2Y2GA

Penicillin-binding protein 1b (pbp-1b) in complex with an alkyl boronate (a01)
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
486
structure length
466
Chain Sequence
EITYSDGTVIASIDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTGQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PENICILLIN-BINDING PROTEIN 1B
publication title Structure-Guided Design of Cell Wall Biosynthesis Inhibitors that Overcome Beta-Lactam Resistance in Staphylococcus Aureus (Mrsa).
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
total genus 165
structure length 466
sequence length 486
chains with identical sequence B
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2y2gA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2y2gA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2y2gA02
2EFXA 2OV5A 1IYSA 2JE5A 3FWLA 3ZNYA 2G2UA 1K54C 3HL9A 2EXBA 3GTCA 4O7DA 1KVMA 3VP3A 3P98A 1XGJA 1XKZA 5F1FA 4OLDA 4GOGA 4OP8A 5A92A 5I94A 3LCEA 4U3TA 3A3EA 4D2OA 3B3XA 3WS1A 1W7FA 4PM6A 5CTNA 1GA9A 5FATA 3W4QA 2A49A 1K54A 2EX2A 3WS0A 1PWGA 4LCLA 3SH8A 4MBFA 4ZJ1A 3TG9A 1K55C 2XF3A 3Q81A 5CGSA 3HLGA 2EX6A 3C4OA 4E6XA 3NC8A 2B5RA 4ZDXA 5FAPA 3D4FA 4OKPA 1EWZA 5CEDA 5DVAA 3Q7VA 4DDYA 3IH8A 1MWTA 1XA1A 3BLSA 2WYXA 3NDEA 4WZ5A 3FKWA 4PM5A 1BLHA 5HW3A 5GLAA 2JC7A 3V3RA 4BD1A 3N8RA 4JF5A 1O7EA 3SS5A 1YLPA 2QZ6A 2G2WA 2R9XA 5DTKA 3ZG0A 4LV2A 1YMXA 4OOYA 3WS4A 1JTGA 1XA7A 5CHJA 4ZJ2A 4PM9A 1PZPA 4S2LA 1ESUA 1S0WA 3SH7A 4DRTA 2XGNA 3LY4A 4B4XA 2WZZA 4P0MA 4WYYA 3UDXA 1OMEA 1E25A 5E43A 1ERMA 1K25A 1LI9A 3BECA 3MKFA 3UNWA 4Q8IA 1MWRA 3RXWA 1FR6A 2P9VA 5KSHA 3GRJA 2Y2LA 2X02A 4LV1A 5E2HA 5AQ7A 3VOZA 2XDMA 2Z2MB 1BT5A 2WADA 3Q7VB 5D3OA 1HZOA 2EXAA 3WRTA 5KSCA 4OQ0A 5FQMA 3BEBA 1BULA 3P09A 3HUNA 1KGEA 3OZHA 3PBNA 2QMIA 3HREA 3ZGAB 4PM7A 4BENA 1L0GA 4B4ZA 4OQGA 1CEFA 1BUEA 4WBGA 1KGGA 1XP4A 3AGDA 3EQUA 4JF4A 4C75A 2IWCA 2J8YA 2HPBA 5M1AA 3V3SA 2UWXA 4BQMA 3VSKA 3VMAA 4GD8A 4KZBA 4K91A 2V20A 3FV7A 1XPBA 4HESA 4KZ9A 1FR1A 2OLVA 4WELA 3G2YA 3UE1A 4MNRA 2Y2OA 2CC1A 3OPHA 4E3KA 4E3OA 4F94A 5FDHA 5FI2A 3VFFA 4KZ4A 3GSGA 2P9VB 1NZUA 2RL3A 3ZNTA 2XH9A 1KE0A 3IH9A 3ITAA 4E3IA 3IF6B 5FQKA 4N1HA 2WKEA 2HP9A 2XR0A 4X68A 1N4OA 4FH4A 5FQJA 5TR7A 1IYQA 2ZQCA 2Y2GA 3M2JA 4JBFA 3ZVWA 3RJUA 5U47A 1YLTA 4EBPA 2JBFA 2FFYA 1RP5A 4KG2A 1L0DA 5E2EA 5EOEA 4DDSA 3ISGA 5TFQA 4YINA 3UE3A 4EV4A 4QHCA 1NYYA 2J7VA 5CGWA 3VP0A 3IF5A 4K0XA 2V2FF 3C7VA 4PMAA 4EUZA 1G6AA 4UHUA 3VP2A 3HLBA 1FSWA 4KZ3A 2XD1A 2HDRA 5CGXA 4PM8A 4HEFA 1E4DA 2H0TA 3GR2A 4DE1A 4P87A 1LL9A 2XD5A 1I5QA 1QMEA 1J9MA 1SKFA 1CI8A 4BL2A 1RGYA 4JXWA 4XXRA 3ZVTA 1NY0A 4GB7A 1WYCA 5EVIA 4WEKA 4XUXA 3LY3A 1MPLA 3O3VA 1XXMA 5DF9A 1TEMA 2XEPA 1ES4A 3GVBA 5DTSA 2PU4A 3C7UA 2Y2QA 3EQVA 3HUMA 1HD8A 4KQQA 4GDNA 5FQQA 5DF7A 2WAEA 1ES5A 3E2KA 5FI6A 4E3JA 1K4FA 4OOMA 1YLWA 3IXDA 1KDWA 3PTEA 1NRFA 4KZ6A 1LL5A 4LCMA 5E2FA 5FAQA 1IYOA 1ZG6A 1PYYA 4WZ5C 2IWDA 3W4OA 4OPRA 3N8SA 4WMCA 3SS4A 1L0EA 3A3DA 5F1GA 2XFTA 4GD6A 4ZTKA 2WKHA 3MXSA 3NBLA 2Y2MA 1W8YA 1BLSA 3IHBA 4IEDA 4OQIA 4GN2A 3UPNA 3W4PA 4LV0A 5GHYA 2VGKA 4C6YA 2BLSA 3G35A 3M6BA 2Y2IA 5KMWA 5EVIB 1ONGA 4DXBA 3UPOA 5HL1A 3Q82A 4R4RA 2WGIA 2WGWA 2ZM8A 3VP1A 3ZFZA 1MWUA 2HDSA 4KENB 3HLWA 1L0FA 1N9BA 3CMZA 3LEZA 3C5AA 4WMCD 5CECA 3IF6C 3HLCA 4QY5A 3PBSA 1PW8A 2EX9A 3MZDA 3UDIA 4IBRA 1FCNA 1IELA 2ZC5B 4KG5A 2C5WB 5HAQA 2ZC6B 3DWKA 2ZC7A 1ERQA 4HBTA 1ONHA 5FSRA 3Q1FA 2DCFA 5HAIA 4EWFA 3I7JA 5JYOA 3IF6A 5M18A 1FOFA 1Z6FA 2ZM2A 4FH2A 1PIOA 3W8KA 4S2NC 1ESIA 1JWPA 4X55A 1PZOA 4FCFA 1IEMA 1Y54A 3S22A 3UE0A 3WRZA 2Y55A 1W79A 4YFMA 2ZD8A 2PBYA 3IXHA 4DE3A 4EQIA 4QJGA 2WGWB 5GLCA 1RGZA 2EFUA 1HTZA 1ES2A 2X01A 1YQSA 1H8ZA 2R9WA 3FZCA 4LENA 5GHZA 1FCMA 2ZQ7A 1YLJA 1PWDA 4S2NA 1LI0A 4WEJA 3VFHA 3CG5A 3PBOA 1YLYA 4JXGA 3BLMA 3UPPA 3HLEA 4GKUA 1KGFA 2ZQ9A 4BJPA 1SCWA 3CJMA 1RCJA 2Z2LB 3A3FA 3O87A 5FQ9A 3RXXA 2ZQ8A 4BD0A 3IWIA 5HAPA 3BM6A 1JWVA 4CPKA 4ZAMA 1EI5A 3OC2A 4S2OA 2H0YA 3WS2A 4CJNA 5CTMA 3MZFA 1PWCA 4X6TA 3N6IA 4IBXA 5AQAA 5HX9A 3ITBA 4R4SA 3G2ZA 4BL3A 3AGFA 1KDSA 3BFFA 4IVKA 5AQ9A 1MY8A 1SDEA 3LO7A 3V39A 3HLDA 5GHXA 4ZJ3A 4ID4A 3V50A 2HP5A 4RA7A 3MXRA 1SHVA 4L0LA 4ZBEA 1GCEA 4N9LA 3N8LA 3TSGA 1PI4A 2ZC4B 1U60A 5L2FA 3BYDA 2J9OA 3FYZA 1E3UA 3CZDA 5FAOA 2Q9NA 4S2PA 3SOIA 1L2SA 4HBUA 4E3LA 5EVIC 3BFGA 1LHYA 1GA0A 3IT9A 3IQAA 4R3JA 3ZDJA 3O86A 4OLGA 3WWXA 4KZAA 1IYPA 5EE8A 3G31A 3G4PA 2Y2PA 4LV3A 2JCHA 4Y7PA 3FKVA 3IXBA 1EROA 3HLFA 3MBZA 1IKIA 5A93A 5A90A 4R1GA 3GV9A 1KE3A 5EECA 5EVLA 4IVIA 3IWOA 1K38A 2XFSA 2ZMAA 1K6SA 3VOYA 1TVFA 1VQQA 2BG1A 2E8IA 2WGVA 3BRMA 3AGEA 3O88A 4X53A 2WK0A 3QHYA 3MZEA 3V5MA 1XX2A 5GLDA 5CHUA 4S2IA 3BFDA 1IKGA 1ZC2A 3Q7ZA 2ZLYA 2DNSA 4FD8A 3PBQA 3UO9A 4P85A 1FSYA 2J9PA 1MKIA 1WYBA 1AXBA 2PU2A 1DY6A 3MKEA 2XQZA 1M6KA 2QPNA 3HVFA 3IHAA 4OH0A 5EVID 5G18A 1BSGA 4U0TA 2Y2NA 2I72A 4QB8A 4N1XA 4Y0OA 1O07A 1JWZA 1NYMA 3OCLA 3G30A 4KZ5A 4R3BA 4RYEA 4BLMA 1DJCA 4OONA 1M40A 5EPHA 5FI7A 3NCKA 1MBLA 2HP6A 2IWBA 4MEZA 4GDBA 3QNBA 3ZHHA 3TOIA 1YT4A 5GLBA 1ALQA 2H10A 2HDUA 2Y59A 1BZAA 1GHPA 4MBHA 5AQBA 2ZQDA 3A3IA 4KZ7A 5EUAA 1MWSA 1K4EA 2Q9MA 2HDQA 4S2JA 1CK3A 5EOOA 5BOHA 5CERA 1K55A 2ZM0A 3OPRA 2C6WB 5CXWA 1LLBA 2A3UA 3PAEA 1W8QA 5HARA 1BLCA 1GHMA 4OVDA 3G34A 1ZKJA 2X71A 4QY6A 3PBTA 1G68A 5HFOA 1ES3A 1KE4A 3PAGA 1K57C 5FASA 5M19A 1ZG4A 4DE2A 3DTMA 4S2MA 4QD4A 5CHMA 3JYIA 4B88A 2ZQAA 4DKIA 4EBNA 5F83A 3IXGA 4M3KA 4FSFA 3S1YA 2FFFB 2ZJ9A 4OPQA 4KG6A 2RCXA 3PBRA 4RVAA 3IWQA 1K57A 4RX2A 1Q2QA 3GMWA 4E3NA 3NIAA 1JTDA 4X56A 1Q2PA 1BLPA 3HUOA 1TDGA 4MLLA 2WUQA 1WE4A 3MFDA 1FCOA 1C3BA 1W5DA 3SS3A 3UN7A 3M2KA 5TGFA 2ZC3B 4R23A 3HBRA 4A5RA 4UA9A 1I2SA 2DRWA 3C4PA 2OLUA 4P6BA 3OPLA 3QNCA 2GDNA 1PI5A 1GHIA 2V1ZA 2WAFA 1YM1A 2H5SA 5F82A 4X69A 4UA7A 4JKTA 1CI9A 5CEBA 4JF6A 1NZOA 3ZG7B 4DF6A 4OPYA 4NETA 4JXSA 4KQRA 1YMSA 3Q07A 4Y0TA 3M6HA 3A3JA 4Z9QA 3NY4A 1YLZA 3GQZA 4NK3A 4N92A 4RX3A 3UDFA 3OCNA 4E3MA 3G32A 4PPRA 1CEGA 1NJ4A 1BTLA 3ZCZA 1FQGA 4UA6A 3S4XA 4GNUA 3OPPA 4XUZA 2Y2KA 3ZG9B 2EX8A 1DJBA 5FQIA 4DXCA 2VGJA 4WZ4A 1MXOA 1KVLA 4OOLA 4N9KA 5CRFA 3VP4A 2OSUA 4OPZA 1PW1A 2Y2JA 3DWZA 1K56A 3DW0A 4JXVA 5KZHA 1DJAA 4K0WA 4UAAA 2XK1A 3N4IA 1QMFA 4H8RA 5A91A 4JPMA 4JLFA 4S2KA 5J8XA 3ZG8B 1HVBA 4KQOA 2Y4AA 3E2LA 3N7WA 3NI9A 4DE0A 5IHVA 1XGIA 4Y0UA 5DF8A 3UY6A 1S6RA 2XLNA 1E3UD 2WKIA 3WS5A 2Y2HA 2Y91A 1SDNA 4EBLA 3VSLA 3ZG5A 3SH9A 5JYPA 1H5XA 4R0QA 5E2GA 4E6WA 4U0XA 1JVJA 1I2WA 4GZBA 4C3QA 1H8YA 1VM1A 4OQHA 4QU3A 2WZXA 3BFCA 4WM9A 1K56D 4OP5A 5DTTA 1TDLA 4MBKA 4KZ8A 5FA7A 2P74A 1NXYA 3NDGA 3BFEA 5GL9A 1K6RA
chains in the Genus database with same CATH superfamily
2EFXA 5DNNA 5CHLB 5B2IC 1K54C 2EXBA 1R4VA 3VP3A 4OLDA 4GOGA 4OP8A 4U3TA 5L10A 3W96A 3A3EA 3B3XA 4D2OA 4G91B 1P3ID 5BS7A 1KOUA 1KX4C 3HSHA 1H8MA 2EX2A 3H82A 3NQUB 3WD3A 4PAUA 3SH8A 3MSHA 4XT2A 1K55C 5GSUA 3C4OA 3VOLA 4ZDXA 3NOTC 2EA9A 2VEAA 5DVAA 3L26A 3EPKA 3W99D 3IH8A 1MWTA 3KXBD 1XA1A 3BLSA 3KS4A 3NDEA 5B32G 1BLHA 1G5UA 5HW3A 3IS2A 2JC7A 4YNRA 1O7EA 3C2WA 5B32B 2FH5A 3NQJA 3ZG0A 4LV2A 2HIOD 4OOYA 5IS1A 1EQZA 5AV5A 3LICA 1E6NA 1XA7A 2YFVB 1STZA 5HWWA 4S2LA 3LY4A 1HTAA 1IOUA 3UDXA 2O9CA 5E43A 3BECA 3MKFA 4X23D 1P3OC 4G3VA 4NE3A 5L07A 1GOIA 2W3DA 4CAYA 2P9VA 1GPFA 4LV1A 2X02A 5AQ7A 5CPJA 2Z2MB 4GHIB 4OQ0A 3BEBA 4HJ6A 4XUJC 2L5AA 4OJ6A 4Y13A 1F98A 2Y8HA 5AV8C 5AY8B 1P3LA 4CLCD 4WBGA 5B0ZB 5B2JA 3R4KA 1M19C 4C75A 2HPBA 3LELB 3V3SA 3H0RC 3KO6A 2J3TC 4KZBA 5AVEA 5DFXA 4H9RA 4WNNA 3KSFA 5DKKA 2OLVA 3C1CD 4JJNA 4F94A 2VKSA 4KUDD 4KGCC 3GSGA 3WAAC 3C1BB 3ICYA 3AZLC 1CJFA 4Z66B 3WD4A 2XR0A 4X68A 4HOIA 1IYQA 4JGQA 1OT9A 4JBFA 4L9EA 5U47A 2Y79A 1E6ZA 2FFYA 1RP5A 2K31A 1L0DA 5E2EA 5EOEA 4EV4A 4QHCA 3VP0A 3VH6W 3TW8A 3MGRD 4WF0A 1G6AA 1AOIC 4YM6D 2PBDP 4TX8A 4PM8A 1E4DA 4DE1A 4HP4A 4XZQC 1J9MA 4BL2A 3AZKA 4XXRA 3W96C 3MGPD 4GB7A 5EVIA 2PHYA 5BS7C 4WEKA 3LY3A 4M6BA 1E15A 1YU0A 1XXMA 2JKFA 1YSQA 3LZ1C 2JKGA 3GVBA 5DTSA 2F2AC 3WTPA 3EQVA 1W63Q 1HD8A 4KQQA 5C3IC 4GDNA 5DF7A 5BNXA 4E3JA 5FI6A 2RIQA 1K4FA 1YLWA 3W97C 3QP4A 2M7VA 5FAQA 1IFQA 2V8CA 5HSQA 3W4OA 4WMCA 4BMWA 2INWA 2V8FA 3PYPA 5B32D 3MXSA 1W8YA 3UPNA 3VE4A 4GN2A 2D01A 5F5YA 2V0UA 4LV0A 4J8VC 2VGKA 2BLSA 5KMWA 2RVQD 3B33A 2JN7A 3Q82A 2WGWA 3AZHA 2IOUA 5FEFA 3B0CW 3N3FA 1P3GC 1MWUA 2HDSA 4HH3A 2ZMVA 1N9BA 5G4ZA 5GT0C 5CPJC 2EX9A 2I9VA 3C30A 2ZC5B 2CV5A 4KG5A 4P6ZS 1NWZA 4HBTA 3AZEC 1ONHA 1Z09A 2DCFA 3I7JA 1P3LC 1FOFA 4BBTA 5AY8D 1N1JB 3O62A 3W8KA 5B0ZD 2YKFA 1Y54A 3LELD 4EQIA 2PT7A 3IXHA 1N9OA 4QJGA 1E8BA 3FC7A 4IBJA 1ES2A 3KUYB 2R9WA 1LI0A 3T1XA 2O99A 3PBOA 3AZMC 1P3BA 3WTPE 3HLEA 4EXOA 3C1BD 4BJPA 4Z66D 2R78A 5FQ9A 4OJLA 4I3IA 1VEUA 3L27A 1P3KA 1TD5A 1EI5A 5B40A 2H0YA 4Q0IA 3EOIA 1LSWA 4LRZE 4X6TA 3ZQ5A 5HX9A 2GNXA 3ITBA 4R4SA 5IU1A 3G2ZA 3BFFA 2M7UA 3LO7A 4ZJ3A 5GHXA 4ID4A 2ZY3A 4L0LA 4WLAA 4ZBEA 3N8LA 3B6GC 1PI4A 3AZGC 3BYDA 4ETZA 3T4QA 5FAOA 4S2PA 5B1MB 4LD9A 4R8PA 2KOIA 4ARZB 2DF4C 5JA4A 5EVIC 3BFGA 4AFIA 4QLCB 1GA0A 3B6FB 3H7WB 4R3JA 5I5LA 1GSVA 3ZDJA 2ZL1B 5EE8A 1IYPA 3G31A 4LV3A 4HQAA 4DRBA 4IJEA 4EU0A 1EROA 3LR5A 2WKPA 1ULYA 1KE3A 3EGDC 5EVLA 4B93A 2CWEA 2FZ0A 3IWOA 4NXFA 3MVDB 2ZMAA 1TVFA 2E8IA 2BG1A 3K2NA 5IT5A 1XJ4A 2WK0A 3QHYA 3MZEA 5GLDA 3W99C 3B42A 1IKGA 3REJB 3REKA 3Q7ZA 1OTEA 4ETXA 1OPXA 1FSYA 2J9PA 2O9BA 3MKEA 2PU2A 3IP4C 4OH0A 2Y2NA 4II7A 2GZAA 1ID3B 3X1SB 1W2EA 2L1MA 3X1UB 3VH6T 1DJCA 4H9PA 5F6AA 5EPHA 1P3AB 1MBLA 4KHAB 4L9FA 3L7HA 4X23C 4MEZA 2IWBA 1KX5B 3TOIA 5GLBA 4GCZA 2Y59A 3MF0A 3MGSB 1YU2A 1P3FB 3AZIA 4Z2KA 5BOHA 3AV1B 4YS3A 4EQ1A 1W1PA 5DNNB 4CLCC 3G34A 4MMNA 3UTAB 1G68A 1KE4A 3PAGA 4OJPA 4DE2A 1MZUA 3KUYD 2NQBA 4B88A 4NZ1A 1P3BC 2G5HC 4OPQA 3H82B 3C1CC 4RVAA 4XT2B 5GSUB 4KUDC 1K57A 2KX6A 1ED7A 3NIAA 3O5YA 5B40C 1BLPA 4H9OA 4CSRA 1TDGA 5AV6B 1BH8A 1WE4A 1FCOA 1F9IA 3UN7A 3C38A 3M2KA 3B0CT 5TGFA 2ZC3B 4JGRA 3HBRA 4R23A 4EUVA 5CPKB 3OPLA 3QNCA 3IS2B 3F6TA 1GHIA 2WAFA 4YOFA 3CPTB 4I38A 4X69A 1CI9A 4OPYA 4JXSA 3MGRC 5B31G 4YM6C 5B1MD 5B31B 4WV4B 4NK3A 4RX3A 1UWPX 4QLCD 4E3MA 3B6FD 3G32A 1NJ4A 1FQGA 3S4XA 2EWWA 2GX5A 5FUGA 3NOPC 2Y2KA 3ZG9B 4E45A 2PR5A 1DJBA 3BQ8A 2HJ9C 2QKPA 5J7EA 4NY2A 1ZHHB 2K7SA 1E6PA 3KYZA 5DJTA 3DWZA 3OOVA 3DW0A 3MVDD 4X1MA 1DJAA 2ZY2A 3X1TB 2XK1A 4H8RA 5A91A 1P3MA 3WA9A 2Y4AA 5TBMB 3EPLA 2F8NA 4NYYA 2ACGA 4HJ4A 5DF8A 3REJD 3WKJA 2PYOA 5G4YA 5JYPA 3SH9A 4FTXA 3X1VA 5BPVA 4UUZA 2JKRI 1M1AB 4GZBA 4JJNB 3L2AA 1VM1A 1F2KA 1ID3D 3X1SD 4KZ8A 1MKMA 3UT9A 5JRGA 3NDGA 4LFUA 3X1UD 3LIEA 2OV5A 1J3WA 3HL9A 1P3AD 3GTCA 5AV9B 4O01A 3TRCA 3WD0A 1XGJA 2LB5A 1KX5D 3LCEA 3E4PA 1S32B 1W7FA 1GA9A 2BYKB 1H8PA 3MGSD 2A49A 1K54A 1P3FD 1PWGA 2BTFP 4ZUXB 1TZYA 2XF3A 5CGSA 3AV1D 2EX6A 2V5OA 2B5RA 3L9KA 5DNND 1KX4A 5AY8C 5CEDA 3UTAD 4DDYA 2YFWA 5B0ZC 3S7PA 3LELC 4WZ5A 4PM5A 4J8UA 3V3RA 4UQIM 2QZ6A 1KS0A 2G2WA 5BNVA 3KYEA 3P5JB 3UTBC 4J8WB 3HCYA 5F69A 5GSUD 2PDRA 1DP9A 5CHJA 1DRMA 4PM9A 2OWJA 1ESUA 1S0WA 3SH7A 3E4QA 5AV6D 4B4XA 2WZZA 3AV2B 1YU4A 4P0MA 4WYYA 2W1RA 5B0YB 3B0DC 4G92B 4UEYA 3UNWA 3QP5A 4EETB 4Q8IA 2JHEA 5AVCB 1FR6A 3IBRA 5CPKD 3GRJA 1VETA 2Y2LA 3T50A 3VOZA 2XDMA 3Q7VB 1ZLAA 3CAXA 4ESPA 3QP2A 1P3OA 2JKRM 3P09A 4MB4A 3H0LC 5B31D 2QMIA 1L0GA 4B4ZA 4OQGA 5G49B 4WU9B 2VGLM 5HPIA 4JF4A 3AZFB 1XP4A 3EQUA 2V1BA 2D49A 2IWCA 5M1AA 3VMAA 4GD8A 4XUJA 4H9QA 3D72A 4K91A 5AV8A 3AZNA 4DRAA 3LJAB 3OPHA 4E3OA 5FI2A 1M19A 3VH6A 3BJNA 3X1TD 1V9ZA 3ITAA 4I3AA 4N1HA 4Y3IA 3LZ0B 3AL0C 2B18A 2HP9A 2O0YA 4R6LA 3O62B 1N4OA 4FH4A 4DQYB 1P34B 3WKJC 3M2JA 5CP6B 4KGCA 1YLTA 3WAAA 1U35B 3AZLA 4DDSA 1M1AD 2G5IC 4JJND 5L09A 2V2FF 5JRGC 3UT9C 4GH9A 1ACFA 1N9LA 3C7VA 1CQAA 4PMAA 4UHUA 5DNMB 3VP2A 3AYWB 3AN2B 5HDSA 1TAFB 2OAP1 4HEFA 3GR2A 1VEUB 4P87A 5AV9D 1CI8A 1P3KB 3IX4A 1XJ3A 5HDCA 3ZVTA 3MNNA 1AOIA 1S32D 3MMHA 1YKDA 1TEMA 2XEPA 2AROA 1L3LA 2Y2QA 4XZQA 1TZYC 3HUMA 3MGPB 4ZUXD 4GJ4A 1KX3A 3S7NA 2QJ5A 1A0KA 2HZ5A 4Q0HA 4WU8B 3LZ1A 1LL5A 5B1LB 1J7MA 5E2FA 4OJOA 1PRQA 3TU4A 4WZ5C 4J8UC 1LSVA 4OPRA 1O6IA 1L0EA 3EEAA 2XFTA 3ZG8B 3W97A 3NBLA 2Y2MA 4OQIA 3LR3A 3KUYC 1XJ2A 3G35A 4UQIS 4J8WD 3R45B 3OBFA 3UPOA 3F1NB 5B24B 2CMNA 2WGIA 4IUHA 3G6OA 3IX8A 3AV2D 1DP6A 3ZFZA 5B0YD 1HQ3B 2W3GA 4J8VA 1L0FA 5HPFA 5AVCD 4WMCD 3IF6C 4WL9A 5HZHA 2HV1A 3PBSA 1ZLAC 1PW8A 4H9NA 1FCNA 1P3GA 3R7WB 4OUIA 4GHAA 5B33A 2PRFA 2ZC6B 1DP8A 2ZC7A 3BWLA 1OTIA 5EM1A 3RFBA 4M4XA 4Z2MH 5GT0A 3RELB 4P6ZM 4ZBJB 1Z6FA 4MN6A 4DMZA 4FH2A 4WU9D 1PIOA 3T4SA 3AZFD 1S4SA 1PZOA 4FCFA 1IEMA 3S22A 3UE0A 3WRZA 2Y55A 1W79A 3M7PA 2VGLS 3AZNC 3AZEA 5GLCA 1HTZA 3LJAD 3FZCA 1KU5A 3MGQA 2ZQ7A 4WEJA 4BBUA 3B47A 1YLYA 4F3LB 5EFWA 2ZQ9A 1LL8A 1SCWA 3LZ0D 3MVDC 3A3FA 5HAPA 3O62D 1OGGA 4CPKA 3L25A 1P34D 5MC7A 4CJNA 5CP6D 3AZMA 1PWCA 2QWSA 3N6IA 5AQAA 2VV6A 1U35D 3WX7A 2FJ7B 1KDSA 1MY8A 1SDEA 3CHWP 5FDSA 4RA7A 2D02A 5DNMD 4Q0JA 4O0PA 1GCEA 4UPKA 2UV0E 3AYWD 3AN2D 1U60A 3EEHA 1P3KD 3MNNC 1L2SA 4HBUA 1YAXA 2NUPC 1LHYA 5DFYA 3IQAA 3NJAA 2AROC 3B6GA 3AZGA 5CPIC 3BW6A 3G4PA 5AJGA 2Y2PA 5AVBA 3V9RB 1BH9B 3REIB 1KX3C 3IXBA 3HJKA 5A93A 5A90A 3MGSC 1P3FC 3WD2A 4LLOB 4IVIA 5A8BA 4WU8D 3TU4C 5B1LD 4EESA 4EO5B 4DJ3A 4R8PD 4X53A 1P3IA 5BO0B 2W3HA 3WD1A 3UTAC 1OGBA 5CHUA 3MQQA 1H3OA 3BFDA 1ZC2A 2DNSA 4FD8A 3UO9A 1AXBA 1M6KA 5DJUA 4EW7A 5B24D 1TS8A 3W99A 3G30A 3KXBA 4R3BA 4RYEA 1HQ3D 4OONA 4AWLB 3W98B 2VX8A 3NCKA 2HIOA 2HP6A 3A6NB 3AFAB 4GDBA 1YT4A 5AVFA 5CPKC 5B33C 3X1VB 2VV7A 2ZQDA 4KZ7A 1F66B 5HL6A 1K4EA 2Q9MA 3RELD 4NXEA 5EOOA 4X23A 3OPRA 2A3UA 5B31C 5HARA 3KWQB 4QY6A 2L4RA 3PBTA 1ES3A 1X0OA 1CF0A 2W3EA 1K0KA 2BYMA 5J3WA 1FIKA 3MGQC 3REHC 1S66L 5GT3B 5E5AB 4FSFA 1T19A 1D7EA 5B2IB 4KG6A 4CLCA 3IWQA 4LRXC 1Q2QA 5KDMB 4NEED 3X1TC 3F1PA 4R70A 4J8XB 1KX4B 4LGWA 1LSXA 2ZMFA 1SKOA 3C1CA 3SS3A 2YFWB 2JKTI 4G3WA 4A5RA 4KUDA 3C4PA 4P6BA 3AZJB 2FJ7D 1YM1A 2PD7A 1W1VA 2H5SA 4IBEA 4JKTA 1M18C 3UB7A 4JF6A 4DF6A 1G6OA 2M1CA 4NXBA 3Q07A 5F99C 4Y0TA 3M6HA 4H9SA 4HGAC 2OOLA 3E0YA 3NY4A 3GQZA 3OCNA 4QPRA 5AV9C 3E98A 1P3PB 1CEGA 3FDDA 2V0WA 5AVBC 3MGRA 4YM6A 5GXQB 1VETB 3REID 4Z5TB 4DXCA 2W1TA 3JPUA 3QP8A 1UR8A 1KVLA 5CRFA 1P9WA 4OPZA 5KZHA 1K56A 4MCWA 3GDIA 3N4IA 1P3IC 4JPMA 2PYPA 5J8XA 4IJFA 3IBJA 3E2LA 4PKYG 4HHDA 4Y17A 3T1QB 4DE0A 1XGIA 4H6JB 3UY6A 3NQUA 3CWFA 1E3UD 2F8NH 2WKIA 3A0VA 5HWTA 2Y2HA 4XUJB 4NZ3A 1H5XA 4GS9B 2Z6CA 1I2WA 1H8YA 2WZXA 3KXBC 3BFCA 5DTTA 1TDLA 3RTYA 2P74A 1NXYA 2KLIA 1F5MA 3ZNYA 2JE5A 3W98D 4IBKA 2G2UA 2HIOC 5B0YC 1XKZA 1Q9CA 3A6ND 3AFAD 1VHMA 5AVCC 2YFVA 3X1VD 4PM6A 5CTNA 2W27A 2JKTM 5FATA 4BBVA 2A24B 2NZDB 3WS0A 1F66D 3TG9A 3Q81A 3HLGA 4E6XA 3NC8A 3ZYTA 4OKPA 3KWQD 1EWZA 2PD8A 4WU9C 2WYXA 4GHIA 1W63M 1AOIB 5GLAA 5GT3D 1YLPA 5E5AD 2R9XA 1AIWA 5B2ID 3LJAC 5AY8A 1YMXA 3KSGA 5B0ZA 3WS4A 3KSYA 3W96B 2W3FA 3LELA 3KSHA 3LIDA 1PZPA 4J8XD 1KX4D 2XGNA 3T4OA 1ERMA 1K25A 1LI9A 3UTBA 1P34C 1F1EA 1MWRA 2DQNC 5CP6C 3AZJD 3LI9A 3EGXC 1U35C 2P08A 4Z66A 5HDDA 1YUEA 1BT5A 1HZOA 2OWHA 2V1AA 4MDZA 5FQMA 2VK3A 4H9SC 5DNMC 2H28A 3HUNA 3NQJB 3OZHA 3MR0A 3PBNA 3ZGAB 3HREA 4BENA 1CEFA 1BUEA 5BT1D 3AGDA 2IO5C 1EQZB 3RH8B 5AV5B 4L9GA 1P3PD 2KDKA 4GLQA 5TJJA 2UWXA 4BQMA 5L8MA 5GXQD 3FV7A 4HNBA 2MJ6A 4KZ9A 4WELA 4Z5TD 3G2YA 3UE1A 2Y2OA 3VFFA 3MGPC 4KZ4A 4CAYB 2HUEB 2P9VB 2RL3A 1QO6A 3IH9A 4G91C 1N9NA 5GT0B 5CPJB 5FQKA 3SZTA 1E88A 4WU8C 2DMWA 3MXQA 3ZVWA 2B95A 4XUJD 3AZEB 1NLZA 3U2AA 2JBFA 3BY8A 1D06A 3D9YA 1P3LB 5FL3A 3IX3A 3S7QA 4KG2A 3ISGA 5B2JB 4HMEA 3UE3A 2J7VA 3IF5A 4EUZA 3HLBA 4H9RB 2E8JA 4WNNB 2HDRA 2J3TD 5B32C 5CGXA 5B24C 3A0RA 3DBAA 1LL9A 1I5QA 4MN7A 1PDCA 3DTIA 1WYCA 2RVQC 1EW0A 3O3VA 3ULFA 5DF9A 4NYUA 2NZDD 2PU4A 2VLGA 3P01A 2Z6DA 5FQQA 4Z2HA 2WAEA 1ES5A 4NE6A 4OOMA 3RELC 1P0ZA 4HIAA 3PTEA 4KZ6A 1S4RA 4LCMA 4Y5FA 3SS4A 1AOID 3B6GB 2WKHA 3MQ0A 1BLSA 4Y15A 3W4PA 5GHYA 3AZKB 4C6YA 2NUTC 3M6BA 3V67A 5EVIB 1ONGA 3W96D 4DXBA 2W8SA 5HL1A 4R4RA 3VP1A 4Z2IA 3WTPB 3KUYA 1B67A 3CMZA 5BNXB 3C5AA 3EWKA 3C1BC 2RTSA 4G3KA 4IJGA 4Z66C 2LY8A 4QY5A 4JGPA 1H3OB 3LIBA 4KUKA 2FJ7C 1OTAA 3T1RA 3BY9A 1JFIA 3DWKA 1ERQA 3Q1FA 5JYOA 2XRNA 3IF6A 1NLYA 3FPWA 4JGOA 2P7JA 4S2NC 1ESIA 1EQZD 1JWPA 5AV5D 1ODVA 2PBYA 2WGWB 3AZHB 1RGZA 2EFUA 2AVXA 3VE3A 1H8ZA 3VFHA 1PWDA 3UE6A 5B1MA 3CG5A 4ARZA 3UPPA 3SW1A 4QLCA 1XFNA 5GT0D 3P7NA 3B6FA 5CPJD 2Z2LB 3FKEA 3H7WA 3RXXA 2ZL1A 4I5SA 4BD0A 2CV5B 1S1YA 4Z2MG 4EO5C 4ZAMA 3DTKA 3OC2A 3WS2A 3T1SA 3AZED 4DJ2A 1P3LD 4BL3A 4WJ3C 3AGFA 3MVDA 5AQ9A 5B2JD 4IVKA 4NKPA 3LIFA 4IBBA 3K3CA 3UB9A 3KX0X 1OT6A 4NG2A 3CZDA 3REJA 3SOIA 1OTDA 1P3BB 4E3LA 3KFUG 4K08A 4HJ3A 3LUQA 3W98C 1SKOB 3TJZC 1ID3A 3A6NC 4OLGA 3X1SA 3WWXA 4KZAA 5CX7A 5B40B 3X1UA 2JCHA 1IKIA 4R1GA 3GV9A 4CQHA 1P3AA 1F66C 1PZRA 5EECA 2HGVA 2XFSA 5CPIA 1K6SA 1VQQA 2WGVA 3BRMA 1Z2CB 2L0WA 3AGEA 2J8PA 3KWQC 3MGSA 1P3FA 1XX2A 3B6GD 4LD9B 4R8PB 3AZKD 2PAVP 4P85A 5JA4B 1MKIA 1WYBA 5GT3C 2XQZA 4BWIA 5E5AC 5EVID 2Q0OA 1BSGA 4U0TA 2I72A 2W1TB 4Y0OA 5J4EA 1O07A 3UTAA 3F1OA 1JWZA 3LIAA 3T4JA 3WTPD 1SZVA 3KS8A 4BLMA 1CK7A 4J8XC 2B02A 4MN5A 5FI7A 1L6JA 2ZBBA 3FG8A 3QNBA 3ZHHA 3AZJC 2HDUA 4PHTA 1TS0A 3NOUC 1GHPA 5AQBA 3A3IA 1D1JA 5AV6A 1Y28A 5EUAA 4Z2GA 1OJ5A 1TS6A 1CK3A 3REKB 5CERA 4ZRRA 2ZM0A 4IBGA 5CPKA 1LLBA 2C6WB 5CXWA 3CPTA 1BLCA 1GHMA 3LGOA 2ZY5A 5HFOA 3AZHD 5BT1C 5M19A 1P3PC 4Y2FA 4DKIA 4H9PB 3H0MC 5B1MC 3VH5W 2ZQAA 5F83A 2WKQA 5GXQC 3S1YA 5B31A 4QLCC 2FFFB 4Z5TC 3U4LP 3B6FC 3PBRA 4HI4A 3NULA 4X56A 2CV5D 3REHA 1EAKA 2P04A 5KIZA 1Q2PA 3AZIB 2WUQA 3E4OA 2J3WA 4UA9A 4YS3B 2DRWA 3C8CA 2OLUA 2V1ZA 3X1TA 4UA7A 3K3DA 3ZG7B 3LR0A 4NETA 4KQRA 2NQBB 3REJC 1YMSA 5TBMA 1P3BD 4Z9QA 3UDFA 2YKHA 1M1AA 1M18A 1ID3C 3UTBB 3X1SC 2QHKA 3ZCZA 3DTEA 3OPPA 4HY8A 4XUZA 3X1UC 4H9OB 1MC0A 5F99A 4CSRB 4E44A 5B40D 1BH8B 1P3AC 2VGJA 2NZDC 4OOLA 3B0DB 5AV9A 2OSUA 4JXVA 1KX5C 4K0WA 1JNUA 1GSWA 3JVVA 4S2KA 1S32A 4KQOA 2BYKA 4IBDA 3UB6A 1W1TA 4Y0UA 1S6RA 2VZWA 3AV1C 4ZUXA 4LD9D 2Y91A 3ZG5A 5DNNC 5E2GA 4E6WA 4U0XA 1JVJA 2IA2A 4C3QA 5FEGA 2PR6A 1YU3A 4WM9A 1K56D 4OP5A 1UWNX 5HWVA 5FUGB 2EWVA 5FA7A 1JTDA 4HESA 5GL9A 1K6RA 3LEQA 1IYSA 3FWLA 4O7DA 1GXDA 1KVMA 2PYRA 3P98A 5GSUC 5F1FA 4J8WA 5A92A 5I94A 4KQDA 3WS1A 1P3MB 3WA9B 2VQRA 3W4QA 5AV6C 2F8NG 3A0SA 3AV2A 2F8NB 4WN5A 5B0YA 1XJ6A 2G7UA 4LCLA 4MBFA 4ZJ1A 2WKRA 3REKD 3WKJB 2PYOB 5AVCA 4UUZB 5FAPA 3D4FA 1H0MA 1T1AA 2QYBA 4O8GA 3Q7VA 1EQZC 5AV5C 5JRGB 3UT9B 3FKWA 4BD1A 3N8RA 4JF5A 3SS5A 3S7OA 1P97A 5DTKA 5G49A 4WU9A 4IBCA 3AZFA 2J80A 1JTGA 2HUEC 4MB5A 4ZJ2A 1OTBA 2QJ7A 4DRTA 3TE8A 3AZID 2HF6A 3LJAA 1E25A 1OMEA 1TZYB 3CUEA 4IHQA 3RXWA 4YS3D 5KSHA 3D3OA 2K2NA 1UR9A 5E2HA 3LZ0A 3W2ZA 2WADA 5B2JC 5D3OA 1AWIA 4DN0A 2EXAA 3WRTA 5KSCA 4J8UB 1P34A 2NQBD 1BULA 5CP6A 3EPHA 1KGEA 5HD5A 5BNVB 4Z2LA 1U35A 1M1AC 4PM7A 4JJNC 1KGGA 3UTBD 2J8YA 3CLOA 1H0GA 4IBIA 3VSKA 1YU1A 5DNMA 2V20A 1XPBA 3AYWA 3AN2A 1FR1A 1TAFA 4MNRA 4E3KA 2CC1A 5FDHA 1W1YA 4WUJA 1JFIB 4IBFA 3VH5T 1NZUA 3ZNTA 2XH9A 1KE0A 1S32C 4E3IA 3LFVA 3L29A 3IF6B 1UGUA 2WKEA 1ZLAB 5FQJA 3T4LA 5TR7A 2XA7M 2ZQCA 2JSSA 2Y2GA 1P3OB 1T3UA 4ZUXC 3MGPA 1YSPA 3RJUA 3QP6A 3MQLA 3PR6A 4GW9A 1OJGA 4EBPA 1FILA 5TFQA 4WU8A 4YINA 5B1LA 3AZKC 5K5BA 1NYYA 5CGWA 4NZ4A 4K0XA 4EERA 3LR4A 2HJEA 4H9QB 3BQAA 1FSWA 4KZ3A 2XD1A 5AV8B 3AZNB 2V9AA 5C5KA 2H0TA 1WWSA 2XD5A 3WTPC 1QMEA 1SKFA 2XROA 2GJ3A 1HLUP 1M19B 1A7WA 4J8WC 1RGYA 4CLCE 4JXWA 3R45A 4WZSB 1NY0A 4XUXA 1MPLA 1P3MD 3WA9D 4LG2A 3F1NA 5B32A 5B24A 1PNEA 3AV2C 1ES4A 3UMDA 4G92C 3C7UA 4HMDA 2F8ND 1T18A 3MJQA 1HQ3A 4KGCB 3WKJD 2PYOD 3FPVA 3WAAB 1B6WA 3E2KA 3AZLB 3IXDA 3B0BA 1KDWA 3PXPA 1NRFA 1IYOA 1ZG6A 1PYYA 3R7WA 2A2LA 1BYWA 2IWDA 5JRGD 3UT9D 4NZ5A 3N8SA 3A3DA 5F1GA 3AZHC 4GD6A 4ZTKA 3IHBA 3RELA 3EPJA 4IEDA 4B9OA 3AZFC 2VV8A 2Y2IA 3MNNB 2OAQ1 1E6RA 4YWZA 2F8NK 4EEUA 1ZTUA 3L28A 2ZM8A 2AROB 1H3QA 1YPRA 5CPIB 1TF1A 4XZQB 3KYQA 3CUEC 2CV5C 1TS7A 4KENB 3HLWA 1TZYD 3LEZA 1KX3B 5CECA 4KUOA 4F3LA 3HLCA 3LZ0C 3LZ1B 3MZDA 1NRJA 5EVEA 3UDIA 4IBRA 3O62C 3TU4B 1IELA 3JVUA 5C3IB 2C5WB 4J8UD 5HAQA 3C1BA 5FSRA 5HAIA 4EWFA 3W97B 3F1OB 5EM0A 5M18A 4LPZA 2ZM2A 2FJ7A 4X55A 4YFMA 4DE3A 2ZD8A 4IUKA 2ZM5A 3AYWC 3AN2C 3NECA 2X01A 4I39A 1YQSA 3MQOA 4LRYC 4J8VB 4LENA 5GHZA 1P3KC 1FCMA 1YLJA 3NHQA 4S2NA 4JXGA 3BLMA 3HJIA 4GKUA 1KGFA 2BASA 3CJMA 1RCJA 4H9NB 3O87A 1P3GB 1ZLAD 4GHLA 2ZQ8A 3IWIA 3BM6A 1JWVA 5B33B 4S2OA 1P3OD 3V9RA 1BH9A 3REIA 3MZFA 5CTMA 4EEPA 4IBXA 1P9RA 3A1IA 2XA7S 1V9YA 3LYXA 2O9AA 5B1LC 4LD9C 4R8PC 3V39A 3HLDA 3V50A 2HP5A 3MXRA 1SHVA 2VA0A 5BO0A 2ZY4A 5AV8D 3AZND 4N9LA 3TSGA 3GECA 2ZC4B 5L2FA 2J9OA 3FYZA 3MGQB 3REHB 1E3UA 2Q9NA 1M19D 4NXGA 3IT9A 3O86A 1BFMA 1HQ3C 3AZMB 4KGCD 3FKVA 4Y7PA 3MBZA 3HLFA 3W98A 3WAAD 3AZLD 4X1LA 4QNLA 4HMCA 3REKC 1K38A 1G28A 3A6NA 3AFAA 3OLOA 3T4KA 3VOYA 3O88A 3DAVA 1M18B 3V5MA 1F66A 5DKLA 4ZBJC 4S2IA 3CITA 1Y4OA 1CXWA 2ZLYA 3PBQA 5F99B 4HGAB 1DY6A 1T1BA 3MNND 2QPNA 3HVFA 3IHAA 5G18A 4QB8A 4N1XA 3KWQA 4E04A 1S67L 3AZGB 1NYMA 3OCLA 2AROD 4KZ5A 3VV4A 1N1JA 5CPID 5AVBB 4XZQD 4X25A 1GSXA 5GT3A 1M40A 1KX3D 5E5AA 3AZIC 5B2IA 2LB9A 3UMEA 3LZ1D 4YS3C 1ALQA 3TU4D 4ME4A 3VH5A 5KDMA 1P3IB 1S1ZA 1BZAA 2H10A 4MB3A 4MBHA 4J8XA 1MWSA 1LT0A 3W97D 2HDQA 2ZOHA 4S2JA 4RQ9A 2NQBC 2FN2A 5F68A 1K55A 3AZJA 3PAEA 1WWIA 1W8QA 2W0NA 4NFTA 4OVDA 1ZKJA 2X71A 3W99B 5FASA 3KXBB 1K57C 1ZG4A 3DTMA 4S2MA 4QD4A 5CHMA 3JYIA 4J8VD 3UB5P 4EBNA 3IXGA 4M3KA 4HP9A 3H9WA 3A1KA 2ZJ9A 2HIOB 2VJWA 3QP1A 2RCXA 5EV0A 4RX2A 1P3PA 3GMWA 3UB8A 1P3GD 4I3JA 4E3NA 3PHYA 4NE5A 4D60A 3MFXA 5B33D 3REIC 3HUOA 5GXQA 4MLLA 4Z5TA 3MFDA 1C3BA 1W5DA 4X23B 1I2SA 4R38A 4HH2A 2GDNA 1PI5A 4Z1WA 2ZOIA 5F82A 5CEBA 3HONA 2BYMB 1NZOA 4H6JA 4PKYA 3MGQD 3REHD 1WA9A 3A3JA 1YLZA 4R3AA 4GS9A 4N92A 4CLCB 1T1CA 3CI6A 2XSSA 5HD3A 1XFQA 3EG5B 4PPRA 1BTLA 3F1PB 4UA6A 4GNUA 3T12B 4AWLC 3WA9C 2EX8A 1P3MC 3AZMD 5FQIA 4FUWA 3C1CB 1MXOA 4WZ4A 3VP4A 4N9KA 4OJ5A 1PW1A 2Y2JA 4KUDB 3AFAC 3T4TA 2PYOC 1H0IA 3LI8A 4UAAA 1QMFA 4JLFA 3X1VC 1HVBA 4FOFA 2A24A 1M18D 2NZDA 3N7WA 1VB6A 3NI9A 5IHVA 4KHAA 2XLNA 5LBRA 3MS6A 1KX5A 1PFLA 3WS5A 1SDNA 4EBLA 3VSLA 4QWOA 5F99D 4R0QA 4OQHA 3KSIA 4QU3A 2IO5B 4Z2JA 3AZGD 3MGRB 4MBKA 4YM6B 3AV1A 5AVBD 3BFEA
chains in the Genus database with same CATH topology
2EFXA 5DNNA 5CHLB 5B2IC 1K54C 2EXBA 1R4VA 3VP3A 4OLDA 4GOGA 4OP8A 4U3TA 3W96A 3A3EA 3B3XA 4D2OA 4G91B 1P3ID 5BS7A 1KX4C 3HSHA 2EX2A 3NQUB 3SH8A 1K55C 5GSUA 3C4OA 4ZDXA 5DVAA 3L26A 3EPKA 3W99D 3IH8A 1MWTA 3KXBD 1XA1A 3BLSA 3KS4A 3NDEA 5B32G 1BLHA 5HW3A 2JC7A 1O7EA 5B32B 3NQJA 3ZG0A 4LV2A 2HIOD 4OOYA 1EQZA 5AV5A 1XA7A 2YFVB 4S2LA 3LY4A 1HTAA 3UDXA 5E43A 3BECA 3MKFA 4X23D 1P3OC 4NE3A 4CAYA 2P9VA 4LV1A 2X02A 5AQ7A 5CPJA 2Z2MB 4OQ0A 3BEBA 4XUJC 2L5AA 4OJ6A 5AV8C 5AY8B 1P3LA 4WBGA 5B0ZB 5B2JA 1M19C 4C75A 2HPBA 3LELB 3V3SA 3H0RC 4KZBA 4H9RA 4WNNA 2OLVA 3C1CD 4JJNA 4F94A 4KUDD 4KGCC 3GSGA 3WAAC 3C1BB 3AZLC 4Z66B 2XR0A 4X68A 1IYQA 4JBFA 5U47A 2FFYA 1RP5A 1L0DA 5E2EA 5EOEA 4EV4A 4QHCA 3VP0A 3VH6W 3MGRD 1G6AA 1AOIC 4YM6D 4PM8A 1E4DA 4DE1A 4XZQC 1J9MA 4BL2A 3AZKA 4XXRA 3W96C 3MGPD 4GB7A 5EVIA 4WEKA 5BS7C 3LY3A 4M6BA 1YU0A 1XXMA 3LZ1C 3GVBA 5DTSA 2F2AC 3WTPA 3EQVA 1HD8A 4KQQA 5C3IC 4GDNA 5DF7A 5BNXA 4E3JA 5FI6A 2RIQA 1K4FA 1YLWA 3W97C 5FAQA 3W4OA 4WMCA 5B32D 3MXSA 1W8YA 3UPNA 4GN2A 4LV0A 4J8VC 2VGKA 2BLSA 5KMWA 2RVQD 3Q82A 2WGWA 3AZHA 2IOUA 3B0CW 3N3FA 1P3GC 1MWUA 2HDSA 1N9BA 5GT0C 5CPJC 2EX9A 2ZC5B 2CV5A 4KG5A 4HBTA 3AZEC 1ONHA 2DCFA 3I7JA 1P3LC 1FOFA 5AY8D 1N1JB 3O62A 3W8KA 5B0ZD 1Y54A 3LELD 4EQIA 3IXHA 4QJGA 4IBJA 1ES2A 3KUYB 2R9WA 1LI0A 3PBOA 3AZMC 1P3BA 3WTPE 3HLEA 3C1BD 4BJPA 4Z66D 5FQ9A 4OJLA 3L27A 1P3KA 1EI5A 5B40A 2H0YA 4X6TA 5HX9A 3ITBA 4R4SA 3G2ZA 3BFFA 3LO7A 4ZJ3A 5GHXA 4ID4A 2ZY3A 4L0LA 4ZBEA 3N8LA 3B6GC 1PI4A 3AZGC 3BYDA 5FAOA 4S2PA 5B1MB 4LD9A 4R8PA 2DF4C 5JA4A 5EVIC 3BFGA 4QLCB 1GA0A 3B6FB 4R3JA 3ZDJA 5EE8A 1IYPA 3G31A 4LV3A 4DRBA 4IJEA 1EROA 1ULYA 1KE3A 5EVLA 2CWEA 3IWOA 3MVDB 2ZMAA 1TVFA 2E8IA 2BG1A 2WK0A 3QHYA 3MZEA 5GLDA 3W99C 1IKGA 3REJB 3REKA 3Q7ZA 1FSYA 2J9PA 3MKEA 2PU2A 3IP4C 4OH0A 2Y2NA 1ID3B 3X1SB 1W2EA 3X1UB 3VH6T 1DJCA 4H9PA 5EPHA 1P3AB 1MBLA 4KHAB 4X23C 4MEZA 2IWBA 1KX5B 3TOIA 5GLBA 2Y59A 3MGSB 1YU2A 1P3FB 3AZIA 5BOHA 3AV1B 4YS3A 5DNNB 3G34A 3UTAB 1G68A 1KE4A 3PAGA 4OJPA 4DE2A 3KUYD 2NQBA 4B88A 4NZ1A 1P3BC 2G5HC 4OPQA 3C1CC 4RVAA 5GSUB 4KUDC 1K57A 3NIAA 5B40C 1BLPA 4H9OA 4CSRA 1TDGA 5AV6B 1BH8A 1WE4A 1FCOA 3UN7A 3M2KA 3B0CT 5TGFA 2ZC3B 4R23A 3HBRA 5CPKB 3OPLA 3QNCA 3F6TA 1GHIA 2WAFA 4X69A 1CI9A 4OPYA 4JXSA 3MGRC 5B31G 4YM6C 5B1MD 5B31B 4WV4B 4NK3A 4RX3A 4QLCD 4E3MA 3B6FD 3G32A 1NJ4A 1FQGA 3S4XA 5FUGA 2Y2KA 3ZG9B 4E45A 1DJBA 4NY2A 3DWZA 3DW0A 3MVDD 1DJAA 2ZY2A 3X1TB 2XK1A 4H8RA 5A91A 1P3MA 3WA9A 2Y4AA 3EPLA 2F8NA 4NYYA 5DF8A 3REJD 3WKJA 2PYOA 5JYPA 3SH9A 3X1VA 5BPVA 4UUZA 1M1AB 4GZBA 4JJNB 3L2AA 1VM1A 1ID3D 3X1SD 4KZ8A 3UT9A 5JRGA 3NDGA 3X1UD 2OV5A 3HL9A 1P3AD 3GTCA 5AV9B 1XGJA 1KX5D 3LCEA 1S32B 1W7FA 1GA9A 2BYKB 3MGSD 2A49A 1K54A 1P3FD 1PWGA 4ZUXB 1TZYA 2XF3A 5CGSA 3AV1D 2EX6A 2B5RA 5DNND 1KX4A 5AY8C 5CEDA 3UTAD 4DDYA 2YFWA 5B0ZC 3LELC 4WZ5A 4PM5A 4J8UA 3V3RA 2QZ6A 2G2WA 5BNVA 3P5JB 3UTBC 4J8WB 5GSUD 5CHJA 4PM9A 1ESUA 1S0WA 3SH7A 5AV6D 4B4XA 2WZZA 3AV2B 1YU4A 4P0MA 4WYYA 5B0YB 3B0DC 4G92B 3UNWA 4Q8IA 5AVCB 1FR6A 5CPKD 3GRJA 2Y2LA 3VOZA 2XDMA 3Q7VB 1ZLAA 1P3OA 3P09A 3H0LC 5B31D 2QMIA 1L0GA 4B4ZA 4OQGA 5G49B 4WU9B 4JF4A 3AZFB 1XP4A 3EQUA 2IWCA 5M1AA 3VMAA 4GD8A 4XUJA 4H9QA 4K91A 5AV8A 3AZNA 4DRAA 3LJAB 3OPHA 4E3OA 5FI2A 1M19A 3VH6A 3X1TD 3ITAA 4N1HA 3LZ0B 3AL0C 2HP9A 3O62B 1N4OA 4FH4A 4DQYB 1P34B 3WKJC 3M2JA 5CP6B 4KGCA 1YLTA 3WAAA 1U35B 3AZLA 4DDSA 1M1AD 2G5IC 4JJND 2V2FF 5JRGC 3UT9C 4GH9A 3C7VA 4PMAA 4UHUA 3VP2A 5DNMB 3AYWB 3AN2B 1TAFB 4HEFA 3GR2A 4P87A 5AV9D 1CI8A 1P3KB 3ZVTA 3MNNA 1AOIA 1S32D 1TEMA 2XEPA 2AROA 2Y2QA 4XZQA 1TZYC 3HUMA 3MGPB 4ZUXD 1KX3A 4WU8B 3LZ1A 1LL5A 5B1LB 5E2FA 4OJOA 3TU4A 4WZ5C 4J8UC 4OPRA 1L0EA 2XFTA 3ZG8B 3W97A 3NBLA 2Y2MA 4OQIA 3KUYC 3G35A 4J8WD 3R45B 3UPOA 5B24B 2WGIA 3AV2D 3ZFZA 5B0YD 1HQ3B 4J8VA 1L0FA 5AVCD 4WMCD 3IF6C 3PBSA 1ZLAC 1PW8A 4H9NA 1FCNA 1P3GA 4OUIA 4GHAA 5B33A 2ZC6B 2ZC7A 4Z2MH 5GT0A 3RELB 4ZBJB 1Z6FA 4FH2A 4WU9D 1PIOA 3AZFD 1PZOA 4FCFA 1IEMA 3S22A 3UE0A 3WRZA 2Y55A 1W79A 3AZNC 3AZEA 5GLCA 1HTZA 3LJAD 3FZCA 1KU5A 3MGQA 2ZQ7A 4WEJA 1YLYA 2ZQ9A 1SCWA 3LZ0D 3MVDC 3A3FA 5HAPA 3O62D 4CPKA 3L25A 1P34D 4CJNA 5CP6D 3AZMA 1PWCA 3N6IA 5AQAA 1U35D 3WX7A 2FJ7B 1KDSA 1MY8A 1SDEA 4RA7A 5DNMD 1GCEA 4UPKA 3AYWD 3AN2D 1U60A 1P3KD 3MNNC 1L2SA 4HBUA 1LHYA 3IQAA 2AROC 3B6GA 3AZGA 5CPIC 3G4PA 2Y2PA 5AVBA 3V9RB 1BH9B 3REIB 1KX3C 3IXBA 5A93A 5A90A 3MGSC 1P3FC 4IVIA 4WU8D 3TU4C 5B1LD 4EO5B 4R8PD 4X53A 1P3IA 5BO0B 3UTAC 5CHUA 1H3OA 3BFDA 1ZC2A 2DNSA 4FD8A 3UO9A 1AXBA 1M6KA 5B24D 3W99A 3G30A 3KXBA 4R3BA 4RYEA 1HQ3D 4OONA 4AWLB 3W98B 3NCKA 2HIOA 2HP6A 3A6NB 3AFAB 4GDBA 1YT4A 5CPKC 5B33C 3X1VB 2ZQDA 4KZ7A 1F66B 1K4EA 2Q9MA 3RELD 5EOOA 4X23A 3OPRA 2A3UA 5B31C 5HARA 3KWQB 4QY6A 3PBTA 1ES3A 2BYMA 3MGQC 3REHC 5GT3B 5E5AB 4FSFA 5B2IB 4KG6A 3IWQA 1Q2QA 5KDMB 3X1TC 4J8XB 1KX4B 3C1CA 3SS3A 2YFWB 4A5RA 4KUDA 3C4PA 4P6BA 3AZJB 2FJ7D 1YM1A 2H5SA 4IBEA 4JKTA 1M18C 4JF6A 4DF6A 3Q07A 5F99C 4Y0TA 3M6HA 4H9SA 4HGAC 3NY4A 3GQZA 3OCNA 5AV9C 1P3PB 1CEGA 3FDDA 5AVBC 3MGRA 4YM6A 5GXQB 3REID 4Z5TB 4DXCA 1KVLA 5CRFA 4OPZA 5KZHA 1K56A 3N4IA 1P3IC 4JPMA 5J8XA 4IJFA 3E2LA 4DE0A 1XGIA 3UY6A 3NQUA 1E3UD 2F8NH 2WKIA 2Y2HA 4XUJB 4NZ3A 1H5XA 1I2WA 1H8YA 2WZXA 3KXBC 3BFCA 5DTTA 1TDLA 2P74A 1NXYA 3ZNYA 2JE5A 3W98D 4IBKA 2G2UA 2HIOC 5B0YC 1XKZA 1Q9CA 3A6ND 3AFAD 5AVCC 2YFVA 3X1VD 4PM6A 5CTNA 5FATA 2NZDB 3WS0A 1F66D 3TG9A 3Q81A 3HLGA 4E6XA 3NC8A 4OKPA 3KWQD 1EWZA 4WU9C 2WYXA 1AOIB 5GLAA 5GT3D 1YLPA 5E5AD 2R9XA 5B2ID 3LJAC 5AY8A 1YMXA 5B0ZA 3WS4A 3KSYA 3W96B 3LELA 1PZPA 4J8XD 1KX4D 2XGNA 1ERMA 1K25A 1LI9A 3UTBA 1P34C 1F1EA 1MWRA 2DQNC 5CP6C 3AZJD 1U35C 4Z66A 1YUEA 1BT5A 1HZOA 5FQMA 4H9SC 5DNMC 3HUNA 3NQJB 3OZHA 3PBNA 3ZGAB 3HREA 4BENA 1CEFA 1BUEA 5BT1D 3AGDA 2IO5C 1EQZB 5AV5B 1P3PD 2UWXA 4BQMA 5GXQD 3FV7A 4KZ9A 4WELA 4Z5TD 3G2YA 3UE1A 2Y2OA 3VFFA 3MGPC 4KZ4A 4CAYB 2HUEB 2P9VB 2RL3A 3IH9A 4G91C 5GT0B 5CPJB 5FQKA 4WU8C 3ZVWA 4XUJD 3AZEB 2JBFA 1P3LB 4KG2A 3ISGA 5B2JB 3UE3A 2J7VA 3IF5A 4EUZA 3HLBA 4H9RB 4WNNB 2HDRA 5B32C 5CGXA 5B24C 1LL9A 1I5QA 1WYCA 2RVQC 3O3VA 5DF9A 4NYUA 2NZDD 2PU4A 5FQQA 2WAEA 1ES5A 4NE6A 4OOMA 3RELC 3PTEA 4KZ6A 4LCMA 3SS4A 1AOID 3B6GB 2WKHA 1BLSA 3W4PA 5GHYA 3AZKB 4C6YA 3M6BA 5EVIB 1ONGA 3W96D 4DXBA 2W8SA 5HL1A 4R4RA 3VP1A 3WTPB 3KUYA 1B67A 3CMZA 5BNXB 3C5AA 3C1BC 4Z66C 2LY8A 4QY5A 1H3OB 2FJ7C 1JFIA 3DWKA 1ERQA 3Q1FA 5JYOA 3IF6A 4S2NC 1ESIA 1EQZD 1JWPA 5AV5D 2PBYA 2WGWB 3AZHB 1RGZA 2EFUA 1H8ZA 3VFHA 1PWDA 5B1MA 3CG5A 3UPPA 4QLCA 5GT0D 3B6FA 5CPJD 2Z2LB 3FKEA 3RXXA 4BD0A 2CV5B 4Z2MG 4EO5C 4ZAMA 3OC2A 3WS2A 3AZED 1P3LD 4BL3A 4WJ3C 3AGFA 3MVDA 5AQ9A 5B2JD 4IVKA 4IBBA 3CZDA 3REJA 3SOIA 1P3BB 4E3LA 3KFUG 3W98C 1ID3A 3A6NC 4OLGA 3X1SA 3WWXA 4KZAA 5B40B 3X1UA 2JCHA 1IKIA 4R1GA 3GV9A 1P3AA 1F66C 1PZRA 5EECA 2XFSA 5CPIA 1K6SA 1VQQA 2WGVA 3BRMA 1Z2CB 3AGEA 2J8PA 3KWQC 3MGSA 1P3FA 1XX2A 3B6GD 4LD9B 4R8PB 3AZKD 4P85A 5JA4B 1MKIA 1WYBA 5GT3C 2XQZA 5E5AC 5EVID 1BSGA 4U0TA 2I72A 4Y0OA 1O07A 3UTAA 1JWZA 3WTPD 3KS8A 4BLMA 4J8XC 5FI7A 3QNBA 3ZHHA 3AZJC 2HDUA 1GHPA 5AQBA 3A3IA 5AV6A 5EUAA 1CK3A 3REKB 5CERA 2ZM0A 4IBGA 5CPKA 1LLBA 2C6WB 5CXWA 1BLCA 1GHMA 2ZY5A 5HFOA 3AZHD 5BT1C 5M19A 1P3PC 4DKIA 4H9PB 3H0MC 5B1MC 3VH5W 2ZQAA 5F83A 5GXQC 3S1YA 5B31A 4QLCC 2FFFB 4Z5TC 3B6FC 3PBRA 4X56A 2CV5D 3REHA 1Q2PA 3AZIB 2WUQA 4UA9A 4YS3B 2DRWA 2OLUA 2V1ZA 3X1TA 4UA7A 3ZG7B 4NETA 4KQRA 2NQBB 3REJC 1YMSA 1P3BD 4Z9QA 3UDFA 1M1AA 1M18A 1ID3C 3UTBB 3X1SC 3ZCZA 3OPPA 4XUZA 3X1UC 4H9OB 5F99A 4CSRB 5B40D 4E44A 1BH8B 1P3AC 2VGJA 2NZDC 4OOLA 3B0DB 5AV9A 2OSUA 4JXVA 1KX5C 4K0WA 4S2KA 1S32A 4KQOA 2BYKA 4IBDA 4Y0UA 1S6RA 3AV1C 4ZUXA 4LD9D 2Y91A 3ZG5A 5DNNC 5E2GA 4E6WA 4U0XA 1JVJA 4C3QA 1YU3A 4WM9A 1K56D 4OP5A 5FUGB 5FA7A 1JTDA 4HESA 5GL9A 1K6RA 1IYSA 3FWLA 4O7DA 1KVMA 3P98A 5GSUC 5F1FA 4J8WA 5A92A 5I94A 3WS1A 1P3MB 3WA9B 2VQRA 3W4QA 5AV6C 2F8NG 3AV2A 2F8NB 5B0YA 4LCLA 4MBFA 4ZJ1A 3REKD 3WKJB 2PYOB 5AVCA 4UUZB 5FAPA 3D4FA 3Q7VA 1EQZC 5AV5C 5JRGB 3UT9B 3FKWA 4BD1A 3N8RA 4JF5A 3SS5A 5DTKA 5G49A 4WU9A 4IBCA 3AZFA 1JTGA 2HUEC 4ZJ2A 4DRTA 3AZID 3LJAA 1E25A 1OMEA 1TZYB 3RXWA 4YS3D 5KSHA 5E2HA 3LZ0A 2WADA 5B2JC 5D3OA 2EXAA 3WRTA 5KSCA 4J8UB 1P34A 2NQBD 1BULA 5CP6A 3EPHA 1KGEA 5BNVB 1U35A 1M1AC 4PM7A 4JJNC 1KGGA 3UTBD 2J8YA 4IBIA 3VSKA 1YU1A 5DNMA 2V20A 1XPBA 3AYWA 3AN2A 1FR1A 1TAFA 4MNRA 4E3KA 2CC1A 5FDHA 1JFIB 4IBFA 3VH5T 1NZUA 3ZNTA 2XH9A 1KE0A 1S32C 4E3IA 3L29A 3IF6B 2WKEA 1ZLAB 5FQJA 5TR7A 2ZQCA 2JSSA 2Y2GA 1P3OB 1T3UA 4ZUXC 3MGPA 3RJUA 4EBPA 5TFQA 4WU8A 4YINA 5B1LA 3AZKC 1NYYA 5CGWA 4NZ4A 4K0XA 4H9QB 1FSWA 4KZ3A 2XD1A 5AV8B 3AZNB 2H0TA 1WWSA 2XD5A 3WTPC 1QMEA 1SKFA 1M19B 1A7WA 4J8WC 1RGYA 4JXWA 3R45A 4WZSB 1NY0A 4XUXA 1MPLA 1P3MD 3WA9D 4LG2A 5B32A 5B24A 3AV2C 1ES4A 4G92C 3C7UA 2F8ND 1HQ3A 4KGCB 3WKJD 2PYOD 3WAAB 1B6WA 3E2KA 3AZLB 3IXDA 3B0BA 1KDWA 1NRFA 1IYOA 1ZG6A 1PYYA 2IWDA 5JRGD 3UT9D 4NZ5A 3N8SA 3A3DA 5F1GA 3AZHC 4GD6A 4ZTKA 3IHBA 3RELA 3EPJA 4IEDA 3AZFC 2Y2IA 3MNNB 2F8NK 3L28A 2ZM8A 2AROB 5CPIB 4XZQB 2CV5C 4KENB 3HLWA 1TZYD 3LEZA 1KX3B 5CECA 3HLCA 3LZ0C 3LZ1B 3MZDA 3UDIA 4IBRA 3O62C 3TU4B 1IELA 5C3IB 2C5WB 4J8UD 5HAQA 3C1BA 5FSRA 5HAIA 4EWFA 3W97B 5M18A 2ZM2A 2FJ7A 4X55A 4YFMA 4DE3A 2ZD8A 2ZM5A 3AYWC 3AN2C 2X01A 1YQSA 4J8VB 4LENA 5GHZA 1P3KC 1FCMA 1YLJA 4S2NA 4JXGA 3BLMA 4GKUA 1KGFA 3CJMA 1RCJA 4H9NB 3O87A 1P3GB 1ZLAD 4GHLA 2ZQ8A 3IWIA 3BM6A 1JWVA 5B33B 4S2OA 1P3OD 3V9RA 1BH9A 3REIA 3MZFA 5CTMA 4IBXA 3A1IA 5B1LC 4LD9C 4R8PC 3V39A 3HLDA 3V50A 2HP5A 3MXRA 1SHVA 5BO0A 2ZY4A 5AV8D 3AZND 4N9LA 3TSGA 2ZC4B 5L2FA 2J9OA 3FYZA 3MGQB 3REHB 1E3UA 2Q9NA 1M19D 3IT9A 3O86A 1BFMA 1HQ3C 3AZMB 4KGCD 3FKVA 4Y7PA 3MBZA 3HLFA 3W98A 3WAAD 3AZLD 4QNLA 3REKC 1K38A 3A6NA 3AFAA 3VOYA 3O88A 3V5MA 1M18B 1F66A 4ZBJC 4S2IA 2ZLYA 3PBQA 5F99B 4HGAB 1DY6A 3MNND 2QPNA 3HVFA 3IHAA 5G18A 4QB8A 4N1XA 3KWQA 3AZGB 1NYMA 3OCLA 2AROD 4KZ5A 1N1JA 5CPID 5AVBB 4XZQD 1M40A 5GT3A 1KX3D 5E5AA 3AZIC 5B2IA 3LZ1D 4YS3C 1ALQA 3TU4D 3VH5A 5KDMA 1P3IB 2H10A 1BZAA 4MBHA 4J8XA 1MWSA 3W97D 2HDQA 4S2JA 2NQBC 1K55A 3AZJA 3PAEA 1WWIA 1W8QA 4NFTA 4OVDA 1ZKJA 2X71A 3W99B 5FASA 3KXBB 1K57C 1ZG4A 3DTMA 4S2MA 4QD4A 5CHMA 3JYIA 4J8VD 4EBNA 3IXGA 4M3KA 3A1KA 2ZJ9A 2HIOB 2RCXA 4RX2A 1P3PA 3GMWA 1P3GD 4E3NA 4NE5A 5B33D 3REIC 3HUOA 5GXQA 4MLLA 4Z5TA 3MFDA 1C3BA 1W5DA 4X23B 1I2SA 2GDNA 1PI5A 5F82A 5CEBA 3HONA 2BYMB 1NZOA 3MGQD 3REHD 3A3JA 1YLZA 4N92A 3EG5B 4PPRA 1BTLA 4UA6A 4GNUA 4AWLC 3WA9C 2EX8A 1P3MC 3AZMD 5FQIA 3C1CB 1MXOA 4WZ4A 3VP4A 4N9KA 4OJ5A 1PW1A 2Y2JA 4KUDB 3AFAC 2PYOC 4UAAA 1QMFA 4JLFA 3X1VC 1HVBA 1M18D 2NZDA 3N7WA 3NI9A 5IHVA 4KHAA 2XLNA 1KX5A 3WS5A 1SDNA 4EBLA 3VSLA 5F99D 4R0QA 4OQHA 4QU3A 2IO5B 3AZGD 3MGRB 4MBKA 4YM6B 3AV1A 5AVBD 3BFEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EFX A;  2OV5 A;  1IYS A;  2JE5 A;  3FWL A;  3ZNY A;  2G2U A;  1K54 C;  3HL9 A;  2EXB A;  3GTC A;  4O7D A;  1KVM A;  3VP3 A;  3P98 A;  1XGJ A;  1XKZ A;  5F1F A;  4OLD A;  4GOG A;  4OP8 A;  5A92 A;  5I94 A;  3LCE A;  4U3T A;  3A3E A;  4D2O A;  3B3X A;  3WS1 A;  1W7F A;  4PM6 A;  5CTN A;  1GA9 A;  5FAT A;  3W4Q A;  2A49 A;  1K54 A;  2EX2 A;  3WS0 A;  1PWG A;  4LCL A;  3SH8 A;  4MBF A;  4ZJ1 A;  3TG9 A;  1K55 C;  2XF3 A;  3Q81 A;  5CGS A;  3HLG A;  2EX6 A;  3C4O A;  4E6X A;  3NC8 A;  2B5R A;  4ZDX A;  5FAP A;  3D4F A;  4OKP A;  1EWZ A;  5CED A;  5DVA A;  3Q7V A;  4DDY A;  3IH8 A;  1MWT A;  1XA1 A;  3BLS A;  2WYX A;  3NDE A;  4WZ5 A;  3FKW A;  4PM5 A;  1BLH A;  5HW3 A;  5GLA A;  2JC7 A;  3V3R A;  4BD1 A;  3N8R A;  4JF5 A;  1O7E A;  3SS5 A;  1YLP A;  2QZ6 A;  2G2W A;  2R9X A;  5DTK A;  3ZG0 A;  4LV2 A;  1YMX A;  4OOY A;  3WS4 A;  1JTG A;  1XA7 A;  5CHJ A;  4ZJ2 A;  4PM9 A;  1PZP A;  4S2L A;  1ESU A;  1S0W A;  3SH7 A;  4DRT A;  2XGN A;  3LY4 A;  4B4X A;  2WZZ A;  4P0M A;  4WYY A;  3UDX A;  1OME A;  1E25 A;  5E43 A;  1ERM A;  1K25 A;  1LI9 A;  3BEC A;  3MKF A;  3UNW A;  4Q8I A;  1MWR A;  3RXW A;  1FR6 A;  2P9V A;  5KSH A;  3GRJ A;  2Y2L A;  2X02 A;  4LV1 A;  5E2H A;  5AQ7 A;  3VOZ A;  2XDM A;  2Z2M B;  1BT5 A;  2WAD A;  3Q7V B;  5D3O A;  1HZO A;  2EXA A;  3WRT A;  5KSC A;  4OQ0 A;  5FQM A;  3BEB A;  1BUL A;  3P09 A;  3HUN A;  1KGE A;  3OZH A;  3PBN A;  2QMI A;  3HRE A;  3ZGA B;  4PM7 A;  4BEN A;  1L0G A;  4B4Z A;  4OQG A;  1CEF A;  1BUE A;  4WBG A;  1KGG A;  1XP4 A;  3AGD A;  3EQU A;  4JF4 A;  4C75 A;  2IWC A;  2J8Y A;  2HPB A;  5M1A A;  3V3S A;  2UWX A;  4BQM A;  3VSK A;  3VMA A;  4GD8 A;  4KZB A;  4K91 A;  2V20 A;  3FV7 A;  1XPB A;  4HES A;  4KZ9 A;  1FR1 A;  2OLV A;  4WEL A;  3G2Y A;  3UE1 A;  4MNR A;  2Y2O A;  2CC1 A;  3OPH A;  4E3K A;  4E3O A;  4F94 A;  5FDH A;  5FI2 A;  3VFF A;  4KZ4 A;  3GSG A;  2P9V B;  1NZU A;  2RL3 A;  3ZNT A;  2XH9 A;  1KE0 A;  3IH9 A;  3ITA A;  4E3I A;  3IF6 B;  5FQK A;  4N1H A;  2WKE A;  2HP9 A;  2XR0 A;  4X68 A;  1N4O A;  4FH4 A;  5FQJ A;  5TR7 A;  1IYQ A;  2ZQC A;  2Y2G A;  3M2J A;  4JBF A;  3ZVW A;  3RJU A;  5U47 A;  1YLT A;  4EBP A;  2JBF A;  2FFY A;  1RP5 A;  4KG2 A;  1L0D A;  5E2E A;  5EOE A;  4DDS A;  3ISG A;  5TFQ A;  4YIN A;  3UE3 A;  4EV4 A;  4QHC A;  1NYY A;  2J7V A;  5CGW A;  3VP0 A;  3IF5 A;  4K0X A;  2V2F F;  3C7V A;  4PMA A;  4EUZ A;  1G6A A;  4UHU A;  3VP2 A;  3HLB A;  1FSW A;  4KZ3 A;  2XD1 A;  2HDR A;  5CGX A;  4PM8 A;  4HEF A;  1E4D A;  2H0T A;  3GR2 A;  4DE1 A;  4P87 A;  1LL9 A;  2XD5 A;  1I5Q A;  1QME A;  1J9M A;  1SKF A;  1CI8 A;  4BL2 A;  1RGY A;  4JXW A;  4XXR A;  3ZVT A;  1NY0 A;  4GB7 A;  1WYC A;  5EVI A;  4WEK A;  4XUX A;  3LY3 A;  1MPL A;  3O3V A;  1XXM A;  5DF9 A;  1TEM A;  2XEP A;  1ES4 A;  3GVB A;  5DTS A;  2PU4 A;  3C7U A;  2Y2Q A;  3EQV A;  3HUM A;  1HD8 A;  4KQQ A;  4GDN A;  5FQQ A;  5DF7 A;  2WAE A;  1ES5 A;  3E2K A;  5FI6 A;  4E3J A;  1K4F A;  4OOM A;  1YLW A;  3IXD A;  1KDW A;  3PTE A;  1NRF A;  4KZ6 A;  1LL5 A;  4LCM A;  5E2F A;  5FAQ A;  1IYO A;  1ZG6 A;  1PYY A;  4WZ5 C;  2IWD A;  3W4O A;  4OPR A;  3N8S A;  4WMC A;  3SS4 A;  1L0E A;  3A3D A;  5F1G A;  2XFT A;  4GD6 A;  4ZTK A;  2WKH A;  3MXS A;  3NBL A;  2Y2M A;  1W8Y A;  1BLS A;  3IHB A;  4IED A;  4OQI A;  4GN2 A;  3UPN A;  3W4P A;  4LV0 A;  5GHY A;  2VGK A;  4C6Y A;  2BLS A;  3G35 A;  3M6B A;  2Y2I A;  5KMW A;  5EVI B;  1ONG A;  4DXB A;  3UPO A;  5HL1 A;  3Q82 A;  4R4R A;  2WGI A;  2WGW A;  2ZM8 A;  3VP1 A;  3ZFZ A;  1MWU A;  2HDS A;  4KEN B;  3HLW A;  1L0F A;  1N9B A;  3CMZ A;  3LEZ A;  3C5A A;  4WMC D;  5CEC A;  3IF6 C;  3HLC A;  4QY5 A;  3PBS A;  1PW8 A;  2EX9 A;  3MZD A;  3UDI A;  4IBR A;  1FCN A;  1IEL A;  2ZC5 B;  4KG5 A;  2C5W B;  5HAQ A;  2ZC6 B;  3DWK A;  2ZC7 A;  1ERQ A;  4HBT A;  1ONH A;  5FSR A;  3Q1F A;  2DCF A;  5HAI A;  4EWF A;  3I7J A;  5JYO A;  3IF6 A;  5M18 A;  1FOF A;  1Z6F A;  2ZM2 A;  4FH2 A;  1PIO A;  3W8K A;  4S2N C;  1ESI A;  1JWP A;  4X55 A;  1PZO A;  4FCF A;  1IEM A;  1Y54 A;  3S22 A;  3UE0 A;  3WRZ A;  2Y55 A;  1W79 A;  4YFM A;  2ZD8 A;  2PBY A;  3IXH A;  4DE3 A;  4EQI A;  4QJG A;  2WGW B;  5GLC A;  1RGZ A;  2EFU A;  1HTZ A;  1ES2 A;  2X01 A;  1YQS A;  1H8Z A;  2R9W A;  3FZC A;  4LEN A;  5GHZ A;  1FCM A;  2ZQ7 A;  1YLJ A;  1PWD A;  4S2N A;  1LI0 A;  4WEJ A;  3VFH A;  3CG5 A;  3PBO A;  1YLY A;  4JXG A;  3BLM A;  3UPP A;  3HLE A;  4GKU A;  1KGF A;  2ZQ9 A;  4BJP A;  1SCW A;  3CJM A;  1RCJ A;  2Z2L B;  3A3F A;  3O87 A;  5FQ9 A;  3RXX A;  2ZQ8 A;  4BD0 A;  3IWI A;  5HAP A;  3BM6 A;  1JWV A;  4CPK A;  4ZAM A;  1EI5 A;  3OC2 A;  4S2O A;  2H0Y A;  3WS2 A;  4CJN A;  5CTM A;  3MZF A;  1PWC A;  4X6T A;  3N6I A;  4IBX A;  5AQA A;  5HX9 A;  3ITB A;  4R4S A;  3G2Z A;  4BL3 A;  3AGF A;  1KDS A;  3BFF A;  4IVK A;  5AQ9 A;  1MY8 A;  1SDE A;  3LO7 A;  3V39 A;  3HLD A;  5GHX A;  4ZJ3 A;  4ID4 A;  3V50 A;  2HP5 A;  4RA7 A;  3MXR A;  1SHV A;  4L0L A;  4ZBE A;  1GCE A;  4N9L A;  3N8L A;  3TSG A;  1PI4 A;  2ZC4 B;  1U60 A;  5L2F A;  3BYD A;  2J9O A;  3FYZ A;  1E3U A;  3CZD A;  5FAO A;  2Q9N A;  4S2P A;  3SOI A;  1L2S A;  4HBU A;  4E3L A;  5EVI C;  3BFG A;  1LHY A;  1GA0 A;  3IT9 A;  3IQA A;  4R3J A;  3ZDJ A;  3O86 A;  4OLG A;  3WWX A;  4KZA A;  1IYP A;  5EE8 A;  3G31 A;  3G4P A;  2Y2P A;  4LV3 A;  2JCH A;  4Y7P A;  3FKV A;  3IXB A;  1ERO A;  3HLF A;  3MBZ A;  1IKI A;  5A93 A;  5A90 A;  4R1G A;  3GV9 A;  1KE3 A;  5EEC A;  5EVL A;  4IVI A;  3IWO A;  1K38 A;  2XFS A;  2ZMA A;  1K6S A;  3VOY A;  1TVF A;  1VQQ A;  2BG1 A;  2E8I A;  2WGV A;  3BRM A;  3AGE A;  3O88 A;  4X53 A;  2WK0 A;  3QHY A;  3MZE A;  3V5M A;  1XX2 A;  5GLD A;  5CHU A;  4S2I A;  3BFD A;  1IKG A;  1ZC2 A;  3Q7Z A;  2ZLY A;  2DNS A;  4FD8 A;  3PBQ A;  3UO9 A;  4P85 A;  1FSY A;  2J9P A;  1MKI A;  1WYB A;  1AXB A;  2PU2 A;  1DY6 A;  3MKE A;  2XQZ A;  1M6K A;  2QPN A;  3HVF A;  3IHA A;  4OH0 A;  5EVI D;  5G18 A;  1BSG A;  4U0T A;  2Y2N A;  2I72 A;  4QB8 A;  4N1X A;  4Y0O A;  1O07 A;  1JWZ A;  1NYM A;  3OCL A;  3G30 A;  4KZ5 A;  4R3B A;  4RYE A;  4BLM A;  1DJC A;  4OON A;  1M40 A;  5EPH A;  5FI7 A;  3NCK A;  1MBL A;  2HP6 A;  2IWB A;  4MEZ A;  4GDB A;  3QNB A;  3ZHH A;  3TOI A;  1YT4 A;  5GLB A;  1ALQ A;  2H10 A;  2HDU A;  2Y59 A;  1BZA A;  1GHP A;  4MBH A;  5AQB A;  2ZQD A;  3A3I A;  4KZ7 A;  5EUA A;  1MWS A;  1K4E A;  2Q9M A;  2HDQ A;  4S2J A;  1CK3 A;  5EOO A;  5BOH A;  5CER A;  1K55 A;  2ZM0 A;  3OPR A;  2C6W B;  5CXW A;  1LLB A;  2A3U A;  3PAE A;  1W8Q A;  5HAR A;  1BLC A;  1GHM A;  4OVD A;  3G34 A;  1ZKJ A;  2X71 A;  4QY6 A;  3PBT A;  1G68 A;  5HFO A;  1ES3 A;  1KE4 A;  3PAG A;  1K57 C;  5FAS A;  5M19 A;  1ZG4 A;  4DE2 A;  3DTM A;  4S2M A;  4QD4 A;  5CHM A;  3JYI A;  4B88 A;  2ZQA A;  4DKI A;  4EBN A;  5F83 A;  3IXG A;  4M3K A;  4FSF A;  3S1Y A;  2FFF B;  2ZJ9 A;  4OPQ A;  4KG6 A;  2RCX A;  3PBR A;  4RVA A;  3IWQ A;  1K57 A;  4RX2 A;  1Q2Q A;  3GMW A;  4E3N A;  3NIA A;  1JTD A;  4X56 A;  1Q2P A;  1BLP A;  3HUO A;  1TDG A;  4MLL A;  2WUQ A;  1WE4 A;  3MFD A;  1FCO A;  1C3B A;  1W5D A;  3SS3 A;  3UN7 A;  3M2K A;  5TGF A;  2ZC3 B;  4R23 A;  3HBR A;  4A5R A;  4UA9 A;  1I2S A;  2DRW A;  3C4P A;  2OLU A;  4P6B A;  3OPL A;  3QNC A;  2GDN A;  1PI5 A;  1GHI A;  2V1Z A;  2WAF A;  1YM1 A;  2H5S A;  5F82 A;  4X69 A;  4UA7 A;  4JKT A;  1CI9 A;  5CEB A;  4JF6 A;  1NZO A;  3ZG7 B;  4DF6 A;  4OPY A;  4NET A;  4JXS A;  4KQR A;  1YMS A;  3Q07 A;  4Y0T A;  3M6H A;  3A3J A;  4Z9Q A;  3NY4 A;  1YLZ A;  3GQZ A;  4NK3 A;  4N92 A;  4RX3 A;  3UDF A;  3OCN A;  4E3M A;  3G32 A;  4PPR A;  1CEG A;  1NJ4 A;  1BTL A;  3ZCZ A;  1FQG A;  4UA6 A;  3S4X A;  4GNU A;  3OPP A;  4XUZ A;  2Y2K A;  3ZG9 B;  2EX8 A;  1DJB A;  5FQI A;  4DXC A;  2VGJ A;  4WZ4 A;  1MXO A;  1KVL A;  4OOL A;  4N9K A;  5CRF A;  3VP4 A;  2OSU A;  4OPZ A;  1PW1 A;  2Y2J A;  3DWZ A;  1K56 A;  3DW0 A;  4JXV A;  5KZH A;  1DJA A;  4K0W A;  4UAA A;  2XK1 A;  3N4I A;  1QMF A;  4H8R A;  5A91 A;  4JPM A;  4JLF A;  4S2K A;  5J8X A;  3ZG8 B;  1HVB A;  4KQO A;  2Y4A A;  3E2L A;  3N7W A;  3NI9 A;  4DE0 A;  5IHV A;  1XGI A;  4Y0U A;  5DF8 A;  3UY6 A;  1S6R A;  2XLN A;  1E3U D;  2WKI A;  3WS5 A;  2Y2H A;  2Y91 A;  1SDN A;  4EBL A;  3VSL A;  3ZG5 A;  3SH9 A;  5JYP A;  1H5X A;  4R0Q A;  5E2G A;  4E6W A;  4U0X A;  1JVJ A;  1I2W A;  4GZB A;  4C3Q A;  1H8Y A;  1VM1 A;  4OQH A;  4QU3 A;  2WZX A;  3BFC A;  4WM9 A;  1K56 D;  4OP5 A;  5DTT A;  1TDL A;  4MBK A;  4KZ8 A;  5FA7 A;  2P74 A;  1NXY A;  3NDG A;  3BFE A;  5GL9 A;  1K6R A; 
#chains in the Genus database with same CATH topology
 2EFX A;  5DNN A;  5CHL B;  5B2I C;  1K54 C;  2EXB A;  1R4V A;  3VP3 A;  4OLD A;  4GOG A;  4OP8 A;  4U3T A;  5L10 A;  3W96 A;  3A3E A;  3B3X A;  4D2O A;  4G91 B;  1P3I D;  5BS7 A;  1KOU A;  1KX4 C;  3HSH A;  1H8M A;  2EX2 A;  3H82 A;  3NQU B;  3WD3 A;  4PAU A;  3SH8 A;  3MSH A;  4XT2 A;  1K55 C;  5GSU A;  3C4O A;  3VOL A;  4ZDX A;  3NOT C;  2EA9 A;  2VEA A;  5DVA A;  3L26 A;  3EPK A;  3W99 D;  3IH8 A;  1MWT A;  3KXB D;  1XA1 A;  3BLS A;  3KS4 A;  3NDE A;  5B32 G;  1BLH A;  1G5U A;  5HW3 A;  3IS2 A;  2JC7 A;  4YNR A;  1O7E A;  3C2W A;  5B32 B;  2FH5 A;  3NQJ A;  3ZG0 A;  4LV2 A;  2HIO D;  4OOY A;  5IS1 A;  1EQZ A;  5AV5 A;  3LIC A;  1E6N A;  1XA7 A;  2YFV B;  1STZ A;  5HWW A;  4S2L A;  3LY4 A;  1HTA A;  1IOU A;  3UDX A;  2O9C A;  5E43 A;  3BEC A;  3MKF A;  4X23 D;  1P3O C;  4G3V A;  4NE3 A;  5L07 A;  1GOI A;  2W3D A;  4CAY A;  2P9V A;  1GPF A;  4LV1 A;  2X02 A;  5AQ7 A;  5CPJ A;  2Z2M B;  4GHI B;  4OQ0 A;  3BEB A;  4HJ6 A;  4XUJ C;  2L5A A;  4OJ6 A;  4Y13 A;  1F98 A;  2Y8H A;  5AV8 C;  5AY8 B;  1P3L A;  4CLC D;  4WBG A;  5B0Z B;  5B2J A;  3R4K A;  1M19 C;  4C75 A;  2HPB A;  3LEL B;  3V3S A;  3H0R C;  3KO6 A;  2J3T C;  4KZB A;  5AVE A;  5DFX A;  4H9R A;  4WNN A;  3KSF A;  5DKK A;  2OLV A;  3C1C D;  4JJN A;  4F94 A;  2VKS A;  4KUD D;  4KGC C;  3GSG A;  3WAA C;  3C1B B;  3ICY A;  3AZL C;  1CJF A;  4Z66 B;  3WD4 A;  2XR0 A;  4X68 A;  4HOI A;  1IYQ A;  4JGQ A;  1OT9 A;  4JBF A;  4L9E A;  5U47 A;  2Y79 A;  1E6Z A;  2FFY A;  1RP5 A;  2K31 A;  1L0D A;  5E2E A;  5EOE A;  4EV4 A;  4QHC A;  3VP0 A;  3VH6 W;  3TW8 A;  3MGR D;  4WF0 A;  1G6A A;  1AOI C;  4YM6 D;  2PBD P;  4TX8 A;  4PM8 A;  1E4D A;  4DE1 A;  4HP4 A;  4XZQ C;  1J9M A;  4BL2 A;  3AZK A;  4XXR A;  3W96 C;  3MGP D;  4GB7 A;  5EVI A;  2PHY A;  5BS7 C;  4WEK A;  3LY3 A;  4M6B A;  1E15 A;  1YU0 A;  1XXM A;  2JKF A;  1YSQ A;  3LZ1 C;  2JKG A;  3GVB A;  5DTS A;  2F2A C;  3WTP A;  3EQV A;  1W63 Q;  1HD8 A;  4KQQ A;  5C3I C;  4GDN A;  5DF7 A;  5BNX A;  4E3J A;  5FI6 A;  2RIQ A;  1K4F A;  1YLW A;  3W97 C;  3QP4 A;  2M7V A;  5FAQ A;  1IFQ A;  2V8C A;  5HSQ A;  3W4O A;  4WMC A;  4BMW A;  2INW A;  2V8F A;  3PYP A;  5B32 D;  3MXS A;  1W8Y A;  3UPN A;  3VE4 A;  4GN2 A;  2D01 A;  5F5Y A;  2V0U A;  4LV0 A;  4J8V C;  2VGK A;  2BLS A;  5KMW A;  2RVQ D;  3B33 A;  2JN7 A;  3Q82 A;  2WGW A;  3AZH A;  2IOU A;  5FEF A;  3B0C W;  3N3F A;  1P3G C;  1MWU A;  2HDS A;  4HH3 A;  2ZMV A;  1N9B A;  5G4Z A;  5GT0 C;  5CPJ C;  2EX9 A;  2I9V A;  3C30 A;  2ZC5 B;  2CV5 A;  4KG5 A;  4P6Z S;  1NWZ A;  4HBT A;  3AZE C;  1ONH A;  1Z09 A;  2DCF A;  3I7J A;  1P3L C;  1FOF A;  4BBT A;  5AY8 D;  1N1J B;  3O62 A;  3W8K A;  5B0Z D;  2YKF A;  1Y54 A;  3LEL D;  4EQI A;  2PT7 A;  3IXH A;  1N9O A;  4QJG A;  1E8B A;  3FC7 A;  4IBJ A;  1ES2 A;  3KUY B;  2R9W A;  1LI0 A;  3T1X A;  2O99 A;  3PBO A;  3AZM C;  1P3B A;  3WTP E;  3HLE A;  4EXO A;  3C1B D;  4BJP A;  4Z66 D;  2R78 A;  5FQ9 A;  4OJL A;  4I3I A;  1VEU A;  3L27 A;  1P3K A;  1TD5 A;  1EI5 A;  5B40 A;  2H0Y A;  4Q0I A;  3EOI A;  1LSW A;  4LRZ E;  4X6T A;  3ZQ5 A;  5HX9 A;  2GNX A;  3ITB A;  4R4S A;  5IU1 A;  3G2Z A;  3BFF A;  2M7U A;  3LO7 A;  4ZJ3 A;  5GHX A;  4ID4 A;  2ZY3 A;  4L0L A;  4WLA A;  4ZBE A;  3N8L A;  3B6G C;  1PI4 A;  3AZG C;  3BYD A;  4ETZ A;  3T4Q A;  5FAO A;  4S2P A;  5B1M B;  4LD9 A;  4R8P A;  2KOI A;  4ARZ B;  2DF4 C;  5JA4 A;  5EVI C;  3BFG A;  4AFI A;  4QLC B;  1GA0 A;  3B6F B;  3H7W B;  4R3J A;  5I5L A;  1GSV A;  3ZDJ A;  2ZL1 B;  5EE8 A;  1IYP A;  3G31 A;  4LV3 A;  4HQA A;  4DRB A;  4IJE A;  4EU0 A;  1ERO A;  3LR5 A;  2WKP A;  1ULY A;  1KE3 A;  3EGD C;  5EVL A;  4B93 A;  2CWE A;  2FZ0 A;  3IWO A;  4NXF A;  3MVD B;  2ZMA A;  1TVF A;  2E8I A;  2BG1 A;  3K2N A;  5IT5 A;  1XJ4 A;  2WK0 A;  3QHY A;  3MZE A;  5GLD A;  3W99 C;  3B42 A;  1IKG A;  3REJ B;  3REK A;  3Q7Z A;  1OTE A;  4ETX A;  1OPX A;  1FSY A;  2J9P A;  2O9B A;  3MKE A;  2PU2 A;  3IP4 C;  4OH0 A;  2Y2N A;  4II7 A;  2GZA A;  1ID3 B;  3X1S B;  1W2E A;  2L1M A;  3X1U B;  3VH6 T;  1DJC A;  4H9P A;  5F6A A;  5EPH A;  1P3A B;  1MBL A;  4KHA B;  4L9F A;  3L7H A;  4X23 C;  4MEZ A;  2IWB A;  1KX5 B;  3TOI A;  5GLB A;  4GCZ A;  2Y59 A;  3MF0 A;  3MGS B;  1YU2 A;  1P3F B;  3AZI A;  4Z2K A;  5BOH A;  3AV1 B;  4YS3 A;  4EQ1 A;  1W1P A;  5DNN B;  4CLC C;  3G34 A;  4MMN A;  3UTA B;  1G68 A;  1KE4 A;  3PAG A;  4OJP A;  4DE2 A;  1MZU A;  3KUY D;  2NQB A;  4B88 A;  4NZ1 A;  1P3B C;  2G5H C;  4OPQ A;  3H82 B;  3C1C C;  4RVA A;  4XT2 B;  5GSU B;  4KUD C;  1K57 A;  2KX6 A;  1ED7 A;  3NIA A;  3O5Y A;  5B40 C;  1BLP A;  4H9O A;  4CSR A;  1TDG A;  5AV6 B;  1BH8 A;  1WE4 A;  1FCO A;  1F9I A;  3UN7 A;  3C38 A;  3M2K A;  3B0C T;  5TGF A;  2ZC3 B;  4JGR A;  3HBR A;  4R23 A;  4EUV A;  5CPK B;  3OPL A;  3QNC A;  3IS2 B;  3F6T A;  1GHI A;  2WAF A;  4YOF A;  3CPT B;  4I38 A;  4X69 A;  1CI9 A;  4OPY A;  4JXS A;  3MGR C;  5B31 G;  4YM6 C;  5B1M D;  5B31 B;  4WV4 B;  4NK3 A;  4RX3 A;  1UWP X;  4QLC D;  4E3M A;  3B6F D;  3G32 A;  1NJ4 A;  1FQG A;  3S4X A;  2EWW A;  2GX5 A;  5FUG A;  3NOP C;  2Y2K A;  3ZG9 B;  4E45 A;  2PR5 A;  1DJB A;  3BQ8 A;  2HJ9 C;  2QKP A;  5J7E A;  4NY2 A;  1ZHH B;  2K7S A;  1E6P A;  3KYZ A;  5DJT A;  3DWZ A;  3OOV A;  3DW0 A;  3MVD D;  4X1M A;  1DJA A;  2ZY2 A;  3X1T B;  2XK1 A;  4H8R A;  5A91 A;  1P3M A;  3WA9 A;  2Y4A A;  5TBM B;  3EPL A;  2F8N A;  4NYY A;  2ACG A;  4HJ4 A;  5DF8 A;  3REJ D;  3WKJ A;  2PYO A;  5G4Y A;  5JYP A;  3SH9 A;  4FTX A;  3X1V A;  5BPV A;  4UUZ A;  2JKR I;  1M1A B;  4GZB A;  4JJN B;  3L2A A;  1VM1 A;  1F2K A;  1ID3 D;  3X1S D;  4KZ8 A;  1MKM A;  3UT9 A;  5JRG A;  3NDG A;  4LFU A;  3X1U D;  3LIE A;  2OV5 A;  1J3W A;  3HL9 A;  1P3A D;  3GTC A;  5AV9 B;  4O01 A;  3TRC A;  3WD0 A;  1XGJ A;  2LB5 A;  1KX5 D;  3LCE A;  3E4P A;  1S32 B;  1W7F A;  1GA9 A;  2BYK B;  1H8P A;  3MGS D;  2A49 A;  1K54 A;  1P3F D;  1PWG A;  2BTF P;  4ZUX B;  1TZY A;  2XF3 A;  5CGS A;  3AV1 D;  2EX6 A;  2V5O A;  2B5R A;  3L9K A;  5DNN D;  1KX4 A;  5AY8 C;  5CED A;  3UTA D;  4DDY A;  2YFW A;  5B0Z C;  3S7P A;  3LEL C;  4WZ5 A;  4PM5 A;  4J8U A;  3V3R A;  4UQI M;  2QZ6 A;  1KS0 A;  2G2W A;  5BNV A;  3KYE A;  3P5J B;  3UTB C;  4J8W B;  3HCY A;  5F69 A;  5GSU D;  2PDR A;  1DP9 A;  5CHJ A;  1DRM A;  4PM9 A;  2OWJ A;  1ESU A;  1S0W A;  3SH7 A;  3E4Q A;  5AV6 D;  4B4X A;  2WZZ A;  3AV2 B;  1YU4 A;  4P0M A;  4WYY A;  2W1R A;  5B0Y B;  3B0D C;  4G92 B;  4UEY A;  3UNW A;  3QP5 A;  4EET B;  4Q8I A;  2JHE A;  5AVC B;  1FR6 A;  3IBR A;  5CPK D;  3GRJ A;  1VET A;  2Y2L A;  3T50 A;  3VOZ A;  2XDM A;  3Q7V B;  1ZLA A;  3CAX A;  4ESP A;  3QP2 A;  1P3O A;  2JKR M;  3P09 A;  4MB4 A;  3H0L C;  5B31 D;  2QMI A;  1L0G A;  4B4Z A;  4OQG A;  5G49 B;  4WU9 B;  2VGL M;  5HPI A;  4JF4 A;  3AZF B;  1XP4 A;  3EQU A;  2V1B A;  2D49 A;  2IWC A;  5M1A A;  3VMA A;  4GD8 A;  4XUJ A;  4H9Q A;  3D72 A;  4K91 A;  5AV8 A;  3AZN A;  4DRA A;  3LJA B;  3OPH A;  4E3O A;  5FI2 A;  1M19 A;  3VH6 A;  3BJN A;  3X1T D;  1V9Z A;  3ITA A;  4I3A A;  4N1H A;  4Y3I A;  3LZ0 B;  3AL0 C;  2B18 A;  2HP9 A;  2O0Y A;  4R6L A;  3O62 B;  1N4O A;  4FH4 A;  4DQY B;  1P34 B;  3WKJ C;  3M2J A;  5CP6 B;  4KGC A;  1YLT A;  3WAA A;  1U35 B;  3AZL A;  4DDS A;  1M1A D;  2G5I C;  4JJN D;  5L09 A;  2V2F F;  5JRG C;  3UT9 C;  4GH9 A;  1ACF A;  1N9L A;  3C7V A;  1CQA A;  4PMA A;  4UHU A;  5DNM B;  3VP2 A;  3AYW B;  3AN2 B;  5HDS A;  1TAF B;  2OAP 1;  4HEF A;  3GR2 A;  1VEU B;  4P87 A;  5AV9 D;  1CI8 A;  1P3K B;  3IX4 A;  1XJ3 A;  5HDC A;  3ZVT A;  3MNN A;  1AOI A;  1S32 D;  3MMH A;  1YKD A;  1TEM A;  2XEP A;  2ARO A;  1L3L A;  2Y2Q A;  4XZQ A;  1TZY C;  3HUM A;  3MGP B;  4ZUX D;  4GJ4 A;  1KX3 A;  3S7N A;  2QJ5 A;  1A0K A;  2HZ5 A;  4Q0H A;  4WU8 B;  3LZ1 A;  1LL5 A;  5B1L B;  1J7M A;  5E2F A;  4OJO A;  1PRQ A;  3TU4 A;  4WZ5 C;  4J8U C;  1LSV A;  4OPR A;  1O6I A;  1L0E A;  3EEA A;  2XFT A;  3ZG8 B;  3W97 A;  3NBL A;  2Y2M A;  4OQI A;  3LR3 A;  3KUY C;  1XJ2 A;  3G35 A;  4UQI S;  4J8W D;  3R45 B;  3OBF A;  3UPO A;  3F1N B;  5B24 B;  2CMN A;  2WGI A;  4IUH A;  3G6O A;  3IX8 A;  3AV2 D;  1DP6 A;  3ZFZ A;  5B0Y D;  1HQ3 B;  2W3G A;  4J8V A;  1L0F A;  5HPF A;  5AVC D;  4WMC D;  3IF6 C;  4WL9 A;  5HZH A;  2HV1 A;  3PBS A;  1ZLA C;  1PW8 A;  4H9N A;  1FCN A;  1P3G A;  3R7W B;  4OUI A;  4GHA A;  5B33 A;  2PRF A;  2ZC6 B;  1DP8 A;  2ZC7 A;  3BWL A;  1OTI A;  5EM1 A;  3RFB A;  4M4X A;  4Z2M H;  5GT0 A;  3REL B;  4P6Z M;  4ZBJ B;  1Z6F A;  4MN6 A;  4DMZ A;  4FH2 A;  4WU9 D;  1PIO A;  3T4S A;  3AZF D;  1S4S A;  1PZO A;  4FCF A;  1IEM A;  3S22 A;  3UE0 A;  3WRZ A;  2Y55 A;  1W79 A;  3M7P A;  2VGL S;  3AZN C;  3AZE A;  5GLC A;  1HTZ A;  3LJA D;  3FZC A;  1KU5 A;  3MGQ A;  2ZQ7 A;  4WEJ A;  4BBU A;  3B47 A;  1YLY A;  4F3L B;  5EFW A;  2ZQ9 A;  1LL8 A;  1SCW A;  3LZ0 D;  3MVD C;  3A3F A;  5HAP A;  3O62 D;  1OGG A;  4CPK A;  3L25 A;  1P34 D;  5MC7 A;  4CJN A;  5CP6 D;  3AZM A;  1PWC A;  2QWS A;  3N6I A;  5AQA A;  2VV6 A;  1U35 D;  3WX7 A;  2FJ7 B;  1KDS A;  1MY8 A;  1SDE A;  3CHW P;  5FDS A;  4RA7 A;  2D02 A;  5DNM D;  4Q0J A;  4O0P A;  1GCE A;  4UPK A;  2UV0 E;  3AYW D;  3AN2 D;  1U60 A;  3EEH A;  1P3K D;  3MNN C;  1L2S A;  4HBU A;  1YAX A;  2NUP C;  1LHY A;  5DFY A;  3IQA A;  3NJA A;  2ARO C;  3B6G A;  3AZG A;  5CPI C;  3BW6 A;  3G4P A;  5AJG A;  2Y2P A;  5AVB A;  3V9R B;  1BH9 B;  3REI B;  1KX3 C;  3IXB A;  3HJK A;  5A93 A;  5A90 A;  3MGS C;  1P3F C;  3WD2 A;  4LLO B;  4IVI A;  5A8B A;  4WU8 D;  3TU4 C;  5B1L D;  4EES A;  4EO5 B;  4DJ3 A;  4R8P D;  4X53 A;  1P3I A;  5BO0 B;  2W3H A;  3WD1 A;  3UTA C;  1OGB A;  5CHU A;  3MQQ A;  1H3O A;  3BFD A;  1ZC2 A;  2DNS A;  4FD8 A;  3UO9 A;  1AXB A;  1M6K A;  5DJU A;  4EW7 A;  5B24 D;  1TS8 A;  3W99 A;  3G30 A;  3KXB A;  4R3B A;  4RYE A;  1HQ3 D;  4OON A;  4AWL B;  3W98 B;  2VX8 A;  3NCK A;  2HIO A;  2HP6 A;  3A6N B;  3AFA B;  4GDB A;  1YT4 A;  5AVF A;  5CPK C;  5B33 C;  3X1V B;  2VV7 A;  2ZQD A;  4KZ7 A;  1F66 B;  5HL6 A;  1K4E A;  2Q9M A;  3REL D;  4NXE A;  5EOO A;  4X23 A;  3OPR A;  2A3U A;  5B31 C;  5HAR A;  3KWQ B;  4QY6 A;  2L4R A;  3PBT A;  1ES3 A;  1X0O A;  1CF0 A;  2W3E A;  1K0K A;  2BYM A;  5J3W A;  1FIK A;  3MGQ C;  3REH C;  1S66 L;  5GT3 B;  5E5A B;  4FSF A;  1T19 A;  1D7E A;  5B2I B;  4KG6 A;  4CLC A;  3IWQ A;  4LRX C;  1Q2Q A;  5KDM B;  4NEE D;  3X1T C;  3F1P A;  4R70 A;  4J8X B;  1KX4 B;  4LGW A;  1LSX A;  2ZMF A;  1SKO A;  3C1C A;  3SS3 A;  2YFW B;  2JKT I;  4G3W A;  4A5R A;  4KUD A;  3C4P A;  4P6B A;  3AZJ B;  2FJ7 D;  1YM1 A;  2PD7 A;  1W1V A;  2H5S A;  4IBE A;  4JKT A;  1M18 C;  3UB7 A;  4JF6 A;  4DF6 A;  1G6O A;  2M1C A;  4NXB A;  3Q07 A;  5F99 C;  4Y0T A;  3M6H A;  4H9S A;  4HGA C;  2OOL A;  3E0Y A;  3NY4 A;  3GQZ A;  3OCN A;  4QPR A;  5AV9 C;  3E98 A;  1P3P B;  1CEG A;  3FDD A;  2V0W A;  5AVB C;  3MGR A;  4YM6 A;  5GXQ B;  1VET B;  3REI D;  4Z5T B;  4DXC A;  2W1T A;  3JPU A;  3QP8 A;  1UR8 A;  1KVL A;  5CRF A;  1P9W A;  4OPZ A;  5KZH A;  1K56 A;  4MCW A;  3GDI A;  3N4I A;  1P3I C;  4JPM A;  2PYP A;  5J8X A;  4IJF A;  3IBJ A;  3E2L A;  4PKY G;  4HHD A;  4Y17 A;  3T1Q B;  4DE0 A;  1XGI A;  4H6J B;  3UY6 A;  3NQU A;  3CWF A;  1E3U D;  2F8N H;  2WKI A;  3A0V A;  5HWT A;  2Y2H A;  4XUJ B;  4NZ3 A;  1H5X A;  4GS9 B;  2Z6C A;  1I2W A;  1H8Y A;  2WZX A;  3KXB C;  3BFC A;  5DTT A;  1TDL A;  3RTY A;  2P74 A;  1NXY A;  2KLI A;  1F5M A;  3ZNY A;  2JE5 A;  3W98 D;  4IBK A;  2G2U A;  2HIO C;  5B0Y C;  1XKZ A;  1Q9C A;  3A6N D;  3AFA D;  1VHM A;  5AVC C;  2YFV A;  3X1V D;  4PM6 A;  5CTN A;  2W27 A;  2JKT M;  5FAT A;  4BBV A;  2A24 B;  2NZD B;  3WS0 A;  1F66 D;  3TG9 A;  3Q81 A;  3HLG A;  4E6X A;  3NC8 A;  3ZYT A;  4OKP A;  3KWQ D;  1EWZ A;  2PD8 A;  4WU9 C;  2WYX A;  4GHI A;  1W63 M;  1AOI B;  5GLA A;  5GT3 D;  1YLP A;  5E5A D;  2R9X A;  1AIW A;  5B2I D;  3LJA C;  5AY8 A;  1YMX A;  3KSG A;  5B0Z A;  3WS4 A;  3KSY A;  3W96 B;  2W3F A;  3LEL A;  3KSH A;  3LID A;  1PZP A;  4J8X D;  1KX4 D;  2XGN A;  3T4O A;  1ERM A;  1K25 A;  1LI9 A;  3UTB A;  1P34 C;  1F1E A;  1MWR A;  2DQN C;  5CP6 C;  3AZJ D;  3LI9 A;  3EGX C;  1U35 C;  2P08 A;  4Z66 A;  5HDD A;  1YUE A;  1BT5 A;  1HZO A;  2OWH A;  2V1A A;  4MDZ A;  5FQM A;  2VK3 A;  4H9S C;  5DNM C;  2H28 A;  3HUN A;  3NQJ B;  3OZH A;  3MR0 A;  3PBN A;  3ZGA B;  3HRE A;  4BEN A;  1CEF A;  1BUE A;  5BT1 D;  3AGD A;  2IO5 C;  1EQZ B;  3RH8 B;  5AV5 B;  4L9G A;  1P3P D;  2KDK A;  4GLQ A;  5TJJ A;  2UWX A;  4BQM A;  5L8M A;  5GXQ D;  3FV7 A;  4HNB A;  2MJ6 A;  4KZ9 A;  4WEL A;  4Z5T D;  3G2Y A;  3UE1 A;  2Y2O A;  3VFF A;  3MGP C;  4KZ4 A;  4CAY B;  2HUE B;  2P9V B;  2RL3 A;  1QO6 A;  3IH9 A;  4G91 C;  1N9N A;  5GT0 B;  5CPJ B;  5FQK A;  3SZT A;  1E88 A;  4WU8 C;  2DMW A;  3MXQ A;  3ZVW A;  2B95 A;  4XUJ D;  3AZE B;  1NLZ A;  3U2A A;  2JBF A;  3BY8 A;  1D06 A;  3D9Y A;  1P3L B;  5FL3 A;  3IX3 A;  3S7Q A;  4KG2 A;  3ISG A;  5B2J B;  4HME A;  3UE3 A;  2J7V A;  3IF5 A;  4EUZ A;  3HLB A;  4H9R B;  2E8J A;  4WNN B;  2HDR A;  2J3T D;  5B32 C;  5CGX A;  5B24 C;  3A0R A;  3DBA A;  1LL9 A;  1I5Q A;  4MN7 A;  1PDC A;  3DTI A;  1WYC A;  2RVQ C;  1EW0 A;  3O3V A;  3ULF A;  5DF9 A;  4NYU A;  2NZD D;  2PU4 A;  2VLG A;  3P01 A;  2Z6D A;  5FQQ A;  4Z2H A;  2WAE A;  1ES5 A;  4NE6 A;  4OOM A;  3REL C;  1P0Z A;  4HIA A;  3PTE A;  4KZ6 A;  1S4R A;  4LCM A;  4Y5F A;  3SS4 A;  1AOI D;  3B6G B;  2WKH A;  3MQ0 A;  1BLS A;  4Y15 A;  3W4P A;  5GHY A;  3AZK B;  4C6Y A;  2NUT C;  3M6B A;  3V67 A;  5EVI B;  1ONG A;  3W96 D;  4DXB A;  2W8S A;  5HL1 A;  4R4R A;  3VP1 A;  4Z2I A;  3WTP B;  3KUY A;  1B67 A;  3CMZ A;  5BNX B;  3C5A A;  3EWK A;  3C1B C;  2RTS A;  4G3K A;  4IJG A;  4Z66 C;  2LY8 A;  4QY5 A;  4JGP A;  1H3O B;  3LIB A;  4KUK A;  2FJ7 C;  1OTA A;  3T1R A;  3BY9 A;  1JFI A;  3DWK A;  1ERQ A;  3Q1F A;  5JYO A;  2XRN A;  3IF6 A;  1NLY A;  3FPW A;  4JGO A;  2P7J A;  4S2N C;  1ESI A;  1EQZ D;  1JWP A;  5AV5 D;  1ODV A;  2PBY A;  2WGW B;  3AZH B;  1RGZ A;  2EFU A;  2AVX A;  3VE3 A;  1H8Z A;  3VFH A;  1PWD A;  3UE6 A;  5B1M A;  3CG5 A;  4ARZ A;  3UPP A;  3SW1 A;  4QLC A;  1XFN A;  5GT0 D;  3P7N A;  3B6F A;  5CPJ D;  2Z2L B;  3FKE A;  3H7W A;  3RXX A;  2ZL1 A;  4I5S A;  4BD0 A;  2CV5 B;  1S1Y A;  4Z2M G;  4EO5 C;  4ZAM A;  3DTK A;  3OC2 A;  3WS2 A;  3T1S A;  3AZE D;  4DJ2 A;  1P3L D;  4BL3 A;  4WJ3 C;  3AGF A;  3MVD A;  5AQ9 A;  5B2J D;  4IVK A;  4NKP A;  3LIF A;  4IBB A;  3K3C A;  3UB9 A;  3KX0 X;  1OT6 A;  4NG2 A;  3CZD A;  3REJ A;  3SOI A;  1OTD A;  1P3B B;  4E3L A;  3KFU G;  4K08 A;  4HJ3 A;  3LUQ A;  3W98 C;  1SKO B;  3TJZ C;  1ID3 A;  3A6N C;  4OLG A;  3X1S A;  3WWX A;  4KZA A;  5CX7 A;  5B40 B;  3X1U A;  2JCH A;  1IKI A;  4R1G A;  3GV9 A;  4CQH A;  1P3A A;  1F66 C;  1PZR A;  5EEC A;  2HGV A;  2XFS A;  5CPI A;  1K6S A;  1VQQ A;  2WGV A;  3BRM A;  1Z2C B;  2L0W A;  3AGE A;  2J8P A;  3KWQ C;  3MGS A;  1P3F A;  1XX2 A;  3B6G D;  4LD9 B;  4R8P B;  3AZK D;  2PAV P;  4P85 A;  5JA4 B;  1MKI A;  1WYB A;  5GT3 C;  2XQZ A;  4BWI A;  5E5A C;  5EVI D;  2Q0O A;  1BSG A;  4U0T A;  2I72 A;  2W1T B;  4Y0O A;  5J4E A;  1O07 A;  3UTA A;  3F1O A;  1JWZ A;  3LIA A;  3T4J A;  3WTP D;  1SZV A;  3KS8 A;  4BLM A;  1CK7 A;  4J8X C;  2B02 A;  4MN5 A;  5FI7 A;  1L6J A;  2ZBB A;  3FG8 A;  3QNB A;  3ZHH A;  3AZJ C;  2HDU A;  4PHT A;  1TS0 A;  3NOU C;  1GHP A;  5AQB A;  3A3I A;  1D1J A;  5AV6 A;  1Y28 A;  5EUA A;  4Z2G A;  1OJ5 A;  1TS6 A;  1CK3 A;  3REK B;  5CER A;  4ZRR A;  2ZM0 A;  4IBG A;  5CPK A;  1LLB A;  2C6W B;  5CXW A;  3CPT A;  1BLC A;  1GHM A;  3LGO A;  2ZY5 A;  5HFO A;  3AZH D;  5BT1 C;  5M19 A;  1P3P C;  4Y2F A;  4DKI A;  4H9P B;  3H0M C;  5B1M C;  3VH5 W;  2ZQA A;  5F83 A;  2WKQ A;  5GXQ C;  3S1Y A;  5B31 A;  4QLC C;  2FFF B;  4Z5T C;  3U4L P;  3B6F C;  3PBR A;  4HI4 A;  3NUL A;  4X56 A;  2CV5 D;  3REH A;  1EAK A;  2P04 A;  5KIZ A;  1Q2P A;  3AZI B;  2WUQ A;  3E4O A;  2J3W A;  4UA9 A;  4YS3 B;  2DRW A;  3C8C A;  2OLU A;  2V1Z A;  3X1T A;  4UA7 A;  3K3D A;  3ZG7 B;  3LR0 A;  4NET A;  4KQR A;  2NQB B;  3REJ C;  1YMS A;  5TBM A;  1P3B D;  4Z9Q A;  3UDF A;  2YKH A;  1M1A A;  1M18 A;  1ID3 C;  3UTB B;  3X1S C;  2QHK A;  3ZCZ A;  3DTE A;  3OPP A;  4HY8 A;  4XUZ A;  3X1U C;  4H9O B;  1MC0 A;  5F99 A;  4CSR B;  4E44 A;  5B40 D;  1BH8 B;  1P3A C;  2VGJ A;  2NZD C;  4OOL A;  3B0D B;  5AV9 A;  2OSU A;  4JXV A;  1KX5 C;  4K0W A;  1JNU A;  1GSW A;  3JVV A;  4S2K A;  1S32 A;  4KQO A;  2BYK A;  4IBD A;  3UB6 A;  1W1T A;  4Y0U A;  1S6R A;  2VZW A;  3AV1 C;  4ZUX A;  4LD9 D;  2Y91 A;  3ZG5 A;  5DNN C;  5E2G A;  4E6W A;  4U0X A;  1JVJ A;  2IA2 A;  4C3Q A;  5FEG A;  2PR6 A;  1YU3 A;  4WM9 A;  1K56 D;  4OP5 A;  1UWN X;  5HWV A;  5FUG B;  2EWV A;  5FA7 A;  1JTD A;  4HES A;  5GL9 A;  1K6R A;  3LEQ A;  1IYS A;  3FWL A;  4O7D A;  1GXD A;  1KVM A;  2PYR A;  3P98 A;  5GSU C;  5F1F A;  4J8W A;  5A92 A;  5I94 A;  4KQD A;  3WS1 A;  1P3M B;  3WA9 B;  2VQR A;  3W4Q A;  5AV6 C;  2F8N G;  3A0S A;  3AV2 A;  2F8N B;  4WN5 A;  5B0Y A;  1XJ6 A;  2G7U A;  4LCL A;  4MBF A;  4ZJ1 A;  2WKR A;  3REK D;  3WKJ B;  2PYO B;  5AVC A;  4UUZ B;  5FAP A;  3D4F A;  1H0M A;  1T1A A;  2QYB A;  4O8G A;  3Q7V A;  1EQZ C;  5AV5 C;  5JRG B;  3UT9 B;  3FKW A;  4BD1 A;  3N8R A;  4JF5 A;  3SS5 A;  3S7O A;  1P97 A;  5DTK A;  5G49 A;  4WU9 A;  4IBC A;  3AZF A;  2J80 A;  1JTG A;  2HUE C;  4MB5 A;  4ZJ2 A;  1OTB A;  2QJ7 A;  4DRT A;  3TE8 A;  3AZI D;  2HF6 A;  3LJA A;  1E25 A;  1OME A;  1TZY B;  3CUE A;  4IHQ A;  3RXW A;  4YS3 D;  5KSH A;  3D3O A;  2K2N A;  1UR9 A;  5E2H A;  3LZ0 A;  3W2Z A;  2WAD A;  5B2J C;  5D3O A;  1AWI A;  4DN0 A;  2EXA A;  3WRT A;  5KSC A;  4J8U B;  1P34 A;  2NQB D;  1BUL A;  5CP6 A;  3EPH A;  1KGE A;  5HD5 A;  5BNV B;  4Z2L A;  1U35 A;  1M1A C;  4PM7 A;  4JJN C;  1KGG A;  3UTB D;  2J8Y A;  3CLO A;  1H0G A;  4IBI A;  3VSK A;  1YU1 A;  5DNM A;  2V20 A;  1XPB A;  3AYW A;  3AN2 A;  1FR1 A;  1TAF A;  4MNR A;  4E3K A;  2CC1 A;  5FDH A;  1W1Y A;  4WUJ A;  1JFI B;  4IBF A;  3VH5 T;  1NZU A;  3ZNT A;  2XH9 A;  1KE0 A;  1S32 C;  4E3I A;  3LFV A;  3L29 A;  3IF6 B;  1UGU A;  2WKE A;  1ZLA B;  5FQJ A;  3T4L A;  5TR7 A;  2XA7 M;  2ZQC A;  2JSS A;  2Y2G A;  1P3O B;  1T3U A;  4ZUX C;  3MGP A;  1YSP A;  3RJU A;  3QP6 A;  3MQL A;  3PR6 A;  4GW9 A;  1OJG A;  4EBP A;  1FIL A;  5TFQ A;  4WU8 A;  4YIN A;  5B1L A;  3AZK C;  5K5B A;  1NYY A;  5CGW A;  4NZ4 A;  4K0X A;  4EER A;  3LR4 A;  2HJE A;  4H9Q B;  3BQA A;  1FSW A;  4KZ3 A;  2XD1 A;  5AV8 B;  3AZN B;  2V9A A;  5C5K A;  2H0T A;  1WWS A;  2XD5 A;  3WTP C;  1QME A;  1SKF A;  2XRO A;  2GJ3 A;  1HLU P;  1M19 B;  1A7W A;  4J8W C;  1RGY A;  4CLC E;  4JXW A;  3R45 A;  4WZS B;  1NY0 A;  4XUX A;  1MPL A;  1P3M D;  3WA9 D;  4LG2 A;  3F1N A;  5B32 A;  5B24 A;  1PNE A;  3AV2 C;  1ES4 A;  3UMD A;  4G92 C;  3C7U A;  4HMD A;  2F8N D;  1T18 A;  3MJQ A;  1HQ3 A;  4KGC B;  3WKJ D;  2PYO D;  3FPV A;  3WAA B;  1B6W A;  3E2K A;  3AZL B;  3IXD A;  3B0B A;  1KDW A;  3PXP A;  1NRF A;  1IYO A;  1ZG6 A;  1PYY A;  3R7W A;  2A2L A;  1BYW A;  2IWD A;  5JRG D;  3UT9 D;  4NZ5 A;  3N8S A;  3A3D A;  5F1G A;  3AZH C;  4GD6 A;  4ZTK A;  3IHB A;  3REL A;  3EPJ A;  4IED A;  4B9O A;  3AZF C;  2VV8 A;  2Y2I A;  3MNN B;  2OAQ 1;  1E6R A;  4YWZ A;  2F8N K;  4EEU A;  1ZTU A;  3L28 A;  2ZM8 A;  2ARO B;  1H3Q A;  1YPR A;  5CPI B;  1TF1 A;  4XZQ B;  3KYQ A;  3CUE C;  2CV5 C;  1TS7 A;  4KEN B;  3HLW A;  1TZY D;  3LEZ A;  1KX3 B;  5CEC A;  4KUO A;  4F3L A;  3HLC A;  3LZ0 C;  3LZ1 B;  3MZD A;  1NRJ A;  5EVE A;  3UDI A;  4IBR A;  3O62 C;  3TU4 B;  1IEL A;  3JVU A;  5C3I B;  2C5W B;  4J8U D;  5HAQ A;  3C1B A;  5FSR A;  5HAI A;  4EWF A;  3W97 B;  3F1O B;  5EM0 A;  5M18 A;  4LPZ A;  2ZM2 A;  2FJ7 A;  4X55 A;  4YFM A;  4DE3 A;  2ZD8 A;  4IUK A;  2ZM5 A;  3AYW C;  3AN2 C;  3NEC A;  2X01 A;  4I39 A;  1YQS A;  3MQO A;  4LRY C;  4J8V B;  4LEN A;  5GHZ A;  1P3K C;  1FCM A;  1YLJ A;  3NHQ A;  4S2N A;  4JXG A;  3BLM A;  3HJI A;  4GKU A;  1KGF A;  2BAS A;  3CJM A;  1RCJ A;  4H9N B;  3O87 A;  1P3G B;  1ZLA D;  4GHL A;  2ZQ8 A;  3IWI A;  3BM6 A;  1JWV A;  5B33 B;  4S2O A;  1P3O D;  3V9R A;  1BH9 A;  3REI A;  3MZF A;  5CTM A;  4EEP A;  4IBX A;  1P9R A;  3A1I A;  2XA7 S;  1V9Y A;  3LYX A;  2O9A A;  5B1L C;  4LD9 C;  4R8P C;  3V39 A;  3HLD A;  3V50 A;  2HP5 A;  3MXR A;  1SHV A;  2VA0 A;  5BO0 A;  2ZY4 A;  5AV8 D;  3AZN D;  4N9L A;  3TSG A;  3GEC A;  2ZC4 B;  5L2F A;  2J9O A;  3FYZ A;  3MGQ B;  3REH B;  1E3U A;  2Q9N A;  1M19 D;  4NXG A;  3IT9 A;  3O86 A;  1BFM A;  1HQ3 C;  3AZM B;  4KGC D;  3FKV A;  4Y7P A;  3MBZ A;  3HLF A;  3W98 A;  3WAA D;  3AZL D;  4X1L A;  4QNL A;  4HMC A;  3REK C;  1K38 A;  1G28 A;  3A6N A;  3AFA A;  3OLO A;  3T4K A;  3VOY A;  3O88 A;  3DAV A;  1M18 B;  3V5M A;  1F66 A;  5DKL A;  4ZBJ C;  4S2I A;  3CIT A;  1Y4O A;  1CXW A;  2ZLY A;  3PBQ A;  5F99 B;  4HGA B;  1DY6 A;  1T1B A;  3MNN D;  2QPN A;  3HVF A;  3IHA A;  5G18 A;  4QB8 A;  4N1X A;  3KWQ A;  4E04 A;  1S67 L;  3AZG B;  1NYM A;  3OCL A;  2ARO D;  4KZ5 A;  3VV4 A;  1N1J A;  5CPI D;  5AVB B;  4XZQ D;  4X25 A;  1GSX A;  5GT3 A;  1M40 A;  1KX3 D;  5E5A A;  3AZI C;  5B2I A;  2LB9 A;  3UME A;  3LZ1 D;  4YS3 C;  1ALQ A;  3TU4 D;  4ME4 A;  3VH5 A;  5KDM A;  1P3I B;  1S1Z A;  1BZA A;  2H10 A;  4MB3 A;  4MBH A;  4J8X A;  1MWS A;  1LT0 A;  3W97 D;  2HDQ A;  2ZOH A;  4S2J A;  4RQ9 A;  2NQB C;  2FN2 A;  5F68 A;  1K55 A;  3AZJ A;  3PAE A;  1WWI A;  1W8Q A;  2W0N A;  4NFT A;  4OVD A;  1ZKJ A;  2X71 A;  3W99 B;  5FAS A;  3KXB B;  1K57 C;  1ZG4 A;  3DTM A;  4S2M A;  4QD4 A;  5CHM A;  3JYI A;  4J8V D;  3UB5 P;  4EBN A;  3IXG A;  4M3K A;  4HP9 A;  3H9W A;  3A1K A;  2ZJ9 A;  2HIO B;  2VJW A;  3QP1 A;  2RCX A;  5EV0 A;  4RX2 A;  1P3P A;  3GMW A;  3UB8 A;  1P3G D;  4I3J A;  4E3N A;  3PHY A;  4NE5 A;  4D60 A;  3MFX A;  5B33 D;  3REI C;  3HUO A;  5GXQ A;  4MLL A;  4Z5T A;  3MFD A;  1C3B A;  1W5D A;  4X23 B;  1I2S A;  4R38 A;  4HH2 A;  2GDN A;  1PI5 A;  4Z1W A;  2ZOI A;  5F82 A;  5CEB A;  3HON A;  2BYM B;  1NZO A;  4H6J A;  4PKY A;  3MGQ D;  3REH D;  1WA9 A;  3A3J A;  1YLZ A;  4R3A A;  4GS9 A;  4N92 A;  4CLC B;  1T1C A;  3CI6 A;  2XSS A;  5HD3 A;  1XFQ A;  3EG5 B;  4PPR A;  1BTL A;  3F1P B;  4UA6 A;  4GNU A;  3T12 B;  4AWL C;  3WA9 C;  2EX8 A;  1P3M C;  3AZM D;  5FQI A;  4FUW A;  3C1C B;  1MXO A;  4WZ4 A;  3VP4 A;  4N9K A;  4OJ5 A;  1PW1 A;  2Y2J A;  4KUD B;  3AFA C;  3T4T A;  2PYO C;  1H0I A;  3LI8 A;  4UAA A;  1QMF A;  4JLF A;  3X1V C;  1HVB A;  4FOF A;  2A24 A;  1M18 D;  2NZD A;  3N7W A;  1VB6 A;  3NI9 A;  5IHV A;  4KHA A;  2XLN A;  5LBR A;  3MS6 A;  1KX5 A;  1PFL A;  3WS5 A;  1SDN A;  4EBL A;  3VSL A;  4QWO A;  5F99 D;  4R0Q A;  4OQH A;  3KSI A;  4QU3 A;  2IO5 B;  4Z2J A;  3AZG D;  3MGR B;  4MBK A;  4YM6 B;  3AV1 A;  5AVB D;  3BFE A; 
#chains in the Genus database with same CATH homology
 2EFX A;  5DNN A;  5CHL B;  5B2I C;  1K54 C;  2EXB A;  1R4V A;  3VP3 A;  4OLD A;  4GOG A;  4OP8 A;  4U3T A;  3W96 A;  3A3E A;  3B3X A;  4D2O A;  4G91 B;  1P3I D;  5BS7 A;  1KX4 C;  3HSH A;  2EX2 A;  3NQU B;  3SH8 A;  1K55 C;  5GSU A;  3C4O A;  4ZDX A;  5DVA A;  3L26 A;  3EPK A;  3W99 D;  3IH8 A;  1MWT A;  3KXB D;  1XA1 A;  3BLS A;  3KS4 A;  3NDE A;  5B32 G;  1BLH A;  5HW3 A;  2JC7 A;  1O7E A;  5B32 B;  3NQJ A;  3ZG0 A;  4LV2 A;  2HIO D;  4OOY A;  1EQZ A;  5AV5 A;  1XA7 A;  2YFV B;  4S2L A;  3LY4 A;  1HTA A;  3UDX A;  5E43 A;  3BEC A;  3MKF A;  4X23 D;  1P3O C;  4NE3 A;  4CAY A;  2P9V A;  4LV1 A;  2X02 A;  5AQ7 A;  5CPJ A;  2Z2M B;  4OQ0 A;  3BEB A;  4XUJ C;  2L5A A;  4OJ6 A;  5AV8 C;  5AY8 B;  1P3L A;  4WBG A;  5B0Z B;  5B2J A;  1M19 C;  4C75 A;  2HPB A;  3LEL B;  3V3S A;  3H0R C;  4KZB A;  4H9R A;  4WNN A;  2OLV A;  3C1C D;  4JJN A;  4F94 A;  4KUD D;  4KGC C;  3GSG A;  3WAA C;  3C1B B;  3AZL C;  4Z66 B;  2XR0 A;  4X68 A;  1IYQ A;  4JBF A;  5U47 A;  2FFY A;  1RP5 A;  1L0D A;  5E2E A;  5EOE A;  4EV4 A;  4QHC A;  3VP0 A;  3VH6 W;  3MGR D;  1G6A A;  1AOI C;  4YM6 D;  4PM8 A;  1E4D A;  4DE1 A;  4XZQ C;  1J9M A;  4BL2 A;  3AZK A;  4XXR A;  3W96 C;  3MGP D;  4GB7 A;  5EVI A;  4WEK A;  5BS7 C;  3LY3 A;  4M6B A;  1YU0 A;  1XXM A;  3LZ1 C;  3GVB A;  5DTS A;  2F2A C;  3WTP A;  3EQV A;  1HD8 A;  4KQQ A;  5C3I C;  4GDN A;  5DF7 A;  5BNX A;  4E3J A;  5FI6 A;  2RIQ A;  1K4F A;  1YLW A;  3W97 C;  5FAQ A;  3W4O A;  4WMC A;  5B32 D;  3MXS A;  1W8Y A;  3UPN A;  4GN2 A;  4LV0 A;  4J8V C;  2VGK A;  2BLS A;  5KMW A;  2RVQ D;  3Q82 A;  2WGW A;  3AZH A;  2IOU A;  3B0C W;  3N3F A;  1P3G C;  1MWU A;  2HDS A;  1N9B A;  5GT0 C;  5CPJ C;  2EX9 A;  2ZC5 B;  2CV5 A;  4KG5 A;  4HBT A;  3AZE C;  1ONH A;  2DCF A;  3I7J A;  1P3L C;  1FOF A;  5AY8 D;  1N1J B;  3O62 A;  3W8K A;  5B0Z D;  1Y54 A;  3LEL D;  4EQI A;  3IXH A;  4QJG A;  4IBJ A;  1ES2 A;  3KUY B;  2R9W A;  1LI0 A;  3PBO A;  3AZM C;  1P3B A;  3WTP E;  3HLE A;  3C1B D;  4BJP A;  4Z66 D;  5FQ9 A;  4OJL A;  3L27 A;  1P3K A;  1EI5 A;  5B40 A;  2H0Y A;  4X6T A;  5HX9 A;  3ITB A;  4R4S A;  3G2Z A;  3BFF A;  3LO7 A;  4ZJ3 A;  5GHX A;  4ID4 A;  2ZY3 A;  4L0L A;  4ZBE A;  3N8L A;  3B6G C;  1PI4 A;  3AZG C;  3BYD A;  5FAO A;  4S2P A;  5B1M B;  4LD9 A;  4R8P A;  2DF4 C;  5JA4 A;  5EVI C;  3BFG A;  4QLC B;  1GA0 A;  3B6F B;  4R3J A;  3ZDJ A;  5EE8 A;  1IYP A;  3G31 A;  4LV3 A;  4DRB A;  4IJE A;  1ERO A;  1ULY A;  1KE3 A;  5EVL A;  2CWE A;  3IWO A;  3MVD B;  2ZMA A;  1TVF A;  2E8I A;  2BG1 A;  2WK0 A;  3QHY A;  3MZE A;  5GLD A;  3W99 C;  1IKG A;  3REJ B;  3REK A;  3Q7Z A;  1FSY A;  2J9P A;  3MKE A;  2PU2 A;  3IP4 C;  4OH0 A;  2Y2N A;  1ID3 B;  3X1S B;  1W2E A;  3X1U B;  3VH6 T;  1DJC A;  4H9P A;  5EPH A;  1P3A B;  1MBL A;  4KHA B;  4X23 C;  4MEZ A;  2IWB A;  1KX5 B;  3TOI A;  5GLB A;  2Y59 A;  3MGS B;  1YU2 A;  1P3F B;  3AZI A;  5BOH A;  3AV1 B;  4YS3 A;  5DNN B;  3G34 A;  3UTA B;  1G68 A;  1KE4 A;  3PAG A;  4OJP A;  4DE2 A;  3KUY D;  2NQB A;  4B88 A;  4NZ1 A;  1P3B C;  2G5H C;  4OPQ A;  3C1C C;  4RVA A;  5GSU B;  4KUD C;  1K57 A;  3NIA A;  5B40 C;  1BLP A;  4H9O A;  4CSR A;  1TDG A;  5AV6 B;  1BH8 A;  1WE4 A;  1FCO A;  3UN7 A;  3M2K A;  3B0C T;  5TGF A;  2ZC3 B;  4R23 A;  3HBR A;  5CPK B;  3OPL A;  3QNC A;  3F6T A;  1GHI A;  2WAF A;  4X69 A;  1CI9 A;  4OPY A;  4JXS A;  3MGR C;  5B31 G;  4YM6 C;  5B1M D;  5B31 B;  4WV4 B;  4NK3 A;  4RX3 A;  4QLC D;  4E3M A;  3B6F D;  3G32 A;  1NJ4 A;  1FQG A;  3S4X A;  5FUG A;  2Y2K A;  3ZG9 B;  4E45 A;  1DJB A;  4NY2 A;  3DWZ A;  3DW0 A;  3MVD D;  1DJA A;  2ZY2 A;  3X1T B;  2XK1 A;  4H8R A;  5A91 A;  1P3M A;  3WA9 A;  2Y4A A;  3EPL A;  2F8N A;  4NYY A;  5DF8 A;  3REJ D;  3WKJ A;  2PYO A;  5JYP A;  3SH9 A;  3X1V A;  5BPV A;  4UUZ A;  1M1A B;  4GZB A;  4JJN B;  3L2A A;  1VM1 A;  1ID3 D;  3X1S D;  4KZ8 A;  3UT9 A;  5JRG A;  3NDG A;  3X1U D;  2OV5 A;  3HL9 A;  1P3A D;  3GTC A;  5AV9 B;  1XGJ A;  1KX5 D;  3LCE A;  1S32 B;  1W7F A;  1GA9 A;  2BYK B;  3MGS D;  2A49 A;  1K54 A;  1P3F D;  1PWG A;  4ZUX B;  1TZY A;  2XF3 A;  5CGS A;  3AV1 D;  2EX6 A;  2B5R A;  5DNN D;  1KX4 A;  5AY8 C;  5CED A;  3UTA D;  4DDY A;  2YFW A;  5B0Z C;  3LEL C;  4WZ5 A;  4PM5 A;  4J8U A;  3V3R A;  2QZ6 A;  2G2W A;  5BNV A;  3P5J B;  3UTB C;  4J8W B;  5GSU D;  5CHJ A;  4PM9 A;  1ESU A;  1S0W A;  3SH7 A;  5AV6 D;  4B4X A;  2WZZ A;  3AV2 B;  1YU4 A;  4P0M A;  4WYY A;  5B0Y B;  3B0D C;  4G92 B;  3UNW A;  4Q8I A;  5AVC B;  1FR6 A;  5CPK D;  3GRJ A;  2Y2L A;  3VOZ A;  2XDM A;  3Q7V B;  1ZLA A;  1P3O A;  3P09 A;  3H0L C;  5B31 D;  2QMI A;  1L0G A;  4B4Z A;  4OQG A;  5G49 B;  4WU9 B;  4JF4 A;  3AZF B;  1XP4 A;  3EQU A;  2IWC A;  5M1A A;  3VMA A;  4GD8 A;  4XUJ A;  4H9Q A;  4K91 A;  5AV8 A;  3AZN A;  4DRA A;  3LJA B;  3OPH A;  4E3O A;  5FI2 A;  1M19 A;  3VH6 A;  3X1T D;  3ITA A;  4N1H A;  3LZ0 B;  3AL0 C;  2HP9 A;  3O62 B;  1N4O A;  4FH4 A;  4DQY B;  1P34 B;  3WKJ C;  3M2J A;  5CP6 B;  4KGC A;  1YLT A;  3WAA A;  1U35 B;  3AZL A;  4DDS A;  1M1A D;  2G5I C;  4JJN D;  2V2F F;  5JRG C;  3UT9 C;  4GH9 A;  3C7V A;  4PMA A;  4UHU A;  3VP2 A;  5DNM B;  3AYW B;  3AN2 B;  1TAF B;  4HEF A;  3GR2 A;  4P87 A;  5AV9 D;  1CI8 A;  1P3K B;  3ZVT A;  3MNN A;  1AOI A;  1S32 D;  1TEM A;  2XEP A;  2ARO A;  2Y2Q A;  4XZQ A;  1TZY C;  3HUM A;  3MGP B;  4ZUX D;  1KX3 A;  4WU8 B;  3LZ1 A;  1LL5 A;  5B1L B;  5E2F A;  4OJO A;  3TU4 A;  4WZ5 C;  4J8U C;  4OPR A;  1L0E A;  2XFT A;  3ZG8 B;  3W97 A;  3NBL A;  2Y2M A;  4OQI A;  3KUY C;  3G35 A;  4J8W D;  3R45 B;  3UPO A;  5B24 B;  2WGI A;  3AV2 D;  3ZFZ A;  5B0Y D;  1HQ3 B;  4J8V A;  1L0F A;  5AVC D;  4WMC D;  3IF6 C;  3PBS A;  1ZLA C;  1PW8 A;  4H9N A;  1FCN A;  1P3G A;  4OUI A;  4GHA A;  5B33 A;  2ZC6 B;  2ZC7 A;  4Z2M H;  5GT0 A;  3REL B;  4ZBJ B;  1Z6F A;  4FH2 A;  4WU9 D;  1PIO A;  3AZF D;  1PZO A;  4FCF A;  1IEM A;  3S22 A;  3UE0 A;  3WRZ A;  2Y55 A;  1W79 A;  3AZN C;  3AZE A;  5GLC A;  1HTZ A;  3LJA D;  3FZC A;  1KU5 A;  3MGQ A;  2ZQ7 A;  4WEJ A;  1YLY A;  2ZQ9 A;  1SCW A;  3LZ0 D;  3MVD C;  3A3F A;  5HAP A;  3O62 D;  4CPK A;  3L25 A;  1P34 D;  4CJN A;  5CP6 D;  3AZM A;  1PWC A;  3N6I A;  5AQA A;  1U35 D;  3WX7 A;  2FJ7 B;  1KDS A;  1MY8 A;  1SDE A;  4RA7 A;  5DNM D;  1GCE A;  4UPK A;  3AYW D;  3AN2 D;  1U60 A;  1P3K D;  3MNN C;  1L2S A;  4HBU A;  1LHY A;  3IQA A;  2ARO C;  3B6G A;  3AZG A;  5CPI C;  3G4P A;  2Y2P A;  5AVB A;  3V9R B;  1BH9 B;  3REI B;  1KX3 C;  3IXB A;  5A93 A;  5A90 A;  3MGS C;  1P3F C;  4IVI A;  4WU8 D;  3TU4 C;  5B1L D;  4EO5 B;  4R8P D;  4X53 A;  1P3I A;  5BO0 B;  3UTA C;  5CHU A;  1H3O A;  3BFD A;  1ZC2 A;  2DNS A;  4FD8 A;  3UO9 A;  1AXB A;  1M6K A;  5B24 D;  3W99 A;  3G30 A;  3KXB A;  4R3B A;  4RYE A;  1HQ3 D;  4OON A;  4AWL B;  3W98 B;  3NCK A;  2HIO A;  2HP6 A;  3A6N B;  3AFA B;  4GDB A;  1YT4 A;  5CPK C;  5B33 C;  3X1V B;  2ZQD A;  4KZ7 A;  1F66 B;  1K4E A;  2Q9M A;  3REL D;  5EOO A;  4X23 A;  3OPR A;  2A3U A;  5B31 C;  5HAR A;  3KWQ B;  4QY6 A;  3PBT A;  1ES3 A;  2BYM A;  3MGQ C;  3REH C;  5GT3 B;  5E5A B;  4FSF A;  5B2I B;  4KG6 A;  3IWQ A;  1Q2Q A;  5KDM B;  3X1T C;  4J8X B;  1KX4 B;  3C1C A;  3SS3 A;  2YFW B;  4A5R A;  4KUD A;  3C4P A;  4P6B A;  3AZJ B;  2FJ7 D;  1YM1 A;  2H5S A;  4IBE A;  4JKT A;  1M18 C;  4JF6 A;  4DF6 A;  3Q07 A;  5F99 C;  4Y0T A;  3M6H A;  4H9S A;  4HGA C;  3NY4 A;  3GQZ A;  3OCN A;  5AV9 C;  1P3P B;  1CEG A;  3FDD A;  5AVB C;  3MGR A;  4YM6 A;  5GXQ B;  3REI D;  4Z5T B;  4DXC A;  1KVL A;  5CRF A;  4OPZ A;  5KZH A;  1K56 A;  3N4I A;  1P3I C;  4JPM A;  5J8X A;  4IJF A;  3E2L A;  4DE0 A;  1XGI A;  3UY6 A;  3NQU A;  1E3U D;  2F8N H;  2WKI A;  2Y2H A;  4XUJ B;  4NZ3 A;  1H5X A;  1I2W A;  1H8Y A;  2WZX A;  3KXB C;  3BFC A;  5DTT A;  1TDL A;  2P74 A;  1NXY A;  3ZNY A;  2JE5 A;  3W98 D;  4IBK A;  2G2U A;  2HIO C;  5B0Y C;  1XKZ A;  1Q9C A;  3A6N D;  3AFA D;  5AVC C;  2YFV A;  3X1V D;  4PM6 A;  5CTN A;  5FAT A;  2NZD B;  3WS0 A;  1F66 D;  3TG9 A;  3Q81 A;  3HLG A;  4E6X A;  3NC8 A;  4OKP A;  3KWQ D;  1EWZ A;  4WU9 C;  2WYX A;  1AOI B;  5GLA A;  5GT3 D;  1YLP A;  5E5A D;  2R9X A;  5B2I D;  3LJA C;  5AY8 A;  1YMX A;  5B0Z A;  3WS4 A;  3KSY A;  3W96 B;  3LEL A;  1PZP A;  4J8X D;  1KX4 D;  2XGN A;  1ERM A;  1K25 A;  1LI9 A;  3UTB A;  1P34 C;  1F1E A;  1MWR A;  2DQN C;  5CP6 C;  3AZJ D;  1U35 C;  4Z66 A;  1YUE A;  1BT5 A;  1HZO A;  5FQM A;  4H9S C;  5DNM C;  3HUN A;  3NQJ B;  3OZH A;  3PBN A;  3ZGA B;  3HRE A;  4BEN A;  1CEF A;  1BUE A;  5BT1 D;  3AGD A;  2IO5 C;  1EQZ B;  5AV5 B;  1P3P D;  2UWX A;  4BQM A;  5GXQ D;  3FV7 A;  4KZ9 A;  4WEL A;  4Z5T D;  3G2Y A;  3UE1 A;  2Y2O A;  3VFF A;  3MGP C;  4KZ4 A;  4CAY B;  2HUE B;  2P9V B;  2RL3 A;  3IH9 A;  4G91 C;  5GT0 B;  5CPJ B;  5FQK A;  4WU8 C;  3ZVW A;  4XUJ D;  3AZE B;  2JBF A;  1P3L B;  4KG2 A;  3ISG A;  5B2J B;  3UE3 A;  2J7V A;  3IF5 A;  4EUZ A;  3HLB A;  4H9R B;  4WNN B;  2HDR A;  5B32 C;  5CGX A;  5B24 C;  1LL9 A;  1I5Q A;  1WYC A;  2RVQ C;  3O3V A;  5DF9 A;  4NYU A;  2NZD D;  2PU4 A;  5FQQ A;  2WAE A;  1ES5 A;  4NE6 A;  4OOM A;  3REL C;  3PTE A;  4KZ6 A;  4LCM A;  3SS4 A;  1AOI D;  3B6G B;  2WKH A;  1BLS A;  3W4P A;  5GHY A;  3AZK B;  4C6Y A;  3M6B A;  5EVI B;  1ONG A;  3W96 D;  4DXB A;  2W8S A;  5HL1 A;  4R4R A;  3VP1 A;  3WTP B;  3KUY A;  1B67 A;  3CMZ A;  5BNX B;  3C5A A;  3C1B C;  4Z66 C;  2LY8 A;  4QY5 A;  1H3O B;  2FJ7 C;  1JFI A;  3DWK A;  1ERQ A;  3Q1F A;  5JYO A;  3IF6 A;  4S2N C;  1ESI A;  1EQZ D;  1JWP A;  5AV5 D;  2PBY A;  2WGW B;  3AZH B;  1RGZ A;  2EFU A;  1H8Z A;  3VFH A;  1PWD A;  5B1M A;  3CG5 A;  3UPP A;  4QLC A;  5GT0 D;  3B6F A;  5CPJ D;  2Z2L B;  3FKE A;  3RXX A;  4BD0 A;  2CV5 B;  4Z2M G;  4EO5 C;  4ZAM A;  3OC2 A;  3WS2 A;  3AZE D;  1P3L D;  4BL3 A;  4WJ3 C;  3AGF A;  3MVD A;  5AQ9 A;  5B2J D;  4IVK A;  4IBB A;  3CZD A;  3REJ A;  3SOI A;  1P3B B;  4E3L A;  3KFU G;  3W98 C;  1ID3 A;  3A6N C;  4OLG A;  3X1S A;  3WWX A;  4KZA A;  5B40 B;  3X1U A;  2JCH A;  1IKI A;  4R1G A;  3GV9 A;  1P3A A;  1F66 C;  1PZR A;  5EEC A;  2XFS A;  5CPI A;  1K6S A;  1VQQ A;  2WGV A;  3BRM A;  1Z2C B;  3AGE A;  2J8P A;  3KWQ C;  3MGS A;  1P3F A;  1XX2 A;  3B6G D;  4LD9 B;  4R8P B;  3AZK D;  4P85 A;  5JA4 B;  1MKI A;  1WYB A;  5GT3 C;  2XQZ A;  5E5A C;  5EVI D;  1BSG A;  4U0T A;  2I72 A;  4Y0O A;  1O07 A;  3UTA A;  1JWZ A;  3WTP D;  3KS8 A;  4BLM A;  4J8X C;  5FI7 A;  3QNB A;  3ZHH A;  3AZJ C;  2HDU A;  1GHP A;  5AQB A;  3A3I A;  5AV6 A;  5EUA A;  1CK3 A;  3REK B;  5CER A;  2ZM0 A;  4IBG A;  5CPK A;  1LLB A;  2C6W B;  5CXW A;  1BLC A;  1GHM A;  2ZY5 A;  5HFO A;  3AZH D;  5BT1 C;  5M19 A;  1P3P C;  4DKI A;  4H9P B;  3H0M C;  5B1M C;  3VH5 W;  2ZQA A;  5F83 A;  5GXQ C;  3S1Y A;  5B31 A;  4QLC C;  2FFF B;  4Z5T C;  3B6F C;  3PBR A;  4X56 A;  2CV5 D;  3REH A;  1Q2P A;  3AZI B;  2WUQ A;  4UA9 A;  4YS3 B;  2DRW A;  2OLU A;  2V1Z A;  3X1T A;  4UA7 A;  3ZG7 B;  4NET A;  4KQR A;  2NQB B;  3REJ C;  1YMS A;  1P3B D;  4Z9Q A;  3UDF A;  1M1A A;  1M18 A;  1ID3 C;  3UTB B;  3X1S C;  3ZCZ A;  3OPP A;  4XUZ A;  3X1U C;  4H9O B;  5F99 A;  4CSR B;  5B40 D;  4E44 A;  1BH8 B;  1P3A C;  2VGJ A;  2NZD C;  4OOL A;  3B0D B;  5AV9 A;  2OSU A;  4JXV A;  1KX5 C;  4K0W A;  4S2K A;  1S32 A;  4KQO A;  2BYK A;  4IBD A;  4Y0U A;  1S6R A;  3AV1 C;  4ZUX A;  4LD9 D;  2Y91 A;  3ZG5 A;  5DNN C;  5E2G A;  4E6W A;  4U0X A;  1JVJ A;  4C3Q A;  1YU3 A;  4WM9 A;  1K56 D;  4OP5 A;  5FUG B;  5FA7 A;  1JTD A;  4HES A;  5GL9 A;  1K6R A;  1IYS A;  3FWL A;  4O7D A;  1KVM A;  3P98 A;  5GSU C;  5F1F A;  4J8W A;  5A92 A;  5I94 A;  3WS1 A;  1P3M B;  3WA9 B;  2VQR A;  3W4Q A;  5AV6 C;  2F8N G;  3AV2 A;  2F8N B;  5B0Y A;  4LCL A;  4MBF A;  4ZJ1 A;  3REK D;  3WKJ B;  2PYO B;  5AVC A;  4UUZ B;  5FAP A;  3D4F A;  3Q7V A;  1EQZ C;  5AV5 C;  5JRG B;  3UT9 B;  3FKW A;  4BD1 A;  3N8R A;  4JF5 A;  3SS5 A;  5DTK A;  5G49 A;  4WU9 A;  4IBC A;  3AZF A;  1JTG A;  2HUE C;  4ZJ2 A;  4DRT A;  3AZI D;  3LJA A;  1E25 A;  1OME A;  1TZY B;  3RXW A;  4YS3 D;  5KSH A;  5E2H A;  3LZ0 A;  2WAD A;  5B2J C;  5D3O A;  2EXA A;  3WRT A;  5KSC A;  4J8U B;  1P34 A;  2NQB D;  1BUL A;  5CP6 A;  3EPH A;  1KGE A;  5BNV B;  1U35 A;  1M1A C;  4PM7 A;  4JJN C;  1KGG A;  3UTB D;  2J8Y A;  4IBI A;  3VSK A;  1YU1 A;  5DNM A;  2V20 A;  1XPB A;  3AYW A;  3AN2 A;  1FR1 A;  1TAF A;  4MNR A;  4E3K A;  2CC1 A;  5FDH A;  1JFI B;  4IBF A;  3VH5 T;  1NZU A;  3ZNT A;  2XH9 A;  1KE0 A;  1S32 C;  4E3I A;  3L29 A;  3IF6 B;  2WKE A;  1ZLA B;  5FQJ A;  5TR7 A;  2ZQC A;  2JSS A;  2Y2G A;  1P3O B;  1T3U A;  4ZUX C;  3MGP A;  3RJU A;  4EBP A;  5TFQ A;  4WU8 A;  4YIN A;  5B1L A;  3AZK C;  1NYY A;  5CGW A;  4NZ4 A;  4K0X A;  4H9Q B;  1FSW A;  4KZ3 A;  2XD1 A;  5AV8 B;  3AZN B;  2H0T A;  1WWS A;  2XD5 A;  3WTP C;  1QME A;  1SKF A;  1M19 B;  1A7W A;  4J8W C;  1RGY A;  4JXW A;  3R45 A;  4WZS B;  1NY0 A;  4XUX A;  1MPL A;  1P3M D;  3WA9 D;  4LG2 A;  5B32 A;  5B24 A;  3AV2 C;  1ES4 A;  4G92 C;  3C7U A;  2F8N D;  1HQ3 A;  4KGC B;  3WKJ D;  2PYO D;  3WAA B;  1B6W A;  3E2K A;  3AZL B;  3IXD A;  3B0B A;  1KDW A;  1NRF A;  1IYO A;  1ZG6 A;  1PYY A;  2IWD A;  5JRG D;  3UT9 D;  4NZ5 A;  3N8S A;  3A3D A;  5F1G A;  3AZH C;  4GD6 A;  4ZTK A;  3IHB A;  3REL A;  3EPJ A;  4IED A;  3AZF C;  2Y2I A;  3MNN B;  2F8N K;  3L28 A;  2ZM8 A;  2ARO B;  5CPI B;  4XZQ B;  2CV5 C;  4KEN B;  3HLW A;  1TZY D;  3LEZ A;  1KX3 B;  5CEC A;  3HLC A;  3LZ0 C;  3LZ1 B;  3MZD A;  3UDI A;  4IBR A;  3O62 C;  3TU4 B;  1IEL A;  5C3I B;  2C5W B;  4J8U D;  5HAQ A;  3C1B A;  5FSR A;  5HAI A;  4EWF A;  3W97 B;  5M18 A;  2ZM2 A;  2FJ7 A;  4X55 A;  4YFM A;  4DE3 A;  2ZD8 A;  2ZM5 A;  3AYW C;  3AN2 C;  2X01 A;  1YQS A;  4J8V B;  4LEN A;  5GHZ A;  1P3K C;  1FCM A;  1YLJ A;  4S2N A;  4JXG A;  3BLM A;  4GKU A;  1KGF A;  3CJM A;  1RCJ A;  4H9N B;  3O87 A;  1P3G B;  1ZLA D;  4GHL A;  2ZQ8 A;  3IWI A;  3BM6 A;  1JWV A;  5B33 B;  4S2O A;  1P3O D;  3V9R A;  1BH9 A;  3REI A;  3MZF A;  5CTM A;  4IBX A;  3A1I A;  5B1L C;  4LD9 C;  4R8P C;  3V39 A;  3HLD A;  3V50 A;  2HP5 A;  3MXR A;  1SHV A;  5BO0 A;  2ZY4 A;  5AV8 D;  3AZN D;  4N9L A;  3TSG A;  2ZC4 B;  5L2F A;  2J9O A;  3FYZ A;  3MGQ B;  3REH B;  1E3U A;  2Q9N A;  1M19 D;  3IT9 A;  3O86 A;  1BFM A;  1HQ3 C;  3AZM B;  4KGC D;  3FKV A;  4Y7P A;  3MBZ A;  3HLF A;  3W98 A;  3WAA D;  3AZL D;  4QNL A;  3REK C;  1K38 A;  3A6N A;  3AFA A;  3VOY A;  3O88 A;  3V5M A;  1M18 B;  1F66 A;  4ZBJ C;  4S2I A;  2ZLY A;  3PBQ A;  5F99 B;  4HGA B;  1DY6 A;  3MNN D;  2QPN A;  3HVF A;  3IHA A;  5G18 A;  4QB8 A;  4N1X A;  3KWQ A;  3AZG B;  1NYM A;  3OCL A;  2ARO D;  4KZ5 A;  1N1J A;  5CPI D;  5AVB B;  4XZQ D;  1M40 A;  5GT3 A;  1KX3 D;  5E5A A;  3AZI C;  5B2I A;  3LZ1 D;  4YS3 C;  1ALQ A;  3TU4 D;  3VH5 A;  5KDM A;  1P3I B;  2H10 A;  1BZA A;  4MBH A;  4J8X A;  1MWS A;  3W97 D;  2HDQ A;  4S2J A;  2NQB C;  1K55 A;  3AZJ A;  3PAE A;  1WWI A;  1W8Q A;  4NFT A;  4OVD A;  1ZKJ A;  2X71 A;  3W99 B;  5FAS A;  3KXB B;  1K57 C;  1ZG4 A;  3DTM A;  4S2M A;  4QD4 A;  5CHM A;  3JYI A;  4J8V D;  4EBN A;  3IXG A;  4M3K A;  3A1K A;  2ZJ9 A;  2HIO B;  2RCX A;  4RX2 A;  1P3P A;  3GMW A;  1P3G D;  4E3N A;  4NE5 A;  5B33 D;  3REI C;  3HUO A;  5GXQ A;  4MLL A;  4Z5T A;  3MFD A;  1C3B A;  1W5D A;  4X23 B;  1I2S A;  2GDN A;  1PI5 A;  5F82 A;  5CEB A;  3HON A;  2BYM B;  1NZO A;  3MGQ D;  3REH D;  3A3J A;  1YLZ A;  4N92 A;  3EG5 B;  4PPR A;  1BTL A;  4UA6 A;  4GNU A;  4AWL C;  3WA9 C;  2EX8 A;  1P3M C;  3AZM D;  5FQI A;  3C1C B;  1MXO A;  4WZ4 A;  3VP4 A;  4N9K A;  4OJ5 A;  1PW1 A;  2Y2J A;  4KUD B;  3AFA C;  2PYO C;  4UAA A;  1QMF A;  4JLF A;  3X1V C;  1HVB A;  1M18 D;  2NZD A;  3N7W A;  3NI9 A;  5IHV A;  4KHA A;  2XLN A;  1KX5 A;  3WS5 A;  1SDN A;  4EBL A;  3VSL A;  5F99 D;  4R0Q A;  4OQH A;  4QU3 A;  2IO5 B;  3AZG D;  3MGR B;  4MBK A;  4YM6 B;  3AV1 A;  5AVB D;  3BFE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...