6A 4HEFA 5F1GA 3L25A 5IHVA 3D4FA 5HW3A 4OPRA 3HONA 4DDSA 3B6FA 3REKA 3PBSA 3AZMD 1FCNA 5DTTA 5CPJB 2F8NB 2XR0A 5KSHA 4EUZA 2RVQC 5F1FA 5AV9D 4F94A 2WGWA 2DCFA 2ZY4A 3N6IA 5KSCA 4WZ5A 1PZPA 4LD9D 1P3AA 2HIOD 5B2JC 3NDEA 1RGZA 3IHBA 4KZ3A 3VH6T 4E3KA 1ESIA 2PYOD 1P3IB 4LV3A 2H0TA 3MGRC 1GHIA 3O62B 3AN2C 4WJ3C 3MGSA 3EPJA 3F6TA 5B2ID 1P3KA 3O3VA 2E8IA 2Z2MB 2Y55A 3FZCA 5JA4A 1KGEA 3IWIA 1S32A 4YM6C 1IELA 3Q82A 3UTBC 1LL5A 1J9MA 2DF4C 1P34A 3E2KA 1AOIB 1HQ3C 2Y2JA 1P3MA 2Y4AA 4R0QA 2ZY5A 4KGCA 5BNXA 3DWZA 2X01A 4X23C 2HUEB 3LZ0B 4X68A 5AY8C 4Z5TB 2J9OA 4ID4A 2YFWA 3W99B 3REKB 1O7EA 3ZVTA 2JBFA 4HGAB 4FSFA 4UHUA 5CPJD 3PBOA 4J8VC 5F82A 5AV5C 3AZKA 2F8ND 1SDEA 4WMCD 3DWKA 2WGWB 1DJAA 3C7UA 2IO5C 1M18C 4H9RA 3V5MA 3MVDC 1I2SA 1Q2PA 5M19A 5A92A 2IWCA 3AZGA 1ULYA 3ZDJA 3AL0C 3AFAA 5GT3B 1P3ID 5CPKC 5FUGA 4R3BA 4AWLC 3O62D 4KHAA 2C5WB 5C3IB 3AZMC 3VH5T 4JXGA 3OPHA 1KX5C 2QMIA 4HBTA 5HAPA 5AV9C 1P3GA 5GXQA 1ERMA 5JA4B 1WE4A 4ZAMA 2ZC7A 3L27A 3REHA 1I2WA 3UPOA 2CC1A 4ZDXA 2PYOC 3TU4A 2EFXA 4H9SA 4GD8A 5B40C 4MEZA 3H0RC 1AOID 3V39A 3AZHA 1P3MB 3BFFA 5JRGD 5AQAA 4KGCB 5B2IC 4EQIA 1PIOA 3UDXA 5DTSA 3MZDA 1ES5A 2XD1A 4DE0A 3LZ0D 4JLFA 4Z5TD 3NIAA 4WU9C 3S1YA 3W99D 1M1AD 4OJOA 4E45A 1ZLAD 4CJNA 1NY0A 3OPPA 3AV1D 5BO0B 1L0EA 3AZKB 4ZBJB 5GLBA 3M6HA 5B32A 4LG2A 1KX3A 3AZFB 4EBNA 4C3QA 4KZ5A 5DF7A 3G2YA 4QU3A 1U35C 5B0ZA 5E2GA 3LZ1B 5GT3D 5FUGB 3WAAA 4JF5A 4JKTA 1EQZB 1NXYA 2F8NG 3AZIB 3HLFA 2AROA 4WELA 1DY6A 1P3OB 5CPJC 5AVCA 3MXRA 3R45A 1KE0A 1B6WA 3NDGA 5GXQB 2QPNA 4B4ZA 3AZEB 4IJFA 4XUXA 5FQMA 3FWLA 3B6GB 2WKHA 3MGQA 1ES2A 3ZNYA 3TU4B 1P3IC 3WRZA 1MBLA 4K91A 3AGEA 3PBTA 3AZHB 4WEJA 3O62C 2ZQ9A 2H10A 5GLCA 1ID3A 5EVID 1CEFA 3GQZA 2WGIA 5DNND 2Y59A 3N3FA 1BFMA 3MKFA 3ITBA 3TOIA 3WS0A 3Q7VA 4NYUA 5FI2A 3KUYA 5CPIA 3A3DA 4JJNA 1JTGA 3UY6A 5HX9A 4BENA 1BH9B 1AOIC 5KMWA 3ITAA 1S6RA 3IWOA 1KX3B 4YFMA 3LJAB 3AZFD 4P85A 4E3LA 1B67A 2HDUA 3LZ1D 3REIA 2HUEC 3LZ0C 4Z5TC 3X1VA 4KZ9A 3VOYA 1EQZD 3W99C 5CP6D 3AZID 2JSSA 3REKC 4NZ1A 4HGAC 1P3OD 2WZXA 2LY8A 2YFVA 3X1SA 5B24B 3AV2B 4IBXA 3G34A 3NCKA 1P3BA 3G2ZA 5JYPA 3PBRA 3AZED 4BD0A 1Q9CA 1PW1A 3WX7A 1FR6A 3MGQB 3B6GD 3BRMA 2XD5A 5GT3C 3BLSA 3UDFA 4OJPA 2ZMAA 2VQRA 4R8PA 5AV8D 4E44A 5AQBA 4LCLA 4QJGA 4KENB 5C3IC 3BFGA 5CHJA 1ID3B 4KZ8A 4WYYA 3IF6A 1TZYB 1BT5A 1JWPA 3LY3A 5AVBB 3AYWB 2G5HC 2EX6A 2OV5A 4OPQA 1F66A 2B5RA 3LO7A 4E3MA 3IHAA 3N4IA 2Y2QA 5B1MA 1P3PD 1M19D 2IOUA 1U60A 3Q7VB 3ZHHA 5BNVB 3KUYB 5CPIB 4LV1A 4NETA 3ZGAB 1P3MC 4H9OB 4Y0UA 5B0YA 1P3FA 1L2SA 3VH6W 4KGCC 4KUDA 3VFFA 4U3TA 1TAFB 3REIB 2NZDA 4X53A 3L29A 5TFQA 4YS3D 5A93A 3M2JA 3KS4A 3REJA 3C4PA 1BH8A 1CI8A 2JE5A 1W7FA 3O88A 1K56A 3AZKC 3S22A 2RIQA 5B24D 4ZBJC 3AV2D 4GZBA 3MGPA 4RYEA 1Q2QA 2WGVA 3FV7A 5CGWA 3AZFC 3WA9B 3VMAA 2G2UA 3RELA 1YU2A 3OZHA 5DF8A 1G6AA 3LZ1C 4OOLA 3HL9A 1YU4A 4DDYA 3MNNA 3AZJB 3WTPE 1EQZC 1BZAA 5M1AA 4J8XA 3AZIC 4J8WB 4LV0A 1P3OC 4S2NA 1M6KA 1FR1A 2CV5A 1TZYD 1IEMA 4IBGA 5GSUA 4S2LA 5AVBD 3AGFA 3EPLA 4ZUXA 5GXQC 3AYWD 3AZEC 4XUJA 3MBZA 5BOHA 3B6GC 4GHLA 1XA7A 1FSWA 4XXRA 3TU4C 1GHPA 1H3OB 2ZQCA 3AZHC 3ZVWA 3P5JB 5B0YB 2Y2OA 2FJ7B 4KUDB 2NQBB 1BTLA 3CJMA 4N1HA 5BS7A 3MGRD 1WYBA 3REJB 4GDNA 3X1UA 3VH5W 3G4PA 2I72A 1CI9A 4M6BA 2ZC3B 4YINA 4OOYA 4LCMA 4OQHA 2OLVA 3WRTA 1KX3C 3LJAC 5EOOA 3RELB 3WA9D 3AZNB 3IF5A 1HTAA 3I7JA 5FI6A 3MNNB 4C75A 4WNNB 3AZJD 3OCLA 5E2EA 4R4RA 5CGSA 4J8WD 5U47A 2R9WA 1N1JA 5B24C 3AV2C 1KX4A 3N7WA 4JF4A 3LEZA 4X23D 3KS8A 4JXSA 5AY8D 3N8SA 3VP1A 2Y2IA 1KDSA 2ZJ9A 4DE3A 3MGQC 3SOIA 1VQQA 5AV5D 4Z9QA 4BLMA 5DF9A 5FASA 2HDSA 3C7VA 4RX3A 4NZ5A 3VSLA 3MVDD 1ID3C 3WKJA 4HBUA 2FJ7D 1TZYC 3HLEA 2NQBD 5AVBC 3W96A 1EI5A 4Z66B 3AYWC 3FDDA 5CPKD 4PM6A 3X1UB 1FQGA 4WM9A 3V50A 3B0BA 4CSRA 4G91B 3KUYC 5CPIC 4H9QB 1KX5D 4NE3A 3W97A 3WS2A 4U0XA 4Z2MH 4R23A 5DNMB 5GHZA 4QY6A 3AZND 1T3UA 5FAPA 3WS5A 3REIC 3HSHA 1YQSA 5B40D 2XF3A 3AZLA 3BLMA 3N8LA 1N1JB 1BLCA 2J9PA 4OPZA 4DRTA 5TR7A 3VFHA 1GA0A 4CAYA 1W8QA 4X55A 5E5AA 3L28A 3SH7A 4WU9D 1FCOA 3WA9C 5F99A 4KZ4A 1E25A 5CTNA 3X1TA 3LELA 3AZJC 1L0FA 4BL2A 4J8WC 3WKJB 5B31A 1QMEA 4K0WA 5FAQA 4O7DA 5CEDA 1U35D 3W96B 4Z66D 3ZG0A 3EPHA 1W79A 3MFDA 5EECA 3ISGA 3NQJA 1YLYA 4OP5A 2F8NH 3B6FB 2ZQ8A 2XEPA 1ONHA 4CSRB 3NY4A 1IYQA 1K57A 2Y2LA 1WWSA 1C3BA 4NY2A 1BLPA 1HD8A 4MLLA 5A90A 5B0YC 5DNMD 3JYIA 1P3AB 4N1XA 5GT0A 2FJ7C 5KZHA 4KUDC 4DE2A 1P3LA 1I5QA 2NQBC 3ZFZA 1JVJA 5EOEA 5CXWA 4KG6A 2H0YA 3REJC 3MGSB 1SCWA 5AV6A 5JYOA 1MKIA 4PM5A 1P3KB 5M18A 1HVBA 2P9VA 2J8PA 5E5AB 1LI0A 1S32B 5F99B 3RELC 4ZJ3A 3AZNC 2ZM5A 2IWBA 4XZQA 2HP5A 1P34B 4X56A 3MNNC 3G30A 2PU2A 4ZJ1A 3HLBA 5I94A 5B33A 5BNXB 4CPKA 4IBRA 1K25A 2FFYA 5EPHA 3CMZA 4N9KA 3NQJB 2YFWB 1XP4A 1E3UA 5GL9A 3B6FD 3REKD 1L0DA 5F83A 3WS4A 4H9RB 3Q81A 1P3AD 4B88A 3AZGB 1XKZA 5G49A 3AFAB 1M19A 4OOMA 3HUOA 4Z66C 4IBIA 2G5IC 3QNCA 1BULA 2XQZA 1W5DA 4KHAB 1W8YA 4NE6A 3MGSD 4J8UA 1R4VA 2WKIA 4NFTA 4G91C 3L26A 1P3KD 5HAIA 4Y0OA 2BYMA 3PAEA 1P3GB 2P9VB 1KVMA 4OVDA 5DNMC 1S32D 1OMEA 3REHB 3HLWA 3HUMA 4FD8A 4IVIA 3IXGA 3V3RA 3A6NA 5B1LA 1P34D 3W8KA 3WTPA 4RVAA 3GMWA 1P3MD 2BG1A 3UTAA 5CHLB 4KGCD 1MXOA 1JFIA 1Z6FA 1K54C 1TDLA 1IYSA 3NQUA 4EO5B 2ZY2A 2A3UA 2UWXA 4L0LA 3C1BA 4WU8A 3ZNTA 3V9RA 1F1EA 3C1CA 1YMXA 2ZC6B 3AZKD 5B32B 3O87A 4MBFA 3B0CT 3AZGD 4QHCA 5B0ZB 4FH4A 3BFCA 3UNWA 3AFAD 3W96C 1HZOA 3WAAB 1CEGA 3GVBA 4DRAA 4EV4A 2ZC5B 3B6FC 4IEDA 5GHYA 4J8UB 2AROB 5AVCB 1YUEA 2BYMB 5B2JA 3R45B 3KWQA 4MNRA 4IBKA 1P3GD 2IWDA 3A1IA 5GXQD 3PAGA 3LY4A 1JTDA 2J8YA 4WZ5C 1ONGA 1P3AC 3REHD 4M3KA 3AN2A 3TU4D 5L2FA 2H5SA 1YMSA 4S2IA 3AZHD 4X6TA 3MGSC 3UTAB 3BFDA 4XUZA 1PI5A 1P3KC 1ES3A 3TG9A 4YM6A 3UTBA 4KZBA 3NQUB 1KE3A 5FQIA 2EX2A 1S32C 5F99C 3V9RB 3L2AA 4PMAA 1RGYA 1HQ3A 5FA7A 5CHUA 3C1CB 3A3IA 4QLCA 4JJNB 1P34C 1XPBA 4GOGA 3UT9A 4JBFA 1RP5A 5BT1C 4UPKA 5B32D 3BM6A 1KX3D 3RXWA 3LJAD 3IWQA 3A3EA 2DNSA 4H9NA 5B0ZD 3KXBA 4UUZA 3X1VB 3RXXA 4J8VA 4S2JA 1ESUA 2ZM0A 2AROD 1M18A 3W98A 1YT4A 5CECA 2YFVB 5E43A 3X1SB 3VP2A 1K57C 5AVCD 3KWQB 4GB7A 1P3BB 4D2OA 2OLUA 1BUEA 3A1KA 1N4OA 3AZGC 1H8YA 3MGQD 3AFAC 5BPVA 3QHYA 3AZMA 5HL1A 5FQ9A 4R8PB 5AV9A 3GTCA 1M40A 1ID3D 2Y2KA 3C5AA 3IF6B 4LD9A 4WZSB 2HIOA 3DW0A 4QY5A 1P3GC 2PYOA 4MBHA 5HFOA 1F66B 3REHC 5B40A 4OQIA 5B1MB 2L5AA 4H9SC 4QLCB 3KUYD 5CPID 4JJND 4IJEA 5B2IA 1KDWA 3UT9B 1ZG6A 4GN2A 4WZ4A 1P3FB 3VP0A 4H9NB 2Q9NA 3KXBB 4DXBA 2NZDB 3REID 2XH9A 2XGNA 4EO5C 3X1VD 4N9LA 2ZM8A 3E2LA 3OCNA 5FQJA 1BH8B 2C6WB 3N8RA 4H8RA 4NE5A 3WS1A 3W98B 5B32G 2QZ6A 2FFFB 3TSGA 3Q7ZA 4OJ6A 3MGPB 2Y2NA 4B4XA 2HDQA 1P3BD 5B32C 3IQAA 5HARA 3H0MC 1ZKJA 5B0ZC 3HREA 3DTMA 2V2FF 1IYOA 2XK1A 3WAAC 3FKVA 5CPJA 3MKEA 3Q1FA 4R8PD 2F8NA 4J8XB 4EBPA 4WMCA 3G31A 4IBEA 5FSRA 4J8UC 2VGKA 2AROC 4IBCA 4U0TA 4LD9B 2CWEA 2CV5B 5AVCC 2HIOB 5GSUB 4ZUXB 1TVFA 1P3IA 3WWXA 3EG5B 1LHYA 4E6WA 4A5RA 1F66D 4XUJB 1Y54A 4NYYA 3O62A 5B1MD 5DTKA 1BSGA 4QD4A 1SDNA 5E2HA 4KG5A 4JPMA 5AQ9A 5EUAA 1YU1A 1YM1A 2ZQAA 4PM8A 3UTAC 5B0YD 1P3FD 2Y91A 3HLCA 2HDRA 1K4FA 4KUDD 4DE1A 5FAOA 2NZDD 3UE0A 1E4DA 1AOIA 3REJD 5JRGA 3V3SA 1K56D 4JJNC 2P74A 4DQYB 3MGPD 4BL3A 3LZ0A 4Z5TA 3RELD 1SKFA 1M1AA 3W99A 3LCEA 1K55A 1YLZA 1ZLAA 3C4OA 4DF6A 4JXWA 3AV1A 1LI9A 3X1VC 4S2OA 3MNND 4C6YA 2Y2MA 4Y7PA 4J8XD 3ZG7B 3HVFA 2WUQA 2ZQDA 1K6SA 1YLJA 2EFUA 4OP8A 3X1SC 1DJCA 2CV5D 3KWQC 1KX4B 5GSUD 4PPRA 1P3BC 1NRFA 4LV2A 4E3OA 4ZUXD 5E2FA 5GT3A 1KGGA 4KQRA 5CHMA 4XUJD 1VM1A 2ZQ7A 3VH5A 2ZC4B 4IBBA 4ZTKA 3CG5A 3FKWA 3OC2A 1PI4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CK3 A;  4LCL A;  4B88 A;  4QJG A;  4S2M A;  1XKZ A;  3ZG9 B;  4KEN B;  3BFG A;  1IKG A;  3UPP A;  2WAF A;  3M6B A;  5CHJ A;  4OOM A;  5TGF A;  3HUO A;  1MPL A;  4KZ8 A;  4WYY A;  3PBQ A;  2EXB A;  1YLP A;  3IF6 A;  1BT5 A;  1JWP A;  3QNC A;  1BUL A;  2XQZ A;  1W5D A;  1YLT A;  3LY3 A;  3OPL A;  3UE3 A;  3IF6 C;  2HP6 A;  2A49 A;  1W8Y A;  2EX6 A;  4KG2 A;  2HPB A;  4E3J A;  2WKI A;  2OV5 A;  4OPQ A;  1JWV A;  2B5R A;  4PM9 A;  3LO7 A;  4E3M A;  2OSU A;  5HAI A;  3IHA A;  4E6X A;  3N4I A;  3HBR A;  4Y0O A;  5AQ7 A;  2Y2Q A;  1U60 A;  3Q7V B;  3ZHH A;  3BEC A;  3PAE A;  3GR2 A;  2P9V B;  1KVM A;  3UPN A;  1XGJ A;  4LV1 A;  3BFE A;  4OVD A;  3GSG A;  4NET A;  3ZGA B;  1OME A;  3GV9 A;  5EVI A;  4N92 A;  3HLW A;  4Q8I A;  3HUM A;  4FD8 A;  4Y0U A;  1BLS A;  4IVI A;  3IXG A;  1JWZ A;  1ALQ A;  1L2S A;  2G2W A;  5CEB A;  3V3R A;  3G35 A;  3IH8 A;  3W8K A;  2WAE A;  3VFF A;  1FOF A;  2BLS A;  4RVA A;  1PWG A;  4QB8 A;  4U3T A;  4X53 A;  3GMW A;  4S2K A;  4KQQ A;  5J8X A;  5TFQ A;  3EQV A;  2BG1 A;  5A93 A;  1K54 A;  3M2J A;  5EVL A;  5FDH A;  3NBL A;  3IH9 A;  5HAQ A;  1MXO A;  2WK0 A;  5FQK A;  1N9B A;  3C4P A;  4JF6 A;  1Z6F A;  1AXB A;  1K54 C;  2JC7 A;  1TDL A;  2WYX A;  1CI8 A;  1IYS A;  2JE5 A;  1EWZ A;  1KVL A;  1W7F A;  1K56 A;  3O88 A;  1YLW A;  3IXB A;  1MWS A;  5G18 A;  3S22 A;  2J7V A;  3VP4 A;  2A3U A;  2UWX A;  4GZB A;  4L0L A;  4RYE A;  1LLB A;  5CRF A;  3ZNT A;  1ZG4 A;  3PBN A;  4OLD A;  1Q2Q A;  2WGV A;  3FV7 A;  1NYY A;  3HLD A;  4ZBE A;  2PBY A;  5CGW A;  3UDI A;  1YMX A;  2XFS A;  3HLG A;  2ZC6 B;  2G2U A;  4WBG A;  3VMA A;  4OKP A;  3VOZ A;  1XGI A;  4P0M A;  3VP3 A;  3OZH A;  2XDM A;  2HP9 A;  5DF8 A;  1G6A A;  4OOL A;  3HL9 A;  1WYC A;  4UA7 A;  4BD1 A;  3SH9 A;  4DDY A;  3SS4 A;  4Y0T A;  2ZLY A;  4KZ6 A;  3CZD A;  3EQU A;  2ZM2 A;  1BZA A;  4HEF A;  5M1A A;  3P98 A;  3O87 A;  4R1G A;  5F1G A;  4MBF A;  5IHV A;  3D4F A;  4QHC A;  5HW3 A;  4FH4 A;  4OPR A;  3BFC A;  3UNW A;  4LV0 A;  5CGX A;  4S2N A;  5GHX A;  2EXA A;  1HZO A;  1M6K A;  1CEG A;  1FR1 A;  4DDS A;  3GVB A;  1IEM A;  4EV4 A;  3S4X A;  3UN7 A;  2ZC5 B;  4S2N C;  4FCF A;  4S2L A;  3AGF A;  3OPR A;  3PBS A;  5DTT A;  1FCN A;  4IED A;  2Y2G A;  5GHY A;  2ZD8 A;  2XR0 A;  5KSH A;  4EUZ A;  5F1F A;  3MBZ A;  5BOH A;  4F94 A;  3O86 A;  4PM7 A;  1XA7 A;  2WGW A;  4MNR A;  1NYM A;  1FSW A;  4XXR A;  2DCF A;  3N6I A;  4BQM A;  5KSC A;  1GHP A;  4WZ5 A;  1PZP A;  2IWD A;  3NDE A;  3PAG A;  3LY4 A;  1JTD A;  2J8Y A;  1RGZ A;  3IHB A;  4KZ3 A;  4WZ5 C;  4E3K A;  3IT9 A;  1ESI A;  1ONG A;  2ZQC A;  5EVI B;  4M3K A;  3ZVW A;  4LV3 A;  2H0T A;  2Y2O A;  1GHI A;  2XLN A;  5L2F A;  2H5S A;  1GA9 A;  1YMS A;  1BTL A;  4S2I A;  3BYD A;  4X6T A;  3G32 A;  3CJM A;  3NI9 A;  4N1H A;  3BFD A;  3O3V A;  1ERQ A;  2E8I A;  4XUZ A;  2Z2M B;  5D3O A;  1PI5 A;  1WYB A;  3UE1 A;  1ES3 A;  4GDN A;  3TG9 A;  2Y55 A;  3G4P A;  2I72 A;  3FZC A;  3A3J A;  1CI9 A;  1KGE A;  3GRJ A;  3IWI A;  4KZB A;  2WAD A;  4OQG A;  1KE3 A;  1IEL A;  5FQI A;  3Q82 A;  3SH8 A;  2ZC3 B;  2EX2 A;  4OQ0 A;  4YIN A;  4OOY A;  5A91 A;  4LCM A;  1LL5 A;  1TEM A;  4OQH A;  1J9M A;  4PMA A;  1RGY A;  5FA7 A;  2OLV A;  3WRT A;  3ZG8 B;  3E2K A;  5CHU A;  3A3I A;  5EOO A;  2Y2J A;  1XPB A;  3IF5 A;  2Y4A A;  4OON A;  4R4S A;  4GOG A;  4KZ7 A;  2PU4 A;  1BLH A;  3VSK A;  1ZC2 A;  2XFT A;  4JBF A;  4R0Q A;  1RP5 A;  4UA6 A;  3DWZ A;  3I7J A;  5FI6 A;  3BM6 A;  3RXW A;  4C75 A;  2X01 A;  3IWQ A;  3A3E A;  4DKI A;  2DNS A;  3OCL A;  1XA1 A;  5E2E A;  4X68 A;  2J9O A;  4R4R A;  4ID4 A;  5CGS A;  1MY8 A;  4LEN A;  5U47 A;  2R9W A;  3ZCZ A;  2Y2P A;  3RXX A;  1IKI A;  1NZU A;  3N7W A;  4JF4 A;  1O7E A;  4S2J A;  3ZVT A;  2JBF A;  3LEZ A;  1ESU A;  3B3X A;  4FSF A;  1H8Z A;  4UHU A;  2RCX A;  1KGF A;  4JXS A;  3PBO A;  1K38 A;  5F82 A;  3UO9 A;  2ZM0 A;  3Q07 A;  3N8S A;  1SDE A;  3VP1 A;  1YT4 A;  2Y2I A;  1KDS A;  3A3F A;  2ZJ9 A;  4WMC D;  5CEC A;  3DWK A;  5E43 A;  3VP2 A;  1K57 C;  2WGW B;  1DJA A;  3C7U A;  4GB7 A;  1PWD A;  3SOI A;  4DE3 A;  3V5M A;  1I2S A;  1Q2P A;  5M19 A;  4E3I A;  5A92 A;  4D2O A;  2OLU A;  2Z2L B;  2IWC A;  1GHM A;  1BUE A;  3ZDJ A;  1VQQ A;  2GDN A;  3MZE A;  4Z9Q A;  4BLM A;  1NZO A;  1N4O A;  4GDB A;  5DF9 A;  5FAS A;  2HDS A;  3C7V A;  4RX3 A;  3BEB A;  4HES A;  3W4Q A;  1H8Y A;  3VSL A;  4R3B A;  2EX9 A;  3QHY A;  4HBU A;  5HL1 A;  3HLE A;  3MZF A;  2C5W B;  5FQ9 A;  4E3N A;  3FYZ A;  2RL3 A;  1EI5 A;  4JXG A;  3OPH A;  1MWR A;  3GTC A;  4ZJ2 A;  2QMI A;  1M40 A;  4HBT A;  4PM6 A;  5HAP A;  2Y2K A;  3C5A A;  3IF6 B;  4FH2 A;  4GD6 A;  1FQG A;  3DW0 A;  1ERM A;  1WE4 A;  4QY5 A;  4WM9 A;  4ZAM A;  3V50 A;  1FSY A;  1MWU A;  2ZC7 A;  4EWF A;  4MBH A;  1I2W A;  3UPO A;  2CC1 A;  5HFO A;  4GNU A;  4ZDX A;  3WS2 A;  4P6B A;  2EFX A;  1ERO A;  4OQI A;  1K6R A;  4U0X A;  3IXD A;  4R23 A;  3P09 A;  4GD8 A;  4OLG A;  4MEZ A;  5GHZ A;  1PZO A;  3V39 A;  4QY6 A;  3BFF A;  2WZZ A;  1KDW A;  1ZG6 A;  2V20 A;  4GN2 A;  5FAP A;  3IXH A;  5AQA A;  3WS5 A;  5GLA A;  4WEK A;  1KE4 A;  4WZ4 A;  4EQI A;  1K55 C;  1XX2 A;  1PIO A;  1YQS A;  5DTS A;  3UDX A;  4RX2 A;  3MZD A;  3VP0 A;  1ES5 A;  2XF3 A;  2XD1 A;  4DE0 A;  4NK3 A;  4JLF A;  2Q9N A;  3NIA A;  3BLM A;  3S1Y A;  4BJP A;  3N8L A;  1QMF A;  4DXB A;  2XH9 A;  2XGN A;  1FCM A;  1BLC A;  4N9L A;  2DRW A;  2J9P A;  4OPZ A;  2ZM8 A;  4DRT A;  5TR7 A;  3E2L A;  4CJN A;  1NY0 A;  3OPP A;  3OCN A;  3VFH A;  1GA0 A;  1H5X A;  5FQJ A;  1L0E A;  2C6W B;  3N8R A;  4H8R A;  1W8Q A;  4IVK A;  1IYP A;  4X55 A;  5DVA A;  3WS1 A;  1PW8 A;  1FCO A;  3SH7 A;  5GLB A;  2QZ6 A;  3RJU A;  4X69 A;  2FFF B;  3TSG A;  3PTE A;  1MWT A;  4KZ4 A;  3Q7Z A;  3M6H A;  1E25 A;  5CTN A;  3SS5 A;  2Y2N A;  4B4X A;  2HDQ A;  4EBN A;  1E3U D;  4C3Q A;  4KZ5 A;  5DF7 A;  3G2Y A;  3IQA A;  4QU3 A;  5HAR A;  5E2G A;  3QNB A;  3AGD A;  1ZKJ A;  1L0F A;  4UA9 A;  3HRE A;  3DTM A;  4JF5 A;  4JKT A;  4BL2 A;  1NXY A;  2V2F F;  1TDG A;  1IYO A;  4K0W A;  1QME A;  5FAQ A;  2X71 A;  2XK1 A;  4O7D A;  5CED A;  3FKV A;  2R9X A;  3MKE A;  3Q1F A;  4DXC A;  3HLF A;  4WEL A;  1DY6 A;  4EBL A;  4EBP A;  4WMC A;  3ZG0 A;  3MXS A;  3G31 A;  1W79 A;  3MFD A;  5EEC A;  5FSR A;  2VGK A;  5FI7 A;  3ISG A;  4U0T A;  3MXR A;  1YLY A;  1KE0 A;  4OP5 A;  3NDG A;  2QPN A;  4B4Z A;  2ZQ8 A;  2XEP A;  4MBK A;  1ONH A;  1NJ4 A;  1TVF A;  4XUX A;  3NY4 A;  1IYQ A;  5FQM A;  3WWX A;  1K57 A;  3FWL A;  1LHY A;  4E6W A;  2WKH A;  2Y2L A;  1ES2 A;  1C3B A;  3ZNY A;  4A5R A;  5EVI C;  1BLP A;  1HD8 A;  1Y54 A;  4R3J A;  2Q9M A;  4KZA A;  3WRZ A;  1MBL A;  2VGJ A;  3ZG5 A;  5DTK A;  4MLL A;  5A90 A;  4K91 A;  1BSG A;  3JYI A;  3AGE A;  3PBT A;  3W4P A;  4N1X A;  4QD4 A;  4WEJ A;  2ZQ9 A;  5KZH A;  2H10 A;  1SDN A;  5E2H A;  4DE2 A;  1I5Q A;  1ES4 A;  4KG5 A;  4JPM A;  5AQ9 A;  5GLC A;  3SS3 A;  5EUA A;  5EVI D;  1YM1 A;  2ZQA A;  4GKU A;  4RA7 A;  4PM8 A;  3ZFZ A;  1CEF A;  1JVJ A;  3GQZ A;  4K0X A;  2WGI A;  5EOE A;  5CXW A;  4KG6 A;  2Y91 A;  3HLC A;  2H0Y A;  2HDR A;  1K4F A;  2Y59 A;  4OH0 A;  1SCW A;  4DE1 A;  5FAO A;  1HTZ A;  3MKF A;  5JYO A;  1MKI A;  4PM5 A;  5CER A;  2EX8 A;  3ITB A;  1GCE A;  3TOI A;  3WS0 A;  3UE0 A;  5M18 A;  3Q7V A;  5FI2 A;  1E4D A;  1HVB A;  2P9V A;  3A3D A;  1SHV A;  1JTG A;  3UY6 A;  5HX9 A;  4BEN A;  1DJB A;  1LI0 A;  3V3S A;  1S0W A;  3W4O A;  5KMW A;  1K56 D;  3ITA A;  4ZJ3 A;  2P74 A;  2X02 A;  1S6R A;  3IWO A;  5EE8 A;  4YFM A;  4P85 A;  2IWB A;  4E3L A;  4BL3 A;  2HP5 A;  4X56 A;  5FAT A;  3G30 A;  2PU2 A;  2HDU A;  4KQO A;  5FQQ A;  4ZJ1 A;  3HLB A;  5I94 A;  1SKF A;  1O07 A;  3HUN A;  3LCE A;  1K4E A;  1PWC A;  1XXM A;  1K55 A;  4KZ9 A;  1YLZ A;  3VOY A;  3C4O A;  4DF6 A;  4JXW A;  4CPK A;  4P87 A;  4IBR A;  4OPY A;  1LI9 A;  4S2P A;  4S2O A;  1K25 A;  4C6Y A;  2Y2M A;  4JXV A;  2FFY A;  2Y2H A;  1PYY A;  4Y7P A;  3ZG7 B;  5EPH A;  2WZX A;  3CMZ A;  3HVF A;  2WUQ A;  4N9K A;  2ZQD A;  1K6S A;  3NC8 A;  4IBX A;  5GLD A;  1YLJ A;  2EFU A;  3G34 A;  3NCK A;  1XP4 A;  4OP8 A;  2V1Z A;  1E3U A;  1DJC A;  3G2Z A;  5GL9 A;  5JYP A;  3PBR A;  1G68 A;  1LL9 A;  4PPR A;  4BD0 A;  1NRF A;  4LV2 A;  4E3O A;  1PW1 A;  5E2F A;  4UAA A;  1KGG A;  1FR6 A;  2WKE A;  1L0D A;  3BRM A;  4KQR A;  2XD5 A;  5CHM A;  5CTM A;  5F83 A;  3WS4 A;  3BLS A;  3UDF A;  1VM1 A;  1RCJ A;  2ZQ7 A;  2ZC4 B;  2ZMA A;  4ZTK A;  3CG5 A;  3Q81 A;  3FKW A;  3OC2 A;  1L0G A;  5AQB A;  1PI4 A;  3M2K A;  2JCH A; 
#chains in the Genus database with same CATH topology
 2D02 A;  4S2M A;  1F98 A;  4R8P C;  3ZG9 B;  1T19 A;  2J3T C;  2WAF A;  5TGF A;  3LYX A;  1MPL A;  3B0C W;  3K3C A;  3OPL A;  3H7W A;  3IF6 C;  2A49 A;  2L0W A;  4KG2 A;  2HPB A;  4E3J A;  3T1X A;  1JWV A;  2OSU A;  3HBR A;  1SKO B;  4DMZ A;  1F66 C;  4O0P A;  3B42 A;  4D60 A;  3UPN A;  1XGJ A;  3X1U D;  5B1M C;  5JRG B;  3GSG A;  3L7H A;  1PZR A;  4IBD A;  4QLC C;  2W8S A;  3V67 A;  3GV9 A;  5EVI A;  1UWP X;  4N92 A;  3W97 B;  4Q8I A;  3UT9 C;  3F1P B;  1JWZ A;  5F5Y A;  5DNN A;  3G35 A;  1FOF A;  1P3F C;  2BLS A;  3T12 B;  1PWG A;  4QB8 A;  3F1O B;  1M1A B;  4S2K A;  3EGX C;  3CIT A;  4ETX A;  1GOI A;  3KXB C;  1ZLA B;  1EW0 A;  2NZD C;  5EVL A;  5FDH A;  1TS0 A;  3IH9 A;  3AV1 B;  5HAQ A;  1YKD A;  5BO0 A;  4JF6 A;  2JC7 A;  2JKT I;  1EWZ A;  1KVL A;  1YLW A;  3WD4 A;  3AZL B;  5G18 A;  2J7V A;  3W98 C;  5G4Z A;  3AZF A;  1LLB A;  3PBN A;  4OLD A;  3HLD A;  1KX4 D;  1NYY A;  4ZBE A;  3MGP C;  2PBY A;  3UDI A;  3MR0 A;  1YU0 A;  1S1Y A;  3LZ1 A;  3HLG A;  4CAY B;  4OKP A;  1XGI A;  1Z09 A;  4P0M A;  3VP3 A;  2XDM A;  4GH9 A;  2HP9 A;  1EQZ A;  4BD1 A;  5CP6 A;  3SH9 A;  3AZI A;  1UR9 A;  3X1T B;  4NXG A;  3SS4 A;  1NLZ A;  4Y0T A;  3LEL B;  2ZLY A;  3CZD A;  3EQU A;  2ZM2 A;  3P98 A;  4R1G A;  1P3O A;  1FIK A;  3KSF A;  3CWF A;  4J8X C;  2GJ3 A;  5CGX A;  5GHX A;  2EXA A;  4Z2M G;  3MQL A;  3S4X A;  3UN7 A;  5B31 B;  3AZE A;  4S2N C;  4FCF A;  3WKJ D;  3OPR A;  4LD9 C;  2CV5 C;  2HIO C;  4I3A A;  2Y2G A;  1E15 A;  2ZD8 A;  5GSU C;  3B6G A;  4M4X A;  2GNX A;  4ZUX C;  3W96 D;  1E6N A;  1IFQ A;  1GXD A;  3O86 A;  4PM7 A;  3NJA A;  1NYM A;  1YAX A;  4BQM A;  5AV8 A;  4XUJ C;  2VV6 A;  3IT9 A;  2PHY A;  5EVI B;  1TS6 A;  3QP5 A;  3W97 D;  2Z6C A;  4I3I A;  4G92 B;  2XLN A;  1GA9 A;  5DNN B;  4LLO B;  4GHI A;  2BYK A;  4X1L A;  5GT0 B;  3BYD A;  3G32 A;  1P3L B;  3H0L C;  3NI9 A;  1P3P A;  3RFB A;  1ERQ A;  3OOV A;  5D3O A;  3UE1 A;  5BS7 C;  3A3J A;  3GRJ A;  2KLI A;  4OQG A;  2WAD A;  1BH9 A;  3LI9 A;  3X1U C;  5AV6 B;  2VV8 A;  1VEU B;  3SH8 A;  4OQ0 A;  3AZL D;  1OT6 A;  5A91 A;  3LJA A;  1TEM A;  3B33 A;  3ZG8 B;  1S1Z A;  1E6Z A;  1E88 A;  4IBJ A;  4H9P A;  4OON A;  5E5A D;  4R4S A;  4KZ7 A;  2PU4 A;  1BLH A;  3VSK A;  1ZC2 A;  4YS3 A;  2XFT A;  5F99 D;  4UA6 A;  5CP6 B;  5EM1 A;  3X1T D;  3KSY A;  3A0S A;  4DKI A;  3LEL D;  4XZQ B;  1XA1 A;  4NZ4 A;  2EWV A;  4IUK A;  3CAX A;  5B24 A;  4G3W A;  3AV2 A;  1MY8 A;  4LEN A;  5BT1 D;  2V1A A;  4FUW A;  3ZCZ A;  2Y2P A;  1IKI A;  1NZU A;  5B33 B;  5KDM A;  4OJL A;  5B31 D;  4ZRR A;  3B3X A;  1H8Z A;  2RCX A;  1KX4 C;  1KGF A;  1K38 A;  3UO9 A;  3Q07 A;  3A3F A;  5AVF A;  1XFN A;  1PWD A;  1LSX A;  4JGP A;  5AV8 B;  3GDI A;  2KX6 A;  3UB6 A;  4E3I A;  1OTD A;  2Z2L B;  4Y2F A;  1GHM A;  2ZOI A;  2GDN A;  3MZE A;  1NZO A;  3MQ0 A;  4GDB A;  3B0D B;  3BEB A;  4HES A;  3W4Q A;  1TZY A;  2YKF A;  2VGL S;  2EX9 A;  3DTE A;  5AVB A;  3AYW A;  4GHI B;  4Q0J A;  3MZF A;  4IBF A;  2BYK B;  4E3N A;  4EXO A;  3FYZ A;  3WKJ C;  2RL3 A;  5GT0 D;  2L1M A;  5G49 B;  4NZ3 A;  1P3L D;  1MZU A;  1P3P B;  1M19 B;  1MWR A;  4ZJ2 A;  3KYE A;  3T4T A;  4FH2 A;  4GD6 A;  5BNV A;  3IX3 A;  4JGQ A;  1FSY A;  1MWU A;  2QJ7 A;  4EWF A;  2G7U A;  5DJT A;  5AV6 D;  5JRG C;  4H9O A;  4GNU A;  2HZ5 A;  3JPU A;  4P6B A;  1ERO A;  1K6R A;  3W97 C;  3IXD A;  4P6Z M;  3P09 A;  4OLG A;  1PZO A;  1TAF A;  4H9P B;  2WZZ A;  4BBV A;  4YS3 B;  2V20 A;  4XT2 A;  3IXH A;  3MGR A;  5GLA A;  2VLG A;  1AIW A;  1M1A C;  5G4Y A;  4WEK A;  1KE4 A;  1K55 C;  3S7P A;  1XX2 A;  1ZLA C;  2AVX A;  4RX2 A;  4XZQ D;  3AV1 C;  3A6N B;  5B1L B;  1E6R A;  3WTP B;  4NK3 A;  2F2A C;  4BJP A;  1QMF A;  3UB7 A;  1FCM A;  3AZL C;  1V9Z A;  4NEE D;  5KDM B;  5B33 D;  2DRW A;  3DBA A;  3IBR A;  3WA9 A;  1JFI B;  1H5X A;  4IVK A;  1IYP A;  5DVA A;  2PDR A;  4UEY A;  2GZA A;  1PW8 A;  3OLO A;  3RJU A;  4X69 A;  1S4R A;  1MWT A;  3PTE A;  5E5A C;  2FH5 A;  1Y28 A;  3SS5 A;  3C1B B;  3NOT C;  4WU8 B;  3AZJ A;  3LUQ A;  1E3U D;  4FTX A;  3X1T C;  3LEL C;  3D3O A;  1GSV A;  4J8W A;  3QNB A;  1WWI A;  2W3H A;  3AGD A;  5B31 G;  1ACF A;  4UA9 A;  3MMH A;  1TDG A;  4WV4 B;  2X71 A;  3MSH A;  4X23 A;  1W2E A;  4CLC E;  2R9X A;  4TX8 A;  5AY8 A;  2XA7 S;  5B31 C;  4G3V A;  4DXC A;  5DKK A;  3WD1 A;  4EBL A;  2VEA A;  3MXS A;  5FI7 A;  5C5K A;  1KU5 A;  1LSV A;  1HLU P;  1H3O A;  3WAA D;  3IS2 A;  4MBK A;  5AV5 A;  1NJ4 A;  4HOI A;  3EPK A;  4J8U D;  3MVD A;  5EVI C;  2DQN C;  2HJ9 C;  4R3J A;  2Q9M A;  2W3E A;  4KZA A;  5B2J B;  2FJ7 A;  2VGJ A;  3ZG5 A;  4G92 C;  2NQB A;  3W4P A;  3VOL A;  5DNN C;  2LB5 A;  5CPK A;  1ES4 A;  4X25 A;  3SS3 A;  5GT0 C;  3MGR B;  4GKU A;  4RA7 A;  1P3L C;  3AN2 B;  3C30 A;  1CJF A;  4K0X A;  3A6N D;  5B1L D;  4OH0 A;  1KX5 A;  3WTP D;  1HTZ A;  5CER A;  2EX8 A;  5AV6 C;  1GCE A;  3UTA D;  4GHA A;  4YM6 B;  1SHV A;  3UTB B;  3AZN A;  1DJB A;  1S0W A;  2XRN A;  4X1M A;  3W4O A;  3CHW P;  4E04 A;  2X02 A;  5EE8 A;  3IP4 C;  3W2Z A;  3C1B D;  4WU8 D;  4LRZ E;  4WNN A;  1HQ3 B;  5CP6 C;  5FAT A;  3C1C D;  4KQO A;  5FQQ A;  4XZQ C;  1O07 A;  3HUN A;  1K4E A;  1PWC A;  1XXM A;  4X23 B;  2PRF A;  2F8N K;  3KSH A;  4OPY A;  4P87 A;  4NXF A;  4S2P A;  3UB9 A;  2CMN A;  5AY8 B;  5B33 C;  4JXV A;  2Y2H A;  1PYY A;  4WU9 A;  3KX0 X;  3UE6 A;  4OUI A;  4UUZ B;  3NC8 A;  5GLD A;  1N9O A;  2V1Z A;  3G6O A;  4Y5F A;  4J8V B;  1G68 A;  5AV5 B;  1LL9 A;  5AV8 C;  2RVQ D;  3QP4 A;  4UAA A;  2WKE A;  1Z2C B;  2IO5 B;  1M18 B;  3MVD B;  5IS1 A;  5CTM A;  3B0D C;  3X1S D;  1RCJ A;  5B2J D;  3KWQ D;  1DP8 A;  1U35 A;  1L0G A;  1YU3 A;  3M2K A;  2JCH A;  3IXB A;  1CK3 A;  4Z66 A;  5CPK B;  1IKG A;  3UPP A;  3M6B A;  3LIB A;  4AWL B;  4QNL A;  2EXB A;  1YLP A;  3PBQ A;  4ME4 A;  3AN2 D;  1P3P C;  1M19 C;  2K31 A;  1YLT A;  3UE3 A;  3AZM B;  2HP6 A;  1A7W A;  4H9Q A;  1KX5 B;  5HD3 A;  4EQ1 A;  5AV9 B;  3KFU G;  3CUE A;  4PM9 A;  4E6X A;  2M1C A;  5AQ7 A;  4Z2G A;  3BEC A;  5DNM A;  3GR2 A;  3VH6 A;  4YM6 D;  3BFE A;  3UTB D;  2A24 A;  2PYO B;  3O5Y A;  4GLQ A;  3C8C A;  3UME A;  1W1P A;  2Y8H A;  1ODV A;  1BLS A;  4YS3 C;  5B40 B;  1ALQ A;  2G2W A;  2BTF P;  5CEB A;  1HQ3 D;  3IH8 A;  2WAE A;  4BBT A;  5LBR A;  4QLC D;  2Z6D A;  3A6N C;  5B2I B;  5B1L C;  4I5S A;  4KQQ A;  5J8X A;  3WTP C;  1NWZ A;  2XSS A;  3UT9 D;  3TE8 A;  3EQV A;  5HD5 A;  1K54 A;  3FKE A;  3NBL A;  3SZT A;  2WK0 A;  4OJ5 A;  1N9B A;  5FQK A;  1AXB A;  2W3G A;  4UQI M;  4WU9 B;  2WYX A;  4Q0I A;  1KS0 A;  4DRB A;  1MWS A;  1Y4O A;  4Y13 A;  3KXB D;  3VP4 A;  5CRF A;  1ZG4 A;  4IHQ A;  3C1B C;  4J8V D;  4WU8 C;  4ETZ A;  2XFS A;  4WBG A;  3VOZ A;  2ZY3 A;  1BYW A;  3C1C C;  3SW1 A;  1M18 D;  3W98 D;  1WYC A;  4UA7 A;  1U35 B;  4KZ6 A;  2PD7 A;  4HEF A;  5F1G A;  3L25 A;  4UQI S;  5IHV A;  3D4F A;  5HW3 A;  4OPR A;  4HME A;  5AVE A;  3HON A;  1PDC A;  4DDS A;  1DP6 A;  3B6F A;  3REK A;  3PBS A;  3AZM D;  1FCN A;  5DTT A;  5CPJ B;  1YSP A;  3IBJ A;  2F8N B;  2XR0 A;  5KSH A;  4EUZ A;  2RVQ C;  5F1F A;  3CPT B;  5AV9 D;  2VA0 A;  4F94 A;  1XJ2 A;  2WGW A;  2DCF A;  2ZY4 A;  3N6I A;  5KSC A;  4WZ5 A;  1PZP A;  4HMC A;  4LD9 D;  1G28 A;  1P3A A;  2HIO D;  5B2J C;  3NDE A;  1RGZ A;  3IHB A;  4KZ3 A;  3VH6 T;  4E3K A;  1ESI A;  2PYO D;  1P3I B;  4Y3I A;  3LFV A;  4LV3 A;  2H0T A;  3MGR C;  1GHI A;  3O62 B;  3AN2 C;  4WJ3 C;  3MGS A;  4KQD A;  3EPJ A;  4HH2 A;  3F6T A;  5B2I D;  1P3K A;  3O3V A;  3NHQ A;  2E8I A;  2Z2M B;  2Y55 A;  3FZC A;  5JA4 A;  1KGE A;  2K7S A;  3IWI A;  1OTA A;  3T4S A;  1S32 A;  4YM6 C;  1IEL A;  1LSW A;  3Q82 A;  3KYQ A;  3UTB C;  1LL5 A;  1J9M A;  2FN2 A;  2DF4 C;  1P34 A;  3E2K A;  1AOI B;  3ICY A;  1HQ3 C;  2Y2J A;  1P3M A;  2Y4A A;  4NXB A;  4R0Q A;  2ZY5 A;  2O9A A;  4KGC A;  1VET B;  5BNX A;  3DWZ A;  2X01 A;  4X23 C;  2JKR I;  2HUE B;  3LZ0 B;  4X68 A;  5AY8 C;  4Z5T B;  2J9O A;  4ID4 A;  2YFW A;  3W99 B;  1W1Y A;  2VZW A;  3REK B;  1O7E A;  3ZVT A;  2JBF A;  4HGA B;  4FSF A;  4UHU A;  4Y15 A;  5CPJ D;  3PBO A;  4J8V C;  5F82 A;  5AV5 C;  3AZK A;  2F8N D;  1SDE A;  4DJ3 A;  3MF0 A;  2J80 A;  4WMC D;  4BMW A;  3DWK A;  2WGW B;  1DJA A;  3C7U A;  2IO5 C;  4HJ4 A;  1M18 C;  4H9R A;  3V5M A;  3MVD C;  1I2S A;  1Q2P A;  5M19 A;  5A92 A;  3EEH A;  2IWC A;  3AZG A;  1ULY A;  5HWT A;  3ZDJ A;  3AL0 C;  3AFA A;  2O0Y A;  5GT3 B;  1P3I D;  5CPK C;  5FUG A;  4R3B A;  4AWL C;  3O62 D;  5HWW A;  4KHA A;  4RQ9 A;  1P97 A;  2C5W B;  5C3I B;  4L9F A;  4HHD A;  3AZM C;  3QP6 A;  3VH5 T;  3JVV A;  4JXG A;  3OPH A;  1KX5 C;  4HY8 A;  2QMI A;  3D72 A;  4HBT A;  5HAP A;  5AV9 C;  2VK3 A;  1P3G A;  5GXQ A;  1ERM A;  5JA4 B;  1WE4 A;  4ZAM A;  3H7W B;  2ZC7 A;  3L27 A;  3REH A;  3KSI A;  1I2W A;  3UPO A;  2CC1 A;  4ZDX A;  2V9A A;  2PYO C;  3TU4 A;  2EFX A;  4H9S A;  2JKT M;  3QP1 A;  5HWV A;  2VKS A;  4HP9 A;  4GD8 A;  5B40 C;  4MEZ A;  3H0R C;  1AOI D;  3V39 A;  3AZH A;  1P3M B;  3BFF A;  2KOI A;  5JRG D;  3MQQ A;  1GSX A;  5AQA A;  4KGC B;  5B2I C;  4EQI A;  1PIO A;  3UDX A;  5DTS A;  3D9Y A;  3MZD A;  3M7P A;  1ES5 A;  2XD1 A;  4DE0 A;  3LZ0 D;  4CLC A;  4JLF A;  3U2A A;  4Z5T D;  3NIA A;  4WU9 C;  3S1Y A;  1QO6 A;  3W99 D;  1M1A D;  4OJO A;  4E45 A;  1ZLA D;  4CJN A;  1NY0 A;  3C38 A;  3AV1 D;  3OPP A;  4MCW A;  5BO0 B;  1L0E A;  2GX5 A;  5TJJ A;  3AZK B;  4ZBJ B;  1XFQ A;  5GLB A;  3L9K A;  2K2N A;  3M6H A;  5B32 A;  4LG2 A;  1KX3 A;  2QYB A;  3AZF B;  1T1A A;  4EBN A;  2ZOH A;  4C3Q A;  4KZ5 A;  5DF7 A;  3G2Y A;  4Z2K A;  4QU3 A;  1U35 C;  4R70 A;  4HMD A;  3LR0 A;  5B0Z A;  5E2G A;  3LZ1 B;  5GT3 D;  5FUG B;  3WAA A;  4JF5 A;  4JKT A;  3C2W A;  1EQZ B;  1NXY A;  2F8N G;  3AZI B;  4WN5 A;  1S4S A;  2B02 A;  4MN5 A;  1H0I A;  3HLF A;  2ARO A;  4WEL A;  1DY6 A;  1P3O B;  1PRQ A;  5CPJ C;  5AVC A;  1DP9 A;  3MXR A;  3R45 A;  1KE0 A;  2V0U A;  1B6W A;  3NDG A;  3NOU C;  5GXQ B;  2QPN A;  4B4Z A;  3AZE B;  2P7J A;  4IJF A;  4XUX A;  5FQM A;  1ZHH B;  3FWL A;  3B6G B;  2A2L A;  2WKH A;  3MGQ A;  1ES2 A;  3ZNY A;  3TU4 B;  1P3I C;  1OTE A;  3WRZ A;  1MBL A;  4K91 A;  3AGE A;  3PBT A;  3AZH B;  3QP8 A;  4WEJ A;  3O62 C;  2ZQ9 A;  2H10 A;  3RTY A;  3H82 A;  2LB9 A;  5GLC A;  1ID3 A;  5EVI D;  1CEF A;  3GQZ A;  2WGI A;  5DNN D;  2Y59 A;  3N3F A;  1BFM A;  3MKF A;  4F3L A;  3ITB A;  3TOI A;  3WS0 A;  3E4O A;  4PKY G;  5DFX A;  3WD3 A;  3Q7V A;  4NYU A;  5FI2 A;  3KUY A;  5CPI A;  3A3D A;  4JJN A;  1JTG A;  3UY6 A;  5HX9 A;  4BEN A;  3E4P A;  1BH9 B;  1AOI C;  5KMW A;  3ITA A;  2JKF A;  1S6R A;  3IWO A;  2NUP C;  1KX3 B;  4YFM A;  3LJA B;  3EWK A;  1FIL A;  3AZF D;  4P85 A;  4LFU A;  2V0W A;  4E3L A;  1B67 A;  2HDU A;  3LZ1 D;  4FOF A;  1XJ6 A;  5FEG A;  3REI A;  2HUE C;  3LZ0 C;  1OPX A;  4Z5T C;  3X1V A;  4KZ9 A;  3VOY A;  1EQZ D;  3W99 C;  2B95 A;  5CP6 D;  3S7Q A;  4R3A A;  3AZI D;  2JSS A;  2W1R A;  3REK C;  3MS6 A;  4NZ1 A;  1OJ5 A;  1UR8 A;  4HGA C;  1P3O D;  2WZX A;  2LY8 A;  2YFV A;  3X1S A;  5B24 B;  2Y79 A;  3AV2 B;  4IBX A;  3G34 A;  3NCK A;  1P3B A;  3FPV A;  3G2Z A;  5JYP A;  3PBR A;  3AZE D;  4P6Z S;  4MDZ A;  1Q9C A;  4BD0 A;  4GS9 A;  1PW1 A;  3WX7 A;  3HJI A;  3TRC A;  1H0M A;  1FR6 A;  3MGQ B;  3B6G D;  3BRM A;  2V1B A;  2XD5 A;  1IOU A;  5GT3 C;  3BLS A;  3VE4 A;  3UDF A;  4JGO A;  4OJP A;  4IJG A;  2ZMA A;  4WUJ A;  2VQR A;  4R8P A;  5AV8 D;  4E44 A;  5AQB A;  4LCL A;  4QJG A;  1F2K A;  4NG2 A;  4KEN B;  5C3I C;  3BFG A;  2P04 A;  5CHJ A;  1ID3 B;  4KZ8 A;  4WYY A;  3IF6 A;  1TZY B;  1BT5 A;  1JWP A;  2OOL A;  3LY3 A;  5AVB B;  3T4Q A;  3AYW B;  2G5H C;  2EX6 A;  5EM0 A;  2OV5 A;  4F3L B;  4OPQ A;  4LRX C;  1F66 A;  2B5R A;  4Z2J A;  3JVU A;  3LO7 A;  4E3M A;  3IHA A;  3N4I A;  2Y2Q A;  5B1M A;  1P3P D;  1M19 D;  2IOU A;  1U60 A;  3Q7V B;  4EUV A;  3ZHH A;  5BNV B;  3KUY B;  5CPI B;  1CF0 A;  2WKR A;  4LV1 A;  1OGG A;  4NET A;  3ZGA B;  3EEA A;  1UGU A;  1P3M C;  5F69 A;  4H9O B;  4Y0U A;  5B0Y A;  1P3F A;  1L2S A;  3VH6 W;  4KGC C;  3LEQ A;  4KUD A;  5HL6 A;  3VFF A;  4U3T A;  1TAF B;  3REI B;  3FPW A;  2NZD A;  4X53 A;  2ZMF A;  3L29 A;  3WD2 A;  5TFQ A;  1PFL A;  4XT2 B;  4YS3 D;  4H6J A;  5A93 A;  3M2J A;  3KS4 A;  2XRO A;  3REJ A;  2W0N A;  2J3W A;  3C4P A;  1BH8 A;  1CI8 A;  2JE5 A;  1W7F A;  3O88 A;  1K56 A;  3AZK C;  3S22 A;  2RIQ A;  5B24 D;  4ZBJ C;  3AV2 D;  4GZB A;  3MGP A;  4RYE A;  1D06 A;  1Q2Q A;  2WGV A;  3FV7 A;  5CGW A;  3AZF C;  3WA9 B;  2PR6 A;  3VMA A;  2G2U A;  3REL A;  3FC7 A;  1YU2 A;  2OWJ A;  5L07 A;  3OZH A;  5DF8 A;  1G6A A;  3LZ1 C;  4OOL A;  3UB8 A;  3HL9 A;  2PD8 A;  1YU4 A;  4GJ4 A;  4DDY A;  3MNN A;  3OBF A;  3AZJ B;  3WTP E;  1EQZ C;  1BZA A;  4NXE A;  5M1A A;  4J8X A;  1TS8 A;  3AZI C;  5FL3 A;  4J8W B;  4LV0 A;  1P3O C;  4S2N A;  1M6K A;  1FR1 A;  2CV5 A;  1TZY D;  1IEM A;  4IBG A;  3T4K A;  5GSU A;  2B18 A;  4S2L A;  5AVB D;  3AGF A;  3EPL A;  4ZUX A;  4DJ2 A;  5GXQ C;  3AYW D;  2MJ6 A;  3AZE C;  2PBD P;  4XUJ A;  3MBZ A;  5BOH A;  3BY8 A;  3B6G C;  4GHL A;  1XA7 A;  1FSW A;  4XXR A;  3TU4 C;  1GHP A;  4Y17 A;  1H3O B;  3IS2 B;  2ZQC A;  3AZH C;  2INW A;  4GW9 A;  3ZVW A;  3P5J B;  2L4R A;  4Z2H A;  4EW7 A;  5B0Y B;  2Y2O A;  5A8B A;  2V8C A;  2FJ7 B;  4KUD B;  2Q0O A;  2NQB B;  1BTL A;  1F9I A;  3MQO A;  1H0G A;  3CJM A;  4N1H A;  2YKH A;  3BWL A;  5BS7 A;  3MGR D;  1WYB A;  3REJ B;  4GDN A;  3X1U A;  3VH5 W;  3G4P A;  4WL9 A;  2I72 A;  4WF0 A;  1CI9 A;  4M6B A;  1P0Z A;  2ZC3 B;  4EET B;  4YIN A;  2WKP A;  4OOY A;  1OTB A;  4LCM A;  4OQH A;  2OLV A;  3WRT A;  1KX3 C;  3LJA C;  3EGD C;  5EOO A;  3REL B;  3ULF A;  3WA9 D;  3AZN B;  3IF5 A;  4Q0H A;  3BQA A;  4I3J A;  1HTA A;  1EAK A;  2H28 A;  3I7J A;  5FI6 A;  3MNN B;  4C75 A;  1KOU A;  4WNN B;  3AZJ D;  3EOI A;  1VB6 A;  3OCL A;  5E2E A;  3TJZ C;  4Z2L A;  3T50 A;  5J3W A;  4L9E A;  4R4R A;  5CGS A;  4J8W D;  5U47 A;  5J7E A;  2R9W A;  1N1J A;  3CLO A;  5B24 C;  2O99 A;  3AV2 C;  1KX4 A;  3N7W A;  4JF4 A;  3LEZ A;  4X23 D;  5J4E A;  3KS8 A;  4JXS A;  5AY8 D;  3N8S A;  3VP1 A;  2Y2I A;  1KDS A;  2ZJ9 A;  3A0V A;  4DE3 A;  3MGQ C;  3SOI A;  4GCZ A;  3PHY A;  1VQQ A;  5AV5 D;  4Z9Q A;  4BLM A;  5DF9 A;  5FAS A;  2HDS A;  3C7V A;  4KUO A;  4RX3 A;  4NZ5 A;  3VSL A;  5L8M A;  3MVD D;  1ID3 C;  2UV0 E;  1AWI A;  3WKJ A;  5DKL A;  4HBU A;  3LR5 A;  2FJ7 D;  1TZY C;  3HLE A;  3R7W A;  2NQB D;  5EV0 A;  5AVB C;  3W96 A;  1EI5 A;  3BQ8 A;  4Z66 B;  3AYW C;  3FDD A;  5CPK D;  1SKO A;  4PM6 A;  4EEP A;  3X1U B;  1FQG A;  4WM9 A;  3V50 A;  3B0B A;  4CSR A;  2ACG A;  3E0Y A;  4G91 B;  3KUY C;  5CPI C;  4H9Q B;  2O9B A;  1KX5 D;  4NE3 A;  3W97 A;  3LIA A;  4IUH A;  3WS2 A;  4U0X A;  4Z2M H;  4R23 A;  1CXW A;  2P08 A;  3T4O A;  5DNM B;  5GHZ A;  4QY6 A;  3AZN D;  1OT9 A;  3F1O A;  2A24 B;  1T3U A;  4L9G A;  5FAP A;  3WS5 A;  3REI C;  3LI8 A;  3HSH A;  5DJU A;  1P9W A;  1YQS A;  5B40 D;  2JN7 A;  2XF3 A;  1W63 Q;  3AZL A;  3BLM A;  3IX4 A;  3N8L A;  1N1J B;  1BLC A;  4QWO A;  2J9P A;  4OPZ A;  4DRT A;  5TR7 A;  3KO6 A;  4PAU A;  3VFH A;  1GA0 A;  2QJ5 A;  4CAY A;  1W8Q A;  3MJQ A;  4X55 A;  5E5A A;  3L28 A;  3SH7 A;  4WU9 D;  1FCO A;  3WA9 C;  5F99 A;  1YPR A;  4KZ4 A;  1E25 A;  5CTN A;  2PYR A;  3X1T A;  2JHE A;  3LEL A;  3AZJ C;  1G5U A;  3HJK A;  1L0F A;  4BL2 A;  4J8W C;  3WKJ B;  5B31 A;  1QME A;  4K0W A;  5FAQ A;  4O7D A;  4R38 A;  5CED A;  1U35 D;  3R7W B;  4NKP A;  1LT0 A;  3W96 B;  4LPZ A;  4Z66 D;  3ZG0 A;  2PT7 A;  3EPH A;  1W79 A;  3MFD A;  5EEC A;  2HGV A;  3ISG A;  3NQJ A;  1YLY A;  4OP5 A;  2DMW A;  2F8N H;  3B6F B;  5K5B A;  2ZQ8 A;  2XEP A;  1ONH A;  4CSR B;  2E8J A;  4LGW A;  4YOF A;  3NY4 A;  1IYQ A;  1ED7 A;  1K57 A;  2Y2L A;  1WWS A;  1C3B A;  4NY2 A;  1BLP A;  1HD8 A;  4MLL A;  5A90 A;  5B0Y C;  5DNM D;  3JYI A;  1P3A B;  4N1X A;  5GT0 A;  2FJ7 C;  4HI4 A;  2RTS A;  5KZH A;  4KUD C;  4DE2 A;  1P3L A;  1I5Q A;  2NQB C;  2BAS A;  4PHT A;  5HDD A;  3ZFZ A;  1JVJ A;  3BW6 A;  5EOE A;  5CXW A;  1GSW A;  4KG6 A;  1XJ4 A;  2H0Y A;  3REJ C;  1J3W A;  3MGS B;  1SCW A;  5AV6 A;  1VEU A;  3MFX A;  1K0K A;  5JYO A;  4HNB A;  1MKI A;  4PM5 A;  1P3K B;  3ZYT A;  1P9R A;  2JKR M;  5M18 A;  1HVB A;  2R78 A;  2P9V A;  2J8P A;  4HP4 A;  5AJG A;  3GEC A;  5E5A B;  3U4L P;  1LI0 A;  1S32 B;  1H8P A;  3NEC A;  5F99 B;  3REL C;  4ZJ3 A;  3AZN C;  2ZM5 A;  1CK7 A;  2ZBB A;  2V5O A;  3CI6 A;  2IWB A;  4XZQ A;  2VV7 A;  2HP5 A;  1P34 B;  4X56 A;  3MNN C;  3DAV A;  3G30 A;  2PU2 A;  5L10 A;  4ZJ1 A;  3LIC A;  3HLB A;  5I94 A;  1W1V A;  5B33 A;  1E8B A;  1E6P A;  5BNX B;  4CPK A;  4IBR A;  3T4L A;  1K25 A;  2FFY A;  5EPH A;  3CMZ A;  1ZTU A;  4N9K A;  3NQJ B;  2YFW B;  1XP4 A;  1E3U A;  1S66 L;  5GL9 A;  3B6F D;  3REK D;  2W1T A;  3NOP C;  3VV4 A;  5TBM A;  1L0D A;  4HIA A;  3E4Q A;  2KDK A;  5F83 A;  3WS4 A;  4B9O A;  5HPF A;  4H9R B;  2EWW A;  2JKG A;  3Q81 A;  2QWS A;  1D1J A;  1P3A D;  4B88 A;  3AZG B;  1XKZ A;  5G49 A;  3AFA B;  1M19 A;  2IA2 A;  4OOM A;  3HUO A;  4Z66 C;  4IBI A;  2G5I C;  3QNC A;  1BUL A;  2XQZ A;  1W5D A;  4KHA B;  1L6J A;  1N9N A;  1W8Y A;  4NE6 A;  3MGS D;  3KYZ A;  4J8U A;  1R4V A;  2WKI A;  4NFT A;  4G91 C;  3L26 A;  5FEF A;  1P3K D;  5HAI A;  4Y0O A;  5HSQ A;  3PR6 A;  2BYM A;  3PAE A;  3CUE C;  1P3G B;  2P9V B;  5IT5 A;  1KVM A;  4OVD A;  5DNM C;  1S32 D;  1T18 A;  1OME A;  3REH B;  3HLW A;  2QHK A;  3PYP A;  3HUM A;  4MB5 A;  4FD8 A;  5KIZ A;  4IVI A;  3IXG A;  3BY9 A;  3V3R A;  3A6N A;  1D7E A;  5B1L A;  1P34 D;  3W8K A;  3WTP A;  4RVA A;  3T1Q B;  2VGL M;  3GMW A;  1P3M D;  4HQA A;  2BG1 A;  3UTA A;  5CHL B;  4KGC D;  1MXO A;  1JFI A;  1T1C A;  1Z6F A;  3H9W A;  1K54 C;  4EES A;  1TDL A;  4QPR A;  1IYS A;  1NLY A;  3NQU A;  4CLC B;  4EO5 B;  2O9C A;  5FDS A;  2ZY2 A;  2A3U A;  2UWX A;  4L0L A;  5EFW A;  3C1B A;  4WU8 A;  4I38 A;  3ZNT A;  5HDS A;  3V9R A;  2W1T B;  1F1E A;  3C1C A;  5IU1 A;  1YMX A;  2ZC6 B;  5TBM B;  4EU0 A;  3AZK D;  5B32 B;  3O87 A;  4MBF A;  3B0C T;  3AZG D;  4QHC A;  5B0Z B;  4FH4 A;  3BFC A;  3UNW A;  3AFA D;  3W96 C;  4K08 A;  1HZO A;  3WAA B;  1CEG A;  5HZH A;  3GVB A;  4DRA A;  4EV4 A;  2ZC5 B;  2D01 A;  1GPF A;  3B6F C;  4IED A;  2ZMV A;  5GHY A;  4J8U B;  2ARO B;  5EVE A;  1MC0 A;  5AVC B;  1YUE A;  4ARZ A;  4BWI A;  1JNU A;  2BYM B;  5B2J A;  3R45 B;  3KWQ A;  1V9Y A;  4MNR A;  4IBK A;  4LRY C;  1P3G D;  2IWD A;  3A1I A;  5GXQ D;  3PAG A;  3LY4 A;  1JTD A;  2J8Y A;  2W3F A;  4WZ5 C;  1ONG A;  1P3A C;  3REH D;  4M3K A;  1H3Q A;  3DTI A;  3AN2 A;  1CQA A;  4O8G A;  3TU4 D;  5L2F A;  2H5S A;  1YMS A;  4S2I A;  3AZH D;  4X6T A;  3H82 B;  3MGS C;  3VE3 A;  3UTA B;  3BFD A;  3LR4 A;  4XUZ A;  1PI5 A;  1P3K C;  1ES3 A;  2XA7 M;  4YM6 A;  3TG9 A;  3UTB A;  4KZB A;  3NQU B;  1KE3 A;  5FQI A;  4CLC D;  3PXP A;  2EX2 A;  1S32 C;  5F99 C;  5DFY A;  3LGO A;  4CQH A;  3V9R B;  3L2A A;  4PMA A;  1RGY A;  1HQ3 A;  5FA7 A;  2VX8 A;  5CHU A;  3C1C B;  3A3I A;  4QLC A;  5HDC A;  4JJN B;  3WD0 A;  1P34 C;  1XPB A;  1X0O A;  1VHM A;  2PYP A;  4GOG A;  3UT9 A;  4Z1W A;  4JBF A;  1RP5 A;  5BT1 C;  2V8F A;  3RH8 B;  4UPK A;  3E98 A;  2VJW A;  5B32 D;  1WA9 A;  2PAV P;  3BM6 A;  1KX3 D;  3R4K A;  3LJA D;  3RXW A;  3IWQ A;  3A3E A;  2DNS A;  4H9N A;  1F5M A;  5B0Z D;  1SZV A;  3LID A;  3KXB A;  4UUZ A;  1OJG A;  3X1V B;  3RXX A;  3QP2 A;  4J8V A;  4S2J A;  1XJ3 A;  2OWH A;  1ESU A;  1J7M A;  2ZM0 A;  2ARO D;  1M18 A;  3W98 A;  3NUL A;  1YT4 A;  5CEC A;  2YFV B;  5E43 A;  3X1S B;  3VP2 A;  1K57 C;  5AVC D;  4ARZ B;  5MC7 A;  3KWQ B;  4GB7 A;  1P3B B;  4HJ6 A;  4D2O A;  2OLU A;  3B47 A;  2HJE A;  1BUE A;  5F6A A;  1DRM A;  4GS9 B;  3A1K A;  1N4O A;  4II7 A;  3AZG C;  2W27 A;  1H8Y A;  3MGQ D;  3AFA C;  5BPV A;  3QHY A;  3AZM A;  5HL1 A;  2FZ0 A;  4KUK A;  5FQ9 A;  4R8P B;  2W3D A;  3IX8 A;  1O6I A;  5AV9 A;  4MMN A;  3GTC A;  1M40 A;  3MXQ A;  1ID3 D;  2Y2K A;  3C5A A;  3IF6 B;  3LIF A;  1L3L A;  4LD9 A;  1T1B A;  4WZS B;  2HIO A;  3DW0 A;  3K3D A;  3DTK A;  4QY5 A;  3HCY A;  1TF1 A;  1P3G C;  2PYO A;  4MB3 A;  1STZ A;  2QKP A;  4MBH A;  1W1T A;  5HFO A;  1F66 B;  3REH C;  5B40 A;  4OQI A;  5B1M B;  3F1N A;  2L5A A;  4H9S C;  4QLC B;  2OAP 1;  3KUY D;  5CPI D;  4JJN D;  4IJE A;  5B2I A;  1KDW A;  3UT9 B;  1ZG6 A;  5F68 A;  4GN2 A;  4WZ4 A;  1P3F B;  3VP0 A;  4H9N B;  1OTI A;  3BJN A;  2Q9N A;  3KXB B;  4DXB A;  2NZD B;  3REI D;  2XH9 A;  2XGN A;  4CLC C;  4MN6 A;  4EO5 C;  3P01 A;  3X1V D;  4Z2I A;  4N9L A;  4H6J B;  2ZM8 A;  3E2L A;  2I9V A;  2ZL1 A;  3OCN A;  5FQJ A;  1BH8 B;  2C6W B;  3N8R A;  4H8R A;  4NE5 A;  3TW8 A;  3WS1 A;  3W98 B;  5B32 G;  2QZ6 A;  2FFF B;  3TSG A;  4MN7 A;  3Q7Z A;  4OJ6 A;  1NRJ A;  3MGP B;  2Y2N A;  4B4X A;  2HDQ A;  1P3B D;  3ZQ5 A;  4R6L A;  5B32 C;  3IQA A;  5HAR A;  1H8M A;  3LIE A;  4HJ3 A;  2PR5 A;  3H0M C;  1N9L A;  1ZKJ A;  4MB4 A;  5B0Z C;  3HRE A;  3DTM A;  2V2F F;  5L09 A;  1IYO A;  2XK1 A;  2D49 A;  4WLA A;  3WAA C;  3FKV A;  5CPJ A;  3MKE A;  3Q1F A;  4R8P D;  2F8N A;  4J8X B;  1TD5 A;  2J3T D;  4EBP A;  4WMC A;  3G31 A;  3CPT A;  4IBE A;  5FSR A;  4J8U C;  2VGK A;  2ARO C;  4IBC A;  4U0T A;  1TS7 A;  4LD9 B;  2CWE A;  2CV5 B;  5AVC C;  2HIO B;  4YWZ A;  5GSU B;  3LR3 A;  4ZUX B;  2OAQ 1;  1TVF A;  1A0K A;  1P3I A;  3WWX A;  3EG5 B;  1LHY A;  4E6W A;  4A5R A;  1F66 D;  4XUJ B;  3K2N A;  1Y54 A;  4NYY A;  3F1N B;  3O62 A;  5B1M D;  5DTK A;  5HPI A;  1BSG A;  1YSQ A;  4QD4 A;  1S67 L;  4ESP A;  1SDN A;  5E2H A;  3A0R A;  4KG5 A;  4JPM A;  5AQ9 A;  5EUA A;  1YU1 A;  3S7N A;  4BBU A;  1YM1 A;  2ZQA A;  4PM8 A;  5CX7 A;  3UTA C;  5B0Y D;  1P3F D;  2Y91 A;  3HLC A;  2EA9 A;  2HDR A;  4B93 A;  1K4F A;  4KUD D;  4DE1 A;  5FAO A;  2NZD D;  4G3K A;  1MKM A;  4I39 A;  3UE0 A;  1E4D A;  1AOI A;  2ZL1 B;  4PKY A;  3REJ D;  2NUT C;  5JRG A;  3V3S A;  4AFI A;  1K56 D;  4JJN C;  1UWN X;  3KSG A;  2P74 A;  4DQY B;  3T4J A;  1VET A;  4EEU A;  3MGP D;  3F1P A;  4BL3 A;  1W63 M;  3S7O A;  3UMD A;  3LZ0 A;  1G6O A;  1PNE A;  4Z5T A;  4YNR A;  3REL D;  1SKF A;  3T1R A;  1M1A A;  3W99 A;  3LCE A;  1K55 A;  1YLZ A;  1ZLA A;  3C4O A;  4DF6 A;  4JXW A;  4DN0 A;  3AV1 A;  1LI9 A;  3X1V C;  4S2O A;  3MNN D;  4JGR A;  4C6Y A;  2Y2M A;  4Y7P A;  4J8X D;  3ZG7 B;  5I5L A;  3HVF A;  4O01 A;  2WUQ A;  2ZQD A;  1K6S A;  3UB5 P;  1YLJ A;  2EFU A;  4OP8 A;  4EER A;  3X1S C;  1DJC A;  2CV5 D;  3FG8 A;  3KWQ C;  1KX4 B;  5GSU D;  4PPR A;  2HF6 A;  1P3B C;  1NRF A;  4LV2 A;  4HH3 A;  4ZUX D;  5E2F A;  4E3O A;  2M7V A;  1LL8 A;  5GT3 A;  1KGG A;  2WKQ A;  4KQR A;  3T1S A;  5CHM A;  4XUJ D;  2HV1 A;  1VM1 A;  1OGB A;  3P7N A;  2ZQ7 A;  3VH5 A;  2ZC4 B;  4IBB A;  4ZTK A;  3CG5 A;  3FKW A;  3OC2 A;  1PI4 A;  2M7U A; 
#chains in the Genus database with same CATH homology
 4S2M A;  4R8P C;  3ZG9 B;  2WAF A;  5TGF A;  1MPL A;  3B0C W;  3OPL A;  3IF6 C;  2A49 A;  4KG2 A;  2HPB A;  4E3J A;  1JWV A;  2OSU A;  3HBR A;  1F66 C;  3UPN A;  1XGJ A;  3X1U D;  5B1M C;  5JRG B;  3GSG A;  1PZR A;  4IBD A;  4QLC C;  2W8S A;  3GV9 A;  5EVI A;  4N92 A;  3W97 B;  4Q8I A;  3UT9 C;  1JWZ A;  5DNN A;  3G35 A;  1FOF A;  1P3F C;  2BLS A;  1PWG A;  4QB8 A;  1M1A B;  4S2K A;  3KXB C;  1ZLA B;  2NZD C;  5EVL A;  5FDH A;  5HAQ A;  3IH9 A;  3AV1 B;  5BO0 A;  4JF6 A;  2JC7 A;  1EWZ A;  1KVL A;  1YLW A;  3AZL B;  5G18 A;  2J7V A;  3W98 C;  3AZF A;  1LLB A;  3PBN A;  4OLD A;  3HLD A;  1KX4 D;  1NYY A;  4ZBE A;  3MGP C;  2PBY A;  3UDI A;  1YU0 A;  3HLG A;  3LZ1 A;  4CAY B;  4OKP A;  1XGI A;  4P0M A;  3VP3 A;  2XDM A;  4GH9 A;  2HP9 A;  1EQZ A;  4BD1 A;  5CP6 A;  3SH9 A;  3AZI A;  3X1T B;  3SS4 A;  4Y0T A;  3LEL B;  2ZLY A;  3CZD A;  3EQU A;  2ZM2 A;  3P98 A;  4R1G A;  1P3O A;  4J8X C;  5CGX A;  5GHX A;  2EXA A;  4Z2M G;  3S4X A;  3UN7 A;  5B31 B;  3AZE A;  4S2N C;  4FCF A;  3WKJ D;  3OPR A;  4LD9 C;  2CV5 C;  2HIO C;  2Y2G A;  2ZD8 A;  5GSU C;  3B6G A;  4ZUX C;  3W96 D;  3O86 A;  4PM7 A;  1NYM A;  4BQM A;  5AV8 A;  4XUJ C;  3IT9 A;  5EVI B;  3W97 D;  4G92 B;  2XLN A;  1GA9 A;  5DNN B;  2BYK A;  5GT0 B;  3BYD A;  3G32 A;  1P3L B;  3H0L C;  3NI9 A;  1P3P A;  1ERQ A;  5D3O A;  3UE1 A;  5BS7 C;  3A3J A;  3GRJ A;  4OQG A;  2WAD A;  1BH9 A;  3X1U C;  5AV6 B;  3SH8 A;  4OQ0 A;  3AZL D;  5A91 A;  3LJA A;  1TEM A;  3ZG8 B;  4IBJ A;  4H9P A;  4OON A;  5E5A D;  4R4S A;  4KZ7 A;  2PU4 A;  1BLH A;  3VSK A;  1ZC2 A;  4YS3 A;  2XFT A;  5F99 D;  4UA6 A;  5CP6 B;  3X1T D;  3KSY A;  4DKI A;  3LEL D;  4XZQ B;  1XA1 A;  4NZ4 A;  5B24 A;  3AV2 A;  1MY8 A;  4LEN A;  5BT1 D;  3ZCZ A;  2Y2P A;  1IKI A;  1NZU A;  5B33 B;  5KDM A;  4OJL A;  5B31 D;  3B3X A;  1H8Z A;  2RCX A;  1KX4 C;  1KGF A;  1K38 A;  3UO9 A;  3Q07 A;  3A3F A;  1PWD A;  5AV8 B;  4E3I A;  2Z2L B;  1GHM A;  2GDN A;  3MZE A;  1NZO A;  4GDB A;  3B0D B;  3BEB A;  4HES A;  3W4Q A;  1TZY A;  2EX9 A;  5AVB A;  3AYW A;  3MZF A;  4IBF A;  2BYK B;  4E3N A;  3FYZ A;  3WKJ C;  2RL3 A;  5GT0 D;  5G49 B;  4NZ3 A;  1P3L D;  1P3P B;  1M19 B;  1MWR A;  4ZJ2 A;  4FH2 A;  4GD6 A;  5BNV A;  1FSY A;  1MWU A;  4EWF A;  5AV6 D;  5JRG C;  4H9O A;  4GNU A;  4P6B A;  1ERO A;  1K6R A;  3W97 C;  3IXD A;  3P09 A;  4OLG A;  1PZO A;  1TAF A;  4H9P B;  2WZZ A;  4YS3 B;  2V20 A;  3IXH A;  3MGR A;  5GLA A;  1M1A C;  4WEK A;  1KE4 A;  1K55 C;  1XX2 A;  1ZLA C;  4RX2 A;  4XZQ D;  3AV1 C;  3A6N B;  5B1L B;  3WTP B;  4NK3 A;  2F2A C;  4BJP A;  1QMF A;  1FCM A;  3AZL C;  5KDM B;  5B33 D;  2DRW A;  3WA9 A;  1JFI B;  1H5X A;  4IVK A;  1IYP A;  5DVA A;  1PW8 A;  3RJU A;  4X69 A;  3PTE A;  1MWT A;  5E5A C;  3SS5 A;  3C1B B;  4WU8 B;  3AZJ A;  1E3U D;  3X1T C;  3LEL C;  4J8W A;  3QNB A;  1WWI A;  3AGD A;  5B31 G;  4UA9 A;  1TDG A;  4WV4 B;  2X71 A;  4X23 A;  1W2E A;  2R9X A;  5AY8 A;  4DXC A;  5B31 C;  4EBL A;  3MXS A;  5FI7 A;  1KU5 A;  1H3O A;  3WAA D;  4MBK A;  5AV5 A;  1NJ4 A;  3EPK A;  4J8U D;  3MVD A;  5EVI C;  2DQN C;  4R3J A;  2Q9M A;  4KZA A;  5B2J B;  2FJ7 A;  2VGJ A;  3ZG5 A;  4G92 C;  2NQB A;  3W4P A;  5DNN C;  5CPK A;  1ES4 A;  3SS3 A;  5GT0 C;  3MGR B;  4GKU A;  4RA7 A;  1P3L C;  3AN2 B;  4K0X A;  3A6N D;  5B1L D;  4OH0 A;  1KX5 A;  3WTP D;  1HTZ A;  5CER A;  2EX8 A;  5AV6 C;  1GCE A;  3UTA D;  4GHA A;  4YM6 B;  1SHV A;  3UTB B;  3AZN A;  1DJB A;  1S0W A;  3W4O A;  2X02 A;  5EE8 A;  3IP4 C;  3C1B D;  4WU8 D;  4WNN A;  1HQ3 B;  5CP6 C;  5FAT A;  3C1C D;  4KQO A;  5FQQ A;  4XZQ C;  1O07 A;  3HUN A;  1K4E A;  1PWC A;  1XXM A;  4X23 B;  4P87 A;  2F8N K;  4OPY A;  4S2P A;  5AY8 B;  5B33 C;  4JXV A;  2Y2H A;  1PYY A;  4WU9 A;  4OUI A;  4UUZ B;  3NC8 A;  5GLD A;  2V1Z A;  4J8V B;  1G68 A;  5AV5 B;  1LL9 A;  5AV8 C;  2RVQ D;  4UAA A;  2WKE A;  1Z2C B;  2IO5 B;  1M18 B;  3MVD B;  5CTM A;  3B0D C;  3X1S D;  1RCJ A;  5B2J D;  3KWQ D;  1U35 A;  1L0G A;  1YU3 A;  3M2K A;  3IXB A;  2JCH A;  1CK3 A;  4Z66 A;  5CPK B;  1IKG A;  3UPP A;  3M6B A;  4AWL B;  4QNL A;  2EXB A;  1YLP A;  3PBQ A;  3AN2 D;  1P3P C;  1M19 C;  1YLT A;  3UE3 A;  3AZM B;  2HP6 A;  1A7W A;  4H9Q A;  1KX5 B;  5AV9 B;  3KFU G;  4PM9 A;  4E6X A;  5AQ7 A;  3BEC A;  5DNM A;  3GR2 A;  3VH6 A;  4YM6 D;  3BFE A;  3UTB D;  2PYO B;  1BLS A;  4YS3 C;  5B40 B;  1ALQ A;  2G2W A;  5CEB A;  1HQ3 D;  3IH8 A;  2WAE A;  4QLC D;  3A6N C;  5B2I B;  5B1L C;  4KQQ A;  5J8X A;  3WTP C;  3UT9 D;  3EQV A;  1K54 A;  3FKE A;  3NBL A;  2WK0 A;  4OJ5 A;  1N9B A;  5FQK A;  1AXB A;  4WU9 B;  2WYX A;  4DRB A;  1MWS A;  3KXB D;  3VP4 A;  5CRF A;  1ZG4 A;  3C1B C;  4J8V D;  4WU8 C;  2XFS A;  4WBG A;  3VOZ A;  2ZY3 A;  3C1C C;  1M18 D;  3W98 D;  1WYC A;  4UA7 A;  1U35 B;  4KZ6 A;  4HEF A;  5F1G A;  3L25 A;  5IHV A;  3D4F A;  5HW3 A;  4OPR A;  3HON A;  4DDS A;  3B6F A;  3REK A;  3PBS A;  3AZM D;  1FCN A;  5DTT A;  5CPJ B;  2F8N B;  2XR0 A;  5KSH A;  4EUZ A;  2RVQ C;  5F1F A;  5AV9 D;  4F94 A;  2WGW A;  2DCF A;  2ZY4 A;  3N6I A;  5KSC A;  4WZ5 A;  1PZP A;  4LD9 D;  1P3A A;  2HIO D;  5B2J C;  3NDE A;  1RGZ A;  3IHB A;  4KZ3 A;  3VH6 T;  4E3K A;  1ESI A;  2PYO D;  1P3I B;  4LV3 A;  2H0T A;  3MGR C;  1GHI A;  3O62 B;  3AN2 C;  4WJ3 C;  3MGS A;  3EPJ A;  3F6T A;  5B2I D;  1P3K A;  3O3V A;  2E8I A;  2Z2M B;  2Y55 A;  3FZC A;  5JA4 A;  1KGE A;  3IWI A;  1S32 A;  4YM6 C;  1IEL A;  3Q82 A;  3UTB C;  1LL5 A;  1J9M A;  2DF4 C;  1P34 A;  3E2K A;  1AOI B;  1HQ3 C;  2Y2J A;  1P3M A;  2Y4A A;  4R0Q A;  2ZY5 A;  4KGC A;  5BNX A;  3DWZ A;  2X01 A;  4X23 C;  2HUE B;  3LZ0 B;  4X68 A;  5AY8 C;  4Z5T B;  2J9O A;  4ID4 A;  2YFW A;  3W99 B;  3REK B;  1O7E A;  3ZVT A;  2JBF A;  4HGA B;  4FSF A;  4UHU A;  5CPJ D;  3PBO A;  4J8V C;  5F82 A;  5AV5 C;  3AZK A;  2F8N D;  1SDE A;  4WMC D;  3DWK A;  2WGW B;  1DJA A;  3C7U A;  2IO5 C;  1M18 C;  4H9R A;  3V5M A;  3MVD C;  1I2S A;  1Q2P A;  5M19 A;  5A92 A;  2IWC A;  3AZG A;  1ULY A;  3ZDJ A;  3AL0 C;  3AFA A;  5GT3 B;  1P3I D;  5CPK C;  5FUG A;  4R3B A;  4AWL C;  3O62 D;  4KHA A;  2C5W B;  5C3I B;  3AZM C;  3VH5 T;  4JXG A;  3OPH A;  1KX5 C;  2QMI A;  4HBT A;  5HAP A;  5AV9 C;  1P3G A;  5GXQ A;  1ERM A;  5JA4 B;  1WE4 A;  4ZAM A;  2ZC7 A;  3L27 A;  3REH A;  1I2W A;  3UPO A;  2CC1 A;  4ZDX A;  2PYO C;  3TU4 A;  2EFX A;  4H9S A;  4GD8 A;  5B40 C;  4MEZ A;  3H0R C;  1AOI D;  3V39 A;  3AZH A;  1P3M B;  3BFF A;  5JRG D;  5AQA A;  4KGC B;  5B2I C;  4EQI A;  1PIO A;  3UDX A;  5DTS A;  3MZD A;  1ES5 A;  2XD1 A;  4DE0 A;  3LZ0 D;  4JLF A;  4Z5T D;  3NIA A;  4WU9 C;  3S1Y A;  3W99 D;  1M1A D;  4OJO A;  4E45 A;  1ZLA D;  4CJN A;  1NY0 A;  3OPP A;  3AV1 D;  5BO0 B;  1L0E A;  3AZK B;  4ZBJ B;  5GLB A;  3M6H A;  5B32 A;  4LG2 A;  1KX3 A;  3AZF B;  4EBN A;  4C3Q A;  4KZ5 A;  5DF7 A;  3G2Y A;  4QU3 A;  1U35 C;  5B0Z A;  5E2G A;  3LZ1 B;  5GT3 D;  5FUG B;  3WAA A;  4JF5 A;  4JKT A;  1EQZ B;  1NXY A;  2F8N G;  3AZI B;  3HLF A;  2ARO A;  4WEL A;  1DY6 A;  1P3O B;  5CPJ C;  5AVC A;  3MXR A;  3R45 A;  1KE0 A;  1B6W A;  3NDG A;  5GXQ B;  2QPN A;  4B4Z A;  3AZE B;  4IJF A;  4XUX A;  5FQM A;  3FWL A;  3B6G B;  2WKH A;  3MGQ A;  1ES2 A;  3ZNY A;  3TU4 B;  1P3I C;  3WRZ A;  1MBL A;  4K91 A;  3AGE A;  3PBT A;  3AZH B;  4WEJ A;  3O62 C;  2ZQ9 A;  2H10 A;  5GLC A;  1ID3 A;  5EVI D;  1CEF A;  3GQZ A;  2WGI A;  5DNN D;  2Y59 A;  3N3F A;  1BFM A;  3MKF A;  3ITB A;  3TOI A;  3WS0 A;  3Q7V A;  4NYU A;  5FI2 A;  3KUY A;  5CPI A;  3A3D A;  4JJN A;  1JTG A;  3UY6 A;  5HX9 A;  4BEN A;  1BH9 B;  1AOI C;  5KMW A;  3ITA A;  1S6R A;  3IWO A;  1KX3 B;  4YFM A;  3LJA B;  3AZF D;  4P85 A;  4E3L A;  1B67 A;  2HDU A;  3LZ1 D;  3REI A;  2HUE C;  3LZ0 C;  4Z5T C;  3X1V A;  4KZ9 A;  3VOY A;  1EQZ D;  3W99 C;  5CP6 D;  3AZI D;  2JSS A;  3REK C;  4NZ1 A;  4HGA C;  1P3O D;  2WZX A;  2LY8 A;  2YFV A;  3X1S A;  5B24 B;  3AV2 B;  4IBX A;  3G34 A;  3NCK A;  1P3B A;  3G2Z A;  5JYP A;  3PBR A;  3AZE D;  4BD0 A;  1Q9C A;  1PW1 A;  3WX7 A;  1FR6 A;  3MGQ B;  3B6G D;  3BRM A;  2XD5 A;  5GT3 C;  3BLS A;  3UDF A;  4OJP A;  2ZMA A;  2VQR A;  4R8P A;  5AV8 D;  4E44 A;  5AQB A;  4LCL A;  4QJG A;  4KEN B;  5C3I C;  3BFG A;  5CHJ A;  1ID3 B;  4KZ8 A;  4WYY A;  3IF6 A;  1TZY B;  1BT5 A;  1JWP A;  3LY3 A;  5AVB B;  3AYW B;  2G5H C;  2EX6 A;  2OV5 A;  4OPQ A;  1F66 A;  2B5R A;  3LO7 A;  4E3M A;  3IHA A;  3N4I A;  2Y2Q A;  5B1M A;  1P3P D;  1M19 D;  2IOU A;  1U60 A;  3Q7V B;  3ZHH A;  5BNV B;  3KUY B;  5CPI B;  4LV1 A;  4NET A;  3ZGA B;  1P3M C;  4H9O B;  4Y0U A;  5B0Y A;  1P3F A;  1L2S A;  3VH6 W;  4KGC C;  4KUD A;  3VFF A;  4U3T A;  1TAF B;  3REI B;  2NZD A;  4X53 A;  3L29 A;  5TFQ A;  4YS3 D;  5A93 A;  3M2J A;  3KS4 A;  3REJ A;  3C4P A;  1BH8 A;  1CI8 A;  2JE5 A;  1W7F A;  3O88 A;  1K56 A;  3AZK C;  3S22 A;  2RIQ A;  5B24 D;  4ZBJ C;  3AV2 D;  4GZB A;  3MGP A;  4RYE A;  1Q2Q A;  2WGV A;  3FV7 A;  5CGW A;  3AZF C;  3WA9 B;  3VMA A;  2G2U A;  3REL A;  1YU2 A;  3OZH A;  5DF8 A;  1G6A A;  3LZ1 C;  4OOL A;  3HL9 A;  1YU4 A;  4DDY A;  3MNN A;  3AZJ B;  3WTP E;  1EQZ C;  1BZA A;  5M1A A;  4J8X A;  3AZI C;  4J8W B;  4LV0 A;  1P3O C;  4S2N A;  1M6K A;  1FR1 A;  2CV5 A;  1TZY D;  1IEM A;  4IBG A;  5GSU A;  4S2L A;  5AVB D;  3AGF A;  3EPL A;  4ZUX A;  5GXQ C;  3AYW D;  3AZE C;  4XUJ A;  3MBZ A;  5BOH A;  3B6G C;  4GHL A;  1XA7 A;  1FSW A;  4XXR A;  3TU4 C;  1GHP A;  1H3O B;  2ZQC A;  3AZH C;  3ZVW A;  3P5J B;  5B0Y B;  2Y2O A;  2FJ7 B;  4KUD B;  2NQB B;  1BTL A;  3CJM A;  4N1H A;  5BS7 A;  3MGR D;  1WYB A;  3REJ B;  4GDN A;  3X1U A;  3VH5 W;  3G4P A;  2I72 A;  1CI9 A;  4M6B A;  2ZC3 B;  4YIN A;  4OOY A;  4LCM A;  4OQH A;  2OLV A;  3WRT A;  1KX3 C;  3LJA C;  5EOO A;  3REL B;  3WA9 D;  3AZN B;  3IF5 A;  1HTA A;  3I7J A;  5FI6 A;  3MNN B;  4C75 A;  4WNN B;  3AZJ D;  3OCL A;  5E2E A;  4R4R A;  5CGS A;  4J8W D;  5U47 A;  2R9W A;  1N1J A;  5B24 C;  3AV2 C;  1KX4 A;  3N7W A;  4JF4 A;  3LEZ A;  4X23 D;  3KS8 A;  4JXS A;  5AY8 D;  3N8S A;  3VP1 A;  2Y2I A;  1KDS A;  2ZJ9 A;  4DE3 A;  3MGQ C;  3SOI A;  1VQQ A;  5AV5 D;  4Z9Q A;  4BLM A;  5DF9 A;  5FAS A;  2HDS A;  3C7V A;  4RX3 A;  4NZ5 A;  3VSL A;  3MVD D;  1ID3 C;  3WKJ A;  4HBU A;  2FJ7 D;  1TZY C;  3HLE A;  2NQB D;  5AVB C;  3W96 A;  1EI5 A;  4Z66 B;  3AYW C;  3FDD A;  5CPK D;  4PM6 A;  3X1U B;  1FQG A;  4WM9 A;  3V50 A;  3B0B A;  4CSR A;  4G91 B;  3KUY C;  5CPI C;  4H9Q B;  1KX5 D;  4NE3 A;  3W97 A;  3WS2 A;  4U0X A;  4Z2M H;  4R23 A;  5DNM B;  5GHZ A;  4QY6 A;  3AZN D;  1T3U A;  5FAP A;  3WS5 A;  3REI C;  3HSH A;  1YQS A;  5B40 D;  2XF3 A;  3AZL A;  3BLM A;  3N8L A;  1N1J B;  1BLC A;  2J9P A;  4OPZ A;  4DRT A;  5TR7 A;  3VFH A;  1GA0 A;  4CAY A;  1W8Q A;  4X55 A;  5E5A A;  3L28 A;  3SH7 A;  4WU9 D;  1FCO A;  3WA9 C;  5F99 A;  4KZ4 A;  1E25 A;  5CTN A;  3X1T A;  3LEL A;  3AZJ C;  1L0F A;  4BL2 A;  4J8W C;  3WKJ B;  5B31 A;  1QME A;  4K0W A;  5FAQ A;  4O7D A;  5CED A;  1U35 D;  3W96 B;  4Z66 D;  3ZG0 A;  3EPH A;  1W79 A;  3MFD A;  5EEC A;  3ISG A;  3NQJ A;  1YLY A;  4OP5 A;  2F8N H;  3B6F B;  2ZQ8 A;  2XEP A;  1ONH A;  4CSR B;  3NY4 A;  1IYQ A;  1K57 A;  2Y2L A;  1WWS A;  1C3B A;  4NY2 A;  1BLP A;  1HD8 A;  4MLL A;  5A90 A;  5B0Y C;  5DNM D;  3JYI A;  1P3A B;  4N1X A;  5GT0 A;  2FJ7 C;  5KZH A;  4KUD C;  4DE2 A;  1P3L A;  1I5Q A;  2NQB C;  3ZFZ A;  1JVJ A;  5EOE A;  5CXW A;  4KG6 A;  2H0Y A;  3REJ C;  3MGS B;  1SCW A;  5AV6 A;  5JYO A;  1MKI A;  4PM5 A;  1P3K B;  5M18 A;  1HVB A;  2P9V A;  2J8P A;  5E5A B;  1LI0 A;  1S32 B;  5F99 B;  3REL C;  4ZJ3 A;  3AZN C;  2ZM5 A;  2IWB A;  4XZQ A;  2HP5 A;  1P34 B;  4X56 A;  3MNN C;  3G30 A;  2PU2 A;  4ZJ1 A;  3HLB A;  5I94 A;  5B33 A;  5BNX B;  4CPK A;  4IBR A;  1K25 A;  2FFY A;  5EPH A;  3CMZ A;  4N9K A;  3NQJ B;  2YFW B;  1XP4 A;  1E3U A;  5GL9 A;  3B6F D;  3REK D;  1L0D A;  5F83 A;  3WS4 A;  4H9R B;  3Q81 A;  1P3A D;  4B88 A;  3AZG B;  1XKZ A;  5G49 A;  3AFA B;  1M19 A;  4OOM A;  3HUO A;  4Z66 C;  4IBI A;  2G5I C;  3QNC A;  1BUL A;  2XQZ A;  1W5D A;  4KHA B;  1W8Y A;  4NE6 A;  3MGS D;  4J8U A;  1R4V A;  2WKI A;  4NFT A;  4G91 C;  3L26 A;  1P3K D;  5HAI A;  4Y0O A;  2BYM A;  3PAE A;  1P3G B;  2P9V B;  1KVM A;  4OVD A;  5DNM C;  1S32 D;  1OME A;  3REH B;  3HLW A;  3HUM A;  4FD8 A;  4IVI A;  3IXG A;  3V3R A;  3A6N A;  5B1L A;  1P34 D;  3W8K A;  3WTP A;  4RVA A;  3GMW A;  1P3M D;  2BG1 A;  3UTA A;  5CHL B;  4KGC D;  1MXO A;  1JFI A;  1Z6F A;  1K54 C;  1TDL A;  1IYS A;  3NQU A;  4EO5 B;  2ZY2 A;  2A3U A;  2UWX A;  4L0L A;  3C1B A;  4WU8 A;  3ZNT A;  3V9R A;  1F1E A;  3C1C A;  1YMX A;  2ZC6 B;  3AZK D;  5B32 B;  3O87 A;  4MBF A;  3B0C T;  3AZG D;  4QHC A;  5B0Z B;  4FH4 A;  3BFC A;  3UNW A;  3AFA D;  3W96 C;  1HZO A;  3WAA B;  1CEG A;  3GVB A;  4DRA A;  4EV4 A;  2ZC5 B;  3B6F C;  4IED A;  5GHY A;  4J8U B;  2ARO B;  5AVC B;  1YUE A;  2BYM B;  5B2J A;  3R45 B;  3KWQ A;  4MNR A;  4IBK A;  1P3G D;  2IWD A;  3A1I A;  5GXQ D;  3PAG A;  3LY4 A;  1JTD A;  2J8Y A;  4WZ5 C;  1ONG A;  1P3A C;  3REH D;  4M3K A;  3AN2 A;  3TU4 D;  5L2F A;  2H5S A;  1YMS A;  4S2I A;  3AZH D;  4X6T A;  3MGS C;  3UTA B;  3BFD A;  4XUZ A;  1PI5 A;  1P3K C;  1ES3 A;  3TG9 A;  4YM6 A;  3UTB A;  4KZB A;  3NQU B;  1KE3 A;  5FQI A;  2EX2 A;  1S32 C;  5F99 C;  3V9R B;  3L2A A;  4PMA A;  1RGY A;  1HQ3 A;  5FA7 A;  5CHU A;  3C1C B;  3A3I A;  4QLC A;  4JJN B;  1P34 C;  1XPB A;  4GOG A;  3UT9 A;  4JBF A;  1RP5 A;  5BT1 C;  4UPK A;  5B32 D;  3BM6 A;  1KX3 D;  3RXW A;  3LJA D;  3IWQ A;  3A3E A;  2DNS A;  4H9N A;  5B0Z D;  3KXB A;  4UUZ A;  3X1V B;  3RXX A;  4J8V A;  4S2J A;  1ESU A;  2ZM0 A;  2ARO D;  1M18 A;  3W98 A;  1YT4 A;  5CEC A;  2YFV B;  5E43 A;  3X1S B;  3VP2 A;  1K57 C;  5AVC D;  3KWQ B;  4GB7 A;  1P3B B;  4D2O A;  2OLU A;  1BUE A;  3A1K A;  1N4O A;  3AZG C;  1H8Y A;  3MGQ D;  3AFA C;  5BPV A;  3QHY A;  3AZM A;  5HL1 A;  5FQ9 A;  4R8P B;  5AV9 A;  3GTC A;  1M40 A;  1ID3 D;  2Y2K A;  3C5A A;  3IF6 B;  4LD9 A;  4WZS B;  2HIO A;  3DW0 A;  4QY5 A;  1P3G C;  2PYO A;  4MBH A;  5HFO A;  1F66 B;  3REH C;  5B40 A;  4OQI A;  5B1M B;  2L5A A;  4H9S C;  4QLC B;  3KUY D;  5CPI D;  4JJN D;  4IJE A;  5B2I A;  1KDW A;  3UT9 B;  1ZG6 A;  4GN2 A;  4WZ4 A;  1P3F B;  3VP0 A;  4H9N B;  2Q9N A;  3KXB B;  4DXB A;  2NZD B;  3REI D;  2XH9 A;  2XGN A;  4EO5 C;  3X1V D;  4N9L A;  2ZM8 A;  3E2L A;  3OCN A;  5FQJ A;  1BH8 B;  2C6W B;  3N8R A;  4H8R A;  4NE5 A;  3WS1 A;  3W98 B;  5B32 G;  2QZ6 A;  2FFF B;  3TSG A;  3Q7Z A;  4OJ6 A;  3MGP B;  2Y2N A;  4B4X A;  2HDQ A;  1P3B D;  5B32 C;  3IQA A;  5HAR A;  3H0M C;  1ZKJ A;  5B0Z C;  3HRE A;  3DTM A;  2V2F F;  1IYO A;  2XK1 A;  3WAA C;  3FKV A;  5CPJ A;  3MKE A;  3Q1F A;  4R8P D;  2F8N A;  4J8X B;  4EBP A;  4WMC A;  3G31 A;  4IBE A;  5FSR A;  4J8U C;  2VGK A;  2ARO C;  4IBC A;  4U0T A;  4LD9 B;  2CWE A;  2CV5 B;  5AVC C;  2HIO B;  5GSU B;  4ZUX B;  1TVF A;  1P3I A;  3WWX A;  3EG5 B;  1LHY A;  4E6W A;  4A5R A;  1F66 D;  4XUJ B;  1Y54 A;  4NYY A;  3O62 A;  5B1M D;  5DTK A;  1BSG A;  4QD4 A;  1SDN A;  5E2H A;  4KG5 A;  4JPM A;  5AQ9 A;  5EUA A;  1YU1 A;  1YM1 A;  2ZQA A;  4PM8 A;  3UTA C;  5B0Y D;  1P3F D;  2Y91 A;  3HLC A;  2HDR A;  1K4F A;  4KUD D;  4DE1 A;  5FAO A;  2NZD D;  3UE0 A;  1E4D A;  1AOI A;  3REJ D;  5JRG A;  3V3S A;  1K56 D;  4JJN C;  2P74 A;  4DQY B;  3MGP D;  4BL3 A;  3LZ0 A;  4Z5T A;  3REL D;  1SKF A;  1M1A A;  3W99 A;  3LCE A;  1K55 A;  1YLZ A;  1ZLA A;  3C4O A;  4DF6 A;  4JXW A;  3AV1 A;  1LI9 A;  3X1V C;  4S2O A;  3MNN D;  4C6Y A;  2Y2M A;  4Y7P A;  4J8X D;  3ZG7 B;  3HVF A;  2WUQ A;  2ZQD A;  1K6S A;  1YLJ A;  2EFU A;  4OP8 A;  3X1S C;  1DJC A;  2CV5 D;  3KWQ C;  1KX4 B;  5GSU D;  4PPR A;  1P3B C;  1NRF A;  4LV2 A;  4E3O A;  4ZUX D;  5E2F A;  5GT3 A;  1KGG A;  4KQR A;  5CHM A;  4XUJ D;  1VM1 A;  2ZQ7 A;  3VH5 A;  2ZC4 B;  4IBB A;  4ZTK A;  3CG5 A;  3FKW A;  3OC2 A;  1PI4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...