2JCHA

Structural and mechanistic basis of penicillin binding protein inhibition by lactivicins
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
684
structure length
461
Chain Sequence
SEITYSDGTVIASIDYLYFTTLAEAQERMYDYLAQRDNVSAATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTNQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PENICILLIN-BINDING PROTEIN 1B
publication title Structural and Mechanistic Basis of Penicillin-Binding Protein Inhibition by Lactivicins
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Drug-binding protein
total genus 144
structure length 461
sequence length 684
ec nomenclature
pdb deposition date 2006-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
A PF00912 Transgly Transglycosylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2jchA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2jchA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2jchA02
2J9OA 3N8LA 2H0TA 2G2WA 1N9BA 3EQVA 1KE3A 4U3TA 5HX9A 4N92A 4ZJ2A 1JVJA 4GOGA 1ES5A 4E3IA 3FWLA 3VMAA 5M18A 2EX2A 1CK3A 3RXWA 3HBRA 4X69A 1I2WA 3OPPA 4OPZA 3HUMA 4KENB 5G18A 4MLLA 3MZFA 4PMAA 4OLDA 2BG1A 3TSGA 2EX9A 3DWKA 1RCJA 4KZ8A 5HARA 4OH0A 2XK1A 3BYDA 4KZAA 5FQKA 5J8XA 1YT4A 2HDQA 3MXSA 2ZC3B 5EVIB 3Q7VB 4OOYA 3PAEA 1CI9A 2QPNA 2H5SA 2ZC4B 2HPBA 5EVLA 4IBRA 1FSYA 1NRFA 3BLSA 4LENA 2ZLYA 4X53A 3EQUA 4UA6A 3ZCZA 3OC2A 1E3UD 3IQAA 4OVDA 4BQMA 4E3LA 1PI5A 4M3KA 1KGGA 3IXDA 5GLBA 5FAQA 3UPNA 1BT5A 2Y2JA 1BLCA 1YLZA 3M6HA 3TOIA 4DF6A 1YMSA 3PTEA 1M40A 3Q81A 4RA7A 2Y2QA 2WKEA 3G32A 4B88A 3LO7A 5BOHA 2JCHA 2Y55A 3BLMA 3PAGA 3ZVWA 2ZD8A 4Y7PA 3GVBA 3V39A 1LI0A 1IELA 3ITBA 4OKPA 4OQ0A 1S0WA 1ESUA 3N6IA 1XX2A 3UPPA 1NY0A 1G6AA 3N8RA 4N9KA 2A3UA 1ERMA 3BFCA 2OLVA 3DTMA 5FQMA 3IHBA 3M2JA 2EX8A 3NBLA 1W8QA 3M2KA 3G4PA 5A92A 5EVIC 1CI8A 1TDLA 3DWZA 1O7EA 1NZOA 1HTZA 4BLMA 4OP5A 1K54C 3BFDA 1ONGA 4OPRA 1GHPA 3VP0A 3WS4A 1FCMA 3HLGA 5A90A 3ISGA 2OV5A 2Y2KA 4R4RA 3IH9A 1SCWA 3ZGAB 3HLFA 1YLTA 2Y91A 4D2OA 2I72A 3BECA 4CPKA 3GSGA 3B3XA 5CHJA 3Q7VA 2V2FF 3P09A 3W4OA 1W79A 4R1GA 5DTKA 4DDYA 4JXGA 4JXWA 4WEKA 2RCXA 5FQJA 4QY5A 3ZG8B 5FQIA 4WYYA 3IF6A 3SS5A 5CGWA 4S2OA 3ZDJA 5CTMA 3FKVA 3BM6A 3A3FA 4PM9A 3HL9A 4P87A 1KGEA 3BFGA 5CTNA 4EWFA 5DF8A 3FKWA 3W4QA 1FCOA 2BLSA 2WKHA 2P9VA 1K6SA 3G35A 4PM5A 1ONHA 1O07A 1XP4A 1I2SA 3CZDA 4OOLA 5F82A 2WZXA 1N4OA 2ZQDA 4KZ7A 4ZAMA 3IWOA 4QB8A 2ZJ9A 3S22A 1NXYA 4CJNA 1SDEA 2HDSA 4MBFA 1KDSA 5FSRA 4OQHA 3WS0A 2XEPA 4FD8A 3A3DA 1DJBA 3AGDA 3E2LA 3OCLA 5M1AA 2Y2OA 3VOZA 3WS5A 3BFFA 5EVID 5KZHA 2WGWB 4E6XA 1BSGA 3UDIA 1AXBA 1Y54A 3IWQA 3LY4A 5HL1A 4ZJ3A 3GV9A 2HP9A 2J8YA 1L2SA 1E4DA 1YQSA 4LV1A 3NCKA 2XD5A 4YINA 3C4OA 4OQGA 2E8IA 3VP1A 5DVAA 4FH2A 2XFTA 4X68A 4WZ4A 4UHUA 4OOMA 1LI9A 2WADA 2XGNA 4UA7A 4E3MA 1W5DA 3WRZA 3Q7ZA 1JWPA 4GKUA 4JPMA 4KG5A 5M19A 5HAQA 1K56D 1ZG4A 4GD8A 4JKTA 5A91A 1MBLA 3D4FA 4ID4A 1K6RA 4DXCA 4XUZA 4HESA 2WKIA 3ZG9B 4KZ4A 5JYOA 2EFUA 3MKFA 4WZ5C 4B4ZA 3JYIA 5D3OA 3UY6A 5EPHA 2ZQ7A 3VSLA 2Y2IA 4S2JA 2EFXA 2Y2MA 3GTCA 5CEDA 4OPYA 4S2KA 2WAFA 2Q9MA 3NI9A 3UE0A 4A5RA 1IYOA 4MBKA 3BFEA 2P74A 5HW3A 5E2HA 2DNSA 5F1GA 3QNCA 5HAPA 3LCEA 5CERA 4DE2A 1IKGA 4PM8A 4FH4A 2B5RA 2HP6A 4ZJ1A 2XF3A 4WEJA 3ZFZA 4X56A 3UNWA 3W4PA 4OLGA 2PBYA 4EBLA 1QMEA 1K38A 3UPOA 1L0DA 4RYEA 5CGSA 1K55C 1QMFA 1H8YA 2GDNA 5JYPA 4IVIA 1BUEA 2H0YA 1SDNA 5TGFA 1WYBA 4E6WA 3OCNA 4Y0OA 5IHVA 3E2KA 4NETA 4QD4A 3BEBA 1ZKJA 3ZNTA 4WELA 4WBGA 5CRFA 5GLCA 4JXVA 2R9WA 3SS4A 3V50A 1VM1A 1IEMA 1U60A 3FYZA 1K55A 1LHYA 2WYXA 4K91A 1GCEA 4S2IA 3OPRA 5FAOA 3VP4A 3IT9A 4HBTA 5FASA 1PWCA 5FAPA 3G2YA 3PBSA 2QZ6A 1KGFA 1NJ4A 2Y2LA 4PPRA 4R3BA 4HEFA 4P6BA 1PI4A 3DW0A 3VOYA 1L0EA 4R0QA 1NYYA 3G34A 3A3EA 2Z2LB 1KDWA 1MWUA 1HVBA 2A49A 4LV0A 1BZAA 1DJCA 2Y2HA 1ZC2A 3V3RA 5EVIA 3P98A 3M6BA 4N1HA 4N1XA 2ZM0A 3PBNA 4R3JA 1K54A 2C5WB 4K0XA 3V5MA 1ESIA 1FOFA 5L2FA 1GA0A 4DE0A 3FV7A 4E3NA 3IXHA 2WK0A 3PBQA 2Y2GA 4R4SA 4LCLA 5E2EA 5EUAA 4BL3A 2EX6A 4RX3A 4ZBEA 3OPLA 2J7VA 1FR1A 4LV2A 5F1FA 4FCFA 1LLBA 1WE4A 3MZDA 3G30A 3BRMA 4UA9A 1K56A 1TVFA 1PYYA 3VSKA 3IXGA 1FQGA 4K0WA 4EBPA 3RJUA 3A3JA 1VQQA 4KQQA 5E2GA 1CEFA 2XLNA 3HLWA 1YLPA 3LY3A 1DJAA 4BL2A 4OONA 2XDMA 2JE5A 3SS3A 4KZ5A 3SH8A 3Q1FA 4OP8A 4QU3A 2H10A 5DF9A 4PM6A 1LL9A 3V3SA 1ERQA 3IH8A 2ZQAA 4PM7A 1PWGA 1G68A 3O86A 1GHMA 1K57C 1MKIA 3PBOA 5AQ7A 2G2UA 1EI5A 3MZEA 3NDEA 3TG9A 4Y0TA 1XKZA 1KVLA 3S1YA 4S2NC 3SOIA 4EUZA 1IKIA 2VGKA 2DRWA 3OPHA 3ZNYA 2IWCA 5KSCA 2X71A 5KMWA 5U47A 4JF6A 3LEZA 1Q2QA 1GHIA 3IWIA 1RP5A 3SH9A 2VGJA 3VP3A 4EV4A 3GQZA 5CECA 5GL9A 5GHZA 1SHVA 3ITAA 1H5XA 4GB7A 1PW8A 1NZUA 3NIAA 4FSFA 1I5QA 3VFHA 4Z9QA 4EBNA 3QHYA 1PIOA 1BLSA 3UE1A 2XQZA 4JF4A 5GLDA 4O7DA 2EXAA 4H8RA 4GDBA 1YM1A 1S6RA 1KE4A 1RGZA 1XGIA 2HDUA 4KG2A 3VFFA 4DXBA 4HBUA 2JC7A 2Y4AA 3C7VA 3ZG0A 4XUXA 4DRTA 1FR6A 3HUNA 4R23A 1CEGA 4B4XA 4BJPA 2ZC6B 1MWTA 1W7FA 1SKFA 5TFQA 4EQIA 4LCMA 1RGYA 1BLHA 3O3VA 3IHAA 4JF5A 3AGEA 3N8SA 4DE1A 4RVAA 3HLBA 4KG6A 3C4PA 4LV3A 4S2LA 4JBFA 4WZ5A 1HD8A 3A3IA 3GRJA 5A93A 1NYMA 3HLEA 4E3OA 3N7WA 3W8KA 1EROA 4C75A 5I94A 2J9PA 3GMWA 4KZ9A 4QJGA 3RXXA 4MEZA 1XGJA 4XXRA 1W8YA 1FCNA 4WM9A 1WYCA 3O87A 2HDRA 1L0FA 1ZG6A 4JXSA 4L0LA 4U0XA 3FZCA 2ZC7A 2EXBA 1MWSA 5GHYA 1C3BA 4WMCD 4GD6A 1XA7A 4KZBA 4MNRA 1LL5A 1KE0A 3IF6B 2ZM8A 3IF5A 5FI7A 2XR0A 2WGWA 1YMXA 3CJMA 5HFOA 4C3QA 2FFYA 1GA9A 4KQOA 5FDHA 3SH7A 5CHMA 2X01A 2PU2A 3CG5A 2OLUA 3MXRA 5FA7A 3OZHA 4BD1A 3I7JA 4NK3A 3ZVTA 4C6YA 3UE3A 1XXMA 3N4IA 2P9VB 5CHUA 4BD0A 4S2MA 4GDNA 4MBHA 3GR2A 1YLJA 4IEDA 1JTGA 2WGIA 5DF7A 2V20A 3UO9A 3AGFA 1DY6A 2WUQA 1Z6FA 5EECA 1ES4A 2PU4A 2ZQ9A 3NDGA 4Y0UA 1PZOA 1MXOA 5AQ9A 5F83A 4Q8IA 2R9XA 1ES3A 4P0MA 2Y2PA 3Q07A 4P85A 5AQAA 4S2PA 4ZTKA 2CC1A 4BENA 4DE3A 2RL3A 3MFDA 3CMZA 3WRTA 5EOOA 2XH9A 3QNBA 4UAAA 1YLYA 1HZOA 1MPLA 4GN2A 4GNUA 2ZQCA 4QY6A 5FQQA 3HLDA 1TDGA 4RX2A 2WAEA 4KZ3A 1PWDA 1XA1A 5CXWA 1JWVA 3ZG7B 4YFMA 3IF6C 3C5AA 3G2ZA 4U0TA 3UN7A 1Q2PA 2IWBA 5FQ9A 4F94A 5FI2A 1IYQA 1JWZA 3MBZA 3NC8A 3UDFA 4KQRA 4E3KA 1PZPA 3HUOA 3ZHHA 2ZMAA 1TEMA 2Y59A 1J9MA 1KVMA 2XD1A 4DDSA 3G31A 1L0GA 5EOEA 4OPQA 4QHCA 4OQIA 2Y2NA 1JTDA 1EWZA 2C6WB 4KZ6A 1MWRA 1OMEA 4X6TA 2Q9NA 3VP2A 4ZDXA 1YLWA 5TR7A 5DTSA 4JLFA 2WZZA 5FI6A 2FFFB 1BLPA 1MY8A 3MKEA 3C7UA 1ALQA 1K4EA 5CGXA 1FSWA 2IWDA 5DTTA 2XFSA 3HREA 3PBTA 1K4FA 2HP5A 1IYPA 5AQBA 1BTLA 3HLCA 4IBXA 3O88A 3NY4A 3IXBA 5CEBA 5HAIA 3HVFA 2V1ZA 1K57A 4IVKA 5GHXA 2WGVA 2UWXA 3S4XA 3UDXA 4X55A 1IYSA 4N9LA 2ZC5B 1H8ZA 5E2FA 4WMCA 3WS2A 1E25A 1XPBA 4GZBA 1BULA 3WS1A 5EE8A 3ZG5A 2JBFA 1K25A 2DCFA 4S2NA 4DKIA 1M6KA 5GLAA 1PW1A 1ES2A 3Q82A 4E3JA 5KSHA 1E3UA 3WWXA 3PBRA 5E43A 2Z2MB 2ZQ8A 5FATA 2QMIA 2OSUA 2ZM2A 2X02A
chains in the Genus database with same CATH superfamily
3N8LA 3BWLA 4XZQD 3AZNA 1KE3A 2D01A 3UB5P 3AZEC 1TZYB 3H7WA 1JVJA 1T18A 5B24D 3UT9D 2V8CA 3L25A 3B0DC 3AZHC 5G18A 4OPZA 2F2AC 5B0YC 3HUMA 3KX0X 3MZFA 3AV1B 1U35D 5HARA 2VK3A 3TU4A 2XK1A 2ZL1A 3MXSA 1TAFA 3LZ1C 4YS3B 2PHYA 2QPNA 1WA9A 2H5SA 3EOIA 1P34D 5EVLA 4IBRA 1FSYA 1NRFA 3BLSA 4X53A 2ZLYA 4EUVA 5JRGC 3EQUA 1YPRA 2V9AA 1E3UD 3IQAA 5DNMC 3VOLA 1WWIA 5B2JB 1PDCA 1VEUA 2Y2JA 1GSWA 1YLZA 2OAP1 4BMWA 3PTEA 4I5SA 3LJAB 2OWHA 4RA7A 3G32A 1YU1A 3AZMB 3F1OA 1ID3D 1KOUA 3KS4A 2J3TC 2BYKB 1TZYC 1NRJA 3V39A 3W96D 1HQ3A 1ESUA 1J3WA 2G5HC 1P3AA 2F8NH 1YU2A 3N8RA 3N3FA 3BFCA 1GOIA 2OLVA 5GSUD 2OOLA 1B6WA 3KXBA 3NBLA 1W8QA 3S7OA 1CI8A 3DWZA 1HTZA 4YS3C 4JJNA 4OP5A 2K7SA 4IUHA 4OPRA 3CUEC 3MGRB 1P3GD 3NULA 3WS4A 1S4RA 4GH9A 3ISGA 4R4RA 4BBTA 2CV5A 1FILA 4IBEA 4CPKA 3Q7VA 5B2JC 2NZDA 4JXGA 1OJGA 4JXWA 2QWSA 3K2NA 5FQJA 5FQIA 2BASA 3AZMC 5CGWA 5AVBA 4LFUA 1P3FA 4S2OA 3R7WA 2AROA 1M1AC 3FKVA 5CTMA 1AOIB 1P3LD 1CXWA 3A3FA 4P87A 1KGEA 4EWFA 1F5MA 5DF8A 4HMDA 2BLSA 4NE6A 2P9VA 3F1NA 3A0SA 3EGXC 5AV8A 3X1TB 3IWOA 5B31A 1NXYA 2HDSA 5AV9B 5J3WA 3JPUA 5C3IB 1DJBA 3AGDA 3OCLA 3MGRC 2W3EA 1P3PA 2JKRM 5EVID 5KIZA 1W1TA 3F1PA 4Y2FA 3B6FB 4ZJ3A 2XD5A 4YINA 3W98B 2E8IA 4II7A 5AY8A 3VP1A 4E3MA 2XGNA 2WADA 5DFYA 3WRZA 4MMNA 4DQYB 4OJOA 1TS6A 4GD8A 2DMWA 4JKTA 1AOIC 4QLCA 3AZLA 3D4FA 5L10A 5F69A 5KDMA 4KZ4A 4DN0A 3AZEA 3EEAA 3VSLA 2IO5C 3GTCA 3AZHA 3X1TC 3EG5B 2P74A 4FTXA 5C3IC 3LR0A 3QNCA 5HAPA 5CERA 3PR6A 3LZ1A 4X1LA 3B6FC 3W4PA 3C1CC 3CHWP 1KX3B 3QP5A 3W98C 3T50A 1H8YA 3AZGC 2KDKA 2J80A 1W1PA 3ICYA 1SDNA 5TGFA 1WYBA 3V67A 4E6WA 2W1RA 5IHVA 3BEBA 4LGWA 3C1BB 4G3WA 3SS4A 1VM1A 5G49B 1IEMA 3UMDA 2V8FA 4HH3A 3KSIA 2IA2A 1BH8B 5CPKD 3IT9A 5B2ID 5CX7A 3AZFB 4MB3A 4ZUXD 2Y2LA 4PPRA 2HIOA 1EQZD 1P3OB 1ZLAB 3VOYA 4RQ9A 3PHYA 4HGAB 1NYYA 1KDWA 1MWUA 2A49A 5B1LB 2Y2HA 3T1RA 3V3RA 1A7WA 4YS3A 4OJPA 3DTKA 4EERA 4H9NB 3CUEA 3OBFA 4DE0A 3FV7A 2D49A 2Y2GA 5E2EA 2B02A 1X0OA 2FZ0A 2J7VA 4LV2A 4FCFA 5B2JA 4IBIA 4G91C 1OTBA 3QP2A 4UA9A 1S1YA 4ETXA 1PYYA 3IXGA 5B24C 4EBPA 3RJUA 3B33A 4IBBA 2HF6A 3X1SB 3AZMA 4KQQA 5E2GA 4Q0HA 2JKTM 1M1AA 5GSUB 4BL2A 2XDMA 3SS3A 3SH8A 3SZTA 2VZWA 1ERQA 3AZFC 3D72A 4YM6B 2JKFA 3UMEA 1AIWA 1P3OC 2G2UA 4HGAC 4GS9B 1P34C 4I3IA 5B1LC 3WTPA 3SOIA 3OPHA 4EETB 5CPJD 3RELD 3MVDB 3AN2B 3V9RA 3MGRA 1CJFA 4LRZE 3IWIA 2VGJA 2M1CA 4EV4A 5CECA 5GL9A 3B47A 4KGCB 4IBCA 3VFHA 1I5QA 3IBRA 3QHYA 2P7JA 1BLSA 1P9RA 2W3GA 2XQZA 3BJNA 2W3DA 5GLDA 2EXAA 1ID3C 3AZJB 4DXBA 1XGIA 2HDUA 1W1YA 3VH6W 3X1SC 2Y4AA 3AFAB 4DRTA 1S32A 1FR6A 4R23A 4D60A 5GSUC 3WTPE 4EQIA 1SKFA 2P08A 1BLHA 1BFMA 4JF5A 4KG6A 3C4PA 3MNNA 3MGQA 4JBFA 4S2LA 4ETZA 4LD9B 2ZY3A 3W8KA 3UTAB 4I39A 3EPKA 1GPFA 4MEZA 3RXXA 1LT0A 3X1TA 1S67L 4WM9A 4G3VA 3O87A 4JXSA 3MVDC 2ZC7A 3LELD 2YKFA 3NQJB 2J3WA 3GECA 4MNRA 5FI7A 1KE0A 3IF5A 2XR0A 4OJ5A 3CJMA 3TE8A 2FFYA 3C1CA 4KQOA 3SH7A 1YKDA 2X01A 3MXRA 1UGUA 3W98A 5FA7A 4Z2MH 3AZJC 3AZGA 2YKHA 3T12B 5G4YA 5DKKA 4BD0A 3AFAC 3OLOA 4XT2B 3X1VD 5EV0A 2PYOA 3X1UD 5GT0D 1DY6A 2WUQA 1Z6FA 5EECA 1ES4A 2PU4A 5AQ9A 2R9XA 3UTBB 2Y2PA 4LD9C 4KUOA 3MFDA 3CMZA 1P9WA 3UTAC 3WRTA 1H3OB 4UAAA 3S7PA 4HH2A 4QY6A 4GN2A 4GNUA 1KX5D 4KUDB 2UV0E 5CXWA 1JWVA 3H7WB 4IJGA 5B40D 5GT3D 3C5AA 4U0TA 1A0KA 5FQ9A 1IYQA 1JWZA 3LEQA 3MBZA 4KQRA 4E3KA 3HUOA 1BH9A 1TEMA 2Y59A 1W1VA 4PAUA 3JVUA 2LB9A 1L0GA 2KX6A 3TU4B 2Y2NA 1JTDA 4HIAA 4KZ6A 1OMEA 4X6TA 3W99D 2Q9NA 5BS7C 5B24A 3UT9A 1M18D 3HJIA 1BLPA 5G49A 4CAYB 1ALQA 3C7UA 1FSWA 2XFSA 2HP5A 1U35A 5AQBA 3HLCA 1D7EA 3O88A 4LLOB 3AZFA 5AV6D 1NLZA 3VH5W 5HAIA 3T4TA 1P3OA 2V1ZA 1P0ZA 4IVKA 4KUDC 3WD1A 3F1OB 4N9LA 3NHQA 1P34A 3AYWD 2PAVP 5B1LA 1BULA 1XFQA 2JBFA 2DCFA 5HZHA 1HQ3B 1GXDA 1PW1A 5GLAA 2YFWB 4E3JA 1E3UA 3M7PA 3BW6A 2HGVA 1ERMA 2OSUA 3KXBB 4UEYA 4MB5A 2H0TA 3LZ0B 4DRBA 3EQVA 5AVCD 1V9YA 4GOGA 1L3LA 4NXFA 4JJNB 3MSHA 1ID3A 3RXWA 3HBRA 4Z66B 3MJQA 3OPPA 3D9YA 5CPKC 4KENB 3W96A 2CV5B 1RCJA 3X1SA 1YAXA 2O9BA 3BYDA 3IBJA 4KZAA 2HDQA 1E88A 4NFTA 5GSUA 3AZID 3Q7VB 3PAEA 1AWIA 4LENA 1LL8A 3GDIA 4UA6A 5AVBB 4GS9A 3R7WB 1L6JA 2HZ5A 5CHLB 2J8PA 5FAQA 3UPNA 1E6RA 4H6JB 1LSWA 4G3KA 3MVDA 5B33D 1SKOB 2XROA 3KSHA 1M40A 1VB6A 3F1NB 3OOVA 4B88A 2WKEA 3LZ0C 3MGSD 2Y55A 3KWQB 5L07A 1H0GA 1TF1A 3ITBA 4JJNC 4OQ0A 3T4QA 1NY0A 3LIDA 4X23D 3EPLA 2JKRI 4Z66C 3AZJA 2A3UA 3KSGA 3WKJB 2CV5C 3M2JA 2EX8A 3AFAA 2WKPA 1ULYA 2O0YA 3KYQA 4K08A 3TJZC 1O7EA 4BLMA 1OTIA 3HLGA 3E4QA 1Q9CA 5CPJC 2Y2KA 3RELC 4ME4A 5CP6D 2OV5A 1SCWA 3L9KA 2I72A 2VV6A 3GSGA 5CHJA 1IFQA 3P09A 5E5AD 3KUYD 1YSQA 3MR0A 4WEKA 5KDMB 4WU9B 3ZG8B 2XA7S 1W2EA 1DRMA 3KFUG 3SS5A 3MQQA 3KWQC 1CF0A 3W2ZA 4PM9A 3HL9A 3K3DA 1TD5A 3C2WA 3WKJC 1I2SA 4OOLA 2WZXA 4XT2A 5BS7A 1N4OA 3S22A 2ZJ9A 4WJ3C 3G6OA 2XEPA 4FD8A 3WS5A 4O01A 2W27A 2NUTC 2FJ7B 5KZHA 2WGWB 4E6XA 1BSGA 1Y54A 2ZM5A 5DJTA 2W0NA 4OQGA 4KUDA 1UWPX 5DVAA 1P3BD 2XFTA 4WU9C 4UQIM 1DP8A 1JFIA 3Q7ZA 1JWPA 4GKUA 1OTDA 5K5BA 5M19A 5HAQA 1K56D 1DP9A 2HIOB 1MBLA 3X1VC 1K6RA 4XUZA 4J8WD 4HESA 2NUPC 5F5YA 2EFUA 3MKFA 1OTAA 3UY6A 4WNNA 4JGPA 4GHIB 3DBAA 4S2KA 1KS0A 3UE0A 3CITA 2FH5A 4HP9A 1IYOA 5CPKA 3E0YA 3BFEA 3VE4A 5F1GA 3LIFA 4CAYA 3IP4C 4F3LA 4ZUXA 1IKGA 1EQZA 2FJ7C 2B5RA 3LFVA 4WEJA 4HJ4A 4O0PA 1TS0A 2PBYA 3UPOA 1K38A 1PRQA 1QMFA 3T4KA 4OJ6A 1PNEA 5JYPA 2H0YA 1M1AB 3REKD 3OCNA 4QD4A 2YFWA 4L9EA 4NG2A 4WELA 3A1IA 3B0CW 4WBGA 3MMHA 4JXVA 2HIOC 3MS6A 2PT7A 1U60A 4DJ2A 3FYZA 1K55A 3LZ0A 4NYYA 3WAAD 1N9NA 4NXEA 1M18C 1T1BA 3WTPB 4AWLC 1YUEA 4PKYA 5FAPA 3G2YA 1NJ4A 4Z66A 3V9RB 3AZKB 4BWIA 4LRXC 1K0KA 3DW0A 4LRYC 2NQBB 4GW9A 5AV6C 1F66B 2Z2LB 4MN7A 2V1AA 1XJ4A 2VKSA 3M6BA 2WKQA 4N1HA 3PBNA 4OJLA 2C5WB 3AYWC 1FOFA 3T1QB 1KX4D 5CPJA 3RELA 3PBQA 4R4SA 5EUAA 5HD5A 1N9LA 1S32B 3OPLA 1LLBA 1ACFA 3MZDA 5B32D 4H6JA 3BRMA 1SKOA 3WA9D 5DNND 3MNNB 3MGQB 1FQGA 2O9CA 1VQQA 4X23B 2IO5B 2Y79A 2YFVB 2ZMFA 3KWQA 3HLWA 3WTPC 4OONA 2JE5A 5AVEA 1CQAA 5HPIA 4KZ5A 3Q1FA 5DF9A 3EGDC 1LL9A 3V3SA 3AZKC 3AZIC 3CI6A 4PM7A 1PWGA 5GXQD 3WKJA 2NQBC 3MZEA 1F66C 3A0RA 3C1CB 3BQAA 2Z6DA 5B1MD 3O62D 4S2NC 5CP6B 1IKIA 2DRWA 5F99D 3AZGB 4Y5FA 5U47A 2HV1A 4WU8B 4Z5TD 2WKRA 3VP3A 3W97B 1VHMA 3GQZA 4MN5A 5GHZA 3LELA 1S32C 1PW8A 2PYOB 4J8UB 1P3MD 3UE1A 3MGSC 2W3HA 4EU0A 1RGZA 3MNNC 3MGQC 4WU9A 1P3ID 2JC7A 4X23C 4IUKA 4XUJD 1CEGA 2JHEA 2XSSA 1FIKA 4LCMA 4DE1A 3X1VA 4LV3A 5AV5D 1HD8A 4CQHA 5CPID 3B6GD 4R6LA 3GMWA 1XGJA 4CLCD 1BH9B 5CP6C 1FCNA 5IS1A 4E44A 2VV7A 4DRAA 4U0XA 3FZCA 1F98A 4WMCD 3IX4A 4WU8C 1KX5A 1T19A 1XA7A 2FJ7A 3W97C 3IF6B 4XZQB 2WGWA 1YMXA 4G91B 2QYBA 3REID 2PYOC 1GA9A 4J8UC 2PR5A 5B24B 3UT9B 5CHMA 5B40A 5GT3A 4Y13A 2PU2A 5I5LA 1QO6A 1KU5A 3AZND 3I7JA 4NK3A 3UE3A 1XXMA 1ED7A 1U35B 4HJ6A 4MBHA 1P3KD 1YLJA 3AV2D 2V20A 3UO9A 3AGFA 3QP1A 2I9VA 3E4OA 4NXGA 4IJFA 1MXOA 1P34B 5IU1A 4HMCA 4P0MA 4P85A 1M18A 4ZTKA 4FOFA 1M19D 4EEUA 4OUIA 4GHIA 5EOOA 2XH9A 1GSVA 1YLYA 2DF4C 1MPLA 2ZQCA 3HLDA 3HCYA 2F8NG 4KZ3A 5BT1D 5AV6A 3NOTC 3ZG7B 2PYPA 3IF6C 4XZQC 3VH6A 1Q2PA 3CLOA 3UB7A 1P3BC 1ID3B 3AYWA 2VV8A 4H9QA 3KSFA 3UT9C 4KHAA 3W96B 2ZMAA 3CAXA 1J9MA 1H8MA 1KVMA 4Z1WA 2RIQA 3MGPD 2QHKA 4OQIA 3LGOA 1U35C 5G4ZA 4J8VD 3VP2A 5TR7A 5DTSA 5FI6A 3KSYA 2W3FA 5AJGA 3MKEA 2XRNA 5CGXA 2IWDA 1P3GB 3PBTA 3C30A 1N9OA 1IYPA 5CEBA 3IXBA 3AZKA 5BO0B 4GLQA 3AZIA 5HWVA 4X55A 1IYSA 2NQBA 1OT6A 1F66A 1OTEA 3WS1A 3A0VA 4S2NA 1M6KA 2NZDD 1ES2A 3Q82A 3WWXA 1HLUP 2PBDP 5E43A 5FATA 3W96C 1P3LB 2ZM2A 2J9OA 5B33A 1P3FD 2VEAA 4FUWA 5HX9A 2AROD 4ZJ2A 1ES5A 3FWLA 3VMAA 3MGSA 3WAAC 2EX2A 5L8MA 1CK3A 2QKPA 4X69A 1I2WA 2QJ7A 4PMAA 3TSGA 2EX9A 3DWKA 4X23A 4KZ8A 2YFVA 1P3GC 5J8XA 4WLAA 4R8PD 5AV8D 5B31D 5EVIB 1ZTUA 2OWJA 4OOYA 3B42A 1R4VA 3A6ND 2ZC4B 2HPBA 3VH6T 1P3PD 2Y8HA 3ZCZA 3NOPC 3FPWA 3T1SA 4BQMA 1PI5A 1KGGA 2GX5A 3IXDA 5GLBA 5CP6A 3UE6A 1BT5A 2BYMA 2LB5A 3RH8B 5AY8D 4DF6A 1YMSA 1P3LC 1MZUA 4WU8A 5A8BA 3Q81A 3W97A 2Y2QA 3UB6A 3QP4A 3WA9C 5BOHA 2JCHA 5DNNC 3REHD 2ZD8A 4J8UA 3AZLD 4OKPA 2PR6A 4HP4A 1S0WA 3N6IA 1XX2A 1V9ZA 5BNVB 3VH5A 3AZED 2EWWA 5FQMA 3IHBA 2FN2A 3FG8A 1LSVA 3G4PA 3AZHD 5EVIC 3HJKA 1PZRA 5B0YD 1NZOA 3BFDA 4EQ1A 1GHPA 4UPKA 3O62C 3VP0A 5A90A 1JFIB 3LZ1D 3ZGAB 3HLFA 1YLTA 4P6ZS 4D2OA 4Z5TC 3B3XA 3W4OA 1W79A 4R1GA 5JRGD 4DDYA 5HWWA 2RCXA 3H0LC 5DNMD 3LICA 4WNNB 3IF6A 4XZQA 4J8XD 2B18A 1P3BA 3T4OA 3ZDJA 3BM6A 5CPKB 2PRFA 5B2IB 5B0ZD 1Z2CB 3MXQA 4F3LB 4ZUXB 2J3TD 1TZYD 1EQZB 4ESPA 1ONHA 4NE5A 3C8CA 3CZDA 4L9FA 5B32G 2ZQDA 3O5YA 5CPIC 3B6GC 4KZ7A 4QB8A 4CJNA 4DMZA 1SDEA 1KDSA 3AV1D 3WS0A 4B9OA 3C38A 3E2LA 1BYWA 4ARZA 4YS3D 2F8NK 5EM0A 1AXBA 1H0IA 5HL1A 1E4DA 1YQSA 4LV1A 3C4OA 2L0WA 3REIC 4LPZA 4X68A 1W63M 4WZ4A 4UHUA 4OOMA 1LI9A 4CSRB 5BPVA 4UA7A 3RTYA 1W5DA 3AL0C 5B2JD 1Y28A 4JPMA 4KG5A 2A2LA 3VH5T 1E15A 4WL9A 3L29A 4EO5C 5HSQA 5B2IC 3LJAD 2HUEB 4J8VB 1P3KC 1F9IA 3AZMD 1B67A 2WKIA 3NJAA 4ZUXC 4WZ5C 4B93A 1EQZC 2B95A 1JNUA 1W63Q 2A24A 2ZQ7A 5EPHA 2Y2IA 5CEDA 5BNXB 3WAAA 4HNBA 5MC7A 2WAFA 3NI9A 2W1TB 4MBKA 5HW3A 5CPJB 3RELB 3PYPA 2VJWA 3F6TA 3LCEA 1P3GA 2OAQ1 4PM8A 2M7VA 2HP6A 4ZJ1A 3ZFZA 2K2NA 4X56A 5BT1C 2RTSA 4OLGA 5BO0A 3MGRD 1QMEA 1L0DA 4RYEA 5CGSA 1K55C 3REJD 1G6OA 3U2AA 4L9GA 3MQ0A 1NLYA 3LIEA 4IVIA 3JVVA 1BUEA 2VX8A 4NETA 3ZNTA 1E8BA 5CRFA 5GLCA 2R9WA 1P3LA 2HUEC 4J8VC 2F8ND 2WYXA 1LHYA 3CPTB 4S2IA 3WA9A 3WD4A 1OJ5A 5DNNA 3NQUA 1AOID 3DTEA 4HBTA 5FASA 1KGFA 3NOUC 3A1KA 3T4LA 4R3BA 4HEFA 1PI4A 4R0QA 4DJ3A 4Z2MG 3LELB 1TS7A 3A3EA 1S1ZA 1HVBA 4LV0A 1BZAA 1DJCA 3X1TD 5EVIA 3LYXA 4N1XA 2ZM0A 5AV9D 4R3JA 4K0XA 1ESIA 5L2FA 3O62A 1GA0A 3IXHA 4LCLA 4GHAA 2EX6A 4RX3A 2W8SA 3B6FD 2V0UA 1FR1A 4Z5TA 5F1FA 1WE4A 4Z2IA 4Q0JA 3W98D 3G30A 3BQ8A 4M6BA 3X1VB 3VSKA 1STZA 5DJUA 1D1JA 4K0WA 3S7QA 4BBVA 3X1UB 5GT0B 3FC7A 1YLPA 3LY3A 4E04A 4NKPA 2H10A 4R8PC 5BNVA 2ZQAA 3WD2A 1KX5B 1K57C 1MKIA 3PBOA 3LELC 4G92B 1EI5A 5J7EA 4EESA 3NDEA 3TG9A 2GJ3A 4Y0TA 5CPIA 3B6GA 3S1YA 5EFWA 4EUZA 5B40B 5GT3B 2ZMVA 2IWCA 2ACGA 5KSCA 4I38A 3KS8A 4JF6A 2L5AA 3SH9A 1RP5A 1SHVA 3ITAA 1H5XA 3T4SA 1NZUA 3NIAA 2BTFP 4Z9QA 1KX3D 4JGQA 4JF4A 4O7DA 3W99B 4GDBA 1S6RA 2DQNC 3REIA 4KG2A 4NZ1A 5FUGB 3X1UC 5GT0C 1M18B 1OGBA 1VETB 4AWLB 1XJ6A 3HUNA 3KYEA 3C1BD 4BJPA 1TS8A 5FL3A 5TFQA 5B2IA 3AGEA 1P3KA 4PHTA 5F6AA 3AV2A 2Z6CA 5AV6B 4CLCE 4WZ5A 3GRJA 1KX5C 1NYMA 4E3OA 3DTIA 3N7WA 3S7NA 1EROA 1S66L 4C75A 4G92C 2J9PA 3ZQ5A 1OPXA 3AYWB 4QJGA 4H9QB 4XXRA 3AZFD 4KHAB 1W8YA 1M19A 2ZY5A 1D06A 5B40C 5GT3C 1P3OD 1WYCA 1ZLAD 2JKTI 4IBKA 2MJ6A 5HDSA 1MWSA 2L4RA 1C3BA 3LR3A 5B1LD 1LL5A 5B31G 2ZM8A 3BY9A 5AVCB 5HFOA 4C3QA 1EW0A 4J8XC 3CG5A 3W99C 3OZHA 4BD1A 4C6YA 2VGLM 4UUZB 1IOUA 2K31A 3N4IA 4CSRA 5B0ZC 5CHUA 4S2MA 4NE3A 4WUJA 3E4PA 4IEDA 3MGPA 5DF7A 3AZIB 3SW1A 1ODVA 1DP6A 1G5UA 4J8VA 5EVEA 4H9OB 1T1CA 3X1SD 2QJ5A 5F83A 1PZOA 3ULFA 4Q8IA 1ES3A 3Q07A 4DE3A 3AV1C 2RL3A 2V1BA 3B0CT 4Y3IA 5BNXA 2R78A 4MDZA 2JN7A 4GCZA 4YM6D 1HZOA 2W1TA 5FQQA 2VLGA 1TDGA 5B33B 1XFNA 2WAEA 2L1MA 3FKEA 3REJB 3MGSB 3UN7A 2IWBA 5AVCC 3MVDD 4X25A 5FI2A 4H9RB 3AN2D 3ZHHA 3H0RC 1E6NA 1E6ZA 4EEPA 2XD1A 4LG2A 4DDSA 4KGCD 3LJAC 2C6WB 1EWZA 5LBRA 2F8NB 1MWRA 5HWTA 2ZOHA 3KYZA 4MB4A 4ZDXA 1YLWA 3AZJD 3LI9A 1F1EA 5JA4A 4JLFA 4QWOA 4ZRRA 2FFFB 2XA7M 2ZOIA 3AFAD 1K4EA 3CPTA 1MC0A 3EPHA 3LR4A 4HMEA 3L2AA 4GHLA 4H9PB 2BYMB 3LI8A 3NY4A 4R8PA 3LUQA 4LD9D 5E5AB 3HVFA 1K57A 3S4XA 3KUYB 1YU3A 2UWXA 2WGVA 3DAVA 5GHXA 3UTAD 5B33C 3UDXA 3A6NA 5E2FA 3WS2A 1E25A 1K25A 2HJ9C 2ZY4A 3REJC 5KSHA 3R45B 4JGRA 2Z2MB 3FPVA 2X02A 2G2WA 1N9BA 4U3TA 4N92A 3T4JA 3TRCA 4E3IA 4NZ3A 4NZ4A 2EA9A 5M18A 3REHA 1P97A 3X1UA 5GT0A 4MLLA 4OLDA 2BG1A 3P5JB 4OH0A 5FQKA 1YT4A 2ZC3B 4Z2JA 4HOIA 2RVQD 1CI9A 4NY2A 1N1JA 3WX7A 3UTBD 3D3OA 5E5AC 5B0YA 5AV9C 3KUYC 4KQDA 1PFLA 2JKGA 3OC2A 2KLIA 4OVDA 1P3BB 4E3LA 4M3KA 4WZSB 1BLCA 4YOFA 4KUDD 3M6HA 3TOIA 1OT9A 5JRGA 3EPJA 3LO7A 4J8WB 3BLMA 5DNMA 3PAGA 3ZVWA 3GVBA 1LI0A 1MKMA 4IBJA 1IELA 1Y4OA 4J8XA 3UPPA 3W99A 1G6AA 4N9KA 3TU4D 4ARZB 5FUGA 3DTMA 5B0ZA 1VETA 3M2KA 5A92A 5L09A 2ZBBA 2P04A 1TZYA 1TDLA 5J4EA 1K54C 1J7MA 3L7HA 1ONGA 1FCMA 3AV1A 3IH9A 2PD7A 2Y91A 1G28A 3BECA 3MF0A 3IX8A 3REKB 2V2FF 5DTKA 4AFIA 1KX3C 5HPFA 1F2KA 4QY5A 2A24B 4WYYA 5HDDA 4H9SC 1HQ3D 4J8WC 1P3AD 3WAAB 5AVCA 3UB9A 4R38A 2V5OA 3KXBD 3LZ0D 5TBMB 3BFGA 3C1BC 3IX3A 5CTNA 3EWKA 4UUZA 3P7NA 3FKWA 3W4QA 1FCOA 2WKHA 1K6SA 3LJAA 3G35A 4PM5A 1O07A 1XP4A 4JJND 2H28A 5F82A 2BYKA 4Z66D 4ZAMA 1HTAA 4MBFA 3K3CA 5FSRA 4OQHA 2CV5D 4H9OA 3A3DA 3RFBA 3VOZA 5M1AA 2Y2OA 3H82B 3FDDA 3BFFA 1KX4B 1ZLAC 2Q0OA 2VQRA 1XJ2A 1XJ3A 3UDIA 3IWQA 3LY4A 3REKC 2HP9A 2J8YA 1L2SA 2PDRA 3GV9A 5B32B 3NCKA 5HD3A 5AVBD 3WA9B 5DNNB 4FH2A 4R70A 3NQUB 4EW7A 3VV4A 3REJA 1ZG4A 4H9RA 5A91A 4MCWA 4ID4A 4DXCA 5JYOA 3HONA 3ZG9B 4B4ZA 3KWQD 3JYIA 5GXQB 5D3OA 2F8NA 2JSSA 4S2JA 2EFXA 2Y2MA 4OPYA 2Q9MA 5B1MB 1S4SA 1AOIA 3O62B 3LIBA 4A5RA 3WKJD 5E2HA 1YU0A 2DNSA 3LR5A 5F99B 5DFXA 3L26A 4YM6C 4DE2A 1KX4C 4Z5TB 4FH4A 4H9PA 2XF3A 4QNLA 3E98A 3UNWA 4HI4A 2HJEA 1P3MB 4EBLA 5E5AA 5B32C 2KOIA 5AV9A 3KUYA 1ZHHB 3MFXA 3AN2C 2GDNA 4I3JA 4I3AA 1P3IB 4QLCD 4Y0OA 3E2KA 4KGCC 3R45A 1ZKJA 4MN6A 3B6FA 4XUJB 3IS2B 4WU9D 2GZAA 3BY8A 3V50A 4YNRA 1YU4A 3P01A 3PXPA 3TW8A 1GSXA 1GCEA 4K91A 3OPRA 5AV5B 5FAOA 5GXQC 5CPIB 3B6GB 3VP4A 1SZVA 2EWVA 1PWCA 3PBSA 2QZ6A 5B1MC 4CLCB 4Z2GA 4ZBJB 4P6BA 1L0EA 5F99C 3G34A 5HL6A 1ZC2A 1UR8A 4HQAA 2M7UA 2V0WA 3P98A 1T1AA 1K54A 3V5MA 3REIB 3WD0A 1P3MC 4O8GA 2AVXA 4E3NA 2FJ7D 2WK0A 4BL3A 4Y17A 3AZNB 2O9AA 4ZBEA 1P3IC 5EM1A 2LY8A 2VA0A 2CWEA 4EO5B 5FDSA 3H9WA 4X1MA 1P3KB 4XUJC 1K56A 1TVFA 5DKLA 3AV2B 5C5KA 1KX3A 5AVFA 1CK7A 3A3JA 4IHQA 5HDCA 4H9SA 4J8WA 1CEFA 4NZ5A 2XLNA 2ZL1B 5AV5C 1M19B 1DJAA 1TAFB 2HIOD 4HJ3A 4OP8A 4QU3A 2E8JA 4PM6A 1UR9A 3C1BA 3IH8A 4CLCC 3NECA 1G68A 2G5IC 4ZBJC 3O86A 1GHMA 2RVQC 3H0MC 5AQ7A 5IT5A 2INWA 4NEED 3UTBC 4UQIS 1BH8A 1KVLA 1XKZA 4WN5A 1VEUB 2VGKA 3ZNYA 4IBDA 2X71A 5KMWA 3LEZA 1Q2QA 1GHIA 1OGGA 4HHDA 1ZLAA 3AZNC 4GB7A 4E45A 4FSFA 3MGPB 4NYUA 2PYRA 4EBNA 1PIOA 3REKA 1P3AB 4H8RA 1YM1A 3AV2C 1KE4A 3VFFA 4H9NA 1H0MA 1M1AD 4HBUA 3C7VA 3TU4C 3ZG0A 4XUXA 4B4XA 1Z09A 1M19C 2ZC6B 1MWTA 1W7FA 1UWNX 1RGYA 3O3VA 3IHAA 3N8SA 4RVAA 3HLBA 5TBMA 4WF0A 5A93A 3A3IA 1E6PA 3HLEA 3WTPD 5I94A 4KZ9A 3AZKD 3L28A 2NZDB 2HDRA 1L0FA 1ZG6A 4L0LA 4QPRA 4Z2KA 2EXBA 5GHYA 2NQBD 3QP8A 1F66D 4YM6A 3H82A 3R4KA 1KX4A 4GD6A 4KZBA 4R3AA 1P3FB 2VGLS 2AROB 3MGPC 5JA4B 2GNXA 5FDHA 3U4LP 1HQ3C 3ZYTA 1P3AC 5B32A 2OLUA 3L27A 1H8PA 3ZVTA 3AN2A 1S32D 2P9VB 4KUKA 3KXBC 4GDNA 4BBUA 4KGCA 3B0BA 3GR2A 2ZY2A 4R8PB 1JTGA 2WGIA 5AV8B 3KO6A 4NXBA 5B31B 3MNND 3MGQD 4YWZA 1YSPA 1NWZA 3HSHA 3A6NB 2ZQ9A 3NDGA 4Y0UA 4Z2LA 4Q0IA 5AQAA 4BENA 4S2PA 1P3PB 2CC1A 5GXQA 4Z2HA 3F1PB 2G7UA 3QNBA 5B1MA 3UB8A 2NZDC 4JGOA 4IJEA 5F99A 2O99A 4RX2A 1WWSA 5AY8B 1PWDA 1XA1A 3C1CD 4LD9A 4YFMA 1LSXA 4TX8A 3G2ZA 3UTAA 5AVBC 1P3FC 4F94A 2AROC 3REHB 3NC8A 3AZGD 3UDFA 4WV4B 1PZPA 3CWFA 4QLCB 2D02A 3AZLB 4M4XA 4WU8D 1P3MA 5FEGA 3W97D 3G31A 3MQOA 1H3QA 4P6ZM 5EOEA 4OPQA 4QHCA 3NQJA 2PYOD 1O6IA 4EXOA 3AZEB 1P3IA 4IBGA 4J8UD 2IOUA 3B0DB 4XUJA 1T3UA 5AV8C 1N1JB 3AZHB 5B31C 3IS2A 2WZZA 5B0YB 4Y15A 1MY8A 3A6NC 3T1XA 5DTTA 3HREA 5AV5A 1P3PC 1K4FA 2PD8A 3LZ1B 1EAKA 3MQLA 3WD3A 5F68A 1BTLA 3EEHA 4IBXA 4HY8A 2CMNA 3LIAA 4CLCA 4IBFA 5JRGB 5AY8C 2ZC5B 1H8ZA 4PKYG 4WMCA 5DNMB 3UTBA 1XPBA 4GZBA 5EE8A 3ZG5A 4GJ4A 3QP6A 4DKIA 4J8XB 1H3OA 3REHC 3PBRA 3VE3A 5TJJA 2ZQ8A 4QLCC 3AZLC 2QMIA 5FEFA 5B0ZB 4Y7PA
chains in the Genus database with same CATH topology
3N8LA 4XZQD 3AZNA 1KE3A 3AZEC 1TZYB 1JVJA 5B24D 3UT9D 3L25A 3B0DC 3AZHC 5G18A 4OPZA 2F2AC 5B0YC 3HUMA 3MZFA 3AV1B 1U35D 5HARA 3TU4A 2XK1A 3MXSA 1TAFA 3LZ1C 4YS3B 2QPNA 2H5SA 1P34D 5EVLA 4IBRA 1FSYA 1NRFA 3BLSA 4X53A 2ZLYA 5JRGC 3EQUA 1E3UD 3IQAA 5DNMC 1WWIA 5B2JB 2Y2JA 1YLZA 3PTEA 3LJAB 4RA7A 3G32A 1YU1A 3AZMB 1ID3D 3KS4A 2BYKB 1TZYC 3V39A 3W96D 1HQ3A 1ESUA 2G5HC 1P3AA 2F8NH 1YU2A 3N8RA 3N3FA 3BFCA 2OLVA 5GSUD 1B6WA 3KXBA 3NBLA 1W8QA 1CI8A 3DWZA 1HTZA 4YS3C 4JJNA 4OP5A 4OPRA 3MGRB 1P3GD 3WS4A 4GH9A 3ISGA 4R4RA 2CV5A 4IBEA 4CPKA 3Q7VA 5B2JC 2NZDA 4JXGA 4JXWA 5FQJA 5FQIA 3AZMC 5CGWA 5AVBA 1P3FA 4S2OA 2AROA 1M1AC 3FKVA 5CTMA 1AOIB 1P3LD 3A3FA 4P87A 1KGEA 4EWFA 5DF8A 2BLSA 4NE6A 2P9VA 5AV8A 3X1TB 3IWOA 5B31A 1NXYA 2HDSA 5AV9B 5C3IB 1DJBA 3AGDA 3OCLA 3MGRC 1P3PA 5EVID 3B6FB 4ZJ3A 2XD5A 4YINA 3W98B 2E8IA 5AY8A 3VP1A 4E3MA 2XGNA 2WADA 3WRZA 4DQYB 4OJOA 4GD8A 4JKTA 1AOIC 4QLCA 3AZLA 3D4FA 5KDMA 4KZ4A 3AZEA 3VSLA 2IO5C 3GTCA 3AZHA 3X1TC 3EG5B 2P74A 5C3IC 3QNCA 5HAPA 5CERA 3LZ1A 3B6FC 3W4PA 3C1CC 1KX3B 3W98C 1H8YA 3AZGC 1SDNA 5TGFA 1WYBA 4E6WA 5IHVA 3BEBA 3C1BB 3SS4A 1VM1A 5G49B 1IEMA 1BH8B 5CPKD 3IT9A 5B2ID 3AZFB 4ZUXD 2Y2LA 4PPRA 2HIOA 1EQZD 1P3OB 1ZLAB 3VOYA 4HGAB 1NYYA 1KDWA 1MWUA 2A49A 5B1LB 2Y2HA 3V3RA 1A7WA 4YS3A 4OJPA 4H9NB 4DE0A 3FV7A 2Y2GA 5E2EA 2J7VA 4LV2A 4FCFA 5B2JA 4IBIA 4G91C 4UA9A 1PYYA 3IXGA 5B24C 4EBPA 3RJUA 4IBBA 3X1SB 3AZMA 4KQQA 5E2GA 1M1AA 5GSUB 4BL2A 2XDMA 3SS3A 3SH8A 1ERQA 3AZFC 4YM6B 1P3OC 2G2UA 4HGAC 1P34C 5B1LC 3WTPA 3SOIA 3OPHA 5CPJD 3RELD 3MVDB 3AN2B 3V9RA 3MGRA 3IWIA 2VGJA 4EV4A 5CECA 5GL9A 4KGCB 4IBCA 3VFHA 1I5QA 3QHYA 1BLSA 2XQZA 5GLDA 2EXAA 1ID3C 3AZJB 4DXBA 1XGIA 2HDUA 3VH6W 3X1SC 2Y4AA 3AFAB 4DRTA 1S32A 1FR6A 4R23A 5GSUC 3WTPE 4EQIA 1SKFA 1BLHA 1BFMA 4JF5A 4KG6A 3C4PA 3MNNA 3MGQA 4JBFA 4S2LA 4LD9B 2ZY3A 3W8KA 3UTAB 3EPKA 3RXXA 4MEZA 3X1TA 4WM9A 3O87A 4JXSA 3MVDC 2ZC7A 3LELD 3NQJB 4MNRA 5FI7A 1KE0A 3IF5A 2XR0A 4OJ5A 3CJMA 2FFYA 3C1CA 4KQOA 3SH7A 2X01A 3MXRA 5FA7A 3W98A 4Z2MH 3AZJC 3AZGA 4BD0A 3AFAC 3X1VD 2PYOA 3X1UD 5GT0D 1DY6A 2WUQA 1Z6FA 5EECA 1ES4A 2PU4A 5AQ9A 2R9XA 3UTBB 2Y2PA 4LD9C 3MFDA 3CMZA 3UTAC 3WRTA 1H3OB 4UAAA 4QY6A 4GN2A 4GNUA 1KX5D 4KUDB 5CXWA 1JWVA 3C5AA 5B40D 5GT3D 4U0TA 5FQ9A 1IYQA 1JWZA 3MBZA 4KQRA 4E3KA 3HUOA 1BH9A 1TEMA 2Y59A 1L0GA 3TU4B 2Y2NA 1JTDA 4KZ6A 1OMEA 4X6TA 3W99D 2Q9NA 5BS7C 5B24A 3UT9A 1M18D 1BLPA 5G49A 4CAYB 1ALQA 3C7UA 1FSWA 2XFSA 2HP5A 1U35A 5AQBA 3HLCA 3O88A 3AZFA 5AV6D 3VH5W 5HAIA 1P3OA 2V1ZA 4IVKA 4KUDC 4N9LA 1P34A 3AYWD 5B1LA 1BULA 2JBFA 2DCFA 1HQ3B 1PW1A 5GLAA 2YFWB 4E3JA 1E3UA 2OSUA 1ERMA 3KXBB 2H0TA 3LZ0B 4DRBA 3EQVA 5AVCD 4GOGA 4JJNB 1ID3A 3RXWA 3HBRA 4Z66B 3OPPA 5CPKC 4KENB 3W96A 2CV5B 1RCJA 3X1SA 3BYDA 4KZAA 2HDQA 4NFTA 5GSUA 3AZID 3Q7VB 3PAEA 4LENA 4UA6A 5AVBB 5CHLB 2J8PA 5FAQA 3UPNA 3MVDA 5B33D 1M40A 4B88A 2WKEA 3LZ0C 3MGSD 2Y55A 3KWQB 3ITBA 4JJNC 4OQ0A 1NY0A 4X23D 3EPLA 4Z66C 3AZJA 2A3UA 3WKJB 2CV5C 3M2JA 2EX8A 3AFAA 1ULYA 1O7EA 4BLMA 3HLGA 1Q9CA 5CPJC 2Y2KA 3RELC 2OV5A 5CP6D 1SCWA 2I72A 3GSGA 5CHJA 3P09A 5E5AD 3KUYD 4WEKA 5KDMB 4WU9B 3ZG8B 1W2EA 3KFUG 3SS5A 3KWQC 4PM9A 3HL9A 3WKJC 1I2SA 4OOLA 2WZXA 5BS7A 1N4OA 3S22A 2ZJ9A 4WJ3C 2XEPA 4FD8A 3WS5A 2FJ7B 5KZHA 2WGWB 4E6XA 1BSGA 1Y54A 2ZM5A 4OQGA 4KUDA 5DVAA 1P3BD 2XFTA 4WU9C 1JFIA 3Q7ZA 1JWPA 4GKUA 5M19A 5HAQA 1K56D 2HIOB 1MBLA 3X1VC 1K6RA 4XUZA 4J8WD 4HESA 2EFUA 3MKFA 3UY6A 4WNNA 4S2KA 3UE0A 1IYOA 5CPKA 3BFEA 5F1GA 4CAYA 3IP4C 4ZUXA 1IKGA 1EQZA 2FJ7C 2B5RA 4WEJA 2PBYA 3UPOA 1K38A 1QMFA 4OJ6A 5JYPA 2H0YA 1M1AB 3REKD 3OCNA 4QD4A 2YFWA 4WELA 3A1IA 3B0CW 4WBGA 4JXVA 2HIOC 1U60A 3FYZA 1K55A 3LZ0A 4NYYA 3WAAD 1M18C 3WTPB 4AWLC 1YUEA 5FAPA 3G2YA 4Z66A 3AZKB 3V9RB 1NJ4A 3DW0A 2NQBB 5AV6C 1F66B 2Z2LB 3M6BA 4N1HA 3PBNA 4OJLA 2C5WB 3AYWC 1FOFA 1KX4D 5CPJA 3RELA 3PBQA 4R4SA 5EUAA 1S32B 3OPLA 1LLBA 3MZDA 5B32D 3BRMA 3WA9D 5DNND 3MNNB 3MGQB 1FQGA 1VQQA 4X23B 2IO5B 2YFVB 3KWQA 3HLWA 3WTPC 4OONA 2JE5A 4KZ5A 3Q1FA 5DF9A 1LL9A 3V3SA 3AZKC 3AZIC 4PM7A 1PWGA 5GXQD 3WKJA 2NQBC 3MZEA 1F66C 3C1CB 5B1MD 3O62D 4S2NC 5CP6B 1IKIA 2DRWA 5F99D 3AZGB 5U47A 4WU8B 4Z5TD 3VP3A 3W97B 3GQZA 5GHZA 3LELA 1S32C 1PW8A 2PYOB 4J8UB 1P3MD 3UE1A 3MGSC 1RGZA 3MNNC 3MGQC 4WU9A 1P3ID 2JC7A 4X23C 4XUJD 1CEGA 4LCMA 4DE1A 3X1VA 4LV3A 5AV5D 1HD8A 5CPID 3B6GD 3GMWA 1XGJA 1BH9B 5CP6C 1FCNA 4E44A 4U0XA 4DRAA 3FZCA 4WMCD 4WU8C 1KX5A 1XA7A 2FJ7A 3W97C 3IF6B 4XZQB 2WGWA 1YMXA 4G91B 3REID 2PYOC 1GA9A 4J8UC 5B24B 3UT9B 5CHMA 5B40A 5GT3A 2PU2A 1KU5A 3AZND 3I7JA 4NK3A 3UE3A 1XXMA 1U35B 4MBHA 1P3KD 1YLJA 3AV2D 2V20A 3UO9A 3AGFA 4IJFA 1MXOA 1P34B 4P0MA 4P85A 4ZTKA 1M18A 1M19D 4OUIA 5EOOA 2XH9A 1YLYA 2DF4C 1MPLA 2ZQCA 3HLDA 2F8NG 4KZ3A 5BT1D 5AV6A 3ZG7B 3IF6C 4XZQC 3VH6A 1Q2PA 1P3BC 1ID3B 3AYWA 4H9QA 3UT9C 4KHAA 3W96B 2ZMAA 1J9MA 1KVMA 2RIQA 3MGPD 4OQIA 1U35C 4J8VD 3VP2A 5TR7A 5DTSA 5FI6A 3KSYA 3MKEA 5CGXA 2IWDA 1P3GB 3PBTA 1IYPA 5CEBA 3IXBA 3AZKA 5BO0B 3AZIA 4X55A 1IYSA 2NQBA 1F66A 3WS1A 4S2NA 1M6KA 2NZDD 1ES2A 3Q82A 3WWXA 5E43A 5FATA 3W96C 1P3LB 2ZM2A 2J9OA 5B33A 1P3FD 5HX9A 2AROD 4ZJ2A 1ES5A 3FWLA 3VMAA 3MGSA 3WAAC 2EX2A 1CK3A 4X69A 1I2WA 4PMAA 3TSGA 2EX9A 3DWKA 4X23A 4KZ8A 2YFVA 1P3GC 5J8XA 4R8PD 5AV8D 5B31D 5EVIB 4OOYA 1R4VA 3A6ND 2ZC4B 2HPBA 3VH6T 1P3PD 3ZCZA 4BQMA 1PI5A 1KGGA 3IXDA 5GLBA 5CP6A 1BT5A 2BYMA 5AY8D 4DF6A 1YMSA 1P3LC 4WU8A 3Q81A 3W97A 2Y2QA 3WA9C 5BOHA 2JCHA 5DNNC 3REHD 2ZD8A 4J8UA 3AZLD 4OKPA 1S0WA 3N6IA 1XX2A 5BNVB 3VH5A 3AZED 5FQMA 3IHBA 3G4PA 3AZHD 5EVIC 1PZRA 5B0YD 1NZOA 3BFDA 1GHPA 4UPKA 3O62C 3VP0A 5A90A 1JFIB 3LZ1D 3ZGAB 3HLFA 1YLTA 4D2OA 4Z5TC 3B3XA 3W4OA 1W79A 4R1GA 5JRGD 4DDYA 2RCXA 3H0LC 5DNMD 4WNNB 3IF6A 4XZQA 4J8XD 1P3BA 3ZDJA 3BM6A 5CPKB 5B2IB 5B0ZD 1Z2CB 4ZUXB 1TZYD 1EQZB 1ONHA 4NE5A 3CZDA 5B32G 2ZQDA 4KZ7A 5CPIC 3B6GC 4QB8A 4CJNA 1SDEA 1KDSA 3AV1D 3WS0A 3E2LA 4YS3D 2F8NK 1AXBA 5HL1A 1E4DA 1YQSA 4LV1A 3C4OA 3REIC 4X68A 4WZ4A 4UHUA 4OOMA 1LI9A 4CSRB 5BPVA 4UA7A 1W5DA 3AL0C 5B2JD 4JPMA 4KG5A 3VH5T 3L29A 4EO5C 5B2IC 3LJAD 2HUEB 4J8VB 1P3KC 3AZMD 1B67A 2WKIA 4ZUXC 4WZ5C 1EQZC 5EPHA 2ZQ7A 2Y2IA 5CEDA 5BNXB 3WAAA 2WAFA 3NI9A 4MBKA 5HW3A 5CPJB 3RELB 3F6TA 3LCEA 1P3GA 4PM8A 2HP6A 4ZJ1A 3ZFZA 4X56A 5BT1C 4OLGA 5BO0A 3MGRD 1QMEA 1L0DA 4RYEA 5CGSA 1K55C 3REJD 4IVIA 1BUEA 4NETA 3ZNTA 5CRFA 5GLCA 2R9WA 1P3LA 2HUEC 4J8VC 2F8ND 2WYXA 1LHYA 4S2IA 3WA9A 5DNNA 3NQUA 1AOID 4HBTA 5FASA 1KGFA 3A1KA 4R3BA 4HEFA 1PI4A 4R0QA 4Z2MG 3LELB 3A3EA 1HVBA 4LV0A 1BZAA 1DJCA 3X1TD 5EVIA 4N1XA 2ZM0A 5AV9D 4R3JA 4K0XA 1ESIA 5L2FA 3O62A 1GA0A 3IXHA 4LCLA 4GHAA 2EX6A 4RX3A 2W8SA 3B6FD 1FR1A 4Z5TA 5F1FA 1WE4A 3W98D 3G30A 4M6BA 3X1VB 3VSKA 4K0WA 3X1UB 5GT0B 1YLPA 3LY3A 2H10A 4R8PC 5BNVA 2ZQAA 1KX5B 1K57C 1MKIA 3PBOA 3LELC 4G92B 1EI5A 3NDEA 3TG9A 4Y0TA 5CPIA 3B6GA 3S1YA 4EUZA 5B40B 5GT3B 2IWCA 5KSCA 3KS8A 4JF6A 2L5AA 3SH9A 1RP5A 1SHVA 3ITAA 1H5XA 1NZUA 3NIAA 4Z9QA 1KX3D 4JF4A 4O7DA 3W99B 4GDBA 1S6RA 2DQNC 3REIA 4KG2A 4NZ1A 5FUGB 3X1UC 5GT0C 1M18B 4AWLB 3HUNA 3C1BD 4BJPA 5TFQA 5B2IA 3AGEA 1P3KA 3AV2A 5AV6B 4WZ5A 3GRJA 1KX5C 1NYMA 4E3OA 3N7WA 1EROA 4C75A 4G92C 2J9PA 3AYWB 4QJGA 4H9QB 4XXRA 3AZFD 4KHAB 1M19A 1W8YA 2ZY5A 5B40C 5GT3C 1P3OD 1WYCA 1ZLAD 4IBKA 1MWSA 1C3BA 5B1LD 1LL5A 5B31G 2ZM8A 5AVCB 5HFOA 4C3QA 4J8XC 3CG5A 3W99C 3OZHA 4BD1A 4C6YA 4UUZB 3N4IA 4CSRA 5B0ZC 5CHUA 4S2MA 4NE3A 4IEDA 3MGPA 5DF7A 3AZIB 4J8VA 4H9OB 3X1SD 5F83A 1PZOA 4Q8IA 1ES3A 3Q07A 4DE3A 3AV1C 2RL3A 3B0CT 5BNXA 4YM6D 1HZOA 5FQQA 1TDGA 5B33B 2WAEA 3FKEA 3REJB 3MGSB 3UN7A 2IWBA 5AVCC 3MVDD 5FI2A 4H9RB 3AN2D 3ZHHA 3H0RC 2XD1A 4LG2A 4DDSA 4KGCD 3LJAC 2C6WB 1EWZA 2F8NB 1MWRA 4ZDXA 1YLWA 3AZJD 1F1EA 5JA4A 4JLFA 2FFFB 3AFAD 1K4EA 3EPHA 3L2AA 4GHLA 4H9PB 2BYMB 3NY4A 4R8PA 4LD9D 5E5AB 3HVFA 1K57A 3S4XA 3KUYB 1YU3A 2UWXA 2WGVA 5GHXA 3UDXA 3UTAD 5B33C 3A6NA 5E2FA 3WS2A 1E25A 1K25A 2ZY4A 3REJC 5KSHA 3R45B 2Z2MB 2X02A 2G2WA 1N9BA 4U3TA 4N92A 4E3IA 4NZ3A 4NZ4A 5M18A 3REHA 3X1UA 5GT0A 4MLLA 4OLDA 2BG1A 3P5JB 4OH0A 5FQKA 1YT4A 2ZC3B 2RVQD 1CI9A 4NY2A 1N1JA 3WX7A 3UTBD 5E5AC 5B0YA 5AV9C 3KUYC 3OC2A 4OVDA 1P3BB 4E3LA 4M3KA 4WZSB 1BLCA 4KUDD 3M6HA 3TOIA 5JRGA 3EPJA 3LO7A 4J8WB 3BLMA 5DNMA 3PAGA 3ZVWA 3GVBA 1LI0A 4IBJA 1IELA 4J8XA 3UPPA 3W99A 1G6AA 4N9KA 3TU4D 5FUGA 3DTMA 5B0ZA 3M2KA 5A92A 1TZYA 1TDLA 1K54C 1ONGA 1FCMA 3AV1A 3IH9A 2Y91A 3BECA 3REKB 2V2FF 5DTKA 1KX3C 4QY5A 4WYYA 4H9SC 1HQ3D 4J8WC 1P3AD 3WAAB 5AVCA 3KXBD 3LZ0D 3BFGA 3C1BC 5CTNA 4UUZA 3FKWA 3W4QA 1FCOA 2WKHA 1K6SA 3LJAA 3G35A 4PM5A 1O07A 1XP4A 4JJND 5F82A 2BYKA 4Z66D 4ZAMA 1HTAA 4MBFA 5FSRA 4OQHA 2CV5D 4H9OA 3A3DA 3VOZA 5M1AA 2Y2OA 3FDDA 3BFFA 1KX4B 1ZLAC 2VQRA 3UDIA 3IWQA 3LY4A 3REKC 2HP9A 2J8YA 1L2SA 3GV9A 5B32B 3NCKA 5AVBD 3WA9B 5DNNB 4FH2A 3NQUB 3REJA 1ZG4A 4H9RA 5A91A 4ID4A 4DXCA 5JYOA 3HONA 3ZG9B 4B4ZA 3KWQD 3JYIA 5GXQB 5D3OA 2F8NA 2JSSA 4S2JA 2EFXA 2Y2MA 4OPYA 2Q9MA 5B1MB 4A5RA 1AOIA 3O62B 3WKJD 5E2HA 1YU0A 2DNSA 5F99B 3L26A 4YM6C 4DE2A 1KX4C 4Z5TB 4FH4A 4H9PA 2XF3A 4QNLA 3UNWA 1P3MB 4EBLA 5E5AA 5B32C 5AV9A 3KUYA 3AN2C 2GDNA 1P3IB 4QLCD 4Y0OA 3E2KA 4KGCC 3R45A 1ZKJA 3B6FA 4XUJB 4WU9D 3V50A 1YU4A 4K91A 1GCEA 3OPRA 5AV5B 5FAOA 5GXQC 5CPIB 3B6GB 3VP4A 1PWCA 3PBSA 2QZ6A 5B1MC 4ZBJB 4P6BA 1L0EA 5F99C 3G34A 1ZC2A 3P98A 1K54A 3V5MA 3REIB 1P3MC 4E3NA 2FJ7D 2WK0A 4BL3A 3AZNB 4ZBEA 1P3IC 2LY8A 2CWEA 4EO5B 1P3KB 4XUJC 1K56A 1TVFA 3AV2B 1KX3A 3A3JA 4H9SA 4J8WA 1CEFA 4NZ5A 2XLNA 5AV5C 1M19B 1DJAA 1TAFB 2HIOD 4OP8A 4QU3A 4PM6A 3C1BA 3IH8A 1G68A 2G5IC 4ZBJC 3O86A 1GHMA 2RVQC 3H0MC 5AQ7A 3UTBC 1BH8A 1KVLA 1XKZA 2VGKA 3ZNYA 4IBDA 2X71A 5KMWA 3LEZA 1Q2QA 1GHIA 1ZLAA 3AZNC 4GB7A 4E45A 4FSFA 3MGPB 4NYUA 4EBNA 1PIOA 3REKA 1P3AB 4H8RA 1YM1A 3AV2C 1KE4A 3VFFA 4H9NA 1M1AD 4HBUA 3C7VA 3TU4C 3ZG0A 4XUXA 4B4XA 1M19C 2ZC6B 1MWTA 1W7FA 1RGYA 3O3VA 3IHAA 3N8SA 4RVAA 3HLBA 5A93A 3A3IA 3HLEA 3WTPD 5I94A 4KZ9A 3AZKD 3L28A 2NZDB 2HDRA 1L0FA 1ZG6A 4L0LA 2EXBA 5GHYA 2NQBD 1F66D 4YM6A 1KX4A 4GD6A 4KZBA 1P3FB 2AROB 3MGPC 5JA4B 5FDHA 1HQ3C 1P3AC 5B32A 2OLUA 3L27A 3ZVTA 3AN2A 1S32D 2P9VB 3KXBC 4GDNA 4KGCA 3B0BA 3GR2A 2ZY2A 2WGIA 4R8PB 1JTGA 5AV8B 5B31B 3MNND 3MGQD 3HSHA 3A6NB 2ZQ9A 3NDGA 4Y0UA 5AQAA 4BENA 4S2PA 1P3PB 2CC1A 5GXQA 3QNBA 5B1MA 2NZDC 4IJEA 5F99A 4RX2A 1WWSA 5AY8B 1PWDA 1XA1A 3C1CD 4LD9A 4YFMA 3G2ZA 3UTAA 5AVBC 1P3FC 4F94A 2AROC 3REHB 3NC8A 3AZGD 3UDFA 4WV4B 1PZPA 4QLCB 3AZLB 4WU8D 1P3MA 3W97D 3G31A 5EOEA 4OPQA 4QHCA 3NQJA 2PYOD 3AZEB 1P3IA 4IBGA 4J8UD 2IOUA 3B0DB 4XUJA 1T3UA 5AV8C 1N1JB 3AZHB 5B31C 2WZZA 5B0YB 1MY8A 3A6NC 5DTTA 3HREA 5AV5A 1P3PC 1K4FA 3LZ1B 1BTLA 4IBXA 4IBFA 5JRGB 5AY8C 2ZC5B 1H8ZA 4WMCA 5DNMB 3UTBA 1XPBA 4GZBA 5EE8A 3ZG5A 4DKIA 4J8XB 1H3OA 3REHC 3PBRA 2ZQ8A 4QLCC 3AZLC 2QMIA 5B0ZB 4Y7PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J9O A;  3N8L A;  2H0T A;  2G2W A;  1N9B A;  3EQV A;  1KE3 A;  4U3T A;  5HX9 A;  4N92 A;  4ZJ2 A;  1JVJ A;  4GOG A;  1ES5 A;  4E3I A;  3FWL A;  3VMA A;  5M18 A;  2EX2 A;  1CK3 A;  3RXW A;  3HBR A;  4X69 A;  1I2W A;  3OPP A;  4OPZ A;  3HUM A;  4KEN B;  5G18 A;  4MLL A;  3MZF A;  4PMA A;  4OLD A;  2BG1 A;  3TSG A;  2EX9 A;  3DWK A;  1RCJ A;  4KZ8 A;  5HAR A;  4OH0 A;  2XK1 A;  3BYD A;  4KZA A;  5FQK A;  5J8X A;  1YT4 A;  2HDQ A;  3MXS A;  2ZC3 B;  5EVI B;  3Q7V B;  4OOY A;  3PAE A;  1CI9 A;  2QPN A;  2H5S A;  2ZC4 B;  2HPB A;  5EVL A;  4IBR A;  1FSY A;  1NRF A;  3BLS A;  4LEN A;  2ZLY A;  4X53 A;  3EQU A;  4UA6 A;  3ZCZ A;  3OC2 A;  1E3U D;  3IQA A;  4OVD A;  4BQM A;  4E3L A;  1PI5 A;  4M3K A;  1KGG A;  3IXD A;  5GLB A;  5FAQ A;  3UPN A;  1BT5 A;  2Y2J A;  1BLC A;  1YLZ A;  3M6H A;  3TOI A;  4DF6 A;  1YMS A;  3PTE A;  1M40 A;  3Q81 A;  4RA7 A;  2Y2Q A;  2WKE A;  3G32 A;  4B88 A;  3LO7 A;  5BOH A;  2JCH A;  2Y55 A;  3BLM A;  3PAG A;  3ZVW A;  2ZD8 A;  4Y7P A;  3GVB A;  3V39 A;  1LI0 A;  1IEL A;  3ITB A;  4OKP A;  4OQ0 A;  1S0W A;  1ESU A;  3N6I A;  1XX2 A;  3UPP A;  1NY0 A;  1G6A A;  3N8R A;  4N9K A;  2A3U A;  1ERM A;  3BFC A;  2OLV A;  3DTM A;  5FQM A;  3IHB A;  3M2J A;  2EX8 A;  3NBL A;  1W8Q A;  3M2K A;  3G4P A;  5A92 A;  5EVI C;  1CI8 A;  1TDL A;  3DWZ A;  1O7E A;  1NZO A;  1HTZ A;  4BLM A;  4OP5 A;  1K54 C;  3BFD A;  1ONG A;  4OPR A;  1GHP A;  3VP0 A;  3WS4 A;  1FCM A;  3HLG A;  5A90 A;  3ISG A;  2OV5 A;  2Y2K A;  4R4R A;  3IH9 A;  1SCW A;  3ZGA B;  3HLF A;  1YLT A;  2Y91 A;  4D2O A;  2I72 A;  3BEC A;  4CPK A;  3GSG A;  3B3X A;  5CHJ A;  3Q7V A;  2V2F F;  3P09 A;  3W4O A;  1W79 A;  4R1G A;  5DTK A;  4DDY A;  4JXG A;  4JXW A;  4WEK A;  2RCX A;  5FQJ A;  4QY5 A;  3ZG8 B;  5FQI A;  4WYY A;  3IF6 A;  3SS5 A;  5CGW A;  4S2O A;  3ZDJ A;  5CTM A;  3FKV A;  3BM6 A;  3A3F A;  4PM9 A;  3HL9 A;  4P87 A;  1KGE A;  3BFG A;  5CTN A;  4EWF A;  5DF8 A;  3FKW A;  3W4Q A;  1FCO A;  2BLS A;  2WKH A;  2P9V A;  1K6S A;  3G35 A;  4PM5 A;  1ONH A;  1O07 A;  1XP4 A;  1I2S A;  3CZD A;  4OOL A;  5F82 A;  2WZX A;  1N4O A;  2ZQD A;  4KZ7 A;  4ZAM A;  3IWO A;  4QB8 A;  2ZJ9 A;  3S22 A;  1NXY A;  4CJN A;  1SDE A;  2HDS A;  4MBF A;  1KDS A;  5FSR A;  4OQH A;  3WS0 A;  2XEP A;  4FD8 A;  3A3D A;  1DJB A;  3AGD A;  3E2L A;  3OCL A;  5M1A A;  2Y2O A;  3VOZ A;  3WS5 A;  3BFF A;  5EVI D;  5KZH A;  2WGW B;  4E6X A;  1BSG A;  3UDI A;  1AXB A;  1Y54 A;  3IWQ A;  3LY4 A;  5HL1 A;  4ZJ3 A;  3GV9 A;  2HP9 A;  2J8Y A;  1L2S A;  1E4D A;  1YQS A;  4LV1 A;  3NCK A;  2XD5 A;  4YIN A;  3C4O A;  4OQG A;  2E8I A;  3VP1 A;  5DVA A;  4FH2 A;  2XFT A;  4X68 A;  4WZ4 A;  4UHU A;  4OOM A;  1LI9 A;  2WAD A;  2XGN A;  4UA7 A;  4E3M A;  1W5D A;  3WRZ A;  3Q7Z A;  1JWP A;  4GKU A;  4JPM A;  4KG5 A;  5M19 A;  5HAQ A;  1K56 D;  1ZG4 A;  4GD8 A;  4JKT A;  5A91 A;  1MBL A;  3D4F A;  4ID4 A;  1K6R A;  4DXC A;  4XUZ A;  4HES A;  2WKI A;  3ZG9 B;  4KZ4 A;  5JYO A;  2EFU A;  3MKF A;  4WZ5 C;  4B4Z A;  3JYI A;  5D3O A;  3UY6 A;  5EPH A;  2ZQ7 A;  3VSL A;  2Y2I A;  4S2J A;  2EFX A;  2Y2M A;  3GTC A;  5CED A;  4OPY A;  4S2K A;  2WAF A;  2Q9M A;  3NI9 A;  3UE0 A;  4A5R A;  1IYO A;  4MBK A;  3BFE A;  2P74 A;  5HW3 A;  5E2H A;  2DNS A;  5F1G A;  3QNC A;  5HAP A;  3LCE A;  5CER A;  4DE2 A;  1IKG A;  4PM8 A;  4FH4 A;  2B5R A;  2HP6 A;  4ZJ1 A;  2XF3 A;  4WEJ A;  3ZFZ A;  4X56 A;  3UNW A;  3W4P A;  4OLG A;  2PBY A;  4EBL A;  1QME A;  1K38 A;  3UPO A;  1L0D A;  4RYE A;  5CGS A;  1K55 C;  1QMF A;  1H8Y A;  2GDN A;  5JYP A;  4IVI A;  1BUE A;  2H0Y A;  1SDN A;  5TGF A;  1WYB A;  4E6W A;  3OCN A;  4Y0O A;  5IHV A;  3E2K A;  4NET A;  4QD4 A;  3BEB A;  1ZKJ A;  3ZNT A;  4WEL A;  4WBG A;  5CRF A;  5GLC A;  4JXV A;  2R9W A;  3SS4 A;  3V50 A;  1VM1 A;  1IEM A;  1U60 A;  3FYZ A;  1K55 A;  1LHY A;  2WYX A;  4K91 A;  1GCE A;  4S2I A;  3OPR A;  5FAO A;  3VP4 A;  3IT9 A;  4HBT A;  5FAS A;  1PWC A;  5FAP A;  3G2Y A;  3PBS A;  2QZ6 A;  1KGF A;  1NJ4 A;  2Y2L A;  4PPR A;  4R3B A;  4HEF A;  4P6B A;  1PI4 A;  3DW0 A;  3VOY A;  1L0E A;  4R0Q A;  1NYY A;  3G34 A;  3A3E A;  2Z2L B;  1KDW A;  1MWU A;  1HVB A;  2A49 A;  4LV0 A;  1BZA A;  1DJC A;  2Y2H A;  1ZC2 A;  3V3R A;  5EVI A;  3P98 A;  3M6B A;  4N1H A;  4N1X A;  2ZM0 A;  3PBN A;  4R3J A;  1K54 A;  2C5W B;  4K0X A;  3V5M A;  1ESI A;  1FOF A;  5L2F A;  1GA0 A;  4DE0 A;  3FV7 A;  4E3N A;  3IXH A;  2WK0 A;  3PBQ A;  2Y2G A;  4R4S A;  4LCL A;  5E2E A;  5EUA A;  4BL3 A;  2EX6 A;  4RX3 A;  4ZBE A;  3OPL A;  2J7V A;  1FR1 A;  4LV2 A;  5F1F A;  4FCF A;  1LLB A;  1WE4 A;  3MZD A;  3G30 A;  3BRM A;  4UA9 A;  1K56 A;  1TVF A;  1PYY A;  3VSK A;  3IXG A;  1FQG A;  4K0W A;  4EBP A;  3RJU A;  3A3J A;  1VQQ A;  4KQQ A;  5E2G A;  1CEF A;  2XLN A;  3HLW A;  1YLP A;  3LY3 A;  1DJA A;  4BL2 A;  4OON A;  2XDM A;  2JE5 A;  3SS3 A;  4KZ5 A;  3SH8 A;  3Q1F A;  4OP8 A;  4QU3 A;  2H10 A;  5DF9 A;  4PM6 A;  1LL9 A;  3V3S A;  1ERQ A;  3IH8 A;  2ZQA A;  4PM7 A;  1PWG A;  1G68 A;  3O86 A;  1GHM A;  1K57 C;  1MKI A;  3PBO A;  5AQ7 A;  2G2U A;  1EI5 A;  3MZE A;  3NDE A;  3TG9 A;  4Y0T A;  1XKZ A;  1KVL A;  3S1Y A;  4S2N C;  3SOI A;  4EUZ A;  1IKI A;  2VGK A;  2DRW A;  3OPH A;  3ZNY A;  2IWC A;  5KSC A;  2X71 A;  5KMW A;  5U47 A;  4JF6 A;  3LEZ A;  1Q2Q A;  1GHI A;  3IWI A;  1RP5 A;  3SH9 A;  2VGJ A;  3VP3 A;  4EV4 A;  3GQZ A;  5CEC A;  5GL9 A;  5GHZ A;  1SHV A;  3ITA A;  1H5X A;  4GB7 A;  1PW8 A;  1NZU A;  3NIA A;  4FSF A;  1I5Q A;  3VFH A;  4Z9Q A;  4EBN A;  3QHY A;  1PIO A;  1BLS A;  3UE1 A;  2XQZ A;  4JF4 A;  5GLD A;  4O7D A;  2EXA A;  4H8R A;  4GDB A;  1YM1 A;  1S6R A;  1KE4 A;  1RGZ A;  1XGI A;  2HDU A;  4KG2 A;  3VFF A;  4DXB A;  4HBU A;  2JC7 A;  2Y4A A;  3C7V A;  3ZG0 A;  4XUX A;  4DRT A;  1FR6 A;  3HUN A;  4R23 A;  1CEG A;  4B4X A;  4BJP A;  2ZC6 B;  1MWT A;  1W7F A;  1SKF A;  5TFQ A;  4EQI A;  4LCM A;  1RGY A;  1BLH A;  3O3V A;  3IHA A;  4JF5 A;  3AGE A;  3N8S A;  4DE1 A;  4RVA A;  3HLB A;  4KG6 A;  3C4P A;  4LV3 A;  4S2L A;  4JBF A;  4WZ5 A;  1HD8 A;  3A3I A;  3GRJ A;  5A93 A;  1NYM A;  3HLE A;  4E3O A;  3N7W A;  3W8K A;  1ERO A;  4C75 A;  5I94 A;  2J9P A;  3GMW A;  4KZ9 A;  4QJG A;  3RXX A;  4MEZ A;  1XGJ A;  4XXR A;  1W8Y A;  1FCN A;  4WM9 A;  1WYC A;  3O87 A;  2HDR A;  1L0F A;  1ZG6 A;  4JXS A;  4L0L A;  4U0X A;  3FZC A;  2ZC7 A;  2EXB A;  1MWS A;  5GHY A;  1C3B A;  4WMC D;  4GD6 A;  1XA7 A;  4KZB A;  4MNR A;  1LL5 A;  1KE0 A;  3IF6 B;  2ZM8 A;  3IF5 A;  5FI7 A;  2XR0 A;  2WGW A;  1YMX A;  3CJM A;  5HFO A;  4C3Q A;  2FFY A;  1GA9 A;  4KQO A;  5FDH A;  3SH7 A;  5CHM A;  2X01 A;  2PU2 A;  3CG5 A;  2OLU A;  3MXR A;  5FA7 A;  3OZH A;  4BD1 A;  3I7J A;  4NK3 A;  3ZVT A;  4C6Y A;  3UE3 A;  1XXM A;  3N4I A;  2P9V B;  5CHU A;  4BD0 A;  4S2M A;  4GDN A;  4MBH A;  3GR2 A;  1YLJ A;  4IED A;  1JTG A;  2WGI A;  5DF7 A;  2V20 A;  3UO9 A;  3AGF A;  1DY6 A;  2WUQ A;  1Z6F A;  5EEC A;  1ES4 A;  2PU4 A;  2ZQ9 A;  3NDG A;  4Y0U A;  1PZO A;  1MXO A;  5AQ9 A;  5F83 A;  4Q8I A;  2R9X A;  1ES3 A;  4P0M A;  2Y2P A;  3Q07 A;  4P85 A;  5AQA A;  4S2P A;  4ZTK A;  2CC1 A;  4BEN A;  4DE3 A;  2RL3 A;  3MFD A;  3CMZ A;  3WRT A;  5EOO A;  2XH9 A;  3QNB A;  4UAA A;  1YLY A;  1HZO A;  1MPL A;  4GN2 A;  4GNU A;  2ZQC A;  4QY6 A;  5FQQ A;  3HLD A;  1TDG A;  4RX2 A;  2WAE A;  4KZ3 A;  1PWD A;  1XA1 A;  5CXW A;  1JWV A;  3ZG7 B;  4YFM A;  3IF6 C;  3C5A A;  3G2Z A;  4U0T A;  3UN7 A;  1Q2P A;  2IWB A;  5FQ9 A;  4F94 A;  5FI2 A;  1IYQ A;  1JWZ A;  3MBZ A;  3NC8 A;  3UDF A;  4KQR A;  4E3K A;  1PZP A;  3HUO A;  3ZHH A;  2ZMA A;  1TEM A;  2Y59 A;  1J9M A;  1KVM A;  2XD1 A;  4DDS A;  3G31 A;  1L0G A;  5EOE A;  4OPQ A;  4QHC A;  4OQI A;  2Y2N A;  1JTD A;  1EWZ A;  2C6W B;  4KZ6 A;  1MWR A;  1OME A;  4X6T A;  2Q9N A;  3VP2 A;  4ZDX A;  1YLW A;  5TR7 A;  5DTS A;  4JLF A;  2WZZ A;  5FI6 A;  2FFF B;  1BLP A;  1MY8 A;  3MKE A;  3C7U A;  1ALQ A;  1K4E A;  5CGX A;  1FSW A;  2IWD A;  5DTT A;  2XFS A;  3HRE A;  3PBT A;  1K4F A;  2HP5 A;  1IYP A;  5AQB A;  1BTL A;  3HLC A;  4IBX A;  3O88 A;  3NY4 A;  3IXB A;  5CEB A;  5HAI A;  3HVF A;  2V1Z A;  1K57 A;  4IVK A;  5GHX A;  2WGV A;  2UWX A;  3S4X A;  3UDX A;  4X55 A;  1IYS A;  4N9L A;  2ZC5 B;  1H8Z A;  5E2F A;  4WMC A;  3WS2 A;  1E25 A;  1XPB A;  4GZB A;  1BUL A;  3WS1 A;  5EE8 A;  3ZG5 A;  2JBF A;  1K25 A;  2DCF A;  4S2N A;  4DKI A;  1M6K A;  5GLA A;  1PW1 A;  1ES2 A;  3Q82 A;  4E3J A;  5KSH A;  1E3U A;  3WWX A;  3PBR A;  5E43 A;  2Z2M B;  2ZQ8 A;  5FAT A;  2QMI A;  2OSU A;  2ZM2 A;  2X02 A; 
#chains in the Genus database with same CATH topology
 3N8L A;  3BWL A;  4XZQ D;  3AZN A;  1KE3 A;  2D01 A;  3UB5 P;  3AZE C;  1TZY B;  3H7W A;  1JVJ A;  1T18 A;  5B24 D;  3UT9 D;  2V8C A;  3L25 A;  3B0D C;  3AZH C;  5G18 A;  4OPZ A;  2F2A C;  5B0Y C;  3HUM A;  3KX0 X;  3MZF A;  3AV1 B;  1U35 D;  5HAR A;  2VK3 A;  3TU4 A;  2XK1 A;  2ZL1 A;  3MXS A;  1TAF A;  3LZ1 C;  4YS3 B;  2PHY A;  2QPN A;  1WA9 A;  2H5S A;  3EOI A;  1P34 D;  5EVL A;  4IBR A;  1FSY A;  1NRF A;  3BLS A;  4X53 A;  2ZLY A;  4EUV A;  5JRG C;  3EQU A;  1YPR A;  2V9A A;  1E3U D;  3IQA A;  5DNM C;  3VOL A;  1WWI A;  5B2J B;  1PDC A;  1VEU A;  2Y2J A;  1GSW A;  1YLZ A;  2OAP 1;  4BMW A;  3PTE A;  4I5S A;  3LJA B;  2OWH A;  4RA7 A;  3G32 A;  1YU1 A;  3AZM B;  3F1O A;  1ID3 D;  1KOU A;  3KS4 A;  2J3T C;  2BYK B;  1TZY C;  1NRJ A;  3V39 A;  3W96 D;  1HQ3 A;  1ESU A;  1J3W A;  2G5H C;  1P3A A;  2F8N H;  1YU2 A;  3N8R A;  3N3F A;  3BFC A;  1GOI A;  2OLV A;  5GSU D;  2OOL A;  1B6W A;  3KXB A;  3NBL A;  1W8Q A;  3S7O A;  1CI8 A;  3DWZ A;  1HTZ A;  4YS3 C;  4JJN A;  4OP5 A;  2K7S A;  4IUH A;  4OPR A;  3CUE C;  3MGR B;  1P3G D;  3NUL A;  3WS4 A;  1S4R A;  4GH9 A;  3ISG A;  4R4R A;  4BBT A;  2CV5 A;  1FIL A;  4IBE A;  4CPK A;  3Q7V A;  5B2J C;  2NZD A;  4JXG A;  1OJG A;  4JXW A;  2QWS A;  3K2N A;  5FQJ A;  5FQI A;  2BAS A;  3AZM C;  5CGW A;  5AVB A;  4LFU A;  1P3F A;  4S2O A;  3R7W A;  2ARO A;  1M1A C;  3FKV A;  5CTM A;  1AOI B;  1P3L D;  1CXW A;  3A3F A;  4P87 A;  1KGE A;  4EWF A;  1F5M A;  5DF8 A;  4HMD A;  2BLS A;  4NE6 A;  2P9V A;  3F1N A;  3A0S A;  3EGX C;  5AV8 A;  3X1T B;  3IWO A;  5B31 A;  1NXY A;  2HDS A;  5AV9 B;  5J3W A;  3JPU A;  5C3I B;  1DJB A;  3AGD A;  3OCL A;  3MGR C;  2W3E A;  1P3P A;  2JKR M;  5EVI D;  5KIZ A;  1W1T A;  3F1P A;  4Y2F A;  3B6F B;  4ZJ3 A;  2XD5 A;  4YIN A;  3W98 B;  2E8I A;  4II7 A;  5AY8 A;  3VP1 A;  4E3M A;  2XGN A;  2WAD A;  5DFY A;  3WRZ A;  4MMN A;  4DQY B;  4OJO A;  1TS6 A;  4GD8 A;  2DMW A;  4JKT A;  1AOI C;  4QLC A;  3AZL A;  3D4F A;  5L10 A;  5F69 A;  5KDM A;  4KZ4 A;  4DN0 A;  3AZE A;  3EEA A;  3VSL A;  2IO5 C;  3GTC A;  3AZH A;  3X1T C;  3EG5 B;  2P74 A;  4FTX A;  5C3I C;  3LR0 A;  3QNC A;  5HAP A;  5CER A;  3PR6 A;  3LZ1 A;  4X1L A;  3B6F C;  3W4P A;  3C1C C;  3CHW P;  1KX3 B;  3QP5 A;  3W98 C;  3T50 A;  1H8Y A;  3AZG C;  2KDK A;  2J80 A;  1W1P A;  3ICY A;  1SDN A;  5TGF A;  1WYB A;  3V67 A;  4E6W A;  2W1R A;  5IHV A;  3BEB A;  4LGW A;  3C1B B;  4G3W A;  3SS4 A;  1VM1 A;  5G49 B;  1IEM A;  3UMD A;  2V8F A;  4HH3 A;  3KSI A;  2IA2 A;  1BH8 B;  5CPK D;  3IT9 A;  5B2I D;  5CX7 A;  3AZF B;  4MB3 A;  4ZUX D;  2Y2L A;  4PPR A;  2HIO A;  1EQZ D;  1P3O B;  1ZLA B;  3VOY A;  4RQ9 A;  3PHY A;  4HGA B;  1NYY A;  1KDW A;  1MWU A;  2A49 A;  5B1L B;  2Y2H A;  3T1R A;  3V3R A;  1A7W A;  4YS3 A;  4OJP A;  3DTK A;  4EER A;  4H9N B;  3CUE A;  3OBF A;  4DE0 A;  3FV7 A;  2D49 A;  2Y2G A;  5E2E A;  2B02 A;  1X0O A;  2FZ0 A;  2J7V A;  4LV2 A;  4FCF A;  5B2J A;  4IBI A;  4G91 C;  1OTB A;  3QP2 A;  4UA9 A;  1S1Y A;  4ETX A;  1PYY A;  3IXG A;  5B24 C;  4EBP A;  3RJU A;  3B33 A;  4IBB A;  2HF6 A;  3X1S B;  3AZM A;  4KQQ A;  5E2G A;  4Q0H A;  2JKT M;  1M1A A;  5GSU B;  4BL2 A;  2XDM A;  3SS3 A;  3SH8 A;  3SZT A;  2VZW A;  1ERQ A;  3AZF C;  3D72 A;  4YM6 B;  2JKF A;  3UME A;  1AIW A;  1P3O C;  2G2U A;  4HGA C;  4GS9 B;  1P34 C;  4I3I A;  5B1L C;  3WTP A;  3SOI A;  3OPH A;  4EET B;  5CPJ D;  3REL D;  3MVD B;  3AN2 B;  3V9R A;  3MGR A;  1CJF A;  4LRZ E;  3IWI A;  2VGJ A;  2M1C A;  4EV4 A;  5CEC A;  5GL9 A;  3B47 A;  4KGC B;  4IBC A;  3VFH A;  1I5Q A;  3IBR A;  3QHY A;  2P7J A;  1BLS A;  1P9R A;  2W3G A;  2XQZ A;  3BJN A;  2W3D A;  5GLD A;  2EXA A;  1ID3 C;  3AZJ B;  4DXB A;  1XGI A;  2HDU A;  1W1Y A;  3VH6 W;  3X1S C;  2Y4A A;  3AFA B;  4DRT A;  1S32 A;  1FR6 A;  4R23 A;  4D60 A;  5GSU C;  3WTP E;  4EQI A;  1SKF A;  2P08 A;  1BLH A;  1BFM A;  4JF5 A;  4KG6 A;  3C4P A;  3MNN A;  3MGQ A;  4JBF A;  4S2L A;  4ETZ A;  4LD9 B;  2ZY3 A;  3W8K A;  3UTA B;  4I39 A;  3EPK A;  1GPF A;  4MEZ A;  3RXX A;  1LT0 A;  3X1T A;  1S67 L;  4WM9 A;  4G3V A;  3O87 A;  4JXS A;  3MVD C;  2ZC7 A;  3LEL D;  2YKF A;  3NQJ B;  2J3W A;  3GEC A;  4MNR A;  5FI7 A;  1KE0 A;  3IF5 A;  2XR0 A;  4OJ5 A;  3CJM A;  3TE8 A;  2FFY A;  3C1C A;  4KQO A;  3SH7 A;  1YKD A;  2X01 A;  3MXR A;  1UGU A;  3W98 A;  5FA7 A;  4Z2M H;  3AZJ C;  3AZG A;  2YKH A;  3T12 B;  5G4Y A;  5DKK A;  4BD0 A;  3AFA C;  3OLO A;  4XT2 B;  3X1V D;  5EV0 A;  2PYO A;  3X1U D;  5GT0 D;  1DY6 A;  2WUQ A;  1Z6F A;  5EEC A;  1ES4 A;  2PU4 A;  5AQ9 A;  2R9X A;  3UTB B;  2Y2P A;  4LD9 C;  4KUO A;  3MFD A;  3CMZ A;  1P9W A;  3UTA C;  3WRT A;  1H3O B;  4UAA A;  3S7P A;  4HH2 A;  4QY6 A;  4GN2 A;  4GNU A;  1KX5 D;  4KUD B;  2UV0 E;  5CXW A;  1JWV A;  3H7W B;  4IJG A;  5B40 D;  5GT3 D;  3C5A A;  4U0T A;  1A0K A;  5FQ9 A;  1IYQ A;  1JWZ A;  3LEQ A;  3MBZ A;  4KQR A;  4E3K A;  3HUO A;  1BH9 A;  1TEM A;  2Y59 A;  1W1V A;  4PAU A;  3JVU A;  2LB9 A;  1L0G A;  2KX6 A;  3TU4 B;  2Y2N A;  1JTD A;  4HIA A;  4KZ6 A;  1OME A;  4X6T A;  3W99 D;  2Q9N A;  5BS7 C;  5B24 A;  3UT9 A;  1M18 D;  3HJI A;  1BLP A;  5G49 A;  4CAY B;  1ALQ A;  3C7U A;  1FSW A;  2XFS A;  2HP5 A;  1U35 A;  5AQB A;  3HLC A;  1D7E A;  3O88 A;  4LLO B;  3AZF A;  5AV6 D;  1NLZ A;  3VH5 W;  5HAI A;  3T4T A;  1P3O A;  2V1Z A;  1P0Z A;  4IVK A;  4KUD C;  3WD1 A;  3F1O B;  4N9L A;  3NHQ A;  1P34 A;  3AYW D;  2PAV P;  5B1L A;  1BUL A;  1XFQ A;  2JBF A;  2DCF A;  5HZH A;  1HQ3 B;  1GXD A;  1PW1 A;  5GLA A;  2YFW B;  4E3J A;  1E3U A;  3M7P A;  3BW6 A;  2HGV A;  1ERM A;  2OSU A;  3KXB B;  4UEY A;  4MB5 A;  2H0T A;  3LZ0 B;  4DRB A;  3EQV A;  5AVC D;  1V9Y A;  4GOG A;  1L3L A;  4NXF A;  4JJN B;  3MSH A;  1ID3 A;  3RXW A;  3HBR A;  4Z66 B;  3MJQ A;  3OPP A;  3D9Y A;  5CPK C;  4KEN B;  3W96 A;  2CV5 B;  1RCJ A;  3X1S A;  1YAX A;  2O9B A;  3BYD A;  3IBJ A;  4KZA A;  2HDQ A;  1E88 A;  4NFT A;  5GSU A;  3AZI D;  3Q7V B;  3PAE A;  1AWI A;  4LEN A;  1LL8 A;  3GDI A;  4UA6 A;  5AVB B;  4GS9 A;  3R7W B;  1L6J A;  2HZ5 A;  5CHL B;  2J8P A;  5FAQ A;  3UPN A;  1E6R A;  4H6J B;  1LSW A;  4G3K A;  3MVD A;  5B33 D;  1SKO B;  2XRO A;  3KSH A;  1M40 A;  1VB6 A;  3F1N B;  3OOV A;  4B88 A;  2WKE A;  3LZ0 C;  3MGS D;  2Y55 A;  3KWQ B;  5L07 A;  1H0G A;  1TF1 A;  3ITB A;  4JJN C;  4OQ0 A;  3T4Q A;  1NY0 A;  3LID A;  4X23 D;  3EPL A;  2JKR I;  4Z66 C;  3AZJ A;  2A3U A;  3KSG A;  3WKJ B;  2CV5 C;  3M2J A;  2EX8 A;  3AFA A;  2WKP A;  1ULY A;  2O0Y A;  3KYQ A;  4K08 A;  3TJZ C;  1O7E A;  4BLM A;  1OTI A;  3HLG A;  3E4Q A;  1Q9C A;  5CPJ C;  2Y2K A;  3REL C;  4ME4 A;  5CP6 D;  2OV5 A;  1SCW A;  3L9K A;  2I72 A;  2VV6 A;  3GSG A;  5CHJ A;  1IFQ A;  3P09 A;  5E5A D;  3KUY D;  1YSQ A;  3MR0 A;  4WEK A;  5KDM B;  4WU9 B;  3ZG8 B;  2XA7 S;  1W2E A;  1DRM A;  3KFU G;  3SS5 A;  3MQQ A;  3KWQ C;  1CF0 A;  3W2Z A;  4PM9 A;  3HL9 A;  3K3D A;  1TD5 A;  3C2W A;  3WKJ C;  1I2S A;  4OOL A;  2WZX A;  4XT2 A;  5BS7 A;  1N4O A;  3S22 A;  2ZJ9 A;  4WJ3 C;  3G6O A;  2XEP A;  4FD8 A;  3WS5 A;  4O01 A;  2W27 A;  2NUT C;  2FJ7 B;  5KZH A;  2WGW B;  4E6X A;  1BSG A;  1Y54 A;  2ZM5 A;  5DJT A;  2W0N A;  4OQG A;  4KUD A;  1UWP X;  5DVA A;  1P3B D;  2XFT A;  4WU9 C;  4UQI M;  1DP8 A;  1JFI A;  3Q7Z A;  1JWP A;  4GKU A;  1OTD A;  5K5B A;  5M19 A;  5HAQ A;  1K56 D;  1DP9 A;  2HIO B;  1MBL A;  3X1V C;  1K6R A;  4XUZ A;  4J8W D;  4HES A;  2NUP C;  5F5Y A;  2EFU A;  3MKF A;  1OTA A;  3UY6 A;  4WNN A;  4JGP A;  4GHI B;  3DBA A;  4S2K A;  1KS0 A;  3UE0 A;  3CIT A;  2FH5 A;  4HP9 A;  1IYO A;  5CPK A;  3E0Y A;  3BFE A;  3VE4 A;  5F1G A;  3LIF A;  4CAY A;  3IP4 C;  4F3L A;  4ZUX A;  1IKG A;  1EQZ A;  2FJ7 C;  2B5R A;  3LFV A;  4WEJ A;  4HJ4 A;  4O0P A;  1TS0 A;  2PBY A;  3UPO A;  1K38 A;  1PRQ A;  1QMF A;  3T4K A;  4OJ6 A;  1PNE A;  5JYP A;  2H0Y A;  1M1A B;  3REK D;  3OCN A;  4QD4 A;  2YFW A;  4L9E A;  4NG2 A;  4WEL A;  3A1I A;  3B0C W;  4WBG A;  3MMH A;  4JXV A;  2HIO C;  3MS6 A;  2PT7 A;  1U60 A;  4DJ2 A;  3FYZ A;  1K55 A;  3LZ0 A;  4NYY A;  3WAA D;  1N9N A;  4NXE A;  1M18 C;  1T1B A;  3WTP B;  4AWL C;  1YUE A;  4PKY A;  5FAP A;  3G2Y A;  1NJ4 A;  4Z66 A;  3V9R B;  3AZK B;  4BWI A;  4LRX C;  1K0K A;  3DW0 A;  4LRY C;  2NQB B;  4GW9 A;  5AV6 C;  1F66 B;  2Z2L B;  4MN7 A;  2V1A A;  1XJ4 A;  2VKS A;  3M6B A;  2WKQ A;  4N1H A;  3PBN A;  4OJL A;  2C5W B;  3AYW C;  1FOF A;  3T1Q B;  1KX4 D;  5CPJ A;  3REL A;  3PBQ A;  4R4S A;  5EUA A;  5HD5 A;  1N9L A;  1S32 B;  3OPL A;  1LLB A;  1ACF A;  3MZD A;  5B32 D;  4H6J A;  3BRM A;  1SKO A;  3WA9 D;  5DNN D;  3MNN B;  3MGQ B;  1FQG A;  2O9C A;  1VQQ A;  4X23 B;  2IO5 B;  2Y79 A;  2YFV B;  2ZMF A;  3KWQ A;  3HLW A;  3WTP C;  4OON A;  2JE5 A;  5AVE A;  1CQA A;  5HPI A;  4KZ5 A;  3Q1F A;  5DF9 A;  3EGD C;  1LL9 A;  3V3S A;  3AZK C;  3AZI C;  3CI6 A;  4PM7 A;  1PWG A;  5GXQ D;  3WKJ A;  2NQB C;  3MZE A;  1F66 C;  3A0R A;  3C1C B;  3BQA A;  2Z6D A;  5B1M D;  3O62 D;  4S2N C;  5CP6 B;  1IKI A;  2DRW A;  5F99 D;  3AZG B;  4Y5F A;  5U47 A;  2HV1 A;  4WU8 B;  4Z5T D;  2WKR A;  3VP3 A;  3W97 B;  1VHM A;  3GQZ A;  4MN5 A;  5GHZ A;  3LEL A;  1S32 C;  1PW8 A;  2PYO B;  4J8U B;  1P3M D;  3UE1 A;  3MGS C;  2W3H A;  4EU0 A;  1RGZ A;  3MNN C;  3MGQ C;  4WU9 A;  1P3I D;  2JC7 A;  4X23 C;  4IUK A;  4XUJ D;  1CEG A;  2JHE A;  2XSS A;  1FIK A;  4LCM A;  4DE1 A;  3X1V A;  4LV3 A;  5AV5 D;  1HD8 A;  4CQH A;  5CPI D;  3B6G D;  4R6L A;  3GMW A;  1XGJ A;  4CLC D;  1BH9 B;  5CP6 C;  1FCN A;  5IS1 A;  4E44 A;  2VV7 A;  4DRA A;  4U0X A;  3FZC A;  1F98 A;  4WMC D;  3IX4 A;  4WU8 C;  1KX5 A;  1T19 A;  1XA7 A;  2FJ7 A;  3W97 C;  3IF6 B;  4XZQ B;  2WGW A;  1YMX A;  4G91 B;  2QYB A;  3REI D;  2PYO C;  1GA9 A;  4J8U C;  2PR5 A;  5B24 B;  3UT9 B;  5CHM A;  5B40 A;  5GT3 A;  4Y13 A;  2PU2 A;  5I5L A;  1QO6 A;  1KU5 A;  3AZN D;  3I7J A;  4NK3 A;  3UE3 A;  1XXM A;  1ED7 A;  1U35 B;  4HJ6 A;  4MBH A;  1P3K D;  1YLJ A;  3AV2 D;  2V20 A;  3UO9 A;  3AGF A;  3QP1 A;  2I9V A;  3E4O A;  4NXG A;  4IJF A;  1MXO A;  1P34 B;  5IU1 A;  4HMC A;  4P0M A;  4P85 A;  1M18 A;  4ZTK A;  4FOF A;  1M19 D;  4EEU A;  4OUI A;  4GHI A;  5EOO A;  2XH9 A;  1GSV A;  1YLY A;  2DF4 C;  1MPL A;  2ZQC A;  3HLD A;  3HCY A;  2F8N G;  4KZ3 A;  5BT1 D;  5AV6 A;  3NOT C;  3ZG7 B;  2PYP A;  3IF6 C;  4XZQ C;  3VH6 A;  1Q2P A;  3CLO A;  3UB7 A;  1P3B C;  1ID3 B;  3AYW A;  2VV8 A;  4H9Q A;  3KSF A;  3UT9 C;  4KHA A;  3W96 B;  2ZMA A;  3CAX A;  1J9M A;  1H8M A;  1KVM A;  4Z1W A;  2RIQ A;  3MGP D;  2QHK A;  4OQI A;  3LGO A;  1U35 C;  5G4Z A;  4J8V D;  3VP2 A;  5TR7 A;  5DTS A;  5FI6 A;  3KSY A;  2W3F A;  5AJG A;  3MKE A;  2XRN A;  5CGX A;  2IWD A;  1P3G B;  3PBT A;  3C30 A;  1N9O A;  1IYP A;  5CEB A;  3IXB A;  3AZK A;  5BO0 B;  4GLQ A;  3AZI A;  5HWV A;  4X55 A;  1IYS A;  2NQB A;  1OT6 A;  1F66 A;  1OTE A;  3WS1 A;  3A0V A;  4S2N A;  1M6K A;  2NZD D;  1ES2 A;  3Q82 A;  3WWX A;  1HLU P;  2PBD P;  5E43 A;  5FAT A;  3W96 C;  1P3L B;  2ZM2 A;  2J9O A;  5B33 A;  1P3F D;  2VEA A;  4FUW A;  5HX9 A;  2ARO D;  4ZJ2 A;  1ES5 A;  3FWL A;  3VMA A;  3MGS A;  3WAA C;  2EX2 A;  5L8M A;  1CK3 A;  2QKP A;  4X69 A;  1I2W A;  2QJ7 A;  4PMA A;  3TSG A;  2EX9 A;  3DWK A;  4X23 A;  4KZ8 A;  2YFV A;  1P3G C;  5J8X A;  4WLA A;  4R8P D;  5AV8 D;  5B31 D;  5EVI B;  1ZTU A;  2OWJ A;  4OOY A;  3B42 A;  1R4V A;  3A6N D;  2ZC4 B;  2HPB A;  3VH6 T;  1P3P D;  2Y8H A;  3ZCZ A;  3NOP C;  3FPW A;  3T1S A;  4BQM A;  1PI5 A;  1KGG A;  2GX5 A;  3IXD A;  5GLB A;  5CP6 A;  3UE6 A;  1BT5 A;  2BYM A;  2LB5 A;  3RH8 B;  5AY8 D;  4DF6 A;  1YMS A;  1P3L C;  1MZU A;  4WU8 A;  5A8B A;  3Q81 A;  3W97 A;  2Y2Q A;  3UB6 A;  3QP4 A;  3WA9 C;  5BOH A;  2JCH A;  5DNN C;  3REH D;  2ZD8 A;  4J8U A;  3AZL D;  4OKP A;  2PR6 A;  4HP4 A;  1S0W A;  3N6I A;  1XX2 A;  1V9Z A;  5BNV B;  3VH5 A;  3AZE D;  2EWW A;  5FQM A;  3IHB A;  2FN2 A;  3FG8 A;  1LSV A;  3G4P A;  3AZH D;  5EVI C;  3HJK A;  1PZR A;  5B0Y D;  1NZO A;  3BFD A;  4EQ1 A;  1GHP A;  4UPK A;  3O62 C;  3VP0 A;  5A90 A;  1JFI B;  3LZ1 D;  3ZGA B;  3HLF A;  1YLT A;  4P6Z S;  4D2O A;  4Z5T C;  3B3X A;  3W4O A;  1W79 A;  4R1G A;  5JRG D;  4DDY A;  5HWW A;  2RCX A;  3H0L C;  5DNM D;  3LIC A;  4WNN B;  3IF6 A;  4XZQ A;  4J8X D;  2B18 A;  1P3B A;  3T4O A;  3ZDJ A;  3BM6 A;  5CPK B;  2PRF A;  5B2I B;  5B0Z D;  1Z2C B;  3MXQ A;  4F3L B;  4ZUX B;  2J3T D;  1TZY D;  1EQZ B;  4ESP A;  1ONH A;  4NE5 A;  3C8C A;  3CZD A;  4L9F A;  5B32 G;  2ZQD A;  3O5Y A;  5CPI C;  3B6G C;  4KZ7 A;  4QB8 A;  4CJN A;  4DMZ A;  1SDE A;  1KDS A;  3AV1 D;  3WS0 A;  4B9O A;  3C38 A;  3E2L A;  1BYW A;  4ARZ A;  4YS3 D;  2F8N K;  5EM0 A;  1AXB A;  1H0I A;  5HL1 A;  1E4D A;  1YQS A;  4LV1 A;  3C4O A;  2L0W A;  3REI C;  4LPZ A;  4X68 A;  1W63 M;  4WZ4 A;  4UHU A;  4OOM A;  1LI9 A;  4CSR B;  5BPV A;  4UA7 A;  3RTY A;  1W5D A;  3AL0 C;  5B2J D;  1Y28 A;  4JPM A;  4KG5 A;  2A2L A;  3VH5 T;  1E15 A;  4WL9 A;  3L29 A;  4EO5 C;  5HSQ A;  5B2I C;  3LJA D;  2HUE B;  4J8V B;  1P3K C;  1F9I A;  3AZM D;  1B67 A;  2WKI A;  3NJA A;  4ZUX C;  4WZ5 C;  4B93 A;  1EQZ C;  2B95 A;  1JNU A;  1W63 Q;  2A24 A;  2ZQ7 A;  5EPH A;  2Y2I A;  5CED A;  5BNX B;  3WAA A;  4HNB A;  5MC7 A;  2WAF A;  3NI9 A;  2W1T B;  4MBK A;  5HW3 A;  5CPJ B;  3REL B;  3PYP A;  2VJW A;  3F6T A;  3LCE A;  1P3G A;  2OAQ 1;  4PM8 A;  2M7V A;  2HP6 A;  4ZJ1 A;  3ZFZ A;  2K2N A;  4X56 A;  5BT1 C;  2RTS A;  4OLG A;  5BO0 A;  3MGR D;  1QME A;  1L0D A;  4RYE A;  5CGS A;  1K55 C;  3REJ D;  1G6O A;  3U2A A;  4L9G A;  3MQ0 A;  1NLY A;  3LIE A;  4IVI A;  3JVV A;  1BUE A;  2VX8 A;  4NET A;  3ZNT A;  1E8B A;  5CRF A;  5GLC A;  2R9W A;  1P3L A;  2HUE C;  4J8V C;  2F8N D;  2WYX A;  1LHY A;  3CPT B;  4S2I A;  3WA9 A;  3WD4 A;  1OJ5 A;  5DNN A;  3NQU A;  1AOI D;  3DTE A;  4HBT A;  5FAS A;  1KGF A;  3NOU C;  3A1K A;  3T4L A;  4R3B A;  4HEF A;  1PI4 A;  4R0Q A;  4DJ3 A;  4Z2M G;  3LEL B;  1TS7 A;  3A3E A;  1S1Z A;  1HVB A;  4LV0 A;  1BZA A;  1DJC A;  3X1T D;  5EVI A;  3LYX A;  4N1X A;  2ZM0 A;  5AV9 D;  4R3J A;  4K0X A;  1ESI A;  5L2F A;  3O62 A;  1GA0 A;  3IXH A;  4LCL A;  4GHA A;  2EX6 A;  4RX3 A;  2W8S A;  3B6F D;  2V0U A;  1FR1 A;  4Z5T A;  5F1F A;  1WE4 A;  4Z2I A;  4Q0J A;  3W98 D;  3G30 A;  3BQ8 A;  4M6B A;  3X1V B;  3VSK A;  1STZ A;  5DJU A;  1D1J A;  4K0W A;  3S7Q A;  4BBV A;  3X1U B;  5GT0 B;  3FC7 A;  1YLP A;  3LY3 A;  4E04 A;  4NKP A;  2H10 A;  4R8P C;  5BNV A;  2ZQA A;  3WD2 A;  1KX5 B;  1K57 C;  1MKI A;  3PBO A;  3LEL C;  4G92 B;  1EI5 A;  5J7E A;  4EES A;  3NDE A;  3TG9 A;  2GJ3 A;  4Y0T A;  5CPI A;  3B6G A;  3S1Y A;  5EFW A;  4EUZ A;  5B40 B;  5GT3 B;  2ZMV A;  2IWC A;  2ACG A;  5KSC A;  4I38 A;  3KS8 A;  4JF6 A;  2L5A A;  3SH9 A;  1RP5 A;  1SHV A;  3ITA A;  1H5X A;  3T4S A;  1NZU A;  3NIA A;  2BTF P;  4Z9Q A;  1KX3 D;  4JGQ A;  4JF4 A;  4O7D A;  3W99 B;  4GDB A;  1S6R A;  2DQN C;  3REI A;  4KG2 A;  4NZ1 A;  5FUG B;  3X1U C;  5GT0 C;  1M18 B;  1OGB A;  1VET B;  4AWL B;  1XJ6 A;  3HUN A;  3KYE A;  3C1B D;  4BJP A;  1TS8 A;  5FL3 A;  5TFQ A;  5B2I A;  3AGE A;  1P3K A;  4PHT A;  5F6A A;  3AV2 A;  2Z6C A;  5AV6 B;  4CLC E;  4WZ5 A;  3GRJ A;  1KX5 C;  1NYM A;  4E3O A;  3DTI A;  3N7W A;  3S7N A;  1ERO A;  1S66 L;  4C75 A;  4G92 C;  2J9P A;  3ZQ5 A;  1OPX A;  3AYW B;  4QJG A;  4H9Q B;  4XXR A;  3AZF D;  4KHA B;  1W8Y A;  1M19 A;  2ZY5 A;  1D06 A;  5B40 C;  5GT3 C;  1P3O D;  1WYC A;  1ZLA D;  2JKT I;  4IBK A;  2MJ6 A;  5HDS A;  1MWS A;  2L4R A;  1C3B A;  3LR3 A;  5B1L D;  1LL5 A;  5B31 G;  2ZM8 A;  3BY9 A;  5AVC B;  5HFO A;  4C3Q A;  1EW0 A;  4J8X C;  3CG5 A;  3W99 C;  3OZH A;  4BD1 A;  4C6Y A;  2VGL M;  4UUZ B;  1IOU A;  2K31 A;  3N4I A;  4CSR A;  5B0Z C;  5CHU A;  4S2M A;  4NE3 A;  4WUJ A;  3E4P A;  4IED A;  3MGP A;  5DF7 A;  3AZI B;  3SW1 A;  1ODV A;  1DP6 A;  1G5U A;  4J8V A;  5EVE A;  4H9O B;  1T1C A;  3X1S D;  2QJ5 A;  5F83 A;  1PZO A;  3ULF A;  4Q8I A;  1ES3 A;  3Q07 A;  4DE3 A;  3AV1 C;  2RL3 A;  2V1B A;  3B0C T;  4Y3I A;  5BNX A;  2R78 A;  4MDZ A;  2JN7 A;  4GCZ A;  4YM6 D;  1HZO A;  2W1T A;  5FQQ A;  2VLG A;  1TDG A;  5B33 B;  1XFN A;  2WAE A;  2L1M A;  3FKE A;  3REJ B;  3MGS B;  3UN7 A;  2IWB A;  5AVC C;  3MVD D;  4X25 A;  5FI2 A;  4H9R B;  3AN2 D;  3ZHH A;  3H0R C;  1E6N A;  1E6Z A;  4EEP A;  2XD1 A;  4LG2 A;  4DDS A;  4KGC D;  3LJA C;  2C6W B;  1EWZ A;  5LBR A;  2F8N B;  1MWR A;  5HWT A;  2ZOH A;  3KYZ A;  4MB4 A;  4ZDX A;  1YLW A;  3AZJ D;  3LI9 A;  1F1E A;  5JA4 A;  4JLF A;  4QWO A;  4ZRR A;  2FFF B;  2XA7 M;  2ZOI A;  3AFA D;  1K4E A;  3CPT A;  1MC0 A;  3EPH A;  3LR4 A;  4HME A;  3L2A A;  4GHL A;  4H9P B;  2BYM B;  3LI8 A;  3NY4 A;  4R8P A;  3LUQ A;  4LD9 D;  5E5A B;  3HVF A;  1K57 A;  3S4X A;  3KUY B;  1YU3 A;  2UWX A;  2WGV A;  3DAV A;  5GHX A;  3UTA D;  5B33 C;  3UDX A;  3A6N A;  5E2F A;  3WS2 A;  1E25 A;  1K25 A;  2HJ9 C;  2ZY4 A;  3REJ C;  5KSH A;  3R45 B;  4JGR A;  2Z2M B;  3FPV A;  2X02 A;  2G2W A;  1N9B A;  4U3T A;  4N92 A;  3T4J A;  3TRC A;  4E3I A;  4NZ3 A;  4NZ4 A;  2EA9 A;  5M18 A;  3REH A;  1P97 A;  3X1U A;  5GT0 A;  4MLL A;  4OLD A;  2BG1 A;  3P5J B;  4OH0 A;  5FQK A;  1YT4 A;  2ZC3 B;  4Z2J A;  4HOI A;  2RVQ D;  1CI9 A;  4NY2 A;  1N1J A;  3WX7 A;  3UTB D;  3D3O A;  5E5A C;  5B0Y A;  5AV9 C;  3KUY C;  4KQD A;  1PFL A;  2JKG A;  3OC2 A;  2KLI A;  4OVD A;  1P3B B;  4E3L A;  4M3K A;  4WZS B;  1BLC A;  4YOF A;  4KUD D;  3M6H A;  3TOI A;  1OT9 A;  5JRG A;  3EPJ A;  3LO7 A;  4J8W B;  3BLM A;  5DNM A;  3PAG A;  3ZVW A;  3GVB A;  1LI0 A;  1MKM A;  4IBJ A;  1IEL A;  1Y4O A;  4J8X A;  3UPP A;  3W99 A;  1G6A A;  4N9K A;  3TU4 D;  4ARZ B;  5FUG A;  3DTM A;  5B0Z A;  1VET A;  3M2K A;  5A92 A;  5L09 A;  2ZBB A;  2P04 A;  1TZY A;  1TDL A;  5J4E A;  1K54 C;  1J7M A;  3L7H A;  1ONG A;  1FCM A;  3AV1 A;  3IH9 A;  2PD7 A;  2Y91 A;  1G28 A;  3BEC A;  3MF0 A;  3IX8 A;  3REK B;  2V2F F;  5DTK A;  4AFI A;  1KX3 C;  5HPF A;  1F2K A;  4QY5 A;  2A24 B;  4WYY A;  5HDD A;  4H9S C;  1HQ3 D;  4J8W C;  1P3A D;  3WAA B;  5AVC A;  3UB9 A;  4R38 A;  2V5O A;  3KXB D;  3LZ0 D;  5TBM B;  3BFG A;  3C1B C;  3IX3 A;  5CTN A;  3EWK A;  4UUZ A;  3P7N A;  3FKW A;  3W4Q A;  1FCO A;  2WKH A;  1K6S A;  3LJA A;  3G35 A;  4PM5 A;  1O07 A;  1XP4 A;  4JJN D;  2H28 A;  5F82 A;  2BYK A;  4Z66 D;  4ZAM A;  1HTA A;  4MBF A;  3K3C A;  5FSR A;  4OQH A;  2CV5 D;  4H9O A;  3A3D A;  3RFB A;  3VOZ A;  5M1A A;  2Y2O A;  3H82 B;  3FDD A;  3BFF A;  1KX4 B;  1ZLA C;  2Q0O A;  2VQR A;  1XJ2 A;  1XJ3 A;  3UDI A;  3IWQ A;  3LY4 A;  3REK C;  2HP9 A;  2J8Y A;  1L2S A;  2PDR A;  3GV9 A;  5B32 B;  3NCK A;  5HD3 A;  5AVB D;  3WA9 B;  5DNN B;  4FH2 A;  4R70 A;  3NQU B;  4EW7 A;  3VV4 A;  3REJ A;  1ZG4 A;  4H9R A;  5A91 A;  4MCW A;  4ID4 A;  4DXC A;  5JYO A;  3HON A;  3ZG9 B;  4B4Z A;  3KWQ D;  3JYI A;  5GXQ B;  5D3O A;  2F8N A;  2JSS A;  4S2J A;  2EFX A;  2Y2M A;  4OPY A;  2Q9M A;  5B1M B;  1S4S A;  1AOI A;  3O62 B;  3LIB A;  4A5R A;  3WKJ D;  5E2H A;  1YU0 A;  2DNS A;  3LR5 A;  5F99 B;  5DFX A;  3L26 A;  4YM6 C;  4DE2 A;  1KX4 C;  4Z5T B;  4FH4 A;  4H9P A;  2XF3 A;  4QNL A;  3E98 A;  3UNW A;  4HI4 A;  2HJE A;  1P3M B;  4EBL A;  5E5A A;  5B32 C;  2KOI A;  5AV9 A;  3KUY A;  1ZHH B;  3MFX A;  3AN2 C;  2GDN A;  4I3J A;  4I3A A;  1P3I B;  4QLC D;  4Y0O A;  3E2K A;  4KGC C;  3R45 A;  1ZKJ A;  4MN6 A;  3B6F A;  4XUJ B;  3IS2 B;  4WU9 D;  2GZA A;  3BY8 A;  3V50 A;  4YNR A;  1YU4 A;  3P01 A;  3PXP A;  3TW8 A;  1GSX A;  1GCE A;  4K91 A;  3OPR A;  5AV5 B;  5FAO A;  5GXQ C;  5CPI B;  3B6G B;  3VP4 A;  1SZV A;  2EWV A;  1PWC A;  3PBS A;  2QZ6 A;  5B1M C;  4CLC B;  4Z2G A;  4ZBJ B;  4P6B A;  1L0E A;  5F99 C;  3G34 A;  5HL6 A;  1ZC2 A;  1UR8 A;  4HQA A;  2M7U A;  2V0W A;  3P98 A;  1T1A A;  1K54 A;  3V5M A;  3REI B;  3WD0 A;  1P3M C;  4O8G A;  2AVX A;  4E3N A;  2FJ7 D;  2WK0 A;  4BL3 A;  4Y17 A;  3AZN B;  2O9A A;  4ZBE A;  1P3I C;  5EM1 A;  2LY8 A;  2VA0 A;  2CWE A;  4EO5 B;  5FDS A;  3H9W A;  4X1M A;  1P3K B;  4XUJ C;  1K56 A;  1TVF A;  5DKL A;  3AV2 B;  5C5K A;  1KX3 A;  5AVF A;  1CK7 A;  3A3J A;  4IHQ A;  5HDC A;  4H9S A;  4J8W A;  1CEF A;  4NZ5 A;  2XLN A;  2ZL1 B;  5AV5 C;  1M19 B;  1DJA A;  1TAF B;  2HIO D;  4HJ3 A;  4OP8 A;  4QU3 A;  2E8J A;  4PM6 A;  1UR9 A;  3C1B A;  3IH8 A;  4CLC C;  3NEC A;  1G68 A;  2G5I C;  4ZBJ C;  3O86 A;  1GHM A;  2RVQ C;  3H0M C;  5AQ7 A;  5IT5 A;  2INW A;  4NEE D;  3UTB C;  4UQI S;  1BH8 A;  1KVL A;  1XKZ A;  4WN5 A;  1VEU B;  2VGK A;  3ZNY A;  4IBD A;  2X71 A;  5KMW A;  3LEZ A;  1Q2Q A;  1GHI A;  1OGG A;  4HHD A;  1ZLA A;  3AZN C;  4GB7 A;  4E45 A;  4FSF A;  3MGP B;  4NYU A;  2PYR A;  4EBN A;  1PIO A;  3REK A;  1P3A B;  4H8R A;  1YM1 A;  3AV2 C;  1KE4 A;  3VFF A;  4H9N A;  1H0M A;  1M1A D;  4HBU A;  3C7V A;  3TU4 C;  3ZG0 A;  4XUX A;  4B4X A;  1Z09 A;  1M19 C;  2ZC6 B;  1MWT A;  1W7F A;  1UWN X;  1RGY A;  3O3V A;  3IHA A;  3N8S A;  4RVA A;  3HLB A;  5TBM A;  4WF0 A;  5A93 A;  3A3I A;  1E6P A;  3HLE A;  3WTP D;  5I94 A;  4KZ9 A;  3AZK D;  3L28 A;  2NZD B;  2HDR A;  1L0F A;  1ZG6 A;  4L0L A;  4QPR A;  4Z2K A;  2EXB A;  5GHY A;  2NQB D;  3QP8 A;  1F66 D;  4YM6 A;  3H82 A;  3R4K A;  1KX4 A;  4GD6 A;  4KZB A;  4R3A A;  1P3F B;  2VGL S;  2ARO B;  3MGP C;  5JA4 B;  2GNX A;  5FDH A;  3U4L P;  1HQ3 C;  3ZYT A;  1P3A C;  5B32 A;  2OLU A;  3L27 A;  1H8P A;  3ZVT A;  3AN2 A;  1S32 D;  2P9V B;  4KUK A;  3KXB C;  4GDN A;  4BBU A;  4KGC A;  3B0B A;  3GR2 A;  2ZY2 A;  4R8P B;  1JTG A;  2WGI A;  5AV8 B;  3KO6 A;  4NXB A;  5B31 B;  3MNN D;  3MGQ D;  4YWZ A;  1YSP A;  1NWZ A;  3HSH A;  3A6N B;  2ZQ9 A;  3NDG A;  4Y0U A;  4Z2L A;  4Q0I A;  5AQA A;  4BEN A;  4S2P A;  1P3P B;  2CC1 A;  5GXQ A;  4Z2H A;  3F1P B;  2G7U A;  3QNB A;  5B1M A;  3UB8 A;  2NZD C;  4JGO A;  4IJE A;  5F99 A;  2O99 A;  4RX2 A;  1WWS A;  5AY8 B;  1PWD A;  1XA1 A;  3C1C D;  4LD9 A;  4YFM A;  1LSX A;  4TX8 A;  3G2Z A;  3UTA A;  5AVB C;  1P3F C;  4F94 A;  2ARO C;  3REH B;  3NC8 A;  3AZG D;  3UDF A;  4WV4 B;  1PZP A;  3CWF A;  4QLC B;  2D02 A;  3AZL B;  4M4X A;  4WU8 D;  1P3M A;  5FEG A;  3W97 D;  3G31 A;  3MQO A;  1H3Q A;  4P6Z M;  5EOE A;  4OPQ A;  4QHC A;  3NQJ A;  2PYO D;  1O6I A;  4EXO A;  3AZE B;  1P3I A;  4IBG A;  4J8U D;  2IOU A;  3B0D B;  4XUJ A;  1T3U A;  5AV8 C;  1N1J B;  3AZH B;  5B31 C;  3IS2 A;  2WZZ A;  5B0Y B;  4Y15 A;  1MY8 A;  3A6N C;  3T1X A;  5DTT A;  3HRE A;  5AV5 A;  1P3P C;  1K4F A;  2PD8 A;  3LZ1 B;  1EAK A;  3MQL A;  3WD3 A;  5F68 A;  1BTL A;  3EEH A;  4IBX A;  4HY8 A;  2CMN A;  3LIA A;  4CLC A;  4IBF A;  5JRG B;  5AY8 C;  2ZC5 B;  1H8Z A;  4PKY G;  4WMC A;  5DNM B;  3UTB A;  1XPB A;  4GZB A;  5EE8 A;  3ZG5 A;  4GJ4 A;  3QP6 A;  4DKI A;  4J8X B;  1H3O A;  3REH C;  3PBR A;  3VE3 A;  5TJJ A;  2ZQ8 A;  4QLC C;  3AZL C;  2QMI A;  5FEF A;  5B0Z B;  4Y7P A; 
#chains in the Genus database with same CATH homology
 3N8L A;  4XZQ D;  3AZN A;  1KE3 A;  3AZE C;  1TZY B;  1JVJ A;  5B24 D;  3UT9 D;  3L25 A;  3B0D C;  3AZH C;  5G18 A;  4OPZ A;  2F2A C;  5B0Y C;  3HUM A;  3MZF A;  3AV1 B;  1U35 D;  5HAR A;  3TU4 A;  2XK1 A;  3MXS A;  1TAF A;  3LZ1 C;  4YS3 B;  2QPN A;  2H5S A;  1P34 D;  5EVL A;  4IBR A;  1FSY A;  1NRF A;  3BLS A;  4X53 A;  2ZLY A;  5JRG C;  3EQU A;  1E3U D;  3IQA A;  5DNM C;  1WWI A;  5B2J B;  2Y2J A;  1YLZ A;  3PTE A;  3LJA B;  4RA7 A;  3G32 A;  1YU1 A;  3AZM B;  1ID3 D;  3KS4 A;  2BYK B;  1TZY C;  3V39 A;  3W96 D;  1HQ3 A;  1ESU A;  2G5H C;  1P3A A;  2F8N H;  1YU2 A;  3N8R A;  3N3F A;  3BFC A;  2OLV A;  5GSU D;  1B6W A;  3KXB A;  3NBL A;  1W8Q A;  1CI8 A;  3DWZ A;  1HTZ A;  4YS3 C;  4JJN A;  4OP5 A;  4OPR A;  3MGR B;  1P3G D;  3WS4 A;  4GH9 A;  3ISG A;  4R4R A;  2CV5 A;  4IBE A;  4CPK A;  3Q7V A;  5B2J C;  2NZD A;  4JXG A;  4JXW A;  5FQJ A;  5FQI A;  3AZM C;  5CGW A;  5AVB A;  1P3F A;  4S2O A;  2ARO A;  1M1A C;  3FKV A;  5CTM A;  1AOI B;  1P3L D;  3A3F A;  4P87 A;  1KGE A;  4EWF A;  5DF8 A;  2BLS A;  4NE6 A;  2P9V A;  5AV8 A;  3X1T B;  3IWO A;  5B31 A;  1NXY A;  2HDS A;  5AV9 B;  5C3I B;  1DJB A;  3AGD A;  3OCL A;  3MGR C;  1P3P A;  5EVI D;  3B6F B;  4ZJ3 A;  2XD5 A;  4YIN A;  3W98 B;  2E8I A;  5AY8 A;  3VP1 A;  4E3M A;  2XGN A;  2WAD A;  3WRZ A;  4DQY B;  4OJO A;  4GD8 A;  4JKT A;  1AOI C;  4QLC A;  3AZL A;  3D4F A;  5KDM A;  4KZ4 A;  3AZE A;  3VSL A;  2IO5 C;  3GTC A;  3AZH A;  3X1T C;  3EG5 B;  2P74 A;  5C3I C;  3QNC A;  5HAP A;  5CER A;  3LZ1 A;  3B6F C;  3W4P A;  3C1C C;  1KX3 B;  3W98 C;  1H8Y A;  3AZG C;  1SDN A;  5TGF A;  1WYB A;  4E6W A;  5IHV A;  3BEB A;  3C1B B;  3SS4 A;  1VM1 A;  5G49 B;  1IEM A;  1BH8 B;  5CPK D;  3IT9 A;  5B2I D;  3AZF B;  4ZUX D;  2Y2L A;  4PPR A;  2HIO A;  1EQZ D;  1P3O B;  1ZLA B;  3VOY A;  4HGA B;  1NYY A;  1KDW A;  1MWU A;  2A49 A;  5B1L B;  2Y2H A;  3V3R A;  1A7W A;  4YS3 A;  4OJP A;  4H9N B;  4DE0 A;  3FV7 A;  2Y2G A;  5E2E A;  2J7V A;  4LV2 A;  4FCF A;  5B2J A;  4IBI A;  4G91 C;  4UA9 A;  1PYY A;  3IXG A;  5B24 C;  4EBP A;  3RJU A;  4IBB A;  3X1S B;  3AZM A;  4KQQ A;  5E2G A;  1M1A A;  5GSU B;  4BL2 A;  2XDM A;  3SS3 A;  3SH8 A;  1ERQ A;  3AZF C;  4YM6 B;  1P3O C;  2G2U A;  4HGA C;  1P34 C;  5B1L C;  3WTP A;  3SOI A;  3OPH A;  5CPJ D;  3REL D;  3MVD B;  3AN2 B;  3V9R A;  3MGR A;  3IWI A;  2VGJ A;  4EV4 A;  5CEC A;  5GL9 A;  4KGC B;  4IBC A;  3VFH A;  1I5Q A;  3QHY A;  1BLS A;  2XQZ A;  5GLD A;  2EXA A;  1ID3 C;  3AZJ B;  4DXB A;  1XGI A;  2HDU A;  3VH6 W;  3X1S C;  2Y4A A;  3AFA B;  4DRT A;  1S32 A;  1FR6 A;  4R23 A;  5GSU C;  3WTP E;  4EQI A;  1SKF A;  1BLH A;  1BFM A;  4JF5 A;  4KG6 A;  3C4P A;  3MNN A;  3MGQ A;  4JBF A;  4S2L A;  4LD9 B;  2ZY3 A;  3W8K A;  3UTA B;  3EPK A;  3RXX A;  4MEZ A;  3X1T A;  4WM9 A;  3O87 A;  4JXS A;  3MVD C;  2ZC7 A;  3LEL D;  3NQJ B;  4MNR A;  5FI7 A;  1KE0 A;  3IF5 A;  2XR0 A;  4OJ5 A;  3CJM A;  2FFY A;  3C1C A;  4KQO A;  3SH7 A;  2X01 A;  3MXR A;  5FA7 A;  3W98 A;  4Z2M H;  3AZJ C;  3AZG A;  4BD0 A;  3AFA C;  3X1V D;  2PYO A;  3X1U D;  5GT0 D;  1DY6 A;  2WUQ A;  1Z6F A;  5EEC A;  1ES4 A;  2PU4 A;  5AQ9 A;  2R9X A;  3UTB B;  2Y2P A;  4LD9 C;  3MFD A;  3CMZ A;  3UTA C;  3WRT A;  1H3O B;  4UAA A;  4QY6 A;  4GN2 A;  4GNU A;  1KX5 D;  4KUD B;  5CXW A;  1JWV A;  3C5A A;  5B40 D;  5GT3 D;  4U0T A;  5FQ9 A;  1IYQ A;  1JWZ A;  3MBZ A;  4KQR A;  4E3K A;  3HUO A;  1BH9 A;  1TEM A;  2Y59 A;  1L0G A;  3TU4 B;  2Y2N A;  1JTD A;  4KZ6 A;  1OME A;  4X6T A;  3W99 D;  2Q9N A;  5BS7 C;  5B24 A;  3UT9 A;  1M18 D;  1BLP A;  5G49 A;  4CAY B;  1ALQ A;  3C7U A;  1FSW A;  2XFS A;  2HP5 A;  1U35 A;  5AQB A;  3HLC A;  3O88 A;  3AZF A;  5AV6 D;  3VH5 W;  5HAI A;  1P3O A;  2V1Z A;  4IVK A;  4KUD C;  4N9L A;  1P34 A;  3AYW D;  5B1L A;  1BUL A;  2JBF A;  2DCF A;  1HQ3 B;  1PW1 A;  5GLA A;  2YFW B;  4E3J A;  1E3U A;  2OSU A;  1ERM A;  3KXB B;  2H0T A;  3LZ0 B;  4DRB A;  3EQV A;  5AVC D;  4GOG A;  4JJN B;  1ID3 A;  3RXW A;  3HBR A;  4Z66 B;  3OPP A;  5CPK C;  4KEN B;  3W96 A;  2CV5 B;  1RCJ A;  3X1S A;  3BYD A;  4KZA A;  2HDQ A;  4NFT A;  5GSU A;  3AZI D;  3Q7V B;  3PAE A;  4LEN A;  4UA6 A;  5AVB B;  5CHL B;  2J8P A;  5FAQ A;  3UPN A;  3MVD A;  5B33 D;  1M40 A;  4B88 A;  2WKE A;  3LZ0 C;  3MGS D;  2Y55 A;  3KWQ B;  3ITB A;  4JJN C;  4OQ0 A;  1NY0 A;  4X23 D;  3EPL A;  4Z66 C;  3AZJ A;  2A3U A;  3WKJ B;  2CV5 C;  3M2J A;  2EX8 A;  3AFA A;  1ULY A;  1O7E A;  4BLM A;  3HLG A;  1Q9C A;  5CPJ C;  2Y2K A;  3REL C;  2OV5 A;  5CP6 D;  1SCW A;  2I72 A;  3GSG A;  5CHJ A;  3P09 A;  5E5A D;  3KUY D;  4WEK A;  5KDM B;  4WU9 B;  3ZG8 B;  1W2E A;  3KFU G;  3SS5 A;  3KWQ C;  4PM9 A;  3HL9 A;  3WKJ C;  1I2S A;  4OOL A;  2WZX A;  5BS7 A;  1N4O A;  3S22 A;  2ZJ9 A;  4WJ3 C;  2XEP A;  4FD8 A;  3WS5 A;  2FJ7 B;  5KZH A;  2WGW B;  4E6X A;  1BSG A;  1Y54 A;  2ZM5 A;  4OQG A;  4KUD A;  5DVA A;  1P3B D;  2XFT A;  4WU9 C;  1JFI A;  3Q7Z A;  1JWP A;  4GKU A;  5M19 A;  5HAQ A;  1K56 D;  2HIO B;  1MBL A;  3X1V C;  1K6R A;  4XUZ A;  4J8W D;  4HES A;  2EFU A;  3MKF A;  3UY6 A;  4WNN A;  4S2K A;  3UE0 A;  1IYO A;  5CPK A;  3BFE A;  5F1G A;  4CAY A;  3IP4 C;  4ZUX A;  1IKG A;  1EQZ A;  2FJ7 C;  2B5R A;  4WEJ A;  2PBY A;  3UPO A;  1K38 A;  1QMF A;  4OJ6 A;  5JYP A;  2H0Y A;  1M1A B;  3REK D;  3OCN A;  4QD4 A;  2YFW A;  4WEL A;  3A1I A;  3B0C W;  4WBG A;  4JXV A;  2HIO C;  1U60 A;  3FYZ A;  1K55 A;  3LZ0 A;  4NYY A;  3WAA D;  1M18 C;  3WTP B;  4AWL C;  1YUE A;  5FAP A;  3G2Y A;  4Z66 A;  3AZK B;  3V9R B;  1NJ4 A;  3DW0 A;  2NQB B;  5AV6 C;  1F66 B;  2Z2L B;  3M6B A;  4N1H A;  3PBN A;  4OJL A;  2C5W B;  3AYW C;  1FOF A;  1KX4 D;  5CPJ A;  3REL A;  3PBQ A;  4R4S A;  5EUA A;  1S32 B;  3OPL A;  1LLB A;  3MZD A;  5B32 D;  3BRM A;  3WA9 D;  5DNN D;  3MNN B;  3MGQ B;  1FQG A;  1VQQ A;  4X23 B;  2IO5 B;  2YFV B;  3KWQ A;  3HLW A;  3WTP C;  4OON A;  2JE5 A;  4KZ5 A;  3Q1F A;  5DF9 A;  1LL9 A;  3V3S A;  3AZK C;  3AZI C;  4PM7 A;  1PWG A;  5GXQ D;  3WKJ A;  2NQB C;  3MZE A;  1F66 C;  3C1C B;  5B1M D;  3O62 D;  4S2N C;  5CP6 B;  1IKI A;  2DRW A;  5F99 D;  3AZG B;  5U47 A;  4WU8 B;  4Z5T D;  3VP3 A;  3W97 B;  3GQZ A;  5GHZ A;  3LEL A;  1S32 C;  1PW8 A;  2PYO B;  4J8U B;  1P3M D;  3UE1 A;  3MGS C;  1RGZ A;  3MNN C;  3MGQ C;  4WU9 A;  1P3I D;  2JC7 A;  4X23 C;  4XUJ D;  1CEG A;  4LCM A;  4DE1 A;  3X1V A;  4LV3 A;  5AV5 D;  1HD8 A;  5CPI D;  3B6G D;  3GMW A;  1XGJ A;  1BH9 B;  5CP6 C;  1FCN A;  4E44 A;  4U0X A;  4DRA A;  3FZC A;  4WMC D;  4WU8 C;  1KX5 A;  1XA7 A;  2FJ7 A;  3W97 C;  3IF6 B;  4XZQ B;  2WGW A;  1YMX A;  4G91 B;  3REI D;  2PYO C;  1GA9 A;  4J8U C;  5B24 B;  3UT9 B;  5CHM A;  5B40 A;  5GT3 A;  2PU2 A;  1KU5 A;  3AZN D;  3I7J A;  4NK3 A;  3UE3 A;  1XXM A;  1U35 B;  4MBH A;  1P3K D;  1YLJ A;  3AV2 D;  2V20 A;  3UO9 A;  3AGF A;  4IJF A;  1MXO A;  1P34 B;  4P0M A;  4P85 A;  4ZTK A;  1M18 A;  1M19 D;  4OUI A;  5EOO A;  2XH9 A;  1YLY A;  2DF4 C;  1MPL A;  2ZQC A;  3HLD A;  2F8N G;  4KZ3 A;  5BT1 D;  5AV6 A;  3ZG7 B;  3IF6 C;  4XZQ C;  3VH6 A;  1Q2P A;  1P3B C;  1ID3 B;  3AYW A;  4H9Q A;  3UT9 C;  4KHA A;  3W96 B;  2ZMA A;  1J9M A;  1KVM A;  2RIQ A;  3MGP D;  4OQI A;  1U35 C;  4J8V D;  3VP2 A;  5TR7 A;  5DTS A;  5FI6 A;  3KSY A;  3MKE A;  5CGX A;  2IWD A;  1P3G B;  3PBT A;  1IYP A;  5CEB A;  3IXB A;  3AZK A;  5BO0 B;  3AZI A;  4X55 A;  1IYS A;  2NQB A;  1F66 A;  3WS1 A;  4S2N A;  1M6K A;  2NZD D;  1ES2 A;  3Q82 A;  3WWX A;  5E43 A;  5FAT A;  3W96 C;  1P3L B;  2ZM2 A;  2J9O A;  5B33 A;  1P3F D;  5HX9 A;  2ARO D;  4ZJ2 A;  1ES5 A;  3FWL A;  3VMA A;  3MGS A;  3WAA C;  2EX2 A;  1CK3 A;  4X69 A;  1I2W A;  4PMA A;  3TSG A;  2EX9 A;  3DWK A;  4X23 A;  4KZ8 A;  2YFV A;  1P3G C;  5J8X A;  4R8P D;  5AV8 D;  5B31 D;  5EVI B;  4OOY A;  1R4V A;  3A6N D;  2ZC4 B;  2HPB A;  3VH6 T;  1P3P D;  3ZCZ A;  4BQM A;  1PI5 A;  1KGG A;  3IXD A;  5GLB A;  5CP6 A;  1BT5 A;  2BYM A;  5AY8 D;  4DF6 A;  1YMS A;  1P3L C;  4WU8 A;  3Q81 A;  3W97 A;  2Y2Q A;  3WA9 C;  5BOH A;  2JCH A;  5DNN C;  3REH D;  2ZD8 A;  4J8U A;  3AZL D;  4OKP A;  1S0W A;  3N6I A;  1XX2 A;  5BNV B;  3VH5 A;  3AZE D;  5FQM A;  3IHB A;  3G4P A;  3AZH D;  5EVI C;  1PZR A;  5B0Y D;  1NZO A;  3BFD A;  1GHP A;  4UPK A;  3O62 C;  3VP0 A;  5A90 A;  1JFI B;  3LZ1 D;  3ZGA B;  3HLF A;  1YLT A;  4D2O A;  4Z5T C;  3B3X A;  3W4O A;  1W79 A;  4R1G A;  5JRG D;  4DDY A;  2RCX A;  3H0L C;  5DNM D;  4WNN B;  3IF6 A;  4XZQ A;  4J8X D;  1P3B A;  3ZDJ A;  3BM6 A;  5CPK B;  5B2I B;  5B0Z D;  1Z2C B;  4ZUX B;  1TZY D;  1EQZ B;  1ONH A;  4NE5 A;  3CZD A;  5B32 G;  2ZQD A;  4KZ7 A;  5CPI C;  3B6G C;  4QB8 A;  4CJN A;  1SDE A;  1KDS A;  3AV1 D;  3WS0 A;  3E2L A;  4YS3 D;  2F8N K;  1AXB A;  5HL1 A;  1E4D A;  1YQS A;  4LV1 A;  3C4O A;  3REI C;  4X68 A;  4WZ4 A;  4UHU A;  4OOM A;  1LI9 A;  4CSR B;  5BPV A;  4UA7 A;  1W5D A;  3AL0 C;  5B2J D;  4JPM A;  4KG5 A;  3VH5 T;  3L29 A;  4EO5 C;  5B2I C;  3LJA D;  2HUE B;  4J8V B;  1P3K C;  3AZM D;  1B67 A;  2WKI A;  4ZUX C;  4WZ5 C;  1EQZ C;  5EPH A;  2ZQ7 A;  2Y2I A;  5CED A;  5BNX B;  3WAA A;  2WAF A;  3NI9 A;  4MBK A;  5HW3 A;  5CPJ B;  3REL B;  3F6T A;  3LCE A;  1P3G A;  4PM8 A;  2HP6 A;  4ZJ1 A;  3ZFZ A;  4X56 A;  5BT1 C;  4OLG A;  5BO0 A;  3MGR D;  1QME A;  1L0D A;  4RYE A;  5CGS A;  1K55 C;  3REJ D;  4IVI A;  1BUE A;  4NET A;  3ZNT A;  5CRF A;  5GLC A;  2R9W A;  1P3L A;  2HUE C;  4J8V C;  2F8N D;  2WYX A;  1LHY A;  4S2I A;  3WA9 A;  5DNN A;  3NQU A;  1AOI D;  4HBT A;  5FAS A;  1KGF A;  3A1K A;  4R3B A;  4HEF A;  1PI4 A;  4R0Q A;  4Z2M G;  3LEL B;  3A3E A;  1HVB A;  4LV0 A;  1BZA A;  1DJC A;  3X1T D;  5EVI A;  4N1X A;  2ZM0 A;  5AV9 D;  4R3J A;  4K0X A;  1ESI A;  5L2F A;  3O62 A;  1GA0 A;  3IXH A;  4LCL A;  4GHA A;  2EX6 A;  4RX3 A;  2W8S A;  3B6F D;  1FR1 A;  4Z5T A;  5F1F A;  1WE4 A;  3W98 D;  3G30 A;  4M6B A;  3X1V B;  3VSK A;  4K0W A;  3X1U B;  5GT0 B;  1YLP A;  3LY3 A;  2H10 A;  4R8P C;  5BNV A;  2ZQA A;  1KX5 B;  1K57 C;  1MKI A;  3PBO A;  3LEL C;  4G92 B;  1EI5 A;  3NDE A;  3TG9 A;  4Y0T A;  5CPI A;  3B6G A;  3S1Y A;  4EUZ A;  5B40 B;  5GT3 B;  2IWC A;  5KSC A;  3KS8 A;  4JF6 A;  2L5A A;  3SH9 A;  1RP5 A;  1SHV A;  3ITA A;  1H5X A;  1NZU A;  3NIA A;  4Z9Q A;  1KX3 D;  4JF4 A;  4O7D A;  3W99 B;  4GDB A;  1S6R A;  2DQN C;  3REI A;  4KG2 A;  4NZ1 A;  5FUG B;  3X1U C;  5GT0 C;  1M18 B;  4AWL B;  3HUN A;  3C1B D;  4BJP A;  5TFQ A;  5B2I A;  3AGE A;  1P3K A;  3AV2 A;  5AV6 B;  4WZ5 A;  3GRJ A;  1KX5 C;  1NYM A;  4E3O A;  3N7W A;  1ERO A;  4C75 A;  4G92 C;  2J9P A;  3AYW B;  4QJG A;  4H9Q B;  4XXR A;  3AZF D;  4KHA B;  1M19 A;  1W8Y A;  2ZY5 A;  5B40 C;  5GT3 C;  1P3O D;  1WYC A;  1ZLA D;  4IBK A;  1MWS A;  1C3B A;  5B1L D;  1LL5 A;  5B31 G;  2ZM8 A;  5AVC B;  5HFO A;  4C3Q A;  4J8X C;  3CG5 A;  3W99 C;  3OZH A;  4BD1 A;  4C6Y A;  4UUZ B;  3N4I A;  4CSR A;  5B0Z C;  5CHU A;  4S2M A;  4NE3 A;  4IED A;  3MGP A;  5DF7 A;  3AZI B;  4J8V A;  4H9O B;  3X1S D;  5F83 A;  1PZO A;  4Q8I A;  1ES3 A;  3Q07 A;  4DE3 A;  3AV1 C;  2RL3 A;  3B0C T;  5BNX A;  4YM6 D;  1HZO A;  5FQQ A;  1TDG A;  5B33 B;  2WAE A;  3FKE A;  3REJ B;  3MGS B;  3UN7 A;  2IWB A;  5AVC C;  3MVD D;  5FI2 A;  4H9R B;  3AN2 D;  3ZHH A;  3H0R C;  2XD1 A;  4LG2 A;  4DDS A;  4KGC D;  3LJA C;  2C6W B;  1EWZ A;  2F8N B;  1MWR A;  4ZDX A;  1YLW A;  3AZJ D;  1F1E A;  5JA4 A;  4JLF A;  2FFF B;  3AFA D;  1K4E A;  3EPH A;  3L2A A;  4GHL A;  4H9P B;  2BYM B;  3NY4 A;  4R8P A;  4LD9 D;  5E5A B;  3HVF A;  1K57 A;  3S4X A;  3KUY B;  1YU3 A;  2UWX A;  2WGV A;  5GHX A;  3UDX A;  3UTA D;  5B33 C;  3A6N A;  5E2F A;  3WS2 A;  1E25 A;  1K25 A;  2ZY4 A;  3REJ C;  5KSH A;  3R45 B;  2Z2M B;  2X02 A;  2G2W A;  1N9B A;  4U3T A;  4N92 A;  4E3I A;  4NZ3 A;  4NZ4 A;  5M18 A;  3REH A;  3X1U A;  5GT0 A;  4MLL A;  4OLD A;  2BG1 A;  3P5J B;  4OH0 A;  5FQK A;  1YT4 A;  2ZC3 B;  2RVQ D;  1CI9 A;  4NY2 A;  1N1J A;  3WX7 A;  3UTB D;  5E5A C;  5B0Y A;  5AV9 C;  3KUY C;  3OC2 A;  4OVD A;  1P3B B;  4E3L A;  4M3K A;  4WZS B;  1BLC A;  4KUD D;  3M6H A;  3TOI A;  5JRG A;  3EPJ A;  3LO7 A;  4J8W B;  3BLM A;  5DNM A;  3PAG A;  3ZVW A;  3GVB A;  1LI0 A;  4IBJ A;  1IEL A;  4J8X A;  3UPP A;  3W99 A;  1G6A A;  4N9K A;  3TU4 D;  5FUG A;  3DTM A;  5B0Z A;  3M2K A;  5A92 A;  1TZY A;  1TDL A;  1K54 C;  1ONG A;  1FCM A;  3AV1 A;  3IH9 A;  2Y91 A;  3BEC A;  3REK B;  2V2F F;  5DTK A;  1KX3 C;  4QY5 A;  4WYY A;  4H9S C;  1HQ3 D;  4J8W C;  1P3A D;  3WAA B;  5AVC A;  3KXB D;  3LZ0 D;  3BFG A;  3C1B C;  5CTN A;  4UUZ A;  3FKW A;  3W4Q A;  1FCO A;  2WKH A;  1K6S A;  3LJA A;  3G35 A;  4PM5 A;  1O07 A;  1XP4 A;  4JJN D;  5F82 A;  2BYK A;  4Z66 D;  4ZAM A;  1HTA A;  4MBF A;  5FSR A;  4OQH A;  2CV5 D;  4H9O A;  3A3D A;  3VOZ A;  5M1A A;  2Y2O A;  3FDD A;  3BFF A;  1KX4 B;  1ZLA C;  2VQR A;  3UDI A;  3IWQ A;  3LY4 A;  3REK C;  2HP9 A;  2J8Y A;  1L2S A;  3GV9 A;  5B32 B;  3NCK A;  5AVB D;  3WA9 B;  5DNN B;  4FH2 A;  3NQU B;  3REJ A;  1ZG4 A;  4H9R A;  5A91 A;  4ID4 A;  4DXC A;  5JYO A;  3HON A;  3ZG9 B;  4B4Z A;  3KWQ D;  3JYI A;  5GXQ B;  5D3O A;  2F8N A;  2JSS A;  4S2J A;  2EFX A;  2Y2M A;  4OPY A;  2Q9M A;  5B1M B;  4A5R A;  1AOI A;  3O62 B;  3WKJ D;  5E2H A;  1YU0 A;  2DNS A;  5F99 B;  3L26 A;  4YM6 C;  4DE2 A;  1KX4 C;  4Z5T B;  4FH4 A;  4H9P A;  2XF3 A;  4QNL A;  3UNW A;  1P3M B;  4EBL A;  5E5A A;  5B32 C;  5AV9 A;  3KUY A;  3AN2 C;  2GDN A;  1P3I B;  4QLC D;  4Y0O A;  3E2K A;  4KGC C;  3R45 A;  1ZKJ A;  3B6F A;  4XUJ B;  4WU9 D;  3V50 A;  1YU4 A;  4K91 A;  1GCE A;  3OPR A;  5AV5 B;  5FAO A;  5GXQ C;  5CPI B;  3B6G B;  3VP4 A;  1PWC A;  3PBS A;  2QZ6 A;  5B1M C;  4ZBJ B;  4P6B A;  1L0E A;  5F99 C;  3G34 A;  1ZC2 A;  3P98 A;  1K54 A;  3V5M A;  3REI B;  1P3M C;  4E3N A;  2FJ7 D;  2WK0 A;  4BL3 A;  3AZN B;  4ZBE A;  1P3I C;  2LY8 A;  2CWE A;  4EO5 B;  1P3K B;  4XUJ C;  1K56 A;  1TVF A;  3AV2 B;  1KX3 A;  3A3J A;  4H9S A;  4J8W A;  1CEF A;  4NZ5 A;  2XLN A;  5AV5 C;  1M19 B;  1DJA A;  1TAF B;  2HIO D;  4OP8 A;  4QU3 A;  4PM6 A;  3C1B A;  3IH8 A;  1G68 A;  2G5I C;  4ZBJ C;  3O86 A;  1GHM A;  2RVQ C;  3H0M C;  5AQ7 A;  3UTB C;  1BH8 A;  1KVL A;  1XKZ A;  2VGK A;  3ZNY A;  4IBD A;  2X71 A;  5KMW A;  3LEZ A;  1Q2Q A;  1GHI A;  1ZLA A;  3AZN C;  4GB7 A;  4E45 A;  4FSF A;  3MGP B;  4NYU A;  4EBN A;  1PIO A;  3REK A;  1P3A B;  4H8R A;  1YM1 A;  3AV2 C;  1KE4 A;  3VFF A;  4H9N A;  1M1A D;  4HBU A;  3C7V A;  3TU4 C;  3ZG0 A;  4XUX A;  4B4X A;  1M19 C;  2ZC6 B;  1MWT A;  1W7F A;  1RGY A;  3O3V A;  3IHA A;  3N8S A;  4RVA A;  3HLB A;  5A93 A;  3A3I A;  3HLE A;  3WTP D;  5I94 A;  4KZ9 A;  3AZK D;  3L28 A;  2NZD B;  2HDR A;  1L0F A;  1ZG6 A;  4L0L A;  2EXB A;  5GHY A;  2NQB D;  1F66 D;  4YM6 A;  1KX4 A;  4GD6 A;  4KZB A;  1P3F B;  2ARO B;  3MGP C;  5JA4 B;  5FDH A;  1HQ3 C;  1P3A C;  5B32 A;  2OLU A;  3L27 A;  3ZVT A;  3AN2 A;  1S32 D;  2P9V B;  3KXB C;  4GDN A;  4KGC A;  3B0B A;  3GR2 A;  2ZY2 A;  2WGI A;  4R8P B;  1JTG A;  5AV8 B;  5B31 B;  3MNN D;  3MGQ D;  3HSH A;  3A6N B;  2ZQ9 A;  3NDG A;  4Y0U A;  5AQA A;  4BEN A;  4S2P A;  1P3P B;  2CC1 A;  5GXQ A;  3QNB A;  5B1M A;  2NZD C;  4IJE A;  5F99 A;  4RX2 A;  1WWS A;  5AY8 B;  1PWD A;  1XA1 A;  3C1C D;  4LD9 A;  4YFM A;  3G2Z A;  3UTA A;  5AVB C;  1P3F C;  4F94 A;  2ARO C;  3REH B;  3NC8 A;  3AZG D;  3UDF A;  4WV4 B;  1PZP A;  4QLC B;  3AZL B;  4WU8 D;  1P3M A;  3W97 D;  3G31 A;  5EOE A;  4OPQ A;  4QHC A;  3NQJ A;  2PYO D;  3AZE B;  1P3I A;  4IBG A;  4J8U D;  2IOU A;  3B0D B;  4XUJ A;  1T3U A;  5AV8 C;  1N1J B;  3AZH B;  5B31 C;  2WZZ A;  5B0Y B;  1MY8 A;  3A6N C;  5DTT A;  3HRE A;  5AV5 A;  1P3P C;  1K4F A;  3LZ1 B;  1BTL A;  4IBX A;  4IBF A;  5JRG B;  5AY8 C;  2ZC5 B;  1H8Z A;  4WMC A;  5DNM B;  3UTB A;  1XPB A;  4GZB A;  5EE8 A;  3ZG5 A;  4DKI A;  4J8X B;  1H3O A;  3REH C;  3PBR A;  2ZQ8 A;  4QLC C;  3AZL C;  2QMI A;  5B0Z B;  4Y7P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...