2Y2GA

Penicillin-binding protein 1b (pbp-1b) in complex with an alkyl boronate (a01)
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
486
structure length
466
Chain Sequence
EITYSDGTVIASIDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTGQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PENICILLIN-BINDING PROTEIN 1B
publication title Structure-Guided Design of Cell Wall Biosynthesis Inhibitors that Overcome Beta-Lactam Resistance in Staphylococcus Aureus (Mrsa).
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 165
structure length 466
sequence length 486
chains with identical sequence B
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2y2gA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2y2gA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2y2gA02
2HP5A 3G35A 3NI9A 5FI6A 5CHJA 5A91A 1KE0A 2G2UA 1IYQA 2WKIA 2ZQAA 4Q8IA 3NIAA 4LV0A 2XD1A 3ZG5A 2ZQ9A 3P09A 1PW1A 1JTGA 2WGWB 3V50A 1NZOA 4KENB 5HAIA 1HVBA 3UE0A 1U60A 4ZJ1A 1DJBA 4RVAA 2WAEA 4EBPA 3VMAA 5BOHA 3HLCA 5EVIA 4MLLA 4LENA 1DY6A 3Q81A 5DTTA 5EE8A 2GDNA 4C3QA 2Y2LA 1BSGA 4OQHA 3OCNA 3RXXA 4BL2A 4WZ5A 5EVID 1JWZA 3Q7VA 5FQ9A 1PYYA 3VP4A 2Y2OA 3IF6C 4DDSA 4GD8A 4NETA 5FAOA 4S2LA 4N9KA 3N4IA 1PZOA 1MXOA 4S2MA 1W8YA 4B4ZA 4KZ4A 3ZVTA 2WZZA 2JCHA 2G2WA 2ZM8A 4KZAA 3A3DA 5FDHA 3VSLA 3ZDJA 4X68A 3IHBA 1KGGA 2QMIA 1PW8A 3SH9A 4E6XA 1I2WA 4BD1A 3VSKA 2XEPA 3N6IA 4FH4A 4DXBA 4EWFA 1G68A 2Y91A 1DJAA 4BQMA 3DWZA 3UNWA 3NCKA 2ZM2A 2WKEA 2Y2IA 4OKPA 5AQ7A 1H8ZA 3WS0A 5HAQA 2XFTA 3Q1FA 3PBTA 2ZMAA 3I7JA 4LV1A 4EUZA 4JXVA 3HBRA 4OOMA 5G18A 3ITBA 1L0FA 2EX9A 5JYOA 5AQAA 1LI0A 3MBZA 2WKHA 4HEFA 4DDYA 3CG5A 5CEDA 4HESA 3OCLA 4OQGA 2DCFA 1K56D 2C5WB 1I5QA 4R4RA 1YLPA 5JYPA 3IF6A 1W5DA 2WAFA 3VFFA 1KE4A 1K55C 2Y2NA 1L0EA 4JF6A 4E3KA 2HP6A 1CI8A 4BD0A 2ZQDA 3TSGA 1YMXA 4B4XA 4L0LA 3FKWA 1TEMA 1ONGA 3IWOA 2RCXA 2IWBA 4HBTA 4PM7A 2XH9A 4IEDA 4JF4A 3G2YA 4JXWA 1RP5A 5CERA 3G31A 4P85A 3PBRA 3SH7A 3C7VA 4E3MA 3V3RA 2R9XA 1K25A 1ONHA 1TVFA 2X71A 1PI5A 4R4SA 1K6RA 4C6YA 2JE5A 2P74A 3OPHA 1FR6A 5CRFA 4E3NA 1BT5A 1TDLA 1ZG4A 2HDQA 4GN2A 4R23A 4D2OA 2EX2A 3ZNYA 4KG5A 5FI7A 5FSRA 2WZXA 4OPZA 3BECA 2PU2A 4MBFA 3GQZA 4GNUA 4ZTKA 4MNRA 2ZJ9A 4P0MA 3C4OA 3WS4A 4XUZA 3VP0A 3HLBA 1JWPA 2ZC3B 1YLYA 3IF6B 4IBXA 3IHAA 4FSFA 4RYEA 5EUAA 3NDGA 4ZDXA 1FR1A 4OQIA 3UPOA 2ZC7A 1JTDA 2B5RA 3D4FA 4QJGA 1GA0A 2OSUA 1XX2A 3IXDA 3IXHA 4PM8A 5CECA 4N92A 1ALQA 1K55A 1ESUA 4O7DA 2Y55A 2XFSA 3OPLA 5D3OA 3PAEA 1NRFA 3IH8A 3GR2A 1K6SA 3V3SA 3UO9A 1ES5A 1BLHA 3UPNA 3S1YA 5HW3A 3BFCA 1FSYA 1KGFA 1SKFA 4GKUA 1NJ4A 2ZQ8A 1E25A 5M18A 1HTZA 5TFQA 1K54C 2ZD8A 5E2EA 3SS3A 1BULA 4EBNA 3UDFA 2XK1A 3VFHA 2E8IA 2Q9NA 3HLEA 2DNSA 4XUXA 3Q07A 5TR7A 3CZDA 1XGJA 1IKGA 1BZAA 1NXYA 3NDEA 5A90A 2PU4A 2BLSA 2UWXA 3N8LA 5GHZA 1E3UA 3BLMA 3IQAA 4PM6A 1RGZA 4F94A 1ESIA 3DTMA 2Y2PA 3ITAA 2JBFA 3SS5A 4GZBA 1K4FA 1SDNA 4KG6A 2WYXA 2JC7A 1E3UD 4JXGA 3E2KA 1LL5A 3OC2A 4FH2A 2ZC6B 4JXSA 4EQIA 3G2ZA 4S2JA 5DTSA 1KVMA 1Q2PA 3HLDA 2ZLYA 3DW0A 5CTNA 2XR0A 1E4DA 5GLCA 4ZJ3A 4GDNA 1MWTA 2Y2JA 4KG2A 1FCMA 3PTEA 2A3UA 2Z2MB 4QD4A 1MWRA 1IYSA 3WRTA 3LEZA 4M3KA 3QNCA 3UDIA 3IXGA 1ZKJA 5GLDA 4LCLA 3UDXA 4BJPA 2Y2KA 4OP8A 2Y2HA 4ZBEA 3MZDA 4K91A 3VOZA 5CTMA 3WS2A 4OQ0A 4BENA 3BFFA 2FFYA 3BEBA 1K54A 1FOFA 3C5AA 2H5SA 1ZG6A 3FV7A 5EVIB 1IYOA 2P9VA 3O87A 1S0WA 4BL3A 4JPMA 5DF7A 1KGEA 4R1GA 1M40A 5IHVA 4R3BA 4RA7A 5FAPA 1YLZA 2HPBA 3Q7VB 4RX3A 2XF3A 1EWZA 3BFGA 4QY5A 2WADA 4OLGA 3IF5A 3HREA 4GB7A 3AGFA 4U0TA 3O3VA 4R0QA 4DXCA 4JF5A 4OLDA 4PM5A 3LY4A 4QB8A 5CHUA 5EVLA 1FCOA 2J7VA 1MWSA 5FQJA 3UE1A 4DE0A 1WE4A 2EFXA 4KZ8A 3IWIA 5KSCA 2H0TA 1PZPA 3VP1A 5I94A 3N8SA 4KZBA 1DJCA 3MKEA 3P98A 2FFFB 5J8XA 3FYZA 1KE3A 4OOYA 2EX8A 3OZHA 2V20A 2CC1A 3BYDA 2XD5A 4X55A 5FQKA 5FQQA 3W4PA 2VGJA 3QHYA 2C6WB 1SDEA 3HVFA 4UA7A 5F83A 3TG9A 2XGNA 4QHCA 1ES4A 2WGIA 5E2FA 3ZCZA 3MFDA 4LV3A 4K0XA 4DRTA 1PWDA 4UA6A 5M1AA 1LHYA 4E3JA 5FQMA 4KQRA 4IVKA 3O88A 5HAPA 2Y59A 2QPNA 1K57C 4S2KA 5GLAA 2J9PA 1KVLA 1RGYA 1ZC2A 2EFUA 1MKIA 5F1GA 2X02A 1TDGA 2WK0A 4FCFA 4DE1A 5HARA 1S6RA 4H8RA 4KQOA 5GL9A 3BRMA 3JYIA 4N1HA 1C3BA 2QZ6A 3BFEA 5E2HA 1XP4A 3SH8A 2ZC4B 1NYMA 3HLWA 3VOYA 2V2FF 4HBUA 2H10A 1SHVA 3MXSA 3MXRA 4WZ4A 1HZOA 3HLGA 3MZEA 4S2OA 5HX9A 1ES3A 2VGKA 4A5RA 3A3JA 4DE3A 3IXBA 1LLBA 1H5XA 3O86A 4WEKA 5E2GA 4QY6A 1GA9A 1W7FA 2WGWA 3IH9A 3IWQA 4N9LA 5FATA 3M2JA 1CEGA 1M6KA 1YLWA 5HL1A 3HLFA 1YM1A 1ERMA 3Q82A 4S2NC 1AXBA 2HDSA 2Z2LB 3FKVA 5EECA 5EOEA 5E43A 1JWVA 1QMFA 1YLJA 3FZCA 2J8YA 3GTCA 3GRJA 5CEBA 1XPBA 4R3JA 4WM9A 2R9WA 2I72A 4OOLA 4RX2A 4WMCA 4LV2A 3RJUA 3G30A 1K57A 5AQBA 1BLCA 1YLTA 4OPYA 3PBSA 3OPRA 2BG1A 3M6BA 5M19A 1IELA 3BFDA 5KMWA 2WGVA 2ZC5B 2H0YA 5DF9A 3V5MA 5F1FA 3UN7A 3ZG0A 1NY0A 1RCJA 4U0XA 3LO7A 4ZAMA 3NC8A 1Z6FA 2J9OA 5HFOA 4EBLA 1QMEA 4OPQA 3UE3A 1XA7A 2EX6A 4E3IA 4KZ6A 4OP5A 4XXRA 4MEZA 2V1ZA 4Z9QA 3A3EA 3BM6A 1N9BA 3W8KA 1SCWA 1IKIA 4ID4A 5FAQA 4E6WA 4P6BA 3PBOA 5CGSA 1IYPA 2HDUA 2XQZA 4EV4A 1KDSA 4DF6A 5A92A 4WYYA 4KQQA 4Y7PA 1CEFA 4Y0TA 3W4QA 5FASA 3ISGA 3ZGAB 2IWDA 4Y0UA 1CK3A 3W4OA 3HUNA 3B3XA 4OH0A 1O07A 3IT9A 3M6HA 4QU3A 4KZ3A 4S2NA 3VP3A 3ZFZA 1NZUA 3CMZA 2OLVA 5EOOA 1PWCA 3ZNTA 1L0DA 4OONA 4X53A 5EPHA 3BLSA 1J9MA 3MKFA 5GHXA 2ZQCA 4GOGA 3WS5A 1BTLA 2OLUA 4X56A 3RXWA 3PBNA 3SOIA 4UAAA 2ZM0A 3NY4A 1EI5A 4DKIA 2DRWA 2EXBA 4E3OA 3C7UA 1JVJA 3HUOA 3WWXA 3N7WA 4IVIA 5CGWA 1GHIA 1HD8A 5FA7A 3GMWA 5DF8A 4FD8A 4WEJA 1ERQA 3DWKA 2WUQA 4IBRA 4K0WA 1XXMA 2IWCA 1MY8A 3E2LA 1G6AA 1Y54A 5U47A 4N1XA 4CPKA 5DTKA 5CXWA 1YMSA 1I2SA 1PIOA 3NBLA 3ZG7B 5KSHA 3G34A 1K56A 1VM1A 4YINA 3AGEA 2Y2QA 1MBLA 4OPRA 4MBKA 1CI9A 1K38A 3CJMA 4PMAA 2Q9MA 1GCEA 2P9VB 3WS1A 2OV5A 5A93A 1PI4A 4UHUA 3V39A 2RL3A 1GHPA 5KZHA 4S2IA 4YFMA 3HL9A 3PAGA 3ZG8B 1L0GA 1FSWA 4DE2A 1XGIA 1MWUA 3SS4A 1KDWA 4BLMA 4NK3A 3M2KA 4S2PA 5F82A 4UA9A 1L2SA 4JBFA 4KZ7A 4WELA 1XA1A 3ZG9B 5TGFA 3GSGA 2Y2GA 1FCNA 5GHYA 3HUMA 1BLPA 1EROA 1W79A 4KZ9A 4ZJ2A 3S22A 3TOIA 2HDRA 4B88A 1K4EA 5FQIA 1MPLA 3VP2A 3G4PA 5FI2A 4P87A 1IEMA 2EXAA 2ZQ7A 4GD6A 1VQQA 4JLFA 5EVIC 4WBGA 1LL9A 3A3IA 2PBYA 4GDBA 4X6TA 3A3FA 1W8QA 3MZFA 3OPPA 3FWLA 4WZ5C 5L2FA 5GLBA 4C75A 1H8YA 3EQUA 4MBHA 5DVAA 5AQ9A 3ZVWA 1GHMA 1Q2QA 4E3LA 5CHMA 2A49A 3UY6A 3EQVA 2XLNA 4PPRA 3PBQA 3Q7ZA 3LY3A 5CGXA 4PM9A 3S4XA 4U3TA 2HP9A 2X01A 4JKTA 4Y0OA 1XKZA 3ZHHA 1LI9A 3UPPA 3GV9A 1BLSA 1BUEA 1N4OA 2Y2MA 1WYBA 2XDMA 3AGDA 3C4PA 3GVBA 4LCMA 4X69A 4OVDA 2Y4AA 1FQGA 1OMEA 1YQSA 3G32A 1YT4A 4KZ5A 1ES2A 3QNBA 4WMCD 1NYYA 3LCEA 1WYCA 1O7EA 3N8RA 4CJNA 3WRZA 1PWGA
chains in the Genus database with same CATH superfamily
4IBEA 5CHJA 3UMEA 1LT0A 3NIAA 4LV0A 5JA4B 4M4XA 4Z2GA 1M19B 2J3TC 3VV4A 1F66D 3V50A 1NZOA 4ZJ1A 2O9CA 3VMAA 3TU4B 3VH5T 5G4YA 3Q81A 1FIKA 2GDNA 3AZLC 3KXBA 1KU5A 2VV6A 4R8PB 3A0SA 4NETA 3N4IA 1M1AC 3AZEA 2WZZA 2JCHA 4KZAA 4OJLA 1HLUP 4R38A 2PYOC 1KGGA 3W97B 4MMNA 3SH9A 3O62B 3KWQC 3VSKA 4NXBA 4FH4A 4GW9A 2W3FA 4EWFA 5L10A 1M18C 2ZM2A 3NQUA 4IUKA 3WA9A 5AQ7A 3EEHA 5HAQA 3WS0A 3Q1FA 4EUVA 3PBTA 3X1VB 3I7JA 1N1JB 4GS9B 4YWZA 3FG8A 2PYPA 1F2KA 3HBRA 1XJ4A 2J3TD 2P08A 1AOIB 1A7WA 4DDYA 5BT1C 4HESA 1E15A 2C5WB 2NZDA 3DBAA 5B32B 5JYPA 1SKOA 2WAFA 3KO6A 1QO6A 2HP6A 4PKYG 3BY9A 5TBMB 4H9SA 1CI8A 2DQNC 4BD0A 3K3CA 3L2AA 2M7VA 3IX3A 1ONGA 1D7EA 3IWOA 1S32A 1E6PA 4PKYA 2IWBA 4PM7A 4JF4A 4JXWA 1RP5A 3LIEA 5CERA 1TF1A 4J8WB 3B0DB 3NULA 3PBRA 3C7VA 4F3LB 5B31A 3V3RA 2R9XA 4R4SA 5F69A 3TRCA 1Y4OA 5CRFA 1Z2CB 4E3NA 2A24B 1BT5A 2HDQA 4D2OA 3ZNYA 5FSRA 4OPZA 2ZJ9A 2V8CA 2W8SA 4J8XB 4Y3IA 3RELD 3IHAA 4FSFA 4RYEA 4ZDXA 4Y15A 2ZC7A 3D4FA 1S67L 5B40A 1GA0A 2OSUA 4E04A 1XX2A 1TZYC 5CPJA 4QLCC 1F98A 4PM8A 5BT1D 5HWTA 1U35A 1ALQA 1BH9A 2Y55A 3SW1A 3OPLA 3PAEA 1NRFA 2HZ5A 3UO9A 3S7NA 1BLHA 4HGAB 4WU9B 4CSRA 4KHAB 1H8PA 2HV1A 3BFCA 3NQJB 1FSYA 1KGFA 1SKFA 1YU2A 3W99C 5M18A 1K54C 2ZD8A 5HDDA 1P3AC 2XK1A 4JJNA 1AWIA 3CZDA 3AZMA 3MGRC 1BZAA 1NXYA 1D1JA 3B6FC 3CITA 2L1MA 3LELA 5GHZA 1DRMA 1P3FC 3LJAA 4HMEA 3GDIA 5HPIA 1SDNA 4H9QA 2WYXA 2JC7A 1E3UD 1V9ZA 3BY8A 3LIFA 5TJJA 4FH2A 3G2ZA 3HLDA 5CTNA 3OBFA 1F5MA 4CLCE 5HD5A 2QJ5A 1X0OA 3PTEA 4H9RA 4G92C 2A3UA 1MWRA 4QD4A 3LZ0C 2XA7M 1TZYD 4M3KA 5JRGC 3MVDD 4QLCD 3MGSB 4GH9A 3MS6A 1P3KB 1P3PC 3UDXA 2BYKB 2Y2KA 2EWWA 4LRXC 1KX5D 4K91A 2PR5A 3B6GB 3BEBA 2VK3A 1FOFA 3FV7A 5EVIB 3R7WB 1S0WA 4BL3A 1P3IC 4IBBA 4R1GA 5CPKA 3W99D 4X23D 1P3AD 1XJ3A 3OOVA 3Q7VB 1YU0A 2O9AA 3BFGA 4I3JA 2O99A 4HJ3A 3LIAA 4OLGA 1S1YA 3IF5A 3AGFA 3B6FD 5B2JC 3O3VA 4H9OA 5BS7A 3MGQB 3C1BB 4QB8A 3ZQ5A 3FKEA 2J7VA 3VH6T 2EFXA 4R70A 3IWIA 3AN2C 4KZBA 1DJCA 3FYZA 5F99C 2EX8A 5B1LC 2V20A 5FQKA 3LZ1A 2V0WA 2AROA 2C6WB 4AWLB 4UA7A 5AV9B 3WAAB 1F1EA 2XSSA 2ZY3A 4IBDA 3F6TA 3MGPB 2BYMA 1FILA 5B0YD 3HSHA 5JRGD 4I39A 2CV5C 3AZNB 1P3PD 3AZGC 3R4KA 1MC0A 3UTBC 2QPNA 5DNMD 4X25A 5GLAA 1KVLA 2WK0A 3IBJA 1P3ID 2VKSA 4H8RA 3BRMA 1HQ3B 5E2HA 1V9YA 2XRNA 5B0ZB 3MQLA 3HLWA 3UT9A 5AVBA 3REIA 3MXRA 4XUJD 4NYYA 3MZEA 5GXQD 5B2JD 5HWVA 1M19A 1LLBA 1E6RA 4WEKA 3WKJB 3CPTB 4QY6A 5EM0A 4NKPA 3AN2D 3IH9A 3IWQA 3FPVA 3P5JB 1CEGA 3TU4A 1M6KA 5GT3D 4I3IA 1KS0A 5B1LD 1AXBA 5EOEA 3MMHA 5AY8A 3LUQA 4WLAA 4R8PA 3FZCA 5CEBA 5BNXB 4LLOB 3REHC 4NE6A 4OPYA 5CP6C 3PBSA 2RVQC 2BG1A 3UTBD 3AV1B 2H0YA 1GSXA 3W97A 4ZAMA 1T1BA 5CPIC 1Z6FA 4OPQA 1TD5A 4BBVA 3T4TA 3H9WA 4KZ6A 4XXRA 1B6WA 1T18A 3W8KA 3EPLA 1N9BA 2FJ7D 2QJ7A 3CLOA 5FAQA 3PBOA 1KX4B 1IYPA 4OJ6A 1P3LC 4KGCB 3X1VA 4KQQA 1CEFA 3K2NA 1P3GB 1P3BB 3AZKB 1MKMA 5FASA 2QHKA 1JFIB 3HUNA 4OH0A 1AOIA 3KS8A 3VP3A 4S2NA 1NZUA 2OLVA 1LSXA 1YAXA 2VGLM 1VHMA 5GSUB 3ZNTA 4X53A 5EPHA 3BLSA 5B32A 1HTAA 4GOGA 3EEAA 3OLOA 2KOIA 4JGQA 4OUIA 4HJ6A 2K31A 4X1MA 5TBMA 4DKIA 4E3OA 3REHD 3WWXA 3A6NB 5CP6D 2RVQD 1YSPA 4J8WA 1ERQA 2WUQA 4K0WA 2NUTC 2CWEA 3F1OB 3E2LA 5E5AB 1G6AA 5U47A 2H28A 3UTAA 3ZG7B 4XZQB 5AV6C 2EA9A 1VM1A 1W1YA 2Y2QA 1MBLA 4MBKA 5AV8C 1K38A 1S1ZA 2Q9MA 1GCEA 2P9VB 2OV5A 5A93A 4J8XA 1S4RA 4UHUA 4WN5A 1N9NA 1GHPA 4XT2B 4S2IA 4YFMA 3PAGA 1P3LD 5FUGB 3AZJA 5LBRA 1FSWA 1KX3B 4DE2A 1CJFA 1A0KA 1MWUA 4NK3A 3M2KA 1PRQA 1XA1A 5TGFA 1P3OB 3GSGA 2Y2GA 4CLCC 1FCNA 3EGXC 2B02A 3HUMA 1UGUA 1CQAA 1EROA 2Z6CA 5BNVA 4ZJ2A 3S22A 2YFVB 4K08A 5FQIA 3VP2A 4KHAA 4P87A 1IEMA 3NQJA 2EXAA 5HL6A 3O5YA 1OTIA 4GHLA 4HMDA 1LL9A 4LG2A 3A3IA 2PBYA 1YU3A 1GOIA 1W8QA 3OPPA 3AZFB 3KXBC 4MBHA 2P04A 3ZVWA 3L29A 4EEUA 2OWJA 1OTDA 3IX4A 3LIBA 5AV6D 2XLNA 5B1MB 3Q7ZA 5B24B 3AZEC 3WD4A 4MN6A 5AV8D 3M7PA 4Z2JA 4LCMA 2XDMA 5DNNB 1EQZB 4X69A 3UB6A 3VH5A 1FQGA 1J3WA 1OMEA 1BH8B 3E4OA 1O7EA 3WRZA 3JVUA 3NI9A 5A91A 4GHIB 1L6JA 1KE0A 5B2IA 2G2UA 2ZQAA 4Q8IA 3WA9C 2BYKA 2XD1A 5AVCB 5HD3A 4G91C 3P09A 1JTGA 3UE0A 3B6GA 3D9YA 5AV5D 4Z2MG 5EVIA 4ZBJC 3R7WA 1E88A 5DTTA 5IT5A 1BSGA 4Z2KA 3X1TB 3OCNA 3AV2B 1VETB 2LB5A 2NZDC 3Q7VA 1PYYA 3VP4A 2Y2OA 4BWIA 3KUYB 5FAOA 3T4KA 4S2LA 4KUDA 4N9KA 2VA0A 4H9SC 3REKA 3IBRA 3KSHA 3MGQA 4S2MA 1W8YA 3C1BA 3LI8A 1S32C 5FDHA 3AFAD 3AZED 5I5LA 2F8NA 1TS0A 5J7EA 4E6XA 3QP5A 5B31C 4IUHA 2XEPA 1P3MD 3EWKA 1G68A 5HPFA 1DJAA 3S7PA 3UNWA 3MGPA 2Y2IA 3U2AA 2XFTA 2PYRA 5HDCA 3AZNA 1YSQA 3W96D 5JYOA 5DKKA 1TS7A 4OQGA 1K56D 3JPUA 1UR8A 5B40C 1OPXA 4R4RA 1YLPA 5CPJC 3IF6A 3VFFA 1U35C 1HQ3A 2Y2NA 4JF6A 2NZDD 5G4ZA 2ZQDA 3TSGA 2VQRA 4DRAA 3B47A 3QP2A 3WTPD 2XH9A 4IEDA 4Z2IA 4QPRA 3G2YA 3G31A 1S32D 4NEED 2A2LA 4J8VA 3H82A 5MC7A 2HUEC 4JJNC 1K6RA 1N9LA 2GNXA 3AZMC 5B31D 4EO5C 1YUEA 1IFQA 4KG5A 2WKRA 3RH8B 3LELC 4MBFA 4ZTKA 2ZOIA 4Z66D 5BNXA 3LJAC 3HLBA 3AYWA 1YLYA 3NDGA 4HP4A 2HIOD 1N9OA 3E4PA 3T4QA 3P7NA 3K3DA 3MNND 3H0RC 1K55A 4H9PB 5B40D 4M6BA 3IH8A 3V3SA 5CX7A 4WU8A 4FTXA 3MJQA 5HW3A 2OAQ1 1H0GA 3WD0A 4NZ4A 1NJ4A 1E25A 3RELB 2QKPA 5E2EA 3SS3A 4KGCA 4AFIA 1P3BA 5CPKC 2F8NK 3CI6A 3KSYA 3Q07A 4XUXA 5TR7A 1IKGA 4WV4B 2QWSA 4WZSB 2BLSA 2UWXA 3N8LA 3AZMD 5GSUA 1RGZA 3DTMA 5BS7C 3ITAA 3SS5A 4B9OA 1K4FA 3NHQA 4KG6A 1B67A 4JXGA 3OC2A 4JXSA 3LJAD 1Q2PA 2ZLYA 3DW0A 5GLCA 2F8NH 3X1UA 4L9GA 3NOTC 2Y8HA 3NECA 4YS3A 3LZ1C 4KG2A 2AROC 2Z2MB 3JVVA 4Z5TA 3QNCA 5E5AA 4BJPA 4EW7A 3T1SA 4OP8A 1E6ZA 4ZBEA 4YM6B 5CTMA 3WS2A 3BFFA 1GPFA 2NQBA 3C5AA 3VH6A 1ZG6A 1YKDA 2P9VA 4JPMA 1M40A 5FUGA 5FAPA 1R4VA 2HPBA 2KLIA 1KX3A 4QY5A 5CPKD 4PHTA 3HREA 2PAVP 5DKLA 1TAFB 5B33A 2OWHA 1OJGA 3UT9C 1TZYB 5AVBC 4OLDA 5EVLA 3MVDB 4QLCB 3REIC 3KSGA 1MWSA 3AZLD 3UE1A 2ZY5A 4KZ8A 5KSCA 2H0TA 2W27A 4DJ2A 1PZPA 5I94A 2O0YA 1KX5B 2VX8A 2YFVA 2P7JA 3P98A 1M19C 2INWA 1KE3A 4ZRRA 2CC1A 5FQQA 2XD5A 3W4PA 1MZUA 1SDEA 3TU4C 1M1AD 3HVFA 5F83A 4QHCA 1YPRA 4X23B 1ES4A 3FPWA 1P3AB 2JN7A 3ZCZA 3LZ1D 3MFDA 2AROD 3AZFA 5AY8C 1ZLAB 2PYOD 4R8PC 4H6JA 5M1AA 4CAYB 1LHYA 3VH6W 3KWQD 4KQRA 4PAUA 5B1MA 3G6OA 2HF6A 4NYUA 3NOUC 5B24A 1M18D 2X02A 1VB6A 1EQZA 4KQOA 2QZ6A 3IS2B 1XP4A 3W97C 1NYMA 3VOYA 2V2FF 4HBUA 3KSIA 4WZ4A 3HLGA 4G92B 2LB9A 5B0YB 3UT9D 5AVBD 2VGKA 3A1IA 5JRGB 3REID 3IXBA 4IBKA 1P3PB 3O86A 5E2GA 1GA9A 3X1VC 3BQAA 3X1SA 1BFMA 3LR3A 1M19D 5DNMB 4Z2LA 1OT6A 3HLFA 1YM1A 1AOIC 3Q82A 4S2NC 1Q9CA 3X1TA 2Z2LB 3C38A 3FKVA 1P3IB 1VETA 1JWVA 3B0BA 1QMFA 2I9VA 3U4LP 1YLJA 5B32C 3GRJA 1XPBA 2RTSA 3KX0X 5AY8D 3KUYA 4J8UA 2I72A 4OOLA 4WMCA 4LV2A 4R8PD 1H0IA 4XUJB 5GXQB 3D72A 5B2JB 3OPRA 1GSVA 1IELA 2WGVA 3HCYA 5DF9A 1G28A 4JGRA 3IX8A 3ZG0A 1RCJA 2CMNA 4J8WC 5G49B 3N3FA 2J9OA 5GT3B 3UE3A 1XA7A 4B93A 5B1LB 4ARZB 3UTAC 3W2ZA 1ED7A 4OP5A 4MEZA 4OJOA 4NZ1A 1SCWA 4EV4A 5CGSA 4DF6A 5BO0B 4WYYA 4J8XC 4Y0TA 3W4QA 4Z1WA 4Y0UA 3W4OA 3AZJC 3X1VD 2ZOHA 3B3XA 1T19A 3M6HA 3UTBB 3REJB 3ZFZA 3CMZA 5EOOA 2BTFP 3AZHA 4RQ9A 1L0DA 2FN2A 5GT0A 5GHXA 2HGVA 2IA2A 4R3AA 4WJ3C 4MN7A 5B32D 4UAAA 3T1RA 1EI5A 3MGRD 2G5HC 3L26A 2FJ7B 3HUOA 4IVIA 5CGWA 1HD8A 5FA7A 5DF8A 4HJ4A 4MB4A 1P3FD 3DWKA 2IWCA 1Y54A 4CPKA 4N1XA 3IP4C 1YMSA 3EOIA 1KOUA 2ZM5A 1DP8A 4YINA 3AGEA 4OPRA 3UTAD 1CI9A 4PMAA 3WS1A 3LZ0D 4DJ3A 4ZUXB 4R6LA 3EGDC 2D49A 1XGIA 5HZHA 3REHB 5AJGA 1KDWA 4Y5FA 5F82A 1P34B 4UA9A 3B0CT 1L3LA 5CP6B 3AZJD 4LD9A 3TE8A 5GHYA 4H9PA 1BLPA 3L7HA 4WUJA 5IU1A 5B2IC 2VZWA 1ID3A 4B88A 3BQ8A 3C30A 3B6GC 3L25A 4LRYC 4O8GA 3RELA 5EVIC 2IO5C 5JA4A 3HJIA 1P3LB 4G3KA 3MZFA 2J8PA 3FWLA 5L2FA 5DFXA 5GLBA 3S7OA 1XFQA 4C75A 3T1QB 5DVAA 2BASA 3F1PB 5F99D 1GHMA 1Q2QA 5CHMA 4KUDC 4NY2A 5CGXA 5AVFA 5C3IC 3REKC 3MGQC 1W1PA 3C1BC 2HP9A 2X01A 4JKTA 4Y0OA 1XKZA 1LI9A 1G6OA 3UPPA 1BLSA 1BUEA 3LFVA 2CV5D 3PYPA 4OVDA 1PFLA 3AZGD 3G32A 4KZ5A 1NYYA 3LCEA 4CJNA 4AWLC 3MGPC 1IYQA 2WKIA 3O62A 3KYZA 3ZG5A 4YM6A 4KENB 5HAIA 5B2ID 1HVBA 1XJ6A 3AZNC 4RVAA 2Y79A 1T3UA 5AV8B 4C3QA 2Y2LA 2VV8A 4OQHA 4O0PA 3KYEA 4BL2A 4WZ5A 1LSWA 1N1JA 4GS9A 1JWZA 5EVID 5FQ9A 3IF6C 5L07A 1DP6A 2W1TB 2V9AA 3FC7A 1PZOA 1IOUA 4KZ4A 3MVDA 2XA7S 3ZVTA 4KUDD 1G5UA 2ZM8A 4JGPA 3A3DA 3VSLA 3ZDJA 3REKD 3IHBA 3MGQD 1KX5A 3C1BD 3HJKA 1I2WA 5AV5B 4BD1A 4J8VC 3N6IA 4DXBA 2J80A 2F8ND 1OJ5A 3LR0A 2Y91A 3E4QA 4X23A 4Y17A 5A8BA 4F3LA 1H8ZA 1O6IA 1ZLAA 3W98B 1GXDA 3MGPD 5HWWA 5FDSA 4EUZA 4OOMA 5CPID 3ITBA 1L0FA 3AYWC 2A24A 4EQ1A 1LI0A 2WKHA 3H7WB 3CG5A 3A0RA 2DCFA 3AFAB 3AZEB 4LGWA 5F5YA 1W1VA 1K55C 4E3KA 3IS2A 1P3MB 4GCZA 2W3EA 4L9FA 2B18A 4WU8C 4L0LA 3FKWA 1TEMA 2RCXA 4HBTA 3VOLA 5B0YA 2EWVA 3NQUB 1VEUB 4P85A 3SH7A 4E3MA 5FL3A 4KGCC 1ONHA 2X71A 3W96B 4WU9A 1PI5A 1P3BC 5DNMA 1FR6A 1NLYA 4J8VD 1TDLA 1ZG4A 4ZBJB 4GN2A 3UB9A 3BECA 3MQOA 5GSUC 3E0YA 3QP8A 4MNRA 4P0MA 3C4OA 4UQIM 2ZC3B 4IBXA 3BW6A 4XUJA 5GXQA 4OQIA 3C1CB 3WTPB 4EESA 3AYWD 2B5RA 4EEPA 3X1UC 3IXDA 3IXHA 5CECA 4YS3C 4O7DA 5L09A 3AZIB 4DN0A 5F68A 4Z5TC 5J4EA 1K6SA 5E5AC 5GT3A 5B31B 1ES5A 4ARZA 3H0LC 1YU4A 5AVEA 4GKUA 4WU8D 4Z66B 4NE3A 5TFQA 2NQBC 3MGSA 4CLCD 1P3KA 4UEYA 3UDFA 3WD2A 2Q9NA 3HLEA 1GSWA 3DAVA 5FEFA 5A90A 3NDEA 2HIOB 2JKRI 1KX3C 3REJA 2R78A 3LIDA 5BPVA 3MNNB 3IQAA 4PM6A 4DMZA 5B33C 2Y2PA 5B40B 3UMDA 2JBFA 3EPJA 2HJEA 1BH9B 1LL5A 3KXBD 4EQIA 3F1NB 4S2JA 4MCWA 3CAXA 2FJ7A 1E4DA 1DP9A 2QYBA 1FCMA 1PZRA 1F66B 3SZTA 1NWZA 3X1UD 5GLDA 3QP4A 4YS3D 4LCLA 1LL8A 2Y2HA 3AZFC 2JKTM 2V1AA 3MZDA 1PDCA 4Z5TD 3VOZA 3AZMB 4OQ0A 4BENA 3MQ0A 2FFYA 5AV9A 3WAAA 2VGLS 3V67A 2H5SA 5KIZA 3O87A 5B1MC 5DF7A 1KGEA 5IHVA 3WD1A 5B24C 4ZUXA 2NQBD 4R3BA 4RA7A 4GLQA 3LJAB 3WA9D 2XF3A 1TS8A 1EQZC 1P34A 4GB7A 3ULFA 4U0TA 4R0QA 3LY4A 3UB8A 1FCOA 5FQJA 4ETZA 1WE4A 3PHYA 5B33D 3BWLA 4KQDA 2JSSA 3MKEA 5B0ZA 2ZL1B 5J8XA 2PR6A 4OOYA 3X1SC 3BYDA 2VGJA 3FDDA 5CHLB 3QHYA 4II7A 4HIAA 3WKJA 3X1TC 3L27A 3CPTA 5CPKB 2UV0E 4DRTA 1PWDA 4UA6A 4H9NB 3F1PA 2MJ6A 1P0ZA 2PBDP 5FQMA 5HDSA 4J8UC 3KUYC 2Y59A 3AZLB 4S2KA 1T1CA 2J9PA 2EFUA 1MKIA 3LICA 5F1GA 1TDGA 4FCFA 4G3VA 3UE6A 1S6RA 2W3DA 5GL9A 3JYIA 4N1HA 3WD3A 2L4RA 3SH8A 2ZC4B 3H0MC 1M1AB 3TJZC 3T50A 2H10A 3AV1A 1HZOA 3LZ1B 4S2OA 5HX9A 2PYOB 4A5RA 4DE3A 5CPJD 3KWQB 1U35D 3M2JA 1YLWA 3WX7A 1M18B 1KX4A 3X1SD 1ERMA 2HDSA 5EECA 4WNNB 3AZHC 1P3GA 3AZKA 2J8YA 5GT0C 1H3OB 1JFIA 3X1TD 2ZY4A 4NG2A 2R9WA 4RX2A 4Z2MH 3CUEA 2W1TA 4L9EA 4JJND 3RJUA 3G30A 1K57A 4HHDA 1BLCA 4J8UD 3M6BA 3UT9B 5AVBB 4Y2FA 5KMWA 3REIB 2ZC5B 2JHEA 4ME4A 2WKPA 3LELD 5F1FA 3UN7A 5FEGA 1LSVA 4HY8A 3LO7A 5AV5A 3NC8A 4UUZB 1QMEA 4HMCA 2EX6A 3A6NA 3VE4A 1TS6A 2V1ZA 4Z9QA 3A3EA 4E6WA 1IKIA 2XQZA 3F1OA 2JKTI 5A92A 3W98A 5AY8B 4Y7PA 4XZQA 3ISGA 2AVXA 2WKQA 4FOFA 1O07A 3IT9A 3H7WA 4QU3A 3AFAA 4HH3A 2D01A 5L8MA 4LD9C 1J9MA 4XT2A 2ACGA 2ZQCA 2OLUA 1P3MA 3AZHD 3RXWA 4IBGA 3PBNA 5GT0D 1ACFA 1P9WA 1ID3C 2DRWA 2EXBA 1P3OA 3C7UA 4HI4A 3N7WA 1AIWA 1WA9A 4HP9A 2W3GA 4FD8A 3RELC 1VEUA 4IBRA 1XXMA 1MY8A 3GECA 3W96A 2E8JA 5DTKA 2L0WA 1PIOA 2O9BA 3G34A 1K56A 3W99B 1SZVA 3CJMA 2DF4C 3E98A 1PI4A 3V39A 1OT9A 3HL9A 3MGRB 4GHAA 3ZG8B 3B6FB 3SS4A 4BLMA 3C1CA 3WTPA 4S2PA 4KZ7A 4WELA 3ZG9B 4OJ5A 1P3FB 5B31G 3AZIA 4LD9D 3RFBA 5DNNA 2PD8A 3V9RB 4KZ9A 3TOIA 2HDRA 3O62C 1MPLA 1BH8A 3UTAB 1P9RA 3G4PA 4YM6C 4P6ZS 5FI2A 2ZQ7A 1ID3D 4GD6A 1VQQA 4Z66A 2ZBBA 4GHIA 3LZ0B 3CHWP 5EV0A 1XJ2A 4WBGA 5AVCA 3MSHA 4GDBA 4X6TA 3A3FA 3PR6A 3B0CW 3T4JA 4LFUA 4WZ5C 4O01A 4IBCA 2ZMVA 2HIOA 1H8MA 3AZJB 1H8YA 3EQUA 3NOPC 5AQ9A 3MNNA 2A49A 4E45A 4LRZE 3PBQA 4NXEA 3AV2A 3LY3A 3TU4D 3KFUG 3S4XA 3MVDC 3ZHHA 4DRBA 2PD7A 2Y2MA 3F1NA 1KX5C 3C4PA 5BNVB 2Y4AA 2OAP1 1H3QA 1ES2A 3QNBA 1WYCA 1PWGA 2HP5A 3G35A 5FI6A 1F66A 4D60A 4X23C 4Z2HA 1XFNA 3AN2B 2L5AA 3B0DC 2ZQ9A 5F99B 1ZLAC 1PW1A 2WGWB 1U60A 3W97D 1DJBA 3O62D 2WAEA 4EBPA 5BOHA 3RTYA 2YFWB 2D02A 3HLCA 4MLLA 1CK7A 4LENA 1DY6A 4YM6D 1ZHHB 5EE8A 4NXFA 3RXXA 4OJPA 2K7SA 2CV5B 4DDSA 3AZGB 4GD8A 4Q0JA 4G3WA 4IBJA 1MXOA 4B4ZA 1ZTUA 1AOID 2G2WA 4IJGA 4X68A 5B0YC 4MB5A 2QMIA 5B2IB 4NFTA 2ZL1A 2B95A 1PW8A 4Y13A 4HGAC 2VEAA 4WU9C 5DNMC 1E6NA 4BQMA 3DWZA 2V8FA 3NCKA 2KDKA 2WKEA 4OKPA 2IO5B 3MF0A 3DTIA 3MQQA 2ZMAA 4J8WD 4H9NA 4JXVA 4LV1A 1S4SA 5G18A 5KDMB 2EX9A 3DTKA 4HOIA 1ZLAD 5AQAA 4NXGA 3AZLA 2ZY2A 3MBZA 4HEFA 4XUJC 4KUDB 5GXQC 4MB3A 5CEDA 3OCLA 5C3IB 3REKB 3TW8A 3KSFA 1I5QA 1W5DA 2W0NA 1KE4A 5C5KA 3VE3A 1L0EA 3BJNA 4J8XD 4WF0A 3MFXA 2F8NB 1M1AA 5GT3C 4B4XA 1YMXA 2PDRA 3L28A 3LR5A 2PYOA 5DFYA 3MGSC 3KWQA 5CPIB 1P3KC 1K25A 4QNLA 1TVFA 2GX5A 3KYQA 1S66L 4C6YA 2JE5A 1M18A 2P74A 3OPHA 4MDZA 3B42A 4R23A 4WU9D 3REJC 2EX2A 5FI7A 2WZXA 3R45B 4WNNA 2PU2A 3GQZA 4GNUA 1H3OA 3WS4A 4XUZA 3VP0A 1JWPA 3D3OA 3IF6B 5EUAA 3T4SA 3EPKA 3WTPE 1FR1A 3UPOA 1JTDA 2FJ7C 4QJGA 4N92A 1ESUA 2XFSA 5D3OA 3UB5P 1W63M 3GR2A 4UUZA 4J8VB 3H82B 4HH2A 3T4LA 3UPNA 5DJUA 3S1YA 1OTAA 4IJFA 3ZYTA 2ZQ8A 3WAAC 5AV9C 1HTZA 4NZ5A 4LPZA 1BULA 4EBNA 3VFHA 2E8IA 3B33A 4ZUXC 2DNSA 3MGSD 1XGJA 2PT7A 5AV6B 1P3KD 2PU4A 3AYWB 4I3AA 3LGOA 3T1XA 2JKRM 2FH5A 1P34C 1E3UA 3BLMA 3B6GD 4FUWA 4F94A 1ESIA 4CQHA 4Q0HA 3REJD 3S7QA 1STZA 4GZBA 4X1LA 5HSQA 3E2KA 2ZC6B 1HQ3C 5DTSA 1KVMA 1TAFA 2V1BA 3PXPA 5B0ZC 4WU8B 1YU1A 4HQAA 2XR0A 1TZYA 4ZJ3A 4QLCA 1MWTA 2HJ9C 4GDNA 4ESPA 4CLCB 4JGOA 2Y2JA 3AL0C 1UR9A 1IYSA 3WRTA 3LEZA 3UDIA 1NRJA 1P97A 3IXGA 1ZKJA 2M7UA 3WKJC 3DTEA 5K5BA 1NLZA 2YKHA 4KUKA 3W99A 1WWIA 1D06A 5B32G 1K54A 1P3AA 2G5IC 1IYOA 1W2EA 5AV9D 3WAAD 3KXBB 3MGRA 1YLZA 4CAYA 3B6FA 4DQYB 2GJ3A 4RX3A 1EWZA 2JKFA 4ZUXD 2WADA 3AZND 4DXCA 1P3FA 4JF5A 4PM5A 5CHUA 4DE0A 1P34D 3X1UB 3AV1C 1E8BA 2W3HA 2XROA 4TX8A 4YS3B 2GZAA 3V9RA 4I5SA 3VP1A 3N8SA 4Z5TB 2FFFB 4QWOA 2J3WA 3OZHA 1HQ3D 1EAKA 4X55A 1T1AA 5B0ZD 3LZ0A 4EERA 3TG9A 2XGNA 5JRGA 2NQBB 2WGIA 1KX4C 3LEQA 5E2FA 1P3PA 4IBFA 3WA9B 3ICYA 4LV3A 4G91B 2NUPC 4K0XA 2KX6A 1P3GC 3AZKC 3QP6A 3WKJD 3P01A 4E3JA 3CWFA 4IVKA 3O88A 1JNUA 5HAPA 3CUEC 4GJ4A 1P3IA 4YOFA 1K57C 4WL9A 5B33B 1RGYA 1ZC2A 2Q0OA 2NZDB 1OGBA 1SKOB 5HARA 4DE1A 1C3BA 3BFEA 5DJTA 5B2JA 2V0UA 5AV5C 2K2NA 1SHVA 2V5OA 3MXSA 3A6NC 1S32B 4BBUA 3AN2A 1ES3A 4YNRA 3A3JA 3AV1D 5G49A 1H5XA 3T12B 5F99A 1W7FA 2WGWA 3W98C 5B1LA 4N9LA 5FATA 4XZQC 3QP1A 4H6JB 4IHQA 2YFWA 5HL1A 1Z09A 5BO0A 4UPKA 5E43A 4EETB 3AFAC 1KX4D 3GTCA 2CV5A 4R3JA 4WM9A 3AZGA 4KGCD 3UTBA 1P3MC 1P3GD 1P3BD 3AZKD 5AQBA 1YLTA 1ODVA 1P3OC 5M19A 3BFDA 5CPJB 3V5MA 1EW0A 5GSUD 1NY0A 1U35B 3KS4A 4E44A 4I38A 4U0XA 1UWPX 3MXQA 5HFOA 3W96C 4EBLA 2FZ0A 4E3IA 2DMWA 3X1SB 3NJAA 5J3WA 1H0MA 1W63Q 4CSRB 4Q0IA 4E3LA 3BM6A 4ID4A 4P6BA 4ETXA 2HDUA 5IS1A 3A6ND 1KDSA 2VLGA 2RIQA 2HUEB 3A0VA 4JJNB 3ZGAB 5KDMA 2IWDA 5E5AD 1CK3A 2JKGA 3W98D 4J8UB 4EO5B 4EU0A 4KZ3A 4XZQD 3C1CC 3WTPC 1OTEA 3LELB 1PWCA 2Z6DA 4OONA 2F8NG 3MKFA 3UB7A 3WS5A 1BTLA 4X56A 3AZIC 3REHA 4H9QB 5DNNC 1OTBA 3VH5W 3SOIA 2ZM0A 3NY4A 5CP6A 1PNEA 3LR4A 1UWNX 5EFWA 1KX3D 1JVJA 4EXOA 1GHIA 3EG5B 2ZMFA 3GMWA 4H9RB 4Z66C 1P3OD 4WEJA 5CPIA 1K0KA 5AVCC 1WWSA 3A1KA 5CXWA 1I2SA 3NBLA 4MN5A 5KSHA 2G7UA 2HIOC 3EPHA 4BBTA 3R45A 3MNNC 1P3LA 2IOUA 4KUOA 5EM1A 3AZHB 3AV2C 1CF0A 1OGGA 2RL3A 5KZHA 5GT0B 4HNBA 4IJEA 3L9KA 1L0GA 3AZFD 3C2WA 1L2SA 4JBFA 4H9OB 2OOLA 3C1CD 3LYXA 3HONA 5B1MD 1F66C 5B24D 1W79A 2YKFA 3AZID 5EVEA 1BYWA 1K4EA 5DNND 1EQZD 3T4OA 2AROB 2W1RA 1F9IA 4JLFA 4P6ZM 4UQIS 2M1CA 1CXWA 2BYMB 2VJWA 2F2AC 5F6AA 4BMWA 5AV6A 5AVCD 3MR0A 2VV7A 5AV8A 4NZ3A 3UY6A 3EQVA 4PPRA 2LY8A 4PM9A 4LD9B 1J7MA 4U3TA 1ULYA 3AV2D 3GV9A 1N4OA 1W1TA 1WYBA 3AGDA 3GVBA 2PRFA 2PHYA 3LI9A 1ID3B 1Y28A 3N8RA 1YQSA 1YT4A 3KUYD 4IBIA 4CLCA 4WMCD 4NE5A 3C8CA
chains in the Genus database with same CATH topology
4IBEA 5CHJA 3NIAA 4LV0A 5JA4B 1M19B 1F66D 3V50A 1NZOA 4ZJ1A 3VMAA 3TU4B 3VH5T 3Q81A 2GDNA 3AZLC 3KXBA 1KU5A 4R8PB 4NETA 3N4IA 1M1AC 3AZEA 2WZZA 2JCHA 4KZAA 4OJLA 2PYOC 1KGGA 3W97B 3SH9A 3O62B 3KWQC 3VSKA 4FH4A 4EWFA 1M18C 2ZM2A 3NQUA 3WA9A 5AQ7A 5HAQA 3WS0A 3Q1FA 3PBTA 3X1VB 3I7JA 1N1JB 3HBRA 1AOIB 1A7WA 4DDYA 5BT1C 4HESA 2C5WB 2NZDA 5B32B 5JYPA 2WAFA 2HP6A 4H9SA 1CI8A 2DQNC 4BD0A 3L2AA 1ONGA 3IWOA 1S32A 2IWBA 4PM7A 4JF4A 4JXWA 1RP5A 5CERA 4J8WB 3B0DB 3PBRA 3C7VA 5B31A 3V3RA 2R9XA 4R4SA 5CRFA 1Z2CB 4E3NA 1BT5A 2HDQA 4D2OA 3ZNYA 5FSRA 4OPZA 2ZJ9A 2W8SA 4J8XB 3RELD 3IHAA 4FSFA 4RYEA 4ZDXA 2ZC7A 3D4FA 5B40A 1GA0A 2OSUA 1XX2A 1TZYC 5CPJA 4QLCC 4PM8A 5BT1D 1U35A 1ALQA 1BH9A 2Y55A 3OPLA 3PAEA 1NRFA 3UO9A 1BLHA 4HGAB 4WU9B 4CSRA 4KHAB 3BFCA 3NQJB 1FSYA 1KGFA 1SKFA 1YU2A 3W99C 5M18A 1K54C 2ZD8A 1P3AC 2XK1A 4JJNA 3CZDA 3AZMA 3MGRC 1BZAA 1NXYA 3B6FC 3LELA 5GHZA 1P3FC 3LJAA 1SDNA 4H9QA 2WYXA 2JC7A 1E3UD 4FH2A 3G2ZA 3HLDA 5CTNA 3PTEA 4H9RA 4G92C 2A3UA 1MWRA 4QD4A 3LZ0C 1TZYD 4M3KA 5JRGC 3MVDD 4QLCD 3MGSB 4GH9A 1P3KB 1P3PC 3UDXA 2BYKB 2Y2KA 1KX5D 4K91A 3B6GB 3BEBA 1FOFA 3FV7A 5EVIB 1S0WA 4BL3A 1P3IC 4IBBA 4R1GA 5CPKA 3W99D 4X23D 1P3AD 3Q7VB 1YU0A 3BFGA 4OLGA 3IF5A 3AGFA 3B6FD 5B2JC 3O3VA 4H9OA 5BS7A 3MGQB 3C1BB 4QB8A 3FKEA 2J7VA 3VH6T 2EFXA 3IWIA 3AN2C 4KZBA 1DJCA 3FYZA 5F99C 2EX8A 5B1LC 2V20A 5FQKA 3LZ1A 2AROA 2C6WB 4AWLB 4UA7A 5AV9B 3WAAB 1F1EA 2ZY3A 4IBDA 3F6TA 3MGPB 2BYMA 5B0YD 3HSHA 5JRGD 2CV5C 3AZNB 1P3PD 3AZGC 3UTBC 2QPNA 5DNMD 5GLAA 1KVLA 2WK0A 1P3ID 4H8RA 3BRMA 1HQ3B 5E2HA 5B0ZB 3HLWA 3UT9A 5AVBA 3REIA 3MXRA 4XUJD 4NYYA 3MZEA 5GXQD 5B2JD 1M19A 1LLBA 4WEKA 3WKJB 4QY6A 3AN2D 3IH9A 3IWQA 3P5JB 1CEGA 3TU4A 1M6KA 5GT3D 5B1LD 1AXBA 5EOEA 5AY8A 4R8PA 3FZCA 5CEBA 5BNXB 3REHC 4NE6A 4OPYA 5CP6C 3PBSA 2RVQC 2BG1A 3UTBD 3AV1B 2H0YA 3W97A 4ZAMA 5CPIC 1Z6FA 4OPQA 4KZ6A 4XXRA 1B6WA 3W8KA 3EPLA 1N9BA 2FJ7D 5FAQA 3PBOA 1KX4B 1IYPA 4OJ6A 1P3LC 4KGCB 3X1VA 4KQQA 1CEFA 1P3GB 1P3BB 3AZKB 5FASA 1JFIB 3HUNA 4OH0A 1AOIA 3KS8A 3VP3A 4S2NA 1NZUA 2OLVA 3ZNTA 5GSUB 4X53A 5EPHA 3BLSA 5B32A 1HTAA 4GOGA 4OUIA 4DKIA 4E3OA 3REHD 3WWXA 3A6NB 5CP6D 2RVQD 4J8WA 1ERQA 2WUQA 4K0WA 2CWEA 3E2LA 5E5AB 1G6AA 5U47A 3UTAA 3ZG7B 4XZQB 5AV6C 1VM1A 2Y2QA 1MBLA 4MBKA 5AV8C 1K38A 2Q9MA 1GCEA 2P9VB 2OV5A 5A93A 4J8XA 4UHUA 1GHPA 4S2IA 4YFMA 3PAGA 1P3LD 5FUGB 3AZJA 1FSWA 1KX3B 4DE2A 1MWUA 4NK3A 3M2KA 1XA1A 5TGFA 1P3OB 3GSGA 2Y2GA 1FCNA 3HUMA 1EROA 5BNVA 4ZJ2A 3S22A 2YFVB 5FQIA 3VP2A 4KHAA 4P87A 1IEMA 3NQJA 2EXAA 4GHLA 1LL9A 4LG2A 3A3IA 2PBYA 1YU3A 1W8QA 3OPPA 3AZFB 3KXBC 4MBHA 3ZVWA 3L29A 5AV6D 2XLNA 5B1MB 3Q7ZA 5B24B 3AZEC 5AV8D 4LCMA 2XDMA 5DNNB 1EQZB 4X69A 3VH5A 1FQGA 1OMEA 1BH8B 1O7EA 3WRZA 3NI9A 5A91A 1KE0A 5B2IA 2G2UA 2ZQAA 4Q8IA 3WA9C 2BYKA 2XD1A 5AVCB 4G91C 3P09A 1JTGA 3UE0A 3B6GA 5AV5D 4Z2MG 5EVIA 4ZBJC 5DTTA 1BSGA 3X1TB 3OCNA 3AV2B 2NZDC 3Q7VA 1PYYA 3VP4A 2Y2OA 3KUYB 5FAOA 4S2LA 4KUDA 4N9KA 4H9SC 3REKA 4S2MA 3MGQA 1W8YA 3C1BA 1S32C 5FDHA 3AFAD 3AZED 2F8NA 4E6XA 5B31C 2XEPA 1P3MD 1G68A 1DJAA 3UNWA 3MGPA 2Y2IA 2XFTA 3AZNA 3W96D 5JYOA 4OQGA 1K56D 5B40C 4R4RA 1YLPA 5CPJC 3IF6A 3VFFA 1U35C 1HQ3A 2Y2NA 4JF6A 2NZDD 2ZQDA 3TSGA 2VQRA 4DRAA 3WTPD 2XH9A 4IEDA 3G2YA 3G31A 1S32D 4J8VA 2HUEC 4JJNC 1K6RA 3AZMC 5B31D 4EO5C 1YUEA 4KG5A 3LELC 4MBFA 4ZTKA 4Z66D 5BNXA 3LJAC 3HLBA 3AYWA 1YLYA 3NDGA 2HIOD 3MNND 3H0RC 1K55A 4H9PB 5B40D 4M6BA 3IH8A 3V3SA 4WU8A 5HW3A 4NZ4A 1NJ4A 1E25A 3RELB 5E2EA 3SS3A 4KGCA 1P3BA 5CPKC 2F8NK 3KSYA 3Q07A 4XUXA 5TR7A 1IKGA 4WV4B 4WZSB 2BLSA 2UWXA 3N8LA 3AZMD 5GSUA 1RGZA 3DTMA 5BS7C 3ITAA 3SS5A 1K4FA 4KG6A 1B67A 4JXGA 3OC2A 4JXSA 3LJAD 1Q2PA 2ZLYA 3DW0A 5GLCA 2F8NH 3X1UA 4YS3A 3LZ1C 4KG2A 2AROC 2Z2MB 4Z5TA 3QNCA 5E5AA 4BJPA 4OP8A 4ZBEA 4YM6B 5CTMA 3WS2A 3BFFA 2NQBA 3C5AA 3VH6A 1ZG6A 2P9VA 4JPMA 1M40A 5FUGA 5FAPA 1R4VA 2HPBA 1KX3A 4QY5A 5CPKD 3HREA 1TAFB 5B33A 3UT9C 1TZYB 5AVBC 4OLDA 5EVLA 3MVDB 4QLCB 3REIC 3UE1A 3AZLD 1MWSA 2ZY5A 4KZ8A 5KSCA 2H0TA 1PZPA 5I94A 1KX5B 2YFVA 3P98A 1M19C 1KE3A 2CC1A 5FQQA 2XD5A 3W4PA 1SDEA 3TU4C 1M1AD 3HVFA 5F83A 4QHCA 4X23B 1ES4A 1P3AB 3ZCZA 3LZ1D 3MFDA 2AROD 3AZFA 5AY8C 1ZLAB 2PYOD 4R8PC 5M1AA 4CAYB 1LHYA 3VH6W 3KWQD 4KQRA 5B1MA 4NYUA 5B24A 1M18D 2X02A 1EQZA 4KQOA 2QZ6A 1XP4A 3W97C 1NYMA 3VOYA 2V2FF 4HBUA 4WZ4A 3HLGA 4G92B 5B0YB 3UT9D 5AVBD 2VGKA 3A1IA 5JRGB 3REID 3IXBA 4IBKA 1P3PB 3O86A 5E2GA 1GA9A 3X1VC 3X1SA 1BFMA 1M19D 5DNMB 3HLFA 1YM1A 1AOIC 3Q82A 4S2NC 1Q9CA 3X1TA 2Z2LB 3FKVA 1P3IB 1JWVA 3B0BA 1QMFA 1YLJA 5B32C 3GRJA 1XPBA 5AY8D 3KUYA 4J8UA 2I72A 4OOLA 4WMCA 4LV2A 4R8PD 4XUJB 5GXQB 5B2JB 3OPRA 1IELA 2WGVA 5DF9A 3ZG0A 1RCJA 4J8WC 5G49B 3N3FA 2J9OA 5GT3B 3UE3A 1XA7A 5B1LB 3UTAC 4OP5A 4MEZA 4OJOA 4NZ1A 1SCWA 4EV4A 5CGSA 4DF6A 5BO0B 4WYYA 4J8XC 4Y0TA 3W4QA 4Y0UA 3W4OA 3AZJC 3X1VD 3B3XA 3M6HA 3UTBB 3REJB 3ZFZA 3CMZA 5EOOA 3AZHA 1L0DA 5GT0A 5GHXA 4WJ3C 5B32D 4UAAA 1EI5A 3MGRD 2G5HC 3L26A 2FJ7B 3HUOA 4IVIA 5CGWA 1HD8A 5FA7A 5DF8A 1P3FD 3DWKA 2IWCA 1Y54A 4CPKA 4N1XA 3IP4C 1YMSA 2ZM5A 4YINA 3AGEA 4OPRA 3UTAD 1CI9A 4PMAA 3WS1A 3LZ0D 4ZUXB 1XGIA 3REHB 1KDWA 5F82A 1P34B 4UA9A 3B0CT 5CP6B 3AZJD 4LD9A 5GHYA 4H9PA 1BLPA 5B2IC 1ID3A 4B88A 3B6GC 3L25A 3RELA 5EVIC 2IO5C 5JA4A 1P3LB 3MZFA 2J8PA 3FWLA 5L2FA 5GLBA 4C75A 5DVAA 5F99D 1GHMA 1Q2QA 5CHMA 4KUDC 4NY2A 5CGXA 5C3IC 3REKC 3MGQC 3C1BC 2HP9A 2X01A 4JKTA 4Y0OA 1XKZA 1LI9A 3UPPA 1BLSA 1BUEA 2CV5D 4OVDA 3AZGD 3G32A 4KZ5A 1NYYA 3LCEA 4CJNA 4AWLC 3MGPC 1IYQA 2WKIA 3O62A 3ZG5A 4YM6A 4KENB 5HAIA 5B2ID 1HVBA 3AZNC 4RVAA 1T3UA 5AV8B 4C3QA 2Y2LA 4OQHA 4BL2A 4WZ5A 5EVID 1N1JA 1JWZA 5FQ9A 3IF6C 1PZOA 4KZ4A 3MVDA 3ZVTA 4KUDD 2ZM8A 3A3DA 3VSLA 3ZDJA 3REKD 3IHBA 3MGQD 1KX5A 3C1BD 1I2WA 5AV5B 4BD1A 4J8VC 3N6IA 4DXBA 2F8ND 2Y91A 4X23A 1H8ZA 1ZLAA 3W98B 3MGPD 4EUZA 4OOMA 5CPID 3ITBA 1L0FA 3AYWC 1LI0A 2WKHA 3CG5A 2DCFA 3AFAB 3AZEB 1K55C 4E3KA 1P3MB 4WU8C 4L0LA 3FKWA 1TEMA 2RCXA 4HBTA 5B0YA 3NQUB 4P85A 3SH7A 4E3MA 4KGCC 1ONHA 2X71A 3W96B 4WU9A 1PI5A 1P3BC 5DNMA 1FR6A 4J8VD 1TDLA 1ZG4A 4ZBJB 4GN2A 3BECA 5GSUC 4MNRA 4P0MA 3C4OA 2ZC3B 4IBXA 4XUJA 5GXQA 4OQIA 3C1CB 3WTPB 3AYWD 2B5RA 3X1UC 3IXDA 3IXHA 5CECA 4YS3C 4O7DA 3AZIB 4Z5TC 1K6SA 5E5AC 5GT3A 5B31B 1ES5A 3H0LC 1YU4A 4GKUA 4WU8D 4Z66B 4NE3A 5TFQA 2NQBC 3MGSA 1P3KA 3UDFA 2Q9NA 3HLEA 5A90A 3NDEA 2HIOB 1KX3C 3REJA 5BPVA 3MNNB 3IQAA 4PM6A 5B33C 2Y2PA 5B40B 2JBFA 3EPJA 1BH9B 1LL5A 3KXBD 4EQIA 4S2JA 2FJ7A 1E4DA 1FCMA 1PZRA 1F66B 3X1UD 5GLDA 4YS3D 4LCLA 2Y2HA 3AZFC 3MZDA 4Z5TD 3VOZA 3AZMB 4OQ0A 4BENA 2FFYA 5AV9A 3WAAA 2H5SA 3O87A 5B1MC 5DF7A 1KGEA 5IHVA 5B24C 4ZUXA 2NQBD 4R3BA 4RA7A 3LJAB 3WA9D 2XF3A 1EQZC 1P34A 4GB7A 4U0TA 4R0QA 3LY4A 1FCOA 5FQJA 1WE4A 5B33D 2JSSA 3MKEA 5B0ZA 5J8XA 4OOYA 3X1SC 3BYDA 2VGJA 3FDDA 5CHLB 3QHYA 3WKJA 3X1TC 3L27A 5CPKB 4DRTA 1PWDA 4UA6A 4H9NB 5FQMA 4J8UC 3KUYC 2Y59A 3AZLB 4S2KA 2J9PA 2EFUA 1MKIA 5F1GA 1TDGA 4FCFA 1S6RA 5GL9A 3JYIA 4N1HA 3SH8A 2ZC4B 3H0MC 1M1AB 2H10A 3AV1A 1HZOA 3LZ1B 4S2OA 5HX9A 2PYOB 4A5RA 4DE3A 5CPJD 3KWQB 1U35D 3M2JA 1YLWA 3WX7A 1M18B 1KX4A 3X1SD 1ERMA 2HDSA 5EECA 4WNNB 3AZHC 1P3GA 3AZKA 2J8YA 5GT0C 1H3OB 1JFIA 3X1TD 2ZY4A 2R9WA 4RX2A 4Z2MH 4JJND 3RJUA 3G30A 1K57A 1BLCA 4J8UD 3M6BA 3UT9B 5AVBB 5KMWA 3REIB 2ZC5B 3LELD 5F1FA 3UN7A 3LO7A 5AV5A 3NC8A 4UUZB 1QMEA 2EX6A 3A6NA 2V1ZA 4Z9QA 3A3EA 4E6WA 1IKIA 2XQZA 5A92A 3W98A 5AY8B 4Y7PA 4XZQA 3ISGA 1O07A 3IT9A 4QU3A 3AFAA 4LD9C 1J9MA 2ZQCA 2OLUA 1P3MA 3AZHD 3RXWA 4IBGA 3PBNA 5GT0D 1ID3C 2DRWA 2EXBA 1P3OA 3C7UA 3N7WA 4FD8A 3RELC 4IBRA 1XXMA 1MY8A 3W96A 5DTKA 1PIOA 3G34A 1K56A 3W99B 3CJMA 2DF4C 1PI4A 3V39A 3HL9A 3MGRB 4GHAA 3ZG8B 3B6FB 3SS4A 4BLMA 3C1CA 3WTPA 4S2PA 4KZ7A 4WELA 3ZG9B 4OJ5A 1P3FB 5B31G 3AZIA 4LD9D 5DNNA 3V9RB 4KZ9A 3TOIA 2HDRA 3O62C 1MPLA 1BH8A 3UTAB 3G4PA 5FI2A 4YM6C 2ZQ7A 1ID3D 4GD6A 1VQQA 4Z66A 3LZ0B 4WBGA 5AVCA 4GDBA 4X6TA 3A3FA 3B0CW 4WZ5C 4IBCA 2HIOA 3AZJB 1H8YA 3EQUA 5AQ9A 3MNNA 2A49A 4E45A 3PBQA 3AV2A 3LY3A 3TU4D 3KFUG 3S4XA 3MVDC 3ZHHA 4DRBA 2Y2MA 1KX5C 3C4PA 5BNVB 2Y4AA 1ES2A 3QNBA 1WYCA 1PWGA 2HP5A 3G35A 5FI6A 1F66A 4X23C 3AN2B 2L5AA 3B0DC 2ZQ9A 5F99B 1ZLAC 1PW1A 2WGWB 1U60A 3W97D 1DJBA 3O62D 2WAEA 4EBPA 5BOHA 2YFWB 3HLCA 4MLLA 4LENA 1DY6A 4YM6D 5EE8A 3RXXA 4OJPA 2CV5B 4DDSA 3AZGB 4GD8A 4IBJA 1MXOA 4B4ZA 1AOID 2G2WA 4X68A 5B0YC 2QMIA 5B2IB 4NFTA 1PW8A 4HGAC 4WU9C 5DNMC 4BQMA 3DWZA 3NCKA 2WKEA 4OKPA 2IO5B 2ZMAA 4J8WD 4H9NA 4JXVA 4LV1A 5G18A 5KDMB 2EX9A 1ZLAD 5AQAA 3AZLA 2ZY2A 3MBZA 4HEFA 4XUJC 4KUDB 5GXQC 5CEDA 3OCLA 5C3IB 3REKB 1I5QA 1W5DA 1KE4A 1L0EA 4J8XD 2F8NB 1M1AA 5GT3C 4B4XA 1YMXA 3L28A 2PYOA 3MGSC 3KWQA 5CPIB 1P3KC 1K25A 4QNLA 1TVFA 4C6YA 2JE5A 1M18A 2P74A 3OPHA 4R23A 4WU9D 3REJC 2EX2A 5FI7A 2WZXA 3R45B 4WNNA 2PU2A 3GQZA 4GNUA 1H3OA 3WS4A 4XUZA 3VP0A 1JWPA 3IF6B 5EUAA 3EPKA 3WTPE 1FR1A 3UPOA 1JTDA 2FJ7C 4QJGA 4N92A 1ESUA 2XFSA 5D3OA 3GR2A 4UUZA 4J8VB 3UPNA 3S1YA 4IJFA 2ZQ8A 3WAAC 5AV9C 1HTZA 4NZ5A 1BULA 4EBNA 3VFHA 2E8IA 4ZUXC 2DNSA 3MGSD 1XGJA 5AV6B 1P3KD 2PU4A 3AYWB 1P34C 1E3UA 3BLMA 3B6GD 4F94A 1ESIA 3REJD 4GZBA 3E2KA 2ZC6B 1HQ3C 5DTSA 1KVMA 1TAFA 5B0ZC 4WU8B 1YU1A 2XR0A 1TZYA 4ZJ3A 4QLCA 1MWTA 4GDNA 2Y2JA 3AL0C 1IYSA 3WRTA 3LEZA 3UDIA 3IXGA 1ZKJA 3WKJC 3W99A 1WWIA 5B32G 1K54A 1P3AA 2G5IC 1IYOA 1W2EA 5AV9D 3WAAD 3KXBB 3MGRA 1YLZA 4CAYA 3B6FA 4DQYB 4RX3A 1EWZA 4ZUXD 2WADA 3AZND 4DXCA 1P3FA 4JF5A 4PM5A 5CHUA 4DE0A 1P34D 3X1UB 3AV1C 4YS3B 3V9RA 3VP1A 3N8SA 4Z5TB 2FFFB 3OZHA 1HQ3D 4X55A 5B0ZD 3LZ0A 3TG9A 2XGNA 5JRGA 2NQBB 2WGIA 1KX4C 5E2FA 1P3PA 4IBFA 3WA9B 4LV3A 4G91B 4K0XA 1P3GC 3AZKC 3WKJD 4E3JA 4IVKA 3O88A 5HAPA 1P3IA 1K57C 5B33B 1RGYA 1ZC2A 2NZDB 4DE1A 5HARA 1C3BA 3BFEA 5B2JA 5AV5C 1SHVA 3MXSA 3A6NC 1S32B 3AN2A 1ES3A 3A3JA 3AV1D 5G49A 1H5XA 5F99A 1W7FA 2WGWA 3W98C 5B1LA 4N9LA 5FATA 4XZQC 2YFWA 5HL1A 5BO0A 4UPKA 5E43A 3AFAC 1KX4D 3GTCA 2CV5A 4R3JA 4WM9A 3AZGA 4KGCD 3UTBA 1P3MC 1P3GD 1P3BD 3AZKD 5AQBA 1YLTA 1P3OC 5M19A 3BFDA 5CPJB 3V5MA 5GSUD 1NY0A 1U35B 3KS4A 4E44A 4U0XA 5HFOA 3W96C 4EBLA 4E3IA 3X1SB 4CSRB 4E3LA 3BM6A 4ID4A 4P6BA 2HDUA 3A6ND 1KDSA 2RIQA 2HUEB 4JJNB 3ZGAB 5KDMA 2IWDA 5E5AD 1CK3A 3W98D 4J8UB 4EO5B 4KZ3A 4XZQD 3C1CC 3WTPC 1PWCA 3LELB 4OONA 2F8NG 3MKFA 3WS5A 1BTLA 4X56A 3AZIC 3REHA 4H9QB 5DNNC 3VH5W 3SOIA 2ZM0A 3NY4A 5CP6A 1KX3D 1JVJA 1GHIA 3EG5B 3GMWA 4H9RB 4Z66C 1P3OD 4WEJA 5CPIA 5AVCC 1WWSA 3A1KA 5CXWA 1I2SA 3NBLA 5KSHA 2HIOC 3EPHA 3R45A 3MNNC 1P3LA 2IOUA 3AZHB 3AV2C 2RL3A 5KZHA 5GT0B 4IJEA 1L0GA 3AZFD 1L2SA 4JBFA 4H9OB 3C1CD 3HONA 5B1MD 1F66C 5B24D 1W79A 3AZID 1K4EA 5DNND 1EQZD 2AROB 4JLFA 2BYMB 2F2AC 5AV6A 5AVCD 5AV8A 4NZ3A 3UY6A 3EQVA 4PPRA 2LY8A 4PM9A 4LD9B 4U3TA 1ULYA 3AV2D 3GV9A 1N4OA 1WYBA 3AGDA 3GVBA 1ID3B 1YQSA 1YT4A 3KUYD 4IBIA 4WMCD 4NE5A 3N8RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HP5 A;  3G35 A;  3NI9 A;  5FI6 A;  5CHJ A;  5A91 A;  1KE0 A;  2G2U A;  1IYQ A;  2WKI A;  2ZQA A;  4Q8I A;  3NIA A;  4LV0 A;  2XD1 A;  3ZG5 A;  2ZQ9 A;  3P09 A;  1PW1 A;  1JTG A;  2WGW B;  3V50 A;  1NZO A;  4KEN B;  5HAI A;  1HVB A;  3UE0 A;  1U60 A;  4ZJ1 A;  1DJB A;  4RVA A;  2WAE A;  4EBP A;  3VMA A;  5BOH A;  3HLC A;  5EVI A;  4MLL A;  4LEN A;  1DY6 A;  3Q81 A;  5DTT A;  5EE8 A;  2GDN A;  4C3Q A;  2Y2L A;  1BSG A;  4OQH A;  3OCN A;  3RXX A;  4BL2 A;  4WZ5 A;  5EVI D;  1JWZ A;  3Q7V A;  5FQ9 A;  1PYY A;  3VP4 A;  2Y2O A;  3IF6 C;  4DDS A;  4GD8 A;  4NET A;  5FAO A;  4S2L A;  4N9K A;  3N4I A;  1PZO A;  1MXO A;  4S2M A;  1W8Y A;  4B4Z A;  4KZ4 A;  3ZVT A;  2WZZ A;  2JCH A;  2G2W A;  2ZM8 A;  4KZA A;  3A3D A;  5FDH A;  3VSL A;  3ZDJ A;  4X68 A;  3IHB A;  1KGG A;  2QMI A;  1PW8 A;  3SH9 A;  4E6X A;  1I2W A;  4BD1 A;  3VSK A;  2XEP A;  3N6I A;  4FH4 A;  4DXB A;  4EWF A;  1G68 A;  2Y91 A;  1DJA A;  4BQM A;  3DWZ A;  3UNW A;  3NCK A;  2ZM2 A;  2WKE A;  2Y2I A;  4OKP A;  5AQ7 A;  1H8Z A;  3WS0 A;  5HAQ A;  2XFT A;  3Q1F A;  3PBT A;  2ZMA A;  3I7J A;  4LV1 A;  4EUZ A;  4JXV A;  3HBR A;  4OOM A;  5G18 A;  3ITB A;  1L0F A;  2EX9 A;  5JYO A;  5AQA A;  1LI0 A;  3MBZ A;  2WKH A;  4HEF A;  4DDY A;  3CG5 A;  5CED A;  4HES A;  3OCL A;  4OQG A;  2DCF A;  1K56 D;  2C5W B;  1I5Q A;  4R4R A;  1YLP A;  5JYP A;  3IF6 A;  1W5D A;  2WAF A;  3VFF A;  1KE4 A;  1K55 C;  2Y2N A;  1L0E A;  4JF6 A;  4E3K A;  2HP6 A;  1CI8 A;  4BD0 A;  2ZQD A;  3TSG A;  1YMX A;  4B4X A;  4L0L A;  3FKW A;  1TEM A;  1ONG A;  3IWO A;  2RCX A;  2IWB A;  4HBT A;  4PM7 A;  2XH9 A;  4IED A;  4JF4 A;  3G2Y A;  4JXW A;  1RP5 A;  5CER A;  3G31 A;  4P85 A;  3PBR A;  3SH7 A;  3C7V A;  4E3M A;  3V3R A;  2R9X A;  1K25 A;  1ONH A;  1TVF A;  2X71 A;  1PI5 A;  4R4S A;  1K6R A;  4C6Y A;  2JE5 A;  2P74 A;  3OPH A;  1FR6 A;  5CRF A;  4E3N A;  1BT5 A;  1TDL A;  1ZG4 A;  2HDQ A;  4GN2 A;  4R23 A;  4D2O A;  2EX2 A;  3ZNY A;  4KG5 A;  5FI7 A;  5FSR A;  2WZX A;  4OPZ A;  3BEC A;  2PU2 A;  4MBF A;  3GQZ A;  4GNU A;  4ZTK A;  4MNR A;  2ZJ9 A;  4P0M A;  3C4O A;  3WS4 A;  4XUZ A;  3VP0 A;  3HLB A;  1JWP A;  2ZC3 B;  1YLY A;  3IF6 B;  4IBX A;  3IHA A;  4FSF A;  4RYE A;  5EUA A;  3NDG A;  4ZDX A;  1FR1 A;  4OQI A;  3UPO A;  2ZC7 A;  1JTD A;  2B5R A;  3D4F A;  4QJG A;  1GA0 A;  2OSU A;  1XX2 A;  3IXD A;  3IXH A;  4PM8 A;  5CEC A;  4N92 A;  1ALQ A;  1K55 A;  1ESU A;  4O7D A;  2Y55 A;  2XFS A;  3OPL A;  5D3O A;  3PAE A;  1NRF A;  3IH8 A;  3GR2 A;  1K6S A;  3V3S A;  3UO9 A;  1ES5 A;  1BLH A;  3UPN A;  3S1Y A;  5HW3 A;  3BFC A;  1FSY A;  1KGF A;  1SKF A;  4GKU A;  1NJ4 A;  2ZQ8 A;  1E25 A;  5M18 A;  1HTZ A;  5TFQ A;  1K54 C;  2ZD8 A;  5E2E A;  3SS3 A;  1BUL A;  4EBN A;  3UDF A;  2XK1 A;  3VFH A;  2E8I A;  2Q9N A;  3HLE A;  2DNS A;  4XUX A;  3Q07 A;  5TR7 A;  3CZD A;  1XGJ A;  1IKG A;  1BZA A;  1NXY A;  3NDE A;  5A90 A;  2PU4 A;  2BLS A;  2UWX A;  3N8L A;  5GHZ A;  1E3U A;  3BLM A;  3IQA A;  4PM6 A;  1RGZ A;  4F94 A;  1ESI A;  3DTM A;  2Y2P A;  3ITA A;  2JBF A;  3SS5 A;  4GZB A;  1K4F A;  1SDN A;  4KG6 A;  2WYX A;  2JC7 A;  1E3U D;  4JXG A;  3E2K A;  1LL5 A;  3OC2 A;  4FH2 A;  2ZC6 B;  4JXS A;  4EQI A;  3G2Z A;  4S2J A;  5DTS A;  1KVM A;  1Q2P A;  3HLD A;  2ZLY A;  3DW0 A;  5CTN A;  2XR0 A;  1E4D A;  5GLC A;  4ZJ3 A;  4GDN A;  1MWT A;  2Y2J A;  4KG2 A;  1FCM A;  3PTE A;  2A3U A;  2Z2M B;  4QD4 A;  1MWR A;  1IYS A;  3WRT A;  3LEZ A;  4M3K A;  3QNC A;  3UDI A;  3IXG A;  1ZKJ A;  5GLD A;  4LCL A;  3UDX A;  4BJP A;  2Y2K A;  4OP8 A;  2Y2H A;  4ZBE A;  3MZD A;  4K91 A;  3VOZ A;  5CTM A;  3WS2 A;  4OQ0 A;  4BEN A;  3BFF A;  2FFY A;  3BEB A;  1K54 A;  1FOF A;  3C5A A;  2H5S A;  1ZG6 A;  3FV7 A;  5EVI B;  1IYO A;  2P9V A;  3O87 A;  1S0W A;  4BL3 A;  4JPM A;  5DF7 A;  1KGE A;  4R1G A;  1M40 A;  5IHV A;  4R3B A;  4RA7 A;  5FAP A;  1YLZ A;  2HPB A;  3Q7V B;  4RX3 A;  2XF3 A;  1EWZ A;  3BFG A;  4QY5 A;  2WAD A;  4OLG A;  3IF5 A;  3HRE A;  4GB7 A;  3AGF A;  4U0T A;  3O3V A;  4R0Q A;  4DXC A;  4JF5 A;  4OLD A;  4PM5 A;  3LY4 A;  4QB8 A;  5CHU A;  5EVL A;  1FCO A;  2J7V A;  1MWS A;  5FQJ A;  3UE1 A;  4DE0 A;  1WE4 A;  2EFX A;  4KZ8 A;  3IWI A;  5KSC A;  2H0T A;  1PZP A;  3VP1 A;  5I94 A;  3N8S A;  4KZB A;  1DJC A;  3MKE A;  3P98 A;  2FFF B;  5J8X A;  3FYZ A;  1KE3 A;  4OOY A;  2EX8 A;  3OZH A;  2V20 A;  2CC1 A;  3BYD A;  2XD5 A;  4X55 A;  5FQK A;  5FQQ A;  3W4P A;  2VGJ A;  3QHY A;  2C6W B;  1SDE A;  3HVF A;  4UA7 A;  5F83 A;  3TG9 A;  2XGN A;  4QHC A;  1ES4 A;  2WGI A;  5E2F A;  3ZCZ A;  3MFD A;  4LV3 A;  4K0X A;  4DRT A;  1PWD A;  4UA6 A;  5M1A A;  1LHY A;  4E3J A;  5FQM A;  4KQR A;  4IVK A;  3O88 A;  5HAP A;  2Y59 A;  2QPN A;  1K57 C;  4S2K A;  5GLA A;  2J9P A;  1KVL A;  1RGY A;  1ZC2 A;  2EFU A;  1MKI A;  5F1G A;  2X02 A;  1TDG A;  2WK0 A;  4FCF A;  4DE1 A;  5HAR A;  1S6R A;  4H8R A;  4KQO A;  5GL9 A;  3BRM A;  3JYI A;  4N1H A;  1C3B A;  2QZ6 A;  3BFE A;  5E2H A;  1XP4 A;  3SH8 A;  2ZC4 B;  1NYM A;  3HLW A;  3VOY A;  2V2F F;  4HBU A;  2H10 A;  1SHV A;  3MXS A;  3MXR A;  4WZ4 A;  1HZO A;  3HLG A;  3MZE A;  4S2O A;  5HX9 A;  1ES3 A;  2VGK A;  4A5R A;  3A3J A;  4DE3 A;  3IXB A;  1LLB A;  1H5X A;  3O86 A;  4WEK A;  5E2G A;  4QY6 A;  1GA9 A;  1W7F A;  2WGW A;  3IH9 A;  3IWQ A;  4N9L A;  5FAT A;  3M2J A;  1CEG A;  1M6K A;  1YLW A;  5HL1 A;  3HLF A;  1YM1 A;  1ERM A;  3Q82 A;  4S2N C;  1AXB A;  2HDS A;  2Z2L B;  3FKV A;  5EEC A;  5EOE A;  5E43 A;  1JWV A;  1QMF A;  1YLJ A;  3FZC A;  2J8Y A;  3GTC A;  3GRJ A;  5CEB A;  1XPB A;  4R3J A;  4WM9 A;  2R9W A;  2I72 A;  4OOL A;  4RX2 A;  4WMC A;  4LV2 A;  3RJU A;  3G30 A;  1K57 A;  5AQB A;  1BLC A;  1YLT A;  4OPY A;  3PBS A;  3OPR A;  2BG1 A;  3M6B A;  5M19 A;  1IEL A;  3BFD A;  5KMW A;  2WGV A;  2ZC5 B;  2H0Y A;  5DF9 A;  3V5M A;  5F1F A;  3UN7 A;  3ZG0 A;  1NY0 A;  1RCJ A;  4U0X A;  3LO7 A;  4ZAM A;  3NC8 A;  1Z6F A;  2J9O A;  5HFO A;  4EBL A;  1QME A;  4OPQ A;  3UE3 A;  1XA7 A;  2EX6 A;  4E3I A;  4KZ6 A;  4OP5 A;  4XXR A;  4MEZ A;  2V1Z A;  4Z9Q A;  3A3E A;  3BM6 A;  1N9B A;  3W8K A;  1SCW A;  1IKI A;  4ID4 A;  5FAQ A;  4E6W A;  4P6B A;  3PBO A;  5CGS A;  1IYP A;  2HDU A;  2XQZ A;  4EV4 A;  1KDS A;  4DF6 A;  5A92 A;  4WYY A;  4KQQ A;  4Y7P A;  1CEF A;  4Y0T A;  3W4Q A;  5FAS A;  3ISG A;  3ZGA B;  2IWD A;  4Y0U A;  1CK3 A;  3W4O A;  3HUN A;  3B3X A;  4OH0 A;  1O07 A;  3IT9 A;  3M6H A;  4QU3 A;  4KZ3 A;  4S2N A;  3VP3 A;  3ZFZ A;  1NZU A;  3CMZ A;  2OLV A;  5EOO A;  1PWC A;  3ZNT A;  1L0D A;  4OON A;  4X53 A;  5EPH A;  3BLS A;  1J9M A;  3MKF A;  5GHX A;  2ZQC A;  4GOG A;  3WS5 A;  1BTL A;  2OLU A;  4X56 A;  3RXW A;  3PBN A;  3SOI A;  4UAA A;  2ZM0 A;  3NY4 A;  1EI5 A;  4DKI A;  2DRW A;  2EXB A;  4E3O A;  3C7U A;  1JVJ A;  3HUO A;  3WWX A;  3N7W A;  4IVI A;  5CGW A;  1GHI A;  1HD8 A;  5FA7 A;  3GMW A;  5DF8 A;  4FD8 A;  4WEJ A;  1ERQ A;  3DWK A;  2WUQ A;  4IBR A;  4K0W A;  1XXM A;  2IWC A;  1MY8 A;  3E2L A;  1G6A A;  1Y54 A;  5U47 A;  4N1X A;  4CPK A;  5DTK A;  5CXW A;  1YMS A;  1I2S A;  1PIO A;  3NBL A;  3ZG7 B;  5KSH A;  3G34 A;  1K56 A;  1VM1 A;  4YIN A;  3AGE A;  2Y2Q A;  1MBL A;  4OPR A;  4MBK A;  1CI9 A;  1K38 A;  3CJM A;  4PMA A;  2Q9M A;  1GCE A;  2P9V B;  3WS1 A;  2OV5 A;  5A93 A;  1PI4 A;  4UHU A;  3V39 A;  2RL3 A;  1GHP A;  5KZH A;  4S2I A;  4YFM A;  3HL9 A;  3PAG A;  3ZG8 B;  1L0G A;  1FSW A;  4DE2 A;  1XGI A;  1MWU A;  3SS4 A;  1KDW A;  4BLM A;  4NK3 A;  3M2K A;  4S2P A;  5F82 A;  4UA9 A;  1L2S A;  4JBF A;  4KZ7 A;  4WEL A;  1XA1 A;  3ZG9 B;  5TGF A;  3GSG A;  2Y2G A;  1FCN A;  5GHY A;  3HUM A;  1BLP A;  1ERO A;  1W79 A;  4KZ9 A;  4ZJ2 A;  3S22 A;  3TOI A;  2HDR A;  4B88 A;  1K4E A;  5FQI A;  1MPL A;  3VP2 A;  3G4P A;  5FI2 A;  4P87 A;  1IEM A;  2EXA A;  2ZQ7 A;  4GD6 A;  1VQQ A;  4JLF A;  5EVI C;  4WBG A;  1LL9 A;  3A3I A;  2PBY A;  4GDB A;  4X6T A;  3A3F A;  1W8Q A;  3MZF A;  3OPP A;  3FWL A;  4WZ5 C;  5L2F A;  5GLB A;  4C75 A;  1H8Y A;  3EQU A;  4MBH A;  5DVA A;  5AQ9 A;  3ZVW A;  1GHM A;  1Q2Q A;  4E3L A;  5CHM A;  2A49 A;  3UY6 A;  3EQV A;  2XLN A;  4PPR A;  3PBQ A;  3Q7Z A;  3LY3 A;  5CGX A;  4PM9 A;  3S4X A;  4U3T A;  2HP9 A;  2X01 A;  4JKT A;  4Y0O A;  1XKZ A;  3ZHH A;  1LI9 A;  3UPP A;  3GV9 A;  1BLS A;  1BUE A;  1N4O A;  2Y2M A;  1WYB A;  2XDM A;  3AGD A;  3C4P A;  3GVB A;  4LCM A;  4X69 A;  4OVD A;  2Y4A A;  1FQG A;  1OME A;  1YQS A;  3G32 A;  1YT4 A;  4KZ5 A;  1ES2 A;  3QNB A;  4WMC D;  1NYY A;  3LCE A;  1WYC A;  1O7E A;  3N8R A;  4CJN A;  3WRZ A;  1PWG A; 
#chains in the Genus database with same CATH topology
 4IBE A;  5CHJ A;  3UME A;  1LT0 A;  3NIA A;  4LV0 A;  5JA4 B;  4M4X A;  4Z2G A;  1M19 B;  2J3T C;  3VV4 A;  1F66 D;  3V50 A;  1NZO A;  4ZJ1 A;  2O9C A;  3VMA A;  3TU4 B;  3VH5 T;  5G4Y A;  3Q81 A;  1FIK A;  2GDN A;  3AZL C;  3KXB A;  1KU5 A;  2VV6 A;  4R8P B;  3A0S A;  4NET A;  3N4I A;  1M1A C;  3AZE A;  2WZZ A;  2JCH A;  4KZA A;  4OJL A;  1HLU P;  4R38 A;  2PYO C;  1KGG A;  3W97 B;  4MMN A;  3SH9 A;  3O62 B;  3KWQ C;  3VSK A;  4NXB A;  4FH4 A;  4GW9 A;  2W3F A;  4EWF A;  5L10 A;  1M18 C;  2ZM2 A;  3NQU A;  4IUK A;  3WA9 A;  5AQ7 A;  3EEH A;  5HAQ A;  3WS0 A;  3Q1F A;  4EUV A;  3PBT A;  3X1V B;  3I7J A;  1N1J B;  4GS9 B;  4YWZ A;  3FG8 A;  2PYP A;  1F2K A;  3HBR A;  1XJ4 A;  2J3T D;  2P08 A;  1AOI B;  1A7W A;  4DDY A;  5BT1 C;  4HES A;  1E15 A;  2C5W B;  2NZD A;  3DBA A;  5B32 B;  5JYP A;  1SKO A;  2WAF A;  3KO6 A;  1QO6 A;  2HP6 A;  4PKY G;  3BY9 A;  5TBM B;  4H9S A;  1CI8 A;  2DQN C;  4BD0 A;  3K3C A;  3L2A A;  2M7V A;  3IX3 A;  1ONG A;  1D7E A;  3IWO A;  1S32 A;  1E6P A;  4PKY A;  2IWB A;  4PM7 A;  4JF4 A;  4JXW A;  1RP5 A;  3LIE A;  5CER A;  1TF1 A;  4J8W B;  3B0D B;  3NUL A;  3PBR A;  3C7V A;  4F3L B;  5B31 A;  3V3R A;  2R9X A;  4R4S A;  5F69 A;  3TRC A;  1Y4O A;  5CRF A;  1Z2C B;  4E3N A;  2A24 B;  1BT5 A;  2HDQ A;  4D2O A;  3ZNY A;  5FSR A;  4OPZ A;  2ZJ9 A;  2V8C A;  2W8S A;  4J8X B;  4Y3I A;  3REL D;  3IHA A;  4FSF A;  4RYE A;  4ZDX A;  4Y15 A;  2ZC7 A;  3D4F A;  1S67 L;  5B40 A;  1GA0 A;  2OSU A;  4E04 A;  1XX2 A;  1TZY C;  5CPJ A;  4QLC C;  1F98 A;  4PM8 A;  5BT1 D;  5HWT A;  1U35 A;  1ALQ A;  1BH9 A;  2Y55 A;  3SW1 A;  3OPL A;  3PAE A;  1NRF A;  2HZ5 A;  3UO9 A;  3S7N A;  1BLH A;  4HGA B;  4WU9 B;  4CSR A;  4KHA B;  1H8P A;  2HV1 A;  3BFC A;  3NQJ B;  1FSY A;  1KGF A;  1SKF A;  1YU2 A;  3W99 C;  5M18 A;  1K54 C;  2ZD8 A;  5HDD A;  1P3A C;  2XK1 A;  4JJN A;  1AWI A;  3CZD A;  3AZM A;  3MGR C;  1BZA A;  1NXY A;  1D1J A;  3B6F C;  3CIT A;  2L1M A;  3LEL A;  5GHZ A;  1DRM A;  1P3F C;  3LJA A;  4HME A;  3GDI A;  5HPI A;  1SDN A;  4H9Q A;  2WYX A;  2JC7 A;  1E3U D;  1V9Z A;  3BY8 A;  3LIF A;  5TJJ A;  4FH2 A;  3G2Z A;  3HLD A;  5CTN A;  3OBF A;  1F5M A;  4CLC E;  5HD5 A;  2QJ5 A;  1X0O A;  3PTE A;  4H9R A;  4G92 C;  2A3U A;  1MWR A;  4QD4 A;  3LZ0 C;  2XA7 M;  1TZY D;  4M3K A;  5JRG C;  3MVD D;  4QLC D;  3MGS B;  4GH9 A;  3MS6 A;  1P3K B;  1P3P C;  3UDX A;  2BYK B;  2Y2K A;  2EWW A;  4LRX C;  1KX5 D;  4K91 A;  2PR5 A;  3B6G B;  3BEB A;  2VK3 A;  1FOF A;  3FV7 A;  5EVI B;  3R7W B;  1S0W A;  4BL3 A;  1P3I C;  4IBB A;  4R1G A;  5CPK A;  3W99 D;  4X23 D;  1P3A D;  1XJ3 A;  3OOV A;  3Q7V B;  1YU0 A;  2O9A A;  3BFG A;  4I3J A;  2O99 A;  4HJ3 A;  3LIA A;  4OLG A;  1S1Y A;  3IF5 A;  3AGF A;  3B6F D;  5B2J C;  3O3V A;  4H9O A;  5BS7 A;  3MGQ B;  3C1B B;  4QB8 A;  3ZQ5 A;  3FKE A;  2J7V A;  3VH6 T;  2EFX A;  4R70 A;  3IWI A;  3AN2 C;  4KZB A;  1DJC A;  3FYZ A;  5F99 C;  2EX8 A;  5B1L C;  2V20 A;  5FQK A;  3LZ1 A;  2V0W A;  2ARO A;  2C6W B;  4AWL B;  4UA7 A;  5AV9 B;  3WAA B;  1F1E A;  2XSS A;  2ZY3 A;  4IBD A;  3F6T A;  3MGP B;  2BYM A;  1FIL A;  5B0Y D;  3HSH A;  5JRG D;  4I39 A;  2CV5 C;  3AZN B;  1P3P D;  3AZG C;  3R4K A;  1MC0 A;  3UTB C;  2QPN A;  5DNM D;  4X25 A;  5GLA A;  1KVL A;  2WK0 A;  3IBJ A;  1P3I D;  2VKS A;  4H8R A;  3BRM A;  1HQ3 B;  5E2H A;  1V9Y A;  2XRN A;  5B0Z B;  3MQL A;  3HLW A;  3UT9 A;  5AVB A;  3REI A;  3MXR A;  4XUJ D;  4NYY A;  3MZE A;  5GXQ D;  5B2J D;  5HWV A;  1M19 A;  1LLB A;  1E6R A;  4WEK A;  3WKJ B;  3CPT B;  4QY6 A;  5EM0 A;  4NKP A;  3AN2 D;  3IH9 A;  3IWQ A;  3FPV A;  3P5J B;  1CEG A;  3TU4 A;  1M6K A;  5GT3 D;  4I3I A;  1KS0 A;  5B1L D;  1AXB A;  5EOE A;  3MMH A;  5AY8 A;  3LUQ A;  4WLA A;  4R8P A;  3FZC A;  5CEB A;  5BNX B;  4LLO B;  3REH C;  4NE6 A;  4OPY A;  5CP6 C;  3PBS A;  2RVQ C;  2BG1 A;  3UTB D;  3AV1 B;  2H0Y A;  1GSX A;  3W97 A;  4ZAM A;  1T1B A;  5CPI C;  1Z6F A;  4OPQ A;  1TD5 A;  4BBV A;  3T4T A;  3H9W A;  4KZ6 A;  4XXR A;  1B6W A;  1T18 A;  3W8K A;  3EPL A;  1N9B A;  2FJ7 D;  2QJ7 A;  3CLO A;  5FAQ A;  3PBO A;  1KX4 B;  1IYP A;  4OJ6 A;  1P3L C;  4KGC B;  3X1V A;  4KQQ A;  1CEF A;  3K2N A;  1P3G B;  1P3B B;  3AZK B;  1MKM A;  5FAS A;  2QHK A;  1JFI B;  3HUN A;  4OH0 A;  1AOI A;  3KS8 A;  3VP3 A;  4S2N A;  1NZU A;  2OLV A;  1LSX A;  1YAX A;  2VGL M;  1VHM A;  5GSU B;  3ZNT A;  4X53 A;  5EPH A;  3BLS A;  5B32 A;  1HTA A;  4GOG A;  3EEA A;  3OLO A;  2KOI A;  4JGQ A;  4OUI A;  4HJ6 A;  2K31 A;  4X1M A;  5TBM A;  4DKI A;  4E3O A;  3REH D;  3WWX A;  3A6N B;  5CP6 D;  2RVQ D;  1YSP A;  4J8W A;  1ERQ A;  2WUQ A;  4K0W A;  2NUT C;  2CWE A;  3F1O B;  3E2L A;  5E5A B;  1G6A A;  5U47 A;  2H28 A;  3UTA A;  3ZG7 B;  4XZQ B;  5AV6 C;  2EA9 A;  1VM1 A;  1W1Y A;  2Y2Q A;  1MBL A;  4MBK A;  5AV8 C;  1K38 A;  1S1Z A;  2Q9M A;  1GCE A;  2P9V B;  2OV5 A;  5A93 A;  4J8X A;  1S4R A;  4UHU A;  4WN5 A;  1N9N A;  1GHP A;  4XT2 B;  4S2I A;  4YFM A;  3PAG A;  1P3L D;  5FUG B;  3AZJ A;  5LBR A;  1FSW A;  1KX3 B;  4DE2 A;  1CJF A;  1A0K A;  1MWU A;  4NK3 A;  3M2K A;  1PRQ A;  1XA1 A;  5TGF A;  1P3O B;  3GSG A;  2Y2G A;  4CLC C;  1FCN A;  3EGX C;  2B02 A;  3HUM A;  1UGU A;  1CQA A;  1ERO A;  2Z6C A;  5BNV A;  4ZJ2 A;  3S22 A;  2YFV B;  4K08 A;  5FQI A;  3VP2 A;  4KHA A;  4P87 A;  1IEM A;  3NQJ A;  2EXA A;  5HL6 A;  3O5Y A;  1OTI A;  4GHL A;  4HMD A;  1LL9 A;  4LG2 A;  3A3I A;  2PBY A;  1YU3 A;  1GOI A;  1W8Q A;  3OPP A;  3AZF B;  3KXB C;  4MBH A;  2P04 A;  3ZVW A;  3L29 A;  4EEU A;  2OWJ A;  1OTD A;  3IX4 A;  3LIB A;  5AV6 D;  2XLN A;  5B1M B;  3Q7Z A;  5B24 B;  3AZE C;  3WD4 A;  4MN6 A;  5AV8 D;  3M7P A;  4Z2J A;  4LCM A;  2XDM A;  5DNN B;  1EQZ B;  4X69 A;  3UB6 A;  3VH5 A;  1FQG A;  1J3W A;  1OME A;  1BH8 B;  3E4O A;  1O7E A;  3WRZ A;  3JVU A;  3NI9 A;  5A91 A;  4GHI B;  1L6J A;  1KE0 A;  5B2I A;  2G2U A;  2ZQA A;  4Q8I A;  3WA9 C;  2BYK A;  2XD1 A;  5AVC B;  5HD3 A;  4G91 C;  3P09 A;  1JTG A;  3UE0 A;  3B6G A;  3D9Y A;  5AV5 D;  4Z2M G;  5EVI A;  4ZBJ C;  3R7W A;  1E88 A;  5DTT A;  5IT5 A;  1BSG A;  4Z2K A;  3X1T B;  3OCN A;  3AV2 B;  1VET B;  2LB5 A;  2NZD C;  3Q7V A;  1PYY A;  3VP4 A;  2Y2O A;  4BWI A;  3KUY B;  5FAO A;  3T4K A;  4S2L A;  4KUD A;  4N9K A;  2VA0 A;  4H9S C;  3REK A;  3IBR A;  3KSH A;  3MGQ A;  4S2M A;  1W8Y A;  3C1B A;  3LI8 A;  1S32 C;  5FDH A;  3AFA D;  3AZE D;  5I5L A;  2F8N A;  1TS0 A;  5J7E A;  4E6X A;  3QP5 A;  5B31 C;  4IUH A;  2XEP A;  1P3M D;  3EWK A;  1G68 A;  5HPF A;  1DJA A;  3S7P A;  3UNW A;  3MGP A;  2Y2I A;  3U2A A;  2XFT A;  2PYR A;  5HDC A;  3AZN A;  1YSQ A;  3W96 D;  5JYO A;  5DKK A;  1TS7 A;  4OQG A;  1K56 D;  3JPU A;  1UR8 A;  5B40 C;  1OPX A;  4R4R A;  1YLP A;  5CPJ C;  3IF6 A;  3VFF A;  1U35 C;  1HQ3 A;  2Y2N A;  4JF6 A;  2NZD D;  5G4Z A;  2ZQD A;  3TSG A;  2VQR A;  4DRA A;  3B47 A;  3QP2 A;  3WTP D;  2XH9 A;  4IED A;  4Z2I A;  4QPR A;  3G2Y A;  3G31 A;  1S32 D;  4NEE D;  2A2L A;  4J8V A;  3H82 A;  5MC7 A;  2HUE C;  4JJN C;  1K6R A;  1N9L A;  2GNX A;  3AZM C;  5B31 D;  4EO5 C;  1YUE A;  1IFQ A;  4KG5 A;  2WKR A;  3RH8 B;  3LEL C;  4MBF A;  4ZTK A;  2ZOI A;  4Z66 D;  5BNX A;  3LJA C;  3HLB A;  3AYW A;  1YLY A;  3NDG A;  4HP4 A;  2HIO D;  1N9O A;  3E4P A;  3T4Q A;  3P7N A;  3K3D A;  3MNN D;  3H0R C;  1K55 A;  4H9P B;  5B40 D;  4M6B A;  3IH8 A;  3V3S A;  5CX7 A;  4WU8 A;  4FTX A;  3MJQ A;  5HW3 A;  2OAQ 1;  1H0G A;  3WD0 A;  4NZ4 A;  1NJ4 A;  1E25 A;  3REL B;  2QKP A;  5E2E A;  3SS3 A;  4KGC A;  4AFI A;  1P3B A;  5CPK C;  2F8N K;  3CI6 A;  3KSY A;  3Q07 A;  4XUX A;  5TR7 A;  1IKG A;  4WV4 B;  2QWS A;  4WZS B;  2BLS A;  2UWX A;  3N8L A;  3AZM D;  5GSU A;  1RGZ A;  3DTM A;  5BS7 C;  3ITA A;  3SS5 A;  4B9O A;  1K4F A;  3NHQ A;  4KG6 A;  1B67 A;  4JXG A;  3OC2 A;  4JXS A;  3LJA D;  1Q2P A;  2ZLY A;  3DW0 A;  5GLC A;  2F8N H;  3X1U A;  4L9G A;  3NOT C;  2Y8H A;  3NEC A;  4YS3 A;  3LZ1 C;  4KG2 A;  2ARO C;  2Z2M B;  3JVV A;  4Z5T A;  3QNC A;  5E5A A;  4BJP A;  4EW7 A;  3T1S A;  4OP8 A;  1E6Z A;  4ZBE A;  4YM6 B;  5CTM A;  3WS2 A;  3BFF A;  1GPF A;  2NQB A;  3C5A A;  3VH6 A;  1ZG6 A;  1YKD A;  2P9V A;  4JPM A;  1M40 A;  5FUG A;  5FAP A;  1R4V A;  2HPB A;  2KLI A;  1KX3 A;  4QY5 A;  5CPK D;  4PHT A;  3HRE A;  2PAV P;  5DKL A;  1TAF B;  5B33 A;  2OWH A;  1OJG A;  3UT9 C;  1TZY B;  5AVB C;  4OLD A;  5EVL A;  3MVD B;  4QLC B;  3REI C;  3KSG A;  1MWS A;  3AZL D;  3UE1 A;  2ZY5 A;  4KZ8 A;  5KSC A;  2H0T A;  2W27 A;  4DJ2 A;  1PZP A;  5I94 A;  2O0Y A;  1KX5 B;  2VX8 A;  2YFV A;  2P7J A;  3P98 A;  1M19 C;  2INW A;  1KE3 A;  4ZRR A;  2CC1 A;  5FQQ A;  2XD5 A;  3W4P A;  1MZU A;  1SDE A;  3TU4 C;  1M1A D;  3HVF A;  5F83 A;  4QHC A;  1YPR A;  4X23 B;  1ES4 A;  3FPW A;  1P3A B;  2JN7 A;  3ZCZ A;  3LZ1 D;  3MFD A;  2ARO D;  3AZF A;  5AY8 C;  1ZLA B;  2PYO D;  4R8P C;  4H6J A;  5M1A A;  4CAY B;  1LHY A;  3VH6 W;  3KWQ D;  4KQR A;  4PAU A;  5B1M A;  3G6O A;  2HF6 A;  4NYU A;  3NOU C;  5B24 A;  1M18 D;  2X02 A;  1VB6 A;  1EQZ A;  4KQO A;  2QZ6 A;  3IS2 B;  1XP4 A;  3W97 C;  1NYM A;  3VOY A;  2V2F F;  4HBU A;  3KSI A;  4WZ4 A;  3HLG A;  4G92 B;  2LB9 A;  5B0Y B;  3UT9 D;  5AVB D;  2VGK A;  3A1I A;  5JRG B;  3REI D;  3IXB A;  4IBK A;  1P3P B;  3O86 A;  5E2G A;  1GA9 A;  3X1V C;  3BQA A;  3X1S A;  1BFM A;  3LR3 A;  1M19 D;  5DNM B;  4Z2L A;  1OT6 A;  3HLF A;  1YM1 A;  1AOI C;  3Q82 A;  4S2N C;  1Q9C A;  3X1T A;  2Z2L B;  3C38 A;  3FKV A;  1P3I B;  1VET A;  1JWV A;  3B0B A;  1QMF A;  2I9V A;  3U4L P;  1YLJ A;  5B32 C;  3GRJ A;  1XPB A;  2RTS A;  3KX0 X;  5AY8 D;  3KUY A;  4J8U A;  2I72 A;  4OOL A;  4WMC A;  4LV2 A;  4R8P D;  1H0I A;  4XUJ B;  5GXQ B;  3D72 A;  5B2J B;  3OPR A;  1GSV A;  1IEL A;  2WGV A;  3HCY A;  5DF9 A;  1G28 A;  4JGR A;  3IX8 A;  3ZG0 A;  1RCJ A;  2CMN A;  4J8W C;  5G49 B;  3N3F A;  2J9O A;  5GT3 B;  3UE3 A;  1XA7 A;  4B93 A;  5B1L B;  4ARZ B;  3UTA C;  3W2Z A;  1ED7 A;  4OP5 A;  4MEZ A;  4OJO A;  4NZ1 A;  1SCW A;  4EV4 A;  5CGS A;  4DF6 A;  5BO0 B;  4WYY A;  4J8X C;  4Y0T A;  3W4Q A;  4Z1W A;  4Y0U A;  3W4O A;  3AZJ C;  3X1V D;  2ZOH A;  3B3X A;  1T19 A;  3M6H A;  3UTB B;  3REJ B;  3ZFZ A;  3CMZ A;  5EOO A;  2BTF P;  3AZH A;  4RQ9 A;  1L0D A;  2FN2 A;  5GT0 A;  5GHX A;  2HGV A;  2IA2 A;  4R3A A;  4WJ3 C;  4MN7 A;  5B32 D;  4UAA A;  3T1R A;  1EI5 A;  3MGR D;  2G5H C;  3L26 A;  2FJ7 B;  3HUO A;  4IVI A;  5CGW A;  1HD8 A;  5FA7 A;  5DF8 A;  4HJ4 A;  4MB4 A;  1P3F D;  3DWK A;  2IWC A;  1Y54 A;  4CPK A;  4N1X A;  3IP4 C;  1YMS A;  3EOI A;  1KOU A;  2ZM5 A;  1DP8 A;  4YIN A;  3AGE A;  4OPR A;  3UTA D;  1CI9 A;  4PMA A;  3WS1 A;  3LZ0 D;  4DJ3 A;  4ZUX B;  4R6L A;  3EGD C;  2D49 A;  1XGI A;  5HZH A;  3REH B;  5AJG A;  1KDW A;  4Y5F A;  5F82 A;  1P34 B;  4UA9 A;  3B0C T;  1L3L A;  5CP6 B;  3AZJ D;  4LD9 A;  3TE8 A;  5GHY A;  4H9P A;  1BLP A;  3L7H A;  4WUJ A;  5IU1 A;  5B2I C;  2VZW A;  1ID3 A;  4B88 A;  3BQ8 A;  3C30 A;  3B6G C;  3L25 A;  4LRY C;  4O8G A;  3REL A;  5EVI C;  2IO5 C;  5JA4 A;  3HJI A;  1P3L B;  4G3K A;  3MZF A;  2J8P A;  3FWL A;  5L2F A;  5DFX A;  5GLB A;  3S7O A;  1XFQ A;  4C75 A;  3T1Q B;  5DVA A;  2BAS A;  3F1P B;  5F99 D;  1GHM A;  1Q2Q A;  5CHM A;  4KUD C;  4NY2 A;  5CGX A;  5AVF A;  5C3I C;  3REK C;  3MGQ C;  1W1P A;  3C1B C;  2HP9 A;  2X01 A;  4JKT A;  4Y0O A;  1XKZ A;  1LI9 A;  1G6O A;  3UPP A;  1BLS A;  1BUE A;  3LFV A;  2CV5 D;  3PYP A;  4OVD A;  1PFL A;  3AZG D;  3G32 A;  4KZ5 A;  1NYY A;  3LCE A;  4CJN A;  4AWL C;  3MGP C;  1IYQ A;  2WKI A;  3O62 A;  3KYZ A;  3ZG5 A;  4YM6 A;  4KEN B;  5HAI A;  5B2I D;  1HVB A;  1XJ6 A;  3AZN C;  4RVA A;  2Y79 A;  1T3U A;  5AV8 B;  4C3Q A;  2Y2L A;  2VV8 A;  4OQH A;  4O0P A;  3KYE A;  4BL2 A;  4WZ5 A;  1LSW A;  1N1J A;  4GS9 A;  1JWZ A;  5EVI D;  5FQ9 A;  3IF6 C;  5L07 A;  1DP6 A;  2W1T B;  2V9A A;  3FC7 A;  1PZO A;  1IOU A;  4KZ4 A;  3MVD A;  2XA7 S;  3ZVT A;  4KUD D;  1G5U A;  2ZM8 A;  4JGP A;  3A3D A;  3VSL A;  3ZDJ A;  3REK D;  3IHB A;  3MGQ D;  1KX5 A;  3C1B D;  3HJK A;  1I2W A;  5AV5 B;  4BD1 A;  4J8V C;  3N6I A;  4DXB A;  2J80 A;  2F8N D;  1OJ5 A;  3LR0 A;  2Y91 A;  3E4Q A;  4X23 A;  4Y17 A;  5A8B A;  4F3L A;  1H8Z A;  1O6I A;  1ZLA A;  3W98 B;  1GXD A;  3MGP D;  5HWW A;  5FDS A;  4EUZ A;  4OOM A;  5CPI D;  3ITB A;  1L0F A;  3AYW C;  2A24 A;  4EQ1 A;  1LI0 A;  2WKH A;  3H7W B;  3CG5 A;  3A0R A;  2DCF A;  3AFA B;  3AZE B;  4LGW A;  5F5Y A;  1W1V A;  1K55 C;  4E3K A;  3IS2 A;  1P3M B;  4GCZ A;  2W3E A;  4L9F A;  2B18 A;  4WU8 C;  4L0L A;  3FKW A;  1TEM A;  2RCX A;  4HBT A;  3VOL A;  5B0Y A;  2EWV A;  3NQU B;  1VEU B;  4P85 A;  3SH7 A;  4E3M A;  5FL3 A;  4KGC C;  1ONH A;  2X71 A;  3W96 B;  4WU9 A;  1PI5 A;  1P3B C;  5DNM A;  1FR6 A;  1NLY A;  4J8V D;  1TDL A;  1ZG4 A;  4ZBJ B;  4GN2 A;  3UB9 A;  3BEC A;  3MQO A;  5GSU C;  3E0Y A;  3QP8 A;  4MNR A;  4P0M A;  3C4O A;  4UQI M;  2ZC3 B;  4IBX A;  3BW6 A;  4XUJ A;  5GXQ A;  4OQI A;  3C1C B;  3WTP B;  4EES A;  3AYW D;  2B5R A;  4EEP A;  3X1U C;  3IXD A;  3IXH A;  5CEC A;  4YS3 C;  4O7D A;  5L09 A;  3AZI B;  4DN0 A;  5F68 A;  4Z5T C;  5J4E A;  1K6S A;  5E5A C;  5GT3 A;  5B31 B;  1ES5 A;  4ARZ A;  3H0L C;  1YU4 A;  5AVE A;  4GKU A;  4WU8 D;  4Z66 B;  4NE3 A;  5TFQ A;  2NQB C;  3MGS A;  4CLC D;  1P3K A;  4UEY A;  3UDF A;  3WD2 A;  2Q9N A;  3HLE A;  1GSW A;  3DAV A;  5FEF A;  5A90 A;  3NDE A;  2HIO B;  2JKR I;  1KX3 C;  3REJ A;  2R78 A;  3LID A;  5BPV A;  3MNN B;  3IQA A;  4PM6 A;  4DMZ A;  5B33 C;  2Y2P A;  5B40 B;  3UMD A;  2JBF A;  3EPJ A;  2HJE A;  1BH9 B;  1LL5 A;  3KXB D;  4EQI A;  3F1N B;  4S2J A;  4MCW A;  3CAX A;  2FJ7 A;  1E4D A;  1DP9 A;  2QYB A;  1FCM A;  1PZR A;  1F66 B;  3SZT A;  1NWZ A;  3X1U D;  5GLD A;  3QP4 A;  4YS3 D;  4LCL A;  1LL8 A;  2Y2H A;  3AZF C;  2JKT M;  2V1A A;  3MZD A;  1PDC A;  4Z5T D;  3VOZ A;  3AZM B;  4OQ0 A;  4BEN A;  3MQ0 A;  2FFY A;  5AV9 A;  3WAA A;  2VGL S;  3V67 A;  2H5S A;  5KIZ A;  3O87 A;  5B1M C;  5DF7 A;  1KGE A;  5IHV A;  3WD1 A;  5B24 C;  4ZUX A;  2NQB D;  4R3B A;  4RA7 A;  4GLQ A;  3LJA B;  3WA9 D;  2XF3 A;  1TS8 A;  1EQZ C;  1P34 A;  4GB7 A;  3ULF A;  4U0T A;  4R0Q A;  3LY4 A;  3UB8 A;  1FCO A;  5FQJ A;  4ETZ A;  1WE4 A;  3PHY A;  5B33 D;  3BWL A;  4KQD A;  2JSS A;  3MKE A;  5B0Z A;  2ZL1 B;  5J8X A;  2PR6 A;  4OOY A;  3X1S C;  3BYD A;  2VGJ A;  3FDD A;  5CHL B;  3QHY A;  4II7 A;  4HIA A;  3WKJ A;  3X1T C;  3L27 A;  3CPT A;  5CPK B;  2UV0 E;  4DRT A;  1PWD A;  4UA6 A;  4H9N B;  3F1P A;  2MJ6 A;  1P0Z A;  2PBD P;  5FQM A;  5HDS A;  4J8U C;  3KUY C;  2Y59 A;  3AZL B;  4S2K A;  1T1C A;  2J9P A;  2EFU A;  1MKI A;  3LIC A;  5F1G A;  1TDG A;  4FCF A;  4G3V A;  3UE6 A;  1S6R A;  2W3D A;  5GL9 A;  3JYI A;  4N1H A;  3WD3 A;  2L4R A;  3SH8 A;  2ZC4 B;  3H0M C;  1M1A B;  3TJZ C;  3T50 A;  2H10 A;  3AV1 A;  1HZO A;  3LZ1 B;  4S2O A;  5HX9 A;  2PYO B;  4A5R A;  4DE3 A;  5CPJ D;  3KWQ B;  1U35 D;  3M2J A;  1YLW A;  3WX7 A;  1M18 B;  1KX4 A;  3X1S D;  1ERM A;  2HDS A;  5EEC A;  4WNN B;  3AZH C;  1P3G A;  3AZK A;  2J8Y A;  5GT0 C;  1H3O B;  1JFI A;  3X1T D;  2ZY4 A;  4NG2 A;  2R9W A;  4RX2 A;  4Z2M H;  3CUE A;  2W1T A;  4L9E A;  4JJN D;  3RJU A;  3G30 A;  1K57 A;  4HHD A;  1BLC A;  4J8U D;  3M6B A;  3UT9 B;  5AVB B;  4Y2F A;  5KMW A;  3REI B;  2ZC5 B;  2JHE A;  4ME4 A;  2WKP A;  3LEL D;  5F1F A;  3UN7 A;  5FEG A;  1LSV A;  4HY8 A;  3LO7 A;  5AV5 A;  3NC8 A;  4UUZ B;  1QME A;  4HMC A;  2EX6 A;  3A6N A;  3VE4 A;  1TS6 A;  2V1Z A;  4Z9Q A;  3A3E A;  4E6W A;  1IKI A;  2XQZ A;  3F1O A;  2JKT I;  5A92 A;  3W98 A;  5AY8 B;  4Y7P A;  4XZQ A;  3ISG A;  2AVX A;  2WKQ A;  4FOF A;  1O07 A;  3IT9 A;  3H7W A;  4QU3 A;  3AFA A;  4HH3 A;  2D01 A;  5L8M A;  4LD9 C;  1J9M A;  4XT2 A;  2ACG A;  2ZQC A;  2OLU A;  1P3M A;  3AZH D;  3RXW A;  4IBG A;  3PBN A;  5GT0 D;  1ACF A;  1P9W A;  1ID3 C;  2DRW A;  2EXB A;  1P3O A;  3C7U A;  4HI4 A;  3N7W A;  1AIW A;  1WA9 A;  4HP9 A;  2W3G A;  4FD8 A;  3REL C;  1VEU A;  4IBR A;  1XXM A;  1MY8 A;  3GEC A;  3W96 A;  2E8J A;  5DTK A;  2L0W A;  1PIO A;  2O9B A;  3G34 A;  1K56 A;  3W99 B;  1SZV A;  3CJM A;  2DF4 C;  3E98 A;  1PI4 A;  3V39 A;  1OT9 A;  3HL9 A;  3MGR B;  4GHA A;  3ZG8 B;  3B6F B;  3SS4 A;  4BLM A;  3C1C A;  3WTP A;  4S2P A;  4KZ7 A;  4WEL A;  3ZG9 B;  4OJ5 A;  1P3F B;  5B31 G;  3AZI A;  4LD9 D;  3RFB A;  5DNN A;  2PD8 A;  3V9R B;  4KZ9 A;  3TOI A;  2HDR A;  3O62 C;  1MPL A;  1BH8 A;  3UTA B;  1P9R A;  3G4P A;  4YM6 C;  4P6Z S;  5FI2 A;  2ZQ7 A;  1ID3 D;  4GD6 A;  1VQQ A;  4Z66 A;  2ZBB A;  4GHI A;  3LZ0 B;  3CHW P;  5EV0 A;  1XJ2 A;  4WBG A;  5AVC A;  3MSH A;  4GDB A;  4X6T A;  3A3F A;  3PR6 A;  3B0C W;  3T4J A;  4LFU A;  4WZ5 C;  4O01 A;  4IBC A;  2ZMV A;  2HIO A;  1H8M A;  3AZJ B;  1H8Y A;  3EQU A;  3NOP C;  5AQ9 A;  3MNN A;  2A49 A;  4E45 A;  4LRZ E;  3PBQ A;  4NXE A;  3AV2 A;  3LY3 A;  3TU4 D;  3KFU G;  3S4X A;  3MVD C;  3ZHH A;  4DRB A;  2PD7 A;  2Y2M A;  3F1N A;  1KX5 C;  3C4P A;  5BNV B;  2Y4A A;  2OAP 1;  1H3Q A;  1ES2 A;  3QNB A;  1WYC A;  1PWG A;  2HP5 A;  3G35 A;  5FI6 A;  1F66 A;  4D60 A;  4X23 C;  4Z2H A;  1XFN A;  3AN2 B;  2L5A A;  3B0D C;  2ZQ9 A;  5F99 B;  1ZLA C;  1PW1 A;  2WGW B;  1U60 A;  3W97 D;  1DJB A;  3O62 D;  2WAE A;  4EBP A;  5BOH A;  3RTY A;  2YFW B;  2D02 A;  3HLC A;  4MLL A;  1CK7 A;  4LEN A;  1DY6 A;  4YM6 D;  1ZHH B;  5EE8 A;  4NXF A;  3RXX A;  4OJP A;  2K7S A;  2CV5 B;  4DDS A;  3AZG B;  4GD8 A;  4Q0J A;  4G3W A;  4IBJ A;  1MXO A;  4B4Z A;  1ZTU A;  1AOI D;  2G2W A;  4IJG A;  4X68 A;  5B0Y C;  4MB5 A;  2QMI A;  5B2I B;  4NFT A;  2ZL1 A;  2B95 A;  1PW8 A;  4Y13 A;  4HGA C;  2VEA A;  4WU9 C;  5DNM C;  1E6N A;  4BQM A;  3DWZ A;  2V8F A;  3NCK A;  2KDK A;  2WKE A;  4OKP A;  2IO5 B;  3MF0 A;  3DTI A;  3MQQ A;  2ZMA A;  4J8W D;  4H9N A;  4JXV A;  4LV1 A;  1S4S A;  5G18 A;  5KDM B;  2EX9 A;  3DTK A;  4HOI A;  1ZLA D;  5AQA A;  4NXG A;  3AZL A;  2ZY2 A;  3MBZ A;  4HEF A;  4XUJ C;  4KUD B;  5GXQ C;  4MB3 A;  5CED A;  3OCL A;  5C3I B;  3REK B;  3TW8 A;  3KSF A;  1I5Q A;  1W5D A;  2W0N A;  1KE4 A;  5C5K A;  3VE3 A;  1L0E A;  3BJN A;  4J8X D;  4WF0 A;  3MFX A;  2F8N B;  1M1A A;  5GT3 C;  4B4X A;  1YMX A;  2PDR A;  3L28 A;  3LR5 A;  2PYO A;  5DFY A;  3MGS C;  3KWQ A;  5CPI B;  1P3K C;  1K25 A;  4QNL A;  1TVF A;  2GX5 A;  3KYQ A;  1S66 L;  4C6Y A;  2JE5 A;  1M18 A;  2P74 A;  3OPH A;  4MDZ A;  3B42 A;  4R23 A;  4WU9 D;  3REJ C;  2EX2 A;  5FI7 A;  2WZX A;  3R45 B;  4WNN A;  2PU2 A;  3GQZ A;  4GNU A;  1H3O A;  3WS4 A;  4XUZ A;  3VP0 A;  1JWP A;  3D3O A;  3IF6 B;  5EUA A;  3T4S A;  3EPK A;  3WTP E;  1FR1 A;  3UPO A;  1JTD A;  2FJ7 C;  4QJG A;  4N92 A;  1ESU A;  2XFS A;  5D3O A;  3UB5 P;  1W63 M;  3GR2 A;  4UUZ A;  4J8V B;  3H82 B;  4HH2 A;  3T4L A;  3UPN A;  5DJU A;  3S1Y A;  1OTA A;  4IJF A;  3ZYT A;  2ZQ8 A;  3WAA C;  5AV9 C;  1HTZ A;  4NZ5 A;  4LPZ A;  1BUL A;  4EBN A;  3VFH A;  2E8I A;  3B33 A;  4ZUX C;  2DNS A;  3MGS D;  1XGJ A;  2PT7 A;  5AV6 B;  1P3K D;  2PU4 A;  3AYW B;  4I3A A;  3LGO A;  3T1X A;  2JKR M;  2FH5 A;  1P34 C;  1E3U A;  3BLM A;  3B6G D;  4FUW A;  4F94 A;  1ESI A;  4CQH A;  4Q0H A;  3REJ D;  3S7Q A;  1STZ A;  4GZB A;  4X1L A;  5HSQ A;  3E2K A;  2ZC6 B;  1HQ3 C;  5DTS A;  1KVM A;  1TAF A;  2V1B A;  3PXP A;  5B0Z C;  4WU8 B;  1YU1 A;  4HQA A;  2XR0 A;  1TZY A;  4ZJ3 A;  4QLC A;  1MWT A;  2HJ9 C;  4GDN A;  4ESP A;  4CLC B;  4JGO A;  2Y2J A;  3AL0 C;  1UR9 A;  1IYS A;  3WRT A;  3LEZ A;  3UDI A;  1NRJ A;  1P97 A;  3IXG A;  1ZKJ A;  2M7U A;  3WKJ C;  3DTE A;  5K5B A;  1NLZ A;  2YKH A;  4KUK A;  3W99 A;  1WWI A;  1D06 A;  5B32 G;  1K54 A;  1P3A A;  2G5I C;  1IYO A;  1W2E A;  5AV9 D;  3WAA D;  3KXB B;  3MGR A;  1YLZ A;  4CAY A;  3B6F A;  4DQY B;  2GJ3 A;  4RX3 A;  1EWZ A;  2JKF A;  4ZUX D;  2WAD A;  3AZN D;  4DXC A;  1P3F A;  4JF5 A;  4PM5 A;  5CHU A;  4DE0 A;  1P34 D;  3X1U B;  3AV1 C;  1E8B A;  2W3H A;  2XRO A;  4TX8 A;  4YS3 B;  2GZA A;  3V9R A;  4I5S A;  3VP1 A;  3N8S A;  4Z5T B;  2FFF B;  4QWO A;  2J3W A;  3OZH A;  1HQ3 D;  1EAK A;  4X55 A;  1T1A A;  5B0Z D;  3LZ0 A;  4EER A;  3TG9 A;  2XGN A;  5JRG A;  2NQB B;  2WGI A;  1KX4 C;  3LEQ A;  5E2F A;  1P3P A;  4IBF A;  3WA9 B;  3ICY A;  4LV3 A;  4G91 B;  2NUP C;  4K0X A;  2KX6 A;  1P3G C;  3AZK C;  3QP6 A;  3WKJ D;  3P01 A;  4E3J A;  3CWF A;  4IVK A;  3O88 A;  1JNU A;  5HAP A;  3CUE C;  4GJ4 A;  1P3I A;  4YOF A;  1K57 C;  4WL9 A;  5B33 B;  1RGY A;  1ZC2 A;  2Q0O A;  2NZD B;  1OGB A;  1SKO B;  5HAR A;  4DE1 A;  1C3B A;  3BFE A;  5DJT A;  5B2J A;  2V0U A;  5AV5 C;  2K2N A;  1SHV A;  2V5O A;  3MXS A;  3A6N C;  1S32 B;  4BBU A;  3AN2 A;  1ES3 A;  4YNR A;  3A3J A;  3AV1 D;  5G49 A;  1H5X A;  3T12 B;  5F99 A;  1W7F A;  2WGW A;  3W98 C;  5B1L A;  4N9L A;  5FAT A;  4XZQ C;  3QP1 A;  4H6J B;  4IHQ A;  2YFW A;  5HL1 A;  1Z09 A;  5BO0 A;  4UPK A;  5E43 A;  4EET B;  3AFA C;  1KX4 D;  3GTC A;  2CV5 A;  4R3J A;  4WM9 A;  3AZG A;  4KGC D;  3UTB A;  1P3M C;  1P3G D;  1P3B D;  3AZK D;  5AQB A;  1YLT A;  1ODV A;  1P3O C;  5M19 A;  3BFD A;  5CPJ B;  3V5M A;  1EW0 A;  5GSU D;  1NY0 A;  1U35 B;  3KS4 A;  4E44 A;  4I38 A;  4U0X A;  1UWP X;  3MXQ A;  5HFO A;  3W96 C;  4EBL A;  2FZ0 A;  4E3I A;  2DMW A;  3X1S B;  3NJA A;  5J3W A;  1H0M A;  1W63 Q;  4CSR B;  4Q0I A;  4E3L A;  3BM6 A;  4ID4 A;  4P6B A;  4ETX A;  2HDU A;  5IS1 A;  3A6N D;  1KDS A;  2VLG A;  2RIQ A;  2HUE B;  3A0V A;  4JJN B;  3ZGA B;  5KDM A;  2IWD A;  5E5A D;  1CK3 A;  2JKG A;  3W98 D;  4J8U B;  4EO5 B;  4EU0 A;  4KZ3 A;  4XZQ D;  3C1C C;  3WTP C;  1OTE A;  3LEL B;  1PWC A;  2Z6D A;  4OON A;  2F8N G;  3MKF A;  3UB7 A;  3WS5 A;  1BTL A;  4X56 A;  3AZI C;  3REH A;  4H9Q B;  5DNN C;  1OTB A;  3VH5 W;  3SOI A;  2ZM0 A;  3NY4 A;  5CP6 A;  1PNE A;  3LR4 A;  1UWN X;  5EFW A;  1KX3 D;  1JVJ A;  4EXO A;  1GHI A;  3EG5 B;  2ZMF A;  3GMW A;  4H9R B;  4Z66 C;  1P3O D;  4WEJ A;  5CPI A;  1K0K A;  5AVC C;  1WWS A;  3A1K A;  5CXW A;  1I2S A;  3NBL A;  4MN5 A;  5KSH A;  2G7U A;  2HIO C;  3EPH A;  4BBT A;  3R45 A;  3MNN C;  1P3L A;  2IOU A;  4KUO A;  5EM1 A;  3AZH B;  3AV2 C;  1CF0 A;  1OGG A;  2RL3 A;  5KZH A;  5GT0 B;  4HNB A;  4IJE A;  3L9K A;  1L0G A;  3AZF D;  3C2W A;  1L2S A;  4JBF A;  4H9O B;  2OOL A;  3C1C D;  3LYX A;  3HON A;  5B1M D;  1F66 C;  5B24 D;  1W79 A;  2YKF A;  3AZI D;  5EVE A;  1BYW A;  1K4E A;  5DNN D;  1EQZ D;  3T4O A;  2ARO B;  2W1R A;  1F9I A;  4JLF A;  4P6Z M;  4UQI S;  2M1C A;  1CXW A;  2BYM B;  2VJW A;  2F2A C;  5F6A A;  4BMW A;  5AV6 A;  5AVC D;  3MR0 A;  2VV7 A;  5AV8 A;  4NZ3 A;  3UY6 A;  3EQV A;  4PPR A;  2LY8 A;  4PM9 A;  4LD9 B;  1J7M A;  4U3T A;  1ULY A;  3AV2 D;  3GV9 A;  1N4O A;  1W1T A;  1WYB A;  3AGD A;  3GVB A;  2PRF A;  2PHY A;  3LI9 A;  1ID3 B;  1Y28 A;  3N8R A;  1YQS A;  1YT4 A;  3KUY D;  4IBI A;  4CLC A;  4WMC D;  4NE5 A;  3C8C A; 
#chains in the Genus database with same CATH homology
 4IBE A;  5CHJ A;  3NIA A;  4LV0 A;  5JA4 B;  1M19 B;  1F66 D;  3V50 A;  1NZO A;  4ZJ1 A;  3VMA A;  3TU4 B;  3VH5 T;  3Q81 A;  2GDN A;  3AZL C;  3KXB A;  1KU5 A;  4R8P B;  4NET A;  3N4I A;  1M1A C;  3AZE A;  2WZZ A;  2JCH A;  4KZA A;  4OJL A;  2PYO C;  1KGG A;  3W97 B;  3SH9 A;  3O62 B;  3KWQ C;  3VSK A;  4FH4 A;  4EWF A;  1M18 C;  2ZM2 A;  3NQU A;  3WA9 A;  5AQ7 A;  5HAQ A;  3WS0 A;  3Q1F A;  3PBT A;  3X1V B;  3I7J A;  1N1J B;  3HBR A;  1AOI B;  1A7W A;  4DDY A;  5BT1 C;  4HES A;  2C5W B;  2NZD A;  5B32 B;  5JYP A;  2WAF A;  2HP6 A;  4H9S A;  1CI8 A;  2DQN C;  4BD0 A;  3L2A A;  1ONG A;  3IWO A;  1S32 A;  2IWB A;  4PM7 A;  4JF4 A;  4JXW A;  1RP5 A;  5CER A;  4J8W B;  3B0D B;  3PBR A;  3C7V A;  5B31 A;  3V3R A;  2R9X A;  4R4S A;  5CRF A;  1Z2C B;  4E3N A;  1BT5 A;  2HDQ A;  4D2O A;  3ZNY A;  5FSR A;  4OPZ A;  2ZJ9 A;  2W8S A;  4J8X B;  3REL D;  3IHA A;  4FSF A;  4RYE A;  4ZDX A;  2ZC7 A;  3D4F A;  5B40 A;  1GA0 A;  2OSU A;  1XX2 A;  1TZY C;  5CPJ A;  4QLC C;  4PM8 A;  5BT1 D;  1U35 A;  1ALQ A;  1BH9 A;  2Y55 A;  3OPL A;  3PAE A;  1NRF A;  3UO9 A;  1BLH A;  4HGA B;  4WU9 B;  4CSR A;  4KHA B;  3BFC A;  3NQJ B;  1FSY A;  1KGF A;  1SKF A;  1YU2 A;  3W99 C;  5M18 A;  1K54 C;  2ZD8 A;  1P3A C;  2XK1 A;  4JJN A;  3CZD A;  3AZM A;  3MGR C;  1BZA A;  1NXY A;  3B6F C;  3LEL A;  5GHZ A;  1P3F C;  3LJA A;  1SDN A;  4H9Q A;  2WYX A;  2JC7 A;  1E3U D;  4FH2 A;  3G2Z A;  3HLD A;  5CTN A;  3PTE A;  4H9R A;  4G92 C;  2A3U A;  1MWR A;  4QD4 A;  3LZ0 C;  1TZY D;  4M3K A;  5JRG C;  3MVD D;  4QLC D;  3MGS B;  4GH9 A;  1P3K B;  1P3P C;  3UDX A;  2BYK B;  2Y2K A;  1KX5 D;  4K91 A;  3B6G B;  3BEB A;  1FOF A;  3FV7 A;  5EVI B;  1S0W A;  4BL3 A;  1P3I C;  4IBB A;  4R1G A;  5CPK A;  3W99 D;  4X23 D;  1P3A D;  3Q7V B;  1YU0 A;  3BFG A;  4OLG A;  3IF5 A;  3AGF A;  3B6F D;  5B2J C;  3O3V A;  4H9O A;  5BS7 A;  3MGQ B;  3C1B B;  4QB8 A;  3FKE A;  2J7V A;  3VH6 T;  2EFX A;  3IWI A;  3AN2 C;  4KZB A;  1DJC A;  3FYZ A;  5F99 C;  2EX8 A;  5B1L C;  2V20 A;  5FQK A;  3LZ1 A;  2ARO A;  2C6W B;  4AWL B;  4UA7 A;  5AV9 B;  3WAA B;  1F1E A;  2ZY3 A;  4IBD A;  3F6T A;  3MGP B;  2BYM A;  5B0Y D;  3HSH A;  5JRG D;  2CV5 C;  3AZN B;  1P3P D;  3AZG C;  3UTB C;  2QPN A;  5DNM D;  5GLA A;  1KVL A;  2WK0 A;  1P3I D;  4H8R A;  3BRM A;  1HQ3 B;  5E2H A;  5B0Z B;  3HLW A;  3UT9 A;  5AVB A;  3REI A;  3MXR A;  4XUJ D;  4NYY A;  3MZE A;  5GXQ D;  5B2J D;  1M19 A;  1LLB A;  4WEK A;  3WKJ B;  4QY6 A;  3AN2 D;  3IH9 A;  3IWQ A;  3P5J B;  1CEG A;  3TU4 A;  1M6K A;  5GT3 D;  5B1L D;  1AXB A;  5EOE A;  5AY8 A;  4R8P A;  3FZC A;  5CEB A;  5BNX B;  3REH C;  4NE6 A;  4OPY A;  5CP6 C;  3PBS A;  2RVQ C;  2BG1 A;  3UTB D;  3AV1 B;  2H0Y A;  3W97 A;  4ZAM A;  5CPI C;  1Z6F A;  4OPQ A;  4KZ6 A;  4XXR A;  1B6W A;  3W8K A;  3EPL A;  1N9B A;  2FJ7 D;  5FAQ A;  3PBO A;  1KX4 B;  1IYP A;  4OJ6 A;  1P3L C;  4KGC B;  3X1V A;  4KQQ A;  1CEF A;  1P3G B;  1P3B B;  3AZK B;  5FAS A;  1JFI B;  3HUN A;  4OH0 A;  1AOI A;  3KS8 A;  3VP3 A;  4S2N A;  1NZU A;  2OLV A;  3ZNT A;  5GSU B;  4X53 A;  5EPH A;  3BLS A;  5B32 A;  1HTA A;  4GOG A;  4OUI A;  4DKI A;  4E3O A;  3REH D;  3WWX A;  3A6N B;  5CP6 D;  2RVQ D;  4J8W A;  1ERQ A;  2WUQ A;  4K0W A;  2CWE A;  3E2L A;  5E5A B;  1G6A A;  5U47 A;  3UTA A;  3ZG7 B;  4XZQ B;  5AV6 C;  1VM1 A;  2Y2Q A;  1MBL A;  4MBK A;  5AV8 C;  1K38 A;  2Q9M A;  1GCE A;  2P9V B;  2OV5 A;  5A93 A;  4J8X A;  4UHU A;  1GHP A;  4S2I A;  4YFM A;  3PAG A;  1P3L D;  5FUG B;  3AZJ A;  1FSW A;  1KX3 B;  4DE2 A;  1MWU A;  4NK3 A;  3M2K A;  1XA1 A;  5TGF A;  1P3O B;  3GSG A;  2Y2G A;  1FCN A;  3HUM A;  1ERO A;  5BNV A;  4ZJ2 A;  3S22 A;  2YFV B;  5FQI A;  3VP2 A;  4KHA A;  4P87 A;  1IEM A;  3NQJ A;  2EXA A;  4GHL A;  1LL9 A;  4LG2 A;  3A3I A;  2PBY A;  1YU3 A;  1W8Q A;  3OPP A;  3AZF B;  3KXB C;  4MBH A;  3ZVW A;  3L29 A;  5AV6 D;  2XLN A;  5B1M B;  3Q7Z A;  5B24 B;  3AZE C;  5AV8 D;  4LCM A;  2XDM A;  5DNN B;  1EQZ B;  4X69 A;  3VH5 A;  1FQG A;  1OME A;  1BH8 B;  1O7E A;  3WRZ A;  3NI9 A;  5A91 A;  1KE0 A;  5B2I A;  2G2U A;  2ZQA A;  4Q8I A;  3WA9 C;  2BYK A;  2XD1 A;  5AVC B;  4G91 C;  3P09 A;  1JTG A;  3UE0 A;  3B6G A;  5AV5 D;  4Z2M G;  5EVI A;  4ZBJ C;  5DTT A;  1BSG A;  3X1T B;  3OCN A;  3AV2 B;  2NZD C;  3Q7V A;  1PYY A;  3VP4 A;  2Y2O A;  3KUY B;  5FAO A;  4S2L A;  4KUD A;  4N9K A;  4H9S C;  3REK A;  4S2M A;  3MGQ A;  1W8Y A;  3C1B A;  1S32 C;  5FDH A;  3AFA D;  3AZE D;  2F8N A;  4E6X A;  5B31 C;  2XEP A;  1P3M D;  1G68 A;  1DJA A;  3UNW A;  3MGP A;  2Y2I A;  2XFT A;  3AZN A;  3W96 D;  5JYO A;  4OQG A;  1K56 D;  5B40 C;  4R4R A;  1YLP A;  5CPJ C;  3IF6 A;  3VFF A;  1U35 C;  1HQ3 A;  2Y2N A;  4JF6 A;  2NZD D;  2ZQD A;  3TSG A;  2VQR A;  4DRA A;  3WTP D;  2XH9 A;  4IED A;  3G2Y A;  3G31 A;  1S32 D;  4J8V A;  2HUE C;  4JJN C;  1K6R A;  3AZM C;  5B31 D;  4EO5 C;  1YUE A;  4KG5 A;  3LEL C;  4MBF A;  4ZTK A;  4Z66 D;  5BNX A;  3LJA C;  3HLB A;  3AYW A;  1YLY A;  3NDG A;  2HIO D;  3MNN D;  3H0R C;  1K55 A;  4H9P B;  5B40 D;  4M6B A;  3IH8 A;  3V3S A;  4WU8 A;  5HW3 A;  4NZ4 A;  1NJ4 A;  1E25 A;  3REL B;  5E2E A;  3SS3 A;  4KGC A;  1P3B A;  5CPK C;  2F8N K;  3KSY A;  3Q07 A;  4XUX A;  5TR7 A;  1IKG A;  4WV4 B;  4WZS B;  2BLS A;  2UWX A;  3N8L A;  3AZM D;  5GSU A;  1RGZ A;  3DTM A;  5BS7 C;  3ITA A;  3SS5 A;  1K4F A;  4KG6 A;  1B67 A;  4JXG A;  3OC2 A;  4JXS A;  3LJA D;  1Q2P A;  2ZLY A;  3DW0 A;  5GLC A;  2F8N H;  3X1U A;  4YS3 A;  3LZ1 C;  4KG2 A;  2ARO C;  2Z2M B;  4Z5T A;  3QNC A;  5E5A A;  4BJP A;  4OP8 A;  4ZBE A;  4YM6 B;  5CTM A;  3WS2 A;  3BFF A;  2NQB A;  3C5A A;  3VH6 A;  1ZG6 A;  2P9V A;  4JPM A;  1M40 A;  5FUG A;  5FAP A;  1R4V A;  2HPB A;  1KX3 A;  4QY5 A;  5CPK D;  3HRE A;  1TAF B;  5B33 A;  3UT9 C;  1TZY B;  5AVB C;  4OLD A;  5EVL A;  3MVD B;  4QLC B;  3REI C;  3UE1 A;  3AZL D;  1MWS A;  2ZY5 A;  4KZ8 A;  5KSC A;  2H0T A;  1PZP A;  5I94 A;  1KX5 B;  2YFV A;  3P98 A;  1M19 C;  1KE3 A;  2CC1 A;  5FQQ A;  2XD5 A;  3W4P A;  1SDE A;  3TU4 C;  1M1A D;  3HVF A;  5F83 A;  4QHC A;  4X23 B;  1ES4 A;  1P3A B;  3ZCZ A;  3LZ1 D;  3MFD A;  2ARO D;  3AZF A;  5AY8 C;  1ZLA B;  2PYO D;  4R8P C;  5M1A A;  4CAY B;  1LHY A;  3VH6 W;  3KWQ D;  4KQR A;  5B1M A;  4NYU A;  5B24 A;  1M18 D;  2X02 A;  1EQZ A;  4KQO A;  2QZ6 A;  1XP4 A;  3W97 C;  1NYM A;  3VOY A;  2V2F F;  4HBU A;  4WZ4 A;  3HLG A;  4G92 B;  5B0Y B;  3UT9 D;  5AVB D;  2VGK A;  3A1I A;  5JRG B;  3REI D;  3IXB A;  4IBK A;  1P3P B;  3O86 A;  5E2G A;  1GA9 A;  3X1V C;  3X1S A;  1BFM A;  1M19 D;  5DNM B;  3HLF A;  1YM1 A;  1AOI C;  3Q82 A;  4S2N C;  1Q9C A;  3X1T A;  2Z2L B;  3FKV A;  1P3I B;  1JWV A;  3B0B A;  1QMF A;  1YLJ A;  5B32 C;  3GRJ A;  1XPB A;  5AY8 D;  3KUY A;  4J8U A;  2I72 A;  4OOL A;  4WMC A;  4LV2 A;  4R8P D;  4XUJ B;  5GXQ B;  5B2J B;  3OPR A;  1IEL A;  2WGV A;  5DF9 A;  3ZG0 A;  1RCJ A;  4J8W C;  5G49 B;  3N3F A;  2J9O A;  5GT3 B;  3UE3 A;  1XA7 A;  5B1L B;  3UTA C;  4OP5 A;  4MEZ A;  4OJO A;  4NZ1 A;  1SCW A;  4EV4 A;  5CGS A;  4DF6 A;  5BO0 B;  4WYY A;  4J8X C;  4Y0T A;  3W4Q A;  4Y0U A;  3W4O A;  3AZJ C;  3X1V D;  3B3X A;  3M6H A;  3UTB B;  3REJ B;  3ZFZ A;  3CMZ A;  5EOO A;  3AZH A;  1L0D A;  5GT0 A;  5GHX A;  4WJ3 C;  5B32 D;  4UAA A;  1EI5 A;  3MGR D;  2G5H C;  3L26 A;  2FJ7 B;  3HUO A;  4IVI A;  5CGW A;  1HD8 A;  5FA7 A;  5DF8 A;  1P3F D;  3DWK A;  2IWC A;  1Y54 A;  4CPK A;  4N1X A;  3IP4 C;  1YMS A;  2ZM5 A;  4YIN A;  3AGE A;  4OPR A;  3UTA D;  1CI9 A;  4PMA A;  3WS1 A;  3LZ0 D;  4ZUX B;  1XGI A;  3REH B;  1KDW A;  5F82 A;  1P34 B;  4UA9 A;  3B0C T;  5CP6 B;  3AZJ D;  4LD9 A;  5GHY A;  4H9P A;  1BLP A;  5B2I C;  1ID3 A;  4B88 A;  3B6G C;  3L25 A;  3REL A;  5EVI C;  2IO5 C;  5JA4 A;  1P3L B;  3MZF A;  2J8P A;  3FWL A;  5L2F A;  5GLB A;  4C75 A;  5DVA A;  5F99 D;  1GHM A;  1Q2Q A;  5CHM A;  4KUD C;  4NY2 A;  5CGX A;  5C3I C;  3REK C;  3MGQ C;  3C1B C;  2HP9 A;  2X01 A;  4JKT A;  4Y0O A;  1XKZ A;  1LI9 A;  3UPP A;  1BLS A;  1BUE A;  2CV5 D;  4OVD A;  3AZG D;  3G32 A;  4KZ5 A;  1NYY A;  3LCE A;  4CJN A;  4AWL C;  3MGP C;  1IYQ A;  2WKI A;  3O62 A;  3ZG5 A;  4YM6 A;  4KEN B;  5HAI A;  5B2I D;  1HVB A;  3AZN C;  4RVA A;  1T3U A;  5AV8 B;  4C3Q A;  2Y2L A;  4OQH A;  4BL2 A;  4WZ5 A;  5EVI D;  1N1J A;  1JWZ A;  5FQ9 A;  3IF6 C;  1PZO A;  4KZ4 A;  3MVD A;  3ZVT A;  4KUD D;  2ZM8 A;  3A3D A;  3VSL A;  3ZDJ A;  3REK D;  3IHB A;  3MGQ D;  1KX5 A;  3C1B D;  1I2W A;  5AV5 B;  4BD1 A;  4J8V C;  3N6I A;  4DXB A;  2F8N D;  2Y91 A;  4X23 A;  1H8Z A;  1ZLA A;  3W98 B;  3MGP D;  4EUZ A;  4OOM A;  5CPI D;  3ITB A;  1L0F A;  3AYW C;  1LI0 A;  2WKH A;  3CG5 A;  2DCF A;  3AFA B;  3AZE B;  1K55 C;  4E3K A;  1P3M B;  4WU8 C;  4L0L A;  3FKW A;  1TEM A;  2RCX A;  4HBT A;  5B0Y A;  3NQU B;  4P85 A;  3SH7 A;  4E3M A;  4KGC C;  1ONH A;  2X71 A;  3W96 B;  4WU9 A;  1PI5 A;  1P3B C;  5DNM A;  1FR6 A;  4J8V D;  1TDL A;  1ZG4 A;  4ZBJ B;  4GN2 A;  3BEC A;  5GSU C;  4MNR A;  4P0M A;  3C4O A;  2ZC3 B;  4IBX A;  4XUJ A;  5GXQ A;  4OQI A;  3C1C B;  3WTP B;  3AYW D;  2B5R A;  3X1U C;  3IXD A;  3IXH A;  5CEC A;  4YS3 C;  4O7D A;  3AZI B;  4Z5T C;  1K6S A;  5E5A C;  5GT3 A;  5B31 B;  1ES5 A;  3H0L C;  1YU4 A;  4GKU A;  4WU8 D;  4Z66 B;  4NE3 A;  5TFQ A;  2NQB C;  3MGS A;  1P3K A;  3UDF A;  2Q9N A;  3HLE A;  5A90 A;  3NDE A;  2HIO B;  1KX3 C;  3REJ A;  5BPV A;  3MNN B;  3IQA A;  4PM6 A;  5B33 C;  2Y2P A;  5B40 B;  2JBF A;  3EPJ A;  1BH9 B;  1LL5 A;  3KXB D;  4EQI A;  4S2J A;  2FJ7 A;  1E4D A;  1FCM A;  1PZR A;  1F66 B;  3X1U D;  5GLD A;  4YS3 D;  4LCL A;  2Y2H A;  3AZF C;  3MZD A;  4Z5T D;  3VOZ A;  3AZM B;  4OQ0 A;  4BEN A;  2FFY A;  5AV9 A;  3WAA A;  2H5S A;  3O87 A;  5B1M C;  5DF7 A;  1KGE A;  5IHV A;  5B24 C;  4ZUX A;  2NQB D;  4R3B A;  4RA7 A;  3LJA B;  3WA9 D;  2XF3 A;  1EQZ C;  1P34 A;  4GB7 A;  4U0T A;  4R0Q A;  3LY4 A;  1FCO A;  5FQJ A;  1WE4 A;  5B33 D;  2JSS A;  3MKE A;  5B0Z A;  5J8X A;  4OOY A;  3X1S C;  3BYD A;  2VGJ A;  3FDD A;  5CHL B;  3QHY A;  3WKJ A;  3X1T C;  3L27 A;  5CPK B;  4DRT A;  1PWD A;  4UA6 A;  4H9N B;  5FQM A;  4J8U C;  3KUY C;  2Y59 A;  3AZL B;  4S2K A;  2J9P A;  2EFU A;  1MKI A;  5F1G A;  1TDG A;  4FCF A;  1S6R A;  5GL9 A;  3JYI A;  4N1H A;  3SH8 A;  2ZC4 B;  3H0M C;  1M1A B;  2H10 A;  3AV1 A;  1HZO A;  3LZ1 B;  4S2O A;  5HX9 A;  2PYO B;  4A5R A;  4DE3 A;  5CPJ D;  3KWQ B;  1U35 D;  3M2J A;  1YLW A;  3WX7 A;  1M18 B;  1KX4 A;  3X1S D;  1ERM A;  2HDS A;  5EEC A;  4WNN B;  3AZH C;  1P3G A;  3AZK A;  2J8Y A;  5GT0 C;  1H3O B;  1JFI A;  3X1T D;  2ZY4 A;  2R9W A;  4RX2 A;  4Z2M H;  4JJN D;  3RJU A;  3G30 A;  1K57 A;  1BLC A;  4J8U D;  3M6B A;  3UT9 B;  5AVB B;  5KMW A;  3REI B;  2ZC5 B;  3LEL D;  5F1F A;  3UN7 A;  3LO7 A;  5AV5 A;  3NC8 A;  4UUZ B;  1QME A;  2EX6 A;  3A6N A;  2V1Z A;  4Z9Q A;  3A3E A;  4E6W A;  1IKI A;  2XQZ A;  5A92 A;  3W98 A;  5AY8 B;  4Y7P A;  4XZQ A;  3ISG A;  1O07 A;  3IT9 A;  4QU3 A;  3AFA A;  4LD9 C;  1J9M A;  2ZQC A;  2OLU A;  1P3M A;  3AZH D;  3RXW A;  4IBG A;  3PBN A;  5GT0 D;  1ID3 C;  2DRW A;  2EXB A;  1P3O A;  3C7U A;  3N7W A;  4FD8 A;  3REL C;  4IBR A;  1XXM A;  1MY8 A;  3W96 A;  5DTK A;  1PIO A;  3G34 A;  1K56 A;  3W99 B;  3CJM A;  2DF4 C;  1PI4 A;  3V39 A;  3HL9 A;  3MGR B;  4GHA A;  3ZG8 B;  3B6F B;  3SS4 A;  4BLM A;  3C1C A;  3WTP A;  4S2P A;  4KZ7 A;  4WEL A;  3ZG9 B;  4OJ5 A;  1P3F B;  5B31 G;  3AZI A;  4LD9 D;  5DNN A;  3V9R B;  4KZ9 A;  3TOI A;  2HDR A;  3O62 C;  1MPL A;  1BH8 A;  3UTA B;  3G4P A;  5FI2 A;  4YM6 C;  2ZQ7 A;  1ID3 D;  4GD6 A;  1VQQ A;  4Z66 A;  3LZ0 B;  4WBG A;  5AVC A;  4GDB A;  4X6T A;  3A3F A;  3B0C W;  4WZ5 C;  4IBC A;  2HIO A;  3AZJ B;  1H8Y A;  3EQU A;  5AQ9 A;  3MNN A;  2A49 A;  4E45 A;  3PBQ A;  3AV2 A;  3LY3 A;  3TU4 D;  3KFU G;  3S4X A;  3MVD C;  3ZHH A;  4DRB A;  2Y2M A;  1KX5 C;  3C4P A;  5BNV B;  2Y4A A;  1ES2 A;  3QNB A;  1WYC A;  1PWG A;  2HP5 A;  3G35 A;  5FI6 A;  1F66 A;  4X23 C;  3AN2 B;  2L5A A;  3B0D C;  2ZQ9 A;  5F99 B;  1ZLA C;  1PW1 A;  2WGW B;  1U60 A;  3W97 D;  1DJB A;  3O62 D;  2WAE A;  4EBP A;  5BOH A;  2YFW B;  3HLC A;  4MLL A;  4LEN A;  1DY6 A;  4YM6 D;  5EE8 A;  3RXX A;  4OJP A;  2CV5 B;  4DDS A;  3AZG B;  4GD8 A;  4IBJ A;  1MXO A;  4B4Z A;  1AOI D;  2G2W A;  4X68 A;  5B0Y C;  2QMI A;  5B2I B;  4NFT A;  1PW8 A;  4HGA C;  4WU9 C;  5DNM C;  4BQM A;  3DWZ A;  3NCK A;  2WKE A;  4OKP A;  2IO5 B;  2ZMA A;  4J8W D;  4H9N A;  4JXV A;  4LV1 A;  5G18 A;  5KDM B;  2EX9 A;  1ZLA D;  5AQA A;  3AZL A;  2ZY2 A;  3MBZ A;  4HEF A;  4XUJ C;  4KUD B;  5GXQ C;  5CED A;  3OCL A;  5C3I B;  3REK B;  1I5Q A;  1W5D A;  1KE4 A;  1L0E A;  4J8X D;  2F8N B;  1M1A A;  5GT3 C;  4B4X A;  1YMX A;  3L28 A;  2PYO A;  3MGS C;  3KWQ A;  5CPI B;  1P3K C;  1K25 A;  4QNL A;  1TVF A;  4C6Y A;  2JE5 A;  1M18 A;  2P74 A;  3OPH A;  4R23 A;  4WU9 D;  3REJ C;  2EX2 A;  5FI7 A;  2WZX A;  3R45 B;  4WNN A;  2PU2 A;  3GQZ A;  4GNU A;  1H3O A;  3WS4 A;  4XUZ A;  3VP0 A;  1JWP A;  3IF6 B;  5EUA A;  3EPK A;  3WTP E;  1FR1 A;  3UPO A;  1JTD A;  2FJ7 C;  4QJG A;  4N92 A;  1ESU A;  2XFS A;  5D3O A;  3GR2 A;  4UUZ A;  4J8V B;  3UPN A;  3S1Y A;  4IJF A;  2ZQ8 A;  3WAA C;  5AV9 C;  1HTZ A;  4NZ5 A;  1BUL A;  4EBN A;  3VFH A;  2E8I A;  4ZUX C;  2DNS A;  3MGS D;  1XGJ A;  5AV6 B;  1P3K D;  2PU4 A;  3AYW B;  1P34 C;  1E3U A;  3BLM A;  3B6G D;  4F94 A;  1ESI A;  3REJ D;  4GZB A;  3E2K A;  2ZC6 B;  1HQ3 C;  5DTS A;  1KVM A;  1TAF A;  5B0Z C;  4WU8 B;  1YU1 A;  2XR0 A;  1TZY A;  4ZJ3 A;  4QLC A;  1MWT A;  4GDN A;  2Y2J A;  3AL0 C;  1IYS A;  3WRT A;  3LEZ A;  3UDI A;  3IXG A;  1ZKJ A;  3WKJ C;  3W99 A;  1WWI A;  5B32 G;  1K54 A;  1P3A A;  2G5I C;  1IYO A;  1W2E A;  5AV9 D;  3WAA D;  3KXB B;  3MGR A;  1YLZ A;  4CAY A;  3B6F A;  4DQY B;  4RX3 A;  1EWZ A;  4ZUX D;  2WAD A;  3AZN D;  4DXC A;  1P3F A;  4JF5 A;  4PM5 A;  5CHU A;  4DE0 A;  1P34 D;  3X1U B;  3AV1 C;  4YS3 B;  3V9R A;  3VP1 A;  3N8S A;  4Z5T B;  2FFF B;  3OZH A;  1HQ3 D;  4X55 A;  5B0Z D;  3LZ0 A;  3TG9 A;  2XGN A;  5JRG A;  2NQB B;  2WGI A;  1KX4 C;  5E2F A;  1P3P A;  4IBF A;  3WA9 B;  4LV3 A;  4G91 B;  4K0X A;  1P3G C;  3AZK C;  3WKJ D;  4E3J A;  4IVK A;  3O88 A;  5HAP A;  1P3I A;  1K57 C;  5B33 B;  1RGY A;  1ZC2 A;  2NZD B;  4DE1 A;  5HAR A;  1C3B A;  3BFE A;  5B2J A;  5AV5 C;  1SHV A;  3MXS A;  3A6N C;  1S32 B;  3AN2 A;  1ES3 A;  3A3J A;  3AV1 D;  5G49 A;  1H5X A;  5F99 A;  1W7F A;  2WGW A;  3W98 C;  5B1L A;  4N9L A;  5FAT A;  4XZQ C;  2YFW A;  5HL1 A;  5BO0 A;  4UPK A;  5E43 A;  3AFA C;  1KX4 D;  3GTC A;  2CV5 A;  4R3J A;  4WM9 A;  3AZG A;  4KGC D;  3UTB A;  1P3M C;  1P3G D;  1P3B D;  3AZK D;  5AQB A;  1YLT A;  1P3O C;  5M19 A;  3BFD A;  5CPJ B;  3V5M A;  5GSU D;  1NY0 A;  1U35 B;  3KS4 A;  4E44 A;  4U0X A;  5HFO A;  3W96 C;  4EBL A;  4E3I A;  3X1S B;  4CSR B;  4E3L A;  3BM6 A;  4ID4 A;  4P6B A;  2HDU A;  3A6N D;  1KDS A;  2RIQ A;  2HUE B;  4JJN B;  3ZGA B;  5KDM A;  2IWD A;  5E5A D;  1CK3 A;  3W98 D;  4J8U B;  4EO5 B;  4KZ3 A;  4XZQ D;  3C1C C;  3WTP C;  1PWC A;  3LEL B;  4OON A;  2F8N G;  3MKF A;  3WS5 A;  1BTL A;  4X56 A;  3AZI C;  3REH A;  4H9Q B;  5DNN C;  3VH5 W;  3SOI A;  2ZM0 A;  3NY4 A;  5CP6 A;  1KX3 D;  1JVJ A;  1GHI A;  3EG5 B;  3GMW A;  4H9R B;  4Z66 C;  1P3O D;  4WEJ A;  5CPI A;  5AVC C;  1WWS A;  3A1K A;  5CXW A;  1I2S A;  3NBL A;  5KSH A;  2HIO C;  3EPH A;  3R45 A;  3MNN C;  1P3L A;  2IOU A;  3AZH B;  3AV2 C;  2RL3 A;  5KZH A;  5GT0 B;  4IJE A;  1L0G A;  3AZF D;  1L2S A;  4JBF A;  4H9O B;  3C1C D;  3HON A;  5B1M D;  1F66 C;  5B24 D;  1W79 A;  3AZI D;  1K4E A;  5DNN D;  1EQZ D;  2ARO B;  4JLF A;  2BYM B;  2F2A C;  5AV6 A;  5AVC D;  5AV8 A;  4NZ3 A;  3UY6 A;  3EQV A;  4PPR A;  2LY8 A;  4PM9 A;  4LD9 B;  4U3T A;  1ULY A;  3AV2 D;  3GV9 A;  1N4O A;  1WYB A;  3AGD A;  3GVB A;  1ID3 B;  1YQS A;  1YT4 A;  3KUY D;  4IBI A;  4WMC D;  4NE5 A;  3N8R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...