2XD5A

Structural insights into the catalytic mechanism and the role of streptococcus pneumoniae pbp1b
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
489
structure length
469
Chain Sequence
ISEITYSDGTVIASIDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTNQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PENICILLIN-BINDING PROTEIN 1B
publication title Structural Insights Into the Catalytic Mechanism and the Role of Streptococcus Pneumoniae Pbp1B
rcsb
source organism Streptococcus pneumoniae
total genus 153
structure length 469
sequence length 489
chains with identical sequence B
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2xd5A01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2xd5A03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2xd5A02
3BFCA 3IH9A 5HFOA 5EVLA 3CJMA 2WKIA 3WRZA 3MFDA 3OC2A 4OQHA 3VFHA 2QZ6A 5FASA 3Q82A 3V3RA 5TGFA 4HBUA 3NC8A 1Z6FA 2WKEA 2ZQAA 3EQUA 3N8SA 1RCJA 5A91A 4XUXA 4N1HA 1MWRA 1XPBA 3G4PA 2XQZA 3W8KA 1JWVA 3ZG8B 4OOYA 5CTMA 1HVBA 4R0QA 2BLSA 4S2KA 3ZG7B 4MBKA 4A5RA 4BL3A 3WS1A 1O07A 1Q2QA 4OKPA 5M1AA 4WMCA 4LCLA 1K38A 3G2YA 5CHUA 3UPOA 3VSLA 4M3KA 2Y2IA 1ES3A 2H0YA 4GN2A 4OOLA 2ZQ9A 1FCNA 1BUEA 1K55A 1VQQA 3G35A 1FR6A 1HTZA 1YLTA 3MXRA 2EXBA 4S2MA 4RYEA 2C5WB 4C75A 3W4OA 4QU3A 2ZJ9A 3UPPA 4EV4A 3PAGA 5HL1A 4DRTA 1TDLA 3PBQA 1RGYA 3LO7A 3LY4A 5DF9A 1ES2A 2H10A 4R1GA 5CGXA 5AQBA 5GLBA 1L0DA 1ONGA 2EX2A 4BENA 4DDSA 4WM9A 5CEDA 5KSCA 1KE0A 4BD0A 3SH7A 4RVAA 4LV0A 5CGSA 1ZG4A 3M6HA 2VGJA 3MBZA 1GHIA 4IBRA 3NI9A 3I7JA 1ERMA 1KE4A 1JWPA 1E3UD 4LV2A 1KDSA 1KDWA 3V5MA 3IQAA 4BD1A 5HAIA 1PIOA 2R9XA 2XK1A 3IWQA 4EBPA 5F83A 4FCFA 4KZ3A 4EQIA 2Y2OA 5M18A 3ZVTA 1N4OA 3DTMA 2WKHA 3E2KA 4QY5A 3IXHA 4OPQA 3S4XA 3UDIA 4PM6A 3G32A 5KMWA 3ZVWA 1M6KA 2WGWB 1K57C 2ZMAA 3GQZA 4NK3A 3VOYA 3ZDJA 3LCEA 4D2OA 5GLDA 4RA7A 4ZJ3A 2OLVA 5CXWA 4UA7A 5DTTA 2WGWA 5EOOA 3C7VA 3PTEA 1W5DA 4DE1A 2Y2LA 3CG5A 3NDEA 4HEFA 4Y0OA 3SH8A 2Y2HA 4S2OA 1NRFA 4ZJ2A 4S2IA 1QMEA 1IYOA 4OP8A 5DTSA 3ISGA 4LCMA 4R3BA 4DE0A 1KVLA 1M40A 4BL2A 4EWFA 4X6TA 3BYDA 5FQMA 4B4ZA 5DF7A 5FI2A 5F1GA 4R4SA 1SDNA 1ES4A 1K56A 3BFDA 3N8RA 3NCKA 1GHMA 2OV5A 1I5QA 3NY4A 4JLFA 4Z9QA 1BZAA 1FR1A 5A93A 4P87A 3UE3A 5TFQA 1KGEA 1LHYA 1YM1A 1JWZA 3M2KA 4BJPA 1ESIA 1RP5A 1PWGA 4X69A 4WMCD 3TOIA 4F94A 1DJAA 1K25A 2WZZA 3GMWA 1IYPA 1YMSA 5JYOA 5M19A 1FSWA 4GZBA 1BTLA 3C4PA 4JXSA 3OPLA 1L0GA 3HLFA 3WWXA 4KZ7A 5HW3A 5FA7A 3GTCA 1BLSA 3A3EA 4HESA 4N9KA 4P0MA 1W8QA 2ZQ7A 5GL9A 3PBOA 4U3TA 4KG2A 1CI9A 3B3XA 1NY0A 3BRMA 2B5RA 1ALQA 4N9LA 1FCOA 1E25A 3OPRA 4KG6A 1GA0A 3DWZA 3GRJA 3BECA 5JYPA 2DRWA 4UHUA 5DTKA 5GLAA 2H5SA 2EX6A 3CZDA 3ZNYA 1PWDA 2HDRA 2XD1A 1I2SA 2I72A 3HLDA 2GDNA 4Q8IA 2E8IA 1HD8A 5HAQA 5I94A 2C6WB 4KZ8A 1PW8A 2Q9NA 3RJUA 2XFTA 2Y2QA 2UWXA 5G18A 4WEJA 1WYBA 4OPRA 4GB7A 4B88A 2HDSA 3IF6A 1EROA 5GLCA 4B4XA 5TR7A 1K6SA 5CECA 5FQIA 1ESUA 1FCMA 1AXBA 4CJNA 2XEPA 4E3OA 3EQVA 2Y4AA 3NDGA 3ZGAB 4BQMA 4GOGA 1IKIA 1FOFA 1CI8A 3MXSA 1NZOA 4EUZA 3N7WA 4GNUA 3LY3A 2R9WA 2Y91A 3SS5A 3Q1FA 4KQRA 3WS0A 5CHMA 3UPNA 1MWSA 3Q7ZA 1I2WA 2HDUA 1YT4A 4ZBEA 1FSYA 4O7DA 3MZDA 5CTNA 5FQQA 4WZ5C 2BG1A 3UE0A 4ZJ1A 5CERA 3P98A 3G31A 3VP3A 2WAFA 2ZC6B 1BSGA 4DXCA 1TDGA 2OSUA 4UA9A 5GHZA 3GR2A 5EVIA 3UNWA 2CC1A 2Z2MB 3IT9A 1XGJA 2FFFB 2HP5A 1CEFA 1BULA 1KE3A 4KQQA 1S0WA 3HLEA 3UDXA 1XA1A 3OCNA 3HLGA 1Q2PA 1U60A 5KZHA 1SKFA 3AGEA 2J9OA 4MBFA 4OOMA 4BLMA 3WRTA 3A3DA 3ZCZA 1H5XA 1K54C 1MY8A 1TVFA 1XP4A 5HARA 2J8YA 2WZXA 2X71A 3BM6A 3E2LA 1MXOA 2HPBA 3FKWA 2ZQCA 1ES5A 3A3FA 3BEBA 3GV9A 3UY6A 3UE1A 2IWDA 4YINA 1LLBA 1DJCA 4S2JA 4GD6A 3TSGA 2XF3A 5L2FA 5EUAA 1XGIA 2A3UA 4Y0TA 4PMAA 4QB8A 3QHYA 3O86A 1G6AA 2ZLYA 3FZCA 2WGVA 3SS3A 3C4OA 3IXGA 3VP1A 1JTGA 4WBGA 5CRFA 3WS2A 1OMEA 5D3OA 2WUQA 3BLMA 4OLDA 3W4QA 2RL3A 4OVDA 2PBYA 1ZG6A 1ZC2A 1N9BA 2G2WA 1L0EA 4R4RA 3V50A 5FQ9A 3NBLA 4X56A 4PM9A 5GHYA 3HBRA 5F82A 1S6RA 2DNSA 1PI4A 3BLSA 3PBTA 4UAAA 3ZG0A 1CEGA 4S2NC 4KZ4A 3MZFA 4GDBA 1PI5A 1NYYA 3M2JA 5AQAA 1PWCA 1WYCA 1ONHA 2ZM2A 2Y2JA 4DE3A 3FV7A 3Q07A 4LV1A 2JE5A 1YLWA 5IHVA 4WZ4A 1EI5A 3PAEA 4X53A 3VOZA 2JCHA 3N4IA 3A3IA 5HX9A 1YLYA 4RX3A 4EBLA 2X02A 1G68A 1GHPA 3GVBA 3DWKA 3O3VA 4OP5A 1JVJA 4OONA 4P85A 4QY6A 3SOIA 4E6XA 5BOHA 5EE8A 2EX8A 4K0WA 4XXRA 2EFUA 2A49A 1DJBA 1K54A 1C3BA 2HDQA 2WAEA 3MZEA 3PBRA 1LL9A 4LV3A 4KZ5A 5EVID 3G2ZA 3DW0A 3IHAA 3RXWA 4KZAA 3IH8A 4JF6A 1PZPA 5DF8A 2XR0A 3FWLA 4PM8A 1W79A 3HL9A 4K0XA 3C7UA 2Y55A 4P6BA 4PM5A 4IBXA 2WYXA 1K55C 2EFXA 2ZC3B 5FAQA 3S22A 1YMXA 5FQJA 3OCLA 1E4DA 3NIAA 4JKTA 4MBHA 4KENB 1YQSA 3P09A 1TEMA 2ZC7A 4JXGA 1K57A 1NXYA 1K6RA 2PU2A 4EBNA 4OQIA 4WELA 3G34A 4X55A 4OQGA 1JTDA 1IYSA 3IF6B 3WS4A 4E3NA 2VGKA 4MNRA 1RGZA 4JBFA 4S2PA 3ITBA 2H0TA 4DF6A 2P74A 1GCEA 2XH9A 2XLNA 3G30A 3V39A 1K4FA 3Q7VB 2J9PA 4U0XA 5CHJA 4RX2A 1MWUA 5A92A 4KQOA 1VM1A 4FH4A 3GSGA 4R3JA 2V1ZA 3IF5A 4Y7PA 4GKUA 2G2UA 3UN7A 5E43A 3IXBA 2PU4A 3LEZA 5HAPA 3Q7VA 2HP9A 2JBFA 3JYIA 5U47A 2ZM8A 2QPNA 3AGDA 3ITAA 4KG5A 2WK0A 2EX9A 2XD5A 1EWZA 5CEBA 3C5AA 4UA6A 4R23A 1IEMA 1Y54A 1SDEA 3O87A 3IWOA 5EVIB 1DY6A 4IVIA 4QJGA 4KZ6A 3TG9A 3N6IA 3BFEA 3QNBA 4NETA 1BLPA 2EXAA 4C3QA 4FD8A 1K56D 2Y59A 2ZD8A 4DE2A 3FYZA 1L2SA 4ZTKA 2OLUA 4KZBA 4OQ0A 3O88A 1XX2A 4QD4A 3ZNTA 1L0FA 4C6YA 4GDNA 4JPMA 2JC7A 2WGIA 3WS5A 3AGFA 4X68A 4ID4A 1XA7A 1YLZA 1O7EA 2V20A 1W7FA 1YLJA 3N8LA 3HUOA 5J8XA 1PZOA 2P9VB 3OPHA 3PBNA 3HLCA 4OLGA 5E2EA 4WYYA 4E3LA 2ZM0A 4FH2A 4MEZA 4DDYA 4LENA 1IELA 1HZOA 4PPRA 1MBLA 3HUNA 1GA9A 3IXDA 2XDMA 1ZKJA 3RXXA 2P9VA 5GHXA 5E2GA 1PYYA 4E3IA 3SS4A 1NJ4A 1MKIA 4DXBA 3V3SA 4IVKA 4JXWA 2Q9MA 4KZ9A 2V2FF 3UO9A 1FQGA 3VFFA 4XUZA 4JXVA 5FAOA 5AQ7A 5FATA 1PW1A 4Y0UA 2QMIA 1MWTA 2X01A 3VSKA 3A3JA 4OPZA 4N1XA 1IKGA 3ZG5A 2Y2KA 4ZDXA 4OH0A 5FQKA 4E3MA 1WE4A 2Y2MA 3HREA 1J9MA 3ZFZA 3ZHHA 1SHVA 3SH9A 2ZC4B 3OPPA 5EOEA 4CPKA 4ZAMA 1ERQA 4PM7A 4K91A 1KVMA 4HBTA 4JF4A 3S1YA 5A90A 4FSFA 4WZ5A 2Z2LB 2ZC5B 5EECA 1SCWA 3IWIA 5KSHA 5FI7A 1XXMA 2DCFA 4YFMA 4E3JA 1LI0A 4N92A 3HLWA 5CGWA 3BFFA 3UDFA 2Y2GA 3IF6C 3MKEA 3CMZA 3HVFA 1K4EA 1NZUA 3PBSA 5E2FA 3MKFA 2WADA 1BLHA 3M6BA 1LI9A 4U0TA 3HLBA 4L0LA 2J7VA 3VP4A 3W4PA 1NYMA 5FAPA 4WEKA 5AQ9A 3FKVA 4JF5A 1BT5A 4H8RA 5FDHA 1QMFA 5F1FA 3Q81A 4DKIA 2FFYA 2ZQDA 3IHBA 4QHCA 4GD8A 4S2LA 1BLCA 4E6WA 5EPHA 2Y2NA 1E3UA 1XKZA 2RCXA 3BFGA 3OZHA 4OPYA 5E2HA 5EVIC 2IWBA 1KGGA 5DVAA 1W8YA 3ZG9B 1LL5A 5FSRA 4E3KA 3HUMA 1CK3A 4MLLA 5FI6A 1H8ZA 2Y2PA 2XFSA 1KGFA 3VMAA 1YLPA 2HP6A 2ZQ8A 2IWCA 1IYQA 1H8YA 1MPLA 4S2NA 3D4FA 3QNCA 4IEDA 3VP0A 2XGNA 3VP2A
chains in the Genus database with same CATH superfamily
2RVQD 3BFCA 5EVLA 3CJMA 5C3IB 3MFDA 2O99A 4MB5A 4HNBA 3Q82A 3NC8A 3UT9D 1Z6FA 3LR3A 3EQUA 3AN2B 1KX4C 2KX6A 3AZND 3AZIB 4NE3A 3UTAB 5B31A 3AFAD 3LIFA 3QP1A 3WTPB 4R0QA 4S2KA 5CTMA 2ZMFA 4LD9D 3W99B 4KUDC 2QKPA 3MGSA 3TU4C 4WMCA 3AZKC 1K38A 3LZ1C 3G2YA 5CHUA 2AROD 3LEQA 3VSLA 4XT2A 3A0VA 2ZQ9A 1FCNA 5B32B 3AZLB 1K55A 1H8PA 2OWHA 3MXRA 2ZJ9A 3O62B 3UPPA 3B0DC 4YM6B 5DNNA 3PBQA 4Z2MG 3LO7A 3LY4A 1P3GB 1ES2A 4FOFA 5CGXA 4BENA 1P3FC 4BWIA 3UTBA 4X23A 4WM9A 2YFVB 4RVAA 1ZG4A 1OJGA 3ICYA 2PR6A 2VGJA 5B2ID 1S32D 2W1TB 4H9QA 4P6ZM 1GHIA 4IBRA 4I3IA 1PZRA 3B42A 1KE4A 2QJ7A 3IX4A 3QP2A 1KDWA 1H0MA 3IQAA 4BD1A 4CAYA 4NYUA 4MN5A 2R9XA 2XK1A 3IWQA 3LIEA 1SKOB 4FCFA 4EQIA 1GPFA 4HMDA 1VB6A 3A6ND 1N9LA 2F8NB 3LGOA 3D9YA 3UDIA 3G32A 2W0NA 1K57C 3REKB 3HCYA 3AZEC 3VOYA 3LCEA 3R4KA 4D2OA 3B33A 3LICA 5CPIA 1M1AB 5EOOA 3C7VA 4DE1A 5CP6C 2Y2LA 1D1JA 4Y0OA 3WAAA 2Y2HA 1P3BC 1F9IA 4Z5TB 4HH2A 1OTBA 5IU1A 4S2IA 4II7A 3LZ0C 1GOIA 2PD8A 4OP8A 1A7WA 3ISGA 1EQZC 4R3BA 4DE0A 1M40A 1GSVA 4B4ZA 3EG5B 3NCKA 4NZ1A 3AN2D 3K2NA 4Z9QA 4P87A 1KGEA 1YM1A 3AZID 3L9KA 1RP5A 1PWGA 3WTPD 3TOIA 4F94A 1T1BA 4Z66A 5JYOA 5B0ZB 1BTLA 3C4PA 1JNUA 4JXSA 1PRQA 1W8QA 2PAVP 3L27A 2XA7M 1N1JB 1NY0A 3AZLD 2D49A 4IJFA 1ALQA 2A24B 3OPRA 3EPKA 3O62D 4YS3A 1P3KC 4YM6D 1GA0A 1XJ2A 4EESA 3GRJA 4MN6A 4UHUA 5DTKA 5GLAA 4CQHA 4EW7A 5B24A 1P3GD 2ZL1A 2XD1A 5JRGC 4NZ3A 2VLGA 4Q8IA 2E8IA 4QLCC 4AFIA 3AZGA 2UWXA 4Q0JA 2D01A 3TE8A 1WYBA 4OPRA 5B31B 4GB7A 4FUWA 1KX3B 4B4XA 5DFYA 1K6SA 5HW3A 4HMCA 1FCMA 5CPJC 4CJNA 3S7PA 4BQMA 3MGSB 2F8ND 1S1YA 4CLCE 5EFWA 3N7WA 3REKD 4GNUA 2RTSA 1O6IA 2HDUA 1M1AD 4ZBEA 5CTNA 1P3OC 3IBJA 5DNNB 4E44A 3W97C 5CERA 2YFWB 2WAFA 5B0YA 1BSGA 1D06A 1VETA 5HZHA 4UA9A 2ZOHA 5EVIA 2CC1A 3IT9A 1XGJA 1CEFA 2ZM5A 3UB8A 5AV6B 4H9QB 4Z2JA 1SKFA 3MVDB 1AOIB 2J9OA 4MBFA 4OOMA 2ZY4A 1WA9A 1P3LA 5GSUB 4IBDA 1K54C 1MXOA 3FKWA 3C1CD 4YINA 5B0ZD 1L6JA 3RFBA 2XF3A 4ZUXC 3B6FA 3FG8A 3MSHA 5DKLA 2A3UA 1E15A 3FZCA 3X1VA 3C4OA 3IXGA 5CPIB 4LRZE 1P9RA 3WS2A 5D3OA 3WAAB 4XZQC 2RL3A 2XRNA 4IJEA 1P34B 2V8FA 4MCWA 4R4RA 1L0EA 5FQ9A 4X56A 4PM9A 3T4SA 3HBRA 3UB9A 5F82A 4LRXC 1W1YA 1PI4A 3AYWD 4IHQA 1PI5A 2O9BA 3M2JA 1ONHA 3DTIA 3UE6A 3OOVA 2W1RA 4LV1A 1MKMA 3X1UC 1KX3D 1K0KA 1EI5A 2JCHA 4Z66B 1CJFA 3MGSD 3GVBA 3LJAC 2L4RA 3F1NA 4E6XA 3WA9B 2EX8A 3KWQC 2BYKA 4HJ4A 1LL9A 2G5IC 5B33C 5DNND 1YU1A 3RXWA 4KZAA 1Y4OA 4IUHA 2HGVA 1PZPA 3FWLA 2JHEA 4YOFA 3MNNB 3CHWP 2EFXA 5AY8C 1YMXA 5FQJA 1E4DA 4MBHA 1STZA 5AV6D 1TEMA 3NULA 2W8SA 4Q0IA 3MVDD 1AOID 2ZC7A 1TZYC 5FUGA 5GSUD 4EBNA 4EQ1A 4HQAA 4X55A 4B9OA 5B1LA 4MNRA 1RGZA 4HP4A 5HWVA 5AV5A 4WNNA 1K4FA 4CLCA 3Q7VB 4XUJB 5CHJA 4WZSB 3WKJA 3GSGA 3F6TA 4GKUA 1M18B 1VEUB 5DNMA 4PKYG 5GT0B 5E5AC 3E4PA 4L9EA 1HQ3A 4HH3A 3AGDA 2XD5A 2EWWA 5CEBA 5B0YB 4R23A 2DF4C 1P34D 1IEMA 1SDEA 1Y54A 5EVIB 4YNRA 4QJGA 3WD2A 4JGOA 4O01A 4FD8A 5AV9C 4NE6A 2ZD8A 4JJND 2NQBA 3MGQD 4J8WC 1F5MA 3LR5A 4ZTKA 3O88A 3X1TD 4QD4A 3ZNTA 4GDNA 3WS5A 3AZHC 2V20A 5HWWA 3REHD 3WTPE 3PBNA 3GECA 3HLCA 1YU2A 4E3LA 4WYYA 1HZOA 3WA9D 4PPRA 1GA9A 3RXXA 2HIOA 1U35A 4I38A 3B6GA 4E3IA 3SS4A 5F99C 1MKIA 4DQYB 5HD5A 2CWEA 5AVFA 2W3DA 4LRYC 3W96C 1QO6A 3MNND 3KFUG 3A3JA 4WLAA 3HREA 2Y2MA 1CK7A 4OJLA 3WX7A 3ZHHA 3UT9A 3SH9A 3A1KA 4CSRB 3N3FA 1OTDA 2HF6A 1KVMA 5L07A 3AFAA 4EU0A 4WZ5A 5EECA 1SCWA 3IWIA 4LD9A 4WF0A 1OT9A 5FI7A 2DCFA 4XUJD 4E3JA 1LI0A 1M18D 4H9SC 4H9PA 2XSSA 3HLWA 5CGWA 4WU9C 3UDFA 3IF6C 4J8XA 2Q0OA 3CMZA 5GT0D 2BYKB 2WADA 4ETXA 1ZLAB 1LI9A 3AV1C 1YKDA 2WKQA 2B02A 3IS2A 1P3MC 4F3LA 1TAFA 5GXQC 3KSIA 5AQ9A 3KSGA 5J3WA 1BT5A 2ZOIA 4AWLC 3R45B 4DKIA 2FFYA 3IHBA 4QHCA 1S32A 2BYMA 3JPUA 5FUGB 4E6WA 4ME4A 3X1SB 3LELB 4I39A 2Y2NA 1ED7A 3BFGA 3OZHA 5B1MD 4HJ6A 3L26A 2WKPA 5BT1C 2H28A 5AV5B 4E3KA 3HUMA 1H8ZA 1TS6A 1H0IA 3WKJB 3HJIA 1P3PA 4ZBJB 5MC7A 1UWPX 3T1XA 1E88A 1H8MA 3QNCA 3C1BB 5BS7C 4WUJA 3CWFA 2QJ5A 1P3AC 3MXQA 5TGFA 4Y15A 4HHDA 2WKEA 1F98A 5HSQA 4GHAA 1RCJA 4XUXA 4N1HA 1XPBA 1M19D 4H9OB 2XQZA 3AN2A 5AV8D 1JWVA 1HVBA 1DP8A 4BL3A 1Q2QA 4UUZA 3WTPA 4LCLA 5BO0B 4ESPA 2VV7A 1ES3A 1BUEA 1VQQA 2NZDB 3G35A 2HIOB 1U35B 1YLTA 2W3HA 2HJ9C 4G91C 2LY8A 4LLOB 3AZLA 1ZLAD 1TDLA 4UEYA 2K31A 1RGYA 4WU8B 5DF9A 3CPTB 3O62A 4Y17A 1KE0A 4YWZA 3AZMC 1P0ZA 3KUYA 1P3GA 4IBKA 3WD4A 1GSXA 4GCZA 2YFVA 4LV2A 1E3UD 1PFLA 3V5MA 5HAIA 2W1TA 1PIOA 3X1SD 3LELD 4KZ3A 3OBFA 1N4OA 2WKHA 4QY5A 5I5LA 1SKOA 5AV5D 1P3IB 3ZVWA 2WGWB 2J3TD 2PRFA 5AVBB 2F8NA 3WKJD 1H3OB 3H0MC 5TJJA 3REIB 4H9PB 3SZTA 2OLVA 5CXWA 5DTTA 4J8XB 3A6NC 3PTEA 3AZFC 1MZUA 3REKA 4HEFA 3C1BD 4S2OA 2DQNC 3REJB 4R3AA 4ZJ2A 2PYOD 3U4LP 1OTEA 5DTSA 4LCMA 1KVLA 1TAFB 4X6TA 2FJ7D 5FQMA 5FI2A 5F1GA 2CV5B 1SDNA 3ULFA 4DJ2A 1K56A 3BFDA 1ID3C 1FR1A 4H6JB 2BYMB 1GSWA 2VQRA 4BJPA 4KGCB 1LT0A 2ZMVA 4X69A 5G4ZA 2BASA 3H9WA 1BH8A 3AV2C 1FSWA 4GZBA 5K5BA 3C1CA 3OPLA 5FA7A 2I9VA 4QWOA 3GTCA 1BLSA 3A3EA 3UTAC 1P3PB 5B0ZA 4GLQA 1OGBA 1TF1A 2NZDD 1U35D 3W99C 1FCOA 4NEED 4R8PB 4J8UC 2V1BA 1N1JA 5GT3B 3DWZA 2VGLS 5JYPA 2DRWA 2A24A 4WU8D 3CZDA 5F69A 2HDRA 3LR0A 4J8VB 3O5YA 5B32C 5CPKA 1YU0A 1HD8A 3T4TA 2B18A 5HAQA 4YM6C 5AVCC 1PW8A 3AZJB 4Y2FA 3AYWA 4B88A 5C5KA 3T1SA 5KMWA 2GNXA 1AXBA 2XEPA 4E3OA 4UUZB 1HTAA 1KX3A 3MR0A 1CI8A 3MXSA 1NZOA 3T4KA 1P3ID 5AVBD 3LY3A 4R6LA 3Q1FA 3REID 3Q7ZA 4JGPA 3SW1A 4J8XD 1I2WA 1FSYA 2J80A 4O7DA 3B0CT 2BG1A 3REJD 3G31A 3P5JB 1TDGA 5GHZA 3C2WA 4M4XA 3KUYB 2YFWA 1KE3A 1S0WA 3EPJA 1KX5B 2CV5D 1M1AC 3UDXA 3HLGA 4Z2HA 3A3DA 1H5XA 4Z5TC 4HY8A 1TVFA 1XP4A 5HD3A 5AV6A 2X71A 3E2LA 4KGCD 3MVDA 1AOIA 2ZQCA 5GSUA 2OWJA 3GDIA 1F66C 4HGAB 3V67A 1DJCA 2W3EA 3W98A 2GZAA 3H0LC 4QLCA 5EUAA 3KO6A 4Y0TA 4PMAA 1P3PD 1YU4A 5F6AA 4EXOA 3SS3A 3MQ0A 2LB9A 5CRFA 4EO5B 4Z2GA 1OMEA 4R8PD 3EGDC 3W4QA 5GT3D 4OVDA 5B2JD 4KUDB 4K08A 4KUKA 2L5AA 2Y79A 1ZC2A 2G2WA 2L1MA 4J8VD 5GHYA 3LZ1B 5L10A 3WD3A 1S6RA 1P34A 2O0YA 1CEGA 3MGPA 1NYYA 3AZJD 5AQAA 1PWCA 2L0WA 2ZM2A 3B0DB 4JJNA 3MGQA 3Q07A 3V9RA 1BH8B 2NUPC 3X1TA 4WZ4A 5IHVA 4X53A 3VOZA 3JVUA 1FILA 3LUQA 3A3IA 3N4IA 5HX9A 4EBLA 3C1CB 2X02A 1G68A 4OP5A 5A8BA 4OONA 4P85A 3SOIA 1W2EA 5BOHA 3CUEA 3REHA 5B31C 2A49A 1K54A 5FEFA 3KXBD 1C3BA 2HDQA 2V0UA 3WA9A 3JVVA 2QHKA 3IHAA 3PHYA 5B40D 3MMHA 4PM8A 3BQ8A 4PM5A 1K55C 5CPKB 2ZC3B 2HJEA 3KUYD 3MS6A 1KX5D 4IJGA 3S22A 3AZEB 3NIAA 3OCLA 4JKTA 4E04A 3P09A 3MNNA 5DNNC 1NXYA 3AYWB 3FPVA 5CP6B 4UQIM 4R38A 3UTBC 4XZQA 4X23C 3K3CA 2VGKA 1N9OA 2A2LA 3LZ0B 3ITBA 4DF6A 4WN5A 4MMNA 3B0CW 2J9PA 4U0XA 4RX2A 5A92A 2ZBBA 4R3JA 5FDSA 3A0SA 1W1TA 2V1ZA 3IF5A 2G2UA 4IUKA 1KX4D 2W3FA 5E43A 3RH8B 5HAPA 3Q7VA 4XUJA 3E98A 1M18A 2ZM8A 1VEUA 2RIQA 2V9AA 2WK0A 2EX9A 5GT0A 1EWZA 4KUDD 3FKEA 4IVIA 3TU4D 1IOUA 3AZKD 3LZ1D 4GJ4A 3TG9A 3N6IA 4NETA 1BLPA 5CPIC 2EXAA 1KU5A 1K56D 3M7PA 3WAAC 4GW9A 4NXGA 3FYZA 1CF0A 1L2SA 4KZBA 4OQ0A 1P3KB 1XX2A 4JPMA 2O9AA 1YLZA 3BQAA 3VOLA 1E8BA 1P3FD 5JRGB 5G49A 1S4RA 3R7WA 5B1MA 2P9VB 4OLGA 3W98B 4QLCB 4MEZA 4DMZA 3IXDA 4IBCA 3RELA 3EPLA 2Z6DA 4MB3A 3T4LA 3A1IA 1BFMA 4Z66C 5EM1A 1H0GA 2Q9MA 4MN7A 4KZ9A 2V2FF 5CPJB 3UO9A 3VFFA 4XUZA 1G28A 5J4EA 2IO5C 3H82A 5AQ7A 3MF0A 3VV4A 1PW1A 1MWTA 1S4SA 5CPKD 5FQKA 4E3MA 3AZED 4YS3C 1NWZA 3MGPB 2ZC4B 3W2ZA 3OPPA 2F2AC 3EGXC 5CP6D 5B24C 1P3OB 3KYQA 4JJNB 3W97B 3PR6A 1ERQA 4ZAMA 3MGQB 3T4OA 1P3BD 4KQDA 1M19A 3V9RB 4CSRA 4JF4A 3S1YA 5AV8A 3X1TB 3LZ0D 4I5SA 3IX8A 1EQZD 4NXFA 1Z2CB 1TS7A 2DMWA 3AZGC 4YFMA 4PHTA 3REHB 4E45A 2XROA 3OLOA 3MKFA 2JKTM 1BLHA 4H9NB 3HLBA 2J7VA 1ZLAA 3E4OA 4Z2KA 4ZUXB 1VHMA 4G92B 2MJ6A 5F1FA 3VH5A 4Z2LA 1G6OA 2W3GA 4GD8A 4S2LA 5B0YC 1P3KD 3L29A 3R45A 4XZQB 1E3UA 5EVIC 2IWBA 5E2HA 1E6RA 3QP8A 3ZG9B 1YUEA 3X1SA 3LELA 3W96A 1GXDA 5JRGD 1LSXA 2VV8A 3C30A 5FI6A 1YSPA 3W98D 2OOLA 4QLCD 1P3LC 1KGFA 4Z2IA 2HP6A 1IYQA 1H8YA 4Y13A 1MPLA 1W1VA 4S2NA 2B95A 2XGNA 3X1UB 3IH9A 5HFOA 2WKIA 5CPJD 3B6FC 3WRZA 3OC2A 3C1BA 3VFHA 2J3WA 2QZ6A 3VH6A 5FASA 2P08A 2PYOA 3LJAB 4HBUA 1XJ6A 5L8MA 3X1VC 3UB6A 1S1ZA 2ZQAA 5J7EA 4P6ZS 2HUEB 3KWQB 4HI4A 2FJ7A 3MGPD 3G4PA 3NECA 3W8KA 4IBBA 5B33B 1P3OD 2BLSA 3W97D 4MBKA 4H9OA 3MGRC 4OJ5A 2VEAA 4A5RA 2VK3A 3VH6W 1B67A 5G49B 1KS0A 3R7WB 5B1MB 5AY8B 2H0YA 2G7UA 4GN2A 2D02A 4OOLA 5BO0A 1FR6A 4ARZA 3RELB 1TZYB 2EXBA 2C5WB 1OTIA 3W4OA 4C75A 1DP9A 3PAGA 5HL1A 4DRTA 2NZDA 5AQBA 3VMAA 4R1GA 5GLBA 5DFXA 1L0DA 4DDSA 5CEDA 3H82B 4NYYA 4WU8A 4ZUXD 3CPTA 3M6HA 5JA4B 3P7NA 3NI9A 4GHIB 3I7JA 1ERMA 1JWPA 4X1MA 2J8PA 5E5AB 4IBFA 3WD0A 4XZQD 4QPRA 1M19B 3KX0X 5AV8B 3DTMA 1BYWA 3BW6A 4O0PA 3E4QA 3IXHA 4OPQA 4PM6A 3T4JA 1LL8A 2XA7S 3GQZA 5AV9B 4NK3A 5GLDA 4J8WB 4RA7A 1P3IA 4UA7A 2WGWA 3HSHA 5B1LC 1W5DA 5AVBA 3CG5A 1H3OA 3SH8A 3REIA 3AZHB 2KLIA 3X1UD 3BWLA 4CLCC 3REJA 4ETZA 4ZBJC 4BL2A 4EWFA 1E6ZA 5DF7A 5DNMC 3LJAD 3DTKA 1GHMA 2OV5A 1I5QA 3NY4A 3KWQD 4JLFA 1HQ3C 1BZAA 1B6WA 5A93A 3UE3A 1LHYA 2CV5A 5F99B 1AIWA 1YPRA 5B33D 4H6JA 2WZZA 3GMWA 1V9YA 1IYPA 4KGCA 3W96B 3NQUB 3WWXA 3KS4A 1L0GA 4KZ7A 2NQBC 4IBEA 5AY8D 4WJ3C 4P0MA 5GL9A 3U2AA 2ZQ7A 3NJAA 2Y8HA 4U3TA 4KG2A 3BRMA 1G5UA 3RELD 1TZYD 1R4VA 4N9LA 4NE5A 3DAVA 4KG6A 3BECA 2H5SA 4R8PA 1PWDA 2KOIA 5GT3A 2GDNA 5B2JA 3NOTC 3HJKA 2PYOB 4EEUA 2HIOC 3B6GC 3LYXA 4J8VA 3QP4A 5I94A 2FJ7B 4WU9B 2Q9NA 3RJUA 5G18A 1UWNX 5E5AD 4WEJA 3QP6A 2RVQC 3AZJA 3AV1B 1JFIA 5TR7A 5CECA 5FQIA 1ESUA 3EQVA 4PKYA 1A0KA 2Y4AA 3NDGA 3NOUC 1P3MB 5GXQB 4GOGA 4L9FA 1FOFA 4NG2A 3UT9C 4EUZA 2YKHA 4AWLB 5AV9D 3FC7A 2R9WA 2Z6CA 3AZNC 3WS0A 4J8WD 4L9GA 4ARZB 3TW8A 1YT4A 4KUOA 3AFAC 5FQQA 4WZ5C 5HWTA 3KXBA 3AZHD 3AV2A 4LD9C 3TJZC 3P98A 3VP3A 2ZC6B 4OJ6A 3E0YA 3AL0C 2OSUA 3UNWA 2V8CA 2Z2MB 3G6OA 5B40A 2AROC 4KQQA 4KHAA 3HLEA 3OCNA 1W1PA 1BH9A 5KZHA 4I3JA 3WRTA 3ZCZA 1KX5A 3BJNA 5F99D 3BM6A 1PDCA 3EEAA 1J7MA 3A3FA 2W27A 3UY6A 3EWKA 3UE1A 3IBRA 3W96D 1LLBA 2JSSA 1P3AB 3F1PB 5EVEA 3TSGA 5L2FA 5B2IC 1S32C 1PNEA 1XGIA 4WL9A 4QB8A 3O86A 1CQAA 3KS8A 1G6AA 3CLOA 2OAP1 2WGVA 3T1QB 3VP1A 2GJ3A 1JTGA 4WBGA 1KX4A 3A0RA 3BLMA 4OLDA 3H7WA 2JKRI 4D60A 1T1CA 1ZG6A 3V50A 1N9BA 4NKPA 5F68A 1NLZA 3NBLA 4KUDA 2V5OA 2YKFA 1J3WA 4UAAA 3KYZA 3PBTA 1T3UA 3TU4A 3AZKA 4HOIA 3LZ1A 4WU9D 1WYCA 2Y2JA 1S67L 3FV7A 4G91B 2JE5A 1DP6A 3AV1D 2P7JA 1YLWA 5C3IC 1P3MD 1Z09A 5GXQD 1YLYA 4RX3A 3O3VA 1GHPA 4QY6A 4NY2A 3DWKA 3HONA 1P3FA 3UMEA 1S66L 5EE8A 4K0WA 4XXRA 3AN2C 5CX7A 1DJBA 3AZIC 2WAEA 2NUTC 3MZEA 1LSWA 3PBRA 3VE3A 4LV3A 5BNVB 4JGRA 1V9ZA 1Q9CA 3WTPC 5FEGA 2CMNA 3IH8A 4JF6A 1F66A 2HV1A 4P6BA 5BT1D 5B2JB 2FZ0A 3LIDA 2UV0E 1YQSA 3AZLC 1K57A 2F8NH 2PU2A 3AZEA 3O62C 4OQIA 2E8JA 3WS4A 1JTDA 1JFIB 4E3NA 5CP6A 1P3GC 2H0TA 3CAXA 1GCEA 1P3BA 2XH9A 1TS8A 1P3AD 3EEHA 3LZ0A 1VM1A 4FH4A 2VV6A 1EQZA 2PD7A 3UN7A 1ID3B 4LPZA 1FIKA 5U47A 3S7OA 3CI6A 4HGAC 2QPNA 3ITAA 4Q0HA 3KXBB 3AV2B 5EM0A 3C5AA 3MJQA 5L09A 1Y28A 3IWOA 4G3VA 1DY6A 3T4QA 5B40B 4KZ6A 4KHAB 1BH9B 4EO5C 3REKC 4G3KA 3NQJB 1ZHHB 5HL6A 4J8UB 1L0FA 4X68A 1XA7A 1O7EA 1SZVA 3T50A 1F2KA 1P3KA 1W7FA 1YLJA 3AZMD 2M7UA 1OTAA 5J8XA 2ZM0A 3QP5A 4LENA 1IELA 5JRGA 3S7NA 5AVCB 3BY9A 1ZKJA 2P9VA 5GHXA 5BPVA 5E2GA 1NJ4A 2PR5A 1KX4B 3H7WB 4JXWA 3C1CC 3EPHA 1FQGA 4JXVA 5FAOA 2K2NA 5B0ZC 5CPJA 4Y0UA 1ACFA 2QMIA 2X01A 3VSKA 4N1XA 1IKGA 3ZG5A 3L2AA 4ZDXA 3TU4B 3AZKB 3KYEA 5CHLB 3AZFD 1IFQA 2JKTI 4K91A 4HBTA 1AWIA 2INWA 5CPKC 3MQLA 4FSFA 1P3OA 1W63M 2WKRA 2Z2LB 3W97A 2ZC5B 2JKRM 3MQOA 5KSHA 1XXMA 1P3FB 3AYWC 4N92A 1ODVA 1ID3D 1OGGA 2Y2GA 3MKEA 3LR4A 1K4EA 5DJTA 3PBSA 4Z1WA 5HPIA 3M6BA 1KX3C 3AV2D 4U0TA 4L0LA 1F66B 1EW0A 2R78A 3MGSC 5FAPA 4H9NA 1UR8A 3UTAD 5FDHA 4ZUXA 4HIAA 3W99D 4LG2A 4J8UD 5EPHA 1XKZA 2RCXA 1KGGA 5DVAA 1LL5A 1P3BB 5FSRA 5B32D 3LI8A 1EQZB 1YLPA 5AV6C 2IWCA 2ZQ8A 5AVCD 3MVDC 1AOIC 5GSUC 4IEDA 1E6PA 4LFUA 3TRCA 3W98C 3C38A 4OQHA 4Y5FA 2JN7A 3X1UA 3V3RA 3L28A 3VH5T 4OUIA 3N8SA 3H0RC 5A91A 2PYRA 3LJAA 1MWRA 3ZG8B 3KWQA 4OOYA 1XJ4A 3ZG7B 4ZRRA 4XT2B 3WS1A 3RTYA 1P34C 1O07A 5B33A 4OKPA 5EV0A 5M1AA 4UPKA 3MGPC 3UPOA 4M3KA 2Y2IA 3L25A 2K7SA 2IOUA 2JKFA 4JJNC 3MGQC 1HTZA 5AY8A 5TBMA 4S2MA 4RYEA 4Z5TD 4QU3A 5KIZA 3X1TC 4EV4A 3UTBB 4X23B 2VJWA 1TZYA 3C8CA 1OPXA 2H10A 3VH6T 1ONGA 1F66D 2EX2A 3CUEC 5IS1A 4BD0A 3SH7A 3REHC 1TD5A 4LV0A 5CGSA 1ULYA 4CAYB 3WA9C 3MBZA 2ZY5A 3D72A 1KDSA 5JA4A 3UB7A 4GHIA 4EBPA 1YSQA 5F83A 5E5AA 2Y2OA 4Y3IA 5M18A 3ZVTA 3LFVA 4G92C 3E2KA 4B93A 3S4XA 2BTFP 3MNNC 1M6KA 2ZMAA 1CXWA 3PYPA 3ZDJA 5HPFA 3KSYA 4ZJ3A 4DJ3A 3B47A 4LGWA 5AV9A 3NDEA 4J8WA 1NRFA 3MGRA 1QMEA 1IYOA 3K3DA 4H9RA 3AZHA 3BYDA 4XUJC 4R4SA 5DJUA 1ES4A 3N8RA 3F1OA 1M18C 1EAKA 1UR9A 5B31D 1UGUA 5TFQA 4Z2MH 5GT0C 1JWZA 3M2KA 3PXPA 4IBGA 1ESIA 4WMCD 1DJAA 4R70A 5F99A 1D7EA 1K25A 2IO5B 4PAUA 1YMSA 5M19A 2HUEC 1LSVA 3HLFA 4HESA 4N9KA 3NQUA 3PBOA 4YS3B 5BNXA 1CI9A 3B3XA 2B5RA 3ZYTA 1E25A 5B24B 2ZL1B 3VH5W 3UTBD 4X23D 1P97A 5B1MC 5DKKA 3ZNYA 2EX6A 4X1LA 1I2SA 2I72A 2V1AA 5F5YA 5FL3A 3HLDA 2EA9A 1DRMA 3AZGB 5AJGA 3RELC 2C6WB 2V0WA 3BY8A 4RQ9A 4KZ8A 3IX3A 3VE4A 2XFTA 2Y2QA 4OJOA 4H9SA 4WU9A 2HDSA 3IF6A 1EROA 5GLCA 3ZGAB 3AV1A 1N9NA 1IKIA 4HJ3A 4EUVA 5CPID 1P3MA 3WD1A 4DRAA 5GXQA 4I3AA 3WAAD 2Y91A 3SS5A 4KQRA 1HLUP 5CHMA 5TBMB 1M19C 1MWSA 3UPNA 1VETB 4MDZA 5AV8C 2VZWA 3MZDA 3UE0A 4ZJ1A 2QWSA 2VGLM 3LI9A 2PYPA 4DXCA 2PT7A 3GR2A 2FFFB 2HP5A 2M1CA 1BULA 2VX8A 1P3LB 1XA1A 5B32G 1Q2PA 1U60A 3AGEA 4BLMA 3D3OA 1MY8A 3MQQA 5KDMA 2J8YA 5HARA 2WZXA 4Z66D 2HPBA 1ZLAC 3NHQA 1ES5A 3B6FB 3BEBA 3GV9A 3S7QA 5BS7A 2IWDA 4S2JA 2HZ5A 4GD6A 4WV4B 2JKGA 3X1VB 4DN0A 1ZTUA 1YU3A 3QHYA 4YS3D 1P3AA 3F1PA 2ZLYA 2LB5A 1T18A 2FH5A 2WUQA 5B24D 3X1SC 3LELC 4NXBA 4X25A 2O9CA 3MGRB 2F8NG 2PBYA 1X0OA 3DBAA 4H9RB 5AV5C 2KDKA 3AZGD 2J3TC 2DNSA 3BLSA 3ZG0A 4S2NC 3WKJC 4KZ4A 3F1OB 3DTEA 3MZFA 4GDBA 3AZNA 3KSHA 4UQIS 4DE3A 1KOUA 3C1BC 3T12B 2PYOC 3F1NB 3PAEA 4NXEA 1XJ3A 4EEPA 3T1RA 2AROA 2FJ7C 4MB4A 3LIBA 1JVJA 4M6BA 3AZMA 5BNXB 2EFUA 3P01A 4NFTA 5B0YD 2ZY3A 4KZ5A 5EVID 3G2ZA 3DW0A 4BMWA 1F1EA 5DF8A 5BNVA 2XR0A 4BBTA 1W79A 3HL9A 4K0XA 3C7UA 2Y55A 3LIAA 4IBXA 1E6NA 2WYXA 3ZQ5A 5B2IA 1T1AA 5FAQA 1P3LD 4KENB 2NZDC 5B1LB 1U35C 4JXGA 1K6RA 4EERA 1OT6A 4WELA 3G34A 4BBVA 4JGQA 2EWVA 4OQGA 3IF6B 1IYSA 4WNNB 4HMEA 4CLCB 3A6NA 3AZFA 4JBFA 4WU8C 4OJPA 3B6FD 4S2PA 4NZ5A 2P74A 2XLNA 3B0BA 3G30A 3V39A 3L7HA 5DNMB 1MWUA 3X1VD 4KQOA 3IP4C 5G4YA 4Y7PA 1HQ3B 3KSFA 3IXBA 2PU4A 3LEZA 4DRBA 2HP9A 5B31G 2JBFA 3JYIA 1ID3A 4GS9A 4KG5A 2PHYA 3MGRD 4UA6A 2G5HC 3O87A 4IBIA 2AVXA 2NQBB 3BFEA 3QNBA 1P3IC 2ZY2A 4TX8A 4C3QA 2Y59A 5AVBC 1XFNA 1WWIA 2GX5A 4DE2A 3REIC 3AZIA 4EETB 3UTAA 4J8XC 1OJ5A 2OLUA 3FPWA 1P9WA 5KDMB 2PBDP 5HDSA 4C6YA 3NQJA 2JC7A 2WGIA 3AGFA 3REJC 4ID4A 3W99A 4J8UA 3N8LA 3HUOA 1NLYA 1PZOA 3OPHA 5HDCA 5E2EA 5KSCA 3B6GB 2CV5C 4FH2A 4DDYA 1MC0A 1MBLA 1YAXA 3HUNA 5B32A 2XDMA 1PYYA 4GHLA 3MFXA 2P04A 4DXBA 4YM6A 4IVKA 5AVCA 3V3SA 4KGCC 1TS0A 4NZ4A 1NRJA 2QYBA 5FATA 2VA0A 3UT9B 3EOIA 4FTXA 3FDDA 4OPZA 2F8NK 4BBUA 2OAQ1 5HDDA 2Y2KA 4OH0A 1P3PC 1WE4A 5AVEA 1J9MA 3ZFZA 3AZNB 2FN2A 1SHVA 5B1LD 5EOEA 4CPKA 3AFAB 4R8PC 5GT3C 4LD9B 4PM7A 5B2JC 2IA2A 4CLCD 5A90A 4J8VC 2AROB 5DNMD 4HP9A 3AZMB 1HQ3D 3BFFA 3AZJC 4QNLA 3UMDA 3HVFA 1M1AA 1NZUA 5E2FA 3IS2B 3UB5P 3CITA 4F3LB 2ACGA 4Z5TA 2VKSA 1T19A 4IBJA 3VP4A 3W4PA 1NYMA 4WEKA 3FKVA 2NQBD 4JF5A 5B2IB 4H8RA 1S32B 1H3QA 1QMFA 3Q81A 4O8GA 1W63Q 2ZQDA 3KXBC 3NOPC 1WWSA 1BLCA 5LBRA 4OPYA 5B40C 1W8YA 3A6NB 3AZFB 1XFQA 4G3WA 1CK3A 4MLLA 1L3LA 2HIOD 3KUYC 4GH9A 2Y2PA 2PDRA 2XFSA 1KX5C 3B6GD 3D4FA 3VP0A 2M7VA 5IT5A 3VP2A 4GS9B
chains in the Genus database with same CATH topology
2RVQD 3BFCA 5EVLA 3CJMA 5C3IB 3MFDA 3Q82A 3NC8A 3UT9D 1Z6FA 3EQUA 3AN2B 1KX4C 3AZND 3AZIB 4NE3A 3UTAB 5B31A 3AFAD 5CTMA 4R0QA 3WTPB 4S2KA 4LD9D 3W99B 4KUDC 3MGSA 3TU4C 4WMCA 3AZKC 1K38A 3LZ1C 3G2YA 5CHUA 2AROD 3VSLA 2ZQ9A 1FCNA 5B32B 3AZLB 1K55A 3MXRA 2ZJ9A 3O62B 3UPPA 3B0DC 4YM6B 5DNNA 3PBQA 4Z2MG 3LO7A 3LY4A 1P3GB 1ES2A 5CGXA 4BENA 1P3FC 3UTBA 4X23A 4WM9A 2YFVB 4RVAA 1ZG4A 2VGJA 5B2ID 1S32D 4H9QA 1GHIA 4IBRA 1PZRA 1KE4A 1KDWA 3IQAA 4BD1A 4CAYA 4NYUA 2R9XA 2XK1A 3IWQA 4FCFA 4EQIA 3A6ND 2F8NB 3UDIA 3G32A 1K57C 3REKB 3AZEC 3VOYA 3LCEA 4D2OA 5CPIA 1M1AB 5EOOA 3C7VA 4DE1A 5CP6C 2Y2LA 4Y0OA 3WAAA 2Y2HA 1P3BC 4Z5TB 4S2IA 3LZ0C 4OP8A 1A7WA 3ISGA 1EQZC 4R3BA 4DE0A 1M40A 4B4ZA 3EG5B 3NCKA 4NZ1A 3AN2D 4Z9QA 4P87A 1KGEA 1YM1A 3AZID 1RP5A 1PWGA 3WTPD 3TOIA 4F94A 4Z66A 5JYOA 5B0ZB 1BTLA 3C4PA 4JXSA 1W8QA 3L27A 1N1JB 3AZLD 1NY0A 4IJFA 1ALQA 3OPRA 3EPKA 3O62D 4YS3A 1P3KC 4YM6D 1GA0A 3GRJA 4UHUA 5DTKA 5GLAA 5B24A 1P3GD 2XD1A 5JRGC 4NZ3A 4Q8IA 2E8IA 4QLCC 3AZGA 2UWXA 1WYBA 4OPRA 5B31B 4GB7A 4B4XA 1KX3B 5HW3A 1K6SA 1FCMA 4CJNA 5CPJC 4BQMA 3MGSB 2F8ND 3N7WA 3REKD 4GNUA 2HDUA 1M1AD 4ZBEA 5CTNA 1P3OC 5DNNB 4E44A 3W97C 5CERA 2YFWB 2WAFA 5B0YA 1BSGA 4UA9A 5EVIA 2CC1A 3IT9A 1XGJA 1CEFA 2ZM5A 5AV6B 4H9QB 1SKFA 3MVDB 1AOIB 2J9OA 4MBFA 4OOMA 2ZY4A 1K54C 1P3LA 5GSUB 4IBDA 1MXOA 3FKWA 3C1CD 4YINA 5B0ZD 2XF3A 4ZUXC 3B6FA 2A3UA 3FZCA 3X1VA 3C4OA 3IXGA 5CPIB 3WS2A 5D3OA 3WAAB 4XZQC 2RL3A 4IJEA 1P34B 4R4RA 1L0EA 5FQ9A 4X56A 4PM9A 3HBRA 5F82A 1PI4A 3AYWD 1PI5A 3M2JA 1ONHA 4LV1A 3X1UC 1KX3D 1EI5A 2JCHA 4Z66B 3MGSD 3GVBA 3LJAC 4E6XA 3WA9B 2EX8A 3KWQC 2BYKA 1LL9A 2G5IC 5B33C 5DNND 1YU1A 3RXWA 4KZAA 1PZPA 3FWLA 3MNNB 2EFXA 5AY8C 1YMXA 5FQJA 1E4DA 4MBHA 5AV6D 1TEMA 2W8SA 2ZC7A 3MVDD 1AOID 1TZYC 5FUGA 5GSUD 4EBNA 4X55A 5B1LA 4MNRA 1RGZA 5AV5A 4WNNA 1K4FA 3Q7VB 4XUJB 5CHJA 4WZSB 3WKJA 3GSGA 3F6TA 4GKUA 1M18B 5DNMA 5GT0B 5E5AC 1HQ3A 3AGDA 2XD5A 5CEBA 5B0YB 4R23A 2DF4C 1P34D 1IEMA 1SDEA 1Y54A 5EVIB 4QJGA 4FD8A 5AV9C 4NE6A 2ZD8A 4JJND 2NQBA 3MGQD 4J8WC 4ZTKA 3O88A 3X1TD 4QD4A 3ZNTA 4GDNA 3WS5A 3AZHC 2V20A 3REHD 3WTPE 3PBNA 4E3LA 3HLCA 1YU2A 4WYYA 1HZOA 3WA9D 4PPRA 1GA9A 3RXXA 2HIOA 1U35A 3B6GA 4E3IA 3SS4A 5F99C 1MKIA 4DQYB 2CWEA 3W96C 3MNND 3KFUG 3A3JA 3HREA 2Y2MA 4OJLA 3WX7A 3ZHHA 3UT9A 3SH9A 3A1KA 4CSRB 3N3FA 1KVMA 3AFAA 4WZ5A 5EECA 1SCWA 3IWIA 4LD9A 5FI7A 2DCFA 4XUJD 4E3JA 1LI0A 1M18D 3HLWA 4H9SC 4H9PA 5CGWA 3UDFA 4WU9C 3IF6C 4J8XA 3CMZA 5GT0D 2BYKB 2WADA 1ZLAB 1LI9A 3AV1C 1P3MC 1TAFA 5GXQC 5AQ9A 1BT5A 4AWLC 3R45B 4DKIA 2FFYA 3IHBA 4QHCA 1S32A 2BYMA 5FUGB 4E6WA 3X1SB 3LELB 2Y2NA 3OZHA 3BFGA 5B1MD 3L26A 5BT1C 5AV5B 4E3KA 3HUMA 1H8ZA 3WKJB 1P3PA 4ZBJB 3QNCA 3C1BB 5BS7C 1P3AC 5TGFA 2WKEA 4GHAA 1RCJA 4XUXA 4N1HA 1XPBA 1M19D 4H9OB 2XQZA 3AN2A 5AV8D 1JWVA 1HVBA 4BL3A 1Q2QA 4UUZA 3WTPA 4LCLA 5BO0B 1ES3A 1BUEA 1VQQA 2NZDB 3G35A 2HIOB 1U35B 1YLTA 4G91C 2LY8A 3AZLA 1ZLAD 1TDLA 1RGYA 4WU8B 5DF9A 3O62A 1KE0A 3AZMC 3KUYA 1P3GA 4IBKA 2YFVA 4LV2A 1E3UD 3V5MA 5HAIA 1PIOA 3X1SD 3LELD 4KZ3A 1N4OA 2WKHA 4QY5A 5AV5D 1P3IB 3ZVWA 2WGWB 5AVBB 2F8NA 3WKJD 1H3OB 3H0MC 3REIB 4H9PB 2OLVA 5CXWA 5DTTA 4J8XB 3A6NC 3PTEA 3AZFC 3REKA 4HEFA 3C1BD 4S2OA 2DQNC 3REJB 4ZJ2A 2PYOD 5DTSA 4LCMA 1KVLA 1TAFB 4X6TA 2FJ7D 5FQMA 5FI2A 5F1GA 2CV5B 1SDNA 1K56A 3BFDA 1ID3C 1FR1A 2BYMB 2VQRA 4BJPA 4KGCB 4X69A 1BH8A 3AV2C 1FSWA 4GZBA 3C1CA 3OPLA 5FA7A 3GTCA 1BLSA 3A3EA 3UTAC 1P3PB 5B0ZA 2NZDD 1U35D 3W99C 1FCOA 4R8PB 4J8UC 1N1JA 5GT3B 3DWZA 5JYPA 2DRWA 4WU8D 3CZDA 2HDRA 4J8VB 5B32C 5CPKA 1YU0A 1HD8A 5HAQA 4YM6C 5AVCC 1PW8A 3AZJB 3AYWA 4B88A 5KMWA 1AXBA 2XEPA 4E3OA 4UUZB 1HTAA 1KX3A 1CI8A 3MXSA 1NZOA 1P3ID 5AVBD 3LY3A 3Q1FA 3REID 3Q7ZA 4J8XD 1I2WA 1FSYA 4O7DA 3B0CT 2BG1A 3REJD 3G31A 3P5JB 1TDGA 5GHZA 3KUYB 2YFWA 1KE3A 1S0WA 3EPJA 1KX5B 2CV5D 1M1AC 3UDXA 3HLGA 3A3DA 1H5XA 4Z5TC 1TVFA 1XP4A 5AV6A 2X71A 3E2LA 4KGCD 3MVDA 1AOIA 2ZQCA 5GSUA 1F66C 4HGAB 1DJCA 3W98A 3H0LC 4QLCA 5EUAA 4Y0TA 4PMAA 1P3PD 1YU4A 3SS3A 5CRFA 4EO5B 1OMEA 4R8PD 3W4QA 5GT3D 4OVDA 5B2JD 4KUDB 2L5AA 1ZC2A 2G2WA 4J8VD 5GHYA 3LZ1B 1S6RA 1P34A 1CEGA 3MGPA 1NYYA 3AZJD 5AQAA 1PWCA 2ZM2A 3B0DB 4JJNA 3MGQA 3Q07A 3V9RA 1BH8B 3X1TA 4WZ4A 5IHVA 4X53A 3VOZA 3N4IA 3A3IA 5HX9A 4EBLA 3C1CB 2X02A 1G68A 4OP5A 4OONA 4P85A 3SOIA 1W2EA 5BOHA 3REHA 5B31C 2A49A 1K54A 3KXBD 1C3BA 2HDQA 3WA9A 3IHAA 5B40D 4PM8A 4PM5A 1K55C 5CPKB 2ZC3B 3KUYD 1KX5D 3S22A 3AZEB 3NIAA 3OCLA 4JKTA 3P09A 3MNNA 5DNNC 1NXYA 3AYWB 5CP6B 3UTBC 4XZQA 4X23C 2VGKA 3LZ0B 3ITBA 4DF6A 3B0CW 2J9PA 4U0XA 4RX2A 5A92A 4R3JA 2V1ZA 3IF5A 2G2UA 1KX4D 5E43A 5HAPA 3Q7VA 4XUJA 1M18A 2ZM8A 2RIQA 2WK0A 2EX9A 5GT0A 1EWZA 4KUDD 3FKEA 4IVIA 3TU4D 3AZKD 3LZ1D 3TG9A 3N6IA 4NETA 1BLPA 5CPIC 2EXAA 1KU5A 1K56D 3WAAC 3FYZA 1L2SA 4KZBA 4OQ0A 1P3KB 1XX2A 4JPMA 1YLZA 1P3FD 5JRGB 5G49A 5B1MA 2P9VB 4OLGA 3W98B 4QLCB 4MEZA 3IXDA 4IBCA 3RELA 3EPLA 3A1IA 1BFMA 4Z66C 2Q9MA 4KZ9A 2V2FF 5CPJB 3UO9A 3VFFA 4XUZA 2IO5C 5AQ7A 1PW1A 1MWTA 5CPKD 5FQKA 4E3MA 3AZED 4YS3C 3MGPB 2ZC4B 3OPPA 2F2AC 5CP6D 5B24C 1P3OB 4JJNB 3W97B 4ZAMA 1ERQA 3MGQB 1P3BD 1M19A 3V9RB 4CSRA 4JF4A 3S1YA 5AV8A 3X1TB 3LZ0D 1EQZD 1Z2CB 3AZGC 4YFMA 3REHB 4E45A 3MKFA 1BLHA 4H9NB 3HLBA 2J7VA 1ZLAA 4ZUXB 4G92B 5F1FA 3VH5A 4GD8A 4S2LA 5B0YC 1P3KD 3L29A 3R45A 4XZQB 1E3UA 5EVIC 2IWBA 5E2HA 3ZG9B 1YUEA 3X1SA 3LELA 3W96A 5JRGD 5FI6A 3W98D 4QLCD 1P3LC 1KGFA 2HP6A 1IYQA 1H8YA 1MPLA 4S2NA 2XGNA 3X1UB 3IH9A 5HFOA 2WKIA 5CPJD 3B6FC 3WRZA 3OC2A 3C1BA 3VFHA 2QZ6A 3VH6A 5FASA 2PYOA 3LJAB 4HBUA 3X1VC 2ZQAA 2HUEB 3KWQB 2FJ7A 3MGPD 3G4PA 3W8KA 4IBBA 5B33B 1P3OD 2BLSA 3W97D 4MBKA 4H9OA 3MGRC 4OJ5A 4A5RA 3VH6W 1B67A 5G49B 5B1MB 5AY8B 2H0YA 4GN2A 4OOLA 5BO0A 1FR6A 3RELB 1TZYB 2EXBA 2C5WB 4C75A 3W4OA 3PAGA 5HL1A 4DRTA 2NZDA 5AQBA 3VMAA 4R1GA 5GLBA 5CEDA 1L0DA 4DDSA 4NYYA 4WU8A 4ZUXD 3M6HA 5JA4B 3NI9A 3I7JA 1ERMA 1JWPA 2J8PA 5E5AB 4IBFA 4XZQD 1M19B 5AV8B 3DTMA 3IXHA 4OPQA 4PM6A 3GQZA 5AV9B 4NK3A 5GLDA 4J8WB 4RA7A 1P3IA 4UA7A 2WGWA 3HSHA 5B1LC 1W5DA 5AVBA 3CG5A 1H3OA 3SH8A 3REIA 3AZHB 3X1UD 3REJA 4ZBJC 4BL2A 4EWFA 5DF7A 5DNMC 3LJAD 1GHMA 2OV5A 1I5QA 3NY4A 3KWQD 4JLFA 1HQ3C 1BZAA 1B6WA 5A93A 3UE3A 1LHYA 2CV5A 5F99B 5B33D 2WZZA 3GMWA 1IYPA 4KGCA 3W96B 3NQUB 3WWXA 3KS4A 1L0GA 4KZ7A 2NQBC 4IBEA 5AY8D 4WJ3C 4P0MA 5GL9A 2ZQ7A 4U3TA 4KG2A 3BRMA 3RELD 1TZYD 1R4VA 4N9LA 4NE5A 4KG6A 3BECA 2H5SA 4R8PA 1PWDA 5GT3A 2GDNA 5B2JA 2PYOB 2HIOC 3B6GC 4J8VA 5I94A 2FJ7B 4WU9B 2Q9NA 3RJUA 5G18A 5E5AD 4WEJA 2RVQC 3AZJA 3AV1B 1JFIA 5TR7A 5CECA 5FQIA 1ESUA 3EQVA 2Y4AA 3NDGA 1P3MB 5GXQB 4GOGA 1FOFA 3UT9C 4EUZA 4AWLB 5AV9D 2R9WA 3AZNC 3WS0A 4J8WD 1YT4A 3AFAC 5FQQA 4WZ5C 3KXBA 3AZHD 3AV2A 4LD9C 3P98A 3VP3A 2ZC6B 4OJ6A 3AL0C 2OSUA 3UNWA 2Z2MB 5B40A 2AROC 4KQQA 4KHAA 3HLEA 3OCNA 1BH9A 5KZHA 3WRTA 3ZCZA 1KX5A 5F99D 3BM6A 3A3FA 3UY6A 3UE1A 3W96D 1LLBA 2JSSA 1P3AB 3TSGA 5L2FA 5B2IC 1S32C 1XGIA 4QB8A 3O86A 3KS8A 1G6AA 2WGVA 3VP1A 1JTGA 4WBGA 1KX4A 3BLMA 4OLDA 1ZG6A 3V50A 1N9BA 3NBLA 4KUDA 4UAAA 3PBTA 1T3UA 3TU4A 3AZKA 3LZ1A 4WU9D 1WYCA 2Y2JA 3FV7A 4G91B 2JE5A 3AV1D 1YLWA 5C3IC 1P3MD 5GXQD 1YLYA 4RX3A 3O3VA 1GHPA 4QY6A 4NY2A 3DWKA 3HONA 1P3FA 5EE8A 4K0WA 4XXRA 3AN2C 1DJBA 3AZIC 2WAEA 3MZEA 3PBRA 4LV3A 5BNVB 1Q9CA 3WTPC 3IH8A 4JF6A 1F66A 4P6BA 5BT1D 5B2JB 1YQSA 3AZLC 1K57A 2F8NH 2PU2A 3AZEA 3O62C 4OQIA 3WS4A 1JTDA 1JFIB 4E3NA 5CP6A 1P3GC 2H0TA 1GCEA 1P3BA 2XH9A 1P3AD 3LZ0A 1VM1A 4FH4A 1EQZA 3UN7A 1ID3B 5U47A 4HGAC 2QPNA 3ITAA 3KXBB 3AV2B 3C5AA 3IWOA 1DY6A 5B40B 4KZ6A 4KHAB 1BH9B 4EO5C 3REKC 3NQJB 4J8UB 1L0FA 4X68A 1XA7A 1O7EA 1P3KA 1W7FA 1YLJA 3AZMD 5J8XA 2ZM0A 4LENA 1IELA 5JRGA 5AVCB 1ZKJA 2P9VA 5GHXA 5BPVA 5E2GA 1NJ4A 1KX4B 4JXWA 3C1CC 3EPHA 1FQGA 4JXVA 5FAOA 5B0ZC 5CPJA 4Y0UA 2QMIA 2X01A 3VSKA 4N1XA 1IKGA 3ZG5A 3L2AA 4ZDXA 3TU4B 3AZKB 5CHLB 3AZFD 4K91A 4HBTA 5CPKC 4FSFA 1P3OA 2Z2LB 3W97A 2ZC5B 5KSHA 1XXMA 1P3FB 3AYWC 4N92A 1ID3D 2Y2GA 3MKEA 1K4EA 3PBSA 3M6BA 1KX3C 3AV2D 4U0TA 4L0LA 1F66B 3MGSC 5FAPA 4H9NA 3UTAD 5FDHA 4ZUXA 3W99D 4LG2A 4J8UD 5EPHA 1XKZA 2RCXA 1KGGA 5DVAA 1LL5A 1P3BB 5FSRA 5B32D 1EQZB 1YLPA 5AV6C 2IWCA 2ZQ8A 5AVCD 3MVDC 1AOIC 5GSUC 4IEDA 3W98C 4OQHA 3X1UA 3V3RA 3L28A 3VH5T 4OUIA 3N8SA 3H0RC 5A91A 3LJAA 1MWRA 3ZG8B 3KWQA 4OOYA 3ZG7B 3WS1A 1P34C 1O07A 5B33A 4OKPA 5M1AA 4UPKA 3MGPC 3UPOA 4M3KA 2Y2IA 3L25A 2IOUA 4JJNC 3MGQC 1HTZA 5AY8A 4S2MA 4RYEA 4Z5TD 4QU3A 3X1TC 4EV4A 3UTBB 4X23B 1TZYA 2H10A 3VH6T 1ONGA 1F66D 2EX2A 4BD0A 3SH7A 3REHC 4LV0A 5CGSA 1ULYA 4CAYB 3WA9C 3MBZA 2ZY5A 1KDSA 5JA4A 4EBPA 5F83A 5E5AA 2Y2OA 5M18A 3ZVTA 4G92C 3E2KA 3S4XA 3MNNC 1M6KA 2ZMAA 3ZDJA 3KSYA 4ZJ3A 5AV9A 3NDEA 4J8WA 1NRFA 3MGRA 1QMEA 1IYOA 4H9RA 3AZHA 3BYDA 4XUJC 4R4SA 1ES4A 3N8RA 1M18C 5B31D 5TFQA 4Z2MH 5GT0C 1JWZA 3M2KA 4IBGA 1ESIA 4WMCD 1DJAA 5F99A 1K25A 2IO5B 1YMSA 5M19A 2HUEC 3HLFA 4HESA 4N9KA 3NQUA 3PBOA 4YS3B 5BNXA 1CI9A 3B3XA 2B5RA 1E25A 5B24B 3VH5W 3UTBD 4X23D 5B1MC 3ZNYA 2EX6A 1I2SA 2I72A 3HLDA 3AZGB 3RELC 2C6WB 4KZ8A 2XFTA 2Y2QA 4OJOA 4H9SA 4WU9A 2HDSA 3IF6A 1EROA 5GLCA 3ZGAB 3AV1A 1IKIA 5CPID 1P3MA 4DRAA 5GXQA 3WAAD 2Y91A 3SS5A 4KQRA 5CHMA 1M19C 1MWSA 3UPNA 5AV8C 3MZDA 3UE0A 4ZJ1A 4DXCA 3GR2A 2FFFB 2HP5A 1BULA 1P3LB 1XA1A 5B32G 1Q2PA 1U60A 3AGEA 4BLMA 1MY8A 5KDMA 2J8YA 5HARA 2WZXA 4Z66D 2HPBA 1ZLAC 1ES5A 3B6FB 3BEBA 3GV9A 5BS7A 2IWDA 4S2JA 4GD6A 4WV4B 3X1VB 1YU3A 3QHYA 4YS3D 1P3AA 2ZLYA 2WUQA 5B24D 3X1SC 3LELC 3MGRB 2F8NG 2PBYA 4H9RB 5AV5C 3AZGD 2DNSA 3BLSA 3ZG0A 4S2NC 3WKJC 4KZ4A 3MZFA 4GDBA 3AZNA 4DE3A 3C1BC 2PYOC 3PAEA 2AROA 2FJ7C 1JVJA 4M6BA 3AZMA 5BNXB 2EFUA 4NFTA 5B0YD 2ZY3A 4KZ5A 5EVID 3G2ZA 3DW0A 1F1EA 5DF8A 5BNVA 2XR0A 1W79A 3HL9A 4K0XA 3C7UA 2Y55A 4IBXA 2WYXA 5B2IA 5FAQA 1P3LD 4KENB 2NZDC 5B1LB 1U35C 4JXGA 1K6RA 4WELA 3G34A 4OQGA 3IF6B 1IYSA 4WNNB 3A6NA 3AZFA 4JBFA 4WU8C 4OJPA 3B6FD 4S2PA 4NZ5A 2P74A 2XLNA 3B0BA 3G30A 3V39A 5DNMB 1MWUA 3X1VD 4KQOA 3IP4C 4Y7PA 1HQ3B 3IXBA 2PU4A 3LEZA 4DRBA 2HP9A 5B31G 2JBFA 3JYIA 1ID3A 4KG5A 3MGRD 4UA6A 2G5HC 3O87A 4IBIA 2NQBB 3BFEA 3QNBA 1P3IC 2ZY2A 4C3QA 2Y59A 5AVBC 1WWIA 4DE2A 3REIC 3AZIA 3UTAA 4J8XC 2OLUA 5KDMB 4C6YA 3NQJA 2JC7A 2WGIA 3AGFA 3REJC 4ID4A 3W99A 4J8UA 3N8LA 3HUOA 1PZOA 3OPHA 5E2EA 5KSCA 3B6GB 2CV5C 4FH2A 4DDYA 1MBLA 3HUNA 5B32A 2XDMA 1PYYA 4GHLA 4DXBA 4YM6A 4IVKA 5AVCA 3V3SA 4KGCC 4NZ4A 5FATA 3UT9B 3FDDA 4OPZA 2F8NK 2Y2KA 4OH0A 1P3PC 1WE4A 1J9MA 3ZFZA 3AZNB 1SHVA 5B1LD 5EOEA 4CPKA 3AFAB 4R8PC 5GT3C 4LD9B 4PM7A 5B2JC 5A90A 4J8VC 2AROB 5DNMD 3AZMB 1HQ3D 3BFFA 3AZJC 4QNLA 3HVFA 1M1AA 1NZUA 5E2FA 4Z5TA 4IBJA 3VP4A 3W4PA 1NYMA 4WEKA 3FKVA 2NQBD 4JF5A 5B2IB 4H8RA 1S32B 1QMFA 3Q81A 2ZQDA 3KXBC 1WWSA 1BLCA 4OPYA 5B40C 1W8YA 3A6NB 3AZFB 1CK3A 4MLLA 2HIOD 3KUYC 4GH9A 2Y2PA 2XFSA 1KX5C 3B6GD 3D4FA 3VP0A 3VP2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BFC A;  3IH9 A;  5HFO A;  5EVL A;  3CJM A;  2WKI A;  3WRZ A;  3MFD A;  3OC2 A;  4OQH A;  3VFH A;  2QZ6 A;  5FAS A;  3Q82 A;  3V3R A;  5TGF A;  4HBU A;  3NC8 A;  1Z6F A;  2WKE A;  2ZQA A;  3EQU A;  3N8S A;  1RCJ A;  5A91 A;  4XUX A;  4N1H A;  1MWR A;  1XPB A;  3G4P A;  2XQZ A;  3W8K A;  1JWV A;  3ZG8 B;  4OOY A;  5CTM A;  1HVB A;  4R0Q A;  2BLS A;  4S2K A;  3ZG7 B;  4MBK A;  4A5R A;  4BL3 A;  3WS1 A;  1O07 A;  1Q2Q A;  4OKP A;  5M1A A;  4WMC A;  4LCL A;  1K38 A;  3G2Y A;  5CHU A;  3UPO A;  3VSL A;  4M3K A;  2Y2I A;  1ES3 A;  2H0Y A;  4GN2 A;  4OOL A;  2ZQ9 A;  1FCN A;  1BUE A;  1K55 A;  1VQQ A;  3G35 A;  1FR6 A;  1HTZ A;  1YLT A;  3MXR A;  2EXB A;  4S2M A;  4RYE A;  2C5W B;  4C75 A;  3W4O A;  4QU3 A;  2ZJ9 A;  3UPP A;  4EV4 A;  3PAG A;  5HL1 A;  4DRT A;  1TDL A;  3PBQ A;  1RGY A;  3LO7 A;  3LY4 A;  5DF9 A;  1ES2 A;  2H10 A;  4R1G A;  5CGX A;  5AQB A;  5GLB A;  1L0D A;  1ONG A;  2EX2 A;  4BEN A;  4DDS A;  4WM9 A;  5CED A;  5KSC A;  1KE0 A;  4BD0 A;  3SH7 A;  4RVA A;  4LV0 A;  5CGS A;  1ZG4 A;  3M6H A;  2VGJ A;  3MBZ A;  1GHI A;  4IBR A;  3NI9 A;  3I7J A;  1ERM A;  1KE4 A;  1JWP A;  1E3U D;  4LV2 A;  1KDS A;  1KDW A;  3V5M A;  3IQA A;  4BD1 A;  5HAI A;  1PIO A;  2R9X A;  2XK1 A;  3IWQ A;  4EBP A;  5F83 A;  4FCF A;  4KZ3 A;  4EQI A;  2Y2O A;  5M18 A;  3ZVT A;  1N4O A;  3DTM A;  2WKH A;  3E2K A;  4QY5 A;  3IXH A;  4OPQ A;  3S4X A;  3UDI A;  4PM6 A;  3G32 A;  5KMW A;  3ZVW A;  1M6K A;  2WGW B;  1K57 C;  2ZMA A;  3GQZ A;  4NK3 A;  3VOY A;  3ZDJ A;  3LCE A;  4D2O A;  5GLD A;  4RA7 A;  4ZJ3 A;  2OLV A;  5CXW A;  4UA7 A;  5DTT A;  2WGW A;  5EOO A;  3C7V A;  3PTE A;  1W5D A;  4DE1 A;  2Y2L A;  3CG5 A;  3NDE A;  4HEF A;  4Y0O A;  3SH8 A;  2Y2H A;  4S2O A;  1NRF A;  4ZJ2 A;  4S2I A;  1QME A;  1IYO A;  4OP8 A;  5DTS A;  3ISG A;  4LCM A;  4R3B A;  4DE0 A;  1KVL A;  1M40 A;  4BL2 A;  4EWF A;  4X6T A;  3BYD A;  5FQM A;  4B4Z A;  5DF7 A;  5FI2 A;  5F1G A;  4R4S A;  1SDN A;  1ES4 A;  1K56 A;  3BFD A;  3N8R A;  3NCK A;  1GHM A;  2OV5 A;  1I5Q A;  3NY4 A;  4JLF A;  4Z9Q A;  1BZA A;  1FR1 A;  5A93 A;  4P87 A;  3UE3 A;  5TFQ A;  1KGE A;  1LHY A;  1YM1 A;  1JWZ A;  3M2K A;  4BJP A;  1ESI A;  1RP5 A;  1PWG A;  4X69 A;  4WMC D;  3TOI A;  4F94 A;  1DJA A;  1K25 A;  2WZZ A;  3GMW A;  1IYP A;  1YMS A;  5JYO A;  5M19 A;  1FSW A;  4GZB A;  1BTL A;  3C4P A;  4JXS A;  3OPL A;  1L0G A;  3HLF A;  3WWX A;  4KZ7 A;  5HW3 A;  5FA7 A;  3GTC A;  1BLS A;  3A3E A;  4HES A;  4N9K A;  4P0M A;  1W8Q A;  2ZQ7 A;  5GL9 A;  3PBO A;  4U3T A;  4KG2 A;  1CI9 A;  3B3X A;  1NY0 A;  3BRM A;  2B5R A;  1ALQ A;  4N9L A;  1FCO A;  1E25 A;  3OPR A;  4KG6 A;  1GA0 A;  3DWZ A;  3GRJ A;  3BEC A;  5JYP A;  2DRW A;  4UHU A;  5DTK A;  5GLA A;  2H5S A;  2EX6 A;  3CZD A;  3ZNY A;  1PWD A;  2HDR A;  2XD1 A;  1I2S A;  2I72 A;  3HLD A;  2GDN A;  4Q8I A;  2E8I A;  1HD8 A;  5HAQ A;  5I94 A;  2C6W B;  4KZ8 A;  1PW8 A;  2Q9N A;  3RJU A;  2XFT A;  2Y2Q A;  2UWX A;  5G18 A;  4WEJ A;  1WYB A;  4OPR A;  4GB7 A;  4B88 A;  2HDS A;  3IF6 A;  1ERO A;  5GLC A;  4B4X A;  5TR7 A;  1K6S A;  5CEC A;  5FQI A;  1ESU A;  1FCM A;  1AXB A;  4CJN A;  2XEP A;  4E3O A;  3EQV A;  2Y4A A;  3NDG A;  3ZGA B;  4BQM A;  4GOG A;  1IKI A;  1FOF A;  1CI8 A;  3MXS A;  1NZO A;  4EUZ A;  3N7W A;  4GNU A;  3LY3 A;  2R9W A;  2Y91 A;  3SS5 A;  3Q1F A;  4KQR A;  3WS0 A;  5CHM A;  3UPN A;  1MWS A;  3Q7Z A;  1I2W A;  2HDU A;  1YT4 A;  4ZBE A;  1FSY A;  4O7D A;  3MZD A;  5CTN A;  5FQQ A;  4WZ5 C;  2BG1 A;  3UE0 A;  4ZJ1 A;  5CER A;  3P98 A;  3G31 A;  3VP3 A;  2WAF A;  2ZC6 B;  1BSG A;  4DXC A;  1TDG A;  2OSU A;  4UA9 A;  5GHZ A;  3GR2 A;  5EVI A;  3UNW A;  2CC1 A;  2Z2M B;  3IT9 A;  1XGJ A;  2FFF B;  2HP5 A;  1CEF A;  1BUL A;  1KE3 A;  4KQQ A;  1S0W A;  3HLE A;  3UDX A;  1XA1 A;  3OCN A;  3HLG A;  1Q2P A;  1U60 A;  5KZH A;  1SKF A;  3AGE A;  2J9O A;  4MBF A;  4OOM A;  4BLM A;  3WRT A;  3A3D A;  3ZCZ A;  1H5X A;  1K54 C;  1MY8 A;  1TVF A;  1XP4 A;  5HAR A;  2J8Y A;  2WZX A;  2X71 A;  3BM6 A;  3E2L A;  1MXO A;  2HPB A;  3FKW A;  2ZQC A;  1ES5 A;  3A3F A;  3BEB A;  3GV9 A;  3UY6 A;  3UE1 A;  2IWD A;  4YIN A;  1LLB A;  1DJC A;  4S2J A;  4GD6 A;  3TSG A;  2XF3 A;  5L2F A;  5EUA A;  1XGI A;  2A3U A;  4Y0T A;  4PMA A;  4QB8 A;  3QHY A;  3O86 A;  1G6A A;  2ZLY A;  3FZC A;  2WGV A;  3SS3 A;  3C4O A;  3IXG A;  3VP1 A;  1JTG A;  4WBG A;  5CRF A;  3WS2 A;  1OME A;  5D3O A;  2WUQ A;  3BLM A;  4OLD A;  3W4Q A;  2RL3 A;  4OVD A;  2PBY A;  1ZG6 A;  1ZC2 A;  1N9B A;  2G2W A;  1L0E A;  4R4R A;  3V50 A;  5FQ9 A;  3NBL A;  4X56 A;  4PM9 A;  5GHY A;  3HBR A;  5F82 A;  1S6R A;  2DNS A;  1PI4 A;  3BLS A;  3PBT A;  4UAA A;  3ZG0 A;  1CEG A;  4S2N C;  4KZ4 A;  3MZF A;  4GDB A;  1PI5 A;  1NYY A;  3M2J A;  5AQA A;  1PWC A;  1WYC A;  1ONH A;  2ZM2 A;  2Y2J A;  4DE3 A;  3FV7 A;  3Q07 A;  4LV1 A;  2JE5 A;  1YLW A;  5IHV A;  4WZ4 A;  1EI5 A;  3PAE A;  4X53 A;  3VOZ A;  2JCH A;  3N4I A;  3A3I A;  5HX9 A;  1YLY A;  4RX3 A;  4EBL A;  2X02 A;  1G68 A;  1GHP A;  3GVB A;  3DWK A;  3O3V A;  4OP5 A;  1JVJ A;  4OON A;  4P85 A;  4QY6 A;  3SOI A;  4E6X A;  5BOH A;  5EE8 A;  2EX8 A;  4K0W A;  4XXR A;  2EFU A;  2A49 A;  1DJB A;  1K54 A;  1C3B A;  2HDQ A;  2WAE A;  3MZE A;  3PBR A;  1LL9 A;  4LV3 A;  4KZ5 A;  5EVI D;  3G2Z A;  3DW0 A;  3IHA A;  3RXW A;  4KZA A;  3IH8 A;  4JF6 A;  1PZP A;  5DF8 A;  2XR0 A;  3FWL A;  4PM8 A;  1W79 A;  3HL9 A;  4K0X A;  3C7U A;  2Y55 A;  4P6B A;  4PM5 A;  4IBX A;  2WYX A;  1K55 C;  2EFX A;  2ZC3 B;  5FAQ A;  3S22 A;  1YMX A;  5FQJ A;  3OCL A;  1E4D A;  3NIA A;  4JKT A;  4MBH A;  4KEN B;  1YQS A;  3P09 A;  1TEM A;  2ZC7 A;  4JXG A;  1K57 A;  1NXY A;  1K6R A;  2PU2 A;  4EBN A;  4OQI A;  4WEL A;  3G34 A;  4X55 A;  4OQG A;  1JTD A;  1IYS A;  3IF6 B;  3WS4 A;  4E3N A;  2VGK A;  4MNR A;  1RGZ A;  4JBF A;  4S2P A;  3ITB A;  2H0T A;  4DF6 A;  2P74 A;  1GCE A;  2XH9 A;  2XLN A;  3G30 A;  3V39 A;  1K4F A;  3Q7V B;  2J9P A;  4U0X A;  5CHJ A;  4RX2 A;  1MWU A;  5A92 A;  4KQO A;  1VM1 A;  4FH4 A;  3GSG A;  4R3J A;  2V1Z A;  3IF5 A;  4Y7P A;  4GKU A;  2G2U A;  3UN7 A;  5E43 A;  3IXB A;  2PU4 A;  3LEZ A;  5HAP A;  3Q7V A;  2HP9 A;  2JBF A;  3JYI A;  5U47 A;  2ZM8 A;  2QPN A;  3AGD A;  3ITA A;  4KG5 A;  2WK0 A;  2EX9 A;  2XD5 A;  1EWZ A;  5CEB A;  3C5A A;  4UA6 A;  4R23 A;  1IEM A;  1Y54 A;  1SDE A;  3O87 A;  3IWO A;  5EVI B;  1DY6 A;  4IVI A;  4QJG A;  4KZ6 A;  3TG9 A;  3N6I A;  3BFE A;  3QNB A;  4NET A;  1BLP A;  2EXA A;  4C3Q A;  4FD8 A;  1K56 D;  2Y59 A;  2ZD8 A;  4DE2 A;  3FYZ A;  1L2S A;  4ZTK A;  2OLU A;  4KZB A;  4OQ0 A;  3O88 A;  1XX2 A;  4QD4 A;  3ZNT A;  1L0F A;  4C6Y A;  4GDN A;  4JPM A;  2JC7 A;  2WGI A;  3WS5 A;  3AGF A;  4X68 A;  4ID4 A;  1XA7 A;  1YLZ A;  1O7E A;  2V20 A;  1W7F A;  1YLJ A;  3N8L A;  3HUO A;  5J8X A;  1PZO A;  2P9V B;  3OPH A;  3PBN A;  3HLC A;  4OLG A;  5E2E A;  4WYY A;  4E3L A;  2ZM0 A;  4FH2 A;  4MEZ A;  4DDY A;  4LEN A;  1IEL A;  1HZO A;  4PPR A;  1MBL A;  3HUN A;  1GA9 A;  3IXD A;  2XDM A;  1ZKJ A;  3RXX A;  2P9V A;  5GHX A;  5E2G A;  1PYY A;  4E3I A;  3SS4 A;  1NJ4 A;  1MKI A;  4DXB A;  3V3S A;  4IVK A;  4JXW A;  2Q9M A;  4KZ9 A;  2V2F F;  3UO9 A;  1FQG A;  3VFF A;  4XUZ A;  4JXV A;  5FAO A;  5AQ7 A;  5FAT A;  1PW1 A;  4Y0U A;  2QMI A;  1MWT A;  2X01 A;  3VSK A;  3A3J A;  4OPZ A;  4N1X A;  1IKG A;  3ZG5 A;  2Y2K A;  4ZDX A;  4OH0 A;  5FQK A;  4E3M A;  1WE4 A;  2Y2M A;  3HRE A;  1J9M A;  3ZFZ A;  3ZHH A;  1SHV A;  3SH9 A;  2ZC4 B;  3OPP A;  5EOE A;  4CPK A;  4ZAM A;  1ERQ A;  4PM7 A;  4K91 A;  1KVM A;  4HBT A;  4JF4 A;  3S1Y A;  5A90 A;  4FSF A;  4WZ5 A;  2Z2L B;  2ZC5 B;  5EEC A;  1SCW A;  3IWI A;  5KSH A;  5FI7 A;  1XXM A;  2DCF A;  4YFM A;  4E3J A;  1LI0 A;  4N92 A;  3HLW A;  5CGW A;  3BFF A;  3UDF A;  2Y2G A;  3IF6 C;  3MKE A;  3CMZ A;  3HVF A;  1K4E A;  1NZU A;  3PBS A;  5E2F A;  3MKF A;  2WAD A;  1BLH A;  3M6B A;  1LI9 A;  4U0T A;  3HLB A;  4L0L A;  2J7V A;  3VP4 A;  3W4P A;  1NYM A;  5FAP A;  4WEK A;  5AQ9 A;  3FKV A;  4JF5 A;  1BT5 A;  4H8R A;  5FDH A;  1QMF A;  5F1F A;  3Q81 A;  4DKI A;  2FFY A;  2ZQD A;  3IHB A;  4QHC A;  4GD8 A;  4S2L A;  1BLC A;  4E6W A;  5EPH A;  2Y2N A;  1E3U A;  1XKZ A;  2RCX A;  3BFG A;  3OZH A;  4OPY A;  5E2H A;  5EVI C;  2IWB A;  1KGG A;  5DVA A;  1W8Y A;  3ZG9 B;  1LL5 A;  5FSR A;  4E3K A;  3HUM A;  1CK3 A;  4MLL A;  5FI6 A;  1H8Z A;  2Y2P A;  2XFS A;  1KGF A;  3VMA A;  1YLP A;  2HP6 A;  2ZQ8 A;  2IWC A;  1IYQ A;  1H8Y A;  1MPL A;  4S2N A;  3D4F A;  3QNC A;  4IED A;  3VP0 A;  2XGN A;  3VP2 A; 
#chains in the Genus database with same CATH topology
 2RVQ D;  3BFC A;  5EVL A;  3CJM A;  5C3I B;  3MFD A;  2O99 A;  4MB5 A;  4HNB A;  3Q82 A;  3NC8 A;  3UT9 D;  1Z6F A;  3LR3 A;  3EQU A;  3AN2 B;  1KX4 C;  2KX6 A;  3AZN D;  3AZI B;  4NE3 A;  3UTA B;  5B31 A;  3AFA D;  3LIF A;  3QP1 A;  3WTP B;  4R0Q A;  4S2K A;  5CTM A;  2ZMF A;  4LD9 D;  3W99 B;  4KUD C;  2QKP A;  3MGS A;  3TU4 C;  4WMC A;  3AZK C;  1K38 A;  3LZ1 C;  3G2Y A;  5CHU A;  2ARO D;  3LEQ A;  3VSL A;  4XT2 A;  3A0V A;  2ZQ9 A;  1FCN A;  5B32 B;  3AZL B;  1K55 A;  1H8P A;  2OWH A;  3MXR A;  2ZJ9 A;  3O62 B;  3UPP A;  3B0D C;  4YM6 B;  5DNN A;  3PBQ A;  4Z2M G;  3LO7 A;  3LY4 A;  1P3G B;  1ES2 A;  4FOF A;  5CGX A;  4BEN A;  1P3F C;  4BWI A;  3UTB A;  4X23 A;  4WM9 A;  2YFV B;  4RVA A;  1ZG4 A;  1OJG A;  3ICY A;  2PR6 A;  2VGJ A;  5B2I D;  1S32 D;  2W1T B;  4H9Q A;  4P6Z M;  1GHI A;  4IBR A;  4I3I A;  1PZR A;  3B42 A;  1KE4 A;  2QJ7 A;  3IX4 A;  3QP2 A;  1KDW A;  1H0M A;  3IQA A;  4BD1 A;  4CAY A;  4NYU A;  4MN5 A;  2R9X A;  2XK1 A;  3IWQ A;  3LIE A;  1SKO B;  4FCF A;  4EQI A;  1GPF A;  4HMD A;  1VB6 A;  3A6N D;  1N9L A;  2F8N B;  3LGO A;  3D9Y A;  3UDI A;  3G32 A;  2W0N A;  1K57 C;  3REK B;  3HCY A;  3AZE C;  3VOY A;  3LCE A;  3R4K A;  4D2O A;  3B33 A;  3LIC A;  5CPI A;  1M1A B;  5EOO A;  3C7V A;  4DE1 A;  5CP6 C;  2Y2L A;  1D1J A;  4Y0O A;  3WAA A;  2Y2H A;  1P3B C;  1F9I A;  4Z5T B;  4HH2 A;  1OTB A;  5IU1 A;  4S2I A;  4II7 A;  3LZ0 C;  1GOI A;  2PD8 A;  4OP8 A;  1A7W A;  3ISG A;  1EQZ C;  4R3B A;  4DE0 A;  1M40 A;  1GSV A;  4B4Z A;  3EG5 B;  3NCK A;  4NZ1 A;  3AN2 D;  3K2N A;  4Z9Q A;  4P87 A;  1KGE A;  1YM1 A;  3AZI D;  3L9K A;  1RP5 A;  1PWG A;  3WTP D;  3TOI A;  4F94 A;  1T1B A;  4Z66 A;  5JYO A;  5B0Z B;  1BTL A;  3C4P A;  1JNU A;  4JXS A;  1PRQ A;  1W8Q A;  2PAV P;  3L27 A;  2XA7 M;  1N1J B;  1NY0 A;  3AZL D;  2D49 A;  4IJF A;  1ALQ A;  2A24 B;  3OPR A;  3EPK A;  3O62 D;  4YS3 A;  1P3K C;  4YM6 D;  1GA0 A;  1XJ2 A;  4EES A;  3GRJ A;  4MN6 A;  4UHU A;  5DTK A;  5GLA A;  4CQH A;  4EW7 A;  5B24 A;  1P3G D;  2ZL1 A;  2XD1 A;  5JRG C;  4NZ3 A;  2VLG A;  4Q8I A;  2E8I A;  4QLC C;  4AFI A;  3AZG A;  2UWX A;  4Q0J A;  2D01 A;  3TE8 A;  1WYB A;  4OPR A;  5B31 B;  4GB7 A;  4FUW A;  1KX3 B;  4B4X A;  5DFY A;  1K6S A;  5HW3 A;  4HMC A;  1FCM A;  5CPJ C;  4CJN A;  3S7P A;  4BQM A;  3MGS B;  2F8N D;  1S1Y A;  4CLC E;  5EFW A;  3N7W A;  3REK D;  4GNU A;  2RTS A;  1O6I A;  2HDU A;  1M1A D;  4ZBE A;  5CTN A;  1P3O C;  3IBJ A;  5DNN B;  4E44 A;  3W97 C;  5CER A;  2YFW B;  2WAF A;  5B0Y A;  1BSG A;  1D06 A;  1VET A;  5HZH A;  4UA9 A;  2ZOH A;  5EVI A;  2CC1 A;  3IT9 A;  1XGJ A;  1CEF A;  2ZM5 A;  3UB8 A;  5AV6 B;  4H9Q B;  4Z2J A;  1SKF A;  3MVD B;  1AOI B;  2J9O A;  4MBF A;  4OOM A;  2ZY4 A;  1WA9 A;  1P3L A;  5GSU B;  4IBD A;  1K54 C;  1MXO A;  3FKW A;  3C1C D;  4YIN A;  5B0Z D;  1L6J A;  3RFB A;  2XF3 A;  4ZUX C;  3B6F A;  3FG8 A;  3MSH A;  5DKL A;  2A3U A;  1E15 A;  3FZC A;  3X1V A;  3C4O A;  3IXG A;  5CPI B;  4LRZ E;  1P9R A;  3WS2 A;  5D3O A;  3WAA B;  4XZQ C;  2RL3 A;  2XRN A;  4IJE A;  1P34 B;  2V8F A;  4MCW A;  4R4R A;  1L0E A;  5FQ9 A;  4X56 A;  4PM9 A;  3T4S A;  3HBR A;  3UB9 A;  5F82 A;  4LRX C;  1W1Y A;  1PI4 A;  3AYW D;  4IHQ A;  1PI5 A;  2O9B A;  3M2J A;  1ONH A;  3DTI A;  3UE6 A;  3OOV A;  2W1R A;  4LV1 A;  1MKM A;  3X1U C;  1KX3 D;  1K0K A;  1EI5 A;  2JCH A;  4Z66 B;  1CJF A;  3MGS D;  3GVB A;  3LJA C;  2L4R A;  3F1N A;  4E6X A;  3WA9 B;  2EX8 A;  3KWQ C;  2BYK A;  4HJ4 A;  1LL9 A;  2G5I C;  5B33 C;  5DNN D;  1YU1 A;  3RXW A;  4KZA A;  1Y4O A;  4IUH A;  2HGV A;  1PZP A;  3FWL A;  2JHE A;  4YOF A;  3MNN B;  3CHW P;  2EFX A;  5AY8 C;  1YMX A;  5FQJ A;  1E4D A;  4MBH A;  1STZ A;  5AV6 D;  1TEM A;  3NUL A;  2W8S A;  4Q0I A;  3MVD D;  1AOI D;  2ZC7 A;  1TZY C;  5FUG A;  5GSU D;  4EBN A;  4EQ1 A;  4HQA A;  4X55 A;  4B9O A;  5B1L A;  4MNR A;  1RGZ A;  4HP4 A;  5HWV A;  5AV5 A;  4WNN A;  1K4F A;  4CLC A;  3Q7V B;  4XUJ B;  5CHJ A;  4WZS B;  3WKJ A;  3GSG A;  3F6T A;  4GKU A;  1M18 B;  1VEU B;  5DNM A;  4PKY G;  5GT0 B;  5E5A C;  3E4P A;  4L9E A;  1HQ3 A;  4HH3 A;  3AGD A;  2XD5 A;  2EWW A;  5CEB A;  5B0Y B;  4R23 A;  2DF4 C;  1P34 D;  1IEM A;  1SDE A;  1Y54 A;  5EVI B;  4YNR A;  4QJG A;  3WD2 A;  4JGO A;  4O01 A;  4FD8 A;  5AV9 C;  4NE6 A;  2ZD8 A;  4JJN D;  2NQB A;  3MGQ D;  4J8W C;  1F5M A;  3LR5 A;  4ZTK A;  3O88 A;  3X1T D;  4QD4 A;  3ZNT A;  4GDN A;  3WS5 A;  3AZH C;  2V20 A;  5HWW A;  3REH D;  3WTP E;  3PBN A;  3GEC A;  3HLC A;  1YU2 A;  4E3L A;  4WYY A;  1HZO A;  3WA9 D;  4PPR A;  1GA9 A;  3RXX A;  2HIO A;  1U35 A;  4I38 A;  3B6G A;  4E3I A;  3SS4 A;  5F99 C;  1MKI A;  4DQY B;  5HD5 A;  2CWE A;  5AVF A;  2W3D A;  4LRY C;  3W96 C;  1QO6 A;  3MNN D;  3KFU G;  3A3J A;  4WLA A;  3HRE A;  2Y2M A;  1CK7 A;  4OJL A;  3WX7 A;  3ZHH A;  3UT9 A;  3SH9 A;  3A1K A;  4CSR B;  3N3F A;  1OTD A;  2HF6 A;  1KVM A;  5L07 A;  3AFA A;  4EU0 A;  4WZ5 A;  5EEC A;  1SCW A;  3IWI A;  4LD9 A;  4WF0 A;  1OT9 A;  5FI7 A;  2DCF A;  4XUJ D;  4E3J A;  1LI0 A;  1M18 D;  4H9S C;  4H9P A;  2XSS A;  3HLW A;  5CGW A;  4WU9 C;  3UDF A;  3IF6 C;  4J8X A;  2Q0O A;  3CMZ A;  5GT0 D;  2BYK B;  2WAD A;  4ETX A;  1ZLA B;  1LI9 A;  3AV1 C;  1YKD A;  2WKQ A;  2B02 A;  3IS2 A;  1P3M C;  4F3L A;  1TAF A;  5GXQ C;  3KSI A;  5AQ9 A;  3KSG A;  5J3W A;  1BT5 A;  2ZOI A;  4AWL C;  3R45 B;  4DKI A;  2FFY A;  3IHB A;  4QHC A;  1S32 A;  2BYM A;  3JPU A;  5FUG B;  4E6W A;  4ME4 A;  3X1S B;  3LEL B;  4I39 A;  2Y2N A;  1ED7 A;  3BFG A;  3OZH A;  5B1M D;  4HJ6 A;  3L26 A;  2WKP A;  5BT1 C;  2H28 A;  5AV5 B;  4E3K A;  3HUM A;  1H8Z A;  1TS6 A;  1H0I A;  3WKJ B;  3HJI A;  1P3P A;  4ZBJ B;  5MC7 A;  1UWP X;  3T1X A;  1E88 A;  1H8M A;  3QNC A;  3C1B B;  5BS7 C;  4WUJ A;  3CWF A;  2QJ5 A;  1P3A C;  3MXQ A;  5TGF A;  4Y15 A;  4HHD A;  2WKE A;  1F98 A;  5HSQ A;  4GHA A;  1RCJ A;  4XUX A;  4N1H A;  1XPB A;  1M19 D;  4H9O B;  2XQZ A;  3AN2 A;  5AV8 D;  1JWV A;  1HVB A;  1DP8 A;  4BL3 A;  1Q2Q A;  4UUZ A;  3WTP A;  4LCL A;  5BO0 B;  4ESP A;  2VV7 A;  1ES3 A;  1BUE A;  1VQQ A;  2NZD B;  3G35 A;  2HIO B;  1U35 B;  1YLT A;  2W3H A;  2HJ9 C;  4G91 C;  2LY8 A;  4LLO B;  3AZL A;  1ZLA D;  1TDL A;  4UEY A;  2K31 A;  1RGY A;  4WU8 B;  5DF9 A;  3CPT B;  3O62 A;  4Y17 A;  1KE0 A;  4YWZ A;  3AZM C;  1P0Z A;  3KUY A;  1P3G A;  4IBK A;  3WD4 A;  1GSX A;  4GCZ A;  2YFV A;  4LV2 A;  1E3U D;  1PFL A;  3V5M A;  5HAI A;  2W1T A;  1PIO A;  3X1S D;  3LEL D;  4KZ3 A;  3OBF A;  1N4O A;  2WKH A;  4QY5 A;  5I5L A;  1SKO A;  5AV5 D;  1P3I B;  3ZVW A;  2WGW B;  2J3T D;  2PRF A;  5AVB B;  2F8N A;  3WKJ D;  1H3O B;  3H0M C;  5TJJ A;  3REI B;  4H9P B;  3SZT A;  2OLV A;  5CXW A;  5DTT A;  4J8X B;  3A6N C;  3PTE A;  3AZF C;  1MZU A;  3REK A;  4HEF A;  3C1B D;  4S2O A;  2DQN C;  3REJ B;  4R3A A;  4ZJ2 A;  2PYO D;  3U4L P;  1OTE A;  5DTS A;  4LCM A;  1KVL A;  1TAF B;  4X6T A;  2FJ7 D;  5FQM A;  5FI2 A;  5F1G A;  2CV5 B;  1SDN A;  3ULF A;  4DJ2 A;  1K56 A;  3BFD A;  1ID3 C;  1FR1 A;  4H6J B;  2BYM B;  1GSW A;  2VQR A;  4BJP A;  4KGC B;  1LT0 A;  2ZMV A;  4X69 A;  5G4Z A;  2BAS A;  3H9W A;  1BH8 A;  3AV2 C;  1FSW A;  4GZB A;  5K5B A;  3C1C A;  3OPL A;  5FA7 A;  2I9V A;  4QWO A;  3GTC A;  1BLS A;  3A3E A;  3UTA C;  1P3P B;  5B0Z A;  4GLQ A;  1OGB A;  1TF1 A;  2NZD D;  1U35 D;  3W99 C;  1FCO A;  4NEE D;  4R8P B;  4J8U C;  2V1B A;  1N1J A;  5GT3 B;  3DWZ A;  2VGL S;  5JYP A;  2DRW A;  2A24 A;  4WU8 D;  3CZD A;  5F69 A;  2HDR A;  3LR0 A;  4J8V B;  3O5Y A;  5B32 C;  5CPK A;  1YU0 A;  1HD8 A;  3T4T A;  2B18 A;  5HAQ A;  4YM6 C;  5AVC C;  1PW8 A;  3AZJ B;  4Y2F A;  3AYW A;  4B88 A;  5C5K A;  3T1S A;  5KMW A;  2GNX A;  1AXB A;  2XEP A;  4E3O A;  4UUZ B;  1HTA A;  1KX3 A;  3MR0 A;  1CI8 A;  3MXS A;  1NZO A;  3T4K A;  1P3I D;  5AVB D;  3LY3 A;  4R6L A;  3Q1F A;  3REI D;  3Q7Z A;  4JGP A;  3SW1 A;  4J8X D;  1I2W A;  1FSY A;  2J80 A;  4O7D A;  3B0C T;  2BG1 A;  3REJ D;  3G31 A;  3P5J B;  1TDG A;  5GHZ A;  3C2W A;  4M4X A;  3KUY B;  2YFW A;  1KE3 A;  1S0W A;  3EPJ A;  1KX5 B;  2CV5 D;  1M1A C;  3UDX A;  3HLG A;  4Z2H A;  3A3D A;  1H5X A;  4Z5T C;  4HY8 A;  1TVF A;  1XP4 A;  5HD3 A;  5AV6 A;  2X71 A;  3E2L A;  4KGC D;  3MVD A;  1AOI A;  2ZQC A;  5GSU A;  2OWJ A;  3GDI A;  1F66 C;  4HGA B;  3V67 A;  1DJC A;  2W3E A;  3W98 A;  2GZA A;  3H0L C;  4QLC A;  5EUA A;  3KO6 A;  4Y0T A;  4PMA A;  1P3P D;  1YU4 A;  5F6A A;  4EXO A;  3SS3 A;  3MQ0 A;  2LB9 A;  5CRF A;  4EO5 B;  4Z2G A;  1OME A;  4R8P D;  3EGD C;  3W4Q A;  5GT3 D;  4OVD A;  5B2J D;  4KUD B;  4K08 A;  4KUK A;  2L5A A;  2Y79 A;  1ZC2 A;  2G2W A;  2L1M A;  4J8V D;  5GHY A;  3LZ1 B;  5L10 A;  3WD3 A;  1S6R A;  1P34 A;  2O0Y A;  1CEG A;  3MGP A;  1NYY A;  3AZJ D;  5AQA A;  1PWC A;  2L0W A;  2ZM2 A;  3B0D B;  4JJN A;  3MGQ A;  3Q07 A;  3V9R A;  1BH8 B;  2NUP C;  3X1T A;  4WZ4 A;  5IHV A;  4X53 A;  3VOZ A;  3JVU A;  1FIL A;  3LUQ A;  3A3I A;  3N4I A;  5HX9 A;  4EBL A;  3C1C B;  2X02 A;  1G68 A;  4OP5 A;  5A8B A;  4OON A;  4P85 A;  3SOI A;  1W2E A;  5BOH A;  3CUE A;  3REH A;  5B31 C;  2A49 A;  1K54 A;  5FEF A;  3KXB D;  1C3B A;  2HDQ A;  2V0U A;  3WA9 A;  3JVV A;  2QHK A;  3IHA A;  3PHY A;  5B40 D;  3MMH A;  4PM8 A;  3BQ8 A;  4PM5 A;  1K55 C;  5CPK B;  2ZC3 B;  2HJE A;  3KUY D;  3MS6 A;  1KX5 D;  4IJG A;  3S22 A;  3AZE B;  3NIA A;  3OCL A;  4JKT A;  4E04 A;  3P09 A;  3MNN A;  5DNN C;  1NXY A;  3AYW B;  3FPV A;  5CP6 B;  4UQI M;  4R38 A;  3UTB C;  4XZQ A;  4X23 C;  3K3C A;  2VGK A;  1N9O A;  2A2L A;  3LZ0 B;  3ITB A;  4DF6 A;  4WN5 A;  4MMN A;  3B0C W;  2J9P A;  4U0X A;  4RX2 A;  5A92 A;  2ZBB A;  4R3J A;  5FDS A;  3A0S A;  1W1T A;  2V1Z A;  3IF5 A;  2G2U A;  4IUK A;  1KX4 D;  2W3F A;  5E43 A;  3RH8 B;  5HAP A;  3Q7V A;  4XUJ A;  3E98 A;  1M18 A;  2ZM8 A;  1VEU A;  2RIQ A;  2V9A A;  2WK0 A;  2EX9 A;  5GT0 A;  1EWZ A;  4KUD D;  3FKE A;  4IVI A;  3TU4 D;  1IOU A;  3AZK D;  3LZ1 D;  4GJ4 A;  3TG9 A;  3N6I A;  4NET A;  1BLP A;  5CPI C;  2EXA A;  1KU5 A;  1K56 D;  3M7P A;  3WAA C;  4GW9 A;  4NXG A;  3FYZ A;  1CF0 A;  1L2S A;  4KZB A;  4OQ0 A;  1P3K B;  1XX2 A;  4JPM A;  2O9A A;  1YLZ A;  3BQA A;  3VOL A;  1E8B A;  1P3F D;  5JRG B;  5G49 A;  1S4R A;  3R7W A;  5B1M A;  2P9V B;  4OLG A;  3W98 B;  4QLC B;  4MEZ A;  4DMZ A;  3IXD A;  4IBC A;  3REL A;  3EPL A;  2Z6D A;  4MB3 A;  3T4L A;  3A1I A;  1BFM A;  4Z66 C;  5EM1 A;  1H0G A;  2Q9M A;  4MN7 A;  4KZ9 A;  2V2F F;  5CPJ B;  3UO9 A;  3VFF A;  4XUZ A;  1G28 A;  5J4E A;  2IO5 C;  3H82 A;  5AQ7 A;  3MF0 A;  3VV4 A;  1PW1 A;  1MWT A;  1S4S A;  5CPK D;  5FQK A;  4E3M A;  3AZE D;  4YS3 C;  1NWZ A;  3MGP B;  2ZC4 B;  3W2Z A;  3OPP A;  2F2A C;  3EGX C;  5CP6 D;  5B24 C;  1P3O B;  3KYQ A;  4JJN B;  3W97 B;  3PR6 A;  1ERQ A;  4ZAM A;  3MGQ B;  3T4O A;  1P3B D;  4KQD A;  1M19 A;  3V9R B;  4CSR A;  4JF4 A;  3S1Y A;  5AV8 A;  3X1T B;  3LZ0 D;  4I5S A;  3IX8 A;  1EQZ D;  4NXF A;  1Z2C B;  1TS7 A;  2DMW A;  3AZG C;  4YFM A;  4PHT A;  3REH B;  4E45 A;  2XRO A;  3OLO A;  3MKF A;  2JKT M;  1BLH A;  4H9N B;  3HLB A;  2J7V A;  1ZLA A;  3E4O A;  4Z2K A;  4ZUX B;  1VHM A;  4G92 B;  2MJ6 A;  5F1F A;  3VH5 A;  4Z2L A;  1G6O A;  2W3G A;  4GD8 A;  4S2L A;  5B0Y C;  1P3K D;  3L29 A;  3R45 A;  4XZQ B;  1E3U A;  5EVI C;  2IWB A;  5E2H A;  1E6R A;  3QP8 A;  3ZG9 B;  1YUE A;  3X1S A;  3LEL A;  3W96 A;  1GXD A;  5JRG D;  1LSX A;  2VV8 A;  3C30 A;  5FI6 A;  1YSP A;  3W98 D;  2OOL A;  4QLC D;  1P3L C;  1KGF A;  4Z2I A;  2HP6 A;  1IYQ A;  1H8Y A;  4Y13 A;  1MPL A;  1W1V A;  4S2N A;  2B95 A;  2XGN A;  3X1U B;  3IH9 A;  5HFO A;  2WKI A;  5CPJ D;  3B6F C;  3WRZ A;  3OC2 A;  3C1B A;  3VFH A;  2J3W A;  2QZ6 A;  3VH6 A;  5FAS A;  2P08 A;  2PYO A;  3LJA B;  4HBU A;  1XJ6 A;  5L8M A;  3X1V C;  3UB6 A;  1S1Z A;  2ZQA A;  5J7E A;  4P6Z S;  2HUE B;  3KWQ B;  4HI4 A;  2FJ7 A;  3MGP D;  3G4P A;  3NEC A;  3W8K A;  4IBB A;  5B33 B;  1P3O D;  2BLS A;  3W97 D;  4MBK A;  4H9O A;  3MGR C;  4OJ5 A;  2VEA A;  4A5R A;  2VK3 A;  3VH6 W;  1B67 A;  5G49 B;  1KS0 A;  3R7W B;  5B1M B;  5AY8 B;  2H0Y A;  2G7U A;  4GN2 A;  2D02 A;  4OOL A;  5BO0 A;  1FR6 A;  4ARZ A;  3REL B;  1TZY B;  2EXB A;  2C5W B;  1OTI A;  3W4O A;  4C75 A;  1DP9 A;  3PAG A;  5HL1 A;  4DRT A;  2NZD A;  5AQB A;  3VMA A;  4R1G A;  5GLB A;  5DFX A;  1L0D A;  4DDS A;  5CED A;  3H82 B;  4NYY A;  4WU8 A;  4ZUX D;  3CPT A;  3M6H A;  5JA4 B;  3P7N A;  3NI9 A;  4GHI B;  3I7J A;  1ERM A;  1JWP A;  4X1M A;  2J8P A;  5E5A B;  4IBF A;  3WD0 A;  4XZQ D;  4QPR A;  1M19 B;  3KX0 X;  5AV8 B;  3DTM A;  1BYW A;  3BW6 A;  4O0P A;  3E4Q A;  3IXH A;  4OPQ A;  4PM6 A;  3T4J A;  1LL8 A;  2XA7 S;  3GQZ A;  5AV9 B;  4NK3 A;  5GLD A;  4J8W B;  4RA7 A;  1P3I A;  4UA7 A;  2WGW A;  3HSH A;  5B1L C;  1W5D A;  5AVB A;  3CG5 A;  1H3O A;  3SH8 A;  3REI A;  3AZH B;  2KLI A;  3X1U D;  3BWL A;  4CLC C;  3REJ A;  4ETZ A;  4ZBJ C;  4BL2 A;  4EWF A;  1E6Z A;  5DF7 A;  5DNM C;  3LJA D;  3DTK A;  1GHM A;  2OV5 A;  1I5Q A;  3NY4 A;  3KWQ D;  4JLF A;  1HQ3 C;  1BZA A;  1B6W A;  5A93 A;  3UE3 A;  1LHY A;  2CV5 A;  5F99 B;  1AIW A;  1YPR A;  5B33 D;  4H6J A;  2WZZ A;  3GMW A;  1V9Y A;  1IYP A;  4KGC A;  3W96 B;  3NQU B;  3WWX A;  3KS4 A;  1L0G A;  4KZ7 A;  2NQB C;  4IBE A;  5AY8 D;  4WJ3 C;  4P0M A;  5GL9 A;  3U2A A;  2ZQ7 A;  3NJA A;  2Y8H A;  4U3T A;  4KG2 A;  3BRM A;  1G5U A;  3REL D;  1TZY D;  1R4V A;  4N9L A;  4NE5 A;  3DAV A;  4KG6 A;  3BEC A;  2H5S A;  4R8P A;  1PWD A;  2KOI A;  5GT3 A;  2GDN A;  5B2J A;  3NOT C;  3HJK A;  2PYO B;  4EEU A;  2HIO C;  3B6G C;  3LYX A;  4J8V A;  3QP4 A;  5I94 A;  2FJ7 B;  4WU9 B;  2Q9N A;  3RJU A;  5G18 A;  1UWN X;  5E5A D;  4WEJ A;  3QP6 A;  2RVQ C;  3AZJ A;  3AV1 B;  1JFI A;  5TR7 A;  5CEC A;  5FQI A;  1ESU A;  3EQV A;  4PKY A;  1A0K A;  2Y4A A;  3NDG A;  3NOU C;  1P3M B;  5GXQ B;  4GOG A;  4L9F A;  1FOF A;  4NG2 A;  3UT9 C;  4EUZ A;  2YKH A;  4AWL B;  5AV9 D;  3FC7 A;  2R9W A;  2Z6C A;  3AZN C;  3WS0 A;  4J8W D;  4L9G A;  4ARZ B;  3TW8 A;  1YT4 A;  4KUO A;  3AFA C;  5FQQ A;  4WZ5 C;  5HWT A;  3KXB A;  3AZH D;  3AV2 A;  4LD9 C;  3TJZ C;  3P98 A;  3VP3 A;  2ZC6 B;  4OJ6 A;  3E0Y A;  3AL0 C;  2OSU A;  3UNW A;  2V8C A;  2Z2M B;  3G6O A;  5B40 A;  2ARO C;  4KQQ A;  4KHA A;  3HLE A;  3OCN A;  1W1P A;  1BH9 A;  5KZH A;  4I3J A;  3WRT A;  3ZCZ A;  1KX5 A;  3BJN A;  5F99 D;  3BM6 A;  1PDC A;  3EEA A;  1J7M A;  3A3F A;  2W27 A;  3UY6 A;  3EWK A;  3UE1 A;  3IBR A;  3W96 D;  1LLB A;  2JSS A;  1P3A B;  3F1P B;  5EVE A;  3TSG A;  5L2F A;  5B2I C;  1S32 C;  1PNE A;  1XGI A;  4WL9 A;  4QB8 A;  3O86 A;  1CQA A;  3KS8 A;  1G6A A;  3CLO A;  2OAP 1;  2WGV A;  3T1Q B;  3VP1 A;  2GJ3 A;  1JTG A;  4WBG A;  1KX4 A;  3A0R A;  3BLM A;  4OLD A;  3H7W A;  2JKR I;  4D60 A;  1T1C A;  1ZG6 A;  3V50 A;  1N9B A;  4NKP A;  5F68 A;  1NLZ A;  3NBL A;  4KUD A;  2V5O A;  2YKF A;  1J3W A;  4UAA A;  3KYZ A;  3PBT A;  1T3U A;  3TU4 A;  3AZK A;  4HOI A;  3LZ1 A;  4WU9 D;  1WYC A;  2Y2J A;  1S67 L;  3FV7 A;  4G91 B;  2JE5 A;  1DP6 A;  3AV1 D;  2P7J A;  1YLW A;  5C3I C;  1P3M D;  1Z09 A;  5GXQ D;  1YLY A;  4RX3 A;  3O3V A;  1GHP A;  4QY6 A;  4NY2 A;  3DWK A;  3HON A;  1P3F A;  3UME A;  1S66 L;  5EE8 A;  4K0W A;  4XXR A;  3AN2 C;  5CX7 A;  1DJB A;  3AZI C;  2WAE A;  2NUT C;  3MZE A;  1LSW A;  3PBR A;  3VE3 A;  4LV3 A;  5BNV B;  4JGR A;  1V9Z A;  1Q9C A;  3WTP C;  5FEG A;  2CMN A;  3IH8 A;  4JF6 A;  1F66 A;  2HV1 A;  4P6B A;  5BT1 D;  5B2J B;  2FZ0 A;  3LID A;  2UV0 E;  1YQS A;  3AZL C;  1K57 A;  2F8N H;  2PU2 A;  3AZE A;  3O62 C;  4OQI A;  2E8J A;  3WS4 A;  1JTD A;  1JFI B;  4E3N A;  5CP6 A;  1P3G C;  2H0T A;  3CAX A;  1GCE A;  1P3B A;  2XH9 A;  1TS8 A;  1P3A D;  3EEH A;  3LZ0 A;  1VM1 A;  4FH4 A;  2VV6 A;  1EQZ A;  2PD7 A;  3UN7 A;  1ID3 B;  4LPZ A;  1FIK A;  5U47 A;  3S7O A;  3CI6 A;  4HGA C;  2QPN A;  3ITA A;  4Q0H A;  3KXB B;  3AV2 B;  5EM0 A;  3C5A A;  3MJQ A;  5L09 A;  1Y28 A;  3IWO A;  4G3V A;  1DY6 A;  3T4Q A;  5B40 B;  4KZ6 A;  4KHA B;  1BH9 B;  4EO5 C;  3REK C;  4G3K A;  3NQJ B;  1ZHH B;  5HL6 A;  4J8U B;  1L0F A;  4X68 A;  1XA7 A;  1O7E A;  1SZV A;  3T50 A;  1F2K A;  1P3K A;  1W7F A;  1YLJ A;  3AZM D;  2M7U A;  1OTA A;  5J8X A;  2ZM0 A;  3QP5 A;  4LEN A;  1IEL A;  5JRG A;  3S7N A;  5AVC B;  3BY9 A;  1ZKJ A;  2P9V A;  5GHX A;  5BPV A;  5E2G A;  1NJ4 A;  2PR5 A;  1KX4 B;  3H7W B;  4JXW A;  3C1C C;  3EPH A;  1FQG A;  4JXV A;  5FAO A;  2K2N A;  5B0Z C;  5CPJ A;  4Y0U A;  1ACF A;  2QMI A;  2X01 A;  3VSK A;  4N1X A;  1IKG A;  3ZG5 A;  3L2A A;  4ZDX A;  3TU4 B;  3AZK B;  3KYE A;  5CHL B;  3AZF D;  1IFQ A;  2JKT I;  4K91 A;  4HBT A;  1AWI A;  2INW A;  5CPK C;  3MQL A;  4FSF A;  1P3O A;  1W63 M;  2WKR A;  2Z2L B;  3W97 A;  2ZC5 B;  2JKR M;  3MQO A;  5KSH A;  1XXM A;  1P3F B;  3AYW C;  4N92 A;  1ODV A;  1ID3 D;  1OGG A;  2Y2G A;  3MKE A;  3LR4 A;  1K4E A;  5DJT A;  3PBS A;  4Z1W A;  5HPI A;  3M6B A;  1KX3 C;  3AV2 D;  4U0T A;  4L0L A;  1F66 B;  1EW0 A;  2R78 A;  3MGS C;  5FAP A;  4H9N A;  1UR8 A;  3UTA D;  5FDH A;  4ZUX A;  4HIA A;  3W99 D;  4LG2 A;  4J8U D;  5EPH A;  1XKZ A;  2RCX A;  1KGG A;  5DVA A;  1LL5 A;  1P3B B;  5FSR A;  5B32 D;  3LI8 A;  1EQZ B;  1YLP A;  5AV6 C;  2IWC A;  2ZQ8 A;  5AVC D;  3MVD C;  1AOI C;  5GSU C;  4IED A;  1E6P A;  4LFU A;  3TRC A;  3W98 C;  3C38 A;  4OQH A;  4Y5F A;  2JN7 A;  3X1U A;  3V3R A;  3L28 A;  3VH5 T;  4OUI A;  3N8S A;  3H0R C;  5A91 A;  2PYR A;  3LJA A;  1MWR A;  3ZG8 B;  3KWQ A;  4OOY A;  1XJ4 A;  3ZG7 B;  4ZRR A;  4XT2 B;  3WS1 A;  3RTY A;  1P34 C;  1O07 A;  5B33 A;  4OKP A;  5EV0 A;  5M1A A;  4UPK A;  3MGP C;  3UPO A;  4M3K A;  2Y2I A;  3L25 A;  2K7S A;  2IOU A;  2JKF A;  4JJN C;  3MGQ C;  1HTZ A;  5AY8 A;  5TBM A;  4S2M A;  4RYE A;  4Z5T D;  4QU3 A;  5KIZ A;  3X1T C;  4EV4 A;  3UTB B;  4X23 B;  2VJW A;  1TZY A;  3C8C A;  1OPX A;  2H10 A;  3VH6 T;  1ONG A;  1F66 D;  2EX2 A;  3CUE C;  5IS1 A;  4BD0 A;  3SH7 A;  3REH C;  1TD5 A;  4LV0 A;  5CGS A;  1ULY A;  4CAY B;  3WA9 C;  3MBZ A;  2ZY5 A;  3D72 A;  1KDS A;  5JA4 A;  3UB7 A;  4GHI A;  4EBP A;  1YSQ A;  5F83 A;  5E5A A;  2Y2O A;  4Y3I A;  5M18 A;  3ZVT A;  3LFV A;  4G92 C;  3E2K A;  4B93 A;  3S4X A;  2BTF P;  3MNN C;  1M6K A;  2ZMA A;  1CXW A;  3PYP A;  3ZDJ A;  5HPF A;  3KSY A;  4ZJ3 A;  4DJ3 A;  3B47 A;  4LGW A;  5AV9 A;  3NDE A;  4J8W A;  1NRF A;  3MGR A;  1QME A;  1IYO A;  3K3D A;  4H9R A;  3AZH A;  3BYD A;  4XUJ C;  4R4S A;  5DJU A;  1ES4 A;  3N8R A;  3F1O A;  1M18 C;  1EAK A;  1UR9 A;  5B31 D;  1UGU A;  5TFQ A;  4Z2M H;  5GT0 C;  1JWZ A;  3M2K A;  3PXP A;  4IBG A;  1ESI A;  4WMC D;  1DJA A;  4R70 A;  5F99 A;  1D7E A;  1K25 A;  2IO5 B;  4PAU A;  1YMS A;  5M19 A;  2HUE C;  1LSV A;  3HLF A;  4HES A;  4N9K A;  3NQU A;  3PBO A;  4YS3 B;  5BNX A;  1CI9 A;  3B3X A;  2B5R A;  3ZYT A;  1E25 A;  5B24 B;  2ZL1 B;  3VH5 W;  3UTB D;  4X23 D;  1P97 A;  5B1M C;  5DKK A;  3ZNY A;  2EX6 A;  4X1L A;  1I2S A;  2I72 A;  2V1A A;  5F5Y A;  5FL3 A;  3HLD A;  2EA9 A;  1DRM A;  3AZG B;  5AJG A;  3REL C;  2C6W B;  2V0W A;  3BY8 A;  4RQ9 A;  4KZ8 A;  3IX3 A;  3VE4 A;  2XFT A;  2Y2Q A;  4OJO A;  4H9S A;  4WU9 A;  2HDS A;  3IF6 A;  1ERO A;  5GLC A;  3ZGA B;  3AV1 A;  1N9N A;  1IKI A;  4HJ3 A;  4EUV A;  5CPI D;  1P3M A;  3WD1 A;  4DRA A;  5GXQ A;  4I3A A;  3WAA D;  2Y91 A;  3SS5 A;  4KQR A;  1HLU P;  5CHM A;  5TBM B;  1M19 C;  1MWS A;  3UPN A;  1VET B;  4MDZ A;  5AV8 C;  2VZW A;  3MZD A;  3UE0 A;  4ZJ1 A;  2QWS A;  2VGL M;  3LI9 A;  2PYP A;  4DXC A;  2PT7 A;  3GR2 A;  2FFF B;  2HP5 A;  2M1C A;  1BUL A;  2VX8 A;  1P3L B;  1XA1 A;  5B32 G;  1Q2P A;  1U60 A;  3AGE A;  4BLM A;  3D3O A;  1MY8 A;  3MQQ A;  5KDM A;  2J8Y A;  5HAR A;  2WZX A;  4Z66 D;  2HPB A;  1ZLA C;  3NHQ A;  1ES5 A;  3B6F B;  3BEB A;  3GV9 A;  3S7Q A;  5BS7 A;  2IWD A;  4S2J A;  2HZ5 A;  4GD6 A;  4WV4 B;  2JKG A;  3X1V B;  4DN0 A;  1ZTU A;  1YU3 A;  3QHY A;  4YS3 D;  1P3A A;  3F1P A;  2ZLY A;  2LB5 A;  1T18 A;  2FH5 A;  2WUQ A;  5B24 D;  3X1S C;  3LEL C;  4NXB A;  4X25 A;  2O9C A;  3MGR B;  2F8N G;  2PBY A;  1X0O A;  3DBA A;  4H9R B;  5AV5 C;  2KDK A;  3AZG D;  2J3T C;  2DNS A;  3BLS A;  3ZG0 A;  4S2N C;  3WKJ C;  4KZ4 A;  3F1O B;  3DTE A;  3MZF A;  4GDB A;  3AZN A;  3KSH A;  4UQI S;  4DE3 A;  1KOU A;  3C1B C;  3T12 B;  2PYO C;  3F1N B;  3PAE A;  4NXE A;  1XJ3 A;  4EEP A;  3T1R A;  2ARO A;  2FJ7 C;  4MB4 A;  3LIB A;  1JVJ A;  4M6B A;  3AZM A;  5BNX B;  2EFU A;  3P01 A;  4NFT A;  5B0Y D;  2ZY3 A;  4KZ5 A;  5EVI D;  3G2Z A;  3DW0 A;  4BMW A;  1F1E A;  5DF8 A;  5BNV A;  2XR0 A;  4BBT A;  1W79 A;  3HL9 A;  4K0X A;  3C7U A;  2Y55 A;  3LIA A;  4IBX A;  1E6N A;  2WYX A;  3ZQ5 A;  5B2I A;  1T1A A;  5FAQ A;  1P3L D;  4KEN B;  2NZD C;  5B1L B;  1U35 C;  4JXG A;  1K6R A;  4EER A;  1OT6 A;  4WEL A;  3G34 A;  4BBV A;  4JGQ A;  2EWV A;  4OQG A;  3IF6 B;  1IYS A;  4WNN B;  4HME A;  4CLC B;  3A6N A;  3AZF A;  4JBF A;  4WU8 C;  4OJP A;  3B6F D;  4S2P A;  4NZ5 A;  2P74 A;  2XLN A;  3B0B A;  3G30 A;  3V39 A;  3L7H A;  5DNM B;  1MWU A;  3X1V D;  4KQO A;  3IP4 C;  5G4Y A;  4Y7P A;  1HQ3 B;  3KSF A;  3IXB A;  2PU4 A;  3LEZ A;  4DRB A;  2HP9 A;  5B31 G;  2JBF A;  3JYI A;  1ID3 A;  4GS9 A;  4KG5 A;  2PHY A;  3MGR D;  4UA6 A;  2G5H C;  3O87 A;  4IBI A;  2AVX A;  2NQB B;  3BFE A;  3QNB A;  1P3I C;  2ZY2 A;  4TX8 A;  4C3Q A;  2Y59 A;  5AVB C;  1XFN A;  1WWI A;  2GX5 A;  4DE2 A;  3REI C;  3AZI A;  4EET B;  3UTA A;  4J8X C;  1OJ5 A;  2OLU A;  3FPW A;  1P9W A;  5KDM B;  2PBD P;  5HDS A;  4C6Y A;  3NQJ A;  2JC7 A;  2WGI A;  3AGF A;  3REJ C;  4ID4 A;  3W99 A;  4J8U A;  3N8L A;  3HUO A;  1NLY A;  1PZO A;  3OPH A;  5HDC A;  5E2E A;  5KSC A;  3B6G B;  2CV5 C;  4FH2 A;  4DDY A;  1MC0 A;  1MBL A;  1YAX A;  3HUN A;  5B32 A;  2XDM A;  1PYY A;  4GHL A;  3MFX A;  2P04 A;  4DXB A;  4YM6 A;  4IVK A;  5AVC A;  3V3S A;  4KGC C;  1TS0 A;  4NZ4 A;  1NRJ A;  2QYB A;  5FAT A;  2VA0 A;  3UT9 B;  3EOI A;  4FTX A;  3FDD A;  4OPZ A;  2F8N K;  4BBU A;  2OAQ 1;  5HDD A;  2Y2K A;  4OH0 A;  1P3P C;  1WE4 A;  5AVE A;  1J9M A;  3ZFZ A;  3AZN B;  2FN2 A;  1SHV A;  5B1L D;  5EOE A;  4CPK A;  3AFA B;  4R8P C;  5GT3 C;  4LD9 B;  4PM7 A;  5B2J C;  2IA2 A;  4CLC D;  5A90 A;  4J8V C;  2ARO B;  5DNM D;  4HP9 A;  3AZM B;  1HQ3 D;  3BFF A;  3AZJ C;  4QNL A;  3UMD A;  3HVF A;  1M1A A;  1NZU A;  5E2F A;  3IS2 B;  3UB5 P;  3CIT A;  4F3L B;  2ACG A;  4Z5T A;  2VKS A;  1T19 A;  4IBJ A;  3VP4 A;  3W4P A;  1NYM A;  4WEK A;  3FKV A;  2NQB D;  4JF5 A;  5B2I B;  4H8R A;  1S32 B;  1H3Q A;  1QMF A;  3Q81 A;  4O8G A;  1W63 Q;  2ZQD A;  3KXB C;  3NOP C;  1WWS A;  1BLC A;  5LBR A;  4OPY A;  5B40 C;  1W8Y A;  3A6N B;  3AZF B;  1XFQ A;  4G3W A;  1CK3 A;  4MLL A;  1L3L A;  2HIO D;  3KUY C;  4GH9 A;  2Y2P A;  2PDR A;  2XFS A;  1KX5 C;  3B6G D;  3D4F A;  3VP0 A;  2M7V A;  5IT5 A;  3VP2 A;  4GS9 B; 
#chains in the Genus database with same CATH homology
 2RVQ D;  3BFC A;  5EVL A;  3CJM A;  5C3I B;  3MFD A;  3Q82 A;  3NC8 A;  3UT9 D;  1Z6F A;  3EQU A;  3AN2 B;  1KX4 C;  3AZN D;  3AZI B;  4NE3 A;  3UTA B;  5B31 A;  3AFA D;  5CTM A;  4R0Q A;  3WTP B;  4S2K A;  4LD9 D;  3W99 B;  4KUD C;  3MGS A;  3TU4 C;  4WMC A;  3AZK C;  1K38 A;  3LZ1 C;  3G2Y A;  5CHU A;  2ARO D;  3VSL A;  2ZQ9 A;  1FCN A;  5B32 B;  3AZL B;  1K55 A;  3MXR A;  2ZJ9 A;  3O62 B;  3UPP A;  3B0D C;  4YM6 B;  5DNN A;  3PBQ A;  4Z2M G;  3LO7 A;  3LY4 A;  1P3G B;  1ES2 A;  5CGX A;  4BEN A;  1P3F C;  3UTB A;  4X23 A;  4WM9 A;  2YFV B;  4RVA A;  1ZG4 A;  2VGJ A;  5B2I D;  1S32 D;  4H9Q A;  1GHI A;  4IBR A;  1PZR A;  1KE4 A;  1KDW A;  3IQA A;  4BD1 A;  4CAY A;  4NYU A;  2R9X A;  2XK1 A;  3IWQ A;  4FCF A;  4EQI A;  3A6N D;  2F8N B;  3UDI A;  3G32 A;  1K57 C;  3REK B;  3AZE C;  3VOY A;  3LCE A;  4D2O A;  5CPI A;  1M1A B;  5EOO A;  3C7V A;  4DE1 A;  5CP6 C;  2Y2L A;  4Y0O A;  3WAA A;  2Y2H A;  1P3B C;  4Z5T B;  4S2I A;  3LZ0 C;  4OP8 A;  1A7W A;  3ISG A;  1EQZ C;  4R3B A;  4DE0 A;  1M40 A;  4B4Z A;  3EG5 B;  3NCK A;  4NZ1 A;  3AN2 D;  4Z9Q A;  4P87 A;  1KGE A;  1YM1 A;  3AZI D;  1RP5 A;  1PWG A;  3WTP D;  3TOI A;  4F94 A;  4Z66 A;  5JYO A;  5B0Z B;  1BTL A;  3C4P A;  4JXS A;  1W8Q A;  3L27 A;  1N1J B;  3AZL D;  1NY0 A;  4IJF A;  1ALQ A;  3OPR A;  3EPK A;  3O62 D;  4YS3 A;  1P3K C;  4YM6 D;  1GA0 A;  3GRJ A;  4UHU A;  5DTK A;  5GLA A;  5B24 A;  1P3G D;  2XD1 A;  5JRG C;  4NZ3 A;  4Q8I A;  2E8I A;  4QLC C;  3AZG A;  2UWX A;  1WYB A;  4OPR A;  5B31 B;  4GB7 A;  4B4X A;  1KX3 B;  5HW3 A;  1K6S A;  1FCM A;  4CJN A;  5CPJ C;  4BQM A;  3MGS B;  2F8N D;  3N7W A;  3REK D;  4GNU A;  2HDU A;  1M1A D;  4ZBE A;  5CTN A;  1P3O C;  5DNN B;  4E44 A;  3W97 C;  5CER A;  2YFW B;  2WAF A;  5B0Y A;  1BSG A;  4UA9 A;  5EVI A;  2CC1 A;  3IT9 A;  1XGJ A;  1CEF A;  2ZM5 A;  5AV6 B;  4H9Q B;  1SKF A;  3MVD B;  1AOI B;  2J9O A;  4MBF A;  4OOM A;  2ZY4 A;  1K54 C;  1P3L A;  5GSU B;  4IBD A;  1MXO A;  3FKW A;  3C1C D;  4YIN A;  5B0Z D;  2XF3 A;  4ZUX C;  3B6F A;  2A3U A;  3FZC A;  3X1V A;  3C4O A;  3IXG A;  5CPI B;  3WS2 A;  5D3O A;  3WAA B;  4XZQ C;  2RL3 A;  4IJE A;  1P34 B;  4R4R A;  1L0E A;  5FQ9 A;  4X56 A;  4PM9 A;  3HBR A;  5F82 A;  1PI4 A;  3AYW D;  1PI5 A;  3M2J A;  1ONH A;  4LV1 A;  3X1U C;  1KX3 D;  1EI5 A;  2JCH A;  4Z66 B;  3MGS D;  3GVB A;  3LJA C;  4E6X A;  3WA9 B;  2EX8 A;  3KWQ C;  2BYK A;  1LL9 A;  2G5I C;  5B33 C;  5DNN D;  1YU1 A;  3RXW A;  4KZA A;  1PZP A;  3FWL A;  3MNN B;  2EFX A;  5AY8 C;  1YMX A;  5FQJ A;  1E4D A;  4MBH A;  5AV6 D;  1TEM A;  2W8S A;  2ZC7 A;  3MVD D;  1AOI D;  1TZY C;  5FUG A;  5GSU D;  4EBN A;  4X55 A;  5B1L A;  4MNR A;  1RGZ A;  5AV5 A;  4WNN A;  1K4F A;  3Q7V B;  4XUJ B;  5CHJ A;  4WZS B;  3WKJ A;  3GSG A;  3F6T A;  4GKU A;  1M18 B;  5DNM A;  5GT0 B;  5E5A C;  1HQ3 A;  3AGD A;  2XD5 A;  5CEB A;  5B0Y B;  4R23 A;  2DF4 C;  1P34 D;  1IEM A;  1SDE A;  1Y54 A;  5EVI B;  4QJG A;  4FD8 A;  5AV9 C;  4NE6 A;  2ZD8 A;  4JJN D;  2NQB A;  3MGQ D;  4J8W C;  4ZTK A;  3O88 A;  3X1T D;  4QD4 A;  3ZNT A;  4GDN A;  3WS5 A;  3AZH C;  2V20 A;  3REH D;  3WTP E;  3PBN A;  4E3L A;  3HLC A;  1YU2 A;  4WYY A;  1HZO A;  3WA9 D;  4PPR A;  1GA9 A;  3RXX A;  2HIO A;  1U35 A;  3B6G A;  4E3I A;  3SS4 A;  5F99 C;  1MKI A;  4DQY B;  2CWE A;  3W96 C;  3MNN D;  3KFU G;  3A3J A;  3HRE A;  2Y2M A;  4OJL A;  3WX7 A;  3ZHH A;  3UT9 A;  3SH9 A;  3A1K A;  4CSR B;  3N3F A;  1KVM A;  3AFA A;  4WZ5 A;  5EEC A;  1SCW A;  3IWI A;  4LD9 A;  5FI7 A;  2DCF A;  4XUJ D;  4E3J A;  1LI0 A;  1M18 D;  3HLW A;  4H9S C;  4H9P A;  5CGW A;  3UDF A;  4WU9 C;  3IF6 C;  4J8X A;  3CMZ A;  5GT0 D;  2BYK B;  2WAD A;  1ZLA B;  1LI9 A;  3AV1 C;  1P3M C;  1TAF A;  5GXQ C;  5AQ9 A;  1BT5 A;  4AWL C;  3R45 B;  4DKI A;  2FFY A;  3IHB A;  4QHC A;  1S32 A;  2BYM A;  5FUG B;  4E6W A;  3X1S B;  3LEL B;  2Y2N A;  3OZH A;  3BFG A;  5B1M D;  3L26 A;  5BT1 C;  5AV5 B;  4E3K A;  3HUM A;  1H8Z A;  3WKJ B;  1P3P A;  4ZBJ B;  3QNC A;  3C1B B;  5BS7 C;  1P3A C;  5TGF A;  2WKE A;  4GHA A;  1RCJ A;  4XUX A;  4N1H A;  1XPB A;  1M19 D;  4H9O B;  2XQZ A;  3AN2 A;  5AV8 D;  1JWV A;  1HVB A;  4BL3 A;  1Q2Q A;  4UUZ A;  3WTP A;  4LCL A;  5BO0 B;  1ES3 A;  1BUE A;  1VQQ A;  2NZD B;  3G35 A;  2HIO B;  1U35 B;  1YLT A;  4G91 C;  2LY8 A;  3AZL A;  1ZLA D;  1TDL A;  1RGY A;  4WU8 B;  5DF9 A;  3O62 A;  1KE0 A;  3AZM C;  3KUY A;  1P3G A;  4IBK A;  2YFV A;  4LV2 A;  1E3U D;  3V5M A;  5HAI A;  1PIO A;  3X1S D;  3LEL D;  4KZ3 A;  1N4O A;  2WKH A;  4QY5 A;  5AV5 D;  1P3I B;  3ZVW A;  2WGW B;  5AVB B;  2F8N A;  3WKJ D;  1H3O B;  3H0M C;  3REI B;  4H9P B;  2OLV A;  5CXW A;  5DTT A;  4J8X B;  3A6N C;  3PTE A;  3AZF C;  3REK A;  4HEF A;  3C1B D;  4S2O A;  2DQN C;  3REJ B;  4ZJ2 A;  2PYO D;  5DTS A;  4LCM A;  1KVL A;  1TAF B;  4X6T A;  2FJ7 D;  5FQM A;  5FI2 A;  5F1G A;  2CV5 B;  1SDN A;  1K56 A;  3BFD A;  1ID3 C;  1FR1 A;  2BYM B;  2VQR A;  4BJP A;  4KGC B;  4X69 A;  1BH8 A;  3AV2 C;  1FSW A;  4GZB A;  3C1C A;  3OPL A;  5FA7 A;  3GTC A;  1BLS A;  3A3E A;  3UTA C;  1P3P B;  5B0Z A;  2NZD D;  1U35 D;  3W99 C;  1FCO A;  4R8P B;  4J8U C;  1N1J A;  5GT3 B;  3DWZ A;  5JYP A;  2DRW A;  4WU8 D;  3CZD A;  2HDR A;  4J8V B;  5B32 C;  5CPK A;  1YU0 A;  1HD8 A;  5HAQ A;  4YM6 C;  5AVC C;  1PW8 A;  3AZJ B;  3AYW A;  4B88 A;  5KMW A;  1AXB A;  2XEP A;  4E3O A;  4UUZ B;  1HTA A;  1KX3 A;  1CI8 A;  3MXS A;  1NZO A;  1P3I D;  5AVB D;  3LY3 A;  3Q1F A;  3REI D;  3Q7Z A;  4J8X D;  1I2W A;  1FSY A;  4O7D A;  3B0C T;  2BG1 A;  3REJ D;  3G31 A;  3P5J B;  1TDG A;  5GHZ A;  3KUY B;  2YFW A;  1KE3 A;  1S0W A;  3EPJ A;  1KX5 B;  2CV5 D;  1M1A C;  3UDX A;  3HLG A;  3A3D A;  1H5X A;  4Z5T C;  1TVF A;  1XP4 A;  5AV6 A;  2X71 A;  3E2L A;  4KGC D;  3MVD A;  1AOI A;  2ZQC A;  5GSU A;  1F66 C;  4HGA B;  1DJC A;  3W98 A;  3H0L C;  4QLC A;  5EUA A;  4Y0T A;  4PMA A;  1P3P D;  1YU4 A;  3SS3 A;  5CRF A;  4EO5 B;  1OME A;  4R8P D;  3W4Q A;  5GT3 D;  4OVD A;  5B2J D;  4KUD B;  2L5A A;  1ZC2 A;  2G2W A;  4J8V D;  5GHY A;  3LZ1 B;  1S6R A;  1P34 A;  1CEG A;  3MGP A;  1NYY A;  3AZJ D;  5AQA A;  1PWC A;  2ZM2 A;  3B0D B;  4JJN A;  3MGQ A;  3Q07 A;  3V9R A;  1BH8 B;  3X1T A;  4WZ4 A;  5IHV A;  4X53 A;  3VOZ A;  3N4I A;  3A3I A;  5HX9 A;  4EBL A;  3C1C B;  2X02 A;  1G68 A;  4OP5 A;  4OON A;  4P85 A;  3SOI A;  1W2E A;  5BOH A;  3REH A;  5B31 C;  2A49 A;  1K54 A;  3KXB D;  1C3B A;  2HDQ A;  3WA9 A;  3IHA A;  5B40 D;  4PM8 A;  4PM5 A;  1K55 C;  5CPK B;  2ZC3 B;  3KUY D;  1KX5 D;  3S22 A;  3AZE B;  3NIA A;  3OCL A;  4JKT A;  3P09 A;  3MNN A;  5DNN C;  1NXY A;  3AYW B;  5CP6 B;  3UTB C;  4XZQ A;  4X23 C;  2VGK A;  3LZ0 B;  3ITB A;  4DF6 A;  3B0C W;  2J9P A;  4U0X A;  4RX2 A;  5A92 A;  4R3J A;  2V1Z A;  3IF5 A;  2G2U A;  1KX4 D;  5E43 A;  5HAP A;  3Q7V A;  4XUJ A;  1M18 A;  2ZM8 A;  2RIQ A;  2WK0 A;  2EX9 A;  5GT0 A;  1EWZ A;  4KUD D;  3FKE A;  4IVI A;  3TU4 D;  3AZK D;  3LZ1 D;  3TG9 A;  3N6I A;  4NET A;  1BLP A;  5CPI C;  2EXA A;  1KU5 A;  1K56 D;  3WAA C;  3FYZ A;  1L2S A;  4KZB A;  4OQ0 A;  1P3K B;  1XX2 A;  4JPM A;  1YLZ A;  1P3F D;  5JRG B;  5G49 A;  5B1M A;  2P9V B;  4OLG A;  3W98 B;  4QLC B;  4MEZ A;  3IXD A;  4IBC A;  3REL A;  3EPL A;  3A1I A;  1BFM A;  4Z66 C;  2Q9M A;  4KZ9 A;  2V2F F;  5CPJ B;  3UO9 A;  3VFF A;  4XUZ A;  2IO5 C;  5AQ7 A;  1PW1 A;  1MWT A;  5CPK D;  5FQK A;  4E3M A;  3AZE D;  4YS3 C;  3MGP B;  2ZC4 B;  3OPP A;  2F2A C;  5CP6 D;  5B24 C;  1P3O B;  4JJN B;  3W97 B;  4ZAM A;  1ERQ A;  3MGQ B;  1P3B D;  1M19 A;  3V9R B;  4CSR A;  4JF4 A;  3S1Y A;  5AV8 A;  3X1T B;  3LZ0 D;  1EQZ D;  1Z2C B;  3AZG C;  4YFM A;  3REH B;  4E45 A;  3MKF A;  1BLH A;  4H9N B;  3HLB A;  2J7V A;  1ZLA A;  4ZUX B;  4G92 B;  5F1F A;  3VH5 A;  4GD8 A;  4S2L A;  5B0Y C;  1P3K D;  3L29 A;  3R45 A;  4XZQ B;  1E3U A;  5EVI C;  2IWB A;  5E2H A;  3ZG9 B;  1YUE A;  3X1S A;  3LEL A;  3W96 A;  5JRG D;  5FI6 A;  3W98 D;  4QLC D;  1P3L C;  1KGF A;  2HP6 A;  1IYQ A;  1H8Y A;  1MPL A;  4S2N A;  2XGN A;  3X1U B;  3IH9 A;  5HFO A;  2WKI A;  5CPJ D;  3B6F C;  3WRZ A;  3OC2 A;  3C1B A;  3VFH A;  2QZ6 A;  3VH6 A;  5FAS A;  2PYO A;  3LJA B;  4HBU A;  3X1V C;  2ZQA A;  2HUE B;  3KWQ B;  2FJ7 A;  3MGP D;  3G4P A;  3W8K A;  4IBB A;  5B33 B;  1P3O D;  2BLS A;  3W97 D;  4MBK A;  4H9O A;  3MGR C;  4OJ5 A;  4A5R A;  3VH6 W;  1B67 A;  5G49 B;  5B1M B;  5AY8 B;  2H0Y A;  4GN2 A;  4OOL A;  5BO0 A;  1FR6 A;  3REL B;  1TZY B;  2EXB A;  2C5W B;  4C75 A;  3W4O A;  3PAG A;  5HL1 A;  4DRT A;  2NZD A;  5AQB A;  3VMA A;  4R1G A;  5GLB A;  5CED A;  1L0D A;  4DDS A;  4NYY A;  4WU8 A;  4ZUX D;  3M6H A;  5JA4 B;  3NI9 A;  3I7J A;  1ERM A;  1JWP A;  2J8P A;  5E5A B;  4IBF A;  4XZQ D;  1M19 B;  5AV8 B;  3DTM A;  3IXH A;  4OPQ A;  4PM6 A;  3GQZ A;  5AV9 B;  4NK3 A;  5GLD A;  4J8W B;  4RA7 A;  1P3I A;  4UA7 A;  2WGW A;  3HSH A;  5B1L C;  1W5D A;  5AVB A;  3CG5 A;  1H3O A;  3SH8 A;  3REI A;  3AZH B;  3X1U D;  3REJ A;  4ZBJ C;  4BL2 A;  4EWF A;  5DF7 A;  5DNM C;  3LJA D;  1GHM A;  2OV5 A;  1I5Q A;  3NY4 A;  3KWQ D;  4JLF A;  1HQ3 C;  1BZA A;  1B6W A;  5A93 A;  3UE3 A;  1LHY A;  2CV5 A;  5F99 B;  5B33 D;  2WZZ A;  3GMW A;  1IYP A;  4KGC A;  3W96 B;  3NQU B;  3WWX A;  3KS4 A;  1L0G A;  4KZ7 A;  2NQB C;  4IBE A;  5AY8 D;  4WJ3 C;  4P0M A;  5GL9 A;  2ZQ7 A;  4U3T A;  4KG2 A;  3BRM A;  3REL D;  1TZY D;  1R4V A;  4N9L A;  4NE5 A;  4KG6 A;  3BEC A;  2H5S A;  4R8P A;  1PWD A;  5GT3 A;  2GDN A;  5B2J A;  2PYO B;  2HIO C;  3B6G C;  4J8V A;  5I94 A;  2FJ7 B;  4WU9 B;  2Q9N A;  3RJU A;  5G18 A;  5E5A D;  4WEJ A;  2RVQ C;  3AZJ A;  3AV1 B;  1JFI A;  5TR7 A;  5CEC A;  5FQI A;  1ESU A;  3EQV A;  2Y4A A;  3NDG A;  1P3M B;  5GXQ B;  4GOG A;  1FOF A;  3UT9 C;  4EUZ A;  4AWL B;  5AV9 D;  2R9W A;  3AZN C;  3WS0 A;  4J8W D;  1YT4 A;  3AFA C;  5FQQ A;  4WZ5 C;  3KXB A;  3AZH D;  3AV2 A;  4LD9 C;  3P98 A;  3VP3 A;  2ZC6 B;  4OJ6 A;  3AL0 C;  2OSU A;  3UNW A;  2Z2M B;  5B40 A;  2ARO C;  4KQQ A;  4KHA A;  3HLE A;  3OCN A;  1BH9 A;  5KZH A;  3WRT A;  3ZCZ A;  1KX5 A;  5F99 D;  3BM6 A;  3A3F A;  3UY6 A;  3UE1 A;  3W96 D;  1LLB A;  2JSS A;  1P3A B;  3TSG A;  5L2F A;  5B2I C;  1S32 C;  1XGI A;  4QB8 A;  3O86 A;  3KS8 A;  1G6A A;  2WGV A;  3VP1 A;  1JTG A;  4WBG A;  1KX4 A;  3BLM A;  4OLD A;  1ZG6 A;  3V50 A;  1N9B A;  3NBL A;  4KUD A;  4UAA A;  3PBT A;  1T3U A;  3TU4 A;  3AZK A;  3LZ1 A;  4WU9 D;  1WYC A;  2Y2J A;  3FV7 A;  4G91 B;  2JE5 A;  3AV1 D;  1YLW A;  5C3I C;  1P3M D;  5GXQ D;  1YLY A;  4RX3 A;  3O3V A;  1GHP A;  4QY6 A;  4NY2 A;  3DWK A;  3HON A;  1P3F A;  5EE8 A;  4K0W A;  4XXR A;  3AN2 C;  1DJB A;  3AZI C;  2WAE A;  3MZE A;  3PBR A;  4LV3 A;  5BNV B;  1Q9C A;  3WTP C;  3IH8 A;  4JF6 A;  1F66 A;  4P6B A;  5BT1 D;  5B2J B;  1YQS A;  3AZL C;  1K57 A;  2F8N H;  2PU2 A;  3AZE A;  3O62 C;  4OQI A;  3WS4 A;  1JTD A;  1JFI B;  4E3N A;  5CP6 A;  1P3G C;  2H0T A;  1GCE A;  1P3B A;  2XH9 A;  1P3A D;  3LZ0 A;  1VM1 A;  4FH4 A;  1EQZ A;  3UN7 A;  1ID3 B;  5U47 A;  4HGA C;  2QPN A;  3ITA A;  3KXB B;  3AV2 B;  3C5A A;  3IWO A;  1DY6 A;  5B40 B;  4KZ6 A;  4KHA B;  1BH9 B;  4EO5 C;  3REK C;  3NQJ B;  4J8U B;  1L0F A;  4X68 A;  1XA7 A;  1O7E A;  1P3K A;  1W7F A;  1YLJ A;  3AZM D;  5J8X A;  2ZM0 A;  4LEN A;  1IEL A;  5JRG A;  5AVC B;  1ZKJ A;  2P9V A;  5GHX A;  5BPV A;  5E2G A;  1NJ4 A;  1KX4 B;  4JXW A;  3C1C C;  3EPH A;  1FQG A;  4JXV A;  5FAO A;  5B0Z C;  5CPJ A;  4Y0U A;  2QMI A;  2X01 A;  3VSK A;  4N1X A;  1IKG A;  3ZG5 A;  3L2A A;  4ZDX A;  3TU4 B;  3AZK B;  5CHL B;  3AZF D;  4K91 A;  4HBT A;  5CPK C;  4FSF A;  1P3O A;  2Z2L B;  3W97 A;  2ZC5 B;  5KSH A;  1XXM A;  1P3F B;  3AYW C;  4N92 A;  1ID3 D;  2Y2G A;  3MKE A;  1K4E A;  3PBS A;  3M6B A;  1KX3 C;  3AV2 D;  4U0T A;  4L0L A;  1F66 B;  3MGS C;  5FAP A;  4H9N A;  3UTA D;  5FDH A;  4ZUX A;  3W99 D;  4LG2 A;  4J8U D;  5EPH A;  1XKZ A;  2RCX A;  1KGG A;  5DVA A;  1LL5 A;  1P3B B;  5FSR A;  5B32 D;  1EQZ B;  1YLP A;  5AV6 C;  2IWC A;  2ZQ8 A;  5AVC D;  3MVD C;  1AOI C;  5GSU C;  4IED A;  3W98 C;  4OQH A;  3X1U A;  3V3R A;  3L28 A;  3VH5 T;  4OUI A;  3N8S A;  3H0R C;  5A91 A;  3LJA A;  1MWR A;  3ZG8 B;  3KWQ A;  4OOY A;  3ZG7 B;  3WS1 A;  1P34 C;  1O07 A;  5B33 A;  4OKP A;  5M1A A;  4UPK A;  3MGP C;  3UPO A;  4M3K A;  2Y2I A;  3L25 A;  2IOU A;  4JJN C;  3MGQ C;  1HTZ A;  5AY8 A;  4S2M A;  4RYE A;  4Z5T D;  4QU3 A;  3X1T C;  4EV4 A;  3UTB B;  4X23 B;  1TZY A;  2H10 A;  3VH6 T;  1ONG A;  1F66 D;  2EX2 A;  4BD0 A;  3SH7 A;  3REH C;  4LV0 A;  5CGS A;  1ULY A;  4CAY B;  3WA9 C;  3MBZ A;  2ZY5 A;  1KDS A;  5JA4 A;  4EBP A;  5F83 A;  5E5A A;  2Y2O A;  5M18 A;  3ZVT A;  4G92 C;  3E2K A;  3S4X A;  3MNN C;  1M6K A;  2ZMA A;  3ZDJ A;  3KSY A;  4ZJ3 A;  5AV9 A;  3NDE A;  4J8W A;  1NRF A;  3MGR A;  1QME A;  1IYO A;  4H9R A;  3AZH A;  3BYD A;  4XUJ C;  4R4S A;  1ES4 A;  3N8R A;  1M18 C;  5B31 D;  5TFQ A;  4Z2M H;  5GT0 C;  1JWZ A;  3M2K A;  4IBG A;  1ESI A;  4WMC D;  1DJA A;  5F99 A;  1K25 A;  2IO5 B;  1YMS A;  5M19 A;  2HUE C;  3HLF A;  4HES A;  4N9K A;  3NQU A;  3PBO A;  4YS3 B;  5BNX A;  1CI9 A;  3B3X A;  2B5R A;  1E25 A;  5B24 B;  3VH5 W;  3UTB D;  4X23 D;  5B1M C;  3ZNY A;  2EX6 A;  1I2S A;  2I72 A;  3HLD A;  3AZG B;  3REL C;  2C6W B;  4KZ8 A;  2XFT A;  2Y2Q A;  4OJO A;  4H9S A;  4WU9 A;  2HDS A;  3IF6 A;  1ERO A;  5GLC A;  3ZGA B;  3AV1 A;  1IKI A;  5CPI D;  1P3M A;  4DRA A;  5GXQ A;  3WAA D;  2Y91 A;  3SS5 A;  4KQR A;  5CHM A;  1M19 C;  1MWS A;  3UPN A;  5AV8 C;  3MZD A;  3UE0 A;  4ZJ1 A;  4DXC A;  3GR2 A;  2FFF B;  2HP5 A;  1BUL A;  1P3L B;  1XA1 A;  5B32 G;  1Q2P A;  1U60 A;  3AGE A;  4BLM A;  1MY8 A;  5KDM A;  2J8Y A;  5HAR A;  2WZX A;  4Z66 D;  2HPB A;  1ZLA C;  1ES5 A;  3B6F B;  3BEB A;  3GV9 A;  5BS7 A;  2IWD A;  4S2J A;  4GD6 A;  4WV4 B;  3X1V B;  1YU3 A;  3QHY A;  4YS3 D;  1P3A A;  2ZLY A;  2WUQ A;  5B24 D;  3X1S C;  3LEL C;  3MGR B;  2F8N G;  2PBY A;  4H9R B;  5AV5 C;  3AZG D;  2DNS A;  3BLS A;  3ZG0 A;  4S2N C;  3WKJ C;  4KZ4 A;  3MZF A;  4GDB A;  3AZN A;  4DE3 A;  3C1B C;  2PYO C;  3PAE A;  2ARO A;  2FJ7 C;  1JVJ A;  4M6B A;  3AZM A;  5BNX B;  2EFU A;  4NFT A;  5B0Y D;  2ZY3 A;  4KZ5 A;  5EVI D;  3G2Z A;  3DW0 A;  1F1E A;  5DF8 A;  5BNV A;  2XR0 A;  1W79 A;  3HL9 A;  4K0X A;  3C7U A;  2Y55 A;  4IBX A;  2WYX A;  5B2I A;  5FAQ A;  1P3L D;  4KEN B;  2NZD C;  5B1L B;  1U35 C;  4JXG A;  1K6R A;  4WEL A;  3G34 A;  4OQG A;  3IF6 B;  1IYS A;  4WNN B;  3A6N A;  3AZF A;  4JBF A;  4WU8 C;  4OJP A;  3B6F D;  4S2P A;  4NZ5 A;  2P74 A;  2XLN A;  3B0B A;  3G30 A;  3V39 A;  5DNM B;  1MWU A;  3X1V D;  4KQO A;  3IP4 C;  4Y7P A;  1HQ3 B;  3IXB A;  2PU4 A;  3LEZ A;  4DRB A;  2HP9 A;  5B31 G;  2JBF A;  3JYI A;  1ID3 A;  4KG5 A;  3MGR D;  4UA6 A;  2G5H C;  3O87 A;  4IBI A;  2NQB B;  3BFE A;  3QNB A;  1P3I C;  2ZY2 A;  4C3Q A;  2Y59 A;  5AVB C;  1WWI A;  4DE2 A;  3REI C;  3AZI A;  3UTA A;  4J8X C;  2OLU A;  5KDM B;  4C6Y A;  3NQJ A;  2JC7 A;  2WGI A;  3AGF A;  3REJ C;  4ID4 A;  3W99 A;  4J8U A;  3N8L A;  3HUO A;  1PZO A;  3OPH A;  5E2E A;  5KSC A;  3B6G B;  2CV5 C;  4FH2 A;  4DDY A;  1MBL A;  3HUN A;  5B32 A;  2XDM A;  1PYY A;  4GHL A;  4DXB A;  4YM6 A;  4IVK A;  5AVC A;  3V3S A;  4KGC C;  4NZ4 A;  5FAT A;  3UT9 B;  3FDD A;  4OPZ A;  2F8N K;  2Y2K A;  4OH0 A;  1P3P C;  1WE4 A;  1J9M A;  3ZFZ A;  3AZN B;  1SHV A;  5B1L D;  5EOE A;  4CPK A;  3AFA B;  4R8P C;  5GT3 C;  4LD9 B;  4PM7 A;  5B2J C;  5A90 A;  4J8V C;  2ARO B;  5DNM D;  3AZM B;  1HQ3 D;  3BFF A;  3AZJ C;  4QNL A;  3HVF A;  1M1A A;  1NZU A;  5E2F A;  4Z5T A;  4IBJ A;  3VP4 A;  3W4P A;  1NYM A;  4WEK A;  3FKV A;  2NQB D;  4JF5 A;  5B2I B;  4H8R A;  1S32 B;  1QMF A;  3Q81 A;  2ZQD A;  3KXB C;  1WWS A;  1BLC A;  4OPY A;  5B40 C;  1W8Y A;  3A6N B;  3AZF B;  1CK3 A;  4MLL A;  2HIO D;  3KUY C;  4GH9 A;  2Y2P A;  2XFS A;  1KX5 C;  3B6G D;  3D4F A;  3VP0 A;  3VP2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...