2XD5A

Structural insights into the catalytic mechanism and the role of streptococcus pneumoniae pbp1b
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
489
structure length
469
Chain Sequence
ISEITYSDGTVIASIDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTNQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PENICILLIN-BINDING PROTEIN 1B
publication title Structural Insights Into the Catalytic Mechanism and the Role of Streptococcus Pneumoniae Pbp1B
rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
total genus 153
structure length 469
sequence length 489
chains with identical sequence B
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2xd5A01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2xd5A03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2xd5A02
4KQQA 2J9OA 1JWZA 4K91A 2EX2A 2RCXA 4LENA 4DRTA 1K55C 3DWKA 2OLVA 2ZC5B 3W4OA 4R4SA 2G2WA 1W8QA 4EV4A 2GDNA 5J8XA 4DDSA 3IH8A 1IYOA 1ZG4A 2OSUA 2QPNA 1PYYA 3OZHA 5HFOA 3HLBA 2XD1A 4N9KA 5FATA 5FI6A 2FFFB 1PW8A 1YLTA 4ID4A 3RJUA 1KDWA 3A3JA 4S2LA 5CRFA 4OP5A 2E8IA 2J9PA 3LY3A 1XGJA 1HTZA 1HVBA 4OLDA 4FH4A 3ZHHA 4KZ3A 4GDBA 3E2KA 1ES4A 5F83A 3MFDA 4X53A 5L2FA 3BFEA 1TEMA 1SKFA 3IXGA 5KZHA 4GZBA 4B4XA 3BFCA 4S2IA 1ALQA 1CI9A 3WWXA 1WYCA 3VFHA 1I2WA 5DTKA 1KGEA 3GVBA 4WYYA 1IELA 3N4IA 4FCFA 3WS2A 1GA0A 5DTTA 5CGWA 3FKWA 1M40A 2VGJA 1K57A 4OPZA 1CEGA 3A3FA 2ZC7A 1K56A 4X55A 5F82A 1I5QA 5HW3A 1MWTA 3QNBA 2J7VA 1FCMA 1FR1A 3VOYA 3VMAA 1K57C 2ZQDA 2X01A 4QD4A 4A5RA 3HUMA 3FV7A 1BLSA 1LHYA 4KG5A 4BD0A 1NZUA 1XGIA 5DF7A 1S0WA 4KZ7A 3VSKA 1XX2A 4OQGA 1LL5A 4UHUA 4GD8A 3NY4A 4WEKA 4Z9QA 3ZG7B 1YLPA 1LI0A 2P9VA 2IWCA 3BFDA 1I2SA 2Q9MA 3P98A 4Y0UA 4OH0A 4E6XA 3UDFA 5HX9A 2EX9A 3NC8A 1BULA 3NI9A 1E4DA 4OONA 1GCEA 1KGFA 3AGEA 5A90A 2WGIA 4B88A 3PBSA 4PM9A 1EROA 3SH7A 2Y2PA 1L0FA 2XD5A 2IWBA 4R4RA 4X56A 3FKVA 3HVFA 5AQAA 3ZFZA 4EBPA 1W79A 2Q9NA 4CPKA 2EFXA 5FASA 4H8RA 1PIOA 2UWXA 4IVIA 1ONHA 4L0LA 2HPBA 1GA9A 4N92A 4P87A 5CHMA 3GRJA 4EQIA 4E6WA 1G6AA 2ZLYA 1GHPA 1NRFA 3BYDA 4QHCA 1FQGA 1O07A 1DY6A 4GKUA 4JBFA 1S6RA 4JF4A 3OC2A 1KVMA 3HUNA 4N9LA 3ZG8B 3WS5A 4DE1A 4WMCA 3BFGA 1KE4A 2JCHA 1IYQA 1XPBA 4UAAA 5HAIA 1E25A 4E3NA 3NDGA 3ZNYA 4ZTKA 3HLGA 1IYSA 1K4EA 4RX3A 2WGWA 3IF6A 4WELA 5EE8A 4LV0A 4QB8A 3HLCA 4QJGA 3C7VA 4JXWA 1W5DA 1PZPA 2V20A 4KENB 1YT4A 3UNWA 4JKTA 5FQIA 5HL1A 2A49A 4OOYA 2ZQ9A 1BSGA 5CEBA 4PPRA 5HARA 4IBRA 4C3QA 1MXOA 3ITBA 4R23A 5FAOA 4NETA 1MWRA 1ESIA 1E3UA 3MZDA 1L0EA 3DTMA 4KZ8A 5FQQA 4KZ4A 2V1ZA 3C4OA 2DRWA 3C4PA 3IH9A 4KQRA 5CEDA 1SHVA 4S2KA 4RVAA 3GQZA 1NYYA 3O86A 4C6YA 5CGXA 1BUEA 4OQ0A 3UO9A 1JTDA 3I7JA 4KQOA 3BRMA 4LV3A 3N6IA 3DW0A 5JYOA 4LV2A 1L0GA 3BFFA 1K54C 2G2UA 4EBLA 4WZ5C 5GLAA 3VP0A 5F1FA 1DJBA 1TVFA 3FYZA 4GN2A 4U3TA 2A3UA 3O87A 1JVJA 1ESUA 4Y7PA 3C7UA 5DTSA 3VP4A 1N9BA 2R9WA 4MBFA 5E2HA 5GHYA 1SCWA 1ONGA 1O7EA 3MZFA 5FDHA 4OOLA 2PBYA 1FCOA 4PM5A 3V5MA 1BLCA 3IXHA 3HREA 1MPLA 3MKFA 1YLZA 4KG2A 3A3DA 4N1XA 4U0TA 5FQMA 1ES5A 3HL9A 3Q82A 2XH9A 2HDSA 4RX2A 2XLNA 4GOGA 4LCLA 4Y0OA 3WS0A 2ZC4B 4DE0A 5M19A 4MEZA 3W8KA 2WKEA 3PBQA 3IF6B 1LI9A 4JLFA 1WYBA 2RL3A 1ERQA 3EQUA 5GHXA 5CTNA 5FSRA 4E3JA 1U60A 5FI7A 2X02A 4RYEA 4IBXA 4BL3A 3SS4A 5GHZA 3WRZA 3VP3A 3G30A 4JXVA 3M6HA 4S2NA 3M2JA 1XA7A 4P6BA 1MWSA 3NCKA 2ZM8A 1ERMA 4QU3A 3TSGA 3ITAA 4CJNA 3ZG9B 4S2NC 2QZ6A 3IT9A 3N8SA 3WS4A 4P85A 5CTMA 4DKIA 3P09A 3S22A 1NJ4A 3WS1A 2PU4A 2FFYA 2XDMA 3ZCZA 3M2KA 4ZAMA 3G31A 1BTLA 3MKEA 4LV1A 4DXBA 3NIAA 2X71A 2Y91A 3UDIA 5EOEA 2Y2JA 2B5RA 3GR2A 5HAPA 3CZDA 4HESA 4GNUA 4KZ9A 1TDLA 2WZZA 2WADA 4PM8A 3Q7VA 3GTCA 5A91A 3Q81A 3SS3A 3G35A 4R3JA 3FZCA 5EVIA 3ZDJA 4K0XA 1OMEA 1FR6A 3IF5A 4GD6A 4OP8A 1JWPA 1WE4A 1YMSA 3BECA 5E2GA 3UE0A 4EUZA 1IEMA 4OPYA 5EVIC 3ZG5A 5A93A 2Y2LA 3A3EA 5AQ9A 2ZD8A 4ZJ3A 3RXXA 5FI2A 1HD8A 2Y2KA 3HLEA 3RXWA 3W4QA 2ZMAA 5A92A 3CJMA 4KZBA 3VP1A 4BJPA 1CK3A 2WKHA 3NDEA 1BT5A 2JC7A 2EXAA 3HLDA 3UY6A 4XUXA 5E2FA 1K56D 4YFMA 4OVDA 5M1AA 3SOIA 2VGKA 2P74A 2V2FF 3IHAA 3BLSA 1L0DA 1TDGA 5GLDA 1FSWA 3A3IA 3UE3A 2QMIA 4U0XA 2XFSA 3PAEA 4EWFA 4IEDA 5CGSA 1MBLA 5JYPA 4X6TA 5GLBA 3O3VA 1KE0A 5AQBA 1YLWA 1YLYA 4HEFA 4IVKA 2H0TA 1ES2A 4KZ6A 4EBNA 3V3SA 4DE3A 1SDEA 4MBKA 5FQKA 3UPNA 4MNRA 3SS5A 4BENA 3G32A 3OPPA 4HBUA 5D3OA 3G2ZA 4E3KA 3HBRA 4K0WA 3QHYA 3LO7A 2P9VB 1ES3A 1N4OA 1PI5A 3G2YA 3ZNTA 2XF3A 3MZEA 5U47A 1HZOA 1K25A 2BLSA 2XEPA 3UDXA 2Y2IA 3V3RA 4FH2A 4DE2A 4E3IA 3HLWA 1SDNA 1K54A 3CG5A 1FSYA 4WZ5A 4BL2A 3OCNA 4BD1A 4OKPA 3OPRA 1IYPA 4RA7A 2WZXA 4R1GA 1FCNA 3VP2A 1Q2PA 1L2SA 2Y59A 3ZVTA 4DXCA 3N8LA 2WGVA 4S2MA 1PZOA 4M3KA 3D4FA 5M18A 3PBRA 4WMCD 3AGDA 1YLJA 2ZC3B 5DF8A 4S2PA 1CEFA 2ZM0A 4OQHA 2Y4AA 3WRTA 1PWGA 1IKGA 1VQQA 3JYIA 2Z2LB 2WUQA 3B3XA 3PAGA 4N1HA 3S4XA 1H8ZA 1DJCA 1MKIA 1NXYA 3MBZA 2ZJ9A 5F1GA 4D2OA 3V50A 3BM6A 3CMZA 5KSCA 2WAFA 2OV5A 2WGWB 5EOOA 3TOIA 3ZG0A 4Q8IA 1EI5A 4X69A 2OLUA 4QY6A 1E3UD 1NZOA 4WZ4A 5EUAA 4ZJ1A 1LL9A 1MWUA 2ZM2A 2WK0A 3PTEA 1RP5A 3IWQA 2Y55A 1XXMA 2Y2NA 2XQZA 3E2LA 3PBTA 3G4PA 2WYXA 1K38A 4ZJ2A 4C75A 1NYMA 5AQ7A 2Y2HA 2Y2QA 1FOFA 5KMWA 5I94A 5CHUA 3GMWA 1GHIA 1BLPA 4GDNA 5G18A 1JWVA 2EXBA 3N7WA 2DNSA 3DWZA 4FD8A 3V39A 1AXBA 4ZBEA 3SH8A 2EX8A 2JBFA 4B4ZA 4E3LA 4BLMA 1GHMA 3C5AA 5DVAA 2J8YA 5CXWA 1H8YA 2DCFA 3LCEA 4S2OA 4PM7A 1ZG6A 4GB7A 1RGYA 1ZKJA 3LEZA 4X68A 4PMAA 4R3BA 2JE5A 2HDQA 4JF6A 4ZDXA 5EPHA 2XR0A 2Y2OA 3G34A 3NBLA 1YM1A 3LY4A 1IKIA 1DJAA 5TGFA 4OLGA 4R0QA 3AGFA 2WAEA 3IQAA 4JPMA 3S1YA 1JTGA 1EWZA 3MXRA 1PW1A 4HBTA 1BZAA 3MXSA 4OOMA 3UPPA 1QMEA 3VFFA 2WKIA 5GL9A 1K4FA 3EQVA 4MBHA 5FQ9A 4OPRA 5HAQA 1H5XA 3Q1FA 3UE1A 2HP9A 4NK3A 2ZC6B 1G68A 5FAQA 2R9XA 4LCMA 5E43A 3Q7ZA 4XUZA 3ISGA 2H10A 1BLHA 4UA7A 5CECA 2C6WB 1PWDA 1XKZA 4FSFA 5E2EA 5TFQA 4UA9A 3OPHA 2I72A 4DF6A 4PM6A 5DF9A 1KDSA 2HDRA 4JXGA 5EVLA 1Z6FA 3VSLA 1W8YA 1YQSA 5EECA 4QY5A 4E3OA 3Q07A 3IWOA 5IHVA 2H0YA 4MLLA 1RGZA 2Y2GA 1PWCA 1YMXA 1MY8A 5FA7A 4S2JA 3BEBA 4UA6A 3SH9A 2C5WB 2ZQ8A 4KZ5A 1NY0A 3ZVWA 1K6SA 3BLMA 4KG6A 3W4PA 2ZQCA 1M6KA 1CI8A 1XA1A 4KZAA 3FWLA 3PBOA 2Y2MA 3OPLA 1Y54A 1XP4A 3GSGA 3ZGAB 4BQMA 1KVLA 2H5SA 5BOHA 3GV9A 4E3MA 2CC1A 3IXDA 3IXBA 4DDYA 4F94A 5EVID 3HLFA 3IF6C 2ZQ7A 5TR7A 3VOZA 2PU2A 3OCLA 1RCJA 3O88A 4OQIA 2HP6A 2ZQAA 4P0MA 2BG1A 1KGGA 3HUOA 3IHBA 5FQJA 3Q7VB 4JXSA 2Z2MB 4OPQA 3M6BA 3N8RA 4XXRA 1KE3A 5GLCA 3UPOA 2EFUA 5EVIB 1VM1A 4WBGA 2XK1A 2XGNA 4Y0TA 4O7DA 1J9MA 1K6RA 1C3BA 3TG9A 4YINA 1PI4A 3UN7A 1W7FA 5CERA 2EX6A 2IWDA 1QMFA 4WM9A 4JF5A 3QNCA 2HDUA 2HP5A 5KSHA 1Q2QA 3PBNA 5CHJA 1ZC2A 1LLBA 4WEJA 1K55A 3IWIA 2XFTA 5FAPA
chains in the Genus database with same CATH superfamily
3MVDA 3MGPB 1S1ZA 2WKPA 3REKC 3VH5W 2EX2A 4ARZA 3DWKA 5DFYA 2OLVA 2G2WA 4H9PB 1UWNX 4DJ3A 5F6AA 5AV5C 3SZTA 2J3WA 2OSUA 3LIFA 5HFOA 4N9KA 3HJIA 4XZQD 1P3AD 4GJ4A 5FI6A 4UEYA 5CRFA 4OP5A 3AZJD 2E8IA 3LY3A 3WKJD 4O01A 1G6OA 4OLDA 4XT2B 4GDBA 1ES4A 3JVUA 3QP1A 5KZHA 5CP6C 4GZBA 4X1LA 3BFCA 4R8PD 3JVVA 3WWXA 1IFQA 3VFHA 2HIOD 4XUJD 3B6FB 3AZMB 3AZIB 3AZEC 4FCFA 4Y17A 4DJ2A 3R4KA 2VGJA 1K57A 5AY8C 5B1MA 4ESPA 2JHEA 5F82A 2V8CA 3QNBA 4EO5C 1FCMA 1FR1A 2YFVB 1K57C 2ZQDA 4QD4A 5KDMA 2Y79A 4Z2MH 2KOIA 5CPIB 1BLSA 1NRJA 4KG5A 1S0WA 3CLOA 4UHUA 2GNXA 3ZG7B 2JKTI 3E0YA 2CV5C 3N3FA 1G5UA 5HX9A 1BULA 4OONA 4HH2A 5A90A 2CWEA 4Z2JA 2XD5A 1P3KA 4QWOA 3MQQA 2Q9NA 3A0VA 1P3KC 4H8RA 2UWXA 1ONHA 4EQIA 4P87A 1STZA 1OTDA 1NRFA 3AN2A 2OWJA 1O07A 1P34A 4JBFA 5K5BA 4JF4A 3OC2A 4DE1A 3BFGA 3AV1B 4IBGA 5B1MD 5B2JC 1IYQA 5HAIA 3REJA 4ZTKA 3IP4C 4MMNA 5JRGD 3EGDC 5HSQA 5AVCD 3REJC 1W5DA 3AZND 1YT4A 5FQIA 4Z5TA 3LIBA 4YWZA 4Y5FA 1SKOB 2O9AA 4OOYA 1M18B 1VHMA 1WA9A 3WTPD 3ITBA 3VH5A 4R23A 1ESIA 1KX4A 3IX3A 3C4PA 2DRWA 5B33A 1P3BA 1P3OB 2ACGA 5CEDA 1OT9A 1SHVA 5EV0A 3GQZA 4UUZA 5GT3B 3MGRD 1KX4C 3IS2A 4KUDA 2W1TB 2JSSA 1BUEA 3X1SD 1JTDA 2K7SA 1GOIA 4KUDC 1EW0A 3C8CA 3F1NB 5GLAA 4ZBJC 4GN2A 5FUGA 2L5AA 1JVJA 5FEFA 5DNNC 3C7UA 5DTSA 2BYKA 4J8VA 5E2HA 1ONGA 3H82B 1BYWA 1FCOA 2PAVP 3REHD 1BLCA 4J8VC 3F1OA 3HREA 4U0TA 4N1XA 5FQMA 3RFBA 1U35B 2GJ3A 2XH9A 2HDSA 4Y0OA 5M19A 5B40D 3B6GD 3W8KA 1KX3B 2WKEA 3IF6B 2RL3A 2G5IC 5FSRA 3W97A 4E3JA 1U60A 2X02A 1YPRA 1TZYB 3W98A 4LGWA 3T1SA 4MN6A 3KS8A 2L0WA 5B31D 1P97A 3SS4A 4WJ3C 3G30A 4HGAC 3M2JA 4WNNB 4PHTA 4MB3A 1MWSA 5KIZA 3WA9D 2VV8A 4I3IA 1ZLAD 1TS8A 3WS4A 5HZHA 5CTMA 3P09A 3ULFA 3S22A 1BFMA 3LGOA 2PU4A 5L10A 1ZTUA 2FFYA 2PHYA 1Y28A 3KXBD 4O0PA 3MKEA 5CPJD 3NIAA 3V9RA 2R78A 1P3PD 2Y2JA 3H0LC 3CZDA 4GNUA 4KZ9A 4WU8D 2NUPC 3E4PA 4Z2GA 3Q7VA 5A91A 4WZSB 3G35A 5EVIA 2VQRA 3AV2A 5E5AC 5GSUA 1FR6A 4CLCA 2L1MA 2BASA 1YMSA 3BECA 3UE0A 3LELB 5EVIC 3W97D 4ZJ3A 3M7PA 5AQ9A 2KDKA 1OTBA 5FI2A 4IJEA 3HLEA 5GSUC 5A92A 4G91B 3W98D 3CJMA 3UY6A 4XUXA 1K56D 1D7EA 4OVDA 3SOIA 5C3IB 4Z66A 4GHIB 4F3LB 3A3IA 2QMIA 3X1VA 4NFTA 3MXQA 5GLBA 2ZL1A 3NQJA 5BO0B 4GH9A 4IVKA 1SZVA 1ES2A 3TW8A 3S7OA 1P3OD 4MBKA 2V5OA 3OPPA 5D3OA 1NLZA 1ES3A 1N4OA 3ZNTA 2XF3A 1GSWA 1P3MC 2AROD 4OJLA 3MGSA 2JKRI 3IX4A 3T4OA 1KX5B 3AFAA 3AZKB 5J3WA 3L27A 3VP2A 1L2SA 2UV0E 4H9RA 1F66B 3BJNA 2V8FA 1AWIA 3D4FA 3X1TB 3V67A 4WMCD 3D9YA 2YFWA 1U35D 4UPKA 4GW9A 5BNXB 2ZM0A 3W2ZA 3MS6A 3X1UD 5HD5A 1YSQA 3UB9A 1ULYA 3X1VD 5F1GA 2QHKA 3MNNC 1MKIA 3MBZA 2PRFA 4PKYA 4JJNB 5KSCA 2WAFA 4HNBA 2OV5A 5A8BA 3TOIA 3ZG0A 2VX8A 3PYPA 4MB4A 5DNMD 1E3UD 3CUEA 4WZ4A 3K3DA 3WAAC 3UTAA 1LL9A 1MWUA 5B0ZB 3PTEA 5BNVA 3IWQA 3QP5A 2WYXA 4OJOA 4GHAA 4C75A 4R6LA 2Y2QA 3AYWA 3TU4B 1BLPA 4GDNA 3EG5B 3L29A 2EXBA 3MGQD 3AYWC 3DWZA 2W27A 3AZHD 1AXBA 4DQYB 3WD4A 2EX8A 2NQBC 4E3LA 3W96D 4G92C 4NXBA 1V9YA 1J7MA 3LZ0D 1N9LA 1ZG6A 5B32A 4KGCB 3LEZA 5AV9A 4YOFA 4IJGA 2NZDA 2HDQA 4JF6A 1KS0A 4CSRA 3LY4A 2INWA 4QLCB 2D01A 5AV9C 1O6IA 1IKIA 1DJAA 5TGFA 4R0QA 2FJ7D 3MXRA 3NULA 3UPPA 4OOMA 4Z1WA 2G5HC 5HAQA 4X23A 3Q1FA 3UTAD 5AV6A 2H10A 1BLHA 3REIA 3KWQD 3VH6T 4UA9A 3AZKC 3LFVA 5HD3A 4PM6A 5DF9A 2HDRA 5EVLA 2ZY4A 5CPKA 1H3OA 4J8WD 3Q07A 3IWOA 4LG2A 5IHVA 2Y2GA 1MY8A 4G3VA 5FA7A 2JKGA 5GXQB 5CPKC 3SH9A 3UT9A 2ZQ8A 4Y13A 4KG6A 3W4PA 4FTXA 3LI9A 5B32D 1JFIA 3RTYA 3EEAA 1KX5D 3UT9C 5B24B 3AZFC 1P3GC 2LY8A 3GSGA 3LR5A 3ZGAB 1KVLA 3LIDA 1E6PA 1N9NA 3O62B 4IBJA 4ZUXD 2ZQ7A 1LT0A 2HP6A 2DQNC 3VH6W 1KGGA 5FQJA 3KSYA 3F1PA 1TD5A 4Z2IA 1TS7A 2Z2MB 3M6BA 2IA2A 5G49A 4X23D 4WBGA 1M1AA 3EPHA 2XK1A 4Y0TA 1H0IA 5AV6D 1PI4A 2IWDA 2HDUA 2HP5A 3PBNA 3REID 4WEJA 1K55A 3NQUA 4IBEA 4CLCE 5FAPA 4KQQA 1M19B 3HSHA 1FIKA 3RELB 3A6ND 3C1BA 5C5KA 3CHWP 5AVBB 1K55C 3LICA 5DKKA 4R4SA 3T4KA 5B0YB 4J8UD 1IYOA 2QPNA 3C1BC 3HLBA 3TU4D 1P3FD 1PW8A 2HF6A 1YLTA 4S2LA 1YAXA 4J8XC 3C1CC 4KZ3A 5F83A 5TBMB 5DJUA 1P3AB 5L07A 5HDDA 2H28A 3L25A 3GDIA 3AZJB 3WKJB 1M1AD 1GA0A 3FKWA 4R8PB 2O9BA 3CAXA 4OPZA 1CEGA 2ZC7A 5AV8A 1ID3A 3T4TA 5HW3A 4ZRRA 2X01A 1A0KA 3HUMA 1LHYA 5DF7A 1W63M 4KZ7A 1XX2A 1LL5A 3B0DB 4Z9QA 3W99D 2P9VA 2IWCA 3P98A 4OH0A 3DAVA 2EX9A 3MVDB 1KGFA 4I3AA 2WGIA 4B88A 3SH7A 2Y2PA 3PXPA 1LSWA 4IHQA 5F68A 3ICYA 4HY8A 3ZFZA 2EFXA 3LIEA 2F8NK 2B18A 4L0LA 2HPBA 2XRNA 3T4SA 5EM0A 4HJ4A 2ZLYA 4IBFA 2V0WA 1EQZD 3BYDA 4QHCA 4WV4B 4LRXC 5B24D 1KVMA 3ZG8B 3P01A 5F99C 1XPBA 1ID3D 3LJAC 3O62D 3NDGA 2RVQD 1HQ3A 2J3TC 1IYSA 1P3IA 3JPUA 4QB8A 3PHYA 3HLCA 3VH5T 1UWPX 5B1MB 1PZPA 4MB5A 1HQ3C 4JKTA 1P3IC 2HUEB 4OJPA 2IO5B 5B1LA 3QP2A 5HARA 4IBRA 5AVCB 2MJ6A 5B1LC 4KZ8A 3LZ1D 3C4OA 3AZGA 4YS3A 3IH9A 4I39A 4XZQC 4Z2LA 4C6YA 4YM6A 5CGXA 3REKA 4YS3C 2ZOHA 4OQ0A 1S32C 1S66L 5B0YD 4P6ZM 4LV3A 3N6IA 5AV5A 4YM6C 1Q9CA 3BFFA 1L0GA 1K54C 4WZ5C 3VP0A 3MGRB 1DJBA 4UQIS 3X1SB 3VP4A 3O5YA 5GHYA 2IOUA 2HIOC 3AZLD 4XUJC 3OBFA 1AOID 1P3LD 2ZOIA 3AN2B 4PAUA 1P34B 4OUIA 3IXHA 5JA4A 4LD9A 5CP6A 1F9IA 3Q82A 2XLNA 4LCLA 4DE0A 4LD9C 1D06A 3REHB 3AZEA 3PBQA 1XJ4A 1LI9A 3EQUA 5AY8A 3B42A 3OLOA 5CTNA 3KUYD 5EFWA 5B40B 4Z5TB 3B6GB 2GZAA 3UTBA 4WU9D 2PYOA 3NOTC 5B2IC 4NE6A 1S1YA 4H9QA 3UTBC 3VP3A 2PYOC 3BW6A 3M6HA 2CV5A 5B33B 3NCKA 1P3BB 1ERMA 4QU3A 3MVDD 5AV5D 4Q0IA 3TSGA 3ITAA 1UGUA 4L9EA 5B31B 3EPJA 2QZ6A 3MQLA 1J3WA 3IT9A 4P85A 1E15A 3WA9B 2O99A 3WD3A 4ZAMA 3G31A 4D60A 4KQDA 4IBIA 4LV1A 4R70A 4KUKA 4EU0A 1ZLAB 5GT0A 5HAPA 2ZBBA 5CP6D 1BH9A 2F8NG 2BYKB 3CITA 4FOFA 4CAYA 3KXBB 5GT0C 5CPJB 2F2AC 3ZDJA 3PR6A 3AZED 5JRGC 1P3PB 3F1OB 5G4ZA 4WU8B 3AZNC 1WE4A 5AY8D 1IEMA 4OPYA 3ZG5A 5B2JA 3A3EA 3RXXA 1ODVA 2Y2KA 1F98A 2PD8A 3RXWA 4HMCA 2GX5A 1MZUA 3VP1A 4BJPA 5G4YA 3NDEA 3WTPC 4CQHA 4BBVA 4YFMA 3W97B 1P0ZA 4AWLC 3BLSA 3W98B 1TDGA 1FSWA 3MGPC 3PAEA 4EWFA 1MBLA 2BYMA 3O3VA 5AQBA 1YLWA 1YLYA 4Y15A 1LL8A 1T18A 4M6BA 4E44A 3G2ZA 4K0WA 5F69A 1DP6A 3G2YA 1PI5A 1H8PA 3MZEA 5U47A 1HZOA 2BLSA 1P3KD 5EVEA 1SDNA 3P7NA 2HZ5A 3B6FA 1FSYA 4BL2A 3AZMA 3AZIA 3OCNA 4II7A 2AROB 5DNNA 2WZXA 3WD0A 3B6FC 3AZMC 3AZIC 4DXCA 3AN2D 1P34D 3BY9A 3IBRA 4M3KA 3AV2B 5CHLB 4Y2FA 4CLCB 3UMEA 3PBRA 3AGDA 2ZC3B 5DF8A 5CPIA 3LR0A 3CPTB 4S2PA 1CEFA 3REJD 4O8GA 3UB5P 5CPIC 2PDRA 2JKFA 3PAGA 1VETA 1NXYA 4Z5TD 3T12B 4Z66B 3BM6A 4H9NB 3X1UB 2WGWB 5EOOA 2QJ5A 3D3OA 3X1VB 1TAFB 2OLUA 4QY6A 1NZOA 2KX6A 1F2KA 2AVXA 4LLOB 1KX4D 2ZM2A 4LPZA 1GSVA 1XXMA 5B33D 3G4PA 1P3BD 1K38A 2LB9A 2Y2HA 1FOFA 3UB8A 5DNMB 4KUDD 2OOLA 2G7UA 5G18A 4NZ1A 4WU8C 3MQ0A 5L8MA 2K2NA 5DNND 3N7WA 3L7HA 2DMWA 3KSIA 3MGSB 3R7WB 3SH8A 3AV1C 2JBFA 4J8VD 1GHMA 3MGQB 3AFAB 1E6RA 2FZ0A 2J8YA 3OOVA 3AZHB 1RGYA 1SKOA 1TF1A 1ZKJA 4PMAA 2JE5A 1M18A 5E5AA 3W96B 1EAKA 2D49A 2YFWB 3LZ0B 3MQOA 1M18C 3AGFA 2WAEA 3IQAA 3C38A 1JTGA 4MCWA 1PW1A 3MXSA 5GL9A 1K4FA 5FQ9A 5GT3A 2W1TA 1H5XA 1KU5A 1P3OC 1G68A 5FAQA 4LCMA 2FJ7B 2A24A 5J7EA 4XUZA 5GT3C 3ISGA 4JGOA 2C6WB 3T4QA 4IBDA 5TFQA 2ZY2A 4H9SC 3UTAB 5BNVB 2VEAA 4DF6A 3HJKA 1N1JA 4JXGA 4DRAA 4ME4A 3KWQB 1YMXA 2A2LA 2ZY5A 1P3MA 3B0CT 4J8WB 2XROA 3H7WA 4EQ1A 1KX3A 4NEED 2Y2MA 5E5AD 1U35C 2H5SA 3GV9A 2CC1A 4DDYA 1KX3C 5EVID 5B32B 3IF6C 3AV2D 4BMWA 5GSUD 2NZDB 4CLCD 4OQIA 2ZQAA 3HUOA 4CSRB 2O0YA 1KE3A 1TZYC 1VM1A 4HP9A 4ZUXB 4WNNA 1C3BA 4YINA 3UN7A 4OJ5A 3MNNA 4Z2HA 3QNCA 5KSHA 3B0CW 4Z66D 1ZC2A 4X23B 4YNRA 3IWIA 5AV6B 2J9OA 1JWZA 5TJJA 4DRTA 3REIB 3WAAA 4NXEA 1P3MD 3A6NB 1XFQA 3A3JA 4G3WA 2F8NH 2J9PA 1XGJA 4J8UB 4HQAA 1HVBA 3MGSD 1GXDA 3E2KA 3LELA 1P3FB 2M7UA 3BFEA 1TEMA 3IXGA 1JFIB 3KSFA 4B4XA 4S2IA 1ALQA 3AFAD 3LELC 2NQBA 3LYXA 5DTKA 1KGEA 4GHLA 2KLIA 3GVBA 3LR4A 4G91C 3B47A 3WS2A 5DTTA 1M40A 4F3LA 3VOLA 3U4LP 1H3QA 5C3IC 1MC0A 4X55A 1DP8A 3MNND 1MWTA 3VOYA 3VMAA 1M1AB 4HIAA 4EEPA 1DRMA 4L9GA 1XGIA 3LR3A 1FILA 3VSKA 4OQGA 1R4VA 3NY4A 1X0OA 2M1CA 4WEKA 2VZWA 1YLPA 1LI0A 3BFDA 4E6XA 3DTKA 1LSXA 3NI9A 1E4DA 4NZ5A 1GCEA 3AGEA 3MFXA 3W99B 4PM9A 2QYBA 3AZKA 4BWIA 4R4RA 5AVEA 3AYWD 1P9RA 5AQAA 3A1IA 1W79A 4EBPA 1KX5C 1PIOA 4IVIA 4N92A 5CHMA 3GRJA 4E6WA 1F66C 1G6AA 1YU3A 1GHPA 5BNXA 4H6JA 1FQGA 3X1TC 1DY6A 1S6RA 2PYPA 1S4SA 1KE4A 3AZFA 1P3GA 2PR6A 4IJFA 4NYYA 2VGLM 1EQZB 1E25A 3ZNYA 4JJNA 5AV9D 3HLGA 3KSGA 2NZDD 4LV0A 4HMEA 1W1VA 3C7VA 4JXWA 4LRYC 4KENB 5AV8B 4JJNC 1ID3B 4X25A 5HL1A 2A49A 2ZQ9A 2PT7A 4PPRA 4IBCA 4NETA 5FAOA 1MWRA 3FPWA 5B0ZC 3DTMA 4ETZA 4KZ4A 1LSVA 3TU4C 4S2KA 4RVAA 1NYYA 3O86A 4E45A 2OAQ1 1F5MA 2EWVA 3LZ1B 3UO9A 3KFUG 1ACFA 3I7JA 3BRMA 5CPKD 2G2UA 3KYQA 4EBLA 5F1FA 1H0MA 4U3TA 2A3UA 4KGCA 3SW1A 1ESUA 1QO6A 4J8XA 1IOUA 3UT9D 3C1CA 1SCWA 3AZFD 1P3GD 2E8JA 3EWKA 4QLCA 4KGCC 3HCYA 5FDHA 4OOLA 2PBYA 1TS0A 3V5MA 1L6JA 1KOUA 3KO6A 3S7NA 1YU0A 4KG2A 3A3DA 4QLCC 1Y4OA 3AZLB 2RIQA 1AOIB 1H0GA 1ES5A 4RX2A 3WX7A 1P3LB 3WS0A 3MMHA 3NOPC 4GS9A 1YU2A 2VKSA 1WYBA 4JLFA 1ERQA 2P04A 5GHXA 3BQAA 4HI4A 5BT1C 5IT5A 5FI7A 1GSXA 4JGQA 3U2AA 4HJ3A 4RYEA 4E04A 3UE6A 2VV7A 4BL3A 3QP4A 4HHDA 3KUYB 1PRQA 4S2NA 4JXVA 4EXOA 1CJFA 4P6BA 4WU9B 3AZGB 5GXQA 2ZM8A 2VGLS 4CJNA 4S2NC 3C1BD 3REKB 2LB5A 3N8SA 5GXQC 5J4EA 3BY8A 4J8XD 5AV5B 2XDMA 2WKRA 3M2KA 4ARZB 3S7QA 2X71A 5B24C 5EOEA 2HGVA 3GR2A 2B5RA 3L26A 4HESA 2YKFA 3KS4A 3A0SA 1TDLA 3O62C 1T1BA 3GTCA 2RVQC 3SS3A 2I9VA 2P7JA 3FZCA 4K0XA 1YU1A 4GD6A 5CP6B 4MDZA 1B67A 1JWPA 4EUZA 5F99A 3DTEA 3B33A 3LJAA 1B6WA 4EERA 4RQ9A 2ZM5A 3AZEB 2PBDP 2W3GA 4WLAA 2WKHA 3E98A 2JC7A 2EXAA 3HLDA 1M19A 5E2FA 5AY8B 3RELA 5AV8D 5HWTA 5LBRA 5M1AA 4EEUA 5AVBA 2VGKA 4FUWA 2P74A 3BQ8A 5GLDA 4EO5B 2B02A 3UE3A 4U0XA 1M19C 2B95A 3RELC 2XFSA 5CGSA 3E4OA 5AVBC 1D1JA 4H9QB 2OWHA 1KE0A 5HPIA 1GPFA 1T1AA 5B0YC 3DTIA 2H0TA 1YU4A 4KZ6A 4EBNA 3V3SA 2CV5B 5KDMB 1SDEA 3UPNA 3HONA 4MNRA 3SS5A 4BENA 1L3LA 1W1TA 5TBMA 4XZQA 1P3AA 4DRBA 3LO7A 3A0RA 1K25A 3WKJA 1S32A 3UDXA 2Y2IA 3V3RA 4FH2A 4DE2A 4E3IA 1P3AC 3HLWA 1P3LC 4H9OA 3UMDA 1K54A 3CG5A 4WZ5A 3AZJC 4BD1A 3WKJC 3OPRA 3KYZA 1BH9B 1P3KB 4R1GA 4NXFA 1Q2PA 2HIOA 4KHAA 2Y59A 4CAYB 4XUJA 3ZVTA 5F99D 3N8LA 2WGVA 4R8PC 3LJAD 1PZOA 1E88A 3EEHA 2QWSA 5IU1A 4OJ6A 5B2JB 2Y4AA 1HQ3D 2HJEA 4WU9C 1IKGA 2CMNA 1P3ID 1WWSA 3JYIA 2Z2LB 2WUQA 1VEUA 3B3XA 2JKRM 3S4XA 3B0DC 1H8ZA 5FL3A 4D2OA 4IBKA 5HWWA 3REJB 3V50A 1H8MA 1HLUP 5B1LD 3MVDC 3CWFA 1N9OA 2V1BA 4X69A 2BYMB 5HDCA 5B2IA 3D72A 1YSPA 3AZGD 4YS3D 2Y2NA 3BWLA 1NWZA 3PBTA 1S32D 4ZJ2A 5AQ7A 3E4QA 4YM6D 2F8NA 5I94A 3REKD 3GMWA 1KX4B 4NG2A 1BH8A 3L2AA 4UUZB 1V9ZA 3IS2B 4KUDB 2K31A 3V39A 5BS7A 4JGPA 4ZBEA 4ZBJB 4LRZE 4B4ZA 3B0BA 4BLMA 3C5AA 3H9WA 5DNNB 5CXWA 1H8YA 3H0RC 3LCEA 5BS7C 4S2OA 4PM7A 5EM1A 5FUGB 4LD9D 3R45A 5B1MC 4J8VB 5JRGA 4ZDXA 5EPHA 1S67L 2Y2OA 2XR0A 3G34A 2M7VA 5AVCA 1YM1A 3AZNA 2HUEC 2IO5C 4OLGA 4JPMA 3VE3A 1YKDA 5AVCC 4HBTA 4I5SA 3VFFA 1QMEA 3FG8A 3WTPA 2WKIA 1VETB 3EQVA 4MBHA 5B2ID 2EA9A 1XJ6A 4P6ZS 3ZQ5A 3UTBD 1AIWA 4HOIA 3UE1A 4NK3A 2D02A 2PYOD 5E43A 4WN5A 3MGPA 4UA7A 1PWDA 3MGRA 2F8ND 4ETXA 4FSFA 4NY2A 3L9KA 1OPXA 5E2EA 4H9PA 2CV5D 3X1SA 3OPHA 4HGAB 4EESA 4EUVA 5HWVA 1Z6FA 3LIAA 3MGRC 2L4RA 2ZMFA 3VSLA 1YQSA 2P08A 5DKLA 4E3OA 3X1SC 4MLLA 1RGZA 2Z6DA 3BEBA 3FPVA 4UA6A 3G6OA 4KZ5A 4XT2A 1NY0A 3ZVWA 3AN2C 3BLMA 1P34C 1CQAA 1M6KA 3REHA 3FWLA 5GT0D 1Y54A 1XP4A 4NZ4A 4E3MA 3REHC 5B40A 3B6GA 3IXBA 4F94A 3V9RB 2VJWA 3HLFA 3NHQA 4HH3A 3VOZA 2PU2A 1OTAA 3OCLA 1VB6A 3O88A 4P0MA 5E5AB 3IHBA 5B40C 4Z5TC 3B6GC 3Q7VB 4OPQA 3T1QB 5B2JD 3N8RA 3UPOA 1DP9A 2PR5A 5EVIB 2XGNA 2YFVA 4HMDA 1J9MA 1K6RA 5GSUB 4NE5A 1W7FA 3T50A 2EX6A 3TRCA 3MGPD 1QMFA 5B31A 4WM9A 4JF5A 1Q2QA 5CHJA 1LLBA 5B33C 1P3BC 4M4XA 4OPRA 2A24B 5B31C 3WA9A 3WD1A 4K91A 1Z09A 2RCXA 4LENA 1OT6A 1ZLAA 3CI6A 2ZC5B 3W4OA 3FDDA 5BPVA 4GCZA 1W8QA 4EV4A 2GDNA 5J8XA 3WA9C 3IH8A 4DDSA 3ZYTA 1ZG4A 1N1JB 3OZHA 1PYYA 2XD1A 5FATA 2FFFB 3KXBA 1ZLAC 1OTEA 2ZL1B 4ID4A 3NQJB 5CPJA 3RJUA 1KDWA 3NECA 3QP6A 4Q0HA 3T1XA 2O9CA 5B31G 1P3PA 1HTZA 4WU8A 3KXBC 1P3MB 3TJZC 4FH4A 3ZHHA 2XSSA 5CPJC 2W8SA 3B6FD 3MFDA 4X53A 3AZMD 5L2FA 3AZID 1P3PC 1ZHHB 3H7WB 3UB6A 1SKFA 1CI9A 1WYCA 3AV1A 3EPKA 2VK3A 1I2WA 4IUHA 4WYYA 1MKMA 1IELA 3N4IA 5CGWA 2QKPA 3S7PA 5CPID 1OJ5A 4MN5A 3W97C 3A3FA 1K56A 4B9OA 4H9RB 1I5QA 3W98C 2Z6CA 2J7VA 3NOUC 4A5RA 4K08A 3FV7A 2V0UA 4BD0A 1NZUA 4BBUA 2VA0A 4GD8A 4DMZA 3MNNB 2XA7M 1I2SA 2Q9MA 4Y0UA 3T4JA 3UDFA 1P3OA 3F6TA 2Y8HA 3MF0A 3NC8A 1HTAA 4Q0JA 3PBSA 3WAAB 1EROA 4H9SA 1L0FA 2AROA 2IWBA 4X56A 3FKVA 5HDSA 3F1NA 3HVFA 4CPKA 5FASA 1ED7A 2AROC 4NZ3A 1GA9A 3AV1D 3H82A 3CPTA 3AYWB 3AV2C 4CLCC 4GKUA 1PNEA 3HUNA 4N9LA 3WS5A 4WMCA 2NQBB 1T19A 2JCHA 3H0MC 1U35A 4G92B 4UAAA 3UB7A 4E3NA 2W3FA 4H9NA 3X1UA 1K4EA 4RX3A 1M18D 2WGWA 5I5LA 3IF6A 4WELA 5EE8A 1G28A 4QJGA 1TAFA 2V20A 3UNWA 4Z66C 4EETB 3X1UC 1TZYA 5AV9B 4GLQA 1W2EA 1BSGA 5CEBA 3X1VC 3TE8A 4C3QA 2VLGA 1MXOA 5GT3D 5DNMA 1E3UA 1L0EA 3MZDA 4NYUA 5FQQA 2V1ZA 4KQRA 3QP8A 5DNMC 3R7WA 4WF0A 4KQOA 3MGSC 4TX8A 3MGQA 3DW0A 5JYOA 4LV2A 5AJGA 3WTPE 1TVFA 1W1PA 3FYZA 3AZHA 3O87A 1S4RA 4I3JA 2W3EA 4Y7PA 3MGQC 3AFAC 1N9BA 2R9WA 3W96A 4MBFA 1O7EA 3LZ0A 5CPKB 3AZHC 2XA7S 3MZFA 1H3OB 4H6JB 2V9AA 4PM5A 1XJ3A 1KX3D 3W96C 1MPLA 3MKFA 1YLZA 3LZ0C 4NE3A 3UT9B 3AZFB 1P3GB 3HL9A 4GOGA 2ZC4B 4MEZA 1TZYD 2PYRA 2FJ7A 1YUEA 1TS6A 4I38A 3MSHA 4GHIA 2FJ7C 1CXWA 2BTFP 4IBXA 3CUEC 3F1PB 3UTAC 5GHZA 5BO0A 5G49B 3WRZA 3L28A 3KWQA 1XA7A 3KX0X 4PKYG 1W1YA 3ZG9B 3KWQC 4J8WA 4KUOA 4DKIA 3WAAD 3NQUB 3K3CA 1NJ4A 2ZY3A 3WS1A 3ZCZA 4J8WC 1BTLA 3C1BB 4DXBA 1WWIA 2Y91A 3UDIA 3C2WA 1KX5A 4J8XB 2WZZA 2WADA 4PM8A 3C1CB 3EOIA 2PD7A 3LELD 5B32C 1F66A 3Q81A 4R3JA 2NZDC 3K2NA 4ZUXA 3X1TA 1OMEA 2OAP1 3IF5A 4L9FA 4OP8A 2NQBD 4WL9A 4MN7A 2JKTM 4R38A 5E2GA 3KYEA 5A93A 3GECA 2Y2LA 2ZD8A 3W4QA 4ZUXC 1HD8A 1Z2CB 2ZMAA 4GS9B 5FEGA 4KZBA 1CK3A 1F1EA 1BT5A 5B32G 1CK7A 2J80A 4X23C 1CF0A 4LFUA 2V2FF 3IHAA 5AV6C 1L0DA 4B93A 4IEDA 4Z2MG 2JN7A 5JYPA 4X6TA 4HJ6A 3REIC 3A6NA 2YKHA 1XFNA 4HEFA 5B0ZA 1E6ZA 2Q0OA 4DE3A 5FQKA 4J8UA 3A6NC 3G32A 4HBUA 3AL0C 1E8BA 4E3KA 3HBRA 3TU4A 1P3FA 1K0KA 3QHYA 2P9VB 1UR9A 1OGGA 2W3DA 4J8UC 3WD2A 2XEPA 3AZKD 1P3FC 1OTIA 2FN2A 4EW7A 1UR8A 1F66D 3NJAA 4OKPA 3X1TD 3LEQA 1IYPA 4RA7A 3T4LA 1FCNA 2NUTC 5HPFA 2FH5A 2W0NA 4S2MA 4IBBA 5M18A 1YLJA 4OQHA 1M1AC 3MR0A 5F99B 1OJGA 4JJND 1PWGA 2HV1A 3WRTA 3LJAB 1VQQA 4WUJA 4N1HA 3P5JB 5DJTA 1DJCA 2ZJ9A 1P9WA 4QNLA 3W99A 1HQ3B 1E6NA 3CMZA 3VV4A 5B0ZD 1P3IB 2EWWA 5IS1A 4Q8IA 1EI5A 3W99C 1NLYA 4ZJ1A 5EUAA 4G3KA 2WK0A 3A1KA 5B1LB 1RP5A 2Y55A 2XQZA 3E2LA 1NYMA 3LI8A 5KMWA 5CX7A 4XZQB 5CHUA 4AFIA 1GHIA 3IX8A 3C30A 4X1MA 4YS3B 1JWVA 1S32B 2DNSA 4IUKA 4NXGA 3FKEA 4H9OB 3IBJA 4YM6B 3VE4A 1EQZA 1T1CA 4FD8A 4KGCD 1PDCA 5B24A 5FDSA 5DVAA 3C1CD 1EQZC 4DN0A 2DCFA 2HIOB 4QLCD 4KHAB 5DFXA 4XUJB 3O62A 4GB7A 4R3AA 5F5YA 4X68A 4R3BA 2RTSA 4UQIM 5AV8C 1ID3C 1OGBA 3NBLA 1T3UA 1PZRA 2J8PA 2DF4C 4NKPA 5BT1D 2HJ9C 3DBAA 3T1RA 5JA4B 4LD9B 3S1YA 1EWZA 1BZAA 1VEUB 1PFLA 4QPRA 4BBTA 2WKQA 5AVFA 2HP9A 3LZ1A 2ZC6B 2R9XA 3KSHA 3Q7ZA 2V1AA 5CECA 1A7WA 5B2IB 1XKZA 3EGXC 3LZ1C 4JGRA 3UTBB 4Y3IA 3MJQA 2I72A 2PYOB 5B0YA 5GXQD 1KDSA 5HL6A 1W8YA 2F8NB 4QY5A 5EECA 2H0YA 2QJ7A 1PWCA 4S2JA 1BH8B 3VH6A 2C5WB 3AZLA 1AOIA 1K6SA 1P3LA 2ZQCA 1CI8A 1XA1A 4KZAA 3AZJA 2VV6A 3PBOA 3OPLA 3FC7A 3AZLC 1AOIC 4BQMA 5BOHA 1XJ2A 3IXDA 3RH8B 5TR7A 4Z2KA 5GT0B 4R8PA 1RCJA 2ZMVA 3R45B 2BG1A 5JRGB 4HP4A 5MC7A 4JXSA 5GLCA 3KUYA 3AZNB 4XXRA 3LUQA 2EFUA 4O7DA 4WU9A 2J3TD 3TG9A 3KUYC 5CERA 1W63Q 1M19D 2W3HA 3RELD 3WTPB 1JNUA 5L09A 5AVBD 3EPLA 3AZGC 4AWLB 2W1RA 2XFTA
chains in the Genus database with same CATH topology
3MVDA 3MGPB 3REKC 3VH5W 2EX2A 3DWKA 2OLVA 2G2WA 4H9PB 5AV5C 2OSUA 5HFOA 4N9KA 5FI6A 4XZQD 1P3AD 5CRFA 4OP5A 3AZJD 2E8IA 3LY3A 3WKJD 4OLDA 4GDBA 1ES4A 5KZHA 5CP6C 4GZBA 3BFCA 4R8PD 3WWXA 3VFHA 2HIOD 4XUJD 3B6FB 3AZMB 3AZIB 3AZEC 4FCFA 2VGJA 1K57A 5AY8C 5B1MA 5F82A 3QNBA 4EO5C 1FCMA 1FR1A 2YFVB 1K57C 2ZQDA 4QD4A 5KDMA 4Z2MH 5CPIB 1BLSA 4KG5A 1S0WA 4UHUA 3ZG7B 2CV5C 3N3FA 5HX9A 1BULA 4OONA 5A90A 2CWEA 2XD5A 1P3KA 2Q9NA 1P3KC 4H8RA 2UWXA 1ONHA 4EQIA 4P87A 1NRFA 3AN2A 1O07A 1P34A 4JBFA 4JF4A 3OC2A 4DE1A 3BFGA 3AV1B 4IBGA 5B1MD 5B2JC 1IYQA 5HAIA 3REJA 4ZTKA 3IP4C 5JRGD 5AVCD 3REJC 1W5DA 3AZND 1YT4A 5FQIA 4Z5TA 4OOYA 1M18B 3WTPD 3ITBA 3VH5A 4R23A 1ESIA 1KX4A 3C4PA 2DRWA 5B33A 1P3BA 1P3OB 5CEDA 1SHVA 3GQZA 4UUZA 5GT3B 3MGRD 1KX4C 4KUDA 2JSSA 1BUEA 3X1SD 1JTDA 4KUDC 5GLAA 4ZBJC 4GN2A 5FUGA 2L5AA 1JVJA 5DNNC 3C7UA 5DTSA 2BYKA 4J8VA 5E2HA 1ONGA 1FCOA 3REHD 1BLCA 4J8VC 3HREA 4U0TA 4N1XA 5FQMA 1U35B 2XH9A 2HDSA 4Y0OA 5M19A 5B40D 3B6GD 3W8KA 1KX3B 2WKEA 3IF6B 2RL3A 2G5IC 5FSRA 3W97A 4E3JA 1U60A 2X02A 1TZYB 3W98A 3KS8A 5B31D 3SS4A 4WJ3C 3G30A 4HGAC 3M2JA 4WNNB 1MWSA 3WA9D 1ZLAD 3WS4A 5CTMA 3P09A 3S22A 1BFMA 2PU4A 2FFYA 3KXBD 3MKEA 5CPJD 3NIAA 3V9RA 1P3PD 2Y2JA 3H0LC 3CZDA 4GNUA 4KZ9A 4WU8D 3Q7VA 5A91A 4WZSB 3G35A 5EVIA 2VQRA 3AV2A 5E5AC 5GSUA 1FR6A 1YMSA 3BECA 3UE0A 3LELB 5EVIC 3W97D 4ZJ3A 5AQ9A 5FI2A 4IJEA 3HLEA 5GSUC 5A92A 4G91B 3W98D 3CJMA 3UY6A 4XUXA 1K56D 4OVDA 3SOIA 5C3IB 4Z66A 3A3IA 2QMIA 3X1VA 4NFTA 5GLBA 3NQJA 5BO0B 4GH9A 4IVKA 1ES2A 1P3OD 4MBKA 3OPPA 5D3OA 1ES3A 1N4OA 3ZNTA 2XF3A 1P3MC 2AROD 4OJLA 3MGSA 1KX5B 3AFAA 3AZKB 3L27A 3VP2A 1L2SA 4H9RA 1F66B 3D4FA 3X1TB 4WMCD 2YFWA 1U35D 4UPKA 5BNXB 2ZM0A 3X1UD 1ULYA 3X1VD 5F1GA 3MNNC 1MKIA 3MBZA 4JJNB 5KSCA 2WAFA 2OV5A 3TOIA 3ZG0A 5DNMD 1E3UD 4WZ4A 3WAAC 3UTAA 1LL9A 1MWUA 5B0ZB 3PTEA 5BNVA 3IWQA 2WYXA 4OJOA 4GHAA 4C75A 2Y2QA 3AYWA 3TU4B 1BLPA 4GDNA 3EG5B 3L29A 2EXBA 3MGQD 3AYWC 3DWZA 3AZHD 1AXBA 4DQYB 2EX8A 2NQBC 4E3LA 3W96D 4G92C 3LZ0D 1ZG6A 5B32A 4KGCB 3LEZA 5AV9A 2NZDA 2HDQA 4JF6A 4CSRA 3LY4A 4QLCB 5AV9C 1IKIA 1DJAA 5TGFA 4R0QA 2FJ7D 3MXRA 3UPPA 4OOMA 2G5HC 5HAQA 4X23A 3Q1FA 3UTAD 5AV6A 2H10A 1BLHA 3REIA 3KWQD 3VH6T 4UA9A 3AZKC 4PM6A 5DF9A 2HDRA 5EVLA 2ZY4A 5CPKA 1H3OA 4J8WD 3Q07A 3IWOA 4LG2A 5IHVA 2Y2GA 1MY8A 5FA7A 5GXQB 5CPKC 3SH9A 3UT9A 2ZQ8A 4KG6A 3W4PA 5B32D 1JFIA 1KX5D 3UT9C 5B24B 3AZFC 1P3GC 2LY8A 3GSGA 3ZGAB 1KVLA 3O62B 4IBJA 4ZUXD 2ZQ7A 2HP6A 2DQNC 3VH6W 1KGGA 5FQJA 3KSYA 2Z2MB 3M6BA 5G49A 4X23D 4WBGA 1M1AA 3EPHA 2XK1A 4Y0TA 5AV6D 1PI4A 2IWDA 2HDUA 2HP5A 3PBNA 3REID 4WEJA 1K55A 3NQUA 4IBEA 5FAPA 4KQQA 1M19B 3HSHA 3RELB 3A6ND 3C1BA 5AVBB 1K55C 4R4SA 5B0YB 4J8UD 1IYOA 2QPNA 3C1BC 3HLBA 3TU4D 1P3FD 1PW8A 1YLTA 4S2LA 4J8XC 3C1CC 4KZ3A 5F83A 1P3AB 3L25A 3AZJB 3WKJB 1M1AD 1GA0A 3FKWA 4R8PB 4OPZA 1CEGA 2ZC7A 5AV8A 1ID3A 5HW3A 2X01A 3HUMA 1LHYA 5DF7A 4KZ7A 1XX2A 1LL5A 3B0DB 4Z9QA 3W99D 2P9VA 2IWCA 3P98A 4OH0A 2EX9A 3MVDB 1KGFA 2WGIA 4B88A 3SH7A 2Y2PA 3ZFZA 2EFXA 2F8NK 4L0LA 2HPBA 2ZLYA 4IBFA 1EQZD 3BYDA 4QHCA 4WV4B 5B24D 1KVMA 3ZG8B 5F99C 1XPBA 1ID3D 3LJAC 3O62D 3NDGA 2RVQD 1HQ3A 1IYSA 1P3IA 4QB8A 3HLCA 3VH5T 5B1MB 1PZPA 1HQ3C 4JKTA 1P3IC 2HUEB 4OJPA 2IO5B 5B1LA 5HARA 4IBRA 5AVCB 5B1LC 4KZ8A 3LZ1D 3C4OA 3AZGA 4YS3A 3IH9A 4XZQC 4C6YA 4YM6A 5CGXA 3REKA 4YS3C 4OQ0A 1S32C 5B0YD 4LV3A 3N6IA 5AV5A 4YM6C 1Q9CA 3BFFA 1L0GA 1K54C 4WZ5C 3VP0A 3MGRB 1DJBA 3X1SB 3VP4A 5GHYA 2IOUA 2HIOC 3AZLD 4XUJC 1AOID 1P3LD 3AN2B 1P34B 4OUIA 3IXHA 5JA4A 4LD9A 5CP6A 3Q82A 2XLNA 4LCLA 4DE0A 4LD9C 3REHB 3AZEA 3PBQA 1LI9A 3EQUA 5AY8A 5CTNA 3KUYD 5B40B 4Z5TB 3B6GB 3UTBA 4WU9D 2PYOA 5B2IC 4NE6A 4H9QA 3UTBC 3VP3A 2PYOC 3M6HA 2CV5A 5B33B 3NCKA 1P3BB 1ERMA 4QU3A 3MVDD 5AV5D 3TSGA 3ITAA 5B31B 3EPJA 2QZ6A 3IT9A 4P85A 3WA9B 4ZAMA 3G31A 4IBIA 4LV1A 1ZLAB 5GT0A 5HAPA 5CP6D 1BH9A 2F8NG 2BYKB 4CAYA 3KXBB 5GT0C 5CPJB 2F2AC 3ZDJA 3AZED 5JRGC 1P3PB 4WU8B 3AZNC 1WE4A 5AY8D 1IEMA 4OPYA 3ZG5A 5B2JA 3A3EA 3RXXA 2Y2KA 3RXWA 3VP1A 4BJPA 3NDEA 3WTPC 4YFMA 3W97B 4AWLC 3BLSA 3W98B 1TDGA 1FSWA 3MGPC 3PAEA 4EWFA 1MBLA 2BYMA 3O3VA 5AQBA 1YLWA 1YLYA 4M6BA 4E44A 3G2ZA 4K0WA 3G2YA 1PI5A 3MZEA 5U47A 1HZOA 2BLSA 1P3KD 1SDNA 3B6FA 1FSYA 4BL2A 3AZMA 3AZIA 3OCNA 2AROB 5DNNA 2WZXA 3B6FC 3AZMC 3AZIC 4DXCA 3AN2D 1P34D 4M3KA 3AV2B 5CHLB 3PBRA 3AGDA 2ZC3B 5DF8A 5CPIA 4S2PA 1CEFA 3REJD 5CPIC 3PAGA 1NXYA 4Z5TD 4Z66B 3BM6A 4H9NB 3X1UB 2WGWB 5EOOA 3X1VB 1TAFB 2OLUA 4QY6A 1NZOA 1KX4D 2ZM2A 1XXMA 5B33D 3G4PA 1P3BD 1K38A 2Y2HA 1FOFA 5DNMB 4KUDD 5G18A 4NZ1A 4WU8C 5DNND 3N7WA 3MGSB 3SH8A 3AV1C 2JBFA 4J8VD 1GHMA 3MGQB 3AFAB 2J8YA 3AZHB 1RGYA 1ZKJA 4PMAA 2JE5A 1M18A 5E5AA 3W96B 2YFWB 3LZ0B 1M18C 3AGFA 2WAEA 3IQAA 1JTGA 1PW1A 3MXSA 5GL9A 1K4FA 5FQ9A 5GT3A 1H5XA 1KU5A 1P3OC 1G68A 5FAQA 4LCMA 2FJ7B 4XUZA 5GT3C 3ISGA 2C6WB 4IBDA 5TFQA 2ZY2A 4H9SC 3UTAB 5BNVB 4DF6A 1N1JA 4JXGA 4DRAA 3KWQB 1YMXA 2ZY5A 1P3MA 3B0CT 4J8WB 1KX3A 2Y2MA 5E5AD 1U35C 2H5SA 3GV9A 2CC1A 4DDYA 1KX3C 5EVID 5B32B 3IF6C 3AV2D 5GSUD 2NZDB 4OQIA 2ZQAA 3HUOA 4CSRB 1KE3A 1TZYC 1VM1A 4ZUXB 4WNNA 1C3BA 4YINA 3UN7A 4OJ5A 3MNNA 3QNCA 5KSHA 3B0CW 4Z66D 1ZC2A 4X23B 3IWIA 5AV6B 2J9OA 1JWZA 4DRTA 3REIB 3WAAA 1P3MD 3A6NB 3A3JA 2F8NH 2J9PA 1XGJA 4J8UB 1HVBA 3MGSD 3E2KA 3LELA 1P3FB 3BFEA 1TEMA 3IXGA 1JFIB 4B4XA 4S2IA 1ALQA 3AFAD 3LELC 2NQBA 5DTKA 1KGEA 4GHLA 3GVBA 4G91C 3WS2A 5DTTA 1M40A 5C3IC 4X55A 3MNND 1MWTA 3VOYA 3VMAA 1M1AB 1XGIA 3VSKA 4OQGA 1R4VA 3NY4A 4WEKA 1YLPA 1LI0A 3BFDA 4E6XA 3NI9A 1E4DA 4NZ5A 1GCEA 3AGEA 3W99B 4PM9A 3AZKA 4R4RA 3AYWD 5AQAA 3A1IA 1W79A 4EBPA 1KX5C 1PIOA 4IVIA 4N92A 5CHMA 3GRJA 4E6WA 1F66C 1G6AA 1YU3A 1GHPA 5BNXA 1FQGA 3X1TC 1DY6A 1S6RA 1KE4A 3AZFA 1P3GA 4IJFA 4NYYA 1EQZB 1E25A 3ZNYA 4JJNA 5AV9D 3HLGA 2NZDD 4LV0A 3C7VA 4JXWA 4KENB 5AV8B 4JJNC 1ID3B 5HL1A 2A49A 2ZQ9A 4PPRA 4IBCA 4NETA 5FAOA 1MWRA 5B0ZC 3DTMA 4KZ4A 3TU4C 4S2KA 4RVAA 1NYYA 3O86A 4E45A 3LZ1B 3UO9A 3KFUG 3I7JA 3BRMA 5CPKD 2G2UA 4EBLA 5F1FA 4U3TA 2A3UA 4KGCA 1ESUA 4J8XA 3UT9D 3C1CA 1SCWA 3AZFD 1P3GD 4QLCA 4KGCC 5FDHA 4OOLA 2PBYA 3V5MA 1YU0A 4KG2A 3A3DA 4QLCC 3AZLB 2RIQA 1AOIB 1ES5A 4RX2A 3WX7A 1P3LB 3WS0A 1YU2A 4JLFA 1WYBA 1ERQA 5GHXA 5BT1C 5FI7A 4RYEA 4BL3A 3KUYB 4S2NA 4JXVA 4P6BA 4WU9B 3AZGB 5GXQA 2ZM8A 4CJNA 4S2NC 3C1BD 3REKB 3N8SA 5GXQC 4J8XD 5AV5B 2XDMA 3M2KA 2X71A 5B24C 5EOEA 3GR2A 2B5RA 3L26A 4HESA 3KS4A 1TDLA 3O62C 3GTCA 2RVQC 3SS3A 3FZCA 4K0XA 1YU1A 4GD6A 5CP6B 1B67A 1JWPA 4EUZA 5F99A 3LJAA 1B6WA 2ZM5A 3AZEB 2WKHA 2JC7A 2EXAA 3HLDA 1M19A 5E2FA 5AY8B 3RELA 5AV8D 5M1AA 5AVBA 2VGKA 2P74A 5GLDA 4EO5B 3UE3A 4U0XA 1M19C 3RELC 2XFSA 5CGSA 5AVBC 4H9QB 1KE0A 5B0YC 4EBNA 2H0TA 1YU4A 4KZ6A 3V3SA 2CV5B 5KDMB 1SDEA 3UPNA 3HONA 4MNRA 3SS5A 4BENA 4XZQA 1P3AA 4DRBA 3LO7A 1K25A 3WKJA 1S32A 3UDXA 2Y2IA 3V3RA 4FH2A 4DE2A 4E3IA 1P3AC 3HLWA 1P3LC 4H9OA 1K54A 3CG5A 4WZ5A 3AZJC 4BD1A 3WKJC 3OPRA 1BH9B 1P3KB 4R1GA 1Q2PA 2HIOA 4KHAA 2Y59A 4CAYB 4XUJA 3ZVTA 5F99D 3N8LA 2WGVA 4R8PC 3LJAD 1PZOA 4OJ6A 5B2JB 2Y4AA 1HQ3D 4WU9C 1IKGA 1P3ID 1WWSA 3JYIA 2Z2LB 2WUQA 3B3XA 3S4XA 3B0DC 1H8ZA 4D2OA 4IBKA 3REJB 3V50A 5B1LD 3MVDC 4X69A 2BYMB 5B2IA 3AZGD 4YS3D 2Y2NA 3PBTA 1S32D 4ZJ2A 5AQ7A 4YM6D 2F8NA 5I94A 3REKD 3GMWA 1KX4B 1BH8A 3L2AA 4UUZB 4KUDB 3V39A 5BS7A 4ZBEA 4ZBJB 4B4ZA 3B0BA 4BLMA 3C5AA 5DNNB 5CXWA 1H8YA 3H0RC 3LCEA 5BS7C 4S2OA 4PM7A 5FUGB 4LD9D 3R45A 5B1MC 4J8VB 5JRGA 4ZDXA 5EPHA 2XR0A 2Y2OA 3G34A 5AVCA 1YM1A 3AZNA 2HUEC 2IO5C 4OLGA 4JPMA 5AVCC 4HBTA 3VFFA 1QMEA 3WTPA 2WKIA 3EQVA 4MBHA 5B2ID 3UTBD 3UE1A 4NK3A 2PYOD 5E43A 3MGPA 4UA7A 1PWDA 3MGRA 2F8ND 4FSFA 4NY2A 5E2EA 4H9PA 2CV5D 3X1SA 3OPHA 4HGAB 1Z6FA 3VSLA 3MGRC 1YQSA 4E3OA 3X1SC 4MLLA 1RGZA 3BEBA 4UA6A 4KZ5A 1NY0A 3ZVWA 3AN2C 3BLMA 1P34C 1M6KA 3REHA 3FWLA 5GT0D 1Y54A 1XP4A 4NZ4A 4E3MA 3REHC 5B40A 3B6GA 3IXBA 4F94A 3V9RB 3HLFA 3VOZA 2PU2A 3OCLA 3O88A 4P0MA 5E5AB 3IHBA 5B40C 4Z5TC 3B6GC 3Q7VB 4OPQA 5B2JD 3N8RA 3UPOA 5EVIB 2XGNA 2YFVA 1J9MA 1K6RA 5GSUB 4NE5A 1W7FA 2EX6A 3MGPD 1QMFA 5B31A 4WM9A 4JF5A 1Q2QA 5CHJA 1LLBA 5B33C 1P3BC 4OPRA 5B31C 3WA9A 4K91A 2RCXA 4LENA 1ZLAA 2ZC5B 3W4OA 3FDDA 5BPVA 1W8QA 4EV4A 2GDNA 5J8XA 3WA9C 3IH8A 4DDSA 1ZG4A 1N1JB 3OZHA 1PYYA 2XD1A 5FATA 2FFFB 3KXBA 1ZLAC 4ID4A 3NQJB 5CPJA 3RJUA 1KDWA 5B31G 1P3PA 1HTZA 4WU8A 3KXBC 1P3MB 4FH4A 3ZHHA 5CPJC 2W8SA 3B6FD 3MFDA 4X53A 3AZMD 5L2FA 3AZID 1P3PC 1SKFA 1CI9A 1WYCA 3AV1A 3EPKA 1I2WA 4WYYA 1IELA 3N4IA 5CGWA 5CPID 3W97C 3A3FA 1K56A 4H9RB 1I5QA 3W98C 2J7VA 4A5RA 3FV7A 4BD0A 1NZUA 4GD8A 3MNNB 1I2SA 2Q9MA 4Y0UA 3UDFA 1P3OA 3F6TA 3NC8A 1HTAA 3PBSA 3WAAB 1EROA 4H9SA 1L0FA 2AROA 2IWBA 4X56A 3FKVA 3HVFA 4CPKA 5FASA 2AROC 4NZ3A 1GA9A 3AV1D 3AYWB 3AV2C 4GKUA 3HUNA 4N9LA 3WS5A 4WMCA 2NQBB 2JCHA 3H0MC 1U35A 4G92B 4UAAA 4E3NA 4H9NA 3X1UA 1K4EA 4RX3A 1M18D 2WGWA 3IF6A 4WELA 5EE8A 4QJGA 1TAFA 2V20A 3UNWA 4Z66C 3X1UC 1TZYA 5AV9B 1W2EA 1BSGA 5CEBA 3X1VC 4C3QA 1MXOA 5GT3D 5DNMA 1E3UA 1L0EA 3MZDA 4NYUA 5FQQA 2V1ZA 4KQRA 5DNMC 4KQOA 3MGSC 3MGQA 3DW0A 5JYOA 4LV2A 3WTPE 1TVFA 3FYZA 3AZHA 3O87A 4Y7PA 3MGQC 3AFAC 2R9WA 1N9BA 3W96A 4MBFA 1O7EA 3LZ0A 5CPKB 3AZHC 3MZFA 1H3OB 4PM5A 1KX3D 3W96C 1MPLA 3MKFA 1YLZA 3LZ0C 4NE3A 3UT9B 3AZFB 1P3GB 3HL9A 4GOGA 2ZC4B 4MEZA 1TZYD 2FJ7A 1YUEA 2FJ7C 4IBXA 3UTAC 5GHZA 5BO0A 5G49B 3WRZA 3L28A 3KWQA 1XA7A 3ZG9B 3KWQC 4J8WA 4DKIA 3WAAD 3NQUB 1NJ4A 2ZY3A 3WS1A 3ZCZA 4J8WC 1BTLA 3C1BB 4DXBA 1WWIA 2Y91A 3UDIA 1KX5A 4J8XB 2WZZA 2WADA 4PM8A 3C1CB 3LELD 5B32C 1F66A 3Q81A 4R3JA 2NZDC 4ZUXA 3X1TA 1OMEA 3IF5A 4OP8A 2NQBD 5E2GA 5A93A 2Y2LA 2ZD8A 3W4QA 4ZUXC 1HD8A 1Z2CB 2ZMAA 4KZBA 1CK3A 1F1EA 1BT5A 5B32G 4X23C 2V2FF 3IHAA 5AV6C 1L0DA 4IEDA 4Z2MG 5JYPA 4X6TA 3REIC 3A6NA 4HEFA 5B0ZA 4DE3A 5FQKA 4J8UA 3A6NC 3G32A 4HBUA 3AL0C 4E3KA 3HBRA 3TU4A 1P3FA 3QHYA 2P9VB 4J8UC 2XEPA 3AZKD 1P3FC 1F66D 4OKPA 3X1TD 1IYPA 4RA7A 1FCNA 4S2MA 4IBBA 5M18A 1YLJA 4OQHA 1M1AC 5F99B 4JJND 1PWGA 3WRTA 3LJAB 1VQQA 4N1HA 3P5JB 1DJCA 2ZJ9A 4QNLA 3W99A 1HQ3B 3CMZA 5B0ZD 1P3IB 4Q8IA 1EI5A 3W99C 4ZJ1A 5EUAA 2WK0A 3A1KA 5B1LB 1RP5A 2Y55A 3E2LA 2XQZA 1NYMA 5KMWA 4XZQB 5CHUA 1GHIA 4YS3B 1JWVA 1S32B 2DNSA 3FKEA 4H9OB 4YM6B 1EQZA 4FD8A 4KGCD 5B24A 5DVAA 3C1CD 1EQZC 2DCFA 2HIOB 4QLCD 4KHAB 4XUJB 3O62A 4GB7A 4X68A 4R3BA 5AV8C 1ID3C 3NBLA 1T3UA 1PZRA 2J8PA 2DF4C 5BT1D 5JA4B 4LD9B 3S1YA 1EWZA 1BZAA 2HP9A 3LZ1A 2ZC6B 2R9XA 3Q7ZA 5CECA 1A7WA 5B2IB 1XKZA 3LZ1C 3UTBB 2I72A 2PYOB 5B0YA 5GXQD 1KDSA 1W8YA 2F8NB 4QY5A 5EECA 2H0YA 1PWCA 4S2JA 1BH8B 3VH6A 2C5WB 3AZLA 1AOIA 1K6SA 1P3LA 2ZQCA 1CI8A 1XA1A 4KZAA 3AZJA 3PBOA 3OPLA 3AZLC 1AOIC 4BQMA 5BOHA 3IXDA 5TR7A 5GT0B 4R8PA 1RCJA 3R45B 2BG1A 5JRGB 4JXSA 5GLCA 3KUYA 3AZNB 4XXRA 2EFUA 4O7DA 4WU9A 3TG9A 3KUYC 5CERA 1M19D 3RELD 3WTPB 5AVBD 3EPLA 3AZGC 4AWLB 2XFTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KQQ A;  2J9O A;  1JWZ A;  4K91 A;  2EX2 A;  2RCX A;  4LEN A;  4DRT A;  1K55 C;  3DWK A;  2OLV A;  2ZC5 B;  3W4O A;  4R4S A;  2G2W A;  1W8Q A;  4EV4 A;  2GDN A;  5J8X A;  4DDS A;  3IH8 A;  1IYO A;  1ZG4 A;  2OSU A;  2QPN A;  1PYY A;  3OZH A;  5HFO A;  3HLB A;  2XD1 A;  4N9K A;  5FAT A;  5FI6 A;  2FFF B;  1PW8 A;  1YLT A;  4ID4 A;  3RJU A;  1KDW A;  3A3J A;  4S2L A;  5CRF A;  4OP5 A;  2E8I A;  2J9P A;  3LY3 A;  1XGJ A;  1HTZ A;  1HVB A;  4OLD A;  4FH4 A;  3ZHH A;  4KZ3 A;  4GDB A;  3E2K A;  1ES4 A;  5F83 A;  3MFD A;  4X53 A;  5L2F A;  3BFE A;  1TEM A;  1SKF A;  3IXG A;  5KZH A;  4GZB A;  4B4X A;  3BFC A;  4S2I A;  1ALQ A;  1CI9 A;  3WWX A;  1WYC A;  3VFH A;  1I2W A;  5DTK A;  1KGE A;  3GVB A;  4WYY A;  1IEL A;  3N4I A;  4FCF A;  3WS2 A;  1GA0 A;  5DTT A;  5CGW A;  3FKW A;  1M40 A;  2VGJ A;  1K57 A;  4OPZ A;  1CEG A;  3A3F A;  2ZC7 A;  1K56 A;  4X55 A;  5F82 A;  1I5Q A;  5HW3 A;  1MWT A;  3QNB A;  2J7V A;  1FCM A;  1FR1 A;  3VOY A;  3VMA A;  1K57 C;  2ZQD A;  2X01 A;  4QD4 A;  4A5R A;  3HUM A;  3FV7 A;  1BLS A;  1LHY A;  4KG5 A;  4BD0 A;  1NZU A;  1XGI A;  5DF7 A;  1S0W A;  4KZ7 A;  3VSK A;  1XX2 A;  4OQG A;  1LL5 A;  4UHU A;  4GD8 A;  3NY4 A;  4WEK A;  4Z9Q A;  3ZG7 B;  1YLP A;  1LI0 A;  2P9V A;  2IWC A;  3BFD A;  1I2S A;  2Q9M A;  3P98 A;  4Y0U A;  4OH0 A;  4E6X A;  3UDF A;  5HX9 A;  2EX9 A;  3NC8 A;  1BUL A;  3NI9 A;  1E4D A;  4OON A;  1GCE A;  1KGF A;  3AGE A;  5A90 A;  2WGI A;  4B88 A;  3PBS A;  4PM9 A;  1ERO A;  3SH7 A;  2Y2P A;  1L0F A;  2XD5 A;  2IWB A;  4R4R A;  4X56 A;  3FKV A;  3HVF A;  5AQA A;  3ZFZ A;  4EBP A;  1W79 A;  2Q9N A;  4CPK A;  2EFX A;  5FAS A;  4H8R A;  1PIO A;  2UWX A;  4IVI A;  1ONH A;  4L0L A;  2HPB A;  1GA9 A;  4N92 A;  4P87 A;  5CHM A;  3GRJ A;  4EQI A;  4E6W A;  1G6A A;  2ZLY A;  1GHP A;  1NRF A;  3BYD A;  4QHC A;  1FQG A;  1O07 A;  1DY6 A;  4GKU A;  4JBF A;  1S6R A;  4JF4 A;  3OC2 A;  1KVM A;  3HUN A;  4N9L A;  3ZG8 B;  3WS5 A;  4DE1 A;  4WMC A;  3BFG A;  1KE4 A;  2JCH A;  1IYQ A;  1XPB A;  4UAA A;  5HAI A;  1E25 A;  4E3N A;  3NDG A;  3ZNY A;  4ZTK A;  3HLG A;  1IYS A;  1K4E A;  4RX3 A;  2WGW A;  3IF6 A;  4WEL A;  5EE8 A;  4LV0 A;  4QB8 A;  3HLC A;  4QJG A;  3C7V A;  4JXW A;  1W5D A;  1PZP A;  2V20 A;  4KEN B;  1YT4 A;  3UNW A;  4JKT A;  5FQI A;  5HL1 A;  2A49 A;  4OOY A;  2ZQ9 A;  1BSG A;  5CEB A;  4PPR A;  5HAR A;  4IBR A;  4C3Q A;  1MXO A;  3ITB A;  4R23 A;  5FAO A;  4NET A;  1MWR A;  1ESI A;  1E3U A;  3MZD A;  1L0E A;  3DTM A;  4KZ8 A;  5FQQ A;  4KZ4 A;  2V1Z A;  3C4O A;  2DRW A;  3C4P A;  3IH9 A;  4KQR A;  5CED A;  1SHV A;  4S2K A;  4RVA A;  3GQZ A;  1NYY A;  3O86 A;  4C6Y A;  5CGX A;  1BUE A;  4OQ0 A;  3UO9 A;  1JTD A;  3I7J A;  4KQO A;  3BRM A;  4LV3 A;  3N6I A;  3DW0 A;  5JYO A;  4LV2 A;  1L0G A;  3BFF A;  1K54 C;  2G2U A;  4EBL A;  4WZ5 C;  5GLA A;  3VP0 A;  5F1F A;  1DJB A;  1TVF A;  3FYZ A;  4GN2 A;  4U3T A;  2A3U A;  3O87 A;  1JVJ A;  1ESU A;  4Y7P A;  3C7U A;  5DTS A;  3VP4 A;  1N9B A;  2R9W A;  4MBF A;  5E2H A;  5GHY A;  1SCW A;  1ONG A;  1O7E A;  3MZF A;  5FDH A;  4OOL A;  2PBY A;  1FCO A;  4PM5 A;  3V5M A;  1BLC A;  3IXH A;  3HRE A;  1MPL A;  3MKF A;  1YLZ A;  4KG2 A;  3A3D A;  4N1X A;  4U0T A;  5FQM A;  1ES5 A;  3HL9 A;  3Q82 A;  2XH9 A;  2HDS A;  4RX2 A;  2XLN A;  4GOG A;  4LCL A;  4Y0O A;  3WS0 A;  2ZC4 B;  4DE0 A;  5M19 A;  4MEZ A;  3W8K A;  2WKE A;  3PBQ A;  3IF6 B;  1LI9 A;  4JLF A;  1WYB A;  2RL3 A;  1ERQ A;  3EQU A;  5GHX A;  5CTN A;  5FSR A;  4E3J A;  1U60 A;  5FI7 A;  2X02 A;  4RYE A;  4IBX A;  4BL3 A;  3SS4 A;  5GHZ A;  3WRZ A;  3VP3 A;  3G30 A;  4JXV A;  3M6H A;  4S2N A;  3M2J A;  1XA7 A;  4P6B A;  1MWS A;  3NCK A;  2ZM8 A;  1ERM A;  4QU3 A;  3TSG A;  3ITA A;  4CJN A;  3ZG9 B;  4S2N C;  2QZ6 A;  3IT9 A;  3N8S A;  3WS4 A;  4P85 A;  5CTM A;  4DKI A;  3P09 A;  3S22 A;  1NJ4 A;  3WS1 A;  2PU4 A;  2FFY A;  2XDM A;  3ZCZ A;  3M2K A;  4ZAM A;  3G31 A;  1BTL A;  3MKE A;  4LV1 A;  4DXB A;  3NIA A;  2X71 A;  2Y91 A;  3UDI A;  5EOE A;  2Y2J A;  2B5R A;  3GR2 A;  5HAP A;  3CZD A;  4HES A;  4GNU A;  4KZ9 A;  1TDL A;  2WZZ A;  2WAD A;  4PM8 A;  3Q7V A;  3GTC A;  5A91 A;  3Q81 A;  3SS3 A;  3G35 A;  4R3J A;  3FZC A;  5EVI A;  3ZDJ A;  4K0X A;  1OME A;  1FR6 A;  3IF5 A;  4GD6 A;  4OP8 A;  1JWP A;  1WE4 A;  1YMS A;  3BEC A;  5E2G A;  3UE0 A;  4EUZ A;  1IEM A;  4OPY A;  5EVI C;  3ZG5 A;  5A93 A;  2Y2L A;  3A3E A;  5AQ9 A;  2ZD8 A;  4ZJ3 A;  3RXX A;  5FI2 A;  1HD8 A;  2Y2K A;  3HLE A;  3RXW A;  3W4Q A;  2ZMA A;  5A92 A;  3CJM A;  4KZB A;  3VP1 A;  4BJP A;  1CK3 A;  2WKH A;  3NDE A;  1BT5 A;  2JC7 A;  2EXA A;  3HLD A;  3UY6 A;  4XUX A;  5E2F A;  1K56 D;  4YFM A;  4OVD A;  5M1A A;  3SOI A;  2VGK A;  2P74 A;  2V2F F;  3IHA A;  3BLS A;  1L0D A;  1TDG A;  5GLD A;  1FSW A;  3A3I A;  3UE3 A;  2QMI A;  4U0X A;  2XFS A;  3PAE A;  4EWF A;  4IED A;  5CGS A;  1MBL A;  5JYP A;  4X6T A;  5GLB A;  3O3V A;  1KE0 A;  5AQB A;  1YLW A;  1YLY A;  4HEF A;  4IVK A;  2H0T A;  1ES2 A;  4KZ6 A;  4EBN A;  3V3S A;  4DE3 A;  1SDE A;  4MBK A;  5FQK A;  3UPN A;  4MNR A;  3SS5 A;  4BEN A;  3G32 A;  3OPP A;  4HBU A;  5D3O A;  3G2Z A;  4E3K A;  3HBR A;  4K0W A;  3QHY A;  3LO7 A;  2P9V B;  1ES3 A;  1N4O A;  1PI5 A;  3G2Y A;  3ZNT A;  2XF3 A;  3MZE A;  5U47 A;  1HZO A;  1K25 A;  2BLS A;  2XEP A;  3UDX A;  2Y2I A;  3V3R A;  4FH2 A;  4DE2 A;  4E3I A;  3HLW A;  1SDN A;  1K54 A;  3CG5 A;  1FSY A;  4WZ5 A;  4BL2 A;  3OCN A;  4BD1 A;  4OKP A;  3OPR A;  1IYP A;  4RA7 A;  2WZX A;  4R1G A;  1FCN A;  3VP2 A;  1Q2P A;  1L2S A;  2Y59 A;  3ZVT A;  4DXC A;  3N8L A;  2WGV A;  4S2M A;  1PZO A;  4M3K A;  3D4F A;  5M18 A;  3PBR A;  4WMC D;  3AGD A;  1YLJ A;  2ZC3 B;  5DF8 A;  4S2P A;  1CEF A;  2ZM0 A;  4OQH A;  2Y4A A;  3WRT A;  1PWG A;  1IKG A;  1VQQ A;  3JYI A;  2Z2L B;  2WUQ A;  3B3X A;  3PAG A;  4N1H A;  3S4X A;  1H8Z A;  1DJC A;  1MKI A;  1NXY A;  3MBZ A;  2ZJ9 A;  5F1G A;  4D2O A;  3V50 A;  3BM6 A;  3CMZ A;  5KSC A;  2WAF A;  2OV5 A;  2WGW B;  5EOO A;  3TOI A;  3ZG0 A;  4Q8I A;  1EI5 A;  4X69 A;  2OLU A;  4QY6 A;  1E3U D;  1NZO A;  4WZ4 A;  5EUA A;  4ZJ1 A;  1LL9 A;  1MWU A;  2ZM2 A;  2WK0 A;  3PTE A;  1RP5 A;  3IWQ A;  2Y55 A;  1XXM A;  2Y2N A;  2XQZ A;  3E2L A;  3PBT A;  3G4P A;  2WYX A;  1K38 A;  4ZJ2 A;  4C75 A;  1NYM A;  5AQ7 A;  2Y2H A;  2Y2Q A;  1FOF A;  5KMW A;  5I94 A;  5CHU A;  3GMW A;  1GHI A;  1BLP A;  4GDN A;  5G18 A;  1JWV A;  2EXB A;  3N7W A;  2DNS A;  3DWZ A;  4FD8 A;  3V39 A;  1AXB A;  4ZBE A;  3SH8 A;  2EX8 A;  2JBF A;  4B4Z A;  4E3L A;  4BLM A;  1GHM A;  3C5A A;  5DVA A;  2J8Y A;  5CXW A;  1H8Y A;  2DCF A;  3LCE A;  4S2O A;  4PM7 A;  1ZG6 A;  4GB7 A;  1RGY A;  1ZKJ A;  3LEZ A;  4X68 A;  4PMA A;  4R3B A;  2JE5 A;  2HDQ A;  4JF6 A;  4ZDX A;  5EPH A;  2XR0 A;  2Y2O A;  3G34 A;  3NBL A;  1YM1 A;  3LY4 A;  1IKI A;  1DJA A;  5TGF A;  4OLG A;  4R0Q A;  3AGF A;  2WAE A;  3IQA A;  4JPM A;  3S1Y A;  1JTG A;  1EWZ A;  3MXR A;  1PW1 A;  4HBT A;  1BZA A;  3MXS A;  4OOM A;  3UPP A;  1QME A;  3VFF A;  2WKI A;  5GL9 A;  1K4F A;  3EQV A;  4MBH A;  5FQ9 A;  4OPR A;  5HAQ A;  1H5X A;  3Q1F A;  3UE1 A;  2HP9 A;  4NK3 A;  2ZC6 B;  1G68 A;  5FAQ A;  2R9X A;  4LCM A;  5E43 A;  3Q7Z A;  4XUZ A;  3ISG A;  2H10 A;  1BLH A;  4UA7 A;  5CEC A;  2C6W B;  1PWD A;  1XKZ A;  4FSF A;  5E2E A;  5TFQ A;  4UA9 A;  3OPH A;  2I72 A;  4DF6 A;  4PM6 A;  5DF9 A;  1KDS A;  2HDR A;  4JXG A;  5EVL A;  1Z6F A;  3VSL A;  1W8Y A;  1YQS A;  5EEC A;  4QY5 A;  4E3O A;  3Q07 A;  3IWO A;  5IHV A;  2H0Y A;  4MLL A;  1RGZ A;  2Y2G A;  1PWC A;  1YMX A;  1MY8 A;  5FA7 A;  4S2J A;  3BEB A;  4UA6 A;  3SH9 A;  2C5W B;  2ZQ8 A;  4KZ5 A;  1NY0 A;  3ZVW A;  1K6S A;  3BLM A;  4KG6 A;  3W4P A;  2ZQC A;  1M6K A;  1CI8 A;  1XA1 A;  4KZA A;  3FWL A;  3PBO A;  2Y2M A;  3OPL A;  1Y54 A;  1XP4 A;  3GSG A;  3ZGA B;  4BQM A;  1KVL A;  2H5S A;  5BOH A;  3GV9 A;  4E3M A;  2CC1 A;  3IXD A;  3IXB A;  4DDY A;  4F94 A;  5EVI D;  3HLF A;  3IF6 C;  2ZQ7 A;  5TR7 A;  3VOZ A;  2PU2 A;  3OCL A;  1RCJ A;  3O88 A;  4OQI A;  2HP6 A;  2ZQA A;  4P0M A;  2BG1 A;  1KGG A;  3HUO A;  3IHB A;  5FQJ A;  3Q7V B;  4JXS A;  2Z2M B;  4OPQ A;  3M6B A;  3N8R A;  4XXR A;  1KE3 A;  5GLC A;  3UPO A;  2EFU A;  5EVI B;  1VM1 A;  4WBG A;  2XK1 A;  2XGN A;  4Y0T A;  4O7D A;  1J9M A;  1K6R A;  1C3B A;  3TG9 A;  4YIN A;  1PI4 A;  3UN7 A;  1W7F A;  5CER A;  2EX6 A;  2IWD A;  1QMF A;  4WM9 A;  4JF5 A;  3QNC A;  2HDU A;  2HP5 A;  5KSH A;  1Q2Q A;  3PBN A;  5CHJ A;  1ZC2 A;  1LLB A;  4WEJ A;  1K55 A;  3IWI A;  2XFT A;  5FAP A; 
#chains in the Genus database with same CATH topology
 3MVD A;  3MGP B;  1S1Z A;  2WKP A;  3REK C;  3VH5 W;  2EX2 A;  4ARZ A;  3DWK A;  5DFY A;  2OLV A;  2G2W A;  4H9P B;  1UWN X;  4DJ3 A;  5F6A A;  5AV5 C;  3SZT A;  2J3W A;  2OSU A;  3LIF A;  5HFO A;  4N9K A;  3HJI A;  4XZQ D;  1P3A D;  4GJ4 A;  5FI6 A;  4UEY A;  5CRF A;  4OP5 A;  3AZJ D;  2E8I A;  3LY3 A;  3WKJ D;  4O01 A;  1G6O A;  4OLD A;  4XT2 B;  4GDB A;  1ES4 A;  3JVU A;  3QP1 A;  5KZH A;  5CP6 C;  4GZB A;  4X1L A;  3BFC A;  4R8P D;  3JVV A;  3WWX A;  1IFQ A;  3VFH A;  2HIO D;  4XUJ D;  3B6F B;  3AZM B;  3AZI B;  3AZE C;  4FCF A;  4Y17 A;  4DJ2 A;  3R4K A;  2VGJ A;  1K57 A;  5AY8 C;  5B1M A;  4ESP A;  2JHE A;  5F82 A;  2V8C A;  3QNB A;  4EO5 C;  1FCM A;  1FR1 A;  2YFV B;  1K57 C;  2ZQD A;  4QD4 A;  5KDM A;  2Y79 A;  4Z2M H;  2KOI A;  5CPI B;  1BLS A;  1NRJ A;  4KG5 A;  1S0W A;  3CLO A;  4UHU A;  2GNX A;  3ZG7 B;  2JKT I;  3E0Y A;  2CV5 C;  3N3F A;  1G5U A;  5HX9 A;  1BUL A;  4OON A;  4HH2 A;  5A90 A;  2CWE A;  4Z2J A;  2XD5 A;  1P3K A;  4QWO A;  3MQQ A;  2Q9N A;  3A0V A;  1P3K C;  4H8R A;  2UWX A;  1ONH A;  4EQI A;  4P87 A;  1STZ A;  1OTD A;  1NRF A;  3AN2 A;  2OWJ A;  1O07 A;  1P34 A;  4JBF A;  5K5B A;  4JF4 A;  3OC2 A;  4DE1 A;  3BFG A;  3AV1 B;  4IBG A;  5B1M D;  5B2J C;  1IYQ A;  5HAI A;  3REJ A;  4ZTK A;  3IP4 C;  4MMN A;  5JRG D;  3EGD C;  5HSQ A;  5AVC D;  3REJ C;  1W5D A;  3AZN D;  1YT4 A;  5FQI A;  4Z5T A;  3LIB A;  4YWZ A;  4Y5F A;  1SKO B;  2O9A A;  4OOY A;  1M18 B;  1VHM A;  1WA9 A;  3WTP D;  3ITB A;  3VH5 A;  4R23 A;  1ESI A;  1KX4 A;  3IX3 A;  3C4P A;  2DRW A;  5B33 A;  1P3B A;  1P3O B;  2ACG A;  5CED A;  1OT9 A;  1SHV A;  5EV0 A;  3GQZ A;  4UUZ A;  5GT3 B;  3MGR D;  1KX4 C;  3IS2 A;  4KUD A;  2W1T B;  2JSS A;  1BUE A;  3X1S D;  1JTD A;  2K7S A;  1GOI A;  4KUD C;  1EW0 A;  3C8C A;  3F1N B;  5GLA A;  4ZBJ C;  4GN2 A;  5FUG A;  2L5A A;  1JVJ A;  5FEF A;  5DNN C;  3C7U A;  5DTS A;  2BYK A;  4J8V A;  5E2H A;  1ONG A;  3H82 B;  1BYW A;  1FCO A;  2PAV P;  3REH D;  1BLC A;  4J8V C;  3F1O A;  3HRE A;  4U0T A;  4N1X A;  5FQM A;  3RFB A;  1U35 B;  2GJ3 A;  2XH9 A;  2HDS A;  4Y0O A;  5M19 A;  5B40 D;  3B6G D;  3W8K A;  1KX3 B;  2WKE A;  3IF6 B;  2RL3 A;  2G5I C;  5FSR A;  3W97 A;  4E3J A;  1U60 A;  2X02 A;  1YPR A;  1TZY B;  3W98 A;  4LGW A;  3T1S A;  4MN6 A;  3KS8 A;  2L0W A;  5B31 D;  1P97 A;  3SS4 A;  4WJ3 C;  3G30 A;  4HGA C;  3M2J A;  4WNN B;  4PHT A;  4MB3 A;  1MWS A;  5KIZ A;  3WA9 D;  2VV8 A;  4I3I A;  1ZLA D;  1TS8 A;  3WS4 A;  5HZH A;  5CTM A;  3P09 A;  3ULF A;  3S22 A;  1BFM A;  3LGO A;  2PU4 A;  5L10 A;  1ZTU A;  2FFY A;  2PHY A;  1Y28 A;  3KXB D;  4O0P A;  3MKE A;  5CPJ D;  3NIA A;  3V9R A;  2R78 A;  1P3P D;  2Y2J A;  3H0L C;  3CZD A;  4GNU A;  4KZ9 A;  4WU8 D;  2NUP C;  3E4P A;  4Z2G A;  3Q7V A;  5A91 A;  4WZS B;  3G35 A;  5EVI A;  2VQR A;  3AV2 A;  5E5A C;  5GSU A;  1FR6 A;  4CLC A;  2L1M A;  2BAS A;  1YMS A;  3BEC A;  3UE0 A;  3LEL B;  5EVI C;  3W97 D;  4ZJ3 A;  3M7P A;  5AQ9 A;  2KDK A;  1OTB A;  5FI2 A;  4IJE A;  3HLE A;  5GSU C;  5A92 A;  4G91 B;  3W98 D;  3CJM A;  3UY6 A;  4XUX A;  1K56 D;  1D7E A;  4OVD A;  3SOI A;  5C3I B;  4Z66 A;  4GHI B;  4F3L B;  3A3I A;  2QMI A;  3X1V A;  4NFT A;  3MXQ A;  5GLB A;  2ZL1 A;  3NQJ A;  5BO0 B;  4GH9 A;  4IVK A;  1SZV A;  1ES2 A;  3TW8 A;  3S7O A;  1P3O D;  4MBK A;  2V5O A;  3OPP A;  5D3O A;  1NLZ A;  1ES3 A;  1N4O A;  3ZNT A;  2XF3 A;  1GSW A;  1P3M C;  2ARO D;  4OJL A;  3MGS A;  2JKR I;  3IX4 A;  3T4O A;  1KX5 B;  3AFA A;  3AZK B;  5J3W A;  3L27 A;  3VP2 A;  1L2S A;  2UV0 E;  4H9R A;  1F66 B;  3BJN A;  2V8F A;  1AWI A;  3D4F A;  3X1T B;  3V67 A;  4WMC D;  3D9Y A;  2YFW A;  1U35 D;  4UPK A;  4GW9 A;  5BNX B;  2ZM0 A;  3W2Z A;  3MS6 A;  3X1U D;  5HD5 A;  1YSQ A;  3UB9 A;  1ULY A;  3X1V D;  5F1G A;  2QHK A;  3MNN C;  1MKI A;  3MBZ A;  2PRF A;  4PKY A;  4JJN B;  5KSC A;  2WAF A;  4HNB A;  2OV5 A;  5A8B A;  3TOI A;  3ZG0 A;  2VX8 A;  3PYP A;  4MB4 A;  5DNM D;  1E3U D;  3CUE A;  4WZ4 A;  3K3D A;  3WAA C;  3UTA A;  1LL9 A;  1MWU A;  5B0Z B;  3PTE A;  5BNV A;  3IWQ A;  3QP5 A;  2WYX A;  4OJO A;  4GHA A;  4C75 A;  4R6L A;  2Y2Q A;  3AYW A;  3TU4 B;  1BLP A;  4GDN A;  3EG5 B;  3L29 A;  2EXB A;  3MGQ D;  3AYW C;  3DWZ A;  2W27 A;  3AZH D;  1AXB A;  4DQY B;  3WD4 A;  2EX8 A;  2NQB C;  4E3L A;  3W96 D;  4G92 C;  4NXB A;  1V9Y A;  1J7M A;  3LZ0 D;  1N9L A;  1ZG6 A;  5B32 A;  4KGC B;  3LEZ A;  5AV9 A;  4YOF A;  4IJG A;  2NZD A;  2HDQ A;  4JF6 A;  1KS0 A;  4CSR A;  3LY4 A;  2INW A;  4QLC B;  2D01 A;  5AV9 C;  1O6I A;  1IKI A;  1DJA A;  5TGF A;  4R0Q A;  2FJ7 D;  3MXR A;  3NUL A;  3UPP A;  4OOM A;  4Z1W A;  2G5H C;  5HAQ A;  4X23 A;  3Q1F A;  3UTA D;  5AV6 A;  2H10 A;  1BLH A;  3REI A;  3KWQ D;  3VH6 T;  4UA9 A;  3AZK C;  3LFV A;  5HD3 A;  4PM6 A;  5DF9 A;  2HDR A;  5EVL A;  2ZY4 A;  5CPK A;  1H3O A;  4J8W D;  3Q07 A;  3IWO A;  4LG2 A;  5IHV A;  2Y2G A;  1MY8 A;  4G3V A;  5FA7 A;  2JKG A;  5GXQ B;  5CPK C;  3SH9 A;  3UT9 A;  2ZQ8 A;  4Y13 A;  4KG6 A;  3W4P A;  4FTX A;  3LI9 A;  5B32 D;  1JFI A;  3RTY A;  3EEA A;  1KX5 D;  3UT9 C;  5B24 B;  3AZF C;  1P3G C;  2LY8 A;  3GSG A;  3LR5 A;  3ZGA B;  1KVL A;  3LID A;  1E6P A;  1N9N A;  3O62 B;  4IBJ A;  4ZUX D;  2ZQ7 A;  1LT0 A;  2HP6 A;  2DQN C;  3VH6 W;  1KGG A;  5FQJ A;  3KSY A;  3F1P A;  1TD5 A;  4Z2I A;  1TS7 A;  2Z2M B;  3M6B A;  2IA2 A;  5G49 A;  4X23 D;  4WBG A;  1M1A A;  3EPH A;  2XK1 A;  4Y0T A;  1H0I A;  5AV6 D;  1PI4 A;  2IWD A;  2HDU A;  2HP5 A;  3PBN A;  3REI D;  4WEJ A;  1K55 A;  3NQU A;  4IBE A;  4CLC E;  5FAP A;  4KQQ A;  1M19 B;  3HSH A;  1FIK A;  3REL B;  3A6N D;  3C1B A;  5C5K A;  3CHW P;  5AVB B;  1K55 C;  3LIC A;  5DKK A;  4R4S A;  3T4K A;  5B0Y B;  4J8U D;  1IYO A;  2QPN A;  3C1B C;  3HLB A;  3TU4 D;  1P3F D;  1PW8 A;  2HF6 A;  1YLT A;  4S2L A;  1YAX A;  4J8X C;  3C1C C;  4KZ3 A;  5F83 A;  5TBM B;  5DJU A;  1P3A B;  5L07 A;  5HDD A;  2H28 A;  3L25 A;  3GDI A;  3AZJ B;  3WKJ B;  1M1A D;  1GA0 A;  3FKW A;  4R8P B;  2O9B A;  3CAX A;  4OPZ A;  1CEG A;  2ZC7 A;  5AV8 A;  1ID3 A;  3T4T A;  5HW3 A;  4ZRR A;  2X01 A;  1A0K A;  3HUM A;  1LHY A;  5DF7 A;  1W63 M;  4KZ7 A;  1XX2 A;  1LL5 A;  3B0D B;  4Z9Q A;  3W99 D;  2P9V A;  2IWC A;  3P98 A;  4OH0 A;  3DAV A;  2EX9 A;  3MVD B;  1KGF A;  4I3A A;  2WGI A;  4B88 A;  3SH7 A;  2Y2P A;  3PXP A;  1LSW A;  4IHQ A;  5F68 A;  3ICY A;  4HY8 A;  3ZFZ A;  2EFX A;  3LIE A;  2F8N K;  2B18 A;  4L0L A;  2HPB A;  2XRN A;  3T4S A;  5EM0 A;  4HJ4 A;  2ZLY A;  4IBF A;  2V0W A;  1EQZ D;  3BYD A;  4QHC A;  4WV4 B;  4LRX C;  5B24 D;  1KVM A;  3ZG8 B;  3P01 A;  5F99 C;  1XPB A;  1ID3 D;  3LJA C;  3O62 D;  3NDG A;  2RVQ D;  1HQ3 A;  2J3T C;  1IYS A;  1P3I A;  3JPU A;  4QB8 A;  3PHY A;  3HLC A;  3VH5 T;  1UWP X;  5B1M B;  1PZP A;  4MB5 A;  1HQ3 C;  4JKT A;  1P3I C;  2HUE B;  4OJP A;  2IO5 B;  5B1L A;  3QP2 A;  5HAR A;  4IBR A;  5AVC B;  2MJ6 A;  5B1L C;  4KZ8 A;  3LZ1 D;  3C4O A;  3AZG A;  4YS3 A;  3IH9 A;  4I39 A;  4XZQ C;  4Z2L A;  4C6Y A;  4YM6 A;  5CGX A;  3REK A;  4YS3 C;  2ZOH A;  4OQ0 A;  1S32 C;  1S66 L;  5B0Y D;  4P6Z M;  4LV3 A;  3N6I A;  5AV5 A;  4YM6 C;  1Q9C A;  3BFF A;  1L0G A;  1K54 C;  4WZ5 C;  3VP0 A;  3MGR B;  1DJB A;  4UQI S;  3X1S B;  3VP4 A;  3O5Y A;  5GHY A;  2IOU A;  2HIO C;  3AZL D;  4XUJ C;  3OBF A;  1AOI D;  1P3L D;  2ZOI A;  3AN2 B;  4PAU A;  1P34 B;  4OUI A;  3IXH A;  5JA4 A;  4LD9 A;  5CP6 A;  1F9I A;  3Q82 A;  2XLN A;  4LCL A;  4DE0 A;  4LD9 C;  1D06 A;  3REH B;  3AZE A;  3PBQ A;  1XJ4 A;  1LI9 A;  3EQU A;  5AY8 A;  3B42 A;  3OLO A;  5CTN A;  3KUY D;  5EFW A;  5B40 B;  4Z5T B;  3B6G B;  2GZA A;  3UTB A;  4WU9 D;  2PYO A;  3NOT C;  5B2I C;  4NE6 A;  1S1Y A;  4H9Q A;  3UTB C;  3VP3 A;  2PYO C;  3BW6 A;  3M6H A;  2CV5 A;  5B33 B;  3NCK A;  1P3B B;  1ERM A;  4QU3 A;  3MVD D;  5AV5 D;  4Q0I A;  3TSG A;  3ITA A;  1UGU A;  4L9E A;  5B31 B;  3EPJ A;  2QZ6 A;  3MQL A;  1J3W A;  3IT9 A;  4P85 A;  1E15 A;  3WA9 B;  2O99 A;  3WD3 A;  4ZAM A;  3G31 A;  4D60 A;  4KQD A;  4IBI A;  4LV1 A;  4R70 A;  4KUK A;  4EU0 A;  1ZLA B;  5GT0 A;  5HAP A;  2ZBB A;  5CP6 D;  1BH9 A;  2F8N G;  2BYK B;  3CIT A;  4FOF A;  4CAY A;  3KXB B;  5GT0 C;  5CPJ B;  2F2A C;  3ZDJ A;  3PR6 A;  3AZE D;  5JRG C;  1P3P B;  3F1O B;  5G4Z A;  4WU8 B;  3AZN C;  1WE4 A;  5AY8 D;  1IEM A;  4OPY A;  3ZG5 A;  5B2J A;  3A3E A;  3RXX A;  1ODV A;  2Y2K A;  1F98 A;  2PD8 A;  3RXW A;  4HMC A;  2GX5 A;  1MZU A;  3VP1 A;  4BJP A;  5G4Y A;  3NDE A;  3WTP C;  4CQH A;  4BBV A;  4YFM A;  3W97 B;  1P0Z A;  4AWL C;  3BLS A;  3W98 B;  1TDG A;  1FSW A;  3MGP C;  3PAE A;  4EWF A;  1MBL A;  2BYM A;  3O3V A;  5AQB A;  1YLW A;  1YLY A;  4Y15 A;  1LL8 A;  1T18 A;  4M6B A;  4E44 A;  3G2Z A;  4K0W A;  5F69 A;  1DP6 A;  3G2Y A;  1PI5 A;  1H8P A;  3MZE A;  5U47 A;  1HZO A;  2BLS A;  1P3K D;  5EVE A;  1SDN A;  3P7N A;  2HZ5 A;  3B6F A;  1FSY A;  4BL2 A;  3AZM A;  3AZI A;  3OCN A;  4II7 A;  2ARO B;  5DNN A;  2WZX A;  3WD0 A;  3B6F C;  3AZM C;  3AZI C;  4DXC A;  3AN2 D;  1P34 D;  3BY9 A;  3IBR A;  4M3K A;  3AV2 B;  5CHL B;  4Y2F A;  4CLC B;  3UME A;  3PBR A;  3AGD A;  2ZC3 B;  5DF8 A;  5CPI A;  3LR0 A;  3CPT B;  4S2P A;  1CEF A;  3REJ D;  4O8G A;  3UB5 P;  5CPI C;  2PDR A;  2JKF A;  3PAG A;  1VET A;  1NXY A;  4Z5T D;  3T12 B;  4Z66 B;  3BM6 A;  4H9N B;  3X1U B;  2WGW B;  5EOO A;  2QJ5 A;  3D3O A;  3X1V B;  1TAF B;  2OLU A;  4QY6 A;  1NZO A;  2KX6 A;  1F2K A;  2AVX A;  4LLO B;  1KX4 D;  2ZM2 A;  4LPZ A;  1GSV A;  1XXM A;  5B33 D;  3G4P A;  1P3B D;  1K38 A;  2LB9 A;  2Y2H A;  1FOF A;  3UB8 A;  5DNM B;  4KUD D;  2OOL A;  2G7U A;  5G18 A;  4NZ1 A;  4WU8 C;  3MQ0 A;  5L8M A;  2K2N A;  5DNN D;  3N7W A;  3L7H A;  2DMW A;  3KSI A;  3MGS B;  3R7W B;  3SH8 A;  3AV1 C;  2JBF A;  4J8V D;  1GHM A;  3MGQ B;  3AFA B;  1E6R A;  2FZ0 A;  2J8Y A;  3OOV A;  3AZH B;  1RGY A;  1SKO A;  1TF1 A;  1ZKJ A;  4PMA A;  2JE5 A;  1M18 A;  5E5A A;  3W96 B;  1EAK A;  2D49 A;  2YFW B;  3LZ0 B;  3MQO A;  1M18 C;  3AGF A;  2WAE A;  3IQA A;  3C38 A;  1JTG A;  4MCW A;  1PW1 A;  3MXS A;  5GL9 A;  1K4F A;  5FQ9 A;  5GT3 A;  2W1T A;  1H5X A;  1KU5 A;  1P3O C;  1G68 A;  5FAQ A;  4LCM A;  2FJ7 B;  2A24 A;  5J7E A;  4XUZ A;  5GT3 C;  3ISG A;  4JGO A;  2C6W B;  3T4Q A;  4IBD A;  5TFQ A;  2ZY2 A;  4H9S C;  3UTA B;  5BNV B;  2VEA A;  4DF6 A;  3HJK A;  1N1J A;  4JXG A;  4DRA A;  4ME4 A;  3KWQ B;  1YMX A;  2A2L A;  2ZY5 A;  1P3M A;  3B0C T;  4J8W B;  2XRO A;  3H7W A;  4EQ1 A;  1KX3 A;  4NEE D;  2Y2M A;  5E5A D;  1U35 C;  2H5S A;  3GV9 A;  2CC1 A;  4DDY A;  1KX3 C;  5EVI D;  5B32 B;  3IF6 C;  3AV2 D;  4BMW A;  5GSU D;  2NZD B;  4CLC D;  4OQI A;  2ZQA A;  3HUO A;  4CSR B;  2O0Y A;  1KE3 A;  1TZY C;  1VM1 A;  4HP9 A;  4ZUX B;  4WNN A;  1C3B A;  4YIN A;  3UN7 A;  4OJ5 A;  3MNN A;  4Z2H A;  3QNC A;  5KSH A;  3B0C W;  4Z66 D;  1ZC2 A;  4X23 B;  4YNR A;  3IWI A;  5AV6 B;  2J9O A;  1JWZ A;  5TJJ A;  4DRT A;  3REI B;  3WAA A;  4NXE A;  1P3M D;  3A6N B;  1XFQ A;  3A3J A;  4G3W A;  2F8N H;  2J9P A;  1XGJ A;  4J8U B;  4HQA A;  1HVB A;  3MGS D;  1GXD A;  3E2K A;  3LEL A;  1P3F B;  2M7U A;  3BFE A;  1TEM A;  3IXG A;  1JFI B;  3KSF A;  4B4X A;  4S2I A;  1ALQ A;  3AFA D;  3LEL C;  2NQB A;  3LYX A;  5DTK A;  1KGE A;  4GHL A;  2KLI A;  3GVB A;  3LR4 A;  4G91 C;  3B47 A;  3WS2 A;  5DTT A;  1M40 A;  4F3L A;  3VOL A;  3U4L P;  1H3Q A;  5C3I C;  1MC0 A;  4X55 A;  1DP8 A;  3MNN D;  1MWT A;  3VOY A;  3VMA A;  1M1A B;  4HIA A;  4EEP A;  1DRM A;  4L9G A;  1XGI A;  3LR3 A;  1FIL A;  3VSK A;  4OQG A;  1R4V A;  3NY4 A;  1X0O A;  2M1C A;  4WEK A;  2VZW A;  1YLP A;  1LI0 A;  3BFD A;  4E6X A;  3DTK A;  1LSX A;  3NI9 A;  1E4D A;  4NZ5 A;  1GCE A;  3AGE A;  3MFX A;  3W99 B;  4PM9 A;  2QYB A;  3AZK A;  4BWI A;  4R4R A;  5AVE A;  3AYW D;  1P9R A;  5AQA A;  3A1I A;  1W79 A;  4EBP A;  1KX5 C;  1PIO A;  4IVI A;  4N92 A;  5CHM A;  3GRJ A;  4E6W A;  1F66 C;  1G6A A;  1YU3 A;  1GHP A;  5BNX A;  4H6J A;  1FQG A;  3X1T C;  1DY6 A;  1S6R A;  2PYP A;  1S4S A;  1KE4 A;  3AZF A;  1P3G A;  2PR6 A;  4IJF A;  4NYY A;  2VGL M;  1EQZ B;  1E25 A;  3ZNY A;  4JJN A;  5AV9 D;  3HLG A;  3KSG A;  2NZD D;  4LV0 A;  4HME A;  1W1V A;  3C7V A;  4JXW A;  4LRY C;  4KEN B;  5AV8 B;  4JJN C;  1ID3 B;  4X25 A;  5HL1 A;  2A49 A;  2ZQ9 A;  2PT7 A;  4PPR A;  4IBC A;  4NET A;  5FAO A;  1MWR A;  3FPW A;  5B0Z C;  3DTM A;  4ETZ A;  4KZ4 A;  1LSV A;  3TU4 C;  4S2K A;  4RVA A;  1NYY A;  3O86 A;  4E45 A;  2OAQ 1;  1F5M A;  2EWV A;  3LZ1 B;  3UO9 A;  3KFU G;  1ACF A;  3I7J A;  3BRM A;  5CPK D;  2G2U A;  3KYQ A;  4EBL A;  5F1F A;  1H0M A;  4U3T A;  2A3U A;  4KGC A;  3SW1 A;  1ESU A;  1QO6 A;  4J8X A;  1IOU A;  3UT9 D;  3C1C A;  1SCW A;  3AZF D;  1P3G D;  2E8J A;  3EWK A;  4QLC A;  4KGC C;  3HCY A;  5FDH A;  4OOL A;  2PBY A;  1TS0 A;  3V5M A;  1L6J A;  1KOU A;  3KO6 A;  3S7N A;  1YU0 A;  4KG2 A;  3A3D A;  4QLC C;  1Y4O A;  3AZL B;  2RIQ A;  1AOI B;  1H0G A;  1ES5 A;  4RX2 A;  3WX7 A;  1P3L B;  3WS0 A;  3MMH A;  3NOP C;  4GS9 A;  1YU2 A;  2VKS A;  1WYB A;  4JLF A;  1ERQ A;  2P04 A;  5GHX A;  3BQA A;  4HI4 A;  5BT1 C;  5IT5 A;  5FI7 A;  1GSX A;  4JGQ A;  3U2A A;  4HJ3 A;  4RYE A;  4E04 A;  3UE6 A;  2VV7 A;  4BL3 A;  3QP4 A;  4HHD A;  3KUY B;  1PRQ A;  4S2N A;  4JXV A;  4EXO A;  1CJF A;  4P6B A;  4WU9 B;  3AZG B;  5GXQ A;  2ZM8 A;  2VGL S;  4CJN A;  4S2N C;  3C1B D;  3REK B;  2LB5 A;  3N8S A;  5GXQ C;  5J4E A;  3BY8 A;  4J8X D;  5AV5 B;  2XDM A;  2WKR A;  3M2K A;  4ARZ B;  3S7Q A;  2X71 A;  5B24 C;  5EOE A;  2HGV A;  3GR2 A;  2B5R A;  3L26 A;  4HES A;  2YKF A;  3KS4 A;  3A0S A;  1TDL A;  3O62 C;  1T1B A;  3GTC A;  2RVQ C;  3SS3 A;  2I9V A;  2P7J A;  3FZC A;  4K0X A;  1YU1 A;  4GD6 A;  5CP6 B;  4MDZ A;  1B67 A;  1JWP A;  4EUZ A;  5F99 A;  3DTE A;  3B33 A;  3LJA A;  1B6W A;  4EER A;  4RQ9 A;  2ZM5 A;  3AZE B;  2PBD P;  2W3G A;  4WLA A;  2WKH A;  3E98 A;  2JC7 A;  2EXA A;  3HLD A;  1M19 A;  5E2F A;  5AY8 B;  3REL A;  5AV8 D;  5HWT A;  5LBR A;  5M1A A;  4EEU A;  5AVB A;  2VGK A;  4FUW A;  2P74 A;  3BQ8 A;  5GLD A;  4EO5 B;  2B02 A;  3UE3 A;  4U0X A;  1M19 C;  2B95 A;  3REL C;  2XFS A;  5CGS A;  3E4O A;  5AVB C;  1D1J A;  4H9Q B;  2OWH A;  1KE0 A;  5HPI A;  1GPF A;  1T1A A;  5B0Y C;  3DTI A;  2H0T A;  1YU4 A;  4KZ6 A;  4EBN A;  3V3S A;  2CV5 B;  5KDM B;  1SDE A;  3UPN A;  3HON A;  4MNR A;  3SS5 A;  4BEN A;  1L3L A;  1W1T A;  5TBM A;  4XZQ A;  1P3A A;  4DRB A;  3LO7 A;  3A0R A;  1K25 A;  3WKJ A;  1S32 A;  3UDX A;  2Y2I A;  3V3R A;  4FH2 A;  4DE2 A;  4E3I A;  1P3A C;  3HLW A;  1P3L C;  4H9O A;  3UMD A;  1K54 A;  3CG5 A;  4WZ5 A;  3AZJ C;  4BD1 A;  3WKJ C;  3OPR A;  3KYZ A;  1BH9 B;  1P3K B;  4R1G A;  4NXF A;  1Q2P A;  2HIO A;  4KHA A;  2Y59 A;  4CAY B;  4XUJ A;  3ZVT A;  5F99 D;  3N8L A;  2WGV A;  4R8P C;  3LJA D;  1PZO A;  1E88 A;  3EEH A;  2QWS A;  5IU1 A;  4OJ6 A;  5B2J B;  2Y4A A;  1HQ3 D;  2HJE A;  4WU9 C;  1IKG A;  2CMN A;  1P3I D;  1WWS A;  3JYI A;  2Z2L B;  2WUQ A;  1VEU A;  3B3X A;  2JKR M;  3S4X A;  3B0D C;  1H8Z A;  5FL3 A;  4D2O A;  4IBK A;  5HWW A;  3REJ B;  3V50 A;  1H8M A;  1HLU P;  5B1L D;  3MVD C;  3CWF A;  1N9O A;  2V1B A;  4X69 A;  2BYM B;  5HDC A;  5B2I A;  3D72 A;  1YSP A;  3AZG D;  4YS3 D;  2Y2N A;  3BWL A;  1NWZ A;  3PBT A;  1S32 D;  4ZJ2 A;  5AQ7 A;  3E4Q A;  4YM6 D;  2F8N A;  5I94 A;  3REK D;  3GMW A;  1KX4 B;  4NG2 A;  1BH8 A;  3L2A A;  4UUZ B;  1V9Z A;  3IS2 B;  4KUD B;  2K31 A;  3V39 A;  5BS7 A;  4JGP A;  4ZBE A;  4ZBJ B;  4LRZ E;  4B4Z A;  3B0B A;  4BLM A;  3C5A A;  3H9W A;  5DNN B;  5CXW A;  1H8Y A;  3H0R C;  3LCE A;  5BS7 C;  4S2O A;  4PM7 A;  5EM1 A;  5FUG B;  4LD9 D;  3R45 A;  5B1M C;  4J8V B;  5JRG A;  4ZDX A;  5EPH A;  1S67 L;  2Y2O A;  2XR0 A;  3G34 A;  2M7V A;  5AVC A;  1YM1 A;  3AZN A;  2HUE C;  2IO5 C;  4OLG A;  4JPM A;  3VE3 A;  1YKD A;  5AVC C;  4HBT A;  4I5S A;  3VFF A;  1QME A;  3FG8 A;  3WTP A;  2WKI A;  1VET B;  3EQV A;  4MBH A;  5B2I D;  2EA9 A;  1XJ6 A;  4P6Z S;  3ZQ5 A;  3UTB D;  1AIW A;  4HOI A;  3UE1 A;  4NK3 A;  2D02 A;  2PYO D;  5E43 A;  4WN5 A;  3MGP A;  4UA7 A;  1PWD A;  3MGR A;  2F8N D;  4ETX A;  4FSF A;  4NY2 A;  3L9K A;  1OPX A;  5E2E A;  4H9P A;  2CV5 D;  3X1S A;  3OPH A;  4HGA B;  4EES A;  4EUV A;  5HWV A;  1Z6F A;  3LIA A;  3MGR C;  2L4R A;  2ZMF A;  3VSL A;  1YQS A;  2P08 A;  5DKL A;  4E3O A;  3X1S C;  4MLL A;  1RGZ A;  2Z6D A;  3BEB A;  3FPV A;  4UA6 A;  3G6O A;  4KZ5 A;  4XT2 A;  1NY0 A;  3ZVW A;  3AN2 C;  3BLM A;  1P34 C;  1CQA A;  1M6K A;  3REH A;  3FWL A;  5GT0 D;  1Y54 A;  1XP4 A;  4NZ4 A;  4E3M A;  3REH C;  5B40 A;  3B6G A;  3IXB A;  4F94 A;  3V9R B;  2VJW A;  3HLF A;  3NHQ A;  4HH3 A;  3VOZ A;  2PU2 A;  1OTA A;  3OCL A;  1VB6 A;  3O88 A;  4P0M A;  5E5A B;  3IHB A;  5B40 C;  4Z5T C;  3B6G C;  3Q7V B;  4OPQ A;  3T1Q B;  5B2J D;  3N8R A;  3UPO A;  1DP9 A;  2PR5 A;  5EVI B;  2XGN A;  2YFV A;  4HMD A;  1J9M A;  1K6R A;  5GSU B;  4NE5 A;  1W7F A;  3T50 A;  2EX6 A;  3TRC A;  3MGP D;  1QMF A;  5B31 A;  4WM9 A;  4JF5 A;  1Q2Q A;  5CHJ A;  1LLB A;  5B33 C;  1P3B C;  4M4X A;  4OPR A;  2A24 B;  5B31 C;  3WA9 A;  3WD1 A;  4K91 A;  1Z09 A;  2RCX A;  4LEN A;  1OT6 A;  1ZLA A;  3CI6 A;  2ZC5 B;  3W4O A;  3FDD A;  5BPV A;  4GCZ A;  1W8Q A;  4EV4 A;  2GDN A;  5J8X A;  3WA9 C;  3IH8 A;  4DDS A;  3ZYT A;  1ZG4 A;  1N1J B;  3OZH A;  1PYY A;  2XD1 A;  5FAT A;  2FFF B;  3KXB A;  1ZLA C;  1OTE A;  2ZL1 B;  4ID4 A;  3NQJ B;  5CPJ A;  3RJU A;  1KDW A;  3NEC A;  3QP6 A;  4Q0H A;  3T1X A;  2O9C A;  5B31 G;  1P3P A;  1HTZ A;  4WU8 A;  3KXB C;  1P3M B;  3TJZ C;  4FH4 A;  3ZHH A;  2XSS A;  5CPJ C;  2W8S A;  3B6F D;  3MFD A;  4X53 A;  3AZM D;  5L2F A;  3AZI D;  1P3P C;  1ZHH B;  3H7W B;  3UB6 A;  1SKF A;  1CI9 A;  1WYC A;  3AV1 A;  3EPK A;  2VK3 A;  1I2W A;  4IUH A;  4WYY A;  1MKM A;  1IEL A;  3N4I A;  5CGW A;  2QKP A;  3S7P A;  5CPI D;  1OJ5 A;  4MN5 A;  3W97 C;  3A3F A;  1K56 A;  4B9O A;  4H9R B;  1I5Q A;  3W98 C;  2Z6C A;  2J7V A;  3NOU C;  4A5R A;  4K08 A;  3FV7 A;  2V0U A;  4BD0 A;  1NZU A;  4BBU A;  2VA0 A;  4GD8 A;  4DMZ A;  3MNN B;  2XA7 M;  1I2S A;  2Q9M A;  4Y0U A;  3T4J A;  3UDF A;  1P3O A;  3F6T A;  2Y8H A;  3MF0 A;  3NC8 A;  1HTA A;  4Q0J A;  3PBS A;  3WAA B;  1ERO A;  4H9S A;  1L0F A;  2ARO A;  2IWB A;  4X56 A;  3FKV A;  5HDS A;  3F1N A;  3HVF A;  4CPK A;  5FAS A;  1ED7 A;  2ARO C;  4NZ3 A;  1GA9 A;  3AV1 D;  3H82 A;  3CPT A;  3AYW B;  3AV2 C;  4CLC C;  4GKU A;  1PNE A;  3HUN A;  4N9L A;  3WS5 A;  4WMC A;  2NQB B;  1T19 A;  2JCH A;  3H0M C;  1U35 A;  4G92 B;  4UAA A;  3UB7 A;  4E3N A;  2W3F A;  4H9N A;  3X1U A;  1K4E A;  4RX3 A;  1M18 D;  2WGW A;  5I5L A;  3IF6 A;  4WEL A;  5EE8 A;  1G28 A;  4QJG A;  1TAF A;  2V20 A;  3UNW A;  4Z66 C;  4EET B;  3X1U C;  1TZY A;  5AV9 B;  4GLQ A;  1W2E A;  1BSG A;  5CEB A;  3X1V C;  3TE8 A;  4C3Q A;  2VLG A;  1MXO A;  5GT3 D;  5DNM A;  1E3U A;  1L0E A;  3MZD A;  4NYU A;  5FQQ A;  2V1Z A;  4KQR A;  3QP8 A;  5DNM C;  3R7W A;  4WF0 A;  4KQO A;  3MGS C;  4TX8 A;  3MGQ A;  3DW0 A;  5JYO A;  4LV2 A;  5AJG A;  3WTP E;  1TVF A;  1W1P A;  3FYZ A;  3AZH A;  3O87 A;  1S4R A;  4I3J A;  2W3E A;  4Y7P A;  3MGQ C;  3AFA C;  1N9B A;  2R9W A;  3W96 A;  4MBF A;  1O7E A;  3LZ0 A;  5CPK B;  3AZH C;  2XA7 S;  3MZF A;  1H3O B;  4H6J B;  2V9A A;  4PM5 A;  1XJ3 A;  1KX3 D;  3W96 C;  1MPL A;  3MKF A;  1YLZ A;  3LZ0 C;  4NE3 A;  3UT9 B;  3AZF B;  1P3G B;  3HL9 A;  4GOG A;  2ZC4 B;  4MEZ A;  1TZY D;  2PYR A;  2FJ7 A;  1YUE A;  1TS6 A;  4I38 A;  3MSH A;  4GHI A;  2FJ7 C;  1CXW A;  2BTF P;  4IBX A;  3CUE C;  3F1P B;  3UTA C;  5GHZ A;  5BO0 A;  5G49 B;  3WRZ A;  3L28 A;  3KWQ A;  1XA7 A;  3KX0 X;  4PKY G;  1W1Y A;  3ZG9 B;  3KWQ C;  4J8W A;  4KUO A;  4DKI A;  3WAA D;  3NQU B;  3K3C A;  1NJ4 A;  2ZY3 A;  3WS1 A;  3ZCZ A;  4J8W C;  1BTL A;  3C1B B;  4DXB A;  1WWI A;  2Y91 A;  3UDI A;  3C2W A;  1KX5 A;  4J8X B;  2WZZ A;  2WAD A;  4PM8 A;  3C1C B;  3EOI A;  2PD7 A;  3LEL D;  5B32 C;  1F66 A;  3Q81 A;  4R3J A;  2NZD C;  3K2N A;  4ZUX A;  3X1T A;  1OME A;  2OAP 1;  3IF5 A;  4L9F A;  4OP8 A;  2NQB D;  4WL9 A;  4MN7 A;  2JKT M;  4R38 A;  5E2G A;  3KYE A;  5A93 A;  3GEC A;  2Y2L A;  2ZD8 A;  3W4Q A;  4ZUX C;  1HD8 A;  1Z2C B;  2ZMA A;  4GS9 B;  5FEG A;  4KZB A;  1CK3 A;  1F1E A;  1BT5 A;  5B32 G;  1CK7 A;  2J80 A;  4X23 C;  1CF0 A;  4LFU A;  2V2F F;  3IHA A;  5AV6 C;  1L0D A;  4B93 A;  4IED A;  4Z2M G;  2JN7 A;  5JYP A;  4X6T A;  4HJ6 A;  3REI C;  3A6N A;  2YKH A;  1XFN A;  4HEF A;  5B0Z A;  1E6Z A;  2Q0O A;  4DE3 A;  5FQK A;  4J8U A;  3A6N C;  3G32 A;  4HBU A;  3AL0 C;  1E8B A;  4E3K A;  3HBR A;  3TU4 A;  1P3F A;  1K0K A;  3QHY A;  2P9V B;  1UR9 A;  1OGG A;  2W3D A;  4J8U C;  3WD2 A;  2XEP A;  3AZK D;  1P3F C;  1OTI A;  2FN2 A;  4EW7 A;  1UR8 A;  1F66 D;  3NJA A;  4OKP A;  3X1T D;  3LEQ A;  1IYP A;  4RA7 A;  3T4L A;  1FCN A;  2NUT C;  5HPF A;  2FH5 A;  2W0N A;  4S2M A;  4IBB A;  5M18 A;  1YLJ A;  4OQH A;  1M1A C;  3MR0 A;  5F99 B;  1OJG A;  4JJN D;  1PWG A;  2HV1 A;  3WRT A;  3LJA B;  1VQQ A;  4WUJ A;  4N1H A;  3P5J B;  5DJT A;  1DJC A;  2ZJ9 A;  1P9W A;  4QNL A;  3W99 A;  1HQ3 B;  1E6N A;  3CMZ A;  3VV4 A;  5B0Z D;  1P3I B;  2EWW A;  5IS1 A;  4Q8I A;  1EI5 A;  3W99 C;  1NLY A;  4ZJ1 A;  5EUA A;  4G3K A;  2WK0 A;  3A1K A;  5B1L B;  1RP5 A;  2Y55 A;  2XQZ A;  3E2L A;  1NYM A;  3LI8 A;  5KMW A;  5CX7 A;  4XZQ B;  5CHU A;  4AFI A;  1GHI A;  3IX8 A;  3C30 A;  4X1M A;  4YS3 B;  1JWV A;  1S32 B;  2DNS A;  4IUK A;  4NXG A;  3FKE A;  4H9O B;  3IBJ A;  4YM6 B;  3VE4 A;  1EQZ A;  1T1C A;  4FD8 A;  4KGC D;  1PDC A;  5B24 A;  5FDS A;  5DVA A;  3C1C D;  1EQZ C;  4DN0 A;  2DCF A;  2HIO B;  4QLC D;  4KHA B;  5DFX A;  4XUJ B;  3O62 A;  4GB7 A;  4R3A A;  5F5Y A;  4X68 A;  4R3B A;  2RTS A;  4UQI M;  5AV8 C;  1ID3 C;  1OGB A;  3NBL A;  1T3U A;  1PZR A;  2J8P A;  2DF4 C;  4NKP A;  5BT1 D;  2HJ9 C;  3DBA A;  3T1R A;  5JA4 B;  4LD9 B;  3S1Y A;  1EWZ A;  1BZA A;  1VEU B;  1PFL A;  4QPR A;  4BBT A;  2WKQ A;  5AVF A;  2HP9 A;  3LZ1 A;  2ZC6 B;  2R9X A;  3KSH A;  3Q7Z A;  2V1A A;  5CEC A;  1A7W A;  5B2I B;  1XKZ A;  3EGX C;  3LZ1 C;  4JGR A;  3UTB B;  4Y3I A;  3MJQ A;  2I72 A;  2PYO B;  5B0Y A;  5GXQ D;  1KDS A;  5HL6 A;  1W8Y A;  2F8N B;  4QY5 A;  5EEC A;  2H0Y A;  2QJ7 A;  1PWC A;  4S2J A;  1BH8 B;  3VH6 A;  2C5W B;  3AZL A;  1AOI A;  1K6S A;  1P3L A;  2ZQC A;  1CI8 A;  1XA1 A;  4KZA A;  3AZJ A;  2VV6 A;  3PBO A;  3OPL A;  3FC7 A;  3AZL C;  1AOI C;  4BQM A;  5BOH A;  1XJ2 A;  3IXD A;  3RH8 B;  5TR7 A;  4Z2K A;  5GT0 B;  4R8P A;  1RCJ A;  2ZMV A;  3R45 B;  2BG1 A;  5JRG B;  4HP4 A;  5MC7 A;  4JXS A;  5GLC A;  3KUY A;  3AZN B;  4XXR A;  3LUQ A;  2EFU A;  4O7D A;  4WU9 A;  2J3T D;  3TG9 A;  3KUY C;  5CER A;  1W63 Q;  1M19 D;  2W3H A;  3REL D;  3WTP B;  1JNU A;  5L09 A;  5AVB D;  3EPL A;  3AZG C;  4AWL B;  2W1R A;  2XFT A; 
#chains in the Genus database with same CATH homology
 3MVD A;  3MGP B;  3REK C;  3VH5 W;  2EX2 A;  3DWK A;  2OLV A;  2G2W A;  4H9P B;  5AV5 C;  2OSU A;  5HFO A;  4N9K A;  5FI6 A;  4XZQ D;  1P3A D;  5CRF A;  4OP5 A;  3AZJ D;  2E8I A;  3LY3 A;  3WKJ D;  4OLD A;  4GDB A;  1ES4 A;  5KZH A;  5CP6 C;  4GZB A;  3BFC A;  4R8P D;  3WWX A;  3VFH A;  2HIO D;  4XUJ D;  3B6F B;  3AZM B;  3AZI B;  3AZE C;  4FCF A;  2VGJ A;  1K57 A;  5AY8 C;  5B1M A;  5F82 A;  3QNB A;  4EO5 C;  1FCM A;  1FR1 A;  2YFV B;  1K57 C;  2ZQD A;  4QD4 A;  5KDM A;  4Z2M H;  5CPI B;  1BLS A;  4KG5 A;  1S0W A;  4UHU A;  3ZG7 B;  2CV5 C;  3N3F A;  5HX9 A;  1BUL A;  4OON A;  5A90 A;  2CWE A;  2XD5 A;  1P3K A;  2Q9N A;  1P3K C;  4H8R A;  2UWX A;  1ONH A;  4EQI A;  4P87 A;  1NRF A;  3AN2 A;  1O07 A;  1P34 A;  4JBF A;  4JF4 A;  3OC2 A;  4DE1 A;  3BFG A;  3AV1 B;  4IBG A;  5B1M D;  5B2J C;  1IYQ A;  5HAI A;  3REJ A;  4ZTK A;  3IP4 C;  5JRG D;  5AVC D;  3REJ C;  1W5D A;  3AZN D;  1YT4 A;  5FQI A;  4Z5T A;  4OOY A;  1M18 B;  3WTP D;  3ITB A;  3VH5 A;  4R23 A;  1ESI A;  1KX4 A;  3C4P A;  2DRW A;  5B33 A;  1P3B A;  1P3O B;  5CED A;  1SHV A;  3GQZ A;  4UUZ A;  5GT3 B;  3MGR D;  1KX4 C;  4KUD A;  2JSS A;  1BUE A;  3X1S D;  1JTD A;  4KUD C;  5GLA A;  4ZBJ C;  4GN2 A;  5FUG A;  2L5A A;  1JVJ A;  5DNN C;  3C7U A;  5DTS A;  2BYK A;  4J8V A;  5E2H A;  1ONG A;  1FCO A;  3REH D;  1BLC A;  4J8V C;  3HRE A;  4U0T A;  4N1X A;  5FQM A;  1U35 B;  2XH9 A;  2HDS A;  4Y0O A;  5M19 A;  5B40 D;  3B6G D;  3W8K A;  1KX3 B;  2WKE A;  3IF6 B;  2RL3 A;  2G5I C;  5FSR A;  3W97 A;  4E3J A;  1U60 A;  2X02 A;  1TZY B;  3W98 A;  3KS8 A;  5B31 D;  3SS4 A;  4WJ3 C;  3G30 A;  4HGA C;  3M2J A;  4WNN B;  1MWS A;  3WA9 D;  1ZLA D;  3WS4 A;  5CTM A;  3P09 A;  3S22 A;  1BFM A;  2PU4 A;  2FFY A;  3KXB D;  3MKE A;  5CPJ D;  3NIA A;  3V9R A;  1P3P D;  2Y2J A;  3H0L C;  3CZD A;  4GNU A;  4KZ9 A;  4WU8 D;  3Q7V A;  5A91 A;  4WZS B;  3G35 A;  5EVI A;  2VQR A;  3AV2 A;  5E5A C;  5GSU A;  1FR6 A;  1YMS A;  3BEC A;  3UE0 A;  3LEL B;  5EVI C;  3W97 D;  4ZJ3 A;  5AQ9 A;  5FI2 A;  4IJE A;  3HLE A;  5GSU C;  5A92 A;  4G91 B;  3W98 D;  3CJM A;  3UY6 A;  4XUX A;  1K56 D;  4OVD A;  3SOI A;  5C3I B;  4Z66 A;  3A3I A;  2QMI A;  3X1V A;  4NFT A;  5GLB A;  3NQJ A;  5BO0 B;  4GH9 A;  4IVK A;  1ES2 A;  1P3O D;  4MBK A;  3OPP A;  5D3O A;  1ES3 A;  1N4O A;  3ZNT A;  2XF3 A;  1P3M C;  2ARO D;  4OJL A;  3MGS A;  1KX5 B;  3AFA A;  3AZK B;  3L27 A;  3VP2 A;  1L2S A;  4H9R A;  1F66 B;  3D4F A;  3X1T B;  4WMC D;  2YFW A;  1U35 D;  4UPK A;  5BNX B;  2ZM0 A;  3X1U D;  1ULY A;  3X1V D;  5F1G A;  3MNN C;  1MKI A;  3MBZ A;  4JJN B;  5KSC A;  2WAF A;  2OV5 A;  3TOI A;  3ZG0 A;  5DNM D;  1E3U D;  4WZ4 A;  3WAA C;  3UTA A;  1LL9 A;  1MWU A;  5B0Z B;  3PTE A;  5BNV A;  3IWQ A;  2WYX A;  4OJO A;  4GHA A;  4C75 A;  2Y2Q A;  3AYW A;  3TU4 B;  1BLP A;  4GDN A;  3EG5 B;  3L29 A;  2EXB A;  3MGQ D;  3AYW C;  3DWZ A;  3AZH D;  1AXB A;  4DQY B;  2EX8 A;  2NQB C;  4E3L A;  3W96 D;  4G92 C;  3LZ0 D;  1ZG6 A;  5B32 A;  4KGC B;  3LEZ A;  5AV9 A;  2NZD A;  2HDQ A;  4JF6 A;  4CSR A;  3LY4 A;  4QLC B;  5AV9 C;  1IKI A;  1DJA A;  5TGF A;  4R0Q A;  2FJ7 D;  3MXR A;  3UPP A;  4OOM A;  2G5H C;  5HAQ A;  4X23 A;  3Q1F A;  3UTA D;  5AV6 A;  2H10 A;  1BLH A;  3REI A;  3KWQ D;  3VH6 T;  4UA9 A;  3AZK C;  4PM6 A;  5DF9 A;  2HDR A;  5EVL A;  2ZY4 A;  5CPK A;  1H3O A;  4J8W D;  3Q07 A;  3IWO A;  4LG2 A;  5IHV A;  2Y2G A;  1MY8 A;  5FA7 A;  5GXQ B;  5CPK C;  3SH9 A;  3UT9 A;  2ZQ8 A;  4KG6 A;  3W4P A;  5B32 D;  1JFI A;  1KX5 D;  3UT9 C;  5B24 B;  3AZF C;  1P3G C;  2LY8 A;  3GSG A;  3ZGA B;  1KVL A;  3O62 B;  4IBJ A;  4ZUX D;  2ZQ7 A;  2HP6 A;  2DQN C;  3VH6 W;  1KGG A;  5FQJ A;  3KSY A;  2Z2M B;  3M6B A;  5G49 A;  4X23 D;  4WBG A;  1M1A A;  3EPH A;  2XK1 A;  4Y0T A;  5AV6 D;  1PI4 A;  2IWD A;  2HDU A;  2HP5 A;  3PBN A;  3REI D;  4WEJ A;  1K55 A;  3NQU A;  4IBE A;  5FAP A;  4KQQ A;  1M19 B;  3HSH A;  3REL B;  3A6N D;  3C1B A;  5AVB B;  1K55 C;  4R4S A;  5B0Y B;  4J8U D;  1IYO A;  2QPN A;  3C1B C;  3HLB A;  3TU4 D;  1P3F D;  1PW8 A;  1YLT A;  4S2L A;  4J8X C;  3C1C C;  4KZ3 A;  5F83 A;  1P3A B;  3L25 A;  3AZJ B;  3WKJ B;  1M1A D;  1GA0 A;  3FKW A;  4R8P B;  4OPZ A;  1CEG A;  2ZC7 A;  5AV8 A;  1ID3 A;  5HW3 A;  2X01 A;  3HUM A;  1LHY A;  5DF7 A;  4KZ7 A;  1XX2 A;  1LL5 A;  3B0D B;  4Z9Q A;  3W99 D;  2P9V A;  2IWC A;  3P98 A;  4OH0 A;  2EX9 A;  3MVD B;  1KGF A;  2WGI A;  4B88 A;  3SH7 A;  2Y2P A;  3ZFZ A;  2EFX A;  2F8N K;  4L0L A;  2HPB A;  2ZLY A;  4IBF A;  1EQZ D;  3BYD A;  4QHC A;  4WV4 B;  5B24 D;  1KVM A;  3ZG8 B;  5F99 C;  1XPB A;  1ID3 D;  3LJA C;  3O62 D;  3NDG A;  2RVQ D;  1HQ3 A;  1IYS A;  1P3I A;  4QB8 A;  3HLC A;  3VH5 T;  5B1M B;  1PZP A;  1HQ3 C;  4JKT A;  1P3I C;  2HUE B;  4OJP A;  2IO5 B;  5B1L A;  5HAR A;  4IBR A;  5AVC B;  5B1L C;  4KZ8 A;  3LZ1 D;  3C4O A;  3AZG A;  4YS3 A;  3IH9 A;  4XZQ C;  4C6Y A;  4YM6 A;  5CGX A;  3REK A;  4YS3 C;  4OQ0 A;  1S32 C;  5B0Y D;  4LV3 A;  3N6I A;  5AV5 A;  4YM6 C;  1Q9C A;  3BFF A;  1L0G A;  1K54 C;  4WZ5 C;  3VP0 A;  3MGR B;  1DJB A;  3X1S B;  3VP4 A;  5GHY A;  2IOU A;  2HIO C;  3AZL D;  4XUJ C;  1AOI D;  1P3L D;  3AN2 B;  1P34 B;  4OUI A;  3IXH A;  5JA4 A;  4LD9 A;  5CP6 A;  3Q82 A;  2XLN A;  4LCL A;  4DE0 A;  4LD9 C;  3REH B;  3AZE A;  3PBQ A;  1LI9 A;  3EQU A;  5AY8 A;  5CTN A;  3KUY D;  5B40 B;  4Z5T B;  3B6G B;  3UTB A;  4WU9 D;  2PYO A;  5B2I C;  4NE6 A;  4H9Q A;  3UTB C;  3VP3 A;  2PYO C;  3M6H A;  2CV5 A;  5B33 B;  3NCK A;  1P3B B;  1ERM A;  4QU3 A;  3MVD D;  5AV5 D;  3TSG A;  3ITA A;  5B31 B;  3EPJ A;  2QZ6 A;  3IT9 A;  4P85 A;  3WA9 B;  4ZAM A;  3G31 A;  4IBI A;  4LV1 A;  1ZLA B;  5GT0 A;  5HAP A;  5CP6 D;  1BH9 A;  2F8N G;  2BYK B;  4CAY A;  3KXB B;  5GT0 C;  5CPJ B;  2F2A C;  3ZDJ A;  3AZE D;  5JRG C;  1P3P B;  4WU8 B;  3AZN C;  1WE4 A;  5AY8 D;  1IEM A;  4OPY A;  3ZG5 A;  5B2J A;  3A3E A;  3RXX A;  2Y2K A;  3RXW A;  3VP1 A;  4BJP A;  3NDE A;  3WTP C;  4YFM A;  3W97 B;  4AWL C;  3BLS A;  3W98 B;  1TDG A;  1FSW A;  3MGP C;  3PAE A;  4EWF A;  1MBL A;  2BYM A;  3O3V A;  5AQB A;  1YLW A;  1YLY A;  4M6B A;  4E44 A;  3G2Z A;  4K0W A;  3G2Y A;  1PI5 A;  3MZE A;  5U47 A;  1HZO A;  2BLS A;  1P3K D;  1SDN A;  3B6F A;  1FSY A;  4BL2 A;  3AZM A;  3AZI A;  3OCN A;  2ARO B;  5DNN A;  2WZX A;  3B6F C;  3AZM C;  3AZI C;  4DXC A;  3AN2 D;  1P34 D;  4M3K A;  3AV2 B;  5CHL B;  3PBR A;  3AGD A;  2ZC3 B;  5DF8 A;  5CPI A;  4S2P A;  1CEF A;  3REJ D;  5CPI C;  3PAG A;  1NXY A;  4Z5T D;  4Z66 B;  3BM6 A;  4H9N B;  3X1U B;  2WGW B;  5EOO A;  3X1V B;  1TAF B;  2OLU A;  4QY6 A;  1NZO A;  1KX4 D;  2ZM2 A;  1XXM A;  5B33 D;  3G4P A;  1P3B D;  1K38 A;  2Y2H A;  1FOF A;  5DNM B;  4KUD D;  5G18 A;  4NZ1 A;  4WU8 C;  5DNN D;  3N7W A;  3MGS B;  3SH8 A;  3AV1 C;  2JBF A;  4J8V D;  1GHM A;  3MGQ B;  3AFA B;  2J8Y A;  3AZH B;  1RGY A;  1ZKJ A;  4PMA A;  2JE5 A;  1M18 A;  5E5A A;  3W96 B;  2YFW B;  3LZ0 B;  1M18 C;  3AGF A;  2WAE A;  3IQA A;  1JTG A;  1PW1 A;  3MXS A;  5GL9 A;  1K4F A;  5FQ9 A;  5GT3 A;  1H5X A;  1KU5 A;  1P3O C;  1G68 A;  5FAQ A;  4LCM A;  2FJ7 B;  4XUZ A;  5GT3 C;  3ISG A;  2C6W B;  4IBD A;  5TFQ A;  2ZY2 A;  4H9S C;  3UTA B;  5BNV B;  4DF6 A;  1N1J A;  4JXG A;  4DRA A;  3KWQ B;  1YMX A;  2ZY5 A;  1P3M A;  3B0C T;  4J8W B;  1KX3 A;  2Y2M A;  5E5A D;  1U35 C;  2H5S A;  3GV9 A;  2CC1 A;  4DDY A;  1KX3 C;  5EVI D;  5B32 B;  3IF6 C;  3AV2 D;  5GSU D;  2NZD B;  4OQI A;  2ZQA A;  3HUO A;  4CSR B;  1KE3 A;  1TZY C;  1VM1 A;  4ZUX B;  4WNN A;  1C3B A;  4YIN A;  3UN7 A;  4OJ5 A;  3MNN A;  3QNC A;  5KSH A;  3B0C W;  4Z66 D;  1ZC2 A;  4X23 B;  3IWI A;  5AV6 B;  2J9O A;  1JWZ A;  4DRT A;  3REI B;  3WAA A;  1P3M D;  3A6N B;  3A3J A;  2F8N H;  2J9P A;  1XGJ A;  4J8U B;  1HVB A;  3MGS D;  3E2K A;  3LEL A;  1P3F B;  3BFE A;  1TEM A;  3IXG A;  1JFI B;  4B4X A;  4S2I A;  1ALQ A;  3AFA D;  3LEL C;  2NQB A;  5DTK A;  1KGE A;  4GHL A;  3GVB A;  4G91 C;  3WS2 A;  5DTT A;  1M40 A;  5C3I C;  4X55 A;  3MNN D;  1MWT A;  3VOY A;  3VMA A;  1M1A B;  1XGI A;  3VSK A;  4OQG A;  1R4V A;  3NY4 A;  4WEK A;  1YLP A;  1LI0 A;  3BFD A;  4E6X A;  3NI9 A;  1E4D A;  4NZ5 A;  1GCE A;  3AGE A;  3W99 B;  4PM9 A;  3AZK A;  4R4R A;  3AYW D;  5AQA A;  3A1I A;  1W79 A;  4EBP A;  1KX5 C;  1PIO A;  4IVI A;  4N92 A;  5CHM A;  3GRJ A;  4E6W A;  1F66 C;  1G6A A;  1YU3 A;  1GHP A;  5BNX A;  1FQG A;  3X1T C;  1DY6 A;  1S6R A;  1KE4 A;  3AZF A;  1P3G A;  4IJF A;  4NYY A;  1EQZ B;  1E25 A;  3ZNY A;  4JJN A;  5AV9 D;  3HLG A;  2NZD D;  4LV0 A;  3C7V A;  4JXW A;  4KEN B;  5AV8 B;  4JJN C;  1ID3 B;  5HL1 A;  2A49 A;  2ZQ9 A;  4PPR A;  4IBC A;  4NET A;  5FAO A;  1MWR A;  5B0Z C;  3DTM A;  4KZ4 A;  3TU4 C;  4S2K A;  4RVA A;  1NYY A;  3O86 A;  4E45 A;  3LZ1 B;  3UO9 A;  3KFU G;  3I7J A;  3BRM A;  5CPK D;  2G2U A;  4EBL A;  5F1F A;  4U3T A;  2A3U A;  4KGC A;  1ESU A;  4J8X A;  3UT9 D;  3C1C A;  1SCW A;  3AZF D;  1P3G D;  4QLC A;  4KGC C;  5FDH A;  4OOL A;  2PBY A;  3V5M A;  1YU0 A;  4KG2 A;  3A3D A;  4QLC C;  3AZL B;  2RIQ A;  1AOI B;  1ES5 A;  4RX2 A;  3WX7 A;  1P3L B;  3WS0 A;  1YU2 A;  4JLF A;  1WYB A;  1ERQ A;  5GHX A;  5BT1 C;  5FI7 A;  4RYE A;  4BL3 A;  3KUY B;  4S2N A;  4JXV A;  4P6B A;  4WU9 B;  3AZG B;  5GXQ A;  2ZM8 A;  4CJN A;  4S2N C;  3C1B D;  3REK B;  3N8S A;  5GXQ C;  4J8X D;  5AV5 B;  2XDM A;  3M2K A;  2X71 A;  5B24 C;  5EOE A;  3GR2 A;  2B5R A;  3L26 A;  4HES A;  3KS4 A;  1TDL A;  3O62 C;  3GTC A;  2RVQ C;  3SS3 A;  3FZC A;  4K0X A;  1YU1 A;  4GD6 A;  5CP6 B;  1B67 A;  1JWP A;  4EUZ A;  5F99 A;  3LJA A;  1B6W A;  2ZM5 A;  3AZE B;  2WKH A;  2JC7 A;  2EXA A;  3HLD A;  1M19 A;  5E2F A;  5AY8 B;  3REL A;  5AV8 D;  5M1A A;  5AVB A;  2VGK A;  2P74 A;  5GLD A;  4EO5 B;  3UE3 A;  4U0X A;  1M19 C;  3REL C;  2XFS A;  5CGS A;  5AVB C;  4H9Q B;  1KE0 A;  5B0Y C;  4EBN A;  2H0T A;  1YU4 A;  4KZ6 A;  3V3S A;  2CV5 B;  5KDM B;  1SDE A;  3UPN A;  3HON A;  4MNR A;  3SS5 A;  4BEN A;  4XZQ A;  1P3A A;  4DRB A;  3LO7 A;  1K25 A;  3WKJ A;  1S32 A;  3UDX A;  2Y2I A;  3V3R A;  4FH2 A;  4DE2 A;  4E3I A;  1P3A C;  3HLW A;  1P3L C;  4H9O A;  1K54 A;  3CG5 A;  4WZ5 A;  3AZJ C;  4BD1 A;  3WKJ C;  3OPR A;  1BH9 B;  1P3K B;  4R1G A;  1Q2P A;  2HIO A;  4KHA A;  2Y59 A;  4CAY B;  4XUJ A;  3ZVT A;  5F99 D;  3N8L A;  2WGV A;  4R8P C;  3LJA D;  1PZO A;  4OJ6 A;  5B2J B;  2Y4A A;  1HQ3 D;  4WU9 C;  1IKG A;  1P3I D;  1WWS A;  3JYI A;  2Z2L B;  2WUQ A;  3B3X A;  3S4X A;  3B0D C;  1H8Z A;  4D2O A;  4IBK A;  3REJ B;  3V50 A;  5B1L D;  3MVD C;  4X69 A;  2BYM B;  5B2I A;  3AZG D;  4YS3 D;  2Y2N A;  3PBT A;  1S32 D;  4ZJ2 A;  5AQ7 A;  4YM6 D;  2F8N A;  5I94 A;  3REK D;  3GMW A;  1KX4 B;  1BH8 A;  3L2A A;  4UUZ B;  4KUD B;  3V39 A;  5BS7 A;  4ZBE A;  4ZBJ B;  4B4Z A;  3B0B A;  4BLM A;  3C5A A;  5DNN B;  5CXW A;  1H8Y A;  3H0R C;  3LCE A;  5BS7 C;  4S2O A;  4PM7 A;  5FUG B;  4LD9 D;  3R45 A;  5B1M C;  4J8V B;  5JRG A;  4ZDX A;  5EPH A;  2XR0 A;  2Y2O A;  3G34 A;  5AVC A;  1YM1 A;  3AZN A;  2HUE C;  2IO5 C;  4OLG A;  4JPM A;  5AVC C;  4HBT A;  3VFF A;  1QME A;  3WTP A;  2WKI A;  3EQV A;  4MBH A;  5B2I D;  3UTB D;  3UE1 A;  4NK3 A;  2PYO D;  5E43 A;  3MGP A;  4UA7 A;  1PWD A;  3MGR A;  2F8N D;  4FSF A;  4NY2 A;  5E2E A;  4H9P A;  2CV5 D;  3X1S A;  3OPH A;  4HGA B;  1Z6F A;  3VSL A;  3MGR C;  1YQS A;  4E3O A;  3X1S C;  4MLL A;  1RGZ A;  3BEB A;  4UA6 A;  4KZ5 A;  1NY0 A;  3ZVW A;  3AN2 C;  3BLM A;  1P34 C;  1M6K A;  3REH A;  3FWL A;  5GT0 D;  1Y54 A;  1XP4 A;  4NZ4 A;  4E3M A;  3REH C;  5B40 A;  3B6G A;  3IXB A;  4F94 A;  3V9R B;  3HLF A;  3VOZ A;  2PU2 A;  3OCL A;  3O88 A;  4P0M A;  5E5A B;  3IHB A;  5B40 C;  4Z5T C;  3B6G C;  3Q7V B;  4OPQ A;  5B2J D;  3N8R A;  3UPO A;  5EVI B;  2XGN A;  2YFV A;  1J9M A;  1K6R A;  5GSU B;  4NE5 A;  1W7F A;  2EX6 A;  3MGP D;  1QMF A;  5B31 A;  4WM9 A;  4JF5 A;  1Q2Q A;  5CHJ A;  1LLB A;  5B33 C;  1P3B C;  4OPR A;  5B31 C;  3WA9 A;  4K91 A;  2RCX A;  4LEN A;  1ZLA A;  2ZC5 B;  3W4O A;  3FDD A;  5BPV A;  1W8Q A;  4EV4 A;  2GDN A;  5J8X A;  3WA9 C;  3IH8 A;  4DDS A;  1ZG4 A;  1N1J B;  3OZH A;  1PYY A;  2XD1 A;  5FAT A;  2FFF B;  3KXB A;  1ZLA C;  4ID4 A;  3NQJ B;  5CPJ A;  3RJU A;  1KDW A;  5B31 G;  1P3P A;  1HTZ A;  4WU8 A;  3KXB C;  1P3M B;  4FH4 A;  3ZHH A;  5CPJ C;  2W8S A;  3B6F D;  3MFD A;  4X53 A;  3AZM D;  5L2F A;  3AZI D;  1P3P C;  1SKF A;  1CI9 A;  1WYC A;  3AV1 A;  3EPK A;  1I2W A;  4WYY A;  1IEL A;  3N4I A;  5CGW A;  5CPI D;  3W97 C;  3A3F A;  1K56 A;  4H9R B;  1I5Q A;  3W98 C;  2J7V A;  4A5R A;  3FV7 A;  4BD0 A;  1NZU A;  4GD8 A;  3MNN B;  1I2S A;  2Q9M A;  4Y0U A;  3UDF A;  1P3O A;  3F6T A;  3NC8 A;  1HTA A;  3PBS A;  3WAA B;  1ERO A;  4H9S A;  1L0F A;  2ARO A;  2IWB A;  4X56 A;  3FKV A;  3HVF A;  4CPK A;  5FAS A;  2ARO C;  4NZ3 A;  1GA9 A;  3AV1 D;  3AYW B;  3AV2 C;  4GKU A;  3HUN A;  4N9L A;  3WS5 A;  4WMC A;  2NQB B;  2JCH A;  3H0M C;  1U35 A;  4G92 B;  4UAA A;  4E3N A;  4H9N A;  3X1U A;  1K4E A;  4RX3 A;  1M18 D;  2WGW A;  3IF6 A;  4WEL A;  5EE8 A;  4QJG A;  1TAF A;  2V20 A;  3UNW A;  4Z66 C;  3X1U C;  1TZY A;  5AV9 B;  1W2E A;  1BSG A;  5CEB A;  3X1V C;  4C3Q A;  1MXO A;  5GT3 D;  5DNM A;  1E3U A;  1L0E A;  3MZD A;  4NYU A;  5FQQ A;  2V1Z A;  4KQR A;  5DNM C;  4KQO A;  3MGS C;  3MGQ A;  3DW0 A;  5JYO A;  4LV2 A;  3WTP E;  1TVF A;  3FYZ A;  3AZH A;  3O87 A;  4Y7P A;  3MGQ C;  3AFA C;  2R9W A;  1N9B A;  3W96 A;  4MBF A;  1O7E A;  3LZ0 A;  5CPK B;  3AZH C;  3MZF A;  1H3O B;  4PM5 A;  1KX3 D;  3W96 C;  1MPL A;  3MKF A;  1YLZ A;  3LZ0 C;  4NE3 A;  3UT9 B;  3AZF B;  1P3G B;  3HL9 A;  4GOG A;  2ZC4 B;  4MEZ A;  1TZY D;  2FJ7 A;  1YUE A;  2FJ7 C;  4IBX A;  3UTA C;  5GHZ A;  5BO0 A;  5G49 B;  3WRZ A;  3L28 A;  3KWQ A;  1XA7 A;  3ZG9 B;  3KWQ C;  4J8W A;  4DKI A;  3WAA D;  3NQU B;  1NJ4 A;  2ZY3 A;  3WS1 A;  3ZCZ A;  4J8W C;  1BTL A;  3C1B B;  4DXB A;  1WWI A;  2Y91 A;  3UDI A;  1KX5 A;  4J8X B;  2WZZ A;  2WAD A;  4PM8 A;  3C1C B;  3LEL D;  5B32 C;  1F66 A;  3Q81 A;  4R3J A;  2NZD C;  4ZUX A;  3X1T A;  1OME A;  3IF5 A;  4OP8 A;  2NQB D;  5E2G A;  5A93 A;  2Y2L A;  2ZD8 A;  3W4Q A;  4ZUX C;  1HD8 A;  1Z2C B;  2ZMA A;  4KZB A;  1CK3 A;  1F1E A;  1BT5 A;  5B32 G;  4X23 C;  2V2F F;  3IHA A;  5AV6 C;  1L0D A;  4IED A;  4Z2M G;  5JYP A;  4X6T A;  3REI C;  3A6N A;  4HEF A;  5B0Z A;  4DE3 A;  5FQK A;  4J8U A;  3A6N C;  3G32 A;  4HBU A;  3AL0 C;  4E3K A;  3HBR A;  3TU4 A;  1P3F A;  3QHY A;  2P9V B;  4J8U C;  2XEP A;  3AZK D;  1P3F C;  1F66 D;  4OKP A;  3X1T D;  1IYP A;  4RA7 A;  1FCN A;  4S2M A;  4IBB A;  5M18 A;  1YLJ A;  4OQH A;  1M1A C;  5F99 B;  4JJN D;  1PWG A;  3WRT A;  3LJA B;  1VQQ A;  4N1H A;  3P5J B;  1DJC A;  2ZJ9 A;  4QNL A;  3W99 A;  1HQ3 B;  3CMZ A;  5B0Z D;  1P3I B;  4Q8I A;  1EI5 A;  3W99 C;  4ZJ1 A;  5EUA A;  2WK0 A;  3A1K A;  5B1L B;  1RP5 A;  2Y55 A;  3E2L A;  2XQZ A;  1NYM A;  5KMW A;  4XZQ B;  5CHU A;  1GHI A;  4YS3 B;  1JWV A;  1S32 B;  2DNS A;  3FKE A;  4H9O B;  4YM6 B;  1EQZ A;  4FD8 A;  4KGC D;  5B24 A;  5DVA A;  3C1C D;  1EQZ C;  2DCF A;  2HIO B;  4QLC D;  4KHA B;  4XUJ B;  3O62 A;  4GB7 A;  4X68 A;  4R3B A;  5AV8 C;  1ID3 C;  3NBL A;  1T3U A;  1PZR A;  2J8P A;  2DF4 C;  5BT1 D;  5JA4 B;  4LD9 B;  3S1Y A;  1EWZ A;  1BZA A;  2HP9 A;  3LZ1 A;  2ZC6 B;  2R9X A;  3Q7Z A;  5CEC A;  1A7W A;  5B2I B;  1XKZ A;  3LZ1 C;  3UTB B;  2I72 A;  2PYO B;  5B0Y A;  5GXQ D;  1KDS A;  1W8Y A;  2F8N B;  4QY5 A;  5EEC A;  2H0Y A;  1PWC A;  4S2J A;  1BH8 B;  3VH6 A;  2C5W B;  3AZL A;  1AOI A;  1K6S A;  1P3L A;  2ZQC A;  1CI8 A;  1XA1 A;  4KZA A;  3AZJ A;  3PBO A;  3OPL A;  3AZL C;  1AOI C;  4BQM A;  5BOH A;  3IXD A;  5TR7 A;  5GT0 B;  4R8P A;  1RCJ A;  3R45 B;  2BG1 A;  5JRG B;  4JXS A;  5GLC A;  3KUY A;  3AZN B;  4XXR A;  2EFU A;  4O7D A;  4WU9 A;  3TG9 A;  3KUY C;  5CER A;  1M19 D;  3REL D;  3WTP B;  5AVB D;  3EPL A;  3AZG C;  4AWL B;  2XFT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...