2JCHA

Structural and mechanistic basis of penicillin binding protein inhibition by lactivicins
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
684
structure length
461
Chain Sequence
SEITYSDGTVIASIDYLYFTTLAEAQERMYDYLAQRDNVSAATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTNQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Mechanistic Basis of Penicillin-Binding Protein Inhibition by Lactivicins
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Drug-binding protein
molecule keywords PENICILLIN-BINDING PROTEIN 1B
total genus 144
structure length 461
sequence length 684
ec nomenclature
pdb deposition date 2006-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
A PF00912 Transgly Transglycosylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2jchA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2jchA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2jchA02
2HP5A 1E25A 3EQVA 5E43A 4ZJ1A 3VP0A 3GVBA 3ZNTA 3Q82A 1BLHA 4LV3A 5DF7A 3PAGA 5EVLA 3ZG0A 1ES3A 3E2LA 3IWOA 1SCWA 1VQQA 2OLUA 1PWCA 1Q2PA 5A90A 4OLDA 4KZ9A 4Y0UA 1CEFA 1L0EA 4N1XA 5HAQA 2WKEA 1DJCA 2WGIA 2EXAA 2ZMAA 3HLBA 1YLZA 3HVFA 3CG5A 4KZ4A 4MBFA 3Q07A 2IWDA 3WS0A 3G32A 1I5QA 4N9LA 1KDSA 4R3JA 4WEKA 4H8RA 1M6KA 3BEBA 1BULA 4OQ0A 5CERA 3HUOA 3DWKA 4IBRA 2Y2QA 4KG5A 4KZAA 1SDNA 4C75A 4E3IA 1BSGA 2IWCA 2EX8A 2HP9A 1PYYA 2ZLYA 3N6IA 4BJPA 4B88A 4MBKA 3VP2A 4EUZA 1IKIA 2WGWB 2XDMA 1HVBA 1DJAA 1LI9A 1SHVA 1MKIA 1NYMA 4WBGA 3S22A 4C6YA 5F1FA 2X71A 4IBXA 4JXWA 5CRFA 4RA7A 2J9PA 3BRMA 3IF5A 5L2FA 2WYXA 3ZCZA 1FR1A 1ESIA 4N1HA 4WZ5A 1W5DA 2XH9A 3ZG5A 1L2SA 1L0DA 1MWSA 3FKVA 4GD8A 4QJGA 3OPPA 4OP8A 1BLSA 2XFTA 1FSWA 1OMEA 4GOGA 3S4XA 2EFXA 4QB8A 2Y2KA 3WWXA 2OSUA 4PM9A 1ERQA 5EPHA 3TSGA 1PZPA 3AGEA 4QU3A 4ZTKA 4NETA 4PMAA 4OVDA 3G30A 1PI4A 2GDNA 1CEGA 3MBZA 3NDGA 1HTZA 1EROA 1YMSA 2DRWA 2XFSA 4UAAA 3VFHA 3Q81A 1K56A 1SKFA 3NCKA 2Y2NA 4GKUA 4U0TA 4UA7A 5FI2A 3OCLA 4WZ4A 3WRTA 1KE4A 4IVIA 1DJBA 4JF6A 3V50A 5F1GA 3P09A 3V39A 1CI8A 5AQ7A 3BFDA 2OLVA 3WS4A 1WE4A 3Q1FA 1XA7A 4OQHA 4QHCA 5A91A 3UY6A 4QY6A 3UDFA 2XD5A 5FAOA 4E3JA 5E2EA 1KGGA 2WKHA 2XQZA 5CEBA 1Z6FA 3MKFA 4N92A 4S2JA 5EVIA 1FSYA 4MLLA 2P9VA 4DKIA 1GCEA 3VFFA 3SH7A 4ZJ3A 2P74A 3IT9A 1KE3A 3SS5A 1LI0A 5E2GA 5KMWA 1FCNA 4OPRA 1YQSA 5EOEA 1GA9A 2Y91A 4S2NC 5HX9A 2JC7A 1YLPA 4R1GA 3M2KA 3OPRA 4HBTA 4S2MA 3WRZA 3UPOA 2G2WA 4BD0A 5I94A 1N4OA 2Y2GA 4JF4A 2FFFB 4S2NA 3MFDA 4FH4A 5CTNA 3E2KA 1NZUA 3M6HA 3JYIA 3OC2A 4OKPA 1FCMA 4WM9A 4P6BA 1E3UD 4EBNA 4HBUA 2VGKA 3VP1A 3GSGA 4KZ5A 2QPNA 3ITBA 4ID4A 4X69A 5HAIA 3ZDJA 3DTMA 4KQOA 1L0FA 3W4OA 3O3VA 4WZ5C 4P87A 3IXBA 1NXYA 1G68A 3ZG7B 3ZVTA 2PBYA 3HLEA 3G4PA 3VP4A 2JCHA 2XR0A 1JVJA 4MEZA 2ZC4B 3SS4A 3B3XA 3FWLA 3ITAA 4R0QA 5FQ9A 4PM8A 3NIAA 2HDSA 4E3KA 3IHBA 1ERMA 3GTCA 3IXGA 4IVKA 3HLGA 3OZHA 2J8YA 4DE3A 1ES4A 2V1ZA 5CECA 1BLPA 1GHPA 5FA7A 2XF3A 3FYZA 3PBNA 2ZQAA 4KENB 1O07A 3QNBA 1W8YA 3IF6C 2Y2LA 3UDIA 5F82A 3IWIA 2DNSA 5GLDA 1ES5A 3ISGA 3OCNA 4S2KA 3UE1A 4E3NA 1G6AA 3BLSA 4R4SA 5FI6A 3VSKA 4JXSA 4EWFA 1TEMA 2Y2IA 2Y4AA 2EX6A 1TVFA 3CJMA 4DRTA 4XXRA 1MXOA 5CHMA 4OP5A 3AGFA 4X68A 5DF8A 3AGDA 1HZOA 3VOZA 5CEDA 3PBSA 2BG1A 4HEFA 5CXWA 4OLGA 5DVAA 5IHVA 4JBFA 1KVLA 4B4XA 2ZM0A 3NY4A 1C3BA 1K57C 3W8KA 1IYPA 3GRJA 4R3BA 2BLSA 4KZ6A 1TDGA 3N8SA 2G2UA 3G35A 4WYYA 5FASA 2EX2A 5HL1A 3IF6B 1IEMA 3PBRA 1H5XA 4F94A 3CMZA 4DE1A 2J7VA 4R4RA 5A92A 1W7FA 2B5RA 1M40A 2ZD8A 1PIOA 1IELA 4GB7A 1FOFA 4BL2A 1WYBA 3WS2A 1K54A 3LY4A 1ALQA 3A3JA 3W4QA 1VM1A 1XGJA 5EE8A 3M2JA 1LHYA 3MZDA 3O86A 2EFUA 2WGWA 4OQGA 1FCOA 1MBLA 3RXWA 3BFCA 5GHYA 4JLFA 2WAEA 5J8XA 2HP6A 2JE5A 1I2SA 1ZG4A 4KG2A 2CC1A 4Y0TA 1IYQA 3G31A 5KZHA 3O87A 4DDYA 3ZNYA 4Q8IA 1Y54A 4S2OA 4S2PA 2Y55A 3QHYA 3N8LA 4OPYA 3GQZA 1YLYA 1ZKJA 4U0XA 3FKWA 3TG9A 5CHJA 5FQIA 3W4PA 5TFQA 3FV7A 2EXBA 3A3FA 2QZ6A 3IF6A 4LENA 4X56A 4FH2A 3S1YA 3C7UA 3PTEA 4OOLA 3N7WA 4FCFA 1NYYA 4B4ZA 1RP5A 2ZJ9A 3IXHA 3O88A 3UPNA 3ZG8B 4E6WA 5HFOA 1MWTA 1XA1A 4RX3A 2UWXA 5G18A 1XXMA 4RVAA 4WMCD 4ZBEA 5CGWA 4KQQA 4BD1A 3NBLA 5EOOA 4EBLA 3EQUA 1ESUA 4PM7A 1ONGA 4L0LA 1SDEA 3N4IA 4GZBA 1BZAA 4OPZA 4UA9A 5FQMA 2X02A 1K55C 1CI9A 4KZBA 4N9KA 2ZQ7A 2WADA 2V2FF 4YFMA 4LV0A 2P9VB 3FZCA 5FQJA 1NRFA 5TGFA 3N8RA 3LO7A 3OPLA 1KGEA 3PBQA 1TDLA 2A3UA 5A93A 2PU2A 1LL9A 1QMEA 1S0WA 3A3IA 4GD6A 2WAFA 1RCJA 4S2IA 3V5MA 1KVMA 3BFEA 3C4PA 2ZQCA 4MNRA 3RJUA 5JYOA 4M3KA 1PW8A 4Z9QA 5E2FA 3SH9A 3NI9A 1E4DA 4C3QA 3BFGA 4FD8A 2H5SA 4DF6A 4GN2A 5DF9A 5HARA 4XUZA 3BYDA 3UE0A 3LCEA 3A3EA 2Y2PA 2ZM8A 3G34A 3Q7ZA 5TR7A 3WS1A 4ZAMA 1XPBA 1EI5A 5CTMA 1YLWA 5FATA 4LV2A 5DTKA 2WZZA 5M19A 2XGNA 1S6RA 2JBFA 3D4FA 1PW1A 3HLCA 4E3MA 2ZQDA 1W8QA 3ZGAB 3C5AA 5DTTA 2Y2MA 1IKGA 2Z2LB 5AQ9A 1PWDA 2ZC7A 2V20A 4LCLA 1MWUA 2Y59A 2VGJA 1KGFA 1N9BA 4GDBA 5U47A 1XX2A 1Q2QA 5BOHA 4QY5A 5EVIC 5HW3A 1YLJA 1ZG6A 2XEPA 5JYPA 5GLCA 4DXCA 4RYEA 3V3SA 1WYCA 2Z2MB 4P0MA 5D3OA 5EUAA 3G2ZA 1JWVA 3ZFZA 1I2WA 1LL5A 3RXXA 2A49A 1LLBA 3TOIA 1GA0A 2XK1A 3MKEA 5DTSA 4UA6A 3I7JA 4BLMA 4EBPA 4EV4A 4U3TA 3HLWA 1K6SA 2C6WB 1HD8A 1FR6A 3HUMA 1PZOA 2RL3A 3VMAA 1XP4A 4WELA 4PM6A 4WMCA 2Y2OA 1BLCA 1GHIA 1FQGA 3LEZA 5M18A 3GMWA 2R9WA 1RGZA 1NY0A 5EVID 5FQQA 1K4FA 1K54C 2J9OA 4S2LA 1EWZA 3GR2A 3SH8A 3OPHA 4FSFA 4MBHA 2IWBA 2ZQ8A 4LV1A 4CJNA 3MZEA 2WKIA 1JWZA 1QMFA 1PI5A 5M1AA 4D2OA 2X01A 3UPPA 2ZC6B 1BTLA 3G2YA 3MXSA 4KZ7A 1H8ZA 4K91A 2PU4A 2QMIA 3A3DA 2ZC3B 3SS3A 3ZHHA 4E3LA 1BT5A 3BFFA 3MZFA 3UO9A 1E3UA 5CGXA 3IH9A 1JWPA 3PBOA 3SOIA 3HUNA 4OQIA 2H0TA 1NJ4A 1XKZA 5FQKA 5F83A 4OPQA 5CGSA 3QNCA 1H8YA 3PBTA 4CPKA 4KZ3A 4JXVA 4RX2A 4IEDA 4JXGA 1KE0A 1GHMA 2WK0A 3MXRA 5HAPA 3NC8A 5EECA 4ZDXA 2WGVA 4OOMA 1XGIA 1YMXA 5AQAA 5GLBA 2HDUA 4DE0A 4OH0A 5KSHA 1NZOA 4BQMA 2RCXA 3IQAA 4XUXA 2HDRA 2HDQA 4DXBA 4K0XA 4WEJA 4YINA 3ZG9B 2H10A 2WUQA 5FDHA 2EX9A 3BECA 3C7VA 3PAEA 2ZQ9A 4O7DA 3CZDA 1ONHA 5GHXA 2XD1A 1K38A 1K56D 1AXBA 2I72A 1JTGA 3GV9A 2E8IA 3HREA 4GDNA 4X53A 1O7EA 2FFYA 2ZC5B 4UHUA 4LCMA 3UN7A 3UNWA 1K55A 3P98A 1CK3A 3HBRA 3IH8A 1J9MA 3BLMA 3IWQA 3HLDA 4DDSA 4DE2A 1W79A 4OOYA 1JTDA 4X55A 5GL9A 1K57A 4P85A 2ZM2A 4KG6A 4R23A 1MPLA 2R9XA 2Q9NA 4JKTA 4OONA 4JF5A 4Y7PA 4QD4A 3ZVWA 1IYOA 3VSLA 2DCFA 1IYSA 2Y2JA 3IXDA 4GNUA 2OV5A 1MY8A 5FAPA 1U60A 2C5WB 3Q7VB 1YLTA 5GHZA 2HPBA 5GLAA 4EQIA 5KSCA 5FAQA 3UDXA 2Y2HA 5EVIB 3WS5A 1YT4A 3HLFA 4E6XA 2H0YA 4PPRA 1KDWA 1MWRA 4KQRA 1K6RA 3V3RA 1BUEA 1YM1A 1K25A 3NDEA 5E2HA 3DW0A 4A5RA 2WZXA 1RGYA 3LY3A 4BL3A 4Y0OA 3HL9A 3DWZA 4JPMA 1DY6A 2Q9MA 3BM6A 3M6BA 4HESA 1K4EA 1ZC2A 1L0GA 3VP3A 2XLNA 1ES2A 4X6TA 4ZJ2A 3Q7VA 5FSRA 5AQBA 4PM5A 1PWGA 4E3OA 3IHAA 3UE3A 5FI7A 3VOYA 4NK3A 3C4OA 4K0WA 5CHUA 4KZ8A 4BENA
chains in the Genus database with same CATH superfamily
2HP5A 1E25A 3EQVA 4KUKA 3ZNTA 3REKD 4LV3A 3PAGA 3IWOA 1P3AA 1P9RA 1VQQA 5L09A 3KUYB 3W99B 1E6PA 4Y0UA 1P3PD 5HAQA 1EW0A 3WTPA 1TAFB 5B24A 4I38A 1I5QA 4N9LA 5CPJD 3X1TD 1ID3D 5B1MB 4Z66A 1U35B 1HLUP 4WEKA 1BH8A 4AWLB 3DWKA 4GJ4A 4IBRA 4H9PB 4KZAA 4C75A 4E3IA 1BSGA 4LRZE 5HWTA 5B31C 1PZRA 4JJNC 1K0KA 4HIAA 4BJPA 3W96B 2WGWB 3S22A 1SHVA 4FTXA 1MKIA 1NYMA 1YUEA 2OWJA 2W8SA 3CHWP 3EGXC 2BYMA 5B31A 4JXWA 2NZDA 2V0WA 3T12B 4J8UC 5L2FA 2WYXA 3ZCZA 1FR1A 1ZHHB 1H3OA 2FJ7B 3H0RC 4Z2JA 4QJGA 1YU3A 3S7OA 2G5IC 3S4XA 1PNEA 3AZGD 4WV4B 4MMNA 4Q0HA 3IP4C 2OSUA 5AY8C 5EPHA 4QU3A 4XT2B 4J8XA 2Z6CA 3LELB 4G3WA 3W99A 3JPUA 4WLAA 3KUYA 2GDNA 3KXBA 1HTZA 1YMSA 2D02A 3VFHA 5CPIC 5F99D 2Y2NA 3LELC 4UA7A 2F8NG 5FI2A 1A0KA 1KE4A 5AVCC 1S32D 3P09A 1CI8A 1T3UA 5AQ7A 4R70A 4OQHA 1XA7A 4WU8A 2XD5A 3QP1A 5AV9B 1P34A 3AZFD 5E2EA 1KGGA 3AZKD 4N92A 1T18A 1P34B 4S2JA 5FUGA 5EVIA 1OGBA 2CV5B 3RFBA 5LBRA 2P74A 3UTAD 5KMWA 1EQZC 1YQSA 2Y91A 5HX9A 4E04A 5DNMC 2HIOC 3WAAD 3WRZA 2NZDD 3HSHA 5GT3D 5CTNA 3MGSC 1NZUA 3JYIA 4WM9A 3IS2A 1FCMA 4EUVA 4F3LB 4EBNA 3GSGA 1KOUA 4XT2A 3ITBA 2IOUA 4X69A 2YFWB 4DN0A 4IBEA 4LRXC 5CPID 4Y17A 3IS2B 1NXYA 1G68A 3LIEA 4MEZA 3B3XA 1P3OC 5FQ9A 3NIAA 2BYMB 5HDDA 3IXGA 5BT1C 3GTCA 3OZHA 2J8YA 1ES4A 2BYKB 1S32A 5AV6C 3W96A 3EPHA 1BLPA 3UTAB 5FA7A 1MKMA 3FYZA 2HV1A 4YS3A 2Y2LA 1P3MC 4M6BA 2PYRA 3CLOA 4CAYB 3ISGA 1XJ4A 3OCNA 3PXPA 2HJEA 4S2KA 3VSKA 2IA2A 3LZ1A 4QLCB 5BNVA 4JXSA 4LG2A 1TEMA 4WF0A 4X23D 4OP5A 3AGFA 5DF8A 1HZOA 5CP6C 1P3BC 4OLGA 4D60A 1KVLA 1XJ2A 3CUEA 3NY4A 1C3BA 1K57C 3GRJA 1M18D 4J8VC 3E4PA 4Y2FA 4H9RA 3AZIB 3NULA 1IEMA 1TS0A 3UT9C 3PBRA 2FN2A 4HQAA 3VE4A 5KDMA 4QLCA 5B2JB 4X23C 1E6NA 1TD5A 3WS2A 1TF1A 1VM1A 2RIQA 5B1LC 3M2JA 4R6LA 3O86A 3LYXA 4OQGA 3BFCA 5F69A 3QP8A 3DTKA 5GHYA 3WX7A 5J8XA 3E4OA 3H0LC 5AY8A 2JE5A 1P3MD 1T1BA 3KO6A 3C1CA 1OPXA 4KG2A 5AVCB 3G31A 5KZHA 1P3OA 4S2OA 3WKJB 3QHYA 5B2JA 4OPYA 3GQZA 1YLYA 4U0XA 3AV1B 4ETXA 1H0IA 5CHJA 3W4PA 4TX8A 2YFWA 4HP4A 3FV7A 2AROC 4OOLA 4H9RB 3AZIA 4B4ZA 2L4RA 3O88A 4E6WA 3TU4D 1P3AB 4WU9B 5GXQB 4RX3A 2UWXA 3RH8B 4ZBEA 4KQQA 4PM7A 3PR6A 4L0LA 3LIAA 4GZBA 3T4KA 4OPZA 5FQMA 2X02A 3VH6T 4WL9A 4KZBA 3AZFC 5FUGB 1UGUA 4CAYA 5E5AA 1P3KD 3AN2D 4LV0A 5FQJA 2AROD 4UPKA 4HGAB 4HH3A 4L9FA 2WAFA 4Z5TB 2HIOD 1FIKA 5JYOA 4B93A 3SH9A 5AV5D 4FD8A 2H5SA 4GN2A 4KUOA 1F66C 3BYDA 5JRGD 3A3EA 4XZQC 3KUYC 5B40D 1OTEA 1W1YA 3B6FA 1EI5A 1YLWA 1P9WA 3B47A 5C3IC 1D1JA 4J8XB 1P3KC 3GECA 5DTKA 5CPKD 5DKLA 1S6RA 1KU5A 3TE8A 5DTTA 3MJQA 3R7WA 4HY8A 4WU8C 1A7WA 5GT3B 1KGFA 1N9BA 2NZDB 4GDBA 3E98A 5FL3A 5B31B 3C1CB 3B0DC 3AZIC 3JVVA 3T1RA 1ZG6A 5GLCA 4DXCA 4RYEA 3V3SA 5IT5A 5B31D 4P0MA 4MDZA 1OT9A 3C8CA 4KGCD 5B24C 3S7QA 5E5AD 2Y79A 3MGRD 5AV9A 2XA7S 1U35A 5B1MA 4Z66B 2OAP1 2C6WB 1N1JA 1FR6A 2PR6A 1PZOA 3VMAA 5B24B 2J8PA 5BNXB 2KLIA 4LLOB 4KUDA 1BLCA 4J8XD 1GHIA 3LEZA 5M18A 3W99D 1RGZA 5EVID 5FQQA 1K54C 3KXBB 3A1KA 3GR2A 3EG5B 3MZEA 3B33A 5DNND 1JWZA 1PI5A 4D2OA 2PD7A 2ZC6B 3MXSA 4K91A 3AYWC 5BNXA 2PU4A 2ZC3B 1GPFA 4MN6A 1BT5A 3MQLA 3WD0A 2CV5D 1H3OB 2PDRA 3PBOA 2LB9A 5AV8C 3HUNA 1S66L 1NJ4A 1ODVA 4OPQA 1B6WA 1UWNX 4Z2HA 4LD9C 3UTAA 1KE0A 1TS7A 2WK0A 2INWA 3AZKC 1S32B 5K5BA 5GLBA 4DE0A 3KWQC 1P3FD 1NZOA 2W0NA 3IQAA 4WJ3C 3VH6A 4ARZB 3T50A 4DXBA 4ZBJB 4H9PA 5GT3A 3NQJB 3AZND 5AJGA 1VEUB 2ZQ9A 3CZDA 5B2IC 5GHXA 4DQYB 4G91C 1K56D 1XJ6A 3TW8A 3LJAC 1K55A 1CK3A 3HBRA 3BLMA 5DNNC 3B6FB 4F3LA 1JTDA 2P08A 2JKGA 4P85A 1P3FC 4X23A 3RELC 4OONA 4JF5A 2VKSA 3ZVWA 1IYOA 3FC7A 1IYSA 2Y2JA 4Z5TA 4ETZA 1MY8A 5FAPA 3UB9A 2CV5A 4M4XA 3UDXA 2Y2HA 5EVIB 4CSRA 3HLFA 3L27A 1GSWA 4ZUXA 4EO5B 1AOIA 3V3RA 1ACFA 1BUEA 1P97A 3DW0A 4WU8B 1BH9A 5BO0A 4JPMA 3M6BA 2XLNA 3AZJD 5HPIA 3W98C 2K31A 3LIDA 4E3OA 3B0DB 3UE3A 4GHIB 4NE5A 4NK3A 1IOUA 5MC7A 5E43A 3R4KA 3AZGC 4I3IA 5DF7A 5EVLA 1P3LB 3KWQA 1SCWA 4J8VD 4OLDA 4H9OA 1L0EA 4YM6D 1VB6A 1YLZA 4KGCB 3MQQA 3Q07A 3AZJC 1NLZA 3NOUC 4CLCE 5A8BA 4GHAA 5JA4A 4R3JA 3AZMA 1P0ZA 1M6KA 3BEBA 4H8RA 4OQ0A 1UWPX 3HUOA 5GT0B 4I3AA 2J3TD 4KG5A 3AZID 2VA0A 1SDNA 3CWFA 5AY8B 2EX8A 2HP9A 1W2EA 4HOIA 1KX4A 4Z2IA 4B88A 4EUZA 4OJPA 1HVBA 3AZLD 4C6YA 5F1FA 2YFVA 3AZFA 3AZHC 4XUJD 3C38A 1CJFA 2G7UA 1BH8B 1W5DA 4H6JB 1ID3C 3ZG5A 1L0DA 1MWSA 5G49B 1TAFA 3FKVA 3OPPA 3WTPB 1BLSA 4OP8A 3REJA 1OMEA 4E44A 4QB8A 3WWXA 3TSGA 1PZPA 3AGEA 3BY8A 3VH5W 4NETA 4WN5A 2NUPC 1W1VA 3CPTB 4IBGA 1CEGA 4LD9A 5B2IB 1EQZD 4WNNB 1HQ3B 1KX5D 4UAAA 4X25A 3Q81A 3X1TC 5GXQD 4IVIA 5B40A 3V50A 5F1GA 3A0VA 3BFDA 3LJAB 3Q1FA 4QHCA 1H0MA 4QY6A 3MGQD 3L29A 5GSUC 2PD8A 1N9OA 2XRNA 5CEBA 2WKHA 2XQZA 3X1SA 4LPZA 4O0PA 2VEAA 3MKFA 4E45A 4MLLA 1ZLAA 2P9VA 2HIOA 5B0YA 3SH7A 2W27A 4ZJ3A 5E2GA 1FCNA 2ZY4A 2M7VA 1GA9A 4S2NC 4J8UD 5F68A 3OPRA 4HBTA 4I3JA 3WTPD 4S2MA 3NQUA 2EA9A 2G2WA 2Y2GA 1N4OA 4Q0JA 2FFFB 4X1LA 1U35C 1HTAA 3OC2A 1TZYA 4P6BA 3B6GB 2VGKA 4KUDC 4K08A 4NE3A 2QPNA 3X1VD 1W63M 3PYPA 4KQOA 1KX5C 4P87A 3IXBA 3PHYA 3AFAB 3ZG7B 2NQBA 3HLEA 3VV4A 2JN7A 3REHA 1JVJA 2ZC4B 3SS4A 3FWLA 3ITAA 4PM8A 1OTDA 2HDSA 3UTBB 3DTIA 4IVKA 4DE3A 3HLGA 1OTIA 2QJ5A 3REHC 3H9WA 3WD4A 3NOPC 3MVDD 3LZ1C 2ZQAA 3QNBA 1Q9CA 5GLDA 1J7MA 1G6AA 4R4SA 4J8UB 2Y4AA 2EX6A 1TVFA 3CJMA 5B32D 3ZYTA 4HMDA 4X68A 5B1LB 3AGDA 3VOLA 3PBSA 5B0ZD 2PYOA 3MGPA 2XSSA 5AV6D 3B0BA 3X1VC 3H7WB 5CP6A 5AV9C 2G2UA 4WYYA 5FASA 2EX2A 3AL0C 5FDSA 5HL1A 3IF6B 3X1UD 1H5XA 3JVUA 4F94A 2J7VA 5AVEA 5CPIB 5A92A 2B5RA 3UTBD 1PIOA 2W3DA 3L2AA 3LR4A 4ZUXC 4KHAA 3REKB 2BTFP 3P01A 3KSFA 2ZY5A 5BT1D 1P3PB 3REHD 3WA9B 2GNXA 3KUYD 2WGWA 1FCOA 1H8PA 1T19A 2WAEA 3T4SA 1I2SA 1YAXA 4YNRA 1IYQA 4R8PB 3ZNYA 4Q8IA 4EU0A 5DNMB 1GSVA 1P3GB 4ZUXD 1DRMA 3FKWA 4GLQA 3AZLB 5IU1A 2QZ6A 4LENA 1P3FB 2QKPA 4FCFA 3AZJA 5J7EA 3UPNA 3F1PB 3AV2A 1MWTA 3LUQA 4NXFA 4WMCD 4BD1A 5EOOA 3EQUA 3B6GC 1M19A 1ESUA 1N9LA 4JJNA 1ONGA 2JHEA 4J8VA 2CWEA 3F1NA 1KX5B 5AV6B 1P3BB 2PHYA 1E8BA 3FZCA 2G5HC 4KQDA 3N8RA 3LO7A 2VV6A 3OPLA 1KGEA 2VX8A 3PBQA 1TDLA 4NYUA 5A93A 4X1MA 1LL9A 2V0UA 1QMEA 4S2IA 1KX3A 1S4RA 4UUZB 2JKFA 2KX6A 2ZQCA 4MNRA 4M3KA 1PW8A 2J80A 5E2FA 3NI9A 3LZ0A 3BFGA 1YU1A 5BS7C 2JKTI 5HARA 3LCEA 3T4TA 1VHMA 2Y2PA 2ZM8A 3Q7ZA 5TR7A 2PBDP 4ZAMA 1XPBA 2ZOIA 4YM6A 1T1AA 4HJ4A 3VH5A 2XGNA 4XUJA 3D4FA 4XZQA 1PW1A 3C1BD 3ZGAB 4YM6C 3C5AA 3CITA 2Y2MA 1IKGA 2Y8HA 1P3MA 4Z2GA 2V20A 2Y59A 4PAUA 3KYZA 5GT0C 2V1BA 2W1TB 1OGGA 3A6NA 3NOTC 2J3WA 5BOHA 4YOFA 4Z66D 1YLJA 5B2JD 3AV1C 2XEPA 3NJAA 5B0YC 3AZEC 5CPJB 1WYCA 1NWZA 1S67L 5D3OA 3AV2C 3MGRB 5EUAA 4B9OA 3DBAA 3FG8A 3ZFZA 3RXXA 2A49A 1LLBA 3EOIA 4Q0IA 5CX7A 2XK1A 4YWZA 4UA6A 3AYWB 4UEYA 3I7JA 3MGSA 3F6TA 5DJTA 1SKOA 1K6SA 1YSQA 5JRGB 1GOIA 3D9YA 2ZL1B 5B2ID 1EQZB 4QWOA 2ZOHA 3HJKA 3X1SD 4Y5FA 2R9WA 1NY0A 3FDDA 3BWLA 4S2LA 3SH8A 2VLGA 4EETB 2H28A 1QMFA 5M1AA 2VV7A 4WU9C 1BTLA 3G2YA 4HMCA 3ZHHA 4E3LA 3C1BA 3MR0A 3MZFA 1HQ3D 3WA9D 1F66D 3SOIA 2Z6DA 5TBMB 4OQIA 1XKZA 5FQKA 2E8JA 1F66B 5CGSA 2HF6A 3QNCA 1W63Q 2V5OA 4BBVA 4JXVA 4IEDA 3A6ND 1F9IA 5EECA 4OOMA 1XGIA 3MNNA 1YMXA 3BQ8A 3A0SA 4HGAC 4OH0A 3KSYA 2RCXA 5DJUA 5CPKA 4XUXA 3UTAC 1TS8A 2HDRA 4K0XA 1R4VA 3AYWD 3MNNC 2PYOC 5CHLB 1AIWA 2P04A 4GW9A 4EXOA 4UQIM 3CUEC 3UMEA 1AXBA 3AN2A 5AV8D 1JTGA 5GT3C 1LT0A 4HH2A 3WD2A 3HREA 3FKEA 4GDNA 1O7EA 2ZC5B 3UN7A 3UT9A 4LCMA 4UHUA 3UNWA 4NZ1A 3IH8A 3IWQA 4HHDA 2NQBD 2L1MA 2DF4C 5GL9A 3MGPC 3IX8A 5B33D 5B32A 5KIZA 1MPLA 2R9XA 4JKTA 4CLCA 3MSHA 2DCFA 3IXDA 1TS6A 4GNUA 5G4YA 2VQRA 2ACGA 2C5WB 3Q7VB 5GLAA 2HPBA 3MVDA 4EQIA 5KSCA 1GXDA 5FAQA 1P3LC 3V9RB 3C1CC 2K2NA 1YPRA 5F99B 4ESPA 3X1UA 4J8WB 3W98A 3MVDC 4A5RA 3W96D 3QP2A 4Y0OA 2NQBC 3HL9A 4II7A 2Q9MA 2PYPA 1G5UA 5FSRA 5AQBA 5F99C 1W1PA 3IBRA 3IHAA 5FI7A 3C4OA 4K0WA 4KZ8A 3W97C 2O99A 4ZJ1A 4GS9B 2HJ9C 3VP0A 5B40C 2F8NH 3ZG0A 4Y13A 1ES3A 3E2LA 3MS6A 2OLUA 1PWCA 5C5KA 5A90A 4KZ9A 3W97B 2WKEA 1DJCA 2F8NA 1M18A 2EXAA 2ZMAA 3HLBA 3HVFA 3CG5A 4DMZA 3AZNB 1PDCA 5GXQC 1EQZA 1KDSA 5CERA 3WTPC 1BULA 4I5SA 5AV8B 1CF0A 4DRAA 4IJGA 3REIB 2IWCA 2KOIA 1PYYA 3MGQB 4H9NB 3H82A 3RELA 1IKIA 1DJAA 1LI9A 4R8PC 4WBGA 3F1OB 4EERA 4FUWA 4IBXA 1ID3A 1D7EA 4RA7A 1Y28A 1KX4C 3BRMA 3IF5A 1PFLA 4ZBJC 4N1HA 1ESIA 5L10A 3EEAA 2XH9A 4OJ6A 2F8NK 4GD8A 1P3OD 3WAAB 1AOIC 5GSUB 1ERQA 1T1CA 2F8NB 3K3DA 4ZTKA 4PMAA 3G30A 4XZQB 2W3GA 2O0YA 3B6FC 2DRWA 1P3KB 3TRCA 3AZKA 4H9QA 5FEFA 3LIFA 1K56A 1SKFA 3NCKA 4U0TA 2ZMVA 3WRTA 3NECA 2EWVA 2YKHA 2QWSA 4JF6A 3UB5P 2V9AA 3KSGA 2J3TC 4O8GA 2OLVA 3WS4A 1WE4A 3UY6A 3UDFA 5FAOA 3KX0X 3BW6A 3KXBD 1Z09A 4OJLA 1KX3D 3LR3A 4P6ZS 5B1MC 5B32G 5HDCA 4DKIA 1GCEA 3VFFA 3SS5A 3IT9A 3L9KA 1KE3A 4OPRA 4R3AA 4J8VB 4JJNB 4NG2A 3UPOA 4BD0A 1UR8A 5I94A 5B0ZB 5AVBB 3OLOA 4JF4A 4S2NA 3MF0A 1DP9A 3E2KA 4OKPA 4XZQD 3S7NA 4HBUA 4QPRA 3VP1A 4KZ5A 1MC0A 1P3IA 1P3IB 1KX3C 5HAIA 3ZDJA 3DTMA 3MGPD 1V9YA 5HWVA 3W4OA 4WZ5C 3LZ0C 4L9EA 2PBYA 3G4PA 3VP4A 2JCHA 2XR0A 4BWIA 4R0QA 3VE3A 1S4SA 1P3BD 1M1AA 1ID3B 2GX5A 4NXBA 3IHBA 3F1OA 5CPKB 1GHPA 3KYQA 3AFAD 3PBNA 4KENB 4IJEA 1O07A 2HUEB 4AFIA 3IF6C 5J4EA 3T4OA 5F82A 2UV0E 2DNSA 2F2AC 3AZHB 1ES5A 4MB4A 3BY9A 5AV5B 3UE1A 4E3NA 3LI8A 5FI6A 2O9BA 4HI4A 2YKFA 1W1TA 2QJ7A 5TJJA 3REIC 4DRTA 1MXOA 4LFUA 1P34C 5CHMA 1P3GD 1U35D 5CEDA 3KFUG 4B4XA 4JBFA 3ICYA 4GH9A 3LI9A 2IO5B 3W8KA 4KUDD 4KZ6A 3A0RA 2ZY3A 3H7WA 4IUKA 2XROA 3P5JB 2JSSA 4WUJA 4DE1A 5DNNA 5B1LA 1W7FA 1M40A 2ZD8A 3H0MC 4GB7A 4NE6A 1FOFA 4IBKA 4BL2A 3DAVA 4J8UA 1WYBA 3LY4A 3W4QA 1XGJA 5EE8A 1F98A 3MZDA 2EFUA 5DFXA 1MBLA 3X1UB 4JLFA 4R8PD 4H9NA 4NXEA 4EQ1A 1ZG4A 2BASA 4XUJC 4I39A 4DDYA 3X1UC 1Y54A 5AV8A 3N8LA 5FEGA 5B32B 3AZNA 3TG9A 1P3MB 1OT6A 1VETB 4IJFA 5EM0A 5TFQA 5AY8D 2EXBA 1M18C 5B0YD 4HJ6A 4X56A 4FH2A 5B33A 3C7UA 3PTEA 3W97A 1RP5A 3AZEA 3IXHA 5G4ZA 3ZG8B 2I9VA 3LICA 3B6GA 2AROA 1TZYB 1XXMA 5G18A 5HZHA 5CGWA 4OJ5A 4JGRA 2ZMFA 4WU8D 1TZYD 4EBLA 1JFIA 2JKRM 2W3HA 4EEPA 5B1LD 4ZRRA 3X1VA 1KX3B 1CI9A 5AV5A 4Z66C 3AZHA 2ZQ7A 2V2FF 4YFMA 3R45B 4QNLA 2P9VB 1NRFA 5HSQA 2A3UA 1UR9A 3X1VB 3KSHA 3E0YA 1Z2CB 3A3IA 4NZ4A 5TBMA 3ULFA 3V9RA 1RCJA 3V5MA 1KVMA 4EEUA 3BFEA 1JFIB 3C4PA 3UMDA 3C30A 4Z9QA 1E4DA 4DF6A 5B40B 1P3KA 3UE0A 5HD5A 3NHQA 3E4QA 3G34A 3REKC 3AZEB 1YSPA 5CTMA 5FATA 3AV2B 4LV2A 1BYWA 2WZZA 5M19A 5B33B 3S7PA 3REJC 1ED7A 1VETA 4E3MA 2ZQDA 1W8QA 1PRQA 3U4LP 1F2KA 5L8MA 5JRGA 3MQOA 1MWUA 3REJB 4NZ3A 3AN2B 5B0ZA 2PYOD 2VGLM 3B6GD 2VGJA 4IBIA 2L5AA 1HQ3C 5U47A 1P3AC 3X1TB 1Q2QA 4NFTA 5HW3A 1B67A 2CMNA 5EM1A 5JYPA 5DFYA 3AN2C 2Z2MB 5B31G 2W3FA 3G2ZA 1I2WA 1KX4B 2JKTM 3B42A 3TOIA 4WU9D 4NZ5A 4JGOA 4EBPA 1WA9A 3HLWA 2RL3A 5DNNB 1KS0A 3B0CW 1XP4A 1P3GC 4LRYC 4WMCA 3C1BB 2A24B 4GCZA 4H9QB 4Z5TC 1K4FA 2J9OA 2PR5A 4XUJB 3REJD 3OPHA 5AV9D 2ZQ8A 4LV1A 4CJNA 4IBDA 3C1BC 2A24A 4NEED 3UPPA 2QMIA 3SS3A 2RVQD 3BJNA 2PYOB 4EO5C 5HDSA 3BFFA 3WD1A 2RTSA 4GHIA 4UUZA 5CGXA 5AVCD 1JWPA 3IH9A 2D01A 3W2ZA 3U2AA 2H0TA 1H8YA 3W98B 3W99C 3PBTA 3LGOA 3C1CD 4KZ3A 3AV2D 2O9AA 3D72A 4JXGA 4RX2A 3OBFA 5HAPA 3NC8A 2WGVA 3CAXA 5B24D 4JGQA 5AQAA 4IBFA 3MGQA 5KSHA 5CPJA 3X1TA 3LR0A 3REIA 4YINA 1M19B 3BECA 5F5YA 3L28A 1ONHA 5DKKA 4Y3IA 3GV9A 3EPKA 1P3LD 1M19C 4HMEA 3AZJB 2E8IA 4Z2MG 1P3FA 4X53A 2FFYA 3UT9B 3VH6W 3P98A 4DE2A 5E5AC 1W79A 3MGRC 1K57A 4YM6B 2ZM2A 4R23A 3SZTA 2RVQC 2Q9NA 2K7SA 1P3GA 4GS9A 4Y7PA 4QD4A 3VSLA 5HPFA 3GDIA 4DJ2A 3NQJA 1AWIA 1YT4A 4E6XA 4MB3A 2H0YA 5B0YB 3R45A 3IX4A 1KDWA 1WWSA 1YM1A 3NDEA 4J8WA 1P3PC 2PT7A 5F99A 2WZXA 1RGYA 4BL3A 3F1NB 4G92B 3DWZA 5L07A 1L0GA 3BM6A 1ZC2A 4MCWA 3RELD 1ES2A 4ZJ2A 3AZNC 3Q7VA 4PKYA 4PM5A 1PWGA 5EFWA 4IBJA 1E88A 3VOYA 5CPIA 5JRGC 1S32C 3AZKB 2AROB 5CHUA 4BENA 3UB7A 4IBBA 2VJWA 3GVBA 3Q82A 3RTYA 1BLHA 2GJ3A 1HQ3A 3MGQC 4DJ3A 3F1PA 2MJ6A 3CPTA 1XFQA 1Q2PA 3AZLC 3K2NA 5GSUA 1CEFA 4N1XA 4G91B 1IFQA 2WGIA 4KZ4A 4MBFA 1KX4D 3WAAA 2VGLS 3SW1A 4NY2A 2IWDA 4CQHA 3MNND 3AZLA 3WS0A 3G32A 1F1EA 3MMHA 1STZA 3O5YA 2QYBA 3MGSB 3WAAC 4ME4A 4BBTA 5DNMA 3UB6A 2W1RA 2Y2QA 3W97D 1GSXA 4R8PA 3AZED 2D49A 3D3OA 3RELB 3KYEA 1O6IA 3H82B 3MGRA 2ZLYA 4H9SA 3N6IA 4MBKA 1H0GA 3VP2A 2XDMA 2X71A 3A6NB 5CRFA 3WA9A 2J9PA 1F66A 3HCYA 4QLCC 4MB5A 2W1TA 3LELD 4DRBA 3BQAA 4KHAB 3REKA 4WZ5A 1S1YA 2R78A 1L2SA 3UE6A 4IUHA 4J8XC 2XFTA 1FSWA 1NLYA 4GOGA 1M18B 2M1CA 2EFXA 4AWLC 4O01A 1G28A 2FJ7D 2Y2KA 4PM9A 2AVXA 3M7PA 1F5MA 4OVDA 2DQNC 1PI4A 3L7HA 3QP4A 3LZ1D 3W96C 3MBZA 3NDGA 1EROA 3MGPB 1Y4OA 2XFSA 4YS3C 1P3ID 4GKUA 3OCLA 4WZ4A 1DJBA 1X0OA 1XJ3A 5IS1A 3V39A 4EW7A 3B0CT 5A91A 4E3JA 5BO0B 4JJND 1P3BA 1M1AD 1SZVA 1Z6FA 1FSYA 3MVDB 1M1AB 3LJAA 1LI0A 4QLCD 5EOEA 2JC7A 1YLPA 4R1GA 3M2KA 4RQ9A 4NXGA 3MFDA 4FH4A 3T4QA 2Q0OA 3M6HA 1E3UD 3OOVA 4WU9A 2QHKA 4ID4A 2HUEC 3T4LA 1YKDA 4MN7A 1L0FA 1H3QA 3O3VA 5AVBA 1ULYA 3WKJC 4HP9A 3MQ0A 3O62D 3ZVTA 2W3EA 1P34D 3WKJA 1AOID 4E3KA 3AZFB 2YFVB 1ERMA 2V1ZA 5CECA 2F8ND 1EAKA 2XF3A 2LY8A 3B6FD 1W8YA 3UDIA 5AV6A 1CXWA 1H8MA 3IWIA 3G6OA 5GT0A 4MN5A 1E6RA 3DTEA 5J3WA 3BLSA 4EWFA 2Y2IA 5HD3A 3T4JA 5KDMB 1WWIA 4XXRA 2FH5A 5HWWA 2VZWA 3VOZA 3MGSD 2HZ5A 2BG1A 4HEFA 5CXWA 5IHVA 5DVAA 2ZM0A 2B18A 5B2IA 1IYPA 4R3BA 2BLSA 4EESA 1TDGA 3N8SA 4Y15A 2O9CA 3G35A 2ZY2A 4FOFA 3CMZA 4R4RA 4NYYA 4KUDB 1SKOB 5G49A 1IELA 3L25A 2NZDC 2OWHA 5B32C 1OJGA 3LR5A 1K54A 4G3KA 1ALQA 5BNVB 3A3JA 5CP6D 5C3IB 3QP6A 1OTBA 4OUIA 1LHYA 4WZSB 3C2WA 3RXWA 3LEQA 3AFAC 4YS3B 5EVEA 4CSRB 2JKRI 2HP6A 3AZHD 4HNBA 4R38A 3UTBA 2CC1A 2A2LA 4Y0TA 3O87A 2V8CA 4J8WC 1P3PA 1QO6A 3P7NA 3REHB 5AVFA 4S2PA 2NQBB 2Y55A 5GT0D 1JNUA 1LL8A 1ZKJA 4HJ3A 5F6AA 4X23B 3TJZC 5B0ZC 5FQIA 2FJ7C 2PAVP 1M19D 4KGCA 2WKRA 2B02A 3A3FA 3IF6A 3S1YA 3QP5A 4H9OB 3N7WA 5CPKC 1NYYA 2ZJ9A 2XA7M 2GZAA 5HFOA 3UT9D 1LSVA 1XA1A 5HL6A 4Z2KA 4LGWA 4GHLA 4RVAA 3NQUB 3WTPE 3LZ0B 1NRJA 3UB8A 1VEUA 5AV5C 3NBLA 1SDEA 3N4IA 4ARZA 1BZAA 4UA9A 1K55C 2KDKA 5GSUD 4N9KA 4Z1WA 3HONA 3AZMC 2WADA 2P7JA 4G92C 2IO5C 5TGFA 4L9GA 2VV8A 4CLCC 1CK7A 2PU2A 4ZUXB 3EEHA 3T1SA 1BFMA 1E15A 4BMWA 1S0WA 1ZTUA 4GD6A 4H9SC 3N3FA 2OOLA 5DNMD 3RJUA 3V67A 3EGDC 4C3QA 4G3VA 3LIBA 4NKPA 4CLCB 2L0WA 5DF9A 4XUZA 4WNNA 1N9NA 3WS1A 3AFAA 4LD9B 3HJIA 4Z5TD 2V8FA 1G6OA 2JBFA 2M7UA 3MFXA 2ZBBA 3LELA 3HLCA 4IHQA 3LZ0D 2OAQ1 2Z2LB 3O62C 5AQ9A 1PWDA 3T1XA 2ZC7A 1OTAA 4LCLA 3WD3A 1N1JB 3AV1A 2FJ7A 2PRFA 1XX2A 2LB5A 3X1SC 1L6JA 1P3OB 4QY5A 5EVIC 3A1IA 3MNNB 5AVCA 5EV0A 2WKQA 3T1QB 1ZLAB 1YU4A 3A6NC 1JWVA 4PHTA 1LL5A 3X1SB 3CI6A 3KWQD 1GA0A 1S1ZA 3MKEA 5DTSA 4BLMA 2VK3A 4EV4A 5JA4B 1E6ZA 4U3TA 1ZLAC 1HD8A 1TZYC 3HUMA 3REID 3EPJA 4WELA 1L3LA 4PM6A 2Y2OA 1DP8A 1FQGA 3GMWA 2B95A 3AZMD 1V9ZA 4Z2MH 5CP6B 3FPWA 1EWZA 5AVBC 4FSFA 4MBHA 2IWBA 1MZUA 1P3LA 2WKIA 3VH5T 4JGPA 2X01A 4KZ7A 1H8ZA 2ZL1A 3A3DA 4YS3D 1P3IC 3UTBC 3UO9A 1E3UA 3EPLA 4H6JA 3ZQ5A 3AZGB 3AYWA 3KSIA 1BH9B 3LZ1B 1DP6A 5B2JC 3AV1D 1D06A 5F83A 1LSXA 4CPKA 3LJAD 3MXQA 3KXBC 1GHMA 5AVBD 1FILA 3MXRA 1M1AC 5E5AB 4ZDXA 4KGCC 3KS8A 3O62A 2HDUA 5B1MD 5B33C 4BQMA 4UQIS 2BYKA 2HDQA 3K3CA 5I5LA 4WEJA 4J8WD 1LSWA 3ZG9B 2H10A 2WUQA 5FDHA 2EX9A 2EWWA 3C7VA 3PAEA 5CPJC 4O7DA 2V1AA 3AZMB 2XD1A 3L26A 4IBCA 1K38A 2DMWA 3TU4B 1P3AD 2I72A 2WKPA 2HGVA 5GXQA 3R7WB 3IBJA 4PKYG 1J9MA 4DDSA 3HLDA 3TU4C 4OOYA 4X55A 3EWKA 3KWQB 4BBUA 2NUTC 4P6ZM 4KG6A 3WKJD 3W98D 1ZLAD 3TU4A 2CV5C 3WA9C 2OV5A 1U60A 1J3WA 1YLTA 3FPVA 4OJOA 3IX3A 2HIOB 5GHZA 5BS7A 3WS5A 1OJ5A 4LD9D 1CQAA 1XFNA 4PPRA 2ZM5A 5BPVA 1MWRA 1YU2A 3LFVA 1K6RA 1KX5A 3O62B 4KQRA 1K25A 4CLCD 5E2HA 4Z2LA 1AOIB 3LY3A 1DY6A 2FZ0A 3VP3A 4HESA 1K4EA 4X6TA 3KS4A 3AZGA 1YU0A
chains in the Genus database with same CATH topology
2HP5A 1E25A 3EQVA 3ZNTA 3REKD 4LV3A 3PAGA 3IWOA 1P3AA 1VQQA 3KUYB 3W99B 4Y0UA 1P3PD 5HAQA 3WTPA 1TAFB 5B24A 1I5QA 4N9LA 5CPJD 3X1TD 1ID3D 5B1MB 4Z66A 1U35B 4WEKA 1BH8A 4AWLB 3DWKA 4IBRA 4H9PB 4KZAA 4C75A 4E3IA 1BSGA 5B31C 1PZRA 4JJNC 4BJPA 3W96B 2WGWB 3S22A 1SHVA 1MKIA 1NYMA 1YUEA 2W8SA 2BYMA 5B31A 4JXWA 2NZDA 4J8UC 5L2FA 2WYXA 3ZCZA 1FR1A 1H3OA 2FJ7B 3H0RC 4QJGA 1YU3A 2G5IC 3S4XA 3AZGD 4WV4B 3IP4C 2OSUA 5AY8C 5EPHA 4QU3A 4J8XA 3LELB 3W99A 3KUYA 2GDNA 3KXBA 1HTZA 1YMSA 3VFHA 5CPIC 5F99D 2Y2NA 3LELC 4UA7A 2F8NG 5FI2A 1KE4A 5AVCC 1S32D 3P09A 1CI8A 1T3UA 5AQ7A 4OQHA 1XA7A 4WU8A 2XD5A 5AV9B 1P34A 3AZFD 5E2EA 1KGGA 3AZKD 4N92A 4S2JA 1P34B 5FUGA 5EVIA 2CV5B 2P74A 3UTAD 5KMWA 1EQZC 1YQSA 2Y91A 5HX9A 5DNMC 2HIOC 3WAAD 3WRZA 2NZDD 3HSHA 5GT3D 5CTNA 3MGSC 1NZUA 3JYIA 4WM9A 1FCMA 4EBNA 3GSGA 3ITBA 2IOUA 4X69A 2YFWB 4IBEA 5CPID 1NXYA 1G68A 4MEZA 3B3XA 1P3OC 5FQ9A 3NIAA 2BYMB 3IXGA 5BT1C 3GTCA 3OZHA 2J8YA 1ES4A 2BYKB 1S32A 5AV6C 3W96A 3EPHA 1BLPA 3UTAB 5FA7A 3FYZA 4YS3A 2Y2LA 1P3MC 4M6BA 4CAYB 3ISGA 3OCNA 4S2KA 3VSKA 3LZ1A 4QLCB 5BNVA 4JXSA 4LG2A 1TEMA 4X23D 4OP5A 3AGFA 5DF8A 1HZOA 5CP6C 1P3BC 4OLGA 1KVLA 3NY4A 1C3BA 1K57C 3GRJA 1M18D 4J8VC 4H9RA 3AZIB 1IEMA 3UT9C 3PBRA 5KDMA 4QLCA 5B2JB 4X23C 3WS2A 1VM1A 2RIQA 5B1LC 3M2JA 3O86A 4OQGA 3BFCA 5GHYA 3WX7A 5J8XA 3H0LC 5AY8A 2JE5A 1P3MD 3C1CA 4KG2A 5AVCB 3G31A 5KZHA 1P3OA 4S2OA 3WKJB 3QHYA 5B2JA 4OPYA 3GQZA 1YLYA 4U0XA 3AV1B 5CHJA 3W4PA 2YFWA 3FV7A 2AROC 4OOLA 4H9RB 3AZIA 4B4ZA 3O88A 4E6WA 3TU4D 1P3AB 4WU9B 5GXQB 4RX3A 2UWXA 4ZBEA 4KQQA 4PM7A 4L0LA 4GZBA 4OPZA 5FQMA 2X02A 3VH6T 4KZBA 3AZFC 5FUGB 4CAYA 5E5AA 1P3KD 3AN2D 4LV0A 5FQJA 2AROD 4UPKA 4HGAB 2WAFA 4Z5TB 2HIOD 5JYOA 3SH9A 5AV5D 4FD8A 2H5SA 4GN2A 1F66C 3BYDA 5JRGD 3A3EA 4XZQC 3KUYC 5B40D 1EI5A 3B6FA 1YLWA 5C3IC 5DTKA 4J8XB 1P3KC 5CPKD 1S6RA 1KU5A 5DTTA 4WU8C 1A7WA 5GT3B 1KGFA 1N9BA 2NZDB 4GDBA 5B31B 3C1CB 3B0DC 3AZIC 1ZG6A 5GLCA 4DXCA 4RYEA 3V3SA 5B31D 4P0MA 4KGCD 5B24C 5E5AD 3MGRD 5AV9A 1U35A 5B1MA 4Z66B 2C6WB 1N1JA 1FR6A 3VMAA 1PZOA 5B24B 2J8PA 5BNXB 4KUDA 1BLCA 4J8XD 1GHIA 3LEZA 5M18A 3W99D 1RGZA 5EVID 5FQQA 1K54C 3KXBB 3A1KA 3GR2A 3EG5B 3MZEA 5DNND 1JWZA 1PI5A 4D2OA 2ZC6B 3MXSA 4K91A 3AYWC 5BNXA 2PU4A 2ZC3B 1BT5A 2CV5D 1H3OB 3PBOA 5AV8C 3HUNA 1NJ4A 4OPQA 1B6WA 4LD9C 3UTAA 1KE0A 2WK0A 3AZKC 1S32B 5GLBA 4DE0A 3KWQC 1P3FD 1NZOA 3IQAA 4WJ3C 3VH6A 4DXBA 4ZBJB 4H9PA 5GT3A 3NQJB 3AZND 2ZQ9A 3CZDA 5B2IC 5GHXA 4DQYB 4G91C 1K56D 3LJAC 1K55A 1CK3A 3HBRA 3BLMA 5DNNC 3B6FB 1JTDA 4P85A 1P3FC 4X23A 3RELC 4OONA 4JF5A 3ZVWA 1IYOA 1IYSA 2Y2JA 4Z5TA 1MY8A 5FAPA 2CV5A 3UDXA 2Y2HA 5EVIB 4CSRA 3HLFA 3L27A 4ZUXA 4EO5B 1AOIA 3V3RA 1BUEA 3DW0A 4WU8B 1BH9A 5BO0A 4JPMA 3M6BA 2XLNA 3AZJD 3W98C 4E3OA 3B0DB 3UE3A 4NK3A 4NE5A 5E43A 3AZGC 5DF7A 5EVLA 1P3LB 3KWQA 1SCWA 4J8VD 4OLDA 4H9OA 1L0EA 4YM6D 1YLZA 4KGCB 3Q07A 3AZJC 4GHAA 5JA4A 4R3JA 3AZMA 4H8RA 1M6KA 3BEBA 4OQ0A 3HUOA 5GT0B 4KG5A 3AZID 1SDNA 5AY8B 2EX8A 2HP9A 1W2EA 1KX4A 4B88A 4EUZA 4OJPA 1HVBA 3AZLD 4C6YA 5F1FA 2YFVA 3AZFA 3AZHC 4XUJD 1BH8B 1W5DA 1ID3C 3ZG5A 1L0DA 1MWSA 5G49B 1TAFA 3FKVA 3OPPA 3WTPB 1BLSA 4OP8A 3REJA 1OMEA 4E44A 4QB8A 3WWXA 3TSGA 1PZPA 3AGEA 3VH5W 4NETA 4IBGA 1CEGA 4LD9A 5B2IB 1EQZD 4WNNB 1HQ3B 1KX5D 4UAAA 3Q81A 3X1TC 5GXQD 4IVIA 5B40A 3V50A 5F1GA 3BFDA 3LJAB 3Q1FA 4QHCA 4QY6A 3MGQD 3L29A 5GSUC 5CEBA 2WKHA 2XQZA 3X1SA 3MKFA 4E45A 4MLLA 1ZLAA 2P9VA 2HIOA 5B0YA 3SH7A 4ZJ3A 5E2GA 1FCNA 2ZY4A 1GA9A 4S2NC 4J8UD 3OPRA 4HBTA 3WTPD 4S2MA 3NQUA 2G2WA 2Y2GA 1N4OA 2FFFB 1U35C 1HTAA 3OC2A 1TZYA 4P6BA 3B6GB 2VGKA 4KUDC 4NE3A 2QPNA 3X1VD 4KQOA 1KX5C 4P87A 3IXBA 3AFAB 3ZG7B 2NQBA 3HLEA 3REHA 1JVJA 2ZC4B 3SS4A 3FWLA 3ITAA 4PM8A 2HDSA 3UTBB 4IVKA 4DE3A 3HLGA 3REHC 3MVDD 3LZ1C 2ZQAA 3QNBA 1Q9CA 5GLDA 1G6AA 4R4SA 4J8UB 2Y4AA 2EX6A 1TVFA 3CJMA 5B32D 4X68A 5B1LB 3AGDA 3PBSA 5B0ZD 2PYOA 3MGPA 5AV6D 3B0BA 3X1VC 5CP6A 5AV9C 2G2UA 4WYYA 5FASA 2EX2A 3AL0C 5HL1A 3IF6B 3X1UD 1H5XA 4F94A 2J7VA 5CPIB 5A92A 2B5RA 3UTBD 1PIOA 3L2AA 4ZUXC 4KHAA 3REKB 2ZY5A 5BT1D 1P3PB 3REHD 3WA9B 2WGWA 3KUYD 1FCOA 2WAEA 1I2SA 1IYQA 4R8PB 3ZNYA 4Q8IA 5DNMB 1P3GB 4ZUXD 3FKWA 3AZLB 2QZ6A 4LENA 1P3FB 4FCFA 3AZJA 3UPNA 3AV2A 1MWTA 4WMCD 4BD1A 5EOOA 3EQUA 3B6GC 1M19A 1ESUA 4JJNA 1ONGA 4J8VA 2CWEA 1KX5B 5AV6B 1P3BB 3FZCA 2G5HC 3N8RA 3LO7A 3OPLA 1KGEA 3PBQA 1TDLA 4NYUA 5A93A 1LL9A 1QMEA 4S2IA 1KX3A 4UUZB 2ZQCA 4MNRA 4M3KA 1PW8A 5E2FA 3NI9A 3LZ0A 3BFGA 1YU1A 5BS7C 5HARA 3LCEA 2Y2PA 2ZM8A 3Q7ZA 5TR7A 4ZAMA 1XPBA 4YM6A 3VH5A 2XGNA 4XUJA 3D4FA 4XZQA 1PW1A 3C1BD 3ZGAB 4YM6C 3C5AA 2Y2MA 1IKGA 1P3MA 2V20A 2Y59A 5GT0C 3A6NA 5BOHA 4Z66D 1YLJA 5B2JD 2XEPA 3AV1C 5B0YC 3AZEC 5CPJB 1WYCA 5D3OA 5EUAA 3AV2C 3MGRB 3ZFZA 3RXXA 2A49A 1LLBA 2XK1A 4UA6A 3AYWB 3I7JA 3MGSA 3F6TA 1K6SA 5JRGB 5B2ID 1EQZB 3X1SD 2R9WA 1NY0A 3FDDA 4S2LA 3SH8A 1QMFA 5M1AA 4WU9C 1BTLA 3G2YA 3ZHHA 4E3LA 3C1BA 3MZFA 1HQ3D 3WA9D 1F66D 3SOIA 4OQIA 1XKZA 5FQKA 1F66B 5CGSA 3QNCA 4JXVA 4IEDA 3A6ND 5EECA 4OOMA 1XGIA 3MNNA 1YMXA 4HGAC 4OH0A 3KSYA 2RCXA 5CPKA 4XUXA 3UTAC 2HDRA 4K0XA 1R4VA 3AYWD 3MNNC 2PYOC 5CHLB 1AXBA 3AN2A 5AV8D 1JTGA 5GT3C 3HREA 3FKEA 4GDNA 1O7EA 2ZC5B 3UN7A 3UT9A 4LCMA 4UHUA 3UNWA 4NZ1A 3IH8A 3IWQA 2NQBD 2DF4C 5GL9A 3MGPC 5B33D 5B32A 1MPLA 2R9XA 4JKTA 2DCFA 3IXDA 4GNUA 2VQRA 2C5WB 3Q7VB 5GLAA 2HPBA 3MVDA 4EQIA 5KSCA 5FAQA 1P3LC 3V9RB 3C1CC 5F99B 3X1UA 4J8WB 3W98A 3MVDC 4A5RA 3W96D 4Y0OA 2NQBC 3HL9A 2Q9MA 5FSRA 5AQBA 5F99C 3IHAA 5FI7A 3C4OA 4K0WA 4KZ8A 3W97C 4ZJ1A 3VP0A 5B40C 2F8NH 3ZG0A 1ES3A 3E2LA 2OLUA 1PWCA 5A90A 4KZ9A 3W97B 2WKEA 1DJCA 2F8NA 1M18A 2EXAA 2ZMAA 3HLBA 3HVFA 3CG5A 3AZNB 5GXQC 1EQZA 1KDSA 5CERA 3WTPC 1BULA 5AV8B 4DRAA 3REIB 2IWCA 1PYYA 3MGQB 4H9NB 3RELA 1IKIA 1DJAA 1LI9A 4R8PC 4WBGA 4IBXA 1ID3A 4RA7A 1KX4C 3BRMA 3IF5A 4ZBJC 4N1HA 1ESIA 2XH9A 4OJ6A 2F8NK 4GD8A 1P3OD 3WAAB 1AOIC 5GSUB 1ERQA 2F8NB 4ZTKA 4PMAA 3G30A 4XZQB 3B6FC 2DRWA 1P3KB 3AZKA 4H9QA 1K56A 1SKFA 3NCKA 4U0TA 3WRTA 4JF6A 2OLVA 3WS4A 1WE4A 3UY6A 3UDFA 5FAOA 3KXBD 4OJLA 1KX3D 5B1MC 5B32G 4DKIA 1GCEA 3VFFA 3SS5A 3IT9A 1KE3A 4OPRA 4J8VB 4JJNB 3UPOA 4BD0A 5I94A 5B0ZB 5AVBB 4JF4A 4S2NA 3E2KA 4OKPA 4XZQD 4HBUA 3VP1A 4KZ5A 1P3IA 1P3IB 1KX3C 5HAIA 3ZDJA 3DTMA 3MGPD 3W4OA 4WZ5C 3LZ0C 2PBYA 3G4PA 3VP4A 2JCHA 2XR0A 4R0QA 1P3BD 1M1AA 1ID3B 3IHBA 5CPKB 1GHPA 3AFAD 3PBNA 4KENB 4IJEA 1O07A 2HUEB 3IF6C 5F82A 2DNSA 2F2AC 3AZHB 1ES5A 5AV5B 3UE1A 4E3NA 5FI6A 3REIC 4DRTA 1MXOA 1P34C 5CHMA 1P3GD 1U35D 5CEDA 3KFUG 4B4XA 4JBFA 4GH9A 2IO5B 3W8KA 4KUDD 4KZ6A 2ZY3A 3P5JB 2JSSA 4DE1A 5DNNA 5B1LA 1W7FA 1M40A 2ZD8A 3H0MC 4GB7A 4NE6A 1FOFA 4IBKA 4BL2A 4J8UA 1WYBA 3LY4A 3W4QA 1XGJA 5EE8A 3MZDA 2EFUA 1MBLA 3X1UB 4JLFA 4R8PD 4H9NA 1ZG4A 4XUJC 4DDYA 3X1UC 1Y54A 5AV8A 3N8LA 5B32B 3AZNA 3TG9A 1P3MB 4IJFA 5TFQA 5AY8D 2EXBA 1M18C 5B0YD 4X56A 4FH2A 5B33A 3C7UA 3PTEA 3W97A 1RP5A 3AZEA 3IXHA 3ZG8B 3B6GA 2AROA 1TZYB 1XXMA 5G18A 5CGWA 4OJ5A 4WU8D 1TZYD 4EBLA 1JFIA 5B1LD 3X1VA 1KX3B 1CI9A 5AV5A 4Z66C 3AZHA 2ZQ7A 2V2FF 4YFMA 3R45B 4QNLA 2P9VB 1NRFA 2A3UA 3X1VB 1Z2CB 3A3IA 4NZ4A 3V5MA 3V9RA 1RCJA 1KVMA 3BFEA 1JFIB 3C4PA 4Z9QA 1E4DA 4DF6A 5B40B 1P3KA 3UE0A 3G34A 3REKC 3AZEB 5CTMA 5FATA 3AV2B 4LV2A 2WZZA 5M19A 5B33B 3REJC 4E3MA 2ZQDA 1W8QA 5JRGA 1MWUA 3REJB 4NZ3A 3AN2B 5B0ZA 2PYOD 3B6GD 2VGJA 4IBIA 2L5AA 1HQ3C 5U47A 1P3AC 3X1TB 1Q2QA 4NFTA 5HW3A 1B67A 5JYPA 3AN2C 2Z2MB 5B31G 3G2ZA 1I2WA 1KX4B 3TOIA 4WU9D 4NZ5A 4EBPA 3HLWA 5DNNB 2RL3A 3B0CW 1XP4A 1P3GC 4WMCA 3C1BB 4H9QB 4Z5TC 1K4FA 2J9OA 4XUJB 3REJD 3OPHA 5AV9D 2ZQ8A 4LV1A 4CJNA 4IBDA 3C1BC 3UPPA 2QMIA 3SS3A 2RVQD 2PYOB 4EO5C 3BFFA 4UUZA 5CGXA 5AVCD 1JWPA 3IH9A 2H0TA 1H8YA 3W98B 3W99C 3PBTA 3C1CD 4KZ3A 3AV2D 4RX2A 4JXGA 5HAPA 3NC8A 2WGVA 5B24D 5AQAA 4IBFA 3MGQA 5KSHA 5CPJA 3X1TA 3REIA 4YINA 1M19B 3BECA 3L28A 1ONHA 3GV9A 3EPKA 1P3LD 1M19C 3AZJB 2E8IA 4Z2MG 1P3FA 4X53A 2FFYA 3UT9B 3VH6W 3P98A 4DE2A 5E5AC 1W79A 3MGRC 1K57A 4YM6B 2ZM2A 4R23A 2RVQC 2Q9NA 1P3GA 4Y7PA 4QD4A 3VSLA 3NQJA 1YT4A 4E6XA 2H0YA 5B0YB 3R45A 1KDWA 1WWSA 1YM1A 3NDEA 4J8WA 1P3PC 5F99A 2WZXA 1RGYA 4BL3A 4G92B 3DWZA 1L0GA 3BM6A 1ZC2A 3RELD 1ES2A 4ZJ2A 3AZNC 3Q7VA 4PM5A 1PWGA 4IBJA 3VOYA 5CPIA 5JRGC 1S32C 3AZKB 2AROB 5CHUA 4BENA 4IBBA 3GVBA 3Q82A 1BLHA 1HQ3A 3MGQC 1Q2PA 3AZLC 5GSUA 1CEFA 4N1XA 4G91B 2WGIA 4KZ4A 4MBFA 1KX4D 3WAAA 4NY2A 2IWDA 3MNND 3AZLA 3WS0A 3G32A 1F1EA 3MGSB 3WAAC 5DNMA 2Y2QA 3W97D 4R8PA 3AZED 3RELB 3MGRA 2ZLYA 4H9SA 3N6IA 4MBKA 3VP2A 2XDMA 2X71A 3A6NB 5CRFA 3WA9A 2J9PA 1F66A 4QLCC 3LELD 4DRBA 4WZ5A 4KHAB 3REKA 1L2SA 4J8XC 2XFTA 1FSWA 4GOGA 1M18B 2EFXA 4AWLC 2FJ7D 2Y2KA 4PM9A 4OVDA 2DQNC 1PI4A 3LZ1D 3W96C 3MBZA 3NDGA 1EROA 3MGPB 2XFSA 4YS3C 1P3ID 4GKUA 3OCLA 4WZ4A 1DJBA 3V39A 3B0CT 5A91A 4E3JA 5BO0B 4JJND 1P3BA 1M1AD 1Z6FA 1FSYA 3MVDB 1M1AB 3LJAA 1LI0A 4QLCD 5EOEA 2JC7A 1YLPA 4R1GA 3M2KA 3MFDA 4FH4A 3M6HA 1E3UD 4WU9A 4ID4A 2HUEC 1L0FA 3O3VA 5AVBA 1ULYA 3WKJC 3O62D 3ZVTA 1P34D 3WKJA 1AOID 4E3KA 3AZFB 2YFVB 1ERMA 2V1ZA 5CECA 2F8ND 2XF3A 2LY8A 3B6FD 1W8YA 3UDIA 5AV6A 3IWIA 5GT0A 3BLSA 4EWFA 2Y2IA 5KDMB 1WWIA 4XXRA 3VOZA 3MGSD 2BG1A 4HEFA 5CXWA 5IHVA 5DVAA 2ZM0A 5B2IA 1IYPA 4R3BA 2BLSA 1TDGA 3N8SA 3G35A 2ZY2A 3CMZA 4R4RA 4NYYA 4KUDB 5G49A 1IELA 3L25A 2NZDC 5B32C 1K54A 1ALQA 5BNVB 3A3JA 5CP6D 5C3IB 4OUIA 1LHYA 4WZSB 3RXWA 3AFAC 4YS3B 4CSRB 2HP6A 3AZHD 3UTBA 2CC1A 4Y0TA 3O87A 4J8WC 1P3PA 3REHB 4S2PA 2NQBB 2Y55A 5GT0D 1ZKJA 4X23B 5B0ZC 5FQIA 2FJ7C 1M19D 4KGCA 3A3FA 3IF6A 3S1YA 4H9OB 3N7WA 5CPKC 1NYYA 2ZJ9A 5HFOA 3UT9D 1XA1A 4GHLA 4RVAA 3NQUB 3WTPE 3LZ0B 5AV5C 3NBLA 1SDEA 3N4IA 1BZAA 4UA9A 1K55C 5GSUD 4N9KA 3HONA 3AZMC 2WADA 4G92C 2IO5C 5TGFA 2PU2A 4ZUXB 1BFMA 1S0WA 4GD6A 4H9SC 3N3FA 5DNMD 3RJUA 4C3QA 5DF9A 4XUZA 4WNNA 3WS1A 3AFAA 4LD9B 4Z5TD 2JBFA 3LELA 3HLCA 3LZ0D 2Z2LB 3O62C 5AQ9A 1PWDA 2ZC7A 4LCLA 1N1JB 3AV1A 2FJ7A 1XX2A 3X1SC 1P3OB 4QY5A 5EVIC 3A1IA 3MNNB 5AVCA 1ZLAB 1YU4A 3A6NC 1JWVA 1LL5A 3X1SB 3KWQD 1GA0A 3MKEA 5DTSA 4BLMA 4EV4A 5JA4B 4U3TA 1ZLAC 1HD8A 1TZYC 3HUMA 3REID 3EPJA 4WELA 4PM6A 2Y2OA 1FQGA 3GMWA 3AZMD 4Z2MH 5CP6B 1EWZA 5AVBC 4FSFA 4MBHA 2IWBA 1P3LA 2WKIA 3VH5T 2X01A 4KZ7A 1H8ZA 3A3DA 4YS3D 1P3IC 3UTBC 3UO9A 1E3UA 3EPLA 3AZGB 3AYWA 1BH9B 3LZ1B 5B2JC 3AV1D 5F83A 4CPKA 3LJAD 3KXBC 1GHMA 5AVBD 3MXRA 1M1AC 5E5AB 4ZDXA 4KGCC 3KS8A 3O62A 2HDUA 5B1MD 5B33C 4BQMA 2BYKA 2HDQA 4WEJA 4J8WD 3ZG9B 2H10A 2WUQA 5FDHA 2EX9A 3C7VA 3PAEA 5CPJC 4O7DA 3AZMB 2XD1A 3L26A 4IBCA 1K38A 3TU4B 1P3AD 2I72A 5GXQA 1J9MA 4DDSA 3HLDA 3TU4C 4OOYA 4X55A 3KWQB 4KG6A 3WKJD 3W98D 1ZLAD 3TU4A 2CV5C 3WA9C 2OV5A 1U60A 1YLTA 5GHZA 4OJOA 2HIOB 5BS7A 3WS5A 4LD9D 4PPRA 2ZM5A 5BPVA 1MWRA 1YU2A 4KQRA 1K6RA 1KX5A 3O62B 1K25A 5E2HA 1AOIB 3LY3A 1DY6A 3VP3A 4HESA 1K4EA 4X6TA 3KS4A 3AZGA 1YU0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HP5 A;  1E25 A;  3EQV A;  5E43 A;  4ZJ1 A;  3VP0 A;  3GVB A;  3ZNT A;  3Q82 A;  1BLH A;  4LV3 A;  5DF7 A;  3PAG A;  5EVL A;  3ZG0 A;  1ES3 A;  3E2L A;  3IWO A;  1SCW A;  1VQQ A;  2OLU A;  1PWC A;  1Q2P A;  5A90 A;  4OLD A;  4KZ9 A;  4Y0U A;  1CEF A;  1L0E A;  4N1X A;  5HAQ A;  2WKE A;  1DJC A;  2WGI A;  2EXA A;  2ZMA A;  3HLB A;  1YLZ A;  3HVF A;  3CG5 A;  4KZ4 A;  4MBF A;  3Q07 A;  2IWD A;  3WS0 A;  3G32 A;  1I5Q A;  4N9L A;  1KDS A;  4R3J A;  4WEK A;  4H8R A;  1M6K A;  3BEB A;  1BUL A;  4OQ0 A;  5CER A;  3HUO A;  3DWK A;  4IBR A;  2Y2Q A;  4KG5 A;  4KZA A;  1SDN A;  4C75 A;  4E3I A;  1BSG A;  2IWC A;  2EX8 A;  2HP9 A;  1PYY A;  2ZLY A;  3N6I A;  4BJP A;  4B88 A;  4MBK A;  3VP2 A;  4EUZ A;  1IKI A;  2WGW B;  2XDM A;  1HVB A;  1DJA A;  1LI9 A;  1SHV A;  1MKI A;  1NYM A;  4WBG A;  3S22 A;  4C6Y A;  5F1F A;  2X71 A;  4IBX A;  4JXW A;  5CRF A;  4RA7 A;  2J9P A;  3BRM A;  3IF5 A;  5L2F A;  2WYX A;  3ZCZ A;  1FR1 A;  1ESI A;  4N1H A;  4WZ5 A;  1W5D A;  2XH9 A;  3ZG5 A;  1L2S A;  1L0D A;  1MWS A;  3FKV A;  4GD8 A;  4QJG A;  3OPP A;  4OP8 A;  1BLS A;  2XFT A;  1FSW A;  1OME A;  4GOG A;  3S4X A;  2EFX A;  4QB8 A;  2Y2K A;  3WWX A;  2OSU A;  4PM9 A;  1ERQ A;  5EPH A;  3TSG A;  1PZP A;  3AGE A;  4QU3 A;  4ZTK A;  4NET A;  4PMA A;  4OVD A;  3G30 A;  1PI4 A;  2GDN A;  1CEG A;  3MBZ A;  3NDG A;  1HTZ A;  1ERO A;  1YMS A;  2DRW A;  2XFS A;  4UAA A;  3VFH A;  3Q81 A;  1K56 A;  1SKF A;  3NCK A;  2Y2N A;  4GKU A;  4U0T A;  4UA7 A;  5FI2 A;  3OCL A;  4WZ4 A;  3WRT A;  1KE4 A;  4IVI A;  1DJB A;  4JF6 A;  3V50 A;  5F1G A;  3P09 A;  3V39 A;  1CI8 A;  5AQ7 A;  3BFD A;  2OLV A;  3WS4 A;  1WE4 A;  3Q1F A;  1XA7 A;  4OQH A;  4QHC A;  5A91 A;  3UY6 A;  4QY6 A;  3UDF A;  2XD5 A;  5FAO A;  4E3J A;  5E2E A;  1KGG A;  2WKH A;  2XQZ A;  5CEB A;  1Z6F A;  3MKF A;  4N92 A;  4S2J A;  5EVI A;  1FSY A;  4MLL A;  2P9V A;  4DKI A;  1GCE A;  3VFF A;  3SH7 A;  4ZJ3 A;  2P74 A;  3IT9 A;  1KE3 A;  3SS5 A;  1LI0 A;  5E2G A;  5KMW A;  1FCN A;  4OPR A;  1YQS A;  5EOE A;  1GA9 A;  2Y91 A;  4S2N C;  5HX9 A;  2JC7 A;  1YLP A;  4R1G A;  3M2K A;  3OPR A;  4HBT A;  4S2M A;  3WRZ A;  3UPO A;  2G2W A;  4BD0 A;  5I94 A;  1N4O A;  2Y2G A;  4JF4 A;  2FFF B;  4S2N A;  3MFD A;  4FH4 A;  5CTN A;  3E2K A;  1NZU A;  3M6H A;  3JYI A;  3OC2 A;  4OKP A;  1FCM A;  4WM9 A;  4P6B A;  1E3U D;  4EBN A;  4HBU A;  2VGK A;  3VP1 A;  3GSG A;  4KZ5 A;  2QPN A;  3ITB A;  4ID4 A;  4X69 A;  5HAI A;  3ZDJ A;  3DTM A;  4KQO A;  1L0F A;  3W4O A;  3O3V A;  4WZ5 C;  4P87 A;  3IXB A;  1NXY A;  1G68 A;  3ZG7 B;  3ZVT A;  2PBY A;  3HLE A;  3G4P A;  3VP4 A;  2JCH A;  2XR0 A;  1JVJ A;  4MEZ A;  2ZC4 B;  3SS4 A;  3B3X A;  3FWL A;  3ITA A;  4R0Q A;  5FQ9 A;  4PM8 A;  3NIA A;  2HDS A;  4E3K A;  3IHB A;  1ERM A;  3GTC A;  3IXG A;  4IVK A;  3HLG A;  3OZH A;  2J8Y A;  4DE3 A;  1ES4 A;  2V1Z A;  5CEC A;  1BLP A;  1GHP A;  5FA7 A;  2XF3 A;  3FYZ A;  3PBN A;  2ZQA A;  4KEN B;  1O07 A;  3QNB A;  1W8Y A;  3IF6 C;  2Y2L A;  3UDI A;  5F82 A;  3IWI A;  2DNS A;  5GLD A;  1ES5 A;  3ISG A;  3OCN A;  4S2K A;  3UE1 A;  4E3N A;  1G6A A;  3BLS A;  4R4S A;  5FI6 A;  3VSK A;  4JXS A;  4EWF A;  1TEM A;  2Y2I A;  2Y4A A;  2EX6 A;  1TVF A;  3CJM A;  4DRT A;  4XXR A;  1MXO A;  5CHM A;  4OP5 A;  3AGF A;  4X68 A;  5DF8 A;  3AGD A;  1HZO A;  3VOZ A;  5CED A;  3PBS A;  2BG1 A;  4HEF A;  5CXW A;  4OLG A;  5DVA A;  5IHV A;  4JBF A;  1KVL A;  4B4X A;  2ZM0 A;  3NY4 A;  1C3B A;  1K57 C;  3W8K A;  1IYP A;  3GRJ A;  4R3B A;  2BLS A;  4KZ6 A;  1TDG A;  3N8S A;  2G2U A;  3G35 A;  4WYY A;  5FAS A;  2EX2 A;  5HL1 A;  3IF6 B;  1IEM A;  3PBR A;  1H5X A;  4F94 A;  3CMZ A;  4DE1 A;  2J7V A;  4R4R A;  5A92 A;  1W7F A;  2B5R A;  1M40 A;  2ZD8 A;  1PIO A;  1IEL A;  4GB7 A;  1FOF A;  4BL2 A;  1WYB A;  3WS2 A;  1K54 A;  3LY4 A;  1ALQ A;  3A3J A;  3W4Q A;  1VM1 A;  1XGJ A;  5EE8 A;  3M2J A;  1LHY A;  3MZD A;  3O86 A;  2EFU A;  2WGW A;  4OQG A;  1FCO A;  1MBL A;  3RXW A;  3BFC A;  5GHY A;  4JLF A;  2WAE A;  5J8X A;  2HP6 A;  2JE5 A;  1I2S A;  1ZG4 A;  4KG2 A;  2CC1 A;  4Y0T A;  1IYQ A;  3G31 A;  5KZH A;  3O87 A;  4DDY A;  3ZNY A;  4Q8I A;  1Y54 A;  4S2O A;  4S2P A;  2Y55 A;  3QHY A;  3N8L A;  4OPY A;  3GQZ A;  1YLY A;  1ZKJ A;  4U0X A;  3FKW A;  3TG9 A;  5CHJ A;  5FQI A;  3W4P A;  5TFQ A;  3FV7 A;  2EXB A;  3A3F A;  2QZ6 A;  3IF6 A;  4LEN A;  4X56 A;  4FH2 A;  3S1Y A;  3C7U A;  3PTE A;  4OOL A;  3N7W A;  4FCF A;  1NYY A;  4B4Z A;  1RP5 A;  2ZJ9 A;  3IXH A;  3O88 A;  3UPN A;  3ZG8 B;  4E6W A;  5HFO A;  1MWT A;  1XA1 A;  4RX3 A;  2UWX A;  5G18 A;  1XXM A;  4RVA A;  4WMC D;  4ZBE A;  5CGW A;  4KQQ A;  4BD1 A;  3NBL A;  5EOO A;  4EBL A;  3EQU A;  1ESU A;  4PM7 A;  1ONG A;  4L0L A;  1SDE A;  3N4I A;  4GZB A;  1BZA A;  4OPZ A;  4UA9 A;  5FQM A;  2X02 A;  1K55 C;  1CI9 A;  4KZB A;  4N9K A;  2ZQ7 A;  2WAD A;  2V2F F;  4YFM A;  4LV0 A;  2P9V B;  3FZC A;  5FQJ A;  1NRF A;  5TGF A;  3N8R A;  3LO7 A;  3OPL A;  1KGE A;  3PBQ A;  1TDL A;  2A3U A;  5A93 A;  2PU2 A;  1LL9 A;  1QME A;  1S0W A;  3A3I A;  4GD6 A;  2WAF A;  1RCJ A;  4S2I A;  3V5M A;  1KVM A;  3BFE A;  3C4P A;  2ZQC A;  4MNR A;  3RJU A;  5JYO A;  4M3K A;  1PW8 A;  4Z9Q A;  5E2F A;  3SH9 A;  3NI9 A;  1E4D A;  4C3Q A;  3BFG A;  4FD8 A;  2H5S A;  4DF6 A;  4GN2 A;  5DF9 A;  5HAR A;  4XUZ A;  3BYD A;  3UE0 A;  3LCE A;  3A3E A;  2Y2P A;  2ZM8 A;  3G34 A;  3Q7Z A;  5TR7 A;  3WS1 A;  4ZAM A;  1XPB A;  1EI5 A;  5CTM A;  1YLW A;  5FAT A;  4LV2 A;  5DTK A;  2WZZ A;  5M19 A;  2XGN A;  1S6R A;  2JBF A;  3D4F A;  1PW1 A;  3HLC A;  4E3M A;  2ZQD A;  1W8Q A;  3ZGA B;  3C5A A;  5DTT A;  2Y2M A;  1IKG A;  2Z2L B;  5AQ9 A;  1PWD A;  2ZC7 A;  2V20 A;  4LCL A;  1MWU A;  2Y59 A;  2VGJ A;  1KGF A;  1N9B A;  4GDB A;  5U47 A;  1XX2 A;  1Q2Q A;  5BOH A;  4QY5 A;  5EVI C;  5HW3 A;  1YLJ A;  1ZG6 A;  2XEP A;  5JYP A;  5GLC A;  4DXC A;  4RYE A;  3V3S A;  1WYC A;  2Z2M B;  4P0M A;  5D3O A;  5EUA A;  3G2Z A;  1JWV A;  3ZFZ A;  1I2W A;  1LL5 A;  3RXX A;  2A49 A;  1LLB A;  3TOI A;  1GA0 A;  2XK1 A;  3MKE A;  5DTS A;  4UA6 A;  3I7J A;  4BLM A;  4EBP A;  4EV4 A;  4U3T A;  3HLW A;  1K6S A;  2C6W B;  1HD8 A;  1FR6 A;  3HUM A;  1PZO A;  2RL3 A;  3VMA A;  1XP4 A;  4WEL A;  4PM6 A;  4WMC A;  2Y2O A;  1BLC A;  1GHI A;  1FQG A;  3LEZ A;  5M18 A;  3GMW A;  2R9W A;  1RGZ A;  1NY0 A;  5EVI D;  5FQQ A;  1K4F A;  1K54 C;  2J9O A;  4S2L A;  1EWZ A;  3GR2 A;  3SH8 A;  3OPH A;  4FSF A;  4MBH A;  2IWB A;  2ZQ8 A;  4LV1 A;  4CJN A;  3MZE A;  2WKI A;  1JWZ A;  1QMF A;  1PI5 A;  5M1A A;  4D2O A;  2X01 A;  3UPP A;  2ZC6 B;  1BTL A;  3G2Y A;  3MXS A;  4KZ7 A;  1H8Z A;  4K91 A;  2PU4 A;  2QMI A;  3A3D A;  2ZC3 B;  3SS3 A;  3ZHH A;  4E3L A;  1BT5 A;  3BFF A;  3MZF A;  3UO9 A;  1E3U A;  5CGX A;  3IH9 A;  1JWP A;  3PBO A;  3SOI A;  3HUN A;  4OQI A;  2H0T A;  1NJ4 A;  1XKZ A;  5FQK A;  5F83 A;  4OPQ A;  5CGS A;  3QNC A;  1H8Y A;  3PBT A;  4CPK A;  4KZ3 A;  4JXV A;  4RX2 A;  4IED A;  4JXG A;  1KE0 A;  1GHM A;  2WK0 A;  3MXR A;  5HAP A;  3NC8 A;  5EEC A;  4ZDX A;  2WGV A;  4OOM A;  1XGI A;  1YMX A;  5AQA A;  5GLB A;  2HDU A;  4DE0 A;  4OH0 A;  5KSH A;  1NZO A;  4BQM A;  2RCX A;  3IQA A;  4XUX A;  2HDR A;  2HDQ A;  4DXB A;  4K0X A;  4WEJ A;  4YIN A;  3ZG9 B;  2H10 A;  2WUQ A;  5FDH A;  2EX9 A;  3BEC A;  3C7V A;  3PAE A;  2ZQ9 A;  4O7D A;  3CZD A;  1ONH A;  5GHX A;  2XD1 A;  1K38 A;  1K56 D;  1AXB A;  2I72 A;  1JTG A;  3GV9 A;  2E8I A;  3HRE A;  4GDN A;  4X53 A;  1O7E A;  2FFY A;  2ZC5 B;  4UHU A;  4LCM A;  3UN7 A;  3UNW A;  1K55 A;  3P98 A;  1CK3 A;  3HBR A;  3IH8 A;  1J9M A;  3BLM A;  3IWQ A;  3HLD A;  4DDS A;  4DE2 A;  1W79 A;  4OOY A;  1JTD A;  4X55 A;  5GL9 A;  1K57 A;  4P85 A;  2ZM2 A;  4KG6 A;  4R23 A;  1MPL A;  2R9X A;  2Q9N A;  4JKT A;  4OON A;  4JF5 A;  4Y7P A;  4QD4 A;  3ZVW A;  1IYO A;  3VSL A;  2DCF A;  1IYS A;  2Y2J A;  3IXD A;  4GNU A;  2OV5 A;  1MY8 A;  5FAP A;  1U60 A;  2C5W B;  3Q7V B;  1YLT A;  5GHZ A;  2HPB A;  5GLA A;  4EQI A;  5KSC A;  5FAQ A;  3UDX A;  2Y2H A;  5EVI B;  3WS5 A;  1YT4 A;  3HLF A;  4E6X A;  2H0Y A;  4PPR A;  1KDW A;  1MWR A;  4KQR A;  1K6R A;  3V3R A;  1BUE A;  1YM1 A;  1K25 A;  3NDE A;  5E2H A;  3DW0 A;  4A5R A;  2WZX A;  1RGY A;  3LY3 A;  4BL3 A;  4Y0O A;  3HL9 A;  3DWZ A;  4JPM A;  1DY6 A;  2Q9M A;  3BM6 A;  3M6B A;  4HES A;  1K4E A;  1ZC2 A;  1L0G A;  3VP3 A;  2XLN A;  1ES2 A;  4X6T A;  4ZJ2 A;  3Q7V A;  5FSR A;  5AQB A;  4PM5 A;  1PWG A;  4E3O A;  3IHA A;  3UE3 A;  5FI7 A;  3VOY A;  4NK3 A;  3C4O A;  4K0W A;  5CHU A;  4KZ8 A;  4BEN A; 
#chains in the Genus database with same CATH topology
 2HP5 A;  1E25 A;  3EQV A;  4KUK A;  3ZNT A;  3REK D;  4LV3 A;  3PAG A;  3IWO A;  1P3A A;  1P9R A;  1VQQ A;  5L09 A;  3KUY B;  3W99 B;  1E6P A;  4Y0U A;  1P3P D;  5HAQ A;  1EW0 A;  3WTP A;  1TAF B;  5B24 A;  4I38 A;  1I5Q A;  4N9L A;  5CPJ D;  3X1T D;  1ID3 D;  5B1M B;  4Z66 A;  1U35 B;  1HLU P;  4WEK A;  1BH8 A;  4AWL B;  3DWK A;  4GJ4 A;  4IBR A;  4H9P B;  4KZA A;  4C75 A;  4E3I A;  1BSG A;  4LRZ E;  5HWT A;  5B31 C;  1PZR A;  4JJN C;  1K0K A;  4HIA A;  4BJP A;  3W96 B;  2WGW B;  3S22 A;  1SHV A;  4FTX A;  1MKI A;  1NYM A;  1YUE A;  2OWJ A;  2W8S A;  3CHW P;  3EGX C;  2BYM A;  5B31 A;  4JXW A;  2NZD A;  2V0W A;  3T12 B;  4J8U C;  5L2F A;  2WYX A;  3ZCZ A;  1FR1 A;  1ZHH B;  1H3O A;  2FJ7 B;  3H0R C;  4Z2J A;  4QJG A;  1YU3 A;  3S7O A;  2G5I C;  3S4X A;  1PNE A;  3AZG D;  4WV4 B;  4MMN A;  4Q0H A;  3IP4 C;  2OSU A;  5AY8 C;  5EPH A;  4QU3 A;  4XT2 B;  4J8X A;  2Z6C A;  3LEL B;  4G3W A;  3W99 A;  3JPU A;  4WLA A;  3KUY A;  2GDN A;  3KXB A;  1HTZ A;  1YMS A;  2D02 A;  3VFH A;  5CPI C;  5F99 D;  2Y2N A;  3LEL C;  4UA7 A;  2F8N G;  5FI2 A;  1A0K A;  1KE4 A;  5AVC C;  1S32 D;  3P09 A;  1CI8 A;  1T3U A;  5AQ7 A;  4R70 A;  4OQH A;  1XA7 A;  4WU8 A;  2XD5 A;  3QP1 A;  5AV9 B;  1P34 A;  3AZF D;  5E2E A;  1KGG A;  3AZK D;  4N92 A;  1T18 A;  1P34 B;  4S2J A;  5FUG A;  5EVI A;  1OGB A;  2CV5 B;  3RFB A;  5LBR A;  2P74 A;  3UTA D;  5KMW A;  1EQZ C;  1YQS A;  2Y91 A;  5HX9 A;  4E04 A;  5DNM C;  2HIO C;  3WAA D;  3WRZ A;  2NZD D;  3HSH A;  5GT3 D;  5CTN A;  3MGS C;  1NZU A;  3JYI A;  4WM9 A;  3IS2 A;  1FCM A;  4EUV A;  4F3L B;  4EBN A;  3GSG A;  1KOU A;  4XT2 A;  3ITB A;  2IOU A;  4X69 A;  2YFW B;  4DN0 A;  4IBE A;  4LRX C;  5CPI D;  4Y17 A;  3IS2 B;  1NXY A;  1G68 A;  3LIE A;  4MEZ A;  3B3X A;  1P3O C;  5FQ9 A;  3NIA A;  2BYM B;  5HDD A;  3IXG A;  5BT1 C;  3GTC A;  3OZH A;  2J8Y A;  1ES4 A;  2BYK B;  1S32 A;  5AV6 C;  3W96 A;  3EPH A;  1BLP A;  3UTA B;  5FA7 A;  1MKM A;  3FYZ A;  2HV1 A;  4YS3 A;  2Y2L A;  1P3M C;  4M6B A;  2PYR A;  3CLO A;  4CAY B;  3ISG A;  1XJ4 A;  3OCN A;  3PXP A;  2HJE A;  4S2K A;  3VSK A;  2IA2 A;  3LZ1 A;  4QLC B;  5BNV A;  4JXS A;  4LG2 A;  1TEM A;  4WF0 A;  4X23 D;  4OP5 A;  3AGF A;  5DF8 A;  1HZO A;  5CP6 C;  1P3B C;  4OLG A;  4D60 A;  1KVL A;  1XJ2 A;  3CUE A;  3NY4 A;  1C3B A;  1K57 C;  3GRJ A;  1M18 D;  4J8V C;  3E4P A;  4Y2F A;  4H9R A;  3AZI B;  3NUL A;  1IEM A;  1TS0 A;  3UT9 C;  3PBR A;  2FN2 A;  4HQA A;  3VE4 A;  5KDM A;  4QLC A;  5B2J B;  4X23 C;  1E6N A;  1TD5 A;  3WS2 A;  1TF1 A;  1VM1 A;  2RIQ A;  5B1L C;  3M2J A;  4R6L A;  3O86 A;  3LYX A;  4OQG A;  3BFC A;  5F69 A;  3QP8 A;  3DTK A;  5GHY A;  3WX7 A;  5J8X A;  3E4O A;  3H0L C;  5AY8 A;  2JE5 A;  1P3M D;  1T1B A;  3KO6 A;  3C1C A;  1OPX A;  4KG2 A;  5AVC B;  3G31 A;  5KZH A;  1P3O A;  4S2O A;  3WKJ B;  3QHY A;  5B2J A;  4OPY A;  3GQZ A;  1YLY A;  4U0X A;  3AV1 B;  4ETX A;  1H0I A;  5CHJ A;  3W4P A;  4TX8 A;  2YFW A;  4HP4 A;  3FV7 A;  2ARO C;  4OOL A;  4H9R B;  3AZI A;  4B4Z A;  2L4R A;  3O88 A;  4E6W A;  3TU4 D;  1P3A B;  4WU9 B;  5GXQ B;  4RX3 A;  2UWX A;  3RH8 B;  4ZBE A;  4KQQ A;  4PM7 A;  3PR6 A;  4L0L A;  3LIA A;  4GZB A;  3T4K A;  4OPZ A;  5FQM A;  2X02 A;  3VH6 T;  4WL9 A;  4KZB A;  3AZF C;  5FUG B;  1UGU A;  4CAY A;  5E5A A;  1P3K D;  3AN2 D;  4LV0 A;  5FQJ A;  2ARO D;  4UPK A;  4HGA B;  4HH3 A;  4L9F A;  2WAF A;  4Z5T B;  2HIO D;  1FIK A;  5JYO A;  4B93 A;  3SH9 A;  5AV5 D;  4FD8 A;  2H5S A;  4GN2 A;  4KUO A;  1F66 C;  3BYD A;  5JRG D;  3A3E A;  4XZQ C;  3KUY C;  5B40 D;  1OTE A;  1W1Y A;  3B6F A;  1EI5 A;  1YLW A;  1P9W A;  3B47 A;  5C3I C;  1D1J A;  4J8X B;  1P3K C;  3GEC A;  5DTK A;  5CPK D;  5DKL A;  1S6R A;  1KU5 A;  3TE8 A;  5DTT A;  3MJQ A;  3R7W A;  4HY8 A;  4WU8 C;  1A7W A;  5GT3 B;  1KGF A;  1N9B A;  2NZD B;  4GDB A;  3E98 A;  5FL3 A;  5B31 B;  3C1C B;  3B0D C;  3AZI C;  3JVV A;  3T1R A;  1ZG6 A;  5GLC A;  4DXC A;  4RYE A;  3V3S A;  5IT5 A;  5B31 D;  4P0M A;  4MDZ A;  1OT9 A;  3C8C A;  4KGC D;  5B24 C;  3S7Q A;  5E5A D;  2Y79 A;  3MGR D;  5AV9 A;  2XA7 S;  1U35 A;  5B1M A;  4Z66 B;  2OAP 1;  2C6W B;  1N1J A;  1FR6 A;  2PR6 A;  1PZO A;  3VMA A;  5B24 B;  2J8P A;  5BNX B;  2KLI A;  4LLO B;  4KUD A;  1BLC A;  4J8X D;  1GHI A;  3LEZ A;  5M18 A;  3W99 D;  1RGZ A;  5EVI D;  5FQQ A;  1K54 C;  3KXB B;  3A1K A;  3GR2 A;  3EG5 B;  3MZE A;  3B33 A;  5DNN D;  1JWZ A;  1PI5 A;  4D2O A;  2PD7 A;  2ZC6 B;  3MXS A;  4K91 A;  3AYW C;  5BNX A;  2PU4 A;  2ZC3 B;  1GPF A;  4MN6 A;  1BT5 A;  3MQL A;  3WD0 A;  2CV5 D;  1H3O B;  2PDR A;  3PBO A;  2LB9 A;  5AV8 C;  3HUN A;  1S66 L;  1NJ4 A;  1ODV A;  4OPQ A;  1B6W A;  1UWN X;  4Z2H A;  4LD9 C;  3UTA A;  1KE0 A;  1TS7 A;  2WK0 A;  2INW A;  3AZK C;  1S32 B;  5K5B A;  5GLB A;  4DE0 A;  3KWQ C;  1P3F D;  1NZO A;  2W0N A;  3IQA A;  4WJ3 C;  3VH6 A;  4ARZ B;  3T50 A;  4DXB A;  4ZBJ B;  4H9P A;  5GT3 A;  3NQJ B;  3AZN D;  5AJG A;  1VEU B;  2ZQ9 A;  3CZD A;  5B2I C;  5GHX A;  4DQY B;  4G91 C;  1K56 D;  1XJ6 A;  3TW8 A;  3LJA C;  1K55 A;  1CK3 A;  3HBR A;  3BLM A;  5DNN C;  3B6F B;  4F3L A;  1JTD A;  2P08 A;  2JKG A;  4P85 A;  1P3F C;  4X23 A;  3REL C;  4OON A;  4JF5 A;  2VKS A;  3ZVW A;  1IYO A;  3FC7 A;  1IYS A;  2Y2J A;  4Z5T A;  4ETZ A;  1MY8 A;  5FAP A;  3UB9 A;  2CV5 A;  4M4X A;  3UDX A;  2Y2H A;  5EVI B;  4CSR A;  3HLF A;  3L27 A;  1GSW A;  4ZUX A;  4EO5 B;  1AOI A;  3V3R A;  1ACF A;  1BUE A;  1P97 A;  3DW0 A;  4WU8 B;  1BH9 A;  5BO0 A;  4JPM A;  3M6B A;  2XLN A;  3AZJ D;  5HPI A;  3W98 C;  2K31 A;  3LID A;  4E3O A;  3B0D B;  3UE3 A;  4GHI B;  4NE5 A;  4NK3 A;  1IOU A;  5MC7 A;  5E43 A;  3R4K A;  3AZG C;  4I3I A;  5DF7 A;  5EVL A;  1P3L B;  3KWQ A;  1SCW A;  4J8V D;  4OLD A;  4H9O A;  1L0E A;  4YM6 D;  1VB6 A;  1YLZ A;  4KGC B;  3MQQ A;  3Q07 A;  3AZJ C;  1NLZ A;  3NOU C;  4CLC E;  5A8B A;  4GHA A;  5JA4 A;  4R3J A;  3AZM A;  1P0Z A;  1M6K A;  3BEB A;  4H8R A;  4OQ0 A;  1UWP X;  3HUO A;  5GT0 B;  4I3A A;  2J3T D;  4KG5 A;  3AZI D;  2VA0 A;  1SDN A;  3CWF A;  5AY8 B;  2EX8 A;  2HP9 A;  1W2E A;  4HOI A;  1KX4 A;  4Z2I A;  4B88 A;  4EUZ A;  4OJP A;  1HVB A;  3AZL D;  4C6Y A;  5F1F A;  2YFV A;  3AZF A;  3AZH C;  4XUJ D;  3C38 A;  1CJF A;  2G7U A;  1BH8 B;  1W5D A;  4H6J B;  1ID3 C;  3ZG5 A;  1L0D A;  1MWS A;  5G49 B;  1TAF A;  3FKV A;  3OPP A;  3WTP B;  1BLS A;  4OP8 A;  3REJ A;  1OME A;  4E44 A;  4QB8 A;  3WWX A;  3TSG A;  1PZP A;  3AGE A;  3BY8 A;  3VH5 W;  4NET A;  4WN5 A;  2NUP C;  1W1V A;  3CPT B;  4IBG A;  1CEG A;  4LD9 A;  5B2I B;  1EQZ D;  4WNN B;  1HQ3 B;  1KX5 D;  4UAA A;  4X25 A;  3Q81 A;  3X1T C;  5GXQ D;  4IVI A;  5B40 A;  3V50 A;  5F1G A;  3A0V A;  3BFD A;  3LJA B;  3Q1F A;  4QHC A;  1H0M A;  4QY6 A;  3MGQ D;  3L29 A;  5GSU C;  2PD8 A;  1N9O A;  2XRN A;  5CEB A;  2WKH A;  2XQZ A;  3X1S A;  4LPZ A;  4O0P A;  2VEA A;  3MKF A;  4E45 A;  4MLL A;  1ZLA A;  2P9V A;  2HIO A;  5B0Y A;  3SH7 A;  2W27 A;  4ZJ3 A;  5E2G A;  1FCN A;  2ZY4 A;  2M7V A;  1GA9 A;  4S2N C;  4J8U D;  5F68 A;  3OPR A;  4HBT A;  4I3J A;  3WTP D;  4S2M A;  3NQU A;  2EA9 A;  2G2W A;  2Y2G A;  1N4O A;  4Q0J A;  2FFF B;  4X1L A;  1U35 C;  1HTA A;  3OC2 A;  1TZY A;  4P6B A;  3B6G B;  2VGK A;  4KUD C;  4K08 A;  4NE3 A;  2QPN A;  3X1V D;  1W63 M;  3PYP A;  4KQO A;  1KX5 C;  4P87 A;  3IXB A;  3PHY A;  3AFA B;  3ZG7 B;  2NQB A;  3HLE A;  3VV4 A;  2JN7 A;  3REH A;  1JVJ A;  2ZC4 B;  3SS4 A;  3FWL A;  3ITA A;  4PM8 A;  1OTD A;  2HDS A;  3UTB B;  3DTI A;  4IVK A;  4DE3 A;  3HLG A;  1OTI A;  2QJ5 A;  3REH C;  3H9W A;  3WD4 A;  3NOP C;  3MVD D;  3LZ1 C;  2ZQA A;  3QNB A;  1Q9C A;  5GLD A;  1J7M A;  1G6A A;  4R4S A;  4J8U B;  2Y4A A;  2EX6 A;  1TVF A;  3CJM A;  5B32 D;  3ZYT A;  4HMD A;  4X68 A;  5B1L B;  3AGD A;  3VOL A;  3PBS A;  5B0Z D;  2PYO A;  3MGP A;  2XSS A;  5AV6 D;  3B0B A;  3X1V C;  3H7W B;  5CP6 A;  5AV9 C;  2G2U A;  4WYY A;  5FAS A;  2EX2 A;  3AL0 C;  5FDS A;  5HL1 A;  3IF6 B;  3X1U D;  1H5X A;  3JVU A;  4F94 A;  2J7V A;  5AVE A;  5CPI B;  5A92 A;  2B5R A;  3UTB D;  1PIO A;  2W3D A;  3L2A A;  3LR4 A;  4ZUX C;  4KHA A;  3REK B;  2BTF P;  3P01 A;  3KSF A;  2ZY5 A;  5BT1 D;  1P3P B;  3REH D;  3WA9 B;  2GNX A;  3KUY D;  2WGW A;  1FCO A;  1H8P A;  1T19 A;  2WAE A;  3T4S A;  1I2S A;  1YAX A;  4YNR A;  1IYQ A;  4R8P B;  3ZNY A;  4Q8I A;  4EU0 A;  5DNM B;  1GSV A;  1P3G B;  4ZUX D;  1DRM A;  3FKW A;  4GLQ A;  3AZL B;  5IU1 A;  2QZ6 A;  4LEN A;  1P3F B;  2QKP A;  4FCF A;  3AZJ A;  5J7E A;  3UPN A;  3F1P B;  3AV2 A;  1MWT A;  3LUQ A;  4NXF A;  4WMC D;  4BD1 A;  5EOO A;  3EQU A;  3B6G C;  1M19 A;  1ESU A;  1N9L A;  4JJN A;  1ONG A;  2JHE A;  4J8V A;  2CWE A;  3F1N A;  1KX5 B;  5AV6 B;  1P3B B;  2PHY A;  1E8B A;  3FZC A;  2G5H C;  4KQD A;  3N8R A;  3LO7 A;  2VV6 A;  3OPL A;  1KGE A;  2VX8 A;  3PBQ A;  1TDL A;  4NYU A;  5A93 A;  4X1M A;  1LL9 A;  2V0U A;  1QME A;  4S2I A;  1KX3 A;  1S4R A;  4UUZ B;  2JKF A;  2KX6 A;  2ZQC A;  4MNR A;  4M3K A;  1PW8 A;  2J80 A;  5E2F A;  3NI9 A;  3LZ0 A;  3BFG A;  1YU1 A;  5BS7 C;  2JKT I;  5HAR A;  3LCE A;  3T4T A;  1VHM A;  2Y2P A;  2ZM8 A;  3Q7Z A;  5TR7 A;  2PBD P;  4ZAM A;  1XPB A;  2ZOI A;  4YM6 A;  1T1A A;  4HJ4 A;  3VH5 A;  2XGN A;  4XUJ A;  3D4F A;  4XZQ A;  1PW1 A;  3C1B D;  3ZGA B;  4YM6 C;  3C5A A;  3CIT A;  2Y2M A;  1IKG A;  2Y8H A;  1P3M A;  4Z2G A;  2V20 A;  2Y59 A;  4PAU A;  3KYZ A;  5GT0 C;  2V1B A;  2W1T B;  1OGG A;  3A6N A;  3NOT C;  2J3W A;  5BOH A;  4YOF A;  4Z66 D;  1YLJ A;  5B2J D;  3AV1 C;  2XEP A;  3NJA A;  5B0Y C;  3AZE C;  5CPJ B;  1WYC A;  1NWZ A;  1S67 L;  5D3O A;  3AV2 C;  3MGR B;  5EUA A;  4B9O A;  3DBA A;  3FG8 A;  3ZFZ A;  3RXX A;  2A49 A;  1LLB A;  3EOI A;  4Q0I A;  5CX7 A;  2XK1 A;  4YWZ A;  4UA6 A;  3AYW B;  4UEY A;  3I7J A;  3MGS A;  3F6T A;  5DJT A;  1SKO A;  1K6S A;  1YSQ A;  5JRG B;  1GOI A;  3D9Y A;  2ZL1 B;  5B2I D;  1EQZ B;  4QWO A;  2ZOH A;  3HJK A;  3X1S D;  4Y5F A;  2R9W A;  1NY0 A;  3FDD A;  3BWL A;  4S2L A;  3SH8 A;  2VLG A;  4EET B;  2H28 A;  1QMF A;  5M1A A;  2VV7 A;  4WU9 C;  1BTL A;  3G2Y A;  4HMC A;  3ZHH A;  4E3L A;  3C1B A;  3MR0 A;  3MZF A;  1HQ3 D;  3WA9 D;  1F66 D;  3SOI A;  2Z6D A;  5TBM B;  4OQI A;  1XKZ A;  5FQK A;  2E8J A;  1F66 B;  5CGS A;  2HF6 A;  3QNC A;  1W63 Q;  2V5O A;  4BBV A;  4JXV A;  4IED A;  3A6N D;  1F9I A;  5EEC A;  4OOM A;  1XGI A;  3MNN A;  1YMX A;  3BQ8 A;  3A0S A;  4HGA C;  4OH0 A;  3KSY A;  2RCX A;  5DJU A;  5CPK A;  4XUX A;  3UTA C;  1TS8 A;  2HDR A;  4K0X A;  1R4V A;  3AYW D;  3MNN C;  2PYO C;  5CHL B;  1AIW A;  2P04 A;  4GW9 A;  4EXO A;  4UQI M;  3CUE C;  3UME A;  1AXB A;  3AN2 A;  5AV8 D;  1JTG A;  5GT3 C;  1LT0 A;  4HH2 A;  3WD2 A;  3HRE A;  3FKE A;  4GDN A;  1O7E A;  2ZC5 B;  3UN7 A;  3UT9 A;  4LCM A;  4UHU A;  3UNW A;  4NZ1 A;  3IH8 A;  3IWQ A;  4HHD A;  2NQB D;  2L1M A;  2DF4 C;  5GL9 A;  3MGP C;  3IX8 A;  5B33 D;  5B32 A;  5KIZ A;  1MPL A;  2R9X A;  4JKT A;  4CLC A;  3MSH A;  2DCF A;  3IXD A;  1TS6 A;  4GNU A;  5G4Y A;  2VQR A;  2ACG A;  2C5W B;  3Q7V B;  5GLA A;  2HPB A;  3MVD A;  4EQI A;  5KSC A;  1GXD A;  5FAQ A;  1P3L C;  3V9R B;  3C1C C;  2K2N A;  1YPR A;  5F99 B;  4ESP A;  3X1U A;  4J8W B;  3W98 A;  3MVD C;  4A5R A;  3W96 D;  3QP2 A;  4Y0O A;  2NQB C;  3HL9 A;  4II7 A;  2Q9M A;  2PYP A;  1G5U A;  5FSR A;  5AQB A;  5F99 C;  1W1P A;  3IBR A;  3IHA A;  5FI7 A;  3C4O A;  4K0W A;  4KZ8 A;  3W97 C;  2O99 A;  4ZJ1 A;  4GS9 B;  2HJ9 C;  3VP0 A;  5B40 C;  2F8N H;  3ZG0 A;  4Y13 A;  1ES3 A;  3E2L A;  3MS6 A;  2OLU A;  1PWC A;  5C5K A;  5A90 A;  4KZ9 A;  3W97 B;  2WKE A;  1DJC A;  2F8N A;  1M18 A;  2EXA A;  2ZMA A;  3HLB A;  3HVF A;  3CG5 A;  4DMZ A;  3AZN B;  1PDC A;  5GXQ C;  1EQZ A;  1KDS A;  5CER A;  3WTP C;  1BUL A;  4I5S A;  5AV8 B;  1CF0 A;  4DRA A;  4IJG A;  3REI B;  2IWC A;  2KOI A;  1PYY A;  3MGQ B;  4H9N B;  3H82 A;  3REL A;  1IKI A;  1DJA A;  1LI9 A;  4R8P C;  4WBG A;  3F1O B;  4EER A;  4FUW A;  4IBX A;  1ID3 A;  1D7E A;  4RA7 A;  1Y28 A;  1KX4 C;  3BRM A;  3IF5 A;  1PFL A;  4ZBJ C;  4N1H A;  1ESI A;  5L10 A;  3EEA A;  2XH9 A;  4OJ6 A;  2F8N K;  4GD8 A;  1P3O D;  3WAA B;  1AOI C;  5GSU B;  1ERQ A;  1T1C A;  2F8N B;  3K3D A;  4ZTK A;  4PMA A;  3G30 A;  4XZQ B;  2W3G A;  2O0Y A;  3B6F C;  2DRW A;  1P3K B;  3TRC A;  3AZK A;  4H9Q A;  5FEF A;  3LIF A;  1K56 A;  1SKF A;  3NCK A;  4U0T A;  2ZMV A;  3WRT A;  3NEC A;  2EWV A;  2YKH A;  2QWS A;  4JF6 A;  3UB5 P;  2V9A A;  3KSG A;  2J3T C;  4O8G A;  2OLV A;  3WS4 A;  1WE4 A;  3UY6 A;  3UDF A;  5FAO A;  3KX0 X;  3BW6 A;  3KXB D;  1Z09 A;  4OJL A;  1KX3 D;  3LR3 A;  4P6Z S;  5B1M C;  5B32 G;  5HDC A;  4DKI A;  1GCE A;  3VFF A;  3SS5 A;  3IT9 A;  3L9K A;  1KE3 A;  4OPR A;  4R3A A;  4J8V B;  4JJN B;  4NG2 A;  3UPO A;  4BD0 A;  1UR8 A;  5I94 A;  5B0Z B;  5AVB B;  3OLO A;  4JF4 A;  4S2N A;  3MF0 A;  1DP9 A;  3E2K A;  4OKP A;  4XZQ D;  3S7N A;  4HBU A;  4QPR A;  3VP1 A;  4KZ5 A;  1MC0 A;  1P3I A;  1P3I B;  1KX3 C;  5HAI A;  3ZDJ A;  3DTM A;  3MGP D;  1V9Y A;  5HWV A;  3W4O A;  4WZ5 C;  3LZ0 C;  4L9E A;  2PBY A;  3G4P A;  3VP4 A;  2JCH A;  2XR0 A;  4BWI A;  4R0Q A;  3VE3 A;  1S4S A;  1P3B D;  1M1A A;  1ID3 B;  2GX5 A;  4NXB A;  3IHB A;  3F1O A;  5CPK B;  1GHP A;  3KYQ A;  3AFA D;  3PBN A;  4KEN B;  4IJE A;  1O07 A;  2HUE B;  4AFI A;  3IF6 C;  5J4E A;  3T4O A;  5F82 A;  2UV0 E;  2DNS A;  2F2A C;  3AZH B;  1ES5 A;  4MB4 A;  3BY9 A;  5AV5 B;  3UE1 A;  4E3N A;  3LI8 A;  5FI6 A;  2O9B A;  4HI4 A;  2YKF A;  1W1T A;  2QJ7 A;  5TJJ A;  3REI C;  4DRT A;  1MXO A;  4LFU A;  1P34 C;  5CHM A;  1P3G D;  1U35 D;  5CED A;  3KFU G;  4B4X A;  4JBF A;  3ICY A;  4GH9 A;  3LI9 A;  2IO5 B;  3W8K A;  4KUD D;  4KZ6 A;  3A0R A;  2ZY3 A;  3H7W A;  4IUK A;  2XRO A;  3P5J B;  2JSS A;  4WUJ A;  4DE1 A;  5DNN A;  5B1L A;  1W7F A;  1M40 A;  2ZD8 A;  3H0M C;  4GB7 A;  4NE6 A;  1FOF A;  4IBK A;  4BL2 A;  3DAV A;  4J8U A;  1WYB A;  3LY4 A;  3W4Q A;  1XGJ A;  5EE8 A;  1F98 A;  3MZD A;  2EFU A;  5DFX A;  1MBL A;  3X1U B;  4JLF A;  4R8P D;  4H9N A;  4NXE A;  4EQ1 A;  1ZG4 A;  2BAS A;  4XUJ C;  4I39 A;  4DDY A;  3X1U C;  1Y54 A;  5AV8 A;  3N8L A;  5FEG A;  5B32 B;  3AZN A;  3TG9 A;  1P3M B;  1OT6 A;  1VET B;  4IJF A;  5EM0 A;  5TFQ A;  5AY8 D;  2EXB A;  1M18 C;  5B0Y D;  4HJ6 A;  4X56 A;  4FH2 A;  5B33 A;  3C7U A;  3PTE A;  3W97 A;  1RP5 A;  3AZE A;  3IXH A;  5G4Z A;  3ZG8 B;  2I9V A;  3LIC A;  3B6G A;  2ARO A;  1TZY B;  1XXM A;  5G18 A;  5HZH A;  5CGW A;  4OJ5 A;  4JGR A;  2ZMF A;  4WU8 D;  1TZY D;  4EBL A;  1JFI A;  2JKR M;  2W3H A;  4EEP A;  5B1L D;  4ZRR A;  3X1V A;  1KX3 B;  1CI9 A;  5AV5 A;  4Z66 C;  3AZH A;  2ZQ7 A;  2V2F F;  4YFM A;  3R45 B;  4QNL A;  2P9V B;  1NRF A;  5HSQ A;  2A3U A;  1UR9 A;  3X1V B;  3KSH A;  3E0Y A;  1Z2C B;  3A3I A;  4NZ4 A;  5TBM A;  3ULF A;  3V9R A;  1RCJ A;  3V5M A;  1KVM A;  4EEU A;  3BFE A;  1JFI B;  3C4P A;  3UMD A;  3C30 A;  4Z9Q A;  1E4D A;  4DF6 A;  5B40 B;  1P3K A;  3UE0 A;  5HD5 A;  3NHQ A;  3E4Q A;  3G34 A;  3REK C;  3AZE B;  1YSP A;  5CTM A;  5FAT A;  3AV2 B;  4LV2 A;  1BYW A;  2WZZ A;  5M19 A;  5B33 B;  3S7P A;  3REJ C;  1ED7 A;  1VET A;  4E3M A;  2ZQD A;  1W8Q A;  1PRQ A;  3U4L P;  1F2K A;  5L8M A;  5JRG A;  3MQO A;  1MWU A;  3REJ B;  4NZ3 A;  3AN2 B;  5B0Z A;  2PYO D;  2VGL M;  3B6G D;  2VGJ A;  4IBI A;  2L5A A;  1HQ3 C;  5U47 A;  1P3A C;  3X1T B;  1Q2Q A;  4NFT A;  5HW3 A;  1B67 A;  2CMN A;  5EM1 A;  5JYP A;  5DFY A;  3AN2 C;  2Z2M B;  5B31 G;  2W3F A;  3G2Z A;  1I2W A;  1KX4 B;  2JKT M;  3B42 A;  3TOI A;  4WU9 D;  4NZ5 A;  4JGO A;  4EBP A;  1WA9 A;  3HLW A;  2RL3 A;  5DNN B;  1KS0 A;  3B0C W;  1XP4 A;  1P3G C;  4LRY C;  4WMC A;  3C1B B;  2A24 B;  4GCZ A;  4H9Q B;  4Z5T C;  1K4F A;  2J9O A;  2PR5 A;  4XUJ B;  3REJ D;  3OPH A;  5AV9 D;  2ZQ8 A;  4LV1 A;  4CJN A;  4IBD A;  3C1B C;  2A24 A;  4NEE D;  3UPP A;  2QMI A;  3SS3 A;  2RVQ D;  3BJN A;  2PYO B;  4EO5 C;  5HDS A;  3BFF A;  3WD1 A;  2RTS A;  4GHI A;  4UUZ A;  5CGX A;  5AVC D;  1JWP A;  3IH9 A;  2D01 A;  3W2Z A;  3U2A A;  2H0T A;  1H8Y A;  3W98 B;  3W99 C;  3PBT A;  3LGO A;  3C1C D;  4KZ3 A;  3AV2 D;  2O9A A;  3D72 A;  4JXG A;  4RX2 A;  3OBF A;  5HAP A;  3NC8 A;  2WGV A;  3CAX A;  5B24 D;  4JGQ A;  5AQA A;  4IBF A;  3MGQ A;  5KSH A;  5CPJ A;  3X1T A;  3LR0 A;  3REI A;  4YIN A;  1M19 B;  3BEC A;  5F5Y A;  3L28 A;  1ONH A;  5DKK A;  4Y3I A;  3GV9 A;  3EPK A;  1P3L D;  1M19 C;  4HME A;  3AZJ B;  2E8I A;  4Z2M G;  1P3F A;  4X53 A;  2FFY A;  3UT9 B;  3VH6 W;  3P98 A;  4DE2 A;  5E5A C;  1W79 A;  3MGR C;  1K57 A;  4YM6 B;  2ZM2 A;  4R23 A;  3SZT A;  2RVQ C;  2Q9N A;  2K7S A;  1P3G A;  4GS9 A;  4Y7P A;  4QD4 A;  3VSL A;  5HPF A;  3GDI A;  4DJ2 A;  3NQJ A;  1AWI A;  1YT4 A;  4E6X A;  4MB3 A;  2H0Y A;  5B0Y B;  3R45 A;  3IX4 A;  1KDW A;  1WWS A;  1YM1 A;  3NDE A;  4J8W A;  1P3P C;  2PT7 A;  5F99 A;  2WZX A;  1RGY A;  4BL3 A;  3F1N B;  4G92 B;  3DWZ A;  5L07 A;  1L0G A;  3BM6 A;  1ZC2 A;  4MCW A;  3REL D;  1ES2 A;  4ZJ2 A;  3AZN C;  3Q7V A;  4PKY A;  4PM5 A;  1PWG A;  5EFW A;  4IBJ A;  1E88 A;  3VOY A;  5CPI A;  5JRG C;  1S32 C;  3AZK B;  2ARO B;  5CHU A;  4BEN A;  3UB7 A;  4IBB A;  2VJW A;  3GVB A;  3Q82 A;  3RTY A;  1BLH A;  2GJ3 A;  1HQ3 A;  3MGQ C;  4DJ3 A;  3F1P A;  2MJ6 A;  3CPT A;  1XFQ A;  1Q2P A;  3AZL C;  3K2N A;  5GSU A;  1CEF A;  4N1X A;  4G91 B;  1IFQ A;  2WGI A;  4KZ4 A;  4MBF A;  1KX4 D;  3WAA A;  2VGL S;  3SW1 A;  4NY2 A;  2IWD A;  4CQH A;  3MNN D;  3AZL A;  3WS0 A;  3G32 A;  1F1E A;  3MMH A;  1STZ A;  3O5Y A;  2QYB A;  3MGS B;  3WAA C;  4ME4 A;  4BBT A;  5DNM A;  3UB6 A;  2W1R A;  2Y2Q A;  3W97 D;  1GSX A;  4R8P A;  3AZE D;  2D49 A;  3D3O A;  3REL B;  3KYE A;  1O6I A;  3H82 B;  3MGR A;  2ZLY A;  4H9S A;  3N6I A;  4MBK A;  1H0G A;  3VP2 A;  2XDM A;  2X71 A;  3A6N B;  5CRF A;  3WA9 A;  2J9P A;  1F66 A;  3HCY A;  4QLC C;  4MB5 A;  2W1T A;  3LEL D;  4DRB A;  3BQA A;  4KHA B;  3REK A;  4WZ5 A;  1S1Y A;  2R78 A;  1L2S A;  3UE6 A;  4IUH A;  4J8X C;  2XFT A;  1FSW A;  1NLY A;  4GOG A;  1M18 B;  2M1C A;  2EFX A;  4AWL C;  4O01 A;  1G28 A;  2FJ7 D;  2Y2K A;  4PM9 A;  2AVX A;  3M7P A;  1F5M A;  4OVD A;  2DQN C;  1PI4 A;  3L7H A;  3QP4 A;  3LZ1 D;  3W96 C;  3MBZ A;  3NDG A;  1ERO A;  3MGP B;  1Y4O A;  2XFS A;  4YS3 C;  1P3I D;  4GKU A;  3OCL A;  4WZ4 A;  1DJB A;  1X0O A;  1XJ3 A;  5IS1 A;  3V39 A;  4EW7 A;  3B0C T;  5A91 A;  4E3J A;  5BO0 B;  4JJN D;  1P3B A;  1M1A D;  1SZV A;  1Z6F A;  1FSY A;  3MVD B;  1M1A B;  3LJA A;  1LI0 A;  4QLC D;  5EOE A;  2JC7 A;  1YLP A;  4R1G A;  3M2K A;  4RQ9 A;  4NXG A;  3MFD A;  4FH4 A;  3T4Q A;  2Q0O A;  3M6H A;  1E3U D;  3OOV A;  4WU9 A;  2QHK A;  4ID4 A;  2HUE C;  3T4L A;  1YKD A;  4MN7 A;  1L0F A;  1H3Q A;  3O3V A;  5AVB A;  1ULY A;  3WKJ C;  4HP9 A;  3MQ0 A;  3O62 D;  3ZVT A;  2W3E A;  1P34 D;  3WKJ A;  1AOI D;  4E3K A;  3AZF B;  2YFV B;  1ERM A;  2V1Z A;  5CEC A;  2F8N D;  1EAK A;  2XF3 A;  2LY8 A;  3B6F D;  1W8Y A;  3UDI A;  5AV6 A;  1CXW A;  1H8M A;  3IWI A;  3G6O A;  5GT0 A;  4MN5 A;  1E6R A;  3DTE A;  5J3W A;  3BLS A;  4EWF A;  2Y2I A;  5HD3 A;  3T4J A;  5KDM B;  1WWI A;  4XXR A;  2FH5 A;  5HWW A;  2VZW A;  3VOZ A;  3MGS D;  2HZ5 A;  2BG1 A;  4HEF A;  5CXW A;  5IHV A;  5DVA A;  2ZM0 A;  2B18 A;  5B2I A;  1IYP A;  4R3B A;  2BLS A;  4EES A;  1TDG A;  3N8S A;  4Y15 A;  2O9C A;  3G35 A;  2ZY2 A;  4FOF A;  3CMZ A;  4R4R A;  4NYY A;  4KUD B;  1SKO B;  5G49 A;  1IEL A;  3L25 A;  2NZD C;  2OWH A;  5B32 C;  1OJG A;  3LR5 A;  1K54 A;  4G3K A;  1ALQ A;  5BNV B;  3A3J A;  5CP6 D;  5C3I B;  3QP6 A;  1OTB A;  4OUI A;  1LHY A;  4WZS B;  3C2W A;  3RXW A;  3LEQ A;  3AFA C;  4YS3 B;  5EVE A;  4CSR B;  2JKR I;  2HP6 A;  3AZH D;  4HNB A;  4R38 A;  3UTB A;  2CC1 A;  2A2L A;  4Y0T A;  3O87 A;  2V8C A;  4J8W C;  1P3P A;  1QO6 A;  3P7N A;  3REH B;  5AVF A;  4S2P A;  2NQB B;  2Y55 A;  5GT0 D;  1JNU A;  1LL8 A;  1ZKJ A;  4HJ3 A;  5F6A A;  4X23 B;  3TJZ C;  5B0Z C;  5FQI A;  2FJ7 C;  2PAV P;  1M19 D;  4KGC A;  2WKR A;  2B02 A;  3A3F A;  3IF6 A;  3S1Y A;  3QP5 A;  4H9O B;  3N7W A;  5CPK C;  1NYY A;  2ZJ9 A;  2XA7 M;  2GZA A;  5HFO A;  3UT9 D;  1LSV A;  1XA1 A;  5HL6 A;  4Z2K A;  4LGW A;  4GHL A;  4RVA A;  3NQU B;  3WTP E;  3LZ0 B;  1NRJ A;  3UB8 A;  1VEU A;  5AV5 C;  3NBL A;  1SDE A;  3N4I A;  4ARZ A;  1BZA A;  4UA9 A;  1K55 C;  2KDK A;  5GSU D;  4N9K A;  4Z1W A;  3HON A;  3AZM C;  2WAD A;  2P7J A;  4G92 C;  2IO5 C;  5TGF A;  4L9G A;  2VV8 A;  4CLC C;  1CK7 A;  2PU2 A;  4ZUX B;  3EEH A;  3T1S A;  1BFM A;  1E15 A;  4BMW A;  1S0W A;  1ZTU A;  4GD6 A;  4H9S C;  3N3F A;  2OOL A;  5DNM D;  3RJU A;  3V67 A;  3EGD C;  4C3Q A;  4G3V A;  3LIB A;  4NKP A;  4CLC B;  2L0W A;  5DF9 A;  4XUZ A;  4WNN A;  1N9N A;  3WS1 A;  3AFA A;  4LD9 B;  3HJI A;  4Z5T D;  2V8F A;  1G6O A;  2JBF A;  2M7U A;  3MFX A;  2ZBB A;  3LEL A;  3HLC A;  4IHQ A;  3LZ0 D;  2OAQ 1;  2Z2L B;  3O62 C;  5AQ9 A;  1PWD A;  3T1X A;  2ZC7 A;  1OTA A;  4LCL A;  3WD3 A;  1N1J B;  3AV1 A;  2FJ7 A;  2PRF A;  1XX2 A;  2LB5 A;  3X1S C;  1L6J A;  1P3O B;  4QY5 A;  5EVI C;  3A1I A;  3MNN B;  5AVC A;  5EV0 A;  2WKQ A;  3T1Q B;  1ZLA B;  1YU4 A;  3A6N C;  1JWV A;  4PHT A;  1LL5 A;  3X1S B;  3CI6 A;  3KWQ D;  1GA0 A;  1S1Z A;  3MKE A;  5DTS A;  4BLM A;  2VK3 A;  4EV4 A;  5JA4 B;  1E6Z A;  4U3T A;  1ZLA C;  1HD8 A;  1TZY C;  3HUM A;  3REI D;  3EPJ A;  4WEL A;  1L3L A;  4PM6 A;  2Y2O A;  1DP8 A;  1FQG A;  3GMW A;  2B95 A;  3AZM D;  1V9Z A;  4Z2M H;  5CP6 B;  3FPW A;  1EWZ A;  5AVB C;  4FSF A;  4MBH A;  2IWB A;  1MZU A;  1P3L A;  2WKI A;  3VH5 T;  4JGP A;  2X01 A;  4KZ7 A;  1H8Z A;  2ZL1 A;  3A3D A;  4YS3 D;  1P3I C;  3UTB C;  3UO9 A;  1E3U A;  3EPL A;  4H6J A;  3ZQ5 A;  3AZG B;  3AYW A;  3KSI A;  1BH9 B;  3LZ1 B;  1DP6 A;  5B2J C;  3AV1 D;  1D06 A;  5F83 A;  1LSX A;  4CPK A;  3LJA D;  3MXQ A;  3KXB C;  1GHM A;  5AVB D;  1FIL A;  3MXR A;  1M1A C;  5E5A B;  4ZDX A;  4KGC C;  3KS8 A;  3O62 A;  2HDU A;  5B1M D;  5B33 C;  4BQM A;  4UQI S;  2BYK A;  2HDQ A;  3K3C A;  5I5L A;  4WEJ A;  4J8W D;  1LSW A;  3ZG9 B;  2H10 A;  2WUQ A;  5FDH A;  2EX9 A;  2EWW A;  3C7V A;  3PAE A;  5CPJ C;  4O7D A;  2V1A A;  3AZM B;  2XD1 A;  3L26 A;  4IBC A;  1K38 A;  2DMW A;  3TU4 B;  1P3A D;  2I72 A;  2WKP A;  2HGV A;  5GXQ A;  3R7W B;  3IBJ A;  4PKY G;  1J9M A;  4DDS A;  3HLD A;  3TU4 C;  4OOY A;  4X55 A;  3EWK A;  3KWQ B;  4BBU A;  2NUT C;  4P6Z M;  4KG6 A;  3WKJ D;  3W98 D;  1ZLA D;  3TU4 A;  2CV5 C;  3WA9 C;  2OV5 A;  1U60 A;  1J3W A;  1YLT A;  3FPV A;  4OJO A;  3IX3 A;  2HIO B;  5GHZ A;  5BS7 A;  3WS5 A;  1OJ5 A;  4LD9 D;  1CQA A;  1XFN A;  4PPR A;  2ZM5 A;  5BPV A;  1MWR A;  1YU2 A;  3LFV A;  1K6R A;  1KX5 A;  3O62 B;  4KQR A;  1K25 A;  4CLC D;  5E2H A;  4Z2L A;  1AOI B;  3LY3 A;  1DY6 A;  2FZ0 A;  3VP3 A;  4HES A;  1K4E A;  4X6T A;  3KS4 A;  3AZG A;  1YU0 A; 
#chains in the Genus database with same CATH homology
 2HP5 A;  1E25 A;  3EQV A;  3ZNT A;  3REK D;  4LV3 A;  3PAG A;  3IWO A;  1P3A A;  1VQQ A;  3KUY B;  3W99 B;  4Y0U A;  1P3P D;  5HAQ A;  3WTP A;  1TAF B;  5B24 A;  1I5Q A;  4N9L A;  5CPJ D;  3X1T D;  1ID3 D;  5B1M B;  4Z66 A;  1U35 B;  4WEK A;  1BH8 A;  4AWL B;  3DWK A;  4IBR A;  4H9P B;  4KZA A;  4C75 A;  4E3I A;  1BSG A;  5B31 C;  1PZR A;  4JJN C;  4BJP A;  3W96 B;  2WGW B;  3S22 A;  1SHV A;  1MKI A;  1NYM A;  1YUE A;  2W8S A;  2BYM A;  5B31 A;  4JXW A;  2NZD A;  4J8U C;  5L2F A;  2WYX A;  3ZCZ A;  1FR1 A;  1H3O A;  2FJ7 B;  3H0R C;  4QJG A;  1YU3 A;  2G5I C;  3S4X A;  3AZG D;  4WV4 B;  3IP4 C;  2OSU A;  5AY8 C;  5EPH A;  4QU3 A;  4J8X A;  3LEL B;  3W99 A;  3KUY A;  2GDN A;  3KXB A;  1HTZ A;  1YMS A;  3VFH A;  5CPI C;  5F99 D;  2Y2N A;  3LEL C;  4UA7 A;  2F8N G;  5FI2 A;  1KE4 A;  5AVC C;  1S32 D;  3P09 A;  1CI8 A;  1T3U A;  5AQ7 A;  4OQH A;  1XA7 A;  4WU8 A;  2XD5 A;  5AV9 B;  1P34 A;  3AZF D;  5E2E A;  1KGG A;  3AZK D;  4N92 A;  4S2J A;  1P34 B;  5FUG A;  5EVI A;  2CV5 B;  2P74 A;  3UTA D;  5KMW A;  1EQZ C;  1YQS A;  2Y91 A;  5HX9 A;  5DNM C;  2HIO C;  3WAA D;  3WRZ A;  2NZD D;  3HSH A;  5GT3 D;  5CTN A;  3MGS C;  1NZU A;  3JYI A;  4WM9 A;  1FCM A;  4EBN A;  3GSG A;  3ITB A;  2IOU A;  4X69 A;  2YFW B;  4IBE A;  5CPI D;  1NXY A;  1G68 A;  4MEZ A;  3B3X A;  1P3O C;  5FQ9 A;  3NIA A;  2BYM B;  3IXG A;  5BT1 C;  3GTC A;  3OZH A;  2J8Y A;  1ES4 A;  2BYK B;  1S32 A;  5AV6 C;  3W96 A;  3EPH A;  1BLP A;  3UTA B;  5FA7 A;  3FYZ A;  4YS3 A;  2Y2L A;  1P3M C;  4M6B A;  4CAY B;  3ISG A;  3OCN A;  4S2K A;  3VSK A;  3LZ1 A;  4QLC B;  5BNV A;  4JXS A;  4LG2 A;  1TEM A;  4X23 D;  4OP5 A;  3AGF A;  5DF8 A;  1HZO A;  5CP6 C;  1P3B C;  4OLG A;  1KVL A;  3NY4 A;  1C3B A;  1K57 C;  3GRJ A;  1M18 D;  4J8V C;  4H9R A;  3AZI B;  1IEM A;  3UT9 C;  3PBR A;  5KDM A;  4QLC A;  5B2J B;  4X23 C;  3WS2 A;  1VM1 A;  2RIQ A;  5B1L C;  3M2J A;  3O86 A;  4OQG A;  3BFC A;  5GHY A;  3WX7 A;  5J8X A;  3H0L C;  5AY8 A;  2JE5 A;  1P3M D;  3C1C A;  4KG2 A;  5AVC B;  3G31 A;  5KZH A;  1P3O A;  4S2O A;  3WKJ B;  3QHY A;  5B2J A;  4OPY A;  3GQZ A;  1YLY A;  4U0X A;  3AV1 B;  5CHJ A;  3W4P A;  2YFW A;  3FV7 A;  2ARO C;  4OOL A;  4H9R B;  3AZI A;  4B4Z A;  3O88 A;  4E6W A;  3TU4 D;  1P3A B;  4WU9 B;  5GXQ B;  4RX3 A;  2UWX A;  4ZBE A;  4KQQ A;  4PM7 A;  4L0L A;  4GZB A;  4OPZ A;  5FQM A;  2X02 A;  3VH6 T;  4KZB A;  3AZF C;  5FUG B;  4CAY A;  5E5A A;  1P3K D;  3AN2 D;  4LV0 A;  5FQJ A;  2ARO D;  4UPK A;  4HGA B;  2WAF A;  4Z5T B;  2HIO D;  5JYO A;  3SH9 A;  5AV5 D;  4FD8 A;  2H5S A;  4GN2 A;  1F66 C;  3BYD A;  5JRG D;  3A3E A;  4XZQ C;  3KUY C;  5B40 D;  1EI5 A;  3B6F A;  1YLW A;  5C3I C;  5DTK A;  4J8X B;  1P3K C;  5CPK D;  1S6R A;  1KU5 A;  5DTT A;  4WU8 C;  1A7W A;  5GT3 B;  1KGF A;  1N9B A;  2NZD B;  4GDB A;  5B31 B;  3C1C B;  3B0D C;  3AZI C;  1ZG6 A;  5GLC A;  4DXC A;  4RYE A;  3V3S A;  5B31 D;  4P0M A;  4KGC D;  5B24 C;  5E5A D;  3MGR D;  5AV9 A;  1U35 A;  5B1M A;  4Z66 B;  2C6W B;  1N1J A;  1FR6 A;  3VMA A;  1PZO A;  5B24 B;  2J8P A;  5BNX B;  4KUD A;  1BLC A;  4J8X D;  1GHI A;  3LEZ A;  5M18 A;  3W99 D;  1RGZ A;  5EVI D;  5FQQ A;  1K54 C;  3KXB B;  3A1K A;  3GR2 A;  3EG5 B;  3MZE A;  5DNN D;  1JWZ A;  1PI5 A;  4D2O A;  2ZC6 B;  3MXS A;  4K91 A;  3AYW C;  5BNX A;  2PU4 A;  2ZC3 B;  1BT5 A;  2CV5 D;  1H3O B;  3PBO A;  5AV8 C;  3HUN A;  1NJ4 A;  4OPQ A;  1B6W A;  4LD9 C;  3UTA A;  1KE0 A;  2WK0 A;  3AZK C;  1S32 B;  5GLB A;  4DE0 A;  3KWQ C;  1P3F D;  1NZO A;  3IQA A;  4WJ3 C;  3VH6 A;  4DXB A;  4ZBJ B;  4H9P A;  5GT3 A;  3NQJ B;  3AZN D;  2ZQ9 A;  3CZD A;  5B2I C;  5GHX A;  4DQY B;  4G91 C;  1K56 D;  3LJA C;  1K55 A;  1CK3 A;  3HBR A;  3BLM A;  5DNN C;  3B6F B;  1JTD A;  4P85 A;  1P3F C;  4X23 A;  3REL C;  4OON A;  4JF5 A;  3ZVW A;  1IYO A;  1IYS A;  2Y2J A;  4Z5T A;  1MY8 A;  5FAP A;  2CV5 A;  3UDX A;  2Y2H A;  5EVI B;  4CSR A;  3HLF A;  3L27 A;  4ZUX A;  4EO5 B;  1AOI A;  3V3R A;  1BUE A;  3DW0 A;  4WU8 B;  1BH9 A;  5BO0 A;  4JPM A;  3M6B A;  2XLN A;  3AZJ D;  3W98 C;  4E3O A;  3B0D B;  3UE3 A;  4NK3 A;  4NE5 A;  5E43 A;  3AZG C;  5DF7 A;  5EVL A;  1P3L B;  3KWQ A;  1SCW A;  4J8V D;  4OLD A;  4H9O A;  1L0E A;  4YM6 D;  1YLZ A;  4KGC B;  3Q07 A;  3AZJ C;  4GHA A;  5JA4 A;  4R3J A;  3AZM A;  4H8R A;  1M6K A;  3BEB A;  4OQ0 A;  3HUO A;  5GT0 B;  4KG5 A;  3AZI D;  1SDN A;  5AY8 B;  2EX8 A;  2HP9 A;  1W2E A;  1KX4 A;  4B88 A;  4EUZ A;  4OJP A;  1HVB A;  3AZL D;  4C6Y A;  5F1F A;  2YFV A;  3AZF A;  3AZH C;  4XUJ D;  1BH8 B;  1W5D A;  1ID3 C;  3ZG5 A;  1L0D A;  1MWS A;  5G49 B;  1TAF A;  3FKV A;  3OPP A;  3WTP B;  1BLS A;  4OP8 A;  3REJ A;  1OME A;  4E44 A;  4QB8 A;  3WWX A;  3TSG A;  1PZP A;  3AGE A;  3VH5 W;  4NET A;  4IBG A;  1CEG A;  4LD9 A;  5B2I B;  1EQZ D;  4WNN B;  1HQ3 B;  1KX5 D;  4UAA A;  3Q81 A;  3X1T C;  5GXQ D;  4IVI A;  5B40 A;  3V50 A;  5F1G A;  3BFD A;  3LJA B;  3Q1F A;  4QHC A;  4QY6 A;  3MGQ D;  3L29 A;  5GSU C;  5CEB A;  2WKH A;  2XQZ A;  3X1S A;  3MKF A;  4E45 A;  4MLL A;  1ZLA A;  2P9V A;  2HIO A;  5B0Y A;  3SH7 A;  4ZJ3 A;  5E2G A;  1FCN A;  2ZY4 A;  1GA9 A;  4S2N C;  4J8U D;  3OPR A;  4HBT A;  3WTP D;  4S2M A;  3NQU A;  2G2W A;  2Y2G A;  1N4O A;  2FFF B;  1U35 C;  1HTA A;  3OC2 A;  1TZY A;  4P6B A;  3B6G B;  2VGK A;  4KUD C;  4NE3 A;  2QPN A;  3X1V D;  4KQO A;  1KX5 C;  4P87 A;  3IXB A;  3AFA B;  3ZG7 B;  2NQB A;  3HLE A;  3REH A;  1JVJ A;  2ZC4 B;  3SS4 A;  3FWL A;  3ITA A;  4PM8 A;  2HDS A;  3UTB B;  4IVK A;  4DE3 A;  3HLG A;  3REH C;  3MVD D;  3LZ1 C;  2ZQA A;  3QNB A;  1Q9C A;  5GLD A;  1G6A A;  4R4S A;  4J8U B;  2Y4A A;  2EX6 A;  1TVF A;  3CJM A;  5B32 D;  4X68 A;  5B1L B;  3AGD A;  3PBS A;  5B0Z D;  2PYO A;  3MGP A;  5AV6 D;  3B0B A;  3X1V C;  5CP6 A;  5AV9 C;  2G2U A;  4WYY A;  5FAS A;  2EX2 A;  3AL0 C;  5HL1 A;  3IF6 B;  3X1U D;  1H5X A;  4F94 A;  2J7V A;  5CPI B;  5A92 A;  2B5R A;  3UTB D;  1PIO A;  3L2A A;  4ZUX C;  4KHA A;  3REK B;  2ZY5 A;  5BT1 D;  1P3P B;  3REH D;  3WA9 B;  2WGW A;  3KUY D;  1FCO A;  2WAE A;  1I2S A;  1IYQ A;  4R8P B;  3ZNY A;  4Q8I A;  5DNM B;  1P3G B;  4ZUX D;  3FKW A;  3AZL B;  2QZ6 A;  4LEN A;  1P3F B;  4FCF A;  3AZJ A;  3UPN A;  3AV2 A;  1MWT A;  4WMC D;  4BD1 A;  5EOO A;  3EQU A;  3B6G C;  1M19 A;  1ESU A;  4JJN A;  1ONG A;  4J8V A;  2CWE A;  1KX5 B;  5AV6 B;  1P3B B;  3FZC A;  2G5H C;  3N8R A;  3LO7 A;  3OPL A;  1KGE A;  3PBQ A;  1TDL A;  4NYU A;  5A93 A;  1LL9 A;  1QME A;  4S2I A;  1KX3 A;  4UUZ B;  2ZQC A;  4MNR A;  4M3K A;  1PW8 A;  5E2F A;  3NI9 A;  3LZ0 A;  3BFG A;  1YU1 A;  5BS7 C;  5HAR A;  3LCE A;  2Y2P A;  2ZM8 A;  3Q7Z A;  5TR7 A;  4ZAM A;  1XPB A;  4YM6 A;  3VH5 A;  2XGN A;  4XUJ A;  3D4F A;  4XZQ A;  1PW1 A;  3C1B D;  3ZGA B;  4YM6 C;  3C5A A;  2Y2M A;  1IKG A;  1P3M A;  2V20 A;  2Y59 A;  5GT0 C;  3A6N A;  5BOH A;  4Z66 D;  1YLJ A;  5B2J D;  2XEP A;  3AV1 C;  5B0Y C;  3AZE C;  5CPJ B;  1WYC A;  5D3O A;  5EUA A;  3AV2 C;  3MGR B;  3ZFZ A;  3RXX A;  2A49 A;  1LLB A;  2XK1 A;  4UA6 A;  3AYW B;  3I7J A;  3MGS A;  3F6T A;  1K6S A;  5JRG B;  5B2I D;  1EQZ B;  3X1S D;  2R9W A;  1NY0 A;  3FDD A;  4S2L A;  3SH8 A;  1QMF A;  5M1A A;  4WU9 C;  1BTL A;  3G2Y A;  3ZHH A;  4E3L A;  3C1B A;  3MZF A;  1HQ3 D;  3WA9 D;  1F66 D;  3SOI A;  4OQI A;  1XKZ A;  5FQK A;  1F66 B;  5CGS A;  3QNC A;  4JXV A;  4IED A;  3A6N D;  5EEC A;  4OOM A;  1XGI A;  3MNN A;  1YMX A;  4HGA C;  4OH0 A;  3KSY A;  2RCX A;  5CPK A;  4XUX A;  3UTA C;  2HDR A;  4K0X A;  1R4V A;  3AYW D;  3MNN C;  2PYO C;  5CHL B;  1AXB A;  3AN2 A;  5AV8 D;  1JTG A;  5GT3 C;  3HRE A;  3FKE A;  4GDN A;  1O7E A;  2ZC5 B;  3UN7 A;  3UT9 A;  4LCM A;  4UHU A;  3UNW A;  4NZ1 A;  3IH8 A;  3IWQ A;  2NQB D;  2DF4 C;  5GL9 A;  3MGP C;  5B33 D;  5B32 A;  1MPL A;  2R9X A;  4JKT A;  2DCF A;  3IXD A;  4GNU A;  2VQR A;  2C5W B;  3Q7V B;  5GLA A;  2HPB A;  3MVD A;  4EQI A;  5KSC A;  5FAQ A;  1P3L C;  3V9R B;  3C1C C;  5F99 B;  3X1U A;  4J8W B;  3W98 A;  3MVD C;  4A5R A;  3W96 D;  4Y0O A;  2NQB C;  3HL9 A;  2Q9M A;  5FSR A;  5AQB A;  5F99 C;  3IHA A;  5FI7 A;  3C4O A;  4K0W A;  4KZ8 A;  3W97 C;  4ZJ1 A;  3VP0 A;  5B40 C;  2F8N H;  3ZG0 A;  1ES3 A;  3E2L A;  2OLU A;  1PWC A;  5A90 A;  4KZ9 A;  3W97 B;  2WKE A;  1DJC A;  2F8N A;  1M18 A;  2EXA A;  2ZMA A;  3HLB A;  3HVF A;  3CG5 A;  3AZN B;  5GXQ C;  1EQZ A;  1KDS A;  5CER A;  3WTP C;  1BUL A;  5AV8 B;  4DRA A;  3REI B;  2IWC A;  1PYY A;  3MGQ B;  4H9N B;  3REL A;  1IKI A;  1DJA A;  1LI9 A;  4R8P C;  4WBG A;  4IBX A;  1ID3 A;  4RA7 A;  1KX4 C;  3BRM A;  3IF5 A;  4ZBJ C;  4N1H A;  1ESI A;  2XH9 A;  4OJ6 A;  2F8N K;  4GD8 A;  1P3O D;  3WAA B;  1AOI C;  5GSU B;  1ERQ A;  2F8N B;  4ZTK A;  4PMA A;  3G30 A;  4XZQ B;  3B6F C;  2DRW A;  1P3K B;  3AZK A;  4H9Q A;  1K56 A;  1SKF A;  3NCK A;  4U0T A;  3WRT A;  4JF6 A;  2OLV A;  3WS4 A;  1WE4 A;  3UY6 A;  3UDF A;  5FAO A;  3KXB D;  4OJL A;  1KX3 D;  5B1M C;  5B32 G;  4DKI A;  1GCE A;  3VFF A;  3SS5 A;  3IT9 A;  1KE3 A;  4OPR A;  4J8V B;  4JJN B;  3UPO A;  4BD0 A;  5I94 A;  5B0Z B;  5AVB B;  4JF4 A;  4S2N A;  3E2K A;  4OKP A;  4XZQ D;  4HBU A;  3VP1 A;  4KZ5 A;  1P3I A;  1P3I B;  1KX3 C;  5HAI A;  3ZDJ A;  3DTM A;  3MGP D;  3W4O A;  4WZ5 C;  3LZ0 C;  2PBY A;  3G4P A;  3VP4 A;  2JCH A;  2XR0 A;  4R0Q A;  1P3B D;  1M1A A;  1ID3 B;  3IHB A;  5CPK B;  1GHP A;  3AFA D;  3PBN A;  4KEN B;  4IJE A;  1O07 A;  2HUE B;  3IF6 C;  5F82 A;  2DNS A;  2F2A C;  3AZH B;  1ES5 A;  5AV5 B;  3UE1 A;  4E3N A;  5FI6 A;  3REI C;  4DRT A;  1MXO A;  1P34 C;  5CHM A;  1P3G D;  1U35 D;  5CED A;  3KFU G;  4B4X A;  4JBF A;  4GH9 A;  2IO5 B;  3W8K A;  4KUD D;  4KZ6 A;  2ZY3 A;  3P5J B;  2JSS A;  4DE1 A;  5DNN A;  5B1L A;  1W7F A;  1M40 A;  2ZD8 A;  3H0M C;  4GB7 A;  4NE6 A;  1FOF A;  4IBK A;  4BL2 A;  4J8U A;  1WYB A;  3LY4 A;  3W4Q A;  1XGJ A;  5EE8 A;  3MZD A;  2EFU A;  1MBL A;  3X1U B;  4JLF A;  4R8P D;  4H9N A;  1ZG4 A;  4XUJ C;  4DDY A;  3X1U C;  1Y54 A;  5AV8 A;  3N8L A;  5B32 B;  3AZN A;  3TG9 A;  1P3M B;  4IJF A;  5TFQ A;  5AY8 D;  2EXB A;  1M18 C;  5B0Y D;  4X56 A;  4FH2 A;  5B33 A;  3C7U A;  3PTE A;  3W97 A;  1RP5 A;  3AZE A;  3IXH A;  3ZG8 B;  3B6G A;  2ARO A;  1TZY B;  1XXM A;  5G18 A;  5CGW A;  4OJ5 A;  4WU8 D;  1TZY D;  4EBL A;  1JFI A;  5B1L D;  3X1V A;  1KX3 B;  1CI9 A;  5AV5 A;  4Z66 C;  3AZH A;  2ZQ7 A;  2V2F F;  4YFM A;  3R45 B;  4QNL A;  2P9V B;  1NRF A;  2A3U A;  3X1V B;  1Z2C B;  3A3I A;  4NZ4 A;  3V5M A;  3V9R A;  1RCJ A;  1KVM A;  3BFE A;  1JFI B;  3C4P A;  4Z9Q A;  1E4D A;  4DF6 A;  5B40 B;  1P3K A;  3UE0 A;  3G34 A;  3REK C;  3AZE B;  5CTM A;  5FAT A;  3AV2 B;  4LV2 A;  2WZZ A;  5M19 A;  5B33 B;  3REJ C;  4E3M A;  2ZQD A;  1W8Q A;  5JRG A;  1MWU A;  3REJ B;  4NZ3 A;  3AN2 B;  5B0Z A;  2PYO D;  3B6G D;  2VGJ A;  4IBI A;  2L5A A;  1HQ3 C;  5U47 A;  1P3A C;  3X1T B;  1Q2Q A;  4NFT A;  5HW3 A;  1B67 A;  5JYP A;  3AN2 C;  2Z2M B;  5B31 G;  3G2Z A;  1I2W A;  1KX4 B;  3TOI A;  4WU9 D;  4NZ5 A;  4EBP A;  3HLW A;  5DNN B;  2RL3 A;  3B0C W;  1XP4 A;  1P3G C;  4WMC A;  3C1B B;  4H9Q B;  4Z5T C;  1K4F A;  2J9O A;  4XUJ B;  3REJ D;  3OPH A;  5AV9 D;  2ZQ8 A;  4LV1 A;  4CJN A;  4IBD A;  3C1B C;  3UPP A;  2QMI A;  3SS3 A;  2RVQ D;  2PYO B;  4EO5 C;  3BFF A;  4UUZ A;  5CGX A;  5AVC D;  1JWP A;  3IH9 A;  2H0T A;  1H8Y A;  3W98 B;  3W99 C;  3PBT A;  3C1C D;  4KZ3 A;  3AV2 D;  4RX2 A;  4JXG A;  5HAP A;  3NC8 A;  2WGV A;  5B24 D;  5AQA A;  4IBF A;  3MGQ A;  5KSH A;  5CPJ A;  3X1T A;  3REI A;  4YIN A;  1M19 B;  3BEC A;  3L28 A;  1ONH A;  3GV9 A;  3EPK A;  1P3L D;  1M19 C;  3AZJ B;  2E8I A;  4Z2M G;  1P3F A;  4X53 A;  2FFY A;  3UT9 B;  3VH6 W;  3P98 A;  4DE2 A;  5E5A C;  1W79 A;  3MGR C;  1K57 A;  4YM6 B;  2ZM2 A;  4R23 A;  2RVQ C;  2Q9N A;  1P3G A;  4Y7P A;  4QD4 A;  3VSL A;  3NQJ A;  1YT4 A;  4E6X A;  2H0Y A;  5B0Y B;  3R45 A;  1KDW A;  1WWS A;  1YM1 A;  3NDE A;  4J8W A;  1P3P C;  5F99 A;  2WZX A;  1RGY A;  4BL3 A;  4G92 B;  3DWZ A;  1L0G A;  3BM6 A;  1ZC2 A;  3REL D;  1ES2 A;  4ZJ2 A;  3AZN C;  3Q7V A;  4PM5 A;  1PWG A;  4IBJ A;  3VOY A;  5CPI A;  5JRG C;  1S32 C;  3AZK B;  2ARO B;  5CHU A;  4BEN A;  4IBB A;  3GVB A;  3Q82 A;  1BLH A;  1HQ3 A;  3MGQ C;  1Q2P A;  3AZL C;  5GSU A;  1CEF A;  4N1X A;  4G91 B;  2WGI A;  4KZ4 A;  4MBF A;  1KX4 D;  3WAA A;  4NY2 A;  2IWD A;  3MNN D;  3AZL A;  3WS0 A;  3G32 A;  1F1E A;  3MGS B;  3WAA C;  5DNM A;  2Y2Q A;  3W97 D;  4R8P A;  3AZE D;  3REL B;  3MGR A;  2ZLY A;  4H9S A;  3N6I A;  4MBK A;  3VP2 A;  2XDM A;  2X71 A;  3A6N B;  5CRF A;  3WA9 A;  2J9P A;  1F66 A;  4QLC C;  3LEL D;  4DRB A;  4WZ5 A;  4KHA B;  3REK A;  1L2S A;  4J8X C;  2XFT A;  1FSW A;  4GOG A;  1M18 B;  2EFX A;  4AWL C;  2FJ7 D;  2Y2K A;  4PM9 A;  4OVD A;  2DQN C;  1PI4 A;  3LZ1 D;  3W96 C;  3MBZ A;  3NDG A;  1ERO A;  3MGP B;  2XFS A;  4YS3 C;  1P3I D;  4GKU A;  3OCL A;  4WZ4 A;  1DJB A;  3V39 A;  3B0C T;  5A91 A;  4E3J A;  5BO0 B;  4JJN D;  1P3B A;  1M1A D;  1Z6F A;  1FSY A;  3MVD B;  1M1A B;  3LJA A;  1LI0 A;  4QLC D;  5EOE A;  2JC7 A;  1YLP A;  4R1G A;  3M2K A;  3MFD A;  4FH4 A;  3M6H A;  1E3U D;  4WU9 A;  4ID4 A;  2HUE C;  1L0F A;  3O3V A;  5AVB A;  1ULY A;  3WKJ C;  3O62 D;  3ZVT A;  1P34 D;  3WKJ A;  1AOI D;  4E3K A;  3AZF B;  2YFV B;  1ERM A;  2V1Z A;  5CEC A;  2F8N D;  2XF3 A;  2LY8 A;  3B6F D;  1W8Y A;  3UDI A;  5AV6 A;  3IWI A;  5GT0 A;  3BLS A;  4EWF A;  2Y2I A;  5KDM B;  1WWI A;  4XXR A;  3VOZ A;  3MGS D;  2BG1 A;  4HEF A;  5CXW A;  5IHV A;  5DVA A;  2ZM0 A;  5B2I A;  1IYP A;  4R3B A;  2BLS A;  1TDG A;  3N8S A;  3G35 A;  2ZY2 A;  3CMZ A;  4R4R A;  4NYY A;  4KUD B;  5G49 A;  1IEL A;  3L25 A;  2NZD C;  5B32 C;  1K54 A;  1ALQ A;  5BNV B;  3A3J A;  5CP6 D;  5C3I B;  4OUI A;  1LHY A;  4WZS B;  3RXW A;  3AFA C;  4YS3 B;  4CSR B;  2HP6 A;  3AZH D;  3UTB A;  2CC1 A;  4Y0T A;  3O87 A;  4J8W C;  1P3P A;  3REH B;  4S2P A;  2NQB B;  2Y55 A;  5GT0 D;  1ZKJ A;  4X23 B;  5B0Z C;  5FQI A;  2FJ7 C;  1M19 D;  4KGC A;  3A3F A;  3IF6 A;  3S1Y A;  4H9O B;  3N7W A;  5CPK C;  1NYY A;  2ZJ9 A;  5HFO A;  3UT9 D;  1XA1 A;  4GHL A;  4RVA A;  3NQU B;  3WTP E;  3LZ0 B;  5AV5 C;  3NBL A;  1SDE A;  3N4I A;  1BZA A;  4UA9 A;  1K55 C;  5GSU D;  4N9K A;  3HON A;  3AZM C;  2WAD A;  4G92 C;  2IO5 C;  5TGF A;  2PU2 A;  4ZUX B;  1BFM A;  1S0W A;  4GD6 A;  4H9S C;  3N3F A;  5DNM D;  3RJU A;  4C3Q A;  5DF9 A;  4XUZ A;  4WNN A;  3WS1 A;  3AFA A;  4LD9 B;  4Z5T D;  2JBF A;  3LEL A;  3HLC A;  3LZ0 D;  2Z2L B;  3O62 C;  5AQ9 A;  1PWD A;  2ZC7 A;  4LCL A;  1N1J B;  3AV1 A;  2FJ7 A;  1XX2 A;  3X1S C;  1P3O B;  4QY5 A;  5EVI C;  3A1I A;  3MNN B;  5AVC A;  1ZLA B;  1YU4 A;  3A6N C;  1JWV A;  1LL5 A;  3X1S B;  3KWQ D;  1GA0 A;  3MKE A;  5DTS A;  4BLM A;  4EV4 A;  5JA4 B;  4U3T A;  1ZLA C;  1HD8 A;  1TZY C;  3HUM A;  3REI D;  3EPJ A;  4WEL A;  4PM6 A;  2Y2O A;  1FQG A;  3GMW A;  3AZM D;  4Z2M H;  5CP6 B;  1EWZ A;  5AVB C;  4FSF A;  4MBH A;  2IWB A;  1P3L A;  2WKI A;  3VH5 T;  2X01 A;  4KZ7 A;  1H8Z A;  3A3D A;  4YS3 D;  1P3I C;  3UTB C;  3UO9 A;  1E3U A;  3EPL A;  3AZG B;  3AYW A;  1BH9 B;  3LZ1 B;  5B2J C;  3AV1 D;  5F83 A;  4CPK A;  3LJA D;  3KXB C;  1GHM A;  5AVB D;  3MXR A;  1M1A C;  5E5A B;  4ZDX A;  4KGC C;  3KS8 A;  3O62 A;  2HDU A;  5B1M D;  5B33 C;  4BQM A;  2BYK A;  2HDQ A;  4WEJ A;  4J8W D;  3ZG9 B;  2H10 A;  2WUQ A;  5FDH A;  2EX9 A;  3C7V A;  3PAE A;  5CPJ C;  4O7D A;  3AZM B;  2XD1 A;  3L26 A;  4IBC A;  1K38 A;  3TU4 B;  1P3A D;  2I72 A;  5GXQ A;  1J9M A;  4DDS A;  3HLD A;  3TU4 C;  4OOY A;  4X55 A;  3KWQ B;  4KG6 A;  3WKJ D;  3W98 D;  1ZLA D;  3TU4 A;  2CV5 C;  3WA9 C;  2OV5 A;  1U60 A;  1YLT A;  5GHZ A;  4OJO A;  2HIO B;  5BS7 A;  3WS5 A;  4LD9 D;  4PPR A;  2ZM5 A;  5BPV A;  1MWR A;  1YU2 A;  4KQR A;  1K6R A;  1KX5 A;  3O62 B;  1K25 A;  5E2H A;  1AOI B;  3LY3 A;  1DY6 A;  3VP3 A;  4HES A;  1K4E A;  4X6T A;  3KS4 A;  3AZG A;  1YU0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...