2BG1A

Active site restructuring regulates ligand recognition in classa penicillin-binding proteins (pbps)
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
484
structure length
455
Chain Sequence
b'ITYDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTNQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PENICILLIN-BINDING PROTEIN 1B
publication title Active Site Restructuring Regulates Ligand Recognition in Class a Penicillin-Binding Proteins
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Peptidoglycan
total genus 147
structure length 455
sequence length 484
ec nomenclature ec 2.4.1.129: Peptidoglycan glycosyltransferase.
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2bg1A01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2bg1A03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2bg1A02
4EUZA 1JWPA 5A93A 2XK1A 2J9PA 3NDGA 3HLGA 5CGSA 5FI2A 2A49A 4BL2A 4CJNA 1GA9A 5HL1A 1DY6A 1SCWA 3GQZA 1N9BA 1NY0A 3FYZA 3N8LA 4KZ9A 4ZTKA 1I5QA 4DE0A 2HP9A 3GMWA 3UDXA 1KE0A 2BG1A 3VMAA 5KSCA 4HBUA 3S4XA 1MKIA 3UE0A 3Q7VA 1YQSA 2HPBA 3IF6C 2V20A 4P6BA 3C4PA 3W8KA 1ERMA 4XXRA 3OC2A 4LV2A 3V5MA 1NYYA 2XQZA 3IF6A 2OLVA 3MZDA 2G2UA 2ZQ8A 4PM9A 1BZAA 4MBHA 3DWZA 5JYOA 3OZHA 1K6SA 3HLDA 5GHZA 3VOZA 5CHUA 1IKGA 4S2NC 4GZBA 3PBSA 2ZM2A 1BULA 4LV3A 2FFYA 3C4OA 3LEZA 3HLFA 1IYPA 4S2NA 3NDEA 5KSHA 2ZC3B 1CK3A 1K57A 2WZXA 1YM1A 1IELA 1MBLA 4MLLA 1CEGA 2E8IA 3ITBA 3PBQA 4QD4A 3ZVWA 4Y7PA 4EBNA 4X69A 3I7JA 4KG2A 3C7UA 3IHAA 4X53A 4ZJ3A 1W79A 2CC1A 3A3DA 2IWBA 1M40A 4D2OA 5EOEA 3UPNA 1PI4A 5GHYA 4BD0A 1HZOA 3ZVTA 4E3MA 4U0XA 1O07A 1Q2QA 3CG5A 3FWLA 1ES5A 4QHCA 3DWKA 4DXCA 1XGJA 2R9WA 4KQRA 2XD5A 4KZ3A 2Z2LB 1GCEA 2Y2NA 3BRMA 1FQGA 3IQAA 4A5RA 2IWCA 4IBXA 4LV0A 4R4SA 5HFOA 1ZG6A 2Y55A 4MNRA 5FAPA 4RX3A 5EVLA 2H5SA 4JLFA 3HLWA 5KMWA 4E3LA 3GVBA 3M6HA 2RL3A 3G31A 3A3JA 1KGFA 1W8YA 5M18A 4GOGA 1FSYA 1YLJA 1SKFA 5TFQA 5CHMA 1KE4A 4JBFA 4WMCD 5E2EA 4KZAA 1PZPA 5M19A 1KE3A 1FOFA 1JWVA 5AQBA 2DCFA 3OPPA 1DJAA 1JVJA 1FR6A 3SS5A 3M2KA 1ZG4A 4UA9A 4OVDA 1KVMA 2DRWA 1ZKJA 4FSFA 2WZZA 5FQIA 5JYPA 5FATA 4E3JA 1BSGA 1NXYA 3BFCA 3QHYA 1H8ZA 5AQ7A 3HUOA 1EI5A 4JXWA 4LENA 1XKZA 1EWZA 2H10A 2G2WA 5EVID 5A91A 2QPNA 3IXGA 3A3EA 4E3IA 3VOYA 3GV9A 3M2JA 2Y2JA 3PAEA 1SHVA 4JF5A 2V2FF 3G2YA 3IXBA 3IWOA 3Q1FA 5FDHA 3UY6A 4F94A 3UO9A 3ZG7B 4RA7A 3BECA 1YT4A 3QNCA 4B4ZA 4U3TA 3AGDA 1YLPA 3RXWA 5TGFA 3WS2A 4BJPA 1BUEA 4OKPA 4IEDA 5AQ9A 2HP5A 3G32A 3E2LA 4OONA 3FZCA 1EROA 2X71A 4PMAA 5E43A 5DTTA 5F1GA 1BLSA 2EXBA 5FI6A 3S1YA 2GDNA 4QY5A 4ZJ1A 3NC8A 4OPRA 4C75A 1K38A 1MPLA 2ZC7A 3NBLA 4DRTA 1QMEA 3Q81A 3GRJA 3PBRA 4E6XA 3LY4A 1PW8A 3HVFA 1MY8A 1L0FA 2WGIA 4JXGA 3IWQA 4PPRA 4MBFA 2Q9MA 1XP4A 4X6TA 5KZHA 4EQIA 3FV7A 4S2LA 4EV4A 2Y2GA 4XUXA 4YFMA 2PU2A 3VP1A 5GLCA 4OQIA 3GSGA 4R4RA 2XEPA 2HP6A 3G30A 4RYEA 3SS3A 1TDGA 2WKEA 3BEBA 3NY4A 3VSLA 3ZFZA 4FH4A 4LV1A 3UE1A 4Y0TA 1ONHA 3UN7A 3TOIA 1GHMA 1E3UA 4HEFA 4K0WA 4L0LA 5E2GA 3ZNYA 1DJCA 1LL5A 4R1GA 3W4OA 3FKWA 3VP2A 3CMZA 5L2FA 1U60A 2EFUA 1BTLA 4E3NA 5DTKA 1YLZA 3SOIA 3OCNA 1ESIA 5DF8A 1RP5A 1XX2A 5EVIB 3N8SA 1RGYA 3O3VA 4QB8A 1VQQA 3IXHA 4FCFA 4P0MA 4GNUA 1RGZA 1LI0A 5E2FA 2EX6A 3BLSA 2PBYA 2Y59A 2ZQAA 2J7VA 2ZJ9A 4KENB 4WM9A 5CTMA 3BM6A 1K57C 3DW0A 4DXBA 3WS4A 3HLEA 1J9MA 2A3UA 4OQHA 2EX9A 5HAQA 2Y2QA 1HTZA 1KGEA 5EOOA 3BFFA 5E2HA 1MWSA 1E3UD 4WMCA 4QY6A 4KZBA 3ZG8B 1G6AA 2V1ZA 5BOHA 1N4OA 3LY3A 2Y2HA 4ZJ2A 3HUNA 4JXVA 3IWIA 3PAGA 4KQOA 1IKIA 1AXBA 3AGFA 4GD6A 4JKTA 4BLMA 1ONGA 2VGJA 1L2SA 1H8YA 2EX2A 3IH8A 3UE3A 2HDUA 5EE8A 5CECA 5AQAA 1LLBA 1YMXA 1YLTA 3ZNTA 5A92A 5EVIC 2ZM0A 4ID4A 4S2KA 1NRFA 4DDYA 2Y91A 4OPYA 4FD8A 3RXXA 4M3KA 4OLGA 5EVIA 4R23A 3VFFA 5J8XA 4N9LA 3FKVA 5I94A 3N6IA 4KZ4A 4UA6A 4B4XA 2RCXA 1LL9A 4JF6A 5FAOA 2ZM8A 4WEJA 3HUMA 2EXAA 5D3OA 3A3FA 3ZG9B 2XLNA 2ZD8A 2ZQDA 4RX2A 1NYMA 1XXMA 3NIAA 1NZUA 1WYBA 5EPHA 4GN2A 2JCHA 2UWXA 2WKIA 3SH8A 2Y4AA 4KG6A 1IYSA 3WWXA 3WS1A 1IEMA 1ES3A 4OH0A 4S2IA 2HDRA 1FSWA 2XFSA 3CJMA 3ZG0A 4ZBEA 3V3SA 1K25A 1PWGA 3SH7A 4FH2A 4WELA 3MKFA 4HESA 1PYYA 4N9KA 1QMFA 3Q82A 3OPRA 1BLPA 4OQ0A 3BFEA 2FFFB 3ZG5A 4X68A 1K4FA 3MBZA 1I2SA 5CRFA 1KDWA 2VGKA 2Y2IA 4OOLA 5GLDA 2JBFA 4LCMA 3RJUA 1PWDA 4K91A 1L0DA 3JYIA 4WZ4A 1SDEA 5CEDA 3UDIA 3BFGA 1IYQA 4JPMA 3UNWA 2ZMAA 5FQQA 4S2MA 4X56A 4UAAA 3ZHHA 1YLWA 1C3BA 1KDSA 3P09A 1K6RA 4Y0OA 1E25A 4ZDXA 1FR1A 3G34A 4E3OA 4KG5A 5EUAA 4H8RA 1DJBA 2I72A 3O87A 4CPKA 2WK0A 3G4PA 4C3QA 4PM5A 5GLAA 3GTCA 5CGWA 5A90A 3PBTA 4PM6A 2EFXA 4XUZA 1CI9A 5CGXA 3VP4A 4MEZA 3N8RA 5GL9A 4KZ7A 4S2PA 5DF7A 2Q9NA 4DF6A 4UHUA 1ES4A 2Y2PA 1BT5A 3Q07A 4KZ5A 1WYCA 1TVFA 4UA7A 3NI9A 3VSKA 2WGWB 2B5RA 3WRTA 3WRZA 1GA0A 1SDNA 4HBTA 2X02A 4E3KA 4R3JA 4DKIA 1GHIA 5DF9A 3A3IA 1YMSA 4U0TA 4WZ5C 4OPQA 5CHJA 3BYDA 1L0EA 1MWRA 3MXSA 4N1XA 4WYYA 4B88A 1MWUA 1KGGA 3DTMA 5TR7A 4WZ5A 2Z2MB 4DE3A 3B3XA 4P87A 2OLUA 2HDSA 1K4EA 2Y2LA 1PIOA 2OV5A 3BFDA 2J8YA 3IT9A 1BLCA 4S2OA 4DE1A 4C6YA 5FA7A 5CTNA 2WADA 4IBRA 2XFTA 1L0GA 3LO7A 2H0TA 5G18A 3EQUA 3C7VA 3ITAA 1HD8A 4KZ6A 4QJGA 3OCLA 5IHVA 1W7FA 3IH9A 1FCNA 4S2JA 1MXOA 5HARA 2JE5A 3MXRA 5HX9A 4NK3A 1XA1A 2QMIA 3C5AA 4KZ8A 3HREA 2Y2OA 1Z6FA 4GDBA 3O88A 5CERA 1ES2A 3QNBA 3VP3A 4GD8A 2WGWA 4WBGA 2ZC6B 1NJ4A 2ZQCA 4MBKA 2J9OA 1Y54A 3AGEA 3LCEA 1M6KA 1Q2PA 4IVIA 2BLSA 1NZOA 1G68A 2P9VB 3O86A 3BLMA 3MKEA 4NETA 1BLHA 2ZC5B 1I2WA 1FCOA 3WS5A 4DDSA 4O7DA 2WAEA 3E2KA 2XH9A 1XGIA 4OOMA 2WGVA 2HDQA 5DTSA 5EECA 4EBPA 1LI9A 4BENA 1ESUA 1MWTA 2H0YA 5FI7A 2XD1A 3ISGA 3ZGAB 1K56A 1ZC2A 4BQMA 5FQJA 4PM7A 4ZAMA 4QU3A 2P74A 2ZQ9A 3MZEA 3GR2A 4R3BA 1FCMA 1GHPA 1XPBA 2ZLYA 3ZDJA 4E6WA 2OSUA 2WUQA 3W4PA 3IXDA 3N4IA 3CZDA 1JTGA 3D4FA 2XR0A 2JC7A 4WEKA 1IYOA 4Z9QA 2WAFA 3S22A 1PWCA 4KQQA 2R9XA 3TSGA 5FSRA 3OPLA 3EQVA 3G2ZA 5U47A 3W4QA 5FAQA 4GKUA 4PM8A 4N92A 5FQMA 4DE2A 1VM1A 4R0QA 2P9VA 1WE4A 2Y2KA 1ERQA 1TDLA 2X01A 3MFDA 1K54C 1TEMA 1K55C 3VFHA 2ZC4B 4EBLA 1K56D 1RCJA 3UPOA 1K54A 4Y0UA 2IWDA 3V50A 3HL9A 3HLBA 4BL3A 1K55A 1ALQA 2ZQ7A 3WS0A 5HAIA 4OQGA 5F83A 1XA7A 4JF4A 2C5WB 4Q8IA 1W5DA 3IHBA 5CEBA 3MZFA 5GLBA 5HW3A 4X55A 1HVBA 1O7EA 3Q7ZA 3HLCA 5GHXA 3UPPA 1PW1A 5F1FA 3SH9A 4GDNA 4OP5A 2QZ6A 1LHYA 3VP0A 3HBRA 1S0WA 3PBOA 4JXSA 3M6BA 2XDMA 3OPHA 3PTEA 2XF3A 1JTDA 4OOYA 5M1AA 5DVAA 3SS4A 4YINA 3UDFA 3Q7VB 1JWZA 1E4DA 1PI5A 4K0XA 4RVAA 4LCLA 3NCKA 3V39A 1W8QA 4IVKA 2WYXA 4BD1A 1H5XA 1CI8A 2DNSA 3IF6B 1KVLA 3N7WA 3PBNA 5HAPA 1CEFA 3G35A 5FASA 3TG9A 2XGNA 4GB7A 4P85A 2C6WB 4EWFA 5F82A 5FQ9A 3IF5A 4OLDA 5FQKA 4OP8A 3P98A 2EX8A 1S6RA 4OPZA 3V3RA 1OMEA 1YLYA 3ZCZA 2WKHA 1PZOA 2PU4A 4N1HA 2Y2MA 5CXWA
chains in the Genus database with same CATH superfamily
4H9QB 3NDGA 5B1MA 4G3VA 5JA4B 3N3FA 4JGPA 4Z5TA 3C1CC 5DNNC 3MGSA 3HLGA 1KX3C 5G49B 4WU9D 4FOFA 1NY0A 4LPZA 1I5QA 5G4ZA 1V9YA 1KE0A 2WKPA 2ZY2A 1MKIA 1E6NA 3F1NA 1YQSA 5BT1D 3KXBA 3MGPA 1P3FA 3WTPC 1ERMA 4XXRA 3OC2A 2XQZA 5GT0B 2OLVA 4I39A 2DQNC 1BZAA 3K3DA 4FUWA 2W1TA 5HWVA 1IKGA 3PBSA 2PYOA 2ZM2A 1BULA 5KDMA 1P3KB 3VH6W 2ZC3B 2D02A 1CK3A 1K57A 1JNUA 4MLLA 1A0KA 1UGUA 1CEGA 5TJJA 3C7UA 3IHAA 3W98B 4X53A 3A3DA 1T3UA 3H7WA 1PI4A 1LSWA 5IT5A 4LRZE 1EQZB 3T4TA 1S67L 2PAVP 2FJ7A 3MQQA 4R4SA 2Y55A 4MNRA 4G3WA 5FAPA 4DMZA 4JLFA 4YM6A 2PDRA 2FZ0A 4J8XD 1W1PA 2OWHA 5B32D 3G31A 3M6HA 1W8YA 4GOGA 3AYWD 1SKFA 5CHMA 4WMCD 1OPXA 4H9NB 2F8NG 2G7UA 5A8BA 3X1SB 5M19A 1WWSA 1FOFA 1JWVA 1TD5A 1FR6A 3SS5A 4UA9A 5B1LB 1KVMA 3AZEA 3W98C 1P3GB 3AZJA 4WJ3C 5FQIA 4J8WA 3AZGA 1EQZC 5DJUA 5FATA 3WKJA 3T4KA 4CLCD 5AQ7A 3PR6A 5HSQA 5EVID 5GXQA 3IXGA 1DP9A 1KU5A 3PAEA 2Y2JA 5GT0D 4NFTA 3M7PA 5J4EA 3LZ1D 3B0CW 2QWSA 3ZG7B 1ZLAC 5E5AC 4U3TA 5CPJB 5AVCC 4OKPA 2LB9A 1P3KD 1P3AA 4PMAA 1CJFA 5FI6A 4IBBA 3S1YA 5B1LC 1MPLA 4C75A 3NBLA 5EVEA 2ZL1B 3HVFA 1L0FA 2W3HA 2M7UA 3V67A 4PPRA 1EQZD 2Q9MA 1XP4A 3WD2A 4DJ2A 3AZNA 4EV4A 5L8MA 4QWOA 3UMDA 3BWLA 2EA9A 1P3MB 5GLCA 3EWKA 2XEPA 2HP6A 1OJ5A 3SS3A 2VK3A 4NKPA 3VSLA 4LV1A 4J8UD 4X23A 1M18D 2OOLA 4K0WA 5E2GA 3NQJA 3X1SD 3A0VA 5HL6A 3S7NA 3LZ0A 1IOUA 5B33A 4E3NA 5B1LD 1YLZA 3MFXA 5DF8A 1RP5A 2V9AA 4WNNB 1P3GD 3LJAB 4P0MA 4FCFA 4NEED 3REIB 5E2FA 2Y59A 4CAYB 3HJIA 1NLZA 2ZJ9A 1U35C 1P3MC 2JKTM 3DW0A 3WS4A 4PAUA 3MQOA 1HTZA 5BS7C 5CPJD 1XJ6A 2JN7A 3D9YA 1G6AA 5BOHA 3LY3A 3QP1A 1BH9B 3HUNA 1X0OA 4KQOA 5AV8D 3F1PB 1ONGA 3IP4C 5HPFA 1L2SA 1Y4OA 5CECA 4XUJB 5AQAA 2K2NA 1YLTA 3LR5A 1OTIA 5JRGA 3ZNTA 4B93A 5AV6B 1TS7A 1NRFA 2Y91A 3AFAB 3UTBB 1E15A 3RXXA 3H0MC 3LELD 1P3OC 2R78A 3REIC 4GHIA 3VFFA 3FKVA 4KZ4A 4UA6A 2ZM8A 2W27A 2EXAA 2ZQDA 1KX5A 2VQRA 3F6TA 5HDDA 1WYBA 4GN2A 2JCHA 1KX4A 2WKIA 1NRJA 3WWXA 3MGRB 1IEMA 3AZFC 3BY9A 4WELA 3MKFA 4HESA 4N9KA 5FL3A 4G92B 1QMFA 3Q82A 3OPRA 4XUJC 1I2SA 5AV6C 5BNXB 3NULA 3LJAD 4GHAA 4IBJA 3AFAC 4JGQA 3UTBC 4EU0A 3EG5B 3REID 2F8NA 5FDSA 5CP6C 4LGWA 4H9OA 1IYQA 2CMNA 2K31A 2D01A 2ZMAA 4DJ3A 2F8NH 3S7QA 4UAAA 3P09A 2HIOA 1K6RA 4Y0OA 1CF0A 1FR1A 4ZDXA 1D1JA 3DTEA 2XROA 5EUAA 2I72A 3LEQA 4F3LA 1B67A 3G4PA 3GTCA 5A90A 4EEUA 3F1OA 2EFXA 4NZ3A 2NQBC 4Y15A 4G92C 4HMEA 3AZIC 4XUJD 4BBUA 5AV9D 4KQDA 1BH8A 5L10A 2J3TD 5AV6D 4HP4A 4DF6A 3B6GC 3AFAD 3UTBD 3Q07A 2CV5B 2PHYA 3NOPC 3WAAB 3LIFA 4E3KA 4K08A 3OOVA 4ZUXB 3IX8A 1AWIA 4WZ5C 3NECA 5DNMB 3IS2A 4OPQA 4CLCE 2BYKB 3MNND 3P5JB 4LFUA 3EPJA 1OJGA 3DTMA 3MGRD 3MJQA 4NE6A 2HDSA 3VH5A 3LIEA 1K4EA 4II7A 5FEGA 4Y5FA 4IBRA 3C1CA 4I3JA 5DNNA 2H0TA 1KX3A 3C7VA 4KZ6A 5IHVA 1XFNA 1FCNA 3TU4C 3IH9A 2QMIA 1MKMA 3HREA 3ICYA 4KZ8A 3WAAC 3IX3A 3NQUB 4KUDC 3RTYA 2NZDD 4YS3A 1CQAA 1P97A 4UUZA 3WTPA 4NE3A 2ZQCA 5DNMC 4MBKA 3C38A 3NOUC 3EPLA 4G91B 1P3IA 4IVIA 1G68A 5B2JA 1VHMA 3O86A 4WU8B 2VEAA 3MGSD 1BLHA 3EPKA 2ZC5B 1PFLA 3UB5P 2B02A 3WS5A 4O7DA 2XH9A 5DTSA 3W99B 3T1RA 4HMDA 2OAQ1 4GLQA 3A1IA 1ZC2A 1P3FD 3AV1B 2CV5D 3KSYA 3AZMA 3WAAD 4H9SC 3GR2A 3T1SA 1XPBA 2WUQA 2JKGA 3IXDA 3N4IA 1JTGA 2AROC 3REJB 4ZUXD 2XR0A 1P3LA 4WEKA 1P3PB 5DNMD 1PWCA 3G6OA 3OPLA 3G2ZA 3X1TC 4GKUA 4WU8C 1EW0A 1K54C 4NXGA 3UT9A 3W99C 3VFHA 4ARZA 4OJPA 2ZC4B 3BY8A 3UPOA 5BNVA 4KHAA 3T4SA 2KX6A 4Y0UA 2HJEA 1ULYA 3ULFA 3AV1C 3DTKA 2AVXA 5F83A 1XA7A 2JKRI 2C5WB 1YU0A 5F99A 4X55A 1HVBA 1P3PC 3H82A 1UWNX 1M1AA 3L2AA 4GDNA 4CSRB 1LHYA 1ZLAA 5E5AA 3LUQA 3PTEA 1F66B 1JTDA 5GT3B 5AVCA 1JWZA 4P6ZS 1P3BB 3AZJD 3W99D 3V39A 3LI9A 1H3OA 3AZGD 1FILA 3IF6B 1CI8A 4QLCA 5AVBA 3G35A 3AL0C 5FASA 5F82A 4LRXC 2JKFA 3LIDA 3W96B 3P98A 3C1BA 2EX8A 1OMEA 2B18A 1OGBA 2VV7A 5CXWA 1W1YA 3HONA 3REJD 4HJ4A 1P3PD 3MMHA 3VE3A 4XT2B 3RELB 3EPHA 2QJ5A 5FI2A 4BL2A 3L27A 1GA9A 5HL1A 1DY6A 1F66C 1N9BA 2P08A 3FYZA 3N8LA 3AZLA 4DE0A 3GMWA 5B0ZB 1P3BC 2BG1A 3VMAA 5KSCA 1CXWA 4HBUA 1HQ3B 1P34B 2FH5A 3B42A 2HPBA 1Y28A 3IF6C 3LYXA 2V20A 5CPKA 5HDCA 4P6BA 3K2NA 1PDCA 5C3IB 3MR0A 1ZHHB 2ZQ8A 4PM9A 3JPUA 3W96C 1UWPX 3DWZA 4MBHA 3IBJA 4HJ3A 5JYOA 1K6SA 3HLDA 5F68A 1P9RA 4WLAA 4GZBA 3BW6A 1YKDA 1E88A 3KFUG 2FFYA 3C4OA 4S2NA 1U35A 1P3MA 1YM1A 1MBLA 4X23D 2E8IA 2M7VA 4QD4A 2RVQD 4XZQB 4HGAB 2HV1A 3CPTA 2G5IC 5DFYA 1W79A 2CC1A 1M40A 5EOEA 5GT3D 3ZVTA 5B0ZC 1T1CA 4E3MA 4U0XA 1O07A 3CG5A 4QHCA 1ES5A 1HQ3C 4H9PB 1P34C 1TZYD 1GCEA 1FQGA 3IQAA 2IWCA 3VH6A 5C3IC 2V5OA 4LV0A 1ZG6A 4R8PC 4UQIS 1P0ZA 4H6JB 5EVLA 2KDKA 5KMWA 3W96D 5B40A 2B95A 2A2LA 5M18A 3A3JA 1KGFA 1P3OA 4Z66B 4JBFA 4IUKA 3RELD 3PXPA 5AQBA 2DCFA 3OPPA 1JVJA 3FPVA 1ZG4A 4XZQC 4HGAC 4OVDA 3RFBA 4ZRRA 2DRWA 4FSFA 2WZZA 5B0ZD 4HNBA 5AY8A 3AZFA 1L3LA 1P34D 3BFCA 1H8ZA 2W1RA 1EI5A 4LENA 2G2WA 2QPNA 3A3EA 3M2JA 4JF5A 3MF0A 1SHVA 3IXBA 3IWOA 3Q1FA 3UY6A 3UO9A 4LD9B 1V9ZA 1OTBA 3AGDA 3RXWA 1E8BA 5TGFA 5J7EA 4BJPA 5CP6A 3BQAA 5E43A 2XRNA 5DTTA 2IA2A 2EXBA 4HOIA 3NC8A 3C8CA 4XZQD 3REHB 1K38A 2ZC7A 1QMEA 3FC7A 3Q81A 3GRJA 1UR8A 5BT1C 3LY4A 1S32D 2IO5B 1TAFA 4JXGA 3UB8A 4UEYA 1GPFA 2JSSA 3FV7A 4S2LA 2Y2GA 4YFMA 2PU2A 2K7SA 2Z6DA 2NQBA 1N9OA 3AYWB 3AZIA 3B6FB 4RYEA 4Z2MG 1TDGA 2L5AA 1VEUA 2VLGA 3B6GA 3T1QB 1TS0A 1F1EA 3P01A 3WD1A 4Y0TA 1ONHA 3ZNYA 4Z66D 4HEFA 4L0LA 1PZRA 4Y13A 2HIOD 1YAXA 2EFUA 3TW8A 1BTLA 3REHC 5EM1A 4BBTA 3CUEA 3SOIA 4CLCB 1XJ3A 5EVIB 3N8SA 3IXHA 1YUEA 2E8JA 3LZ1B 3IX4A 4L9EA 2EX6A 2HUEB 2YFVA 2PBYA 4J8XC 4WM9A 5B32C 5CTMA 3AYWC 1NWZA 2QJ7A 3HLEA 1J9MA 2A3UA 5LBRA 3B6FC 2VV6A 3T4QA 5E2HA 4LD9D 1E3UD 2PR6A 5F69A 3V9RB 3TU4A 1T18A 2V1ZA 5HPIA 3KSHA 2PD8A 3X1VB 4GD6A 4KUDA 3T50A 1H8YA 3H9WA 3IH8A 3REHD 2HDUA 4CLCC 5A92A 5EVIC 2ZM0A 1N1JB 4KGCB 5GT0C 3LZ1C 2WKQA 2PT7A 3WA9A 3N6IA 1ED7A 4B4XA 4WZSB 1LL9A 1VB6A 4JF6A 3R4KA 4IUHA 1YU3A 4J8UB 3HUMA 1M18B 1P3KC 3B6FD 3A3FA 2PYPA 2XLNA 3S7PA 3MGQB 1NZUA 2PRFA 5AV5B 3SH8A 2Y4AA 4KG6A 1IYSA 2BYMB 1ID3A 4OH0A 3X1VC 2HDRA 2XFSA 3CJMA 3ZG0A 4ZBEA 2PR5A 3SH7A 2CWEA 1PYYA 2AROA 1T1AA 4OQ0A 2VV8A 4NXFA 3UE6A 3ZG5A 3MBZA 3KS8A 3KUYA 4KGCC 2VGKA 3X1TA 3REKA 4OOLA 1E6PA 5GLDA 4WU8A 4JJNB 3CITA 4K91A 4WZ4A 5CEDA 5I5LA 2J3WA 3BFGA 1TS6A 4Y2FA 3UNWA 4J8UC 4S2MA 1M18C 2GZAA 4NZ5A 5B0YA 5AV8B 3X1SC 3AZKA 1C3BA 5AV5C 1E25A 2KLIA 1YU4A 4H8RA 3X1VD 1DJBA 1S4RA 1P3GC 3CAXA 4ETXA 4HMCA 3LIAA 5GLAA 5CGWA 3PBTA 3LELB 4XUZA 1CI9A 5CGXA 3VP4A 3BJNA 4AWLB 4KZ7A 2Q9NA 4KGCD 3T4OA 5TBMB 3U2AA 1ES4A 1BT5A 4JJNC 3GDIA 2H28A 5HWTA 5CPJC 1H0MA 1ODVA 3VSKA 3WRZA 1GA0A 4HBTA 3KSIA 3T4JA 5B31B 4H9RA 1SKOB 3W97B 1GHIA 5AV8C 3A3IA 1YMSA 4U0TA 3MGQD 3AN2A 5F99D 1S1YA 4WYYA 1L0EA 1MWRA 5IU1A 5AV5D 5TR7A 1M19A 2Z2MB 3B0DB 2HGVA 4P87A 3AZHA 2ZMFA 2W3GA 1BFMA 1PIOA 2OV5A 3BFDA 3IT9A 1OGGA 4S2OA 3LELC 4C6YA 2P04A 5CTNA 5B24A 2WADA 1ZTUA 4AWLC 5B2IB 5B32G 2XFTA 5G18A 4CSRA 3ITAA 1AOIA 4Z2MH 4QJGA 4JJND 1W7FA 5HARA 5HX9A 2MJ6A 4LRYC 4NK3A 1XA1A 3C5AA 5GSUA 1MZUA 2Y2OA 4NZ4A 1P3BA 5B31C 3VP3A 2WGWA 2ZC6B 4IBDA 2J9OA 2GX5A 3IBRA 3O62B 3AGEA 3B0DC 5AV9B 2P9VB 4DQYB 3MKEA 4NETA 3LJAC 1I2WA 4EETB 1FCOA 3MVDB 2WAEA 1XJ2A 2WGVA 2HDQA 5EECA 3KSGA 4BENA 3AZLD 1OT9A 2A24B 4R6LA 5B2IC 3ISGA 5F6AA 3ZGAB 1TS8A 5BO0A 4IBFA 4BQMA 2XA7S 5FQJA 4QU3A 3MNNB 5J3WA 1FCMA 4EQIA 3KS4A 5B31D 3W97D 2O9CA 3A6NA 4Z9QA 4AFIA 1HTAA 4NYUA 2D49A 2ZOHA 2R9XA 5FSRA 4R8PA 4J8VA 3UTAB 3NOTC 5U47A 3O62C 4ESPA 5AV9C 2VX8A 4DE2A 2J3TC 5CPIA 3MSHA 3R45B 2Y2KA 4WF0A 2M1CA 3MVDC 3AV2B 1K56D 5B2ID 1W1TA 1K55A 1VETA 1ALQA 2JKRM 1Q9CA 2NZDB 3WS0A 1OTAA 2BTFP 4KUKA 3MNNC 2V0WA 4Q8IA 1W5DA 3L29A 3MGRC 5B1MB 5HW3A 4Z5TB 3MGSB 5FEFA 4IHQA 2HJ9C 1YSPA 3SH9A 3O62D 4OP5A 1TF1A 3PBOA 3M6BA 3F1NB 5M1AA 3UDFA 4YINA 4ME4A 3KXBB 1P3FB 3MGPB 3MVDD 4WU9A 4LCLA 4IVKA 4GS9A 4BD1A 1H5XA 3KWQA 1CEFA 3R7WA 1G28A 3LGOA 2W1TB 2NZDC 4EWFA 1F2KA 3X1UA 2PYOB 4OP8A 5KDMB 1S6RA 4OPZA 4HQAA 4N1HA 2Y2MA 4EUZA 5A93A 3GECA 4Z5TC 3MGSC 2XK1A 5AVFA 2J9PA 1KS0A 2Q0OA 3UTAD 1G5UA 3H7WB 3CLOA 4CJNA 3GQZA 4KZ9A 2HP9A 3KXBC 3MGPC 1P3FC 2FJ7B 3UDXA 2CV5C 3AV2D 1XFQA 3S4XA 3UE0A 3Q7VA 5HZHA 5FUGA 5B31G 4PKYG 3V5MA 4YM6B 4LV2A 2V1AA 4ZUXC 4P6ZM 2PYOC 3WD3A 5GHZA 3VOZA 5CHUA 3KYEA 3VV4A 1JFIA 5B1MD 3H0RC 4Z5TD 2YFWA 4J8XA 3LEZA 5B32A 1IYPA 5KSHA 3AYWA 1IELA 3PBQA 3AZEB 2L4RA 3AZJB 4H9QA 1OT6A 4J8WB 4Y7PA 1LSVA 4EBNA 3AZGB 4E04A 5JA4A 3SZTA 3WKJB 5G49A 3UPNA 5GHYA 4BD0A 3KXBD 3MGPD 2INWA 2O9AA 1Q2QA 3B33A 4DXCA 1F5MA 3FKEA 2XD5A 4KZ3A 2Y2NA 3KO6A 2NUPC 3CHWP 2PYOD 2H5SA 1L6JA 3ZQ5A 5GT0A 4E3LA 2ACGA 3GVBA 2RL3A 1P3AB 4G91C 3D3OA 1YLJA 5E2EA 1PZPA 2ZBBA 4WL9A 3AZEC 1P3KA 3AZJC 4Q0HA 3AZGC 3WKJC 3AZNB 1ZKJA 5JYPA 3QP2A 2FJ7D 4GHLA 3NJAA 3W98A 4E3JA 1BSGA 1NXYA 1D7EA 3HUOA 4KUOA 1EQZA 4ZBJB 1XKZA 2H10A 5A91A 4O0PA 4YM6D 3VOYA 1SZVA 3GV9A 4IJFA 3REJC 3G2YA 4MN7A 5G4YA 4RA7A 4X23B 4B4ZA 3NQJB 3WS2A 3LZ0B 4IEDA 5B33B 4OONA 4UQIM 1EROA 2X71A 4M4XA 2VA0A 1R4VA 5F1GA 1BLSA 2V1BA 4M6BA 3AZED 4H9NA 2GDNA 4QY5A 4OPRA 3X1SA 3TE8A 4J8WD 4DRTA 1TZYB 3PBRA 4E6XA 3WKJD 2PBDP 5B1LA 2WGIA 3CI6A 3IWQA 4X6TA 5GXQD 1P3GA 5KZHA 4UPKA 4ZBJC 3VP1A 1LL8A 3U4LP 2J8PA 4X23C 2WKEA 1LT0A 3ZFZA 1P3AD 2RVQC 4FH4A 3UE1A 3LZ0C 3UN7A 3TOIA 4I3IA 1DJCA 5CPJA 3W4OA 4MB4A 3FKWA 3VP2A 5GT3C 5L2FA 1U60A 4QPRA 5JRGB 5DTKA 1TZYC 3OCNA 4MB3A 3AZND 3A0RA 4GHIB 1RGYA 1YPRA 2ZL1A 1VQQA 4R38A 1RGZA 1LI0A 2ZQAA 2QKPA 4Z1WA 3BM6A 1KX5B 4DXBA 2EX9A 2Y2QA 1E6ZA 1KX4B 3CWFA 5EOOA 2JHEA 3RELC 1MWSA 3E4QA 4QY6A 3ZG8B 3LZ0D 1N4OA 2I9VA 3AN2D 4JXVA 5BS7A 3IWIA 1XJ4A 5B33D 1S32B 1AXBA 3AGFA 4PKYA 2EX2A 5JRGC 3AZHD 5BPVA 3UE3A 1LLBA 1YMXA 2ZMVA 5MC7A 2VJWA 2F8NB 3PHYA 4DDYA 4NG2A 4H9OB 4WNNA 4EERA 3W2ZA 3LJAA 3PYPA 3HCYA 1PRQA 2RCXA 3REIA 1KX5C 5FAOA 4WEJA 4CAYA 5GSUD 4MN5A 2HIOB 3ZG9B 5EV0A 4RX2A 1NYMA 3NIAA 2O99A 2UWXA 4F3LB 1H8PA 4BMWA 4R3AA 1T1BA 3WS1A 2IOUA 1FSWA 1S32C 3F1OB 5DJTA 3V3SA 1D06A 1BH9A 4Z2IA 2F8NK 3LI8A 1BH8B 5JRGD 5CHLB 3F1PA 4BWIA 3BFEA 1K4FA 2DMWA 4EESA 4HY8A 5CRFA 4OJOA 1KDWA 2Y2IA 1N9LA 4XUJA 4LCMA 1PWDA 4O01A 5AV6A 3JYIA 1SDEA 3AFAA 3UTBA 4X1LA 1KX5D 5FQQA 3IS2B 4YNRA 4Z66C 2G5HC 5CX7A 1KX4D 2HIOC 3S7OA 2YKFA 1K0KA 5AVEA 1KDSA 3A6ND 4DRBA 4KG5A 2P7JA 2ZY5A 4J8VD 4CPKA 2WK0A 4C3QA 3MGRA 4PM6A 3C1CB 5DNNB 5CPID 1KX3B 4MEZA 3N8RA 5GL9A 2F8ND 2L1MA 4KZ5A 5BNXA 1A7WA 4LD9C 4YS3B 4UUZB 3WTPB 1H3QA 1SDNA 1W63M 2OAP1 4GW9A 5DF9A 1P3IB 5CHJA 5EM0A 5B2JB 4B88A 2NZDA 1IFQA 1MWUA 4WZ5A 2OLUA 2IO5C 4TX8A 1T19A 1H0GA 4E45A 4EO5B 2Y79A 1L0GA 3AZMB 3E4PA 3EQUA 3EGXC 3WD0A 3OCLA 4S2JA 1MXOA 1S4SA 3MXRA 3KWQD 1BYWA 1STZA 1Z2CB 5L07A 4YS3C 1P3LB 2CV5A 3X1UD 3E0YA 3O88A 5CERA 3QNBA 2V8CA 3WAAA 5DFXA 4GD8A 2YKHA 1J7MA 1P3IC 1NJ4A 5B2JC 1F98A 4ZUXA 1NLYA 2OWJA 5DNMA 2BYKA 3ZYTA 3WD4A 3UT9B 4ARZB 3O5YA 5BNVB 4KHAB 2W3DA 4DDSA 3C1CD 4OOMA 5DNND 1XGIA 2FN2A 2HUEC 1KX3D 4EO5C 2XSSA 1MWTA 2H0YA 5FI7A 2XD1A 4HH2A 3AZMC 3UB7A 3T1XA 3HSHA 5F99B 1PNEA 2P74A 4YS3D 3D72A 1P3LC 3WTPD 3BQ8A 4NXEA 4E6WA 1GHPA 3H82B 3ZDJA 2OSUA 3W4PA 1M1AB 4OJ6A 3D4FA 4IBCA 4H9SA 3NQUA 1IYOA 1P3ID 2VGLS 4Q0IA 4EW7A 1ZLAB 5E5AB 5B2JD 4DRAA 3W4QA 5FAQA 3JVUA 4PM8A 4N92A 5AVCB 3UT9C 2X01A 1ERQA 1H3OB 3MFDA 4QLCB 5AVBB 1K54A 3V50A 2IWDA 4Z2HA 3AZMD 3HL9A 3LFVA 3W99A 4BL3A 3C1BB 5HAIA 3MGQC 5F99C 4JF4A 4DN0A 2ZOIA 1P3LD 3AV1A 1P9WA 1M1AC 3IHBA 3MZFA 5GLBA 5GHXA 2XA7M 5F1FA 3REJA 3JVVA 1P3PA 3VP0A 1S0WA 3AZLB 2XDMA 3OPHA 4NE5A 3UT9D 2XF3A 1G6OA 3SS4A 4RQ9A 4QLCC 5CPKB 5AVBC 1PI5A 4EEPA 4K0XA 3NCKA 4O8GA 3VOLA 2WYXA 3N7WA 3PBNA 1KVLA 4R70A 3W98D 5HAPA 3C1BC 3TG9A 2XGNA 4P85A 2C6WB 5FQ9A 5FQKA 4OLDA 4LG2A 3ZCZA 1PZOA 2PU4A 1U35B 1M1AD 4MN6A 1UR9A 1JWPA 1KOUA 3KX0X 1W63Q 4I3AA 1ZLAD 5E5AD 1OTEA 3CPTB 5DKKA 5CGSA 4MMNA 3AZLC 5AVCD 2A49A 4MDZA 1SCWA 4ZTKA 4QLCD 5CPKC 5AVBD 1F66A 5AJGA 1OTDA 3TJZC 5GT3A 3C4PA 3W8KA 5B40B 3C1BD 1NYYA 1TZYA 3W97C 4FTXA 3IF6A 2EWWA 3MZDA 2G2UA 1P3OB 4NZ1A 3LR4A 3OZHA 1FIKA 4S2NC 3W96A 4LV3A 3HLFA 3NDEA 1MC0A 2WZXA 2ZY4A 3FPWA 3ITBA 3ZVWA 4XT2A 3RELA 4X69A 3I7JA 4KG2A 5AY8B 4L9GA 4ZJ3A 3AZFB 1O6IA 2IWBA 4D2OA 2EWVA 1HZOA 5CPKD 4GJ4A 3FWLA 3DWKA 1XGJA 2R9WA 4KQRA 5B0ZA 2Z2LB 3BRMA 4PHTA 1HQ3A 4A5RA 5B40C 1P34A 4IBXA 5HFOA 4RX3A 3HLWA 5CP6B 1U35D 1P3MD 5C5KA 1FSYA 4HHDA 5TFQA 1KE4A 4KZAA 4L9FA 3WX7A 1KE3A 2BASA 1DJAA 3M2KA 1TAFB 3L9KA 3E98A 5AY8C 4XZQA 3OLOA 1QO6A 2DF4C 1S32A 2NQBB 4EUVA 3QHYA 3AZIB 3B0BA 4JXWA 1EWZA 4E3IA 4H9PA 1VEUB 5B40D 3B6GB 5FDHA 2V2FF 4F94A 1P3OD 4WUJA 3BECA 1YT4A 3QNCA 2Z6CA 1YLPA 3UTAC 4EQ1A 4H6JA 3MQ0A 3B47A 4MB5A 1BUEA 5AQ9A 2HP5A 1LSXA 3EGDC 3G32A 3E2LA 3FZCA 2L0WA 4Z66A 4ZJ1A 3AV2C 3WTPE 4LLOB 4GH9A 5AY8D 1PW8A 3AZFD 1MY8A 2V0UA 2YFVB 3VH5T 4MBFA 4IBIA 4BBVA 4XUXA 1H8MA 2F2AC 4OQIA 3GSGA 3MXQA 5B1MC 1W2EA 4Y3IA 4R4RA 2KOIA 1EAKA 3G30A 1DRMA 3TU4B 2V8FA 3BEBA 5CP6D 4IBEA 2LY8A 3NY4A 4KUDB 4LD9A 1E3UA 1GHMA 4D60A 1LL5A 4R1GA 1DP8A 3CUEC 3CMZA 1AIWA 2W3FA 2WKRA 2J80A 3LR0A 1ESIA 1XX2A 4QB8A 3REHA 3O3VA 3WA9B 4YOFA 4GNUA 4Q0JA 2NQBD 3BLSA 3AZID 3EEAA 2J7VA 4KENB 2W3EA 4OJLA 1K57C 3B6GD 4OQHA 5HAQA 4OUIA 2O0YA 1KGEA 3BFFA 2JKTI 1ID3B 4WMCA 3B6FA 3L7HA 4KZBA 2Y2HA 4ZJ2A 2ZY3A 3PAGA 2AROB 2W8SA 1IKIA 4JKTA 4BLMA 2VGJA 2RIQA 4E44A 2FJ7C 2W0NA 5GXQB 3KUYB 5EE8A 4MCWA 3X1TB 3REKB 1GSVA 4HI4A 1HLUP 4ID4A 4YM6C 1GXDA 3WA9C 4S2KA 4CLCA 4IBKA 4OPYA 4FD8A 4M3KA 4OLGA 5EVIA 4R23A 5J8XA 4NYYA 3LIBA 4N9LA 5I94A 5HD3A 2VKSA 5B0YB 3LZ1A 2GJ3A 1GSWA 3AZKB 2LB5A 1WA9A 3SW1A 5D3OA 3TU4D 2ZD8A 3NHQA 3EOIA 1XXMA 4GCZA 3MQLA 1ID3C 4B9OA 5EPHA 4KUDD 4J8WC 2O9BA 4I5SA 1DP6A 1ES3A 4S2IA 4JGOA 3V9RA 1W1VA 2ZM5A 3P7NA 1K25A 1PWGA 1B6WA 4FH2A 4NXBA 2Y8HA 3X1VA 5GXQC 3KUYC 3E4OA 3REKC 1BLPA 3HJKA 2FFFB 4X68A 3QP8A 5IS1A 3WA9D 3KSFA 2JBFA 4HH3A 3RJUA 3L28A 1N1JA 4KGCA 1L0DA 4H9RB 3UDIA 4IJGA 5B0YC 1P3AC 2HZ5A 4JPMA 3AZKC 3AN2B 4X1MA 4Y17A 4X56A 3ZHHA 1M19B 4J8UA 1YLWA 1M18A 1ID3D 2PD7A 3AZHB 3DAVA 3MGQA 3G34A 4E3OA 2AROD 5HDSA 3AZNC 5AV5A 3O87A 5B24B 2BYMA 3H0LC 4PM5A 4I38A 1GSXA 3KUYD 3T12B 3X1TD 3REKD 1AOIB 4WU8D 2VZWA 4S2PA 5DF7A 4UHUA 3VH5W 2Y2PA 5GSUB 1WYCA 1TVFA 4IJEA 4HIAA 4UA7A 3NI9A 5B0YD 4JJNA 2B5RA 2WGWB 3L26A 3WRTA 2X02A 3AZKD 3AN2C 1J3WA 4R3JA 4DKIA 4CQHA 5B33C 4JGRA 3AV1D 3A1KA 1M19C 3KYQA 3BYDA 4N1XA 3MXSA 3AZHC 5AV8A 1KGGA 4DE3A 2GNXA 3RH8B 3B3XA 3DTIA 5B24C 2Y2LA 5KIZA 2HF6A 2J8YA 1BLCA 4OJ5A 4DE1A 4WV4B 5FA7A 1AOIC 3C30A 3UMEA 3LELA 5BO0B 3LO7A 1S66L 3VE4A 1HD8A 1N9NA 5GSUC 3QP5A 5HD5A 2JE5A 5TBMA 3A6NB 1Z6FA 4NY2A 1ACFA 4GDBA 1ES2A 3EEHA 4QNLA 4R8PB 4J8VB 3VH6T 4Z2JA 4WBGA 1M19D 2QYBA 5B31A 5EFWA 1SKOA 3W97A 3QP4A 1YSQA 4IBGA 1Y54A 3LCEA 5CPIB 1M6KA 1Q2PA 4ETZA 2BLSA 1NZOA 3OBFA 3BLMA 3UB6A 5B24D 3LICA 5DKLA 3E2KA 4EBPA 1VETB 1AOID 1LI9A 1Z09A 1ESUA 1H0IA 2NUTC 1WWIA 3A0SA 4Z2KA 3T4LA 4HP9A 1F66D 1S1ZA 3MS6A 3LR3A 1K56A 1KX4C 3K3CA 5B2IA 1P3BD 3L25A 4PM7A 4ZAMA 5K5BA 2ZQ9A 3MZEA 4R3BA 5F5YA 3A6NC 1CK7A 2ZLYA 4WN5A 3CZDA 4G3KA 4J8VC 2JC7A 2WAFA 3S22A 4KQQA 3TSGA 3EQVA 3TRCA 5CPIC 5FQMA 3DBAA 4EXOA 4WU9B 3O62A 1VM1A 4R0QA 5AV9A 1WE4A 2P9VA 1TDLA 4Z2LA 4GS9B 1TEMA 1K55C 3KWQB 3R7WB 4EBLA 1RCJA 3MVDA 3HLBA 3X1UB 4Z2GA 2A24A 2ZQ7A 1YU2A 4OQGA 3B0CT 1YU1A 1HQ3D 5L09A 3FDDA 5CEBA 3FG8A 3MNNA 1E6RA 4YWZA 4R8PD 3QP6A 1O7EA 3Q7ZA 3HLCA 2UV0E 4X25A 3UPPA 1PW1A 2RTSA 2QZ6A 2QHKA 3HBRA 4JXSA 1GOIA 3UTAA 4WU9C 2PYRA 4OOYA 5DVAA 2VGLM 3Q7VB 1E4DA 5FUGB 4RVAA 3KWQC 3C2WA 1W8QA 3R45A 5HWWA 2DNSA 3X1UC 3AV2A 1F9IA 4GB7A 4HJ6A 3IF5A 3UB9A 1JFIB 3V3RA 1YLYA 2YFWB 4J8XB 5B32B 2WKHA 3KYZA
chains in the Genus database with same CATH topology
4H9QB 3NDGA 5B1MA 5JA4B 3N3FA 4Z5TA 3C1CC 5DNNC 3MGSA 3HLGA 1KX3C 5G49B 4WU9D 1NY0A 1I5QA 1KE0A 2ZY2A 1MKIA 1YQSA 5BT1D 3KXBA 3MGPA 1P3FA 3WTPC 1ERMA 4XXRA 3OC2A 2XQZA 5GT0B 2OLVA 2DQNC 1BZAA 1IKGA 3PBSA 2PYOA 2ZM2A 1BULA 5KDMA 1P3KB 3VH6W 2ZC3B 1CK3A 1K57A 4MLLA 1CEGA 3C7UA 3IHAA 3W98B 4X53A 3A3DA 1T3UA 1PI4A 1EQZB 2FJ7A 4R4SA 2Y55A 4MNRA 5FAPA 4JLFA 4YM6A 4J8XD 3M6HA 5B32D 3G31A 1W8YA 4GOGA 3AYWD 1SKFA 5CHMA 4WMCD 4H9NB 2F8NG 3X1SB 5M19A 1WWSA 1FOFA 1JWVA 1FR6A 3SS5A 4UA9A 5B1LB 1KVMA 3AZEA 3W98C 1P3GB 3AZJA 4WJ3C 5FQIA 4J8WA 3AZGA 1EQZC 5FATA 3WKJA 5AQ7A 5EVID 5GXQA 3IXGA 1KU5A 3PAEA 2Y2JA 5GT0D 4NFTA 3LZ1D 3B0CW 3ZG7B 1ZLAC 5E5AC 4U3TA 5CPJB 5AVCC 4OKPA 1P3KD 1P3AA 4PMAA 5FI6A 4IBBA 3S1YA 5B1LC 1MPLA 4C75A 3NBLA 3HVFA 1L0FA 4PPRA 1EQZD 2Q9MA 1XP4A 3AZNA 4EV4A 1P3MB 5GLCA 2XEPA 2HP6A 3SS3A 3VSLA 4LV1A 4J8UD 4X23A 1M18D 4K0WA 5E2GA 3NQJA 3X1SD 3LZ0A 5B33A 4E3NA 5B1LD 1YLZA 5DF8A 1RP5A 4WNNB 1P3GD 3LJAB 4P0MA 4FCFA 3REIB 5E2FA 2Y59A 4CAYB 2ZJ9A 1U35C 1P3MC 3DW0A 3WS4A 1HTZA 5BS7C 5CPJD 1G6AA 5BOHA 3LY3A 1BH9B 3HUNA 4KQOA 5AV8D 1ONGA 3IP4C 1L2SA 5CECA 4XUJB 5AQAA 1YLTA 3ZNTA 5JRGA 5AV6B 1NRFA 2Y91A 3AFAB 3UTBB 3RXXA 3H0MC 3LELD 1P3OC 3VFFA 3REIC 3FKVA 4KZ4A 4UA6A 2ZM8A 2EXAA 2ZQDA 1KX5A 2VQRA 3F6TA 1WYBA 4GN2A 2JCHA 1KX4A 2WKIA 3WWXA 3MGRB 1IEMA 3AZFC 4WELA 3MKFA 4HESA 4N9KA 4G92B 1QMFA 3Q82A 3OPRA 4XUJC 1I2SA 5AV6C 5BNXB 3LJAD 4GHAA 4IBJA 3AFAC 3UTBC 3EG5B 3REID 2F8NA 5CP6C 4H9OA 1IYQA 2ZMAA 2F8NH 4UAAA 3P09A 2HIOA 1K6RA 4Y0OA 4ZDXA 1FR1A 5EUAA 2I72A 1B67A 3G4PA 3GTCA 5A90A 4NZ3A 2NQBC 2EFXA 4G92C 3AZIC 4XUJD 5AV9D 1BH8A 5AV6D 4DF6A 3B6GC 3AFAD 3UTBD 3Q07A 2CV5B 3WAAB 4E3KA 4ZUXB 4WZ5C 5DNMB 4OPQA 2BYKB 3MNND 3P5JB 3EPJA 3DTMA 3MGRD 4NE6A 2HDSA 3VH5A 1K4EA 4IBRA 3C1CA 5DNNA 2H0TA 1KX3A 3C7VA 4KZ6A 5IHVA 3IH9A 1FCNA 3TU4C 2QMIA 4KZ8A 3HREA 3WAAC 3NQUB 4KUDC 2NZDD 4YS3A 4UUZA 3WTPA 4NE3A 2ZQCA 5DNMC 4MBKA 3EPLA 4G91B 1P3IA 4IVIA 1G68A 5B2JA 3O86A 4WU8B 3MGSD 1BLHA 3EPKA 2ZC5B 3WS5A 4O7DA 2XH9A 5DTSA 3W99B 3A1IA 1ZC2A 1P3FD 3AV1B 2CV5D 3KSYA 3AZMA 3WAAD 4H9SC 3GR2A 1XPBA 2WUQA 3IXDA 3N4IA 1JTGA 2AROC 3REJB 4ZUXD 2XR0A 1P3LA 4WEKA 1P3PB 5DNMD 1PWCA 3OPLA 3G2ZA 3X1TC 4GKUA 4WU8C 1K54C 3UT9A 3W99C 3VFHA 4OJPA 2ZC4B 3UPOA 5BNVA 4KHAA 4Y0UA 1ULYA 3AV1C 5F83A 1XA7A 2C5WB 1YU0A 5F99A 4X55A 1HVBA 1P3PC 1M1AA 3L2AA 4GDNA 4CSRB 1LHYA 1ZLAA 5E5AA 3PTEA 1F66B 1JTDA 5GT3B 5AVCA 1JWZA 1P3BB 3AZJD 3W99D 3V39A 1H3OA 3AZGD 3IF6B 1CI8A 4QLCA 5AVBA 3G35A 3AL0C 5FASA 5F82A 3W96B 3P98A 3C1BA 2EX8A 1OMEA 5CXWA 3HONA 3REJD 1P3PD 3RELB 3EPHA 5FI2A 4BL2A 3L27A 1GA9A 5HL1A 1DY6A 1F66C 1N9BA 3FYZA 3N8LA 3AZLA 4DE0A 3GMWA 5B0ZB 1P3BC 2BG1A 3VMAA 5KSCA 4HBUA 1HQ3B 1P34B 2HPBA 3IF6C 2V20A 5CPKA 4P6BA 5C3IB 2ZQ8A 4PM9A 4MBHA 3W96C 3DWZA 5JYOA 1K6SA 3HLDA 4GZBA 3KFUG 2FFYA 3C4OA 4S2NA 1U35A 1P3MA 1YM1A 1MBLA 4X23D 2E8IA 4QD4A 2RVQD 4XZQB 4HGAB 2G5IC 1W79A 2CC1A 1M40A 5EOEA 5GT3D 3ZVTA 5B0ZC 4E3MA 4U0XA 1O07A 3CG5A 4QHCA 1ES5A 1HQ3C 4H9PB 1P34C 1TZYD 1GCEA 1FQGA 3IQAA 2IWCA 3VH6A 5C3IC 4LV0A 1ZG6A 4R8PC 5EVLA 5KMWA 3W96D 5B40A 5M18A 3A3JA 1KGFA 1P3OA 4Z66B 4JBFA 3RELD 5AQBA 2DCFA 3OPPA 1JVJA 1ZG4A 4XZQC 4HGAC 4OVDA 2DRWA 4FSFA 2WZZA 5B0ZD 5AY8A 3AZFA 1P34D 3BFCA 1H8ZA 1EI5A 4LENA 2G2WA 2QPNA 3A3EA 3M2JA 4JF5A 1SHVA 3IXBA 3IWOA 3Q1FA 3UY6A 3UO9A 4LD9B 3AGDA 3RXWA 5TGFA 4BJPA 5CP6A 5E43A 5DTTA 2EXBA 3NC8A 4XZQD 3REHB 1K38A 2ZC7A 1QMEA 3Q81A 3GRJA 5BT1C 3LY4A 1S32D 2IO5B 1TAFA 4JXGA 2JSSA 3FV7A 4S2LA 2Y2GA 4YFMA 2PU2A 2NQBA 3AYWB 3AZIA 3B6FB 4RYEA 4Z2MG 1TDGA 2L5AA 3B6GA 1F1EA 4Y0TA 1ONHA 3ZNYA 4Z66D 4HEFA 4L0LA 1PZRA 2HIOD 2EFUA 1BTLA 3REHC 3SOIA 5EVIB 3N8SA 3IXHA 1YUEA 3LZ1B 2EX6A 2HUEB 2YFVA 2PBYA 4J8XC 4WM9A 5B32C 5CTMA 3AYWC 3HLEA 1J9MA 2A3UA 3B6FC 5E2HA 4LD9D 1E3UD 3V9RB 3TU4A 2V1ZA 3X1VB 4GD6A 4KUDA 1H8YA 3IH8A 3REHD 2HDUA 5A92A 5EVIC 2ZM0A 1N1JB 4KGCB 5GT0C 3LZ1C 3WA9A 3N6IA 4B4XA 4WZSB 1LL9A 4JF6A 1YU3A 4J8UB 3HUMA 1M18B 1P3KC 3B6FD 3A3FA 2XLNA 3MGQB 1NZUA 5AV5B 3SH8A 2Y4AA 4KG6A 1IYSA 2BYMB 1ID3A 4OH0A 3X1VC 2HDRA 2XFSA 3CJMA 3ZG0A 4ZBEA 3SH7A 2CWEA 1PYYA 2AROA 4OQ0A 3ZG5A 3MBZA 3KS8A 3KUYA 2VGKA 4KGCC 3X1TA 3REKA 4OOLA 5GLDA 4WU8A 4JJNB 4K91A 4WZ4A 5CEDA 3BFGA 3UNWA 4J8UC 4S2MA 1M18C 4NZ5A 5B0YA 5AV8B 3X1SC 3AZKA 1C3BA 5AV5C 1E25A 1YU4A 4H8RA 3X1VD 1DJBA 1P3GC 5GLAA 5CGWA 3PBTA 3LELB 4XUZA 1CI9A 5CGXA 3VP4A 4AWLB 4KZ7A 2Q9NA 4KGCD 1ES4A 1BT5A 4JJNC 5CPJC 3VSKA 3WRZA 1GA0A 4HBTA 5B31B 4H9RA 3W97B 1GHIA 5AV8C 3A3IA 1YMSA 4U0TA 3MGQD 3AN2A 5F99D 4WYYA 1L0EA 1MWRA 5AV5D 5TR7A 1M19A 2Z2MB 3B0DB 4P87A 3AZHA 1BFMA 1PIOA 2OV5A 3BFDA 3IT9A 4S2OA 3LELC 4C6YA 5CTNA 5B24A 2WADA 4AWLC 5B2IB 5B32G 2XFTA 5G18A 4CSRA 3ITAA 1AOIA 4Z2MH 4QJGA 4JJND 1W7FA 5HARA 5HX9A 4NK3A 1XA1A 3C5AA 5GSUA 2Y2OA 4NZ4A 1P3BA 5B31C 3VP3A 2WGWA 2ZC6B 4IBDA 2J9OA 3AGEA 3O62B 3B0DC 5AV9B 2P9VB 4DQYB 3MKEA 4NETA 3LJAC 1I2WA 1FCOA 3MVDB 2WAEA 2WGVA 2HDQA 5EECA 4BENA 3AZLD 5B2IC 3ISGA 3ZGAB 5BO0A 4IBFA 4BQMA 5FQJA 4QU3A 3MNNB 1FCMA 4EQIA 3KS4A 5B31D 3W97D 3A6NA 4Z9QA 1HTAA 4NYUA 2R9XA 5FSRA 4R8PA 4J8VA 3UTAB 5U47A 3O62C 5AV9C 4DE2A 5CPIA 3R45B 2Y2KA 3MVDC 3AV2B 1K56D 5B2ID 1K55A 1ALQA 1Q9CA 2NZDB 3WS0A 3MNNC 4Q8IA 1W5DA 3L29A 3MGRC 5B1MB 5HW3A 4Z5TB 3MGSB 3SH9A 3O62D 4OP5A 3PBOA 3M6BA 5M1AA 3UDFA 4YINA 3KXBB 1P3FB 3MGPB 3MVDD 4WU9A 4LCLA 4IVKA 4BD1A 1H5XA 3KWQA 1CEFA 2NZDC 4EWFA 3X1UA 2PYOB 4OP8A 5KDMB 1S6RA 4OPZA 4N1HA 2Y2MA 4EUZA 5A93A 4Z5TC 3MGSC 2XK1A 2J9PA 3UTAD 4CJNA 3GQZA 4KZ9A 2HP9A 3KXBC 3MGPC 1P3FC 2FJ7B 3UDXA 2CV5C 3AV2D 3S4XA 3UE0A 3Q7VA 5FUGA 5B31G 3V5MA 4YM6B 4LV2A 4ZUXC 2PYOC 5GHZA 3VOZA 5CHUA 1JFIA 5B1MD 3H0RC 4Z5TD 2YFWA 4J8XA 3LEZA 5B32A 1IYPA 5KSHA 3AYWA 1IELA 3PBQA 3AZEB 3AZJB 4H9QA 4J8WB 4Y7PA 4EBNA 3AZGB 5JA4A 3WKJB 5G49A 3UPNA 5GHYA 4BD0A 3KXBD 3MGPD 1Q2QA 4DXCA 3FKEA 2XD5A 4KZ3A 2Y2NA 2PYOD 2H5SA 5GT0A 4E3LA 3GVBA 2RL3A 1P3AB 4G91C 1YLJA 5E2EA 1PZPA 3AZEC 1P3KA 3AZJC 3AZGC 3WKJC 3AZNB 1ZKJA 5JYPA 2FJ7D 4GHLA 3W98A 4E3JA 1BSGA 1NXYA 3HUOA 5A91A 1EQZA 4ZBJB 1XKZA 2H10A 4YM6D 3VOYA 3GV9A 4IJFA 3REJC 3G2YA 4RA7A 4X23B 4B4ZA 3NQJB 3WS2A 3LZ0B 4IEDA 5B33B 4OONA 1EROA 2X71A 1R4VA 5F1GA 1BLSA 4M6BA 3AZED 4H9NA 2GDNA 4QY5A 4OPRA 3X1SA 4J8WD 4DRTA 1TZYB 3PBRA 4E6XA 3WKJD 2WGIA 5B1LA 3IWQA 4X6TA 5GXQD 1P3GA 5KZHA 4UPKA 4ZBJC 3VP1A 2J8PA 4X23C 2WKEA 3ZFZA 1P3AD 2RVQC 4FH4A 3UE1A 3LZ0C 3UN7A 3TOIA 1DJCA 5CPJA 3W4OA 3FKWA 3VP2A 5GT3C 5L2FA 1U60A 5JRGB 5DTKA 1TZYC 3OCNA 3AZND 1RGYA 1VQQA 1RGZA 1LI0A 2ZQAA 3BM6A 1KX5B 4DXBA 2EX9A 2Y2QA 1KX4B 5EOOA 3RELC 1MWSA 4QY6A 3ZG8B 3LZ0D 1N4OA 3AN2D 4JXVA 5BS7A 3IWIA 5B33D 1S32B 1AXBA 3AGFA 2EX2A 5JRGC 3AZHD 5BPVA 3UE3A 1LLBA 1YMXA 2F8NB 4DDYA 4H9OB 4WNNA 3LJAA 2RCXA 3REIA 1KX5C 5FAOA 4WEJA 4CAYA 5GSUD 2HIOB 3ZG9B 4RX2A 1NYMA 3NIAA 2UWXA 3WS1A 2IOUA 1FSWA 1S32C 3V3SA 1BH9A 2F8NK 1BH8B 5JRGD 5CHLB 3BFEA 1K4FA 5CRFA 4OJOA 1KDWA 2Y2IA 4XUJA 4LCMA 1PWDA 5AV6A 3JYIA 1SDEA 3AFAA 3UTBA 1KX5D 5FQQA 4Z66C 2G5HC 1KX4D 2HIOC 1KDSA 3A6ND 4DRBA 4KG5A 2ZY5A 4J8VD 4CPKA 2WK0A 4C3QA 3MGRA 4PM6A 3C1CB 5DNNB 5CPID 1KX3B 4MEZA 3N8RA 5GL9A 2F8ND 4KZ5A 5BNXA 1A7WA 4LD9C 4YS3B 4UUZB 3WTPB 1SDNA 5DF9A 1P3IB 5CHJA 5B2JB 4B88A 2NZDA 1MWUA 4WZ5A 2OLUA 2IO5C 4E45A 4EO5B 1L0GA 3AZMB 3EQUA 3OCLA 4S2JA 1MXOA 3MXRA 3KWQD 1Z2CB 4YS3C 1P3LB 2CV5A 3X1UD 3O88A 5CERA 3QNBA 3WAAA 4GD8A 1P3IC 1NJ4A 5B2JC 4ZUXA 5DNMA 2BYKA 3UT9B 5BNVB 4KHAB 4DDSA 3C1CD 4OOMA 5DNND 1XGIA 2HUEC 1KX3D 4EO5C 1MWTA 2H0YA 5FI7A 2XD1A 3AZMC 3HSHA 5F99B 2P74A 4YS3D 1P3LC 3WTPD 4E6WA 1GHPA 3ZDJA 2OSUA 3W4PA 1M1AB 4OJ6A 3D4FA 4IBCA 4H9SA 3NQUA 1IYOA 1P3ID 1ZLAB 5E5AB 5B2JD 4DRAA 3W4QA 5FAQA 4PM8A 4N92A 5AVCB 3UT9C 2X01A 1ERQA 1H3OB 3MFDA 4QLCB 5AVBB 1K54A 3V50A 2IWDA 3HL9A 3AZMD 4BL3A 3W99A 3C1BB 5HAIA 3MGQC 5F99C 4JF4A 1P3LD 3AV1A 1M1AC 3IHBA 3MZFA 5GLBA 5GHXA 5F1FA 3REJA 1P3PA 3VP0A 1S0WA 3AZLB 2XDMA 3OPHA 4NE5A 3UT9D 2XF3A 3SS4A 4QLCC 5CPKB 5AVBC 1PI5A 4K0XA 3NCKA 2WYXA 3N7WA 3PBNA 1KVLA 5HAPA 3W98D 3C1BC 3TG9A 2XGNA 4P85A 2C6WB 5FQ9A 5FQKA 4OLDA 4LG2A 3ZCZA 1PZOA 2PU4A 1U35B 1M1AD 1JWPA 1ZLAD 5E5AD 5CGSA 3AZLC 5AVCD 2A49A 1SCWA 4ZTKA 4QLCD 5CPKC 5AVBD 1F66A 5GT3A 3C4PA 3W8KA 5B40B 3C1BD 1NYYA 1TZYA 3W97C 3IF6A 3MZDA 2G2UA 1P3OB 4NZ1A 3OZHA 4S2NC 3W96A 4LV3A 3HLFA 3NDEA 2WZXA 2ZY4A 3ITBA 3ZVWA 3RELA 4X69A 3I7JA 4KG2A 5AY8B 4ZJ3A 3AZFB 4D2OA 2IWBA 1HZOA 5CPKD 3FWLA 3DWKA 1XGJA 2R9WA 4KQRA 5B0ZA 2Z2LB 3BRMA 1HQ3A 4A5RA 5B40C 1P34A 4IBXA 5HFOA 4RX3A 3HLWA 5CP6B 1U35D 1P3MD 1FSYA 5TFQA 1KE4A 4KZAA 3WX7A 1KE3A 1DJAA 3M2KA 1TAFB 5AY8C 4XZQA 2DF4C 1S32A 2NQBB 3QHYA 3AZIB 3B0BA 4JXWA 1EWZA 4E3IA 4H9PA 5B40D 3B6GB 5FDHA 2V2FF 4F94A 1P3OD 3BECA 1YT4A 3QNCA 1YLPA 3UTAC 1BUEA 5AQ9A 2HP5A 3G32A 3E2LA 3FZCA 4Z66A 4ZJ1A 3AV2C 3WTPE 4GH9A 5AY8D 1PW8A 3AZFD 1MY8A 2YFVB 3VH5T 4MBFA 4IBIA 4XUXA 2F2AC 4OQIA 3GSGA 5B1MC 1W2EA 4R4RA 3G30A 3TU4B 3BEBA 5CP6D 4IBEA 2LY8A 3NY4A 4KUDB 4LD9A 1E3UA 1GHMA 1LL5A 4R1GA 3CMZA 1ESIA 1XX2A 4QB8A 3REHA 3O3VA 3WA9B 4GNUA 2NQBD 3BLSA 3AZID 2J7VA 4KENB 4OJLA 1K57C 3B6GD 4OQHA 5HAQA 4OUIA 1KGEA 3BFFA 1ID3B 4WMCA 3B6FA 4KZBA 2Y2HA 4ZJ2A 2ZY3A 3PAGA 2AROB 2W8SA 1IKIA 4JKTA 4BLMA 2VGJA 2RIQA 4E44A 2FJ7C 5GXQB 3KUYB 5EE8A 3X1TB 3REKB 4ID4A 4YM6C 3WA9C 4S2KA 4IBKA 4OPYA 4FD8A 4M3KA 4OLGA 5EVIA 4R23A 5J8XA 4NYYA 4N9LA 5I94A 5B0YB 3LZ1A 3AZKB 5D3OA 3TU4D 2ZD8A 1XXMA 1ID3C 5EPHA 4KUDD 4J8WC 1ES3A 4S2IA 3V9RA 2ZM5A 1K25A 1PWGA 1B6WA 4FH2A 3X1VA 5GXQC 3KUYC 3REKC 1BLPA 2FFFB 4X68A 3WA9D 2JBFA 3RJUA 3L28A 1N1JA 4KGCA 1L0DA 4H9RB 3UDIA 5B0YC 1P3AC 4JPMA 3AZKC 3AN2B 4X56A 3ZHHA 1M19B 4J8UA 1YLWA 1M18A 1ID3D 3AZHB 3MGQA 3G34A 4E3OA 2AROD 3AZNC 5AV5A 3O87A 5B24B 2BYMA 3H0LC 4PM5A 3KUYD 3X1TD 3REKD 1AOIB 4WU8D 4S2PA 5DF7A 4UHUA 3VH5W 2Y2PA 5GSUB 1WYCA 1TVFA 4IJEA 4UA7A 3NI9A 5B0YD 4JJNA 2B5RA 2WGWB 3L26A 3WRTA 2X02A 3AZKD 3AN2C 4R3JA 4DKIA 5B33C 3AV1D 3A1KA 1M19C 3BYDA 4N1XA 3MXSA 3AZHC 5AV8A 1KGGA 4DE3A 3B3XA 5B24C 2Y2LA 2J8YA 1BLCA 4OJ5A 4DE1A 4WV4B 5FA7A 1AOIC 3LELA 5BO0B 3LO7A 1HD8A 5GSUC 2JE5A 3A6NB 1Z6FA 4NY2A 4GDBA 1ES2A 4QNLA 4R8PB 4J8VB 3VH6T 4WBGA 1M19D 5B31A 3W97A 4IBGA 3LCEA 1Y54A 5CPIB 1M6KA 1Q2PA 2BLSA 1NZOA 3BLMA 5B24D 3E2KA 4EBPA 1AOID 1LI9A 1ESUA 1WWIA 1F66D 1K56A 1KX4C 5B2IA 1P3BD 3L25A 4PM7A 4ZAMA 2ZQ9A 3MZEA 4R3BA 3A6NC 2ZLYA 3CZDA 4J8VC 2JC7A 2WAFA 3S22A 4KQQA 3TSGA 3EQVA 5CPIC 5FQMA 4WU9B 3O62A 1VM1A 4R0QA 5AV9A 1WE4A 2P9VA 1TDLA 1TEMA 1K55C 3KWQB 4EBLA 1RCJA 3MVDA 3HLBA 3X1UB 2ZQ7A 1YU2A 4OQGA 3B0CT 1YU1A 1HQ3D 3FDDA 5CEBA 3MNNA 4R8PD 1O7EA 3Q7ZA 3HLCA 3UPPA 1PW1A 2QZ6A 3HBRA 4JXSA 3UTAA 4WU9C 4OOYA 5DVAA 3Q7VB 1E4DA 5FUGB 4RVAA 3KWQC 1W8QA 3R45A 2DNSA 3X1UC 3AV2A 4GB7A 3IF5A 1JFIB 3V3RA 1YLYA 2YFWB 4J8XB 5B32B 2WKHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EUZ A;  1JWP A;  5A93 A;  2XK1 A;  2J9P A;  3NDG A;  3HLG A;  5CGS A;  5FI2 A;  2A49 A;  4BL2 A;  4CJN A;  1GA9 A;  5HL1 A;  1DY6 A;  1SCW A;  3GQZ A;  1N9B A;  1NY0 A;  3FYZ A;  3N8L A;  4KZ9 A;  4ZTK A;  1I5Q A;  4DE0 A;  2HP9 A;  3GMW A;  3UDX A;  1KE0 A;  2BG1 A;  3VMA A;  5KSC A;  4HBU A;  3S4X A;  1MKI A;  3UE0 A;  3Q7V A;  1YQS A;  2HPB A;  3IF6 C;  2V20 A;  4P6B A;  3C4P A;  3W8K A;  1ERM A;  4XXR A;  3OC2 A;  4LV2 A;  3V5M A;  1NYY A;  2XQZ A;  3IF6 A;  2OLV A;  3MZD A;  2G2U A;  2ZQ8 A;  4PM9 A;  1BZA A;  4MBH A;  3DWZ A;  5JYO A;  3OZH A;  1K6S A;  3HLD A;  5GHZ A;  3VOZ A;  5CHU A;  1IKG A;  4S2N C;  4GZB A;  3PBS A;  2ZM2 A;  1BUL A;  4LV3 A;  2FFY A;  3C4O A;  3LEZ A;  3HLF A;  1IYP A;  4S2N A;  3NDE A;  5KSH A;  2ZC3 B;  1CK3 A;  1K57 A;  2WZX A;  1YM1 A;  1IEL A;  1MBL A;  4MLL A;  1CEG A;  2E8I A;  3ITB A;  3PBQ A;  4QD4 A;  3ZVW A;  4Y7P A;  4EBN A;  4X69 A;  3I7J A;  4KG2 A;  3C7U A;  3IHA A;  4X53 A;  4ZJ3 A;  1W79 A;  2CC1 A;  3A3D A;  2IWB A;  1M40 A;  4D2O A;  5EOE A;  3UPN A;  1PI4 A;  5GHY A;  4BD0 A;  1HZO A;  3ZVT A;  4E3M A;  4U0X A;  1O07 A;  1Q2Q A;  3CG5 A;  3FWL A;  1ES5 A;  4QHC A;  3DWK A;  4DXC A;  1XGJ A;  2R9W A;  4KQR A;  2XD5 A;  4KZ3 A;  2Z2L B;  1GCE A;  2Y2N A;  3BRM A;  1FQG A;  3IQA A;  4A5R A;  2IWC A;  4IBX A;  4LV0 A;  4R4S A;  5HFO A;  1ZG6 A;  2Y55 A;  4MNR A;  5FAP A;  4RX3 A;  5EVL A;  2H5S A;  4JLF A;  3HLW A;  5KMW A;  4E3L A;  3GVB A;  3M6H A;  2RL3 A;  3G31 A;  3A3J A;  1KGF A;  1W8Y A;  5M18 A;  4GOG A;  1FSY A;  1YLJ A;  1SKF A;  5TFQ A;  5CHM A;  1KE4 A;  4JBF A;  4WMC D;  5E2E A;  4KZA A;  1PZP A;  5M19 A;  1KE3 A;  1FOF A;  1JWV A;  5AQB A;  2DCF A;  3OPP A;  1DJA A;  1JVJ A;  1FR6 A;  3SS5 A;  3M2K A;  1ZG4 A;  4UA9 A;  4OVD A;  1KVM A;  2DRW A;  1ZKJ A;  4FSF A;  2WZZ A;  5FQI A;  5JYP A;  5FAT A;  4E3J A;  1BSG A;  1NXY A;  3BFC A;  3QHY A;  1H8Z A;  5AQ7 A;  3HUO A;  1EI5 A;  4JXW A;  4LEN A;  1XKZ A;  1EWZ A;  2H10 A;  2G2W A;  5EVI D;  5A91 A;  2QPN A;  3IXG A;  3A3E A;  4E3I A;  3VOY A;  3GV9 A;  3M2J A;  2Y2J A;  3PAE A;  1SHV A;  4JF5 A;  2V2F F;  3G2Y A;  3IXB A;  3IWO A;  3Q1F A;  5FDH A;  3UY6 A;  4F94 A;  3UO9 A;  3ZG7 B;  4RA7 A;  3BEC A;  1YT4 A;  3QNC A;  4B4Z A;  4U3T A;  3AGD A;  1YLP A;  3RXW A;  5TGF A;  3WS2 A;  4BJP A;  1BUE A;  4OKP A;  4IED A;  5AQ9 A;  2HP5 A;  3G32 A;  3E2L A;  4OON A;  3FZC A;  1ERO A;  2X71 A;  4PMA A;  5E43 A;  5DTT A;  5F1G A;  1BLS A;  2EXB A;  5FI6 A;  3S1Y A;  2GDN A;  4QY5 A;  4ZJ1 A;  3NC8 A;  4OPR A;  4C75 A;  1K38 A;  1MPL A;  2ZC7 A;  3NBL A;  4DRT A;  1QME A;  3Q81 A;  3GRJ A;  3PBR A;  4E6X A;  3LY4 A;  1PW8 A;  3HVF A;  1MY8 A;  1L0F A;  2WGI A;  4JXG A;  3IWQ A;  4PPR A;  4MBF A;  2Q9M A;  1XP4 A;  4X6T A;  5KZH A;  4EQI A;  3FV7 A;  4S2L A;  4EV4 A;  2Y2G A;  4XUX A;  4YFM A;  2PU2 A;  3VP1 A;  5GLC A;  4OQI A;  3GSG A;  4R4R A;  2XEP A;  2HP6 A;  3G30 A;  4RYE A;  3SS3 A;  1TDG A;  2WKE A;  3BEB A;  3NY4 A;  3VSL A;  3ZFZ A;  4FH4 A;  4LV1 A;  3UE1 A;  4Y0T A;  1ONH A;  3UN7 A;  3TOI A;  1GHM A;  1E3U A;  4HEF A;  4K0W A;  4L0L A;  5E2G A;  3ZNY A;  1DJC A;  1LL5 A;  4R1G A;  3W4O A;  3FKW A;  3VP2 A;  3CMZ A;  5L2F A;  1U60 A;  2EFU A;  1BTL A;  4E3N A;  5DTK A;  1YLZ A;  3SOI A;  3OCN A;  1ESI A;  5DF8 A;  1RP5 A;  1XX2 A;  5EVI B;  3N8S A;  1RGY A;  3O3V A;  4QB8 A;  1VQQ A;  3IXH A;  4FCF A;  4P0M A;  4GNU A;  1RGZ A;  1LI0 A;  5E2F A;  2EX6 A;  3BLS A;  2PBY A;  2Y59 A;  2ZQA A;  2J7V A;  2ZJ9 A;  4KEN B;  4WM9 A;  5CTM A;  3BM6 A;  1K57 C;  3DW0 A;  4DXB A;  3WS4 A;  3HLE A;  1J9M A;  2A3U A;  4OQH A;  2EX9 A;  5HAQ A;  2Y2Q A;  1HTZ A;  1KGE A;  5EOO A;  3BFF A;  5E2H A;  1MWS A;  1E3U D;  4WMC A;  4QY6 A;  4KZB A;  3ZG8 B;  1G6A A;  2V1Z A;  5BOH A;  1N4O A;  3LY3 A;  2Y2H A;  4ZJ2 A;  3HUN A;  4JXV A;  3IWI A;  3PAG A;  4KQO A;  1IKI A;  1AXB A;  3AGF A;  4GD6 A;  4JKT A;  4BLM A;  1ONG A;  2VGJ A;  1L2S A;  1H8Y A;  2EX2 A;  3IH8 A;  3UE3 A;  2HDU A;  5EE8 A;  5CEC A;  5AQA A;  1LLB A;  1YMX A;  1YLT A;  3ZNT A;  5A92 A;  5EVI C;  2ZM0 A;  4ID4 A;  4S2K A;  1NRF A;  4DDY A;  2Y91 A;  4OPY A;  4FD8 A;  3RXX A;  4M3K A;  4OLG A;  5EVI A;  4R23 A;  3VFF A;  5J8X A;  4N9L A;  3FKV A;  5I94 A;  3N6I A;  4KZ4 A;  4UA6 A;  4B4X A;  2RCX A;  1LL9 A;  4JF6 A;  5FAO A;  2ZM8 A;  4WEJ A;  3HUM A;  2EXA A;  5D3O A;  3A3F A;  3ZG9 B;  2XLN A;  2ZD8 A;  2ZQD A;  4RX2 A;  1NYM A;  1XXM A;  3NIA A;  1NZU A;  1WYB A;  5EPH A;  4GN2 A;  2JCH A;  2UWX A;  2WKI A;  3SH8 A;  2Y4A A;  4KG6 A;  1IYS A;  3WWX A;  3WS1 A;  1IEM A;  1ES3 A;  4OH0 A;  4S2I A;  2HDR A;  1FSW A;  2XFS A;  3CJM A;  3ZG0 A;  4ZBE A;  3V3S A;  1K25 A;  1PWG A;  3SH7 A;  4FH2 A;  4WEL A;  3MKF A;  4HES A;  1PYY A;  4N9K A;  1QMF A;  3Q82 A;  3OPR A;  1BLP A;  4OQ0 A;  3BFE A;  2FFF B;  3ZG5 A;  4X68 A;  1K4F A;  3MBZ A;  1I2S A;  5CRF A;  1KDW A;  2VGK A;  2Y2I A;  4OOL A;  5GLD A;  2JBF A;  4LCM A;  3RJU A;  1PWD A;  4K91 A;  1L0D A;  3JYI A;  4WZ4 A;  1SDE A;  5CED A;  3UDI A;  3BFG A;  1IYQ A;  4JPM A;  3UNW A;  2ZMA A;  5FQQ A;  4S2M A;  4X56 A;  4UAA A;  3ZHH A;  1YLW A;  1C3B A;  1KDS A;  3P09 A;  1K6R A;  4Y0O A;  1E25 A;  4ZDX A;  1FR1 A;  3G34 A;  4E3O A;  4KG5 A;  5EUA A;  4H8R A;  1DJB A;  2I72 A;  3O87 A;  4CPK A;  2WK0 A;  3G4P A;  4C3Q A;  4PM5 A;  5GLA A;  3GTC A;  5CGW A;  5A90 A;  3PBT A;  4PM6 A;  2EFX A;  4XUZ A;  1CI9 A;  5CGX A;  3VP4 A;  4MEZ A;  3N8R A;  5GL9 A;  4KZ7 A;  4S2P A;  5DF7 A;  2Q9N A;  4DF6 A;  4UHU A;  1ES4 A;  2Y2P A;  1BT5 A;  3Q07 A;  4KZ5 A;  1WYC A;  1TVF A;  4UA7 A;  3NI9 A;  3VSK A;  2WGW B;  2B5R A;  3WRT A;  3WRZ A;  1GA0 A;  1SDN A;  4HBT A;  2X02 A;  4E3K A;  4R3J A;  4DKI A;  1GHI A;  5DF9 A;  3A3I A;  1YMS A;  4U0T A;  4WZ5 C;  4OPQ A;  5CHJ A;  3BYD A;  1L0E A;  1MWR A;  3MXS A;  4N1X A;  4WYY A;  4B88 A;  1MWU A;  1KGG A;  3DTM A;  5TR7 A;  4WZ5 A;  2Z2M B;  4DE3 A;  3B3X A;  4P87 A;  2OLU A;  2HDS A;  1K4E A;  2Y2L A;  1PIO A;  2OV5 A;  3BFD A;  2J8Y A;  3IT9 A;  1BLC A;  4S2O A;  4DE1 A;  4C6Y A;  5FA7 A;  5CTN A;  2WAD A;  4IBR A;  2XFT A;  1L0G A;  3LO7 A;  2H0T A;  5G18 A;  3EQU A;  3C7V A;  3ITA A;  1HD8 A;  4KZ6 A;  4QJG A;  3OCL A;  5IHV A;  1W7F A;  3IH9 A;  1FCN A;  4S2J A;  1MXO A;  5HAR A;  2JE5 A;  3MXR A;  5HX9 A;  4NK3 A;  1XA1 A;  2QMI A;  3C5A A;  4KZ8 A;  3HRE A;  2Y2O A;  1Z6F A;  4GDB A;  3O88 A;  5CER A;  1ES2 A;  3QNB A;  3VP3 A;  4GD8 A;  2WGW A;  4WBG A;  2ZC6 B;  1NJ4 A;  2ZQC A;  4MBK A;  2J9O A;  1Y54 A;  3AGE A;  3LCE A;  1M6K A;  1Q2P A;  4IVI A;  2BLS A;  1NZO A;  1G68 A;  2P9V B;  3O86 A;  3BLM A;  3MKE A;  4NET A;  1BLH A;  2ZC5 B;  1I2W A;  1FCO A;  3WS5 A;  4DDS A;  4O7D A;  2WAE A;  3E2K A;  2XH9 A;  1XGI A;  4OOM A;  2WGV A;  2HDQ A;  5DTS A;  5EEC A;  4EBP A;  1LI9 A;  4BEN A;  1ESU A;  1MWT A;  2H0Y A;  5FI7 A;  2XD1 A;  3ISG A;  3ZGA B;  1K56 A;  1ZC2 A;  4BQM A;  5FQJ A;  4PM7 A;  4ZAM A;  4QU3 A;  2P74 A;  2ZQ9 A;  3MZE A;  3GR2 A;  4R3B A;  1FCM A;  1GHP A;  1XPB A;  2ZLY A;  3ZDJ A;  4E6W A;  2OSU A;  2WUQ A;  3W4P A;  3IXD A;  3N4I A;  3CZD A;  1JTG A;  3D4F A;  2XR0 A;  2JC7 A;  4WEK A;  1IYO A;  4Z9Q A;  2WAF A;  3S22 A;  1PWC A;  4KQQ A;  2R9X A;  3TSG A;  5FSR A;  3OPL A;  3EQV A;  3G2Z A;  5U47 A;  3W4Q A;  5FAQ A;  4GKU A;  4PM8 A;  4N92 A;  5FQM A;  4DE2 A;  1VM1 A;  4R0Q A;  2P9V A;  1WE4 A;  2Y2K A;  1ERQ A;  1TDL A;  2X01 A;  3MFD A;  1K54 C;  1TEM A;  1K55 C;  3VFH A;  2ZC4 B;  4EBL A;  1K56 D;  1RCJ A;  3UPO A;  1K54 A;  4Y0U A;  2IWD A;  3V50 A;  3HL9 A;  3HLB A;  4BL3 A;  1K55 A;  1ALQ A;  2ZQ7 A;  3WS0 A;  5HAI A;  4OQG A;  5F83 A;  1XA7 A;  4JF4 A;  2C5W B;  4Q8I A;  1W5D A;  3IHB A;  5CEB A;  3MZF A;  5GLB A;  5HW3 A;  4X55 A;  1HVB A;  1O7E A;  3Q7Z A;  3HLC A;  5GHX A;  3UPP A;  1PW1 A;  5F1F A;  3SH9 A;  4GDN A;  4OP5 A;  2QZ6 A;  1LHY A;  3VP0 A;  3HBR A;  1S0W A;  3PBO A;  4JXS A;  3M6B A;  2XDM A;  3OPH A;  3PTE A;  2XF3 A;  1JTD A;  4OOY A;  5M1A A;  5DVA A;  3SS4 A;  4YIN A;  3UDF A;  3Q7V B;  1JWZ A;  1E4D A;  1PI5 A;  4K0X A;  4RVA A;  4LCL A;  3NCK A;  3V39 A;  1W8Q A;  4IVK A;  2WYX A;  4BD1 A;  1H5X A;  1CI8 A;  2DNS A;  3IF6 B;  1KVL A;  3N7W A;  3PBN A;  5HAP A;  1CEF A;  3G35 A;  5FAS A;  3TG9 A;  2XGN A;  4GB7 A;  4P85 A;  2C6W B;  4EWF A;  5F82 A;  5FQ9 A;  3IF5 A;  4OLD A;  5FQK A;  4OP8 A;  3P98 A;  2EX8 A;  1S6R A;  4OPZ A;  3V3R A;  1OME A;  1YLY A;  3ZCZ A;  2WKH A;  1PZO A;  2PU4 A;  4N1H A;  2Y2M A;  5CXW A; 
#chains in the Genus database with same CATH topology
 4H9Q B;  3NDG A;  5B1M A;  4G3V A;  5JA4 B;  3N3F A;  4JGP A;  4Z5T A;  3C1C C;  5DNN C;  3MGS A;  3HLG A;  1KX3 C;  5G49 B;  4WU9 D;  4FOF A;  1NY0 A;  4LPZ A;  1I5Q A;  5G4Z A;  1V9Y A;  1KE0 A;  2WKP A;  2ZY2 A;  1MKI A;  1E6N A;  3F1N A;  1YQS A;  5BT1 D;  3KXB A;  3MGP A;  1P3F A;  3WTP C;  1ERM A;  4XXR A;  3OC2 A;  2XQZ A;  5GT0 B;  2OLV A;  4I39 A;  2DQN C;  1BZA A;  3K3D A;  4FUW A;  2W1T A;  5HWV A;  1IKG A;  3PBS A;  2PYO A;  2ZM2 A;  1BUL A;  5KDM A;  1P3K B;  3VH6 W;  2ZC3 B;  2D02 A;  1CK3 A;  1K57 A;  1JNU A;  4MLL A;  1A0K A;  1UGU A;  1CEG A;  5TJJ A;  3C7U A;  3IHA A;  3W98 B;  4X53 A;  3A3D A;  1T3U A;  3H7W A;  1PI4 A;  1LSW A;  5IT5 A;  4LRZ E;  1EQZ B;  3T4T A;  1S67 L;  2PAV P;  2FJ7 A;  3MQQ A;  4R4S A;  2Y55 A;  4MNR A;  4G3W A;  5FAP A;  4DMZ A;  4JLF A;  4YM6 A;  2PDR A;  2FZ0 A;  4J8X D;  1W1P A;  2OWH A;  5B32 D;  3G31 A;  3M6H A;  1W8Y A;  4GOG A;  3AYW D;  1SKF A;  5CHM A;  4WMC D;  1OPX A;  4H9N B;  2F8N G;  2G7U A;  5A8B A;  3X1S B;  5M19 A;  1WWS A;  1FOF A;  1JWV A;  1TD5 A;  1FR6 A;  3SS5 A;  4UA9 A;  5B1L B;  1KVM A;  3AZE A;  3W98 C;  1P3G B;  3AZJ A;  4WJ3 C;  5FQI A;  4J8W A;  3AZG A;  1EQZ C;  5DJU A;  5FAT A;  3WKJ A;  3T4K A;  4CLC D;  5AQ7 A;  3PR6 A;  5HSQ A;  5EVI D;  5GXQ A;  3IXG A;  1DP9 A;  1KU5 A;  3PAE A;  2Y2J A;  5GT0 D;  4NFT A;  3M7P A;  5J4E A;  3LZ1 D;  3B0C W;  2QWS A;  3ZG7 B;  1ZLA C;  5E5A C;  4U3T A;  5CPJ B;  5AVC C;  4OKP A;  2LB9 A;  1P3K D;  1P3A A;  4PMA A;  1CJF A;  5FI6 A;  4IBB A;  3S1Y A;  5B1L C;  1MPL A;  4C75 A;  3NBL A;  5EVE A;  2ZL1 B;  3HVF A;  1L0F A;  2W3H A;  2M7U A;  3V67 A;  4PPR A;  1EQZ D;  2Q9M A;  1XP4 A;  3WD2 A;  4DJ2 A;  3AZN A;  4EV4 A;  5L8M A;  4QWO A;  3UMD A;  3BWL A;  2EA9 A;  1P3M B;  5GLC A;  3EWK A;  2XEP A;  2HP6 A;  1OJ5 A;  3SS3 A;  2VK3 A;  4NKP A;  3VSL A;  4LV1 A;  4J8U D;  4X23 A;  1M18 D;  2OOL A;  4K0W A;  5E2G A;  3NQJ A;  3X1S D;  3A0V A;  5HL6 A;  3S7N A;  3LZ0 A;  1IOU A;  5B33 A;  4E3N A;  5B1L D;  1YLZ A;  3MFX A;  5DF8 A;  1RP5 A;  2V9A A;  4WNN B;  1P3G D;  3LJA B;  4P0M A;  4FCF A;  4NEE D;  3REI B;  5E2F A;  2Y59 A;  4CAY B;  3HJI A;  1NLZ A;  2ZJ9 A;  1U35 C;  1P3M C;  2JKT M;  3DW0 A;  3WS4 A;  4PAU A;  3MQO A;  1HTZ A;  5BS7 C;  5CPJ D;  1XJ6 A;  2JN7 A;  3D9Y A;  1G6A A;  5BOH A;  3LY3 A;  3QP1 A;  1BH9 B;  3HUN A;  1X0O A;  4KQO A;  5AV8 D;  3F1P B;  1ONG A;  3IP4 C;  5HPF A;  1L2S A;  1Y4O A;  5CEC A;  4XUJ B;  5AQA A;  2K2N A;  1YLT A;  3LR5 A;  1OTI A;  5JRG A;  3ZNT A;  4B93 A;  5AV6 B;  1TS7 A;  1NRF A;  2Y91 A;  3AFA B;  3UTB B;  1E15 A;  3RXX A;  3H0M C;  3LEL D;  1P3O C;  2R78 A;  3REI C;  4GHI A;  3VFF A;  3FKV A;  4KZ4 A;  4UA6 A;  2ZM8 A;  2W27 A;  2EXA A;  2ZQD A;  1KX5 A;  2VQR A;  3F6T A;  5HDD A;  1WYB A;  4GN2 A;  2JCH A;  1KX4 A;  2WKI A;  1NRJ A;  3WWX A;  3MGR B;  1IEM A;  3AZF C;  3BY9 A;  4WEL A;  3MKF A;  4HES A;  4N9K A;  5FL3 A;  4G92 B;  1QMF A;  3Q82 A;  3OPR A;  4XUJ C;  1I2S A;  5AV6 C;  5BNX B;  3NUL A;  3LJA D;  4GHA A;  4IBJ A;  3AFA C;  4JGQ A;  3UTB C;  4EU0 A;  3EG5 B;  3REI D;  2F8N A;  5FDS A;  5CP6 C;  4LGW A;  4H9O A;  1IYQ A;  2CMN A;  2K31 A;  2D01 A;  2ZMA A;  4DJ3 A;  2F8N H;  3S7Q A;  4UAA A;  3P09 A;  2HIO A;  1K6R A;  4Y0O A;  1CF0 A;  1FR1 A;  4ZDX A;  1D1J A;  3DTE A;  2XRO A;  5EUA A;  2I72 A;  3LEQ A;  4F3L A;  1B67 A;  3G4P A;  3GTC A;  5A90 A;  4EEU A;  3F1O A;  2EFX A;  4NZ3 A;  2NQB C;  4Y15 A;  4G92 C;  4HME A;  3AZI C;  4XUJ D;  4BBU A;  5AV9 D;  4KQD A;  1BH8 A;  5L10 A;  2J3T D;  5AV6 D;  4HP4 A;  4DF6 A;  3B6G C;  3AFA D;  3UTB D;  3Q07 A;  2CV5 B;  2PHY A;  3NOP C;  3WAA B;  3LIF A;  4E3K A;  4K08 A;  3OOV A;  4ZUX B;  3IX8 A;  1AWI A;  4WZ5 C;  3NEC A;  5DNM B;  3IS2 A;  4OPQ A;  4CLC E;  2BYK B;  3MNN D;  3P5J B;  4LFU A;  3EPJ A;  1OJG A;  3DTM A;  3MGR D;  3MJQ A;  4NE6 A;  2HDS A;  3VH5 A;  3LIE A;  1K4E A;  4II7 A;  5FEG A;  4Y5F A;  4IBR A;  3C1C A;  4I3J A;  5DNN A;  2H0T A;  1KX3 A;  3C7V A;  4KZ6 A;  5IHV A;  1XFN A;  1FCN A;  3TU4 C;  3IH9 A;  2QMI A;  1MKM A;  3HRE A;  3ICY A;  4KZ8 A;  3WAA C;  3IX3 A;  3NQU B;  4KUD C;  3RTY A;  2NZD D;  4YS3 A;  1CQA A;  1P97 A;  4UUZ A;  3WTP A;  4NE3 A;  2ZQC A;  5DNM C;  4MBK A;  3C38 A;  3NOU C;  3EPL A;  4G91 B;  1P3I A;  4IVI A;  1G68 A;  5B2J A;  1VHM A;  3O86 A;  4WU8 B;  2VEA A;  3MGS D;  1BLH A;  3EPK A;  2ZC5 B;  1PFL A;  3UB5 P;  2B02 A;  3WS5 A;  4O7D A;  2XH9 A;  5DTS A;  3W99 B;  3T1R A;  4HMD A;  2OAQ 1;  4GLQ A;  3A1I A;  1ZC2 A;  1P3F D;  3AV1 B;  2CV5 D;  3KSY A;  3AZM A;  3WAA D;  4H9S C;  3GR2 A;  3T1S A;  1XPB A;  2WUQ A;  2JKG A;  3IXD A;  3N4I A;  1JTG A;  2ARO C;  3REJ B;  4ZUX D;  2XR0 A;  1P3L A;  4WEK A;  1P3P B;  5DNM D;  1PWC A;  3G6O A;  3OPL A;  3G2Z A;  3X1T C;  4GKU A;  4WU8 C;  1EW0 A;  1K54 C;  4NXG A;  3UT9 A;  3W99 C;  3VFH A;  4ARZ A;  4OJP A;  2ZC4 B;  3BY8 A;  3UPO A;  5BNV A;  4KHA A;  3T4S A;  2KX6 A;  4Y0U A;  2HJE A;  1ULY A;  3ULF A;  3AV1 C;  3DTK A;  2AVX A;  5F83 A;  1XA7 A;  2JKR I;  2C5W B;  1YU0 A;  5F99 A;  4X55 A;  1HVB A;  1P3P C;  3H82 A;  1UWN X;  1M1A A;  3L2A A;  4GDN A;  4CSR B;  1LHY A;  1ZLA A;  5E5A A;  3LUQ A;  3PTE A;  1F66 B;  1JTD A;  5GT3 B;  5AVC A;  1JWZ A;  4P6Z S;  1P3B B;  3AZJ D;  3W99 D;  3V39 A;  3LI9 A;  1H3O A;  3AZG D;  1FIL A;  3IF6 B;  1CI8 A;  4QLC A;  5AVB A;  3G35 A;  3AL0 C;  5FAS A;  5F82 A;  4LRX C;  2JKF A;  3LID A;  3W96 B;  3P98 A;  3C1B A;  2EX8 A;  1OME A;  2B18 A;  1OGB A;  2VV7 A;  5CXW A;  1W1Y A;  3HON A;  3REJ D;  4HJ4 A;  1P3P D;  3MMH A;  3VE3 A;  4XT2 B;  3REL B;  3EPH A;  2QJ5 A;  5FI2 A;  4BL2 A;  3L27 A;  1GA9 A;  5HL1 A;  1DY6 A;  1F66 C;  1N9B A;  2P08 A;  3FYZ A;  3N8L A;  3AZL A;  4DE0 A;  3GMW A;  5B0Z B;  1P3B C;  2BG1 A;  3VMA A;  5KSC A;  1CXW A;  4HBU A;  1HQ3 B;  1P34 B;  2FH5 A;  3B42 A;  2HPB A;  1Y28 A;  3IF6 C;  3LYX A;  2V20 A;  5CPK A;  5HDC A;  4P6B A;  3K2N A;  1PDC A;  5C3I B;  3MR0 A;  1ZHH B;  2ZQ8 A;  4PM9 A;  3JPU A;  3W96 C;  1UWP X;  3DWZ A;  4MBH A;  3IBJ A;  4HJ3 A;  5JYO A;  1K6S A;  3HLD A;  5F68 A;  1P9R A;  4WLA A;  4GZB A;  3BW6 A;  1YKD A;  1E88 A;  3KFU G;  2FFY A;  3C4O A;  4S2N A;  1U35 A;  1P3M A;  1YM1 A;  1MBL A;  4X23 D;  2E8I A;  2M7V A;  4QD4 A;  2RVQ D;  4XZQ B;  4HGA B;  2HV1 A;  3CPT A;  2G5I C;  5DFY A;  1W79 A;  2CC1 A;  1M40 A;  5EOE A;  5GT3 D;  3ZVT A;  5B0Z C;  1T1C A;  4E3M A;  4U0X A;  1O07 A;  3CG5 A;  4QHC A;  1ES5 A;  1HQ3 C;  4H9P B;  1P34 C;  1TZY D;  1GCE A;  1FQG A;  3IQA A;  2IWC A;  3VH6 A;  5C3I C;  2V5O A;  4LV0 A;  1ZG6 A;  4R8P C;  4UQI S;  1P0Z A;  4H6J B;  5EVL A;  2KDK A;  5KMW A;  3W96 D;  5B40 A;  2B95 A;  2A2L A;  5M18 A;  3A3J A;  1KGF A;  1P3O A;  4Z66 B;  4JBF A;  4IUK A;  3REL D;  3PXP A;  5AQB A;  2DCF A;  3OPP A;  1JVJ A;  3FPV A;  1ZG4 A;  4XZQ C;  4HGA C;  4OVD A;  3RFB A;  4ZRR A;  2DRW A;  4FSF A;  2WZZ A;  5B0Z D;  4HNB A;  5AY8 A;  3AZF A;  1L3L A;  1P34 D;  3BFC A;  1H8Z A;  2W1R A;  1EI5 A;  4LEN A;  2G2W A;  2QPN A;  3A3E A;  3M2J A;  4JF5 A;  3MF0 A;  1SHV A;  3IXB A;  3IWO A;  3Q1F A;  3UY6 A;  3UO9 A;  4LD9 B;  1V9Z A;  1OTB A;  3AGD A;  3RXW A;  1E8B A;  5TGF A;  5J7E A;  4BJP A;  5CP6 A;  3BQA A;  5E43 A;  2XRN A;  5DTT A;  2IA2 A;  2EXB A;  4HOI A;  3NC8 A;  3C8C A;  4XZQ D;  3REH B;  1K38 A;  2ZC7 A;  1QME A;  3FC7 A;  3Q81 A;  3GRJ A;  1UR8 A;  5BT1 C;  3LY4 A;  1S32 D;  2IO5 B;  1TAF A;  4JXG A;  3UB8 A;  4UEY A;  1GPF A;  2JSS A;  3FV7 A;  4S2L A;  2Y2G A;  4YFM A;  2PU2 A;  2K7S A;  2Z6D A;  2NQB A;  1N9O A;  3AYW B;  3AZI A;  3B6F B;  4RYE A;  4Z2M G;  1TDG A;  2L5A A;  1VEU A;  2VLG A;  3B6G A;  3T1Q B;  1TS0 A;  1F1E A;  3P01 A;  3WD1 A;  4Y0T A;  1ONH A;  3ZNY A;  4Z66 D;  4HEF A;  4L0L A;  1PZR A;  4Y13 A;  2HIO D;  1YAX A;  2EFU A;  3TW8 A;  1BTL A;  3REH C;  5EM1 A;  4BBT A;  3CUE A;  3SOI A;  4CLC B;  1XJ3 A;  5EVI B;  3N8S A;  3IXH A;  1YUE A;  2E8J A;  3LZ1 B;  3IX4 A;  4L9E A;  2EX6 A;  2HUE B;  2YFV A;  2PBY A;  4J8X C;  4WM9 A;  5B32 C;  5CTM A;  3AYW C;  1NWZ A;  2QJ7 A;  3HLE A;  1J9M A;  2A3U A;  5LBR A;  3B6F C;  2VV6 A;  3T4Q A;  5E2H A;  4LD9 D;  1E3U D;  2PR6 A;  5F69 A;  3V9R B;  3TU4 A;  1T18 A;  2V1Z A;  5HPI A;  3KSH A;  2PD8 A;  3X1V B;  4GD6 A;  4KUD A;  3T50 A;  1H8Y A;  3H9W A;  3IH8 A;  3REH D;  2HDU A;  4CLC C;  5A92 A;  5EVI C;  2ZM0 A;  1N1J B;  4KGC B;  5GT0 C;  3LZ1 C;  2WKQ A;  2PT7 A;  3WA9 A;  3N6I A;  1ED7 A;  4B4X A;  4WZS B;  1LL9 A;  1VB6 A;  4JF6 A;  3R4K A;  4IUH A;  1YU3 A;  4J8U B;  3HUM A;  1M18 B;  1P3K C;  3B6F D;  3A3F A;  2PYP A;  2XLN A;  3S7P A;  3MGQ B;  1NZU A;  2PRF A;  5AV5 B;  3SH8 A;  2Y4A A;  4KG6 A;  1IYS A;  2BYM B;  1ID3 A;  4OH0 A;  3X1V C;  2HDR A;  2XFS A;  3CJM A;  3ZG0 A;  4ZBE A;  2PR5 A;  3SH7 A;  2CWE A;  1PYY A;  2ARO A;  1T1A A;  4OQ0 A;  2VV8 A;  4NXF A;  3UE6 A;  3ZG5 A;  3MBZ A;  3KS8 A;  3KUY A;  4KGC C;  2VGK A;  3X1T A;  3REK A;  4OOL A;  1E6P A;  5GLD A;  4WU8 A;  4JJN B;  3CIT A;  4K91 A;  4WZ4 A;  5CED A;  5I5L A;  2J3W A;  3BFG A;  1TS6 A;  4Y2F A;  3UNW A;  4J8U C;  4S2M A;  1M18 C;  2GZA A;  4NZ5 A;  5B0Y A;  5AV8 B;  3X1S C;  3AZK A;  1C3B A;  5AV5 C;  1E25 A;  2KLI A;  1YU4 A;  4H8R A;  3X1V D;  1DJB A;  1S4R A;  1P3G C;  3CAX A;  4ETX A;  4HMC A;  3LIA A;  5GLA A;  5CGW A;  3PBT A;  3LEL B;  4XUZ A;  1CI9 A;  5CGX A;  3VP4 A;  3BJN A;  4AWL B;  4KZ7 A;  2Q9N A;  4KGC D;  3T4O A;  5TBM B;  3U2A A;  1ES4 A;  1BT5 A;  4JJN C;  3GDI A;  2H28 A;  5HWT A;  5CPJ C;  1H0M A;  1ODV A;  3VSK A;  3WRZ A;  1GA0 A;  4HBT A;  3KSI A;  3T4J A;  5B31 B;  4H9R A;  1SKO B;  3W97 B;  1GHI A;  5AV8 C;  3A3I A;  1YMS A;  4U0T A;  3MGQ D;  3AN2 A;  5F99 D;  1S1Y A;  4WYY A;  1L0E A;  1MWR A;  5IU1 A;  5AV5 D;  5TR7 A;  1M19 A;  2Z2M B;  3B0D B;  2HGV A;  4P87 A;  3AZH A;  2ZMF A;  2W3G A;  1BFM A;  1PIO A;  2OV5 A;  3BFD A;  3IT9 A;  1OGG A;  4S2O A;  3LEL C;  4C6Y A;  2P04 A;  5CTN A;  5B24 A;  2WAD A;  1ZTU A;  4AWL C;  5B2I B;  5B32 G;  2XFT A;  5G18 A;  4CSR A;  3ITA A;  1AOI A;  4Z2M H;  4QJG A;  4JJN D;  1W7F A;  5HAR A;  5HX9 A;  2MJ6 A;  4LRY C;  4NK3 A;  1XA1 A;  3C5A A;  5GSU A;  1MZU A;  2Y2O A;  4NZ4 A;  1P3B A;  5B31 C;  3VP3 A;  2WGW A;  2ZC6 B;  4IBD A;  2J9O A;  2GX5 A;  3IBR A;  3O62 B;  3AGE A;  3B0D C;  5AV9 B;  2P9V B;  4DQY B;  3MKE A;  4NET A;  3LJA C;  1I2W A;  4EET B;  1FCO A;  3MVD B;  2WAE A;  1XJ2 A;  2WGV A;  2HDQ A;  5EEC A;  3KSG A;  4BEN A;  3AZL D;  1OT9 A;  2A24 B;  4R6L A;  5B2I C;  3ISG A;  5F6A A;  3ZGA B;  1TS8 A;  5BO0 A;  4IBF A;  4BQM A;  2XA7 S;  5FQJ A;  4QU3 A;  3MNN B;  5J3W A;  1FCM A;  4EQI A;  3KS4 A;  5B31 D;  3W97 D;  2O9C A;  3A6N A;  4Z9Q A;  4AFI A;  1HTA A;  4NYU A;  2D49 A;  2ZOH A;  2R9X A;  5FSR A;  4R8P A;  4J8V A;  3UTA B;  3NOT C;  5U47 A;  3O62 C;  4ESP A;  5AV9 C;  2VX8 A;  4DE2 A;  2J3T C;  5CPI A;  3MSH A;  3R45 B;  2Y2K A;  4WF0 A;  2M1C A;  3MVD C;  3AV2 B;  1K56 D;  5B2I D;  1W1T A;  1K55 A;  1VET A;  1ALQ A;  2JKR M;  1Q9C A;  2NZD B;  3WS0 A;  1OTA A;  2BTF P;  4KUK A;  3MNN C;  2V0W A;  4Q8I A;  1W5D A;  3L29 A;  3MGR C;  5B1M B;  5HW3 A;  4Z5T B;  3MGS B;  5FEF A;  4IHQ A;  2HJ9 C;  1YSP A;  3SH9 A;  3O62 D;  4OP5 A;  1TF1 A;  3PBO A;  3M6B A;  3F1N B;  5M1A A;  3UDF A;  4YIN A;  4ME4 A;  3KXB B;  1P3F B;  3MGP B;  3MVD D;  4WU9 A;  4LCL A;  4IVK A;  4GS9 A;  4BD1 A;  1H5X A;  3KWQ A;  1CEF A;  3R7W A;  1G28 A;  3LGO A;  2W1T B;  2NZD C;  4EWF A;  1F2K A;  3X1U A;  2PYO B;  4OP8 A;  5KDM B;  1S6R A;  4OPZ A;  4HQA A;  4N1H A;  2Y2M A;  4EUZ A;  5A93 A;  3GEC A;  4Z5T C;  3MGS C;  2XK1 A;  5AVF A;  2J9P A;  1KS0 A;  2Q0O A;  3UTA D;  1G5U A;  3H7W B;  3CLO A;  4CJN A;  3GQZ A;  4KZ9 A;  2HP9 A;  3KXB C;  3MGP C;  1P3F C;  2FJ7 B;  3UDX A;  2CV5 C;  3AV2 D;  1XFQ A;  3S4X A;  3UE0 A;  3Q7V A;  5HZH A;  5FUG A;  5B31 G;  4PKY G;  3V5M A;  4YM6 B;  4LV2 A;  2V1A A;  4ZUX C;  4P6Z M;  2PYO C;  3WD3 A;  5GHZ A;  3VOZ A;  5CHU A;  3KYE A;  3VV4 A;  1JFI A;  5B1M D;  3H0R C;  4Z5T D;  2YFW A;  4J8X A;  3LEZ A;  5B32 A;  1IYP A;  5KSH A;  3AYW A;  1IEL A;  3PBQ A;  3AZE B;  2L4R A;  3AZJ B;  4H9Q A;  1OT6 A;  4J8W B;  4Y7P A;  1LSV A;  4EBN A;  3AZG B;  4E04 A;  5JA4 A;  3SZT A;  3WKJ B;  5G49 A;  3UPN A;  5GHY A;  4BD0 A;  3KXB D;  3MGP D;  2INW A;  2O9A A;  1Q2Q A;  3B33 A;  4DXC A;  1F5M A;  3FKE A;  2XD5 A;  4KZ3 A;  2Y2N A;  3KO6 A;  2NUP C;  3CHW P;  2PYO D;  2H5S A;  1L6J A;  3ZQ5 A;  5GT0 A;  4E3L A;  2ACG A;  3GVB A;  2RL3 A;  1P3A B;  4G91 C;  3D3O A;  1YLJ A;  5E2E A;  1PZP A;  2ZBB A;  4WL9 A;  3AZE C;  1P3K A;  3AZJ C;  4Q0H A;  3AZG C;  3WKJ C;  3AZN B;  1ZKJ A;  5JYP A;  3QP2 A;  2FJ7 D;  4GHL A;  3NJA A;  3W98 A;  4E3J A;  1BSG A;  1NXY A;  1D7E A;  3HUO A;  4KUO A;  1EQZ A;  4ZBJ B;  1XKZ A;  2H10 A;  5A91 A;  4O0P A;  4YM6 D;  3VOY A;  1SZV A;  3GV9 A;  4IJF A;  3REJ C;  3G2Y A;  4MN7 A;  5G4Y A;  4RA7 A;  4X23 B;  4B4Z A;  3NQJ B;  3WS2 A;  3LZ0 B;  4IED A;  5B33 B;  4OON A;  4UQI M;  1ERO A;  2X71 A;  4M4X A;  2VA0 A;  1R4V A;  5F1G A;  1BLS A;  2V1B A;  4M6B A;  3AZE D;  4H9N A;  2GDN A;  4QY5 A;  4OPR A;  3X1S A;  3TE8 A;  4J8W D;  4DRT A;  1TZY B;  3PBR A;  4E6X A;  3WKJ D;  2PBD P;  5B1L A;  2WGI A;  3CI6 A;  3IWQ A;  4X6T A;  5GXQ D;  1P3G A;  5KZH A;  4UPK A;  4ZBJ C;  3VP1 A;  1LL8 A;  3U4L P;  2J8P A;  4X23 C;  2WKE A;  1LT0 A;  3ZFZ A;  1P3A D;  2RVQ C;  4FH4 A;  3UE1 A;  3LZ0 C;  3UN7 A;  3TOI A;  4I3I A;  1DJC A;  5CPJ A;  3W4O A;  4MB4 A;  3FKW A;  3VP2 A;  5GT3 C;  5L2F A;  1U60 A;  4QPR A;  5JRG B;  5DTK A;  1TZY C;  3OCN A;  4MB3 A;  3AZN D;  3A0R A;  4GHI B;  1RGY A;  1YPR A;  2ZL1 A;  1VQQ A;  4R38 A;  1RGZ A;  1LI0 A;  2ZQA A;  2QKP A;  4Z1W A;  3BM6 A;  1KX5 B;  4DXB A;  2EX9 A;  2Y2Q A;  1E6Z A;  1KX4 B;  3CWF A;  5EOO A;  2JHE A;  3REL C;  1MWS A;  3E4Q A;  4QY6 A;  3ZG8 B;  3LZ0 D;  1N4O A;  2I9V A;  3AN2 D;  4JXV A;  5BS7 A;  3IWI A;  1XJ4 A;  5B33 D;  1S32 B;  1AXB A;  3AGF A;  4PKY A;  2EX2 A;  5JRG C;  3AZH D;  5BPV A;  3UE3 A;  1LLB A;  1YMX A;  2ZMV A;  5MC7 A;  2VJW A;  2F8N B;  3PHY A;  4DDY A;  4NG2 A;  4H9O B;  4WNN A;  4EER A;  3W2Z A;  3LJA A;  3PYP A;  3HCY A;  1PRQ A;  2RCX A;  3REI A;  1KX5 C;  5FAO A;  4WEJ A;  4CAY A;  5GSU D;  4MN5 A;  2HIO B;  3ZG9 B;  5EV0 A;  4RX2 A;  1NYM A;  3NIA A;  2O99 A;  2UWX A;  4F3L B;  1H8P A;  4BMW A;  4R3A A;  1T1B A;  3WS1 A;  2IOU A;  1FSW A;  1S32 C;  3F1O B;  5DJT A;  3V3S A;  1D06 A;  1BH9 A;  4Z2I A;  2F8N K;  3LI8 A;  1BH8 B;  5JRG D;  5CHL B;  3F1P A;  4BWI A;  3BFE A;  1K4F A;  2DMW A;  4EES A;  4HY8 A;  5CRF A;  4OJO A;  1KDW A;  2Y2I A;  1N9L A;  4XUJ A;  4LCM A;  1PWD A;  4O01 A;  5AV6 A;  3JYI A;  1SDE A;  3AFA A;  3UTB A;  4X1L A;  1KX5 D;  5FQQ A;  3IS2 B;  4YNR A;  4Z66 C;  2G5H C;  5CX7 A;  1KX4 D;  2HIO C;  3S7O A;  2YKF A;  1K0K A;  5AVE A;  1KDS A;  3A6N D;  4DRB A;  4KG5 A;  2P7J A;  2ZY5 A;  4J8V D;  4CPK A;  2WK0 A;  4C3Q A;  3MGR A;  4PM6 A;  3C1C B;  5DNN B;  5CPI D;  1KX3 B;  4MEZ A;  3N8R A;  5GL9 A;  2F8N D;  2L1M A;  4KZ5 A;  5BNX A;  1A7W A;  4LD9 C;  4YS3 B;  4UUZ B;  3WTP B;  1H3Q A;  1SDN A;  1W63 M;  2OAP 1;  4GW9 A;  5DF9 A;  1P3I B;  5CHJ A;  5EM0 A;  5B2J B;  4B88 A;  2NZD A;  1IFQ A;  1MWU A;  4WZ5 A;  2OLU A;  2IO5 C;  4TX8 A;  1T19 A;  1H0G A;  4E45 A;  4EO5 B;  2Y79 A;  1L0G A;  3AZM B;  3E4P A;  3EQU A;  3EGX C;  3WD0 A;  3OCL A;  4S2J A;  1MXO A;  1S4S A;  3MXR A;  3KWQ D;  1BYW A;  1STZ A;  1Z2C B;  5L07 A;  4YS3 C;  1P3L B;  2CV5 A;  3X1U D;  3E0Y A;  3O88 A;  5CER A;  3QNB A;  2V8C A;  3WAA A;  5DFX A;  4GD8 A;  2YKH A;  1J7M A;  1P3I C;  1NJ4 A;  5B2J C;  1F98 A;  4ZUX A;  1NLY A;  2OWJ A;  5DNM A;  2BYK A;  3ZYT A;  3WD4 A;  3UT9 B;  4ARZ B;  3O5Y A;  5BNV B;  4KHA B;  2W3D A;  4DDS A;  3C1C D;  4OOM A;  5DNN D;  1XGI A;  2FN2 A;  2HUE C;  1KX3 D;  4EO5 C;  2XSS A;  1MWT A;  2H0Y A;  5FI7 A;  2XD1 A;  4HH2 A;  3AZM C;  3UB7 A;  3T1X A;  3HSH A;  5F99 B;  1PNE A;  2P74 A;  4YS3 D;  3D72 A;  1P3L C;  3WTP D;  3BQ8 A;  4NXE A;  4E6W A;  1GHP A;  3H82 B;  3ZDJ A;  2OSU A;  3W4P A;  1M1A B;  4OJ6 A;  3D4F A;  4IBC A;  4H9S A;  3NQU A;  1IYO A;  1P3I D;  2VGL S;  4Q0I A;  4EW7 A;  1ZLA B;  5E5A B;  5B2J D;  4DRA A;  3W4Q A;  5FAQ A;  3JVU A;  4PM8 A;  4N92 A;  5AVC B;  3UT9 C;  2X01 A;  1ERQ A;  1H3O B;  3MFD A;  4QLC B;  5AVB B;  1K54 A;  3V50 A;  2IWD A;  4Z2H A;  3AZM D;  3HL9 A;  3LFV A;  3W99 A;  4BL3 A;  3C1B B;  5HAI A;  3MGQ C;  5F99 C;  4JF4 A;  4DN0 A;  2ZOI A;  1P3L D;  3AV1 A;  1P9W A;  1M1A C;  3IHB A;  3MZF A;  5GLB A;  5GHX A;  2XA7 M;  5F1F A;  3REJ A;  3JVV A;  1P3P A;  3VP0 A;  1S0W A;  3AZL B;  2XDM A;  3OPH A;  4NE5 A;  3UT9 D;  2XF3 A;  1G6O A;  3SS4 A;  4RQ9 A;  4QLC C;  5CPK B;  5AVB C;  1PI5 A;  4EEP A;  4K0X A;  3NCK A;  4O8G A;  3VOL A;  2WYX A;  3N7W A;  3PBN A;  1KVL A;  4R70 A;  3W98 D;  5HAP A;  3C1B C;  3TG9 A;  2XGN A;  4P85 A;  2C6W B;  5FQ9 A;  5FQK A;  4OLD A;  4LG2 A;  3ZCZ A;  1PZO A;  2PU4 A;  1U35 B;  1M1A D;  4MN6 A;  1UR9 A;  1JWP A;  1KOU A;  3KX0 X;  1W63 Q;  4I3A A;  1ZLA D;  5E5A D;  1OTE A;  3CPT B;  5DKK A;  5CGS A;  4MMN A;  3AZL C;  5AVC D;  2A49 A;  4MDZ A;  1SCW A;  4ZTK A;  4QLC D;  5CPK C;  5AVB D;  1F66 A;  5AJG A;  1OTD A;  3TJZ C;  5GT3 A;  3C4P A;  3W8K A;  5B40 B;  3C1B D;  1NYY A;  1TZY A;  3W97 C;  4FTX A;  3IF6 A;  2EWW A;  3MZD A;  2G2U A;  1P3O B;  4NZ1 A;  3LR4 A;  3OZH A;  1FIK A;  4S2N C;  3W96 A;  4LV3 A;  3HLF A;  3NDE A;  1MC0 A;  2WZX A;  2ZY4 A;  3FPW A;  3ITB A;  3ZVW A;  4XT2 A;  3REL A;  4X69 A;  3I7J A;  4KG2 A;  5AY8 B;  4L9G A;  4ZJ3 A;  3AZF B;  1O6I A;  2IWB A;  4D2O A;  2EWV A;  1HZO A;  5CPK D;  4GJ4 A;  3FWL A;  3DWK A;  1XGJ A;  2R9W A;  4KQR A;  5B0Z A;  2Z2L B;  3BRM A;  4PHT A;  1HQ3 A;  4A5R A;  5B40 C;  1P34 A;  4IBX A;  5HFO A;  4RX3 A;  3HLW A;  5CP6 B;  1U35 D;  1P3M D;  5C5K A;  1FSY A;  4HHD A;  5TFQ A;  1KE4 A;  4KZA A;  4L9F A;  3WX7 A;  1KE3 A;  2BAS A;  1DJA A;  3M2K A;  1TAF B;  3L9K A;  3E98 A;  5AY8 C;  4XZQ A;  3OLO A;  1QO6 A;  2DF4 C;  1S32 A;  2NQB B;  4EUV A;  3QHY A;  3AZI B;  3B0B A;  4JXW A;  1EWZ A;  4E3I A;  4H9P A;  1VEU B;  5B40 D;  3B6G B;  5FDH A;  2V2F F;  4F94 A;  1P3O D;  4WUJ A;  3BEC A;  1YT4 A;  3QNC A;  2Z6C A;  1YLP A;  3UTA C;  4EQ1 A;  4H6J A;  3MQ0 A;  3B47 A;  4MB5 A;  1BUE A;  5AQ9 A;  2HP5 A;  1LSX A;  3EGD C;  3G32 A;  3E2L A;  3FZC A;  2L0W A;  4Z66 A;  4ZJ1 A;  3AV2 C;  3WTP E;  4LLO B;  4GH9 A;  5AY8 D;  1PW8 A;  3AZF D;  1MY8 A;  2V0U A;  2YFV B;  3VH5 T;  4MBF A;  4IBI A;  4BBV A;  4XUX A;  1H8M A;  2F2A C;  4OQI A;  3GSG A;  3MXQ A;  5B1M C;  1W2E A;  4Y3I A;  4R4R A;  2KOI A;  1EAK A;  3G30 A;  1DRM A;  3TU4 B;  2V8F A;  3BEB A;  5CP6 D;  4IBE A;  2LY8 A;  3NY4 A;  4KUD B;  4LD9 A;  1E3U A;  1GHM A;  4D60 A;  1LL5 A;  4R1G A;  1DP8 A;  3CUE C;  3CMZ A;  1AIW A;  2W3F A;  2WKR A;  2J80 A;  3LR0 A;  1ESI A;  1XX2 A;  4QB8 A;  3REH A;  3O3V A;  3WA9 B;  4YOF A;  4GNU A;  4Q0J A;  2NQB D;  3BLS A;  3AZI D;  3EEA A;  2J7V A;  4KEN B;  2W3E A;  4OJL A;  1K57 C;  3B6G D;  4OQH A;  5HAQ A;  4OUI A;  2O0Y A;  1KGE A;  3BFF A;  2JKT I;  1ID3 B;  4WMC A;  3B6F A;  3L7H A;  4KZB A;  2Y2H A;  4ZJ2 A;  2ZY3 A;  3PAG A;  2ARO B;  2W8S A;  1IKI A;  4JKT A;  4BLM A;  2VGJ A;  2RIQ A;  4E44 A;  2FJ7 C;  2W0N A;  5GXQ B;  3KUY B;  5EE8 A;  4MCW A;  3X1T B;  3REK B;  1GSV A;  4HI4 A;  1HLU P;  4ID4 A;  4YM6 C;  1GXD A;  3WA9 C;  4S2K A;  4CLC A;  4IBK A;  4OPY A;  4FD8 A;  4M3K A;  4OLG A;  5EVI A;  4R23 A;  5J8X A;  4NYY A;  3LIB A;  4N9L A;  5I94 A;  5HD3 A;  2VKS A;  5B0Y B;  3LZ1 A;  2GJ3 A;  1GSW A;  3AZK B;  2LB5 A;  1WA9 A;  3SW1 A;  5D3O A;  3TU4 D;  2ZD8 A;  3NHQ A;  3EOI A;  1XXM A;  4GCZ A;  3MQL A;  1ID3 C;  4B9O A;  5EPH A;  4KUD D;  4J8W C;  2O9B A;  4I5S A;  1DP6 A;  1ES3 A;  4S2I A;  4JGO A;  3V9R A;  1W1V A;  2ZM5 A;  3P7N A;  1K25 A;  1PWG A;  1B6W A;  4FH2 A;  4NXB A;  2Y8H A;  3X1V A;  5GXQ C;  3KUY C;  3E4O A;  3REK C;  1BLP A;  3HJK A;  2FFF B;  4X68 A;  3QP8 A;  5IS1 A;  3WA9 D;  3KSF A;  2JBF A;  4HH3 A;  3RJU A;  3L28 A;  1N1J A;  4KGC A;  1L0D A;  4H9R B;  3UDI A;  4IJG A;  5B0Y C;  1P3A C;  2HZ5 A;  4JPM A;  3AZK C;  3AN2 B;  4X1M A;  4Y17 A;  4X56 A;  3ZHH A;  1M19 B;  4J8U A;  1YLW A;  1M18 A;  1ID3 D;  2PD7 A;  3AZH B;  3DAV A;  3MGQ A;  3G34 A;  4E3O A;  2ARO D;  5HDS A;  3AZN C;  5AV5 A;  3O87 A;  5B24 B;  2BYM A;  3H0L C;  4PM5 A;  4I38 A;  1GSX A;  3KUY D;  3T12 B;  3X1T D;  3REK D;  1AOI B;  4WU8 D;  2VZW A;  4S2P A;  5DF7 A;  4UHU A;  3VH5 W;  2Y2P A;  5GSU B;  1WYC A;  1TVF A;  4IJE A;  4HIA A;  4UA7 A;  3NI9 A;  5B0Y D;  4JJN A;  2B5R A;  2WGW B;  3L26 A;  3WRT A;  2X02 A;  3AZK D;  3AN2 C;  1J3W A;  4R3J A;  4DKI A;  4CQH A;  5B33 C;  4JGR A;  3AV1 D;  3A1K A;  1M19 C;  3KYQ A;  3BYD A;  4N1X A;  3MXS A;  3AZH C;  5AV8 A;  1KGG A;  4DE3 A;  2GNX A;  3RH8 B;  3B3X A;  3DTI A;  5B24 C;  2Y2L A;  5KIZ A;  2HF6 A;  2J8Y A;  1BLC A;  4OJ5 A;  4DE1 A;  4WV4 B;  5FA7 A;  1AOI C;  3C30 A;  3UME A;  3LEL A;  5BO0 B;  3LO7 A;  1S66 L;  3VE4 A;  1HD8 A;  1N9N A;  5GSU C;  3QP5 A;  5HD5 A;  2JE5 A;  5TBM A;  3A6N B;  1Z6F A;  4NY2 A;  1ACF A;  4GDB A;  1ES2 A;  3EEH A;  4QNL A;  4R8P B;  4J8V B;  3VH6 T;  4Z2J A;  4WBG A;  1M19 D;  2QYB A;  5B31 A;  5EFW A;  1SKO A;  3W97 A;  3QP4 A;  1YSQ A;  4IBG A;  1Y54 A;  3LCE A;  5CPI B;  1M6K A;  1Q2P A;  4ETZ A;  2BLS A;  1NZO A;  3OBF A;  3BLM A;  3UB6 A;  5B24 D;  3LIC A;  5DKL A;  3E2K A;  4EBP A;  1VET B;  1AOI D;  1LI9 A;  1Z09 A;  1ESU A;  1H0I A;  2NUT C;  1WWI A;  3A0S A;  4Z2K A;  3T4L A;  4HP9 A;  1F66 D;  1S1Z A;  3MS6 A;  3LR3 A;  1K56 A;  1KX4 C;  3K3C A;  5B2I A;  1P3B D;  3L25 A;  4PM7 A;  4ZAM A;  5K5B A;  2ZQ9 A;  3MZE A;  4R3B A;  5F5Y A;  3A6N C;  1CK7 A;  2ZLY A;  4WN5 A;  3CZD A;  4G3K A;  4J8V C;  2JC7 A;  2WAF A;  3S22 A;  4KQQ A;  3TSG A;  3EQV A;  3TRC A;  5CPI C;  5FQM A;  3DBA A;  4EXO A;  4WU9 B;  3O62 A;  1VM1 A;  4R0Q A;  5AV9 A;  1WE4 A;  2P9V A;  1TDL A;  4Z2L A;  4GS9 B;  1TEM A;  1K55 C;  3KWQ B;  3R7W B;  4EBL A;  1RCJ A;  3MVD A;  3HLB A;  3X1U B;  4Z2G A;  2A24 A;  2ZQ7 A;  1YU2 A;  4OQG A;  3B0C T;  1YU1 A;  1HQ3 D;  5L09 A;  3FDD A;  5CEB A;  3FG8 A;  3MNN A;  1E6R A;  4YWZ A;  4R8P D;  3QP6 A;  1O7E A;  3Q7Z A;  3HLC A;  2UV0 E;  4X25 A;  3UPP A;  1PW1 A;  2RTS A;  2QZ6 A;  2QHK A;  3HBR A;  4JXS A;  1GOI A;  3UTA A;  4WU9 C;  2PYR A;  4OOY A;  5DVA A;  2VGL M;  3Q7V B;  1E4D A;  5FUG B;  4RVA A;  3KWQ C;  3C2W A;  1W8Q A;  3R45 A;  5HWW A;  2DNS A;  3X1U C;  3AV2 A;  1F9I A;  4GB7 A;  4HJ6 A;  3IF5 A;  3UB9 A;  1JFI B;  3V3R A;  1YLY A;  2YFW B;  4J8X B;  5B32 B;  2WKH A;  3KYZ A; 
#chains in the Genus database with same CATH homology
 4H9Q B;  3NDG A;  5B1M A;  5JA4 B;  3N3F A;  4Z5T A;  3C1C C;  5DNN C;  3MGS A;  3HLG A;  1KX3 C;  5G49 B;  4WU9 D;  1NY0 A;  1I5Q A;  1KE0 A;  2ZY2 A;  1MKI A;  1YQS A;  5BT1 D;  3KXB A;  3MGP A;  1P3F A;  3WTP C;  1ERM A;  4XXR A;  3OC2 A;  2XQZ A;  5GT0 B;  2OLV A;  2DQN C;  1BZA A;  1IKG A;  3PBS A;  2PYO A;  2ZM2 A;  1BUL A;  5KDM A;  1P3K B;  3VH6 W;  2ZC3 B;  1CK3 A;  1K57 A;  4MLL A;  1CEG A;  3C7U A;  3IHA A;  3W98 B;  4X53 A;  3A3D A;  1T3U A;  1PI4 A;  1EQZ B;  2FJ7 A;  4R4S A;  2Y55 A;  4MNR A;  5FAP A;  4JLF A;  4YM6 A;  4J8X D;  3M6H A;  5B32 D;  3G31 A;  1W8Y A;  4GOG A;  3AYW D;  1SKF A;  5CHM A;  4WMC D;  4H9N B;  2F8N G;  3X1S B;  5M19 A;  1WWS A;  1FOF A;  1JWV A;  1FR6 A;  3SS5 A;  4UA9 A;  5B1L B;  1KVM A;  3AZE A;  3W98 C;  1P3G B;  3AZJ A;  4WJ3 C;  5FQI A;  4J8W A;  3AZG A;  1EQZ C;  5FAT A;  3WKJ A;  5AQ7 A;  5EVI D;  5GXQ A;  3IXG A;  1KU5 A;  3PAE A;  2Y2J A;  5GT0 D;  4NFT A;  3LZ1 D;  3B0C W;  3ZG7 B;  1ZLA C;  5E5A C;  4U3T A;  5CPJ B;  5AVC C;  4OKP A;  1P3K D;  1P3A A;  4PMA A;  5FI6 A;  4IBB A;  3S1Y A;  5B1L C;  1MPL A;  4C75 A;  3NBL A;  3HVF A;  1L0F A;  4PPR A;  1EQZ D;  2Q9M A;  1XP4 A;  3AZN A;  4EV4 A;  1P3M B;  5GLC A;  2XEP A;  2HP6 A;  3SS3 A;  3VSL A;  4LV1 A;  4J8U D;  4X23 A;  1M18 D;  4K0W A;  5E2G A;  3NQJ A;  3X1S D;  3LZ0 A;  5B33 A;  4E3N A;  5B1L D;  1YLZ A;  5DF8 A;  1RP5 A;  4WNN B;  1P3G D;  3LJA B;  4P0M A;  4FCF A;  3REI B;  5E2F A;  2Y59 A;  4CAY B;  2ZJ9 A;  1U35 C;  1P3M C;  3DW0 A;  3WS4 A;  1HTZ A;  5BS7 C;  5CPJ D;  1G6A A;  5BOH A;  3LY3 A;  1BH9 B;  3HUN A;  4KQO A;  5AV8 D;  1ONG A;  3IP4 C;  1L2S A;  5CEC A;  4XUJ B;  5AQA A;  1YLT A;  3ZNT A;  5JRG A;  5AV6 B;  1NRF A;  2Y91 A;  3AFA B;  3UTB B;  3RXX A;  3H0M C;  3LEL D;  1P3O C;  3VFF A;  3REI C;  3FKV A;  4KZ4 A;  4UA6 A;  2ZM8 A;  2EXA A;  2ZQD A;  1KX5 A;  2VQR A;  3F6T A;  1WYB A;  4GN2 A;  2JCH A;  1KX4 A;  2WKI A;  3WWX A;  3MGR B;  1IEM A;  3AZF C;  4WEL A;  3MKF A;  4HES A;  4N9K A;  4G92 B;  1QMF A;  3Q82 A;  3OPR A;  4XUJ C;  1I2S A;  5AV6 C;  5BNX B;  3LJA D;  4GHA A;  4IBJ A;  3AFA C;  3UTB C;  3EG5 B;  3REI D;  2F8N A;  5CP6 C;  4H9O A;  1IYQ A;  2ZMA A;  2F8N H;  4UAA A;  3P09 A;  2HIO A;  1K6R A;  4Y0O A;  4ZDX A;  1FR1 A;  5EUA A;  2I72 A;  1B67 A;  3G4P A;  3GTC A;  5A90 A;  4NZ3 A;  2NQB C;  2EFX A;  4G92 C;  3AZI C;  4XUJ D;  5AV9 D;  1BH8 A;  5AV6 D;  4DF6 A;  3B6G C;  3AFA D;  3UTB D;  3Q07 A;  2CV5 B;  3WAA B;  4E3K A;  4ZUX B;  4WZ5 C;  5DNM B;  4OPQ A;  2BYK B;  3MNN D;  3P5J B;  3EPJ A;  3DTM A;  3MGR D;  4NE6 A;  2HDS A;  3VH5 A;  1K4E A;  4IBR A;  3C1C A;  5DNN A;  2H0T A;  1KX3 A;  3C7V A;  4KZ6 A;  5IHV A;  3IH9 A;  1FCN A;  3TU4 C;  2QMI A;  4KZ8 A;  3HRE A;  3WAA C;  3NQU B;  4KUD C;  2NZD D;  4YS3 A;  4UUZ A;  3WTP A;  4NE3 A;  2ZQC A;  5DNM C;  4MBK A;  3EPL A;  4G91 B;  1P3I A;  4IVI A;  1G68 A;  5B2J A;  3O86 A;  4WU8 B;  3MGS D;  1BLH A;  3EPK A;  2ZC5 B;  3WS5 A;  4O7D A;  2XH9 A;  5DTS A;  3W99 B;  3A1I A;  1ZC2 A;  1P3F D;  3AV1 B;  2CV5 D;  3KSY A;  3AZM A;  3WAA D;  4H9S C;  3GR2 A;  1XPB A;  2WUQ A;  3IXD A;  3N4I A;  1JTG A;  2ARO C;  3REJ B;  4ZUX D;  2XR0 A;  1P3L A;  4WEK A;  1P3P B;  5DNM D;  1PWC A;  3OPL A;  3G2Z A;  3X1T C;  4GKU A;  4WU8 C;  1K54 C;  3UT9 A;  3W99 C;  3VFH A;  4OJP A;  2ZC4 B;  3UPO A;  5BNV A;  4KHA A;  4Y0U A;  1ULY A;  3AV1 C;  5F83 A;  1XA7 A;  2C5W B;  1YU0 A;  5F99 A;  4X55 A;  1HVB A;  1P3P C;  1M1A A;  3L2A A;  4GDN A;  4CSR B;  1LHY A;  1ZLA A;  5E5A A;  3PTE A;  1F66 B;  1JTD A;  5GT3 B;  5AVC A;  1JWZ A;  1P3B B;  3AZJ D;  3W99 D;  3V39 A;  1H3O A;  3AZG D;  3IF6 B;  1CI8 A;  4QLC A;  5AVB A;  3G35 A;  3AL0 C;  5FAS A;  5F82 A;  3W96 B;  3P98 A;  3C1B A;  2EX8 A;  1OME A;  5CXW A;  3HON A;  3REJ D;  1P3P D;  3REL B;  3EPH A;  5FI2 A;  4BL2 A;  3L27 A;  1GA9 A;  5HL1 A;  1DY6 A;  1F66 C;  1N9B A;  3FYZ A;  3N8L A;  3AZL A;  4DE0 A;  3GMW A;  5B0Z B;  1P3B C;  2BG1 A;  3VMA A;  5KSC A;  4HBU A;  1HQ3 B;  1P34 B;  2HPB A;  3IF6 C;  2V20 A;  5CPK A;  4P6B A;  5C3I B;  2ZQ8 A;  4PM9 A;  4MBH A;  3W96 C;  3DWZ A;  5JYO A;  1K6S A;  3HLD A;  4GZB A;  3KFU G;  2FFY A;  3C4O A;  4S2N A;  1U35 A;  1P3M A;  1YM1 A;  1MBL A;  4X23 D;  2E8I A;  4QD4 A;  2RVQ D;  4XZQ B;  4HGA B;  2G5I C;  1W79 A;  2CC1 A;  1M40 A;  5EOE A;  5GT3 D;  3ZVT A;  5B0Z C;  4E3M A;  4U0X A;  1O07 A;  3CG5 A;  4QHC A;  1ES5 A;  1HQ3 C;  4H9P B;  1P34 C;  1TZY D;  1GCE A;  1FQG A;  3IQA A;  2IWC A;  3VH6 A;  5C3I C;  4LV0 A;  1ZG6 A;  4R8P C;  5EVL A;  5KMW A;  3W96 D;  5B40 A;  5M18 A;  3A3J A;  1KGF A;  1P3O A;  4Z66 B;  4JBF A;  3REL D;  5AQB A;  2DCF A;  3OPP A;  1JVJ A;  1ZG4 A;  4XZQ C;  4HGA C;  4OVD A;  2DRW A;  4FSF A;  2WZZ A;  5B0Z D;  5AY8 A;  3AZF A;  1P34 D;  3BFC A;  1H8Z A;  1EI5 A;  4LEN A;  2G2W A;  2QPN A;  3A3E A;  3M2J A;  4JF5 A;  1SHV A;  3IXB A;  3IWO A;  3Q1F A;  3UY6 A;  3UO9 A;  4LD9 B;  3AGD A;  3RXW A;  5TGF A;  4BJP A;  5CP6 A;  5E43 A;  5DTT A;  2EXB A;  3NC8 A;  4XZQ D;  3REH B;  1K38 A;  2ZC7 A;  1QME A;  3Q81 A;  3GRJ A;  5BT1 C;  3LY4 A;  1S32 D;  2IO5 B;  1TAF A;  4JXG A;  2JSS A;  3FV7 A;  4S2L A;  2Y2G A;  4YFM A;  2PU2 A;  2NQB A;  3AYW B;  3AZI A;  3B6F B;  4RYE A;  4Z2M G;  1TDG A;  2L5A A;  3B6G A;  1F1E A;  4Y0T A;  1ONH A;  3ZNY A;  4Z66 D;  4HEF A;  4L0L A;  1PZR A;  2HIO D;  2EFU A;  1BTL A;  3REH C;  3SOI A;  5EVI B;  3N8S A;  3IXH A;  1YUE A;  3LZ1 B;  2EX6 A;  2HUE B;  2YFV A;  2PBY A;  4J8X C;  4WM9 A;  5B32 C;  5CTM A;  3AYW C;  3HLE A;  1J9M A;  2A3U A;  3B6F C;  5E2H A;  4LD9 D;  1E3U D;  3V9R B;  3TU4 A;  2V1Z A;  3X1V B;  4GD6 A;  4KUD A;  1H8Y A;  3IH8 A;  3REH D;  2HDU A;  5A92 A;  5EVI C;  2ZM0 A;  1N1J B;  4KGC B;  5GT0 C;  3LZ1 C;  3WA9 A;  3N6I A;  4B4X A;  4WZS B;  1LL9 A;  4JF6 A;  1YU3 A;  4J8U B;  3HUM A;  1M18 B;  1P3K C;  3B6F D;  3A3F A;  2XLN A;  3MGQ B;  1NZU A;  5AV5 B;  3SH8 A;  2Y4A A;  4KG6 A;  1IYS A;  2BYM B;  1ID3 A;  4OH0 A;  3X1V C;  2HDR A;  2XFS A;  3CJM A;  3ZG0 A;  4ZBE A;  3SH7 A;  2CWE A;  1PYY A;  2ARO A;  4OQ0 A;  3ZG5 A;  3MBZ A;  3KS8 A;  3KUY A;  2VGK A;  4KGC C;  3X1T A;  3REK A;  4OOL A;  5GLD A;  4WU8 A;  4JJN B;  4K91 A;  4WZ4 A;  5CED A;  3BFG A;  3UNW A;  4J8U C;  4S2M A;  1M18 C;  4NZ5 A;  5B0Y A;  5AV8 B;  3X1S C;  3AZK A;  1C3B A;  5AV5 C;  1E25 A;  1YU4 A;  4H8R A;  3X1V D;  1DJB A;  1P3G C;  5GLA A;  5CGW A;  3PBT A;  3LEL B;  4XUZ A;  1CI9 A;  5CGX A;  3VP4 A;  4AWL B;  4KZ7 A;  2Q9N A;  4KGC D;  1ES4 A;  1BT5 A;  4JJN C;  5CPJ C;  3VSK A;  3WRZ A;  1GA0 A;  4HBT A;  5B31 B;  4H9R A;  3W97 B;  1GHI A;  5AV8 C;  3A3I A;  1YMS A;  4U0T A;  3MGQ D;  3AN2 A;  5F99 D;  4WYY A;  1L0E A;  1MWR A;  5AV5 D;  5TR7 A;  1M19 A;  2Z2M B;  3B0D B;  4P87 A;  3AZH A;  1BFM A;  1PIO A;  2OV5 A;  3BFD A;  3IT9 A;  4S2O A;  3LEL C;  4C6Y A;  5CTN A;  5B24 A;  2WAD A;  4AWL C;  5B2I B;  5B32 G;  2XFT A;  5G18 A;  4CSR A;  3ITA A;  1AOI A;  4Z2M H;  4QJG A;  4JJN D;  1W7F A;  5HAR A;  5HX9 A;  4NK3 A;  1XA1 A;  3C5A A;  5GSU A;  2Y2O A;  4NZ4 A;  1P3B A;  5B31 C;  3VP3 A;  2WGW A;  2ZC6 B;  4IBD A;  2J9O A;  3AGE A;  3O62 B;  3B0D C;  5AV9 B;  2P9V B;  4DQY B;  3MKE A;  4NET A;  3LJA C;  1I2W A;  1FCO A;  3MVD B;  2WAE A;  2WGV A;  2HDQ A;  5EEC A;  4BEN A;  3AZL D;  5B2I C;  3ISG A;  3ZGA B;  5BO0 A;  4IBF A;  4BQM A;  5FQJ A;  4QU3 A;  3MNN B;  1FCM A;  4EQI A;  3KS4 A;  5B31 D;  3W97 D;  3A6N A;  4Z9Q A;  1HTA A;  4NYU A;  2R9X A;  5FSR A;  4R8P A;  4J8V A;  3UTA B;  5U47 A;  3O62 C;  5AV9 C;  4DE2 A;  5CPI A;  3R45 B;  2Y2K A;  3MVD C;  3AV2 B;  1K56 D;  5B2I D;  1K55 A;  1ALQ A;  1Q9C A;  2NZD B;  3WS0 A;  3MNN C;  4Q8I A;  1W5D A;  3L29 A;  3MGR C;  5B1M B;  5HW3 A;  4Z5T B;  3MGS B;  3SH9 A;  3O62 D;  4OP5 A;  3PBO A;  3M6B A;  5M1A A;  3UDF A;  4YIN A;  3KXB B;  1P3F B;  3MGP B;  3MVD D;  4WU9 A;  4LCL A;  4IVK A;  4BD1 A;  1H5X A;  3KWQ A;  1CEF A;  2NZD C;  4EWF A;  3X1U A;  2PYO B;  4OP8 A;  5KDM B;  1S6R A;  4OPZ A;  4N1H A;  2Y2M A;  4EUZ A;  5A93 A;  4Z5T C;  3MGS C;  2XK1 A;  2J9P A;  3UTA D;  4CJN A;  3GQZ A;  4KZ9 A;  2HP9 A;  3KXB C;  3MGP C;  1P3F C;  2FJ7 B;  3UDX A;  2CV5 C;  3AV2 D;  3S4X A;  3UE0 A;  3Q7V A;  5FUG A;  5B31 G;  3V5M A;  4YM6 B;  4LV2 A;  4ZUX C;  2PYO C;  5GHZ A;  3VOZ A;  5CHU A;  1JFI A;  5B1M D;  3H0R C;  4Z5T D;  2YFW A;  4J8X A;  3LEZ A;  5B32 A;  1IYP A;  5KSH A;  3AYW A;  1IEL A;  3PBQ A;  3AZE B;  3AZJ B;  4H9Q A;  4J8W B;  4Y7P A;  4EBN A;  3AZG B;  5JA4 A;  3WKJ B;  5G49 A;  3UPN A;  5GHY A;  4BD0 A;  3KXB D;  3MGP D;  1Q2Q A;  4DXC A;  3FKE A;  2XD5 A;  4KZ3 A;  2Y2N A;  2PYO D;  2H5S A;  5GT0 A;  4E3L A;  3GVB A;  2RL3 A;  1P3A B;  4G91 C;  1YLJ A;  5E2E A;  1PZP A;  3AZE C;  1P3K A;  3AZJ C;  3AZG C;  3WKJ C;  3AZN B;  1ZKJ A;  5JYP A;  2FJ7 D;  4GHL A;  3W98 A;  4E3J A;  1BSG A;  1NXY A;  3HUO A;  5A91 A;  1EQZ A;  4ZBJ B;  1XKZ A;  2H10 A;  4YM6 D;  3VOY A;  3GV9 A;  4IJF A;  3REJ C;  3G2Y A;  4RA7 A;  4X23 B;  4B4Z A;  3NQJ B;  3WS2 A;  3LZ0 B;  4IED A;  5B33 B;  4OON A;  1ERO A;  2X71 A;  1R4V A;  5F1G A;  1BLS A;  4M6B A;  3AZE D;  4H9N A;  2GDN A;  4QY5 A;  4OPR A;  3X1S A;  4J8W D;  4DRT A;  1TZY B;  3PBR A;  4E6X A;  3WKJ D;  2WGI A;  5B1L A;  3IWQ A;  4X6T A;  5GXQ D;  1P3G A;  5KZH A;  4UPK A;  4ZBJ C;  3VP1 A;  2J8P A;  4X23 C;  2WKE A;  3ZFZ A;  1P3A D;  2RVQ C;  4FH4 A;  3UE1 A;  3LZ0 C;  3UN7 A;  3TOI A;  1DJC A;  5CPJ A;  3W4O A;  3FKW A;  3VP2 A;  5GT3 C;  5L2F A;  1U60 A;  5JRG B;  5DTK A;  1TZY C;  3OCN A;  3AZN D;  1RGY A;  1VQQ A;  1RGZ A;  1LI0 A;  2ZQA A;  3BM6 A;  1KX5 B;  4DXB A;  2EX9 A;  2Y2Q A;  1KX4 B;  5EOO A;  3REL C;  1MWS A;  4QY6 A;  3ZG8 B;  3LZ0 D;  1N4O A;  3AN2 D;  4JXV A;  5BS7 A;  3IWI A;  5B33 D;  1S32 B;  1AXB A;  3AGF A;  2EX2 A;  5JRG C;  3AZH D;  5BPV A;  3UE3 A;  1LLB A;  1YMX A;  2F8N B;  4DDY A;  4H9O B;  4WNN A;  3LJA A;  2RCX A;  3REI A;  1KX5 C;  5FAO A;  4WEJ A;  4CAY A;  5GSU D;  2HIO B;  3ZG9 B;  4RX2 A;  1NYM A;  3NIA A;  2UWX A;  3WS1 A;  2IOU A;  1FSW A;  1S32 C;  3V3S A;  1BH9 A;  2F8N K;  1BH8 B;  5JRG D;  5CHL B;  3BFE A;  1K4F A;  5CRF A;  4OJO A;  1KDW A;  2Y2I A;  4XUJ A;  4LCM A;  1PWD A;  5AV6 A;  3JYI A;  1SDE A;  3AFA A;  3UTB A;  1KX5 D;  5FQQ A;  4Z66 C;  2G5H C;  1KX4 D;  2HIO C;  1KDS A;  3A6N D;  4DRB A;  4KG5 A;  2ZY5 A;  4J8V D;  4CPK A;  2WK0 A;  4C3Q A;  3MGR A;  4PM6 A;  3C1C B;  5DNN B;  5CPI D;  1KX3 B;  4MEZ A;  3N8R A;  5GL9 A;  2F8N D;  4KZ5 A;  5BNX A;  1A7W A;  4LD9 C;  4YS3 B;  4UUZ B;  3WTP B;  1SDN A;  5DF9 A;  1P3I B;  5CHJ A;  5B2J B;  4B88 A;  2NZD A;  1MWU A;  4WZ5 A;  2OLU A;  2IO5 C;  4E45 A;  4EO5 B;  1L0G A;  3AZM B;  3EQU A;  3OCL A;  4S2J A;  1MXO A;  3MXR A;  3KWQ D;  1Z2C B;  4YS3 C;  1P3L B;  2CV5 A;  3X1U D;  3O88 A;  5CER A;  3QNB A;  3WAA A;  4GD8 A;  1P3I C;  1NJ4 A;  5B2J C;  4ZUX A;  5DNM A;  2BYK A;  3UT9 B;  5BNV B;  4KHA B;  4DDS A;  3C1C D;  4OOM A;  5DNN D;  1XGI A;  2HUE C;  1KX3 D;  4EO5 C;  1MWT A;  2H0Y A;  5FI7 A;  2XD1 A;  3AZM C;  3HSH A;  5F99 B;  2P74 A;  4YS3 D;  1P3L C;  3WTP D;  4E6W A;  1GHP A;  3ZDJ A;  2OSU A;  3W4P A;  1M1A B;  4OJ6 A;  3D4F A;  4IBC A;  4H9S A;  3NQU A;  1IYO A;  1P3I D;  1ZLA B;  5E5A B;  5B2J D;  4DRA A;  3W4Q A;  5FAQ A;  4PM8 A;  4N92 A;  5AVC B;  3UT9 C;  2X01 A;  1ERQ A;  1H3O B;  3MFD A;  4QLC B;  5AVB B;  1K54 A;  3V50 A;  2IWD A;  3HL9 A;  3AZM D;  4BL3 A;  3W99 A;  3C1B B;  5HAI A;  3MGQ C;  5F99 C;  4JF4 A;  1P3L D;  3AV1 A;  1M1A C;  3IHB A;  3MZF A;  5GLB A;  5GHX A;  5F1F A;  3REJ A;  1P3P A;  3VP0 A;  1S0W A;  3AZL B;  2XDM A;  3OPH A;  4NE5 A;  3UT9 D;  2XF3 A;  3SS4 A;  4QLC C;  5CPK B;  5AVB C;  1PI5 A;  4K0X A;  3NCK A;  2WYX A;  3N7W A;  3PBN A;  1KVL A;  5HAP A;  3W98 D;  3C1B C;  3TG9 A;  2XGN A;  4P85 A;  2C6W B;  5FQ9 A;  5FQK A;  4OLD A;  4LG2 A;  3ZCZ A;  1PZO A;  2PU4 A;  1U35 B;  1M1A D;  1JWP A;  1ZLA D;  5E5A D;  5CGS A;  3AZL C;  5AVC D;  2A49 A;  1SCW A;  4ZTK A;  4QLC D;  5CPK C;  5AVB D;  1F66 A;  5GT3 A;  3C4P A;  3W8K A;  5B40 B;  3C1B D;  1NYY A;  1TZY A;  3W97 C;  3IF6 A;  3MZD A;  2G2U A;  1P3O B;  4NZ1 A;  3OZH A;  4S2N C;  3W96 A;  4LV3 A;  3HLF A;  3NDE A;  2WZX A;  2ZY4 A;  3ITB A;  3ZVW A;  3REL A;  4X69 A;  3I7J A;  4KG2 A;  5AY8 B;  4ZJ3 A;  3AZF B;  4D2O A;  2IWB A;  1HZO A;  5CPK D;  3FWL A;  3DWK A;  1XGJ A;  2R9W A;  4KQR A;  5B0Z A;  2Z2L B;  3BRM A;  1HQ3 A;  4A5R A;  5B40 C;  1P34 A;  4IBX A;  5HFO A;  4RX3 A;  3HLW A;  5CP6 B;  1U35 D;  1P3M D;  1FSY A;  5TFQ A;  1KE4 A;  4KZA A;  3WX7 A;  1KE3 A;  1DJA A;  3M2K A;  1TAF B;  5AY8 C;  4XZQ A;  2DF4 C;  1S32 A;  2NQB B;  3QHY A;  3AZI B;  3B0B A;  4JXW A;  1EWZ A;  4E3I A;  4H9P A;  5B40 D;  3B6G B;  5FDH A;  2V2F F;  4F94 A;  1P3O D;  3BEC A;  1YT4 A;  3QNC A;  1YLP A;  3UTA C;  1BUE A;  5AQ9 A;  2HP5 A;  3G32 A;  3E2L A;  3FZC A;  4Z66 A;  4ZJ1 A;  3AV2 C;  3WTP E;  4GH9 A;  5AY8 D;  1PW8 A;  3AZF D;  1MY8 A;  2YFV B;  3VH5 T;  4MBF A;  4IBI A;  4XUX A;  2F2A C;  4OQI A;  3GSG A;  5B1M C;  1W2E A;  4R4R A;  3G30 A;  3TU4 B;  3BEB A;  5CP6 D;  4IBE A;  2LY8 A;  3NY4 A;  4KUD B;  4LD9 A;  1E3U A;  1GHM A;  1LL5 A;  4R1G A;  3CMZ A;  1ESI A;  1XX2 A;  4QB8 A;  3REH A;  3O3V A;  3WA9 B;  4GNU A;  2NQB D;  3BLS A;  3AZI D;  2J7V A;  4KEN B;  4OJL A;  1K57 C;  3B6G D;  4OQH A;  5HAQ A;  4OUI A;  1KGE A;  3BFF A;  1ID3 B;  4WMC A;  3B6F A;  4KZB A;  2Y2H A;  4ZJ2 A;  2ZY3 A;  3PAG A;  2ARO B;  2W8S A;  1IKI A;  4JKT A;  4BLM A;  2VGJ A;  2RIQ A;  4E44 A;  2FJ7 C;  5GXQ B;  3KUY B;  5EE8 A;  3X1T B;  3REK B;  4ID4 A;  4YM6 C;  3WA9 C;  4S2K A;  4IBK A;  4OPY A;  4FD8 A;  4M3K A;  4OLG A;  5EVI A;  4R23 A;  5J8X A;  4NYY A;  4N9L A;  5I94 A;  5B0Y B;  3LZ1 A;  3AZK B;  5D3O A;  3TU4 D;  2ZD8 A;  1XXM A;  1ID3 C;  5EPH A;  4KUD D;  4J8W C;  1ES3 A;  4S2I A;  3V9R A;  2ZM5 A;  1K25 A;  1PWG A;  1B6W A;  4FH2 A;  3X1V A;  5GXQ C;  3KUY C;  3REK C;  1BLP A;  2FFF B;  4X68 A;  3WA9 D;  2JBF A;  3RJU A;  3L28 A;  1N1J A;  4KGC A;  1L0D A;  4H9R B;  3UDI A;  5B0Y C;  1P3A C;  4JPM A;  3AZK C;  3AN2 B;  4X56 A;  3ZHH A;  1M19 B;  4J8U A;  1YLW A;  1M18 A;  1ID3 D;  3AZH B;  3MGQ A;  3G34 A;  4E3O A;  2ARO D;  3AZN C;  5AV5 A;  3O87 A;  5B24 B;  2BYM A;  3H0L C;  4PM5 A;  3KUY D;  3X1T D;  3REK D;  1AOI B;  4WU8 D;  4S2P A;  5DF7 A;  4UHU A;  3VH5 W;  2Y2P A;  5GSU B;  1WYC A;  1TVF A;  4IJE A;  4UA7 A;  3NI9 A;  5B0Y D;  4JJN A;  2B5R A;  2WGW B;  3L26 A;  3WRT A;  2X02 A;  3AZK D;  3AN2 C;  4R3J A;  4DKI A;  5B33 C;  3AV1 D;  3A1K A;  1M19 C;  3BYD A;  4N1X A;  3MXS A;  3AZH C;  5AV8 A;  1KGG A;  4DE3 A;  3B3X A;  5B24 C;  2Y2L A;  2J8Y A;  1BLC A;  4OJ5 A;  4DE1 A;  4WV4 B;  5FA7 A;  1AOI C;  3LEL A;  5BO0 B;  3LO7 A;  1HD8 A;  5GSU C;  2JE5 A;  3A6N B;  1Z6F A;  4NY2 A;  4GDB A;  1ES2 A;  4QNL A;  4R8P B;  4J8V B;  3VH6 T;  4WBG A;  1M19 D;  5B31 A;  3W97 A;  4IBG A;  3LCE A;  1Y54 A;  5CPI B;  1M6K A;  1Q2P A;  2BLS A;  1NZO A;  3BLM A;  5B24 D;  3E2K A;  4EBP A;  1AOI D;  1LI9 A;  1ESU A;  1WWI A;  1F66 D;  1K56 A;  1KX4 C;  5B2I A;  1P3B D;  3L25 A;  4PM7 A;  4ZAM A;  2ZQ9 A;  3MZE A;  4R3B A;  3A6N C;  2ZLY A;  3CZD A;  4J8V C;  2JC7 A;  2WAF A;  3S22 A;  4KQQ A;  3TSG A;  3EQV A;  5CPI C;  5FQM A;  4WU9 B;  3O62 A;  1VM1 A;  4R0Q A;  5AV9 A;  1WE4 A;  2P9V A;  1TDL A;  1TEM A;  1K55 C;  3KWQ B;  4EBL A;  1RCJ A;  3MVD A;  3HLB A;  3X1U B;  2ZQ7 A;  1YU2 A;  4OQG A;  3B0C T;  1YU1 A;  1HQ3 D;  3FDD A;  5CEB A;  3MNN A;  4R8P D;  1O7E A;  3Q7Z A;  3HLC A;  3UPP A;  1PW1 A;  2QZ6 A;  3HBR A;  4JXS A;  3UTA A;  4WU9 C;  4OOY A;  5DVA A;  3Q7V B;  1E4D A;  5FUG B;  4RVA A;  3KWQ C;  1W8Q A;  3R45 A;  2DNS A;  3X1U C;  3AV2 A;  4GB7 A;  3IF5 A;  1JFI B;  3V3R A;  1YLY A;  2YFW B;  4J8X B;  5B32 B;  2WKH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...