2JCHA

Structural and mechanistic basis of penicillin binding protein inhibition by lactivicins
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
684
structure length
461
Chain Sequence
b'SEITYSDGTVIASIDYLYFTTLAEAQERMYDYLAQRDNVSAATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTNQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PENICILLIN-BINDING PROTEIN 1B
publication title Structural and Mechanistic Basis of Penicillin-Binding Protein Inhibition by Lactivicins
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Drug-binding protein
total genus 144
structure length 461
sequence length 684
ec nomenclature
pdb deposition date 2006-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
A PF00912 Transgly Transglycosylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2jchA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2jchA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2jchA02
1Y54A 3CMZA 3IWIA 1NY0A 1NXYA 5AQ7A 4P85A 4BD0A 4N9KA 2JE5A 4R1GA 3G32A 4U3TA 1KDWA 5CEDA 2J8YA 5DTKA 3FKVA 3BFEA 3UDXA 2IWDA 3UE1A 2Y59A 4S2IA 4N1HA 4X68A 2Y2KA 1K57C 5EVIC 1NZUA 3Q07A 4FSFA 5HAPA 1PWGA 2HP6A 2J7VA 4DRTA 1JTGA 1XA7A 5HAIA 4IVKA 4YFMA 1PIOA 3V3SA 3HLCA 1I2WA 2R9XA 2XFSA 2J9OA 4S2KA 2PU4A 2Z2LB 4DDYA 4GB7A 4EQIA 3BEBA 5EVIB 3NY4A 2Y2HA 1KE4A 2VGKA 2XGNA 2C5WB 3WS0A 5JYPA 3G34A 3OC2A 1XKZA 3HLBA 4KZAA 3ZVTA 3N4IA 4KZ9A 5CECA 1RCJA 2Y91A 4KZ4A 1LL9A 2VGJA 1WYCA 1W7FA 2ZC7A 1SDNA 1BLSA 2XQZA 3QHYA 3FKWA 1K6SA 4X55A 2UWXA 2OSUA 4Y7PA 5E43A 3M2KA 5FAPA 2OV5A 1ZC2A 4JKTA 2EFUA 4LV0A 5M19A 4LV1A 4GDNA 5AQAA 1MY8A 1OMEA 5CGXA 5CXWA 4S2OA 3BFDA 3O3VA 1NYYA 3HUMA 4MNRA 4E3NA 4ID4A 1MWRA 4GKUA 5DF7A 1XA1A 5CTNA 4P6BA 4BD1A 4WELA 1HVBA 4B4ZA 4R4RA 3IH8A 1LL5A 1LLBA 2DNSA 4BENA 4KG6A 3NBLA 4LENA 4UA6A 4DKIA 5CGWA 3I7JA 4XUXA 5L2FA 3ZVWA 4K0WA 5E2GA 3VP1A 4E6WA 4OLDA 4JLFA 4S2NC 1KE3A 1GCEA 4O7DA 2ZC4B 4K91A 3G31A 3DWZA 2QMIA 3RXXA 3JYIA 2A3UA 2CC1A 3QNCA 4KZBA 3C4OA 5HFOA 2E8IA 4X56A 3MKEA 2HDUA 1FSYA 4E3JA 3VOZA 1L2SA 3S1YA 1PI5A 3A3EA 4D2OA 2H10A 1YLJA 1ZG6A 4R23A 4DE2A 1CI9A 4KZ5A 4BL2A 4QHCA 4S2PA 4C3QA 4IBRA 4XUZA 4MBKA 3IH9A 4OONA 5HARA 4EBPA 4LV3A 1FCNA 4DE0A 4BL3A 2WYXA 2A49A 2XLNA 4WZ5C 3WS1A 4E6XA 2Y2MA 3IWQA 4B88A 3EQUA 4ZJ1A 2V2FF 1JVJA 3HL9A 3HLEA 3EQVA 1XPBA 3VP2A 1GHIA 5CRFA 5EE8A 5CERA 3SH7A 2WKHA 5HW3A 4E3LA 2Z2MB 1LI0A 4N92A 5CHUA 4KZ7A 5EVIA 2XFTA 1GA9A 5FQJA 3W4PA 3V39A 1MKIA 1TEMA 2G2WA 3A3IA 3GQZA 3MKFA 3CJMA 4IEDA 4OQIA 3O87A 2OLVA 1IEMA 3BYDA 5CGSA 4EWFA 5F82A 5CHJA 5GHXA 2ZM2A 4JXSA 1QMEA 5KSCA 4WBGA 3OCLA 3PBRA 1MXOA 3Q1FA 1ALQA 5EVLA 1KVLA 4OQ0A 1E4DA 2HPBA 4FCFA 4OP8A 2Y2OA 1G6AA 2Y2GA 3G35A 5I94A 1HD8A 2ZMAA 3PBQA 3PAEA 3Q7VB 3G30A 1YMXA 3WWXA 3ZNYA 4BQMA 4OLGA 5DTTA 1ONHA 3UPPA 3MBZA 4KZ3A 4OP5A 3V5MA 5GLAA 2V1ZA 4OPQA 1BT5A 3NDGA 3GMWA 5CTMA 2H0YA 1MPLA 4EUZA 1I5QA 1BTLA 3ITAA 5EUAA 3NDEA 2WADA 3SS4A 4EV4A 3PAGA 1K56A 4DDSA 1GA0A 5FATA 5BOHA 4GOGA 4GD8A 3NI9A 3M2JA 4JF4A 1W8QA 3ZG8B 4F94A 4JF5A 5DVAA 2WZXA 3OZHA 4GZBA 4OPRA 4E3MA 1KGFA 1XX2A 3ZNTA 4BLMA 4Q8IA 1ZKJA 2ZC5B 3IWOA 4P87A 4QU3A 4U0TA 1JWPA 4ZJ3A 5TGFA 5JYOA 5FDHA 3IXDA 4WEJA 3VP4A 3VFFA 4HESA 2Y2QA 1ES4A 2EX9A 4NK3A 3VSKA 2XDMA 3HLGA 3TOIA 1JTDA 3E2KA 1FSWA 3HREA 4S2NA 3C5AA 4WZ4A 4X6TA 4E3IA 2WAEA 2R9WA 4UAAA 4Z9QA 2ZD8A 5DF9A 2QZ6A 1XGJA 1IKGA 4ZBEA 4S2MA 1ERMA 2JCHA 4KQOA 1DY6A 2X02A 4UA9A 3OPHA 4GN2A 3VP3A 3WRZA 1Q2QA 5DF8A 1K4FA 1E25A 3IXHA 3P98A 4FH4A 5AQ9A 2HP9A 5FQKA 1YLZA 5GL9A 2ZM0A 4OPYA 4OVDA 1XGIA 5FASA 3VMAA 3AGFA 3G2ZA 4OOYA 3VP0A 5EECA 4KENB 2FFYA 1NRFA 3Q81A 4M3KA 2ZJ9A 2WGWB 2I72A 4JF6A 3NC8A 1BSGA 1EI5A 3IT9A 4WZ5A 4U0XA 1EROA 3GV9A 3ISGA 3N7WA 1KVMA 5E2FA 1YQSA 4E3KA 4JXWA 1TDGA 1M40A 3GR2A 4FH2A 1PW8A 3CZDA 3ZG5A 2ZQAA 4N1XA 5M1AA 4C75A 3C7VA 3BFFA 1O7EA 1FCOA 5HL1A 4A5RA 3UN7A 1K25A 2DCFA 4KG2A 1YMSA 1YLPA 2XEPA 4FD8A 2ZLYA 3Q7VA 4KZ6A 4QB8A 3ZG7B 2FFFB 3PBTA 3UDIA 4HEFA 2EX6A 3NIAA 3IHBA 4KQRA 2P74A 3MFDA 5F1FA 3NCKA 3PBNA 3HUNA 1Q2PA 1Z6FA 1VQQA 2ZQ8A 4QD4A 1MBLA 5A91A 2ZQ9A 3UNWA 4DF6A 3GTCA 1IYPA 1RGYA 4WMCA 4CPKA 4HBUA 3DWKA 5CEBA 3FYZA 3O86A 1K55C 1YLWA 1N9BA 2ZQ7A 2JC7A 5GHZA 2EX2A 3C7UA 4K0XA 3V3RA 5FA7A 4KG5A 3A3DA 3BECA 5TFQA 1G68A 2X71A 3QNBA 1ESIA 2PBYA 1DJBA 5AQBA 1KE0A 1BLCA 1GHPA 3MXRA 1K57A 1U60A 4S2JA 3BLSA 2B5RA 2BLSA 1BUEA 5DTSA 5E2HA 4PM6A 4C6YA 3MXSA 4IVIA 5FAQA 1BULA 1CEGA 5CHMA 2QPNA 3ZCZA 3ZDJA 4X53A 1K6RA 3LEZA 4PM9A 1SCWA 1FR1A 3A3JA 3VFHA 1GHMA 1MWTA 1TDLA 3HVFA 4S2LA 1SHVA 3PTEA 4H8RA 4XXRA 5HX9A 3TSGA 3W4OA 3FZCA 3HLWA 1H8YA 3ITBA 3N6IA 3C4PA 1YM1A 1YT4A 4JXGA 4QY6A 4WEKA 5FI2A 1K54C 2Q9NA 3FV7A 5EPHA 1S0WA 2EXAA 2RCXA 4PM8A 1M6KA 5A93A 3GSGA 3UY6A 2WKIA 3SH8A 4PMAA 1PI4A 3IF6C 3UO9A 2J9PA 4MBFA 3VSLA 1L0DA 3E2LA 4OH0A 4Y0TA 2IWCA 2WGWA 1E3UA 4OOMA 1BLPA 1BZAA 3D4FA 4ZTKA 4GD6A 3UDFA 3MZFA 5FI6A 3ZFZA 1AXBA 3GVBA 4JBFA 3IF6B 1KDSA 2HP5A 2H0TA 1N4OA 1XXMA 3S4XA 4DE1A 4E3OA 2P9VB 2Y55A 4MEZA 1NZOA 1KGGA 2EX8A 3WRTA 1IKIA 3PBSA 2WK0A 4WYYA 3AGEA 2OLUA 3HLDA 3PBOA 5FQ9A 1PZOA 1KGEA 5KZHA 1LHYA 3A3FA 1YLYA 3W8KA 1ZG4A 1JWVA 1W79A 4JPMA 5F1GA 2XD1A 4OPZA 4UHUA 4OQHA 4BJPA 4N9LA 4KQQA 5TR7A 3BFCA 5D3OA 3UPNA 3IF5A 1IYOA 4Y0OA 3LO7A 3HBRA 5FQMA 2DRWA 3HUOA 3OPLA 2IWBA 1ES3A 2ZM8A 1NJ4A 1ES5A 3GRJA 1QMFA 2HDRA 4R0QA 4RX2A 2WZZA 2XD5A 2G2UA 2ZC3B 2Y4AA 4OQGA 5F83A 1H8ZA 3VOYA 5HAQA 3MZEA 3G2YA 2XH9A 3WS2A 4UA7A 3AGDA 2H5SA 2WUQA 5FSRA 3BFGA 2Y2PA 3ZG0A 3N8SA 3Q7ZA 4MLLA 1L0FA 4CJNA 2Y2IA 3BLMA 3IHAA 3M6HA 3N8RA 4RVAA 5FAOA 3W4QA 3IXGA 1K55A 2BG1A 2PU2A 2V20A 2ZQCA 2Y2JA 1W5DA 4DXBA 5J8XA 3UE0A 1XP4A 2C6WB 3IQAA 3DTMA 1L0GA 4OOLA 1ERQA 4L0LA 1MWUA 2ZC6B 5GLDA 1H5XA 3ZGAB 1NYMA 1W8YA 1VM1A 4MBHA 2XK1A 3OPPA 4PM5A 1MWSA 5FQIA 1PWCA 5EOOA 2XR0A 1CK3A 2HDQA 1SKFA 1EWZA 4R3BA 4ZAMA 2HDSA 5E2EA 4WMCD 4EBNA 1ONGA 5IHVA 2Y2LA 1RP5A 4GNUA 1PWDA 3RJUA 4GDBA 4YINA 3FWLA 3HLFA 3SS3A 3O88A 4OKPA 5FQQA 4LCMA 5A92A 1IELA 1YLTA 1FQGA 4RYEA 4LV2A 3V50A 2WKEA 4DXCA 3BM6A 1PYYA 2WGIA 1O07A 3LY3A 3SOIA 4ZDXA 1K54A 1IYQA 4B4XA 3DW0A 1C3BA 2EXBA 2Y2NA 3OPRA 5EVID 3ZG9B 2WAFA 1K38A 3RXWA 1ES2A 1BLHA 1HZOA 5GLBA 1K4EA 5A90A 1L0EA 5KSHA 5FI7A 4DE3A 4QJGA 1LI9A 4P0MA 1HTZA 1FOFA 1PZPA 5G18A 1SDEA 3IF6A 1WE4A 2XF3A 1PW1A 5KMWA 4Y0UA 2P9VA 3M6BA 1WYBA 2WGVA 3OCNA 3P09A 1DJAA 4NETA 2GDNA 5GHYA 2ZQDA 3Q82A 5GLCA 2RL3A 1I2SA 3S22A 3TG9A 5EOEA 4WM9A 4R4SA 5U47A 3UPOA 3WS4A 3ZHHA 2EFXA 4PPRA 4EBLA 4HBTA 1FR6A 1S6RA 3SH9A 1FCMA 1TVFA 2JBFA 2Q9MA 3SS5A 4ZJ2A 1J9MA 4LCLA 1K56D 3N8LA 4PM7A 1IYSA 4RX3A 4JXVA 3CG5A 4R3JA 1CI8A 1RGZA 4KZ8A 4X69A 3LCEA 1DJCA 3BRMA 3IXBA 3UE3A 3WS5A 1JWZA 1ESUA 3MZDA 1E3UD 3B3XA 4IBXA 5M18A 4RA7A 3LY4A 2X01A 3G4PA 1CEFA 4QY5A
chains in the Genus database with same CATH superfamily
3IWIA 1NY0A 1NXYA 5AQ7A 3REJD 4N9KA 5CPIB 2J8YA 2BYMB 4AWLC 5IU1A 3WTPA 4J8VC 4N1HA 3AZJC 4UEYA 1AOIC 4NZ4A 5HPIA 2CV5A 2J3TC 2JKFA 5GXQC 3A0SA 4NXGA 5HAPA 1D1JA 3B6FD 2HP6A 2QJ7A 3MXQA 1T19A 4X23B 4DRTA 1XA7A 3KXBD 4YFMA 1M18C 1D7EA 3HLCA 3P5JB 1I2WA 2V8CA 4Z5TD 2J9OA 2B02A 4EQIA 3C8CA 5EVIB 1P3PD 2VJWA 4GCZA 5BO0B 3UTAC 4X1MA 1S67L 4YWZA 3CI6A 2VKSA 3N4IA 5CECA 2E8JA 2M7VA 1S1ZA 3TU4D 4HOIA 5E43A 4CQHA 3O62C 5FAPA 5C5KA 2OV5A 3MVDD 4LV0A 4Y13A 4GDNA 2J80A 2G5IC 3NQJB 2EWWA 3FG8A 3IX8A 1P3OD 1NYYA 3X1VD 2JHEA 1OT9A 1XA1A 1LL5A 4KUKA 3AZHC 3B6GD 1S32D 4IBBA 3NBLA 1ULYA 4KHAA 3MGPD 1P3GB 3B0CW 1E6RA 3LIAA 4K0WA 3MGRB 5A8BA 4UQIM 2LY8A 3V67A 2FZ0A 3W99D 2QMIA 4IUHA 3C4OA 2VA0A 2E8IA 4X56A 4GH9A 1FSYA 4E3JA 3VOZA 1P3BA 3BQAA 1F66A 2RVQC 4MB5A 5B0YA 3AZLA 1AIWA 1E15A 1YLJA 2EA9A 1ZG6A 4R23A 1G5UA 4QHCA 4C3QA 3WA9D 4MMNA 3AYWA 2NZDD 4MBKA 4OONA 4CLCD 5HARA 4EBPA 1TZYD 4F3LA 1P3AC 5AV5A 1P34C 4J8WA 3RFBA 4WZ5C 3LR3A 2Y2MA 4B88A 3UTBD 3EQUA 2DMWA 4WU9D 4R8PC 3HLEA 4XZQC 1XPBA 3EQVA 5CERA 5HW3A 3SH7A 1CF0A 4GHIA 2Z2MB 3MS6A 4N92A 4E3LA 5CP6B 5CHUA 2XFTA 1GA9A 5FQJA 3W4PA 4NE3A 1TEMA 4NXEA 3A6NC 4EWFA 5F82A 3MSHA 5KSCA 3AZMA 1F5MA 5EVLA 1W63Q 2F8ND 1E4DA 2NUTC 4HHDA 2Y2OA 1G6AA 1HLUP 4I3IA 2PDRA 1HD8A 3B0CT 4BQMA 5B1LD 4H9OA 5JRGA 3AFAB 1BT5A 5GSUB 4BBTA 3EEAA 3GMWA 3UT9B 3PAGA 1E6ZA 1TAFB 3QP8A 4XUJB 3ZG8B 4F94A 3FKEA 5B1MD 3KWQA 4GW9A 1YAXA 4Q8IA 4MB4A 4BWIA 1A7WA 1JWPA 4ZJ3A 1V9YA 2HF6A 4WEJA 4HESA 3MGQC 5EM0A 3LELB 3VSKA 3IX4A 4Z2MH 5BNXA 4R6LA 1YSPA 4S2NA 5J4EA 3C5AA 3REID 1M19A 1F98A 1PNEA 1M1AC 4ZBEA 3E4PA 4JJNB 2F2AC 4H9NB 3LJAA 5AV6A 4P6ZS 3IXHA 4IBFA 4J8UB 3E98A 5F99D 2L5AA 1XGIA 2PBDP 3G2ZA 4WZSB 4OOYA 3VP0A 3C1CD 1NRFA 4M3KA 3WAAA 4OUIA 4JGQA 1MZUA 3REJB 4FH2A 5FEFA 1BH8B 3CZDA 4C75A 3BFFA 1O7EA 1FCOA 1B67A 5B2JC 5HL1A 2M1CA 3UN7A 4MB3A 3BW6A 3MMHA 2XEPA 4QB8A 3PBTA 3UDIA 4EEUA 3B6FB 2EX6A 3NIAA 3IHBA 4WU8C 3MFDA 4ETZA 3MGPA 3KXBB 1Q2PA 1VQQA 4LD9B 2ZQ8A 1P3MD 3CPTB 2ZQ9A 4Z5TB 2CMNA 1IYPA 3QP2A 4HBUA 3DWKA 1P3PB 1P3LC 4G3KA 3LZ0A 4QLCC 1WA9A 2ZQ7A 2JC7A 5GHZA 2EX2A 3MNND 4PKYA 1H0IA 3UMDA 4H9QB 3A3DA 5TFQA 4J8XD 1G68A 1DJBA 3TU4B 3AZJA 1U60A 2Q0OA 1AOIA 1T1AA 4NZ3A 5DTSA 3WA9A 5E2HA 4IVIA 1CEGA 4WF0A 2VQRA 4CLCA 2QPNA 3MVDB 1K6RA 1P3OB 3X1VB 1FR1A 3A3JA 1L3LA 2P04A 2AROC 4S2LA 5HX9A 3PTEA 4H8RA 1XJ6A 3HLWA 2EWVA 4G91B 3B6GB 3N6IA 5AVCC 1EQZB 4JXGA 1S32B 4QY6A 3B33A 5B24B 2AVXA 5CPIC 5A93A 2WKIA 1GOIA 3UO9A 4MBFA 3W99B 5B40D 3E2LA 1BH9A 1KX5C 4OH0A 4GHLA 2F8NA 3AZND 3S7OA 1BLPA 2F8NK 3AV1C 4YM6C 4HI4A 2IO5C 1AXBA 3KYZA 2HJ9C 3GVBA 2NZDB 1N4OA 4EETB 3D9YA 1XXMA 3ZQ5A 3LIEA 1DP6A 3AZFC 1TZYB 2P9VB 1P3KB 3NJAA 4Q0IA 1IKIA 4CAYB 3UTBB 1KGEA 5BT1D 4WU9B 3AZGA 1E6NA 4H9PB 2VZWA 1ZG4A 5F1GA 2XD1A 2BASA 4NYYA 5FQMA 2ZM8A 3LEQA 1ES5A 3GRJA 4O8GA 1NWZA 2WZZA 3GDIA 3MR0A 1GSWA 3WTPC 2WKPA 3AGDA 5AVBB 5CPKD 2CV5C 3N8SA 5BS7A 1D06A 3M6HA 3AZID 4I39A 1P34A 1TS6A 3W4QA 3EEHA 4IUKA 2BG1A 2V20A 2ZQCA 4R8PA 3KO6A 5B1LB 4XZQA 3L2AA 4MN6A 5B31D 3UE0A 1P3FD 3G6OA 2C6WB 3IQAA 3IX3A 1KX3B 4OOLA 5GLDA 4NFTA 1W8YA 4PM5A 3LIFA 4EQ1A 3C1BB 5FQIA 5AY8A 2Y8HA 5B0ZD 1EWZA 4KUOA 5B1MB 5E2EA 3VOLA 5IHVA 4MCWA 5AV9A 4X23D 5KDMB 3SW1A 5A92A 4LCMA 4WUJA 1IELA 3AN2D 3V50A 2WKEA 2GZAA 2VGLS 3O5YA 3SOIA 1IYQA 1ID3D 4Z1WA 2EXBA 5EVID 3ZG9B 3KS8A 4HMDA 1V9ZA 1L0EA 1LI9A 4Z2IA 1HTZA 1ZLAB 4Y17A 4XT2A 2A2LA 3REIB 3X1SC 2ZY4A 1PW1A 4Y0UA 4HP4A 2KOIA 3P09A 1DJAA 3T1XA 5HWVA 3W96D 3IP4C 5EOEA 1OTIA 2A24A 5U47A 3UPOA 3ZHHA 5GT3D 4J8XA 1S6RA 3SH9A 5B0YC 4NKPA 3REHD 3VE4A 1FCMA 1TVFA 3C1CB 2B18A 1BFMA 3F1PB 3AYWC 4G92B 3AFAC 1K56D 4IBJA 5B32A 5AV5C 1M1AA 4X69A 4J8WC 4IBXA 3G4PA 4XUJC 3CMZA 4BD0A 3W98A 4P85A 5CEDA 4U3TA 2ZY3A 1S1YA 4H9SC 3BFEA 3UDXA 2IWDA 2Y59A 4S2IA 5HWWA 5FUGB 4X68A 2FH5A 3Q07A 3T1QB 1P3MB 5G4YA 4QNLA 3KSYA 3DAVA 1U35B 5HAIA 3AZMC 1PIOA 2VK3A 4NZ5A 3MNNB 2PU4A 4DDYA 2YFWA 2PYPA 2YFVB 1KE4A 2VGKA 5JYPA 3WS0A 3G34A 3OC2A 1XKZA 3UE6A 5JRGC 4KZ9A 5CP6D 4WU8A 2Y91A 1IOUA 5G49B 1SDNA 3EG5B 3F1OA 4J8UC 3QHYA 3HONA 3MQLA 2UWXA 4Y7PA 4YS3D 5DNMB 2O9AA 4FOFA 5HSQA 1P3LA 3KUYB 2PD8A 1OMEA 1HQ3A 5G4ZA 5DNNA 3REJC 5DF7A 4P6BA 4WELA 3IH8A 4GJ4A 3FC7A 2W8SA 2DNSA 4LENA 4UA6A 2QWSA 5CGWA 1W1VA 3MQQA 5B40B 3I7JA 5IT5A 3B6FC 1S4RA 5BNVB 5E2GA 3VP1A 3AZNB 4KUDA 4S2NC 1P3IA 2BYKA 4IBKA 4K91A 3KXBC 3DWZA 1M19C 4NXBA 5DKKA 1GXDA 3RXXA 3AV2A 5HDSA 2A3UA 2DQNC 2AROA 4AFIA 5HZHA 5B31A 4Z5TC 3A3EA 3T4KA 3W97D 4ZUXB 4DE2A 2XA7S 5CPIA 3QP5A 2BYMA 3IH9A 2PR6A 3TU4C 4LV3A 1FCNA 5EFWA 1P9WA 3WAAC 4X23A 4EUVA 3MVDC 4ME4A 3VP2A 4YM6A 5CRFA 5EE8A 2WKHA 3AZKD 4DJ3A 1GPFA 1LI0A 3LIBA 5EVIA 4H6JB 5BO0A 3V39A 1MKIA 5CPKB 3A3IA 2UV0E 5DFXA 2RTSA 3O87A 3KS4A 1S32C 1IEMA 3AZIB 5CGSA 5CHJA 5GHXA 3MGPC 2ZM2A 4EXOA 1KVLA 1P3FB 1YKDA 4OQ0A 5F68A 2W1TB 3W99C 3LZ0C 3PBQA 3PAEA 3HJIA 3ZNYA 3H82B 3LFVA 3UPPA 3MBZA 1NLYA 3NQJA 3V5MA 5FDSA 5B0ZB 1P97A 1LT0A 2H0YA 4IBIA 1I5QA 4L9FA 4I5SA 4EUZA 3WA9C 3NDEA 2WADA 4HGAC 1K56A 4O0PA 4CLCC 3MF0A 1TZYC 5BOHA 4GD8A 3M2JA 4JF4A 3WTPE 1P3GA 4LD9D 2WZXA 4H9RB 3AN2B 3MGRA 1KGFA 1XX2A 3DTKA 4BLMA 1ID3B 4WU9C 1ZKJA 1W2EA 2ZC5B 4P87A 1YUEA 5TGFA 5JYOA 4R3AA 2K31A 2K7SA 1NRJA 3OLOA 2OAQ1 3W96B 1YPRA 2MJ6A 2R9WA 4Z9QA 2ZD8A 5DF9A 1XGJA 1IKGA 2LB5A 3HJKA 2JCHA 1DY6A 5GT3B 2L1MA 3VP3A 2B95A 1CQAA 3REHB 1K4FA 1E25A 4FH4A 5B1LC 5FQKA 2PYRA 5GL9A 1EQZD 5CP6A 3F1NB 1YU0A 5FASA 3AGFA 1VEUB 5B24D 3X1SA 5GT0B 1KX4D 4KENB 4ESPA 2PYOB 1FIKA 2ZJ9A 5AVEA 4MN5A 1EI5A 2I9VA 1KVMA 4E3KA 1YQSA 4JXWA 3AZGC 1M40A 3B0DB 2NQBB 1ZTUA 4N1XA 5M1AA 3C7VA 3K3DA 1CJFA 5KIZA 3UB7A 3VH5W 4A5RA 4KG2A 1YLPA 3ZG7B 4E44A 4KQRA 3AFAA 3NCKA 3EWKA 1Z6FA 5GSUA 4QD4A 5CPJB 1H8MA 5BS7C 3GTCA 3AZED 1P3KD 3UT9A 2H28A 5CEBA 1YU4A 4RQ9A 1TAFA 1N9BA 4XUJA 4K0XA 3V3RA 2LB9A 3BECA 4H9SA 4J8VD 1S4SA 4UQIS 3QNBA 1ESIA 4KGCD 2PBYA 5AQBA 1BLCA 5GXQD 3MXRA 2B5RA 2BLSA 1TD5A 4PM6A 3PR6A 5F99C 5AY8C 4YS3B 1BULA 4CSRB 5CHMA 3LELA 1KU5A 5AVBD 3LUQA 1Z09A 5AV9C 3VFHA 3TSGA 5DJTA 3UMEA 2W0NA 3C4PA 4JJNA 1YT4A 4WEKA 5FI2A 4H9NA 2Q9NA 1KX3D 3NQUB 4ZBJC 1T1BA 3EGXC 3GSGA 3UY6A 4J8UA 5B33D 3O62D 3VH5T 3L9KA 3C1BD 4OJLA 1T1CA 5I5LA 1L0DA 2ZM5A 1Y28A 1P3BB 4G3WA 1E3UA 4EO5B 1W1YA 1BZAA 3DBAA 4ZTKA 3W97B 3AZHD 3REJA 5FI6A 3UDFA 1XJ2A 5C3IB 2VEAA 4J8XC 3L25A 2HP5A 3IF6B 3REKD 2H0TA 4R70A 5L8MA 3S4XA 2P7JA 4DE1A 4E3OA 3X1UB 3FPVA 2FJ7B 3WKJD 1NZOA 2EX8A 3B6FA 3PBSA 2OLUA 2K2NA 1ZLAD 3KXBA 4GHIB 5B32C 1OTDA 3CPTA 3AZKB 2YKHA 4BJPA 4Z5TA 2D01A 5TR7A 3UPNA 3WD1A 4Y0OA 4GS9B 1P3PA 3W98C 4Z2LA 2DRWA 1ES3A 2HUEB 4RX2A 2HDRA 2XD5A 2G2UA 1G6OA 4H9QA 4JGPA 3T1SA 4OQGA 3MGSB 3MZEA 3G2YA 1P3AD 4QPRA 2XH9A 3RH8B 3JPUA 3MQ0A 2H5SA 2WUQA 3LGOA 4UA7A 3TU4A 3ZG0A 4MLLA 4CJNA 2V1BA 3N8RA 4RVAA 3H7WA 5AVFA 1K55A 2PU2A 3MVDA 4TX8A 3OBFA 4K08A 1W5DA 3AZNC 3H0RC 2O99A 2XSSA 3DTMA 1L0GA 3SZTA 2WKQA 4Z66D 1P3OA 2ZC6B 3EPHA 3X1VA 1H5XA 1H0MA 1VM1A 3C38A 4MBHA 3OPPA 3A6ND 3B6GA 3CUEA 1N9OA 1EQZA 3FPWA 1S32A 1CK3A 1SKFA 5B24A 4HIAA 4R3BA 5K5BA 2HDSA 1OTBA 3BWLA 3P01A 1H8PA 4WMCD 5HD3A 4GNUA 4HJ4A 3RJUA 4GDBA 1U35D 3HLFA 3W99A 3VH6T 3D3OA 1E8BA 1PZRA 4RYEA 3OOVA 1HQ3C 5DNNC 3RELB 3DW0A 3OPRA 2WAFA 1K38A 1PRQA 2VLGA 1BLHA 5GLBA 1K4EA 5A90A 4HJ3A 2W3DA 4DE3A 5G18A 3RTYA 2XF3A 2NZDA 2OAP1 4ETXA 5FEGA 5AV8D 5EM1A 1TZYA 5CPKC 2P9VA 3ZYTA 2WGVA 3OCNA 2KDKA 3B42A 3Q82A 4KUDC 1P3IC 1OPXA 5B2IB 4UPKA 4CAYA 5DNMD 3WD2A 3UTBA 3S22A 4BBUA 3TG9A 3AV2C 4WU9A 1H3OB 2W1RA 4H9PA 4UUZA 5B31C 3IS2B 4CLCE 1P3FC 3KUYD 2FN2A 4Y15A 1FR6A 4NEED 1KX4B 3JVVA 4DQYB 4D60A 3N3FA 4LG2A 4ZJ2A 5AVBA 3LCEA 3BRMA 2GJ3A 1ESUA 3B3XA 2X01A 4X23C 1CEFA 2JSSA 3PYPA 2JE5A 4R1GA 3G32A 5E5AB 4EW7A 1QO6A 2QKPA 5B1LA 3AN2C 3UB6A 3FKVA 3R45B 2V5OA 3NULA 1W1PA 1KX3A 1K57C 5EVIC 3X1TB 5BPVA 4FSFA 1PWGA 4ZUXD 4NYUA 3AZEB 2J7VA 1JTGA 3C1BA 4PHTA 4BBVA 3V3SA 5B1MA 4J8VB 2V1AA 4KGCB 2W27A 5GXQB 2C5WB 5KDMA 1N9LA 2ZBBA 3HLBA 5GT3C 4HP9A 4KZ4A 1LL9A 2VGJA 1M18B 3REHC 1W7FA 2ZC7A 1ED7A 1BLSA 2XQZA 1K6SA 2JKRI 2OSUA 1L6JA 1ZLAA 3UTAB 3TE8A 4QLCD 4ARZB 3REIA 1ZC2A 5M19A 2EFUA 4LV1A 4IBEA 3FDDA 5AQAA 1P3GC 3EOIA 5CGXA 5CXWA 3MGRC 1SKOB 4S2OA 4HMEA 4E3NA 4ID4A 4GKUA 4BD1A 3V9RB 4R4RA 3P7NA 1LLBA 5B33B 4KG6A 3O62B 5DFYA 5F99A 5L10A 1STZA 2O9BA 4XUXA 5L2FA 3ZVWA 3C1CA 5DJUA 2ZMFA 5F69A 1GCEA 2ZC4B 3F1PA 1F9IA 4KZBA 3AZHB 3QNCA 5AVCD 5F6AA 3MKEA 2HDUA 1XJ4A 3S1YA 3REKB 1PI5A 2H10A 4B93A 3WKJB 4Z2GA 1CI9A 1WWSA 3LZ1D 4S2PA 3U4LP 4XUZA 5CP6C 4MDZA 5FUGA 1P3MA 2A49A 2XLNA 5TBMB 4E6XA 3IWQA 2HGVA 3AV1D 1U35A 2Z6CA 1JVJA 3HL9A 3R4KA 1GHIA 5LBRA 4EERA 3MNNA 3AZFD 5JA4B 1P3AB 3K2NA 2YFVA 1AWIA 4NXFA 4M4XA 4IEDA 3NOPC 3L26A 4L9GA 3DTEA 2HIOD 5GSUC 3OCLA 3Q1FA 1MXOA 5G49A 4FUWA 5GT0D 3T4QA 2PYOD 2HPBA 4Y5FA 3UT9C 2PT7A 3G35A 5DNMA 5I94A 4Z66B 2D02A 3LR4A 3Q7VB 3G30A 3WWXA 1N1JB 4OLGA 5DTTA 3A6NB 2NQBD 4KZ3A 4OP5A 4EO5C 2V1ZA 4OPQA 3NDGA 2PR5A 1CXWA 5CTMA 3WD3A 1MPLA 2HZ5A 4OJ6A 3ITAA 1IFQA 3SS4A 4EV4A 2OOLA 1GA0A 3NECA 4FTXA 5B40A 3LELC 1PFLA 5CPJD 4GZBA 5BNVA 4OPRA 4E3MA 3AZNA 3ZNTA 2IOUA 3IWOA 3AZKC 5MC7A 4JJNC 1OGGA 5FDHA 2Y2QA 2EX9A 5AV8B 2HUEC 1OJGA 4ZUXA 3HREA 3T4JA 2WAEA 5J7EA 4S2MA 5HWTA 1ERMA 3AL0C 4UA9A 3OPHA 3MGQB 1Q2QA 3BQ8A 3CHWP 3P98A 1YLZA 1CK7A 2ZM0A 4LLOB 4Y3IA 4DJ2A 1H3QA 3VMAA 2ZOHA 1P9RA 4H6JA 4PAUA 3LI9A 5CPKA 2WGWB 2I72A 4JF6A 3NC8A 1BSGA 3AZIA 1OT6A 5E2FA 5TJJA 3GR2A 3ULFA 4WNNB 4LD9C 1PW8A 3ZG5A 2ZQAA 1P3BD 1F66D 1P3FA 2BTFP 3AZLD 3KFUG 3R7WB 1K25A 2W1TA 1P3PC 4KZ6A 3H82A 4Z2HA 3AYWD 5F1FA 4M6BA 2KX6A 3F6TA 4NG2A 3S7QA 3PBNA 5B0ZA 3HSHA 3E4QA 3H0LC 5AV5D 2ZL1B 3VV4A 5CHLB 3X1UD 1MBLA 4J8WD 3UNWA 2FJ7D 3CAXA 5B2JB 1RGYA 3FYZA 3O86A 1K55C 1YLWA 1H0GA 4WU8B 4H9RA 3AN2A 1P3OC 1ID3A 3X1VC 3QP1A 3HCYA 1K57A 5J3WA 4NY2A 3IBJA 3BLSA 4C6YA 1GSVA 4G91C 3B6GC 2XRNA 3A0RA 3CUEC 1EQZC 3MXSA 5FAQA 4WLAA 4QLCB 3MGSD 2VV6A 5B24C 3NOUC 3ZDJA 1KX4C 4X53A 5HPFA 1N9NA 1J3WA 1SCWA 3W96A 1GHMA 4DRAA 1MWTA 1TDLA 1SHVA 1VETB 3BY9A 5GT3A 4WN5A 5EPHA 1S0WA 2RCXA 3REHA 1M6KA 1JFIB 3SH8A 4PMAA 2CWEA 1PI4A 1T3UA 3T1RA 2HV1A 2NZDC 2J9PA 3F1NA 4IJFA 3KWQD 1VEUA 5GT0A 5AVCB 2PYOA 1P3KC 4OOMA 1Z2CB 3UTBC 3KSFA 4GD6A 4GHAA 2NQBA 4ZRRA 3LZ1B 1KDSA 3T50A 3CLOA 4KGCC 1KX5B 2Y55A 3RELD 4MEZA 4HH3A 1UR9A 3KSGA 1KGGA 3WRTA 3CWFA 1OTAA 2IA2A 3HLDA 3PBOA 1M19D 4HJ6A 1PZOA 3AV1B 4NZ1A 4YM6B 2IO5B 5KZHA 1W63M 2WKRA 1YLYA 3A3FA 5AVBC 1JWVA 1W79A 4JPMA 3WX7A 5CPJA 4UHUA 4N9LA 4HH2A 3LJAD 3AZFB 5D3OA 5AV6D 3IF5A 1X0OA 5B2ID 3LO7A 3HUOA 4HQAA 1NJ4A 4R0QA 1QMFA 5FL3A 1LSXA 2PD7A 2ZC3B 2Y4AA 3EPLA 4Q0JA 1H8ZA 5HAQA 3PHYA 3BY8A 1J7MA 1KX3C 2HIOB 3WS2A 3BJNA 5FSRA 3JVUA 3BFGA 2Y2PA 2V0UA 3VH5A 3WAAD 2Y2IA 5B33C 3BLMA 3IHAA 5FAOA 3C1BC 4YS3A 2YKFA 4WV4B 4CSRA 1LSVA 3A0VA 3L28A 5J8XA 5B1MC 3WTPB 2W3EA 1ERQA 2CV5B 1NYMA 3A1KA 5E5AD 3LYXA 3REKC 2HDQA 3NQUA 3WKJC 1TS8A 3X1TD 3MFXA 1ONGA 2G7UA 2Y2LA 2GX5A 1RP5A 1ODVA 1ZLAC 3LZ0D 1PWDA 4YINA 3FWLA 3REIC 3EPJA 4X25A 3O88A 5FQQA 1YLTA 2M7UA 4LV2A 2VX8A 1PYYA 4ZDXA 1K54A 2ZY5A 4B4XA 3AZJD 1AOID 3RXWA 2J3TD 1HZOA 3W97A 2JKTI 5KSHA 4QJGA 4IBGA 1PZPA 1SDEA 2INWA 3IF6A 3UB8A 1PDCA 1M18D 3X1UA 1VHMA 3M6BA 2FJ7A 3C1CC 2GDNA 2ZQDA 2P08A 1O6IA 4G92C 5HDDA 4LRYC 3UTAD 1YU2A 3MJQA 1OTEA 3AZKA 4PPRA 4EBLA 4KHAB 3X1SB 4MN7A 4Z66C 4GS9A 2QYBA 2Q9MA 3SS5A 4LCLA 1E88A 3MGSA 2ACGA 4JXVA 3CG5A 1CI8A 1RGZA 1DJCA 1P3MC 3WS5A 1JWZA 5M18A 2JKGA 1F66B 4WJ3C 4Z2MG 2W3FA 5B0YB 3AZLB 4QY5A 3VH6A 1U35C 1Y54A 2W3GA 4DDSA 1KDWA 5DTKA 3AYWB 3MNNC 1KS0A 2G5HC 1BH8A 3UE1A 2VV7A 4F3LB 2Y2KA 2Z6DA 5AV5B 1NZUA 5L09A 4J8WB 3EGDC 3VH6W 4L9EA 4LGWA 2Y79A 4IVKA 4P6ZM 3AZGD 5AV8C 2XFSA 2R9XA 4S2KA 4LD9A 2Z2LB 4QWOA 4GB7A 3BEBA 2RVQD 5DNMC 3NY4A 2Y2HA 1A0KA 3TW8A 2PRFA 2XGNA 3IBRA 3WD0A 3KUYC 4OJ5A 1XFQA 4KQDA 4KZAA 3ZVTA 1RCJA 4PKYG 3AZMB 1T18A 1WYCA 2ZMVA 3RELA 5DKLA 3VE3A 3FKWA 3UB9A 4X55A 1P34D 3M2KA 4R8PD 4JKTA 4H9OB 5B40C 4XZQD 1B6WA 1EAKA 1MY8A 2V9AA 5JRGB 3BFDA 5HD5A 3O3VA 3HUMA 4MNRA 5B2IA 1MWRA 1VB6A 3LR5A 5CTNA 4WL9A 1H3OA 1HVBA 4B4ZA 3IS2A 5AY8D 4BENA 2JKRM 4IJEA 4DKIA 2V0WA 5F5YA 3KWQB 1OGBA 4ZUXC 1KX4A 4E6WA 4OLDA 5AV9D 4JLFA 1XFNA 1KE3A 1HTAA 4O7DA 3G31A 1UWPX 5BT1C 3JYIA 2CC1A 5HFOA 4OJPA 1L2SA 2F8NG 4E45A 4D2OA 2HJEA 5BNXB 3E0YA 1LSWA 4KZ5A 5E5AA 1UWNX 4BL2A 4IBRA 3R45A 1M19B 1UGUA 5EV0A 4DE0A 3X1TA 4BL3A 3QP4A 2WYXA 3LR0A 3WS1A 3AZEA 1P3KA 3AZIC 3LJAB 4O01A 5AV6B 4ZJ1A 2V2FF 4GLQA 1DRMA 4KZ7A 4J8VA 3MGQD 4KGCA 2W3HA 1F2KA 2G2WA 3GQZA 5GXQA 3MKFA 3CJMA 3H7WB 4OQIA 3WAAB 2OLVA 2OWJA 3BYDA 4EU0A 4JXSA 5B0ZC 1QMEA 3KSIA 5B32D 3H9WA 3KYQA 1M18A 1M1AD 3E4OA 3PBRA 4WBGA 3T12B 2F8NH 1Y4OA 1ALQA 2NUPC 4FCFA 2QJ5A 4LPZA 4OP8A 2Y2GA 3W98D 2ZMAA 3UTAA 4ARZA 3NOTC 1YMXA 1ONHA 3B47A 3KX0X 3MGPB 1SKOA 5GLAA 2ZOIA 4I3JA 4Q0HA 1ID3C 4DMZA 2V8FA 3V9RA 3LZ1C 1BTLA 5EUAA 1ZHHB 4LRXC 5B33A 3O62A 3LZ0B 5FATA 4GOGA 3CITA 3NI9A 1W8QA 4JF5A 5DVAA 4AWLB 3OZHA 4LRZE 5B2JD 3GECA 3W96C 3AZJB 4BMWA 1AOIB 4E04A 2DF4C 4QU3A 3WA9B 3AZHA 4U0TA 4HGAB 1S66L 4WU8D 4CLCB 4HNBA 3IXDA 3REKA 3VP4A 3VFFA 1ES4A 4NK3A 2XDMA 3WKJA 3HLGA 3TOIA 1JTDA 1YU3A 3EPKA 1FSWA 3E2KA 3MQOA 4WZ4A 4X6TA 4E3IA 2HIOC 4UAAA 4UUZB 1P3LD 2QZ6A 5GT0C 2L0WA 2PYOC 4KQOA 2X02A 1HQ3D 5TBMA 4GN2A 5DNND 1EW0A 3WRZA 5DF8A 5AQ9A 2HP9A 3B0DC 2NQBC 1JNUA 4OPYA 4DN0A 4OVDA 1BH9B 5JA4A 1P3AA 2F8NB 5EECA 2FFYA 3Q81A 4KUDD 2VGLM 1P3ID 3IT9A 4WZ5A 4U0XA 1EROA 3GV9A 3ISGA 3N7WA 3AV2D 3T4OA 2AROD 1TDGA 3K3CA 5CPJC 3PXPA 1MC0A 5B32G 1OJ5A 2GNXA 4IJGA 2RIQA 2DCFA 4Z66A 1YMSA 4FD8A 2ZLYA 5CPID 3Q7VA 2FFFB 4LFUA 1TS7A 4HEFA 1N1JA 2XROA 3A6NA 2P74A 1SZVA 1TF1A 3HUNA 2L4RA 3AZGB 1K0KA 1KX5D 4Y2FA 1GSXA 5A91A 4DF6A 4WMCA 4CPKA 4II7A 4YS3C 1TS0A 4G3VA 4YM6D 1DP8A 3C7UA 1DP9A 5FA7A 3KSHA 4KG5A 2X71A 1KE0A 4HMCA 3S7NA 4NE6A 1GHPA 4S2JA 1WWIA 1G28A 1MKMA 3A1IA 3KYEA 2JN7A 1BUEA 1P34B 5HDCA 4R8PB 3ZCZA 4XZQB 5AV8A 2QHKA 1YU1A 3LEZA 4PM9A 4EESA 3HVFA 4XXRA 3W4OA 2ZY2A 3FZCA 1H8YA 3ITBA 1P0ZA 1P3BC 1F66C 5F99B 5AY8B 3KUYA 1YM1A 3L7HA 3AZLC 3T4SA 2OWHA 3WTPD 1K54C 3UB5P 1NLZA 3FV7A 4DRBA 3MGQA 4PM8A 2EXAA 2CV5D 5HL6A 3W97C 5AV9B 5C3IC 2PAVP 3IF6C 3VSLA 1P3GD 4JGRA 4Y0TA 3X1UC 2FJ7C 3MGRD 2IWCA 4YOFA 2WGWA 4ZBJB 3LIDA 3D4FA 3MZFA 3ZFZA 3ICYA 4WNNA 4HY8A 1UR8A 4JBFA 4XT2B 4JGOA 5B31G 4IBDA 3R7WA 1ACFA 2J3WA 2WK0A 4WYYA 3AGEA 5FQ9A 3MGSC 1LHYA 2A24B 1BYWA 3W8KA 2ZL1A 4IHQA 4OPZA 4J8XB 3U2AA 4OQHA 5B2JA 2J8PA 4KQQA 3LICA 3BFCA 1IYOA 3DTIA 3HBRA 3OPLA 2IWBA 4B9OA 1KOUA 3C2WA 5F83A 3VOYA 3QP6A 3X1SD 5B32B 1M1AB 3LI8A 3Q7ZA 1L0FA 4I3AA 3W98B 1F1EA 3IXGA 4QLCA 3KWQC 5AJGA 5IS1A 1E6PA 2XA7M 1FILA 2Y2JA 5CX7A 4DXBA 1XP4A 3W2ZA 3C30A 4L0LA 5B0YD 1MWUA 3ZGAB 2PHYA 3TJZC 4R38A 2XK1A 1MWSA 4EEPA 1VETA 1PWCA 5EOOA 3AFAD 2XR0A 5GSUD 3WD4A 3RELC 4ZAMA 3D72A 2YFWB 4EBNA 3UT9D 1JFIA 3M7PA 2O9CA 4XUJD 4OJOA 3SS3A 3T4LA 4OKPA 3B0BA 1FQGA 4DXCA 4IBCA 5AVCA 4NE5A 3BM6A 2WGIA 4X1LA 3LJAC 1O07A 3LY3A 5AV6C 1LL8A 1Q9CA 5B2IC 1C3BA 3F1OB 2Y2NA 3T4TA 1ES2A 5FI7A 4P0MA 1FOFA 3LZ1A 1WE4A 1XJ3A 1P3LB 3LELD 5KMWA 3AZMD 1R4VA 1KX5A 1WYBA 5GLCA 4NETA 5GHYA 2R78A 3NHQA 3TRCA 1HQ3B 5DNNB 2RL3A 4YNRA 1I2SA 3H0MC 3AV1A 1YSQA 4WM9A 4R4SA 3S7PA 4JJND 3WS4A 2EFXA 3L27A 2JKTM 5JRGD 4HBTA 2D49A 3AZFA 4I38A 4Z2JA 4J8UD 2JBFA 2KLIA 5E5AC 4KUDB 1P3IB 2BYKB 1J9MA 5L07A 3N8LA 4PM7A 1IYSA 1W1TA 4RX3A 3AV2B 4R3JA 2HIOA 2AROB 2O0YA 2VV8A 5B31B 4KZ8A 3X1TC 3IXBA 3UE3A 3MZDA 1E3UD 4RA7A 3LY4A 3L29A 5EVEA 3AZEC 4Z2KA
chains in the Genus database with same CATH topology
3IWIA 1NY0A 1NXYA 5AQ7A 3REJD 4N9KA 5CPIB 2J8YA 2BYMB 4AWLC 3WTPA 4J8VC 4N1HA 3AZJC 1AOIC 4NZ4A 2CV5A 5GXQC 5HAPA 2HP6A 3B6FD 4X23B 4DRTA 1XA7A 3KXBD 4YFMA 1M18C 3HLCA 3P5JB 1I2WA 4Z5TD 2J9OA 4EQIA 5EVIB 1P3PD 5BO0B 3UTAC 3N4IA 5CECA 3TU4D 5E43A 3O62C 5FAPA 2OV5A 3MVDD 4LV0A 4GDNA 2G5IC 3NQJB 1P3OD 1NYYA 3X1VD 1XA1A 1LL5A 3AZHC 3B6GD 1S32D 4IBBA 3NBLA 1ULYA 4KHAA 3MGPD 1P3GB 3B0CW 4K0WA 3MGRB 2LY8A 3W99D 2QMIA 3C4OA 2E8IA 4X56A 4GH9A 1FSYA 4E3JA 3VOZA 1P3BA 1F66A 2RVQC 5B0YA 3AZLA 1YLJA 1ZG6A 4R23A 4QHCA 4C3QA 3WA9D 3AYWA 2NZDD 4MBKA 4OONA 5HARA 4EBPA 1TZYD 1P3AC 5AV5A 1P34C 4J8WA 4WZ5C 2Y2MA 4B88A 3UTBD 3EQUA 4WU9D 4R8PC 3HLEA 4XZQC 1XPBA 3EQVA 5CERA 5HW3A 3SH7A 4E3LA 2Z2MB 4N92A 5CP6B 5CHUA 2XFTA 1GA9A 5FQJA 3W4PA 4NE3A 1TEMA 3A6NC 4EWFA 5F82A 5KSCA 3AZMA 5EVLA 2F8ND 1E4DA 2Y2OA 1G6AA 1HD8A 3B0CT 4BQMA 5B1LD 4H9OA 5JRGA 3AFAB 1BT5A 5GSUB 3GMWA 3UT9B 3PAGA 1TAFB 4XUJB 3ZG8B 4F94A 3FKEA 5B1MD 3KWQA 4Q8IA 1A7WA 1JWPA 4ZJ3A 4WEJA 4HESA 3MGQC 3LELB 3VSKA 4Z2MH 5BNXA 4S2NA 3C5AA 3REID 1M19A 1M1AC 4ZBEA 4JJNB 2F2AC 4H9NB 3LJAA 5AV6A 3IXHA 4IBFA 4J8UB 5F99D 2L5AA 1XGIA 3G2ZA 4WZSB 4OOYA 3VP0A 3C1CD 1NRFA 4M3KA 3WAAA 4OUIA 3REJB 4FH2A 1BH8B 3CZDA 4C75A 3BFFA 1O7EA 1FCOA 1B67A 5B2JC 5HL1A 3UN7A 2XEPA 4QB8A 3PBTA 3UDIA 3B6FB 2EX6A 3NIAA 3IHBA 4WU8C 3MFDA 3MGPA 3KXBB 1Q2PA 1VQQA 4LD9B 2ZQ8A 1P3MD 2ZQ9A 4Z5TB 1IYPA 4HBUA 3DWKA 1P3PB 1P3LC 3LZ0A 4QLCC 2ZQ7A 2JC7A 5GHZA 2EX2A 3MNND 4H9QB 3A3DA 5TFQA 4J8XD 1G68A 1DJBA 3TU4B 3AZJA 1U60A 1AOIA 4NZ3A 5DTSA 3WA9A 5E2HA 4IVIA 1CEGA 2VQRA 2QPNA 3MVDB 1K6RA 1P3OB 3X1VB 1FR1A 3A3JA 2AROC 4S2LA 5HX9A 3PTEA 4H8RA 3HLWA 4G91B 3B6GB 3N6IA 5AVCC 1EQZB 4JXGA 1S32B 4QY6A 5B24B 5CPIC 5A93A 2WKIA 3UO9A 4MBFA 3W99B 5B40D 3E2LA 1BH9A 1KX5C 4OH0A 4GHLA 2F8NA 3AZND 1BLPA 2F8NK 3AV1C 4YM6C 2IO5C 1AXBA 3GVBA 2NZDB 1N4OA 1XXMA 3AZFC 1TZYB 2P9VB 1P3KB 1IKIA 4CAYB 3UTBB 1KGEA 5BT1D 4WU9B 3AZGA 4H9PB 1ZG4A 5F1GA 2XD1A 4NYYA 5FQMA 2ZM8A 1ES5A 3GRJA 2WZZA 3WTPC 3AGDA 5AVBB 5CPKD 2CV5C 3N8SA 5BS7A 3M6HA 3AZID 1P34A 3W4QA 2BG1A 2V20A 2ZQCA 4R8PA 5B1LB 4XZQA 3L2AA 5B31D 3UE0A 1P3FD 2C6WB 3IQAA 1KX3B 4OOLA 5GLDA 4NFTA 1W8YA 4PM5A 3C1BB 5FQIA 5AY8A 5B0ZD 1EWZA 5B1MB 5E2EA 5IHVA 5AV9A 4X23D 5KDMB 5A92A 4LCMA 1IELA 3AN2D 3V50A 2WKEA 3SOIA 1IYQA 1ID3D 2EXBA 5EVID 3ZG9B 3KS8A 1L0EA 1LI9A 1HTZA 1ZLAB 3REIB 3X1SC 2ZY4A 1PW1A 4Y0UA 3P09A 1DJAA 3W96D 3IP4C 5EOEA 5U47A 3UPOA 3ZHHA 5GT3D 4J8XA 1S6RA 3SH9A 5B0YC 3REHD 1FCMA 1TVFA 3C1CB 1BFMA 3AYWC 4G92B 3AFAC 1K56D 4IBJA 5B32A 5AV5C 1M1AA 4X69A 4J8WC 4IBXA 3G4PA 4XUJC 3CMZA 4BD0A 3W98A 4P85A 5CEDA 4U3TA 2ZY3A 4H9SC 3BFEA 3UDXA 2IWDA 2Y59A 4S2IA 5FUGB 4X68A 3Q07A 1P3MB 4QNLA 3KSYA 1U35B 5HAIA 3AZMC 1PIOA 4NZ5A 3MNNB 2PU4A 4DDYA 2YFWA 2YFVB 1KE4A 2VGKA 5JYPA 3WS0A 3G34A 3OC2A 1XKZA 5JRGC 4KZ9A 5CP6D 4WU8A 2Y91A 5G49B 1SDNA 3EG5B 4J8UC 3QHYA 3HONA 2UWXA 4Y7PA 4YS3D 5DNMB 1P3LA 3KUYB 1OMEA 1HQ3A 5DNNA 3REJC 5DF7A 4P6BA 4WELA 3IH8A 2W8SA 2DNSA 4LENA 4UA6A 5CGWA 5B40B 3I7JA 3B6FC 5E2GA 5BNVB 3VP1A 3AZNB 4KUDA 4S2NC 1P3IA 2BYKA 4IBKA 4K91A 3KXBC 3DWZA 1M19C 3RXXA 3AV2A 2A3UA 2DQNC 2AROA 5B31A 4Z5TC 3A3EA 3W97D 4ZUXB 4DE2A 5CPIA 2BYMA 3IH9A 3TU4C 4LV3A 1FCNA 3WAAC 4X23A 3MVDC 3VP2A 4YM6A 5CRFA 5EE8A 2WKHA 3AZKD 1LI0A 5EVIA 5BO0A 3V39A 1MKIA 5CPKB 3A3IA 3O87A 3KS4A 1S32C 1IEMA 3AZIB 5CGSA 5CHJA 5GHXA 3MGPC 2ZM2A 1KVLA 1P3FB 4OQ0A 3W99C 3LZ0C 3PBQA 3PAEA 3ZNYA 3UPPA 3MBZA 3NQJA 3V5MA 5B0ZB 2H0YA 4IBIA 1I5QA 4EUZA 3WA9C 3NDEA 2WADA 4HGAC 1K56A 1TZYC 5BOHA 4GD8A 3M2JA 4JF4A 3WTPE 1P3GA 4LD9D 2WZXA 4H9RB 3AN2B 3MGRA 1KGFA 1XX2A 4BLMA 1ID3B 4WU9C 1ZKJA 1W2EA 2ZC5B 4P87A 1YUEA 5TGFA 5JYOA 3W96B 2R9WA 4Z9QA 2ZD8A 5DF9A 1XGJA 1IKGA 2JCHA 1DY6A 5GT3B 3VP3A 3REHB 1K4FA 1E25A 4FH4A 5B1LC 5FQKA 5GL9A 1EQZD 5CP6A 1YU0A 5FASA 3AGFA 5B24D 3X1SA 5GT0B 1KX4D 4KENB 2PYOB 2ZJ9A 1EI5A 1KVMA 4E3KA 1YQSA 4JXWA 3AZGC 1M40A 3B0DB 2NQBB 4N1XA 5M1AA 3C7VA 3VH5W 4A5RA 4KG2A 1YLPA 3ZG7B 4E44A 4KQRA 3AFAA 3NCKA 1Z6FA 5GSUA 4QD4A 5CPJB 5BS7C 3GTCA 3AZED 1P3KD 3UT9A 5CEBA 1YU4A 1TAFA 1N9BA 4XUJA 4K0XA 3V3RA 3BECA 4H9SA 4J8VD 3QNBA 1ESIA 4KGCD 2PBYA 5AQBA 1BLCA 5GXQD 3MXRA 2B5RA 2BLSA 4PM6A 5F99C 5AY8C 4YS3B 1BULA 4CSRB 5CHMA 3LELA 1KU5A 5AVBD 5AV9C 3VFHA 3TSGA 3C4PA 4JJNA 1YT4A 4WEKA 5FI2A 4H9NA 2Q9NA 1KX3D 3NQUB 4ZBJC 3GSGA 3UY6A 4J8UA 5B33D 3O62D 3VH5T 3C1BD 4OJLA 1L0DA 2ZM5A 1P3BB 1E3UA 4EO5B 1BZAA 4ZTKA 3W97B 3AZHD 3REJA 5FI6A 3UDFA 5C3IB 4J8XC 3L25A 2HP5A 3IF6B 3REKD 2H0TA 3S4XA 4DE1A 4E3OA 3X1UB 2FJ7B 3WKJD 1NZOA 2EX8A 3B6FA 3PBSA 2OLUA 1ZLAD 3KXBA 5B32C 3AZKB 4BJPA 4Z5TA 5TR7A 3UPNA 4Y0OA 1P3PA 3W98C 2DRWA 1ES3A 2HUEB 4RX2A 2HDRA 2XD5A 2G2UA 4H9QA 4OQGA 3MGSB 3MZEA 3G2YA 1P3AD 2XH9A 4UA7A 2H5SA 2WUQA 3TU4A 3ZG0A 4MLLA 4CJNA 3N8RA 4RVAA 1K55A 2PU2A 3MVDA 1W5DA 3AZNC 3H0RC 1L0GA 3DTMA 4Z66D 1P3OA 2ZC6B 3EPHA 3X1VA 1H5XA 1VM1A 4MBHA 3OPPA 3A6ND 3B6GA 1EQZA 1S32A 1CK3A 1SKFA 5B24A 4R3BA 2HDSA 4WMCD 4GNUA 3RJUA 4GDBA 1U35D 3HLFA 3W99A 3VH6T 1PZRA 4RYEA 1HQ3C 5DNNC 3RELB 3DW0A 3OPRA 2WAFA 1K38A 5GLBA 1BLHA 1K4EA 5A90A 4DE3A 5G18A 2XF3A 2NZDA 5AV8D 1TZYA 5CPKC 2P9VA 2WGVA 3OCNA 3Q82A 4KUDC 1P3IC 5B2IB 4UPKA 4CAYA 5DNMD 3UTBA 3S22A 3TG9A 3AV2C 4WU9A 1H3OB 4H9PA 4UUZA 5B31C 1P3FC 3KUYD 1FR6A 1KX4B 4DQYB 3N3FA 4LG2A 4ZJ2A 5AVBA 3LCEA 3BRMA 1ESUA 3B3XA 2X01A 4X23C 1CEFA 2JSSA 2JE5A 4R1GA 3G32A 5E5AB 5B1LA 3AN2C 3FKVA 3R45B 1KX3A 1K57C 5EVIC 3X1TB 5BPVA 4FSFA 1PWGA 4ZUXD 4NYUA 3AZEB 2J7VA 1JTGA 3C1BA 3V3SA 5B1MA 4J8VB 4KGCB 5GXQB 2C5WB 5KDMA 3HLBA 5GT3C 4KZ4A 1LL9A 2VGJA 1M18B 3REHC 1W7FA 2ZC7A 1BLSA 2XQZA 1K6SA 2OSUA 1ZLAA 3UTAB 4QLCD 3REIA 1ZC2A 5M19A 2EFUA 4LV1A 4IBEA 3FDDA 5AQAA 1P3GC 5CGXA 5CXWA 3MGRC 4S2OA 4E3NA 4ID4A 4GKUA 4BD1A 3V9RB 4R4RA 1LLBA 5B33B 4KG6A 3O62B 5F99A 4XUXA 5L2FA 3ZVWA 3C1CA 1GCEA 2ZC4B 4KZBA 3AZHB 3QNCA 5AVCD 3MKEA 2HDUA 3S1YA 3REKB 1PI5A 2H10A 3WKJB 1CI9A 1WWSA 3LZ1D 4S2PA 4XUZA 5CP6C 5FUGA 1P3MA 2A49A 2XLNA 4E6XA 3IWQA 3AV1D 1U35A 1JVJA 3HL9A 1GHIA 3MNNA 3AZFD 5JA4B 1P3AB 2YFVA 4IEDA 3L26A 2HIOD 5GSUC 3OCLA 3Q1FA 1MXOA 5G49A 5GT0D 2PYOD 2HPBA 3UT9C 3G35A 5DNMA 5I94A 4Z66B 3Q7VB 3G30A 3WWXA 1N1JB 4OLGA 5DTTA 3A6NB 2NQBD 4KZ3A 4OP5A 4EO5C 2V1ZA 4OPQA 3NDGA 5CTMA 1MPLA 4OJ6A 3ITAA 3SS4A 4EV4A 1GA0A 5B40A 3LELC 5CPJD 4GZBA 5BNVA 4OPRA 4E3MA 3AZNA 3ZNTA 2IOUA 3IWOA 3AZKC 4JJNC 5FDHA 2Y2QA 2EX9A 5AV8B 2HUEC 4ZUXA 3HREA 2WAEA 4S2MA 1ERMA 3AL0C 4UA9A 3OPHA 3MGQB 1Q2QA 3P98A 1YLZA 2ZM0A 3VMAA 5CPKA 2WGWB 2I72A 4JF6A 3NC8A 1BSGA 3AZIA 5E2FA 3GR2A 4WNNB 4LD9C 1PW8A 3ZG5A 2ZQAA 1P3BD 1F66D 1P3FA 3AZLD 3KFUG 1K25A 1P3PC 4KZ6A 3AYWD 5F1FA 4M6BA 3F6TA 3PBNA 5B0ZA 3HSHA 3H0LC 5AV5D 5CHLB 3X1UD 1MBLA 4J8WD 3UNWA 2FJ7D 5B2JB 1RGYA 3FYZA 3O86A 1K55C 1YLWA 4WU8B 4H9RA 3AN2A 1P3OC 1ID3A 3X1VC 1K57A 4NY2A 3BLSA 4C6YA 4G91C 3B6GC 3MXSA 5FAQA 1EQZC 4QLCB 3MGSD 5B24C 3ZDJA 1KX4C 4X53A 1SCWA 3W96A 1GHMA 4DRAA 1MWTA 1TDLA 1SHVA 5GT3A 5EPHA 1S0WA 2RCXA 3REHA 1M6KA 1JFIB 3SH8A 4PMAA 2CWEA 1PI4A 1T3UA 2NZDC 2J9PA 4IJFA 3KWQD 5GT0A 5AVCB 2PYOA 1P3KC 4OOMA 1Z2CB 3UTBC 4GD6A 4GHAA 2NQBA 3LZ1B 1KDSA 4KGCC 1KX5B 2Y55A 3RELD 4MEZA 1KGGA 3WRTA 3HLDA 3PBOA 1M19D 1PZOA 3AV1B 4NZ1A 4YM6B 2IO5B 5KZHA 3A3FA 1YLYA 5AVBC 1JWVA 1W79A 4JPMA 3WX7A 5CPJA 4UHUA 4N9LA 3LJAD 3AZFB 5D3OA 5AV6D 3IF5A 5B2ID 3LO7A 3HUOA 1NJ4A 4R0QA 1QMFA 2ZC3B 2Y4AA 3EPLA 1H8ZA 5HAQA 1KX3C 2HIOB 3WS2A 5FSRA 3BFGA 2Y2PA 3VH5A 3WAAD 2Y2IA 5B33C 3BLMA 3IHAA 5FAOA 3C1BC 4YS3A 4WV4B 4CSRA 3L28A 5J8XA 5B1MC 3WTPB 1ERQA 2CV5B 1NYMA 3A1KA 5E5AD 3REKC 2HDQA 3NQUA 3WKJC 3X1TD 1ONGA 2Y2LA 1RP5A 1ZLAC 3LZ0D 1PWDA 4YINA 3FWLA 3REIC 3EPJA 3O88A 5FQQA 1YLTA 4LV2A 1PYYA 4ZDXA 1K54A 2ZY5A 4B4XA 3AZJD 1AOID 3RXWA 1HZOA 3W97A 5KSHA 4QJGA 4IBGA 1PZPA 1SDEA 3IF6A 1M18D 3X1UA 3M6BA 2FJ7A 3C1CC 2GDNA 2ZQDA 4G92C 3UTAD 1YU2A 3AZKA 4PPRA 4EBLA 4KHAB 3X1SB 4Z66C 2Q9MA 3SS5A 4LCLA 3MGSA 4JXVA 3CG5A 1CI8A 1RGZA 1DJCA 1P3MC 3WS5A 1JWZA 5M18A 1F66B 4WJ3C 4Z2MG 5B0YB 3AZLB 4QY5A 3VH6A 1U35C 1Y54A 4DDSA 1KDWA 5DTKA 3AYWB 3MNNC 2G5HC 1BH8A 3UE1A 2Y2KA 5AV5B 1NZUA 4J8WB 3VH6W 4IVKA 3AZGD 5AV8C 2XFSA 2R9XA 4S2KA 4LD9A 2Z2LB 4GB7A 3BEBA 2RVQD 5DNMC 3NY4A 2Y2HA 2XGNA 3KUYC 4OJ5A 4KZAA 3ZVTA 1RCJA 3AZMB 1WYCA 3RELA 3FKWA 4X55A 1P34D 3M2KA 4R8PD 4JKTA 4H9OB 5B40C 4XZQD 1B6WA 1MY8A 5JRGB 3BFDA 3O3VA 3HUMA 4MNRA 5B2IA 1MWRA 5CTNA 1H3OA 1HVBA 4B4ZA 5AY8D 4BENA 4IJEA 4DKIA 3KWQB 4ZUXC 1KX4A 4E6WA 4OLDA 5AV9D 4JLFA 1KE3A 1HTAA 4O7DA 3G31A 5BT1C 3JYIA 2CC1A 5HFOA 4OJPA 1L2SA 2F8NG 4E45A 4D2OA 5BNXB 4KZ5A 5E5AA 4BL2A 4IBRA 3R45A 1M19B 4DE0A 3X1TA 4BL3A 2WYXA 3WS1A 3AZEA 1P3KA 3AZIC 3LJAB 5AV6B 4ZJ1A 2V2FF 4KZ7A 4J8VA 3MGQD 4KGCA 2G2WA 3GQZA 5GXQA 3MKFA 3CJMA 4OQIA 3WAAB 2OLVA 3BYDA 4JXSA 5B0ZC 1QMEA 5B32D 4WBGA 1M18A 1M1AD 3PBRA 2F8NH 1ALQA 4FCFA 4OP8A 2Y2GA 3W98D 2ZMAA 3UTAA 1YMXA 1ONHA 3MGPB 5GLAA 1ID3C 3V9RA 3LZ1C 1BTLA 5EUAA 5B33A 3O62A 3LZ0B 5FATA 4GOGA 3NI9A 1W8QA 4JF5A 5DVAA 4AWLB 3OZHA 5B2JD 3W96C 3AZJB 1AOIB 2DF4C 4QU3A 3WA9B 3AZHA 4U0TA 4HGAB 4WU8D 3IXDA 3REKA 3VP4A 3VFFA 1ES4A 4NK3A 2XDMA 3WKJA 3HLGA 3TOIA 1JTDA 1YU3A 3EPKA 1FSWA 3E2KA 4WZ4A 4X6TA 4E3IA 2HIOC 4UAAA 4UUZB 1P3LD 2QZ6A 5GT0C 2PYOC 4KQOA 2X02A 1HQ3D 4GN2A 5DNND 3WRZA 5DF8A 5AQ9A 2HP9A 3B0DC 2NQBC 4OPYA 4OVDA 1BH9B 5JA4A 1P3AA 2F8NB 5EECA 2FFYA 3Q81A 4KUDD 1P3ID 3IT9A 4WZ5A 4U0XA 1EROA 3GV9A 3ISGA 3N7WA 3AV2D 2AROD 1TDGA 5CPJC 5B32G 2RIQA 2DCFA 4Z66A 1YMSA 4FD8A 2ZLYA 5CPID 3Q7VA 2FFFB 4HEFA 1N1JA 3A6NA 2P74A 3HUNA 3AZGB 1KX5D 5A91A 4DF6A 4WMCA 4CPKA 4YS3C 4YM6D 3C7UA 5FA7A 4KG5A 2X71A 1KE0A 4NE6A 1GHPA 4S2JA 1WWIA 3A1IA 1BUEA 1P34B 4R8PB 3ZCZA 4XZQB 5AV8A 1YU1A 3LEZA 4PM9A 3HVFA 4XXRA 3W4OA 2ZY2A 3FZCA 1H8YA 3ITBA 1P3BC 1F66C 5F99B 5AY8B 3KUYA 1YM1A 3AZLC 3WTPD 1K54C 3FV7A 4DRBA 3MGQA 4PM8A 2EXAA 2CV5D 3W97C 5AV9B 5C3IC 3IF6C 3VSLA 1P3GD 4Y0TA 3X1UC 2FJ7C 3MGRD 2IWCA 2WGWA 4ZBJB 3D4FA 3MZFA 3ZFZA 4WNNA 4JBFA 5B31G 4IBDA 2WK0A 4WYYA 3AGEA 5FQ9A 3MGSC 1LHYA 3W8KA 4OPZA 4J8XB 4OQHA 5B2JA 2J8PA 4KQQA 3BFCA 1IYOA 3HBRA 3OPLA 2IWBA 5F83A 3VOYA 3X1SD 5B32B 1M1AB 3Q7ZA 1L0FA 3W98B 1F1EA 3IXGA 4QLCA 3KWQC 2Y2JA 4DXBA 1XP4A 4L0LA 5B0YD 1MWUA 3ZGAB 2XK1A 1MWSA 1PWCA 5EOOA 3AFAD 2XR0A 5GSUD 3RELC 4ZAMA 2YFWB 4EBNA 3UT9D 1JFIA 4XUJD 4OJOA 3SS3A 4OKPA 3B0BA 1FQGA 4DXCA 4IBCA 5AVCA 4NE5A 3BM6A 2WGIA 3LJAC 1O07A 3LY3A 5AV6C 1Q9CA 5B2IC 1C3BA 2Y2NA 1ES2A 5FI7A 4P0MA 1FOFA 3LZ1A 1WE4A 5KMWA 1P3LB 3LELD 3AZMD 1R4VA 1KX5A 1WYBA 5GLCA 4NETA 5GHYA 1HQ3B 2RL3A 5DNNB 1I2SA 3H0MC 3AV1A 4WM9A 4R4SA 4JJND 3WS4A 2EFXA 3L27A 5JRGD 4HBTA 3AZFA 4J8UD 2JBFA 5E5AC 4KUDB 1P3IB 2BYKB 1J9MA 3N8LA 4PM7A 1IYSA 4RX3A 3AV2B 4R3JA 2HIOA 2AROB 4KZ8A 5B31B 3X1TC 3IXBA 3UE3A 3MZDA 1E3UD 4RA7A 3LY4A 3L29A 3AZEC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y54 A;  3CMZ A;  3IWI A;  1NY0 A;  1NXY A;  5AQ7 A;  4P85 A;  4BD0 A;  4N9K A;  2JE5 A;  4R1G A;  3G32 A;  4U3T A;  1KDW A;  5CED A;  2J8Y A;  5DTK A;  3FKV A;  3BFE A;  3UDX A;  2IWD A;  3UE1 A;  2Y59 A;  4S2I A;  4N1H A;  4X68 A;  2Y2K A;  1K57 C;  5EVI C;  1NZU A;  3Q07 A;  4FSF A;  5HAP A;  1PWG A;  2HP6 A;  2J7V A;  4DRT A;  1JTG A;  1XA7 A;  5HAI A;  4IVK A;  4YFM A;  1PIO A;  3V3S A;  3HLC A;  1I2W A;  2R9X A;  2XFS A;  2J9O A;  4S2K A;  2PU4 A;  2Z2L B;  4DDY A;  4GB7 A;  4EQI A;  3BEB A;  5EVI B;  3NY4 A;  2Y2H A;  1KE4 A;  2VGK A;  2XGN A;  2C5W B;  3WS0 A;  5JYP A;  3G34 A;  3OC2 A;  1XKZ A;  3HLB A;  4KZA A;  3ZVT A;  3N4I A;  4KZ9 A;  5CEC A;  1RCJ A;  2Y91 A;  4KZ4 A;  1LL9 A;  2VGJ A;  1WYC A;  1W7F A;  2ZC7 A;  1SDN A;  1BLS A;  2XQZ A;  3QHY A;  3FKW A;  1K6S A;  4X55 A;  2UWX A;  2OSU A;  4Y7P A;  5E43 A;  3M2K A;  5FAP A;  2OV5 A;  1ZC2 A;  4JKT A;  2EFU A;  4LV0 A;  5M19 A;  4LV1 A;  4GDN A;  5AQA A;  1MY8 A;  1OME A;  5CGX A;  5CXW A;  4S2O A;  3BFD A;  3O3V A;  1NYY A;  3HUM A;  4MNR A;  4E3N A;  4ID4 A;  1MWR A;  4GKU A;  5DF7 A;  1XA1 A;  5CTN A;  4P6B A;  4BD1 A;  4WEL A;  1HVB A;  4B4Z A;  4R4R A;  3IH8 A;  1LL5 A;  1LLB A;  2DNS A;  4BEN A;  4KG6 A;  3NBL A;  4LEN A;  4UA6 A;  4DKI A;  5CGW A;  3I7J A;  4XUX A;  5L2F A;  3ZVW A;  4K0W A;  5E2G A;  3VP1 A;  4E6W A;  4OLD A;  4JLF A;  4S2N C;  1KE3 A;  1GCE A;  4O7D A;  2ZC4 B;  4K91 A;  3G31 A;  3DWZ A;  2QMI A;  3RXX A;  3JYI A;  2A3U A;  2CC1 A;  3QNC A;  4KZB A;  3C4O A;  5HFO A;  2E8I A;  4X56 A;  3MKE A;  2HDU A;  1FSY A;  4E3J A;  3VOZ A;  1L2S A;  3S1Y A;  1PI5 A;  3A3E A;  4D2O A;  2H10 A;  1YLJ A;  1ZG6 A;  4R23 A;  4DE2 A;  1CI9 A;  4KZ5 A;  4BL2 A;  4QHC A;  4S2P A;  4C3Q A;  4IBR A;  4XUZ A;  4MBK A;  3IH9 A;  4OON A;  5HAR A;  4EBP A;  4LV3 A;  1FCN A;  4DE0 A;  4BL3 A;  2WYX A;  2A49 A;  2XLN A;  4WZ5 C;  3WS1 A;  4E6X A;  2Y2M A;  3IWQ A;  4B88 A;  3EQU A;  4ZJ1 A;  2V2F F;  1JVJ A;  3HL9 A;  3HLE A;  3EQV A;  1XPB A;  3VP2 A;  1GHI A;  5CRF A;  5EE8 A;  5CER A;  3SH7 A;  2WKH A;  5HW3 A;  4E3L A;  2Z2M B;  1LI0 A;  4N92 A;  5CHU A;  4KZ7 A;  5EVI A;  2XFT A;  1GA9 A;  5FQJ A;  3W4P A;  3V39 A;  1MKI A;  1TEM A;  2G2W A;  3A3I A;  3GQZ A;  3MKF A;  3CJM A;  4IED A;  4OQI A;  3O87 A;  2OLV A;  1IEM A;  3BYD A;  5CGS A;  4EWF A;  5F82 A;  5CHJ A;  5GHX A;  2ZM2 A;  4JXS A;  1QME A;  5KSC A;  4WBG A;  3OCL A;  3PBR A;  1MXO A;  3Q1F A;  1ALQ A;  5EVL A;  1KVL A;  4OQ0 A;  1E4D A;  2HPB A;  4FCF A;  4OP8 A;  2Y2O A;  1G6A A;  2Y2G A;  3G35 A;  5I94 A;  1HD8 A;  2ZMA A;  3PBQ A;  3PAE A;  3Q7V B;  3G30 A;  1YMX A;  3WWX A;  3ZNY A;  4BQM A;  4OLG A;  5DTT A;  1ONH A;  3UPP A;  3MBZ A;  4KZ3 A;  4OP5 A;  3V5M A;  5GLA A;  2V1Z A;  4OPQ A;  1BT5 A;  3NDG A;  3GMW A;  5CTM A;  2H0Y A;  1MPL A;  4EUZ A;  1I5Q A;  1BTL A;  3ITA A;  5EUA A;  3NDE A;  2WAD A;  3SS4 A;  4EV4 A;  3PAG A;  1K56 A;  4DDS A;  1GA0 A;  5FAT A;  5BOH A;  4GOG A;  4GD8 A;  3NI9 A;  3M2J A;  4JF4 A;  1W8Q A;  3ZG8 B;  4F94 A;  4JF5 A;  5DVA A;  2WZX A;  3OZH A;  4GZB A;  4OPR A;  4E3M A;  1KGF A;  1XX2 A;  3ZNT A;  4BLM A;  4Q8I A;  1ZKJ A;  2ZC5 B;  3IWO A;  4P87 A;  4QU3 A;  4U0T A;  1JWP A;  4ZJ3 A;  5TGF A;  5JYO A;  5FDH A;  3IXD A;  4WEJ A;  3VP4 A;  3VFF A;  4HES A;  2Y2Q A;  1ES4 A;  2EX9 A;  4NK3 A;  3VSK A;  2XDM A;  3HLG A;  3TOI A;  1JTD A;  3E2K A;  1FSW A;  3HRE A;  4S2N A;  3C5A A;  4WZ4 A;  4X6T A;  4E3I A;  2WAE A;  2R9W A;  4UAA A;  4Z9Q A;  2ZD8 A;  5DF9 A;  2QZ6 A;  1XGJ A;  1IKG A;  4ZBE A;  4S2M A;  1ERM A;  2JCH A;  4KQO A;  1DY6 A;  2X02 A;  4UA9 A;  3OPH A;  4GN2 A;  3VP3 A;  3WRZ A;  1Q2Q A;  5DF8 A;  1K4F A;  1E25 A;  3IXH A;  3P98 A;  4FH4 A;  5AQ9 A;  2HP9 A;  5FQK A;  1YLZ A;  5GL9 A;  2ZM0 A;  4OPY A;  4OVD A;  1XGI A;  5FAS A;  3VMA A;  3AGF A;  3G2Z A;  4OOY A;  3VP0 A;  5EEC A;  4KEN B;  2FFY A;  1NRF A;  3Q81 A;  4M3K A;  2ZJ9 A;  2WGW B;  2I72 A;  4JF6 A;  3NC8 A;  1BSG A;  1EI5 A;  3IT9 A;  4WZ5 A;  4U0X A;  1ERO A;  3GV9 A;  3ISG A;  3N7W A;  1KVM A;  5E2F A;  1YQS A;  4E3K A;  4JXW A;  1TDG A;  1M40 A;  3GR2 A;  4FH2 A;  1PW8 A;  3CZD A;  3ZG5 A;  2ZQA A;  4N1X A;  5M1A A;  4C75 A;  3C7V A;  3BFF A;  1O7E A;  1FCO A;  5HL1 A;  4A5R A;  3UN7 A;  1K25 A;  2DCF A;  4KG2 A;  1YMS A;  1YLP A;  2XEP A;  4FD8 A;  2ZLY A;  3Q7V A;  4KZ6 A;  4QB8 A;  3ZG7 B;  2FFF B;  3PBT A;  3UDI A;  4HEF A;  2EX6 A;  3NIA A;  3IHB A;  4KQR A;  2P74 A;  3MFD A;  5F1F A;  3NCK A;  3PBN A;  3HUN A;  1Q2P A;  1Z6F A;  1VQQ A;  2ZQ8 A;  4QD4 A;  1MBL A;  5A91 A;  2ZQ9 A;  3UNW A;  4DF6 A;  3GTC A;  1IYP A;  1RGY A;  4WMC A;  4CPK A;  4HBU A;  3DWK A;  5CEB A;  3FYZ A;  3O86 A;  1K55 C;  1YLW A;  1N9B A;  2ZQ7 A;  2JC7 A;  5GHZ A;  2EX2 A;  3C7U A;  4K0X A;  3V3R A;  5FA7 A;  4KG5 A;  3A3D A;  3BEC A;  5TFQ A;  1G68 A;  2X71 A;  3QNB A;  1ESI A;  2PBY A;  1DJB A;  5AQB A;  1KE0 A;  1BLC A;  1GHP A;  3MXR A;  1K57 A;  1U60 A;  4S2J A;  3BLS A;  2B5R A;  2BLS A;  1BUE A;  5DTS A;  5E2H A;  4PM6 A;  4C6Y A;  3MXS A;  4IVI A;  5FAQ A;  1BUL A;  1CEG A;  5CHM A;  2QPN A;  3ZCZ A;  3ZDJ A;  4X53 A;  1K6R A;  3LEZ A;  4PM9 A;  1SCW A;  1FR1 A;  3A3J A;  3VFH A;  1GHM A;  1MWT A;  1TDL A;  3HVF A;  4S2L A;  1SHV A;  3PTE A;  4H8R A;  4XXR A;  5HX9 A;  3TSG A;  3W4O A;  3FZC A;  3HLW A;  1H8Y A;  3ITB A;  3N6I A;  3C4P A;  1YM1 A;  1YT4 A;  4JXG A;  4QY6 A;  4WEK A;  5FI2 A;  1K54 C;  2Q9N A;  3FV7 A;  5EPH A;  1S0W A;  2EXA A;  2RCX A;  4PM8 A;  1M6K A;  5A93 A;  3GSG A;  3UY6 A;  2WKI A;  3SH8 A;  4PMA A;  1PI4 A;  3IF6 C;  3UO9 A;  2J9P A;  4MBF A;  3VSL A;  1L0D A;  3E2L A;  4OH0 A;  4Y0T A;  2IWC A;  2WGW A;  1E3U A;  4OOM A;  1BLP A;  1BZA A;  3D4F A;  4ZTK A;  4GD6 A;  3UDF A;  3MZF A;  5FI6 A;  3ZFZ A;  1AXB A;  3GVB A;  4JBF A;  3IF6 B;  1KDS A;  2HP5 A;  2H0T A;  1N4O A;  1XXM A;  3S4X A;  4DE1 A;  4E3O A;  2P9V B;  2Y55 A;  4MEZ A;  1NZO A;  1KGG A;  2EX8 A;  3WRT A;  1IKI A;  3PBS A;  2WK0 A;  4WYY A;  3AGE A;  2OLU A;  3HLD A;  3PBO A;  5FQ9 A;  1PZO A;  1KGE A;  5KZH A;  1LHY A;  3A3F A;  1YLY A;  3W8K A;  1ZG4 A;  1JWV A;  1W79 A;  4JPM A;  5F1G A;  2XD1 A;  4OPZ A;  4UHU A;  4OQH A;  4BJP A;  4N9L A;  4KQQ A;  5TR7 A;  3BFC A;  5D3O A;  3UPN A;  3IF5 A;  1IYO A;  4Y0O A;  3LO7 A;  3HBR A;  5FQM A;  2DRW A;  3HUO A;  3OPL A;  2IWB A;  1ES3 A;  2ZM8 A;  1NJ4 A;  1ES5 A;  3GRJ A;  1QMF A;  2HDR A;  4R0Q A;  4RX2 A;  2WZZ A;  2XD5 A;  2G2U A;  2ZC3 B;  2Y4A A;  4OQG A;  5F83 A;  1H8Z A;  3VOY A;  5HAQ A;  3MZE A;  3G2Y A;  2XH9 A;  3WS2 A;  4UA7 A;  3AGD A;  2H5S A;  2WUQ A;  5FSR A;  3BFG A;  2Y2P A;  3ZG0 A;  3N8S A;  3Q7Z A;  4MLL A;  1L0F A;  4CJN A;  2Y2I A;  3BLM A;  3IHA A;  3M6H A;  3N8R A;  4RVA A;  5FAO A;  3W4Q A;  3IXG A;  1K55 A;  2BG1 A;  2PU2 A;  2V20 A;  2ZQC A;  2Y2J A;  1W5D A;  4DXB A;  5J8X A;  3UE0 A;  1XP4 A;  2C6W B;  3IQA A;  3DTM A;  1L0G A;  4OOL A;  1ERQ A;  4L0L A;  1MWU A;  2ZC6 B;  5GLD A;  1H5X A;  3ZGA B;  1NYM A;  1W8Y A;  1VM1 A;  4MBH A;  2XK1 A;  3OPP A;  4PM5 A;  1MWS A;  5FQI A;  1PWC A;  5EOO A;  2XR0 A;  1CK3 A;  2HDQ A;  1SKF A;  1EWZ A;  4R3B A;  4ZAM A;  2HDS A;  5E2E A;  4WMC D;  4EBN A;  1ONG A;  5IHV A;  2Y2L A;  1RP5 A;  4GNU A;  1PWD A;  3RJU A;  4GDB A;  4YIN A;  3FWL A;  3HLF A;  3SS3 A;  3O88 A;  4OKP A;  5FQQ A;  4LCM A;  5A92 A;  1IEL A;  1YLT A;  1FQG A;  4RYE A;  4LV2 A;  3V50 A;  2WKE A;  4DXC A;  3BM6 A;  1PYY A;  2WGI A;  1O07 A;  3LY3 A;  3SOI A;  4ZDX A;  1K54 A;  1IYQ A;  4B4X A;  3DW0 A;  1C3B A;  2EXB A;  2Y2N A;  3OPR A;  5EVI D;  3ZG9 B;  2WAF A;  1K38 A;  3RXW A;  1ES2 A;  1BLH A;  1HZO A;  5GLB A;  1K4E A;  5A90 A;  1L0E A;  5KSH A;  5FI7 A;  4DE3 A;  4QJG A;  1LI9 A;  4P0M A;  1HTZ A;  1FOF A;  1PZP A;  5G18 A;  1SDE A;  3IF6 A;  1WE4 A;  2XF3 A;  1PW1 A;  5KMW A;  4Y0U A;  2P9V A;  3M6B A;  1WYB A;  2WGV A;  3OCN A;  3P09 A;  1DJA A;  4NET A;  2GDN A;  5GHY A;  2ZQD A;  3Q82 A;  5GLC A;  2RL3 A;  1I2S A;  3S22 A;  3TG9 A;  5EOE A;  4WM9 A;  4R4S A;  5U47 A;  3UPO A;  3WS4 A;  3ZHH A;  2EFX A;  4PPR A;  4EBL A;  4HBT A;  1FR6 A;  1S6R A;  3SH9 A;  1FCM A;  1TVF A;  2JBF A;  2Q9M A;  3SS5 A;  4ZJ2 A;  1J9M A;  4LCL A;  1K56 D;  3N8L A;  4PM7 A;  1IYS A;  4RX3 A;  4JXV A;  3CG5 A;  4R3J A;  1CI8 A;  1RGZ A;  4KZ8 A;  4X69 A;  3LCE A;  1DJC A;  3BRM A;  3IXB A;  3UE3 A;  3WS5 A;  1JWZ A;  1ESU A;  3MZD A;  1E3U D;  3B3X A;  4IBX A;  5M18 A;  4RA7 A;  3LY4 A;  2X01 A;  3G4P A;  1CEF A;  4QY5 A; 
#chains in the Genus database with same CATH topology
 3IWI A;  1NY0 A;  1NXY A;  5AQ7 A;  3REJ D;  4N9K A;  5CPI B;  2J8Y A;  2BYM B;  4AWL C;  5IU1 A;  3WTP A;  4J8V C;  4N1H A;  3AZJ C;  4UEY A;  1AOI C;  4NZ4 A;  5HPI A;  2CV5 A;  2J3T C;  2JKF A;  5GXQ C;  3A0S A;  4NXG A;  5HAP A;  1D1J A;  3B6F D;  2HP6 A;  2QJ7 A;  3MXQ A;  1T19 A;  4X23 B;  4DRT A;  1XA7 A;  3KXB D;  4YFM A;  1M18 C;  1D7E A;  3HLC A;  3P5J B;  1I2W A;  2V8C A;  4Z5T D;  2J9O A;  2B02 A;  4EQI A;  3C8C A;  5EVI B;  1P3P D;  2VJW A;  4GCZ A;  5BO0 B;  3UTA C;  4X1M A;  1S67 L;  4YWZ A;  3CI6 A;  2VKS A;  3N4I A;  5CEC A;  2E8J A;  2M7V A;  1S1Z A;  3TU4 D;  4HOI A;  5E43 A;  4CQH A;  3O62 C;  5FAP A;  5C5K A;  2OV5 A;  3MVD D;  4LV0 A;  4Y13 A;  4GDN A;  2J80 A;  2G5I C;  3NQJ B;  2EWW A;  3FG8 A;  3IX8 A;  1P3O D;  1NYY A;  3X1V D;  2JHE A;  1OT9 A;  1XA1 A;  1LL5 A;  4KUK A;  3AZH C;  3B6G D;  1S32 D;  4IBB A;  3NBL A;  1ULY A;  4KHA A;  3MGP D;  1P3G B;  3B0C W;  1E6R A;  3LIA A;  4K0W A;  3MGR B;  5A8B A;  4UQI M;  2LY8 A;  3V67 A;  2FZ0 A;  3W99 D;  2QMI A;  4IUH A;  3C4O A;  2VA0 A;  2E8I A;  4X56 A;  4GH9 A;  1FSY A;  4E3J A;  3VOZ A;  1P3B A;  3BQA A;  1F66 A;  2RVQ C;  4MB5 A;  5B0Y A;  3AZL A;  1AIW A;  1E15 A;  1YLJ A;  2EA9 A;  1ZG6 A;  4R23 A;  1G5U A;  4QHC A;  4C3Q A;  3WA9 D;  4MMN A;  3AYW A;  2NZD D;  4MBK A;  4OON A;  4CLC D;  5HAR A;  4EBP A;  1TZY D;  4F3L A;  1P3A C;  5AV5 A;  1P34 C;  4J8W A;  3RFB A;  4WZ5 C;  3LR3 A;  2Y2M A;  4B88 A;  3UTB D;  3EQU A;  2DMW A;  4WU9 D;  4R8P C;  3HLE A;  4XZQ C;  1XPB A;  3EQV A;  5CER A;  5HW3 A;  3SH7 A;  1CF0 A;  4GHI A;  2Z2M B;  3MS6 A;  4N92 A;  4E3L A;  5CP6 B;  5CHU A;  2XFT A;  1GA9 A;  5FQJ A;  3W4P A;  4NE3 A;  1TEM A;  4NXE A;  3A6N C;  4EWF A;  5F82 A;  3MSH A;  5KSC A;  3AZM A;  1F5M A;  5EVL A;  1W63 Q;  2F8N D;  1E4D A;  2NUT C;  4HHD A;  2Y2O A;  1G6A A;  1HLU P;  4I3I A;  2PDR A;  1HD8 A;  3B0C T;  4BQM A;  5B1L D;  4H9O A;  5JRG A;  3AFA B;  1BT5 A;  5GSU B;  4BBT A;  3EEA A;  3GMW A;  3UT9 B;  3PAG A;  1E6Z A;  1TAF B;  3QP8 A;  4XUJ B;  3ZG8 B;  4F94 A;  3FKE A;  5B1M D;  3KWQ A;  4GW9 A;  1YAX A;  4Q8I A;  4MB4 A;  4BWI A;  1A7W A;  1JWP A;  4ZJ3 A;  1V9Y A;  2HF6 A;  4WEJ A;  4HES A;  3MGQ C;  5EM0 A;  3LEL B;  3VSK A;  3IX4 A;  4Z2M H;  5BNX A;  4R6L A;  1YSP A;  4S2N A;  5J4E A;  3C5A A;  3REI D;  1M19 A;  1F98 A;  1PNE A;  1M1A C;  4ZBE A;  3E4P A;  4JJN B;  2F2A C;  4H9N B;  3LJA A;  5AV6 A;  4P6Z S;  3IXH A;  4IBF A;  4J8U B;  3E98 A;  5F99 D;  2L5A A;  1XGI A;  2PBD P;  3G2Z A;  4WZS B;  4OOY A;  3VP0 A;  3C1C D;  1NRF A;  4M3K A;  3WAA A;  4OUI A;  4JGQ A;  1MZU A;  3REJ B;  4FH2 A;  5FEF A;  1BH8 B;  3CZD A;  4C75 A;  3BFF A;  1O7E A;  1FCO A;  1B67 A;  5B2J C;  5HL1 A;  2M1C A;  3UN7 A;  4MB3 A;  3BW6 A;  3MMH A;  2XEP A;  4QB8 A;  3PBT A;  3UDI A;  4EEU A;  3B6F B;  2EX6 A;  3NIA A;  3IHB A;  4WU8 C;  3MFD A;  4ETZ A;  3MGP A;  3KXB B;  1Q2P A;  1VQQ A;  4LD9 B;  2ZQ8 A;  1P3M D;  3CPT B;  2ZQ9 A;  4Z5T B;  2CMN A;  1IYP A;  3QP2 A;  4HBU A;  3DWK A;  1P3P B;  1P3L C;  4G3K A;  3LZ0 A;  4QLC C;  1WA9 A;  2ZQ7 A;  2JC7 A;  5GHZ A;  2EX2 A;  3MNN D;  4PKY A;  1H0I A;  3UMD A;  4H9Q B;  3A3D A;  5TFQ A;  4J8X D;  1G68 A;  1DJB A;  3TU4 B;  3AZJ A;  1U60 A;  2Q0O A;  1AOI A;  1T1A A;  4NZ3 A;  5DTS A;  3WA9 A;  5E2H A;  4IVI A;  1CEG A;  4WF0 A;  2VQR A;  4CLC A;  2QPN A;  3MVD B;  1K6R A;  1P3O B;  3X1V B;  1FR1 A;  3A3J A;  1L3L A;  2P04 A;  2ARO C;  4S2L A;  5HX9 A;  3PTE A;  4H8R A;  1XJ6 A;  3HLW A;  2EWV A;  4G91 B;  3B6G B;  3N6I A;  5AVC C;  1EQZ B;  4JXG A;  1S32 B;  4QY6 A;  3B33 A;  5B24 B;  2AVX A;  5CPI C;  5A93 A;  2WKI A;  1GOI A;  3UO9 A;  4MBF A;  3W99 B;  5B40 D;  3E2L A;  1BH9 A;  1KX5 C;  4OH0 A;  4GHL A;  2F8N A;  3AZN D;  3S7O A;  1BLP A;  2F8N K;  3AV1 C;  4YM6 C;  4HI4 A;  2IO5 C;  1AXB A;  3KYZ A;  2HJ9 C;  3GVB A;  2NZD B;  1N4O A;  4EET B;  3D9Y A;  1XXM A;  3ZQ5 A;  3LIE A;  1DP6 A;  3AZF C;  1TZY B;  2P9V B;  1P3K B;  3NJA A;  4Q0I A;  1IKI A;  4CAY B;  3UTB B;  1KGE A;  5BT1 D;  4WU9 B;  3AZG A;  1E6N A;  4H9P B;  2VZW A;  1ZG4 A;  5F1G A;  2XD1 A;  2BAS A;  4NYY A;  5FQM A;  2ZM8 A;  3LEQ A;  1ES5 A;  3GRJ A;  4O8G A;  1NWZ A;  2WZZ A;  3GDI A;  3MR0 A;  1GSW A;  3WTP C;  2WKP A;  3AGD A;  5AVB B;  5CPK D;  2CV5 C;  3N8S A;  5BS7 A;  1D06 A;  3M6H A;  3AZI D;  4I39 A;  1P34 A;  1TS6 A;  3W4Q A;  3EEH A;  4IUK A;  2BG1 A;  2V20 A;  2ZQC A;  4R8P A;  3KO6 A;  5B1L B;  4XZQ A;  3L2A A;  4MN6 A;  5B31 D;  3UE0 A;  1P3F D;  3G6O A;  2C6W B;  3IQA A;  3IX3 A;  1KX3 B;  4OOL A;  5GLD A;  4NFT A;  1W8Y A;  4PM5 A;  3LIF A;  4EQ1 A;  3C1B B;  5FQI A;  5AY8 A;  2Y8H A;  5B0Z D;  1EWZ A;  4KUO A;  5B1M B;  5E2E A;  3VOL A;  5IHV A;  4MCW A;  5AV9 A;  4X23 D;  5KDM B;  3SW1 A;  5A92 A;  4LCM A;  4WUJ A;  1IEL A;  3AN2 D;  3V50 A;  2WKE A;  2GZA A;  2VGL S;  3O5Y A;  3SOI A;  1IYQ A;  1ID3 D;  4Z1W A;  2EXB A;  5EVI D;  3ZG9 B;  3KS8 A;  4HMD A;  1V9Z A;  1L0E A;  1LI9 A;  4Z2I A;  1HTZ A;  1ZLA B;  4Y17 A;  4XT2 A;  2A2L A;  3REI B;  3X1S C;  2ZY4 A;  1PW1 A;  4Y0U A;  4HP4 A;  2KOI A;  3P09 A;  1DJA A;  3T1X A;  5HWV A;  3W96 D;  3IP4 C;  5EOE A;  1OTI A;  2A24 A;  5U47 A;  3UPO A;  3ZHH A;  5GT3 D;  4J8X A;  1S6R A;  3SH9 A;  5B0Y C;  4NKP A;  3REH D;  3VE4 A;  1FCM A;  1TVF A;  3C1C B;  2B18 A;  1BFM A;  3F1P B;  3AYW C;  4G92 B;  3AFA C;  1K56 D;  4IBJ A;  5B32 A;  5AV5 C;  1M1A A;  4X69 A;  4J8W C;  4IBX A;  3G4P A;  4XUJ C;  3CMZ A;  4BD0 A;  3W98 A;  4P85 A;  5CED A;  4U3T A;  2ZY3 A;  1S1Y A;  4H9S C;  3BFE A;  3UDX A;  2IWD A;  2Y59 A;  4S2I A;  5HWW A;  5FUG B;  4X68 A;  2FH5 A;  3Q07 A;  3T1Q B;  1P3M B;  5G4Y A;  4QNL A;  3KSY A;  3DAV A;  1U35 B;  5HAI A;  3AZM C;  1PIO A;  2VK3 A;  4NZ5 A;  3MNN B;  2PU4 A;  4DDY A;  2YFW A;  2PYP A;  2YFV B;  1KE4 A;  2VGK A;  5JYP A;  3WS0 A;  3G34 A;  3OC2 A;  1XKZ A;  3UE6 A;  5JRG C;  4KZ9 A;  5CP6 D;  4WU8 A;  2Y91 A;  1IOU A;  5G49 B;  1SDN A;  3EG5 B;  3F1O A;  4J8U C;  3QHY A;  3HON A;  3MQL A;  2UWX A;  4Y7P A;  4YS3 D;  5DNM B;  2O9A A;  4FOF A;  5HSQ A;  1P3L A;  3KUY B;  2PD8 A;  1OME A;  1HQ3 A;  5G4Z A;  5DNN A;  3REJ C;  5DF7 A;  4P6B A;  4WEL A;  3IH8 A;  4GJ4 A;  3FC7 A;  2W8S A;  2DNS A;  4LEN A;  4UA6 A;  2QWS A;  5CGW A;  1W1V A;  3MQQ A;  5B40 B;  3I7J A;  5IT5 A;  3B6F C;  1S4R A;  5BNV B;  5E2G A;  3VP1 A;  3AZN B;  4KUD A;  4S2N C;  1P3I A;  2BYK A;  4IBK A;  4K91 A;  3KXB C;  3DWZ A;  1M19 C;  4NXB A;  5DKK A;  1GXD A;  3RXX A;  3AV2 A;  5HDS A;  2A3U A;  2DQN C;  2ARO A;  4AFI A;  5HZH A;  5B31 A;  4Z5T C;  3A3E A;  3T4K A;  3W97 D;  4ZUX B;  4DE2 A;  2XA7 S;  5CPI A;  3QP5 A;  2BYM A;  3IH9 A;  2PR6 A;  3TU4 C;  4LV3 A;  1FCN A;  5EFW A;  1P9W A;  3WAA C;  4X23 A;  4EUV A;  3MVD C;  4ME4 A;  3VP2 A;  4YM6 A;  5CRF A;  5EE8 A;  2WKH A;  3AZK D;  4DJ3 A;  1GPF A;  1LI0 A;  3LIB A;  5EVI A;  4H6J B;  5BO0 A;  3V39 A;  1MKI A;  5CPK B;  3A3I A;  2UV0 E;  5DFX A;  2RTS A;  3O87 A;  3KS4 A;  1S32 C;  1IEM A;  3AZI B;  5CGS A;  5CHJ A;  5GHX A;  3MGP C;  2ZM2 A;  4EXO A;  1KVL A;  1P3F B;  1YKD A;  4OQ0 A;  5F68 A;  2W1T B;  3W99 C;  3LZ0 C;  3PBQ A;  3PAE A;  3HJI A;  3ZNY A;  3H82 B;  3LFV A;  3UPP A;  3MBZ A;  1NLY A;  3NQJ A;  3V5M A;  5FDS A;  5B0Z B;  1P97 A;  1LT0 A;  2H0Y A;  4IBI A;  1I5Q A;  4L9F A;  4I5S A;  4EUZ A;  3WA9 C;  3NDE A;  2WAD A;  4HGA C;  1K56 A;  4O0P A;  4CLC C;  3MF0 A;  1TZY C;  5BOH A;  4GD8 A;  3M2J A;  4JF4 A;  3WTP E;  1P3G A;  4LD9 D;  2WZX A;  4H9R B;  3AN2 B;  3MGR A;  1KGF A;  1XX2 A;  3DTK A;  4BLM A;  1ID3 B;  4WU9 C;  1ZKJ A;  1W2E A;  2ZC5 B;  4P87 A;  1YUE A;  5TGF A;  5JYO A;  4R3A A;  2K31 A;  2K7S A;  1NRJ A;  3OLO A;  2OAQ 1;  3W96 B;  1YPR A;  2MJ6 A;  2R9W A;  4Z9Q A;  2ZD8 A;  5DF9 A;  1XGJ A;  1IKG A;  2LB5 A;  3HJK A;  2JCH A;  1DY6 A;  5GT3 B;  2L1M A;  3VP3 A;  2B95 A;  1CQA A;  3REH B;  1K4F A;  1E25 A;  4FH4 A;  5B1L C;  5FQK A;  2PYR A;  5GL9 A;  1EQZ D;  5CP6 A;  3F1N B;  1YU0 A;  5FAS A;  3AGF A;  1VEU B;  5B24 D;  3X1S A;  5GT0 B;  1KX4 D;  4KEN B;  4ESP A;  2PYO B;  1FIK A;  2ZJ9 A;  5AVE A;  4MN5 A;  1EI5 A;  2I9V A;  1KVM A;  4E3K A;  1YQS A;  4JXW A;  3AZG C;  1M40 A;  3B0D B;  2NQB B;  1ZTU A;  4N1X A;  5M1A A;  3C7V A;  3K3D A;  1CJF A;  5KIZ A;  3UB7 A;  3VH5 W;  4A5R A;  4KG2 A;  1YLP A;  3ZG7 B;  4E44 A;  4KQR A;  3AFA A;  3NCK A;  3EWK A;  1Z6F A;  5GSU A;  4QD4 A;  5CPJ B;  1H8M A;  5BS7 C;  3GTC A;  3AZE D;  1P3K D;  3UT9 A;  2H28 A;  5CEB A;  1YU4 A;  4RQ9 A;  1TAF A;  1N9B A;  4XUJ A;  4K0X A;  3V3R A;  2LB9 A;  3BEC A;  4H9S A;  4J8V D;  1S4S A;  4UQI S;  3QNB A;  1ESI A;  4KGC D;  2PBY A;  5AQB A;  1BLC A;  5GXQ D;  3MXR A;  2B5R A;  2BLS A;  1TD5 A;  4PM6 A;  3PR6 A;  5F99 C;  5AY8 C;  4YS3 B;  1BUL A;  4CSR B;  5CHM A;  3LEL A;  1KU5 A;  5AVB D;  3LUQ A;  1Z09 A;  5AV9 C;  3VFH A;  3TSG A;  5DJT A;  3UME A;  2W0N A;  3C4P A;  4JJN A;  1YT4 A;  4WEK A;  5FI2 A;  4H9N A;  2Q9N A;  1KX3 D;  3NQU B;  4ZBJ C;  1T1B A;  3EGX C;  3GSG A;  3UY6 A;  4J8U A;  5B33 D;  3O62 D;  3VH5 T;  3L9K A;  3C1B D;  4OJL A;  1T1C A;  5I5L A;  1L0D A;  2ZM5 A;  1Y28 A;  1P3B B;  4G3W A;  1E3U A;  4EO5 B;  1W1Y A;  1BZA A;  3DBA A;  4ZTK A;  3W97 B;  3AZH D;  3REJ A;  5FI6 A;  3UDF A;  1XJ2 A;  5C3I B;  2VEA A;  4J8X C;  3L25 A;  2HP5 A;  3IF6 B;  3REK D;  2H0T A;  4R70 A;  5L8M A;  3S4X A;  2P7J A;  4DE1 A;  4E3O A;  3X1U B;  3FPV A;  2FJ7 B;  3WKJ D;  1NZO A;  2EX8 A;  3B6F A;  3PBS A;  2OLU A;  2K2N A;  1ZLA D;  3KXB A;  4GHI B;  5B32 C;  1OTD A;  3CPT A;  3AZK B;  2YKH A;  4BJP A;  4Z5T A;  2D01 A;  5TR7 A;  3UPN A;  3WD1 A;  4Y0O A;  4GS9 B;  1P3P A;  3W98 C;  4Z2L A;  2DRW A;  1ES3 A;  2HUE B;  4RX2 A;  2HDR A;  2XD5 A;  2G2U A;  1G6O A;  4H9Q A;  4JGP A;  3T1S A;  4OQG A;  3MGS B;  3MZE A;  3G2Y A;  1P3A D;  4QPR A;  2XH9 A;  3RH8 B;  3JPU A;  3MQ0 A;  2H5S A;  2WUQ A;  3LGO A;  4UA7 A;  3TU4 A;  3ZG0 A;  4MLL A;  4CJN A;  2V1B A;  3N8R A;  4RVA A;  3H7W A;  5AVF A;  1K55 A;  2PU2 A;  3MVD A;  4TX8 A;  3OBF A;  4K08 A;  1W5D A;  3AZN C;  3H0R C;  2O99 A;  2XSS A;  3DTM A;  1L0G A;  3SZT A;  2WKQ A;  4Z66 D;  1P3O A;  2ZC6 B;  3EPH A;  3X1V A;  1H5X A;  1H0M A;  1VM1 A;  3C38 A;  4MBH A;  3OPP A;  3A6N D;  3B6G A;  3CUE A;  1N9O A;  1EQZ A;  3FPW A;  1S32 A;  1CK3 A;  1SKF A;  5B24 A;  4HIA A;  4R3B A;  5K5B A;  2HDS A;  1OTB A;  3BWL A;  3P01 A;  1H8P A;  4WMC D;  5HD3 A;  4GNU A;  4HJ4 A;  3RJU A;  4GDB A;  1U35 D;  3HLF A;  3W99 A;  3VH6 T;  3D3O A;  1E8B A;  1PZR A;  4RYE A;  3OOV A;  1HQ3 C;  5DNN C;  3REL B;  3DW0 A;  3OPR A;  2WAF A;  1K38 A;  1PRQ A;  2VLG A;  1BLH A;  5GLB A;  1K4E A;  5A90 A;  4HJ3 A;  2W3D A;  4DE3 A;  5G18 A;  3RTY A;  2XF3 A;  2NZD A;  2OAP 1;  4ETX A;  5FEG A;  5AV8 D;  5EM1 A;  1TZY A;  5CPK C;  2P9V A;  3ZYT A;  2WGV A;  3OCN A;  2KDK A;  3B42 A;  3Q82 A;  4KUD C;  1P3I C;  1OPX A;  5B2I B;  4UPK A;  4CAY A;  5DNM D;  3WD2 A;  3UTB A;  3S22 A;  4BBU A;  3TG9 A;  3AV2 C;  4WU9 A;  1H3O B;  2W1R A;  4H9P A;  4UUZ A;  5B31 C;  3IS2 B;  4CLC E;  1P3F C;  3KUY D;  2FN2 A;  4Y15 A;  1FR6 A;  4NEE D;  1KX4 B;  3JVV A;  4DQY B;  4D60 A;  3N3F A;  4LG2 A;  4ZJ2 A;  5AVB A;  3LCE A;  3BRM A;  2GJ3 A;  1ESU A;  3B3X A;  2X01 A;  4X23 C;  1CEF A;  2JSS A;  3PYP A;  2JE5 A;  4R1G A;  3G32 A;  5E5A B;  4EW7 A;  1QO6 A;  2QKP A;  5B1L A;  3AN2 C;  3UB6 A;  3FKV A;  3R45 B;  2V5O A;  3NUL A;  1W1P A;  1KX3 A;  1K57 C;  5EVI C;  3X1T B;  5BPV A;  4FSF A;  1PWG A;  4ZUX D;  4NYU A;  3AZE B;  2J7V A;  1JTG A;  3C1B A;  4PHT A;  4BBV A;  3V3S A;  5B1M A;  4J8V B;  2V1A A;  4KGC B;  2W27 A;  5GXQ B;  2C5W B;  5KDM A;  1N9L A;  2ZBB A;  3HLB A;  5GT3 C;  4HP9 A;  4KZ4 A;  1LL9 A;  2VGJ A;  1M18 B;  3REH C;  1W7F A;  2ZC7 A;  1ED7 A;  1BLS A;  2XQZ A;  1K6S A;  2JKR I;  2OSU A;  1L6J A;  1ZLA A;  3UTA B;  3TE8 A;  4QLC D;  4ARZ B;  3REI A;  1ZC2 A;  5M19 A;  2EFU A;  4LV1 A;  4IBE A;  3FDD A;  5AQA A;  1P3G C;  3EOI A;  5CGX A;  5CXW A;  3MGR C;  1SKO B;  4S2O A;  4HME A;  4E3N A;  4ID4 A;  4GKU A;  4BD1 A;  3V9R B;  4R4R A;  3P7N A;  1LLB A;  5B33 B;  4KG6 A;  3O62 B;  5DFY A;  5F99 A;  5L10 A;  1STZ A;  2O9B A;  4XUX A;  5L2F A;  3ZVW A;  3C1C A;  5DJU A;  2ZMF A;  5F69 A;  1GCE A;  2ZC4 B;  3F1P A;  1F9I A;  4KZB A;  3AZH B;  3QNC A;  5AVC D;  5F6A A;  3MKE A;  2HDU A;  1XJ4 A;  3S1Y A;  3REK B;  1PI5 A;  2H10 A;  4B93 A;  3WKJ B;  4Z2G A;  1CI9 A;  1WWS A;  3LZ1 D;  4S2P A;  3U4L P;  4XUZ A;  5CP6 C;  4MDZ A;  5FUG A;  1P3M A;  2A49 A;  2XLN A;  5TBM B;  4E6X A;  3IWQ A;  2HGV A;  3AV1 D;  1U35 A;  2Z6C A;  1JVJ A;  3HL9 A;  3R4K A;  1GHI A;  5LBR A;  4EER A;  3MNN A;  3AZF D;  5JA4 B;  1P3A B;  3K2N A;  2YFV A;  1AWI A;  4NXF A;  4M4X A;  4IED A;  3NOP C;  3L26 A;  4L9G A;  3DTE A;  2HIO D;  5GSU C;  3OCL A;  3Q1F A;  1MXO A;  5G49 A;  4FUW A;  5GT0 D;  3T4Q A;  2PYO D;  2HPB A;  4Y5F A;  3UT9 C;  2PT7 A;  3G35 A;  5DNM A;  5I94 A;  4Z66 B;  2D02 A;  3LR4 A;  3Q7V B;  3G30 A;  3WWX A;  1N1J B;  4OLG A;  5DTT A;  3A6N B;  2NQB D;  4KZ3 A;  4OP5 A;  4EO5 C;  2V1Z A;  4OPQ A;  3NDG A;  2PR5 A;  1CXW A;  5CTM A;  3WD3 A;  1MPL A;  2HZ5 A;  4OJ6 A;  3ITA A;  1IFQ A;  3SS4 A;  4EV4 A;  2OOL A;  1GA0 A;  3NEC A;  4FTX A;  5B40 A;  3LEL C;  1PFL A;  5CPJ D;  4GZB A;  5BNV A;  4OPR A;  4E3M A;  3AZN A;  3ZNT A;  2IOU A;  3IWO A;  3AZK C;  5MC7 A;  4JJN C;  1OGG A;  5FDH A;  2Y2Q A;  2EX9 A;  5AV8 B;  2HUE C;  1OJG A;  4ZUX A;  3HRE A;  3T4J A;  2WAE A;  5J7E A;  4S2M A;  5HWT A;  1ERM A;  3AL0 C;  4UA9 A;  3OPH A;  3MGQ B;  1Q2Q A;  3BQ8 A;  3CHW P;  3P98 A;  1YLZ A;  1CK7 A;  2ZM0 A;  4LLO B;  4Y3I A;  4DJ2 A;  1H3Q A;  3VMA A;  2ZOH A;  1P9R A;  4H6J A;  4PAU A;  3LI9 A;  5CPK A;  2WGW B;  2I72 A;  4JF6 A;  3NC8 A;  1BSG A;  3AZI A;  1OT6 A;  5E2F A;  5TJJ A;  3GR2 A;  3ULF A;  4WNN B;  4LD9 C;  1PW8 A;  3ZG5 A;  2ZQA A;  1P3B D;  1F66 D;  1P3F A;  2BTF P;  3AZL D;  3KFU G;  3R7W B;  1K25 A;  2W1T A;  1P3P C;  4KZ6 A;  3H82 A;  4Z2H A;  3AYW D;  5F1F A;  4M6B A;  2KX6 A;  3F6T A;  4NG2 A;  3S7Q A;  3PBN A;  5B0Z A;  3HSH A;  3E4Q A;  3H0L C;  5AV5 D;  2ZL1 B;  3VV4 A;  5CHL B;  3X1U D;  1MBL A;  4J8W D;  3UNW A;  2FJ7 D;  3CAX A;  5B2J B;  1RGY A;  3FYZ A;  3O86 A;  1K55 C;  1YLW A;  1H0G A;  4WU8 B;  4H9R A;  3AN2 A;  1P3O C;  1ID3 A;  3X1V C;  3QP1 A;  3HCY A;  1K57 A;  5J3W A;  4NY2 A;  3IBJ A;  3BLS A;  4C6Y A;  1GSV A;  4G91 C;  3B6G C;  2XRN A;  3A0R A;  3CUE C;  1EQZ C;  3MXS A;  5FAQ A;  4WLA A;  4QLC B;  3MGS D;  2VV6 A;  5B24 C;  3NOU C;  3ZDJ A;  1KX4 C;  4X53 A;  5HPF A;  1N9N A;  1J3W A;  1SCW A;  3W96 A;  1GHM A;  4DRA A;  1MWT A;  1TDL A;  1SHV A;  1VET B;  3BY9 A;  5GT3 A;  4WN5 A;  5EPH A;  1S0W A;  2RCX A;  3REH A;  1M6K A;  1JFI B;  3SH8 A;  4PMA A;  2CWE A;  1PI4 A;  1T3U A;  3T1R A;  2HV1 A;  2NZD C;  2J9P A;  3F1N A;  4IJF A;  3KWQ D;  1VEU A;  5GT0 A;  5AVC B;  2PYO A;  1P3K C;  4OOM A;  1Z2C B;  3UTB C;  3KSF A;  4GD6 A;  4GHA A;  2NQB A;  4ZRR A;  3LZ1 B;  1KDS A;  3T50 A;  3CLO A;  4KGC C;  1KX5 B;  2Y55 A;  3REL D;  4MEZ A;  4HH3 A;  1UR9 A;  3KSG A;  1KGG A;  3WRT A;  3CWF A;  1OTA A;  2IA2 A;  3HLD A;  3PBO A;  1M19 D;  4HJ6 A;  1PZO A;  3AV1 B;  4NZ1 A;  4YM6 B;  2IO5 B;  5KZH A;  1W63 M;  2WKR A;  1YLY A;  3A3F A;  5AVB C;  1JWV A;  1W79 A;  4JPM A;  3WX7 A;  5CPJ A;  4UHU A;  4N9L A;  4HH2 A;  3LJA D;  3AZF B;  5D3O A;  5AV6 D;  3IF5 A;  1X0O A;  5B2I D;  3LO7 A;  3HUO A;  4HQA A;  1NJ4 A;  4R0Q A;  1QMF A;  5FL3 A;  1LSX A;  2PD7 A;  2ZC3 B;  2Y4A A;  3EPL A;  4Q0J A;  1H8Z A;  5HAQ A;  3PHY A;  3BY8 A;  1J7M A;  1KX3 C;  2HIO B;  3WS2 A;  3BJN A;  5FSR A;  3JVU A;  3BFG A;  2Y2P A;  2V0U A;  3VH5 A;  3WAA D;  2Y2I A;  5B33 C;  3BLM A;  3IHA A;  5FAO A;  3C1B C;  4YS3 A;  2YKF A;  4WV4 B;  4CSR A;  1LSV A;  3A0V A;  3L28 A;  5J8X A;  5B1M C;  3WTP B;  2W3E A;  1ERQ A;  2CV5 B;  1NYM A;  3A1K A;  5E5A D;  3LYX A;  3REK C;  2HDQ A;  3NQU A;  3WKJ C;  1TS8 A;  3X1T D;  3MFX A;  1ONG A;  2G7U A;  2Y2L A;  2GX5 A;  1RP5 A;  1ODV A;  1ZLA C;  3LZ0 D;  1PWD A;  4YIN A;  3FWL A;  3REI C;  3EPJ A;  4X25 A;  3O88 A;  5FQQ A;  1YLT A;  2M7U A;  4LV2 A;  2VX8 A;  1PYY A;  4ZDX A;  1K54 A;  2ZY5 A;  4B4X A;  3AZJ D;  1AOI D;  3RXW A;  2J3T D;  1HZO A;  3W97 A;  2JKT I;  5KSH A;  4QJG A;  4IBG A;  1PZP A;  1SDE A;  2INW A;  3IF6 A;  3UB8 A;  1PDC A;  1M18 D;  3X1U A;  1VHM A;  3M6B A;  2FJ7 A;  3C1C C;  2GDN A;  2ZQD A;  2P08 A;  1O6I A;  4G92 C;  5HDD A;  4LRY C;  3UTA D;  1YU2 A;  3MJQ A;  1OTE A;  3AZK A;  4PPR A;  4EBL A;  4KHA B;  3X1S B;  4MN7 A;  4Z66 C;  4GS9 A;  2QYB A;  2Q9M A;  3SS5 A;  4LCL A;  1E88 A;  3MGS A;  2ACG A;  4JXV A;  3CG5 A;  1CI8 A;  1RGZ A;  1DJC A;  1P3M C;  3WS5 A;  1JWZ A;  5M18 A;  2JKG A;  1F66 B;  4WJ3 C;  4Z2M G;  2W3F A;  5B0Y B;  3AZL B;  4QY5 A;  3VH6 A;  1U35 C;  1Y54 A;  2W3G A;  4DDS A;  1KDW A;  5DTK A;  3AYW B;  3MNN C;  1KS0 A;  2G5H C;  1BH8 A;  3UE1 A;  2VV7 A;  4F3L B;  2Y2K A;  2Z6D A;  5AV5 B;  1NZU A;  5L09 A;  4J8W B;  3EGD C;  3VH6 W;  4L9E A;  4LGW A;  2Y79 A;  4IVK A;  4P6Z M;  3AZG D;  5AV8 C;  2XFS A;  2R9X A;  4S2K A;  4LD9 A;  2Z2L B;  4QWO A;  4GB7 A;  3BEB A;  2RVQ D;  5DNM C;  3NY4 A;  2Y2H A;  1A0K A;  3TW8 A;  2PRF A;  2XGN A;  3IBR A;  3WD0 A;  3KUY C;  4OJ5 A;  1XFQ A;  4KQD A;  4KZA A;  3ZVT A;  1RCJ A;  4PKY G;  3AZM B;  1T18 A;  1WYC A;  2ZMV A;  3REL A;  5DKL A;  3VE3 A;  3FKW A;  3UB9 A;  4X55 A;  1P34 D;  3M2K A;  4R8P D;  4JKT A;  4H9O B;  5B40 C;  4XZQ D;  1B6W A;  1EAK A;  1MY8 A;  2V9A A;  5JRG B;  3BFD A;  5HD5 A;  3O3V A;  3HUM A;  4MNR A;  5B2I A;  1MWR A;  1VB6 A;  3LR5 A;  5CTN A;  4WL9 A;  1H3O A;  1HVB A;  4B4Z A;  3IS2 A;  5AY8 D;  4BEN A;  2JKR M;  4IJE A;  4DKI A;  2V0W A;  5F5Y A;  3KWQ B;  1OGB A;  4ZUX C;  1KX4 A;  4E6W A;  4OLD A;  5AV9 D;  4JLF A;  1XFN A;  1KE3 A;  1HTA A;  4O7D A;  3G31 A;  1UWP X;  5BT1 C;  3JYI A;  2CC1 A;  5HFO A;  4OJP A;  1L2S A;  2F8N G;  4E45 A;  4D2O A;  2HJE A;  5BNX B;  3E0Y A;  1LSW A;  4KZ5 A;  5E5A A;  1UWN X;  4BL2 A;  4IBR A;  3R45 A;  1M19 B;  1UGU A;  5EV0 A;  4DE0 A;  3X1T A;  4BL3 A;  3QP4 A;  2WYX A;  3LR0 A;  3WS1 A;  3AZE A;  1P3K A;  3AZI C;  3LJA B;  4O01 A;  5AV6 B;  4ZJ1 A;  2V2F F;  4GLQ A;  1DRM A;  4KZ7 A;  4J8V A;  3MGQ D;  4KGC A;  2W3H A;  1F2K A;  2G2W A;  3GQZ A;  5GXQ A;  3MKF A;  3CJM A;  3H7W B;  4OQI A;  3WAA B;  2OLV A;  2OWJ A;  3BYD A;  4EU0 A;  4JXS A;  5B0Z C;  1QME A;  3KSI A;  5B32 D;  3H9W A;  3KYQ A;  1M18 A;  1M1A D;  3E4O A;  3PBR A;  4WBG A;  3T12 B;  2F8N H;  1Y4O A;  1ALQ A;  2NUP C;  4FCF A;  2QJ5 A;  4LPZ A;  4OP8 A;  2Y2G A;  3W98 D;  2ZMA A;  3UTA A;  4ARZ A;  3NOT C;  1YMX A;  1ONH A;  3B47 A;  3KX0 X;  3MGP B;  1SKO A;  5GLA A;  2ZOI A;  4I3J A;  4Q0H A;  1ID3 C;  4DMZ A;  2V8F A;  3V9R A;  3LZ1 C;  1BTL A;  5EUA A;  1ZHH B;  4LRX C;  5B33 A;  3O62 A;  3LZ0 B;  5FAT A;  4GOG A;  3CIT A;  3NI9 A;  1W8Q A;  4JF5 A;  5DVA A;  4AWL B;  3OZH A;  4LRZ E;  5B2J D;  3GEC A;  3W96 C;  3AZJ B;  4BMW A;  1AOI B;  4E04 A;  2DF4 C;  4QU3 A;  3WA9 B;  3AZH A;  4U0T A;  4HGA B;  1S66 L;  4WU8 D;  4CLC B;  4HNB A;  3IXD A;  3REK A;  3VP4 A;  3VFF A;  1ES4 A;  4NK3 A;  2XDM A;  3WKJ A;  3HLG A;  3TOI A;  1JTD A;  1YU3 A;  3EPK A;  1FSW A;  3E2K A;  3MQO A;  4WZ4 A;  4X6T A;  4E3I A;  2HIO C;  4UAA A;  4UUZ B;  1P3L D;  2QZ6 A;  5GT0 C;  2L0W A;  2PYO C;  4KQO A;  2X02 A;  1HQ3 D;  5TBM A;  4GN2 A;  5DNN D;  1EW0 A;  3WRZ A;  5DF8 A;  5AQ9 A;  2HP9 A;  3B0D C;  2NQB C;  1JNU A;  4OPY A;  4DN0 A;  4OVD A;  1BH9 B;  5JA4 A;  1P3A A;  2F8N B;  5EEC A;  2FFY A;  3Q81 A;  4KUD D;  2VGL M;  1P3I D;  3IT9 A;  4WZ5 A;  4U0X A;  1ERO A;  3GV9 A;  3ISG A;  3N7W A;  3AV2 D;  3T4O A;  2ARO D;  1TDG A;  3K3C A;  5CPJ C;  3PXP A;  1MC0 A;  5B32 G;  1OJ5 A;  2GNX A;  4IJG A;  2RIQ A;  2DCF A;  4Z66 A;  1YMS A;  4FD8 A;  2ZLY A;  5CPI D;  3Q7V A;  2FFF B;  4LFU A;  1TS7 A;  4HEF A;  1N1J A;  2XRO A;  3A6N A;  2P74 A;  1SZV A;  1TF1 A;  3HUN A;  2L4R A;  3AZG B;  1K0K A;  1KX5 D;  4Y2F A;  1GSX A;  5A91 A;  4DF6 A;  4WMC A;  4CPK A;  4II7 A;  4YS3 C;  1TS0 A;  4G3V A;  4YM6 D;  1DP8 A;  3C7U A;  1DP9 A;  5FA7 A;  3KSH A;  4KG5 A;  2X71 A;  1KE0 A;  4HMC A;  3S7N A;  4NE6 A;  1GHP A;  4S2J A;  1WWI A;  1G28 A;  1MKM A;  3A1I A;  3KYE A;  2JN7 A;  1BUE A;  1P34 B;  5HDC A;  4R8P B;  3ZCZ A;  4XZQ B;  5AV8 A;  2QHK A;  1YU1 A;  3LEZ A;  4PM9 A;  4EES A;  3HVF A;  4XXR A;  3W4O A;  2ZY2 A;  3FZC A;  1H8Y A;  3ITB A;  1P0Z A;  1P3B C;  1F66 C;  5F99 B;  5AY8 B;  3KUY A;  1YM1 A;  3L7H A;  3AZL C;  3T4S A;  2OWH A;  3WTP D;  1K54 C;  3UB5 P;  1NLZ A;  3FV7 A;  4DRB A;  3MGQ A;  4PM8 A;  2EXA A;  2CV5 D;  5HL6 A;  3W97 C;  5AV9 B;  5C3I C;  2PAV P;  3IF6 C;  3VSL A;  1P3G D;  4JGR A;  4Y0T A;  3X1U C;  2FJ7 C;  3MGR D;  2IWC A;  4YOF A;  2WGW A;  4ZBJ B;  3LID A;  3D4F A;  3MZF A;  3ZFZ A;  3ICY A;  4WNN A;  4HY8 A;  1UR8 A;  4JBF A;  4XT2 B;  4JGO A;  5B31 G;  4IBD A;  3R7W A;  1ACF A;  2J3W A;  2WK0 A;  4WYY A;  3AGE A;  5FQ9 A;  3MGS C;  1LHY A;  2A24 B;  1BYW A;  3W8K A;  2ZL1 A;  4IHQ A;  4OPZ A;  4J8X B;  3U2A A;  4OQH A;  5B2J A;  2J8P A;  4KQQ A;  3LIC A;  3BFC A;  1IYO A;  3DTI A;  3HBR A;  3OPL A;  2IWB A;  4B9O A;  1KOU A;  3C2W A;  5F83 A;  3VOY A;  3QP6 A;  3X1S D;  5B32 B;  1M1A B;  3LI8 A;  3Q7Z A;  1L0F A;  4I3A A;  3W98 B;  1F1E A;  3IXG A;  4QLC A;  3KWQ C;  5AJG A;  5IS1 A;  1E6P A;  2XA7 M;  1FIL A;  2Y2J A;  5CX7 A;  4DXB A;  1XP4 A;  3W2Z A;  3C30 A;  4L0L A;  5B0Y D;  1MWU A;  3ZGA B;  2PHY A;  3TJZ C;  4R38 A;  2XK1 A;  1MWS A;  4EEP A;  1VET A;  1PWC A;  5EOO A;  3AFA D;  2XR0 A;  5GSU D;  3WD4 A;  3REL C;  4ZAM A;  3D72 A;  2YFW B;  4EBN A;  3UT9 D;  1JFI A;  3M7P A;  2O9C A;  4XUJ D;  4OJO A;  3SS3 A;  3T4L A;  4OKP A;  3B0B A;  1FQG A;  4DXC A;  4IBC A;  5AVC A;  4NE5 A;  3BM6 A;  2WGI A;  4X1L A;  3LJA C;  1O07 A;  3LY3 A;  5AV6 C;  1LL8 A;  1Q9C A;  5B2I C;  1C3B A;  3F1O B;  2Y2N A;  3T4T A;  1ES2 A;  5FI7 A;  4P0M A;  1FOF A;  3LZ1 A;  1WE4 A;  1XJ3 A;  1P3L B;  3LEL D;  5KMW A;  3AZM D;  1R4V A;  1KX5 A;  1WYB A;  5GLC A;  4NET A;  5GHY A;  2R78 A;  3NHQ A;  3TRC A;  1HQ3 B;  5DNN B;  2RL3 A;  4YNR A;  1I2S A;  3H0M C;  3AV1 A;  1YSQ A;  4WM9 A;  4R4S A;  3S7P A;  4JJN D;  3WS4 A;  2EFX A;  3L27 A;  2JKT M;  5JRG D;  4HBT A;  2D49 A;  3AZF A;  4I38 A;  4Z2J A;  4J8U D;  2JBF A;  2KLI A;  5E5A C;  4KUD B;  1P3I B;  2BYK B;  1J9M A;  5L07 A;  3N8L A;  4PM7 A;  1IYS A;  1W1T A;  4RX3 A;  3AV2 B;  4R3J A;  2HIO A;  2ARO B;  2O0Y A;  2VV8 A;  5B31 B;  4KZ8 A;  3X1T C;  3IXB A;  3UE3 A;  3MZD A;  1E3U D;  4RA7 A;  3LY4 A;  3L29 A;  5EVE A;  3AZE C;  4Z2K A; 
#chains in the Genus database with same CATH homology
 3IWI A;  1NY0 A;  1NXY A;  5AQ7 A;  3REJ D;  4N9K A;  5CPI B;  2J8Y A;  2BYM B;  4AWL C;  3WTP A;  4J8V C;  4N1H A;  3AZJ C;  1AOI C;  4NZ4 A;  2CV5 A;  5GXQ C;  5HAP A;  2HP6 A;  3B6F D;  4X23 B;  4DRT A;  1XA7 A;  3KXB D;  4YFM A;  1M18 C;  3HLC A;  3P5J B;  1I2W A;  4Z5T D;  2J9O A;  4EQI A;  5EVI B;  1P3P D;  5BO0 B;  3UTA C;  3N4I A;  5CEC A;  3TU4 D;  5E43 A;  3O62 C;  5FAP A;  2OV5 A;  3MVD D;  4LV0 A;  4GDN A;  2G5I C;  3NQJ B;  1P3O D;  1NYY A;  3X1V D;  1XA1 A;  1LL5 A;  3AZH C;  3B6G D;  1S32 D;  4IBB A;  3NBL A;  1ULY A;  4KHA A;  3MGP D;  1P3G B;  3B0C W;  4K0W A;  3MGR B;  2LY8 A;  3W99 D;  2QMI A;  3C4O A;  2E8I A;  4X56 A;  4GH9 A;  1FSY A;  4E3J A;  3VOZ A;  1P3B A;  1F66 A;  2RVQ C;  5B0Y A;  3AZL A;  1YLJ A;  1ZG6 A;  4R23 A;  4QHC A;  4C3Q A;  3WA9 D;  3AYW A;  2NZD D;  4MBK A;  4OON A;  5HAR A;  4EBP A;  1TZY D;  1P3A C;  5AV5 A;  1P34 C;  4J8W A;  4WZ5 C;  2Y2M A;  4B88 A;  3UTB D;  3EQU A;  4WU9 D;  4R8P C;  3HLE A;  4XZQ C;  1XPB A;  3EQV A;  5CER A;  5HW3 A;  3SH7 A;  4E3L A;  2Z2M B;  4N92 A;  5CP6 B;  5CHU A;  2XFT A;  1GA9 A;  5FQJ A;  3W4P A;  4NE3 A;  1TEM A;  3A6N C;  4EWF A;  5F82 A;  5KSC A;  3AZM A;  5EVL A;  2F8N D;  1E4D A;  2Y2O A;  1G6A A;  1HD8 A;  3B0C T;  4BQM A;  5B1L D;  4H9O A;  5JRG A;  3AFA B;  1BT5 A;  5GSU B;  3GMW A;  3UT9 B;  3PAG A;  1TAF B;  4XUJ B;  3ZG8 B;  4F94 A;  3FKE A;  5B1M D;  3KWQ A;  4Q8I A;  1A7W A;  1JWP A;  4ZJ3 A;  4WEJ A;  4HES A;  3MGQ C;  3LEL B;  3VSK A;  4Z2M H;  5BNX A;  4S2N A;  3C5A A;  3REI D;  1M19 A;  1M1A C;  4ZBE A;  4JJN B;  2F2A C;  4H9N B;  3LJA A;  5AV6 A;  3IXH A;  4IBF A;  4J8U B;  5F99 D;  2L5A A;  1XGI A;  3G2Z A;  4WZS B;  4OOY A;  3VP0 A;  3C1C D;  1NRF A;  4M3K A;  3WAA A;  4OUI A;  3REJ B;  4FH2 A;  1BH8 B;  3CZD A;  4C75 A;  3BFF A;  1O7E A;  1FCO A;  1B67 A;  5B2J C;  5HL1 A;  3UN7 A;  2XEP A;  4QB8 A;  3PBT A;  3UDI A;  3B6F B;  2EX6 A;  3NIA A;  3IHB A;  4WU8 C;  3MFD A;  3MGP A;  3KXB B;  1Q2P A;  1VQQ A;  4LD9 B;  2ZQ8 A;  1P3M D;  2ZQ9 A;  4Z5T B;  1IYP A;  4HBU A;  3DWK A;  1P3P B;  1P3L C;  3LZ0 A;  4QLC C;  2ZQ7 A;  2JC7 A;  5GHZ A;  2EX2 A;  3MNN D;  4H9Q B;  3A3D A;  5TFQ A;  4J8X D;  1G68 A;  1DJB A;  3TU4 B;  3AZJ A;  1U60 A;  1AOI A;  4NZ3 A;  5DTS A;  3WA9 A;  5E2H A;  4IVI A;  1CEG A;  2VQR A;  2QPN A;  3MVD B;  1K6R A;  1P3O B;  3X1V B;  1FR1 A;  3A3J A;  2ARO C;  4S2L A;  5HX9 A;  3PTE A;  4H8R A;  3HLW A;  4G91 B;  3B6G B;  3N6I A;  5AVC C;  1EQZ B;  4JXG A;  1S32 B;  4QY6 A;  5B24 B;  5CPI C;  5A93 A;  2WKI A;  3UO9 A;  4MBF A;  3W99 B;  5B40 D;  3E2L A;  1BH9 A;  1KX5 C;  4OH0 A;  4GHL A;  2F8N A;  3AZN D;  1BLP A;  2F8N K;  3AV1 C;  4YM6 C;  2IO5 C;  1AXB A;  3GVB A;  2NZD B;  1N4O A;  1XXM A;  3AZF C;  1TZY B;  2P9V B;  1P3K B;  1IKI A;  4CAY B;  3UTB B;  1KGE A;  5BT1 D;  4WU9 B;  3AZG A;  4H9P B;  1ZG4 A;  5F1G A;  2XD1 A;  4NYY A;  5FQM A;  2ZM8 A;  1ES5 A;  3GRJ A;  2WZZ A;  3WTP C;  3AGD A;  5AVB B;  5CPK D;  2CV5 C;  3N8S A;  5BS7 A;  3M6H A;  3AZI D;  1P34 A;  3W4Q A;  2BG1 A;  2V20 A;  2ZQC A;  4R8P A;  5B1L B;  4XZQ A;  3L2A A;  5B31 D;  3UE0 A;  1P3F D;  2C6W B;  3IQA A;  1KX3 B;  4OOL A;  5GLD A;  4NFT A;  1W8Y A;  4PM5 A;  3C1B B;  5FQI A;  5AY8 A;  5B0Z D;  1EWZ A;  5B1M B;  5E2E A;  5IHV A;  5AV9 A;  4X23 D;  5KDM B;  5A92 A;  4LCM A;  1IEL A;  3AN2 D;  3V50 A;  2WKE A;  3SOI A;  1IYQ A;  1ID3 D;  2EXB A;  5EVI D;  3ZG9 B;  3KS8 A;  1L0E A;  1LI9 A;  1HTZ A;  1ZLA B;  3REI B;  3X1S C;  2ZY4 A;  1PW1 A;  4Y0U A;  3P09 A;  1DJA A;  3W96 D;  3IP4 C;  5EOE A;  5U47 A;  3UPO A;  3ZHH A;  5GT3 D;  4J8X A;  1S6R A;  3SH9 A;  5B0Y C;  3REH D;  1FCM A;  1TVF A;  3C1C B;  1BFM A;  3AYW C;  4G92 B;  3AFA C;  1K56 D;  4IBJ A;  5B32 A;  5AV5 C;  1M1A A;  4X69 A;  4J8W C;  4IBX A;  3G4P A;  4XUJ C;  3CMZ A;  4BD0 A;  3W98 A;  4P85 A;  5CED A;  4U3T A;  2ZY3 A;  4H9S C;  3BFE A;  3UDX A;  2IWD A;  2Y59 A;  4S2I A;  5FUG B;  4X68 A;  3Q07 A;  1P3M B;  4QNL A;  3KSY A;  1U35 B;  5HAI A;  3AZM C;  1PIO A;  4NZ5 A;  3MNN B;  2PU4 A;  4DDY A;  2YFW A;  2YFV B;  1KE4 A;  2VGK A;  5JYP A;  3WS0 A;  3G34 A;  3OC2 A;  1XKZ A;  5JRG C;  4KZ9 A;  5CP6 D;  4WU8 A;  2Y91 A;  5G49 B;  1SDN A;  3EG5 B;  4J8U C;  3QHY A;  3HON A;  2UWX A;  4Y7P A;  4YS3 D;  5DNM B;  1P3L A;  3KUY B;  1OME A;  1HQ3 A;  5DNN A;  3REJ C;  5DF7 A;  4P6B A;  4WEL A;  3IH8 A;  2W8S A;  2DNS A;  4LEN A;  4UA6 A;  5CGW A;  5B40 B;  3I7J A;  3B6F C;  5E2G A;  5BNV B;  3VP1 A;  3AZN B;  4KUD A;  4S2N C;  1P3I A;  2BYK A;  4IBK A;  4K91 A;  3KXB C;  3DWZ A;  1M19 C;  3RXX A;  3AV2 A;  2A3U A;  2DQN C;  2ARO A;  5B31 A;  4Z5T C;  3A3E A;  3W97 D;  4ZUX B;  4DE2 A;  5CPI A;  2BYM A;  3IH9 A;  3TU4 C;  4LV3 A;  1FCN A;  3WAA C;  4X23 A;  3MVD C;  3VP2 A;  4YM6 A;  5CRF A;  5EE8 A;  2WKH A;  3AZK D;  1LI0 A;  5EVI A;  5BO0 A;  3V39 A;  1MKI A;  5CPK B;  3A3I A;  3O87 A;  3KS4 A;  1S32 C;  1IEM A;  3AZI B;  5CGS A;  5CHJ A;  5GHX A;  3MGP C;  2ZM2 A;  1KVL A;  1P3F B;  4OQ0 A;  3W99 C;  3LZ0 C;  3PBQ A;  3PAE A;  3ZNY A;  3UPP A;  3MBZ A;  3NQJ A;  3V5M A;  5B0Z B;  2H0Y A;  4IBI A;  1I5Q A;  4EUZ A;  3WA9 C;  3NDE A;  2WAD A;  4HGA C;  1K56 A;  1TZY C;  5BOH A;  4GD8 A;  3M2J A;  4JF4 A;  3WTP E;  1P3G A;  4LD9 D;  2WZX A;  4H9R B;  3AN2 B;  3MGR A;  1KGF A;  1XX2 A;  4BLM A;  1ID3 B;  4WU9 C;  1ZKJ A;  1W2E A;  2ZC5 B;  4P87 A;  1YUE A;  5TGF A;  5JYO A;  3W96 B;  2R9W A;  4Z9Q A;  2ZD8 A;  5DF9 A;  1XGJ A;  1IKG A;  2JCH A;  1DY6 A;  5GT3 B;  3VP3 A;  3REH B;  1K4F A;  1E25 A;  4FH4 A;  5B1L C;  5FQK A;  5GL9 A;  1EQZ D;  5CP6 A;  1YU0 A;  5FAS A;  3AGF A;  5B24 D;  3X1S A;  5GT0 B;  1KX4 D;  4KEN B;  2PYO B;  2ZJ9 A;  1EI5 A;  1KVM A;  4E3K A;  1YQS A;  4JXW A;  3AZG C;  1M40 A;  3B0D B;  2NQB B;  4N1X A;  5M1A A;  3C7V A;  3VH5 W;  4A5R A;  4KG2 A;  1YLP A;  3ZG7 B;  4E44 A;  4KQR A;  3AFA A;  3NCK A;  1Z6F A;  5GSU A;  4QD4 A;  5CPJ B;  5BS7 C;  3GTC A;  3AZE D;  1P3K D;  3UT9 A;  5CEB A;  1YU4 A;  1TAF A;  1N9B A;  4XUJ A;  4K0X A;  3V3R A;  3BEC A;  4H9S A;  4J8V D;  3QNB A;  1ESI A;  4KGC D;  2PBY A;  5AQB A;  1BLC A;  5GXQ D;  3MXR A;  2B5R A;  2BLS A;  4PM6 A;  5F99 C;  5AY8 C;  4YS3 B;  1BUL A;  4CSR B;  5CHM A;  3LEL A;  1KU5 A;  5AVB D;  5AV9 C;  3VFH A;  3TSG A;  3C4P A;  4JJN A;  1YT4 A;  4WEK A;  5FI2 A;  4H9N A;  2Q9N A;  1KX3 D;  3NQU B;  4ZBJ C;  3GSG A;  3UY6 A;  4J8U A;  5B33 D;  3O62 D;  3VH5 T;  3C1B D;  4OJL A;  1L0D A;  2ZM5 A;  1P3B B;  1E3U A;  4EO5 B;  1BZA A;  4ZTK A;  3W97 B;  3AZH D;  3REJ A;  5FI6 A;  3UDF A;  5C3I B;  4J8X C;  3L25 A;  2HP5 A;  3IF6 B;  3REK D;  2H0T A;  3S4X A;  4DE1 A;  4E3O A;  3X1U B;  2FJ7 B;  3WKJ D;  1NZO A;  2EX8 A;  3B6F A;  3PBS A;  2OLU A;  1ZLA D;  3KXB A;  5B32 C;  3AZK B;  4BJP A;  4Z5T A;  5TR7 A;  3UPN A;  4Y0O A;  1P3P A;  3W98 C;  2DRW A;  1ES3 A;  2HUE B;  4RX2 A;  2HDR A;  2XD5 A;  2G2U A;  4H9Q A;  4OQG A;  3MGS B;  3MZE A;  3G2Y A;  1P3A D;  2XH9 A;  4UA7 A;  2H5S A;  2WUQ A;  3TU4 A;  3ZG0 A;  4MLL A;  4CJN A;  3N8R A;  4RVA A;  1K55 A;  2PU2 A;  3MVD A;  1W5D A;  3AZN C;  3H0R C;  1L0G A;  3DTM A;  4Z66 D;  1P3O A;  2ZC6 B;  3EPH A;  3X1V A;  1H5X A;  1VM1 A;  4MBH A;  3OPP A;  3A6N D;  3B6G A;  1EQZ A;  1S32 A;  1CK3 A;  1SKF A;  5B24 A;  4R3B A;  2HDS A;  4WMC D;  4GNU A;  3RJU A;  4GDB A;  1U35 D;  3HLF A;  3W99 A;  3VH6 T;  1PZR A;  4RYE A;  1HQ3 C;  5DNN C;  3REL B;  3DW0 A;  3OPR A;  2WAF A;  1K38 A;  5GLB A;  1BLH A;  1K4E A;  5A90 A;  4DE3 A;  5G18 A;  2XF3 A;  2NZD A;  5AV8 D;  1TZY A;  5CPK C;  2P9V A;  2WGV A;  3OCN A;  3Q82 A;  4KUD C;  1P3I C;  5B2I B;  4UPK A;  4CAY A;  5DNM D;  3UTB A;  3S22 A;  3TG9 A;  3AV2 C;  4WU9 A;  1H3O B;  4H9P A;  4UUZ A;  5B31 C;  1P3F C;  3KUY D;  1FR6 A;  1KX4 B;  4DQY B;  3N3F A;  4LG2 A;  4ZJ2 A;  5AVB A;  3LCE A;  3BRM A;  1ESU A;  3B3X A;  2X01 A;  4X23 C;  1CEF A;  2JSS A;  2JE5 A;  4R1G A;  3G32 A;  5E5A B;  5B1L A;  3AN2 C;  3FKV A;  3R45 B;  1KX3 A;  1K57 C;  5EVI C;  3X1T B;  5BPV A;  4FSF A;  1PWG A;  4ZUX D;  4NYU A;  3AZE B;  2J7V A;  1JTG A;  3C1B A;  3V3S A;  5B1M A;  4J8V B;  4KGC B;  5GXQ B;  2C5W B;  5KDM A;  3HLB A;  5GT3 C;  4KZ4 A;  1LL9 A;  2VGJ A;  1M18 B;  3REH C;  1W7F A;  2ZC7 A;  1BLS A;  2XQZ A;  1K6S A;  2OSU A;  1ZLA A;  3UTA B;  4QLC D;  3REI A;  1ZC2 A;  5M19 A;  2EFU A;  4LV1 A;  4IBE A;  3FDD A;  5AQA A;  1P3G C;  5CGX A;  5CXW A;  3MGR C;  4S2O A;  4E3N A;  4ID4 A;  4GKU A;  4BD1 A;  3V9R B;  4R4R A;  1LLB A;  5B33 B;  4KG6 A;  3O62 B;  5F99 A;  4XUX A;  5L2F A;  3ZVW A;  3C1C A;  1GCE A;  2ZC4 B;  4KZB A;  3AZH B;  3QNC A;  5AVC D;  3MKE A;  2HDU A;  3S1Y A;  3REK B;  1PI5 A;  2H10 A;  3WKJ B;  1CI9 A;  1WWS A;  3LZ1 D;  4S2P A;  4XUZ A;  5CP6 C;  5FUG A;  1P3M A;  2A49 A;  2XLN A;  4E6X A;  3IWQ A;  3AV1 D;  1U35 A;  1JVJ A;  3HL9 A;  1GHI A;  3MNN A;  3AZF D;  5JA4 B;  1P3A B;  2YFV A;  4IED A;  3L26 A;  2HIO D;  5GSU C;  3OCL A;  3Q1F A;  1MXO A;  5G49 A;  5GT0 D;  2PYO D;  2HPB A;  3UT9 C;  3G35 A;  5DNM A;  5I94 A;  4Z66 B;  3Q7V B;  3G30 A;  3WWX A;  1N1J B;  4OLG A;  5DTT A;  3A6N B;  2NQB D;  4KZ3 A;  4OP5 A;  4EO5 C;  2V1Z A;  4OPQ A;  3NDG A;  5CTM A;  1MPL A;  4OJ6 A;  3ITA A;  3SS4 A;  4EV4 A;  1GA0 A;  5B40 A;  3LEL C;  5CPJ D;  4GZB A;  5BNV A;  4OPR A;  4E3M A;  3AZN A;  3ZNT A;  2IOU A;  3IWO A;  3AZK C;  4JJN C;  5FDH A;  2Y2Q A;  2EX9 A;  5AV8 B;  2HUE C;  4ZUX A;  3HRE A;  2WAE A;  4S2M A;  1ERM A;  3AL0 C;  4UA9 A;  3OPH A;  3MGQ B;  1Q2Q A;  3P98 A;  1YLZ A;  2ZM0 A;  3VMA A;  5CPK A;  2WGW B;  2I72 A;  4JF6 A;  3NC8 A;  1BSG A;  3AZI A;  5E2F A;  3GR2 A;  4WNN B;  4LD9 C;  1PW8 A;  3ZG5 A;  2ZQA A;  1P3B D;  1F66 D;  1P3F A;  3AZL D;  3KFU G;  1K25 A;  1P3P C;  4KZ6 A;  3AYW D;  5F1F A;  4M6B A;  3F6T A;  3PBN A;  5B0Z A;  3HSH A;  3H0L C;  5AV5 D;  5CHL B;  3X1U D;  1MBL A;  4J8W D;  3UNW A;  2FJ7 D;  5B2J B;  1RGY A;  3FYZ A;  3O86 A;  1K55 C;  1YLW A;  4WU8 B;  4H9R A;  3AN2 A;  1P3O C;  1ID3 A;  3X1V C;  1K57 A;  4NY2 A;  3BLS A;  4C6Y A;  4G91 C;  3B6G C;  3MXS A;  5FAQ A;  1EQZ C;  4QLC B;  3MGS D;  5B24 C;  3ZDJ A;  1KX4 C;  4X53 A;  1SCW A;  3W96 A;  1GHM A;  4DRA A;  1MWT A;  1TDL A;  1SHV A;  5GT3 A;  5EPH A;  1S0W A;  2RCX A;  3REH A;  1M6K A;  1JFI B;  3SH8 A;  4PMA A;  2CWE A;  1PI4 A;  1T3U A;  2NZD C;  2J9P A;  4IJF A;  3KWQ D;  5GT0 A;  5AVC B;  2PYO A;  1P3K C;  4OOM A;  1Z2C B;  3UTB C;  4GD6 A;  4GHA A;  2NQB A;  3LZ1 B;  1KDS A;  4KGC C;  1KX5 B;  2Y55 A;  3REL D;  4MEZ A;  1KGG A;  3WRT A;  3HLD A;  3PBO A;  1M19 D;  1PZO A;  3AV1 B;  4NZ1 A;  4YM6 B;  2IO5 B;  5KZH A;  3A3F A;  1YLY A;  5AVB C;  1JWV A;  1W79 A;  4JPM A;  3WX7 A;  5CPJ A;  4UHU A;  4N9L A;  3LJA D;  3AZF B;  5D3O A;  5AV6 D;  3IF5 A;  5B2I D;  3LO7 A;  3HUO A;  1NJ4 A;  4R0Q A;  1QMF A;  2ZC3 B;  2Y4A A;  3EPL A;  1H8Z A;  5HAQ A;  1KX3 C;  2HIO B;  3WS2 A;  5FSR A;  3BFG A;  2Y2P A;  3VH5 A;  3WAA D;  2Y2I A;  5B33 C;  3BLM A;  3IHA A;  5FAO A;  3C1B C;  4YS3 A;  4WV4 B;  4CSR A;  3L28 A;  5J8X A;  5B1M C;  3WTP B;  1ERQ A;  2CV5 B;  1NYM A;  3A1K A;  5E5A D;  3REK C;  2HDQ A;  3NQU A;  3WKJ C;  3X1T D;  1ONG A;  2Y2L A;  1RP5 A;  1ZLA C;  3LZ0 D;  1PWD A;  4YIN A;  3FWL A;  3REI C;  3EPJ A;  3O88 A;  5FQQ A;  1YLT A;  4LV2 A;  1PYY A;  4ZDX A;  1K54 A;  2ZY5 A;  4B4X A;  3AZJ D;  1AOI D;  3RXW A;  1HZO A;  3W97 A;  5KSH A;  4QJG A;  4IBG A;  1PZP A;  1SDE A;  3IF6 A;  1M18 D;  3X1U A;  3M6B A;  2FJ7 A;  3C1C C;  2GDN A;  2ZQD A;  4G92 C;  3UTA D;  1YU2 A;  3AZK A;  4PPR A;  4EBL A;  4KHA B;  3X1S B;  4Z66 C;  2Q9M A;  3SS5 A;  4LCL A;  3MGS A;  4JXV A;  3CG5 A;  1CI8 A;  1RGZ A;  1DJC A;  1P3M C;  3WS5 A;  1JWZ A;  5M18 A;  1F66 B;  4WJ3 C;  4Z2M G;  5B0Y B;  3AZL B;  4QY5 A;  3VH6 A;  1U35 C;  1Y54 A;  4DDS A;  1KDW A;  5DTK A;  3AYW B;  3MNN C;  2G5H C;  1BH8 A;  3UE1 A;  2Y2K A;  5AV5 B;  1NZU A;  4J8W B;  3VH6 W;  4IVK A;  3AZG D;  5AV8 C;  2XFS A;  2R9X A;  4S2K A;  4LD9 A;  2Z2L B;  4GB7 A;  3BEB A;  2RVQ D;  5DNM C;  3NY4 A;  2Y2H A;  2XGN A;  3KUY C;  4OJ5 A;  4KZA A;  3ZVT A;  1RCJ A;  3AZM B;  1WYC A;  3REL A;  3FKW A;  4X55 A;  1P34 D;  3M2K A;  4R8P D;  4JKT A;  4H9O B;  5B40 C;  4XZQ D;  1B6W A;  1MY8 A;  5JRG B;  3BFD A;  3O3V A;  3HUM A;  4MNR A;  5B2I A;  1MWR A;  5CTN A;  1H3O A;  1HVB A;  4B4Z A;  5AY8 D;  4BEN A;  4IJE A;  4DKI A;  3KWQ B;  4ZUX C;  1KX4 A;  4E6W A;  4OLD A;  5AV9 D;  4JLF A;  1KE3 A;  1HTA A;  4O7D A;  3G31 A;  5BT1 C;  3JYI A;  2CC1 A;  5HFO A;  4OJP A;  1L2S A;  2F8N G;  4E45 A;  4D2O A;  5BNX B;  4KZ5 A;  5E5A A;  4BL2 A;  4IBR A;  3R45 A;  1M19 B;  4DE0 A;  3X1T A;  4BL3 A;  2WYX A;  3WS1 A;  3AZE A;  1P3K A;  3AZI C;  3LJA B;  5AV6 B;  4ZJ1 A;  2V2F F;  4KZ7 A;  4J8V A;  3MGQ D;  4KGC A;  2G2W A;  3GQZ A;  5GXQ A;  3MKF A;  3CJM A;  4OQI A;  3WAA B;  2OLV A;  3BYD A;  4JXS A;  5B0Z C;  1QME A;  5B32 D;  4WBG A;  1M18 A;  1M1A D;  3PBR A;  2F8N H;  1ALQ A;  4FCF A;  4OP8 A;  2Y2G A;  3W98 D;  2ZMA A;  3UTA A;  1YMX A;  1ONH A;  3MGP B;  5GLA A;  1ID3 C;  3V9R A;  3LZ1 C;  1BTL A;  5EUA A;  5B33 A;  3O62 A;  3LZ0 B;  5FAT A;  4GOG A;  3NI9 A;  1W8Q A;  4JF5 A;  5DVA A;  4AWL B;  3OZH A;  5B2J D;  3W96 C;  3AZJ B;  1AOI B;  2DF4 C;  4QU3 A;  3WA9 B;  3AZH A;  4U0T A;  4HGA B;  4WU8 D;  3IXD A;  3REK A;  3VP4 A;  3VFF A;  1ES4 A;  4NK3 A;  2XDM A;  3WKJ A;  3HLG A;  3TOI A;  1JTD A;  1YU3 A;  3EPK A;  1FSW A;  3E2K A;  4WZ4 A;  4X6T A;  4E3I A;  2HIO C;  4UAA A;  4UUZ B;  1P3L D;  2QZ6 A;  5GT0 C;  2PYO C;  4KQO A;  2X02 A;  1HQ3 D;  4GN2 A;  5DNN D;  3WRZ A;  5DF8 A;  5AQ9 A;  2HP9 A;  3B0D C;  2NQB C;  4OPY A;  4OVD A;  1BH9 B;  5JA4 A;  1P3A A;  2F8N B;  5EEC A;  2FFY A;  3Q81 A;  4KUD D;  1P3I D;  3IT9 A;  4WZ5 A;  4U0X A;  1ERO A;  3GV9 A;  3ISG A;  3N7W A;  3AV2 D;  2ARO D;  1TDG A;  5CPJ C;  5B32 G;  2RIQ A;  2DCF A;  4Z66 A;  1YMS A;  4FD8 A;  2ZLY A;  5CPI D;  3Q7V A;  2FFF B;  4HEF A;  1N1J A;  3A6N A;  2P74 A;  3HUN A;  3AZG B;  1KX5 D;  5A91 A;  4DF6 A;  4WMC A;  4CPK A;  4YS3 C;  4YM6 D;  3C7U A;  5FA7 A;  4KG5 A;  2X71 A;  1KE0 A;  4NE6 A;  1GHP A;  4S2J A;  1WWI A;  3A1I A;  1BUE A;  1P34 B;  4R8P B;  3ZCZ A;  4XZQ B;  5AV8 A;  1YU1 A;  3LEZ A;  4PM9 A;  3HVF A;  4XXR A;  3W4O A;  2ZY2 A;  3FZC A;  1H8Y A;  3ITB A;  1P3B C;  1F66 C;  5F99 B;  5AY8 B;  3KUY A;  1YM1 A;  3AZL C;  3WTP D;  1K54 C;  3FV7 A;  4DRB A;  3MGQ A;  4PM8 A;  2EXA A;  2CV5 D;  3W97 C;  5AV9 B;  5C3I C;  3IF6 C;  3VSL A;  1P3G D;  4Y0T A;  3X1U C;  2FJ7 C;  3MGR D;  2IWC A;  2WGW A;  4ZBJ B;  3D4F A;  3MZF A;  3ZFZ A;  4WNN A;  4JBF A;  5B31 G;  4IBD A;  2WK0 A;  4WYY A;  3AGE A;  5FQ9 A;  3MGS C;  1LHY A;  3W8K A;  4OPZ A;  4J8X B;  4OQH A;  5B2J A;  2J8P A;  4KQQ A;  3BFC A;  1IYO A;  3HBR A;  3OPL A;  2IWB A;  5F83 A;  3VOY A;  3X1S D;  5B32 B;  1M1A B;  3Q7Z A;  1L0F A;  3W98 B;  1F1E A;  3IXG A;  4QLC A;  3KWQ C;  2Y2J A;  4DXB A;  1XP4 A;  4L0L A;  5B0Y D;  1MWU A;  3ZGA B;  2XK1 A;  1MWS A;  1PWC A;  5EOO A;  3AFA D;  2XR0 A;  5GSU D;  3REL C;  4ZAM A;  2YFW B;  4EBN A;  3UT9 D;  1JFI A;  4XUJ D;  4OJO A;  3SS3 A;  4OKP A;  3B0B A;  1FQG A;  4DXC A;  4IBC A;  5AVC A;  4NE5 A;  3BM6 A;  2WGI A;  3LJA C;  1O07 A;  3LY3 A;  5AV6 C;  1Q9C A;  5B2I C;  1C3B A;  2Y2N A;  1ES2 A;  5FI7 A;  4P0M A;  1FOF A;  3LZ1 A;  1WE4 A;  5KMW A;  1P3L B;  3LEL D;  3AZM D;  1R4V A;  1KX5 A;  1WYB A;  5GLC A;  4NET A;  5GHY A;  1HQ3 B;  2RL3 A;  5DNN B;  1I2S A;  3H0M C;  3AV1 A;  4WM9 A;  4R4S A;  4JJN D;  3WS4 A;  2EFX A;  3L27 A;  5JRG D;  4HBT A;  3AZF A;  4J8U D;  2JBF A;  5E5A C;  4KUD B;  1P3I B;  2BYK B;  1J9M A;  3N8L A;  4PM7 A;  1IYS A;  4RX3 A;  3AV2 B;  4R3J A;  2HIO A;  2ARO B;  4KZ8 A;  5B31 B;  3X1T C;  3IXB A;  3UE3 A;  3MZD A;  1E3U D;  4RA7 A;  3LY4 A;  3L29 A;  3AZE C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...