2Y2GA

Penicillin-binding protein 1b (pbp-1b) in complex with an alkyl boronate (a01)
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
486
structure length
466
Chain Sequence
EITYSDGTVIASIDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTGQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Guided Design of Cell Wall Biosynthesis Inhibitors that Overcome Beta-Lactam Resistance in Staphylococcus Aureus (Mrsa).
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
molecule keywords PENICILLIN-BINDING PROTEIN 1B
total genus 165
structure length 466
sequence length 486
chains with identical sequence B
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2y2gA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2y2gA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2y2gA02
1CI8A 2X71A 1XPBA 4DXCA 2H0TA 1VM1A 3IXGA 4EBLA 1QMFA 2EX8A 5U47A 5HW3A 2XH9A 5KZHA 3GV9A 4LV1A 4Y0OA 3PBNA 3VFFA 4LCLA 1ESIA 1MWUA 3NDGA 3VP3A 5FQMA 2HPBA 3Q1FA 1BTLA 4WBGA 5CERA 1IYPA 1TVFA 3PBSA 5FAPA 4H8RA 1PZPA 1RGYA 3UY6A 2HDQA 2PU4A 2WADA 2XF3A 3BFDA 1MXOA 4IEDA 3TG9A 3CJMA 1E3UD 1TDGA 3M6BA 3UPPA 3UPOA 1EROA 3QHYA 3ITAA 4WMCD 4ZJ3A 3UNWA 2ZC6B 3GR2A 3V3RA 2FFFB 3HLEA 4UA7A 4X68A 2WZXA 3SH7A 4KQRA 4GDNA 1E4DA 4GDBA 1K57A 1C3BA 5FQQA 4QJGA 5I94A 4M3KA 3VP4A 3UDFA 3N4IA 1BLHA 2Y2QA 1YLZA 2HP6A 3EQUA 3PBTA 3AGEA 4OQIA 4XXRA 4PM7A 1BLCA 2ZM2A 3A3IA 2XD1A 1LI0A 3MXSA 4P0MA 1PI4A 2I72A 1U60A 3C5AA 4IBXA 5FAQA 1SDEA 2PU2A 1MWTA 4DDYA 2Y2HA 1SKFA 4S2IA 2XDMA 3GRJA 3GQZA 1FR1A 1BULA 1BLPA 1EWZA 2ZQ9A 2EXBA 1FSWA 4QD4A 2ZM0A 1O7EA 3RXXA 2A49A 2HDUA 4FH2A 4JBFA 4S2NA 3VOZA 3RXWA 2EX2A 3CMZA 1YMXA 4WEJA 3PBQA 4X53A 2QMIA 2Q9NA 2WZZA 1M6KA 4UAAA 1PW1A 4PM5A 4GKUA 4DDSA 1BLSA 5DF9A 2Y2IA 3WS5A 5CEBA 5EVIA 3VOYA 4CJNA 3EQVA 3MZFA 4EBNA 4C75A 2RL3A 1HVBA 3BRMA 3M6HA 3N8SA 1FSYA 2H5SA 1DJAA 1KGEA 3G2YA 2Y2KA 3A3FA 1KE0A 3CG5A 4WMCA 4K0XA 2WGWA 1MKIA 2J9OA 3MXRA 5FSRA 1CK3A 4XUZA 5AQBA 3GTCA 3FV7A 3PTEA 4E3NA 3SOIA 3BECA 2Q9MA 4OQHA 4OPYA 4OQGA 4OLDA 4K91A 5AQAA 4IVKA 2G2WA 3HLCA 4HESA 2ZQ7A 5D3OA 1SHVA 1ONHA 3IF6B 4WZ5A 3UE3A 4N92A 1L0EA 2QPNA 1I2SA 2Y59A 3UE1A 2WKEA 3P09A 2OLVA 3GSGA 1SDNA 5JYOA 1PYYA 4X56A 4U0XA 2Z2LB 3SS4A 3ZVTA 1BSGA 1BZAA 1GHIA 1GHMA 1DJBA 5GLCA 4WELA 1O07A 4GB7A 4MBKA 2ZLYA 3B3XA 2PBYA 3BFGA 2Y2NA 2WKIA 4D2OA 4JXVA 1M40A 1ESUA 4P85A 4ZAMA 4E3JA 2Y2JA 4N1HA 4JXSA 1K4FA 2R9WA 4Y7PA 5A90A 2E8IA 2EX9A 3DWZA 4PM6A 1PWCA 2WGIA 3BFFA 3DW0A 4R0QA 5A91A 4PM9A 1YLJA 4Q8IA 1MBLA 1FCNA 5CECA 4DE3A 5FDHA 1K6RA 2ZQAA 3LEZA 3Q7ZA 3IXHA 1YLTA 2XFSA 5HFOA 5F82A 3OCLA 3PBOA 5GHYA 1KE4A 2FFYA 3IF6A 3IH9A 3OPRA 3IHAA 3OPLA 5CTMA 4MEZA 5FA7A 3WS1A 4K0WA 2A3UA 3ZG0A 1K6SA 3G30A 1ZC2A 4E3IA 1OMEA 4JPMA 4BD1A 1QMEA 1XP4A 2ZC3B 4KENB 3VP0A 1K56D 3Q07A 4EUZA 3MKEA 4LV2A 5IHVA 1H8YA 3NC8A 1VQQA 1PWGA 4DRTA 1K54C 2XEPA 3BFEA 5FQ9A 4FCFA 3S1YA 2Y2OA 1Q2PA 3DTMA 3HVFA 3MZDA 2V20A 3CZDA 2IWCA 2C5WB 3O88A 1KVLA 3OCNA 1LLBA 4JXWA 5E2FA 3HLBA 2WGVA 2QZ6A 3OZHA 5CGWA 1FOFA 1GA0A 1SCWA 4EV4A 4KG6A 4B4XA 3NCKA 3O86A 5CHUA 3VMAA 4LCMA 2RCXA 1KVMA 1RGZA 1MWSA 3PBRA 1ZG6A 4JF5A 2J9PA 5CXWA 3OC2A 3N7WA 3ZNTA 5FI2A 2WKHA 1NY0A 1S6RA 3PAGA 2Y2GA 2V2FF 1K4EA 3ZFZA 3LY4A 1IYOA 1FQGA 1JVJA 1YQSA 3V50A 3V5MA 1KE3A 4OOMA 5HX9A 4ZTKA 1PI5A 1ALQA 3HUOA 4DF6A 3E2KA 4PM8A 3UDXA 1NRFA 4UHUA 4E3KA 4BL3A 5A93A 2XR0A 1XA7A 3P98A 2Y2MA 3UO9A 1DY6A 1ERMA 3A3DA 3TSGA 2WGWB 4X6TA 1NXYA 3O87A 5HL1A 5FQKA 2Y55A 2VGKA 5GL9A 2BLSA 5GLDA 4GZBA 5HARA 1ZG4A 2H0YA 5F1GA 2EFXA 3ZCZA 3BYDA 3ZG7B 4LENA 3ZG5A 5TR7A 1LI9A 3JYIA 4N1XA 1L0DA 2ZQDA 4KQOA 5EECA 4WYYA 2IWBA 5G18A 1NJ4A 2ZC4B 5EVIC 1XGJA 2XD5A 4KZAA 2ZC7A 4FD8A 1NYYA 4S2MA 1ES2A 1KDWA 3LO7A 5E2EA 5EVIB 2ZQCA 4OVDA 5J8XA 3SH8A 3AGFA 5EVID 4P6BA 4BL2A 4KZ5A 4OP5A 3W4QA 4KQQA 3WS0A 5KSHA 4L0LA 3C4OA 3BLSA 3BFCA 1E3UA 1YMSA 3NIAA 4JF4A 1W7FA 4OOYA 5EVLA 3VSKA 4Y0UA 3WS2A 5GHZA 2J8YA 4KZ7A 4JKTA 2ZC5B 4QU3A 3C7VA 1MWRA 2X01A 3VSLA 4OOLA 2P9VB 4R4RA 1Z6FA 1H8ZA 4OPRA 1K55A 3HLGA 3O3VA 2XGNA 4RX2A 4KZ6A 1GA9A 2XLNA 2VGJA 1YT4A 5HAPA 1ERQA 3NI9A 1W8QA 1AXBA 3AGDA 4GOGA 1RCJA 5FQIA 1HTZA 1YLYA 3N8RA 4OPZA 1K38A 5CGXA 3ZG8B 4QHCA 1ES3A 2Y91A 4R4SA 4S2OA 3IWIA 2G2UA 4OQ0A 3ZG9B 1IEMA 1W8YA 1K55C 2X02A 1JTGA 5FQJA 1E25A 2R9XA 3WRZA 2OSUA 4F94A 5A92A 3G35A 5DF7A 1G6AA 3HLWA 4KZBA 4S2NC 4QY6A 1Q2QA 2EX6A 3Q7VB 2P9VA 3FZCA 3GMWA 2B5RA 1K56A 2GDNA 4MLLA 5DTKA 5E2GA 4E3MA 1N9BA 1XX2A 2HP9A 1JWVA 3MBZA 5BOHA 5F83A 5EUAA 3DWKA 1IYSA 2XQZA 3WWXA 2UWXA 1NZUA 3IT9A 2DNSA 2EXAA 5CHJA 4BJPA 2ZM8A 5DTSA 4Z9QA 4ZDXA 3WS4A 1FR6A 1BUEA 1ES4A 1K25A 3HLFA 4UA9A 4WZ5C 1DJCA 4DE1A 1IKIA 3V3SA 1PW8A 1Y54A 3A3EA 4N9KA 3MFDA 4B4ZA 3FKVA 3HLDA 3S4XA 3UPNA 2JC7A 4KZ9A 3Q7VA 3C4PA 3G2ZA 5GLBA 3V39A 4KZ3A 3W4OA 3IQAA 3ZHHA 3M2KA 5HAQA 4XUXA 1TEMA 3ITBA 4ZBEA 2ZQ8A 5M19A 1GHPA 3UN7A 3E2LA 4EQIA 2EFUA 3I7JA 5EPHA 3S22A 1WYBA 1W79A 4HBTA 4OLGA 3BM6A 1NZOA 2DCFA 1PZOA 2WYXA 3N8LA 5GHXA 1L0FA 4DE0A 3IF6C 3WRTA 4S2PA 2C6WB 4ZJ2A 4E6XA 2Z2MB 4O7DA 5F1FA 2Y4AA 3PAEA 3M2JA 4RX3A 3N6IA 1ONGA 1HZOA 1ZKJA 1FCMA 5CHMA 1N4OA 5FASA 1KGFA 1RP5A 1TDLA 4YFMA 3ZVWA 3NY4A 3ZNYA 5CRFA 3HBRA 1KDSA 3HREA 3VP1A 4KZ4A 4KZ8A 4Y0TA 1H5XA 4GNUA 4S2LA 5FI6A 1W5DA 3HUMA 5CEDA 4E3LA 3QNBA 5KMWA 1LL9A 1J9MA 2ZMAA 4PMAA 3UE0A 4DKIA 3IXBA 2Y2PA 3IXDA 3LY3A 4BENA 1BT5A 2JBFA 2ZJ9A 4DE2A 1ES5A 4JXGA 4GN2A 4C6YA 3FYZA 3VFHA 5FAOA 2WUQA 3TOIA 1IYQA 2H10A 4NETA 4MBFA 4C3QA 3IH8A 3OPPA 2WAFA 1YLPA 4OONA 4U0TA 4HBUA 5E43A 4U3TA 3SS5A 3IF5A 1JWZA 4EWFA 4R1GA 4RVAA 4X55A 5EOOA 2BG1A 5TGFA 4NK3A 1CEFA 4RYEA 4OPQA 4OKPA 3W4PA 1IELA 4CPKA 1K54A 1EI5A 3SH9A 5EE8A 3G31A 4JLFA 5FATA 4YINA 4ID4A 4GD8A 4N9LA 1LHYA 3IHBA 3MZEA 4P87A 3RJUA 4R3BA 5KSCA 1MY8A 3OPHA 3NDEA 5AQ7A 1XGIA 3G34A 4X69A 1L2SA 4FSFA 5CTNA 2V1ZA 3LCEA 2OV5A 5DTTA 3NBLA 3IWOA 4GD6A 2J7VA 4KG5A 1NYMA 4LV0A 4BLMA 1YLWA 4KG2A 2OLUA 1XXMA 1YM1A 1WYCA 4S2JA 1K57C 2WK0A 4QY5A 3FKWA 1KGGA 4S2KA 1HD8A 5AQ9A 1MPLA 5DF8A 5EOEA 2HP5A 4DXBA 3VP2A 3UDIA 1I2WA 5DVAA 3FWLA 4BD0A 1CI9A 1S0WA 4EBPA 3BLMA 2JE5A 4JF6A 4FH4A 3BEBA 3SS3A 4A5RA 4R23A 4ZJ1A 4B88A 1PWDA 3A3JA 2WAEA 5TFQA 4BQMA 4LV3A 1JTDA 4QB8A 1IKGA 4OP8A 1WE4A 5CGSA 4E6WA 1CEGA 3Q82A 2P74A 2HDRA 3ZGAB 5M18A 3ZDJA 5FI7A 2Y2LA 3D4FA 5E2HA 3HUNA 3G32A 1XKZA 3C7UA 1FCOA 1JWPA 1G68A 4WM9A 4E3OA 3Q81A 5M1AA 2XK1A 4MNRA 4MBHA 4IBRA 2XFTA 4UA6A 3G4PA 1XA1A 4WZ4A 5GLAA 3W8KA 3HL9A 4RA7A 4PPRA 4OH0A 4IVIA 2HDSA 2DRWA 1LL5A 3IWQA 3QNCA 5HAIA 1GCEA 2IWDA 5L2FA 1I5QA 1L0GA 4R3JA 2CC1A 1PIOA 3ISGA 2ZD8A 3MKFA 2JCHA 3GVBA 5JYPA 4WEKA 4HEFA
chains in the Genus database with same CATH superfamily
4JGQA 3UT9D 1P3IB 1EQZD 1TAFA 3AYWC 5CPJA 3H7WB 5B1MA 2W1RA 2QHKA 3AZMA 2YFVB 1QMFA 3M7PA 5KZHA 1R4VA 4IBBA 3A6NA 1S67L 2YKHA 1IFQA 1P3FB 3VP3A 2HPBA 5AVFA 5DNND 5CP6D 1IYPA 3PBSA 4Y13A 1PZPA 3REIA 1OJGA 2VGLM 3W97D 3WAAA 3TG9A 1KX5B 2Z6CA 1EROA 3TW8A 2JSSA 5F68A 5FL3A 3GR2A 3HLEA 1XFQA 4ZBJB 4UA7A 2WZXA 1EQZA 3REJB 5CP6C 1KX3D 4GHIB 1EQZB 3LIEA 4O8GA 5GT3B 4IBIA 4GDBA 1T19A 1YU3A 4J8VB 3VP4A 5B1LA 4LRXC 3OLOA 2Y2QA 1YPRA 2HP6A 2OWJA 4O01A 4OQIA 4XXRA 3A3IA 4M6BA 4CSRA 5FAQA 1SDEA 4L9EA 4KGCC 2BYMA 2XDMA 3GQZA 4XZQD 1MZUA 4GLQA 4LG2A 5K5BA 2B18A 3AZLB 4X1LA 2PRFA 3MVDB 4EU0A 1YMXA 4WEJA 1W1TA 5B2IC 4J8XB 3AZKA 2J8PA 3KWQD 4DDSA 2NUTC 3TE8A 1AWIA 3WS5A 5EVIA 4WU8C 3MZFA 4CLCA 4C75A 4ETZA 2RL3A 3TU4A 2H28A 3M6HA 2Y79A 1FSYA 1NLYA 3MGSD 1KGEA 4OJ5A 2Y2KA 4H9NB 1GPFA 4R3AA 4K0XA 2WGWA 3REIC 1MKIA 5B2JC 4IBEA 4XUZA 4EQ1A 5DJUA 3FV7A 2VV7A 3R7WB 5D3OA 3X1VB 2V5OA 1KX5A 3S7PA 5BS7A 3UE3A 1KX3B 1L0EA 1I2SA 2Y59A 3UE1A 2WKEA 3P09A 2OLVA 1T3UA 3UB5P 3R45B 4X56A 4U0XA 2Z2LB 3X1SD 1TS7A 2D49A 1XJ4A 2JKRI 1DJBA 4HP9A 4IBFA 5AV8C 4KGCD 1PDCA 2Y2NA 5AV5B 2ZY3A 1M40A 3AZLC 4P85A 4JXSA 1K4FA 1M19B 3AZLD 2EX9A 2ZL1B 1DP6A 1MKMA 1VHMA 4EO5B 5BT1C 1O6IA 4ME4A 1YLJA 3S7OA 2RVQD 1MBLA 4LLOB 4Z66D 1P3GC 1P3MA 4DE3A 3AZGB 1E15A 1K6RA 3REKB 3L29A 3OCLA 1KX4B 1F1EA 3OPRA 4H9PB 3LJAC 3IH9A 5FA7A 4MEZA 1XJ3A 1OMEA 4JPMA 3RELC 4BD1A 5AV5D 3C1BA 5DNMB 4EUZA 3Q07A 1JNUA 3NC8A 1VQQA 3UB8A 3T4TA 3BY8A 1Q2PA 2W3DA 5DFXA 3O88A 1P3PD 1UGUA 5CGWA 4DJ2A 1P3PB 2PR5A 3MGRA 3IS2A 3O86A 3WA9A 1RGZA 2J9PA 1NY0A 1S6RA 1YSPA 1JVJA 3V50A 4GCZA 4OOMA 4LFUA 2CV5B 4PM8A 3UDXA 4HGAB 4Z2LA 5A93A 3P98A 2Y2MA 3UO9A 1DY6A 1E6PA 5AVBD 4ETXA 2HUEB 3A3DA 3TSGA 5AVBB 3T1SA 5L07A 2Y55A 2VGKA 2O99A 2KX6A 4LENA 4HQAA 4H9PA 3JYIA 4N1XA 3AV1B 1WWSA 1BH8B 1P3GD 1L0DA 3B6FB 1NJ4A 4KZAA 5GT3A 4S2MA 1ES2A 1S32A 3LO7A 2LY8A 4OVDA 3LEQA 4BL2A 5BNXA 3UTAA 4J8UA 1B67A 3KXBD 3C4OA 2PAVP 3B0DC 3JVUA 5AVCA 2PYRA 3AZJB 2J8YA 4JKTA 2ZC5B 3WTPE 3EOIA 3C7VA 5EM1A 3X1SC 2P9VB 3U4LP 4WUJA 3HLGA 4RX2A 2OAQ1 1YU4A 2XLNA 3AZEC 3NI9A 1W8QA 3MVDD 3T4KA 3P7NA 1P3IA 3AGDA 1RCJA 5FQIA 1HTZA 2J80A 1PFLA 3N8RA 3ZG8B 3CLOA 4QHCA 1ES3A 2Y91A 4S2OA 3IWIA 2G2UA 2HF6A 3ZG9B 2K31A 2X02A 2W1TA 1G6AA 4QY6A 5EV0A 1Q2QA 2EX6A 1K56A 2GDNA 1UWPX 4YWZA 4E3MA 1E88A 3AZHB 1XX2A 4Q0JA 1JWVA 4UEYA 5AVCB 5BOHA 4PHTA 3A0VA 4X68A 3MGQC 3ICYA 1S1ZA 1IYSA 3QP4A 5DNMC 3WWXA 3IT9A 4BJPA 2DNSA 2EXAA 1S32B 3WKJD 1D1JA 4Z9QA 4ZDXA 1P3GB 5HDDA 1K25A 1BUEA 3D9YA 4UA9A 4WZ5C 1DJCA 3V3SA 4RQ9A 3W2ZA 4WJ3C 1PW8A 5B0YD 3MGQA 3A3EA 3L9KA 3UPNA 2JC7A 3FPVA 4J8UB 1F66D 4MN5A 1OJ5A 3Q7VA 3C4PA 3N3FA 3X1SB 3VH5A 3MJQA 3IQAA 3M2KA 1E6ZA 3TJZC 3B6GA 3K3DA 1N9LA 2ZQ8A 2AROC 2HZ5A 3QP2A 3AFAB 3UN7A 4EQIA 3I7JA 1M1AC 3RTYA 1W79A 4HBTA 4H9QB 2FJ7D 1GSWA 4YNRA 3AYWB 1NZOA 3JVVA 1PZOA 1KX3C 1P3IC 3WA9C 4JGRA 4Y17A 3UTAB 3WRTA 4XZQB 2Z2MB 3C1BB 3WA9D 1P34B 4RX3A 1HZOA 1ZKJA 3X1UB 1N4OA 4WV4B 5FASA 3UMEA 3ZVWA 4K08A 4OUIA 4QLCD 3ZNYA 3HREA 2G5HC 3VP1A 4KZ8A 3QP6A 4Y0TA 4GNUA 5KMWA 5CEDA 1P3AD 2GNXA 1LL8A 3QNBA 1GSXA 1TF1A 2K7SA 3CAXA 3IXDA 1F9IA 4HY8A 2JKRM 1P3KC 1BT5A 1S32C 4C6YA 5LBRA 3WX7A 1IYQA 5HSQA 3WKJB 5F99B 1D7EA 4J8XC 4OONA 2V1BA 4U0TA 5B0ZA 3AN2A 3LZ0B 4U3TA 3MNND 3SS5A 2NZDB 5JA4A 3MNNB 3NECA 4R1GA 5B2JA 4NK3A 3X1TD 4OPQA 4J8UD 1K54A 1P3AB 3SH9A 4LPZA 5EE8A 4HH2A 4JLFA 3UT9B 4ID4A 4N9LA 3R7WA 1OTEA 4NZ3A 4NG2A 2O0YA 1M18B 3NULA 3LI8A 4Y2FA 3G34A 4MN7A 1L2SA 2OV5A 5CTNA 2V1ZA 3G6OA 4PAUA 4KG2A 2OLUA 4GS9B 2I9VA 5AV6C 2V0WA 1MPLA 4YOFA 1H0IA 4DRBA 3UDIA 4ZBJC 4B9OA 4JF6A 4ZJ1A 1EAKA 4B88A 3W99C 3KX0X 4BQMA 4LV3A 3LIFA 3MVDA 1CEGA 3Q82A 2HDRA 3LJAA 5F99C 1W2EA 2F2AC 5B1LD 4H9NA 4IBCA 1JWPA 1G68A 2J3TC 4WM9A 3AZFB 5JRGB 3A6ND 1GOIA 2XFTA 3O62A 3G4PA 3T1QB 3T4JA 1AOIA 5DJTA 3FPWA 5HAIA 5L2FA 3VH5T 4MCWA 2PHYA 3ISGA 2ZD8A 3MKFA 4NE5A 2JCHA 3GVBA 4Z2JA 2X71A 3V9RB 2PT7A 4DXCA 4Z5TC 1VM1A 2H0TA 2V8CA 1Z09A 1D06A 4EBLA 5FUGA 2EX8A 3A0SA 5HW3A 3VFFA 4LV1A 3PBNA 3WTPD 3S7NA 2PYOC 2XRNA 4KUKA 1STZA 3MNNA 1BTLA 3NJAA 5CERA 4ZUXD 3F6TA 4H8RA 2HDQA 3T1XA 4QLCA 2XF3A 3H9WA 4HNBA 5C5KA 3M6BA 3CITA 5BO0A 1P3FD 3QHYA 3QP1A 3EPJA 4G92B 2ZC6B 2V8FA 4KQRA 4QJGA 4OJLA 5CX7A 3LJAB 1BLHA 3AZKC 4H9QA 3VE3A 3V9RA 3MXSA 2BYKA 1LI0A 3A0RA 1P9WA 5GT3D 1B6WA 3MR0A 1YU0A 2Y2HA 1YSQA 1P3FA 3BJNA 5BT1D 1EWZA 2A24A 3AL0C 2ZQ9A 4YM6C 2YKFA 2ZM0A 2VZWA 4DRAA 2HDUA 4H6JA 3VOZA 3ULFA 4J8XD 3EWKA 1ZLAA 3PBQA 1P3OA 4PM5A 5AV6A 5L10A 3X1VC 4KHAA 3W98A 5CEBA 3VOYA 2HGVA 4ZRRA 3BRMA 3UE6A 3AV2D 1ZLAC 3QP8A 5F99D 1P3AA 5GXQB 2JKGA 2QWSA 5AY8C 5FSRA 5B2JB 1CK3A 5AV9A 5AQBA 3GTCA 2XA7S 4E3NA 3SOIA 3H82A 4K91A 3F1NB 1H3OA 3F1PB 4HJ3A 2ZQ7A 4UUZA 1ONHA 4R70A 4WZ5A 3B6FC 1A0KA 3DBAA 1M18D 1SDNA 1VEUB 4KUDC 2W3FA 3W99B 3T1RA 3MGSB 3ZVTA 3UTBD 1BZAA 5GXQD 5GLCA 4UPKA 3B42A 1O07A 4GB7A 1T1AA 3T12B 2PBYA 5BO0B 4JXVA 5EM0A 1ESUA 4YM6A 5F5YA 4E3JA 1KX5D 1F66A 5A90A 3DW0A 4PM9A 5B32A 3QP5A 4WU9A 5CECA 1DP9A 3UB9A 5J3WA 4EEUA 5FDHA 1YU1A 3LEZA 3REKC 1YLTA 5F82A 3PBOA 5GHYA 3P01A 3E98A 3IHAA 4IBGA 4Q0IA 4NXGA 2A3UA 3G30A 1ZC2A 3C2WA 1QMEA 2ZC3B 4KENB 1ID3C 3VP0A 2XSSA 1H8YA 3RH8B 1PWGA 3C30A 4DRTA 2XEPA 3MQQA 3LIBA 5G4YA 4I3IA 3KXBA 3S1YA 3O5YA 5B33B 3DTMA 3HVFA 3UB6A 3S7QA 2WKRA 1LLBA 3OCNA 4JXWA 3HLBA 3K2NA 5E2FA 4R38A 2PYOB 1KX4C 4MN6A 1KS0A 3NCKA 1ZLAD 5AVBA 4LCMA 2W8SA 5B32B 1ZG6A 3OC2A 3N7WA 5DNMA 5FI2A 5BNVA 4AWLC 5GT0C 3DTIA 3AZHD 3MFXA 5HX9A 4ZTKA 3E2KA 3AZFC 3UMDA 3F1NA 4E3KA 1TS8A 1XA7A 4YS3B 5FQKA 1OTAA 1ZLAB 4GZBA 4BBVA 5F1GA 3VV4A 5TR7A 3VH6A 2ZQDA 4KQOA 4LD9B 4WYYA 3REKA 5EECA 1P3LA 1T1CA 2W3GA 2IOUA 5DFYA 2PR6A 1OPXA 4FD8A 3H0RC 3HCYA 4G91B 3AGFA 4KQQA 5AV9C 3R45A 3BFCA 5GXQA 4JF4A 3WS2A 1M19A 1PZRA 5EVLA 5GSUB 4NE3A 3NQUA 4KGCA 1XJ6A 1MWRA 3VSLA 3MMHA 4R4RA 5B33D 3HONA 4R8PB 2XGNA 3W98B 3AV1D 1H8PA 5L09A 1P3LB 2M1CA 4J8WA 4M4XA 1P3BC 5HAPA 1ERQA 3B6FD 2ZM5A 3AZKB 1W1PA 2VX8A 3LZ0A 2NQBC 2PDRA 3LIDA 5B24A 1J3WA 3F1OA 4GOGA 3WKJA 1M1AA 2F8NH 4IUKA 3REHA 1IEMA 4P6ZM 3TU4B 4X23A 2G7UA 4B93A 3WRZA 4F94A 3G35A 4S2NC 4KZBA 1N9NA 2F8NB 4LRYC 3KSGA 2P9VA 1UR8A 2B5RA 5DTKA 3RELD 1J7MA 4J8WD 2P7JA 3C1CD 3REHC 3W98D 3KSFA 1YAXA 5EUAA 1TS6A 4G3KA 3DWKA 4H6JB 3V67A 2EWWA 2UWXA 1NZUA 5AVEA 5DTSA 1QO6A 3W98C 3MGRD 3WS4A 4DE1A 1IKIA 1H8MA 5FEGA 3MFDA 3HLDA 4YM6D 4QLCC 5IT5A 4KZ9A 2WKPA 3B6GB 2VJWA 5IS1A 3W4OA 2Y8HA 2A2LA 3ZHHA 2JHEA 3IX3A 1GHPA 3UTAC 4CQHA 4G3VA 1P3BD 3S22A 1WYBA 3FC7A 3F1OB 4Z5TB 3LELA 2WYXA 2P08A 1H0MA 3DTKA 1NLZA 5HD5A 3BQ8A 3NQJB 4KUDB 3WA9B 1P3MC 1P3GA 2C6WB 2Y4AA 4KUDD 4ARZB 3N6IA 4ZUXA 4Y15A 5FUGB 1KGFA 1S4RA 3C1CA 3AZFA 2VKSA 4NKPA 4S2LA 1E6RA 3WTPC 5B40A 1W5DA 3EPLA 4J8WB 2ZMAA 1J9MA 5AVCD 4DKIA 4WU8D 2Y2PA 3LY3A 1W1VA 1ES5A 2LB5A 5B1MD 3FYZA 3VFHA 4LD9A 3TOIA 3MGQD 5B1MB 1P3OD 4NETA 3X1VA 3IH8A 4HJ6A 3OPPA 2WAFA 4ZUXB 3MGRC 5CP6A 3FKEA 1EW0A 3IX4A 4DN0A 3IF5A 3NQJA 5EOOA 3B0BA 1CEFA 1SKOA 3W4PA 2HIOB 4CPKA 3L27A 3LR3A 4Z2HA 4R3BA 3OPHA 3SZTA 1AOID 4X69A 3L2AA 1LSXA 4FSFA 4KUDA 4H9OB 3B0CW 1YLWA 5CP6B 1XXMA 1YM1A 4IBDA 3B6FA 2NQBB 1KGGA 4O0PA 5F99A 5AQ9A 5EOEA 3BWLA 4GH9A 1M1AD 3VP2A 1I2WA 4OJPA 4BD0A 3E4QA 1CI9A 4WZSB 3BLMA 5B0YA 1CJFA 1TS0A 4JGOA 3MGPD 4A5RA 1P3FC 4R23A 4IJEA 2PD8A 3A3JA 5TFQA 5GSUD 3LYXA 4X1MA 1IKGA 3AYWD 1WE4A 5CGSA 4E6WA 1BH9B 1OT9A 3VH5W 5EFWA 1P34A 3REJA 3D4FA 4GHIA 1AIWA 1U35C 2ZMFA 1XKZA 3C7UA 1FCOA 4MB4A 2PYPA 4CAYA 1P3KA 3T4QA 5E5AB 4MBHA 4IBRA 3KFUG 4WZ4A 3AZLA 3HL9A 4HJ4A 4KQDA 4IVIA 2HDSA 3EPHA 4Z66A 4WU9B 1YUEA 2IWDA 1L0GA 4R3JA 1NRJA 1FIKA 5B31B 4OP8A 1P3PC 1XPBA 2J3TD 4E04A 3LR5A 1U35B 5B1LB 3NHQA 1P9RA 5U47A 2XH9A 5B2IA 4LCLA 3AZED 5JRGD 3A6NB 3AZID 1MWUA 3NDGA 3MXQA 3W99A 3Q1FA 4WBGA 4H9SC 3REHB 1TVFA 2PBDP 5TBMB 3KUYA 5FAPA 3NQUB 3B6GC 1E8BA 5GSUA 1RGYA 3UY6A 3MSHA 1KU5A 2PU4A 3BFDA 3CJMA 4YM6B 1E3UD 1TDGA 3UPPA 3E0YA 4ZJ3A 3F1PA 3V3RA 1HLUP 2INWA 3SH7A 3AZNA 3E4PA 2CWEA 1E4DA 4E44A 5FQQA 4XUJB 1C3BA 5I94A 5J7EA 2YFVA 3N4IA 3OOVA 1YLZA 3EQUA 3A1IA 1BLCA 4P0MA 2NUPC 3C5AA 4XUJC 2EWVA 4IBXA 2PU2A 1EQZC 1MWTA 5AV8D 1SKFA 1ED7A 4S2IA 2VK3A 5AV8B 3GRJA 1FR1A 3EG5B 1BLPA 5E5AD 2EXBA 4QD4A 2A49A 4JBFA 4JJND 1OTDA 3CPTA 3LELD 3K3CA 3RXWA 3B0CT 2EX2A 3CMZA 1SZVA 4X53A 3X1TC 4UAAA 3WKJC 1ULYA 4GKUA 5DNMD 1BLSA 4WN5A 3LZ0C 3AZMC 3EQVA 4EBNA 4KHAB 4WU9C 1HVBA 3N8SA 1JFIA 1V9ZA 5B31C 1DJAA 3E4OA 4CAYB 1P3KB 1LSWA 3CG5A 4GHLA 1P3KD 4L9GA 5GSUC 1ID3A 3BECA 2Q9MA 4OPYA 4OQGA 3MGPC 4OLDA 3RELA 3HLCA 4HESA 1BH9A 1U35A 3IF6B 1G6OA 5MC7A 5FDSA 1VETB 5KIZA 5CHLB 2D02A 2V0UA 3LJAD 5CPKC 3GSGA 5BNVB 4JJNC 4FUWA 3LICA 2O9CA 3SS4A 1BYWA 1V9YA 5B2IB 1GHMA 2RVQC 4MBKA 4QPRA 3BFGA 1DRMA 2WKIA 4D2OA 4EUVA 4KUOA 4ZAMA 3IBRA 5JRGA 5B33A 5DKKA 2R9WA 2KDKA 4Y7PA 4PKYG 3UTBB 3IP4C 3W96B 5DNNA 1W1YA 2WGIA 4R0QA 5A91A 1N9OA 5HDSA 1P3PA 3T4LA 4X23D 2ZQAA 1G28A 5HFOA 1KE4A 2FFYA 3IF6A 1KX4A 3OPLA 4GHAA 2W0NA 3WS1A 4K0WA 3ZG0A 1K6SA 4NEED 4E3IA 4IBJA 4EO5C 3KWQB 1K56D 3NOUC 4IJFA 4R8PD 5B40C 1K54C 1H0GA 4FCFA 5B2JD 3O62C 2V20A 3CZDA 2IWCA 2C5WB 3KSYA 3CPTB 1KVLA 4ZUXC 4Q0HA 2WGVA 1IOUA 3MGSC 1FOFA 2Z6DA 1SCWA 4KG6A 4B4XA 3VMAA 5CHUA 4Z2IA 4H9OA 1MWSA 3PBRA 1ZHHB 4HI4A 4JF5A 5CXWA 3U2AA 1VEUA 1KOUA 2WKHA 3PAGA 2Y2GA 1K4EA 4CLCD 3LY4A 3V5MA 1YQSA 1K0KA 2HJEA 3C1CB 1KE3A 3H0LC 1PI5A 1CXWA 3CHWP 3HUOA 2OAP1 3KO6A 4UHUA 4BL3A 5AV5C 2A24B 2W3EA 3AZIB 2QJ5A 4XZQC 1NXYA 3O87A 5GL9A 1S1YA 5HARA 1ZG4A 2H0YA 4HH3A 2EFXA 3ZCZA 3BYDA 5DKLA 3ZG7B 2F8NG 2IWBA 5G18A 5FEFA 5EVIC 1XGJA 3CI6A 2ZC7A 4CLCB 4QNLA 5E2EA 4WLAA 5J8XA 2HUEC 5EVID 2DQNC 2NZDA 3MGPB 3WS0A 1OGGA 4L0LA 2MJ6A 3KS8A 3BLSA 1E3UA 3UTBA 1TZYC 3AZJA 2YFWA 4OOYA 3VSKA 5AY8B 1S4SA 5IU1A 5TBMA 4QU3A 3C1CC 2X01A 3W97C 5HPFA 4OOLA 2K2NA 2QYBA 4Z66B 2OWHA 2DMWA 1H8ZA 4OPRA 1K55A 4L9FA 4KZ6A 3X1UD 2NZDD 4Z5TA 3LELB 3L28A 1Y4OA 2PD7A 1NWZA 1AXBA 4OPZA 5CGXA 4DMZA 3UT9C 1K55C 1JTGA 1E25A 5CPJD 3EGXC 2R9XA 2OSUA 3WD4A 3HLWA 4EETB 2R78A 4MLLA 5B31D 3O62B 5E2GA 5B33C 2Q0OA 3WAAB 3O62D 3KSIA 5AJGA 2YFWB 1A7WA 3HJIA 3LI9A 5F83A 3LR4A 4MMNA 4EEPA 3LZ0D 5B1MC 3KWQC 3TU4C 3RELB 3MGRB 4F3LB 1X0OA 3IX8A 4Z2GA 1FR6A 1ES4A 3H0MC 3HLFA 4MB5A 3LELC 1Y54A 4CSRB 4TX8A 3NOTC 4N9KA 4B4ZA 2ZY5A 3S4XA 1LT0A 4NXBA 2M7VA 1TZYB 3MGPA 5HWTA 4OJOA 3G2ZA 2F8NA 3V39A 4NXEA 3EEHA 5CPIB 4XUXA 1TEMA 1Y28A 3UT9A 2BASA 3E2LA 3JPUA 4IJGA 5EPHA 3X1UC 4NY2A 5B0ZC 2DF4C 3AN2C 1CF0A 3PHYA 4H9RA 4DE0A 3FDDA 4Z2MG 4O7DA 4WNNA 5CPKB 3PAEA 4LD9C 1ONGA 5B0ZB 3AN2B 4X23B 5B0ZD 3AN2D 4BMWA 3OBFA 1RP5A 1TDLA 3B6GD 5CRFA 3HBRA 3KXBC 5DNNC 1H5XA 5I5LA 5JRGC 5KDMB 2EA9A 3AV2C 3C38A 1LL9A 5GT0B 4XUJA 1ZTUA 4BENA 4XT2A 4DE2A 5C3IC 1VB6A 4GN2A 1ID3D 2WUQA 5FAOA 3AV1A 2VGLS 1OTIA 4C3QA 2M7UA 3X1TB 3WD2A 2HV1A 2GZAA 4I39A 1LSVA 3KYQA 5TJJA 2F8ND 5BNXB 1JWZA 5JA4B 4X55A 5TGFA 4EERA 4RYEA 4MB3A 5AVCC 3WD3A 2VV8A 1EI5A 4AFIA 2HIOC 4GW9A 5FATA 4YINA 4HMDA 2V1AA 1LHYA 4JGPA 4P87A 4I5SA 3B47A 5AQ7A 5B31A 3VE4A 1G5UA 1P3BB 5DTTA 2B02A 3NBLA 2ZY4A 2J7VA 4BLMA 1WYCA 2VLGA 3FG8A 4I3JA 2WK0A 4QY5A 3AFAD 3FKWA 1BH8A 5C3IB 1HD8A 1M18C 2HP5A 3GDIA 1ODVA 3LR0A 4R8PC 5B40D 1CK7A 4MDZA 5DVAA 3FWLA 3LUQA 2BYMB 4FH4A 3BEBA 3MQOA 4D60A 3W96A 1GSVA 4II7A 2FH5A 2WAEA 3B0DB 2PYOA 1F66B 2D01A 1JTDA 4X23C 1VETA 4Z1WA 4Z5TD 3AFAA 3ZGAB 2P74A 5M18A 2NQBA 5HZHA 1HQ3C 4J8VA 4FOFA 2GX5A 4G3WA 2XA7M 1S66L 5E2HA 3G32A 1P3BA 4UQIS 1M1AB 3DAVA 4EESA 4NXFA 4E3OA 5M1AA 1L6JA 2XK1A 4MNRA 4UA6A 4GJ4A 3LIAA 4I3AA 1XA1A 5GLAA 3W8KA 4RA7A 2JKTI 4UQIM 1P97A 2VA0A 5G49A 3H82B 3IWQA 2JN7A 1BFMA 3KUYD 3C1BC 4DJ3A 5JYPA 1PNEA 4WEKA 3WAAD 1CI8A 1KX3A 3IXGA 5B32C 3LFVA 5A8BA 3BW6A 3GV9A 4Y0OA 1SKOB 3ZYTA 1HQ3B 1ESIA 3NOPC 4OJ6A 5FQMA 3W96D 3HJKA 5B40B 2ZL1A 1H3QA 4WU9D 2WADA 1MXOA 4IEDA 3KUYB 2WKQA 4UUZB 5HPIA 3UPOA 3ITAA 4WMCD 3UNWA 2FJ7A 4YS3A 4XT2B 2FFFB 5AV9D 1W63Q 4GDNA 1K57A 5B2ID 4J8VC 4LRZE 4M3KA 1L3LA 5B24C 3UDFA 5AV6B 5J4EA 3AZGD 4BBTA 4J8XA 3PBTA 3AGEA 2CMNA 4PM7A 2ZM2A 2XD1A 1KX5C 1PI4A 5BS7C 1U60A 2I72A 2RTSA 3EGDC 4Z66C 4DDYA 3WAAC 3W97A 1BULA 3UTBC 1FSWA 2QKPA 1AOIC 1O7EA 3RXXA 2JKTM 1TZYA 3AZJC 3MNNC 4FH2A 2UV0E 4S2NA 4BWIA 3WD0A 2QMIA 2Q9NA 2WZZA 1F2KA 4G91C 1M6KA 3IBJA 1PW1A 3A6NC 1XFNA 3AZEA 5DF9A 2Y2IA 5GT0D 3IS2B 4CJNA 3L25A 2CV5A 4IBKA 3DTEA 1P3OC 3PYPA 5E5AA 2H5SA 3G2YA 3A3FA 1KE0A 4WMCA 3AZIC 2J9OA 3MXRA 4HHDA 3PTEA 4LD9D 4OQHA 2IA2A 5AQAA 4NYYA 4IVKA 2G2WA 1SHVA 2P04A 3MS6A 4N92A 2QPNA 4QWOA 3AV1C 2AROD 1P3MB 1PYYA 2RIQA 5JYOA 3MGSA 2AROB 1P3MD 2FZ0A 3REJD 4HIAA 5CPIC 1BSGA 1GHIA 3RFBA 1N1JB 4WELA 2ZLYA 3B3XA 3MF0A 4Y5FA 4KGCB 1UWNX 2Y2JA 4N1HA 3WTPA 3AZKD 1H3OB 2E8IA 2ZOHA 3DWZA 2O9AA 4PM6A 5F6AA 1PWCA 2KOIA 3BFFA 1Q9CA 4J8UC 4Q8IA 4NE6A 1FCNA 3CWFA 4WF0A 1DP8A 3TU4D 1M18A 1OGBA 3REJC 3Q7ZA 1T18A 3IXHA 2XFSA 1P0ZA 2FN2A 1TAFB 5CTMA 2KLIA 5HDCA 2LB9A 2VV6A 4GS9A 1XP4A 4ARZA 3LZ1D 3W96C 4G92C 4I38A 2ACGA 3MKEA 4LV2A 5IHVA 4HMCA 2PYOD 3AZIA 1M19C 3BFEA 5FQ9A 5G49B 2L0WA 3AZHC 2Y2OA 5B32D 5HD3A 3MZDA 3SW1A 4JJNA 1WWIA 2QZ6A 3OZHA 5CPIA 1GA0A 4EV4A 2RCXA 1KVMA 2ZY2A 1OTBA 3ZNTA 3KWQA 3EPKA 3KYZA 3VH6W 2V9AA 2BYKB 3X1VD 2V2FF 3B33A 3ZFZA 1IYOA 5B31G 1FQGA 1P3ID 4HMEA 1GXDA 2J3WA 1ALQA 4DF6A 3KXBB 1NRFA 2CV5D 3LZ1C 2XR0A 3AV2B 3AZJD 4NZ1A 2HJ9C 1ERMA 2WGWB 5DNNB 4X6TA 5HL1A 3R4KA 2L5AA 5GLDA 2BLSA 3ZG5A 1LI9A 1P34C 3C8CA 3MQ0A 2ZC4B 3X1UA 4IUHA 3W99D 3AZNC 2XD5A 1N1JA 1TD5A 1NYYA 5HWWA 1KDWA 5EVIB 5B24D 2ZQCA 3SH8A 5AVBC 3PR6A 4J8VD 4P6BA 2AROA 4KZ5A 4OP5A 3W4QA 5KSHA 1P34D 1YMSA 3LGOA 3PXPA 3NIAA 1W7FA 4Y0UA 3REIB 2F8NK 1UR9A 5GHZA 4KZ7A 4EW7A 2JKFA 3CUEA 4Z2MH 3KSHA 1Z6FA 2O9BA 3O3VA 2FJ7B 4HP4A 1GA9A 4WU8B 2VGJA 1YT4A 3AZMB 2W3HA 3H7WA 3UTAD 3AYWA 5CPJC 5B24B 3MGQB 4AWLB 1YLYA 1HTAA 1K38A 4R4SA 2HIOD 4OQ0A 1W8YA 5FQJA 2W27A 3MVDC 3D3OA 3KS4A 5A92A 5BPVA 1F98A 5AY8D 2ZMVA 5DF7A 3X1SA 1KX4D 3KUYC 3Q7VB 1AOIB 2OOLA 3FZCA 3LZ1A 3GMWA 1PRQA 1N9BA 2HP9A 1E6NA 3MBZA 4H9SA 4PKYA 3T4OA 1FILA 2XQZA 5B1LC 5CHJA 2GJ3A 2ZM8A 1P3LC 4WNNB 2W1TB 2XROA 4P6ZS 4R6LA 4J8WC 2QJ7A 5CPJB 4H9RB 3ZQ5A 3CUEC 3EEAA 3FKVA 3AZHA 4X25A 5GLBA 4KZ3A 4R8PA 2L1MA 5F69A 5HAQA 5AV8A 1YKDA 3ITBA 4ZBEA 5M19A 2B95A 2NQBD 2EFUA 3HSHA 2AVXA 4OLGA 4YS3D 3BM6A 2DCFA 3KYEA 3N8LA 5GHXA 2E8JA 5CPID 1L0FA 2VEAA 3AFAC 3IF6C 4WU8A 4CLCC 4S2PA 4ZJ2A 4WL9A 4E6XA 5F1FA 4F3LA 1HQ3A 3M2JA 5L8MA 1W63M 4E45A 4YS3C 1FCMA 5CHMA 1F66C 4LGWA 4YFMA 2L4RA 3NY4A 1KDSA 4QLCB 3D72A 5B0YC 4KZ4A 4ESPA 4IHQA 5FI6A 3HUMA 4E3LA 3LZ1B 2VQRA 3BY9A 2G5IC 4PMAA 4Y3IA 3UE0A 2IO5C 3IXBA 1ACFA 4HOIA 4NZ4A 1MC0A 3A1KA 2JBFA 2ZJ9A 4JXGA 3BQAA 3P5JB 1OT6A 2H10A 4MBFA 3VH6T 2ZBBA 1YLPA 4HBUA 1P3LD 5E43A 4XZQA 3AZFD 4EWFA 1S32D 4RVAA 2BG1A 3AV2A 4OKPA 1IELA 4BBUA 3REHD 3T4SA 1P3AC 3G31A 4XUJD 4NFTA 1CQAA 4GD8A 5AY8A 3IHBA 5KSCA 3MZEA 3RJUA 1MY8A 3NDEA 3AZGA 2NZDC 1XGIA 1ID3B 3LCEA 5GT0A 3AZEB 1HQ3D 5G4ZA 3IWOA 4GD6A 4KG5A 4LV0A 1NYMA 5GT3C 4S2JA 1K57C 3X1TA 1WA9A 4S2KA 3GECA 5CPKD 4EXOA 3AZGC 1JFIB 4NYUA 5DF8A 2FJ7C 4NZ5A 1M19D 1TZYD 4DXBA 2HIOA 2BTFP 4DQYB 1F5MA 3TRCA 1S0WA 3W97B 4EBPA 5AV9B 2JE5A 5B0YB 1Z2CB 3SS3A 5AV6D 1PWDA 3UB7A 3REKD 4JJNB 3REID 4QB8A 3T50A 1YU2A 1T1BA 3ZDJA 5FI7A 2Y2LA 3AZNB 5CPKA 4CLCE 3HUNA 3AZND 2ZOIA 3L7HA 3WD1A 3AZMD 2IO5B 3MQLA 3Q81A 4HGAC 3WTPB 4FTXA 5GXQC 5AV5A 3C1BD 1XJ2A 4PPRA 4OH0A 5HL6A 5B32G 5HWVA 3L26A 2DRWA 1LL5A 3QNCA 5EVEA 2CV5C 1U35D 1GCEA 1I5QA 3VOLA 2CC1A 1PIOA 4Z2KA 5E5AC 5KDMA 1P3OB 4HEFA
chains in the Genus database with same CATH topology
3UT9D 1P3IB 1EQZD 1TAFA 3AYWC 5CPJA 5B1MA 3AZMA 2YFVB 1QMFA 5KZHA 1R4VA 4IBBA 3A6NA 1P3FB 3VP3A 2HPBA 5DNND 5CP6D 1IYPA 3PBSA 1PZPA 3REIA 3W97D 3WAAA 3TG9A 1KX5B 1EROA 2JSSA 3GR2A 3HLEA 4UA7A 4ZBJB 4X68A 2WZXA 1EQZA 3REJB 5CP6C 1KX3D 1EQZB 5GT3B 4IBIA 4GDBA 1YU3A 4J8VB 3VP4A 5B1LA 2Y2QA 2HP6A 4OQIA 4XXRA 3A3IA 4M6BA 4CSRA 5FAQA 1SDEA 4KGCC 2BYMA 2XDMA 3GQZA 4XZQD 4LG2A 3AZLB 3MVDB 1YMXA 4WEJA 5B2IC 4J8XB 3AZKA 2J8PA 3KWQD 4DDSA 3WS5A 5EVIA 4WU8C 3MZFA 4C75A 2RL3A 3TU4A 3M6HA 1FSYA 3MGSD 1KGEA 4OJ5A 2Y2KA 4H9NB 4K0XA 2WGWA 3REIC 1MKIA 5B2JC 4IBEA 4XUZA 3FV7A 5D3OA 3X1VB 1KX5A 5BS7A 3UE3A 1KX3B 1L0EA 1I2SA 2Y59A 3UE1A 2WKEA 3P09A 2OLVA 1T3UA 3R45B 4X56A 4U0XA 2Z2LB 3X1SD 1DJBA 4IBFA 5AV8C 4KGCD 2Y2NA 5AV5B 2ZY3A 1M40A 3AZLC 4P85A 4JXSA 1K4FA 1M19B 3AZLD 2EX9A 4EO5B 5BT1C 1YLJA 2RVQD 1MBLA 4Z66D 1P3GC 1P3MA 4DE3A 3AZGB 1K6RA 3REKB 3L29A 3OCLA 1KX4B 1F1EA 3OPRA 4H9PB 3LJAC 3IH9A 5FA7A 4MEZA 1OMEA 4JPMA 3RELC 4BD1A 5AV5D 3C1BA 5DNMB 4EUZA 3Q07A 3NC8A 1VQQA 1Q2PA 3O88A 1P3PD 5CGWA 1P3PB 3MGRA 3O86A 3WA9A 1RGZA 2J9PA 1NY0A 1S6RA 1JVJA 3V50A 4OOMA 2CV5B 4PM8A 3UDXA 4HGAB 5A93A 3P98A 2Y2MA 3UO9A 1DY6A 5AVBD 2HUEB 3A3DA 3TSGA 5AVBB 2Y55A 2VGKA 4LENA 4H9PA 3JYIA 4N1XA 3AV1B 1WWSA 1BH8B 1P3GD 1L0DA 3B6FB 1NJ4A 4KZAA 5GT3A 4S2MA 1ES2A 1S32A 3LO7A 2LY8A 4OVDA 4BL2A 5BNXA 3UTAA 4J8UA 1B67A 3KXBD 3C4OA 3B0DC 5AVCA 3AZJB 2J8YA 4JKTA 2ZC5B 3WTPE 3C7VA 3X1SC 2P9VB 3HLGA 4RX2A 1YU4A 2XLNA 3AZEC 3NI9A 1W8QA 3MVDD 1P3IA 3AGDA 1RCJA 5FQIA 1HTZA 3N8RA 3ZG8B 4QHCA 1ES3A 2Y91A 4S2OA 3IWIA 2G2UA 3ZG9B 2X02A 1G6AA 4QY6A 1Q2QA 2EX6A 1K56A 2GDNA 4E3MA 3AZHB 1XX2A 1JWVA 5AVCB 5BOHA 3MGQC 1IYSA 5DNMC 3WWXA 3IT9A 4BJPA 2DNSA 2EXAA 1S32B 3WKJD 4Z9QA 4ZDXA 1P3GB 1K25A 1BUEA 4UA9A 4WZ5C 1DJCA 3V3SA 4WJ3C 1PW8A 5B0YD 3MGQA 3A3EA 3UPNA 2JC7A 4J8UB 1F66D 3Q7VA 3C4PA 3N3FA 3X1SB 3VH5A 3IQAA 3M2KA 3B6GA 2ZQ8A 2AROC 3AFAB 3UN7A 4EQIA 3I7JA 1M1AC 1W79A 4HBTA 4H9QB 2FJ7D 3AYWB 1NZOA 1PZOA 1KX3C 1P3IC 3WA9C 3UTAB 3WRTA 4XZQB 2Z2MB 3C1BB 3WA9D 1P34B 4RX3A 1HZOA 1ZKJA 3X1UB 1N4OA 4WV4B 5FASA 3ZVWA 4OUIA 4QLCD 3ZNYA 3HREA 2G5HC 3VP1A 4KZ8A 4Y0TA 4GNUA 5KMWA 5CEDA 1P3AD 3QNBA 3IXDA 1P3KC 1BT5A 1S32C 4C6YA 3WX7A 1IYQA 3WKJB 5F99B 4J8XC 4OONA 4U0TA 5B0ZA 3AN2A 3LZ0B 4U3TA 3MNND 3SS5A 2NZDB 5JA4A 3MNNB 4R1GA 5B2JA 4NK3A 3X1TD 4OPQA 4J8UD 1K54A 1P3AB 3SH9A 5EE8A 4JLFA 3UT9B 4ID4A 4N9LA 4NZ3A 1M18B 3G34A 1L2SA 2OV5A 5CTNA 2V1ZA 4KG2A 2OLUA 5AV6C 1MPLA 4DRBA 3UDIA 4ZBJC 4JF6A 4ZJ1A 4B88A 3W99C 4BQMA 4LV3A 3MVDA 1CEGA 3Q82A 2HDRA 3LJAA 5F99C 1W2EA 2F2AC 5B1LD 4H9NA 4IBCA 1JWPA 1G68A 4WM9A 3AZFB 5JRGB 3A6ND 2XFTA 3O62A 3G4PA 1AOIA 5HAIA 5L2FA 3VH5T 3ISGA 2ZD8A 3MKFA 4NE5A 2JCHA 3GVBA 2X71A 3V9RB 4DXCA 4Z5TC 1VM1A 2H0TA 4EBLA 5FUGA 2EX8A 5HW3A 3VFFA 4LV1A 3PBNA 3WTPD 2PYOC 3MNNA 1BTLA 5CERA 4ZUXD 3F6TA 4H8RA 2HDQA 4QLCA 2XF3A 3M6BA 5BO0A 1P3FD 3QHYA 3EPJA 4G92B 2ZC6B 4KQRA 4QJGA 4OJLA 3LJAB 1BLHA 3AZKC 4H9QA 3V9RA 3MXSA 2BYKA 1LI0A 5GT3D 1B6WA 1YU0A 2Y2HA 1P3FA 5BT1D 1EWZA 3AL0C 2ZQ9A 4YM6C 2ZM0A 4DRAA 2HDUA 3VOZA 4J8XD 3PBQA 1ZLAA 1P3OA 4PM5A 5AV6A 3X1VC 4KHAA 3W98A 5CEBA 3VOYA 3BRMA 3AV2D 1ZLAC 5F99D 1P3AA 5GXQB 5AY8C 5FSRA 5B2JB 1CK3A 5AV9A 5AQBA 3GTCA 4E3NA 3SOIA 4K91A 1H3OA 2ZQ7A 4UUZA 1ONHA 4WZ5A 3B6FC 1M18D 1SDNA 4KUDC 3W99B 3MGSB 3ZVTA 3UTBD 1BZAA 5GXQD 5GLCA 4UPKA 1O07A 4GB7A 2PBYA 5BO0B 4JXVA 1ESUA 4YM6A 4E3JA 1KX5D 1F66A 5A90A 3DW0A 4PM9A 5B32A 4WU9A 5CECA 5FDHA 1YU1A 3LEZA 3REKC 1YLTA 5F82A 3PBOA 5GHYA 3IHAA 4IBGA 2A3UA 3G30A 1ZC2A 1QMEA 2ZC3B 4KENB 1ID3C 3VP0A 1H8YA 1PWGA 4DRTA 2XEPA 3KXBA 3S1YA 5B33B 3DTMA 3HVFA 3OCNA 1LLBA 4JXWA 5E2FA 3HLBA 2PYOB 1KX4C 3NCKA 1ZLAD 5AVBA 4LCMA 2W8SA 5B32B 1ZG6A 3OC2A 3N7WA 5DNMA 5FI2A 5BNVA 4AWLC 5GT0C 3AZHD 5HX9A 4ZTKA 3E2KA 3AZFC 4E3KA 1XA7A 4YS3B 5FQKA 1ZLAB 4GZBA 5F1GA 5TR7A 3VH6A 2ZQDA 4KQOA 4LD9B 4WYYA 3REKA 5EECA 1P3LA 2IOUA 4FD8A 3H0RC 4G91B 3AGFA 4KQQA 5AV9C 3R45A 3BFCA 5GXQA 4JF4A 3WS2A 1M19A 1PZRA 5EVLA 5GSUB 4NE3A 3NQUA 4KGCA 1MWRA 3VSLA 4R4RA 5B33D 3HONA 4R8PB 2XGNA 3W98B 3AV1D 1P3LB 4J8WA 1P3BC 5HAPA 1ERQA 3B6FD 2ZM5A 3AZKB 3LZ0A 2NQBC 5B24A 4GOGA 3WKJA 1M1AA 2F8NH 3REHA 1IEMA 3TU4B 4X23A 3WRZA 4F94A 3G35A 4S2NC 4KZBA 2F8NB 2P9VA 2B5RA 5DTKA 3RELD 4J8WD 3C1CD 3REHC 3W98D 5EUAA 3DWKA 2UWXA 1NZUA 5DTSA 3W98C 3MGRD 3WS4A 4DE1A 1IKIA 3MFDA 3HLDA 4YM6D 4QLCC 4KZ9A 3B6GB 3W4OA 3ZHHA 1GHPA 3UTAC 1P3BD 3S22A 1WYBA 4Z5TB 3LELA 2WYXA 3NQJB 4KUDB 3WA9B 1P3MC 1P3GA 2C6WB 2Y4AA 4KUDD 3N6IA 4ZUXA 5FUGB 1KGFA 3C1CA 3AZFA 4S2LA 3WTPC 5B40A 1W5DA 3EPLA 4J8WB 2ZMAA 1J9MA 5AVCD 4DKIA 4WU8D 2Y2PA 3LY3A 1ES5A 5B1MD 3FYZA 3VFHA 4LD9A 3TOIA 3MGQD 5B1MB 1P3OD 4NETA 3X1VA 3IH8A 3OPPA 2WAFA 4ZUXB 3MGRC 5CP6A 3FKEA 3IF5A 3NQJA 5EOOA 3B0BA 1CEFA 3W4PA 2HIOB 4CPKA 3L27A 4R3BA 3OPHA 1AOID 4X69A 3L2AA 4FSFA 4KUDA 4H9OB 3B0CW 1YLWA 5CP6B 1XXMA 1YM1A 4IBDA 3B6FA 2NQBB 1KGGA 5F99A 5AQ9A 5EOEA 4GH9A 1M1AD 3VP2A 1I2WA 4OJPA 4BD0A 1CI9A 4WZSB 3BLMA 5B0YA 3MGPD 4A5RA 1P3FC 4R23A 4IJEA 3A3JA 5TFQA 5GSUD 1IKGA 3AYWD 1WE4A 5CGSA 4E6WA 1BH9B 3VH5W 1P34A 3REJA 3D4FA 1U35C 1XKZA 3C7UA 1FCOA 4CAYA 1P3KA 5E5AB 4MBHA 4IBRA 3KFUG 4WZ4A 3AZLA 3HL9A 4IVIA 2HDSA 3EPHA 4Z66A 4WU9B 1YUEA 2IWDA 1L0GA 4R3JA 5B31B 4OP8A 1P3PC 1XPBA 1U35B 5B1LB 5U47A 2XH9A 5B2IA 4LCLA 3AZED 5JRGD 3A6NB 3AZID 1MWUA 3NDGA 3W99A 3Q1FA 4WBGA 4H9SC 3REHB 1TVFA 3KUYA 5FAPA 3NQUB 3B6GC 5GSUA 1RGYA 3UY6A 1KU5A 2PU4A 3BFDA 3CJMA 4YM6B 1E3UD 1TDGA 3UPPA 4ZJ3A 3V3RA 3SH7A 3AZNA 2CWEA 1E4DA 4E44A 5FQQA 4XUJB 1C3BA 5I94A 2YFVA 3N4IA 1YLZA 3EQUA 3A1IA 1BLCA 4P0MA 3C5AA 4XUJC 4IBXA 2PU2A 1EQZC 1MWTA 5AV8D 1SKFA 4S2IA 5AV8B 3GRJA 1FR1A 3EG5B 1BLPA 5E5AD 2EXBA 4QD4A 2A49A 4JBFA 4JJND 3LELD 3RXWA 3B0CT 2EX2A 3CMZA 4X53A 3X1TC 4UAAA 3WKJC 1ULYA 4GKUA 5DNMD 1BLSA 3LZ0C 3AZMC 3EQVA 4EBNA 4KHAB 4WU9C 1HVBA 3N8SA 1JFIA 5B31C 1DJAA 4CAYB 1P3KB 3CG5A 4GHLA 1P3KD 5GSUC 1ID3A 3BECA 2Q9MA 4OPYA 4OQGA 3MGPC 4OLDA 3RELA 3HLCA 4HESA 1BH9A 1U35A 3IF6B 5CHLB 3LJAD 5CPKC 3GSGA 5BNVB 4JJNC 3SS4A 5B2IB 1GHMA 2RVQC 4MBKA 3BFGA 2WKIA 4D2OA 4ZAMA 5JRGA 5B33A 2R9WA 4Y7PA 3UTBB 3IP4C 3W96B 5DNNA 2WGIA 4R0QA 5A91A 1P3PA 4X23D 2ZQAA 5HFOA 1KE4A 2FFYA 3IF6A 1KX4A 3OPLA 4GHAA 3WS1A 4K0WA 3ZG0A 1K6SA 4E3IA 4IBJA 4EO5C 3KWQB 1K56D 4IJFA 4R8PD 5B40C 1K54C 4FCFA 5B2JD 3O62C 2V20A 3CZDA 2IWCA 2C5WB 3KSYA 1KVLA 4ZUXC 2WGVA 3MGSC 1FOFA 1SCWA 4KG6A 4B4XA 3VMAA 5CHUA 4H9OA 1MWSA 3PBRA 5CXWA 4JF5A 2WKHA 3PAGA 2Y2GA 1K4EA 3LY4A 3V5MA 1YQSA 3C1CB 1KE3A 3H0LC 1PI5A 3HUOA 4UHUA 4BL3A 5AV5C 3AZIB 4XZQC 1NXYA 3O87A 5GL9A 5HARA 1ZG4A 2H0YA 3ZCZA 2EFXA 3BYDA 3ZG7B 2F8NG 2IWBA 5G18A 5EVIC 1XGJA 2ZC7A 4QNLA 5E2EA 5J8XA 2HUEC 5EVID 2DQNC 2NZDA 3MGPB 3WS0A 4L0LA 3KS8A 3BLSA 1E3UA 3UTBA 1TZYC 3AZJA 2YFWA 4OOYA 3VSKA 5AY8B 4QU3A 3C1CC 2X01A 3W97C 4OOLA 4Z66B 1H8ZA 4OPRA 1K55A 4KZ6A 3X1UD 2NZDD 4Z5TA 3LELB 3L28A 1AXBA 4OPZA 5CGXA 3UT9C 1K55C 1JTGA 1E25A 5CPJD 2R9XA 2OSUA 3HLWA 4MLLA 5B31D 3O62B 5E2GA 5B33C 3WAAB 3O62D 2YFWB 1A7WA 5F83A 3LZ0D 5B1MC 3KWQC 3TU4C 3RELB 3MGRB 1FR6A 1ES4A 3H0MC 3HLFA 3LELC 1Y54A 4CSRB 4N9KA 4B4ZA 2ZY5A 3S4XA 1TZYB 3MGPA 4OJOA 3G2ZA 2F8NA 3V39A 5CPIB 4XUXA 1TEMA 3UT9A 3E2LA 5EPHA 3X1UC 4NY2A 5B0ZC 2DF4C 3AN2C 4H9RA 4DE0A 3FDDA 4Z2MG 4O7DA 4WNNA 5CPKB 3PAEA 4LD9C 1ONGA 5B0ZB 3AN2B 4X23B 5B0ZD 3AN2D 1RP5A 1TDLA 3B6GD 5CRFA 3HBRA 3KXBC 5DNNC 1H5XA 5JRGC 5KDMB 3AV2C 1LL9A 5GT0B 4XUJA 4BENA 4DE2A 5C3IC 4GN2A 1ID3D 2WUQA 5FAOA 3AV1A 4C3QA 3X1TB 2F8ND 5BNXB 1JWZA 5JA4B 4X55A 5TGFA 4RYEA 5AVCC 1EI5A 2HIOC 5FATA 4YINA 1LHYA 4P87A 5AQ7A 5B31A 1P3BB 5DTTA 3NBLA 2ZY4A 2J7VA 4BLMA 1WYCA 2WK0A 4QY5A 3AFAD 3FKWA 1BH8A 5C3IB 1HD8A 1M18C 2HP5A 4R8PC 5B40D 5DVAA 3FWLA 2BYMB 4FH4A 3BEBA 3W96A 2WAEA 3B0DB 2PYOA 1F66B 1JTDA 4X23C 4Z5TD 3AFAA 3ZGAB 2P74A 5M18A 2NQBA 1HQ3C 4J8VA 5E2HA 3G32A 1P3BA 1M1AB 4E3OA 5M1AA 2XK1A 4MNRA 4UA6A 1XA1A 5GLAA 3W8KA 4RA7A 5G49A 3IWQA 1BFMA 3KUYD 3C1BC 5JYPA 4WEKA 3WAAD 1CI8A 1KX3A 3IXGA 5B32C 3GV9A 4Y0OA 1HQ3B 1ESIA 4OJ6A 5FQMA 3W96D 5B40B 4WU9D 2WADA 1MXOA 4IEDA 3KUYB 4UUZB 3UPOA 3ITAA 4WMCD 3UNWA 2FJ7A 4YS3A 2FFFB 5AV9D 4GDNA 1K57A 5B2ID 4J8VC 4M3KA 5B24C 3UDFA 5AV6B 3AZGD 4J8XA 3PBTA 3AGEA 4PM7A 2ZM2A 2XD1A 1KX5C 1PI4A 5BS7C 1U60A 2I72A 4Z66C 4DDYA 3WAAC 3W97A 1BULA 3UTBC 1FSWA 1AOIC 1O7EA 3RXXA 1TZYA 3AZJC 3MNNC 4FH2A 4S2NA 2QMIA 2Q9NA 2WZZA 4G91C 1M6KA 1PW1A 3A6NC 3AZEA 5DF9A 2Y2IA 5GT0D 4CJNA 3L25A 2CV5A 4IBKA 1P3OC 5E5AA 2H5SA 3G2YA 3A3FA 1KE0A 4WMCA 3AZIC 2J9OA 3MXRA 3PTEA 4LD9D 4OQHA 5AQAA 4NYYA 4IVKA 2G2WA 1SHVA 4N92A 2QPNA 3AV1C 2AROD 1P3MB 1PYYA 2RIQA 5JYOA 3MGSA 2AROB 1P3MD 3REJD 5CPIC 1BSGA 1GHIA 1N1JB 4WELA 2ZLYA 3B3XA 4KGCB 2Y2JA 4N1HA 3WTPA 3AZKD 1H3OB 2E8IA 3DWZA 4PM6A 1PWCA 3BFFA 1Q9CA 4J8UC 4Q8IA 4NE6A 1FCNA 3TU4D 1M18A 3REJC 3Q7ZA 3IXHA 2XFSA 1TAFB 5CTMA 1XP4A 3LZ1D 3W96C 4G92C 3MKEA 4LV2A 5IHVA 2PYOD 3AZIA 1M19C 3BFEA 5FQ9A 5G49B 3AZHC 2Y2OA 5B32D 3MZDA 4JJNA 1WWIA 2QZ6A 3OZHA 5CPIA 1GA0A 4EV4A 2RCXA 1KVMA 2ZY2A 3ZNTA 3KWQA 3EPKA 3VH6W 2BYKB 3X1VD 2V2FF 3ZFZA 1IYOA 5B31G 1FQGA 1P3ID 1ALQA 4DF6A 3KXBB 1NRFA 2CV5D 3LZ1C 2XR0A 3AV2B 3AZJD 4NZ1A 1ERMA 2WGWB 5DNNB 4X6TA 5HL1A 2L5AA 5GLDA 2BLSA 3ZG5A 1LI9A 1P34C 2ZC4B 3X1UA 3W99D 3AZNC 2XD5A 1N1JA 1NYYA 1KDWA 5EVIB 5B24D 2ZQCA 3SH8A 5AVBC 4J8VD 4P6BA 2AROA 4KZ5A 4OP5A 3W4QA 5KSHA 1P34D 1YMSA 3NIAA 1W7FA 4Y0UA 3REIB 2F8NK 5GHZA 4KZ7A 4Z2MH 1Z6FA 3O3VA 2FJ7B 1GA9A 4WU8B 2VGJA 1YT4A 3AZMB 3UTAD 3AYWA 5CPJC 5B24B 3MGQB 4AWLB 1YLYA 1HTAA 1K38A 4R4SA 2HIOD 4OQ0A 1W8YA 5FQJA 3MVDC 3KS4A 5A92A 5BPVA 5DF7A 5AY8D 3X1SA 1KX4D 3KUYC 3Q7VB 1AOIB 3FZCA 3GMWA 3LZ1A 1N9BA 2HP9A 3MBZA 4H9SA 2XQZA 5B1LC 5CHJA 2ZM8A 1P3LC 4WNNB 4J8WC 5CPJB 4H9RB 3FKVA 3AZHA 5GLBA 4KZ3A 4R8PA 5HAQA 5AV8A 3ITBA 4ZBEA 5M19A 2NQBD 2EFUA 3HSHA 4OLGA 4YS3D 3BM6A 2DCFA 3N8LA 5GHXA 5CPID 1L0FA 3IF6C 3AFAC 4WU8A 4S2PA 4ZJ2A 4E6XA 5F1FA 1HQ3A 3M2JA 4E45A 4YS3C 1FCMA 5CHMA 1F66C 4YFMA 3NY4A 1KDSA 4QLCB 5B0YC 4KZ4A 5FI6A 3HUMA 4E3LA 3LZ1B 2VQRA 2G5IC 4PMAA 3UE0A 2IO5C 3IXBA 4NZ4A 3A1KA 2JBFA 2ZJ9A 4JXGA 3P5JB 2H10A 4MBFA 3VH6T 1YLPA 4HBUA 1P3LD 5E43A 4XZQA 3AZFD 4EWFA 1S32D 4RVAA 2BG1A 3AV2A 4OKPA 1IELA 3REHD 1P3AC 3G31A 4XUJD 4NFTA 4GD8A 5AY8A 3IHBA 5KSCA 3MZEA 3RJUA 1MY8A 3NDEA 3AZGA 2NZDC 1XGIA 1ID3B 3LCEA 5GT0A 3AZEB 1HQ3D 3IWOA 4GD6A 4KG5A 4LV0A 1NYMA 5GT3C 4S2JA 1K57C 3X1TA 4S2KA 5CPKD 3AZGC 1JFIB 4NYUA 5DF8A 2FJ7C 4NZ5A 1M19D 1TZYD 4DXBA 2HIOA 4DQYB 1S0WA 3W97B 4EBPA 5AV9B 2JE5A 5B0YB 1Z2CB 3SS3A 5AV6D 1PWDA 3REKD 4JJNB 3REID 4QB8A 1YU2A 3ZDJA 5FI7A 2Y2LA 3AZNB 5CPKA 3HUNA 3AZND 3AZMD 2IO5B 3Q81A 4HGAC 3WTPB 5GXQC 5AV5A 3C1BD 4PPRA 4OH0A 5B32G 3L26A 2DRWA 1LL5A 3QNCA 2CV5C 1U35D 1GCEA 1I5QA 2CC1A 1PIOA 5E5AC 5KDMA 1P3OB 4HEFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CI8 A;  2X71 A;  1XPB A;  4DXC A;  2H0T A;  1VM1 A;  3IXG A;  4EBL A;  1QMF A;  2EX8 A;  5U47 A;  5HW3 A;  2XH9 A;  5KZH A;  3GV9 A;  4LV1 A;  4Y0O A;  3PBN A;  3VFF A;  4LCL A;  1ESI A;  1MWU A;  3NDG A;  3VP3 A;  5FQM A;  2HPB A;  3Q1F A;  1BTL A;  4WBG A;  5CER A;  1IYP A;  1TVF A;  3PBS A;  5FAP A;  4H8R A;  1PZP A;  1RGY A;  3UY6 A;  2HDQ A;  2PU4 A;  2WAD A;  2XF3 A;  3BFD A;  1MXO A;  4IED A;  3TG9 A;  3CJM A;  1E3U D;  1TDG A;  3M6B A;  3UPP A;  3UPO A;  1ERO A;  3QHY A;  3ITA A;  4WMC D;  4ZJ3 A;  3UNW A;  2ZC6 B;  3GR2 A;  3V3R A;  2FFF B;  3HLE A;  4UA7 A;  4X68 A;  2WZX A;  3SH7 A;  4KQR A;  4GDN A;  1E4D A;  4GDB A;  1K57 A;  1C3B A;  5FQQ A;  4QJG A;  5I94 A;  4M3K A;  3VP4 A;  3UDF A;  3N4I A;  1BLH A;  2Y2Q A;  1YLZ A;  2HP6 A;  3EQU A;  3PBT A;  3AGE A;  4OQI A;  4XXR A;  4PM7 A;  1BLC A;  2ZM2 A;  3A3I A;  2XD1 A;  1LI0 A;  3MXS A;  4P0M A;  1PI4 A;  2I72 A;  1U60 A;  3C5A A;  4IBX A;  5FAQ A;  1SDE A;  2PU2 A;  1MWT A;  4DDY A;  2Y2H A;  1SKF A;  4S2I A;  2XDM A;  3GRJ A;  3GQZ A;  1FR1 A;  1BUL A;  1BLP A;  1EWZ A;  2ZQ9 A;  2EXB A;  1FSW A;  4QD4 A;  2ZM0 A;  1O7E A;  3RXX A;  2A49 A;  2HDU A;  4FH2 A;  4JBF A;  4S2N A;  3VOZ A;  3RXW A;  2EX2 A;  3CMZ A;  1YMX A;  4WEJ A;  3PBQ A;  4X53 A;  2QMI A;  2Q9N A;  2WZZ A;  1M6K A;  4UAA A;  1PW1 A;  4PM5 A;  4GKU A;  4DDS A;  1BLS A;  5DF9 A;  2Y2I A;  3WS5 A;  5CEB A;  5EVI A;  3VOY A;  4CJN A;  3EQV A;  3MZF A;  4EBN A;  4C75 A;  2RL3 A;  1HVB A;  3BRM A;  3M6H A;  3N8S A;  1FSY A;  2H5S A;  1DJA A;  1KGE A;  3G2Y A;  2Y2K A;  3A3F A;  1KE0 A;  3CG5 A;  4WMC A;  4K0X A;  2WGW A;  1MKI A;  2J9O A;  3MXR A;  5FSR A;  1CK3 A;  4XUZ A;  5AQB A;  3GTC A;  3FV7 A;  3PTE A;  4E3N A;  3SOI A;  3BEC A;  2Q9M A;  4OQH A;  4OPY A;  4OQG A;  4OLD A;  4K91 A;  5AQA A;  4IVK A;  2G2W A;  3HLC A;  4HES A;  2ZQ7 A;  5D3O A;  1SHV A;  1ONH A;  3IF6 B;  4WZ5 A;  3UE3 A;  4N92 A;  1L0E A;  2QPN A;  1I2S A;  2Y59 A;  3UE1 A;  2WKE A;  3P09 A;  2OLV A;  3GSG A;  1SDN A;  5JYO A;  1PYY A;  4X56 A;  4U0X A;  2Z2L B;  3SS4 A;  3ZVT A;  1BSG A;  1BZA A;  1GHI A;  1GHM A;  1DJB A;  5GLC A;  4WEL A;  1O07 A;  4GB7 A;  4MBK A;  2ZLY A;  3B3X A;  2PBY A;  3BFG A;  2Y2N A;  2WKI A;  4D2O A;  4JXV A;  1M40 A;  1ESU A;  4P85 A;  4ZAM A;  4E3J A;  2Y2J A;  4N1H A;  4JXS A;  1K4F A;  2R9W A;  4Y7P A;  5A90 A;  2E8I A;  2EX9 A;  3DWZ A;  4PM6 A;  1PWC A;  2WGI A;  3BFF A;  3DW0 A;  4R0Q A;  5A91 A;  4PM9 A;  1YLJ A;  4Q8I A;  1MBL A;  1FCN A;  5CEC A;  4DE3 A;  5FDH A;  1K6R A;  2ZQA A;  3LEZ A;  3Q7Z A;  3IXH A;  1YLT A;  2XFS A;  5HFO A;  5F82 A;  3OCL A;  3PBO A;  5GHY A;  1KE4 A;  2FFY A;  3IF6 A;  3IH9 A;  3OPR A;  3IHA A;  3OPL A;  5CTM A;  4MEZ A;  5FA7 A;  3WS1 A;  4K0W A;  2A3U A;  3ZG0 A;  1K6S A;  3G30 A;  1ZC2 A;  4E3I A;  1OME A;  4JPM A;  4BD1 A;  1QME A;  1XP4 A;  2ZC3 B;  4KEN B;  3VP0 A;  1K56 D;  3Q07 A;  4EUZ A;  3MKE A;  4LV2 A;  5IHV A;  1H8Y A;  3NC8 A;  1VQQ A;  1PWG A;  4DRT A;  1K54 C;  2XEP A;  3BFE A;  5FQ9 A;  4FCF A;  3S1Y A;  2Y2O A;  1Q2P A;  3DTM A;  3HVF A;  3MZD A;  2V20 A;  3CZD A;  2IWC A;  2C5W B;  3O88 A;  1KVL A;  3OCN A;  1LLB A;  4JXW A;  5E2F A;  3HLB A;  2WGV A;  2QZ6 A;  3OZH A;  5CGW A;  1FOF A;  1GA0 A;  1SCW A;  4EV4 A;  4KG6 A;  4B4X A;  3NCK A;  3O86 A;  5CHU A;  3VMA A;  4LCM A;  2RCX A;  1KVM A;  1RGZ A;  1MWS A;  3PBR A;  1ZG6 A;  4JF5 A;  2J9P A;  5CXW A;  3OC2 A;  3N7W A;  3ZNT A;  5FI2 A;  2WKH A;  1NY0 A;  1S6R A;  3PAG A;  2Y2G A;  2V2F F;  1K4E A;  3ZFZ A;  3LY4 A;  1IYO A;  1FQG A;  1JVJ A;  1YQS A;  3V50 A;  3V5M A;  1KE3 A;  4OOM A;  5HX9 A;  4ZTK A;  1PI5 A;  1ALQ A;  3HUO A;  4DF6 A;  3E2K A;  4PM8 A;  3UDX A;  1NRF A;  4UHU A;  4E3K A;  4BL3 A;  5A93 A;  2XR0 A;  1XA7 A;  3P98 A;  2Y2M A;  3UO9 A;  1DY6 A;  1ERM A;  3A3D A;  3TSG A;  2WGW B;  4X6T A;  1NXY A;  3O87 A;  5HL1 A;  5FQK A;  2Y55 A;  2VGK A;  5GL9 A;  2BLS A;  5GLD A;  4GZB A;  5HAR A;  1ZG4 A;  2H0Y A;  5F1G A;  2EFX A;  3ZCZ A;  3BYD A;  3ZG7 B;  4LEN A;  3ZG5 A;  5TR7 A;  1LI9 A;  3JYI A;  4N1X A;  1L0D A;  2ZQD A;  4KQO A;  5EEC A;  4WYY A;  2IWB A;  5G18 A;  1NJ4 A;  2ZC4 B;  5EVI C;  1XGJ A;  2XD5 A;  4KZA A;  2ZC7 A;  4FD8 A;  1NYY A;  4S2M A;  1ES2 A;  1KDW A;  3LO7 A;  5E2E A;  5EVI B;  2ZQC A;  4OVD A;  5J8X A;  3SH8 A;  3AGF A;  5EVI D;  4P6B A;  4BL2 A;  4KZ5 A;  4OP5 A;  3W4Q A;  4KQQ A;  3WS0 A;  5KSH A;  4L0L A;  3C4O A;  3BLS A;  3BFC A;  1E3U A;  1YMS A;  3NIA A;  4JF4 A;  1W7F A;  4OOY A;  5EVL A;  3VSK A;  4Y0U A;  3WS2 A;  5GHZ A;  2J8Y A;  4KZ7 A;  4JKT A;  2ZC5 B;  4QU3 A;  3C7V A;  1MWR A;  2X01 A;  3VSL A;  4OOL A;  2P9V B;  4R4R A;  1Z6F A;  1H8Z A;  4OPR A;  1K55 A;  3HLG A;  3O3V A;  2XGN A;  4RX2 A;  4KZ6 A;  1GA9 A;  2XLN A;  2VGJ A;  1YT4 A;  5HAP A;  1ERQ A;  3NI9 A;  1W8Q A;  1AXB A;  3AGD A;  4GOG A;  1RCJ A;  5FQI A;  1HTZ A;  1YLY A;  3N8R A;  4OPZ A;  1K38 A;  5CGX A;  3ZG8 B;  4QHC A;  1ES3 A;  2Y91 A;  4R4S A;  4S2O A;  3IWI A;  2G2U A;  4OQ0 A;  3ZG9 B;  1IEM A;  1W8Y A;  1K55 C;  2X02 A;  1JTG A;  5FQJ A;  1E25 A;  2R9X A;  3WRZ A;  2OSU A;  4F94 A;  5A92 A;  3G35 A;  5DF7 A;  1G6A A;  3HLW A;  4KZB A;  4S2N C;  4QY6 A;  1Q2Q A;  2EX6 A;  3Q7V B;  2P9V A;  3FZC A;  3GMW A;  2B5R A;  1K56 A;  2GDN A;  4MLL A;  5DTK A;  5E2G A;  4E3M A;  1N9B A;  1XX2 A;  2HP9 A;  1JWV A;  3MBZ A;  5BOH A;  5F83 A;  5EUA A;  3DWK A;  1IYS A;  2XQZ A;  3WWX A;  2UWX A;  1NZU A;  3IT9 A;  2DNS A;  2EXA A;  5CHJ A;  4BJP A;  2ZM8 A;  5DTS A;  4Z9Q A;  4ZDX A;  3WS4 A;  1FR6 A;  1BUE A;  1ES4 A;  1K25 A;  3HLF A;  4UA9 A;  4WZ5 C;  1DJC A;  4DE1 A;  1IKI A;  3V3S A;  1PW8 A;  1Y54 A;  3A3E A;  4N9K A;  3MFD A;  4B4Z A;  3FKV A;  3HLD A;  3S4X A;  3UPN A;  2JC7 A;  4KZ9 A;  3Q7V A;  3C4P A;  3G2Z A;  5GLB A;  3V39 A;  4KZ3 A;  3W4O A;  3IQA A;  3ZHH A;  3M2K A;  5HAQ A;  4XUX A;  1TEM A;  3ITB A;  4ZBE A;  2ZQ8 A;  5M19 A;  1GHP A;  3UN7 A;  3E2L A;  4EQI A;  2EFU A;  3I7J A;  5EPH A;  3S22 A;  1WYB A;  1W79 A;  4HBT A;  4OLG A;  3BM6 A;  1NZO A;  2DCF A;  1PZO A;  2WYX A;  3N8L A;  5GHX A;  1L0F A;  4DE0 A;  3IF6 C;  3WRT A;  4S2P A;  2C6W B;  4ZJ2 A;  4E6X A;  2Z2M B;  4O7D A;  5F1F A;  2Y4A A;  3PAE A;  3M2J A;  4RX3 A;  3N6I A;  1ONG A;  1HZO A;  1ZKJ A;  1FCM A;  5CHM A;  1N4O A;  5FAS A;  1KGF A;  1RP5 A;  1TDL A;  4YFM A;  3ZVW A;  3NY4 A;  3ZNY A;  5CRF A;  3HBR A;  1KDS A;  3HRE A;  3VP1 A;  4KZ4 A;  4KZ8 A;  4Y0T A;  1H5X A;  4GNU A;  4S2L A;  5FI6 A;  1W5D A;  3HUM A;  5CED A;  4E3L A;  3QNB A;  5KMW A;  1LL9 A;  1J9M A;  2ZMA A;  4PMA A;  3UE0 A;  4DKI A;  3IXB A;  2Y2P A;  3IXD A;  3LY3 A;  4BEN A;  1BT5 A;  2JBF A;  2ZJ9 A;  4DE2 A;  1ES5 A;  4JXG A;  4GN2 A;  4C6Y A;  3FYZ A;  3VFH A;  5FAO A;  2WUQ A;  3TOI A;  1IYQ A;  2H10 A;  4NET A;  4MBF A;  4C3Q A;  3IH8 A;  3OPP A;  2WAF A;  1YLP A;  4OON A;  4U0T A;  4HBU A;  5E43 A;  4U3T A;  3SS5 A;  3IF5 A;  1JWZ A;  4EWF A;  4R1G A;  4RVA A;  4X55 A;  5EOO A;  2BG1 A;  5TGF A;  4NK3 A;  1CEF A;  4RYE A;  4OPQ A;  4OKP A;  3W4P A;  1IEL A;  4CPK A;  1K54 A;  1EI5 A;  3SH9 A;  5EE8 A;  3G31 A;  4JLF A;  5FAT A;  4YIN A;  4ID4 A;  4GD8 A;  4N9L A;  1LHY A;  3IHB A;  3MZE A;  4P87 A;  3RJU A;  4R3B A;  5KSC A;  1MY8 A;  3OPH A;  3NDE A;  5AQ7 A;  1XGI A;  3G34 A;  4X69 A;  1L2S A;  4FSF A;  5CTN A;  2V1Z A;  3LCE A;  2OV5 A;  5DTT A;  3NBL A;  3IWO A;  4GD6 A;  2J7V A;  4KG5 A;  1NYM A;  4LV0 A;  4BLM A;  1YLW A;  4KG2 A;  2OLU A;  1XXM A;  1YM1 A;  1WYC A;  4S2J A;  1K57 C;  2WK0 A;  4QY5 A;  3FKW A;  1KGG A;  4S2K A;  1HD8 A;  5AQ9 A;  1MPL A;  5DF8 A;  5EOE A;  2HP5 A;  4DXB A;  3VP2 A;  3UDI A;  1I2W A;  5DVA A;  3FWL A;  4BD0 A;  1CI9 A;  1S0W A;  4EBP A;  3BLM A;  2JE5 A;  4JF6 A;  4FH4 A;  3BEB A;  3SS3 A;  4A5R A;  4R23 A;  4ZJ1 A;  4B88 A;  1PWD A;  3A3J A;  2WAE A;  5TFQ A;  4BQM A;  4LV3 A;  1JTD A;  4QB8 A;  1IKG A;  4OP8 A;  1WE4 A;  5CGS A;  4E6W A;  1CEG A;  3Q82 A;  2P74 A;  2HDR A;  3ZGA B;  5M18 A;  3ZDJ A;  5FI7 A;  2Y2L A;  3D4F A;  5E2H A;  3HUN A;  3G32 A;  1XKZ A;  3C7U A;  1FCO A;  1JWP A;  1G68 A;  4WM9 A;  4E3O A;  3Q81 A;  5M1A A;  2XK1 A;  4MNR A;  4MBH A;  4IBR A;  2XFT A;  4UA6 A;  3G4P A;  1XA1 A;  4WZ4 A;  5GLA A;  3W8K A;  3HL9 A;  4RA7 A;  4PPR A;  4OH0 A;  4IVI A;  2HDS A;  2DRW A;  1LL5 A;  3IWQ A;  3QNC A;  5HAI A;  1GCE A;  2IWD A;  5L2F A;  1I5Q A;  1L0G A;  4R3J A;  2CC1 A;  1PIO A;  3ISG A;  2ZD8 A;  3MKF A;  2JCH A;  3GVB A;  5JYP A;  4WEK A;  4HEF A; 
#chains in the Genus database with same CATH topology
 4JGQ A;  3UT9 D;  1P3I B;  1EQZ D;  1TAF A;  3AYW C;  5CPJ A;  3H7W B;  5B1M A;  2W1R A;  2QHK A;  3AZM A;  2YFV B;  1QMF A;  3M7P A;  5KZH A;  1R4V A;  4IBB A;  3A6N A;  1S67 L;  2YKH A;  1IFQ A;  1P3F B;  3VP3 A;  2HPB A;  5AVF A;  5DNN D;  5CP6 D;  1IYP A;  3PBS A;  4Y13 A;  1PZP A;  3REI A;  1OJG A;  2VGL M;  3W97 D;  3WAA A;  3TG9 A;  1KX5 B;  2Z6C A;  1ERO A;  3TW8 A;  2JSS A;  5F68 A;  5FL3 A;  3GR2 A;  3HLE A;  1XFQ A;  4ZBJ B;  4UA7 A;  2WZX A;  1EQZ A;  3REJ B;  5CP6 C;  1KX3 D;  4GHI B;  1EQZ B;  3LIE A;  4O8G A;  5GT3 B;  4IBI A;  4GDB A;  1T19 A;  1YU3 A;  4J8V B;  3VP4 A;  5B1L A;  4LRX C;  3OLO A;  2Y2Q A;  1YPR A;  2HP6 A;  2OWJ A;  4O01 A;  4OQI A;  4XXR A;  3A3I A;  4M6B A;  4CSR A;  5FAQ A;  1SDE A;  4L9E A;  4KGC C;  2BYM A;  2XDM A;  3GQZ A;  4XZQ D;  1MZU A;  4GLQ A;  4LG2 A;  5K5B A;  2B18 A;  3AZL B;  4X1L A;  2PRF A;  3MVD B;  4EU0 A;  1YMX A;  4WEJ A;  1W1T A;  5B2I C;  4J8X B;  3AZK A;  2J8P A;  3KWQ D;  4DDS A;  2NUT C;  3TE8 A;  1AWI A;  3WS5 A;  5EVI A;  4WU8 C;  3MZF A;  4CLC A;  4C75 A;  4ETZ A;  2RL3 A;  3TU4 A;  2H28 A;  3M6H A;  2Y79 A;  1FSY A;  1NLY A;  3MGS D;  1KGE A;  4OJ5 A;  2Y2K A;  4H9N B;  1GPF A;  4R3A A;  4K0X A;  2WGW A;  3REI C;  1MKI A;  5B2J C;  4IBE A;  4XUZ A;  4EQ1 A;  5DJU A;  3FV7 A;  2VV7 A;  3R7W B;  5D3O A;  3X1V B;  2V5O A;  1KX5 A;  3S7P A;  5BS7 A;  3UE3 A;  1KX3 B;  1L0E A;  1I2S A;  2Y59 A;  3UE1 A;  2WKE A;  3P09 A;  2OLV A;  1T3U A;  3UB5 P;  3R45 B;  4X56 A;  4U0X A;  2Z2L B;  3X1S D;  1TS7 A;  2D49 A;  1XJ4 A;  2JKR I;  1DJB A;  4HP9 A;  4IBF A;  5AV8 C;  4KGC D;  1PDC A;  2Y2N A;  5AV5 B;  2ZY3 A;  1M40 A;  3AZL C;  4P85 A;  4JXS A;  1K4F A;  1M19 B;  3AZL D;  2EX9 A;  2ZL1 B;  1DP6 A;  1MKM A;  1VHM A;  4EO5 B;  5BT1 C;  1O6I A;  4ME4 A;  1YLJ A;  3S7O A;  2RVQ D;  1MBL A;  4LLO B;  4Z66 D;  1P3G C;  1P3M A;  4DE3 A;  3AZG B;  1E15 A;  1K6R A;  3REK B;  3L29 A;  3OCL A;  1KX4 B;  1F1E A;  3OPR A;  4H9P B;  3LJA C;  3IH9 A;  5FA7 A;  4MEZ A;  1XJ3 A;  1OME A;  4JPM A;  3REL C;  4BD1 A;  5AV5 D;  3C1B A;  5DNM B;  4EUZ A;  3Q07 A;  1JNU A;  3NC8 A;  1VQQ A;  3UB8 A;  3T4T A;  3BY8 A;  1Q2P A;  2W3D A;  5DFX A;  3O88 A;  1P3P D;  1UGU A;  5CGW A;  4DJ2 A;  1P3P B;  2PR5 A;  3MGR A;  3IS2 A;  3O86 A;  3WA9 A;  1RGZ A;  2J9P A;  1NY0 A;  1S6R A;  1YSP A;  1JVJ A;  3V50 A;  4GCZ A;  4OOM A;  4LFU A;  2CV5 B;  4PM8 A;  3UDX A;  4HGA B;  4Z2L A;  5A93 A;  3P98 A;  2Y2M A;  3UO9 A;  1DY6 A;  1E6P A;  5AVB D;  4ETX A;  2HUE B;  3A3D A;  3TSG A;  5AVB B;  3T1S A;  5L07 A;  2Y55 A;  2VGK A;  2O99 A;  2KX6 A;  4LEN A;  4HQA A;  4H9P A;  3JYI A;  4N1X A;  3AV1 B;  1WWS A;  1BH8 B;  1P3G D;  1L0D A;  3B6F B;  1NJ4 A;  4KZA A;  5GT3 A;  4S2M A;  1ES2 A;  1S32 A;  3LO7 A;  2LY8 A;  4OVD A;  3LEQ A;  4BL2 A;  5BNX A;  3UTA A;  4J8U A;  1B67 A;  3KXB D;  3C4O A;  2PAV P;  3B0D C;  3JVU A;  5AVC A;  2PYR A;  3AZJ B;  2J8Y A;  4JKT A;  2ZC5 B;  3WTP E;  3EOI A;  3C7V A;  5EM1 A;  3X1S C;  2P9V B;  3U4L P;  4WUJ A;  3HLG A;  4RX2 A;  2OAQ 1;  1YU4 A;  2XLN A;  3AZE C;  3NI9 A;  1W8Q A;  3MVD D;  3T4K A;  3P7N A;  1P3I A;  3AGD A;  1RCJ A;  5FQI A;  1HTZ A;  2J80 A;  1PFL A;  3N8R A;  3ZG8 B;  3CLO A;  4QHC A;  1ES3 A;  2Y91 A;  4S2O A;  3IWI A;  2G2U A;  2HF6 A;  3ZG9 B;  2K31 A;  2X02 A;  2W1T A;  1G6A A;  4QY6 A;  5EV0 A;  1Q2Q A;  2EX6 A;  1K56 A;  2GDN A;  1UWP X;  4YWZ A;  4E3M A;  1E88 A;  3AZH B;  1XX2 A;  4Q0J A;  1JWV A;  4UEY A;  5AVC B;  5BOH A;  4PHT A;  3A0V A;  4X68 A;  3MGQ C;  3ICY A;  1S1Z A;  1IYS A;  3QP4 A;  5DNM C;  3WWX A;  3IT9 A;  4BJP A;  2DNS A;  2EXA A;  1S32 B;  3WKJ D;  1D1J A;  4Z9Q A;  4ZDX A;  1P3G B;  5HDD A;  1K25 A;  1BUE A;  3D9Y A;  4UA9 A;  4WZ5 C;  1DJC A;  3V3S A;  4RQ9 A;  3W2Z A;  4WJ3 C;  1PW8 A;  5B0Y D;  3MGQ A;  3A3E A;  3L9K A;  3UPN A;  2JC7 A;  3FPV A;  4J8U B;  1F66 D;  4MN5 A;  1OJ5 A;  3Q7V A;  3C4P A;  3N3F A;  3X1S B;  3VH5 A;  3MJQ A;  3IQA A;  3M2K A;  1E6Z A;  3TJZ C;  3B6G A;  3K3D A;  1N9L A;  2ZQ8 A;  2ARO C;  2HZ5 A;  3QP2 A;  3AFA B;  3UN7 A;  4EQI A;  3I7J A;  1M1A C;  3RTY A;  1W79 A;  4HBT A;  4H9Q B;  2FJ7 D;  1GSW A;  4YNR A;  3AYW B;  1NZO A;  3JVV A;  1PZO A;  1KX3 C;  1P3I C;  3WA9 C;  4JGR A;  4Y17 A;  3UTA B;  3WRT A;  4XZQ B;  2Z2M B;  3C1B B;  3WA9 D;  1P34 B;  4RX3 A;  1HZO A;  1ZKJ A;  3X1U B;  1N4O A;  4WV4 B;  5FAS A;  3UME A;  3ZVW A;  4K08 A;  4OUI A;  4QLC D;  3ZNY A;  3HRE A;  2G5H C;  3VP1 A;  4KZ8 A;  3QP6 A;  4Y0T A;  4GNU A;  5KMW A;  5CED A;  1P3A D;  2GNX A;  1LL8 A;  3QNB A;  1GSX A;  1TF1 A;  2K7S A;  3CAX A;  3IXD A;  1F9I A;  4HY8 A;  2JKR M;  1P3K C;  1BT5 A;  1S32 C;  4C6Y A;  5LBR A;  3WX7 A;  1IYQ A;  5HSQ A;  3WKJ B;  5F99 B;  1D7E A;  4J8X C;  4OON A;  2V1B A;  4U0T A;  5B0Z A;  3AN2 A;  3LZ0 B;  4U3T A;  3MNN D;  3SS5 A;  2NZD B;  5JA4 A;  3MNN B;  3NEC A;  4R1G A;  5B2J A;  4NK3 A;  3X1T D;  4OPQ A;  4J8U D;  1K54 A;  1P3A B;  3SH9 A;  4LPZ A;  5EE8 A;  4HH2 A;  4JLF A;  3UT9 B;  4ID4 A;  4N9L A;  3R7W A;  1OTE A;  4NZ3 A;  4NG2 A;  2O0Y A;  1M18 B;  3NUL A;  3LI8 A;  4Y2F A;  3G34 A;  4MN7 A;  1L2S A;  2OV5 A;  5CTN A;  2V1Z A;  3G6O A;  4PAU A;  4KG2 A;  2OLU A;  4GS9 B;  2I9V A;  5AV6 C;  2V0W A;  1MPL A;  4YOF A;  1H0I A;  4DRB A;  3UDI A;  4ZBJ C;  4B9O A;  4JF6 A;  4ZJ1 A;  1EAK A;  4B88 A;  3W99 C;  3KX0 X;  4BQM A;  4LV3 A;  3LIF A;  3MVD A;  1CEG A;  3Q82 A;  2HDR A;  3LJA A;  5F99 C;  1W2E A;  2F2A C;  5B1L D;  4H9N A;  4IBC A;  1JWP A;  1G68 A;  2J3T C;  4WM9 A;  3AZF B;  5JRG B;  3A6N D;  1GOI A;  2XFT A;  3O62 A;  3G4P A;  3T1Q B;  3T4J A;  1AOI A;  5DJT A;  3FPW A;  5HAI A;  5L2F A;  3VH5 T;  4MCW A;  2PHY A;  3ISG A;  2ZD8 A;  3MKF A;  4NE5 A;  2JCH A;  3GVB A;  4Z2J A;  2X71 A;  3V9R B;  2PT7 A;  4DXC A;  4Z5T C;  1VM1 A;  2H0T A;  2V8C A;  1Z09 A;  1D06 A;  4EBL A;  5FUG A;  2EX8 A;  3A0S A;  5HW3 A;  3VFF A;  4LV1 A;  3PBN A;  3WTP D;  3S7N A;  2PYO C;  2XRN A;  4KUK A;  1STZ A;  3MNN A;  1BTL A;  3NJA A;  5CER A;  4ZUX D;  3F6T A;  4H8R A;  2HDQ A;  3T1X A;  4QLC A;  2XF3 A;  3H9W A;  4HNB A;  5C5K A;  3M6B A;  3CIT A;  5BO0 A;  1P3F D;  3QHY A;  3QP1 A;  3EPJ A;  4G92 B;  2ZC6 B;  2V8F A;  4KQR A;  4QJG A;  4OJL A;  5CX7 A;  3LJA B;  1BLH A;  3AZK C;  4H9Q A;  3VE3 A;  3V9R A;  3MXS A;  2BYK A;  1LI0 A;  3A0R A;  1P9W A;  5GT3 D;  1B6W A;  3MR0 A;  1YU0 A;  2Y2H A;  1YSQ A;  1P3F A;  3BJN A;  5BT1 D;  1EWZ A;  2A24 A;  3AL0 C;  2ZQ9 A;  4YM6 C;  2YKF A;  2ZM0 A;  2VZW A;  4DRA A;  2HDU A;  4H6J A;  3VOZ A;  3ULF A;  4J8X D;  3EWK A;  1ZLA A;  3PBQ A;  1P3O A;  4PM5 A;  5AV6 A;  5L10 A;  3X1V C;  4KHA A;  3W98 A;  5CEB A;  3VOY A;  2HGV A;  4ZRR A;  3BRM A;  3UE6 A;  3AV2 D;  1ZLA C;  3QP8 A;  5F99 D;  1P3A A;  5GXQ B;  2JKG A;  2QWS A;  5AY8 C;  5FSR A;  5B2J B;  1CK3 A;  5AV9 A;  5AQB A;  3GTC A;  2XA7 S;  4E3N A;  3SOI A;  3H82 A;  4K91 A;  3F1N B;  1H3O A;  3F1P B;  4HJ3 A;  2ZQ7 A;  4UUZ A;  1ONH A;  4R70 A;  4WZ5 A;  3B6F C;  1A0K A;  3DBA A;  1M18 D;  1SDN A;  1VEU B;  4KUD C;  2W3F A;  3W99 B;  3T1R A;  3MGS B;  3ZVT A;  3UTB D;  1BZA A;  5GXQ D;  5GLC A;  4UPK A;  3B42 A;  1O07 A;  4GB7 A;  1T1A A;  3T12 B;  2PBY A;  5BO0 B;  4JXV A;  5EM0 A;  1ESU A;  4YM6 A;  5F5Y A;  4E3J A;  1KX5 D;  1F66 A;  5A90 A;  3DW0 A;  4PM9 A;  5B32 A;  3QP5 A;  4WU9 A;  5CEC A;  1DP9 A;  3UB9 A;  5J3W A;  4EEU A;  5FDH A;  1YU1 A;  3LEZ A;  3REK C;  1YLT A;  5F82 A;  3PBO A;  5GHY A;  3P01 A;  3E98 A;  3IHA A;  4IBG A;  4Q0I A;  4NXG A;  2A3U A;  3G30 A;  1ZC2 A;  3C2W A;  1QME A;  2ZC3 B;  4KEN B;  1ID3 C;  3VP0 A;  2XSS A;  1H8Y A;  3RH8 B;  1PWG A;  3C30 A;  4DRT A;  2XEP A;  3MQQ A;  3LIB A;  5G4Y A;  4I3I A;  3KXB A;  3S1Y A;  3O5Y A;  5B33 B;  3DTM A;  3HVF A;  3UB6 A;  3S7Q A;  2WKR A;  1LLB A;  3OCN A;  4JXW A;  3HLB A;  3K2N A;  5E2F A;  4R38 A;  2PYO B;  1KX4 C;  4MN6 A;  1KS0 A;  3NCK A;  1ZLA D;  5AVB A;  4LCM A;  2W8S A;  5B32 B;  1ZG6 A;  3OC2 A;  3N7W A;  5DNM A;  5FI2 A;  5BNV A;  4AWL C;  5GT0 C;  3DTI A;  3AZH D;  3MFX A;  5HX9 A;  4ZTK A;  3E2K A;  3AZF C;  3UMD A;  3F1N A;  4E3K A;  1TS8 A;  1XA7 A;  4YS3 B;  5FQK A;  1OTA A;  1ZLA B;  4GZB A;  4BBV A;  5F1G A;  3VV4 A;  5TR7 A;  3VH6 A;  2ZQD A;  4KQO A;  4LD9 B;  4WYY A;  3REK A;  5EEC A;  1P3L A;  1T1C A;  2W3G A;  2IOU A;  5DFY A;  2PR6 A;  1OPX A;  4FD8 A;  3H0R C;  3HCY A;  4G91 B;  3AGF A;  4KQQ A;  5AV9 C;  3R45 A;  3BFC A;  5GXQ A;  4JF4 A;  3WS2 A;  1M19 A;  1PZR A;  5EVL A;  5GSU B;  4NE3 A;  3NQU A;  4KGC A;  1XJ6 A;  1MWR A;  3VSL A;  3MMH A;  4R4R A;  5B33 D;  3HON A;  4R8P B;  2XGN A;  3W98 B;  3AV1 D;  1H8P A;  5L09 A;  1P3L B;  2M1C A;  4J8W A;  4M4X A;  1P3B C;  5HAP A;  1ERQ A;  3B6F D;  2ZM5 A;  3AZK B;  1W1P A;  2VX8 A;  3LZ0 A;  2NQB C;  2PDR A;  3LID A;  5B24 A;  1J3W A;  3F1O A;  4GOG A;  3WKJ A;  1M1A A;  2F8N H;  4IUK A;  3REH A;  1IEM A;  4P6Z M;  3TU4 B;  4X23 A;  2G7U A;  4B93 A;  3WRZ A;  4F94 A;  3G35 A;  4S2N C;  4KZB A;  1N9N A;  2F8N B;  4LRY C;  3KSG A;  2P9V A;  1UR8 A;  2B5R A;  5DTK A;  3REL D;  1J7M A;  4J8W D;  2P7J A;  3C1C D;  3REH C;  3W98 D;  3KSF A;  1YAX A;  5EUA A;  1TS6 A;  4G3K A;  3DWK A;  4H6J B;  3V67 A;  2EWW A;  2UWX A;  1NZU A;  5AVE A;  5DTS A;  1QO6 A;  3W98 C;  3MGR D;  3WS4 A;  4DE1 A;  1IKI A;  1H8M A;  5FEG A;  3MFD A;  3HLD A;  4YM6 D;  4QLC C;  5IT5 A;  4KZ9 A;  2WKP A;  3B6G B;  2VJW A;  5IS1 A;  3W4O A;  2Y8H A;  2A2L A;  3ZHH A;  2JHE A;  3IX3 A;  1GHP A;  3UTA C;  4CQH A;  4G3V A;  1P3B D;  3S22 A;  1WYB A;  3FC7 A;  3F1O B;  4Z5T B;  3LEL A;  2WYX A;  2P08 A;  1H0M A;  3DTK A;  1NLZ A;  5HD5 A;  3BQ8 A;  3NQJ B;  4KUD B;  3WA9 B;  1P3M C;  1P3G A;  2C6W B;  2Y4A A;  4KUD D;  4ARZ B;  3N6I A;  4ZUX A;  4Y15 A;  5FUG B;  1KGF A;  1S4R A;  3C1C A;  3AZF A;  2VKS A;  4NKP A;  4S2L A;  1E6R A;  3WTP C;  5B40 A;  1W5D A;  3EPL A;  4J8W B;  2ZMA A;  1J9M A;  5AVC D;  4DKI A;  4WU8 D;  2Y2P A;  3LY3 A;  1W1V A;  1ES5 A;  2LB5 A;  5B1M D;  3FYZ A;  3VFH A;  4LD9 A;  3TOI A;  3MGQ D;  5B1M B;  1P3O D;  4NET A;  3X1V A;  3IH8 A;  4HJ6 A;  3OPP A;  2WAF A;  4ZUX B;  3MGR C;  5CP6 A;  3FKE A;  1EW0 A;  3IX4 A;  4DN0 A;  3IF5 A;  3NQJ A;  5EOO A;  3B0B A;  1CEF A;  1SKO A;  3W4P A;  2HIO B;  4CPK A;  3L27 A;  3LR3 A;  4Z2H A;  4R3B A;  3OPH A;  3SZT A;  1AOI D;  4X69 A;  3L2A A;  1LSX A;  4FSF A;  4KUD A;  4H9O B;  3B0C W;  1YLW A;  5CP6 B;  1XXM A;  1YM1 A;  4IBD A;  3B6F A;  2NQB B;  1KGG A;  4O0P A;  5F99 A;  5AQ9 A;  5EOE A;  3BWL A;  4GH9 A;  1M1A D;  3VP2 A;  1I2W A;  4OJP A;  4BD0 A;  3E4Q A;  1CI9 A;  4WZS B;  3BLM A;  5B0Y A;  1CJF A;  1TS0 A;  4JGO A;  3MGP D;  4A5R A;  1P3F C;  4R23 A;  4IJE A;  2PD8 A;  3A3J A;  5TFQ A;  5GSU D;  3LYX A;  4X1M A;  1IKG A;  3AYW D;  1WE4 A;  5CGS A;  4E6W A;  1BH9 B;  1OT9 A;  3VH5 W;  5EFW A;  1P34 A;  3REJ A;  3D4F A;  4GHI A;  1AIW A;  1U35 C;  2ZMF A;  1XKZ A;  3C7U A;  1FCO A;  4MB4 A;  2PYP A;  4CAY A;  1P3K A;  3T4Q A;  5E5A B;  4MBH A;  4IBR A;  3KFU G;  4WZ4 A;  3AZL A;  3HL9 A;  4HJ4 A;  4KQD A;  4IVI A;  2HDS A;  3EPH A;  4Z66 A;  4WU9 B;  1YUE A;  2IWD A;  1L0G A;  4R3J A;  1NRJ A;  1FIK A;  5B31 B;  4OP8 A;  1P3P C;  1XPB A;  2J3T D;  4E04 A;  3LR5 A;  1U35 B;  5B1L B;  3NHQ A;  1P9R A;  5U47 A;  2XH9 A;  5B2I A;  4LCL A;  3AZE D;  5JRG D;  3A6N B;  3AZI D;  1MWU A;  3NDG A;  3MXQ A;  3W99 A;  3Q1F A;  4WBG A;  4H9S C;  3REH B;  1TVF A;  2PBD P;  5TBM B;  3KUY A;  5FAP A;  3NQU B;  3B6G C;  1E8B A;  5GSU A;  1RGY A;  3UY6 A;  3MSH A;  1KU5 A;  2PU4 A;  3BFD A;  3CJM A;  4YM6 B;  1E3U D;  1TDG A;  3UPP A;  3E0Y A;  4ZJ3 A;  3F1P A;  3V3R A;  1HLU P;  2INW A;  3SH7 A;  3AZN A;  3E4P A;  2CWE A;  1E4D A;  4E44 A;  5FQQ A;  4XUJ B;  1C3B A;  5I94 A;  5J7E A;  2YFV A;  3N4I A;  3OOV A;  1YLZ A;  3EQU A;  3A1I A;  1BLC A;  4P0M A;  2NUP C;  3C5A A;  4XUJ C;  2EWV A;  4IBX A;  2PU2 A;  1EQZ C;  1MWT A;  5AV8 D;  1SKF A;  1ED7 A;  4S2I A;  2VK3 A;  5AV8 B;  3GRJ A;  1FR1 A;  3EG5 B;  1BLP A;  5E5A D;  2EXB A;  4QD4 A;  2A49 A;  4JBF A;  4JJN D;  1OTD A;  3CPT A;  3LEL D;  3K3C A;  3RXW A;  3B0C T;  2EX2 A;  3CMZ A;  1SZV A;  4X53 A;  3X1T C;  4UAA A;  3WKJ C;  1ULY A;  4GKU A;  5DNM D;  1BLS A;  4WN5 A;  3LZ0 C;  3AZM C;  3EQV A;  4EBN A;  4KHA B;  4WU9 C;  1HVB A;  3N8S A;  1JFI A;  1V9Z A;  5B31 C;  1DJA A;  3E4O A;  4CAY B;  1P3K B;  1LSW A;  3CG5 A;  4GHL A;  1P3K D;  4L9G A;  5GSU C;  1ID3 A;  3BEC A;  2Q9M A;  4OPY A;  4OQG A;  3MGP C;  4OLD A;  3REL A;  3HLC A;  4HES A;  1BH9 A;  1U35 A;  3IF6 B;  1G6O A;  5MC7 A;  5FDS A;  1VET B;  5KIZ A;  5CHL B;  2D02 A;  2V0U A;  3LJA D;  5CPK C;  3GSG A;  5BNV B;  4JJN C;  4FUW A;  3LIC A;  2O9C A;  3SS4 A;  1BYW A;  1V9Y A;  5B2I B;  1GHM A;  2RVQ C;  4MBK A;  4QPR A;  3BFG A;  1DRM A;  2WKI A;  4D2O A;  4EUV A;  4KUO A;  4ZAM A;  3IBR A;  5JRG A;  5B33 A;  5DKK A;  2R9W A;  2KDK A;  4Y7P A;  4PKY G;  3UTB B;  3IP4 C;  3W96 B;  5DNN A;  1W1Y A;  2WGI A;  4R0Q A;  5A91 A;  1N9O A;  5HDS A;  1P3P A;  3T4L A;  4X23 D;  2ZQA A;  1G28 A;  5HFO A;  1KE4 A;  2FFY A;  3IF6 A;  1KX4 A;  3OPL A;  4GHA A;  2W0N A;  3WS1 A;  4K0W A;  3ZG0 A;  1K6S A;  4NEE D;  4E3I A;  4IBJ A;  4EO5 C;  3KWQ B;  1K56 D;  3NOU C;  4IJF A;  4R8P D;  5B40 C;  1K54 C;  1H0G A;  4FCF A;  5B2J D;  3O62 C;  2V20 A;  3CZD A;  2IWC A;  2C5W B;  3KSY A;  3CPT B;  1KVL A;  4ZUX C;  4Q0H A;  2WGV A;  1IOU A;  3MGS C;  1FOF A;  2Z6D A;  1SCW A;  4KG6 A;  4B4X A;  3VMA A;  5CHU A;  4Z2I A;  4H9O A;  1MWS A;  3PBR A;  1ZHH B;  4HI4 A;  4JF5 A;  5CXW A;  3U2A A;  1VEU A;  1KOU A;  2WKH A;  3PAG A;  2Y2G A;  1K4E A;  4CLC D;  3LY4 A;  3V5M A;  1YQS A;  1K0K A;  2HJE A;  3C1C B;  1KE3 A;  3H0L C;  1PI5 A;  1CXW A;  3CHW P;  3HUO A;  2OAP 1;  3KO6 A;  4UHU A;  4BL3 A;  5AV5 C;  2A24 B;  2W3E A;  3AZI B;  2QJ5 A;  4XZQ C;  1NXY A;  3O87 A;  5GL9 A;  1S1Y A;  5HAR A;  1ZG4 A;  2H0Y A;  4HH3 A;  2EFX A;  3ZCZ A;  3BYD A;  5DKL A;  3ZG7 B;  2F8N G;  2IWB A;  5G18 A;  5FEF A;  5EVI C;  1XGJ A;  3CI6 A;  2ZC7 A;  4CLC B;  4QNL A;  5E2E A;  4WLA A;  5J8X A;  2HUE C;  5EVI D;  2DQN C;  2NZD A;  3MGP B;  3WS0 A;  1OGG A;  4L0L A;  2MJ6 A;  3KS8 A;  3BLS A;  1E3U A;  3UTB A;  1TZY C;  3AZJ A;  2YFW A;  4OOY A;  3VSK A;  5AY8 B;  1S4S A;  5IU1 A;  5TBM A;  4QU3 A;  3C1C C;  2X01 A;  3W97 C;  5HPF A;  4OOL A;  2K2N A;  2QYB A;  4Z66 B;  2OWH A;  2DMW A;  1H8Z A;  4OPR A;  1K55 A;  4L9F A;  4KZ6 A;  3X1U D;  2NZD D;  4Z5T A;  3LEL B;  3L28 A;  1Y4O A;  2PD7 A;  1NWZ A;  1AXB A;  4OPZ A;  5CGX A;  4DMZ A;  3UT9 C;  1K55 C;  1JTG A;  1E25 A;  5CPJ D;  3EGX C;  2R9X A;  2OSU A;  3WD4 A;  3HLW A;  4EET B;  2R78 A;  4MLL A;  5B31 D;  3O62 B;  5E2G A;  5B33 C;  2Q0O A;  3WAA B;  3O62 D;  3KSI A;  5AJG A;  2YFW B;  1A7W A;  3HJI A;  3LI9 A;  5F83 A;  3LR4 A;  4MMN A;  4EEP A;  3LZ0 D;  5B1M C;  3KWQ C;  3TU4 C;  3REL B;  3MGR B;  4F3L B;  1X0O A;  3IX8 A;  4Z2G A;  1FR6 A;  1ES4 A;  3H0M C;  3HLF A;  4MB5 A;  3LEL C;  1Y54 A;  4CSR B;  4TX8 A;  3NOT C;  4N9K A;  4B4Z A;  2ZY5 A;  3S4X A;  1LT0 A;  4NXB A;  2M7V A;  1TZY B;  3MGP A;  5HWT A;  4OJO A;  3G2Z A;  2F8N A;  3V39 A;  4NXE A;  3EEH A;  5CPI B;  4XUX A;  1TEM A;  1Y28 A;  3UT9 A;  2BAS A;  3E2L A;  3JPU A;  4IJG A;  5EPH A;  3X1U C;  4NY2 A;  5B0Z C;  2DF4 C;  3AN2 C;  1CF0 A;  3PHY A;  4H9R A;  4DE0 A;  3FDD A;  4Z2M G;  4O7D A;  4WNN A;  5CPK B;  3PAE A;  4LD9 C;  1ONG A;  5B0Z B;  3AN2 B;  4X23 B;  5B0Z D;  3AN2 D;  4BMW A;  3OBF A;  1RP5 A;  1TDL A;  3B6G D;  5CRF A;  3HBR A;  3KXB C;  5DNN C;  1H5X A;  5I5L A;  5JRG C;  5KDM B;  2EA9 A;  3AV2 C;  3C38 A;  1LL9 A;  5GT0 B;  4XUJ A;  1ZTU A;  4BEN A;  4XT2 A;  4DE2 A;  5C3I C;  1VB6 A;  4GN2 A;  1ID3 D;  2WUQ A;  5FAO A;  3AV1 A;  2VGL S;  1OTI A;  4C3Q A;  2M7U A;  3X1T B;  3WD2 A;  2HV1 A;  2GZA A;  4I39 A;  1LSV A;  3KYQ A;  5TJJ A;  2F8N D;  5BNX B;  1JWZ A;  5JA4 B;  4X55 A;  5TGF A;  4EER A;  4RYE A;  4MB3 A;  5AVC C;  3WD3 A;  2VV8 A;  1EI5 A;  4AFI A;  2HIO C;  4GW9 A;  5FAT A;  4YIN A;  4HMD A;  2V1A A;  1LHY A;  4JGP A;  4P87 A;  4I5S A;  3B47 A;  5AQ7 A;  5B31 A;  3VE4 A;  1G5U A;  1P3B B;  5DTT A;  2B02 A;  3NBL A;  2ZY4 A;  2J7V A;  4BLM A;  1WYC A;  2VLG A;  3FG8 A;  4I3J A;  2WK0 A;  4QY5 A;  3AFA D;  3FKW A;  1BH8 A;  5C3I B;  1HD8 A;  1M18 C;  2HP5 A;  3GDI A;  1ODV A;  3LR0 A;  4R8P C;  5B40 D;  1CK7 A;  4MDZ A;  5DVA A;  3FWL A;  3LUQ A;  2BYM B;  4FH4 A;  3BEB A;  3MQO A;  4D60 A;  3W96 A;  1GSV A;  4II7 A;  2FH5 A;  2WAE A;  3B0D B;  2PYO A;  1F66 B;  2D01 A;  1JTD A;  4X23 C;  1VET A;  4Z1W A;  4Z5T D;  3AFA A;  3ZGA B;  2P74 A;  5M18 A;  2NQB A;  5HZH A;  1HQ3 C;  4J8V A;  4FOF A;  2GX5 A;  4G3W A;  2XA7 M;  1S66 L;  5E2H A;  3G32 A;  1P3B A;  4UQI S;  1M1A B;  3DAV A;  4EES A;  4NXF A;  4E3O A;  5M1A A;  1L6J A;  2XK1 A;  4MNR A;  4UA6 A;  4GJ4 A;  3LIA A;  4I3A A;  1XA1 A;  5GLA A;  3W8K A;  4RA7 A;  2JKT I;  4UQI M;  1P97 A;  2VA0 A;  5G49 A;  3H82 B;  3IWQ A;  2JN7 A;  1BFM A;  3KUY D;  3C1B C;  4DJ3 A;  5JYP A;  1PNE A;  4WEK A;  3WAA D;  1CI8 A;  1KX3 A;  3IXG A;  5B32 C;  3LFV A;  5A8B A;  3BW6 A;  3GV9 A;  4Y0O A;  1SKO B;  3ZYT A;  1HQ3 B;  1ESI A;  3NOP C;  4OJ6 A;  5FQM A;  3W96 D;  3HJK A;  5B40 B;  2ZL1 A;  1H3Q A;  4WU9 D;  2WAD A;  1MXO A;  4IED A;  3KUY B;  2WKQ A;  4UUZ B;  5HPI A;  3UPO A;  3ITA A;  4WMC D;  3UNW A;  2FJ7 A;  4YS3 A;  4XT2 B;  2FFF B;  5AV9 D;  1W63 Q;  4GDN A;  1K57 A;  5B2I D;  4J8V C;  4LRZ E;  4M3K A;  1L3L A;  5B24 C;  3UDF A;  5AV6 B;  5J4E A;  3AZG D;  4BBT A;  4J8X A;  3PBT A;  3AGE A;  2CMN A;  4PM7 A;  2ZM2 A;  2XD1 A;  1KX5 C;  1PI4 A;  5BS7 C;  1U60 A;  2I72 A;  2RTS A;  3EGD C;  4Z66 C;  4DDY A;  3WAA C;  3W97 A;  1BUL A;  3UTB C;  1FSW A;  2QKP A;  1AOI C;  1O7E A;  3RXX A;  2JKT M;  1TZY A;  3AZJ C;  3MNN C;  4FH2 A;  2UV0 E;  4S2N A;  4BWI A;  3WD0 A;  2QMI A;  2Q9N A;  2WZZ A;  1F2K A;  4G91 C;  1M6K A;  3IBJ A;  1PW1 A;  3A6N C;  1XFN A;  3AZE A;  5DF9 A;  2Y2I A;  5GT0 D;  3IS2 B;  4CJN A;  3L25 A;  2CV5 A;  4IBK A;  3DTE A;  1P3O C;  3PYP A;  5E5A A;  2H5S A;  3G2Y A;  3A3F A;  1KE0 A;  4WMC A;  3AZI C;  2J9O A;  3MXR A;  4HHD A;  3PTE A;  4LD9 D;  4OQH A;  2IA2 A;  5AQA A;  4NYY A;  4IVK A;  2G2W A;  1SHV A;  2P04 A;  3MS6 A;  4N92 A;  2QPN A;  4QWO A;  3AV1 C;  2ARO D;  1P3M B;  1PYY A;  2RIQ A;  5JYO A;  3MGS A;  2ARO B;  1P3M D;  2FZ0 A;  3REJ D;  4HIA A;  5CPI C;  1BSG A;  1GHI A;  3RFB A;  1N1J B;  4WEL A;  2ZLY A;  3B3X A;  3MF0 A;  4Y5F A;  4KGC B;  1UWN X;  2Y2J A;  4N1H A;  3WTP A;  3AZK D;  1H3O B;  2E8I A;  2ZOH A;  3DWZ A;  2O9A A;  4PM6 A;  5F6A A;  1PWC A;  2KOI A;  3BFF A;  1Q9C A;  4J8U C;  4Q8I A;  4NE6 A;  1FCN A;  3CWF A;  4WF0 A;  1DP8 A;  3TU4 D;  1M18 A;  1OGB A;  3REJ C;  3Q7Z A;  1T18 A;  3IXH A;  2XFS A;  1P0Z A;  2FN2 A;  1TAF B;  5CTM A;  2KLI A;  5HDC A;  2LB9 A;  2VV6 A;  4GS9 A;  1XP4 A;  4ARZ A;  3LZ1 D;  3W96 C;  4G92 C;  4I38 A;  2ACG A;  3MKE A;  4LV2 A;  5IHV A;  4HMC A;  2PYO D;  3AZI A;  1M19 C;  3BFE A;  5FQ9 A;  5G49 B;  2L0W A;  3AZH C;  2Y2O A;  5B32 D;  5HD3 A;  3MZD A;  3SW1 A;  4JJN A;  1WWI A;  2QZ6 A;  3OZH A;  5CPI A;  1GA0 A;  4EV4 A;  2RCX A;  1KVM A;  2ZY2 A;  1OTB A;  3ZNT A;  3KWQ A;  3EPK A;  3KYZ A;  3VH6 W;  2V9A A;  2BYK B;  3X1V D;  2V2F F;  3B33 A;  3ZFZ A;  1IYO A;  5B31 G;  1FQG A;  1P3I D;  4HME A;  1GXD A;  2J3W A;  1ALQ A;  4DF6 A;  3KXB B;  1NRF A;  2CV5 D;  3LZ1 C;  2XR0 A;  3AV2 B;  3AZJ D;  4NZ1 A;  2HJ9 C;  1ERM A;  2WGW B;  5DNN B;  4X6T A;  5HL1 A;  3R4K A;  2L5A A;  5GLD A;  2BLS A;  3ZG5 A;  1LI9 A;  1P34 C;  3C8C A;  3MQ0 A;  2ZC4 B;  3X1U A;  4IUH A;  3W99 D;  3AZN C;  2XD5 A;  1N1J A;  1TD5 A;  1NYY A;  5HWW A;  1KDW A;  5EVI B;  5B24 D;  2ZQC A;  3SH8 A;  5AVB C;  3PR6 A;  4J8V D;  4P6B A;  2ARO A;  4KZ5 A;  4OP5 A;  3W4Q A;  5KSH A;  1P34 D;  1YMS A;  3LGO A;  3PXP A;  3NIA A;  1W7F A;  4Y0U A;  3REI B;  2F8N K;  1UR9 A;  5GHZ A;  4KZ7 A;  4EW7 A;  2JKF A;  3CUE A;  4Z2M H;  3KSH A;  1Z6F A;  2O9B A;  3O3V A;  2FJ7 B;  4HP4 A;  1GA9 A;  4WU8 B;  2VGJ A;  1YT4 A;  3AZM B;  2W3H A;  3H7W A;  3UTA D;  3AYW A;  5CPJ C;  5B24 B;  3MGQ B;  4AWL B;  1YLY A;  1HTA A;  1K38 A;  4R4S A;  2HIO D;  4OQ0 A;  1W8Y A;  5FQJ A;  2W27 A;  3MVD C;  3D3O A;  3KS4 A;  5A92 A;  5BPV A;  1F98 A;  5AY8 D;  2ZMV A;  5DF7 A;  3X1S A;  1KX4 D;  3KUY C;  3Q7V B;  1AOI B;  2OOL A;  3FZC A;  3LZ1 A;  3GMW A;  1PRQ A;  1N9B A;  2HP9 A;  1E6N A;  3MBZ A;  4H9S A;  4PKY A;  3T4O A;  1FIL A;  2XQZ A;  5B1L C;  5CHJ A;  2GJ3 A;  2ZM8 A;  1P3L C;  4WNN B;  2W1T B;  2XRO A;  4P6Z S;  4R6L A;  4J8W C;  2QJ7 A;  5CPJ B;  4H9R B;  3ZQ5 A;  3CUE C;  3EEA A;  3FKV A;  3AZH A;  4X25 A;  5GLB A;  4KZ3 A;  4R8P A;  2L1M A;  5F69 A;  5HAQ A;  5AV8 A;  1YKD A;  3ITB A;  4ZBE A;  5M19 A;  2B95 A;  2NQB D;  2EFU A;  3HSH A;  2AVX A;  4OLG A;  4YS3 D;  3BM6 A;  2DCF A;  3KYE A;  3N8L A;  5GHX A;  2E8J A;  5CPI D;  1L0F A;  2VEA A;  3AFA C;  3IF6 C;  4WU8 A;  4CLC C;  4S2P A;  4ZJ2 A;  4WL9 A;  4E6X A;  5F1F A;  4F3L A;  1HQ3 A;  3M2J A;  5L8M A;  1W63 M;  4E45 A;  4YS3 C;  1FCM A;  5CHM A;  1F66 C;  4LGW A;  4YFM A;  2L4R A;  3NY4 A;  1KDS A;  4QLC B;  3D72 A;  5B0Y C;  4KZ4 A;  4ESP A;  4IHQ A;  5FI6 A;  3HUM A;  4E3L A;  3LZ1 B;  2VQR A;  3BY9 A;  2G5I C;  4PMA A;  4Y3I A;  3UE0 A;  2IO5 C;  3IXB A;  1ACF A;  4HOI A;  4NZ4 A;  1MC0 A;  3A1K A;  2JBF A;  2ZJ9 A;  4JXG A;  3BQA A;  3P5J B;  1OT6 A;  2H10 A;  4MBF A;  3VH6 T;  2ZBB A;  1YLP A;  4HBU A;  1P3L D;  5E43 A;  4XZQ A;  3AZF D;  4EWF A;  1S32 D;  4RVA A;  2BG1 A;  3AV2 A;  4OKP A;  1IEL A;  4BBU A;  3REH D;  3T4S A;  1P3A C;  3G31 A;  4XUJ D;  4NFT A;  1CQA A;  4GD8 A;  5AY8 A;  3IHB A;  5KSC A;  3MZE A;  3RJU A;  1MY8 A;  3NDE A;  3AZG A;  2NZD C;  1XGI A;  1ID3 B;  3LCE A;  5GT0 A;  3AZE B;  1HQ3 D;  5G4Z A;  3IWO A;  4GD6 A;  4KG5 A;  4LV0 A;  1NYM A;  5GT3 C;  4S2J A;  1K57 C;  3X1T A;  1WA9 A;  4S2K A;  3GEC A;  5CPK D;  4EXO A;  3AZG C;  1JFI B;  4NYU A;  5DF8 A;  2FJ7 C;  4NZ5 A;  1M19 D;  1TZY D;  4DXB A;  2HIO A;  2BTF P;  4DQY B;  1F5M A;  3TRC A;  1S0W A;  3W97 B;  4EBP A;  5AV9 B;  2JE5 A;  5B0Y B;  1Z2C B;  3SS3 A;  5AV6 D;  1PWD A;  3UB7 A;  3REK D;  4JJN B;  3REI D;  4QB8 A;  3T50 A;  1YU2 A;  1T1B A;  3ZDJ A;  5FI7 A;  2Y2L A;  3AZN B;  5CPK A;  4CLC E;  3HUN A;  3AZN D;  2ZOI A;  3L7H A;  3WD1 A;  3AZM D;  2IO5 B;  3MQL A;  3Q81 A;  4HGA C;  3WTP B;  4FTX A;  5GXQ C;  5AV5 A;  3C1B D;  1XJ2 A;  4PPR A;  4OH0 A;  5HL6 A;  5B32 G;  5HWV A;  3L26 A;  2DRW A;  1LL5 A;  3QNC A;  5EVE A;  2CV5 C;  1U35 D;  1GCE A;  1I5Q A;  3VOL A;  2CC1 A;  1PIO A;  4Z2K A;  5E5A C;  5KDM A;  1P3O B;  4HEF A; 
#chains in the Genus database with same CATH homology
 3UT9 D;  1P3I B;  1EQZ D;  1TAF A;  3AYW C;  5CPJ A;  5B1M A;  3AZM A;  2YFV B;  1QMF A;  5KZH A;  1R4V A;  4IBB A;  3A6N A;  1P3F B;  3VP3 A;  2HPB A;  5DNN D;  5CP6 D;  1IYP A;  3PBS A;  1PZP A;  3REI A;  3W97 D;  3WAA A;  3TG9 A;  1KX5 B;  1ERO A;  2JSS A;  3GR2 A;  3HLE A;  4UA7 A;  4ZBJ B;  4X68 A;  2WZX A;  1EQZ A;  3REJ B;  5CP6 C;  1KX3 D;  1EQZ B;  5GT3 B;  4IBI A;  4GDB A;  1YU3 A;  4J8V B;  3VP4 A;  5B1L A;  2Y2Q A;  2HP6 A;  4OQI A;  4XXR A;  3A3I A;  4M6B A;  4CSR A;  5FAQ A;  1SDE A;  4KGC C;  2BYM A;  2XDM A;  3GQZ A;  4XZQ D;  4LG2 A;  3AZL B;  3MVD B;  1YMX A;  4WEJ A;  5B2I C;  4J8X B;  3AZK A;  2J8P A;  3KWQ D;  4DDS A;  3WS5 A;  5EVI A;  4WU8 C;  3MZF A;  4C75 A;  2RL3 A;  3TU4 A;  3M6H A;  1FSY A;  3MGS D;  1KGE A;  4OJ5 A;  2Y2K A;  4H9N B;  4K0X A;  2WGW A;  3REI C;  1MKI A;  5B2J C;  4IBE A;  4XUZ A;  3FV7 A;  5D3O A;  3X1V B;  1KX5 A;  5BS7 A;  3UE3 A;  1KX3 B;  1L0E A;  1I2S A;  2Y59 A;  3UE1 A;  2WKE A;  3P09 A;  2OLV A;  1T3U A;  3R45 B;  4X56 A;  4U0X A;  2Z2L B;  3X1S D;  1DJB A;  4IBF A;  5AV8 C;  4KGC D;  2Y2N A;  5AV5 B;  2ZY3 A;  1M40 A;  3AZL C;  4P85 A;  4JXS A;  1K4F A;  1M19 B;  3AZL D;  2EX9 A;  4EO5 B;  5BT1 C;  1YLJ A;  2RVQ D;  1MBL A;  4Z66 D;  1P3G C;  1P3M A;  4DE3 A;  3AZG B;  1K6R A;  3REK B;  3L29 A;  3OCL A;  1KX4 B;  1F1E A;  3OPR A;  4H9P B;  3LJA C;  3IH9 A;  5FA7 A;  4MEZ A;  1OME A;  4JPM A;  3REL C;  4BD1 A;  5AV5 D;  3C1B A;  5DNM B;  4EUZ A;  3Q07 A;  3NC8 A;  1VQQ A;  1Q2P A;  3O88 A;  1P3P D;  5CGW A;  1P3P B;  3MGR A;  3O86 A;  3WA9 A;  1RGZ A;  2J9P A;  1NY0 A;  1S6R A;  1JVJ A;  3V50 A;  4OOM A;  2CV5 B;  4PM8 A;  3UDX A;  4HGA B;  5A93 A;  3P98 A;  2Y2M A;  3UO9 A;  1DY6 A;  5AVB D;  2HUE B;  3A3D A;  3TSG A;  5AVB B;  2Y55 A;  2VGK A;  4LEN A;  4H9P A;  3JYI A;  4N1X A;  3AV1 B;  1WWS A;  1BH8 B;  1P3G D;  1L0D A;  3B6F B;  1NJ4 A;  4KZA A;  5GT3 A;  4S2M A;  1ES2 A;  1S32 A;  3LO7 A;  2LY8 A;  4OVD A;  4BL2 A;  5BNX A;  3UTA A;  4J8U A;  1B67 A;  3KXB D;  3C4O A;  3B0D C;  5AVC A;  3AZJ B;  2J8Y A;  4JKT A;  2ZC5 B;  3WTP E;  3C7V A;  3X1S C;  2P9V B;  3HLG A;  4RX2 A;  1YU4 A;  2XLN A;  3AZE C;  3NI9 A;  1W8Q A;  3MVD D;  1P3I A;  3AGD A;  1RCJ A;  5FQI A;  1HTZ A;  3N8R A;  3ZG8 B;  4QHC A;  1ES3 A;  2Y91 A;  4S2O A;  3IWI A;  2G2U A;  3ZG9 B;  2X02 A;  1G6A A;  4QY6 A;  1Q2Q A;  2EX6 A;  1K56 A;  2GDN A;  4E3M A;  3AZH B;  1XX2 A;  1JWV A;  5AVC B;  5BOH A;  3MGQ C;  1IYS A;  5DNM C;  3WWX A;  3IT9 A;  4BJP A;  2DNS A;  2EXA A;  1S32 B;  3WKJ D;  4Z9Q A;  4ZDX A;  1P3G B;  1K25 A;  1BUE A;  4UA9 A;  4WZ5 C;  1DJC A;  3V3S A;  4WJ3 C;  1PW8 A;  5B0Y D;  3MGQ A;  3A3E A;  3UPN A;  2JC7 A;  4J8U B;  1F66 D;  3Q7V A;  3C4P A;  3N3F A;  3X1S B;  3VH5 A;  3IQA A;  3M2K A;  3B6G A;  2ZQ8 A;  2ARO C;  3AFA B;  3UN7 A;  4EQI A;  3I7J A;  1M1A C;  1W79 A;  4HBT A;  4H9Q B;  2FJ7 D;  3AYW B;  1NZO A;  1PZO A;  1KX3 C;  1P3I C;  3WA9 C;  3UTA B;  3WRT A;  4XZQ B;  2Z2M B;  3C1B B;  3WA9 D;  1P34 B;  4RX3 A;  1HZO A;  1ZKJ A;  3X1U B;  1N4O A;  4WV4 B;  5FAS A;  3ZVW A;  4OUI A;  4QLC D;  3ZNY A;  3HRE A;  2G5H C;  3VP1 A;  4KZ8 A;  4Y0T A;  4GNU A;  5KMW A;  5CED A;  1P3A D;  3QNB A;  3IXD A;  1P3K C;  1BT5 A;  1S32 C;  4C6Y A;  3WX7 A;  1IYQ A;  3WKJ B;  5F99 B;  4J8X C;  4OON A;  4U0T A;  5B0Z A;  3AN2 A;  3LZ0 B;  4U3T A;  3MNN D;  3SS5 A;  2NZD B;  5JA4 A;  3MNN B;  4R1G A;  5B2J A;  4NK3 A;  3X1T D;  4OPQ A;  4J8U D;  1K54 A;  1P3A B;  3SH9 A;  5EE8 A;  4JLF A;  3UT9 B;  4ID4 A;  4N9L A;  4NZ3 A;  1M18 B;  3G34 A;  1L2S A;  2OV5 A;  5CTN A;  2V1Z A;  4KG2 A;  2OLU A;  5AV6 C;  1MPL A;  4DRB A;  3UDI A;  4ZBJ C;  4JF6 A;  4ZJ1 A;  4B88 A;  3W99 C;  4BQM A;  4LV3 A;  3MVD A;  1CEG A;  3Q82 A;  2HDR A;  3LJA A;  5F99 C;  1W2E A;  2F2A C;  5B1L D;  4H9N A;  4IBC A;  1JWP A;  1G68 A;  4WM9 A;  3AZF B;  5JRG B;  3A6N D;  2XFT A;  3O62 A;  3G4P A;  1AOI A;  5HAI A;  5L2F A;  3VH5 T;  3ISG A;  2ZD8 A;  3MKF A;  4NE5 A;  2JCH A;  3GVB A;  2X71 A;  3V9R B;  4DXC A;  4Z5T C;  1VM1 A;  2H0T A;  4EBL A;  5FUG A;  2EX8 A;  5HW3 A;  3VFF A;  4LV1 A;  3PBN A;  3WTP D;  2PYO C;  3MNN A;  1BTL A;  5CER A;  4ZUX D;  3F6T A;  4H8R A;  2HDQ A;  4QLC A;  2XF3 A;  3M6B A;  5BO0 A;  1P3F D;  3QHY A;  3EPJ A;  4G92 B;  2ZC6 B;  4KQR A;  4QJG A;  4OJL A;  3LJA B;  1BLH A;  3AZK C;  4H9Q A;  3V9R A;  3MXS A;  2BYK A;  1LI0 A;  5GT3 D;  1B6W A;  1YU0 A;  2Y2H A;  1P3F A;  5BT1 D;  1EWZ A;  3AL0 C;  2ZQ9 A;  4YM6 C;  2ZM0 A;  4DRA A;  2HDU A;  3VOZ A;  4J8X D;  3PBQ A;  1ZLA A;  1P3O A;  4PM5 A;  5AV6 A;  3X1V C;  4KHA A;  3W98 A;  5CEB A;  3VOY A;  3BRM A;  3AV2 D;  1ZLA C;  5F99 D;  1P3A A;  5GXQ B;  5AY8 C;  5FSR A;  5B2J B;  1CK3 A;  5AV9 A;  5AQB A;  3GTC A;  4E3N A;  3SOI A;  4K91 A;  1H3O A;  2ZQ7 A;  4UUZ A;  1ONH A;  4WZ5 A;  3B6F C;  1M18 D;  1SDN A;  4KUD C;  3W99 B;  3MGS B;  3ZVT A;  3UTB D;  1BZA A;  5GXQ D;  5GLC A;  4UPK A;  1O07 A;  4GB7 A;  2PBY A;  5BO0 B;  4JXV A;  1ESU A;  4YM6 A;  4E3J A;  1KX5 D;  1F66 A;  5A90 A;  3DW0 A;  4PM9 A;  5B32 A;  4WU9 A;  5CEC A;  5FDH A;  1YU1 A;  3LEZ A;  3REK C;  1YLT A;  5F82 A;  3PBO A;  5GHY A;  3IHA A;  4IBG A;  2A3U A;  3G30 A;  1ZC2 A;  1QME A;  2ZC3 B;  4KEN B;  1ID3 C;  3VP0 A;  1H8Y A;  1PWG A;  4DRT A;  2XEP A;  3KXB A;  3S1Y A;  5B33 B;  3DTM A;  3HVF A;  3OCN A;  1LLB A;  4JXW A;  5E2F A;  3HLB A;  2PYO B;  1KX4 C;  3NCK A;  1ZLA D;  5AVB A;  4LCM A;  2W8S A;  5B32 B;  1ZG6 A;  3OC2 A;  3N7W A;  5DNM A;  5FI2 A;  5BNV A;  4AWL C;  5GT0 C;  3AZH D;  5HX9 A;  4ZTK A;  3E2K A;  3AZF C;  4E3K A;  1XA7 A;  4YS3 B;  5FQK A;  1ZLA B;  4GZB A;  5F1G A;  5TR7 A;  3VH6 A;  2ZQD A;  4KQO A;  4LD9 B;  4WYY A;  3REK A;  5EEC A;  1P3L A;  2IOU A;  4FD8 A;  3H0R C;  4G91 B;  3AGF A;  4KQQ A;  5AV9 C;  3R45 A;  3BFC A;  5GXQ A;  4JF4 A;  3WS2 A;  1M19 A;  1PZR A;  5EVL A;  5GSU B;  4NE3 A;  3NQU A;  4KGC A;  1MWR A;  3VSL A;  4R4R A;  5B33 D;  3HON A;  4R8P B;  2XGN A;  3W98 B;  3AV1 D;  1P3L B;  4J8W A;  1P3B C;  5HAP A;  1ERQ A;  3B6F D;  2ZM5 A;  3AZK B;  3LZ0 A;  2NQB C;  5B24 A;  4GOG A;  3WKJ A;  1M1A A;  2F8N H;  3REH A;  1IEM A;  3TU4 B;  4X23 A;  3WRZ A;  4F94 A;  3G35 A;  4S2N C;  4KZB A;  2F8N B;  2P9V A;  2B5R A;  5DTK A;  3REL D;  4J8W D;  3C1C D;  3REH C;  3W98 D;  5EUA A;  3DWK A;  2UWX A;  1NZU A;  5DTS A;  3W98 C;  3MGR D;  3WS4 A;  4DE1 A;  1IKI A;  3MFD A;  3HLD A;  4YM6 D;  4QLC C;  4KZ9 A;  3B6G B;  3W4O A;  3ZHH A;  1GHP A;  3UTA C;  1P3B D;  3S22 A;  1WYB A;  4Z5T B;  3LEL A;  2WYX A;  3NQJ B;  4KUD B;  3WA9 B;  1P3M C;  1P3G A;  2C6W B;  2Y4A A;  4KUD D;  3N6I A;  4ZUX A;  5FUG B;  1KGF A;  3C1C A;  3AZF A;  4S2L A;  3WTP C;  5B40 A;  1W5D A;  3EPL A;  4J8W B;  2ZMA A;  1J9M A;  5AVC D;  4DKI A;  4WU8 D;  2Y2P A;  3LY3 A;  1ES5 A;  5B1M D;  3FYZ A;  3VFH A;  4LD9 A;  3TOI A;  3MGQ D;  5B1M B;  1P3O D;  4NET A;  3X1V A;  3IH8 A;  3OPP A;  2WAF A;  4ZUX B;  3MGR C;  5CP6 A;  3FKE A;  3IF5 A;  3NQJ A;  5EOO A;  3B0B A;  1CEF A;  3W4P A;  2HIO B;  4CPK A;  3L27 A;  4R3B A;  3OPH A;  1AOI D;  4X69 A;  3L2A A;  4FSF A;  4KUD A;  4H9O B;  3B0C W;  1YLW A;  5CP6 B;  1XXM A;  1YM1 A;  4IBD A;  3B6F A;  2NQB B;  1KGG A;  5F99 A;  5AQ9 A;  5EOE A;  4GH9 A;  1M1A D;  3VP2 A;  1I2W A;  4OJP A;  4BD0 A;  1CI9 A;  4WZS B;  3BLM A;  5B0Y A;  3MGP D;  4A5R A;  1P3F C;  4R23 A;  4IJE A;  3A3J A;  5TFQ A;  5GSU D;  1IKG A;  3AYW D;  1WE4 A;  5CGS A;  4E6W A;  1BH9 B;  3VH5 W;  1P34 A;  3REJ A;  3D4F A;  1U35 C;  1XKZ A;  3C7U A;  1FCO A;  4CAY A;  1P3K A;  5E5A B;  4MBH A;  4IBR A;  3KFU G;  4WZ4 A;  3AZL A;  3HL9 A;  4IVI A;  2HDS A;  3EPH A;  4Z66 A;  4WU9 B;  1YUE A;  2IWD A;  1L0G A;  4R3J A;  5B31 B;  4OP8 A;  1P3P C;  1XPB A;  1U35 B;  5B1L B;  5U47 A;  2XH9 A;  5B2I A;  4LCL A;  3AZE D;  5JRG D;  3A6N B;  3AZI D;  1MWU A;  3NDG A;  3W99 A;  3Q1F A;  4WBG A;  4H9S C;  3REH B;  1TVF A;  3KUY A;  5FAP A;  3NQU B;  3B6G C;  5GSU A;  1RGY A;  3UY6 A;  1KU5 A;  2PU4 A;  3BFD A;  3CJM A;  4YM6 B;  1E3U D;  1TDG A;  3UPP A;  4ZJ3 A;  3V3R A;  3SH7 A;  3AZN A;  2CWE A;  1E4D A;  4E44 A;  5FQQ A;  4XUJ B;  1C3B A;  5I94 A;  2YFV A;  3N4I A;  1YLZ A;  3EQU A;  3A1I A;  1BLC A;  4P0M A;  3C5A A;  4XUJ C;  4IBX A;  2PU2 A;  1EQZ C;  1MWT A;  5AV8 D;  1SKF A;  4S2I A;  5AV8 B;  3GRJ A;  1FR1 A;  3EG5 B;  1BLP A;  5E5A D;  2EXB A;  4QD4 A;  2A49 A;  4JBF A;  4JJN D;  3LEL D;  3RXW A;  3B0C T;  2EX2 A;  3CMZ A;  4X53 A;  3X1T C;  4UAA A;  3WKJ C;  1ULY A;  4GKU A;  5DNM D;  1BLS A;  3LZ0 C;  3AZM C;  3EQV A;  4EBN A;  4KHA B;  4WU9 C;  1HVB A;  3N8S A;  1JFI A;  5B31 C;  1DJA A;  4CAY B;  1P3K B;  3CG5 A;  4GHL A;  1P3K D;  5GSU C;  1ID3 A;  3BEC A;  2Q9M A;  4OPY A;  4OQG A;  3MGP C;  4OLD A;  3REL A;  3HLC A;  4HES A;  1BH9 A;  1U35 A;  3IF6 B;  5CHL B;  3LJA D;  5CPK C;  3GSG A;  5BNV B;  4JJN C;  3SS4 A;  5B2I B;  1GHM A;  2RVQ C;  4MBK A;  3BFG A;  2WKI A;  4D2O A;  4ZAM A;  5JRG A;  5B33 A;  2R9W A;  4Y7P A;  3UTB B;  3IP4 C;  3W96 B;  5DNN A;  2WGI A;  4R0Q A;  5A91 A;  1P3P A;  4X23 D;  2ZQA A;  5HFO A;  1KE4 A;  2FFY A;  3IF6 A;  1KX4 A;  3OPL A;  4GHA A;  3WS1 A;  4K0W A;  3ZG0 A;  1K6S A;  4E3I A;  4IBJ A;  4EO5 C;  3KWQ B;  1K56 D;  4IJF A;  4R8P D;  5B40 C;  1K54 C;  4FCF A;  5B2J D;  3O62 C;  2V20 A;  3CZD A;  2IWC A;  2C5W B;  3KSY A;  1KVL A;  4ZUX C;  2WGV A;  3MGS C;  1FOF A;  1SCW A;  4KG6 A;  4B4X A;  3VMA A;  5CHU A;  4H9O A;  1MWS A;  3PBR A;  5CXW A;  4JF5 A;  2WKH A;  3PAG A;  2Y2G A;  1K4E A;  3LY4 A;  3V5M A;  1YQS A;  3C1C B;  1KE3 A;  3H0L C;  1PI5 A;  3HUO A;  4UHU A;  4BL3 A;  5AV5 C;  3AZI B;  4XZQ C;  1NXY A;  3O87 A;  5GL9 A;  5HAR A;  1ZG4 A;  2H0Y A;  3ZCZ A;  2EFX A;  3BYD A;  3ZG7 B;  2F8N G;  2IWB A;  5G18 A;  5EVI C;  1XGJ A;  2ZC7 A;  4QNL A;  5E2E A;  5J8X A;  2HUE C;  5EVI D;  2DQN C;  2NZD A;  3MGP B;  3WS0 A;  4L0L A;  3KS8 A;  3BLS A;  1E3U A;  3UTB A;  1TZY C;  3AZJ A;  2YFW A;  4OOY A;  3VSK A;  5AY8 B;  4QU3 A;  3C1C C;  2X01 A;  3W97 C;  4OOL A;  4Z66 B;  1H8Z A;  4OPR A;  1K55 A;  4KZ6 A;  3X1U D;  2NZD D;  4Z5T A;  3LEL B;  3L28 A;  1AXB A;  4OPZ A;  5CGX A;  3UT9 C;  1K55 C;  1JTG A;  1E25 A;  5CPJ D;  2R9X A;  2OSU A;  3HLW A;  4MLL A;  5B31 D;  3O62 B;  5E2G A;  5B33 C;  3WAA B;  3O62 D;  2YFW B;  1A7W A;  5F83 A;  3LZ0 D;  5B1M C;  3KWQ C;  3TU4 C;  3REL B;  3MGR B;  1FR6 A;  1ES4 A;  3H0M C;  3HLF A;  3LEL C;  1Y54 A;  4CSR B;  4N9K A;  4B4Z A;  2ZY5 A;  3S4X A;  1TZY B;  3MGP A;  4OJO A;  3G2Z A;  2F8N A;  3V39 A;  5CPI B;  4XUX A;  1TEM A;  3UT9 A;  3E2L A;  5EPH A;  3X1U C;  4NY2 A;  5B0Z C;  2DF4 C;  3AN2 C;  4H9R A;  4DE0 A;  3FDD A;  4Z2M G;  4O7D A;  4WNN A;  5CPK B;  3PAE A;  4LD9 C;  1ONG A;  5B0Z B;  3AN2 B;  4X23 B;  5B0Z D;  3AN2 D;  1RP5 A;  1TDL A;  3B6G D;  5CRF A;  3HBR A;  3KXB C;  5DNN C;  1H5X A;  5JRG C;  5KDM B;  3AV2 C;  1LL9 A;  5GT0 B;  4XUJ A;  4BEN A;  4DE2 A;  5C3I C;  4GN2 A;  1ID3 D;  2WUQ A;  5FAO A;  3AV1 A;  4C3Q A;  3X1T B;  2F8N D;  5BNX B;  1JWZ A;  5JA4 B;  4X55 A;  5TGF A;  4RYE A;  5AVC C;  1EI5 A;  2HIO C;  5FAT A;  4YIN A;  1LHY A;  4P87 A;  5AQ7 A;  5B31 A;  1P3B B;  5DTT A;  3NBL A;  2ZY4 A;  2J7V A;  4BLM A;  1WYC A;  2WK0 A;  4QY5 A;  3AFA D;  3FKW A;  1BH8 A;  5C3I B;  1HD8 A;  1M18 C;  2HP5 A;  4R8P C;  5B40 D;  5DVA A;  3FWL A;  2BYM B;  4FH4 A;  3BEB A;  3W96 A;  2WAE A;  3B0D B;  2PYO A;  1F66 B;  1JTD A;  4X23 C;  4Z5T D;  3AFA A;  3ZGA B;  2P74 A;  5M18 A;  2NQB A;  1HQ3 C;  4J8V A;  5E2H A;  3G32 A;  1P3B A;  1M1A B;  4E3O A;  5M1A A;  2XK1 A;  4MNR A;  4UA6 A;  1XA1 A;  5GLA A;  3W8K A;  4RA7 A;  5G49 A;  3IWQ A;  1BFM A;  3KUY D;  3C1B C;  5JYP A;  4WEK A;  3WAA D;  1CI8 A;  1KX3 A;  3IXG A;  5B32 C;  3GV9 A;  4Y0O A;  1HQ3 B;  1ESI A;  4OJ6 A;  5FQM A;  3W96 D;  5B40 B;  4WU9 D;  2WAD A;  1MXO A;  4IED A;  3KUY B;  4UUZ B;  3UPO A;  3ITA A;  4WMC D;  3UNW A;  2FJ7 A;  4YS3 A;  2FFF B;  5AV9 D;  4GDN A;  1K57 A;  5B2I D;  4J8V C;  4M3K A;  5B24 C;  3UDF A;  5AV6 B;  3AZG D;  4J8X A;  3PBT A;  3AGE A;  4PM7 A;  2ZM2 A;  2XD1 A;  1KX5 C;  1PI4 A;  5BS7 C;  1U60 A;  2I72 A;  4Z66 C;  4DDY A;  3WAA C;  3W97 A;  1BUL A;  3UTB C;  1FSW A;  1AOI C;  1O7E A;  3RXX A;  1TZY A;  3AZJ C;  3MNN C;  4FH2 A;  4S2N A;  2QMI A;  2Q9N A;  2WZZ A;  4G91 C;  1M6K A;  1PW1 A;  3A6N C;  3AZE A;  5DF9 A;  2Y2I A;  5GT0 D;  4CJN A;  3L25 A;  2CV5 A;  4IBK A;  1P3O C;  5E5A A;  2H5S A;  3G2Y A;  3A3F A;  1KE0 A;  4WMC A;  3AZI C;  2J9O A;  3MXR A;  3PTE A;  4LD9 D;  4OQH A;  5AQA A;  4NYY A;  4IVK A;  2G2W A;  1SHV A;  4N92 A;  2QPN A;  3AV1 C;  2ARO D;  1P3M B;  1PYY A;  2RIQ A;  5JYO A;  3MGS A;  2ARO B;  1P3M D;  3REJ D;  5CPI C;  1BSG A;  1GHI A;  1N1J B;  4WEL A;  2ZLY A;  3B3X A;  4KGC B;  2Y2J A;  4N1H A;  3WTP A;  3AZK D;  1H3O B;  2E8I A;  3DWZ A;  4PM6 A;  1PWC A;  3BFF A;  1Q9C A;  4J8U C;  4Q8I A;  4NE6 A;  1FCN A;  3TU4 D;  1M18 A;  3REJ C;  3Q7Z A;  3IXH A;  2XFS A;  1TAF B;  5CTM A;  1XP4 A;  3LZ1 D;  3W96 C;  4G92 C;  3MKE A;  4LV2 A;  5IHV A;  2PYO D;  3AZI A;  1M19 C;  3BFE A;  5FQ9 A;  5G49 B;  3AZH C;  2Y2O A;  5B32 D;  3MZD A;  4JJN A;  1WWI A;  2QZ6 A;  3OZH A;  5CPI A;  1GA0 A;  4EV4 A;  2RCX A;  1KVM A;  2ZY2 A;  3ZNT A;  3KWQ A;  3EPK A;  3VH6 W;  2BYK B;  3X1V D;  2V2F F;  3ZFZ A;  1IYO A;  5B31 G;  1FQG A;  1P3I D;  1ALQ A;  4DF6 A;  3KXB B;  1NRF A;  2CV5 D;  3LZ1 C;  2XR0 A;  3AV2 B;  3AZJ D;  4NZ1 A;  1ERM A;  2WGW B;  5DNN B;  4X6T A;  5HL1 A;  2L5A A;  5GLD A;  2BLS A;  3ZG5 A;  1LI9 A;  1P34 C;  2ZC4 B;  3X1U A;  3W99 D;  3AZN C;  2XD5 A;  1N1J A;  1NYY A;  1KDW A;  5EVI B;  5B24 D;  2ZQC A;  3SH8 A;  5AVB C;  4J8V D;  4P6B A;  2ARO A;  4KZ5 A;  4OP5 A;  3W4Q A;  5KSH A;  1P34 D;  1YMS A;  3NIA A;  1W7F A;  4Y0U A;  3REI B;  2F8N K;  5GHZ A;  4KZ7 A;  4Z2M H;  1Z6F A;  3O3V A;  2FJ7 B;  1GA9 A;  4WU8 B;  2VGJ A;  1YT4 A;  3AZM B;  3UTA D;  3AYW A;  5CPJ C;  5B24 B;  3MGQ B;  4AWL B;  1YLY A;  1HTA A;  1K38 A;  4R4S A;  2HIO D;  4OQ0 A;  1W8Y A;  5FQJ A;  3MVD C;  3KS4 A;  5A92 A;  5BPV A;  5DF7 A;  5AY8 D;  3X1S A;  1KX4 D;  3KUY C;  3Q7V B;  1AOI B;  3FZC A;  3GMW A;  3LZ1 A;  1N9B A;  2HP9 A;  3MBZ A;  4H9S A;  2XQZ A;  5B1L C;  5CHJ A;  2ZM8 A;  1P3L C;  4WNN B;  4J8W C;  5CPJ B;  4H9R B;  3FKV A;  3AZH A;  5GLB A;  4KZ3 A;  4R8P A;  5HAQ A;  5AV8 A;  3ITB A;  4ZBE A;  5M19 A;  2NQB D;  2EFU A;  3HSH A;  4OLG A;  4YS3 D;  3BM6 A;  2DCF A;  3N8L A;  5GHX A;  5CPI D;  1L0F A;  3IF6 C;  3AFA C;  4WU8 A;  4S2P A;  4ZJ2 A;  4E6X A;  5F1F A;  1HQ3 A;  3M2J A;  4E45 A;  4YS3 C;  1FCM A;  5CHM A;  1F66 C;  4YFM A;  3NY4 A;  1KDS A;  4QLC B;  5B0Y C;  4KZ4 A;  5FI6 A;  3HUM A;  4E3L A;  3LZ1 B;  2VQR A;  2G5I C;  4PMA A;  3UE0 A;  2IO5 C;  3IXB A;  4NZ4 A;  3A1K A;  2JBF A;  2ZJ9 A;  4JXG A;  3P5J B;  2H10 A;  4MBF A;  3VH6 T;  1YLP A;  4HBU A;  1P3L D;  5E43 A;  4XZQ A;  3AZF D;  4EWF A;  1S32 D;  4RVA A;  2BG1 A;  3AV2 A;  4OKP A;  1IEL A;  3REH D;  1P3A C;  3G31 A;  4XUJ D;  4NFT A;  4GD8 A;  5AY8 A;  3IHB A;  5KSC A;  3MZE A;  3RJU A;  1MY8 A;  3NDE A;  3AZG A;  2NZD C;  1XGI A;  1ID3 B;  3LCE A;  5GT0 A;  3AZE B;  1HQ3 D;  3IWO A;  4GD6 A;  4KG5 A;  4LV0 A;  1NYM A;  5GT3 C;  4S2J A;  1K57 C;  3X1T A;  4S2K A;  5CPK D;  3AZG C;  1JFI B;  4NYU A;  5DF8 A;  2FJ7 C;  4NZ5 A;  1M19 D;  1TZY D;  4DXB A;  2HIO A;  4DQY B;  1S0W A;  3W97 B;  4EBP A;  5AV9 B;  2JE5 A;  5B0Y B;  1Z2C B;  3SS3 A;  5AV6 D;  1PWD A;  3REK D;  4JJN B;  3REI D;  4QB8 A;  1YU2 A;  3ZDJ A;  5FI7 A;  2Y2L A;  3AZN B;  5CPK A;  3HUN A;  3AZN D;  3AZM D;  2IO5 B;  3Q81 A;  4HGA C;  3WTP B;  5GXQ C;  5AV5 A;  3C1B D;  4PPR A;  4OH0 A;  5B32 G;  3L26 A;  2DRW A;  1LL5 A;  3QNC A;  2CV5 C;  1U35 D;  1GCE A;  1I5Q A;  2CC1 A;  1PIO A;  5E5A C;  5KDM A;  1P3O B;  4HEF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...