2JCHA

Structural and mechanistic basis of penicillin binding protein inhibition by lactivicins
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
684
structure length
461
Chain Sequence
SEITYSDGTVIASIDYLYFTTLAEAQERMYDYLAQRDNVSAATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTNQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Drug-binding protein
molecule keywords PENICILLIN-BINDING PROTEIN 1B
publication title Structural and Mechanistic Basis of Penicillin-Binding Protein Inhibition by Lactivicins
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 144
structure length 461
sequence length 684
ec nomenclature
pdb deposition date 2006-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
A PF00912 Transgly Transglycosylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2jchA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2jchA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2jchA02
2BG1A 3NDGA 2HP9A 1SDEA 3P09A 4JXGA 4WEJA 1K4FA 1YLPA 4FSFA 4R3BA 3W4PA 4NK3A 5HFOA 1TDGA 4RA7A 1YMXA 5E2GA 4WZ5A 4GD8A 2FFYA 3BM6A 2ZM8A 4E6WA 1BZAA 3BFEA 3IHBA 4XUXA 5F82A 2ZMAA 1LHYA 4R0QA 4S2NC 1MY8A 3HLWA 3HLBA 3MKEA 4ID4A 3AGFA 5DTTA 1Y54A 2Z2MB 2XR0A 2WYXA 1MXOA 4P0MA 5JYOA 1WE4A 5D3OA 3HUOA 4EUZA 3G4PA 3BYDA 4BD1A 1YM1A 5FAOA 2ZC5B 3N6IA 4E6XA 2DNSA 2WUQA 4OOMA 4R3JA 4R4SA 2Y2LA 4EBLA 4OH0A 4OPZA 1L2SA 3O87A 2P9VB 1SCWA 2QZ6A 2WKEA 3HLFA 4KZ4A 2H5SA 4X55A 4UA6A 1PW1A 4BJPA 2X71A 3ZG9B 2Y2HA 3OC2A 2WAFA 3CG5A 4S2IA 3UO9A 5AQBA 3UDFA 4WBGA 3WRZA 5FAPA 3V3RA 1KGGA 4DKIA 4WZ4A 1PI4A 2XFTA 3UE1A 1E25A 2UWXA 2H0YA 1PWGA 1YQSA 1Q2PA 2GDNA 4PM8A 2RL3A 1LI0A 5DVAA 4WMCA 4C75A 5TGFA 4QY5A 3BRMA 4WELA 4CJNA 5EUAA 4Y0UA 1IEMA 1K54C 4O7DA 2ZQ8A 1H8ZA 3IH8A 3IF6B 1ES5A 1GA0A 2P74A 3PBQA 3VP4A 4DE0A 1BLHA 2WZXA 3SS3A 1FSWA 1XXMA 4HBUA 5FDHA 4E3LA 1E3UA 1EI5A 3ZVWA 5GLCA 1DY6A 3MZEA 5CHJA 4N1XA 2ZLYA 4F94A 3A3DA 1WYCA 1GA9A 4EWFA 1G68A 5E2FA 2OV5A 1LLBA 3LEZA 4X6TA 3SS4A 2Y2GA 3MZDA 2X01A 2ZM0A 1W8YA 5CGXA 2ZQ7A 3G31A 3ZCZA 3A3IA 4OKPA 3HL9A 3UN7A 4PM5A 3ZGAB 3HUNA 5GHXA 3ZDJA 2WGIA 3M6HA 3WWXA 3MFDA 2IWCA 3QNCA 1IELA 1TDLA 3N8LA 1HD8A 1PZPA 2HPBA 3HLGA 5DF7A 4S2NA 5GHYA 3HREA 1NYMA 3BECA 4C6YA 2J8YA 2Y2OA 4OPYA 3I7JA 4S2OA 2J9PA 1WYBA 4MLLA 4EBNA 4Y0OA 2QPNA 1YMSA 3Q81A 1SKFA 1K25A 3N7WA 4JXSA 4E3KA 1XGJA 4YINA 2VGKA 3VOZA 3ITBA 4JXVA 3VFFA 2HDQA 1H5XA 4BENA 3UNWA 4K0XA 3IWQA 5E2HA 4KZ3A 1ONGA 4ZTKA 1VM1A 4JLFA 3WS0A 1ZG4A 1NY0A 1KE0A 2Y2QA 3GVBA 1ES2A 3NI9A 5EVID 5KZHA 3QNBA 1BSGA 4S2JA 3MBZA 1KDSA 1MWRA 3ZG8B 3ZVTA 1S6RA 2WGWB 5F83A 1TVFA 1K55C 4DF6A 1CEGA 1L0FA 1PI5A 3ITAA 4P6BA 4DDSA 4OOLA 4PM6A 4BL3A 1CI8A 4CPKA 2XD1A 3RXWA 3IWIA 4IEDA 4OOYA 2WKIA 2ZC6B 4PM7A 3FYZA 4UA7A 1ZG6A 4DXBA 3OZHA 3V50A 2EX2A 5CERA 4B4XA 4X68A 1K56A 1BLPA 2WADA 1FCMA 1LI9A 3OPPA 2G2WA 4KZBA 2R9XA 2WGWA 4Y0TA 1GCEA 4S2KA 2XF3A 1PIOA 3FZCA 5CGSA 4A5RA 1ESUA 5F1GA 4BLMA 4BL2A 4LCMA 3WS5A 2JC7A 1KGEA 1K54A 2RCXA 3ZNYA 4MNRA 1M6KA 4N92A 3VMAA 3SH8A 1IYQA 3PBTA 3WRTA 4Y7PA 3LY4A 5FQMA 5DF8A 2PU4A 1LL9A 3G2ZA 2FFFB 1PWCA 1O07A 3UDIA 1NYYA 4HBTA 4GNUA 2HP5A 5GHZA 3IHAA 4JXWA 5L2FA 3B3XA 5CTNA 2XEPA 5E2EA 4FCFA 2ZQCA 3NBLA 5CHMA 4S2MA 1OMEA 1MWTA 2Y4AA 5GL9A 2Q9MA 1EROA 2PU2A 3PAEA 1DJCA 1NXYA 3GV9A 4KG6A 3S22A 4KENB 4E3OA 1GHMA 4P87A 3BFCA 3QHYA 4R23A 5E43A 3A3JA 4L0LA 3SOIA 2PBYA 2XDMA 3FKVA 3PBOA 5IHVA 3VSKA 3G34A 4KQOA 2XK1A 2EX6A 3Q7VA 4Z9QA 5EVLA 4ZDXA 2Y2PA 4LV0A 5EPHA 5CECA 3PBNA 5G18A 4JBFA 1SDNA 2R9WA 3WS1A 1KVMA 1K6RA 5FI6A 4QD4A 1GHIA 4JKTA 3UE3A 5TR7A 1W79A 2HDRA 3S1YA 3BFGA 3G2YA 5HW3A 3CMZA 2IWDA 3IXHA 4GD6A 3UPNA 2ZC4B 2XQZA 3ZFZA 5KMWA 2XGNA 5M19A 1IYPA 2A49A 2Y59A 1QMFA 3EQVA 5A91A 4KZ5A 3O88A 3DW0A 4WM9A 5M1AA 3W4QA 4DDYA 1KGFA 3HLDA 4OQ0A 2ZC3B 1FQGA 2JBFA 1I2SA 5FQKA 5HX9A 1L0GA 4MBKA 1YLZA 5FQJA 1K55A 2C6WB 3ISGA 3OPHA 1JWVA 4OLDA 2Z2LB 4GB7A 3C7VA 4R4RA 3PAGA 1KE3A 1S0WA 3E2LA 5M18A 1HTZA 2HDUA 4Q8IA 3DWZA 4LCLA 1YLYA 1E4DA 2WGVA 1MWUA 1YLJA 4EV4A 3M2KA 1FCNA 5BOHA 5FQIA 3VP0A 4DE1A 4WYYA 2XH9A 4B4ZA 1XA1A 4OLGA 5CGWA 3TG9A 1JWPA 2J7VA 3BLMA 4ZJ1A 3ZHHA 4D2OA 3LY3A 3BFFA 4WZ5C 1ES4A 1JWZA 4GOGA 1N4OA 3C4PA 3VP3A 2HDSA 3NDEA 5EVIC 3G32A 4GKUA 5HARA 5CTMA 3C4OA 2B5RA 4JPMA 3S4XA 4KZ6A 3ZNTA 2ZM2A 5GLBA 2EXBA 1XKZA 1YLWA 1EWZA 2Y2MA 3Q82A 2EFUA 4HEFA 4IVIA 5CEBA 4PPRA 3IH9A 3G30A 4P85A 5CXWA 1JTDA 2WKHA 1FCOA 1ALQA 1KE4A 4KQQA 3RJUA 2WK0A 4KZ8A 4LV3A 4GDNA 4RVAA 3SS5A 3A3EA 3D4FA 3HVFA 3VSLA 3BFDA 3M6BA 5FI2A 1PYYA 1C3BA 3OPRA 4BQMA 2HP6A 3C7UA 4DE3A 2ZC7A 4C3QA 5FQQA 2V20A 3UPPA 3SH7A 4YFMA 1L0EA 1MKIA 4UAAA 1BUEA 1Z6FA 4ZBEA 3NIAA 5EOEA 3UE0A 2J9OA 4OP8A 4RX2A 5FATA 2XFSA 1M40A 4S2LA 1IYOA 4XXRA 1U60A 3GR2A 3GRJA 1XA7A 3OPLA 4QJGA 3ZG7B 5TFQA 3UPOA 4N9KA 2BLSA 5AQ7A 5HAQA 3DTMA 2EX8A 4OP5A 1BT5A 1AXBA 1PW8A 2V1ZA 4PMAA 4B88A 3C5AA 3HBRA 5CEDA 4ZJ3A 1W8QA 2Y55A 4IBXA 4IVKA 2G2UA 1MPLA 1K57C 3IF6C 2ZJ9A 4WMCD 2A3UA 3Q07A 4GDBA 4E3IA 4MBHA 1XGIA 4OVDA 4KZ9A 1PWDA 3Q7VB 4DE2A 2WZZA 2V2FF 2Y2IA 1I2WA 3VP1A 2JCHA 4JF4A 3E2KA 2E8IA 1ONHA 2OSUA 2DCFA 3IWOA 5FASA 3LCEA 1H8YA 3FKWA 4UHUA 1E3UD 1FOFA 5EVIA 5F1FA 1RGYA 2X02A 4EBPA 2XD5A 5KSHA 3N8SA 1L0DA 3GSGA 5FAQA 4OPRA 1SHVA 3TSGA 4OQHA 5FSRA 1IKGA 3TOIA 4N1HA 3PBSA 3IXDA 5JYPA 3AGEA 1TEMA 1ERMA 2Y91A 1HVBA 1N9BA 3VP2A 4UA9A 1ESIA 5J8XA 3MXRA 3MXSA 5A92A 4GZBA 2Y2NA 2ZQDA 4R1GA 3LO7A 2OLUA 3OCNA 3WS4A 3PTEA 4ZJ2A 1ZC2A 1ZKJA 3JYIA 4DRTA 3ZG0A 3NY4A 5FQ9A 2ZD8A 1BULA 4XUZA 2OLVA 3BEBA 3CZDA 1CK3A 3FV7A 4FD8A 1CI9A 4X56A 1RP5A 1JVJA 4KQRA 4KZAA 4QU3A 5CHUA 3GTCA 2Y2KA 2P9VA 1KDWA 4KZ7A 5EOOA 2IWBA 5I94A 3Q7ZA 4PM9A 2VGJA 5GLAA 1IYSA 4OQIA 1NRFA 3N8RA 3ZG5A 4U3TA 4QY6A 4WEKA 1I5QA 3VOYA 3O86A 4IBRA 4KG2A 2JE5A 3EQUA 4EQIA 1FR6A 2QMIA 3DWKA 4X53A 1K6SA 4K0WA 5AQ9A 5EECA 4JF6A 3W4OA 1MBLA 1NZUA 2CC1A 3IF5A 3GMWA 3O3VA 4M3KA 1ES3A 5KSCA 1K4EA 3HLEA 4OPQA 3HUMA 1G6AA 1K38A 1W7FA 1RGZA 1KVLA 4LV1A 3M2JA 4ZAMA 4RYEA 1K56D 4OQGA 1DJAA 1K57A 3IF6A 1ERQA 3IXGA 1J9MA 1IKIA 4E3MA 3BLSA 1FR1A 5FA7A 4FH2A 4QHCA 2XLNA 3G35A 3Q1FA 3VFHA 5DF9A 3PBRA 3AGDA 2EX9A 1BLSA 4LENA 2ZQAA 4LV2A 3UY6A 3MKFA 4N9LA 4OONA 2ZQ9A 1GHPA 4QB8A 4RX3A 3CJMA 3W8KA 3V39A 4E3JA 1BTLA 1MWSA 1VQQA 2I72A 1NZOA 1XX2A 5A93A 1W5DA 2EXAA 2H0TA 2H10A 3P98A 3V5MA 3UDXA 3GQZA 3MZFA 1PZOA 2WAEA 3N4IA 1RCJA 1XPBA 4HESA 3HLCA 1YT4A 1FSYA 4S2PA 3FWLA 1LL5A 4H8RA 4U0XA 5CRFA 2Y2JA 4FH4A 5HL1A 3NC8A 1XP4A 1HZOA 5AQAA 2Q9NA 4BD0A 1NJ4A 2C5WB 5EE8A 3SH9A 4DXCA 4GN2A 5FI7A 3IQAA 5A90A 4MEZA 5GLDA 3RXXA 2DRWA 3WS2A 1CEFA 1JTGA 1QMEA 3IXBA 4K91A 4MBFA 4KG5A 4NETA 1YLTA 2EFXA 4X69A 5DTSA 5HAIA 1O7EA 5DTKA 3V3SA 4JF5A 3IT9A 5U47A 4U0TA 1BLCA 5EVIB 3NCKA 3OCLA 1DJBA 1Q2QA 4E3NA 3A3FA 5HAPA
chains in the Genus database with same CATH superfamily
3P09A 4JXGA 1YLPA 4R3BA 3X1VC 4GD8A 1E88A 1LHYA 4R0QA 3KUYA 4CLCD 3HLBA 4F3LB 2HJEA 3AGFA 2A24B 3N3FA 5CPID 1HLUP 3KS4A 5AV8C 3A6ND 3EEAA 5GXQD 5CP6C 5D3OA 3FPWA 1G28A 4BD1A 1YM1A 3N6IA 4JGQA 1M18C 2DNSA 2WUQA 4OOMA 4I38A 4F3LA 4H9SA 2J3TD 4OPZA 3S7OA 2A24A 1XJ3A 1P3KA 4UA6A 1M1AB 1PW1A 4BJPA 3B47A 4HMCA 1UR8A 3OC2A 4PKYA 3V3RA 1KGGA 4IHQA 4KUOA 2B18A 2XFTA 2YFVB 4H9QB 3UE1A 3LZ0A 2UWXA 3AN2D 1M1AA 2RL3A 1LI0A 3LJAB 4LRXC 5TGFA 3C1BD 4CJNA 2JKRM 3LIBA 2ZQ8A 1H8ZA 3IH8A 3PBQA 5DNND 4H9QA 1EQZB 3SS3A 1E3UA 3ZVWA 1P3GD 3MZEA 5CHJA 3FG8A 1HTAA 4F94A 5BS7C 3LELA 5E2FA 3LEZA 4X6TA 4NZ1A 3UMEA 3RELB 1EQZA 3A3IA 4OKPA 5FUGA 5F5YA 4EO5C 3HCYA 3MGPC 4G3KA 1S1YA 4HHDA 3IBJA 1LL8A 2IWCA 3QNCA 5B1LC 2L5AA 2ZM5A 1PZPA 1KX4B 2HPBA 1S32A 5GHYA 3WA9B 4IUHA 2V8FA 1NYMA 5B2JC 1K0KA 3I7JA 3N7WA 1K25A 2GX5A 3VOZA 2VGKA 4JXVA 3AFAD 3B6GB 3A0SA 1H5XA 4BENA 1KX4A 3UNWA 5AY8C 3VE4A 3WA9A 3M7PA 4IJGA 3W96C 3GVBA 3AV1B 1KE0A 5EVID 1E6NA 1GSWA 1BSGA 3QNBA 1MWRA 3CAXA 1S6RA 5F83A 1AOIA 1BH9B 3LZ1B 1CEGA 4P6BA 4O01A 3B6GA 3PYPA 2AROD 4DDSA 3DTEA 4OOYA 4R3AA 3U2AA 1YKDA 3R45B 3KSYA 1S4SA 4X68A 4Q0IA 3L29A 3UB5P 1LI9A 1E15A 4KZBA 4Z5TD 2XF3A 3DTIA 5B2IC 3AZKC 1ESUA 5F1GA 3T4TA 2O0YA 3WS5A 1K54A 1P3LD 4HP9A 3CHWP 3R45A 3NJAA 1F2KA 4Y7PA 3T4OA 1TZYA 3REKC 1P3IA 3G2ZA 3D3OA 3NOPC 1O07A 3SZTA 4GNUA 4H6JA 3QP4A 4NE6A 4P6ZS 1ZLAD 3B3XA 5HWVA 5B1MD 5DJUA 4II7A 4S2MA 1EROA 5HSQA 3REHB 5HPFA 1NXYA 5F69A 4E3OA 3WD3A 4EEUA 4NZ5A 4P87A 3KYZA 4WU8A 5IHVA 1ZTUA 1CF0A 3LI8A 4JBFA 3WS1A 1KVMA 2PRFA 3REHA 5TR7A 4Q0HA 2HDRA 5BNVB 3MNNB 2K31A 2IWDA 4GD6A 4Z66A 2ZC4B 2VV7A 5KMWA 2XGNA 2Y59A 3NOUC 3DW0A 2PR5A 4OQ0A 3X1TB 4X23A 1YLZA 1E6RA 1K55A 4ETZA 3MS6A 3E2LA 5M18A 2HDUA 4Q8IA 4EU0A 3X1VB 1YLYA 2WGVA 4QLCD 3B0CW 1P3FA 3VP0A 2XH9A 1XA1A 3KSGA 3ZHHA 5AV8B 3LY3A 1ES4A 5CP6B 4TX8A 1N4OA 3X1VA 3VP3A 2CMNA 4Z1WA 1M18B 3T1XA 1P3BC 3C4OA 3E4OA 4JPMA 4WV4B 4KZ6A 3ZNTA 3UTBA 5HZHA 1A0KA 2V1AA 1P3AC 4L9GA 1G6OA 5GLBA 5AV9A 2EXBA 5B24C 2ZOHA 4R70A 1KS0A 2Q0OA 2EFUA 3E4PA 1SKOB 4IVIA 4GHLA 3LIEA 3IH9A 3C38A 3AZNC 1M18A 2F8NG 3LGOA 2GJ3A 1FCOA 3O62D 2WK0A 3AZHC 3F1OB 3SS5A 1XJ4A 1P3MD 3A3EA 3X1SB 2XA7S 5TBMB 5FI2A 1PYYA 1JFIB 3OPRA 4GH9A 3VOLA 3SW1A 3W99A 3UPPA 1NLYA 1L0EA 2M7VA 3NIAA 1S1ZA 3X1SA 4Y13A 2O9AA 1JFIA 3ZG7B 3UT9C 1PZRA 4EO5B 1AXBA 1VHMA 4B88A 3MGPB 4BBVA 3C5AA 3HBRA 4ZJ3A 5EM0A 1H0IA 3EPLA 3AZID 2INWA 1P34C 5DNMD 5B1LB 3UTAD 4WMCD 4J8XD 4MBHA 2BTFP 2VK3A 1PWDA 3Q7VB 5B2JB 4DE2A 3AZJA 5CPKD 1U35A 2V2FF 4IBBA 2Y2IA 2WZZA 1I2WA 3H82B 3AZFA 3IWOA 3B0BA 1P3OC 3QP8A 4UHUA 3WTPE 3FKWA 5FASA 1RGYA 5AY8B 5GSUD 1OTBA 2O9CA 2D02A 5FAQA 3MGQD 3TOIA 3MXQA 4MMNA 3PBSA 3EGDC 5B32C 3AGEA 1HQ3D 5JRGA 4UA9A 5AY8A 4HMDA 3MXSA 1KX3D 4GZBA 1P3PD 2W3HA 4R1GA 2OLUA 3PTEA 4DRTA 3NQUA 3ZG0A 3W97B 5B2IB 3AZKB 5CHUA 2VLGA 2Y2KA 5B33C 1P9WA 1YU0A 3Q7ZA 3AV2D 3WD0A 1OT9A 1H3OA 1IYSA 4R8PD 4YS3D 3W97A 3AZLD 5CPJC 3ZG5A 3REKB 3CITA 3O86A 2HUEC 3AZEA 2W3EA 1CJFA 2QMIA 3E4QA 2F8ND 1K6SA 5AQ9A 4JF6A 4QNLA 4H9NB 3IF5A 3KUYC 3AZMA 5KSCA 3MQOA 2PYOB 3HLEA 5DJTA 3MGSD 4XUJD 2W1RA 3HUMA 4LV1A 1K56D 1PDCA 4MB5A 1ERQA 4GS9B 1IKIA 4H9NA 4QHCA 2F8NK 3VFHA 4H9SC 5DF9A 2PYOA 4H9PB 1M19B 1ODVA 1P3KC 3PXPA 4AFIA 4RX3A 3NULA 4E3JA 4GS9A 1MWSA 5BO0B 1YU1A 3TU4D 5B32G 4IBEA 4CLCE 4H9OB 5B0ZA 1W5DA 3UDXA 1BYWA 3GQZA 2WAEA 4H9PA 3LZ0C 1M19A 1RCJA 4GHAA 1XPBA 4HESA 1Z09A 3NECA 3F1NB 1YT4A 3T4JA 4S2PA 4CSRB 3REJD 4FTXA 4J8WD 1F66A 2OWHA 3X1UC 2Y2JA 4FH4A 3KYEA 4J8VA 5DFXA 4GHIB 1NJ4A 2C5WB 4Z2GA 2HF6A 4GN2A 5FI7A 3IQAA 3B0CT 2JKGA 4MEZA 4GJ4A 5G49A 5B40B 4KGCD 1JTGA 4CSRA 2D49A 1QMEA 3LYXA 4K91A 3LELC 5DTSA 1O7EA 3UB9A 4KUDD 4JF5A 4GHIA 2HJ9C 3OCLA 1F1EA 5MC7A 1EQZC 2BG1A 5B40A 3GDIA 1P3BB 1Y28A 1K4FA 4NZ3A 4FSFA 4IUKA 3W4PA 2JKTI 2J3TC 1P3AB 4NK3A 3MGRA 3ULFA 1ID3D 1TDGA 3C1CD 3VH5T 2FFYA 4E6WA 4XZQD 3R4KA 3BFEA 3IHBA 3NHQA 5F82A 1S32C 2QYBA 3AZNB 1Q9CA 1Y54A 3A1KA 5HWWA 1P3BA 4LD9A 2WYXA 1XJ6A 4YM6A 3HUOA 4JJNB 5FAOA 5F68A 3QP2A 4R4SA 3WA9C 3H9WA 4PKYG 1L2SA 2L0WA 2P9VB 3HLFA 3B0DC 4NXFA 2LB9A 4UQIM 3ZG9B 4JJNA 1AOIC 1YSQA 3MQQA 3MSHA 3UDFA 2W3GA 4DKIA 1L6JA 1KX5B 5AV5D 1LSVA 3UT9B 1MZUA 5DVAA 3KWQA 1UWNX 5EUAA 1IEMA 1K54C 4O7DA 3WTPD 1P34B 1GA0A 4DE0A 4KHAB 4UUZB 4I5SA 3A1IA 1KX5A 1BLHA 1FSWA 4HBUA 2OAQ1 5EFWA 4N1XA 1TZYC 2ZLYA 1P3IC 1WYCA 1GA9A 1G5UA 2Y2GA 2X01A 4KHAA 4EETB 3RFBA 5CGXA 2ZQ7A 5E5AD 2UV0E 3T50A 4PM5A 2Y79A 3ZGAB 4E04A 5B0YD 3ZDJA 2WGIA 3M6HA 3MFDA 3KXBD 3N8LA 3REID 4WU8C 3B6FA 4J8UD 5GT0D 3HREA 3MR0A 5AVCD 3AZGD 3BECA 4DRBA 3REHC 2RVQD 4Y0OA 1E8BA 4JXSA 1OTEA 1XGJA 4YINA 3VFFA 4K0XA 4Z66C 3AYWD 1ONGA 3EG5B 4JLFA 3WS0A 5L09A 3B42A 5B33B 2WKRA 2Y2QA 3NI9A 1KDSA 4X23C 4Z2HA 1K55C 4DF6A 5CPJB 1PI5A 3ITAA 4EUVA 4PM6A 4M6BA 2HUEB 4QWOA 4IEDA 4PM7A 2WKIA 2ZC6B 4UA7A 1ZG6A 2EX2A 2QKPA 1BLPA 3JPUA 1P3FC 3S7PA 3WAAA 1GCEA 4S2KA 2EA9A 3H7WA 5CPJA 4A5RA 3CI6A 4LCMA 2JC7A 1H8MA 1NWZA 3QP5A 3VMAA 4G3VA 3SH8A 1IYQA 5FQMA 3TJZC 2PR6A 2PU4A 5B31A 3K3CA 5AV6A 3UTBC 4HI4A 2BYMB 2FFFB 4Y3IA 5AV9C 3UDIA 4HJ6A 1P3KB 4HBTA 4JXWA 2PBDP 2XEPA 1UGUA 3BWLA 5CHMA 3VH6T 2Q9MA 2IA2A 3LZ0B 1UR9A 2BYMA 4I3JA 4KENB 3U4LP 3F6TA 3SOIA 3LJAD 3A3JA 3FKVA 3PBOA 3X1UB 3VSKA 4ZDXA 1OJGA 3BW6A 4KQDA 4LV0A 5IU1A 5CECA 4Y17A 2R9WA 3LIDA 3UE3A 4JKTA 3W99C 3EPKA 4QLCC 2NQBA 3WKJA 1T3UA 5DKKA 3P7NA 5HW3A 3CMZA 3X1SC 5M19A 3X1UA 3LELB 1IYPA 5CPIB 1QMFA 3EQVA 4I3AA 3W4QA 1KGFA 5GXQB 2ZC3B 3RELD 1I2SA 3NQJA 2M7UA 1JWVA 5FUGB 2Z2LB 4GB7A 3C7VA 3PAGA 2EWWA 3DWZA 4LCLA 5CPIA 1FILA 3E0YA 3A6NA 1YU4A 1IOUA 1FCNA 1S32B 5GXQA 1OTAA 4IBFA 5CGWA 3AZJC 1R4VA 1U35C 3BLMA 2PYPA 4ZJ1A 4YNRA 3AZFC 4B9OA 2MJ6A 3O62C 2YFWB 2HDSA 3G32A 4BBTA 2YKHA 5F99D 4NYYA 3E98A 4LGWA 5CTMA 3IX3A 5FEGA 3C1BB 3AV1D 1O6IA 3CPTA 3B0DB 1XKZA 1YLWA 1EWZA 3LZ1D 1AOIB 2YFWA 5JRGC 3MQLA 1P3GB 4LRYC 1JTDA 4ZBJC 1ALQA 1KE4A 4H9RA 3C1BA 2R78A 2GNXA 4WL9A 4OJOA 5DNNA 1CK7A 3HVFA 2XRNA 3M6BA 3EPJA 1P3GA 1T1CA 2ZY5A 3C7UA 4AWLC 2K7SA 4C3QA 1MKIA 3KSFA 1F5MA 1Z6FA 3W97C 4ARZB 1TZYB 1P3IB 2XFSA 1W2EA 1P9RA 3BQAA 4S2LA 4XXRA 3AZEC 5CPKC 2NZDC 3GR2A 1GSVA 4H6JB 1XA7A 1PFLA 4Z2IA 3UPOA 5AQ7A 5HAQA 3AZMC 2EX8A 4OP5A 3NOTC 2V1ZA 1PW8A 4PMAA 4ARZA 3MGQC 2ZJ9A 4HIAA 4LFUA 4WU8B 5CX7A 1XGIA 4OVDA 3AFAA 2AROB 4ZUXD 2PYOC 2JCHA 4JF4A 1ONHA 2DCFA 1LT0A 3MNND 2FH5A 3HJIA 2ZMFA 5EVIA 4G3WA 2X02A 3VH5A 4Z66B 3N8SA 5B0ZC 5GT3D 1OGGA 2AROA 3TSGA 3X1TD 1IKGA 1M19C 2A2LA 4X23B 3PHYA 3IXDA 1WWSA 3AV2C 1F66C 3MVDC 1HVBA 3VP2A 4J8VC 4Z5TA 4MB4A 2ZQDA 3F1PB 3WS4A 2IO5C 1P3LA 2PD8A 3JYIA 1ZLAB 1P3FB 5FQ9A 2ZD8A 4EERA 1X0OA 1CK3A 2WKQA 5AV8D 1CI9A 3FV7A 4FD8A 4X56A 1RP5A 4KQRA 3V9RA 5CP6D 3GTCA 1KDWA 4MN7A 5HPIA 3T12B 5GLAA 3F1PA 4JGOA 1ZLAA 5B40C 2HV1A 4U3TA 5B1MA 4QY6A 3UTBB 4WEKA 1I5QA 4IBRA 3MGRC 5AV9B 2HGVA 4EQIA 1FR6A 3L2AA 4X53A 2HIOD 3W4OA 2VJWA 2CC1A 3DAVA 3O3VA 3TW8A 4M3KA 1K4EA 3L25A 2QJ7A 2O99A 4LD9C 2W3FA 1G6AA 1K38A 3V67A 1RGZA 1KVLA 3S7QA 4YM6C 1DJAA 1K57A 3IF6A 4ESPA 5BT1C 1J9MA 3VH5W 5I5LA 1W1TA 2P08A 3BLSA 3C8CA 3G35A 3H0LC 3AGDA 3D72A 2FN2A 2ZQAA 4LRZE 3W99B 2ZQ9A 3IS2A 4QLCB 5L8MA 4JJNC 5L10A 1BTLA 1VQQA 1NZOA 1W1VA 1XFNA 2H10A 4Y15A 2V5OA 3EGXC 3N4IA 5C5KA 4O0PA 4KUKA 3AL0C 1OGBA 1LL5A 4MB3A 4MN6A 4QLCA 3LR5A 3KWQC 2FJ7D 3MGPD 3NC8A 2ZL1A 1HZOA 2BASA 4UQIS 5AQAA 4BD0A 5B1LD 5A90A 3RXXA 2L4RA 1KX5C 2DRWA 3WS2A 5B2JD 3W2ZA 3IXBA 3AZJB 1U35B 2QWSA 4KG5A 3AZFB 3RTYA 3O62B 2CV5C 2KDKA 3LEQA 3NCKA 4QPRA 2DF4C 5AY8D 1Q2QA 1P3MB 5HAPA 4WEJA 2HP9A 5C3IC 1SDEA 3W96D 4NZ4A 5HDSA 3BM6A 1BZAA 3O62A 3LR3A 5JRGB 1MY8A 3B6FC 5DTTA 2Z2MB 1P3MA 4ZBJB 2XR0A 2ZMVA 4P0MA 5JYOA 1WE4A 1D1JA 4EUZA 3NQUB 5AV5C 2Z6CA 1A7WA 2ZC5B 5B2ID 2G5HC 4E6XA 3AZKD 2Y2LA 4EBLA 4OH0A 4LG2A 4AWLB 1SCWA 2QZ6A 4X25A 4X55A 1H3OB 3WTPC 3VH6A 3UTAB 4J8XB 4K08A 1TAFA 2WAFA 4S2IA 3REKD 5AQBA 3D9YA 2AVXA 3WRZA 5FAPA 1ULYA 3LIFA 4WU9C 3AZEB 5CPKB 2NZDB 2H28A 4RQ9A 2RIQA 4ETXA 1E25A 2H0YA 1PWGA 1YQSA 3AZMB 3AZIA 5DNMA 5BNXA 3WAAC 3UTAA 4WMCA 4OJLA 4J8XA 4C75A 3BY8A 2JHEA 3MGQB 1P97A 5CPKA 2NZDA 4Z2KA 1ES5A 2P74A 4EXOA 2VEAA 1QO6A 3GECA 3KXBC 1EW0A 2WZXA 5FDSA 1EI5A 3JVUA 4J8UC 1DY6A 5GT0C 5GLCA 5B31C 5AV6C 5GSUA 4EWFA 1G68A 1LLBA 3MGQA 5B0ZB 4O8GA 1HQ3A 3B33A 3HUNA 3MJQA 1KX3A 1P3PA 1KU5A 4Z2MG 3K2NA 1TDLA 3AV2B 1F66B 3HLGA 5DF7A 3MVDB 4S2NA 4C6YA 4J8VB 3VE3A 4S2OA 4D60A 2J9PA 3VH6W 4MLLA 2IO5B 5G49B 2NQBC 3ITBA 3WKJC 2P04A 3AV2A 2HDQA 1PNEA 3MVDA 4YS3A 2HZ5A 5E2HA 4KZ3A 3CLOA 1VM1A 5K5BA 3AZLA 3MGSB 1ZG4A 1ES2A 1N9LA 2L1MA 3ZG8B 3ZVTA 1T19A 4MCWA 2WGWB 2F8NA 1DP9A 1P3BD 1TVFA 1L0FA 4CLCC 5L07A 1P3AD 4OOLA 4BL3A 1CI8A 3RXWA 3MGRB 5B24D 3IWIA 1S4RA 3MGSA 4XUJA 5CPIC 4DXBA 5KDMA 3A6NC 3OZHA 3V50A 2OAP1 3H0MC 1KOUA 5GXQC 1K56A 2WADA 3S7NA 3AZND 3FDDA 2G2WA 2WGWA 3TRCA 1PIOA 5CGSA 4LD9B 4BLMA 4BL2A 4YM6B 4YOFA 5B31G 3AZHD 3ZNYA 1CXWA 4MNRA 1M6KA 4HJ3A 4N92A 4BWIA 3WRTA 3FPVA 3LY4A 5DF8A 3TU4A 1LL9A 1V9ZA 4PAUA 4MN5A 1NYYA 5L2FA 2JKRI 3AN2C 5DKLA 3REJA 3NBLA 4J8WA 5GL9A 5AVBD 3C1BC 3GV9A 3UT9D 3BFCA 4R23A 5E43A 5DNNC 3L26A 2PBYA 3KWQB 2XK1A 2EX6A 4KGCA 5EVLA 1P3GC 3RH8B 2Y2PA 5EPHA 1P34D 1SDNA 3VV4A 1K6RA 1TS8A 5FI6A 4KUDA 3W98D 1F98A 1MKMA 3HSHA 3G2YA 3OLOA 3IXHA 3T4SA 1T1BA 3ZFZA 1JNUA 3T1SA 1P3OD 1V9YA 3O88A 2CV5B 4WM9A 5M1AA 4NG2A 5AVFA 1TS0A 1ID3A 5FQKA 1L0GA 3C1CA 4X1LA 4MBKA 2C6WB 5F99C 5C3IB 3ISGA 3OPHA 2DMWA 1KE3A 1S0WA 1LSXA 2B95A 3L9KA 1IFQA 5B32D 2P7JA 4NXBA 2CV5A 3M2KA 4EV4A 4NFTA 1AWIA 5BOHA 3B6FB 4X1MA 4DE1A 3AFAC 4OLGA 3TG9A 1JWPA 4FUWA 1NLZA 2WKPA 1ACFA 4WZ5C 1JWZA 2VA0A 4NXEA 3C4PA 5AV5B 3NDEA 5EVIC 2QJ5A 1WA9A 5EM1A 3ZYTA 5HARA 2B5RA 5B33D 4XT2B 2AROC 3L27A 3WTPB 3DBAA 1YU3A 4NYUA 3Q82A 3UB7A 4G91C 5AV5A 4HEFA 5CEBA 3KYQA 4IJFA 3G30A 4WUJA 4P85A 4WU9B 5CXWA 2WKHA 3CUEA 4WNNA 4Z5TC 1W1PA 4XT2A 4KQQA 3KUYD 1F9IA 1P3LC 4RVAA 3WTPA 3WAAB 3D4FA 2V0UA 3H7WB 3BFDA 5F6AA 1C3BA 4WU9A 3OOVA 2HP6A 4BQMA 2PYRA 4DE3A 4OJ5A 2J80A 1J7MA 2V20A 5FQQA 3UB8A 2G5IC 3KXBB 3HONA 3SH7A 4UAAA 5HD3A 1ZLAC 4ZBEA 4J8UB 5DFYA 5GT0B 2J9OA 4RX2A 5B31B 5B1MC 5AV6B 5E5AA 2VV6A 2OWJA 1P3KD 5EVEA 5B0YA 3OPLA 4QJGA 4BBUA 4N9KA 4UEYA 3KXBA 3REIA 1BT5A 2J3WA 4J8UA 3LZ0D 5GT0A 3AYWB 2NUTC 5GT3C 4DQYB 4DJ2A 3WD1A 2W3DA 4IVKA 1M1AD 1K57C 3IF6C 1FIKA 4GDBA 4GLQA 4EEPA 4KZ9A 4DJ3A 3VP1A 3AYWA 2E8IA 2ZOIA 2Y8HA 4NE3A 3LCEA 1H8YA 1E3UD 2NQBB 4EESA 3WKJB 4EBPA 2XD5A 5KSHA 3LELD 4R6LA 4Z2MH 1D06A 4CAYB 1SHVA 4OQHA 5FSRA 1EQZD 3NQJB 5IS1A 1TEMA 3IX8A 4CLCB 2Y91A 1PRQA 2VGLM 5A92A 4NKPA 3P5JB 3T4KA 3LO7A 3OCNA 4CAYA 3A6NB 4DMZA 1S32D 4ZJ2A 1N9OA 4WJ3C 2HIOC 1ZKJA 2JKTM 1BULA 4XUZA 2OLVA 2EWVA 4CLCA 1JVJA 4QU3A 5EOOA 2IWBA 5I94A 1ZHHB 2VGJA 1KX4D 2W1TB 4NY2A 3WA9D 1NRFA 3N8RA 1H0GA 2PD7A 4IBDA 3ICYA 3VOYA 4KG2A 3CPTB 3EQUA 1TS7A 2YFVA 2NUPC 1DP8A 1AOID 3UMDA 5EECA 3B6GD 1GSXA 4MDZA 3AN2B 2W1TA 1E6PA 3LJAA 1P3MC 3EPHA 3WD2A 3EOIA 1W7FA 4H9RB 4RYEA 4E44A 3IXGA 5DNNB 4JGRA 4E3MA 2XLNA 1S66L 2FJ7C 3AN2A 3PBRA 1GXDA 3UY6A 4N9LA 3O5YA 4QB8A 1GHPA 4UPKA 3RELA 1TZYD 2I72A 1P3ID 4G92C 2H0TA 3V5MA 3P98A 4HH3A 2LY8A 1PZOA 2M1CA 3IBRA 3HLCA 3IX4A 2W0NA 1FSYA 4GW9A 3AZIC 4DRAA 3FWLA 5DNMC 4IBGA 3UTAC 5F99B 4H8RA 4J8XC 4WF0A 1TF1A 4U0XA 5LBRA 5CRFA 5HD5A 1XP4A 3LICA 5EE8A 2JKFA 3SH9A 4WU8D 5GLDA 4EQ1A 3AFAB 5F99A 5GSUC 1Z2CB 3REHD 1YLTA 5HAIA 5DTKA 4WN5A 3IT9A 3AV1A 1UWPX 1BLCA 5EVIB 1DJBA 3MQ0A 1OTDA 4E3NA 4Z66D 3A3FA 3KSHA 1BH9A 3LZ1A 3NDGA 1HQ3C 2KOIA 4R38A 4EW7A 2VX8A 3EWKA 5HFOA 2CWEA 4X23D 4RA7A 1KX3C 1YMXA 5BPVA 1P3PC 4WZ5A 3QP6A 5E2GA 1AIWA 2ZM8A 4XUXA 2ZMAA 4HOIA 4G91B 4S2NC 3MKEA 3HLWA 3T4LA 4ID4A 4CQHA 2V1BA 1YUEA 4Z5TB 1YSPA 4L9FA 1MXOA 1P3LB 1P3FD 3G4PA 3BYDA 4HNBA 4R3JA 4R8PC 4YS3C 4Z2JA 1OJ5A 2V8CA 3V9RB 2XSSA 3AZLC 1Y4OA 3O87A 3X1VD 2WKEA 3CWFA 1TD5A 4KZ4A 2H5SA 3LFVA 4NXGA 2X71A 3PR6A 2Y2HA 3CG5A 3UTBD 3UO9A 5B1MB 4WBGA 1P0ZA 5AV9D 4WZ4A 4ZUXB 3JVVA 1PI4A 3MGSC 4XUJC 1VETB 4HGAC 3T1QB 2GDNA 1M18D 1Q2PA 4PM8A 3WX7A 4QY5A 1D7EA 5GT3B 3BRMA 4WELA 4Y0UA 4WZSB 1T18A 4ZUXA 3VP4A 3IF6B 4B93A 1N9NA 1VETA 2IOUA 1XJ2A 5BNVA 3MNNA 5FDHA 1XXMA 4E3LA 3G6OA 3UB6A 3TU4C 3A3DA 3W99D 5GT3A 4HMEA 1OPXA 3K3DA 2OV5A 5J7EA 3WD4A 3IS2B 3SS4A 4IBCA 3MZDA 3X1TA 1CQAA 1W1YA 3C2WA 2ZM0A 3X1SD 1MC0A 1W8YA 1B6WA 3G31A 3REJC 3ZCZA 4J8WC 3HL9A 3UN7A 2XROA 5GHXA 1GOIA 1GPFA 1L3LA 3WWXA 5HDDA 1IELA 2LB5A 1HD8A 2ZBBA 5A8BA 4OJ6A 3TE8A 4KGCC 2J8YA 2ZL1B 5TJJA 3UE6A 2Y2OA 3C30A 4OPYA 5AV8A 1WYBA 4EBNA 1EAKA 5CP6A 1YMSA 2QPNA 1SKFA 3Q81A 2HIOB 4E3KA 4KUDC 4WLAA 3AZJD 2VZWA 1U35D 5G4YA 1VEUB 3IWQA 3AZFD 2ACGA 4ZTKA 4Q0JA 1NY0A 1YU2A 5KZHA 4S2JA 1ID3C 1DP6A 3MBZA 3C1CC 2HIOA 4XZQC 4HJ4A 1SKOA 1SZVA 4CPKA 2XD1A 1VEUA 3FYZA 5CERA 4B4XA 5JRGD 4IBIA 3F1OA 2YKFA 1XFQA 3IP4C 4Z2LA 4FOFA 1FCMA 3OPPA 4Y0TA 2R9XA 5HWTA 3FZCA 5TBMA 1OTIA 4I3IA 5J4EA 1KGEA 2RCXA 5AVBC 4OJPA 3MMHA 3PBTA 2FJ7B 5BS7A 1PWCA 5GHZA 2HP5A 5AVEA 3IHAA 3W97D 1BFMA 1TAFB 5CTNA 3KS8A 3W98C 5E2EA 4BMWA 3BQ8A 3LR4A 4FCFA 4G92B 3AZED 2NZDD 2ZQCA 1OMEA 1MWTA 2Y4AA 3CUEC 2FJ7A 4Y2FA 3MGPA 2PU2A 4NE5A 3PAEA 1DJCA 3BY9A 4KG6A 3S22A 3AZMD 2JSSA 1GHMA 3QHYA 5B1LA 3AZIB 4M4XA 5DNMB 4L0LA 5BNXB 2XDMA 4HP4A 5IT5A 1OT6A 2ZY3A 3G34A 4KQOA 3Q7VA 4Z9QA 4ZRRA 3W96B 5B2JA 2B02A 1W63M 1ED7A 3H82A 3PBNA 5G18A 2K2NA 4QD4A 2BYKB 1GHIA 1W79A 2F2AC 3EEHA 2O9BA 3S1YA 3BFGA 2PYOD 3UPNA 2XQZA 5E5AC 5GSUB 5HL6A 2A49A 5A91A 3W96A 4KZ5A 3KSIA 3MF0A 5B0YC 3HLDA 4DDYA 1FQGA 2JBFA 5HX9A 5FL3A 2BYKA 5FQJA 5B0ZD 3REIC 4OLDA 1HQ3B 3FKEA 4R4RA 1M19D 5AVCC 1T1AA 3AZGC 1HTZA 1KX3B 1P3PB 1E4DA 1MWUA 3R7WB 1F66D 1YLJA 2V0WA 3MVDD 2RVQC 5FQIA 4IJEA 3L7HA 4WYYA 4B4ZA 4J8VD 3FC7A 4P6ZM 2PHYA 5B2IA 2J7VA 3AZKA 4D2OA 3BFFA 3AYWC 4GOGA 4HY8A 3R7WA 2PAVP 5HDCA 2KX6A 4R8PB 4YS3B 4GKUA 3S4XA 2VV8A 3AZLB 3REKA 2W27A 2ZM2A 1B67A 2Y2MA 4E45A 5B40D 2F8NB 3LR0A 4HQAA 3A0RA 4PPRA 3MGRD 4R8PA 4XUJB 4LLOB 5KDMB 3RJUA 4HGAB 4KZ8A 4LV3A 4GDNA 4JGPA 4I39A 4LD9D 2V9AA 3VSLA 4YM6D 2ZC7A 3L28A 5BT1D 3T4QA 2J8PA 1E6ZA 3LUQA 1N1JB 1M1AC 5J3WA 4YFMA 2VGLS 1BUEA 5EOEA 3UE0A 5BO0A 4OP8A 5FATA 4H9OA 3TU4B 1M40A 1IYOA 1W63Q 1U60A 2G7UA 3GRJA 4JJND 5TFQA 2BLSA 3F1NA 3DTMA 2PT7A 1N1JA 3REJB 1BH8B 3LJAC 5CHLB 4J8WB 2GZAA 5CEDA 1J3WA 1W8QA 2Y55A 4IBXA 2G2UA 1MPLA 1TS6A 2E8JA 3KWQD 2A3UA 3Q07A 4E3IA 2D01A 2ZY4A 4KGCB 1BH8A 5B24B 3BJNA 3E2KA 2OSUA 1KX5D 4OUIA 4L9EA 4KUDB 3T1RA 1NRJA 1FOFA 3KO6A 3OBFA 5F1FA 1YAXA 3RELC 3MFXA 3ZQ5A 3KFUG 1L0DA 3GSGA 2CV5D 4OPRA 4Y5FA 2XA7M 1WWIA 1P3AA 4YWZA 3AZHB 5B24A 4N1HA 1ID3B 3C1CB 5JYPA 1YPRA 4XZQB 1KX4C 1ERMA 5J8XA 3AZNA 1N9BA 1ESIA 2DQNC 3MXRA 2Y2NA 3H0RC 4ME4A 2JN7A 2FZ0A 1ZC2A 3B6FD 3AZHA 2F8NH 3NY4A 3B6GC 4XZQA 3BEBA 3CZDA 5G4ZA 4KZAA 2PDRA 2P9VA 4KZ7A 5AVBB 3AV1C 3HJKA 4PM9A 2RTSA 4DN0A 4PHTA 4OQIA 3LZ1C 2VQRA 4GCZA 4LPZA 2W8SA 2JE5A 3DWKA 1H8PA 4K0WA 3P01A 5AVBA 1MBLA 3UT9A 1NZUA 3W98B 3GMWA 1VB6A 5FEFA 4WU9D 1ES3A 4WNNB 4OPQA 1P3OB 3M2JA 4ZAMA 3KX0X 4OQGA 1P34A 3WAAD 4UUZA 3A0VA 2Z6DA 5CPJD 4IBKA 1FR1A 5FA7A 3W98A 4FH2A 3Q1FA 2VKSA 2EX9A 4HH2A 1BLSA 4LENA 4LV2A 3LI9A 3LIAA 1DRMA 3MKFA 1H3QA 5B32B 1P3OA 4OONA 2ZY2A 3QP1A 3CJMA 3W8KA 3V39A 2QHKA 5B31D 5AV6D 5A93A 1XX2A 5E5AB 2EXAA 2OOLA 1S67L 3MZFA 1LSWA 5B0YB 5B32A 5KIZA 3REIB 4NEED 5JA4B 2KLIA 5HL1A 5AVCB 3AZGB 2Q9NA 4ZUXC 2I9VA 4DXCA 5AJGA 3MNNC 3DTKA 4IBJA 1CEFA 4MBFA 4NETA 5JA4A 2EFXA 4X69A 3V3SA 5AVCA 5B33A 3AZGA 1STZA 5U47A 2NQBD 4U0TA 3WKJD 3KUYB 3X1TC 5EV0A 1H0MA 3X1UD
chains in the Genus database with same CATH topology
3P09A 4JXGA 1YLPA 4R3BA 3X1VC 4GD8A 1LHYA 4R0QA 3KUYA 3HLBA 3AGFA 3N3FA 5CPID 3KS4A 5AV8C 3A6ND 5GXQD 5CP6C 5D3OA 4BD1A 1YM1A 3N6IA 1M18C 2DNSA 2WUQA 4OOMA 4H9SA 4OPZA 1P3KA 4UA6A 1M1AB 1PW1A 4BJPA 3OC2A 3V3RA 1KGGA 2XFTA 2YFVB 4H9QB 3UE1A 3LZ0A 2UWXA 3AN2D 1M1AA 2RL3A 1LI0A 3LJAB 5TGFA 3C1BD 4CJNA 2ZQ8A 1H8ZA 3IH8A 3PBQA 5DNND 4H9QA 1EQZB 3SS3A 1E3UA 3ZVWA 1P3GD 3MZEA 5CHJA 1HTAA 4F94A 5BS7C 3LELA 5E2FA 3LEZA 4X6TA 4NZ1A 3RELB 1EQZA 3A3IA 4OKPA 5FUGA 4EO5C 3MGPC 2IWCA 3QNCA 5B1LC 2L5AA 2ZM5A 1PZPA 1KX4B 2HPBA 1S32A 5GHYA 3WA9B 1NYMA 5B2JC 3I7JA 3N7WA 1K25A 3VOZA 2VGKA 4JXVA 3AFAD 3B6GB 1H5XA 4BENA 1KX4A 3UNWA 5AY8C 3WA9A 3W96C 3GVBA 3AV1B 1KE0A 5EVID 3QNBA 1BSGA 1MWRA 1S6RA 5F83A 1AOIA 1BH9B 3LZ1B 1CEGA 4P6BA 3B6GA 2AROD 4DDSA 4OOYA 3R45B 3KSYA 4X68A 3L29A 1LI9A 4KZBA 4Z5TD 2XF3A 5B2IC 3AZKC 1ESUA 5F1GA 3WS5A 1K54A 1P3LD 3R45A 4Y7PA 1TZYA 3REKC 1P3IA 3G2ZA 1O07A 4GNUA 4NE6A 1ZLAD 3B3XA 5B1MD 4S2MA 1EROA 3REHB 1NXYA 4E3OA 4NZ5A 4P87A 4WU8A 5IHVA 4JBFA 3WS1A 1KVMA 3REHA 5TR7A 2HDRA 5BNVB 3MNNB 2IWDA 4GD6A 4Z66A 2ZC4B 5KMWA 2XGNA 2Y59A 3DW0A 4OQ0A 3X1TB 4X23A 1YLZA 1K55A 3E2LA 5M18A 2HDUA 4Q8IA 3X1VB 1YLYA 2WGVA 4QLCD 3B0CW 1P3FA 3VP0A 2XH9A 1XA1A 3ZHHA 5AV8B 3LY3A 1ES4A 5CP6B 1N4OA 3X1VA 3VP3A 1M18B 1P3BC 3C4OA 4JPMA 3ZNTA 4WV4B 4KZ6A 3UTBA 1P3AC 5GLBA 5AV9A 2EXBA 5B24C 2EFUA 4IVIA 4GHLA 3IH9A 3AZNC 1M18A 2F8NG 1FCOA 3O62D 2WK0A 3AZHC 3SS5A 1P3MD 3A3EA 3X1SB 5FI2A 1PYYA 1JFIB 3OPRA 4GH9A 3W99A 3UPPA 1L0EA 3NIAA 3X1SA 1JFIA 3ZG7B 3UT9C 1PZRA 4EO5B 1AXBA 4B88A 3MGPB 3C5AA 3HBRA 4ZJ3A 3EPLA 3AZID 1P34C 5DNMD 5B1LB 3UTAD 4WMCD 4J8XD 4MBHA 1PWDA 3Q7VB 5B2JB 4DE2A 3AZJA 5CPKD 1U35A 2V2FF 4IBBA 2Y2IA 2WZZA 1I2WA 3AZFA 3IWOA 3B0BA 1P3OC 5FASA 4UHUA 3WTPE 3FKWA 1RGYA 5AY8B 5GSUD 5FAQA 3MGQD 3TOIA 3PBSA 5B32C 3AGEA 1HQ3D 5JRGA 4UA9A 5AY8A 3MXSA 1KX3D 4GZBA 1P3PD 4R1GA 2OLUA 3PTEA 4DRTA 3NQUA 3ZG0A 3W97B 5B2IB 3AZKB 5CHUA 2Y2KA 5B33C 1YU0A 3Q7ZA 3AV2D 1H3OA 1IYSA 4R8PD 4YS3D 3W97A 3AZLD 5CPJC 3ZG5A 3REKB 3O86A 2HUEC 3AZEA 2QMIA 2F8ND 1K6SA 5AQ9A 4JF6A 4QNLA 4H9NB 3IF5A 3KUYC 3AZMA 5KSCA 2PYOB 3HLEA 3MGSD 4XUJD 3HUMA 4LV1A 1K56D 1ERQA 1IKIA 4H9NA 4QHCA 2F8NK 3VFHA 4H9SC 5DF9A 2PYOA 4H9PB 1M19B 1P3KC 4RX3A 4E3JA 1MWSA 5BO0B 1YU1A 3TU4D 5B32G 4IBEA 4H9OB 5B0ZA 1W5DA 3UDXA 3GQZA 2WAEA 4H9PA 3LZ0C 1M19A 1RCJA 4GHAA 1XPBA 4HESA 1YT4A 4S2PA 4CSRB 3REJD 4J8WD 1F66A 3X1UC 2Y2JA 4FH4A 4J8VA 1NJ4A 2C5WB 4GN2A 5FI7A 3IQAA 3B0CT 4MEZA 5G49A 5B40B 4KGCD 1JTGA 4CSRA 1QMEA 4K91A 3LELC 5DTSA 1O7EA 4KUDD 4JF5A 3OCLA 1F1EA 1EQZC 2BG1A 5B40A 1P3BB 1K4FA 4NZ3A 4FSFA 3W4PA 1P3AB 4NK3A 3MGRA 1ID3D 1TDGA 3C1CD 3VH5T 2FFYA 4E6WA 4XZQD 3BFEA 3IHBA 5F82A 1S32C 3AZNB 1Q9CA 1Y54A 3A1KA 1P3BA 4LD9A 2WYXA 4YM6A 3HUOA 4JJNB 5FAOA 4R4SA 3WA9C 1L2SA 2P9VB 3HLFA 3B0DC 3ZG9B 4JJNA 1AOIC 3UDFA 4DKIA 1KX5B 5AV5D 3UT9B 5DVAA 3KWQA 5EUAA 1IEMA 1K54C 4O7DA 3WTPD 1P34B 1GA0A 4DE0A 4KHAB 4UUZB 3A1IA 1KX5A 1BLHA 1FSWA 4HBUA 4N1XA 1TZYC 2ZLYA 1P3IC 1WYCA 1GA9A 2Y2GA 2X01A 4KHAA 5CGXA 2ZQ7A 5E5AD 4PM5A 3ZGAB 5B0YD 3ZDJA 2WGIA 3M6HA 3MFDA 3KXBD 3N8LA 3REID 4WU8C 3B6FA 4J8UD 5GT0D 3HREA 5AVCD 3AZGD 3BECA 4DRBA 3REHC 2RVQD 4Y0OA 4JXSA 1XGJA 4YINA 3VFFA 4K0XA 4Z66C 3AYWD 1ONGA 3EG5B 4JLFA 3WS0A 5B33B 2Y2QA 3NI9A 1KDSA 4X23C 1K55C 4DF6A 5CPJB 1PI5A 3ITAA 4PM6A 4M6BA 2HUEB 4IEDA 4PM7A 2WKIA 2ZC6B 4UA7A 1ZG6A 2EX2A 1BLPA 1P3FC 3WAAA 1GCEA 4S2KA 5CPJA 4A5RA 4LCMA 2JC7A 3VMAA 3SH8A 1IYQA 5FQMA 2PU4A 5B31A 5AV6A 3UTBC 2BYMB 2FFFB 5AV9C 3UDIA 1P3KB 4HBTA 4JXWA 2XEPA 5CHMA 3VH6T 2Q9MA 3LZ0B 2BYMA 4KENB 3F6TA 3SOIA 3LJAD 3A3JA 3FKVA 3PBOA 3X1UB 3VSKA 4ZDXA 4LV0A 5CECA 2R9WA 3UE3A 4JKTA 3W99C 3EPKA 4QLCC 2NQBA 3WKJA 1T3UA 5HW3A 3CMZA 3X1SC 5M19A 3X1UA 3LELB 1IYPA 5CPIB 1QMFA 3EQVA 3W4QA 1KGFA 5GXQB 2ZC3B 3RELD 1I2SA 3NQJA 1JWVA 5FUGB 2Z2LB 4GB7A 3C7VA 3PAGA 3DWZA 4LCLA 5CPIA 3A6NA 1YU4A 1FCNA 1S32B 5GXQA 4IBFA 5CGWA 3AZJC 1R4VA 1U35C 3BLMA 4ZJ1A 3AZFC 3O62C 2YFWB 2HDSA 3G32A 5F99D 4NYYA 5CTMA 3C1BB 3AV1D 3B0DB 1XKZA 1YLWA 1EWZA 3LZ1D 1AOIB 2YFWA 5JRGC 1P3GB 1JTDA 4ZBJC 1ALQA 1KE4A 4H9RA 3C1BA 4OJOA 5DNNA 3HVFA 3M6BA 3EPJA 1P3GA 2ZY5A 3C7UA 4AWLC 4C3QA 1MKIA 1Z6FA 3W97C 1TZYB 1P3IB 2XFSA 1W2EA 4S2LA 4XXRA 3AZEC 5CPKC 2NZDC 3GR2A 1XA7A 3UPOA 5AQ7A 5HAQA 3AZMC 2EX8A 4OP5A 2V1ZA 1PW8A 4PMAA 3MGQC 2ZJ9A 4WU8B 1XGIA 4OVDA 3AFAA 2AROB 4ZUXD 2PYOC 2JCHA 4JF4A 1ONHA 2DCFA 3MNND 5EVIA 2X02A 3VH5A 4Z66B 3N8SA 5B0ZC 5GT3D 2AROA 3TSGA 3X1TD 1IKGA 1M19C 4X23B 3IXDA 1WWSA 3AV2C 1F66C 3MVDC 1HVBA 3VP2A 4J8VC 4Z5TA 2ZQDA 3WS4A 2IO5C 1P3LA 3JYIA 1ZLAB 1P3FB 5FQ9A 2ZD8A 1CK3A 3FV7A 5AV8D 1CI9A 4FD8A 4X56A 1RP5A 4KQRA 3V9RA 5CP6D 3GTCA 1KDWA 5GLAA 1ZLAA 5B40C 4U3TA 5B1MA 4QY6A 3UTBB 4WEKA 1I5QA 4IBRA 3MGRC 5AV9B 4EQIA 1FR6A 3L2AA 4X53A 2HIOD 3W4OA 2CC1A 3O3VA 4M3KA 1K4EA 3L25A 4LD9C 1G6AA 1K38A 1RGZA 1KVLA 4YM6C 1DJAA 1K57A 3IF6A 5BT1C 1J9MA 3VH5W 3BLSA 3G35A 3H0LC 3AGDA 2ZQAA 3W99B 2ZQ9A 4QLCB 4JJNC 1BTLA 1VQQA 1NZOA 2H10A 3N4IA 3AL0C 1LL5A 4QLCA 3KWQC 2FJ7D 3MGPD 3NC8A 1HZOA 5AQAA 4BD0A 5B1LD 5A90A 3RXXA 1KX5C 2DRWA 3WS2A 5B2JD 3IXBA 3AZJB 1U35B 4KG5A 3AZFB 3O62B 2CV5C 3NCKA 2DF4C 5AY8D 1Q2QA 1P3MB 5HAPA 4WEJA 2HP9A 5C3IC 1SDEA 3W96D 4NZ4A 3BM6A 1BZAA 3O62A 5JRGB 1MY8A 3B6FC 5DTTA 2Z2MB 1P3MA 4ZBJB 2XR0A 4P0MA 5JYOA 1WE4A 4EUZA 3NQUB 5AV5C 1A7WA 2ZC5B 5B2ID 2G5HC 4E6XA 3AZKD 2Y2LA 4EBLA 4OH0A 4LG2A 4AWLB 1SCWA 2QZ6A 4X55A 1H3OB 3WTPC 3VH6A 3UTAB 4J8XB 1TAFA 2WAFA 4S2IA 3REKD 5AQBA 3WRZA 5FAPA 1ULYA 4WU9C 3AZEB 5CPKB 2NZDB 2RIQA 1E25A 2H0YA 1PWGA 1YQSA 3AZMB 3AZIA 5DNMA 5BNXA 3WAAC 3UTAA 4WMCA 4OJLA 4J8XA 4C75A 3MGQB 5CPKA 2NZDA 1ES5A 2P74A 3KXBC 2WZXA 1EI5A 5GLCA 4J8UC 1DY6A 5GT0C 5B31C 5AV6C 5GSUA 4EWFA 1G68A 1LLBA 3MGQA 5B0ZB 1HQ3A 3HUNA 1KX3A 1P3PA 1KU5A 4Z2MG 1TDLA 3AV2B 1F66B 3HLGA 5DF7A 3MVDB 4S2NA 4C6YA 4J8VB 4S2OA 2J9PA 3VH6W 4MLLA 2IO5B 5G49B 2NQBC 3ITBA 3WKJC 3AV2A 2HDQA 3MVDA 4YS3A 5E2HA 4KZ3A 1VM1A 3AZLA 3MGSB 1ZG4A 1ES2A 3ZG8B 3ZVTA 2WGWB 2F8NA 1P3BD 1TVFA 1L0FA 1P3AD 4OOLA 4BL3A 1CI8A 3RXWA 3MGRB 5B24D 3IWIA 3MGSA 4XUJA 5CPIC 4DXBA 5KDMA 3A6NC 3OZHA 3V50A 3H0MC 5GXQC 1K56A 2WADA 3AZND 3FDDA 2G2WA 2WGWA 1PIOA 5CGSA 4LD9B 4BLMA 4BL2A 4YM6B 5B31G 3AZHD 3ZNYA 4MNRA 1M6KA 4N92A 3WRTA 3LY4A 5DF8A 3TU4A 1LL9A 1NYYA 5L2FA 3AN2C 3REJA 3NBLA 4J8WA 5GL9A 5AVBD 3C1BC 3GV9A 3UT9D 3BFCA 4R23A 5E43A 5DNNC 3L26A 2PBYA 3KWQB 2XK1A 2EX6A 4KGCA 5EVLA 1P3GC 2Y2PA 5EPHA 1P34D 1SDNA 1K6RA 5FI6A 4KUDA 3W98D 3HSHA 3G2YA 3IXHA 3ZFZA 1P3OD 3O88A 2CV5B 4WM9A 5M1AA 1ID3A 5FQKA 1L0GA 3C1CA 4MBKA 2C6WB 5F99C 5C3IB 3ISGA 3OPHA 1KE3A 1S0WA 5B32D 2CV5A 3M2KA 4EV4A 4NFTA 5BOHA 3B6FB 4DE1A 3AFAC 4OLGA 3TG9A 1JWPA 4WZ5C 1JWZA 3C4PA 5AV5B 3NDEA 5EVIC 5HARA 2B5RA 5B33D 2AROC 3L27A 3WTPB 1YU3A 4NYUA 3Q82A 4G91C 5AV5A 4HEFA 5CEBA 4IJFA 3G30A 4P85A 4WU9B 5CXWA 2WKHA 4WNNA 4Z5TC 4KQQA 3KUYD 1P3LC 4RVAA 3WTPA 3WAAB 3D4FA 3BFDA 1C3BA 4WU9A 4BQMA 2HP6A 4DE3A 4OJ5A 5FQQA 2V20A 2G5IC 3KXBB 3HONA 3SH7A 4UAAA 1ZLAC 4ZBEA 4J8UB 5GT0B 2J9OA 4RX2A 5B31B 5B1MC 5AV6B 5E5AA 1P3KD 5B0YA 3OPLA 4QJGA 4N9KA 3KXBA 3REIA 1BT5A 4J8UA 3LZ0D 5GT0A 3AYWB 5GT3C 4DQYB 4IVKA 1M1AD 3IF6C 1K57C 4GDBA 4KZ9A 3VP1A 3AYWA 2E8IA 4NE3A 3LCEA 1H8YA 1E3UD 2NQBB 3WKJB 4EBPA 2XD5A 5KSHA 3LELD 4Z2MH 4CAYB 1SHVA 4OQHA 5FSRA 1EQZD 3NQJB 1TEMA 2Y91A 5A92A 3P5JB 3LO7A 3OCNA 4CAYA 3A6NB 1S32D 4ZJ2A 4WJ3C 2HIOC 1ZKJA 1BULA 4XUZA 2OLVA 1JVJA 4QU3A 5EOOA 2IWBA 5I94A 2VGJA 1KX4D 4NY2A 3WA9D 1NRFA 3N8RA 4IBDA 3VOYA 4KG2A 3EQUA 2YFVA 1AOID 5EECA 3B6GD 3AN2B 3LJAA 1P3MC 3EPHA 1W7FA 4H9RB 4RYEA 4E44A 3IXGA 5DNNB 4E3MA 2XLNA 2FJ7C 3AN2A 3PBRA 3UY6A 4N9LA 4QB8A 1GHPA 4UPKA 3RELA 1TZYD 2I72A 1P3ID 4G92C 2H0TA 3V5MA 3P98A 2LY8A 1PZOA 3HLCA 1FSYA 3AZIC 4DRAA 3FWLA 5DNMC 4IBGA 3UTAC 5F99B 4H8RA 4J8XC 4U0XA 5CRFA 1XP4A 5EE8A 3SH9A 4WU8D 5GLDA 3AFAB 5F99A 5GSUC 1Z2CB 3REHD 1YLTA 5HAIA 5DTKA 3IT9A 3AV1A 1BLCA 5EVIB 1DJBA 4E3NA 3A3FA 4Z66D 1BH9A 3LZ1A 3NDGA 1HQ3C 5HFOA 2CWEA 4X23D 4RA7A 1KX3C 1YMXA 5BPVA 1P3PC 4WZ5A 5E2GA 2ZM8A 4XUXA 2ZMAA 4G91B 4S2NC 3MKEA 3HLWA 4ID4A 1YUEA 4Z5TB 1MXOA 1P3LB 1P3FD 3G4PA 3BYDA 4R3JA 4R8PC 4YS3C 3V9RB 3AZLC 3O87A 3X1VD 2WKEA 4KZ4A 2H5SA 2X71A 2Y2HA 3CG5A 3UTBD 3UO9A 5B1MB 4WBGA 5AV9D 4WZ4A 4ZUXB 1PI4A 3MGSC 4XUJC 4HGAC 2GDNA 1M18D 1Q2PA 4PM8A 3WX7A 4QY5A 5GT3B 3BRMA 4WELA 4Y0UA 4WZSB 4ZUXA 3VP4A 3IF6B 2IOUA 5BNVA 3MNNA 5FDHA 1XXMA 4E3LA 3TU4C 3A3DA 3W99D 5GT3A 2OV5A 3SS4A 4IBCA 3MZDA 3X1TA 2ZM0A 3X1SD 1W8YA 1B6WA 3G31A 3REJC 3ZCZA 4J8WC 3HL9A 3UN7A 5GHXA 3WWXA 1IELA 1HD8A 4OJ6A 4KGCC 2J8YA 2Y2OA 4OPYA 5AV8A 1WYBA 4EBNA 5CP6A 1YMSA 2QPNA 1SKFA 3Q81A 2HIOB 4E3KA 4KUDC 3AZJD 1U35D 3IWQA 3AZFD 4ZTKA 1NY0A 1YU2A 5KZHA 4S2JA 1ID3C 3MBZA 3C1CC 2HIOA 4XZQC 4CPKA 2XD1A 3FYZA 5CERA 4B4XA 5JRGD 4IBIA 3IP4C 1FCMA 3OPPA 4Y0TA 2R9XA 3FZCA 1KGEA 2RCXA 5AVBC 4OJPA 3PBTA 2FJ7B 5BS7A 1PWCA 5GHZA 2HP5A 3IHAA 3W97D 1BFMA 1TAFB 5CTNA 3KS8A 3W98C 5E2EA 4FCFA 4G92B 3AZED 2NZDD 2ZQCA 1OMEA 1MWTA 2Y4AA 2FJ7A 3MGPA 2PU2A 4NE5A 3PAEA 1DJCA 4KG6A 3S22A 3AZMD 2JSSA 1GHMA 3QHYA 5B1LA 3AZIB 5DNMB 4L0LA 5BNXB 2XDMA 2ZY3A 3G34A 4KQOA 3Q7VA 4Z9QA 3W96B 5B2JA 3PBNA 5G18A 4QD4A 2BYKB 1GHIA 1W79A 2F2AC 3S1YA 3BFGA 2PYOD 3UPNA 2XQZA 5E5AC 5GSUB 2A49A 5A91A 3W96A 4KZ5A 4DDYA 5B0YC 3HLDA 1FQGA 2JBFA 5HX9A 2BYKA 5FQJA 5B0ZD 3REIC 4OLDA 1HQ3B 3FKEA 4R4RA 1M19D 5AVCC 3AZGC 1HTZA 1KX3B 1P3PB 1E4DA 1MWUA 1F66D 1YLJA 3MVDD 2RVQC 5FQIA 4IJEA 4WYYA 4B4ZA 4J8VD 5B2IA 2J7VA 3AZKA 4D2OA 3BFFA 3AYWC 4GOGA 4R8PB 4YS3B 4GKUA 3S4XA 3AZLB 3REKA 2ZM2A 1B67A 2Y2MA 4E45A 5B40D 2F8NB 4PPRA 3MGRD 4R8PA 4XUJB 5KDMB 3RJUA 4HGAB 4KZ8A 4LV3A 4GDNA 4LD9D 3VSLA 4YM6D 2ZC7A 3L28A 5BT1D 2J8PA 1N1JB 1M1AC 4YFMA 1BUEA 5EOEA 3UE0A 5BO0A 4OP8A 5FATA 4H9OA 3TU4B 1M40A 1IYOA 1U60A 3GRJA 4JJND 5TFQA 2BLSA 3DTMA 1N1JA 3REJB 1BH8B 3LJAC 5CHLB 4J8WB 5CEDA 1W8QA 2Y55A 4IBXA 2G2UA 1MPLA 3KWQD 2A3UA 3Q07A 4E3IA 2ZY4A 4KGCB 1BH8A 5B24B 3E2KA 2OSUA 1KX5D 4OUIA 4KUDB 1FOFA 5F1FA 3RELC 3KFUG 1L0DA 3GSGA 2CV5D 4OPRA 1WWIA 1P3AA 3AZHB 5B24A 4N1HA 1ID3B 3C1CB 5JYPA 4XZQB 1KX4C 1ERMA 5J8XA 3AZNA 1N9BA 1ESIA 2DQNC 3MXRA 2Y2NA 3H0RC 1ZC2A 3B6FD 3AZHA 2F8NH 3NY4A 3B6GC 4XZQA 3BEBA 3CZDA 4KZAA 2P9VA 4KZ7A 5AVBB 3AV1C 4PM9A 4OQIA 3LZ1C 2VQRA 2W8SA 2JE5A 3DWKA 4K0WA 5AVBA 1MBLA 3UT9A 1NZUA 3W98B 3GMWA 4WU9D 1ES3A 4WNNB 4OPQA 1P3OB 3M2JA 4ZAMA 4OQGA 1P34A 3WAAD 4UUZA 5CPJD 4IBKA 1FR1A 5FA7A 3W98A 4FH2A 3Q1FA 2EX9A 1BLSA 4LENA 4LV2A 3MKFA 5B32B 1P3OA 4OONA 2ZY2A 3CJMA 3W8KA 3V39A 5B31D 5AV6D 5A93A 1XX2A 5E5AB 2EXAA 3MZFA 5B0YB 5B32A 3REIB 5JA4B 5HL1A 5AVCB 3AZGB 2Q9NA 4ZUXC 4DXCA 3MNNC 4IBJA 1CEFA 4MBFA 4NETA 5JA4A 2EFXA 4X69A 3V3SA 5AVCA 5B33A 3AZGA 5U47A 2NQBD 4U0TA 3WKJD 3KUYB 3X1TC 3X1UD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BG1 A;  3NDG A;  2HP9 A;  1SDE A;  3P09 A;  4JXG A;  4WEJ A;  1K4F A;  1YLP A;  4FSF A;  4R3B A;  3W4P A;  4NK3 A;  5HFO A;  1TDG A;  4RA7 A;  1YMX A;  5E2G A;  4WZ5 A;  4GD8 A;  2FFY A;  3BM6 A;  2ZM8 A;  4E6W A;  1BZA A;  3BFE A;  3IHB A;  4XUX A;  5F82 A;  2ZMA A;  1LHY A;  4R0Q A;  4S2N C;  1MY8 A;  3HLW A;  3HLB A;  3MKE A;  4ID4 A;  3AGF A;  5DTT A;  1Y54 A;  2Z2M B;  2XR0 A;  2WYX A;  1MXO A;  4P0M A;  5JYO A;  1WE4 A;  5D3O A;  3HUO A;  4EUZ A;  3G4P A;  3BYD A;  4BD1 A;  1YM1 A;  5FAO A;  2ZC5 B;  3N6I A;  4E6X A;  2DNS A;  2WUQ A;  4OOM A;  4R3J A;  4R4S A;  2Y2L A;  4EBL A;  4OH0 A;  4OPZ A;  1L2S A;  3O87 A;  2P9V B;  1SCW A;  2QZ6 A;  2WKE A;  3HLF A;  4KZ4 A;  2H5S A;  4X55 A;  4UA6 A;  1PW1 A;  4BJP A;  2X71 A;  3ZG9 B;  2Y2H A;  3OC2 A;  2WAF A;  3CG5 A;  4S2I A;  3UO9 A;  5AQB A;  3UDF A;  4WBG A;  3WRZ A;  5FAP A;  3V3R A;  1KGG A;  4DKI A;  4WZ4 A;  1PI4 A;  2XFT A;  3UE1 A;  1E25 A;  2UWX A;  2H0Y A;  1PWG A;  1YQS A;  1Q2P A;  2GDN A;  4PM8 A;  2RL3 A;  1LI0 A;  5DVA A;  4WMC A;  4C75 A;  5TGF A;  4QY5 A;  3BRM A;  4WEL A;  4CJN A;  5EUA A;  4Y0U A;  1IEM A;  1K54 C;  4O7D A;  2ZQ8 A;  1H8Z A;  3IH8 A;  3IF6 B;  1ES5 A;  1GA0 A;  2P74 A;  3PBQ A;  3VP4 A;  4DE0 A;  1BLH A;  2WZX A;  3SS3 A;  1FSW A;  1XXM A;  4HBU A;  5FDH A;  4E3L A;  1E3U A;  1EI5 A;  3ZVW A;  5GLC A;  1DY6 A;  3MZE A;  5CHJ A;  4N1X A;  2ZLY A;  4F94 A;  3A3D A;  1WYC A;  1GA9 A;  4EWF A;  1G68 A;  5E2F A;  2OV5 A;  1LLB A;  3LEZ A;  4X6T A;  3SS4 A;  2Y2G A;  3MZD A;  2X01 A;  2ZM0 A;  1W8Y A;  5CGX A;  2ZQ7 A;  3G31 A;  3ZCZ A;  3A3I A;  4OKP A;  3HL9 A;  3UN7 A;  4PM5 A;  3ZGA B;  3HUN A;  5GHX A;  3ZDJ A;  2WGI A;  3M6H A;  3WWX A;  3MFD A;  2IWC A;  3QNC A;  1IEL A;  1TDL A;  3N8L A;  1HD8 A;  1PZP A;  2HPB A;  3HLG A;  5DF7 A;  4S2N A;  5GHY A;  3HRE A;  1NYM A;  3BEC A;  4C6Y A;  2J8Y A;  2Y2O A;  4OPY A;  3I7J A;  4S2O A;  2J9P A;  1WYB A;  4MLL A;  4EBN A;  4Y0O A;  2QPN A;  1YMS A;  3Q81 A;  1SKF A;  1K25 A;  3N7W A;  4JXS A;  4E3K A;  1XGJ A;  4YIN A;  2VGK A;  3VOZ A;  3ITB A;  4JXV A;  3VFF A;  2HDQ A;  1H5X A;  4BEN A;  3UNW A;  4K0X A;  3IWQ A;  5E2H A;  4KZ3 A;  1ONG A;  4ZTK A;  1VM1 A;  4JLF A;  3WS0 A;  1ZG4 A;  1NY0 A;  1KE0 A;  2Y2Q A;  3GVB A;  1ES2 A;  3NI9 A;  5EVI D;  5KZH A;  3QNB A;  1BSG A;  4S2J A;  3MBZ A;  1KDS A;  1MWR A;  3ZG8 B;  3ZVT A;  1S6R A;  2WGW B;  5F83 A;  1TVF A;  1K55 C;  4DF6 A;  1CEG A;  1L0F A;  1PI5 A;  3ITA A;  4P6B A;  4DDS A;  4OOL A;  4PM6 A;  4BL3 A;  1CI8 A;  4CPK A;  2XD1 A;  3RXW A;  3IWI A;  4IED A;  4OOY A;  2WKI A;  2ZC6 B;  4PM7 A;  3FYZ A;  4UA7 A;  1ZG6 A;  4DXB A;  3OZH A;  3V50 A;  2EX2 A;  5CER A;  4B4X A;  4X68 A;  1K56 A;  1BLP A;  2WAD A;  1FCM A;  1LI9 A;  3OPP A;  2G2W A;  4KZB A;  2R9X A;  2WGW A;  4Y0T A;  1GCE A;  4S2K A;  2XF3 A;  1PIO A;  3FZC A;  5CGS A;  4A5R A;  1ESU A;  5F1G A;  4BLM A;  4BL2 A;  4LCM A;  3WS5 A;  2JC7 A;  1KGE A;  1K54 A;  2RCX A;  3ZNY A;  4MNR A;  1M6K A;  4N92 A;  3VMA A;  3SH8 A;  1IYQ A;  3PBT A;  3WRT A;  4Y7P A;  3LY4 A;  5FQM A;  5DF8 A;  2PU4 A;  1LL9 A;  3G2Z A;  2FFF B;  1PWC A;  1O07 A;  3UDI A;  1NYY A;  4HBT A;  4GNU A;  2HP5 A;  5GHZ A;  3IHA A;  4JXW A;  5L2F A;  3B3X A;  5CTN A;  2XEP A;  5E2E A;  4FCF A;  2ZQC A;  3NBL A;  5CHM A;  4S2M A;  1OME A;  1MWT A;  2Y4A A;  5GL9 A;  2Q9M A;  1ERO A;  2PU2 A;  3PAE A;  1DJC A;  1NXY A;  3GV9 A;  4KG6 A;  3S22 A;  4KEN B;  4E3O A;  1GHM A;  4P87 A;  3BFC A;  3QHY A;  4R23 A;  5E43 A;  3A3J A;  4L0L A;  3SOI A;  2PBY A;  2XDM A;  3FKV A;  3PBO A;  5IHV A;  3VSK A;  3G34 A;  4KQO A;  2XK1 A;  2EX6 A;  3Q7V A;  4Z9Q A;  5EVL A;  4ZDX A;  2Y2P A;  4LV0 A;  5EPH A;  5CEC A;  3PBN A;  5G18 A;  4JBF A;  1SDN A;  2R9W A;  3WS1 A;  1KVM A;  1K6R A;  5FI6 A;  4QD4 A;  1GHI A;  4JKT A;  3UE3 A;  5TR7 A;  1W79 A;  2HDR A;  3S1Y A;  3BFG A;  3G2Y A;  5HW3 A;  3CMZ A;  2IWD A;  3IXH A;  4GD6 A;  3UPN A;  2ZC4 B;  2XQZ A;  3ZFZ A;  5KMW A;  2XGN A;  5M19 A;  1IYP A;  2A49 A;  2Y59 A;  1QMF A;  3EQV A;  5A91 A;  4KZ5 A;  3O88 A;  3DW0 A;  4WM9 A;  5M1A A;  3W4Q A;  4DDY A;  1KGF A;  3HLD A;  4OQ0 A;  2ZC3 B;  1FQG A;  2JBF A;  1I2S A;  5FQK A;  5HX9 A;  1L0G A;  4MBK A;  1YLZ A;  5FQJ A;  1K55 A;  2C6W B;  3ISG A;  3OPH A;  1JWV A;  4OLD A;  2Z2L B;  4GB7 A;  3C7V A;  4R4R A;  3PAG A;  1KE3 A;  1S0W A;  3E2L A;  5M18 A;  1HTZ A;  2HDU A;  4Q8I A;  3DWZ A;  4LCL A;  1YLY A;  1E4D A;  2WGV A;  1MWU A;  1YLJ A;  4EV4 A;  3M2K A;  1FCN A;  5BOH A;  5FQI A;  3VP0 A;  4DE1 A;  4WYY A;  2XH9 A;  4B4Z A;  1XA1 A;  4OLG A;  5CGW A;  3TG9 A;  1JWP A;  2J7V A;  3BLM A;  4ZJ1 A;  3ZHH A;  4D2O A;  3LY3 A;  3BFF A;  4WZ5 C;  1ES4 A;  1JWZ A;  4GOG A;  1N4O A;  3C4P A;  3VP3 A;  2HDS A;  3NDE A;  5EVI C;  3G32 A;  4GKU A;  5HAR A;  5CTM A;  3C4O A;  2B5R A;  4JPM A;  3S4X A;  4KZ6 A;  3ZNT A;  2ZM2 A;  5GLB A;  2EXB A;  1XKZ A;  1YLW A;  1EWZ A;  2Y2M A;  3Q82 A;  2EFU A;  4HEF A;  4IVI A;  5CEB A;  4PPR A;  3IH9 A;  3G30 A;  4P85 A;  5CXW A;  1JTD A;  2WKH A;  1FCO A;  1ALQ A;  1KE4 A;  4KQQ A;  3RJU A;  2WK0 A;  4KZ8 A;  4LV3 A;  4GDN A;  4RVA A;  3SS5 A;  3A3E A;  3D4F A;  3HVF A;  3VSL A;  3BFD A;  3M6B A;  5FI2 A;  1PYY A;  1C3B A;  3OPR A;  4BQM A;  2HP6 A;  3C7U A;  4DE3 A;  2ZC7 A;  4C3Q A;  5FQQ A;  2V20 A;  3UPP A;  3SH7 A;  4YFM A;  1L0E A;  1MKI A;  4UAA A;  1BUE A;  1Z6F A;  4ZBE A;  3NIA A;  5EOE A;  3UE0 A;  2J9O A;  4OP8 A;  4RX2 A;  5FAT A;  2XFS A;  1M40 A;  4S2L A;  1IYO A;  4XXR A;  1U60 A;  3GR2 A;  3GRJ A;  1XA7 A;  3OPL A;  4QJG A;  3ZG7 B;  5TFQ A;  3UPO A;  4N9K A;  2BLS A;  5AQ7 A;  5HAQ A;  3DTM A;  2EX8 A;  4OP5 A;  1BT5 A;  1AXB A;  1PW8 A;  2V1Z A;  4PMA A;  4B88 A;  3C5A A;  3HBR A;  5CED A;  4ZJ3 A;  1W8Q A;  2Y55 A;  4IBX A;  4IVK A;  2G2U A;  1MPL A;  1K57 C;  3IF6 C;  2ZJ9 A;  4WMC D;  2A3U A;  3Q07 A;  4GDB A;  4E3I A;  4MBH A;  1XGI A;  4OVD A;  4KZ9 A;  1PWD A;  3Q7V B;  4DE2 A;  2WZZ A;  2V2F F;  2Y2I A;  1I2W A;  3VP1 A;  2JCH A;  4JF4 A;  3E2K A;  2E8I A;  1ONH A;  2OSU A;  2DCF A;  3IWO A;  5FAS A;  3LCE A;  1H8Y A;  3FKW A;  4UHU A;  1E3U D;  1FOF A;  5EVI A;  5F1F A;  1RGY A;  2X02 A;  4EBP A;  2XD5 A;  5KSH A;  3N8S A;  1L0D A;  3GSG A;  5FAQ A;  4OPR A;  1SHV A;  3TSG A;  4OQH A;  5FSR A;  1IKG A;  3TOI A;  4N1H A;  3PBS A;  3IXD A;  5JYP A;  3AGE A;  1TEM A;  1ERM A;  2Y91 A;  1HVB A;  1N9B A;  3VP2 A;  4UA9 A;  1ESI A;  5J8X A;  3MXR A;  3MXS A;  5A92 A;  4GZB A;  2Y2N A;  2ZQD A;  4R1G A;  3LO7 A;  2OLU A;  3OCN A;  3WS4 A;  3PTE A;  4ZJ2 A;  1ZC2 A;  1ZKJ A;  3JYI A;  4DRT A;  3ZG0 A;  3NY4 A;  5FQ9 A;  2ZD8 A;  1BUL A;  4XUZ A;  2OLV A;  3BEB A;  3CZD A;  1CK3 A;  3FV7 A;  4FD8 A;  1CI9 A;  4X56 A;  1RP5 A;  1JVJ A;  4KQR A;  4KZA A;  4QU3 A;  5CHU A;  3GTC A;  2Y2K A;  2P9V A;  1KDW A;  4KZ7 A;  5EOO A;  2IWB A;  5I94 A;  3Q7Z A;  4PM9 A;  2VGJ A;  5GLA A;  1IYS A;  4OQI A;  1NRF A;  3N8R A;  3ZG5 A;  4U3T A;  4QY6 A;  4WEK A;  1I5Q A;  3VOY A;  3O86 A;  4IBR A;  4KG2 A;  2JE5 A;  3EQU A;  4EQI A;  1FR6 A;  2QMI A;  3DWK A;  4X53 A;  1K6S A;  4K0W A;  5AQ9 A;  5EEC A;  4JF6 A;  3W4O A;  1MBL A;  1NZU A;  2CC1 A;  3IF5 A;  3GMW A;  3O3V A;  4M3K A;  1ES3 A;  5KSC A;  1K4E A;  3HLE A;  4OPQ A;  3HUM A;  1G6A A;  1K38 A;  1W7F A;  1RGZ A;  1KVL A;  4LV1 A;  3M2J A;  4ZAM A;  4RYE A;  1K56 D;  4OQG A;  1DJA A;  1K57 A;  3IF6 A;  1ERQ A;  3IXG A;  1J9M A;  1IKI A;  4E3M A;  3BLS A;  1FR1 A;  5FA7 A;  4FH2 A;  4QHC A;  2XLN A;  3G35 A;  3Q1F A;  3VFH A;  5DF9 A;  3PBR A;  3AGD A;  2EX9 A;  1BLS A;  4LEN A;  2ZQA A;  4LV2 A;  3UY6 A;  3MKF A;  4N9L A;  4OON A;  2ZQ9 A;  1GHP A;  4QB8 A;  4RX3 A;  3CJM A;  3W8K A;  3V39 A;  4E3J A;  1BTL A;  1MWS A;  1VQQ A;  2I72 A;  1NZO A;  1XX2 A;  5A93 A;  1W5D A;  2EXA A;  2H0T A;  2H10 A;  3P98 A;  3V5M A;  3UDX A;  3GQZ A;  3MZF A;  1PZO A;  2WAE A;  3N4I A;  1RCJ A;  1XPB A;  4HES A;  3HLC A;  1YT4 A;  1FSY A;  4S2P A;  3FWL A;  1LL5 A;  4H8R A;  4U0X A;  5CRF A;  2Y2J A;  4FH4 A;  5HL1 A;  3NC8 A;  1XP4 A;  1HZO A;  5AQA A;  2Q9N A;  4BD0 A;  1NJ4 A;  2C5W B;  5EE8 A;  3SH9 A;  4DXC A;  4GN2 A;  5FI7 A;  3IQA A;  5A90 A;  4MEZ A;  5GLD A;  3RXX A;  2DRW A;  3WS2 A;  1CEF A;  1JTG A;  1QME A;  3IXB A;  4K91 A;  4MBF A;  4KG5 A;  4NET A;  1YLT A;  2EFX A;  4X69 A;  5DTS A;  5HAI A;  1O7E A;  5DTK A;  3V3S A;  4JF5 A;  3IT9 A;  5U47 A;  4U0T A;  1BLC A;  5EVI B;  3NCK A;  3OCL A;  1DJB A;  1Q2Q A;  4E3N A;  3A3F A;  5HAP A; 
#chains in the Genus database with same CATH topology
 3P09 A;  4JXG A;  1YLP A;  4R3B A;  3X1V C;  4GD8 A;  1E88 A;  1LHY A;  4R0Q A;  3KUY A;  4CLC D;  3HLB A;  4F3L B;  2HJE A;  3AGF A;  2A24 B;  3N3F A;  5CPI D;  1HLU P;  3KS4 A;  5AV8 C;  3A6N D;  3EEA A;  5GXQ D;  5CP6 C;  5D3O A;  3FPW A;  1G28 A;  4BD1 A;  1YM1 A;  3N6I A;  4JGQ A;  1M18 C;  2DNS A;  2WUQ A;  4OOM A;  4I38 A;  4F3L A;  4H9S A;  2J3T D;  4OPZ A;  3S7O A;  2A24 A;  1XJ3 A;  1P3K A;  4UA6 A;  1M1A B;  1PW1 A;  4BJP A;  3B47 A;  4HMC A;  1UR8 A;  3OC2 A;  4PKY A;  3V3R A;  1KGG A;  4IHQ A;  4KUO A;  2B18 A;  2XFT A;  2YFV B;  4H9Q B;  3UE1 A;  3LZ0 A;  2UWX A;  3AN2 D;  1M1A A;  2RL3 A;  1LI0 A;  3LJA B;  4LRX C;  5TGF A;  3C1B D;  4CJN A;  2JKR M;  3LIB A;  2ZQ8 A;  1H8Z A;  3IH8 A;  3PBQ A;  5DNN D;  4H9Q A;  1EQZ B;  3SS3 A;  1E3U A;  3ZVW A;  1P3G D;  3MZE A;  5CHJ A;  3FG8 A;  1HTA A;  4F94 A;  5BS7 C;  3LEL A;  5E2F A;  3LEZ A;  4X6T A;  4NZ1 A;  3UME A;  3REL B;  1EQZ A;  3A3I A;  4OKP A;  5FUG A;  5F5Y A;  4EO5 C;  3HCY A;  3MGP C;  4G3K A;  1S1Y A;  4HHD A;  3IBJ A;  1LL8 A;  2IWC A;  3QNC A;  5B1L C;  2L5A A;  2ZM5 A;  1PZP A;  1KX4 B;  2HPB A;  1S32 A;  5GHY A;  3WA9 B;  4IUH A;  2V8F A;  1NYM A;  5B2J C;  1K0K A;  3I7J A;  3N7W A;  1K25 A;  2GX5 A;  3VOZ A;  2VGK A;  4JXV A;  3AFA D;  3B6G B;  3A0S A;  1H5X A;  4BEN A;  1KX4 A;  3UNW A;  5AY8 C;  3VE4 A;  3WA9 A;  3M7P A;  4IJG A;  3W96 C;  3GVB A;  3AV1 B;  1KE0 A;  5EVI D;  1E6N A;  1GSW A;  1BSG A;  3QNB A;  1MWR A;  3CAX A;  1S6R A;  5F83 A;  1AOI A;  1BH9 B;  3LZ1 B;  1CEG A;  4P6B A;  4O01 A;  3B6G A;  3PYP A;  2ARO D;  4DDS A;  3DTE A;  4OOY A;  4R3A A;  3U2A A;  1YKD A;  3R45 B;  3KSY A;  1S4S A;  4X68 A;  4Q0I A;  3L29 A;  3UB5 P;  1LI9 A;  1E15 A;  4KZB A;  4Z5T D;  2XF3 A;  3DTI A;  5B2I C;  3AZK C;  1ESU A;  5F1G A;  3T4T A;  2O0Y A;  3WS5 A;  1K54 A;  1P3L D;  4HP9 A;  3CHW P;  3R45 A;  3NJA A;  1F2K A;  4Y7P A;  3T4O A;  1TZY A;  3REK C;  1P3I A;  3G2Z A;  3D3O A;  3NOP C;  1O07 A;  3SZT A;  4GNU A;  4H6J A;  3QP4 A;  4NE6 A;  4P6Z S;  1ZLA D;  3B3X A;  5HWV A;  5B1M D;  5DJU A;  4II7 A;  4S2M A;  1ERO A;  5HSQ A;  3REH B;  5HPF A;  1NXY A;  5F69 A;  4E3O A;  3WD3 A;  4EEU A;  4NZ5 A;  4P87 A;  3KYZ A;  4WU8 A;  5IHV A;  1ZTU A;  1CF0 A;  3LI8 A;  4JBF A;  3WS1 A;  1KVM A;  2PRF A;  3REH A;  5TR7 A;  4Q0H A;  2HDR A;  5BNV B;  3MNN B;  2K31 A;  2IWD A;  4GD6 A;  4Z66 A;  2ZC4 B;  2VV7 A;  5KMW A;  2XGN A;  2Y59 A;  3NOU C;  3DW0 A;  2PR5 A;  4OQ0 A;  3X1T B;  4X23 A;  1YLZ A;  1E6R A;  1K55 A;  4ETZ A;  3MS6 A;  3E2L A;  5M18 A;  2HDU A;  4Q8I A;  4EU0 A;  3X1V B;  1YLY A;  2WGV A;  4QLC D;  3B0C W;  1P3F A;  3VP0 A;  2XH9 A;  1XA1 A;  3KSG A;  3ZHH A;  5AV8 B;  3LY3 A;  1ES4 A;  5CP6 B;  4TX8 A;  1N4O A;  3X1V A;  3VP3 A;  2CMN A;  4Z1W A;  1M18 B;  3T1X A;  1P3B C;  3C4O A;  3E4O A;  4JPM A;  4WV4 B;  4KZ6 A;  3ZNT A;  3UTB A;  5HZH A;  1A0K A;  2V1A A;  1P3A C;  4L9G A;  1G6O A;  5GLB A;  5AV9 A;  2EXB A;  5B24 C;  2ZOH A;  4R70 A;  1KS0 A;  2Q0O A;  2EFU A;  3E4P A;  1SKO B;  4IVI A;  4GHL A;  3LIE A;  3IH9 A;  3C38 A;  3AZN C;  1M18 A;  2F8N G;  3LGO A;  2GJ3 A;  1FCO A;  3O62 D;  2WK0 A;  3AZH C;  3F1O B;  3SS5 A;  1XJ4 A;  1P3M D;  3A3E A;  3X1S B;  2XA7 S;  5TBM B;  5FI2 A;  1PYY A;  1JFI B;  3OPR A;  4GH9 A;  3VOL A;  3SW1 A;  3W99 A;  3UPP A;  1NLY A;  1L0E A;  2M7V A;  3NIA A;  1S1Z A;  3X1S A;  4Y13 A;  2O9A A;  1JFI A;  3ZG7 B;  3UT9 C;  1PZR A;  4EO5 B;  1AXB A;  1VHM A;  4B88 A;  3MGP B;  4BBV A;  3C5A A;  3HBR A;  4ZJ3 A;  5EM0 A;  1H0I A;  3EPL A;  3AZI D;  2INW A;  1P34 C;  5DNM D;  5B1L B;  3UTA D;  4WMC D;  4J8X D;  4MBH A;  2BTF P;  2VK3 A;  1PWD A;  3Q7V B;  5B2J B;  4DE2 A;  3AZJ A;  5CPK D;  1U35 A;  2V2F F;  4IBB A;  2Y2I A;  2WZZ A;  1I2W A;  3H82 B;  3AZF A;  3IWO A;  3B0B A;  1P3O C;  3QP8 A;  4UHU A;  3WTP E;  3FKW A;  5FAS A;  1RGY A;  5AY8 B;  5GSU D;  1OTB A;  2O9C A;  2D02 A;  5FAQ A;  3MGQ D;  3TOI A;  3MXQ A;  4MMN A;  3PBS A;  3EGD C;  5B32 C;  3AGE A;  1HQ3 D;  5JRG A;  4UA9 A;  5AY8 A;  4HMD A;  3MXS A;  1KX3 D;  4GZB A;  1P3P D;  2W3H A;  4R1G A;  2OLU A;  3PTE A;  4DRT A;  3NQU A;  3ZG0 A;  3W97 B;  5B2I B;  3AZK B;  5CHU A;  2VLG A;  2Y2K A;  5B33 C;  1P9W A;  1YU0 A;  3Q7Z A;  3AV2 D;  3WD0 A;  1OT9 A;  1H3O A;  1IYS A;  4R8P D;  4YS3 D;  3W97 A;  3AZL D;  5CPJ C;  3ZG5 A;  3REK B;  3CIT A;  3O86 A;  2HUE C;  3AZE A;  2W3E A;  1CJF A;  2QMI A;  3E4Q A;  2F8N D;  1K6S A;  5AQ9 A;  4JF6 A;  4QNL A;  4H9N B;  3IF5 A;  3KUY C;  3AZM A;  5KSC A;  3MQO A;  2PYO B;  3HLE A;  5DJT A;  3MGS D;  4XUJ D;  2W1R A;  3HUM A;  4LV1 A;  1K56 D;  1PDC A;  4MB5 A;  1ERQ A;  4GS9 B;  1IKI A;  4H9N A;  4QHC A;  2F8N K;  3VFH A;  4H9S C;  5DF9 A;  2PYO A;  4H9P B;  1M19 B;  1ODV A;  1P3K C;  3PXP A;  4AFI A;  4RX3 A;  3NUL A;  4E3J A;  4GS9 A;  1MWS A;  5BO0 B;  1YU1 A;  3TU4 D;  5B32 G;  4IBE A;  4CLC E;  4H9O B;  5B0Z A;  1W5D A;  3UDX A;  1BYW A;  3GQZ A;  2WAE A;  4H9P A;  3LZ0 C;  1M19 A;  1RCJ A;  4GHA A;  1XPB A;  4HES A;  1Z09 A;  3NEC A;  3F1N B;  1YT4 A;  3T4J A;  4S2P A;  4CSR B;  3REJ D;  4FTX A;  4J8W D;  1F66 A;  2OWH A;  3X1U C;  2Y2J A;  4FH4 A;  3KYE A;  4J8V A;  5DFX A;  4GHI B;  1NJ4 A;  2C5W B;  4Z2G A;  2HF6 A;  4GN2 A;  5FI7 A;  3IQA A;  3B0C T;  2JKG A;  4MEZ A;  4GJ4 A;  5G49 A;  5B40 B;  4KGC D;  1JTG A;  4CSR A;  2D49 A;  1QME A;  3LYX A;  4K91 A;  3LEL C;  5DTS A;  1O7E A;  3UB9 A;  4KUD D;  4JF5 A;  4GHI A;  2HJ9 C;  3OCL A;  1F1E A;  5MC7 A;  1EQZ C;  2BG1 A;  5B40 A;  3GDI A;  1P3B B;  1Y28 A;  1K4F A;  4NZ3 A;  4FSF A;  4IUK A;  3W4P A;  2JKT I;  2J3T C;  1P3A B;  4NK3 A;  3MGR A;  3ULF A;  1ID3 D;  1TDG A;  3C1C D;  3VH5 T;  2FFY A;  4E6W A;  4XZQ D;  3R4K A;  3BFE A;  3IHB A;  3NHQ A;  5F82 A;  1S32 C;  2QYB A;  3AZN B;  1Q9C A;  1Y54 A;  3A1K A;  5HWW A;  1P3B A;  4LD9 A;  2WYX A;  1XJ6 A;  4YM6 A;  3HUO A;  4JJN B;  5FAO A;  5F68 A;  3QP2 A;  4R4S A;  3WA9 C;  3H9W A;  4PKY G;  1L2S A;  2L0W A;  2P9V B;  3HLF A;  3B0D C;  4NXF A;  2LB9 A;  4UQI M;  3ZG9 B;  4JJN A;  1AOI C;  1YSQ A;  3MQQ A;  3MSH A;  3UDF A;  2W3G A;  4DKI A;  1L6J A;  1KX5 B;  5AV5 D;  1LSV A;  3UT9 B;  1MZU A;  5DVA A;  3KWQ A;  1UWN X;  5EUA A;  1IEM A;  1K54 C;  4O7D A;  3WTP D;  1P34 B;  1GA0 A;  4DE0 A;  4KHA B;  4UUZ B;  4I5S A;  3A1I A;  1KX5 A;  1BLH A;  1FSW A;  4HBU A;  2OAQ 1;  5EFW A;  4N1X A;  1TZY C;  2ZLY A;  1P3I C;  1WYC A;  1GA9 A;  1G5U A;  2Y2G A;  2X01 A;  4KHA A;  4EET B;  3RFB A;  5CGX A;  2ZQ7 A;  5E5A D;  2UV0 E;  3T50 A;  4PM5 A;  2Y79 A;  3ZGA B;  4E04 A;  5B0Y D;  3ZDJ A;  2WGI A;  3M6H A;  3MFD A;  3KXB D;  3N8L A;  3REI D;  4WU8 C;  3B6F A;  4J8U D;  5GT0 D;  3HRE A;  3MR0 A;  5AVC D;  3AZG D;  3BEC A;  4DRB A;  3REH C;  2RVQ D;  4Y0O A;  1E8B A;  4JXS A;  1OTE A;  1XGJ A;  4YIN A;  3VFF A;  4K0X A;  4Z66 C;  3AYW D;  1ONG A;  3EG5 B;  4JLF A;  3WS0 A;  5L09 A;  3B42 A;  5B33 B;  2WKR A;  2Y2Q A;  3NI9 A;  1KDS A;  4X23 C;  4Z2H A;  1K55 C;  4DF6 A;  5CPJ B;  1PI5 A;  3ITA A;  4EUV A;  4PM6 A;  4M6B A;  2HUE B;  4QWO A;  4IED A;  4PM7 A;  2WKI A;  2ZC6 B;  4UA7 A;  1ZG6 A;  2EX2 A;  2QKP A;  1BLP A;  3JPU A;  1P3F C;  3S7P A;  3WAA A;  1GCE A;  4S2K A;  2EA9 A;  3H7W A;  5CPJ A;  4A5R A;  3CI6 A;  4LCM A;  2JC7 A;  1H8M A;  1NWZ A;  3QP5 A;  3VMA A;  4G3V A;  3SH8 A;  1IYQ A;  5FQM A;  3TJZ C;  2PR6 A;  2PU4 A;  5B31 A;  3K3C A;  5AV6 A;  3UTB C;  4HI4 A;  2BYM B;  2FFF B;  4Y3I A;  5AV9 C;  3UDI A;  4HJ6 A;  1P3K B;  4HBT A;  4JXW A;  2PBD P;  2XEP A;  1UGU A;  3BWL A;  5CHM A;  3VH6 T;  2Q9M A;  2IA2 A;  3LZ0 B;  1UR9 A;  2BYM A;  4I3J A;  4KEN B;  3U4L P;  3F6T A;  3SOI A;  3LJA D;  3A3J A;  3FKV A;  3PBO A;  3X1U B;  3VSK A;  4ZDX A;  1OJG A;  3BW6 A;  4KQD A;  4LV0 A;  5IU1 A;  5CEC A;  4Y17 A;  2R9W A;  3LID A;  3UE3 A;  4JKT A;  3W99 C;  3EPK A;  4QLC C;  2NQB A;  3WKJ A;  1T3U A;  5DKK A;  3P7N A;  5HW3 A;  3CMZ A;  3X1S C;  5M19 A;  3X1U A;  3LEL B;  1IYP A;  5CPI B;  1QMF A;  3EQV A;  4I3A A;  3W4Q A;  1KGF A;  5GXQ B;  2ZC3 B;  3REL D;  1I2S A;  3NQJ A;  2M7U A;  1JWV A;  5FUG B;  2Z2L B;  4GB7 A;  3C7V A;  3PAG A;  2EWW A;  3DWZ A;  4LCL A;  5CPI A;  1FIL A;  3E0Y A;  3A6N A;  1YU4 A;  1IOU A;  1FCN A;  1S32 B;  5GXQ A;  1OTA A;  4IBF A;  5CGW A;  3AZJ C;  1R4V A;  1U35 C;  3BLM A;  2PYP A;  4ZJ1 A;  4YNR A;  3AZF C;  4B9O A;  2MJ6 A;  3O62 C;  2YFW B;  2HDS A;  3G32 A;  4BBT A;  2YKH A;  5F99 D;  4NYY A;  3E98 A;  4LGW A;  5CTM A;  3IX3 A;  5FEG A;  3C1B B;  3AV1 D;  1O6I A;  3CPT A;  3B0D B;  1XKZ A;  1YLW A;  1EWZ A;  3LZ1 D;  1AOI B;  2YFW A;  5JRG C;  3MQL A;  1P3G B;  4LRY C;  1JTD A;  4ZBJ C;  1ALQ A;  1KE4 A;  4H9R A;  3C1B A;  2R78 A;  2GNX A;  4WL9 A;  4OJO A;  5DNN A;  1CK7 A;  3HVF A;  2XRN A;  3M6B A;  3EPJ A;  1P3G A;  1T1C A;  2ZY5 A;  3C7U A;  4AWL C;  2K7S A;  4C3Q A;  1MKI A;  3KSF A;  1F5M A;  1Z6F A;  3W97 C;  4ARZ B;  1TZY B;  1P3I B;  2XFS A;  1W2E A;  1P9R A;  3BQA A;  4S2L A;  4XXR A;  3AZE C;  5CPK C;  2NZD C;  3GR2 A;  1GSV A;  4H6J B;  1XA7 A;  1PFL A;  4Z2I A;  3UPO A;  5AQ7 A;  5HAQ A;  3AZM C;  2EX8 A;  4OP5 A;  3NOT C;  2V1Z A;  1PW8 A;  4PMA A;  4ARZ A;  3MGQ C;  2ZJ9 A;  4HIA A;  4LFU A;  4WU8 B;  5CX7 A;  1XGI A;  4OVD A;  3AFA A;  2ARO B;  4ZUX D;  2PYO C;  2JCH A;  4JF4 A;  1ONH A;  2DCF A;  1LT0 A;  3MNN D;  2FH5 A;  3HJI A;  2ZMF A;  5EVI A;  4G3W A;  2X02 A;  3VH5 A;  4Z66 B;  3N8S A;  5B0Z C;  5GT3 D;  1OGG A;  2ARO A;  3TSG A;  3X1T D;  1IKG A;  1M19 C;  2A2L A;  4X23 B;  3PHY A;  3IXD A;  1WWS A;  3AV2 C;  1F66 C;  3MVD C;  1HVB A;  3VP2 A;  4J8V C;  4Z5T A;  4MB4 A;  2ZQD A;  3F1P B;  3WS4 A;  2IO5 C;  1P3L A;  2PD8 A;  3JYI A;  1ZLA B;  1P3F B;  5FQ9 A;  2ZD8 A;  4EER A;  1X0O A;  1CK3 A;  2WKQ A;  5AV8 D;  1CI9 A;  3FV7 A;  4FD8 A;  4X56 A;  1RP5 A;  4KQR A;  3V9R A;  5CP6 D;  3GTC A;  1KDW A;  4MN7 A;  5HPI A;  3T12 B;  5GLA A;  3F1P A;  4JGO A;  1ZLA A;  5B40 C;  2HV1 A;  4U3T A;  5B1M A;  4QY6 A;  3UTB B;  4WEK A;  1I5Q A;  4IBR A;  3MGR C;  5AV9 B;  2HGV A;  4EQI A;  1FR6 A;  3L2A A;  4X53 A;  2HIO D;  3W4O A;  2VJW A;  2CC1 A;  3DAV A;  3O3V A;  3TW8 A;  4M3K A;  1K4E A;  3L25 A;  2QJ7 A;  2O99 A;  4LD9 C;  2W3F A;  1G6A A;  1K38 A;  3V67 A;  1RGZ A;  1KVL A;  3S7Q A;  4YM6 C;  1DJA A;  1K57 A;  3IF6 A;  4ESP A;  5BT1 C;  1J9M A;  3VH5 W;  5I5L A;  1W1T A;  2P08 A;  3BLS A;  3C8C A;  3G35 A;  3H0L C;  3AGD A;  3D72 A;  2FN2 A;  2ZQA A;  4LRZ E;  3W99 B;  2ZQ9 A;  3IS2 A;  4QLC B;  5L8M A;  4JJN C;  5L10 A;  1BTL A;  1VQQ A;  1NZO A;  1W1V A;  1XFN A;  2H10 A;  4Y15 A;  2V5O A;  3EGX C;  3N4I A;  5C5K A;  4O0P A;  4KUK A;  3AL0 C;  1OGB A;  1LL5 A;  4MB3 A;  4MN6 A;  4QLC A;  3LR5 A;  3KWQ C;  2FJ7 D;  3MGP D;  3NC8 A;  2ZL1 A;  1HZO A;  2BAS A;  4UQI S;  5AQA A;  4BD0 A;  5B1L D;  5A90 A;  3RXX A;  2L4R A;  1KX5 C;  2DRW A;  3WS2 A;  5B2J D;  3W2Z A;  3IXB A;  3AZJ B;  1U35 B;  2QWS A;  4KG5 A;  3AZF B;  3RTY A;  3O62 B;  2CV5 C;  2KDK A;  3LEQ A;  3NCK A;  4QPR A;  2DF4 C;  5AY8 D;  1Q2Q A;  1P3M B;  5HAP A;  4WEJ A;  2HP9 A;  5C3I C;  1SDE A;  3W96 D;  4NZ4 A;  5HDS A;  3BM6 A;  1BZA A;  3O62 A;  3LR3 A;  5JRG B;  1MY8 A;  3B6F C;  5DTT A;  2Z2M B;  1P3M A;  4ZBJ B;  2XR0 A;  2ZMV A;  4P0M A;  5JYO A;  1WE4 A;  1D1J A;  4EUZ A;  3NQU B;  5AV5 C;  2Z6C A;  1A7W A;  2ZC5 B;  5B2I D;  2G5H C;  4E6X A;  3AZK D;  2Y2L A;  4EBL A;  4OH0 A;  4LG2 A;  4AWL B;  1SCW A;  2QZ6 A;  4X25 A;  4X55 A;  1H3O B;  3WTP C;  3VH6 A;  3UTA B;  4J8X B;  4K08 A;  1TAF A;  2WAF A;  4S2I A;  3REK D;  5AQB A;  3D9Y A;  2AVX A;  3WRZ A;  5FAP A;  1ULY A;  3LIF A;  4WU9 C;  3AZE B;  5CPK B;  2NZD B;  2H28 A;  4RQ9 A;  2RIQ A;  4ETX A;  1E25 A;  2H0Y A;  1PWG A;  1YQS A;  3AZM B;  3AZI A;  5DNM A;  5BNX A;  3WAA C;  3UTA A;  4WMC A;  4OJL A;  4J8X A;  4C75 A;  3BY8 A;  2JHE A;  3MGQ B;  1P97 A;  5CPK A;  2NZD A;  4Z2K A;  1ES5 A;  2P74 A;  4EXO A;  2VEA A;  1QO6 A;  3GEC A;  3KXB C;  1EW0 A;  2WZX A;  5FDS A;  1EI5 A;  3JVU A;  4J8U C;  1DY6 A;  5GT0 C;  5GLC A;  5B31 C;  5AV6 C;  5GSU A;  4EWF A;  1G68 A;  1LLB A;  3MGQ A;  5B0Z B;  4O8G A;  1HQ3 A;  3B33 A;  3HUN A;  3MJQ A;  1KX3 A;  1P3P A;  1KU5 A;  4Z2M G;  3K2N A;  1TDL A;  3AV2 B;  1F66 B;  3HLG A;  5DF7 A;  3MVD B;  4S2N A;  4C6Y A;  4J8V B;  3VE3 A;  4S2O A;  4D60 A;  2J9P A;  3VH6 W;  4MLL A;  2IO5 B;  5G49 B;  2NQB C;  3ITB A;  3WKJ C;  2P04 A;  3AV2 A;  2HDQ A;  1PNE A;  3MVD A;  4YS3 A;  2HZ5 A;  5E2H A;  4KZ3 A;  3CLO A;  1VM1 A;  5K5B A;  3AZL A;  3MGS B;  1ZG4 A;  1ES2 A;  1N9L A;  2L1M A;  3ZG8 B;  3ZVT A;  1T19 A;  4MCW A;  2WGW B;  2F8N A;  1DP9 A;  1P3B D;  1TVF A;  1L0F A;  4CLC C;  5L07 A;  1P3A D;  4OOL A;  4BL3 A;  1CI8 A;  3RXW A;  3MGR B;  5B24 D;  3IWI A;  1S4R A;  3MGS A;  4XUJ A;  5CPI C;  4DXB A;  5KDM A;  3A6N C;  3OZH A;  3V50 A;  2OAP 1;  3H0M C;  1KOU A;  5GXQ C;  1K56 A;  2WAD A;  3S7N A;  3AZN D;  3FDD A;  2G2W A;  2WGW A;  3TRC A;  1PIO A;  5CGS A;  4LD9 B;  4BLM A;  4BL2 A;  4YM6 B;  4YOF A;  5B31 G;  3AZH D;  3ZNY A;  1CXW A;  4MNR A;  1M6K A;  4HJ3 A;  4N92 A;  4BWI A;  3WRT A;  3FPV A;  3LY4 A;  5DF8 A;  3TU4 A;  1LL9 A;  1V9Z A;  4PAU A;  4MN5 A;  1NYY A;  5L2F A;  2JKR I;  3AN2 C;  5DKL A;  3REJ A;  3NBL A;  4J8W A;  5GL9 A;  5AVB D;  3C1B C;  3GV9 A;  3UT9 D;  3BFC A;  4R23 A;  5E43 A;  5DNN C;  3L26 A;  2PBY A;  3KWQ B;  2XK1 A;  2EX6 A;  4KGC A;  5EVL A;  1P3G C;  3RH8 B;  2Y2P A;  5EPH A;  1P34 D;  1SDN A;  3VV4 A;  1K6R A;  1TS8 A;  5FI6 A;  4KUD A;  3W98 D;  1F98 A;  1MKM A;  3HSH A;  3G2Y A;  3OLO A;  3IXH A;  3T4S A;  1T1B A;  3ZFZ A;  1JNU A;  3T1S A;  1P3O D;  1V9Y A;  3O88 A;  2CV5 B;  4WM9 A;  5M1A A;  4NG2 A;  5AVF A;  1TS0 A;  1ID3 A;  5FQK A;  1L0G A;  3C1C A;  4X1L A;  4MBK A;  2C6W B;  5F99 C;  5C3I B;  3ISG A;  3OPH A;  2DMW A;  1KE3 A;  1S0W A;  1LSX A;  2B95 A;  3L9K A;  1IFQ A;  5B32 D;  2P7J A;  4NXB A;  2CV5 A;  3M2K A;  4EV4 A;  4NFT A;  1AWI A;  5BOH A;  3B6F B;  4X1M A;  4DE1 A;  3AFA C;  4OLG A;  3TG9 A;  1JWP A;  4FUW A;  1NLZ A;  2WKP A;  1ACF A;  4WZ5 C;  1JWZ A;  2VA0 A;  4NXE A;  3C4P A;  5AV5 B;  3NDE A;  5EVI C;  2QJ5 A;  1WA9 A;  5EM1 A;  3ZYT A;  5HAR A;  2B5R A;  5B33 D;  4XT2 B;  2ARO C;  3L27 A;  3WTP B;  3DBA A;  1YU3 A;  4NYU A;  3Q82 A;  3UB7 A;  4G91 C;  5AV5 A;  4HEF A;  5CEB A;  3KYQ A;  4IJF A;  3G30 A;  4WUJ A;  4P85 A;  4WU9 B;  5CXW A;  2WKH A;  3CUE A;  4WNN A;  4Z5T C;  1W1P A;  4XT2 A;  4KQQ A;  3KUY D;  1F9I A;  1P3L C;  4RVA A;  3WTP A;  3WAA B;  3D4F A;  2V0U A;  3H7W B;  3BFD A;  5F6A A;  1C3B A;  4WU9 A;  3OOV A;  2HP6 A;  4BQM A;  2PYR A;  4DE3 A;  4OJ5 A;  2J80 A;  1J7M A;  2V20 A;  5FQQ A;  3UB8 A;  2G5I C;  3KXB B;  3HON A;  3SH7 A;  4UAA A;  5HD3 A;  1ZLA C;  4ZBE A;  4J8U B;  5DFY A;  5GT0 B;  2J9O A;  4RX2 A;  5B31 B;  5B1M C;  5AV6 B;  5E5A A;  2VV6 A;  2OWJ A;  1P3K D;  5EVE A;  5B0Y A;  3OPL A;  4QJG A;  4BBU A;  4N9K A;  4UEY A;  3KXB A;  3REI A;  1BT5 A;  2J3W A;  4J8U A;  3LZ0 D;  5GT0 A;  3AYW B;  2NUT C;  5GT3 C;  4DQY B;  4DJ2 A;  3WD1 A;  2W3D A;  4IVK A;  1M1A D;  1K57 C;  3IF6 C;  1FIK A;  4GDB A;  4GLQ A;  4EEP A;  4KZ9 A;  4DJ3 A;  3VP1 A;  3AYW A;  2E8I A;  2ZOI A;  2Y8H A;  4NE3 A;  3LCE A;  1H8Y A;  1E3U D;  2NQB B;  4EES A;  3WKJ B;  4EBP A;  2XD5 A;  5KSH A;  3LEL D;  4R6L A;  4Z2M H;  1D06 A;  4CAY B;  1SHV A;  4OQH A;  5FSR A;  1EQZ D;  3NQJ B;  5IS1 A;  1TEM A;  3IX8 A;  4CLC B;  2Y91 A;  1PRQ A;  2VGL M;  5A92 A;  4NKP A;  3P5J B;  3T4K A;  3LO7 A;  3OCN A;  4CAY A;  3A6N B;  4DMZ A;  1S32 D;  4ZJ2 A;  1N9O A;  4WJ3 C;  2HIO C;  1ZKJ A;  2JKT M;  1BUL A;  4XUZ A;  2OLV A;  2EWV A;  4CLC A;  1JVJ A;  4QU3 A;  5EOO A;  2IWB A;  5I94 A;  1ZHH B;  2VGJ A;  1KX4 D;  2W1T B;  4NY2 A;  3WA9 D;  1NRF A;  3N8R A;  1H0G A;  2PD7 A;  4IBD A;  3ICY A;  3VOY A;  4KG2 A;  3CPT B;  3EQU A;  1TS7 A;  2YFV A;  2NUP C;  1DP8 A;  1AOI D;  3UMD A;  5EEC A;  3B6G D;  1GSX A;  4MDZ A;  3AN2 B;  2W1T A;  1E6P A;  3LJA A;  1P3M C;  3EPH A;  3WD2 A;  3EOI A;  1W7F A;  4H9R B;  4RYE A;  4E44 A;  3IXG A;  5DNN B;  4JGR A;  4E3M A;  2XLN A;  1S66 L;  2FJ7 C;  3AN2 A;  3PBR A;  1GXD A;  3UY6 A;  4N9L A;  3O5Y A;  4QB8 A;  1GHP A;  4UPK A;  3REL A;  1TZY D;  2I72 A;  1P3I D;  4G92 C;  2H0T A;  3V5M A;  3P98 A;  4HH3 A;  2LY8 A;  1PZO A;  2M1C A;  3IBR A;  3HLC A;  3IX4 A;  2W0N A;  1FSY A;  4GW9 A;  3AZI C;  4DRA A;  3FWL A;  5DNM C;  4IBG A;  3UTA C;  5F99 B;  4H8R A;  4J8X C;  4WF0 A;  1TF1 A;  4U0X A;  5LBR A;  5CRF A;  5HD5 A;  1XP4 A;  3LIC A;  5EE8 A;  2JKF A;  3SH9 A;  4WU8 D;  5GLD A;  4EQ1 A;  3AFA B;  5F99 A;  5GSU C;  1Z2C B;  3REH D;  1YLT A;  5HAI A;  5DTK A;  4WN5 A;  3IT9 A;  3AV1 A;  1UWP X;  1BLC A;  5EVI B;  1DJB A;  3MQ0 A;  1OTD A;  4E3N A;  4Z66 D;  3A3F A;  3KSH A;  1BH9 A;  3LZ1 A;  3NDG A;  1HQ3 C;  2KOI A;  4R38 A;  4EW7 A;  2VX8 A;  3EWK A;  5HFO A;  2CWE A;  4X23 D;  4RA7 A;  1KX3 C;  1YMX A;  5BPV A;  1P3P C;  4WZ5 A;  3QP6 A;  5E2G A;  1AIW A;  2ZM8 A;  4XUX A;  2ZMA A;  4HOI A;  4G91 B;  4S2N C;  3MKE A;  3HLW A;  3T4L A;  4ID4 A;  4CQH A;  2V1B A;  1YUE A;  4Z5T B;  1YSP A;  4L9F A;  1MXO A;  1P3L B;  1P3F D;  3G4P A;  3BYD A;  4HNB A;  4R3J A;  4R8P C;  4YS3 C;  4Z2J A;  1OJ5 A;  2V8C A;  3V9R B;  2XSS A;  3AZL C;  1Y4O A;  3O87 A;  3X1V D;  2WKE A;  3CWF A;  1TD5 A;  4KZ4 A;  2H5S A;  3LFV A;  4NXG A;  2X71 A;  3PR6 A;  2Y2H A;  3CG5 A;  3UTB D;  3UO9 A;  5B1M B;  4WBG A;  1P0Z A;  5AV9 D;  4WZ4 A;  4ZUX B;  3JVV A;  1PI4 A;  3MGS C;  4XUJ C;  1VET B;  4HGA C;  3T1Q B;  2GDN A;  1M18 D;  1Q2P A;  4PM8 A;  3WX7 A;  4QY5 A;  1D7E A;  5GT3 B;  3BRM A;  4WEL A;  4Y0U A;  4WZS B;  1T18 A;  4ZUX A;  3VP4 A;  3IF6 B;  4B93 A;  1N9N A;  1VET A;  2IOU A;  1XJ2 A;  5BNV A;  3MNN A;  5FDH A;  1XXM A;  4E3L A;  3G6O A;  3UB6 A;  3TU4 C;  3A3D A;  3W99 D;  5GT3 A;  4HME A;  1OPX A;  3K3D A;  2OV5 A;  5J7E A;  3WD4 A;  3IS2 B;  3SS4 A;  4IBC A;  3MZD A;  3X1T A;  1CQA A;  1W1Y A;  3C2W A;  2ZM0 A;  3X1S D;  1MC0 A;  1W8Y A;  1B6W A;  3G31 A;  3REJ C;  3ZCZ A;  4J8W C;  3HL9 A;  3UN7 A;  2XRO A;  5GHX A;  1GOI A;  1GPF A;  1L3L A;  3WWX A;  5HDD A;  1IEL A;  2LB5 A;  1HD8 A;  2ZBB A;  5A8B A;  4OJ6 A;  3TE8 A;  4KGC C;  2J8Y A;  2ZL1 B;  5TJJ A;  3UE6 A;  2Y2O A;  3C30 A;  4OPY A;  5AV8 A;  1WYB A;  4EBN A;  1EAK A;  5CP6 A;  1YMS A;  2QPN A;  1SKF A;  3Q81 A;  2HIO B;  4E3K A;  4KUD C;  4WLA A;  3AZJ D;  2VZW A;  1U35 D;  5G4Y A;  1VEU B;  3IWQ A;  3AZF D;  2ACG A;  4ZTK A;  4Q0J A;  1NY0 A;  1YU2 A;  5KZH A;  4S2J A;  1ID3 C;  1DP6 A;  3MBZ A;  3C1C C;  2HIO A;  4XZQ C;  4HJ4 A;  1SKO A;  1SZV A;  4CPK A;  2XD1 A;  1VEU A;  3FYZ A;  5CER A;  4B4X A;  5JRG D;  4IBI A;  3F1O A;  2YKF A;  1XFQ A;  3IP4 C;  4Z2L A;  4FOF A;  1FCM A;  3OPP A;  4Y0T A;  2R9X A;  5HWT A;  3FZC A;  5TBM A;  1OTI A;  4I3I A;  5J4E A;  1KGE A;  2RCX A;  5AVB C;  4OJP A;  3MMH A;  3PBT A;  2FJ7 B;  5BS7 A;  1PWC A;  5GHZ A;  2HP5 A;  5AVE A;  3IHA A;  3W97 D;  1BFM A;  1TAF B;  5CTN A;  3KS8 A;  3W98 C;  5E2E A;  4BMW A;  3BQ8 A;  3LR4 A;  4FCF A;  4G92 B;  3AZE D;  2NZD D;  2ZQC A;  1OME A;  1MWT A;  2Y4A A;  3CUE C;  2FJ7 A;  4Y2F A;  3MGP A;  2PU2 A;  4NE5 A;  3PAE A;  1DJC A;  3BY9 A;  4KG6 A;  3S22 A;  3AZM D;  2JSS A;  1GHM A;  3QHY A;  5B1L A;  3AZI B;  4M4X A;  5DNM B;  4L0L A;  5BNX B;  2XDM A;  4HP4 A;  5IT5 A;  1OT6 A;  2ZY3 A;  3G34 A;  4KQO A;  3Q7V A;  4Z9Q A;  4ZRR A;  3W96 B;  5B2J A;  2B02 A;  1W63 M;  1ED7 A;  3H82 A;  3PBN A;  5G18 A;  2K2N A;  4QD4 A;  2BYK B;  1GHI A;  1W79 A;  2F2A C;  3EEH A;  2O9B A;  3S1Y A;  3BFG A;  2PYO D;  3UPN A;  2XQZ A;  5E5A C;  5GSU B;  5HL6 A;  2A49 A;  5A91 A;  3W96 A;  4KZ5 A;  3KSI A;  3MF0 A;  5B0Y C;  3HLD A;  4DDY A;  1FQG A;  2JBF A;  5HX9 A;  5FL3 A;  2BYK A;  5FQJ A;  5B0Z D;  3REI C;  4OLD A;  1HQ3 B;  3FKE A;  4R4R A;  1M19 D;  5AVC C;  1T1A A;  3AZG C;  1HTZ A;  1KX3 B;  1P3P B;  1E4D A;  1MWU A;  3R7W B;  1F66 D;  1YLJ A;  2V0W A;  3MVD D;  2RVQ C;  5FQI A;  4IJE A;  3L7H A;  4WYY A;  4B4Z A;  4J8V D;  3FC7 A;  4P6Z M;  2PHY A;  5B2I A;  2J7V A;  3AZK A;  4D2O A;  3BFF A;  3AYW C;  4GOG A;  4HY8 A;  3R7W A;  2PAV P;  5HDC A;  2KX6 A;  4R8P B;  4YS3 B;  4GKU A;  3S4X A;  2VV8 A;  3AZL B;  3REK A;  2W27 A;  2ZM2 A;  1B67 A;  2Y2M A;  4E45 A;  5B40 D;  2F8N B;  3LR0 A;  4HQA A;  3A0R A;  4PPR A;  3MGR D;  4R8P A;  4XUJ B;  4LLO B;  5KDM B;  3RJU A;  4HGA B;  4KZ8 A;  4LV3 A;  4GDN A;  4JGP A;  4I39 A;  4LD9 D;  2V9A A;  3VSL A;  4YM6 D;  2ZC7 A;  3L28 A;  5BT1 D;  3T4Q A;  2J8P A;  1E6Z A;  3LUQ A;  1N1J B;  1M1A C;  5J3W A;  4YFM A;  2VGL S;  1BUE A;  5EOE A;  3UE0 A;  5BO0 A;  4OP8 A;  5FAT A;  4H9O A;  3TU4 B;  1M40 A;  1IYO A;  1W63 Q;  1U60 A;  2G7U A;  3GRJ A;  4JJN D;  5TFQ A;  2BLS A;  3F1N A;  3DTM A;  2PT7 A;  1N1J A;  3REJ B;  1BH8 B;  3LJA C;  5CHL B;  4J8W B;  2GZA A;  5CED A;  1J3W A;  1W8Q A;  2Y55 A;  4IBX A;  2G2U A;  1MPL A;  1TS6 A;  2E8J A;  3KWQ D;  2A3U A;  3Q07 A;  4E3I A;  2D01 A;  2ZY4 A;  4KGC B;  1BH8 A;  5B24 B;  3BJN A;  3E2K A;  2OSU A;  1KX5 D;  4OUI A;  4L9E A;  4KUD B;  3T1R A;  1NRJ A;  1FOF A;  3KO6 A;  3OBF A;  5F1F A;  1YAX A;  3REL C;  3MFX A;  3ZQ5 A;  3KFU G;  1L0D A;  3GSG A;  2CV5 D;  4OPR A;  4Y5F A;  2XA7 M;  1WWI A;  1P3A A;  4YWZ A;  3AZH B;  5B24 A;  4N1H A;  1ID3 B;  3C1C B;  5JYP A;  1YPR A;  4XZQ B;  1KX4 C;  1ERM A;  5J8X A;  3AZN A;  1N9B A;  1ESI A;  2DQN C;  3MXR A;  2Y2N A;  3H0R C;  4ME4 A;  2JN7 A;  2FZ0 A;  1ZC2 A;  3B6F D;  3AZH A;  2F8N H;  3NY4 A;  3B6G C;  4XZQ A;  3BEB A;  3CZD A;  5G4Z A;  4KZA A;  2PDR A;  2P9V A;  4KZ7 A;  5AVB B;  3AV1 C;  3HJK A;  4PM9 A;  2RTS A;  4DN0 A;  4PHT A;  4OQI A;  3LZ1 C;  2VQR A;  4GCZ A;  4LPZ A;  2W8S A;  2JE5 A;  3DWK A;  1H8P A;  4K0W A;  3P01 A;  5AVB A;  1MBL A;  3UT9 A;  1NZU A;  3W98 B;  3GMW A;  1VB6 A;  5FEF A;  4WU9 D;  1ES3 A;  4WNN B;  4OPQ A;  1P3O B;  3M2J A;  4ZAM A;  3KX0 X;  4OQG A;  1P34 A;  3WAA D;  4UUZ A;  3A0V A;  2Z6D A;  5CPJ D;  4IBK A;  1FR1 A;  5FA7 A;  3W98 A;  4FH2 A;  3Q1F A;  2VKS A;  2EX9 A;  4HH2 A;  1BLS A;  4LEN A;  4LV2 A;  3LI9 A;  3LIA A;  1DRM A;  3MKF A;  1H3Q A;  5B32 B;  1P3O A;  4OON A;  2ZY2 A;  3QP1 A;  3CJM A;  3W8K A;  3V39 A;  2QHK A;  5B31 D;  5AV6 D;  5A93 A;  1XX2 A;  5E5A B;  2EXA A;  2OOL A;  1S67 L;  3MZF A;  1LSW A;  5B0Y B;  5B32 A;  5KIZ A;  3REI B;  4NEE D;  5JA4 B;  2KLI A;  5HL1 A;  5AVC B;  3AZG B;  2Q9N A;  4ZUX C;  2I9V A;  4DXC A;  5AJG A;  3MNN C;  3DTK A;  4IBJ A;  1CEF A;  4MBF A;  4NET A;  5JA4 A;  2EFX A;  4X69 A;  3V3S A;  5AVC A;  5B33 A;  3AZG A;  1STZ A;  5U47 A;  2NQB D;  4U0T A;  3WKJ D;  3KUY B;  3X1T C;  5EV0 A;  1H0M A;  3X1U D; 
#chains in the Genus database with same CATH homology
 3P09 A;  4JXG A;  1YLP A;  4R3B A;  3X1V C;  4GD8 A;  1LHY A;  4R0Q A;  3KUY A;  3HLB A;  3AGF A;  3N3F A;  5CPI D;  3KS4 A;  5AV8 C;  3A6N D;  5GXQ D;  5CP6 C;  5D3O A;  4BD1 A;  1YM1 A;  3N6I A;  1M18 C;  2DNS A;  2WUQ A;  4OOM A;  4H9S A;  4OPZ A;  1P3K A;  4UA6 A;  1M1A B;  1PW1 A;  4BJP A;  3OC2 A;  3V3R A;  1KGG A;  2XFT A;  2YFV B;  4H9Q B;  3UE1 A;  3LZ0 A;  2UWX A;  3AN2 D;  1M1A A;  2RL3 A;  1LI0 A;  3LJA B;  5TGF A;  3C1B D;  4CJN A;  2ZQ8 A;  1H8Z A;  3IH8 A;  3PBQ A;  5DNN D;  4H9Q A;  1EQZ B;  3SS3 A;  1E3U A;  3ZVW A;  1P3G D;  3MZE A;  5CHJ A;  1HTA A;  4F94 A;  5BS7 C;  3LEL A;  5E2F A;  3LEZ A;  4X6T A;  4NZ1 A;  3REL B;  1EQZ A;  3A3I A;  4OKP A;  5FUG A;  4EO5 C;  3MGP C;  2IWC A;  3QNC A;  5B1L C;  2L5A A;  2ZM5 A;  1PZP A;  1KX4 B;  2HPB A;  1S32 A;  5GHY A;  3WA9 B;  1NYM A;  5B2J C;  3I7J A;  3N7W A;  1K25 A;  3VOZ A;  2VGK A;  4JXV A;  3AFA D;  3B6G B;  1H5X A;  4BEN A;  1KX4 A;  3UNW A;  5AY8 C;  3WA9 A;  3W96 C;  3GVB A;  3AV1 B;  1KE0 A;  5EVI D;  3QNB A;  1BSG A;  1MWR A;  1S6R A;  5F83 A;  1AOI A;  1BH9 B;  3LZ1 B;  1CEG A;  4P6B A;  3B6G A;  2ARO D;  4DDS A;  4OOY A;  3R45 B;  3KSY A;  4X68 A;  3L29 A;  1LI9 A;  4KZB A;  4Z5T D;  2XF3 A;  5B2I C;  3AZK C;  1ESU A;  5F1G A;  3WS5 A;  1K54 A;  1P3L D;  3R45 A;  4Y7P A;  1TZY A;  3REK C;  1P3I A;  3G2Z A;  1O07 A;  4GNU A;  4NE6 A;  1ZLA D;  3B3X A;  5B1M D;  4S2M A;  1ERO A;  3REH B;  1NXY A;  4E3O A;  4NZ5 A;  4P87 A;  4WU8 A;  5IHV A;  4JBF A;  3WS1 A;  1KVM A;  3REH A;  5TR7 A;  2HDR A;  5BNV B;  3MNN B;  2IWD A;  4GD6 A;  4Z66 A;  2ZC4 B;  5KMW A;  2XGN A;  2Y59 A;  3DW0 A;  4OQ0 A;  3X1T B;  4X23 A;  1YLZ A;  1K55 A;  3E2L A;  5M18 A;  2HDU A;  4Q8I A;  3X1V B;  1YLY A;  2WGV A;  4QLC D;  3B0C W;  1P3F A;  3VP0 A;  2XH9 A;  1XA1 A;  3ZHH A;  5AV8 B;  3LY3 A;  1ES4 A;  5CP6 B;  1N4O A;  3X1V A;  3VP3 A;  1M18 B;  1P3B C;  3C4O A;  4JPM A;  3ZNT A;  4WV4 B;  4KZ6 A;  3UTB A;  1P3A C;  5GLB A;  5AV9 A;  2EXB A;  5B24 C;  2EFU A;  4IVI A;  4GHL A;  3IH9 A;  3AZN C;  1M18 A;  2F8N G;  1FCO A;  3O62 D;  2WK0 A;  3AZH C;  3SS5 A;  1P3M D;  3A3E A;  3X1S B;  5FI2 A;  1PYY A;  1JFI B;  3OPR A;  4GH9 A;  3W99 A;  3UPP A;  1L0E A;  3NIA A;  3X1S A;  1JFI A;  3ZG7 B;  3UT9 C;  1PZR A;  4EO5 B;  1AXB A;  4B88 A;  3MGP B;  3C5A A;  3HBR A;  4ZJ3 A;  3EPL A;  3AZI D;  1P34 C;  5DNM D;  5B1L B;  3UTA D;  4WMC D;  4J8X D;  4MBH A;  1PWD A;  3Q7V B;  5B2J B;  4DE2 A;  3AZJ A;  5CPK D;  1U35 A;  2V2F F;  4IBB A;  2Y2I A;  2WZZ A;  1I2W A;  3AZF A;  3IWO A;  3B0B A;  1P3O C;  5FAS A;  4UHU A;  3WTP E;  3FKW A;  1RGY A;  5AY8 B;  5GSU D;  5FAQ A;  3MGQ D;  3TOI A;  3PBS A;  5B32 C;  3AGE A;  1HQ3 D;  5JRG A;  4UA9 A;  5AY8 A;  3MXS A;  1KX3 D;  4GZB A;  1P3P D;  4R1G A;  2OLU A;  3PTE A;  4DRT A;  3NQU A;  3ZG0 A;  3W97 B;  5B2I B;  3AZK B;  5CHU A;  2Y2K A;  5B33 C;  1YU0 A;  3Q7Z A;  3AV2 D;  1H3O A;  1IYS A;  4R8P D;  4YS3 D;  3W97 A;  3AZL D;  5CPJ C;  3ZG5 A;  3REK B;  3O86 A;  2HUE C;  3AZE A;  2QMI A;  2F8N D;  1K6S A;  5AQ9 A;  4JF6 A;  4QNL A;  4H9N B;  3IF5 A;  3KUY C;  3AZM A;  5KSC A;  2PYO B;  3HLE A;  3MGS D;  4XUJ D;  3HUM A;  4LV1 A;  1K56 D;  1ERQ A;  1IKI A;  4H9N A;  4QHC A;  2F8N K;  3VFH A;  4H9S C;  5DF9 A;  2PYO A;  4H9P B;  1M19 B;  1P3K C;  4RX3 A;  4E3J A;  1MWS A;  5BO0 B;  1YU1 A;  3TU4 D;  5B32 G;  4IBE A;  4H9O B;  5B0Z A;  1W5D A;  3UDX A;  3GQZ A;  2WAE A;  4H9P A;  3LZ0 C;  1M19 A;  1RCJ A;  4GHA A;  1XPB A;  4HES A;  1YT4 A;  4S2P A;  4CSR B;  3REJ D;  4J8W D;  1F66 A;  3X1U C;  2Y2J A;  4FH4 A;  4J8V A;  1NJ4 A;  2C5W B;  4GN2 A;  5FI7 A;  3IQA A;  3B0C T;  4MEZ A;  5G49 A;  5B40 B;  4KGC D;  1JTG A;  4CSR A;  1QME A;  4K91 A;  3LEL C;  5DTS A;  1O7E A;  4KUD D;  4JF5 A;  3OCL A;  1F1E A;  1EQZ C;  2BG1 A;  5B40 A;  1P3B B;  1K4F A;  4NZ3 A;  4FSF A;  3W4P A;  1P3A B;  4NK3 A;  3MGR A;  1ID3 D;  1TDG A;  3C1C D;  3VH5 T;  2FFY A;  4E6W A;  4XZQ D;  3BFE A;  3IHB A;  5F82 A;  1S32 C;  3AZN B;  1Q9C A;  1Y54 A;  3A1K A;  1P3B A;  4LD9 A;  2WYX A;  4YM6 A;  3HUO A;  4JJN B;  5FAO A;  4R4S A;  3WA9 C;  1L2S A;  2P9V B;  3HLF A;  3B0D C;  3ZG9 B;  4JJN A;  1AOI C;  3UDF A;  4DKI A;  1KX5 B;  5AV5 D;  3UT9 B;  5DVA A;  3KWQ A;  5EUA A;  1IEM A;  1K54 C;  4O7D A;  3WTP D;  1P34 B;  1GA0 A;  4DE0 A;  4KHA B;  4UUZ B;  3A1I A;  1KX5 A;  1BLH A;  1FSW A;  4HBU A;  4N1X A;  1TZY C;  2ZLY A;  1P3I C;  1WYC A;  1GA9 A;  2Y2G A;  2X01 A;  4KHA A;  5CGX A;  2ZQ7 A;  5E5A D;  4PM5 A;  3ZGA B;  5B0Y D;  3ZDJ A;  2WGI A;  3M6H A;  3MFD A;  3KXB D;  3N8L A;  3REI D;  4WU8 C;  3B6F A;  4J8U D;  5GT0 D;  3HRE A;  5AVC D;  3AZG D;  3BEC A;  4DRB A;  3REH C;  2RVQ D;  4Y0O A;  4JXS A;  1XGJ A;  4YIN A;  3VFF A;  4K0X A;  4Z66 C;  3AYW D;  1ONG A;  3EG5 B;  4JLF A;  3WS0 A;  5B33 B;  2Y2Q A;  3NI9 A;  1KDS A;  4X23 C;  1K55 C;  4DF6 A;  5CPJ B;  1PI5 A;  3ITA A;  4PM6 A;  4M6B A;  2HUE B;  4IED A;  4PM7 A;  2WKI A;  2ZC6 B;  4UA7 A;  1ZG6 A;  2EX2 A;  1BLP A;  1P3F C;  3WAA A;  1GCE A;  4S2K A;  5CPJ A;  4A5R A;  4LCM A;  2JC7 A;  3VMA A;  3SH8 A;  1IYQ A;  5FQM A;  2PU4 A;  5B31 A;  5AV6 A;  3UTB C;  2BYM B;  2FFF B;  5AV9 C;  3UDI A;  1P3K B;  4HBT A;  4JXW A;  2XEP A;  5CHM A;  3VH6 T;  2Q9M A;  3LZ0 B;  2BYM A;  4KEN B;  3F6T A;  3SOI A;  3LJA D;  3A3J A;  3FKV A;  3PBO A;  3X1U B;  3VSK A;  4ZDX A;  4LV0 A;  5CEC A;  2R9W A;  3UE3 A;  4JKT A;  3W99 C;  3EPK A;  4QLC C;  2NQB A;  3WKJ A;  1T3U A;  5HW3 A;  3CMZ A;  3X1S C;  5M19 A;  3X1U A;  3LEL B;  1IYP A;  5CPI B;  1QMF A;  3EQV A;  3W4Q A;  1KGF A;  5GXQ B;  2ZC3 B;  3REL D;  1I2S A;  3NQJ A;  1JWV A;  5FUG B;  2Z2L B;  4GB7 A;  3C7V A;  3PAG A;  3DWZ A;  4LCL A;  5CPI A;  3A6N A;  1YU4 A;  1FCN A;  1S32 B;  5GXQ A;  4IBF A;  5CGW A;  3AZJ C;  1R4V A;  1U35 C;  3BLM A;  4ZJ1 A;  3AZF C;  3O62 C;  2YFW B;  2HDS A;  3G32 A;  5F99 D;  4NYY A;  5CTM A;  3C1B B;  3AV1 D;  3B0D B;  1XKZ A;  1YLW A;  1EWZ A;  3LZ1 D;  1AOI B;  2YFW A;  5JRG C;  1P3G B;  1JTD A;  4ZBJ C;  1ALQ A;  1KE4 A;  4H9R A;  3C1B A;  4OJO A;  5DNN A;  3HVF A;  3M6B A;  3EPJ A;  1P3G A;  2ZY5 A;  3C7U A;  4AWL C;  4C3Q A;  1MKI A;  1Z6F A;  3W97 C;  1TZY B;  1P3I B;  2XFS A;  1W2E A;  4S2L A;  4XXR A;  3AZE C;  5CPK C;  2NZD C;  3GR2 A;  1XA7 A;  3UPO A;  5AQ7 A;  5HAQ A;  3AZM C;  2EX8 A;  4OP5 A;  2V1Z A;  1PW8 A;  4PMA A;  3MGQ C;  2ZJ9 A;  4WU8 B;  1XGI A;  4OVD A;  3AFA A;  2ARO B;  4ZUX D;  2PYO C;  2JCH A;  4JF4 A;  1ONH A;  2DCF A;  3MNN D;  5EVI A;  2X02 A;  3VH5 A;  4Z66 B;  3N8S A;  5B0Z C;  5GT3 D;  2ARO A;  3TSG A;  3X1T D;  1IKG A;  1M19 C;  4X23 B;  3IXD A;  1WWS A;  3AV2 C;  1F66 C;  3MVD C;  1HVB A;  3VP2 A;  4J8V C;  4Z5T A;  2ZQD A;  3WS4 A;  2IO5 C;  1P3L A;  3JYI A;  1ZLA B;  1P3F B;  5FQ9 A;  2ZD8 A;  1CK3 A;  3FV7 A;  5AV8 D;  1CI9 A;  4FD8 A;  4X56 A;  1RP5 A;  4KQR A;  3V9R A;  5CP6 D;  3GTC A;  1KDW A;  5GLA A;  1ZLA A;  5B40 C;  4U3T A;  5B1M A;  4QY6 A;  3UTB B;  4WEK A;  1I5Q A;  4IBR A;  3MGR C;  5AV9 B;  4EQI A;  1FR6 A;  3L2A A;  4X53 A;  2HIO D;  3W4O A;  2CC1 A;  3O3V A;  4M3K A;  1K4E A;  3L25 A;  4LD9 C;  1G6A A;  1K38 A;  1RGZ A;  1KVL A;  4YM6 C;  1DJA A;  1K57 A;  3IF6 A;  5BT1 C;  1J9M A;  3VH5 W;  3BLS A;  3G35 A;  3H0L C;  3AGD A;  2ZQA A;  3W99 B;  2ZQ9 A;  4QLC B;  4JJN C;  1BTL A;  1VQQ A;  1NZO A;  2H10 A;  3N4I A;  3AL0 C;  1LL5 A;  4QLC A;  3KWQ C;  2FJ7 D;  3MGP D;  3NC8 A;  1HZO A;  5AQA A;  4BD0 A;  5B1L D;  5A90 A;  3RXX A;  1KX5 C;  2DRW A;  3WS2 A;  5B2J D;  3IXB A;  3AZJ B;  1U35 B;  4KG5 A;  3AZF B;  3O62 B;  2CV5 C;  3NCK A;  2DF4 C;  5AY8 D;  1Q2Q A;  1P3M B;  5HAP A;  4WEJ A;  2HP9 A;  5C3I C;  1SDE A;  3W96 D;  4NZ4 A;  3BM6 A;  1BZA A;  3O62 A;  5JRG B;  1MY8 A;  3B6F C;  5DTT A;  2Z2M B;  1P3M A;  4ZBJ B;  2XR0 A;  4P0M A;  5JYO A;  1WE4 A;  4EUZ A;  3NQU B;  5AV5 C;  1A7W A;  2ZC5 B;  5B2I D;  2G5H C;  4E6X A;  3AZK D;  2Y2L A;  4EBL A;  4OH0 A;  4LG2 A;  4AWL B;  1SCW A;  2QZ6 A;  4X55 A;  1H3O B;  3WTP C;  3VH6 A;  3UTA B;  4J8X B;  1TAF A;  2WAF A;  4S2I A;  3REK D;  5AQB A;  3WRZ A;  5FAP A;  1ULY A;  4WU9 C;  3AZE B;  5CPK B;  2NZD B;  2RIQ A;  1E25 A;  2H0Y A;  1PWG A;  1YQS A;  3AZM B;  3AZI A;  5DNM A;  5BNX A;  3WAA C;  3UTA A;  4WMC A;  4OJL A;  4J8X A;  4C75 A;  3MGQ B;  5CPK A;  2NZD A;  1ES5 A;  2P74 A;  3KXB C;  2WZX A;  1EI5 A;  5GLC A;  4J8U C;  1DY6 A;  5GT0 C;  5B31 C;  5AV6 C;  5GSU A;  4EWF A;  1G68 A;  1LLB A;  3MGQ A;  5B0Z B;  1HQ3 A;  3HUN A;  1KX3 A;  1P3P A;  1KU5 A;  4Z2M G;  1TDL A;  3AV2 B;  1F66 B;  3HLG A;  5DF7 A;  3MVD B;  4S2N A;  4C6Y A;  4J8V B;  4S2O A;  2J9P A;  3VH6 W;  4MLL A;  2IO5 B;  5G49 B;  2NQB C;  3ITB A;  3WKJ C;  3AV2 A;  2HDQ A;  3MVD A;  4YS3 A;  5E2H A;  4KZ3 A;  1VM1 A;  3AZL A;  3MGS B;  1ZG4 A;  1ES2 A;  3ZG8 B;  3ZVT A;  2WGW B;  2F8N A;  1P3B D;  1TVF A;  1L0F A;  1P3A D;  4OOL A;  4BL3 A;  1CI8 A;  3RXW A;  3MGR B;  5B24 D;  3IWI A;  3MGS A;  4XUJ A;  5CPI C;  4DXB A;  5KDM A;  3A6N C;  3OZH A;  3V50 A;  3H0M C;  5GXQ C;  1K56 A;  2WAD A;  3AZN D;  3FDD A;  2G2W A;  2WGW A;  1PIO A;  5CGS A;  4LD9 B;  4BLM A;  4BL2 A;  4YM6 B;  5B31 G;  3AZH D;  3ZNY A;  4MNR A;  1M6K A;  4N92 A;  3WRT A;  3LY4 A;  5DF8 A;  3TU4 A;  1LL9 A;  1NYY A;  5L2F A;  3AN2 C;  3REJ A;  3NBL A;  4J8W A;  5GL9 A;  5AVB D;  3C1B C;  3GV9 A;  3UT9 D;  3BFC A;  4R23 A;  5E43 A;  5DNN C;  3L26 A;  2PBY A;  3KWQ B;  2XK1 A;  2EX6 A;  4KGC A;  5EVL A;  1P3G C;  2Y2P A;  5EPH A;  1P34 D;  1SDN A;  1K6R A;  5FI6 A;  4KUD A;  3W98 D;  3HSH A;  3G2Y A;  3IXH A;  3ZFZ A;  1P3O D;  3O88 A;  2CV5 B;  4WM9 A;  5M1A A;  1ID3 A;  5FQK A;  1L0G A;  3C1C A;  4MBK A;  2C6W B;  5F99 C;  5C3I B;  3ISG A;  3OPH A;  1KE3 A;  1S0W A;  5B32 D;  2CV5 A;  3M2K A;  4EV4 A;  4NFT A;  5BOH A;  3B6F B;  4DE1 A;  3AFA C;  4OLG A;  3TG9 A;  1JWP A;  4WZ5 C;  1JWZ A;  3C4P A;  5AV5 B;  3NDE A;  5EVI C;  5HAR A;  2B5R A;  5B33 D;  2ARO C;  3L27 A;  3WTP B;  1YU3 A;  4NYU A;  3Q82 A;  4G91 C;  5AV5 A;  4HEF A;  5CEB A;  4IJF A;  3G30 A;  4P85 A;  4WU9 B;  5CXW A;  2WKH A;  4WNN A;  4Z5T C;  4KQQ A;  3KUY D;  1P3L C;  4RVA A;  3WTP A;  3WAA B;  3D4F A;  3BFD A;  1C3B A;  4WU9 A;  4BQM A;  2HP6 A;  4DE3 A;  4OJ5 A;  5FQQ A;  2V20 A;  2G5I C;  3KXB B;  3HON A;  3SH7 A;  4UAA A;  1ZLA C;  4ZBE A;  4J8U B;  5GT0 B;  2J9O A;  4RX2 A;  5B31 B;  5B1M C;  5AV6 B;  5E5A A;  1P3K D;  5B0Y A;  3OPL A;  4QJG A;  4N9K A;  3KXB A;  3REI A;  1BT5 A;  4J8U A;  3LZ0 D;  5GT0 A;  3AYW B;  5GT3 C;  4DQY B;  4IVK A;  1M1A D;  3IF6 C;  1K57 C;  4GDB A;  4KZ9 A;  3VP1 A;  3AYW A;  2E8I A;  4NE3 A;  3LCE A;  1H8Y A;  1E3U D;  2NQB B;  3WKJ B;  4EBP A;  2XD5 A;  5KSH A;  3LEL D;  4Z2M H;  4CAY B;  1SHV A;  4OQH A;  5FSR A;  1EQZ D;  3NQJ B;  1TEM A;  2Y91 A;  5A92 A;  3P5J B;  3LO7 A;  3OCN A;  4CAY A;  3A6N B;  1S32 D;  4ZJ2 A;  4WJ3 C;  2HIO C;  1ZKJ A;  1BUL A;  4XUZ A;  2OLV A;  1JVJ A;  4QU3 A;  5EOO A;  2IWB A;  5I94 A;  2VGJ A;  1KX4 D;  4NY2 A;  3WA9 D;  1NRF A;  3N8R A;  4IBD A;  3VOY A;  4KG2 A;  3EQU A;  2YFV A;  1AOI D;  5EEC A;  3B6G D;  3AN2 B;  3LJA A;  1P3M C;  3EPH A;  1W7F A;  4H9R B;  4RYE A;  4E44 A;  3IXG A;  5DNN B;  4E3M A;  2XLN A;  2FJ7 C;  3AN2 A;  3PBR A;  3UY6 A;  4N9L A;  4QB8 A;  1GHP A;  4UPK A;  3REL A;  1TZY D;  2I72 A;  1P3I D;  4G92 C;  2H0T A;  3V5M A;  3P98 A;  2LY8 A;  1PZO A;  3HLC A;  1FSY A;  3AZI C;  4DRA A;  3FWL A;  5DNM C;  4IBG A;  3UTA C;  5F99 B;  4H8R A;  4J8X C;  4U0X A;  5CRF A;  1XP4 A;  5EE8 A;  3SH9 A;  4WU8 D;  5GLD A;  3AFA B;  5F99 A;  5GSU C;  1Z2C B;  3REH D;  1YLT A;  5HAI A;  5DTK A;  3IT9 A;  3AV1 A;  1BLC A;  5EVI B;  1DJB A;  4E3N A;  3A3F A;  4Z66 D;  1BH9 A;  3LZ1 A;  3NDG A;  1HQ3 C;  5HFO A;  2CWE A;  4X23 D;  4RA7 A;  1KX3 C;  1YMX A;  5BPV A;  1P3P C;  4WZ5 A;  5E2G A;  2ZM8 A;  4XUX A;  2ZMA A;  4G91 B;  4S2N C;  3MKE A;  3HLW A;  4ID4 A;  1YUE A;  4Z5T B;  1MXO A;  1P3L B;  1P3F D;  3G4P A;  3BYD A;  4R3J A;  4R8P C;  4YS3 C;  3V9R B;  3AZL C;  3O87 A;  3X1V D;  2WKE A;  4KZ4 A;  2H5S A;  2X71 A;  2Y2H A;  3CG5 A;  3UTB D;  3UO9 A;  5B1M B;  4WBG A;  5AV9 D;  4WZ4 A;  4ZUX B;  1PI4 A;  3MGS C;  4XUJ C;  4HGA C;  2GDN A;  1M18 D;  1Q2P A;  4PM8 A;  3WX7 A;  4QY5 A;  5GT3 B;  3BRM A;  4WEL A;  4Y0U A;  4WZS B;  4ZUX A;  3VP4 A;  3IF6 B;  2IOU A;  5BNV A;  3MNN A;  5FDH A;  1XXM A;  4E3L A;  3TU4 C;  3A3D A;  3W99 D;  5GT3 A;  2OV5 A;  3SS4 A;  4IBC A;  3MZD A;  3X1T A;  2ZM0 A;  3X1S D;  1W8Y A;  1B6W A;  3G31 A;  3REJ C;  3ZCZ A;  4J8W C;  3HL9 A;  3UN7 A;  5GHX A;  3WWX A;  1IEL A;  1HD8 A;  4OJ6 A;  4KGC C;  2J8Y A;  2Y2O A;  4OPY A;  5AV8 A;  1WYB A;  4EBN A;  5CP6 A;  1YMS A;  2QPN A;  1SKF A;  3Q81 A;  2HIO B;  4E3K A;  4KUD C;  3AZJ D;  1U35 D;  3IWQ A;  3AZF D;  4ZTK A;  1NY0 A;  1YU2 A;  5KZH A;  4S2J A;  1ID3 C;  3MBZ A;  3C1C C;  2HIO A;  4XZQ C;  4CPK A;  2XD1 A;  3FYZ A;  5CER A;  4B4X A;  5JRG D;  4IBI A;  3IP4 C;  1FCM A;  3OPP A;  4Y0T A;  2R9X A;  3FZC A;  1KGE A;  2RCX A;  5AVB C;  4OJP A;  3PBT A;  2FJ7 B;  5BS7 A;  1PWC A;  5GHZ A;  2HP5 A;  3IHA A;  3W97 D;  1BFM A;  1TAF B;  5CTN A;  3KS8 A;  3W98 C;  5E2E A;  4FCF A;  4G92 B;  3AZE D;  2NZD D;  2ZQC A;  1OME A;  1MWT A;  2Y4A A;  2FJ7 A;  3MGP A;  2PU2 A;  4NE5 A;  3PAE A;  1DJC A;  4KG6 A;  3S22 A;  3AZM D;  2JSS A;  1GHM A;  3QHY A;  5B1L A;  3AZI B;  5DNM B;  4L0L A;  5BNX B;  2XDM A;  2ZY3 A;  3G34 A;  4KQO A;  3Q7V A;  4Z9Q A;  3W96 B;  5B2J A;  3PBN A;  5G18 A;  4QD4 A;  2BYK B;  1GHI A;  1W79 A;  2F2A C;  3S1Y A;  3BFG A;  2PYO D;  3UPN A;  2XQZ A;  5E5A C;  5GSU B;  2A49 A;  5A91 A;  3W96 A;  4KZ5 A;  4DDY A;  5B0Y C;  3HLD A;  1FQG A;  2JBF A;  5HX9 A;  2BYK A;  5FQJ A;  5B0Z D;  3REI C;  4OLD A;  1HQ3 B;  3FKE A;  4R4R A;  1M19 D;  5AVC C;  3AZG C;  1HTZ A;  1KX3 B;  1P3P B;  1E4D A;  1MWU A;  1F66 D;  1YLJ A;  3MVD D;  2RVQ C;  5FQI A;  4IJE A;  4WYY A;  4B4Z A;  4J8V D;  5B2I A;  2J7V A;  3AZK A;  4D2O A;  3BFF A;  3AYW C;  4GOG A;  4R8P B;  4YS3 B;  4GKU A;  3S4X A;  3AZL B;  3REK A;  2ZM2 A;  1B67 A;  2Y2M A;  4E45 A;  5B40 D;  2F8N B;  4PPR A;  3MGR D;  4R8P A;  4XUJ B;  5KDM B;  3RJU A;  4HGA B;  4KZ8 A;  4LV3 A;  4GDN A;  4LD9 D;  3VSL A;  4YM6 D;  2ZC7 A;  3L28 A;  5BT1 D;  2J8P A;  1N1J B;  1M1A C;  4YFM A;  1BUE A;  5EOE A;  3UE0 A;  5BO0 A;  4OP8 A;  5FAT A;  4H9O A;  3TU4 B;  1M40 A;  1IYO A;  1U60 A;  3GRJ A;  4JJN D;  5TFQ A;  2BLS A;  3DTM A;  1N1J A;  3REJ B;  1BH8 B;  3LJA C;  5CHL B;  4J8W B;  5CED A;  1W8Q A;  2Y55 A;  4IBX A;  2G2U A;  1MPL A;  3KWQ D;  2A3U A;  3Q07 A;  4E3I A;  2ZY4 A;  4KGC B;  1BH8 A;  5B24 B;  3E2K A;  2OSU A;  1KX5 D;  4OUI A;  4KUD B;  1FOF A;  5F1F A;  3REL C;  3KFU G;  1L0D A;  3GSG A;  2CV5 D;  4OPR A;  1WWI A;  1P3A A;  3AZH B;  5B24 A;  4N1H A;  1ID3 B;  3C1C B;  5JYP A;  4XZQ B;  1KX4 C;  1ERM A;  5J8X A;  3AZN A;  1N9B A;  1ESI A;  2DQN C;  3MXR A;  2Y2N A;  3H0R C;  1ZC2 A;  3B6F D;  3AZH A;  2F8N H;  3NY4 A;  3B6G C;  4XZQ A;  3BEB A;  3CZD A;  4KZA A;  2P9V A;  4KZ7 A;  5AVB B;  3AV1 C;  4PM9 A;  4OQI A;  3LZ1 C;  2VQR A;  2W8S A;  2JE5 A;  3DWK A;  4K0W A;  5AVB A;  1MBL A;  3UT9 A;  1NZU A;  3W98 B;  3GMW A;  4WU9 D;  1ES3 A;  4WNN B;  4OPQ A;  1P3O B;  3M2J A;  4ZAM A;  4OQG A;  1P34 A;  3WAA D;  4UUZ A;  5CPJ D;  4IBK A;  1FR1 A;  5FA7 A;  3W98 A;  4FH2 A;  3Q1F A;  2EX9 A;  1BLS A;  4LEN A;  4LV2 A;  3MKF A;  5B32 B;  1P3O A;  4OON A;  2ZY2 A;  3CJM A;  3W8K A;  3V39 A;  5B31 D;  5AV6 D;  5A93 A;  1XX2 A;  5E5A B;  2EXA A;  3MZF A;  5B0Y B;  5B32 A;  3REI B;  5JA4 B;  5HL1 A;  5AVC B;  3AZG B;  2Q9N A;  4ZUX C;  4DXC A;  3MNN C;  4IBJ A;  1CEF A;  4MBF A;  4NET A;  5JA4 A;  2EFX A;  4X69 A;  3V3S A;  5AVC A;  5B33 A;  3AZG A;  5U47 A;  2NQB D;  4U0T A;  3WKJ D;  3KUY B;  3X1T C;  3X1U D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...