2BG1A

Active site restructuring regulates ligand recognition in classa penicillin-binding proteins (pbps)
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
484
structure length
455
Chain Sequence
ITYDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTNQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Active Site Restructuring Regulates Ligand Recognition in Class a Penicillin-Binding Proteins
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Peptidoglycan
molecule keywords PENICILLIN-BINDING PROTEIN 1B
total genus 147
structure length 455
sequence length 484
ec nomenclature ec 2.4.1.129: Peptidoglycan glycosyltransferase.
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2bg1A01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2bg1A03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2bg1A02
4QY5A 5DVAA 1DJCA 1JWZA 1HZOA 4OOMA 2Y2PA 1G68A 1GA9A 2WK0A 1DY6A 4R3JA 3CMZA 1K55C 5TFQA 3WS1A 4KZBA 5HAQA 3W4OA 3V39A 3SS5A 5EVLA 3UPPA 4KZ5A 5A92A 5HX9A 4RX2A 3UE1A 3M2KA 4X6TA 3OZHA 1GHMA 1NYYA 2H10A 4WZ4A 4GD6A 3IF6B 4PM8A 1ERQA 1ES3A 4MBFA 5DF9A 3VP3A 4F94A 1ES5A 1W79A 4E3NA 3IWIA 3DTMA 1JWVA 2IWBA 2HDSA 3C5AA 3GQZA 3WWXA 1MXOA 2Y2OA 3HBRA 1N9BA 3HLWA 1L2SA 4DE1A 4D2OA 5FQJA 3V5MA 5CERA 5HAIA 1LI0A 3HLEA 5DTKA 3ZG8B 2J9PA 1CI8A 2Y2GA 1WYBA 5A91A 5AQBA 2Z2MB 1DJBA 3WRZA 5EUAA 4E3OA 5E2FA 2V1ZA 4X69A 1OMEA 5DF8A 1SDEA 4LV1A 2H5SA 3OCLA 4R23A 5EVIA 5GLBA 1BT5A 4KQOA 3LEZA 2E8IA 3OPRA 5EE8A 5KSCA 5FAOA 3NDEA 4BJPA 2IWDA 3MZEA 1KDWA 3BFFA 3M6HA 1W7FA 4NETA 1NY0A 2G2WA 2Y2NA 3O86A 3DWZA 3DW0A 2ZQ8A 4EBLA 1W5DA 4XUZA 3SH8A 3PAEA 1CEFA 2H0TA 1JWPA 4BD1A 3MXRA 3EQUA 1O7EA 3UN7A 1L0EA 1NYMA 1VQQA 1IELA 3E2KA 3PBSA 3HLCA 3IHAA 5I94A 1Y54A 5HFOA 3SS3A 5KMWA 3G2YA 2BLSA 4EUZA 1XGIA 1K38A 3BEBA 4FCFA 2WGWA 3HVFA 3UO9A 1YLWA 1XGJA 5F1FA 5FI6A 4IEDA 4UA9A 4ZAMA 3BYDA 4ZJ1A 4Q8IA 4QB8A 4YINA 5F82A 1L0DA 1MWRA 3C4OA 4P6BA 3NDGA 1DJAA 1BUEA 1Q2QA 3BFGA 1SCWA 2HDUA 3NC8A 4IVIA 1ES4A 5U47A 1K56D 3HREA 4OQIA 3HLFA 3IXBA 5CRFA 3C7UA 3HL9A 2R9WA 5M1AA 1MBLA 3BFDA 1ZG4A 5FAQA 3ZG9B 4OPQA 3GRJA 3S1YA 3Q82A 4FH2A 4OONA 3ZHHA 4U3TA 1PW1A 4S2JA 2ZM8A 1NZUA 4Y0OA 2Q9NA 2XDMA 3IH9A 2WKIA 2V20A 2I72A 2WUQA 3GTCA 4GOGA 3VP0A 4KZAA 4X53A 1KE4A 2ZLYA 3HUNA 4K91A 1FR6A 4DXCA 4YFMA 4C75A 3IQAA 1IKIA 1PWGA 1RCJA 2J7VA 4QHCA 3BM6A 4RX3A 2DNSA 2EFXA 3SH7A 1G6AA 5EVIB 3ZVWA 5EVIC 1SDNA 2Y2JA 1GA0A 2X02A 4P87A 4DRTA 4QU3A 4LV0A 1PW8A 2ZC4B 3PBOA 2UWXA 1N4OA 2C5WB 4S2NA 5CTNA 3UDFA 3OPHA 1FSWA 1YLJA 3IXGA 4WZ5C 5A90A 4OQHA 3PBTA 4WMCA 2J8YA 2XK1A 5HW3A 2ZJ9A 4QD4A 2WAFA 4DE2A 4R0QA 3UPNA 4B88A 1O07A 1QMEA 3QHYA 3PAGA 2IWCA 3GR2A 1TDLA 1LI9A 3LO7A 4QY6A 2XD1A 3UDXA 4JXGA 4N9KA 1EWZA 5DF7A 1KVLA 1GHIA 5CHJA 2XLNA 4FSFA 1IYOA 1IYSA 5EOOA 1W8YA 5GHXA 3BLSA 4OOLA 2JCHA 1CI9A 3BECA 3S4XA 4RYEA 3LY4A 5F1GA 4OH0A 3V3RA 3NI9A 4MLLA 1CK3A 1XKZA 1LL9A 3RJUA 4A5RA 2JBFA 4DDSA 2EX6A 2OLUA 2XEPA 5FI7A 4JKTA 4X56A 3ZFZA 2EX8A 4E3LA 3HUMA 4PM7A 4EBNA 5GLAA 1W8QA 1GCEA 3Q7VA 1MY8A 3M2JA 4B4ZA 4KG2A 4OPZA 3MFDA 1XA7A 4RA7A 3W4QA 5CGXA 3M6BA 4KZ9A 3OCNA 4C3QA 5G18A 2ZM2A 4PM5A 4HBTA 1ESIA 1E3UA 1PZPA 2XH9A 1VM1A 4JXVA 3A3JA 4ZJ2A 1MKIA 2C6WB 3AGFA 5GHYA 2A3UA 3FZCA 4RVAA 3RXXA 4KZ3A 4JXWA 1E3UD 3ZG5A 4OP5A 5GHZA 2ZQ7A 2JE5A 4ZJ3A 3SOIA 3HLBA 3NIAA 4KQRA 1I2WA 4MEZA 1HD8A 4E3JA 4KG6A 4DF6A 1M6KA 2ZD8A 4PM6A 3UY6A 4GN2A 2EX2A 3VP4A 4K0WA 3TG9A 4OLGA 1IYQA 3ZG0A 3IH8A 3O3VA 4ZTKA 5CXWA 1ZG6A 5J8XA 4K0XA 1JTDA 2HPBA 5E2GA 4OVDA 5HL1A 3IF6A 1XXMA 5HAPA 5TR7A 4Y7PA 1XPBA 4U0XA 4E6XA 1U60A 1YT4A 3GSGA 4B4XA 2EXAA 3HUOA 3N6IA 4R1GA 4Z9QA 4LENA 4Y0UA 1K54C 1PWCA 1YLZA 4OKPA 2ZM0A 4IVKA 4DE0A 1H5XA 1BZAA 1HTZA 5GLDA 1ERMA 3JYIA 3MZDA 5GL9A 3PBQA 2Y91A 4MBKA 4WYYA 3UPOA 3ZNYA 1KGGA 3W4PA 4IBRA 1RP5A 1I5QA 4OP8A 1AXBA 2Z2LB 4PMAA 3C4PA 4N1HA 2P9VA 5FQMA 4GB7A 3MKEA 5FA7A 1JTGA 2X71A 5GLCA 5HARA 4S2KA 1PYYA 2ZQAA 3A3DA 1L0GA 2WAEA 3MKFA 2ZMAA 2ZQ9A 3CJMA 3WRTA 4KZ4A 2Y2LA 4KZ7A 1ESUA 3WS4A 1IYPA 1YQSA 4MBHA 1FOFA 3GMWA 3WS5A 1H8YA 2PU4A 3I7JA 4PM9A 1PI5A 2G2UA 3O88A 5F83A 2WGVA 5BOHA 2XF3A 3QNCA 3Q81A 3C7VA 1K54A 3OPLA 5EVID 1SHVA 1IEMA 3FWLA 2Y2QA 5CGSA 5AQ9A 3VP1A 4LV2A 3VSKA 5CGWA 1K4FA 2DRWA 1S0WA 3ZCZA 1XX2A 1NJ4A 3TOIA 5FQKA 1K56A 4OPYA 1BLHA 2P9VB 4N1XA 2VGKA 3V50A 5CEDA 4X55A 2A49A 1KDSA 2ZQDA 3VFHA 3CG5A 3EQVA 4JPMA 4H8RA 3BRMA 4S2NC 1YMSA 1K6RA 3AGDA 1S6RA 4O7DA 4S2IA 5DTSA 3VSLA 5CEBA 3MBZA 2OLVA 4GDBA 2Y2KA 1YLTA 2WKHA 3VOYA 4CPKA 1Z6FA 1I2SA 4FD8A 3Q07A 4KG5A 1XP4A 2BG1A 3QNBA 3G35A 3O87A 4N92A 3G4PA 3N8LA 4LV3A 5FI2A 4E6WA 3BFEA 5TGFA 2FFFB 2XR0A 3A3IA 5EPHA 3ZDJA 3IT9A 5FATA 2HDQA 1FCMA 2ZC6B 1BTLA 4OLDA 2GDNA 4BD0A 1FR1A 3IHBA 3UE0A 4R3BA 3S22A 3V3SA 3G31A 3G30A 1LHYA 3SS4A 5L2FA 4ZBEA 3N7WA 4DDYA 1BULA 1EI5A 3PBRA 3FV7A 4GDNA 2OSUA 2EX9A 2P74A 2XFTA 2FFYA 2QZ6A 2Q9MA 1MWUA 1ZC2A 1KVMA 3NCKA 2WYXA 5AQAA 5IHVA 1SKFA 4GNUA 4BQMA 3IF5A 1ALQA 4PPRA 1LLBA 3VFFA 1J9MA 2XQZA 1PIOA 4WZ5A 4EV4A 1GHPA 2PU2A 4JXSA 1K4EA 3D4FA 4LCLA 4S2LA 1TVFA 1LL5A 1YLPA 2HDRA 3G32A 3NY4A 4WMCD 2QMIA 4WEKA 3G34A 2OV5A 2RCXA 4XUXA 4E3IA 2DCFA 1M40A 4NK3A 2ZC7A 4XXRA 3IXDA 4GD8A 4KZ6A 4OQ0A 5FAPA 3SH9A 2Y2MA 4C6YA 1ONGA 1IKGA 1NXYA 4R4RA 3ZVTA 2WZXA 3BLMA 1C3BA 1TEMA 1K57C 3WS2A 1YLYA 4UA6A 3ITAA 2X01A 3FKWA 4X68A 1BLCA 1H8ZA 5FSRA 2RL3A 1QMFA 3TSGA 4JF4A 5EECA 2JC7A 4S2PA 3HLDA 4JLFA 1RGYA 2R9XA 2Y55A 4WM9A 4DE3A 2HP6A 4UHUA 4U0TA 3AGEA 1BSGA 5D3OA 2XFSA 2Y4AA 3MZFA 1L0FA 3IF6C 1TDGA 3OC2A 4WEJA 3N8SA 4WELA 2EXBA 4BENA 3IXHA 2VGJA 4M3KA 4UAAA 3ZG7B 1PWDA 1EROA 3G2ZA 4OOYA 4DXBA 5JYPA 2WGIA 3A3EA 1K57A 4BL2A 4P85A 4E3KA 4ID4A 3LY3A 4OPRA 4KZ8A 2J9OA 2WZZA 4ZDXA 4GKUA 4JBFA 1MWTA 4EQIA 3P09A 5CTMA 4MNRA 3B3XA 3PBNA 2V2FF 3W8KA 4BLMA 5KSHA 4S2MA 2EFUA 2XD5A 4IBXA 1ZKJA 5CHMA 2QPNA 4KQQA 4QJGA 5E43A 1E4DA 4WBGA 1MPLA 1JVJA 4HEFA 1XA1A 1FCOA 1YM1A 3MXSA 4HESA 4EWFA 5M19A 3N8RA 1PZOA 2ZQCA 5A93A 1KE0A 3ZNTA 1ES2A 1K6SA 1Q2PA 2ZC5B 1YMXA 3GVBA 3PTEA 2HP5A 2WGWB 2WKEA 4JF5A 5E2HA 1WE4A 3FKVA 4LCMA 4Y0TA 2H0YA 3LCEA 3A3FA 4BL3A 3IWQA 3Q7VB 5FQQA 2Y2HA 1ONHA 1BLSA 3N4IA 4N9LA 4P0MA 4CJNA 1RGZA 3P98A 5CECA 3ZGAB 3DWKA 4HBUA 4FH4A 3WS0A 4JF6A 5AQ7A 2XGNA 4EBPA 1WYCA 5FQIA 3UE3A 1KE3A 2ZC3B 1MWSA 3UNWA 4DKIA 5M18A 3IWOA 4R4SA 5JYOA 1K55A 1BLPA 3CZDA 2WADA 3VP2A 3GV9A 4S2OA 3Q1FA 2Y2IA 3ISGA 1CEGA 1NRFA 3E2LA 1E25A 4GZBA 4KENB 1PI4A 4E3MA 1K25A 3BFCA 3HLGA 3NBLA 3OPPA 2Y59A 4UA7A 5FQ9A 1NZOA 3UDIA 5EOEA 1FCNA 5E2EA 1FQGA 3Q7ZA 4L0LA 2B5RA 4OQGA 5DTTA 5CHUA 3VMAA 1KGFA 5KZHA 2PBYA 3VOZA 3ITBA 1HVBA 1KGEA 3FYZA 1FSYA 5FASA 3RXWA 5FDHA 2CC1A 2HP9A
chains in the Genus database with same CATH superfamily
1JWZA 4XZQC 3WTPE 1J7MA 1G68A 1SKOB 4R3JA 2V8FA 3KS4A 1K55C 3WS1A 1E6NA 3W4OA 4IJEA 4HH3A 5AV6D 1GHMA 1S66L 4WZ4A 1LSVA 4NE6A 2O9CA 4MBFA 3REIC 1ES5A 3OOVA 3W96A 3IWIA 5HPIA 2IO5B 3WWXA 1S67L 1P34B 3UB6A 3QP2A 4TX8A 2Y2OA 3WKJB 3E98A 5IS1A 3CUEC 1L2SA 4ETXA 1ZTUA 5F99A 5CERA 5HAIA 1LI0A 3HLEA 3ZG8B 1WYBA 3EPKA 1DJBA 2CV5B 5E2FA 2W0NA 1SDEA 5IT5A 3WTPB 4OJ6A 4KQOA 2E8IA 3OPRA 3NDEA 2GZAA 5B31D 2IWDA 1H3OA 3MZEA 3M6HA 1NY0A 2QJ7A 4DMZA 3LELD 3AN2A 1CF0A 2ZQ8A 1W5DA 4EBLA 2J3WA 3SH8A 1CEFA 1YUEA 1JWPA 5BT1C 4BD1A 1S32D 1P3LA 3EQUA 1E6RA 1VQQA 5I94A 1IELA 3HLCA 2O99A 4BWIA 4Z5TB 1XGIA 5AV5A 4ZUXD 4HH2A 5F1FA 5AVBD 4NZ1A 2DF4C 4LRZE 4QB8A 5F82A 1L0DA 3MGSB 5B1LB 1SCWA 1K56D 3HREA 3NULA 3IXBA 3C7UA 3HL9A 2R9WA 4PHTA 1M1AB 5M1AA 5L09A 3BFDA 1N9OA 2JHEA 4OPQA 3S1YA 4WNNB 4S2JA 3JVUA 1AOID 3T1XA 3AZLB 3IH9A 3AZHA 3AV1B 2V20A 4GOGA 3GDIA 1P3OC 3VP0A 3WA9B 3LI9A 4X53A 1KE4A 2ZLYA 1T3UA 3LELB 4C75A 4L9GA 5J7EA 1RCJA 1HLUP 2JSSA 2DNSA 2EFXA 3MGPB 1G6AA 3WTPA 5EVIC 4KGCB 1P9WA 4NXGA 1QO6A 3JVVA 4DRTA 4LV0A 3C1BC 2UWXA 3OPHA 2HV1A 3B47A 2VGLM 3AZHC 3AYWD 2PYOD 4WZ5C 5KDMA 3X1TB 5HW3A 5CPJD 5CHLB 3UPNA 4J8UB 4B88A 1QMEA 3B6GA 4NFTA 4E45A 1TDLA 2W3DA 5KDMB 1GHIA 1GSXA 1HTAA 5EOOA 1MZUA 3P7NA 2NQBB 1YAXA 4EUVA 5EFWA 3BECA 5LBRA 5F1GA 4M6BA 4L9EA 2V9AA 1CK3A 1LL9A 3W96C 1OTAA 5E5AD 3HJKA 3H0MC 2XEPA 3AZKC 5FI7A 3T4KA 3ZFZA 2EX8A 5AJGA 3AZFD 1P3LD 4EEUA 4E44A 1GCEA 3LJAD 1P3KC 1P3PC 4KG2A 3W4QA 1XA7A 2P04A 3D9YA 4KZ9A 5JRGA 5G18A 2ZM2A 1PZPA 1E3UA 5AV6C 1P3GB 1MKIA 2C6WB 2FJ7B 3RXXA 2ZBBA 1E3UD 3KSFA 1ODVA 1P3GA 4IBCA 2JE5A 3UTBB 3SOIA 2GNXA 3P01A 4AFIA 2V8CA 1P3BD 1K0KA 3NOUC 1KX3B 3AZEA 2IOUA 4PM6A 2H28A 2VKSA 4GS9B 4CAYA 3QP1A 1P34C 5B0YB 1KX3A 5E2GA 5E5AC 5TR7A 2OWJA 1XPBA 4Y7PA 3KS8A 1U60A 3QP4A 4B4XA 2EXAA 4H6JB 4R1GA 3D3OA 5AVCD 1W63Q 1Z2CB 3QP6A 1H5XA 1BZAA 1N1JB 2Y79A 4LLOB 3AZEC 4WJ3C 2ZY3A 1P3AC 4EEPA 4J8VA 3MZDA 5B32G 4KUDA 4WYYA 3W97A 4PKYA 5CPKD 1P34A 1KX3C 3MKEA 5FA7A 4EU0A 4I38A 3X1VA 3A3DA 2QWSA 1P3MA 5AV9A 2M7UA 4Z2GA 3UE6A 1F66D 4Y3IA 3WS4A 4YS3C 4HI4A 3GMWA 4J8VD 2PU4A 3EGXC 1PI5A 5F83A 1P3AA 3QNCA 3Q81A 1Y28A 5DKLA 4KUDC 1F5MA 1SHVA 3BY9A 3VSKA 1OTBA 3AZKB 2G5HC 4LV2A 1P3IC 3VP1A 1OGBA 3LR3A 5HD5A 2A2LA 1XX2A 3AZMC 1K56A 1BLHA 2P9VB 4OPYA 3DTKA 5CEDA 1P3AB 2ZQDA 3VFHA 3CG5A 4JPMA 1P3OD 3AGDA 1S6RA 5FUGA 3B0DC 1YLTA 3VOYA 2FJ7C 3REHD 2BG1A 3G35A 5FI2A 3N8LA 3BFEA 5GT3C 1N9NA 3A3IA 3IT9A 5FUGB 3HJIA 3TE8A 3W98C 5DNMB 5FL3A 2ZC6B 3MGQA 4JGQA 3AV1C 3WAAD 4OJPA 3AZMA 3LZ1A 3PHYA 3S7PA 4CSRA 4UEYA 2Z6DA 1P97A 1BULA 4X23D 3FV7A 2JKRI 3T4OA 3MQQA 2AROB 2PDRA 1ZLAD 4XT2B 4Y2FA 4Q0HA 4I5SA 4BBVA 4ZUXC 1ZC2A 4YM6C 4IBEA 1TAFA 3A1KA 1KVMA 2WYXA 4GNUA 5AQAA 4BQMA 4J8XD 3VFFA 5BO0B 3FPWA 4WZ5A 4CSRB 3AZJD 4EV4A 3TW8A 1K4EA 3NY4A 4WMCD 3G34A 3B6GC 2RCXA 5HWTA 5BT1D 2QYBA 1BH8A 2W1RA 1M40A 4NK3A 2ZC7A 4FOFA 3IXDA 3IS2B 2QJ5A 2Y2MA 1IKGA 1CQAA 2VEAA 2ZY5A 4Z2MG 3IBRA 2WZXA 4ZBJB 5AVBB 1YLYA 4UA6A 3P5JB 2X01A 1H8ZA 4HMCA 1M18C 5EM1A 5B1LD 4GH9A 4JF4A 2JC7A 5F99D 4JLFA 1RGYA 2R9XA 3UT9D 4DE3A 3WD0A 4UHUA 3L28A 2XFSA 2Y4AA 1WWSA 3OC2A 4BENA 1YU4A 3B0CW 1PWDA 4OOYA 1H8PA 1A7WA 3A3EA 3EPHA 4MB3A 4OPRA 1P3KB 1P3PB 1PRQA 4GLQA 4EQIA 3P09A 2XSSA 5DNMA 3PBNA 4WU9C 4BLMA 4P6ZM 2EFUA 2XD5A 1ZKJA 3W99B 4MN7A 4IBGA 1AOIB 3KXBA 2AROD 4WBGA 1JVJA 4HESA 5M19A 3A0VA 5GSUD 2ZC5B 3KWQB 3W99A 4Z2IA 2WKEA 1AOIA 3UTBD 3EEHA 4LCMA 1D06A 3L25A 3A3FA 5F5YA 2EWVA 5B2IB 1P3MC 2EA9A 1JNUA 2VQRA 3AZJC 3ZGAB 4YWZA 3NHQA 3W97D 1OJ5A 5F68A 5AQ7A 4EBPA 1WYCA 4ZUXB 1ZLAC 3REJB 3UTAC 3MGSD 3E4QA 4R4SA 5JYOA 3CZDA 3G6OA 3GV9A 1E25A 3CHWP 1PI4A 3W97C 5FQ9A 4MB5A 4HMDA 4L0LA 4OQGA 2B5RA 1OGGA 5CHUA 3REHC 2FJ7A 3FYZA 4HJ4A 3RXWA 3PXPA 3AZNC 2CC1A 3LCEA 1D1JA 4QY5A 5B32B 2PD7A 3AZJB 3CMZA 5TFQA 3AZMD 3L26A 2F8NB 2EWWA 3V39A 5EVLA 4RX2A 3UE1A 4X6TA 1EAKA 2H10A 4PM8A 3IX8A 2YFVA 4IJGA 3WD2A 2E8JA 4G92C 1L6JA 1JWVA 3WD3A 4L9FA 2IWBA 3C5AA 2ZL1B 3ZQ5A 3HBRA 3W97B 3WD4A 3F1OA 3LR5A 2YKHA 3MGSA 2J9PA 2Y2GA 5A91A 4HMEA 5DF8A 4LV1A 1P0ZA 5EVIA 1ID3D 1BT5A 1P3AD 3H82B 3LEZA 1XJ4A 5KSCA 5FAOA 3RELB 5JA4B 1AWIA 3BFFA 4R6LA 4NETA 5DJUA 4OUIA 1DP8A 3DWZA 3MF0A 4LRYC 3DW0A 4Y13A 3R7WA 3S7QA 3C1CB 3LJAA 3B6GD 2W1TA 1ZLAB 1O7EA 5CPIA 3UN7A 3T4SA 1Y54A 5HFOA 3SS3A 5BNXB 5KMWA 2BLSA 4EUZA 3HVFA 2OWHA 3AZLA 2L4RA 1YLWA 3L2AA 3E4PA 3TU4C 3BYDA 3OLOA 1G28A 2I9VA 4I3JA 4YINA 3C4OA 1DJAA 2A24A 4WU9A 4IVIA 4BMWA 4J8UA 4IBDA 4I39A 1OTIA 4XT2A 4J8WB 5DKKA 1MBLA 4NZ5A 1HQ3D 5GSUB 1UR9A 1ZG4A 5DNNC 5CP6D 5GT3D 2ZM8A 5HL6A 2W3GA 5AVEA 1HQ3B 1VB6A 1P3LC 2LB9A 3AZLC 2JKFA 1N1JA 3AZKD 2WKIA 2I72A 3GTCA 3E0YA 3LZ0C 1A0KA 4X25A 3HUNA 4K91A 4KUKA 4ETZA 5B24B 2J3TD 1M1AD 1PWGA 4H9QB 3BM6A 1P3ID 3LFVA 3UT9B 4YS3B 3SH7A 5DNMD 5EVIB 3ZVWA 4KUDD 1SDNA 4X1MA 3KFUG 2VV6A 4P87A 3FC7A 4QU3A 5I5LA 2ZC4B 2HGVA 2C5WB 4S2NA 3UDFA 2ACGA 3IXGA 3W99C 4OQHA 4DQYB 4MMNA 1Z09A 3REHA 3AV2B 3QHYA 1S32A 3PAGA 3GR2A 1LI9A 3REJA 4XUJC 3LO7A 4QY6A 2XD1A 1P3OA 3KWQD 5DF7A 4IHQA 2FN2A 1KVLA 4H9OB 3KUYB 1IYSA 4MDZA 3AZED 3AV2A 3BLSA 1VEUB 3KWQC 3BW6A 3UB9A 2J3TC 2A24B 2YFVB 1MKMA 2JBFA 4A5RA 5CP6B 2OLUA 2JKTM 3HUMA 4PM7A 3LIAA 5GSUA 3REJC 4EBNA 2JKTI 5GLAA 4CLCB 4B4ZA 1EW0A 4OPZA 4RA7A 3OCNA 4C3QA 1E8BA 1HQ3A 3ICYA 4KUDB 3C1BB 2V5OA 3A3JA 4ZJ2A 3AGFA 2KOIA 5AV5B 4RVAA 2BYKA 3WTPC 3KYQA 3O62B 3L27A 4EERA 2AVXA 5GXQA 4H9QA 5AVBC 1P3LB 4YNRA 4KQRA 3AZLD 1D7EA 4DF6A 4QLCC 3WKJA 3UY6A 4NY2A 2EX2A 3IS2A 4DRBA 5B32D 3VP4A 5CP6C 1P3KD 1P3PD 1U35B 3ZG0A 3IH8A 5CXWA 5J4EA 3MNNC 1JTDA 1B67A 1XXMA 2VGLS 1OT9A 5CPJA 4HGAB 4EXOA 3N6IA 1YU1A 4NYYA 1PWCA 4OKPA 3VOLA 1F66B 2W3EA 5BS7A 5GLDA 3T1SA 3MGPA 2O9AA 2V0WA 3X1UC 5GL9A 3W4PA 3OBFA 1LL8A 2Z2LB 4N1HA 3B33A 2P9VA 4J8WA 3MQLA 5FQMA 2ZL1A 4GB7A 5GLCA 1PYYA 5CPJC 1P3KA 1P3PA 1L0GA 2WAEA 2V1AA 3DTEA 3WRTA 3AZHD 4QNLA 1ESUA 4RQ9A 3C1CD 3WS5A 1TS8A 4HIAA 4PM9A 2G2UA 1XJ6A 5B33C 5EVID 1IEMA 2DRWA 1S0WA 4HHDA 3ZCZA 3TOIA 3AZMB 1U35D 3IX3A 4QLCB 4N1XA 4X55A 1KX4D 3BRMA 4S2NC 4HNBA 4O7DA 3ULFA 1NRJA 1P3FA 2Y2KA 2WKHA 4FD8A 4H9NA 4KG5A 1XP4A 4H9SC 2ZY4A 3O87A 4LV3A 3H82A 3RTYA 1XJ2A 3O62C 3ZDJA 3VH6W 2V0UA 2GDNA 1FR1A 2J80A 1EQZA 4R3BA 4OJOA 3S22A 3V3SA 2M7VA 3VV4A 3G30A 1LHYA 4Z5TD 1GSWA 3N7WA 5G4YA 3SW1A 2FFYA 1F66A 3B6FA 3NCKA 3IF5A 3PR6A 3WD1A 2XQZA 3REIA 2O0YA 4BBTA 5B32A 5C5KA 3X1VC 2L1MA 3BY8A 4S2LA 2DMWA 3B6GB 4Q0IA 1S32C 5B24D 4G3KA 4E3IA 4KGCA 2NQBD 5FAPA 3NECA 4HQAA 1FIKA 4KZ6A 3SH9A 3T50A 4C6YA 4Z5TC 2YFWA 3ZVTA 3LELC 2VLGA 2AROC 1C3BA 4WV4B 3AV2C 4ZBJC 4K08A 4ME4A 4H9PA 3WAAB 3B0DB 3WS2A 1DP6A 4NYUA 1P3IA 1BLCA 3MSHA 3L29A 2RL3A 3TSGA 2RTSA 4NKPA 4P6ZS 4S2PA 3HLDA 3UTBC 1XFNA 2UV0E 4U0TA 3MS6A 3IF6C 1TDGA 1KX4C 3H0LC 2VV7A 2G5IC 3LYXA 4UAAA 4ARZB 3C38A 1EROA 3B0CT 4G91C 3T4QA 3UT9A 4P85A 1F98A 4E3KA 1T1BA 1P3OB 4WLAA 3AN2D 2P7JA 1M19B 3TJZC 1MWTA 1ED7A 5CTMA 3GECA 5GT0C 4KQDA 5KSHA 1F1EA 4IBXA 4JGPA 1CK7A 2QPNA 4KQQA 5AY8D 4FTXA 5E43A 1E4DA 2PR5A 5CPIB 1MPLA 1XA1A 1FCOA 4EWFA 1B6WA 4XZQD 4GHIB 2ZQCA 5A93A 1KE0A 1Q2PA 3WKJD 4CAYB 1YMXA 2HP5A 4J8WC 5E2HA 1WE4A 3FKVA 2H0YA 4BL3A 1KX5C 3AZIC 1ONHA 4WF0A 4CJNA 5B1LC 3MXQA 3P98A 4EQ1A 3BQ8A 5CECA 3DWKA 3MQ0A 4HBUA 4WU9B 3WS0A 4JF6A 4J8XC 4Z66A 3AV2D 2NUPC 1H0IA 3UNWA 4WU8A 3V67A 3IWOA 3VH5A 5AVFA 5GT0B 2HIOD 1BLPA 3FDDA 4H9PB 3WAAA 3KSGA 2K31A 3MJQA 5EVEA 1NRFA 3AZFA 2CMNA 4E3MA 5CPIC 5G49B 3V9RB 3HLGA 3OPPA 3LR4A 1OPXA 4HGAC 4Z2KA 1FCNA 2W3HA 1OTEA 4J8XA 4HP9A 4OJ5A 3ITBA 1KGEA 5FASA 4MN5A 5FDHA 1MXOA 2HP9A 5DVAA 1DJCA 4WNNA 5EV0A 1UGUA 1DY6A 5F69A 1WWIA 4Y15A 4F3LA 3SS5A 3UPPA 4KZ5A 5HX9A 5B0ZD 3AZHB 3M2KA 3OZHA 1NYYA 4GD6A 3IF6B 1KU5A 1ERQA 1ES3A 3D72A 5DF9A 3T4TA 3O62D 1P3MB 3VP3A 4H9RB 5AV9B 4G92B 5JA4A 3CAXA 2XRNA 4JGOA 2WKRA 5B40A 3GQZA 4PKYG 4R38A 3R45B 1W1YA 4D2OA 5FQJA 4WUJA 4R8PA 5DTKA 5HDCA 3KUYA 3LJAB 5AQBA 5EUAA 4MN6A 1ZHHB 4X69A 1OMEA 4MB4A 2F2AC 2H5SA 4NXBA 3UTAA 3A6NB 4IUHA 5BPVA 4J8VC 5EM0A 3AFAB 2G2WA 3H7WB 2Y2NA 5AVCC 4EW7A 5C3IB 3KUYD 1S4RA 4XUZA 1M19D 4O8GA 3PAEA 2H0TA 1KX3D 4DJ2A 3A0RA 3B42A 3CI6A 3H7WA 1STZA 3MXRA 1CXWA 4I3AA 3EGDC 3KSYA 4J8UD 3E2KA 3UMEA 4AWLB 4CQHA 4NE3A 4HJ6A 1K38A 4FCFA 3W98B 4EESA 1P3BC 1N9LA 1M1AC 2ZM5A 5FI6A 4IEDA 4ZAMA 4R70A 5AVCA 1MC0A 2Q0OA 3C8CA 3VE3A 1OTDA 1MWRA 1Q2QA 3BFGA 4X1LA 3X1VB 2HDUA 3NC8A 5U47A 4CLCD 3HLFA 5B2JD 1UR8A 4YM6B 3ZG9B 4QPRA 3GRJA 3Q82A 3ZHHA 4U3TA 3QP8A 4LD9A 4QLCD 3SZTA 1LSWA 3LJAC 1HQ3C 3VE4A 5HWVA 2XDMA 1KX5A 2B02A 2WUQA 3AZEB 3MGRC 1XFQA 5F6AA 3IBJA 2INWA 1FR6A 4DXCA 4YFMA 2W8SA 2NZDA 5B40D 1IKIA 2J7VA 2YKFA 3AFAC 4QHCA 2RVQC 1IFQA 3F6TA 3HONA 2X02A 3AN2B 4J8UC 3PBOA 4H6JA 3REJD 2HUEB 5CTNA 3AZFC 4GW9A 5A90A 3CWFA 3PBTA 2BYMB 4WMCA 1M19C 2YFWB 2ZJ9A 4LD9D 4QD4A 2WAFA 4R0QA 3RH8B 3AYWC 2PYOC 2IWCA 2NZDC 1P3IB 2K2NA 2P08A 1Q9CA 2PAVP 2WKPA 3LZ0A 4JXGA 1EWZA 4NXEA 5C3IC 3AZIB 5CHJA 2XLNA 4FSFA 5BO0A 1ID3C 4WU8C 5GHXA 3W98A 1YU0A 5A8BA 4XUJD 3S4XA 4EO5B 2Y8HA 3LY4A 4OH0A 2HIOA 5FEGA 4O01A 1XKZA 2EX6A 4J8XB 4JKTA 4X56A 3W99D 4E3LA 4YM6A 3K3CA 1W8QA 4GHLA 4FUWA 3LIDA 2BASA 5CGXA 3M6BA 1E88A 3W96B 4PM5A 4HBTA 3RELA 2XH9A 5DFXA 4JXVA 2A3UA 3DAVA 4KZ3A 3ZG5A 4KHAA 3NJAA 1TZYB 4OP5A 5B0ZA 4ZJ3A 3NIAA 1V9YA 2DQNC 1I2WA 4MEZA 1AOIC 1HD8A 4E3JA 4H9SA 2ZD8A 1TZYA 4K0WA 4R8PC 3TG9A 4OLGA 5CPID 1IYQA 3M7PA 1PDCA 3LIFA 3VH6T 3O3VA 2PHYA 5HPFA 4ZTKA 5AV5C 2HPBA 4OVDA 2BYMA 3KYEA 2QKPA 3JPUA 4NEED 5HAPA 4E6XA 4U0XA 3CPTA 3GSGA 1ID3B 1S4SA 2Z6CA 2JN7A 4LENA 4ESPA 5B0YD 1K54C 1YLZA 2ZM0A 4IVKA 4DE0A 3NOTC 3KWQA 3B6FC 4H9NB 2KDKA 4WU8D 1ACFA 3VH6A 2ZOHA 4MBKA 5B1MA 3F1PA 3ZNYA 4IBRA 1I5QA 4OJLA 1O6IA 1S1YA 2NZDD 2CV5D 4G3VA 5B40B 3MVDB 1YU2A 4QLCA 3WKJC 1H8MA 4JJNC 4X23B 5GSUC 4KGCC 1JTGA 2X71A 2WKQA 3T1RA 3MFXA 3B0BA 3MKFA 1FILA 2ZMAA 3MNNA 3X1SB 1GSVA 4KZ4A 4KZ7A 1P3BA 3DBAA 5B31C 1YQSA 4MBHA 1FOFA 5HDSA 3REID 2OOLA 2WGVA 5BOHA 4LRXC 3C7VA 5B1MC 3OPLA 2RVQD 3FWLA 4UUZA 2W1TB 3UTBA 5GXQC 1ZLAA 1TS0A 1NJ4A 5FQKA 4Z66D 2VGKA 3EQVA 3LZ1D 1K6RA 5DTSA 3VSLA 5CP6A 3MBZA 2OLVA 4GDBA 1H3OB 3UT9C 5HD3A 3Q07A 4JGRA 5F99B 3QNBA 5TGFA 2FFFB 2XR0A 2XA7S 1VEUA 5GT0A 3U2AA 1FCMA 4BD0A 4NE5A 1P3FD 4B9OA 5AY8A 3IHBA 5B2JC 3G31A 3CITA 5B33A 3EEAA 3MGRB 3FG8A 4DDYA 3X1UA 3PBRA 1EI5A 1OJGA 4GDNA 3AZND 2PYRA 2QZ6A 3K3DA 1G6OA 1MWUA 3UB8A 3F1NB 4PPRA 1LLBA 2NUTC 1PIOA 1GHPA 1M19A 3KO6A 3WA9D 5B1LA 4JXSA 3A6ND 3D4FA 4LCLA 3C1BA 4ZRRA 5AV8A 2PD8A 2QMIA 2OV5A 1S32B 3AYWA 2PYOA 4XUXA 4F3LB 5B31B 3F1NA 1W2EA 4NZ3A 5B2IA 2DCFA 1ONGA 1YPRA 2VK3A 3UTAD 3WAAC 1K57C 5KIZA 3ITAA 3UB7A 3AZGC 3H0RC 3MVDC 3FKWA 3W98D 5FSRA 1QMFA 3C2WA 5BNVB 3X1TD 1P3MD 1EQZD 5HSQA 5DFYA 4HJ3A 5D3OA 4H9OA 3MZFA 5E5AA 4WEJA 3N8SA 3A6NA 4YOFA 4WU8B 2KX6A 2VGJA 4M3KA 3BJNA 3ZG7B 3FKEA 3G2ZA 1U35C 4DXBA 3EG5B 4M4XA 2ZMVA 2WGIA 1K57A 5G4ZA 4NG2A 4XUJB 4ID4A 3AZGA 1EQZC 3LZ0B 2J9OA 3VH5W 4JBFA 3LELA 4MNRA 3W8KA 4IUKA 5HWWA 5B0ZC 3AZGD 3C1CC 4UQIS 2J8PA 1W1VA 3L7HA 1F66C 4QJGA 3TU4A 2B18A 4HEFA 3NQJB 3X1UB 1KX4B 1YM1A 3T1QB 3N8RA 1GXDA 1TZYC 3IP4C 4DRAA 4G91B 5CPKC 1K6SA 3PTEA 2ZY2A 1U35A 3GVBA 4WZSB 3T4JA 2F8NG 4Y0TA 5DNNA 4YS3A 5FQQA 2XA7M 3WA9C 1GOIA 4P0MA 5CPJB 1RGZA 3EPLA 3C1CA 2ZC3B 1MWSA 1EQZB 2L0WA 5AV9D 5M18A 4XZQB 2MJ6A 2WADA 1P34D 5L07A 3MR0A 2XROA 2Y2IA 3K2NA 5MC7A 1K25A 3BFCA 3NBLA 5BNVA 1NZOA 3UDIA 3R7WB 5E2EA 3DTIA 1FQGA 3AZID 3EWKA 3LGOA 2PBYA 3VOZA 1HVBA 1W63M 5E5AB 4X23C 2JKRM 3LZ1C 5FEFA 1HZOA 4OOMA 2Y2PA 3WTPD 1GA9A 2WK0A 4Z66C 4KZBA 3TRCA 2GX5A 5AY8C 5HAQA 4QWOA 5GXQD 5A92A 4MCWA 1LSXA 3ZYTA 1YKDA 3AZNB 4IBBA 5GT0D 2R78A 4F94A 1X0OA 3A0SA 3W2ZA 4IJFA 3KYZA 1W79A 4E3NA 3MGQB 3DTMA 3S7NA 2HDSA 1UWNX 4UPKA 1N9BA 3HLWA 2L5AA 1M18B 4DE1A 1YU3A 3V5MA 4B93A 4Q0JA 3AZIA 1CJFA 5B2ID 1CI8A 3VH5T 1ULYA 4KGCD 4R3AA 1H3QA 2Z2MB 3WRZA 2GJ3A 4E3OA 2CV5C 2V1ZA 4WN5A 5AV8D 3REKC 5BS7C 4R23A 3OCLA 5GLBA 1E6PA 5GT3A 2BTFP 5EE8A 4BJPA 4YS3D 2KLIA 2HUEC 3B6FD 1KDWA 4UUZB 1W7FA 5B2JB 2IA2A 5AVCB 5B0YC 3O86A 1TS6A 2O9BA 4I3IA 3MMHA 2W3FA 4Y17A 3EOIA 3X1SA 3U4LP 5AVBA 4II7A 4ZUXA 5AV5D 2NZDB 2CV5A 1YSPA 5J3WA 1L0EA 4WL9A 3A6NC 1NYMA 3PBSA 2D49A 5JRGB 3IHAA 3G2YA 4KHAB 5DNMC 3BEBA 3LICA 2WGWA 3T12B 3UO9A 1XGJA 3H9WA 4UA9A 4Q8IA 4ZJ1A 3MGQD 5B0YA 4P6BA 4E04A 3NDGA 1BUEA 1KS0A 1ES4A 5HDDA 2LB5A 4OQIA 3CLOA 5CRFA 1P3FC 1Y4OA 3MGPC 3LEQA 5FAQA 1OT6A 2B95A 4FH2A 4OONA 3LZ1B 4AWLC 3CPTB 1PW1A 5CPKA 4J8VB 4Y5FA 5DNND 4Z66B 3KSIA 1NZUA 5AY8B 4Y0OA 2Q9NA 3N3FA 3CUEA 5DNNB 5JRGC 4KZAA 1PZRA 3LIEA 4NZ4A 3TU4D 3IQAA 2D01A 4RX3A 2OAQ1 2VZWA 5B1MD 1BH8B 1VETB 3IX4A 5B33D 2Y2JA 1GA0A 4ARZA 2HZ5A 2F8NK 1PW8A 4GHIA 1N4OA 3AZKA 1FSWA 1YLJA 2J8YA 3R45A 3HCYA 2XK1A 3W96D 4DN0A 4LD9C 4DE2A 3WA9A 2CWEA 4JJND 1O07A 5IU1A 3BQAA 1P3GD 3UDXA 4N9KA 1IYOA 3REIB 3X1UD 1W8YA 1E15A 1BFMA 4OOLA 2JCHA 1CI9A 1XJ3A 5B31G 1P3GC 3AFAD 4RYEA 3V3RA 4JJNA 3NI9A 4MLLA 3RJUA 3NQJA 1KX4A 4DDSA 1JFIA 3MNND 1GPFA 3C1BD 1TAFB 1BYWA 3FPVA 1MY8A 2VJWA 4IBJA 3M2JA 3Q7VA 4R8PD 3MFDA 5B32C 1E6ZA 1T19A 3MGRA 3EPJA 4GHAA 1ESIA 5B1MB 3F1PB 2OAP1 5AV6B 1TF1A 1VM1A 2D02A 5GHYA 1P3FB 4EO5C 2JKGA 3AZNA 3FZCA 3E4OA 4JXWA 1T18A 4Z5TA 5JRGD 2AROA 4Z2JA 5GHZA 2ZQ7A 3BWLA 4IBIA 3HLBA 2W27A 2VX8A 2PR6A 4KG6A 1M6KA 3C30A 3O5YA 4GN2A 1L3LA 3QP5A 3MGPD 5HZHA 5FDSA 5J8XA 1ZG6A 2F8ND 4K0XA 3X1SD 5HL1A 3IF6A 3REKA 1W1TA 1T1CA 1YT4A 3MGSC 3HUOA 4CLCE 4D60A 4Z9QA 1J3WA 3MGQC 4Y0UA 1T1AA 3AV1A 1P3BB 1HTZA 1ERMA 3REKB 3JYIA 2LY8A 4LD9B 1DP9A 2Y91A 3PBQA 3UPOA 2HJEA 1KGGA 1RP5A 4LGWA 4GS9A 3REKD 5AV8C 1PNEA 3WX7A 1AXBA 4OP8A 4PMAA 3C4PA 3L9KA 5DJTA 1DRMA 3UTAB 1W1PA 5B2IC 2FZ0A 5HARA 4S2KA 1VHMA 2ZQAA 5B33B 1JFIB 2ZQ9A 2PBDP 3CJMA 2Y2LA 1IYPA 3LI8A 2FH5A 4WU9D 3TU4B 4Z1WA 1H8YA 1UWPX 3F1OB 2ZOIA 3I7JA 3O88A 4Z2LA 5L10A 2XF3A 4LPZA 1K54A 5AV6A 1SKOA 5AQ9A 5CGSA 2Y2QA 5TJJA 1S1ZA 5GXQB 5CGWA 3KX0X 1K4FA 5B40C 3KSHA 1M18A 4CLCA 3V50A 2A49A 1KDSA 3MGRD 4H8RA 3LZ0D 1YMSA 4S2IA 2RIQA 3NQUB 2HF6A 5CEBA 4PAUA 4CPKA 1Z6FA 1I2SA 5F99C 4N92A 3G4PA 4NXFA 4E6WA 3HSHA 5EPHA 4XZQA 1NLZA 2PT7A 5FATA 1M18D 2HDQA 3UMDA 3AYWB 2PYOB 1BTLA 4OLDA 5B31A 4GJ4A 3UE0A 4LFUA 1F2KA 4CLCC 1LT0A 3SS4A 5L2FA 5TBMA 4ZBEA 1H0GA 2OSUA 2EX9A 2P74A 2XFTA 2Q9MA 2F8NA 5IHVA 1SKFA 4HP4A 4LG2A 1BH9A 3RELD 1ALQA 1J9MA 2VA0A 3A1IA 1YSQA 4IBFA 2PU2A 4G3WA 2G7UA 1KX5D 1LL5A 1TVFA 1YLPA 2HDRA 3G32A 4YM6D 4WEKA 4HOIA 3LIBA 1R4VA 4XXRA 4OQ0A 4GD8A 4GCZA 5G49A 3V9RA 3AZJA 3KUYC 1NXYA 5AV9C 4R4RA 3BLMA 1TEMA 3AV1D 4XUJA 3AZGB 2V1BA 4X68A 1KOUA 1G5UA 2HIOB 3KXBC 2PRFA 2PYPA 1VETA 1SZVA 5EECA 4UQIM 3AN2C 2FJ7D 2Y55A 4WM9A 1AIWA 3AZFB 2HP6A 1NLYA 1WA9A 3AGEA 1BSGA 1PFLA 1NWZA 1H0MA 1L0FA 1TZYD 4X23A 4WELA 2EXBA 3IXHA 4EETB 3NQUA 4Z2MH 5JYPA 2F8NH 4BL2A 3LY3A 5B2JA 4KZ8A 2WZZA 4ZDXA 3X1TC 4GKUA 5L8MA 3LUQA 2ZMFA 4R8PB 3LR0A 3B3XA 2V2FF 3REHB 5B0ZB 4S2MA 1M1AA 1V9ZA 3MVDA 5CHMA 3R4KA 3B6FB 1KX5B 4O0PA 5TBMB 4H9RA 5CX7A 2VV8A 3MXSA 3NOPC 1PZOA 2NQBC 3ZNTA 1ES2A 1P9RA 5B24C 2WGWB 2IO5C 4JF5A 1BH9B 3PYPA 4KUOA 3IWQA 3Q7VB 2Y2HA 3X1VD 5BNXA 1BLSA 3N4IA 4N9LA 3X1TA 1ID3A 3KXBD 4FH4A 1TS7A 1IOUA 3MVDD 2XGNA 1TD5A 5FQIA 3UE3A 1KE3A 3S7OA 4JJNB 4DJ3A 2HIOC 3KXBB 4DKIA 3T4LA 1K55A 2M1CA 3VP2A 5CPKB 2NQBA 2K7SA 3X1SC 4S2OA 3AFAA 3Q1FA 5B24A 3RFBA 3ISGA 4Z2HA 3UB5P 1CEGA 4GZBA 3AL0C 3E2LA 4KENB 4UA7A 1F9IA 2Y59A 5EOEA 2BYKB 3MQOA 4IBKA 5GT3B 3O62A 3Q7ZA 5DTTA 3RELC 3VMAA 4BBUA 1KGFA 5KZHA 5AV8B 3MNNB 4J8WD 2HJ9C 2QHKA 5K5BA 4HY8A 1FSYA
chains in the Genus database with same CATH topology
1JWZA 4XZQC 3WTPE 1G68A 4R3JA 3KS4A 1K55C 3WS1A 3W4OA 4IJEA 5AV6D 1GHMA 4WZ4A 4NE6A 4MBFA 3REIC 1ES5A 3W96A 3IWIA 2IO5B 3WWXA 1P34B 2Y2OA 3WKJB 1L2SA 5F99A 5CERA 5HAIA 1LI0A 3HLEA 3ZG8B 1WYBA 3EPKA 1DJBA 2CV5B 5E2FA 1SDEA 3WTPB 4OJ6A 4KQOA 2E8IA 3OPRA 3NDEA 5B31D 2IWDA 1H3OA 3MZEA 3M6HA 1NY0A 3LELD 3AN2A 2ZQ8A 4EBLA 1W5DA 3SH8A 1CEFA 1YUEA 1JWPA 5BT1C 4BD1A 1S32D 1P3LA 3EQUA 1VQQA 5I94A 1IELA 3HLCA 4Z5TB 1XGIA 5AV5A 4ZUXD 5F1FA 5AVBD 4NZ1A 2DF4C 4QB8A 5F82A 1L0DA 3MGSB 5B1LB 1SCWA 1K56D 3HREA 3IXBA 3C7UA 3HL9A 2R9WA 1M1AB 5M1AA 3BFDA 4OPQA 3S1YA 4WNNB 4S2JA 1AOID 3AZLB 3IH9A 3AZHA 3AV1B 2V20A 4GOGA 1P3OC 3VP0A 3WA9B 4X53A 1KE4A 2ZLYA 1T3UA 3LELB 4C75A 1RCJA 2JSSA 2DNSA 2EFXA 3MGPB 1G6AA 3WTPA 5EVIC 4KGCB 4DRTA 4LV0A 3C1BC 2UWXA 3OPHA 3AZHC 3AYWD 2PYOD 4WZ5C 5KDMA 3X1TB 5HW3A 5CPJD 5CHLB 3UPNA 4J8UB 4B88A 1QMEA 3B6GA 4NFTA 4E45A 1TDLA 5KDMB 1GHIA 1HTAA 5EOOA 2NQBB 3BECA 5F1GA 4M6BA 1CK3A 1LL9A 3W96C 5E5AD 3H0MC 2XEPA 3AZKC 5FI7A 3ZFZA 2EX8A 3AZFD 1P3LD 4E44A 1GCEA 3LJAD 1P3KC 1P3PC 4KG2A 3W4QA 1XA7A 4KZ9A 5JRGA 5G18A 2ZM2A 1PZPA 1E3UA 5AV6C 1P3GB 1MKIA 2C6WB 2FJ7B 3RXXA 1E3UD 1P3GA 4IBCA 2JE5A 3UTBB 3SOIA 1P3BD 1KX3B 3AZEA 2IOUA 4PM6A 4CAYA 1P34C 5B0YB 1KX3A 5E2GA 5E5AC 5TR7A 4Y7PA 1XPBA 3KS8A 1U60A 4B4XA 2EXAA 4R1GA 5AVCD 1Z2CB 1H5XA 1BZAA 1N1JB 3AZEC 4WJ3C 2ZY3A 1P3AC 4J8VA 3MZDA 5B32G 4KUDA 4WYYA 3W97A 5CPKD 1P34A 1KX3C 3MKEA 5FA7A 3X1VA 3A3DA 1P3MA 5AV9A 1F66D 3WS4A 4YS3C 3GMWA 4J8VD 2PU4A 1PI5A 5F83A 1P3AA 3QNCA 3Q81A 4KUDC 1SHVA 3VSKA 3AZKB 2G5HC 4LV2A 1P3IC 3VP1A 1XX2A 3AZMC 1K56A 1BLHA 2P9VB 4OPYA 5CEDA 1P3AB 2ZQDA 3VFHA 3CG5A 4JPMA 1P3OD 3AGDA 1S6RA 5FUGA 3B0DC 1YLTA 3VOYA 2FJ7C 3REHD 2BG1A 3G35A 5FI2A 3N8LA 3BFEA 5GT3C 3A3IA 3IT9A 5FUGB 3W98C 5DNMB 2ZC6B 3MGQA 3AV1C 3WAAD 4OJPA 3AZMA 3LZ1A 4CSRA 1BULA 4X23D 3FV7A 2AROB 1ZLAD 4ZUXC 1ZC2A 4YM6C 4IBEA 1TAFA 3A1KA 1KVMA 4GNUA 2WYXA 5AQAA 4BQMA 4J8XD 3VFFA 5BO0B 4WZ5A 4CSRB 3AZJD 4EV4A 1K4EA 3NY4A 4WMCD 3G34A 3B6GC 2RCXA 5BT1D 1BH8A 1M40A 4NK3A 2ZC7A 3IXDA 2Y2MA 1IKGA 2ZY5A 4Z2MG 2WZXA 4ZBJB 5AVBB 1YLYA 4UA6A 3P5JB 2X01A 1H8ZA 1M18C 5B1LD 4GH9A 4JF4A 2JC7A 5F99D 4JLFA 1RGYA 2R9XA 3UT9D 4DE3A 4UHUA 3L28A 2XFSA 2Y4AA 1WWSA 3OC2A 4BENA 1YU4A 3B0CW 1PWDA 4OOYA 1A7WA 3A3EA 3EPHA 4OPRA 1P3KB 1P3PB 4EQIA 3P09A 5DNMA 3PBNA 4WU9C 4BLMA 2EFUA 2XD5A 1ZKJA 3W99B 4IBGA 1AOIB 3KXBA 2AROD 4WBGA 1JVJA 4HESA 5M19A 5GSUD 2ZC5B 3KWQB 3W99A 2WKEA 1AOIA 3UTBD 4LCMA 3L25A 3A3FA 5B2IB 1P3MC 2VQRA 3AZJC 3ZGAB 3W97D 5AQ7A 4EBPA 1WYCA 4ZUXB 1ZLAC 3REJB 3UTAC 3MGSD 4R4SA 5JYOA 3CZDA 3GV9A 1E25A 1PI4A 3W97C 5FQ9A 4L0LA 4OQGA 2B5RA 5CHUA 3REHC 2FJ7A 3FYZA 3RXWA 3AZNC 2CC1A 3LCEA 4QY5A 5B32B 3AZJB 3CMZA 5TFQA 3AZMD 3L26A 2F8NB 3V39A 5EVLA 4RX2A 3UE1A 4X6TA 2H10A 4PM8A 2YFVA 4G92C 1JWVA 2IWBA 3C5AA 3HBRA 3W97B 3MGSA 2J9PA 2Y2GA 5A91A 5DF8A 4LV1A 5EVIA 1ID3D 1BT5A 1P3AD 3LEZA 5KSCA 5FAOA 3RELB 5JA4B 3BFFA 4NETA 4OUIA 3DWZA 3DW0A 3C1CB 3LJAA 3B6GD 1ZLAB 1O7EA 5CPIA 3UN7A 1Y54A 5HFOA 3SS3A 5BNXB 5KMWA 2BLSA 4EUZA 3HVFA 3AZLA 1YLWA 3L2AA 3TU4C 3BYDA 4YINA 3C4OA 1DJAA 4WU9A 4IVIA 4J8UA 4IBDA 4J8WB 1MBLA 4NZ5A 1HQ3D 5GSUB 1ZG4A 5DNNC 5CP6D 5GT3D 2ZM8A 1HQ3B 1P3LC 3AZLC 1N1JA 3AZKD 2WKIA 2I72A 3GTCA 3LZ0C 3HUNA 4K91A 5B24B 1M1AD 1PWGA 4H9QB 3BM6A 1P3ID 3UT9B 4YS3B 3SH7A 5DNMD 5EVIB 3ZVWA 4KUDD 1SDNA 3KFUG 4P87A 4QU3A 2ZC4B 2C5WB 4S2NA 3UDFA 3IXGA 3W99C 4OQHA 4DQYB 3REHA 3AV2B 3QHYA 1S32A 3PAGA 3GR2A 1LI9A 3REJA 4XUJC 3LO7A 4QY6A 2XD1A 1P3OA 3KWQD 5DF7A 1KVLA 4H9OB 3KUYB 1IYSA 3AZED 3AV2A 3BLSA 3KWQC 2YFVB 2JBFA 4A5RA 5CP6B 2OLUA 3HUMA 4PM7A 5GSUA 3REJC 4EBNA 5GLAA 4B4ZA 4OPZA 4RA7A 3OCNA 4C3QA 1HQ3A 4KUDB 3C1BB 3A3JA 4ZJ2A 3AGFA 5AV5B 4RVAA 2BYKA 3WTPC 3O62B 3L27A 5GXQA 4H9QA 5AVBC 1P3LB 4KQRA 3AZLD 4DF6A 4QLCC 3WKJA 3UY6A 4NY2A 2EX2A 4DRBA 5B32D 3VP4A 5CP6C 1P3KD 1P3PD 1U35B 3ZG0A 3IH8A 5CXWA 3MNNC 1JTDA 1B67A 1XXMA 5CPJA 4HGAB 3N6IA 1YU1A 4NYYA 1PWCA 4OKPA 1F66B 5BS7A 5GLDA 3MGPA 3X1UC 5GL9A 3W4PA 2Z2LB 4N1HA 2P9VA 4J8WA 5FQMA 4GB7A 5GLCA 1PYYA 5CPJC 1P3KA 1P3PA 1L0GA 2WAEA 3WRTA 3AZHD 4QNLA 1ESUA 3C1CD 3WS5A 4PM9A 2G2UA 5B33C 5EVID 1IEMA 2DRWA 1S0WA 3ZCZA 3TOIA 3AZMB 1U35D 4QLCB 4N1XA 4X55A 1KX4D 3BRMA 4S2NC 4O7DA 1P3FA 2Y2KA 2WKHA 4FD8A 4H9NA 4KG5A 1XP4A 4H9SC 2ZY4A 3O87A 4LV3A 3O62C 3ZDJA 3VH6W 2GDNA 1FR1A 1EQZA 4R3BA 4OJOA 3S22A 3V3SA 3G30A 1LHYA 4Z5TD 3N7WA 2FFYA 1F66A 3B6FA 3NCKA 3IF5A 2XQZA 3REIA 5B32A 3X1VC 4S2LA 3B6GB 1S32C 5B24D 4E3IA 4KGCA 2NQBD 5FAPA 4KZ6A 3SH9A 4C6YA 4Z5TC 2YFWA 3ZVTA 3LELC 2AROC 1C3BA 4WV4B 3AV2C 4ZBJC 4H9PA 3WAAB 3B0DB 3WS2A 4NYUA 1P3IA 1BLCA 3L29A 2RL3A 3TSGA 4S2PA 3HLDA 3UTBC 4U0TA 3IF6C 1TDGA 1KX4C 3H0LC 2G5IC 4UAAA 1EROA 3B0CT 4G91C 3UT9A 4P85A 4E3KA 1P3OB 3AN2D 1M19B 1MWTA 5CTMA 5GT0C 5KSHA 1F1EA 4IBXA 2QPNA 4KQQA 5AY8D 5E43A 1E4DA 5CPIB 1MPLA 1XA1A 1FCOA 4EWFA 1B6WA 4XZQD 2ZQCA 5A93A 1KE0A 1Q2PA 3WKJD 4CAYB 1YMXA 2HP5A 4J8WC 5E2HA 1WE4A 3FKVA 2H0YA 4BL3A 1KX5C 3AZIC 1ONHA 4CJNA 5B1LC 3P98A 5CECA 3DWKA 4HBUA 4WU9B 3WS0A 4JF6A 4J8XC 4Z66A 3AV2D 3UNWA 4WU8A 3IWOA 3VH5A 5GT0B 2HIOD 1BLPA 3FDDA 4H9PB 3WAAA 1NRFA 3AZFA 4E3MA 5CPIC 5G49B 3V9RB 3HLGA 3OPPA 4HGAC 1FCNA 4J8XA 4OJ5A 3ITBA 1KGEA 5FASA 5FDHA 1MXOA 2HP9A 5DVAA 1DJCA 4WNNA 1DY6A 1WWIA 3SS5A 3UPPA 4KZ5A 5HX9A 5B0ZD 3AZHB 3M2KA 3OZHA 1NYYA 4GD6A 3IF6B 1KU5A 1ERQA 1ES3A 5DF9A 3O62D 1P3MB 3VP3A 4H9RB 5AV9B 4G92B 5JA4A 5B40A 3GQZA 3R45B 4D2OA 5FQJA 4R8PA 5DTKA 3KUYA 3LJAB 5AQBA 5EUAA 4X69A 1OMEA 2F2AC 2H5SA 3UTAA 3A6NB 5BPVA 4J8VC 3AFAB 2G2WA 2Y2NA 5AVCC 5C3IB 3KUYD 4XUZA 1M19D 3PAEA 2H0TA 1KX3D 3MXRA 3KSYA 4J8UD 3E2KA 4AWLB 4NE3A 1K38A 4FCFA 3W98B 1P3BC 1M1AC 2ZM5A 5FI6A 4IEDA 4ZAMA 5AVCA 1MWRA 1Q2QA 3BFGA 3X1VB 2HDUA 3NC8A 5U47A 3HLFA 5B2JD 4YM6B 3ZG9B 3GRJA 3Q82A 3ZHHA 4U3TA 4LD9A 4QLCD 3LJAC 1HQ3C 2XDMA 1KX5A 2WUQA 3AZEB 3MGRC 1FR6A 4DXCA 4YFMA 2W8SA 2NZDA 5B40D 1IKIA 2J7VA 4QHCA 3AFAC 2RVQC 3F6TA 3HONA 2X02A 3AN2B 4J8UC 3PBOA 3REJD 2HUEB 5CTNA 3AZFC 5A90A 3PBTA 2BYMB 4WMCA 1M19C 2YFWB 2ZJ9A 4LD9D 4QD4A 2WAFA 4R0QA 3AYWC 2PYOC 2IWCA 2NZDC 1P3IB 1Q9CA 3LZ0A 4JXGA 1EWZA 5C3IC 3AZIB 5CHJA 2XLNA 4FSFA 5BO0A 1ID3C 4WU8C 5GHXA 3W98A 1YU0A 4XUJD 3S4XA 4EO5B 3LY4A 4OH0A 2HIOA 1XKZA 2EX6A 4J8XB 4JKTA 4X56A 3W99D 4E3LA 4YM6A 1W8QA 4GHLA 5CGXA 3M6BA 3W96B 4PM5A 4HBTA 3RELA 2XH9A 4JXVA 2A3UA 4KZ3A 3ZG5A 4KHAA 1TZYB 4OP5A 5B0ZA 4ZJ3A 3NIAA 2DQNC 1I2WA 4MEZA 1AOIC 1HD8A 4E3JA 4H9SA 2ZD8A 1TZYA 4K0WA 4R8PC 3TG9A 4OLGA 5CPID 1IYQA 3VH6T 3O3VA 4ZTKA 5AV5C 2HPBA 4OVDA 2BYMA 5HAPA 4E6XA 4U0XA 3GSGA 1ID3B 4LENA 5B0YD 1K54C 1YLZA 2ZM0A 4IVKA 4DE0A 3KWQA 3B6FC 4H9NB 4WU8D 3VH6A 4MBKA 5B1MA 3ZNYA 4IBRA 1I5QA 4OJLA 2NZDD 2CV5D 5B40B 3MVDB 1YU2A 4QLCA 3WKJC 4JJNC 4X23B 5GSUC 4KGCC 1JTGA 2X71A 3B0BA 3MKFA 2ZMAA 3MNNA 3X1SB 4KZ4A 4KZ7A 1P3BA 5B31C 1YQSA 4MBHA 1FOFA 3REID 2WGVA 5BOHA 3C7VA 5B1MC 3OPLA 2RVQD 3FWLA 4UUZA 3UTBA 5GXQC 1ZLAA 1NJ4A 5FQKA 4Z66D 2VGKA 3EQVA 3LZ1D 1K6RA 5DTSA 3VSLA 5CP6A 3MBZA 2OLVA 4GDBA 1H3OB 3UT9C 3Q07A 5F99B 3QNBA 5TGFA 2FFFB 2XR0A 5GT0A 1FCMA 4BD0A 4NE5A 1P3FD 5AY8A 3IHBA 5B2JC 3G31A 5B33A 3MGRB 4DDYA 3X1UA 3PBRA 1EI5A 4GDNA 3AZND 2QZ6A 1MWUA 4PPRA 1LLBA 1PIOA 1GHPA 1M19A 4JXSA 3WA9D 5B1LA 3A6ND 3D4FA 4LCLA 3C1BA 5AV8A 2QMIA 2OV5A 1S32B 3AYWA 2PYOA 4XUXA 5B31B 1W2EA 4NZ3A 5B2IA 2DCFA 1ONGA 3UTAD 3WAAC 1K57C 3ITAA 3AZGC 3H0RC 3MVDC 3FKWA 3W98D 5FSRA 1QMFA 5BNVB 3X1TD 1P3MD 1EQZD 5D3OA 4H9OA 3MZFA 5E5AA 4WEJA 3N8SA 3A6NA 4WU8B 2VGJA 4M3KA 3ZG7B 3FKEA 3G2ZA 1U35C 4DXBA 3EG5B 2WGIA 1K57A 4XUJB 4ID4A 3AZGA 1EQZC 3LZ0B 2J9OA 3VH5W 4JBFA 3LELA 4MNRA 3W8KA 5B0ZC 3AZGD 3C1CC 2J8PA 1F66C 4QJGA 3TU4A 4HEFA 3NQJB 3X1UB 1KX4B 1YM1A 3N8RA 1TZYC 3IP4C 4DRAA 4G91B 3PTEA 5CPKC 1K6SA 2ZY2A 3GVBA 1U35A 4WZSB 2F8NG 4Y0TA 5DNNA 4YS3A 5FQQA 3WA9C 4P0MA 5CPJB 1RGZA 3EPLA 3C1CA 2ZC3B 1MWSA 1EQZB 5AV9D 5M18A 4XZQB 2WADA 1P34D 2Y2IA 1K25A 3BFCA 3NBLA 5BNVA 1NZOA 3UDIA 5E2EA 1FQGA 3AZID 2PBYA 3VOZA 1HVBA 5E5AB 4X23C 3LZ1C 1HZOA 4OOMA 2Y2PA 3WTPD 1GA9A 2WK0A 4Z66C 4KZBA 5AY8C 5HAQA 5GXQD 5A92A 3AZNB 4IBBA 5GT0D 4F94A 4IJFA 1W79A 4E3NA 3MGQB 3DTMA 2HDSA 4UPKA 1N9BA 3HLWA 2L5AA 1M18B 4DE1A 1YU3A 3V5MA 3AZIA 5B2ID 1CI8A 3VH5T 1ULYA 4KGCD 2Z2MB 3WRZA 4E3OA 2CV5C 2V1ZA 5AV8D 3REKC 5BS7C 4R23A 3OCLA 5GLBA 5GT3A 5EE8A 4BJPA 4YS3D 2HUEC 3B6FD 1KDWA 4UUZB 1W7FA 5B2JB 5AVCB 5B0YC 3O86A 3X1SA 5AVBA 4ZUXA 5AV5D 2NZDB 2CV5A 1L0EA 3A6NC 1NYMA 3PBSA 5JRGB 3IHAA 3G2YA 4KHAB 5DNMC 3BEBA 2WGWA 3UO9A 1XGJA 4UA9A 4Q8IA 4ZJ1A 3MGQD 5B0YA 4P6BA 3NDGA 1BUEA 1ES4A 4OQIA 5CRFA 1P3FC 3MGPC 5FAQA 4FH2A 4OONA 3LZ1B 4AWLC 1PW1A 5CPKA 4J8VB 5DNND 4Z66B 1NZUA 5AY8B 4Y0OA 2Q9NA 3N3FA 5DNNB 5JRGC 4KZAA 1PZRA 4NZ4A 3TU4D 3IQAA 4RX3A 5B1MD 1BH8B 5B33D 2Y2JA 1GA0A 2F8NK 1PW8A 1N4OA 3AZKA 1FSWA 1YLJA 2J8YA 3R45A 2XK1A 3W96D 4LD9C 4DE2A 3WA9A 2CWEA 4JJND 1O07A 1P3GD 3UDXA 4N9KA 1IYOA 3REIB 3X1UD 1W8YA 1BFMA 4OOLA 2JCHA 1CI9A 5B31G 1P3GC 3AFAD 4RYEA 3V3RA 4JJNA 3NI9A 4MLLA 3RJUA 3NQJA 1KX4A 4DDSA 1JFIA 3MNND 3Q7VA 3C1BD 1TAFB 1MY8A 4IBJA 3M2JA 4R8PD 3MFDA 5B32C 3MGRA 3EPJA 4GHAA 1ESIA 5B1MB 5AV6B 1VM1A 5GHYA 1P3FB 4EO5C 3AZNA 3FZCA 4JXWA 4Z5TA 5JRGD 2AROA 5GHZA 2ZQ7A 4IBIA 3HLBA 4KG6A 1M6KA 4GN2A 3MGPD 5J8XA 1ZG6A 2F8ND 4K0XA 3X1SD 5HL1A 3IF6A 3REKA 1YT4A 3MGSC 3HUOA 4Z9QA 3MGQC 4Y0UA 3AV1A 1P3BB 1HTZA 1ERMA 3REKB 3JYIA 2LY8A 4LD9B 3PBQA 2Y91A 3UPOA 1KGGA 1RP5A 3REKD 5AV8C 3WX7A 4OP8A 1AXBA 4PMAA 3C4PA 3UTAB 5B2IC 5HARA 4S2KA 2ZQAA 5B33B 1JFIB 2ZQ9A 3CJMA 2Y2LA 1IYPA 4WU9D 3TU4B 1H8YA 3I7JA 3O88A 2XF3A 1K54A 5AV6A 5AQ9A 5CGSA 2Y2QA 5GXQB 5CGWA 1K4FA 5B40C 1M18A 3V50A 2A49A 1KDSA 3MGRD 4H8RA 3LZ0D 1YMSA 4S2IA 2RIQA 3NQUB 5CEBA 4CPKA 1Z6FA 1I2SA 5F99C 4N92A 3G4PA 4E6WA 3HSHA 5EPHA 4XZQA 5FATA 1M18D 2HDQA 3AYWB 2PYOB 1BTLA 4OLDA 5B31A 3UE0A 3SS4A 5L2FA 4ZBEA 2OSUA 2EX9A 2P74A 2XFTA 2Q9MA 2F8NA 5IHVA 1SKFA 4LG2A 1BH9A 3RELD 1ALQA 1J9MA 3A1IA 4IBFA 2PU2A 1KX5D 1LL5A 1TVFA 1YLPA 2HDRA 3G32A 4YM6D 4WEKA 1R4VA 4XXRA 4OQ0A 4GD8A 5G49A 3V9RA 3AZJA 3KUYC 1NXYA 5AV9C 4R4RA 3BLMA 1TEMA 3AV1D 4XUJA 3AZGB 4X68A 2HIOB 3KXBC 5EECA 3AN2C 2FJ7D 2Y55A 4WM9A 2HP6A 3AZFB 3AGEA 1BSGA 1L0FA 1TZYD 4X23A 4WELA 2EXBA 3IXHA 3NQUA 4Z2MH 5JYPA 2F8NH 4BL2A 3LY3A 5B2JA 4KZ8A 2WZZA 4ZDXA 3X1TC 4GKUA 4R8PB 3B3XA 2V2FF 3REHB 5B0ZB 4S2MA 1M1AA 3MVDA 5CHMA 3B6FB 1KX5B 4H9RA 3MXSA 1PZOA 2NQBC 3ZNTA 1ES2A 5B24C 2WGWB 2IO5C 4JF5A 1BH9B 3IWQA 3Q7VB 2Y2HA 3X1VD 5BNXA 1BLSA 4N9LA 3N4IA 3X1TA 1ID3A 3KXBD 4FH4A 3MVDD 2XGNA 5FQIA 3UE3A 1KE3A 4JJNB 2HIOC 3KXBB 4DKIA 1K55A 3VP2A 5CPKB 2NQBA 3X1SC 4S2OA 3AFAA 3Q1FA 5B24A 3ISGA 1CEGA 4GZBA 3AL0C 3E2LA 4KENB 4UA7A 2Y59A 5EOEA 2BYKB 4IBKA 5GT3B 3O62A 3Q7ZA 5DTTA 3RELC 3VMAA 1KGFA 5KZHA 5AV8B 3MNNB 4J8WD 1FSYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QY5 A;  5DVA A;  1DJC A;  1JWZ A;  1HZO A;  4OOM A;  2Y2P A;  1G68 A;  1GA9 A;  2WK0 A;  1DY6 A;  4R3J A;  3CMZ A;  1K55 C;  5TFQ A;  3WS1 A;  4KZB A;  5HAQ A;  3W4O A;  3V39 A;  3SS5 A;  5EVL A;  3UPP A;  4KZ5 A;  5A92 A;  5HX9 A;  4RX2 A;  3UE1 A;  3M2K A;  4X6T A;  3OZH A;  1GHM A;  1NYY A;  2H10 A;  4WZ4 A;  4GD6 A;  3IF6 B;  4PM8 A;  1ERQ A;  1ES3 A;  4MBF A;  5DF9 A;  3VP3 A;  4F94 A;  1ES5 A;  1W79 A;  4E3N A;  3IWI A;  3DTM A;  1JWV A;  2IWB A;  2HDS A;  3C5A A;  3GQZ A;  3WWX A;  1MXO A;  2Y2O A;  3HBR A;  1N9B A;  3HLW A;  1L2S A;  4DE1 A;  4D2O A;  5FQJ A;  3V5M A;  5CER A;  5HAI A;  1LI0 A;  3HLE A;  5DTK A;  3ZG8 B;  2J9P A;  1CI8 A;  2Y2G A;  1WYB A;  5A91 A;  5AQB A;  2Z2M B;  1DJB A;  3WRZ A;  5EUA A;  4E3O A;  5E2F A;  2V1Z A;  4X69 A;  1OME A;  5DF8 A;  1SDE A;  4LV1 A;  2H5S A;  3OCL A;  4R23 A;  5EVI A;  5GLB A;  1BT5 A;  4KQO A;  3LEZ A;  2E8I A;  3OPR A;  5EE8 A;  5KSC A;  5FAO A;  3NDE A;  4BJP A;  2IWD A;  3MZE A;  1KDW A;  3BFF A;  3M6H A;  1W7F A;  4NET A;  1NY0 A;  2G2W A;  2Y2N A;  3O86 A;  3DWZ A;  3DW0 A;  2ZQ8 A;  4EBL A;  1W5D A;  4XUZ A;  3SH8 A;  3PAE A;  1CEF A;  2H0T A;  1JWP A;  4BD1 A;  3MXR A;  3EQU A;  1O7E A;  3UN7 A;  1L0E A;  1NYM A;  1VQQ A;  1IEL A;  3E2K A;  3PBS A;  3HLC A;  3IHA A;  5I94 A;  1Y54 A;  5HFO A;  3SS3 A;  5KMW A;  3G2Y A;  2BLS A;  4EUZ A;  1XGI A;  1K38 A;  3BEB A;  4FCF A;  2WGW A;  3HVF A;  3UO9 A;  1YLW A;  1XGJ A;  5F1F A;  5FI6 A;  4IED A;  4UA9 A;  4ZAM A;  3BYD A;  4ZJ1 A;  4Q8I A;  4QB8 A;  4YIN A;  5F82 A;  1L0D A;  1MWR A;  3C4O A;  4P6B A;  3NDG A;  1DJA A;  1BUE A;  1Q2Q A;  3BFG A;  1SCW A;  2HDU A;  3NC8 A;  4IVI A;  1ES4 A;  5U47 A;  1K56 D;  3HRE A;  4OQI A;  3HLF A;  3IXB A;  5CRF A;  3C7U A;  3HL9 A;  2R9W A;  5M1A A;  1MBL A;  3BFD A;  1ZG4 A;  5FAQ A;  3ZG9 B;  4OPQ A;  3GRJ A;  3S1Y A;  3Q82 A;  4FH2 A;  4OON A;  3ZHH A;  4U3T A;  1PW1 A;  4S2J A;  2ZM8 A;  1NZU A;  4Y0O A;  2Q9N A;  2XDM A;  3IH9 A;  2WKI A;  2V20 A;  2I72 A;  2WUQ A;  3GTC A;  4GOG A;  3VP0 A;  4KZA A;  4X53 A;  1KE4 A;  2ZLY A;  3HUN A;  4K91 A;  1FR6 A;  4DXC A;  4YFM A;  4C75 A;  3IQA A;  1IKI A;  1PWG A;  1RCJ A;  2J7V A;  4QHC A;  3BM6 A;  4RX3 A;  2DNS A;  2EFX A;  3SH7 A;  1G6A A;  5EVI B;  3ZVW A;  5EVI C;  1SDN A;  2Y2J A;  1GA0 A;  2X02 A;  4P87 A;  4DRT A;  4QU3 A;  4LV0 A;  1PW8 A;  2ZC4 B;  3PBO A;  2UWX A;  1N4O A;  2C5W B;  4S2N A;  5CTN A;  3UDF A;  3OPH A;  1FSW A;  1YLJ A;  3IXG A;  4WZ5 C;  5A90 A;  4OQH A;  3PBT A;  4WMC A;  2J8Y A;  2XK1 A;  5HW3 A;  2ZJ9 A;  4QD4 A;  2WAF A;  4DE2 A;  4R0Q A;  3UPN A;  4B88 A;  1O07 A;  1QME A;  3QHY A;  3PAG A;  2IWC A;  3GR2 A;  1TDL A;  1LI9 A;  3LO7 A;  4QY6 A;  2XD1 A;  3UDX A;  4JXG A;  4N9K A;  1EWZ A;  5DF7 A;  1KVL A;  1GHI A;  5CHJ A;  2XLN A;  4FSF A;  1IYO A;  1IYS A;  5EOO A;  1W8Y A;  5GHX A;  3BLS A;  4OOL A;  2JCH A;  1CI9 A;  3BEC A;  3S4X A;  4RYE A;  3LY4 A;  5F1G A;  4OH0 A;  3V3R A;  3NI9 A;  4MLL A;  1CK3 A;  1XKZ A;  1LL9 A;  3RJU A;  4A5R A;  2JBF A;  4DDS A;  2EX6 A;  2OLU A;  2XEP A;  5FI7 A;  4JKT A;  4X56 A;  3ZFZ A;  2EX8 A;  4E3L A;  3HUM A;  4PM7 A;  4EBN A;  5GLA A;  1W8Q A;  1GCE A;  3Q7V A;  1MY8 A;  3M2J A;  4B4Z A;  4KG2 A;  4OPZ A;  3MFD A;  1XA7 A;  4RA7 A;  3W4Q A;  5CGX A;  3M6B A;  4KZ9 A;  3OCN A;  4C3Q A;  5G18 A;  2ZM2 A;  4PM5 A;  4HBT A;  1ESI A;  1E3U A;  1PZP A;  2XH9 A;  1VM1 A;  4JXV A;  3A3J A;  4ZJ2 A;  1MKI A;  2C6W B;  3AGF A;  5GHY A;  2A3U A;  3FZC A;  4RVA A;  3RXX A;  4KZ3 A;  4JXW A;  1E3U D;  3ZG5 A;  4OP5 A;  5GHZ A;  2ZQ7 A;  2JE5 A;  4ZJ3 A;  3SOI A;  3HLB A;  3NIA A;  4KQR A;  1I2W A;  4MEZ A;  1HD8 A;  4E3J A;  4KG6 A;  4DF6 A;  1M6K A;  2ZD8 A;  4PM6 A;  3UY6 A;  4GN2 A;  2EX2 A;  3VP4 A;  4K0W A;  3TG9 A;  4OLG A;  1IYQ A;  3ZG0 A;  3IH8 A;  3O3V A;  4ZTK A;  5CXW A;  1ZG6 A;  5J8X A;  4K0X A;  1JTD A;  2HPB A;  5E2G A;  4OVD A;  5HL1 A;  3IF6 A;  1XXM A;  5HAP A;  5TR7 A;  4Y7P A;  1XPB A;  4U0X A;  4E6X A;  1U60 A;  1YT4 A;  3GSG A;  4B4X A;  2EXA A;  3HUO A;  3N6I A;  4R1G A;  4Z9Q A;  4LEN A;  4Y0U A;  1K54 C;  1PWC A;  1YLZ A;  4OKP A;  2ZM0 A;  4IVK A;  4DE0 A;  1H5X A;  1BZA A;  1HTZ A;  5GLD A;  1ERM A;  3JYI A;  3MZD A;  5GL9 A;  3PBQ A;  2Y91 A;  4MBK A;  4WYY A;  3UPO A;  3ZNY A;  1KGG A;  3W4P A;  4IBR A;  1RP5 A;  1I5Q A;  4OP8 A;  1AXB A;  2Z2L B;  4PMA A;  3C4P A;  4N1H A;  2P9V A;  5FQM A;  4GB7 A;  3MKE A;  5FA7 A;  1JTG A;  2X71 A;  5GLC A;  5HAR A;  4S2K A;  1PYY A;  2ZQA A;  3A3D A;  1L0G A;  2WAE A;  3MKF A;  2ZMA A;  2ZQ9 A;  3CJM A;  3WRT A;  4KZ4 A;  2Y2L A;  4KZ7 A;  1ESU A;  3WS4 A;  1IYP A;  1YQS A;  4MBH A;  1FOF A;  3GMW A;  3WS5 A;  1H8Y A;  2PU4 A;  3I7J A;  4PM9 A;  1PI5 A;  2G2U A;  3O88 A;  5F83 A;  2WGV A;  5BOH A;  2XF3 A;  3QNC A;  3Q81 A;  3C7V A;  1K54 A;  3OPL A;  5EVI D;  1SHV A;  1IEM A;  3FWL A;  2Y2Q A;  5CGS A;  5AQ9 A;  3VP1 A;  4LV2 A;  3VSK A;  5CGW A;  1K4F A;  2DRW A;  1S0W A;  3ZCZ A;  1XX2 A;  1NJ4 A;  3TOI A;  5FQK A;  1K56 A;  4OPY A;  1BLH A;  2P9V B;  4N1X A;  2VGK A;  3V50 A;  5CED A;  4X55 A;  2A49 A;  1KDS A;  2ZQD A;  3VFH A;  3CG5 A;  3EQV A;  4JPM A;  4H8R A;  3BRM A;  4S2N C;  1YMS A;  1K6R A;  3AGD A;  1S6R A;  4O7D A;  4S2I A;  5DTS A;  3VSL A;  5CEB A;  3MBZ A;  2OLV A;  4GDB A;  2Y2K A;  1YLT A;  2WKH A;  3VOY A;  4CPK A;  1Z6F A;  1I2S A;  4FD8 A;  3Q07 A;  4KG5 A;  1XP4 A;  2BG1 A;  3QNB A;  3G35 A;  3O87 A;  4N92 A;  3G4P A;  3N8L A;  4LV3 A;  5FI2 A;  4E6W A;  3BFE A;  5TGF A;  2FFF B;  2XR0 A;  3A3I A;  5EPH A;  3ZDJ A;  3IT9 A;  5FAT A;  2HDQ A;  1FCM A;  2ZC6 B;  1BTL A;  4OLD A;  2GDN A;  4BD0 A;  1FR1 A;  3IHB A;  3UE0 A;  4R3B A;  3S22 A;  3V3S A;  3G31 A;  3G30 A;  1LHY A;  3SS4 A;  5L2F A;  4ZBE A;  3N7W A;  4DDY A;  1BUL A;  1EI5 A;  3PBR A;  3FV7 A;  4GDN A;  2OSU A;  2EX9 A;  2P74 A;  2XFT A;  2FFY A;  2QZ6 A;  2Q9M A;  1MWU A;  1ZC2 A;  1KVM A;  3NCK A;  2WYX A;  5AQA A;  5IHV A;  1SKF A;  4GNU A;  4BQM A;  3IF5 A;  1ALQ A;  4PPR A;  1LLB A;  3VFF A;  1J9M A;  2XQZ A;  1PIO A;  4WZ5 A;  4EV4 A;  1GHP A;  2PU2 A;  4JXS A;  1K4E A;  3D4F A;  4LCL A;  4S2L A;  1TVF A;  1LL5 A;  1YLP A;  2HDR A;  3G32 A;  3NY4 A;  4WMC D;  2QMI A;  4WEK A;  3G34 A;  2OV5 A;  2RCX A;  4XUX A;  4E3I A;  2DCF A;  1M40 A;  4NK3 A;  2ZC7 A;  4XXR A;  3IXD A;  4GD8 A;  4KZ6 A;  4OQ0 A;  5FAP A;  3SH9 A;  2Y2M A;  4C6Y A;  1ONG A;  1IKG A;  1NXY A;  4R4R A;  3ZVT A;  2WZX A;  3BLM A;  1C3B A;  1TEM A;  1K57 C;  3WS2 A;  1YLY A;  4UA6 A;  3ITA A;  2X01 A;  3FKW A;  4X68 A;  1BLC A;  1H8Z A;  5FSR A;  2RL3 A;  1QMF A;  3TSG A;  4JF4 A;  5EEC A;  2JC7 A;  4S2P A;  3HLD A;  4JLF A;  1RGY A;  2R9X A;  2Y55 A;  4WM9 A;  4DE3 A;  2HP6 A;  4UHU A;  4U0T A;  3AGE A;  1BSG A;  5D3O A;  2XFS A;  2Y4A A;  3MZF A;  1L0F A;  3IF6 C;  1TDG A;  3OC2 A;  4WEJ A;  3N8S A;  4WEL A;  2EXB A;  4BEN A;  3IXH A;  2VGJ A;  4M3K A;  4UAA A;  3ZG7 B;  1PWD A;  1ERO A;  3G2Z A;  4OOY A;  4DXB A;  5JYP A;  2WGI A;  3A3E A;  1K57 A;  4BL2 A;  4P85 A;  4E3K A;  4ID4 A;  3LY3 A;  4OPR A;  4KZ8 A;  2J9O A;  2WZZ A;  4ZDX A;  4GKU A;  4JBF A;  1MWT A;  4EQI A;  3P09 A;  5CTM A;  4MNR A;  3B3X A;  3PBN A;  2V2F F;  3W8K A;  4BLM A;  5KSH A;  4S2M A;  2EFU A;  2XD5 A;  4IBX A;  1ZKJ A;  5CHM A;  2QPN A;  4KQQ A;  4QJG A;  5E43 A;  1E4D A;  4WBG A;  1MPL A;  1JVJ A;  4HEF A;  1XA1 A;  1FCO A;  1YM1 A;  3MXS A;  4HES A;  4EWF A;  5M19 A;  3N8R A;  1PZO A;  2ZQC A;  5A93 A;  1KE0 A;  3ZNT A;  1ES2 A;  1K6S A;  1Q2P A;  2ZC5 B;  1YMX A;  3GVB A;  3PTE A;  2HP5 A;  2WGW B;  2WKE A;  4JF5 A;  5E2H A;  1WE4 A;  3FKV A;  4LCM A;  4Y0T A;  2H0Y A;  3LCE A;  3A3F A;  4BL3 A;  3IWQ A;  3Q7V B;  5FQQ A;  2Y2H A;  1ONH A;  1BLS A;  3N4I A;  4N9L A;  4P0M A;  4CJN A;  1RGZ A;  3P98 A;  5CEC A;  3ZGA B;  3DWK A;  4HBU A;  4FH4 A;  3WS0 A;  4JF6 A;  5AQ7 A;  2XGN A;  4EBP A;  1WYC A;  5FQI A;  3UE3 A;  1KE3 A;  2ZC3 B;  1MWS A;  3UNW A;  4DKI A;  5M18 A;  3IWO A;  4R4S A;  5JYO A;  1K55 A;  1BLP A;  3CZD A;  2WAD A;  3VP2 A;  3GV9 A;  4S2O A;  3Q1F A;  2Y2I A;  3ISG A;  1CEG A;  1NRF A;  3E2L A;  1E25 A;  4GZB A;  4KEN B;  1PI4 A;  4E3M A;  1K25 A;  3BFC A;  3HLG A;  3NBL A;  3OPP A;  2Y59 A;  4UA7 A;  5FQ9 A;  1NZO A;  3UDI A;  5EOE A;  1FCN A;  5E2E A;  1FQG A;  3Q7Z A;  4L0L A;  2B5R A;  4OQG A;  5DTT A;  5CHU A;  3VMA A;  1KGF A;  5KZH A;  2PBY A;  3VOZ A;  3ITB A;  1HVB A;  1KGE A;  3FYZ A;  1FSY A;  5FAS A;  3RXW A;  5FDH A;  2CC1 A;  2HP9 A; 
#chains in the Genus database with same CATH topology
 1JWZ A;  4XZQ C;  3WTP E;  1J7M A;  1G68 A;  1SKO B;  4R3J A;  2V8F A;  3KS4 A;  1K55 C;  3WS1 A;  1E6N A;  3W4O A;  4IJE A;  4HH3 A;  5AV6 D;  1GHM A;  1S66 L;  4WZ4 A;  1LSV A;  4NE6 A;  2O9C A;  4MBF A;  3REI C;  1ES5 A;  3OOV A;  3W96 A;  3IWI A;  5HPI A;  2IO5 B;  3WWX A;  1S67 L;  1P34 B;  3UB6 A;  3QP2 A;  4TX8 A;  2Y2O A;  3WKJ B;  3E98 A;  5IS1 A;  3CUE C;  1L2S A;  4ETX A;  1ZTU A;  5F99 A;  5CER A;  5HAI A;  1LI0 A;  3HLE A;  3ZG8 B;  1WYB A;  3EPK A;  1DJB A;  2CV5 B;  5E2F A;  2W0N A;  1SDE A;  5IT5 A;  3WTP B;  4OJ6 A;  4KQO A;  2E8I A;  3OPR A;  3NDE A;  2GZA A;  5B31 D;  2IWD A;  1H3O A;  3MZE A;  3M6H A;  1NY0 A;  2QJ7 A;  4DMZ A;  3LEL D;  3AN2 A;  1CF0 A;  2ZQ8 A;  1W5D A;  4EBL A;  2J3W A;  3SH8 A;  1CEF A;  1YUE A;  1JWP A;  5BT1 C;  4BD1 A;  1S32 D;  1P3L A;  3EQU A;  1E6R A;  1VQQ A;  5I94 A;  1IEL A;  3HLC A;  2O99 A;  4BWI A;  4Z5T B;  1XGI A;  5AV5 A;  4ZUX D;  4HH2 A;  5F1F A;  5AVB D;  4NZ1 A;  2DF4 C;  4LRZ E;  4QB8 A;  5F82 A;  1L0D A;  3MGS B;  5B1L B;  1SCW A;  1K56 D;  3HRE A;  3NUL A;  3IXB A;  3C7U A;  3HL9 A;  2R9W A;  4PHT A;  1M1A B;  5M1A A;  5L09 A;  3BFD A;  1N9O A;  2JHE A;  4OPQ A;  3S1Y A;  4WNN B;  4S2J A;  3JVU A;  1AOI D;  3T1X A;  3AZL B;  3IH9 A;  3AZH A;  3AV1 B;  2V20 A;  4GOG A;  3GDI A;  1P3O C;  3VP0 A;  3WA9 B;  3LI9 A;  4X53 A;  1KE4 A;  2ZLY A;  1T3U A;  3LEL B;  4C75 A;  4L9G A;  5J7E A;  1RCJ A;  1HLU P;  2JSS A;  2DNS A;  2EFX A;  3MGP B;  1G6A A;  3WTP A;  5EVI C;  4KGC B;  1P9W A;  4NXG A;  1QO6 A;  3JVV A;  4DRT A;  4LV0 A;  3C1B C;  2UWX A;  3OPH A;  2HV1 A;  3B47 A;  2VGL M;  3AZH C;  3AYW D;  2PYO D;  4WZ5 C;  5KDM A;  3X1T B;  5HW3 A;  5CPJ D;  5CHL B;  3UPN A;  4J8U B;  4B88 A;  1QME A;  3B6G A;  4NFT A;  4E45 A;  1TDL A;  2W3D A;  5KDM B;  1GHI A;  1GSX A;  1HTA A;  5EOO A;  1MZU A;  3P7N A;  2NQB B;  1YAX A;  4EUV A;  5EFW A;  3BEC A;  5LBR A;  5F1G A;  4M6B A;  4L9E A;  2V9A A;  1CK3 A;  1LL9 A;  3W96 C;  1OTA A;  5E5A D;  3HJK A;  3H0M C;  2XEP A;  3AZK C;  5FI7 A;  3T4K A;  3ZFZ A;  2EX8 A;  5AJG A;  3AZF D;  1P3L D;  4EEU A;  4E44 A;  1GCE A;  3LJA D;  1P3K C;  1P3P C;  4KG2 A;  3W4Q A;  1XA7 A;  2P04 A;  3D9Y A;  4KZ9 A;  5JRG A;  5G18 A;  2ZM2 A;  1PZP A;  1E3U A;  5AV6 C;  1P3G B;  1MKI A;  2C6W B;  2FJ7 B;  3RXX A;  2ZBB A;  1E3U D;  3KSF A;  1ODV A;  1P3G A;  4IBC A;  2JE5 A;  3UTB B;  3SOI A;  2GNX A;  3P01 A;  4AFI A;  2V8C A;  1P3B D;  1K0K A;  3NOU C;  1KX3 B;  3AZE A;  2IOU A;  4PM6 A;  2H28 A;  2VKS A;  4GS9 B;  4CAY A;  3QP1 A;  1P34 C;  5B0Y B;  1KX3 A;  5E2G A;  5E5A C;  5TR7 A;  2OWJ A;  1XPB A;  4Y7P A;  3KS8 A;  1U60 A;  3QP4 A;  4B4X A;  2EXA A;  4H6J B;  4R1G A;  3D3O A;  5AVC D;  1W63 Q;  1Z2C B;  3QP6 A;  1H5X A;  1BZA A;  1N1J B;  2Y79 A;  4LLO B;  3AZE C;  4WJ3 C;  2ZY3 A;  1P3A C;  4EEP A;  4J8V A;  3MZD A;  5B32 G;  4KUD A;  4WYY A;  3W97 A;  4PKY A;  5CPK D;  1P34 A;  1KX3 C;  3MKE A;  5FA7 A;  4EU0 A;  4I38 A;  3X1V A;  3A3D A;  2QWS A;  1P3M A;  5AV9 A;  2M7U A;  4Z2G A;  3UE6 A;  1F66 D;  4Y3I A;  3WS4 A;  4YS3 C;  4HI4 A;  3GMW A;  4J8V D;  2PU4 A;  3EGX C;  1PI5 A;  5F83 A;  1P3A A;  3QNC A;  3Q81 A;  1Y28 A;  5DKL A;  4KUD C;  1F5M A;  1SHV A;  3BY9 A;  3VSK A;  1OTB A;  3AZK B;  2G5H C;  4LV2 A;  1P3I C;  3VP1 A;  1OGB A;  3LR3 A;  5HD5 A;  2A2L A;  1XX2 A;  3AZM C;  1K56 A;  1BLH A;  2P9V B;  4OPY A;  3DTK A;  5CED A;  1P3A B;  2ZQD A;  3VFH A;  3CG5 A;  4JPM A;  1P3O D;  3AGD A;  1S6R A;  5FUG A;  3B0D C;  1YLT A;  3VOY A;  2FJ7 C;  3REH D;  2BG1 A;  3G35 A;  5FI2 A;  3N8L A;  3BFE A;  5GT3 C;  1N9N A;  3A3I A;  3IT9 A;  5FUG B;  3HJI A;  3TE8 A;  3W98 C;  5DNM B;  5FL3 A;  2ZC6 B;  3MGQ A;  4JGQ A;  3AV1 C;  3WAA D;  4OJP A;  3AZM A;  3LZ1 A;  3PHY A;  3S7P A;  4CSR A;  4UEY A;  2Z6D A;  1P97 A;  1BUL A;  4X23 D;  3FV7 A;  2JKR I;  3T4O A;  3MQQ A;  2ARO B;  2PDR A;  1ZLA D;  4XT2 B;  4Y2F A;  4Q0H A;  4I5S A;  4BBV A;  4ZUX C;  1ZC2 A;  4YM6 C;  4IBE A;  1TAF A;  3A1K A;  1KVM A;  2WYX A;  4GNU A;  5AQA A;  4BQM A;  4J8X D;  3VFF A;  5BO0 B;  3FPW A;  4WZ5 A;  4CSR B;  3AZJ D;  4EV4 A;  3TW8 A;  1K4E A;  3NY4 A;  4WMC D;  3G34 A;  3B6G C;  2RCX A;  5HWT A;  5BT1 D;  2QYB A;  1BH8 A;  2W1R A;  1M40 A;  4NK3 A;  2ZC7 A;  4FOF A;  3IXD A;  3IS2 B;  2QJ5 A;  2Y2M A;  1IKG A;  1CQA A;  2VEA A;  2ZY5 A;  4Z2M G;  3IBR A;  2WZX A;  4ZBJ B;  5AVB B;  1YLY A;  4UA6 A;  3P5J B;  2X01 A;  1H8Z A;  4HMC A;  1M18 C;  5EM1 A;  5B1L D;  4GH9 A;  4JF4 A;  2JC7 A;  5F99 D;  4JLF A;  1RGY A;  2R9X A;  3UT9 D;  4DE3 A;  3WD0 A;  4UHU A;  3L28 A;  2XFS A;  2Y4A A;  1WWS A;  3OC2 A;  4BEN A;  1YU4 A;  3B0C W;  1PWD A;  4OOY A;  1H8P A;  1A7W A;  3A3E A;  3EPH A;  4MB3 A;  4OPR A;  1P3K B;  1P3P B;  1PRQ A;  4GLQ A;  4EQI A;  3P09 A;  2XSS A;  5DNM A;  3PBN A;  4WU9 C;  4BLM A;  4P6Z M;  2EFU A;  2XD5 A;  1ZKJ A;  3W99 B;  4MN7 A;  4IBG A;  1AOI B;  3KXB A;  2ARO D;  4WBG A;  1JVJ A;  4HES A;  5M19 A;  3A0V A;  5GSU D;  2ZC5 B;  3KWQ B;  3W99 A;  4Z2I A;  2WKE A;  1AOI A;  3UTB D;  3EEH A;  4LCM A;  1D06 A;  3L25 A;  3A3F A;  5F5Y A;  2EWV A;  5B2I B;  1P3M C;  2EA9 A;  1JNU A;  2VQR A;  3AZJ C;  3ZGA B;  4YWZ A;  3NHQ A;  3W97 D;  1OJ5 A;  5F68 A;  5AQ7 A;  4EBP A;  1WYC A;  4ZUX B;  1ZLA C;  3REJ B;  3UTA C;  3MGS D;  3E4Q A;  4R4S A;  5JYO A;  3CZD A;  3G6O A;  3GV9 A;  1E25 A;  3CHW P;  1PI4 A;  3W97 C;  5FQ9 A;  4MB5 A;  4HMD A;  4L0L A;  4OQG A;  2B5R A;  1OGG A;  5CHU A;  3REH C;  2FJ7 A;  3FYZ A;  4HJ4 A;  3RXW A;  3PXP A;  3AZN C;  2CC1 A;  3LCE A;  1D1J A;  4QY5 A;  5B32 B;  2PD7 A;  3AZJ B;  3CMZ A;  5TFQ A;  3AZM D;  3L26 A;  2F8N B;  2EWW A;  3V39 A;  5EVL A;  4RX2 A;  3UE1 A;  4X6T A;  1EAK A;  2H10 A;  4PM8 A;  3IX8 A;  2YFV A;  4IJG A;  3WD2 A;  2E8J A;  4G92 C;  1L6J A;  1JWV A;  3WD3 A;  4L9F A;  2IWB A;  3C5A A;  2ZL1 B;  3ZQ5 A;  3HBR A;  3W97 B;  3WD4 A;  3F1O A;  3LR5 A;  2YKH A;  3MGS A;  2J9P A;  2Y2G A;  5A91 A;  4HME A;  5DF8 A;  4LV1 A;  1P0Z A;  5EVI A;  1ID3 D;  1BT5 A;  1P3A D;  3H82 B;  3LEZ A;  1XJ4 A;  5KSC A;  5FAO A;  3REL B;  5JA4 B;  1AWI A;  3BFF A;  4R6L A;  4NET A;  5DJU A;  4OUI A;  1DP8 A;  3DWZ A;  3MF0 A;  4LRY C;  3DW0 A;  4Y13 A;  3R7W A;  3S7Q A;  3C1C B;  3LJA A;  3B6G D;  2W1T A;  1ZLA B;  1O7E A;  5CPI A;  3UN7 A;  3T4S A;  1Y54 A;  5HFO A;  3SS3 A;  5BNX B;  5KMW A;  2BLS A;  4EUZ A;  3HVF A;  2OWH A;  3AZL A;  2L4R A;  1YLW A;  3L2A A;  3E4P A;  3TU4 C;  3BYD A;  3OLO A;  1G28 A;  2I9V A;  4I3J A;  4YIN A;  3C4O A;  1DJA A;  2A24 A;  4WU9 A;  4IVI A;  4BMW A;  4J8U A;  4IBD A;  4I39 A;  1OTI A;  4XT2 A;  4J8W B;  5DKK A;  1MBL A;  4NZ5 A;  1HQ3 D;  5GSU B;  1UR9 A;  1ZG4 A;  5DNN C;  5CP6 D;  5GT3 D;  2ZM8 A;  5HL6 A;  2W3G A;  5AVE A;  1HQ3 B;  1VB6 A;  1P3L C;  2LB9 A;  3AZL C;  2JKF A;  1N1J A;  3AZK D;  2WKI A;  2I72 A;  3GTC A;  3E0Y A;  3LZ0 C;  1A0K A;  4X25 A;  3HUN A;  4K91 A;  4KUK A;  4ETZ A;  5B24 B;  2J3T D;  1M1A D;  1PWG A;  4H9Q B;  3BM6 A;  1P3I D;  3LFV A;  3UT9 B;  4YS3 B;  3SH7 A;  5DNM D;  5EVI B;  3ZVW A;  4KUD D;  1SDN A;  4X1M A;  3KFU G;  2VV6 A;  4P87 A;  3FC7 A;  4QU3 A;  5I5L A;  2ZC4 B;  2HGV A;  2C5W B;  4S2N A;  3UDF A;  2ACG A;  3IXG A;  3W99 C;  4OQH A;  4DQY B;  4MMN A;  1Z09 A;  3REH A;  3AV2 B;  3QHY A;  1S32 A;  3PAG A;  3GR2 A;  1LI9 A;  3REJ A;  4XUJ C;  3LO7 A;  4QY6 A;  2XD1 A;  1P3O A;  3KWQ D;  5DF7 A;  4IHQ A;  2FN2 A;  1KVL A;  4H9O B;  3KUY B;  1IYS A;  4MDZ A;  3AZE D;  3AV2 A;  3BLS A;  1VEU B;  3KWQ C;  3BW6 A;  3UB9 A;  2J3T C;  2A24 B;  2YFV B;  1MKM A;  2JBF A;  4A5R A;  5CP6 B;  2OLU A;  2JKT M;  3HUM A;  4PM7 A;  3LIA A;  5GSU A;  3REJ C;  4EBN A;  2JKT I;  5GLA A;  4CLC B;  4B4Z A;  1EW0 A;  4OPZ A;  4RA7 A;  3OCN A;  4C3Q A;  1E8B A;  1HQ3 A;  3ICY A;  4KUD B;  3C1B B;  2V5O A;  3A3J A;  4ZJ2 A;  3AGF A;  2KOI A;  5AV5 B;  4RVA A;  2BYK A;  3WTP C;  3KYQ A;  3O62 B;  3L27 A;  4EER A;  2AVX A;  5GXQ A;  4H9Q A;  5AVB C;  1P3L B;  4YNR A;  4KQR A;  3AZL D;  1D7E A;  4DF6 A;  4QLC C;  3WKJ A;  3UY6 A;  4NY2 A;  2EX2 A;  3IS2 A;  4DRB A;  5B32 D;  3VP4 A;  5CP6 C;  1P3K D;  1P3P D;  1U35 B;  3ZG0 A;  3IH8 A;  5CXW A;  5J4E A;  3MNN C;  1JTD A;  1B67 A;  1XXM A;  2VGL S;  1OT9 A;  5CPJ A;  4HGA B;  4EXO A;  3N6I A;  1YU1 A;  4NYY A;  1PWC A;  4OKP A;  3VOL A;  1F66 B;  2W3E A;  5BS7 A;  5GLD A;  3T1S A;  3MGP A;  2O9A A;  2V0W A;  3X1U C;  5GL9 A;  3W4P A;  3OBF A;  1LL8 A;  2Z2L B;  4N1H A;  3B33 A;  2P9V A;  4J8W A;  3MQL A;  5FQM A;  2ZL1 A;  4GB7 A;  5GLC A;  1PYY A;  5CPJ C;  1P3K A;  1P3P A;  1L0G A;  2WAE A;  2V1A A;  3DTE A;  3WRT A;  3AZH D;  4QNL A;  1ESU A;  4RQ9 A;  3C1C D;  3WS5 A;  1TS8 A;  4HIA A;  4PM9 A;  2G2U A;  1XJ6 A;  5B33 C;  5EVI D;  1IEM A;  2DRW A;  1S0W A;  4HHD A;  3ZCZ A;  3TOI A;  3AZM B;  1U35 D;  3IX3 A;  4QLC B;  4N1X A;  4X55 A;  1KX4 D;  3BRM A;  4S2N C;  4HNB A;  4O7D A;  3ULF A;  1NRJ A;  1P3F A;  2Y2K A;  2WKH A;  4FD8 A;  4H9N A;  4KG5 A;  1XP4 A;  4H9S C;  2ZY4 A;  3O87 A;  4LV3 A;  3H82 A;  3RTY A;  1XJ2 A;  3O62 C;  3ZDJ A;  3VH6 W;  2V0U A;  2GDN A;  1FR1 A;  2J80 A;  1EQZ A;  4R3B A;  4OJO A;  3S22 A;  3V3S A;  2M7V A;  3VV4 A;  3G30 A;  1LHY A;  4Z5T D;  1GSW A;  3N7W A;  5G4Y A;  3SW1 A;  2FFY A;  1F66 A;  3B6F A;  3NCK A;  3IF5 A;  3PR6 A;  3WD1 A;  2XQZ A;  3REI A;  2O0Y A;  4BBT A;  5B32 A;  5C5K A;  3X1V C;  2L1M A;  3BY8 A;  4S2L A;  2DMW A;  3B6G B;  4Q0I A;  1S32 C;  5B24 D;  4G3K A;  4E3I A;  4KGC A;  2NQB D;  5FAP A;  3NEC A;  4HQA A;  1FIK A;  4KZ6 A;  3SH9 A;  3T50 A;  4C6Y A;  4Z5T C;  2YFW A;  3ZVT A;  3LEL C;  2VLG A;  2ARO C;  1C3B A;  4WV4 B;  3AV2 C;  4ZBJ C;  4K08 A;  4ME4 A;  4H9P A;  3WAA B;  3B0D B;  3WS2 A;  1DP6 A;  4NYU A;  1P3I A;  1BLC A;  3MSH A;  3L29 A;  2RL3 A;  3TSG A;  2RTS A;  4NKP A;  4P6Z S;  4S2P A;  3HLD A;  3UTB C;  1XFN A;  2UV0 E;  4U0T A;  3MS6 A;  3IF6 C;  1TDG A;  1KX4 C;  3H0L C;  2VV7 A;  2G5I C;  3LYX A;  4UAA A;  4ARZ B;  3C38 A;  1ERO A;  3B0C T;  4G91 C;  3T4Q A;  3UT9 A;  4P85 A;  1F98 A;  4E3K A;  1T1B A;  1P3O B;  4WLA A;  3AN2 D;  2P7J A;  1M19 B;  3TJZ C;  1MWT A;  1ED7 A;  5CTM A;  3GEC A;  5GT0 C;  4KQD A;  5KSH A;  1F1E A;  4IBX A;  4JGP A;  1CK7 A;  2QPN A;  4KQQ A;  5AY8 D;  4FTX A;  5E43 A;  1E4D A;  2PR5 A;  5CPI B;  1MPL A;  1XA1 A;  1FCO A;  4EWF A;  1B6W A;  4XZQ D;  4GHI B;  2ZQC A;  5A93 A;  1KE0 A;  1Q2P A;  3WKJ D;  4CAY B;  1YMX A;  2HP5 A;  4J8W C;  5E2H A;  1WE4 A;  3FKV A;  2H0Y A;  4BL3 A;  1KX5 C;  3AZI C;  1ONH A;  4WF0 A;  4CJN A;  5B1L C;  3MXQ A;  3P98 A;  4EQ1 A;  3BQ8 A;  5CEC A;  3DWK A;  3MQ0 A;  4HBU A;  4WU9 B;  3WS0 A;  4JF6 A;  4J8X C;  4Z66 A;  3AV2 D;  2NUP C;  1H0I A;  3UNW A;  4WU8 A;  3V67 A;  3IWO A;  3VH5 A;  5AVF A;  5GT0 B;  2HIO D;  1BLP A;  3FDD A;  4H9P B;  3WAA A;  3KSG A;  2K31 A;  3MJQ A;  5EVE A;  1NRF A;  3AZF A;  2CMN A;  4E3M A;  5CPI C;  5G49 B;  3V9R B;  3HLG A;  3OPP A;  3LR4 A;  1OPX A;  4HGA C;  4Z2K A;  1FCN A;  2W3H A;  1OTE A;  4J8X A;  4HP9 A;  4OJ5 A;  3ITB A;  1KGE A;  5FAS A;  4MN5 A;  5FDH A;  1MXO A;  2HP9 A;  5DVA A;  1DJC A;  4WNN A;  5EV0 A;  1UGU A;  1DY6 A;  5F69 A;  1WWI A;  4Y15 A;  4F3L A;  3SS5 A;  3UPP A;  4KZ5 A;  5HX9 A;  5B0Z D;  3AZH B;  3M2K A;  3OZH A;  1NYY A;  4GD6 A;  3IF6 B;  1KU5 A;  1ERQ A;  1ES3 A;  3D72 A;  5DF9 A;  3T4T A;  3O62 D;  1P3M B;  3VP3 A;  4H9R B;  5AV9 B;  4G92 B;  5JA4 A;  3CAX A;  2XRN A;  4JGO A;  2WKR A;  5B40 A;  3GQZ A;  4PKY G;  4R38 A;  3R45 B;  1W1Y A;  4D2O A;  5FQJ A;  4WUJ A;  4R8P A;  5DTK A;  5HDC A;  3KUY A;  3LJA B;  5AQB A;  5EUA A;  4MN6 A;  1ZHH B;  4X69 A;  1OME A;  4MB4 A;  2F2A C;  2H5S A;  4NXB A;  3UTA A;  3A6N B;  4IUH A;  5BPV A;  4J8V C;  5EM0 A;  3AFA B;  2G2W A;  3H7W B;  2Y2N A;  5AVC C;  4EW7 A;  5C3I B;  3KUY D;  1S4R A;  4XUZ A;  1M19 D;  4O8G A;  3PAE A;  2H0T A;  1KX3 D;  4DJ2 A;  3A0R A;  3B42 A;  3CI6 A;  3H7W A;  1STZ A;  3MXR A;  1CXW A;  4I3A A;  3EGD C;  3KSY A;  4J8U D;  3E2K A;  3UME A;  4AWL B;  4CQH A;  4NE3 A;  4HJ6 A;  1K38 A;  4FCF A;  3W98 B;  4EES A;  1P3B C;  1N9L A;  1M1A C;  2ZM5 A;  5FI6 A;  4IED A;  4ZAM A;  4R70 A;  5AVC A;  1MC0 A;  2Q0O A;  3C8C A;  3VE3 A;  1OTD A;  1MWR A;  1Q2Q A;  3BFG A;  4X1L A;  3X1V B;  2HDU A;  3NC8 A;  5U47 A;  4CLC D;  3HLF A;  5B2J D;  1UR8 A;  4YM6 B;  3ZG9 B;  4QPR A;  3GRJ A;  3Q82 A;  3ZHH A;  4U3T A;  3QP8 A;  4LD9 A;  4QLC D;  3SZT A;  1LSW A;  3LJA C;  1HQ3 C;  3VE4 A;  5HWV A;  2XDM A;  1KX5 A;  2B02 A;  2WUQ A;  3AZE B;  3MGR C;  1XFQ A;  5F6A A;  3IBJ A;  2INW A;  1FR6 A;  4DXC A;  4YFM A;  2W8S A;  2NZD A;  5B40 D;  1IKI A;  2J7V A;  2YKF A;  3AFA C;  4QHC A;  2RVQ C;  1IFQ A;  3F6T A;  3HON A;  2X02 A;  3AN2 B;  4J8U C;  3PBO A;  4H6J A;  3REJ D;  2HUE B;  5CTN A;  3AZF C;  4GW9 A;  5A90 A;  3CWF A;  3PBT A;  2BYM B;  4WMC A;  1M19 C;  2YFW B;  2ZJ9 A;  4LD9 D;  4QD4 A;  2WAF A;  4R0Q A;  3RH8 B;  3AYW C;  2PYO C;  2IWC A;  2NZD C;  1P3I B;  2K2N A;  2P08 A;  1Q9C A;  2PAV P;  2WKP A;  3LZ0 A;  4JXG A;  1EWZ A;  4NXE A;  5C3I C;  3AZI B;  5CHJ A;  2XLN A;  4FSF A;  5BO0 A;  1ID3 C;  4WU8 C;  5GHX A;  3W98 A;  1YU0 A;  5A8B A;  4XUJ D;  3S4X A;  4EO5 B;  2Y8H A;  3LY4 A;  4OH0 A;  2HIO A;  5FEG A;  4O01 A;  1XKZ A;  2EX6 A;  4J8X B;  4JKT A;  4X56 A;  3W99 D;  4E3L A;  4YM6 A;  3K3C A;  1W8Q A;  4GHL A;  4FUW A;  3LID A;  2BAS A;  5CGX A;  3M6B A;  1E88 A;  3W96 B;  4PM5 A;  4HBT A;  3REL A;  2XH9 A;  5DFX A;  4JXV A;  2A3U A;  3DAV A;  4KZ3 A;  3ZG5 A;  4KHA A;  3NJA A;  1TZY B;  4OP5 A;  5B0Z A;  4ZJ3 A;  3NIA A;  1V9Y A;  2DQN C;  1I2W A;  4MEZ A;  1AOI C;  1HD8 A;  4E3J A;  4H9S A;  2ZD8 A;  1TZY A;  4K0W A;  4R8P C;  3TG9 A;  4OLG A;  5CPI D;  1IYQ A;  3M7P A;  1PDC A;  3LIF A;  3VH6 T;  3O3V A;  2PHY A;  5HPF A;  4ZTK A;  5AV5 C;  2HPB A;  4OVD A;  2BYM A;  3KYE A;  2QKP A;  3JPU A;  4NEE D;  5HAP A;  4E6X A;  4U0X A;  3CPT A;  3GSG A;  1ID3 B;  1S4S A;  2Z6C A;  2JN7 A;  4LEN A;  4ESP A;  5B0Y D;  1K54 C;  1YLZ A;  2ZM0 A;  4IVK A;  4DE0 A;  3NOT C;  3KWQ A;  3B6F C;  4H9N B;  2KDK A;  4WU8 D;  1ACF A;  3VH6 A;  2ZOH A;  4MBK A;  5B1M A;  3F1P A;  3ZNY A;  4IBR A;  1I5Q A;  4OJL A;  1O6I A;  1S1Y A;  2NZD D;  2CV5 D;  4G3V A;  5B40 B;  3MVD B;  1YU2 A;  4QLC A;  3WKJ C;  1H8M A;  4JJN C;  4X23 B;  5GSU C;  4KGC C;  1JTG A;  2X71 A;  2WKQ A;  3T1R A;  3MFX A;  3B0B A;  3MKF A;  1FIL A;  2ZMA A;  3MNN A;  3X1S B;  1GSV A;  4KZ4 A;  4KZ7 A;  1P3B A;  3DBA A;  5B31 C;  1YQS A;  4MBH A;  1FOF A;  5HDS A;  3REI D;  2OOL A;  2WGV A;  5BOH A;  4LRX C;  3C7V A;  5B1M C;  3OPL A;  2RVQ D;  3FWL A;  4UUZ A;  2W1T B;  3UTB A;  5GXQ C;  1ZLA A;  1TS0 A;  1NJ4 A;  5FQK A;  4Z66 D;  2VGK A;  3EQV A;  3LZ1 D;  1K6R A;  5DTS A;  3VSL A;  5CP6 A;  3MBZ A;  2OLV A;  4GDB A;  1H3O B;  3UT9 C;  5HD3 A;  3Q07 A;  4JGR A;  5F99 B;  3QNB A;  5TGF A;  2FFF B;  2XR0 A;  2XA7 S;  1VEU A;  5GT0 A;  3U2A A;  1FCM A;  4BD0 A;  4NE5 A;  1P3F D;  4B9O A;  5AY8 A;  3IHB A;  5B2J C;  3G31 A;  3CIT A;  5B33 A;  3EEA A;  3MGR B;  3FG8 A;  4DDY A;  3X1U A;  3PBR A;  1EI5 A;  1OJG A;  4GDN A;  3AZN D;  2PYR A;  2QZ6 A;  3K3D A;  1G6O A;  1MWU A;  3UB8 A;  3F1N B;  4PPR A;  1LLB A;  2NUT C;  1PIO A;  1GHP A;  1M19 A;  3KO6 A;  3WA9 D;  5B1L A;  4JXS A;  3A6N D;  3D4F A;  4LCL A;  3C1B A;  4ZRR A;  5AV8 A;  2PD8 A;  2QMI A;  2OV5 A;  1S32 B;  3AYW A;  2PYO A;  4XUX A;  4F3L B;  5B31 B;  3F1N A;  1W2E A;  4NZ3 A;  5B2I A;  2DCF A;  1ONG A;  1YPR A;  2VK3 A;  3UTA D;  3WAA C;  1K57 C;  5KIZ A;  3ITA A;  3UB7 A;  3AZG C;  3H0R C;  3MVD C;  3FKW A;  3W98 D;  5FSR A;  1QMF A;  3C2W A;  5BNV B;  3X1T D;  1P3M D;  1EQZ D;  5HSQ A;  5DFY A;  4HJ3 A;  5D3O A;  4H9O A;  3MZF A;  5E5A A;  4WEJ A;  3N8S A;  3A6N A;  4YOF A;  4WU8 B;  2KX6 A;  2VGJ A;  4M3K A;  3BJN A;  3ZG7 B;  3FKE A;  3G2Z A;  1U35 C;  4DXB A;  3EG5 B;  4M4X A;  2ZMV A;  2WGI A;  1K57 A;  5G4Z A;  4NG2 A;  4XUJ B;  4ID4 A;  3AZG A;  1EQZ C;  3LZ0 B;  2J9O A;  3VH5 W;  4JBF A;  3LEL A;  4MNR A;  3W8K A;  4IUK A;  5HWW A;  5B0Z C;  3AZG D;  3C1C C;  4UQI S;  2J8P A;  1W1V A;  3L7H A;  1F66 C;  4QJG A;  3TU4 A;  2B18 A;  4HEF A;  3NQJ B;  3X1U B;  1KX4 B;  1YM1 A;  3T1Q B;  3N8R A;  1GXD A;  1TZY C;  3IP4 C;  4DRA A;  4G91 B;  5CPK C;  1K6S A;  3PTE A;  2ZY2 A;  1U35 A;  3GVB A;  4WZS B;  3T4J A;  2F8N G;  4Y0T A;  5DNN A;  4YS3 A;  5FQQ A;  2XA7 M;  3WA9 C;  1GOI A;  4P0M A;  5CPJ B;  1RGZ A;  3EPL A;  3C1C A;  2ZC3 B;  1MWS A;  1EQZ B;  2L0W A;  5AV9 D;  5M18 A;  4XZQ B;  2MJ6 A;  2WAD A;  1P34 D;  5L07 A;  3MR0 A;  2XRO A;  2Y2I A;  3K2N A;  5MC7 A;  1K25 A;  3BFC A;  3NBL A;  5BNV A;  1NZO A;  3UDI A;  3R7W B;  5E2E A;  3DTI A;  1FQG A;  3AZI D;  3EWK A;  3LGO A;  2PBY A;  3VOZ A;  1HVB A;  1W63 M;  5E5A B;  4X23 C;  2JKR M;  3LZ1 C;  5FEF A;  1HZO A;  4OOM A;  2Y2P A;  3WTP D;  1GA9 A;  2WK0 A;  4Z66 C;  4KZB A;  3TRC A;  2GX5 A;  5AY8 C;  5HAQ A;  4QWO A;  5GXQ D;  5A92 A;  4MCW A;  1LSX A;  3ZYT A;  1YKD A;  3AZN B;  4IBB A;  5GT0 D;  2R78 A;  4F94 A;  1X0O A;  3A0S A;  3W2Z A;  4IJF A;  3KYZ A;  1W79 A;  4E3N A;  3MGQ B;  3DTM A;  3S7N A;  2HDS A;  1UWN X;  4UPK A;  1N9B A;  3HLW A;  2L5A A;  1M18 B;  4DE1 A;  1YU3 A;  3V5M A;  4B93 A;  4Q0J A;  3AZI A;  1CJF A;  5B2I D;  1CI8 A;  3VH5 T;  1ULY A;  4KGC D;  4R3A A;  1H3Q A;  2Z2M B;  3WRZ A;  2GJ3 A;  4E3O A;  2CV5 C;  2V1Z A;  4WN5 A;  5AV8 D;  3REK C;  5BS7 C;  4R23 A;  3OCL A;  5GLB A;  1E6P A;  5GT3 A;  2BTF P;  5EE8 A;  4BJP A;  4YS3 D;  2KLI A;  2HUE C;  3B6F D;  1KDW A;  4UUZ B;  1W7F A;  5B2J B;  2IA2 A;  5AVC B;  5B0Y C;  3O86 A;  1TS6 A;  2O9B A;  4I3I A;  3MMH A;  2W3F A;  4Y17 A;  3EOI A;  3X1S A;  3U4L P;  5AVB A;  4II7 A;  4ZUX A;  5AV5 D;  2NZD B;  2CV5 A;  1YSP A;  5J3W A;  1L0E A;  4WL9 A;  3A6N C;  1NYM A;  3PBS A;  2D49 A;  5JRG B;  3IHA A;  3G2Y A;  4KHA B;  5DNM C;  3BEB A;  3LIC A;  2WGW A;  3T12 B;  3UO9 A;  1XGJ A;  3H9W A;  4UA9 A;  4Q8I A;  4ZJ1 A;  3MGQ D;  5B0Y A;  4P6B A;  4E04 A;  3NDG A;  1BUE A;  1KS0 A;  1ES4 A;  5HDD A;  2LB5 A;  4OQI A;  3CLO A;  5CRF A;  1P3F C;  1Y4O A;  3MGP C;  3LEQ A;  5FAQ A;  1OT6 A;  2B95 A;  4FH2 A;  4OON A;  3LZ1 B;  4AWL C;  3CPT B;  1PW1 A;  5CPK A;  4J8V B;  4Y5F A;  5DNN D;  4Z66 B;  3KSI A;  1NZU A;  5AY8 B;  4Y0O A;  2Q9N A;  3N3F A;  3CUE A;  5DNN B;  5JRG C;  4KZA A;  1PZR A;  3LIE A;  4NZ4 A;  3TU4 D;  3IQA A;  2D01 A;  4RX3 A;  2OAQ 1;  2VZW A;  5B1M D;  1BH8 B;  1VET B;  3IX4 A;  5B33 D;  2Y2J A;  1GA0 A;  4ARZ A;  2HZ5 A;  2F8N K;  1PW8 A;  4GHI A;  1N4O A;  3AZK A;  1FSW A;  1YLJ A;  2J8Y A;  3R45 A;  3HCY A;  2XK1 A;  3W96 D;  4DN0 A;  4LD9 C;  4DE2 A;  3WA9 A;  2CWE A;  4JJN D;  1O07 A;  5IU1 A;  3BQA A;  1P3G D;  3UDX A;  4N9K A;  1IYO A;  3REI B;  3X1U D;  1W8Y A;  1E15 A;  1BFM A;  4OOL A;  2JCH A;  1CI9 A;  1XJ3 A;  5B31 G;  1P3G C;  3AFA D;  4RYE A;  3V3R A;  4JJN A;  3NI9 A;  4MLL A;  3RJU A;  3NQJ A;  1KX4 A;  4DDS A;  1JFI A;  3MNN D;  1GPF A;  3C1B D;  1TAF B;  1BYW A;  3FPV A;  1MY8 A;  2VJW A;  4IBJ A;  3M2J A;  3Q7V A;  4R8P D;  3MFD A;  5B32 C;  1E6Z A;  1T19 A;  3MGR A;  3EPJ A;  4GHA A;  1ESI A;  5B1M B;  3F1P B;  2OAP 1;  5AV6 B;  1TF1 A;  1VM1 A;  2D02 A;  5GHY A;  1P3F B;  4EO5 C;  2JKG A;  3AZN A;  3FZC A;  3E4O A;  4JXW A;  1T18 A;  4Z5T A;  5JRG D;  2ARO A;  4Z2J A;  5GHZ A;  2ZQ7 A;  3BWL A;  4IBI A;  3HLB A;  2W27 A;  2VX8 A;  2PR6 A;  4KG6 A;  1M6K A;  3C30 A;  3O5Y A;  4GN2 A;  1L3L A;  3QP5 A;  3MGP D;  5HZH A;  5FDS A;  5J8X A;  1ZG6 A;  2F8N D;  4K0X A;  3X1S D;  5HL1 A;  3IF6 A;  3REK A;  1W1T A;  1T1C A;  1YT4 A;  3MGS C;  3HUO A;  4CLC E;  4D60 A;  4Z9Q A;  1J3W A;  3MGQ C;  4Y0U A;  1T1A A;  3AV1 A;  1P3B B;  1HTZ A;  1ERM A;  3REK B;  3JYI A;  2LY8 A;  4LD9 B;  1DP9 A;  2Y91 A;  3PBQ A;  3UPO A;  2HJE A;  1KGG A;  1RP5 A;  4LGW A;  4GS9 A;  3REK D;  5AV8 C;  1PNE A;  3WX7 A;  1AXB A;  4OP8 A;  4PMA A;  3C4P A;  3L9K A;  5DJT A;  1DRM A;  3UTA B;  1W1P A;  5B2I C;  2FZ0 A;  5HAR A;  4S2K A;  1VHM A;  2ZQA A;  5B33 B;  1JFI B;  2ZQ9 A;  2PBD P;  3CJM A;  2Y2L A;  1IYP A;  3LI8 A;  2FH5 A;  4WU9 D;  3TU4 B;  4Z1W A;  1H8Y A;  1UWP X;  3F1O B;  2ZOI A;  3I7J A;  3O88 A;  4Z2L A;  5L10 A;  2XF3 A;  4LPZ A;  1K54 A;  5AV6 A;  1SKO A;  5AQ9 A;  5CGS A;  2Y2Q A;  5TJJ A;  1S1Z A;  5GXQ B;  5CGW A;  3KX0 X;  1K4F A;  5B40 C;  3KSH A;  1M18 A;  4CLC A;  3V50 A;  2A49 A;  1KDS A;  3MGR D;  4H8R A;  3LZ0 D;  1YMS A;  4S2I A;  2RIQ A;  3NQU B;  2HF6 A;  5CEB A;  4PAU A;  4CPK A;  1Z6F A;  1I2S A;  5F99 C;  4N92 A;  3G4P A;  4NXF A;  4E6W A;  3HSH A;  5EPH A;  4XZQ A;  1NLZ A;  2PT7 A;  5FAT A;  1M18 D;  2HDQ A;  3UMD A;  3AYW B;  2PYO B;  1BTL A;  4OLD A;  5B31 A;  4GJ4 A;  3UE0 A;  4LFU A;  1F2K A;  4CLC C;  1LT0 A;  3SS4 A;  5L2F A;  5TBM A;  4ZBE A;  1H0G A;  2OSU A;  2EX9 A;  2P74 A;  2XFT A;  2Q9M A;  2F8N A;  5IHV A;  1SKF A;  4HP4 A;  4LG2 A;  1BH9 A;  3REL D;  1ALQ A;  1J9M A;  2VA0 A;  3A1I A;  1YSQ A;  4IBF A;  2PU2 A;  4G3W A;  2G7U A;  1KX5 D;  1LL5 A;  1TVF A;  1YLP A;  2HDR A;  3G32 A;  4YM6 D;  4WEK A;  4HOI A;  3LIB A;  1R4V A;  4XXR A;  4OQ0 A;  4GD8 A;  4GCZ A;  5G49 A;  3V9R A;  3AZJ A;  3KUY C;  1NXY A;  5AV9 C;  4R4R A;  3BLM A;  1TEM A;  3AV1 D;  4XUJ A;  3AZG B;  2V1B A;  4X68 A;  1KOU A;  1G5U A;  2HIO B;  3KXB C;  2PRF A;  2PYP A;  1VET A;  1SZV A;  5EEC A;  4UQI M;  3AN2 C;  2FJ7 D;  2Y55 A;  4WM9 A;  1AIW A;  3AZF B;  2HP6 A;  1NLY A;  1WA9 A;  3AGE A;  1BSG A;  1PFL A;  1NWZ A;  1H0M A;  1L0F A;  1TZY D;  4X23 A;  4WEL A;  2EXB A;  3IXH A;  4EET B;  3NQU A;  4Z2M H;  5JYP A;  2F8N H;  4BL2 A;  3LY3 A;  5B2J A;  4KZ8 A;  2WZZ A;  4ZDX A;  3X1T C;  4GKU A;  5L8M A;  3LUQ A;  2ZMF A;  4R8P B;  3LR0 A;  3B3X A;  2V2F F;  3REH B;  5B0Z B;  4S2M A;  1M1A A;  1V9Z A;  3MVD A;  5CHM A;  3R4K A;  3B6F B;  1KX5 B;  4O0P A;  5TBM B;  4H9R A;  5CX7 A;  2VV8 A;  3MXS A;  3NOP C;  1PZO A;  2NQB C;  3ZNT A;  1ES2 A;  1P9R A;  5B24 C;  2WGW B;  2IO5 C;  4JF5 A;  1BH9 B;  3PYP A;  4KUO A;  3IWQ A;  3Q7V B;  2Y2H A;  3X1V D;  5BNX A;  1BLS A;  3N4I A;  4N9L A;  3X1T A;  1ID3 A;  3KXB D;  4FH4 A;  1TS7 A;  1IOU A;  3MVD D;  2XGN A;  1TD5 A;  5FQI A;  3UE3 A;  1KE3 A;  3S7O A;  4JJN B;  4DJ3 A;  2HIO C;  3KXB B;  4DKI A;  3T4L A;  1K55 A;  2M1C A;  3VP2 A;  5CPK B;  2NQB A;  2K7S A;  3X1S C;  4S2O A;  3AFA A;  3Q1F A;  5B24 A;  3RFB A;  3ISG A;  4Z2H A;  3UB5 P;  1CEG A;  4GZB A;  3AL0 C;  3E2L A;  4KEN B;  4UA7 A;  1F9I A;  2Y59 A;  5EOE A;  2BYK B;  3MQO A;  4IBK A;  5GT3 B;  3O62 A;  3Q7Z A;  5DTT A;  3REL C;  3VMA A;  4BBU A;  1KGF A;  5KZH A;  5AV8 B;  3MNN B;  4J8W D;  2HJ9 C;  2QHK A;  5K5B A;  4HY8 A;  1FSY A; 
#chains in the Genus database with same CATH homology
 1JWZ A;  4XZQ C;  3WTP E;  1G68 A;  4R3J A;  3KS4 A;  1K55 C;  3WS1 A;  3W4O A;  4IJE A;  5AV6 D;  1GHM A;  4WZ4 A;  4NE6 A;  4MBF A;  3REI C;  1ES5 A;  3W96 A;  3IWI A;  2IO5 B;  3WWX A;  1P34 B;  2Y2O A;  3WKJ B;  1L2S A;  5F99 A;  5CER A;  5HAI A;  1LI0 A;  3HLE A;  3ZG8 B;  1WYB A;  3EPK A;  1DJB A;  2CV5 B;  5E2F A;  1SDE A;  3WTP B;  4OJ6 A;  4KQO A;  2E8I A;  3OPR A;  3NDE A;  5B31 D;  2IWD A;  1H3O A;  3MZE A;  3M6H A;  1NY0 A;  3LEL D;  3AN2 A;  2ZQ8 A;  4EBL A;  1W5D A;  3SH8 A;  1CEF A;  1YUE A;  1JWP A;  5BT1 C;  4BD1 A;  1S32 D;  1P3L A;  3EQU A;  1VQQ A;  5I94 A;  1IEL A;  3HLC A;  4Z5T B;  1XGI A;  5AV5 A;  4ZUX D;  5F1F A;  5AVB D;  4NZ1 A;  2DF4 C;  4QB8 A;  5F82 A;  1L0D A;  3MGS B;  5B1L B;  1SCW A;  1K56 D;  3HRE A;  3IXB A;  3C7U A;  3HL9 A;  2R9W A;  1M1A B;  5M1A A;  3BFD A;  4OPQ A;  3S1Y A;  4WNN B;  4S2J A;  1AOI D;  3AZL B;  3IH9 A;  3AZH A;  3AV1 B;  2V20 A;  4GOG A;  1P3O C;  3VP0 A;  3WA9 B;  4X53 A;  1KE4 A;  2ZLY A;  1T3U A;  3LEL B;  4C75 A;  1RCJ A;  2JSS A;  2DNS A;  2EFX A;  3MGP B;  1G6A A;  3WTP A;  5EVI C;  4KGC B;  4DRT A;  4LV0 A;  3C1B C;  2UWX A;  3OPH A;  3AZH C;  3AYW D;  2PYO D;  4WZ5 C;  5KDM A;  3X1T B;  5HW3 A;  5CPJ D;  5CHL B;  3UPN A;  4J8U B;  4B88 A;  1QME A;  3B6G A;  4NFT A;  4E45 A;  1TDL A;  5KDM B;  1GHI A;  1HTA A;  5EOO A;  2NQB B;  3BEC A;  5F1G A;  4M6B A;  1CK3 A;  1LL9 A;  3W96 C;  5E5A D;  3H0M C;  2XEP A;  3AZK C;  5FI7 A;  3ZFZ A;  2EX8 A;  3AZF D;  1P3L D;  4E44 A;  1GCE A;  3LJA D;  1P3K C;  1P3P C;  4KG2 A;  3W4Q A;  1XA7 A;  4KZ9 A;  5JRG A;  5G18 A;  2ZM2 A;  1PZP A;  1E3U A;  5AV6 C;  1P3G B;  1MKI A;  2C6W B;  2FJ7 B;  3RXX A;  1E3U D;  1P3G A;  4IBC A;  2JE5 A;  3UTB B;  3SOI A;  1P3B D;  1KX3 B;  3AZE A;  2IOU A;  4PM6 A;  4CAY A;  1P34 C;  5B0Y B;  1KX3 A;  5E2G A;  5E5A C;  5TR7 A;  4Y7P A;  1XPB A;  3KS8 A;  1U60 A;  4B4X A;  2EXA A;  4R1G A;  5AVC D;  1Z2C B;  1H5X A;  1BZA A;  1N1J B;  3AZE C;  4WJ3 C;  2ZY3 A;  1P3A C;  4J8V A;  3MZD A;  5B32 G;  4KUD A;  4WYY A;  3W97 A;  5CPK D;  1P34 A;  1KX3 C;  3MKE A;  5FA7 A;  3X1V A;  3A3D A;  1P3M A;  5AV9 A;  1F66 D;  3WS4 A;  4YS3 C;  3GMW A;  4J8V D;  2PU4 A;  1PI5 A;  5F83 A;  1P3A A;  3QNC A;  3Q81 A;  4KUD C;  1SHV A;  3VSK A;  3AZK B;  2G5H C;  4LV2 A;  1P3I C;  3VP1 A;  1XX2 A;  3AZM C;  1K56 A;  1BLH A;  2P9V B;  4OPY A;  5CED A;  1P3A B;  2ZQD A;  3VFH A;  3CG5 A;  4JPM A;  1P3O D;  3AGD A;  1S6R A;  5FUG A;  3B0D C;  1YLT A;  3VOY A;  2FJ7 C;  3REH D;  2BG1 A;  3G35 A;  5FI2 A;  3N8L A;  3BFE A;  5GT3 C;  3A3I A;  3IT9 A;  5FUG B;  3W98 C;  5DNM B;  2ZC6 B;  3MGQ A;  3AV1 C;  3WAA D;  4OJP A;  3AZM A;  3LZ1 A;  4CSR A;  1BUL A;  4X23 D;  3FV7 A;  2ARO B;  1ZLA D;  4ZUX C;  1ZC2 A;  4YM6 C;  4IBE A;  1TAF A;  3A1K A;  1KVM A;  4GNU A;  2WYX A;  5AQA A;  4BQM A;  4J8X D;  3VFF A;  5BO0 B;  4WZ5 A;  4CSR B;  3AZJ D;  4EV4 A;  1K4E A;  3NY4 A;  4WMC D;  3G34 A;  3B6G C;  2RCX A;  5BT1 D;  1BH8 A;  1M40 A;  4NK3 A;  2ZC7 A;  3IXD A;  2Y2M A;  1IKG A;  2ZY5 A;  4Z2M G;  2WZX A;  4ZBJ B;  5AVB B;  1YLY A;  4UA6 A;  3P5J B;  2X01 A;  1H8Z A;  1M18 C;  5B1L D;  4GH9 A;  4JF4 A;  2JC7 A;  5F99 D;  4JLF A;  1RGY A;  2R9X A;  3UT9 D;  4DE3 A;  4UHU A;  3L28 A;  2XFS A;  2Y4A A;  1WWS A;  3OC2 A;  4BEN A;  1YU4 A;  3B0C W;  1PWD A;  4OOY A;  1A7W A;  3A3E A;  3EPH A;  4OPR A;  1P3K B;  1P3P B;  4EQI A;  3P09 A;  5DNM A;  3PBN A;  4WU9 C;  4BLM A;  2EFU A;  2XD5 A;  1ZKJ A;  3W99 B;  4IBG A;  1AOI B;  3KXB A;  2ARO D;  4WBG A;  1JVJ A;  4HES A;  5M19 A;  5GSU D;  2ZC5 B;  3KWQ B;  3W99 A;  2WKE A;  1AOI A;  3UTB D;  4LCM A;  3L25 A;  3A3F A;  5B2I B;  1P3M C;  2VQR A;  3AZJ C;  3ZGA B;  3W97 D;  5AQ7 A;  4EBP A;  1WYC A;  4ZUX B;  1ZLA C;  3REJ B;  3UTA C;  3MGS D;  4R4S A;  5JYO A;  3CZD A;  3GV9 A;  1E25 A;  1PI4 A;  3W97 C;  5FQ9 A;  4L0L A;  4OQG A;  2B5R A;  5CHU A;  3REH C;  2FJ7 A;  3FYZ A;  3RXW A;  3AZN C;  2CC1 A;  3LCE A;  4QY5 A;  5B32 B;  3AZJ B;  3CMZ A;  5TFQ A;  3AZM D;  3L26 A;  2F8N B;  3V39 A;  5EVL A;  4RX2 A;  3UE1 A;  4X6T A;  2H10 A;  4PM8 A;  2YFV A;  4G92 C;  1JWV A;  2IWB A;  3C5A A;  3HBR A;  3W97 B;  3MGS A;  2J9P A;  2Y2G A;  5A91 A;  5DF8 A;  4LV1 A;  5EVI A;  1ID3 D;  1BT5 A;  1P3A D;  3LEZ A;  5KSC A;  5FAO A;  3REL B;  5JA4 B;  3BFF A;  4NET A;  4OUI A;  3DWZ A;  3DW0 A;  3C1C B;  3LJA A;  3B6G D;  1ZLA B;  1O7E A;  5CPI A;  3UN7 A;  1Y54 A;  5HFO A;  3SS3 A;  5BNX B;  5KMW A;  2BLS A;  4EUZ A;  3HVF A;  3AZL A;  1YLW A;  3L2A A;  3TU4 C;  3BYD A;  4YIN A;  3C4O A;  1DJA A;  4WU9 A;  4IVI A;  4J8U A;  4IBD A;  4J8W B;  1MBL A;  4NZ5 A;  1HQ3 D;  5GSU B;  1ZG4 A;  5DNN C;  5CP6 D;  5GT3 D;  2ZM8 A;  1HQ3 B;  1P3L C;  3AZL C;  1N1J A;  3AZK D;  2WKI A;  2I72 A;  3GTC A;  3LZ0 C;  3HUN A;  4K91 A;  5B24 B;  1M1A D;  1PWG A;  4H9Q B;  3BM6 A;  1P3I D;  3UT9 B;  4YS3 B;  3SH7 A;  5DNM D;  5EVI B;  3ZVW A;  4KUD D;  1SDN A;  3KFU G;  4P87 A;  4QU3 A;  2ZC4 B;  2C5W B;  4S2N A;  3UDF A;  3IXG A;  3W99 C;  4OQH A;  4DQY B;  3REH A;  3AV2 B;  3QHY A;  1S32 A;  3PAG A;  3GR2 A;  1LI9 A;  3REJ A;  4XUJ C;  3LO7 A;  4QY6 A;  2XD1 A;  1P3O A;  3KWQ D;  5DF7 A;  1KVL A;  4H9O B;  3KUY B;  1IYS A;  3AZE D;  3AV2 A;  3BLS A;  3KWQ C;  2YFV B;  2JBF A;  4A5R A;  5CP6 B;  2OLU A;  3HUM A;  4PM7 A;  5GSU A;  3REJ C;  4EBN A;  5GLA A;  4B4Z A;  4OPZ A;  4RA7 A;  3OCN A;  4C3Q A;  1HQ3 A;  4KUD B;  3C1B B;  3A3J A;  4ZJ2 A;  3AGF A;  5AV5 B;  4RVA A;  2BYK A;  3WTP C;  3O62 B;  3L27 A;  5GXQ A;  4H9Q A;  5AVB C;  1P3L B;  4KQR A;  3AZL D;  4DF6 A;  4QLC C;  3WKJ A;  3UY6 A;  4NY2 A;  2EX2 A;  4DRB A;  5B32 D;  3VP4 A;  5CP6 C;  1P3K D;  1P3P D;  1U35 B;  3ZG0 A;  3IH8 A;  5CXW A;  3MNN C;  1JTD A;  1B67 A;  1XXM A;  5CPJ A;  4HGA B;  3N6I A;  1YU1 A;  4NYY A;  1PWC A;  4OKP A;  1F66 B;  5BS7 A;  5GLD A;  3MGP A;  3X1U C;  5GL9 A;  3W4P A;  2Z2L B;  4N1H A;  2P9V A;  4J8W A;  5FQM A;  4GB7 A;  5GLC A;  1PYY A;  5CPJ C;  1P3K A;  1P3P A;  1L0G A;  2WAE A;  3WRT A;  3AZH D;  4QNL A;  1ESU A;  3C1C D;  3WS5 A;  4PM9 A;  2G2U A;  5B33 C;  5EVI D;  1IEM A;  2DRW A;  1S0W A;  3ZCZ A;  3TOI A;  3AZM B;  1U35 D;  4QLC B;  4N1X A;  4X55 A;  1KX4 D;  3BRM A;  4S2N C;  4O7D A;  1P3F A;  2Y2K A;  2WKH A;  4FD8 A;  4H9N A;  4KG5 A;  1XP4 A;  4H9S C;  2ZY4 A;  3O87 A;  4LV3 A;  3O62 C;  3ZDJ A;  3VH6 W;  2GDN A;  1FR1 A;  1EQZ A;  4R3B A;  4OJO A;  3S22 A;  3V3S A;  3G30 A;  1LHY A;  4Z5T D;  3N7W A;  2FFY A;  1F66 A;  3B6F A;  3NCK A;  3IF5 A;  2XQZ A;  3REI A;  5B32 A;  3X1V C;  4S2L A;  3B6G B;  1S32 C;  5B24 D;  4E3I A;  4KGC A;  2NQB D;  5FAP A;  4KZ6 A;  3SH9 A;  4C6Y A;  4Z5T C;  2YFW A;  3ZVT A;  3LEL C;  2ARO C;  1C3B A;  4WV4 B;  3AV2 C;  4ZBJ C;  4H9P A;  3WAA B;  3B0D B;  3WS2 A;  4NYU A;  1P3I A;  1BLC A;  3L29 A;  2RL3 A;  3TSG A;  4S2P A;  3HLD A;  3UTB C;  4U0T A;  3IF6 C;  1TDG A;  1KX4 C;  3H0L C;  2G5I C;  4UAA A;  1ERO A;  3B0C T;  4G91 C;  3UT9 A;  4P85 A;  4E3K A;  1P3O B;  3AN2 D;  1M19 B;  1MWT A;  5CTM A;  5GT0 C;  5KSH A;  1F1E A;  4IBX A;  2QPN A;  4KQQ A;  5AY8 D;  5E43 A;  1E4D A;  5CPI B;  1MPL A;  1XA1 A;  1FCO A;  4EWF A;  1B6W A;  4XZQ D;  2ZQC A;  5A93 A;  1KE0 A;  1Q2P A;  3WKJ D;  4CAY B;  1YMX A;  2HP5 A;  4J8W C;  5E2H A;  1WE4 A;  3FKV A;  2H0Y A;  4BL3 A;  1KX5 C;  3AZI C;  1ONH A;  4CJN A;  5B1L C;  3P98 A;  5CEC A;  3DWK A;  4HBU A;  4WU9 B;  3WS0 A;  4JF6 A;  4J8X C;  4Z66 A;  3AV2 D;  3UNW A;  4WU8 A;  3IWO A;  3VH5 A;  5GT0 B;  2HIO D;  1BLP A;  3FDD A;  4H9P B;  3WAA A;  1NRF A;  3AZF A;  4E3M A;  5CPI C;  5G49 B;  3V9R B;  3HLG A;  3OPP A;  4HGA C;  1FCN A;  4J8X A;  4OJ5 A;  3ITB A;  1KGE A;  5FAS A;  5FDH A;  1MXO A;  2HP9 A;  5DVA A;  1DJC A;  4WNN A;  1DY6 A;  1WWI A;  3SS5 A;  3UPP A;  4KZ5 A;  5HX9 A;  5B0Z D;  3AZH B;  3M2K A;  3OZH A;  1NYY A;  4GD6 A;  3IF6 B;  1KU5 A;  1ERQ A;  1ES3 A;  5DF9 A;  3O62 D;  1P3M B;  3VP3 A;  4H9R B;  5AV9 B;  4G92 B;  5JA4 A;  5B40 A;  3GQZ A;  3R45 B;  4D2O A;  5FQJ A;  4R8P A;  5DTK A;  3KUY A;  3LJA B;  5AQB A;  5EUA A;  4X69 A;  1OME A;  2F2A C;  2H5S A;  3UTA A;  3A6N B;  5BPV A;  4J8V C;  3AFA B;  2G2W A;  2Y2N A;  5AVC C;  5C3I B;  3KUY D;  4XUZ A;  1M19 D;  3PAE A;  2H0T A;  1KX3 D;  3MXR A;  3KSY A;  4J8U D;  3E2K A;  4AWL B;  4NE3 A;  1K38 A;  4FCF A;  3W98 B;  1P3B C;  1M1A C;  2ZM5 A;  5FI6 A;  4IED A;  4ZAM A;  5AVC A;  1MWR A;  1Q2Q A;  3BFG A;  3X1V B;  2HDU A;  3NC8 A;  5U47 A;  3HLF A;  5B2J D;  4YM6 B;  3ZG9 B;  3GRJ A;  3Q82 A;  3ZHH A;  4U3T A;  4LD9 A;  4QLC D;  3LJA C;  1HQ3 C;  2XDM A;  1KX5 A;  2WUQ A;  3AZE B;  3MGR C;  1FR6 A;  4DXC A;  4YFM A;  2W8S A;  2NZD A;  5B40 D;  1IKI A;  2J7V A;  4QHC A;  3AFA C;  2RVQ C;  3F6T A;  3HON A;  2X02 A;  3AN2 B;  4J8U C;  3PBO A;  3REJ D;  2HUE B;  5CTN A;  3AZF C;  5A90 A;  3PBT A;  2BYM B;  4WMC A;  1M19 C;  2YFW B;  2ZJ9 A;  4LD9 D;  4QD4 A;  2WAF A;  4R0Q A;  3AYW C;  2PYO C;  2IWC A;  2NZD C;  1P3I B;  1Q9C A;  3LZ0 A;  4JXG A;  1EWZ A;  5C3I C;  3AZI B;  5CHJ A;  2XLN A;  4FSF A;  5BO0 A;  1ID3 C;  4WU8 C;  5GHX A;  3W98 A;  1YU0 A;  4XUJ D;  3S4X A;  4EO5 B;  3LY4 A;  4OH0 A;  2HIO A;  1XKZ A;  2EX6 A;  4J8X B;  4JKT A;  4X56 A;  3W99 D;  4E3L A;  4YM6 A;  1W8Q A;  4GHL A;  5CGX A;  3M6B A;  3W96 B;  4PM5 A;  4HBT A;  3REL A;  2XH9 A;  4JXV A;  2A3U A;  4KZ3 A;  3ZG5 A;  4KHA A;  1TZY B;  4OP5 A;  5B0Z A;  4ZJ3 A;  3NIA A;  2DQN C;  1I2W A;  4MEZ A;  1AOI C;  1HD8 A;  4E3J A;  4H9S A;  2ZD8 A;  1TZY A;  4K0W A;  4R8P C;  3TG9 A;  4OLG A;  5CPI D;  1IYQ A;  3VH6 T;  3O3V A;  4ZTK A;  5AV5 C;  2HPB A;  4OVD A;  2BYM A;  5HAP A;  4E6X A;  4U0X A;  3GSG A;  1ID3 B;  4LEN A;  5B0Y D;  1K54 C;  1YLZ A;  2ZM0 A;  4IVK A;  4DE0 A;  3KWQ A;  3B6F C;  4H9N B;  4WU8 D;  3VH6 A;  4MBK A;  5B1M A;  3ZNY A;  4IBR A;  1I5Q A;  4OJL A;  2NZD D;  2CV5 D;  5B40 B;  3MVD B;  1YU2 A;  4QLC A;  3WKJ C;  4JJN C;  4X23 B;  5GSU C;  4KGC C;  1JTG A;  2X71 A;  3B0B A;  3MKF A;  2ZMA A;  3MNN A;  3X1S B;  4KZ4 A;  4KZ7 A;  1P3B A;  5B31 C;  1YQS A;  4MBH A;  1FOF A;  3REI D;  2WGV A;  5BOH A;  3C7V A;  5B1M C;  3OPL A;  2RVQ D;  3FWL A;  4UUZ A;  3UTB A;  5GXQ C;  1ZLA A;  1NJ4 A;  5FQK A;  4Z66 D;  2VGK A;  3EQV A;  3LZ1 D;  1K6R A;  5DTS A;  3VSL A;  5CP6 A;  3MBZ A;  2OLV A;  4GDB A;  1H3O B;  3UT9 C;  3Q07 A;  5F99 B;  3QNB A;  5TGF A;  2FFF B;  2XR0 A;  5GT0 A;  1FCM A;  4BD0 A;  4NE5 A;  1P3F D;  5AY8 A;  3IHB A;  5B2J C;  3G31 A;  5B33 A;  3MGR B;  4DDY A;  3X1U A;  3PBR A;  1EI5 A;  4GDN A;  3AZN D;  2QZ6 A;  1MWU A;  4PPR A;  1LLB A;  1PIO A;  1GHP A;  1M19 A;  4JXS A;  3WA9 D;  5B1L A;  3A6N D;  3D4F A;  4LCL A;  3C1B A;  5AV8 A;  2QMI A;  2OV5 A;  1S32 B;  3AYW A;  2PYO A;  4XUX A;  5B31 B;  1W2E A;  4NZ3 A;  5B2I A;  2DCF A;  1ONG A;  3UTA D;  3WAA C;  1K57 C;  3ITA A;  3AZG C;  3H0R C;  3MVD C;  3FKW A;  3W98 D;  5FSR A;  1QMF A;  5BNV B;  3X1T D;  1P3M D;  1EQZ D;  5D3O A;  4H9O A;  3MZF A;  5E5A A;  4WEJ A;  3N8S A;  3A6N A;  4WU8 B;  2VGJ A;  4M3K A;  3ZG7 B;  3FKE A;  3G2Z A;  1U35 C;  4DXB A;  3EG5 B;  2WGI A;  1K57 A;  4XUJ B;  4ID4 A;  3AZG A;  1EQZ C;  3LZ0 B;  2J9O A;  3VH5 W;  4JBF A;  3LEL A;  4MNR A;  3W8K A;  5B0Z C;  3AZG D;  3C1C C;  2J8P A;  1F66 C;  4QJG A;  3TU4 A;  4HEF A;  3NQJ B;  3X1U B;  1KX4 B;  1YM1 A;  3N8R A;  1TZY C;  3IP4 C;  4DRA A;  4G91 B;  3PTE A;  5CPK C;  1K6S A;  2ZY2 A;  3GVB A;  1U35 A;  4WZS B;  2F8N G;  4Y0T A;  5DNN A;  4YS3 A;  5FQQ A;  3WA9 C;  4P0M A;  5CPJ B;  1RGZ A;  3EPL A;  3C1C A;  2ZC3 B;  1MWS A;  1EQZ B;  5AV9 D;  5M18 A;  4XZQ B;  2WAD A;  1P34 D;  2Y2I A;  1K25 A;  3BFC A;  3NBL A;  5BNV A;  1NZO A;  3UDI A;  5E2E A;  1FQG A;  3AZI D;  2PBY A;  3VOZ A;  1HVB A;  5E5A B;  4X23 C;  3LZ1 C;  1HZO A;  4OOM A;  2Y2P A;  3WTP D;  1GA9 A;  2WK0 A;  4Z66 C;  4KZB A;  5AY8 C;  5HAQ A;  5GXQ D;  5A92 A;  3AZN B;  4IBB A;  5GT0 D;  4F94 A;  4IJF A;  1W79 A;  4E3N A;  3MGQ B;  3DTM A;  2HDS A;  4UPK A;  1N9B A;  3HLW A;  2L5A A;  1M18 B;  4DE1 A;  1YU3 A;  3V5M A;  3AZI A;  5B2I D;  1CI8 A;  3VH5 T;  1ULY A;  4KGC D;  2Z2M B;  3WRZ A;  4E3O A;  2CV5 C;  2V1Z A;  5AV8 D;  3REK C;  5BS7 C;  4R23 A;  3OCL A;  5GLB A;  5GT3 A;  5EE8 A;  4BJP A;  4YS3 D;  2HUE C;  3B6F D;  1KDW A;  4UUZ B;  1W7F A;  5B2J B;  5AVC B;  5B0Y C;  3O86 A;  3X1S A;  5AVB A;  4ZUX A;  5AV5 D;  2NZD B;  2CV5 A;  1L0E A;  3A6N C;  1NYM A;  3PBS A;  5JRG B;  3IHA A;  3G2Y A;  4KHA B;  5DNM C;  3BEB A;  2WGW A;  3UO9 A;  1XGJ A;  4UA9 A;  4Q8I A;  4ZJ1 A;  3MGQ D;  5B0Y A;  4P6B A;  3NDG A;  1BUE A;  1ES4 A;  4OQI A;  5CRF A;  1P3F C;  3MGP C;  5FAQ A;  4FH2 A;  4OON A;  3LZ1 B;  4AWL C;  1PW1 A;  5CPK A;  4J8V B;  5DNN D;  4Z66 B;  1NZU A;  5AY8 B;  4Y0O A;  2Q9N A;  3N3F A;  5DNN B;  5JRG C;  4KZA A;  1PZR A;  4NZ4 A;  3TU4 D;  3IQA A;  4RX3 A;  5B1M D;  1BH8 B;  5B33 D;  2Y2J A;  1GA0 A;  2F8N K;  1PW8 A;  1N4O A;  3AZK A;  1FSW A;  1YLJ A;  2J8Y A;  3R45 A;  2XK1 A;  3W96 D;  4LD9 C;  4DE2 A;  3WA9 A;  2CWE A;  4JJN D;  1O07 A;  1P3G D;  3UDX A;  4N9K A;  1IYO A;  3REI B;  3X1U D;  1W8Y A;  1BFM A;  4OOL A;  2JCH A;  1CI9 A;  5B31 G;  1P3G C;  3AFA D;  4RYE A;  3V3R A;  4JJN A;  3NI9 A;  4MLL A;  3RJU A;  3NQJ A;  1KX4 A;  4DDS A;  1JFI A;  3MNN D;  3Q7V A;  3C1B D;  1TAF B;  1MY8 A;  4IBJ A;  3M2J A;  4R8P D;  3MFD A;  5B32 C;  3MGR A;  3EPJ A;  4GHA A;  1ESI A;  5B1M B;  5AV6 B;  1VM1 A;  5GHY A;  1P3F B;  4EO5 C;  3AZN A;  3FZC A;  4JXW A;  4Z5T A;  5JRG D;  2ARO A;  5GHZ A;  2ZQ7 A;  4IBI A;  3HLB A;  4KG6 A;  1M6K A;  4GN2 A;  3MGP D;  5J8X A;  1ZG6 A;  2F8N D;  4K0X A;  3X1S D;  5HL1 A;  3IF6 A;  3REK A;  1YT4 A;  3MGS C;  3HUO A;  4Z9Q A;  3MGQ C;  4Y0U A;  3AV1 A;  1P3B B;  1HTZ A;  1ERM A;  3REK B;  3JYI A;  2LY8 A;  4LD9 B;  3PBQ A;  2Y91 A;  3UPO A;  1KGG A;  1RP5 A;  3REK D;  5AV8 C;  3WX7 A;  4OP8 A;  1AXB A;  4PMA A;  3C4P A;  3UTA B;  5B2I C;  5HAR A;  4S2K A;  2ZQA A;  5B33 B;  1JFI B;  2ZQ9 A;  3CJM A;  2Y2L A;  1IYP A;  4WU9 D;  3TU4 B;  1H8Y A;  3I7J A;  3O88 A;  2XF3 A;  1K54 A;  5AV6 A;  5AQ9 A;  5CGS A;  2Y2Q A;  5GXQ B;  5CGW A;  1K4F A;  5B40 C;  1M18 A;  3V50 A;  2A49 A;  1KDS A;  3MGR D;  4H8R A;  3LZ0 D;  1YMS A;  4S2I A;  2RIQ A;  3NQU B;  5CEB A;  4CPK A;  1Z6F A;  1I2S A;  5F99 C;  4N92 A;  3G4P A;  4E6W A;  3HSH A;  5EPH A;  4XZQ A;  5FAT A;  1M18 D;  2HDQ A;  3AYW B;  2PYO B;  1BTL A;  4OLD A;  5B31 A;  3UE0 A;  3SS4 A;  5L2F A;  4ZBE A;  2OSU A;  2EX9 A;  2P74 A;  2XFT A;  2Q9M A;  2F8N A;  5IHV A;  1SKF A;  4LG2 A;  1BH9 A;  3REL D;  1ALQ A;  1J9M A;  3A1I A;  4IBF A;  2PU2 A;  1KX5 D;  1LL5 A;  1TVF A;  1YLP A;  2HDR A;  3G32 A;  4YM6 D;  4WEK A;  1R4V A;  4XXR A;  4OQ0 A;  4GD8 A;  5G49 A;  3V9R A;  3AZJ A;  3KUY C;  1NXY A;  5AV9 C;  4R4R A;  3BLM A;  1TEM A;  3AV1 D;  4XUJ A;  3AZG B;  4X68 A;  2HIO B;  3KXB C;  5EEC A;  3AN2 C;  2FJ7 D;  2Y55 A;  4WM9 A;  2HP6 A;  3AZF B;  3AGE A;  1BSG A;  1L0F A;  1TZY D;  4X23 A;  4WEL A;  2EXB A;  3IXH A;  3NQU A;  4Z2M H;  5JYP A;  2F8N H;  4BL2 A;  3LY3 A;  5B2J A;  4KZ8 A;  2WZZ A;  4ZDX A;  3X1T C;  4GKU A;  4R8P B;  3B3X A;  2V2F F;  3REH B;  5B0Z B;  4S2M A;  1M1A A;  3MVD A;  5CHM A;  3B6F B;  1KX5 B;  4H9R A;  3MXS A;  1PZO A;  2NQB C;  3ZNT A;  1ES2 A;  5B24 C;  2WGW B;  2IO5 C;  4JF5 A;  1BH9 B;  3IWQ A;  3Q7V B;  2Y2H A;  3X1V D;  5BNX A;  1BLS A;  4N9L A;  3N4I A;  3X1T A;  1ID3 A;  3KXB D;  4FH4 A;  3MVD D;  2XGN A;  5FQI A;  3UE3 A;  1KE3 A;  4JJN B;  2HIO C;  3KXB B;  4DKI A;  1K55 A;  3VP2 A;  5CPK B;  2NQB A;  3X1S C;  4S2O A;  3AFA A;  3Q1F A;  5B24 A;  3ISG A;  1CEG A;  4GZB A;  3AL0 C;  3E2L A;  4KEN B;  4UA7 A;  2Y59 A;  5EOE A;  2BYK B;  4IBK A;  5GT3 B;  3O62 A;  3Q7Z A;  5DTT A;  3REL C;  3VMA A;  1KGF A;  5KZH A;  5AV8 B;  3MNN B;  4J8W D;  1FSY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...