2Y2GA

Penicillin-binding protein 1b (pbp-1b) in complex with an alkyl boronate (a01)
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
486
structure length
466
Chain Sequence
EITYSDGTVIASIDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTGQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Guided Design of Cell Wall Biosynthesis Inhibitors that Overcome Beta-Lactam Resistance in Staphylococcus Aureus (Mrsa).
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
molecule keywords PENICILLIN-BINDING PROTEIN 1B
total genus 165
structure length 466
sequence length 486
chains with identical sequence B
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2y2gA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2y2gA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2y2gA02
4E3NA 1WYBA 2ZJ9A 1K54A 5HL1A 4OH0A 3A3FA 4OQIA 2E8IA 1GHIA 3MZEA 1CI8A 1OMEA 4KZAA 1ZC2A 3MBZA 1NY0A 2A49A 3C4OA 3NDGA 5EOEA 3V50A 4LCMA 3HL9A 5CHJA 3V39A 5HAIA 2Y2IA 1EWZA 3GR2A 3OZHA 1SDNA 4CPKA 2ZQAA 4DF6A 2BG1A 3ZG5A 4WYYA 4P0MA 2Q9MA 4CJNA 1EROA 1XP4A 2QPNA 1YM1A 2Y2MA 3LEZA 5M19A 1PWGA 2Y2KA 2HDRA 1KE3A 4PM6A 1LL9A 3VP1A 3IXBA 4BD1A 4C6YA 2OLUA 4WELA 2XDMA 2ZQ8A 2PBYA 3GMWA 4GB7A 1I5QA 3OCLA 4R0QA 3EQVA 4OOYA 1TVFA 3IF5A 2WGWA 3MXSA 1E3UA 3IHBA 5DF8A 1YLTA 4UA6A 5FQIA 1IKIA 4JPMA 2JCHA 2Y2GA 2FFYA 2WKHA 3CZDA 4EBNA 1FCNA 5FQMA 4KG5A 5CXWA 2ZQ9A 3ITAA 5GLBA 3UN7A 3NDEA 5EECA 1I2WA 2DRWA 1S0WA 1K38A 3HUNA 4S2JA 1XA7A 3UY6A 3HUMA 4S2LA 3G4PA 1KVMA 2ZC7A 5L2FA 1HD8A 4BENA 4OQ0A 3BECA 3CJMA 4BL3A 1ES4A 4S2PA 3HVFA 1C3BA 1E3UD 1XX2A 4WZ5C 3IXDA 1FCMA 4E3KA 5JYPA 3E2KA 1L0DA 4DDSA 4DXCA 4K0XA 1TEMA 3DWZA 1PZOA 3HLDA 3ZVTA 1IYOA 2J9PA 5AQ7A 3FKWA 3MKFA 1H5XA 4GOGA 1MWTA 1L0GA 5CEBA 1IELA 2Y59A 4PM8A 4A5RA 4JLFA 1O7EA 4EBPA 1MWRA 3WS2A 4E6WA 1LL5A 1GA9A 2ZC4B 1KDWA 3UPNA 5EVIB 2I72A 4BQMA 2Z2LB 3Q81A 2R9XA 3FWLA 4E3OA 1HZOA 3ZFZA 1K6RA 3Q7VA 5J8XA 4RVAA 4B88A 2QMIA 4PM7A 2WAEA 3S22A 2A3UA 2IWCA 2R9WA 3O88A 1SHVA 4X53A 3FKVA 1L0FA 1WYCA 3GRJA 3JYIA 4KENB 3O86A 1Q2PA 1NYMA 2VGJA 1PIOA 1VQQA 3IWQA 3ZG8B 4ZDXA 4KG6A 5BOHA 2H5SA 3RJUA 4C3QA 5GLAA 3PBTA 4DE0A 4P6BA 2Y4AA 1YT4A 1KGEA 3NY4A 3Q82A 1YLYA 3ZGAB 4OQHA 3ISGA 1Y54A 3BM6A 4OP8A 2ZMAA 1BUEA 4UA7A 5EVID 1RGYA 5FQQA 4PM9A 3SS3A 1W7FA 4WEJA 3W4PA 1KE4A 3PTEA 4R23A 1MKIA 1PI4A 3NC8A 1IKGA 4IBRA 4E3MA 4FCFA 5M1AA 1XA1A 4JF6A 3IWIA 3BRMA 3SH9A 2EX6A 1VM1A 3FZCA 4WMCA 3VP0A 3HLGA 4IVIA 5GLCA 2OSUA 4WBGA 1MPLA 3NCKA 2Y2LA 1NJ4A 2ZQDA 2ZM8A 3Q7ZA 4OOMA 2WAFA 2DCFA 4HBTA 2QZ6A 4N92A 5FDHA 1GA0A 1AXBA 5CGWA 1YMXA 3M2JA 4LV1A 3V5MA 3OPPA 5FQKA 2PU4A 3S1YA 3P09A 1K4EA 1JWZA 4R3BA 3PAEA 2EX8A 3IHAA 3VP2A 3VMAA 3WWXA 3C5AA 3VSKA 2J7VA 4WM9A 3IXHA 5KMWA 1JWVA 4EWFA 4OOLA 3VOYA 3W4OA 4EQIA 2Y2OA 2DNSA 3RXWA 3IQAA 5E2HA 4MBKA 3M6BA 1DJAA 1ESUA 3N8SA 2XH9A 4EV4A 1ZG4A 3Q1FA 3UDXA 4EUZA 1W8YA 1RCJA 2XFTA 5JYOA 4RA7A 2IWDA 3IH8A 1BSGA 1KGGA 1K25A 2H10A 4ZTKA 3HLWA 5A92A 3V3RA 4ID4A 1U60A 5CERA 2XFSA 3W8KA 3P98A 5EVIC 3SOIA 2HDUA 3SS5A 5F1GA 3PBRA 1MBLA 3UDIA 3GSGA 1KDSA 4XXRA 3C4PA 1W5DA 1RP5A 4QB8A 2EXBA 1MWSA 2Y2QA 4IVKA 1PYYA 4X6TA 1XPBA 2HP6A 2X71A 3IWOA 4U3TA 3DW0A 1K57C 2XGNA 5FAPA 5FATA 1W79A 1FCOA 4S2MA 5TR7A 3ZVWA 4OONA 5EOOA 3A3IA 5G18A 3GQZA 1BLHA 2IWBA 3C7UA 4GDBA 1JTGA 3VFFA 4Y0TA 2G2WA 3ZCZA 3Q7VB 3BLSA 2EXAA 2ZQ7A 3SS4A 4K91A 2J9OA 3A3EA 5DF7A 3IF6B 2B5RA 3IF6C 1BLCA 1S6RA 4QY6A 1Q2QA 4OPZA 3UNWA 3LY3A 4NETA 1K6SA 3GV9A 3DTMA 1FR6A 2ZM2A 4S2IA 4MLLA 1MWUA 3V3SA 5M18A 5FASA 2RCXA 4M3KA 1YLZA 1FSYA 4MEZA 1LLBA 3HLCA 4QHCA 4WEKA 1IYQA 5FI2A 1L2SA 1YMSA 4OQGA 1SKFA 5FQ9A 4MBFA 4P85A 3WS5A 4KZ6A 5I94A 2ZC3B 3G30A 2C5WB 4QD4A 5A93A 4GZBA 5FA7A 2XD5A 1E25A 4ZJ3A 3WS4A 4JKTA 1FOFA 4S2NA 5FAOA 3ZDJA 1FSWA 3IF6A 2H0TA 4LV0A 2VGKA 1LI0A 4HBUA 2XK1A 1GCEA 1KGFA 2WZZA 3IT9A 2XEPA 1N9BA 1YLJA 3FYZA 5CTMA 1ESIA 4EBLA 3SH7A 5FI6A 1GHMA 4ZAMA 4JXWA 4K0WA 5D3OA 4KZ9A 4N9KA 3HLFA 1K56A 1K55C 4L0LA 5FQJA 3MZDA 4FD8A 5U47A 3HREA 5F82A 1DY6A 1K56D 4JBFA 2Y91A 1DJCA 1K57A 1H8ZA 2P74A 3MXRA 1K4FA 2WYXA 4R3JA 1NRFA 3I7JA 3OPLA 3FV7A 4P87A 2ZD8A 4X69A 5FAQA 3BFFA 4X68A 4KQOA 1KVLA 5HARA 3QHYA 2Y2NA 1L0EA 2XF3A 2V20A 1DJBA 4IBXA 5FSRA 4C75A 1M6KA 3D4FA 2UWXA 3N4IA 4PPRA 5KSHA 4E3IA 4S2OA 4XUXA 4JXVA 3ZG9B 3EQUA 5A91A 3CMZA 2XLNA 4DE3A 5CHMA 4PM5A 3LO7A 1XGIA 2ZC6B 4LV3A 1SCWA 4DDYA 3N7WA 3N8RA 4F94A 3HBRA 1PW8A 2Y2PA 3BYDA 3MFDA 4X56A 2X01A 5EVLA 2Y2JA 3OPHA 3ZHHA 3BEBA 3LCEA 4YINA 2WGVA 2OV5A 3TSGA 2C6WB 4BD0A 5HX9A 4BLMA 2ZM0A 3N6IA 4WZ5A 3G35A 2Y55A 2Z2MB 1YLPA 3G34A 3Q07A 2Q9NA 3B3XA 5CEDA 5E43A 3ZG7B 3RXXA 5EPHA 5HAQA 3G2ZA 5DF9A 1RGZA 4RYEA 1QMEA 3HUOA 3O87A 3SH8A 4BL2A 2XD1A 2HP5A 3GVBA 5KZHA 1HTZA 4OLGA 2WUQA 5HAPA 4KQQA 1N4OA 4RX3A 4B4XA 4HEFA 2ZC5B 1XGJA 1MY8A 1BULA 2WKIA 3OC2A 1QMFA 1PWCA 1BT5A 3HLEA 4ZBEA 2EFXA 3BLMA 4O7DA 4KZ3A 3PBNA 4ZJ2A 4GDNA 4GD6A 1W8QA 5CRFA 2H0YA 3PBQA 4LENA 5EUAA 4N9LA 4OPQA 5TGFA 3C7VA 4KQRA 4LCLA 4R4RA 4PMAA 5FI7A 1ALQA 1K55A 4JF5A 4NK3A 4DRTA 4E6XA 1YQSA 3G32A 2V2FF 3O3VA 4HESA 2G2UA 3QNBA 3GTCA 1JWPA 3AGDA 2HDSA 2GDNA 4KG2A 5DTTA 4QU3A 1NZUA 2WGWB 3ITBA 1TDGA 2FFFB 3NBLA 5CHUA 1ZG6A 1E4DA 1JVJA 3A3DA 4DE1A 5GLDA 1BLSA 4Z9QA 3BFCA 3NI9A 2JC7A 1XKZA 4DXBA 3VP3A 3M6HA 4R1GA 1CI9A 1CEGA 4IEDA 5DTSA 1ERMA 1J9MA 3MKEA 4E3LA 3M2KA 4D2OA 3WS1A 2PU2A 3IH9A 4UAAA 5CGXA 4JXGA 1PZPA 4WZ4A 3A3JA 3AGEA 5E2EA 4Q8IA 4GN2A 5GHYA 4B4ZA 1CEFA 4Y0OA 2ZQCA 2CC1A 1TDLA 5F1FA 5AQAA 3TG9A 4KZ8A 1ES5A 4JXSA 4MBHA 1BTLA 4XUZA 5HW3A 3PAGA 1XXMA 1NYYA 2WADA 3BFEA 4LV2A 1NZOA 4ZJ1A 3BFDA 3VFHA 1NXYA 3WRZA 3LY4A 2ZLYA 3QNCA 2X02A 4KZBA 3E2LA 4N1XA 4S2KA 5TFQA 4Y7PA 2BLSA 4OP5A 3UE3A 3PBSA 1BZAA 3VSLA 5IHVA 1ERQA 5GHXA 2WZXA 4OLDA 1HVBA 4FSFA 1G68A 4WMCD 2XQZA 5AQ9A 3WRTA 4BJPA 3UPPA 1LI9A 1G6AA 1IEMA 3S4XA 1EI5A 2J8YA 3ZG0A 5CTNA 3G2YA 4GD8A 3OPRA 1ONHA 4DE2A 4R4SA 1O07A 1IYPA 3N8LA 1ES2A 4KZ4A 3W4QA 3G31A 1Z6FA 1M40A 2EX2A 2HP9A 2WKEA 1PI5A 3UO9A 4E3JA 3DWKA 5DTKA 3CG5A 4QJGA 5CGSA 5EVIA 4UHUA 4U0XA 1MXOA 2Y2HA 5A90A 1H8YA 1ONGA 2V1ZA 5DVAA 4FH4A 4GNUA 3UE0A 3AGFA 3UDFA 1K54C 3PBOA 3ZNYA 4OVDA 3UE1A 4UA9A 4Y0UA 1I2SA 3UPOA 2P9VB 4JF4A 3HLBA 2EX9A 1JTDA 3OCNA 5KSCA 1CK3A 4GKUA 4H8RA 5E2GA 3MZFA 2WGIA 4X55A 1ES3A 4OPRA 1PW1A 3TOIA 1SDEA 1WE4A 4OKPA 1GHPA 4OPYA 4DKIA 3ZNTA 4KZ5A 1ZKJA 1FQGA 1PWDA 2P9VA 2XR0A 5GHZA 5GL9A 2OLVA 5F83A 4QY5A 3VP4A 4YFMA 3WS0A 4KZ7A 2HPBA 1YLWA 4U0TA 1LHYA 4FH2A 4RX2A 2HDQA 1BLPA 5E2FA 5AQBA 2JBFA 1IYSA 1FR1A 5CECA 1KE0A 4N1HA 5EE8A 3NIAA 3BFGA 4S2NC 3VOZA 4MNRA 2EFUA 2WK0A 5HFOA 2RL3A 2JE5A 3IXGA
chains in the Genus database with same CATH superfamily
5HL1A 1K54A 4OQIA 3KO6A 3FKEA 1KX3C 1GHIA 2VA0A 3MZEA 4O0PA 4KZAA 3MBZA 4KGCA 4NXGA 3KXBD 5EOEA 3HL9A 3NHQA 2Y2IA 3OZHA 4CPKA 1OT6A 2ZQAA 3MFXA 2NZDD 4CJNA 1U35C 2Y2MA 2HDRA 1ID3A 3VH6T 4G91C 3A1IA 4WELA 4UQIM 4EO5C 1I5QA 3MR0A 1TS7A 3AZNA 5B33A 2ZMVA 3MXSA 1LL8A 4UA6A 5FQIA 4Y5FA 4JPMA 2JCHA 3CZDA 1P3LC 2VV7A 4KG5A 5CXWA 3REKC 4DRAA 3UN7A 3AFAB 1S0WA 1K38A 4S2JA 1XA7A 2JKTI 3UY6A 5TBMA 5B2IB 5HSQA 5L2FA 4ZBJB 4BENA 5E5AA 3UTBD 3UTAD 4S2PA 1C3BA 3MVDA 3KSYA 4LLOB 2JKFA 4DDSA 1TEMA 3HLDA 2ZY3A 3C1CC 5AQ7A 3KS4A 4XUJB 5DNMD 3O62A 5CEBA 3WD0A 1IELA 2Y8HA 5BNVA 3MJQA 4Z5TA 2ZC4B 1KX5C 5CPKB 3FC7A 5EVIB 4BQMA 3VOLA 2Z2LB 1U35D 1H3OB 1DP9A 2PR5A 4E3OA 1HZOA 5J8XA 4RVAA 2WKRA 2QMIA 3WAAB 1H0GA 3LICA 5B31G 3JPUA 5B40C 3O88A 1SHVA 1L0FA 2JKRM 2OAQ1 4UQIS 5CPIB 1KS0A 5BOHA 1PIOA 3IWQA 2H5SA 1OTIA 3REHB 5GLAA 4P6BA 3RELA 3AZGB 1M18A 3NY4A 3WA9A 1YLYA 4I39A 3AZND 3X1TB 1K0KA 3LGOA 5DNMC 1Y54A 4MMNA 4OP8A 3WX7A 1W7FA 3LR4A 3IS2B 3VE3A 4IBIA 3B6GB 1G5UA 4IBRA 2HUEC 2CV5B 1NRJA 2VEAA 4DN0A 2HV1A 2EX6A 1VM1A 3WTPB 5GLCA 2OSUA 4LRXC 4WBGA 2Y2LA 2QZ6A 5FDHA 1AXBA 4J8VA 3CPTA 5CGWA 3WKJA 5GT3A 3UTBC 4LV1A 3MGPB 4ZUXC 3S1YA 5BNXB 1K4EA 4R3BA 3UT9A 1OT9A 3C5AA 5HPIA 4AWLC 1S1YA 4IBGA 4EWFA 4GHIB 3WTPA 2NQBA 3W4OA 5B1LC 4EQIA 4HI4A 2Y2OA 3RXWA 1P3PA 4MBKA 4IJFA 1DJAA 3N8SA 1M19A 1ZG4A 1KX5D 1XJ6A 1M1AD 1T19A 3ZQ5A 1RCJA 2AVXA 2AROB 3KWQB 3IH8A 1OGBA 1E6ZA 1H0IA 3V3RA 4ID4A 4AWLB 4M6BA 2PYRA 2V8CA 3SS5A 5EVIC 2HDUA 3W98B 3H7WA 1MBLA 5KIZA 3CI6A 4QB8A 4JGQA 3EPLA 2W1RA 4U3TA 5F69A 2PDRA 5FAPA 4S2MA 2W3DA 3NQUB 4XZQB 4IJGA 5G18A 3GQZA 1OTEA 4GDBA 2XA7S 2JKGA 3ZCZA 2M7UA 4YOFA 5BT1D 4KUOA 3Q7VB 2EXAA 1KX3B 5GT0C 4NZ1A 5DF7A 3IF6B 3B42A 3IF6C 3LFVA 4OJOA 5IT5A 1P34C 3TU4B 3D3OA 5A8BA 3AN2A 3W97B 3X1TC 3W96C 4WNNA 5F99C 3W99B 4M3KA 2W1TB 1L2SA 4H9OB 3IX3A 2BYMA 4R70A 3MGQB 4MBFA 4WU8D 2Y79A 4NKPA 4P85A 4KZ6A 4QD4A 2L4RA 4Z1WA 2DF4C 1E25A 2KDKA 3WS4A 1ID3C 1FOFA 4S2NA 3CUEC 5GT0D 4NYUA 5FAOA 2H0TA 1KX5B 5B31C 2HGVA 2RTSA 2XK1A 1PFLA 1T1CA 3F1NA 1ESIA 5EM0A 3MGSA 4EBLA 4ZAMA 2QJ7A 4JXWA 4K0WA 1A0KA 3B6FB 3M7PA 4GS9A 3LJAA 3W98D 3E4QA 1A7WA 5EV0A 1S4RA 4MB3A 5F82A 3L26A 3X1SC 3A6NA 3L25A 3MXRA 1K4FA 3F1NB 1TAFA 3I7JA 5AVBA 3TW8A 5J3WA 4X68A 2ZM5A 3AFAC 2O0YA 3QHYA 2V20A 1M6KA 3D4FA 2UWXA 4PPRA 3EPKA 3KWQA 4NY2A 4GHLA 5A91A 4PM5A 2IA2A 2Z6DA 1SCWA 3LELA 3N8RA 3MQ0A 2XROA 3LJAD 3MFDA 2X01A 3C8CA 5EVLA 4EU0A 5FEGA 3LCEA 2WGVA 4HMEA 2OV5A 2C6WB 4Z66A 2HIOA 3N6IA 4WZ5A 1SZVA 3REHA 1TZYD 3X1TD 3G2ZA 4RYEA 1QMEA 3SH8A 4BL2A 4GCZA 2V1BA 3GVBA 4CAYB 3BQAA 2B95A 4OLGA 4R8PA 4GJ4A 5HAPA 3B6GD 4CQHA 3KS8A 1W1TA 1P3IB 4E44A 1QMFA 1CJFA 4HY8A 4DQYB 3CAXA 3MGRB 5E5AB 1Z09A 3AZJC 2JKTM 4GDNA 1YUEA 5CRFA 3TRCA 2H0YA 2QJ5A 4N9LA 3R45B 3C7VA 4KQRA 4PMAA 1K55A 4NK3A 2V2FF 1Q9CA 4HESA 3QNBA 5EM1A 1JWPA 3P7NA 2GDNA 5CX7A 5BPVA 3NBLA 5CHUA 4LGWA 3MQLA 1JVJA 1Y4OA 4QLCD 5B24B 4KHAB 3NI9A 2JC7A 1XKZA 3VP3A 3M6HA 4R1GA 5B1MC 1ERMA 4E3LA 3PHYA 4D2OA 4JXGA 4ZUXA 2VGLS 2YKHA 4GN2A 3W99D 1TD5A 2VKSA 5GSUC 5AJGA 4Z2MG 2NQBC 1T3UA 5AV5A 1X0OA 2VJWA 4MBHA 4XUZA 1BTLA 3B0DC 2WADA 3LJAB 4ZJ1A 2ZLYA 2X02A 3E2LA 1YPRA 2BLSA 4OP5A 1YSQA 3PBSA 3X1UB 5GHXA 1F66B 4MCWA 3F1PB 4LD9D 1HVBA 5DJUA 4BJPA 1P3KB 2VX8A 3S4XA 2J8YA 2PAVP 5CTNA 1P3GB 5B32A 1ONHA 4R4SA 3AV1D 5CP6A 3N8LA 3MNND 1EQZD 1ES2A 3G31A 1Z6FA 4PKYA 4YS3C 5JRGC 1PI5A 2JHEA 4XUJC 3MGRC 3DWKA 4J8VD 4MN6A 1ZLAC 4Y2FA 5CPJD 1MXOA 5A90A 1H8YA 5CPIA 2V1ZA 4FH4A 4J8WA 3UE0A 5AV8C 3PBOA 3UE1A 5AVBB 4ZUXB 2ZY2A 2VGLM 3UTAA 5GSUD 2M1CA 2VV8A 2QYBA 5IU1A 3T4OA 4GKUA 4H8RA 3KFUG 2F8NA 5F99A 4HOIA 4OPRA 1SDEA 1GHPA 1FQGA 4MN5A 4QY5A 2RVQC 3LZ1C 4J8WB 4KZ7A 3VP4A 4CLCC 3REID 1W63M 4FH2A 5B33D 5E2FA 5AQBA 1IYSA 1FR1A 3T4TA 3T4QA 2KX6A 3A6NB 4S2NC 1GPFA 2I9VA 5HFOA 3H0RC 2RL3A 2PHYA 1GOIA 4E3NA 3LZ0D 5HWTA 3A3FA 4BBUA 1CI8A 3C4OA 5HD5A 5DNND 1LSXA 5HAIA 5E5AD 3C2WA 1SDNA 4WYYA 2HJEA 5AVCA 2Q9MA 5AV6A 3HSHA 1YM1A 5M19A 2Y2KA 3WA9B 1LL9A 3VP1A 3IXBA 3O62D 4C6YA 4WF0A 3X1VB 4NE5A 4H9QB 3AV1B 1NLYA 3IX8A 3IF5A 1L6JA 4XUJD 4J8VB 5B0ZD 3AZJB 2FFYA 4I3JA 4X1MA 5JA4B 2ZQ9A 3MS6A 1KX4C 3NDEA 1F66C 1W1VA 3REJA 5AVEA 3HUMA 5DNNC 4KUKA 3SW1A 1KVMA 1HD8A 3F1PA 4WZ5C 1U35A 3EGXC 3EG5B 4DXCA 1CK7A 4NXEA 4K0XA 3REKD 3IBRA 3DWZA 3LZ0A 4LRYC 3LIFA 1BH8A 2XRNA 3AZMD 2J9PA 1ZTUA 1MWTA 4J8XC 3AZGD 4JLFA 3BW6A 1MWRA 5B33C 3UPNA 2J3WA 3Q81A 4J8UA 2R9XA 3X1UA 3FWLA 1KX4D 3MMHA 3ZFZA 1K6RA 1WA9A 1HQ3B 3RFBA 3OBFA 2WAEA 3LZ0B 3S22A 2R9WA 4DRBA 3B6GC 4X53A 3LUQA 5DKLA 2XA7M 3GRJA 3MXQA 4R8PB 2W3GA 3KUYA 3KSHA 3KYQA 3ZG8B 4ZDXA 2VV6A 4KG6A 3NOTC 3PBTA 2Y4AA 1KGEA 3LIEA 4Z2MH 3AZMC 4EXOA 4O8GA 3ISGA 1G28A 4EUVA 4CLCB 5FEFA 2CWEA 3BM6A 2ZMAA 4UA7A 3O62C 4YWZA 3FPWA 4H9RA 2O99A 3W4PA 4IBJA 1KE4A 3PTEA 3K2NA 1MKIA 3W99A 1P3IC 3UB8A 4FCFA 5M1AA 3E98A 4JF6A 5GSUA 4KUDD 4Q0HA 3JVUA 5B1MB 3FZCA 3T4SA 1DP8A 5CPKC 3NCKA 2ZQDA 4OJLA 3L7HA 4LD9B 2WAFA 4H9PA 4HBTA 4N92A 1GA0A 1YMXA 3AZED 3RELC 5GXQC 3OPPA 4IBBA 2PU4A 5FQKA 3UB5P 1JWZA 3VP2A 3PAEA 3MNNA 1EQZA 3IHAA 4JGPA 3C1BB 1YU2A 2ZL1A 4WM9A 3VH5W 2VLGA 5AV5D 3AV2D 1E6PA 1PRQA 4ZBJC 4LD9A 3MVDC 1MKMA 1ESUA 5B2JB 3Q1FA 1MZUA 3UDXA 4EUZA 4ZUXD 2PBDP 2XFTA 3UE6A 5JYOA 1SKOB 5C3IC 1KGGA 1W2EA 3O62B 4HP4A 5BO0B 5CERA 2XFSA 4R3AA 4H9RB 3SOIA 3B0CW 5J4EA 2VZWA 5GT3C 4X23A 3UDIA 3KX0X 3C4PA 2HIOD 4DJ3A 3UT9C 2Y2QA 2V9AA 4IVKA 1PYYA 1XPBA 5B40A 3DTIA 4R38A 3MGPA 3CWFA 3DW0A 4ZRRA 2XGNA 4II7A 5TR7A 3ZVWA 1HQ3C 2IO5B 5EOOA 3LR0A 1BLHA 2IWBA 3KWQD 4Y0TA 1JTGA 3VFFA 4JJND 1UR9A 2B5RA 1BLCA 3U4LP 1Q2QA 4OPZA 4KUDC 3UNWA 3EEAA 4HIAA 4MLLA 1MWUA 4X25A 3HLCA 4WEKA 3W98A 5FI2A 1YMSA 5B0YB 3X1VD 1H0MA 1SKFA 1P34B 3WS5A 1SKOA 4E45A 3T1RA 3G30A 2C5WB 4WNNB 2XD5A 4X1LA 1P3GC 2W3FA 5B0ZB 4JKTA 4JJNC 4WU9D 2PYOC 3DTKA 5GT0A 3WKJC 1CQAA 3GECA 3IF6A 4NYYA 1N9BA 1YLJA 3FYZA 1P3MB 3FG8A 1H3QA 3SH7A 3D9YA 4Z66D 3AN2C 3AN2B 1TS8A 3W96A 3C1CB 4KZ9A 4N9KA 4GLQA 4Z2KA 4H9SC 5FQJA 4FD8A 3HREA 1K56D 4PHTA 4NE3A 3NECA 3WKJB 4LG2A 5B31D 3QP1A 4NE6A 1K57A 1BH8B 5F5YA 1TZYB 2WYXA 3FV7A 4X69A 5FAQA 1F5MA 2G7UA 2K7SA 5B32B 4KQOA 5HARA 3T4KA 2PYOD 2OAP1 2Y2NA 1L0EA 5FSRA 4K08A 2HF6A 1HQ3D 3B33A 5KSHA 1VEUB 4XUXA 1VETA 5B31A 2XLNA 4XZQC 4DE3A 4O01A 1XGIA 2ZC6B 3RH8B 5L10A 4DDYA 4L9FA 3HBRA 1PW8A 4MDZA 5B1LD 3OPHA 4CAYA 3W97A 3LEQA 4ARZA 3TSGA 3X1VA 5HX9A 2ZM0A 3G35A 4BWIA 2Z2MB 3Q07A 2Q9NA 3B3XA 5DJTA 2W8SA 5E43A 3H0LC 3RXXA 1W63Q 5DF9A 4EEPA 5F99B 3UMDA 3HUOA 5B2ID 1GSWA 3F1OB 2Z6CA 2WUQA 3H9WA 4RX3A 4Y15A 2R78A 4HJ4A 2ZC5B 1XGJA 1B6WA 1MY8A 2WKIA 3MGQC 1BT5A 3HLEA 4ZBEA 5BNVB 4JGRA 1VHMA 3IX4A 5GT3B 4OPQA 4R4RA 4LCLA 1D06A 1CF0A 3AZHD 4Z66C 3AN2D 3O3VA 3AZEB 5C3IB 3GTCA 3K3DA 5AY8B 4QU3A 1NZUA 1QO6A 2WGWB 2FFFB 1KU5A 1ZG6A 3LI9A 3HCYA 1BLSA 3BFCA 3BY8A 4PKYG 3EEHA 2JN7A 3B0CT 2JKRI 4IEDA 1T18A 1PZRA 1J9MA 3MKEA 4MB5A 3IH9A 4UAAA 2DQNC 3LJAC 5E2EA 5BT1C 2ZOIA 5GHYA 4B4ZA 2O9AA 3AZJA 4Y0OA 3R7WA 1TZYC 3MQOA 1TDLA 4Z2GA 1FIKA 5AQAA 2F2AC 1P34D 1OPXA 5HW3A 3HJIA 3AZLA 4HH3A 4LV2A 1NZOA 4NZ3A 2D49A 3BFDA 1NXYA 3VH6A 3IP4C 2G5IC 2HIOB 3QNCA 3AZFB 2ZY5A 4N1XA 1P0ZA 4Y17A 4FSFA 3WD2A 2XQZA 2WKPA 1E15A 5F6AA 3UPPA 3WRTA 1LI9A 4HJ3A 1IEMA 3OPRA 4DE2A 1PDCA 5HZHA 1IYPA 1YKDA 3X1SD 3MGPC 2K31A 4GH9A 3NOUC 2EX2A 2HP9A 3RELB 2EWVA 2WKEA 4EO5B 5GT3D 1S1ZA 5G49A 4FUWA 3CG5A 1UR8A 2FH5A 2J3TC 1ONGA 3AFAD 3L9KA 1O6IA 4J8XD 2FN2A 3UPOA 4Y0UA 4JF4A 3HLBA 4KUDA 2EX9A 4BBVA 3WD4A 3MZFA 2QKPA 2YKFA 3T4JA 3P5JB 4I3IA 3T1SA 1WE4A 3ZNTA 4KZ5A 4LRZE 3PYPA 1YU3A 3ZYTA 2OLVA 5AV8D 3WTPD 2GJ3A 3PXPA 5HPFA 5DNMB 3S7NA 4RX2A 1BLPA 3ULFA 3WA9D 5CPJB 1OGGA 4GHAA 3WD1A 5G4ZA 5EE8A 4QNLA 1P3FB 3NIAA 3BFGA 3VOZA 1L3LA 2JE5A 3LELB 2V0WA 3WAAD 2W3HA 3LR3A 1OMEA 1BH9A 2NZDA 4UEYA 1NY0A 1LSWA 2A49A 3NDGA 4LCMA 5CHJA 1P3BA 1EWZA 3KXBA 2RIQA 4J8UD 5BS7A 2BG1A 4NEED 5HDCA 1EROA 2QPNA 1XP4A 2AROD 1PWGA 4PM6A 1KE3A 1Y28A 4BD1A 2A24B 2ACGA 2OLUA 1M18C 3GMWA 3WA9C 3OCLA 5AY8D 3AZKD 4QLCC 4WU8B 2W3EA 4R0QA 2V0UA 3EQVA 4OOYA 3RELD 2WGWA 1E3UA 3IHBA 2V5OA 1YLTA 1IKIA 4IBEA 2Y2GA 5BO0A 4EBNA 3F1OA 1FCNA 5FQMA 1G6OA 5DNNB 5EECA 2DRWA 2AROA 2VQRA 5F99D 5CP6C 2J8PA 2ZC7A 3A0SA 3QP5A 1AIWA 3BECA 1LSVA 3CJMA 4BL3A 1ES4A 5AVCC 5FL3A 3WTPE 1XX2A 4G3KA 3IXDA 1FCMA 3B6FD 5B0ZC 3REJB 1L0DA 3WAAA 1PZOA 3LZ1B 4J8WC 3LIAA 3ZVTA 1IYOA 4OJ5A 5AY8C 3AZKC 2OWJA 4ESPA 1L0GA 5DFYA 4A5RA 3U2AA 1O7EA 3NJAA 3WS2A 4E6WA 1GA9A 5AV6D 3N3FA 1KDWA 3GDIA 1MC0A 1M1AB 1IOUA 3Q7VA 2WKQA 2DMWA 3L27A 4PM7A 2A3UA 4L9GA 2NUPC 3L2AA 5AVFA 5K5BA 1XJ2A 3KYEA 2EWWA 2F8ND 4KENB 3D72A 1JNUA 3RJUA 5EFWA 4C3QA 4DE0A 1N1JB 1YT4A 2IO5C 3OLOA 5HD3A 3ZGAB 4OQHA 1P3AC 4WU8C 3AZNC 3AZLD 3AZHC 1BUEA 2BASA 3AV1C 1RGYA 3A0VA 4WEJA 1V9ZA 1XFQA 1ID3D 4OUIA 4R23A 4IUKA 3X1UC 3NC8A 4I3AA 1S32B 1P3OD 5FDSA 2INWA 1AOIC 2V1AA 3BRMA 3TU4C 3CHWP 4LFUA 3SH9A 3VP0A 1NLZA 3SZTA 5J7EA 4IVIA 1MPLA 3G6OA 3Q7ZA 2ZL1B 2DCFA 4Y3IA 4Q0JA 4HGAB 1Z2CB 5KDMA 5JRGB 3LIDA 4ETZA 1H3OA 2A24A 2O9CA 4KHAA 3K3CA 3P09A 3VMAA 2EX8A 5L07A 3REJC 2RVQD 3LZ1D 4M4XA 3VSKA 2J7VA 2Q0OA 2YFVA 5KMWA 1JWVA 2EA9A 3VOYA 2KOIA 4WV4B 1N9LA 3AL0C 1P3MC 3CUEA 3LZ0C 4RA7A 2IWDA 1J7MA 2J3TD 2H10A 4ZTKA 2HJ9C 5A92A 4J8XA 1U60A 1F2KA 3P98A 4B93A 5CPID 3PBRA 2FJ7A 3B0DB 5B24C 5B2JC 3REHD 3F6TA 1P3FA 3L29A 1RP5A 1P3OC 4FOFA 5AV5B 4HJ6A 2JSSA 3S7OA 3NQJB 5AV9B 4WL9A 4X6TA 3X1SA 3IWOA 1P3AB 3C30A 1W79A 1FCOA 4OONA 4ARZB 1GSVA 5HL6A 3C7UA 4IHQA 3BLSA 3RTYA 2ZQ7A 2J9OA 1UWNX 1S32D 4QY6A 4EQ1A 1AOID 4HMDA 3LY3A 4J8UB 4NETA 1K6SA 1OJGA 3GV9A 4BMWA 3DTMA 2ZM2A 3V3SA 1P3MD 3W99C 1FSYA 4Y13A 2A2LA 4QHCA 1IYQA 1ZLAB 3EPJA 4HMCA 5FQ9A 3AZKB 5G4YA 1P3BC 5B1LA 1T1BA 3C1BA 1W1YA 5I94A 2ZC3B 2OWHA 5HWWA 5FA7A 4GS9B 4ZJ3A 3ZDJA 1FSWA 3VH5A 3MGRD 1S32C 4BBTA 2VGKA 1E6NA 1BYWA 3REIB 4HQAA 1GCEA 2WZZA 4DMZA 5CTMA 1V9YA 5FI6A 1GHMA 5D3OA 5B0YD 1DRMA 4H9NB 3A6ND 1P3GD 2K2NA 4P6ZM 1ZHHB 3HLFA 1K55C 4I38A 3W98C 4H9PB 2PT7A 3MZDA 3BY9A 1DY6A 5B24D 4QLCB 2QHKA 4IBFA 1DJCA 3EOIA 1B67A 5B0YA 4MB4A 2P74A 1VETB 5I5LA 2FZ0A 5AV6B 1N9OA 1NRFA 3OPLA 5CPKD 2ZD8A 4P87A 2D02A 2BTFP 3BFFA 3QP8A 5DKKA 5AVBD 4JJNA 4IBXA 1DJBA 4Q0IA 2D01A 4E3IA 4S2OA 3H0MC 4WU9A 4JXVA 5B2IA 3EQUA 1ED7A 5G49B 3CMZA 5JRGD 1M1AC 3LO7A 4E04A 1VB6A 3N7WA 3X1TA 4F94A 2Y2PA 3KYZA 3BYDA 3LI8A 5AV5C 2Y2JA 3NULA 3BEBA 3V9RB 4YINA 3W97D 4NG2A 3G34A 3AZNB 3ZG7B 2FJ7D 5GXQD 1RGZA 3O87A 2XD1A 3W2ZA 1ID3B 4X23B 5KZHA 3B0BA 4YM6C 4KQQA 4B4XA 1S4SA 3V67A 1BULA 3OC2A 3REIC 2GX5A 4WU8A 1PWCA 5GT0B 4KZ3A 3UB7A 3PBNA 4ZJ2A 2ZY4A 1W8QA 3E4OA 3PBQA 4LENA 5TGFA 5EUAA 3T50A 4ETXA 4YS3A 1R4VA 3W97C 1TAFB 1ALQA 4JF5A 4DRTA 1P3AD 2NUTC 4XT2B 1P3GA 2G2UA 3W96D 3AGDA 1ZLAA 3AZFA 2HDSA 4H9OA 1AOIA 4WN5A 5DTTA 3A6NC 1E4DA 3A3DA 4DE1A 3MVDB 5GLDA 4DXBA 3UTAC 3AYWB 3IBJA 1CI9A 4NFTA 3M2KA 3WS1A 1J3WA 2PU2A 3TU4D 2LB5A 1PZPA 3KWQC 3AGEA 4Q8IA 3LELC 2ZQCA 4H9QA 5F1FA 1CXWA 2NQBD 3VH5T 4JXSA 4WUJA 2HIOC 3X1SB 1P3MA 3C38A 3UT9D 3QP4A 3VFHA 3WRZA 1M18D 3LY4A 2PR6A 1H8MA 2L1MA 4IUHA 3AZEA 4Y7PA 4KUDB 3UE3A 1JFIA 3JVVA 3KUYD 5L09A 3VSLA 5IHVA 2FJ7C 4QPRA 3B47A 5AQ9A 1P3LB 1OTAA 3AV2A 1N9NA 1P3OA 4EESA 3KSGA 3ZG0A 1HTAA 3G2YA 1OTDA 1WWSA 5HDSA 4KZ4A 4Z5TD 3AZIC 1E6RA 4E3JA 2PYPA 4UUZB 1E88A 3VV4A 1ODVA 4D60A 1WWIA 5CPJC 4GNUA 3UDFA 1K54C 3ZNYA 3C1CA 3W96B 1I2SA 2P9VB 3PR6A 2F8NK 1PNEA 4KGCC 3OCNA 4HP9A 5F68A 1P97A 1KX5A 2WGIA 1M19D 1PW1A 4IJEA 4OKPA 3NOPC 2QWSA 3R4KA 4DKIA 5IS1A 1ZKJA 4YNRA 4OJ6A 4H9NA 2B18A 5F83A 3WS0A 4YFMA 4B9OA 2HPBA 5LBRA 3FDDA 3T1QB 2HDQA 2YFWA 3T4LA 4N1HA 3S7QA 3ICYA 1F98A 4CSRB 4IBDA 2PD7A 2EFUA 4XT2A 3IXGA 1P3LA 1WYBA 2ZJ9A 5B32G 4OH0A 3REKA 2KLIA 2E8IA 1ZC2A 2ZMFA 3HONA 3V50A 3V39A 3X1UD 1TF1A 1XJ4A 3GR2A 3UB9A 5E5AC 4DF6A 3ZG5A 1FILA 3KUYC 2YFVB 4P0MA 3LEZA 5B32C 3MF0A 2W27A 1P3LD 1XJ3A 2L5AA 4UPKA 2XDMA 2ZQ8A 2PBYA 5B0YC 3AZMA 4XUJA 4GB7A 4EEUA 4Z5TB 4Z5TC 3B6FA 1TVFA 2LY8A 3MVDD 5DF8A 1KOUA 5C5KA 5AV8A 3UTBA 2WKHA 2G5HC 5GLBA 3ITAA 5B2IC 2FJ7B 1I2WA 4Z2HA 1BH9B 2NZDB 3HUNA 4S2LA 3G4PA 1UWPX 3WTPC 4Z2JA 4OQ0A 5BS7C 4JJNB 3HVFA 4Z2LA 4KGCD 1E3UD 3BWLA 4E3KA 5JYPA 1M19C 3E2KA 4WZSB 3FPVA 1STZA 5JA4A 3UT9B 4YM6D 1NWZA 5DNMA 3FKWA 4GW9A 4L9EA 3MKFA 1H5XA 4GHIA 4GOGA 2Y59A 4PM8A 3MNNC 1EQZC 2PRFA 4EBPA 4TX8A 3O5YA 4IBCA 1LL5A 5AVCD 1P9WA 2I72A 2LB9A 4AFIA 5B32D 3REIA 2H28A 2PYOB 4R6LA 4B88A 2V8FA 2AROC 3UTAB 2IWCA 2CV5D 2OOLA 3FKVA 1LT0A 3AYWD 1WYCA 3JYIA 3O86A 1Q2PA 1NYMA 1VQQA 2VGJA 5AV6C 5B1LB 3AZFC 2CMNA 4J8VC 3Q82A 1F1EA 2P7JA 5AY8A 5EVID 1P34A 3EPHA 5FQQA 4PM9A 3SS3A 3KXBC 1PI4A 2O9BA 1IKGA 1F66A 1EAKA 4E3MA 1M19B 1P3BD 2F8NB 1XA1A 5DNNA 3IWIA 4MN7A 4WMCA 4J8WD 3HLGA 4QWOA 4QLCA 1NJ4A 2ZM8A 2XSSA 5B33B 4OOMA 4WJ3C 1P3KD 3AZLB 1P9RA 4KGCB 3M2JA 3AZEC 3V5MA 3QP2A 5TJJA 1P3AA 3WWXA 3AZHA 3NQJA 5AV9A 3AV1A 1EW0A 3IXHA 4OOLA 4J8UC 3AV2C 5EVEA 2DNSA 3MQQA 3IQAA 5E2HA 3M6BA 5L8MA 3CITA 2XH9A 4EV4A 4XZQD 1W8YA 3P01A 1KX4B 3B6GA 1VEUA 3WAAC 4IBKA 3TU4A 3AZIA 1BSGA 1K25A 3HLWA 3C1CD 3W8KA 5AVBC 3AYWC 4H6JB 2W1TA 5CHLB 3AFAA 5F1GA 2HUEB 2CV5C 5CPJA 4ME4A 3GSGA 1KDSA 4XXRA 5HWVA 3T12B 3BQ8A 1W5DA 3LYXA 3AZFD 2F8NH 2EXBA 1MWSA 3H82A 3AZJD 5KDMB 2HP6A 5CP6D 2X71A 1K57C 1H8PA 4UUZA 5FATA 1P3IA 3AZGC 1IFQA 1ULYA 3A3IA 4HHDA 1P3KC 3MGQD 2G2WA 3T1XA 3REHC 3E4PA 3EGDC 1D1JA 3SS4A 4K91A 3A3EA 1T1AA 4DJ2A 1S6RA 5CPKA 3REKB 5B1MD 4YM6B 3MGSC 3BJNA 1FR6A 5B24A 3R7WB 4S2IA 3MSHA 4YS3D 1S67L 5FASA 5GXQA 2RCXA 2W0NA 4LPZA 5M18A 1YLZA 1JFIB 4MEZA 2BYKA 1LLBA 5AVCB 2MJ6A 3X1VC 4OQGA 4G92C 2L0WA 3AZIB 2IOUA 1GSXA 3L28A 3R45A 4LD9C 4OJPA 4HNBA 1N1JA 1KX3D 5A93A 4GZBA 1S66L 5TBMB 4F3LB 4CLCE 4R8PD 4NZ4A 1P3PB 3CPTB 1AOIB 2P04A 1UGUA 5AV8B 4LV0A 5B2JD 3UB6A 1LI0A 4HBUA 1KX3A 1KGFA 3IT9A 1W1PA 2XEPA 3B6FC 3TE8A 3A1KA 3LR5A 5B40B 3E0YA 4CLCD 1ZLAD 4JGOA 4X23C 4F3LA 4G3VA 1HLUP 1K56A 4L0LA 2UV0E 3LELD 1BFMA 5U47A 3DBAA 3AZMB 4JBFA 2Y91A 4KQDA 1H8ZA 1HQ3A 3WD3A 3LIBA 4R3JA 5CP6B 4R8PC 3HJKA 1KVLA 3VH6W 4EERA 2XF3A 1YAXA 3TJZC 5B2JA 4C75A 2E8JA 1GXDA 3N4IA 1P3FC 3KSFA 3ZG9B 2J80A 5CHMA 1P3ID 4LV3A 3UMEA 1TZYA 4H6JA 4X56A 3C1BD 2GNXA 3ZHHA 1TS0A 3AZLC 4BD0A 4BLMA 2GZAA 3MGSD 4G3WA 2Y55A 1YLPA 5FUGB 5CEDA 5EPHA 5HAQA 1E8BA 5JRGA 3MGRA 2HP5A 3V9RA 5B1MA 1HTZA 1N4OA 2PYOA 4Z2IA 4HEFA 5CPIC 3QP6A 2P08A 1P3BB 3KXBB 1XFNA 2EFXA 3EWKA 4WU9B 4G92B 3BLMA 4O7DA 1D7EA 4GD6A 5DFXA 3C1BC 3A0RA 4NXBA 5FI7A 5HDDA 5B40D 4H9SA 3IS2A 4E6XA 4NXFA 5GXQB 1YQSA 3G32A 4J8XB 2NQBB 4HGAC 4KG2A 4CLCA 4X23D 1TDGA 3ITBA 2B02A 1S32A 4PAUA 4Z9QA 5B31B 3AV2B 2VK3A 1CEGA 2ZBBA 5DTSA 4WLAA 5CGXA 1DP6A 4WZ4A 1F66D 3A3JA 3NQUA 4XZQA 5AV9C 1CEFA 3UTBB 3OOVA 5FUGA 5BNXA 2CC1A 3TG9A 1P3FD 3H82B 5MC7A 4KZ8A 1ES5A 2M7VA 3PAGA 1XXMA 1NYYA 3BFEA 4I5SA 2F8NG 1YSPA 1OTBA 1YU0A 2HZ5A 4KZBA 3S7PA 4S2KA 3MGSB 5TFQA 1OJ5A 1P3OB 4G91B 4WU9C 2PD8A 1M1AA 1BZAA 2NZDC 1YU1A 1U35B 3AYWA 1ERQA 2ZOHA 2CV5A 2WZXA 1ACFA 4OLDA 4WMCD 1G68A 4RQ9A 3MGQA 4Z66B 1G6AA 1P3PC 1EI5A 1KX4A 4GD8A 1O07A 3LZ1A 3MGPD 1YU4A 3KSIA 2YFWB 3W4QA 3VE4A 1M40A 3AZGA 2BYMB 1M18B 3UO9A 3WKJD 5DTKA 4CSRA 1P3KA 4QJGA 5CGSA 4YS3B 4YM6A 5EVIA 4UHUA 4U0XA 1TS6A 2Y2HA 3AZHB 4NZ5A 1F9IA 3KUYB 5DVAA 4P6ZS 3AGFA 3DAVA 4OVDA 3CLOA 4UA9A 1JTDA 3AZID 5KSCA 1CK3A 5E2GA 4X55A 1ES3A 4EW7A 4HH2A 3TOIA 3REJD 4EETB 3MNNB 1EQZB 1P3PD 4OPYA 1PWDA 2P9VA 5GHZA 2XR0A 5GL9A 5B0ZA 1YLWA 1AWIA 4U0TA 1LHYA 5AV9D 2JBFA 5CECA 3H7WB 1KE0A 3AZKA 4MNRA 2WK0A 2BYKB 3DTEA 5GSUB 4FTXA
chains in the Genus database with same CATH topology
5HL1A 1K54A 4OQIA 3FKEA 1KX3C 1GHIA 3MZEA 4KZAA 3MBZA 4KGCA 3KXBD 5EOEA 3HL9A 2Y2IA 3OZHA 4CPKA 2ZQAA 2NZDD 4CJNA 1U35C 2Y2MA 2HDRA 1ID3A 3VH6T 4G91C 3A1IA 4WELA 4EO5C 1I5QA 3AZNA 5B33A 3MXSA 4UA6A 5FQIA 4JPMA 2JCHA 3CZDA 1P3LC 4KG5A 5CXWA 3REKC 4DRAA 3UN7A 3AFAB 1S0WA 1K38A 4S2JA 1XA7A 3UY6A 5B2IB 5L2FA 4ZBJB 4BENA 5E5AA 3UTBD 3UTAD 4S2PA 1C3BA 3MVDA 3KSYA 4DDSA 1TEMA 3HLDA 2ZY3A 3C1CC 5AQ7A 3KS4A 4XUJB 5DNMD 3O62A 5CEBA 1IELA 5BNVA 4Z5TA 2ZC4B 1KX5C 5CPKB 5EVIB 4BQMA 2Z2LB 1U35D 1H3OB 4E3OA 1HZOA 5J8XA 4RVAA 2QMIA 3WAAB 5B31G 5B40C 3O88A 1SHVA 1L0FA 5CPIB 5BOHA 1PIOA 3IWQA 2H5SA 3REHB 5GLAA 4P6BA 3RELA 3AZGB 1M18A 3NY4A 3WA9A 1YLYA 3AZND 3X1TB 5DNMC 1Y54A 4OP8A 3WX7A 1W7FA 4IBIA 3B6GB 4IBRA 2HUEC 2CV5B 2EX6A 1VM1A 3WTPB 5GLCA 2OSUA 4WBGA 2Y2LA 2QZ6A 5FDHA 1AXBA 4J8VA 5CGWA 3WKJA 5GT3A 3UTBC 4LV1A 3MGPB 4ZUXC 3S1YA 5BNXB 1K4EA 4R3BA 3UT9A 3C5AA 4AWLC 4IBGA 4EWFA 3WTPA 2NQBA 3W4OA 5B1LC 4EQIA 2Y2OA 3RXWA 1P3PA 4MBKA 4IJFA 1DJAA 3N8SA 1M19A 1ZG4A 1KX5D 1M1AD 1RCJA 2AROB 3KWQB 3IH8A 3V3RA 4ID4A 4AWLB 4M6BA 3SS5A 5EVIC 2HDUA 3W98B 1MBLA 4QB8A 3EPLA 4U3TA 5FAPA 4S2MA 3NQUB 4XZQB 5G18A 3GQZA 4GDBA 3ZCZA 5BT1D 3Q7VB 2EXAA 1KX3B 5GT0C 4NZ1A 5DF7A 3IF6B 3IF6C 4OJOA 1P34C 3TU4B 3AN2A 3W97B 3X1TC 3W96C 4WNNA 5F99C 3W99B 4M3KA 1L2SA 4H9OB 2BYMA 4MBFA 3MGQB 4WU8D 4P85A 4KZ6A 4QD4A 2DF4C 1E25A 3WS4A 1ID3C 1FOFA 4S2NA 5GT0D 4NYUA 5FAOA 2H0TA 1KX5B 5B31C 2XK1A 1ESIA 3MGSA 4EBLA 4ZAMA 4JXWA 4K0WA 3B6FB 3LJAA 3W98D 1A7WA 5F82A 3L26A 3X1SC 3A6NA 3L25A 3MXRA 1K4FA 1TAFA 3I7JA 5AVBA 4X68A 2ZM5A 3AFAC 3QHYA 2V20A 1M6KA 3D4FA 2UWXA 4PPRA 3EPKA 3KWQA 4NY2A 4GHLA 5A91A 4PM5A 1SCWA 3LELA 3N8RA 3LJAD 3MFDA 2X01A 5EVLA 3LCEA 2WGVA 2OV5A 2C6WB 4Z66A 2HIOA 3N6IA 4WZ5A 3REHA 1TZYD 3X1TD 3G2ZA 4RYEA 1QMEA 3SH8A 4BL2A 3GVBA 4CAYB 4OLGA 4R8PA 5HAPA 3B6GD 3KS8A 1P3IB 4E44A 1QMFA 4DQYB 3MGRB 5E5AB 3AZJC 4GDNA 1YUEA 5CRFA 2H0YA 4N9LA 3R45B 3C7VA 4KQRA 4PMAA 1K55A 4NK3A 2V2FF 1Q9CA 4HESA 3QNBA 1JWPA 2GDNA 5BPVA 3NBLA 5CHUA 1JVJA 4QLCD 5B24B 4KHAB 3NI9A 2JC7A 1XKZA 3VP3A 3M6HA 4R1GA 5B1MC 1ERMA 4E3LA 4D2OA 4JXGA 4ZUXA 4GN2A 3W99D 5GSUC 4Z2MG 2NQBC 1T3UA 5AV5A 4MBHA 4XUZA 1BTLA 3B0DC 2WADA 3LJAB 4ZJ1A 2ZLYA 2X02A 3E2LA 2BLSA 4OP5A 3PBSA 3X1UB 5GHXA 1F66B 4LD9D 1HVBA 4BJPA 1P3KB 3S4XA 2J8YA 5CTNA 1P3GB 5B32A 1ONHA 4R4SA 3AV1D 5CP6A 3N8LA 3MNND 1EQZD 1ES2A 3G31A 1Z6FA 4YS3C 5JRGC 1PI5A 4XUJC 3MGRC 3DWKA 4J8VD 1ZLAC 5CPJD 1MXOA 5A90A 1H8YA 5CPIA 2V1ZA 4FH4A 4J8WA 3UE0A 5AV8C 3PBOA 3UE1A 5AVBB 4ZUXB 2ZY2A 3UTAA 5GSUD 4GKUA 4H8RA 3KFUG 2F8NA 5F99A 4OPRA 1SDEA 1GHPA 1FQGA 4QY5A 2RVQC 3LZ1C 4J8WB 4KZ7A 3VP4A 3REID 4FH2A 5B33D 5E2FA 5AQBA 1IYSA 1FR1A 3A6NB 4S2NC 5HFOA 3H0RC 2RL3A 4E3NA 3LZ0D 3A3FA 1CI8A 3C4OA 5DNND 5HAIA 5E5AD 1SDNA 4WYYA 5AVCA 2Q9MA 5AV6A 3HSHA 1YM1A 5M19A 2Y2KA 3WA9B 1LL9A 3VP1A 3IXBA 3O62D 4C6YA 3X1VB 4NE5A 4H9QB 3AV1B 3IF5A 4XUJD 4J8VB 5B0ZD 3AZJB 2FFYA 5JA4B 2ZQ9A 1KX4C 3NDEA 1F66C 3REJA 3HUMA 5DNNC 1KVMA 1HD8A 4WZ5C 1U35A 3EG5B 4DXCA 4K0XA 3REKD 3DWZA 3LZ0A 1BH8A 3AZMD 2J9PA 1MWTA 4J8XC 3AZGD 4JLFA 1MWRA 5B33C 3UPNA 3Q81A 4J8UA 2R9XA 3X1UA 3FWLA 1KX4D 3ZFZA 1K6RA 1HQ3B 2WAEA 3LZ0B 3S22A 2R9WA 4DRBA 3B6GC 4X53A 3GRJA 4R8PB 3KUYA 3ZG8B 4ZDXA 4KG6A 3PBTA 2Y4AA 1KGEA 4Z2MH 3AZMC 3ISGA 2CWEA 3BM6A 2ZMAA 4UA7A 3O62C 4H9RA 3W4PA 4IBJA 1KE4A 3PTEA 1MKIA 3W99A 1P3IC 4FCFA 5M1AA 4JF6A 5GSUA 4KUDD 5B1MB 3FZCA 5CPKC 3NCKA 2ZQDA 4OJLA 4LD9B 2WAFA 4H9PA 4HBTA 4N92A 1GA0A 1YMXA 3AZED 3RELC 5GXQC 3OPPA 4IBBA 2PU4A 5FQKA 1JWZA 3VP2A 3PAEA 3MNNA 1EQZA 3IHAA 3C1BB 1YU2A 4WM9A 3VH5W 5AV5D 3AV2D 4ZBJC 4LD9A 3MVDC 1ESUA 5B2JB 3Q1FA 3UDXA 4EUZA 4ZUXD 2XFTA 5JYOA 5C3IC 1KGGA 1W2EA 3O62B 5BO0B 5CERA 2XFSA 4H9RB 3SOIA 3B0CW 5GT3C 4X23A 3UDIA 3C4PA 2HIOD 3UT9C 2Y2QA 4IVKA 1PYYA 1XPBA 5B40A 3MGPA 3DW0A 2XGNA 5TR7A 3ZVWA 1HQ3C 2IO5B 5EOOA 1BLHA 2IWBA 3KWQD 4Y0TA 1JTGA 3VFFA 4JJND 2B5RA 1BLCA 1Q2QA 4OPZA 4KUDC 3UNWA 4MLLA 1MWUA 3HLCA 4WEKA 3W98A 5FI2A 1YMSA 5B0YB 3X1VD 1SKFA 1P34B 3WS5A 4E45A 3G30A 2C5WB 4WNNB 2XD5A 1P3GC 5B0ZB 4JKTA 4JJNC 4WU9D 2PYOC 5GT0A 3WKJC 3IF6A 4NYYA 1N9BA 1YLJA 3FYZA 1P3MB 3SH7A 4Z66D 3AN2C 3AN2B 3W96A 3C1CB 4KZ9A 4N9KA 4H9SC 5FQJA 4FD8A 3HREA 1K56D 4NE3A 3WKJB 4LG2A 5B31D 4NE6A 1K57A 1BH8B 1TZYB 2WYXA 3FV7A 4X69A 5FAQA 4KQOA 5B32B 5HARA 2PYOD 2Y2NA 1L0EA 5FSRA 1HQ3D 5KSHA 4XUXA 5B31A 2XLNA 4XZQC 4DE3A 1XGIA 2ZC6B 4DDYA 3HBRA 1PW8A 5B1LD 3OPHA 4CAYA 3W97A 3TSGA 3X1VA 5HX9A 2ZM0A 3G35A 2Z2MB 3Q07A 2Q9NA 3B3XA 2W8SA 5E43A 3H0LC 3RXXA 5DF9A 5F99B 3HUOA 5B2ID 2WUQA 4RX3A 2ZC5B 1XGJA 1B6WA 1MY8A 2WKIA 3MGQC 1BT5A 3HLEA 4ZBEA 5BNVB 5GT3B 4OPQA 4R4RA 4LCLA 3AZHD 4Z66C 3AN2D 3O3VA 3AZEB 5C3IB 3GTCA 5AY8B 4QU3A 1NZUA 2WGWB 2FFFB 1KU5A 1ZG6A 1BLSA 3BFCA 3B0CT 4IEDA 1PZRA 1J9MA 3MKEA 3IH9A 4UAAA 2DQNC 3LJAC 5E2EA 5BT1C 5GHYA 4B4ZA 4Y0OA 3AZJA 1TZYC 1TDLA 5AQAA 2F2AC 1P34D 5HW3A 3AZLA 4LV2A 1NZOA 4NZ3A 3BFDA 1NXYA 3VH6A 3IP4C 2G5IC 2HIOB 3QNCA 3AZFB 2ZY5A 4N1XA 4FSFA 2XQZA 3WRTA 3UPPA 1LI9A 1IEMA 3OPRA 4DE2A 1IYPA 3X1SD 3MGPC 4GH9A 2HP9A 2EX2A 3RELB 2WKEA 4EO5B 5GT3D 5G49A 3CG5A 1ONGA 3AFAD 4J8XD 3UPOA 4Y0UA 4JF4A 3HLBA 4KUDA 2EX9A 3MZFA 3P5JB 1WE4A 3ZNTA 4KZ5A 1YU3A 2OLVA 5AV8D 3WTPD 5DNMB 4RX2A 1BLPA 3WA9D 5CPJB 4GHAA 5EE8A 4QNLA 1P3FB 3NIAA 3BFGA 3VOZA 2JE5A 3LELB 3WAAD 1OMEA 1BH9A 2NZDA 1NY0A 2A49A 3NDGA 4LCMA 5CHJA 1P3BA 1EWZA 3KXBA 2RIQA 4J8UD 5BS7A 2BG1A 1EROA 1XP4A 2QPNA 2AROD 1PWGA 4PM6A 1KE3A 4BD1A 2OLUA 1M18C 3GMWA 3WA9C 3OCLA 5AY8D 3AZKD 4QLCC 4WU8B 4R0QA 3EQVA 4OOYA 3RELD 2WGWA 1E3UA 3IHBA 1YLTA 1IKIA 4IBEA 2Y2GA 5BO0A 4EBNA 1FCNA 5FQMA 5DNNB 5EECA 2DRWA 2AROA 2VQRA 5F99D 5CP6C 2J8PA 2ZC7A 3BECA 3CJMA 4BL3A 1ES4A 5AVCC 3WTPE 1XX2A 3IXDA 1FCMA 3B6FD 5B0ZC 3REJB 1L0DA 3WAAA 1PZOA 3LZ1B 4J8WC 3ZVTA 1IYOA 4OJ5A 5AY8C 3AZKC 1L0GA 4A5RA 1O7EA 3WS2A 4E6WA 1GA9A 5AV6D 3N3FA 1KDWA 1M1AB 3Q7VA 3L27A 4PM7A 2A3UA 3L2AA 2F8ND 4KENB 3RJUA 4C3QA 4DE0A 1N1JB 1YT4A 2IO5C 3ZGAB 4OQHA 1P3AC 4WU8C 3AZNC 3AZLD 3AZHC 1BUEA 3AV1C 1RGYA 4WEJA 1ID3D 4OUIA 4R23A 3X1UC 3NC8A 1S32B 1P3OD 1AOIC 3BRMA 3TU4C 3SH9A 3VP0A 4IVIA 1MPLA 3Q7ZA 2DCFA 4HGAB 1Z2CB 5KDMA 5JRGB 1H3OA 4KHAA 3P09A 3VMAA 2EX8A 3REJC 2RVQD 3LZ1D 3VSKA 2J7VA 2YFVA 5KMWA 1JWVA 3VOYA 4WV4B 3AL0C 1P3MC 3LZ0C 4RA7A 2IWDA 2H10A 4ZTKA 5A92A 4J8XA 1U60A 3P98A 5CPID 3PBRA 2FJ7A 3B0DB 5B24C 5B2JC 3REHD 3F6TA 1P3FA 3L29A 1RP5A 1P3OC 5AV5B 2JSSA 3NQJB 5AV9B 4X6TA 3X1SA 3IWOA 1P3AB 1W79A 1FCOA 4OONA 3C7UA 3BLSA 2ZQ7A 2J9OA 1S32D 4QY6A 1AOID 3LY3A 4J8UB 4NETA 1K6SA 3GV9A 3DTMA 2ZM2A 3V3SA 1P3MD 3W99C 1FSYA 4QHCA 1IYQA 1ZLAB 3EPJA 5FQ9A 3AZKB 1P3BC 5B1LA 3C1BA 5I94A 2ZC3B 5FA7A 4ZJ3A 3ZDJA 1FSWA 3VH5A 3MGRD 1S32C 2VGKA 3REIB 1GCEA 2WZZA 5CTMA 5FI6A 1GHMA 5D3OA 5B0YD 4H9NB 3A6ND 1P3GD 3HLFA 1K55C 3W98C 4H9PB 3MZDA 1DY6A 5B24D 4QLCB 4IBFA 1DJCA 1B67A 5B0YA 2P74A 5AV6B 1NRFA 3OPLA 5CPKD 2ZD8A 4P87A 3BFFA 5AVBD 4JJNA 4IBXA 1DJBA 4E3IA 4S2OA 3H0MC 4WU9A 4JXVA 5B2IA 3EQUA 3CMZA 5G49B 5JRGD 1M1AC 3LO7A 3N7WA 3X1TA 4F94A 2Y2PA 3BYDA 5AV5C 2Y2JA 3BEBA 3V9RB 4YINA 3W97D 3G34A 3AZNB 3ZG7B 2FJ7D 5GXQD 1RGZA 3O87A 2XD1A 1ID3B 4X23B 5KZHA 3B0BA 4YM6C 4KQQA 4B4XA 1BULA 3OC2A 3REIC 4WU8A 1PWCA 5GT0B 4KZ3A 3PBNA 4ZJ2A 2ZY4A 1W8QA 3PBQA 4LENA 5TGFA 5EUAA 4YS3A 1R4VA 3W97C 1TAFB 1ALQA 4JF5A 4DRTA 1P3AD 1P3GA 2G2UA 3W96D 3AGDA 1ZLAA 3AZFA 2HDSA 4H9OA 1AOIA 5DTTA 3A6NC 1E4DA 3A3DA 4DE1A 3MVDB 5GLDA 4DXBA 3UTAC 3AYWB 1CI9A 4NFTA 3M2KA 3WS1A 2PU2A 3TU4D 1PZPA 3KWQC 3AGEA 4Q8IA 3LELC 2ZQCA 4H9QA 5F1FA 2NQBD 3VH5T 4JXSA 2HIOC 3X1SB 1P3MA 3UT9D 3VFHA 3WRZA 1M18D 3LY4A 3AZEA 4Y7PA 4KUDB 3UE3A 1JFIA 3KUYD 3VSLA 5IHVA 2FJ7C 5AQ9A 1P3LB 3AV2A 1P3OA 3ZG0A 1HTAA 3G2YA 1WWSA 4KZ4A 4Z5TD 3AZIC 4E3JA 4UUZB 1WWIA 5CPJC 4GNUA 3UDFA 1K54C 3ZNYA 3C1CA 3W96B 1I2SA 2P9VB 2F8NK 4KGCC 3OCNA 1KX5A 2WGIA 1M19D 1PW1A 4IJEA 4OKPA 4DKIA 1ZKJA 4OJ6A 4H9NA 5F83A 3WS0A 4YFMA 2HPBA 3FDDA 2HDQA 2YFWA 4N1HA 4CSRB 4IBDA 2EFUA 3IXGA 1P3LA 1WYBA 2ZJ9A 5B32G 4OH0A 3REKA 2E8IA 1ZC2A 3HONA 3V50A 3V39A 3X1UD 3GR2A 5E5AC 4DF6A 3ZG5A 3KUYC 2YFVB 4P0MA 3LEZA 5B32C 1P3LD 2L5AA 4UPKA 2XDMA 2ZQ8A 2PBYA 5B0YC 3AZMA 4XUJA 4GB7A 4Z5TB 4Z5TC 3B6FA 1TVFA 2LY8A 3MVDD 5DF8A 5AV8A 3UTBA 2WKHA 2G5HC 5GLBA 3ITAA 5B2IC 2FJ7B 1I2WA 1BH9B 2NZDB 3HUNA 4S2LA 3G4PA 3WTPC 4OQ0A 5BS7C 4JJNB 3HVFA 4KGCD 1E3UD 4E3KA 5JYPA 1M19C 3E2KA 4WZSB 5JA4A 3UT9B 4YM6D 5DNMA 3FKWA 3MKFA 1H5XA 4GOGA 2Y59A 4PM8A 3MNNC 1EQZC 4EBPA 4IBCA 1LL5A 5AVCD 2I72A 5B32D 3REIA 2PYOB 4B88A 2AROC 3UTAB 2IWCA 2CV5D 3FKVA 3AYWD 1WYCA 3JYIA 3O86A 1Q2PA 1NYMA 1VQQA 2VGJA 5AV6C 5B1LB 3AZFC 4J8VC 3Q82A 1F1EA 5AY8A 5EVID 1P34A 3EPHA 5FQQA 4PM9A 3SS3A 3KXBC 1PI4A 1IKGA 1F66A 4E3MA 1M19B 1P3BD 2F8NB 1XA1A 5DNNA 3IWIA 4WMCA 4J8WD 3HLGA 4QLCA 1NJ4A 2ZM8A 4OOMA 5B33B 4WJ3C 1P3KD 3AZLB 4KGCB 3M2JA 3AZEC 3V5MA 1P3AA 3WWXA 3AZHA 3NQJA 5AV9A 3AV1A 3IXHA 4OOLA 4J8UC 3AV2C 2DNSA 3IQAA 5E2HA 3M6BA 2XH9A 4EV4A 4XZQD 1W8YA 1KX4B 3B6GA 3WAAC 4IBKA 3TU4A 3AZIA 1BSGA 1K25A 3HLWA 3C1CD 3W8KA 5AVBC 3AYWC 5F1GA 5CHLB 3AFAA 2HUEB 2CV5C 5CPJA 3GSGA 1KDSA 4XXRA 1W5DA 3AZFD 2F8NH 2EXBA 1MWSA 3AZJD 5KDMB 2HP6A 5CP6D 2X71A 1K57C 5FATA 4UUZA 1P3IA 3AZGC 1ULYA 3A3IA 1P3KC 3MGQD 2G2WA 3REHC 3SS4A 4K91A 3A3EA 1S6RA 5CPKA 3REKB 5B1MD 4YM6B 3MGSC 1FR6A 5B24A 4S2IA 4YS3D 5M18A 5FASA 5GXQA 2RCXA 1YLZA 1JFIB 4MEZA 2BYKA 1LLBA 5AVCB 3X1VC 4OQGA 4G92C 3AZIB 2IOUA 3L28A 3R45A 4LD9C 4OJPA 1N1JA 1KX3D 5A93A 4GZBA 4R8PD 4NZ4A 1P3PB 1AOIB 5AV8B 4LV0A 5B2JD 1LI0A 4HBUA 1KX3A 1KGFA 3IT9A 2XEPA 3B6FC 3A1KA 5B40B 1ZLAD 4X23C 1K56A 4L0LA 3LELD 1BFMA 5U47A 3AZMB 4JBFA 2Y91A 1H8ZA 1HQ3A 4R3JA 5CP6B 4R8PC 1KVLA 3VH6W 2XF3A 4C75A 5B2JA 3N4IA 1P3FC 3ZG9B 5CHMA 1P3ID 4LV3A 1TZYA 4X56A 3C1BD 3ZHHA 3AZLC 4BD0A 4BLMA 3MGSD 2Y55A 1YLPA 5FUGB 5CEDA 5EPHA 5HAQA 5JRGA 3MGRA 2HP5A 3V9RA 5B1MA 1HTZA 1N4OA 2PYOA 4HEFA 5CPIC 1P3BB 3KXBB 2EFXA 4WU9B 4G92B 3BLMA 4O7DA 4GD6A 3C1BC 5FI7A 5B40D 4H9SA 4E6XA 3G32A 5GXQB 1YQSA 4J8XB 2NQBB 4HGAC 4KG2A 4X23D 1TDGA 3ITBA 1S32A 4Z9QA 5B31B 3AV2B 1CEGA 5DTSA 5CGXA 4WZ4A 1F66D 3A3JA 3NQUA 4XZQA 5AV9C 1CEFA 3UTBB 5FUGA 5BNXA 2CC1A 3TG9A 1P3FD 4KZ8A 1ES5A 3PAGA 1XXMA 1NYYA 3BFEA 2F8NG 1YU0A 4KZBA 4S2KA 3MGSB 5TFQA 1P3OB 4G91B 4WU9C 1M1AA 1BZAA 2NZDC 1YU1A 1U35B 3AYWA 1ERQA 2CV5A 2WZXA 4OLDA 4WMCD 1G68A 3MGQA 4Z66B 1G6AA 1P3PC 1EI5A 1KX4A 4GD8A 1O07A 3LZ1A 3MGPD 1YU4A 2YFWB 3W4QA 1M40A 3AZGA 2BYMB 1M18B 3UO9A 3WKJD 5DTKA 4CSRA 1P3KA 4QJGA 5CGSA 4YS3B 4YM6A 5EVIA 4UHUA 4U0XA 2Y2HA 3AZHB 4NZ5A 3KUYB 5DVAA 3AGFA 4OVDA 4UA9A 1JTDA 3AZID 5KSCA 1CK3A 5E2GA 4X55A 1ES3A 3TOIA 3REJD 3MNNB 1EQZB 1P3PD 4OPYA 1PWDA 2P9VA 5GHZA 2XR0A 5GL9A 5B0ZA 1YLWA 4U0TA 1LHYA 5AV9D 2JBFA 5CECA 1KE0A 3AZKA 4MNRA 2WK0A 2BYKB 5GSUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E3N A;  1WYB A;  2ZJ9 A;  1K54 A;  5HL1 A;  4OH0 A;  3A3F A;  4OQI A;  2E8I A;  1GHI A;  3MZE A;  1CI8 A;  1OME A;  4KZA A;  1ZC2 A;  3MBZ A;  1NY0 A;  2A49 A;  3C4O A;  3NDG A;  5EOE A;  3V50 A;  4LCM A;  3HL9 A;  5CHJ A;  3V39 A;  5HAI A;  2Y2I A;  1EWZ A;  3GR2 A;  3OZH A;  1SDN A;  4CPK A;  2ZQA A;  4DF6 A;  2BG1 A;  3ZG5 A;  4WYY A;  4P0M A;  2Q9M A;  4CJN A;  1ERO A;  1XP4 A;  2QPN A;  1YM1 A;  2Y2M A;  3LEZ A;  5M19 A;  1PWG A;  2Y2K A;  2HDR A;  1KE3 A;  4PM6 A;  1LL9 A;  3VP1 A;  3IXB A;  4BD1 A;  4C6Y A;  2OLU A;  4WEL A;  2XDM A;  2ZQ8 A;  2PBY A;  3GMW A;  4GB7 A;  1I5Q A;  3OCL A;  4R0Q A;  3EQV A;  4OOY A;  1TVF A;  3IF5 A;  2WGW A;  3MXS A;  1E3U A;  3IHB A;  5DF8 A;  1YLT A;  4UA6 A;  5FQI A;  1IKI A;  4JPM A;  2JCH A;  2Y2G A;  2FFY A;  2WKH A;  3CZD A;  4EBN A;  1FCN A;  5FQM A;  4KG5 A;  5CXW A;  2ZQ9 A;  3ITA A;  5GLB A;  3UN7 A;  3NDE A;  5EEC A;  1I2W A;  2DRW A;  1S0W A;  1K38 A;  3HUN A;  4S2J A;  1XA7 A;  3UY6 A;  3HUM A;  4S2L A;  3G4P A;  1KVM A;  2ZC7 A;  5L2F A;  1HD8 A;  4BEN A;  4OQ0 A;  3BEC A;  3CJM A;  4BL3 A;  1ES4 A;  4S2P A;  3HVF A;  1C3B A;  1E3U D;  1XX2 A;  4WZ5 C;  3IXD A;  1FCM A;  4E3K A;  5JYP A;  3E2K A;  1L0D A;  4DDS A;  4DXC A;  4K0X A;  1TEM A;  3DWZ A;  1PZO A;  3HLD A;  3ZVT A;  1IYO A;  2J9P A;  5AQ7 A;  3FKW A;  3MKF A;  1H5X A;  4GOG A;  1MWT A;  1L0G A;  5CEB A;  1IEL A;  2Y59 A;  4PM8 A;  4A5R A;  4JLF A;  1O7E A;  4EBP A;  1MWR A;  3WS2 A;  4E6W A;  1LL5 A;  1GA9 A;  2ZC4 B;  1KDW A;  3UPN A;  5EVI B;  2I72 A;  4BQM A;  2Z2L B;  3Q81 A;  2R9X A;  3FWL A;  4E3O A;  1HZO A;  3ZFZ A;  1K6R A;  3Q7V A;  5J8X A;  4RVA A;  4B88 A;  2QMI A;  4PM7 A;  2WAE A;  3S22 A;  2A3U A;  2IWC A;  2R9W A;  3O88 A;  1SHV A;  4X53 A;  3FKV A;  1L0F A;  1WYC A;  3GRJ A;  3JYI A;  4KEN B;  3O86 A;  1Q2P A;  1NYM A;  2VGJ A;  1PIO A;  1VQQ A;  3IWQ A;  3ZG8 B;  4ZDX A;  4KG6 A;  5BOH A;  2H5S A;  3RJU A;  4C3Q A;  5GLA A;  3PBT A;  4DE0 A;  4P6B A;  2Y4A A;  1YT4 A;  1KGE A;  3NY4 A;  3Q82 A;  1YLY A;  3ZGA B;  4OQH A;  3ISG A;  1Y54 A;  3BM6 A;  4OP8 A;  2ZMA A;  1BUE A;  4UA7 A;  5EVI D;  1RGY A;  5FQQ A;  4PM9 A;  3SS3 A;  1W7F A;  4WEJ A;  3W4P A;  1KE4 A;  3PTE A;  4R23 A;  1MKI A;  1PI4 A;  3NC8 A;  1IKG A;  4IBR A;  4E3M A;  4FCF A;  5M1A A;  1XA1 A;  4JF6 A;  3IWI A;  3BRM A;  3SH9 A;  2EX6 A;  1VM1 A;  3FZC A;  4WMC A;  3VP0 A;  3HLG A;  4IVI A;  5GLC A;  2OSU A;  4WBG A;  1MPL A;  3NCK A;  2Y2L A;  1NJ4 A;  2ZQD A;  2ZM8 A;  3Q7Z A;  4OOM A;  2WAF A;  2DCF A;  4HBT A;  2QZ6 A;  4N92 A;  5FDH A;  1GA0 A;  1AXB A;  5CGW A;  1YMX A;  3M2J A;  4LV1 A;  3V5M A;  3OPP A;  5FQK A;  2PU4 A;  3S1Y A;  3P09 A;  1K4E A;  1JWZ A;  4R3B A;  3PAE A;  2EX8 A;  3IHA A;  3VP2 A;  3VMA A;  3WWX A;  3C5A A;  3VSK A;  2J7V A;  4WM9 A;  3IXH A;  5KMW A;  1JWV A;  4EWF A;  4OOL A;  3VOY A;  3W4O A;  4EQI A;  2Y2O A;  2DNS A;  3RXW A;  3IQA A;  5E2H A;  4MBK A;  3M6B A;  1DJA A;  1ESU A;  3N8S A;  2XH9 A;  4EV4 A;  1ZG4 A;  3Q1F A;  3UDX A;  4EUZ A;  1W8Y A;  1RCJ A;  2XFT A;  5JYO A;  4RA7 A;  2IWD A;  3IH8 A;  1BSG A;  1KGG A;  1K25 A;  2H10 A;  4ZTK A;  3HLW A;  5A92 A;  3V3R A;  4ID4 A;  1U60 A;  5CER A;  2XFS A;  3W8K A;  3P98 A;  5EVI C;  3SOI A;  2HDU A;  3SS5 A;  5F1G A;  3PBR A;  1MBL A;  3UDI A;  3GSG A;  1KDS A;  4XXR A;  3C4P A;  1W5D A;  1RP5 A;  4QB8 A;  2EXB A;  1MWS A;  2Y2Q A;  4IVK A;  1PYY A;  4X6T A;  1XPB A;  2HP6 A;  2X71 A;  3IWO A;  4U3T A;  3DW0 A;  1K57 C;  2XGN A;  5FAP A;  5FAT A;  1W79 A;  1FCO A;  4S2M A;  5TR7 A;  3ZVW A;  4OON A;  5EOO A;  3A3I A;  5G18 A;  3GQZ A;  1BLH A;  2IWB A;  3C7U A;  4GDB A;  1JTG A;  3VFF A;  4Y0T A;  2G2W A;  3ZCZ A;  3Q7V B;  3BLS A;  2EXA A;  2ZQ7 A;  3SS4 A;  4K91 A;  2J9O A;  3A3E A;  5DF7 A;  3IF6 B;  2B5R A;  3IF6 C;  1BLC A;  1S6R A;  4QY6 A;  1Q2Q A;  4OPZ A;  3UNW A;  3LY3 A;  4NET A;  1K6S A;  3GV9 A;  3DTM A;  1FR6 A;  2ZM2 A;  4S2I A;  4MLL A;  1MWU A;  3V3S A;  5M18 A;  5FAS A;  2RCX A;  4M3K A;  1YLZ A;  1FSY A;  4MEZ A;  1LLB A;  3HLC A;  4QHC A;  4WEK A;  1IYQ A;  5FI2 A;  1L2S A;  1YMS A;  4OQG A;  1SKF A;  5FQ9 A;  4MBF A;  4P85 A;  3WS5 A;  4KZ6 A;  5I94 A;  2ZC3 B;  3G30 A;  2C5W B;  4QD4 A;  5A93 A;  4GZB A;  5FA7 A;  2XD5 A;  1E25 A;  4ZJ3 A;  3WS4 A;  4JKT A;  1FOF A;  4S2N A;  5FAO A;  3ZDJ A;  1FSW A;  3IF6 A;  2H0T A;  4LV0 A;  2VGK A;  1LI0 A;  4HBU A;  2XK1 A;  1GCE A;  1KGF A;  2WZZ A;  3IT9 A;  2XEP A;  1N9B A;  1YLJ A;  3FYZ A;  5CTM A;  1ESI A;  4EBL A;  3SH7 A;  5FI6 A;  1GHM A;  4ZAM A;  4JXW A;  4K0W A;  5D3O A;  4KZ9 A;  4N9K A;  3HLF A;  1K56 A;  1K55 C;  4L0L A;  5FQJ A;  3MZD A;  4FD8 A;  5U47 A;  3HRE A;  5F82 A;  1DY6 A;  1K56 D;  4JBF A;  2Y91 A;  1DJC A;  1K57 A;  1H8Z A;  2P74 A;  3MXR A;  1K4F A;  2WYX A;  4R3J A;  1NRF A;  3I7J A;  3OPL A;  3FV7 A;  4P87 A;  2ZD8 A;  4X69 A;  5FAQ A;  3BFF A;  4X68 A;  4KQO A;  1KVL A;  5HAR A;  3QHY A;  2Y2N A;  1L0E A;  2XF3 A;  2V20 A;  1DJB A;  4IBX A;  5FSR A;  4C75 A;  1M6K A;  3D4F A;  2UWX A;  3N4I A;  4PPR A;  5KSH A;  4E3I A;  4S2O A;  4XUX A;  4JXV A;  3ZG9 B;  3EQU A;  5A91 A;  3CMZ A;  2XLN A;  4DE3 A;  5CHM A;  4PM5 A;  3LO7 A;  1XGI A;  2ZC6 B;  4LV3 A;  1SCW A;  4DDY A;  3N7W A;  3N8R A;  4F94 A;  3HBR A;  1PW8 A;  2Y2P A;  3BYD A;  3MFD A;  4X56 A;  2X01 A;  5EVL A;  2Y2J A;  3OPH A;  3ZHH A;  3BEB A;  3LCE A;  4YIN A;  2WGV A;  2OV5 A;  3TSG A;  2C6W B;  4BD0 A;  5HX9 A;  4BLM A;  2ZM0 A;  3N6I A;  4WZ5 A;  3G35 A;  2Y55 A;  2Z2M B;  1YLP A;  3G34 A;  3Q07 A;  2Q9N A;  3B3X A;  5CED A;  5E43 A;  3ZG7 B;  3RXX A;  5EPH A;  5HAQ A;  3G2Z A;  5DF9 A;  1RGZ A;  4RYE A;  1QME A;  3HUO A;  3O87 A;  3SH8 A;  4BL2 A;  2XD1 A;  2HP5 A;  3GVB A;  5KZH A;  1HTZ A;  4OLG A;  2WUQ A;  5HAP A;  4KQQ A;  1N4O A;  4RX3 A;  4B4X A;  4HEF A;  2ZC5 B;  1XGJ A;  1MY8 A;  1BUL A;  2WKI A;  3OC2 A;  1QMF A;  1PWC A;  1BT5 A;  3HLE A;  4ZBE A;  2EFX A;  3BLM A;  4O7D A;  4KZ3 A;  3PBN A;  4ZJ2 A;  4GDN A;  4GD6 A;  1W8Q A;  5CRF A;  2H0Y A;  3PBQ A;  4LEN A;  5EUA A;  4N9L A;  4OPQ A;  5TGF A;  3C7V A;  4KQR A;  4LCL A;  4R4R A;  4PMA A;  5FI7 A;  1ALQ A;  1K55 A;  4JF5 A;  4NK3 A;  4DRT A;  4E6X A;  1YQS A;  3G32 A;  2V2F F;  3O3V A;  4HES A;  2G2U A;  3QNB A;  3GTC A;  1JWP A;  3AGD A;  2HDS A;  2GDN A;  4KG2 A;  5DTT A;  4QU3 A;  1NZU A;  2WGW B;  3ITB A;  1TDG A;  2FFF B;  3NBL A;  5CHU A;  1ZG6 A;  1E4D A;  1JVJ A;  3A3D A;  4DE1 A;  5GLD A;  1BLS A;  4Z9Q A;  3BFC A;  3NI9 A;  2JC7 A;  1XKZ A;  4DXB A;  3VP3 A;  3M6H A;  4R1G A;  1CI9 A;  1CEG A;  4IED A;  5DTS A;  1ERM A;  1J9M A;  3MKE A;  4E3L A;  3M2K A;  4D2O A;  3WS1 A;  2PU2 A;  3IH9 A;  4UAA A;  5CGX A;  4JXG A;  1PZP A;  4WZ4 A;  3A3J A;  3AGE A;  5E2E A;  4Q8I A;  4GN2 A;  5GHY A;  4B4Z A;  1CEF A;  4Y0O A;  2ZQC A;  2CC1 A;  1TDL A;  5F1F A;  5AQA A;  3TG9 A;  4KZ8 A;  1ES5 A;  4JXS A;  4MBH A;  1BTL A;  4XUZ A;  5HW3 A;  3PAG A;  1XXM A;  1NYY A;  2WAD A;  3BFE A;  4LV2 A;  1NZO A;  4ZJ1 A;  3BFD A;  3VFH A;  1NXY A;  3WRZ A;  3LY4 A;  2ZLY A;  3QNC A;  2X02 A;  4KZB A;  3E2L A;  4N1X A;  4S2K A;  5TFQ A;  4Y7P A;  2BLS A;  4OP5 A;  3UE3 A;  3PBS A;  1BZA A;  3VSL A;  5IHV A;  1ERQ A;  5GHX A;  2WZX A;  4OLD A;  1HVB A;  4FSF A;  1G68 A;  4WMC D;  2XQZ A;  5AQ9 A;  3WRT A;  4BJP A;  3UPP A;  1LI9 A;  1G6A A;  1IEM A;  3S4X A;  1EI5 A;  2J8Y A;  3ZG0 A;  5CTN A;  3G2Y A;  4GD8 A;  3OPR A;  1ONH A;  4DE2 A;  4R4S A;  1O07 A;  1IYP A;  3N8L A;  1ES2 A;  4KZ4 A;  3W4Q A;  3G31 A;  1Z6F A;  1M40 A;  2EX2 A;  2HP9 A;  2WKE A;  1PI5 A;  3UO9 A;  4E3J A;  3DWK A;  5DTK A;  3CG5 A;  4QJG A;  5CGS A;  5EVI A;  4UHU A;  4U0X A;  1MXO A;  2Y2H A;  5A90 A;  1H8Y A;  1ONG A;  2V1Z A;  5DVA A;  4FH4 A;  4GNU A;  3UE0 A;  3AGF A;  3UDF A;  1K54 C;  3PBO A;  3ZNY A;  4OVD A;  3UE1 A;  4UA9 A;  4Y0U A;  1I2S A;  3UPO A;  2P9V B;  4JF4 A;  3HLB A;  2EX9 A;  1JTD A;  3OCN A;  5KSC A;  1CK3 A;  4GKU A;  4H8R A;  5E2G A;  3MZF A;  2WGI A;  4X55 A;  1ES3 A;  4OPR A;  1PW1 A;  3TOI A;  1SDE A;  1WE4 A;  4OKP A;  1GHP A;  4OPY A;  4DKI A;  3ZNT A;  4KZ5 A;  1ZKJ A;  1FQG A;  1PWD A;  2P9V A;  2XR0 A;  5GHZ A;  5GL9 A;  2OLV A;  5F83 A;  4QY5 A;  3VP4 A;  4YFM A;  3WS0 A;  4KZ7 A;  2HPB A;  1YLW A;  4U0T A;  1LHY A;  4FH2 A;  4RX2 A;  2HDQ A;  1BLP A;  5E2F A;  5AQB A;  2JBF A;  1IYS A;  1FR1 A;  5CEC A;  1KE0 A;  4N1H A;  5EE8 A;  3NIA A;  3BFG A;  4S2N C;  3VOZ A;  4MNR A;  2EFU A;  2WK0 A;  5HFO A;  2RL3 A;  2JE5 A;  3IXG A; 
#chains in the Genus database with same CATH topology
 5HL1 A;  1K54 A;  4OQI A;  3KO6 A;  3FKE A;  1KX3 C;  1GHI A;  2VA0 A;  3MZE A;  4O0P A;  4KZA A;  3MBZ A;  4KGC A;  4NXG A;  3KXB D;  5EOE A;  3HL9 A;  3NHQ A;  2Y2I A;  3OZH A;  4CPK A;  1OT6 A;  2ZQA A;  3MFX A;  2NZD D;  4CJN A;  1U35 C;  2Y2M A;  2HDR A;  1ID3 A;  3VH6 T;  4G91 C;  3A1I A;  4WEL A;  4UQI M;  4EO5 C;  1I5Q A;  3MR0 A;  1TS7 A;  3AZN A;  5B33 A;  2ZMV A;  3MXS A;  1LL8 A;  4UA6 A;  5FQI A;  4Y5F A;  4JPM A;  2JCH A;  3CZD A;  1P3L C;  2VV7 A;  4KG5 A;  5CXW A;  3REK C;  4DRA A;  3UN7 A;  3AFA B;  1S0W A;  1K38 A;  4S2J A;  1XA7 A;  2JKT I;  3UY6 A;  5TBM A;  5B2I B;  5HSQ A;  5L2F A;  4ZBJ B;  4BEN A;  5E5A A;  3UTB D;  3UTA D;  4S2P A;  1C3B A;  3MVD A;  3KSY A;  4LLO B;  2JKF A;  4DDS A;  1TEM A;  3HLD A;  2ZY3 A;  3C1C C;  5AQ7 A;  3KS4 A;  4XUJ B;  5DNM D;  3O62 A;  5CEB A;  3WD0 A;  1IEL A;  2Y8H A;  5BNV A;  3MJQ A;  4Z5T A;  2ZC4 B;  1KX5 C;  5CPK B;  3FC7 A;  5EVI B;  4BQM A;  3VOL A;  2Z2L B;  1U35 D;  1H3O B;  1DP9 A;  2PR5 A;  4E3O A;  1HZO A;  5J8X A;  4RVA A;  2WKR A;  2QMI A;  3WAA B;  1H0G A;  3LIC A;  5B31 G;  3JPU A;  5B40 C;  3O88 A;  1SHV A;  1L0F A;  2JKR M;  2OAQ 1;  4UQI S;  5CPI B;  1KS0 A;  5BOH A;  1PIO A;  3IWQ A;  2H5S A;  1OTI A;  3REH B;  5GLA A;  4P6B A;  3REL A;  3AZG B;  1M18 A;  3NY4 A;  3WA9 A;  1YLY A;  4I39 A;  3AZN D;  3X1T B;  1K0K A;  3LGO A;  5DNM C;  1Y54 A;  4MMN A;  4OP8 A;  3WX7 A;  1W7F A;  3LR4 A;  3IS2 B;  3VE3 A;  4IBI A;  3B6G B;  1G5U A;  4IBR A;  2HUE C;  2CV5 B;  1NRJ A;  2VEA A;  4DN0 A;  2HV1 A;  2EX6 A;  1VM1 A;  3WTP B;  5GLC A;  2OSU A;  4LRX C;  4WBG A;  2Y2L A;  2QZ6 A;  5FDH A;  1AXB A;  4J8V A;  3CPT A;  5CGW A;  3WKJ A;  5GT3 A;  3UTB C;  4LV1 A;  3MGP B;  4ZUX C;  3S1Y A;  5BNX B;  1K4E A;  4R3B A;  3UT9 A;  1OT9 A;  3C5A A;  5HPI A;  4AWL C;  1S1Y A;  4IBG A;  4EWF A;  4GHI B;  3WTP A;  2NQB A;  3W4O A;  5B1L C;  4EQI A;  4HI4 A;  2Y2O A;  3RXW A;  1P3P A;  4MBK A;  4IJF A;  1DJA A;  3N8S A;  1M19 A;  1ZG4 A;  1KX5 D;  1XJ6 A;  1M1A D;  1T19 A;  3ZQ5 A;  1RCJ A;  2AVX A;  2ARO B;  3KWQ B;  3IH8 A;  1OGB A;  1E6Z A;  1H0I A;  3V3R A;  4ID4 A;  4AWL B;  4M6B A;  2PYR A;  2V8C A;  3SS5 A;  5EVI C;  2HDU A;  3W98 B;  3H7W A;  1MBL A;  5KIZ A;  3CI6 A;  4QB8 A;  4JGQ A;  3EPL A;  2W1R A;  4U3T A;  5F69 A;  2PDR A;  5FAP A;  4S2M A;  2W3D A;  3NQU B;  4XZQ B;  4IJG A;  5G18 A;  3GQZ A;  1OTE A;  4GDB A;  2XA7 S;  2JKG A;  3ZCZ A;  2M7U A;  4YOF A;  5BT1 D;  4KUO A;  3Q7V B;  2EXA A;  1KX3 B;  5GT0 C;  4NZ1 A;  5DF7 A;  3IF6 B;  3B42 A;  3IF6 C;  3LFV A;  4OJO A;  5IT5 A;  1P34 C;  3TU4 B;  3D3O A;  5A8B A;  3AN2 A;  3W97 B;  3X1T C;  3W96 C;  4WNN A;  5F99 C;  3W99 B;  4M3K A;  2W1T B;  1L2S A;  4H9O B;  3IX3 A;  2BYM A;  4R70 A;  3MGQ B;  4MBF A;  4WU8 D;  2Y79 A;  4NKP A;  4P85 A;  4KZ6 A;  4QD4 A;  2L4R A;  4Z1W A;  2DF4 C;  1E25 A;  2KDK A;  3WS4 A;  1ID3 C;  1FOF A;  4S2N A;  3CUE C;  5GT0 D;  4NYU A;  5FAO A;  2H0T A;  1KX5 B;  5B31 C;  2HGV A;  2RTS A;  2XK1 A;  1PFL A;  1T1C A;  3F1N A;  1ESI A;  5EM0 A;  3MGS A;  4EBL A;  4ZAM A;  2QJ7 A;  4JXW A;  4K0W A;  1A0K A;  3B6F B;  3M7P A;  4GS9 A;  3LJA A;  3W98 D;  3E4Q A;  1A7W A;  5EV0 A;  1S4R A;  4MB3 A;  5F82 A;  3L26 A;  3X1S C;  3A6N A;  3L25 A;  3MXR A;  1K4F A;  3F1N B;  1TAF A;  3I7J A;  5AVB A;  3TW8 A;  5J3W A;  4X68 A;  2ZM5 A;  3AFA C;  2O0Y A;  3QHY A;  2V20 A;  1M6K A;  3D4F A;  2UWX A;  4PPR A;  3EPK A;  3KWQ A;  4NY2 A;  4GHL A;  5A91 A;  4PM5 A;  2IA2 A;  2Z6D A;  1SCW A;  3LEL A;  3N8R A;  3MQ0 A;  2XRO A;  3LJA D;  3MFD A;  2X01 A;  3C8C A;  5EVL A;  4EU0 A;  5FEG A;  3LCE A;  2WGV A;  4HME A;  2OV5 A;  2C6W B;  4Z66 A;  2HIO A;  3N6I A;  4WZ5 A;  1SZV A;  3REH A;  1TZY D;  3X1T D;  3G2Z A;  4RYE A;  1QME A;  3SH8 A;  4BL2 A;  4GCZ A;  2V1B A;  3GVB A;  4CAY B;  3BQA A;  2B95 A;  4OLG A;  4R8P A;  4GJ4 A;  5HAP A;  3B6G D;  4CQH A;  3KS8 A;  1W1T A;  1P3I B;  4E44 A;  1QMF A;  1CJF A;  4HY8 A;  4DQY B;  3CAX A;  3MGR B;  5E5A B;  1Z09 A;  3AZJ C;  2JKT M;  4GDN A;  1YUE A;  5CRF A;  3TRC A;  2H0Y A;  2QJ5 A;  4N9L A;  3R45 B;  3C7V A;  4KQR A;  4PMA A;  1K55 A;  4NK3 A;  2V2F F;  1Q9C A;  4HES A;  3QNB A;  5EM1 A;  1JWP A;  3P7N A;  2GDN A;  5CX7 A;  5BPV A;  3NBL A;  5CHU A;  4LGW A;  3MQL A;  1JVJ A;  1Y4O A;  4QLC D;  5B24 B;  4KHA B;  3NI9 A;  2JC7 A;  1XKZ A;  3VP3 A;  3M6H A;  4R1G A;  5B1M C;  1ERM A;  4E3L A;  3PHY A;  4D2O A;  4JXG A;  4ZUX A;  2VGL S;  2YKH A;  4GN2 A;  3W99 D;  1TD5 A;  2VKS A;  5GSU C;  5AJG A;  4Z2M G;  2NQB C;  1T3U A;  5AV5 A;  1X0O A;  2VJW A;  4MBH A;  4XUZ A;  1BTL A;  3B0D C;  2WAD A;  3LJA B;  4ZJ1 A;  2ZLY A;  2X02 A;  3E2L A;  1YPR A;  2BLS A;  4OP5 A;  1YSQ A;  3PBS A;  3X1U B;  5GHX A;  1F66 B;  4MCW A;  3F1P B;  4LD9 D;  1HVB A;  5DJU A;  4BJP A;  1P3K B;  2VX8 A;  3S4X A;  2J8Y A;  2PAV P;  5CTN A;  1P3G B;  5B32 A;  1ONH A;  4R4S A;  3AV1 D;  5CP6 A;  3N8L A;  3MNN D;  1EQZ D;  1ES2 A;  3G31 A;  1Z6F A;  4PKY A;  4YS3 C;  5JRG C;  1PI5 A;  2JHE A;  4XUJ C;  3MGR C;  3DWK A;  4J8V D;  4MN6 A;  1ZLA C;  4Y2F A;  5CPJ D;  1MXO A;  5A90 A;  1H8Y A;  5CPI A;  2V1Z A;  4FH4 A;  4J8W A;  3UE0 A;  5AV8 C;  3PBO A;  3UE1 A;  5AVB B;  4ZUX B;  2ZY2 A;  2VGL M;  3UTA A;  5GSU D;  2M1C A;  2VV8 A;  2QYB A;  5IU1 A;  3T4O A;  4GKU A;  4H8R A;  3KFU G;  2F8N A;  5F99 A;  4HOI A;  4OPR A;  1SDE A;  1GHP A;  1FQG A;  4MN5 A;  4QY5 A;  2RVQ C;  3LZ1 C;  4J8W B;  4KZ7 A;  3VP4 A;  4CLC C;  3REI D;  1W63 M;  4FH2 A;  5B33 D;  5E2F A;  5AQB A;  1IYS A;  1FR1 A;  3T4T A;  3T4Q A;  2KX6 A;  3A6N B;  4S2N C;  1GPF A;  2I9V A;  5HFO A;  3H0R C;  2RL3 A;  2PHY A;  1GOI A;  4E3N A;  3LZ0 D;  5HWT A;  3A3F A;  4BBU A;  1CI8 A;  3C4O A;  5HD5 A;  5DNN D;  1LSX A;  5HAI A;  5E5A D;  3C2W A;  1SDN A;  4WYY A;  2HJE A;  5AVC A;  2Q9M A;  5AV6 A;  3HSH A;  1YM1 A;  5M19 A;  2Y2K A;  3WA9 B;  1LL9 A;  3VP1 A;  3IXB A;  3O62 D;  4C6Y A;  4WF0 A;  3X1V B;  4NE5 A;  4H9Q B;  3AV1 B;  1NLY A;  3IX8 A;  3IF5 A;  1L6J A;  4XUJ D;  4J8V B;  5B0Z D;  3AZJ B;  2FFY A;  4I3J A;  4X1M A;  5JA4 B;  2ZQ9 A;  3MS6 A;  1KX4 C;  3NDE A;  1F66 C;  1W1V A;  3REJ A;  5AVE A;  3HUM A;  5DNN C;  4KUK A;  3SW1 A;  1KVM A;  1HD8 A;  3F1P A;  4WZ5 C;  1U35 A;  3EGX C;  3EG5 B;  4DXC A;  1CK7 A;  4NXE A;  4K0X A;  3REK D;  3IBR A;  3DWZ A;  3LZ0 A;  4LRY C;  3LIF A;  1BH8 A;  2XRN A;  3AZM D;  2J9P A;  1ZTU A;  1MWT A;  4J8X C;  3AZG D;  4JLF A;  3BW6 A;  1MWR A;  5B33 C;  3UPN A;  2J3W A;  3Q81 A;  4J8U A;  2R9X A;  3X1U A;  3FWL A;  1KX4 D;  3MMH A;  3ZFZ A;  1K6R A;  1WA9 A;  1HQ3 B;  3RFB A;  3OBF A;  2WAE A;  3LZ0 B;  3S22 A;  2R9W A;  4DRB A;  3B6G C;  4X53 A;  3LUQ A;  5DKL A;  2XA7 M;  3GRJ A;  3MXQ A;  4R8P B;  2W3G A;  3KUY A;  3KSH A;  3KYQ A;  3ZG8 B;  4ZDX A;  2VV6 A;  4KG6 A;  3NOT C;  3PBT A;  2Y4A A;  1KGE A;  3LIE A;  4Z2M H;  3AZM C;  4EXO A;  4O8G A;  3ISG A;  1G28 A;  4EUV A;  4CLC B;  5FEF A;  2CWE A;  3BM6 A;  2ZMA A;  4UA7 A;  3O62 C;  4YWZ A;  3FPW A;  4H9R A;  2O99 A;  3W4P A;  4IBJ A;  1KE4 A;  3PTE A;  3K2N A;  1MKI A;  3W99 A;  1P3I C;  3UB8 A;  4FCF A;  5M1A A;  3E98 A;  4JF6 A;  5GSU A;  4KUD D;  4Q0H A;  3JVU A;  5B1M B;  3FZC A;  3T4S A;  1DP8 A;  5CPK C;  3NCK A;  2ZQD A;  4OJL A;  3L7H A;  4LD9 B;  2WAF A;  4H9P A;  4HBT A;  4N92 A;  1GA0 A;  1YMX A;  3AZE D;  3REL C;  5GXQ C;  3OPP A;  4IBB A;  2PU4 A;  5FQK A;  3UB5 P;  1JWZ A;  3VP2 A;  3PAE A;  3MNN A;  1EQZ A;  3IHA A;  4JGP A;  3C1B B;  1YU2 A;  2ZL1 A;  4WM9 A;  3VH5 W;  2VLG A;  5AV5 D;  3AV2 D;  1E6P A;  1PRQ A;  4ZBJ C;  4LD9 A;  3MVD C;  1MKM A;  1ESU A;  5B2J B;  3Q1F A;  1MZU A;  3UDX A;  4EUZ A;  4ZUX D;  2PBD P;  2XFT A;  3UE6 A;  5JYO A;  1SKO B;  5C3I C;  1KGG A;  1W2E A;  3O62 B;  4HP4 A;  5BO0 B;  5CER A;  2XFS A;  4R3A A;  4H9R B;  3SOI A;  3B0C W;  5J4E A;  2VZW A;  5GT3 C;  4X23 A;  3UDI A;  3KX0 X;  3C4P A;  2HIO D;  4DJ3 A;  3UT9 C;  2Y2Q A;  2V9A A;  4IVK A;  1PYY A;  1XPB A;  5B40 A;  3DTI A;  4R38 A;  3MGP A;  3CWF A;  3DW0 A;  4ZRR A;  2XGN A;  4II7 A;  5TR7 A;  3ZVW A;  1HQ3 C;  2IO5 B;  5EOO A;  3LR0 A;  1BLH A;  2IWB A;  3KWQ D;  4Y0T A;  1JTG A;  3VFF A;  4JJN D;  1UR9 A;  2B5R A;  1BLC A;  3U4L P;  1Q2Q A;  4OPZ A;  4KUD C;  3UNW A;  3EEA A;  4HIA A;  4MLL A;  1MWU A;  4X25 A;  3HLC A;  4WEK A;  3W98 A;  5FI2 A;  1YMS A;  5B0Y B;  3X1V D;  1H0M A;  1SKF A;  1P34 B;  3WS5 A;  1SKO A;  4E45 A;  3T1R A;  3G30 A;  2C5W B;  4WNN B;  2XD5 A;  4X1L A;  1P3G C;  2W3F A;  5B0Z B;  4JKT A;  4JJN C;  4WU9 D;  2PYO C;  3DTK A;  5GT0 A;  3WKJ C;  1CQA A;  3GEC A;  3IF6 A;  4NYY A;  1N9B A;  1YLJ A;  3FYZ A;  1P3M B;  3FG8 A;  1H3Q A;  3SH7 A;  3D9Y A;  4Z66 D;  3AN2 C;  3AN2 B;  1TS8 A;  3W96 A;  3C1C B;  4KZ9 A;  4N9K A;  4GLQ A;  4Z2K A;  4H9S C;  5FQJ A;  4FD8 A;  3HRE A;  1K56 D;  4PHT A;  4NE3 A;  3NEC A;  3WKJ B;  4LG2 A;  5B31 D;  3QP1 A;  4NE6 A;  1K57 A;  1BH8 B;  5F5Y A;  1TZY B;  2WYX A;  3FV7 A;  4X69 A;  5FAQ A;  1F5M A;  2G7U A;  2K7S A;  5B32 B;  4KQO A;  5HAR A;  3T4K A;  2PYO D;  2OAP 1;  2Y2N A;  1L0E A;  5FSR A;  4K08 A;  2HF6 A;  1HQ3 D;  3B33 A;  5KSH A;  1VEU B;  4XUX A;  1VET A;  5B31 A;  2XLN A;  4XZQ C;  4DE3 A;  4O01 A;  1XGI A;  2ZC6 B;  3RH8 B;  5L10 A;  4DDY A;  4L9F A;  3HBR A;  1PW8 A;  4MDZ A;  5B1L D;  3OPH A;  4CAY A;  3W97 A;  3LEQ A;  4ARZ A;  3TSG A;  3X1V A;  5HX9 A;  2ZM0 A;  3G35 A;  4BWI A;  2Z2M B;  3Q07 A;  2Q9N A;  3B3X A;  5DJT A;  2W8S A;  5E43 A;  3H0L C;  3RXX A;  1W63 Q;  5DF9 A;  4EEP A;  5F99 B;  3UMD A;  3HUO A;  5B2I D;  1GSW A;  3F1O B;  2Z6C A;  2WUQ A;  3H9W A;  4RX3 A;  4Y15 A;  2R78 A;  4HJ4 A;  2ZC5 B;  1XGJ A;  1B6W A;  1MY8 A;  2WKI A;  3MGQ C;  1BT5 A;  3HLE A;  4ZBE A;  5BNV B;  4JGR A;  1VHM A;  3IX4 A;  5GT3 B;  4OPQ A;  4R4R A;  4LCL A;  1D06 A;  1CF0 A;  3AZH D;  4Z66 C;  3AN2 D;  3O3V A;  3AZE B;  5C3I B;  3GTC A;  3K3D A;  5AY8 B;  4QU3 A;  1NZU A;  1QO6 A;  2WGW B;  2FFF B;  1KU5 A;  1ZG6 A;  3LI9 A;  3HCY A;  1BLS A;  3BFC A;  3BY8 A;  4PKY G;  3EEH A;  2JN7 A;  3B0C T;  2JKR I;  4IED A;  1T18 A;  1PZR A;  1J9M A;  3MKE A;  4MB5 A;  3IH9 A;  4UAA A;  2DQN C;  3LJA C;  5E2E A;  5BT1 C;  2ZOI A;  5GHY A;  4B4Z A;  2O9A A;  3AZJ A;  4Y0O A;  3R7W A;  1TZY C;  3MQO A;  1TDL A;  4Z2G A;  1FIK A;  5AQA A;  2F2A C;  1P34 D;  1OPX A;  5HW3 A;  3HJI A;  3AZL A;  4HH3 A;  4LV2 A;  1NZO A;  4NZ3 A;  2D49 A;  3BFD A;  1NXY A;  3VH6 A;  3IP4 C;  2G5I C;  2HIO B;  3QNC A;  3AZF B;  2ZY5 A;  4N1X A;  1P0Z A;  4Y17 A;  4FSF A;  3WD2 A;  2XQZ A;  2WKP A;  1E15 A;  5F6A A;  3UPP A;  3WRT A;  1LI9 A;  4HJ3 A;  1IEM A;  3OPR A;  4DE2 A;  1PDC A;  5HZH A;  1IYP A;  1YKD A;  3X1S D;  3MGP C;  2K31 A;  4GH9 A;  3NOU C;  2EX2 A;  2HP9 A;  3REL B;  2EWV A;  2WKE A;  4EO5 B;  5GT3 D;  1S1Z A;  5G49 A;  4FUW A;  3CG5 A;  1UR8 A;  2FH5 A;  2J3T C;  1ONG A;  3AFA D;  3L9K A;  1O6I A;  4J8X D;  2FN2 A;  3UPO A;  4Y0U A;  4JF4 A;  3HLB A;  4KUD A;  2EX9 A;  4BBV A;  3WD4 A;  3MZF A;  2QKP A;  2YKF A;  3T4J A;  3P5J B;  4I3I A;  3T1S A;  1WE4 A;  3ZNT A;  4KZ5 A;  4LRZ E;  3PYP A;  1YU3 A;  3ZYT A;  2OLV A;  5AV8 D;  3WTP D;  2GJ3 A;  3PXP A;  5HPF A;  5DNM B;  3S7N A;  4RX2 A;  1BLP A;  3ULF A;  3WA9 D;  5CPJ B;  1OGG A;  4GHA A;  3WD1 A;  5G4Z A;  5EE8 A;  4QNL A;  1P3F B;  3NIA A;  3BFG A;  3VOZ A;  1L3L A;  2JE5 A;  3LEL B;  2V0W A;  3WAA D;  2W3H A;  3LR3 A;  1OME A;  1BH9 A;  2NZD A;  4UEY A;  1NY0 A;  1LSW A;  2A49 A;  3NDG A;  4LCM A;  5CHJ A;  1P3B A;  1EWZ A;  3KXB A;  2RIQ A;  4J8U D;  5BS7 A;  2BG1 A;  4NEE D;  5HDC A;  1ERO A;  2QPN A;  1XP4 A;  2ARO D;  1PWG A;  4PM6 A;  1KE3 A;  1Y28 A;  4BD1 A;  2A24 B;  2ACG A;  2OLU A;  1M18 C;  3GMW A;  3WA9 C;  3OCL A;  5AY8 D;  3AZK D;  4QLC C;  4WU8 B;  2W3E A;  4R0Q A;  2V0U A;  3EQV A;  4OOY A;  3REL D;  2WGW A;  1E3U A;  3IHB A;  2V5O A;  1YLT A;  1IKI A;  4IBE A;  2Y2G A;  5BO0 A;  4EBN A;  3F1O A;  1FCN A;  5FQM A;  1G6O A;  5DNN B;  5EEC A;  2DRW A;  2ARO A;  2VQR A;  5F99 D;  5CP6 C;  2J8P A;  2ZC7 A;  3A0S A;  3QP5 A;  1AIW A;  3BEC A;  1LSV A;  3CJM A;  4BL3 A;  1ES4 A;  5AVC C;  5FL3 A;  3WTP E;  1XX2 A;  4G3K A;  3IXD A;  1FCM A;  3B6F D;  5B0Z C;  3REJ B;  1L0D A;  3WAA A;  1PZO A;  3LZ1 B;  4J8W C;  3LIA A;  3ZVT A;  1IYO A;  4OJ5 A;  5AY8 C;  3AZK C;  2OWJ A;  4ESP A;  1L0G A;  5DFY A;  4A5R A;  3U2A A;  1O7E A;  3NJA A;  3WS2 A;  4E6W A;  1GA9 A;  5AV6 D;  3N3F A;  1KDW A;  3GDI A;  1MC0 A;  1M1A B;  1IOU A;  3Q7V A;  2WKQ A;  2DMW A;  3L27 A;  4PM7 A;  2A3U A;  4L9G A;  2NUP C;  3L2A A;  5AVF A;  5K5B A;  1XJ2 A;  3KYE A;  2EWW A;  2F8N D;  4KEN B;  3D72 A;  1JNU A;  3RJU A;  5EFW A;  4C3Q A;  4DE0 A;  1N1J B;  1YT4 A;  2IO5 C;  3OLO A;  5HD3 A;  3ZGA B;  4OQH A;  1P3A C;  4WU8 C;  3AZN C;  3AZL D;  3AZH C;  1BUE A;  2BAS A;  3AV1 C;  1RGY A;  3A0V A;  4WEJ A;  1V9Z A;  1XFQ A;  1ID3 D;  4OUI A;  4R23 A;  4IUK A;  3X1U C;  3NC8 A;  4I3A A;  1S32 B;  1P3O D;  5FDS A;  2INW A;  1AOI C;  2V1A A;  3BRM A;  3TU4 C;  3CHW P;  4LFU A;  3SH9 A;  3VP0 A;  1NLZ A;  3SZT A;  5J7E A;  4IVI A;  1MPL A;  3G6O A;  3Q7Z A;  2ZL1 B;  2DCF A;  4Y3I A;  4Q0J A;  4HGA B;  1Z2C B;  5KDM A;  5JRG B;  3LID A;  4ETZ A;  1H3O A;  2A24 A;  2O9C A;  4KHA A;  3K3C A;  3P09 A;  3VMA A;  2EX8 A;  5L07 A;  3REJ C;  2RVQ D;  3LZ1 D;  4M4X A;  3VSK A;  2J7V A;  2Q0O A;  2YFV A;  5KMW A;  1JWV A;  2EA9 A;  3VOY A;  2KOI A;  4WV4 B;  1N9L A;  3AL0 C;  1P3M C;  3CUE A;  3LZ0 C;  4RA7 A;  2IWD A;  1J7M A;  2J3T D;  2H10 A;  4ZTK A;  2HJ9 C;  5A92 A;  4J8X A;  1U60 A;  1F2K A;  3P98 A;  4B93 A;  5CPI D;  3PBR A;  2FJ7 A;  3B0D B;  5B24 C;  5B2J C;  3REH D;  3F6T A;  1P3F A;  3L29 A;  1RP5 A;  1P3O C;  4FOF A;  5AV5 B;  4HJ6 A;  2JSS A;  3S7O A;  3NQJ B;  5AV9 B;  4WL9 A;  4X6T A;  3X1S A;  3IWO A;  1P3A B;  3C30 A;  1W79 A;  1FCO A;  4OON A;  4ARZ B;  1GSV A;  5HL6 A;  3C7U A;  4IHQ A;  3BLS A;  3RTY A;  2ZQ7 A;  2J9O A;  1UWN X;  1S32 D;  4QY6 A;  4EQ1 A;  1AOI D;  4HMD A;  3LY3 A;  4J8U B;  4NET A;  1K6S A;  1OJG A;  3GV9 A;  4BMW A;  3DTM A;  2ZM2 A;  3V3S A;  1P3M D;  3W99 C;  1FSY A;  4Y13 A;  2A2L A;  4QHC A;  1IYQ A;  1ZLA B;  3EPJ A;  4HMC A;  5FQ9 A;  3AZK B;  5G4Y A;  1P3B C;  5B1L A;  1T1B A;  3C1B A;  1W1Y A;  5I94 A;  2ZC3 B;  2OWH A;  5HWW A;  5FA7 A;  4GS9 B;  4ZJ3 A;  3ZDJ A;  1FSW A;  3VH5 A;  3MGR D;  1S32 C;  4BBT A;  2VGK A;  1E6N A;  1BYW A;  3REI B;  4HQA A;  1GCE A;  2WZZ A;  4DMZ A;  5CTM A;  1V9Y A;  5FI6 A;  1GHM A;  5D3O A;  5B0Y D;  1DRM A;  4H9N B;  3A6N D;  1P3G D;  2K2N A;  4P6Z M;  1ZHH B;  3HLF A;  1K55 C;  4I38 A;  3W98 C;  4H9P B;  2PT7 A;  3MZD A;  3BY9 A;  1DY6 A;  5B24 D;  4QLC B;  2QHK A;  4IBF A;  1DJC A;  3EOI A;  1B67 A;  5B0Y A;  4MB4 A;  2P74 A;  1VET B;  5I5L A;  2FZ0 A;  5AV6 B;  1N9O A;  1NRF A;  3OPL A;  5CPK D;  2ZD8 A;  4P87 A;  2D02 A;  2BTF P;  3BFF A;  3QP8 A;  5DKK A;  5AVB D;  4JJN A;  4IBX A;  1DJB A;  4Q0I A;  2D01 A;  4E3I A;  4S2O A;  3H0M C;  4WU9 A;  4JXV A;  5B2I A;  3EQU A;  1ED7 A;  5G49 B;  3CMZ A;  5JRG D;  1M1A C;  3LO7 A;  4E04 A;  1VB6 A;  3N7W A;  3X1T A;  4F94 A;  2Y2P A;  3KYZ A;  3BYD A;  3LI8 A;  5AV5 C;  2Y2J A;  3NUL A;  3BEB A;  3V9R B;  4YIN A;  3W97 D;  4NG2 A;  3G34 A;  3AZN B;  3ZG7 B;  2FJ7 D;  5GXQ D;  1RGZ A;  3O87 A;  2XD1 A;  3W2Z A;  1ID3 B;  4X23 B;  5KZH A;  3B0B A;  4YM6 C;  4KQQ A;  4B4X A;  1S4S A;  3V67 A;  1BUL A;  3OC2 A;  3REI C;  2GX5 A;  4WU8 A;  1PWC A;  5GT0 B;  4KZ3 A;  3UB7 A;  3PBN A;  4ZJ2 A;  2ZY4 A;  1W8Q A;  3E4O A;  3PBQ A;  4LEN A;  5TGF A;  5EUA A;  3T50 A;  4ETX A;  4YS3 A;  1R4V A;  3W97 C;  1TAF B;  1ALQ A;  4JF5 A;  4DRT A;  1P3A D;  2NUT C;  4XT2 B;  1P3G A;  2G2U A;  3W96 D;  3AGD A;  1ZLA A;  3AZF A;  2HDS A;  4H9O A;  1AOI A;  4WN5 A;  5DTT A;  3A6N C;  1E4D A;  3A3D A;  4DE1 A;  3MVD B;  5GLD A;  4DXB A;  3UTA C;  3AYW B;  3IBJ A;  1CI9 A;  4NFT A;  3M2K A;  3WS1 A;  1J3W A;  2PU2 A;  3TU4 D;  2LB5 A;  1PZP A;  3KWQ C;  3AGE A;  4Q8I A;  3LEL C;  2ZQC A;  4H9Q A;  5F1F A;  1CXW A;  2NQB D;  3VH5 T;  4JXS A;  4WUJ A;  2HIO C;  3X1S B;  1P3M A;  3C38 A;  3UT9 D;  3QP4 A;  3VFH A;  3WRZ A;  1M18 D;  3LY4 A;  2PR6 A;  1H8M A;  2L1M A;  4IUH A;  3AZE A;  4Y7P A;  4KUD B;  3UE3 A;  1JFI A;  3JVV A;  3KUY D;  5L09 A;  3VSL A;  5IHV A;  2FJ7 C;  4QPR A;  3B47 A;  5AQ9 A;  1P3L B;  1OTA A;  3AV2 A;  1N9N A;  1P3O A;  4EES A;  3KSG A;  3ZG0 A;  1HTA A;  3G2Y A;  1OTD A;  1WWS A;  5HDS A;  4KZ4 A;  4Z5T D;  3AZI C;  1E6R A;  4E3J A;  2PYP A;  4UUZ B;  1E88 A;  3VV4 A;  1ODV A;  4D60 A;  1WWI A;  5CPJ C;  4GNU A;  3UDF A;  1K54 C;  3ZNY A;  3C1C A;  3W96 B;  1I2S A;  2P9V B;  3PR6 A;  2F8N K;  1PNE A;  4KGC C;  3OCN A;  4HP9 A;  5F68 A;  1P97 A;  1KX5 A;  2WGI A;  1M19 D;  1PW1 A;  4IJE A;  4OKP A;  3NOP C;  2QWS A;  3R4K A;  4DKI A;  5IS1 A;  1ZKJ A;  4YNR A;  4OJ6 A;  4H9N A;  2B18 A;  5F83 A;  3WS0 A;  4YFM A;  4B9O A;  2HPB A;  5LBR A;  3FDD A;  3T1Q B;  2HDQ A;  2YFW A;  3T4L A;  4N1H A;  3S7Q A;  3ICY A;  1F98 A;  4CSR B;  4IBD A;  2PD7 A;  2EFU A;  4XT2 A;  3IXG A;  1P3L A;  1WYB A;  2ZJ9 A;  5B32 G;  4OH0 A;  3REK A;  2KLI A;  2E8I A;  1ZC2 A;  2ZMF A;  3HON A;  3V50 A;  3V39 A;  3X1U D;  1TF1 A;  1XJ4 A;  3GR2 A;  3UB9 A;  5E5A C;  4DF6 A;  3ZG5 A;  1FIL A;  3KUY C;  2YFV B;  4P0M A;  3LEZ A;  5B32 C;  3MF0 A;  2W27 A;  1P3L D;  1XJ3 A;  2L5A A;  4UPK A;  2XDM A;  2ZQ8 A;  2PBY A;  5B0Y C;  3AZM A;  4XUJ A;  4GB7 A;  4EEU A;  4Z5T B;  4Z5T C;  3B6F A;  1TVF A;  2LY8 A;  3MVD D;  5DF8 A;  1KOU A;  5C5K A;  5AV8 A;  3UTB A;  2WKH A;  2G5H C;  5GLB A;  3ITA A;  5B2I C;  2FJ7 B;  1I2W A;  4Z2H A;  1BH9 B;  2NZD B;  3HUN A;  4S2L A;  3G4P A;  1UWP X;  3WTP C;  4Z2J A;  4OQ0 A;  5BS7 C;  4JJN B;  3HVF A;  4Z2L A;  4KGC D;  1E3U D;  3BWL A;  4E3K A;  5JYP A;  1M19 C;  3E2K A;  4WZS B;  3FPV A;  1STZ A;  5JA4 A;  3UT9 B;  4YM6 D;  1NWZ A;  5DNM A;  3FKW A;  4GW9 A;  4L9E A;  3MKF A;  1H5X A;  4GHI A;  4GOG A;  2Y59 A;  4PM8 A;  3MNN C;  1EQZ C;  2PRF A;  4EBP A;  4TX8 A;  3O5Y A;  4IBC A;  1LL5 A;  5AVC D;  1P9W A;  2I72 A;  2LB9 A;  4AFI A;  5B32 D;  3REI A;  2H28 A;  2PYO B;  4R6L A;  4B88 A;  2V8F A;  2ARO C;  3UTA B;  2IWC A;  2CV5 D;  2OOL A;  3FKV A;  1LT0 A;  3AYW D;  1WYC A;  3JYI A;  3O86 A;  1Q2P A;  1NYM A;  1VQQ A;  2VGJ A;  5AV6 C;  5B1L B;  3AZF C;  2CMN A;  4J8V C;  3Q82 A;  1F1E A;  2P7J A;  5AY8 A;  5EVI D;  1P34 A;  3EPH A;  5FQQ A;  4PM9 A;  3SS3 A;  3KXB C;  1PI4 A;  2O9B A;  1IKG A;  1F66 A;  1EAK A;  4E3M A;  1M19 B;  1P3B D;  2F8N B;  1XA1 A;  5DNN A;  3IWI A;  4MN7 A;  4WMC A;  4J8W D;  3HLG A;  4QWO A;  4QLC A;  1NJ4 A;  2ZM8 A;  2XSS A;  5B33 B;  4OOM A;  4WJ3 C;  1P3K D;  3AZL B;  1P9R A;  4KGC B;  3M2J A;  3AZE C;  3V5M A;  3QP2 A;  5TJJ A;  1P3A A;  3WWX A;  3AZH A;  3NQJ A;  5AV9 A;  3AV1 A;  1EW0 A;  3IXH A;  4OOL A;  4J8U C;  3AV2 C;  5EVE A;  2DNS A;  3MQQ A;  3IQA A;  5E2H A;  3M6B A;  5L8M A;  3CIT A;  2XH9 A;  4EV4 A;  4XZQ D;  1W8Y A;  3P01 A;  1KX4 B;  3B6G A;  1VEU A;  3WAA C;  4IBK A;  3TU4 A;  3AZI A;  1BSG A;  1K25 A;  3HLW A;  3C1C D;  3W8K A;  5AVB C;  3AYW C;  4H6J B;  2W1T A;  5CHL B;  3AFA A;  5F1G A;  2HUE B;  2CV5 C;  5CPJ A;  4ME4 A;  3GSG A;  1KDS A;  4XXR A;  5HWV A;  3T12 B;  3BQ8 A;  1W5D A;  3LYX A;  3AZF D;  2F8N H;  2EXB A;  1MWS A;  3H82 A;  3AZJ D;  5KDM B;  2HP6 A;  5CP6 D;  2X71 A;  1K57 C;  1H8P A;  4UUZ A;  5FAT A;  1P3I A;  3AZG C;  1IFQ A;  1ULY A;  3A3I A;  4HHD A;  1P3K C;  3MGQ D;  2G2W A;  3T1X A;  3REH C;  3E4P A;  3EGD C;  1D1J A;  3SS4 A;  4K91 A;  3A3E A;  1T1A A;  4DJ2 A;  1S6R A;  5CPK A;  3REK B;  5B1M D;  4YM6 B;  3MGS C;  3BJN A;  1FR6 A;  5B24 A;  3R7W B;  4S2I A;  3MSH A;  4YS3 D;  1S67 L;  5FAS A;  5GXQ A;  2RCX A;  2W0N A;  4LPZ A;  5M18 A;  1YLZ A;  1JFI B;  4MEZ A;  2BYK A;  1LLB A;  5AVC B;  2MJ6 A;  3X1V C;  4OQG A;  4G92 C;  2L0W A;  3AZI B;  2IOU A;  1GSX A;  3L28 A;  3R45 A;  4LD9 C;  4OJP A;  4HNB A;  1N1J A;  1KX3 D;  5A93 A;  4GZB A;  1S66 L;  5TBM B;  4F3L B;  4CLC E;  4R8P D;  4NZ4 A;  1P3P B;  3CPT B;  1AOI B;  2P04 A;  1UGU A;  5AV8 B;  4LV0 A;  5B2J D;  3UB6 A;  1LI0 A;  4HBU A;  1KX3 A;  1KGF A;  3IT9 A;  1W1P A;  2XEP A;  3B6F C;  3TE8 A;  3A1K A;  3LR5 A;  5B40 B;  3E0Y A;  4CLC D;  1ZLA D;  4JGO A;  4X23 C;  4F3L A;  4G3V A;  1HLU P;  1K56 A;  4L0L A;  2UV0 E;  3LEL D;  1BFM A;  5U47 A;  3DBA A;  3AZM B;  4JBF A;  2Y91 A;  4KQD A;  1H8Z A;  1HQ3 A;  3WD3 A;  3LIB A;  4R3J A;  5CP6 B;  4R8P C;  3HJK A;  1KVL A;  3VH6 W;  4EER A;  2XF3 A;  1YAX A;  3TJZ C;  5B2J A;  4C75 A;  2E8J A;  1GXD A;  3N4I A;  1P3F C;  3KSF A;  3ZG9 B;  2J80 A;  5CHM A;  1P3I D;  4LV3 A;  3UME A;  1TZY A;  4H6J A;  4X56 A;  3C1B D;  2GNX A;  3ZHH A;  1TS0 A;  3AZL C;  4BD0 A;  4BLM A;  2GZA A;  3MGS D;  4G3W A;  2Y55 A;  1YLP A;  5FUG B;  5CED A;  5EPH A;  5HAQ A;  1E8B A;  5JRG A;  3MGR A;  2HP5 A;  3V9R A;  5B1M A;  1HTZ A;  1N4O A;  2PYO A;  4Z2I A;  4HEF A;  5CPI C;  3QP6 A;  2P08 A;  1P3B B;  3KXB B;  1XFN A;  2EFX A;  3EWK A;  4WU9 B;  4G92 B;  3BLM A;  4O7D A;  1D7E A;  4GD6 A;  5DFX A;  3C1B C;  3A0R A;  4NXB A;  5FI7 A;  5HDD A;  5B40 D;  4H9S A;  3IS2 A;  4E6X A;  4NXF A;  5GXQ B;  1YQS A;  3G32 A;  4J8X B;  2NQB B;  4HGA C;  4KG2 A;  4CLC A;  4X23 D;  1TDG A;  3ITB A;  2B02 A;  1S32 A;  4PAU A;  4Z9Q A;  5B31 B;  3AV2 B;  2VK3 A;  1CEG A;  2ZBB A;  5DTS A;  4WLA A;  5CGX A;  1DP6 A;  4WZ4 A;  1F66 D;  3A3J A;  3NQU A;  4XZQ A;  5AV9 C;  1CEF A;  3UTB B;  3OOV A;  5FUG A;  5BNX A;  2CC1 A;  3TG9 A;  1P3F D;  3H82 B;  5MC7 A;  4KZ8 A;  1ES5 A;  2M7V A;  3PAG A;  1XXM A;  1NYY A;  3BFE A;  4I5S A;  2F8N G;  1YSP A;  1OTB A;  1YU0 A;  2HZ5 A;  4KZB A;  3S7P A;  4S2K A;  3MGS B;  5TFQ A;  1OJ5 A;  1P3O B;  4G91 B;  4WU9 C;  2PD8 A;  1M1A A;  1BZA A;  2NZD C;  1YU1 A;  1U35 B;  3AYW A;  1ERQ A;  2ZOH A;  2CV5 A;  2WZX A;  1ACF A;  4OLD A;  4WMC D;  1G68 A;  4RQ9 A;  3MGQ A;  4Z66 B;  1G6A A;  1P3P C;  1EI5 A;  1KX4 A;  4GD8 A;  1O07 A;  3LZ1 A;  3MGP D;  1YU4 A;  3KSI A;  2YFW B;  3W4Q A;  3VE4 A;  1M40 A;  3AZG A;  2BYM B;  1M18 B;  3UO9 A;  3WKJ D;  5DTK A;  4CSR A;  1P3K A;  4QJG A;  5CGS A;  4YS3 B;  4YM6 A;  5EVI A;  4UHU A;  4U0X A;  1TS6 A;  2Y2H A;  3AZH B;  4NZ5 A;  1F9I A;  3KUY B;  5DVA A;  4P6Z S;  3AGF A;  3DAV A;  4OVD A;  3CLO A;  4UA9 A;  1JTD A;  3AZI D;  5KSC A;  1CK3 A;  5E2G A;  4X55 A;  1ES3 A;  4EW7 A;  4HH2 A;  3TOI A;  3REJ D;  4EET B;  3MNN B;  1EQZ B;  1P3P D;  4OPY A;  1PWD A;  2P9V A;  5GHZ A;  2XR0 A;  5GL9 A;  5B0Z A;  1YLW A;  1AWI A;  4U0T A;  1LHY A;  5AV9 D;  2JBF A;  5CEC A;  3H7W B;  1KE0 A;  3AZK A;  4MNR A;  2WK0 A;  2BYK B;  3DTE A;  5GSU B;  4FTX A; 
#chains in the Genus database with same CATH homology
 5HL1 A;  1K54 A;  4OQI A;  3FKE A;  1KX3 C;  1GHI A;  3MZE A;  4KZA A;  3MBZ A;  4KGC A;  3KXB D;  5EOE A;  3HL9 A;  2Y2I A;  3OZH A;  4CPK A;  2ZQA A;  2NZD D;  4CJN A;  1U35 C;  2Y2M A;  2HDR A;  1ID3 A;  3VH6 T;  4G91 C;  3A1I A;  4WEL A;  4EO5 C;  1I5Q A;  3AZN A;  5B33 A;  3MXS A;  4UA6 A;  5FQI A;  4JPM A;  2JCH A;  3CZD A;  1P3L C;  4KG5 A;  5CXW A;  3REK C;  4DRA A;  3UN7 A;  3AFA B;  1S0W A;  1K38 A;  4S2J A;  1XA7 A;  3UY6 A;  5B2I B;  5L2F A;  4ZBJ B;  4BEN A;  5E5A A;  3UTB D;  3UTA D;  4S2P A;  1C3B A;  3MVD A;  3KSY A;  4DDS A;  1TEM A;  3HLD A;  2ZY3 A;  3C1C C;  5AQ7 A;  3KS4 A;  4XUJ B;  5DNM D;  3O62 A;  5CEB A;  1IEL A;  5BNV A;  4Z5T A;  2ZC4 B;  1KX5 C;  5CPK B;  5EVI B;  4BQM A;  2Z2L B;  1U35 D;  1H3O B;  4E3O A;  1HZO A;  5J8X A;  4RVA A;  2QMI A;  3WAA B;  5B31 G;  5B40 C;  3O88 A;  1SHV A;  1L0F A;  5CPI B;  5BOH A;  1PIO A;  3IWQ A;  2H5S A;  3REH B;  5GLA A;  4P6B A;  3REL A;  3AZG B;  1M18 A;  3NY4 A;  3WA9 A;  1YLY A;  3AZN D;  3X1T B;  5DNM C;  1Y54 A;  4OP8 A;  3WX7 A;  1W7F A;  4IBI A;  3B6G B;  4IBR A;  2HUE C;  2CV5 B;  2EX6 A;  1VM1 A;  3WTP B;  5GLC A;  2OSU A;  4WBG A;  2Y2L A;  2QZ6 A;  5FDH A;  1AXB A;  4J8V A;  5CGW A;  3WKJ A;  5GT3 A;  3UTB C;  4LV1 A;  3MGP B;  4ZUX C;  3S1Y A;  5BNX B;  1K4E A;  4R3B A;  3UT9 A;  3C5A A;  4AWL C;  4IBG A;  4EWF A;  3WTP A;  2NQB A;  3W4O A;  5B1L C;  4EQI A;  2Y2O A;  3RXW A;  1P3P A;  4MBK A;  4IJF A;  1DJA A;  3N8S A;  1M19 A;  1ZG4 A;  1KX5 D;  1M1A D;  1RCJ A;  2ARO B;  3KWQ B;  3IH8 A;  3V3R A;  4ID4 A;  4AWL B;  4M6B A;  3SS5 A;  5EVI C;  2HDU A;  3W98 B;  1MBL A;  4QB8 A;  3EPL A;  4U3T A;  5FAP A;  4S2M A;  3NQU B;  4XZQ B;  5G18 A;  3GQZ A;  4GDB A;  3ZCZ A;  5BT1 D;  3Q7V B;  2EXA A;  1KX3 B;  5GT0 C;  4NZ1 A;  5DF7 A;  3IF6 B;  3IF6 C;  4OJO A;  1P34 C;  3TU4 B;  3AN2 A;  3W97 B;  3X1T C;  3W96 C;  4WNN A;  5F99 C;  3W99 B;  4M3K A;  1L2S A;  4H9O B;  2BYM A;  4MBF A;  3MGQ B;  4WU8 D;  4P85 A;  4KZ6 A;  4QD4 A;  2DF4 C;  1E25 A;  3WS4 A;  1ID3 C;  1FOF A;  4S2N A;  5GT0 D;  4NYU A;  5FAO A;  2H0T A;  1KX5 B;  5B31 C;  2XK1 A;  1ESI A;  3MGS A;  4EBL A;  4ZAM A;  4JXW A;  4K0W A;  3B6F B;  3LJA A;  3W98 D;  1A7W A;  5F82 A;  3L26 A;  3X1S C;  3A6N A;  3L25 A;  3MXR A;  1K4F A;  1TAF A;  3I7J A;  5AVB A;  4X68 A;  2ZM5 A;  3AFA C;  3QHY A;  2V20 A;  1M6K A;  3D4F A;  2UWX A;  4PPR A;  3EPK A;  3KWQ A;  4NY2 A;  4GHL A;  5A91 A;  4PM5 A;  1SCW A;  3LEL A;  3N8R A;  3LJA D;  3MFD A;  2X01 A;  5EVL A;  3LCE A;  2WGV A;  2OV5 A;  2C6W B;  4Z66 A;  2HIO A;  3N6I A;  4WZ5 A;  3REH A;  1TZY D;  3X1T D;  3G2Z A;  4RYE A;  1QME A;  3SH8 A;  4BL2 A;  3GVB A;  4CAY B;  4OLG A;  4R8P A;  5HAP A;  3B6G D;  3KS8 A;  1P3I B;  4E44 A;  1QMF A;  4DQY B;  3MGR B;  5E5A B;  3AZJ C;  4GDN A;  1YUE A;  5CRF A;  2H0Y A;  4N9L A;  3R45 B;  3C7V A;  4KQR A;  4PMA A;  1K55 A;  4NK3 A;  2V2F F;  1Q9C A;  4HES A;  3QNB A;  1JWP A;  2GDN A;  5BPV A;  3NBL A;  5CHU A;  1JVJ A;  4QLC D;  5B24 B;  4KHA B;  3NI9 A;  2JC7 A;  1XKZ A;  3VP3 A;  3M6H A;  4R1G A;  5B1M C;  1ERM A;  4E3L A;  4D2O A;  4JXG A;  4ZUX A;  4GN2 A;  3W99 D;  5GSU C;  4Z2M G;  2NQB C;  1T3U A;  5AV5 A;  4MBH A;  4XUZ A;  1BTL A;  3B0D C;  2WAD A;  3LJA B;  4ZJ1 A;  2ZLY A;  2X02 A;  3E2L A;  2BLS A;  4OP5 A;  3PBS A;  3X1U B;  5GHX A;  1F66 B;  4LD9 D;  1HVB A;  4BJP A;  1P3K B;  3S4X A;  2J8Y A;  5CTN A;  1P3G B;  5B32 A;  1ONH A;  4R4S A;  3AV1 D;  5CP6 A;  3N8L A;  3MNN D;  1EQZ D;  1ES2 A;  3G31 A;  1Z6F A;  4YS3 C;  5JRG C;  1PI5 A;  4XUJ C;  3MGR C;  3DWK A;  4J8V D;  1ZLA C;  5CPJ D;  1MXO A;  5A90 A;  1H8Y A;  5CPI A;  2V1Z A;  4FH4 A;  4J8W A;  3UE0 A;  5AV8 C;  3PBO A;  3UE1 A;  5AVB B;  4ZUX B;  2ZY2 A;  3UTA A;  5GSU D;  4GKU A;  4H8R A;  3KFU G;  2F8N A;  5F99 A;  4OPR A;  1SDE A;  1GHP A;  1FQG A;  4QY5 A;  2RVQ C;  3LZ1 C;  4J8W B;  4KZ7 A;  3VP4 A;  3REI D;  4FH2 A;  5B33 D;  5E2F A;  5AQB A;  1IYS A;  1FR1 A;  3A6N B;  4S2N C;  5HFO A;  3H0R C;  2RL3 A;  4E3N A;  3LZ0 D;  3A3F A;  1CI8 A;  3C4O A;  5DNN D;  5HAI A;  5E5A D;  1SDN A;  4WYY A;  5AVC A;  2Q9M A;  5AV6 A;  3HSH A;  1YM1 A;  5M19 A;  2Y2K A;  3WA9 B;  1LL9 A;  3VP1 A;  3IXB A;  3O62 D;  4C6Y A;  3X1V B;  4NE5 A;  4H9Q B;  3AV1 B;  3IF5 A;  4XUJ D;  4J8V B;  5B0Z D;  3AZJ B;  2FFY A;  5JA4 B;  2ZQ9 A;  1KX4 C;  3NDE A;  1F66 C;  3REJ A;  3HUM A;  5DNN C;  1KVM A;  1HD8 A;  4WZ5 C;  1U35 A;  3EG5 B;  4DXC A;  4K0X A;  3REK D;  3DWZ A;  3LZ0 A;  1BH8 A;  3AZM D;  2J9P A;  1MWT A;  4J8X C;  3AZG D;  4JLF A;  1MWR A;  5B33 C;  3UPN A;  3Q81 A;  4J8U A;  2R9X A;  3X1U A;  3FWL A;  1KX4 D;  3ZFZ A;  1K6R A;  1HQ3 B;  2WAE A;  3LZ0 B;  3S22 A;  2R9W A;  4DRB A;  3B6G C;  4X53 A;  3GRJ A;  4R8P B;  3KUY A;  3ZG8 B;  4ZDX A;  4KG6 A;  3PBT A;  2Y4A A;  1KGE A;  4Z2M H;  3AZM C;  3ISG A;  2CWE A;  3BM6 A;  2ZMA A;  4UA7 A;  3O62 C;  4H9R A;  3W4P A;  4IBJ A;  1KE4 A;  3PTE A;  1MKI A;  3W99 A;  1P3I C;  4FCF A;  5M1A A;  4JF6 A;  5GSU A;  4KUD D;  5B1M B;  3FZC A;  5CPK C;  3NCK A;  2ZQD A;  4OJL A;  4LD9 B;  2WAF A;  4H9P A;  4HBT A;  4N92 A;  1GA0 A;  1YMX A;  3AZE D;  3REL C;  5GXQ C;  3OPP A;  4IBB A;  2PU4 A;  5FQK A;  1JWZ A;  3VP2 A;  3PAE A;  3MNN A;  1EQZ A;  3IHA A;  3C1B B;  1YU2 A;  4WM9 A;  3VH5 W;  5AV5 D;  3AV2 D;  4ZBJ C;  4LD9 A;  3MVD C;  1ESU A;  5B2J B;  3Q1F A;  3UDX A;  4EUZ A;  4ZUX D;  2XFT A;  5JYO A;  5C3I C;  1KGG A;  1W2E A;  3O62 B;  5BO0 B;  5CER A;  2XFS A;  4H9R B;  3SOI A;  3B0C W;  5GT3 C;  4X23 A;  3UDI A;  3C4P A;  2HIO D;  3UT9 C;  2Y2Q A;  4IVK A;  1PYY A;  1XPB A;  5B40 A;  3MGP A;  3DW0 A;  2XGN A;  5TR7 A;  3ZVW A;  1HQ3 C;  2IO5 B;  5EOO A;  1BLH A;  2IWB A;  3KWQ D;  4Y0T A;  1JTG A;  3VFF A;  4JJN D;  2B5R A;  1BLC A;  1Q2Q A;  4OPZ A;  4KUD C;  3UNW A;  4MLL A;  1MWU A;  3HLC A;  4WEK A;  3W98 A;  5FI2 A;  1YMS A;  5B0Y B;  3X1V D;  1SKF A;  1P34 B;  3WS5 A;  4E45 A;  3G30 A;  2C5W B;  4WNN B;  2XD5 A;  1P3G C;  5B0Z B;  4JKT A;  4JJN C;  4WU9 D;  2PYO C;  5GT0 A;  3WKJ C;  3IF6 A;  4NYY A;  1N9B A;  1YLJ A;  3FYZ A;  1P3M B;  3SH7 A;  4Z66 D;  3AN2 C;  3AN2 B;  3W96 A;  3C1C B;  4KZ9 A;  4N9K A;  4H9S C;  5FQJ A;  4FD8 A;  3HRE A;  1K56 D;  4NE3 A;  3WKJ B;  4LG2 A;  5B31 D;  4NE6 A;  1K57 A;  1BH8 B;  1TZY B;  2WYX A;  3FV7 A;  4X69 A;  5FAQ A;  4KQO A;  5B32 B;  5HAR A;  2PYO D;  2Y2N A;  1L0E A;  5FSR A;  1HQ3 D;  5KSH A;  4XUX A;  5B31 A;  2XLN A;  4XZQ C;  4DE3 A;  1XGI A;  2ZC6 B;  4DDY A;  3HBR A;  1PW8 A;  5B1L D;  3OPH A;  4CAY A;  3W97 A;  3TSG A;  3X1V A;  5HX9 A;  2ZM0 A;  3G35 A;  2Z2M B;  3Q07 A;  2Q9N A;  3B3X A;  2W8S A;  5E43 A;  3H0L C;  3RXX A;  5DF9 A;  5F99 B;  3HUO A;  5B2I D;  2WUQ A;  4RX3 A;  2ZC5 B;  1XGJ A;  1B6W A;  1MY8 A;  2WKI A;  3MGQ C;  1BT5 A;  3HLE A;  4ZBE A;  5BNV B;  5GT3 B;  4OPQ A;  4R4R A;  4LCL A;  3AZH D;  4Z66 C;  3AN2 D;  3O3V A;  3AZE B;  5C3I B;  3GTC A;  5AY8 B;  4QU3 A;  1NZU A;  2WGW B;  2FFF B;  1KU5 A;  1ZG6 A;  1BLS A;  3BFC A;  3B0C T;  4IED A;  1PZR A;  1J9M A;  3MKE A;  3IH9 A;  4UAA A;  2DQN C;  3LJA C;  5E2E A;  5BT1 C;  5GHY A;  4B4Z A;  4Y0O A;  3AZJ A;  1TZY C;  1TDL A;  5AQA A;  2F2A C;  1P34 D;  5HW3 A;  3AZL A;  4LV2 A;  1NZO A;  4NZ3 A;  3BFD A;  1NXY A;  3VH6 A;  3IP4 C;  2G5I C;  2HIO B;  3QNC A;  3AZF B;  2ZY5 A;  4N1X A;  4FSF A;  2XQZ A;  3WRT A;  3UPP A;  1LI9 A;  1IEM A;  3OPR A;  4DE2 A;  1IYP A;  3X1S D;  3MGP C;  4GH9 A;  2HP9 A;  2EX2 A;  3REL B;  2WKE A;  4EO5 B;  5GT3 D;  5G49 A;  3CG5 A;  1ONG A;  3AFA D;  4J8X D;  3UPO A;  4Y0U A;  4JF4 A;  3HLB A;  4KUD A;  2EX9 A;  3MZF A;  3P5J B;  1WE4 A;  3ZNT A;  4KZ5 A;  1YU3 A;  2OLV A;  5AV8 D;  3WTP D;  5DNM B;  4RX2 A;  1BLP A;  3WA9 D;  5CPJ B;  4GHA A;  5EE8 A;  4QNL A;  1P3F B;  3NIA A;  3BFG A;  3VOZ A;  2JE5 A;  3LEL B;  3WAA D;  1OME A;  1BH9 A;  2NZD A;  1NY0 A;  2A49 A;  3NDG A;  4LCM A;  5CHJ A;  1P3B A;  1EWZ A;  3KXB A;  2RIQ A;  4J8U D;  5BS7 A;  2BG1 A;  1ERO A;  1XP4 A;  2QPN A;  2ARO D;  1PWG A;  4PM6 A;  1KE3 A;  4BD1 A;  2OLU A;  1M18 C;  3GMW A;  3WA9 C;  3OCL A;  5AY8 D;  3AZK D;  4QLC C;  4WU8 B;  4R0Q A;  3EQV A;  4OOY A;  3REL D;  2WGW A;  1E3U A;  3IHB A;  1YLT A;  1IKI A;  4IBE A;  2Y2G A;  5BO0 A;  4EBN A;  1FCN A;  5FQM A;  5DNN B;  5EEC A;  2DRW A;  2ARO A;  2VQR A;  5F99 D;  5CP6 C;  2J8P A;  2ZC7 A;  3BEC A;  3CJM A;  4BL3 A;  1ES4 A;  5AVC C;  3WTP E;  1XX2 A;  3IXD A;  1FCM A;  3B6F D;  5B0Z C;  3REJ B;  1L0D A;  3WAA A;  1PZO A;  3LZ1 B;  4J8W C;  3ZVT A;  1IYO A;  4OJ5 A;  5AY8 C;  3AZK C;  1L0G A;  4A5R A;  1O7E A;  3WS2 A;  4E6W A;  1GA9 A;  5AV6 D;  3N3F A;  1KDW A;  1M1A B;  3Q7V A;  3L27 A;  4PM7 A;  2A3U A;  3L2A A;  2F8N D;  4KEN B;  3RJU A;  4C3Q A;  4DE0 A;  1N1J B;  1YT4 A;  2IO5 C;  3ZGA B;  4OQH A;  1P3A C;  4WU8 C;  3AZN C;  3AZL D;  3AZH C;  1BUE A;  3AV1 C;  1RGY A;  4WEJ A;  1ID3 D;  4OUI A;  4R23 A;  3X1U C;  3NC8 A;  1S32 B;  1P3O D;  1AOI C;  3BRM A;  3TU4 C;  3SH9 A;  3VP0 A;  4IVI A;  1MPL A;  3Q7Z A;  2DCF A;  4HGA B;  1Z2C B;  5KDM A;  5JRG B;  1H3O A;  4KHA A;  3P09 A;  3VMA A;  2EX8 A;  3REJ C;  2RVQ D;  3LZ1 D;  3VSK A;  2J7V A;  2YFV A;  5KMW A;  1JWV A;  3VOY A;  4WV4 B;  3AL0 C;  1P3M C;  3LZ0 C;  4RA7 A;  2IWD A;  2H10 A;  4ZTK A;  5A92 A;  4J8X A;  1U60 A;  3P98 A;  5CPI D;  3PBR A;  2FJ7 A;  3B0D B;  5B24 C;  5B2J C;  3REH D;  3F6T A;  1P3F A;  3L29 A;  1RP5 A;  1P3O C;  5AV5 B;  2JSS A;  3NQJ B;  5AV9 B;  4X6T A;  3X1S A;  3IWO A;  1P3A B;  1W79 A;  1FCO A;  4OON A;  3C7U A;  3BLS A;  2ZQ7 A;  2J9O A;  1S32 D;  4QY6 A;  1AOI D;  3LY3 A;  4J8U B;  4NET A;  1K6S A;  3GV9 A;  3DTM A;  2ZM2 A;  3V3S A;  1P3M D;  3W99 C;  1FSY A;  4QHC A;  1IYQ A;  1ZLA B;  3EPJ A;  5FQ9 A;  3AZK B;  1P3B C;  5B1L A;  3C1B A;  5I94 A;  2ZC3 B;  5FA7 A;  4ZJ3 A;  3ZDJ A;  1FSW A;  3VH5 A;  3MGR D;  1S32 C;  2VGK A;  3REI B;  1GCE A;  2WZZ A;  5CTM A;  5FI6 A;  1GHM A;  5D3O A;  5B0Y D;  4H9N B;  3A6N D;  1P3G D;  3HLF A;  1K55 C;  3W98 C;  4H9P B;  3MZD A;  1DY6 A;  5B24 D;  4QLC B;  4IBF A;  1DJC A;  1B67 A;  5B0Y A;  2P74 A;  5AV6 B;  1NRF A;  3OPL A;  5CPK D;  2ZD8 A;  4P87 A;  3BFF A;  5AVB D;  4JJN A;  4IBX A;  1DJB A;  4E3I A;  4S2O A;  3H0M C;  4WU9 A;  4JXV A;  5B2I A;  3EQU A;  3CMZ A;  5G49 B;  5JRG D;  1M1A C;  3LO7 A;  3N7W A;  3X1T A;  4F94 A;  2Y2P A;  3BYD A;  5AV5 C;  2Y2J A;  3BEB A;  3V9R B;  4YIN A;  3W97 D;  3G34 A;  3AZN B;  3ZG7 B;  2FJ7 D;  5GXQ D;  1RGZ A;  3O87 A;  2XD1 A;  1ID3 B;  4X23 B;  5KZH A;  3B0B A;  4YM6 C;  4KQQ A;  4B4X A;  1BUL A;  3OC2 A;  3REI C;  4WU8 A;  1PWC A;  5GT0 B;  4KZ3 A;  3PBN A;  4ZJ2 A;  2ZY4 A;  1W8Q A;  3PBQ A;  4LEN A;  5TGF A;  5EUA A;  4YS3 A;  1R4V A;  3W97 C;  1TAF B;  1ALQ A;  4JF5 A;  4DRT A;  1P3A D;  1P3G A;  2G2U A;  3W96 D;  3AGD A;  1ZLA A;  3AZF A;  2HDS A;  4H9O A;  1AOI A;  5DTT A;  3A6N C;  1E4D A;  3A3D A;  4DE1 A;  3MVD B;  5GLD A;  4DXB A;  3UTA C;  3AYW B;  1CI9 A;  4NFT A;  3M2K A;  3WS1 A;  2PU2 A;  3TU4 D;  1PZP A;  3KWQ C;  3AGE A;  4Q8I A;  3LEL C;  2ZQC A;  4H9Q A;  5F1F A;  2NQB D;  3VH5 T;  4JXS A;  2HIO C;  3X1S B;  1P3M A;  3UT9 D;  3VFH A;  3WRZ A;  1M18 D;  3LY4 A;  3AZE A;  4Y7P A;  4KUD B;  3UE3 A;  1JFI A;  3KUY D;  3VSL A;  5IHV A;  2FJ7 C;  5AQ9 A;  1P3L B;  3AV2 A;  1P3O A;  3ZG0 A;  1HTA A;  3G2Y A;  1WWS A;  4KZ4 A;  4Z5T D;  3AZI C;  4E3J A;  4UUZ B;  1WWI A;  5CPJ C;  4GNU A;  3UDF A;  1K54 C;  3ZNY A;  3C1C A;  3W96 B;  1I2S A;  2P9V B;  2F8N K;  4KGC C;  3OCN A;  1KX5 A;  2WGI A;  1M19 D;  1PW1 A;  4IJE A;  4OKP A;  4DKI A;  1ZKJ A;  4OJ6 A;  4H9N A;  5F83 A;  3WS0 A;  4YFM A;  2HPB A;  3FDD A;  2HDQ A;  2YFW A;  4N1H A;  4CSR B;  4IBD A;  2EFU A;  3IXG A;  1P3L A;  1WYB A;  2ZJ9 A;  5B32 G;  4OH0 A;  3REK A;  2E8I A;  1ZC2 A;  3HON A;  3V50 A;  3V39 A;  3X1U D;  3GR2 A;  5E5A C;  4DF6 A;  3ZG5 A;  3KUY C;  2YFV B;  4P0M A;  3LEZ A;  5B32 C;  1P3L D;  2L5A A;  4UPK A;  2XDM A;  2ZQ8 A;  2PBY A;  5B0Y C;  3AZM A;  4XUJ A;  4GB7 A;  4Z5T B;  4Z5T C;  3B6F A;  1TVF A;  2LY8 A;  3MVD D;  5DF8 A;  5AV8 A;  3UTB A;  2WKH A;  2G5H C;  5GLB A;  3ITA A;  5B2I C;  2FJ7 B;  1I2W A;  1BH9 B;  2NZD B;  3HUN A;  4S2L A;  3G4P A;  3WTP C;  4OQ0 A;  5BS7 C;  4JJN B;  3HVF A;  4KGC D;  1E3U D;  4E3K A;  5JYP A;  1M19 C;  3E2K A;  4WZS B;  5JA4 A;  3UT9 B;  4YM6 D;  5DNM A;  3FKW A;  3MKF A;  1H5X A;  4GOG A;  2Y59 A;  4PM8 A;  3MNN C;  1EQZ C;  4EBP A;  4IBC A;  1LL5 A;  5AVC D;  2I72 A;  5B32 D;  3REI A;  2PYO B;  4B88 A;  2ARO C;  3UTA B;  2IWC A;  2CV5 D;  3FKV A;  3AYW D;  1WYC A;  3JYI A;  3O86 A;  1Q2P A;  1NYM A;  1VQQ A;  2VGJ A;  5AV6 C;  5B1L B;  3AZF C;  4J8V C;  3Q82 A;  1F1E A;  5AY8 A;  5EVI D;  1P34 A;  3EPH A;  5FQQ A;  4PM9 A;  3SS3 A;  3KXB C;  1PI4 A;  1IKG A;  1F66 A;  4E3M A;  1M19 B;  1P3B D;  2F8N B;  1XA1 A;  5DNN A;  3IWI A;  4WMC A;  4J8W D;  3HLG A;  4QLC A;  1NJ4 A;  2ZM8 A;  4OOM A;  5B33 B;  4WJ3 C;  1P3K D;  3AZL B;  4KGC B;  3M2J A;  3AZE C;  3V5M A;  1P3A A;  3WWX A;  3AZH A;  3NQJ A;  5AV9 A;  3AV1 A;  3IXH A;  4OOL A;  4J8U C;  3AV2 C;  2DNS A;  3IQA A;  5E2H A;  3M6B A;  2XH9 A;  4EV4 A;  4XZQ D;  1W8Y A;  1KX4 B;  3B6G A;  3WAA C;  4IBK A;  3TU4 A;  3AZI A;  1BSG A;  1K25 A;  3HLW A;  3C1C D;  3W8K A;  5AVB C;  3AYW C;  5F1G A;  5CHL B;  3AFA A;  2HUE B;  2CV5 C;  5CPJ A;  3GSG A;  1KDS A;  4XXR A;  1W5D A;  3AZF D;  2F8N H;  2EXB A;  1MWS A;  3AZJ D;  5KDM B;  2HP6 A;  5CP6 D;  2X71 A;  1K57 C;  5FAT A;  4UUZ A;  1P3I A;  3AZG C;  1ULY A;  3A3I A;  1P3K C;  3MGQ D;  2G2W A;  3REH C;  3SS4 A;  4K91 A;  3A3E A;  1S6R A;  5CPK A;  3REK B;  5B1M D;  4YM6 B;  3MGS C;  1FR6 A;  5B24 A;  4S2I A;  4YS3 D;  5M18 A;  5FAS A;  5GXQ A;  2RCX A;  1YLZ A;  1JFI B;  4MEZ A;  2BYK A;  1LLB A;  5AVC B;  3X1V C;  4OQG A;  4G92 C;  3AZI B;  2IOU A;  3L28 A;  3R45 A;  4LD9 C;  4OJP A;  1N1J A;  1KX3 D;  5A93 A;  4GZB A;  4R8P D;  4NZ4 A;  1P3P B;  1AOI B;  5AV8 B;  4LV0 A;  5B2J D;  1LI0 A;  4HBU A;  1KX3 A;  1KGF A;  3IT9 A;  2XEP A;  3B6F C;  3A1K A;  5B40 B;  1ZLA D;  4X23 C;  1K56 A;  4L0L A;  3LEL D;  1BFM A;  5U47 A;  3AZM B;  4JBF A;  2Y91 A;  1H8Z A;  1HQ3 A;  4R3J A;  5CP6 B;  4R8P C;  1KVL A;  3VH6 W;  2XF3 A;  4C75 A;  5B2J A;  3N4I A;  1P3F C;  3ZG9 B;  5CHM A;  1P3I D;  4LV3 A;  1TZY A;  4X56 A;  3C1B D;  3ZHH A;  3AZL C;  4BD0 A;  4BLM A;  3MGS D;  2Y55 A;  1YLP A;  5FUG B;  5CED A;  5EPH A;  5HAQ A;  5JRG A;  3MGR A;  2HP5 A;  3V9R A;  5B1M A;  1HTZ A;  1N4O A;  2PYO A;  4HEF A;  5CPI C;  1P3B B;  3KXB B;  2EFX A;  4WU9 B;  4G92 B;  3BLM A;  4O7D A;  4GD6 A;  3C1B C;  5FI7 A;  5B40 D;  4H9S A;  4E6X A;  3G32 A;  5GXQ B;  1YQS A;  4J8X B;  2NQB B;  4HGA C;  4KG2 A;  4X23 D;  1TDG A;  3ITB A;  1S32 A;  4Z9Q A;  5B31 B;  3AV2 B;  1CEG A;  5DTS A;  5CGX A;  4WZ4 A;  1F66 D;  3A3J A;  3NQU A;  4XZQ A;  5AV9 C;  1CEF A;  3UTB B;  5FUG A;  5BNX A;  2CC1 A;  3TG9 A;  1P3F D;  4KZ8 A;  1ES5 A;  3PAG A;  1XXM A;  1NYY A;  3BFE A;  2F8N G;  1YU0 A;  4KZB A;  4S2K A;  3MGS B;  5TFQ A;  1P3O B;  4G91 B;  4WU9 C;  1M1A A;  1BZA A;  2NZD C;  1YU1 A;  1U35 B;  3AYW A;  1ERQ A;  2CV5 A;  2WZX A;  4OLD A;  4WMC D;  1G68 A;  3MGQ A;  4Z66 B;  1G6A A;  1P3P C;  1EI5 A;  1KX4 A;  4GD8 A;  1O07 A;  3LZ1 A;  3MGP D;  1YU4 A;  2YFW B;  3W4Q A;  1M40 A;  3AZG A;  2BYM B;  1M18 B;  3UO9 A;  3WKJ D;  5DTK A;  4CSR A;  1P3K A;  4QJG A;  5CGS A;  4YS3 B;  4YM6 A;  5EVI A;  4UHU A;  4U0X A;  2Y2H A;  3AZH B;  4NZ5 A;  3KUY B;  5DVA A;  3AGF A;  4OVD A;  4UA9 A;  1JTD A;  3AZI D;  5KSC A;  1CK3 A;  5E2G A;  4X55 A;  1ES3 A;  3TOI A;  3REJ D;  3MNN B;  1EQZ B;  1P3P D;  4OPY A;  1PWD A;  2P9V A;  5GHZ A;  2XR0 A;  5GL9 A;  5B0Z A;  1YLW A;  4U0T A;  1LHY A;  5AV9 D;  2JBF A;  5CEC A;  1KE0 A;  3AZK A;  4MNR A;  2WK0 A;  2BYK B;  5GSU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...