2BG1A

Active site restructuring regulates ligand recognition in classa penicillin-binding proteins (pbps)
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
484
structure length
455
Chain Sequence
ITYDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTNQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Active Site Restructuring Regulates Ligand Recognition in Class a Penicillin-Binding Proteins
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Peptidoglycan
molecule keywords PENICILLIN-BINDING PROTEIN 1B
total genus 147
structure length 455
sequence length 484
ec nomenclature ec 2.4.1.129: Peptidoglycan glycosyltransferase.
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2bg1A01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2bg1A03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2bg1A02
5EVIC 2WUQA 1MWRA 4WMCD 3IXDA 4DE0A 3PBOA 1MWSA 1H8ZA 1KDWA 2X01A 1PIOA 4OP8A 3D4FA 5FA7A 3IHAA 4MBKA 1GCEA 3M2KA 3TSGA 1RP5A 2PU2A 4OPRA 5DVAA 3HUMA 1N9BA 2Q9MA 4QB8A 4ZBEA 3A3EA 4ZJ1A 2RL3A 4WEJA 3RJUA 4IBRA 2Z2MB 3IWOA 3BYDA 1PWDA 2XR0A 5E43A 4E3OA 1TVFA 5GLCA 3S4XA 2ZC4B 4DDSA 4S2KA 2DCFA 5M18A 2BLSA 3E2LA 2VGJA 1ONHA 4GB7A 4XUXA 5FQJA 3UE1A 3BEBA 1W7FA 2V20A 4X6TA 3S22A 4DXCA 5AQ9A 1RGYA 3DW0A 3A3DA 5DF8A 1NZUA 3I7JA 3ZGAB 5FATA 4QY6A 4ZTKA 1G6AA 2Y2IA 5GHXA 5GL9A 4FH2A 3HLCA 3ZG7B 3UY6A 4DF6A 3G35A 3G2YA 1IYQA 2WGVA 1SKFA 3NI9A 1ES3A 4NK3A 4EQIA 4GDNA 3LO7A 5HX9A 1DJCA 5F83A 5CXWA 5E2GA 3SS5A 1FR1A 2EFXA 3WWXA 5JYOA 3NDGA 4N1HA 3V5MA 1EROA 1QMEA 4R3BA 4CPKA 4LV1A 1RCJA 4Y0UA 1IELA 3GRJA 3ZHHA 4E3JA 3CJMA 3A3IA 1Q2PA 2QMIA 4ZJ3A 4S2PA 1ZKJA 2PU4A 4BENA 4FD8A 1SCWA 1FSYA 4EBNA 2HDRA 5FAQA 1W5DA 3ITAA 4OPZA 4S2NC 4YINA 1CEFA 2Y2MA 1GA9A 3BECA 3HLFA 1BLSA 1FQGA 3NC8A 4KZBA 3GVBA 1L0EA 1I2WA 1K38A 3MZEA 1C3BA 4QJGA 3Q82A 1YMXA 2GDNA 4JXWA 1LL5A 3DWKA 4MLLA 4OVDA 4X55A 5TGFA 3ZG8B 4HBUA 4RYEA 1K54A 3C7VA 3WS4A 4R3JA 2OLUA 1HZOA 3IHBA 3VFHA 5KZHA 4BJPA 1L2SA 4WEKA 5TR7A 2JC7A 1HTZA 2EX2A 3MFDA 5EVIB 5F82A 1BZAA 1SDEA 2Y2LA 3Q7ZA 3VP0A 3Q7VB 4QHCA 4E3LA 1K25A 2HP5A 2H0YA 4XUZA 1I5QA 4K91A 1WYCA 3SS4A 2WZXA 4OKPA 4LCLA 2ZMAA 4M3KA 2EXBA 5CHUA 1DY6A 5HFOA 4P85A 4JF5A 2ZC5B 3OPHA 3CMZA 5KSCA 3Q07A 4PM9A 2EFUA 4KQRA 3UN7A 2XK1A 3OZHA 3LY3A 2G2UA 4E3NA 4RX2A 1LL9A 1YQSA 5EECA 3HUOA 5TFQA 5CTMA 3WS2A 1WYBA 3JYIA 1SHVA 1MXOA 1BSGA 3NDEA 5DF7A 3O3VA 1K57C 2EXAA 4KZ9A 1IKIA 2ZC7A 1PZPA 2ZQDA 5KSHA 1K56A 1E4DA 5A93A 1S6RA 1PWGA 3ZNYA 1NYMA 1RGZA 4JPMA 3QHYA 4K0XA 5IHVA 3ZG5A 2V1ZA 1ESUA 1GHMA 4EV4A 1ALQA 4KQQA 1LI9A 4GKUA 4P87A 5CHJA 3FV7A 3ZDJA 2X71A 3UDIA 3MXSA 3QNBA 3C4PA 4JF4A 4EBLA 3ZVWA 2WKEA 4QU3A 4WZ5A 4R4RA 1LHYA 4OQIA 4X68A 1FOFA 1IYSA 4LCMA 2C5WB 2DRWA 3NCKA 4E3MA 2XF3A 3M6BA 2XGNA 1KE3A 2H10A 4PM6A 3MKEA 1MY8A 2C6WB 4LV3A 3VP3A 3DWZA 2Y91A 4OQ0A 5AQ7A 3ZVTA 4A5RA 4U3TA 4Y0TA 2Y2GA 4R4SA 1WE4A 5FI6A 2OSUA 1CEGA 3N6IA 1CI8A 1K6SA 3RXWA 3VP1A 3VP2A 4KG6A 5CECA 1XKZA 3N8RA 4Y7PA 4L0LA 1M6KA 1Y54A 2B5RA 5CGSA 2ZQAA 3V3SA 1NXYA 2R9WA 4RX3A 4WBGA 4BL3A 4E6XA 2P9VB 1S0WA 3LEZA 2IWBA 4S2OA 4JBFA 2XEPA 4KZ3A 3IXGA 1ES4A 5CEDA 3C7UA 2JBFA 4WM9A 2JE5A 4CJNA 2XFSA 1W8YA 4LENA 1XA7A 5AQBA 2WGWA 4X53A 1DJBA 4GZBA 5CERA 4KZ8A 4FSFA 4BL2A 1Z6FA 3VSKA 1NYYA 3G2ZA 3EQVA 3P09A 3W4OA 3SH8A 3UO9A 2Y55A 4E6WA 4JLFA 2XD5A 2RCXA 3IH9A 4JXGA 3OPRA 4UA9A 4P6BA 2UWXA 1OMEA 1EWZA 4DDYA 1K55C 2ZM0A 2EX8A 4Y0OA 3VOZA 4DE1A 4QD4A 4OOLA 3GR2A 2A3UA 1K57A 3S1YA 1J9MA 3WRTA 1KDSA 4UA7A 1GHPA 1VQQA 1BT5A 1TEMA 5FQQA 3VFFA 3IF6A 3PBQA 1PW8A 2HP9A 3OPPA 1YLWA 5HARA 1VM1A 4U0XA 3LY4A 4KZ4A 4RA7A 5M19A 1PWCA 1BULA 4DE3A 2Y2NA 1FCNA 5EE8A 1JTDA 2JCHA 3Q7VA 4JKTA 2ZC3B 4DE2A 3AGEA 1EI5A 3IWIA 3UE0A 1BLHA 1M40A 1JWVA 3ZCZA 4C6YA 3G34A 1PYYA 3OCLA 3N7WA 3PAGA 1NJ4A 3FKVA 4R1GA 2IWDA 5G18A 1XGIA 4WMCA 3DTMA 5HAQA 3NBLA 3P98A 1DJAA 4GD8A 2WZZA 4JXSA 3M2JA 3AGFA 2EX6A 4JXVA 1IYOA 3A3FA 5DF9A 4Z9QA 5FQMA 1FR6A 3TOIA 1SDNA 1H5XA 1KGFA 1L0DA 1PZOA 4KQOA 1BLCA 1GA0A 1YLJA 5GHZA 5FQ9A 2XD1A 5HAIA 3WRZA 4UAAA 1FSWA 4DRTA 4IVKA 1XP4A 1Q2QA 1CI9A 2VGKA 1L0FA 3HVFA 3MKFA 3GQZA 4GOGA 2ZQ9A 3HBRA 2XH9A 1PW1A 2H5SA 3UPOA 1BUEA 4KG5A 4H8RA 3Q1FA 5EOEA 1O7EA 4KZ7A 5GLAA 4S2MA 2FFFB 3IWQA 1PI4A 1NRFA 3BRMA 2Y2OA 3BFFA 2CC1A 1GHIA 2IWCA 1CK3A 4KENB 4EBPA 3FWLA 3OC2A 4NETA 1K4EA 1PI5A 4EWFA 3NY4A 4EUZA 5CRFA 1W79A 2Z2LB 5EVID 5FAOA 1MKIA 5FQKA 3ZNTA 3MZFA 1XGJA 4HESA 4PM8A 2WAFA 1XX2A 4KZAA 3A3JA 1BTLA 3FKWA 5GLBA 3IH8A 4GNUA 4MBFA 3SH7A 2ZM8A 1ES5A 1FCMA 2P74A 4BD1A 1MPLA 5CTNA 5L2FA 3G31A 2J7VA 4WZ4A 3ZFZA 3BFEA 3HLGA 3G32A 4OPQA 3IXHA 3MBZA 5FAPA 2FFYA 5FI2A 5JYPA 3SOIA 1G68A 2HP6A 3PBRA 2P9VA 3G30A 3UE3A 2XQZA 5AQAA 4B88A 3NIAA 2OV5A 3PTEA 2Y4AA 4WYYA 3C4OA 5GLDA 4MBHA 3V3RA 4UHUA 3GMWA 4ID4A 5A90A 2WADA 2ZQ8A 3W4PA 1MWUA 2DNSA 2WGWB 2QPNA 3HUNA 3W4QA 3BFCA 3BFGA 1KVLA 4KZ6A 3ITBA 4PPRA 3TG9A 1K55A 5CHMA 2OLVA 5CGXA 5HL1A 4OPYA 4DKIA 1E25A 2ZM2A 3HL9A 5M1AA 1E3UA 2A49A 2EX9A 3M6HA 1ONGA 3GTCA 3O87A 1JWZA 1ZC2A 2ZJ9A 5CEBA 2Y2KA 1YM1A 1QMFA 1TDLA 3MZDA 1YMSA 3VSLA 2WKHA 3IF6B 3V50A 1LI0A 2Y2PA 3N8LA 1JVJA 3LCEA 4BQMA 3ISGA 4KZ5A 2HDSA 4HEFA 3WS0A 1H8YA 1YLZA 4MEZA 3SS3A 4IVIA 1XA1A 1YLYA 4RVAA 2HDQA 1JWPA 1IYPA 3N8SA 4LV0A 4FH4A 3CG5A 4GDBA 1ES2A 3IXBA 5A92A 1IEMA 4S2JA 3V39A 4BD0A 3UNWA 4N9LA 4WZ5C 5D3OA 4ZDXA 3FYZA 4OQGA 3HREA 4C75A 4ZAMA 5F1GA 3WS5A 3E2KA 2XLNA 4S2NA 4OOYA 1KE0A 3VMAA 3IT9A 4WELA 4B4ZA 2I72A 1XXMA 3OPLA 4OH0A 4ZJ2A 4MNRA 4IEDA 4LV2A 2G2WA 3Q81A 4O7DA 5KMWA 3HLWA 4PM7A 5FDHA 3UDXA 1YLPA 4HBTA 4R23A 4S2IA 1ESIA 4FCFA 5GHYA 2Y2JA 3UDFA 1KGGA 5F1FA 1AXBA 3GV9A 1I2SA 4GN2A 2ZD8A 3C5AA 4X69A 1YLTA 4DXBA 2ZLYA 5DTTA 2J8YA 3PBSA 4YFMA 2Y2HA 1HVBA 1U60A 2V2FF 4OONA 3EQUA 4UA6A 3W8KA 4N1XA 2Y2QA 3AGDA 2XDMA 3VP4A 1E3UD 4XXRA 3UPNA 4F94A 1KGEA 2R9XA 4Q8IA 3PBNA 5EUAA 1KVMA 2WAEA 5FSRA 5A91A 1K6RA 3SH9A 3OCNA 4E3KA 3GSGA 2XFTA 3WS1A 2WYXA 1N4OA 5FASA 1W8QA 2X02A 5E2HA 5FI7A 1MWTA 5EVLA 3CZDA 4OP5A 1LLBA 1JTGA 2QZ6A 5DTKA 2J9OA 3BFDA 2BG1A 5DTSA 1ZG4A 2Q9NA 1IKGA 1ZG6A 4C3QA 1NY0A 4PMAA 5E2EA 1L0GA 2HDUA 4X56A 3PBTA 4D2OA 1K54C 3IF6C 3HLBA 1K56D 5I94A 1O07A 1HD8A 2ZC6B 1BLPA 2ZQCA 3O88A 3PAEA 4JF6A 3BM6A 4OLDA 4R0QA 5EVIA 4E3IA 5U47A 4GD6A 4IBXA 5FQIA 4BLMA 3O86A 2ZQ7A 4K0WA 4OLGA 2WKIA 1K4FA 1YT4A 2PBYA 1ERMA 3BLSA 1NZOA 3ZG0A 4OQHA 4QY5A 3IQAA 3QNCA 5E2FA 3UPPA 2WGIA 5HW3A 3FZCA 3N4IA 3RXXA 3MXRA 2Y59A 3HLEA 4U0TA 4PM5A 2H0TA 1FCOA 5EPHA 1TDGA 5J8XA 1ERQA 2J9PA 4B4XA 3B3XA 3HLDA 4OOMA 2HPBA 3ZG9B 5EOOA 4KG2A 4S2LA 3G4PA 2WK0A 3IF5A 1KE4A 4N9KA 4P0MA 3VOYA 4N92A 2E8IA 5CGWA 3BLMA 1MBLA 1XPBA 5HAPA 5BOHA
chains in the Genus database with same CATH superfamily
3D72A 2WUQA 3HSHA 1Y4OA 3CPTA 3PBOA 5AVBC 1MWSA 3LR4A 3MF0A 1TF1A 3IHAA 3TSGA 2F2AC 4OPRA 4ZBEA 1N9BA 3A3EA 2NQBB 3REID 4WEJA 4JGOA 1Q9CA 1YPRA 1Y28A 3W97D 2Z2MB 5E43A 3AN2D 1TVFA 5HWVA 5GLCA 3S4XA 1F66C 2BLSA 1ONHA 3UB8A 3BEBA 1W7FA 2V20A 4X6TA 1F1EA 2NZDC 3HCYA 2QWSA 3R4KA 1UWNX 5CHLB 4IUHA 4ZTKA 1G6AA 2Y2IA 4JJNA 1GSXA 5GHXA 5GL9A 3IBRA 3HLCA 3G35A 1P3LC 3KO6A 4WU9A 5HD5A 3AZIB 1ES3A 3LO7A 1S32B 3UT9D 3IX3A 4N1HA 1CF0A 3WKJC 3AV2D 4MDZA 1QMEA 2J3TC 2FJ7C 1RCJA 3EPLA 2ZMFA 5EM0A 1P3KA 5GXQB 4FD8A 2Y8HA 2ZY2A 1V9ZA 2R78A 4X23A 5BT1D 3NOUC 4YS3B 1LL8A 1W5DA 4YINA 3A6NA 4I3JA 3QP1A 3NC8A 3GVBA 1P3PB 4NE6A 2XRNA 1C3BA 4QJGA 3Q82A 3MMHA 5HWTA 5TGFA 4ESPA 3MR0A 1K54A 3X1UC 4I3IA 3ULFA 4R3JA 4OJ5A 3S7NA 4WEKA 5TR7A 1DP9A 2EX2A 3VH6A 1F66A 3Q7VB 4NG2A 1H3OA 1D06A 2PYOD 1ZLAC 3L7HA 3SS4A 4Q0JA 5B1MC 4AWLB 5B0YB 5C3IC 4LCLA 4EUVA 3TU4C 3TJZC 4WN5A 1M19C 2ZC5B 1KS0A 3WA9C 2ZM5A 2EFUA 3F1NA 3UN7A 3X1VB 5DFYA 2G2UA 2VX8A 5B32A 2EA9A 4QLCB 4LRXC 1S4RA 1VB6A 3WS2A 5DNND 5B2JB 3NDEA 3O3VA 4Y3IA 3LR0A 5KSHA 4HH2A 3X1TD 1K56A 5DNMA 1ESUA 1GHMA 4EV4A 2JKTM 4HHDA 3W98B 5CHJA 5B33A 5E5AC 3REIC 3VV4A 4R4RA 2W3DA 1TS7A 4X68A 1P0ZA 2C5WB 3NCKA 5HSQA 4EXOA 1KE3A 3QP2A 2K7SA 2C6WB 2YKHA 4MN7A 3MGRC 3VP3A 2Y91A 3ZVTA 3IS2A 4U3TA 1WE4A 4M6BA 5FI6A 4MN6A 2W1RA 1CI8A 2JKGA 4HJ3A 1AOIB 5B31D 4KG6A 5CECA 1M6KA 4Z5TD 2B5RA 5FUGB 4RX3A 3U4LP 2XROA 5B31A 5HDCA 2IWBA 4OUIA 5GSUD 4S2OA 4JBFA 2XEPA 4KZ3A 1KX4A 3C7UA 3F1PA 3UTBB 3BWLA 1HLUP 3WKJB 3O62D 5CERA 4KZ8A 3TU4A 3UT9B 1P3FA 4HJ4A 1S32C 3VSKA 3G2ZA 3FC7A 5AV9C 5CPJB 3AV2B 3W4OA 5CPIC 1P34B 2CV5C 3W96C 4E6WA 2Y55A 5KIZA 1H3QA 4DDYA 2G5IC 2UWXA 3WAAA 1EWZA 1M1AD 2HIOA 3B0DC 2EX8A 3H7WA 5BT1C 4CLCB 4WZSB 3S1YA 1J9MA 3P01A 4YOFA 1M1AC 3X1TA 3VFFA 1GHPA 3WRTA 5HPFA 1TEMA 3P7NA 2Y79A 1PW8A 3OPPA 2QJ5A 2B95A 1KX3B 5HARA 2JKRM 1H0IA 3AL0C 2W27A 4DE3A 1F66B 1FCNA 2W0NA 3RELB 1TZYC 3EWKA 2AVXA 4CAYA 2CMNA 3Q7VA 1LT0A 1W63M 2ZC3B 3H82B 4MB4A 4LD9C 1N9LA 3H0MC 4GHIB 5B0YA 1PYYA 2JKTI 3LYXA 1XGIA 4WMCA 3VH6W 3P98A 3M2JA 2EX6A 3LJAC 1IYOA 4Z9QA 5FQMA 3L28A 4IBCA 1SDNA 1W1YA 3X1VD 2XD1A 5FQ9A 4DRTA 3W99C 4UAAA 3AZLA 4E04A 1L0FA 5DKKA 4Z2MH 3MKFA 2EWWA 5AV5C 2OWJA 1GXDA 3HBRA 2XH9A 4O8GA 5B2JD 4XT2A 3REKD 4H8RA 1U35C 4BWIA 5EOEA 5GLAA 4KZ7A 3BRMA 1NRFA 1H8PA 4KGCB 2IWCA 1IFQA 4EBPA 4NETA 3OC2A 2BASA 1U35D 5BO0B 4EWFA 5CRFA 2Z2LB 4MN5A 1OTBA 4ZBJC 5AVCD 3MZFA 1XGJA 2W3FA 3R7WB 3WAAD 1P3MB 3UB7A 3IH8A 2ZM8A 2P74A 4BD1A 3MXQA 4OJ6A 1X0OA 3G31A 2F8NA 2J7VA 3MGRD 3ZFZA 3BFEA 3CLOA 4H9SC 2PD8A 1AOIA 3G32A 1T1AA 3MBZA 4R38A 3LIBA 3MGPB 4HIAA 5FI2A 3KXBA 3REHB 5JYPA 2VEAA 2M7UA 5B31B 3G30A 3UE3A 4EO5C 4H9NA 2XQZA 4HQAA 3KSGA 3C4OA 4UHUA 3LEQA 1L3LA 2WADA 3F1PB 2ZQ8A 4IBJA 3VH6T 3HUNA 4HY8A 2YFWB 1KX5D 3AZGC 3UT9A 3BFGA 3R45B 5B0ZB 1P34A 3W97A 1P3LB 3ITBA 1LSXA 3B0BA 4WL9A 2KX6A 3TG9A 1XJ4A 5CGXA 3UT9C 1E25A 2HIOB 1P34D 2EX9A 4CLCA 5CPKB 2BYMA 1ONGA 4ZBJB 3O87A 4Z2LA 3W99B 1YM1A 1QMFA 1SZVA 3IF6B 3V50A 4HI4A 1KU5A 2Y2PA 1E6RA 1JVJA 4NZ1A 1YLYA 2F8NH 3N8SA 4CAYB 1M1AA 4H9PB 4Z2MG 1P3AB 3LR3A 3UNWA 4N9LA 4WZ5C 1J3WA 4OQGA 1ULYA 4GHIA 5IT5A 4J8XD 3VMAA 1XXMA 4OH0A 4IEDA 2G2WA 1N1JA 4HBTA 1V9YA 3SW1A 3L25A 1ESIA 5GHYA 2VV6A 3RH8B 3DAVA 1AXBA 1I2SA 1OGBA 2D49A 1QO6A 5B0YD 2M7VA 5BNVA 4YFMA 2V2FF 3EQUA 3MNNA 3AGDA 1YU2A 1KVMA 2WAEA 5A91A 2VQRA 5AY8D 5IU1A 3LJAA 1E15A 2XFTA 1BYWA 3SZTA 3WS1A 3UTBC 4X23C 2WYXA 3KS8A 1W8QA 5FASA 3QP8A 1EQZA 5B2IC 3MGSB 5DTSA 4KHAA 2F8NB 3MS6A 1NY0A 2NUTC 3PYPA 3T4KA 4PMAA 5E2EA 1L0GA 5CP6C 2HDUA 3A6NC 1OJ5A 4D2OA 3KSHA 3HLBA 5I94A 3MGPA 1MZUA 1HD8A 2ZC6B 4JF6A 3B6FA 2ZQCA 5EVIA 3REHC 5FQIA 4K0WA 2WKIA 1IOUA 1YT4A 3T4QA 3LI8A 5E2FA 4BBUA 3UPPA 2J3WA 2WGIA 4ETZA 3MXRA 2LY8A 5TBMA 2Y59A 3HLEA 3WD1A 4Z66B 5EPHA 5J8XA 4HMCA 3KUYC 4S2LA 3AZND 3AFAA 1P3LA 4N9KA 4P0MA 4II7A 1HTAA 1NLZA 2L0WA 4J8UD 4IBEA 5B0ZD 1XPBA 1P3KD 1P3LD 3BQAA 4DE0A 1H8ZA 1KDWA 2VLGA 1P3FC 4HH3A 3D4FA 5JRGD 1GCEA 1RP5A 2PU2A 5DVAA 3WTPA 3HUMA 2VGLM 4IBKA 3RJUA 4R3AA 3PXPA 2PRFA 4E3OA 1M1AB 4ETXA 4JGPA 2ZC4B 2O9AA 2DCFA 4H9PA 1P3AA 2NQBA 4NXGA 4G3KA 1KX3C 3BY9A 4MCWA 1P3BB 4DXCA 3G6OA 4KUDB 4X25A 3DW0A 1P3AD 1NZUA 3LZ0B 5FATA 4E45A 1KX3D 1CK7A 1GOIA 3KSYA 3T4TA 4FH2A 4IJFA 3X1UB 4TX8A 3X1SA 4UUZA 1IYQA 5DNNA 5GT3A 3WTPD 1SKFA 3NI9A 4GDNA 3CITA 4H9QA 3REIA 3NULA 4EU0A 5F83A 5E2GA 4NYUA 1FR1A 2EFXA 5JYOA 5JA4B 1MKMA 5E5AA 1FIKA 4DJ3A 4DRAA 2ZBBA 3MNNB 3OBFA 3CJMA 3A3IA 1M19D 1SCWA 1FSYA 1A0KA 2D02A 1S66L 3BJNA 3UE6A 4GJ4A 5CPKC 5B1LD 5AV5D 4S2NC 3B47A 3AV1A 1CEFA 1FILA 1XFNA 1FQGA 4GH9A 4O0PA 1YU3A 3KS4A 5GXQA 2VV8A 1L0EA 3MGSA 1K38A 5GT3D 3BQ8A 1B67A 3ZG8B 2ACGA 3EEAA 2PR6A 4KGCD 5KZHA 4BJPA 4R8PB 1L2SA 4BBVA 1W63Q 2JC7A 1P3PA 3EPHA 3LZ0C 3AZEC 2F8NG 1SDEA 2Y2LA 2L5AA 3VP0A 4ARZB 4P6ZM 4QHCA 4E3LA 1M19A 2HP5A 1GSVA 3LIDA 3DTEA 4H6JA 3TE8A 4K91A 1WYCA 5BS7C 1T3UA 2WZXA 4HMDA 4YWZA 1DY6A 3CHWP 5TBMB 3MGRB 4IBFA 3OPHA 4WU8D 3Q07A 4YNRA 4KQRA 4E3NA 1LL9A 4DN0A 5CTMA 4NY2A 4Z66D 5CX7A 4Y5FA 3MGPC 1WYBA 2Z6DA 5FDSA 1F98A 1SHVA 1G5UA 1MXOA 1BSGA 4RQ9A 1GPFA 3P5JB 1K57C 2EXAA 5HL6A 2ZC7A 3NOTC 2ZQDA 5B33D 2F8NK 1E4DA 1S6RA 3O5YA 2MJ6A 4MB5A 1OTEA 4HP9A 3QHYA 3ZG5A 3B6GD 1EQZC 1ALQA 4KQQA 1LI9A 3T1QB 4GKUA 3S7QA 3S7OA 3S7PA 2X71A 4HGAC 1WWSA 4JF4A 1PZRA 4EBLA 4LPZA 5C3IB 1IYSA 1P3GB 3AZMB 3O62A 2H10A 1MY8A 3W99D 4A5RA 2DMWA 2YKFA 4XUJA 4WUJA 4CSRA 3WA9A 1P3IA 5IS1A 1XKZA 3N8RA 5BNXA 4IUKA 3IBJA 3NHQA 2ZQAA 1UR9A 2R9WA 1P3PD 4WU9B 2P9VB 2KDKA 1ID3B 5BS7A 1TS6A 3AZIA 2GJ3A 2V9AA 3MGSC 1Z09A 3KYEA 1ZTUA 3QP5A 2D01A 1ES4A 3IXGA 4B93A 5JA4A 5FUGA 4WM9A 2JE5A 4CJNA 5E5AB 3A0VA 4LENA 5AQBA 2V8CA 4MB3A 1P9RA 4FSFA 1Z6FA 2Z6CA 1W1VA 1KX4B 3W2ZA 3UO9A 3UMDA 4JLFA 5B32G 4UA9A 4GS9B 1K55C 3TU4B 3VOZA 1P3FB 4QD4A 4G91C 1K57A 3C1BA 3AZNC 2HP9A 1XJ6A 3AZJC 2GNXA 2FJ7A 2A24B 4RA7A 3KXBD 1BULA 3JPUA 3X1TB 3HJIA 5EE8A 4J8WB 4F3LB 3REJD 4IJGA 4DE2A 2G5HC 1BFMA 1KX3A 1EI5A 4WU9C 5GT3C 4C6YA 4J8VD 1HQ3C 1KX5A 5BPVA 1JNUA 3AZEA 3NBLA 1DJAA 3W96B 3AGFA 4R70A 3TOIA 1T18A 5F6AA 3ICYA 1PZOA 1YLJA 2VGKA 1P3AC 1AOID 3H9WA 2H5SA 5DNMB 5GT0C 3AYWA 1BUEA 2FFFB 1PI4A 2Y2OA 5B33B 2CC1A 4KENB 1CJFA 3WTPC 3C8CA 3FWLA 2B18A 3AZNB 3AZGB 1YU1A 4EUZA 1W79A 3C1BD 5EVID 4XT2B 1VETA 1MKIA 3ZNTA 4PM8A 4HESA 5HWWA 3KUYA 2XA7M 1P3GA 4KZAA 5JRGC 3O62B 5GLBA 4E44A 5BO0A 1ES5A 3V67A 1NRJA 3D9YA 2VZWA 4LRYC 3NQJA 5AV6A 3TW8A 5AV9D 3L27A 4R8PC 2QKPA 1BH9B 3WA9B 5B24C 5B1LC 1P3MA 4Y17A 3SOIA 1W1PA 1G68A 3B6FC 5AQAA 2OV5A 2Y4AA 5LBRA 3EGDC 5GLDA 5DKLA 4X23D 3WTPE 4YM6B 5A90A 4ID4A 3FDDA 3NOPC 4WF0A 2QPNA 3LZ0D 5EVEA 3AV2A 1KVLA 4BMWA 3LR5A 1K55A 3FPWA 4DKIA 5AVBD 3MQQA 2A49A 5KDMB 3AN2C 3M6HA 3R45A 3AZKD 5CEBA 1ZC2A 2ZJ9A 3VSLA 2WKHA 2W3HA 2VKSA 4HGAB 3MNND 3N8LA 3ISGA 4NXBA 4HEFA 1YLZA 4HP4A 3SS3A 4IVIA 4KUKA 4PAUA 1SKOB 1XA1A 3UTAA 2HDQA 3RELA 5B1LB 5AV5B 4NYYA 1E88A 4FH4A 4PKYA 5C5KA 1ES2A 3IXBA 5A92A 1IEMA 2W1TB 1P3ID 4BD0A 3HREA 2AROD 4C75A 4ZAMA 3WS5A 4DJ2A 3E2KA 4S2NA 4OOYA 5AVBA 1G6OA 3AZEB 1KE0A 2AROA 2ZY4A 4R8PD 4ZJ2A 2IO5C 4J8VB 4NXEA 3JVUA 5KMWA 3HLWA 2NUPC 4J8UA 3UDXA 1YLPA 2CWEA 4R23A 4S2IA 3AZLC 2Y2JA 1KGGA 5CPIB 3AZLB 3GV9A 4GN2A 3C5AA 4CLCC 4X69A 4Y2FA 1T19A 4DXBA 1E6PA 1CQAA 2ZLYA 2HGVA 3PBSA 2Q0OA 1HVBA 4N1XA 3VP4A 3W97C 3UPNA 4F94A 1KGEA 2R9XA 3UMEA 3LIEA 3SH9A 5B32D 3C1CC 3AZGA 4E3KA 3GSGA 4AFIA 1VETB 3T12B 2BYKA 3KWQA 2X02A 2RVQD 2L4RA 3CZDA 4OP5A 1TZYD 4P6ZS 1JTGA 5DTKA 2NQBC 5G49B 5GSUC 1ZG4A 1IKGA 1ZG6A 2NQBD 3PBTA 4J8WC 1K56D 1P3GC 3PAEA 3BM6A 3PR6A 5U47A 1M18D 4XZQC 4KHAB 3AZJB 2PBYA 1NZOA 3IQAA 3QNCA 4ZUXA 3H0RC 3FZCA 3N4IA 3RXXA 5B1MA 5AV9A 3KXBC 1YUEA 1FCOA 1TDGA 3QP4A 2YFWA 1ERQA 2HV1A 1AWIA 2HPBA 4QNLA 2H28A 2ZMVA 5B0ZA 4KG2A 5G4YA 4IJEA 3G4PA 3IF5A 5B2IB 5CGWA 5AV8D 3AZFD 4OLDA 5KDMA 1MWRA 3W98C 1XJ2A 4WMCD 3IXDA 1U35A 3AZHA 3W99A 3LZ1D 5CP6D 5E5AD 1PIOA 5FA7A 3M2KA 4NZ3A 2O99A 5F99D 3B0CT 4ZUXD 5GXQD 1KX4D 3IWOA 3BYDA 1PWDA 3VE3A 1YU4A 2PYOC 5B0YC 4S2KA 3E2LA 4R6LA 2VGJA 3UE1A 3NQUA 3S22A 5AQ9A 1RGYA 3WD4A 3A3DA 3A0SA 2AROC 1VEUB 3ZGAB 4QY6A 2AROB 3EG5B 5FEGA 4M4XA 4J8UC 4KGCC 3UY6A 1EAKA 2WGVA 1P9WA 3CI6A 3VH5A 1OTAA 4NK3A 5HDDA 5HX9A 5CXWA 2HJ9C 4L9GA 1P3OD 3NDGA 3V5MA 3U2AA 3UB6A 4YS3A 2K2NA 3IX4A 3A6NB 3ZHHA 4E3JA 4H9QB 3REIB 1Q2PA 3KSFA 4S2PA 1S32A 2W8SA 2PU4A 3LI9A 4NXFA 4YS3C 4EBNA 2HDRA 4QLCD 3AN2A 3ITAA 4QPRA 4NZ4A 2ZOHA 3BECA 3LIAA 3MGQC 1YAXA 4KZBA 2RVQC 1JFIB 3C1CB 1YMXA 4O01A 1LL5A 4X55A 4UEYA 5CP6A 1TZYB 3C7VA 3LELD 1HZOA 5F5YA 5EVIB 5F82A 4LD9D 2P08A 5JRGB 3MJQA 2H0YA 5DJUA 2KLIA 2OWHA 4LD9A 2DQNC 4OKPA 1P97A 2QJ7A 2ZMAA 4M3KA 2EXBA 5HFOA 4JF5A 5AV9B 1ODVA 2OAQ1 5KSCA 5B2JA 4XZQB 3REKC 1H3OB 1ED7A 2O9BA 3OZHA 3LY3A 3OOVA 4JGRA 4RX2A 1YQSA 1R4VA 5EECA 4Z5TB 3MGRA 3W98A 5DF7A 4KZ9A 1IKIA 1YSQA 1PZPA 4YM6D 3A0RA 2HIOC 1PWGA 5AVEA 3ZNYA 3T4JA 1RGZA 4JPMA 4K0XA 5IHVA 2V1ZA 5FL3A 3MQOA 3WKJD 2I9VA 3ZDJA 3UDIA 2PD7A 2NZDA 3L29A 5F99B 4H9SA 1YSPA 4WZ5A 1LHYA 2PDRA 4OQIA 1KX4C 2DRWA 4E3MA 2XF3A 3KYQA 3M6BA 2PYOB 2XGNA 3LZ1C 3MKEA 4OQ0A 4Y0TA 4EO5B 4R4SA 3UTAC 1CEGA 3EPJA 3N6IA 5GT0A 3RXWA 3AZMA 4L0LA 3V9RA 1Y54A 3X1UA 4PKYG 3AV1C 3IS2B 5CGSA 3V3SA 1NXYA 1F66D 2GX5A 4WBGA 4Z1WA 3KUYD 3LEZA 1S0WA 5DNNB 4UQIS 3LGOA 1P3IB 1F9IA 4I5SA 5CPJA 3T1XA 4IBBA 3DTIA 5CEDA 2JBFA 4NFTA 3REKA 1ZLAD 2XFSA 1XA7A 2WGWA 4X53A 1DJBA 4GZBA 4J8XA 1M18C 1P3OB 1NYYA 3REJA 1TD5A 3AZHD 3A6ND 4JXGA 2PYPA 3WKJA 5B40D 4IBIA 2V0UA 4QLCC 5L09A 3B6FD 4WU8B 2KOIA 3GR2A 5I5LA 2O0YA 2A3UA 1UR8A 1VQQA 1BT5A 5FQQA 5J4EA 2W3GA 5DNMC 1TZYA 4HOIA 1YLWA 3A1IA 2EWVA 4CLCE 4Y15A 3M7PA 3MVDB 4U0XA 4R8PA 5M19A 3BY8A 4QWOA 3MVDC 2Y2NA 1W2EA 3LELB 4H9RB 5AVCB 4JJNC 5JRGA 4LRZE 3AGEA 3IWIA 3UE0A 1BLHA 2YFVA 4LD9B 3ZCZA 4JJND 1S1YA 2W3EA 4IBGA 3N7WA 4K08A 3PAGA 1NJ4A 4R1GA 4H9OB 3DTMA 5HZHA 3UTAD 2WZZA 4JXSA 3IP4C 4Q0IA 4JXVA 4Z2JA 3A3FA 1FR6A 3EOIA 1M18B 1O6IA 1A7WA 1L0DA 4KQOA 1BLCA 5GHZA 3LJAD 5HAIA 3WRZA 1FSWA 3KWQD 4IVKA 4KGCA 1XP4A 3L26A 3AZKA 3HVFA 4GOGA 3GQZA 5G4ZA 2ZQ9A 3LICA 3UPOA 1P3IC 1AIWA 3B42A 4S2MA 2QYBA 2PYRA 3NECA 2K31A 3UB5P 1G28A 1CK3A 1K4EA 1PI5A 3NY4A 4L9EA 3B33A 5FQKA 2WAFA 2HIOD 3FKWA 4GNUA 5B24A 4MBFA 1FCMA 3VH5W 3LZ1B 5L2FA 1W1TA 4EESA 1UGUA 4XUJB 3HLGA 4Y13A 1VHMA 3IXHA 3HONA 2FFYA 3PBRA 2P9VA 2JHEA 4HJ6A 3F6TA 4Z66C 3PTEA 1OT9A 1GSWA 2UV0E 4WYYA 4MBHA 2CV5A 3GMWA 3REKB 4KQDA 2PAVP 4UQIM 4H9NB 3RFBA 3W4QA 4J8XB 2RTSA 1P3OA 4Z5TC 3BFCA 3REJB 3B6GC 4PPRA 5CHMA 2OLVA 5HL1A 1P3OC 4OPYA 3UB9A 2ZM2A 3E4QA 3E4PA 3HL9A 5A8BA 1P3MD 1ACFA 2IO5B 4WU8A 3EPKA 4J8VC 3AZIC 1JWZA 2Y2KA 3OLOA 1TAFA 1YMSA 2P7JA 4KUOA 1H0MA 2DF4C 5GSUA 4OJLA 4BQMA 2CV5D 2FJ7B 4KZ5A 1E6NA 5CPKA 4MEZA 3REHD 4EERA 2RIQA 1P3BC 4J8WA 2XSSA 1BH8A 3MVDD 4GDBA 5GT0D 5AV8C 3AZFC 3VH5T 5D3OA 4ZDXA 2YFVB 3WD2A 3MGSD 5F1GA 1N1JB 3C30A 3C2WA 3LELC 5AJGA 3T50A 4H9OA 2F8ND 5B33C 3IT9A 4B4ZA 2JSSA 4JJNB 3FG8A 3JVVA 4LV2A 4O7DA 3F1OA 4J8XC 5FDHA 4AWLC 2VGLS 3X1SC 5CPKD 2ZD8A 3WA9D 4ME4A 5DTTA 3LJAB 2J8YA 2PHYA 2Y2HA 3KYZA 2Y2QA 2XDMA 1E3UD 3PBNA 1EQZB 5FSRA 1K6RA 4X23B 2JKRI 5BNVB 4YM6C 1N4OA 3WD0A 3VOLA 5E2HA 1L6JA 1MWTA 5EVLA 4EW7A 4BBTA 1HQ3B 4G92C 2J9OA 2ZOIA 2XA7S 2BG1A 3AZID 1UWPX 3NQJB 5AV6B 3B6GA 4C3QA 4X56A 4XUJC 2J3TD 1E6ZA 3IF6C 1BLPA 4LGWA 4GD6A 4IBXA 4CQHA 1D1JA 4Z66A 4OLGA 3H0LC 5K5BA 4DQYB 3ZG0A 4OQHA 4QY5A 3IX8A 3MGQB 1ZHHB 2H0TA 1S67L 3FPVA 3B3XA 3T4OA 4FTXA 5F68A 4Z2GA 2WK0A 3L9KA 1PNEA 4DMZA 3X1UD 4QLCA 3VOYA 5EV0A 2VA0A 4LLOB 3WTPB 3BLMA 1MBLA 5HAPA 5BOHA 5EVIC 4NKPA 3AFAB 3REJC 2X01A 2G7UA 5B2IA 4OP8A 1PDCA 1TAFB 4MBKA 4QB8A 2Q9MA 4FOFA 4ZJ1A 2RL3A 5B40C 3AZLD 1SKOA 1P3BA 3AZHB 4IBRA 2ZY3A 2OOLA 2XR0A 5B1LA 1P3MC 1N9OA 3AZMC 4GW9A 1BH8B 5HPIA 3LZ0A 4DDSA 5M18A 4GB7A 4XUXA 5FQJA 2PT7A 4I39A 3K2NA 5GT3B 4LFUA 5DF8A 3I7JA 2QHKA 5AVCC 3GDIA 3F1OB 3NQUB 3ZG7B 3WAAC 4DF6A 3B0CW 3W98D 3G2YA 1NLYA 3D3OA 4EQIA 1P3KB 5CPIA 1DJCA 3MSHA 3SS5A 3WWXA 4WNNB 4NE5A 4HNBA 1EROA 4R3BA 4CPKA 3X1SB 3HJKA 4LV1A 4ZUXC 4Y0UA 1IELA 2P04A 3GRJA 3K3CA 2J8PA 2QMIA 4ZJ3A 1ZKJA 3AZJD 2WKQA 4BENA 2IOUA 4NE3A 3E4OA 5FAQA 2BYKB 4OPZA 1S4SA 3KWQB 2Y2MA 1GA9A 2BTFP 3HLFA 1BLSA 3LFVA 4I3AA 1HQ3A 5DNNC 1KX5C 1I2WA 3MZEA 4KUDD 1Z2CB 2GDNA 3B6GB 4JXWA 3DWKA 4MLLA 4OVDA 5L10A 5B2ID 4ARZA 2V5OA 4HBUA 3KX0X 4RYEA 1HQ3D 4Z2HA 3WS4A 2OLUA 5HDSA 3IHBA 3VFHA 2M1CA 1ID3C 5L8MA 3UTBD 3WD3A 1HTZA 1K0KA 1P34C 3MFDA 1BZAA 2OAP1 3C1CA 1OGGA 2HF6A 2O9CA 2ZL1A 3Q7ZA 5CP6B 3KSIA 3AZHC 1K25A 1CXWA 3AZJA 3H82A 4EEUA 4XUZA 1I5QA 3AZMD 5F99C 5CHUA 4P85A 4IBDA 3MGQA 4I38A 3CMZA 3MQLA 4XUJD 4CLCD 3AYWD 3AZKC 3T1SA 1E8BA 1OPXA 4GHLA 4PM9A 4H6JB 4X1MA 2XK1A 4Z2IA 3HUOA 5TFQA 1F5MA 3RELC 3JYIA 1LSVA 1AOIC 3AV1D 1PRQA 4OJOA 1PFLA 3RELD 5A93A 1NYMA 4P87A 3FV7A 3AFAD 3MXSA 3QNBA 3C4PA 3O62C 4X1LA 3ZVWA 2WKEA 4QU3A 3AFAC 4WJ3C 1FOFA 4LCMA 3R7WA 4IHQA 3TU4D 1OTIA 3AV2C 1P3FD 1TS0A 4PM6A 4LV3A 3DWZA 1B6WA 1N9NA 3KWQC 5AQ7A 2Y2GA 1DP8A 5F99A 5B24D 2V1BA 2OSUA 4PHTA 1VEUA 4KUDC 1K6SA 5B2JC 2PYOA 3VP1A 3VP2A 4Y7PA 3KXBB 3REHA 4E6XA 2INWA 4BL3A 1STZA 3UTBA 1OTDA 4GHAA 3KFUG 4CSRB 3C1CD 3CWFA 3ZQ5A 5GT0B 3NJAA 5BNXB 4WNNA 1XJ3A 1W8YA 4L9FA 2JKFA 1ID3A 3WAAB 4GS9A 2HUEC 4BL2A 2FZ0A 3H7WB 3EQVA 3MNNC 3P09A 3SH8A 3X1SD 3W97B 3MFXA 2XD5A 2RCXA 3IH9A 3OPRA 4NZ5A 3AN2B 4P6BA 1OMEA 1P3GD 3MGPD 2ZM0A 4Y0OA 4DE1A 4OOLA 4XZQD 1KDSA 3EGXC 4UA7A 1JFIA 4F3LA 3IF6A 3PBQA 4WLAA 1EQZD 1VM1A 5L07A 3LY4A 4KZ4A 5B0ZC 1PWCA 5DJTA 3AZGD 5EFWA 3C1BB 1KX5B 4WU9D 1JTDA 1ID3D 2ZL1B 2JCHA 2L1MA 5HD3A 4JKTA 2PBDP 3W96A 2VK3A 2WKPA 1M40A 2A24A 1JWVA 5FEFA 3G34A 5AV6D 3OCLA 3A1KA 5G18A 3FKVA 2IWDA 4HMEA 4H9RA 5AVCA 4XZQA 5HAQA 4GD8A 1DP6A 2PR5A 3T1RA 5DF9A 1H8MA 2HZ5A 4Z5TA 3AYWB 1H5XA 1KGFA 4DRBA 4G3VA 1GA0A 3CUEC 3T4SA 2VJWA 1Q2QA 1CI9A 5EM1A 3QP6A 1PW1A 4UPKA 4KG5A 3MGQD 3Q1FA 1O7EA 3IWQA 3KUYB 3BFFA 1GHIA 2NZDB 1P3KC 4J8WD 5FAOA 5AV8A 3AZFA 1WA9A 1F2KA 1ZLAB 1BH9A 1XX2A 2HJEA 3A3JA 1BTLA 2E8JA 3AZNA 3SH7A 1MPLA 5CTNA 3GECA 4WZ4A 3DBAA 5B1MD 3W96D 4OPQA 5B40B 4GCZA 5FAPA 5B31G 5B24B 1YU0A 3V9RB 3B6FB 3MQ0A 2LB9A 2HP6A 1OT6A 1LSWA 4B88A 3NIAA 2J80A 3N3FA 5AY8B 2FN2A 3V3RA 4ZRRA 5DNMD 2V1AA 4LG2A 5J3WA 3W4PA 1MWUA 2DNSA 2WGWB 3AZED 2BYMB 1J7MA 4YM6A 4KZ6A 3DTKA 3WX7A 3K3DA 5F69A 5M1AA 1E3UA 4Z2KA 2JN7A 3CPTB 3GTCA 4G3WA 3UTAB 4JGQA 4G91B 1TDLA 3MZDA 5MC7A 5AV5A 2IA2A 5AVFA 3LCEA 2HDSA 3WS0A 3MVDA 1H8YA 3TRCA 4RVAA 1JWPA 4OJPA 1IYPA 4LV0A 2ZY5A 3LELA 3C1BC 2V0WA 3CG5A 1OJGA 5GSUB 3V39A 4S2JA 1EW0A 1XFQA 3FYZA 4J8UB 3PHYA 4KUDA 3FKEA 2XLNA 3X1TC 4WELA 2I72A 5AV6C 4Q0HA 2W1TA 3OPLA 5CPJD 4MNRA 3Q81A 4PM7A 1M18A 1S32D 1MC0A 4UUZB 2B02A 3C38A 5AVBB 4FCFA 3UDFA 3CAXA 5F1FA 2FH5A 3LIFA 3AZKB 4J8VA 4WU8C 1TS8A 3AYWC 1YLTA 2HUEB 4D60A 1U60A 4OONA 1WWIA 5B32C 1T1CA 2A2LA 4UA6A 3W8KA 4YS3D 4XXRA 5GXQC 1P3PC 4Q8IA 3RTYA 1P3BD 5EUAA 1DRMA 3OCNA 5G49A 3EEHA 5DFXA 1KOUA 5B31C 4EETB 5AV8B 3AZFB 1ZLAA 3AV1B 1D7EA 1NWZA 5FI7A 2NZDD 4GLQA 1LLBA 4B9OA 2QZ6A 3E98A 4WV4B 3LZ1A 4NEED 3BFDA 2Q9NA 4FUWA 2WKRA 4EQ1A 5TJJA 1T1BA 3E0YA 2GZAA 1K54C 4EEPA 5B40A 4ZUXB 1O07A 3BW6A 5J7EA 3O88A 4R0QA 3T4LA 5B1MB 4E3IA 2VV7A 3ZYTA 4BLMA 3O86A 3LUQA 2ZQ7A 1M19B 5CPID 1K4FA 5AY8A 1ERMA 3BLSA 3X1VC 2CV5B 2FJ7D 5HW3A 4PM5A 4U0TA 1S1ZA 5AY8C 3L2AA 3B0DB 2J9PA 4B4XA 3HLDA 4OOMA 3F1NB 3ZG9B 3X1VA 5EOOA 4MMNA 1YKDA 5B32B 1U35B 1KE4A 4G92B 3CUEA 2V8FA 1H0GA 4N92A 5CPJC 2E8IA 3VE4A 2LB5A 1LI0A
chains in the Genus database with same CATH topology
2WUQA 3HSHA 3PBOA 5AVBC 1MWSA 3IHAA 3TSGA 2F2AC 4OPRA 4ZBEA 1N9BA 3A3EA 2NQBB 3REID 4WEJA 1Q9CA 3W97D 2Z2MB 5E43A 3AN2D 1TVFA 5GLCA 3S4XA 1F66C 2BLSA 1ONHA 3BEBA 1W7FA 2V20A 4X6TA 1F1EA 2NZDC 5CHLB 4ZTKA 1G6AA 2Y2IA 4JJNA 5GHXA 5GL9A 3HLCA 3G35A 1P3LC 4WU9A 3AZIB 1ES3A 3LO7A 1S32B 3UT9D 4N1HA 3WKJC 3AV2D 1QMEA 2FJ7C 1RCJA 3EPLA 1P3KA 5GXQB 4FD8A 2ZY2A 4X23A 5BT1D 4YS3B 1W5DA 4YINA 3A6NA 3NC8A 3GVBA 1P3PB 4NE6A 1C3BA 4QJGA 3Q82A 5TGFA 1K54A 3X1UC 4R3JA 4OJ5A 4WEKA 5TR7A 2EX2A 3VH6A 1F66A 3Q7VB 1H3OA 2PYOD 1ZLAC 3SS4A 5B1MC 4AWLB 5B0YB 5C3IC 4LCLA 3TU4C 1M19C 2ZC5B 3WA9C 2ZM5A 2EFUA 3UN7A 3X1VB 2G2UA 5B32A 4QLCB 3WS2A 5DNND 5B2JB 3NDEA 3O3VA 5KSHA 3X1TD 1K56A 5DNMA 1ESUA 1GHMA 4EV4A 3W98B 5CHJA 5B33A 5E5AC 3REIC 4R4RA 4X68A 2C5WB 3NCKA 1KE3A 2C6WB 3VP3A 3MGRC 3ZVTA 2Y91A 4U3TA 1WE4A 4M6BA 5FI6A 1CI8A 1AOIB 5B31D 4KG6A 5CECA 1M6KA 4Z5TD 2B5RA 5FUGB 4RX3A 5B31A 2IWBA 4OUIA 5GSUD 4S2OA 4JBFA 2XEPA 4KZ3A 1KX4A 3C7UA 3UTBB 3WKJB 3O62D 5CERA 4KZ8A 3TU4A 3UT9B 1P3FA 1S32C 3VSKA 3G2ZA 5AV9C 5CPJB 3AV2B 3W4OA 5CPIC 1P34B 2CV5C 3W96C 4E6WA 2Y55A 4DDYA 2G5IC 2UWXA 3WAAA 1EWZA 1M1AD 2HIOA 3B0DC 2EX8A 5BT1C 4WZSB 3S1YA 1J9MA 3WRTA 1M1AC 3X1TA 3VFFA 1GHPA 1TEMA 1PW8A 3OPPA 1KX3B 5HARA 3AL0C 4DE3A 1F66B 1FCNA 3RELB 1TZYC 4CAYA 3Q7VA 2ZC3B 4LD9C 3H0MC 5B0YA 1PYYA 1XGIA 4WMCA 3VH6W 3P98A 3M2JA 2EX6A 3LJAC 1IYOA 4Z9QA 5FQMA 3L28A 4IBCA 1SDNA 3X1VD 2XD1A 5FQ9A 4DRTA 3W99C 4UAAA 3AZLA 1L0FA 4Z2MH 3MKFA 5AV5C 3HBRA 2XH9A 5B2JD 3REKD 4H8RA 1U35C 5EOEA 5GLAA 4KZ7A 3BRMA 1NRFA 4KGCB 2IWCA 4EBPA 4NETA 3OC2A 1U35D 5BO0B 4EWFA 5CRFA 2Z2LB 4ZBJC 5AVCD 3MZFA 1XGJA 3WAAD 1P3MB 3IH8A 2ZM8A 2P74A 4BD1A 4OJ6A 3G31A 2F8NA 2J7VA 3MGRD 3ZFZA 3BFEA 4H9SC 1AOIA 3G32A 3MBZA 3MGPB 5FI2A 5JYPA 3KXBA 3REHB 5B31B 3G30A 3UE3A 4EO5C 4H9NA 2XQZA 3C4OA 4UHUA 2WADA 2ZQ8A 4IBJA 3VH6T 3HUNA 2YFWB 1KX5D 3AZGC 3UT9A 3BFGA 3R45B 5B0ZB 1P34A 3W97A 1P3LB 3ITBA 3B0BA 3TG9A 5CGXA 3UT9C 1E25A 2HIOB 1P34D 2EX9A 5CPKB 2BYMA 1ONGA 4ZBJB 3O87A 3W99B 1YM1A 1QMFA 3IF6B 3V50A 1KU5A 2Y2PA 1JVJA 4NZ1A 1YLYA 2F8NH 3N8SA 4CAYB 1M1AA 4H9PB 4Z2MG 1P3AB 3UNWA 4N9LA 4WZ5C 4OQGA 1ULYA 4J8XD 3VMAA 1XXMA 4OH0A 4IEDA 2G2WA 1N1JA 4HBTA 3L25A 1ESIA 5GHYA 1AXBA 1I2SA 5B0YD 5BNVA 4YFMA 2V2FF 3EQUA 3MNNA 3AGDA 1YU2A 1KVMA 2WAEA 5A91A 2VQRA 5AY8D 3LJAA 2XFTA 3WS1A 3UTBC 4X23C 2WYXA 3KS8A 1W8QA 5FASA 1EQZA 5B2IC 3MGSB 5DTSA 4KHAA 2F8NB 1NY0A 4PMAA 5E2EA 1L0GA 5CP6C 2HDUA 3A6NC 4D2OA 3HLBA 5I94A 3MGPA 4JF6A 1HD8A 2ZC6B 3B6FA 2ZQCA 5EVIA 3REHC 5FQIA 4K0WA 2WKIA 1YT4A 5E2FA 3UPPA 2WGIA 3MXRA 2LY8A 2Y59A 3HLEA 4Z66B 5EPHA 5J8XA 3KUYC 4S2LA 3AZND 3AFAA 1P3LA 4N9KA 4P0MA 1HTAA 4J8UD 4IBEA 5B0ZD 1XPBA 1P3KD 1P3LD 4DE0A 1H8ZA 1KDWA 1P3FC 3D4FA 5JRGD 1GCEA 1RP5A 2PU2A 5DVAA 3WTPA 3HUMA 4IBKA 3RJUA 4E3OA 1M1AB 2ZC4B 2DCFA 4H9PA 1P3AA 2NQBA 1KX3C 1P3BB 4DXCA 4KUDB 3DW0A 1P3AD 1NZUA 3LZ0B 5FATA 4E45A 1KX3D 3KSYA 4FH2A 4IJFA 3X1UB 3X1SA 4UUZA 1IYQA 5DNNA 5GT3A 3WTPD 1SKFA 3NI9A 4GDNA 4H9QA 3REIA 5F83A 5E2GA 4NYUA 1FR1A 2EFXA 5JYOA 5JA4B 5E5AA 4DRAA 3MNNB 3CJMA 3A3IA 1M19D 1SCWA 1FSYA 5CPKC 5B1LD 5AV5D 4S2NC 3AV1A 1CEFA 1FQGA 4GH9A 1YU3A 3KS4A 5GXQA 1L0EA 3MGSA 1K38A 5GT3D 1B67A 3ZG8B 4KGCD 5KZHA 4BJPA 4R8PB 1L2SA 2JC7A 1P3PA 3EPHA 3LZ0C 3AZEC 2F8NG 1SDEA 2Y2LA 2L5AA 3VP0A 4QHCA 4E3LA 1M19A 2HP5A 4K91A 1WYCA 5BS7C 1T3UA 2WZXA 1DY6A 3MGRB 4IBFA 3OPHA 4WU8D 3Q07A 4KQRA 4E3NA 1LL9A 5CTMA 4NY2A 4Z66D 3MGPC 1WYBA 1SHVA 1MXOA 1BSGA 3P5JB 1K57C 2EXAA 2ZC7A 2ZQDA 5B33D 2F8NK 1E4DA 1S6RA 3ZG5A 3QHYA 3B6GD 1EQZC 1ALQA 4KQQA 1LI9A 4GKUA 2X71A 4HGAC 1WWSA 4JF4A 1PZRA 4EBLA 5C3IB 1IYSA 1P3GB 3AZMB 3O62A 2H10A 1MY8A 3W99D 4A5RA 4XUJA 4CSRA 3WA9A 1P3IA 1XKZA 3N8RA 5BNXA 2ZQAA 2R9WA 1P3PD 4WU9B 2P9VB 1ID3B 5BS7A 3AZIA 3MGSC 3IXGA 1ES4A 5JA4A 5FUGA 4WM9A 2JE5A 4CJNA 5E5AB 4LENA 5AQBA 4FSFA 1Z6FA 1KX4B 3UO9A 4JLFA 5B32G 4UA9A 1K55C 3TU4B 3VOZA 1P3FB 4QD4A 4G91C 1K57A 3C1BA 3AZNC 2HP9A 3AZJC 2FJ7A 4RA7A 3KXBD 1BULA 3X1TB 5EE8A 4J8WB 3REJD 4DE2A 2G5HC 1BFMA 1KX3A 1EI5A 4WU9C 5GT3C 4C6YA 4J8VD 1HQ3C 1KX5A 5BPVA 3AZEA 3NBLA 1DJAA 3W96B 3AGFA 3TOIA 1PZOA 1YLJA 2VGKA 1P3AC 1AOID 2H5SA 5DNMB 5GT0C 3AYWA 1BUEA 2FFFB 1PI4A 2Y2OA 5B33B 2CC1A 4KENB 3WTPC 3FWLA 3AZNB 3AZGB 1YU1A 4EUZA 1W79A 3C1BD 5EVID 1MKIA 3ZNTA 4PM8A 4HESA 3KUYA 4KZAA 1P3GA 5JRGC 3O62B 5GLBA 4E44A 5BO0A 1ES5A 3NQJA 5AV6A 5AV9D 3L27A 4R8PC 1BH9B 3WA9B 5B24C 5B1LC 1P3MA 3SOIA 1G68A 3B6FC 5AQAA 2OV5A 2Y4AA 5GLDA 4X23D 3WTPE 4YM6B 5A90A 4ID4A 3FDDA 2QPNA 3LZ0D 3AV2A 1KVLA 1K55A 4DKIA 5AVBD 2A49A 5KDMB 3AN2C 3M6HA 3R45A 3AZKD 5CEBA 1ZC2A 2ZJ9A 3VSLA 2WKHA 4HGAB 3MNND 3N8LA 3ISGA 4HEFA 1YLZA 3SS3A 4IVIA 1XA1A 3UTAA 2HDQA 3RELA 5B1LB 5AV5B 4NYYA 4FH4A 1ES2A 3IXBA 5A92A 1IEMA 1P3ID 4BD0A 3HREA 2AROD 4C75A 4ZAMA 3WS5A 3E2KA 4S2NA 4OOYA 5AVBA 3AZEB 1KE0A 2AROA 2ZY4A 4R8PD 4ZJ2A 2IO5C 4J8VB 5KMWA 3HLWA 4J8UA 3UDXA 1YLPA 2CWEA 4R23A 4S2IA 3AZLC 2Y2JA 1KGGA 5CPIB 3AZLB 3GV9A 4GN2A 3C5AA 4X69A 4DXBA 2ZLYA 3PBSA 1HVBA 4N1XA 3VP4A 3W97C 3UPNA 4F94A 1KGEA 2R9XA 3SH9A 5B32D 3C1CC 3AZGA 4E3KA 3GSGA 2BYKA 3KWQA 2X02A 2RVQD 3CZDA 4OP5A 1TZYD 1JTGA 5DTKA 2NQBC 5G49B 5GSUC 1ZG4A 1IKGA 1ZG6A 2NQBD 3PBTA 4J8WC 1K56D 1P3GC 3PAEA 3BM6A 5U47A 1M18D 4XZQC 4KHAB 3AZJB 2PBYA 1NZOA 3IQAA 3QNCA 4ZUXA 3H0RC 3FZCA 3N4IA 3RXXA 5B1MA 5AV9A 3KXBC 1YUEA 1FCOA 1TDGA 2YFWA 1ERQA 2HPBA 4QNLA 5B0ZA 4KG2A 4IJEA 3G4PA 3IF5A 5B2IB 5CGWA 5AV8D 3AZFD 4OLDA 5KDMA 1MWRA 3W98C 4WMCD 3IXDA 1U35A 3AZHA 3W99A 3LZ1D 5CP6D 5E5AD 1PIOA 5FA7A 3M2KA 4NZ3A 5F99D 3B0CT 4ZUXD 5GXQD 1KX4D 3IWOA 3BYDA 1PWDA 1YU4A 2PYOC 5B0YC 4S2KA 3E2LA 2VGJA 3UE1A 3NQUA 3S22A 5AQ9A 1RGYA 3A3DA 2AROC 3ZGAB 4QY6A 2AROB 3EG5B 4J8UC 4KGCC 3UY6A 2WGVA 4NK3A 3VH5A 5HX9A 5CXWA 1P3OD 3NDGA 3V5MA 4YS3A 3A6NB 3ZHHA 4E3JA 4H9QB 3REIB 1Q2PA 4S2PA 1S32A 2W8SA 2PU4A 4YS3C 4EBNA 2HDRA 4QLCD 3AN2A 3ITAA 4NZ4A 3BECA 3MGQC 4KZBA 2RVQC 1JFIB 3C1CB 1YMXA 4X55A 1LL5A 5CP6A 1TZYB 3C7VA 3LELD 1HZOA 5EVIB 5F82A 4LD9D 5JRGB 2H0YA 4LD9A 2DQNC 4OKPA 2ZMAA 4M3KA 2EXBA 5HFOA 4JF5A 5AV9B 5KSCA 5B2JA 4XZQB 3REKC 1H3OB 3OZHA 3LY3A 4RX2A 1YQSA 1R4VA 5EECA 4Z5TB 3MGRA 3W98A 5DF7A 4KZ9A 1IKIA 1PZPA 4YM6D 2HIOC 1PWGA 3ZNYA 1RGZA 4JPMA 4K0XA 5IHVA 2V1ZA 3WKJD 3ZDJA 3UDIA 2NZDA 3L29A 5F99B 4H9SA 4WZ5A 1LHYA 4OQIA 1KX4C 2DRWA 4E3MA 2XF3A 3M6BA 2PYOB 2XGNA 3LZ1C 3MKEA 4OQ0A 4Y0TA 4EO5B 4R4SA 3UTAC 1CEGA 3EPJA 3N6IA 5GT0A 3RXWA 3AZMA 4L0LA 3V9RA 1Y54A 3X1UA 3AV1C 5CGSA 3V3SA 1NXYA 1F66D 4WBGA 3KUYD 3LEZA 1S0WA 5DNNB 1P3IB 5CPJA 4IBBA 5CEDA 2JBFA 4NFTA 3REKA 1ZLAD 2XFSA 1XA7A 2WGWA 4X53A 1DJBA 4GZBA 4J8XA 1M18C 1P3OB 1NYYA 3REJA 3AZHD 3A6ND 4JXGA 3WKJA 5B40D 4IBIA 4QLCC 3B6FD 4WU8B 3GR2A 2A3UA 1VQQA 1BT5A 5FQQA 5DNMC 1TZYA 1YLWA 3A1IA 3MVDB 4U0XA 4R8PA 5M19A 3MVDC 2Y2NA 1W2EA 3LELB 4H9RB 5AVCB 4JJNC 5JRGA 3AGEA 3IWIA 3UE0A 1BLHA 2YFVA 4LD9B 3ZCZA 4JJND 4IBGA 3N7WA 3PAGA 1NJ4A 4R1GA 4H9OB 3DTMA 3UTAD 2WZZA 4JXSA 3IP4C 4JXVA 3A3FA 1FR6A 1M18B 1A7WA 1L0DA 4KQOA 1BLCA 5GHZA 3LJAD 5HAIA 3WRZA 1FSWA 3KWQD 4IVKA 4KGCA 1XP4A 3L26A 3AZKA 3HVFA 4GOGA 3GQZA 2ZQ9A 3UPOA 1P3IC 4S2MA 1CK3A 1K4EA 1PI5A 3NY4A 5FQKA 2WAFA 2HIOD 3FKWA 4GNUA 5B24A 4MBFA 1FCMA 3VH5W 3LZ1B 5L2FA 4XUJB 3HLGA 3IXHA 3HONA 2FFYA 3PBRA 2P9VA 3F6TA 4Z66C 3PTEA 4WYYA 4MBHA 2CV5A 3GMWA 3REKB 4H9NB 3W4QA 4J8XB 1P3OA 4Z5TC 3BFCA 3REJB 3B6GC 4PPRA 5CHMA 2OLVA 5HL1A 1P3OC 4OPYA 2ZM2A 3HL9A 1P3MD 2IO5B 4WU8A 3EPKA 4J8VC 3AZIC 1JWZA 2Y2KA 1TAFA 1YMSA 2DF4C 5GSUA 4OJLA 4BQMA 2CV5D 2FJ7B 4KZ5A 5CPKA 4MEZA 3REHD 2RIQA 1P3BC 4J8WA 1BH8A 3MVDD 4GDBA 5GT0D 5AV8C 3AZFC 3VH5T 5D3OA 4ZDXA 2YFVB 3MGSD 5F1GA 1N1JB 3LELC 4H9OA 2F8ND 5B33C 3IT9A 4B4ZA 2JSSA 4JJNB 4LV2A 4O7DA 4J8XC 5FDHA 4AWLC 3X1SC 5CPKD 2ZD8A 3WA9D 5DTTA 3LJAB 2J8YA 2Y2HA 2Y2QA 2XDMA 1E3UD 3PBNA 1EQZB 5FSRA 1K6RA 4X23B 5BNVB 4YM6C 1N4OA 5E2HA 1MWTA 5EVLA 1HQ3B 4G92C 2J9OA 2BG1A 3AZID 3NQJB 5AV6B 3B6GA 4C3QA 4X56A 4XUJC 3IF6C 1BLPA 4GD6A 4IBXA 4Z66A 4OLGA 3H0LC 4DQYB 3ZG0A 4OQHA 4QY5A 3MGQB 2H0TA 3B3XA 2WK0A 3X1UD 4QLCA 3VOYA 3WTPB 3BLMA 1MBLA 5HAPA 5BOHA 5EVIC 3AFAB 3REJC 2X01A 5B2IA 4OP8A 1TAFB 4MBKA 4QB8A 2Q9MA 4ZJ1A 2RL3A 5B40C 3AZLD 1P3BA 3AZHB 4IBRA 2ZY3A 2XR0A 5B1LA 1P3MC 3AZMC 1BH8B 3LZ0A 4DDSA 5M18A 4GB7A 4XUXA 5FQJA 5GT3B 5DF8A 3I7JA 5AVCC 3NQUB 3ZG7B 3WAAC 4DF6A 3B0CW 3W98D 3G2YA 4EQIA 1P3KB 5CPIA 1DJCA 3SS5A 3WWXA 4WNNB 4NE5A 1EROA 4R3BA 4CPKA 3X1SB 4LV1A 4ZUXC 4Y0UA 1IELA 3GRJA 2J8PA 2QMIA 4ZJ3A 1ZKJA 3AZJD 4BENA 2IOUA 4NE3A 5FAQA 2BYKB 4OPZA 3KWQB 2Y2MA 1GA9A 3HLFA 1BLSA 1HQ3A 5DNNC 1KX5C 1I2WA 3MZEA 4KUDD 1Z2CB 2GDNA 4MLLA 3B6GB 3DWKA 4JXWA 4OVDA 5B2ID 4HBUA 4RYEA 1HQ3D 3WS4A 2OLUA 3IHBA 3VFHA 1ID3C 3UTBD 1HTZA 1P34C 3MFDA 1BZAA 3C1CA 3Q7ZA 5CP6B 3AZHC 1K25A 3AZJA 4XUZA 1I5QA 3AZMD 5F99C 5CHUA 4P85A 4IBDA 3MGQA 3CMZA 4XUJD 3AYWD 3AZKC 4PM9A 4GHLA 2XK1A 3HUOA 5TFQA 3RELC 3JYIA 1AOIC 3AV1D 4OJOA 3RELD 5A93A 1NYMA 4P87A 3FV7A 3AFAD 3MXSA 3QNBA 3C4PA 3O62C 3ZVWA 2WKEA 4QU3A 3AFAC 4WJ3C 1FOFA 4LCMA 3TU4D 3AV2C 1P3FD 4PM6A 4LV3A 3DWZA 1B6WA 5AQ7A 3KWQC 2Y2GA 5F99A 5B24D 2OSUA 4KUDC 1K6SA 5B2JC 2PYOA 3VP1A 3VP2A 4Y7PA 3KXBB 3REHA 4E6XA 4BL3A 3UTBA 4GHAA 3KFUG 4CSRB 3C1CD 5GT0B 5BNXB 4WNNA 1W8YA 1ID3A 3WAAB 2HUEC 4BL2A 3EQVA 3MNNC 3P09A 3SH8A 3X1SD 3W97B 2XD5A 2RCXA 3IH9A 3OPRA 4NZ5A 3AN2B 4P6BA 1OMEA 1P3GD 2ZM0A 3MGPD 4Y0OA 4DE1A 4OOLA 4XZQD 1KDSA 4UA7A 1JFIA 3IF6A 3PBQA 1EQZD 1VM1A 3LY4A 4KZ4A 5B0ZC 1PWCA 3AZGD 3C1BB 1KX5B 4WU9D 1JTDA 1ID3D 2JCHA 4JKTA 3W96A 1M40A 1JWVA 3G34A 5AV6D 3OCLA 3A1KA 5G18A 3FKVA 2IWDA 4H9RA 5AVCA 4XZQA 5HAQA 4GD8A 5DF9A 4Z5TA 3AYWB 1H5XA 1KGFA 4DRBA 1GA0A 1Q2QA 1CI9A 1PW1A 4UPKA 4KG5A 3MGQD 3Q1FA 1O7EA 3IWQA 3KUYB 3BFFA 1GHIA 2NZDB 1P3KC 4J8WD 5FAOA 5AV8A 3AZFA 1ZLAB 1BH9A 1XX2A 3A3JA 1BTLA 3AZNA 3SH7A 1MPLA 5CTNA 4WZ4A 5B1MD 3W96D 4OPQA 5B40B 5FAPA 5B31G 5B24B 1YU0A 3V9RB 3B6FB 2HP6A 4B88A 3NIAA 3N3FA 5AY8B 3V3RA 5DNMD 4LG2A 3W4PA 1MWUA 2DNSA 2WGWB 3AZED 2BYMB 4YM6A 4KZ6A 3WX7A 5M1AA 1E3UA 3GTCA 3UTAB 4G91B 1TDLA 3MZDA 5AV5A 3LCEA 2HDSA 3WS0A 3MVDA 1H8YA 4RVAA 1JWPA 4OJPA 1IYPA 4LV0A 2ZY5A 3LELA 3C1BC 3CG5A 5GSUB 3V39A 4S2JA 3FYZA 4J8UB 4KUDA 3FKEA 2XLNA 3X1TC 4WELA 2I72A 5AV6C 3OPLA 5CPJD 4MNRA 3Q81A 4PM7A 1M18A 1S32D 4UUZB 5AVBB 4FCFA 3UDFA 5F1FA 3AZKB 4J8VA 4WU8C 3AYWC 1YLTA 2HUEB 1U60A 4OONA 1WWIA 5B32C 4UA6A 3W8KA 4YS3D 4XXRA 5GXQC 1P3PC 4Q8IA 1P3BD 5EUAA 3OCNA 5G49A 5B31C 5AV8B 3AZFB 1ZLAA 3AV1B 5FI7A 2NZDD 1LLBA 2QZ6A 4WV4B 3LZ1A 3BFDA 2Q9NA 1K54C 5B40A 4ZUXB 1O07A 3O88A 4R0QA 5B1MB 4E3IA 4BLMA 3O86A 2ZQ7A 1M19B 5CPID 1K4FA 5AY8A 1ERMA 3BLSA 3X1VC 2CV5B 2FJ7D 5HW3A 4PM5A 4U0TA 5AY8C 3L2AA 3B0DB 2J9PA 4B4XA 3HLDA 4OOMA 3ZG9B 3X1VA 5EOOA 5B32B 1U35B 1KE4A 4G92B 4N92A 5CPJC 2E8IA 1LI0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EVI C;  2WUQ A;  1MWR A;  4WMC D;  3IXD A;  4DE0 A;  3PBO A;  1MWS A;  1H8Z A;  1KDW A;  2X01 A;  1PIO A;  4OP8 A;  3D4F A;  5FA7 A;  3IHA A;  4MBK A;  1GCE A;  3M2K A;  3TSG A;  1RP5 A;  2PU2 A;  4OPR A;  5DVA A;  3HUM A;  1N9B A;  2Q9M A;  4QB8 A;  4ZBE A;  3A3E A;  4ZJ1 A;  2RL3 A;  4WEJ A;  3RJU A;  4IBR A;  2Z2M B;  3IWO A;  3BYD A;  1PWD A;  2XR0 A;  5E43 A;  4E3O A;  1TVF A;  5GLC A;  3S4X A;  2ZC4 B;  4DDS A;  4S2K A;  2DCF A;  5M18 A;  2BLS A;  3E2L A;  2VGJ A;  1ONH A;  4GB7 A;  4XUX A;  5FQJ A;  3UE1 A;  3BEB A;  1W7F A;  2V20 A;  4X6T A;  3S22 A;  4DXC A;  5AQ9 A;  1RGY A;  3DW0 A;  3A3D A;  5DF8 A;  1NZU A;  3I7J A;  3ZGA B;  5FAT A;  4QY6 A;  4ZTK A;  1G6A A;  2Y2I A;  5GHX A;  5GL9 A;  4FH2 A;  3HLC A;  3ZG7 B;  3UY6 A;  4DF6 A;  3G35 A;  3G2Y A;  1IYQ A;  2WGV A;  1SKF A;  3NI9 A;  1ES3 A;  4NK3 A;  4EQI A;  4GDN A;  3LO7 A;  5HX9 A;  1DJC A;  5F83 A;  5CXW A;  5E2G A;  3SS5 A;  1FR1 A;  2EFX A;  3WWX A;  5JYO A;  3NDG A;  4N1H A;  3V5M A;  1ERO A;  1QME A;  4R3B A;  4CPK A;  4LV1 A;  1RCJ A;  4Y0U A;  1IEL A;  3GRJ A;  3ZHH A;  4E3J A;  3CJM A;  3A3I A;  1Q2P A;  2QMI A;  4ZJ3 A;  4S2P A;  1ZKJ A;  2PU4 A;  4BEN A;  4FD8 A;  1SCW A;  1FSY A;  4EBN A;  2HDR A;  5FAQ A;  1W5D A;  3ITA A;  4OPZ A;  4S2N C;  4YIN A;  1CEF A;  2Y2M A;  1GA9 A;  3BEC A;  3HLF A;  1BLS A;  1FQG A;  3NC8 A;  4KZB A;  3GVB A;  1L0E A;  1I2W A;  1K38 A;  3MZE A;  1C3B A;  4QJG A;  3Q82 A;  1YMX A;  2GDN A;  4JXW A;  1LL5 A;  3DWK A;  4MLL A;  4OVD A;  4X55 A;  5TGF A;  3ZG8 B;  4HBU A;  4RYE A;  1K54 A;  3C7V A;  3WS4 A;  4R3J A;  2OLU A;  1HZO A;  3IHB A;  3VFH A;  5KZH A;  4BJP A;  1L2S A;  4WEK A;  5TR7 A;  2JC7 A;  1HTZ A;  2EX2 A;  3MFD A;  5EVI B;  5F82 A;  1BZA A;  1SDE A;  2Y2L A;  3Q7Z A;  3VP0 A;  3Q7V B;  4QHC A;  4E3L A;  1K25 A;  2HP5 A;  2H0Y A;  4XUZ A;  1I5Q A;  4K91 A;  1WYC A;  3SS4 A;  2WZX A;  4OKP A;  4LCL A;  2ZMA A;  4M3K A;  2EXB A;  5CHU A;  1DY6 A;  5HFO A;  4P85 A;  4JF5 A;  2ZC5 B;  3OPH A;  3CMZ A;  5KSC A;  3Q07 A;  4PM9 A;  2EFU A;  4KQR A;  3UN7 A;  2XK1 A;  3OZH A;  3LY3 A;  2G2U A;  4E3N A;  4RX2 A;  1LL9 A;  1YQS A;  5EEC A;  3HUO A;  5TFQ A;  5CTM A;  3WS2 A;  1WYB A;  3JYI A;  1SHV A;  1MXO A;  1BSG A;  3NDE A;  5DF7 A;  3O3V A;  1K57 C;  2EXA A;  4KZ9 A;  1IKI A;  2ZC7 A;  1PZP A;  2ZQD A;  5KSH A;  1K56 A;  1E4D A;  5A93 A;  1S6R A;  1PWG A;  3ZNY A;  1NYM A;  1RGZ A;  4JPM A;  3QHY A;  4K0X A;  5IHV A;  3ZG5 A;  2V1Z A;  1ESU A;  1GHM A;  4EV4 A;  1ALQ A;  4KQQ A;  1LI9 A;  4GKU A;  4P87 A;  5CHJ A;  3FV7 A;  3ZDJ A;  2X71 A;  3UDI A;  3MXS A;  3QNB A;  3C4P A;  4JF4 A;  4EBL A;  3ZVW A;  2WKE A;  4QU3 A;  4WZ5 A;  4R4R A;  1LHY A;  4OQI A;  4X68 A;  1FOF A;  1IYS A;  4LCM A;  2C5W B;  2DRW A;  3NCK A;  4E3M A;  2XF3 A;  3M6B A;  2XGN A;  1KE3 A;  2H10 A;  4PM6 A;  3MKE A;  1MY8 A;  2C6W B;  4LV3 A;  3VP3 A;  3DWZ A;  2Y91 A;  4OQ0 A;  5AQ7 A;  3ZVT A;  4A5R A;  4U3T A;  4Y0T A;  2Y2G A;  4R4S A;  1WE4 A;  5FI6 A;  2OSU A;  1CEG A;  3N6I A;  1CI8 A;  1K6S A;  3RXW A;  3VP1 A;  3VP2 A;  4KG6 A;  5CEC A;  1XKZ A;  3N8R A;  4Y7P A;  4L0L A;  1M6K A;  1Y54 A;  2B5R A;  5CGS A;  2ZQA A;  3V3S A;  1NXY A;  2R9W A;  4RX3 A;  4WBG A;  4BL3 A;  4E6X A;  2P9V B;  1S0W A;  3LEZ A;  2IWB A;  4S2O A;  4JBF A;  2XEP A;  4KZ3 A;  3IXG A;  1ES4 A;  5CED A;  3C7U A;  2JBF A;  4WM9 A;  2JE5 A;  4CJN A;  2XFS A;  1W8Y A;  4LEN A;  1XA7 A;  5AQB A;  2WGW A;  4X53 A;  1DJB A;  4GZB A;  5CER A;  4KZ8 A;  4FSF A;  4BL2 A;  1Z6F A;  3VSK A;  1NYY A;  3G2Z A;  3EQV A;  3P09 A;  3W4O A;  3SH8 A;  3UO9 A;  2Y55 A;  4E6W A;  4JLF A;  2XD5 A;  2RCX A;  3IH9 A;  4JXG A;  3OPR A;  4UA9 A;  4P6B A;  2UWX A;  1OME A;  1EWZ A;  4DDY A;  1K55 C;  2ZM0 A;  2EX8 A;  4Y0O A;  3VOZ A;  4DE1 A;  4QD4 A;  4OOL A;  3GR2 A;  2A3U A;  1K57 A;  3S1Y A;  1J9M A;  3WRT A;  1KDS A;  4UA7 A;  1GHP A;  1VQQ A;  1BT5 A;  1TEM A;  5FQQ A;  3VFF A;  3IF6 A;  3PBQ A;  1PW8 A;  2HP9 A;  3OPP A;  1YLW A;  5HAR A;  1VM1 A;  4U0X A;  3LY4 A;  4KZ4 A;  4RA7 A;  5M19 A;  1PWC A;  1BUL A;  4DE3 A;  2Y2N A;  1FCN A;  5EE8 A;  1JTD A;  2JCH A;  3Q7V A;  4JKT A;  2ZC3 B;  4DE2 A;  3AGE A;  1EI5 A;  3IWI A;  3UE0 A;  1BLH A;  1M40 A;  1JWV A;  3ZCZ A;  4C6Y A;  3G34 A;  1PYY A;  3OCL A;  3N7W A;  3PAG A;  1NJ4 A;  3FKV A;  4R1G A;  2IWD A;  5G18 A;  1XGI A;  4WMC A;  3DTM A;  5HAQ A;  3NBL A;  3P98 A;  1DJA A;  4GD8 A;  2WZZ A;  4JXS A;  3M2J A;  3AGF A;  2EX6 A;  4JXV A;  1IYO A;  3A3F A;  5DF9 A;  4Z9Q A;  5FQM A;  1FR6 A;  3TOI A;  1SDN A;  1H5X A;  1KGF A;  1L0D A;  1PZO A;  4KQO A;  1BLC A;  1GA0 A;  1YLJ A;  5GHZ A;  5FQ9 A;  2XD1 A;  5HAI A;  3WRZ A;  4UAA A;  1FSW A;  4DRT A;  4IVK A;  1XP4 A;  1Q2Q A;  1CI9 A;  2VGK A;  1L0F A;  3HVF A;  3MKF A;  3GQZ A;  4GOG A;  2ZQ9 A;  3HBR A;  2XH9 A;  1PW1 A;  2H5S A;  3UPO A;  1BUE A;  4KG5 A;  4H8R A;  3Q1F A;  5EOE A;  1O7E A;  4KZ7 A;  5GLA A;  4S2M A;  2FFF B;  3IWQ A;  1PI4 A;  1NRF A;  3BRM A;  2Y2O A;  3BFF A;  2CC1 A;  1GHI A;  2IWC A;  1CK3 A;  4KEN B;  4EBP A;  3FWL A;  3OC2 A;  4NET A;  1K4E A;  1PI5 A;  4EWF A;  3NY4 A;  4EUZ A;  5CRF A;  1W79 A;  2Z2L B;  5EVI D;  5FAO A;  1MKI A;  5FQK A;  3ZNT A;  3MZF A;  1XGJ A;  4HES A;  4PM8 A;  2WAF A;  1XX2 A;  4KZA A;  3A3J A;  1BTL A;  3FKW A;  5GLB A;  3IH8 A;  4GNU A;  4MBF A;  3SH7 A;  2ZM8 A;  1ES5 A;  1FCM A;  2P74 A;  4BD1 A;  1MPL A;  5CTN A;  5L2F A;  3G31 A;  2J7V A;  4WZ4 A;  3ZFZ A;  3BFE A;  3HLG A;  3G32 A;  4OPQ A;  3IXH A;  3MBZ A;  5FAP A;  2FFY A;  5FI2 A;  5JYP A;  3SOI A;  1G68 A;  2HP6 A;  3PBR A;  2P9V A;  3G30 A;  3UE3 A;  2XQZ A;  5AQA A;  4B88 A;  3NIA A;  2OV5 A;  3PTE A;  2Y4A A;  4WYY A;  3C4O A;  5GLD A;  4MBH A;  3V3R A;  4UHU A;  3GMW A;  4ID4 A;  5A90 A;  2WAD A;  2ZQ8 A;  3W4P A;  1MWU A;  2DNS A;  2WGW B;  2QPN A;  3HUN A;  3W4Q A;  3BFC A;  3BFG A;  1KVL A;  4KZ6 A;  3ITB A;  4PPR A;  3TG9 A;  1K55 A;  5CHM A;  2OLV A;  5CGX A;  5HL1 A;  4OPY A;  4DKI A;  1E25 A;  2ZM2 A;  3HL9 A;  5M1A A;  1E3U A;  2A49 A;  2EX9 A;  3M6H A;  1ONG A;  3GTC A;  3O87 A;  1JWZ A;  1ZC2 A;  2ZJ9 A;  5CEB A;  2Y2K A;  1YM1 A;  1QMF A;  1TDL A;  3MZD A;  1YMS A;  3VSL A;  2WKH A;  3IF6 B;  3V50 A;  1LI0 A;  2Y2P A;  3N8L A;  1JVJ A;  3LCE A;  4BQM A;  3ISG A;  4KZ5 A;  2HDS A;  4HEF A;  3WS0 A;  1H8Y A;  1YLZ A;  4MEZ A;  3SS3 A;  4IVI A;  1XA1 A;  1YLY A;  4RVA A;  2HDQ A;  1JWP A;  1IYP A;  3N8S A;  4LV0 A;  4FH4 A;  3CG5 A;  4GDB A;  1ES2 A;  3IXB A;  5A92 A;  1IEM A;  4S2J A;  3V39 A;  4BD0 A;  3UNW A;  4N9L A;  4WZ5 C;  5D3O A;  4ZDX A;  3FYZ A;  4OQG A;  3HRE A;  4C75 A;  4ZAM A;  5F1G A;  3WS5 A;  3E2K A;  2XLN A;  4S2N A;  4OOY A;  1KE0 A;  3VMA A;  3IT9 A;  4WEL A;  4B4Z A;  2I72 A;  1XXM A;  3OPL A;  4OH0 A;  4ZJ2 A;  4MNR A;  4IED A;  4LV2 A;  2G2W A;  3Q81 A;  4O7D A;  5KMW A;  3HLW A;  4PM7 A;  5FDH A;  3UDX A;  1YLP A;  4HBT A;  4R23 A;  4S2I A;  1ESI A;  4FCF A;  5GHY A;  2Y2J A;  3UDF A;  1KGG A;  5F1F A;  1AXB A;  3GV9 A;  1I2S A;  4GN2 A;  2ZD8 A;  3C5A A;  4X69 A;  1YLT A;  4DXB A;  2ZLY A;  5DTT A;  2J8Y A;  3PBS A;  4YFM A;  2Y2H A;  1HVB A;  1U60 A;  2V2F F;  4OON A;  3EQU A;  4UA6 A;  3W8K A;  4N1X A;  2Y2Q A;  3AGD A;  2XDM A;  3VP4 A;  1E3U D;  4XXR A;  3UPN A;  4F94 A;  1KGE A;  2R9X A;  4Q8I A;  3PBN A;  5EUA A;  1KVM A;  2WAE A;  5FSR A;  5A91 A;  1K6R A;  3SH9 A;  3OCN A;  4E3K A;  3GSG A;  2XFT A;  3WS1 A;  2WYX A;  1N4O A;  5FAS A;  1W8Q A;  2X02 A;  5E2H A;  5FI7 A;  1MWT A;  5EVL A;  3CZD A;  4OP5 A;  1LLB A;  1JTG A;  2QZ6 A;  5DTK A;  2J9O A;  3BFD A;  2BG1 A;  5DTS A;  1ZG4 A;  2Q9N A;  1IKG A;  1ZG6 A;  4C3Q A;  1NY0 A;  4PMA A;  5E2E A;  1L0G A;  2HDU A;  4X56 A;  3PBT A;  4D2O A;  1K54 C;  3IF6 C;  3HLB A;  1K56 D;  5I94 A;  1O07 A;  1HD8 A;  2ZC6 B;  1BLP A;  2ZQC A;  3O88 A;  3PAE A;  4JF6 A;  3BM6 A;  4OLD A;  4R0Q A;  5EVI A;  4E3I A;  5U47 A;  4GD6 A;  4IBX A;  5FQI A;  4BLM A;  3O86 A;  2ZQ7 A;  4K0W A;  4OLG A;  2WKI A;  1K4F A;  1YT4 A;  2PBY A;  1ERM A;  3BLS A;  1NZO A;  3ZG0 A;  4OQH A;  4QY5 A;  3IQA A;  3QNC A;  5E2F A;  3UPP A;  2WGI A;  5HW3 A;  3FZC A;  3N4I A;  3RXX A;  3MXR A;  2Y59 A;  3HLE A;  4U0T A;  4PM5 A;  2H0T A;  1FCO A;  5EPH A;  1TDG A;  5J8X A;  1ERQ A;  2J9P A;  4B4X A;  3B3X A;  3HLD A;  4OOM A;  2HPB A;  3ZG9 B;  5EOO A;  4KG2 A;  4S2L A;  3G4P A;  2WK0 A;  3IF5 A;  1KE4 A;  4N9K A;  4P0M A;  3VOY A;  4N92 A;  2E8I A;  5CGW A;  3BLM A;  1MBL A;  1XPB A;  5HAP A;  5BOH A; 
#chains in the Genus database with same CATH topology
 3D72 A;  2WUQ A;  3HSH A;  1Y4O A;  3CPT A;  3PBO A;  5AVB C;  1MWS A;  3LR4 A;  3MF0 A;  1TF1 A;  3IHA A;  3TSG A;  2F2A C;  4OPR A;  4ZBE A;  1N9B A;  3A3E A;  2NQB B;  3REI D;  4WEJ A;  4JGO A;  1Q9C A;  1YPR A;  1Y28 A;  3W97 D;  2Z2M B;  5E43 A;  3AN2 D;  1TVF A;  5HWV A;  5GLC A;  3S4X A;  1F66 C;  2BLS A;  1ONH A;  3UB8 A;  3BEB A;  1W7F A;  2V20 A;  4X6T A;  1F1E A;  2NZD C;  3HCY A;  2QWS A;  3R4K A;  1UWN X;  5CHL B;  4IUH A;  4ZTK A;  1G6A A;  2Y2I A;  4JJN A;  1GSX A;  5GHX A;  5GL9 A;  3IBR A;  3HLC A;  3G35 A;  1P3L C;  3KO6 A;  4WU9 A;  5HD5 A;  3AZI B;  1ES3 A;  3LO7 A;  1S32 B;  3UT9 D;  3IX3 A;  4N1H A;  1CF0 A;  3WKJ C;  3AV2 D;  4MDZ A;  1QME A;  2J3T C;  2FJ7 C;  1RCJ A;  3EPL A;  2ZMF A;  5EM0 A;  1P3K A;  5GXQ B;  4FD8 A;  2Y8H A;  2ZY2 A;  1V9Z A;  2R78 A;  4X23 A;  5BT1 D;  3NOU C;  4YS3 B;  1LL8 A;  1W5D A;  4YIN A;  3A6N A;  4I3J A;  3QP1 A;  3NC8 A;  3GVB A;  1P3P B;  4NE6 A;  2XRN A;  1C3B A;  4QJG A;  3Q82 A;  3MMH A;  5HWT A;  5TGF A;  4ESP A;  3MR0 A;  1K54 A;  3X1U C;  4I3I A;  3ULF A;  4R3J A;  4OJ5 A;  3S7N A;  4WEK A;  5TR7 A;  1DP9 A;  2EX2 A;  3VH6 A;  1F66 A;  3Q7V B;  4NG2 A;  1H3O A;  1D06 A;  2PYO D;  1ZLA C;  3L7H A;  3SS4 A;  4Q0J A;  5B1M C;  4AWL B;  5B0Y B;  5C3I C;  4LCL A;  4EUV A;  3TU4 C;  3TJZ C;  4WN5 A;  1M19 C;  2ZC5 B;  1KS0 A;  3WA9 C;  2ZM5 A;  2EFU A;  3F1N A;  3UN7 A;  3X1V B;  5DFY A;  2G2U A;  2VX8 A;  5B32 A;  2EA9 A;  4QLC B;  4LRX C;  1S4R A;  1VB6 A;  3WS2 A;  5DNN D;  5B2J B;  3NDE A;  3O3V A;  4Y3I A;  3LR0 A;  5KSH A;  4HH2 A;  3X1T D;  1K56 A;  5DNM A;  1ESU A;  1GHM A;  4EV4 A;  2JKT M;  4HHD A;  3W98 B;  5CHJ A;  5B33 A;  5E5A C;  3REI C;  3VV4 A;  4R4R A;  2W3D A;  1TS7 A;  4X68 A;  1P0Z A;  2C5W B;  3NCK A;  5HSQ A;  4EXO A;  1KE3 A;  3QP2 A;  2K7S A;  2C6W B;  2YKH A;  4MN7 A;  3MGR C;  3VP3 A;  2Y91 A;  3ZVT A;  3IS2 A;  4U3T A;  1WE4 A;  4M6B A;  5FI6 A;  4MN6 A;  2W1R A;  1CI8 A;  2JKG A;  4HJ3 A;  1AOI B;  5B31 D;  4KG6 A;  5CEC A;  1M6K A;  4Z5T D;  2B5R A;  5FUG B;  4RX3 A;  3U4L P;  2XRO A;  5B31 A;  5HDC A;  2IWB A;  4OUI A;  5GSU D;  4S2O A;  4JBF A;  2XEP A;  4KZ3 A;  1KX4 A;  3C7U A;  3F1P A;  3UTB B;  3BWL A;  1HLU P;  3WKJ B;  3O62 D;  5CER A;  4KZ8 A;  3TU4 A;  3UT9 B;  1P3F A;  4HJ4 A;  1S32 C;  3VSK A;  3G2Z A;  3FC7 A;  5AV9 C;  5CPJ B;  3AV2 B;  3W4O A;  5CPI C;  1P34 B;  2CV5 C;  3W96 C;  4E6W A;  2Y55 A;  5KIZ A;  1H3Q A;  4DDY A;  2G5I C;  2UWX A;  3WAA A;  1EWZ A;  1M1A D;  2HIO A;  3B0D C;  2EX8 A;  3H7W A;  5BT1 C;  4CLC B;  4WZS B;  3S1Y A;  1J9M A;  3P01 A;  4YOF A;  1M1A C;  3X1T A;  3VFF A;  1GHP A;  3WRT A;  5HPF A;  1TEM A;  3P7N A;  2Y79 A;  1PW8 A;  3OPP A;  2QJ5 A;  2B95 A;  1KX3 B;  5HAR A;  2JKR M;  1H0I A;  3AL0 C;  2W27 A;  4DE3 A;  1F66 B;  1FCN A;  2W0N A;  3REL B;  1TZY C;  3EWK A;  2AVX A;  4CAY A;  2CMN A;  3Q7V A;  1LT0 A;  1W63 M;  2ZC3 B;  3H82 B;  4MB4 A;  4LD9 C;  1N9L A;  3H0M C;  4GHI B;  5B0Y A;  1PYY A;  2JKT I;  3LYX A;  1XGI A;  4WMC A;  3VH6 W;  3P98 A;  3M2J A;  2EX6 A;  3LJA C;  1IYO A;  4Z9Q A;  5FQM A;  3L28 A;  4IBC A;  1SDN A;  1W1Y A;  3X1V D;  2XD1 A;  5FQ9 A;  4DRT A;  3W99 C;  4UAA A;  3AZL A;  4E04 A;  1L0F A;  5DKK A;  4Z2M H;  3MKF A;  2EWW A;  5AV5 C;  2OWJ A;  1GXD A;  3HBR A;  2XH9 A;  4O8G A;  5B2J D;  4XT2 A;  3REK D;  4H8R A;  1U35 C;  4BWI A;  5EOE A;  5GLA A;  4KZ7 A;  3BRM A;  1NRF A;  1H8P A;  4KGC B;  2IWC A;  1IFQ A;  4EBP A;  4NET A;  3OC2 A;  2BAS A;  1U35 D;  5BO0 B;  4EWF A;  5CRF A;  2Z2L B;  4MN5 A;  1OTB A;  4ZBJ C;  5AVC D;  3MZF A;  1XGJ A;  2W3F A;  3R7W B;  3WAA D;  1P3M B;  3UB7 A;  3IH8 A;  2ZM8 A;  2P74 A;  4BD1 A;  3MXQ A;  4OJ6 A;  1X0O A;  3G31 A;  2F8N A;  2J7V A;  3MGR D;  3ZFZ A;  3BFE A;  3CLO A;  4H9S C;  2PD8 A;  1AOI A;  3G32 A;  1T1A A;  3MBZ A;  4R38 A;  3LIB A;  3MGP B;  4HIA A;  5FI2 A;  3KXB A;  3REH B;  5JYP A;  2VEA A;  2M7U A;  5B31 B;  3G30 A;  3UE3 A;  4EO5 C;  4H9N A;  2XQZ A;  4HQA A;  3KSG A;  3C4O A;  4UHU A;  3LEQ A;  1L3L A;  2WAD A;  3F1P B;  2ZQ8 A;  4IBJ A;  3VH6 T;  3HUN A;  4HY8 A;  2YFW B;  1KX5 D;  3AZG C;  3UT9 A;  3BFG A;  3R45 B;  5B0Z B;  1P34 A;  3W97 A;  1P3L B;  3ITB A;  1LSX A;  3B0B A;  4WL9 A;  2KX6 A;  3TG9 A;  1XJ4 A;  5CGX A;  3UT9 C;  1E25 A;  2HIO B;  1P34 D;  2EX9 A;  4CLC A;  5CPK B;  2BYM A;  1ONG A;  4ZBJ B;  3O87 A;  4Z2L A;  3W99 B;  1YM1 A;  1QMF A;  1SZV A;  3IF6 B;  3V50 A;  4HI4 A;  1KU5 A;  2Y2P A;  1E6R A;  1JVJ A;  4NZ1 A;  1YLY A;  2F8N H;  3N8S A;  4CAY B;  1M1A A;  4H9P B;  4Z2M G;  1P3A B;  3LR3 A;  3UNW A;  4N9L A;  4WZ5 C;  1J3W A;  4OQG A;  1ULY A;  4GHI A;  5IT5 A;  4J8X D;  3VMA A;  1XXM A;  4OH0 A;  4IED A;  2G2W A;  1N1J A;  4HBT A;  1V9Y A;  3SW1 A;  3L25 A;  1ESI A;  5GHY A;  2VV6 A;  3RH8 B;  3DAV A;  1AXB A;  1I2S A;  1OGB A;  2D49 A;  1QO6 A;  5B0Y D;  2M7V A;  5BNV A;  4YFM A;  2V2F F;  3EQU A;  3MNN A;  3AGD A;  1YU2 A;  1KVM A;  2WAE A;  5A91 A;  2VQR A;  5AY8 D;  5IU1 A;  3LJA A;  1E15 A;  2XFT A;  1BYW A;  3SZT A;  3WS1 A;  3UTB C;  4X23 C;  2WYX A;  3KS8 A;  1W8Q A;  5FAS A;  3QP8 A;  1EQZ A;  5B2I C;  3MGS B;  5DTS A;  4KHA A;  2F8N B;  3MS6 A;  1NY0 A;  2NUT C;  3PYP A;  3T4K A;  4PMA A;  5E2E A;  1L0G A;  5CP6 C;  2HDU A;  3A6N C;  1OJ5 A;  4D2O A;  3KSH A;  3HLB A;  5I94 A;  3MGP A;  1MZU A;  1HD8 A;  2ZC6 B;  4JF6 A;  3B6F A;  2ZQC A;  5EVI A;  3REH C;  5FQI A;  4K0W A;  2WKI A;  1IOU A;  1YT4 A;  3T4Q A;  3LI8 A;  5E2F A;  4BBU A;  3UPP A;  2J3W A;  2WGI A;  4ETZ A;  3MXR A;  2LY8 A;  5TBM A;  2Y59 A;  3HLE A;  3WD1 A;  4Z66 B;  5EPH A;  5J8X A;  4HMC A;  3KUY C;  4S2L A;  3AZN D;  3AFA A;  1P3L A;  4N9K A;  4P0M A;  4II7 A;  1HTA A;  1NLZ A;  2L0W A;  4J8U D;  4IBE A;  5B0Z D;  1XPB A;  1P3K D;  1P3L D;  3BQA A;  4DE0 A;  1H8Z A;  1KDW A;  2VLG A;  1P3F C;  4HH3 A;  3D4F A;  5JRG D;  1GCE A;  1RP5 A;  2PU2 A;  5DVA A;  3WTP A;  3HUM A;  2VGL M;  4IBK A;  3RJU A;  4R3A A;  3PXP A;  2PRF A;  4E3O A;  1M1A B;  4ETX A;  4JGP A;  2ZC4 B;  2O9A A;  2DCF A;  4H9P A;  1P3A A;  2NQB A;  4NXG A;  4G3K A;  1KX3 C;  3BY9 A;  4MCW A;  1P3B B;  4DXC A;  3G6O A;  4KUD B;  4X25 A;  3DW0 A;  1P3A D;  1NZU A;  3LZ0 B;  5FAT A;  4E45 A;  1KX3 D;  1CK7 A;  1GOI A;  3KSY A;  3T4T A;  4FH2 A;  4IJF A;  3X1U B;  4TX8 A;  3X1S A;  4UUZ A;  1IYQ A;  5DNN A;  5GT3 A;  3WTP D;  1SKF A;  3NI9 A;  4GDN A;  3CIT A;  4H9Q A;  3REI A;  3NUL A;  4EU0 A;  5F83 A;  5E2G A;  4NYU A;  1FR1 A;  2EFX A;  5JYO A;  5JA4 B;  1MKM A;  5E5A A;  1FIK A;  4DJ3 A;  4DRA A;  2ZBB A;  3MNN B;  3OBF A;  3CJM A;  3A3I A;  1M19 D;  1SCW A;  1FSY A;  1A0K A;  2D02 A;  1S66 L;  3BJN A;  3UE6 A;  4GJ4 A;  5CPK C;  5B1L D;  5AV5 D;  4S2N C;  3B47 A;  3AV1 A;  1CEF A;  1FIL A;  1XFN A;  1FQG A;  4GH9 A;  4O0P A;  1YU3 A;  3KS4 A;  5GXQ A;  2VV8 A;  1L0E A;  3MGS A;  1K38 A;  5GT3 D;  3BQ8 A;  1B67 A;  3ZG8 B;  2ACG A;  3EEA A;  2PR6 A;  4KGC D;  5KZH A;  4BJP A;  4R8P B;  1L2S A;  4BBV A;  1W63 Q;  2JC7 A;  1P3P A;  3EPH A;  3LZ0 C;  3AZE C;  2F8N G;  1SDE A;  2Y2L A;  2L5A A;  3VP0 A;  4ARZ B;  4P6Z M;  4QHC A;  4E3L A;  1M19 A;  2HP5 A;  1GSV A;  3LID A;  3DTE A;  4H6J A;  3TE8 A;  4K91 A;  1WYC A;  5BS7 C;  1T3U A;  2WZX A;  4HMD A;  4YWZ A;  1DY6 A;  3CHW P;  5TBM B;  3MGR B;  4IBF A;  3OPH A;  4WU8 D;  3Q07 A;  4YNR A;  4KQR A;  4E3N A;  1LL9 A;  4DN0 A;  5CTM A;  4NY2 A;  4Z66 D;  5CX7 A;  4Y5F A;  3MGP C;  1WYB A;  2Z6D A;  5FDS A;  1F98 A;  1SHV A;  1G5U A;  1MXO A;  1BSG A;  4RQ9 A;  1GPF A;  3P5J B;  1K57 C;  2EXA A;  5HL6 A;  2ZC7 A;  3NOT C;  2ZQD A;  5B33 D;  2F8N K;  1E4D A;  1S6R A;  3O5Y A;  2MJ6 A;  4MB5 A;  1OTE A;  4HP9 A;  3QHY A;  3ZG5 A;  3B6G D;  1EQZ C;  1ALQ A;  4KQQ A;  1LI9 A;  3T1Q B;  4GKU A;  3S7Q A;  3S7O A;  3S7P A;  2X71 A;  4HGA C;  1WWS A;  4JF4 A;  1PZR A;  4EBL A;  4LPZ A;  5C3I B;  1IYS A;  1P3G B;  3AZM B;  3O62 A;  2H10 A;  1MY8 A;  3W99 D;  4A5R A;  2DMW A;  2YKF A;  4XUJ A;  4WUJ A;  4CSR A;  3WA9 A;  1P3I A;  5IS1 A;  1XKZ A;  3N8R A;  5BNX A;  4IUK A;  3IBJ A;  3NHQ A;  2ZQA A;  1UR9 A;  2R9W A;  1P3P D;  4WU9 B;  2P9V B;  2KDK A;  1ID3 B;  5BS7 A;  1TS6 A;  3AZI A;  2GJ3 A;  2V9A A;  3MGS C;  1Z09 A;  3KYE A;  1ZTU A;  3QP5 A;  2D01 A;  1ES4 A;  3IXG A;  4B93 A;  5JA4 A;  5FUG A;  4WM9 A;  2JE5 A;  4CJN A;  5E5A B;  3A0V A;  4LEN A;  5AQB A;  2V8C A;  4MB3 A;  1P9R A;  4FSF A;  1Z6F A;  2Z6C A;  1W1V A;  1KX4 B;  3W2Z A;  3UO9 A;  3UMD A;  4JLF A;  5B32 G;  4UA9 A;  4GS9 B;  1K55 C;  3TU4 B;  3VOZ A;  1P3F B;  4QD4 A;  4G91 C;  1K57 A;  3C1B A;  3AZN C;  2HP9 A;  1XJ6 A;  3AZJ C;  2GNX A;  2FJ7 A;  2A24 B;  4RA7 A;  3KXB D;  1BUL A;  3JPU A;  3X1T B;  3HJI A;  5EE8 A;  4J8W B;  4F3L B;  3REJ D;  4IJG A;  4DE2 A;  2G5H C;  1BFM A;  1KX3 A;  1EI5 A;  4WU9 C;  5GT3 C;  4C6Y A;  4J8V D;  1HQ3 C;  1KX5 A;  5BPV A;  1JNU A;  3AZE A;  3NBL A;  1DJA A;  3W96 B;  3AGF A;  4R70 A;  3TOI A;  1T18 A;  5F6A A;  3ICY A;  1PZO A;  1YLJ A;  2VGK A;  1P3A C;  1AOI D;  3H9W A;  2H5S A;  5DNM B;  5GT0 C;  3AYW A;  1BUE A;  2FFF B;  1PI4 A;  2Y2O A;  5B33 B;  2CC1 A;  4KEN B;  1CJF A;  3WTP C;  3C8C A;  3FWL A;  2B18 A;  3AZN B;  3AZG B;  1YU1 A;  4EUZ A;  1W79 A;  3C1B D;  5EVI D;  4XT2 B;  1VET A;  1MKI A;  3ZNT A;  4PM8 A;  4HES A;  5HWW A;  3KUY A;  2XA7 M;  1P3G A;  4KZA A;  5JRG C;  3O62 B;  5GLB A;  4E44 A;  5BO0 A;  1ES5 A;  3V67 A;  1NRJ A;  3D9Y A;  2VZW A;  4LRY C;  3NQJ A;  5AV6 A;  3TW8 A;  5AV9 D;  3L27 A;  4R8P C;  2QKP A;  1BH9 B;  3WA9 B;  5B24 C;  5B1L C;  1P3M A;  4Y17 A;  3SOI A;  1W1P A;  1G68 A;  3B6F C;  5AQA A;  2OV5 A;  2Y4A A;  5LBR A;  3EGD C;  5GLD A;  5DKL A;  4X23 D;  3WTP E;  4YM6 B;  5A90 A;  4ID4 A;  3FDD A;  3NOP C;  4WF0 A;  2QPN A;  3LZ0 D;  5EVE A;  3AV2 A;  1KVL A;  4BMW A;  3LR5 A;  1K55 A;  3FPW A;  4DKI A;  5AVB D;  3MQQ A;  2A49 A;  5KDM B;  3AN2 C;  3M6H A;  3R45 A;  3AZK D;  5CEB A;  1ZC2 A;  2ZJ9 A;  3VSL A;  2WKH A;  2W3H A;  2VKS A;  4HGA B;  3MNN D;  3N8L A;  3ISG A;  4NXB A;  4HEF A;  1YLZ A;  4HP4 A;  3SS3 A;  4IVI A;  4KUK A;  4PAU A;  1SKO B;  1XA1 A;  3UTA A;  2HDQ A;  3REL A;  5B1L B;  5AV5 B;  4NYY A;  1E88 A;  4FH4 A;  4PKY A;  5C5K A;  1ES2 A;  3IXB A;  5A92 A;  1IEM A;  2W1T B;  1P3I D;  4BD0 A;  3HRE A;  2ARO D;  4C75 A;  4ZAM A;  3WS5 A;  4DJ2 A;  3E2K A;  4S2N A;  4OOY A;  5AVB A;  1G6O A;  3AZE B;  1KE0 A;  2ARO A;  2ZY4 A;  4R8P D;  4ZJ2 A;  2IO5 C;  4J8V B;  4NXE A;  3JVU A;  5KMW A;  3HLW A;  2NUP C;  4J8U A;  3UDX A;  1YLP A;  2CWE A;  4R23 A;  4S2I A;  3AZL C;  2Y2J A;  1KGG A;  5CPI B;  3AZL B;  3GV9 A;  4GN2 A;  3C5A A;  4CLC C;  4X69 A;  4Y2F A;  1T19 A;  4DXB A;  1E6P A;  1CQA A;  2ZLY A;  2HGV A;  3PBS A;  2Q0O A;  1HVB A;  4N1X A;  3VP4 A;  3W97 C;  3UPN A;  4F94 A;  1KGE A;  2R9X A;  3UME A;  3LIE A;  3SH9 A;  5B32 D;  3C1C C;  3AZG A;  4E3K A;  3GSG A;  4AFI A;  1VET B;  3T12 B;  2BYK A;  3KWQ A;  2X02 A;  2RVQ D;  2L4R A;  3CZD A;  4OP5 A;  1TZY D;  4P6Z S;  1JTG A;  5DTK A;  2NQB C;  5G49 B;  5GSU C;  1ZG4 A;  1IKG A;  1ZG6 A;  2NQB D;  3PBT A;  4J8W C;  1K56 D;  1P3G C;  3PAE A;  3BM6 A;  3PR6 A;  5U47 A;  1M18 D;  4XZQ C;  4KHA B;  3AZJ B;  2PBY A;  1NZO A;  3IQA A;  3QNC A;  4ZUX A;  3H0R C;  3FZC A;  3N4I A;  3RXX A;  5B1M A;  5AV9 A;  3KXB C;  1YUE A;  1FCO A;  1TDG A;  3QP4 A;  2YFW A;  1ERQ A;  2HV1 A;  1AWI A;  2HPB A;  4QNL A;  2H28 A;  2ZMV A;  5B0Z A;  4KG2 A;  5G4Y A;  4IJE A;  3G4P A;  3IF5 A;  5B2I B;  5CGW A;  5AV8 D;  3AZF D;  4OLD A;  5KDM A;  1MWR A;  3W98 C;  1XJ2 A;  4WMC D;  3IXD A;  1U35 A;  3AZH A;  3W99 A;  3LZ1 D;  5CP6 D;  5E5A D;  1PIO A;  5FA7 A;  3M2K A;  4NZ3 A;  2O99 A;  5F99 D;  3B0C T;  4ZUX D;  5GXQ D;  1KX4 D;  3IWO A;  3BYD A;  1PWD A;  3VE3 A;  1YU4 A;  2PYO C;  5B0Y C;  4S2K A;  3E2L A;  4R6L A;  2VGJ A;  3UE1 A;  3NQU A;  3S22 A;  5AQ9 A;  1RGY A;  3WD4 A;  3A3D A;  3A0S A;  2ARO C;  1VEU B;  3ZGA B;  4QY6 A;  2ARO B;  3EG5 B;  5FEG A;  4M4X A;  4J8U C;  4KGC C;  3UY6 A;  1EAK A;  2WGV A;  1P9W A;  3CI6 A;  3VH5 A;  1OTA A;  4NK3 A;  5HDD A;  5HX9 A;  5CXW A;  2HJ9 C;  4L9G A;  1P3O D;  3NDG A;  3V5M A;  3U2A A;  3UB6 A;  4YS3 A;  2K2N A;  3IX4 A;  3A6N B;  3ZHH A;  4E3J A;  4H9Q B;  3REI B;  1Q2P A;  3KSF A;  4S2P A;  1S32 A;  2W8S A;  2PU4 A;  3LI9 A;  4NXF A;  4YS3 C;  4EBN A;  2HDR A;  4QLC D;  3AN2 A;  3ITA A;  4QPR A;  4NZ4 A;  2ZOH A;  3BEC A;  3LIA A;  3MGQ C;  1YAX A;  4KZB A;  2RVQ C;  1JFI B;  3C1C B;  1YMX A;  4O01 A;  1LL5 A;  4X55 A;  4UEY A;  5CP6 A;  1TZY B;  3C7V A;  3LEL D;  1HZO A;  5F5Y A;  5EVI B;  5F82 A;  4LD9 D;  2P08 A;  5JRG B;  3MJQ A;  2H0Y A;  5DJU A;  2KLI A;  2OWH A;  4LD9 A;  2DQN C;  4OKP A;  1P97 A;  2QJ7 A;  2ZMA A;  4M3K A;  2EXB A;  5HFO A;  4JF5 A;  5AV9 B;  1ODV A;  2OAQ 1;  5KSC A;  5B2J A;  4XZQ B;  3REK C;  1H3O B;  1ED7 A;  2O9B A;  3OZH A;  3LY3 A;  3OOV A;  4JGR A;  4RX2 A;  1YQS A;  1R4V A;  5EEC A;  4Z5T B;  3MGR A;  3W98 A;  5DF7 A;  4KZ9 A;  1IKI A;  1YSQ A;  1PZP A;  4YM6 D;  3A0R A;  2HIO C;  1PWG A;  5AVE A;  3ZNY A;  3T4J A;  1RGZ A;  4JPM A;  4K0X A;  5IHV A;  2V1Z A;  5FL3 A;  3MQO A;  3WKJ D;  2I9V A;  3ZDJ A;  3UDI A;  2PD7 A;  2NZD A;  3L29 A;  5F99 B;  4H9S A;  1YSP A;  4WZ5 A;  1LHY A;  2PDR A;  4OQI A;  1KX4 C;  2DRW A;  4E3M A;  2XF3 A;  3KYQ A;  3M6B A;  2PYO B;  2XGN A;  3LZ1 C;  3MKE A;  4OQ0 A;  4Y0T A;  4EO5 B;  4R4S A;  3UTA C;  1CEG A;  3EPJ A;  3N6I A;  5GT0 A;  3RXW A;  3AZM A;  4L0L A;  3V9R A;  1Y54 A;  3X1U A;  4PKY G;  3AV1 C;  3IS2 B;  5CGS A;  3V3S A;  1NXY A;  1F66 D;  2GX5 A;  4WBG A;  4Z1W A;  3KUY D;  3LEZ A;  1S0W A;  5DNN B;  4UQI S;  3LGO A;  1P3I B;  1F9I A;  4I5S A;  5CPJ A;  3T1X A;  4IBB A;  3DTI A;  5CED A;  2JBF A;  4NFT A;  3REK A;  1ZLA D;  2XFS A;  1XA7 A;  2WGW A;  4X53 A;  1DJB A;  4GZB A;  4J8X A;  1M18 C;  1P3O B;  1NYY A;  3REJ A;  1TD5 A;  3AZH D;  3A6N D;  4JXG A;  2PYP A;  3WKJ A;  5B40 D;  4IBI A;  2V0U A;  4QLC C;  5L09 A;  3B6F D;  4WU8 B;  2KOI A;  3GR2 A;  5I5L A;  2O0Y A;  2A3U A;  1UR8 A;  1VQQ A;  1BT5 A;  5FQQ A;  5J4E A;  2W3G A;  5DNM C;  1TZY A;  4HOI A;  1YLW A;  3A1I A;  2EWV A;  4CLC E;  4Y15 A;  3M7P A;  3MVD B;  4U0X A;  4R8P A;  5M19 A;  3BY8 A;  4QWO A;  3MVD C;  2Y2N A;  1W2E A;  3LEL B;  4H9R B;  5AVC B;  4JJN C;  5JRG A;  4LRZ E;  3AGE A;  3IWI A;  3UE0 A;  1BLH A;  2YFV A;  4LD9 B;  3ZCZ A;  4JJN D;  1S1Y A;  2W3E A;  4IBG A;  3N7W A;  4K08 A;  3PAG A;  1NJ4 A;  4R1G A;  4H9O B;  3DTM A;  5HZH A;  3UTA D;  2WZZ A;  4JXS A;  3IP4 C;  4Q0I A;  4JXV A;  4Z2J A;  3A3F A;  1FR6 A;  3EOI A;  1M18 B;  1O6I A;  1A7W A;  1L0D A;  4KQO A;  1BLC A;  5GHZ A;  3LJA D;  5HAI A;  3WRZ A;  1FSW A;  3KWQ D;  4IVK A;  4KGC A;  1XP4 A;  3L26 A;  3AZK A;  3HVF A;  4GOG A;  3GQZ A;  5G4Z A;  2ZQ9 A;  3LIC A;  3UPO A;  1P3I C;  1AIW A;  3B42 A;  4S2M A;  2QYB A;  2PYR A;  3NEC A;  2K31 A;  3UB5 P;  1G28 A;  1CK3 A;  1K4E A;  1PI5 A;  3NY4 A;  4L9E A;  3B33 A;  5FQK A;  2WAF A;  2HIO D;  3FKW A;  4GNU A;  5B24 A;  4MBF A;  1FCM A;  3VH5 W;  3LZ1 B;  5L2F A;  1W1T A;  4EES A;  1UGU A;  4XUJ B;  3HLG A;  4Y13 A;  1VHM A;  3IXH A;  3HON A;  2FFY A;  3PBR A;  2P9V A;  2JHE A;  4HJ6 A;  3F6T A;  4Z66 C;  3PTE A;  1OT9 A;  1GSW A;  2UV0 E;  4WYY A;  4MBH A;  2CV5 A;  3GMW A;  3REK B;  4KQD A;  2PAV P;  4UQI M;  4H9N B;  3RFB A;  3W4Q A;  4J8X B;  2RTS A;  1P3O A;  4Z5T C;  3BFC A;  3REJ B;  3B6G C;  4PPR A;  5CHM A;  2OLV A;  5HL1 A;  1P3O C;  4OPY A;  3UB9 A;  2ZM2 A;  3E4Q A;  3E4P A;  3HL9 A;  5A8B A;  1P3M D;  1ACF A;  2IO5 B;  4WU8 A;  3EPK A;  4J8V C;  3AZI C;  1JWZ A;  2Y2K A;  3OLO A;  1TAF A;  1YMS A;  2P7J A;  4KUO A;  1H0M A;  2DF4 C;  5GSU A;  4OJL A;  4BQM A;  2CV5 D;  2FJ7 B;  4KZ5 A;  1E6N A;  5CPK A;  4MEZ A;  3REH D;  4EER A;  2RIQ A;  1P3B C;  4J8W A;  2XSS A;  1BH8 A;  3MVD D;  4GDB A;  5GT0 D;  5AV8 C;  3AZF C;  3VH5 T;  5D3O A;  4ZDX A;  2YFV B;  3WD2 A;  3MGS D;  5F1G A;  1N1J B;  3C30 A;  3C2W A;  3LEL C;  5AJG A;  3T50 A;  4H9O A;  2F8N D;  5B33 C;  3IT9 A;  4B4Z A;  2JSS A;  4JJN B;  3FG8 A;  3JVV A;  4LV2 A;  4O7D A;  3F1O A;  4J8X C;  5FDH A;  4AWL C;  2VGL S;  3X1S C;  5CPK D;  2ZD8 A;  3WA9 D;  4ME4 A;  5DTT A;  3LJA B;  2J8Y A;  2PHY A;  2Y2H A;  3KYZ A;  2Y2Q A;  2XDM A;  1E3U D;  3PBN A;  1EQZ B;  5FSR A;  1K6R A;  4X23 B;  2JKR I;  5BNV B;  4YM6 C;  1N4O A;  3WD0 A;  3VOL A;  5E2H A;  1L6J A;  1MWT A;  5EVL A;  4EW7 A;  4BBT A;  1HQ3 B;  4G92 C;  2J9O A;  2ZOI A;  2XA7 S;  2BG1 A;  3AZI D;  1UWP X;  3NQJ B;  5AV6 B;  3B6G A;  4C3Q A;  4X56 A;  4XUJ C;  2J3T D;  1E6Z A;  3IF6 C;  1BLP A;  4LGW A;  4GD6 A;  4IBX A;  4CQH A;  1D1J A;  4Z66 A;  4OLG A;  3H0L C;  5K5B A;  4DQY B;  3ZG0 A;  4OQH A;  4QY5 A;  3IX8 A;  3MGQ B;  1ZHH B;  2H0T A;  1S67 L;  3FPV A;  3B3X A;  3T4O A;  4FTX A;  5F68 A;  4Z2G A;  2WK0 A;  3L9K A;  1PNE A;  4DMZ A;  3X1U D;  4QLC A;  3VOY A;  5EV0 A;  2VA0 A;  4LLO B;  3WTP B;  3BLM A;  1MBL A;  5HAP A;  5BOH A;  5EVI C;  4NKP A;  3AFA B;  3REJ C;  2X01 A;  2G7U A;  5B2I A;  4OP8 A;  1PDC A;  1TAF B;  4MBK A;  4QB8 A;  2Q9M A;  4FOF A;  4ZJ1 A;  2RL3 A;  5B40 C;  3AZL D;  1SKO A;  1P3B A;  3AZH B;  4IBR A;  2ZY3 A;  2OOL A;  2XR0 A;  5B1L A;  1P3M C;  1N9O A;  3AZM C;  4GW9 A;  1BH8 B;  5HPI A;  3LZ0 A;  4DDS A;  5M18 A;  4GB7 A;  4XUX A;  5FQJ A;  2PT7 A;  4I39 A;  3K2N A;  5GT3 B;  4LFU A;  5DF8 A;  3I7J A;  2QHK A;  5AVC C;  3GDI A;  3F1O B;  3NQU B;  3ZG7 B;  3WAA C;  4DF6 A;  3B0C W;  3W98 D;  3G2Y A;  1NLY A;  3D3O A;  4EQI A;  1P3K B;  5CPI A;  1DJC A;  3MSH A;  3SS5 A;  3WWX A;  4WNN B;  4NE5 A;  4HNB A;  1ERO A;  4R3B A;  4CPK A;  3X1S B;  3HJK A;  4LV1 A;  4ZUX C;  4Y0U A;  1IEL A;  2P04 A;  3GRJ A;  3K3C A;  2J8P A;  2QMI A;  4ZJ3 A;  1ZKJ A;  3AZJ D;  2WKQ A;  4BEN A;  2IOU A;  4NE3 A;  3E4O A;  5FAQ A;  2BYK B;  4OPZ A;  1S4S A;  3KWQ B;  2Y2M A;  1GA9 A;  2BTF P;  3HLF A;  1BLS A;  3LFV A;  4I3A A;  1HQ3 A;  5DNN C;  1KX5 C;  1I2W A;  3MZE A;  4KUD D;  1Z2C B;  2GDN A;  3B6G B;  4JXW A;  3DWK A;  4MLL A;  4OVD A;  5L10 A;  5B2I D;  4ARZ A;  2V5O A;  4HBU A;  3KX0 X;  4RYE A;  1HQ3 D;  4Z2H A;  3WS4 A;  2OLU A;  5HDS A;  3IHB A;  3VFH A;  2M1C A;  1ID3 C;  5L8M A;  3UTB D;  3WD3 A;  1HTZ A;  1K0K A;  1P34 C;  3MFD A;  1BZA A;  2OAP 1;  3C1C A;  1OGG A;  2HF6 A;  2O9C A;  2ZL1 A;  3Q7Z A;  5CP6 B;  3KSI A;  3AZH C;  1K25 A;  1CXW A;  3AZJ A;  3H82 A;  4EEU A;  4XUZ A;  1I5Q A;  3AZM D;  5F99 C;  5CHU A;  4P85 A;  4IBD A;  3MGQ A;  4I38 A;  3CMZ A;  3MQL A;  4XUJ D;  4CLC D;  3AYW D;  3AZK C;  3T1S A;  1E8B A;  1OPX A;  4GHL A;  4PM9 A;  4H6J B;  4X1M A;  2XK1 A;  4Z2I A;  3HUO A;  5TFQ A;  1F5M A;  3REL C;  3JYI A;  1LSV A;  1AOI C;  3AV1 D;  1PRQ A;  4OJO A;  1PFL A;  3REL D;  5A93 A;  1NYM A;  4P87 A;  3FV7 A;  3AFA D;  3MXS A;  3QNB A;  3C4P A;  3O62 C;  4X1L A;  3ZVW A;  2WKE A;  4QU3 A;  3AFA C;  4WJ3 C;  1FOF A;  4LCM A;  3R7W A;  4IHQ A;  3TU4 D;  1OTI A;  3AV2 C;  1P3F D;  1TS0 A;  4PM6 A;  4LV3 A;  3DWZ A;  1B6W A;  1N9N A;  3KWQ C;  5AQ7 A;  2Y2G A;  1DP8 A;  5F99 A;  5B24 D;  2V1B A;  2OSU A;  4PHT A;  1VEU A;  4KUD C;  1K6S A;  5B2J C;  2PYO A;  3VP1 A;  3VP2 A;  4Y7P A;  3KXB B;  3REH A;  4E6X A;  2INW A;  4BL3 A;  1STZ A;  3UTB A;  1OTD A;  4GHA A;  3KFU G;  4CSR B;  3C1C D;  3CWF A;  3ZQ5 A;  5GT0 B;  3NJA A;  5BNX B;  4WNN A;  1XJ3 A;  1W8Y A;  4L9F A;  2JKF A;  1ID3 A;  3WAA B;  4GS9 A;  2HUE C;  4BL2 A;  2FZ0 A;  3H7W B;  3EQV A;  3MNN C;  3P09 A;  3SH8 A;  3X1S D;  3W97 B;  3MFX A;  2XD5 A;  2RCX A;  3IH9 A;  3OPR A;  4NZ5 A;  3AN2 B;  4P6B A;  1OME A;  1P3G D;  3MGP D;  2ZM0 A;  4Y0O A;  4DE1 A;  4OOL A;  4XZQ D;  1KDS A;  3EGX C;  4UA7 A;  1JFI A;  4F3L A;  3IF6 A;  3PBQ A;  4WLA A;  1EQZ D;  1VM1 A;  5L07 A;  3LY4 A;  4KZ4 A;  5B0Z C;  1PWC A;  5DJT A;  3AZG D;  5EFW A;  3C1B B;  1KX5 B;  4WU9 D;  1JTD A;  1ID3 D;  2ZL1 B;  2JCH A;  2L1M A;  5HD3 A;  4JKT A;  2PBD P;  3W96 A;  2VK3 A;  2WKP A;  1M40 A;  2A24 A;  1JWV A;  5FEF A;  3G34 A;  5AV6 D;  3OCL A;  3A1K A;  5G18 A;  3FKV A;  2IWD A;  4HME A;  4H9R A;  5AVC A;  4XZQ A;  5HAQ A;  4GD8 A;  1DP6 A;  2PR5 A;  3T1R A;  5DF9 A;  1H8M A;  2HZ5 A;  4Z5T A;  3AYW B;  1H5X A;  1KGF A;  4DRB A;  4G3V A;  1GA0 A;  3CUE C;  3T4S A;  2VJW A;  1Q2Q A;  1CI9 A;  5EM1 A;  3QP6 A;  1PW1 A;  4UPK A;  4KG5 A;  3MGQ D;  3Q1F A;  1O7E A;  3IWQ A;  3KUY B;  3BFF A;  1GHI A;  2NZD B;  1P3K C;  4J8W D;  5FAO A;  5AV8 A;  3AZF A;  1WA9 A;  1F2K A;  1ZLA B;  1BH9 A;  1XX2 A;  2HJE A;  3A3J A;  1BTL A;  2E8J A;  3AZN A;  3SH7 A;  1MPL A;  5CTN A;  3GEC A;  4WZ4 A;  3DBA A;  5B1M D;  3W96 D;  4OPQ A;  5B40 B;  4GCZ A;  5FAP A;  5B31 G;  5B24 B;  1YU0 A;  3V9R B;  3B6F B;  3MQ0 A;  2LB9 A;  2HP6 A;  1OT6 A;  1LSW A;  4B88 A;  3NIA A;  2J80 A;  3N3F A;  5AY8 B;  2FN2 A;  3V3R A;  4ZRR A;  5DNM D;  2V1A A;  4LG2 A;  5J3W A;  3W4P A;  1MWU A;  2DNS A;  2WGW B;  3AZE D;  2BYM B;  1J7M A;  4YM6 A;  4KZ6 A;  3DTK A;  3WX7 A;  3K3D A;  5F69 A;  5M1A A;  1E3U A;  4Z2K A;  2JN7 A;  3CPT B;  3GTC A;  4G3W A;  3UTA B;  4JGQ A;  4G91 B;  1TDL A;  3MZD A;  5MC7 A;  5AV5 A;  2IA2 A;  5AVF A;  3LCE A;  2HDS A;  3WS0 A;  3MVD A;  1H8Y A;  3TRC A;  4RVA A;  1JWP A;  4OJP A;  1IYP A;  4LV0 A;  2ZY5 A;  3LEL A;  3C1B C;  2V0W A;  3CG5 A;  1OJG A;  5GSU B;  3V39 A;  4S2J A;  1EW0 A;  1XFQ A;  3FYZ A;  4J8U B;  3PHY A;  4KUD A;  3FKE A;  2XLN A;  3X1T C;  4WEL A;  2I72 A;  5AV6 C;  4Q0H A;  2W1T A;  3OPL A;  5CPJ D;  4MNR A;  3Q81 A;  4PM7 A;  1M18 A;  1S32 D;  1MC0 A;  4UUZ B;  2B02 A;  3C38 A;  5AVB B;  4FCF A;  3UDF A;  3CAX A;  5F1F A;  2FH5 A;  3LIF A;  3AZK B;  4J8V A;  4WU8 C;  1TS8 A;  3AYW C;  1YLT A;  2HUE B;  4D60 A;  1U60 A;  4OON A;  1WWI A;  5B32 C;  1T1C A;  2A2L A;  4UA6 A;  3W8K A;  4YS3 D;  4XXR A;  5GXQ C;  1P3P C;  4Q8I A;  3RTY A;  1P3B D;  5EUA A;  1DRM A;  3OCN A;  5G49 A;  3EEH A;  5DFX A;  1KOU A;  5B31 C;  4EET B;  5AV8 B;  3AZF B;  1ZLA A;  3AV1 B;  1D7E A;  1NWZ A;  5FI7 A;  2NZD D;  4GLQ A;  1LLB A;  4B9O A;  2QZ6 A;  3E98 A;  4WV4 B;  3LZ1 A;  4NEE D;  3BFD A;  2Q9N A;  4FUW A;  2WKR A;  4EQ1 A;  5TJJ A;  1T1B A;  3E0Y A;  2GZA A;  1K54 C;  4EEP A;  5B40 A;  4ZUX B;  1O07 A;  3BW6 A;  5J7E A;  3O88 A;  4R0Q A;  3T4L A;  5B1M B;  4E3I A;  2VV7 A;  3ZYT A;  4BLM A;  3O86 A;  3LUQ A;  2ZQ7 A;  1M19 B;  5CPI D;  1K4F A;  5AY8 A;  1ERM A;  3BLS A;  3X1V C;  2CV5 B;  2FJ7 D;  5HW3 A;  4PM5 A;  4U0T A;  1S1Z A;  5AY8 C;  3L2A A;  3B0D B;  2J9P A;  4B4X A;  3HLD A;  4OOM A;  3F1N B;  3ZG9 B;  3X1V A;  5EOO A;  4MMN A;  1YKD A;  5B32 B;  1U35 B;  1KE4 A;  4G92 B;  3CUE A;  2V8F A;  1H0G A;  4N92 A;  5CPJ C;  2E8I A;  3VE4 A;  2LB5 A;  1LI0 A; 
#chains in the Genus database with same CATH homology
 2WUQ A;  3HSH A;  3PBO A;  5AVB C;  1MWS A;  3IHA A;  3TSG A;  2F2A C;  4OPR A;  4ZBE A;  1N9B A;  3A3E A;  2NQB B;  3REI D;  4WEJ A;  1Q9C A;  3W97 D;  2Z2M B;  5E43 A;  3AN2 D;  1TVF A;  5GLC A;  3S4X A;  1F66 C;  2BLS A;  1ONH A;  3BEB A;  1W7F A;  2V20 A;  4X6T A;  1F1E A;  2NZD C;  5CHL B;  4ZTK A;  1G6A A;  2Y2I A;  4JJN A;  5GHX A;  5GL9 A;  3HLC A;  3G35 A;  1P3L C;  4WU9 A;  3AZI B;  1ES3 A;  3LO7 A;  1S32 B;  3UT9 D;  4N1H A;  3WKJ C;  3AV2 D;  1QME A;  2FJ7 C;  1RCJ A;  3EPL A;  1P3K A;  5GXQ B;  4FD8 A;  2ZY2 A;  4X23 A;  5BT1 D;  4YS3 B;  1W5D A;  4YIN A;  3A6N A;  3NC8 A;  3GVB A;  1P3P B;  4NE6 A;  1C3B A;  4QJG A;  3Q82 A;  5TGF A;  1K54 A;  3X1U C;  4R3J A;  4OJ5 A;  4WEK A;  5TR7 A;  2EX2 A;  3VH6 A;  1F66 A;  3Q7V B;  1H3O A;  2PYO D;  1ZLA C;  3SS4 A;  5B1M C;  4AWL B;  5B0Y B;  5C3I C;  4LCL A;  3TU4 C;  1M19 C;  2ZC5 B;  3WA9 C;  2ZM5 A;  2EFU A;  3UN7 A;  3X1V B;  2G2U A;  5B32 A;  4QLC B;  3WS2 A;  5DNN D;  5B2J B;  3NDE A;  3O3V A;  5KSH A;  3X1T D;  1K56 A;  5DNM A;  1ESU A;  1GHM A;  4EV4 A;  3W98 B;  5CHJ A;  5B33 A;  5E5A C;  3REI C;  4R4R A;  4X68 A;  2C5W B;  3NCK A;  1KE3 A;  2C6W B;  3VP3 A;  3MGR C;  3ZVT A;  2Y91 A;  4U3T A;  1WE4 A;  4M6B A;  5FI6 A;  1CI8 A;  1AOI B;  5B31 D;  4KG6 A;  5CEC A;  1M6K A;  4Z5T D;  2B5R A;  5FUG B;  4RX3 A;  5B31 A;  2IWB A;  4OUI A;  5GSU D;  4S2O A;  4JBF A;  2XEP A;  4KZ3 A;  1KX4 A;  3C7U A;  3UTB B;  3WKJ B;  3O62 D;  5CER A;  4KZ8 A;  3TU4 A;  3UT9 B;  1P3F A;  1S32 C;  3VSK A;  3G2Z A;  5AV9 C;  5CPJ B;  3AV2 B;  3W4O A;  5CPI C;  1P34 B;  2CV5 C;  3W96 C;  4E6W A;  2Y55 A;  4DDY A;  2G5I C;  2UWX A;  3WAA A;  1EWZ A;  1M1A D;  2HIO A;  3B0D C;  2EX8 A;  5BT1 C;  4WZS B;  3S1Y A;  1J9M A;  3WRT A;  1M1A C;  3X1T A;  3VFF A;  1GHP A;  1TEM A;  1PW8 A;  3OPP A;  1KX3 B;  5HAR A;  3AL0 C;  4DE3 A;  1F66 B;  1FCN A;  3REL B;  1TZY C;  4CAY A;  3Q7V A;  2ZC3 B;  4LD9 C;  3H0M C;  5B0Y A;  1PYY A;  1XGI A;  4WMC A;  3VH6 W;  3P98 A;  3M2J A;  2EX6 A;  3LJA C;  1IYO A;  4Z9Q A;  5FQM A;  3L28 A;  4IBC A;  1SDN A;  3X1V D;  2XD1 A;  5FQ9 A;  4DRT A;  3W99 C;  4UAA A;  3AZL A;  1L0F A;  4Z2M H;  3MKF A;  5AV5 C;  3HBR A;  2XH9 A;  5B2J D;  3REK D;  4H8R A;  1U35 C;  5EOE A;  5GLA A;  4KZ7 A;  3BRM A;  1NRF A;  4KGC B;  2IWC A;  4EBP A;  4NET A;  3OC2 A;  1U35 D;  5BO0 B;  4EWF A;  5CRF A;  2Z2L B;  4ZBJ C;  5AVC D;  3MZF A;  1XGJ A;  3WAA D;  1P3M B;  3IH8 A;  2ZM8 A;  2P74 A;  4BD1 A;  4OJ6 A;  3G31 A;  2F8N A;  2J7V A;  3MGR D;  3ZFZ A;  3BFE A;  4H9S C;  1AOI A;  3G32 A;  3MBZ A;  3MGP B;  5FI2 A;  5JYP A;  3KXB A;  3REH B;  5B31 B;  3G30 A;  3UE3 A;  4EO5 C;  4H9N A;  2XQZ A;  3C4O A;  4UHU A;  2WAD A;  2ZQ8 A;  4IBJ A;  3VH6 T;  3HUN A;  2YFW B;  1KX5 D;  3AZG C;  3UT9 A;  3BFG A;  3R45 B;  5B0Z B;  1P34 A;  3W97 A;  1P3L B;  3ITB A;  3B0B A;  3TG9 A;  5CGX A;  3UT9 C;  1E25 A;  2HIO B;  1P34 D;  2EX9 A;  5CPK B;  2BYM A;  1ONG A;  4ZBJ B;  3O87 A;  3W99 B;  1YM1 A;  1QMF A;  3IF6 B;  3V50 A;  1KU5 A;  2Y2P A;  1JVJ A;  4NZ1 A;  1YLY A;  2F8N H;  3N8S A;  4CAY B;  1M1A A;  4H9P B;  4Z2M G;  1P3A B;  3UNW A;  4N9L A;  4WZ5 C;  4OQG A;  1ULY A;  4J8X D;  3VMA A;  1XXM A;  4OH0 A;  4IED A;  2G2W A;  1N1J A;  4HBT A;  3L25 A;  1ESI A;  5GHY A;  1AXB A;  1I2S A;  5B0Y D;  5BNV A;  4YFM A;  2V2F F;  3EQU A;  3MNN A;  3AGD A;  1YU2 A;  1KVM A;  2WAE A;  5A91 A;  2VQR A;  5AY8 D;  3LJA A;  2XFT A;  3WS1 A;  3UTB C;  4X23 C;  2WYX A;  3KS8 A;  1W8Q A;  5FAS A;  1EQZ A;  5B2I C;  3MGS B;  5DTS A;  4KHA A;  2F8N B;  1NY0 A;  4PMA A;  5E2E A;  1L0G A;  5CP6 C;  2HDU A;  3A6N C;  4D2O A;  3HLB A;  5I94 A;  3MGP A;  4JF6 A;  1HD8 A;  2ZC6 B;  3B6F A;  2ZQC A;  5EVI A;  3REH C;  5FQI A;  4K0W A;  2WKI A;  1YT4 A;  5E2F A;  3UPP A;  2WGI A;  3MXR A;  2LY8 A;  2Y59 A;  3HLE A;  4Z66 B;  5EPH A;  5J8X A;  3KUY C;  4S2L A;  3AZN D;  3AFA A;  1P3L A;  4N9K A;  4P0M A;  1HTA A;  4J8U D;  4IBE A;  5B0Z D;  1XPB A;  1P3K D;  1P3L D;  4DE0 A;  1H8Z A;  1KDW A;  1P3F C;  3D4F A;  5JRG D;  1GCE A;  1RP5 A;  2PU2 A;  5DVA A;  3WTP A;  3HUM A;  4IBK A;  3RJU A;  4E3O A;  1M1A B;  2ZC4 B;  2DCF A;  4H9P A;  1P3A A;  2NQB A;  1KX3 C;  1P3B B;  4DXC A;  4KUD B;  3DW0 A;  1P3A D;  1NZU A;  3LZ0 B;  5FAT A;  4E45 A;  1KX3 D;  3KSY A;  4FH2 A;  4IJF A;  3X1U B;  3X1S A;  4UUZ A;  1IYQ A;  5DNN A;  5GT3 A;  3WTP D;  1SKF A;  3NI9 A;  4GDN A;  4H9Q A;  3REI A;  5F83 A;  5E2G A;  4NYU A;  1FR1 A;  2EFX A;  5JYO A;  5JA4 B;  5E5A A;  4DRA A;  3MNN B;  3CJM A;  3A3I A;  1M19 D;  1SCW A;  1FSY A;  5CPK C;  5B1L D;  5AV5 D;  4S2N C;  3AV1 A;  1CEF A;  1FQG A;  4GH9 A;  1YU3 A;  3KS4 A;  5GXQ A;  1L0E A;  3MGS A;  1K38 A;  5GT3 D;  1B67 A;  3ZG8 B;  4KGC D;  5KZH A;  4BJP A;  4R8P B;  1L2S A;  2JC7 A;  1P3P A;  3EPH A;  3LZ0 C;  3AZE C;  2F8N G;  1SDE A;  2Y2L A;  2L5A A;  3VP0 A;  4QHC A;  4E3L A;  1M19 A;  2HP5 A;  4K91 A;  1WYC A;  5BS7 C;  1T3U A;  2WZX A;  1DY6 A;  3MGR B;  4IBF A;  3OPH A;  4WU8 D;  3Q07 A;  4KQR A;  4E3N A;  1LL9 A;  5CTM A;  4NY2 A;  4Z66 D;  3MGP C;  1WYB A;  1SHV A;  1MXO A;  1BSG A;  3P5J B;  1K57 C;  2EXA A;  2ZC7 A;  2ZQD A;  5B33 D;  2F8N K;  1E4D A;  1S6R A;  3ZG5 A;  3QHY A;  3B6G D;  1EQZ C;  1ALQ A;  4KQQ A;  1LI9 A;  4GKU A;  2X71 A;  4HGA C;  1WWS A;  4JF4 A;  1PZR A;  4EBL A;  5C3I B;  1IYS A;  1P3G B;  3AZM B;  3O62 A;  2H10 A;  1MY8 A;  3W99 D;  4A5R A;  4XUJ A;  4CSR A;  3WA9 A;  1P3I A;  1XKZ A;  3N8R A;  5BNX A;  2ZQA A;  2R9W A;  1P3P D;  4WU9 B;  2P9V B;  1ID3 B;  5BS7 A;  3AZI A;  3MGS C;  3IXG A;  1ES4 A;  5JA4 A;  5FUG A;  4WM9 A;  2JE5 A;  4CJN A;  5E5A B;  4LEN A;  5AQB A;  4FSF A;  1Z6F A;  1KX4 B;  3UO9 A;  4JLF A;  5B32 G;  4UA9 A;  1K55 C;  3TU4 B;  3VOZ A;  1P3F B;  4QD4 A;  4G91 C;  1K57 A;  3C1B A;  3AZN C;  2HP9 A;  3AZJ C;  2FJ7 A;  4RA7 A;  3KXB D;  1BUL A;  3X1T B;  5EE8 A;  4J8W B;  3REJ D;  4DE2 A;  2G5H C;  1BFM A;  1KX3 A;  1EI5 A;  4WU9 C;  5GT3 C;  4C6Y A;  4J8V D;  1HQ3 C;  1KX5 A;  5BPV A;  3AZE A;  3NBL A;  1DJA A;  3W96 B;  3AGF A;  3TOI A;  1PZO A;  1YLJ A;  2VGK A;  1P3A C;  1AOI D;  2H5S A;  5DNM B;  5GT0 C;  3AYW A;  1BUE A;  2FFF B;  1PI4 A;  2Y2O A;  5B33 B;  2CC1 A;  4KEN B;  3WTP C;  3FWL A;  3AZN B;  3AZG B;  1YU1 A;  4EUZ A;  1W79 A;  3C1B D;  5EVI D;  1MKI A;  3ZNT A;  4PM8 A;  4HES A;  3KUY A;  4KZA A;  1P3G A;  5JRG C;  3O62 B;  5GLB A;  4E44 A;  5BO0 A;  1ES5 A;  3NQJ A;  5AV6 A;  5AV9 D;  3L27 A;  4R8P C;  1BH9 B;  3WA9 B;  5B24 C;  5B1L C;  1P3M A;  3SOI A;  1G68 A;  3B6F C;  5AQA A;  2OV5 A;  2Y4A A;  5GLD A;  4X23 D;  3WTP E;  4YM6 B;  5A90 A;  4ID4 A;  3FDD A;  2QPN A;  3LZ0 D;  3AV2 A;  1KVL A;  1K55 A;  4DKI A;  5AVB D;  2A49 A;  5KDM B;  3AN2 C;  3M6H A;  3R45 A;  3AZK D;  5CEB A;  1ZC2 A;  2ZJ9 A;  3VSL A;  2WKH A;  4HGA B;  3MNN D;  3N8L A;  3ISG A;  4HEF A;  1YLZ A;  3SS3 A;  4IVI A;  1XA1 A;  3UTA A;  2HDQ A;  3REL A;  5B1L B;  5AV5 B;  4NYY A;  4FH4 A;  1ES2 A;  3IXB A;  5A92 A;  1IEM A;  1P3I D;  4BD0 A;  3HRE A;  2ARO D;  4C75 A;  4ZAM A;  3WS5 A;  3E2K A;  4S2N A;  4OOY A;  5AVB A;  3AZE B;  1KE0 A;  2ARO A;  2ZY4 A;  4R8P D;  4ZJ2 A;  2IO5 C;  4J8V B;  5KMW A;  3HLW A;  4J8U A;  3UDX A;  1YLP A;  2CWE A;  4R23 A;  4S2I A;  3AZL C;  2Y2J A;  1KGG A;  5CPI B;  3AZL B;  3GV9 A;  4GN2 A;  3C5A A;  4X69 A;  4DXB A;  2ZLY A;  3PBS A;  1HVB A;  4N1X A;  3VP4 A;  3W97 C;  3UPN A;  4F94 A;  1KGE A;  2R9X A;  3SH9 A;  5B32 D;  3C1C C;  3AZG A;  4E3K A;  3GSG A;  2BYK A;  3KWQ A;  2X02 A;  2RVQ D;  3CZD A;  4OP5 A;  1TZY D;  1JTG A;  5DTK A;  2NQB C;  5G49 B;  5GSU C;  1ZG4 A;  1IKG A;  1ZG6 A;  2NQB D;  3PBT A;  4J8W C;  1K56 D;  1P3G C;  3PAE A;  3BM6 A;  5U47 A;  1M18 D;  4XZQ C;  4KHA B;  3AZJ B;  2PBY A;  1NZO A;  3IQA A;  3QNC A;  4ZUX A;  3H0R C;  3FZC A;  3N4I A;  3RXX A;  5B1M A;  5AV9 A;  3KXB C;  1YUE A;  1FCO A;  1TDG A;  2YFW A;  1ERQ A;  2HPB A;  4QNL A;  5B0Z A;  4KG2 A;  4IJE A;  3G4P A;  3IF5 A;  5B2I B;  5CGW A;  5AV8 D;  3AZF D;  4OLD A;  5KDM A;  1MWR A;  3W98 C;  4WMC D;  3IXD A;  1U35 A;  3AZH A;  3W99 A;  3LZ1 D;  5CP6 D;  5E5A D;  1PIO A;  5FA7 A;  3M2K A;  4NZ3 A;  5F99 D;  3B0C T;  4ZUX D;  5GXQ D;  1KX4 D;  3IWO A;  3BYD A;  1PWD A;  1YU4 A;  2PYO C;  5B0Y C;  4S2K A;  3E2L A;  2VGJ A;  3UE1 A;  3NQU A;  3S22 A;  5AQ9 A;  1RGY A;  3A3D A;  2ARO C;  3ZGA B;  4QY6 A;  2ARO B;  3EG5 B;  4J8U C;  4KGC C;  3UY6 A;  2WGV A;  4NK3 A;  3VH5 A;  5HX9 A;  5CXW A;  1P3O D;  3NDG A;  3V5M A;  4YS3 A;  3A6N B;  3ZHH A;  4E3J A;  4H9Q B;  3REI B;  1Q2P A;  4S2P A;  1S32 A;  2W8S A;  2PU4 A;  4YS3 C;  4EBN A;  2HDR A;  4QLC D;  3AN2 A;  3ITA A;  4NZ4 A;  3BEC A;  3MGQ C;  4KZB A;  2RVQ C;  1JFI B;  3C1C B;  1YMX A;  4X55 A;  1LL5 A;  5CP6 A;  1TZY B;  3C7V A;  3LEL D;  1HZO A;  5EVI B;  5F82 A;  4LD9 D;  5JRG B;  2H0Y A;  4LD9 A;  2DQN C;  4OKP A;  2ZMA A;  4M3K A;  2EXB A;  5HFO A;  4JF5 A;  5AV9 B;  5KSC A;  5B2J A;  4XZQ B;  3REK C;  1H3O B;  3OZH A;  3LY3 A;  4RX2 A;  1YQS A;  1R4V A;  5EEC A;  4Z5T B;  3MGR A;  3W98 A;  5DF7 A;  4KZ9 A;  1IKI A;  1PZP A;  4YM6 D;  2HIO C;  1PWG A;  3ZNY A;  1RGZ A;  4JPM A;  4K0X A;  5IHV A;  2V1Z A;  3WKJ D;  3ZDJ A;  3UDI A;  2NZD A;  3L29 A;  5F99 B;  4H9S A;  4WZ5 A;  1LHY A;  4OQI A;  1KX4 C;  2DRW A;  4E3M A;  2XF3 A;  3M6B A;  2PYO B;  2XGN A;  3LZ1 C;  3MKE A;  4OQ0 A;  4Y0T A;  4EO5 B;  4R4S A;  3UTA C;  1CEG A;  3EPJ A;  3N6I A;  5GT0 A;  3RXW A;  3AZM A;  4L0L A;  3V9R A;  1Y54 A;  3X1U A;  3AV1 C;  5CGS A;  3V3S A;  1NXY A;  1F66 D;  4WBG A;  3KUY D;  3LEZ A;  1S0W A;  5DNN B;  1P3I B;  5CPJ A;  4IBB A;  5CED A;  2JBF A;  4NFT A;  3REK A;  1ZLA D;  2XFS A;  1XA7 A;  2WGW A;  4X53 A;  1DJB A;  4GZB A;  4J8X A;  1M18 C;  1P3O B;  1NYY A;  3REJ A;  3AZH D;  3A6N D;  4JXG A;  3WKJ A;  5B40 D;  4IBI A;  4QLC C;  3B6F D;  4WU8 B;  3GR2 A;  2A3U A;  1VQQ A;  1BT5 A;  5FQQ A;  5DNM C;  1TZY A;  1YLW A;  3A1I A;  3MVD B;  4U0X A;  4R8P A;  5M19 A;  3MVD C;  2Y2N A;  1W2E A;  3LEL B;  4H9R B;  5AVC B;  4JJN C;  5JRG A;  3AGE A;  3IWI A;  3UE0 A;  1BLH A;  2YFV A;  4LD9 B;  3ZCZ A;  4JJN D;  4IBG A;  3N7W A;  3PAG A;  1NJ4 A;  4R1G A;  4H9O B;  3DTM A;  3UTA D;  2WZZ A;  4JXS A;  3IP4 C;  4JXV A;  3A3F A;  1FR6 A;  1M18 B;  1A7W A;  1L0D A;  4KQO A;  1BLC A;  5GHZ A;  3LJA D;  5HAI A;  3WRZ A;  1FSW A;  3KWQ D;  4IVK A;  4KGC A;  1XP4 A;  3L26 A;  3AZK A;  3HVF A;  4GOG A;  3GQZ A;  2ZQ9 A;  3UPO A;  1P3I C;  4S2M A;  1CK3 A;  1K4E A;  1PI5 A;  3NY4 A;  5FQK A;  2WAF A;  2HIO D;  3FKW A;  4GNU A;  5B24 A;  4MBF A;  1FCM A;  3VH5 W;  3LZ1 B;  5L2F A;  4XUJ B;  3HLG A;  3IXH A;  3HON A;  2FFY A;  3PBR A;  2P9V A;  3F6T A;  4Z66 C;  3PTE A;  4WYY A;  4MBH A;  2CV5 A;  3GMW A;  3REK B;  4H9N B;  3W4Q A;  4J8X B;  1P3O A;  4Z5T C;  3BFC A;  3REJ B;  3B6G C;  4PPR A;  5CHM A;  2OLV A;  5HL1 A;  1P3O C;  4OPY A;  2ZM2 A;  3HL9 A;  1P3M D;  2IO5 B;  4WU8 A;  3EPK A;  4J8V C;  3AZI C;  1JWZ A;  2Y2K A;  1TAF A;  1YMS A;  2DF4 C;  5GSU A;  4OJL A;  4BQM A;  2CV5 D;  2FJ7 B;  4KZ5 A;  5CPK A;  4MEZ A;  3REH D;  2RIQ A;  1P3B C;  4J8W A;  1BH8 A;  3MVD D;  4GDB A;  5GT0 D;  5AV8 C;  3AZF C;  3VH5 T;  5D3O A;  4ZDX A;  2YFV B;  3MGS D;  5F1G A;  1N1J B;  3LEL C;  4H9O A;  2F8N D;  5B33 C;  3IT9 A;  4B4Z A;  2JSS A;  4JJN B;  4LV2 A;  4O7D A;  4J8X C;  5FDH A;  4AWL C;  3X1S C;  5CPK D;  2ZD8 A;  3WA9 D;  5DTT A;  3LJA B;  2J8Y A;  2Y2H A;  2Y2Q A;  2XDM A;  1E3U D;  3PBN A;  1EQZ B;  5FSR A;  1K6R A;  4X23 B;  5BNV B;  4YM6 C;  1N4O A;  5E2H A;  1MWT A;  5EVL A;  1HQ3 B;  4G92 C;  2J9O A;  2BG1 A;  3AZI D;  3NQJ B;  5AV6 B;  3B6G A;  4C3Q A;  4X56 A;  4XUJ C;  3IF6 C;  1BLP A;  4GD6 A;  4IBX A;  4Z66 A;  4OLG A;  3H0L C;  4DQY B;  3ZG0 A;  4OQH A;  4QY5 A;  3MGQ B;  2H0T A;  3B3X A;  2WK0 A;  3X1U D;  4QLC A;  3VOY A;  3WTP B;  3BLM A;  1MBL A;  5HAP A;  5BOH A;  5EVI C;  3AFA B;  3REJ C;  2X01 A;  5B2I A;  4OP8 A;  1TAF B;  4MBK A;  4QB8 A;  2Q9M A;  4ZJ1 A;  2RL3 A;  5B40 C;  3AZL D;  1P3B A;  3AZH B;  4IBR A;  2ZY3 A;  2XR0 A;  5B1L A;  1P3M C;  3AZM C;  1BH8 B;  3LZ0 A;  4DDS A;  5M18 A;  4GB7 A;  4XUX A;  5FQJ A;  5GT3 B;  5DF8 A;  3I7J A;  5AVC C;  3NQU B;  3ZG7 B;  3WAA C;  4DF6 A;  3B0C W;  3W98 D;  3G2Y A;  4EQI A;  1P3K B;  5CPI A;  1DJC A;  3SS5 A;  3WWX A;  4WNN B;  4NE5 A;  1ERO A;  4R3B A;  4CPK A;  3X1S B;  4LV1 A;  4ZUX C;  4Y0U A;  1IEL A;  3GRJ A;  2J8P A;  2QMI A;  4ZJ3 A;  1ZKJ A;  3AZJ D;  4BEN A;  2IOU A;  4NE3 A;  5FAQ A;  2BYK B;  4OPZ A;  3KWQ B;  2Y2M A;  1GA9 A;  3HLF A;  1BLS A;  1HQ3 A;  5DNN C;  1KX5 C;  1I2W A;  3MZE A;  4KUD D;  1Z2C B;  2GDN A;  4MLL A;  3B6G B;  3DWK A;  4JXW A;  4OVD A;  5B2I D;  4HBU A;  4RYE A;  1HQ3 D;  3WS4 A;  2OLU A;  3IHB A;  3VFH A;  1ID3 C;  3UTB D;  1HTZ A;  1P34 C;  3MFD A;  1BZA A;  3C1C A;  3Q7Z A;  5CP6 B;  3AZH C;  1K25 A;  3AZJ A;  4XUZ A;  1I5Q A;  3AZM D;  5F99 C;  5CHU A;  4P85 A;  4IBD A;  3MGQ A;  3CMZ A;  4XUJ D;  3AYW D;  3AZK C;  4PM9 A;  4GHL A;  2XK1 A;  3HUO A;  5TFQ A;  3REL C;  3JYI A;  1AOI C;  3AV1 D;  4OJO A;  3REL D;  5A93 A;  1NYM A;  4P87 A;  3FV7 A;  3AFA D;  3MXS A;  3QNB A;  3C4P A;  3O62 C;  3ZVW A;  2WKE A;  4QU3 A;  3AFA C;  4WJ3 C;  1FOF A;  4LCM A;  3TU4 D;  3AV2 C;  1P3F D;  4PM6 A;  4LV3 A;  3DWZ A;  1B6W A;  5AQ7 A;  3KWQ C;  2Y2G A;  5F99 A;  5B24 D;  2OSU A;  4KUD C;  1K6S A;  5B2J C;  2PYO A;  3VP1 A;  3VP2 A;  4Y7P A;  3KXB B;  3REH A;  4E6X A;  4BL3 A;  3UTB A;  4GHA A;  3KFU G;  4CSR B;  3C1C D;  5GT0 B;  5BNX B;  4WNN A;  1W8Y A;  1ID3 A;  3WAA B;  2HUE C;  4BL2 A;  3EQV A;  3MNN C;  3P09 A;  3SH8 A;  3X1S D;  3W97 B;  2XD5 A;  2RCX A;  3IH9 A;  3OPR A;  4NZ5 A;  3AN2 B;  4P6B A;  1OME A;  1P3G D;  2ZM0 A;  3MGP D;  4Y0O A;  4DE1 A;  4OOL A;  4XZQ D;  1KDS A;  4UA7 A;  1JFI A;  3IF6 A;  3PBQ A;  1EQZ D;  1VM1 A;  3LY4 A;  4KZ4 A;  5B0Z C;  1PWC A;  3AZG D;  3C1B B;  1KX5 B;  4WU9 D;  1JTD A;  1ID3 D;  2JCH A;  4JKT A;  3W96 A;  1M40 A;  1JWV A;  3G34 A;  5AV6 D;  3OCL A;  3A1K A;  5G18 A;  3FKV A;  2IWD A;  4H9R A;  5AVC A;  4XZQ A;  5HAQ A;  4GD8 A;  5DF9 A;  4Z5T A;  3AYW B;  1H5X A;  1KGF A;  4DRB A;  1GA0 A;  1Q2Q A;  1CI9 A;  1PW1 A;  4UPK A;  4KG5 A;  3MGQ D;  3Q1F A;  1O7E A;  3IWQ A;  3KUY B;  3BFF A;  1GHI A;  2NZD B;  1P3K C;  4J8W D;  5FAO A;  5AV8 A;  3AZF A;  1ZLA B;  1BH9 A;  1XX2 A;  3A3J A;  1BTL A;  3AZN A;  3SH7 A;  1MPL A;  5CTN A;  4WZ4 A;  5B1M D;  3W96 D;  4OPQ A;  5B40 B;  5FAP A;  5B31 G;  5B24 B;  1YU0 A;  3V9R B;  3B6F B;  2HP6 A;  4B88 A;  3NIA A;  3N3F A;  5AY8 B;  3V3R A;  5DNM D;  4LG2 A;  3W4P A;  1MWU A;  2DNS A;  2WGW B;  3AZE D;  2BYM B;  4YM6 A;  4KZ6 A;  3WX7 A;  5M1A A;  1E3U A;  3GTC A;  3UTA B;  4G91 B;  1TDL A;  3MZD A;  5AV5 A;  3LCE A;  2HDS A;  3WS0 A;  3MVD A;  1H8Y A;  4RVA A;  1JWP A;  4OJP A;  1IYP A;  4LV0 A;  2ZY5 A;  3LEL A;  3C1B C;  3CG5 A;  5GSU B;  3V39 A;  4S2J A;  3FYZ A;  4J8U B;  4KUD A;  3FKE A;  2XLN A;  3X1T C;  4WEL A;  2I72 A;  5AV6 C;  3OPL A;  5CPJ D;  4MNR A;  3Q81 A;  4PM7 A;  1M18 A;  1S32 D;  4UUZ B;  5AVB B;  4FCF A;  3UDF A;  5F1F A;  3AZK B;  4J8V A;  4WU8 C;  3AYW C;  1YLT A;  2HUE B;  1U60 A;  4OON A;  1WWI A;  5B32 C;  4UA6 A;  3W8K A;  4YS3 D;  4XXR A;  5GXQ C;  1P3P C;  4Q8I A;  1P3B D;  5EUA A;  3OCN A;  5G49 A;  5B31 C;  5AV8 B;  3AZF B;  1ZLA A;  3AV1 B;  5FI7 A;  2NZD D;  1LLB A;  2QZ6 A;  4WV4 B;  3LZ1 A;  3BFD A;  2Q9N A;  1K54 C;  5B40 A;  4ZUX B;  1O07 A;  3O88 A;  4R0Q A;  5B1M B;  4E3I A;  4BLM A;  3O86 A;  2ZQ7 A;  1M19 B;  5CPI D;  1K4F A;  5AY8 A;  1ERM A;  3BLS A;  3X1V C;  2CV5 B;  2FJ7 D;  5HW3 A;  4PM5 A;  4U0T A;  5AY8 C;  3L2A A;  3B0D B;  2J9P A;  4B4X A;  3HLD A;  4OOM A;  3ZG9 B;  3X1V A;  5EOO A;  5B32 B;  1U35 B;  1KE4 A;  4G92 B;  4N92 A;  5CPJ C;  2E8I A;  1LI0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...