2BG1A

Active site restructuring regulates ligand recognition in classa penicillin-binding proteins (pbps)
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
484
structure length
455
Chain Sequence
ITYDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTNQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Peptidoglycan
molecule keywords PENICILLIN-BINDING PROTEIN 1B
publication title Active Site Restructuring Regulates Ligand Recognition in Class a Penicillin-Binding Proteins
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 147
structure length 455
sequence length 484
ec nomenclature ec 2.4.1.129: Peptidoglycan glycosyltransferase.
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2bg1A01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2bg1A03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2bg1A02
2WAFA 5CGWA 1TVFA 1U60A 4C3QA 5FATA 2Y2OA 1GHMA 4Z9QA 3VOZA 3LY4A 4B4XA 5EOEA 1HVBA 2XEPA 3HLWA 4N1XA 3G31A 3PBRA 1PWDA 5AQ7A 4P87A 5GLCA 3ISGA 1WE4A 1MWSA 1DJAA 1SKFA 3WS0A 1KGEA 3EQUA 3OCLA 1K4FA 1OMEA 2WADA 3G32A 4X53A 5CTNA 5HAQA 2V2FF 1ZG4A 2H5SA 2ZQDA 3D4FA 3VSLA 3WS5A 1LLBA 2H0YA 4RX3A 5A90A 3IF6B 1MXOA 3BFEA 3I7JA 2ZQ9A 1TDGA 1H8YA 2ZJ9A 1YLJA 4DE2A 4E3JA 2XR0A 3HLFA 1KVLA 2ZQ8A 4L0LA 2XF3A 2P9VB 5G18A 1NY0A 5HAPA 4X56A 4GD6A 3HUOA 4HBUA 4IVIA 3WS2A 5M18A 1ESUA 4B4ZA 4XXRA 1PZPA 2XK1A 2Y91A 5DVAA 3ZCZA 4YFMA 2Y59A 3ZG0A 1YQSA 3HLDA 3W4PA 1G68A 4UA9A 2E8IA 1L2SA 1FSYA 4NETA 5CHMA 3UDXA 3VP3A 2WKIA 3TG9A 3MFDA 1N9BA 4EBNA 3VP0A 4JXGA 3W4QA 1L0FA 1KE4A 5CERA 5M19A 1E3UD 3PBTA 1EI5A 4DE0A 1G6AA 3UE0A 2V1ZA 2ZC4B 4GNUA 1FR6A 1IKGA 4LCLA 4S2JA 4C6YA 4MBHA 2EFXA 1GA9A 2VGKA 1IYQA 2XD1A 1S6RA 3EQVA 3GRJA 1JTGA 5CECA 5CGSA 3VOYA 3VFHA 1XX2A 1ZC2A 2G2UA 4R3BA 1K54A 2VGJA 4KZ3A 2FFFB 2ZC3B 2QZ6A 3IXBA 1BT5A 4HBTA 4S2NC 1PI4A 2HDSA 2EXBA 3C5AA 4N1HA 1L0DA 2WAEA 4B88A 5F82A 4FH4A 3NCKA 4IEDA 4R0QA 2WYXA 1N4OA 1TEMA 3HLEA 4DDSA 5GL9A 4EUZA 5FQKA 4M3KA 1W8QA 5FAPA 3IWQA 4BLMA 1ESIA 4DXCA 3A3EA 1NZOA 3FZCA 5KZHA 4LENA 1ES3A 1FSWA 3IWIA 3A3FA 4QHCA 5DF9A 5AQ9A 4P0MA 3G34A 1MWTA 5TGFA 5KMWA 3SS3A 3UN7A 1DJCA 3CG5A 2Q9MA 1K6RA 2X01A 4KG6A 2XFSA 1MWUA 4Q8IA 3N6IA 2ZM8A 5HFOA 4UAAA 3VSKA 4Y0TA 5E2GA 2OLUA 3FYZA 3Q81A 4RVAA 1SDNA 1YLWA 4DF6A 1XGJA 2WGIA 1YLYA 1KE3A 3NDEA 3G30A 2XFTA 5HAIA 3Q7ZA 4S2OA 4X55A 3LY3A 2CC1A 1LI0A 1WYCA 4GDNA 4KZ5A 4X68A 2Y2IA 1LL5A 1BLSA 3OPHA 3NY4A 3SS5A 1JWVA 5FQJA 1BTLA 2HP9A 4KZAA 3S22A 1GA0A 3P09A 1FCMA 4OPQA 2XQZA 4Y0OA 1HZOA 3UDIA 5AQAA 3WS4A 2ZQAA 3GR2A 5CRFA 3HLBA 4EBLA 4R3JA 2FFYA 3V3RA 1QMFA 5FAOA 1XXMA 1FR1A 2RCXA 2Y2JA 5FQ9A 4JLFA 5FQIA 1HD8A 4LV0A 3Q1FA 4KZBA 3PBQA 1W8YA 1GHPA 3GMWA 3NIAA 4H8RA 4JXSA 4WMCD 4Y7PA 4K0WA 3OZHA 1QMEA 2IWDA 3VP1A 3ZVTA 2HDUA 3RJUA 5AQBA 4DE1A 5E2HA 1KVMA 3HL9A 3IH9A 4OLGA 4ZJ2A 1BLHA 1PWGA 1EROA 2ZLYA 3FV7A 2ZM0A 1SDEA 1K55A 5GLDA 3O87A 3OCNA 1MBLA 4S2NA 4F94A 4PM8A 4EWFA 1BSGA 3IWOA 3ZG7B 1K57C 2P74A 4S2PA 4JXVA 1AXBA 3ZG8B 2Y55A 4D2OA 1MWRA 4XUZA 2JBFA 1O07A 3LCEA 4R23A 4S2LA 4MNRA 2ZC6B 4OOYA 3PAGA 1KDSA 5F83A 1E4DA 5FAQA 3FKVA 3ITAA 4S2KA 2PU2A 3MKFA 1FCOA 1KDWA 2WUQA 4PM7A 4RYEA 4QD4A 3BLSA 3AGFA 1XKZA 2WZZA 3A3JA 3BYDA 2UWXA 3DWZA 3ZG9B 1PW8A 5GLAA 4C75A 4E3IA 5DTTA 2GDNA 1DY6A 3ITBA 4PM6A 3UPNA 4N92A 4QJGA 3PTEA 3UNWA 3W8KA 3IT9A 1I2WA 1NJ4A 2BLSA 3IQAA 1RGZA 3BFGA 2ZM2A 3G4PA 3GSGA 5GHXA 1KGGA 5D3OA 1JWZA 5CEDA 1NYYA 1W5DA 4MEZA 3OPPA 3ZGAB 4WZ4A 4QU3A 3OC2A 2WZXA 2C6WB 1YLPA 4GZBA 1TDLA 3O86A 1H5XA 3OPLA 3SH7A 3BEBA 2HP5A 4ZJ3A 3V50A 2ZMAA 2EX2A 4LCMA 5DF7A 4QY5A 4YINA 3BLMA 4E3NA 3LEZA 3RXWA 4JF4A 5GLBA 1BLPA 4HEFA 4JPMA 5GHYA 3WRTA 3VP2A 5BOHA 5FSRA 1YMSA 5EVIC 3C7UA 3IXGA 4ZBEA 4BL3A 1IEMA 1E3UA 1RP5A 4GDBA 2C5WB 2Q9NA 1JWPA 4N9LA 2XD5A 5F1FA 3CMZA 3Q7VA 3PAEA 4UA7A 1MKIA 3ZG5A 2HDRA 4IBXA 2WGVA 2DCFA 2G2WA 3HBRA 4KG5A 1NZUA 4OQHA 2J9PA 3PBOA 1XP4A 4QY6A 2PU4A 3G2YA 1ES2A 2EFUA 3BM6A 3WRZA 3V5MA 5JYPA 4RX2A 2ZQ7A 3CJMA 4PPRA 4R4RA 4WEJA 2WKHA 3CZDA 1WYBA 3FKWA 5GHZA 4BJPA 5JYOA 5L2FA 1BULA 4WM9A 1VM1A 3ZVWA 1K57A 4BL2A 4MBKA 1LHYA 5EE8A 5TFQA 3IHBA 2WK0A 5FQQA 4P85A 1W7FA 4EV4A 3HREA 1VQQA 4GN2A 4EQIA 4KG2A 4K91A 3A3IA 4UA6A 1Q2PA 3TOIA 2I72A 3MXRA 4KZ8A 4BQMA 1FCNA 5HL1A 2EX9A 4WZ5C 1IELA 4KZ6A 4Y0UA 4E3LA 5HX9A 2DNSA 3N8RA 4PM9A 4GB7A 3RXXA 1YT4A 1CEFA 2ZD8A 4JF6A 4X69A 3LO7A 4LV3A 2H10A 3HUMA 5EPHA 4OQ0A 1Y54A 5EVID 5CEBA 1FOFA 3UO9A 1S0WA 5KSHA 3Q82A 4FH2A 3O3VA 5A93A 3A3DA 5EECA 4OQGA 1IYSA 2BG1A 4JKTA 4S2MA 5EOOA 3N4IA 4FSFA 3V3SA 1NRFA 4OP5A 3SH9A 3UDFA 4P6BA 4OPZA 2Z2MB 3GQZA 1EWZA 3M2JA 1KGFA 5CXWA 4ZTKA 4KZ7A 2JCHA 1K6SA 2OSUA 4A5RA 3MKEA 5J8XA 1PI5A 5FQMA 2JE5A 3DW0A 1Z6FA 3SS4A 1K54C 3NC8A 2EX8A 5EVIA 4OPYA 3SOIA 5I94A 4N9KA 5A92A 2EX6A 2A49A 5M1AA 4KQOA 1W79A 3VFFA 1IKIA 3GVBA 4E6XA 3Q7VB 1CK3A 1JTDA 3N8SA 3NI9A 5CHUA 3PBSA 3IF6C 2Y2KA 2WGWA 4WMCA 3C7VA 3E2LA 3N8LA 3IHAA 2Y2HA 4PMAA 5CTMA 2J7VA 3QHYA 5EVLA 4GKUA 3ZNTA 1M6KA 4GOGA 4DE3A 3M6HA 2QMIA 5E2FA 1ZKJA 2IWBA 2ZC7A 2B5RA 3JYIA 1SCWA 2Z2LB 2XGNA 1J9MA 4JBFA 4WEKA 4IVKA 2R9XA 2HDQA 4OOLA 5KSCA 3UPOA 2DRWA 3Q07A 1FQGA 2Y2GA 3C4PA 5CHJA 4KQQA 3HUNA 3HLGA 4ZJ1A 1Q2QA 3UE1A 3QNCA 4OQIA 3UY6A 1XA1A 3FWLA 1K4EA 1MY8A 5IHVA 1DJBA 1YLTA 3IH8A 3GTCA 4CPKA 4OPRA 4WELA 2XH9A 1ERQA 1PIOA 2OV5A 3MBZA 4ZDXA 1HTZA 1RCJA 4E3OA 2OLVA 4WZ5A 5EUAA 3BECA 3HLCA 1BUEA 3UE3A 3PBNA 4O7DA 3WWXA 2HPBA 1L0GA 1M40A 1JVJA 2X71A 3BFFA 4FD8A 5FDHA 2EXAA 2Y4AA 5FA7A 4U0XA 5E2EA 1ALQA 5FASA 1K38A 4RA7A 4KENB 5F1GA 3S4XA 4R1GA 5A91A 1ONGA 2R9WA 1YM1A 2PBYA 1K56D 3G2ZA 2J8YA 3C4OA 4ZAMA 1SHVA 3DWKA 1XA7A 4ID4A 4S2IA 5HARA 1GHIA 5E43A 1XGIA 3BFCA 4OOMA 1ES5A 1ES4A 3HVFA 3MZFA 4LV1A 3V39A 3IF5A 4BD0A 1IYPA 2Y2QA 2RL3A 1O7EA 3WS1A 1I5QA 3SH8A 1NYMA 4OH0A 4WYYA 4OVDA 4DXBA 4QB8A 1K55C 1E25A 3NBLA 3M2KA 5EVIB 4E3MA 2XDMA 1K56A 1BZAA 4MBFA 1CI9A 1LL9A 4U3TA 1K25A 2HP6A 3W4OA 2QPNA 4GD8A 4NK3A 3ZFZA 5DTSA 4BD1A 4OONA 4EBPA 4IBRA 1L0EA 3BFDA 1ZG6A 3IF6A 3UPPA 3MXSA 2WGWB 2Y2LA 3P98A 3MZDA 4WBGA 3B3XA 3S1YA 4JXWA 5HW3A 1I2SA 1LI9A 4R4SA 1BLCA 1XPBA 4K0XA 3MZEA 4HESA 3ZDJA 1IYOA 2P9VA 3AGEA 3O88A 1H8ZA 3G35A 4OP8A 4U0TA 4KQRA 3TSGA 3DTMA 2J9OA 4JF5A 4E3KA 2X02A 3N7WA 4OKPA 4DKIA 2Y2PA 1CI8A 4MLLA 5DTKA 2Y2NA 1ONHA 4BENA 3M6BA 4KZ4A 1PW1A 2XLNA 2V20A 2ZC5B 3VP4A 1YLZA 2H0TA 4DRTA 2Y2MA 3OPRA 2JC7A 4X6TA 3NDGA 1PWCA 1PYYA 5TR7A 2IWCA 1MPLA 4CJNA 3ZHHA 2A3UA 3BRMA 1C3BA 3ZNYA 1PZOA 1YMXA 4UHUA 5FI7A 3E2KA 2ZQCA 4LV2A 4KZ9A 4DDYA 3AGDA 1NXYA 5U47A 4E6WA 1KE0A 1GCEA 1ERMA 4FCFA 4OLDA 3GV9A 5FI6A 5DF8A 2WKEA 3IXHA 5CGXA 4XUXA 4PM5A 1RGYA 3VMAA 1CEGA 5FI2A 3IXDA 3QNBA
chains in the Genus database with same CATH superfamily
3A0VA 4EESA 1U60A 4C3QA 3W96C 3VOZA 4HJ6A 1P3MB 3LY4A 3AZGB 4B4XA 2JKTI 5EOEA 2XEPA 3CPTA 3NULA 1P3FB 2HF6A 3PBRA 4Y17A 3LICA 3ISGA 3KXBB 1L3LA 3DTKA 3H7WB 5CPJB 2O99A 5HL6A 3LJAB 3G32A 4XT2B 5HAQA 2V2FF 2VK3A 3QP6A 3BFEA 1Y28A 2HJ9C 2ZJ9A 1YLJA 4JGQA 2XR0A 4J8WB 1UGUA 3JVUA 2XF3A 5CP6A 5G18A 5HAPA 3HUOA 4GHAA 4Y3IA 5B31A 2VEAA 1YQSA 3HLDA 4HJ3A 1G68A 2O9BA 4NEED 4ZUXC 4CSRB 4QLCD 5AV9D 3O62A 4I3JA 3S7PA 1L0FA 5F5YA 3W4QA 3AYWC 5M19A 3PBTA 3R45A 1EI5A 5FL3A 1G6AA 3REHD 4E04A 5B32C 1IKGA 1YSQA 4LCLA 3TE8A 3WTPA 1P3MA 1GA9A 2OWJA 3JPUA 5G4YA 3MQLA 3T1XA 3GRJA 5DNNC 5CECA 1P3FA 5BNXB 2PHYA 5CGSA 3VOYA 3ZYTA 1W2EA 3AZLD 3VFHA 1ZC2A 2VGJA 3A1KA 3KXBA 2FFFB 4WU8C 5AVFA 2AVXA 2EXBA 1P3BC 3LJAA 1XJ2A 2WYXA 1N4OA 4DDSA 5GL9A 1W8QA 3AZEC 1LSVA 3A3EA 4J8WA 1P3OA 3W99D 4IBCA 3IWIA 4QHCA 3A3FA 3H9WA 3SS3A 3X1VC 4KHAB 1K6RA 5BPVA 2X01A 4KG6A 2XFSA 1MWUA 5B1LD 4DJ2A 4Z5TB 4YM6C 1H3QA 1YU4A 4CSRA 1F9IA 4Y0TA 3L9KA 3RH8B 2HJEA 4DF6A 4KQDA 5DNMD 3NDEA 3G30A 1SZVA 4X55A 4X68A 4H9RB 4KGCD 1BLSA 3SS5A 3EG5B 3S22A 2HP9A 4KZAA 3P09A 2V8FA 1FCMA 5BNXA 2W0NA 4GLQA 5F68A 5AQAA 5IS1A 3GR2A 4NZ3A 3HLBA 4EBLA 3V3RA 1QMFA 2PYRA 5FAOA 4BBTA 2RCXA 3C1BD 4MDZA 1N9NA 5FQ9A 5GT3D 3B0CT 3B33A 3Q1FA 1M1AB 1W8YA 1S4RA 2W3EA 3OZHA 1QMEA 2HDUA 1KVMA 1BLHA 2D01A 4QLCB 1EROA 1M19D 2O0YA 3T12B 3E98A 1NLZA 3WD1A 1TZYD 1KX3B 5B2ID 2RVQD 4Z5TA 1K57C 3REHB 3UTBA 4JXVA 2Y55A 4XUZA 2JBFA 4Q0JA 3V67A 4R23A 4GHLA 5FAQA 3PAGA 1DP6A 2FJ7A 3B0DB 3AN2B 3MKFA 2WUQA 4PM7A 3CUEC 2W1RA 2WZZA 5K5BA 1PW8A 4E3IA 2JKGA 2L0WA 4YS3C 4L9GA 4O0PA 3W8KA 2BLSA 1RGZA 3REID 1KGGA 5D3OA 1ID3C 3TU4C 1NYYA 3KWQC 3AZFC 3W99B 4H9SA 1P0ZA 5BS7A 2C6WB 3UB7A 1GXDA 3SH7A 3BEBA 2HP5A 3VH5A 1M1AA 3C1CD 5B1LB 4M6BA 2BYKB 3VH6A 2YKHA 3AZJB 2K2NA 4HEFA 3P01A 3K2NA 3IXGA 1IEMA 1KX3A 5DNMB 3T1QB 3V9RA 4N9LA 3PAEA 4LD9A 3KFUG 2L5AA 3BY8A 4IBXA 3CHWP 2WGVA 2F8NK 2DCFA 4LRZE 4KGCB 3HBRA 3AN2A 4XZQD 3BM6A 3CJMA 4X1MA 4WEJA 1UR9A 2Y79A 3L27A 5L2FA 2RIQA 3MMHA 3C1BB 2BASA 2QYBA 1HQ3A 3LZ0D 2NZDD 5AV6C 3IHBA 3P5JB 2WK0A 5FQQA 1OJGA 1YKDA 4IBJA 5B31G 4NZ5A 2ZMVA 3NOUC 4EQIA 5E5AA 1T1CA 5AVBB 4K91A 4ME4A 5GT0C 1Q2PA 3TOIA 2I72A 4KZ8A 1M19B 1FCNA 5CP6C 4WZ5C 3LR0A 1TZYB 4JGPA 1JNUA 4CLCD 4E3LA 5B2IB 4PM9A 1JFIB 1YT4A 3AZJA 1DP9A 3N3FA 3AL0C 1PFLA 1Q9CA 3HUMA 5EPHA 2J3TD 1S0WA 3EGDC 1IYSA 3T4TA 1WA9A 4QNLA 3SH9A 3UDFA 3MGRA 4OPZA 2Z2MB 1P3MC 3M2JA 3AZGC 4IBBA 1P3FC 4DJ3A 3DW0A 1Z6FA 2EX8A 5EVIA 3KXBC 3SOIA 1GSXA 1E6PA 4N9KA 5B0YB 5CPJC 1W79A 4Q0HA 3VFFA 3C1CB 1DP8A 2Y2KA 1KU5A 2ZY4A 3A6NA 2Y2HA 3IHAA 5AVBA 4J8WC 2V8CA 3AZIB 4WL9A 1M6KA 3HJIA 4GOGA 4R3AA 1XJ6A 3KUYB 1M19A 3EPHA 2IWBA 1TZYA 1SCWA 2LB5A 5B2IA 2Z2LB 1JFIA 4JBFA 1P3IA 3B6FB 5KSCA 2Y2GA 1STZA 4ZJ1A 4BBUA 4XZQB 3LELD 3GTCA 5B24B 1Y4OA 5C3IB 1ERQA 3FDDA 2B02A 3LZ1B 3MBZA 3AZHD 2G5IC 1HTZA 4OJOA 4NXGA 4ZDXA 1BUEA 3PBNA 1P34A 3OLOA 3E4OA 1M40A 3LZ0B 3AZND 2NZDB 4Y2FA 1M18B 4FD8A 5FDHA 2EXAA 3LGOA 5FA7A 2VA0A 2PT7A 1CJFA 1SKOA 3BW6A 4KENB 5B0YA 5DKLA 4R1GA 4CQHA 5A91A 1YM1A 3GECA 3C1CA 4QPRA 4CLCB 5HARA 1X0OA 2W3FA 1XGIA 3B0BA 1H3OB 4OOMA 4LV1A 2W1TB 3AZIA 3V39A 2RL3A 3KUYA 3X1TD 3WS1A 1I5QA 1F5MA 1NYMA 4OH0A 4QB8A 5HPIA 2E8JA 3LI9A 1K56A 3B6FA 1LL9A 1K25A 3W4OA 2QPNA 3H0LC 3ZFZA 1P9WA 4BD1A 4OONA 4EBPA 4IBRA 5B1MD 3BFDA 2WGWB 4NXBA 4LGWA 2Y2LA 2WKQA 3HCYA 3AV1A 5B24A 4WBGA 2PBDP 3LR4A 1BLCA 5AJGA 3LZ1A 2D49A 2OAP1 1VEUB 3NJAA 3NQUA 3MXQA 4HH2A 4JF5A 1M18A 3M7PA 2Y2PA 3MVDD 5G49B 1KX5A 1PW1A 1EW0A 4DRTA 2Y2MA 1KX4D 2JC7A 3NDGA 5TR7A 1H3OA 5F69A 1C3BA 1P3AB 2W1TA 5FI7A 4Z2HA 4HGAB 4QLCC 5J3WA 5B40B 3VOLA 4E6WA 1P9RA 4ZBJC 3IX8A 3WAAB 1KX3C 3IXHA 2GX5A 4Q0IA 1YAXA 5BO0A 3REHC 4PM5A 3AZHB 3IXDA 3QNBA 2WAFA 3IS2B 2F8NG 4IBEA 3B0DC 3AZNB 4Z9QA 4UQIM 1HVBA 5A8BA 1ZLAB 3AZMD 3H0RC 3MGQA 5TBMB 1PWDA 5AQ7A 4NE3A 2J3WA 4YNRA 1OTAA 1MWSA 4UUZB 4G3KA 4RQ9A 5G4ZA 3WS0A 3OCLA 5B31D 1OMEA 1TS6A 1LLBA 3IF6B 4H9QA 5G49A 3I7JA 3W99C 3WA9D 4B93A 4DE2A 3IX4A 3O62D 3E4PA 3X1TB 3CAXA 3HLFA 2PR5A 2ZY5A 2ZQ8A 4L0LA 5LBRA 5B33D 4X56A 5B1LC 4HBUA 4IVIA 4B4ZA 5DVAA 1P3AA 2Y91A 3ZCZA 4J8VB 3VH5T 3WTPD 3AZJC 3T4SA 2I9VA 3C38A 5B1MB 1S67L 2E8IA 2HUEC 5B40A 3UDXA 5CHMA 4OUIA 1P3FD 4NXFA 4X23D 3REJB 3WAAA 5DNMC 1KE4A 1E3UD 3AZHA 2IA2A 5AV8A 4DE0A 3UE0A 3UMDA 4KGCC 2VV7A 3LJAD 1FR6A 2CV5A 4HJ4A 1IYQA 5HWWA 5GSUB 4Z1WA 1S6RA 1LSXA 3EQVA 1JTGA 4J8WD 1ZLAA 1P3OD 5TBMA 1FIKA 4EEPA 2G2UA 4HBTA 2ZC3B 2QZ6A 3IXBA 1BT5A 4S2NC 3C1BC 3L28A 5I5LA 4N1HA 2YFWB 1L0DA 2WAEA 5GT3C 4NYYA 4IEDA 4ETXA 1KX4B 2AROB 1TEMA 1YU0A 5FQKA 5CPKA 1U35B 3G6OA 5FAPA 3IWQA 4EUVA 4BLMA 4DXCA 2O9AA 4Z2MH 1M19C 3UB8A 5KMWA 3CPTB 4P0MA 1TZYC 1DJCA 3CG5A 5B2IC 2RVQC 1P97A 2Q9MA 4J8VA 3KX0X 5JRGB 4UEYA 4R8PB 3REJA 1YLWA 3AZMB 2WGIA 3KO6A 3FKEA 1KE3A 4IBKA 3SW1A 1LI0A 4R70A 4IBDA 1LL5A 5B31B 3OPHA 3NY4A 5GSUA 1JWVA 4GW9A 4OPQA 4I5SA 3B42A 3UDIA 3WS4A 3WA9B 3O62B 2VZWA 2YFWA 4II7A 1KX4A 4NKPA 3C1CC 2AROA 5B33B 1E6RA 4Z5TD 2CWEA 1KS0A 3UTBD 2KDKA 4KZBA 1U35A 5J7EA 3WTPB 4Y7PA 4JXSA 3ZVTA 1N9LA 4MN6A 2FJ7D 4DE1A 5KIZA 2DQNC 2HIOA 3K3CA 4ZJ2A 1PWGA 1TF1A 1BH8A 4X23B 2CMNA 1UWPX 1SDEA 1K55A 4Z2GA 4F94A 4NXEA 3B6FC 5JRGA 3UB9A 4EWFA 3IWOA 2P74A 2HV1A 4R8PA 1MWRA 5AY8A 1O07A 4S2LA 4XZQC 2ZC6B 4OOYA 5F83A 3FKVA 4S2KA 1P3GB 2PU2A 5C3IC 3AZMA 1P3OB 1KDWA 2PAVP 4QD4A 3UT9A 3BLSA 4IUHA 3HJKA 1M1AD 3W98A 3LZ0C 2WKPA 4PM6A 2NZDC 1G6OA 3DTIA 1NJ4A 3BFGA 3G4PA 3WA9A 1W5DA 2XROA 4HMCA 3OC2A 2WZXA 4GZBA 5B33A 1KX3D 1H5XA 4CLCC 4LD9D 2EX2A 5DF7A 4EETB 1S4SA 2YFVB 4QY5A 4WN5A 3B47A 4GCZA 3AN2D 4E3NA 3RXWA 5GLBA 1F66A 1BLPA 4X23A 5B32G 5FSRA 2J3TC 3C7UA 1E3UA 5F99A 1H0IA 2F8ND 2EA9A 2HDRA 1HQ3D 1NZUA 1W1TA 1XP4A 4NZ1A 3G2YA 1XFQA 1P3GA 5JYPA 5E5AD 2L1MA 3CZDA 1WYBA 5JYOA 5KDMB 4WM9A 5CPIB 2DF4C 1BFMA 1VM1A 3UTBB 1LHYA 2WKRA 5EE8A 1GPFA 3AZJD 5AVCA 4P85A 3HREA 1VQQA 3OBFA 4KG2A 4HP4A 2FJ7B 3A3IA 3AV2A 3MXRA 4BQMA 1YUEA 4XUJA 2ZY2A 1IELA 2INWA 4KZ6A 4Y0UA 2YFVA 3RXXA 3MGRD 1LL8A 4HGAC 4WF0A 4EQ1A 1CEFA 2ZD8A 2JHEA 4X69A 1PZRA 3VV4A 5B40C 4MN7A 3LELC 1CQAA 4EERA 4OQ0A 5EVID 1FOFA 4G91B 5KSHA 3AZHC 5A93A 4S2MA 4Y15A 4ARZA 3N4IA 4HI4A 3AZNC 1EWZA 1KGFA 4ZTKA 3A6ND 5AVBD 1ZLAC 2JE5A 4IJGA 4KUDA 3NC8A 5KDMA 1VB6A 4OPYA 3MGPB 5CPIA 2EX6A 2GZAA 4KQOA 3U2AA 3V9RB 1P3ID 4LD9B 3NI9A 5CHUA 3IF6C 3C7VA 3E2LA 2L4RA 5AV5B 3X1TC 2J7VA 3L2AA 3QHYA 3ZNTA 2RTSA 2XA7M 4AFIA 5E2FA 2ZC7A 4O01A 2B5RA 3UB6A 1OTIA 2XGNA 2XRNA 4J8VC 2F8NB 2R9XA 5B1MC 3LIEA 1P34D 1YU1A 3UPOA 2DRWA 1FQGA 1HQ3B 3LR5A 3QP2A 4OQIA 4LFUA 3REJC 1XA1A 3L25A 1T1BA 1MY8A 5B0ZA 3IX3A 4MMNA 4CPKA 5E5AB 3UTAB 5B0YD 2OV5A 1RCJA 2P04A 1FILA 4E3OA 2OLVA 5HPFA 3B6GB 3BECA 4O7DA 1ZTUA 1YPRA 4I38A 1L0GA 2PD7A 3PHYA 5DFXA 3AZID 3AZKA 3MVDC 3KUYD 3IBRA 5E2EA 5FASA 3MGPA 1K38A 1P3PA 1KX4C 2H28A 1K56D 3G2ZA 3B6FD 3CITA 1V9YA 1XA7A 1U35C 1P3LA 4WU9A 1BYWA 4DMZA 3MGRB 5AV5A 1AOIA 1J3WA 1ES4A 3CI6A 4FOFA 3AV1D 5B24D 2JSSA 4Y5FA 4DXBA 1TD5A 3W97B 3DTEA 3LZ1D 3MR0A 1K55C 1E25A 5EVIB 4E3MA 2XDMA 2F8NA 3LYXA 5JRGC 4MBFA 2Q0OA 1W63Q 4U3TA 4GD8A 4NK3A 4IBFA 1M18D 1L0EA 3T4JA 3UPPA 4NG2A 3EGXC 3A6NB 1H8MA 4X25A 3UTAA 2K31A 1BH9B 1WWIA 3AZMC 1KX5D 5L09A 1LI9A 4AWLB 3ZDJA 3MZEA 4HESA 4JJNB 1IYOA 2P9VA 1E6NA 2PYPA 3AGEA 1H8ZA 3B6GA 3TSGA 4KQRA 5B31C 3ICYA 2J9OA 3RELD 1P3IB 1ODVA 4E3KA 4BWIA 1OT6A 4MLLA 5EV0A 5JA4A 5DTKA 1A0KA 2W8SA 1T19A 2W3DA 3TJZC 3WA9C 1VHMA 3O62C 2V20A 2ZC5B 3VP4A 1YLZA 3BQAA 5B33C 1S1YA 4DN0A 3P7NA 4CJNA 3WTPC 3MNNA 3BRMA 1S1ZA 4EW7A 1P34B 1PZOA 4UHUA 3S7NA 3E2KA 4Z66D 4X23C 3W97A 1NXYA 1KE0A 1ERMA 1SKOB 5DF8A 3MGQD 1ACFA 3QP5A 3LI8A 3AFAA 1T1AA 2JKRM 3LJAC 1CEGA 3NOPC 4MB3A 4QWOA 4L9FA 5CGWA 4M4XA 3O5YA 5HZHA 1P3GC 3X1UA 1W63M 1BH9A 1P3OC 4HIAA 4JJNA 5BT1D 1D7EA 4N1XA 2V0WA 5L8MA 1DJAA 1KGEA 1P3AD 3EEHA 1XFNA 4X53A 5CTNA 2KLIA 1ZG4A 2H5SA 3D4FA 2H0YA 5A90A 5B40D 5GXQA 3AV1B 1TDGA 1H8YA 1EQZA 4UQIS 3WAAD 1P3KD 2PYOD 4NFTA 1KVLA 1E8BA 3PXPA 5AV8D 1NY0A 4GD6A 1ESUA 5B2JB 1E15A 2CV5D 2Y59A 3ZG0A 3W4PA 3NQUB 4UA9A 4MB4A 3REKA 2UV0E 1FSYA 3TG9A 1F1EA 3MFDA 1ZLAD 3VP0A 1KX5B 5CERA 5FEFA 3ZQ5A 3BQ8A 4EXOA 2ZC4B 4H9PA 3BJNA 1N1JB 3RELB 4MBHA 2EFXA 5CPKD 4GS9A 4CLCE 2JKRI 2XD1A 1MZUA 1XX2A 1K54A 3KSIA 4KZ3A 5CPIC 2J80A 1PI4A 2HDSA 4Z5TC 5F82A 4FH4A 5BO0B 3UTBC 4R0QA 4J8VD 3HLEA 1G5UA 3LIFA 1TS0A 4NY2A 2FJ7C 4Z66B 3W96A 1ESIA 3REJD 3VH5W 5AQ9A 5TGFA 5FDSA 3G34A 1MWTA 4PAUA 3F1NA 3UN7A 3VH6W 3MGQB 3WX7A 5HD5A 5B2JA 4Q8IA 5CHLB 3UB5P 5HFOA 5GSUD 2VGLM 1T18A 4UAAA 2OLUA 3FYZA 1NRJA 4H9QB 4RVAA 1SDNA 3MGSD 4G91C 4H9SC 5BS7C 2EWWA 3MQOA 1M1AC 1N1JA 2AROD 5HAIA 4S2OA 3RELA 2CC1A 4GDNA 2Y2IA 2F2AC 1U35D 4Z2JA 4TX8A 1BTLA 1GA0A 1GSVA 4HMEA 4ZUXA 1HZOA 1W1VA 2HIOD 3MGPC 2ZQAA 5CRFA 1P3KB 2PYOB 4ZRRA 1XXMA 5JRGD 4LD9C 3VE3A 5AV8B 4JLFA 4LV0A 5B32A 3C2WA 3PBQA 4R8PD 2CV5B 1NLYA 4Z66A 5AY8D 4Z2KA 3GMWA 3AN2C 2NQBD 4H8RA 5AVEA 4K0WA 3RJUA 5AQBA 4D60A 3OOVA 5E2HA 5DNNA 3WKJD 4LRYC 2ZLYA 3FV7A 3UT9D 2V5OA 2ZM0A 3F1PB 4IBIA 4WU8A 5GLDA 4PM8A 1P3BA 4G3WA 1OT9A 3W98D 1HQ3C 4HP9A 1AXBA 4D2OA 5HDCA 5EM1A 5CPKB 3AZEA 5E5AC 3ITAA 3UTAC 1FCOA 3UE6A 2ZL1A 1LT0A 4RYEA 3AGFA 1UWNX 1XKZA 3X1VA 3BYDA 3B6GC 3BWLA 3DWZA 5GLAA 5DTTA 3ITBA 3IP4C 4N92A 4YM6A 3UNWA 3GSGA 5GHXA 1F66D 1P3KA 2PYOA 3ZGAB 4MEZA 1O6IA 1J7MA 1YSPA 4WZ4A 4QU3A 5F99D 1YLPA 3O86A 3OPLA 3WD2A 3MGRC 2ZMAA 3H82B 3BLMA 1P3GD 3X1SB 4JF4A 1PRQA 3W97C 3VP2A 5EVIC 3F1PA 3MGSB 4ZBEA 3BY9A 4BL3A 1RP5A 4ESPA 3MQ0A 2Q9NA 2MJ6A 1ULYA 1JWPA 5F1FA 2XD5A 3R7WA 3Q7VA 1MKIA 3ZG5A 3R4KA 2G2WA 4KG5A 3FC7A 3A6NC 5AVCD 2PU4A 5AVBC 1ES2A 3WRZA 5DJUA 3V5MA 4AWLC 2ZQ7A 4PPRA 2HIOB 4CAYA 2WKHA 4I3AA 3AV2D 2M1CA 1BH8B 4BJPA 2V0UA 1BULA 4XUJD 1P3IC 1K57A 4MBKA 5EFWA 5TFQA 5AY8B 2NQBB 4EV4A 2VV8A 3WKJB 3UT9B 2EX9A 1TAFB 3H82A 2ZOHA 3E0YA 2DNSA 1P34C 3N8RA 5EM0A 3W98B 4P6ZM 3WD3A 2Z6CA 2DMWA 3X1SA 2VJWA 3MGSA 4KUDD 5B0YC 1ID3A 3TU4A 1Y54A 1GSWA 3KWQA 5CEBA 3AZFA 2ZBBA 1GOIA 4FH2A 5CPID 1OTBA 3O3VA 4YOFA 2K7SA 3A3DA 4JKTA 2BG1A 2LY8A 5EOOA 4FSFA 1NRFA 4I39A 4NE6A 4DQYB 3EPJA 3AZIC 4KZ7A 3W2ZA 1K6SA 3KUYC 3MF0A 3WTPE 2VX8A 4A5RA 1PI5A 5FQMA 1F66B 3SS4A 1K54C 3RFBA 5I94A 3EOIA 5HWVA 5F99B 5M1AA 1CK3A 3N8SA 4J8XD 2FH5A 3PBSA 3T4KA 3U4LP 2NQBA 5MC7A 4JGOA 3AV1C 5B24C 2GJ3A 5CTMA 3WKJA 2B95A 2ZOIA 4GKUA 4DE3A 5B0ZD 2QMIA 3LZ1C 1ZKJA 1CXWA 1TAFA 2QJ7A 3JYIA 5B2JC 2V9AA 2HDQA 1M18C 3Q07A 3DBAA 5CHJA 4EEUA 4KQQA 3HUNA 1PNEA 3HLGA 3UE1A 3B0CW 5AV6A 3UY6A 5AVCB 3FWLA 3AZKD 4WV4B 1K4EA 1KX5C 5IHVA 1YLTA 1ZHHB 2ACGA 2R78A 3MGPD 2XA7S 4WELA 2XH9A 1P3PD 5GT0A 3AV2B 1PIOA 3KS4A 4WLAA 2JKFA 3MJQA 4WZ5A 3RELC 5EUAA 4XUJB 2A2LA 3HLCA 3UE3A 1P3LD 3WWXA 2W27A 4WU9D 1D1JA 5AV5D 1AOID 4Z2MG 2X71A 4LRXC 2Y4AA 1LSWA 4RA7A 5F1GA 4HY8A 3S4XA 1ONGA 2PBYA 2J8YA 2FZ0A 1SHVA 4KUKA 4UPKA 3DWKA 4S2IA 3MQQA 4ARZB 1GHIA 3BFCA 4Z66C 1ES5A 3AZGA 3MZFA 3IF5A 1IYPA 2QWSA 2P08A 3D9YA 3UTAD 3PYPA 3SH8A 3MGQC 4OVDA 4KUDB 4OJ5A 4Z2LA 4ETZA 2ZM5A 3B6GD 3H7WA 5CPJA 1HTAA 4XT2A 1ZG6A 3MXSA 2P7JA 3P98A 5L10A 2PDRA 3F1OB 5BT1C 4IHQA 3B3XA 2BTFP 3S1YA 4JXWA 1XJ3A 1I2SA 4R4SA 4JGRA 5HW3A 1XPBA 4J8UB 2ZMFA 2OWHA 4U0TA 1P3AC 1QO6A 4MCWA 3MNND 4OKPA 4J8XB 4PKYG 3LFVA 2PRFA 2Y2NA 1ONHA 3WD4A 3WAAC 3W97D 1P3KC 2PYOC 4KZ4A 4EO5B 5B0ZB 4E45A 5AV8C 3AFAD 1B6WA 3OPRA 4GJ4A 4HNBA 4X6TA 3EPKA 1S32D 2CV5C 2IWCA 3ZHHA 2A3UA 3ZNYA 1YMXA 2ZQCA 3CLOA 3X1UD 4KZ9A 3AGDA 5FUGB 3AZKB 4JJND 1GCEA 3GV9A 5CGXA 1P3PB 4XUXA 1RGYA 3MFXA 3D72A 5DFYA 2B18A 1OGGA 5CPKC 1P3LB 1TVFA 4WU9B 3F1OA 5FATA 2Y2OA 1AOIB 1GHMA 5GXQD 4HHDA 3NOTC 4J8UA 1EQZD 3HLWA 4G92B 3G31A 5AV9B 4KHAA 4P87A 5GLCA 3ULFA 4ZBJB 1WE4A 3FPWA 1AIWA 1SKFA 3EQUA 4J8XA 5L07A 1K4FA 2WADA 3VSLA 2ZQDA 3CWFA 3WS5A 3REKD 4FTXA 4RX3A 1MXOA 3WD0A 1E6ZA 2ZQ9A 4E3JA 1CF0A 3AZLB 3LIDA 1H0MA 2P9VB 4H9RA 5HDSA 5M18A 3WS2A 4XXRA 1PZPA 2XK1A 5IT5A 5GSUC 4YFMA 5IU1A 3X1SC 3KS8A 3HONA 1VETB 4H9OB 1L2SA 5FUGA 4NETA 3SZTA 3VP3A 5JA4B 1PDCA 3MGSC 2WKIA 1N9BA 4EBNA 2V1AA 4JXGA 2NUPC 4Z2IA 3L26A 2AROC 2V1ZA 3KYZA 3HSHA 4O8GA 4GNUA 1YU3A 4S2JA 4C6YA 4DRBA 3MNNB 1R4VA 1IFQA 2VGKA 5J4EA 3W96D 1UR8A 2HIOC 4YWZA 2HUEB 4QLCA 5AV9A 3EEAA 4R38A 4R3BA 3QP4A 3T1RA 2BYMB 1S66L 3C5AA 4B88A 1MC0A 5B2JD 3REHA 4IJEA 3NCKA 3L29A 3AFAB 2VV6A 5DJTA 5DKKA 1S32B 4R8PC 4NYUA 4EUZA 5AY8C 2NQBC 4M3KA 3T4LA 3X1UB 1NZOA 3WKJC 3FZCA 5KZHA 2OAQ1 4LENA 3AZLA 1ES3A 2IO5B 1FSWA 3UT9C 5DF9A 1OPXA 1V9ZA 3W98C 3QP1A 3LR3A 1F98A 3N6IA 1L6JA 2ZM8A 5GT3B 1VETA 4H9OA 1ED7A 5HWTA 1KOUA 2PR6A 3A0SA 3VSKA 5E2GA 4ZUXD 5GXQB 1D06A 3Q81A 3W99A 2YKFA 1XGJA 1EQZB 4G3VA 3AYWD 1YLYA 2XFTA 4E6XA 3Q7ZA 3LY3A 4KZ5A 2VQRA 5B1LA 1WYCA 2BYKA 5B32D 1F2KA 3FPVA 5FQJA 2VGLS 1XJ4A 1F66C 3REKB 2XQZA 2VKSA 4Y0OA 5DNND 2BYMA 4NE5A 5F99C 3S7QA 3VE4A 5DNMA 4R3JA 2FFYA 4WU8D 4MB5A 1FR1A 4K08A 5BNVB 1S32A 2Y2JA 1P3BD 5FQIA 1HD8A 3TW8A 4H9PB 2NUTC 4KGCA 1GHPA 3NQJB 3NIAA 4WMCD 4GS9B 1E88A 3VP1A 2IWDA 4HH3A 3AZED 4FUWA 3HL9A 3IH9A 4OLGA 1TS7A 3REIB 3O87A 3OCNA 1MBLA 3X1VD 4S2NA 3C1BA 1OJ5A 1BSGA 3ZG7B 5GT3A 4HMDA 4S2PA 3ZG8B 3H0MC 2W3GA 3DAVA 5AVCC 4YM6D 3LCEA 4Y13A 4MNRA 2IOUA 2KOIA 1KDSA 1E4DA 3W96B 3AV2C 3QP8A 3F1NB 4XUJC 3A3JA 2UWXA 3KYEA 2M7VA 3ZG9B 4C75A 1H8PA 2GDNA 1DY6A 3UPNA 4QJGA 5F6AA 3PTEA 3IT9A 1I2WA 3K3DA 3IQAA 5FEGA 2ZM2A 2D02A 2F8NH 1JWZA 5CEDA 3OPPA 5HSQA 1W1PA 5BNVA 1TDLA 1Z09A 1G28A 4ZJ3A 3T4QA 3C30A 1N9OA 3V50A 3NQJA 5CX7A 4LCMA 1MKMA 4YINA 1TS8A 3LEZA 3REIA 5GHYA 3WRTA 4JPMA 5BOHA 4KUDC 4ZUXB 2HZ5A 1YMSA 4B9OA 1OGBA 4GDBA 2C5WB 3UMEA 2G5HC 4LG2A 3AYWB 3CMZA 1Z2CB 4UA7A 1WWSA 5B32B 4OQHA 4WNNB 2J9PA 3PBOA 4QY6A 4BMWA 2EFUA 1H0GA 3GDIA 4RX2A 4J8UC 4R4RA 5DNNB 3FKWA 5GHZA 2Y8HA 4WU8B 3PR6A 1DRMA 2W3HA 3ZVWA 1W1YA 1P3BB 4J8XC 1EAKA 4BL2A 4OJPA 4YS3D 3X1SD 1CK7A 1W7FA 3T4OA 4XZQA 4EO5C 1A7WA 4GN2A 5B0ZC 3AZEB 3KYQA 4HQAA 2M7UA 1ID3D 3TU4D 4UA6A 3KWQD 3AZFD 2ZL1B 5HL1A 4IUKA 3X1VB 3MSHA 4NZ4A 5HX9A 4GB7A 3LZ0A 2NZDA 3F6TA 4JF6A 2PD8A 4YM6B 1YU2A 3LO7A 3AZKC 4LV3A 2H10A 4H9NB 1P3PC 1K0KA 3UO9A 3AYWA 3Q82A 2V1BA 5EECA 4OQGA 1T3UA 4CLCA 1P3LC 3V3SA 4WU9C 4OP5A 5C5KA 4WNNA 4P6BA 5TJJA 5AV5C 1AOIC 3GQZA 1OTDA 4P6ZS 5CXWA 2JCHA 2OSUA 4H6JB 4KUOA 3MKEA 5J8XA 4G92C 4EU0A 4OJ6A 5AV9C 3LELB 2VLGA 2KX6A 2QJ5A 5A92A 2A49A 2QHKA 1IKIA 3GVBA 3R7WB 3Q7VB 4R6LA 1JTDA 2WGWA 4WMCA 2GNXA 1HLUP 3N8LA 5AV6D 4PMAA 5EVLA 3AZLC 3M6HA 3TRCA 4CAYB 5GT0D 5EVEA 1VEUA 2G7UA 4WZSB 5CP6D 1J9MA 4WEKA 4IVKA 4I3IA 4OOLA 1B67A 3C4PA 1Q2QA 3RTYA 3QNCA 3LUQA 4LLOB 5HDDA 4H9NA 1DJBA 3IH8A 3LEQA 4OPRA 3LIBA 3D3OA 4PKYA 3E4QA 4MN5A 3A1IA 3KSGA 3FG8A 3MNNC 4X1LA 3EWKA 1NWZA 2HPBA 4H6JA 1JVJA 4YS3B 1P3MD 3AZGD 3BFFA 5HD3A 2LB9A 4HOIA 3EPLA 3VH6T 4U0XA 3LELA 1ALQA 1ID3B 3TU4B 3KXBD 4GH9A 3KWQB 3AFAC 3AZFB 4GHIB 2R9WA 4F3LB 3LIAA 3C8CA 1S32C 3C4OA 5CPJD 4ZAMA 4ID4A 3IS2A 2QKPA 5E43A 2XSSA 3MS6A 4WUJA 3AZNA 4DRAA 2JN7A 3X1UC 3KSFA 2ZY3A 3HVFA 3L7HA 4BD0A 2Y2QA 2IO5C 4JJNC 1O7EA 4IBGA 4WYYA 2EWVA 3MVDB 3NBLA 3M2KA 4UUZA 2A24B 1AWIA 1BZAA 1CI9A 2HP6A 5DTSA 2JKTM 3A0RA 3IF6A 3NECA 5GXQC 3MZDA 1EQZC 3KSYA 3X1TA 3JVVA 4K0XA 4BBVA 3T1SA 3O88A 3CUEA 3G35A 4LPZA 4OP8A 3DTMA 4PHTA 4YS3A 5B1MA 4WJ3C 2X02A 3N7WA 3REKC 3NHQA 4DKIA 1CI8A 4E44A 3IBJA 5AV6B 2OOLA 4BENA 3M6BA 2XLNA 1IOUA 4GHIA 4F3LA 2H0TA 3T50A 5GT0B 4L9EA 5CP6B 1PWCA 1PYYA 1MPLA 1OTEA 2J8PA 4OJLA 2Z6DA 4LV2A 3REIC 4DDYA 3MVDA 3S7OA 4J8UD 2HGVA 5U47A 3KSHA 4FCFA 2FN2A 2O9CA 4IJFA 4OLDA 5FI6A 2WKEA 2A24A 3VMAA 5FI2A 3R45B
chains in the Genus database with same CATH topology
1U60A 4C3QA 3W96C 3VOZA 1P3MB 3LY4A 3AZGB 4B4XA 5EOEA 2XEPA 1P3FB 3PBRA 3ISGA 3KXBB 5CPJB 3LJAB 3G32A 5HAQA 2V2FF 3BFEA 2ZJ9A 1YLJA 2XR0A 4J8WB 2XF3A 5CP6A 5G18A 5HAPA 3HUOA 4GHAA 5B31A 1YQSA 3HLDA 1G68A 4ZUXC 4CSRB 4QLCD 5AV9D 3O62A 3W4QA 1L0FA 3AYWC 5M19A 3PBTA 3R45A 1EI5A 1G6AA 3REHD 5B32C 1IKGA 4LCLA 3WTPA 1P3MA 1GA9A 3GRJA 5DNNC 5CECA 1P3FA 5BNXB 5CGSA 3VOYA 1W2EA 3AZLD 3VFHA 1ZC2A 2VGJA 3A1KA 3KXBA 2FFFB 4WU8C 2EXBA 1P3BC 3LJAA 2WYXA 1N4OA 4DDSA 5GL9A 1W8QA 3AZEC 3A3EA 4J8WA 1P3OA 3W99D 4IBCA 3IWIA 4QHCA 3A3FA 3SS3A 3X1VC 4KHAB 1K6RA 5BPVA 2X01A 4KG6A 2XFSA 1MWUA 5B1LD 4Z5TB 4YM6C 1YU4A 4CSRA 4Y0TA 4DF6A 5DNMD 3NDEA 3G30A 4X55A 4X68A 4H9RB 4KGCD 1BLSA 3SS5A 3EG5B 3S22A 2HP9A 4KZAA 3P09A 1FCMA 5BNXA 5AQAA 3GR2A 4NZ3A 3HLBA 4EBLA 3V3RA 1QMFA 5FAOA 2RCXA 3C1BD 5FQ9A 5GT3D 3B0CT 3Q1FA 1M1AB 1W8YA 3OZHA 1QMEA 2HDUA 1KVMA 1BLHA 4QLCB 1EROA 1M19D 1TZYD 1KX3B 5B2ID 2RVQD 4Z5TA 1K57C 3REHB 3UTBA 4JXVA 2Y55A 4XUZA 2JBFA 4R23A 4GHLA 5FAQA 3PAGA 2FJ7A 3B0DB 3AN2B 3MKFA 2WUQA 4PM7A 2WZZA 1PW8A 4E3IA 4YS3C 3W8KA 2BLSA 1RGZA 3REID 1KGGA 5D3OA 1ID3C 3TU4C 1NYYA 3KWQC 3AZFC 3W99B 4H9SA 5BS7A 2C6WB 3SH7A 3BEBA 2HP5A 3VH5A 1M1AA 3C1CD 5B1LB 4M6BA 2BYKB 3VH6A 3AZJB 4HEFA 3IXGA 1IEMA 1KX3A 5DNMB 3V9RA 4N9LA 3PAEA 4LD9A 3KFUG 2L5AA 4IBXA 2WGVA 2F8NK 2DCFA 4KGCB 3HBRA 3AN2A 4XZQD 3BM6A 3CJMA 4WEJA 3L27A 5L2FA 2RIQA 3C1BB 1HQ3A 3LZ0D 2NZDD 5AV6C 3IHBA 3P5JB 2WK0A 5FQQA 4IBJA 5B31G 4NZ5A 4EQIA 5E5AA 5AVBB 4K91A 5GT0C 1Q2PA 3TOIA 2I72A 4KZ8A 1M19B 1FCNA 5CP6C 4WZ5C 1TZYB 4E3LA 5B2IB 4PM9A 1JFIB 1YT4A 3AZJA 3N3FA 3AL0C 1Q9CA 3HUMA 5EPHA 1S0WA 1IYSA 4QNLA 3SH9A 3UDFA 3MGRA 4OPZA 2Z2MB 1P3MC 3M2JA 3AZGC 4IBBA 1P3FC 3DW0A 1Z6FA 2EX8A 5EVIA 3KXBC 3SOIA 4N9KA 5B0YB 5CPJC 1W79A 3VFFA 3C1CB 2Y2KA 1KU5A 2ZY4A 3A6NA 2Y2HA 3IHAA 5AVBA 4J8WC 3AZIB 1M6KA 4GOGA 3KUYB 1M19A 3EPHA 2IWBA 1TZYA 1SCWA 5B2IA 2Z2LB 1JFIA 4JBFA 1P3IA 3B6FB 5KSCA 2Y2GA 4ZJ1A 4XZQB 3LELD 3GTCA 5B24B 5C3IB 1ERQA 3FDDA 3LZ1B 3MBZA 3AZHD 2G5IC 1HTZA 4OJOA 4ZDXA 1BUEA 3PBNA 1P34A 1M40A 3LZ0B 3AZND 2NZDB 1M18B 4FD8A 5FDHA 2EXAA 5FA7A 4KENB 5B0YA 4R1GA 5A91A 1YM1A 3C1CA 5HARA 1XGIA 3B0BA 1H3OB 4OOMA 4LV1A 3AZIA 3V39A 2RL3A 3KUYA 3X1TD 3WS1A 1I5QA 1NYMA 4OH0A 4QB8A 1K56A 3B6FA 1LL9A 1K25A 3W4OA 2QPNA 3H0LC 3ZFZA 4BD1A 4OONA 4EBPA 4IBRA 5B1MD 3BFDA 2WGWB 2Y2LA 3AV1A 5B24A 4WBGA 1BLCA 3LZ1A 3NQUA 4JF5A 1M18A 2Y2PA 3MVDD 5G49B 1KX5A 1PW1A 4DRTA 2Y2MA 1KX4D 2JC7A 3NDGA 5TR7A 1H3OA 1C3BA 1P3AB 5FI7A 4HGAB 4QLCC 5B40B 4E6WA 4ZBJC 3WAAB 1KX3C 3IXHA 5BO0A 3REHC 4PM5A 3AZHB 3IXDA 3QNBA 2WAFA 2F8NG 4IBEA 3B0DC 3AZNB 4Z9QA 1HVBA 1ZLAB 3AZMD 3H0RC 3MGQA 1PWDA 5AQ7A 4NE3A 1MWSA 4UUZB 3WS0A 3OCLA 5B31D 1OMEA 1LLBA 3IF6B 4H9QA 5G49A 3I7JA 3W99C 3WA9D 4DE2A 3O62D 3X1TB 3HLFA 2ZY5A 2ZQ8A 4L0LA 5B33D 4X56A 5B1LC 4HBUA 4IVIA 4B4ZA 5DVAA 1P3AA 2Y91A 3ZCZA 4J8VB 3VH5T 3WTPD 3AZJC 5B1MB 2E8IA 2HUEC 5B40A 3UDXA 5CHMA 4OUIA 1P3FD 4X23D 3REJB 3WAAA 5DNMC 1KE4A 1E3UD 3AZHA 5AV8A 4DE0A 3UE0A 4KGCC 3LJAD 1FR6A 2CV5A 1IYQA 5GSUB 1S6RA 3EQVA 1JTGA 4J8WD 1ZLAA 1P3OD 2G2UA 4HBTA 2ZC3B 2QZ6A 3IXBA 1BT5A 4S2NC 3C1BC 3L28A 4N1HA 2YFWB 1L0DA 2WAEA 5GT3C 4NYYA 4IEDA 1KX4B 2AROB 1TEMA 1YU0A 5FQKA 5CPKA 1U35B 5FAPA 3IWQA 4BLMA 4DXCA 4Z2MH 1M19C 5KMWA 4P0MA 1TZYC 1DJCA 3CG5A 5B2IC 2RVQC 2Q9MA 4J8VA 5JRGB 4R8PB 3REJA 1YLWA 3AZMB 2WGIA 3FKEA 1KE3A 4IBKA 1LI0A 4IBDA 1LL5A 5B31B 3OPHA 3NY4A 5GSUA 1JWVA 4OPQA 3UDIA 3WS4A 3WA9B 3O62B 2YFWA 1KX4A 3C1CC 2AROA 5B33B 4Z5TD 2CWEA 3UTBD 4KZBA 1U35A 3WTPB 4Y7PA 4JXSA 3ZVTA 2FJ7D 4DE1A 2DQNC 2HIOA 4ZJ2A 1PWGA 1BH8A 4X23B 1SDEA 1K55A 4F94A 3B6FC 5JRGA 4EWFA 3IWOA 2P74A 4R8PA 1MWRA 5AY8A 1O07A 4S2LA 4XZQC 2ZC6B 4OOYA 5F83A 3FKVA 4S2KA 1P3GB 2PU2A 5C3IC 3AZMA 1P3OB 1KDWA 4QD4A 3UT9A 3BLSA 1M1AD 3W98A 3LZ0C 4PM6A 2NZDC 1NJ4A 3BFGA 3G4PA 3WA9A 1W5DA 3OC2A 2WZXA 4GZBA 5B33A 1KX3D 1H5XA 4LD9D 2EX2A 5DF7A 2YFVB 4QY5A 3AN2D 4E3NA 3RXWA 5GLBA 1F66A 1BLPA 4X23A 5B32G 5FSRA 3C7UA 1E3UA 5F99A 2F8ND 2HDRA 1HQ3D 1NZUA 1XP4A 4NZ1A 3G2YA 1P3GA 5JYPA 5E5AD 3CZDA 1WYBA 5JYOA 5KDMB 4WM9A 5CPIB 2DF4C 1BFMA 1VM1A 3UTBB 1LHYA 5EE8A 3AZJD 5AVCA 4P85A 3HREA 1VQQA 4KG2A 2FJ7B 3A3IA 3AV2A 3MXRA 4BQMA 1YUEA 4XUJA 2ZY2A 1IELA 4KZ6A 4Y0UA 2YFVA 3RXXA 3MGRD 4HGAC 1CEFA 2ZD8A 4X69A 1PZRA 5B40C 3LELC 4OQ0A 5EVID 1FOFA 4G91B 5KSHA 3AZHC 5A93A 4S2MA 3N4IA 3AZNC 1EWZA 1KGFA 4ZTKA 3A6ND 5AVBD 1ZLAC 2JE5A 4KUDA 3NC8A 5KDMA 4OPYA 3MGPB 5CPIA 2EX6A 4KQOA 3V9RB 1P3ID 4LD9B 3NI9A 5CHUA 3IF6C 3C7VA 3E2LA 5AV5B 3X1TC 2J7VA 3L2AA 3QHYA 3ZNTA 5E2FA 2ZC7A 2B5RA 2XGNA 4J8VC 2F8NB 2R9XA 5B1MC 1P34D 1YU1A 3UPOA 2DRWA 1FQGA 1HQ3B 4OQIA 3REJC 1XA1A 3L25A 1MY8A 5B0ZA 4CPKA 5E5AB 3UTAB 5B0YD 2OV5A 1RCJA 4E3OA 2OLVA 3B6GB 3BECA 4O7DA 1L0GA 3AZID 3AZKA 3MVDC 3KUYD 5E2EA 5FASA 3MGPA 1K38A 1P3PA 1KX4C 1K56D 3G2ZA 3B6FD 1XA7A 1U35C 1P3LA 4WU9A 3MGRB 5AV5A 1AOIA 1ES4A 3AV1D 5B24D 2JSSA 4DXBA 3W97B 3LZ1D 1K55C 1E25A 5EVIB 4E3MA 2XDMA 2F8NA 5JRGC 4MBFA 4U3TA 4GD8A 4NK3A 4IBFA 1M18D 1L0EA 3UPPA 3A6NB 3UTAA 1BH9B 1WWIA 3AZMC 1KX5D 1LI9A 4AWLB 3ZDJA 3MZEA 4HESA 4JJNB 1IYOA 2P9VA 3AGEA 1H8ZA 3B6GA 3TSGA 4KQRA 5B31C 2J9OA 3RELD 1P3IB 4E3KA 4MLLA 5JA4A 5DTKA 2W8SA 3WA9C 3O62C 2V20A 2ZC5B 3VP4A 1YLZA 5B33C 4CJNA 3WTPC 3MNNA 3BRMA 1P34B 1PZOA 4UHUA 3E2KA 4Z66D 4X23C 3W97A 1NXYA 1KE0A 1ERMA 5DF8A 3MGQD 3AFAA 3LJAC 1CEGA 5CGWA 1P3GC 3X1UA 1BH9A 1P3OC 4JJNA 5BT1D 4N1XA 1DJAA 1KGEA 1P3AD 4X53A 5CTNA 1ZG4A 2H5SA 3D4FA 2H0YA 5A90A 5B40D 5GXQA 3AV1B 1TDGA 1H8YA 1EQZA 3WAAD 1P3KD 2PYOD 4NFTA 1KVLA 5AV8D 1NY0A 4GD6A 1ESUA 5B2JB 2CV5D 2Y59A 3ZG0A 3W4PA 3NQUB 4UA9A 3REKA 1FSYA 3TG9A 1F1EA 3MFDA 1ZLAD 3VP0A 1KX5B 5CERA 2ZC4B 4H9PA 1N1JB 3RELB 4MBHA 2EFXA 5CPKD 2XD1A 1XX2A 1K54A 4KZ3A 5CPIC 1PI4A 2HDSA 4Z5TC 5F82A 4FH4A 5BO0B 3UTBC 4R0QA 4J8VD 3HLEA 4NY2A 2FJ7C 4Z66B 3W96A 1ESIA 3REJD 3VH5W 5AQ9A 5TGFA 3G34A 1MWTA 3UN7A 3VH6W 3MGQB 3WX7A 5B2JA 4Q8IA 5CHLB 5HFOA 5GSUD 4UAAA 2OLUA 3FYZA 4H9QB 4RVAA 1SDNA 3MGSD 4G91C 4H9SC 5BS7C 1M1AC 1N1JA 2AROD 5HAIA 4S2OA 3RELA 2CC1A 4GDNA 2Y2IA 2F2AC 1U35D 1BTLA 1GA0A 4ZUXA 1HZOA 2HIOD 3MGPC 2ZQAA 5CRFA 1P3KB 2PYOB 1XXMA 5JRGD 4LD9C 5AV8B 4JLFA 4LV0A 5B32A 3PBQA 4R8PD 2CV5B 4Z66A 5AY8D 3GMWA 3AN2C 2NQBD 4H8RA 4K0WA 3RJUA 5AQBA 5E2HA 5DNNA 3WKJD 2ZLYA 3FV7A 3UT9D 2ZM0A 4IBIA 4WU8A 5GLDA 4PM8A 1P3BA 3W98D 1HQ3C 1AXBA 4D2OA 5CPKB 3AZEA 5E5AC 3ITAA 3UTAC 1FCOA 4RYEA 3AGFA 1XKZA 3X1VA 3BYDA 3B6GC 3DWZA 5GLAA 5DTTA 3ITBA 3IP4C 4N92A 4YM6A 3UNWA 3GSGA 5GHXA 1F66D 1P3KA 2PYOA 3ZGAB 4MEZA 4WZ4A 4QU3A 5F99D 1YLPA 3O86A 3OPLA 3MGRC 2ZMAA 3BLMA 1P3GD 3X1SB 4JF4A 3W97C 3VP2A 5EVIC 4BL3A 3MGSB 4ZBEA 1RP5A 2Q9NA 1ULYA 1JWPA 5F1FA 2XD5A 3Q7VA 1MKIA 3ZG5A 2G2WA 4KG5A 3A6NC 5AVCD 2PU4A 5AVBC 1ES2A 3WRZA 3V5MA 4AWLC 2ZQ7A 4PPRA 2HIOB 4CAYA 2WKHA 3AV2D 1BH8B 4BJPA 1BULA 4XUJD 1P3IC 1K57A 4MBKA 5TFQA 5AY8B 2NQBB 4EV4A 3WKJB 3UT9B 2EX9A 1TAFB 2DNSA 1P34C 3N8RA 3W98B 3X1SA 3MGSA 4KUDD 5B0YC 1ID3A 3TU4A 1Y54A 3KWQA 5CEBA 3AZFA 4FH2A 5CPID 3O3VA 3A3DA 4JKTA 2BG1A 2LY8A 5EOOA 4FSFA 1NRFA 4NE6A 4DQYB 3EPJA 3AZIC 4KZ7A 1K6SA 3KUYC 4A5RA 3WTPE 1PI5A 5FQMA 1F66B 3SS4A 1K54C 5I94A 5F99B 5M1AA 1CK3A 3N8SA 4J8XD 3PBSA 2NQBA 3AV1C 5B24C 5CTMA 3WKJA 4GKUA 4DE3A 5B0ZD 2QMIA 3LZ1C 1ZKJA 1TAFA 3JYIA 5B2JC 2HDQA 1M18C 3Q07A 5CHJA 4KQQA 3HUNA 3HLGA 3UE1A 3B0CW 5AV6A 3UY6A 5AVCB 3FWLA 3AZKD 4WV4B 1K4EA 1KX5C 5IHVA 1YLTA 3MGPD 4WELA 2XH9A 1P3PD 5GT0A 3AV2B 1PIOA 3KS4A 5EUAA 4WZ5A 3RELC 4XUJB 3HLCA 3UE3A 1P3LD 3WWXA 4WU9D 5AV5D 1AOID 4Z2MG 2X71A 2Y4AA 4RA7A 5F1GA 3S4XA 1ONGA 2PBYA 2J8YA 1SHVA 4UPKA 3DWKA 4S2IA 1GHIA 3BFCA 4Z66C 1ES5A 3AZGA 3MZFA 3IF5A 1IYPA 3UTAD 3SH8A 3MGQC 4OVDA 4KUDB 4OJ5A 2ZM5A 3B6GD 5CPJA 1HTAA 1ZG6A 3MXSA 3P98A 5BT1C 3B3XA 3S1YA 4JXWA 5HW3A 1I2SA 4R4SA 1XPBA 4J8UB 4U0TA 1P3AC 3MNND 4OKPA 4J8XB 2Y2NA 1ONHA 3WAAC 3W97D 1P3KC 2PYOC 4KZ4A 4EO5B 5B0ZB 4E45A 5AV8C 3AFAD 1B6WA 3OPRA 4X6TA 3EPKA 1S32D 2CV5C 2IWCA 3ZHHA 2A3UA 3ZNYA 1YMXA 2ZQCA 3X1UD 4KZ9A 3AGDA 5FUGB 3AZKB 4JJND 1GCEA 3GV9A 5CGXA 1P3PB 4XUXA 1RGYA 5CPKC 1P3LB 1TVFA 4WU9B 5FATA 2Y2OA 1AOIB 1GHMA 5GXQD 4J8UA 1EQZD 3HLWA 4G92B 3G31A 5AV9B 4KHAA 4P87A 5GLCA 4ZBJB 1WE4A 1SKFA 3EQUA 4J8XA 1K4FA 2WADA 3VSLA 2ZQDA 3WS5A 3REKD 4RX3A 1MXOA 2ZQ9A 4E3JA 3AZLB 2P9VB 4H9RA 5M18A 3WS2A 4XXRA 1PZPA 2XK1A 5GSUC 4YFMA 3X1SC 3KS8A 3HONA 4H9OB 1L2SA 5FUGA 4NETA 3VP3A 5JA4B 2WKIA 3MGSC 4EBNA 1N9BA 4JXGA 3L26A 2AROC 2V1ZA 3HSHA 4GNUA 1YU3A 4S2JA 4C6YA 4DRBA 3MNNB 1R4VA 2VGKA 3W96D 2HIOC 2HUEB 4QLCA 5AV9A 4R3BA 2BYMB 3C5AA 4B88A 5B2JD 3REHA 4IJEA 3NCKA 3L29A 3AFAB 1S32B 4R8PC 4NYUA 4EUZA 5AY8C 2NQBC 4M3KA 3X1UB 1NZOA 3WKJC 3FZCA 5KZHA 4LENA 3AZLA 1ES3A 2IO5B 1FSWA 3UT9C 5DF9A 3W98C 3N6IA 2ZM8A 5GT3B 4H9OA 3VSKA 5E2GA 4ZUXD 5GXQB 3Q81A 3W99A 1XGJA 1EQZB 3AYWD 1YLYA 2XFTA 4E6XA 3Q7ZA 3LY3A 4KZ5A 2VQRA 5B1LA 1WYCA 2BYKA 5B32D 5FQJA 1F66C 3REKB 2XQZA 4Y0OA 5DNND 2BYMA 4NE5A 5F99C 5DNMA 4R3JA 2FFYA 4WU8D 1FR1A 5BNVB 1S32A 2Y2JA 1P3BD 5FQIA 1HD8A 4H9PB 4KGCA 1GHPA 3NQJB 3NIAA 4WMCD 3VP1A 2IWDA 3AZED 3HL9A 3IH9A 4OLGA 3REIB 3O87A 3OCNA 1MBLA 3X1VD 4S2NA 3C1BA 1BSGA 3ZG7B 5GT3A 4S2PA 3ZG8B 3H0MC 5AVCC 4YM6D 3LCEA 4MNRA 2IOUA 1KDSA 1E4DA 3W96B 3AV2C 4XUJC 3A3JA 2UWXA 4C75A 3ZG9B 2GDNA 1DY6A 3UPNA 4QJGA 3PTEA 3IT9A 1I2WA 3IQAA 2ZM2A 2F8NH 1JWZA 5CEDA 3OPPA 5BNVA 1TDLA 4ZJ3A 3V50A 3NQJA 4LCMA 4YINA 3LEZA 3REIA 5GHYA 3WRTA 4JPMA 5BOHA 4KUDC 4ZUXB 1YMSA 4GDBA 2C5WB 2G5HC 4LG2A 3AYWB 3CMZA 1Z2CB 4UA7A 1WWSA 5B32B 4OQHA 4WNNB 2J9PA 3PBOA 4QY6A 2EFUA 4RX2A 4J8UC 4R4RA 5DNNB 3FKWA 5GHZA 4WU8B 3ZVWA 1P3BB 4J8XC 4BL2A 4OJPA 4YS3D 3X1SD 1W7FA 4XZQA 4EO5C 1A7WA 4GN2A 5B0ZC 3AZEB 1ID3D 3TU4D 4UA6A 3KWQD 3AZFD 5HL1A 3X1VB 4NZ4A 5HX9A 4GB7A 3LZ0A 2NZDA 3F6TA 4JF6A 4YM6B 1YU2A 3LO7A 3AZKC 4LV3A 2H10A 4H9NB 1P3PC 3UO9A 3AYWA 3Q82A 5EECA 4OQGA 1T3UA 1P3LC 3V3SA 4WU9C 4OP5A 4WNNA 4P6BA 5AV5C 1AOIC 3GQZA 5CXWA 2JCHA 2OSUA 5J8XA 3MKEA 4G92C 4OJ6A 5AV9C 3LELB 5A92A 2A49A 1IKIA 3GVBA 3Q7VB 1JTDA 2WGWA 4WMCA 3N8LA 5AV6D 4PMAA 5EVLA 3AZLC 3M6HA 4CAYB 5GT0D 4WZSB 5CP6D 1J9MA 4WEKA 4IVKA 4OOLA 1B67A 3C4PA 1Q2QA 3QNCA 4H9NA 1DJBA 3IH8A 4OPRA 3A1IA 3MNNC 2HPBA 1JVJA 4YS3B 1P3MD 3AZGD 3BFFA 3EPLA 3VH6T 4U0XA 3LELA 1ALQA 1ID3B 3TU4B 3KXBD 4GH9A 3KWQB 3AFAC 3AZFB 2R9WA 1S32C 3C4OA 5CPJD 4ZAMA 4ID4A 5E43A 3AZNA 4DRAA 3X1UC 2ZY3A 3HVFA 4BD0A 2Y2QA 2IO5C 4JJNC 1O7EA 4IBGA 4WYYA 3MVDB 3NBLA 3M2KA 4UUZA 1BZAA 1CI9A 2HP6A 5DTSA 3IF6A 5GXQC 3MZDA 1EQZC 3KSYA 3X1TA 4K0XA 3O88A 3G35A 4OP8A 3DTMA 4YS3A 5B1MA 4WJ3C 2X02A 3N7WA 3REKC 4DKIA 1CI8A 4E44A 5AV6B 4BENA 3M6BA 2XLNA 2H0TA 5GT0B 5CP6B 1PWCA 1PYYA 1MPLA 2J8PA 4OJLA 4LV2A 3REIC 4DDYA 3MVDA 4J8UD 5U47A 4FCFA 4OLDA 4IJFA 5FI6A 2WKEA 3VMAA 5FI2A 3R45B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WAF A;  5CGW A;  1TVF A;  1U60 A;  4C3Q A;  5FAT A;  2Y2O A;  1GHM A;  4Z9Q A;  3VOZ A;  3LY4 A;  4B4X A;  5EOE A;  1HVB A;  2XEP A;  3HLW A;  4N1X A;  3G31 A;  3PBR A;  1PWD A;  5AQ7 A;  4P87 A;  5GLC A;  3ISG A;  1WE4 A;  1MWS A;  1DJA A;  1SKF A;  3WS0 A;  1KGE A;  3EQU A;  3OCL A;  1K4F A;  1OME A;  2WAD A;  3G32 A;  4X53 A;  5CTN A;  5HAQ A;  2V2F F;  1ZG4 A;  2H5S A;  2ZQD A;  3D4F A;  3VSL A;  3WS5 A;  1LLB A;  2H0Y A;  4RX3 A;  5A90 A;  3IF6 B;  1MXO A;  3BFE A;  3I7J A;  2ZQ9 A;  1TDG A;  1H8Y A;  2ZJ9 A;  1YLJ A;  4DE2 A;  4E3J A;  2XR0 A;  3HLF A;  1KVL A;  2ZQ8 A;  4L0L A;  2XF3 A;  2P9V B;  5G18 A;  1NY0 A;  5HAP A;  4X56 A;  4GD6 A;  3HUO A;  4HBU A;  4IVI A;  3WS2 A;  5M18 A;  1ESU A;  4B4Z A;  4XXR A;  1PZP A;  2XK1 A;  2Y91 A;  5DVA A;  3ZCZ A;  4YFM A;  2Y59 A;  3ZG0 A;  1YQS A;  3HLD A;  3W4P A;  1G68 A;  4UA9 A;  2E8I A;  1L2S A;  1FSY A;  4NET A;  5CHM A;  3UDX A;  3VP3 A;  2WKI A;  3TG9 A;  3MFD A;  1N9B A;  4EBN A;  3VP0 A;  4JXG A;  3W4Q A;  1L0F A;  1KE4 A;  5CER A;  5M19 A;  1E3U D;  3PBT A;  1EI5 A;  4DE0 A;  1G6A A;  3UE0 A;  2V1Z A;  2ZC4 B;  4GNU A;  1FR6 A;  1IKG A;  4LCL A;  4S2J A;  4C6Y A;  4MBH A;  2EFX A;  1GA9 A;  2VGK A;  1IYQ A;  2XD1 A;  1S6R A;  3EQV A;  3GRJ A;  1JTG A;  5CEC A;  5CGS A;  3VOY A;  3VFH A;  1XX2 A;  1ZC2 A;  2G2U A;  4R3B A;  1K54 A;  2VGJ A;  4KZ3 A;  2FFF B;  2ZC3 B;  2QZ6 A;  3IXB A;  1BT5 A;  4HBT A;  4S2N C;  1PI4 A;  2HDS A;  2EXB A;  3C5A A;  4N1H A;  1L0D A;  2WAE A;  4B88 A;  5F82 A;  4FH4 A;  3NCK A;  4IED A;  4R0Q A;  2WYX A;  1N4O A;  1TEM A;  3HLE A;  4DDS A;  5GL9 A;  4EUZ A;  5FQK A;  4M3K A;  1W8Q A;  5FAP A;  3IWQ A;  4BLM A;  1ESI A;  4DXC A;  3A3E A;  1NZO A;  3FZC A;  5KZH A;  4LEN A;  1ES3 A;  1FSW A;  3IWI A;  3A3F A;  4QHC A;  5DF9 A;  5AQ9 A;  4P0M A;  3G34 A;  1MWT A;  5TGF A;  5KMW A;  3SS3 A;  3UN7 A;  1DJC A;  3CG5 A;  2Q9M A;  1K6R A;  2X01 A;  4KG6 A;  2XFS A;  1MWU A;  4Q8I A;  3N6I A;  2ZM8 A;  5HFO A;  4UAA A;  3VSK A;  4Y0T A;  5E2G A;  2OLU A;  3FYZ A;  3Q81 A;  4RVA A;  1SDN A;  1YLW A;  4DF6 A;  1XGJ A;  2WGI A;  1YLY A;  1KE3 A;  3NDE A;  3G30 A;  2XFT A;  5HAI A;  3Q7Z A;  4S2O A;  4X55 A;  3LY3 A;  2CC1 A;  1LI0 A;  1WYC A;  4GDN A;  4KZ5 A;  4X68 A;  2Y2I A;  1LL5 A;  1BLS A;  3OPH A;  3NY4 A;  3SS5 A;  1JWV A;  5FQJ A;  1BTL A;  2HP9 A;  4KZA A;  3S22 A;  1GA0 A;  3P09 A;  1FCM A;  4OPQ A;  2XQZ A;  4Y0O A;  1HZO A;  3UDI A;  5AQA A;  3WS4 A;  2ZQA A;  3GR2 A;  5CRF A;  3HLB A;  4EBL A;  4R3J A;  2FFY A;  3V3R A;  1QMF A;  5FAO A;  1XXM A;  1FR1 A;  2RCX A;  2Y2J A;  5FQ9 A;  4JLF A;  5FQI A;  1HD8 A;  4LV0 A;  3Q1F A;  4KZB A;  3PBQ A;  1W8Y A;  1GHP A;  3GMW A;  3NIA A;  4H8R A;  4JXS A;  4WMC D;  4Y7P A;  4K0W A;  3OZH A;  1QME A;  2IWD A;  3VP1 A;  3ZVT A;  2HDU A;  3RJU A;  5AQB A;  4DE1 A;  5E2H A;  1KVM A;  3HL9 A;  3IH9 A;  4OLG A;  4ZJ2 A;  1BLH A;  1PWG A;  1ERO A;  2ZLY A;  3FV7 A;  2ZM0 A;  1SDE A;  1K55 A;  5GLD A;  3O87 A;  3OCN A;  1MBL A;  4S2N A;  4F94 A;  4PM8 A;  4EWF A;  1BSG A;  3IWO A;  3ZG7 B;  1K57 C;  2P74 A;  4S2P A;  4JXV A;  1AXB A;  3ZG8 B;  2Y55 A;  4D2O A;  1MWR A;  4XUZ A;  2JBF A;  1O07 A;  3LCE A;  4R23 A;  4S2L A;  4MNR A;  2ZC6 B;  4OOY A;  3PAG A;  1KDS A;  5F83 A;  1E4D A;  5FAQ A;  3FKV A;  3ITA A;  4S2K A;  2PU2 A;  3MKF A;  1FCO A;  1KDW A;  2WUQ A;  4PM7 A;  4RYE A;  4QD4 A;  3BLS A;  3AGF A;  1XKZ A;  2WZZ A;  3A3J A;  3BYD A;  2UWX A;  3DWZ A;  3ZG9 B;  1PW8 A;  5GLA A;  4C75 A;  4E3I A;  5DTT A;  2GDN A;  1DY6 A;  3ITB A;  4PM6 A;  3UPN A;  4N92 A;  4QJG A;  3PTE A;  3UNW A;  3W8K A;  3IT9 A;  1I2W A;  1NJ4 A;  2BLS A;  3IQA A;  1RGZ A;  3BFG A;  2ZM2 A;  3G4P A;  3GSG A;  5GHX A;  1KGG A;  5D3O A;  1JWZ A;  5CED A;  1NYY A;  1W5D A;  4MEZ A;  3OPP A;  3ZGA B;  4WZ4 A;  4QU3 A;  3OC2 A;  2WZX A;  2C6W B;  1YLP A;  4GZB A;  1TDL A;  3O86 A;  1H5X A;  3OPL A;  3SH7 A;  3BEB A;  2HP5 A;  4ZJ3 A;  3V50 A;  2ZMA A;  2EX2 A;  4LCM A;  5DF7 A;  4QY5 A;  4YIN A;  3BLM A;  4E3N A;  3LEZ A;  3RXW A;  4JF4 A;  5GLB A;  1BLP A;  4HEF A;  4JPM A;  5GHY A;  3WRT A;  3VP2 A;  5BOH A;  5FSR A;  1YMS A;  5EVI C;  3C7U A;  3IXG A;  4ZBE A;  4BL3 A;  1IEM A;  1E3U A;  1RP5 A;  4GDB A;  2C5W B;  2Q9N A;  1JWP A;  4N9L A;  2XD5 A;  5F1F A;  3CMZ A;  3Q7V A;  3PAE A;  4UA7 A;  1MKI A;  3ZG5 A;  2HDR A;  4IBX A;  2WGV A;  2DCF A;  2G2W A;  3HBR A;  4KG5 A;  1NZU A;  4OQH A;  2J9P A;  3PBO A;  1XP4 A;  4QY6 A;  2PU4 A;  3G2Y A;  1ES2 A;  2EFU A;  3BM6 A;  3WRZ A;  3V5M A;  5JYP A;  4RX2 A;  2ZQ7 A;  3CJM A;  4PPR A;  4R4R A;  4WEJ A;  2WKH A;  3CZD A;  1WYB A;  3FKW A;  5GHZ A;  4BJP A;  5JYO A;  5L2F A;  1BUL A;  4WM9 A;  1VM1 A;  3ZVW A;  1K57 A;  4BL2 A;  4MBK A;  1LHY A;  5EE8 A;  5TFQ A;  3IHB A;  2WK0 A;  5FQQ A;  4P85 A;  1W7F A;  4EV4 A;  3HRE A;  1VQQ A;  4GN2 A;  4EQI A;  4KG2 A;  4K91 A;  3A3I A;  4UA6 A;  1Q2P A;  3TOI A;  2I72 A;  3MXR A;  4KZ8 A;  4BQM A;  1FCN A;  5HL1 A;  2EX9 A;  4WZ5 C;  1IEL A;  4KZ6 A;  4Y0U A;  4E3L A;  5HX9 A;  2DNS A;  3N8R A;  4PM9 A;  4GB7 A;  3RXX A;  1YT4 A;  1CEF A;  2ZD8 A;  4JF6 A;  4X69 A;  3LO7 A;  4LV3 A;  2H10 A;  3HUM A;  5EPH A;  4OQ0 A;  1Y54 A;  5EVI D;  5CEB A;  1FOF A;  3UO9 A;  1S0W A;  5KSH A;  3Q82 A;  4FH2 A;  3O3V A;  5A93 A;  3A3D A;  5EEC A;  4OQG A;  1IYS A;  2BG1 A;  4JKT A;  4S2M A;  5EOO A;  3N4I A;  4FSF A;  3V3S A;  1NRF A;  4OP5 A;  3SH9 A;  3UDF A;  4P6B A;  4OPZ A;  2Z2M B;  3GQZ A;  1EWZ A;  3M2J A;  1KGF A;  5CXW A;  4ZTK A;  4KZ7 A;  2JCH A;  1K6S A;  2OSU A;  4A5R A;  3MKE A;  5J8X A;  1PI5 A;  5FQM A;  2JE5 A;  3DW0 A;  1Z6F A;  3SS4 A;  1K54 C;  3NC8 A;  2EX8 A;  5EVI A;  4OPY A;  3SOI A;  5I94 A;  4N9K A;  5A92 A;  2EX6 A;  2A49 A;  5M1A A;  4KQO A;  1W79 A;  3VFF A;  1IKI A;  3GVB A;  4E6X A;  3Q7V B;  1CK3 A;  1JTD A;  3N8S A;  3NI9 A;  5CHU A;  3PBS A;  3IF6 C;  2Y2K A;  2WGW A;  4WMC A;  3C7V A;  3E2L A;  3N8L A;  3IHA A;  2Y2H A;  4PMA A;  5CTM A;  2J7V A;  3QHY A;  5EVL A;  4GKU A;  3ZNT A;  1M6K A;  4GOG A;  4DE3 A;  3M6H A;  2QMI A;  5E2F A;  1ZKJ A;  2IWB A;  2ZC7 A;  2B5R A;  3JYI A;  1SCW A;  2Z2L B;  2XGN A;  1J9M A;  4JBF A;  4WEK A;  4IVK A;  2R9X A;  2HDQ A;  4OOL A;  5KSC A;  3UPO A;  2DRW A;  3Q07 A;  1FQG A;  2Y2G A;  3C4P A;  5CHJ A;  4KQQ A;  3HUN A;  3HLG A;  4ZJ1 A;  1Q2Q A;  3UE1 A;  3QNC A;  4OQI A;  3UY6 A;  1XA1 A;  3FWL A;  1K4E A;  1MY8 A;  5IHV A;  1DJB A;  1YLT A;  3IH8 A;  3GTC A;  4CPK A;  4OPR A;  4WEL A;  2XH9 A;  1ERQ A;  1PIO A;  2OV5 A;  3MBZ A;  4ZDX A;  1HTZ A;  1RCJ A;  4E3O A;  2OLV A;  4WZ5 A;  5EUA A;  3BEC A;  3HLC A;  1BUE A;  3UE3 A;  3PBN A;  4O7D A;  3WWX A;  2HPB A;  1L0G A;  1M40 A;  1JVJ A;  2X71 A;  3BFF A;  4FD8 A;  5FDH A;  2EXA A;  2Y4A A;  5FA7 A;  4U0X A;  5E2E A;  1ALQ A;  5FAS A;  1K38 A;  4RA7 A;  4KEN B;  5F1G A;  3S4X A;  4R1G A;  5A91 A;  1ONG A;  2R9W A;  1YM1 A;  2PBY A;  1K56 D;  3G2Z A;  2J8Y A;  3C4O A;  4ZAM A;  1SHV A;  3DWK A;  1XA7 A;  4ID4 A;  4S2I A;  5HAR A;  1GHI A;  5E43 A;  1XGI A;  3BFC A;  4OOM A;  1ES5 A;  1ES4 A;  3HVF A;  3MZF A;  4LV1 A;  3V39 A;  3IF5 A;  4BD0 A;  1IYP A;  2Y2Q A;  2RL3 A;  1O7E A;  3WS1 A;  1I5Q A;  3SH8 A;  1NYM A;  4OH0 A;  4WYY A;  4OVD A;  4DXB A;  4QB8 A;  1K55 C;  1E25 A;  3NBL A;  3M2K A;  5EVI B;  4E3M A;  2XDM A;  1K56 A;  1BZA A;  4MBF A;  1CI9 A;  1LL9 A;  4U3T A;  1K25 A;  2HP6 A;  3W4O A;  2QPN A;  4GD8 A;  4NK3 A;  3ZFZ A;  5DTS A;  4BD1 A;  4OON A;  4EBP A;  4IBR A;  1L0E A;  3BFD A;  1ZG6 A;  3IF6 A;  3UPP A;  3MXS A;  2WGW B;  2Y2L A;  3P98 A;  3MZD A;  4WBG A;  3B3X A;  3S1Y A;  4JXW A;  5HW3 A;  1I2S A;  1LI9 A;  4R4S A;  1BLC A;  1XPB A;  4K0X A;  3MZE A;  4HES A;  3ZDJ A;  1IYO A;  2P9V A;  3AGE A;  3O88 A;  1H8Z A;  3G35 A;  4OP8 A;  4U0T A;  4KQR A;  3TSG A;  3DTM A;  2J9O A;  4JF5 A;  4E3K A;  2X02 A;  3N7W A;  4OKP A;  4DKI A;  2Y2P A;  1CI8 A;  4MLL A;  5DTK A;  2Y2N A;  1ONH A;  4BEN A;  3M6B A;  4KZ4 A;  1PW1 A;  2XLN A;  2V20 A;  2ZC5 B;  3VP4 A;  1YLZ A;  2H0T A;  4DRT A;  2Y2M A;  3OPR A;  2JC7 A;  4X6T A;  3NDG A;  1PWC A;  1PYY A;  5TR7 A;  2IWC A;  1MPL A;  4CJN A;  3ZHH A;  2A3U A;  3BRM A;  1C3B A;  3ZNY A;  1PZO A;  1YMX A;  4UHU A;  5FI7 A;  3E2K A;  2ZQC A;  4LV2 A;  4KZ9 A;  4DDY A;  3AGD A;  1NXY A;  5U47 A;  4E6W A;  1KE0 A;  1GCE A;  1ERM A;  4FCF A;  4OLD A;  3GV9 A;  5FI6 A;  5DF8 A;  2WKE A;  3IXH A;  5CGX A;  4XUX A;  4PM5 A;  1RGY A;  3VMA A;  1CEG A;  5FI2 A;  3IXD A;  3QNB A; 
#chains in the Genus database with same CATH topology
 3A0V A;  4EES A;  1U60 A;  4C3Q A;  3W96 C;  3VOZ A;  4HJ6 A;  1P3M B;  3LY4 A;  3AZG B;  4B4X A;  2JKT I;  5EOE A;  2XEP A;  3CPT A;  3NUL A;  1P3F B;  2HF6 A;  3PBR A;  4Y17 A;  3LIC A;  3ISG A;  3KXB B;  1L3L A;  3DTK A;  3H7W B;  5CPJ B;  2O99 A;  5HL6 A;  3LJA B;  3G32 A;  4XT2 B;  5HAQ A;  2V2F F;  2VK3 A;  3QP6 A;  3BFE A;  1Y28 A;  2HJ9 C;  2ZJ9 A;  1YLJ A;  4JGQ A;  2XR0 A;  4J8W B;  1UGU A;  3JVU A;  2XF3 A;  5CP6 A;  5G18 A;  5HAP A;  3HUO A;  4GHA A;  4Y3I A;  5B31 A;  2VEA A;  1YQS A;  3HLD A;  4HJ3 A;  1G68 A;  2O9B A;  4NEE D;  4ZUX C;  4CSR B;  4QLC D;  5AV9 D;  3O62 A;  4I3J A;  3S7P A;  1L0F A;  5F5Y A;  3W4Q A;  3AYW C;  5M19 A;  3PBT A;  3R45 A;  1EI5 A;  5FL3 A;  1G6A A;  3REH D;  4E04 A;  5B32 C;  1IKG A;  1YSQ A;  4LCL A;  3TE8 A;  3WTP A;  1P3M A;  1GA9 A;  2OWJ A;  3JPU A;  5G4Y A;  3MQL A;  3T1X A;  3GRJ A;  5DNN C;  5CEC A;  1P3F A;  5BNX B;  2PHY A;  5CGS A;  3VOY A;  3ZYT A;  1W2E A;  3AZL D;  3VFH A;  1ZC2 A;  2VGJ A;  3A1K A;  3KXB A;  2FFF B;  4WU8 C;  5AVF A;  2AVX A;  2EXB A;  1P3B C;  3LJA A;  1XJ2 A;  2WYX A;  1N4O A;  4DDS A;  5GL9 A;  1W8Q A;  3AZE C;  1LSV A;  3A3E A;  4J8W A;  1P3O A;  3W99 D;  4IBC A;  3IWI A;  4QHC A;  3A3F A;  3H9W A;  3SS3 A;  3X1V C;  4KHA B;  1K6R A;  5BPV A;  2X01 A;  4KG6 A;  2XFS A;  1MWU A;  5B1L D;  4DJ2 A;  4Z5T B;  4YM6 C;  1H3Q A;  1YU4 A;  4CSR A;  1F9I A;  4Y0T A;  3L9K A;  3RH8 B;  2HJE A;  4DF6 A;  4KQD A;  5DNM D;  3NDE A;  3G30 A;  1SZV A;  4X55 A;  4X68 A;  4H9R B;  4KGC D;  1BLS A;  3SS5 A;  3EG5 B;  3S22 A;  2HP9 A;  4KZA A;  3P09 A;  2V8F A;  1FCM A;  5BNX A;  2W0N A;  4GLQ A;  5F68 A;  5AQA A;  5IS1 A;  3GR2 A;  4NZ3 A;  3HLB A;  4EBL A;  3V3R A;  1QMF A;  2PYR A;  5FAO A;  4BBT A;  2RCX A;  3C1B D;  4MDZ A;  1N9N A;  5FQ9 A;  5GT3 D;  3B0C T;  3B33 A;  3Q1F A;  1M1A B;  1W8Y A;  1S4R A;  2W3E A;  3OZH A;  1QME A;  2HDU A;  1KVM A;  1BLH A;  2D01 A;  4QLC B;  1ERO A;  1M19 D;  2O0Y A;  3T12 B;  3E98 A;  1NLZ A;  3WD1 A;  1TZY D;  1KX3 B;  5B2I D;  2RVQ D;  4Z5T A;  1K57 C;  3REH B;  3UTB A;  4JXV A;  2Y55 A;  4XUZ A;  2JBF A;  4Q0J A;  3V67 A;  4R23 A;  4GHL A;  5FAQ A;  3PAG A;  1DP6 A;  2FJ7 A;  3B0D B;  3AN2 B;  3MKF A;  2WUQ A;  4PM7 A;  3CUE C;  2W1R A;  2WZZ A;  5K5B A;  1PW8 A;  4E3I A;  2JKG A;  2L0W A;  4YS3 C;  4L9G A;  4O0P A;  3W8K A;  2BLS A;  1RGZ A;  3REI D;  1KGG A;  5D3O A;  1ID3 C;  3TU4 C;  1NYY A;  3KWQ C;  3AZF C;  3W99 B;  4H9S A;  1P0Z A;  5BS7 A;  2C6W B;  3UB7 A;  1GXD A;  3SH7 A;  3BEB A;  2HP5 A;  3VH5 A;  1M1A A;  3C1C D;  5B1L B;  4M6B A;  2BYK B;  3VH6 A;  2YKH A;  3AZJ B;  2K2N A;  4HEF A;  3P01 A;  3K2N A;  3IXG A;  1IEM A;  1KX3 A;  5DNM B;  3T1Q B;  3V9R A;  4N9L A;  3PAE A;  4LD9 A;  3KFU G;  2L5A A;  3BY8 A;  4IBX A;  3CHW P;  2WGV A;  2F8N K;  2DCF A;  4LRZ E;  4KGC B;  3HBR A;  3AN2 A;  4XZQ D;  3BM6 A;  3CJM A;  4X1M A;  4WEJ A;  1UR9 A;  2Y79 A;  3L27 A;  5L2F A;  2RIQ A;  3MMH A;  3C1B B;  2BAS A;  2QYB A;  1HQ3 A;  3LZ0 D;  2NZD D;  5AV6 C;  3IHB A;  3P5J B;  2WK0 A;  5FQQ A;  1OJG A;  1YKD A;  4IBJ A;  5B31 G;  4NZ5 A;  2ZMV A;  3NOU C;  4EQI A;  5E5A A;  1T1C A;  5AVB B;  4K91 A;  4ME4 A;  5GT0 C;  1Q2P A;  3TOI A;  2I72 A;  4KZ8 A;  1M19 B;  1FCN A;  5CP6 C;  4WZ5 C;  3LR0 A;  1TZY B;  4JGP A;  1JNU A;  4CLC D;  4E3L A;  5B2I B;  4PM9 A;  1JFI B;  1YT4 A;  3AZJ A;  1DP9 A;  3N3F A;  3AL0 C;  1PFL A;  1Q9C A;  3HUM A;  5EPH A;  2J3T D;  1S0W A;  3EGD C;  1IYS A;  3T4T A;  1WA9 A;  4QNL A;  3SH9 A;  3UDF A;  3MGR A;  4OPZ A;  2Z2M B;  1P3M C;  3M2J A;  3AZG C;  4IBB A;  1P3F C;  4DJ3 A;  3DW0 A;  1Z6F A;  2EX8 A;  5EVI A;  3KXB C;  3SOI A;  1GSX A;  1E6P A;  4N9K A;  5B0Y B;  5CPJ C;  1W79 A;  4Q0H A;  3VFF A;  3C1C B;  1DP8 A;  2Y2K A;  1KU5 A;  2ZY4 A;  3A6N A;  2Y2H A;  3IHA A;  5AVB A;  4J8W C;  2V8C A;  3AZI B;  4WL9 A;  1M6K A;  3HJI A;  4GOG A;  4R3A A;  1XJ6 A;  3KUY B;  1M19 A;  3EPH A;  2IWB A;  1TZY A;  1SCW A;  2LB5 A;  5B2I A;  2Z2L B;  1JFI A;  4JBF A;  1P3I A;  3B6F B;  5KSC A;  2Y2G A;  1STZ A;  4ZJ1 A;  4BBU A;  4XZQ B;  3LEL D;  3GTC A;  5B24 B;  1Y4O A;  5C3I B;  1ERQ A;  3FDD A;  2B02 A;  3LZ1 B;  3MBZ A;  3AZH D;  2G5I C;  1HTZ A;  4OJO A;  4NXG A;  4ZDX A;  1BUE A;  3PBN A;  1P34 A;  3OLO A;  3E4O A;  1M40 A;  3LZ0 B;  3AZN D;  2NZD B;  4Y2F A;  1M18 B;  4FD8 A;  5FDH A;  2EXA A;  3LGO A;  5FA7 A;  2VA0 A;  2PT7 A;  1CJF A;  1SKO A;  3BW6 A;  4KEN B;  5B0Y A;  5DKL A;  4R1G A;  4CQH A;  5A91 A;  1YM1 A;  3GEC A;  3C1C A;  4QPR A;  4CLC B;  5HAR A;  1X0O A;  2W3F A;  1XGI A;  3B0B A;  1H3O B;  4OOM A;  4LV1 A;  2W1T B;  3AZI A;  3V39 A;  2RL3 A;  3KUY A;  3X1T D;  3WS1 A;  1I5Q A;  1F5M A;  1NYM A;  4OH0 A;  4QB8 A;  5HPI A;  2E8J A;  3LI9 A;  1K56 A;  3B6F A;  1LL9 A;  1K25 A;  3W4O A;  2QPN A;  3H0L C;  3ZFZ A;  1P9W A;  4BD1 A;  4OON A;  4EBP A;  4IBR A;  5B1M D;  3BFD A;  2WGW B;  4NXB A;  4LGW A;  2Y2L A;  2WKQ A;  3HCY A;  3AV1 A;  5B24 A;  4WBG A;  2PBD P;  3LR4 A;  1BLC A;  5AJG A;  3LZ1 A;  2D49 A;  2OAP 1;  1VEU B;  3NJA A;  3NQU A;  3MXQ A;  4HH2 A;  4JF5 A;  1M18 A;  3M7P A;  2Y2P A;  3MVD D;  5G49 B;  1KX5 A;  1PW1 A;  1EW0 A;  4DRT A;  2Y2M A;  1KX4 D;  2JC7 A;  3NDG A;  5TR7 A;  1H3O A;  5F69 A;  1C3B A;  1P3A B;  2W1T A;  5FI7 A;  4Z2H A;  4HGA B;  4QLC C;  5J3W A;  5B40 B;  3VOL A;  4E6W A;  1P9R A;  4ZBJ C;  3IX8 A;  3WAA B;  1KX3 C;  3IXH A;  2GX5 A;  4Q0I A;  1YAX A;  5BO0 A;  3REH C;  4PM5 A;  3AZH B;  3IXD A;  3QNB A;  2WAF A;  3IS2 B;  2F8N G;  4IBE A;  3B0D C;  3AZN B;  4Z9Q A;  4UQI M;  1HVB A;  5A8B A;  1ZLA B;  3AZM D;  3H0R C;  3MGQ A;  5TBM B;  1PWD A;  5AQ7 A;  4NE3 A;  2J3W A;  4YNR A;  1OTA A;  1MWS A;  4UUZ B;  4G3K A;  4RQ9 A;  5G4Z A;  3WS0 A;  3OCL A;  5B31 D;  1OME A;  1TS6 A;  1LLB A;  3IF6 B;  4H9Q A;  5G49 A;  3I7J A;  3W99 C;  3WA9 D;  4B93 A;  4DE2 A;  3IX4 A;  3O62 D;  3E4P A;  3X1T B;  3CAX A;  3HLF A;  2PR5 A;  2ZY5 A;  2ZQ8 A;  4L0L A;  5LBR A;  5B33 D;  4X56 A;  5B1L C;  4HBU A;  4IVI A;  4B4Z A;  5DVA A;  1P3A A;  2Y91 A;  3ZCZ A;  4J8V B;  3VH5 T;  3WTP D;  3AZJ C;  3T4S A;  2I9V A;  3C38 A;  5B1M B;  1S67 L;  2E8I A;  2HUE C;  5B40 A;  3UDX A;  5CHM A;  4OUI A;  1P3F D;  4NXF A;  4X23 D;  3REJ B;  3WAA A;  5DNM C;  1KE4 A;  1E3U D;  3AZH A;  2IA2 A;  5AV8 A;  4DE0 A;  3UE0 A;  3UMD A;  4KGC C;  2VV7 A;  3LJA D;  1FR6 A;  2CV5 A;  4HJ4 A;  1IYQ A;  5HWW A;  5GSU B;  4Z1W A;  1S6R A;  1LSX A;  3EQV A;  1JTG A;  4J8W D;  1ZLA A;  1P3O D;  5TBM A;  1FIK A;  4EEP A;  2G2U A;  4HBT A;  2ZC3 B;  2QZ6 A;  3IXB A;  1BT5 A;  4S2N C;  3C1B C;  3L28 A;  5I5L A;  4N1H A;  2YFW B;  1L0D A;  2WAE A;  5GT3 C;  4NYY A;  4IED A;  4ETX A;  1KX4 B;  2ARO B;  1TEM A;  1YU0 A;  5FQK A;  5CPK A;  1U35 B;  3G6O A;  5FAP A;  3IWQ A;  4EUV A;  4BLM A;  4DXC A;  2O9A A;  4Z2M H;  1M19 C;  3UB8 A;  5KMW A;  3CPT B;  4P0M A;  1TZY C;  1DJC A;  3CG5 A;  5B2I C;  2RVQ C;  1P97 A;  2Q9M A;  4J8V A;  3KX0 X;  5JRG B;  4UEY A;  4R8P B;  3REJ A;  1YLW A;  3AZM B;  2WGI A;  3KO6 A;  3FKE A;  1KE3 A;  4IBK A;  3SW1 A;  1LI0 A;  4R70 A;  4IBD A;  1LL5 A;  5B31 B;  3OPH A;  3NY4 A;  5GSU A;  1JWV A;  4GW9 A;  4OPQ A;  4I5S A;  3B42 A;  3UDI A;  3WS4 A;  3WA9 B;  3O62 B;  2VZW A;  2YFW A;  4II7 A;  1KX4 A;  4NKP A;  3C1C C;  2ARO A;  5B33 B;  1E6R A;  4Z5T D;  2CWE A;  1KS0 A;  3UTB D;  2KDK A;  4KZB A;  1U35 A;  5J7E A;  3WTP B;  4Y7P A;  4JXS A;  3ZVT A;  1N9L A;  4MN6 A;  2FJ7 D;  4DE1 A;  5KIZ A;  2DQN C;  2HIO A;  3K3C A;  4ZJ2 A;  1PWG A;  1TF1 A;  1BH8 A;  4X23 B;  2CMN A;  1UWP X;  1SDE A;  1K55 A;  4Z2G A;  4F94 A;  4NXE A;  3B6F C;  5JRG A;  3UB9 A;  4EWF A;  3IWO A;  2P74 A;  2HV1 A;  4R8P A;  1MWR A;  5AY8 A;  1O07 A;  4S2L A;  4XZQ C;  2ZC6 B;  4OOY A;  5F83 A;  3FKV A;  4S2K A;  1P3G B;  2PU2 A;  5C3I C;  3AZM A;  1P3O B;  1KDW A;  2PAV P;  4QD4 A;  3UT9 A;  3BLS A;  4IUH A;  3HJK A;  1M1A D;  3W98 A;  3LZ0 C;  2WKP A;  4PM6 A;  2NZD C;  1G6O A;  3DTI A;  1NJ4 A;  3BFG A;  3G4P A;  3WA9 A;  1W5D A;  2XRO A;  4HMC A;  3OC2 A;  2WZX A;  4GZB A;  5B33 A;  1KX3 D;  1H5X A;  4CLC C;  4LD9 D;  2EX2 A;  5DF7 A;  4EET B;  1S4S A;  2YFV B;  4QY5 A;  4WN5 A;  3B47 A;  4GCZ A;  3AN2 D;  4E3N A;  3RXW A;  5GLB A;  1F66 A;  1BLP A;  4X23 A;  5B32 G;  5FSR A;  2J3T C;  3C7U A;  1E3U A;  5F99 A;  1H0I A;  2F8N D;  2EA9 A;  2HDR A;  1HQ3 D;  1NZU A;  1W1T A;  1XP4 A;  4NZ1 A;  3G2Y A;  1XFQ A;  1P3G A;  5JYP A;  5E5A D;  2L1M A;  3CZD A;  1WYB A;  5JYO A;  5KDM B;  4WM9 A;  5CPI B;  2DF4 C;  1BFM A;  1VM1 A;  3UTB B;  1LHY A;  2WKR A;  5EE8 A;  1GPF A;  3AZJ D;  5AVC A;  4P85 A;  3HRE A;  1VQQ A;  3OBF A;  4KG2 A;  4HP4 A;  2FJ7 B;  3A3I A;  3AV2 A;  3MXR A;  4BQM A;  1YUE A;  4XUJ A;  2ZY2 A;  1IEL A;  2INW A;  4KZ6 A;  4Y0U A;  2YFV A;  3RXX A;  3MGR D;  1LL8 A;  4HGA C;  4WF0 A;  4EQ1 A;  1CEF A;  2ZD8 A;  2JHE A;  4X69 A;  1PZR A;  3VV4 A;  5B40 C;  4MN7 A;  3LEL C;  1CQA A;  4EER A;  4OQ0 A;  5EVI D;  1FOF A;  4G91 B;  5KSH A;  3AZH C;  5A93 A;  4S2M A;  4Y15 A;  4ARZ A;  3N4I A;  4HI4 A;  3AZN C;  1EWZ A;  1KGF A;  4ZTK A;  3A6N D;  5AVB D;  1ZLA C;  2JE5 A;  4IJG A;  4KUD A;  3NC8 A;  5KDM A;  1VB6 A;  4OPY A;  3MGP B;  5CPI A;  2EX6 A;  2GZA A;  4KQO A;  3U2A A;  3V9R B;  1P3I D;  4LD9 B;  3NI9 A;  5CHU A;  3IF6 C;  3C7V A;  3E2L A;  2L4R A;  5AV5 B;  3X1T C;  2J7V A;  3L2A A;  3QHY A;  3ZNT A;  2RTS A;  2XA7 M;  4AFI A;  5E2F A;  2ZC7 A;  4O01 A;  2B5R A;  3UB6 A;  1OTI A;  2XGN A;  2XRN A;  4J8V C;  2F8N B;  2R9X A;  5B1M C;  3LIE A;  1P34 D;  1YU1 A;  3UPO A;  2DRW A;  1FQG A;  1HQ3 B;  3LR5 A;  3QP2 A;  4OQI A;  4LFU A;  3REJ C;  1XA1 A;  3L25 A;  1T1B A;  1MY8 A;  5B0Z A;  3IX3 A;  4MMN A;  4CPK A;  5E5A B;  3UTA B;  5B0Y D;  2OV5 A;  1RCJ A;  2P04 A;  1FIL A;  4E3O A;  2OLV A;  5HPF A;  3B6G B;  3BEC A;  4O7D A;  1ZTU A;  1YPR A;  4I38 A;  1L0G A;  2PD7 A;  3PHY A;  5DFX A;  3AZI D;  3AZK A;  3MVD C;  3KUY D;  3IBR A;  5E2E A;  5FAS A;  3MGP A;  1K38 A;  1P3P A;  1KX4 C;  2H28 A;  1K56 D;  3G2Z A;  3B6F D;  3CIT A;  1V9Y A;  1XA7 A;  1U35 C;  1P3L A;  4WU9 A;  1BYW A;  4DMZ A;  3MGR B;  5AV5 A;  1AOI A;  1J3W A;  1ES4 A;  3CI6 A;  4FOF A;  3AV1 D;  5B24 D;  2JSS A;  4Y5F A;  4DXB A;  1TD5 A;  3W97 B;  3DTE A;  3LZ1 D;  3MR0 A;  1K55 C;  1E25 A;  5EVI B;  4E3M A;  2XDM A;  2F8N A;  3LYX A;  5JRG C;  4MBF A;  2Q0O A;  1W63 Q;  4U3T A;  4GD8 A;  4NK3 A;  4IBF A;  1M18 D;  1L0E A;  3T4J A;  3UPP A;  4NG2 A;  3EGX C;  3A6N B;  1H8M A;  4X25 A;  3UTA A;  2K31 A;  1BH9 B;  1WWI A;  3AZM C;  1KX5 D;  5L09 A;  1LI9 A;  4AWL B;  3ZDJ A;  3MZE A;  4HES A;  4JJN B;  1IYO A;  2P9V A;  1E6N A;  2PYP A;  3AGE A;  1H8Z A;  3B6G A;  3TSG A;  4KQR A;  5B31 C;  3ICY A;  2J9O A;  3REL D;  1P3I B;  1ODV A;  4E3K A;  4BWI A;  1OT6 A;  4MLL A;  5EV0 A;  5JA4 A;  5DTK A;  1A0K A;  2W8S A;  1T19 A;  2W3D A;  3TJZ C;  3WA9 C;  1VHM A;  3O62 C;  2V20 A;  2ZC5 B;  3VP4 A;  1YLZ A;  3BQA A;  5B33 C;  1S1Y A;  4DN0 A;  3P7N A;  4CJN A;  3WTP C;  3MNN A;  3BRM A;  1S1Z A;  4EW7 A;  1P34 B;  1PZO A;  4UHU A;  3S7N A;  3E2K A;  4Z66 D;  4X23 C;  3W97 A;  1NXY A;  1KE0 A;  1ERM A;  1SKO B;  5DF8 A;  3MGQ D;  1ACF A;  3QP5 A;  3LI8 A;  3AFA A;  1T1A A;  2JKR M;  3LJA C;  1CEG A;  3NOP C;  4MB3 A;  4QWO A;  4L9F A;  5CGW A;  4M4X A;  3O5Y A;  5HZH A;  1P3G C;  3X1U A;  1W63 M;  1BH9 A;  1P3O C;  4HIA A;  4JJN A;  5BT1 D;  1D7E A;  4N1X A;  2V0W A;  5L8M A;  1DJA A;  1KGE A;  1P3A D;  3EEH A;  1XFN A;  4X53 A;  5CTN A;  2KLI A;  1ZG4 A;  2H5S A;  3D4F A;  2H0Y A;  5A90 A;  5B40 D;  5GXQ A;  3AV1 B;  1TDG A;  1H8Y A;  1EQZ A;  4UQI S;  3WAA D;  1P3K D;  2PYO D;  4NFT A;  1KVL A;  1E8B A;  3PXP A;  5AV8 D;  1NY0 A;  4GD6 A;  1ESU A;  5B2J B;  1E15 A;  2CV5 D;  2Y59 A;  3ZG0 A;  3W4P A;  3NQU B;  4UA9 A;  4MB4 A;  3REK A;  2UV0 E;  1FSY A;  3TG9 A;  1F1E A;  3MFD A;  1ZLA D;  3VP0 A;  1KX5 B;  5CER A;  5FEF A;  3ZQ5 A;  3BQ8 A;  4EXO A;  2ZC4 B;  4H9P A;  3BJN A;  1N1J B;  3REL B;  4MBH A;  2EFX A;  5CPK D;  4GS9 A;  4CLC E;  2JKR I;  2XD1 A;  1MZU A;  1XX2 A;  1K54 A;  3KSI A;  4KZ3 A;  5CPI C;  2J80 A;  1PI4 A;  2HDS A;  4Z5T C;  5F82 A;  4FH4 A;  5BO0 B;  3UTB C;  4R0Q A;  4J8V D;  3HLE A;  1G5U A;  3LIF A;  1TS0 A;  4NY2 A;  2FJ7 C;  4Z66 B;  3W96 A;  1ESI A;  3REJ D;  3VH5 W;  5AQ9 A;  5TGF A;  5FDS A;  3G34 A;  1MWT A;  4PAU A;  3F1N A;  3UN7 A;  3VH6 W;  3MGQ B;  3WX7 A;  5HD5 A;  5B2J A;  4Q8I A;  5CHL B;  3UB5 P;  5HFO A;  5GSU D;  2VGL M;  1T18 A;  4UAA A;  2OLU A;  3FYZ A;  1NRJ A;  4H9Q B;  4RVA A;  1SDN A;  3MGS D;  4G91 C;  4H9S C;  5BS7 C;  2EWW A;  3MQO A;  1M1A C;  1N1J A;  2ARO D;  5HAI A;  4S2O A;  3REL A;  2CC1 A;  4GDN A;  2Y2I A;  2F2A C;  1U35 D;  4Z2J A;  4TX8 A;  1BTL A;  1GA0 A;  1GSV A;  4HME A;  4ZUX A;  1HZO A;  1W1V A;  2HIO D;  3MGP C;  2ZQA A;  5CRF A;  1P3K B;  2PYO B;  4ZRR A;  1XXM A;  5JRG D;  4LD9 C;  3VE3 A;  5AV8 B;  4JLF A;  4LV0 A;  5B32 A;  3C2W A;  3PBQ A;  4R8P D;  2CV5 B;  1NLY A;  4Z66 A;  5AY8 D;  4Z2K A;  3GMW A;  3AN2 C;  2NQB D;  4H8R A;  5AVE A;  4K0W A;  3RJU A;  5AQB A;  4D60 A;  3OOV A;  5E2H A;  5DNN A;  3WKJ D;  4LRY C;  2ZLY A;  3FV7 A;  3UT9 D;  2V5O A;  2ZM0 A;  3F1P B;  4IBI A;  4WU8 A;  5GLD A;  4PM8 A;  1P3B A;  4G3W A;  1OT9 A;  3W98 D;  1HQ3 C;  4HP9 A;  1AXB A;  4D2O A;  5HDC A;  5EM1 A;  5CPK B;  3AZE A;  5E5A C;  3ITA A;  3UTA C;  1FCO A;  3UE6 A;  2ZL1 A;  1LT0 A;  4RYE A;  3AGF A;  1UWN X;  1XKZ A;  3X1V A;  3BYD A;  3B6G C;  3BWL A;  3DWZ A;  5GLA A;  5DTT A;  3ITB A;  3IP4 C;  4N92 A;  4YM6 A;  3UNW A;  3GSG A;  5GHX A;  1F66 D;  1P3K A;  2PYO A;  3ZGA B;  4MEZ A;  1O6I A;  1J7M A;  1YSP A;  4WZ4 A;  4QU3 A;  5F99 D;  1YLP A;  3O86 A;  3OPL A;  3WD2 A;  3MGR C;  2ZMA A;  3H82 B;  3BLM A;  1P3G D;  3X1S B;  4JF4 A;  1PRQ A;  3W97 C;  3VP2 A;  5EVI C;  3F1P A;  3MGS B;  4ZBE A;  3BY9 A;  4BL3 A;  1RP5 A;  4ESP A;  3MQ0 A;  2Q9N A;  2MJ6 A;  1ULY A;  1JWP A;  5F1F A;  2XD5 A;  3R7W A;  3Q7V A;  1MKI A;  3ZG5 A;  3R4K A;  2G2W A;  4KG5 A;  3FC7 A;  3A6N C;  5AVC D;  2PU4 A;  5AVB C;  1ES2 A;  3WRZ A;  5DJU A;  3V5M A;  4AWL C;  2ZQ7 A;  4PPR A;  2HIO B;  4CAY A;  2WKH A;  4I3A A;  3AV2 D;  2M1C A;  1BH8 B;  4BJP A;  2V0U A;  1BUL A;  4XUJ D;  1P3I C;  1K57 A;  4MBK A;  5EFW A;  5TFQ A;  5AY8 B;  2NQB B;  4EV4 A;  2VV8 A;  3WKJ B;  3UT9 B;  2EX9 A;  1TAF B;  3H82 A;  2ZOH A;  3E0Y A;  2DNS A;  1P34 C;  3N8R A;  5EM0 A;  3W98 B;  4P6Z M;  3WD3 A;  2Z6C A;  2DMW A;  3X1S A;  2VJW A;  3MGS A;  4KUD D;  5B0Y C;  1ID3 A;  3TU4 A;  1Y54 A;  1GSW A;  3KWQ A;  5CEB A;  3AZF A;  2ZBB A;  1GOI A;  4FH2 A;  5CPI D;  1OTB A;  3O3V A;  4YOF A;  2K7S A;  3A3D A;  4JKT A;  2BG1 A;  2LY8 A;  5EOO A;  4FSF A;  1NRF A;  4I39 A;  4NE6 A;  4DQY B;  3EPJ A;  3AZI C;  4KZ7 A;  3W2Z A;  1K6S A;  3KUY C;  3MF0 A;  3WTP E;  2VX8 A;  4A5R A;  1PI5 A;  5FQM A;  1F66 B;  3SS4 A;  1K54 C;  3RFB A;  5I94 A;  3EOI A;  5HWV A;  5F99 B;  5M1A A;  1CK3 A;  3N8S A;  4J8X D;  2FH5 A;  3PBS A;  3T4K A;  3U4L P;  2NQB A;  5MC7 A;  4JGO A;  3AV1 C;  5B24 C;  2GJ3 A;  5CTM A;  3WKJ A;  2B95 A;  2ZOI A;  4GKU A;  4DE3 A;  5B0Z D;  2QMI A;  3LZ1 C;  1ZKJ A;  1CXW A;  1TAF A;  2QJ7 A;  3JYI A;  5B2J C;  2V9A A;  2HDQ A;  1M18 C;  3Q07 A;  3DBA A;  5CHJ A;  4EEU A;  4KQQ A;  3HUN A;  1PNE A;  3HLG A;  3UE1 A;  3B0C W;  5AV6 A;  3UY6 A;  5AVC B;  3FWL A;  3AZK D;  4WV4 B;  1K4E A;  1KX5 C;  5IHV A;  1YLT A;  1ZHH B;  2ACG A;  2R78 A;  3MGP D;  2XA7 S;  4WEL A;  2XH9 A;  1P3P D;  5GT0 A;  3AV2 B;  1PIO A;  3KS4 A;  4WLA A;  2JKF A;  3MJQ A;  4WZ5 A;  3REL C;  5EUA A;  4XUJ B;  2A2L A;  3HLC A;  3UE3 A;  1P3L D;  3WWX A;  2W27 A;  4WU9 D;  1D1J A;  5AV5 D;  1AOI D;  4Z2M G;  2X71 A;  4LRX C;  2Y4A A;  1LSW A;  4RA7 A;  5F1G A;  4HY8 A;  3S4X A;  1ONG A;  2PBY A;  2J8Y A;  2FZ0 A;  1SHV A;  4KUK A;  4UPK A;  3DWK A;  4S2I A;  3MQQ A;  4ARZ B;  1GHI A;  3BFC A;  4Z66 C;  1ES5 A;  3AZG A;  3MZF A;  3IF5 A;  1IYP A;  2QWS A;  2P08 A;  3D9Y A;  3UTA D;  3PYP A;  3SH8 A;  3MGQ C;  4OVD A;  4KUD B;  4OJ5 A;  4Z2L A;  4ETZ A;  2ZM5 A;  3B6G D;  3H7W A;  5CPJ A;  1HTA A;  4XT2 A;  1ZG6 A;  3MXS A;  2P7J A;  3P98 A;  5L10 A;  2PDR A;  3F1O B;  5BT1 C;  4IHQ A;  3B3X A;  2BTF P;  3S1Y A;  4JXW A;  1XJ3 A;  1I2S A;  4R4S A;  4JGR A;  5HW3 A;  1XPB A;  4J8U B;  2ZMF A;  2OWH A;  4U0T A;  1P3A C;  1QO6 A;  4MCW A;  3MNN D;  4OKP A;  4J8X B;  4PKY G;  3LFV A;  2PRF A;  2Y2N A;  1ONH A;  3WD4 A;  3WAA C;  3W97 D;  1P3K C;  2PYO C;  4KZ4 A;  4EO5 B;  5B0Z B;  4E45 A;  5AV8 C;  3AFA D;  1B6W A;  3OPR A;  4GJ4 A;  4HNB A;  4X6T A;  3EPK A;  1S32 D;  2CV5 C;  2IWC A;  3ZHH A;  2A3U A;  3ZNY A;  1YMX A;  2ZQC A;  3CLO A;  3X1U D;  4KZ9 A;  3AGD A;  5FUG B;  3AZK B;  4JJN D;  1GCE A;  3GV9 A;  5CGX A;  1P3P B;  4XUX A;  1RGY A;  3MFX A;  3D72 A;  5DFY A;  2B18 A;  1OGG A;  5CPK C;  1P3L B;  1TVF A;  4WU9 B;  3F1O A;  5FAT A;  2Y2O A;  1AOI B;  1GHM A;  5GXQ D;  4HHD A;  3NOT C;  4J8U A;  1EQZ D;  3HLW A;  4G92 B;  3G31 A;  5AV9 B;  4KHA A;  4P87 A;  5GLC A;  3ULF A;  4ZBJ B;  1WE4 A;  3FPW A;  1AIW A;  1SKF A;  3EQU A;  4J8X A;  5L07 A;  1K4F A;  2WAD A;  3VSL A;  2ZQD A;  3CWF A;  3WS5 A;  3REK D;  4FTX A;  4RX3 A;  1MXO A;  3WD0 A;  1E6Z A;  2ZQ9 A;  4E3J A;  1CF0 A;  3AZL B;  3LID A;  1H0M A;  2P9V B;  4H9R A;  5HDS A;  5M18 A;  3WS2 A;  4XXR A;  1PZP A;  2XK1 A;  5IT5 A;  5GSU C;  4YFM A;  5IU1 A;  3X1S C;  3KS8 A;  3HON A;  1VET B;  4H9O B;  1L2S A;  5FUG A;  4NET A;  3SZT A;  3VP3 A;  5JA4 B;  1PDC A;  3MGS C;  2WKI A;  1N9B A;  4EBN A;  2V1A A;  4JXG A;  2NUP C;  4Z2I A;  3L26 A;  2ARO C;  2V1Z A;  3KYZ A;  3HSH A;  4O8G A;  4GNU A;  1YU3 A;  4S2J A;  4C6Y A;  4DRB A;  3MNN B;  1R4V A;  1IFQ A;  2VGK A;  5J4E A;  3W96 D;  1UR8 A;  2HIO C;  4YWZ A;  2HUE B;  4QLC A;  5AV9 A;  3EEA A;  4R38 A;  4R3B A;  3QP4 A;  3T1R A;  2BYM B;  1S66 L;  3C5A A;  4B88 A;  1MC0 A;  5B2J D;  3REH A;  4IJE A;  3NCK A;  3L29 A;  3AFA B;  2VV6 A;  5DJT A;  5DKK A;  1S32 B;  4R8P C;  4NYU A;  4EUZ A;  5AY8 C;  2NQB C;  4M3K A;  3T4L A;  3X1U B;  1NZO A;  3WKJ C;  3FZC A;  5KZH A;  2OAQ 1;  4LEN A;  3AZL A;  1ES3 A;  2IO5 B;  1FSW A;  3UT9 C;  5DF9 A;  1OPX A;  1V9Z A;  3W98 C;  3QP1 A;  3LR3 A;  1F98 A;  3N6I A;  1L6J A;  2ZM8 A;  5GT3 B;  1VET A;  4H9O A;  1ED7 A;  5HWT A;  1KOU A;  2PR6 A;  3A0S A;  3VSK A;  5E2G A;  4ZUX D;  5GXQ B;  1D06 A;  3Q81 A;  3W99 A;  2YKF A;  1XGJ A;  1EQZ B;  4G3V A;  3AYW D;  1YLY A;  2XFT A;  4E6X A;  3Q7Z A;  3LY3 A;  4KZ5 A;  2VQR A;  5B1L A;  1WYC A;  2BYK A;  5B32 D;  1F2K A;  3FPV A;  5FQJ A;  2VGL S;  1XJ4 A;  1F66 C;  3REK B;  2XQZ A;  2VKS A;  4Y0O A;  5DNN D;  2BYM A;  4NE5 A;  5F99 C;  3S7Q A;  3VE4 A;  5DNM A;  4R3J A;  2FFY A;  4WU8 D;  4MB5 A;  1FR1 A;  4K08 A;  5BNV B;  1S32 A;  2Y2J A;  1P3B D;  5FQI A;  1HD8 A;  3TW8 A;  4H9P B;  2NUT C;  4KGC A;  1GHP A;  3NQJ B;  3NIA A;  4WMC D;  4GS9 B;  1E88 A;  3VP1 A;  2IWD A;  4HH3 A;  3AZE D;  4FUW A;  3HL9 A;  3IH9 A;  4OLG A;  1TS7 A;  3REI B;  3O87 A;  3OCN A;  1MBL A;  3X1V D;  4S2N A;  3C1B A;  1OJ5 A;  1BSG A;  3ZG7 B;  5GT3 A;  4HMD A;  4S2P A;  3ZG8 B;  3H0M C;  2W3G A;  3DAV A;  5AVC C;  4YM6 D;  3LCE A;  4Y13 A;  4MNR A;  2IOU A;  2KOI A;  1KDS A;  1E4D A;  3W96 B;  3AV2 C;  3QP8 A;  3F1N B;  4XUJ C;  3A3J A;  2UWX A;  3KYE A;  2M7V A;  3ZG9 B;  4C75 A;  1H8P A;  2GDN A;  1DY6 A;  3UPN A;  4QJG A;  5F6A A;  3PTE A;  3IT9 A;  1I2W A;  3K3D A;  3IQA A;  5FEG A;  2ZM2 A;  2D02 A;  2F8N H;  1JWZ A;  5CED A;  3OPP A;  5HSQ A;  1W1P A;  5BNV A;  1TDL A;  1Z09 A;  1G28 A;  4ZJ3 A;  3T4Q A;  3C30 A;  1N9O A;  3V50 A;  3NQJ A;  5CX7 A;  4LCM A;  1MKM A;  4YIN A;  1TS8 A;  3LEZ A;  3REI A;  5GHY A;  3WRT A;  4JPM A;  5BOH A;  4KUD C;  4ZUX B;  2HZ5 A;  1YMS A;  4B9O A;  1OGB A;  4GDB A;  2C5W B;  3UME A;  2G5H C;  4LG2 A;  3AYW B;  3CMZ A;  1Z2C B;  4UA7 A;  1WWS A;  5B32 B;  4OQH A;  4WNN B;  2J9P A;  3PBO A;  4QY6 A;  4BMW A;  2EFU A;  1H0G A;  3GDI A;  4RX2 A;  4J8U C;  4R4R A;  5DNN B;  3FKW A;  5GHZ A;  2Y8H A;  4WU8 B;  3PR6 A;  1DRM A;  2W3H A;  3ZVW A;  1W1Y A;  1P3B B;  4J8X C;  1EAK A;  4BL2 A;  4OJP A;  4YS3 D;  3X1S D;  1CK7 A;  1W7F A;  3T4O A;  4XZQ A;  4EO5 C;  1A7W A;  4GN2 A;  5B0Z C;  3AZE B;  3KYQ A;  4HQA A;  2M7U A;  1ID3 D;  3TU4 D;  4UA6 A;  3KWQ D;  3AZF D;  2ZL1 B;  5HL1 A;  4IUK A;  3X1V B;  3MSH A;  4NZ4 A;  5HX9 A;  4GB7 A;  3LZ0 A;  2NZD A;  3F6T A;  4JF6 A;  2PD8 A;  4YM6 B;  1YU2 A;  3LO7 A;  3AZK C;  4LV3 A;  2H10 A;  4H9N B;  1P3P C;  1K0K A;  3UO9 A;  3AYW A;  3Q82 A;  2V1B A;  5EEC A;  4OQG A;  1T3U A;  4CLC A;  1P3L C;  3V3S A;  4WU9 C;  4OP5 A;  5C5K A;  4WNN A;  4P6B A;  5TJJ A;  5AV5 C;  1AOI C;  3GQZ A;  1OTD A;  4P6Z S;  5CXW A;  2JCH A;  2OSU A;  4H6J B;  4KUO A;  3MKE A;  5J8X A;  4G92 C;  4EU0 A;  4OJ6 A;  5AV9 C;  3LEL B;  2VLG A;  2KX6 A;  2QJ5 A;  5A92 A;  2A49 A;  2QHK A;  1IKI A;  3GVB A;  3R7W B;  3Q7V B;  4R6L A;  1JTD A;  2WGW A;  4WMC A;  2GNX A;  1HLU P;  3N8L A;  5AV6 D;  4PMA A;  5EVL A;  3AZL C;  3M6H A;  3TRC A;  4CAY B;  5GT0 D;  5EVE A;  1VEU A;  2G7U A;  4WZS B;  5CP6 D;  1J9M A;  4WEK A;  4IVK A;  4I3I A;  4OOL A;  1B67 A;  3C4P A;  1Q2Q A;  3RTY A;  3QNC A;  3LUQ A;  4LLO B;  5HDD A;  4H9N A;  1DJB A;  3IH8 A;  3LEQ A;  4OPR A;  3LIB A;  3D3O A;  4PKY A;  3E4Q A;  4MN5 A;  3A1I A;  3KSG A;  3FG8 A;  3MNN C;  4X1L A;  3EWK A;  1NWZ A;  2HPB A;  4H6J A;  1JVJ A;  4YS3 B;  1P3M D;  3AZG D;  3BFF A;  5HD3 A;  2LB9 A;  4HOI A;  3EPL A;  3VH6 T;  4U0X A;  3LEL A;  1ALQ A;  1ID3 B;  3TU4 B;  3KXB D;  4GH9 A;  3KWQ B;  3AFA C;  3AZF B;  4GHI B;  2R9W A;  4F3L B;  3LIA A;  3C8C A;  1S32 C;  3C4O A;  5CPJ D;  4ZAM A;  4ID4 A;  3IS2 A;  2QKP A;  5E43 A;  2XSS A;  3MS6 A;  4WUJ A;  3AZN A;  4DRA A;  2JN7 A;  3X1U C;  3KSF A;  2ZY3 A;  3HVF A;  3L7H A;  4BD0 A;  2Y2Q A;  2IO5 C;  4JJN C;  1O7E A;  4IBG A;  4WYY A;  2EWV A;  3MVD B;  3NBL A;  3M2K A;  4UUZ A;  2A24 B;  1AWI A;  1BZA A;  1CI9 A;  2HP6 A;  5DTS A;  2JKT M;  3A0R A;  3IF6 A;  3NEC A;  5GXQ C;  3MZD A;  1EQZ C;  3KSY A;  3X1T A;  3JVV A;  4K0X A;  4BBV A;  3T1S A;  3O88 A;  3CUE A;  3G35 A;  4LPZ A;  4OP8 A;  3DTM A;  4PHT A;  4YS3 A;  5B1M A;  4WJ3 C;  2X02 A;  3N7W A;  3REK C;  3NHQ A;  4DKI A;  1CI8 A;  4E44 A;  3IBJ A;  5AV6 B;  2OOL A;  4BEN A;  3M6B A;  2XLN A;  1IOU A;  4GHI A;  4F3L A;  2H0T A;  3T50 A;  5GT0 B;  4L9E A;  5CP6 B;  1PWC A;  1PYY A;  1MPL A;  1OTE A;  2J8P A;  4OJL A;  2Z6D A;  4LV2 A;  3REI C;  4DDY A;  3MVD A;  3S7O A;  4J8U D;  2HGV A;  5U47 A;  3KSH A;  4FCF A;  2FN2 A;  2O9C A;  4IJF A;  4OLD A;  5FI6 A;  2WKE A;  2A24 A;  3VMA A;  5FI2 A;  3R45 B; 
#chains in the Genus database with same CATH homology
 1U60 A;  4C3Q A;  3W96 C;  3VOZ A;  1P3M B;  3LY4 A;  3AZG B;  4B4X A;  5EOE A;  2XEP A;  1P3F B;  3PBR A;  3ISG A;  3KXB B;  5CPJ B;  3LJA B;  3G32 A;  5HAQ A;  2V2F F;  3BFE A;  2ZJ9 A;  1YLJ A;  2XR0 A;  4J8W B;  2XF3 A;  5CP6 A;  5G18 A;  5HAP A;  3HUO A;  4GHA A;  5B31 A;  1YQS A;  3HLD A;  1G68 A;  4ZUX C;  4CSR B;  4QLC D;  5AV9 D;  3O62 A;  3W4Q A;  1L0F A;  3AYW C;  5M19 A;  3PBT A;  3R45 A;  1EI5 A;  1G6A A;  3REH D;  5B32 C;  1IKG A;  4LCL A;  3WTP A;  1P3M A;  1GA9 A;  3GRJ A;  5DNN C;  5CEC A;  1P3F A;  5BNX B;  5CGS A;  3VOY A;  1W2E A;  3AZL D;  3VFH A;  1ZC2 A;  2VGJ A;  3A1K A;  3KXB A;  2FFF B;  4WU8 C;  2EXB A;  1P3B C;  3LJA A;  2WYX A;  1N4O A;  4DDS A;  5GL9 A;  1W8Q A;  3AZE C;  3A3E A;  4J8W A;  1P3O A;  3W99 D;  4IBC A;  3IWI A;  4QHC A;  3A3F A;  3SS3 A;  3X1V C;  4KHA B;  1K6R A;  5BPV A;  2X01 A;  4KG6 A;  2XFS A;  1MWU A;  5B1L D;  4Z5T B;  4YM6 C;  1YU4 A;  4CSR A;  4Y0T A;  4DF6 A;  5DNM D;  3NDE A;  3G30 A;  4X55 A;  4X68 A;  4H9R B;  4KGC D;  1BLS A;  3SS5 A;  3EG5 B;  3S22 A;  2HP9 A;  4KZA A;  3P09 A;  1FCM A;  5BNX A;  5AQA A;  3GR2 A;  4NZ3 A;  3HLB A;  4EBL A;  3V3R A;  1QMF A;  5FAO A;  2RCX A;  3C1B D;  5FQ9 A;  5GT3 D;  3B0C T;  3Q1F A;  1M1A B;  1W8Y A;  3OZH A;  1QME A;  2HDU A;  1KVM A;  1BLH A;  4QLC B;  1ERO A;  1M19 D;  1TZY D;  1KX3 B;  5B2I D;  2RVQ D;  4Z5T A;  1K57 C;  3REH B;  3UTB A;  4JXV A;  2Y55 A;  4XUZ A;  2JBF A;  4R23 A;  4GHL A;  5FAQ A;  3PAG A;  2FJ7 A;  3B0D B;  3AN2 B;  3MKF A;  2WUQ A;  4PM7 A;  2WZZ A;  1PW8 A;  4E3I A;  4YS3 C;  3W8K A;  2BLS A;  1RGZ A;  3REI D;  1KGG A;  5D3O A;  1ID3 C;  3TU4 C;  1NYY A;  3KWQ C;  3AZF C;  3W99 B;  4H9S A;  5BS7 A;  2C6W B;  3SH7 A;  3BEB A;  2HP5 A;  3VH5 A;  1M1A A;  3C1C D;  5B1L B;  4M6B A;  2BYK B;  3VH6 A;  3AZJ B;  4HEF A;  3IXG A;  1IEM A;  1KX3 A;  5DNM B;  3V9R A;  4N9L A;  3PAE A;  4LD9 A;  3KFU G;  2L5A A;  4IBX A;  2WGV A;  2F8N K;  2DCF A;  4KGC B;  3HBR A;  3AN2 A;  4XZQ D;  3BM6 A;  3CJM A;  4WEJ A;  3L27 A;  5L2F A;  2RIQ A;  3C1B B;  1HQ3 A;  3LZ0 D;  2NZD D;  5AV6 C;  3IHB A;  3P5J B;  2WK0 A;  5FQQ A;  4IBJ A;  5B31 G;  4NZ5 A;  4EQI A;  5E5A A;  5AVB B;  4K91 A;  5GT0 C;  1Q2P A;  3TOI A;  2I72 A;  4KZ8 A;  1M19 B;  1FCN A;  5CP6 C;  4WZ5 C;  1TZY B;  4E3L A;  5B2I B;  4PM9 A;  1JFI B;  1YT4 A;  3AZJ A;  3N3F A;  3AL0 C;  1Q9C A;  3HUM A;  5EPH A;  1S0W A;  1IYS A;  4QNL A;  3SH9 A;  3UDF A;  3MGR A;  4OPZ A;  2Z2M B;  1P3M C;  3M2J A;  3AZG C;  4IBB A;  1P3F C;  3DW0 A;  1Z6F A;  2EX8 A;  5EVI A;  3KXB C;  3SOI A;  4N9K A;  5B0Y B;  5CPJ C;  1W79 A;  3VFF A;  3C1C B;  2Y2K A;  1KU5 A;  2ZY4 A;  3A6N A;  2Y2H A;  3IHA A;  5AVB A;  4J8W C;  3AZI B;  1M6K A;  4GOG A;  3KUY B;  1M19 A;  3EPH A;  2IWB A;  1TZY A;  1SCW A;  5B2I A;  2Z2L B;  1JFI A;  4JBF A;  1P3I A;  3B6F B;  5KSC A;  2Y2G A;  4ZJ1 A;  4XZQ B;  3LEL D;  3GTC A;  5B24 B;  5C3I B;  1ERQ A;  3FDD A;  3LZ1 B;  3MBZ A;  3AZH D;  2G5I C;  1HTZ A;  4OJO A;  4ZDX A;  1BUE A;  3PBN A;  1P34 A;  1M40 A;  3LZ0 B;  3AZN D;  2NZD B;  1M18 B;  4FD8 A;  5FDH A;  2EXA A;  5FA7 A;  4KEN B;  5B0Y A;  4R1G A;  5A91 A;  1YM1 A;  3C1C A;  5HAR A;  1XGI A;  3B0B A;  1H3O B;  4OOM A;  4LV1 A;  3AZI A;  3V39 A;  2RL3 A;  3KUY A;  3X1T D;  3WS1 A;  1I5Q A;  1NYM A;  4OH0 A;  4QB8 A;  1K56 A;  3B6F A;  1LL9 A;  1K25 A;  3W4O A;  2QPN A;  3H0L C;  3ZFZ A;  4BD1 A;  4OON A;  4EBP A;  4IBR A;  5B1M D;  3BFD A;  2WGW B;  2Y2L A;  3AV1 A;  5B24 A;  4WBG A;  1BLC A;  3LZ1 A;  3NQU A;  4JF5 A;  1M18 A;  2Y2P A;  3MVD D;  5G49 B;  1KX5 A;  1PW1 A;  4DRT A;  2Y2M A;  1KX4 D;  2JC7 A;  3NDG A;  5TR7 A;  1H3O A;  1C3B A;  1P3A B;  5FI7 A;  4HGA B;  4QLC C;  5B40 B;  4E6W A;  4ZBJ C;  3WAA B;  1KX3 C;  3IXH A;  5BO0 A;  3REH C;  4PM5 A;  3AZH B;  3IXD A;  3QNB A;  2WAF A;  2F8N G;  4IBE A;  3B0D C;  3AZN B;  4Z9Q A;  1HVB A;  1ZLA B;  3AZM D;  3H0R C;  3MGQ A;  1PWD A;  5AQ7 A;  4NE3 A;  1MWS A;  4UUZ B;  3WS0 A;  3OCL A;  5B31 D;  1OME A;  1LLB A;  3IF6 B;  4H9Q A;  5G49 A;  3I7J A;  3W99 C;  3WA9 D;  4DE2 A;  3O62 D;  3X1T B;  3HLF A;  2ZY5 A;  2ZQ8 A;  4L0L A;  5B33 D;  4X56 A;  5B1L C;  4HBU A;  4IVI A;  4B4Z A;  5DVA A;  1P3A A;  2Y91 A;  3ZCZ A;  4J8V B;  3VH5 T;  3WTP D;  3AZJ C;  5B1M B;  2E8I A;  2HUE C;  5B40 A;  3UDX A;  5CHM A;  4OUI A;  1P3F D;  4X23 D;  3REJ B;  3WAA A;  5DNM C;  1KE4 A;  1E3U D;  3AZH A;  5AV8 A;  4DE0 A;  3UE0 A;  4KGC C;  3LJA D;  1FR6 A;  2CV5 A;  1IYQ A;  5GSU B;  1S6R A;  3EQV A;  1JTG A;  4J8W D;  1ZLA A;  1P3O D;  2G2U A;  4HBT A;  2ZC3 B;  2QZ6 A;  3IXB A;  1BT5 A;  4S2N C;  3C1B C;  3L28 A;  4N1H A;  2YFW B;  1L0D A;  2WAE A;  5GT3 C;  4NYY A;  4IED A;  1KX4 B;  2ARO B;  1TEM A;  1YU0 A;  5FQK A;  5CPK A;  1U35 B;  5FAP A;  3IWQ A;  4BLM A;  4DXC A;  4Z2M H;  1M19 C;  5KMW A;  4P0M A;  1TZY C;  1DJC A;  3CG5 A;  5B2I C;  2RVQ C;  2Q9M A;  4J8V A;  5JRG B;  4R8P B;  3REJ A;  1YLW A;  3AZM B;  2WGI A;  3FKE A;  1KE3 A;  4IBK A;  1LI0 A;  4IBD A;  1LL5 A;  5B31 B;  3OPH A;  3NY4 A;  5GSU A;  1JWV A;  4OPQ A;  3UDI A;  3WS4 A;  3WA9 B;  3O62 B;  2YFW A;  1KX4 A;  3C1C C;  2ARO A;  5B33 B;  4Z5T D;  2CWE A;  3UTB D;  4KZB A;  1U35 A;  3WTP B;  4Y7P A;  4JXS A;  3ZVT A;  2FJ7 D;  4DE1 A;  2DQN C;  2HIO A;  4ZJ2 A;  1PWG A;  1BH8 A;  4X23 B;  1SDE A;  1K55 A;  4F94 A;  3B6F C;  5JRG A;  4EWF A;  3IWO A;  2P74 A;  4R8P A;  1MWR A;  5AY8 A;  1O07 A;  4S2L A;  4XZQ C;  2ZC6 B;  4OOY A;  5F83 A;  3FKV A;  4S2K A;  1P3G B;  2PU2 A;  5C3I C;  3AZM A;  1P3O B;  1KDW A;  4QD4 A;  3UT9 A;  3BLS A;  1M1A D;  3W98 A;  3LZ0 C;  4PM6 A;  2NZD C;  1NJ4 A;  3BFG A;  3G4P A;  3WA9 A;  1W5D A;  3OC2 A;  2WZX A;  4GZB A;  5B33 A;  1KX3 D;  1H5X A;  4LD9 D;  2EX2 A;  5DF7 A;  2YFV B;  4QY5 A;  3AN2 D;  4E3N A;  3RXW A;  5GLB A;  1F66 A;  1BLP A;  4X23 A;  5B32 G;  5FSR A;  3C7U A;  1E3U A;  5F99 A;  2F8N D;  2HDR A;  1HQ3 D;  1NZU A;  1XP4 A;  4NZ1 A;  3G2Y A;  1P3G A;  5JYP A;  5E5A D;  3CZD A;  1WYB A;  5JYO A;  5KDM B;  4WM9 A;  5CPI B;  2DF4 C;  1BFM A;  1VM1 A;  3UTB B;  1LHY A;  5EE8 A;  3AZJ D;  5AVC A;  4P85 A;  3HRE A;  1VQQ A;  4KG2 A;  2FJ7 B;  3A3I A;  3AV2 A;  3MXR A;  4BQM A;  1YUE A;  4XUJ A;  2ZY2 A;  1IEL A;  4KZ6 A;  4Y0U A;  2YFV A;  3RXX A;  3MGR D;  4HGA C;  1CEF A;  2ZD8 A;  4X69 A;  1PZR A;  5B40 C;  3LEL C;  4OQ0 A;  5EVI D;  1FOF A;  4G91 B;  5KSH A;  3AZH C;  5A93 A;  4S2M A;  3N4I A;  3AZN C;  1EWZ A;  1KGF A;  4ZTK A;  3A6N D;  5AVB D;  1ZLA C;  2JE5 A;  4KUD A;  3NC8 A;  5KDM A;  4OPY A;  3MGP B;  5CPI A;  2EX6 A;  4KQO A;  3V9R B;  1P3I D;  4LD9 B;  3NI9 A;  5CHU A;  3IF6 C;  3C7V A;  3E2L A;  5AV5 B;  3X1T C;  2J7V A;  3L2A A;  3QHY A;  3ZNT A;  5E2F A;  2ZC7 A;  2B5R A;  2XGN A;  4J8V C;  2F8N B;  2R9X A;  5B1M C;  1P34 D;  1YU1 A;  3UPO A;  2DRW A;  1FQG A;  1HQ3 B;  4OQI A;  3REJ C;  1XA1 A;  3L25 A;  1MY8 A;  5B0Z A;  4CPK A;  5E5A B;  3UTA B;  5B0Y D;  2OV5 A;  1RCJ A;  4E3O A;  2OLV A;  3B6G B;  3BEC A;  4O7D A;  1L0G A;  3AZI D;  3AZK A;  3MVD C;  3KUY D;  5E2E A;  5FAS A;  3MGP A;  1K38 A;  1P3P A;  1KX4 C;  1K56 D;  3G2Z A;  3B6F D;  1XA7 A;  1U35 C;  1P3L A;  4WU9 A;  3MGR B;  5AV5 A;  1AOI A;  1ES4 A;  3AV1 D;  5B24 D;  2JSS A;  4DXB A;  3W97 B;  3LZ1 D;  1K55 C;  1E25 A;  5EVI B;  4E3M A;  2XDM A;  2F8N A;  5JRG C;  4MBF A;  4U3T A;  4GD8 A;  4NK3 A;  4IBF A;  1M18 D;  1L0E A;  3UPP A;  3A6N B;  3UTA A;  1BH9 B;  1WWI A;  3AZM C;  1KX5 D;  1LI9 A;  4AWL B;  3ZDJ A;  3MZE A;  4HES A;  4JJN B;  1IYO A;  2P9V A;  3AGE A;  1H8Z A;  3B6G A;  3TSG A;  4KQR A;  5B31 C;  2J9O A;  3REL D;  1P3I B;  4E3K A;  4MLL A;  5JA4 A;  5DTK A;  2W8S A;  3WA9 C;  3O62 C;  2V20 A;  2ZC5 B;  3VP4 A;  1YLZ A;  5B33 C;  4CJN A;  3WTP C;  3MNN A;  3BRM A;  1P34 B;  1PZO A;  4UHU A;  3E2K A;  4Z66 D;  4X23 C;  3W97 A;  1NXY A;  1KE0 A;  1ERM A;  5DF8 A;  3MGQ D;  3AFA A;  3LJA C;  1CEG A;  5CGW A;  1P3G C;  3X1U A;  1BH9 A;  1P3O C;  4JJN A;  5BT1 D;  4N1X A;  1DJA A;  1KGE A;  1P3A D;  4X53 A;  5CTN A;  1ZG4 A;  2H5S A;  3D4F A;  2H0Y A;  5A90 A;  5B40 D;  5GXQ A;  3AV1 B;  1TDG A;  1H8Y A;  1EQZ A;  3WAA D;  1P3K D;  2PYO D;  4NFT A;  1KVL A;  5AV8 D;  1NY0 A;  4GD6 A;  1ESU A;  5B2J B;  2CV5 D;  2Y59 A;  3ZG0 A;  3W4P A;  3NQU B;  4UA9 A;  3REK A;  1FSY A;  3TG9 A;  1F1E A;  3MFD A;  1ZLA D;  3VP0 A;  1KX5 B;  5CER A;  2ZC4 B;  4H9P A;  1N1J B;  3REL B;  4MBH A;  2EFX A;  5CPK D;  2XD1 A;  1XX2 A;  1K54 A;  4KZ3 A;  5CPI C;  1PI4 A;  2HDS A;  4Z5T C;  5F82 A;  4FH4 A;  5BO0 B;  3UTB C;  4R0Q A;  4J8V D;  3HLE A;  4NY2 A;  2FJ7 C;  4Z66 B;  3W96 A;  1ESI A;  3REJ D;  3VH5 W;  5AQ9 A;  5TGF A;  3G34 A;  1MWT A;  3UN7 A;  3VH6 W;  3MGQ B;  3WX7 A;  5B2J A;  4Q8I A;  5CHL B;  5HFO A;  5GSU D;  4UAA A;  2OLU A;  3FYZ A;  4H9Q B;  4RVA A;  1SDN A;  3MGS D;  4G91 C;  4H9S C;  5BS7 C;  1M1A C;  1N1J A;  2ARO D;  5HAI A;  4S2O A;  3REL A;  2CC1 A;  4GDN A;  2Y2I A;  2F2A C;  1U35 D;  1BTL A;  1GA0 A;  4ZUX A;  1HZO A;  2HIO D;  3MGP C;  2ZQA A;  5CRF A;  1P3K B;  2PYO B;  1XXM A;  5JRG D;  4LD9 C;  5AV8 B;  4JLF A;  4LV0 A;  5B32 A;  3PBQ A;  4R8P D;  2CV5 B;  4Z66 A;  5AY8 D;  3GMW A;  3AN2 C;  2NQB D;  4H8R A;  4K0W A;  3RJU A;  5AQB A;  5E2H A;  5DNN A;  3WKJ D;  2ZLY A;  3FV7 A;  3UT9 D;  2ZM0 A;  4IBI A;  4WU8 A;  5GLD A;  4PM8 A;  1P3B A;  3W98 D;  1HQ3 C;  1AXB A;  4D2O A;  5CPK B;  3AZE A;  5E5A C;  3ITA A;  3UTA C;  1FCO A;  4RYE A;  3AGF A;  1XKZ A;  3X1V A;  3BYD A;  3B6G C;  3DWZ A;  5GLA A;  5DTT A;  3ITB A;  3IP4 C;  4N92 A;  4YM6 A;  3UNW A;  3GSG A;  5GHX A;  1F66 D;  1P3K A;  2PYO A;  3ZGA B;  4MEZ A;  4WZ4 A;  4QU3 A;  5F99 D;  1YLP A;  3O86 A;  3OPL A;  3MGR C;  2ZMA A;  3BLM A;  1P3G D;  3X1S B;  4JF4 A;  3W97 C;  3VP2 A;  5EVI C;  4BL3 A;  3MGS B;  4ZBE A;  1RP5 A;  2Q9N A;  1ULY A;  1JWP A;  5F1F A;  2XD5 A;  3Q7V A;  1MKI A;  3ZG5 A;  2G2W A;  4KG5 A;  3A6N C;  5AVC D;  2PU4 A;  5AVB C;  1ES2 A;  3WRZ A;  3V5M A;  4AWL C;  2ZQ7 A;  4PPR A;  2HIO B;  4CAY A;  2WKH A;  3AV2 D;  1BH8 B;  4BJP A;  1BUL A;  4XUJ D;  1P3I C;  1K57 A;  4MBK A;  5TFQ A;  5AY8 B;  2NQB B;  4EV4 A;  3WKJ B;  3UT9 B;  2EX9 A;  1TAF B;  2DNS A;  1P34 C;  3N8R A;  3W98 B;  3X1S A;  3MGS A;  4KUD D;  5B0Y C;  1ID3 A;  3TU4 A;  1Y54 A;  3KWQ A;  5CEB A;  3AZF A;  4FH2 A;  5CPI D;  3O3V A;  3A3D A;  4JKT A;  2BG1 A;  2LY8 A;  5EOO A;  4FSF A;  1NRF A;  4NE6 A;  4DQY B;  3EPJ A;  3AZI C;  4KZ7 A;  1K6S A;  3KUY C;  4A5R A;  3WTP E;  1PI5 A;  5FQM A;  1F66 B;  3SS4 A;  1K54 C;  5I94 A;  5F99 B;  5M1A A;  1CK3 A;  3N8S A;  4J8X D;  3PBS A;  2NQB A;  3AV1 C;  5B24 C;  5CTM A;  3WKJ A;  4GKU A;  4DE3 A;  5B0Z D;  2QMI A;  3LZ1 C;  1ZKJ A;  1TAF A;  3JYI A;  5B2J C;  2HDQ A;  1M18 C;  3Q07 A;  5CHJ A;  4KQQ A;  3HUN A;  3HLG A;  3UE1 A;  3B0C W;  5AV6 A;  3UY6 A;  5AVC B;  3FWL A;  3AZK D;  4WV4 B;  1K4E A;  1KX5 C;  5IHV A;  1YLT A;  3MGP D;  4WEL A;  2XH9 A;  1P3P D;  5GT0 A;  3AV2 B;  1PIO A;  3KS4 A;  5EUA A;  4WZ5 A;  3REL C;  4XUJ B;  3HLC A;  3UE3 A;  1P3L D;  3WWX A;  4WU9 D;  5AV5 D;  1AOI D;  4Z2M G;  2X71 A;  2Y4A A;  4RA7 A;  5F1G A;  3S4X A;  1ONG A;  2PBY A;  2J8Y A;  1SHV A;  4UPK A;  3DWK A;  4S2I A;  1GHI A;  3BFC A;  4Z66 C;  1ES5 A;  3AZG A;  3MZF A;  3IF5 A;  1IYP A;  3UTA D;  3SH8 A;  3MGQ C;  4OVD A;  4KUD B;  4OJ5 A;  2ZM5 A;  3B6G D;  5CPJ A;  1HTA A;  1ZG6 A;  3MXS A;  3P98 A;  5BT1 C;  3B3X A;  3S1Y A;  4JXW A;  5HW3 A;  1I2S A;  4R4S A;  1XPB A;  4J8U B;  4U0T A;  1P3A C;  3MNN D;  4OKP A;  4J8X B;  2Y2N A;  1ONH A;  3WAA C;  3W97 D;  1P3K C;  2PYO C;  4KZ4 A;  4EO5 B;  5B0Z B;  4E45 A;  5AV8 C;  3AFA D;  1B6W A;  3OPR A;  4X6T A;  3EPK A;  1S32 D;  2CV5 C;  2IWC A;  3ZHH A;  2A3U A;  3ZNY A;  1YMX A;  2ZQC A;  3X1U D;  4KZ9 A;  3AGD A;  5FUG B;  3AZK B;  4JJN D;  1GCE A;  3GV9 A;  5CGX A;  1P3P B;  4XUX A;  1RGY A;  5CPK C;  1P3L B;  1TVF A;  4WU9 B;  5FAT A;  2Y2O A;  1AOI B;  1GHM A;  5GXQ D;  4J8U A;  1EQZ D;  3HLW A;  4G92 B;  3G31 A;  5AV9 B;  4KHA A;  4P87 A;  5GLC A;  4ZBJ B;  1WE4 A;  1SKF A;  3EQU A;  4J8X A;  1K4F A;  2WAD A;  3VSL A;  2ZQD A;  3WS5 A;  3REK D;  4RX3 A;  1MXO A;  2ZQ9 A;  4E3J A;  3AZL B;  2P9V B;  4H9R A;  5M18 A;  3WS2 A;  4XXR A;  1PZP A;  2XK1 A;  5GSU C;  4YFM A;  3X1S C;  3KS8 A;  3HON A;  4H9O B;  1L2S A;  5FUG A;  4NET A;  3VP3 A;  5JA4 B;  2WKI A;  3MGS C;  4EBN A;  1N9B A;  4JXG A;  3L26 A;  2ARO C;  2V1Z A;  3HSH A;  4GNU A;  1YU3 A;  4S2J A;  4C6Y A;  4DRB A;  3MNN B;  1R4V A;  2VGK A;  3W96 D;  2HIO C;  2HUE B;  4QLC A;  5AV9 A;  4R3B A;  2BYM B;  3C5A A;  4B88 A;  5B2J D;  3REH A;  4IJE A;  3NCK A;  3L29 A;  3AFA B;  1S32 B;  4R8P C;  4NYU A;  4EUZ A;  5AY8 C;  2NQB C;  4M3K A;  3X1U B;  1NZO A;  3WKJ C;  3FZC A;  5KZH A;  4LEN A;  3AZL A;  1ES3 A;  2IO5 B;  1FSW A;  3UT9 C;  5DF9 A;  3W98 C;  3N6I A;  2ZM8 A;  5GT3 B;  4H9O A;  3VSK A;  5E2G A;  4ZUX D;  5GXQ B;  3Q81 A;  3W99 A;  1XGJ A;  1EQZ B;  3AYW D;  1YLY A;  2XFT A;  4E6X A;  3Q7Z A;  3LY3 A;  4KZ5 A;  2VQR A;  5B1L A;  1WYC A;  2BYK A;  5B32 D;  5FQJ A;  1F66 C;  3REK B;  2XQZ A;  4Y0O A;  5DNN D;  2BYM A;  4NE5 A;  5F99 C;  5DNM A;  4R3J A;  2FFY A;  4WU8 D;  1FR1 A;  5BNV B;  1S32 A;  2Y2J A;  1P3B D;  5FQI A;  1HD8 A;  4H9P B;  4KGC A;  1GHP A;  3NQJ B;  3NIA A;  4WMC D;  3VP1 A;  2IWD A;  3AZE D;  3HL9 A;  3IH9 A;  4OLG A;  3REI B;  3O87 A;  3OCN A;  1MBL A;  3X1V D;  4S2N A;  3C1B A;  1BSG A;  3ZG7 B;  5GT3 A;  4S2P A;  3ZG8 B;  3H0M C;  5AVC C;  4YM6 D;  3LCE A;  4MNR A;  2IOU A;  1KDS A;  1E4D A;  3W96 B;  3AV2 C;  4XUJ C;  3A3J A;  2UWX A;  4C75 A;  3ZG9 B;  2GDN A;  1DY6 A;  3UPN A;  4QJG A;  3PTE A;  3IT9 A;  1I2W A;  3IQA A;  2ZM2 A;  2F8N H;  1JWZ A;  5CED A;  3OPP A;  5BNV A;  1TDL A;  4ZJ3 A;  3V50 A;  3NQJ A;  4LCM A;  4YIN A;  3LEZ A;  3REI A;  5GHY A;  3WRT A;  4JPM A;  5BOH A;  4KUD C;  4ZUX B;  1YMS A;  4GDB A;  2C5W B;  2G5H C;  4LG2 A;  3AYW B;  3CMZ A;  1Z2C B;  4UA7 A;  1WWS A;  5B32 B;  4OQH A;  4WNN B;  2J9P A;  3PBO A;  4QY6 A;  2EFU A;  4RX2 A;  4J8U C;  4R4R A;  5DNN B;  3FKW A;  5GHZ A;  4WU8 B;  3ZVW A;  1P3B B;  4J8X C;  4BL2 A;  4OJP A;  4YS3 D;  3X1S D;  1W7F A;  4XZQ A;  4EO5 C;  1A7W A;  4GN2 A;  5B0Z C;  3AZE B;  1ID3 D;  3TU4 D;  4UA6 A;  3KWQ D;  3AZF D;  5HL1 A;  3X1V B;  4NZ4 A;  5HX9 A;  4GB7 A;  3LZ0 A;  2NZD A;  3F6T A;  4JF6 A;  4YM6 B;  1YU2 A;  3LO7 A;  3AZK C;  4LV3 A;  2H10 A;  4H9N B;  1P3P C;  3UO9 A;  3AYW A;  3Q82 A;  5EEC A;  4OQG A;  1T3U A;  1P3L C;  3V3S A;  4WU9 C;  4OP5 A;  4WNN A;  4P6B A;  5AV5 C;  1AOI C;  3GQZ A;  5CXW A;  2JCH A;  2OSU A;  5J8X A;  3MKE A;  4G92 C;  4OJ6 A;  5AV9 C;  3LEL B;  5A92 A;  2A49 A;  1IKI A;  3GVB A;  3Q7V B;  1JTD A;  2WGW A;  4WMC A;  3N8L A;  5AV6 D;  4PMA A;  5EVL A;  3AZL C;  3M6H A;  4CAY B;  5GT0 D;  4WZS B;  5CP6 D;  1J9M A;  4WEK A;  4IVK A;  4OOL A;  1B67 A;  3C4P A;  1Q2Q A;  3QNC A;  4H9N A;  1DJB A;  3IH8 A;  4OPR A;  3A1I A;  3MNN C;  2HPB A;  1JVJ A;  4YS3 B;  1P3M D;  3AZG D;  3BFF A;  3EPL A;  3VH6 T;  4U0X A;  3LEL A;  1ALQ A;  1ID3 B;  3TU4 B;  3KXB D;  4GH9 A;  3KWQ B;  3AFA C;  3AZF B;  2R9W A;  1S32 C;  3C4O A;  5CPJ D;  4ZAM A;  4ID4 A;  5E43 A;  3AZN A;  4DRA A;  3X1U C;  2ZY3 A;  3HVF A;  4BD0 A;  2Y2Q A;  2IO5 C;  4JJN C;  1O7E A;  4IBG A;  4WYY A;  3MVD B;  3NBL A;  3M2K A;  4UUZ A;  1BZA A;  1CI9 A;  2HP6 A;  5DTS A;  3IF6 A;  5GXQ C;  3MZD A;  1EQZ C;  3KSY A;  3X1T A;  4K0X A;  3O88 A;  3G35 A;  4OP8 A;  3DTM A;  4YS3 A;  5B1M A;  4WJ3 C;  2X02 A;  3N7W A;  3REK C;  4DKI A;  1CI8 A;  4E44 A;  5AV6 B;  4BEN A;  3M6B A;  2XLN A;  2H0T A;  5GT0 B;  5CP6 B;  1PWC A;  1PYY A;  1MPL A;  2J8P A;  4OJL A;  4LV2 A;  3REI C;  4DDY A;  3MVD A;  4J8U D;  5U47 A;  4FCF A;  4OLD A;  4IJF A;  5FI6 A;  2WKE A;  3VMA A;  5FI2 A;  3R45 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...