2Y2GA

Penicillin-binding protein 1b (pbp-1b) in complex with an alkyl boronate (a01)
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
486
structure length
466
Chain Sequence
EITYSDGTVIASIDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTGQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PENICILLIN-BINDING PROTEIN 1B
publication title Structure-Guided Design of Cell Wall Biosynthesis Inhibitors that Overcome Beta-Lactam Resistance in Staphylococcus Aureus (Mrsa).
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
total genus 165
structure length 466
sequence length 486
chains with identical sequence B
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2y2gA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2y2gA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2y2gA02
4E3JA 2Y2IA 4P85A 4P87A 1Y54A 2EXAA 3S1YA 4DXBA 4HBTA 4QU3A 2ZQ8A 1GCEA 2HPBA 1EROA 4ZAMA 3PBRA 1K57C 2ZM8A 4PMAA 2Y2PA 5KSCA 3HLDA 3HVFA 2RL3A 3IF5A 2IWCA 4DDSA 4RYEA 2VGKA 3MFDA 5KZHA 3FKWA 3WWXA 2WAEA 3GMWA 5EVIC 5FI2A 4BD1A 4FCFA 4D2OA 4EV4A 1O7EA 4Y0TA 4B4ZA 4JXVA 3MXRA 2Y91A 3NY4A 4JXSA 1K56D 4WZ5A 5HAQA 5BOHA 5CRFA 2HP6A 1N4OA 2OLVA 3NBLA 3GVBA 3C7UA 3IQAA 1ESIA 3C7VA 1PW1A 3PBNA 4OKPA 3HREA 4WZ5C 1MWUA 3G2YA 3G30A 1IYPA 3PBQA 3BFFA 3OCLA 3CMZA 1IYSA 3EQUA 3BRMA 1ES3A 3ZVTA 3SH8A 1K6SA 1KE3A 3WS0A 3LEZA 3HUNA 3WS1A 4C3QA 2PBYA 3MZDA 3OC2A 3G31A 3GSGA 3OPRA 3Q1FA 2PU2A 4BL2A 2XF3A 3MKFA 1L2SA 1PYYA 3D4FA 4PM9A 3RXXA 2WUQA 1BZAA 2HDRA 1SHVA 2ZQAA 3O3VA 1MKIA 5EE8A 2EFUA 1GA0A 3VSKA 4L0LA 3SS4A 3E2LA 5GLCA 3Q7VA 4S2JA 1OMEA 3SOIA 5FSRA 2EXBA 3V3RA 1FR1A 3UE3A 2XDMA 4GD6A 1BLHA 3ZG9B 1YLZA 4UAAA 1FQGA 2XD1A 2J8YA 3MZEA 3AGDA 1O07A 3A3JA 4S2LA 2ZJ9A 4FD8A 4QY5A 4KQRA 2IWBA 2R9WA 3P09A 4JXWA 3FWLA 2ZQ9A 3GR2A 2HP9A 1HVBA 2I72A 3N6IA 4QD4A 5DF7A 5M18A 1L0EA 3VFHA 4N92A 1W8QA 2A3UA 2WYXA 1KDSA 2Z2MB 3Q82A 5DTSA 3OCNA 3G35A 5CEDA 4LCMA 3ITAA 5FI7A 1TVFA 4ZBEA 3W4OA 1RGZA 2HDSA 3N4IA 5DVAA 4EQIA 2WKHA 3BFDA 5GHZA 2WGWB 2BG1A 3A3EA 4U3TA 5GL9A 3HBRA 4ZJ1A 1BUEA 4GDNA 1PW8A 2XD5A 4KZ8A 1Z6FA 3MXSA 1FR6A 3V50A 4S2OA 4LCLA 3QNBA 4GDBA 3UPNA 1ES2A 3DW0A 4PM6A 3OPPA 4WEKA 3IF6B 2Y2HA 3V3SA 5HL1A 1K54A 3ITBA 5EOOA 1G6AA 2XEPA 5CTMA 1PI4A 1NZUA 3EQVA 1W7FA 2QPNA 2GDNA 2VGJA 1BLPA 1MXOA 1WYCA 1JTGA 3FKVA 1PZPA 4WELA 5FQ9A 3B3XA 3DWKA 3UY6A 4U0XA 2ZC3B 3BLMA 4UA6A 4OOMA 4OP8A 1AXBA 1IKGA 1K54C 2OV5A 1PWGA 4E3LA 4BQMA 5DTTA 3FV7A 5DF9A 1XP4A 2Y2GA 3V5MA 4KZ3A 3BFCA 1Q2QA 2XGNA 3NDGA 3UO9A 4ZDXA 5GLAA 3I7JA 1QMFA 3PAGA 2ZC7A 2A49A 3ZG0A 3JYIA 3SS3A 1BTLA 3VFFA 3O87A 4X56A 4OPQA 1JTDA 4KENB 1W8YA 4N1XA 3LY3A 4LV0A 5FI6A 1K57A 1PWDA 5M19A 4Q8IA 2Y2QA 2OSUA 5CGSA 5HX9A 4WBGA 2C5WB 4GD8A 1K55C 5A92A 4BL3A 3IH9A 5EVIA 4X55A 2XLNA 4QB8A 3UPPA 4ID4A 3UPOA 4OONA 2PU4A 4GOGA 2XFSA 4DDYA 4OH0A 3CG5A 5GLDA 3Q81A 3UNWA 4PM7A 4B4XA 3LY4A 4HBUA 3O86A 2ZMAA 2ZQDA 1XXMA 3NCKA 4B88A 2R9XA 2IWDA 2ZLYA 4IVKA 1YLPA 2ZC6B 3IWQA 3IF6C 4OOLA 4FH4A 4JXGA 1SDEA 2XH9A 3IXBA 4M3KA 4R4RA 3PBTA 5EECA 1LI0A 3HLEA 2JCHA 1PWCA 4GNUA 4JF5A 1N9BA 4S2NC 4S2PA 3ZVWA 4JF4A 4IBXA 2XQZA 5FATA 1XX2A 1SDNA 2X01A 4MBKA 2WADA 3WRZA 1SCWA 3G4PA 3W4QA 1JWZA 3GV9A 2B5RA 1XA7A 1ONGA 2EX8A 2QMIA 2V1ZA 1QMEA 1YLJA 2X02A 3ZNTA 3WS2A 3RXWA 4WM9A 2Y2NA 2JE5A 1YLWA 4E3NA 5F1GA 1YMSA 3AGEA 2ZD8A 3SH9A 1LLBA 4BLMA 1BSGA 2JC7A 5GHXA 4Y7PA 3IT9A 2ZC5B 4YFMA 4EBLA 2WZZA 4EWFA 1XGJA 2Y4AA 3HLFA 4R4SA 3ZG7B 3IXHA 4E6XA 2WK0A 4E3KA 3G34A 4X6TA 4A5RA 3BFGA 4XXRA 1ZG6A 1FSWA 1DJCA 1TDLA 2P9VB 3IXDA 4BENA 1JWPA 4RX2A 1K4EA 1YM1A 5DF8A 1ONHA 1ZKJA 4UHUA 1K38A 3QHYA 1VQQA 4R3BA 1NRFA 3FYZA 4Y0UA 3NDEA 4RVAA 3ZDJA 5A90A 3VP4A 4GKUA 4KG6A 3MKEA 1BT5A 3M2KA 3E2KA 5HARA 1GHPA 3P98A 1HZOA 3A3IA 1KGGA 3C5AA 1WE4A 4WYYA 1JWVA 1W79A 1L0GA 1I5QA 2WKIA 1YMXA 3BEBA 3A3FA 4OLGA 4P6BA 5EOEA 5AQBA 4S2MA 4DXCA 5I94A 4Z9QA 4DE3A 4DE2A 1CK3A 4R0QA 1W5DA 1IELA 1KE0A 2G2WA 2E8IA 3IWIA 2Y2OA 1ERMA 5AQ9A 4LV1A 4ZTKA 3CJMA 1H8ZA 1S6RA 1KGFA 1DJAA 2G2UA 5IHVA 1IEMA 4KZ4A 3IXGA 4R3JA 1ZC2A 2C6WB 1U60A 1RP5A 3SH7A 1I2WA 2EX2A 1K4FA 4XUXA 2X71A 2V20A 5CGXA 4EUZA 3HLCA 1EWZA 4KZ9A 3ZG8B 4Y0OA 4P0MA 5E2HA 1S0WA 1NJ4A 2Q9NA 2RCXA 2XK1A 1E3UA 4JBFA 2ZM0A 4YINA 4KQQA 4LV2A 5FA7A 3W8KA 4EBNA 2ZC4B 3TSGA 1CEFA 2UWXA 4DF6A 5EVID 4E6WA 3FZCA 5HW3A 1L0FA 1CI9A 1KDWA 2WZXA 4OQIA 5KSHA 5HFOA 5J8XA 5DTKA 1DY6A 3N8RA 1GHIA 1K55A 4JKTA 2J9PA 3HLWA 1MBLA 3WS5A 1IYOA 1MPLA 4H8RA 2H5SA 1SKFA 5F82A 4X68A 4F94A 4OQHA 2WGWA 4OPZA 5U47A 1TDGA 4FSFA 5G18A 3M6BA 5M1AA 4ZJ3A 5CEBA 1ZG4A 4PM8A 5FAPA 2FFYA 5FQKA 4DE0A 4HEFA 3Q7ZA 3C4PA 3WS4A 5FDHA 3PAEA 3RJUA 4WEJA 1RCJA 3IF6A 5FQMA 1ALQA 1PI5A 4OVDA 3VP3A 2V2FF 2EFXA 4S2NA 1BLCA 3IHBA 2WGIA 4DE1A 1LHYA 4S2KA 5HAPA 5A93A 1XGIA 5E43A 5GLBA 2H10A 1NXYA 3A3DA 4K0WA 2WGVA 4IEDA 4E3MA 4PM5A 3IH8A 4R23A 1Q2PA 5KMWA 5CHMA 3SS5A 1ERQA 2Y59A 3AGFA 1M6KA 4JLFA 4K0XA 5CXWA 3G2ZA 1GA9A 1ES4A 2HDUA 1M40A 3N8SA 4EBPA 5L2FA 3NC8A 4WMCA 5F1FA 2XR0A 5EVLA 5FQJA 3S4XA 3LCEA 4IVIA 4QY6A 1DJBA 1XKZA 1LL5A 1K6RA 1ESUA 4X53A 3C4OA 3ZNYA 1G68A 3PBOA 4GB7A 5D3OA 4KQOA 3Q7VB 2OLUA 3PTEA 2Y2JA 4OQGA 3LO7A 3W4PA 3VSLA 4BJPA 3VP1A 4JPMA 4KZ5A 3HLGA 4MBFA 4MNRA 4RA7A 1J9MA 4S2IA 5E2EA 5FAQA 3ZG5A 3VP0A 2H0TA 3UDFA 4K91A 2ZQ7A 3ISGA 3GTCA 5TR7A 3IWOA 3N7WA 1KVLA 2Y55A 3S22A 3Q07A 3V39A 4DRTA 3HLBA 2H0YA 1C3BA 1BULA 1FOFA 1I2SA 3ZFZA 4HESA 1K25A 3HL9A 1XPBA 2EX6A 2Q9MA 2Z2LB 4E3OA 4E3IA 1BLSA 3GQZA 2BLSA 4WZ4A 4MLLA 5TFQA 5CTNA 1FSYA 2WAFA 3BECA 3HUMA 1K56A 2J9OA 4OPRA 5CHUA 5FQIA 4RX3A 4R1GA 3G32A 2HDQA 4JF6A 5E2FA 4KG5A 1WYBA 4LENA 1PZOA 2ZM2A 5JYOA 4UA7A 4KZAA 4NK3A 4CPKA 5A91A 2FFFB 4MBHA 1MWSA 1KVMA 2Y2KA 3UDXA 3QNCA 4OLDA 1EI5A 1NY0A 1YLYA 1VM1A 4UA9A 1E3UD 1KGEA 1NYMA 5F83A 3NIAA 5TGFA 3M2JA 4IBRA 3ZHHA 4N9KA 3VMAA 4GN2A 1GHMA 4XUZA 4OPYA 2Y2MA 1MWRA 4GZBA 3TG9A 3OPHA 3VOZA 2P9VA 3OZHA 4N9LA 1H8YA 2WKEA 3OPLA 1E4DA 5HAIA 3NI9A 1FCOA 3ZCZA 4BD0A 3VOYA 4U0TA 3PBSA 1ES5A 5FQQA 3UDIA 4FH2A 3ZGAB 3BYDA 4DKIA 3HUOA 3UE1A 5FAOA 2CC1A 3UE0A 4MEZA 3GRJA 1HTZA 3UN7A 5EUAA 1CI8A 4N1HA 3MZFA 4O7DA 5AQAA 2P74A 4QJGA 1LI9A 3O88A 4OP5A 1XA1A 2J7VA 1L0DA 5EVIB 1RGYA 4OQ0A 3DTMA 4PPRA 5JYPA 1YLTA 3BM6A 3IHAA 2DCFA 1FCMA 1HD8A 2DRWA 2XFTA 1LL9A 3MBZA 3M6HA 5CGWA 3VP2A 1KE4A 1MY8A 1JVJA 4KZ6A 1H5XA 5GHYA 4C6YA 2DNSA 3TOIA 4C75A 2HP5A 2Y2LA 1NYYA 1YT4A 1IKIA 2JBFA 5CECA 4OOYA 3BLSA 2QZ6A 4NETA 4WMCD 1TEMA 4KG2A 5FASA 1FCNA 3WRTA 1CEGA 1NZOA 3CZDA 4X69A 5E2GA 1MWTA 4KZ7A 4QHCA 3BFEA 3DWZA 1IYQA 1YQSA 1PIOA 5EPHA 5CHJA 4CJNA 2EX9A 4ZJ2A 2ZQCA 4KZBA 4LV3A 5AQ7A 5CERA 3N8LA 1E25A
chains in the Genus database with same CATH superfamily
3LI8A 3MGPD 2W0NA 1G28A 1FIKA 1Y54A 4P87A 3WAAB 3AN2C 5DKKA 3MVDA 1P3AB 4J8VC 2IA2A 3HVFA 4NYYA 2RL3A 3IF5A 3MFXA 3X1UA 2Q0OA 2HZ5A 2VGKA 2WAEA 4D2OA 2RVQC 5CP6A 4JXSA 2V0WA 3AZKD 5BOHA 4JJNC 3B33A 5CRFA 4PKYA 2OLVA 3GVBA 1Y4OA 1BH9A 3AZJD 3C7VA 2PYRA 4CLCC 4OKPA 2QJ5A 3MNNC 3G2YA 4L9EA 3BFFA 3OCLA 2JKGA 3EQUA 2FH5A 5B2ID 4Z66D 4G91B 1PDCA 2GJ3A 4J8XA 5B0YD 4C3QA 1P3MC 4D60A 3LZ1B 4KQDA 3W98D 3C1BC 3OPRA 4QWOA 3W97D 3AZNA 3MSHA 5EE8A 3KS8A 2V0UA 4L0LA 1ED7A 3SS4A 1S32B 3TJZC 5GLCA 5FDSA 3Q7VA 5L07A 3MXQA 3SOIA 3IBJA 2OAQ1 2HJ9C 1UR8A 1YLZA 2V9AA 2L5AA 5KDMB 4G3WA 1FQGA 2J8YA 3MZEA 5CHLB 1B6WA 1O07A 2KOIA 1D7EA 4S2LA 3MQOA 5AV9B 3O62D 4KUDA 2HP9A 5M18A 3VFHA 3QP2A 5B24C 4E45A 3OCNA 2O0YA 5CEDA 4LCMA 5FUGB 4O8GA 4X1MA 3AZIA 3N4IA 5DVAA 2WKHA 2YFWA 3A3EA 4U3TA 4ZJ1A 3AZHB 1W1PA 3UMEA 3T1RA 5E5AB 2XSSA 4LCLA 4HJ4A 5BO0B 3QNBA 3RH8B 1ES2A 4EUVA 4CSRB 3X1VB 3VH5W 3IF6B 3AZIC 3LIBA 4GLQA 5IS1A 4MCWA 1Q9CA 1ULYA 4YWZA 4EERA 4GH9A 1TAFB 5CTMA 3AN2D 1PI4A 1W7FA 2GDNA 1N1JA 2VGJA 1WYCA 1JTGA 3FKVA 1PZPA 3MQQA 2AVXA 5FQ9A 5J7EA 3B6FA 3LR0A 2ZC3B 3BLMA 4OOMA 1AXBA 5DTTA 3AV1B 3REJB 3BFCA 3MVDD 4OUIA 2ZC7A 3X1UD 4I3JA 2A49A 5G4YA 3U4LP 2YFVB 2VKSA 5B33A 3CPTA 4OPQA 1YAXA 4KENB 5CP6D 4YNRA 1S1ZA 5M19A 4YS3B 3NQUB 3REIB 4DRAA 1OTBA 4DN0A 4WBGA 4R70A 3UPPA 4ID4A 4OONA 2PU4A 4OH0A 5JRGB 3Q81A 4XUJC 5F69A 3A1IA 2ZOHA 3NCKA 3F6TA 3ZYTA 4B88A 3BWLA 3IBRA 4J8XD 4J8UC 2R78A 3IXBA 2AROB 3AFAA 3MGRA 2A24B 3S7PA 4WU9A 4GNUA 3AL0C 1PWCA 3T4KA 3KUYA 5AY8A 1SDNA 1ACFA 3AZND 3LJAB 1SCWA 3NHQA 2B5RA 4WU9C 1XA7A 2QMIA 1KS0A 2V1ZA 4Z5TC 4X23C 1UWPX 3F1OA 5AY8C 3AGEA 2ZD8A 3WAAA 2JC7A 3IT9A 2ZC5B 4EXOA 1KX4B 1D06A 3HLFA 2RTSA 3IXHA 3AZFC 3X1SB 1KX5C 4E3KA 3G34A 4X6TA 5BPVA 1M19B 4KUDD 3M7PA 1TS7A 3WTPC 2VV8A 4BENA 5DF8A 1YM1A 2W1TB 5MC7A 5GT3B 1P9RA 1M18B 5BNXB 1YUEA 1VQQA 4Y0UA 3AZID 4RVAA 5G4ZA 3SZTA 3B0DC 3VP4A 2PYOC 3M2KA 3B0BA 5B40C 2BYMB 3T4LA 2PDRA 4MN7A 4CLCE 1YMXA 5AQBA 5B32B 4MDZA 4ZBJC 4DE2A 3X1TB 4R0QA 1E6NA 2E8IA 2Y2OA 3B6FD 4AWLB 1S6RA 2G5HC 2G2UA 2VZWA 1IEMA 4R3JA 4XZQC 1ZC2A 1S32A 1RP5A 5JA4B 5CPIC 3HLCA 5B33D 4K08A 3EGDC 5KDMA 4NE5A 4YINA 4LV2A 5FA7A 3W8KA 2ZC4B 1P3KC 3B42A 1GXDA 4Q0JA 3T12B 2UWXA 1LSWA 1P3OB 5AV9A 2P08A 3BY9A 4LGWA 5KSHA 5HFOA 2L1MA 5J8XA 5DTKA 3R7WB 3WA9C 4WU8C 2XA7M 1U35B 1TF1A 2Z6DA 2ZY5A 2ZY4A 5FUGA 3KYEA 3LELB 5F82A 4F94A 3IS2B 3AZHA 5G18A 3AFAD 5BS7C 3MGRD 3M6BA 5M1AA 4ZJ3A 4WU9D 1ZG4A 4PM8A 5E5AA 5BO0A 3WS4A 3RJUA 4WEJA 4CSRA 3X1VA 3GDIA 2VQRA 3KUYD 5AY8D 3IF6A 5FQMA 1TAFA 3AZHC 4S2NA 1BLCA 3LI9A 1N9OA 4G3KA 5A93A 1XGIA 5E43A 5GLBA 2H10A 1NXYA 3A3DA 4K0WA 5B31B 3S7NA 5B2JC 4PM5A 1NWZA 3WAAD 5CHMA 2EWVA 1ERQA 4DQYB 2HIOB 1KX3B 3AV1A 3REJA 2HDUA 1M40A 4EBPA 1EAKA 5L2FA 4WMCA 4O01A 3S4XA 2YFVA 2YKHA 3KSFA 5EFWA 2ZM5A 4YS3A 3NQUA 3REIA 4GB7A 3VSLA 2OWHA 4JPMA 4JGPA 4MBFA 5FAQA 5B0YB 5DNMA 3B6GC 2H0TA 3A0VA 3ISGA 3GTCA 5TR7A 3LYXA 5JRGA 1KVLA 3V39A 3UB9A 3REIC 3REKC 2HUEB 3MJQA 4QNLA 1FOFA 4ESPA 1J7MA 2B95A 3ZFZA 5DNMC 1OT6A 4R8PC 2HF6A 3IX8A 3T4QA 1IOUA 4E3OA 2AROA 5GSUB 3GQZA 2A24A 2K31A 5AV6B 2D01A 3W99C 3S7OA 2J9OA 4KHAB 3MGSB 4KG5A 3LJAA 2AROC 5JYOA 4UA7A 4KZAA 4E04A 1S32D 3UTBC 5F99C 1P3KD 2Y2KA 4UQIM 3QNCA 4OLDA 1NY0A 3VH6T 4F3LB 3LJAC 3EWKA 3FKEA 1KGEA 1KX4A 5B0ZB 4EW7A 4IBRA 4N9KA 3X1SA 1H0IA 4Y5FA 4OJLA 5AV9D 1M19A 5GT0C 4XUZA 3QP4A 2Y2MA 4GZBA 5F5YA 3OPHA 5LBRA 1H8YA 1E4DA 2W1TA 5CPKC 4BD0A 5GT3A 4G92B 1M18A 5BNXA 4NXFA 5FQQA 4DKIA 3WTPE 1M19C 2PHYA 3UE1A 5FAOA 1LSVA 3AZHD 3GRJA 1HTZA 4J8VB 5E5AD 3P5JB 1CI8A 4O7DA 3WKJC 2HGVA 2P74A 2BYMA 1K0KA 4B93A 2YKFA 3O88A 2J7VA 5B2JD 1AOIC 5B32A 4II7A 4P6ZM 1EW0A 2ACGA 1LL9A 2FN2A 3MBZA 3X1TA 5CGWA 3VP2A 1KE4A 4JJNB 4C6YA 1X0OA 2KX6A 5B32C 4CLCB 3TU4C 3MNNB 5CECA 3AV1D 4OOYA 3REJD 3T1XA 2NUTC 4WMCD 1TEMA 1O6IA 5JA4A 1E15A 5FASA 1CEGA 1NZOA 3CZDA 1P3MB 2K7SA 3DTIA 1IYQA 1YQSA 3C1BB 4YS3D 3LIFA 3REID 1UGUA 5CHJA 3OBFA 2ZQCA 2G7UA 3N8LA 2Y2IA 5DNMD 4Z2IA 2EXAA 4DXBA 4QU3A 5JRGD 2HPBA 2NQBC 1A0KA 2LB9A 3R7WA 3HLDA 3UB5P 2IWCA 4RYEA 5KZHA 3IS2A 3EOIA 3WWXA 5J3WA 3HCYA 2AROD 4IBIA 1O7EA 4WZ5A 5HAQA 4Q0HA 1GSVA 2RIQA 3N3FA 3EEAA 3LR4A 4JGQA 3LJAD 1E88A 1TS6A 1ESIA 3PBNA 5B24B 3VH6W 4WZ5C 4YM6C 3PBQA 3CMZA 4OJ5A 5B31A 3SH8A 3LZ0C 4I38A 5HDCA 4LPZA 4ETZA 4H9RB 4Y3IA 3LEZA 2HIOA 3HUNA 1KX3A 3WS1A 1KX4D 1J3WA 3MZDA 3OC2A 3G31A 4H9SC 3CAXA 2PU2A 3X1SD 4JGOA 2XF3A 1L2SA 1M19D 1L3LA 5HDSA 3D4FA 4GJ4A 1OTDA 3LR5A 3V67A 1SHVA 1MKIA 3C8CA 5L8MA 4NE3A 3LR3A 5GT3D 1M18D 3F1PB 4EU0A 3LIAA 3V3RA 5B0YA 5AVBC 1AOID 4GD6A 4NE6A 3FPVA 3MR0A 1D1JA 3DAVA 2ZJ9A 3PYPA 4KQRA 3GR2A 1HVBA 5B32D 1V9YA 3N6IA 5GSUA 3SW1A 4N92A 3X1TD 1KDSA 5AV6A 3ULFA 4KHAA 4MB4A 1TVFA 4ZBEA 3W4OA 1DP9A 1F66A 2J3TD 1RGZA 5CPJC 3MGSA 5GHZA 1YSQA 4XUJB 3HBRA 1BUEA 4GDNA 1PW8A 2XD5A 3AZMC 3MXSA 3V50A 4S2OA 3T50A 2J8PA 1HTAA 1BYWA 4NFTA 3DW0A 4WEKA 1F66C 4J8UB 4MB3A 5HL1A 3KSIA 4F3LA 1G6AA 2XEPA 5B0ZA 5TJJA 2GZAA 3B47A 3JVUA 3DWKA 3K3DA 4BQMA 4WU9B 2JKTI 5DF9A 1XP4A 4LRXC 3V5MA 4Z5TB 4X23B 1Q2QA 3UO9A 4ZDXA 4NZ1A 5GLAA 3AZLA 3T4TA 1LL8A 3PAGA 5HWWA 3VFFA 4X56A 3AYWC 1JTDA 2JKTM 4N1XA 1W8YA 4J8VA 3L27A 2ZOIA 4Q8IA 3AZFB 2Y2QA 1KX5B 4IBEA 5CGSA 3AZLC 3NOUC 2C5WB 1K55C 3IH9A 4WJ3C 3WTPB 4NG2A 3H9WA 4DDYA 3CG5A 3KSGA 5GLDA 4FUWA 3L26A 4JJNA 2Y79A 2ZMAA 5BNVB 1XXMA 5B1MC 4HI4A 3B0DB 4IVKA 5B31D 1NRJA 2V8FA 2ZC6B 2PYOB 4CLCA 5B40B 4FH4A 2XH9A 3MNNA 4M3KA 2HIOD 3A6NC 1KX3D 2FZ0A 4JF5A 1N9BA 4GHLA 2X01A 2WADA 4E44A 1P3MA 4ZBJB 1KU5A 2WKPA 3C1BA 1ONGA 2HJEA 2X02A 3ZNTA 3WS2A 5F1GA 2VV7A 4XZQB 4BLMA 5GHXA 3VH5A 4YFMA 2WZZA 3AV2C 2Y4AA 2VEAA 4R4SA 2WK0A 5CPIB 5GXQC 2I9VA 1T19A 2UV0E 3BFGA 4XXRA 3A0SA 1FSWA 5GSUD 3EPHA 1JWPA 1K4EA 2QKPA 5EM0A 1ZKJA 5AV6D 4IHQA 1P3KB 1YU4A 3WX7A 2BTFP 3BW6A 3QHYA 1F66D 2B02A 3NDEA 3MGSD 5A90A 1OGGA 3MKEA 5B24A 4WU8B 3WA9B 5DJTA 1GHPA 3P98A 4G3VA 1KGGA 3C5AA 1WE4A 2IO5C 4J8WC 1W79A 4GW9A 3BEBA 1E6PA 2NZDC 4HMEA 4H9RA 4BBTA 2V8CA 5I94A 5B0ZD 2QJ7A 5B1LC 3EEHA 1W5DA 1IELA 1UWNX 3KYZA 3CJMA 1KGFA 2JKRM 4MMNA 4KZ4A 3IXGA 4HIAA 1K4FA 3F1PA 3AZLD 5B2JB 4EUZA 4NZ4A 4IBJA 3JVVA 3ZG8B 1TZYC 4P0MA 2PT7A 1NJ4A 2Q9NA 4J8VD 1E3UA 4JBFA 1M1AC 3TSGA 3DBAA 4ZUXC 4E6WA 2RVQD 2BASA 3FZCA 5HW3A 4QPRA 3R4KA 1KDWA 3IP4C 4JJND 3E0YA 3B6GB 1MBLA 1MPLA 4H8RA 4CLCD 4XUJA 3MNND 1TDGA 4NKPA 2XA7S 2BYKB 3REKB 3AZGC 5FQKA 2FFYA 4HEFA 5DNMB 4R8PB 4J8UA 3VP3A 1P3MD 3WD4A 3R45B 3KX0X 2EFXA 3C1BD 3W99B 3LICA 4IBFA 2WGIA 4DE1A 3NQJB 2GNXA 4E3MA 3A1KA 1Q2PA 2PR6A 1JNUA 3UTBB 3EPKA 3AGFA 4L9FA 1M6KA 4FOFA 4JLFA 5F99B 4Z5TA 1T3UA 5AV8C 4X23A 1ES4A 2W3HA 2QWSA 3G2ZA 5J4EA 2E8JA 1LSXA 5F1FA 3AZEC 3EGXC 1P3PC 4Z2HA 5FQJA 3LCEA 5A8BA 1NLYA 4IVIA 1DJBA 1XKZA 4LFUA 3ZNYA 1R4VA 5D3OA 3AZFA 1KX5A 3MQ0A 2OLUA 2Y2JA 5GT0B 3LO7A 4BJPA 3VP1A 3HLGA 1J9MA 4R38A 3WTPA 3UDFA 5CPKB 3IWOA 5B24D 2Y55A 3N7WA 4Y17A 2H0YA 4DRBA 5B1LD 5BNVA 2W3GA 1I2SA 4HESA 2PYOA 2IOUA 5B40A 2Z2LB 1TS0A 1H3QA 2BLSA 4WZ4A 3WKJB 3MGQC 4PKYG 2F8NB 3BECA 3HUMA 1K56A 3VOLA 4BWIA 3G32A 1AOIB 1F98A 1W1YA 2HDQA 5HD3A 2O9CA 4CPKA 3LEQA 4Z2MH 1WWIA 1MWSA 3UDXA 2JHEA 3TU4B 1YU3A 4XZQA 1YLYA 2FJ7C 1E3UD 1NYMA 4QLCC 1PZRA 4WUJA 5TGFA 3M2JA 3T4OA 2PYPA 3PR6A 4UQIS 4BBUA 5CPIA 1XJ2A 3P7NA 1MWRA 5AVFA 1H8PA 2WKEA 1P3KA 3HONA 2VLGA 3PBSA 4LD9C 4U0TA 3W96C 1F1EA 1CXWA 3HUOA 4H9QA 4I3AA 1G6OA 4MB5A 4MEZA 3UE0A 2D02A 4XUJD 5HWTA 2NQBB 3WA9A 4WU8A 5EUAA 5F68A 2P04A 4OP5A 3S7QA 1GSWA 1L0DA 4J8UD 4LRZE 4HY8A 3DTMA 5BS7A 2DRWA 2XFTA 4X1LA 3CITA 2CMNA 1ZTUA 3QP8A 5AVCC 3TOIA 2W27A 4ARZB 2VV6A 2Y8HA 4C75A 1IKIA 1EQZC 4Z5TD 4X23D 1OJ5A 3BLSA 1E8BA 4YM6B 4NETA 3KWQC 4EESA 5B2JA 4KG2A 1P3LC 4I39A 1FCNA 2W8SA 3LZ0B 2P7JA 3WRTA 4PHTA 1MWTA 4QHCA 3DWZA 2ZBBA 3AZFD 1KX5D 1CJFA 3KSHA 4ZJ2A 5AQ7A 5CERA 5KMWA 1E25A 1WWSA 3WTPD 1P3FB 4E3JA 4P85A 3S1YA 4HBTA 2ZQ8A 1GCEA 4GCZA 3H82B 3PBRA 1K57C 2ZM8A 4PMAA 2Y2PA 5KSCA 3B6GA 5AVBB 2PYOD 4DDSA 3FKWA 5B40D 5FI2A 5EVIC 4EV4A 5HWVA 2BYKA 3REKA 1BFMA 4JGRA 4JXVA 2Y91A 4B4ZA 1K56D 4NEED 2HP6A 1N4OA 4R8PA 2HV1A 1P3BC 3NBLA 3C38A 3C7UA 3R45A 4TX8A 3IQAA 1PW1A 3W99A 1OTEA 2OOLA 1S1YA 3HREA 2G5IC 3NQJA 1XJ3A 1Y28A 5CPJB 1IYSA 3L28A 2MJ6A 3BRMA 3ZVTA 4XZQD 1K6SA 2PAVP 2INWA 3WS0A 3UTBA 3AZMB 5F99A 2PBYA 1GPFA 3GSGA 4Q0IA 1F66B 5CPID 3V9RB 3KXBC 2HDRA 1S66L 3F1NB 3O3VA 3E2LA 4S2JA 5AVEA 1OMEA 5GT0A 2EXBA 3D3OA 3UE3A 1VHMA 3W2ZA 2XDMA 2QHKA 4IUHA 3ZG9B 5CPKA 4UAAA 3WA9D 4WU8D 5AV5C 2XD1A 2CWEA 2F2AC 4QY5A 2IWBA 2R9WA 3P09A 3AYWB 4JXWA 2ZQ9A 5I5LA 1P9WA 2I72A 4NZ3A 4QD4A 1L0EA 3WKJA 1W8QA 2WYXA 3AZLB 2F8NA 2EA9A 3ITAA 3MF0A 5FI7A 4WZSB 1P3LD 1AOIA 2VJWA 2HDSA 3BFDA 4ZRRA 2BG1A 5GL9A 4KZ8A 2K2NA 2XROA 1Z6FA 5B1MB 3NJAA 3CI6A 3OPPA 3TU4A 2Y2HA 3V3SA 3A6NB 3BY8A 5EOOA 3EQVA 1BLPA 1W2EA 3BJNA 4CAYB 3EPJA 4GHAA 3B3XA 3UY6A 4U0XA 1E6ZA 4IBDA 3VH6A 4E3LA 2OV5A 1PWGA 2Y2GA 4KZ3A 1P34C 4H6JB 2VGLM 3NDGA 3B6GD 1P3BD 4EQ1A 3ZG0A 1BTLA 3O87A 2NQBA 3AV2B 3LY3A 3REKD 4LV0A 5FI6A 1PWDA 4IJGA 5GXQB 1VEUB 1XFNA 3C30A 3E4PA 5HX9A 4R8PD 3VE4A 4BL3A 1KOUA 1OTAA 2PD8A 4LG2A 3RFBA 3W99D 2V5OA 3UNWA 4PM7A 4B4XA 4GHIB 4Y15A 4HBUA 3O86A 2CV5C 2LY8A 2R9XA 2IWDA 2ZLYA 5EM1A 1YLPA 3UE6A 3IWQA 4ARZA 4OOLA 3UMDA 4JXGA 3UTBD 4R4RA 5EECA 5F99D 1LI0A 1H3OB 4YM6A 2IO5B 4J8WB 4WL9A 4JF4A 4IBXA 3REHC 2XQZA 3KFUG 2NZDB 3LZ0A 4MBKA 3WRZA 3UTAC 3G4PA 3W4QA 5B1LB 4H9SA 2ZY2A 1MZUA 1ZLAC 2EX8A 3E4OA 1QMEA 3C1CC 5GT0D 3RXWA 1P3IC 1YLWA 1P3FA 3RELC 3UT9C 1LLBA 5CPKD 1BSGA 4EWFA 4Y7PA 4EBLA 3H82A 1XGJA 2O99A 4E6XA 1P3GC 5AVBA 1P3FC 1TZYB 1ID3C 1ZG6A 3NECA 1DJCA 3MGPC 3D72A 3IXDA 3WKJD 1ONHA 2F8NH 1M1AB 4IUKA 1N9LA 2F8ND 3H7WB 4H9NB 1K38A 4ZUXB 3KSYA 4BBVA 4R3BA 1NRFA 3FYZA 4KGCB 3QP1A 1UR9A 3VV4A 3A3IA 1SKOB 5EVEA 4WYYA 5CPJA 1JWVA 2PRFA 4IJEA 1I5QA 3LIDA 3TU4D 3AZKC 4P6BA 3A3FA 5EOEA 4S2MA 3AZGB 3AZMA 1YSPA 4DJ3A 3AZJC 3L25A 3FG8A 1KE0A 3V9RA 2G2WA 5G49B 1H0GA 5AQ9A 4LV1A 2PBDP 1H8ZA 1DJAA 4LRYC 3F1NA 1BH8B 5B2IC 4Z66C 2C6WB 2L0WA 2ZMVA 4XUXA 3W98C 2V20A 3CUEC 5CGXA 4FTXA 4KZ9A 3W97C 2NQBD 5AV8B 5E2HA 2XK1A 4R6LA 5TBMB 3AZEB 4EBNA 2F8NK 1P3PB 1CEFA 3VE3A 3AYWA 2V1BA 2W3DA 3U2AA 1L0FA 1CI9A 2WZXA 2JN7A 4OQIA 3N8RA 1CK7A 1K55A 4EEPA 3HLWA 3T4SA 3WS5A 1IYOA 5C3IC 2H5SA 2W1RA 3O62C 4YM6D 5FAPA 4DE0A 5B1MA 1H0MA 5FDHA 3PAEA 4IBCA 1RCJA 3LZ0D 3A6NA 1ALQA 1PI5A 2J80A 3HSHA 4OVDA 3MGQB 4OJ6A 2WKQA 1LT0A 4S2KA 4CAYA 1P3FD 2WGVA 4IEDA 4NZ5A 3IH8A 4R23A 3SS5A 4KUKA 5CXWA 3N8SA 4H6JA 3NC8A 3ZQ5A 5AVBD 2FJ7B 4X53A 1K6RA 1OJGA 3AV2A 4QLCB 1G68A 5GXQA 4IJFA 1VEUA 3PTEA 4OQGA 3MVDC 1W63M 2M7UA 3RXXA 4RA7A 5E2EA 1T1CA 4WNNB 4KUOA 3X1UC 2ZL1B 4DRTA 4LD9B 4GHIA 3W96B 5CP6C 1OTIA 4B9OA 5CPJD 1C3BA 2O9AA 2O9BA 1K25A 3HL9A 2Q9MA 4HMCA 3AZMD 4E3IA 1IFQA 1H3OA 4MLLA 4J8WA 3OOVA 4WLAA 1FSYA 4H9QB 4OPRA 1W63Q 4R1GA 1ZHHB 2NZDA 3FC7A 4JF6A 5E2FA 3ICYA 1WYBA 4LENA 4OJOA 2B18A 4AFIA 3H0LC 5B1LA 4NK3A 4J8XC 3L29A 5B31G 5A91A 2FFFB 4MBHA 5AVCB 3CWFA 2JKRI 1EI5A 3B0CT 1EQZB 1VM1A 4UA9A 4HGAC 3AZNC 3KWQB 3NIAA 1QO6A 3ZHHA 1P3LB 4PAUA 4GN2A 2VA0A 3AYWD 1TZYA 4OPYA 4H9PB 3TG9A 3OZHA 5HAIA 3OPLA 3QP5A 1M1AA 3NI9A 2PR5A 3H7WA 3VOYA 5HL6A 4H9NA 4ZUXA 1ES5A 3A0RA 3MS6A 3UDIA 3JPUA 3ZGAB 3BYDA 4KGCA 2H28A 2CC1A 4M4XA 2QYBA 1YPRA 4KUDC 5B1MD 1SKOA 3MZFA 5AQAA 4HJ3A 1OPXA 4KGCC 1XA1A 5EVIB 3A6ND 1RGYA 4PPRA 5JYPA 3BM6A 5L09A 3AZGA 2DCFA 1FCMA 1HD8A 3CHWP 3M6HA 3MMHA 1MY8A 1DRMA 1P3BB 5G49A 4KZ6A 4UEYA 3EG5B 2DNSA 2HP5A 1NYYA 2JBFA 1YT4A 3IX3A 1BH8A 5DNNB 2QZ6A 2V1AA 5BT1C 3FPWA 4X69A 3B6FC 3WD1A 1PRQA 5AV8A 3AV2D 5KIZA 3HJKA 5TBMA 3AZEA 1W1TA 5GXQD 3KXBB 1P3PA 2EX9A 4KZBA 4LV3A 2VK3A 2EWWA 5B33C 1HQ3B 5FEGA 1EROA 4ZAMA 3O5YA 1GSXA 3HJIA 5IT5A 3MFDA 1Z2CB 3GMWA 5AV5B 4BD1A 3KYQA 4FCFA 1XJ6A 4Y0TA 3MXRA 3TE8A 4J8WD 4BMWA 3NY4A 1P0ZA 2NZDD 3H0RC 1P97A 3RTYA 3MGQA 4H9OB 3KO6A 3AFAC 3MGRC 3B0CW 1MWUA 3G30A 1IYPA 1ES3A 4MN6A 1KE3A 3KUYC 4I3IA 3NULA 5HZHA 1YKDA 3GECA 3Q1FA 4BL2A 3MKFA 1P3AA 1PYYA 1CQAA 2ZMFA 1TZYD 4PM9A 2FJ7A 2WUQA 1BZAA 1S67L 2ZQAA 4QLCA 2EFUA 1HLUP 1GA0A 1M1AD 3WAAC 3VSKA 5DJUA 4ZUXD 2W3FA 5FSRA 1P3AC 4KGCD 5AJGA 1FR1A 2M7VA 4WNNA 5K5BA 1BLHA 4IBKA 2ZL1A 5DFXA 1P34B 4LD9A 3W96A 2VX8A 3UB8A 3AGDA 3A3JA 3L9KA 4FD8A 5DFYA 3FWLA 3AZGD 5FEFA 5DF7A 3T1QB 4OJPA 2Z2MB 2A3UA 3Q82A 5DTSA 3LZ1A 3G35A 3NOPC 4XT2B 5BT1D 4Z2JA 1YU0A 4EQIA 2W3EA 2WGWB 4G91C 1VB6A 2CV5B 1FR6A 4IBGA 3LZ1C 4GDBA 3UPNA 5AVCA 4NXBA 2Z6CA 2OWJA 4PM6A 2JKFA 1EQZA 1K54A 5AV8D 3ITBA 4O0PA 1NZUA 4UUZB 3KWQA 3AZED 2QPNA 3BQAA 3REHB 1P3PD 1P3LA 1MXOA 1S32C 3DTKA 4P6ZS 4WELA 4H9PA 4UA6A 3UTAB 4OP8A 2D49A 1IKGA 1K54C 1WA9A 1ZLAB 3E4QA 3FV7A 1OT9A 3C1CB 1E6RA 4Z2MG 5C5KA 4Z2GA 1P3IB 2XGNA 1VETB 3I7JA 1QMFA 1PFLA 3RELB 3UT9B 3JYIA 3SS3A 5AV9C 4WN5A 3G6OA 1F9IA 4HHDA 2VGLS 1K57A 3KS4A 1P3GB 2OSUA 1ID3B 2A2LA 4GD8A 5A92A 4ETXA 4I5SA 2KLIA 5EVIA 3K3CA 4X55A 3MGPB 2XLNA 4QB8A 3UPOA 3MGQD 4GOGA 2XFSA 4Z2KA 2DF4C 3LY4A 1P3BA 2ZQDA 5E5AC 3IX4A 4M6BA 3X1VC 4HH2A 1OGBA 3IF6C 1SDEA 4EO5B 3PBTA 3NOTC 4HQAA 5DNNA 4Z1WA 3HLEA 2JCHA 3PXPA 4S2NC 3ZVWA 4S2PA 3AZKB 1P3AD 1DP6A 1S4SA 4DJ2A 5FATA 2FJ7D 2DQNC 1XX2A 1ODVA 4QLCD 3AZJB 2ZY3A 1JWZA 3GV9A 5DNNC 5F6AA 3KXBA 1YLJA 3AV1C 3REJC 4WM9A 1MC0A 2Y2NA 2JE5A 4E3NA 1YMSA 4Z66B 5B2IB 3SH9A 4LD9D 1HQ3A 5FL3A 3W96D 3EPLA 3W98B 3ZG7B 4YS3C 3UB7A 3L7HA 2XRNA 4A5RA 3W97B 5AV5A 1TDLA 2P9VB 4RX2A 1HQ3C 3WD0A 1V9ZA 4UHUA 5JRGC 1JFIB 4CQHA 3LZ1D 1YU2A 3DTEA 4GS9B 1S4RA 3LFVA 1T1AA 3ZDJA 3T1SA 4HMDA 4GKUA 4KG6A 4H9OA 1BT5A 2OAP1 3E2KA 3UB6A 5HARA 1HZOA 4NY2A 4R3AA 5AVCD 1B67A 5C3IB 1L0GA 2WKIA 4OLGA 2L4RA 3O62B 5HPIA 1EQZD 4DXCA 3KWQD 4Z9QA 4DE3A 1CK3A 4HH3A 3IWIA 1ERMA 4ZTKA 5IHVA 4MN5A 1U60A 3SH7A 4Y2FA 2KDKA 1I2WA 1KX4C 2EX2A 1T1BA 2X71A 3D9YA 1XJ4A 3X1SC 3TRCA 3CLOA 1EWZA 3OLOA 4Y0OA 1P34A 1S0WA 2RCXA 3AN2B 4HJ6A 2ZM0A 3BQ8A 4KQQA 4LLOB 3FDDA 5HD5A 5GT3C 4YOFA 4DF6A 1M18C 1YU1A 5EVID 1AIWA 3X1VD 4ME4A 2M1CA 2LB5A 5HSQA 1DY6A 3MVDB 1GHIA 4JKTA 2J9PA 4XT2A 3PHYA 3L2AA 3X1UB 1SKFA 4X68A 4OQHA 2WGWA 1FILA 4OPZA 4X25A 5U47A 4FSFA 5DNND 5CP6B 5CEBA 2CV5A 3Q7ZA 3C4PA 3X1TC 4NYUA 1H8MA 2V2FF 1NLZA 4AWLC 2J3TC 1BH9B 4UUZA 3KXBD 3REHA 3IHBA 1LHYA 5HAPA 4WV4B 3UTAA 1P3OA 5L10A 4J8XB 1ZLAA 2Y59A 3QP6A 1HQ3D 4HNBA 4K0XA 3C1CA 1GA9A 1P3IA 1VETA 4HP4A 2XR0A 1U35A 5EVLA 3RELA 4NXEA 3UT9A 1P3OC 3LELA 4HGAB 5AV5D 4QY6A 3AZNB 1LL5A 1ESUA 3C4OA 3PBOA 5IU1A 4KQOA 1P3GA 3Q7VB 4HOIA 1ID3A 3W4PA 1U35C 4MNRA 1GOIA 4KZ5A 4S2IA 3ZG5A 3LELC 3MGPA 3VP0A 1XFQA 1CF0A 2ZQ7A 4K91A 2DMWA 3S22A 3WD2A 2GX5A 3Q07A 1AWIA 1TD5A 3HLBA 4NXGA 1TS8A 3LUQA 4RQ9A 4Y13A 1BULA 3K2NA 1G5UA 4KUDB 3TW8A 1XPBA 2EX6A 1BLSA 5TFQA 4UPKA 5CTNA 1F5MA 2WAFA 5FQIA 5CHUA 3AZKA 1STZA 4RX3A 4L9GA 3LGOA 1Z09A 2NUPC 3AZIB 4IBBA 5HDDA 4EEUA 1PZOA 5B31C 2YFWB 2ZM2A 4EO5C 3AZJA 2J3WA 1W1VA 2HIOC 1SZVA 1KX3C 1KVMA 3H0MC 5B2IA 4Z66A 1A7WA 3WD3A 1P34D 1MKMA 5F83A 3W98A 4WF0A 1N1JB 3CUEA 3VMAA 4DMZA 1GHMA 3B6FB 3W97A 3VOZA 5B0YC 2P9VA 4N9LA 3P01A 1FCOA 3ZCZA 1JFIA 4GS9A 5HPFA 2JSSA 1F2KA 4FH2A 2HUEC 3LIEA 5B33B 3CPTB 3UN7A 2CV5D 4Z2LA 5GSUC 1DP8A 2PD7A 4N1HA 4EETB 4HP9A 4QJGA 5AV6C 1LI9A 5EV0A 3C2WA 3O62A 4OQ0A 1YLTA 3IHAA 5DKLA 2F8NG 3MGSC 3REHD 1JVJA 3T4JA 1H5XA 5GHYA 3UTAD 3MQLA 1P3OD 2Y2LA 1ZLAD 1L6JA 3C1CD 3AFAB 3MGRB 1P3ID 5B32G 2WKRA 5B0ZC 1U35D 3RELD 3UT9D 1T18A 3KUYB 5CX7A 5AY8B 3LELD 1PNEA 5E2GA 4KZ7A 3BFEA 3AN2A 3VH5T 1PIOA 5EPHA 1P3GD 1N9NA 4CJNA 1ID3D 4G92C 3F1OB 3E98A
chains in the Genus database with same CATH topology
3MGPD 4P87A 1Y54A 3WAAB 3AN2C 3MVDA 1P3AB 4J8VC 3HVFA 4NYYA 2RL3A 3IF5A 3X1UA 2VGKA 2WAEA 4D2OA 2RVQC 5CP6A 4JXSA 3AZKD 5BOHA 4JJNC 5CRFA 2OLVA 3GVBA 1BH9A 3AZJD 3C7VA 4OKPA 3MNNC 3G2YA 3BFFA 3OCLA 3EQUA 5B2ID 4Z66D 4G91B 4J8XA 5B0YD 4C3QA 1P3MC 3LZ1B 3W98D 3C1BC 3OPRA 3W97D 3AZNA 5EE8A 3KS8A 4L0LA 3SS4A 1S32B 5GLCA 3Q7VA 3SOIA 1YLZA 2L5AA 5KDMB 1FQGA 2J8YA 3MZEA 5CHLB 1B6WA 1O07A 4S2LA 5AV9B 3O62D 4KUDA 2HP9A 5M18A 3VFHA 5B24C 4E45A 3OCNA 5CEDA 4LCMA 5FUGB 3AZIA 3N4IA 5DVAA 2WKHA 2YFWA 3A3EA 4U3TA 4ZJ1A 3AZHB 5E5AB 4LCLA 5BO0B 3QNBA 1ES2A 4CSRB 3X1VB 3VH5W 3IF6B 3AZIC 1Q9CA 1ULYA 4GH9A 1TAFB 5CTMA 3AN2D 1PI4A 1W7FA 2GDNA 1N1JA 2VGJA 1WYCA 1JTGA 3FKVA 1PZPA 5FQ9A 3B6FA 2ZC3B 3BLMA 4OOMA 1AXBA 5DTTA 3AV1B 3REJB 3BFCA 3MVDD 4OUIA 2ZC7A 3X1UD 2A49A 2YFVB 5B33A 4OPQA 4KENB 5CP6D 5M19A 4YS3B 3NQUB 3REIB 4DRAA 4WBGA 3UPPA 4ID4A 4OONA 2PU4A 4OH0A 5JRGB 3Q81A 4XUJC 3A1IA 3NCKA 3F6TA 4B88A 4J8XD 4J8UC 3IXBA 2AROB 3AFAA 3MGRA 4WU9A 4GNUA 3AL0C 1PWCA 3KUYA 5AY8A 1SDNA 3AZND 3LJAB 1SCWA 2B5RA 4WU9C 1XA7A 2QMIA 2V1ZA 4Z5TC 4X23C 5AY8C 3AGEA 2ZD8A 3WAAA 2JC7A 3IT9A 2ZC5B 1KX4B 3HLFA 3IXHA 3AZFC 3X1SB 1KX5C 4E3KA 3G34A 4X6TA 5BPVA 1M19B 4KUDD 3WTPC 4BENA 5DF8A 1YM1A 5GT3B 1M18B 5BNXB 1YUEA 1VQQA 4Y0UA 3AZID 4RVAA 3B0DC 3VP4A 2PYOC 3M2KA 3B0BA 5B40C 2BYMB 1YMXA 5AQBA 5B32B 4ZBJC 4DE2A 3X1TB 4R0QA 2E8IA 2Y2OA 3B6FD 4AWLB 1S6RA 2G5HC 2G2UA 1IEMA 4R3JA 4XZQC 1ZC2A 1S32A 1RP5A 5JA4B 5CPIC 3HLCA 5B33D 5KDMA 4NE5A 4YINA 4LV2A 5FA7A 3W8KA 2ZC4B 1P3KC 2UWXA 1P3OB 5AV9A 5KSHA 5HFOA 5J8XA 5DTKA 3WA9C 4WU8C 1U35B 2ZY5A 2ZY4A 5FUGA 3LELB 5F82A 4F94A 3AZHA 5G18A 3AFAD 5BS7C 3MGRD 3M6BA 5M1AA 4ZJ3A 4WU9D 1ZG4A 4PM8A 5E5AA 5BO0A 3WS4A 3RJUA 4WEJA 4CSRA 3X1VA 2VQRA 3KUYD 5AY8D 3IF6A 5FQMA 1TAFA 3AZHC 4S2NA 1BLCA 5A93A 1XGIA 5E43A 5GLBA 2H10A 1NXYA 3A3DA 4K0WA 5B31B 5B2JC 4PM5A 3WAAD 5CHMA 1ERQA 4DQYB 2HIOB 1KX3B 3AV1A 3REJA 2HDUA 1M40A 4EBPA 5L2FA 4WMCA 3S4XA 2YFVA 2ZM5A 4YS3A 3NQUA 3REIA 4GB7A 3VSLA 4JPMA 4MBFA 5FAQA 5B0YB 5DNMA 3B6GC 2H0TA 3ISGA 3GTCA 5TR7A 5JRGA 1KVLA 3V39A 3REIC 3REKC 2HUEB 4QNLA 1FOFA 3ZFZA 5DNMC 4R8PC 4E3OA 2AROA 5GSUB 3GQZA 5AV6B 3W99C 2J9OA 4KHAB 3MGSB 4KG5A 3LJAA 2AROC 5JYOA 4UA7A 4KZAA 1S32D 3UTBC 5F99C 1P3KD 2Y2KA 3QNCA 4OLDA 1NY0A 3VH6T 3LJAC 3FKEA 1KGEA 1KX4A 5B0ZB 4IBRA 4N9KA 3X1SA 4OJLA 5AV9D 1M19A 5GT0C 4XUZA 2Y2MA 4GZBA 3OPHA 1H8YA 1E4DA 5CPKC 4BD0A 5GT3A 4G92B 1M18A 5BNXA 5FQQA 4DKIA 3WTPE 1M19C 3UE1A 5FAOA 3AZHD 3GRJA 1HTZA 4J8VB 5E5AD 3P5JB 1CI8A 4O7DA 3WKJC 2P74A 2BYMA 3O88A 2J7VA 5B2JD 1AOIC 5B32A 1LL9A 3MBZA 3X1TA 5CGWA 3VP2A 1KE4A 4JJNB 4C6YA 5B32C 3TU4C 3MNNB 5CECA 3AV1D 4OOYA 3REJD 4WMCD 1TEMA 5JA4A 5FASA 1CEGA 1NZOA 3CZDA 1P3MB 1IYQA 1YQSA 3C1BB 4YS3D 3REID 5CHJA 2ZQCA 3N8LA 2Y2IA 5DNMD 2EXAA 4DXBA 4QU3A 5JRGD 2HPBA 2NQBC 3HLDA 2IWCA 4RYEA 5KZHA 3WWXA 2AROD 4IBIA 1O7EA 4WZ5A 5HAQA 2RIQA 3N3FA 3LJAD 1ESIA 3PBNA 5B24B 3VH6W 4WZ5C 4YM6C 3PBQA 3CMZA 4OJ5A 5B31A 3SH8A 3LZ0C 4H9RB 3LEZA 2HIOA 3HUNA 1KX3A 3WS1A 1KX4D 3MZDA 3OC2A 3G31A 4H9SC 2PU2A 3X1SD 2XF3A 1L2SA 1M19D 3D4FA 1SHVA 1MKIA 4NE3A 5GT3D 1M18D 3V3RA 5B0YA 5AVBC 1AOID 4GD6A 4NE6A 2ZJ9A 4KQRA 3GR2A 1HVBA 5B32D 3N6IA 5GSUA 4N92A 3X1TD 1KDSA 5AV6A 4KHAA 3W4OA 1TVFA 4ZBEA 1F66A 1RGZA 5CPJC 3MGSA 5GHZA 4XUJB 3HBRA 1BUEA 4GDNA 1PW8A 2XD5A 3AZMC 3MXSA 3V50A 4S2OA 2J8PA 1HTAA 4NFTA 3DW0A 4WEKA 1F66C 4J8UB 5HL1A 1G6AA 2XEPA 5B0ZA 3DWKA 4BQMA 4WU9B 5DF9A 1XP4A 3V5MA 4Z5TB 4X23B 1Q2QA 3UO9A 4ZDXA 4NZ1A 5GLAA 3AZLA 3PAGA 3VFFA 4X56A 3AYWC 1JTDA 4N1XA 1W8YA 4J8VA 3L27A 4Q8IA 3AZFB 2Y2QA 1KX5B 4IBEA 5CGSA 3AZLC 2C5WB 1K55C 3IH9A 4WJ3C 3WTPB 4DDYA 3CG5A 5GLDA 3L26A 4JJNA 2ZMAA 5BNVB 1XXMA 5B1MC 3B0DB 4IVKA 5B31D 2ZC6B 2PYOB 5B40B 4FH4A 2XH9A 3MNNA 4M3KA 2HIOD 3A6NC 1KX3D 4JF5A 1N9BA 4GHLA 2X01A 2WADA 4E44A 1P3MA 4ZBJB 1KU5A 3C1BA 1ONGA 2X02A 3ZNTA 3WS2A 5F1GA 4XZQB 4BLMA 5GHXA 3VH5A 4YFMA 2WZZA 3AV2C 2Y4AA 4R4SA 2WK0A 5CPIB 5GXQC 3BFGA 4XXRA 1FSWA 5GSUD 3EPHA 1JWPA 1K4EA 1ZKJA 5AV6D 1P3KB 1YU4A 3WX7A 3QHYA 1F66D 3NDEA 3MGSD 5A90A 3MKEA 5B24A 4WU8B 3WA9B 1GHPA 3P98A 1KGGA 3C5AA 1WE4A 2IO5C 4J8WC 1W79A 3BEBA 2NZDC 4H9RA 5I94A 5B0ZD 5B1LC 1W5DA 1IELA 3CJMA 1KGFA 4KZ4A 3IXGA 1K4FA 3AZLD 5B2JB 4EUZA 4NZ4A 4IBJA 3ZG8B 1TZYC 4P0MA 1NJ4A 2Q9NA 4J8VD 1E3UA 4JBFA 1M1AC 3TSGA 4ZUXC 4E6WA 2RVQD 3FZCA 5HW3A 1KDWA 3IP4C 4JJND 3B6GB 1MBLA 1MPLA 4H8RA 4XUJA 3MNND 1TDGA 2BYKB 3REKB 3AZGC 5FQKA 2FFYA 4HEFA 5DNMB 4R8PB 4J8UA 3VP3A 1P3MD 3R45B 2EFXA 3C1BD 3W99B 4IBFA 2WGIA 4DE1A 3NQJB 4E3MA 3A1KA 1Q2PA 3UTBB 3EPKA 3AGFA 1M6KA 4JLFA 5F99B 3G2ZA 4Z5TA 1T3UA 5AV8C 4X23A 1ES4A 5F1FA 3AZEC 1P3PC 5FQJA 3LCEA 4IVIA 1DJBA 1XKZA 3ZNYA 1R4VA 5D3OA 3AZFA 1KX5A 2OLUA 2Y2JA 5GT0B 3LO7A 4BJPA 3VP1A 3HLGA 1J9MA 3WTPA 3UDFA 5CPKB 3IWOA 5B24D 2Y55A 3N7WA 2H0YA 4DRBA 5B1LD 5BNVA 1I2SA 4HESA 2PYOA 2IOUA 5B40A 2Z2LB 2BLSA 4WZ4A 3WKJB 3MGQC 2F8NB 3BECA 3HUMA 1K56A 3G32A 1AOIB 2HDQA 4CPKA 4Z2MH 1WWIA 1MWSA 3UDXA 3TU4B 1YU3A 4XZQA 1YLYA 2FJ7C 1E3UD 1NYMA 4QLCC 1PZRA 5TGFA 3M2JA 5CPIA 1MWRA 2WKEA 1P3KA 3HONA 4U0TA 3PBSA 4LD9C 3W96C 1F1EA 3HUOA 4H9QA 3UE0A 4MEZA 4XUJD 2NQBB 3WA9A 4WU8A 5EUAA 4OP5A 1L0DA 4J8UD 3DTMA 5BS7A 2DRWA 2XFTA 5AVCC 3TOIA 4C75A 1IKIA 1EQZC 4Z5TD 4X23D 3BLSA 4YM6B 4NETA 3KWQC 5B2JA 4KG2A 1P3LC 1FCNA 2W8SA 3LZ0B 3WRTA 1MWTA 4QHCA 3DWZA 3AZFD 1KX5D 4ZJ2A 5AQ7A 5CERA 5KMWA 1E25A 1WWSA 3WTPD 1P3FB 4E3JA 4P85A 3S1YA 4HBTA 2ZQ8A 1GCEA 3PBRA 1K57C 2ZM8A 4PMAA 2Y2PA 5KSCA 3B6GA 5AVBB 2PYOD 4DDSA 3FKWA 5B40D 5FI2A 5EVIC 4EV4A 2BYKA 3REKA 1BFMA 4JXVA 4B4ZA 2Y91A 1K56D 2HP6A 1N4OA 4R8PA 1P3BC 3NBLA 3C7UA 3R45A 3IQAA 1PW1A 3W99A 3HREA 2G5IC 3NQJA 5CPJB 1IYSA 3L28A 3BRMA 3ZVTA 4XZQD 1K6SA 3WS0A 3UTBA 3AZMB 5F99A 2PBYA 3GSGA 1F66B 5CPID 3V9RB 3KXBC 2HDRA 3O3VA 3E2LA 4S2JA 1OMEA 5GT0A 2EXBA 3UE3A 2XDMA 3ZG9B 5CPKA 4UAAA 3WA9D 4WU8D 5AV5C 2XD1A 2CWEA 2F2AC 4QY5A 2IWBA 2R9WA 3P09A 3AYWB 4JXWA 2ZQ9A 2I72A 4NZ3A 4QD4A 1L0EA 3WKJA 1W8QA 2WYXA 3AZLB 2F8NA 3ITAA 5FI7A 4WZSB 1P3LD 1AOIA 2HDSA 3BFDA 2BG1A 5GL9A 4KZ8A 1Z6FA 5B1MB 3OPPA 3TU4A 2Y2HA 3V3SA 3A6NB 5EOOA 3EQVA 1BLPA 1W2EA 4CAYB 3EPJA 4GHAA 3B3XA 3UY6A 4U0XA 4IBDA 3VH6A 4E3LA 2OV5A 1PWGA 2Y2GA 4KZ3A 1P34C 3NDGA 3B6GD 1P3BD 3ZG0A 1BTLA 3O87A 2NQBA 3AV2B 3LY3A 3REKD 4LV0A 5FI6A 1PWDA 5GXQB 5HX9A 4R8PD 4BL3A 4LG2A 3W99D 3UNWA 4PM7A 4B4XA 4HBUA 3O86A 2CV5C 2LY8A 2R9XA 2IWDA 2ZLYA 1YLPA 3IWQA 4OOLA 4JXGA 3UTBD 4R4RA 5EECA 5F99D 1LI0A 1H3OB 4YM6A 2IO5B 4J8WB 4JF4A 4IBXA 3REHC 2XQZA 3KFUG 2NZDB 3LZ0A 4MBKA 3WRZA 3UTAC 3G4PA 3W4QA 5B1LB 4H9SA 2ZY2A 1ZLAC 2EX8A 1QMEA 3C1CC 5GT0D 3RXWA 1P3IC 1YLWA 1P3FA 3RELC 3UT9C 1LLBA 5CPKD 1BSGA 4EWFA 4Y7PA 4EBLA 1XGJA 4E6XA 1P3GC 5AVBA 1P3FC 1TZYB 1ID3C 1ZG6A 1DJCA 3MGPC 3IXDA 3WKJD 1ONHA 2F8NH 1M1AB 2F8ND 4H9NB 1K38A 4ZUXB 3KSYA 4R3BA 1NRFA 3FYZA 4KGCB 3A3IA 4WYYA 5CPJA 1JWVA 4IJEA 1I5QA 3TU4D 3AZKC 4P6BA 3A3FA 5EOEA 4S2MA 3AZGB 3AZMA 3AZJC 3L25A 1KE0A 3V9RA 2G2WA 5G49B 5AQ9A 4LV1A 1H8ZA 1DJAA 1BH8B 5B2IC 4Z66C 2C6WB 4XUXA 3W98C 2V20A 5CGXA 4KZ9A 3W97C 2NQBD 5AV8B 5E2HA 2XK1A 3AZEB 4EBNA 2F8NK 1P3PB 1CEFA 3AYWA 1L0FA 1CI9A 2WZXA 4OQIA 3N8RA 1K55A 3HLWA 3WS5A 1IYOA 5C3IC 2H5SA 3O62C 4YM6D 5FAPA 4DE0A 5B1MA 5FDHA 3PAEA 4IBCA 1RCJA 3LZ0D 3A6NA 1ALQA 1PI5A 4OVDA 3HSHA 3MGQB 4OJ6A 4S2KA 4CAYA 1P3FD 2WGVA 4IEDA 4NZ5A 3IH8A 4R23A 3SS5A 5CXWA 3N8SA 3NC8A 5AVBD 2FJ7B 4X53A 1K6RA 3AV2A 4QLCB 1G68A 5GXQA 4IJFA 3PTEA 4OQGA 3MVDC 3RXXA 4RA7A 5E2EA 4WNNB 3X1UC 4DRTA 4LD9B 3W96B 5CP6C 5CPJD 1C3BA 1K25A 3HL9A 2Q9MA 3AZMD 4E3IA 1H3OA 4MLLA 4J8WA 1FSYA 4H9QB 4OPRA 4R1GA 2NZDA 4JF6A 5E2FA 1WYBA 4LENA 4OJOA 3H0LC 5B1LA 4NK3A 4J8XC 3L29A 5B31G 5A91A 2FFFB 4MBHA 5AVCB 1EI5A 3B0CT 1EQZB 1VM1A 4UA9A 4HGAC 3AZNC 3KWQB 3NIAA 3ZHHA 1P3LB 4GN2A 3AYWD 1TZYA 4OPYA 4H9PB 3TG9A 3OZHA 5HAIA 3OPLA 1M1AA 3NI9A 3VOYA 4H9NA 4ZUXA 1ES5A 3UDIA 3ZGAB 3BYDA 4KGCA 2CC1A 4KUDC 5B1MD 3MZFA 5AQAA 4KGCC 1XA1A 5EVIB 3A6ND 1RGYA 4PPRA 5JYPA 3BM6A 3AZGA 2DCFA 1FCMA 1HD8A 3M6HA 1MY8A 1P3BB 5G49A 4KZ6A 3EG5B 2DNSA 2HP5A 1NYYA 2JBFA 1YT4A 1BH8A 5DNNB 2QZ6A 5BT1C 4X69A 3B6FC 5AV8A 3AV2D 3AZEA 5GXQD 3KXBB 1P3PA 2EX9A 4KZBA 4LV3A 5B33C 1HQ3B 1EROA 4ZAMA 3MFDA 1Z2CB 3GMWA 5AV5B 4BD1A 4FCFA 4Y0TA 3MXRA 4J8WD 3NY4A 2NZDD 3H0RC 3MGQA 4H9OB 3AFAC 3MGRC 3B0CW 1MWUA 3G30A 1IYPA 1ES3A 1KE3A 3KUYC 3Q1FA 4BL2A 3MKFA 1P3AA 1PYYA 1TZYD 4PM9A 2FJ7A 2WUQA 1BZAA 2ZQAA 4QLCA 2EFUA 1GA0A 1M1AD 3WAAC 3VSKA 4ZUXD 5FSRA 1P3AC 4KGCD 1FR1A 4WNNA 1BLHA 4IBKA 1P34B 4LD9A 3W96A 3AGDA 3A3JA 4FD8A 3FWLA 3AZGD 5DF7A 4OJPA 2Z2MB 2A3UA 3Q82A 5DTSA 3LZ1A 3G35A 5BT1D 1YU0A 4EQIA 2WGWB 4G91C 2CV5B 1FR6A 4IBGA 3LZ1C 4GDBA 3UPNA 5AVCA 4PM6A 1EQZA 1K54A 5AV8D 3ITBA 1NZUA 4UUZB 3KWQA 3AZED 2QPNA 3REHB 1P3PD 1P3LA 1MXOA 1S32C 4WELA 4H9PA 4UA6A 3UTAB 4OP8A 1IKGA 1K54C 1ZLAB 3FV7A 3C1CB 4Z2MG 2XGNA 1P3IB 3I7JA 1QMFA 3RELB 3UT9B 3JYIA 3SS3A 5AV9C 1K57A 3KS4A 1P3GB 2OSUA 1ID3B 4GD8A 5A92A 5EVIA 4X55A 3MGPB 2XLNA 4QB8A 3UPOA 3MGQD 4GOGA 2XFSA 2DF4C 3LY4A 1P3BA 2ZQDA 5E5AC 4M6BA 3X1VC 3IF6C 1SDEA 4EO5B 3PBTA 5DNNA 3HLEA 2JCHA 4S2NC 3ZVWA 4S2PA 3AZKB 1P3AD 5FATA 2FJ7D 2DQNC 1XX2A 4QLCD 3AZJB 2ZY3A 1JWZA 3GV9A 5DNNC 3KXBA 1YLJA 3AV1C 3REJC 4WM9A 2Y2NA 2JE5A 4E3NA 1YMSA 4Z66B 5B2IB 3SH9A 4LD9D 1HQ3A 3W96D 3EPLA 3W98B 3ZG7B 4YS3C 4A5RA 3W97B 5AV5A 1TDLA 2P9VB 4RX2A 1HQ3C 4UHUA 5JRGC 1JFIB 3LZ1D 1YU2A 3ZDJA 4GKUA 4KG6A 4H9OA 1BT5A 3E2KA 5HARA 1HZOA 4NY2A 5AVCD 1B67A 5C3IB 1L0GA 2WKIA 4OLGA 3O62B 1EQZD 4DXCA 3KWQD 4Z9QA 4DE3A 1CK3A 3IWIA 1ERMA 4ZTKA 5IHVA 1U60A 3SH7A 1I2WA 1KX4C 2EX2A 2X71A 3X1SC 1EWZA 4Y0OA 1P34A 1S0WA 2RCXA 3AN2B 2ZM0A 4KQQA 3FDDA 5GT3C 4DF6A 1M18C 1YU1A 5EVID 3X1VD 1DY6A 3MVDB 1GHIA 4JKTA 2J9PA 3L2AA 3X1UB 1SKFA 4X68A 4OQHA 2WGWA 4OPZA 5U47A 4FSFA 5DNND 5CP6B 5CEBA 2CV5A 3Q7ZA 3C4PA 3X1TC 4NYUA 2V2FF 4AWLC 1BH9B 4UUZA 3KXBD 3REHA 3IHBA 1LHYA 5HAPA 4WV4B 3UTAA 1P3OA 4J8XB 1ZLAA 2Y59A 1HQ3D 4K0XA 3C1CA 1GA9A 1P3IA 2XR0A 1U35A 5EVLA 3RELA 3UT9A 1P3OC 3LELA 4HGAB 5AV5D 4QY6A 3AZNB 1LL5A 1ESUA 3C4OA 3PBOA 4KQOA 1P3GA 3Q7VB 1ID3A 3W4PA 1U35C 4MNRA 4KZ5A 4S2IA 3ZG5A 3LELC 3MGPA 3VP0A 4K91A 2ZQ7A 3S22A 3Q07A 3HLBA 1BULA 4KUDB 1XPBA 2EX6A 1BLSA 5TFQA 4UPKA 5CTNA 2WAFA 5FQIA 5CHUA 3AZKA 4RX3A 3AZIB 4IBBA 1PZOA 5B31C 2YFWB 2ZM2A 4EO5C 3AZJA 2HIOC 1KX3C 1KVMA 3H0MC 5B2IA 4Z66A 1A7WA 1P34D 5F83A 3W98A 1N1JB 3VMAA 1GHMA 3B6FB 3W97A 3VOZA 5B0YC 2P9VA 4N9LA 1FCOA 3ZCZA 1JFIA 2JSSA 4FH2A 2HUEC 5B33B 3UN7A 2CV5D 5GSUC 4N1HA 4QJGA 5AV6C 1LI9A 3O62A 4OQ0A 1YLTA 3IHAA 2F8NG 3MGSC 3REHD 1JVJA 1H5XA 5GHYA 3UTAD 1P3OD 2Y2LA 1ZLAD 3C1CD 3AFAB 3MGRB 1P3ID 5B32G 5B0ZC 1U35D 3RELD 3UT9D 3KUYB 5AY8B 3LELD 5E2GA 4KZ7A 3BFEA 3AN2A 3VH5T 1PIOA 5EPHA 1P3GD 4CJNA 1ID3D 4G92C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E3J A;  2Y2I A;  4P85 A;  4P87 A;  1Y54 A;  2EXA A;  3S1Y A;  4DXB A;  4HBT A;  4QU3 A;  2ZQ8 A;  1GCE A;  2HPB A;  1ERO A;  4ZAM A;  3PBR A;  1K57 C;  2ZM8 A;  4PMA A;  2Y2P A;  5KSC A;  3HLD A;  3HVF A;  2RL3 A;  3IF5 A;  2IWC A;  4DDS A;  4RYE A;  2VGK A;  3MFD A;  5KZH A;  3FKW A;  3WWX A;  2WAE A;  3GMW A;  5EVI C;  5FI2 A;  4BD1 A;  4FCF A;  4D2O A;  4EV4 A;  1O7E A;  4Y0T A;  4B4Z A;  4JXV A;  3MXR A;  2Y91 A;  3NY4 A;  4JXS A;  1K56 D;  4WZ5 A;  5HAQ A;  5BOH A;  5CRF A;  2HP6 A;  1N4O A;  2OLV A;  3NBL A;  3GVB A;  3C7U A;  3IQA A;  1ESI A;  3C7V A;  1PW1 A;  3PBN A;  4OKP A;  3HRE A;  4WZ5 C;  1MWU A;  3G2Y A;  3G30 A;  1IYP A;  3PBQ A;  3BFF A;  3OCL A;  3CMZ A;  1IYS A;  3EQU A;  3BRM A;  1ES3 A;  3ZVT A;  3SH8 A;  1K6S A;  1KE3 A;  3WS0 A;  3LEZ A;  3HUN A;  3WS1 A;  4C3Q A;  2PBY A;  3MZD A;  3OC2 A;  3G31 A;  3GSG A;  3OPR A;  3Q1F A;  2PU2 A;  4BL2 A;  2XF3 A;  3MKF A;  1L2S A;  1PYY A;  3D4F A;  4PM9 A;  3RXX A;  2WUQ A;  1BZA A;  2HDR A;  1SHV A;  2ZQA A;  3O3V A;  1MKI A;  5EE8 A;  2EFU A;  1GA0 A;  3VSK A;  4L0L A;  3SS4 A;  3E2L A;  5GLC A;  3Q7V A;  4S2J A;  1OME A;  3SOI A;  5FSR A;  2EXB A;  3V3R A;  1FR1 A;  3UE3 A;  2XDM A;  4GD6 A;  1BLH A;  3ZG9 B;  1YLZ A;  4UAA A;  1FQG A;  2XD1 A;  2J8Y A;  3MZE A;  3AGD A;  1O07 A;  3A3J A;  4S2L A;  2ZJ9 A;  4FD8 A;  4QY5 A;  4KQR A;  2IWB A;  2R9W A;  3P09 A;  4JXW A;  3FWL A;  2ZQ9 A;  3GR2 A;  2HP9 A;  1HVB A;  2I72 A;  3N6I A;  4QD4 A;  5DF7 A;  5M18 A;  1L0E A;  3VFH A;  4N92 A;  1W8Q A;  2A3U A;  2WYX A;  1KDS A;  2Z2M B;  3Q82 A;  5DTS A;  3OCN A;  3G35 A;  5CED A;  4LCM A;  3ITA A;  5FI7 A;  1TVF A;  4ZBE A;  3W4O A;  1RGZ A;  2HDS A;  3N4I A;  5DVA A;  4EQI A;  2WKH A;  3BFD A;  5GHZ A;  2WGW B;  2BG1 A;  3A3E A;  4U3T A;  5GL9 A;  3HBR A;  4ZJ1 A;  1BUE A;  4GDN A;  1PW8 A;  2XD5 A;  4KZ8 A;  1Z6F A;  3MXS A;  1FR6 A;  3V50 A;  4S2O A;  4LCL A;  3QNB A;  4GDB A;  3UPN A;  1ES2 A;  3DW0 A;  4PM6 A;  3OPP A;  4WEK A;  3IF6 B;  2Y2H A;  3V3S A;  5HL1 A;  1K54 A;  3ITB A;  5EOO A;  1G6A A;  2XEP A;  5CTM A;  1PI4 A;  1NZU A;  3EQV A;  1W7F A;  2QPN A;  2GDN A;  2VGJ A;  1BLP A;  1MXO A;  1WYC A;  1JTG A;  3FKV A;  1PZP A;  4WEL A;  5FQ9 A;  3B3X A;  3DWK A;  3UY6 A;  4U0X A;  2ZC3 B;  3BLM A;  4UA6 A;  4OOM A;  4OP8 A;  1AXB A;  1IKG A;  1K54 C;  2OV5 A;  1PWG A;  4E3L A;  4BQM A;  5DTT A;  3FV7 A;  5DF9 A;  1XP4 A;  2Y2G A;  3V5M A;  4KZ3 A;  3BFC A;  1Q2Q A;  2XGN A;  3NDG A;  3UO9 A;  4ZDX A;  5GLA A;  3I7J A;  1QMF A;  3PAG A;  2ZC7 A;  2A49 A;  3ZG0 A;  3JYI A;  3SS3 A;  1BTL A;  3VFF A;  3O87 A;  4X56 A;  4OPQ A;  1JTD A;  4KEN B;  1W8Y A;  4N1X A;  3LY3 A;  4LV0 A;  5FI6 A;  1K57 A;  1PWD A;  5M19 A;  4Q8I A;  2Y2Q A;  2OSU A;  5CGS A;  5HX9 A;  4WBG A;  2C5W B;  4GD8 A;  1K55 C;  5A92 A;  4BL3 A;  3IH9 A;  5EVI A;  4X55 A;  2XLN A;  4QB8 A;  3UPP A;  4ID4 A;  3UPO A;  4OON A;  2PU4 A;  4GOG A;  2XFS A;  4DDY A;  4OH0 A;  3CG5 A;  5GLD A;  3Q81 A;  3UNW A;  4PM7 A;  4B4X A;  3LY4 A;  4HBU A;  3O86 A;  2ZMA A;  2ZQD A;  1XXM A;  3NCK A;  4B88 A;  2R9X A;  2IWD A;  2ZLY A;  4IVK A;  1YLP A;  2ZC6 B;  3IWQ A;  3IF6 C;  4OOL A;  4FH4 A;  4JXG A;  1SDE A;  2XH9 A;  3IXB A;  4M3K A;  4R4R A;  3PBT A;  5EEC A;  1LI0 A;  3HLE A;  2JCH A;  1PWC A;  4GNU A;  4JF5 A;  1N9B A;  4S2N C;  4S2P A;  3ZVW A;  4JF4 A;  4IBX A;  2XQZ A;  5FAT A;  1XX2 A;  1SDN A;  2X01 A;  4MBK A;  2WAD A;  3WRZ A;  1SCW A;  3G4P A;  3W4Q A;  1JWZ A;  3GV9 A;  2B5R A;  1XA7 A;  1ONG A;  2EX8 A;  2QMI A;  2V1Z A;  1QME A;  1YLJ A;  2X02 A;  3ZNT A;  3WS2 A;  3RXW A;  4WM9 A;  2Y2N A;  2JE5 A;  1YLW A;  4E3N A;  5F1G A;  1YMS A;  3AGE A;  2ZD8 A;  3SH9 A;  1LLB A;  4BLM A;  1BSG A;  2JC7 A;  5GHX A;  4Y7P A;  3IT9 A;  2ZC5 B;  4YFM A;  4EBL A;  2WZZ A;  4EWF A;  1XGJ A;  2Y4A A;  3HLF A;  4R4S A;  3ZG7 B;  3IXH A;  4E6X A;  2WK0 A;  4E3K A;  3G34 A;  4X6T A;  4A5R A;  3BFG A;  4XXR A;  1ZG6 A;  1FSW A;  1DJC A;  1TDL A;  2P9V B;  3IXD A;  4BEN A;  1JWP A;  4RX2 A;  1K4E A;  1YM1 A;  5DF8 A;  1ONH A;  1ZKJ A;  4UHU A;  1K38 A;  3QHY A;  1VQQ A;  4R3B A;  1NRF A;  3FYZ A;  4Y0U A;  3NDE A;  4RVA A;  3ZDJ A;  5A90 A;  3VP4 A;  4GKU A;  4KG6 A;  3MKE A;  1BT5 A;  3M2K A;  3E2K A;  5HAR A;  1GHP A;  3P98 A;  1HZO A;  3A3I A;  1KGG A;  3C5A A;  1WE4 A;  4WYY A;  1JWV A;  1W79 A;  1L0G A;  1I5Q A;  2WKI A;  1YMX A;  3BEB A;  3A3F A;  4OLG A;  4P6B A;  5EOE A;  5AQB A;  4S2M A;  4DXC A;  5I94 A;  4Z9Q A;  4DE3 A;  4DE2 A;  1CK3 A;  4R0Q A;  1W5D A;  1IEL A;  1KE0 A;  2G2W A;  2E8I A;  3IWI A;  2Y2O A;  1ERM A;  5AQ9 A;  4LV1 A;  4ZTK A;  3CJM A;  1H8Z A;  1S6R A;  1KGF A;  1DJA A;  2G2U A;  5IHV A;  1IEM A;  4KZ4 A;  3IXG A;  4R3J A;  1ZC2 A;  2C6W B;  1U60 A;  1RP5 A;  3SH7 A;  1I2W A;  2EX2 A;  1K4F A;  4XUX A;  2X71 A;  2V20 A;  5CGX A;  4EUZ A;  3HLC A;  1EWZ A;  4KZ9 A;  3ZG8 B;  4Y0O A;  4P0M A;  5E2H A;  1S0W A;  1NJ4 A;  2Q9N A;  2RCX A;  2XK1 A;  1E3U A;  4JBF A;  2ZM0 A;  4YIN A;  4KQQ A;  4LV2 A;  5FA7 A;  3W8K A;  4EBN A;  2ZC4 B;  3TSG A;  1CEF A;  2UWX A;  4DF6 A;  5EVI D;  4E6W A;  3FZC A;  5HW3 A;  1L0F A;  1CI9 A;  1KDW A;  2WZX A;  4OQI A;  5KSH A;  5HFO A;  5J8X A;  5DTK A;  1DY6 A;  3N8R A;  1GHI A;  1K55 A;  4JKT A;  2J9P A;  3HLW A;  1MBL A;  3WS5 A;  1IYO A;  1MPL A;  4H8R A;  2H5S A;  1SKF A;  5F82 A;  4X68 A;  4F94 A;  4OQH A;  2WGW A;  4OPZ A;  5U47 A;  1TDG A;  4FSF A;  5G18 A;  3M6B A;  5M1A A;  4ZJ3 A;  5CEB A;  1ZG4 A;  4PM8 A;  5FAP A;  2FFY A;  5FQK A;  4DE0 A;  4HEF A;  3Q7Z A;  3C4P A;  3WS4 A;  5FDH A;  3PAE A;  3RJU A;  4WEJ A;  1RCJ A;  3IF6 A;  5FQM A;  1ALQ A;  1PI5 A;  4OVD A;  3VP3 A;  2V2F F;  2EFX A;  4S2N A;  1BLC A;  3IHB A;  2WGI A;  4DE1 A;  1LHY A;  4S2K A;  5HAP A;  5A93 A;  1XGI A;  5E43 A;  5GLB A;  2H10 A;  1NXY A;  3A3D A;  4K0W A;  2WGV A;  4IED A;  4E3M A;  4PM5 A;  3IH8 A;  4R23 A;  1Q2P A;  5KMW A;  5CHM A;  3SS5 A;  1ERQ A;  2Y59 A;  3AGF A;  1M6K A;  4JLF A;  4K0X A;  5CXW A;  3G2Z A;  1GA9 A;  1ES4 A;  2HDU A;  1M40 A;  3N8S A;  4EBP A;  5L2F A;  3NC8 A;  4WMC A;  5F1F A;  2XR0 A;  5EVL A;  5FQJ A;  3S4X A;  3LCE A;  4IVI A;  4QY6 A;  1DJB A;  1XKZ A;  1LL5 A;  1K6R A;  1ESU A;  4X53 A;  3C4O A;  3ZNY A;  1G68 A;  3PBO A;  4GB7 A;  5D3O A;  4KQO A;  3Q7V B;  2OLU A;  3PTE A;  2Y2J A;  4OQG A;  3LO7 A;  3W4P A;  3VSL A;  4BJP A;  3VP1 A;  4JPM A;  4KZ5 A;  3HLG A;  4MBF A;  4MNR A;  4RA7 A;  1J9M A;  4S2I A;  5E2E A;  5FAQ A;  3ZG5 A;  3VP0 A;  2H0T A;  3UDF A;  4K91 A;  2ZQ7 A;  3ISG A;  3GTC A;  5TR7 A;  3IWO A;  3N7W A;  1KVL A;  2Y55 A;  3S22 A;  3Q07 A;  3V39 A;  4DRT A;  3HLB A;  2H0Y A;  1C3B A;  1BUL A;  1FOF A;  1I2S A;  3ZFZ A;  4HES A;  1K25 A;  3HL9 A;  1XPB A;  2EX6 A;  2Q9M A;  2Z2L B;  4E3O A;  4E3I A;  1BLS A;  3GQZ A;  2BLS A;  4WZ4 A;  4MLL A;  5TFQ A;  5CTN A;  1FSY A;  2WAF A;  3BEC A;  3HUM A;  1K56 A;  2J9O A;  4OPR A;  5CHU A;  5FQI A;  4RX3 A;  4R1G A;  3G32 A;  2HDQ A;  4JF6 A;  5E2F A;  4KG5 A;  1WYB A;  4LEN A;  1PZO A;  2ZM2 A;  5JYO A;  4UA7 A;  4KZA A;  4NK3 A;  4CPK A;  5A91 A;  2FFF B;  4MBH A;  1MWS A;  1KVM A;  2Y2K A;  3UDX A;  3QNC A;  4OLD A;  1EI5 A;  1NY0 A;  1YLY A;  1VM1 A;  4UA9 A;  1E3U D;  1KGE A;  1NYM A;  5F83 A;  3NIA A;  5TGF A;  3M2J A;  4IBR A;  3ZHH A;  4N9K A;  3VMA A;  4GN2 A;  1GHM A;  4XUZ A;  4OPY A;  2Y2M A;  1MWR A;  4GZB A;  3TG9 A;  3OPH A;  3VOZ A;  2P9V A;  3OZH A;  4N9L A;  1H8Y A;  2WKE A;  3OPL A;  1E4D A;  5HAI A;  3NI9 A;  1FCO A;  3ZCZ A;  4BD0 A;  3VOY A;  4U0T A;  3PBS A;  1ES5 A;  5FQQ A;  3UDI A;  4FH2 A;  3ZGA B;  3BYD A;  4DKI A;  3HUO A;  3UE1 A;  5FAO A;  2CC1 A;  3UE0 A;  4MEZ A;  3GRJ A;  1HTZ A;  3UN7 A;  5EUA A;  1CI8 A;  4N1H A;  3MZF A;  4O7D A;  5AQA A;  2P74 A;  4QJG A;  1LI9 A;  3O88 A;  4OP5 A;  1XA1 A;  2J7V A;  1L0D A;  5EVI B;  1RGY A;  4OQ0 A;  3DTM A;  4PPR A;  5JYP A;  1YLT A;  3BM6 A;  3IHA A;  2DCF A;  1FCM A;  1HD8 A;  2DRW A;  2XFT A;  1LL9 A;  3MBZ A;  3M6H A;  5CGW A;  3VP2 A;  1KE4 A;  1MY8 A;  1JVJ A;  4KZ6 A;  1H5X A;  5GHY A;  4C6Y A;  2DNS A;  3TOI A;  4C75 A;  2HP5 A;  2Y2L A;  1NYY A;  1YT4 A;  1IKI A;  2JBF A;  5CEC A;  4OOY A;  3BLS A;  2QZ6 A;  4NET A;  4WMC D;  1TEM A;  4KG2 A;  5FAS A;  1FCN A;  3WRT A;  1CEG A;  1NZO A;  3CZD A;  4X69 A;  5E2G A;  1MWT A;  4KZ7 A;  4QHC A;  3BFE A;  3DWZ A;  1IYQ A;  1YQS A;  1PIO A;  5EPH A;  5CHJ A;  4CJN A;  2EX9 A;  4ZJ2 A;  2ZQC A;  4KZB A;  4LV3 A;  5AQ7 A;  5CER A;  3N8L A;  1E25 A; 
#chains in the Genus database with same CATH topology
 3LI8 A;  3MGP D;  2W0N A;  1G28 A;  1FIK A;  1Y54 A;  4P87 A;  3WAA B;  3AN2 C;  5DKK A;  3MVD A;  1P3A B;  4J8V C;  2IA2 A;  3HVF A;  4NYY A;  2RL3 A;  3IF5 A;  3MFX A;  3X1U A;  2Q0O A;  2HZ5 A;  2VGK A;  2WAE A;  4D2O A;  2RVQ C;  5CP6 A;  4JXS A;  2V0W A;  3AZK D;  5BOH A;  4JJN C;  3B33 A;  5CRF A;  4PKY A;  2OLV A;  3GVB A;  1Y4O A;  1BH9 A;  3AZJ D;  3C7V A;  2PYR A;  4CLC C;  4OKP A;  2QJ5 A;  3MNN C;  3G2Y A;  4L9E A;  3BFF A;  3OCL A;  2JKG A;  3EQU A;  2FH5 A;  5B2I D;  4Z66 D;  4G91 B;  1PDC A;  2GJ3 A;  4J8X A;  5B0Y D;  4C3Q A;  1P3M C;  4D60 A;  3LZ1 B;  4KQD A;  3W98 D;  3C1B C;  3OPR A;  4QWO A;  3W97 D;  3AZN A;  3MSH A;  5EE8 A;  3KS8 A;  2V0U A;  4L0L A;  1ED7 A;  3SS4 A;  1S32 B;  3TJZ C;  5GLC A;  5FDS A;  3Q7V A;  5L07 A;  3MXQ A;  3SOI A;  3IBJ A;  2OAQ 1;  2HJ9 C;  1UR8 A;  1YLZ A;  2V9A A;  2L5A A;  5KDM B;  4G3W A;  1FQG A;  2J8Y A;  3MZE A;  5CHL B;  1B6W A;  1O07 A;  2KOI A;  1D7E A;  4S2L A;  3MQO A;  5AV9 B;  3O62 D;  4KUD A;  2HP9 A;  5M18 A;  3VFH A;  3QP2 A;  5B24 C;  4E45 A;  3OCN A;  2O0Y A;  5CED A;  4LCM A;  5FUG B;  4O8G A;  4X1M A;  3AZI A;  3N4I A;  5DVA A;  2WKH A;  2YFW A;  3A3E A;  4U3T A;  4ZJ1 A;  3AZH B;  1W1P A;  3UME A;  3T1R A;  5E5A B;  2XSS A;  4LCL A;  4HJ4 A;  5BO0 B;  3QNB A;  3RH8 B;  1ES2 A;  4EUV A;  4CSR B;  3X1V B;  3VH5 W;  3IF6 B;  3AZI C;  3LIB A;  4GLQ A;  5IS1 A;  4MCW A;  1Q9C A;  1ULY A;  4YWZ A;  4EER A;  4GH9 A;  1TAF B;  5CTM A;  3AN2 D;  1PI4 A;  1W7F A;  2GDN A;  1N1J A;  2VGJ A;  1WYC A;  1JTG A;  3FKV A;  1PZP A;  3MQQ A;  2AVX A;  5FQ9 A;  5J7E A;  3B6F A;  3LR0 A;  2ZC3 B;  3BLM A;  4OOM A;  1AXB A;  5DTT A;  3AV1 B;  3REJ B;  3BFC A;  3MVD D;  4OUI A;  2ZC7 A;  3X1U D;  4I3J A;  2A49 A;  5G4Y A;  3U4L P;  2YFV B;  2VKS A;  5B33 A;  3CPT A;  4OPQ A;  1YAX A;  4KEN B;  5CP6 D;  4YNR A;  1S1Z A;  5M19 A;  4YS3 B;  3NQU B;  3REI B;  4DRA A;  1OTB A;  4DN0 A;  4WBG A;  4R70 A;  3UPP A;  4ID4 A;  4OON A;  2PU4 A;  4OH0 A;  5JRG B;  3Q81 A;  4XUJ C;  5F69 A;  3A1I A;  2ZOH A;  3NCK A;  3F6T A;  3ZYT A;  4B88 A;  3BWL A;  3IBR A;  4J8X D;  4J8U C;  2R78 A;  3IXB A;  2ARO B;  3AFA A;  3MGR A;  2A24 B;  3S7P A;  4WU9 A;  4GNU A;  3AL0 C;  1PWC A;  3T4K A;  3KUY A;  5AY8 A;  1SDN A;  1ACF A;  3AZN D;  3LJA B;  1SCW A;  3NHQ A;  2B5R A;  4WU9 C;  1XA7 A;  2QMI A;  1KS0 A;  2V1Z A;  4Z5T C;  4X23 C;  1UWP X;  3F1O A;  5AY8 C;  3AGE A;  2ZD8 A;  3WAA A;  2JC7 A;  3IT9 A;  2ZC5 B;  4EXO A;  1KX4 B;  1D06 A;  3HLF A;  2RTS A;  3IXH A;  3AZF C;  3X1S B;  1KX5 C;  4E3K A;  3G34 A;  4X6T A;  5BPV A;  1M19 B;  4KUD D;  3M7P A;  1TS7 A;  3WTP C;  2VV8 A;  4BEN A;  5DF8 A;  1YM1 A;  2W1T B;  5MC7 A;  5GT3 B;  1P9R A;  1M18 B;  5BNX B;  1YUE A;  1VQQ A;  4Y0U A;  3AZI D;  4RVA A;  5G4Z A;  3SZT A;  3B0D C;  3VP4 A;  2PYO C;  3M2K A;  3B0B A;  5B40 C;  2BYM B;  3T4L A;  2PDR A;  4MN7 A;  4CLC E;  1YMX A;  5AQB A;  5B32 B;  4MDZ A;  4ZBJ C;  4DE2 A;  3X1T B;  4R0Q A;  1E6N A;  2E8I A;  2Y2O A;  3B6F D;  4AWL B;  1S6R A;  2G5H C;  2G2U A;  2VZW A;  1IEM A;  4R3J A;  4XZQ C;  1ZC2 A;  1S32 A;  1RP5 A;  5JA4 B;  5CPI C;  3HLC A;  5B33 D;  4K08 A;  3EGD C;  5KDM A;  4NE5 A;  4YIN A;  4LV2 A;  5FA7 A;  3W8K A;  2ZC4 B;  1P3K C;  3B42 A;  1GXD A;  4Q0J A;  3T12 B;  2UWX A;  1LSW A;  1P3O B;  5AV9 A;  2P08 A;  3BY9 A;  4LGW A;  5KSH A;  5HFO A;  2L1M A;  5J8X A;  5DTK A;  3R7W B;  3WA9 C;  4WU8 C;  2XA7 M;  1U35 B;  1TF1 A;  2Z6D A;  2ZY5 A;  2ZY4 A;  5FUG A;  3KYE A;  3LEL B;  5F82 A;  4F94 A;  3IS2 B;  3AZH A;  5G18 A;  3AFA D;  5BS7 C;  3MGR D;  3M6B A;  5M1A A;  4ZJ3 A;  4WU9 D;  1ZG4 A;  4PM8 A;  5E5A A;  5BO0 A;  3WS4 A;  3RJU A;  4WEJ A;  4CSR A;  3X1V A;  3GDI A;  2VQR A;  3KUY D;  5AY8 D;  3IF6 A;  5FQM A;  1TAF A;  3AZH C;  4S2N A;  1BLC A;  3LI9 A;  1N9O A;  4G3K A;  5A93 A;  1XGI A;  5E43 A;  5GLB A;  2H10 A;  1NXY A;  3A3D A;  4K0W A;  5B31 B;  3S7N A;  5B2J C;  4PM5 A;  1NWZ A;  3WAA D;  5CHM A;  2EWV A;  1ERQ A;  4DQY B;  2HIO B;  1KX3 B;  3AV1 A;  3REJ A;  2HDU A;  1M40 A;  4EBP A;  1EAK A;  5L2F A;  4WMC A;  4O01 A;  3S4X A;  2YFV A;  2YKH A;  3KSF A;  5EFW A;  2ZM5 A;  4YS3 A;  3NQU A;  3REI A;  4GB7 A;  3VSL A;  2OWH A;  4JPM A;  4JGP A;  4MBF A;  5FAQ A;  5B0Y B;  5DNM A;  3B6G C;  2H0T A;  3A0V A;  3ISG A;  3GTC A;  5TR7 A;  3LYX A;  5JRG A;  1KVL A;  3V39 A;  3UB9 A;  3REI C;  3REK C;  2HUE B;  3MJQ A;  4QNL A;  1FOF A;  4ESP A;  1J7M A;  2B95 A;  3ZFZ A;  5DNM C;  1OT6 A;  4R8P C;  2HF6 A;  3IX8 A;  3T4Q A;  1IOU A;  4E3O A;  2ARO A;  5GSU B;  3GQZ A;  2A24 A;  2K31 A;  5AV6 B;  2D01 A;  3W99 C;  3S7O A;  2J9O A;  4KHA B;  3MGS B;  4KG5 A;  3LJA A;  2ARO C;  5JYO A;  4UA7 A;  4KZA A;  4E04 A;  1S32 D;  3UTB C;  5F99 C;  1P3K D;  2Y2K A;  4UQI M;  3QNC A;  4OLD A;  1NY0 A;  3VH6 T;  4F3L B;  3LJA C;  3EWK A;  3FKE A;  1KGE A;  1KX4 A;  5B0Z B;  4EW7 A;  4IBR A;  4N9K A;  3X1S A;  1H0I A;  4Y5F A;  4OJL A;  5AV9 D;  1M19 A;  5GT0 C;  4XUZ A;  3QP4 A;  2Y2M A;  4GZB A;  5F5Y A;  3OPH A;  5LBR A;  1H8Y A;  1E4D A;  2W1T A;  5CPK C;  4BD0 A;  5GT3 A;  4G92 B;  1M18 A;  5BNX A;  4NXF A;  5FQQ A;  4DKI A;  3WTP E;  1M19 C;  2PHY A;  3UE1 A;  5FAO A;  1LSV A;  3AZH D;  3GRJ A;  1HTZ A;  4J8V B;  5E5A D;  3P5J B;  1CI8 A;  4O7D A;  3WKJ C;  2HGV A;  2P74 A;  2BYM A;  1K0K A;  4B93 A;  2YKF A;  3O88 A;  2J7V A;  5B2J D;  1AOI C;  5B32 A;  4II7 A;  4P6Z M;  1EW0 A;  2ACG A;  1LL9 A;  2FN2 A;  3MBZ A;  3X1T A;  5CGW A;  3VP2 A;  1KE4 A;  4JJN B;  4C6Y A;  1X0O A;  2KX6 A;  5B32 C;  4CLC B;  3TU4 C;  3MNN B;  5CEC A;  3AV1 D;  4OOY A;  3REJ D;  3T1X A;  2NUT C;  4WMC D;  1TEM A;  1O6I A;  5JA4 A;  1E15 A;  5FAS A;  1CEG A;  1NZO A;  3CZD A;  1P3M B;  2K7S A;  3DTI A;  1IYQ A;  1YQS A;  3C1B B;  4YS3 D;  3LIF A;  3REI D;  1UGU A;  5CHJ A;  3OBF A;  2ZQC A;  2G7U A;  3N8L A;  2Y2I A;  5DNM D;  4Z2I A;  2EXA A;  4DXB A;  4QU3 A;  5JRG D;  2HPB A;  2NQB C;  1A0K A;  2LB9 A;  3R7W A;  3HLD A;  3UB5 P;  2IWC A;  4RYE A;  5KZH A;  3IS2 A;  3EOI A;  3WWX A;  5J3W A;  3HCY A;  2ARO D;  4IBI A;  1O7E A;  4WZ5 A;  5HAQ A;  4Q0H A;  1GSV A;  2RIQ A;  3N3F A;  3EEA A;  3LR4 A;  4JGQ A;  3LJA D;  1E88 A;  1TS6 A;  1ESI A;  3PBN A;  5B24 B;  3VH6 W;  4WZ5 C;  4YM6 C;  3PBQ A;  3CMZ A;  4OJ5 A;  5B31 A;  3SH8 A;  3LZ0 C;  4I38 A;  5HDC A;  4LPZ A;  4ETZ A;  4H9R B;  4Y3I A;  3LEZ A;  2HIO A;  3HUN A;  1KX3 A;  3WS1 A;  1KX4 D;  1J3W A;  3MZD A;  3OC2 A;  3G31 A;  4H9S C;  3CAX A;  2PU2 A;  3X1S D;  4JGO A;  2XF3 A;  1L2S A;  1M19 D;  1L3L A;  5HDS A;  3D4F A;  4GJ4 A;  1OTD A;  3LR5 A;  3V67 A;  1SHV A;  1MKI A;  3C8C A;  5L8M A;  4NE3 A;  3LR3 A;  5GT3 D;  1M18 D;  3F1P B;  4EU0 A;  3LIA A;  3V3R A;  5B0Y A;  5AVB C;  1AOI D;  4GD6 A;  4NE6 A;  3FPV A;  3MR0 A;  1D1J A;  3DAV A;  2ZJ9 A;  3PYP A;  4KQR A;  3GR2 A;  1HVB A;  5B32 D;  1V9Y A;  3N6I A;  5GSU A;  3SW1 A;  4N92 A;  3X1T D;  1KDS A;  5AV6 A;  3ULF A;  4KHA A;  4MB4 A;  1TVF A;  4ZBE A;  3W4O A;  1DP9 A;  1F66 A;  2J3T D;  1RGZ A;  5CPJ C;  3MGS A;  5GHZ A;  1YSQ A;  4XUJ B;  3HBR A;  1BUE A;  4GDN A;  1PW8 A;  2XD5 A;  3AZM C;  3MXS A;  3V50 A;  4S2O A;  3T50 A;  2J8P A;  1HTA A;  1BYW A;  4NFT A;  3DW0 A;  4WEK A;  1F66 C;  4J8U B;  4MB3 A;  5HL1 A;  3KSI A;  4F3L A;  1G6A A;  2XEP A;  5B0Z A;  5TJJ A;  2GZA A;  3B47 A;  3JVU A;  3DWK A;  3K3D A;  4BQM A;  4WU9 B;  2JKT I;  5DF9 A;  1XP4 A;  4LRX C;  3V5M A;  4Z5T B;  4X23 B;  1Q2Q A;  3UO9 A;  4ZDX A;  4NZ1 A;  5GLA A;  3AZL A;  3T4T A;  1LL8 A;  3PAG A;  5HWW A;  3VFF A;  4X56 A;  3AYW C;  1JTD A;  2JKT M;  4N1X A;  1W8Y A;  4J8V A;  3L27 A;  2ZOI A;  4Q8I A;  3AZF B;  2Y2Q A;  1KX5 B;  4IBE A;  5CGS A;  3AZL C;  3NOU C;  2C5W B;  1K55 C;  3IH9 A;  4WJ3 C;  3WTP B;  4NG2 A;  3H9W A;  4DDY A;  3CG5 A;  3KSG A;  5GLD A;  4FUW A;  3L26 A;  4JJN A;  2Y79 A;  2ZMA A;  5BNV B;  1XXM A;  5B1M C;  4HI4 A;  3B0D B;  4IVK A;  5B31 D;  1NRJ A;  2V8F A;  2ZC6 B;  2PYO B;  4CLC A;  5B40 B;  4FH4 A;  2XH9 A;  3MNN A;  4M3K A;  2HIO D;  3A6N C;  1KX3 D;  2FZ0 A;  4JF5 A;  1N9B A;  4GHL A;  2X01 A;  2WAD A;  4E44 A;  1P3M A;  4ZBJ B;  1KU5 A;  2WKP A;  3C1B A;  1ONG A;  2HJE A;  2X02 A;  3ZNT A;  3WS2 A;  5F1G A;  2VV7 A;  4XZQ B;  4BLM A;  5GHX A;  3VH5 A;  4YFM A;  2WZZ A;  3AV2 C;  2Y4A A;  2VEA A;  4R4S A;  2WK0 A;  5CPI B;  5GXQ C;  2I9V A;  1T19 A;  2UV0 E;  3BFG A;  4XXR A;  3A0S A;  1FSW A;  5GSU D;  3EPH A;  1JWP A;  1K4E A;  2QKP A;  5EM0 A;  1ZKJ A;  5AV6 D;  4IHQ A;  1P3K B;  1YU4 A;  3WX7 A;  2BTF P;  3BW6 A;  3QHY A;  1F66 D;  2B02 A;  3NDE A;  3MGS D;  5A90 A;  1OGG A;  3MKE A;  5B24 A;  4WU8 B;  3WA9 B;  5DJT A;  1GHP A;  3P98 A;  4G3V A;  1KGG A;  3C5A A;  1WE4 A;  2IO5 C;  4J8W C;  1W79 A;  4GW9 A;  3BEB A;  1E6P A;  2NZD C;  4HME A;  4H9R A;  4BBT A;  2V8C A;  5I94 A;  5B0Z D;  2QJ7 A;  5B1L C;  3EEH A;  1W5D A;  1IEL A;  1UWN X;  3KYZ A;  3CJM A;  1KGF A;  2JKR M;  4MMN A;  4KZ4 A;  3IXG A;  4HIA A;  1K4F A;  3F1P A;  3AZL D;  5B2J B;  4EUZ A;  4NZ4 A;  4IBJ A;  3JVV A;  3ZG8 B;  1TZY C;  4P0M A;  2PT7 A;  1NJ4 A;  2Q9N A;  4J8V D;  1E3U A;  4JBF A;  1M1A C;  3TSG A;  3DBA A;  4ZUX C;  4E6W A;  2RVQ D;  2BAS A;  3FZC A;  5HW3 A;  4QPR A;  3R4K A;  1KDW A;  3IP4 C;  4JJN D;  3E0Y A;  3B6G B;  1MBL A;  1MPL A;  4H8R A;  4CLC D;  4XUJ A;  3MNN D;  1TDG A;  4NKP A;  2XA7 S;  2BYK B;  3REK B;  3AZG C;  5FQK A;  2FFY A;  4HEF A;  5DNM B;  4R8P B;  4J8U A;  3VP3 A;  1P3M D;  3WD4 A;  3R45 B;  3KX0 X;  2EFX A;  3C1B D;  3W99 B;  3LIC A;  4IBF A;  2WGI A;  4DE1 A;  3NQJ B;  2GNX A;  4E3M A;  3A1K A;  1Q2P A;  2PR6 A;  1JNU A;  3UTB B;  3EPK A;  3AGF A;  4L9F A;  1M6K A;  4FOF A;  4JLF A;  5F99 B;  4Z5T A;  1T3U A;  5AV8 C;  4X23 A;  1ES4 A;  2W3H A;  2QWS A;  3G2Z A;  5J4E A;  2E8J A;  1LSX A;  5F1F A;  3AZE C;  3EGX C;  1P3P C;  4Z2H A;  5FQJ A;  3LCE A;  5A8B A;  1NLY A;  4IVI A;  1DJB A;  1XKZ A;  4LFU A;  3ZNY A;  1R4V A;  5D3O A;  3AZF A;  1KX5 A;  3MQ0 A;  2OLU A;  2Y2J A;  5GT0 B;  3LO7 A;  4BJP A;  3VP1 A;  3HLG A;  1J9M A;  4R38 A;  3WTP A;  3UDF A;  5CPK B;  3IWO A;  5B24 D;  2Y55 A;  3N7W A;  4Y17 A;  2H0Y A;  4DRB A;  5B1L D;  5BNV A;  2W3G A;  1I2S A;  4HES A;  2PYO A;  2IOU A;  5B40 A;  2Z2L B;  1TS0 A;  1H3Q A;  2BLS A;  4WZ4 A;  3WKJ B;  3MGQ C;  4PKY G;  2F8N B;  3BEC A;  3HUM A;  1K56 A;  3VOL A;  4BWI A;  3G32 A;  1AOI B;  1F98 A;  1W1Y A;  2HDQ A;  5HD3 A;  2O9C A;  4CPK A;  3LEQ A;  4Z2M H;  1WWI A;  1MWS A;  3UDX A;  2JHE A;  3TU4 B;  1YU3 A;  4XZQ A;  1YLY A;  2FJ7 C;  1E3U D;  1NYM A;  4QLC C;  1PZR A;  4WUJ A;  5TGF A;  3M2J A;  3T4O A;  2PYP A;  3PR6 A;  4UQI S;  4BBU A;  5CPI A;  1XJ2 A;  3P7N A;  1MWR A;  5AVF A;  1H8P A;  2WKE A;  1P3K A;  3HON A;  2VLG A;  3PBS A;  4LD9 C;  4U0T A;  3W96 C;  1F1E A;  1CXW A;  3HUO A;  4H9Q A;  4I3A A;  1G6O A;  4MB5 A;  4MEZ A;  3UE0 A;  2D02 A;  4XUJ D;  5HWT A;  2NQB B;  3WA9 A;  4WU8 A;  5EUA A;  5F68 A;  2P04 A;  4OP5 A;  3S7Q A;  1GSW A;  1L0D A;  4J8U D;  4LRZ E;  4HY8 A;  3DTM A;  5BS7 A;  2DRW A;  2XFT A;  4X1L A;  3CIT A;  2CMN A;  1ZTU A;  3QP8 A;  5AVC C;  3TOI A;  2W27 A;  4ARZ B;  2VV6 A;  2Y8H A;  4C75 A;  1IKI A;  1EQZ C;  4Z5T D;  4X23 D;  1OJ5 A;  3BLS A;  1E8B A;  4YM6 B;  4NET A;  3KWQ C;  4EES A;  5B2J A;  4KG2 A;  1P3L C;  4I39 A;  1FCN A;  2W8S A;  3LZ0 B;  2P7J A;  3WRT A;  4PHT A;  1MWT A;  4QHC A;  3DWZ A;  2ZBB A;  3AZF D;  1KX5 D;  1CJF A;  3KSH A;  4ZJ2 A;  5AQ7 A;  5CER A;  5KMW A;  1E25 A;  1WWS A;  3WTP D;  1P3F B;  4E3J A;  4P85 A;  3S1Y A;  4HBT A;  2ZQ8 A;  1GCE A;  4GCZ A;  3H82 B;  3PBR A;  1K57 C;  2ZM8 A;  4PMA A;  2Y2P A;  5KSC A;  3B6G A;  5AVB B;  2PYO D;  4DDS A;  3FKW A;  5B40 D;  5FI2 A;  5EVI C;  4EV4 A;  5HWV A;  2BYK A;  3REK A;  1BFM A;  4JGR A;  4JXV A;  2Y91 A;  4B4Z A;  1K56 D;  4NEE D;  2HP6 A;  1N4O A;  4R8P A;  2HV1 A;  1P3B C;  3NBL A;  3C38 A;  3C7U A;  3R45 A;  4TX8 A;  3IQA A;  1PW1 A;  3W99 A;  1OTE A;  2OOL A;  1S1Y A;  3HRE A;  2G5I C;  3NQJ A;  1XJ3 A;  1Y28 A;  5CPJ B;  1IYS A;  3L28 A;  2MJ6 A;  3BRM A;  3ZVT A;  4XZQ D;  1K6S A;  2PAV P;  2INW A;  3WS0 A;  3UTB A;  3AZM B;  5F99 A;  2PBY A;  1GPF A;  3GSG A;  4Q0I A;  1F66 B;  5CPI D;  3V9R B;  3KXB C;  2HDR A;  1S66 L;  3F1N B;  3O3V A;  3E2L A;  4S2J A;  5AVE A;  1OME A;  5GT0 A;  2EXB A;  3D3O A;  3UE3 A;  1VHM A;  3W2Z A;  2XDM A;  2QHK A;  4IUH A;  3ZG9 B;  5CPK A;  4UAA A;  3WA9 D;  4WU8 D;  5AV5 C;  2XD1 A;  2CWE A;  2F2A C;  4QY5 A;  2IWB A;  2R9W A;  3P09 A;  3AYW B;  4JXW A;  2ZQ9 A;  5I5L A;  1P9W A;  2I72 A;  4NZ3 A;  4QD4 A;  1L0E A;  3WKJ A;  1W8Q A;  2WYX A;  3AZL B;  2F8N A;  2EA9 A;  3ITA A;  3MF0 A;  5FI7 A;  4WZS B;  1P3L D;  1AOI A;  2VJW A;  2HDS A;  3BFD A;  4ZRR A;  2BG1 A;  5GL9 A;  4KZ8 A;  2K2N A;  2XRO A;  1Z6F A;  5B1M B;  3NJA A;  3CI6 A;  3OPP A;  3TU4 A;  2Y2H A;  3V3S A;  3A6N B;  3BY8 A;  5EOO A;  3EQV A;  1BLP A;  1W2E A;  3BJN A;  4CAY B;  3EPJ A;  4GHA A;  3B3X A;  3UY6 A;  4U0X A;  1E6Z A;  4IBD A;  3VH6 A;  4E3L A;  2OV5 A;  1PWG A;  2Y2G A;  4KZ3 A;  1P34 C;  4H6J B;  2VGL M;  3NDG A;  3B6G D;  1P3B D;  4EQ1 A;  3ZG0 A;  1BTL A;  3O87 A;  2NQB A;  3AV2 B;  3LY3 A;  3REK D;  4LV0 A;  5FI6 A;  1PWD A;  4IJG A;  5GXQ B;  1VEU B;  1XFN A;  3C30 A;  3E4P A;  5HX9 A;  4R8P D;  3VE4 A;  4BL3 A;  1KOU A;  1OTA A;  2PD8 A;  4LG2 A;  3RFB A;  3W99 D;  2V5O A;  3UNW A;  4PM7 A;  4B4X A;  4GHI B;  4Y15 A;  4HBU A;  3O86 A;  2CV5 C;  2LY8 A;  2R9X A;  2IWD A;  2ZLY A;  5EM1 A;  1YLP A;  3UE6 A;  3IWQ A;  4ARZ A;  4OOL A;  3UMD A;  4JXG A;  3UTB D;  4R4R A;  5EEC A;  5F99 D;  1LI0 A;  1H3O B;  4YM6 A;  2IO5 B;  4J8W B;  4WL9 A;  4JF4 A;  4IBX A;  3REH C;  2XQZ A;  3KFU G;  2NZD B;  3LZ0 A;  4MBK A;  3WRZ A;  3UTA C;  3G4P A;  3W4Q A;  5B1L B;  4H9S A;  2ZY2 A;  1MZU A;  1ZLA C;  2EX8 A;  3E4O A;  1QME A;  3C1C C;  5GT0 D;  3RXW A;  1P3I C;  1YLW A;  1P3F A;  3REL C;  3UT9 C;  1LLB A;  5CPK D;  1BSG A;  4EWF A;  4Y7P A;  4EBL A;  3H82 A;  1XGJ A;  2O99 A;  4E6X A;  1P3G C;  5AVB A;  1P3F C;  1TZY B;  1ID3 C;  1ZG6 A;  3NEC A;  1DJC A;  3MGP C;  3D72 A;  3IXD A;  3WKJ D;  1ONH A;  2F8N H;  1M1A B;  4IUK A;  1N9L A;  2F8N D;  3H7W B;  4H9N B;  1K38 A;  4ZUX B;  3KSY A;  4BBV A;  4R3B A;  1NRF A;  3FYZ A;  4KGC B;  3QP1 A;  1UR9 A;  3VV4 A;  3A3I A;  1SKO B;  5EVE A;  4WYY A;  5CPJ A;  1JWV A;  2PRF A;  4IJE A;  1I5Q A;  3LID A;  3TU4 D;  3AZK C;  4P6B A;  3A3F A;  5EOE A;  4S2M A;  3AZG B;  3AZM A;  1YSP A;  4DJ3 A;  3AZJ C;  3L25 A;  3FG8 A;  1KE0 A;  3V9R A;  2G2W A;  5G49 B;  1H0G A;  5AQ9 A;  4LV1 A;  2PBD P;  1H8Z A;  1DJA A;  4LRY C;  3F1N A;  1BH8 B;  5B2I C;  4Z66 C;  2C6W B;  2L0W A;  2ZMV A;  4XUX A;  3W98 C;  2V20 A;  3CUE C;  5CGX A;  4FTX A;  4KZ9 A;  3W97 C;  2NQB D;  5AV8 B;  5E2H A;  2XK1 A;  4R6L A;  5TBM B;  3AZE B;  4EBN A;  2F8N K;  1P3P B;  1CEF A;  3VE3 A;  3AYW A;  2V1B A;  2W3D A;  3U2A A;  1L0F A;  1CI9 A;  2WZX A;  2JN7 A;  4OQI A;  3N8R A;  1CK7 A;  1K55 A;  4EEP A;  3HLW A;  3T4S A;  3WS5 A;  1IYO A;  5C3I C;  2H5S A;  2W1R A;  3O62 C;  4YM6 D;  5FAP A;  4DE0 A;  5B1M A;  1H0M A;  5FDH A;  3PAE A;  4IBC A;  1RCJ A;  3LZ0 D;  3A6N A;  1ALQ A;  1PI5 A;  2J80 A;  3HSH A;  4OVD A;  3MGQ B;  4OJ6 A;  2WKQ A;  1LT0 A;  4S2K A;  4CAY A;  1P3F D;  2WGV A;  4IED A;  4NZ5 A;  3IH8 A;  4R23 A;  3SS5 A;  4KUK A;  5CXW A;  3N8S A;  4H6J A;  3NC8 A;  3ZQ5 A;  5AVB D;  2FJ7 B;  4X53 A;  1K6R A;  1OJG A;  3AV2 A;  4QLC B;  1G68 A;  5GXQ A;  4IJF A;  1VEU A;  3PTE A;  4OQG A;  3MVD C;  1W63 M;  2M7U A;  3RXX A;  4RA7 A;  5E2E A;  1T1C A;  4WNN B;  4KUO A;  3X1U C;  2ZL1 B;  4DRT A;  4LD9 B;  4GHI A;  3W96 B;  5CP6 C;  1OTI A;  4B9O A;  5CPJ D;  1C3B A;  2O9A A;  2O9B A;  1K25 A;  3HL9 A;  2Q9M A;  4HMC A;  3AZM D;  4E3I A;  1IFQ A;  1H3O A;  4MLL A;  4J8W A;  3OOV A;  4WLA A;  1FSY A;  4H9Q B;  4OPR A;  1W63 Q;  4R1G A;  1ZHH B;  2NZD A;  3FC7 A;  4JF6 A;  5E2F A;  3ICY A;  1WYB A;  4LEN A;  4OJO A;  2B18 A;  4AFI A;  3H0L C;  5B1L A;  4NK3 A;  4J8X C;  3L29 A;  5B31 G;  5A91 A;  2FFF B;  4MBH A;  5AVC B;  3CWF A;  2JKR I;  1EI5 A;  3B0C T;  1EQZ B;  1VM1 A;  4UA9 A;  4HGA C;  3AZN C;  3KWQ B;  3NIA A;  1QO6 A;  3ZHH A;  1P3L B;  4PAU A;  4GN2 A;  2VA0 A;  3AYW D;  1TZY A;  4OPY A;  4H9P B;  3TG9 A;  3OZH A;  5HAI A;  3OPL A;  3QP5 A;  1M1A A;  3NI9 A;  2PR5 A;  3H7W A;  3VOY A;  5HL6 A;  4H9N A;  4ZUX A;  1ES5 A;  3A0R A;  3MS6 A;  3UDI A;  3JPU A;  3ZGA B;  3BYD A;  4KGC A;  2H28 A;  2CC1 A;  4M4X A;  2QYB A;  1YPR A;  4KUD C;  5B1M D;  1SKO A;  3MZF A;  5AQA A;  4HJ3 A;  1OPX A;  4KGC C;  1XA1 A;  5EVI B;  3A6N D;  1RGY A;  4PPR A;  5JYP A;  3BM6 A;  5L09 A;  3AZG A;  2DCF A;  1FCM A;  1HD8 A;  3CHW P;  3M6H A;  3MMH A;  1MY8 A;  1DRM A;  1P3B B;  5G49 A;  4KZ6 A;  4UEY A;  3EG5 B;  2DNS A;  2HP5 A;  1NYY A;  2JBF A;  1YT4 A;  3IX3 A;  1BH8 A;  5DNN B;  2QZ6 A;  2V1A A;  5BT1 C;  3FPW A;  4X69 A;  3B6F C;  3WD1 A;  1PRQ A;  5AV8 A;  3AV2 D;  5KIZ A;  3HJK A;  5TBM A;  3AZE A;  1W1T A;  5GXQ D;  3KXB B;  1P3P A;  2EX9 A;  4KZB A;  4LV3 A;  2VK3 A;  2EWW A;  5B33 C;  1HQ3 B;  5FEG A;  1ERO A;  4ZAM A;  3O5Y A;  1GSX A;  3HJI A;  5IT5 A;  3MFD A;  1Z2C B;  3GMW A;  5AV5 B;  4BD1 A;  3KYQ A;  4FCF A;  1XJ6 A;  4Y0T A;  3MXR A;  3TE8 A;  4J8W D;  4BMW A;  3NY4 A;  1P0Z A;  2NZD D;  3H0R C;  1P97 A;  3RTY A;  3MGQ A;  4H9O B;  3KO6 A;  3AFA C;  3MGR C;  3B0C W;  1MWU A;  3G30 A;  1IYP A;  1ES3 A;  4MN6 A;  1KE3 A;  3KUY C;  4I3I A;  3NUL A;  5HZH A;  1YKD A;  3GEC A;  3Q1F A;  4BL2 A;  3MKF A;  1P3A A;  1PYY A;  1CQA A;  2ZMF A;  1TZY D;  4PM9 A;  2FJ7 A;  2WUQ A;  1BZA A;  1S67 L;  2ZQA A;  4QLC A;  2EFU A;  1HLU P;  1GA0 A;  1M1A D;  3WAA C;  3VSK A;  5DJU A;  4ZUX D;  2W3F A;  5FSR A;  1P3A C;  4KGC D;  5AJG A;  1FR1 A;  2M7V A;  4WNN A;  5K5B A;  1BLH A;  4IBK A;  2ZL1 A;  5DFX A;  1P34 B;  4LD9 A;  3W96 A;  2VX8 A;  3UB8 A;  3AGD A;  3A3J A;  3L9K A;  4FD8 A;  5DFY A;  3FWL A;  3AZG D;  5FEF A;  5DF7 A;  3T1Q B;  4OJP A;  2Z2M B;  2A3U A;  3Q82 A;  5DTS A;  3LZ1 A;  3G35 A;  3NOP C;  4XT2 B;  5BT1 D;  4Z2J A;  1YU0 A;  4EQI A;  2W3E A;  2WGW B;  4G91 C;  1VB6 A;  2CV5 B;  1FR6 A;  4IBG A;  3LZ1 C;  4GDB A;  3UPN A;  5AVC A;  4NXB A;  2Z6C A;  2OWJ A;  4PM6 A;  2JKF A;  1EQZ A;  1K54 A;  5AV8 D;  3ITB A;  4O0P A;  1NZU A;  4UUZ B;  3KWQ A;  3AZE D;  2QPN A;  3BQA A;  3REH B;  1P3P D;  1P3L A;  1MXO A;  1S32 C;  3DTK A;  4P6Z S;  4WEL A;  4H9P A;  4UA6 A;  3UTA B;  4OP8 A;  2D49 A;  1IKG A;  1K54 C;  1WA9 A;  1ZLA B;  3E4Q A;  3FV7 A;  1OT9 A;  3C1C B;  1E6R A;  4Z2M G;  5C5K A;  4Z2G A;  1P3I B;  2XGN A;  1VET B;  3I7J A;  1QMF A;  1PFL A;  3REL B;  3UT9 B;  3JYI A;  3SS3 A;  5AV9 C;  4WN5 A;  3G6O A;  1F9I A;  4HHD A;  2VGL S;  1K57 A;  3KS4 A;  1P3G B;  2OSU A;  1ID3 B;  2A2L A;  4GD8 A;  5A92 A;  4ETX A;  4I5S A;  2KLI A;  5EVI A;  3K3C A;  4X55 A;  3MGP B;  2XLN A;  4QB8 A;  3UPO A;  3MGQ D;  4GOG A;  2XFS A;  4Z2K A;  2DF4 C;  3LY4 A;  1P3B A;  2ZQD A;  5E5A C;  3IX4 A;  4M6B A;  3X1V C;  4HH2 A;  1OGB A;  3IF6 C;  1SDE A;  4EO5 B;  3PBT A;  3NOT C;  4HQA A;  5DNN A;  4Z1W A;  3HLE A;  2JCH A;  3PXP A;  4S2N C;  3ZVW A;  4S2P A;  3AZK B;  1P3A D;  1DP6 A;  1S4S A;  4DJ2 A;  5FAT A;  2FJ7 D;  2DQN C;  1XX2 A;  1ODV A;  4QLC D;  3AZJ B;  2ZY3 A;  1JWZ A;  3GV9 A;  5DNN C;  5F6A A;  3KXB A;  1YLJ A;  3AV1 C;  3REJ C;  4WM9 A;  1MC0 A;  2Y2N A;  2JE5 A;  4E3N A;  1YMS A;  4Z66 B;  5B2I B;  3SH9 A;  4LD9 D;  1HQ3 A;  5FL3 A;  3W96 D;  3EPL A;  3W98 B;  3ZG7 B;  4YS3 C;  3UB7 A;  3L7H A;  2XRN A;  4A5R A;  3W97 B;  5AV5 A;  1TDL A;  2P9V B;  4RX2 A;  1HQ3 C;  3WD0 A;  1V9Z A;  4UHU A;  5JRG C;  1JFI B;  4CQH A;  3LZ1 D;  1YU2 A;  3DTE A;  4GS9 B;  1S4R A;  3LFV A;  1T1A A;  3ZDJ A;  3T1S A;  4HMD A;  4GKU A;  4KG6 A;  4H9O A;  1BT5 A;  2OAP 1;  3E2K A;  3UB6 A;  5HAR A;  1HZO A;  4NY2 A;  4R3A A;  5AVC D;  1B67 A;  5C3I B;  1L0G A;  2WKI A;  4OLG A;  2L4R A;  3O62 B;  5HPI A;  1EQZ D;  4DXC A;  3KWQ D;  4Z9Q A;  4DE3 A;  1CK3 A;  4HH3 A;  3IWI A;  1ERM A;  4ZTK A;  5IHV A;  4MN5 A;  1U60 A;  3SH7 A;  4Y2F A;  2KDK A;  1I2W A;  1KX4 C;  2EX2 A;  1T1B A;  2X71 A;  3D9Y A;  1XJ4 A;  3X1S C;  3TRC A;  3CLO A;  1EWZ A;  3OLO A;  4Y0O A;  1P34 A;  1S0W A;  2RCX A;  3AN2 B;  4HJ6 A;  2ZM0 A;  3BQ8 A;  4KQQ A;  4LLO B;  3FDD A;  5HD5 A;  5GT3 C;  4YOF A;  4DF6 A;  1M18 C;  1YU1 A;  5EVI D;  1AIW A;  3X1V D;  4ME4 A;  2M1C A;  2LB5 A;  5HSQ A;  1DY6 A;  3MVD B;  1GHI A;  4JKT A;  2J9P A;  4XT2 A;  3PHY A;  3L2A A;  3X1U B;  1SKF A;  4X68 A;  4OQH A;  2WGW A;  1FIL A;  4OPZ A;  4X25 A;  5U47 A;  4FSF A;  5DNN D;  5CP6 B;  5CEB A;  2CV5 A;  3Q7Z A;  3C4P A;  3X1T C;  4NYU A;  1H8M A;  2V2F F;  1NLZ A;  4AWL C;  2J3T C;  1BH9 B;  4UUZ A;  3KXB D;  3REH A;  3IHB A;  1LHY A;  5HAP A;  4WV4 B;  3UTA A;  1P3O A;  5L10 A;  4J8X B;  1ZLA A;  2Y59 A;  3QP6 A;  1HQ3 D;  4HNB A;  4K0X A;  3C1C A;  1GA9 A;  1P3I A;  1VET A;  4HP4 A;  2XR0 A;  1U35 A;  5EVL A;  3REL A;  4NXE A;  3UT9 A;  1P3O C;  3LEL A;  4HGA B;  5AV5 D;  4QY6 A;  3AZN B;  1LL5 A;  1ESU A;  3C4O A;  3PBO A;  5IU1 A;  4KQO A;  1P3G A;  3Q7V B;  4HOI A;  1ID3 A;  3W4P A;  1U35 C;  4MNR A;  1GOI A;  4KZ5 A;  4S2I A;  3ZG5 A;  3LEL C;  3MGP A;  3VP0 A;  1XFQ A;  1CF0 A;  2ZQ7 A;  4K91 A;  2DMW A;  3S22 A;  3WD2 A;  2GX5 A;  3Q07 A;  1AWI A;  1TD5 A;  3HLB A;  4NXG A;  1TS8 A;  3LUQ A;  4RQ9 A;  4Y13 A;  1BUL A;  3K2N A;  1G5U A;  4KUD B;  3TW8 A;  1XPB A;  2EX6 A;  1BLS A;  5TFQ A;  4UPK A;  5CTN A;  1F5M A;  2WAF A;  5FQI A;  5CHU A;  3AZK A;  1STZ A;  4RX3 A;  4L9G A;  3LGO A;  1Z09 A;  2NUP C;  3AZI B;  4IBB A;  5HDD A;  4EEU A;  1PZO A;  5B31 C;  2YFW B;  2ZM2 A;  4EO5 C;  3AZJ A;  2J3W A;  1W1V A;  2HIO C;  1SZV A;  1KX3 C;  1KVM A;  3H0M C;  5B2I A;  4Z66 A;  1A7W A;  3WD3 A;  1P34 D;  1MKM A;  5F83 A;  3W98 A;  4WF0 A;  1N1J B;  3CUE A;  3VMA A;  4DMZ A;  1GHM A;  3B6F B;  3W97 A;  3VOZ A;  5B0Y C;  2P9V A;  4N9L A;  3P01 A;  1FCO A;  3ZCZ A;  1JFI A;  4GS9 A;  5HPF A;  2JSS A;  1F2K A;  4FH2 A;  2HUE C;  3LIE A;  5B33 B;  3CPT B;  3UN7 A;  2CV5 D;  4Z2L A;  5GSU C;  1DP8 A;  2PD7 A;  4N1H A;  4EET B;  4HP9 A;  4QJG A;  5AV6 C;  1LI9 A;  5EV0 A;  3C2W A;  3O62 A;  4OQ0 A;  1YLT A;  3IHA A;  5DKL A;  2F8N G;  3MGS C;  3REH D;  1JVJ A;  3T4J A;  1H5X A;  5GHY A;  3UTA D;  3MQL A;  1P3O D;  2Y2L A;  1ZLA D;  1L6J A;  3C1C D;  3AFA B;  3MGR B;  1P3I D;  5B32 G;  2WKR A;  5B0Z C;  1U35 D;  3REL D;  3UT9 D;  1T18 A;  3KUY B;  5CX7 A;  5AY8 B;  3LEL D;  1PNE A;  5E2G A;  4KZ7 A;  3BFE A;  3AN2 A;  3VH5 T;  1PIO A;  5EPH A;  1P3G D;  1N9N A;  4CJN A;  1ID3 D;  4G92 C;  3F1O B;  3E98 A; 
#chains in the Genus database with same CATH homology
 3MGP D;  4P87 A;  1Y54 A;  3WAA B;  3AN2 C;  3MVD A;  1P3A B;  4J8V C;  3HVF A;  4NYY A;  2RL3 A;  3IF5 A;  3X1U A;  2VGK A;  2WAE A;  4D2O A;  2RVQ C;  5CP6 A;  4JXS A;  3AZK D;  5BOH A;  4JJN C;  5CRF A;  2OLV A;  3GVB A;  1BH9 A;  3AZJ D;  3C7V A;  4OKP A;  3MNN C;  3G2Y A;  3BFF A;  3OCL A;  3EQU A;  5B2I D;  4Z66 D;  4G91 B;  4J8X A;  5B0Y D;  4C3Q A;  1P3M C;  3LZ1 B;  3W98 D;  3C1B C;  3OPR A;  3W97 D;  3AZN A;  5EE8 A;  3KS8 A;  4L0L A;  3SS4 A;  1S32 B;  5GLC A;  3Q7V A;  3SOI A;  1YLZ A;  2L5A A;  5KDM B;  1FQG A;  2J8Y A;  3MZE A;  5CHL B;  1B6W A;  1O07 A;  4S2L A;  5AV9 B;  3O62 D;  4KUD A;  2HP9 A;  5M18 A;  3VFH A;  5B24 C;  4E45 A;  3OCN A;  5CED A;  4LCM A;  5FUG B;  3AZI A;  3N4I A;  5DVA A;  2WKH A;  2YFW A;  3A3E A;  4U3T A;  4ZJ1 A;  3AZH B;  5E5A B;  4LCL A;  5BO0 B;  3QNB A;  1ES2 A;  4CSR B;  3X1V B;  3VH5 W;  3IF6 B;  3AZI C;  1Q9C A;  1ULY A;  4GH9 A;  1TAF B;  5CTM A;  3AN2 D;  1PI4 A;  1W7F A;  2GDN A;  1N1J A;  2VGJ A;  1WYC A;  1JTG A;  3FKV A;  1PZP A;  5FQ9 A;  3B6F A;  2ZC3 B;  3BLM A;  4OOM A;  1AXB A;  5DTT A;  3AV1 B;  3REJ B;  3BFC A;  3MVD D;  4OUI A;  2ZC7 A;  3X1U D;  2A49 A;  2YFV B;  5B33 A;  4OPQ A;  4KEN B;  5CP6 D;  5M19 A;  4YS3 B;  3NQU B;  3REI B;  4DRA A;  4WBG A;  3UPP A;  4ID4 A;  4OON A;  2PU4 A;  4OH0 A;  5JRG B;  3Q81 A;  4XUJ C;  3A1I A;  3NCK A;  3F6T A;  4B88 A;  4J8X D;  4J8U C;  3IXB A;  2ARO B;  3AFA A;  3MGR A;  4WU9 A;  4GNU A;  3AL0 C;  1PWC A;  3KUY A;  5AY8 A;  1SDN A;  3AZN D;  3LJA B;  1SCW A;  2B5R A;  4WU9 C;  1XA7 A;  2QMI A;  2V1Z A;  4Z5T C;  4X23 C;  5AY8 C;  3AGE A;  2ZD8 A;  3WAA A;  2JC7 A;  3IT9 A;  2ZC5 B;  1KX4 B;  3HLF A;  3IXH A;  3AZF C;  3X1S B;  1KX5 C;  4E3K A;  3G34 A;  4X6T A;  5BPV A;  1M19 B;  4KUD D;  3WTP C;  4BEN A;  5DF8 A;  1YM1 A;  5GT3 B;  1M18 B;  5BNX B;  1YUE A;  1VQQ A;  4Y0U A;  3AZI D;  4RVA A;  3B0D C;  3VP4 A;  2PYO C;  3M2K A;  3B0B A;  5B40 C;  2BYM B;  1YMX A;  5AQB A;  5B32 B;  4ZBJ C;  4DE2 A;  3X1T B;  4R0Q A;  2E8I A;  2Y2O A;  3B6F D;  4AWL B;  1S6R A;  2G5H C;  2G2U A;  1IEM A;  4R3J A;  4XZQ C;  1ZC2 A;  1S32 A;  1RP5 A;  5JA4 B;  5CPI C;  3HLC A;  5B33 D;  5KDM A;  4NE5 A;  4YIN A;  4LV2 A;  5FA7 A;  3W8K A;  2ZC4 B;  1P3K C;  2UWX A;  1P3O B;  5AV9 A;  5KSH A;  5HFO A;  5J8X A;  5DTK A;  3WA9 C;  4WU8 C;  1U35 B;  2ZY5 A;  2ZY4 A;  5FUG A;  3LEL B;  5F82 A;  4F94 A;  3AZH A;  5G18 A;  3AFA D;  5BS7 C;  3MGR D;  3M6B A;  5M1A A;  4ZJ3 A;  4WU9 D;  1ZG4 A;  4PM8 A;  5E5A A;  5BO0 A;  3WS4 A;  3RJU A;  4WEJ A;  4CSR A;  3X1V A;  2VQR A;  3KUY D;  5AY8 D;  3IF6 A;  5FQM A;  1TAF A;  3AZH C;  4S2N A;  1BLC A;  5A93 A;  1XGI A;  5E43 A;  5GLB A;  2H10 A;  1NXY A;  3A3D A;  4K0W A;  5B31 B;  5B2J C;  4PM5 A;  3WAA D;  5CHM A;  1ERQ A;  4DQY B;  2HIO B;  1KX3 B;  3AV1 A;  3REJ A;  2HDU A;  1M40 A;  4EBP A;  5L2F A;  4WMC A;  3S4X A;  2YFV A;  2ZM5 A;  4YS3 A;  3NQU A;  3REI A;  4GB7 A;  3VSL A;  4JPM A;  4MBF A;  5FAQ A;  5B0Y B;  5DNM A;  3B6G C;  2H0T A;  3ISG A;  3GTC A;  5TR7 A;  5JRG A;  1KVL A;  3V39 A;  3REI C;  3REK C;  2HUE B;  4QNL A;  1FOF A;  3ZFZ A;  5DNM C;  4R8P C;  4E3O A;  2ARO A;  5GSU B;  3GQZ A;  5AV6 B;  3W99 C;  2J9O A;  4KHA B;  3MGS B;  4KG5 A;  3LJA A;  2ARO C;  5JYO A;  4UA7 A;  4KZA A;  1S32 D;  3UTB C;  5F99 C;  1P3K D;  2Y2K A;  3QNC A;  4OLD A;  1NY0 A;  3VH6 T;  3LJA C;  3FKE A;  1KGE A;  1KX4 A;  5B0Z B;  4IBR A;  4N9K A;  3X1S A;  4OJL A;  5AV9 D;  1M19 A;  5GT0 C;  4XUZ A;  2Y2M A;  4GZB A;  3OPH A;  1H8Y A;  1E4D A;  5CPK C;  4BD0 A;  5GT3 A;  4G92 B;  1M18 A;  5BNX A;  5FQQ A;  4DKI A;  3WTP E;  1M19 C;  3UE1 A;  5FAO A;  3AZH D;  3GRJ A;  1HTZ A;  4J8V B;  5E5A D;  3P5J B;  1CI8 A;  4O7D A;  3WKJ C;  2P74 A;  2BYM A;  3O88 A;  2J7V A;  5B2J D;  1AOI C;  5B32 A;  1LL9 A;  3MBZ A;  3X1T A;  5CGW A;  3VP2 A;  1KE4 A;  4JJN B;  4C6Y A;  5B32 C;  3TU4 C;  3MNN B;  5CEC A;  3AV1 D;  4OOY A;  3REJ D;  4WMC D;  1TEM A;  5JA4 A;  5FAS A;  1CEG A;  1NZO A;  3CZD A;  1P3M B;  1IYQ A;  1YQS A;  3C1B B;  4YS3 D;  3REI D;  5CHJ A;  2ZQC A;  3N8L A;  2Y2I A;  5DNM D;  2EXA A;  4DXB A;  4QU3 A;  5JRG D;  2HPB A;  2NQB C;  3HLD A;  2IWC A;  4RYE A;  5KZH A;  3WWX A;  2ARO D;  4IBI A;  1O7E A;  4WZ5 A;  5HAQ A;  2RIQ A;  3N3F A;  3LJA D;  1ESI A;  3PBN A;  5B24 B;  3VH6 W;  4WZ5 C;  4YM6 C;  3PBQ A;  3CMZ A;  4OJ5 A;  5B31 A;  3SH8 A;  3LZ0 C;  4H9R B;  3LEZ A;  2HIO A;  3HUN A;  1KX3 A;  3WS1 A;  1KX4 D;  3MZD A;  3OC2 A;  3G31 A;  4H9S C;  2PU2 A;  3X1S D;  2XF3 A;  1L2S A;  1M19 D;  3D4F A;  1SHV A;  1MKI A;  4NE3 A;  5GT3 D;  1M18 D;  3V3R A;  5B0Y A;  5AVB C;  1AOI D;  4GD6 A;  4NE6 A;  2ZJ9 A;  4KQR A;  3GR2 A;  1HVB A;  5B32 D;  3N6I A;  5GSU A;  4N92 A;  3X1T D;  1KDS A;  5AV6 A;  4KHA A;  3W4O A;  1TVF A;  4ZBE A;  1F66 A;  1RGZ A;  5CPJ C;  3MGS A;  5GHZ A;  4XUJ B;  3HBR A;  1BUE A;  4GDN A;  1PW8 A;  2XD5 A;  3AZM C;  3MXS A;  3V50 A;  4S2O A;  2J8P A;  1HTA A;  4NFT A;  3DW0 A;  4WEK A;  1F66 C;  4J8U B;  5HL1 A;  1G6A A;  2XEP A;  5B0Z A;  3DWK A;  4BQM A;  4WU9 B;  5DF9 A;  1XP4 A;  3V5M A;  4Z5T B;  4X23 B;  1Q2Q A;  3UO9 A;  4ZDX A;  4NZ1 A;  5GLA A;  3AZL A;  3PAG A;  3VFF A;  4X56 A;  3AYW C;  1JTD A;  4N1X A;  1W8Y A;  4J8V A;  3L27 A;  4Q8I A;  3AZF B;  2Y2Q A;  1KX5 B;  4IBE A;  5CGS A;  3AZL C;  2C5W B;  1K55 C;  3IH9 A;  4WJ3 C;  3WTP B;  4DDY A;  3CG5 A;  5GLD A;  3L26 A;  4JJN A;  2ZMA A;  5BNV B;  1XXM A;  5B1M C;  3B0D B;  4IVK A;  5B31 D;  2ZC6 B;  2PYO B;  5B40 B;  4FH4 A;  2XH9 A;  3MNN A;  4M3K A;  2HIO D;  3A6N C;  1KX3 D;  4JF5 A;  1N9B A;  4GHL A;  2X01 A;  2WAD A;  4E44 A;  1P3M A;  4ZBJ B;  1KU5 A;  3C1B A;  1ONG A;  2X02 A;  3ZNT A;  3WS2 A;  5F1G A;  4XZQ B;  4BLM A;  5GHX A;  3VH5 A;  4YFM A;  2WZZ A;  3AV2 C;  2Y4A A;  4R4S A;  2WK0 A;  5CPI B;  5GXQ C;  3BFG A;  4XXR A;  1FSW A;  5GSU D;  3EPH A;  1JWP A;  1K4E A;  1ZKJ A;  5AV6 D;  1P3K B;  1YU4 A;  3WX7 A;  3QHY A;  1F66 D;  3NDE A;  3MGS D;  5A90 A;  3MKE A;  5B24 A;  4WU8 B;  3WA9 B;  1GHP A;  3P98 A;  1KGG A;  3C5A A;  1WE4 A;  2IO5 C;  4J8W C;  1W79 A;  3BEB A;  2NZD C;  4H9R A;  5I94 A;  5B0Z D;  5B1L C;  1W5D A;  1IEL A;  3CJM A;  1KGF A;  4KZ4 A;  3IXG A;  1K4F A;  3AZL D;  5B2J B;  4EUZ A;  4NZ4 A;  4IBJ A;  3ZG8 B;  1TZY C;  4P0M A;  1NJ4 A;  2Q9N A;  4J8V D;  1E3U A;  4JBF A;  1M1A C;  3TSG A;  4ZUX C;  4E6W A;  2RVQ D;  3FZC A;  5HW3 A;  1KDW A;  3IP4 C;  4JJN D;  3B6G B;  1MBL A;  1MPL A;  4H8R A;  4XUJ A;  3MNN D;  1TDG A;  2BYK B;  3REK B;  3AZG C;  5FQK A;  2FFY A;  4HEF A;  5DNM B;  4R8P B;  4J8U A;  3VP3 A;  1P3M D;  3R45 B;  2EFX A;  3C1B D;  3W99 B;  4IBF A;  2WGI A;  4DE1 A;  3NQJ B;  4E3M A;  3A1K A;  1Q2P A;  3UTB B;  3EPK A;  3AGF A;  1M6K A;  4JLF A;  5F99 B;  3G2Z A;  4Z5T A;  1T3U A;  5AV8 C;  4X23 A;  1ES4 A;  5F1F A;  3AZE C;  1P3P C;  5FQJ A;  3LCE A;  4IVI A;  1DJB A;  1XKZ A;  3ZNY A;  1R4V A;  5D3O A;  3AZF A;  1KX5 A;  2OLU A;  2Y2J A;  5GT0 B;  3LO7 A;  4BJP A;  3VP1 A;  3HLG A;  1J9M A;  3WTP A;  3UDF A;  5CPK B;  3IWO A;  5B24 D;  2Y55 A;  3N7W A;  2H0Y A;  4DRB A;  5B1L D;  5BNV A;  1I2S A;  4HES A;  2PYO A;  2IOU A;  5B40 A;  2Z2L B;  2BLS A;  4WZ4 A;  3WKJ B;  3MGQ C;  2F8N B;  3BEC A;  3HUM A;  1K56 A;  3G32 A;  1AOI B;  2HDQ A;  4CPK A;  4Z2M H;  1WWI A;  1MWS A;  3UDX A;  3TU4 B;  1YU3 A;  4XZQ A;  1YLY A;  2FJ7 C;  1E3U D;  1NYM A;  4QLC C;  1PZR A;  5TGF A;  3M2J A;  5CPI A;  1MWR A;  2WKE A;  1P3K A;  3HON A;  4U0T A;  3PBS A;  4LD9 C;  3W96 C;  1F1E A;  3HUO A;  4H9Q A;  3UE0 A;  4MEZ A;  4XUJ D;  2NQB B;  3WA9 A;  4WU8 A;  5EUA A;  4OP5 A;  1L0D A;  4J8U D;  3DTM A;  5BS7 A;  2DRW A;  2XFT A;  5AVC C;  3TOI A;  4C75 A;  1IKI A;  1EQZ C;  4Z5T D;  4X23 D;  3BLS A;  4YM6 B;  4NET A;  3KWQ C;  5B2J A;  4KG2 A;  1P3L C;  1FCN A;  2W8S A;  3LZ0 B;  3WRT A;  1MWT A;  4QHC A;  3DWZ A;  3AZF D;  1KX5 D;  4ZJ2 A;  5AQ7 A;  5CER A;  5KMW A;  1E25 A;  1WWS A;  3WTP D;  1P3F B;  4E3J A;  4P85 A;  3S1Y A;  4HBT A;  2ZQ8 A;  1GCE A;  3PBR A;  1K57 C;  2ZM8 A;  4PMA A;  2Y2P A;  5KSC A;  3B6G A;  5AVB B;  2PYO D;  4DDS A;  3FKW A;  5B40 D;  5FI2 A;  5EVI C;  4EV4 A;  2BYK A;  3REK A;  1BFM A;  4JXV A;  4B4Z A;  2Y91 A;  1K56 D;  2HP6 A;  1N4O A;  4R8P A;  1P3B C;  3NBL A;  3C7U A;  3R45 A;  3IQA A;  1PW1 A;  3W99 A;  3HRE A;  2G5I C;  3NQJ A;  5CPJ B;  1IYS A;  3L28 A;  3BRM A;  3ZVT A;  4XZQ D;  1K6S A;  3WS0 A;  3UTB A;  3AZM B;  5F99 A;  2PBY A;  3GSG A;  1F66 B;  5CPI D;  3V9R B;  3KXB C;  2HDR A;  3O3V A;  3E2L A;  4S2J A;  1OME A;  5GT0 A;  2EXB A;  3UE3 A;  2XDM A;  3ZG9 B;  5CPK A;  4UAA A;  3WA9 D;  4WU8 D;  5AV5 C;  2XD1 A;  2CWE A;  2F2A C;  4QY5 A;  2IWB A;  2R9W A;  3P09 A;  3AYW B;  4JXW A;  2ZQ9 A;  2I72 A;  4NZ3 A;  4QD4 A;  1L0E A;  3WKJ A;  1W8Q A;  2WYX A;  3AZL B;  2F8N A;  3ITA A;  5FI7 A;  4WZS B;  1P3L D;  1AOI A;  2HDS A;  3BFD A;  2BG1 A;  5GL9 A;  4KZ8 A;  1Z6F A;  5B1M B;  3OPP A;  3TU4 A;  2Y2H A;  3V3S A;  3A6N B;  5EOO A;  3EQV A;  1BLP A;  1W2E A;  4CAY B;  3EPJ A;  4GHA A;  3B3X A;  3UY6 A;  4U0X A;  4IBD A;  3VH6 A;  4E3L A;  2OV5 A;  1PWG A;  2Y2G A;  4KZ3 A;  1P34 C;  3NDG A;  3B6G D;  1P3B D;  3ZG0 A;  1BTL A;  3O87 A;  2NQB A;  3AV2 B;  3LY3 A;  3REK D;  4LV0 A;  5FI6 A;  1PWD A;  5GXQ B;  5HX9 A;  4R8P D;  4BL3 A;  4LG2 A;  3W99 D;  3UNW A;  4PM7 A;  4B4X A;  4HBU A;  3O86 A;  2CV5 C;  2LY8 A;  2R9X A;  2IWD A;  2ZLY A;  1YLP A;  3IWQ A;  4OOL A;  4JXG A;  3UTB D;  4R4R A;  5EEC A;  5F99 D;  1LI0 A;  1H3O B;  4YM6 A;  2IO5 B;  4J8W B;  4JF4 A;  4IBX A;  3REH C;  2XQZ A;  3KFU G;  2NZD B;  3LZ0 A;  4MBK A;  3WRZ A;  3UTA C;  3G4P A;  3W4Q A;  5B1L B;  4H9S A;  2ZY2 A;  1ZLA C;  2EX8 A;  1QME A;  3C1C C;  5GT0 D;  3RXW A;  1P3I C;  1YLW A;  1P3F A;  3REL C;  3UT9 C;  1LLB A;  5CPK D;  1BSG A;  4EWF A;  4Y7P A;  4EBL A;  1XGJ A;  4E6X A;  1P3G C;  5AVB A;  1P3F C;  1TZY B;  1ID3 C;  1ZG6 A;  1DJC A;  3MGP C;  3IXD A;  3WKJ D;  1ONH A;  2F8N H;  1M1A B;  2F8N D;  4H9N B;  1K38 A;  4ZUX B;  3KSY A;  4R3B A;  1NRF A;  3FYZ A;  4KGC B;  3A3I A;  4WYY A;  5CPJ A;  1JWV A;  4IJE A;  1I5Q A;  3TU4 D;  3AZK C;  4P6B A;  3A3F A;  5EOE A;  4S2M A;  3AZG B;  3AZM A;  3AZJ C;  3L25 A;  1KE0 A;  3V9R A;  2G2W A;  5G49 B;  5AQ9 A;  4LV1 A;  1H8Z A;  1DJA A;  1BH8 B;  5B2I C;  4Z66 C;  2C6W B;  4XUX A;  3W98 C;  2V20 A;  5CGX A;  4KZ9 A;  3W97 C;  2NQB D;  5AV8 B;  5E2H A;  2XK1 A;  3AZE B;  4EBN A;  2F8N K;  1P3P B;  1CEF A;  3AYW A;  1L0F A;  1CI9 A;  2WZX A;  4OQI A;  3N8R A;  1K55 A;  3HLW A;  3WS5 A;  1IYO A;  5C3I C;  2H5S A;  3O62 C;  4YM6 D;  5FAP A;  4DE0 A;  5B1M A;  5FDH A;  3PAE A;  4IBC A;  1RCJ A;  3LZ0 D;  3A6N A;  1ALQ A;  1PI5 A;  4OVD A;  3HSH A;  3MGQ B;  4OJ6 A;  4S2K A;  4CAY A;  1P3F D;  2WGV A;  4IED A;  4NZ5 A;  3IH8 A;  4R23 A;  3SS5 A;  5CXW A;  3N8S A;  3NC8 A;  5AVB D;  2FJ7 B;  4X53 A;  1K6R A;  3AV2 A;  4QLC B;  1G68 A;  5GXQ A;  4IJF A;  3PTE A;  4OQG A;  3MVD C;  3RXX A;  4RA7 A;  5E2E A;  4WNN B;  3X1U C;  4DRT A;  4LD9 B;  3W96 B;  5CP6 C;  5CPJ D;  1C3B A;  1K25 A;  3HL9 A;  2Q9M A;  3AZM D;  4E3I A;  1H3O A;  4MLL A;  4J8W A;  1FSY A;  4H9Q B;  4OPR A;  4R1G A;  2NZD A;  4JF6 A;  5E2F A;  1WYB A;  4LEN A;  4OJO A;  3H0L C;  5B1L A;  4NK3 A;  4J8X C;  3L29 A;  5B31 G;  5A91 A;  2FFF B;  4MBH A;  5AVC B;  1EI5 A;  3B0C T;  1EQZ B;  1VM1 A;  4UA9 A;  4HGA C;  3AZN C;  3KWQ B;  3NIA A;  3ZHH A;  1P3L B;  4GN2 A;  3AYW D;  1TZY A;  4OPY A;  4H9P B;  3TG9 A;  3OZH A;  5HAI A;  3OPL A;  1M1A A;  3NI9 A;  3VOY A;  4H9N A;  4ZUX A;  1ES5 A;  3UDI A;  3ZGA B;  3BYD A;  4KGC A;  2CC1 A;  4KUD C;  5B1M D;  3MZF A;  5AQA A;  4KGC C;  1XA1 A;  5EVI B;  3A6N D;  1RGY A;  4PPR A;  5JYP A;  3BM6 A;  3AZG A;  2DCF A;  1FCM A;  1HD8 A;  3M6H A;  1MY8 A;  1P3B B;  5G49 A;  4KZ6 A;  3EG5 B;  2DNS A;  2HP5 A;  1NYY A;  2JBF A;  1YT4 A;  1BH8 A;  5DNN B;  2QZ6 A;  5BT1 C;  4X69 A;  3B6F C;  5AV8 A;  3AV2 D;  3AZE A;  5GXQ D;  3KXB B;  1P3P A;  2EX9 A;  4KZB A;  4LV3 A;  5B33 C;  1HQ3 B;  1ERO A;  4ZAM A;  3MFD A;  1Z2C B;  3GMW A;  5AV5 B;  4BD1 A;  4FCF A;  4Y0T A;  3MXR A;  4J8W D;  3NY4 A;  2NZD D;  3H0R C;  3MGQ A;  4H9O B;  3AFA C;  3MGR C;  3B0C W;  1MWU A;  3G30 A;  1IYP A;  1ES3 A;  1KE3 A;  3KUY C;  3Q1F A;  4BL2 A;  3MKF A;  1P3A A;  1PYY A;  1TZY D;  4PM9 A;  2FJ7 A;  2WUQ A;  1BZA A;  2ZQA A;  4QLC A;  2EFU A;  1GA0 A;  1M1A D;  3WAA C;  3VSK A;  4ZUX D;  5FSR A;  1P3A C;  4KGC D;  1FR1 A;  4WNN A;  1BLH A;  4IBK A;  1P34 B;  4LD9 A;  3W96 A;  3AGD A;  3A3J A;  4FD8 A;  3FWL A;  3AZG D;  5DF7 A;  4OJP A;  2Z2M B;  2A3U A;  3Q82 A;  5DTS A;  3LZ1 A;  3G35 A;  5BT1 D;  1YU0 A;  4EQI A;  2WGW B;  4G91 C;  2CV5 B;  1FR6 A;  4IBG A;  3LZ1 C;  4GDB A;  3UPN A;  5AVC A;  4PM6 A;  1EQZ A;  1K54 A;  5AV8 D;  3ITB A;  1NZU A;  4UUZ B;  3KWQ A;  3AZE D;  2QPN A;  3REH B;  1P3P D;  1P3L A;  1MXO A;  1S32 C;  4WEL A;  4H9P A;  4UA6 A;  3UTA B;  4OP8 A;  1IKG A;  1K54 C;  1ZLA B;  3FV7 A;  3C1C B;  4Z2M G;  2XGN A;  1P3I B;  3I7J A;  1QMF A;  3REL B;  3UT9 B;  3JYI A;  3SS3 A;  5AV9 C;  1K57 A;  3KS4 A;  1P3G B;  2OSU A;  1ID3 B;  4GD8 A;  5A92 A;  5EVI A;  4X55 A;  3MGP B;  2XLN A;  4QB8 A;  3UPO A;  3MGQ D;  4GOG A;  2XFS A;  2DF4 C;  3LY4 A;  1P3B A;  2ZQD A;  5E5A C;  4M6B A;  3X1V C;  3IF6 C;  1SDE A;  4EO5 B;  3PBT A;  5DNN A;  3HLE A;  2JCH A;  4S2N C;  3ZVW A;  4S2P A;  3AZK B;  1P3A D;  5FAT A;  2FJ7 D;  2DQN C;  1XX2 A;  4QLC D;  3AZJ B;  2ZY3 A;  1JWZ A;  3GV9 A;  5DNN C;  3KXB A;  1YLJ A;  3AV1 C;  3REJ C;  4WM9 A;  2Y2N A;  2JE5 A;  4E3N A;  1YMS A;  4Z66 B;  5B2I B;  3SH9 A;  4LD9 D;  1HQ3 A;  3W96 D;  3EPL A;  3W98 B;  3ZG7 B;  4YS3 C;  4A5R A;  3W97 B;  5AV5 A;  1TDL A;  2P9V B;  4RX2 A;  1HQ3 C;  4UHU A;  5JRG C;  1JFI B;  3LZ1 D;  1YU2 A;  3ZDJ A;  4GKU A;  4KG6 A;  4H9O A;  1BT5 A;  3E2K A;  5HAR A;  1HZO A;  4NY2 A;  5AVC D;  1B67 A;  5C3I B;  1L0G A;  2WKI A;  4OLG A;  3O62 B;  1EQZ D;  4DXC A;  3KWQ D;  4Z9Q A;  4DE3 A;  1CK3 A;  3IWI A;  1ERM A;  4ZTK A;  5IHV A;  1U60 A;  3SH7 A;  1I2W A;  1KX4 C;  2EX2 A;  2X71 A;  3X1S C;  1EWZ A;  4Y0O A;  1P34 A;  1S0W A;  2RCX A;  3AN2 B;  2ZM0 A;  4KQQ A;  3FDD A;  5GT3 C;  4DF6 A;  1M18 C;  1YU1 A;  5EVI D;  3X1V D;  1DY6 A;  3MVD B;  1GHI A;  4JKT A;  2J9P A;  3L2A A;  3X1U B;  1SKF A;  4X68 A;  4OQH A;  2WGW A;  4OPZ A;  5U47 A;  4FSF A;  5DNN D;  5CP6 B;  5CEB A;  2CV5 A;  3Q7Z A;  3C4P A;  3X1T C;  4NYU A;  2V2F F;  4AWL C;  1BH9 B;  4UUZ A;  3KXB D;  3REH A;  3IHB A;  1LHY A;  5HAP A;  4WV4 B;  3UTA A;  1P3O A;  4J8X B;  1ZLA A;  2Y59 A;  1HQ3 D;  4K0X A;  3C1C A;  1GA9 A;  1P3I A;  2XR0 A;  1U35 A;  5EVL A;  3REL A;  3UT9 A;  1P3O C;  3LEL A;  4HGA B;  5AV5 D;  4QY6 A;  3AZN B;  1LL5 A;  1ESU A;  3C4O A;  3PBO A;  4KQO A;  1P3G A;  3Q7V B;  1ID3 A;  3W4P A;  1U35 C;  4MNR A;  4KZ5 A;  4S2I A;  3ZG5 A;  3LEL C;  3MGP A;  3VP0 A;  4K91 A;  2ZQ7 A;  3S22 A;  3Q07 A;  3HLB A;  1BUL A;  4KUD B;  1XPB A;  2EX6 A;  1BLS A;  5TFQ A;  4UPK A;  5CTN A;  2WAF A;  5FQI A;  5CHU A;  3AZK A;  4RX3 A;  3AZI B;  4IBB A;  1PZO A;  5B31 C;  2YFW B;  2ZM2 A;  4EO5 C;  3AZJ A;  2HIO C;  1KX3 C;  1KVM A;  3H0M C;  5B2I A;  4Z66 A;  1A7W A;  1P34 D;  5F83 A;  3W98 A;  1N1J B;  3VMA A;  1GHM A;  3B6F B;  3W97 A;  3VOZ A;  5B0Y C;  2P9V A;  4N9L A;  1FCO A;  3ZCZ A;  1JFI A;  2JSS A;  4FH2 A;  2HUE C;  5B33 B;  3UN7 A;  2CV5 D;  5GSU C;  4N1H A;  4QJG A;  5AV6 C;  1LI9 A;  3O62 A;  4OQ0 A;  1YLT A;  3IHA A;  2F8N G;  3MGS C;  3REH D;  1JVJ A;  1H5X A;  5GHY A;  3UTA D;  1P3O D;  2Y2L A;  1ZLA D;  3C1C D;  3AFA B;  3MGR B;  1P3I D;  5B32 G;  5B0Z C;  1U35 D;  3REL D;  3UT9 D;  3KUY B;  5AY8 B;  3LEL D;  5E2G A;  4KZ7 A;  3BFE A;  3AN2 A;  3VH5 T;  1PIO A;  5EPH A;  1P3G D;  4CJN A;  1ID3 D;  4G92 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...