2BG1A

Active site restructuring regulates ligand recognition in classa penicillin-binding proteins (pbps)
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
484
structure length
455
Chain Sequence
ITYDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTNQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PENICILLIN-BINDING PROTEIN 1B
publication title Active Site Restructuring Regulates Ligand Recognition in Class a Penicillin-Binding Proteins
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Peptidoglycan
total genus 147
structure length 455
sequence length 484
ec nomenclature ec 2.4.1.129: Peptidoglycan glycosyltransferase.
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2bg1A01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2bg1A03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2bg1A02
1SDNA 3JYIA 1ES5A 4OPYA 4RVAA 5FI6A 4LCLA 5E2GA 4GN2A 4N9KA 5E2FA 3PBSA 3P98A 1C3BA 4QJGA 5FQQA 3LO7A 1AXBA 1IYQA 2ZQ9A 4WZ4A 4GDNA 1HVBA 2XR0A 4R23A 1RGZA 4KZ7A 2Y2LA 4Y0UA 3N4IA 4QHCA 4DE2A 4Y0TA 2WGWA 3GQZA 3NBLA 4FD8A 3G2YA 3VP0A 1E3UA 3BFCA 1BTLA 1NJ4A 2QZ6A 5KSHA 3PBTA 4IVKA 3ZNTA 1H5XA 1FR1A 1EROA 2OV5A 3ZG8B 3E2KA 1PWDA 1L0EA 3DWKA 5CECA 3BFFA 3I7JA 3V3SA 3ZG5A 5DF9A 1ONHA 1W8YA 2I72A 4EQIA 3FWLA 1RGYA 4YFMA 2ZLYA 2ZJ9A 2ZQCA 2VGJA 1K4FA 4WZ5C 4S2NC 5EVID 3Q7VA 1IKGA 1IYSA 2C6WB 3C7VA 3S1YA 1K6RA 3IT9A 4WMCD 4KZ5A 1XX2A 3LCEA 4X6TA 3IXBA 4EBNA 1Y54A 1S6RA 3G2ZA 1TEMA 4ZTKA 3SS3A 3O86A 1GHIA 2Q9MA 1TVFA 5DTSA 3LEZA 4KZ9A 2WKIA 1VM1A 2ZQAA 3B3XA 1GA0A 3W8KA 1K54A 1O7EA 4R4SA 5GHYA 2G2WA 3V5MA 3ZG7B 1JWPA 2WK0A 3FYZA 3UPNA 1DJCA 2EFXA 3N8RA 5M19A 4GD8A 4BJPA 2JE5A 4R1GA 1SKFA 4MBHA 4N1HA 5CTNA 2H0TA 1HD8A 2IWCA 1PWCA 3IXGA 3A3IA 1ESIA 2OLVA 2ZM2A 4DF6A 3SS5A 2EXAA 4R0QA 1BLPA 4DE0A 3FZCA 3A3JA 4E3OA 1MWSA 3IXHA 1G68A 3CMZA 1MWRA 2WGIA 3PBQA 4RX2A 4DE3A 2HDRA 5FATA 2QMIA 4OPRA 4B88A 4NK3A 5HX9A 5KMWA 2X02A 4RA7A 1IELA 1BLCA 1WYBA 2FFYA 4MEZA 3M2KA 4KG6A 3IHBA 4PM8A 2DRWA 4E3NA 2Y4AA 1K4EA 3Q07A 3IWIA 4JF6A 5GLBA 3GRJA 4IBRA 3FV7A 3IWQA 1BLSA 3HUNA 4OP8A 3W4PA 5AQBA 1QMEA 2B5RA 1BSGA 4WEKA 1BUEA 1W7FA 3VOZA 3UE1A 4GKUA 4N9LA 5DTKA 1XXMA 4OOMA 5GL9A 1RCJA 5FQIA 5CEBA 5HAPA 2Y55A 2E8IA 3PBNA 4S2PA 2QPNA 3ZG0A 5F1GA 3IHAA 2Q9NA 1GCEA 4HEFA 3IXDA 1MXOA 1PI4A 4PM7A 1LI0A 3RJUA 3V3RA 2J9PA 4WELA 3UN7A 3LY4A 4PPRA 2XFSA 1E3UD 1M40A 1MWTA 3SS4A 3ZVWA 2X71A 3ZCZA 4QB8A 2WAEA 4L0LA 2DNSA 4BQMA 4X68A 3ISGA 3UPPA 1IKIA 1PI5A 1S0WA 2P74A 2EX2A 2HDUA 4X69A 2WGVA 3G4PA 3UPOA 1KE4A 4O7DA 2XK1A 3WRZA 1O07A 2WKEA 4P0MA 4LCMA 3EQVA 5E2EA 5GHZA 3N7WA 4QY5A 3IF5A 4WYYA 3WS1A 5HAQA 3AGEA 1KDWA 4GD6A 5CHJA 1BULA 1Z6FA 2WADA 3NIAA 4UHUA 3G35A 1KGGA 3ZFZA 2WYXA 3OCLA 3GTCA 4ZBEA 4QU3A 1GHPA 4NETA 4OH0A 3DWZA 5M1AA 2IWDA 4IVIA 5EOEA 1XGIA 5DF8A 1FCNA 2UWXA 1JVJA 4JXGA 3VSKA 4EUZA 5A90A 4U0TA 4LV2A 5EPHA 3PAEA 5HAIA 4X56A 1YLYA 4GB7A 4IEDA 4MBKA 1SCWA 2GDNA 1BLHA 1TDLA 4DXBA 2A3UA 3RXWA 3GMWA 4OPZA 2HDSA 2ZQDA 2H0YA 4ZAMA 1HTZA 3VP1A 2WAFA 1IEMA 2XGNA 1N9BA 3GVBA 4DRTA 2P9VB 1XA1A 3DTMA 4BENA 5M18A 4LV0A 2XD1A 4BD1A 5F82A 3HLWA 3IWOA 3VP3A 3UE3A 5JYPA 2BG1A 3BFEA 2XEPA 3C5AA 3NY4A 4S2LA 4C6YA 2RCXA 3MXSA 1SDEA 4WBGA 2ZC4B 4R3JA 1CI8A 2Y59A 4Y7PA 1ES4A 1TDGA 3BFGA 4FH4A 3HUMA 4GOGA 3UO9A 5FQJA 2Y2GA 1LHYA 4KZ6A 1L0FA 2OLUA 3N8SA 1L2SA 1PZOA 3IQAA 5E43A 4MNRA 1BT5A 4XXRA 2JCHA 2ZMAA 1K6SA 3D4FA 1JWVA 2WGWB 4WEJA 3G31A 3NDGA 4H8RA 4K0WA 1EI5A 5EVIC 1G6AA 3NC8A 5A91A 1ZG6A 1YLPA 3HUOA 3HBRA 3DW0A 1I2SA 4OONA 2H5SA 4OP5A 5J8XA 3IF6C 1I2WA 2XLNA 2ZC7A 3BLSA 4CJNA 4E3MA 3HL9A 4KZ8A 4OOLA 2HDQA 4BLMA 2FFFB 4RYEA 2EXBA 3M6BA 4JF4A 5A92A 3Q7VB 3VFFA 2C5WB 3VMAA 4DKIA 2Y2QA 2A49A 1E4DA 4GNUA 2Y2OA 1DJBA 4PM6A 3AGFA 3HLDA 1YMSA 2WKHA 5DTTA 3UY6A 1J9MA 2J7VA 4M3KA 3TG9A 3HLFA 5L2FA 1NY0A 1YT4A 3UDXA 1GA9A 4EBPA 3O88A 5AQ7A 3VSLA 4ZJ3A 4S2IA 5CERA 5FQMA 3ZGAB 1W79A 4E3KA 2V1ZA 1ES2A 1JTGA 3LY3A 3MZFA 1ZKJA 3OPRA 2OSUA 1FCOA 3A3EA 2ZQ8A 4RX3A 4A5RA 4FH2A 1LL9A 3UDIA 4N92A 4Z9QA 5I94A 1N4OA 3ZG9B 1NXYA 3W4QA 3Q82A 5HL1A 1PIOA 4KQOA 3PBOA 4OOYA 3ZDJA 3O87A 3NI9A 5CTMA 2WZZA 3SH8A 4XUXA 1LI9A 5EVIB 1HZOA 5HFOA 1ERMA 3SH9A 5FI2A 4DDYA 2PBYA 4XUZA 3S4XA 4UA6A 5DF7A 4ZJ1A 3V50A 5FA7A 2R9XA 3HLEA 3MZDA 3IF6B 4E6XA 1JWZA 4PMAA 1NZOA 3PAGA 4P85A 1NYMA 1EWZA 2Z2LB 3GSGA 2Y2JA 4PM9A 1QMFA 3MKFA 3OPLA 3C7UA 1DJAA 3MZEA 4S2OA 5A93A 1CEGA 1H8YA 1MBLA 3OZHA 1KE0A 4Y0OA 4ID4A 5FAOA 4E3LA 1FQGA 1PYYA 3RXXA 2EX6A 1XPBA 2XF3A 1Q2PA 1BZAA 4QY6A 4B4ZA 4KENB 1YMXA 5FI7A 3Q1FA 1SHVA 1W8QA 3QHYA 2XQZA 4KG5A 2ZC3B 5EUAA 5FAQA 1E25A 1K57A 5IHVA 2BLSA 5CXWA 4PM5A 1XKZA 4E6WA 3C4OA 3ITBA 2ZQ7A 4OPQA 4KZAA 3A3FA 1K56A 5F1FA 1KGFA 4BD0A 1ZG4A 3MFDA 1JTDA 1ONGA 2IWBA 1M6KA 4JXWA 4MLLA 4R3BA 2Y2KA 4P87A 1FCMA 4GDBA 5GLAA 2H10A 3P09A 1U60A 4BL3A 1PWGA 4EV4A 5HW3A 4JBFA 3OCNA 4S2KA 5JYOA 1K54C 2WUQA 2XFTA 3QNBA 2HP9A 3BRMA 3S22A 3M2JA 3M6HA 3PTEA 4E3JA 5FASA 4QD4A 1ERQA 5AQ9A 3IH9A 5EECA 5FQKA 4KG2A 4KZ3A 1FOFA 4OLDA 2XH9A 1ALQA 3UE0A 4DXCA 2DCFA 4D2OA 1CI9A 1MY8A 3UNWA 2WZXA 3MBZA 2XDMA 4K91A 4OLGA 5EOOA 2R9WA 1LLBA 3MXRA 1K38A 3PBRA 1GHMA 4N1XA 4JXVA 5G18A 3BEBA 1FSWA 5CEDA 3WS2A 3ZVTA 4OQHA 3SOIA 1OMEA 2XD5A 2ZD8A 3WS0A 5EE8A 2EFUA 1XA7A 4R4RA 4C3QA 1K55A 5GLDA 1PZPA 4C75A 4OQIA 5CHMA 3HLBA 3MKEA 3NDEA 4U3TA 2Y2HA 4Q8IA 5GHXA 3WS4A 1MPLA 4ZJ2A 2HP6A 3FKWA 4HBUA 1YLWA 4P6BA 1LL5A 5TR7A 5E2HA 1KDSA 1CK3A 3A3DA 3O3VA 3ZNYA 2G2UA 2RL3A 4JXSA 3HLCA 4KQRA 2Y2NA 5U47A 1L0DA 4S2MA 3HVFA 4OQ0A 4BL2A 5FAPA 4DE1A 4CPKA 1ES3A 1IYOA 2J8YA 5GLCA 4LV3A 3E2LA 1L0GA 2EX9A 4LENA 2ZC5B 4OVDA 4WZ5A 5F83A 2JC7A 4S2NA 4GZBA 2ZM0A 2Y2MA 4B4XA 1NZUA 3BM6A 1YLJA 1VQQA 2HP5A 2PU2A 2ZM8A 3HREA 1KVLA 1WE4A 3ZHHA 1KGEA 4UA7A 5KSCA 2Y91A 4OQGA 5HARA 4KQQA 4ZDXA 5KZHA 3N8LA 4MBFA 5FSRA 1K25A 2X01A 1IYPA 3BYDA 3IH8A 3UDFA 5EVIA 5FDHA 3W4OA 1KE3A 1K56D 3C4PA 4FSFA 5TGFA 3G32A 5DVAA 2EX8A 2V2FF 4WM9A 4EBLA 4WMCA 1MWUA 3V39A 3AGDA 1K57C 3IF6A 5CGWA 2Y2PA 4JF5A 4UAAA 3CJMA 4LV1A 2J9OA 2JBFA 4IBXA 1K55C 4JPMA 2PU4A 3G34A 1PW8A 1CEFA 5EVLA 3G30A 4E3IA 4HESA 1XP4A 4KZBA 5BOHA 5CHUA 1YM1A 2ZC6B 5CGSA 3HLGA 3VFHA 4S2JA 2HPBA 1I5QA 3N6IA 1W5DA 4U0XA 3VP4A 3OPHA 3OC2A 3WWXA 3FKVA 2V20A 3QNCA 2Z2MB 4K0XA 1DY6A 1ESUA 4KZ4A 4YINA 4DDSA 2CC1A 4X53A 3GR2A 3EQUA 3Q7ZA 4HBTA 4OKPA 5CGXA 1NRFA 3CZDA 1MKIA 4UA9A 5TFQA 5D3OA 1FR6A 4JKTA 1YLTA 4FCFA 1YQSA 4EWFA 4F94A 4X55A 3ITAA 3SH7A 1Q2QA 3WS5A 5AQAA 5CRFA 3CG5A 3NCKA 5FQ9A 3TOIA 3WRTA 3TSGA 1ZC2A 3VOYA 1FSYA 1KVMA 2VGKA 3BLMA 1XGJA 3GV9A 1H8ZA 3Q81A 1YLZA 4JLFA 3VP2A 1WYCA 3BFDA 1NYYA 1RP5A 3BECA 2Y2IA 3OPPA 1PW1A 2P9VA
chains in the Genus database with same CATH superfamily
3JYIA 1Z09A 3H0LC 1O6IA 1YU1A 4JGRA 5B40D 3P98A 3KUYB 4QJGA 1TZYB 5BO0B 3B6FA 5MC7A 2CV5B 4WZ4A 2Y2LA 4Y0UA 3AZEA 3P7NA 4H9QB 3LELA 2WGWA 3GQZA 4HIAA 1G6OA 1BTLA 5KSHA 5CPJC 2GX5A 3ZNTA 3KSHA 3LUQA 1KX4C 1L0EA 5CECA 3BFFA 1P9WA 3C1BC 3AN2D 2I72A 4EQIA 3PHYA 2PR6A 2HIOB 3VH6A 3L25A 4R70A 3FKEA 4DRBA 2DMWA 4WZ5C 4EW7A 4X25A 4S2NC 5B32D 3Q7VA 3S1YA 3AZIB 1P3MB 1K6RA 3LZ0D 2D01A 3AZGD 2K2NA 3IXBA 3AYWB 3AZJD 1S6RA 4ZTKA 5DTSA 1TVFA 5DNMC 3EPKA 1W63Q 4R4SA 5GHYA 3REIC 1JWPA 5DNNA 2WK0A 4XUJC 1DJCA 2EFXA 4J8WC 3UB6A 1SKFA 3LIAA 4MBHA 1HD8A 3AV2A 2K7SA 5AVCC 3WTPA 1P3FA 4R0QA 5CP6C 3IXHA 5G4ZA 3CMZA 1ZLAA 4MN7A 2WGIA 5B40B 3PBQA 4RX2A 2QMIA 4NK3A 5HD5A 4AFIA 5HX9A 4FOFA 4FTXA 4ETXA 2X02A 3A1KA 1IELA 2O9CA 1WYBA 2FFYA 4MEZA 3RTYA 5J4EA 4PM8A 1K4EA 3Q07A 1DRMA 3IWIA 5BS7C 1ID3D 4Z66D 4KGCD 2LB9A 1QMEA 2B5RA 2QWSA 3MVDA 3CHWP 4DN0A 5TBMA 3AN2B 4OOMA 5E5AA 3UT9D 3IX8A 5FQIA 3E4OA 2Y55A 2E8IA 4S2PA 3RH8B 5B32B 5F1GA 3IHAA 4I3AA 3IXDA 4H9OA 1OT6A 4PM7A 3V3RA 3JVVA 3F1NA 3LZ0B 4IBCA 3AZGB 2V1AA 3AZJB 4YS3B 3H0MC 2M1CA 4YOFA 1S0WA 5HPFA 3LELC 5G49B 2F8NG 2DF4C 2XK1A 1O07A 4Z2GA 2ZL1A 3EQVA 2K31A 2YFVA 4H9RB 1KDWA 1CQAA 3G35A 5CPIC 3ZFZA 3OCLA 4ZBEA 3MGRA 3LYXA 4Z2MH 1P3KD 5DF8A 2UWXA 3VSKA 5BNVA 4JGPA 2VV6A 4X56A 1B6WA 1SCWA 3A6ND 4HY8A 2A3UA 5KDMB 2ZQDA 2H0YA 1ID3B 4IJFA 1N9BA 5HD3A 4Z1WA 4Z66B 4KGCB 3DTMA 5GT0A 4LV0A 2RVQC 5DNNC 3F1PA 3HLWA 3VP3A 3UE3A 5JYPA 2XEPA 3C5AA 3NY4A 3MGSD 3V9RA 3UT9B 3BFGA 3AV2C 2AVXA 1LHYA 3N8SA 3X1TC 3WTPC 1P3FC 3IQAA 5E43A 3WA9D 2ZMAA 1M1AA 1OGGA 1ZLAC 3D4FA 3VV4A 4WU8A 5DKKA 4H8RA 1G6AA 3OOVA 4DJ2A 2V1BA 5FUGB 3DW0A 4OONA 1P34A 5B0YA 3MQOA 3VE3A 4GS9A 4BBUA 3H82A 5AV5D 3AZKD 4OJ5A 2EXBA 3M6BA 4JF4A 3MVDC 4L9FA 5A92A 5B2JC 4QWOA 5AV9A 4JGQA 2A49A 4ZRRA 2PD7A 3H7WA 4Q0IA 4PM6A 4I3JA 2WKHA 5DTTA 1UR8A 1YSQA 2J7VA 4Z2MG 4M3KA 3TG9A 2F8NK 3KWQD 1DP6A 1TF1A 3TJZC 1DP9A 4Z5TD 5BT1C 3BY9A 1P3KB 1GA9A 4EBPA 4OJOA 4LD9A 4ZJ3A 5IS1A 1JTGA 4X23A 1SZVA 2NZDA 3AFAC 2ZQ8A 3IS2B 3T4OA 1LL9A 3X1VD 1VEUA 4Z9QA 3MXQA 3AZLA 4UEYA 3Q82A 5HL1A 4NXEA 2ZOIA 4OOYA 3O87A 3C38A 3SH8A 3NOTC 5FEFA 1LI9A 3MR0A 4LRZE 1U35A 1ERMA 3NJAA 5FI2A 4WJ3C 3F1OA 3LGOA 4XUZA 3S4XA 1PDCA 2PYOA 2R9XA 3WA9B 1KOUA 4PAUA 4E6XA 5AY8A 3QP1A 4ZUXC 3AZFA 4P85A 2Z2LB 5DFYA 3OPLA 3C7UA 4S2OA 1CEGA 1H8YA 1MBLA 4ID4A 4E3LA 1FQGA 2EX6A 1XPBA 1Q2PA 2ACGA 5B24D 5GT0C 3AZKB 3QHYA 2XQZA 3KUYA 3NULA 1PFLA 1TZYA 5FAQA 5BO0A 1W1TA 2CV5A 4J8VA 3AZHA 3L2AA 5CXWA 3C4OA 1W63M 3ITBA 4OPQA 1E6ZA 2PYRA 5AVEA 2IWBA 1ONGA 5DJUA 5AVBD 2V0UA 3KWQB 1M1AC 2L0WA 4HP4A 4JXWA 4Z5TB 4GDBA 2HJ9C 4WU8C 2YKHA 3OCNA 4JBFA 1PRQA 1K54C 3D3OA 5GXQA 2WUQA 3S22A 2HIOA 3M6HA 5B0YC 2VA0A 3X1VB 4PKYG 5FASA 5AQ9A 3IH9A 1P3IC 3EPHA 3AZIA 4OLDA 1P3MA 3B6FB 3BWLA 1MY8A 3X1SD 1LL8A 4OLGA 3AYWA 5EOOA 3WAAD 5AV9C 2R9WA 1F1EA 5JA4B 3MXRA 3PBRA 3WD4A 2RIQA 3BEBA 5CEDA 4KHAB 4GCZA 1OMEA 5EE8A 1K55A 5GLDA 1WWIA 5GT3D 1PZPA 5CHMA 2A24B 1P97A 3RFBA 5EV0A 2P7JA 2HP6A 3FKWA 4X23C 2NZDC 2W3DA 3BQ8A 1KDSA 5B24B 3O3VA 5B40A 3AZLC 4KQRA 2ZY4A 2Y2NA 4S2MA 2ZM5A 2YFWB 1OJ5A 1ES3A 1U35C 1IYOA 1OTBA 2PYOC 5AVBB 4LENA 3V67A 3LICA 3UB7A 5AY8C 2J3WA 4OVDA 5B0ZD 4KUDC 5C3IB 2W3FA 3DAVA 3AZFC 2ZM0A 2Y2MA 3HJIA 3S7NA 2ZM8A 2HP5A 2PU2A 3ZHHA 3AN2A 2BTFP 3PYPA 5HARA 5KZHA 3N8LA 1NLZA 2X01A 1IYPA 1P3GD 5B32A 3W4OA 3K2NA 2OOLA 5HWTA 3G32A 4EBLA 4WM9A 1T3UA 3KUYC 2O9BA 3LZ0A 3V39A 1TZYC 3AZGA 2Y2PA 5B2ID 3X1SB 3KXBD 4JF5A 3AZJA 4UAAA 3WAAB 4LLOB 4H9SA 4IBXA 1TD5A 2PU4A 4E3IA 3GECA 4HESA 5G49A 5BOHA 1YM1A 2ZC6B 5CGSA 5GT3B 4LGWA 3N6IA 1ODVA 3T50A 1E88A 3QNCA 1LSXA 4H9RA 3RELD 4HBTA 2VV8A 3BJNA 1NRFA 2HIOC 4JKTA 4EWFA 2MJ6A 4HMCA 4F94A 3FPWA 3NQJB 3HONA 3AZIC 1P3MC 3KS4A 1V9ZA 3AYWC 1JFIA 4JLFA 3BLMA 3GDIA 1P34D 3VP2A 3F6TA 3BFDA 1ID3A 2J8PA 3OPPA 1H3OB 1K55C 4Z66A 4KGCA 5B0ZB 4OPYA 4RVAA 1M18D 5FI6A 4LCLA 4GN2A 4E45A 2OWJA 4BBTA 1C3BA 3UT9A 2PAVP 5FQQA 4IBKA 3LO7A 3MGPD 1AXBA 1IYQA 1HVBA 4R23A 4WU9C 1STZA 1P3GB 1RGZA 4KZ7A 2EA9A 4UQIS 5B40C 3NBLA 4FD8A 5L8MA 3G2YA 3VP0A 1E8BA 5B2IB 3KXBB 4KQDA 2M7UA 4IVKA 1H5XA 1EROA 3DWKA 3C1CD 1YU3A 3W98A 3V3SA 1LT0A 1W8YA 2ZLYA 4NXFA 1M19D 2VGJA 1K4FA 5JRGD 3LI9A 5EVID 3RELB 1IKGA 1IYSA 5AJGA 4LFUA 1XX2A 2G5IC 1TEMA 3SS3A 3O86A 3LEZA 5B32C 2ZQAA 3B3XA 5G4YA 4II7A 3NHQA 5L10A 1P3KA 2BYKB 3V5MA 1DP8A 3AZGC 2W1RA 3FYZA 3AZJC 3UPNA 3N8RA 4YS3C 4BJPA 3A6NA 1P34B 4H9SC 1S1YA 2JE5A 4R1GA 4DMZA 2HGVA 4J8UC 1PWCA 3IS2A 3IXGA 1ESIA 1S32D 1BLPA 1Q9CA 3FZCA 1ULYA 1M18B 4E3OA 1Y28A 1G68A 3MGSA 4FUWA 3UB8A 4DE3A 4B88A 3B33A 3MGPB 5KMWA 2L4RA 1P3LD 1BLCA 4P6ZM 3WA9A 1H0IA 3IHBA 2Y4AA 5GLBA 1HQ3D 4EU0A 2XA7S 1VETB 3LEQA 4LD9B 1BLSA 1PZRA 3HUNA 3W4PA 4NZ3A 3W96D 4WEKA 1BSGA 4H6JB 5GXQD 4GKUA 4N9LA 3C1CB 3FG8A 1VHMA 1ID3C 1M19B 5CEBA 5AV5A 4Z66C 4KGCC 3AZKA 5JRGB 2QJ7A 1OPXA 4HEFA 1MXOA 1KX3D 1LI0A 4G91B 4WELA 3UN7A 1T1CA 5F99D 3UT9C 2XFSA 3SS4A 3ZVWA 4QB8A 2WAEA 2CMNA 3B47A 1OTDA 1X0OA 3KWQA 4Z5TA 2P74A 5B1MD 2G5HC 3EG5B 4HNBA 3UPOA 1KE4A 4O7DA 3WRZA 3KSGA 5BPVA 3VH5W 2ZOHA 5E2EA 3N7WA 4QY5A 2Y79A 3OLOA 4WYYA 1V9YA 4NYUA 3DTEA 3X1VA 2HV1A 5CHJA 1S32B 5HZHA 3NIAA 2DQNC 4UHUA 3SW1A 4R3AA 2HZ5A 1T1BA 2WYXA 2WKPA 4QU3A 1OT9A 4J8VB 3AZHB 1P0ZA 4IVIA 1XGIA 3P5JB 5JA4A 3W97D 1FCNA 1JVJA 5FEGA 4HJ6A 5A90A 2H28A 4EUZA 1P3LB 4KHAA 3HJKA 4MBKA 4IEDA 5B31D 4DXBA 3RXWA 1HQ3B 4MB3A 4NKPA 2A24A 1P3KC 3GVBA 5M18A 2P9VB 2RTSA 1XA1A 4BENA 3W96B 1G5UA 3DTKA 5F82A 3IWOA 1N1JA 5GXQB 2BASA 4R8PD 3KFUG 4S2LA 3MXSA 1SDEA 4KUOA 4WBGA 2ZC4B 1L3LA 1B67A 4FH4A 3UO9A 5FQJA 4O8GA 3FDDA 1L0FA 5B24A 2OLUA 1PZOA 5F6AA 4XXRA 1P3PD 1KX3B 5F99B 4WEJA 2YFWA 4IUKA 1YLPA 5AVBA 3WA9C 5J8XA 5B1MB 1D7EA 2F8NH 4ME4A 4NE3A 3HL9A 4KZ8A 2XSSA 3S7PA 1IOUA 2HF6A 2C5WB 3VMAA 3FPVA 4NZ1A 2GNXA 3WD1A 4GNUA 2Y2OA 4H9NB 3R4KA 1YMSA 3AZKC 1J9MA 1PNEA 3HLFA 4IBJA 5HPIA 2XROA 3UTAA 3X1SA 3B42A 1YT4A 4GHAA 3WAAA 3W97B 3O88A 5AQ7A 3L26A 5CERA 5FQMA 5B31B 1R4VA 4E3KA 3QP4A 3T4LA 2V1ZA 1ES2A 3LY3A 5GT3A 3KWQC 3MZFA 3VH5T 4WNNB 4Z5TC 1FCOA 3LIBA 3AZMA 5I94A 3LIDA 4R8PB 4L9EA 5I5LA 2J3TD 3NI9A 4NY2A 5CTMA 2HJEA 1TS7A 3EEHA 2ZY3A 3X1VC 3NQJA 4DDYA 2W27A 4ZJ1A 3KSIA 2W0NA 3E4PA 5FA7A 3HLEA 3CLOA 5HDDA 3MZDA 3B6FC 4PMAA 1NLYA 4BMWA 2Y2JA 4IJGA 3AZEC 4IBDA 3MKFA 3W98D 1DJAA 5A93A 4Y0OA 3O5YA 1H3OA 1PYYA 3RXXA 3TW8A 5B0ZA 3NECA 1BZAA 4B4ZA 4CLCD 5EVEA 5EUAA 1T1AA 2WKQA 1K57A 3ZQ5A 2PYPA 1XFQA 1P3AD 1P3GA 5HSQA 4KZAA 5B24C 1YU0A 1ZG4A 1JTDA 3NQUB 1M6KA 4MLLA 5B2IA 3KXBA 4LRYC 4E44A 4EQ1A 1JFIB 1BYWA 4BL3A 4EV4A 4S2KA 3L27A 2WKRA 5AVBC 4MN5A 1GPFA 3IBJA 4Y15A 2VLGA 5C3IC 3CUEA 1BH8B 4IHQA 3RELA 5EECA 5FQKA 4KG2A 3QP8A 4KZ3A 3UE0A 4DXCA 1FILA 4D2OA 3ZYTA 3UNWA 3MBZA 2XDMA 1LLBA 2D49A 3WS2A 4OQHA 3SOIA 2F8ND 3SZTA 2BYKA 4C75A 3X1SC 3C30A 3AZND 3MKEA 3PXPA 3W98B 1CXWA 3REKD 5EM1A 3PR6A 1F2KA 4HBUA 1YLWA 1NWZA 1M18A 4CLCB 4KUKA 3MQQA 4XZQD 3L28A 3LZ1D 5E5AC 3MGPA 5U47A 2O9AA 1L0DA 1UR9A 1P3AB 1S67L 1TS6A 4BL2A 5FAPA 4J8XD 4GHIB 3LJAD 5GLCA 5CP6D 1L0GA 5FDSA 1S1ZA 4K08A 1VETA 2ZC5B 1XJ2A 5F83A 1D06A 2VQRA 3A6NB 3B0BA 4GZBA 4H6JA 1NZUA 1YLJA 3C1CA 2JSSA 5HDCA 3UE6A 4ZDXA 1M19A 3DBAA 3REJD 5B0ZC 5JRGA 5EVIA 3MGSB 1YAXA 3C4PA 2JKRM 5DVAA 1YU4A 1MWUA 3IF6A 1K57C 2NUPC 2BYMA 4JPMA 3MGRC 3G34A 2R78A 2ZBBA 2F8NB 1XP4A 4QLCA 4ZBJB 4GLQA 5CHUA 3X1UD 4S2JA 2O99A 5B2IC 3B0DB 3KXBC 5B1LD 1MC0A 3AZNB 3OPHA 3OC2A 4HGAB 4H9PB 2NQBA 2V20A 4HH3A 4K0XA 1P9RA 3WKJD 2AROD 4KZ4A 4GHLA 4DDSA 3REKB 2CC1A 4X53A 1S32A 5AV5B 5TFQA 3CZDA 1MKIA 4UA9A 1YQSA 3T1XA 4XZQB 3SH7A 3RELC 3LZ1B 5AQAA 3WRTA 3TSGA 1ZC2A 3VOYA 1P3LA 1CK7A 1YUEA 1FSYA 1KVMA 4J8XB 1XGJA 3A0RA 3LJAB 5CP6B 5CPID 4O01A 1HQ3A 3G6OA 4LG2A 1J7MA 1PW1A 2P9VA 4HJ3A 1SDNA 3W96A 1ES5A 4N9KA 2QHKA 5E2FA 1P34C 3CITA 3T4TA 1UWPX 2ZQ9A 4GDNA 3REJB 2XR0A 4D60A 1M18C 4WZSB 3N4IA 4Q0HA 3UTAD 2RVQD 1KX3A 4QHCA 4YNRA 2PT7A 4DE2A 5F99A 1QO6A 3TE8A 3UTBD 3MGPC 2QZ6A 1TS8A 3OBFA 1UWNX 3D9YA 3E2KA 4R38A 5B1MA 3I7JA 3MQ0A 3ZG5A 1ONHA 3X1UB 4WLAA 3FWLA 1RGYA 4YFMA 2ZJ9A 4LD9C 3AZMD 5B1LB 1T19A 1N1JB 3T4KA 3WKJB 1S66L 2AROB 1AWIA 3C1CC 3IT9A 4YM6D 4NG2A 3LCEA 4H9NA 3MMHA 4X6TA 1M19C 5BNXB 1VB6A 3W8KA 1GHIA 3HSHA 4KZ9A 1BH9B 1VM1A 4B9OA 1O7EA 2V8FA 4G91C 3W97A 5B33D 5B2JD 3LI8A 1EQZD 5M19A 5B31A 3KSYA 2I9VA 3LR4A 4N1HA 5CHLB 5CX7A 4WNNA 1H8MA 2FJ7D 2IWCA 3HCYA 2W8SA 4CLCE 2ZM2A 4Y3IA 2EXAA 1MWSA 4EESA 4R8PA 3TU4D 2QJ5A 1MWRA 1S32C 2VGLM 3LIEA 2B18A 3H9WA 4I38A 4E3NA 3UTAB 1P3PA 2CV5C 4J8VC 3AZHC 2P04A 4JF6A 4EUVA 4IBRA 4Y5FA 3UTBB 3IWQA 3QP2A 4OP8A 5AQBA 1P3LC 3T1SA 5EM0A 4IJEA 1BUEA 4MB5A 1W7FA 2D02A 5DTKA 1HQ3C 5GL9A 3R45B 4L9GA 1F66D 3AZMB 3CI6A 5HAPA 4ZUXD 2G7UA 3W96C 4MCWA 2O0YA 1LSVA 5GXQC 1BFMA 1OTAA 3RJUA 2J9PA 4YM6B 3LY4A 3S7OA 2IA2A 1E3UD 1M40A 3K3DA 5LBRA 3ZCZA 2DNSA 3T12B 4X68A 3NQUA 3ISGA 1GSWA 1KX3C 4MDZA 1L6JA 5B33B 5F99C 2WGVA 4GW9A 4HQAA 4X69A 1EQZB 3K3CA 4QPRA 3IX4A 4JJND 2WKEA 4P0MA 4LCMA 3AL0C 5GHZA 4UUZA 2GZAA 4G92B 2FJ7B 3IF5A 1E15A 5HAQA 2FN2A 4GD6A 1BH8A 1CJFA 3LFVA 4DRAA 2ZY5A 3GTCA 3TU4B 4HI4A 2ZY2A 5M1AA 3DWZA 2IWDA 1W1PA 5AV6D 2W3EA 4U0TA 3EWKA 4LV2A 5EPHA 1W2EA 4GB7A 2GDNA 3KYEA 4O0PA 1P3ID 4OPZA 4Y2FA 3LIFA 4ZAMA 3VP1A 3W97C 1IEMA 1Y4OA 4BD1A 1F98A 3BFEA 5B31C 2RCXA 3WX7A 1CI8A 2Y59A 1TDGA 4GOGA 4CLCA 1F66B 2Y2GA 1L2SA 3EPLA 3E98A 4MNRA 1BT5A 3AN2C 1K6SA 3LR3A 1P3AA 3G31A 3NDGA 4HMDA 1EI5A 5A91A 3O62D 4GHIA 1ZG6A 4BBVA 1GOIA 2CWEA 3HBRA 4QLCD 1I2SA 3LZ0C 2A2LA 2L5AA 4AWLB 1OGBA 2Z6CA 4OP5A 1I2WA 2XLNA 3BLSA 3IBRA 4EO5B 2NQBD 2W3GA 1N9NA 4JJNB 2FFFB 5HWVA 3MS6A 4Y17A 3VFFA 1P3BD 2XRNA 2Y2QA 1F9IA 1E4DA 3VH5A 3AGFA 3CAXA 4IUHA 4GH9A 4F3LB 1YSPA 5L2FA 5L09A 1NY0A 5AV6B 3UDXA 5IU1A 3W99D 4CQHA 2INWA 4B93A 1T18A 4S2IA 2F8NA 1OJGA 1AIWA 3OPRA 2OSUA 3N3FA 3AZNA 4H9PA 4N92A 3REKA 4XT2B 3T1QB 1PIOA 3PBOA 4EEPA 2WZZA 4XUXA 5EVIB 4XZQA 4HP9A 3V50A 3LZ1A 5GSUD 4MN6A 2PBDP 3IF6B 1KU5A 1JWZA 2J3TC 1NZOA 2W3HA 3PAGA 5TJJA 3BY8A 2BYMB 4Z2KA 5AVCA 1EWZA 1NYMA 4PM9A 4J8XA 3O62B 3EEAA 3LJAA 1QMFA 5CP6A 5J3WA 4QLCB 3OZHA 3R7WB 4NXGA 1EAKA 4I5SA 2NQBB 4KENB 5FI7A 1SHVA 1W8QA 3W98C 2ZC3B 1P3BB 1G28A 1K0KA 5B32G 2BLSA 3MJQA 3REJA 2ZQ7A 4CLCC 4ARZB 5F1FA 1MKMA 1KGFA 4BD0A 5CPKD 3NOUC 4P87A 1FCMA 3W99B 1P3AC 1PWGA 5AV8D 4ETZA 4WU9D 5HW3A 4IBBA 1LSWA 5JYOA 2ZMFA 3X1UA 2VZWA 3QNBA 4G3KA 4EETB 5B1LA 1D1JA 1OTEA 1WWSA 4EEUA 3EGXC 4UPKA 3WKJA 3A6NC 2W1TA 2AROA 4QD4A 1ZTUA 1ERQA 1J3WA 2DCFA 3D72A 1H3QA 1CI9A 2EWWA 5BNXA 2WZXA 4K91A 3B6GD 4IBIA 4N1XA 4JXVA 1BH9A 3MGSC 1FSWA 5HL6A 3ZVTA 3C2WA 5GSUB 2ZD8A 1JNUA 2EFUA 4R4RA 4OQIA 4I3IA 1TAFB 4U3TA 5CPIA 2JN7A 3L29A 3WS4A 1MPLA 3L7HA 4LPZA 4ZBJC 3H0RC 3B0DC 1SKOA 4P6BA 3REHD 3AZNC 5TR7A 4HGAC 3ZNYA 3A3DA 2G2UA 2JKGA 4YS3D 3REKC 2VKSA 1YU2A 3BW6A 4J8UD 5AV5C 2PD8A 3HVFA 4OQ0A 4CPKA 2J8YA 4LV3A 4XZQC 2OWHA 3AV1D 3LZ1C 5CPKB 2EX9A 3UTBA 2YKFA 2HUEB 5AV8B 4J8XC 3X1TA 4WU9B 3LJAC 3BM6A 1VQQA 1WE4A 4UA7A 3UMEA 3R45A 1AOID 4OQGA 2IO5B 4Q0JA 5FSRA 3IH8A 5FDHA 1KE3A 1P3OD 1K56D 5TGFA 4P6ZS 2V2FF 4YM6A 4IBFA 3MGQD 3IX3A 3CJMA 3REJC 2J9OA 3B6GB 2JBFA 1P3PB 3VH6W 1PW8A 1CEFA 4IBGA 1MZUA 2PDRA 5B33A 5B2JA 1GSVA 1EQZA 3MF0A 3EOIA 3VP4A 3WWXA 1DY6A 1ESUA 4YINA 2FJ7A 3EQUA 4Z2IA 4PKYA 3X1UC 1N9LA 4OKPA 1F5MA 5C5KA 5B1LC 3REHB 4G3WA 1YLTA 4FCFA 3TU4A 1KX5D 3WKJC 3QP6A 4X55A 2AROC 3MNND 3WS5A 3W2ZA 2Z6DA 3NCKA 5FQ9A 5DJTA 4J8UB 3AFAA 3T4SA 2VGKA 3GV9A 1YLZA 5DFXA 1WYCA 1N9OA 3AV1B 1NYYA 3BECA 4CSRB 1E6RA 1FR6A 2Y2IA 2Y8HA 4CJNA 3VOLA 3P01A 5E2GA 4OUIA 4UUZB 4PHTA 3PBSA 3WD2A 1AOIB 1F66A 5HWWA 5CPJD 4ZUXA 2UV0E 1KX4D 1P3OB 4Y0TA 3C1BD 1E3UA 3BFCA 3MGQB 1NJ4A 3PBTA 4HOIA 1FR1A 2OV5A 4NZ5A 3ZG8B 3A0VA 3UTAC 1PWDA 5DF9A 3WAAC 4HMEA 2ZQCA 3UTBC 4JJNA 5DNMD 2VX8A 2C6WB 3C7VA 5GT3C 4HH2A 3LR0A 4WMCD 2V8CA 4KZ5A 3REID 4EBNA 1Y54A 3AZMC 2VV7A 4XUJD 4NXBA 3G2ZA 4J8WD 2Q9MA 1KX5B 3A0SA 2WKIA 1W1YA 4F3LA 3MNNB 3U2AA 1GA0A 3FC7A 1K54A 3VH6T 5AV6A 5AVCD 4YM6C 3KSFA 2G2WA 3ZG7B 3KO6A 4GJ4A 2KDKA 2PR5A 4GD8A 1P3IA 4HJ4A 5CTNA 5F68A 3ULFA 2H0TA 3A3IA 5B33C 2OLVA 4DF6A 3SS5A 4X1LA 1EQZC 4DE0A 1OTIA 3A3JA 4XT2A 5AVFA 2HDRA 5FATA 4OPRA 4G92C 2FJ7C 5CPJB 4EXOA 4RA7A 1KX4B 3M2KA 4KG6A 2Q0OA 3TU4C 2DRWA 1H0MA 3C1BB 4Z2JA 3GRJA 3TRCA 5IT5A 1P3GC 3FV7A 3O62A 4NEED 2OAQ1 3VOZA 3UE1A 1E6PA 3R7WA 1XXMA 3B6FD 4NZ4A 2L1MA 1RCJA 5HDSA 3U4LP 3PBNA 2QPNA 3ZG0A 5DNMB 1P3BA 3AZED 2Q9NA 1GCEA 4CAYB 1PI4A 3CPTB 3LELD 3E4QA 4PPRA 3REIB 1YKDA 1MWTA 3CUEC 1F66C 2X71A 4ARZA 4XUJB 1HLUP 4KUDA 4L0LA 4J8WB 4BQMA 3UB5P 3UPPA 1IKIA 1PI5A 2EX2A 2HDUA 5AVCB 3W99A 3G4PA 3EPJA 1NRJA 3LR5A 1ACFA 4AWLC 3WS1A 3AGEA 1BULA 1W1VA 1GSXA 4EO5C 1Z6FA 2WADA 1KGGA 4JJNC 4DQYB 1GHPA 5KIZA 2JKTI 4NETA 4H9QA 3KX0X 4OH0A 5EOEA 4EERA 4WV4B 4JXGA 1Z2CB 5DNND 4UQIM 3PAEA 5HAIA 1YLYA 5GSUA 3EGDC 1BLHA 2B02A 1TDLA 3GMWA 2HDSA 2P08A 5J7EA 1HTZA 3AV2D 5AV6C 2WAFA 1TAFA 2XGNA 4DRTA 3X1TD 3WTPD 1P3FD 2XD1A 3JPUA 2BG1A 3IP4C 4C6YA 1ZLAD 1HTAA 3KYQA 4R3JA 4Y7PA 4WN5A 1ES4A 2OAP1 3HUMA 2W1TB 2PHYA 4KZ6A 1XJ6A 4X1MA 3T4QA 2VEAA 5K5BA 2JCHA 3AZEB 4OJPA 3LELB 1JWVA 2WGWB 2ZMVA 5JRGC 4K0WA 4MB4A 5EVIC 3NC8A 5DKLA 3HUOA 3MVDD 5CPKA 2H5SA 3IF6C 2ZC7A 5E5AD 5AV8A 4E3MA 3KYZA 5CPIB 3O62C 4WU9A 2HDQA 4OOLA 4BLMA 4RYEA 2EWVA 4NE6A 3UB9A 4QLCC 3Q7VB 4DKIA 2LY8A 5BT1D 1SKOB 3KS8A 1DJBA 2NQBC 3HLDA 2QYBA 2J80A 4RQ9A 3UY6A 4M6BA 3QP5A 1P3BC 2VK3A 3AFAD 4QNLA 3B6GA 5EFWA 5DNNB 2LB5A 3VSLA 3ZGAB 1W79A 2XA7M 4G3VA 3T4JA 4Z2HA 1ZKJA 3AV2B 3A3EA 3C8CA 4RX3A 4A5RA 4FH2A 3UDIA 3W99C 3X1TB 3WTPB 1P3FB 2V5OA 1N4OA 3ZG9B 1NXYA 3W4QA 3MGRD 1ZLAB 4KQOA 2JHEA 3ZDJA 4Z2LA 2M7VA 3REHA 2KX6A 1HZOA 3MSHA 5HFOA 3SH9A 2PBYA 4UA6A 5DF7A 4YS3A 3BQAA 4J8UA 2KLIA 4M4XA 3GSGA 4LRXC 5GT0D 3DTIA 1XFNA 3MVDB 3AV1A 3MZEA 5GSUC 5B2JB 3S7QA 1KE0A 4CSRA 5FAOA 5TBMB 5E5AB 2XF3A 4QY6A 2FZ0A 1YMXA 3Q1FA 5B1MC 4KG5A 1AOIA 1E25A 1M1AD 1S4RA 1A0KA 5IHVA 4H9OB 1ZHHB 4PM5A 1XKZA 3F1NB 4E6WA 4WU8D 5A8BA 1P3OA 1K56A 1S4SA 2NUTC 3A3FA 3JVUA 3NOPC 4JGOA 3MFDA 2IOUA 3MGQA 4R3BA 2Y2KA 3AFAB 5KDMA 5B0YD 5GLAA 2H10A 3P09A 1U60A 2KOIA 2ZL1B 4TX8A 4OJ6A 5F5YA 2YFVB 5CPKC 2XFTA 2HP9A 3BRMA 3M2JA 2HUEC 5AV9D 5FL3A 3PTEA 4E3JA 5AV8C 4IBEA 1YPRA 1GXDA 1FOFA 3MGRB 1ALQA 2XH9A 3B0CW 4ZUXB 1A7WA 2IO5C 2B95A 4NFTA 1K38A 1GHMA 5BNVB 4R8PC 1KX5A 4LD9D 5G18A 3MNNA 1EW0A 2XD5A 5FUGA 3WS0A 4C3QA 1XA7A 1H0GA 4Y13A 3WD0A 4X23D 1CF0A 2NZDD 3HLBA 3B6GC 5GT0B 3NDEA 2Y2HA 1P3PC 3F1PB 4Q8IA 3AZLD 2PRFA 5GHXA 1IFQA 4ZJ2A 3V9RB 4I39A 1LL5A 1UGUA 1U35D 1E6NA 5E2HA 1CK3A 3E0YA 2RL3A 4JXSA 2PYOD 3HLCA 1M1AB 5CPJA 5AY8D 4WU8B 4KUDD 3AZFD 3REHC 2V9AA 1KX4A 2FH5A 4DE1A 3E2LA 3C1BA 1KS0A 1WA9A 3VE4A 3WD3A 4OJLA 2VJWA 5B0YB 4WZ5A 2JC7A 4S2NA 2V0WA 1H8PA 4WL9A 4GS9B 1P3IB 3H82B 4B4XA 5KSCA 3HREA 1KVLA 1KGEA 3KUYD 3AV1C 2Y91A 1TZYD 4KQQA 2CV5D 4J8VD 3AZHD 4MBFA 5AV9B 1K25A 3BYDA 4NYYA 4ESPA 3H7WB 1FIKA 3UDFA 4DJ3A 5DNMA 1XJ4A 3CWFA 4MMNA 4YWZA 4CAYA 2VGLS 4FSFA 3CPTA 2EX8A 3UMDA 4WMCA 1AOIC 3REIA 3AGDA 5CGWA 2QKPA 4XUJA 4LV1A 4J8WA 5L07A 4HHDA 1P3OC 5EVLA 3G30A 4R6LA 4BWIA 4KZBA 3A1IA 2F2AC 5B31G 3HLGA 3T1RA 3VFHA 2HPBA 1I5QA 1TS0A 1XJ3A 1W5DA 4NE5A 2HIOD 3WTPE 4X23B 3MGQC 2NZDB 2JKRI 3ICYA 4U0XA 3FKVA 1VEUB 3MQLA 2Z2MB 3AZLB 3GR2A 3AZID 1P3MD 3Q7ZA 5CGXA 2E8JA 5D3OA 3AYWD 3B0CT 1U35B 3L9KA 4E04A 3F1OB 3ITAA 1ED7A 1Q2QA 5BS7A 2PYOB 4WF0A 5CRFA 3CG5A 3TOIA 3M7PA 5AY8B 4KUDB 3AZFB 3MFXA 2JKTM 3Q81A 1H8ZA 2JKFA 4WUJA 1KX5C 3MNNC 2GJ3A 1RP5A 5F69A
chains in the Genus database with same CATH topology
3JYIA 3H0LC 1YU1A 5B40D 3P98A 3KUYB 4QJGA 1TZYB 5BO0B 3B6FA 2CV5B 4WZ4A 2Y2LA 4Y0UA 3AZEA 4H9QB 3LELA 2WGWA 3GQZA 1BTLA 5KSHA 5CPJC 3ZNTA 1KX4C 1L0EA 5CECA 3BFFA 3C1BC 3AN2D 2I72A 4EQIA 2HIOB 3VH6A 3L25A 3FKEA 4DRBA 4WZ5C 4S2NC 5B32D 3Q7VA 3S1YA 3AZIB 1P3MB 1K6RA 3LZ0D 3AZGD 3IXBA 3AYWB 3AZJD 1S6RA 4ZTKA 5DTSA 1TVFA 5DNMC 3EPKA 4R4SA 5GHYA 3REIC 1JWPA 5DNNA 2WK0A 4XUJC 1DJCA 2EFXA 4J8WC 1SKFA 4MBHA 1HD8A 3AV2A 5AVCC 3WTPA 1P3FA 4R0QA 5CP6C 3IXHA 3CMZA 1ZLAA 2WGIA 5B40B 3PBQA 4RX2A 2QMIA 4NK3A 5HX9A 2X02A 3A1KA 1IELA 1WYBA 2FFYA 4MEZA 4PM8A 1K4EA 3Q07A 3IWIA 5BS7C 1ID3D 4Z66D 4KGCD 1QMEA 2B5RA 3MVDA 3AN2B 4OOMA 5E5AA 3UT9D 5FQIA 2Y55A 2E8IA 4S2PA 5B32B 5F1GA 3IHAA 3IXDA 4H9OA 4PM7A 3V3RA 3LZ0B 4IBCA 3AZGB 3AZJB 4YS3B 3H0MC 1S0WA 3LELC 5G49B 2F8NG 2DF4C 2XK1A 1O07A 3EQVA 2YFVA 4H9RB 1KDWA 3G35A 5CPIC 3ZFZA 3OCLA 4ZBEA 3MGRA 4Z2MH 1P3KD 5DF8A 2UWXA 3VSKA 5BNVA 4X56A 1B6WA 1SCWA 3A6ND 2A3UA 5KDMB 2ZQDA 2H0YA 1ID3B 4IJFA 1N9BA 4Z66B 3DTMA 4KGCB 5GT0A 4LV0A 2RVQC 5DNNC 3HLWA 3VP3A 3UE3A 5JYPA 2XEPA 3C5AA 3NY4A 3MGSD 3V9RA 3UT9B 3BFGA 3AV2C 1LHYA 3N8SA 3X1TC 3WTPC 1P3FC 3IQAA 5E43A 3WA9D 2ZMAA 1M1AA 1ZLAC 3D4FA 4WU8A 4H8RA 1G6AA 5FUGB 3DW0A 4OONA 1P34A 5B0YA 5AV5D 3AZKD 4OJ5A 2EXBA 3M6BA 4JF4A 3MVDC 5A92A 5B2JC 5AV9A 2A49A 4PM6A 2WKHA 5DTTA 2J7VA 4Z2MG 4M3KA 3TG9A 2F8NK 3KWQD 4Z5TD 5BT1C 1P3KB 1GA9A 4EBPA 4OJOA 4LD9A 4ZJ3A 1JTGA 4X23A 2NZDA 3AFAC 2ZQ8A 1LL9A 3X1VD 4Z9QA 3AZLA 3Q82A 5HL1A 4OOYA 3O87A 3SH8A 1LI9A 1U35A 1ERMA 5FI2A 4WJ3C 4XUZA 3S4XA 2PYOA 2R9XA 3WA9B 4E6XA 5AY8A 4ZUXC 3AZFA 4P85A 2Z2LB 3OPLA 3C7UA 4S2OA 1CEGA 1H8YA 1MBLA 4ID4A 4E3LA 1FQGA 2EX6A 1XPBA 1Q2PA 5B24D 5GT0C 3AZKB 3QHYA 2XQZA 3KUYA 1TZYA 5FAQA 5BO0A 2CV5A 4J8VA 3AZHA 3L2AA 5CXWA 3C4OA 3ITBA 4OPQA 2IWBA 1ONGA 5AVBD 3KWQB 1M1AC 4JXWA 4Z5TB 4GDBA 4WU8C 4JBFA 3OCNA 1K54C 5GXQA 2WUQA 3S22A 2HIOA 3M6HA 5B0YC 3X1VB 5FASA 5AQ9A 3IH9A 1P3IC 3EPHA 3AZIA 4OLDA 1P3MA 3B6FB 1MY8A 3X1SD 4OLGA 5EOOA 3AYWA 3WAAD 5AV9C 2R9WA 1F1EA 5JA4B 3MXRA 3PBRA 2RIQA 3BEBA 5CEDA 4KHAB 1OMEA 5EE8A 1K55A 5GLDA 1WWIA 5GT3D 1PZPA 5CHMA 2HP6A 3FKWA 4X23C 2NZDC 1KDSA 5B24B 3O3VA 5B40A 3AZLC 4KQRA 2ZY4A 2Y2NA 4S2MA 2ZM5A 2YFWB 1ES3A 1U35C 1IYOA 2PYOC 5AVBB 4LENA 5AY8C 4OVDA 5B0ZD 4KUDC 5C3IB 3AZFC 2ZM0A 2Y2MA 2ZM8A 2HP5A 2PU2A 3ZHHA 3AN2A 5HARA 5KZHA 3N8LA 2X01A 1IYPA 1P3GD 5B32A 3W4OA 3G32A 4EBLA 4WM9A 1T3UA 3KUYC 3V39A 3LZ0A 1TZYC 3AZGA 2Y2PA 5B2ID 3X1SB 3KXBD 4JF5A 3AZJA 4UAAA 3WAAB 4H9SA 4IBXA 2PU4A 4E3IA 4HESA 5G49A 5BOHA 1YM1A 2ZC6B 5CGSA 5GT3B 3N6IA 3QNCA 4H9RA 3RELD 4HBTA 1NRFA 2HIOC 4JKTA 4EWFA 4F94A 3NQJB 3HONA 3AZIC 1P3MC 3KS4A 3AYWC 1JFIA 4JLFA 3BLMA 1P34D 3VP2A 3F6TA 3BFDA 1ID3A 2J8PA 3OPPA 1H3OB 1K55C 4Z66A 4KGCA 5B0ZB 4OPYA 4RVAA 1M18D 5FI6A 4LCLA 4GN2A 4E45A 1C3BA 3UT9A 5FQQA 4IBKA 3LO7A 3MGPD 1AXBA 1IYQA 1HVBA 4R23A 4WU9C 1P3GB 1RGZA 4KZ7A 5B40C 3NBLA 4FD8A 3G2YA 3VP0A 5B2IB 3KXBB 4IVKA 1H5XA 1EROA 3DWKA 3C1CD 1YU3A 3W98A 3V3SA 1W8YA 2ZLYA 1M19D 2VGJA 1K4FA 5JRGD 5EVID 3RELB 1IKGA 1IYSA 1XX2A 2G5IC 1TEMA 3SS3A 3O86A 3LEZA 5B32C 2ZQAA 3B3XA 1P3KA 2BYKB 3V5MA 3AZGC 3FYZA 3AZJC 3UPNA 3N8RA 4YS3C 4BJPA 3A6NA 1P34B 4H9SC 2JE5A 4R1GA 4J8UC 1PWCA 3IXGA 1ESIA 1S32D 1BLPA 1Q9CA 3FZCA 1ULYA 1M18B 4E3OA 1G68A 3MGSA 4DE3A 4B88A 3MGPB 5KMWA 1P3LD 1BLCA 3WA9A 3IHBA 2Y4AA 5GLBA 1HQ3D 4LD9B 1BLSA 1PZRA 3HUNA 3W4PA 4NZ3A 3W96D 4WEKA 1BSGA 5GXQD 4GKUA 4N9LA 3C1CB 1ID3C 1M19B 5CEBA 5AV5A 4Z66C 4KGCC 3AZKA 5JRGB 4HEFA 1MXOA 1KX3D 1LI0A 4G91B 4WELA 3UN7A 5F99D 3UT9C 2XFSA 3SS4A 3ZVWA 4QB8A 2WAEA 3KWQA 4Z5TA 2P74A 5B1MD 2G5HC 3EG5B 3UPOA 1KE4A 4O7DA 3WRZA 5BPVA 3VH5W 5E2EA 3N7WA 4QY5A 4WYYA 4NYUA 3X1VA 5CHJA 1S32B 3NIAA 2DQNC 4UHUA 2WYXA 4QU3A 4J8VB 3AZHB 4IVIA 1XGIA 3P5JB 5JA4A 3W97D 1FCNA 1JVJA 5A90A 4EUZA 1P3LB 4KHAA 4MBKA 4IEDA 5B31D 4DXBA 3RXWA 1HQ3B 1P3KC 3GVBA 5M18A 2P9VB 1XA1A 4BENA 3W96B 5F82A 3IWOA 1N1JA 5GXQB 4R8PD 3KFUG 4S2LA 3MXSA 1SDEA 4WBGA 2ZC4B 1B67A 4FH4A 3UO9A 5FQJA 3FDDA 1L0FA 5B24A 2OLUA 1PZOA 4XXRA 1P3PD 1KX3B 5F99B 4WEJA 2YFWA 1YLPA 5AVBA 3WA9C 5J8XA 5B1MB 2F8NH 4NE3A 3HL9A 4KZ8A 2C5WB 3VMAA 4NZ1A 4GNUA 2Y2OA 4H9NB 1YMSA 3AZKC 1J9MA 3HLFA 4IBJA 3UTAA 3X1SA 1YT4A 4GHAA 3WAAA 3W97B 3O88A 5AQ7A 3L26A 5CERA 5FQMA 5B31B 1R4VA 4E3KA 2V1ZA 1ES2A 3LY3A 5GT3A 3KWQC 3MZFA 3VH5T 4WNNB 4Z5TC 1FCOA 3AZMA 5I94A 4R8PB 3NI9A 4NY2A 5CTMA 2ZY3A 3X1VC 3NQJA 4DDYA 4ZJ1A 5FA7A 3HLEA 3MZDA 3B6FC 4PMAA 2Y2JA 3AZEC 4IBDA 3MKFA 3W98D 1DJAA 5A93A 4Y0OA 1H3OA 1PYYA 3RXXA 5B0ZA 1BZAA 4B4ZA 5EUAA 1K57A 1P3AD 1P3GA 4KZAA 5B24C 1YU0A 1ZG4A 1JTDA 3NQUB 1M6KA 4MLLA 5B2IA 3KXBA 4E44A 1JFIB 4BL3A 4EV4A 4S2KA 3L27A 5AVBC 5C3IC 1BH8B 3RELA 5EECA 5FQKA 4KG2A 4KZ3A 3UE0A 4DXCA 4D2OA 3UNWA 3MBZA 2XDMA 1LLBA 3WS2A 4OQHA 3SOIA 2F8ND 2BYKA 4C75A 3X1SC 3AZND 3MKEA 3W98B 3REKD 4HBUA 1YLWA 1M18A 4XZQD 3L28A 3LZ1D 5E5AC 3MGPA 5U47A 1L0DA 1P3AB 4BL2A 5FAPA 4J8XD 3LJAD 5GLCA 5CP6D 1L0GA 2ZC5B 5F83A 2VQRA 3A6NB 3B0BA 4GZBA 1NZUA 1YLJA 3C1CA 2JSSA 4ZDXA 1M19A 3REJD 5B0ZC 5JRGA 5EVIA 3MGSB 3C4PA 5DVAA 1YU4A 1MWUA 3IF6A 1K57C 2BYMA 4JPMA 3MGRC 3G34A 2F8NB 1XP4A 4QLCA 4ZBJB 5CHUA 3X1UD 4S2JA 5B2IC 3B0DB 3KXBC 5B1LD 3AZNB 3OPHA 3OC2A 4HGAB 4H9PB 2NQBA 2V20A 4K0XA 3WKJD 2AROD 4KZ4A 4GHLA 4DDSA 3REKB 2CC1A 4X53A 1S32A 5AV5B 5TFQA 3CZDA 1MKIA 4UA9A 1YQSA 4XZQB 3SH7A 3RELC 3LZ1B 5AQAA 3WRTA 3TSGA 1ZC2A 3VOYA 1P3LA 1YUEA 1FSYA 1KVMA 4J8XB 1XGJA 3LJAB 5CP6B 5CPID 1HQ3A 4LG2A 1PW1A 2P9VA 1SDNA 3W96A 1ES5A 4N9KA 5E2FA 1P34C 2ZQ9A 4GDNA 3REJB 2XR0A 1M18C 4WZSB 3N4IA 3UTAD 2RVQD 1KX3A 4QHCA 4DE2A 5F99A 3UTBD 3MGPC 2QZ6A 3E2KA 5B1MA 3I7JA 3ZG5A 1ONHA 3X1UB 3FWLA 1RGYA 4YFMA 2ZJ9A 4LD9C 3AZMD 5B1LB 1N1JB 3WKJB 2AROB 3C1CC 3IT9A 4YM6D 3LCEA 4H9NA 4X6TA 1M19C 5BNXB 3W8KA 1GHIA 3HSHA 4KZ9A 1BH9B 1VM1A 1O7EA 4G91C 3W97A 5B33D 5B2JD 1EQZD 5M19A 5B31A 3KSYA 4N1HA 5CHLB 4WNNA 2IWCA 2FJ7D 2W8SA 2ZM2A 2EXAA 1MWSA 4R8PA 3TU4D 1MWRA 1S32C 4E3NA 3UTAB 1P3PA 2CV5C 4J8VC 3AZHC 4JF6A 4IBRA 3UTBB 3IWQA 4OP8A 5AQBA 1P3LC 4IJEA 1BUEA 1W7FA 5DTKA 1HQ3C 5GL9A 3R45B 1F66D 3AZMB 5HAPA 4ZUXD 3W96C 5GXQC 1BFMA 3RJUA 2J9PA 4YM6B 3LY4A 1E3UD 1M40A 3ZCZA 2DNSA 4X68A 3NQUA 3ISGA 1KX3C 5B33B 5F99C 4X69A 2WGVA 1EQZB 4JJND 2WKEA 4P0MA 4LCMA 3AL0C 5GHZA 4UUZA 4G92B 2FJ7B 3IF5A 5HAQA 4GD6A 1BH8A 4DRAA 2ZY5A 3GTCA 3TU4B 2ZY2A 5M1AA 3DWZA 2IWDA 5AV6D 4U0TA 4LV2A 5EPHA 1W2EA 4GB7A 2GDNA 1P3ID 4OPZA 4ZAMA 3VP1A 3W97C 1IEMA 4BD1A 3BFEA 5B31C 2RCXA 3WX7A 1CI8A 2Y59A 1TDGA 4GOGA 1F66B 2Y2GA 1L2SA 3EPLA 4MNRA 1BT5A 3AN2C 1K6SA 1P3AA 3G31A 3NDGA 1EI5A 5A91A 3O62D 1ZG6A 2CWEA 3HBRA 4QLCD 1I2SA 3LZ0C 4OP5A 2L5AA 4AWLB 1I2WA 2XLNA 3BLSA 4EO5B 2NQBD 4JJNB 2FFFB 3VFFA 1P3BD 2Y2QA 1E4DA 3VH5A 3AGFA 4GH9A 5L2FA 1NY0A 5AV6B 3UDXA 3W99D 4S2IA 2F8NA 3OPRA 2OSUA 3N3FA 3AZNA 4H9PA 4N92A 3REKA 1PIOA 3PBOA 2WZZA 4XUXA 5EVIB 4XZQA 3V50A 3LZ1A 5GSUD 3IF6B 1KU5A 1JWZA 1NZOA 3PAGA 2BYMB 5AVCA 1EWZA 1NYMA 4PM9A 4J8XA 3O62B 3LJAA 1QMFA 5CP6A 4QLCB 3OZHA 2NQBB 4KENB 5FI7A 1SHVA 1W8QA 3W98C 2ZC3B 1P3BB 5B32G 2BLSA 3REJA 2ZQ7A 5F1FA 1KGFA 4BD0A 5CPKD 4P87A 1FCMA 3W99B 1P3AC 1PWGA 5AV8D 4WU9D 5HW3A 4IBBA 5JYOA 3X1UA 3QNBA 5B1LA 1WWSA 4UPKA 3WKJA 3A6NC 2AROA 4QD4A 1ERQA 2DCFA 1CI9A 5BNXA 2WZXA 4K91A 3B6GD 4IBIA 4N1XA 4JXVA 1BH9A 3MGSC 1FSWA 3ZVTA 5GSUB 2ZD8A 2EFUA 4R4RA 4OQIA 1TAFB 4U3TA 5CPIA 3L29A 3WS4A 1MPLA 4ZBJC 3H0RC 3B0DC 4P6BA 3REHD 3AZNC 5TR7A 4HGAC 3ZNYA 3A3DA 2G2UA 4YS3D 3REKC 1YU2A 4J8UD 5AV5C 3HVFA 4OQ0A 4CPKA 2J8YA 4LV3A 4XZQC 3AV1D 3LZ1C 5CPKB 2EX9A 3UTBA 2HUEB 5AV8B 4J8XC 3X1TA 4WU9B 3LJAC 3BM6A 1VQQA 1WE4A 4UA7A 3R45A 1AOID 4OQGA 2IO5B 5FSRA 3IH8A 5FDHA 1KE3A 1P3OD 1K56D 5TGFA 2V2FF 4YM6A 4IBFA 3MGQD 3CJMA 3REJC 2J9OA 3B6GB 2JBFA 1P3PB 3VH6W 1PW8A 1CEFA 4IBGA 5B33A 5B2JA 1EQZA 3VP4A 3WWXA 1DY6A 1ESUA 4YINA 2FJ7A 3EQUA 3X1UC 4OKPA 5B1LC 3REHB 1YLTA 4FCFA 3TU4A 1KX5D 3WKJC 4X55A 2AROC 3MNND 3WS5A 3NCKA 5FQ9A 4J8UB 3AFAA 2VGKA 3GV9A 1YLZA 1WYCA 3AV1B 1NYYA 3BECA 4CSRB 1FR6A 2Y2IA 4CJNA 5E2GA 4OUIA 4UUZB 3PBSA 1AOIB 1F66A 5CPJD 4ZUXA 1KX4D 1P3OB 4Y0TA 3C1BD 1E3UA 3BFCA 3MGQB 1NJ4A 3PBTA 1FR1A 2OV5A 4NZ5A 3ZG8B 3UTAC 1PWDA 5DF9A 3WAAC 2ZQCA 3UTBC 4JJNA 5DNMD 2C6WB 3C7VA 5GT3C 4WMCD 4KZ5A 3REID 4EBNA 1Y54A 3AZMC 4XUJD 3G2ZA 4J8WD 2Q9MA 1KX5B 2WKIA 3MNNB 1GA0A 1K54A 3VH6T 5AV6A 5AVCD 4YM6C 2G2WA 3ZG7B 4GD8A 1P3IA 5CTNA 2H0TA 3A3IA 5B33C 2OLVA 4DF6A 3SS5A 1EQZC 4DE0A 3A3JA 2HDRA 5FATA 4OPRA 4G92C 2FJ7C 5CPJB 4RA7A 1KX4B 3M2KA 4KG6A 3TU4C 2DRWA 3C1BB 3GRJA 1P3GC 3FV7A 3O62A 3VOZA 3UE1A 1XXMA 3B6FD 4NZ4A 1RCJA 3PBNA 2QPNA 3ZG0A 5DNMB 1P3BA 3AZED 2Q9NA 1GCEA 4CAYB 1PI4A 3LELD 4PPRA 3REIB 1MWTA 1F66C 2X71A 4XUJB 4KUDA 4L0LA 4J8WB 4BQMA 3UPPA 1IKIA 1PI5A 2EX2A 2HDUA 5AVCB 3W99A 3G4PA 3EPJA 4AWLC 3WS1A 3AGEA 1BULA 4EO5C 1Z6FA 2WADA 1KGGA 4JJNC 4DQYB 1GHPA 4NETA 4H9QA 4OH0A 5EOEA 4WV4B 4JXGA 1Z2CB 5DNND 3PAEA 5HAIA 1YLYA 5GSUA 1BLHA 1TDLA 3GMWA 2HDSA 1HTZA 3AV2D 5AV6C 2WAFA 1TAFA 2XGNA 4DRTA 3X1TD 3WTPD 1P3FD 2XD1A 2BG1A 3IP4C 4C6YA 1ZLAD 1HTAA 4R3JA 4Y7PA 1ES4A 3HUMA 4KZ6A 2JCHA 3AZEB 4OJPA 3LELB 1JWVA 2WGWB 5JRGC 4K0WA 5EVIC 3NC8A 3HUOA 3MVDD 5CPKA 2H5SA 3IF6C 2ZC7A 5E5AD 5AV8A 4E3MA 5CPIB 3O62C 4WU9A 2HDQA 4OOLA 4BLMA 4RYEA 4NE6A 4QLCC 3Q7VB 4DKIA 2LY8A 5BT1D 3KS8A 1DJBA 2NQBC 3HLDA 3UY6A 4M6BA 1P3BC 3AFAD 4QNLA 3B6GA 5DNNB 3VSLA 3ZGAB 1W79A 1ZKJA 3AV2B 3A3EA 4RX3A 4A5RA 4FH2A 3UDIA 3W99C 3X1TB 3WTPB 1P3FB 1N4OA 3ZG9B 1NXYA 3W4QA 3MGRD 1ZLAB 4KQOA 3ZDJA 3REHA 1HZOA 5HFOA 3SH9A 2PBYA 4UA6A 5DF7A 4YS3A 4J8UA 3GSGA 5GT0D 3MVDB 3AV1A 3MZEA 5GSUC 5B2JB 1KE0A 4CSRA 5FAOA 5E5AB 2XF3A 4QY6A 1YMXA 3Q1FA 5B1MC 4KG5A 1AOIA 1E25A 1M1AD 5IHVA 4H9OB 4PM5A 1XKZA 4E6WA 4WU8D 1P3OA 1K56A 3A3FA 3MFDA 2IOUA 3MGQA 4R3BA 2Y2KA 3AFAB 5KDMA 5B0YD 5GLAA 2H10A 3P09A 1U60A 4OJ6A 2YFVB 5CPKC 2XFTA 2HP9A 3BRMA 3M2JA 2HUEC 5AV9D 3PTEA 4E3JA 5AV8C 4IBEA 1FOFA 3MGRB 1ALQA 2XH9A 3B0CW 4ZUXB 1A7WA 2IO5C 4NFTA 1K38A 1GHMA 5BNVB 4R8PC 1KX5A 4LD9D 5G18A 3MNNA 2XD5A 5FUGA 3WS0A 4C3QA 1XA7A 4X23D 2NZDD 3HLBA 3B6GC 5GT0B 3NDEA 2Y2HA 1P3PC 4Q8IA 3AZLD 5GHXA 4ZJ2A 3V9RB 1LL5A 1U35D 5E2HA 1CK3A 2RL3A 4JXSA 2PYOD 3HLCA 1M1AB 5CPJA 5AY8D 4WU8B 4KUDD 3AZFD 3REHC 1KX4A 4DE1A 3E2LA 3C1BA 4OJLA 5B0YB 4WZ5A 2JC7A 4S2NA 1P3IB 4B4XA 5KSCA 3HREA 1KVLA 1KGEA 3KUYD 3AV1C 2Y91A 1TZYD 4KQQA 2CV5D 4J8VD 3AZHD 4MBFA 5AV9B 1K25A 3BYDA 4NYYA 3UDFA 5DNMA 4CAYA 4FSFA 2EX8A 4WMCA 1AOIC 3REIA 3AGDA 5CGWA 4XUJA 4LV1A 4J8WA 1P3OC 5EVLA 3G30A 4KZBA 3A1IA 2F2AC 5B31G 3HLGA 3VFHA 2HPBA 1I5QA 4NE5A 2HIOD 3WTPE 4X23B 3MGQC 2NZDB 1W5DA 4U0XA 3FKVA 2Z2MB 3AZLB 3GR2A 3AZID 1P3MD 3Q7ZA 5CGXA 5D3OA 3AYWD 3B0CT 1U35B 3ITAA 1Q2QA 5BS7A 2PYOB 5CRFA 3CG5A 3TOIA 5AY8B 4KUDB 3AZFB 3Q81A 1H8ZA 1KX5C 3MNNC 1RP5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SDN A;  3JYI A;  1ES5 A;  4OPY A;  4RVA A;  5FI6 A;  4LCL A;  5E2G A;  4GN2 A;  4N9K A;  5E2F A;  3PBS A;  3P98 A;  1C3B A;  4QJG A;  5FQQ A;  3LO7 A;  1AXB A;  1IYQ A;  2ZQ9 A;  4WZ4 A;  4GDN A;  1HVB A;  2XR0 A;  4R23 A;  1RGZ A;  4KZ7 A;  2Y2L A;  4Y0U A;  3N4I A;  4QHC A;  4DE2 A;  4Y0T A;  2WGW A;  3GQZ A;  3NBL A;  4FD8 A;  3G2Y A;  3VP0 A;  1E3U A;  3BFC A;  1BTL A;  1NJ4 A;  2QZ6 A;  5KSH A;  3PBT A;  4IVK A;  3ZNT A;  1H5X A;  1FR1 A;  1ERO A;  2OV5 A;  3ZG8 B;  3E2K A;  1PWD A;  1L0E A;  3DWK A;  5CEC A;  3BFF A;  3I7J A;  3V3S A;  3ZG5 A;  5DF9 A;  1ONH A;  1W8Y A;  2I72 A;  4EQI A;  3FWL A;  1RGY A;  4YFM A;  2ZLY A;  2ZJ9 A;  2ZQC A;  2VGJ A;  1K4F A;  4WZ5 C;  4S2N C;  5EVI D;  3Q7V A;  1IKG A;  1IYS A;  2C6W B;  3C7V A;  3S1Y A;  1K6R A;  3IT9 A;  4WMC D;  4KZ5 A;  1XX2 A;  3LCE A;  4X6T A;  3IXB A;  4EBN A;  1Y54 A;  1S6R A;  3G2Z A;  1TEM A;  4ZTK A;  3SS3 A;  3O86 A;  1GHI A;  2Q9M A;  1TVF A;  5DTS A;  3LEZ A;  4KZ9 A;  2WKI A;  1VM1 A;  2ZQA A;  3B3X A;  1GA0 A;  3W8K A;  1K54 A;  1O7E A;  4R4S A;  5GHY A;  2G2W A;  3V5M A;  3ZG7 B;  1JWP A;  2WK0 A;  3FYZ A;  3UPN A;  1DJC A;  2EFX A;  3N8R A;  5M19 A;  4GD8 A;  4BJP A;  2JE5 A;  4R1G A;  1SKF A;  4MBH A;  4N1H A;  5CTN A;  2H0T A;  1HD8 A;  2IWC A;  1PWC A;  3IXG A;  3A3I A;  1ESI A;  2OLV A;  2ZM2 A;  4DF6 A;  3SS5 A;  2EXA A;  4R0Q A;  1BLP A;  4DE0 A;  3FZC A;  3A3J A;  4E3O A;  1MWS A;  3IXH A;  1G68 A;  3CMZ A;  1MWR A;  2WGI A;  3PBQ A;  4RX2 A;  4DE3 A;  2HDR A;  5FAT A;  2QMI A;  4OPR A;  4B88 A;  4NK3 A;  5HX9 A;  5KMW A;  2X02 A;  4RA7 A;  1IEL A;  1BLC A;  1WYB A;  2FFY A;  4MEZ A;  3M2K A;  4KG6 A;  3IHB A;  4PM8 A;  2DRW A;  4E3N A;  2Y4A A;  1K4E A;  3Q07 A;  3IWI A;  4JF6 A;  5GLB A;  3GRJ A;  4IBR A;  3FV7 A;  3IWQ A;  1BLS A;  3HUN A;  4OP8 A;  3W4P A;  5AQB A;  1QME A;  2B5R A;  1BSG A;  4WEK A;  1BUE A;  1W7F A;  3VOZ A;  3UE1 A;  4GKU A;  4N9L A;  5DTK A;  1XXM A;  4OOM A;  5GL9 A;  1RCJ A;  5FQI A;  5CEB A;  5HAP A;  2Y55 A;  2E8I A;  3PBN A;  4S2P A;  2QPN A;  3ZG0 A;  5F1G A;  3IHA A;  2Q9N A;  1GCE A;  4HEF A;  3IXD A;  1MXO A;  1PI4 A;  4PM7 A;  1LI0 A;  3RJU A;  3V3R A;  2J9P A;  4WEL A;  3UN7 A;  3LY4 A;  4PPR A;  2XFS A;  1E3U D;  1M40 A;  1MWT A;  3SS4 A;  3ZVW A;  2X71 A;  3ZCZ A;  4QB8 A;  2WAE A;  4L0L A;  2DNS A;  4BQM A;  4X68 A;  3ISG A;  3UPP A;  1IKI A;  1PI5 A;  1S0W A;  2P74 A;  2EX2 A;  2HDU A;  4X69 A;  2WGV A;  3G4P A;  3UPO A;  1KE4 A;  4O7D A;  2XK1 A;  3WRZ A;  1O07 A;  2WKE A;  4P0M A;  4LCM A;  3EQV A;  5E2E A;  5GHZ A;  3N7W A;  4QY5 A;  3IF5 A;  4WYY A;  3WS1 A;  5HAQ A;  3AGE A;  1KDW A;  4GD6 A;  5CHJ A;  1BUL A;  1Z6F A;  2WAD A;  3NIA A;  4UHU A;  3G35 A;  1KGG A;  3ZFZ A;  2WYX A;  3OCL A;  3GTC A;  4ZBE A;  4QU3 A;  1GHP A;  4NET A;  4OH0 A;  3DWZ A;  5M1A A;  2IWD A;  4IVI A;  5EOE A;  1XGI A;  5DF8 A;  1FCN A;  2UWX A;  1JVJ A;  4JXG A;  3VSK A;  4EUZ A;  5A90 A;  4U0T A;  4LV2 A;  5EPH A;  3PAE A;  5HAI A;  4X56 A;  1YLY A;  4GB7 A;  4IED A;  4MBK A;  1SCW A;  2GDN A;  1BLH A;  1TDL A;  4DXB A;  2A3U A;  3RXW A;  3GMW A;  4OPZ A;  2HDS A;  2ZQD A;  2H0Y A;  4ZAM A;  1HTZ A;  3VP1 A;  2WAF A;  1IEM A;  2XGN A;  1N9B A;  3GVB A;  4DRT A;  2P9V B;  1XA1 A;  3DTM A;  4BEN A;  5M18 A;  4LV0 A;  2XD1 A;  4BD1 A;  5F82 A;  3HLW A;  3IWO A;  3VP3 A;  3UE3 A;  5JYP A;  2BG1 A;  3BFE A;  2XEP A;  3C5A A;  3NY4 A;  4S2L A;  4C6Y A;  2RCX A;  3MXS A;  1SDE A;  4WBG A;  2ZC4 B;  4R3J A;  1CI8 A;  2Y59 A;  4Y7P A;  1ES4 A;  1TDG A;  3BFG A;  4FH4 A;  3HUM A;  4GOG A;  3UO9 A;  5FQJ A;  2Y2G A;  1LHY A;  4KZ6 A;  1L0F A;  2OLU A;  3N8S A;  1L2S A;  1PZO A;  3IQA A;  5E43 A;  4MNR A;  1BT5 A;  4XXR A;  2JCH A;  2ZMA A;  1K6S A;  3D4F A;  1JWV A;  2WGW B;  4WEJ A;  3G31 A;  3NDG A;  4H8R A;  4K0W A;  1EI5 A;  5EVI C;  1G6A A;  3NC8 A;  5A91 A;  1ZG6 A;  1YLP A;  3HUO A;  3HBR A;  3DW0 A;  1I2S A;  4OON A;  2H5S A;  4OP5 A;  5J8X A;  3IF6 C;  1I2W A;  2XLN A;  2ZC7 A;  3BLS A;  4CJN A;  4E3M A;  3HL9 A;  4KZ8 A;  4OOL A;  2HDQ A;  4BLM A;  2FFF B;  4RYE A;  2EXB A;  3M6B A;  4JF4 A;  5A92 A;  3Q7V B;  3VFF A;  2C5W B;  3VMA A;  4DKI A;  2Y2Q A;  2A49 A;  1E4D A;  4GNU A;  2Y2O A;  1DJB A;  4PM6 A;  3AGF A;  3HLD A;  1YMS A;  2WKH A;  5DTT A;  3UY6 A;  1J9M A;  2J7V A;  4M3K A;  3TG9 A;  3HLF A;  5L2F A;  1NY0 A;  1YT4 A;  3UDX A;  1GA9 A;  4EBP A;  3O88 A;  5AQ7 A;  3VSL A;  4ZJ3 A;  4S2I A;  5CER A;  5FQM A;  3ZGA B;  1W79 A;  4E3K A;  2V1Z A;  1ES2 A;  1JTG A;  3LY3 A;  3MZF A;  1ZKJ A;  3OPR A;  2OSU A;  1FCO A;  3A3E A;  2ZQ8 A;  4RX3 A;  4A5R A;  4FH2 A;  1LL9 A;  3UDI A;  4N92 A;  4Z9Q A;  5I94 A;  1N4O A;  3ZG9 B;  1NXY A;  3W4Q A;  3Q82 A;  5HL1 A;  1PIO A;  4KQO A;  3PBO A;  4OOY A;  3ZDJ A;  3O87 A;  3NI9 A;  5CTM A;  2WZZ A;  3SH8 A;  4XUX A;  1LI9 A;  5EVI B;  1HZO A;  5HFO A;  1ERM A;  3SH9 A;  5FI2 A;  4DDY A;  2PBY A;  4XUZ A;  3S4X A;  4UA6 A;  5DF7 A;  4ZJ1 A;  3V50 A;  5FA7 A;  2R9X A;  3HLE A;  3MZD A;  3IF6 B;  4E6X A;  1JWZ A;  4PMA A;  1NZO A;  3PAG A;  4P85 A;  1NYM A;  1EWZ A;  2Z2L B;  3GSG A;  2Y2J A;  4PM9 A;  1QMF A;  3MKF A;  3OPL A;  3C7U A;  1DJA A;  3MZE A;  4S2O A;  5A93 A;  1CEG A;  1H8Y A;  1MBL A;  3OZH A;  1KE0 A;  4Y0O A;  4ID4 A;  5FAO A;  4E3L A;  1FQG A;  1PYY A;  3RXX A;  2EX6 A;  1XPB A;  2XF3 A;  1Q2P A;  1BZA A;  4QY6 A;  4B4Z A;  4KEN B;  1YMX A;  5FI7 A;  3Q1F A;  1SHV A;  1W8Q A;  3QHY A;  2XQZ A;  4KG5 A;  2ZC3 B;  5EUA A;  5FAQ A;  1E25 A;  1K57 A;  5IHV A;  2BLS A;  5CXW A;  4PM5 A;  1XKZ A;  4E6W A;  3C4O A;  3ITB A;  2ZQ7 A;  4OPQ A;  4KZA A;  3A3F A;  1K56 A;  5F1F A;  1KGF A;  4BD0 A;  1ZG4 A;  3MFD A;  1JTD A;  1ONG A;  2IWB A;  1M6K A;  4JXW A;  4MLL A;  4R3B A;  2Y2K A;  4P87 A;  1FCM A;  4GDB A;  5GLA A;  2H10 A;  3P09 A;  1U60 A;  4BL3 A;  1PWG A;  4EV4 A;  5HW3 A;  4JBF A;  3OCN A;  4S2K A;  5JYO A;  1K54 C;  2WUQ A;  2XFT A;  3QNB A;  2HP9 A;  3BRM A;  3S22 A;  3M2J A;  3M6H A;  3PTE A;  4E3J A;  5FAS A;  4QD4 A;  1ERQ A;  5AQ9 A;  3IH9 A;  5EEC A;  5FQK A;  4KG2 A;  4KZ3 A;  1FOF A;  4OLD A;  2XH9 A;  1ALQ A;  3UE0 A;  4DXC A;  2DCF A;  4D2O A;  1CI9 A;  1MY8 A;  3UNW A;  2WZX A;  3MBZ A;  2XDM A;  4K91 A;  4OLG A;  5EOO A;  2R9W A;  1LLB A;  3MXR A;  1K38 A;  3PBR A;  1GHM A;  4N1X A;  4JXV A;  5G18 A;  3BEB A;  1FSW A;  5CED A;  3WS2 A;  3ZVT A;  4OQH A;  3SOI A;  1OME A;  2XD5 A;  2ZD8 A;  3WS0 A;  5EE8 A;  2EFU A;  1XA7 A;  4R4R A;  4C3Q A;  1K55 A;  5GLD A;  1PZP A;  4C75 A;  4OQI A;  5CHM A;  3HLB A;  3MKE A;  3NDE A;  4U3T A;  2Y2H A;  4Q8I A;  5GHX A;  3WS4 A;  1MPL A;  4ZJ2 A;  2HP6 A;  3FKW A;  4HBU A;  1YLW A;  4P6B A;  1LL5 A;  5TR7 A;  5E2H A;  1KDS A;  1CK3 A;  3A3D A;  3O3V A;  3ZNY A;  2G2U A;  2RL3 A;  4JXS A;  3HLC A;  4KQR A;  2Y2N A;  5U47 A;  1L0D A;  4S2M A;  3HVF A;  4OQ0 A;  4BL2 A;  5FAP A;  4DE1 A;  4CPK A;  1ES3 A;  1IYO A;  2J8Y A;  5GLC A;  4LV3 A;  3E2L A;  1L0G A;  2EX9 A;  4LEN A;  2ZC5 B;  4OVD A;  4WZ5 A;  5F83 A;  2JC7 A;  4S2N A;  4GZB A;  2ZM0 A;  2Y2M A;  4B4X A;  1NZU A;  3BM6 A;  1YLJ A;  1VQQ A;  2HP5 A;  2PU2 A;  2ZM8 A;  3HRE A;  1KVL A;  1WE4 A;  3ZHH A;  1KGE A;  4UA7 A;  5KSC A;  2Y91 A;  4OQG A;  5HAR A;  4KQQ A;  4ZDX A;  5KZH A;  3N8L A;  4MBF A;  5FSR A;  1K25 A;  2X01 A;  1IYP A;  3BYD A;  3IH8 A;  3UDF A;  5EVI A;  5FDH A;  3W4O A;  1KE3 A;  1K56 D;  3C4P A;  4FSF A;  5TGF A;  3G32 A;  5DVA A;  2EX8 A;  2V2F F;  4WM9 A;  4EBL A;  4WMC A;  1MWU A;  3V39 A;  3AGD A;  1K57 C;  3IF6 A;  5CGW A;  2Y2P A;  4JF5 A;  4UAA A;  3CJM A;  4LV1 A;  2J9O A;  2JBF A;  4IBX A;  1K55 C;  4JPM A;  2PU4 A;  3G34 A;  1PW8 A;  1CEF A;  5EVL A;  3G30 A;  4E3I A;  4HES A;  1XP4 A;  4KZB A;  5BOH A;  5CHU A;  1YM1 A;  2ZC6 B;  5CGS A;  3HLG A;  3VFH A;  4S2J A;  2HPB A;  1I5Q A;  3N6I A;  1W5D A;  4U0X A;  3VP4 A;  3OPH A;  3OC2 A;  3WWX A;  3FKV A;  2V20 A;  3QNC A;  2Z2M B;  4K0X A;  1DY6 A;  1ESU A;  4KZ4 A;  4YIN A;  4DDS A;  2CC1 A;  4X53 A;  3GR2 A;  3EQU A;  3Q7Z A;  4HBT A;  4OKP A;  5CGX A;  1NRF A;  3CZD A;  1MKI A;  4UA9 A;  5TFQ A;  5D3O A;  1FR6 A;  4JKT A;  1YLT A;  4FCF A;  1YQS A;  4EWF A;  4F94 A;  4X55 A;  3ITA A;  3SH7 A;  1Q2Q A;  3WS5 A;  5AQA A;  5CRF A;  3CG5 A;  3NCK A;  5FQ9 A;  3TOI A;  3WRT A;  3TSG A;  1ZC2 A;  3VOY A;  1FSY A;  1KVM A;  2VGK A;  3BLM A;  1XGJ A;  3GV9 A;  1H8Z A;  3Q81 A;  1YLZ A;  4JLF A;  3VP2 A;  1WYC A;  3BFD A;  1NYY A;  1RP5 A;  3BEC A;  2Y2I A;  3OPP A;  1PW1 A;  2P9V A; 
#chains in the Genus database with same CATH topology
 3JYI A;  1Z09 A;  3H0L C;  1O6I A;  1YU1 A;  4JGR A;  5B40 D;  3P98 A;  3KUY B;  4QJG A;  1TZY B;  5BO0 B;  3B6F A;  5MC7 A;  2CV5 B;  4WZ4 A;  2Y2L A;  4Y0U A;  3AZE A;  3P7N A;  4H9Q B;  3LEL A;  2WGW A;  3GQZ A;  4HIA A;  1G6O A;  1BTL A;  5KSH A;  5CPJ C;  2GX5 A;  3ZNT A;  3KSH A;  3LUQ A;  1KX4 C;  1L0E A;  5CEC A;  3BFF A;  1P9W A;  3C1B C;  3AN2 D;  2I72 A;  4EQI A;  3PHY A;  2PR6 A;  2HIO B;  3VH6 A;  3L25 A;  4R70 A;  3FKE A;  4DRB A;  2DMW A;  4WZ5 C;  4EW7 A;  4X25 A;  4S2N C;  5B32 D;  3Q7V A;  3S1Y A;  3AZI B;  1P3M B;  1K6R A;  3LZ0 D;  2D01 A;  3AZG D;  2K2N A;  3IXB A;  3AYW B;  3AZJ D;  1S6R A;  4ZTK A;  5DTS A;  1TVF A;  5DNM C;  3EPK A;  1W63 Q;  4R4S A;  5GHY A;  3REI C;  1JWP A;  5DNN A;  2WK0 A;  4XUJ C;  1DJC A;  2EFX A;  4J8W C;  3UB6 A;  1SKF A;  3LIA A;  4MBH A;  1HD8 A;  3AV2 A;  2K7S A;  5AVC C;  3WTP A;  1P3F A;  4R0Q A;  5CP6 C;  3IXH A;  5G4Z A;  3CMZ A;  1ZLA A;  4MN7 A;  2WGI A;  5B40 B;  3PBQ A;  4RX2 A;  2QMI A;  4NK3 A;  5HD5 A;  4AFI A;  5HX9 A;  4FOF A;  4FTX A;  4ETX A;  2X02 A;  3A1K A;  1IEL A;  2O9C A;  1WYB A;  2FFY A;  4MEZ A;  3RTY A;  5J4E A;  4PM8 A;  1K4E A;  3Q07 A;  1DRM A;  3IWI A;  5BS7 C;  1ID3 D;  4Z66 D;  4KGC D;  2LB9 A;  1QME A;  2B5R A;  2QWS A;  3MVD A;  3CHW P;  4DN0 A;  5TBM A;  3AN2 B;  4OOM A;  5E5A A;  3UT9 D;  3IX8 A;  5FQI A;  3E4O A;  2Y55 A;  2E8I A;  4S2P A;  3RH8 B;  5B32 B;  5F1G A;  3IHA A;  4I3A A;  3IXD A;  4H9O A;  1OT6 A;  4PM7 A;  3V3R A;  3JVV A;  3F1N A;  3LZ0 B;  4IBC A;  3AZG B;  2V1A A;  3AZJ B;  4YS3 B;  3H0M C;  2M1C A;  4YOF A;  1S0W A;  5HPF A;  3LEL C;  5G49 B;  2F8N G;  2DF4 C;  2XK1 A;  1O07 A;  4Z2G A;  2ZL1 A;  3EQV A;  2K31 A;  2YFV A;  4H9R B;  1KDW A;  1CQA A;  3G35 A;  5CPI C;  3ZFZ A;  3OCL A;  4ZBE A;  3MGR A;  3LYX A;  4Z2M H;  1P3K D;  5DF8 A;  2UWX A;  3VSK A;  5BNV A;  4JGP A;  2VV6 A;  4X56 A;  1B6W A;  1SCW A;  3A6N D;  4HY8 A;  2A3U A;  5KDM B;  2ZQD A;  2H0Y A;  1ID3 B;  4IJF A;  1N9B A;  5HD3 A;  4Z1W A;  4Z66 B;  4KGC B;  3DTM A;  5GT0 A;  4LV0 A;  2RVQ C;  5DNN C;  3F1P A;  3HLW A;  3VP3 A;  3UE3 A;  5JYP A;  2XEP A;  3C5A A;  3NY4 A;  3MGS D;  3V9R A;  3UT9 B;  3BFG A;  3AV2 C;  2AVX A;  1LHY A;  3N8S A;  3X1T C;  3WTP C;  1P3F C;  3IQA A;  5E43 A;  3WA9 D;  2ZMA A;  1M1A A;  1OGG A;  1ZLA C;  3D4F A;  3VV4 A;  4WU8 A;  5DKK A;  4H8R A;  1G6A A;  3OOV A;  4DJ2 A;  2V1B A;  5FUG B;  3DW0 A;  4OON A;  1P34 A;  5B0Y A;  3MQO A;  3VE3 A;  4GS9 A;  4BBU A;  3H82 A;  5AV5 D;  3AZK D;  4OJ5 A;  2EXB A;  3M6B A;  4JF4 A;  3MVD C;  4L9F A;  5A92 A;  5B2J C;  4QWO A;  5AV9 A;  4JGQ A;  2A49 A;  4ZRR A;  2PD7 A;  3H7W A;  4Q0I A;  4PM6 A;  4I3J A;  2WKH A;  5DTT A;  1UR8 A;  1YSQ A;  2J7V A;  4Z2M G;  4M3K A;  3TG9 A;  2F8N K;  3KWQ D;  1DP6 A;  1TF1 A;  3TJZ C;  1DP9 A;  4Z5T D;  5BT1 C;  3BY9 A;  1P3K B;  1GA9 A;  4EBP A;  4OJO A;  4LD9 A;  4ZJ3 A;  5IS1 A;  1JTG A;  4X23 A;  1SZV A;  2NZD A;  3AFA C;  2ZQ8 A;  3IS2 B;  3T4O A;  1LL9 A;  3X1V D;  1VEU A;  4Z9Q A;  3MXQ A;  3AZL A;  4UEY A;  3Q82 A;  5HL1 A;  4NXE A;  2ZOI A;  4OOY A;  3O87 A;  3C38 A;  3SH8 A;  3NOT C;  5FEF A;  1LI9 A;  3MR0 A;  4LRZ E;  1U35 A;  1ERM A;  3NJA A;  5FI2 A;  4WJ3 C;  3F1O A;  3LGO A;  4XUZ A;  3S4X A;  1PDC A;  2PYO A;  2R9X A;  3WA9 B;  1KOU A;  4PAU A;  4E6X A;  5AY8 A;  3QP1 A;  4ZUX C;  3AZF A;  4P85 A;  2Z2L B;  5DFY A;  3OPL A;  3C7U A;  4S2O A;  1CEG A;  1H8Y A;  1MBL A;  4ID4 A;  4E3L A;  1FQG A;  2EX6 A;  1XPB A;  1Q2P A;  2ACG A;  5B24 D;  5GT0 C;  3AZK B;  3QHY A;  2XQZ A;  3KUY A;  3NUL A;  1PFL A;  1TZY A;  5FAQ A;  5BO0 A;  1W1T A;  2CV5 A;  4J8V A;  3AZH A;  3L2A A;  5CXW A;  3C4O A;  1W63 M;  3ITB A;  4OPQ A;  1E6Z A;  2PYR A;  5AVE A;  2IWB A;  1ONG A;  5DJU A;  5AVB D;  2V0U A;  3KWQ B;  1M1A C;  2L0W A;  4HP4 A;  4JXW A;  4Z5T B;  4GDB A;  2HJ9 C;  4WU8 C;  2YKH A;  3OCN A;  4JBF A;  1PRQ A;  1K54 C;  3D3O A;  5GXQ A;  2WUQ A;  3S22 A;  2HIO A;  3M6H A;  5B0Y C;  2VA0 A;  3X1V B;  4PKY G;  5FAS A;  5AQ9 A;  3IH9 A;  1P3I C;  3EPH A;  3AZI A;  4OLD A;  1P3M A;  3B6F B;  3BWL A;  1MY8 A;  3X1S D;  1LL8 A;  4OLG A;  3AYW A;  5EOO A;  3WAA D;  5AV9 C;  2R9W A;  1F1E A;  5JA4 B;  3MXR A;  3PBR A;  3WD4 A;  2RIQ A;  3BEB A;  5CED A;  4KHA B;  4GCZ A;  1OME A;  5EE8 A;  1K55 A;  5GLD A;  1WWI A;  5GT3 D;  1PZP A;  5CHM A;  2A24 B;  1P97 A;  3RFB A;  5EV0 A;  2P7J A;  2HP6 A;  3FKW A;  4X23 C;  2NZD C;  2W3D A;  3BQ8 A;  1KDS A;  5B24 B;  3O3V A;  5B40 A;  3AZL C;  4KQR A;  2ZY4 A;  2Y2N A;  4S2M A;  2ZM5 A;  2YFW B;  1OJ5 A;  1ES3 A;  1U35 C;  1IYO A;  1OTB A;  2PYO C;  5AVB B;  4LEN A;  3V67 A;  3LIC A;  3UB7 A;  5AY8 C;  2J3W A;  4OVD A;  5B0Z D;  4KUD C;  5C3I B;  2W3F A;  3DAV A;  3AZF C;  2ZM0 A;  2Y2M A;  3HJI A;  3S7N A;  2ZM8 A;  2HP5 A;  2PU2 A;  3ZHH A;  3AN2 A;  2BTF P;  3PYP A;  5HAR A;  5KZH A;  3N8L A;  1NLZ A;  2X01 A;  1IYP A;  1P3G D;  5B32 A;  3W4O A;  3K2N A;  2OOL A;  5HWT A;  3G32 A;  4EBL A;  4WM9 A;  1T3U A;  3KUY C;  2O9B A;  3LZ0 A;  3V39 A;  1TZY C;  3AZG A;  2Y2P A;  5B2I D;  3X1S B;  3KXB D;  4JF5 A;  3AZJ A;  4UAA A;  3WAA B;  4LLO B;  4H9S A;  4IBX A;  1TD5 A;  2PU4 A;  4E3I A;  3GEC A;  4HES A;  5G49 A;  5BOH A;  1YM1 A;  2ZC6 B;  5CGS A;  5GT3 B;  4LGW A;  3N6I A;  1ODV A;  3T50 A;  1E88 A;  3QNC A;  1LSX A;  4H9R A;  3REL D;  4HBT A;  2VV8 A;  3BJN A;  1NRF A;  2HIO C;  4JKT A;  4EWF A;  2MJ6 A;  4HMC A;  4F94 A;  3FPW A;  3NQJ B;  3HON A;  3AZI C;  1P3M C;  3KS4 A;  1V9Z A;  3AYW C;  1JFI A;  4JLF A;  3BLM A;  3GDI A;  1P34 D;  3VP2 A;  3F6T A;  3BFD A;  1ID3 A;  2J8P A;  3OPP A;  1H3O B;  1K55 C;  4Z66 A;  4KGC A;  5B0Z B;  4OPY A;  4RVA A;  1M18 D;  5FI6 A;  4LCL A;  4GN2 A;  4E45 A;  2OWJ A;  4BBT A;  1C3B A;  3UT9 A;  2PAV P;  5FQQ A;  4IBK A;  3LO7 A;  3MGP D;  1AXB A;  1IYQ A;  1HVB A;  4R23 A;  4WU9 C;  1STZ A;  1P3G B;  1RGZ A;  4KZ7 A;  2EA9 A;  4UQI S;  5B40 C;  3NBL A;  4FD8 A;  5L8M A;  3G2Y A;  3VP0 A;  1E8B A;  5B2I B;  3KXB B;  4KQD A;  2M7U A;  4IVK A;  1H5X A;  1ERO A;  3DWK A;  3C1C D;  1YU3 A;  3W98 A;  3V3S A;  1LT0 A;  1W8Y A;  2ZLY A;  4NXF A;  1M19 D;  2VGJ A;  1K4F A;  5JRG D;  3LI9 A;  5EVI D;  3REL B;  1IKG A;  1IYS A;  5AJG A;  4LFU A;  1XX2 A;  2G5I C;  1TEM A;  3SS3 A;  3O86 A;  3LEZ A;  5B32 C;  2ZQA A;  3B3X A;  5G4Y A;  4II7 A;  3NHQ A;  5L10 A;  1P3K A;  2BYK B;  3V5M A;  1DP8 A;  3AZG C;  2W1R A;  3FYZ A;  3AZJ C;  3UPN A;  3N8R A;  4YS3 C;  4BJP A;  3A6N A;  1P34 B;  4H9S C;  1S1Y A;  2JE5 A;  4R1G A;  4DMZ A;  2HGV A;  4J8U C;  1PWC A;  3IS2 A;  3IXG A;  1ESI A;  1S32 D;  1BLP A;  1Q9C A;  3FZC A;  1ULY A;  1M18 B;  4E3O A;  1Y28 A;  1G68 A;  3MGS A;  4FUW A;  3UB8 A;  4DE3 A;  4B88 A;  3B33 A;  3MGP B;  5KMW A;  2L4R A;  1P3L D;  1BLC A;  4P6Z M;  3WA9 A;  1H0I A;  3IHB A;  2Y4A A;  5GLB A;  1HQ3 D;  4EU0 A;  2XA7 S;  1VET B;  3LEQ A;  4LD9 B;  1BLS A;  1PZR A;  3HUN A;  3W4P A;  4NZ3 A;  3W96 D;  4WEK A;  1BSG A;  4H6J B;  5GXQ D;  4GKU A;  4N9L A;  3C1C B;  3FG8 A;  1VHM A;  1ID3 C;  1M19 B;  5CEB A;  5AV5 A;  4Z66 C;  4KGC C;  3AZK A;  5JRG B;  2QJ7 A;  1OPX A;  4HEF A;  1MXO A;  1KX3 D;  1LI0 A;  4G91 B;  4WEL A;  3UN7 A;  1T1C A;  5F99 D;  3UT9 C;  2XFS A;  3SS4 A;  3ZVW A;  4QB8 A;  2WAE A;  2CMN A;  3B47 A;  1OTD A;  1X0O A;  3KWQ A;  4Z5T A;  2P74 A;  5B1M D;  2G5H C;  3EG5 B;  4HNB A;  3UPO A;  1KE4 A;  4O7D A;  3WRZ A;  3KSG A;  5BPV A;  3VH5 W;  2ZOH A;  5E2E A;  3N7W A;  4QY5 A;  2Y79 A;  3OLO A;  4WYY A;  1V9Y A;  4NYU A;  3DTE A;  3X1V A;  2HV1 A;  5CHJ A;  1S32 B;  5HZH A;  3NIA A;  2DQN C;  4UHU A;  3SW1 A;  4R3A A;  2HZ5 A;  1T1B A;  2WYX A;  2WKP A;  4QU3 A;  1OT9 A;  4J8V B;  3AZH B;  1P0Z A;  4IVI A;  1XGI A;  3P5J B;  5JA4 A;  3W97 D;  1FCN A;  1JVJ A;  5FEG A;  4HJ6 A;  5A90 A;  2H28 A;  4EUZ A;  1P3L B;  4KHA A;  3HJK A;  4MBK A;  4IED A;  5B31 D;  4DXB A;  3RXW A;  1HQ3 B;  4MB3 A;  4NKP A;  2A24 A;  1P3K C;  3GVB A;  5M18 A;  2P9V B;  2RTS A;  1XA1 A;  4BEN A;  3W96 B;  1G5U A;  3DTK A;  5F82 A;  3IWO A;  1N1J A;  5GXQ B;  2BAS A;  4R8P D;  3KFU G;  4S2L A;  3MXS A;  1SDE A;  4KUO A;  4WBG A;  2ZC4 B;  1L3L A;  1B67 A;  4FH4 A;  3UO9 A;  5FQJ A;  4O8G A;  3FDD A;  1L0F A;  5B24 A;  2OLU A;  1PZO A;  5F6A A;  4XXR A;  1P3P D;  1KX3 B;  5F99 B;  4WEJ A;  2YFW A;  4IUK A;  1YLP A;  5AVB A;  3WA9 C;  5J8X A;  5B1M B;  1D7E A;  2F8N H;  4ME4 A;  4NE3 A;  3HL9 A;  4KZ8 A;  2XSS A;  3S7P A;  1IOU A;  2HF6 A;  2C5W B;  3VMA A;  3FPV A;  4NZ1 A;  2GNX A;  3WD1 A;  4GNU A;  2Y2O A;  4H9N B;  3R4K A;  1YMS A;  3AZK C;  1J9M A;  1PNE A;  3HLF A;  4IBJ A;  5HPI A;  2XRO A;  3UTA A;  3X1S A;  3B42 A;  1YT4 A;  4GHA A;  3WAA A;  3W97 B;  3O88 A;  5AQ7 A;  3L26 A;  5CER A;  5FQM A;  5B31 B;  1R4V A;  4E3K A;  3QP4 A;  3T4L A;  2V1Z A;  1ES2 A;  3LY3 A;  5GT3 A;  3KWQ C;  3MZF A;  3VH5 T;  4WNN B;  4Z5T C;  1FCO A;  3LIB A;  3AZM A;  5I94 A;  3LID A;  4R8P B;  4L9E A;  5I5L A;  2J3T D;  3NI9 A;  4NY2 A;  5CTM A;  2HJE A;  1TS7 A;  3EEH A;  2ZY3 A;  3X1V C;  3NQJ A;  4DDY A;  2W27 A;  4ZJ1 A;  3KSI A;  2W0N A;  3E4P A;  5FA7 A;  3HLE A;  3CLO A;  5HDD A;  3MZD A;  3B6F C;  4PMA A;  1NLY A;  4BMW A;  2Y2J A;  4IJG A;  3AZE C;  4IBD A;  3MKF A;  3W98 D;  1DJA A;  5A93 A;  4Y0O A;  3O5Y A;  1H3O A;  1PYY A;  3RXX A;  3TW8 A;  5B0Z A;  3NEC A;  1BZA A;  4B4Z A;  4CLC D;  5EVE A;  5EUA A;  1T1A A;  2WKQ A;  1K57 A;  3ZQ5 A;  2PYP A;  1XFQ A;  1P3A D;  1P3G A;  5HSQ A;  4KZA A;  5B24 C;  1YU0 A;  1ZG4 A;  1JTD A;  3NQU B;  1M6K A;  4MLL A;  5B2I A;  3KXB A;  4LRY C;  4E44 A;  4EQ1 A;  1JFI B;  1BYW A;  4BL3 A;  4EV4 A;  4S2K A;  3L27 A;  2WKR A;  5AVB C;  4MN5 A;  1GPF A;  3IBJ A;  4Y15 A;  2VLG A;  5C3I C;  3CUE A;  1BH8 B;  4IHQ A;  3REL A;  5EEC A;  5FQK A;  4KG2 A;  3QP8 A;  4KZ3 A;  3UE0 A;  4DXC A;  1FIL A;  4D2O A;  3ZYT A;  3UNW A;  3MBZ A;  2XDM A;  1LLB A;  2D49 A;  3WS2 A;  4OQH A;  3SOI A;  2F8N D;  3SZT A;  2BYK A;  4C75 A;  3X1S C;  3C30 A;  3AZN D;  3MKE A;  3PXP A;  3W98 B;  1CXW A;  3REK D;  5EM1 A;  3PR6 A;  1F2K A;  4HBU A;  1YLW A;  1NWZ A;  1M18 A;  4CLC B;  4KUK A;  3MQQ A;  4XZQ D;  3L28 A;  3LZ1 D;  5E5A C;  3MGP A;  5U47 A;  2O9A A;  1L0D A;  1UR9 A;  1P3A B;  1S67 L;  1TS6 A;  4BL2 A;  5FAP A;  4J8X D;  4GHI B;  3LJA D;  5GLC A;  5CP6 D;  1L0G A;  5FDS A;  1S1Z A;  4K08 A;  1VET A;  2ZC5 B;  1XJ2 A;  5F83 A;  1D06 A;  2VQR A;  3A6N B;  3B0B A;  4GZB A;  4H6J A;  1NZU A;  1YLJ A;  3C1C A;  2JSS A;  5HDC A;  3UE6 A;  4ZDX A;  1M19 A;  3DBA A;  3REJ D;  5B0Z C;  5JRG A;  5EVI A;  3MGS B;  1YAX A;  3C4P A;  2JKR M;  5DVA A;  1YU4 A;  1MWU A;  3IF6 A;  1K57 C;  2NUP C;  2BYM A;  4JPM A;  3MGR C;  3G34 A;  2R78 A;  2ZBB A;  2F8N B;  1XP4 A;  4QLC A;  4ZBJ B;  4GLQ A;  5CHU A;  3X1U D;  4S2J A;  2O99 A;  5B2I C;  3B0D B;  3KXB C;  5B1L D;  1MC0 A;  3AZN B;  3OPH A;  3OC2 A;  4HGA B;  4H9P B;  2NQB A;  2V20 A;  4HH3 A;  4K0X A;  1P9R A;  3WKJ D;  2ARO D;  4KZ4 A;  4GHL A;  4DDS A;  3REK B;  2CC1 A;  4X53 A;  1S32 A;  5AV5 B;  5TFQ A;  3CZD A;  1MKI A;  4UA9 A;  1YQS A;  3T1X A;  4XZQ B;  3SH7 A;  3REL C;  3LZ1 B;  5AQA A;  3WRT A;  3TSG A;  1ZC2 A;  3VOY A;  1P3L A;  1CK7 A;  1YUE A;  1FSY A;  1KVM A;  4J8X B;  1XGJ A;  3A0R A;  3LJA B;  5CP6 B;  5CPI D;  4O01 A;  1HQ3 A;  3G6O A;  4LG2 A;  1J7M A;  1PW1 A;  2P9V A;  4HJ3 A;  1SDN A;  3W96 A;  1ES5 A;  4N9K A;  2QHK A;  5E2F A;  1P34 C;  3CIT A;  3T4T A;  1UWP X;  2ZQ9 A;  4GDN A;  3REJ B;  2XR0 A;  4D60 A;  1M18 C;  4WZS B;  3N4I A;  4Q0H A;  3UTA D;  2RVQ D;  1KX3 A;  4QHC A;  4YNR A;  2PT7 A;  4DE2 A;  5F99 A;  1QO6 A;  3TE8 A;  3UTB D;  3MGP C;  2QZ6 A;  1TS8 A;  3OBF A;  1UWN X;  3D9Y A;  3E2K A;  4R38 A;  5B1M A;  3I7J A;  3MQ0 A;  3ZG5 A;  1ONH A;  3X1U B;  4WLA A;  3FWL A;  1RGY A;  4YFM A;  2ZJ9 A;  4LD9 C;  3AZM D;  5B1L B;  1T19 A;  1N1J B;  3T4K A;  3WKJ B;  1S66 L;  2ARO B;  1AWI A;  3C1C C;  3IT9 A;  4YM6 D;  4NG2 A;  3LCE A;  4H9N A;  3MMH A;  4X6T A;  1M19 C;  5BNX B;  1VB6 A;  3W8K A;  1GHI A;  3HSH A;  4KZ9 A;  1BH9 B;  1VM1 A;  4B9O A;  1O7E A;  2V8F A;  4G91 C;  3W97 A;  5B33 D;  5B2J D;  3LI8 A;  1EQZ D;  5M19 A;  5B31 A;  3KSY A;  2I9V A;  3LR4 A;  4N1H A;  5CHL B;  5CX7 A;  4WNN A;  1H8M A;  2FJ7 D;  2IWC A;  3HCY A;  2W8S A;  4CLC E;  2ZM2 A;  4Y3I A;  2EXA A;  1MWS A;  4EES A;  4R8P A;  3TU4 D;  2QJ5 A;  1MWR A;  1S32 C;  2VGL M;  3LIE A;  2B18 A;  3H9W A;  4I38 A;  4E3N A;  3UTA B;  1P3P A;  2CV5 C;  4J8V C;  3AZH C;  2P04 A;  4JF6 A;  4EUV A;  4IBR A;  4Y5F A;  3UTB B;  3IWQ A;  3QP2 A;  4OP8 A;  5AQB A;  1P3L C;  3T1S A;  5EM0 A;  4IJE A;  1BUE A;  4MB5 A;  1W7F A;  2D02 A;  5DTK A;  1HQ3 C;  5GL9 A;  3R45 B;  4L9G A;  1F66 D;  3AZM B;  3CI6 A;  5HAP A;  4ZUX D;  2G7U A;  3W96 C;  4MCW A;  2O0Y A;  1LSV A;  5GXQ C;  1BFM A;  1OTA A;  3RJU A;  2J9P A;  4YM6 B;  3LY4 A;  3S7O A;  2IA2 A;  1E3U D;  1M40 A;  3K3D A;  5LBR A;  3ZCZ A;  2DNS A;  3T12 B;  4X68 A;  3NQU A;  3ISG A;  1GSW A;  1KX3 C;  4MDZ A;  1L6J A;  5B33 B;  5F99 C;  2WGV A;  4GW9 A;  4HQA A;  4X69 A;  1EQZ B;  3K3C A;  4QPR A;  3IX4 A;  4JJN D;  2WKE A;  4P0M A;  4LCM A;  3AL0 C;  5GHZ A;  4UUZ A;  2GZA A;  4G92 B;  2FJ7 B;  3IF5 A;  1E15 A;  5HAQ A;  2FN2 A;  4GD6 A;  1BH8 A;  1CJF A;  3LFV A;  4DRA A;  2ZY5 A;  3GTC A;  3TU4 B;  4HI4 A;  2ZY2 A;  5M1A A;  3DWZ A;  2IWD A;  1W1P A;  5AV6 D;  2W3E A;  4U0T A;  3EWK A;  4LV2 A;  5EPH A;  1W2E A;  4GB7 A;  2GDN A;  3KYE A;  4O0P A;  1P3I D;  4OPZ A;  4Y2F A;  3LIF A;  4ZAM A;  3VP1 A;  3W97 C;  1IEM A;  1Y4O A;  4BD1 A;  1F98 A;  3BFE A;  5B31 C;  2RCX A;  3WX7 A;  1CI8 A;  2Y59 A;  1TDG A;  4GOG A;  4CLC A;  1F66 B;  2Y2G A;  1L2S A;  3EPL A;  3E98 A;  4MNR A;  1BT5 A;  3AN2 C;  1K6S A;  3LR3 A;  1P3A A;  3G31 A;  3NDG A;  4HMD A;  1EI5 A;  5A91 A;  3O62 D;  4GHI A;  1ZG6 A;  4BBV A;  1GOI A;  2CWE A;  3HBR A;  4QLC D;  1I2S A;  3LZ0 C;  2A2L A;  2L5A A;  4AWL B;  1OGB A;  2Z6C A;  4OP5 A;  1I2W A;  2XLN A;  3BLS A;  3IBR A;  4EO5 B;  2NQB D;  2W3G A;  1N9N A;  4JJN B;  2FFF B;  5HWV A;  3MS6 A;  4Y17 A;  3VFF A;  1P3B D;  2XRN A;  2Y2Q A;  1F9I A;  1E4D A;  3VH5 A;  3AGF A;  3CAX A;  4IUH A;  4GH9 A;  4F3L B;  1YSP A;  5L2F A;  5L09 A;  1NY0 A;  5AV6 B;  3UDX A;  5IU1 A;  3W99 D;  4CQH A;  2INW A;  4B93 A;  1T18 A;  4S2I A;  2F8N A;  1OJG A;  1AIW A;  3OPR A;  2OSU A;  3N3F A;  3AZN A;  4H9P A;  4N92 A;  3REK A;  4XT2 B;  3T1Q B;  1PIO A;  3PBO A;  4EEP A;  2WZZ A;  4XUX A;  5EVI B;  4XZQ A;  4HP9 A;  3V50 A;  3LZ1 A;  5GSU D;  4MN6 A;  2PBD P;  3IF6 B;  1KU5 A;  1JWZ A;  2J3T C;  1NZO A;  2W3H A;  3PAG A;  5TJJ A;  3BY8 A;  2BYM B;  4Z2K A;  5AVC A;  1EWZ A;  1NYM A;  4PM9 A;  4J8X A;  3O62 B;  3EEA A;  3LJA A;  1QMF A;  5CP6 A;  5J3W A;  4QLC B;  3OZH A;  3R7W B;  4NXG A;  1EAK A;  4I5S A;  2NQB B;  4KEN B;  5FI7 A;  1SHV A;  1W8Q A;  3W98 C;  2ZC3 B;  1P3B B;  1G28 A;  1K0K A;  5B32 G;  2BLS A;  3MJQ A;  3REJ A;  2ZQ7 A;  4CLC C;  4ARZ B;  5F1F A;  1MKM A;  1KGF A;  4BD0 A;  5CPK D;  3NOU C;  4P87 A;  1FCM A;  3W99 B;  1P3A C;  1PWG A;  5AV8 D;  4ETZ A;  4WU9 D;  5HW3 A;  4IBB A;  1LSW A;  5JYO A;  2ZMF A;  3X1U A;  2VZW A;  3QNB A;  4G3K A;  4EET B;  5B1L A;  1D1J A;  1OTE A;  1WWS A;  4EEU A;  3EGX C;  4UPK A;  3WKJ A;  3A6N C;  2W1T A;  2ARO A;  4QD4 A;  1ZTU A;  1ERQ A;  1J3W A;  2DCF A;  3D72 A;  1H3Q A;  1CI9 A;  2EWW A;  5BNX A;  2WZX A;  4K91 A;  3B6G D;  4IBI A;  4N1X A;  4JXV A;  1BH9 A;  3MGS C;  1FSW A;  5HL6 A;  3ZVT A;  3C2W A;  5GSU B;  2ZD8 A;  1JNU A;  2EFU A;  4R4R A;  4OQI A;  4I3I A;  1TAF B;  4U3T A;  5CPI A;  2JN7 A;  3L29 A;  3WS4 A;  1MPL A;  3L7H A;  4LPZ A;  4ZBJ C;  3H0R C;  3B0D C;  1SKO A;  4P6B A;  3REH D;  3AZN C;  5TR7 A;  4HGA C;  3ZNY A;  3A3D A;  2G2U A;  2JKG A;  4YS3 D;  3REK C;  2VKS A;  1YU2 A;  3BW6 A;  4J8U D;  5AV5 C;  2PD8 A;  3HVF A;  4OQ0 A;  4CPK A;  2J8Y A;  4LV3 A;  4XZQ C;  2OWH A;  3AV1 D;  3LZ1 C;  5CPK B;  2EX9 A;  3UTB A;  2YKF A;  2HUE B;  5AV8 B;  4J8X C;  3X1T A;  4WU9 B;  3LJA C;  3BM6 A;  1VQQ A;  1WE4 A;  4UA7 A;  3UME A;  3R45 A;  1AOI D;  4OQG A;  2IO5 B;  4Q0J A;  5FSR A;  3IH8 A;  5FDH A;  1KE3 A;  1P3O D;  1K56 D;  5TGF A;  4P6Z S;  2V2F F;  4YM6 A;  4IBF A;  3MGQ D;  3IX3 A;  3CJM A;  3REJ C;  2J9O A;  3B6G B;  2JBF A;  1P3P B;  3VH6 W;  1PW8 A;  1CEF A;  4IBG A;  1MZU A;  2PDR A;  5B33 A;  5B2J A;  1GSV A;  1EQZ A;  3MF0 A;  3EOI A;  3VP4 A;  3WWX A;  1DY6 A;  1ESU A;  4YIN A;  2FJ7 A;  3EQU A;  4Z2I A;  4PKY A;  3X1U C;  1N9L A;  4OKP A;  1F5M A;  5C5K A;  5B1L C;  3REH B;  4G3W A;  1YLT A;  4FCF A;  3TU4 A;  1KX5 D;  3WKJ C;  3QP6 A;  4X55 A;  2ARO C;  3MNN D;  3WS5 A;  3W2Z A;  2Z6D A;  3NCK A;  5FQ9 A;  5DJT A;  4J8U B;  3AFA A;  3T4S A;  2VGK A;  3GV9 A;  1YLZ A;  5DFX A;  1WYC A;  1N9O A;  3AV1 B;  1NYY A;  3BEC A;  4CSR B;  1E6R A;  1FR6 A;  2Y2I A;  2Y8H A;  4CJN A;  3VOL A;  3P01 A;  5E2G A;  4OUI A;  4UUZ B;  4PHT A;  3PBS A;  3WD2 A;  1AOI B;  1F66 A;  5HWW A;  5CPJ D;  4ZUX A;  2UV0 E;  1KX4 D;  1P3O B;  4Y0T A;  3C1B D;  1E3U A;  3BFC A;  3MGQ B;  1NJ4 A;  3PBT A;  4HOI A;  1FR1 A;  2OV5 A;  4NZ5 A;  3ZG8 B;  3A0V A;  3UTA C;  1PWD A;  5DF9 A;  3WAA C;  4HME A;  2ZQC A;  3UTB C;  4JJN A;  5DNM D;  2VX8 A;  2C6W B;  3C7V A;  5GT3 C;  4HH2 A;  3LR0 A;  4WMC D;  2V8C A;  4KZ5 A;  3REI D;  4EBN A;  1Y54 A;  3AZM C;  2VV7 A;  4XUJ D;  4NXB A;  3G2Z A;  4J8W D;  2Q9M A;  1KX5 B;  3A0S A;  2WKI A;  1W1Y A;  4F3L A;  3MNN B;  3U2A A;  1GA0 A;  3FC7 A;  1K54 A;  3VH6 T;  5AV6 A;  5AVC D;  4YM6 C;  3KSF A;  2G2W A;  3ZG7 B;  3KO6 A;  4GJ4 A;  2KDK A;  2PR5 A;  4GD8 A;  1P3I A;  4HJ4 A;  5CTN A;  5F68 A;  3ULF A;  2H0T A;  3A3I A;  5B33 C;  2OLV A;  4DF6 A;  3SS5 A;  4X1L A;  1EQZ C;  4DE0 A;  1OTI A;  3A3J A;  4XT2 A;  5AVF A;  2HDR A;  5FAT A;  4OPR A;  4G92 C;  2FJ7 C;  5CPJ B;  4EXO A;  4RA7 A;  1KX4 B;  3M2K A;  4KG6 A;  2Q0O A;  3TU4 C;  2DRW A;  1H0M A;  3C1B B;  4Z2J A;  3GRJ A;  3TRC A;  5IT5 A;  1P3G C;  3FV7 A;  3O62 A;  4NEE D;  2OAQ 1;  3VOZ A;  3UE1 A;  1E6P A;  3R7W A;  1XXM A;  3B6F D;  4NZ4 A;  2L1M A;  1RCJ A;  5HDS A;  3U4L P;  3PBN A;  2QPN A;  3ZG0 A;  5DNM B;  1P3B A;  3AZE D;  2Q9N A;  1GCE A;  4CAY B;  1PI4 A;  3CPT B;  3LEL D;  3E4Q A;  4PPR A;  3REI B;  1YKD A;  1MWT A;  3CUE C;  1F66 C;  2X71 A;  4ARZ A;  4XUJ B;  1HLU P;  4KUD A;  4L0L A;  4J8W B;  4BQM A;  3UB5 P;  3UPP A;  1IKI A;  1PI5 A;  2EX2 A;  2HDU A;  5AVC B;  3W99 A;  3G4P A;  3EPJ A;  1NRJ A;  3LR5 A;  1ACF A;  4AWL C;  3WS1 A;  3AGE A;  1BUL A;  1W1V A;  1GSX A;  4EO5 C;  1Z6F A;  2WAD A;  1KGG A;  4JJN C;  4DQY B;  1GHP A;  5KIZ A;  2JKT I;  4NET A;  4H9Q A;  3KX0 X;  4OH0 A;  5EOE A;  4EER A;  4WV4 B;  4JXG A;  1Z2C B;  5DNN D;  4UQI M;  3PAE A;  5HAI A;  1YLY A;  5GSU A;  3EGD C;  1BLH A;  2B02 A;  1TDL A;  3GMW A;  2HDS A;  2P08 A;  5J7E A;  1HTZ A;  3AV2 D;  5AV6 C;  2WAF A;  1TAF A;  2XGN A;  4DRT A;  3X1T D;  3WTP D;  1P3F D;  2XD1 A;  3JPU A;  2BG1 A;  3IP4 C;  4C6Y A;  1ZLA D;  1HTA A;  3KYQ A;  4R3J A;  4Y7P A;  4WN5 A;  1ES4 A;  2OAP 1;  3HUM A;  2W1T B;  2PHY A;  4KZ6 A;  1XJ6 A;  4X1M A;  3T4Q A;  2VEA A;  5K5B A;  2JCH A;  3AZE B;  4OJP A;  3LEL B;  1JWV A;  2WGW B;  2ZMV A;  5JRG C;  4K0W A;  4MB4 A;  5EVI C;  3NC8 A;  5DKL A;  3HUO A;  3MVD D;  5CPK A;  2H5S A;  3IF6 C;  2ZC7 A;  5E5A D;  5AV8 A;  4E3M A;  3KYZ A;  5CPI B;  3O62 C;  4WU9 A;  2HDQ A;  4OOL A;  4BLM A;  4RYE A;  2EWV A;  4NE6 A;  3UB9 A;  4QLC C;  3Q7V B;  4DKI A;  2LY8 A;  5BT1 D;  1SKO B;  3KS8 A;  1DJB A;  2NQB C;  3HLD A;  2QYB A;  2J80 A;  4RQ9 A;  3UY6 A;  4M6B A;  3QP5 A;  1P3B C;  2VK3 A;  3AFA D;  4QNL A;  3B6G A;  5EFW A;  5DNN B;  2LB5 A;  3VSL A;  3ZGA B;  1W79 A;  2XA7 M;  4G3V A;  3T4J A;  4Z2H A;  1ZKJ A;  3AV2 B;  3A3E A;  3C8C A;  4RX3 A;  4A5R A;  4FH2 A;  3UDI A;  3W99 C;  3X1T B;  3WTP B;  1P3F B;  2V5O A;  1N4O A;  3ZG9 B;  1NXY A;  3W4Q A;  3MGR D;  1ZLA B;  4KQO A;  2JHE A;  3ZDJ A;  4Z2L A;  2M7V A;  3REH A;  2KX6 A;  1HZO A;  3MSH A;  5HFO A;  3SH9 A;  2PBY A;  4UA6 A;  5DF7 A;  4YS3 A;  3BQA A;  4J8U A;  2KLI A;  4M4X A;  3GSG A;  4LRX C;  5GT0 D;  3DTI A;  1XFN A;  3MVD B;  3AV1 A;  3MZE A;  5GSU C;  5B2J B;  3S7Q A;  1KE0 A;  4CSR A;  5FAO A;  5TBM B;  5E5A B;  2XF3 A;  4QY6 A;  2FZ0 A;  1YMX A;  3Q1F A;  5B1M C;  4KG5 A;  1AOI A;  1E25 A;  1M1A D;  1S4R A;  1A0K A;  5IHV A;  4H9O B;  1ZHH B;  4PM5 A;  1XKZ A;  3F1N B;  4E6W A;  4WU8 D;  5A8B A;  1P3O A;  1K56 A;  1S4S A;  2NUT C;  3A3F A;  3JVU A;  3NOP C;  4JGO A;  3MFD A;  2IOU A;  3MGQ A;  4R3B A;  2Y2K A;  3AFA B;  5KDM A;  5B0Y D;  5GLA A;  2H10 A;  3P09 A;  1U60 A;  2KOI A;  2ZL1 B;  4TX8 A;  4OJ6 A;  5F5Y A;  2YFV B;  5CPK C;  2XFT A;  2HP9 A;  3BRM A;  3M2J A;  2HUE C;  5AV9 D;  5FL3 A;  3PTE A;  4E3J A;  5AV8 C;  4IBE A;  1YPR A;  1GXD A;  1FOF A;  3MGR B;  1ALQ A;  2XH9 A;  3B0C W;  4ZUX B;  1A7W A;  2IO5 C;  2B95 A;  4NFT A;  1K38 A;  1GHM A;  5BNV B;  4R8P C;  1KX5 A;  4LD9 D;  5G18 A;  3MNN A;  1EW0 A;  2XD5 A;  5FUG A;  3WS0 A;  4C3Q A;  1XA7 A;  1H0G A;  4Y13 A;  3WD0 A;  4X23 D;  1CF0 A;  2NZD D;  3HLB A;  3B6G C;  5GT0 B;  3NDE A;  2Y2H A;  1P3P C;  3F1P B;  4Q8I A;  3AZL D;  2PRF A;  5GHX A;  1IFQ A;  4ZJ2 A;  3V9R B;  4I39 A;  1LL5 A;  1UGU A;  1U35 D;  1E6N A;  5E2H A;  1CK3 A;  3E0Y A;  2RL3 A;  4JXS A;  2PYO D;  3HLC A;  1M1A B;  5CPJ A;  5AY8 D;  4WU8 B;  4KUD D;  3AZF D;  3REH C;  2V9A A;  1KX4 A;  2FH5 A;  4DE1 A;  3E2L A;  3C1B A;  1KS0 A;  1WA9 A;  3VE4 A;  3WD3 A;  4OJL A;  2VJW A;  5B0Y B;  4WZ5 A;  2JC7 A;  4S2N A;  2V0W A;  1H8P A;  4WL9 A;  4GS9 B;  1P3I B;  3H82 B;  4B4X A;  5KSC A;  3HRE A;  1KVL A;  1KGE A;  3KUY D;  3AV1 C;  2Y91 A;  1TZY D;  4KQQ A;  2CV5 D;  4J8V D;  3AZH D;  4MBF A;  5AV9 B;  1K25 A;  3BYD A;  4NYY A;  4ESP A;  3H7W B;  1FIK A;  3UDF A;  4DJ3 A;  5DNM A;  1XJ4 A;  3CWF A;  4MMN A;  4YWZ A;  4CAY A;  2VGL S;  4FSF A;  3CPT A;  2EX8 A;  3UMD A;  4WMC A;  1AOI C;  3REI A;  3AGD A;  5CGW A;  2QKP A;  4XUJ A;  4LV1 A;  4J8W A;  5L07 A;  4HHD A;  1P3O C;  5EVL A;  3G30 A;  4R6L A;  4BWI A;  4KZB A;  3A1I A;  2F2A C;  5B31 G;  3HLG A;  3T1R A;  3VFH A;  2HPB A;  1I5Q A;  1TS0 A;  1XJ3 A;  1W5D A;  4NE5 A;  2HIO D;  3WTP E;  4X23 B;  3MGQ C;  2NZD B;  2JKR I;  3ICY A;  4U0X A;  3FKV A;  1VEU B;  3MQL A;  2Z2M B;  3AZL B;  3GR2 A;  3AZI D;  1P3M D;  3Q7Z A;  5CGX A;  2E8J A;  5D3O A;  3AYW D;  3B0C T;  1U35 B;  3L9K A;  4E04 A;  3F1O B;  3ITA A;  1ED7 A;  1Q2Q A;  5BS7 A;  2PYO B;  4WF0 A;  5CRF A;  3CG5 A;  3TOI A;  3M7P A;  5AY8 B;  4KUD B;  3AZF B;  3MFX A;  2JKT M;  3Q81 A;  1H8Z A;  2JKF A;  4WUJ A;  1KX5 C;  3MNN C;  2GJ3 A;  1RP5 A;  5F69 A; 
#chains in the Genus database with same CATH homology
 3JYI A;  3H0L C;  1YU1 A;  5B40 D;  3P98 A;  3KUY B;  4QJG A;  1TZY B;  5BO0 B;  3B6F A;  2CV5 B;  4WZ4 A;  2Y2L A;  4Y0U A;  3AZE A;  4H9Q B;  3LEL A;  2WGW A;  3GQZ A;  1BTL A;  5KSH A;  5CPJ C;  3ZNT A;  1KX4 C;  1L0E A;  5CEC A;  3BFF A;  3C1B C;  3AN2 D;  2I72 A;  4EQI A;  2HIO B;  3VH6 A;  3L25 A;  3FKE A;  4DRB A;  4WZ5 C;  4S2N C;  5B32 D;  3Q7V A;  3S1Y A;  3AZI B;  1P3M B;  1K6R A;  3LZ0 D;  3AZG D;  3IXB A;  3AYW B;  3AZJ D;  1S6R A;  4ZTK A;  5DTS A;  1TVF A;  5DNM C;  3EPK A;  4R4S A;  5GHY A;  3REI C;  1JWP A;  5DNN A;  2WK0 A;  4XUJ C;  1DJC A;  2EFX A;  4J8W C;  1SKF A;  4MBH A;  1HD8 A;  3AV2 A;  5AVC C;  3WTP A;  1P3F A;  4R0Q A;  5CP6 C;  3IXH A;  3CMZ A;  1ZLA A;  2WGI A;  5B40 B;  3PBQ A;  4RX2 A;  2QMI A;  4NK3 A;  5HX9 A;  2X02 A;  3A1K A;  1IEL A;  1WYB A;  2FFY A;  4MEZ A;  4PM8 A;  1K4E A;  3Q07 A;  3IWI A;  5BS7 C;  1ID3 D;  4Z66 D;  4KGC D;  1QME A;  2B5R A;  3MVD A;  3AN2 B;  4OOM A;  5E5A A;  3UT9 D;  5FQI A;  2Y55 A;  2E8I A;  4S2P A;  5B32 B;  5F1G A;  3IHA A;  3IXD A;  4H9O A;  4PM7 A;  3V3R A;  3LZ0 B;  4IBC A;  3AZG B;  3AZJ B;  4YS3 B;  3H0M C;  1S0W A;  3LEL C;  5G49 B;  2F8N G;  2DF4 C;  2XK1 A;  1O07 A;  3EQV A;  2YFV A;  4H9R B;  1KDW A;  3G35 A;  5CPI C;  3ZFZ A;  3OCL A;  4ZBE A;  3MGR A;  4Z2M H;  1P3K D;  5DF8 A;  2UWX A;  3VSK A;  5BNV A;  4X56 A;  1B6W A;  1SCW A;  3A6N D;  2A3U A;  5KDM B;  2ZQD A;  2H0Y A;  1ID3 B;  4IJF A;  1N9B A;  4Z66 B;  3DTM A;  4KGC B;  5GT0 A;  4LV0 A;  2RVQ C;  5DNN C;  3HLW A;  3VP3 A;  3UE3 A;  5JYP A;  2XEP A;  3C5A A;  3NY4 A;  3MGS D;  3V9R A;  3UT9 B;  3BFG A;  3AV2 C;  1LHY A;  3N8S A;  3X1T C;  3WTP C;  1P3F C;  3IQA A;  5E43 A;  3WA9 D;  2ZMA A;  1M1A A;  1ZLA C;  3D4F A;  4WU8 A;  4H8R A;  1G6A A;  5FUG B;  3DW0 A;  4OON A;  1P34 A;  5B0Y A;  5AV5 D;  3AZK D;  4OJ5 A;  2EXB A;  3M6B A;  4JF4 A;  3MVD C;  5A92 A;  5B2J C;  5AV9 A;  2A49 A;  4PM6 A;  2WKH A;  5DTT A;  2J7V A;  4Z2M G;  4M3K A;  3TG9 A;  2F8N K;  3KWQ D;  4Z5T D;  5BT1 C;  1P3K B;  1GA9 A;  4EBP A;  4OJO A;  4LD9 A;  4ZJ3 A;  1JTG A;  4X23 A;  2NZD A;  3AFA C;  2ZQ8 A;  1LL9 A;  3X1V D;  4Z9Q A;  3AZL A;  3Q82 A;  5HL1 A;  4OOY A;  3O87 A;  3SH8 A;  1LI9 A;  1U35 A;  1ERM A;  5FI2 A;  4WJ3 C;  4XUZ A;  3S4X A;  2PYO A;  2R9X A;  3WA9 B;  4E6X A;  5AY8 A;  4ZUX C;  3AZF A;  4P85 A;  2Z2L B;  3OPL A;  3C7U A;  4S2O A;  1CEG A;  1H8Y A;  1MBL A;  4ID4 A;  4E3L A;  1FQG A;  2EX6 A;  1XPB A;  1Q2P A;  5B24 D;  5GT0 C;  3AZK B;  3QHY A;  2XQZ A;  3KUY A;  1TZY A;  5FAQ A;  5BO0 A;  2CV5 A;  4J8V A;  3AZH A;  3L2A A;  5CXW A;  3C4O A;  3ITB A;  4OPQ A;  2IWB A;  1ONG A;  5AVB D;  3KWQ B;  1M1A C;  4JXW A;  4Z5T B;  4GDB A;  4WU8 C;  4JBF A;  3OCN A;  1K54 C;  5GXQ A;  2WUQ A;  3S22 A;  2HIO A;  3M6H A;  5B0Y C;  3X1V B;  5FAS A;  5AQ9 A;  3IH9 A;  1P3I C;  3EPH A;  3AZI A;  4OLD A;  1P3M A;  3B6F B;  1MY8 A;  3X1S D;  4OLG A;  5EOO A;  3AYW A;  3WAA D;  5AV9 C;  2R9W A;  1F1E A;  5JA4 B;  3MXR A;  3PBR A;  2RIQ A;  3BEB A;  5CED A;  4KHA B;  1OME A;  5EE8 A;  1K55 A;  5GLD A;  1WWI A;  5GT3 D;  1PZP A;  5CHM A;  2HP6 A;  3FKW A;  4X23 C;  2NZD C;  1KDS A;  5B24 B;  3O3V A;  5B40 A;  3AZL C;  4KQR A;  2ZY4 A;  2Y2N A;  4S2M A;  2ZM5 A;  2YFW B;  1ES3 A;  1U35 C;  1IYO A;  2PYO C;  5AVB B;  4LEN A;  5AY8 C;  4OVD A;  5B0Z D;  4KUD C;  5C3I B;  3AZF C;  2ZM0 A;  2Y2M A;  2ZM8 A;  2HP5 A;  2PU2 A;  3ZHH A;  3AN2 A;  5HAR A;  5KZH A;  3N8L A;  2X01 A;  1IYP A;  1P3G D;  5B32 A;  3W4O A;  3G32 A;  4EBL A;  4WM9 A;  1T3U A;  3KUY C;  3V39 A;  3LZ0 A;  1TZY C;  3AZG A;  2Y2P A;  5B2I D;  3X1S B;  3KXB D;  4JF5 A;  3AZJ A;  4UAA A;  3WAA B;  4H9S A;  4IBX A;  2PU4 A;  4E3I A;  4HES A;  5G49 A;  5BOH A;  1YM1 A;  2ZC6 B;  5CGS A;  5GT3 B;  3N6I A;  3QNC A;  4H9R A;  3REL D;  4HBT A;  1NRF A;  2HIO C;  4JKT A;  4EWF A;  4F94 A;  3NQJ B;  3HON A;  3AZI C;  1P3M C;  3KS4 A;  3AYW C;  1JFI A;  4JLF A;  3BLM A;  1P34 D;  3VP2 A;  3F6T A;  3BFD A;  1ID3 A;  2J8P A;  3OPP A;  1H3O B;  1K55 C;  4Z66 A;  4KGC A;  5B0Z B;  4OPY A;  4RVA A;  1M18 D;  5FI6 A;  4LCL A;  4GN2 A;  4E45 A;  1C3B A;  3UT9 A;  5FQQ A;  4IBK A;  3LO7 A;  3MGP D;  1AXB A;  1IYQ A;  1HVB A;  4R23 A;  4WU9 C;  1P3G B;  1RGZ A;  4KZ7 A;  5B40 C;  3NBL A;  4FD8 A;  3G2Y A;  3VP0 A;  5B2I B;  3KXB B;  4IVK A;  1H5X A;  1ERO A;  3DWK A;  3C1C D;  1YU3 A;  3W98 A;  3V3S A;  1W8Y A;  2ZLY A;  1M19 D;  2VGJ A;  1K4F A;  5JRG D;  5EVI D;  3REL B;  1IKG A;  1IYS A;  1XX2 A;  2G5I C;  1TEM A;  3SS3 A;  3O86 A;  3LEZ A;  5B32 C;  2ZQA A;  3B3X A;  1P3K A;  2BYK B;  3V5M A;  3AZG C;  3FYZ A;  3AZJ C;  3UPN A;  3N8R A;  4YS3 C;  4BJP A;  3A6N A;  1P34 B;  4H9S C;  2JE5 A;  4R1G A;  4J8U C;  1PWC A;  3IXG A;  1ESI A;  1S32 D;  1BLP A;  1Q9C A;  3FZC A;  1ULY A;  1M18 B;  4E3O A;  1G68 A;  3MGS A;  4DE3 A;  4B88 A;  3MGP B;  5KMW A;  1P3L D;  1BLC A;  3WA9 A;  3IHB A;  2Y4A A;  5GLB A;  1HQ3 D;  4LD9 B;  1BLS A;  1PZR A;  3HUN A;  3W4P A;  4NZ3 A;  3W96 D;  4WEK A;  1BSG A;  5GXQ D;  4GKU A;  4N9L A;  3C1C B;  1ID3 C;  1M19 B;  5CEB A;  5AV5 A;  4Z66 C;  4KGC C;  3AZK A;  5JRG B;  4HEF A;  1MXO A;  1KX3 D;  1LI0 A;  4G91 B;  4WEL A;  3UN7 A;  5F99 D;  3UT9 C;  2XFS A;  3SS4 A;  3ZVW A;  4QB8 A;  2WAE A;  3KWQ A;  4Z5T A;  2P74 A;  5B1M D;  2G5H C;  3EG5 B;  3UPO A;  1KE4 A;  4O7D A;  3WRZ A;  5BPV A;  3VH5 W;  5E2E A;  3N7W A;  4QY5 A;  4WYY A;  4NYU A;  3X1V A;  5CHJ A;  1S32 B;  3NIA A;  2DQN C;  4UHU A;  2WYX A;  4QU3 A;  4J8V B;  3AZH B;  4IVI A;  1XGI A;  3P5J B;  5JA4 A;  3W97 D;  1FCN A;  1JVJ A;  5A90 A;  4EUZ A;  1P3L B;  4KHA A;  4MBK A;  4IED A;  5B31 D;  4DXB A;  3RXW A;  1HQ3 B;  1P3K C;  3GVB A;  5M18 A;  2P9V B;  1XA1 A;  4BEN A;  3W96 B;  5F82 A;  3IWO A;  1N1J A;  5GXQ B;  4R8P D;  3KFU G;  4S2L A;  3MXS A;  1SDE A;  4WBG A;  2ZC4 B;  1B67 A;  4FH4 A;  3UO9 A;  5FQJ A;  3FDD A;  1L0F A;  5B24 A;  2OLU A;  1PZO A;  4XXR A;  1P3P D;  1KX3 B;  5F99 B;  4WEJ A;  2YFW A;  1YLP A;  5AVB A;  3WA9 C;  5J8X A;  5B1M B;  2F8N H;  4NE3 A;  3HL9 A;  4KZ8 A;  2C5W B;  3VMA A;  4NZ1 A;  4GNU A;  2Y2O A;  4H9N B;  1YMS A;  3AZK C;  1J9M A;  3HLF A;  4IBJ A;  3UTA A;  3X1S A;  1YT4 A;  4GHA A;  3WAA A;  3W97 B;  3O88 A;  5AQ7 A;  3L26 A;  5CER A;  5FQM A;  5B31 B;  1R4V A;  4E3K A;  2V1Z A;  1ES2 A;  3LY3 A;  5GT3 A;  3KWQ C;  3MZF A;  3VH5 T;  4WNN B;  4Z5T C;  1FCO A;  3AZM A;  5I94 A;  4R8P B;  3NI9 A;  4NY2 A;  5CTM A;  2ZY3 A;  3X1V C;  3NQJ A;  4DDY A;  4ZJ1 A;  5FA7 A;  3HLE A;  3MZD A;  3B6F C;  4PMA A;  2Y2J A;  3AZE C;  4IBD A;  3MKF A;  3W98 D;  1DJA A;  5A93 A;  4Y0O A;  1H3O A;  1PYY A;  3RXX A;  5B0Z A;  1BZA A;  4B4Z A;  5EUA A;  1K57 A;  1P3A D;  1P3G A;  4KZA A;  5B24 C;  1YU0 A;  1ZG4 A;  1JTD A;  3NQU B;  1M6K A;  4MLL A;  5B2I A;  3KXB A;  4E44 A;  1JFI B;  4BL3 A;  4EV4 A;  4S2K A;  3L27 A;  5AVB C;  5C3I C;  1BH8 B;  3REL A;  5EEC A;  5FQK A;  4KG2 A;  4KZ3 A;  3UE0 A;  4DXC A;  4D2O A;  3UNW A;  3MBZ A;  2XDM A;  1LLB A;  3WS2 A;  4OQH A;  3SOI A;  2F8N D;  2BYK A;  4C75 A;  3X1S C;  3AZN D;  3MKE A;  3W98 B;  3REK D;  4HBU A;  1YLW A;  1M18 A;  4XZQ D;  3L28 A;  3LZ1 D;  5E5A C;  3MGP A;  5U47 A;  1L0D A;  1P3A B;  4BL2 A;  5FAP A;  4J8X D;  3LJA D;  5GLC A;  5CP6 D;  1L0G A;  2ZC5 B;  5F83 A;  2VQR A;  3A6N B;  3B0B A;  4GZB A;  1NZU A;  1YLJ A;  3C1C A;  2JSS A;  4ZDX A;  1M19 A;  3REJ D;  5B0Z C;  5JRG A;  5EVI A;  3MGS B;  3C4P A;  5DVA A;  1YU4 A;  1MWU A;  3IF6 A;  1K57 C;  2BYM A;  4JPM A;  3MGR C;  3G34 A;  2F8N B;  1XP4 A;  4QLC A;  4ZBJ B;  5CHU A;  3X1U D;  4S2J A;  5B2I C;  3B0D B;  3KXB C;  5B1L D;  3AZN B;  3OPH A;  3OC2 A;  4HGA B;  4H9P B;  2NQB A;  2V20 A;  4K0X A;  3WKJ D;  2ARO D;  4KZ4 A;  4GHL A;  4DDS A;  3REK B;  2CC1 A;  4X53 A;  1S32 A;  5AV5 B;  5TFQ A;  3CZD A;  1MKI A;  4UA9 A;  1YQS A;  4XZQ B;  3SH7 A;  3REL C;  3LZ1 B;  5AQA A;  3WRT A;  3TSG A;  1ZC2 A;  3VOY A;  1P3L A;  1YUE A;  1FSY A;  1KVM A;  4J8X B;  1XGJ A;  3LJA B;  5CP6 B;  5CPI D;  1HQ3 A;  4LG2 A;  1PW1 A;  2P9V A;  1SDN A;  3W96 A;  1ES5 A;  4N9K A;  5E2F A;  1P34 C;  2ZQ9 A;  4GDN A;  3REJ B;  2XR0 A;  1M18 C;  4WZS B;  3N4I A;  3UTA D;  2RVQ D;  1KX3 A;  4QHC A;  4DE2 A;  5F99 A;  3UTB D;  3MGP C;  2QZ6 A;  3E2K A;  5B1M A;  3I7J A;  3ZG5 A;  1ONH A;  3X1U B;  3FWL A;  1RGY A;  4YFM A;  2ZJ9 A;  4LD9 C;  3AZM D;  5B1L B;  1N1J B;  3WKJ B;  2ARO B;  3C1C C;  3IT9 A;  4YM6 D;  3LCE A;  4H9N A;  4X6T A;  1M19 C;  5BNX B;  3W8K A;  1GHI A;  3HSH A;  4KZ9 A;  1BH9 B;  1VM1 A;  1O7E A;  4G91 C;  3W97 A;  5B33 D;  5B2J D;  1EQZ D;  5M19 A;  5B31 A;  3KSY A;  4N1H A;  5CHL B;  4WNN A;  2IWC A;  2FJ7 D;  2W8S A;  2ZM2 A;  2EXA A;  1MWS A;  4R8P A;  3TU4 D;  1MWR A;  1S32 C;  4E3N A;  3UTA B;  1P3P A;  2CV5 C;  4J8V C;  3AZH C;  4JF6 A;  4IBR A;  3UTB B;  3IWQ A;  4OP8 A;  5AQB A;  1P3L C;  4IJE A;  1BUE A;  1W7F A;  5DTK A;  1HQ3 C;  5GL9 A;  3R45 B;  1F66 D;  3AZM B;  5HAP A;  4ZUX D;  3W96 C;  5GXQ C;  1BFM A;  3RJU A;  2J9P A;  4YM6 B;  3LY4 A;  1E3U D;  1M40 A;  3ZCZ A;  2DNS A;  4X68 A;  3NQU A;  3ISG A;  1KX3 C;  5B33 B;  5F99 C;  4X69 A;  2WGV A;  1EQZ B;  4JJN D;  2WKE A;  4P0M A;  4LCM A;  3AL0 C;  5GHZ A;  4UUZ A;  4G92 B;  2FJ7 B;  3IF5 A;  5HAQ A;  4GD6 A;  1BH8 A;  4DRA A;  2ZY5 A;  3GTC A;  3TU4 B;  2ZY2 A;  5M1A A;  3DWZ A;  2IWD A;  5AV6 D;  4U0T A;  4LV2 A;  5EPH A;  1W2E A;  4GB7 A;  2GDN A;  1P3I D;  4OPZ A;  4ZAM A;  3VP1 A;  3W97 C;  1IEM A;  4BD1 A;  3BFE A;  5B31 C;  2RCX A;  3WX7 A;  1CI8 A;  2Y59 A;  1TDG A;  4GOG A;  1F66 B;  2Y2G A;  1L2S A;  3EPL A;  4MNR A;  1BT5 A;  3AN2 C;  1K6S A;  1P3A A;  3G31 A;  3NDG A;  1EI5 A;  5A91 A;  3O62 D;  1ZG6 A;  2CWE A;  3HBR A;  4QLC D;  1I2S A;  3LZ0 C;  4OP5 A;  2L5A A;  4AWL B;  1I2W A;  2XLN A;  3BLS A;  4EO5 B;  2NQB D;  4JJN B;  2FFF B;  3VFF A;  1P3B D;  2Y2Q A;  1E4D A;  3VH5 A;  3AGF A;  4GH9 A;  5L2F A;  1NY0 A;  5AV6 B;  3UDX A;  3W99 D;  4S2I A;  2F8N A;  3OPR A;  2OSU A;  3N3F A;  3AZN A;  4H9P A;  4N92 A;  3REK A;  1PIO A;  3PBO A;  2WZZ A;  4XUX A;  5EVI B;  4XZQ A;  3V50 A;  3LZ1 A;  5GSU D;  3IF6 B;  1KU5 A;  1JWZ A;  1NZO A;  3PAG A;  2BYM B;  5AVC A;  1EWZ A;  1NYM A;  4PM9 A;  4J8X A;  3O62 B;  3LJA A;  1QMF A;  5CP6 A;  4QLC B;  3OZH A;  2NQB B;  4KEN B;  5FI7 A;  1SHV A;  1W8Q A;  3W98 C;  2ZC3 B;  1P3B B;  5B32 G;  2BLS A;  3REJ A;  2ZQ7 A;  5F1F A;  1KGF A;  4BD0 A;  5CPK D;  4P87 A;  1FCM A;  3W99 B;  1P3A C;  1PWG A;  5AV8 D;  4WU9 D;  5HW3 A;  4IBB A;  5JYO A;  3X1U A;  3QNB A;  5B1L A;  1WWS A;  4UPK A;  3WKJ A;  3A6N C;  2ARO A;  4QD4 A;  1ERQ A;  2DCF A;  1CI9 A;  5BNX A;  2WZX A;  4K91 A;  3B6G D;  4IBI A;  4N1X A;  4JXV A;  1BH9 A;  3MGS C;  1FSW A;  3ZVT A;  5GSU B;  2ZD8 A;  2EFU A;  4R4R A;  4OQI A;  1TAF B;  4U3T A;  5CPI A;  3L29 A;  3WS4 A;  1MPL A;  4ZBJ C;  3H0R C;  3B0D C;  4P6B A;  3REH D;  3AZN C;  5TR7 A;  4HGA C;  3ZNY A;  3A3D A;  2G2U A;  4YS3 D;  3REK C;  1YU2 A;  4J8U D;  5AV5 C;  3HVF A;  4OQ0 A;  4CPK A;  2J8Y A;  4LV3 A;  4XZQ C;  3AV1 D;  3LZ1 C;  5CPK B;  2EX9 A;  3UTB A;  2HUE B;  5AV8 B;  4J8X C;  3X1T A;  4WU9 B;  3LJA C;  3BM6 A;  1VQQ A;  1WE4 A;  4UA7 A;  3R45 A;  1AOI D;  4OQG A;  2IO5 B;  5FSR A;  3IH8 A;  5FDH A;  1KE3 A;  1P3O D;  1K56 D;  5TGF A;  2V2F F;  4YM6 A;  4IBF A;  3MGQ D;  3CJM A;  3REJ C;  2J9O A;  3B6G B;  2JBF A;  1P3P B;  3VH6 W;  1PW8 A;  1CEF A;  4IBG A;  5B33 A;  5B2J A;  1EQZ A;  3VP4 A;  3WWX A;  1DY6 A;  1ESU A;  4YIN A;  2FJ7 A;  3EQU A;  3X1U C;  4OKP A;  5B1L C;  3REH B;  1YLT A;  4FCF A;  3TU4 A;  1KX5 D;  3WKJ C;  4X55 A;  2ARO C;  3MNN D;  3WS5 A;  3NCK A;  5FQ9 A;  4J8U B;  3AFA A;  2VGK A;  3GV9 A;  1YLZ A;  1WYC A;  3AV1 B;  1NYY A;  3BEC A;  4CSR B;  1FR6 A;  2Y2I A;  4CJN A;  5E2G A;  4OUI A;  4UUZ B;  3PBS A;  1AOI B;  1F66 A;  5CPJ D;  4ZUX A;  1KX4 D;  1P3O B;  4Y0T A;  3C1B D;  1E3U A;  3BFC A;  3MGQ B;  1NJ4 A;  3PBT A;  1FR1 A;  2OV5 A;  4NZ5 A;  3ZG8 B;  3UTA C;  1PWD A;  5DF9 A;  3WAA C;  2ZQC A;  3UTB C;  4JJN A;  5DNM D;  2C6W B;  3C7V A;  5GT3 C;  4WMC D;  4KZ5 A;  3REI D;  4EBN A;  1Y54 A;  3AZM C;  4XUJ D;  3G2Z A;  4J8W D;  2Q9M A;  1KX5 B;  2WKI A;  3MNN B;  1GA0 A;  1K54 A;  3VH6 T;  5AV6 A;  5AVC D;  4YM6 C;  2G2W A;  3ZG7 B;  4GD8 A;  1P3I A;  5CTN A;  2H0T A;  3A3I A;  5B33 C;  2OLV A;  4DF6 A;  3SS5 A;  1EQZ C;  4DE0 A;  3A3J A;  2HDR A;  5FAT A;  4OPR A;  4G92 C;  2FJ7 C;  5CPJ B;  4RA7 A;  1KX4 B;  3M2K A;  4KG6 A;  3TU4 C;  2DRW A;  3C1B B;  3GRJ A;  1P3G C;  3FV7 A;  3O62 A;  3VOZ A;  3UE1 A;  1XXM A;  3B6F D;  4NZ4 A;  1RCJ A;  3PBN A;  2QPN A;  3ZG0 A;  5DNM B;  1P3B A;  3AZE D;  2Q9N A;  1GCE A;  4CAY B;  1PI4 A;  3LEL D;  4PPR A;  3REI B;  1MWT A;  1F66 C;  2X71 A;  4XUJ B;  4KUD A;  4L0L A;  4J8W B;  4BQM A;  3UPP A;  1IKI A;  1PI5 A;  2EX2 A;  2HDU A;  5AVC B;  3W99 A;  3G4P A;  3EPJ A;  4AWL C;  3WS1 A;  3AGE A;  1BUL A;  4EO5 C;  1Z6F A;  2WAD A;  1KGG A;  4JJN C;  4DQY B;  1GHP A;  4NET A;  4H9Q A;  4OH0 A;  5EOE A;  4WV4 B;  4JXG A;  1Z2C B;  5DNN D;  3PAE A;  5HAI A;  1YLY A;  5GSU A;  1BLH A;  1TDL A;  3GMW A;  2HDS A;  1HTZ A;  3AV2 D;  5AV6 C;  2WAF A;  1TAF A;  2XGN A;  4DRT A;  3X1T D;  3WTP D;  1P3F D;  2XD1 A;  2BG1 A;  3IP4 C;  4C6Y A;  1ZLA D;  1HTA A;  4R3J A;  4Y7P A;  1ES4 A;  3HUM A;  4KZ6 A;  2JCH A;  3AZE B;  4OJP A;  3LEL B;  1JWV A;  2WGW B;  5JRG C;  4K0W A;  5EVI C;  3NC8 A;  3HUO A;  3MVD D;  5CPK A;  2H5S A;  3IF6 C;  2ZC7 A;  5E5A D;  5AV8 A;  4E3M A;  5CPI B;  3O62 C;  4WU9 A;  2HDQ A;  4OOL A;  4BLM A;  4RYE A;  4NE6 A;  4QLC C;  3Q7V B;  4DKI A;  2LY8 A;  5BT1 D;  3KS8 A;  1DJB A;  2NQB C;  3HLD A;  3UY6 A;  4M6B A;  1P3B C;  3AFA D;  4QNL A;  3B6G A;  5DNN B;  3VSL A;  3ZGA B;  1W79 A;  1ZKJ A;  3AV2 B;  3A3E A;  4RX3 A;  4A5R A;  4FH2 A;  3UDI A;  3W99 C;  3X1T B;  3WTP B;  1P3F B;  1N4O A;  3ZG9 B;  1NXY A;  3W4Q A;  3MGR D;  1ZLA B;  4KQO A;  3ZDJ A;  3REH A;  1HZO A;  5HFO A;  3SH9 A;  2PBY A;  4UA6 A;  5DF7 A;  4YS3 A;  4J8U A;  3GSG A;  5GT0 D;  3MVD B;  3AV1 A;  3MZE A;  5GSU C;  5B2J B;  1KE0 A;  4CSR A;  5FAO A;  5E5A B;  2XF3 A;  4QY6 A;  1YMX A;  3Q1F A;  5B1M C;  4KG5 A;  1AOI A;  1E25 A;  1M1A D;  5IHV A;  4H9O B;  4PM5 A;  1XKZ A;  4E6W A;  4WU8 D;  1P3O A;  1K56 A;  3A3F A;  3MFD A;  2IOU A;  3MGQ A;  4R3B A;  2Y2K A;  3AFA B;  5KDM A;  5B0Y D;  5GLA A;  2H10 A;  3P09 A;  1U60 A;  4OJ6 A;  2YFV B;  5CPK C;  2XFT A;  2HP9 A;  3BRM A;  3M2J A;  2HUE C;  5AV9 D;  3PTE A;  4E3J A;  5AV8 C;  4IBE A;  1FOF A;  3MGR B;  1ALQ A;  2XH9 A;  3B0C W;  4ZUX B;  1A7W A;  2IO5 C;  4NFT A;  1K38 A;  1GHM A;  5BNV B;  4R8P C;  1KX5 A;  4LD9 D;  5G18 A;  3MNN A;  2XD5 A;  5FUG A;  3WS0 A;  4C3Q A;  1XA7 A;  4X23 D;  2NZD D;  3HLB A;  3B6G C;  5GT0 B;  3NDE A;  2Y2H A;  1P3P C;  4Q8I A;  3AZL D;  5GHX A;  4ZJ2 A;  3V9R B;  1LL5 A;  1U35 D;  5E2H A;  1CK3 A;  2RL3 A;  4JXS A;  2PYO D;  3HLC A;  1M1A B;  5CPJ A;  5AY8 D;  4WU8 B;  4KUD D;  3AZF D;  3REH C;  1KX4 A;  4DE1 A;  3E2L A;  3C1B A;  4OJL A;  5B0Y B;  4WZ5 A;  2JC7 A;  4S2N A;  1P3I B;  4B4X A;  5KSC A;  3HRE A;  1KVL A;  1KGE A;  3KUY D;  3AV1 C;  2Y91 A;  1TZY D;  4KQQ A;  2CV5 D;  4J8V D;  3AZH D;  4MBF A;  5AV9 B;  1K25 A;  3BYD A;  4NYY A;  3UDF A;  5DNM A;  4CAY A;  4FSF A;  2EX8 A;  4WMC A;  1AOI C;  3REI A;  3AGD A;  5CGW A;  4XUJ A;  4LV1 A;  4J8W A;  1P3O C;  5EVL A;  3G30 A;  4KZB A;  3A1I A;  2F2A C;  5B31 G;  3HLG A;  3VFH A;  2HPB A;  1I5Q A;  4NE5 A;  2HIO D;  3WTP E;  4X23 B;  3MGQ C;  2NZD B;  1W5D A;  4U0X A;  3FKV A;  2Z2M B;  3AZL B;  3GR2 A;  3AZI D;  1P3M D;  3Q7Z A;  5CGX A;  5D3O A;  3AYW D;  3B0C T;  1U35 B;  3ITA A;  1Q2Q A;  5BS7 A;  2PYO B;  5CRF A;  3CG5 A;  3TOI A;  5AY8 B;  4KUD B;  3AZF B;  3Q81 A;  1H8Z A;  1KX5 C;  3MNN C;  1RP5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...