2Y2GA

Penicillin-binding protein 1b (pbp-1b) in complex with an alkyl boronate (a01)
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
486
structure length
466
Chain Sequence
b'EITYSDGTVIASIDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTGQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PENICILLIN-BINDING PROTEIN 1B
publication title Structure-Guided Design of Cell Wall Biosynthesis Inhibitors that Overcome Beta-Lactam Resistance in Staphylococcus Aureus (Mrsa).
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
total genus 165
structure length 466
sequence length 486
chains with identical sequence B
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2y2gA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2y2gA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2y2gA02
3FKWA 5AQ9A 3GTCA 1L2SA 4KG2A 1PWGA 3PAEA 5A91A 1NZOA 3IQAA 1PIOA 3MKFA 4M3KA 4QU3A 2ZM0A 5FQMA 3BLSA 1NZUA 2WUQA 3GR2A 5GHXA 1WYBA 4R4RA 2Y2NA 4WEKA 1PWCA 4GN2A 3ZFZA 4QJGA 3HUMA 5CRFA 3SH9A 4CJNA 2HDRA 5CEDA 2WKHA 4Y0OA 3O88A 4ZAMA 4RYEA 4E6WA 1XKZA 4JF4A 1K4EA 1KVLA 2JBFA 4RX2A 1E3UA 3GMWA 2JE5A 1K4FA 3W4QA 4D2OA 3S22A 1I2WA 2P9VA 3WWXA 2WGVA 4Z9QA 5GLCA 1HD8A 4XUZA 5I94A 1GA9A 5D3OA 1SKFA 2J7VA 2OLVA 3EQUA 3A3JA 3I7JA 4FSFA 2HDSA 5DTTA 3W4OA 3OPRA 1LI0A 2Y2IA 3IF6C 2Q9NA 3N8RA 1M40A 2FFFB 3ZGAB 5KSHA 2V1ZA 4KQRA 5E2GA 3QHYA 4GB7A 4WYYA 3OPHA 4BD1A 3O3VA 3ZVWA 3IF5A 4U0XA 3WS0A 2XF3A 1BSGA 2WAEA 3G31A 4KZ8A 1L0GA 4UHUA 2HP5A 1JWPA 3HLBA 1YQSA 2ZC3B 3AGDA 3O86A 4MBKA 4BJPA 5EVIA 2EX8A 2WK0A 4OPQA 1KVMA 1FOFA 3CG5A 4S2OA 3UY6A 4DE0A 3ZG0A 3Q82A 4GOGA 5M19A 2CC1A 5TR7A 4S2IA 3O87A 1IKGA 1S6RA 2EXBA 1GHPA 4OPZA 4QD4A 1W7FA 3G2YA 1ES2A 2ZQDA 4GNUA 2PU2A 2UWXA 3TSGA 3W4PA 4S2NA 4ZBEA 5HAIA 1K6RA 5GLDA 4X55A 1N9BA 1DJCA 3NC8A 1ONHA 3OCNA 5GHZA 1HZOA 2Y2KA 2EFUA 4DKIA 3JYIA 1PW1A 2G2UA 5EOEA 2BLSA 1NYMA 3HBRA 3IWQA 4PM8A 5CTMA 5BOHA 5E2FA 3A3IA 1I2SA 5IHVA 4ZTKA 2H0TA 1GHIA 1SHVA 3FKVA 3HLDA 4BENA 3V39A 4F94A 3QNBA 2WYXA 1ZKJA 4PM5A 3ZG7B 2ZC7A 3BLMA 3G34A 3MBZA 3P98A 5DF9A 3E2KA 3C5AA 1SCWA 3EQVA 4E3KA 2XEPA 2PU4A 4N1HA 4B4ZA 4RX3A 3UNWA 5CTNA 4KZ6A 1AXBA 5CEBA 3OPPA 4YFMA 1XGJA 1OMEA 3Q81A 4WM9A 2XLNA 3IXBA 2VGJA 1LI9A 4WELA 2ZLYA 3MZEA 3UDXA 3PBRA 4DF6A 2JCHA 1J9MA 2J9OA 4R23A 1FCOA 3ZNYA 1GHMA 1W8QA 4GD8A 4P87A 2P9VB 2FFYA 4S2PA 2ZQ8A 1PZOA 2A49A 1TVFA 1KE0A 1CEGA 4B88A 4K0XA 5DF8A 4MBFA 1FR6A 1XX2A 1MWRA 2ZC6B 2ZMAA 5FI7A 5AQAA 5FA7A 1IYSA 3MFDA 3BFDA 4P6BA 1U60A 1W8YA 2EX2A 3IXDA 1M6KA 3SS4A 2B5RA 2C6WB 3D4FA 4KZ9A 4WBGA 4XUXA 2IWCA 4IVKA 4JXVA 3Q7ZA 2P74A 1JWVA 1SDEA 2WAFA 3C7VA 1FR1A 5EECA 4C3QA 4WMCA 3VP1A 5AQ7A 3DWKA 1TDLA 2H10A 3AGFA 1H5XA 3HLWA 3PBOA 1YM1A 1JTDA 4LV2A 5EVIB 3VP3A 4BL3A 1GCEA 5FQJA 4H8RA 4FCFA 5HFOA 5CGXA 5FI2A 1IELA 3HLGA 1YMXA 5FAPA 1W5DA 1N4OA 4MLLA 3ZG9B 2C5WB 4R1GA 3PBQA 2IWBA 2JC7A 4RVAA 3G35A 1VM1A 4KZBA 3A3EA 5HX9A 4K0WA 4PMAA 4X56A 4JBFA 4P85A 4GZBA 3S1YA 2HDUA 3GQZA 1MXOA 4OPRA 3WRZA 2OLUA 1K25A 1BLHA 4DE1A 2DCFA 3BFEA 1JVJA 3OCLA 1CI8A 5EPHA 2V20A 3BFGA 1ALQA 5FAOA 3CJMA 1BTLA 2OSUA 1GA0A 1RGYA 5GLAA 1PYYA 1BLPA 2XQZA 3Q07A 1LHYA 4JXWA 5EVIC 3PBSA 4CPKA 3UPPA 4WMCD 3G30A 2Y55A 3NY4A 4UAAA 4QY6A 2EX6A 3UE0A 3NDEA 3C4OA 2XDMA 3G2ZA 2BG1A 3IXHA 5FQ9A 1K54C 2DRWA 4JLFA 4P0MA 5DF7A 3UPOA 1KDWA 2Y2OA 3HLFA 4Y7PA 2G2WA 1ZC2A 1K57C 1LL9A 3AGEA 5CGSA 4S2NC 1ERQA 3ZHHA 1BZAA 3SS5A 2QZ6A 2XFTA 4DXBA 1ZG6A 1YLYA 4BL2A 3IHAA 5A90A 3MXRA 4FH2A 5F1FA 4KQOA 3WS5A 2Y4AA 1K55A 1MY8A 1JTGA 4ZJ1A 1PI5A 2ZC5B 1PW8A 1NYYA 5JYPA 5AQBA 1KGFA 3B3XA 4KZ5A 2ZQ9A 1YT4A 5FQQA 5CECA 3GV9A 3N8SA 3VP0A 1MWSA 1KE4A 3Q1FA 4FD8A 5DVAA 1YMSA 4S2JA 5KMWA 2WGWA 3DW0A 5TGFA 4WZ5A 3UE1A 3VSLA 3CMZA 3ZG8B 3BFFA 3IH8A 3WS2A 2PBYA 1MPLA 1TDGA 4GD6A 3BM6A 5E2HA 2RL3A 3IF6A 4UA7A 4BQMA 4LCMA 4X69A 4X68A 1RP5A 3NBLA 2ZM2A 2IWDA 3IT9A 1XGIA 4EBNA 2J8YA 4OOLA 4ID4A 4EBPA 4PM6A 2Y91A 1IEMA 2QMIA 4QHCA 4E6XA 2ZQ7A 1ES4A 1JWZA 3M6HA 4LV3A 1WYCA 4GDNA 2DNSA 1IYOA 5GL9A 2HPBA 1BLSA 1ZG4A 4ZDXA 2Y2MA 2J9PA 2WZZA 1ES5A 5FDHA 4KZ3A 5HW3A 4MEZA 3BRMA 3A3DA 4DDSA 1MKIA 3HLEA 3NIAA 4YINA 5HL1A 4DE3A 5A93A 4OOYA 5F1GA 1ONGA 4IEDA 5EE8A 3VFHA 2XD1A 4E3JA 2WADA 2Y2GA 1Q2PA 2Y2PA 4C75A 2WZXA 1K38A 3ZDJA 3BFCA 4OQ0A 1XA7A 3WRTA 5EOOA 3OZHA 3GRJA 5E2EA 4BD0A 1PWDA 4E3LA 5FAQA 3RJUA 5EUAA 2XH9A 4O7DA 4MNRA 5GLBA 1EROA 3MKEA 5J8XA 1HVBA 4E3IA 3S4XA 3IH9A 3UDFA 4WZ4A 4C6YA 5KSCA 2I72A 3MZFA 1H8ZA 3NDGA 2Y2QA 3Q7VA 5CHUA 5DTKA 1FQGA 4KQQA 5F83A 2E8IA 1Q2QA 1E4DA 1MWTA 4N9KA 5EVLA 5L2FA 3M6BA 3ITAA 4EBLA 1QMFA 2Y2JA 1XA1A 4QB8A 1WE4A 4LV1A 4GDBA 4N1XA 3VFFA 5A92A 4E3MA 4IBXA 3N6IA 1PZPA 4PM7A 3TG9A 4GKUA 1IKIA 4PM9A 3CZDA 1NJ4A 2ZQCA 1FSYA 3A3FA 4L0LA 4MBHA 2WKEA 4PPRA 5JYOA 3N7WA 2X71A 1CEFA 3OC2A 3QNCA 3LY4A 5GHYA 4DE2A 1G68A 5CHJA 1DJAA 4Q8IA 2WGWB 2V2FF 4WEJA 2XR0A 4KZ7A 4OLDA 1BULA 2Y59A 2H5SA 3IF6B 1LL5A 1CI9A 4KZ4A 5FATA 1W79A 5G18A 1NY0A 1KE3A 2HDQA 4EV4A 2VGKA 1K55C 2X01A 3VOZA 3LCEA 2EFXA 4Y0UA 1G6AA 2EXAA 2EX9A 4NK3A 1VQQA 3GSGA 1FCNA 3UN7A 3P09A 4U0TA 3FYZA 1YLJA 1L0DA 4DRTA 3G32A 2ZM8A 4HBUA 4JF5A 1ESUA 1Y54A 1BUEA 5CXWA 3WS1A 4WZ5C 1MBLA 3RXXA 3V3SA 1KGEA 4KG6A 3V3RA 2Y2LA 3N4IA 4JXGA 1BT5A 3NI9A 3BEBA 4X6TA 3MXSA 1I5QA 4LV0A 4OPYA 1YLWA 4EQIA 4KZAA 3PBTA 3W8KA 5FI6A 3UE3A 4K91A 3BECA 2ZC4B 3C7UA 5FQKA 4UA9A 4S2KA 5M1AA 5FASA 1RCJA 1BLCA 2X02A 1KGGA 1MWUA 2XGNA 4NETA 4OH0A 3HVFA 4R4SA 4HBTA 4U3TA 3GVBA 3NCKA 1XXMA 4ZJ3A 3VSKA 3ZNTA 3FV7A 3VMAA 2Z2MB 3HUOA 4XXRA 1Z6FA 1E3UD 4A5RA 4BLMA 4OOMA 4KG5A 3Q7VB 3IWIA 3MZDA 1YLTA 1O7EA 1SDNA 5FQIA 3M2JA 2R9WA 1C3BA 3V5MA 2A3UA 1K54A 3ZG5A 4B4XA 3FZCA 1K57A 4X53A 2WKIA 4OQGA 3V50A 1KDSA 4EUZA 4KENB 5KZHA 3G4PA 3SS3A 5CGWA 3VP2A 1NRFA 2R9XA 3IHBA 5HARA 3FWLA 4S2MA 1CK3A 1QMEA 1FCMA 1E25A 1H8YA 1TEMA 3IWOA 4FH4A 5F82A 3SH8A 3ZCZA 4IBRA 5U47A 4R0QA 2ZJ9A 3ZVTA 3PBNA 4UA6A 2OV5A 4OKPA 3UO9A 1K56A 4OQIA 1IYQA 1ERMA 1EWZA 3HL9A 4HESA 4IVIA 4JXSA 5CERA 2HP9A 3LY3A 4RA7A 5EVID 4HEFA 3ISGA 4OONA 5TFQA 3IXGA 2WGIA 1L0EA 2XFSA 4N9LA 1YLZA 3OPLA 2HP6A 5HAQA 4DXCA 2RCXA 2H0YA 3VP4A 4E3OA 4LCLA 4OLGA 2Y2HA 3C4PA 2ZD8A 3N8LA 3BYDA 2ZQAA 3HREA 3UDIA 3PTEA 3SOIA 2QPNA 4JKTA 4OVDA 4OP8A 2XK1A 2Z2LB 3ITBA 1YLPA 3SH7A 1ESIA 5E43A 3VOYA 3M2KA 1IYPA 4Y0TA 1DY6A 2XD5A 3LO7A 4ZJ2A 1PI4A 4LENA 3LEZA 5CHMA 1EI5A 3HUNA 3PAGA 4QY5A 1HTZA 3DTMA 5DTSA 4DDYA 5FSRA 4OQHA 1S0WA 1LLBA 1K56D 3UPNA 3WS4A 3RXWA 3TOIA 5M18A 3E2LA 1XPBA 4EWFA 4R3JA 4S2LA 3HLCA 4R3BA 1FSWA 1NXYA 1O07A 2Q9MA 4JF6A 1DJBA 3DWZA 5HAPA 1L0FA 4E3NA 1XP4A 4N92A 1ES3A 4OP5A 2GDNA 4JPMA 1RGZA 1K6SA
chains in the Genus database with same CATH superfamily
1P3LA 3FKWA 4Z5TB 1L2SA 4WU8C 4R8PD 5A91A 1LT0A 4J8WA 3QP2A 1NZOA 5L07A 3IQAA 4M3KA 5CPKA 1GPFA 3C1BC 1NZUA 4XZQC 3KYQA 5GHXA 1ED7A 3RFBA 4J8VC 1E6PA 3ZFZA 3LJAA 3AZKC 2D49A 3ULFA 4NE3A 3O88A 2FJ7D 4JF4A 3K2NA 3REHA 2NZDB 1TZYB 5AV6C 1U35A 1E3UA 2HIOD 3B0BA 3ZQ5A 2V9AA 3B6GA 3DTIA 1GOIA 4XUJD 3X1TB 4Z5TC 3KWQD 3W98A 4XUZA 2J7VA 3EQUA 3L7HA 3REJC 4I3IA 1LI0A 4X25A 4B93A 3QHYA 2PRFA 4BD1A 5A8BA 3O3VA 4QWOA 1H0GA 3IF5A 3VH6A 2W27A 1PDCA 3WA9B 3B42A 2NZDC 1AOIA 2HP5A 1JWPA 3O86A 4AWLB 4BJPA 4MBKA 1MC0A 3FPVA 2WK0A 4OPQA 4NZ5A 2L4RA 3X1TC 3V67A 1HQ3B 3NJAA 1A0KA 1P3IA 1BYWA 2EXBA 3MS6A 3G2YA 3NQJA 2O9CA 3AZIB 2UWXA 2PU2A 4S2NA 3VH5T 4PHTA 3REKA 5B1MD 3WKJA 5EVEA 1ONHA 2ZMVA 3LZ1B 4LD9D 4AWLC 3LR0A 3AZNA 4DKIA 4EERA 1PW1A 2G7UA 4RQ9A 3KSFA 1NYMA 3MGRB 5CTMA 1H0MA 1P3LB 3A3IA 1HQ3C 1N9NA 4ZTKA 4F94A 3FKVA 3V39A 3QNBA 4X23A 4J8WB 3DBAA 5CPKB 2O9AA 4L9EA 3E2KA 3C5AA 3AZIC 2PU4A 4N1HA 4RX3A 3LJAB 4KUOA 2V8FA 3BQ8A 4KZ6A 5CTNA 2OWJA 3E4OA 1XGJA 3IXBA 3KXBA 3REHB 1CK7A 4WELA 3LZ0A 1U35B 4R23A 4Y5FA 3MGRC 3B6GB 1GHMA 4R3AA 3FKEA 3AYWD 1W8QA 4S2PA 2A49A 1TVFA 3W98B 2VX8A 5GXQD 4J8WC 2A24A 4MBFA 2ZMAA 5CPKC 2GJ3A 2V8CA 2ACGA 4F3LA 5JRGC 3MFDA 1BH8A 5B2JA 1F9IA 1SZVA 1KX4D 3L29A 4WBGA 4XUXA 2L0WA 2HUEB 4IVKA 3MGQD 1JWVA 4YS3C 4EETB 3REHC 1U35C 1AOIB 2B02A 4C3QA 5AQ7A 3MGPA 3PBOA 4DRTA 3UT9D 3VP3A 3B6GC 2F8ND 5CPJA 3HLGA 5FAPA 1P3IB 3W98C 4MLLA 3ZG9B 2IWBA 2V5OA 3NQJB 1OJGA 2GZAA 4GZBA 3GQZA 1MXOA 2M1CA 5GT0D 1K25A 1EQZA 2WKRA 1JVJA 3REKB 3X1UA 3WKJB 2KOIA 1BTLA 3CJMA 4JJNA 1PYYA 1BLPA 3Q07A 3AZNB 4JXWA 3MGSA 4CPKA 3T4LA 3VH6W 3UPPA 4WMCD 3NY4A 4UAAA 5AVBA 1Y28A 5AV8A 4P6ZS 3CPTA 4X23B 4HMDA 2XDMA 3A6NC 3V9RA 3G2ZA 3S7QA 1KDWA 4HOIA 3AZFA 1ZC2A 2D02A 5EM0A 5B0YA 1W1YA 4S2NC 1KX5D 4TX8A 3L9KA 2XFTA 4MN7A 4DXBA 2W8SA 3WKJC 2W0NA 3IHAA 3KXBB 5F1FA 2VJWA 3LZ0B 3AZNC 2Y4AA 1K55A 1P3MA 1PI5A 2ZC5B 4QPRA 3B3XA 4KZ5A 2ZQ9A 4X23C 5FQQA 5CECA 3GV9A 3N8SA 2A24B 1KE4A 3B0CT 3W97C 4S2JA 5AV5D 4EXOA 3AZGA 4F3LB 1BH8B 3CUEA 5B2JB 5TGFA 1H3OA 2L1MA 3CMZA 3FC7A 3WS2A 2PBYA 1MPLA 4GD6A 2XRNA 3NBLA 3KXBC 4G92B 4WU8D 3LZ0C 4HGAC 1OGGA 2IWDA 4OJ6A 4EBNA 3MGPB 4YM6C 3C1BD 4E6XA 4XZQD 1JWZA 4LV3A 1WYCA 4J8VD 5AJGA 5CPJB 5GL9A 2W3HA 4MN5A 4ZDXA 1YU2A 2Y2MA 5HW3A 4DDSA 1MKIA 3HLEA 1W1PA 3B6FA 5B2JC 1P3AA 1ONGA 1EQZB 3X1UB 4G92C 3ZDJA 4BBVA 3BFCA 4JJNB 3UMDA 3REJD 3MGPC 1CXWA 3GRJA 4BD0A 1PWDA 5AVCA 3KFUG 2XH9A 5GLBA 4MNRA 5AVBB 3W2ZA 5AV8B 5B31G 3CPTB 3PXPA 3V9RB 2NZDD 5CPIA 2A2LA 2KDKA 3AZFB 3B0DB 5B0YB 5CHUA 1FQGA 4KQQA 4WN5A 2IA2A 3X1UC 5BNVA 2Y2JA 4QB8A 4JJNC 2WKQA 1CJFA 1PZPA 4GKUA 1P3MB 1O6IA 1IKIA 3AZED 4X1MA 2Q0OA 1V9YA 1FSYA 5AVBC 2WKEA 1XFQA 5JYOA 2M7VA 3PR6A 1E6ZA 3AZJB 5E5AA 3LY4A 2VV7A 2VK3A 5FUGB 3AZGB 5B0YC 3AL0C 1H3OB 3AV1A 2XR0A 5B1LA 4OLDA 1BULA 2Y59A 1HQ3D 4IBKA 3BY8A 1PRQA 5DFYA 1K55C 2EFXA 4JGOA 4Y0UA 1AIWA 2EXAA 3AZID 4CLCA 3C30A 5JA4A 5FEGA 2NUPC 1K0KA 5HWWA 5F99D 3AZJC 3G32A 3O62A 4IUKA 4JF5A 5CXWA 3X1VA 3B6FB 5BS7C 3RXXA 1P3AB 4KG6A 2Y2LA 3T50A 3T4TA 3MGRD 1BT5A 4X6TA 4EQIA 5FI6A 1LSXA 4K91A 3C7UA 2ZC4B 4J8WD 3CITA 4UA9A 5M1AA 1F98A 5FASA 5JRGD 1KGGA 5AVCB 3L25A 3RTYA 3VMAA 1M19A 2FZ0A 4YS3D 4XXRA 2E8JA 3T4SA 4ETXA 3U2AA 3REHD 1E3UD 5CPIB 5AV9D 4A5RA 4BLMA 3AFAC 1P3AC 3B6GD 1T3UA 3M2JA 4MN6A 1K54A 5BNVB 3ZG5A 4B4XA 4X53A 5GT3A 4OQGA 1KDSA 4EUZA 4KENB 2PHYA 3SS3A 5CGWA 3VP2A 4HJ4A 3FWLA 3OBFA 5EFWA 1H8YA 5F82A 4R0QA 5E5AB 3LGOA 4OKPA 4KUKA 5CERA 1H8PA 3LY3A 4RA7A 4OONA 3AV1B 3KUYD 5B1LB 2XFSA 4N9LA 4QNLA 5B24A 5HPFA 4ZBJB 2Y2HA 1P3GD 4XT2A 3T12B 3C4PA 3A6ND 1CQAA 3HREA 4Z1WA 3UDIA 4ARZA 5DKLA 4CLCB 2XK1A 5JA4B 3UB8A 3M2KA 3VH5A 1DY6A 3WKJD 3WD3A 4Z2IA 1PI4A 2Y8HA 3O62B 3HCYA 5B32C 3LEZA 1EI5A 3HUNA 4QY5A 3AZND 3X1VB 5DTSA 4GS9A 3UB7A 1YU3A 4MCWA 1GSVA 1LLBA 1K56D 1LSVA 3P01A 4ZBJC 4S2LA 4EO5B 1FSWA 1NXYA 3MQ0A 1DJBA 3W97D 4CLCC 5HAPA 1YU4A 3BWLA 1K6SA 1F66A 3CHWP 1M19B 1DP6A 4KUDA 3GTCA 3O62C 2VEAA 4KG2A 3KXBD 3PAEA 4IBIA 3LZ0D 3MKFA 4WV4B 4YM6D 5B0ZC 2Y2NA 2PR6A 2JHEA 3HUMA 4Z2LA 2WKHA 3D3OA 4RYEA 4E6WA 5GT3B 4EO5C 4WJ3C 3T4JA 2Z6CA 4RX2A 4HP4A 1L6JA 5B2JD 3LICA 4WZSB 1LL8A 1J7MA 1A7WA 1M19C 1SKFA 3I7JA 2OLVA 5DTTA 1OTIA 3W4OA 3IF6C 3N8RA 2MJ6A 4IHQA 2FFFB 1D7EA 4NZ4A 2PDRA 2V0WA 4O01A 2XF3A 5B24B 2WAEA 1W1TA 4NE5A 3KYZA 4XT2B 2PBDP 1S1YA 1YPRA 4ARZB 2IOUA 3HLBA 1YQSA 3E4QA 3AGDA 3MNND 1G28A 5B40A 5EVIA 5B2IA 4Z66A 4OUIA 3CG5A 4DE0A 3S7PA 3X1UD 4H9SA 3O87A 4JJND 1IKGA 4Z2KA 3RELC 2PD7A 5CP6A 4GS9B 3REIA 3LELA 4NY2A 1PFLA 3X1SC 3TSGA 2Z6DA 3W4PA 5AVBD 1K6RA 5B24C 4ETZA 1P9RA 1N9BA 1DP9A 3WD2A 3H7WA 5DNNA 3OCNA 5B0YD 1VB6A 2G2UA 3HBRA 3IWQA 1BH9B 1F66B 5BOHA 2H0TA 4KUDB 1S67L 4J8UA 1ZKJA 4PM5A 3TU4C 3UB9A 2QJ7A 3EQVA 4CLCE 4HH3A 4E3KA 3VH5W 1G6OA 2K31A 2HGVA 4YFMA 1ODVA 1OMEA 2DQNC 4ME4A 3AZJD 4WM9A 2BASA 1FILA 2AROB 3MZEA 3LFVA 4DF6A 1BFMA 2J9OA 4Z2HA 5DFXA 3W99C 4GD8A 2PD8A 3LIAA 3UTBB 1PZOA 4KUDC 1KE0A 2OAP1 3AV2C 2J3WA 4K0XA 2F8NG 4MMNA 1MZUA 1Z2CB 2ZC6B 5FI7A 2FH5A 1IYSA 1H8MA 4P6BA 1U60A 1W8YA 2B5RA 2C6WB 1P3OA 1OGBA 3D4FA 4KZ9A 5HDDA 3WX7A 1WA9A 2IWCA 4JXVA 3C7VA 1P9WA 2AROC 1ZTUA 3DWKA 2H10A 3AFAD 3HLWA 3UE6A 5DNMA 1JTDA 4LV2A 5B40B 4OJPA 5EVIB 5FDSA 5B2IB 5FQJA 4Z66B 4G3KA 4H8RA 5HFOA 3UTBC 1GSXA 1YMXA 2C5WB 3EEAA 4ZUXC 5CP6B 5J4EA 3REIB 3LELB 5HX9A 4P85A 4QLCA 2GNXA 3S1YA 4OPRA 1BLHA 3BFEA 3OCLA 5L10A 3N3FA 1ALQA 5FAOA 4Y17A 3H7WB 5DNNB 5GLAA 4EQ1A 2W3FA 4Z2GA 1E88A 1XFNA 4LLOB 5EVIC 1M1AA 2ZL1A 3PBSA 4Z66C 4WU9A 4R6LA 3L26A 2Y55A 1ID3A 4YOFA 4H9SC 4J8UB 3C4OA 4B9OA 5CP6C 3UPOA 3REIC 3LELC 3HLFA 1K57C 3NOPC 5CGSA 4NXGA 5LBRA 1AWIA 1ERQA 1TZYC 1BZAA 3C38A 2QZ6A 3SS5A 3AZHD 1F1EA 4O0PA 1VETA 5DNNC 5B32D 4H9OA 4KQOA 3WS5A 4ZJ1A 2V1BA 1PW8A 5JYPA 5AQBA 2L5AA 1P3BA 1MWSA 1GXDA 3Q1FA 4FD8A 3WA9C 2ZY4A 1QO6A 4LRXC 3UE1A 4CLCD 5MC7A 3F1NA 1P3OB 5J7EA 1TDGA 5E2HA 3BM6A 3A1KA 1NLYA 1RP5A 2H28A 3O62D 4IBCA 3QP6A 3AZMD 5DNMB 2Y91A 2QMIA 4HJ3A 4L9FA 2ZQ7A 5B0ZD 3M6HA 4Y3IA 1BLSA 3LEQA 4HY8A 4Q0JA 1YSQA 3ICYA 4KZ3A 3WD0A 2VA0A 3BRMA 3B0CW 3NIAA 4YINA 4DE3A 5A93A 4G91B 4QLCB 1P3OC 1IFQA 3LZ1C 2XD1A 3BW6A 2WADA 5GSUA 4C75A 5B31A 1K38A 3WAAA 1P3LC 1VEUA 3WRTA 5DNMC 1M1AB 2ZL1B 1WWIA 2K2NA 4E3LA 4WU9B 5FAQA 3AN2A 3P7NA 1VHMA 1P97A 5EUAA 1ID3B 3MKEA 2W3GA 5J8XA 3IH9A 4JGRA 4DJ3A 3UDFA 4MB3A 5G4ZA 3LJAC 3B47A 5KSCA 1H8ZA 3NDGA 4HMCA 4QLCC 2E8IA 1Q2QA 4N9KA 1VETB 1XA1A 1WE4A 4LV1A 4GDBA 4H9OB 3VFFA 5A92A 1H0IA 3RELD 1M1AC 3T4KA 3CZDA 3X1SD 5IU1A 1NJ4A 2ZQCA 5HD3A 1ID3C 3TJZC 4L0LA 4PPRA 5B24D 3EEHA 1UWNX 1P3BB 3N7WA 2KX6A 4PKYG 4DE2A 2HUEC 4KGCD 1DJAA 4H9RA 4NXEA 4HI4A 3SZTA 3F1NB 4IBFA 4WEJA 1AOIC 2DMWA 4OJ5A 3DTEA 4J8XA 3O5YA 2CV5A 2H5SA 1LL5A 1MKMA 4LFUA 4KZ4A 2Y79A 4UEYA 3F1OA 3TU4D 1P3IC 4GHAA 4H9QA 2XROA 3P09A 4UPKA 4FOFA 1YLJA 1P3BC 5B33D 2JKFA 5AVEA 4KHAA 5AY8A 2VV8A 1ESUA 1TS8A 3REKC 4P6ZM 3V3SA 3W99D 4IUHA 5GSUB 3MXSA 1I5QA 4OPYA 5B31B 1YLWA 4KZAA 2HJEA 3W8KA 3UE3A 3WAAB 3AV2D 4H9PA 4H6JA 5IS1A 1VEUB 2ZMFA 1RCJA 2P04A 2J80A 2ZOHA 4GLQA 3KYEA 1MWUA 4OH0A 3HVFA 3AN2B 4EESA 4MDZA 3MQLA 4ZJ3A 3ZNTA 1P3PA 3WD1A 2Z2MB 2AROD 2QHKA 4KG5A 3FDDA 3MZDA 3AZLA 3IBJA 1YLTA 4GHIA 5FQIA 2R9WA 5GSUC 3V5MA 3UTBD 2P08A 5F69A 5B31C 1M18A 3FZCA 4ZUXD 3AZKD 3F1PA 2R9XA 2O9BA 2K7SA 3IS2A 5AV6D 3FPWA 5CHLB 3IWOA 4GJ4A 4NZ3A 4OQIA 3P5JB 1IYQA 3HL9A 4H9RB 4Z5TD 4IVIA 5EVID 2NQBA 3T1RA 4HEFA 3KS8A 3ISGA 4HP9A 4Z66D 3IXGA 2WGIA 1Z09A 4J8XB 2PYOA 2CV5B 5HAQA 2VKSA 4EUVA 3HSHA 2RCXA 2H0YA 4HHDA 4LCLA 3MGSB 2WKPA 5CPJC 1YU1A 3N8LA 3BYDA 2ZQAA 3F1OB 3PTEA 5CP6D 4JKTA 3LELD 4H9QB 1YLPA 3SH7A 1TZYD 2LY8A 4Y0TA 3TW8A 4ZJ2A 1H3QA 5C5KA 4KHAB 4LENA 5DNND 2AVXA 5AY8B 1EQZC 5CHMA 3X1TD 1HTZA 3WTPA 3T4QA 3E0YA 2FJ7A 5FSRA 1S0WA 4G3VA 3UPNA 4GH9A 1L3LA 2HIOA 3MGSC 3RXWA 3TOIA 4H9PB 5HDCA 1XPBA 4H6JB 5DKKA 4EWFA 4R3BA 2Q9MA 5AV8C 4XUJA 3DWZA 3WA9D 1XJ2A 4N92A 2GDNA 3MVDA 4JPMA 1SKOA 3AZFC 3F6TA 2QYBA 3B0DC 1P3PB 5AQ9A 3RH8B 5HPIA 5AY8C 3LIBA 5J3WA 1PWGA 2W1RA 4GHLA 1PIOA 4QU3A 5FQMA 2ZM0A 3AZLB 3BLSA 4HJ6A 4GHIB 2EWWA 1WYBA 3D72A 1PWCA 2ZBBA 2F8NH 4WNNA 1P3MC 4CJNA 5L09A 1M18B 1TS7A 4Y0OA 1F2KA 5CEDA 4ZAMA 1ZHHB 3HJIA 3F1PB 3GMWA 3MFXA 1FIKA 1K4FA 3IS2B 3W4QA 1P3OD 3LZ1D 4D2OA 3AZGC 1I2WA 2P9VA 1P3PC 3CUEC 4I3AA 3S22A 2WGVA 4Z9QA 1HD8A 3JVVA 5D3OA 3EPKA 2IO5B 4FSFA 1P3LD 1T1CA 3OPRA 2Y2IA 2Q9NA 3AZLC 5DJTA 5DNMD 1X0OA 3VV4A 5KSHA 2JKRI 2V1ZA 2NQBB 5E2GA 3PHYA 5B1MA 4X1LA 4NEED 4WYYA 2PYOB 3EGXC 3QP1A 5CPKD 3ZVWA 4LD9A 4U0XA 1M18C 1BSGA 1YSPA 3G31A 4KZ8A 1L0GA 3LJAD 4UHUA 2VQRA 4NZ1A 2G5HC 5DJUA 2EX8A 4QLCD 1U35D 3B6FC 2CC1A 2LB5A 1S6RA 1GHPA 3WTPB 1OTBA 1M1AD 2NQBC 1W7FA 3W98D 4GNUA 2FJ7B 1T1AA 3MJQA 2HIOB 5AVCC 3NC8A 5EM1A 4BBUA 1HZOA 2Y2KA 2EFUA 4XUJB 5EOEA 2BLSA 4CAYA 3MVDB 1AOID 5CPIC 5GXQA 1LSWA 3GECA 1SKOB 1I2SA 1T18A 2XA7S 5IHVA 2W3EA 2W1TA 2O99A 5BT1C 1KX4A 3WTPC 3ZG7B 2ZC7A 3G34A 3MBZA 1P3ID 5DF9A 3MGQA 2FJ7C 2XEPA 2XA7M 4B4ZA 1ULYA 4DRAA 4WNNB 1AXBA 3OPPA 2EWVA 2HIOC 1P3BD 3UT9A 2XLNA 2F8NA 3S7NA 2ZLYA 4HQAA 3UDXA 3REKD 2JCHA 1J9MA 3TE8A 3KO6A 5E5AC 3MVDC 2OOLA 4FTXA 4P87A 2P7JA 2P9VB 2FFYA 2ZQ8A 3T1QB 3AV1C 5B1LC 4B88A 2R78A 4HNBA 5DF8A 1XX2A 5FA7A 3BFDA 4X23D 2EX2A 3IXDA 5IT5A 3W96A 4BMWA 2JSSA 5G49A 4LD9B 4LRYC 1NLZA 3MQQA 3Q7ZA 2P74A 1SDEA 3MQOA 3K3CA 1FR1A 3E98A 5EECA 2QJ5A 4WMCA 3VP1A 2BTFP 1TDLA 3AGFA 1H5XA 4BL3A 4NXBA 2F8NK 4FCFA 3X1VC 1IELA 5B31D 2LB9A 4OJOA 3PBQA 1KX5A 2INWA 3G35A 4IBDA 1ZLAA 4PMAA 4JBFA 4X56A 3R7WA 3WRZA 2HDUA 4LD9C 1TF1A 2DCFA 1CI8A 2V20A 3BFGA 4Q0HA 1GA0A 2XQZA 3MF0A 1OJ5A 2PYPA 4CAYB 3G30A 5BO0A 5B32G 3MGPD 4QY6A 1N1JA 2EX6A 3UE0A 3NDEA 2W1TB 1W63Q 5CPJD 5FQ9A 4CSRA 3LYXA 1K54C 2Y2OA 4DMZA 3MGQB 3AGEA 5GT3C 3ZHHA 1KS0A 4WU8A 1W1VA 1OTAA 1YLYA 4BL2A 3C1BA 3UT9B 5AVFA 4XZQA 1S1ZA 5A90A 4FH2A 2F8NB 1EQZD 4EU0A 3WTPE 4KQDA 3HONA 1JTGA 2JN7A 2V0UA 1KGFA 2B18A 3MGSD 3UTAA 5BNXA 1YMSA 5AV8D 3U4LP 5KMWA 2WGWA 3VSLA 3ZG8B 3BFFA 3W96B 4NG2A 5G49B 3REJA 3AZFD 4UA7A 4LCMA 1S66L 5AY8D 5FEFA 3C1CA 1XGIA 3QP8A 4PM6A 1IEMA 4QHCA 4HH2A 4GDNA 4NYUA 2V1AA 1P3MD 4Q0IA 4UQIS 3R4KA 2J9PA 5FDHA 1ACFA 3HJKA 3A3DA 5HL1A 4OOYA 1ZLAB 2JKTI 3R7WB 4IEDA 4AFIA 3W96C 2JKRM 5EE8A 2Y2GA 1Q2PA 3AZGD 4UQIM 1P3PD 1F66C 3AZEA 4OQ0A 1XA7A 5EOOA 3OZHA 3AZLD 2EA9A 2HV1A 5BPVA 1TD5A 1UWPX 3RJUA 5BO0B 4O7DA 2CMNA 1N1JB 1M18D 3S4XA 4WZ4A 4CSRB 2I72A 3MZFA 4OJLA 3Q7VA 1ZLAC 1HQ3A 3LIFA 5F83A 1Q9CA 4WU8B 4GW9A 3B6FD 1P34A 5EVLA 5KDMA 5L2FA 1P3AD 3ITAA 3C1BB 1QMFA 4FUWA 4XZQB 3T1SA 1S32A 4N1XA 4O8GA 4PKYA 1UR9A 3N6IA 5HD5A 1Y4OA 2FN2A 2NUTC 1E6RA 5F99A 1XJ4A 2GX5A 4MBHA 5F68A 3UTAB 2X71A 5AVCD 5BNXB 3OC2A 5GHYA 5TJJA 1G68A 4Q8IA 2WGWB 4E45A 2V2FF 1T19A 3A1IA 4E04A 3CWFA 5CPID 3G6OA 3REJB 5B40C 5B2IC 5JRGA 1NY0A 5G18A 2HDQA 3K3DA 3C1CB 5BT1D 3KSGA 4Z2MG 3WTPD 2X01A 3VOZA 2BYKA 1G6AA 1P3FA 4NK3A 4EEPA 4YS3A 1VQQA 1FCNA 3GSGA 3UMEA 4CQHA 5AV9A 4I5SA 3UTAC 1IOUA 2ZM8A 3C8CA 4HBUA 1Y54A 1BUEA 2B95A 1MBLA 4NKPA 3N4IA 5E5AD 3MVDD 1XJ6A 3NI9A 1DP8A 3AV1D 1TAFA 2W3DA 5B1LD 3C1CC 3AZEB 4R38A 3NOUC 1HLUP 4S2KA 4IBBA 4M4XA 1BLCA 2X02A 4J8UC 2XGNA 4HBTA 2O0YA 4U3TA 4DN0A 3GVBA 3NCKA 1XXMA 3VSKA 3LI9A 3S7OA 3FV7A 3HUOA 4WL9A 2ZY5A 4GCZA 3KUYA 1Z6FA 3Q7VB 1YKDA 3IWIA 4I39A 1F5MA 1O7EA 1SDNA 1P3GA 2JKGA 1C3BA 3A6NA 1E8BA 3X1VD 1P34B 5KDMB 2A3UA 1R4VA 3LR4A 1S32B 3AZEC 2RTSA 2WKIA 4IBEA 3V50A 3G4PA 3OLOA 3R45A 1KX3A 5F99B 4BBTA 5HARA 4S2MA 1CK3A 1FCMA 3SH8A 4FH4A 3ZCZA 4IBRA 2ZJ9A 3H0LC 3ZVTA 3PBNA 2OV5A 2RVQC 3UO9A 1K56A 1M19D 2HP9A 5TFQA 4ZRRA 1P3KA 4LGWA 5EV0A 1P34C 1YLZA 4II7A 4DXCA 3EWKA 3W97A 4OLGA 5JRGB 1S32C 2QPNA 2BYKB 4OVDA 5F99C 1P3FB 1OPXA 5GT3D 4UUZA 4YS3B 3ITBA 3CLOA 3VOYA 1B67A 4G91C 5AV9B 3IX8A 1IYPA 3UB6A 2XD5A 5L8MA 4YM6A 4L9GA 1S4SA 3IX4A 4OQHA 2HZ5A 3D9YA 3A0SA 1TAFB 4WU9C 1UGUA 4BWIA 5M18A 3E2LA 3EPHA 3M7PA 1P3FC 4E3NA 1ES3A 1RGZA 4EEUA 5AV9C 2OWHA 3KUYB 2YKFA 2VLGA 3MSHA 4JGPA 5C3IB 2WUQA 2ZY2A 3GR2A 4R4RA 1P3GB 4WEKA 1NWZA 3A6NB 2JKTM 4GN2A 4QJGA 3SH9A 5CRFA 2HDRA 3MNNA 1XKZA 1K4EA 1KVLA 2JBFA 1TS0A 3EPLA 3R45B 4LPZA 3LIDA 2JE5A 1KX3B 2VGLS 1YAXA 3W96D 1D06A 4D60A 3WWXA 5GLCA 5I94A 3KUYC 1GA9A 5CEBA 1F66D 3A3JA 2HDSA 1OTEA 3ZGAB 4ESPA 1M40A 5C3IC 5I5LA 4KUDD 4KQRA 2VGLM 1P3GC 1P3KB 3KSIA 4GB7A 3OPHA 4IBJA 4Y2FA 3WS0A 3W97B 4IBGA 4NXFA 4E44A 3L2AA 3FG8A 2ZC3B 1ZLAD 1KX3C 4UUZB 1KVMA 4I3JA 1FOFA 4S2OA 2PAVP 3UY6A 5TBMA 4HGAB 3ZG0A 3Q82A 1WWSA 4GOGA 5M19A 4YM6B 5TR7A 4S2IA 2M7UA 4OPZA 4QD4A 4K08A 3MMHA 1ES2A 1P3KC 2ZQDA 3WAAC 2J3TC 3AZJA 4ZBEA 5HAIA 5F5YA 5GLDA 5FUGA 4X55A 3AN2C 5BS7A 3PYPA 1DJCA 5GHZA 3EPJA 5K5BA 3JYIA 4PM8A 5E2FA 4G3WA 5B40D 1GHIA 1SHVA 3HLDA 4BENA 5B2ID 2ZM5A 2WYXA 2VZWA 3BQAA 1OT9A 3BLMA 3P98A 5FL3A 4H9NA 1P0ZA 1SCWA 3A0VA 1G5UA 3QP4A 3UNWA 3REID 3KX0X 3EGDC 3UTAD 3T1XA 3AFAA 3BY9A 5HWVA 3MNNB 1B6WA 3Q81A 2VGJA 1LI9A 4R8PA 4HIAA 1E6NA 3VE4A 3PBRA 1FCOA 3ZNYA 3KS4A 5CX7A 3LR5A 4LG2A 1CEGA 3UB5P 4J8XC 3C1CD 2CV5C 2CWEA 1FR6A 1MWRA 5AQAA 3LIEA 4J8UD 3SS4A 1M6KA 4IJEA 4IJFA 3MNNC 2WAFA 3KWQA 3BJNA 3C2WA 1S4RA 1YM1A 1GCEA 4YNRA 3CI6A 5CGXA 3VH6T 5FI2A 5TBMB 5F6AA 1W5DA 1N4OA 4R1GA 2JC7A 4RVAA 1VM1A 2ZOIA 4M6BA 4KZBA 3AZHA 3A3EA 4K0WA 1YUEA 5B32A 2OLUA 3H9WA 4DE1A 5EPHA 2OSUA 1RGYA 3LUQA 4R70A 2RVQD 1LHYA 2RIQA 3VE3A 3H82A 1P34D 2KLIA 2HJ9C 3DTKA 3IX3A 1S32D 2F2AC 2PT7A 2BG1A 3IXHA 1JNUA 4JLFA 2DRWA 4P0MA 5DF7A 4Y7PA 5HWTA 2G2WA 1PZRA 4H9NB 1TS6A 1LL9A 1STZA 3E4PA 3L28A 5HDSA 4I38A 3AZMA 1ZG6A 3AFAB 3L27A 5B0ZA 3MXRA 4R8PB 3EOIA 2YFWA 1N9LA 1UR8A 3TRCA 1MY8A 2DF4C 2IO5C 1NRJA 1NYYA 4Z2MH 1YT4A 4WU9D 2PYOC 3VP0A 1ID3D 1J3WA 5DVAA 3DW0A 1P3FD 4WZ5A 4Y13A 3AYWA 2RL3A 3IF6A 4BQMA 4X69A 2YKHA 3KWQB 4X68A 2BYMA 4R8PC 1N9OA 2ZM2A 3IT9A 4NFTA 2J8YA 2XSSA 4ID4A 4OOLA 4EBPA 1ES4A 2DNSA 1IYOA 2HPBA 1ZG4A 1JFIA 4PAUA 2WZZA 1ES5A 4MEZA 3WD4A 2UV0E 1YU0A 3JPUA 3GDIA 3AZHB 5HZHA 5F1GA 3VFHA 4E3JA 5B32B 4XUJC 2Y2PA 2WZXA 3RELA 3KWQC 3QP5A 3X1SA 4EW7A 4LRZE 3LI8A 5E2EA 2J8PA 2G5IC 3H82B 1EROA 5GT0A 4KGCA 1HVBA 4E3IA 5B1MB 4MB5A 4Z2JA 4C6YA 3AZHC 2Y2QA 5KIZA 1KX3D 2QKPA 5DTKA 1V9ZA 1GSWA 1CF0A 3IBRA 1E4DA 1MWTA 3AZMB 3TU4A 4JGQA 3M6BA 4EBLA 2OAQ1 5B0ZB 2YFWB 5GSUD 4E3MA 4IBXA 4PM7A 3TG9A 4PM9A 1P3KD 5B33A 3WAAD 2J3TD 3EG5B 3A3FA 3T4OA 5B1MC 3AN2D 1CEFA 1W63M 3QNCA 3W99A 1BH9A 5CHJA 4KZ7A 3AYWB 3AV2A 3AZMC 3NOTC 3IF6B 1CI9A 5FATA 1W79A 2BYMB 1KE3A 4EV4A 2PYRA 2VGKA 5GXQB 3LCEA 3NQUA 5AV5A 2EX9A 3UN7A 1KX4B 4U0TA 2AROA 1JFIB 3FYZA 1L0DA 2I9VA 2VV6A 3KSHA 3WS1A 4WZ5C 3UTBA 3OOVA 1KGEA 3V3RA 1OTDA 3NHQA 4JXGA 3AYWC 2QWSA 4J8VA 4NYYA 3BEBA 4ZUXA 4DJ2A 3RELB 3AZKA 4LV0A 3PBTA 5GXQC 2YFVA 3X1SB 3BECA 5FQKA 4J8XD 2CV5D 3B33A 5HSQA 5AV6A 2HF6A 5HL6A 3NULA 4NETA 4R4SA 1KX4C 3H0RC 5GT0B 4KGCB 4Y15A 3MGQC 4Z5TA 3MR0A 3JVUA 4OOMA 3A0RA 3UT9C 3ZYTA 1OT6A 4IJGA 3TU4B 1W2EA 1K57A 2NZDA 1TZYA 5KZHA 3DAVA 5B33B 1NRFA 3IHBA 1KX5B 5GT0C 4KGCC 1QMEA 3X1TA 3SW1A 1E25A 1TEMA 1E15A 3H0MC 5U47A 3W99B 4UA6A 3CAXA 1D1JA 1ERMA 1EWZA 4JXSA 4HESA 1XJ3A 4WLAA 1L0EA 3AV2B 2PR5A 2ZY3A 3OPLA 2HP6A 3VP4A 4E3OA 2D01A 5G4YA 4DQYB 3WA9A 2ZD8A 1EW0A 3SOIA 4NE6A 3NQUB 5AV5B 4OP8A 5B33C 1KOUA 2Z2LB 1KX5C 1ESIA 1PNEA 1DRMA 5E43A 4MB4A 3LO7A 3PAGA 1EAKA 3DTMA 4DRBA 4HMEA 4DDYA 4WUJA 3AZIA 4J8VB 4YWZA 3MXQA 3VOLA 4ZUXB 4WF0A 3KSYA 3AZKB 2NQBD 3WS4A 1HTAA 2YFVB 2PYOD 4R3JA 3HLCA 3LZ1A 1O07A 4JF6A 5AV5C 3LR3A 5AV6B 1L0FA 1KU5A 1XP4A 4OP5A 1T1BA 3IP4C 3MGRA 3NECA 3IH8A
chains in the Genus database with same CATH topology
1P3LA 3FKWA 4Z5TB 1L2SA 4WU8C 4R8PD 5A91A 4J8WA 1NZOA 3IQAA 4M3KA 5CPKA 3C1BC 1NZUA 4XZQC 5GHXA 4J8VC 3ZFZA 3LJAA 3AZKC 4NE3A 3O88A 2FJ7D 4JF4A 3REHA 2NZDB 1TZYB 5AV6C 1U35A 1E3UA 2HIOD 3B0BA 3B6GA 4XUJD 3X1TB 4Z5TC 3KWQD 3W98A 4XUZA 2J7VA 3EQUA 3REJC 1LI0A 3QHYA 4BD1A 3O3VA 3IF5A 3VH6A 3WA9B 2NZDC 1AOIA 2HP5A 1JWPA 3O86A 4AWLB 4BJPA 4MBKA 2WK0A 4OPQA 4NZ5A 3X1TC 1HQ3B 1P3IA 2EXBA 3G2YA 3NQJA 3AZIB 2UWXA 2PU2A 4S2NA 3VH5T 3REKA 5B1MD 3WKJA 1ONHA 3LZ1B 4LD9D 4AWLC 3AZNA 4DKIA 1PW1A 1NYMA 3MGRB 5CTMA 1P3LB 3A3IA 1HQ3C 4ZTKA 4F94A 3FKVA 3V39A 3QNBA 4X23A 4J8WB 5CPKB 3E2KA 3C5AA 3AZIC 2PU4A 4N1HA 4RX3A 3LJAB 4KZ6A 5CTNA 1XGJA 3IXBA 3KXBA 3REHB 4WELA 3LZ0A 1U35B 4R23A 3MGRC 3B6GB 1GHMA 3FKEA 3AYWD 1W8QA 4S2PA 2A49A 1TVFA 3W98B 5GXQD 4J8WC 4MBFA 2ZMAA 5CPKC 5JRGC 3MFDA 1BH8A 5B2JA 1KX4D 3L29A 4WBGA 4XUXA 2HUEB 4IVKA 3MGQD 1JWVA 4YS3C 3REHC 1U35C 1AOIB 4C3QA 5AQ7A 3MGPA 3PBOA 4DRTA 3UT9D 3VP3A 3B6GC 2F8ND 5CPJA 3HLGA 5FAPA 1P3IB 3W98C 4MLLA 3ZG9B 2IWBA 3NQJB 4GZBA 3GQZA 1MXOA 5GT0D 1K25A 1EQZA 1JVJA 3REKB 3X1UA 3WKJB 3CJMA 1BTLA 4JJNA 1PYYA 1BLPA 3Q07A 3AZNB 4JXWA 3MGSA 4CPKA 3UPPA 3VH6W 4WMCD 3NY4A 4UAAA 5AVBA 5AV8A 4X23B 2XDMA 3A6NC 3V9RA 3G2ZA 1KDWA 3AZFA 1ZC2A 5B0YA 4S2NC 1KX5D 2XFTA 4DXBA 2W8SA 3WKJC 3IHAA 3KXBB 5F1FA 3LZ0B 3AZNC 2Y4AA 1K55A 1P3MA 1PI5A 2ZC5B 3B3XA 4KZ5A 2ZQ9A 4X23C 5FQQA 5CECA 3GV9A 3N8SA 1KE4A 3B0CT 3W97C 4S2JA 5AV5D 3AZGA 1BH8B 5TGFA 5B2JB 1H3OA 3CMZA 3WS2A 2PBYA 1MPLA 4GD6A 3NBLA 3KXBC 4G92B 4WU8D 3LZ0C 4HGAC 2IWDA 4OJ6A 4EBNA 3MGPB 4YM6C 3C1BD 4E6XA 4XZQD 1JWZA 4LV3A 1WYCA 4J8VD 5CPJB 5GL9A 4ZDXA 1YU2A 2Y2MA 5HW3A 4DDSA 1MKIA 3HLEA 3B6FA 5B2JC 1P3AA 1ONGA 1EQZB 3X1UB 4G92C 3ZDJA 3BFCA 4JJNB 3REJD 3MGPC 3GRJA 4BD0A 1PWDA 5AVCA 3KFUG 2XH9A 5GLBA 4MNRA 5AVBB 5AV8B 5B31G 3V9RB 2NZDD 5CPIA 3AZFB 3B0DB 5B0YB 5CHUA 1FQGA 4KQQA 3X1UC 5BNVA 2Y2JA 4QB8A 4JJNC 1PZPA 4GKUA 1P3MB 1IKIA 3AZED 1FSYA 5AVBC 2WKEA 5JYOA 3AZJB 5E5AA 3LY4A 5FUGB 3AZGB 5B0YC 3AL0C 1H3OB 3AV1A 2XR0A 5B1LA 4OLDA 1BULA 2Y59A 1HQ3D 4IBKA 1K55C 2EFXA 4Y0UA 2EXAA 3AZID 5JA4A 5F99D 3AZJC 3G32A 3O62A 4JF5A 5CXWA 3X1VA 3B6FB 5BS7C 3RXXA 1P3AB 4KG6A 2Y2LA 3MGRD 1BT5A 4X6TA 4EQIA 5FI6A 4K91A 3C7UA 2ZC4B 4J8WD 4UA9A 5M1AA 5FASA 5JRGD 1KGGA 5AVCB 3L25A 3VMAA 1M19A 4YS3D 4XXRA 3REHD 1E3UD 5CPIB 5AV9D 4A5RA 4BLMA 3AFAC 1P3AC 3B6GD 1T3UA 3M2JA 1K54A 5BNVB 3ZG5A 4B4XA 4X53A 5GT3A 4OQGA 1KDSA 4EUZA 4KENB 5CGWA 3VP2A 3FWLA 1H8YA 5F82A 4R0QA 5E5AB 4OKPA 5CERA 3LY3A 4RA7A 4OONA 3AV1B 3KUYD 5B1LB 2XFSA 4N9LA 4QNLA 5B24A 4ZBJB 2Y2HA 1P3GD 3C4PA 3A6ND 3HREA 3UDIA 2XK1A 5JA4B 3M2KA 3VH5A 1DY6A 3WKJD 1PI4A 3O62B 3LEZA 5B32C 1EI5A 3HUNA 4QY5A 3AZND 3X1VB 5DTSA 1YU3A 1LLBA 1K56D 4ZBJC 4S2LA 4EO5B 1FSWA 1NXYA 1DJBA 3W97D 5HAPA 1YU4A 1K6SA 1F66A 1M19B 4KUDA 3GTCA 3O62C 4KG2A 3KXBD 3PAEA 4IBIA 3LZ0D 3MKFA 4WV4B 4YM6D 5B0ZC 2Y2NA 3HUMA 2WKHA 4RYEA 4E6WA 5GT3B 4EO5C 4WJ3C 4RX2A 5B2JD 4WZSB 1A7WA 1M19C 1SKFA 3I7JA 2OLVA 5DTTA 3W4OA 3IF6C 3N8RA 2FFFB 4NZ4A 2XF3A 5B24B 2WAEA 4NE5A 2IOUA 3HLBA 1YQSA 3AGDA 3MNND 5B40A 5EVIA 5B2IA 4Z66A 4OUIA 3CG5A 4DE0A 3X1UD 4H9SA 3O87A 4JJND 1IKGA 3RELC 5CP6A 3REIA 3LELA 4NY2A 3X1SC 3TSGA 3W4PA 5AVBD 1K6RA 5B24C 1N9BA 5DNNA 3OCNA 5B0YD 2G2UA 3HBRA 3IWQA 1BH9B 1F66B 5BOHA 2H0TA 4KUDB 4J8UA 1ZKJA 4PM5A 3TU4C 3EQVA 4E3KA 3VH5W 4YFMA 1OMEA 2DQNC 3AZJD 4WM9A 2AROB 3MZEA 4DF6A 1BFMA 2J9OA 3W99C 4GD8A 3UTBB 1PZOA 4KUDC 1KE0A 3AV2C 4K0XA 2F8NG 2ZC6B 1Z2CB 5FI7A 1IYSA 4P6BA 1U60A 1W8YA 2B5RA 2C6WB 1P3OA 3D4FA 4KZ9A 3WX7A 2IWCA 4JXVA 3C7VA 2AROC 3DWKA 2H10A 3AFAD 3HLWA 5DNMA 1JTDA 4LV2A 5B40B 4OJPA 5EVIB 5B2IB 5FQJA 4Z66B 4H8RA 5HFOA 3UTBC 1YMXA 2C5WB 4ZUXC 5CP6B 3REIB 3LELB 5HX9A 4P85A 4QLCA 3S1YA 4OPRA 1BLHA 3BFEA 3OCLA 3N3FA 1ALQA 5FAOA 5DNNB 5GLAA 5EVIC 1M1AA 3PBSA 4Z66C 4WU9A 3L26A 2Y55A 1ID3A 4H9SC 4J8UB 3C4OA 5CP6C 3UPOA 3REIC 3LELC 3HLFA 1K57C 5CGSA 1ERQA 1TZYC 1BZAA 3SS5A 2QZ6A 3AZHD 1F1EA 5DNNC 5B32D 4H9OA 4KQOA 3WS5A 4ZJ1A 1PW8A 5JYPA 5AQBA 2L5AA 1P3BA 1MWSA 3Q1FA 4FD8A 3WA9C 2ZY4A 3UE1A 1P3OB 1TDGA 5E2HA 3BM6A 3A1KA 1RP5A 3O62D 4IBCA 3AZMD 5DNMB 2Y91A 2QMIA 2ZQ7A 5B0ZD 3M6HA 1BLSA 4KZ3A 3BRMA 3B0CW 3NIAA 4YINA 4DE3A 5A93A 4G91B 4QLCB 1P3OC 3LZ1C 2XD1A 2WADA 5GSUA 4C75A 5B31A 1K38A 3WAAA 1P3LC 3WRTA 5DNMC 1M1AB 1WWIA 4E3LA 4WU9B 5FAQA 3AN2A 5EUAA 1ID3B 3MKEA 5J8XA 3IH9A 3UDFA 3LJAC 5KSCA 1H8ZA 3NDGA 4QLCC 2E8IA 1Q2QA 4N9KA 1XA1A 1WE4A 4LV1A 4GDBA 4H9OB 3VFFA 5A92A 3RELD 1M1AC 3CZDA 3X1SD 1NJ4A 2ZQCA 1ID3C 4L0LA 4PPRA 5B24D 1P3BB 3N7WA 4DE2A 2HUEC 4KGCD 1DJAA 4H9RA 4IBFA 4WEJA 1AOIC 4OJ5A 4J8XA 2CV5A 2H5SA 1LL5A 4KZ4A 3TU4D 1P3IC 4GHAA 4H9QA 3P09A 4UPKA 1YLJA 1P3BC 5B33D 4KHAA 5AY8A 1ESUA 3REKC 3V3SA 3W99D 5GSUB 3MXSA 1I5QA 4OPYA 5B31B 1YLWA 4KZAA 3W8KA 3UE3A 3WAAB 3AV2D 4H9PA 1RCJA 1MWUA 4OH0A 3HVFA 3AN2B 4ZJ3A 3ZNTA 1P3PA 2Z2MB 2AROD 4KG5A 3FDDA 3MZDA 3AZLA 1YLTA 5FQIA 2R9WA 5GSUC 3V5MA 3UTBD 5B31C 1M18A 3FZCA 4ZUXD 3AZKD 2R9XA 5AV6D 5CHLB 3IWOA 4NZ3A 4OQIA 3P5JB 1IYQA 3HL9A 4H9RB 4Z5TD 4IVIA 5EVID 2NQBA 4HEFA 3KS8A 3ISGA 4Z66D 3IXGA 2WGIA 4J8XB 2PYOA 2CV5B 5HAQA 3HSHA 2RCXA 2H0YA 4LCLA 3MGSB 5CPJC 1YU1A 3N8LA 3BYDA 2ZQAA 3PTEA 5CP6D 4JKTA 3LELD 4H9QB 1YLPA 3SH7A 1TZYD 2LY8A 4Y0TA 4ZJ2A 4KHAB 4LENA 5DNND 5AY8B 1EQZC 5CHMA 3X1TD 1HTZA 3WTPA 2FJ7A 5FSRA 1S0WA 3UPNA 4GH9A 2HIOA 3MGSC 3RXWA 3TOIA 4H9PB 1XPBA 4EWFA 4R3BA 2Q9MA 5AV8C 4XUJA 3DWZA 3WA9D 4N92A 2GDNA 3MVDA 4JPMA 3AZFC 3F6TA 3B0DC 1P3PB 5AQ9A 5AY8C 1PWGA 4GHLA 1PIOA 4QU3A 5FQMA 2ZM0A 3AZLB 3BLSA 1WYBA 1PWCA 2F8NH 4WNNA 1P3MC 4CJNA 1M18B 4Y0OA 5CEDA 4ZAMA 3GMWA 1K4FA 3W4QA 1P3OD 3LZ1D 4D2OA 3AZGC 1I2WA 2P9VA 1P3PC 3S22A 2WGVA 4Z9QA 1HD8A 5D3OA 3EPKA 2IO5B 4FSFA 1P3LD 3OPRA 2Y2IA 2Q9NA 3AZLC 5DNMD 5KSHA 2V1ZA 2NQBB 5E2GA 5B1MA 4WYYA 2PYOB 5CPKD 3ZVWA 4LD9A 4U0XA 1M18C 1BSGA 3G31A 4KZ8A 1L0GA 3LJAD 4UHUA 2VQRA 4NZ1A 2G5HC 2EX8A 4QLCD 1U35D 3B6FC 2CC1A 1S6RA 1GHPA 3WTPB 1M1AD 2NQBC 1W7FA 3W98D 4GNUA 2FJ7B 2HIOB 5AVCC 3NC8A 1HZOA 2Y2KA 2EFUA 4XUJB 5EOEA 2BLSA 4CAYA 3MVDB 1AOID 5CPIC 5GXQA 5IHVA 1I2SA 5BT1C 1KX4A 3WTPC 3ZG7B 2ZC7A 3G34A 3MBZA 1P3ID 5DF9A 3MGQA 2FJ7C 2XEPA 4B4ZA 1ULYA 4DRAA 4WNNB 1AXBA 3OPPA 2HIOC 1P3BD 3UT9A 2XLNA 2F8NA 2ZLYA 3UDXA 3REKD 2JCHA 1J9MA 5E5AC 3MVDC 4P87A 2P9VB 2FFYA 2ZQ8A 3AV1C 5B1LC 4B88A 5DF8A 1XX2A 5FA7A 3BFDA 4X23D 2EX2A 3IXDA 3W96A 2JSSA 5G49A 4LD9B 3Q7ZA 2P74A 1SDEA 1FR1A 5EECA 4WMCA 3VP1A 1TDLA 3AGFA 1H5XA 4BL3A 2F8NK 4FCFA 3X1VC 1IELA 5B31D 4OJOA 3PBQA 1KX5A 3G35A 4IBDA 1ZLAA 4PMAA 4JBFA 4X56A 3WRZA 2HDUA 4LD9C 2DCFA 1CI8A 2V20A 3BFGA 1GA0A 2XQZA 4CAYB 3G30A 5BO0A 5B32G 3MGPD 4QY6A 1N1JA 2EX6A 3UE0A 3NDEA 5CPJD 5FQ9A 4CSRA 1K54C 2Y2OA 3MGQB 3AGEA 5GT3C 3ZHHA 4WU8A 1YLYA 4BL2A 3C1BA 3UT9B 4XZQA 5A90A 4FH2A 2F8NB 1EQZD 3WTPE 3HONA 1JTGA 1KGFA 3MGSD 3UTAA 5BNXA 1YMSA 5AV8D 5KMWA 2WGWA 3VSLA 3ZG8B 3BFFA 3W96B 5G49B 3REJA 3AZFD 4UA7A 4LCMA 5AY8D 3C1CA 1XGIA 4PM6A 1IEMA 4QHCA 4GDNA 4NYUA 1P3MD 2J9PA 5FDHA 3A3DA 5HL1A 4OOYA 1ZLAB 4IEDA 3W96C 5EE8A 2Y2GA 1Q2PA 3AZGD 1P3PD 1F66C 3AZEA 4OQ0A 1XA7A 5EOOA 3OZHA 3AZLD 5BPVA 3RJUA 5BO0B 4O7DA 1N1JB 1M18D 3S4XA 4WZ4A 4CSRB 2I72A 3MZFA 4OJLA 3Q7VA 1ZLAC 1HQ3A 5F83A 1Q9CA 4WU8B 3B6FD 1P34A 5EVLA 5KDMA 5L2FA 1P3AD 3ITAA 3C1BB 1QMFA 4XZQB 1S32A 4N1XA 3N6IA 5F99A 4MBHA 3UTAB 2X71A 5AVCD 5BNXB 3OC2A 5GHYA 1G68A 4Q8IA 2WGWB 4E45A 2V2FF 3A1IA 5CPID 3REJB 5B40C 5B2IC 5JRGA 1NY0A 5G18A 2HDQA 3C1CB 5BT1D 4Z2MG 3WTPD 2X01A 3VOZA 2BYKA 1G6AA 1P3FA 4NK3A 4YS3A 1VQQA 1FCNA 3GSGA 5AV9A 3UTAC 2ZM8A 4HBUA 1Y54A 1BUEA 1MBLA 3N4IA 5E5AD 3MVDD 3NI9A 3AV1D 1TAFA 5B1LD 3C1CC 3AZEB 4S2KA 4IBBA 1BLCA 2X02A 4J8UC 2XGNA 4HBTA 4U3TA 3GVBA 3NCKA 1XXMA 3VSKA 3FV7A 3HUOA 2ZY5A 3KUYA 1Z6FA 3Q7VB 3IWIA 1O7EA 1SDNA 1P3GA 1C3BA 3A6NA 3X1VD 1P34B 5KDMB 2A3UA 1R4VA 1S32B 3AZEC 2WKIA 4IBEA 3V50A 3G4PA 3R45A 1KX3A 5F99B 5HARA 4S2MA 1CK3A 1FCMA 3SH8A 4FH4A 3ZCZA 4IBRA 2ZJ9A 3H0LC 3ZVTA 3PBNA 2OV5A 2RVQC 3UO9A 1K56A 1M19D 2HP9A 5TFQA 1P3KA 1P34C 1YLZA 4DXCA 3W97A 4OLGA 5JRGB 1S32C 2QPNA 2BYKB 4OVDA 5F99C 1P3FB 5GT3D 4UUZA 4YS3B 3ITBA 3VOYA 1B67A 4G91C 5AV9B 1IYPA 2XD5A 4YM6A 4OQHA 1TAFB 4WU9C 5M18A 3E2LA 3EPHA 1P3FC 4E3NA 1ES3A 1RGZA 5AV9C 3KUYB 5C3IB 2WUQA 2ZY2A 3GR2A 4R4RA 1P3GB 4WEKA 3A6NB 4GN2A 4QJGA 3SH9A 5CRFA 2HDRA 3MNNA 1XKZA 1K4EA 1KVLA 2JBFA 3EPLA 3R45B 2JE5A 1KX3B 3W96D 3WWXA 5GLCA 5I94A 3KUYC 1GA9A 5CEBA 1F66D 3A3JA 2HDSA 3ZGAB 1M40A 5C3IC 4KUDD 4KQRA 1P3GC 1P3KB 4GB7A 3OPHA 4IBJA 3WS0A 3W97B 4IBGA 4E44A 3L2AA 2ZC3B 1ZLAD 1KX3C 4UUZB 1KVMA 1FOFA 4S2OA 3UY6A 4HGAB 3ZG0A 3Q82A 1WWSA 4GOGA 5M19A 4YM6B 5TR7A 4S2IA 4OPZA 4QD4A 1ES2A 1P3KC 2ZQDA 3WAAC 3AZJA 4ZBEA 5HAIA 5GLDA 5FUGA 4X55A 3AN2C 5BS7A 1DJCA 5GHZA 3EPJA 3JYIA 4PM8A 5E2FA 5B40D 1GHIA 1SHVA 3HLDA 4BENA 5B2ID 2ZM5A 2WYXA 3BLMA 3P98A 4H9NA 1SCWA 3UNWA 3REID 3UTAD 3AFAA 3MNNB 1B6WA 3Q81A 2VGJA 1LI9A 4R8PA 3PBRA 1FCOA 3ZNYA 3KS4A 4LG2A 1CEGA 4J8XC 3C1CD 2CV5C 2CWEA 1FR6A 1MWRA 5AQAA 4J8UD 3SS4A 1M6KA 4IJEA 4IJFA 3MNNC 2WAFA 3KWQA 1YM1A 1GCEA 5CGXA 3VH6T 5FI2A 1W5DA 1N4OA 4R1GA 2JC7A 4RVAA 1VM1A 4KZBA 4M6BA 3AZHA 3A3EA 4K0WA 1YUEA 5B32A 2OLUA 4DE1A 5EPHA 2OSUA 1RGYA 2RVQD 1LHYA 2RIQA 1P34D 1S32D 2F2AC 2BG1A 3IXHA 4JLFA 2DRWA 4P0MA 5DF7A 4Y7PA 2G2WA 1PZRA 4H9NB 1LL9A 3L28A 3AZMA 1ZG6A 3AFAB 3L27A 5B0ZA 3MXRA 4R8PB 2YFWA 1MY8A 2DF4C 2IO5C 1NYYA 4Z2MH 1YT4A 4WU9D 2PYOC 3VP0A 1ID3D 5DVAA 3DW0A 1P3FD 4WZ5A 3AYWA 2RL3A 3IF6A 4BQMA 4X69A 3KWQB 4X68A 2BYMA 4R8PC 2ZM2A 3IT9A 4NFTA 2J8YA 4OOLA 4ID4A 4EBPA 1ES4A 2DNSA 1IYOA 2HPBA 1ZG4A 1JFIA 2WZZA 1ES5A 4MEZA 1YU0A 3AZHB 5F1GA 3VFHA 4E3JA 5B32B 4XUJC 2Y2PA 2WZXA 3RELA 3KWQC 3X1SA 5E2EA 2J8PA 2G5IC 1EROA 5GT0A 4KGCA 1HVBA 4E3IA 5B1MB 4C6YA 3AZHC 2Y2QA 1KX3D 5DTKA 1E4DA 1MWTA 3AZMB 3TU4A 3M6BA 4EBLA 5B0ZB 2YFWB 5GSUD 4E3MA 4IBXA 4PM7A 3TG9A 4PM9A 1P3KD 5B33A 3WAAD 3EG5B 3A3FA 5B1MC 3AN2D 1CEFA 3QNCA 3W99A 1BH9A 5CHJA 4KZ7A 3AYWB 3AV2A 3AZMC 3IF6B 1CI9A 5FATA 1W79A 2BYMB 1KE3A 4EV4A 2VGKA 5GXQB 3LCEA 3NQUA 5AV5A 2EX9A 3UN7A 1KX4B 4U0TA 2AROA 1JFIB 3FYZA 1L0DA 3WS1A 4WZ5C 3UTBA 1KGEA 3V3RA 4JXGA 3AYWC 4J8VA 4NYYA 3BEBA 4ZUXA 3RELB 3AZKA 4LV0A 3PBTA 5GXQC 2YFVA 3X1SB 3BECA 5FQKA 4J8XD 2CV5D 5AV6A 4NETA 4R4SA 1KX4C 3H0RC 5GT0B 4KGCB 3MGQC 4Z5TA 4OOMA 3UT9C 3TU4B 1W2EA 1K57A 2NZDA 1TZYA 5KZHA 5B33B 1NRFA 3IHBA 1KX5B 5GT0C 4KGCC 1QMEA 3X1TA 1E25A 1TEMA 3H0MC 5U47A 3W99B 4UA6A 1ERMA 1EWZA 4JXSA 4HESA 1L0EA 3AV2B 2ZY3A 3OPLA 2HP6A 3VP4A 4E3OA 4DQYB 3WA9A 2ZD8A 3SOIA 4NE6A 3NQUB 5AV5B 4OP8A 5B33C 2Z2LB 1KX5C 1ESIA 5E43A 3LO7A 3PAGA 3DTMA 4DRBA 4DDYA 3AZIA 4J8VB 4ZUXB 3KSYA 3AZKB 2NQBD 3WS4A 1HTAA 2YFVB 2PYOD 4R3JA 3HLCA 3LZ1A 1O07A 4JF6A 5AV5C 5AV6B 1L0FA 1KU5A 1XP4A 4OP5A 3SS3A 3IP4C 3MGRA 3IH8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FKW A;  5AQ9 A;  3GTC A;  1L2S A;  4KG2 A;  1PWG A;  3PAE A;  5A91 A;  1NZO A;  3IQA A;  1PIO A;  3MKF A;  4M3K A;  4QU3 A;  2ZM0 A;  5FQM A;  3BLS A;  1NZU A;  2WUQ A;  3GR2 A;  5GHX A;  1WYB A;  4R4R A;  2Y2N A;  4WEK A;  1PWC A;  4GN2 A;  3ZFZ A;  4QJG A;  3HUM A;  5CRF A;  3SH9 A;  4CJN A;  2HDR A;  5CED A;  2WKH A;  4Y0O A;  3O88 A;  4ZAM A;  4RYE A;  4E6W A;  1XKZ A;  4JF4 A;  1K4E A;  1KVL A;  2JBF A;  4RX2 A;  1E3U A;  3GMW A;  2JE5 A;  1K4F A;  3W4Q A;  4D2O A;  3S22 A;  1I2W A;  2P9V A;  3WWX A;  2WGV A;  4Z9Q A;  5GLC A;  1HD8 A;  4XUZ A;  5I94 A;  1GA9 A;  5D3O A;  1SKF A;  2J7V A;  2OLV A;  3EQU A;  3A3J A;  3I7J A;  4FSF A;  2HDS A;  5DTT A;  3W4O A;  3OPR A;  1LI0 A;  2Y2I A;  3IF6 C;  2Q9N A;  3N8R A;  1M40 A;  2FFF B;  3ZGA B;  5KSH A;  2V1Z A;  4KQR A;  5E2G A;  3QHY A;  4GB7 A;  4WYY A;  3OPH A;  4BD1 A;  3O3V A;  3ZVW A;  3IF5 A;  4U0X A;  3WS0 A;  2XF3 A;  1BSG A;  2WAE A;  3G31 A;  4KZ8 A;  1L0G A;  4UHU A;  2HP5 A;  1JWP A;  3HLB A;  1YQS A;  2ZC3 B;  3AGD A;  3O86 A;  4MBK A;  4BJP A;  5EVI A;  2EX8 A;  2WK0 A;  4OPQ A;  1KVM A;  1FOF A;  3CG5 A;  4S2O A;  3UY6 A;  4DE0 A;  3ZG0 A;  3Q82 A;  4GOG A;  5M19 A;  2CC1 A;  5TR7 A;  4S2I A;  3O87 A;  1IKG A;  1S6R A;  2EXB A;  1GHP A;  4OPZ A;  4QD4 A;  1W7F A;  3G2Y A;  1ES2 A;  2ZQD A;  4GNU A;  2PU2 A;  2UWX A;  3TSG A;  3W4P A;  4S2N A;  4ZBE A;  5HAI A;  1K6R A;  5GLD A;  4X55 A;  1N9B A;  1DJC A;  3NC8 A;  1ONH A;  3OCN A;  5GHZ A;  1HZO A;  2Y2K A;  2EFU A;  4DKI A;  3JYI A;  1PW1 A;  2G2U A;  5EOE A;  2BLS A;  1NYM A;  3HBR A;  3IWQ A;  4PM8 A;  5CTM A;  5BOH A;  5E2F A;  3A3I A;  1I2S A;  5IHV A;  4ZTK A;  2H0T A;  1GHI A;  1SHV A;  3FKV A;  3HLD A;  4BEN A;  3V39 A;  4F94 A;  3QNB A;  2WYX A;  1ZKJ A;  4PM5 A;  3ZG7 B;  2ZC7 A;  3BLM A;  3G34 A;  3MBZ A;  3P98 A;  5DF9 A;  3E2K A;  3C5A A;  1SCW A;  3EQV A;  4E3K A;  2XEP A;  2PU4 A;  4N1H A;  4B4Z A;  4RX3 A;  3UNW A;  5CTN A;  4KZ6 A;  1AXB A;  5CEB A;  3OPP A;  4YFM A;  1XGJ A;  1OME A;  3Q81 A;  4WM9 A;  2XLN A;  3IXB A;  2VGJ A;  1LI9 A;  4WEL A;  2ZLY A;  3MZE A;  3UDX A;  3PBR A;  4DF6 A;  2JCH A;  1J9M A;  2J9O A;  4R23 A;  1FCO A;  3ZNY A;  1GHM A;  1W8Q A;  4GD8 A;  4P87 A;  2P9V B;  2FFY A;  4S2P A;  2ZQ8 A;  1PZO A;  2A49 A;  1TVF A;  1KE0 A;  1CEG A;  4B88 A;  4K0X A;  5DF8 A;  4MBF A;  1FR6 A;  1XX2 A;  1MWR A;  2ZC6 B;  2ZMA A;  5FI7 A;  5AQA A;  5FA7 A;  1IYS A;  3MFD A;  3BFD A;  4P6B A;  1U60 A;  1W8Y A;  2EX2 A;  3IXD A;  1M6K A;  3SS4 A;  2B5R A;  2C6W B;  3D4F A;  4KZ9 A;  4WBG A;  4XUX A;  2IWC A;  4IVK A;  4JXV A;  3Q7Z A;  2P74 A;  1JWV A;  1SDE A;  2WAF A;  3C7V A;  1FR1 A;  5EEC A;  4C3Q A;  4WMC A;  3VP1 A;  5AQ7 A;  3DWK A;  1TDL A;  2H10 A;  3AGF A;  1H5X A;  3HLW A;  3PBO A;  1YM1 A;  1JTD A;  4LV2 A;  5EVI B;  3VP3 A;  4BL3 A;  1GCE A;  5FQJ A;  4H8R A;  4FCF A;  5HFO A;  5CGX A;  5FI2 A;  1IEL A;  3HLG A;  1YMX A;  5FAP A;  1W5D A;  1N4O A;  4MLL A;  3ZG9 B;  2C5W B;  4R1G A;  3PBQ A;  2IWB A;  2JC7 A;  4RVA A;  3G35 A;  1VM1 A;  4KZB A;  3A3E A;  5HX9 A;  4K0W A;  4PMA A;  4X56 A;  4JBF A;  4P85 A;  4GZB A;  3S1Y A;  2HDU A;  3GQZ A;  1MXO A;  4OPR A;  3WRZ A;  2OLU A;  1K25 A;  1BLH A;  4DE1 A;  2DCF A;  3BFE A;  1JVJ A;  3OCL A;  1CI8 A;  5EPH A;  2V20 A;  3BFG A;  1ALQ A;  5FAO A;  3CJM A;  1BTL A;  2OSU A;  1GA0 A;  1RGY A;  5GLA A;  1PYY A;  1BLP A;  2XQZ A;  3Q07 A;  1LHY A;  4JXW A;  5EVI C;  3PBS A;  4CPK A;  3UPP A;  4WMC D;  3G30 A;  2Y55 A;  3NY4 A;  4UAA A;  4QY6 A;  2EX6 A;  3UE0 A;  3NDE A;  3C4O A;  2XDM A;  3G2Z A;  2BG1 A;  3IXH A;  5FQ9 A;  1K54 C;  2DRW A;  4JLF A;  4P0M A;  5DF7 A;  3UPO A;  1KDW A;  2Y2O A;  3HLF A;  4Y7P A;  2G2W A;  1ZC2 A;  1K57 C;  1LL9 A;  3AGE A;  5CGS A;  4S2N C;  1ERQ A;  3ZHH A;  1BZA A;  3SS5 A;  2QZ6 A;  2XFT A;  4DXB A;  1ZG6 A;  1YLY A;  4BL2 A;  3IHA A;  5A90 A;  3MXR A;  4FH2 A;  5F1F A;  4KQO A;  3WS5 A;  2Y4A A;  1K55 A;  1MY8 A;  1JTG A;  4ZJ1 A;  1PI5 A;  2ZC5 B;  1PW8 A;  1NYY A;  5JYP A;  5AQB A;  1KGF A;  3B3X A;  4KZ5 A;  2ZQ9 A;  1YT4 A;  5FQQ A;  5CEC A;  3GV9 A;  3N8S A;  3VP0 A;  1MWS A;  1KE4 A;  3Q1F A;  4FD8 A;  5DVA A;  1YMS A;  4S2J A;  5KMW A;  2WGW A;  3DW0 A;  5TGF A;  4WZ5 A;  3UE1 A;  3VSL A;  3CMZ A;  3ZG8 B;  3BFF A;  3IH8 A;  3WS2 A;  2PBY A;  1MPL A;  1TDG A;  4GD6 A;  3BM6 A;  5E2H A;  2RL3 A;  3IF6 A;  4UA7 A;  4BQM A;  4LCM A;  4X69 A;  4X68 A;  1RP5 A;  3NBL A;  2ZM2 A;  2IWD A;  3IT9 A;  1XGI A;  4EBN A;  2J8Y A;  4OOL A;  4ID4 A;  4EBP A;  4PM6 A;  2Y91 A;  1IEM A;  2QMI A;  4QHC A;  4E6X A;  2ZQ7 A;  1ES4 A;  1JWZ A;  3M6H A;  4LV3 A;  1WYC A;  4GDN A;  2DNS A;  1IYO A;  5GL9 A;  2HPB A;  1BLS A;  1ZG4 A;  4ZDX A;  2Y2M A;  2J9P A;  2WZZ A;  1ES5 A;  5FDH A;  4KZ3 A;  5HW3 A;  4MEZ A;  3BRM A;  3A3D A;  4DDS A;  1MKI A;  3HLE A;  3NIA A;  4YIN A;  5HL1 A;  4DE3 A;  5A93 A;  4OOY A;  5F1G A;  1ONG A;  4IED A;  5EE8 A;  3VFH A;  2XD1 A;  4E3J A;  2WAD A;  2Y2G A;  1Q2P A;  2Y2P A;  4C75 A;  2WZX A;  1K38 A;  3ZDJ A;  3BFC A;  4OQ0 A;  1XA7 A;  3WRT A;  5EOO A;  3OZH A;  3GRJ A;  5E2E A;  4BD0 A;  1PWD A;  4E3L A;  5FAQ A;  3RJU A;  5EUA A;  2XH9 A;  4O7D A;  4MNR A;  5GLB A;  1ERO A;  3MKE A;  5J8X A;  1HVB A;  4E3I A;  3S4X A;  3IH9 A;  3UDF A;  4WZ4 A;  4C6Y A;  5KSC A;  2I72 A;  3MZF A;  1H8Z A;  3NDG A;  2Y2Q A;  3Q7V A;  5CHU A;  5DTK A;  1FQG A;  4KQQ A;  5F83 A;  2E8I A;  1Q2Q A;  1E4D A;  1MWT A;  4N9K A;  5EVL A;  5L2F A;  3M6B A;  3ITA A;  4EBL A;  1QMF A;  2Y2J A;  1XA1 A;  4QB8 A;  1WE4 A;  4LV1 A;  4GDB A;  4N1X A;  3VFF A;  5A92 A;  4E3M A;  4IBX A;  3N6I A;  1PZP A;  4PM7 A;  3TG9 A;  4GKU A;  1IKI A;  4PM9 A;  3CZD A;  1NJ4 A;  2ZQC A;  1FSY A;  3A3F A;  4L0L A;  4MBH A;  2WKE A;  4PPR A;  5JYO A;  3N7W A;  2X71 A;  1CEF A;  3OC2 A;  3QNC A;  3LY4 A;  5GHY A;  4DE2 A;  1G68 A;  5CHJ A;  1DJA A;  4Q8I A;  2WGW B;  2V2F F;  4WEJ A;  2XR0 A;  4KZ7 A;  4OLD A;  1BUL A;  2Y59 A;  2H5S A;  3IF6 B;  1LL5 A;  1CI9 A;  4KZ4 A;  5FAT A;  1W79 A;  5G18 A;  1NY0 A;  1KE3 A;  2HDQ A;  4EV4 A;  2VGK A;  1K55 C;  2X01 A;  3VOZ A;  3LCE A;  2EFX A;  4Y0U A;  1G6A A;  2EXA A;  2EX9 A;  4NK3 A;  1VQQ A;  3GSG A;  1FCN A;  3UN7 A;  3P09 A;  4U0T A;  3FYZ A;  1YLJ A;  1L0D A;  4DRT A;  3G32 A;  2ZM8 A;  4HBU A;  4JF5 A;  1ESU A;  1Y54 A;  1BUE A;  5CXW A;  3WS1 A;  4WZ5 C;  1MBL A;  3RXX A;  3V3S A;  1KGE A;  4KG6 A;  3V3R A;  2Y2L A;  3N4I A;  4JXG A;  1BT5 A;  3NI9 A;  3BEB A;  4X6T A;  3MXS A;  1I5Q A;  4LV0 A;  4OPY A;  1YLW A;  4EQI A;  4KZA A;  3PBT A;  3W8K A;  5FI6 A;  3UE3 A;  4K91 A;  3BEC A;  2ZC4 B;  3C7U A;  5FQK A;  4UA9 A;  4S2K A;  5M1A A;  5FAS A;  1RCJ A;  1BLC A;  2X02 A;  1KGG A;  1MWU A;  2XGN A;  4NET A;  4OH0 A;  3HVF A;  4R4S A;  4HBT A;  4U3T A;  3GVB A;  3NCK A;  1XXM A;  4ZJ3 A;  3VSK A;  3ZNT A;  3FV7 A;  3VMA A;  2Z2M B;  3HUO A;  4XXR A;  1Z6F A;  1E3U D;  4A5R A;  4BLM A;  4OOM A;  4KG5 A;  3Q7V B;  3IWI A;  3MZD A;  1YLT A;  1O7E A;  1SDN A;  5FQI A;  3M2J A;  2R9W A;  1C3B A;  3V5M A;  2A3U A;  1K54 A;  3ZG5 A;  4B4X A;  3FZC A;  1K57 A;  4X53 A;  2WKI A;  4OQG A;  3V50 A;  1KDS A;  4EUZ A;  4KEN B;  5KZH A;  3G4P A;  3SS3 A;  5CGW A;  3VP2 A;  1NRF A;  2R9X A;  3IHB A;  5HAR A;  3FWL A;  4S2M A;  1CK3 A;  1QME A;  1FCM A;  1E25 A;  1H8Y A;  1TEM A;  3IWO A;  4FH4 A;  5F82 A;  3SH8 A;  3ZCZ A;  4IBR A;  5U47 A;  4R0Q A;  2ZJ9 A;  3ZVT A;  3PBN A;  4UA6 A;  2OV5 A;  4OKP A;  3UO9 A;  1K56 A;  4OQI A;  1IYQ A;  1ERM A;  1EWZ A;  3HL9 A;  4HES A;  4IVI A;  4JXS A;  5CER A;  2HP9 A;  3LY3 A;  4RA7 A;  5EVI D;  4HEF A;  3ISG A;  4OON A;  5TFQ A;  3IXG A;  2WGI A;  1L0E A;  2XFS A;  4N9L A;  1YLZ A;  3OPL A;  2HP6 A;  5HAQ A;  4DXC A;  2RCX A;  2H0Y A;  3VP4 A;  4E3O A;  4LCL A;  4OLG A;  2Y2H A;  3C4P A;  2ZD8 A;  3N8L A;  3BYD A;  2ZQA A;  3HRE A;  3UDI A;  3PTE A;  3SOI A;  2QPN A;  4JKT A;  4OVD A;  4OP8 A;  2XK1 A;  2Z2L B;  3ITB A;  1YLP A;  3SH7 A;  1ESI A;  5E43 A;  3VOY A;  3M2K A;  1IYP A;  4Y0T A;  1DY6 A;  2XD5 A;  3LO7 A;  4ZJ2 A;  1PI4 A;  4LEN A;  3LEZ A;  5CHM A;  1EI5 A;  3HUN A;  3PAG A;  4QY5 A;  1HTZ A;  3DTM A;  5DTS A;  4DDY A;  5FSR A;  4OQH A;  1S0W A;  1LLB A;  1K56 D;  3UPN A;  3WS4 A;  3RXW A;  3TOI A;  5M18 A;  3E2L A;  1XPB A;  4EWF A;  4R3J A;  4S2L A;  3HLC A;  4R3B A;  1FSW A;  1NXY A;  1O07 A;  2Q9M A;  4JF6 A;  1DJB A;  3DWZ A;  5HAP A;  1L0F A;  4E3N A;  1XP4 A;  4N92 A;  1ES3 A;  4OP5 A;  2GDN A;  4JPM A;  1RGZ A;  1K6S A; 
#chains in the Genus database with same CATH topology
 1P3L A;  3FKW A;  4Z5T B;  1L2S A;  4WU8 C;  4R8P D;  5A91 A;  1LT0 A;  4J8W A;  3QP2 A;  1NZO A;  5L07 A;  3IQA A;  4M3K A;  5CPK A;  1GPF A;  3C1B C;  1NZU A;  4XZQ C;  3KYQ A;  5GHX A;  1ED7 A;  3RFB A;  4J8V C;  1E6P A;  3ZFZ A;  3LJA A;  3AZK C;  2D49 A;  3ULF A;  4NE3 A;  3O88 A;  2FJ7 D;  4JF4 A;  3K2N A;  3REH A;  2NZD B;  1TZY B;  5AV6 C;  1U35 A;  1E3U A;  2HIO D;  3B0B A;  3ZQ5 A;  2V9A A;  3B6G A;  3DTI A;  1GOI A;  4XUJ D;  3X1T B;  4Z5T C;  3KWQ D;  3W98 A;  4XUZ A;  2J7V A;  3EQU A;  3L7H A;  3REJ C;  4I3I A;  1LI0 A;  4X25 A;  4B93 A;  3QHY A;  2PRF A;  4BD1 A;  5A8B A;  3O3V A;  4QWO A;  1H0G A;  3IF5 A;  3VH6 A;  2W27 A;  1PDC A;  3WA9 B;  3B42 A;  2NZD C;  1AOI A;  2HP5 A;  1JWP A;  3O86 A;  4AWL B;  4BJP A;  4MBK A;  1MC0 A;  3FPV A;  2WK0 A;  4OPQ A;  4NZ5 A;  2L4R A;  3X1T C;  3V67 A;  1HQ3 B;  3NJA A;  1A0K A;  1P3I A;  1BYW A;  2EXB A;  3MS6 A;  3G2Y A;  3NQJ A;  2O9C A;  3AZI B;  2UWX A;  2PU2 A;  4S2N A;  3VH5 T;  4PHT A;  3REK A;  5B1M D;  3WKJ A;  5EVE A;  1ONH A;  2ZMV A;  3LZ1 B;  4LD9 D;  4AWL C;  3LR0 A;  3AZN A;  4DKI A;  4EER A;  1PW1 A;  2G7U A;  4RQ9 A;  3KSF A;  1NYM A;  3MGR B;  5CTM A;  1H0M A;  1P3L B;  3A3I A;  1HQ3 C;  1N9N A;  4ZTK A;  4F94 A;  3FKV A;  3V39 A;  3QNB A;  4X23 A;  4J8W B;  3DBA A;  5CPK B;  2O9A A;  4L9E A;  3E2K A;  3C5A A;  3AZI C;  2PU4 A;  4N1H A;  4RX3 A;  3LJA B;  4KUO A;  2V8F A;  3BQ8 A;  4KZ6 A;  5CTN A;  2OWJ A;  3E4O A;  1XGJ A;  3IXB A;  3KXB A;  3REH B;  1CK7 A;  4WEL A;  3LZ0 A;  1U35 B;  4R23 A;  4Y5F A;  3MGR C;  3B6G B;  1GHM A;  4R3A A;  3FKE A;  3AYW D;  1W8Q A;  4S2P A;  2A49 A;  1TVF A;  3W98 B;  2VX8 A;  5GXQ D;  4J8W C;  2A24 A;  4MBF A;  2ZMA A;  5CPK C;  2GJ3 A;  2V8C A;  2ACG A;  4F3L A;  5JRG C;  3MFD A;  1BH8 A;  5B2J A;  1F9I A;  1SZV A;  1KX4 D;  3L29 A;  4WBG A;  4XUX A;  2L0W A;  2HUE B;  4IVK A;  3MGQ D;  1JWV A;  4YS3 C;  4EET B;  3REH C;  1U35 C;  1AOI B;  2B02 A;  4C3Q A;  5AQ7 A;  3MGP A;  3PBO A;  4DRT A;  3UT9 D;  3VP3 A;  3B6G C;  2F8N D;  5CPJ A;  3HLG A;  5FAP A;  1P3I B;  3W98 C;  4MLL A;  3ZG9 B;  2IWB A;  2V5O A;  3NQJ B;  1OJG A;  2GZA A;  4GZB A;  3GQZ A;  1MXO A;  2M1C A;  5GT0 D;  1K25 A;  1EQZ A;  2WKR A;  1JVJ A;  3REK B;  3X1U A;  3WKJ B;  2KOI A;  1BTL A;  3CJM A;  4JJN A;  1PYY A;  1BLP A;  3Q07 A;  3AZN B;  4JXW A;  3MGS A;  4CPK A;  3T4L A;  3VH6 W;  3UPP A;  4WMC D;  3NY4 A;  4UAA A;  5AVB A;  1Y28 A;  5AV8 A;  4P6Z S;  3CPT A;  4X23 B;  4HMD A;  2XDM A;  3A6N C;  3V9R A;  3G2Z A;  3S7Q A;  1KDW A;  4HOI A;  3AZF A;  1ZC2 A;  2D02 A;  5EM0 A;  5B0Y A;  1W1Y A;  4S2N C;  1KX5 D;  4TX8 A;  3L9K A;  2XFT A;  4MN7 A;  4DXB A;  2W8S A;  3WKJ C;  2W0N A;  3IHA A;  3KXB B;  5F1F A;  2VJW A;  3LZ0 B;  3AZN C;  2Y4A A;  1K55 A;  1P3M A;  1PI5 A;  2ZC5 B;  4QPR A;  3B3X A;  4KZ5 A;  2ZQ9 A;  4X23 C;  5FQQ A;  5CEC A;  3GV9 A;  3N8S A;  2A24 B;  1KE4 A;  3B0C T;  3W97 C;  4S2J A;  5AV5 D;  4EXO A;  3AZG A;  4F3L B;  1BH8 B;  3CUE A;  5B2J B;  5TGF A;  1H3O A;  2L1M A;  3CMZ A;  3FC7 A;  3WS2 A;  2PBY A;  1MPL A;  4GD6 A;  2XRN A;  3NBL A;  3KXB C;  4G92 B;  4WU8 D;  3LZ0 C;  4HGA C;  1OGG A;  2IWD A;  4OJ6 A;  4EBN A;  3MGP B;  4YM6 C;  3C1B D;  4E6X A;  4XZQ D;  1JWZ A;  4LV3 A;  1WYC A;  4J8V D;  5AJG A;  5CPJ B;  5GL9 A;  2W3H A;  4MN5 A;  4ZDX A;  1YU2 A;  2Y2M A;  5HW3 A;  4DDS A;  1MKI A;  3HLE A;  1W1P A;  3B6F A;  5B2J C;  1P3A A;  1ONG A;  1EQZ B;  3X1U B;  4G92 C;  3ZDJ A;  4BBV A;  3BFC A;  4JJN B;  3UMD A;  3REJ D;  3MGP C;  1CXW A;  3GRJ A;  4BD0 A;  1PWD A;  5AVC A;  3KFU G;  2XH9 A;  5GLB A;  4MNR A;  5AVB B;  3W2Z A;  5AV8 B;  5B31 G;  3CPT B;  3PXP A;  3V9R B;  2NZD D;  5CPI A;  2A2L A;  2KDK A;  3AZF B;  3B0D B;  5B0Y B;  5CHU A;  1FQG A;  4KQQ A;  4WN5 A;  2IA2 A;  3X1U C;  5BNV A;  2Y2J A;  4QB8 A;  4JJN C;  2WKQ A;  1CJF A;  1PZP A;  4GKU A;  1P3M B;  1O6I A;  1IKI A;  3AZE D;  4X1M A;  2Q0O A;  1V9Y A;  1FSY A;  5AVB C;  2WKE A;  1XFQ A;  5JYO A;  2M7V A;  3PR6 A;  1E6Z A;  3AZJ B;  5E5A A;  3LY4 A;  2VV7 A;  2VK3 A;  5FUG B;  3AZG B;  5B0Y C;  3AL0 C;  1H3O B;  3AV1 A;  2XR0 A;  5B1L A;  4OLD A;  1BUL A;  2Y59 A;  1HQ3 D;  4IBK A;  3BY8 A;  1PRQ A;  5DFY A;  1K55 C;  2EFX A;  4JGO A;  4Y0U A;  1AIW A;  2EXA A;  3AZI D;  4CLC A;  3C30 A;  5JA4 A;  5FEG A;  2NUP C;  1K0K A;  5HWW A;  5F99 D;  3AZJ C;  3G32 A;  3O62 A;  4IUK A;  4JF5 A;  5CXW A;  3X1V A;  3B6F B;  5BS7 C;  3RXX A;  1P3A B;  4KG6 A;  2Y2L A;  3T50 A;  3T4T A;  3MGR D;  1BT5 A;  4X6T A;  4EQI A;  5FI6 A;  1LSX A;  4K91 A;  3C7U A;  2ZC4 B;  4J8W D;  3CIT A;  4UA9 A;  5M1A A;  1F98 A;  5FAS A;  5JRG D;  1KGG A;  5AVC B;  3L25 A;  3RTY A;  3VMA A;  1M19 A;  2FZ0 A;  4YS3 D;  4XXR A;  2E8J A;  3T4S A;  4ETX A;  3U2A A;  3REH D;  1E3U D;  5CPI B;  5AV9 D;  4A5R A;  4BLM A;  3AFA C;  1P3A C;  3B6G D;  1T3U A;  3M2J A;  4MN6 A;  1K54 A;  5BNV B;  3ZG5 A;  4B4X A;  4X53 A;  5GT3 A;  4OQG A;  1KDS A;  4EUZ A;  4KEN B;  2PHY A;  3SS3 A;  5CGW A;  3VP2 A;  4HJ4 A;  3FWL A;  3OBF A;  5EFW A;  1H8Y A;  5F82 A;  4R0Q A;  5E5A B;  3LGO A;  4OKP A;  4KUK A;  5CER A;  1H8P A;  3LY3 A;  4RA7 A;  4OON A;  3AV1 B;  3KUY D;  5B1L B;  2XFS A;  4N9L A;  4QNL A;  5B24 A;  5HPF A;  4ZBJ B;  2Y2H A;  1P3G D;  4XT2 A;  3T12 B;  3C4P A;  3A6N D;  1CQA A;  3HRE A;  4Z1W A;  3UDI A;  4ARZ A;  5DKL A;  4CLC B;  2XK1 A;  5JA4 B;  3UB8 A;  3M2K A;  3VH5 A;  1DY6 A;  3WKJ D;  3WD3 A;  4Z2I A;  1PI4 A;  2Y8H A;  3O62 B;  3HCY A;  5B32 C;  3LEZ A;  1EI5 A;  3HUN A;  4QY5 A;  3AZN D;  3X1V B;  5DTS A;  4GS9 A;  3UB7 A;  1YU3 A;  4MCW A;  1GSV A;  1LLB A;  1K56 D;  1LSV A;  3P01 A;  4ZBJ C;  4S2L A;  4EO5 B;  1FSW A;  1NXY A;  3MQ0 A;  1DJB A;  3W97 D;  4CLC C;  5HAP A;  1YU4 A;  3BWL A;  1K6S A;  1F66 A;  3CHW P;  1M19 B;  1DP6 A;  4KUD A;  3GTC A;  3O62 C;  2VEA A;  4KG2 A;  3KXB D;  3PAE A;  4IBI A;  3LZ0 D;  3MKF A;  4WV4 B;  4YM6 D;  5B0Z C;  2Y2N A;  2PR6 A;  2JHE A;  3HUM A;  4Z2L A;  2WKH A;  3D3O A;  4RYE A;  4E6W A;  5GT3 B;  4EO5 C;  4WJ3 C;  3T4J A;  2Z6C A;  4RX2 A;  4HP4 A;  1L6J A;  5B2J D;  3LIC A;  4WZS B;  1LL8 A;  1J7M A;  1A7W A;  1M19 C;  1SKF A;  3I7J A;  2OLV A;  5DTT A;  1OTI A;  3W4O A;  3IF6 C;  3N8R A;  2MJ6 A;  4IHQ A;  2FFF B;  1D7E A;  4NZ4 A;  2PDR A;  2V0W A;  4O01 A;  2XF3 A;  5B24 B;  2WAE A;  1W1T A;  4NE5 A;  3KYZ A;  4XT2 B;  2PBD P;  1S1Y A;  1YPR A;  4ARZ B;  2IOU A;  3HLB A;  1YQS A;  3E4Q A;  3AGD A;  3MNN D;  1G28 A;  5B40 A;  5EVI A;  5B2I A;  4Z66 A;  4OUI A;  3CG5 A;  4DE0 A;  3S7P A;  3X1U D;  4H9S A;  3O87 A;  4JJN D;  1IKG A;  4Z2K A;  3REL C;  2PD7 A;  5CP6 A;  4GS9 B;  3REI A;  3LEL A;  4NY2 A;  1PFL A;  3X1S C;  3TSG A;  2Z6D A;  3W4P A;  5AVB D;  1K6R A;  5B24 C;  4ETZ A;  1P9R A;  1N9B A;  1DP9 A;  3WD2 A;  3H7W A;  5DNN A;  3OCN A;  5B0Y D;  1VB6 A;  2G2U A;  3HBR A;  3IWQ A;  1BH9 B;  1F66 B;  5BOH A;  2H0T A;  4KUD B;  1S67 L;  4J8U A;  1ZKJ A;  4PM5 A;  3TU4 C;  3UB9 A;  2QJ7 A;  3EQV A;  4CLC E;  4HH3 A;  4E3K A;  3VH5 W;  1G6O A;  2K31 A;  2HGV A;  4YFM A;  1ODV A;  1OME A;  2DQN C;  4ME4 A;  3AZJ D;  4WM9 A;  2BAS A;  1FIL A;  2ARO B;  3MZE A;  3LFV A;  4DF6 A;  1BFM A;  2J9O A;  4Z2H A;  5DFX A;  3W99 C;  4GD8 A;  2PD8 A;  3LIA A;  3UTB B;  1PZO A;  4KUD C;  1KE0 A;  2OAP 1;  3AV2 C;  2J3W A;  4K0X A;  2F8N G;  4MMN A;  1MZU A;  1Z2C B;  2ZC6 B;  5FI7 A;  2FH5 A;  1IYS A;  1H8M A;  4P6B A;  1U60 A;  1W8Y A;  2B5R A;  2C6W B;  1P3O A;  1OGB A;  3D4F A;  4KZ9 A;  5HDD A;  3WX7 A;  1WA9 A;  2IWC A;  4JXV A;  3C7V A;  1P9W A;  2ARO C;  1ZTU A;  3DWK A;  2H10 A;  3AFA D;  3HLW A;  3UE6 A;  5DNM A;  1JTD A;  4LV2 A;  5B40 B;  4OJP A;  5EVI B;  5FDS A;  5B2I B;  5FQJ A;  4Z66 B;  4G3K A;  4H8R A;  5HFO A;  3UTB C;  1GSX A;  1YMX A;  2C5W B;  3EEA A;  4ZUX C;  5CP6 B;  5J4E A;  3REI B;  3LEL B;  5HX9 A;  4P85 A;  4QLC A;  2GNX A;  3S1Y A;  4OPR A;  1BLH A;  3BFE A;  3OCL A;  5L10 A;  3N3F A;  1ALQ A;  5FAO A;  4Y17 A;  3H7W B;  5DNN B;  5GLA A;  4EQ1 A;  2W3F A;  4Z2G A;  1E88 A;  1XFN A;  4LLO B;  5EVI C;  1M1A A;  2ZL1 A;  3PBS A;  4Z66 C;  4WU9 A;  4R6L A;  3L26 A;  2Y55 A;  1ID3 A;  4YOF A;  4H9S C;  4J8U B;  3C4O A;  4B9O A;  5CP6 C;  3UPO A;  3REI C;  3LEL C;  3HLF A;  1K57 C;  3NOP C;  5CGS A;  4NXG A;  5LBR A;  1AWI A;  1ERQ A;  1TZY C;  1BZA A;  3C38 A;  2QZ6 A;  3SS5 A;  3AZH D;  1F1E A;  4O0P A;  1VET A;  5DNN C;  5B32 D;  4H9O A;  4KQO A;  3WS5 A;  4ZJ1 A;  2V1B A;  1PW8 A;  5JYP A;  5AQB A;  2L5A A;  1P3B A;  1MWS A;  1GXD A;  3Q1F A;  4FD8 A;  3WA9 C;  2ZY4 A;  1QO6 A;  4LRX C;  3UE1 A;  4CLC D;  5MC7 A;  3F1N A;  1P3O B;  5J7E A;  1TDG A;  5E2H A;  3BM6 A;  3A1K A;  1NLY A;  1RP5 A;  2H28 A;  3O62 D;  4IBC A;  3QP6 A;  3AZM D;  5DNM B;  2Y91 A;  2QMI A;  4HJ3 A;  4L9F A;  2ZQ7 A;  5B0Z D;  3M6H A;  4Y3I A;  1BLS A;  3LEQ A;  4HY8 A;  4Q0J A;  1YSQ A;  3ICY A;  4KZ3 A;  3WD0 A;  2VA0 A;  3BRM A;  3B0C W;  3NIA A;  4YIN A;  4DE3 A;  5A93 A;  4G91 B;  4QLC B;  1P3O C;  1IFQ A;  3LZ1 C;  2XD1 A;  3BW6 A;  2WAD A;  5GSU A;  4C75 A;  5B31 A;  1K38 A;  3WAA A;  1P3L C;  1VEU A;  3WRT A;  5DNM C;  1M1A B;  2ZL1 B;  1WWI A;  2K2N A;  4E3L A;  4WU9 B;  5FAQ A;  3AN2 A;  3P7N A;  1VHM A;  1P97 A;  5EUA A;  1ID3 B;  3MKE A;  2W3G A;  5J8X A;  3IH9 A;  4JGR A;  4DJ3 A;  3UDF A;  4MB3 A;  5G4Z A;  3LJA C;  3B47 A;  5KSC A;  1H8Z A;  3NDG A;  4HMC A;  4QLC C;  2E8I A;  1Q2Q A;  4N9K A;  1VET B;  1XA1 A;  1WE4 A;  4LV1 A;  4GDB A;  4H9O B;  3VFF A;  5A92 A;  1H0I A;  3REL D;  1M1A C;  3T4K A;  3CZD A;  3X1S D;  5IU1 A;  1NJ4 A;  2ZQC A;  5HD3 A;  1ID3 C;  3TJZ C;  4L0L A;  4PPR A;  5B24 D;  3EEH A;  1UWN X;  1P3B B;  3N7W A;  2KX6 A;  4PKY G;  4DE2 A;  2HUE C;  4KGC D;  1DJA A;  4H9R A;  4NXE A;  4HI4 A;  3SZT A;  3F1N B;  4IBF A;  4WEJ A;  1AOI C;  2DMW A;  4OJ5 A;  3DTE A;  4J8X A;  3O5Y A;  2CV5 A;  2H5S A;  1LL5 A;  1MKM A;  4LFU A;  4KZ4 A;  2Y79 A;  4UEY A;  3F1O A;  3TU4 D;  1P3I C;  4GHA A;  4H9Q A;  2XRO A;  3P09 A;  4UPK A;  4FOF A;  1YLJ A;  1P3B C;  5B33 D;  2JKF A;  5AVE A;  4KHA A;  5AY8 A;  2VV8 A;  1ESU A;  1TS8 A;  3REK C;  4P6Z M;  3V3S A;  3W99 D;  4IUH A;  5GSU B;  3MXS A;  1I5Q A;  4OPY A;  5B31 B;  1YLW A;  4KZA A;  2HJE A;  3W8K A;  3UE3 A;  3WAA B;  3AV2 D;  4H9P A;  4H6J A;  5IS1 A;  1VEU B;  2ZMF A;  1RCJ A;  2P04 A;  2J80 A;  2ZOH A;  4GLQ A;  3KYE A;  1MWU A;  4OH0 A;  3HVF A;  3AN2 B;  4EES A;  4MDZ A;  3MQL A;  4ZJ3 A;  3ZNT A;  1P3P A;  3WD1 A;  2Z2M B;  2ARO D;  2QHK A;  4KG5 A;  3FDD A;  3MZD A;  3AZL A;  3IBJ A;  1YLT A;  4GHI A;  5FQI A;  2R9W A;  5GSU C;  3V5M A;  3UTB D;  2P08 A;  5F69 A;  5B31 C;  1M18 A;  3FZC A;  4ZUX D;  3AZK D;  3F1P A;  2R9X A;  2O9B A;  2K7S A;  3IS2 A;  5AV6 D;  3FPW A;  5CHL B;  3IWO A;  4GJ4 A;  4NZ3 A;  4OQI A;  3P5J B;  1IYQ A;  3HL9 A;  4H9R B;  4Z5T D;  4IVI A;  5EVI D;  2NQB A;  3T1R A;  4HEF A;  3KS8 A;  3ISG A;  4HP9 A;  4Z66 D;  3IXG A;  2WGI A;  1Z09 A;  4J8X B;  2PYO A;  2CV5 B;  5HAQ A;  2VKS A;  4EUV A;  3HSH A;  2RCX A;  2H0Y A;  4HHD A;  4LCL A;  3MGS B;  2WKP A;  5CPJ C;  1YU1 A;  3N8L A;  3BYD A;  2ZQA A;  3F1O B;  3PTE A;  5CP6 D;  4JKT A;  3LEL D;  4H9Q B;  1YLP A;  3SH7 A;  1TZY D;  2LY8 A;  4Y0T A;  3TW8 A;  4ZJ2 A;  1H3Q A;  5C5K A;  4KHA B;  4LEN A;  5DNN D;  2AVX A;  5AY8 B;  1EQZ C;  5CHM A;  3X1T D;  1HTZ A;  3WTP A;  3T4Q A;  3E0Y A;  2FJ7 A;  5FSR A;  1S0W A;  4G3V A;  3UPN A;  4GH9 A;  1L3L A;  2HIO A;  3MGS C;  3RXW A;  3TOI A;  4H9P B;  5HDC A;  1XPB A;  4H6J B;  5DKK A;  4EWF A;  4R3B A;  2Q9M A;  5AV8 C;  4XUJ A;  3DWZ A;  3WA9 D;  1XJ2 A;  4N92 A;  2GDN A;  3MVD A;  4JPM A;  1SKO A;  3AZF C;  3F6T A;  2QYB A;  3B0D C;  1P3P B;  5AQ9 A;  3RH8 B;  5HPI A;  5AY8 C;  3LIB A;  5J3W A;  1PWG A;  2W1R A;  4GHL A;  1PIO A;  4QU3 A;  5FQM A;  2ZM0 A;  3AZL B;  3BLS A;  4HJ6 A;  4GHI B;  2EWW A;  1WYB A;  3D72 A;  1PWC A;  2ZBB A;  2F8N H;  4WNN A;  1P3M C;  4CJN A;  5L09 A;  1M18 B;  1TS7 A;  4Y0O A;  1F2K A;  5CED A;  4ZAM A;  1ZHH B;  3HJI A;  3F1P B;  3GMW A;  3MFX A;  1FIK A;  1K4F A;  3IS2 B;  3W4Q A;  1P3O D;  3LZ1 D;  4D2O A;  3AZG C;  1I2W A;  2P9V A;  1P3P C;  3CUE C;  4I3A A;  3S22 A;  2WGV A;  4Z9Q A;  1HD8 A;  3JVV A;  5D3O A;  3EPK A;  2IO5 B;  4FSF A;  1P3L D;  1T1C A;  3OPR A;  2Y2I A;  2Q9N A;  3AZL C;  5DJT A;  5DNM D;  1X0O A;  3VV4 A;  5KSH A;  2JKR I;  2V1Z A;  2NQB B;  5E2G A;  3PHY A;  5B1M A;  4X1L A;  4NEE D;  4WYY A;  2PYO B;  3EGX C;  3QP1 A;  5CPK D;  3ZVW A;  4LD9 A;  4U0X A;  1M18 C;  1BSG A;  1YSP A;  3G31 A;  4KZ8 A;  1L0G A;  3LJA D;  4UHU A;  2VQR A;  4NZ1 A;  2G5H C;  5DJU A;  2EX8 A;  4QLC D;  1U35 D;  3B6F C;  2CC1 A;  2LB5 A;  1S6R A;  1GHP A;  3WTP B;  1OTB A;  1M1A D;  2NQB C;  1W7F A;  3W98 D;  4GNU A;  2FJ7 B;  1T1A A;  3MJQ A;  2HIO B;  5AVC C;  3NC8 A;  5EM1 A;  4BBU A;  1HZO A;  2Y2K A;  2EFU A;  4XUJ B;  5EOE A;  2BLS A;  4CAY A;  3MVD B;  1AOI D;  5CPI C;  5GXQ A;  1LSW A;  3GEC A;  1SKO B;  1I2S A;  1T18 A;  2XA7 S;  5IHV A;  2W3E A;  2W1T A;  2O99 A;  5BT1 C;  1KX4 A;  3WTP C;  3ZG7 B;  2ZC7 A;  3G34 A;  3MBZ A;  1P3I D;  5DF9 A;  3MGQ A;  2FJ7 C;  2XEP A;  2XA7 M;  4B4Z A;  1ULY A;  4DRA A;  4WNN B;  1AXB A;  3OPP A;  2EWV A;  2HIO C;  1P3B D;  3UT9 A;  2XLN A;  2F8N A;  3S7N A;  2ZLY A;  4HQA A;  3UDX A;  3REK D;  2JCH A;  1J9M A;  3TE8 A;  3KO6 A;  5E5A C;  3MVD C;  2OOL A;  4FTX A;  4P87 A;  2P7J A;  2P9V B;  2FFY A;  2ZQ8 A;  3T1Q B;  3AV1 C;  5B1L C;  4B88 A;  2R78 A;  4HNB A;  5DF8 A;  1XX2 A;  5FA7 A;  3BFD A;  4X23 D;  2EX2 A;  3IXD A;  5IT5 A;  3W96 A;  4BMW A;  2JSS A;  5G49 A;  4LD9 B;  4LRY C;  1NLZ A;  3MQQ A;  3Q7Z A;  2P74 A;  1SDE A;  3MQO A;  3K3C A;  1FR1 A;  3E98 A;  5EEC A;  2QJ5 A;  4WMC A;  3VP1 A;  2BTF P;  1TDL A;  3AGF A;  1H5X A;  4BL3 A;  4NXB A;  2F8N K;  4FCF A;  3X1V C;  1IEL A;  5B31 D;  2LB9 A;  4OJO A;  3PBQ A;  1KX5 A;  2INW A;  3G35 A;  4IBD A;  1ZLA A;  4PMA A;  4JBF A;  4X56 A;  3R7W A;  3WRZ A;  2HDU A;  4LD9 C;  1TF1 A;  2DCF A;  1CI8 A;  2V20 A;  3BFG A;  4Q0H A;  1GA0 A;  2XQZ A;  3MF0 A;  1OJ5 A;  2PYP A;  4CAY B;  3G30 A;  5BO0 A;  5B32 G;  3MGP D;  4QY6 A;  1N1J A;  2EX6 A;  3UE0 A;  3NDE A;  2W1T B;  1W63 Q;  5CPJ D;  5FQ9 A;  4CSR A;  3LYX A;  1K54 C;  2Y2O A;  4DMZ A;  3MGQ B;  3AGE A;  5GT3 C;  3ZHH A;  1KS0 A;  4WU8 A;  1W1V A;  1OTA A;  1YLY A;  4BL2 A;  3C1B A;  3UT9 B;  5AVF A;  4XZQ A;  1S1Z A;  5A90 A;  4FH2 A;  2F8N B;  1EQZ D;  4EU0 A;  3WTP E;  4KQD A;  3HON A;  1JTG A;  2JN7 A;  2V0U A;  1KGF A;  2B18 A;  3MGS D;  3UTA A;  5BNX A;  1YMS A;  5AV8 D;  3U4L P;  5KMW A;  2WGW A;  3VSL A;  3ZG8 B;  3BFF A;  3W96 B;  4NG2 A;  5G49 B;  3REJ A;  3AZF D;  4UA7 A;  4LCM A;  1S66 L;  5AY8 D;  5FEF A;  3C1C A;  1XGI A;  3QP8 A;  4PM6 A;  1IEM A;  4QHC A;  4HH2 A;  4GDN A;  4NYU A;  2V1A A;  1P3M D;  4Q0I A;  4UQI S;  3R4K A;  2J9P A;  5FDH A;  1ACF A;  3HJK A;  3A3D A;  5HL1 A;  4OOY A;  1ZLA B;  2JKT I;  3R7W B;  4IED A;  4AFI A;  3W96 C;  2JKR M;  5EE8 A;  2Y2G A;  1Q2P A;  3AZG D;  4UQI M;  1P3P D;  1F66 C;  3AZE A;  4OQ0 A;  1XA7 A;  5EOO A;  3OZH A;  3AZL D;  2EA9 A;  2HV1 A;  5BPV A;  1TD5 A;  1UWP X;  3RJU A;  5BO0 B;  4O7D A;  2CMN A;  1N1J B;  1M18 D;  3S4X A;  4WZ4 A;  4CSR B;  2I72 A;  3MZF A;  4OJL A;  3Q7V A;  1ZLA C;  1HQ3 A;  3LIF A;  5F83 A;  1Q9C A;  4WU8 B;  4GW9 A;  3B6F D;  1P34 A;  5EVL A;  5KDM A;  5L2F A;  1P3A D;  3ITA A;  3C1B B;  1QMF A;  4FUW A;  4XZQ B;  3T1S A;  1S32 A;  4N1X A;  4O8G A;  4PKY A;  1UR9 A;  3N6I A;  5HD5 A;  1Y4O A;  2FN2 A;  2NUT C;  1E6R A;  5F99 A;  1XJ4 A;  2GX5 A;  4MBH A;  5F68 A;  3UTA B;  2X71 A;  5AVC D;  5BNX B;  3OC2 A;  5GHY A;  5TJJ A;  1G68 A;  4Q8I A;  2WGW B;  4E45 A;  2V2F F;  1T19 A;  3A1I A;  4E04 A;  3CWF A;  5CPI D;  3G6O A;  3REJ B;  5B40 C;  5B2I C;  5JRG A;  1NY0 A;  5G18 A;  2HDQ A;  3K3D A;  3C1C B;  5BT1 D;  3KSG A;  4Z2M G;  3WTP D;  2X01 A;  3VOZ A;  2BYK A;  1G6A A;  1P3F A;  4NK3 A;  4EEP A;  4YS3 A;  1VQQ A;  1FCN A;  3GSG A;  3UME A;  4CQH A;  5AV9 A;  4I5S A;  3UTA C;  1IOU A;  2ZM8 A;  3C8C A;  4HBU A;  1Y54 A;  1BUE A;  2B95 A;  1MBL A;  4NKP A;  3N4I A;  5E5A D;  3MVD D;  1XJ6 A;  3NI9 A;  1DP8 A;  3AV1 D;  1TAF A;  2W3D A;  5B1L D;  3C1C C;  3AZE B;  4R38 A;  3NOU C;  1HLU P;  4S2K A;  4IBB A;  4M4X A;  1BLC A;  2X02 A;  4J8U C;  2XGN A;  4HBT A;  2O0Y A;  4U3T A;  4DN0 A;  3GVB A;  3NCK A;  1XXM A;  3VSK A;  3LI9 A;  3S7O A;  3FV7 A;  3HUO A;  4WL9 A;  2ZY5 A;  4GCZ A;  3KUY A;  1Z6F A;  3Q7V B;  1YKD A;  3IWI A;  4I39 A;  1F5M A;  1O7E A;  1SDN A;  1P3G A;  2JKG A;  1C3B A;  3A6N A;  1E8B A;  3X1V D;  1P34 B;  5KDM B;  2A3U A;  1R4V A;  3LR4 A;  1S32 B;  3AZE C;  2RTS A;  2WKI A;  4IBE A;  3V50 A;  3G4P A;  3OLO A;  3R45 A;  1KX3 A;  5F99 B;  4BBT A;  5HAR A;  4S2M A;  1CK3 A;  1FCM A;  3SH8 A;  4FH4 A;  3ZCZ A;  4IBR A;  2ZJ9 A;  3H0L C;  3ZVT A;  3PBN A;  2OV5 A;  2RVQ C;  3UO9 A;  1K56 A;  1M19 D;  2HP9 A;  5TFQ A;  4ZRR A;  1P3K A;  4LGW A;  5EV0 A;  1P34 C;  1YLZ A;  4II7 A;  4DXC A;  3EWK A;  3W97 A;  4OLG A;  5JRG B;  1S32 C;  2QPN A;  2BYK B;  4OVD A;  5F99 C;  1P3F B;  1OPX A;  5GT3 D;  4UUZ A;  4YS3 B;  3ITB A;  3CLO A;  3VOY A;  1B67 A;  4G91 C;  5AV9 B;  3IX8 A;  1IYP A;  3UB6 A;  2XD5 A;  5L8M A;  4YM6 A;  4L9G A;  1S4S A;  3IX4 A;  4OQH A;  2HZ5 A;  3D9Y A;  3A0S A;  1TAF B;  4WU9 C;  1UGU A;  4BWI A;  5M18 A;  3E2L A;  3EPH A;  3M7P A;  1P3F C;  4E3N A;  1ES3 A;  1RGZ A;  4EEU A;  5AV9 C;  2OWH A;  3KUY B;  2YKF A;  2VLG A;  3MSH A;  4JGP A;  5C3I B;  2WUQ A;  2ZY2 A;  3GR2 A;  4R4R A;  1P3G B;  4WEK A;  1NWZ A;  3A6N B;  2JKT M;  4GN2 A;  4QJG A;  3SH9 A;  5CRF A;  2HDR A;  3MNN A;  1XKZ A;  1K4E A;  1KVL A;  2JBF A;  1TS0 A;  3EPL A;  3R45 B;  4LPZ A;  3LID A;  2JE5 A;  1KX3 B;  2VGL S;  1YAX A;  3W96 D;  1D06 A;  4D60 A;  3WWX A;  5GLC A;  5I94 A;  3KUY C;  1GA9 A;  5CEB A;  1F66 D;  3A3J A;  2HDS A;  1OTE A;  3ZGA B;  4ESP A;  1M40 A;  5C3I C;  5I5L A;  4KUD D;  4KQR A;  2VGL M;  1P3G C;  1P3K B;  3KSI A;  4GB7 A;  3OPH A;  4IBJ A;  4Y2F A;  3WS0 A;  3W97 B;  4IBG A;  4NXF A;  4E44 A;  3L2A A;  3FG8 A;  2ZC3 B;  1ZLA D;  1KX3 C;  4UUZ B;  1KVM A;  4I3J A;  1FOF A;  4S2O A;  2PAV P;  3UY6 A;  5TBM A;  4HGA B;  3ZG0 A;  3Q82 A;  1WWS A;  4GOG A;  5M19 A;  4YM6 B;  5TR7 A;  4S2I A;  2M7U A;  4OPZ A;  4QD4 A;  4K08 A;  3MMH A;  1ES2 A;  1P3K C;  2ZQD A;  3WAA C;  2J3T C;  3AZJ A;  4ZBE A;  5HAI A;  5F5Y A;  5GLD A;  5FUG A;  4X55 A;  3AN2 C;  5BS7 A;  3PYP A;  1DJC A;  5GHZ A;  3EPJ A;  5K5B A;  3JYI A;  4PM8 A;  5E2F A;  4G3W A;  5B40 D;  1GHI A;  1SHV A;  3HLD A;  4BEN A;  5B2I D;  2ZM5 A;  2WYX A;  2VZW A;  3BQA A;  1OT9 A;  3BLM A;  3P98 A;  5FL3 A;  4H9N A;  1P0Z A;  1SCW A;  3A0V A;  1G5U A;  3QP4 A;  3UNW A;  3REI D;  3KX0 X;  3EGD C;  3UTA D;  3T1X A;  3AFA A;  3BY9 A;  5HWV A;  3MNN B;  1B6W A;  3Q81 A;  2VGJ A;  1LI9 A;  4R8P A;  4HIA A;  1E6N A;  3VE4 A;  3PBR A;  1FCO A;  3ZNY A;  3KS4 A;  5CX7 A;  3LR5 A;  4LG2 A;  1CEG A;  3UB5 P;  4J8X C;  3C1C D;  2CV5 C;  2CWE A;  1FR6 A;  1MWR A;  5AQA A;  3LIE A;  4J8U D;  3SS4 A;  1M6K A;  4IJE A;  4IJF A;  3MNN C;  2WAF A;  3KWQ A;  3BJN A;  3C2W A;  1S4R A;  1YM1 A;  1GCE A;  4YNR A;  3CI6 A;  5CGX A;  3VH6 T;  5FI2 A;  5TBM B;  5F6A A;  1W5D A;  1N4O A;  4R1G A;  2JC7 A;  4RVA A;  1VM1 A;  2ZOI A;  4M6B A;  4KZB A;  3AZH A;  3A3E A;  4K0W A;  1YUE A;  5B32 A;  2OLU A;  3H9W A;  4DE1 A;  5EPH A;  2OSU A;  1RGY A;  3LUQ A;  4R70 A;  2RVQ D;  1LHY A;  2RIQ A;  3VE3 A;  3H82 A;  1P34 D;  2KLI A;  2HJ9 C;  3DTK A;  3IX3 A;  1S32 D;  2F2A C;  2PT7 A;  2BG1 A;  3IXH A;  1JNU A;  4JLF A;  2DRW A;  4P0M A;  5DF7 A;  4Y7P A;  5HWT A;  2G2W A;  1PZR A;  4H9N B;  1TS6 A;  1LL9 A;  1STZ A;  3E4P A;  3L28 A;  5HDS A;  4I38 A;  3AZM A;  1ZG6 A;  3AFA B;  3L27 A;  5B0Z A;  3MXR A;  4R8P B;  3EOI A;  2YFW A;  1N9L A;  1UR8 A;  3TRC A;  1MY8 A;  2DF4 C;  2IO5 C;  1NRJ A;  1NYY A;  4Z2M H;  1YT4 A;  4WU9 D;  2PYO C;  3VP0 A;  1ID3 D;  1J3W A;  5DVA A;  3DW0 A;  1P3F D;  4WZ5 A;  4Y13 A;  3AYW A;  2RL3 A;  3IF6 A;  4BQM A;  4X69 A;  2YKH A;  3KWQ B;  4X68 A;  2BYM A;  4R8P C;  1N9O A;  2ZM2 A;  3IT9 A;  4NFT A;  2J8Y A;  2XSS A;  4ID4 A;  4OOL A;  4EBP A;  1ES4 A;  2DNS A;  1IYO A;  2HPB A;  1ZG4 A;  1JFI A;  4PAU A;  2WZZ A;  1ES5 A;  4MEZ A;  3WD4 A;  2UV0 E;  1YU0 A;  3JPU A;  3GDI A;  3AZH B;  5HZH A;  5F1G A;  3VFH A;  4E3J A;  5B32 B;  4XUJ C;  2Y2P A;  2WZX A;  3REL A;  3KWQ C;  3QP5 A;  3X1S A;  4EW7 A;  4LRZ E;  3LI8 A;  5E2E A;  2J8P A;  2G5I C;  3H82 B;  1ERO A;  5GT0 A;  4KGC A;  1HVB A;  4E3I A;  5B1M B;  4MB5 A;  4Z2J A;  4C6Y A;  3AZH C;  2Y2Q A;  5KIZ A;  1KX3 D;  2QKP A;  5DTK A;  1V9Z A;  1GSW A;  1CF0 A;  3IBR A;  1E4D A;  1MWT A;  3AZM B;  3TU4 A;  4JGQ A;  3M6B A;  4EBL A;  2OAQ 1;  5B0Z B;  2YFW B;  5GSU D;  4E3M A;  4IBX A;  4PM7 A;  3TG9 A;  4PM9 A;  1P3K D;  5B33 A;  3WAA D;  2J3T D;  3EG5 B;  3A3F A;  3T4O A;  5B1M C;  3AN2 D;  1CEF A;  1W63 M;  3QNC A;  3W99 A;  1BH9 A;  5CHJ A;  4KZ7 A;  3AYW B;  3AV2 A;  3AZM C;  3NOT C;  3IF6 B;  1CI9 A;  5FAT A;  1W79 A;  2BYM B;  1KE3 A;  4EV4 A;  2PYR A;  2VGK A;  5GXQ B;  3LCE A;  3NQU A;  5AV5 A;  2EX9 A;  3UN7 A;  1KX4 B;  4U0T A;  2ARO A;  1JFI B;  3FYZ A;  1L0D A;  2I9V A;  2VV6 A;  3KSH A;  3WS1 A;  4WZ5 C;  3UTB A;  3OOV A;  1KGE A;  3V3R A;  1OTD A;  3NHQ A;  4JXG A;  3AYW C;  2QWS A;  4J8V A;  4NYY A;  3BEB A;  4ZUX A;  4DJ2 A;  3REL B;  3AZK A;  4LV0 A;  3PBT A;  5GXQ C;  2YFV A;  3X1S B;  3BEC A;  5FQK A;  4J8X D;  2CV5 D;  3B33 A;  5HSQ A;  5AV6 A;  2HF6 A;  5HL6 A;  3NUL A;  4NET A;  4R4S A;  1KX4 C;  3H0R C;  5GT0 B;  4KGC B;  4Y15 A;  3MGQ C;  4Z5T A;  3MR0 A;  3JVU A;  4OOM A;  3A0R A;  3UT9 C;  3ZYT A;  1OT6 A;  4IJG A;  3TU4 B;  1W2E A;  1K57 A;  2NZD A;  1TZY A;  5KZH A;  3DAV A;  5B33 B;  1NRF A;  3IHB A;  1KX5 B;  5GT0 C;  4KGC C;  1QME A;  3X1T A;  3SW1 A;  1E25 A;  1TEM A;  1E15 A;  3H0M C;  5U47 A;  3W99 B;  4UA6 A;  3CAX A;  1D1J A;  1ERM A;  1EWZ A;  4JXS A;  4HES A;  1XJ3 A;  4WLA A;  1L0E A;  3AV2 B;  2PR5 A;  2ZY3 A;  3OPL A;  2HP6 A;  3VP4 A;  4E3O A;  2D01 A;  5G4Y A;  4DQY B;  3WA9 A;  2ZD8 A;  1EW0 A;  3SOI A;  4NE6 A;  3NQU B;  5AV5 B;  4OP8 A;  5B33 C;  1KOU A;  2Z2L B;  1KX5 C;  1ESI A;  1PNE A;  1DRM A;  5E43 A;  4MB4 A;  3LO7 A;  3PAG A;  1EAK A;  3DTM A;  4DRB A;  4HME A;  4DDY A;  4WUJ A;  3AZI A;  4J8V B;  4YWZ A;  3MXQ A;  3VOL A;  4ZUX B;  4WF0 A;  3KSY A;  3AZK B;  2NQB D;  3WS4 A;  1HTA A;  2YFV B;  2PYO D;  4R3J A;  3HLC A;  3LZ1 A;  1O07 A;  4JF6 A;  5AV5 C;  3LR3 A;  5AV6 B;  1L0F A;  1KU5 A;  1XP4 A;  4OP5 A;  1T1B A;  3IP4 C;  3MGR A;  3NEC A;  3IH8 A; 
#chains in the Genus database with same CATH homology
 1P3L A;  3FKW A;  4Z5T B;  1L2S A;  4WU8 C;  4R8P D;  5A91 A;  4J8W A;  1NZO A;  3IQA A;  4M3K A;  5CPK A;  3C1B C;  1NZU A;  4XZQ C;  5GHX A;  4J8V C;  3ZFZ A;  3LJA A;  3AZK C;  4NE3 A;  3O88 A;  2FJ7 D;  4JF4 A;  3REH A;  2NZD B;  1TZY B;  5AV6 C;  1U35 A;  1E3U A;  2HIO D;  3B0B A;  3B6G A;  4XUJ D;  3X1T B;  4Z5T C;  3KWQ D;  3W98 A;  4XUZ A;  2J7V A;  3EQU A;  3REJ C;  1LI0 A;  3QHY A;  4BD1 A;  3O3V A;  3IF5 A;  3VH6 A;  3WA9 B;  2NZD C;  1AOI A;  2HP5 A;  1JWP A;  3O86 A;  4AWL B;  4BJP A;  4MBK A;  2WK0 A;  4OPQ A;  4NZ5 A;  3X1T C;  1HQ3 B;  1P3I A;  2EXB A;  3G2Y A;  3NQJ A;  3AZI B;  2UWX A;  2PU2 A;  4S2N A;  3VH5 T;  3REK A;  5B1M D;  3WKJ A;  1ONH A;  3LZ1 B;  4LD9 D;  4AWL C;  3AZN A;  4DKI A;  1PW1 A;  1NYM A;  3MGR B;  5CTM A;  1P3L B;  3A3I A;  1HQ3 C;  4ZTK A;  4F94 A;  3FKV A;  3V39 A;  3QNB A;  4X23 A;  4J8W B;  5CPK B;  3E2K A;  3C5A A;  3AZI C;  2PU4 A;  4N1H A;  4RX3 A;  3LJA B;  4KZ6 A;  5CTN A;  1XGJ A;  3IXB A;  3KXB A;  3REH B;  4WEL A;  3LZ0 A;  1U35 B;  4R23 A;  3MGR C;  3B6G B;  1GHM A;  3FKE A;  3AYW D;  1W8Q A;  4S2P A;  2A49 A;  1TVF A;  3W98 B;  5GXQ D;  4J8W C;  4MBF A;  2ZMA A;  5CPK C;  5JRG C;  3MFD A;  1BH8 A;  5B2J A;  1KX4 D;  3L29 A;  4WBG A;  4XUX A;  2HUE B;  4IVK A;  3MGQ D;  1JWV A;  4YS3 C;  3REH C;  1U35 C;  1AOI B;  4C3Q A;  5AQ7 A;  3MGP A;  3PBO A;  4DRT A;  3UT9 D;  3VP3 A;  3B6G C;  2F8N D;  5CPJ A;  3HLG A;  5FAP A;  1P3I B;  3W98 C;  4MLL A;  3ZG9 B;  2IWB A;  3NQJ B;  4GZB A;  3GQZ A;  1MXO A;  5GT0 D;  1K25 A;  1EQZ A;  1JVJ A;  3REK B;  3X1U A;  3WKJ B;  3CJM A;  1BTL A;  4JJN A;  1PYY A;  1BLP A;  3Q07 A;  3AZN B;  4JXW A;  3MGS A;  4CPK A;  3UPP A;  3VH6 W;  4WMC D;  3NY4 A;  4UAA A;  5AVB A;  5AV8 A;  4X23 B;  2XDM A;  3A6N C;  3V9R A;  3G2Z A;  1KDW A;  3AZF A;  1ZC2 A;  5B0Y A;  4S2N C;  1KX5 D;  2XFT A;  4DXB A;  2W8S A;  3WKJ C;  3IHA A;  3KXB B;  5F1F A;  3LZ0 B;  3AZN C;  2Y4A A;  1K55 A;  1P3M A;  1PI5 A;  2ZC5 B;  3B3X A;  4KZ5 A;  2ZQ9 A;  4X23 C;  5FQQ A;  5CEC A;  3GV9 A;  3N8S A;  1KE4 A;  3B0C T;  3W97 C;  4S2J A;  5AV5 D;  3AZG A;  1BH8 B;  5TGF A;  5B2J B;  1H3O A;  3CMZ A;  3WS2 A;  2PBY A;  1MPL A;  4GD6 A;  3NBL A;  3KXB C;  4G92 B;  4WU8 D;  3LZ0 C;  4HGA C;  2IWD A;  4OJ6 A;  4EBN A;  3MGP B;  4YM6 C;  3C1B D;  4E6X A;  4XZQ D;  1JWZ A;  4LV3 A;  1WYC A;  4J8V D;  5CPJ B;  5GL9 A;  4ZDX A;  1YU2 A;  2Y2M A;  5HW3 A;  4DDS A;  1MKI A;  3HLE A;  3B6F A;  5B2J C;  1P3A A;  1ONG A;  1EQZ B;  3X1U B;  4G92 C;  3ZDJ A;  3BFC A;  4JJN B;  3REJ D;  3MGP C;  3GRJ A;  4BD0 A;  1PWD A;  5AVC A;  3KFU G;  2XH9 A;  5GLB A;  4MNR A;  5AVB B;  5AV8 B;  5B31 G;  3V9R B;  2NZD D;  5CPI A;  3AZF B;  3B0D B;  5B0Y B;  5CHU A;  1FQG A;  4KQQ A;  3X1U C;  5BNV A;  2Y2J A;  4QB8 A;  4JJN C;  1PZP A;  4GKU A;  1P3M B;  1IKI A;  3AZE D;  1FSY A;  5AVB C;  2WKE A;  5JYO A;  3AZJ B;  5E5A A;  3LY4 A;  5FUG B;  3AZG B;  5B0Y C;  3AL0 C;  1H3O B;  3AV1 A;  2XR0 A;  5B1L A;  4OLD A;  1BUL A;  2Y59 A;  1HQ3 D;  4IBK A;  1K55 C;  2EFX A;  4Y0U A;  2EXA A;  3AZI D;  5JA4 A;  5F99 D;  3AZJ C;  3G32 A;  3O62 A;  4JF5 A;  5CXW A;  3X1V A;  3B6F B;  5BS7 C;  3RXX A;  1P3A B;  4KG6 A;  2Y2L A;  3MGR D;  1BT5 A;  4X6T A;  4EQI A;  5FI6 A;  4K91 A;  3C7U A;  2ZC4 B;  4J8W D;  4UA9 A;  5M1A A;  5FAS A;  5JRG D;  1KGG A;  5AVC B;  3L25 A;  3VMA A;  1M19 A;  4YS3 D;  4XXR A;  3REH D;  1E3U D;  5CPI B;  5AV9 D;  4A5R A;  4BLM A;  3AFA C;  1P3A C;  3B6G D;  1T3U A;  3M2J A;  1K54 A;  5BNV B;  3ZG5 A;  4B4X A;  4X53 A;  5GT3 A;  4OQG A;  1KDS A;  4EUZ A;  4KEN B;  5CGW A;  3VP2 A;  3FWL A;  1H8Y A;  5F82 A;  4R0Q A;  5E5A B;  4OKP A;  5CER A;  3LY3 A;  4RA7 A;  4OON A;  3AV1 B;  3KUY D;  5B1L B;  2XFS A;  4N9L A;  4QNL A;  5B24 A;  4ZBJ B;  2Y2H A;  1P3G D;  3C4P A;  3A6N D;  3HRE A;  3UDI A;  2XK1 A;  5JA4 B;  3M2K A;  3VH5 A;  1DY6 A;  3WKJ D;  1PI4 A;  3O62 B;  3LEZ A;  5B32 C;  1EI5 A;  3HUN A;  4QY5 A;  3AZN D;  3X1V B;  5DTS A;  1YU3 A;  1LLB A;  1K56 D;  4ZBJ C;  4S2L A;  4EO5 B;  1FSW A;  1NXY A;  1DJB A;  3W97 D;  5HAP A;  1YU4 A;  1K6S A;  1F66 A;  1M19 B;  4KUD A;  3GTC A;  3O62 C;  4KG2 A;  3KXB D;  3PAE A;  4IBI A;  3LZ0 D;  3MKF A;  4WV4 B;  4YM6 D;  5B0Z C;  2Y2N A;  3HUM A;  2WKH A;  4RYE A;  4E6W A;  5GT3 B;  4EO5 C;  4WJ3 C;  4RX2 A;  5B2J D;  4WZS B;  1A7W A;  1M19 C;  1SKF A;  3I7J A;  2OLV A;  5DTT A;  3W4O A;  3IF6 C;  3N8R A;  2FFF B;  4NZ4 A;  2XF3 A;  5B24 B;  2WAE A;  4NE5 A;  2IOU A;  3HLB A;  1YQS A;  3AGD A;  3MNN D;  5B40 A;  5EVI A;  5B2I A;  4Z66 A;  4OUI A;  3CG5 A;  4DE0 A;  3X1U D;  4H9S A;  3O87 A;  4JJN D;  1IKG A;  3REL C;  5CP6 A;  3REI A;  3LEL A;  4NY2 A;  3X1S C;  3TSG A;  3W4P A;  5AVB D;  1K6R A;  5B24 C;  1N9B A;  5DNN A;  3OCN A;  5B0Y D;  2G2U A;  3HBR A;  3IWQ A;  1BH9 B;  1F66 B;  5BOH A;  2H0T A;  4KUD B;  4J8U A;  1ZKJ A;  4PM5 A;  3TU4 C;  3EQV A;  4E3K A;  3VH5 W;  4YFM A;  1OME A;  2DQN C;  3AZJ D;  4WM9 A;  2ARO B;  3MZE A;  4DF6 A;  1BFM A;  2J9O A;  3W99 C;  4GD8 A;  3UTB B;  1PZO A;  4KUD C;  1KE0 A;  3AV2 C;  4K0X A;  2F8N G;  2ZC6 B;  1Z2C B;  5FI7 A;  1IYS A;  4P6B A;  1U60 A;  1W8Y A;  2B5R A;  2C6W B;  1P3O A;  3D4F A;  4KZ9 A;  3WX7 A;  2IWC A;  4JXV A;  3C7V A;  2ARO C;  3DWK A;  2H10 A;  3AFA D;  3HLW A;  5DNM A;  1JTD A;  4LV2 A;  5B40 B;  4OJP A;  5EVI B;  5B2I B;  5FQJ A;  4Z66 B;  4H8R A;  5HFO A;  3UTB C;  1YMX A;  2C5W B;  4ZUX C;  5CP6 B;  3REI B;  3LEL B;  5HX9 A;  4P85 A;  4QLC A;  3S1Y A;  4OPR A;  1BLH A;  3BFE A;  3OCL A;  3N3F A;  1ALQ A;  5FAO A;  5DNN B;  5GLA A;  5EVI C;  1M1A A;  3PBS A;  4Z66 C;  4WU9 A;  3L26 A;  2Y55 A;  1ID3 A;  4H9S C;  4J8U B;  3C4O A;  5CP6 C;  3UPO A;  3REI C;  3LEL C;  3HLF A;  1K57 C;  5CGS A;  1ERQ A;  1TZY C;  1BZA A;  3SS5 A;  2QZ6 A;  3AZH D;  1F1E A;  5DNN C;  5B32 D;  4H9O A;  4KQO A;  3WS5 A;  4ZJ1 A;  1PW8 A;  5JYP A;  5AQB A;  2L5A A;  1P3B A;  1MWS A;  3Q1F A;  4FD8 A;  3WA9 C;  2ZY4 A;  3UE1 A;  1P3O B;  1TDG A;  5E2H A;  3BM6 A;  3A1K A;  1RP5 A;  3O62 D;  4IBC A;  3AZM D;  5DNM B;  2Y91 A;  2QMI A;  2ZQ7 A;  5B0Z D;  3M6H A;  1BLS A;  4KZ3 A;  3BRM A;  3B0C W;  3NIA A;  4YIN A;  4DE3 A;  5A93 A;  4G91 B;  4QLC B;  1P3O C;  3LZ1 C;  2XD1 A;  2WAD A;  5GSU A;  4C75 A;  5B31 A;  1K38 A;  3WAA A;  1P3L C;  3WRT A;  5DNM C;  1M1A B;  1WWI A;  4E3L A;  4WU9 B;  5FAQ A;  3AN2 A;  5EUA A;  1ID3 B;  3MKE A;  5J8X A;  3IH9 A;  3UDF A;  3LJA C;  5KSC A;  1H8Z A;  3NDG A;  4QLC C;  2E8I A;  1Q2Q A;  4N9K A;  1XA1 A;  1WE4 A;  4LV1 A;  4GDB A;  4H9O B;  3VFF A;  5A92 A;  3REL D;  1M1A C;  3CZD A;  3X1S D;  1NJ4 A;  2ZQC A;  1ID3 C;  4L0L A;  4PPR A;  5B24 D;  1P3B B;  3N7W A;  4DE2 A;  2HUE C;  4KGC D;  1DJA A;  4H9R A;  4IBF A;  4WEJ A;  1AOI C;  4OJ5 A;  4J8X A;  2CV5 A;  2H5S A;  1LL5 A;  4KZ4 A;  3TU4 D;  1P3I C;  4GHA A;  4H9Q A;  3P09 A;  4UPK A;  1YLJ A;  1P3B C;  5B33 D;  4KHA A;  5AY8 A;  1ESU A;  3REK C;  3V3S A;  3W99 D;  5GSU B;  3MXS A;  1I5Q A;  4OPY A;  5B31 B;  1YLW A;  4KZA A;  3W8K A;  3UE3 A;  3WAA B;  3AV2 D;  4H9P A;  1RCJ A;  1MWU A;  4OH0 A;  3HVF A;  3AN2 B;  4ZJ3 A;  3ZNT A;  1P3P A;  2Z2M B;  2ARO D;  4KG5 A;  3FDD A;  3MZD A;  3AZL A;  1YLT A;  5FQI A;  2R9W A;  5GSU C;  3V5M A;  3UTB D;  5B31 C;  1M18 A;  3FZC A;  4ZUX D;  3AZK D;  2R9X A;  5AV6 D;  5CHL B;  3IWO A;  4NZ3 A;  4OQI A;  3P5J B;  1IYQ A;  3HL9 A;  4H9R B;  4Z5T D;  4IVI A;  5EVI D;  2NQB A;  4HEF A;  3KS8 A;  3ISG A;  4Z66 D;  3IXG A;  2WGI A;  4J8X B;  2PYO A;  2CV5 B;  5HAQ A;  3HSH A;  2RCX A;  2H0Y A;  4LCL A;  3MGS B;  5CPJ C;  1YU1 A;  3N8L A;  3BYD A;  2ZQA A;  3PTE A;  5CP6 D;  4JKT A;  3LEL D;  4H9Q B;  1YLP A;  3SH7 A;  1TZY D;  2LY8 A;  4Y0T A;  4ZJ2 A;  4KHA B;  4LEN A;  5DNN D;  5AY8 B;  1EQZ C;  5CHM A;  3X1T D;  1HTZ A;  3WTP A;  2FJ7 A;  5FSR A;  1S0W A;  3UPN A;  4GH9 A;  2HIO A;  3MGS C;  3RXW A;  3TOI A;  4H9P B;  1XPB A;  4EWF A;  4R3B A;  2Q9M A;  5AV8 C;  4XUJ A;  3DWZ A;  3WA9 D;  4N92 A;  2GDN A;  3MVD A;  4JPM A;  3AZF C;  3F6T A;  3B0D C;  1P3P B;  5AQ9 A;  5AY8 C;  1PWG A;  4GHL A;  1PIO A;  4QU3 A;  5FQM A;  2ZM0 A;  3AZL B;  3BLS A;  1WYB A;  1PWC A;  2F8N H;  4WNN A;  1P3M C;  4CJN A;  1M18 B;  4Y0O A;  5CED A;  4ZAM A;  3GMW A;  1K4F A;  3W4Q A;  1P3O D;  3LZ1 D;  4D2O A;  3AZG C;  1I2W A;  2P9V A;  1P3P C;  3S22 A;  2WGV A;  4Z9Q A;  1HD8 A;  5D3O A;  3EPK A;  2IO5 B;  4FSF A;  1P3L D;  3OPR A;  2Y2I A;  2Q9N A;  3AZL C;  5DNM D;  5KSH A;  2V1Z A;  2NQB B;  5E2G A;  5B1M A;  4WYY A;  2PYO B;  5CPK D;  3ZVW A;  4LD9 A;  4U0X A;  1M18 C;  1BSG A;  3G31 A;  4KZ8 A;  1L0G A;  3LJA D;  4UHU A;  2VQR A;  4NZ1 A;  2G5H C;  2EX8 A;  4QLC D;  1U35 D;  3B6F C;  2CC1 A;  1S6R A;  1GHP A;  3WTP B;  1M1A D;  2NQB C;  1W7F A;  3W98 D;  4GNU A;  2FJ7 B;  2HIO B;  5AVC C;  3NC8 A;  1HZO A;  2Y2K A;  2EFU A;  4XUJ B;  5EOE A;  2BLS A;  4CAY A;  3MVD B;  1AOI D;  5CPI C;  5GXQ A;  5IHV A;  1I2S A;  5BT1 C;  1KX4 A;  3WTP C;  3ZG7 B;  2ZC7 A;  3G34 A;  3MBZ A;  1P3I D;  5DF9 A;  3MGQ A;  2FJ7 C;  2XEP A;  4B4Z A;  1ULY A;  4DRA A;  4WNN B;  1AXB A;  3OPP A;  2HIO C;  1P3B D;  3UT9 A;  2XLN A;  2F8N A;  2ZLY A;  3UDX A;  3REK D;  2JCH A;  1J9M A;  5E5A C;  3MVD C;  4P87 A;  2P9V B;  2FFY A;  2ZQ8 A;  3AV1 C;  5B1L C;  4B88 A;  5DF8 A;  1XX2 A;  5FA7 A;  3BFD A;  4X23 D;  2EX2 A;  3IXD A;  3W96 A;  2JSS A;  5G49 A;  4LD9 B;  3Q7Z A;  2P74 A;  1SDE A;  1FR1 A;  5EEC A;  4WMC A;  3VP1 A;  1TDL A;  3AGF A;  1H5X A;  4BL3 A;  2F8N K;  4FCF A;  3X1V C;  1IEL A;  5B31 D;  4OJO A;  3PBQ A;  1KX5 A;  3G35 A;  4IBD A;  1ZLA A;  4PMA A;  4JBF A;  4X56 A;  3WRZ A;  2HDU A;  4LD9 C;  2DCF A;  1CI8 A;  2V20 A;  3BFG A;  1GA0 A;  2XQZ A;  4CAY B;  3G30 A;  5BO0 A;  5B32 G;  3MGP D;  4QY6 A;  1N1J A;  2EX6 A;  3UE0 A;  3NDE A;  5CPJ D;  5FQ9 A;  4CSR A;  1K54 C;  2Y2O A;  3MGQ B;  3AGE A;  5GT3 C;  3ZHH A;  4WU8 A;  1YLY A;  4BL2 A;  3C1B A;  3UT9 B;  4XZQ A;  5A90 A;  4FH2 A;  2F8N B;  1EQZ D;  3WTP E;  3HON A;  1JTG A;  1KGF A;  3MGS D;  3UTA A;  5BNX A;  1YMS A;  5AV8 D;  5KMW A;  2WGW A;  3VSL A;  3ZG8 B;  3BFF A;  3W96 B;  5G49 B;  3REJ A;  3AZF D;  4UA7 A;  4LCM A;  5AY8 D;  3C1C A;  1XGI A;  4PM6 A;  1IEM A;  4QHC A;  4GDN A;  4NYU A;  1P3M D;  2J9P A;  5FDH A;  3A3D A;  5HL1 A;  4OOY A;  1ZLA B;  4IED A;  3W96 C;  5EE8 A;  2Y2G A;  1Q2P A;  3AZG D;  1P3P D;  1F66 C;  3AZE A;  4OQ0 A;  1XA7 A;  5EOO A;  3OZH A;  3AZL D;  5BPV A;  3RJU A;  5BO0 B;  4O7D A;  1N1J B;  1M18 D;  3S4X A;  4WZ4 A;  4CSR B;  2I72 A;  3MZF A;  4OJL A;  3Q7V A;  1ZLA C;  1HQ3 A;  5F83 A;  1Q9C A;  4WU8 B;  3B6F D;  1P34 A;  5EVL A;  5KDM A;  5L2F A;  1P3A D;  3ITA A;  3C1B B;  1QMF A;  4XZQ B;  1S32 A;  4N1X A;  3N6I A;  5F99 A;  4MBH A;  3UTA B;  2X71 A;  5AVC D;  5BNX B;  3OC2 A;  5GHY A;  1G68 A;  4Q8I A;  2WGW B;  4E45 A;  2V2F F;  3A1I A;  5CPI D;  3REJ B;  5B40 C;  5B2I C;  5JRG A;  1NY0 A;  5G18 A;  2HDQ A;  3C1C B;  5BT1 D;  4Z2M G;  3WTP D;  2X01 A;  3VOZ A;  2BYK A;  1G6A A;  1P3F A;  4NK3 A;  4YS3 A;  1VQQ A;  1FCN A;  3GSG A;  5AV9 A;  3UTA C;  2ZM8 A;  4HBU A;  1Y54 A;  1BUE A;  1MBL A;  3N4I A;  5E5A D;  3MVD D;  3NI9 A;  3AV1 D;  1TAF A;  5B1L D;  3C1C C;  3AZE B;  4S2K A;  4IBB A;  1BLC A;  2X02 A;  4J8U C;  2XGN A;  4HBT A;  4U3T A;  3GVB A;  3NCK A;  1XXM A;  3VSK A;  3FV7 A;  3HUO A;  2ZY5 A;  3KUY A;  1Z6F A;  3Q7V B;  3IWI A;  1O7E A;  1SDN A;  1P3G A;  1C3B A;  3A6N A;  3X1V D;  1P34 B;  5KDM B;  2A3U A;  1R4V A;  1S32 B;  3AZE C;  2WKI A;  4IBE A;  3V50 A;  3G4P A;  3R45 A;  1KX3 A;  5F99 B;  5HAR A;  4S2M A;  1CK3 A;  1FCM A;  3SH8 A;  4FH4 A;  3ZCZ A;  4IBR A;  2ZJ9 A;  3H0L C;  3ZVT A;  3PBN A;  2OV5 A;  2RVQ C;  3UO9 A;  1K56 A;  1M19 D;  2HP9 A;  5TFQ A;  1P3K A;  1P34 C;  1YLZ A;  4DXC A;  3W97 A;  4OLG A;  5JRG B;  1S32 C;  2QPN A;  2BYK B;  4OVD A;  5F99 C;  1P3F B;  5GT3 D;  4UUZ A;  4YS3 B;  3ITB A;  3VOY A;  1B67 A;  4G91 C;  5AV9 B;  1IYP A;  2XD5 A;  4YM6 A;  4OQH A;  1TAF B;  4WU9 C;  5M18 A;  3E2L A;  3EPH A;  1P3F C;  4E3N A;  1ES3 A;  1RGZ A;  5AV9 C;  3KUY B;  5C3I B;  2WUQ A;  2ZY2 A;  3GR2 A;  4R4R A;  1P3G B;  4WEK A;  3A6N B;  4GN2 A;  4QJG A;  3SH9 A;  5CRF A;  2HDR A;  3MNN A;  1XKZ A;  1K4E A;  1KVL A;  2JBF A;  3EPL A;  3R45 B;  2JE5 A;  1KX3 B;  3W96 D;  3WWX A;  5GLC A;  5I94 A;  3KUY C;  1GA9 A;  5CEB A;  1F66 D;  3A3J A;  2HDS A;  3ZGA B;  1M40 A;  5C3I C;  4KUD D;  4KQR A;  1P3G C;  1P3K B;  4GB7 A;  3OPH A;  4IBJ A;  3WS0 A;  3W97 B;  4IBG A;  4E44 A;  3L2A A;  2ZC3 B;  1ZLA D;  1KX3 C;  4UUZ B;  1KVM A;  1FOF A;  4S2O A;  3UY6 A;  4HGA B;  3ZG0 A;  3Q82 A;  1WWS A;  4GOG A;  5M19 A;  4YM6 B;  5TR7 A;  4S2I A;  4OPZ A;  4QD4 A;  1ES2 A;  1P3K C;  2ZQD A;  3WAA C;  3AZJ A;  4ZBE A;  5HAI A;  5GLD A;  5FUG A;  4X55 A;  3AN2 C;  5BS7 A;  1DJC A;  5GHZ A;  3EPJ A;  3JYI A;  4PM8 A;  5E2F A;  5B40 D;  1GHI A;  1SHV A;  3HLD A;  4BEN A;  5B2I D;  2ZM5 A;  2WYX A;  3BLM A;  3P98 A;  4H9N A;  1SCW A;  3UNW A;  3REI D;  3UTA D;  3AFA A;  3MNN B;  1B6W A;  3Q81 A;  2VGJ A;  1LI9 A;  4R8P A;  3PBR A;  1FCO A;  3ZNY A;  3KS4 A;  4LG2 A;  1CEG A;  4J8X C;  3C1C D;  2CV5 C;  2CWE A;  1FR6 A;  1MWR A;  5AQA A;  4J8U D;  3SS4 A;  1M6K A;  4IJE A;  4IJF A;  3MNN C;  2WAF A;  3KWQ A;  1YM1 A;  1GCE A;  5CGX A;  3VH6 T;  5FI2 A;  1W5D A;  1N4O A;  4R1G A;  2JC7 A;  4RVA A;  1VM1 A;  4KZB A;  4M6B A;  3AZH A;  3A3E A;  4K0W A;  1YUE A;  5B32 A;  2OLU A;  4DE1 A;  5EPH A;  2OSU A;  1RGY A;  2RVQ D;  1LHY A;  2RIQ A;  1P34 D;  1S32 D;  2F2A C;  2BG1 A;  3IXH A;  4JLF A;  2DRW A;  4P0M A;  5DF7 A;  4Y7P A;  2G2W A;  1PZR A;  4H9N B;  1LL9 A;  3L28 A;  3AZM A;  1ZG6 A;  3AFA B;  3L27 A;  5B0Z A;  3MXR A;  4R8P B;  2YFW A;  1MY8 A;  2DF4 C;  2IO5 C;  1NYY A;  4Z2M H;  1YT4 A;  4WU9 D;  2PYO C;  3VP0 A;  1ID3 D;  5DVA A;  3DW0 A;  1P3F D;  4WZ5 A;  3AYW A;  2RL3 A;  3IF6 A;  4BQM A;  4X69 A;  3KWQ B;  4X68 A;  2BYM A;  4R8P C;  2ZM2 A;  3IT9 A;  4NFT A;  2J8Y A;  4OOL A;  4ID4 A;  4EBP A;  1ES4 A;  2DNS A;  1IYO A;  2HPB A;  1ZG4 A;  1JFI A;  2WZZ A;  1ES5 A;  4MEZ A;  1YU0 A;  3AZH B;  5F1G A;  3VFH A;  4E3J A;  5B32 B;  4XUJ C;  2Y2P A;  2WZX A;  3REL A;  3KWQ C;  3X1S A;  5E2E A;  2J8P A;  2G5I C;  1ERO A;  5GT0 A;  4KGC A;  1HVB A;  4E3I A;  5B1M B;  4C6Y A;  3AZH C;  2Y2Q A;  1KX3 D;  5DTK A;  1E4D A;  1MWT A;  3AZM B;  3TU4 A;  3M6B A;  4EBL A;  5B0Z B;  2YFW B;  5GSU D;  4E3M A;  4IBX A;  4PM7 A;  3TG9 A;  4PM9 A;  1P3K D;  5B33 A;  3WAA D;  3EG5 B;  3A3F A;  5B1M C;  3AN2 D;  1CEF A;  3QNC A;  3W99 A;  1BH9 A;  5CHJ A;  4KZ7 A;  3AYW B;  3AV2 A;  3AZM C;  3IF6 B;  1CI9 A;  5FAT A;  1W79 A;  2BYM B;  1KE3 A;  4EV4 A;  2VGK A;  5GXQ B;  3LCE A;  3NQU A;  5AV5 A;  2EX9 A;  3UN7 A;  1KX4 B;  4U0T A;  2ARO A;  1JFI B;  3FYZ A;  1L0D A;  3WS1 A;  4WZ5 C;  3UTB A;  1KGE A;  3V3R A;  4JXG A;  3AYW C;  4J8V A;  4NYY A;  3BEB A;  4ZUX A;  3REL B;  3AZK A;  4LV0 A;  3PBT A;  5GXQ C;  2YFV A;  3X1S B;  3BEC A;  5FQK A;  4J8X D;  2CV5 D;  5AV6 A;  4NET A;  4R4S A;  1KX4 C;  3H0R C;  5GT0 B;  4KGC B;  3MGQ C;  4Z5T A;  4OOM A;  3UT9 C;  3TU4 B;  1W2E A;  1K57 A;  2NZD A;  1TZY A;  5KZH A;  5B33 B;  1NRF A;  3IHB A;  1KX5 B;  5GT0 C;  4KGC C;  1QME A;  3X1T A;  1E25 A;  1TEM A;  3H0M C;  5U47 A;  3W99 B;  4UA6 A;  1ERM A;  1EWZ A;  4JXS A;  4HES A;  1L0E A;  3AV2 B;  2ZY3 A;  3OPL A;  2HP6 A;  3VP4 A;  4E3O A;  4DQY B;  3WA9 A;  2ZD8 A;  3SOI A;  4NE6 A;  3NQU B;  5AV5 B;  4OP8 A;  5B33 C;  2Z2L B;  1KX5 C;  1ESI A;  5E43 A;  3LO7 A;  3PAG A;  3DTM A;  4DRB A;  4DDY A;  3AZI A;  4J8V B;  4ZUX B;  3KSY A;  3AZK B;  2NQB D;  3WS4 A;  1HTA A;  2YFV B;  2PYO D;  4R3J A;  3HLC A;  3LZ1 A;  1O07 A;  4JF6 A;  5AV5 C;  5AV6 B;  1L0F A;  1KU5 A;  1XP4 A;  4OP5 A;  3SS3 A;  3IP4 C;  3MGR A;  3IH8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...