2XD5A

Structural insights into the catalytic mechanism and the role of streptococcus pneumoniae pbp1b
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
489
structure length
469
Chain Sequence
b'ISEITYSDGTVIASIDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTNQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PENICILLIN-BINDING PROTEIN 1B
publication title Structural Insights Into the Catalytic Mechanism and the Role of Streptococcus Pneumoniae Pbp1B
rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
total genus 153
structure length 469
sequence length 489
chains with identical sequence B
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2xd5A01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2xd5A03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2xd5A02
1PW1A 1CK3A 3C5AA 5FQKA 5CGWA 5A90A 1OMEA 1S0WA 3PTEA 4FD8A 4P85A 3N6IA 5DTTA 5EECA 2P9VA 3CJMA 2V1ZA 4HBTA 3VP4A 2EFUA 4WZ5C 3O3VA 1YMSA 3P98A 4EBPA 1ONGA 1TVFA 1K38A 3E2LA 4FCFA 1KDWA 2ZC3B 3SH8A 1PW8A 5DF9A 1BTLA 4U0XA 4LV2A 4UAAA 1MWUA 2WAEA 1BLCA 3UDXA 2B5RA 2ZC7A 4MBHA 3HLWA 3MXSA 3AGDA 5JYOA 2WGWB 3HLFA 1PWDA 4DRTA 3FZCA 1S6RA 4P87A 3ZCZA 3Q7VB 3V3SA 1WYBA 2IWCA 1IYOA 5DVAA 4BLMA 3IH8A 4JXWA 1W5DA 3LO7A 4JLFA 4ZDXA 2J8YA 4DXBA 1SDEA 1BUEA 1W8QA 3HBRA 3O88A 3UPPA 2FFYA 1TEMA 1KVMA 1SDNA 3BLSA 4WZ5A 5GLAA 2FFFB 1J9MA 1CEFA 1SHVA 4UA9A 4E6WA 1NZUA 3VMAA 5GLDA 1JWVA 1PZOA 4OQ0A 4KZ7A 4X68A 3V50A 4GDNA 5E2EA 3VP0A 5KMWA 1QMEA 3O87A 1GHMA 4EQIA 1JTDA 1IKIA 3SOIA 1HTZA 2Y91A 2ZJ9A 3SS5A 2WKHA 2I72A 4S2NC 4WZ4A 4X55A 1K55C 3IXDA 3G34A 1ES4A 1YT4A 4BL3A 3ZG8B 2Y2HA 3FKVA 3MKFA 2HP6A 4KZAA 4N9KA 4R4RA 5FSRA 3UDFA 1HZOA 4CJNA 3N4IA 1TDGA 1I2WA 2R9WA 4KENB 3RXXA 3G32A 5FAPA 3AGFA 5FI7A 5FA7A 5IHVA 3Q1FA 3ZG5A 4OQGA 2EX8A 5M18A 4EBLA 2Y2PA 5KSHA 1JVJA 3Q82A 1E3UA 5FQMA 1YLJA 2PU4A 3ZGAB 4YFMA 4WEKA 3BFCA 5CEBA 1ALQA 4S2NA 1BLPA 3M6HA 5GHYA 1K55A 1PZPA 4JXGA 4QD4A 2G2WA 2XQZA 3NI9A 3GMWA 5HARA 4QB8A 2E8IA 3EQVA 1MXOA 2Q9NA 2RL3A 1FCNA 4HEFA 4JF6A 1KDSA 2ZQ7A 5A91A 1KGGA 3UY6A 4BD1A 2DCFA 4RA7A 1G6AA 2HPBA 5HW3A 5CECA 5FQJA 4BL2A 4DDYA 1DY6A 2HP5A 2EXBA 4JF4A 4S2MA 1ES5A 5EOEA 1IYSA 5FAOA 5F1FA 1W8YA 2IWDA 4Y0OA 1M6KA 2WZXA 1FSYA 3WS0A 2XD5A 5TFQA 4B4XA 5CTNA 2Y55A 2Z2MB 2XR0A 4IVKA 2ZC5B 4DE1A 3Q81A 1FQGA 1IELA 1JTGA 4GZBA 4PM6A 1LI0A 4X69A 4QJGA 4GNUA 1DJCA 3E2KA 4Y7PA 2XDMA 4PPRA 3UO9A 5EVIB 4OPYA 1NRFA 5I94A 5FI6A 3SH9A 1PWGA 1VM1A 1MWTA 4OOMA 2JBFA 2J7VA 3CZDA 3HUOA 3VFHA 1EI5A 4X53A 4BENA 2PBYA 3WRTA 2VGJA 2R9XA 4KQRA 4QY6A 3A3JA 2X01A 2CC1A 2WGIA 4R3JA 4KG5A 2WGWA 3UE0A 3W4QA 3FYZA 3G2ZA 1MBLA 3Q7VA 4KZ4A 1I2SA 2BLSA 1MWSA 4WBGA 2UWXA 2XF3A 3A3FA 1H5XA 2X71A 5CTMA 4WYYA 3EQUA 3BFGA 4QU3A 1LL5A 2XLNA 5GLCA 3GR2A 4E3IA 4RYEA 3UDIA 1AXBA 4R4SA 3LCEA 1N4OA 3PBTA 1G68A 3GTCA 3S4XA 2ZLYA 2XGNA 3BFDA 2WK0A 3WS1A 1QMFA 3A3IA 1PI5A 4M3KA 1ES3A 4IBXA 4S2IA 3BM6A 3WS5A 3GQZA 3IT9A 3HUNA 5M19A 2EX2A 2WADA 1RCJA 3UPOA 1K4EA 4KQOA 4EBNA 3P09A 3BRMA 3VOYA 2ZQDA 3N8SA 3PBQA 3ITAA 2Y2LA 3S22A 3NC8A 2A49A 2DNSA 2EFXA 2JC7A 3HLGA 4U0TA 1NXYA 2PU2A 1ZC2A 4OOLA 5AQBA 2V20A 2ZM8A 1K57A 4JF5A 3ZFZA 3G30A 1L2SA 4FH2A 4OLDA 1YLWA 5GL9A 4DE2A 3MZDA 4EV4A 2A3UA 3OC2A 3W8KA 1PIOA 1W7FA 3IWOA 1IYQA 5E2GA 3ZDJA 2JCHA 3PBSA 5CHJA 1ESIA 2VGKA 2WUQA 3MZEA 3OPLA 4MBKA 3FV7A 4N1HA 4JXSA 3VP1A 3BFEA 1NJ4A 2WKEA 2EX9A 4JBFA 4DDSA 4GOGA 4WMCA 4KG6A 3IF6B 3IXHA 2ZM2A 2V2FF 4NK3A 3DWKA 3DW0A 1XA1A 2OLUA 3M6BA 5EVIC 1N9BA 4ID4A 3QNBA 5GLBA 1YM1A 2QZ6A 1YLYA 3WS2A 1K56A 1FR6A 4N92A 4C6YA 4MLLA 4R0QA 5EVLA 4FH4A 4NETA 3ZHHA 1CI9A 2ZMAA 2Y2QA 4MNRA 1SKFA 2XFSA 5DTSA 3CG5A 1LHYA 1M40A 4PM7A 3VSLA 5HAQA 5A93A 3G31A 5AQ7A 1H8ZA 5GHXA 3AGEA 1BSGA 1L0DA 4R23A 1JWPA 4S2OA 4LV1A 3V3RA 3IWQA 3ZG0A 5FI2A 4KQQA 4Y0UA 2WYXA 3ZNYA 3UNWA 5F1GA 5F83A 1ERQA 1JWZA 3DTMA 3I7JA 4RX3A 4E3KA 5FASA 1XXMA 4KZ3A 1YLTA 2WAFA 3PAEA 2Y2JA 1Q2PA 4XUZA 3ZVTA 4N9LA 3BEBA 1BT5A 3RJUA 5BOHA 3C4PA 2WGVA 1K4FA 4H8RA 5EVIA 3UPNA 4B88A 3D4FA 4IVIA 3GVBA 3IXGA 1CI8A 2ZC4B 4MBFA 4DE0A 1XKZA 3N7WA 4BJPA 1O7EA 3PBNA 4WELA 1XA7A 3A3EA 3G35A 2RCXA 4OPZA 3V39A 3BECA 4OQIA 1NZOA 3QHYA 5E2FA 1L0GA 4DXCA 3HLEA 5HAPA 5CHUA 1KE4A 4LCMA 4OPQA 4LV0A 1XP4A 5CGXA 3MFDA 3GV9A 5HAIA 4R1GA 4Z9QA 1XPBA 3TSGA 1IEMA 4WEJA 3NBLA 4XUXA 1NYMA 2H10A 1BULA 1K6SA 2WKIA 3PBRA 5U47A 1PI4A 1YQSA 4L0LA 2Y2NA 2J9OA 2OLVA 3ZG9B 4OP5A 4EWFA 1ONHA 3C7UA 3SH7A 4DF6A 3HLCA 4OKPA 4P0MA 3RXWA 2XH9A 1Y54A 2EX6A 5GHZA 5TR7A 1I5QA 5CGSA 2HDRA 3NIAA 2OV5A 4LENA 2OSUA 3PAGA 2IWBA 3HLDA 2HDUA 2ZQ9A 4OQHA 5J8XA 1PWCA 2J9PA 1LLBA 2X02A 4B4ZA 3GSGA 2H5SA 1ES2A 1Q2QA 4F94A 3MBZA 2QMIA 1GA0A 1ZKJA 4PMAA 5EPHA 1EWZA 4RVAA 4QY5A 1HD8A 2Y59A 1NY0A 3IF6C 4JPMA 2XFTA 3V5MA 1K57C 1XGJA 4S2PA 5FQ9A 1IYPA 4KG2A 1L0EA 1RP5A 3G2YA 4KZ8A 3WS4A 2Y2MA 5DF7A 3TOIA 3W4PA 5TGFA 4DKIA 4WM9A 4DE3A 4ZBEA 1ERMA 4UA6A 3SS3A 3IH9A 4Y0TA 5AQ9A 1W79A 2JE5A 4PM9A 3LY4A 1KVLA 3QNCA 3ZG7B 5DTKA 2HDSA 3IHAA 5D3OA 4HESA 4ZTKA 4A5RA 4GKUA 3TG9A 2P9VB 3FWLA 3IF6A 4S2KA 1YMXA 3ISGA 2HDQA 3IXBA 3OPRA 4GDBA 3OPPA 4HBUA 1E25A 4S2LA 4ZAMA 4E3LA 4BQMA 2Y4AA 5L2FA 3B3XA 2Z2LB 1XGIA 4X6TA 1FCMA 1FOFA 1NYYA 5E43A 3ITBA 4X56A 4OLGA 1FSWA 3Q07A 2ZQAA 1WYCA 4LV3A 1H8YA 2G2UA 4GN2A 3GRJA 5AQAA 1BZAA 2ZM0A 2ZD8A 3OCLA 4JXVA 3JYIA 5KZHA 3MXRA 3N8RA 1LI9A 3N8LA 4PM5A 2WZZA 4LCLA 3VP2A 3VP3A 2QPNA 3ZVWA 3OPHA 3BFFA 4PM8A 3DWZA 4OVDA 4N1XA 2C6WB 1Z6FA 1GA9A 5FDHA 5M1AA 4OP8A 3IF5A 4OOYA 3A3DA 1CEGA 3M2KA 1E4DA 4OH0A 4QHCA 3IQAA 5FQIA 3IHBA 2ZQCA 4FSFA 4U3TA 2Y2OA 3NDEA 3HLBA 5F82A 3VSKA 1MKIA 1XX2A 3ZNTA 4IEDA 1K6RA 3BLMA 1LL9A 4OONA 3UE3A 3HREA 4ZJ2A 3O86A 5G18A 5HFOA 3OZHA 4KZ9A 1DJAA 1ZG4A 1YLZA 4BD0A 2P74A 1O07A 4K91A 2Y2KA 4IBRA 3UN7A 1GHPA 2Y2GA 4S2JA 3C4OA 2EXAA 2DRWA 4E3NA 2H0YA 1TDLA 5EUAA 4E3OA 3HVFA 1MWRA 3LY3A 3VOZA 1K25A 3M2JA 4K0WA 5HX9A 1PYYA 3BYDA 1HVBA 1K54C 1EROA 5CRFA 5FAQA 1L0FA 4K0XA 4MEZA 2HP9A 4OPRA 1FCOA 4R3BA 3NY4A 4KZBA 3WRZA 2ZQ8A 4WMCD 1DJBA 1GCEA 1VQQA 2H0TA 4YINA 1KGEA 5E2HA 3W4OA 4CPKA 5FQQA 4E3JA 4ZJ1A 5EOOA 1C3BA 3G4PA 3OCNA 4XXRA 1KGFA 1ZG6A 1BLSA 2XEPA 1KE3A 1K56D 3PBOA 3SS4A 1YLPA 1FR1A 4JKTA 2GDNA 2XD1A 1E3UD 4RX2A 5CHMA 5EE8A 1SCWA 3NCKA 4O7DA 5A92A 2XK1A 5JYPA 1K54A 2C5WB 4C3QA 4GD8A 4UA7A 4UHUA 3WWXA 2ZC6B 2BG1A 2Y2IA 3C7VA 4E6XA 5DF8A 3HUMA 4GD6A 4ZJ3A 4EUZA 1ESUA 1IKGA 1MY8A 3NDGA 3MKEA 3IWIA 5KSCA 1RGYA 5CXWA 4P6BA 5CERA 2Q9MA 4Q8IA 3MZFA 3HL9A 1RGZA 5EVID 1KE0A 5HL1A 3FKWA 3S1YA 5CEDA 4KZ6A 1MPLA 4E3MA 3LEZA 3CMZA 4KZ5A 5FATA 3UE1A 1WE4A 3Q7ZA 4GB7A 4D2OA 1BLHA 3VFFA 1U60A 1GHIA 4C75A
chains in the Genus database with same CATH superfamily
1CK3A 4PKYA 2NQBB 1OMEA 4P6ZS 2P9VA 3CJMA 1F9IA 4OJPA 4YS3B 3VP4A 1YMSA 1KDWA 3AZIB 5DF9A 3VH5A 2LB5A 2WAEA 4BWIA 2M7UA 4LRYC 1P3FB 2ZC7A 3BY8A 4MBHA 2JKFA 3HLWA 3MXSA 5DNNC 2WGWB 1PWDA 3L26A 3BY9A 1GXDA 5DFXA 5B1MC 5DKLA 3ZCZA 1WYBA 2IWCA 5BT1D 5DVAA 1P3AB 3IH8A 2XA7S 1N1JB 3EWKA 5FUGB 3UPPA 3LI8A 5DNMD 1P3PA 1AOID 1SDNA 3AZFD 4WZ5A 5GSUC 2ZBBA 2FFFB 3R7WA 1SHVA 4R8PC 1M19B 2GJ3A 1Z09A 1NZUA 3V50A 4KZ7A 1EQZC 1GHMA 4EQIA 2NUPC 2HJEA 1HTZA 5B31G 2YKFA 1P3GA 3KSGA 2G5HC 4MN7A 3W96A 5IU1A 3RTYA 3T4QA 2JSSA 2HIOD 3HJIA 3M7PA 1GOIA 3FPWA 4KZAA 5FEFA 3REKB 1JFIB 1F98A 4CJNA 4EO5B 3N4IA 2R9WA 1I2WA 4WV4B 3X1VD 3DBAA 5FAPA 5GXQA 1VB6A 4OQGA 1OTEA 5B2IC 3R45B 4CAYA 4TX8A 3PXPA 3CITA 5FQMA 3VH6T 3ZGAB 3L2AA 5CEBA 2PYOC 2IOUA 3REJD 4KQDA 1BLPA 4NXEA 4O0PA 4S2NA 5GHYA 1K55A 3WD4A 4QD4A 4Z66B 5B0ZA 4GJ4A 3B6FB 3NOPC 4QB8A 2NQBC 1MXOA 4R70A 1HQ3A 1IOUA 3MFXA 1KDSA 4BD1A 5A91A 4YS3C 1G6AA 5HW3A 1TZYA 5CECA 1CJFA 2ZY3A 3C1BB 4Y0OA 3WS0A 2ZMVA 3AZIC 2DMWA 4B4XA 3W98A 5GT0D 1P3FC 3ZYTA 1CXWA 3BWLA 1JTGA 4GZBA 1MZUA 2BYKB 1KX5B 3UO9A 1VEUA 3IX4A 1P3AC 5EVIB 4CLCA 2G5IC 3SH9A 5CPIB 2JBFA 5HD3A 4BENA 2VGJA 1M19C 1PNEA 1HTAA 3AZKA 1P3OD 4J8VB 5AVCB 4H9OA 1H0MA 4KHAB 3X1SB 3AZGA 4I5SA 3CWFA 2V8FA 5AV6A 2E8JA 2O0YA 4H6JA 4WBGA 4OJ5A 5TBMB 2PYPA 5CTMA 4WYYA 3REKC 2RTSA 4QU3A 5CPKB 2K7SA 4EO5C 3GR2A 2PD8A 4RYEA 2A24A 1CQAA 3LGOA 5F5YA 3AZGB 2DF4C 4L9FA 3GTCA 4EERA 4YM6B 4M3KA 1B6WA 3BM6A 5AV8D 1P34B 3WA9D 5CPJA 3UPOA 4CSRA 3DTEA 4Z66C 4ZRRA 3VOYA 2HJ9C 2ZQDA 3B6FC 1H0IA 3ITAA 5GXQC 2Y2LA 1Y28A 3S22A 5L10A 3AZNA 2A49A 3KS4A 1NXYA 2VV8A 2V20A 4JF5A 1K57A 3ZFZA 2QKPA 4FH2A 5GL9A 1YLWA 1P9WA 4H9NA 3MZDA 3C1BC 3W8KA 3LZ0D 1PIOA 5CP6D 3IWOA 1IYQA 4LLOB 5CHJA 5B0YD 3REHA 4WL9A 3FV7A 3BFEA 2WKEA 3MGPA 4WMCA 1ZLAD 2YFVB 3IF6B 2YFWA 4KG6A 1DRMA 1KX5C 3AZMA 1XA1A 2FH5A 5EM1A 5EVIC 5GLBA 5CPIC 3WS2A 5A8BA 2AVXA 3KSFA 4XZQB 3W98C 1E6PA 1OJGA 4R0QA 3C1CA 3AV2D 5EVLA 4C6YA 3AZEB 2B18A 1W2EA 4MNRA 4II7A 2V8CA 4PM7A 1H8ZA 5GHXA 4J8VC 1BSGA 4R23A 1EW0A 5AVCC 4L9EA 3ZNYA 5F1GA 3X1SC 3OBFA 4E3KA 4NY2A 3NQJA 1XXMA 3BQ8A 4KZ3A 3C1CB 3UTBB 4P6ZM 2Y2JA 1BT5A 1TF1A 3RJUA 1ACFA 3D4FA 3GVBA 5G49B 4MBFA 3CUEC 3LELB 1P97A 5CPKC 5AV5B 4IBEA 1XA7A 5GSUD 3AZGC 3KFUG 4NEED 1MC0A 4R8PD 4OQIA 4H9RB 3L27A 1L0GA 4DXCA 4YM6C 1LL8A 5CHUA 1KE4A 2O9BA 3AYWA 4WUJA 1D7EA 2RVQD 1KX3D 1EQZD 2XA7M 1P34C 1ZHHB 3MFDA 2WKPA 2HGVA 3PBRA 1YQSA 4Z2JA 1U35A 5EM0A 2J9OA 3ULFA 5BNXA 1XJ2A 4DF6A 1P3BB 5B1LA 3RXWA 1OTIA 3AYWB 5AV9B 4GH9A 4Z2KA 2HDUA 4IJFA 4OQHA 1YAXA 5DNMA 3GSGA 3RH8B 4PMAA 2VZWA 4QY5A 3IF6C 1K57C 2PYOD 3E4QA 3G2YA 2J8PA 4KZ8A 2ZL1A 5DF7A 3TOIA 4DKIA 4EQ1A 4XZQC 4WU9A 4DE3A 3CI6A 5B33A 4UA6A 4ZBEA 2JHEA 3SS3A 3AZEC 3MS6A 4Y0TA 1W1PA 4EW7A 1W1VA 5FL3A 5BS7A 2F8NK 2JKRM 2EA9A 2HIOA 5B2JD 5DTKA 3AZID 4R6LA 3IHAA 3X1UB 2W3DA 2EWWA 3X1VA 4WU9B 3C1CC 3UTBC 3IXBA 3A6NB 3OPRA 3REIB 3KWQB 2QYBA 1DP8A 5L2FA 3B3XA 4NE3A 5AJGA 2Z2LB 1NYYA 5E43A 3AZJB 1P3AD 3LELC 4X56A 4OLGA 1WYCA 3CPTB 5AV5C 3GRJA 5I5LA 4DJ2A 5KZHA 3FG8A 3N8RA 1BYWA 1M19D 2WZZA 4Y3IA 2QPNA 1OGGA 4HJ3A 4EU0A 5DFYA 1Z6FA 1GA9A 5M1AA 2KLIA 4OP8A 3A3DA 1CEGA 3D72A 4OH0A 3IHBA 3MQOA 5KDMA 2Y2OA 3NDEA 3EPHA 1P3PD 1BH9B 3B42A 4IEDA 2WKRA 1L6JA 3LIFA 3O86A 1P3BC 4HH2A 1DJAA 1ZG4A 4BD0A 2P74A 4R38A 3AYWC 3H0MC 4IBRA 5AV9C 3T4KA 3PYPA 3REKD 4F3LB 2H0YA 3HVFA 1TAFB 2R78A 3M2JA 1PYYA 3NHQA 3IX8A 4OPRA 4I39A 3KUYB 4WU8B 2H0TA 1P3OA 3W4OA 1XJ3A 4Z66D 5EOOA 3F1OA 3B6FD 5GXQD 1CF0A 4QWOA 1KGFA 2VA0A 2B95A 1K56D 3PBOA 1OTBA 5CHMA 1SCWA 5EE8A 4O7DA 3C1BD 2QHKA 1K54A 4UA7A 3UE6A 3X1UC 2BG1A 4ZJ3A 4WU9C 2NZDB 2PT7A 3ICYA 3A6NC 4G92B 3REIC 3KWQC 1BH8A 5DJUA 1D06A 1TZYD 2UV0E 3AZJC 5EVID 3MNNB 5AV8A 3QP2A 4HMEA 3S1YA 3WA9A 5CPID 2JKRI 1W63M 3W98D 1YU0A 1ODVA 4KZ5A 5FATA 3B6GB 1WE4A 1GPFA 4GB7A 3LZ1B 4IBXA 2QWSA 1M1AB 1XFQA 5A90A 2FZ0A 3FDDA 4FD8A 2V1ZA 5KIZA 5AVCD 4CLCD 4WJ3C 4J8XA 3X1SD 3LZ0A 1XJ6A 1K38A 3E2LA 4HNBA 2ZC3B 5B0YA 3MMHA 1BTLA 4U0XA 1H3OA 1ZLAA 4I38A 3P5JB 4Z2MH 1EAKA 5CPKD 2ZY2A 4J8XB 2J3TD 1BFMA 3MQLA 1IYOA 1TS6A 3AZGD 1R4VA 1T1CA 4JXWA 4JLFA 3KS8A 4ZUXB 2J8YA 4YM6D 4DXBA 1W8QA 1BUEA 3HBRA 3O88A 3TE8A 1XJ4A 3UB6A 1G5UA 2FFYA 3BLSA 5HWVA 1P34D 3KUYC 4UA9A 4WU8C 4XT2B 4WF0A 3KXBB 1G28A 5B24B 1PZOA 4X68A 4GDNA 3LJAB 5HDSA 1JTDA 5DNNA 1F5MA 2CV5B 2ZJ9A 2AROB 3G34A 5B1MA 1ES4A 1YT4A 3H7WA 1S1YA 2Y2HA 1P3MB 4Q0IA 2IA2A 4Q0JA 4R4RA 2NZDC 5GSUA 3UDFA 4JJNB 4G92C 3WAAA 1TDGA 4R8PA 2L1MA 3RXXA 3G32A 5IHVA 3ZG5A 4YOFA 1QO6A 1WWSA 3MNNC 1EQZA 4EBLA 5M18A 3H7WB 1JVJA 5JA4B 4XZQD 1ID3B 3REHD 3B6GC 4HMDA 3LZ1C 3MGPD 3LR5A 1M1AC 3WAAB 2ZMFA 3EQVA 1FCNA 5HDDA 4PHTA 2ZQ7A 4RA7A 2HPBA 4MB5A 4DDYA 4WNNA 2HP5A 3T4TA 3C1CD 3UTBD 5F1FA 2WZXA 2XD5A 5B2IA 3WTPE 2Y55A 2Z2MB 4HJ6A 3FC7A 4IVKA 3LELD 4HHDA 2PYOA 1FQGA 1IELA 5AV5D 4LRXC 4E45A 4J8XC 4Y2FA 2XDMA 3VOLA 2QJ7A 3W99B 3T4SA 5I94A 2NQBA 4ZUXC 1PWGA 1MWTA 3ZQ5A 1VHMA 3CZDA 4YS3A 3AV1B 3IS2B 5EFWA 3WRTA 2O9CA 3KXBC 5BNVB 3AZIA 5B24C 5HSQA 3LJAC 4J8WB 1P3FA 3A3JA 2X01A 1FILA 1P3BD 4KG5A 2CV5C 2WGWA 3AYWD 2AROC 5AV9D 3FYZA 1MBLA 3KSYA 4K08A 1P3AA 3EPJA 1I2SA 1N1JA 1P3MC 1Y4OA 4O01A 3B0DB 5FUGA 1F66B 1U35D 1H5XA 1LL5A 2XLNA 4JJNC 1M19A 3QP1A 4E3IA 5B1LD 1AXBA 1G68A 3S4XA 1M18B 4KGCB 2WK0A 4Y17A 3WS1A 1ES3A 5CX7A 2LB9A 1E8BA 3WS5A 3GQZA 4ARZA 3IT9A 1ID3C 4EUVA 5M19A 2EX2A 3AZLB 1YU4A 1YKDA 4KQOA 3L28A 3WAAC 3T1SA 3BRMA 2JKGA 2PAVP 3N8SA 4GHIB 2INWA 2JC7A 5JYPA 3REKA 2PU2A 1ZC2A 3S7OA 3X1UD 1JFIA 3G30A 4ARZB 2KDKA 4WU9D 1UR9A 5B33D 4DJ3A 3OC2A 3D3OA 3MGRB 3R45A 5G4YA 3RELB 1ZTUA 3OPLA 4MBKA 4JXSA 4JBFA 3KO6A 3P7NA 1P3IB 2ZM2A 2DQNC 2A2LA 4Z66A 4YNRA 3W99C 3B6FA 2OOLA 4ID4A 3A0VA 4M4XA 5DJTA 1B67A 1YLYA 1UGUA 4NE5A 1FR6A 1K56A 2FJ7B 3AV1C 3L29A 2W1TB 4HP4A 1CI9A 2ZMAA 3MSHA 2Y2QA 1WA9A 5AVBB 3C1BA 2F8NB 5A93A 3G31A 4J8WC 3V3RA 3DTKA 3R4KA 1JWPA 4UQIS 2H28A 1SZVA 2WYXA 5F83A 1JWZA 3DTMA 1P9RA 3I7JA 4LFUA 1OGBA 4RX3A 4XUZA 2BYKA 1KX5A 2V0WA 5C5KA 5EVIA 4HP9A 1CI8A 3B0DC 5CPIA 1F66C 3N7WA 4XUJB 4EETB 4J8UB 3PBNA 3A3EA 3G35A 3VH5T 3V39A 3KUYD 4WU8D 1YSQA 1M18C 3QHYA 4KGCC 3HLEA 4J8VA 4DRBA 3B0BA 1G6OA 5AVCA 1XP4A 4NFTA 4KHAA 3F1PB 3X1SA 5HAIA 1IEMA 2VV7A 1NYMA 3AZLC 1BULA 1PFLA 1AIWA 2H10A 2WKIA 1PI4A 5U47A 3U4LP 1LSXA 4KUDB 2OLVA 3ZG9B 4OP5A 5TBMA 1ONHA 3CUEA 2ZY4A 3BW6A 4P0MA 5CPKA 3E98A 1Y54A 2PR5A 2NZDD 5DKKA 1NRJA 3AN2B 3PAGA 2IWBA 5J8XA 4YM6A 3MGRC 3RELC 4B4ZA 2Z6CA 3MNND 1GA0A 1P34A 1ZKJA 5EPHA 1HD8A 5B40B 1P3IC 3V5MA 5B32B 4IBKA 4I3AA 1XGJA 5FQ9A 3TRCA 1IYPA 3LZ1D 1L0EA 1KX4B 1M1AD 3C38A 3DAVA 2FJ7C 3V9RB 1GSWA 5AVBC 4PM9A 4WZSB 1ED7A 3LI9A 4HESA 4A5RA 3B0CT 4HMCA 2YFVA 3IF6A 3X1TB 4S2KA 1YMXA 4ZAMA 2HDQA 4GDBA 1E25A 3IBJA 4J8XD 3KYZA 1FCMA 1S32B 3L7HA 2JN7A 1W1TA 2HZ5A 4XZQA 4ZUXD 4XUJC 3RFBA 3AZEA 4J8UC 5AQAA 2W27A 3MXQA 2NUTC 2ZD8A 3OCLA 3T4LA 5JRGA 3JYIA 5EVEA 3N8LA 4ESPA 4LCLA 5HD5A 3VP2A 3ZVWA 3OPHA 4PM8A 5B24D 1AWIA 4N1XA 3LJAD 5FDHA 2Y79A 3UB7A 1E4DA 1FIKA 4U3TA 3UTBA 2ZQCA 4O8GA 2CV5D 5GT3B 3HLBA 5F82A 4KUDC 5JRGB 3UE3A 5G49A 4ZJ2A 2CMNA 3LELA 1OTAA 5HFOA 4KZ9A 1YLZA 4K91A 5AV5A 3UN7A 2Y2GA 3C4OA 3O62B 5DNND 1TDLA 4E3OA 4H9RA 3EEHA 3AN2C 4K0WA 5HX9A 5HAQA 3B47A 2YKHA 5B1MD 3UMDA 1L0FA 2HP9A 2L4RA 4KZBA 5B40C 2L0WA 5B32C 1ID3D 4GHLA 3WRZA 1VQQA 4YINA 1KU5A 1KX4C 3UT9B 5IT5A 3WAAD 5FQQA 4ZJ1A 1PDCA 1P3BA 1P3KB 4DQYB 3WX7A 3LIAA 5AV9A 4LD9A 2XEPA 2XD1A 2O9AA 3NCKA 5A92A 1Z2CB 3AZHB 3WWXA 4E6XA 2Y2IA 1OT9A 3X1TC 3BJNA 4BMWA 1MY8A 4L9GA 4LD9B 4IUKA 3A1KA 2Q9MA 3LIDA 1S32C 1KE0A 5J3WA 2P04A 5HL1A 4UPKA 3FKWA 3LR3A 5CEDA 4KZ6A 5B2ID 4E3MA 3AV1D 3Q7ZA 1BLHA 1U60A 1PW1A 3C5AA 5FQKA 5CGWA 2I9VA 1S0WA 3X1UA 3PTEA 4J8WD 2K2NA 3N6IA 4P85A 4PKYG 2NQBD 4HBTA 3WKJB 1HLUP 3A6NA 2EFUA 3REIA 4ETZA 3KWQA 5GT3C 1ONGA 2VX8A 4YS3D 4FCFA 3SH8A 5JRGC 2PD7A 3AZJA 4NZ3A 1MWUA 1BLCA 3UDXA 2B5RA 3CPTA 1LSVA 3U2AA 1F66D 1W1YA 1P3FD 4UQIM 3AFAB 3O62C 4CQHA 3KYQA 4DRTA 3FZCA 5F68A 4Z2MG 4P87A 3Q7VB 3V3SA 2BYMB 1W5DA 3LO7A 4ZDXA 4KGCD 4IBFA 4H9PB 1SDEA 4H9QB 4IHQA 1TEMA 1KVMA 4JGPA 1CEFA 1BH9A 3AZLD 3UT9C 5GLDA 4OQ0A 3VP0A 5E2EA 5KMWA 1P3KC 2JKTM 3O87A 4NZ5A 3A0RA 3UB5P 3NOUC 2VK3A 4WN5A 1WWIA 4F3LA 3SS5A 4WZ4A 4I3JA 1TAFA 5LBRA 3AZHC 3L25A 3MGRD 3MKFA 2HP6A 4HI4A 4N9KA 5B31B 4MDZA 1HZOA 3GECA 2BTFP 4LD9C 3KUYA 4NXGA 4WU8A 4MMNA 1P3ID 3AGFA 3Q1FA 2OWHA 3IX3A 2Y2PA 5KSHA 2WKQA 3Q82A 3REJB 1E3UA 1E6ZA 2PU4A 2VJWA 4MCWA 1ALQA 1PZPA 3PR6A 1W63Q 3W97B 2XQZA 1E6RA 5AVBD 2F8ND 2E8IA 2Q9NA 2RL3A 4Y15A 3UY6A 3WKJC 2NZDA 4X23B 1X0OA 1L3LA 1DY6A 4G3VA 2EXBA 4H9SC 3KSIA 1ES5A 2D49A 4JF4A 1W8YA 3F6TA 4LPZA 5GT0B 1M6KA 1FSYA 5TFQA 4RQ9A 4IBBA 5CTNA 3MNNA 2M1CA 5BO0B 5BT1C 4XUJD 3MVDB 3AFAC 3B6GA 2V9AA 1LI0A 4X69A 3LZ1A 3SZTA 4GNUA 4J8UD 3E2KA 4Y7PA 1M1AA 3VE4A 4PPRA 2XSSA 4OPYA 1NRFA 1E6NA 4IBJA 3DTIA 2G7UA 1KX5D 2HV1A 1VM1A 3WTPB 3S7NA 3UTAB 2J7VA 3VFHA 2EWVA 2R9XA 4KQRA 1UWNX 5HPIA 3UB8A 4KUDD 3FKEA 3TU4B 2CC1A 2WGIA 4NXBA 4J8VD 4R3JA 1YU1A 3LEQA 1N9LA 4JGOA 3K3CA 4E44A 4KZ4A 3EEAA 1MWSA 4ZUXA 4KUKA 3PHYA 4GS9B 5B31C 3EQUA 3BFGA 2IO5B 5GLCA 2KOIA 4NE6A 4R4SA 4XT2A 1NWZA 5B32D 3KXBA 3PBTA 5B24A 4Z2HA 3NQUB 2JKTI 2ZLYA 4HGAB 3LJAA 1PI5A 4S2IA 3REJC 1DP6A 1J3WA 2CV5A 3T12B 2AROA 4UUZB 4R3AA 1RCJA 4PAUA 1K4EA 4GW9A 3W97C 3P09A 1P3MA 1V9YA 3H0RC 3HLGA 5C3IB 2PRFA 4EEUA 2ZM8A 3SW1A 4JJNA 4X23C 4OLDA 4DE2A 3X1TD 1NLYA 2A3UA 5GT0C 3OOVA 3PBSA 1DP9A 2WUQA 1S32D 4HY8A 5JA4A 3VP1A 4DDSA 3H82B 1ID3A 3MVDC 3HSHA 4NK3A 2F8NH 3DWKA 1OJ5A 3QNBA 3AV2B 3WTPC 3UTAC 4MLLA 4BBUA 5E5AA 4HJ4A 3OLOA 1SKFA 2XFSA 3AZED 3CG5A 1LHYA 3LYXA 5AQ7A 5JRGD 1VETA 3AGEA 3TU4C 4S2OA 3IWQA 3ZG0A 1CK7A 3BQAA 5FI2A 1YPRA 3H9WA 2WAFA 5E5AB 3PAEA 2J80A 1Q2PA 3ZVTA 2RIQA 5MC7A 3O62D 4B88A 3W99A 4Z5TB 1T19A 2ZC4B 3JVVA 5J7EA 3FPVA 3HONA 1VETB 4QLCB 2IO5C 3AV1A 3IS2A 1O7EA 1D1JA 4WELA 2RCXA 4OPZA 5BNVA 4YWZA 4HGAC 1KX3B 3UT9D 4J8WA 5HAPA 3P01A 4LCMA 4LV0A 5CGXA 1F1EA 1GSXA 1XPBA 5AY8A 3NBLA 4EEPA 1S66L 4L0LA 4ME4A 5F99B 4EWFA 2VEAA 1F66A 3HLCA 5C3IC 3AZHD 3B33A 4Z2IA 2XH9A 4IBGA 4MN6A 3UB9A 2HDRA 5AY8B 4LD9D 2OV5A 2OSUA 1M18A 4KGCA 2ZQ9A 1PWCA 1OTDA 1ES2A 1Q2QA 3MBZA 3W2ZA 3G6OA 4G3KA 3C30A 2Y59A 1NY0A 3CAXA 3AZLA 3QP8A 2M7VA 4Z2GA 4KG2A 3L9KA 4GHIA 1LT0A 3WS4A 3AV2C 5TGFA 3EPKA 4WM9A 2J3WA 4UEYA 1P3LB 1ERMA 2Z6DA 4AWLB 3MGSB 3IH9A 5B2JB 3WKJD 3QP5A 1W79A 2JE5A 4JGQA 1KVLA 4EXOA 3MGRA 3ZG7B 3RELA 5D3OA 4ZTKA 1YUEA 2P9VB 1P3IA 5E5AC 1TD5A 4S2LA 1OPXA 2Q0OA 2V1AA 4HBUA 3AFAD 4E3LA 3NJAA 3A6ND 3REID 4Z5TC 1E88A 1XGIA 3KWQD 1FOFA 3QP6A 4IJGA 2FJ7A 4QLCC 2ZQAA 4LV3A 2W1TA 3AZJD 4LGWA 2G2UA 4JXVA 5AVBA 2PHYA 4PM5A 2Y8HA 2F8NA 4IBIA 3VP3A 2RVQC 1KX3C 3K2NA 3MJQA 3O5YA 2C6WB 3QP4A 3IF5A 4NG2A 3M2KA 3CHWP 4G91B 1P3PB 3LIEA 4Q0HA 2ZOIA 2VGLS 3R7WB 1MKIA 3C8CA 1XX2A 3ZNTA 1K6RA 3S7QA 5F99C 3HREA 2ZM5A 5G18A 1O07A 4XUJA 3VV4A 5EV0A 4BBTA 1GHPA 4J8UA 4S2JA 5B31D 2DRWA 1P3GB 1S4SA 5AY8C 5EUAA 5FDSA 2CWEA 3W96B 1JNUA 3VOZA 4Y13A 2W3GA 5CRFA 4G3WA 2VKSA 3F1PA 4K0XA 1T1BA 4R3BA 2V5OA 1H8MA 2PYRA 1DJBA 1GCEA 2ACGA 4KUDA 4CPKA 5GXQB 3W97D 4IBCA 1C3BA 2B02A 4HQAA 4CAYB 3OCNA 2V0UA 4XXRA 5HDCA 1P3LC 1KE3A 4AWLC 3MGSC 1YLPA 5B2JC 3EGDC 2GDNA 4MB3A 1E3UD 4X23D 4RX2A 3AN2A 4KUOA 2XK1A 5B0ZB 2C5WB 3C7VA 1HQ3B 3EPLA 5B40A 5B32A 1IKGA 1V9ZA 1TZYB 3NDGA 3MVDD 1PRQA 3IWIA 1KX4A 5KSCA 1RGYA 5L8MA 3H0LC 4P6BA 5CERA 4Q8IA 3MZFA 3W98B 2F2AC 3LFVA 3EG5B 3V9RA 3WTPD 3UTAD 3KX0X 1N9NA 3E0YA 5FEGA 3WD2A 3B6GD 2PBDP 1VEUB 1GSVA 3EGXC 4CLCB 3MF0A 1T18A 3TU4D 5DTTA 5EECA 2QJ5A 3V67A 4G91C 3X1TA 1P3PC 4GLQA 4WZ5C 3O3VA 3P98A 3GDIA 4EBPA 1TVFA 1PW8A 2HUEB 1S32A 4LV2A 3AZKB 3E4OA 1A0KA 4UAAA 4H9OB 3AGDA 3T4JA 5JYOA 3T50A 3HLFA 2XRNA 1P3GC 1S6RA 1XFNA 3D9YA 5AV6B 3N3FA 3W96C 4BLMA 3A0SA 4H6JB 2OAP1 4Z2LA 3IBRA 5GLAA 5GT3A 1J9MA 2A24B 4E6WA 3VMAA 1IFQA 1JWVA 4B93A 3KXBD 1QMEA 1ULYA 4LG2A 1IKIA 3SOIA 2Y91A 3O62A 2WKHA 2I72A 4S2NC 4X55A 1F2KA 3MGQA 1K55C 3IXDA 5CPJB 4CSRB 4BL3A 2AROD 5B0ZC 3ZG8B 3C2WA 2D01A 3T1XA 2VV6A 3AZNB 1HQ3C 3FKVA 3CLOA 1P3MD 4QPRA 5FSRA 1TZYC 4KENB 4NXFA 4H9NB 3UT9A 4IUHA 4JJND 3MGQB 5FA7A 5FI7A 2EX8A 1A7WA 1P3KA 3REHB 1YLJA 3MGPB 4WEKA 3BFCA 4YFMA 2YFWB 3M6HA 4JXGA 2G2WA 3AZMB 3NI9A 3GMWA 5HARA 3AZHA 3EOIA 4DRAA 4HEFA 4CLCC 2KX6A 4JF6A 2P08A 3LICA 1KGGA 3VE3A 2DCFA 5FQJA 4BL2A 1KS0A 2GZAA 4S2MA 1PZRA 3LUQA 1IYSA 2MJ6A 5E5AD 2IWDA 5EOEA 5FAOA 2HUEC 5K5BA 3AZKC 2P7JA 2XR0A 5HWTA 1T1AA 4ETXA 4Z5TD 2ZC5B 3A1IA 2J3TC 4DE1A 3Q81A 4QLCD 3NQJB 2VLGA 4PM6A 4QJGA 1S1ZA 4X1MA 1DJCA 1LSWA 3T1RA 5AV6C 3HCYA 5FI6A 4CLCE 3W99D 4OOMA 3HUOA 1EI5A 3WKJA 4X53A 3MQQA 1TS0A 2PBYA 4OJ6A 2XROA 4H9SA 4NZ1A 4QY6A 2K31A 3AL0C 2VQRA 5F99D 5IS1A 4OUIA 3AFAA 3UE0A 3W4QA 3JVUA 3G2ZA 3Q7VA 5CPJC 3WD1A 2V1BA 1NLZA 2BYMA 5AY8D 1U35B 1AOIA 2BLSA 2D02A 2VGLM 2UWXA 2XF3A 4QNLA 3AZFA 5BNXB 3A3FA 3AZNC 4H9PA 4H9QA 2X71A 4I3IA 5B1LB 3UDIA 4ZBJB 3LCEA 1N4OA 4HIAA 3MGQC 4B9OA 2XGNA 3BFDA 1E15A 1QMFA 3A3IA 3REHC 5DNMB 1AOIB 1M18D 2GX5A 3MGPC 3AZFB 3E4PA 3HUNA 4DMZA 4MN5A 2WADA 1P3LD 1UR8A 4D60A 3MGSD 3TJZC 4EBNA 3AZMC 3PBQA 2ZL1B 3NC8A 2DNSA 2EFXA 2PDRA 5AQBA 5B31A 4U0TA 1J7MA 4OOLA 5B33B 1L2SA 1T3UA 4EV4A 1W7FA 2HIOB 5TJJA 5E2GA 4HOIA 2JCHA 3ZDJA 1ESIA 2VGKA 3MZEA 3REJA 4N1HA 1O6IA 1NJ4A 2EX9A 5HL6A 2L5AA 3RELD 4GOGA 2W3HA 3IXHA 3X1VB 2V2FF 3W97A 3DW0A 2OLUA 4Z1WA 3M6BA 1N9BA 1YM1A 2F8NG 2QZ6A 4N92A 4FH4A 4NETA 3ZHHA 4X23A 4DN0A 4NYUA 3S7PA 2FJ7D 5GT0A 3WD0A 5DTSA 3K3DA 5F6AA 1M40A 3VSLA 5HWWA 5CHLB 2HF6A 1L0DA 4LV1A 4KQQA 5BO0A 4Y0UA 4WLAA 3UNWA 1YU2A 3NECA 1ERQA 5FASA 3MVDA 1YLTA 5KDMB 4N9LA 3BEBA 5BOHA 1P3GD 3C4PA 2WGVA 1K4FA 4H8RA 3UPNA 5AVFA 1KOUA 1U35C 4IVIA 3JPUA 3IXGA 2GNXA 3W96D 3NOTC 4DE0A 1XKZA 3WTPA 3UTAA 5B1LC 4BJPA 3UMEA 5HZHA 4ZBJC 3F1NA 3WD3A 2BASA 3BECA 1NZOA 5E2FA 3TU4A 4JGRA 5DNMC 1AOIC 4OPQA 2O99A 3AZFC 3GV9A 4LRZE 4R1GA 4Z9QA 3TSGA 4WEJA 4XUXA 2FN2A 2OAQ1 1K6SA 4FUWA 3F1NB 1P3OB 2Y2NA 5J4EA 3C7UA 3SH7A 5B0ZD 3F1OB 4GS9A 4OKPA 1YSPA 4NZ4A 1HQ3D 5B33C 3T1QB 2EX6A 5GHZA 5TR7A 1I5QA 5CGSA 2W8SA 5BS7C 5B32G 3NIAA 3NQUA 4LENA 2HIOC 4IJEA 4HH3A 3HLDA 2J9PA 1LLBA 2X02A 2H5SA 3AN2D 4F94A 2QMIA 3LR4A 4MB4A 1EWZA 4RVAA 4UUZA 4JPMA 5L07A 3X1VC 2W3FA 2XFTA 3VH6W 4S2PA 2LY8A 1BH8B 5B40D 1RP5A 2Y2MA 3W4PA 1MKMA 5AV8B 1KX4D 5F69A 3WA9B 4E04A 5CP6A 5AQ9A 1K0KA 2W1RA 4IBDA 3LY4A 1YU3A 3QNCA 2W3EA 2HDSA 5G4ZA 3AZKD 3H82A 1SKOA 4GKUA 3TG9A 3FWLA 3ISGA 3OPPA 2ZOHA 3LZ0B 5CP6B 4BQMA 2Y4AA 3VH5W 5B0YB 5AV6D 3AV2A 4X6TA 3ITBA 1H3OB 1FSWA 3Q07A 2ZY5A 1ZLAB 1TS8A 1H8YA 1SKOB 4GN2A 1BZAA 1Q9CA 2ZM0A 3MXRA 1STZA 1LI9A 1S4RA 3BFFA 4NYYA 4OJOA 1P0ZA 3DWZA 4OVDA 2W0NA 4QHCA 4OOYA 3IQAA 5FQIA 4FSFA 1OT6A 3VSKA 1P3OC 5CPJD 3IP4C 3BLMA 4Z5TA 1LL9A 1TS7A 4OONA 5GT3D 5AVEA 1H3QA 1S67L 3OZHA 2OWJA 4QLCA 4X25A 2Y2KA 3AZND 5DNNB 2EXAA 4FTXA 2PR6A 4E3NA 5B1MB 1H8PA 1MWRA 3LY3A 1KX3A 1K25A 4BBVA 3BYDA 3MGQD 1HVBA 1EROA 1K54C 4GHAA 5FAQA 4MEZA 1FCOA 3NY4A 1UWPX 5L09A 5GSUB 4NKPA 2ZQ8A 4WMCD 4R8PB 5E2HA 1KGEA 4OJLA 3HJKA 3TW8A 5F99A 3AZMD 4E3JA 1EQZB 5AV8C 3G4PA 4AFIA 3WA9C 3T4OA 3KYEA 1ZG6A 1BLSA 3B0CW 1P3KD 3SS4A 5HPFA 1FR1A 4JKTA 4EESA 3LIBA 3MQ0A 4Y5FA 4C3QA 4GD8A 4FOFA 4UHUA 2ZC6B 1N9OA 5DF8A 3HUMA 4GD6A 4X1LA 4EUZA 1ESUA 4GCZA 3LZ0C 3MKEA 4WNNB 5CP6C 3LR0A 3VH6A 5B0YC 5CXWA 1H0GA 3HL9A 1RGZA 3MR0A 5BPVA 4M6BA 5B2IB 1ZLAC 1P3LA 3NULA 3KSHA 1MPLA 3LEZA 3MGSA 3CMZA 5B2JA 2PYOB 3UE1A 4D2OA 3VFFA 1GHIA 4C75A
chains in the Genus database with same CATH topology
1CK3A 2NQBB 1OMEA 2P9VA 3CJMA 4OJPA 4YS3B 3VP4A 1YMSA 1KDWA 3AZIB 5DF9A 3VH5A 2WAEA 1P3FB 2ZC7A 4MBHA 3HLWA 3MXSA 5DNNC 2WGWB 1PWDA 3L26A 3ZCZA 5B1MC 1WYBA 2IWCA 5BT1D 5DVAA 1P3AB 3IH8A 1N1JB 5FUGB 3UPPA 5DNMD 1P3PA 1AOID 1SDNA 3AZFD 4WZ5A 5GSUC 2FFFB 1SHVA 4R8PC 1M19B 1NZUA 3V50A 4KZ7A 1EQZC 1GHMA 4EQIA 1HTZA 5B31G 1P3GA 2G5HC 3W96A 2JSSA 2HIOD 4KZAA 3REKB 1JFIB 4CJNA 4EO5B 3N4IA 2R9WA 1I2WA 4WV4B 3X1VD 5FAPA 5GXQA 4OQGA 5B2IC 3R45B 4CAYA 5FQMA 3VH6T 3ZGAB 3L2AA 5CEBA 2PYOC 2IOUA 3REJD 4S2NA 1BLPA 5GHYA 1K55A 4QD4A 4Z66B 5B0ZA 3B6FB 4QB8A 2NQBC 1MXOA 1HQ3A 1KDSA 4BD1A 5A91A 4YS3C 1G6AA 5HW3A 1TZYA 5CECA 2ZY3A 3C1BB 4Y0OA 3WS0A 3AZIC 4B4XA 3W98A 5GT0D 1P3FC 1JTGA 4GZBA 2BYKB 1KX5B 3UO9A 5EVIB 1P3AC 2G5IC 3SH9A 5CPIB 2JBFA 4BENA 2VGJA 1M19C 1HTAA 3AZKA 1P3OD 4J8VB 5AVCB 4H9OA 4KHAB 3X1SB 3AZGA 5AV6A 4WBGA 4OJ5A 5CTMA 4WYYA 3REKC 4QU3A 5CPKB 4EO5C 3GR2A 4RYEA 3AZGB 2DF4C 3GTCA 4YM6B 4M3KA 1B6WA 3BM6A 5AV8D 1P34B 3WA9D 5CPJA 3UPOA 4CSRA 4Z66C 3VOYA 2ZQDA 3B6FC 3ITAA 5GXQC 2Y2LA 3S22A 3AZNA 2A49A 3KS4A 1NXYA 2V20A 4JF5A 1K57A 3ZFZA 4FH2A 5GL9A 1YLWA 4H9NA 3MZDA 3C1BC 3W8KA 3LZ0D 1PIOA 5CP6D 3IWOA 1IYQA 5CHJA 5B0YD 3REHA 3FV7A 3BFEA 2WKEA 3MGPA 4WMCA 1ZLAD 2YFVB 3IF6B 2YFWA 4KG6A 1KX5C 3AZMA 1XA1A 5EVIC 5GLBA 5CPIC 3WS2A 4C6YA 4XZQB 3W98C 4R0QA 5EVLA 3C1CA 3AV2D 3AZEB 1W2EA 4MNRA 4PM7A 1H8ZA 5GHXA 4J8VC 1BSGA 4R23A 5AVCC 3ZNYA 5F1GA 3X1SC 4E3KA 4NY2A 3NQJA 1XXMA 4KZ3A 3C1CB 3UTBB 2Y2JA 1BT5A 3RJUA 3D4FA 3GVBA 5G49B 4MBFA 3LELB 5CPKC 5AV5B 4IBEA 1XA7A 5GSUD 3AZGC 3KFUG 4R8PD 4OQIA 4H9RB 3L27A 1L0GA 4DXCA 4YM6C 5CHUA 1KE4A 3AYWA 2RVQD 1KX3D 1EQZD 3MFDA 1P34C 3PBRA 1YQSA 1U35A 2J9OA 5BNXA 4DF6A 1P3BB 5B1LA 3RXWA 3AYWB 5AV9B 4GH9A 2HDUA 4IJFA 4OQHA 5DNMA 3GSGA 4PMAA 4QY5A 3IF6C 1K57C 2PYOD 3G2YA 2J8PA 4KZ8A 5DF7A 3TOIA 4DKIA 4XZQC 4WU9A 4DE3A 5B33A 4UA6A 4ZBEA 3SS3A 3AZEC 4Y0TA 5BS7A 2F8NK 2HIOA 5B2JD 5DTKA 3AZID 3IHAA 3X1UB 3X1VA 4WU9B 3C1CC 3UTBC 3IXBA 3A6NB 3OPRA 3REIB 3KWQB 5L2FA 3B3XA 4NE3A 2Z2LB 1NYYA 5E43A 3AZJB 1P3AD 3LELC 4X56A 4OLGA 1WYCA 5AV5C 3GRJA 5KZHA 3N8RA 1M19D 2WZZA 2QPNA 1Z6FA 1GA9A 5M1AA 4OP8A 3A3DA 1CEGA 4OH0A 3IHBA 5KDMA 2Y2OA 3NDEA 3EPHA 1P3PD 1BH9B 4IEDA 3O86A 1P3BC 1DJAA 1ZG4A 4BD0A 2P74A 3AYWC 3H0MC 4IBRA 5AV9C 3REKD 2H0YA 3HVFA 1TAFB 3M2JA 1PYYA 4OPRA 3KUYB 4WU8B 2H0TA 1P3OA 3W4OA 4Z66D 5EOOA 3B6FD 5GXQD 1KGFA 1K56D 3PBOA 5CHMA 5EE8A 1SCWA 4O7DA 3C1BD 1K54A 4UA7A 3X1UC 2BG1A 4ZJ3A 4WU9C 2NZDB 3A6NC 4G92B 3REIC 3KWQC 1BH8A 1TZYD 3AZJC 5EVID 3MNNB 5AV8A 3S1YA 3WA9A 5CPID 3W98D 1YU0A 4KZ5A 5FATA 3B6GB 1WE4A 4GB7A 3LZ1B 4IBXA 1M1AB 5A90A 3FDDA 4FD8A 2V1ZA 5AVCD 4WJ3C 4J8XA 3X1SD 3LZ0A 1K38A 3E2LA 2ZC3B 5B0YA 1BTLA 4U0XA 1H3OA 1ZLAA 3P5JB 4Z2MH 5CPKD 2ZY2A 4J8XB 1BFMA 1IYOA 3AZGD 1R4VA 4JXWA 4JLFA 3KS8A 4ZUXB 2J8YA 4YM6D 4DXBA 1W8QA 1BUEA 3HBRA 3O88A 2FFYA 3BLSA 1P34D 3KUYC 4UA9A 4WU8C 3KXBB 5B24B 1PZOA 4X68A 4GDNA 3LJAB 1JTDA 5DNNA 2CV5B 2ZJ9A 2AROB 3G34A 5B1MA 1ES4A 1YT4A 2Y2HA 1P3MB 4R4RA 2NZDC 5GSUA 3UDFA 4JJNB 4G92C 3WAAA 1TDGA 4R8PA 3RXXA 3G32A 5IHVA 3ZG5A 5M18A 1WWSA 3MNNC 1EQZA 4EBLA 1JVJA 5JA4B 4XZQD 1ID3B 3REHD 3B6GC 3LZ1C 3MGPD 1M1AC 3WAAB 3EQVA 1FCNA 2ZQ7A 4RA7A 2HPBA 4DDYA 4WNNA 2HP5A 3C1CD 3UTBD 5F1FA 2WZXA 2XD5A 5B2IA 3WTPE 2Y55A 2Z2MB 4IVKA 3LELD 2PYOA 1FQGA 1IELA 5AV5D 4E45A 4J8XC 2XDMA 3W99B 5I94A 2NQBA 4ZUXC 1PWGA 1MWTA 3CZDA 4YS3A 3AV1B 3WRTA 3KXBC 5BNVB 3AZIA 5B24C 3LJAC 4J8WB 1P3FA 3A3JA 2X01A 1P3BD 4KG5A 2CV5C 2WGWA 3AYWD 2AROC 5AV9D 3FYZA 1MBLA 3KSYA 1P3AA 3EPJA 1I2SA 1N1JA 1P3MC 3B0DB 5FUGA 1F66B 1U35D 1H5XA 1LL5A 2XLNA 4JJNC 1M19A 4E3IA 5B1LD 1AXBA 1G68A 3S4XA 1M18B 4KGCB 2WK0A 3WS1A 1ES3A 3WS5A 3GQZA 3IT9A 1ID3C 5M19A 2EX2A 3AZLB 1YU4A 4KQOA 3L28A 3WAAC 3BRMA 3N8SA 2JC7A 5JYPA 3REKA 2PU2A 1ZC2A 3X1UD 1JFIA 3G30A 4WU9D 5B33D 3OC2A 3MGRB 3R45A 3RELB 3OPLA 4MBKA 4JXSA 4JBFA 1P3IB 2ZM2A 2DQNC 4Z66A 3W99C 3B6FA 4ID4A 1B67A 1YLYA 4NE5A 1FR6A 1K56A 2FJ7B 3AV1C 3L29A 1CI9A 2ZMAA 2Y2QA 5AVBB 3C1BA 2F8NB 5A93A 3G31A 4J8WC 3V3RA 1JWPA 2WYXA 5F83A 1JWZA 3DTMA 3I7JA 4RX3A 4XUZA 2BYKA 1KX5A 5EVIA 1CI8A 3B0DC 5CPIA 1F66C 3N7WA 4XUJB 4J8UB 3PBNA 3A3EA 3G35A 3VH5T 3V39A 3KUYD 4WU8D 1M18C 3QHYA 4KGCC 3HLEA 4J8VA 4DRBA 3B0BA 5AVCA 1XP4A 4NFTA 4KHAA 3X1SA 5HAIA 1IEMA 1NYMA 3AZLC 1BULA 2H10A 2WKIA 5U47A 1PI4A 4KUDB 2OLVA 3ZG9B 4OP5A 1ONHA 2ZY4A 4P0MA 5CPKA 1Y54A 2NZDD 3AN2B 3PAGA 2IWBA 5J8XA 4YM6A 3MGRC 3RELC 4B4ZA 3MNND 1GA0A 1P34A 1ZKJA 5EPHA 1HD8A 5B40B 1P3IC 3V5MA 5B32B 4IBKA 1XGJA 5FQ9A 1IYPA 3LZ1D 1L0EA 1KX4B 1M1AD 2FJ7C 3V9RB 5AVBC 4PM9A 4WZSB 4HESA 4A5RA 3B0CT 2YFVA 3IF6A 3X1TB 4S2KA 1YMXA 4ZAMA 2HDQA 4GDBA 1E25A 4J8XD 1FCMA 1S32B 4XZQA 4ZUXD 4XUJC 3AZEA 4J8UC 5AQAA 2ZD8A 3OCLA 5JRGA 3JYIA 3N8LA 4LCLA 3VP2A 3ZVWA 3OPHA 4PM8A 5B24D 4N1XA 3LJAD 5FDHA 1E4DA 4U3TA 3UTBA 2ZQCA 2CV5D 5GT3B 3HLBA 5F82A 4KUDC 5JRGB 3UE3A 5G49A 4ZJ2A 3LELA 5HFOA 4KZ9A 1YLZA 4K91A 5AV5A 3UN7A 2Y2GA 3C4OA 3O62B 5DNND 1TDLA 4E3OA 4H9RA 3AN2C 4K0WA 5HX9A 5HAQA 5B1MD 1L0FA 2HP9A 4KZBA 5B40C 5B32C 1ID3D 4GHLA 3WRZA 1VQQA 4YINA 1KU5A 1KX4C 3UT9B 3WAAD 5FQQA 4ZJ1A 1P3BA 1P3KB 4DQYB 3WX7A 5AV9A 4LD9A 2XEPA 2XD1A 3NCKA 5A92A 1Z2CB 3AZHB 3WWXA 4E6XA 2Y2IA 3X1TC 1MY8A 4LD9B 3A1KA 2Q9MA 1S32C 1KE0A 5HL1A 4UPKA 3FKWA 5CEDA 4KZ6A 5B2ID 4E3MA 3AV1D 3Q7ZA 1BLHA 1U60A 1PW1A 3C5AA 5FQKA 5CGWA 1S0WA 3X1UA 3PTEA 4J8WD 3N6IA 4P85A 2NQBD 4HBTA 3WKJB 3A6NA 2EFUA 3REIA 3KWQA 5GT3C 1ONGA 4YS3D 4FCFA 3SH8A 5JRGC 3AZJA 4NZ3A 1MWUA 1BLCA 3UDXA 2B5RA 1F66D 1P3FD 3AFAB 3O62C 4DRTA 3FZCA 4Z2MG 4P87A 3Q7VB 3V3SA 2BYMB 1W5DA 3LO7A 4ZDXA 4KGCD 4IBFA 4H9PB 1SDEA 4H9QB 1TEMA 1KVMA 1CEFA 1BH9A 3AZLD 3UT9C 5GLDA 4OQ0A 3VP0A 5E2EA 5KMWA 1P3KC 3O87A 4NZ5A 1WWIA 3SS5A 4WZ4A 1TAFA 3AZHC 3L25A 3MGRD 3MKFA 2HP6A 4N9KA 5B31B 1HZOA 4LD9C 3KUYA 4WU8A 1P3ID 3AGFA 3Q1FA 2Y2PA 5KSHA 3Q82A 3REJB 1E3UA 2PU4A 1ALQA 1PZPA 3W97B 2XQZA 5AVBD 2F8ND 2E8IA 2Q9NA 2RL3A 3UY6A 3WKJC 2NZDA 4X23B 1DY6A 2EXBA 4H9SC 4JF4A 1ES5A 1W8YA 3F6TA 5GT0B 1M6KA 1FSYA 5TFQA 4IBBA 5CTNA 3MNNA 5BO0B 5BT1C 4XUJD 3MVDB 3AFAC 3B6GA 1LI0A 4X69A 3LZ1A 4GNUA 4J8UD 3E2KA 4Y7PA 1M1AA 4PPRA 4OPYA 1NRFA 4IBJA 1KX5D 1VM1A 3WTPB 3UTAB 2J7VA 3VFHA 2R9XA 4KQRA 4KUDD 3FKEA 3TU4B 2CC1A 2WGIA 4J8VD 4R3JA 1YU1A 4E44A 4KZ4A 1MWSA 4ZUXA 5B31C 3EQUA 3BFGA 2IO5B 5GLCA 4NE6A 4R4SA 5B32D 3KXBA 3PBTA 5B24A 3NQUB 2ZLYA 4HGAB 3LJAA 1PI5A 4S2IA 3REJC 2CV5A 2AROA 4UUZB 1RCJA 1K4EA 3W97C 3P09A 1P3MA 3H0RC 3HLGA 5C3IB 2ZM8A 4JJNA 4X23C 4OLDA 4DE2A 3X1TD 2A3UA 5GT0C 3PBSA 2WUQA 1S32D 5JA4A 3VP1A 4DDSA 1ID3A 3MVDC 3HSHA 4NK3A 2F8NH 3DWKA 3QNBA 3AV2B 3WTPC 3UTAC 4MLLA 5E5AA 1SKFA 2XFSA 3AZED 3CG5A 1LHYA 5AQ7A 5JRGD 3AGEA 4S2OA 3TU4C 3IWQA 3ZG0A 5FI2A 2WAFA 5E5AB 3PAEA 1Q2PA 3ZVTA 2RIQA 3O62D 4B88A 3W99A 4Z5TB 2ZC4B 3HONA 4QLCB 2IO5C 3AV1A 1O7EA 4WELA 2RCXA 4OPZA 5BNVA 4HGAC 1KX3B 3UT9D 4J8WA 5HAPA 4LCMA 4LV0A 5CGXA 1F1EA 1XPBA 5AY8A 3NBLA 4L0LA 5F99B 4EWFA 1F66A 3HLCA 5C3IC 3AZHD 2XH9A 4IBGA 2HDRA 5AY8B 4LD9D 2OV5A 2OSUA 1M18A 4KGCA 2ZQ9A 1PWCA 1ES2A 1Q2QA 3MBZA 2Y59A 1NY0A 3AZLA 4KG2A 3WS4A 3AV2C 5TGFA 3EPKA 4WM9A 1P3LB 1ERMA 4AWLB 3MGSB 3IH9A 5B2JB 3WKJD 1W79A 2JE5A 1KVLA 3MGRA 3ZG7B 3RELA 5D3OA 4ZTKA 1YUEA 2P9VB 1P3IA 5E5AC 4S2LA 4HBUA 3AFAD 4E3LA 3A6ND 3REID 4Z5TC 1XGIA 3KWQD 1FOFA 2FJ7A 4QLCC 2ZQAA 4LV3A 3AZJD 2G2UA 4JXVA 5AVBA 4PM5A 2F8NA 4IBIA 3VP3A 2RVQC 1KX3C 2C6WB 3IF5A 3M2KA 4G91B 1P3PB 1MKIA 1XX2A 3ZNTA 1K6RA 5F99C 3HREA 2ZM5A 5G18A 1O07A 4XUJA 1GHPA 4J8UA 4S2JA 5B31D 2DRWA 1P3GB 5AY8C 5EUAA 2CWEA 3W96B 3VOZA 5CRFA 4K0XA 4R3BA 1DJBA 1GCEA 4KUDA 4CPKA 5GXQB 3W97D 4IBCA 1C3BA 4CAYB 3OCNA 4XXRA 1P3LC 1KE3A 4AWLC 3MGSC 1YLPA 5B2JC 2GDNA 1E3UD 4X23D 4RX2A 3AN2A 2XK1A 5B0ZB 2C5WB 3C7VA 1HQ3B 3EPLA 5B40A 5B32A 1IKGA 1TZYB 3NDGA 3MVDD 3IWIA 1KX4A 5KSCA 1RGYA 5CERA 3H0LC 4P6BA 4Q8IA 3MZFA 3W98B 2F2AC 3EG5B 3V9RA 3WTPD 3UTAD 3B6GD 5DTTA 3TU4D 5EECA 4G91C 3X1TA 1P3PC 4WZ5C 3O3VA 3P98A 4EBPA 1TVFA 1PW8A 2HUEB 1S32A 4LV2A 3AZKB 4UAAA 4H9OB 3AGDA 5JYOA 3HLFA 1P3GC 1S6RA 5AV6B 3N3FA 3W96C 4BLMA 5GLAA 5GT3A 1J9MA 4E6WA 3VMAA 1JWVA 3KXBD 1QMEA 1ULYA 4LG2A 1IKIA 3SOIA 2Y91A 3O62A 2WKHA 2I72A 4S2NC 4X55A 3MGQA 1K55C 3IXDA 5CPJB 4CSRB 4BL3A 2AROD 5B0ZC 3ZG8B 3AZNB 1HQ3C 3FKVA 1P3MD 5FSRA 1TZYC 4KENB 4H9NB 3UT9A 4JJND 3MGQB 5FA7A 5FI7A 2EX8A 1A7WA 1P3KA 3REHB 1YLJA 3MGPB 4WEKA 3BFCA 4YFMA 2YFWB 3M6HA 4JXGA 2G2WA 3AZMB 3NI9A 3GMWA 5HARA 3AZHA 4DRAA 4HEFA 4JF6A 1KGGA 2DCFA 5FQJA 4BL2A 4S2MA 1PZRA 5EOEA 1IYSA 5FAOA 5E5AD 2IWDA 2HUEC 3AZKC 2XR0A 4Z5TD 2ZC5B 3A1IA 4DE1A 3Q81A 4QLCD 3NQJB 4PM6A 4QJGA 1DJCA 5AV6C 5FI6A 3W99D 4OOMA 3HUOA 1EI5A 3WKJA 4X53A 2PBYA 4OJ6A 4H9SA 4NZ1A 4QY6A 3AL0C 2VQRA 5F99D 4OUIA 3AFAA 3UE0A 3W4QA 3G2ZA 3Q7VA 5CPJC 2BYMA 5AY8D 1U35B 1AOIA 2BLSA 2UWXA 2XF3A 4QNLA 3AZFA 5BNXB 3A3FA 3AZNC 4H9PA 4H9QA 2X71A 5B1LB 3UDIA 4ZBJB 3LCEA 1N4OA 3MGQC 2XGNA 3BFDA 1QMFA 3A3IA 3REHC 5DNMB 1AOIB 1M18D 3MGPC 3AZFB 3HUNA 2WADA 1P3LD 3MGSD 4EBNA 3AZMC 3PBQA 3NC8A 2DNSA 2EFXA 5AQBA 5B31A 4U0TA 4OOLA 5B33B 1L2SA 1T3UA 4EV4A 1W7FA 2HIOB 5E2GA 3ZDJA 2JCHA 1ESIA 2VGKA 3MZEA 3REJA 4N1HA 1NJ4A 2EX9A 2L5AA 3RELD 4GOGA 3IXHA 3X1VB 2V2FF 3W97A 3DW0A 2OLUA 3M6BA 1N9BA 1YM1A 2F8NG 2QZ6A 4N92A 4FH4A 4NETA 3ZHHA 4X23A 4NYUA 2FJ7D 5GT0A 5DTSA 1M40A 3VSLA 5CHLB 1L0DA 4LV1A 4KQQA 5BO0A 4Y0UA 3UNWA 1YU2A 1ERQA 5FASA 3MVDA 1YLTA 5KDMB 4N9LA 3BEBA 5BOHA 1P3GD 3C4PA 2WGVA 1K4FA 4H8RA 3UPNA 1U35C 4IVIA 3IXGA 3W96D 4DE0A 1XKZA 3WTPA 3UTAA 5B1LC 4BJPA 4ZBJC 3BECA 1NZOA 5E2FA 3TU4A 5DNMC 1AOIC 4OPQA 3AZFC 3GV9A 4R1GA 4Z9QA 3TSGA 4WEJA 4XUXA 1K6SA 1P3OB 2Y2NA 3C7UA 3SH7A 5B0ZD 4OKPA 4NZ4A 1HQ3D 5B33C 2EX6A 5GHZA 5TR7A 1I5QA 5CGSA 2W8SA 5BS7C 5B32G 3NIAA 3NQUA 4LENA 2HIOC 4IJEA 3HLDA 2J9PA 1LLBA 2X02A 2H5SA 3AN2D 4F94A 2QMIA 1EWZA 4RVAA 4UUZA 4JPMA 3X1VC 2XFTA 3VH6W 4S2PA 2LY8A 1BH8B 5B40D 1RP5A 2Y2MA 3W4PA 5AV8B 1KX4D 3WA9B 5CP6A 5AQ9A 4IBDA 3LY4A 1YU3A 3QNCA 2HDSA 3AZKD 4GKUA 3TG9A 3FWLA 3ISGA 3OPPA 3LZ0B 5CP6B 4BQMA 2Y4AA 3VH5W 5B0YB 5AV6D 3AV2A 4X6TA 3ITBA 1H3OB 1FSWA 3Q07A 2ZY5A 1ZLAB 1H8YA 4GN2A 1BZAA 1Q9CA 2ZM0A 3MXRA 1LI9A 3BFFA 4NYYA 4OJOA 3DWZA 4OVDA 4QHCA 4OOYA 3IQAA 5FQIA 4FSFA 3VSKA 1P3OC 5CPJD 3IP4C 3BLMA 4Z5TA 1LL9A 4OONA 5GT3D 3OZHA 4QLCA 2Y2KA 3AZND 5DNNB 2EXAA 4E3NA 5B1MB 1MWRA 3LY3A 1KX3A 1K25A 3BYDA 3MGQD 1HVBA 1EROA 1K54C 4GHAA 5FAQA 4MEZA 1FCOA 3NY4A 5GSUB 2ZQ8A 4WMCD 4R8PB 5E2HA 1KGEA 4OJLA 5F99A 3AZMD 4E3JA 1EQZB 5AV8C 3G4PA 3WA9C 1ZG6A 1BLSA 3B0CW 1P3KD 3SS4A 1FR1A 4JKTA 4C3QA 4GD8A 4UHUA 2ZC6B 5DF8A 3HUMA 4GD6A 4EUZA 1ESUA 3LZ0C 3MKEA 4WNNB 5CP6C 3VH6A 5B0YC 5CXWA 3HL9A 1RGZA 5BPVA 4M6BA 5B2IB 1ZLAC 1P3LA 1MPLA 3LEZA 3MGSA 3CMZA 5B2JA 2PYOB 3UE1A 4D2OA 3VFFA 1GHIA 4C75A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PW1 A;  1CK3 A;  3C5A A;  5FQK A;  5CGW A;  5A90 A;  1OME A;  1S0W A;  3PTE A;  4FD8 A;  4P85 A;  3N6I A;  5DTT A;  5EEC A;  2P9V A;  3CJM A;  2V1Z A;  4HBT A;  3VP4 A;  2EFU A;  4WZ5 C;  3O3V A;  1YMS A;  3P98 A;  4EBP A;  1ONG A;  1TVF A;  1K38 A;  3E2L A;  4FCF A;  1KDW A;  2ZC3 B;  3SH8 A;  1PW8 A;  5DF9 A;  1BTL A;  4U0X A;  4LV2 A;  4UAA A;  1MWU A;  2WAE A;  1BLC A;  3UDX A;  2B5R A;  2ZC7 A;  4MBH A;  3HLW A;  3MXS A;  3AGD A;  5JYO A;  2WGW B;  3HLF A;  1PWD A;  4DRT A;  3FZC A;  1S6R A;  4P87 A;  3ZCZ A;  3Q7V B;  3V3S A;  1WYB A;  2IWC A;  1IYO A;  5DVA A;  4BLM A;  3IH8 A;  4JXW A;  1W5D A;  3LO7 A;  4JLF A;  4ZDX A;  2J8Y A;  4DXB A;  1SDE A;  1BUE A;  1W8Q A;  3HBR A;  3O88 A;  3UPP A;  2FFY A;  1TEM A;  1KVM A;  1SDN A;  3BLS A;  4WZ5 A;  5GLA A;  2FFF B;  1J9M A;  1CEF A;  1SHV A;  4UA9 A;  4E6W A;  1NZU A;  3VMA A;  5GLD A;  1JWV A;  1PZO A;  4OQ0 A;  4KZ7 A;  4X68 A;  3V50 A;  4GDN A;  5E2E A;  3VP0 A;  5KMW A;  1QME A;  3O87 A;  1GHM A;  4EQI A;  1JTD A;  1IKI A;  3SOI A;  1HTZ A;  2Y91 A;  2ZJ9 A;  3SS5 A;  2WKH A;  2I72 A;  4S2N C;  4WZ4 A;  4X55 A;  1K55 C;  3IXD A;  3G34 A;  1ES4 A;  1YT4 A;  4BL3 A;  3ZG8 B;  2Y2H A;  3FKV A;  3MKF A;  2HP6 A;  4KZA A;  4N9K A;  4R4R A;  5FSR A;  3UDF A;  1HZO A;  4CJN A;  3N4I A;  1TDG A;  1I2W A;  2R9W A;  4KEN B;  3RXX A;  3G32 A;  5FAP A;  3AGF A;  5FI7 A;  5FA7 A;  5IHV A;  3Q1F A;  3ZG5 A;  4OQG A;  2EX8 A;  5M18 A;  4EBL A;  2Y2P A;  5KSH A;  1JVJ A;  3Q82 A;  1E3U A;  5FQM A;  1YLJ A;  2PU4 A;  3ZGA B;  4YFM A;  4WEK A;  3BFC A;  5CEB A;  1ALQ A;  4S2N A;  1BLP A;  3M6H A;  5GHY A;  1K55 A;  1PZP A;  4JXG A;  4QD4 A;  2G2W A;  2XQZ A;  3NI9 A;  3GMW A;  5HAR A;  4QB8 A;  2E8I A;  3EQV A;  1MXO A;  2Q9N A;  2RL3 A;  1FCN A;  4HEF A;  4JF6 A;  1KDS A;  2ZQ7 A;  5A91 A;  1KGG A;  3UY6 A;  4BD1 A;  2DCF A;  4RA7 A;  1G6A A;  2HPB A;  5HW3 A;  5CEC A;  5FQJ A;  4BL2 A;  4DDY A;  1DY6 A;  2HP5 A;  2EXB A;  4JF4 A;  4S2M A;  1ES5 A;  5EOE A;  1IYS A;  5FAO A;  5F1F A;  1W8Y A;  2IWD A;  4Y0O A;  1M6K A;  2WZX A;  1FSY A;  3WS0 A;  2XD5 A;  5TFQ A;  4B4X A;  5CTN A;  2Y55 A;  2Z2M B;  2XR0 A;  4IVK A;  2ZC5 B;  4DE1 A;  3Q81 A;  1FQG A;  1IEL A;  1JTG A;  4GZB A;  4PM6 A;  1LI0 A;  4X69 A;  4QJG A;  4GNU A;  1DJC A;  3E2K A;  4Y7P A;  2XDM A;  4PPR A;  3UO9 A;  5EVI B;  4OPY A;  1NRF A;  5I94 A;  5FI6 A;  3SH9 A;  1PWG A;  1VM1 A;  1MWT A;  4OOM A;  2JBF A;  2J7V A;  3CZD A;  3HUO A;  3VFH A;  1EI5 A;  4X53 A;  4BEN A;  2PBY A;  3WRT A;  2VGJ A;  2R9X A;  4KQR A;  4QY6 A;  3A3J A;  2X01 A;  2CC1 A;  2WGI A;  4R3J A;  4KG5 A;  2WGW A;  3UE0 A;  3W4Q A;  3FYZ A;  3G2Z A;  1MBL A;  3Q7V A;  4KZ4 A;  1I2S A;  2BLS A;  1MWS A;  4WBG A;  2UWX A;  2XF3 A;  3A3F A;  1H5X A;  2X71 A;  5CTM A;  4WYY A;  3EQU A;  3BFG A;  4QU3 A;  1LL5 A;  2XLN A;  5GLC A;  3GR2 A;  4E3I A;  4RYE A;  3UDI A;  1AXB A;  4R4S A;  3LCE A;  1N4O A;  3PBT A;  1G68 A;  3GTC A;  3S4X A;  2ZLY A;  2XGN A;  3BFD A;  2WK0 A;  3WS1 A;  1QMF A;  3A3I A;  1PI5 A;  4M3K A;  1ES3 A;  4IBX A;  4S2I A;  3BM6 A;  3WS5 A;  3GQZ A;  3IT9 A;  3HUN A;  5M19 A;  2EX2 A;  2WAD A;  1RCJ A;  3UPO A;  1K4E A;  4KQO A;  4EBN A;  3P09 A;  3BRM A;  3VOY A;  2ZQD A;  3N8S A;  3PBQ A;  3ITA A;  2Y2L A;  3S22 A;  3NC8 A;  2A49 A;  2DNS A;  2EFX A;  2JC7 A;  3HLG A;  4U0T A;  1NXY A;  2PU2 A;  1ZC2 A;  4OOL A;  5AQB A;  2V20 A;  2ZM8 A;  1K57 A;  4JF5 A;  3ZFZ A;  3G30 A;  1L2S A;  4FH2 A;  4OLD A;  1YLW A;  5GL9 A;  4DE2 A;  3MZD A;  4EV4 A;  2A3U A;  3OC2 A;  3W8K A;  1PIO A;  1W7F A;  3IWO A;  1IYQ A;  5E2G A;  3ZDJ A;  2JCH A;  3PBS A;  5CHJ A;  1ESI A;  2VGK A;  2WUQ A;  3MZE A;  3OPL A;  4MBK A;  3FV7 A;  4N1H A;  4JXS A;  3VP1 A;  3BFE A;  1NJ4 A;  2WKE A;  2EX9 A;  4JBF A;  4DDS A;  4GOG A;  4WMC A;  4KG6 A;  3IF6 B;  3IXH A;  2ZM2 A;  2V2F F;  4NK3 A;  3DWK A;  3DW0 A;  1XA1 A;  2OLU A;  3M6B A;  5EVI C;  1N9B A;  4ID4 A;  3QNB A;  5GLB A;  1YM1 A;  2QZ6 A;  1YLY A;  3WS2 A;  1K56 A;  1FR6 A;  4N92 A;  4C6Y A;  4MLL A;  4R0Q A;  5EVL A;  4FH4 A;  4NET A;  3ZHH A;  1CI9 A;  2ZMA A;  2Y2Q A;  4MNR A;  1SKF A;  2XFS A;  5DTS A;  3CG5 A;  1LHY A;  1M40 A;  4PM7 A;  3VSL A;  5HAQ A;  5A93 A;  3G31 A;  5AQ7 A;  1H8Z A;  5GHX A;  3AGE A;  1BSG A;  1L0D A;  4R23 A;  1JWP A;  4S2O A;  4LV1 A;  3V3R A;  3IWQ A;  3ZG0 A;  5FI2 A;  4KQQ A;  4Y0U A;  2WYX A;  3ZNY A;  3UNW A;  5F1G A;  5F83 A;  1ERQ A;  1JWZ A;  3DTM A;  3I7J A;  4RX3 A;  4E3K A;  5FAS A;  1XXM A;  4KZ3 A;  1YLT A;  2WAF A;  3PAE A;  2Y2J A;  1Q2P A;  4XUZ A;  3ZVT A;  4N9L A;  3BEB A;  1BT5 A;  3RJU A;  5BOH A;  3C4P A;  2WGV A;  1K4F A;  4H8R A;  5EVI A;  3UPN A;  4B88 A;  3D4F A;  4IVI A;  3GVB A;  3IXG A;  1CI8 A;  2ZC4 B;  4MBF A;  4DE0 A;  1XKZ A;  3N7W A;  4BJP A;  1O7E A;  3PBN A;  4WEL A;  1XA7 A;  3A3E A;  3G35 A;  2RCX A;  4OPZ A;  3V39 A;  3BEC A;  4OQI A;  1NZO A;  3QHY A;  5E2F A;  1L0G A;  4DXC A;  3HLE A;  5HAP A;  5CHU A;  1KE4 A;  4LCM A;  4OPQ A;  4LV0 A;  1XP4 A;  5CGX A;  3MFD A;  3GV9 A;  5HAI A;  4R1G A;  4Z9Q A;  1XPB A;  3TSG A;  1IEM A;  4WEJ A;  3NBL A;  4XUX A;  1NYM A;  2H10 A;  1BUL A;  1K6S A;  2WKI A;  3PBR A;  5U47 A;  1PI4 A;  1YQS A;  4L0L A;  2Y2N A;  2J9O A;  2OLV A;  3ZG9 B;  4OP5 A;  4EWF A;  1ONH A;  3C7U A;  3SH7 A;  4DF6 A;  3HLC A;  4OKP A;  4P0M A;  3RXW A;  2XH9 A;  1Y54 A;  2EX6 A;  5GHZ A;  5TR7 A;  1I5Q A;  5CGS A;  2HDR A;  3NIA A;  2OV5 A;  4LEN A;  2OSU A;  3PAG A;  2IWB A;  3HLD A;  2HDU A;  2ZQ9 A;  4OQH A;  5J8X A;  1PWC A;  2J9P A;  1LLB A;  2X02 A;  4B4Z A;  3GSG A;  2H5S A;  1ES2 A;  1Q2Q A;  4F94 A;  3MBZ A;  2QMI A;  1GA0 A;  1ZKJ A;  4PMA A;  5EPH A;  1EWZ A;  4RVA A;  4QY5 A;  1HD8 A;  2Y59 A;  1NY0 A;  3IF6 C;  4JPM A;  2XFT A;  3V5M A;  1K57 C;  1XGJ A;  4S2P A;  5FQ9 A;  1IYP A;  4KG2 A;  1L0E A;  1RP5 A;  3G2Y A;  4KZ8 A;  3WS4 A;  2Y2M A;  5DF7 A;  3TOI A;  3W4P A;  5TGF A;  4DKI A;  4WM9 A;  4DE3 A;  4ZBE A;  1ERM A;  4UA6 A;  3SS3 A;  3IH9 A;  4Y0T A;  5AQ9 A;  1W79 A;  2JE5 A;  4PM9 A;  3LY4 A;  1KVL A;  3QNC A;  3ZG7 B;  5DTK A;  2HDS A;  3IHA A;  5D3O A;  4HES A;  4ZTK A;  4A5R A;  4GKU A;  3TG9 A;  2P9V B;  3FWL A;  3IF6 A;  4S2K A;  1YMX A;  3ISG A;  2HDQ A;  3IXB A;  3OPR A;  4GDB A;  3OPP A;  4HBU A;  1E25 A;  4S2L A;  4ZAM A;  4E3L A;  4BQM A;  2Y4A A;  5L2F A;  3B3X A;  2Z2L B;  1XGI A;  4X6T A;  1FCM A;  1FOF A;  1NYY A;  5E43 A;  3ITB A;  4X56 A;  4OLG A;  1FSW A;  3Q07 A;  2ZQA A;  1WYC A;  4LV3 A;  1H8Y A;  2G2U A;  4GN2 A;  3GRJ A;  5AQA A;  1BZA A;  2ZM0 A;  2ZD8 A;  3OCL A;  4JXV A;  3JYI A;  5KZH A;  3MXR A;  3N8R A;  1LI9 A;  3N8L A;  4PM5 A;  2WZZ A;  4LCL A;  3VP2 A;  3VP3 A;  2QPN A;  3ZVW A;  3OPH A;  3BFF A;  4PM8 A;  3DWZ A;  4OVD A;  4N1X A;  2C6W B;  1Z6F A;  1GA9 A;  5FDH A;  5M1A A;  4OP8 A;  3IF5 A;  4OOY A;  3A3D A;  1CEG A;  3M2K A;  1E4D A;  4OH0 A;  4QHC A;  3IQA A;  5FQI A;  3IHB A;  2ZQC A;  4FSF A;  4U3T A;  2Y2O A;  3NDE A;  3HLB A;  5F82 A;  3VSK A;  1MKI A;  1XX2 A;  3ZNT A;  4IED A;  1K6R A;  3BLM A;  1LL9 A;  4OON A;  3UE3 A;  3HRE A;  4ZJ2 A;  3O86 A;  5G18 A;  5HFO A;  3OZH A;  4KZ9 A;  1DJA A;  1ZG4 A;  1YLZ A;  4BD0 A;  2P74 A;  1O07 A;  4K91 A;  2Y2K A;  4IBR A;  3UN7 A;  1GHP A;  2Y2G A;  4S2J A;  3C4O A;  2EXA A;  2DRW A;  4E3N A;  2H0Y A;  1TDL A;  5EUA A;  4E3O A;  3HVF A;  1MWR A;  3LY3 A;  3VOZ A;  1K25 A;  3M2J A;  4K0W A;  5HX9 A;  1PYY A;  3BYD A;  1HVB A;  1K54 C;  1ERO A;  5CRF A;  5FAQ A;  1L0F A;  4K0X A;  4MEZ A;  2HP9 A;  4OPR A;  1FCO A;  4R3B A;  3NY4 A;  4KZB A;  3WRZ A;  2ZQ8 A;  4WMC D;  1DJB A;  1GCE A;  1VQQ A;  2H0T A;  4YIN A;  1KGE A;  5E2H A;  3W4O A;  4CPK A;  5FQQ A;  4E3J A;  4ZJ1 A;  5EOO A;  1C3B A;  3G4P A;  3OCN A;  4XXR A;  1KGF A;  1ZG6 A;  1BLS A;  2XEP A;  1KE3 A;  1K56 D;  3PBO A;  3SS4 A;  1YLP A;  1FR1 A;  4JKT A;  2GDN A;  2XD1 A;  1E3U D;  4RX2 A;  5CHM A;  5EE8 A;  1SCW A;  3NCK A;  4O7D A;  5A92 A;  2XK1 A;  5JYP A;  1K54 A;  2C5W B;  4C3Q A;  4GD8 A;  4UA7 A;  4UHU A;  3WWX A;  2ZC6 B;  2BG1 A;  2Y2I A;  3C7V A;  4E6X A;  5DF8 A;  3HUM A;  4GD6 A;  4ZJ3 A;  4EUZ A;  1ESU A;  1IKG A;  1MY8 A;  3NDG A;  3MKE A;  3IWI A;  5KSC A;  1RGY A;  5CXW A;  4P6B A;  5CER A;  2Q9M A;  4Q8I A;  3MZF A;  3HL9 A;  1RGZ A;  5EVI D;  1KE0 A;  5HL1 A;  3FKW A;  3S1Y A;  5CED A;  4KZ6 A;  1MPL A;  4E3M A;  3LEZ A;  3CMZ A;  4KZ5 A;  5FAT A;  3UE1 A;  1WE4 A;  3Q7Z A;  4GB7 A;  4D2O A;  1BLH A;  3VFF A;  1U60 A;  1GHI A;  4C75 A; 
#chains in the Genus database with same CATH topology
 1CK3 A;  4PKY A;  2NQB B;  1OME A;  4P6Z S;  2P9V A;  3CJM A;  1F9I A;  4OJP A;  4YS3 B;  3VP4 A;  1YMS A;  1KDW A;  3AZI B;  5DF9 A;  3VH5 A;  2LB5 A;  2WAE A;  4BWI A;  2M7U A;  4LRY C;  1P3F B;  2ZC7 A;  3BY8 A;  4MBH A;  2JKF A;  3HLW A;  3MXS A;  5DNN C;  2WGW B;  1PWD A;  3L26 A;  3BY9 A;  1GXD A;  5DFX A;  5B1M C;  5DKL A;  3ZCZ A;  1WYB A;  2IWC A;  5BT1 D;  5DVA A;  1P3A B;  3IH8 A;  2XA7 S;  1N1J B;  3EWK A;  5FUG B;  3UPP A;  3LI8 A;  5DNM D;  1P3P A;  1AOI D;  1SDN A;  3AZF D;  4WZ5 A;  5GSU C;  2ZBB A;  2FFF B;  3R7W A;  1SHV A;  4R8P C;  1M19 B;  2GJ3 A;  1Z09 A;  1NZU A;  3V50 A;  4KZ7 A;  1EQZ C;  1GHM A;  4EQI A;  2NUP C;  2HJE A;  1HTZ A;  5B31 G;  2YKF A;  1P3G A;  3KSG A;  2G5H C;  4MN7 A;  3W96 A;  5IU1 A;  3RTY A;  3T4Q A;  2JSS A;  2HIO D;  3HJI A;  3M7P A;  1GOI A;  3FPW A;  4KZA A;  5FEF A;  3REK B;  1JFI B;  1F98 A;  4CJN A;  4EO5 B;  3N4I A;  2R9W A;  1I2W A;  4WV4 B;  3X1V D;  3DBA A;  5FAP A;  5GXQ A;  1VB6 A;  4OQG A;  1OTE A;  5B2I C;  3R45 B;  4CAY A;  4TX8 A;  3PXP A;  3CIT A;  5FQM A;  3VH6 T;  3ZGA B;  3L2A A;  5CEB A;  2PYO C;  2IOU A;  3REJ D;  4KQD A;  1BLP A;  4NXE A;  4O0P A;  4S2N A;  5GHY A;  1K55 A;  3WD4 A;  4QD4 A;  4Z66 B;  5B0Z A;  4GJ4 A;  3B6F B;  3NOP C;  4QB8 A;  2NQB C;  1MXO A;  4R70 A;  1HQ3 A;  1IOU A;  3MFX A;  1KDS A;  4BD1 A;  5A91 A;  4YS3 C;  1G6A A;  5HW3 A;  1TZY A;  5CEC A;  1CJF A;  2ZY3 A;  3C1B B;  4Y0O A;  3WS0 A;  2ZMV A;  3AZI C;  2DMW A;  4B4X A;  3W98 A;  5GT0 D;  1P3F C;  3ZYT A;  1CXW A;  3BWL A;  1JTG A;  4GZB A;  1MZU A;  2BYK B;  1KX5 B;  3UO9 A;  1VEU A;  3IX4 A;  1P3A C;  5EVI B;  4CLC A;  2G5I C;  3SH9 A;  5CPI B;  2JBF A;  5HD3 A;  4BEN A;  2VGJ A;  1M19 C;  1PNE A;  1HTA A;  3AZK A;  1P3O D;  4J8V B;  5AVC B;  4H9O A;  1H0M A;  4KHA B;  3X1S B;  3AZG A;  4I5S A;  3CWF A;  2V8F A;  5AV6 A;  2E8J A;  2O0Y A;  4H6J A;  4WBG A;  4OJ5 A;  5TBM B;  2PYP A;  5CTM A;  4WYY A;  3REK C;  2RTS A;  4QU3 A;  5CPK B;  2K7S A;  4EO5 C;  3GR2 A;  2PD8 A;  4RYE A;  2A24 A;  1CQA A;  3LGO A;  5F5Y A;  3AZG B;  2DF4 C;  4L9F A;  3GTC A;  4EER A;  4YM6 B;  4M3K A;  1B6W A;  3BM6 A;  5AV8 D;  1P34 B;  3WA9 D;  5CPJ A;  3UPO A;  4CSR A;  3DTE A;  4Z66 C;  4ZRR A;  3VOY A;  2HJ9 C;  2ZQD A;  3B6F C;  1H0I A;  3ITA A;  5GXQ C;  2Y2L A;  1Y28 A;  3S22 A;  5L10 A;  3AZN A;  2A49 A;  3KS4 A;  1NXY A;  2VV8 A;  2V20 A;  4JF5 A;  1K57 A;  3ZFZ A;  2QKP A;  4FH2 A;  5GL9 A;  1YLW A;  1P9W A;  4H9N A;  3MZD A;  3C1B C;  3W8K A;  3LZ0 D;  1PIO A;  5CP6 D;  3IWO A;  1IYQ A;  4LLO B;  5CHJ A;  5B0Y D;  3REH A;  4WL9 A;  3FV7 A;  3BFE A;  2WKE A;  3MGP A;  4WMC A;  1ZLA D;  2YFV B;  3IF6 B;  2YFW A;  4KG6 A;  1DRM A;  1KX5 C;  3AZM A;  1XA1 A;  2FH5 A;  5EM1 A;  5EVI C;  5GLB A;  5CPI C;  3WS2 A;  5A8B A;  2AVX A;  3KSF A;  4XZQ B;  3W98 C;  1E6P A;  1OJG A;  4R0Q A;  3C1C A;  3AV2 D;  5EVL A;  4C6Y A;  3AZE B;  2B18 A;  1W2E A;  4MNR A;  4II7 A;  2V8C A;  4PM7 A;  1H8Z A;  5GHX A;  4J8V C;  1BSG A;  4R23 A;  1EW0 A;  5AVC C;  4L9E A;  3ZNY A;  5F1G A;  3X1S C;  3OBF A;  4E3K A;  4NY2 A;  3NQJ A;  1XXM A;  3BQ8 A;  4KZ3 A;  3C1C B;  3UTB B;  4P6Z M;  2Y2J A;  1BT5 A;  1TF1 A;  3RJU A;  1ACF A;  3D4F A;  3GVB A;  5G49 B;  4MBF A;  3CUE C;  3LEL B;  1P97 A;  5CPK C;  5AV5 B;  4IBE A;  1XA7 A;  5GSU D;  3AZG C;  3KFU G;  4NEE D;  1MC0 A;  4R8P D;  4OQI A;  4H9R B;  3L27 A;  1L0G A;  4DXC A;  4YM6 C;  1LL8 A;  5CHU A;  1KE4 A;  2O9B A;  3AYW A;  4WUJ A;  1D7E A;  2RVQ D;  1KX3 D;  1EQZ D;  2XA7 M;  1P34 C;  1ZHH B;  3MFD A;  2WKP A;  2HGV A;  3PBR A;  1YQS A;  4Z2J A;  1U35 A;  5EM0 A;  2J9O A;  3ULF A;  5BNX A;  1XJ2 A;  4DF6 A;  1P3B B;  5B1L A;  3RXW A;  1OTI A;  3AYW B;  5AV9 B;  4GH9 A;  4Z2K A;  2HDU A;  4IJF A;  4OQH A;  1YAX A;  5DNM A;  3GSG A;  3RH8 B;  4PMA A;  2VZW A;  4QY5 A;  3IF6 C;  1K57 C;  2PYO D;  3E4Q A;  3G2Y A;  2J8P A;  4KZ8 A;  2ZL1 A;  5DF7 A;  3TOI A;  4DKI A;  4EQ1 A;  4XZQ C;  4WU9 A;  4DE3 A;  3CI6 A;  5B33 A;  4UA6 A;  4ZBE A;  2JHE A;  3SS3 A;  3AZE C;  3MS6 A;  4Y0T A;  1W1P A;  4EW7 A;  1W1V A;  5FL3 A;  5BS7 A;  2F8N K;  2JKR M;  2EA9 A;  2HIO A;  5B2J D;  5DTK A;  3AZI D;  4R6L A;  3IHA A;  3X1U B;  2W3D A;  2EWW A;  3X1V A;  4WU9 B;  3C1C C;  3UTB C;  3IXB A;  3A6N B;  3OPR A;  3REI B;  3KWQ B;  2QYB A;  1DP8 A;  5L2F A;  3B3X A;  4NE3 A;  5AJG A;  2Z2L B;  1NYY A;  5E43 A;  3AZJ B;  1P3A D;  3LEL C;  4X56 A;  4OLG A;  1WYC A;  3CPT B;  5AV5 C;  3GRJ A;  5I5L A;  4DJ2 A;  5KZH A;  3FG8 A;  3N8R A;  1BYW A;  1M19 D;  2WZZ A;  4Y3I A;  2QPN A;  1OGG A;  4HJ3 A;  4EU0 A;  5DFY A;  1Z6F A;  1GA9 A;  5M1A A;  2KLI A;  4OP8 A;  3A3D A;  1CEG A;  3D72 A;  4OH0 A;  3IHB A;  3MQO A;  5KDM A;  2Y2O A;  3NDE A;  3EPH A;  1P3P D;  1BH9 B;  3B42 A;  4IED A;  2WKR A;  1L6J A;  3LIF A;  3O86 A;  1P3B C;  4HH2 A;  1DJA A;  1ZG4 A;  4BD0 A;  2P74 A;  4R38 A;  3AYW C;  3H0M C;  4IBR A;  5AV9 C;  3T4K A;  3PYP A;  3REK D;  4F3L B;  2H0Y A;  3HVF A;  1TAF B;  2R78 A;  3M2J A;  1PYY A;  3NHQ A;  3IX8 A;  4OPR A;  4I39 A;  3KUY B;  4WU8 B;  2H0T A;  1P3O A;  3W4O A;  1XJ3 A;  4Z66 D;  5EOO A;  3F1O A;  3B6F D;  5GXQ D;  1CF0 A;  4QWO A;  1KGF A;  2VA0 A;  2B95 A;  1K56 D;  3PBO A;  1OTB A;  5CHM A;  1SCW A;  5EE8 A;  4O7D A;  3C1B D;  2QHK A;  1K54 A;  4UA7 A;  3UE6 A;  3X1U C;  2BG1 A;  4ZJ3 A;  4WU9 C;  2NZD B;  2PT7 A;  3ICY A;  3A6N C;  4G92 B;  3REI C;  3KWQ C;  1BH8 A;  5DJU A;  1D06 A;  1TZY D;  2UV0 E;  3AZJ C;  5EVI D;  3MNN B;  5AV8 A;  3QP2 A;  4HME A;  3S1Y A;  3WA9 A;  5CPI D;  2JKR I;  1W63 M;  3W98 D;  1YU0 A;  1ODV A;  4KZ5 A;  5FAT A;  3B6G B;  1WE4 A;  1GPF A;  4GB7 A;  3LZ1 B;  4IBX A;  2QWS A;  1M1A B;  1XFQ A;  5A90 A;  2FZ0 A;  3FDD A;  4FD8 A;  2V1Z A;  5KIZ A;  5AVC D;  4CLC D;  4WJ3 C;  4J8X A;  3X1S D;  3LZ0 A;  1XJ6 A;  1K38 A;  3E2L A;  4HNB A;  2ZC3 B;  5B0Y A;  3MMH A;  1BTL A;  4U0X A;  1H3O A;  1ZLA A;  4I38 A;  3P5J B;  4Z2M H;  1EAK A;  5CPK D;  2ZY2 A;  4J8X B;  2J3T D;  1BFM A;  3MQL A;  1IYO A;  1TS6 A;  3AZG D;  1R4V A;  1T1C A;  4JXW A;  4JLF A;  3KS8 A;  4ZUX B;  2J8Y A;  4YM6 D;  4DXB A;  1W8Q A;  1BUE A;  3HBR A;  3O88 A;  3TE8 A;  1XJ4 A;  3UB6 A;  1G5U A;  2FFY A;  3BLS A;  5HWV A;  1P34 D;  3KUY C;  4UA9 A;  4WU8 C;  4XT2 B;  4WF0 A;  3KXB B;  1G28 A;  5B24 B;  1PZO A;  4X68 A;  4GDN A;  3LJA B;  5HDS A;  1JTD A;  5DNN A;  1F5M A;  2CV5 B;  2ZJ9 A;  2ARO B;  3G34 A;  5B1M A;  1ES4 A;  1YT4 A;  3H7W A;  1S1Y A;  2Y2H A;  1P3M B;  4Q0I A;  2IA2 A;  4Q0J A;  4R4R A;  2NZD C;  5GSU A;  3UDF A;  4JJN B;  4G92 C;  3WAA A;  1TDG A;  4R8P A;  2L1M A;  3RXX A;  3G32 A;  5IHV A;  3ZG5 A;  4YOF A;  1QO6 A;  1WWS A;  3MNN C;  1EQZ A;  4EBL A;  5M18 A;  3H7W B;  1JVJ A;  5JA4 B;  4XZQ D;  1ID3 B;  3REH D;  3B6G C;  4HMD A;  3LZ1 C;  3MGP D;  3LR5 A;  1M1A C;  3WAA B;  2ZMF A;  3EQV A;  1FCN A;  5HDD A;  4PHT A;  2ZQ7 A;  4RA7 A;  2HPB A;  4MB5 A;  4DDY A;  4WNN A;  2HP5 A;  3T4T A;  3C1C D;  3UTB D;  5F1F A;  2WZX A;  2XD5 A;  5B2I A;  3WTP E;  2Y55 A;  2Z2M B;  4HJ6 A;  3FC7 A;  4IVK A;  3LEL D;  4HHD A;  2PYO A;  1FQG A;  1IEL A;  5AV5 D;  4LRX C;  4E45 A;  4J8X C;  4Y2F A;  2XDM A;  3VOL A;  2QJ7 A;  3W99 B;  3T4S A;  5I94 A;  2NQB A;  4ZUX C;  1PWG A;  1MWT A;  3ZQ5 A;  1VHM A;  3CZD A;  4YS3 A;  3AV1 B;  3IS2 B;  5EFW A;  3WRT A;  2O9C A;  3KXB C;  5BNV B;  3AZI A;  5B24 C;  5HSQ A;  3LJA C;  4J8W B;  1P3F A;  3A3J A;  2X01 A;  1FIL A;  1P3B D;  4KG5 A;  2CV5 C;  2WGW A;  3AYW D;  2ARO C;  5AV9 D;  3FYZ A;  1MBL A;  3KSY A;  4K08 A;  1P3A A;  3EPJ A;  1I2S A;  1N1J A;  1P3M C;  1Y4O A;  4O01 A;  3B0D B;  5FUG A;  1F66 B;  1U35 D;  1H5X A;  1LL5 A;  2XLN A;  4JJN C;  1M19 A;  3QP1 A;  4E3I A;  5B1L D;  1AXB A;  1G68 A;  3S4X A;  1M18 B;  4KGC B;  2WK0 A;  4Y17 A;  3WS1 A;  1ES3 A;  5CX7 A;  2LB9 A;  1E8B A;  3WS5 A;  3GQZ A;  4ARZ A;  3IT9 A;  1ID3 C;  4EUV A;  5M19 A;  2EX2 A;  3AZL B;  1YU4 A;  1YKD A;  4KQO A;  3L28 A;  3WAA C;  3T1S A;  3BRM A;  2JKG A;  2PAV P;  3N8S A;  4GHI B;  2INW A;  2JC7 A;  5JYP A;  3REK A;  2PU2 A;  1ZC2 A;  3S7O A;  3X1U D;  1JFI A;  3G30 A;  4ARZ B;  2KDK A;  4WU9 D;  1UR9 A;  5B33 D;  4DJ3 A;  3OC2 A;  3D3O A;  3MGR B;  3R45 A;  5G4Y A;  3REL B;  1ZTU A;  3OPL A;  4MBK A;  4JXS A;  4JBF A;  3KO6 A;  3P7N A;  1P3I B;  2ZM2 A;  2DQN C;  2A2L A;  4Z66 A;  4YNR A;  3W99 C;  3B6F A;  2OOL A;  4ID4 A;  3A0V A;  4M4X A;  5DJT A;  1B67 A;  1YLY A;  1UGU A;  4NE5 A;  1FR6 A;  1K56 A;  2FJ7 B;  3AV1 C;  3L29 A;  2W1T B;  4HP4 A;  1CI9 A;  2ZMA A;  3MSH A;  2Y2Q A;  1WA9 A;  5AVB B;  3C1B A;  2F8N B;  5A93 A;  3G31 A;  4J8W C;  3V3R A;  3DTK A;  3R4K A;  1JWP A;  4UQI S;  2H28 A;  1SZV A;  2WYX A;  5F83 A;  1JWZ A;  3DTM A;  1P9R A;  3I7J A;  4LFU A;  1OGB A;  4RX3 A;  4XUZ A;  2BYK A;  1KX5 A;  2V0W A;  5C5K A;  5EVI A;  4HP9 A;  1CI8 A;  3B0D C;  5CPI A;  1F66 C;  3N7W A;  4XUJ B;  4EET B;  4J8U B;  3PBN A;  3A3E A;  3G35 A;  3VH5 T;  3V39 A;  3KUY D;  4WU8 D;  1YSQ A;  1M18 C;  3QHY A;  4KGC C;  3HLE A;  4J8V A;  4DRB A;  3B0B A;  1G6O A;  5AVC A;  1XP4 A;  4NFT A;  4KHA A;  3F1P B;  3X1S A;  5HAI A;  1IEM A;  2VV7 A;  1NYM A;  3AZL C;  1BUL A;  1PFL A;  1AIW A;  2H10 A;  2WKI A;  1PI4 A;  5U47 A;  3U4L P;  1LSX A;  4KUD B;  2OLV A;  3ZG9 B;  4OP5 A;  5TBM A;  1ONH A;  3CUE A;  2ZY4 A;  3BW6 A;  4P0M A;  5CPK A;  3E98 A;  1Y54 A;  2PR5 A;  2NZD D;  5DKK A;  1NRJ A;  3AN2 B;  3PAG A;  2IWB A;  5J8X A;  4YM6 A;  3MGR C;  3REL C;  4B4Z A;  2Z6C A;  3MNN D;  1GA0 A;  1P34 A;  1ZKJ A;  5EPH A;  1HD8 A;  5B40 B;  1P3I C;  3V5M A;  5B32 B;  4IBK A;  4I3A A;  1XGJ A;  5FQ9 A;  3TRC A;  1IYP A;  3LZ1 D;  1L0E A;  1KX4 B;  1M1A D;  3C38 A;  3DAV A;  2FJ7 C;  3V9R B;  1GSW A;  5AVB C;  4PM9 A;  4WZS B;  1ED7 A;  3LI9 A;  4HES A;  4A5R A;  3B0C T;  4HMC A;  2YFV A;  3IF6 A;  3X1T B;  4S2K A;  1YMX A;  4ZAM A;  2HDQ A;  4GDB A;  1E25 A;  3IBJ A;  4J8X D;  3KYZ A;  1FCM A;  1S32 B;  3L7H A;  2JN7 A;  1W1T A;  2HZ5 A;  4XZQ A;  4ZUX D;  4XUJ C;  3RFB A;  3AZE A;  4J8U C;  5AQA A;  2W27 A;  3MXQ A;  2NUT C;  2ZD8 A;  3OCL A;  3T4L A;  5JRG A;  3JYI A;  5EVE A;  3N8L A;  4ESP A;  4LCL A;  5HD5 A;  3VP2 A;  3ZVW A;  3OPH A;  4PM8 A;  5B24 D;  1AWI A;  4N1X A;  3LJA D;  5FDH A;  2Y79 A;  3UB7 A;  1E4D A;  1FIK A;  4U3T A;  3UTB A;  2ZQC A;  4O8G A;  2CV5 D;  5GT3 B;  3HLB A;  5F82 A;  4KUD C;  5JRG B;  3UE3 A;  5G49 A;  4ZJ2 A;  2CMN A;  3LEL A;  1OTA A;  5HFO A;  4KZ9 A;  1YLZ A;  4K91 A;  5AV5 A;  3UN7 A;  2Y2G A;  3C4O A;  3O62 B;  5DNN D;  1TDL A;  4E3O A;  4H9R A;  3EEH A;  3AN2 C;  4K0W A;  5HX9 A;  5HAQ A;  3B47 A;  2YKH A;  5B1M D;  3UMD A;  1L0F A;  2HP9 A;  2L4R A;  4KZB A;  5B40 C;  2L0W A;  5B32 C;  1ID3 D;  4GHL A;  3WRZ A;  1VQQ A;  4YIN A;  1KU5 A;  1KX4 C;  3UT9 B;  5IT5 A;  3WAA D;  5FQQ A;  4ZJ1 A;  1PDC A;  1P3B A;  1P3K B;  4DQY B;  3WX7 A;  3LIA A;  5AV9 A;  4LD9 A;  2XEP A;  2XD1 A;  2O9A A;  3NCK A;  5A92 A;  1Z2C B;  3AZH B;  3WWX A;  4E6X A;  2Y2I A;  1OT9 A;  3X1T C;  3BJN A;  4BMW A;  1MY8 A;  4L9G A;  4LD9 B;  4IUK A;  3A1K A;  2Q9M A;  3LID A;  1S32 C;  1KE0 A;  5J3W A;  2P04 A;  5HL1 A;  4UPK A;  3FKW A;  3LR3 A;  5CED A;  4KZ6 A;  5B2I D;  4E3M A;  3AV1 D;  3Q7Z A;  1BLH A;  1U60 A;  1PW1 A;  3C5A A;  5FQK A;  5CGW A;  2I9V A;  1S0W A;  3X1U A;  3PTE A;  4J8W D;  2K2N A;  3N6I A;  4P85 A;  4PKY G;  2NQB D;  4HBT A;  3WKJ B;  1HLU P;  3A6N A;  2EFU A;  3REI A;  4ETZ A;  3KWQ A;  5GT3 C;  1ONG A;  2VX8 A;  4YS3 D;  4FCF A;  3SH8 A;  5JRG C;  2PD7 A;  3AZJ A;  4NZ3 A;  1MWU A;  1BLC A;  3UDX A;  2B5R A;  3CPT A;  1LSV A;  3U2A A;  1F66 D;  1W1Y A;  1P3F D;  4UQI M;  3AFA B;  3O62 C;  4CQH A;  3KYQ A;  4DRT A;  3FZC A;  5F68 A;  4Z2M G;  4P87 A;  3Q7V B;  3V3S A;  2BYM B;  1W5D A;  3LO7 A;  4ZDX A;  4KGC D;  4IBF A;  4H9P B;  1SDE A;  4H9Q B;  4IHQ A;  1TEM A;  1KVM A;  4JGP A;  1CEF A;  1BH9 A;  3AZL D;  3UT9 C;  5GLD A;  4OQ0 A;  3VP0 A;  5E2E A;  5KMW A;  1P3K C;  2JKT M;  3O87 A;  4NZ5 A;  3A0R A;  3UB5 P;  3NOU C;  2VK3 A;  4WN5 A;  1WWI A;  4F3L A;  3SS5 A;  4WZ4 A;  4I3J A;  1TAF A;  5LBR A;  3AZH C;  3L25 A;  3MGR D;  3MKF A;  2HP6 A;  4HI4 A;  4N9K A;  5B31 B;  4MDZ A;  1HZO A;  3GEC A;  2BTF P;  4LD9 C;  3KUY A;  4NXG A;  4WU8 A;  4MMN A;  1P3I D;  3AGF A;  3Q1F A;  2OWH A;  3IX3 A;  2Y2P A;  5KSH A;  2WKQ A;  3Q82 A;  3REJ B;  1E3U A;  1E6Z A;  2PU4 A;  2VJW A;  4MCW A;  1ALQ A;  1PZP A;  3PR6 A;  1W63 Q;  3W97 B;  2XQZ A;  1E6R A;  5AVB D;  2F8N D;  2E8I A;  2Q9N A;  2RL3 A;  4Y15 A;  3UY6 A;  3WKJ C;  2NZD A;  4X23 B;  1X0O A;  1L3L A;  1DY6 A;  4G3V A;  2EXB A;  4H9S C;  3KSI A;  1ES5 A;  2D49 A;  4JF4 A;  1W8Y A;  3F6T A;  4LPZ A;  5GT0 B;  1M6K A;  1FSY A;  5TFQ A;  4RQ9 A;  4IBB A;  5CTN A;  3MNN A;  2M1C A;  5BO0 B;  5BT1 C;  4XUJ D;  3MVD B;  3AFA C;  3B6G A;  2V9A A;  1LI0 A;  4X69 A;  3LZ1 A;  3SZT A;  4GNU A;  4J8U D;  3E2K A;  4Y7P A;  1M1A A;  3VE4 A;  4PPR A;  2XSS A;  4OPY A;  1NRF A;  1E6N A;  4IBJ A;  3DTI A;  2G7U A;  1KX5 D;  2HV1 A;  1VM1 A;  3WTP B;  3S7N A;  3UTA B;  2J7V A;  3VFH A;  2EWV A;  2R9X A;  4KQR A;  1UWN X;  5HPI A;  3UB8 A;  4KUD D;  3FKE A;  3TU4 B;  2CC1 A;  2WGI A;  4NXB A;  4J8V D;  4R3J A;  1YU1 A;  3LEQ A;  1N9L A;  4JGO A;  3K3C A;  4E44 A;  4KZ4 A;  3EEA A;  1MWS A;  4ZUX A;  4KUK A;  3PHY A;  4GS9 B;  5B31 C;  3EQU A;  3BFG A;  2IO5 B;  5GLC A;  2KOI A;  4NE6 A;  4R4S A;  4XT2 A;  1NWZ A;  5B32 D;  3KXB A;  3PBT A;  5B24 A;  4Z2H A;  3NQU B;  2JKT I;  2ZLY A;  4HGA B;  3LJA A;  1PI5 A;  4S2I A;  3REJ C;  1DP6 A;  1J3W A;  2CV5 A;  3T12 B;  2ARO A;  4UUZ B;  4R3A A;  1RCJ A;  4PAU A;  1K4E A;  4GW9 A;  3W97 C;  3P09 A;  1P3M A;  1V9Y A;  3H0R C;  3HLG A;  5C3I B;  2PRF A;  4EEU A;  2ZM8 A;  3SW1 A;  4JJN A;  4X23 C;  4OLD A;  4DE2 A;  3X1T D;  1NLY A;  2A3U A;  5GT0 C;  3OOV A;  3PBS A;  1DP9 A;  2WUQ A;  1S32 D;  4HY8 A;  5JA4 A;  3VP1 A;  4DDS A;  3H82 B;  1ID3 A;  3MVD C;  3HSH A;  4NK3 A;  2F8N H;  3DWK A;  1OJ5 A;  3QNB A;  3AV2 B;  3WTP C;  3UTA C;  4MLL A;  4BBU A;  5E5A A;  4HJ4 A;  3OLO A;  1SKF A;  2XFS A;  3AZE D;  3CG5 A;  1LHY A;  3LYX A;  5AQ7 A;  5JRG D;  1VET A;  3AGE A;  3TU4 C;  4S2O A;  3IWQ A;  3ZG0 A;  1CK7 A;  3BQA A;  5FI2 A;  1YPR A;  3H9W A;  2WAF A;  5E5A B;  3PAE A;  2J80 A;  1Q2P A;  3ZVT A;  2RIQ A;  5MC7 A;  3O62 D;  4B88 A;  3W99 A;  4Z5T B;  1T19 A;  2ZC4 B;  3JVV A;  5J7E A;  3FPV A;  3HON A;  1VET B;  4QLC B;  2IO5 C;  3AV1 A;  3IS2 A;  1O7E A;  1D1J A;  4WEL A;  2RCX A;  4OPZ A;  5BNV A;  4YWZ A;  4HGA C;  1KX3 B;  3UT9 D;  4J8W A;  5HAP A;  3P01 A;  4LCM A;  4LV0 A;  5CGX A;  1F1E A;  1GSX A;  1XPB A;  5AY8 A;  3NBL A;  4EEP A;  1S66 L;  4L0L A;  4ME4 A;  5F99 B;  4EWF A;  2VEA A;  1F66 A;  3HLC A;  5C3I C;  3AZH D;  3B33 A;  4Z2I A;  2XH9 A;  4IBG A;  4MN6 A;  3UB9 A;  2HDR A;  5AY8 B;  4LD9 D;  2OV5 A;  2OSU A;  1M18 A;  4KGC A;  2ZQ9 A;  1PWC A;  1OTD A;  1ES2 A;  1Q2Q A;  3MBZ A;  3W2Z A;  3G6O A;  4G3K A;  3C30 A;  2Y59 A;  1NY0 A;  3CAX A;  3AZL A;  3QP8 A;  2M7V A;  4Z2G A;  4KG2 A;  3L9K A;  4GHI A;  1LT0 A;  3WS4 A;  3AV2 C;  5TGF A;  3EPK A;  4WM9 A;  2J3W A;  4UEY A;  1P3L B;  1ERM A;  2Z6D A;  4AWL B;  3MGS B;  3IH9 A;  5B2J B;  3WKJ D;  3QP5 A;  1W79 A;  2JE5 A;  4JGQ A;  1KVL A;  4EXO A;  3MGR A;  3ZG7 B;  3REL A;  5D3O A;  4ZTK A;  1YUE A;  2P9V B;  1P3I A;  5E5A C;  1TD5 A;  4S2L A;  1OPX A;  2Q0O A;  2V1A A;  4HBU A;  3AFA D;  4E3L A;  3NJA A;  3A6N D;  3REI D;  4Z5T C;  1E88 A;  1XGI A;  3KWQ D;  1FOF A;  3QP6 A;  4IJG A;  2FJ7 A;  4QLC C;  2ZQA A;  4LV3 A;  2W1T A;  3AZJ D;  4LGW A;  2G2U A;  4JXV A;  5AVB A;  2PHY A;  4PM5 A;  2Y8H A;  2F8N A;  4IBI A;  3VP3 A;  2RVQ C;  1KX3 C;  3K2N A;  3MJQ A;  3O5Y A;  2C6W B;  3QP4 A;  3IF5 A;  4NG2 A;  3M2K A;  3CHW P;  4G91 B;  1P3P B;  3LIE A;  4Q0H A;  2ZOI A;  2VGL S;  3R7W B;  1MKI A;  3C8C A;  1XX2 A;  3ZNT A;  1K6R A;  3S7Q A;  5F99 C;  3HRE A;  2ZM5 A;  5G18 A;  1O07 A;  4XUJ A;  3VV4 A;  5EV0 A;  4BBT A;  1GHP A;  4J8U A;  4S2J A;  5B31 D;  2DRW A;  1P3G B;  1S4S A;  5AY8 C;  5EUA A;  5FDS A;  2CWE A;  3W96 B;  1JNU A;  3VOZ A;  4Y13 A;  2W3G A;  5CRF A;  4G3W A;  2VKS A;  3F1P A;  4K0X A;  1T1B A;  4R3B A;  2V5O A;  1H8M A;  2PYR A;  1DJB A;  1GCE A;  2ACG A;  4KUD A;  4CPK A;  5GXQ B;  3W97 D;  4IBC A;  1C3B A;  2B02 A;  4HQA A;  4CAY B;  3OCN A;  2V0U A;  4XXR A;  5HDC A;  1P3L C;  1KE3 A;  4AWL C;  3MGS C;  1YLP A;  5B2J C;  3EGD C;  2GDN A;  4MB3 A;  1E3U D;  4X23 D;  4RX2 A;  3AN2 A;  4KUO A;  2XK1 A;  5B0Z B;  2C5W B;  3C7V A;  1HQ3 B;  3EPL A;  5B40 A;  5B32 A;  1IKG A;  1V9Z A;  1TZY B;  3NDG A;  3MVD D;  1PRQ A;  3IWI A;  1KX4 A;  5KSC A;  1RGY A;  5L8M A;  3H0L C;  4P6B A;  5CER A;  4Q8I A;  3MZF A;  3W98 B;  2F2A C;  3LFV A;  3EG5 B;  3V9R A;  3WTP D;  3UTA D;  3KX0 X;  1N9N A;  3E0Y A;  5FEG A;  3WD2 A;  3B6G D;  2PBD P;  1VEU B;  1GSV A;  3EGX C;  4CLC B;  3MF0 A;  1T18 A;  3TU4 D;  5DTT A;  5EEC A;  2QJ5 A;  3V67 A;  4G91 C;  3X1T A;  1P3P C;  4GLQ A;  4WZ5 C;  3O3V A;  3P98 A;  3GDI A;  4EBP A;  1TVF A;  1PW8 A;  2HUE B;  1S32 A;  4LV2 A;  3AZK B;  3E4O A;  1A0K A;  4UAA A;  4H9O B;  3AGD A;  3T4J A;  5JYO A;  3T50 A;  3HLF A;  2XRN A;  1P3G C;  1S6R A;  1XFN A;  3D9Y A;  5AV6 B;  3N3F A;  3W96 C;  4BLM A;  3A0S A;  4H6J B;  2OAP 1;  4Z2L A;  3IBR A;  5GLA A;  5GT3 A;  1J9M A;  2A24 B;  4E6W A;  3VMA A;  1IFQ A;  1JWV A;  4B93 A;  3KXB D;  1QME A;  1ULY A;  4LG2 A;  1IKI A;  3SOI A;  2Y91 A;  3O62 A;  2WKH A;  2I72 A;  4S2N C;  4X55 A;  1F2K A;  3MGQ A;  1K55 C;  3IXD A;  5CPJ B;  4CSR B;  4BL3 A;  2ARO D;  5B0Z C;  3ZG8 B;  3C2W A;  2D01 A;  3T1X A;  2VV6 A;  3AZN B;  1HQ3 C;  3FKV A;  3CLO A;  1P3M D;  4QPR A;  5FSR A;  1TZY C;  4KEN B;  4NXF A;  4H9N B;  3UT9 A;  4IUH A;  4JJN D;  3MGQ B;  5FA7 A;  5FI7 A;  2EX8 A;  1A7W A;  1P3K A;  3REH B;  1YLJ A;  3MGP B;  4WEK A;  3BFC A;  4YFM A;  2YFW B;  3M6H A;  4JXG A;  2G2W A;  3AZM B;  3NI9 A;  3GMW A;  5HAR A;  3AZH A;  3EOI A;  4DRA A;  4HEF A;  4CLC C;  2KX6 A;  4JF6 A;  2P08 A;  3LIC A;  1KGG A;  3VE3 A;  2DCF A;  5FQJ A;  4BL2 A;  1KS0 A;  2GZA A;  4S2M A;  1PZR A;  3LUQ A;  1IYS A;  2MJ6 A;  5E5A D;  2IWD A;  5EOE A;  5FAO A;  2HUE C;  5K5B A;  3AZK C;  2P7J A;  2XR0 A;  5HWT A;  1T1A A;  4ETX A;  4Z5T D;  2ZC5 B;  3A1I A;  2J3T C;  4DE1 A;  3Q81 A;  4QLC D;  3NQJ B;  2VLG A;  4PM6 A;  4QJG A;  1S1Z A;  4X1M A;  1DJC A;  1LSW A;  3T1R A;  5AV6 C;  3HCY A;  5FI6 A;  4CLC E;  3W99 D;  4OOM A;  3HUO A;  1EI5 A;  3WKJ A;  4X53 A;  3MQQ A;  1TS0 A;  2PBY A;  4OJ6 A;  2XRO A;  4H9S A;  4NZ1 A;  4QY6 A;  2K31 A;  3AL0 C;  2VQR A;  5F99 D;  5IS1 A;  4OUI A;  3AFA A;  3UE0 A;  3W4Q A;  3JVU A;  3G2Z A;  3Q7V A;  5CPJ C;  3WD1 A;  2V1B A;  1NLZ A;  2BYM A;  5AY8 D;  1U35 B;  1AOI A;  2BLS A;  2D02 A;  2VGL M;  2UWX A;  2XF3 A;  4QNL A;  3AZF A;  5BNX B;  3A3F A;  3AZN C;  4H9P A;  4H9Q A;  2X71 A;  4I3I A;  5B1L B;  3UDI A;  4ZBJ B;  3LCE A;  1N4O A;  4HIA A;  3MGQ C;  4B9O A;  2XGN A;  3BFD A;  1E15 A;  1QMF A;  3A3I A;  3REH C;  5DNM B;  1AOI B;  1M18 D;  2GX5 A;  3MGP C;  3AZF B;  3E4P A;  3HUN A;  4DMZ A;  4MN5 A;  2WAD A;  1P3L D;  1UR8 A;  4D60 A;  3MGS D;  3TJZ C;  4EBN A;  3AZM C;  3PBQ A;  2ZL1 B;  3NC8 A;  2DNS A;  2EFX A;  2PDR A;  5AQB A;  5B31 A;  4U0T A;  1J7M A;  4OOL A;  5B33 B;  1L2S A;  1T3U A;  4EV4 A;  1W7F A;  2HIO B;  5TJJ A;  5E2G A;  4HOI A;  2JCH A;  3ZDJ A;  1ESI A;  2VGK A;  3MZE A;  3REJ A;  4N1H A;  1O6I A;  1NJ4 A;  2EX9 A;  5HL6 A;  2L5A A;  3REL D;  4GOG A;  2W3H A;  3IXH A;  3X1V B;  2V2F F;  3W97 A;  3DW0 A;  2OLU A;  4Z1W A;  3M6B A;  1N9B A;  1YM1 A;  2F8N G;  2QZ6 A;  4N92 A;  4FH4 A;  4NET A;  3ZHH A;  4X23 A;  4DN0 A;  4NYU A;  3S7P A;  2FJ7 D;  5GT0 A;  3WD0 A;  5DTS A;  3K3D A;  5F6A A;  1M40 A;  3VSL A;  5HWW A;  5CHL B;  2HF6 A;  1L0D A;  4LV1 A;  4KQQ A;  5BO0 A;  4Y0U A;  4WLA A;  3UNW A;  1YU2 A;  3NEC A;  1ERQ A;  5FAS A;  3MVD A;  1YLT A;  5KDM B;  4N9L A;  3BEB A;  5BOH A;  1P3G D;  3C4P A;  2WGV A;  1K4F A;  4H8R A;  3UPN A;  5AVF A;  1KOU A;  1U35 C;  4IVI A;  3JPU A;  3IXG A;  2GNX A;  3W96 D;  3NOT C;  4DE0 A;  1XKZ A;  3WTP A;  3UTA A;  5B1L C;  4BJP A;  3UME A;  5HZH A;  4ZBJ C;  3F1N A;  3WD3 A;  2BAS A;  3BEC A;  1NZO A;  5E2F A;  3TU4 A;  4JGR A;  5DNM C;  1AOI C;  4OPQ A;  2O99 A;  3AZF C;  3GV9 A;  4LRZ E;  4R1G A;  4Z9Q A;  3TSG A;  4WEJ A;  4XUX A;  2FN2 A;  2OAQ 1;  1K6S A;  4FUW A;  3F1N B;  1P3O B;  2Y2N A;  5J4E A;  3C7U A;  3SH7 A;  5B0Z D;  3F1O B;  4GS9 A;  4OKP A;  1YSP A;  4NZ4 A;  1HQ3 D;  5B33 C;  3T1Q B;  2EX6 A;  5GHZ A;  5TR7 A;  1I5Q A;  5CGS A;  2W8S A;  5BS7 C;  5B32 G;  3NIA A;  3NQU A;  4LEN A;  2HIO C;  4IJE A;  4HH3 A;  3HLD A;  2J9P A;  1LLB A;  2X02 A;  2H5S A;  3AN2 D;  4F94 A;  2QMI A;  3LR4 A;  4MB4 A;  1EWZ A;  4RVA A;  4UUZ A;  4JPM A;  5L07 A;  3X1V C;  2W3F A;  2XFT A;  3VH6 W;  4S2P A;  2LY8 A;  1BH8 B;  5B40 D;  1RP5 A;  2Y2M A;  3W4P A;  1MKM A;  5AV8 B;  1KX4 D;  5F69 A;  3WA9 B;  4E04 A;  5CP6 A;  5AQ9 A;  1K0K A;  2W1R A;  4IBD A;  3LY4 A;  1YU3 A;  3QNC A;  2W3E A;  2HDS A;  5G4Z A;  3AZK D;  3H82 A;  1SKO A;  4GKU A;  3TG9 A;  3FWL A;  3ISG A;  3OPP A;  2ZOH A;  3LZ0 B;  5CP6 B;  4BQM A;  2Y4A A;  3VH5 W;  5B0Y B;  5AV6 D;  3AV2 A;  4X6T A;  3ITB A;  1H3O B;  1FSW A;  3Q07 A;  2ZY5 A;  1ZLA B;  1TS8 A;  1H8Y A;  1SKO B;  4GN2 A;  1BZA A;  1Q9C A;  2ZM0 A;  3MXR A;  1STZ A;  1LI9 A;  1S4R A;  3BFF A;  4NYY A;  4OJO A;  1P0Z A;  3DWZ A;  4OVD A;  2W0N A;  4QHC A;  4OOY A;  3IQA A;  5FQI A;  4FSF A;  1OT6 A;  3VSK A;  1P3O C;  5CPJ D;  3IP4 C;  3BLM A;  4Z5T A;  1LL9 A;  1TS7 A;  4OON A;  5GT3 D;  5AVE A;  1H3Q A;  1S67 L;  3OZH A;  2OWJ A;  4QLC A;  4X25 A;  2Y2K A;  3AZN D;  5DNN B;  2EXA A;  4FTX A;  2PR6 A;  4E3N A;  5B1M B;  1H8P A;  1MWR A;  3LY3 A;  1KX3 A;  1K25 A;  4BBV A;  3BYD A;  3MGQ D;  1HVB A;  1ERO A;  1K54 C;  4GHA A;  5FAQ A;  4MEZ A;  1FCO A;  3NY4 A;  1UWP X;  5L09 A;  5GSU B;  4NKP A;  2ZQ8 A;  4WMC D;  4R8P B;  5E2H A;  1KGE A;  4OJL A;  3HJK A;  3TW8 A;  5F99 A;  3AZM D;  4E3J A;  1EQZ B;  5AV8 C;  3G4P A;  4AFI A;  3WA9 C;  3T4O A;  3KYE A;  1ZG6 A;  1BLS A;  3B0C W;  1P3K D;  3SS4 A;  5HPF A;  1FR1 A;  4JKT A;  4EES A;  3LIB A;  3MQ0 A;  4Y5F A;  4C3Q A;  4GD8 A;  4FOF A;  4UHU A;  2ZC6 B;  1N9O A;  5DF8 A;  3HUM A;  4GD6 A;  4X1L A;  4EUZ A;  1ESU A;  4GCZ A;  3LZ0 C;  3MKE A;  4WNN B;  5CP6 C;  3LR0 A;  3VH6 A;  5B0Y C;  5CXW A;  1H0G A;  3HL9 A;  1RGZ A;  3MR0 A;  5BPV A;  4M6B A;  5B2I B;  1ZLA C;  1P3L A;  3NUL A;  3KSH A;  1MPL A;  3LEZ A;  3MGS A;  3CMZ A;  5B2J A;  2PYO B;  3UE1 A;  4D2O A;  3VFF A;  1GHI A;  4C75 A; 
#chains in the Genus database with same CATH homology
 1CK3 A;  2NQB B;  1OME A;  2P9V A;  3CJM A;  4OJP A;  4YS3 B;  3VP4 A;  1YMS A;  1KDW A;  3AZI B;  5DF9 A;  3VH5 A;  2WAE A;  1P3F B;  2ZC7 A;  4MBH A;  3HLW A;  3MXS A;  5DNN C;  2WGW B;  1PWD A;  3L26 A;  3ZCZ A;  5B1M C;  1WYB A;  2IWC A;  5BT1 D;  5DVA A;  1P3A B;  3IH8 A;  1N1J B;  5FUG B;  3UPP A;  5DNM D;  1P3P A;  1AOI D;  1SDN A;  3AZF D;  4WZ5 A;  5GSU C;  2FFF B;  1SHV A;  4R8P C;  1M19 B;  1NZU A;  3V50 A;  4KZ7 A;  1EQZ C;  1GHM A;  4EQI A;  1HTZ A;  5B31 G;  1P3G A;  2G5H C;  3W96 A;  2JSS A;  2HIO D;  4KZA A;  3REK B;  1JFI B;  4CJN A;  4EO5 B;  3N4I A;  2R9W A;  1I2W A;  4WV4 B;  3X1V D;  5FAP A;  5GXQ A;  4OQG A;  5B2I C;  3R45 B;  4CAY A;  5FQM A;  3VH6 T;  3ZGA B;  3L2A A;  5CEB A;  2PYO C;  2IOU A;  3REJ D;  4S2N A;  1BLP A;  5GHY A;  1K55 A;  4QD4 A;  4Z66 B;  5B0Z A;  3B6F B;  4QB8 A;  2NQB C;  1MXO A;  1HQ3 A;  1KDS A;  4BD1 A;  5A91 A;  4YS3 C;  1G6A A;  5HW3 A;  1TZY A;  5CEC A;  2ZY3 A;  3C1B B;  4Y0O A;  3WS0 A;  3AZI C;  4B4X A;  3W98 A;  5GT0 D;  1P3F C;  1JTG A;  4GZB A;  2BYK B;  1KX5 B;  3UO9 A;  5EVI B;  1P3A C;  2G5I C;  3SH9 A;  5CPI B;  2JBF A;  4BEN A;  2VGJ A;  1M19 C;  1HTA A;  3AZK A;  1P3O D;  4J8V B;  5AVC B;  4H9O A;  4KHA B;  3X1S B;  3AZG A;  5AV6 A;  4WBG A;  4OJ5 A;  5CTM A;  4WYY A;  3REK C;  4QU3 A;  5CPK B;  4EO5 C;  3GR2 A;  4RYE A;  3AZG B;  2DF4 C;  3GTC A;  4YM6 B;  4M3K A;  1B6W A;  3BM6 A;  5AV8 D;  1P34 B;  3WA9 D;  5CPJ A;  3UPO A;  4CSR A;  4Z66 C;  3VOY A;  2ZQD A;  3B6F C;  3ITA A;  5GXQ C;  2Y2L A;  3S22 A;  3AZN A;  2A49 A;  3KS4 A;  1NXY A;  2V20 A;  4JF5 A;  1K57 A;  3ZFZ A;  4FH2 A;  5GL9 A;  1YLW A;  4H9N A;  3MZD A;  3C1B C;  3W8K A;  3LZ0 D;  1PIO A;  5CP6 D;  3IWO A;  1IYQ A;  5CHJ A;  5B0Y D;  3REH A;  3FV7 A;  3BFE A;  2WKE A;  3MGP A;  4WMC A;  1ZLA D;  2YFV B;  3IF6 B;  2YFW A;  4KG6 A;  1KX5 C;  3AZM A;  1XA1 A;  5EVI C;  5GLB A;  5CPI C;  3WS2 A;  4C6Y A;  4XZQ B;  3W98 C;  4R0Q A;  5EVL A;  3C1C A;  3AV2 D;  3AZE B;  1W2E A;  4MNR A;  4PM7 A;  1H8Z A;  5GHX A;  4J8V C;  1BSG A;  4R23 A;  5AVC C;  3ZNY A;  5F1G A;  3X1S C;  4E3K A;  4NY2 A;  3NQJ A;  1XXM A;  4KZ3 A;  3C1C B;  3UTB B;  2Y2J A;  1BT5 A;  3RJU A;  3D4F A;  3GVB A;  5G49 B;  4MBF A;  3LEL B;  5CPK C;  5AV5 B;  4IBE A;  1XA7 A;  5GSU D;  3AZG C;  3KFU G;  4R8P D;  4OQI A;  4H9R B;  3L27 A;  1L0G A;  4DXC A;  4YM6 C;  5CHU A;  1KE4 A;  3AYW A;  2RVQ D;  1KX3 D;  1EQZ D;  3MFD A;  1P34 C;  3PBR A;  1YQS A;  1U35 A;  2J9O A;  5BNX A;  4DF6 A;  1P3B B;  5B1L A;  3RXW A;  3AYW B;  5AV9 B;  4GH9 A;  2HDU A;  4IJF A;  4OQH A;  5DNM A;  3GSG A;  4PMA A;  4QY5 A;  3IF6 C;  1K57 C;  2PYO D;  3G2Y A;  2J8P A;  4KZ8 A;  5DF7 A;  3TOI A;  4DKI A;  4XZQ C;  4WU9 A;  4DE3 A;  5B33 A;  4UA6 A;  4ZBE A;  3SS3 A;  3AZE C;  4Y0T A;  5BS7 A;  2F8N K;  2HIO A;  5B2J D;  5DTK A;  3AZI D;  3IHA A;  3X1U B;  3X1V A;  4WU9 B;  3C1C C;  3UTB C;  3IXB A;  3A6N B;  3OPR A;  3REI B;  3KWQ B;  5L2F A;  3B3X A;  4NE3 A;  2Z2L B;  1NYY A;  5E43 A;  3AZJ B;  1P3A D;  3LEL C;  4X56 A;  4OLG A;  1WYC A;  5AV5 C;  3GRJ A;  5KZH A;  3N8R A;  1M19 D;  2WZZ A;  2QPN A;  1Z6F A;  1GA9 A;  5M1A A;  4OP8 A;  3A3D A;  1CEG A;  4OH0 A;  3IHB A;  5KDM A;  2Y2O A;  3NDE A;  3EPH A;  1P3P D;  1BH9 B;  4IED A;  3O86 A;  1P3B C;  1DJA A;  1ZG4 A;  4BD0 A;  2P74 A;  3AYW C;  3H0M C;  4IBR A;  5AV9 C;  3REK D;  2H0Y A;  3HVF A;  1TAF B;  3M2J A;  1PYY A;  4OPR A;  3KUY B;  4WU8 B;  2H0T A;  1P3O A;  3W4O A;  4Z66 D;  5EOO A;  3B6F D;  5GXQ D;  1KGF A;  1K56 D;  3PBO A;  5CHM A;  5EE8 A;  1SCW A;  4O7D A;  3C1B D;  1K54 A;  4UA7 A;  3X1U C;  2BG1 A;  4ZJ3 A;  4WU9 C;  2NZD B;  3A6N C;  4G92 B;  3REI C;  3KWQ C;  1BH8 A;  1TZY D;  3AZJ C;  5EVI D;  3MNN B;  5AV8 A;  3S1Y A;  3WA9 A;  5CPI D;  3W98 D;  1YU0 A;  4KZ5 A;  5FAT A;  3B6G B;  1WE4 A;  4GB7 A;  3LZ1 B;  4IBX A;  1M1A B;  5A90 A;  3FDD A;  4FD8 A;  2V1Z A;  5AVC D;  4WJ3 C;  4J8X A;  3X1S D;  3LZ0 A;  1K38 A;  3E2L A;  2ZC3 B;  5B0Y A;  1BTL A;  4U0X A;  1H3O A;  1ZLA A;  3P5J B;  4Z2M H;  5CPK D;  2ZY2 A;  4J8X B;  1BFM A;  1IYO A;  3AZG D;  1R4V A;  4JXW A;  4JLF A;  3KS8 A;  4ZUX B;  2J8Y A;  4YM6 D;  4DXB A;  1W8Q A;  1BUE A;  3HBR A;  3O88 A;  2FFY A;  3BLS A;  1P34 D;  3KUY C;  4UA9 A;  4WU8 C;  3KXB B;  5B24 B;  1PZO A;  4X68 A;  4GDN A;  3LJA B;  1JTD A;  5DNN A;  2CV5 B;  2ZJ9 A;  2ARO B;  3G34 A;  5B1M A;  1ES4 A;  1YT4 A;  2Y2H A;  1P3M B;  4R4R A;  2NZD C;  5GSU A;  3UDF A;  4JJN B;  4G92 C;  3WAA A;  1TDG A;  4R8P A;  3RXX A;  3G32 A;  5IHV A;  3ZG5 A;  5M18 A;  1WWS A;  3MNN C;  1EQZ A;  4EBL A;  1JVJ A;  5JA4 B;  4XZQ D;  1ID3 B;  3REH D;  3B6G C;  3LZ1 C;  3MGP D;  1M1A C;  3WAA B;  3EQV A;  1FCN A;  2ZQ7 A;  4RA7 A;  2HPB A;  4DDY A;  4WNN A;  2HP5 A;  3C1C D;  3UTB D;  5F1F A;  2WZX A;  2XD5 A;  5B2I A;  3WTP E;  2Y55 A;  2Z2M B;  4IVK A;  3LEL D;  2PYO A;  1FQG A;  1IEL A;  5AV5 D;  4E45 A;  4J8X C;  2XDM A;  3W99 B;  5I94 A;  2NQB A;  4ZUX C;  1PWG A;  1MWT A;  3CZD A;  4YS3 A;  3AV1 B;  3WRT A;  3KXB C;  5BNV B;  3AZI A;  5B24 C;  3LJA C;  4J8W B;  1P3F A;  3A3J A;  2X01 A;  1P3B D;  4KG5 A;  2CV5 C;  2WGW A;  3AYW D;  2ARO C;  5AV9 D;  3FYZ A;  1MBL A;  3KSY A;  1P3A A;  3EPJ A;  1I2S A;  1N1J A;  1P3M C;  3B0D B;  5FUG A;  1F66 B;  1U35 D;  1H5X A;  1LL5 A;  2XLN A;  4JJN C;  1M19 A;  4E3I A;  5B1L D;  1AXB A;  1G68 A;  3S4X A;  1M18 B;  4KGC B;  2WK0 A;  3WS1 A;  1ES3 A;  3WS5 A;  3GQZ A;  3IT9 A;  1ID3 C;  5M19 A;  2EX2 A;  3AZL B;  1YU4 A;  4KQO A;  3L28 A;  3WAA C;  3BRM A;  3N8S A;  2JC7 A;  5JYP A;  3REK A;  2PU2 A;  1ZC2 A;  3X1U D;  1JFI A;  3G30 A;  4WU9 D;  5B33 D;  3OC2 A;  3MGR B;  3R45 A;  3REL B;  3OPL A;  4MBK A;  4JXS A;  4JBF A;  1P3I B;  2ZM2 A;  2DQN C;  4Z66 A;  3W99 C;  3B6F A;  4ID4 A;  1B67 A;  1YLY A;  4NE5 A;  1FR6 A;  1K56 A;  2FJ7 B;  3AV1 C;  3L29 A;  1CI9 A;  2ZMA A;  2Y2Q A;  5AVB B;  3C1B A;  2F8N B;  5A93 A;  3G31 A;  4J8W C;  3V3R A;  1JWP A;  2WYX A;  5F83 A;  1JWZ A;  3DTM A;  3I7J A;  4RX3 A;  4XUZ A;  2BYK A;  1KX5 A;  5EVI A;  1CI8 A;  3B0D C;  5CPI A;  1F66 C;  3N7W A;  4XUJ B;  4J8U B;  3PBN A;  3A3E A;  3G35 A;  3VH5 T;  3V39 A;  3KUY D;  4WU8 D;  1M18 C;  3QHY A;  4KGC C;  3HLE A;  4J8V A;  4DRB A;  3B0B A;  5AVC A;  1XP4 A;  4NFT A;  4KHA A;  3X1S A;  5HAI A;  1IEM A;  1NYM A;  3AZL C;  1BUL A;  2H10 A;  2WKI A;  5U47 A;  1PI4 A;  4KUD B;  2OLV A;  3ZG9 B;  4OP5 A;  1ONH A;  2ZY4 A;  4P0M A;  5CPK A;  1Y54 A;  2NZD D;  3AN2 B;  3PAG A;  2IWB A;  5J8X A;  4YM6 A;  3MGR C;  3REL C;  4B4Z A;  3MNN D;  1GA0 A;  1P34 A;  1ZKJ A;  5EPH A;  1HD8 A;  5B40 B;  1P3I C;  3V5M A;  5B32 B;  4IBK A;  1XGJ A;  5FQ9 A;  1IYP A;  3LZ1 D;  1L0E A;  1KX4 B;  1M1A D;  2FJ7 C;  3V9R B;  5AVB C;  4PM9 A;  4WZS B;  4HES A;  4A5R A;  3B0C T;  2YFV A;  3IF6 A;  3X1T B;  4S2K A;  1YMX A;  4ZAM A;  2HDQ A;  4GDB A;  1E25 A;  4J8X D;  1FCM A;  1S32 B;  4XZQ A;  4ZUX D;  4XUJ C;  3AZE A;  4J8U C;  5AQA A;  2ZD8 A;  3OCL A;  5JRG A;  3JYI A;  3N8L A;  4LCL A;  3VP2 A;  3ZVW A;  3OPH A;  4PM8 A;  5B24 D;  4N1X A;  3LJA D;  5FDH A;  1E4D A;  4U3T A;  3UTB A;  2ZQC A;  2CV5 D;  5GT3 B;  3HLB A;  5F82 A;  4KUD C;  5JRG B;  3UE3 A;  5G49 A;  4ZJ2 A;  3LEL A;  5HFO A;  4KZ9 A;  1YLZ A;  4K91 A;  5AV5 A;  3UN7 A;  2Y2G A;  3C4O A;  3O62 B;  5DNN D;  1TDL A;  4E3O A;  4H9R A;  3AN2 C;  4K0W A;  5HX9 A;  5HAQ A;  5B1M D;  1L0F A;  2HP9 A;  4KZB A;  5B40 C;  5B32 C;  1ID3 D;  4GHL A;  3WRZ A;  1VQQ A;  4YIN A;  1KU5 A;  1KX4 C;  3UT9 B;  3WAA D;  5FQQ A;  4ZJ1 A;  1P3B A;  1P3K B;  4DQY B;  3WX7 A;  5AV9 A;  4LD9 A;  2XEP A;  2XD1 A;  3NCK A;  5A92 A;  1Z2C B;  3AZH B;  3WWX A;  4E6X A;  2Y2I A;  3X1T C;  1MY8 A;  4LD9 B;  3A1K A;  2Q9M A;  1S32 C;  1KE0 A;  5HL1 A;  4UPK A;  3FKW A;  5CED A;  4KZ6 A;  5B2I D;  4E3M A;  3AV1 D;  3Q7Z A;  1BLH A;  1U60 A;  1PW1 A;  3C5A A;  5FQK A;  5CGW A;  1S0W A;  3X1U A;  3PTE A;  4J8W D;  3N6I A;  4P85 A;  2NQB D;  4HBT A;  3WKJ B;  3A6N A;  2EFU A;  3REI A;  3KWQ A;  5GT3 C;  1ONG A;  4YS3 D;  4FCF A;  3SH8 A;  5JRG C;  3AZJ A;  4NZ3 A;  1MWU A;  1BLC A;  3UDX A;  2B5R A;  1F66 D;  1P3F D;  3AFA B;  3O62 C;  4DRT A;  3FZC A;  4Z2M G;  4P87 A;  3Q7V B;  3V3S A;  2BYM B;  1W5D A;  3LO7 A;  4ZDX A;  4KGC D;  4IBF A;  4H9P B;  1SDE A;  4H9Q B;  1TEM A;  1KVM A;  1CEF A;  1BH9 A;  3AZL D;  3UT9 C;  5GLD A;  4OQ0 A;  3VP0 A;  5E2E A;  5KMW A;  1P3K C;  3O87 A;  4NZ5 A;  1WWI A;  3SS5 A;  4WZ4 A;  1TAF A;  3AZH C;  3L25 A;  3MGR D;  3MKF A;  2HP6 A;  4N9K A;  5B31 B;  1HZO A;  4LD9 C;  3KUY A;  4WU8 A;  1P3I D;  3AGF A;  3Q1F A;  2Y2P A;  5KSH A;  3Q82 A;  3REJ B;  1E3U A;  2PU4 A;  1ALQ A;  1PZP A;  3W97 B;  2XQZ A;  5AVB D;  2F8N D;  2E8I A;  2Q9N A;  2RL3 A;  3UY6 A;  3WKJ C;  2NZD A;  4X23 B;  1DY6 A;  2EXB A;  4H9S C;  4JF4 A;  1ES5 A;  1W8Y A;  3F6T A;  5GT0 B;  1M6K A;  1FSY A;  5TFQ A;  4IBB A;  5CTN A;  3MNN A;  5BO0 B;  5BT1 C;  4XUJ D;  3MVD B;  3AFA C;  3B6G A;  1LI0 A;  4X69 A;  3LZ1 A;  4GNU A;  4J8U D;  3E2K A;  4Y7P A;  1M1A A;  4PPR A;  4OPY A;  1NRF A;  4IBJ A;  1KX5 D;  1VM1 A;  3WTP B;  3UTA B;  2J7V A;  3VFH A;  2R9X A;  4KQR A;  4KUD D;  3FKE A;  3TU4 B;  2CC1 A;  2WGI A;  4J8V D;  4R3J A;  1YU1 A;  4E44 A;  4KZ4 A;  1MWS A;  4ZUX A;  5B31 C;  3EQU A;  3BFG A;  2IO5 B;  5GLC A;  4NE6 A;  4R4S A;  5B32 D;  3KXB A;  3PBT A;  5B24 A;  3NQU B;  2ZLY A;  4HGA B;  3LJA A;  1PI5 A;  4S2I A;  3REJ C;  2CV5 A;  2ARO A;  4UUZ B;  1RCJ A;  1K4E A;  3W97 C;  3P09 A;  1P3M A;  3H0R C;  3HLG A;  5C3I B;  2ZM8 A;  4JJN A;  4X23 C;  4OLD A;  4DE2 A;  3X1T D;  2A3U A;  5GT0 C;  3PBS A;  2WUQ A;  1S32 D;  5JA4 A;  3VP1 A;  4DDS A;  1ID3 A;  3MVD C;  3HSH A;  4NK3 A;  2F8N H;  3DWK A;  3QNB A;  3AV2 B;  3WTP C;  3UTA C;  4MLL A;  5E5A A;  1SKF A;  2XFS A;  3AZE D;  3CG5 A;  1LHY A;  5AQ7 A;  5JRG D;  3AGE A;  4S2O A;  3TU4 C;  3IWQ A;  3ZG0 A;  5FI2 A;  2WAF A;  5E5A B;  3PAE A;  1Q2P A;  3ZVT A;  2RIQ A;  3O62 D;  4B88 A;  3W99 A;  4Z5T B;  2ZC4 B;  3HON A;  4QLC B;  2IO5 C;  3AV1 A;  1O7E A;  4WEL A;  2RCX A;  4OPZ A;  5BNV A;  4HGA C;  1KX3 B;  3UT9 D;  4J8W A;  5HAP A;  4LCM A;  4LV0 A;  5CGX A;  1F1E A;  1XPB A;  5AY8 A;  3NBL A;  4L0L A;  5F99 B;  4EWF A;  1F66 A;  3HLC A;  5C3I C;  3AZH D;  2XH9 A;  4IBG A;  2HDR A;  5AY8 B;  4LD9 D;  2OV5 A;  2OSU A;  1M18 A;  4KGC A;  2ZQ9 A;  1PWC A;  1ES2 A;  1Q2Q A;  3MBZ A;  2Y59 A;  1NY0 A;  3AZL A;  4KG2 A;  3WS4 A;  3AV2 C;  5TGF A;  3EPK A;  4WM9 A;  1P3L B;  1ERM A;  4AWL B;  3MGS B;  3IH9 A;  5B2J B;  3WKJ D;  1W79 A;  2JE5 A;  1KVL A;  3MGR A;  3ZG7 B;  3REL A;  5D3O A;  4ZTK A;  1YUE A;  2P9V B;  1P3I A;  5E5A C;  4S2L A;  4HBU A;  3AFA D;  4E3L A;  3A6N D;  3REI D;  4Z5T C;  1XGI A;  3KWQ D;  1FOF A;  2FJ7 A;  4QLC C;  2ZQA A;  4LV3 A;  3AZJ D;  2G2U A;  4JXV A;  5AVB A;  4PM5 A;  2F8N A;  4IBI A;  3VP3 A;  2RVQ C;  1KX3 C;  2C6W B;  3IF5 A;  3M2K A;  4G91 B;  1P3P B;  1MKI A;  1XX2 A;  3ZNT A;  1K6R A;  5F99 C;  3HRE A;  2ZM5 A;  5G18 A;  1O07 A;  4XUJ A;  1GHP A;  4J8U A;  4S2J A;  5B31 D;  2DRW A;  1P3G B;  5AY8 C;  5EUA A;  2CWE A;  3W96 B;  3VOZ A;  5CRF A;  4K0X A;  4R3B A;  1DJB A;  1GCE A;  4KUD A;  4CPK A;  5GXQ B;  3W97 D;  4IBC A;  1C3B A;  4CAY B;  3OCN A;  4XXR A;  1P3L C;  1KE3 A;  4AWL C;  3MGS C;  1YLP A;  5B2J C;  2GDN A;  1E3U D;  4X23 D;  4RX2 A;  3AN2 A;  2XK1 A;  5B0Z B;  2C5W B;  3C7V A;  1HQ3 B;  3EPL A;  5B40 A;  5B32 A;  1IKG A;  1TZY B;  3NDG A;  3MVD D;  3IWI A;  1KX4 A;  5KSC A;  1RGY A;  5CER A;  3H0L C;  4P6B A;  4Q8I A;  3MZF A;  3W98 B;  2F2A C;  3EG5 B;  3V9R A;  3WTP D;  3UTA D;  3B6G D;  5DTT A;  3TU4 D;  5EEC A;  4G91 C;  3X1T A;  1P3P C;  4WZ5 C;  3O3V A;  3P98 A;  4EBP A;  1TVF A;  1PW8 A;  2HUE B;  1S32 A;  4LV2 A;  3AZK B;  4UAA A;  4H9O B;  3AGD A;  5JYO A;  3HLF A;  1P3G C;  1S6R A;  5AV6 B;  3N3F A;  3W96 C;  4BLM A;  5GLA A;  5GT3 A;  1J9M A;  4E6W A;  3VMA A;  1JWV A;  3KXB D;  1QME A;  1ULY A;  4LG2 A;  1IKI A;  3SOI A;  2Y91 A;  3O62 A;  2WKH A;  2I72 A;  4S2N C;  4X55 A;  3MGQ A;  1K55 C;  3IXD A;  5CPJ B;  4CSR B;  4BL3 A;  2ARO D;  5B0Z C;  3ZG8 B;  3AZN B;  1HQ3 C;  3FKV A;  1P3M D;  5FSR A;  1TZY C;  4KEN B;  4H9N B;  3UT9 A;  4JJN D;  3MGQ B;  5FA7 A;  5FI7 A;  2EX8 A;  1A7W A;  1P3K A;  3REH B;  1YLJ A;  3MGP B;  4WEK A;  3BFC A;  4YFM A;  2YFW B;  3M6H A;  4JXG A;  2G2W A;  3AZM B;  3NI9 A;  3GMW A;  5HAR A;  3AZH A;  4DRA A;  4HEF A;  4JF6 A;  1KGG A;  2DCF A;  5FQJ A;  4BL2 A;  4S2M A;  1PZR A;  5EOE A;  1IYS A;  5FAO A;  5E5A D;  2IWD A;  2HUE C;  3AZK C;  2XR0 A;  4Z5T D;  2ZC5 B;  3A1I A;  4DE1 A;  3Q81 A;  4QLC D;  3NQJ B;  4PM6 A;  4QJG A;  1DJC A;  5AV6 C;  5FI6 A;  3W99 D;  4OOM A;  3HUO A;  1EI5 A;  3WKJ A;  4X53 A;  2PBY A;  4OJ6 A;  4H9S A;  4NZ1 A;  4QY6 A;  3AL0 C;  2VQR A;  5F99 D;  4OUI A;  3AFA A;  3UE0 A;  3W4Q A;  3G2Z A;  3Q7V A;  5CPJ C;  2BYM A;  5AY8 D;  1U35 B;  1AOI A;  2BLS A;  2UWX A;  2XF3 A;  4QNL A;  3AZF A;  5BNX B;  3A3F A;  3AZN C;  4H9P A;  4H9Q A;  2X71 A;  5B1L B;  3UDI A;  4ZBJ B;  3LCE A;  1N4O A;  3MGQ C;  2XGN A;  3BFD A;  1QMF A;  3A3I A;  3REH C;  5DNM B;  1AOI B;  1M18 D;  3MGP C;  3AZF B;  3HUN A;  2WAD A;  1P3L D;  3MGS D;  4EBN A;  3AZM C;  3PBQ A;  3NC8 A;  2DNS A;  2EFX A;  5AQB A;  5B31 A;  4U0T A;  4OOL A;  5B33 B;  1L2S A;  1T3U A;  4EV4 A;  1W7F A;  2HIO B;  5E2G A;  3ZDJ A;  2JCH A;  1ESI A;  2VGK A;  3MZE A;  3REJ A;  4N1H A;  1NJ4 A;  2EX9 A;  2L5A A;  3REL D;  4GOG A;  3IXH A;  3X1V B;  2V2F F;  3W97 A;  3DW0 A;  2OLU A;  3M6B A;  1N9B A;  1YM1 A;  2F8N G;  2QZ6 A;  4N92 A;  4FH4 A;  4NET A;  3ZHH A;  4X23 A;  4NYU A;  2FJ7 D;  5GT0 A;  5DTS A;  1M40 A;  3VSL A;  5CHL B;  1L0D A;  4LV1 A;  4KQQ A;  5BO0 A;  4Y0U A;  3UNW A;  1YU2 A;  1ERQ A;  5FAS A;  3MVD A;  1YLT A;  5KDM B;  4N9L A;  3BEB A;  5BOH A;  1P3G D;  3C4P A;  2WGV A;  1K4F A;  4H8R A;  3UPN A;  1U35 C;  4IVI A;  3IXG A;  3W96 D;  4DE0 A;  1XKZ A;  3WTP A;  3UTA A;  5B1L C;  4BJP A;  4ZBJ C;  3BEC A;  1NZO A;  5E2F A;  3TU4 A;  5DNM C;  1AOI C;  4OPQ A;  3AZF C;  3GV9 A;  4R1G A;  4Z9Q A;  3TSG A;  4WEJ A;  4XUX A;  1K6S A;  1P3O B;  2Y2N A;  3C7U A;  3SH7 A;  5B0Z D;  4OKP A;  4NZ4 A;  1HQ3 D;  5B33 C;  2EX6 A;  5GHZ A;  5TR7 A;  1I5Q A;  5CGS A;  2W8S A;  5BS7 C;  5B32 G;  3NIA A;  3NQU A;  4LEN A;  2HIO C;  4IJE A;  3HLD A;  2J9P A;  1LLB A;  2X02 A;  2H5S A;  3AN2 D;  4F94 A;  2QMI A;  1EWZ A;  4RVA A;  4UUZ A;  4JPM A;  3X1V C;  2XFT A;  3VH6 W;  4S2P A;  2LY8 A;  1BH8 B;  5B40 D;  1RP5 A;  2Y2M A;  3W4P A;  5AV8 B;  1KX4 D;  3WA9 B;  5CP6 A;  5AQ9 A;  4IBD A;  3LY4 A;  1YU3 A;  3QNC A;  2HDS A;  3AZK D;  4GKU A;  3TG9 A;  3FWL A;  3ISG A;  3OPP A;  3LZ0 B;  5CP6 B;  4BQM A;  2Y4A A;  3VH5 W;  5B0Y B;  5AV6 D;  3AV2 A;  4X6T A;  3ITB A;  1H3O B;  1FSW A;  3Q07 A;  2ZY5 A;  1ZLA B;  1H8Y A;  4GN2 A;  1BZA A;  1Q9C A;  2ZM0 A;  3MXR A;  1LI9 A;  3BFF A;  4NYY A;  4OJO A;  3DWZ A;  4OVD A;  4QHC A;  4OOY A;  3IQA A;  5FQI A;  4FSF A;  3VSK A;  1P3O C;  5CPJ D;  3IP4 C;  3BLM A;  4Z5T A;  1LL9 A;  4OON A;  5GT3 D;  3OZH A;  4QLC A;  2Y2K A;  3AZN D;  5DNN B;  2EXA A;  4E3N A;  5B1M B;  1MWR A;  3LY3 A;  1KX3 A;  1K25 A;  3BYD A;  3MGQ D;  1HVB A;  1ERO A;  1K54 C;  4GHA A;  5FAQ A;  4MEZ A;  1FCO A;  3NY4 A;  5GSU B;  2ZQ8 A;  4WMC D;  4R8P B;  5E2H A;  1KGE A;  4OJL A;  5F99 A;  3AZM D;  4E3J A;  1EQZ B;  5AV8 C;  3G4P A;  3WA9 C;  1ZG6 A;  1BLS A;  3B0C W;  1P3K D;  3SS4 A;  1FR1 A;  4JKT A;  4C3Q A;  4GD8 A;  4UHU A;  2ZC6 B;  5DF8 A;  3HUM A;  4GD6 A;  4EUZ A;  1ESU A;  3LZ0 C;  3MKE A;  4WNN B;  5CP6 C;  3VH6 A;  5B0Y C;  5CXW A;  3HL9 A;  1RGZ A;  5BPV A;  4M6B A;  5B2I B;  1ZLA C;  1P3L A;  1MPL A;  3LEZ A;  3MGS A;  3CMZ A;  5B2J A;  2PYO B;  3UE1 A;  4D2O A;  3VFF A;  1GHI A;  4C75 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...