2JCHA

Structural and mechanistic basis of penicillin binding protein inhibition by lactivicins
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
684
structure length
461
Chain Sequence
SEITYSDGTVIASIDYLYFTTLAEAQERMYDYLAQRDNVSAATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTNQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PENICILLIN-BINDING PROTEIN 1B
publication title Structural and Mechanistic Basis of Penicillin-Binding Protein Inhibition by Lactivicins
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Drug-binding protein
total genus 144
structure length 461
sequence length 684
ec nomenclature
pdb deposition date 2006-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
A PF00912 Transgly Transglycosylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2jchA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2jchA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2jchA02
3G2ZA 4S2MA 2H0YA 4K0WA 1E3UA 1MWTA 3BLSA 3Q82A 1XP4A 4HBTA 2DCFA 3G31A 1TVFA 2ZQCA 4WYYA 3IWQA 2RCXA 4PM8A 1L0FA 1YLZA 4BD0A 3CJMA 2XEPA 1KVMA 1BSGA 1ES3A 2Y2GA 1YLWA 5EVID 3QNCA 1M6KA 1MPLA 2EXBA 3PAEA 2B5RA 4M3KA 3BFDA 4N9LA 4NK3A 4JXWA 1IEMA 4OOLA 4S2LA 1YM1A 1ONGA 1YLTA 3IWIA 3UE1A 4E3NA 2XDMA 3PBTA 1ZG4A 5GHZA 5HARA 5DTSA 1Q2QA 1GCEA 3NIAA 4MNRA 4S2OA 1L0DA 4E3OA 2Q9NA 2WUQA 4ID4A 1GHPA 4ZTKA 3UDXA 2WAEA 4OPZA 1CK3A 1PW1A 3GQZA 3MZEA 1NY0A 2R9XA 2Y2LA 3G32A 1W7FA 4FH2A 3LEZA 3QNBA 4JKTA 1FR1A 3WS1A 3ZNYA 1ONHA 4EBNA 4IVIA 4B4ZA 2ZMAA 3HUNA 4KZ3A 4UA7A 1WYCA 4Y0UA 4E6WA 3VSLA 1K55A 2WKHA 3NDEA 4L0LA 2WADA 4LCLA 4S2NA 4QHCA 5EOOA 1E4DA 5E2EA 1KGFA 4JBFA 4KG5A 2ZC7A 3GSGA 3A3IA 2ZC5B 2G2WA 2R9WA 3VSKA 4P87A 1ESIA 2XD1A 1S0WA 2Z2MB 3G4PA 4WBGA 1H8YA 4LENA 2IWCA 1H5XA 4C6YA 4R0QA 3SS3A 1TDGA 1MWUA 3OCNA 3UDFA 4KZAA 3MZFA 3Q07A 3C4PA 4GN2A 3AGDA 4S2IA 1YT4A 3CG5A 5M19A 2HP6A 3HLWA 2JCHA 1BT5A 1ESUA 1NZUA 3BM6A 3LCEA 3N8RA 3PTEA 4BJPA 4E3KA 2WGWA 3ITBA 5I94A 1PIOA 2Y91A 3W8KA 1GHIA 3CMZA 1E3UD 1LHYA 5FATA 2ZJ9A 3HUOA 4XXRA 2XD5A 1SKFA 4OLGA 1NRFA 1ALQA 4RYEA 1BTLA 4ZDXA 3BFCA 3BLMA 4EV4A 3N8SA 2ZM2A 5CHMA 3UNWA 1CI8A 1K57A 2ZQ8A 2ZM8A 4LV3A 4GKUA 4UHUA 3IF6C 4JLFA 3AGEA 4OPYA 1DY6A 5FAOA 3N4IA 4KZ6A 4JF6A 3NBLA 4DRTA 4MBHA 4A5RA 3P98A 3W4PA 5CGWA 4KZ4A 2EFXA 4OOYA 3A3DA 1E25A 3W4QA 5EVLA 3D4FA 1BLHA 4U0TA 3Q1FA 5JYPA 3JYIA 4C3QA 4N1XA 4LV1A 4B4XA 3Q7ZA 2P9VB 4WEKA 1PI5A 2X02A 3SH7A 3SS4A 2PU2A 4OLDA 3SH8A 3MZDA 4DXCA 4PMAA 3S4XA 4R3BA 2P74A 3A3JA 5CEBA 3V5MA 4KG6A 3NCKA 1W5DA 4ZJ1A 4QY6A 5HFOA 2Y2MA 4E6XA 3V3RA 1Q2PA 3M2KA 2Y2PA 1H8ZA 4U3TA 4N92A 4X53A 4O7DA 4RX2A 3VP4A 3OC2A 4WELA 1K4FA 2HP5A 3G2YA 2ZC3B 1TDLA 4X69A 3VFFA 3ZCZA 5GLCA 3PBRA 1MWSA 2HDUA 3RXWA 2J7VA 1DJAA 5JYOA 2EX2A 1IKGA 3ZNTA 1NYYA 1NYMA 3CZDA 3IXBA 4XUZA 2XQZA 1ERMA 4OVDA 4UAAA 3HLDA 4QD4A 4DE3A 4KQRA 1LLBA 3E2KA 4P6BA 1XXMA 4BL3A 2WK0A 4DXBA 5EVIC 4Y7PA 3HBRA 3ZG5A 3IWOA 1JVJA 1NJ4A 3SH9A 2IWDA 4DDYA 3TG9A 1K6SA 5DTTA 4R3JA 2ZM0A 5E2HA 4PM7A 3HREA 1N9BA 2VGJA 1JTGA 2ZQDA 2XFTA 3OPPA 5DF9A 5FI2A 2E8IA 1KDWA 1ES5A 4JF5A 3UN7A 4R4SA 3FZCA 2EXAA 3SS5A 2HDSA 3E2LA 5FQQA 1N4OA 4WZ4A 3GTCA 3IH8A 4PM9A 2WKEA 3NC8A 5E2FA 3IF6B 4GD6A 2XGNA 1YLJA 2XH9A 3IT9A 1GHMA 2Y2OA 1NXYA 1K54A 3B3XA 1G6AA 2J8YA 4IVKA 4Z9QA 5F83A 3VMAA 5CGSA 4GOGA 3Q7VB 2IWBA 3PAGA 3N7WA 1K56A 3HLCA 1YLYA 1MKIA 1Y54A 1U60A 3P09A 4OH0A 3ZG7B 1BLSA 4WMCA 5HL1A 1BZAA 1MXOA 3GMWA 1IYPA 4CJNA 4DE2A 5BOHA 5EPHA 3LO7A 1IYOA 3G35A 1M40A 4IBRA 1ERQA 1IYQA 2EX6A 3MBZA 3NY4A 3ZG9B 3C7UA 4S2KA 1HZOA 3ITAA 1I2SA 4QB8A 4F94A 4KZ9A 2JE5A 3BRMA 4UA6A 1FQGA 3WRZA 1HVBA 3ZVWA 3O87A 4YFMA 1WYBA 5FDHA 3ZG8B 3V39A 1FSYA 5KZHA 2BG1A 3IXGA 4KQOA 3UE3A 2XR0A 1KGGA 2QMIA 2OSUA 2C5WB 3BFFA 1W8QA 4GD8A 4MBKA 3WS4A 5DF7A 2FFYA 1LL5A 2Y55A 3A3FA 3N8LA 1SCWA 2WYXA 3HUMA 3MXSA 4MBFA 5TGFA 4EBPA 2WKIA 3G30A 5HAQA 4DDSA 5HX9A 4E3MA 2G2UA 4RA7A 4PM5A 3GR2A 3C7VA 1KE0A 5EVIB 5HW3A 4WEJA 5GLDA 4R23A 2H5SA 2EX9A 1EROA 5EOEA 3UPOA 5CTMA 1FCMA 3OPRA 2PBYA 3DW0A 3PBNA 3MFDA 1HTZA 4OPQA 4GDBA 4RVAA 3O86A 3IXDA 4HEFA 4DE0A 4DE1A 5FQJA 1OMEA 5EECA 5CRFA 1EWZA 4KQQA 3A3EA 4X56A 2QPNA 2XK1A 1BULA 1YMXA 5CGXA 3GV9A 3O88A 4JPMA 4EBLA 3IF5A 3VOYA 1RCJA 5FI7A 4MLLA 2P9VA 4FH4A 3FYZA 4S2PA 3HL9A 4R1GA 5CECA 2H0TA 1WE4A 3NDGA 1JWVA 1QMFA 2Q9MA 1PZOA 4H8RA 3M2JA 1K56D 1K55C 4U0XA 2ZC4B 4Y0TA 2UWXA 1MBLA 4S2NC 4OP8A 1GA0A 4WZ5A 4WMCD 4LCMA 3UDIA 4Q8IA 4PPRA 1XA1A 4P0MA 1KDSA 4JF4A 4RX3A 4FCFA 1FR6A 4NETA 3DTMA 4FSFA 3AGFA 2RL3A 4JXGA 2ZC6B 3ISGA 2FFFB 5KMWA 2ZQAA 1PWGA 5CXWA 3UY6A 1K25A 5U47A 1PWCA 3OPLA 4ZJ2A 3MXRA 4K0XA 4LV2A 1I5QA 1EI5A 1SHVA 5DVAA 2BLSA 1PW8A 1DJCA 4OPRA 3IHAA 5L2FA 5GLAA 2WAFA 2Y4AA 2XF3A 5DTKA 4IEDA 5HAIA 4JXSA 5CERA 3MKFA 3N6IA 2HPBA 1RP5A 3FKWA 4ZAMA 2WGIA 3BFEA 2X01A 4OKPA 3GRJA 5A93A 3IXHA 5TFQA 4BD1A 3DWZA 1K6RA 5A91A 2C6WB 1JWZA 4OQGA 4GB7A 1IKIA 5KSHA 2Z2LB 3VP3A 5FQ9A 1K57C 2EX8A 3ZVTA 4HESA 4OOMA 4OQHA 1RGYA 3Q81A 2OLVA 4GNUA 1LL9A 2WGVA 3LY3A 3WS2A 1XGIA 2PU4A 2Y59A 4OQ0A 4D2OA 3LY4A 2ZQ9A 3UPPA 3IQAA 3VP0A 1XKZA 3IF6A 4N9KA 2ZD8A 5EUAA 1K4EA 4IBXA 4EQIA 1L0GA 4UA9A 2GDNA 2VGKA 4YINA 4C75A 4JXVA 1HD8A 2Y2IA 3FV7A 1ES2A 5CTNA 1I2WA 5AQAA 2QZ6A 1MWRA 4KG2A 2J9PA 1BLPA 1G68A 3PBQA 3Q7VA 4X6TA 2HDQA 3UO9A 2WZXA 4GZBA 1FSWA 2XFSA 3O3VA 4X55A 1C3BA 5FQIA 4S2JA 5CEDA 1Z6FA 4KZBA 1O7EA 1ZG6A 1RGZA 1VQQA 5DF8A 3IH9A 1SDNA 2HP9A 4KZ7A 1LI9A 3HLEA 4WZ5C 3HLFA 3C5AA 4OONA 3WRTA 4DF6A 5M18A 1YMSA 5M1AA 5FSRA 4HBUA 4P85A 5GLBA 4BLMA 2X71A 2DNSA 5E2GA 5A90A 5FA7A 1FCOA 5CHJA 3ZDJA 3EQVA 5FI6A 1CEFA 3FKVA 4QU3A 5F1FA 4OQIA 3UPNA 5IHVA 1IELA 3VP1A 3BEBA 5F1GA 4K91A 5FQKA 3C4OA 3ZGAB 1CEGA 3UE0A 1L2SA 2V1ZA 3VFHA 3DWKA 4EWFA 4QY5A 4MEZA 1KGEA 3I7JA 3OCLA 2JC7A 3WS5A 3MKEA 2WGWB 3WWXA 1ES4A 1K38A 4PM6A 3S1YA 5A92A 5KSCA 2V20A 3RXXA 1ZC2A 2A3UA 5EVIA 5CHUA 3HLBA 5E43A 1VM1A 3HLGA 1KVLA 1JTDA 2WZZA 5GHYA 4BL2A 2HDRA 2Y2KA 1QMEA 3OPHA 3HVFA 4ZBEA 5AQ7A 3WS0A 4LV0A 1IYSA 1KE3A 4B88A 2ZLYA 1PYYA 2CC1A 2Y2QA 1O07A 1FOFA 1DJBA 3IHBA 1PI4A 1YLPA 1K54C 1TEMA 3OZHA 3SOIA 3EQUA 4ZJ3A 4E3JA 2V2FF 2DRWA 3V3SA 5AQBA 2JBFA 1NZOA 3NI9A 3QHYA 5TR7A 1SDEA 1LI0A 1XA7A 2I72A 3M6HA 2OV5A 3VP2A 4BENA 1GA9A 3TOIA 4DKIA 1XGJA 3PBOA 4WM9A 4E3IA 1YQSA 3BYDA 4QJGA 1PWDA 1ZKJA 1XX2A 1AXBA 1W79A 1PZPA 2H10A 3PBSA 4FD8A 3TSGA 4CPKA 2J9OA 5HAPA 3VOZA 1CI9A 5GHXA 3M6BA 4KENB 5FAPA 3BFGA 3FWLA 5FAQA 4BQMA 4X68A 5FASA 3S22A 4E3LA 2A49A 5J8XA 2Y2HA 4EUZA 1JWPA 2Y2JA 1W8YA 2EFUA 3V50A 4Y0OA 5EE8A 3BECA 4KZ5A 4KZ8A 3RJUA 2XLNA 1MY8A 2ZQ7A 4OP5A 5D3OA 3W4OA 4GDNA 1L0EA 1J9MA 4R4RA 5GL9A 2Y2NA 1XPBA 4XUXA 3ZHHA 1BLCA 5FQMA 1S6RA 1KE4A 1FCNA 5AQ9A 3G34A 3GVBA 4N1HA 5G18A 5F82A 2OLUA 3ZFZA 1BUEA 3ZG0A
chains in the Genus database with same CATH superfamily
1P3OA 3K2NA 4NY2A 2NUPC 1E3UA 5EM1A 4DKIA 4CSRB 3IWQA 1L0FA 1YLZA 4IJEA 5IU1A 1BSGA 2L5AA 5EVID 3QNCA 1MPLA 4NK3A 2XSSA 4OOLA 2JHEA 2G7UA 3EG5B 1YM1A 4S2LA 1KU5A 2PYOB 3DTKA 1P3BC 1UGUA 3VH5A 4ZBJC 3PBTA 5DJUA 4IBJA 3X1UA 4F3LA 2O0YA 3T4OA 5B24A 5FUGB 5AV6B 4IHQA 5B40B 1IOUA 3O5YA 2P08A 4UEYA 3LEZA 3QNBA 1EQZA 1FR1A 3WS1A 3ZNYA 3X1TC 4IVIA 4J8VC 3W96C 4O0PA 3VSLA 2HIOA 4LCLA 4NZ1A 4QHCA 4H9RA 5E2EA 1KGFA 3REHB 4JBFA 2BASA 4JGQA 1N1JB 1LL8A 4G91B 1KX4C 3AV1D 2XD1A 3AZGD 1YKDA 3G4PA 1H8YA 2L4RA 3AZGC 5HWWA 2AROC 3KS8A 4GHIB 5JA4A 3MZFA 3C4PA 5M19A 4P6ZS 4EBLA 1PDCA 3LCEA 1TAFA 2WGWA 3W8KA 3KXBD 2Y91A 3MF0A 3CMZA 3T4SA 1P3AD 4KGCA 3B6GA 2M1CA 5FATA 1P3AC 1KX5B 1ALQA 3MGSD 4EV4A 5AY8D 3U2AA 3WKJD 4R6LA 4UHUA 5CX7A 4JLFA 5I5LA 4YOFA 3N4IA 3HJKA 5B32G 5E5AC 4X23D 3P98A 4HJ6A 5C5KA 4KZ4A 2ZY4A 2GNXA 5TBMA 3TE8A 4U0TA 5AV6D 1ZLAB 5B31G 3MGRC 3REKD 3JPUA 2ZY2A 5B1MC 4C3QA 5B40D 1MKMA 4BWIA 5AV9A 1KX3A 4LV1A 1P3FB 2P9VB 1OTDA 1PI5A 3K3CA 4DXCA 3H0RC 4PMAA 2P74A 3A3JA 4WLAA 3AZLA 1TS7A 3V5MA 2VGLS 1LT0A 1M1AB 5B0YA 2XA7M 5HFOA 4E6XA 3V3RA 1P3IA 4U3TA 1A0KA 4RX2A 4Y3IA 3H0MC 5B31B 2OAP1 3F1OB 3PXPA 3AL0C 5GLCA 1E6RA 1MWSA 1DJAA 4ARZA 5FL3A 2J80A 3CZDA 4YNRA 2XROA 4WU9B 4CSRA 5DNND 1OJGA 2CV5C 4P6BA 3TU4D 4QWOA 5DNNC 4R8PB 3A0RA 4G3KA 4M4XA 3IWOA 2IWDA 3AFAD 3TG9A 2PYOA 3AFAC 4CLCB 3HREA 5FI2A 2XFTA 1CK7A 5B0ZB 3LR0A 3W99C 2PT7A 3S7NA 4LD9D 4JF5A 3OLOA 3FZCA 2HDSA 4ZUXD 5FQQA 2K2NA 5AV8C 4PM9A 4ZUXC 4LPZA 5FUGA 3NC8A 3IF6B 1P97A 3A1KA 1GHMA 3AYWD 1K54A 4IBFA 4AWLC 3AYWC 1O6IA 1U35D 5CGSA 3X1SD 3Q7VB 2IWBA 3PAGA 3B6FC 4PKYG 5EFWA 1Y54A 3ZG7B 4UUZA 3UB7A 4WMCA 3REHA 4Z66D 2JKFA 1N1JA 4H9SC 3LO7A 4YM6C 4Z2GA 1ERQA 4XUJB 3ITAA 4F94A 4QB8A 4KZ9A 1JNUA 3BRMA 4GHIA 4YFMA 5FDHA 1WYBA 4LG2A 1FSYA 3IXGA 3RELC 4Q0HA 4QNLA 2XR0A 1KGGA 2OSUA 2QMIA 3W98B 3UTAB 1GOIA 3AN2C 1LL5A 1ZHHB 4WU9D 5GT0D 1P3MB 3N8LA 1KX5A 2WYXA 2WKIA 4DRBA 4DDSA 4R8PD 5HX9A 4NFTA 5B2JD 4ETZA 4WEJA 5B2JC 3AZJB 1SZVA 5CTMA 4HMCA 2BTFP 4YS3A 1MZUA 3ICYA 3IXDA 4HEFA 5JRGD 3X1VB 5JRGC 1H3OB 4X56A 2QPNA 1YMXA 1ZLAA 3SW1A 2QWSA 1P3FA 2P9VA 2QKPA 4Z2MH 4R1GA 2H0TA 1WE4A 1JWVA 1S32B 2Q9MA 4H8RA 3M2JA 1F2KA 2G5HC 4U0XA 2DQNC 2UWXA 1M1AA 1GA0A 4J8UC 4IBEA 3H9WA 1ULYA 5CP6C 4KUDB 1S4SA 1KDSA 2D49A 5B31A 4RQ9A 3AGFA 2RL3A 4JXGA 1E6ZA 3F1OA 5CPJD 2ZQAA 1PWGA 5CPJC 1K25A 4XUJD 4XT2B 3OPLA 3M7PA 4ZJ2A 4LV2A 4K0XA 4J8WD 3KYQA 3RFBA 1I5QA 3NOPC 3UT9C 3T12B 3REJB 5L2FA 1P3GC 2Y4AA 2XF3A 5F99D 5CERA 3MKFA 3N6IA 1H8MA 2HUEB 2V0WA 3BFEA 3UTAD 3IX8A 5A93A 1OT9A 3IXHA 4CLCA 1K6RA 4WUJA 5B0ZA 2Z2LB 3VP3A 3ZVTA 2ZL1B 5DNMB 4HESA 5CPID 4G92C 3Q81A 1LL9A 5CPIC 5AV5C 2PU4A 3B0DC 3AZNA 1OGGA 2ZQ9A 1HLUP 3UPPA 3DTEA 3VP0A 1B67A 1XKZA 3IF6A 2ZD8A 4OJ6A 3MS6A 3MGQC 4DMZA 4UA9A 4C75A 4J8XA 2Y2IA 3FV7A 3NQJA 1DP9A 2QZ6A 3NQUB 3PBQA 3Q7VA 2HDQA 3KUYB 2BYMB 5GXQB 4OJLA 1NLZA 4PHTA 4X55A 5FQIA 5CEDA 5B1LB 2F8NH 4HY8A 1S32D 1RGZA 4H9PB 3KWQC 3IH9A 2ZM5A 4KZ7A 3EOIA 1Y4OA 5J3WA 1LI9A 3K3DA 2KOIA 3HLFA 3AZIB 4OONA 1CQAA 5M18A 2CWEA 5M1AA 4OJOA 1F9IA 4P85A 4QPRA 4Q0JA 2X71A 1P3LC 4H6JB 5CHJA 3UMDA 5IS1A 1CEFA 4PKYA 4WNNB 5IHVA 1P3PA 3BEBA 2F8ND 5GT3C 4X25A 5FQKA 3W98A 1GSVA 3P01A 2H28A 5DFYA 1P3MA 3L2AA 5GSUB 1N9NA 3VH6W 1D1JA 1K38A 4PM6A 5A92A 1V9YA 2W8SA 2YFVB 3LIFA 2W1TB 3DTIA 2A3UA 4MB3A 5E43A 1VM1A 3C38A 1X0OA 3AZJA 4XZQD 2FJ7D 3KSFA 3AZMC 5F5YA 2Y2KA 2UV0E 5B2IC 3HVFA 2MJ6A 3LZ1B 5DNMD 4Y5FA 4LV0A 4E04A 1H3OA 4IJGA 1PYYA 2CC1A 2Y2QA 3R7WA 4O8GA 4Z5TC 5C3IC 3TW8A 1TEMA 2ZOHA 3SOIA 5B33B 3C8CA 2G5IC 4WU8A 5EM0A 1NZOA 2PRFA 3QHYA 4Y2FA 3AZFB 4Y15A 3REID 3R4KA 3ZQ5A 3MQLA 5BS7A 4JJNA 1AXBA 2NZDB 4UPKA 4KUDA 3WD2A 2B18A 3UTBB 3VOZA 3M6BA 1S1ZA 3C1BA 5FAQA 4R3AA 5J8XA 2A49A 4IBGA 2WKRA 4JGPA 4XT2A 3O62D 5CPKC 4KZ5A 2ZQ7A 3A6ND 2NQBA 2Q0OA 4IJFA 4R4RA 1XPBA 3REJA 1UR8A 1S6RA 1JFIA 1KE4A 1PZRA 4H9NB 1M18C 1W1PA 5F82A 3ZG0A 1OTEA 3G2ZA 2H0YA 1ID3D 3Q82A 4WYYA 4HBTA 3FPVA 3G31A 2HJEA 2ZQCA 4PM8A 2RCXA 2V1AA 1AOIC 4BD0A 3CJMA 1BH8B 5GSUD 1P34B 2ZL1A 3PAEA 1AWIA 4M3KA 4L9FA 2O9CA 4DN0A 1ONGA 1YLTA 3IWIA 4E3NA 2XDMA 3NULA 3FKEA 3AZKB 3WAAB 5B24B 1Q2QA 5AVBC 3NIAA 2WUQA 4ID4A 1P3KC 4ZTKA 1HQ3B 2KDKA 3NQUA 3KUYA 1GPFA 3GQZA 2BYMA 1EQZB 5GXQA 3LIEA 5B1LA 2PDRA 4B4ZA 1VEUB 4KZ3A 3LZ0B 3AV2D 3IP4C 2WKHA 4L0LA 4WZSB 3CLOA 3AZIA 2I9VA 5EOOA 3UTBD 3FDDA 3RTYA 3KSHA 2R9WA 3LELA 1GSWA 3VSKA 5AVCD 3BY8A 4WNNA 4HH3A 1S0WA 2Z2MB 5AVCC 4WBGA 4LENA 2IWCA 2VLGA 1STZA 4C6YA 4BMWA 3OCNA 3Q07A 3W2ZA 1YT4A 3CG5A 1W63Q 1BT5A 1NZUA 1AIWA 4NG2A 1P3OD 3ITBA 4KGCB 1GHIA 2YFVA 1E3UD 3WTPB 2W1TA 3W97A 2V0UA 4FOFA 3C1CC 2BYKB 4EUVA 3MVDC 4XXRA 1SKFA 4OLGA 4G3WA 4RYEA 3BFCA 3WA9C 3LZ1A 3N8SA 3VOLA 4KUOA 1CI8A 3WD4A 2M7UA 5L8MA 2XA7S 4M6BA 1DY6A 4GJ4A 3NOUC 3X1UD 5TJJA 4NZ4A 1P3BB 3IX3A 4DRTA 4BBTA 5B33A 3IBRA 3W4PA 3RH8B 5B24D 2EFXA 4OOYA 3AZFA 5L07A 2HV1A 5CHLB 3LICA 5JYPA 4I3JA 4N1XA 1EQZD 2D01A 3Q7ZA 4WEKA 2NZDA 2QJ5A 2X02A 3SZTA 2R78A 2PU2A 1DP8A 2V9AA 3X1TB 2HIOD 4J8VB 1W5DA 2HIOC 3T4KA 2Y2PA 4X53A 4N92A 4LLOB 4O7DA 3OC2A 4WELA 3A1IA 1GXDA 2HP5A 2ZC3B 2RTSA 4X69A 3EPHA 3ZCZA 3MQ0A 3MNNB 4H9NA 3EEAA 4Z2LA 4OJ5A 2VX8A 4CLCE 4XUZA 4EO5C 1H0MA 4OVDA 2AROB 4UAAA 3MJQA 5BT1D 3VH6A 4PAUA 1BH8A 5BT1C 1P34A 2WK0A 4KGCD 5EVIC 4DXBA 3B6GD 3SH9A 4DDYA 4H9QB 5DTTA 3B6GC 3UB8A 1YU1A 2ZM0A 5E2HA 1M19A 4OJPA 3H7WA 3V67A 4ZRRA 3UN7A 3AZKA 2KX6A 3WAAA 1WWIA 4BBVA 3VH6T 3E2LA 1N4OA 2CMNA 2QHKA 3KS4A 3GTCA 3T4TA 2WKEA 5J4EA 1HQ3A 3E4OA 5E2FA 2XGNA 1YLJA 2XH9A 3IT9A 2Y2OA 3F1NA 1NXYA 3D9YA 3B3XA 1G6AA 2J8YA 5E5AB 1BYWA 1VEUA 5AV9D 1KX3D 3LZ0A 3H82B 3N7WA 3MGRB 1K56A 3HLCA 4UUZB 1MKIA 2VV7A 4HMDA 1IYPA 4MB5A 4DE2A 3AZLD 1LSXA 5EPHA 5BOHA 2IA2A 1NRJA 4JGOA 5B0YD 3AZLC 3WD0A 3AV1C 3G35A 4IBRA 1P3ID 1Z09A 4I38A 3ZG9B 3C7UA 4S2KA 1I2SA 1XFNA 1HVBA 5KZHA 3UE3A 3KXBC 3WTPA 3BFFA 1TZYB 2BYKA 4NEED 3WS4A 5DF7A 2FFYA 1P0ZA 5TGFA 2ZY3A 3MGSC 3G30A 4E3MA 4PM5A 5AY8C 4BBUA 2CV5B 2PYOD 3WKJC 5GLDA 2H5SA 4YS3B 1HTAA 1FCMA 1J3WA 1J7MA 3MFDA 3PBNA 4NE5A 1P3BA 4RVAA 4X23C 3W99B 3L7HA 2WKQA 2VZWA 5FQJA 1OMEA 5EECA 5CRFA 1EWZA 4KQQA 3A3EA 2XK1A 1BULA 5AV6C 3REKC 5AV8B 3IF5A 3VOYA 1B6WA 5B40C 4NXGA 3QP5A 2O9BA 2PHYA 3OOVA 2RVQD 2ZBBA 3FYZA 4S2PA 2J3WA 3OBFA 4AWLB 3X1TA 5B32B 1K55C 4J8VA 3W96A 1MBLA 4S2NC 4WZ5A 1PRQA 4WMCD 3REHD 4HI4A 4LCMA 3UDIA 3B6FB 3REHC 4RX3A 2D02A 4FCFA 1WA9A 4UQIM 4FSFA 1F66B 4G91C 4Y13A 3MNNA 3UY6A 1KX4A 2AVXA 4YM6B 3MXRA 3BW6A 4EEPA 1KS0A 1PW8A 1DJCA 2AROA 4OPRA 4Q0IA 3IHAA 5GLAA 4JXSA 4R38A 5F68A 3TU4C 1RP5A 3RELB 5BO0B 4ZAMA 4H9QA 3GRJA 2VEAA 1E6NA 1KX5D 1JWZA 4GB7A 1KX5C 1P3AA 3AN2B 4LD9C 3BQAA 1K57C 2EX8A 2W3DA 4HGAC 4OOMA 1RGYA 3AZNB 2WGVA 3LY3A 3WS2A 4OQ0A 4YS3D 5EV0A 4IBCA 4IBXA 4J8XB 3IS2B 1L0GA 3LJAB 3NQJB 2GDNA 2VGKA 4YINA 5E5AA 1HD8A 3NOTC 3AZEB 4JXVA 1ZLAD 1ES2A 5CTNA 5AQAA 1U35C 3X1SC 1F98A 1G68A 1P3FD 2Z6CA 3H82A 3MGRA 3LIBA 5B1MA 2V5OA 4HOIA 1C3BA 1W1YA 4Z66C 1O7EA 1VQQA 3DBAA 4LGWA 5DF8A 4CQHA 1M1AD 4ETXA 4Z2MG 2HP9A 1M1AC 2Y79A 3WRTA 4DF6A 2ZOIA 3VV4A 3LR4A 5B31D 4HBUA 5CP6B 5FA7A 2OAQ1 1L3LA 1P3PB 3EQVA 5K5BA 3FKVA 3UPNA 1IELA 5HDCA 1TZYA 4R70A 5IT5A 3DWKA 2O99A 5GT0C 4WU9C 4QY5A 4LFUA 5DKKA 3I7JA 3UT9B 3OCLA 2JC7A 3WS5A 4R8PC 1P3GB 1BFMA 2CV5A 4CLCD 3G6OA 3CPTB 3HSHA 5CHUA 4LRXC 1KVLA 1JTDA 5B0ZD 2HDRA 2JKTM 5BPVA 3UB9A 1QMEA 1VB6A 3OPHA 4ZBEA 1PNEA 5AQ7A 3W99A 5EVEA 3UE6A 3WS0A 3CWFA 3AZND 3R7WB 1KE3A 4B88A 2ZLYA 2LY8A 5AV8A 5AV5B 1O07A 3B0DB 3IHBA 3LR3A 5LBRA 1YLPA 4WU8B 4J8XD 3NECA 2W3EA 3MGQB 1KOUA 1MC0A 5B32A 3TOIA 4JJNB 3PBOA 4QJGA 4E3IA 3BYDA 5A8BA 1PZPA 4FD8A 3C1BB 3B6FA 3T4JA 1T1BA 4KENB 5FAPA 3FWLA 4IUHA 4KHAB 3EWKA 4NYUA 1F66A 4H9SA 4NZ3A 1JWPA 3KWQB 4XUJC 5EE8A 2NQBB 3BECA 3CUEA 4YM6A 1XJ3A 4J8WC 3W4OA 1L0EA 5G4ZA 1JFIB 3FG8A 4Z1WA 3GECA 1P3PD 5F99C 1P3LB 1FCNA 1LSVA 3GVBA 3W98D 3RELA 5BO0A 2OLUA 3UTAC 3KYEA 4S2MA 4K0WA 5GT3B 3MGPB 4I39A 3BLSA 1P3MD 1NWZA 1TVFA 3AN2A 1KVMA 1ES3A 1YLWA 1M6KA 2EXBA 2B5RA 4N9LA 3AZJD 2JSSA 3BFDA 2ZMVA 2EWWA 3AZJC 5AVFA 3S7PA 4EEUA 4EERA 2HF6A 3AZMB 1ZG4A 3X1VD 1T1CA 3IS2A 5HARA 4B93A 3LJAA 3X1VC 5L09A 4MCWA 2B02A 3AZEA 1GHPA 3UDXA 4DRAA 1P9RA 4MB4A 5DFXA 1L6JA 4EETB 1CK3A 2P04A 4KUKA 4Z5TB 1NY0A 3G32A 2Y2LA 4WU8D 1W7FA 4IUKA 1S67L 4EBNA 3MR0A 3LEQA 4HP4A 1S32C 2ZMAA 3HUNA 4Y17A 4JJND 5BNVA 4Y0UA 4E6WA 4KUDD 4Z2JA 2WADA 3F1PB 3E98A 1E4DA 3CAXA 4J8UA 5CP6A 1W1VA 2ZC7A 3GSGA 3LELB 1YU2A 2VA0A 2HGVA 1CJFA 3WTPE 1XJ4A 2PBDP 3F6TA 2NQBD 1OTAA 4D60A 4R0QA 1TDGA 5CPKB 3REJD 4KZAA 4GN2A 3AGDA 4S2IA 2E8JA 2JCHA 1ESUA 3N8RA 3UT9A 3HCYA 3W97B 1P3GA 5I94A 2HUEC 1M18B 1LHYA 3T50A 3CPTA 2ZJ9A 2A2LA 3HUOA 2FJ7C 4XZQC 1W1TA 2XD5A 1NRFA 4ZDXA 1ZTUA 1AOIB 3BLMA 3EGDC 2VJWA 5DNMC 2ZM2A 3UNWA 2ZQ8A 2ZM8A 4MDZA 3AGEA 5AV5A 5CPIA 4KZ6A 2ZMFA 1LSWA 3NBLA 1DP6A 3BJNA 3VH5W 3MGQA 3W4QA 5AVBB 3REIC 4CAYA 4Z2HA 5EVLA 3KUYD 3Q1FA 5GXQD 1D06A 1P3KB 4B4XA 5B1LD 3PR6A 3LYXA 3SS4A 3AZHB 3MZDA 3SH8A 3EPKA 3S4XA 4KHAA 1Q9CA 3EPJA 2HJ9C 4KG6A 5MC7A 3AZID 3NCKA 4ZJ1A 4LRZE 3KWQA 1Q2PA 3M2KA 3O62C 4NXBA 3T1RA 1H8ZA 4II7A 1TS0A 4I5SA 4FTXA 3A6NC 3VP4A 3LELD 1K4FA 3G2YA 2A24B 1TDLA 3VFFA 1P3LA 3PBRA 2HDUA 2J7VA 3WD3A 3EGXC 1EW0A 5FDSA 2OWJA 2EX2A 1A7WA 5GT3A 1NYMA 1ID3C 3MGPA 5FEFA 1UWPX 4DE3A 1LLBA 5GSUC 4BL3A 3W97D 2PD8A 2VV6A 3HBRA 3ZG5A 1YSQA 1NJ4A 3QP8A 1M19B 1K6SA 4R3JA 3FC7A 1XJ2A 4PM7A 3H7WB 2VGJA 1JTGA 2ZQDA 3LZ1D 3MVDB 1BH9B 3AZMA 1XFQA 4EU0A 4R4SA 2EXAA 5B2IA 3WA9B 4WZ4A 1W2EA 3V9RA 5B33D 3F1NB 4Z5TA 3AZFD 4IVKA 5HPFA 3MSHA 4Z9QA 3D72A 5BNXA 5F83A 3IBJA 4GOGA 3AV2C 2NZDD 4GS9A 1CF0A 2W0NA 3F1PA 3UTBC 3P09A 5HL1A 4WJ3C 5J7EA 1MXOA 4CJNA 4HIAA 2L1MA 1IYOA 2EX6A 3MBZA 3NY4A 2L0WA 1HZOA 4UA6A 2YFWB 5CPKA 3WRZA 3ZVWA 4QLCB 3O87A 3ZG8B 1WWSA 2BG1A 4HHDA 4EQ1A 1P3OC 3N3FA 5AJGA 1M18A 3D3OA 2C5WB 3DAVA 4GD8A 2V1BA 2J3TD 2Y55A 3TRCA 1F1EA 1P34D 2INWA 3A3FA 2J3TC 1E6PA 3MXSA 1P34C 1AOIA 5HAQA 2G2UA 4RA7A 3GR2A 1M19D 5EVIB 1OTIA 4R23A 2JKRM 3UPOA 1IFQA 3X1UC 1Z2CB 3AZKD 3DW0A 4ZBJB 3WAAD 1HTZA 4OPQA 4GDBA 4EESA 3O86A 4UQIS 5B24C 4DE1A 1HQ3D 5AVBA 1HQ3C 5CGXA 3O88A 1P3KA 1RCJA 5FI7A 1VETA 1EQZC 4HMEA 3C2WA 4MLLA 1E88A 2FZ0A 3AZHA 3W96B 3ULFA 3LZ0D 3UB6A 3MXQA 1K56D 2ZC4B 4ESPA 4G3VA 1XA1A 4P0MA 3VE3A 2FH5A 4NETA 3DTMA 2A24A 2ZC6B 1KX4B 3ISGA 2FFFB 3AV1B 5U47A 4HNBA 4OUIA 3AZGB 2WKPA 5AVCA 1EI5A 5DVAA 2BLSA 5DTKA 5HAIA 2HPBA 3WTPD 4KGCC 3T1QB 2WGIA 2X01A 4OKPA 3TJZC 3KXBB 2QJ7A 3DWZA 1P3AB 3C1CA 3CHWP 3B42A 5KSHA 2V8FA 3MVDA 2O9AA 1BH9A 5FQ9A 2XRNA 4L9GA 4OQHA 2ZY5A 3MGSB 4EW7A 3WA9A 4E44A 3C30A 2Y59A 5AY8B 3KYZA 3B0CW 3HJIA 1P3BD 3WKJB 4AFIA 4GLQA 4N9KA 1E15A 4EQIA 4X23B 3B47A 5AV9C 1KX3C 1BLPA 4I3AA 5B1MB 4X6TA 3UO9A 2DMWA 3REKB 4NXFA 1FSWA 2XFSA 4S2JA 3QP4A 4KZBA 3X1TD 4J8VD 1H0IA 3VH5T 3W96D 5B0YC 1P3IC 4WZ5C 1T3UA 2YFWA 5GLBA 4BLMA 4QLCA 2NUTC 5A90A 3L28A 3MNND 1FCOA 2W3HA 1H8PA 2IO5C 5FI6A 1KX4D 3MNNC 3LFVA 5HD5A 3T1SA 2FN2A 5F1GA 4K91A 3C4OA 4MN5A 2IOUA 1CEGA 2AROD 3UE0A 3VFHA 1N9LA 3MQQA 4EWFA 3CITA 4MEZA 3KFUG 2M7VA 5KIZA 3MKEA 4NKPA 3WWXA 4DJ3A 1UWNX 5DNNB 1H3QA 3S1YA 5KSCA 2V20A 2PYOC 4WV4B 3TU4B 1ZC2A 3RXXA 5EVIA 2VQRA 3HLGA 3AFAB 2WZZA 5GHYA 4BL2A 2PR6A 4MMNA 1G6OA 3KX0X 4KQDA 5HPIA 4LD9B 5HWVA 1IYSA 4HGAB 2LB9A 4ZUXB 1FOFA 2VKSA 2DF4C 1K54C 3OZHA 2RVQC 5E5AD 2V2FF 3EEHA 1V9ZA 3AYWB 1H0GA 3E4PA 4IBKA 1SDEA 1LI0A 2OV5A 3MGRD 1GA9A 3JVVA 5B1MD 1U35B 4Z2IA 3T1XA 5DJTA 3X1SB 1W79A 3QP2A 2H10A 2J9OA 4YWZA 5HAPA 3BFGA 4BQMA 5FASA 3S22A 4Z66B 4EUZA 2Y2JA 5AVEA 3V50A 2JKTI 3AV1A 1S1YA 4KZ8A 1F5MA 3AZGA 2XLNA 1MY8A 4OP5A 5D3OA 4GDNA 3KO6A 3GDIA 5GL9A 2Y2NA 2PD7A 4XUXA 2HZ5A 1BLCA 3S7OA 4HH2A 3QP1A 3H0LC 3LR5A 3G34A 4N1HA 5G18A 1T18A 1TZYD 2GX5A 1TZYC 3KXBA 1MWTA 1XP4A 2DCFA 4GHLA 2YKFA 5GT0B 2XEPA 4GCZA 2CV5D 2Y2GA 3MGSA 4JXWA 1IEMA 3ZYTA 5B2JB 2ACGA 5AY8A 3MQOA 3UE1A 4YS3C 2OOLA 3WKJA 3W99D 2KLIA 5GHZA 5DTSA 1GCEA 5JRGB 4X23A 4MNRA 4S2OA 1L0DA 1ZLAC 5AV8D 2Q9NA 3A0SA 4E3OA 5HZHA 2QYBA 2WAEA 3MMHA 4OPZA 1P3FC 2Y8HA 1PW1A 5AV6A 3REKA 3LI9A 3MFXA 3MZEA 2R9XA 4FH2A 5G4YA 5B40A 4JKTA 1ONHA 1UR9A 5B32D 5BNVB 5B32C 4UA7A 1WYCA 5DKLA 4K08A 3B6FD 1K55A 3NDEA 4J8UB 4S2NA 5B31C 1F66D 4KG5A 3A3IA 2VK3A 1F66C 2ZC5B 2G2WA 3S7QA 5HL6A 4EXOA 4P87A 1ESIA 4YM6D 5CPJB 3CUEC 1H5XA 3SS3A 1MWUA 1YU4A 3UDFA 4J8WB 4IBBA 2RIQA 2HP6A 1G5UA 3HLWA 3RELD 3BM6A 3PTEA 4BJPA 4E3KA 1FIKA 2W1RA 1PIOA 5DNNA 1CXWA 5HDDA 5F99B 4CLCC 3TU4A 4GH9A 1PFLA 1N9OA 5B0ZC 3AFAA 3AN2D 2K31A 4MN7A 3LUQA 1BTLA 4O01A 5CHMA 4LD9A 2LB5A 4G92B 1K57A 3UB5P 3AZNC 4LV3A 5CPIB 2V8CA 4GKUA 4ZUXA 3IF6C 3NJAA 4OPYA 5FAOA 3VE4A 4JF6A 2F2AC 3LJAD 4P6ZM 4MBHA 4J8XC 4A5RA 3AZED 3LJAC 5CGWA 4CAYB 3AYWA 3AZEC 3A3DA 1E25A 4HP9A 3D4FA 1BLHA 1YUEA 3R45B 3B0CT 3JVUA 3JYIA 1U35A 4NXEA 1G28A 3T4LA 3X1SA 3SH7A 3KSGA 4OLDA 2F8NG 2P7JA 3WX7A 4R3BA 1TS8A 4Z66A 5CEBA 3LIAA 1TS6A 2PAVP 4QY6A 2Y2MA 4J8UD 1OTBA 1YAXA 5CP6D 4X1LA 4NE3A 3E0YA 1P3PC 2Z6DA 4ME4A 3NHQA 3RXWA 3W98C 5JYOA 1IKGA 2F8NB 3ZNTA 1NYYA 3IXBA 1P3MC 2XQZA 1ERMA 3UT9D 3HLDA 4QD4A 1P3GD 4KQRA 3E2KA 5GT0A 4WU9A 1XXMA 4Y7PA 3CI6A 1JVJA 2VGLM 4R8PA 3L26A 4Z2KA 5B2JA 3UMEA 1N9BA 1YU3A 3OPPA 5DF9A 2FJ7B 4XZQB 3L25A 1XJ6A 2E8IA 5B2IB 1KDWA 1ES5A 3BY9A 3SS5A 5JRGA 5AV5D 2B95A 3IH8A 3V9RB 1EAKA 5C3IB 4GD6A 4WU8C 3MGQD 5BNXB 4HJ3A 5G49B 1D7EA 1OJ5A 3VMAA 4GS9B 5BS7C 4JJNC 2GZAA 4FUWA 3EPLA 3REIB 3C1BD 4KUDC 1YLYA 1TF1A 3C1BC 1U60A 4OH0A 1BLSA 4H9OB 1BZAA 3GMWA 4WF0A 3BQ8A 3KWQD 1ACFA 1E8BA 4WL9A 1M40A 1IYQA 5CPJA 1T19A 2NQBC 2PYPA 1YSPA 2JE5A 4XUJA 3O62B 3REJC 1FQGA 4J8WA 1P3LD 3V39A 3A6NB 4GW9A 4KQOA 3IX4A 5F99A 5GT3D 3MGPD 1W8QA 3MGPC 4MBKA 3UTAA 3T4QA 1ID3B 1Y28A 1SCWA 3HUMA 5HWTA 1SKOB 4MBFA 4EBPA 4LRYC 3P7NA 2J8PA 3C7VA 1KE0A 5HW3A 2EX9A 4GHAA 1EROA 3AZMD 1YU0A 3E4QA 3WD1A 5EOEA 3OPRA 2PBYA 5B2ID 4DE0A 4HJ4A 4X1MA 3X1VA 3LGOA 1TD5A 3KUYC 3GV9A 1VETB 4JPMA 4Z5TD 4HQAA 3R45A 5GXQC 2W3FA 5F6AA 4DQYB 5B1LC 2W3GA 5F69A 4FH4A 5FEGA 3HL9A 5CECA 3NDGA 1QMFA 1PZOA 1S32A 4Y0TA 3AZIC 4OP8A 3AV2B 4Q8IA 4PPRA 3LIDA 4JF4A 3A0VA 5KDMB 1FR6A 3LELC 4B9OA 5L10A 1P9WA 5KMWA 1GSXA 5CXWA 2JKRI 5AVCB 1PWCA 5CPKD 1DRMA 2F8NA 3HONA 1SHVA 5HSQA 2F8NK 2WAFA 4IEDA 1M18D 4MN6A 3FKWA 3W97C 2K7SA 1P3OB 3C1CB 4BD1A 5TFQA 1OGBA 5A91A 3L29A 2C6WB 4OQGA 1AOID 1IKIA 4JGRA 3LZ1C 4XZQA 2FJ7A 1OT6A 2OLVA 4GNUA 5DNMA 1XGIA 2YKHA 4D2OA 4IBIA 3U4LP 3LY4A 1ODVA 3B33A 3IQAA 5B33C 5EUAA 1K4EA 3X1UB 4F3LB 4WN5A 1VHMA 3AZFC 5AVBD 5G49A 2PR5A 5HD3A 2EA9A 3PYPA 1I2WA 1P3KD 1MWRA 4KG2A 2J9PA 2NZDC 3REIA 2WZXA 4GZBA 3O3VA 3AZHD 1W63M 1Z6FA 3AZHC 4NYYA 4H9OA 3B0BA 1ZG6A 2JN7A 1SDNA 2OWHA 4NZ5A 4H9PA 3HLEA 2HIOB 3C5AA 3L9KA 4H9RB 1YMSA 5FSRA 1ED7A 3O62A 2DNSA 5E2GA 3A6NA 3ZDJA 4DJ2A 3P5JB 3FPWA 4QU3A 5F1FA 4H6JA 1QO6A 4OQIA 2GJ3A 3VP1A 3L27A 1FILA 3ZGAB 1OPXA 1S66L 3BWLA 5JA4B 1L2SA 4EO5B 2V1ZA 2VV8A 1NLYA 1ID3A 1KGEA 1TAFB 1SKOA 2WGWB 2PYRA 1S4RA 1ES4A 3LI8A 5GSUA 1M19C 3QP6A 3C1CD 3B6GB 2W27A 3HLBA 3MVDD 1T1AA 1K0KA 3AZKC 3WAAC 3KSIA 3WA9D 4NE6A 1DJBA 1YPRA 1PI4A 3KSYA 3EQUA 4ZJ3A 4E3JA 2DRWA 3V3SA 5AQBA 2JBFA 3NI9A 3LZ0C 5TBMB 2JKGA 1XA7A 3M6HA 2I72A 5TR7A 3VP2A 4BENA 1XGJA 4WM9A 1YQSA 1PWDA 1ZKJA 5AV9B 1KX3B 1XX2A 4CPKA 3AV2A 3PBSA 4I3IA 3TSGA 1CI9A 5GHXA 1R4VA 5KDMA 3UTBA 4X68A 4E45A 4E3LA 3AZLB 4L9EA 2Y2HA 5B0YB 2EFUA 1W8YA 4Y0OA 2EWVA 1P3IB 4QLCD 3RJUA 4IBDA 1J9MA 4QLCC 4TX8A 5HDSA 3ZHHA 5FQMA 5AQ9A 3WTPC 2IO5B 4ARZB 3ZFZA 3PHYA 1BUEA
chains in the Genus database with same CATH topology
1P3OA 4NY2A 1E3UA 4DKIA 4CSRB 3IWQA 1L0FA 1YLZA 4IJEA 1BSGA 2L5AA 5EVID 3QNCA 1MPLA 4NK3A 4OOLA 3EG5B 1YM1A 4S2LA 1KU5A 2PYOB 1P3BC 3VH5A 4ZBJC 3PBTA 4IBJA 3X1UA 5B24A 5FUGB 5AV6B 5B40B 3LEZA 3QNBA 1EQZA 1FR1A 3WS1A 3ZNYA 3X1TC 4IVIA 4J8VC 3W96C 3VSLA 2HIOA 4LCLA 4NZ1A 4QHCA 4H9RA 5E2EA 1KGFA 3REHB 4JBFA 1N1JB 4G91B 1KX4C 3AV1D 2XD1A 3AZGD 3G4PA 1H8YA 3AZGC 2AROC 3KS8A 5JA4A 3MZFA 3C4PA 5M19A 4EBLA 3LCEA 1TAFA 2WGWA 3W8KA 3KXBD 2Y91A 3CMZA 1P3AD 4KGCA 3B6GA 5FATA 1P3AC 1KX5B 1ALQA 3MGSD 4EV4A 5AY8D 3WKJD 4UHUA 4JLFA 3N4IA 5B32G 5E5AC 4X23D 3P98A 4KZ4A 2ZY4A 4U0TA 5AV6D 1ZLAB 5B31G 3MGRC 3REKD 2ZY2A 5B1MC 4C3QA 5B40D 5AV9A 1KX3A 4LV1A 1P3FB 2P9VB 1PI5A 4DXCA 3H0RC 4PMAA 2P74A 3A3JA 3V5MA 3AZLA 1M1AB 5B0YA 5HFOA 4E6XA 3V3RA 1P3IA 4U3TA 4RX2A 3H0MC 5B31B 3AL0C 5GLCA 1MWSA 1DJAA 3CZDA 4WU9B 4CSRA 5DNND 2CV5C 4P6BA 3TU4D 5DNNC 4R8PB 3IWOA 2IWDA 3AFAD 3TG9A 2PYOA 3AFAC 3HREA 5FI2A 2XFTA 5B0ZB 3W99C 4LD9D 4JF5A 3FZCA 2HDSA 4ZUXD 5FQQA 5AV8C 4PM9A 4ZUXC 5FUGA 3NC8A 3IF6B 3A1KA 1GHMA 3AYWD 1K54A 4IBFA 4AWLC 3AYWC 1U35D 5CGSA 3X1SD 3Q7VB 2IWBA 3PAGA 3B6FC 1Y54A 3ZG7B 4UUZA 4WMCA 3REHA 4Z66D 1N1JA 4H9SC 3LO7A 4YM6C 1ERQA 4XUJB 3ITAA 4F94A 4QB8A 4KZ9A 3BRMA 4YFMA 5FDHA 1WYBA 4LG2A 1FSYA 3IXGA 3RELC 4QNLA 2XR0A 1KGGA 2OSUA 2QMIA 3W98B 3UTAB 3AN2C 1LL5A 4WU9D 5GT0D 1P3MB 3N8LA 1KX5A 2WYXA 2WKIA 4DRBA 4DDSA 4R8PD 5HX9A 4NFTA 5B2JD 4WEJA 5B2JC 3AZJB 5CTMA 4YS3A 3IXDA 4HEFA 5JRGD 3X1VB 5JRGC 1H3OB 4X56A 2QPNA 1YMXA 1ZLAA 1P3FA 2P9VA 4Z2MH 4R1GA 2H0TA 1WE4A 1JWVA 1S32B 2Q9MA 4H8RA 3M2JA 2G5HC 4U0XA 2DQNC 2UWXA 1M1AA 1GA0A 4J8UC 4IBEA 1ULYA 5CP6C 4KUDB 1KDSA 5B31A 3AGFA 2RL3A 4JXGA 5CPJD 2ZQAA 1PWGA 5CPJC 1K25A 4XUJD 3OPLA 4ZJ2A 4LV2A 4K0XA 4J8WD 1I5QA 3UT9C 3REJB 5L2FA 1P3GC 2Y4AA 2XF3A 5F99D 5CERA 3MKFA 3N6IA 2HUEB 3BFEA 3UTAD 5A93A 3IXHA 1K6RA 5B0ZA 2Z2LB 3VP3A 3ZVTA 5DNMB 4HESA 5CPID 4G92C 3Q81A 1LL9A 5CPIC 5AV5C 2PU4A 3B0DC 3AZNA 2ZQ9A 3UPPA 3VP0A 1B67A 1XKZA 3IF6A 2ZD8A 4OJ6A 3MGQC 4UA9A 4C75A 4J8XA 2Y2IA 3FV7A 3NQJA 2QZ6A 3NQUB 3PBQA 3Q7VA 2HDQA 3KUYB 2BYMB 5GXQB 4OJLA 4X55A 5FQIA 5CEDA 5B1LB 2F8NH 1S32D 1RGZA 4H9PB 3KWQC 3IH9A 2ZM5A 4KZ7A 1LI9A 3HLFA 3AZIB 4OONA 5M18A 2CWEA 5M1AA 4OJOA 4P85A 2X71A 1P3LC 5CHJA 1CEFA 4WNNB 5IHVA 1P3PA 3BEBA 2F8ND 5GT3C 5FQKA 3W98A 1P3MA 3L2AA 5GSUB 3VH6W 1K38A 4PM6A 5A92A 2W8SA 2YFVB 2A3UA 5E43A 1VM1A 3AZJA 4XZQD 2FJ7D 3AZMC 2Y2KA 5B2IC 3HVFA 3LZ1B 5DNMD 4LV0A 1H3OA 1PYYA 2CC1A 2Y2QA 4Z5TC 5C3IC 1TEMA 3SOIA 5B33B 2G5IC 4WU8A 1NZOA 3QHYA 3AZFB 3REID 5BS7A 4JJNA 1AXBA 2NZDB 4UPKA 4KUDA 3UTBB 3VOZA 3M6BA 3C1BA 5FAQA 5J8XA 2A49A 4IBGA 3O62D 5CPKC 4KZ5A 2ZQ7A 3A6ND 2NQBA 4R4RA 4IJFA 1XPBA 3REJA 1S6RA 1JFIA 1KE4A 1PZRA 4H9NB 1M18C 5F82A 3ZG0A 3G2ZA 2H0YA 1ID3D 3Q82A 4WYYA 4HBTA 3G31A 2ZQCA 4PM8A 2RCXA 1AOIC 4BD0A 3CJMA 1BH8B 5GSUD 1P34B 3PAEA 4M3KA 1ONGA 1YLTA 3IWIA 4E3NA 2XDMA 3FKEA 3AZKB 3WAAB 5B24B 1Q2QA 5AVBC 3NIAA 2WUQA 4ID4A 1P3KC 4ZTKA 1HQ3B 3NQUA 3KUYA 3GQZA 2BYMA 1EQZB 5GXQA 5B1LA 4B4ZA 4KZ3A 3LZ0B 3AV2D 3IP4C 2WKHA 4L0LA 4WZSB 3AZIA 5EOOA 3UTBD 3FDDA 2R9WA 3LELA 3VSKA 5AVCD 4WNNA 1S0WA 2Z2MB 5AVCC 4WBGA 4LENA 2IWCA 4C6YA 3OCNA 3Q07A 1YT4A 3CG5A 1BT5A 1NZUA 1P3OD 3ITBA 4KGCB 1GHIA 2YFVA 1E3UD 3WTPB 3W97A 3C1CC 2BYKB 3MVDC 4XXRA 1SKFA 4OLGA 4RYEA 3BFCA 3WA9C 3LZ1A 3N8SA 1CI8A 4M6BA 1DY6A 3X1UD 4NZ4A 1P3BB 4DRTA 5B33A 3W4PA 5B24D 2EFXA 4OOYA 3AZFA 5CHLB 5JYPA 4N1XA 1EQZD 3Q7ZA 4WEKA 2NZDA 2X02A 2PU2A 3X1TB 2HIOD 4J8VB 1W5DA 2HIOC 2Y2PA 4X53A 4N92A 4O7DA 3OC2A 4WELA 3A1IA 2HP5A 2ZC3B 4X69A 3EPHA 3ZCZA 3MNNB 4H9NA 4OJ5A 4XUZA 4EO5C 4OVDA 2AROB 4UAAA 5BT1D 3VH6A 1BH8A 5BT1C 1P34A 2WK0A 4KGCD 5EVIC 4DXBA 3B6GD 3SH9A 4DDYA 4H9QB 5DTTA 3B6GC 1YU1A 2ZM0A 5E2HA 1M19A 4OJPA 3UN7A 3AZKA 3WAAA 1WWIA 3VH6T 3E2LA 1N4OA 3KS4A 3GTCA 2WKEA 1HQ3A 5E2FA 2XGNA 1YLJA 2XH9A 3IT9A 2Y2OA 1NXYA 3B3XA 1G6AA 2J8YA 5E5AB 5AV9D 1KX3D 3LZ0A 3N7WA 3MGRB 1K56A 3HLCA 4UUZB 1MKIA 1IYPA 4DE2A 5BOHA 3AZLD 5EPHA 5B0YD 3AZLC 3AV1C 3G35A 4IBRA 1P3ID 3ZG9B 3C7UA 4S2KA 1I2SA 1HVBA 5KZHA 3UE3A 3KXBC 3WTPA 3BFFA 1TZYB 2BYKA 3WS4A 5DF7A 2FFYA 5TGFA 2ZY3A 3MGSC 3G30A 4E3MA 4PM5A 5AY8C 2CV5B 2PYOD 3WKJC 5GLDA 2H5SA 4YS3B 1HTAA 1FCMA 3PBNA 3MFDA 4NE5A 1P3BA 4RVAA 4X23C 3W99B 5FQJA 1OMEA 5EECA 5CRFA 1EWZA 4KQQA 3A3EA 2XK1A 1BULA 5AV6C 3REKC 5AV8B 3IF5A 3VOYA 1B6WA 5B40C 2RVQD 3FYZA 4S2PA 4AWLB 3X1TA 5B32B 1K55C 4J8VA 3W96A 1MBLA 4S2NC 4WZ5A 4WMCD 3REHD 4LCMA 3UDIA 3B6FB 3REHC 4RX3A 4FCFA 4FSFA 1F66B 4G91C 3MNNA 3UY6A 1KX4A 4YM6B 3MXRA 1PW8A 1DJCA 2AROA 4OPRA 3IHAA 5GLAA 4JXSA 3TU4C 1RP5A 3RELB 5BO0B 4ZAMA 4H9QA 3GRJA 1KX5D 1JWZA 4GB7A 1KX5C 1P3AA 3AN2B 4LD9C 1K57C 2EX8A 4HGAC 4OOMA 1RGYA 3AZNB 2WGVA 3LY3A 3WS2A 4OQ0A 4YS3D 4IBCA 4IBXA 4J8XB 1L0GA 3LJAB 3NQJB 2GDNA 2VGKA 4YINA 5E5AA 1HD8A 4JXVA 3AZEB 1ZLAD 1ES2A 5CTNA 5AQAA 1U35C 3X1SC 1G68A 1P3FD 3MGRA 5B1MA 1C3BA 4Z66C 1O7EA 1VQQA 5DF8A 1M1AD 4Z2MG 2HP9A 1M1AC 3WRTA 4DF6A 5B31D 4HBUA 5CP6B 5FA7A 1P3PB 3EQVA 3FKVA 3UPNA 1IELA 1TZYA 3DWKA 5GT0C 4WU9C 4QY5A 3I7JA 3UT9B 3OCLA 2JC7A 3WS5A 4R8PC 1P3GB 1BFMA 2CV5A 3HSHA 5CHUA 1KVLA 1JTDA 5B0ZD 2HDRA 5BPVA 1QMEA 3OPHA 4ZBEA 5AQ7A 3W99A 3WS0A 3AZND 1KE3A 4B88A 2ZLYA 2LY8A 5AV8A 5AV5B 1O07A 3B0DB 3IHBA 1YLPA 4WU8B 4J8XD 3MGQB 5B32A 3TOIA 4JJNB 3PBOA 4QJGA 4E3IA 3BYDA 1PZPA 4FD8A 3C1BB 3B6FA 4KENB 5FAPA 3FWLA 4KHAB 4NYUA 1F66A 4H9SA 4NZ3A 1JWPA 3KWQB 4XUJC 5EE8A 2NQBB 3BECA 4YM6A 4J8WC 3W4OA 1L0EA 1JFIB 1P3PD 5F99C 1P3LB 1FCNA 3GVBA 3W98D 2OLUA 3RELA 5BO0A 3UTAC 4S2MA 4K0WA 5GT3B 3MGPB 3BLSA 1P3MD 1TVFA 3AN2A 1KVMA 1ES3A 1YLWA 1M6KA 2EXBA 2B5RA 4N9LA 3AZJD 2JSSA 3BFDA 3AZJC 3AZMB 1ZG4A 3X1VD 5HARA 3LJAA 3X1VC 3AZEA 1GHPA 3UDXA 4DRAA 1CK3A 4Z5TB 1NY0A 3G32A 2Y2LA 4WU8D 1W7FA 4EBNA 1S32C 2ZMAA 3HUNA 4JJND 5BNVA 4Y0UA 4E6WA 4KUDD 2WADA 1E4DA 4J8UA 5CP6A 2ZC7A 3GSGA 3LELB 1YU2A 3WTPE 3F6TA 2NQBD 4R0QA 1TDGA 5CPKB 3REJD 4KZAA 4GN2A 3AGDA 4S2IA 2JCHA 1ESUA 3N8RA 3UT9A 3W97B 1P3GA 5I94A 2HUEC 1M18B 1LHYA 2ZJ9A 3HUOA 2FJ7C 4XZQC 2XD5A 1NRFA 4ZDXA 1AOIB 3BLMA 5DNMC 2ZM2A 3UNWA 2ZQ8A 2ZM8A 3AGEA 5AV5A 5CPIA 4KZ6A 3NBLA 3VH5W 3MGQA 3W4QA 5AVBB 3REIC 4CAYA 5EVLA 3KUYD 3Q1FA 5GXQD 1P3KB 4B4XA 5B1LD 3SS4A 3AZHB 3MZDA 3SH8A 3EPKA 3S4XA 4KHAA 1Q9CA 3EPJA 4KG6A 3AZID 3NCKA 4ZJ1A 3KWQA 1Q2PA 3M2KA 3O62C 1H8ZA 3A6NC 3VP4A 3LELD 1K4FA 3G2YA 1TDLA 3VFFA 1P3LA 3PBRA 2HDUA 2J7VA 2EX2A 1A7WA 5GT3A 1NYMA 1ID3C 3MGPA 4DE3A 1LLBA 5GSUC 4BL3A 3W97D 3HBRA 3ZG5A 1NJ4A 1M19B 1K6SA 4R3JA 4PM7A 2VGJA 1JTGA 2ZQDA 3LZ1D 3MVDB 1BH9B 3AZMA 4R4SA 2EXAA 5B2IA 3WA9B 4WZ4A 1W2EA 3V9RA 5B33D 4Z5TA 3AZFD 4IVKA 4Z9QA 5BNXA 5F83A 4GOGA 3AV2C 2NZDD 3UTBC 3P09A 5HL1A 4WJ3C 1MXOA 4CJNA 1IYOA 2EX6A 3MBZA 3NY4A 1HZOA 4UA6A 2YFWB 5CPKA 3WRZA 3ZVWA 4QLCB 3O87A 3ZG8B 1WWSA 2BG1A 1P3OC 3N3FA 1M18A 2C5WB 4GD8A 2Y55A 1F1EA 1P34D 3A3FA 3MXSA 1P34C 1AOIA 5HAQA 2G2UA 4RA7A 3GR2A 1M19D 5EVIB 4R23A 3UPOA 3X1UC 1Z2CB 3AZKD 3DW0A 4ZBJB 3WAAD 1HTZA 4OPQA 4GDBA 3O86A 5B24C 4DE1A 1HQ3D 5AVBA 1HQ3C 5CGXA 3O88A 1P3KA 1RCJA 5FI7A 1EQZC 4MLLA 3AZHA 3W96B 3LZ0D 1K56D 2ZC4B 1XA1A 4P0MA 4NETA 3DTMA 2ZC6B 1KX4B 3ISGA 2FFFB 3AV1B 5U47A 4OUIA 3AZGB 5AVCA 1EI5A 5DVAA 2BLSA 5DTKA 5HAIA 2HPBA 3WTPD 4KGCC 2WGIA 2X01A 4OKPA 3KXBB 3DWZA 1P3AB 3C1CA 5KSHA 3MVDA 1BH9A 5FQ9A 4OQHA 2ZY5A 3MGSB 3WA9A 4E44A 2Y59A 5AY8B 3B0CW 1P3BD 3WKJB 4N9KA 4EQIA 4X23B 5AV9C 1KX3C 1BLPA 5B1MB 4X6TA 3UO9A 3REKB 1FSWA 2XFSA 4S2JA 4KZBA 3X1TD 4J8VD 3VH5T 3W96D 5B0YC 1P3IC 4WZ5C 1T3UA 2YFWA 5GLBA 4BLMA 4QLCA 5A90A 3L28A 3MNND 1FCOA 2IO5C 5FI6A 1KX4D 3MNNC 5F1GA 4K91A 3C4OA 2IOUA 1CEGA 2AROD 3UE0A 3VFHA 4EWFA 4MEZA 3KFUG 3MKEA 3WWXA 5DNNB 3S1YA 5KSCA 2V20A 2PYOC 4WV4B 3TU4B 1ZC2A 3RXXA 5EVIA 2VQRA 3HLGA 3AFAB 2WZZA 5GHYA 4BL2A 4LD9B 1IYSA 4HGAB 4ZUXB 1FOFA 2DF4C 1K54C 3OZHA 2RVQC 5E5AD 2V2FF 3AYWB 4IBKA 1SDEA 1LI0A 2OV5A 3MGRD 1GA9A 5B1MD 1U35B 3X1SB 1W79A 2H10A 2J9OA 5HAPA 3BFGA 4BQMA 5FASA 3S22A 4Z66B 4EUZA 2Y2JA 3V50A 3AV1A 4KZ8A 3AZGA 2XLNA 1MY8A 4OP5A 5D3OA 4GDNA 5GL9A 2Y2NA 4XUXA 1BLCA 3H0LC 3G34A 4N1HA 5G18A 1TZYD 1TZYC 3KXBA 1MWTA 1XP4A 2DCFA 4GHLA 5GT0B 2XEPA 2CV5D 2Y2GA 3MGSA 4JXWA 1IEMA 5B2JB 5AY8A 3UE1A 4YS3C 3WKJA 3W99D 5GHZA 5DTSA 1GCEA 5JRGB 4X23A 4MNRA 4S2OA 1L0DA 1ZLAC 5AV8D 2Q9NA 4E3OA 2WAEA 4OPZA 1P3FC 1PW1A 5AV6A 3REKA 3MZEA 4FH2A 2R9XA 5B40A 4JKTA 1ONHA 5B32D 5BNVB 5B32C 4UA7A 1WYCA 3B6FD 1K55A 3NDEA 4J8UB 4S2NA 5B31C 1F66D 4KG5A 3A3IA 1F66C 2ZC5B 2G2WA 4P87A 1ESIA 4YM6D 5CPJB 1H5XA 3SS3A 1MWUA 1YU4A 3UDFA 4J8WB 4IBBA 2RIQA 2HP6A 3HLWA 3RELD 3BM6A 3PTEA 4BJPA 4E3KA 1PIOA 5DNNA 5F99B 3TU4A 4GH9A 5B0ZC 3AFAA 3AN2D 1BTLA 5CHMA 4LD9A 4G92B 1K57A 3AZNC 4LV3A 5CPIB 4GKUA 4ZUXA 3IF6C 4OPYA 5FAOA 4JF6A 2F2AC 3LJAD 4MBHA 4J8XC 4A5RA 3AZED 3LJAC 5CGWA 4CAYB 3AYWA 3AZEC 3A3DA 1E25A 3D4FA 1BLHA 1YUEA 3R45B 3B0CT 3JYIA 1U35A 3X1SA 3SH7A 4OLDA 2F8NG 3WX7A 4R3BA 4Z66A 5CEBA 4QY6A 2Y2MA 4J8UD 5CP6D 4NE3A 1P3PC 3RXWA 3W98C 5JYOA 1IKGA 2F8NB 3ZNTA 1NYYA 3IXBA 1P3MC 2XQZA 1ERMA 3UT9D 3HLDA 4QD4A 1P3GD 4KQRA 3E2KA 5GT0A 4WU9A 1XXMA 4Y7PA 1JVJA 4R8PA 3L26A 5B2JA 1N9BA 1YU3A 3OPPA 5DF9A 2FJ7B 4XZQB 3L25A 2E8IA 5B2IB 1KDWA 1ES5A 3SS5A 5JRGA 5AV5D 3IH8A 3V9RB 5C3IB 4GD6A 4WU8C 3MGQD 5BNXB 5G49B 3VMAA 5BS7C 4JJNC 3EPLA 3REIB 3C1BD 4KUDC 1YLYA 3C1BC 1U60A 4OH0A 1BLSA 4H9OB 1BZAA 3GMWA 3KWQD 1M40A 1IYQA 5CPJA 2NQBC 2JE5A 4XUJA 3O62B 3REJC 1FQGA 4J8WA 1P3LD 3V39A 3A6NB 4KQOA 5F99A 5GT3D 3MGPD 1W8QA 3MGPC 4MBKA 3UTAA 1ID3B 1SCWA 3HUMA 4MBFA 4EBPA 2J8PA 3C7VA 1KE0A 5HW3A 2EX9A 4GHAA 1EROA 3AZMD 1YU0A 5EOEA 3OPRA 2PBYA 5B2ID 4DE0A 3X1VA 3KUYC 3GV9A 4JPMA 4Z5TD 3R45A 5GXQC 4DQYB 5B1LC 4FH4A 3HL9A 5CECA 3NDGA 1QMFA 1PZOA 1S32A 4Y0TA 3AZIC 4OP8A 3AV2B 4Q8IA 4PPRA 4JF4A 5KDMB 1FR6A 3LELC 5KMWA 5CXWA 5AVCB 1PWCA 5CPKD 2F8NA 3HONA 1SHVA 2F8NK 2WAFA 4IEDA 1M18D 3FKWA 3W97C 1P3OB 3C1CB 4BD1A 5TFQA 5A91A 3L29A 2C6WB 4OQGA 1AOID 1IKIA 3LZ1C 4XZQA 2FJ7A 2OLVA 4GNUA 5DNMA 1XGIA 4D2OA 4IBIA 3LY4A 3IQAA 5B33C 5EUAA 1K4EA 3X1UB 3AZFC 5AVBD 5G49A 1I2WA 1P3KD 1MWRA 4KG2A 2J9PA 2NZDC 3REIA 2WZXA 4GZBA 3O3VA 3AZHD 1Z6FA 3AZHC 4NYYA 4H9OA 3B0BA 1ZG6A 1SDNA 4NZ5A 4H9PA 3HLEA 2HIOB 3C5AA 4H9RB 1YMSA 5FSRA 3O62A 2DNSA 5E2GA 3A6NA 3ZDJA 3P5JB 4QU3A 5F1FA 4OQIA 3VP1A 3L27A 3ZGAB 5JA4B 1L2SA 4EO5B 2V1ZA 1ID3A 1KGEA 1TAFB 2WGWB 1ES4A 5GSUA 1M19C 3C1CD 3B6GB 3HLBA 3MVDD 3AZKC 3WAAC 3WA9D 4NE6A 1DJBA 1PI4A 3KSYA 3EQUA 4ZJ3A 4E3JA 2DRWA 3V3SA 5AQBA 2JBFA 3NI9A 3LZ0C 5TR7A 1XA7A 3M6HA 2I72A 3VP2A 4BENA 1XGJA 4WM9A 1YQSA 1PWDA 1ZKJA 5AV9B 1KX3B 1XX2A 4CPKA 3AV2A 3PBSA 3TSGA 1CI9A 5GHXA 1R4VA 5KDMA 3UTBA 4X68A 4E45A 4E3LA 3AZLB 2Y2HA 5B0YB 2EFUA 1W8YA 4Y0OA 1P3IB 4QLCD 3RJUA 4IBDA 1J9MA 4QLCC 3ZHHA 5FQMA 5AQ9A 3WTPC 2IO5B 3ZFZA 1BUEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G2Z A;  4S2M A;  2H0Y A;  4K0W A;  1E3U A;  1MWT A;  3BLS A;  3Q82 A;  1XP4 A;  4HBT A;  2DCF A;  3G31 A;  1TVF A;  2ZQC A;  4WYY A;  3IWQ A;  2RCX A;  4PM8 A;  1L0F A;  1YLZ A;  4BD0 A;  3CJM A;  2XEP A;  1KVM A;  1BSG A;  1ES3 A;  2Y2G A;  1YLW A;  5EVI D;  3QNC A;  1M6K A;  1MPL A;  2EXB A;  3PAE A;  2B5R A;  4M3K A;  3BFD A;  4N9L A;  4NK3 A;  4JXW A;  1IEM A;  4OOL A;  4S2L A;  1YM1 A;  1ONG A;  1YLT A;  3IWI A;  3UE1 A;  4E3N A;  2XDM A;  3PBT A;  1ZG4 A;  5GHZ A;  5HAR A;  5DTS A;  1Q2Q A;  1GCE A;  3NIA A;  4MNR A;  4S2O A;  1L0D A;  4E3O A;  2Q9N A;  2WUQ A;  4ID4 A;  1GHP A;  4ZTK A;  3UDX A;  2WAE A;  4OPZ A;  1CK3 A;  1PW1 A;  3GQZ A;  3MZE A;  1NY0 A;  2R9X A;  2Y2L A;  3G32 A;  1W7F A;  4FH2 A;  3LEZ A;  3QNB A;  4JKT A;  1FR1 A;  3WS1 A;  3ZNY A;  1ONH A;  4EBN A;  4IVI A;  4B4Z A;  2ZMA A;  3HUN A;  4KZ3 A;  4UA7 A;  1WYC A;  4Y0U A;  4E6W A;  3VSL A;  1K55 A;  2WKH A;  3NDE A;  4L0L A;  2WAD A;  4LCL A;  4S2N A;  4QHC A;  5EOO A;  1E4D A;  5E2E A;  1KGF A;  4JBF A;  4KG5 A;  2ZC7 A;  3GSG A;  3A3I A;  2ZC5 B;  2G2W A;  2R9W A;  3VSK A;  4P87 A;  1ESI A;  2XD1 A;  1S0W A;  2Z2M B;  3G4P A;  4WBG A;  1H8Y A;  4LEN A;  2IWC A;  1H5X A;  4C6Y A;  4R0Q A;  3SS3 A;  1TDG A;  1MWU A;  3OCN A;  3UDF A;  4KZA A;  3MZF A;  3Q07 A;  3C4P A;  4GN2 A;  3AGD A;  4S2I A;  1YT4 A;  3CG5 A;  5M19 A;  2HP6 A;  3HLW A;  2JCH A;  1BT5 A;  1ESU A;  1NZU A;  3BM6 A;  3LCE A;  3N8R A;  3PTE A;  4BJP A;  4E3K A;  2WGW A;  3ITB A;  5I94 A;  1PIO A;  2Y91 A;  3W8K A;  1GHI A;  3CMZ A;  1E3U D;  1LHY A;  5FAT A;  2ZJ9 A;  3HUO A;  4XXR A;  2XD5 A;  1SKF A;  4OLG A;  1NRF A;  1ALQ A;  4RYE A;  1BTL A;  4ZDX A;  3BFC A;  3BLM A;  4EV4 A;  3N8S A;  2ZM2 A;  5CHM A;  3UNW A;  1CI8 A;  1K57 A;  2ZQ8 A;  2ZM8 A;  4LV3 A;  4GKU A;  4UHU A;  3IF6 C;  4JLF A;  3AGE A;  4OPY A;  1DY6 A;  5FAO A;  3N4I A;  4KZ6 A;  4JF6 A;  3NBL A;  4DRT A;  4MBH A;  4A5R A;  3P98 A;  3W4P A;  5CGW A;  4KZ4 A;  2EFX A;  4OOY A;  3A3D A;  1E25 A;  3W4Q A;  5EVL A;  3D4F A;  1BLH A;  4U0T A;  3Q1F A;  5JYP A;  3JYI A;  4C3Q A;  4N1X A;  4LV1 A;  4B4X A;  3Q7Z A;  2P9V B;  4WEK A;  1PI5 A;  2X02 A;  3SH7 A;  3SS4 A;  2PU2 A;  4OLD A;  3SH8 A;  3MZD A;  4DXC A;  4PMA A;  3S4X A;  4R3B A;  2P74 A;  3A3J A;  5CEB A;  3V5M A;  4KG6 A;  3NCK A;  1W5D A;  4ZJ1 A;  4QY6 A;  5HFO A;  2Y2M A;  4E6X A;  3V3R A;  1Q2P A;  3M2K A;  2Y2P A;  1H8Z A;  4U3T A;  4N92 A;  4X53 A;  4O7D A;  4RX2 A;  3VP4 A;  3OC2 A;  4WEL A;  1K4F A;  2HP5 A;  3G2Y A;  2ZC3 B;  1TDL A;  4X69 A;  3VFF A;  3ZCZ A;  5GLC A;  3PBR A;  1MWS A;  2HDU A;  3RXW A;  2J7V A;  1DJA A;  5JYO A;  2EX2 A;  1IKG A;  3ZNT A;  1NYY A;  1NYM A;  3CZD A;  3IXB A;  4XUZ A;  2XQZ A;  1ERM A;  4OVD A;  4UAA A;  3HLD A;  4QD4 A;  4DE3 A;  4KQR A;  1LLB A;  3E2K A;  4P6B A;  1XXM A;  4BL3 A;  2WK0 A;  4DXB A;  5EVI C;  4Y7P A;  3HBR A;  3ZG5 A;  3IWO A;  1JVJ A;  1NJ4 A;  3SH9 A;  2IWD A;  4DDY A;  3TG9 A;  1K6S A;  5DTT A;  4R3J A;  2ZM0 A;  5E2H A;  4PM7 A;  3HRE A;  1N9B A;  2VGJ A;  1JTG A;  2ZQD A;  2XFT A;  3OPP A;  5DF9 A;  5FI2 A;  2E8I A;  1KDW A;  1ES5 A;  4JF5 A;  3UN7 A;  4R4S A;  3FZC A;  2EXA A;  3SS5 A;  2HDS A;  3E2L A;  5FQQ A;  1N4O A;  4WZ4 A;  3GTC A;  3IH8 A;  4PM9 A;  2WKE A;  3NC8 A;  5E2F A;  3IF6 B;  4GD6 A;  2XGN A;  1YLJ A;  2XH9 A;  3IT9 A;  1GHM A;  2Y2O A;  1NXY A;  1K54 A;  3B3X A;  1G6A A;  2J8Y A;  4IVK A;  4Z9Q A;  5F83 A;  3VMA A;  5CGS A;  4GOG A;  3Q7V B;  2IWB A;  3PAG A;  3N7W A;  1K56 A;  3HLC A;  1YLY A;  1MKI A;  1Y54 A;  1U60 A;  3P09 A;  4OH0 A;  3ZG7 B;  1BLS A;  4WMC A;  5HL1 A;  1BZA A;  1MXO A;  3GMW A;  1IYP A;  4CJN A;  4DE2 A;  5BOH A;  5EPH A;  3LO7 A;  1IYO A;  3G35 A;  1M40 A;  4IBR A;  1ERQ A;  1IYQ A;  2EX6 A;  3MBZ A;  3NY4 A;  3ZG9 B;  3C7U A;  4S2K A;  1HZO A;  3ITA A;  1I2S A;  4QB8 A;  4F94 A;  4KZ9 A;  2JE5 A;  3BRM A;  4UA6 A;  1FQG A;  3WRZ A;  1HVB A;  3ZVW A;  3O87 A;  4YFM A;  1WYB A;  5FDH A;  3ZG8 B;  3V39 A;  1FSY A;  5KZH A;  2BG1 A;  3IXG A;  4KQO A;  3UE3 A;  2XR0 A;  1KGG A;  2QMI A;  2OSU A;  2C5W B;  3BFF A;  1W8Q A;  4GD8 A;  4MBK A;  3WS4 A;  5DF7 A;  2FFY A;  1LL5 A;  2Y55 A;  3A3F A;  3N8L A;  1SCW A;  2WYX A;  3HUM A;  3MXS A;  4MBF A;  5TGF A;  4EBP A;  2WKI A;  3G30 A;  5HAQ A;  4DDS A;  5HX9 A;  4E3M A;  2G2U A;  4RA7 A;  4PM5 A;  3GR2 A;  3C7V A;  1KE0 A;  5EVI B;  5HW3 A;  4WEJ A;  5GLD A;  4R23 A;  2H5S A;  2EX9 A;  1ERO A;  5EOE A;  3UPO A;  5CTM A;  1FCM A;  3OPR A;  2PBY A;  3DW0 A;  3PBN A;  3MFD A;  1HTZ A;  4OPQ A;  4GDB A;  4RVA A;  3O86 A;  3IXD A;  4HEF A;  4DE0 A;  4DE1 A;  5FQJ A;  1OME A;  5EEC A;  5CRF A;  1EWZ A;  4KQQ A;  3A3E A;  4X56 A;  2QPN A;  2XK1 A;  1BUL A;  1YMX A;  5CGX A;  3GV9 A;  3O88 A;  4JPM A;  4EBL A;  3IF5 A;  3VOY A;  1RCJ A;  5FI7 A;  4MLL A;  2P9V A;  4FH4 A;  3FYZ A;  4S2P A;  3HL9 A;  4R1G A;  5CEC A;  2H0T A;  1WE4 A;  3NDG A;  1JWV A;  1QMF A;  2Q9M A;  1PZO A;  4H8R A;  3M2J A;  1K56 D;  1K55 C;  4U0X A;  2ZC4 B;  4Y0T A;  2UWX A;  1MBL A;  4S2N C;  4OP8 A;  1GA0 A;  4WZ5 A;  4WMC D;  4LCM A;  3UDI A;  4Q8I A;  4PPR A;  1XA1 A;  4P0M A;  1KDS A;  4JF4 A;  4RX3 A;  4FCF A;  1FR6 A;  4NET A;  3DTM A;  4FSF A;  3AGF A;  2RL3 A;  4JXG A;  2ZC6 B;  3ISG A;  2FFF B;  5KMW A;  2ZQA A;  1PWG A;  5CXW A;  3UY6 A;  1K25 A;  5U47 A;  1PWC A;  3OPL A;  4ZJ2 A;  3MXR A;  4K0X A;  4LV2 A;  1I5Q A;  1EI5 A;  1SHV A;  5DVA A;  2BLS A;  1PW8 A;  1DJC A;  4OPR A;  3IHA A;  5L2F A;  5GLA A;  2WAF A;  2Y4A A;  2XF3 A;  5DTK A;  4IED A;  5HAI A;  4JXS A;  5CER A;  3MKF A;  3N6I A;  2HPB A;  1RP5 A;  3FKW A;  4ZAM A;  2WGI A;  3BFE A;  2X01 A;  4OKP A;  3GRJ A;  5A93 A;  3IXH A;  5TFQ A;  4BD1 A;  3DWZ A;  1K6R A;  5A91 A;  2C6W B;  1JWZ A;  4OQG A;  4GB7 A;  1IKI A;  5KSH A;  2Z2L B;  3VP3 A;  5FQ9 A;  1K57 C;  2EX8 A;  3ZVT A;  4HES A;  4OOM A;  4OQH A;  1RGY A;  3Q81 A;  2OLV A;  4GNU A;  1LL9 A;  2WGV A;  3LY3 A;  3WS2 A;  1XGI A;  2PU4 A;  2Y59 A;  4OQ0 A;  4D2O A;  3LY4 A;  2ZQ9 A;  3UPP A;  3IQA A;  3VP0 A;  1XKZ A;  3IF6 A;  4N9K A;  2ZD8 A;  5EUA A;  1K4E A;  4IBX A;  4EQI A;  1L0G A;  4UA9 A;  2GDN A;  2VGK A;  4YIN A;  4C75 A;  4JXV A;  1HD8 A;  2Y2I A;  3FV7 A;  1ES2 A;  5CTN A;  1I2W A;  5AQA A;  2QZ6 A;  1MWR A;  4KG2 A;  2J9P A;  1BLP A;  1G68 A;  3PBQ A;  3Q7V A;  4X6T A;  2HDQ A;  3UO9 A;  2WZX A;  4GZB A;  1FSW A;  2XFS A;  3O3V A;  4X55 A;  1C3B A;  5FQI A;  4S2J A;  5CED A;  1Z6F A;  4KZB A;  1O7E A;  1ZG6 A;  1RGZ A;  1VQQ A;  5DF8 A;  3IH9 A;  1SDN A;  2HP9 A;  4KZ7 A;  1LI9 A;  3HLE A;  4WZ5 C;  3HLF A;  3C5A A;  4OON A;  3WRT A;  4DF6 A;  5M18 A;  1YMS A;  5M1A A;  5FSR A;  4HBU A;  4P85 A;  5GLB A;  4BLM A;  2X71 A;  2DNS A;  5E2G A;  5A90 A;  5FA7 A;  1FCO A;  5CHJ A;  3ZDJ A;  3EQV A;  5FI6 A;  1CEF A;  3FKV A;  4QU3 A;  5F1F A;  4OQI A;  3UPN A;  5IHV A;  1IEL A;  3VP1 A;  3BEB A;  5F1G A;  4K91 A;  5FQK A;  3C4O A;  3ZGA B;  1CEG A;  3UE0 A;  1L2S A;  2V1Z A;  3VFH A;  3DWK A;  4EWF A;  4QY5 A;  4MEZ A;  1KGE A;  3I7J A;  3OCL A;  2JC7 A;  3WS5 A;  3MKE A;  2WGW B;  3WWX A;  1ES4 A;  1K38 A;  4PM6 A;  3S1Y A;  5A92 A;  5KSC A;  2V20 A;  3RXX A;  1ZC2 A;  2A3U A;  5EVI A;  5CHU A;  3HLB A;  5E43 A;  1VM1 A;  3HLG A;  1KVL A;  1JTD A;  2WZZ A;  5GHY A;  4BL2 A;  2HDR A;  2Y2K A;  1QME A;  3OPH A;  3HVF A;  4ZBE A;  5AQ7 A;  3WS0 A;  4LV0 A;  1IYS A;  1KE3 A;  4B88 A;  2ZLY A;  1PYY A;  2CC1 A;  2Y2Q A;  1O07 A;  1FOF A;  1DJB A;  3IHB A;  1PI4 A;  1YLP A;  1K54 C;  1TEM A;  3OZH A;  3SOI A;  3EQU A;  4ZJ3 A;  4E3J A;  2V2F F;  2DRW A;  3V3S A;  5AQB A;  2JBF A;  1NZO A;  3NI9 A;  3QHY A;  5TR7 A;  1SDE A;  1LI0 A;  1XA7 A;  2I72 A;  3M6H A;  2OV5 A;  3VP2 A;  4BEN A;  1GA9 A;  3TOI A;  4DKI A;  1XGJ A;  3PBO A;  4WM9 A;  4E3I A;  1YQS A;  3BYD A;  4QJG A;  1PWD A;  1ZKJ A;  1XX2 A;  1AXB A;  1W79 A;  1PZP A;  2H10 A;  3PBS A;  4FD8 A;  3TSG A;  4CPK A;  2J9O A;  5HAP A;  3VOZ A;  1CI9 A;  5GHX A;  3M6B A;  4KEN B;  5FAP A;  3BFG A;  3FWL A;  5FAQ A;  4BQM A;  4X68 A;  5FAS A;  3S22 A;  4E3L A;  2A49 A;  5J8X A;  2Y2H A;  4EUZ A;  1JWP A;  2Y2J A;  1W8Y A;  2EFU A;  3V50 A;  4Y0O A;  5EE8 A;  3BEC A;  4KZ5 A;  4KZ8 A;  3RJU A;  2XLN A;  1MY8 A;  2ZQ7 A;  4OP5 A;  5D3O A;  3W4O A;  4GDN A;  1L0E A;  1J9M A;  4R4R A;  5GL9 A;  2Y2N A;  1XPB A;  4XUX A;  3ZHH A;  1BLC A;  5FQM A;  1S6R A;  1KE4 A;  1FCN A;  5AQ9 A;  3G34 A;  3GVB A;  4N1H A;  5G18 A;  5F82 A;  2OLU A;  3ZFZ A;  1BUE A;  3ZG0 A; 
#chains in the Genus database with same CATH topology
 1P3O A;  3K2N A;  4NY2 A;  2NUP C;  1E3U A;  5EM1 A;  4DKI A;  4CSR B;  3IWQ A;  1L0F A;  1YLZ A;  4IJE A;  5IU1 A;  1BSG A;  2L5A A;  5EVI D;  3QNC A;  1MPL A;  4NK3 A;  2XSS A;  4OOL A;  2JHE A;  2G7U A;  3EG5 B;  1YM1 A;  4S2L A;  1KU5 A;  2PYO B;  3DTK A;  1P3B C;  1UGU A;  3VH5 A;  4ZBJ C;  3PBT A;  5DJU A;  4IBJ A;  3X1U A;  4F3L A;  2O0Y A;  3T4O A;  5B24 A;  5FUG B;  5AV6 B;  4IHQ A;  5B40 B;  1IOU A;  3O5Y A;  2P08 A;  4UEY A;  3LEZ A;  3QNB A;  1EQZ A;  1FR1 A;  3WS1 A;  3ZNY A;  3X1T C;  4IVI A;  4J8V C;  3W96 C;  4O0P A;  3VSL A;  2HIO A;  4LCL A;  4NZ1 A;  4QHC A;  4H9R A;  5E2E A;  1KGF A;  3REH B;  4JBF A;  2BAS A;  4JGQ A;  1N1J B;  1LL8 A;  4G91 B;  1KX4 C;  3AV1 D;  2XD1 A;  3AZG D;  1YKD A;  3G4P A;  1H8Y A;  2L4R A;  3AZG C;  5HWW A;  2ARO C;  3KS8 A;  4GHI B;  5JA4 A;  3MZF A;  3C4P A;  5M19 A;  4P6Z S;  4EBL A;  1PDC A;  3LCE A;  1TAF A;  2WGW A;  3W8K A;  3KXB D;  2Y91 A;  3MF0 A;  3CMZ A;  3T4S A;  1P3A D;  4KGC A;  3B6G A;  2M1C A;  5FAT A;  1P3A C;  1KX5 B;  1ALQ A;  3MGS D;  4EV4 A;  5AY8 D;  3U2A A;  3WKJ D;  4R6L A;  4UHU A;  5CX7 A;  4JLF A;  5I5L A;  4YOF A;  3N4I A;  3HJK A;  5B32 G;  5E5A C;  4X23 D;  3P98 A;  4HJ6 A;  5C5K A;  4KZ4 A;  2ZY4 A;  2GNX A;  5TBM A;  3TE8 A;  4U0T A;  5AV6 D;  1ZLA B;  5B31 G;  3MGR C;  3REK D;  3JPU A;  2ZY2 A;  5B1M C;  4C3Q A;  5B40 D;  1MKM A;  4BWI A;  5AV9 A;  1KX3 A;  4LV1 A;  1P3F B;  2P9V B;  1OTD A;  1PI5 A;  3K3C A;  4DXC A;  3H0R C;  4PMA A;  2P74 A;  3A3J A;  4WLA A;  3AZL A;  1TS7 A;  3V5M A;  2VGL S;  1LT0 A;  1M1A B;  5B0Y A;  2XA7 M;  5HFO A;  4E6X A;  3V3R A;  1P3I A;  4U3T A;  1A0K A;  4RX2 A;  4Y3I A;  3H0M C;  5B31 B;  2OAP 1;  3F1O B;  3PXP A;  3AL0 C;  5GLC A;  1E6R A;  1MWS A;  1DJA A;  4ARZ A;  5FL3 A;  2J80 A;  3CZD A;  4YNR A;  2XRO A;  4WU9 B;  4CSR A;  5DNN D;  1OJG A;  2CV5 C;  4P6B A;  3TU4 D;  4QWO A;  5DNN C;  4R8P B;  3A0R A;  4G3K A;  4M4X A;  3IWO A;  2IWD A;  3AFA D;  3TG9 A;  2PYO A;  3AFA C;  4CLC B;  3HRE A;  5FI2 A;  2XFT A;  1CK7 A;  5B0Z B;  3LR0 A;  3W99 C;  2PT7 A;  3S7N A;  4LD9 D;  4JF5 A;  3OLO A;  3FZC A;  2HDS A;  4ZUX D;  5FQQ A;  2K2N A;  5AV8 C;  4PM9 A;  4ZUX C;  4LPZ A;  5FUG A;  3NC8 A;  3IF6 B;  1P97 A;  3A1K A;  1GHM A;  3AYW D;  1K54 A;  4IBF A;  4AWL C;  3AYW C;  1O6I A;  1U35 D;  5CGS A;  3X1S D;  3Q7V B;  2IWB A;  3PAG A;  3B6F C;  4PKY G;  5EFW A;  1Y54 A;  3ZG7 B;  4UUZ A;  3UB7 A;  4WMC A;  3REH A;  4Z66 D;  2JKF A;  1N1J A;  4H9S C;  3LO7 A;  4YM6 C;  4Z2G A;  1ERQ A;  4XUJ B;  3ITA A;  4F94 A;  4QB8 A;  4KZ9 A;  1JNU A;  3BRM A;  4GHI A;  4YFM A;  5FDH A;  1WYB A;  4LG2 A;  1FSY A;  3IXG A;  3REL C;  4Q0H A;  4QNL A;  2XR0 A;  1KGG A;  2OSU A;  2QMI A;  3W98 B;  3UTA B;  1GOI A;  3AN2 C;  1LL5 A;  1ZHH B;  4WU9 D;  5GT0 D;  1P3M B;  3N8L A;  1KX5 A;  2WYX A;  2WKI A;  4DRB A;  4DDS A;  4R8P D;  5HX9 A;  4NFT A;  5B2J D;  4ETZ A;  4WEJ A;  5B2J C;  3AZJ B;  1SZV A;  5CTM A;  4HMC A;  2BTF P;  4YS3 A;  1MZU A;  3ICY A;  3IXD A;  4HEF A;  5JRG D;  3X1V B;  5JRG C;  1H3O B;  4X56 A;  2QPN A;  1YMX A;  1ZLA A;  3SW1 A;  2QWS A;  1P3F A;  2P9V A;  2QKP A;  4Z2M H;  4R1G A;  2H0T A;  1WE4 A;  1JWV A;  1S32 B;  2Q9M A;  4H8R A;  3M2J A;  1F2K A;  2G5H C;  4U0X A;  2DQN C;  2UWX A;  1M1A A;  1GA0 A;  4J8U C;  4IBE A;  3H9W A;  1ULY A;  5CP6 C;  4KUD B;  1S4S A;  1KDS A;  2D49 A;  5B31 A;  4RQ9 A;  3AGF A;  2RL3 A;  4JXG A;  1E6Z A;  3F1O A;  5CPJ D;  2ZQA A;  1PWG A;  5CPJ C;  1K25 A;  4XUJ D;  4XT2 B;  3OPL A;  3M7P A;  4ZJ2 A;  4LV2 A;  4K0X A;  4J8W D;  3KYQ A;  3RFB A;  1I5Q A;  3NOP C;  3UT9 C;  3T12 B;  3REJ B;  5L2F A;  1P3G C;  2Y4A A;  2XF3 A;  5F99 D;  5CER A;  3MKF A;  3N6I A;  1H8M A;  2HUE B;  2V0W A;  3BFE A;  3UTA D;  3IX8 A;  5A93 A;  1OT9 A;  3IXH A;  4CLC A;  1K6R A;  4WUJ A;  5B0Z A;  2Z2L B;  3VP3 A;  3ZVT A;  2ZL1 B;  5DNM B;  4HES A;  5CPI D;  4G92 C;  3Q81 A;  1LL9 A;  5CPI C;  5AV5 C;  2PU4 A;  3B0D C;  3AZN A;  1OGG A;  2ZQ9 A;  1HLU P;  3UPP A;  3DTE A;  3VP0 A;  1B67 A;  1XKZ A;  3IF6 A;  2ZD8 A;  4OJ6 A;  3MS6 A;  3MGQ C;  4DMZ A;  4UA9 A;  4C75 A;  4J8X A;  2Y2I A;  3FV7 A;  3NQJ A;  1DP9 A;  2QZ6 A;  3NQU B;  3PBQ A;  3Q7V A;  2HDQ A;  3KUY B;  2BYM B;  5GXQ B;  4OJL A;  1NLZ A;  4PHT A;  4X55 A;  5FQI A;  5CED A;  5B1L B;  2F8N H;  4HY8 A;  1S32 D;  1RGZ A;  4H9P B;  3KWQ C;  3IH9 A;  2ZM5 A;  4KZ7 A;  3EOI A;  1Y4O A;  5J3W A;  1LI9 A;  3K3D A;  2KOI A;  3HLF A;  3AZI B;  4OON A;  1CQA A;  5M18 A;  2CWE A;  5M1A A;  4OJO A;  1F9I A;  4P85 A;  4QPR A;  4Q0J A;  2X71 A;  1P3L C;  4H6J B;  5CHJ A;  3UMD A;  5IS1 A;  1CEF A;  4PKY A;  4WNN B;  5IHV A;  1P3P A;  3BEB A;  2F8N D;  5GT3 C;  4X25 A;  5FQK A;  3W98 A;  1GSV A;  3P01 A;  2H28 A;  5DFY A;  1P3M A;  3L2A A;  5GSU B;  1N9N A;  3VH6 W;  1D1J A;  1K38 A;  4PM6 A;  5A92 A;  1V9Y A;  2W8S A;  2YFV B;  3LIF A;  2W1T B;  3DTI A;  2A3U A;  4MB3 A;  5E43 A;  1VM1 A;  3C38 A;  1X0O A;  3AZJ A;  4XZQ D;  2FJ7 D;  3KSF A;  3AZM C;  5F5Y A;  2Y2K A;  2UV0 E;  5B2I C;  3HVF A;  2MJ6 A;  3LZ1 B;  5DNM D;  4Y5F A;  4LV0 A;  4E04 A;  1H3O A;  4IJG A;  1PYY A;  2CC1 A;  2Y2Q A;  3R7W A;  4O8G A;  4Z5T C;  5C3I C;  3TW8 A;  1TEM A;  2ZOH A;  3SOI A;  5B33 B;  3C8C A;  2G5I C;  4WU8 A;  5EM0 A;  1NZO A;  2PRF A;  3QHY A;  4Y2F A;  3AZF B;  4Y15 A;  3REI D;  3R4K A;  3ZQ5 A;  3MQL A;  5BS7 A;  4JJN A;  1AXB A;  2NZD B;  4UPK A;  4KUD A;  3WD2 A;  2B18 A;  3UTB B;  3VOZ A;  3M6B A;  1S1Z A;  3C1B A;  5FAQ A;  4R3A A;  5J8X A;  2A49 A;  4IBG A;  2WKR A;  4JGP A;  4XT2 A;  3O62 D;  5CPK C;  4KZ5 A;  2ZQ7 A;  3A6N D;  2NQB A;  2Q0O A;  4IJF A;  4R4R A;  1XPB A;  3REJ A;  1UR8 A;  1S6R A;  1JFI A;  1KE4 A;  1PZR A;  4H9N B;  1M18 C;  1W1P A;  5F82 A;  3ZG0 A;  1OTE A;  3G2Z A;  2H0Y A;  1ID3 D;  3Q82 A;  4WYY A;  4HBT A;  3FPV A;  3G31 A;  2HJE A;  2ZQC A;  4PM8 A;  2RCX A;  2V1A A;  1AOI C;  4BD0 A;  3CJM A;  1BH8 B;  5GSU D;  1P34 B;  2ZL1 A;  3PAE A;  1AWI A;  4M3K A;  4L9F A;  2O9C A;  4DN0 A;  1ONG A;  1YLT A;  3IWI A;  4E3N A;  2XDM A;  3NUL A;  3FKE A;  3AZK B;  3WAA B;  5B24 B;  1Q2Q A;  5AVB C;  3NIA A;  2WUQ A;  4ID4 A;  1P3K C;  4ZTK A;  1HQ3 B;  2KDK A;  3NQU A;  3KUY A;  1GPF A;  3GQZ A;  2BYM A;  1EQZ B;  5GXQ A;  3LIE A;  5B1L A;  2PDR A;  4B4Z A;  1VEU B;  4KZ3 A;  3LZ0 B;  3AV2 D;  3IP4 C;  2WKH A;  4L0L A;  4WZS B;  3CLO A;  3AZI A;  2I9V A;  5EOO A;  3UTB D;  3FDD A;  3RTY A;  3KSH A;  2R9W A;  3LEL A;  1GSW A;  3VSK A;  5AVC D;  3BY8 A;  4WNN A;  4HH3 A;  1S0W A;  2Z2M B;  5AVC C;  4WBG A;  4LEN A;  2IWC A;  2VLG A;  1STZ A;  4C6Y A;  4BMW A;  3OCN A;  3Q07 A;  3W2Z A;  1YT4 A;  3CG5 A;  1W63 Q;  1BT5 A;  1NZU A;  1AIW A;  4NG2 A;  1P3O D;  3ITB A;  4KGC B;  1GHI A;  2YFV A;  1E3U D;  3WTP B;  2W1T A;  3W97 A;  2V0U A;  4FOF A;  3C1C C;  2BYK B;  4EUV A;  3MVD C;  4XXR A;  1SKF A;  4OLG A;  4G3W A;  4RYE A;  3BFC A;  3WA9 C;  3LZ1 A;  3N8S A;  3VOL A;  4KUO A;  1CI8 A;  3WD4 A;  2M7U A;  5L8M A;  2XA7 S;  4M6B A;  1DY6 A;  4GJ4 A;  3NOU C;  3X1U D;  5TJJ A;  4NZ4 A;  1P3B B;  3IX3 A;  4DRT A;  4BBT A;  5B33 A;  3IBR A;  3W4P A;  3RH8 B;  5B24 D;  2EFX A;  4OOY A;  3AZF A;  5L07 A;  2HV1 A;  5CHL B;  3LIC A;  5JYP A;  4I3J A;  4N1X A;  1EQZ D;  2D01 A;  3Q7Z A;  4WEK A;  2NZD A;  2QJ5 A;  2X02 A;  3SZT A;  2R78 A;  2PU2 A;  1DP8 A;  2V9A A;  3X1T B;  2HIO D;  4J8V B;  1W5D A;  2HIO C;  3T4K A;  2Y2P A;  4X53 A;  4N92 A;  4LLO B;  4O7D A;  3OC2 A;  4WEL A;  3A1I A;  1GXD A;  2HP5 A;  2ZC3 B;  2RTS A;  4X69 A;  3EPH A;  3ZCZ A;  3MQ0 A;  3MNN B;  4H9N A;  3EEA A;  4Z2L A;  4OJ5 A;  2VX8 A;  4CLC E;  4XUZ A;  4EO5 C;  1H0M A;  4OVD A;  2ARO B;  4UAA A;  3MJQ A;  5BT1 D;  3VH6 A;  4PAU A;  1BH8 A;  5BT1 C;  1P34 A;  2WK0 A;  4KGC D;  5EVI C;  4DXB A;  3B6G D;  3SH9 A;  4DDY A;  4H9Q B;  5DTT A;  3B6G C;  3UB8 A;  1YU1 A;  2ZM0 A;  5E2H A;  1M19 A;  4OJP A;  3H7W A;  3V67 A;  4ZRR A;  3UN7 A;  3AZK A;  2KX6 A;  3WAA A;  1WWI A;  4BBV A;  3VH6 T;  3E2L A;  1N4O A;  2CMN A;  2QHK A;  3KS4 A;  3GTC A;  3T4T A;  2WKE A;  5J4E A;  1HQ3 A;  3E4O A;  5E2F A;  2XGN A;  1YLJ A;  2XH9 A;  3IT9 A;  2Y2O A;  3F1N A;  1NXY A;  3D9Y A;  3B3X A;  1G6A A;  2J8Y A;  5E5A B;  1BYW A;  1VEU A;  5AV9 D;  1KX3 D;  3LZ0 A;  3H82 B;  3N7W A;  3MGR B;  1K56 A;  3HLC A;  4UUZ B;  1MKI A;  2VV7 A;  4HMD A;  1IYP A;  4MB5 A;  4DE2 A;  3AZL D;  1LSX A;  5EPH A;  5BOH A;  2IA2 A;  1NRJ A;  4JGO A;  5B0Y D;  3AZL C;  3WD0 A;  3AV1 C;  3G35 A;  4IBR A;  1P3I D;  1Z09 A;  4I38 A;  3ZG9 B;  3C7U A;  4S2K A;  1I2S A;  1XFN A;  1HVB A;  5KZH A;  3UE3 A;  3KXB C;  3WTP A;  3BFF A;  1TZY B;  2BYK A;  4NEE D;  3WS4 A;  5DF7 A;  2FFY A;  1P0Z A;  5TGF A;  2ZY3 A;  3MGS C;  3G30 A;  4E3M A;  4PM5 A;  5AY8 C;  4BBU A;  2CV5 B;  2PYO D;  3WKJ C;  5GLD A;  2H5S A;  4YS3 B;  1HTA A;  1FCM A;  1J3W A;  1J7M A;  3MFD A;  3PBN A;  4NE5 A;  1P3B A;  4RVA A;  4X23 C;  3W99 B;  3L7H A;  2WKQ A;  2VZW A;  5FQJ A;  1OME A;  5EEC A;  5CRF A;  1EWZ A;  4KQQ A;  3A3E A;  2XK1 A;  1BUL A;  5AV6 C;  3REK C;  5AV8 B;  3IF5 A;  3VOY A;  1B6W A;  5B40 C;  4NXG A;  3QP5 A;  2O9B A;  2PHY A;  3OOV A;  2RVQ D;  2ZBB A;  3FYZ A;  4S2P A;  2J3W A;  3OBF A;  4AWL B;  3X1T A;  5B32 B;  1K55 C;  4J8V A;  3W96 A;  1MBL A;  4S2N C;  4WZ5 A;  1PRQ A;  4WMC D;  3REH D;  4HI4 A;  4LCM A;  3UDI A;  3B6F B;  3REH C;  4RX3 A;  2D02 A;  4FCF A;  1WA9 A;  4UQI M;  4FSF A;  1F66 B;  4G91 C;  4Y13 A;  3MNN A;  3UY6 A;  1KX4 A;  2AVX A;  4YM6 B;  3MXR A;  3BW6 A;  4EEP A;  1KS0 A;  1PW8 A;  1DJC A;  2ARO A;  4OPR A;  4Q0I A;  3IHA A;  5GLA A;  4JXS A;  4R38 A;  5F68 A;  3TU4 C;  1RP5 A;  3REL B;  5BO0 B;  4ZAM A;  4H9Q A;  3GRJ A;  2VEA A;  1E6N A;  1KX5 D;  1JWZ A;  4GB7 A;  1KX5 C;  1P3A A;  3AN2 B;  4LD9 C;  3BQA A;  1K57 C;  2EX8 A;  2W3D A;  4HGA C;  4OOM A;  1RGY A;  3AZN B;  2WGV A;  3LY3 A;  3WS2 A;  4OQ0 A;  4YS3 D;  5EV0 A;  4IBC A;  4IBX A;  4J8X B;  3IS2 B;  1L0G A;  3LJA B;  3NQJ B;  2GDN A;  2VGK A;  4YIN A;  5E5A A;  1HD8 A;  3NOT C;  3AZE B;  4JXV A;  1ZLA D;  1ES2 A;  5CTN A;  5AQA A;  1U35 C;  3X1S C;  1F98 A;  1G68 A;  1P3F D;  2Z6C A;  3H82 A;  3MGR A;  3LIB A;  5B1M A;  2V5O A;  4HOI A;  1C3B A;  1W1Y A;  4Z66 C;  1O7E A;  1VQQ A;  3DBA A;  4LGW A;  5DF8 A;  4CQH A;  1M1A D;  4ETX A;  4Z2M G;  2HP9 A;  1M1A C;  2Y79 A;  3WRT A;  4DF6 A;  2ZOI A;  3VV4 A;  3LR4 A;  5B31 D;  4HBU A;  5CP6 B;  5FA7 A;  2OAQ 1;  1L3L A;  1P3P B;  3EQV A;  5K5B A;  3FKV A;  3UPN A;  1IEL A;  5HDC A;  1TZY A;  4R70 A;  5IT5 A;  3DWK A;  2O99 A;  5GT0 C;  4WU9 C;  4QY5 A;  4LFU A;  5DKK A;  3I7J A;  3UT9 B;  3OCL A;  2JC7 A;  3WS5 A;  4R8P C;  1P3G B;  1BFM A;  2CV5 A;  4CLC D;  3G6O A;  3CPT B;  3HSH A;  5CHU A;  4LRX C;  1KVL A;  1JTD A;  5B0Z D;  2HDR A;  2JKT M;  5BPV A;  3UB9 A;  1QME A;  1VB6 A;  3OPH A;  4ZBE A;  1PNE A;  5AQ7 A;  3W99 A;  5EVE A;  3UE6 A;  3WS0 A;  3CWF A;  3AZN D;  3R7W B;  1KE3 A;  4B88 A;  2ZLY A;  2LY8 A;  5AV8 A;  5AV5 B;  1O07 A;  3B0D B;  3IHB A;  3LR3 A;  5LBR A;  1YLP A;  4WU8 B;  4J8X D;  3NEC A;  2W3E A;  3MGQ B;  1KOU A;  1MC0 A;  5B32 A;  3TOI A;  4JJN B;  3PBO A;  4QJG A;  4E3I A;  3BYD A;  5A8B A;  1PZP A;  4FD8 A;  3C1B B;  3B6F A;  3T4J A;  1T1B A;  4KEN B;  5FAP A;  3FWL A;  4IUH A;  4KHA B;  3EWK A;  4NYU A;  1F66 A;  4H9S A;  4NZ3 A;  1JWP A;  3KWQ B;  4XUJ C;  5EE8 A;  2NQB B;  3BEC A;  3CUE A;  4YM6 A;  1XJ3 A;  4J8W C;  3W4O A;  1L0E A;  5G4Z A;  1JFI B;  3FG8 A;  4Z1W A;  3GEC A;  1P3P D;  5F99 C;  1P3L B;  1FCN A;  1LSV A;  3GVB A;  3W98 D;  3REL A;  5BO0 A;  2OLU A;  3UTA C;  3KYE A;  4S2M A;  4K0W A;  5GT3 B;  3MGP B;  4I39 A;  3BLS A;  1P3M D;  1NWZ A;  1TVF A;  3AN2 A;  1KVM A;  1ES3 A;  1YLW A;  1M6K A;  2EXB A;  2B5R A;  4N9L A;  3AZJ D;  2JSS A;  3BFD A;  2ZMV A;  2EWW A;  3AZJ C;  5AVF A;  3S7P A;  4EEU A;  4EER A;  2HF6 A;  3AZM B;  1ZG4 A;  3X1V D;  1T1C A;  3IS2 A;  5HAR A;  4B93 A;  3LJA A;  3X1V C;  5L09 A;  4MCW A;  2B02 A;  3AZE A;  1GHP A;  3UDX A;  4DRA A;  1P9R A;  4MB4 A;  5DFX A;  1L6J A;  4EET B;  1CK3 A;  2P04 A;  4KUK A;  4Z5T B;  1NY0 A;  3G32 A;  2Y2L A;  4WU8 D;  1W7F A;  4IUK A;  1S67 L;  4EBN A;  3MR0 A;  3LEQ A;  4HP4 A;  1S32 C;  2ZMA A;  3HUN A;  4Y17 A;  4JJN D;  5BNV A;  4Y0U A;  4E6W A;  4KUD D;  4Z2J A;  2WAD A;  3F1P B;  3E98 A;  1E4D A;  3CAX A;  4J8U A;  5CP6 A;  1W1V A;  2ZC7 A;  3GSG A;  3LEL B;  1YU2 A;  2VA0 A;  2HGV A;  1CJF A;  3WTP E;  1XJ4 A;  2PBD P;  3F6T A;  2NQB D;  1OTA A;  4D60 A;  4R0Q A;  1TDG A;  5CPK B;  3REJ D;  4KZA A;  4GN2 A;  3AGD A;  4S2I A;  2E8J A;  2JCH A;  1ESU A;  3N8R A;  3UT9 A;  3HCY A;  3W97 B;  1P3G A;  5I94 A;  2HUE C;  1M18 B;  1LHY A;  3T50 A;  3CPT A;  2ZJ9 A;  2A2L A;  3HUO A;  2FJ7 C;  4XZQ C;  1W1T A;  2XD5 A;  1NRF A;  4ZDX A;  1ZTU A;  1AOI B;  3BLM A;  3EGD C;  2VJW A;  5DNM C;  2ZM2 A;  3UNW A;  2ZQ8 A;  2ZM8 A;  4MDZ A;  3AGE A;  5AV5 A;  5CPI A;  4KZ6 A;  2ZMF A;  1LSW A;  3NBL A;  1DP6 A;  3BJN A;  3VH5 W;  3MGQ A;  3W4Q A;  5AVB B;  3REI C;  4CAY A;  4Z2H A;  5EVL A;  3KUY D;  3Q1F A;  5GXQ D;  1D06 A;  1P3K B;  4B4X A;  5B1L D;  3PR6 A;  3LYX A;  3SS4 A;  3AZH B;  3MZD A;  3SH8 A;  3EPK A;  3S4X A;  4KHA A;  1Q9C A;  3EPJ A;  2HJ9 C;  4KG6 A;  5MC7 A;  3AZI D;  3NCK A;  4ZJ1 A;  4LRZ E;  3KWQ A;  1Q2P A;  3M2K A;  3O62 C;  4NXB A;  3T1R A;  1H8Z A;  4II7 A;  1TS0 A;  4I5S A;  4FTX A;  3A6N C;  3VP4 A;  3LEL D;  1K4F A;  3G2Y A;  2A24 B;  1TDL A;  3VFF A;  1P3L A;  3PBR A;  2HDU A;  2J7V A;  3WD3 A;  3EGX C;  1EW0 A;  5FDS A;  2OWJ A;  2EX2 A;  1A7W A;  5GT3 A;  1NYM A;  1ID3 C;  3MGP A;  5FEF A;  1UWP X;  4DE3 A;  1LLB A;  5GSU C;  4BL3 A;  3W97 D;  2PD8 A;  2VV6 A;  3HBR A;  3ZG5 A;  1YSQ A;  1NJ4 A;  3QP8 A;  1M19 B;  1K6S A;  4R3J A;  3FC7 A;  1XJ2 A;  4PM7 A;  3H7W B;  2VGJ A;  1JTG A;  2ZQD A;  3LZ1 D;  3MVD B;  1BH9 B;  3AZM A;  1XFQ A;  4EU0 A;  4R4S A;  2EXA A;  5B2I A;  3WA9 B;  4WZ4 A;  1W2E A;  3V9R A;  5B33 D;  3F1N B;  4Z5T A;  3AZF D;  4IVK A;  5HPF A;  3MSH A;  4Z9Q A;  3D72 A;  5BNX A;  5F83 A;  3IBJ A;  4GOG A;  3AV2 C;  2NZD D;  4GS9 A;  1CF0 A;  2W0N A;  3F1P A;  3UTB C;  3P09 A;  5HL1 A;  4WJ3 C;  5J7E A;  1MXO A;  4CJN A;  4HIA A;  2L1M A;  1IYO A;  2EX6 A;  3MBZ A;  3NY4 A;  2L0W A;  1HZO A;  4UA6 A;  2YFW B;  5CPK A;  3WRZ A;  3ZVW A;  4QLC B;  3O87 A;  3ZG8 B;  1WWS A;  2BG1 A;  4HHD A;  4EQ1 A;  1P3O C;  3N3F A;  5AJG A;  1M18 A;  3D3O A;  2C5W B;  3DAV A;  4GD8 A;  2V1B A;  2J3T D;  2Y55 A;  3TRC A;  1F1E A;  1P34 D;  2INW A;  3A3F A;  2J3T C;  1E6P A;  3MXS A;  1P34 C;  1AOI A;  5HAQ A;  2G2U A;  4RA7 A;  3GR2 A;  1M19 D;  5EVI B;  1OTI A;  4R23 A;  2JKR M;  3UPO A;  1IFQ A;  3X1U C;  1Z2C B;  3AZK D;  3DW0 A;  4ZBJ B;  3WAA D;  1HTZ A;  4OPQ A;  4GDB A;  4EES A;  3O86 A;  4UQI S;  5B24 C;  4DE1 A;  1HQ3 D;  5AVB A;  1HQ3 C;  5CGX A;  3O88 A;  1P3K A;  1RCJ A;  5FI7 A;  1VET A;  1EQZ C;  4HME A;  3C2W A;  4MLL A;  1E88 A;  2FZ0 A;  3AZH A;  3W96 B;  3ULF A;  3LZ0 D;  3UB6 A;  3MXQ A;  1K56 D;  2ZC4 B;  4ESP A;  4G3V A;  1XA1 A;  4P0M A;  3VE3 A;  2FH5 A;  4NET A;  3DTM A;  2A24 A;  2ZC6 B;  1KX4 B;  3ISG A;  2FFF B;  3AV1 B;  5U47 A;  4HNB A;  4OUI A;  3AZG B;  2WKP A;  5AVC A;  1EI5 A;  5DVA A;  2BLS A;  5DTK A;  5HAI A;  2HPB A;  3WTP D;  4KGC C;  3T1Q B;  2WGI A;  2X01 A;  4OKP A;  3TJZ C;  3KXB B;  2QJ7 A;  3DWZ A;  1P3A B;  3C1C A;  3CHW P;  3B42 A;  5KSH A;  2V8F A;  3MVD A;  2O9A A;  1BH9 A;  5FQ9 A;  2XRN A;  4L9G A;  4OQH A;  2ZY5 A;  3MGS B;  4EW7 A;  3WA9 A;  4E44 A;  3C30 A;  2Y59 A;  5AY8 B;  3KYZ A;  3B0C W;  3HJI A;  1P3B D;  3WKJ B;  4AFI A;  4GLQ A;  4N9K A;  1E15 A;  4EQI A;  4X23 B;  3B47 A;  5AV9 C;  1KX3 C;  1BLP A;  4I3A A;  5B1M B;  4X6T A;  3UO9 A;  2DMW A;  3REK B;  4NXF A;  1FSW A;  2XFS A;  4S2J A;  3QP4 A;  4KZB A;  3X1T D;  4J8V D;  1H0I A;  3VH5 T;  3W96 D;  5B0Y C;  1P3I C;  4WZ5 C;  1T3U A;  2YFW A;  5GLB A;  4BLM A;  4QLC A;  2NUT C;  5A90 A;  3L28 A;  3MNN D;  1FCO A;  2W3H A;  1H8P A;  2IO5 C;  5FI6 A;  1KX4 D;  3MNN C;  3LFV A;  5HD5 A;  3T1S A;  2FN2 A;  5F1G A;  4K91 A;  3C4O A;  4MN5 A;  2IOU A;  1CEG A;  2ARO D;  3UE0 A;  3VFH A;  1N9L A;  3MQQ A;  4EWF A;  3CIT A;  4MEZ A;  3KFU G;  2M7V A;  5KIZ A;  3MKE A;  4NKP A;  3WWX A;  4DJ3 A;  1UWN X;  5DNN B;  1H3Q A;  3S1Y A;  5KSC A;  2V20 A;  2PYO C;  4WV4 B;  3TU4 B;  1ZC2 A;  3RXX A;  5EVI A;  2VQR A;  3HLG A;  3AFA B;  2WZZ A;  5GHY A;  4BL2 A;  2PR6 A;  4MMN A;  1G6O A;  3KX0 X;  4KQD A;  5HPI A;  4LD9 B;  5HWV A;  1IYS A;  4HGA B;  2LB9 A;  4ZUX B;  1FOF A;  2VKS A;  2DF4 C;  1K54 C;  3OZH A;  2RVQ C;  5E5A D;  2V2F F;  3EEH A;  1V9Z A;  3AYW B;  1H0G A;  3E4P A;  4IBK A;  1SDE A;  1LI0 A;  2OV5 A;  3MGR D;  1GA9 A;  3JVV A;  5B1M D;  1U35 B;  4Z2I A;  3T1X A;  5DJT A;  3X1S B;  1W79 A;  3QP2 A;  2H10 A;  2J9O A;  4YWZ A;  5HAP A;  3BFG A;  4BQM A;  5FAS A;  3S22 A;  4Z66 B;  4EUZ A;  2Y2J A;  5AVE A;  3V50 A;  2JKT I;  3AV1 A;  1S1Y A;  4KZ8 A;  1F5M A;  3AZG A;  2XLN A;  1MY8 A;  4OP5 A;  5D3O A;  4GDN A;  3KO6 A;  3GDI A;  5GL9 A;  2Y2N A;  2PD7 A;  4XUX A;  2HZ5 A;  1BLC A;  3S7O A;  4HH2 A;  3QP1 A;  3H0L C;  3LR5 A;  3G34 A;  4N1H A;  5G18 A;  1T18 A;  1TZY D;  2GX5 A;  1TZY C;  3KXB A;  1MWT A;  1XP4 A;  2DCF A;  4GHL A;  2YKF A;  5GT0 B;  2XEP A;  4GCZ A;  2CV5 D;  2Y2G A;  3MGS A;  4JXW A;  1IEM A;  3ZYT A;  5B2J B;  2ACG A;  5AY8 A;  3MQO A;  3UE1 A;  4YS3 C;  2OOL A;  3WKJ A;  3W99 D;  2KLI A;  5GHZ A;  5DTS A;  1GCE A;  5JRG B;  4X23 A;  4MNR A;  4S2O A;  1L0D A;  1ZLA C;  5AV8 D;  2Q9N A;  3A0S A;  4E3O A;  5HZH A;  2QYB A;  2WAE A;  3MMH A;  4OPZ A;  1P3F C;  2Y8H A;  1PW1 A;  5AV6 A;  3REK A;  3LI9 A;  3MFX A;  3MZE A;  2R9X A;  4FH2 A;  5G4Y A;  5B40 A;  4JKT A;  1ONH A;  1UR9 A;  5B32 D;  5BNV B;  5B32 C;  4UA7 A;  1WYC A;  5DKL A;  4K08 A;  3B6F D;  1K55 A;  3NDE A;  4J8U B;  4S2N A;  5B31 C;  1F66 D;  4KG5 A;  3A3I A;  2VK3 A;  1F66 C;  2ZC5 B;  2G2W A;  3S7Q A;  5HL6 A;  4EXO A;  4P87 A;  1ESI A;  4YM6 D;  5CPJ B;  3CUE C;  1H5X A;  3SS3 A;  1MWU A;  1YU4 A;  3UDF A;  4J8W B;  4IBB A;  2RIQ A;  2HP6 A;  1G5U A;  3HLW A;  3REL D;  3BM6 A;  3PTE A;  4BJP A;  4E3K A;  1FIK A;  2W1R A;  1PIO A;  5DNN A;  1CXW A;  5HDD A;  5F99 B;  4CLC C;  3TU4 A;  4GH9 A;  1PFL A;  1N9O A;  5B0Z C;  3AFA A;  3AN2 D;  2K31 A;  4MN7 A;  3LUQ A;  1BTL A;  4O01 A;  5CHM A;  4LD9 A;  2LB5 A;  4G92 B;  1K57 A;  3UB5 P;  3AZN C;  4LV3 A;  5CPI B;  2V8C A;  4GKU A;  4ZUX A;  3IF6 C;  3NJA A;  4OPY A;  5FAO A;  3VE4 A;  4JF6 A;  2F2A C;  3LJA D;  4P6Z M;  4MBH A;  4J8X C;  4A5R A;  3AZE D;  3LJA C;  5CGW A;  4CAY B;  3AYW A;  3AZE C;  3A3D A;  1E25 A;  4HP9 A;  3D4F A;  1BLH A;  1YUE A;  3R45 B;  3B0C T;  3JVU A;  3JYI A;  1U35 A;  4NXE A;  1G28 A;  3T4L A;  3X1S A;  3SH7 A;  3KSG A;  4OLD A;  2F8N G;  2P7J A;  3WX7 A;  4R3B A;  1TS8 A;  4Z66 A;  5CEB A;  3LIA A;  1TS6 A;  2PAV P;  4QY6 A;  2Y2M A;  4J8U D;  1OTB A;  1YAX A;  5CP6 D;  4X1L A;  4NE3 A;  3E0Y A;  1P3P C;  2Z6D A;  4ME4 A;  3NHQ A;  3RXW A;  3W98 C;  5JYO A;  1IKG A;  2F8N B;  3ZNT A;  1NYY A;  3IXB A;  1P3M C;  2XQZ A;  1ERM A;  3UT9 D;  3HLD A;  4QD4 A;  1P3G D;  4KQR A;  3E2K A;  5GT0 A;  4WU9 A;  1XXM A;  4Y7P A;  3CI6 A;  1JVJ A;  2VGL M;  4R8P A;  3L26 A;  4Z2K A;  5B2J A;  3UME A;  1N9B A;  1YU3 A;  3OPP A;  5DF9 A;  2FJ7 B;  4XZQ B;  3L25 A;  1XJ6 A;  2E8I A;  5B2I B;  1KDW A;  1ES5 A;  3BY9 A;  3SS5 A;  5JRG A;  5AV5 D;  2B95 A;  3IH8 A;  3V9R B;  1EAK A;  5C3I B;  4GD6 A;  4WU8 C;  3MGQ D;  5BNX B;  4HJ3 A;  5G49 B;  1D7E A;  1OJ5 A;  3VMA A;  4GS9 B;  5BS7 C;  4JJN C;  2GZA A;  4FUW A;  3EPL A;  3REI B;  3C1B D;  4KUD C;  1YLY A;  1TF1 A;  3C1B C;  1U60 A;  4OH0 A;  1BLS A;  4H9O B;  1BZA A;  3GMW A;  4WF0 A;  3BQ8 A;  3KWQ D;  1ACF A;  1E8B A;  4WL9 A;  1M40 A;  1IYQ A;  5CPJ A;  1T19 A;  2NQB C;  2PYP A;  1YSP A;  2JE5 A;  4XUJ A;  3O62 B;  3REJ C;  1FQG A;  4J8W A;  1P3L D;  3V39 A;  3A6N B;  4GW9 A;  4KQO A;  3IX4 A;  5F99 A;  5GT3 D;  3MGP D;  1W8Q A;  3MGP C;  4MBK A;  3UTA A;  3T4Q A;  1ID3 B;  1Y28 A;  1SCW A;  3HUM A;  5HWT A;  1SKO B;  4MBF A;  4EBP A;  4LRY C;  3P7N A;  2J8P A;  3C7V A;  1KE0 A;  5HW3 A;  2EX9 A;  4GHA A;  1ERO A;  3AZM D;  1YU0 A;  3E4Q A;  3WD1 A;  5EOE A;  3OPR A;  2PBY A;  5B2I D;  4DE0 A;  4HJ4 A;  4X1M A;  3X1V A;  3LGO A;  1TD5 A;  3KUY C;  3GV9 A;  1VET B;  4JPM A;  4Z5T D;  4HQA A;  3R45 A;  5GXQ C;  2W3F A;  5F6A A;  4DQY B;  5B1L C;  2W3G A;  5F69 A;  4FH4 A;  5FEG A;  3HL9 A;  5CEC A;  3NDG A;  1QMF A;  1PZO A;  1S32 A;  4Y0T A;  3AZI C;  4OP8 A;  3AV2 B;  4Q8I A;  4PPR A;  3LID A;  4JF4 A;  3A0V A;  5KDM B;  1FR6 A;  3LEL C;  4B9O A;  5L10 A;  1P9W A;  5KMW A;  1GSX A;  5CXW A;  2JKR I;  5AVC B;  1PWC A;  5CPK D;  1DRM A;  2F8N A;  3HON A;  1SHV A;  5HSQ A;  2F8N K;  2WAF A;  4IED A;  1M18 D;  4MN6 A;  3FKW A;  3W97 C;  2K7S A;  1P3O B;  3C1C B;  4BD1 A;  5TFQ A;  1OGB A;  5A91 A;  3L29 A;  2C6W B;  4OQG A;  1AOI D;  1IKI A;  4JGR A;  3LZ1 C;  4XZQ A;  2FJ7 A;  1OT6 A;  2OLV A;  4GNU A;  5DNM A;  1XGI A;  2YKH A;  4D2O A;  4IBI A;  3U4L P;  3LY4 A;  1ODV A;  3B33 A;  3IQA A;  5B33 C;  5EUA A;  1K4E A;  3X1U B;  4F3L B;  4WN5 A;  1VHM A;  3AZF C;  5AVB D;  5G49 A;  2PR5 A;  5HD3 A;  2EA9 A;  3PYP A;  1I2W A;  1P3K D;  1MWR A;  4KG2 A;  2J9P A;  2NZD C;  3REI A;  2WZX A;  4GZB A;  3O3V A;  3AZH D;  1W63 M;  1Z6F A;  3AZH C;  4NYY A;  4H9O A;  3B0B A;  1ZG6 A;  2JN7 A;  1SDN A;  2OWH A;  4NZ5 A;  4H9P A;  3HLE A;  2HIO B;  3C5A A;  3L9K A;  4H9R B;  1YMS A;  5FSR A;  1ED7 A;  3O62 A;  2DNS A;  5E2G A;  3A6N A;  3ZDJ A;  4DJ2 A;  3P5J B;  3FPW A;  4QU3 A;  5F1F A;  4H6J A;  1QO6 A;  4OQI A;  2GJ3 A;  3VP1 A;  3L27 A;  1FIL A;  3ZGA B;  1OPX A;  1S66 L;  3BWL A;  5JA4 B;  1L2S A;  4EO5 B;  2V1Z A;  2VV8 A;  1NLY A;  1ID3 A;  1KGE A;  1TAF B;  1SKO A;  2WGW B;  2PYR A;  1S4R A;  1ES4 A;  3LI8 A;  5GSU A;  1M19 C;  3QP6 A;  3C1C D;  3B6G B;  2W27 A;  3HLB A;  3MVD D;  1T1A A;  1K0K A;  3AZK C;  3WAA C;  3KSI A;  3WA9 D;  4NE6 A;  1DJB A;  1YPR A;  1PI4 A;  3KSY A;  3EQU A;  4ZJ3 A;  4E3J A;  2DRW A;  3V3S A;  5AQB A;  2JBF A;  3NI9 A;  3LZ0 C;  5TBM B;  2JKG A;  1XA7 A;  3M6H A;  2I72 A;  5TR7 A;  3VP2 A;  4BEN A;  1XGJ A;  4WM9 A;  1YQS A;  1PWD A;  1ZKJ A;  5AV9 B;  1KX3 B;  1XX2 A;  4CPK A;  3AV2 A;  3PBS A;  4I3I A;  3TSG A;  1CI9 A;  5GHX A;  1R4V A;  5KDM A;  3UTB A;  4X68 A;  4E45 A;  4E3L A;  3AZL B;  4L9E A;  2Y2H A;  5B0Y B;  2EFU A;  1W8Y A;  4Y0O A;  2EWV A;  1P3I B;  4QLC D;  3RJU A;  4IBD A;  1J9M A;  4QLC C;  4TX8 A;  5HDS A;  3ZHH A;  5FQM A;  5AQ9 A;  3WTP C;  2IO5 B;  4ARZ B;  3ZFZ A;  3PHY A;  1BUE A; 
#chains in the Genus database with same CATH homology
 1P3O A;  4NY2 A;  1E3U A;  4DKI A;  4CSR B;  3IWQ A;  1L0F A;  1YLZ A;  4IJE A;  1BSG A;  2L5A A;  5EVI D;  3QNC A;  1MPL A;  4NK3 A;  4OOL A;  3EG5 B;  1YM1 A;  4S2L A;  1KU5 A;  2PYO B;  1P3B C;  3VH5 A;  4ZBJ C;  3PBT A;  4IBJ A;  3X1U A;  5B24 A;  5FUG B;  5AV6 B;  5B40 B;  3LEZ A;  3QNB A;  1EQZ A;  1FR1 A;  3WS1 A;  3ZNY A;  3X1T C;  4IVI A;  4J8V C;  3W96 C;  3VSL A;  2HIO A;  4LCL A;  4NZ1 A;  4QHC A;  4H9R A;  5E2E A;  1KGF A;  3REH B;  4JBF A;  1N1J B;  4G91 B;  1KX4 C;  3AV1 D;  2XD1 A;  3AZG D;  3G4P A;  1H8Y A;  3AZG C;  2ARO C;  3KS8 A;  5JA4 A;  3MZF A;  3C4P A;  5M19 A;  4EBL A;  3LCE A;  1TAF A;  2WGW A;  3W8K A;  3KXB D;  2Y91 A;  3CMZ A;  1P3A D;  4KGC A;  3B6G A;  5FAT A;  1P3A C;  1KX5 B;  1ALQ A;  3MGS D;  4EV4 A;  5AY8 D;  3WKJ D;  4UHU A;  4JLF A;  3N4I A;  5B32 G;  5E5A C;  4X23 D;  3P98 A;  4KZ4 A;  2ZY4 A;  4U0T A;  5AV6 D;  1ZLA B;  5B31 G;  3MGR C;  3REK D;  2ZY2 A;  5B1M C;  4C3Q A;  5B40 D;  5AV9 A;  1KX3 A;  4LV1 A;  1P3F B;  2P9V B;  1PI5 A;  4DXC A;  3H0R C;  4PMA A;  2P74 A;  3A3J A;  3V5M A;  3AZL A;  1M1A B;  5B0Y A;  5HFO A;  4E6X A;  3V3R A;  1P3I A;  4U3T A;  4RX2 A;  3H0M C;  5B31 B;  3AL0 C;  5GLC A;  1MWS A;  1DJA A;  3CZD A;  4WU9 B;  4CSR A;  5DNN D;  2CV5 C;  4P6B A;  3TU4 D;  5DNN C;  4R8P B;  3IWO A;  2IWD A;  3AFA D;  3TG9 A;  2PYO A;  3AFA C;  3HRE A;  5FI2 A;  2XFT A;  5B0Z B;  3W99 C;  4LD9 D;  4JF5 A;  3FZC A;  2HDS A;  4ZUX D;  5FQQ A;  5AV8 C;  4PM9 A;  4ZUX C;  5FUG A;  3NC8 A;  3IF6 B;  3A1K A;  1GHM A;  3AYW D;  1K54 A;  4IBF A;  4AWL C;  3AYW C;  1U35 D;  5CGS A;  3X1S D;  3Q7V B;  2IWB A;  3PAG A;  3B6F C;  1Y54 A;  3ZG7 B;  4UUZ A;  4WMC A;  3REH A;  4Z66 D;  1N1J A;  4H9S C;  3LO7 A;  4YM6 C;  1ERQ A;  4XUJ B;  3ITA A;  4F94 A;  4QB8 A;  4KZ9 A;  3BRM A;  4YFM A;  5FDH A;  1WYB A;  4LG2 A;  1FSY A;  3IXG A;  3REL C;  4QNL A;  2XR0 A;  1KGG A;  2OSU A;  2QMI A;  3W98 B;  3UTA B;  3AN2 C;  1LL5 A;  4WU9 D;  5GT0 D;  1P3M B;  3N8L A;  1KX5 A;  2WYX A;  2WKI A;  4DRB A;  4DDS A;  4R8P D;  5HX9 A;  4NFT A;  5B2J D;  4WEJ A;  5B2J C;  3AZJ B;  5CTM A;  4YS3 A;  3IXD A;  4HEF A;  5JRG D;  3X1V B;  5JRG C;  1H3O B;  4X56 A;  2QPN A;  1YMX A;  1ZLA A;  1P3F A;  2P9V A;  4Z2M H;  4R1G A;  2H0T A;  1WE4 A;  1JWV A;  1S32 B;  2Q9M A;  4H8R A;  3M2J A;  2G5H C;  4U0X A;  2DQN C;  2UWX A;  1M1A A;  1GA0 A;  4J8U C;  4IBE A;  1ULY A;  5CP6 C;  4KUD B;  1KDS A;  5B31 A;  3AGF A;  2RL3 A;  4JXG A;  5CPJ D;  2ZQA A;  1PWG A;  5CPJ C;  1K25 A;  4XUJ D;  3OPL A;  4ZJ2 A;  4LV2 A;  4K0X A;  4J8W D;  1I5Q A;  3UT9 C;  3REJ B;  5L2F A;  1P3G C;  2Y4A A;  2XF3 A;  5F99 D;  5CER A;  3MKF A;  3N6I A;  2HUE B;  3BFE A;  3UTA D;  5A93 A;  3IXH A;  1K6R A;  5B0Z A;  2Z2L B;  3VP3 A;  3ZVT A;  5DNM B;  4HES A;  5CPI D;  4G92 C;  3Q81 A;  1LL9 A;  5CPI C;  5AV5 C;  2PU4 A;  3B0D C;  3AZN A;  2ZQ9 A;  3UPP A;  3VP0 A;  1B67 A;  1XKZ A;  3IF6 A;  2ZD8 A;  4OJ6 A;  3MGQ C;  4UA9 A;  4C75 A;  4J8X A;  2Y2I A;  3FV7 A;  3NQJ A;  2QZ6 A;  3NQU B;  3PBQ A;  3Q7V A;  2HDQ A;  3KUY B;  2BYM B;  5GXQ B;  4OJL A;  4X55 A;  5FQI A;  5CED A;  5B1L B;  2F8N H;  1S32 D;  1RGZ A;  4H9P B;  3KWQ C;  3IH9 A;  2ZM5 A;  4KZ7 A;  1LI9 A;  3HLF A;  3AZI B;  4OON A;  5M18 A;  2CWE A;  5M1A A;  4OJO A;  4P85 A;  2X71 A;  1P3L C;  5CHJ A;  1CEF A;  4WNN B;  5IHV A;  1P3P A;  3BEB A;  2F8N D;  5GT3 C;  5FQK A;  3W98 A;  1P3M A;  3L2A A;  5GSU B;  3VH6 W;  1K38 A;  4PM6 A;  5A92 A;  2W8S A;  2YFV B;  2A3U A;  5E43 A;  1VM1 A;  3AZJ A;  4XZQ D;  2FJ7 D;  3AZM C;  2Y2K A;  5B2I C;  3HVF A;  3LZ1 B;  5DNM D;  4LV0 A;  1H3O A;  1PYY A;  2CC1 A;  2Y2Q A;  4Z5T C;  5C3I C;  1TEM A;  3SOI A;  5B33 B;  2G5I C;  4WU8 A;  1NZO A;  3QHY A;  3AZF B;  3REI D;  5BS7 A;  4JJN A;  1AXB A;  2NZD B;  4UPK A;  4KUD A;  3UTB B;  3VOZ A;  3M6B A;  3C1B A;  5FAQ A;  5J8X A;  2A49 A;  4IBG A;  3O62 D;  5CPK C;  4KZ5 A;  2ZQ7 A;  3A6N D;  2NQB A;  4R4R A;  4IJF A;  1XPB A;  3REJ A;  1S6R A;  1JFI A;  1KE4 A;  1PZR A;  4H9N B;  1M18 C;  5F82 A;  3ZG0 A;  3G2Z A;  2H0Y A;  1ID3 D;  3Q82 A;  4WYY A;  4HBT A;  3G31 A;  2ZQC A;  4PM8 A;  2RCX A;  1AOI C;  4BD0 A;  3CJM A;  1BH8 B;  5GSU D;  1P34 B;  3PAE A;  4M3K A;  1ONG A;  1YLT A;  3IWI A;  4E3N A;  2XDM A;  3FKE A;  3AZK B;  3WAA B;  5B24 B;  1Q2Q A;  5AVB C;  3NIA A;  2WUQ A;  4ID4 A;  1P3K C;  4ZTK A;  1HQ3 B;  3NQU A;  3KUY A;  3GQZ A;  2BYM A;  1EQZ B;  5GXQ A;  5B1L A;  4B4Z A;  4KZ3 A;  3LZ0 B;  3AV2 D;  3IP4 C;  2WKH A;  4L0L A;  4WZS B;  3AZI A;  5EOO A;  3UTB D;  3FDD A;  2R9W A;  3LEL A;  3VSK A;  5AVC D;  4WNN A;  1S0W A;  2Z2M B;  5AVC C;  4WBG A;  4LEN A;  2IWC A;  4C6Y A;  3OCN A;  3Q07 A;  1YT4 A;  3CG5 A;  1BT5 A;  1NZU A;  1P3O D;  3ITB A;  4KGC B;  1GHI A;  2YFV A;  1E3U D;  3WTP B;  3W97 A;  3C1C C;  2BYK B;  3MVD C;  4XXR A;  1SKF A;  4OLG A;  4RYE A;  3BFC A;  3WA9 C;  3LZ1 A;  3N8S A;  1CI8 A;  4M6B A;  1DY6 A;  3X1U D;  4NZ4 A;  1P3B B;  4DRT A;  5B33 A;  3W4P A;  5B24 D;  2EFX A;  4OOY A;  3AZF A;  5CHL B;  5JYP A;  4N1X A;  1EQZ D;  3Q7Z A;  4WEK A;  2NZD A;  2X02 A;  2PU2 A;  3X1T B;  2HIO D;  4J8V B;  1W5D A;  2HIO C;  2Y2P A;  4X53 A;  4N92 A;  4O7D A;  3OC2 A;  4WEL A;  3A1I A;  2HP5 A;  2ZC3 B;  4X69 A;  3EPH A;  3ZCZ A;  3MNN B;  4H9N A;  4OJ5 A;  4XUZ A;  4EO5 C;  4OVD A;  2ARO B;  4UAA A;  5BT1 D;  3VH6 A;  1BH8 A;  5BT1 C;  1P34 A;  2WK0 A;  4KGC D;  5EVI C;  4DXB A;  3B6G D;  3SH9 A;  4DDY A;  4H9Q B;  5DTT A;  3B6G C;  1YU1 A;  2ZM0 A;  5E2H A;  1M19 A;  4OJP A;  3UN7 A;  3AZK A;  3WAA A;  1WWI A;  3VH6 T;  3E2L A;  1N4O A;  3KS4 A;  3GTC A;  2WKE A;  1HQ3 A;  5E2F A;  2XGN A;  1YLJ A;  2XH9 A;  3IT9 A;  2Y2O A;  1NXY A;  3B3X A;  1G6A A;  2J8Y A;  5E5A B;  5AV9 D;  1KX3 D;  3LZ0 A;  3N7W A;  3MGR B;  1K56 A;  3HLC A;  4UUZ B;  1MKI A;  1IYP A;  4DE2 A;  5BOH A;  3AZL D;  5EPH A;  5B0Y D;  3AZL C;  3AV1 C;  3G35 A;  4IBR A;  1P3I D;  3ZG9 B;  3C7U A;  4S2K A;  1I2S A;  1HVB A;  5KZH A;  3UE3 A;  3KXB C;  3WTP A;  3BFF A;  1TZY B;  2BYK A;  3WS4 A;  5DF7 A;  2FFY A;  5TGF A;  2ZY3 A;  3MGS C;  3G30 A;  4E3M A;  4PM5 A;  5AY8 C;  2CV5 B;  2PYO D;  3WKJ C;  5GLD A;  2H5S A;  4YS3 B;  1HTA A;  1FCM A;  3PBN A;  3MFD A;  4NE5 A;  1P3B A;  4RVA A;  4X23 C;  3W99 B;  5FQJ A;  1OME A;  5EEC A;  5CRF A;  1EWZ A;  4KQQ A;  3A3E A;  2XK1 A;  1BUL A;  5AV6 C;  3REK C;  5AV8 B;  3IF5 A;  3VOY A;  1B6W A;  5B40 C;  2RVQ D;  3FYZ A;  4S2P A;  4AWL B;  3X1T A;  5B32 B;  1K55 C;  4J8V A;  3W96 A;  1MBL A;  4S2N C;  4WZ5 A;  4WMC D;  3REH D;  4LCM A;  3UDI A;  3B6F B;  3REH C;  4RX3 A;  4FCF A;  4FSF A;  1F66 B;  4G91 C;  3MNN A;  3UY6 A;  1KX4 A;  4YM6 B;  3MXR A;  1PW8 A;  1DJC A;  2ARO A;  4OPR A;  3IHA A;  5GLA A;  4JXS A;  3TU4 C;  1RP5 A;  3REL B;  5BO0 B;  4ZAM A;  4H9Q A;  3GRJ A;  1KX5 D;  1JWZ A;  4GB7 A;  1KX5 C;  1P3A A;  3AN2 B;  4LD9 C;  1K57 C;  2EX8 A;  4HGA C;  4OOM A;  1RGY A;  3AZN B;  2WGV A;  3LY3 A;  3WS2 A;  4OQ0 A;  4YS3 D;  4IBC A;  4IBX A;  4J8X B;  1L0G A;  3LJA B;  3NQJ B;  2GDN A;  2VGK A;  4YIN A;  5E5A A;  1HD8 A;  4JXV A;  3AZE B;  1ZLA D;  1ES2 A;  5CTN A;  5AQA A;  1U35 C;  3X1S C;  1G68 A;  1P3F D;  3MGR A;  5B1M A;  1C3B A;  4Z66 C;  1O7E A;  1VQQ A;  5DF8 A;  1M1A D;  4Z2M G;  2HP9 A;  1M1A C;  3WRT A;  4DF6 A;  5B31 D;  4HBU A;  5CP6 B;  5FA7 A;  1P3P B;  3EQV A;  3FKV A;  3UPN A;  1IEL A;  1TZY A;  3DWK A;  5GT0 C;  4WU9 C;  4QY5 A;  3I7J A;  3UT9 B;  3OCL A;  2JC7 A;  3WS5 A;  4R8P C;  1P3G B;  1BFM A;  2CV5 A;  3HSH A;  5CHU A;  1KVL A;  1JTD A;  5B0Z D;  2HDR A;  5BPV A;  1QME A;  3OPH A;  4ZBE A;  5AQ7 A;  3W99 A;  3WS0 A;  3AZN D;  1KE3 A;  4B88 A;  2ZLY A;  2LY8 A;  5AV8 A;  5AV5 B;  1O07 A;  3B0D B;  3IHB A;  1YLP A;  4WU8 B;  4J8X D;  3MGQ B;  5B32 A;  3TOI A;  4JJN B;  3PBO A;  4QJG A;  4E3I A;  3BYD A;  1PZP A;  4FD8 A;  3C1B B;  3B6F A;  4KEN B;  5FAP A;  3FWL A;  4KHA B;  4NYU A;  1F66 A;  4H9S A;  4NZ3 A;  1JWP A;  3KWQ B;  4XUJ C;  5EE8 A;  2NQB B;  3BEC A;  4YM6 A;  4J8W C;  3W4O A;  1L0E A;  1JFI B;  1P3P D;  5F99 C;  1P3L B;  1FCN A;  3GVB A;  3W98 D;  2OLU A;  3REL A;  5BO0 A;  3UTA C;  4S2M A;  4K0W A;  5GT3 B;  3MGP B;  3BLS A;  1P3M D;  1TVF A;  3AN2 A;  1KVM A;  1ES3 A;  1YLW A;  1M6K A;  2EXB A;  2B5R A;  4N9L A;  3AZJ D;  2JSS A;  3BFD A;  3AZJ C;  3AZM B;  1ZG4 A;  3X1V D;  5HAR A;  3LJA A;  3X1V C;  3AZE A;  1GHP A;  3UDX A;  4DRA A;  1CK3 A;  4Z5T B;  1NY0 A;  3G32 A;  2Y2L A;  4WU8 D;  1W7F A;  4EBN A;  1S32 C;  2ZMA A;  3HUN A;  4JJN D;  5BNV A;  4Y0U A;  4E6W A;  4KUD D;  2WAD A;  1E4D A;  4J8U A;  5CP6 A;  2ZC7 A;  3GSG A;  3LEL B;  1YU2 A;  3WTP E;  3F6T A;  2NQB D;  4R0Q A;  1TDG A;  5CPK B;  3REJ D;  4KZA A;  4GN2 A;  3AGD A;  4S2I A;  2JCH A;  1ESU A;  3N8R A;  3UT9 A;  3W97 B;  1P3G A;  5I94 A;  2HUE C;  1M18 B;  1LHY A;  2ZJ9 A;  3HUO A;  2FJ7 C;  4XZQ C;  2XD5 A;  1NRF A;  4ZDX A;  1AOI B;  3BLM A;  5DNM C;  2ZM2 A;  3UNW A;  2ZQ8 A;  2ZM8 A;  3AGE A;  5AV5 A;  5CPI A;  4KZ6 A;  3NBL A;  3VH5 W;  3MGQ A;  3W4Q A;  5AVB B;  3REI C;  4CAY A;  5EVL A;  3KUY D;  3Q1F A;  5GXQ D;  1P3K B;  4B4X A;  5B1L D;  3SS4 A;  3AZH B;  3MZD A;  3SH8 A;  3EPK A;  3S4X A;  4KHA A;  1Q9C A;  3EPJ A;  4KG6 A;  3AZI D;  3NCK A;  4ZJ1 A;  3KWQ A;  1Q2P A;  3M2K A;  3O62 C;  1H8Z A;  3A6N C;  3VP4 A;  3LEL D;  1K4F A;  3G2Y A;  1TDL A;  3VFF A;  1P3L A;  3PBR A;  2HDU A;  2J7V A;  2EX2 A;  1A7W A;  5GT3 A;  1NYM A;  1ID3 C;  3MGP A;  4DE3 A;  1LLB A;  5GSU C;  4BL3 A;  3W97 D;  3HBR A;  3ZG5 A;  1NJ4 A;  1M19 B;  1K6S A;  4R3J A;  4PM7 A;  2VGJ A;  1JTG A;  2ZQD A;  3LZ1 D;  3MVD B;  1BH9 B;  3AZM A;  4R4S A;  2EXA A;  5B2I A;  3WA9 B;  4WZ4 A;  1W2E A;  3V9R A;  5B33 D;  4Z5T A;  3AZF D;  4IVK A;  4Z9Q A;  5BNX A;  5F83 A;  4GOG A;  3AV2 C;  2NZD D;  3UTB C;  3P09 A;  5HL1 A;  4WJ3 C;  1MXO A;  4CJN A;  1IYO A;  2EX6 A;  3MBZ A;  3NY4 A;  1HZO A;  4UA6 A;  2YFW B;  5CPK A;  3WRZ A;  3ZVW A;  4QLC B;  3O87 A;  3ZG8 B;  1WWS A;  2BG1 A;  1P3O C;  3N3F A;  1M18 A;  2C5W B;  4GD8 A;  2Y55 A;  1F1E A;  1P34 D;  3A3F A;  3MXS A;  1P34 C;  1AOI A;  5HAQ A;  2G2U A;  4RA7 A;  3GR2 A;  1M19 D;  5EVI B;  4R23 A;  3UPO A;  3X1U C;  1Z2C B;  3AZK D;  3DW0 A;  4ZBJ B;  3WAA D;  1HTZ A;  4OPQ A;  4GDB A;  3O86 A;  5B24 C;  4DE1 A;  1HQ3 D;  5AVB A;  1HQ3 C;  5CGX A;  3O88 A;  1P3K A;  1RCJ A;  5FI7 A;  1EQZ C;  4MLL A;  3AZH A;  3W96 B;  3LZ0 D;  1K56 D;  2ZC4 B;  1XA1 A;  4P0M A;  4NET A;  3DTM A;  2ZC6 B;  1KX4 B;  3ISG A;  2FFF B;  3AV1 B;  5U47 A;  4OUI A;  3AZG B;  5AVC A;  1EI5 A;  5DVA A;  2BLS A;  5DTK A;  5HAI A;  2HPB A;  3WTP D;  4KGC C;  2WGI A;  2X01 A;  4OKP A;  3KXB B;  3DWZ A;  1P3A B;  3C1C A;  5KSH A;  3MVD A;  1BH9 A;  5FQ9 A;  4OQH A;  2ZY5 A;  3MGS B;  3WA9 A;  4E44 A;  2Y59 A;  5AY8 B;  3B0C W;  1P3B D;  3WKJ B;  4N9K A;  4EQI A;  4X23 B;  5AV9 C;  1KX3 C;  1BLP A;  5B1M B;  4X6T A;  3UO9 A;  3REK B;  1FSW A;  2XFS A;  4S2J A;  4KZB A;  3X1T D;  4J8V D;  3VH5 T;  3W96 D;  5B0Y C;  1P3I C;  4WZ5 C;  1T3U A;  2YFW A;  5GLB A;  4BLM A;  4QLC A;  5A90 A;  3L28 A;  3MNN D;  1FCO A;  2IO5 C;  5FI6 A;  1KX4 D;  3MNN C;  5F1G A;  4K91 A;  3C4O A;  2IOU A;  1CEG A;  2ARO D;  3UE0 A;  3VFH A;  4EWF A;  4MEZ A;  3KFU G;  3MKE A;  3WWX A;  5DNN B;  3S1Y A;  5KSC A;  2V20 A;  2PYO C;  4WV4 B;  3TU4 B;  1ZC2 A;  3RXX A;  5EVI A;  2VQR A;  3HLG A;  3AFA B;  2WZZ A;  5GHY A;  4BL2 A;  4LD9 B;  1IYS A;  4HGA B;  4ZUX B;  1FOF A;  2DF4 C;  1K54 C;  3OZH A;  2RVQ C;  5E5A D;  2V2F F;  3AYW B;  4IBK A;  1SDE A;  1LI0 A;  2OV5 A;  3MGR D;  1GA9 A;  5B1M D;  1U35 B;  3X1S B;  1W79 A;  2H10 A;  2J9O A;  5HAP A;  3BFG A;  4BQM A;  5FAS A;  3S22 A;  4Z66 B;  4EUZ A;  2Y2J A;  3V50 A;  3AV1 A;  4KZ8 A;  3AZG A;  2XLN A;  1MY8 A;  4OP5 A;  5D3O A;  4GDN A;  5GL9 A;  2Y2N A;  4XUX A;  1BLC A;  3H0L C;  3G34 A;  4N1H A;  5G18 A;  1TZY D;  1TZY C;  3KXB A;  1MWT A;  1XP4 A;  2DCF A;  4GHL A;  5GT0 B;  2XEP A;  2CV5 D;  2Y2G A;  3MGS A;  4JXW A;  1IEM A;  5B2J B;  5AY8 A;  3UE1 A;  4YS3 C;  3WKJ A;  3W99 D;  5GHZ A;  5DTS A;  1GCE A;  5JRG B;  4X23 A;  4MNR A;  4S2O A;  1L0D A;  1ZLA C;  5AV8 D;  2Q9N A;  4E3O A;  2WAE A;  4OPZ A;  1P3F C;  1PW1 A;  5AV6 A;  3REK A;  3MZE A;  4FH2 A;  2R9X A;  5B40 A;  4JKT A;  1ONH A;  5B32 D;  5BNV B;  5B32 C;  4UA7 A;  1WYC A;  3B6F D;  1K55 A;  3NDE A;  4J8U B;  4S2N A;  5B31 C;  1F66 D;  4KG5 A;  3A3I A;  1F66 C;  2ZC5 B;  2G2W A;  4P87 A;  1ESI A;  4YM6 D;  5CPJ B;  1H5X A;  3SS3 A;  1MWU A;  1YU4 A;  3UDF A;  4J8W B;  4IBB A;  2RIQ A;  2HP6 A;  3HLW A;  3REL D;  3BM6 A;  3PTE A;  4BJP A;  4E3K A;  1PIO A;  5DNN A;  5F99 B;  3TU4 A;  4GH9 A;  5B0Z C;  3AFA A;  3AN2 D;  1BTL A;  5CHM A;  4LD9 A;  4G92 B;  1K57 A;  3AZN C;  4LV3 A;  5CPI B;  4GKU A;  4ZUX A;  3IF6 C;  4OPY A;  5FAO A;  4JF6 A;  2F2A C;  3LJA D;  4MBH A;  4J8X C;  4A5R A;  3AZE D;  3LJA C;  5CGW A;  4CAY B;  3AYW A;  3AZE C;  3A3D A;  1E25 A;  3D4F A;  1BLH A;  1YUE A;  3R45 B;  3B0C T;  3JYI A;  1U35 A;  3X1S A;  3SH7 A;  4OLD A;  2F8N G;  3WX7 A;  4R3B A;  4Z66 A;  5CEB A;  4QY6 A;  2Y2M A;  4J8U D;  5CP6 D;  4NE3 A;  1P3P C;  3RXW A;  3W98 C;  5JYO A;  1IKG A;  2F8N B;  3ZNT A;  1NYY A;  3IXB A;  1P3M C;  2XQZ A;  1ERM A;  3UT9 D;  3HLD A;  4QD4 A;  1P3G D;  4KQR A;  3E2K A;  5GT0 A;  4WU9 A;  1XXM A;  4Y7P A;  1JVJ A;  4R8P A;  3L26 A;  5B2J A;  1N9B A;  1YU3 A;  3OPP A;  5DF9 A;  2FJ7 B;  4XZQ B;  3L25 A;  2E8I A;  5B2I B;  1KDW A;  1ES5 A;  3SS5 A;  5JRG A;  5AV5 D;  3IH8 A;  3V9R B;  5C3I B;  4GD6 A;  4WU8 C;  3MGQ D;  5BNX B;  5G49 B;  3VMA A;  5BS7 C;  4JJN C;  3EPL A;  3REI B;  3C1B D;  4KUD C;  1YLY A;  3C1B C;  1U60 A;  4OH0 A;  1BLS A;  4H9O B;  1BZA A;  3GMW A;  3KWQ D;  1M40 A;  1IYQ A;  5CPJ A;  2NQB C;  2JE5 A;  4XUJ A;  3O62 B;  3REJ C;  1FQG A;  4J8W A;  1P3L D;  3V39 A;  3A6N B;  4KQO A;  5F99 A;  5GT3 D;  3MGP D;  1W8Q A;  3MGP C;  4MBK A;  3UTA A;  1ID3 B;  1SCW A;  3HUM A;  4MBF A;  4EBP A;  2J8P A;  3C7V A;  1KE0 A;  5HW3 A;  2EX9 A;  4GHA A;  1ERO A;  3AZM D;  1YU0 A;  5EOE A;  3OPR A;  2PBY A;  5B2I D;  4DE0 A;  3X1V A;  3KUY C;  3GV9 A;  4JPM A;  4Z5T D;  3R45 A;  5GXQ C;  4DQY B;  5B1L C;  4FH4 A;  3HL9 A;  5CEC A;  3NDG A;  1QMF A;  1PZO A;  1S32 A;  4Y0T A;  3AZI C;  4OP8 A;  3AV2 B;  4Q8I A;  4PPR A;  4JF4 A;  5KDM B;  1FR6 A;  3LEL C;  5KMW A;  5CXW A;  5AVC B;  1PWC A;  5CPK D;  2F8N A;  3HON A;  1SHV A;  2F8N K;  2WAF A;  4IED A;  1M18 D;  3FKW A;  3W97 C;  1P3O B;  3C1C B;  4BD1 A;  5TFQ A;  5A91 A;  3L29 A;  2C6W B;  4OQG A;  1AOI D;  1IKI A;  3LZ1 C;  4XZQ A;  2FJ7 A;  2OLV A;  4GNU A;  5DNM A;  1XGI A;  4D2O A;  4IBI A;  3LY4 A;  3IQA A;  5B33 C;  5EUA A;  1K4E A;  3X1U B;  3AZF C;  5AVB D;  5G49 A;  1I2W A;  1P3K D;  1MWR A;  4KG2 A;  2J9P A;  2NZD C;  3REI A;  2WZX A;  4GZB A;  3O3V A;  3AZH D;  1Z6F A;  3AZH C;  4NYY A;  4H9O A;  3B0B A;  1ZG6 A;  1SDN A;  4NZ5 A;  4H9P A;  3HLE A;  2HIO B;  3C5A A;  4H9R B;  1YMS A;  5FSR A;  3O62 A;  2DNS A;  5E2G A;  3A6N A;  3ZDJ A;  3P5J B;  4QU3 A;  5F1F A;  4OQI A;  3VP1 A;  3L27 A;  3ZGA B;  5JA4 B;  1L2S A;  4EO5 B;  2V1Z A;  1ID3 A;  1KGE A;  1TAF B;  2WGW B;  1ES4 A;  5GSU A;  1M19 C;  3C1C D;  3B6G B;  3HLB A;  3MVD D;  3AZK C;  3WAA C;  3WA9 D;  4NE6 A;  1DJB A;  1PI4 A;  3KSY A;  3EQU A;  4ZJ3 A;  4E3J A;  2DRW A;  3V3S A;  5AQB A;  2JBF A;  3NI9 A;  3LZ0 C;  5TR7 A;  1XA7 A;  3M6H A;  2I72 A;  3VP2 A;  4BEN A;  1XGJ A;  4WM9 A;  1YQS A;  1PWD A;  1ZKJ A;  5AV9 B;  1KX3 B;  1XX2 A;  4CPK A;  3AV2 A;  3PBS A;  3TSG A;  1CI9 A;  5GHX A;  1R4V A;  5KDM A;  3UTB A;  4X68 A;  4E45 A;  4E3L A;  3AZL B;  2Y2H A;  5B0Y B;  2EFU A;  1W8Y A;  4Y0O A;  1P3I B;  4QLC D;  3RJU A;  4IBD A;  1J9M A;  4QLC C;  3ZHH A;  5FQM A;  5AQ9 A;  3WTP C;  2IO5 B;  3ZFZ A;  1BUE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...