2BG1A

Active site restructuring regulates ligand recognition in classa penicillin-binding proteins (pbps)
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
484
structure length
455
Chain Sequence
ITYDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTNQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PENICILLIN-BINDING PROTEIN 1B
publication title Active Site Restructuring Regulates Ligand Recognition in Class a Penicillin-Binding Proteins
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Peptidoglycan
total genus 147
structure length 455
sequence length 484
ec nomenclature ec 2.4.1.129: Peptidoglycan glycosyltransferase.
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2bg1A01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2bg1A03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2bg1A02
1YLTA 1NYMA 4LV0A 4EQIA 3MXSA 1FSYA 5HFOA 4EWFA 4RX3A 4RYEA 5CHMA 4E3NA 1ES2A 4E3OA 3W4QA 1G68A 1L2SA 2BG1A 5CGXA 3IH9A 3IH8A 1LL9A 5CERA 4X6TA 2JE5A 5CEDA 4OQHA 3V39A 2E8IA 1LLBA 1GHMA 3HREA 3B3XA 5A93A 4HBUA 3OPPA 3ISGA 1HZOA 4WZ5C 3UPOA 3CG5A 1KE3A 4MLLA 3RXWA 3MZEA 2HPBA 4OLDA 4GD6A 3SS5A 3ZG5A 3FWLA 2HDSA 3PBRA 2P74A 2WZZA 5CHUA 4IVIA 4UAAA 5BOHA 3G4PA 4X69A 4X68A 4N9KA 2C5WB 3MKFA 5FAQA 3HLDA 1C3BA 3IXBA 1CI9A 3LEZA 3PBQA 2DNSA 5FQIA 2J9PA 2JBFA 1KGEA 2Y2PA 4KZBA 1ERQA 3N8SA 2DRWA 4N1XA 3VSLA 4E3KA 5EVLA 5GHYA 1MY8A 4RX2A 3RJUA 3UPNA 4U0XA 2A49A 3OCNA 4K0WA 3IXGA 4E6XA 1H8YA 1BLCA 4OOLA 2ZQDA 4X53A 5EE8A 1ZKJA 3BLSA 3M2JA 3VP2A 2H0TA 4OH0A 1XXMA 2ZM0A 2IWDA 2Q9MA 3IT9A 3IWQA 4WM9A 4WMCD 3PTEA 4B88A 5A92A 1XKZA 5HAPA 3VP3A 2EX9A 1IELA 1PI4A 1H5XA 4FH4A 1TDGA 2HP9A 4E3JA 4WEJA 4KZ9A 2HDQA 2ZD8A 3OC2A 2XH9A 3N8LA 2J9OA 3LCEA 3W8KA 3BFDA 3TG9A 1TEMA 5GHZA 3OPLA 2EXAA 5CXWA 1KE4A 4P6BA 2BLSA 4BJPA 4ZJ2A 3BYDA 4H8RA 3WS2A 5JYPA 1JTGA 3PBSA 3M2KA 3M6BA 3SOIA 2UWXA 4U3TA 3ZDJA 1IKIA 4RVAA 3ZGAB 5FASA 4NK3A 1XA1A 2EFXA 5E2EA 4KG6A 4DDYA 1W7FA 5IHVA 3SS3A 3IWOA 4PM9A 3OPRA 2XFSA 2WK0A 4C6YA 2Y2JA 3FKWA 2ZMAA 1QMEA 4MBKA 5FQQA 3AGFA 1Q2PA 4GDBA 3EQUA 3IWIA 3V5MA 3VOYA 3D4FA 1K56A 1YMXA 2ZC4B 3Q1FA 5M19A 1BLPA 1Y54A 5FATA 3G35A 3BFEA 1L0FA 5E43A 2WGVA 2XR0A 2XD1A 2QZ6A 1PYYA 1RCJA 1N4OA 1RGZA 5F1GA 1K57A 3O87A 1CI8A 4HBTA 4HESA 3A3DA 4HEFA 4KQQA 1IEMA 4DXCA 5EVIB 2A3UA 4GZBA 4Y0OA 2JCHA 3E2LA 3MZDA 4QU3A 1L0GA 1LL5A 1WE4A 3P09A 4MBHA 3UDIA 1RP5A 4KQOA 4BL3A 2WAEA 4JXGA 5FAOA 5E2GA 5DVAA 3BFCA 5G18A 3BLMA 1GHIA 4OOYA 3V3SA 3W4OA 2WGWA 4Y0TA 3ZG9B 3G31A 3GMWA 1GHPA 4E3MA 5A91A 3HUOA 1NY0A 5FA7A 5KSHA 3MFDA 1BLSA 1G6AA 4PM8A 5FQKA 4QJGA 4EUZA 2VGJA 5EPHA 2EX8A 3NC8A 1YLWA 5AQAA 4OP5A 2V2FF 1J9MA 1MWRA 4JXVA 3GR2A 1ESIA 1DY6A 2EFUA 4X55A 4BENA 4QY6A 4JPMA 4DDSA 3MZFA 3HLEA 3IF6C 4PMAA 3UN7A 3ZNTA 1KVLA 3BFGA 1IYQA 3NY4A 3BM6A 3S1YA 1YMSA 2H10A 1ZG6A 3N7WA 1LI9A 2XD5A 3WWXA 1QMFA 2Y2HA 1K54A 4F94A 5EOEA 4KZ8A 1YT4A 5GLDA 1PZOA 2WGWB 5TFQA 1MPLA 1BLHA 3WRTA 4S2NC 1BULA 2ZC5B 4YINA 3NIAA 2R9XA 2PBYA 2HDRA 4PM6A 2X02A 3UY6A 5FQMA 5KZHA 1BTLA 5FI2A 3ZVTA 3GV9A 5CTNA 4E3IA 4GD8A 4BQMA 1NRFA 4DKIA 1JTDA 1O07A 3UO9A 1K38A 4L0LA 5FAPA 4OLGA 3WS5A 5KSCA 1E3UD 4FCFA 3ZG0A 3O3VA 4MEZA 4XUXA 4S2OA 1KE0A 2G2UA 5U47A 2FFFB 4PPRA 2RL3A 3QNCA 4C75A 1GA9A 1K57C 3N8RA 2EX6A 3UNWA 1I5QA 3G2YA 4PM7A 2QMIA 2Q9NA 4IBRA 4R4RA 3S4XA 3WRZA 5E2FA 5EUAA 1WYCA 4WZ4A 1ES5A 4WEKA 3LY3A 1MWSA 2EX2A 5CRFA 1FSWA 5EOOA 1EWZA 3S22A 3UE1A 1K25A 5HW3A 1DJCA 3UE3A 3DTMA 3A3FA 5GLAA 1EI5A 4JXWA 5HAIA 2HP6A 4MBFA 1IYSA 4X56A 2XK1A 2Y2OA 2XF3A 2XQZA 1YLPA 4ZJ3A 4BLMA 5CHJA 4KZ3A 4CJNA 4OPYA 5F1FA 2WKIA 5F82A 3Q82A 4EV4A 1FQGA 1VM1A 1FCNA 2WKHA 3ZFZA 5EVIA 4Q8IA 5HARA 3NDGA 3VP1A 4S2LA 4E6WA 1XP4A 1ES3A 4WYYA 3C4OA 3GTCA 1PWGA 4OKPA 2V20A 4QB8A 3M6HA 4PM5A 3CJMA 1H8ZA 3HLGA 4KG5A 4U0TA 4GNUA 1KDSA 4FSFA 2XFTA 3W4PA 2Y59A 3O88A 3Q7ZA 4KZ7A 3HLFA 1GCEA 3VFFA 3HLWA 3DW0A 3FZCA 4DF6A 3GSGA 4K0XA 1LHYA 3A3JA 3BECA 2H5SA 2ZC6B 4N9LA 4R1GA 4C3QA 3OPHA 4DE2A 1PZPA 3NDEA 1VQQA 1OMEA 1Q2QA 3FYZA 4FD8A 1IYPA 2XDMA 1ZG4A 1DJAA 3BFFA 4UA7A 2ZC7A 1PI5A 4WELA 4D2OA 3ZG7B 5GHXA 4KZAA 1M6KA 1GA0A 4XXRA 5HAQA 2Z2MB 3CMZA 3HBRA 4WMCA 1S6RA 1IYOA 1BT5A 4KENB 5M18A 2WYXA 1KGFA 1W8QA 2ZQ7A 3RXXA 3OCLA 2J7VA 3VFHA 1W79A 2ZLYA 1XGJA 4IVKA 4OQ0A 2WGIA 2ZM2A 3HVFA 4LCLA 3ITBA 1W5DA 1YM1A 4IBXA 1W8YA 1CEGA 1XGIA 3C7VA 5DTKA 1S0WA 1FR1A 1ONHA 5A90A 1FR6A 3MKEA 3VMAA 1E25A 1DJBA 1JWVA 3GRJA 1WYBA 3GQZA 3HUNA 3IXDA 4P0MA 4BL2A 3IHAA 1K6RA 1KDWA 1I2WA 1PW1A 1SDNA 3C5AA 4ZJ1A 1CK3A 4UHUA 3UPPA 4GB7A 5DF9A 4N92A 4R4SA 3PBNA 4BD0A 3Q7VB 1MBLA 4KQRA 4JLFA 3C7UA 1EROA 1JVJA 3ZNYA 3SH7A 1ONGA 3WS1A 4UA9A 3GVBA 5EVIC 3LY4A 4KZ6A 2Y4AA 1YLZA 4FH2A 4ID4A 4MNRA 4JF5A 3EQVA 4A5RA 4OONA 2OLUA 1NXYA 4Y0UA 2C6WB 4GKUA 5GLBA 3AGDA 1MWUA 1NYYA 3Q81A 1SCWA 2G2WA 2ZM8A 3N4IA 2R9WA 5FI6A 3VOZA 4DRTA 3V50A 5M1AA 4R0QA 4UA6A 1Z6FA 4WBGA 1YLYA 2QPNA 3SH8A 4BD1A 2WKEA 3QHYA 2VGKA 5GL9A 5JYOA 2CC1A 5GLCA 2EXBA 2B5RA 3IXHA 4GOGA 4IEDA 3NBLA 1KGGA 4OVDA 4ZBEA 2Y2MA 5L2FA 5EVID 1ESUA 2ZJ9A 4LV1A 2I72A 3PAGA 3IQAA 2OSUA 4OQIA 3G32A 5DTTA 2PU2A 1ERMA 3HUMA 1FCMA 5AQ9A 4EBLA 4QHCA 1IKGA 3I7JA 3VP0A 4N1HA 4R23A 4JBFA 3VSKA 5AQ7A 5DF8A 1K56D 1M40A 3BRMA 4S2KA 4YFMA 3ZVWA 4OPQA 1K55A 3FV7A 5CECA 3SS4A 5J8XA 4KZ4A 3HLCA 2Y2QA 2WZXA 3G2ZA 2ZQ9A 4JF6A 2X71A 3ITAA 1TVFA 1K6SA 1FCOA 1PWDA 1N9BA 4JXSA 4DXBA 1CEFA 2Z2LB 3AGEA 3UE0A 1RGYA 1K4EA 2XGNA 4OP8A 4OQGA 1ES4A 4GDNA 2ZQCA 4JF4A 3PAEA 1JWZA 1L0EA 1XX2A 3HLBA 3A3EA 4R3JA 5DF7A 1LI0A 1E4DA 1MWTA 3FKVA 4QY5A 1XPBA 3JYIA 5DTSA 3ZHHA 4ZTKA 1KVMA 1YLJA 5HX9A 2ZQAA 2IWBA 1TDLA 3V3RA 3G34A 4XUZA 2JC7A 4OPRA 1PIOA 3IHBA 3PBOA 2WADA 3IF6A 1K4FA 4KG2A 2ZQ8A 3G30A 4NETA 1K54C 2H0YA 3A3IA 4P85A 5D3OA 3SH9A 2DCFA 3DWKA 4GN2A 4QD4A 3TOIA 4EBNA 2FFYA 2Y2KA 4B4XA 1AXBA 1E3UA 2Y2IA 1L0DA 1XA7A 1NJ4A 5CGSA 2IWCA 2Y2GA 1FOFA 3LO7A 4WZ5A 3ZCZA 4R3BA 4K91A 4B4ZA 3Q07A 4LV3A 5FI7A 3IF5A 4S2NA 2WUQA 3MXRA 4DE3A 5FQ9A 3ZG8B 3OZHA 1HVBA 4ZAMA 4ZDXA 3HL9A 3O86A 4JKTA 3Q7VA 4P87A 2P9VA 3PBTA 5FDHA 4S2JA 2Y2NA 1O7EA 1BSGA 2HP5A 5TGFA 3NI9A 4M3KA 1ZC2A 4OPZA 5F83A 5CGWA 1BUEA 5HL1A 2XLNA 2V1ZA 2Y2LA 4RA7A 2Y55A 1JWPA 5AQBA 4E3LA 1ALQA 1MXOA 4OOMA 3E2KA 3IF6B 4LCMA 3UDFA 2WAFA 1PW8A 4KZ5A 5TR7A 1SHVA 4DE1A 1PWCA 1U60A 3CZDA 5CTMA 5FQJA 4S2MA 2ZC3B 5CEBA 4O7DA 2X01A 1BZAA 1K55C 2PU4A 5FSRA 1SDEA 3TSGA 1YQSA 3WS4A 4DE0A 1NZOA 2RCXA 2J8YA 2GDNA 1MKIA 3P98A 3NCKA 4Y7PA 4EBPA 1I2SA 5I94A 4S2PA 2HDUA 4Z9QA 1HTZA 2Y91A 2OV5A 2XEPA 3DWZA 2OLVA 4CPKA 3C4PA 5E2HA 3WS0A 3BEBA 5EECA 1HD8A 3VP4A 3MBZA 2P9VB 1SKFA 1NZUA 3N6IA 4LENA 4LV2A 3QNBA 5KMWA 3UDXA 4S2IA
chains in the Genus database with same CATH superfamily
2YFVA 2XROA 4E3OA 1OTAA 5CGXA 3IH9A 3IH8A 3F1PB 3AZHA 4X6TA 3K3DA 2OAP1 4XT2B 3VH6W 2PR6A 1LLBA 4IUKA 4PKYG 1DP9A 2D02A 4J8VC 5CPJB 2W1TB 4I3JA 4GHIB 3ISGA 1F9IA 1TD5A 4BMWA 1KE3A 3B6GD 4MLLA 5GSUA 3RXWA 3MZEA 1AOID 4HNBA 3AZID 3C1CC 3SS5A 4YS3B 2VV7A 4X69A 1H0IA 2C5WB 3F1NA 1AIWA 3MKFA 3X1TA 1NRJA 2DNSA 4XUJC 4AWLB 4DQYB 1KGEA 3REHB 3MQQA 3UPNA 3T4OA 4NG2A 3JPUA 4I3AA 2F8NG 3VE4A 1H8YA 2D01A 1FILA 2W3FA 3M2JA 3IWQA 3UTBC 5A92A 4B88A 5GXQD 4CLCA 5HAPA 1P3BB 4AFIA 4FH4A 1EQZB 3LEQA 4E3JA 1VEUA 3MF0A 2K2NA 3BFDA 4WU9A 5GHZA 2EXAA 1XJ6A 1ID3C 2QHKA 4H8RA 4JJNA 1XFNA 1P9WA 3CI6A 3M6BA 3IS2A 4RVAA 2F8ND 2EFXA 5E2EA 3AZFC 3UB9A 2Y2JA 5AVCA 3FKWA 3WKJB 2ZMAA 4GDBA 2AROA 3D4FA 1K56A 3A6NB 5M19A 3CITA 4ZRRA 3G35A 3W2ZA 3UB5P 2WGVA 1N4OA 5B0YB 1GSXA 5EVIB 2A3UA 4GZBA 2F8NH 5A8BA 1P3GA 5HWWA 1GSWA 1E88A 5DVAA 5G18A 3X1UB 3REKC 3W4OA 4Y0TA 1P3LC 1P97A 3W97B 3MGRC 3MFDA 1BLSA 2NZDD 1PRQA 4PM8A 4EUZA 3C1BA 4NE3A 4ARZB 2EX8A 3A0SA 1YLWA 3H0LC 5AQAA 1SZVA 4XZQD 3X1SC 3GR2A 2L0WA 1DY6A 2Y8HA 4JPMA 4DDSA 5B40A 2GNXA 5GT3D 2W0NA 3MMHA 3IF6C 1TZYA 5KDMB 3A1KA 4HGAC 3ZNTA 3OOVA 3LR0A 3BM6A 3X1VC 2P08A 1YMSA 3N7WA 1DP8A 5EOEA 1YT4A 2WGWB 3WRTA 4S2NC 3MVDC 2ZC5B 3NIAA 1VHMA 2PBYA 3E4OA 4PM6A 3ZVTA 2HGVA 2A24A 3DBAA 5B0ZA 1UR9A 5BT1D 2JKTI 4L0LA 4FCFA 3ZG0A 3O3VA 4XUXA 4J8VD 5U47A 2RL3A 1F66A 3QNCA 1GA9A 1K57C 3T4SA 3UNWA 3NOTC 4PM7A 1V9ZA 2Q9NA 3WRZA 5E2FA 2HUEB 4YNRA 5CRFA 1M1AA 3B6FA 5AV8B 2PHYA 3WD1A 1EWZA 2W3GA 4XUJD 3UE3A 2FZ0A 1EI5A 1MC0A 4JXWA 5HAIA 1LSVA 1P3AD 1P3IB 5DNMC 5B33C 2XF3A 4ZJ3A 5AVBC 3WA9B 3W96C 5B31B 4OPYA 5CHJA 5F1FA 3AV1D 5F82A 1FQGA 2WKHA 1FCNA 3ZFZA 4Q8IA 3UTBD 3NDGA 4YM6B 1PWGA 1AOIA 2M7UA 4QB8A 1OPXA 3M6HA 3AZIA 3LFVA 4PM5A 2KOIA 4DJ3A 3AZNC 5IU1A 2J80A 5B2IC 5MC7A 4IBGA 1ID3D 5CPKA 4KZ7A 4R8PC 5GSUC 1GCEA 4ZUXD 4R6LA 4DF6A 5B1LA 2YFWB 4R1GA 2HV1A 1V9YA 4O01A 3FYZA 5CX7A 2XDMA 1ZG4A 4PKYA 4UA7A 2ZC7A 4WZSB 4WELA 3ZG7B 3X1TC 4XXRA 4H9SA 2B02A 2FJ7D 3HBRA 1YSPA 4H9NA 5GXQA 3KSFA 4Z66B 3B0CW 4KENB 3UMDA 4MB5A 1N9OA 4WU8C 5M18A 1YU1A 2J7VA 5CPID 4WJ3C 2JKRM 4Z2GA 1PZRA 2ZM2A 5F68A 4LD9C 4JGQA 1VETB 2ZY4A 1CEGA 1XGIA 1GXDA 4MN7A 1FR6A 3O62B 3MGQD 1DJBA 3P7NA 3GRJA 3HUNA 1W1YA 3W99B 4KUDB 3IHAA 1KDWA 5AY8C 1SDNA 3C5AA 1O6IA 4ZJ1A 1CK3A 5DF9A 1JNUA 4H9QA 1P3PB 1MBLA 4KQRA 1F5MA 1EROA 3KUYD 2Z6CA 5AV9B 3GVBA 4X23D 1YLZA 4ID4A 3UTAB 4JF5A 5GT0B 3EQVA 4A5RA 4Q0IA 2PDRA 5GLBA 4O0PA 3AGDA 1MWUA 5AVCC 3AZLB 2ZM8A 3N4IA 2AROC 4UA6A 4BD1A 3K2NA 2FN2A 5JYOA 1P34B 3L28A 2CC1A 2EXBA 3NBLA 3AZJA 1KX5B 5F69A 1HQ3C 4PHTA 1G28A 3PAGA 5G4ZA 3NJAA 4I3IA 4OQIA 2PU2A 1SKOB 3HUMA 5AQ9A 4Z2MH 1IKGA 3I7JA 3LIFA 4Q0JA 3VSKA 3LZ0B 3AZMB 1M40A 3FPWA 3ZVWA 4OPQA 2PYOD 2V8FA 3HLCA 2JSSA 3AYWB 4E04A 4J8UC 2EA9A 3G2ZA 5C5KA 5E5AD 1Y28A 5GT3A 4JXSA 1CJFA 3C1BC 3LZ1B 1CEFA 1TF1A 2Z2LB 2PR5A 2IOUA 1XJ4A 1T1BA 3PAEA 3RELA 5G49B 1JWZA 1L0EA 3HLBA 3B33A 3MQ0A 5B40C 1KX4B 5DTSA 1TZYC 2F2AC 4ZTKA 1M18D 5HX9A 1ZHHB 4XUZA 2JC7A 3PBOA 4HH3A 4RQ9A 5C3IC 4UQIS 1K4FA 5AVBD 3A3IA 5D3OA 3W96D 4QD4A 2BYMA 3TOIA 1E8BA 2O99A 4J8VA 4WNNB 5CGSA 3AZGC 4NZ5A 3IX3A 5FI7A 3H7WA 5B0ZC 3MXRA 4WUJA 5FQ9A 4ZAMA 4JKTA 5B24C 3CLOA 4P87A 5B2ID 4L9EA 4S2JA 1H3OA 1BSGA 3VOLA 5B2JD 1OT9A 1KU5A 2LY8A 5AVFA 5HL1A 2Y2LA 4UEYA 4IHQA 4XUJA 2Y55A 5AQBA 2WAFA 1P3AA 1U60A 5FQJA 1CQAA 4NE6A 3RFBA 2ZC3B 1DRMA 4O7DA 5HWTA 1BZAA 4JJNB 2X01A 5CEBA 3B6FC 1SDEA 2RCXA 3AZEB 4Y7PA 5AV6D 3AV1A 2RTSA 1S4RA 3UTBA 1HTZA 4CPKA 5E2HA 3WS0A 1E15A 3PXPA 1B6WA 3MBZA 5CP6D 1SKFA 5B32B 4YOFA 4LENA 3FG8A 1LL8A 5KMWA 3UDXA 1ID3A 1P3MD 3MJQA 1NYMA 3B6GC 3VH5W 2INWA 4LV0A 4GLQA 4ZUXA 1FSYA 3AZIC 1P0ZA 3R7WB 5AY8D 2F8NK 3KXBB 2DMWA 1LL9A 3LELB 4LFUA 5F99B 4IBKA 4OQHA 4HI4A 3HREA 3LJAB 2FJ7A 5A93A 4HBUA 3OPPA 3UPOA 3CG5A 2VJWA 4GD6A 4G91C 3BQ8A 5CPIA 2ZM5A 3FWLA 3JVUA 2HDSA 4H9SC 2P74A 2WZZA 5B1MB 3MNND 5BOHA 3G4PA 3KWQD 4N9KA 5FAQA 1C3BA 3LEZA 3AFAC 1CI9A 4G92B 1HQ3D 4HMEA 4Z5TB 4QLCD 3LICA 3N8SA 2D49A 2DRWA 5F6AA 3VSLA 1MY8A 4RX2A 3RJUA 2O0YA 3B0BA 2Y79A 1ODVA 3MGPD 1ZLAB 3OCNA 2W27A 4NZ4A 4OJOA 3TU4D 1S32D 3KUYA 5JRGB 1P9RA 3MGSD 3IT9A 3REID 1A0KA 2IWDA 2Q9MA 3BW6A 1P3FB 1CXWA 3QP8A 3TW8A 1XKZA 2IO5C 4X23A 2HP9A 4WEJA 4KZ9A 2ZD8A 2XH9A 3N8LA 3LCEA 3W8KA 3REJB 3TG9A 4UUZB 4P6BA 1UGUA 2Q0OA 1W1PA 3OBFA 3WS2A 5JYPA 4U3TA 4GS9B 5FASA 4NK3A 4KG6A 5IHVA 3IWOA 4F3LB 3OPRA 2XFSA 5FEFA 2CV5B 3MVDA 5FUGA 2VKSA 5FQQA 1M1AB 1Q2PA 1E6ZA 4O8GA 3EQUA 3T12B 4X25A 1YMXA 3Q1FA 5L8MA 4M6BA 1Y54A 1KX3D 2PYOA 1G6OA 5TBMB 2XR0A 5E5AA 1PYYA 1RCJA 3W98D 5F1GA 1K57A 2NZDC 2K7SA 3FC7A 3O87A 4HESA 4HEFA 2OOLA 3A1IA 4KQQA 3WD4A 1W2EA 5B24D 4XZQC 3FKEA 4ZBJC 3MZDA 3E2LA 5DNNB 4QU3A 3AV2B 3P09A 3UDIA 3MXQA 4JXGA 5GT3C 5E2GA 4OJLA 1M18A 3MQLA 3V3SA 3G6OA 4E3MA 5A91A 1NY0A 3AZKD 5CPKB 1G6AA 1M19B 5AVBA 2G5IC 3NC8A 3S7QA 5B1LB 3A6NC 3W96A 1J9MA 2V2FF 1MWRA 3EEAA 3PHYA 1ESIA 3WAAD 2VGLS 3MZFA 3O5YA 2W3HA 4G3WA 5BT1C 3S1YA 3AZNA 2B95A 4H9NB 5B2IA 1LI9A 3IX8A 1LSXA 4KZ8A 5B2JA 5GLDA 1PZOA 4R8PA 4JGOA 3NQJA 1BULA 4KHAB 1ULYA 5DJUA 2V1AA 2X02A 3UY6A 5KZHA 5FI2A 4M4XA 2K31A 5TJJA 4J8XD 4GD8A 1NRFA 2NQBB 5HPIA 3AN2B 1K38A 5FAPA 4OLGA 3B47A 5J7EA 2J8PA 5AV6A 1E3UD 4HMDA 1N9LA 4S2OA 3T1QB 4PPRA 1P3AC 4HQAA 4H9QB 1MZUA 3KSIA 1I5QA 4WU8A 4KGCD 1G5UA 3H0MC 1P3KB 4IBDA 2VK3A 4R4RA 5CP6A 3L2AA 1J3WA 3AV1C 4EEPA 1MWSA 5BNVA 4LD9A 1FSWA 3AFAD 4LG2A 3UT9D 1P3MA 3KS4A 3S22A 3LGOA 5GLAA 5AY8A 4MBFA 1IYSA 2XQZA 3AZJB 4H9OA 4KZ3A 1YU4A 4ZUXC 4EV4A 1ED7A 4HHDA 4IBEA 4S2LA 5CPJD 3F1OB 3GTCA 1JFIB 2QJ7A 3ULFA 4OKPA 4UQIM 2L1MA 3DAVA 3HLGA 1U35B 3UB8A 4YS3D 3MNNA 2FJ7C 4GNUA 4II7A 2DF4C 3S7PA 2XFTA 1YPRA 3KWQA 2HUEC 2Y59A 3O88A 3Q7ZA 3HLWA 4EUVA 3DW0A 3FZCA 1GSVA 5CPIC 4HP9A 1HQ3A 3A3JA 3BECA 4DJ2A 2J3WA 4QLCA 4C3QA 1OMEA 4NEED 1IYPA 3WTPB 4DRBA 3MGPA 3REHD 4D2OA 1BYWA 5GHXA 1M6KA 3TU4A 3MGQC 3RELB 1S32A 4HOIA 1P3OB 2Z2MB 3MGSA 1S6RA 3R45B 1IYOA 1L6JA 1BT5A 4G3VA 2WYXA 1KGFA 1W8QA 3P5JB 1P3BD 2A2LA 4J8UA 3OCLA 3RXXA 2V1BA 3EWKA 5KIZA 1W79A 1EQZD 3KUYC 4OQ0A 2WGIA 1YU0A 3L27A 3HVFA 1YM1A 4IBXA 1W8YA 1FR1A 4X23C 3LI8A 3NQUA 3MKEA 1OGBA 3VMAA 3GQZA 3IXDA 2KDKA 5LBRA 2EWWA 1K6RA 1X0OA 1I2WA 1PW1A 3H7WB 4MMNA 3LIDA 2GJ3A 2P04A 3L9KA 3C1CB 4GHLA 4G3KA 4GB7A 1TAFB 5F5YA 3CHWP 1JVJA 3ZNYA 3LR4A 3KYQA 3WKJD 4KZ6A 4FH2A 4EESA 3A6ND 1KX3A 2C6WB 4GKUA 1S66L 2BYKB 1NYYA 3VOZA 3AZGA 2ZL1B 2JKRI 4B93A 5B0YD 2QPNA 4J8WB 3QHYA 2PYOC 3LI9A 5GLCA 4ZBEA 3IXHA 4LRYC 4JGRA 1KGGA 5L2FA 5B24A 2Y2MA 3BY8A 5EVID 1ESUA 5E5AC 2ZJ9A 4LV1A 5JA4A 4OUIA 4NY2A 5HPFA 5L09A 3IQAA 3GECA 5DTTA 1ERMA 1FCMA 3X1UD 4QHCA 3LUQA 3VP0A 1P3PC 4N1HA 2W1RA 4R23A 3AZKA 3W97D 4S2KA 5AV9C 3S7NA 5CECA 1M18C 3FDDA 2QKPA 5GT0C 2Y2QA 3ITAA 3AZFB 3WD0A 3C30A 3N3FA 3V67A 4DXBA 2V9AA 3UE0A 5HWVA 5BO0A 1K4EA 4OQGA 3A3EA 1LI0A 4H9PA 4HH2A 3HONA 3QP4A 3ZHHA 3B6GA 1KVMA 5DFYA 4EERA 1YLJA 1TS0A 2ZQAA 2IWBA 4KUOA 3T4JA 1PIOA 1FIKA 2WADA 3EPHA 2ZQ8A 3G30A 4J8XA 1H8MA 4HJ6A 5FL3A 5B2JC 3SH9A 2DCFA 4GN2A 2FFYA 1OGGA 2KLIA 2PD8A 3T1XA 3TE8A 1BH9A 1E3UA 4I38A 1NJ4A 4H6JA 2IWCA 4MB3A 3REKB 2PAVP 5B31G 2E8JA 2HJ9C 4Y17A 1P3LB 4B4ZA 3IF5A 4KGCA 3MGRB 4DE3A 1HVBA 3LZ1C 3O86A 3Q7VA 2P9VA 3PBTA 5AV6C 2Y2NA 4FUWA 1KOUA 2V0UA 3X1SB 1BUEA 3AFAA 3SW1A 4Z2MG 3UT9A 1T1AA 2AVXA 2V1ZA 5AV8D 1MXOA 5CP6C 3E2KA 3IF6B 4LCMA 3UDFA 1PW8A 3C8CA 1PWCA 5CTMA 4MN6A 1YU2A 1P3ID 4H9RB 3X1VB 3TSGA 1P3MC 1YQSA 2V0WA 3WS4A 1PNEA 3F1PA 4XT2A 2ZY2A 5AV5B 3WA9D 3T4TA 5B31D 4EBPA 4S2PA 3L29A 2HDUA 1T3UA 2XEPA 2F8NA 3MVDB 1BH8B 5CPJA 2W1TA 4GHIA 4YM6D 1NZUA 2HIOB 4WL9A 3BJNA 4Z2IA 2W3DA 3H82B 4YS3A 3QNBA 4S2IA 3KO6A 1A7WA 1N1JB 2VGLM 3MXSA 5HFOA 1ES2A 3MNNC 1DP6A 1H8PA 3KWQC 3REHA 3KSHA 3V39A 2E8IA 1YSQA 5BNXB 4QLCC 1HZOA 3QP1A 2WKRA 4IJEA 3K3CA 2HPBA 3MGPC 4Z66D 3PBRA 5DNMB 3TU4C 1S32C 5B33B 3V9RB 1EQZA 5CHUA 5B32C 4BWIA 4Z2LA 2NZDA 3MGSC 2YFVB 3REIC 2PYRA 3IXBA 4IBJA 1S4SA 3IBJA 5FQIA 4XZQA 2J9PA 3O62D 2JBFA 2Y2PA 4KZBA 1ERQA 2JN7A 4E3KA 3DTEA 3W99D 3AZHB 4KUDD 2ZMVA 4KUKA 4NXGA 2G7UA 3CPTA 2CWEA 2A49A 3AZNB 3IXGA 4E6XA 2ZOHA 1P3PD 1ZKJA 3VP2A 3CUEC 5F99C 3U2AA 4R8PB 5GSUB 1J7MA 3LYXA 4X1LA 3NQJB 5AV9D 3LJAC 1OJ5A 3A6NA 3VP3A 5AJGA 3UTAD 1WA9A 5GT0D 1H5XA 1TDGA 2HDQA 3KYEA 3F1NB 3AZLD 3OPLA 5CXWA 3X1TB 1KE4A 5B1MC 5B0YA 1KX3C 1UWPX 4ZJ2A 3HCYA 1P34D 2M7VA 2UWXA 1IKIA 2CMNA 4WU8B 1KX5D 1XA1A 3E4PA 2ZBBA 3W98C 1W7FA 4Z5TC 4PM9A 2WK0A 2O9BA 1ZLAC 3NECA 1QMEA 4LD9B 4MBKA 3PYPA 1GPFA 4CLCB 3W97A 4PAUA 1B67A 3V5MA 3VOYA 4E44A 1E6PA 3VH6A 1BLPA 1T19A 3LZ0D 3AZMD 5FATA 5DKKA 1P3FC 1T18A 1VEUB 4ARZA 3L26A 5E43A 3AYWD 2QZ6A 4WU9B 1RGZA 1TS7A 3AZKC 5HD5A 5KDMA 4DXCA 3IS2B 3LZ1D 4L9GA 4Y0OA 2JCHA 1L0GA 4CLCE 1WE4A 4MBHA 3E0YA 3WAAC 4KQOA 5FAOA 3BFCA 5AVCB 3BLMA 1GHIA 4OOYA 1KX4D 2WGWA 3G31A 3GMWA 1GHPA 3E4QA 5KSHA 2AROB 3B42A 1Q9CA 4NYUA 1F98A 2O9CA 2WKPA 2V5OA 4QJGA 1H0GA 2VGJA 4OP5A 1IOUA 4JXVA 2EFUA 5HDDA 1NLYA 1OJGA 3KS8A 3HLEA 4LRZE 4WV4B 3UN7A 4J8XC 4I5SA 1KVLA 1P3GB 3UE6A 3BFGA 4CAYA 1ZG6A 2XD5A 3MS6A 3WWXA 1QMFA 3IP4C 2Y2HA 5EM1A 4F94A 5B32G 4J8UB 1MPLA 2V8CA 5AV8A 4KGCC 1PDCA 3KSYA 3C1BB 3GV9A 4E3IA 3H9WA 4BQMA 4HJ3A 4DKIA 2MJ6A 1O07A 1LT0A 3UO9A 4BBUA 3UT9C 4JJND 3MGQA 5B40B 3WA9A 5B31A 3AZED 1TZYB 1KE0A 1PFLA 2G2UA 2FFFB 4C75A 3KSGA 2EX6A 1D06A 3G2YA 4YM6A 4OJ5A 4NXFA 5C3IB 5B32D 4WZ4A 2EX2A 2ZY5A 3QP2A 3MSHA 3WD2A 5EOOA 5CPJC 1W1VA 1DJCA 1H3QA 3DTMA 3A3FA 3ZQ5A 3AZGB 2HP6A 2A24B 5B0ZB 4IBFA 4YS3C 4P6ZS 2XK1A 1YLPA 3KXBD 4BLMA 4CJNA 3B0DB 3LELD 3Q82A 5F99D 4E45A 1F66B 4NZ3A 1IFQA 3FPVA 5HARA 3LJAD 4HY8A 4E6WA 4AWLC 1ES3A 4WYYA 3C4OA 4B9OA 1ACFA 4L9FA 5DJTA 1VB6A 4Z66A 3REHC 1OTBA 1H8ZA 3CJMA 4GJ4A 1W63Q 3B6FB 1KDSA 2QJ5A 4FSFA 3EG5B 5B1MD 3LIAA 3TJZC 1VETA 3RTYA 4WN5A 1P3BC 1YU3A 3O62A 4MB4A 4NYYA 2ZC6B 1EQZC 4Z5TD 3W99A 4KUDA 1Q2QA 2ZY3A 3BFFA 1PI5A 1ZLAD 1GA0A 3PR6A 5HAQA 1P3PA 1Z2CB 3CMZA 1OTDA 5JRGD 3B6GB 2KX6A 1AOIB 5AV9A 3AZIB 1P3FD 5GT0A 3GDIA 3A0VA 1S67L 1XGJA 2FH5A 3NOUC 3AZLA 3WKJC 1NWZA 3ITBA 1W5DA 3REJD 3C7VA 5DTKA 3R4KA 1P34A 4P0MA 1F66D 1KX5A 2YKFA 4UHUA 4G91B 3HSHA 3NHQA 4N92A 4R4SA 5B0YC 3Q7VB 4GHAA 4JLFA 4EU0A 3D3OA 2CV5D 1SKOA 1AWIA 2BASA 4UA9A 5GXQB 5EVIC 3LY4A 1P3OC 1M1AD 3C38A 3LZ0A 3AZMA 2EWVA 2OLUA 4Y0UA 5K5BA 5I5LA 3MR0A 4LGWA 3X1UC 1F2KA 3AYWA 2R9WA 3CAXA 4EXOA 1EW0A 5M1AA 3W97C 4R0QA 1Z6FA 4WBGA 1YLYA 1S1ZA 3SH8A 5GL9A 4GOGA 4OVDA 3H0RC 3LZ1A 3OLOA 4IBCA 1UWNX 3T50A 2IO5B 2F8NB 4UPKA 4KQDA 5DNND 3AV2D 4OJ6A 1W63M 3L7HA 2OSUA 5G49A 1KX4A 4EBLA 4JBFA 5AQ7A 3EOIA 3T4QA 3BRMA 2W8SA 5CPKD 2VQRA 4IBIA 3FV7A 3SS4A 1M19D 5B1LD 2WZXA 2ZQ9A 4Z2JA 1TVFA 1K6SA 1FCOA 1PWDA 4WNNA 4LRXC 2IA2A 3AGEA 4OP8A 4J8WC 1ES4A 1K0KA 2ZQCA 3T1SA 1XX2A 4Y2FA 4BBTA 5DF7A 3EPJA 1MWTA 1E4DA 4QY5A 3FKVA 1XPBA 2WKQA 3D72A 3JYIA 5FDSA 4HIAA 2NZDB 1ZTUA 2XA7S 4EO5B 4NETA 4XZQB 4ZBJB 3DWKA 2NQBD 2Y2KA 5AV8C 2VX8A 1AXBA 3AN2D 1XA7A 5GT3B 1L0DA 3AZEA 3CPTB 1FOFA 3LO7A 3LR5A 4MCWA 1P3IC 3Q07A 4GW9A 3UB6A 4ZDXA 1P3KD 3HL9A 5HDSA 3EPLA 5FDHA 5B32A 4CQHA 3WA9C 5B31C 5TGFA 3WX7A 3REIA 4CSRA 4OPZA 5F83A 2HJEA 2JKGA 2QWSA 3B0CT 4RA7A 4YM6C 3VE3A 2HF6A 1ALQA 1STZA 4OOMA 1SHVA 3LIEA 2LB5A 4DE1A 4EEUA 3R7WA 3WTPE 2BYMB 1K55C 3KXBA 2PU4A 4DE0A 1NZOA 2J8YA 3AZJD 4J8VB 1MKIA 3LELA 3NCKA 3P98A 4NXEA 1I2SA 3CUEA 5F99A 2Y91A 2RIQA 2OV5A 3LJAA 2ZOIA 4GCZA 5EECA 3VP4A 3JVVA 3N6IA 1H3OB 3LIBA 5CHLB 1U35D 1H0MA 1HLUP 5B1MA 3V3RA 4XUJB 1YLTA 3EGDC 3BWLA 4EQIA 5J3WA 4Z66C 1P3AB 4EWFA 4RX3A 4RYEA 5CHMA 5L07A 4E3NA 2R78A 3W4QA 3W98A 1G68A 4Z5TA 2BG1A 1L2SA 4JGPA 5CERA 3ICYA 4Z2HA 2JE5A 3WTPD 3AV1B 2OWJA 5CEDA 1ZLAA 3UTBB 2RVQD 1GHMA 1D7EA 3O62C 3RELD 3B3XA 1P3OD 5AV5C 5JRGA 4WZ5C 3W99C 4KUDC 3CWFA 1P3FA 5FEGA 4OLDA 3ZG5A 4Z1WA 5HDCA 1N9NA 4IBBA 4OJPA 2YKHA 4IVIA 4UAAA 2HIOC 2VA0A 1ID3B 4R3AA 4X68A 2VZWA 3REJA 3HLDA 3SZTA 4UUZA 4ZUXB 1E6RA 3PBQA 3UTAC 4ETZA 3WAAA 4N1XA 4GS9A 5EVLA 5GHYA 3VV4A 3AZLC 3KX0X 4U0XA 1R4VA 4CAYB 4K0WA 3C1CD 4F3LA 1BLCA 4OOLA 2FJ7B 2ZQDA 4X53A 2CV5A 5EE8A 3BLSA 1P34C 2VV6A 2H0TA 4OH0A 1XXMA 2ZM0A 4WMCD 4WM9A 3PTEA 1KX5C 3D9YA 5CPIB 3KYZA 2EX9A 1IELA 3DTKA 1PI4A 4P6ZM 3OC2A 5TBMA 2J9OA 4ETXA 4EETB 1TEMA 3MGQB 2BLSA 4DRAA 4BJPA 3LZ0C 3AZMC 3TRCA 4J8WD 3BYDA 1JTGA 3PBSA 3M2KA 3SOIA 3ZDJA 3AYWC 3ZGAB 4DMZA 5DNNA 3VH5A 3AV2A 4DDYA 3SS3A 1MKMA 3AZHC 4C6YA 3KUYB 5DKLA 3AGFA 3IBRA 3T4KA 5DFXA 3BY9A 4X23B 3IWIA 2LB9A 2ZC4B 2L5AA 4MN5A 3DTIA 1M19A 3BFEA 1KX4C 1L0FA 4ESPA 2XD1A 1NLZA 4R38A 2XSSA 3WD3A 4HGAB 3AZFD 4IJGA 1CI8A 4HBTA 3A3DA 1IEMA 5EFWA 1LL5A 4BL3A 1RP5A 2QYBA 3NULA 4LLOB 2WAEA 2O9AA 4QPRA 1UR8A 2UV0E 5FUGB 2J3TC 3ZG9B 3HUOA 5FA7A 4EQ1A 4KHAA 2PYOB 5FQKA 2JKTM 3E98A 5EPHA 4CLCC 5E5AB 1CF0A 2NQBA 3VH5T 3EPKA 4X55A 3AN2A 4BENA 4QY6A 1WWIA 4WU9C 2XRNA 3UMEA 3HJIA 3REKD 4PMAA 4Y3IA 4DN0A 1P3LD 1IYQA 3NY4A 3MGRD 4JJNC 1P3KA 2H10A 1W1TA 3AZEC 1M18B 1K54A 5TFQA 1BLHA 3X1SD 3RH8B 1CK7A 1P3BA 4YINA 5BS7A 2R9XA 2HDRA 5FQMA 1BTLA 1YUEA 3MFXA 5AVBB 5CTNA 3W96B 4HP4A 1JTDA 2PYPA 3X1VD 2NUTC 3WS5A 5KSCA 2M1CA 4MEZA 4MDZA 5AV5D 2H28A 1XJ3A 3N8RA 3MVDD 2JKFA 5AVEA 3KXBC 2QMIA 4IJFA 3F1OA 4IBRA 1JFIA 5B2IB 3S4XA 5EUAA 4QWOA 3LELC 1WYCA 2PBDP 1P3GC 1ES5A 2HIOD 4WEKA 5B2JB 3WKJA 3LY3A 1D1JA 1T1CA 1U35A 2JHEA 3UE1A 1K25A 5HW3A 5EV0A 1S1YA 3S7OA 1WWSA 1OT6A 4WLAA 2BTFP 3QP5A 4X56A 5EVEA 3T1RA 2Y2OA 4I39A 5AV6B 3WTPA 2WKIA 2L4RA 1VM1A 5EVIA 4G92C 1P3OA 3VP1A 2GX5A 3M7PA 1XP4A 5CP6B 3R45A 2ACGA 2V20A 5BPVA 2XA7M 3X1UA 5EM0A 4KG5A 5BNVB 4HJ4A 4U0TA 5DNMD 5B33D 1P3MB 3W4PA 5JRGC 4K08A 3HLFA 4Z2KA 3VFFA 2PD7A 5AY8B 3GSGA 4K0XA 1LHYA 4Y13A 2H5SA 4YWZA 4N9LA 4NXBA 3OPHA 4DE2A 1PZPA 3NDEA 1VQQA 4FD8A 4H9OB 3AZHD 2VLGA 3REJC 1DJAA 3C1CA 1XJ2A 4KZAA 1TAFA 3AZND 1HTAA 3UB7A 2OAQ1 3B0DC 4WMCA 1F66C 4R8PD 5GSUD 5L10A 2ZQ7A 1TS6A 1KS0A 3MNNB 3MQOA 4IUHA 2CV5C 2ZLYA 3VFHA 4IVKA 3KWQB 2BYKA 4LCLA 1M1AC 2ZL1A 1S0WA 5HL6A 1ONHA 5A90A 3X1TD 4D60A 1HQ3B 4J8WA 1E25A 1JWVA 4QLCB 1WYBA 5J4EA 4FTXA 4BL2A 3MGPB 5HD3A 3UPPA 4WU8D 3TU4B 1S32B 2OWHA 3PBNA 4FOFA 2HZ5A 2J3TD 3T4LA 4BD0A 3C7UA 3SH7A 3MGSB 1ONGA 3REIB 3VH6T 4CSRB 1YAXA 3WS1A 4LD9D 2Y4AA 4CLCD 5DNNC 3AV2C 4MNRA 4OONA 1NXYA 1AOIC 3A0RA 1YKDA 3Q81A 4EW7A 1SCWA 2G2WA 2NUPC 4DRTA 5FI6A 3V50A 4WU9D 3NQUB 3AZFA 1P3IA 2WKEA 5CPKC 2VGKA 2B5RA 4IEDA 4X1MA 1M19C 2G5HC 1EAKA 5B1LC 2PRFA 5IT5A 2I72A 4NE5A 3G32A 1LSWA 3BQAA 5AVCD 4BBVA 2W3EA 4GH9A 3ZYTA 2AROD 5DF8A 1K56D 1KX3B 4YFMA 2B18A 5GXQC 3KFUG 1K55A 4Q0HA 2P7JA 5J8XA 4KZ4A 4HMCA 4JF6A 4LPZA 2X71A 3W98B 3F6TA 3LR3A 2PT7A 1E6NA 1GOIA 2YFWA 2I9VA 1N9BA 1F1EA 3REKA 1TS8A 5B24B 1RGYA 1P3LA 2XGNA 5JA4B 3MGRA 2NQBC 1P3GD 4GDNA 5HZHA 4JF4A 3AN2C 4WF0A 3NOPC 4R3JA 4Y15A 2VEAA 4Y5FA 4J8UD 3X1SA 3AZKB 1TDLA 3G34A 3HJKA 1P3KC 4OPRA 1OTEA 3IHBA 3EGXC 2Z6DA 3IF6A 3C2WA 4R70A 4KG2A 3C1BD 1Y4OA 1K54C 2H0YA 2VV8A 4P85A 3QP6A 4ME4A 4EBNA 4H9RA 3X1VA 3WAAB 4B4XA 5BS7C 2Y2IA 5AV5A 2Y2GA 5B40D 4WZ5A 3U4LP 3ZCZA 1L3LA 1TZYD 4R3BA 4QNLA 5BO0B 4K91A 4LV3A 4S2NA 2WUQA 1BH8A 3ZG8B 3OZHA 3AZJC 2HIOA 4H9PB 1O7EA 2HP5A 3NI9A 3P01A 4M3KA 1ZC2A 3L25A 1OTIA 3H82A 5CGWA 2XLNA 3AL0C 5HSQA 4NFTA 3UTAA 1JWPA 2ZMFA 4E3LA 5IS1A 1N1JA 1XFQA 4KZ5A 5TR7A 3AZGD 4J8XB 3CZDA 4NZ1A 4S2MA 5B0ZD 1U35C 4EO5C 1BFMA 5FSRA 1BH9B 4TX8A 2GDNA 4H6JB 5G4YA 5I94A 2GZAA 3IX4A 4Z9QA 4KGCB 3DWZA 2OLVA 3C4PA 5BNXA 3BEBA 1QO6A 1HD8A 2P9VB 3EEHA 3WTPC 1Z09A 4LV2A 2RVQC 4NKPA 5DNMA 5B33A 2DQNC 3V9RA 3AFAB 3RELC 3UT9B 3B6FD
chains in the Genus database with same CATH topology
2YFVA 4E3OA 5CGXA 3IH9A 3IH8A 3AZHA 4X6TA 3VH6W 1LLBA 4J8VC 5CPJB 3ISGA 1KE3A 3B6GD 4MLLA 5GSUA 3RXWA 3MZEA 1AOID 3AZID 3C1CC 3SS5A 4YS3B 4X69A 2C5WB 3MKFA 3X1TA 2DNSA 4XUJC 4AWLB 4DQYB 1KGEA 3REHB 3UPNA 2F8NG 1H8YA 3M2JA 3IWQA 3UTBC 5A92A 4B88A 5GXQD 5HAPA 1P3BB 4FH4A 1EQZB 4E3JA 3BFDA 4WU9A 5GHZA 2EXAA 1ID3C 4H8RA 4JJNA 3M6BA 4RVAA 2F8ND 2EFXA 5E2EA 3AZFC 2Y2JA 5AVCA 3FKWA 3WKJB 2ZMAA 4GDBA 2AROA 3D4FA 1K56A 3A6NB 5M19A 3G35A 2WGVA 1N4OA 5B0YB 5EVIB 2A3UA 4GZBA 2F8NH 1P3GA 5DVAA 5G18A 3X1UB 3REKC 3W4OA 4Y0TA 1P3LC 3W97B 3MGRC 3MFDA 1BLSA 2NZDD 4PM8A 4EUZA 3C1BA 4NE3A 2EX8A 1YLWA 3H0LC 5AQAA 4XZQD 3X1SC 3GR2A 1DY6A 4JPMA 4DDSA 5B40A 5GT3D 3IF6C 1TZYA 5KDMB 3A1KA 4HGAC 3ZNTA 3BM6A 3X1VC 1YMSA 3N7WA 5EOEA 1YT4A 2WGWB 3WRTA 4S2NC 3MVDC 2ZC5B 3NIAA 2PBYA 4PM6A 3ZVTA 5B0ZA 5BT1D 4L0LA 4FCFA 3ZG0A 3O3VA 4XUXA 4J8VD 5U47A 2RL3A 1F66A 3QNCA 1GA9A 1K57C 3UNWA 4PM7A 2Q9NA 3WRZA 5E2FA 2HUEB 5CRFA 1M1AA 3B6FA 5AV8B 1EWZA 4XUJD 3UE3A 1EI5A 4JXWA 5HAIA 1P3AD 1P3IB 5DNMC 5B33C 2XF3A 4ZJ3A 5AVBC 3WA9B 3W96C 5B31B 4OPYA 5CHJA 5F1FA 3AV1D 5F82A 1FQGA 2WKHA 1FCNA 3ZFZA 4Q8IA 3UTBD 3NDGA 4YM6B 1PWGA 1AOIA 4QB8A 3M6HA 3AZIA 4PM5A 3AZNC 5B2IC 4IBGA 1ID3D 5CPKA 4KZ7A 4R8PC 5GSUC 1GCEA 4ZUXD 4DF6A 5B1LA 2YFWB 4R1GA 3FYZA 2XDMA 1ZG4A 4UA7A 2ZC7A 4WZSB 4WELA 3ZG7B 3X1TC 4XXRA 4H9SA 2FJ7D 3HBRA 4H9NA 5GXQA 4Z66B 3B0CW 4KENB 4WU8C 5M18A 1YU1A 2J7VA 5CPID 4WJ3C 1PZRA 2ZM2A 4LD9C 2ZY4A 1CEGA 1XGIA 1FR6A 3O62B 3MGQD 1DJBA 3GRJA 3HUNA 3W99B 4KUDB 3IHAA 1KDWA 5AY8C 1SDNA 3C5AA 4ZJ1A 1CK3A 5DF9A 4H9QA 1P3PB 1MBLA 4KQRA 1EROA 3KUYD 5AV9B 3GVBA 4X23D 1YLZA 4ID4A 3UTAB 4JF5A 5GT0B 3EQVA 4A5RA 5GLBA 3AGDA 1MWUA 5AVCC 3AZLB 2ZM8A 3N4IA 2AROC 4UA6A 4BD1A 5JYOA 1P34B 3L28A 2CC1A 2EXBA 3NBLA 3AZJA 1KX5B 1HQ3C 3PAGA 4OQIA 2PU2A 3HUMA 5AQ9A 4Z2MH 1IKGA 3I7JA 3VSKA 3LZ0B 3AZMB 1M40A 3ZVWA 4OPQA 2PYOD 3HLCA 2JSSA 3AYWB 4J8UC 3G2ZA 5E5AD 5GT3A 4JXSA 3C1BC 3LZ1B 1CEFA 2Z2LB 2IOUA 3PAEA 3RELA 5G49B 1JWZA 1L0EA 3HLBA 5B40C 1KX4B 5DTSA 1TZYC 2F2AC 4ZTKA 1M18D 5HX9A 4XUZA 2JC7A 3PBOA 5C3IC 1K4FA 5AVBD 3A3IA 5D3OA 3W96D 4QD4A 2BYMA 3TOIA 4J8VA 4WNNB 5CGSA 3AZGC 4NZ5A 5FI7A 5B0ZC 3MXRA 5FQ9A 4ZAMA 4JKTA 5B24C 4P87A 5B2ID 4S2JA 1H3OA 1BSGA 5B2JD 1KU5A 2LY8A 5HL1A 2Y2LA 4XUJA 2Y55A 5AQBA 2WAFA 1P3AA 1U60A 5FQJA 4NE6A 2ZC3B 5CEBA 4O7DA 2X01A 1BZAA 4JJNB 3B6FC 1SDEA 2RCXA 3AZEB 4Y7PA 5AV6D 3AV1A 3UTBA 1HTZA 4CPKA 5E2HA 3WS0A 1B6WA 3MBZA 5CP6D 1SKFA 5B32B 4LENA 5KMWA 3UDXA 1ID3A 1P3MD 1NYMA 3B6GC 3VH5W 4LV0A 4ZUXA 1FSYA 3AZIC 5AY8D 2F8NK 3KXBB 1LL9A 3LELB 5F99B 4IBKA 4OQHA 3HREA 3LJAB 2FJ7A 5A93A 4HBUA 3OPPA 3UPOA 3CG5A 4GD6A 4G91C 5CPIA 2ZM5A 3FWLA 2HDSA 4H9SC 2P74A 2WZZA 5B1MB 3MNND 5BOHA 3G4PA 3KWQD 4N9KA 5FAQA 1C3BA 3LEZA 3AFAC 1CI9A 4G92B 1HQ3D 4Z5TB 4QLCD 3N8SA 2DRWA 3VSLA 1MY8A 4RX2A 3RJUA 3B0BA 3MGPD 1ZLAB 3OCNA 4NZ4A 4OJOA 3TU4D 1S32D 3KUYA 5JRGB 3MGSD 3IT9A 3REID 2IWDA 2Q9MA 1P3FB 1XKZA 2IO5C 4X23A 2HP9A 4WEJA 4KZ9A 2ZD8A 2XH9A 3N8LA 3LCEA 3W8KA 3REJB 3TG9A 4UUZB 4P6BA 3WS2A 5JYPA 4U3TA 5FASA 4NK3A 4KG6A 5IHVA 3IWOA 3OPRA 2XFSA 2CV5B 3MVDA 5FUGA 5FQQA 1M1AB 1Q2PA 3EQUA 1YMXA 3Q1FA 4M6BA 1Y54A 1KX3D 2PYOA 2XR0A 5E5AA 1PYYA 1RCJA 3W98D 5F1GA 1K57A 2NZDC 3O87A 4HESA 4HEFA 3A1IA 4KQQA 1W2EA 5B24D 4XZQC 3FKEA 4ZBJC 3MZDA 3E2LA 5DNNB 4QU3A 3AV2B 3P09A 3UDIA 4JXGA 5GT3C 5E2GA 4OJLA 1M18A 3V3SA 4E3MA 5A91A 1NY0A 3AZKD 5CPKB 1G6AA 1M19B 5AVBA 2G5IC 3NC8A 5B1LB 3A6NC 3W96A 1J9MA 2V2FF 1MWRA 1ESIA 3WAAD 3MZFA 5BT1C 3S1YA 3AZNA 4H9NB 5B2IA 1LI9A 4KZ8A 5B2JA 5GLDA 1PZOA 4R8PA 3NQJA 1BULA 4KHAB 1ULYA 2X02A 3UY6A 5KZHA 5FI2A 4J8XD 4GD8A 1NRFA 2NQBB 3AN2B 1K38A 5FAPA 4OLGA 2J8PA 5AV6A 1E3UD 4S2OA 4PPRA 1P3AC 4H9QB 1I5QA 4WU8A 4KGCD 3H0MC 1P3KB 4IBDA 4R4RA 5CP6A 3L2AA 3AV1C 1MWSA 5BNVA 4LD9A 1FSWA 3AFAD 4LG2A 3UT9D 1P3MA 3KS4A 3S22A 5GLAA 5AY8A 4MBFA 1IYSA 2XQZA 3AZJB 4H9OA 4KZ3A 1YU4A 4ZUXC 4EV4A 4IBEA 4S2LA 5CPJD 3GTCA 1JFIB 4OKPA 3HLGA 1U35B 4YS3D 3MNNA 2FJ7C 4GNUA 2DF4C 2XFTA 3KWQA 2HUEC 2Y59A 3O88A 3Q7ZA 3HLWA 3DW0A 3FZCA 5CPIC 1HQ3A 3A3JA 3BECA 4C3QA 4QLCA 1OMEA 1IYPA 3WTPB 4DRBA 3MGPA 3REHD 4D2OA 5GHXA 1M6KA 3TU4A 3MGQC 3RELB 1S32A 1P3OB 2Z2MB 3MGSA 1S6RA 3R45B 1IYOA 1BT5A 2WYXA 1KGFA 1W8QA 3P5JB 1P3BD 3OCLA 4J8UA 3RXXA 1W79A 1EQZD 3KUYC 4OQ0A 2WGIA 1YU0A 3L27A 3HVFA 1YM1A 4IBXA 1W8YA 1FR1A 4X23C 3NQUA 3MKEA 3VMAA 3GQZA 3IXDA 1K6RA 1I2WA 1PW1A 3C1CB 4GHLA 4GB7A 1TAFB 1JVJA 3ZNYA 3WKJD 4KZ6A 4FH2A 3A6ND 1KX3A 2C6WB 4GKUA 2BYKB 1NYYA 3VOZA 3AZGA 5B0YD 2QPNA 4J8WB 3QHYA 2PYOC 5GLCA 4ZBEA 3IXHA 1KGGA 5L2FA 5B24A 2Y2MA 5EVID 1ESUA 5E5AC 2ZJ9A 4LV1A 5JA4A 4OUIA 4NY2A 3IQAA 5DTTA 1ERMA 1FCMA 3X1UD 4QHCA 3VP0A 1P3PC 4N1HA 4R23A 3AZKA 3W97D 4S2KA 5AV9C 5CECA 1M18C 3FDDA 5GT0C 2Y2QA 3ITAA 3AZFB 3N3FA 4DXBA 3UE0A 5BO0A 1K4EA 4OQGA 3A3EA 1LI0A 4H9PA 3HONA 3ZHHA 3B6GA 1KVMA 1YLJA 2ZQAA 2IWBA 1PIOA 2WADA 3EPHA 2ZQ8A 3G30A 4J8XA 5B2JC 3SH9A 2DCFA 4GN2A 2FFYA 1BH9A 1E3UA 1NJ4A 2IWCA 3REKB 5B31G 1P3LB 4B4ZA 3IF5A 4KGCA 3MGRB 4DE3A 1HVBA 3LZ1C 3O86A 3Q7VA 2P9VA 3PBTA 5AV6C 2Y2NA 3X1SB 1BUEA 3AFAA 4Z2MG 3UT9A 2V1ZA 5AV8D 1MXOA 5CP6C 3E2KA 3IF6B 4LCMA 3UDFA 1PW8A 1PWCA 5CTMA 1YU2A 1P3ID 4H9RB 3X1VB 3TSGA 1P3MC 1YQSA 3WS4A 2ZY2A 5AV5B 3WA9D 4EBPA 5B31D 4S2PA 3L29A 2HDUA 1T3UA 2XEPA 2F8NA 3MVDB 1BH8B 5CPJA 4YM6D 1NZUA 2HIOB 4YS3A 3QNBA 4S2IA 1A7WA 1N1JB 3MXSA 5HFOA 1ES2A 3MNNC 3KWQC 3REHA 3V39A 2E8IA 5BNXB 4QLCC 1HZOA 4IJEA 2HPBA 3MGPC 4Z66D 3PBRA 5DNMB 3TU4C 1S32C 5B33B 3V9RB 1EQZA 5CHUA 5B32C 2NZDA 3MGSC 2YFVB 3REIC 3IXBA 4IBJA 5FQIA 4XZQA 2J9PA 3O62D 2JBFA 2Y2PA 4KZBA 1ERQA 4E3KA 3W99D 3AZHB 4KUDD 2CWEA 2A49A 3AZNB 3IXGA 4E6XA 1P3PD 1ZKJA 3VP2A 5F99C 4R8PB 5GSUB 3NQJB 5AV9D 3LJAC 3A6NA 3VP3A 3UTAD 5GT0D 1H5XA 1TDGA 2HDQA 3AZLD 3OPLA 5CXWA 3X1TB 1KE4A 5B1MC 5B0YA 1KX3C 4ZJ2A 1P34D 2UWXA 1IKIA 4WU8B 1KX5D 1XA1A 3W98C 1W7FA 4Z5TC 4PM9A 2WK0A 1ZLAC 1QMEA 4LD9B 4MBKA 3W97A 1B67A 3V5MA 3VOYA 4E44A 3VH6A 1BLPA 3LZ0D 3AZMD 5FATA 1P3FC 3L26A 5E43A 3AYWD 2QZ6A 4WU9B 1RGZA 3AZKC 5KDMA 4DXCA 3LZ1D 4Y0OA 2JCHA 1L0GA 1WE4A 4MBHA 3WAAC 4KQOA 5FAOA 3BFCA 5AVCB 3BLMA 1GHIA 4OOYA 1KX4D 2WGWA 3G31A 3GMWA 1GHPA 5KSHA 2AROB 1Q9CA 4NYUA 4QJGA 2VGJA 4OP5A 4JXVA 2EFUA 3KS8A 3HLEA 4WV4B 3UN7A 4J8XC 1KVLA 1P3GB 3BFGA 4CAYA 1ZG6A 2XD5A 3WWXA 1QMFA 3IP4C 2Y2HA 4F94A 5B32G 4J8UB 1MPLA 5AV8A 4KGCC 3KSYA 3C1BB 3GV9A 4E3IA 4BQMA 4DKIA 3UO9A 1O07A 3UT9C 4JJND 3MGQA 5B40B 3WA9A 5B31A 3AZED 1TZYB 1KE0A 2G2UA 2FFFB 4C75A 2EX6A 3G2YA 4YM6A 4OJ5A 5C3IB 5B32D 4WZ4A 2EX2A 2ZY5A 5EOOA 5CPJC 1DJCA 3DTMA 3A3FA 3AZGB 2HP6A 5B0ZB 4IBFA 4YS3C 2XK1A 1YLPA 3KXBD 4BLMA 4CJNA 3B0DB 3LELD 3Q82A 5F99D 4E45A 1F66B 4NZ3A 5HARA 3LJAD 4E6WA 4AWLC 1ES3A 4WYYA 3C4OA 4Z66A 3REHC 3CJMA 1H8ZA 3B6FB 1KDSA 4FSFA 3EG5B 5B1MD 1P3BC 1YU3A 3O62A 2ZC6B 4NYYA 1EQZC 4Z5TD 3W99A 4KUDA 1Q2QA 2ZY3A 3BFFA 1PI5A 1ZLAD 1GA0A 5HAQA 1P3PA 1Z2CB 3CMZA 5JRGD 3B6GB 1AOIB 5AV9A 3AZIB 1P3FD 5GT0A 1XGJA 3AZLA 3WKJC 3ITBA 1W5DA 3REJD 3C7VA 5DTKA 1P34A 4P0MA 1F66D 1KX5A 4UHUA 4G91B 3HSHA 4N92A 4R4SA 5B0YC 3Q7VB 4GHAA 4JLFA 2CV5D 4UA9A 5GXQB 5EVIC 3LY4A 1P3OC 1M1AD 3LZ0A 3AZMA 2OLUA 4Y0UA 3X1UC 3AYWA 2R9WA 5M1AA 3W97C 4R0QA 1Z6FA 4WBGA 1YLYA 3SH8A 5GL9A 4GOGA 4OVDA 3H0RC 3LZ1A 4IBCA 2IO5B 2F8NB 4UPKA 5DNND 3AV2D 4OJ6A 2OSUA 5G49A 1KX4A 4EBLA 4JBFA 5AQ7A 3BRMA 2W8SA 5CPKD 2VQRA 4IBIA 3FV7A 3SS4A 1M19D 5B1LD 2WZXA 2ZQ9A 1TVFA 1K6SA 1FCOA 1PWDA 4WNNA 3AGEA 4OP8A 4J8WC 1ES4A 2ZQCA 1XX2A 5DF7A 3EPJA 1MWTA 1E4DA 4QY5A 3FKVA 1XPBA 3JYIA 2NZDB 4EO5B 4NETA 4XZQB 4ZBJB 3DWKA 2NQBD 2Y2KA 5AV8C 1AXBA 3AN2D 1XA7A 5GT3B 1L0DA 3AZEA 1FOFA 3LO7A 1P3IC 3Q07A 4ZDXA 1P3KD 3HL9A 3EPLA 5FDHA 5B32A 3WA9C 5B31C 5TGFA 3WX7A 3REIA 4CSRA 4OPZA 5F83A 3B0CT 4RA7A 4YM6C 1ALQA 4OOMA 1SHVA 4DE1A 3WTPE 2BYMB 1K55C 3KXBA 2PU4A 4DE0A 1NZOA 2J8YA 3AZJD 4J8VB 3LELA 1MKIA 3NCKA 3P98A 1I2SA 5F99A 2Y91A 2RIQA 2OV5A 3LJAA 5EECA 3VP4A 3N6IA 1H3OB 5CHLB 1U35D 5B1MA 3V3RA 4XUJB 1YLTA 4EQIA 4Z66C 1P3AB 4EWFA 4RX3A 4RYEA 5CHMA 4E3NA 3W4QA 3W98A 1G68A 4Z5TA 2BG1A 1L2SA 5CERA 2JE5A 3WTPD 3AV1B 5CEDA 1ZLAA 3UTBB 2RVQD 1GHMA 3O62C 3RELD 3B3XA 1P3OD 5AV5C 5JRGA 4WZ5C 3W99C 4KUDC 1P3FA 4OLDA 3ZG5A 4IBBA 4OJPA 4IVIA 4UAAA 2HIOC 1ID3B 4X68A 3REJA 3HLDA 4UUZA 4ZUXB 3PBQA 3UTAC 3WAAA 4N1XA 5EVLA 5GHYA 3AZLC 4U0XA 1R4VA 4CAYB 4K0WA 3C1CD 1BLCA 4OOLA 2FJ7B 2ZQDA 4X53A 2CV5A 5EE8A 3BLSA 1P34C 2H0TA 4OH0A 1XXMA 2ZM0A 4WMCD 4WM9A 3PTEA 1KX5C 5CPIB 2EX9A 1IELA 1PI4A 3OC2A 2J9OA 1TEMA 3MGQB 2BLSA 4DRAA 4BJPA 3LZ0C 3AZMC 4J8WD 3BYDA 1JTGA 3PBSA 3M2KA 3SOIA 3ZDJA 3AYWC 3ZGAB 5DNNA 3VH5A 3AV2A 4DDYA 3SS3A 3AZHC 4C6YA 3KUYB 3AGFA 4X23B 3IWIA 2ZC4B 2L5AA 1M19A 3BFEA 1KX4C 1L0FA 2XD1A 4HGAB 3AZFD 1CI8A 4HBTA 3A3DA 1IEMA 4BL3A 1LL5A 1RP5A 2WAEA 5FUGB 3ZG9B 3HUOA 5FA7A 4KHAA 2PYOB 5FQKA 5EPHA 5E5AB 2NQBA 3VH5T 3EPKA 4X55A 3AN2A 4BENA 4QY6A 1WWIA 4WU9C 4PMAA 3REKD 1P3LD 1IYQA 3NY4A 3MGRD 4JJNC 1P3KA 2H10A 3AZEC 1M18B 1K54A 5TFQA 1BLHA 3X1SD 1P3BA 4YINA 5BS7A 2R9XA 2HDRA 5FQMA 1BTLA 1YUEA 5AVBB 5CTNA 3W96B 1JTDA 3X1VD 3WS5A 5KSCA 4MEZA 5AV5D 3N8RA 3MVDD 3KXBC 2QMIA 4IJFA 4IBRA 3S4XA 1JFIA 5B2IB 5EUAA 3LELC 1WYCA 1P3GC 1ES5A 2HIOD 4WEKA 5B2JB 3WKJA 3LY3A 1U35A 3UE1A 1K25A 5HW3A 1WWSA 4X56A 2Y2OA 5AV6B 3WTPA 2WKIA 1VM1A 5EVIA 4G92C 1P3OA 3VP1A 1XP4A 5CP6B 3R45A 2V20A 5BPVA 3X1UA 4KG5A 5BNVB 4U0TA 5DNMD 5B33D 1P3MB 3W4PA 5JRGC 3HLFA 3VFFA 5AY8B 3GSGA 4K0XA 1LHYA 2H5SA 4N9LA 3OPHA 4DE2A 1PZPA 3NDEA 1VQQA 4FD8A 4H9OB 3AZHD 3REJC 1DJAA 3C1CA 4KZAA 1TAFA 3AZND 1HTAA 3B0DC 4WMCA 1F66C 4R8PD 5GSUD 2ZQ7A 3MNNB 3VFHA 2CV5C 2ZLYA 4IVKA 3KWQB 2BYKA 4LCLA 1M1AC 1S0WA 1ONHA 5A90A 3X1TD 1HQ3B 4J8WA 1E25A 1JWVA 4QLCB 1WYBA 4BL2A 3MGPB 3UPPA 4WU8D 3TU4B 1S32B 3PBNA 4BD0A 3C7UA 3SH7A 3MGSB 1ONGA 3REIB 3VH6T 4CSRB 3WS1A 4LD9D 2Y4AA 5DNNC 3AV2C 4MNRA 4OONA 1NXYA 1AOIC 3Q81A 1SCWA 2G2WA 4DRTA 5FI6A 3V50A 4WU9D 3NQUB 3AZFA 1P3IA 2WKEA 5CPKC 2VGKA 2B5RA 4IEDA 1M19C 2G5HC 5B1LC 2I72A 4NE5A 3G32A 5AVCD 4GH9A 2AROD 5DF8A 1K56D 1KX3B 4YFMA 5GXQC 3KFUG 1K55A 5J8XA 4KZ4A 4JF6A 2X71A 3W98B 3F6TA 2YFWA 1N9BA 1F1EA 3REKA 5B24B 1RGYA 1P3LA 2XGNA 5JA4B 3MGRA 2NQBC 1P3GD 4GDNA 4JF4A 3AN2C 4R3JA 4J8UD 3X1SA 3AZKB 1TDLA 3G34A 1P3KC 4OPRA 3IHBA 3IF6A 4KG2A 3C1BD 1K54C 2H0YA 4P85A 4EBNA 4H9RA 3X1VA 3WAAB 4B4XA 5BS7C 2Y2IA 5AV5A 2Y2GA 5B40D 4WZ5A 3ZCZA 1TZYD 4R3BA 4QNLA 5BO0B 4K91A 4LV3A 4S2NA 2WUQA 1BH8A 3ZG8B 3OZHA 3AZJC 2HIOA 4H9PB 1O7EA 2HP5A 3NI9A 4M3KA 1ZC2A 3L25A 5CGWA 2XLNA 3AL0C 4NFTA 3UTAA 1JWPA 4E3LA 1N1JA 4KZ5A 5TR7A 3AZGD 4J8XB 3CZDA 4NZ1A 4S2MA 5B0ZD 1U35C 4EO5C 1BFMA 5FSRA 1BH9B 2GDNA 5I94A 4Z9QA 4KGCB 3DWZA 2OLVA 3C4PA 5BNXA 3BEBA 1HD8A 2P9VB 3WTPC 4LV2A 2RVQC 5DNMA 5B33A 2DQNC 3V9RA 3AFAB 3RELC 3UT9B 3B6FD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YLT A;  1NYM A;  4LV0 A;  4EQI A;  3MXS A;  1FSY A;  5HFO A;  4EWF A;  4RX3 A;  4RYE A;  5CHM A;  4E3N A;  1ES2 A;  4E3O A;  3W4Q A;  1G68 A;  1L2S A;  2BG1 A;  5CGX A;  3IH9 A;  3IH8 A;  1LL9 A;  5CER A;  4X6T A;  2JE5 A;  5CED A;  4OQH A;  3V39 A;  2E8I A;  1LLB A;  1GHM A;  3HRE A;  3B3X A;  5A93 A;  4HBU A;  3OPP A;  3ISG A;  1HZO A;  4WZ5 C;  3UPO A;  3CG5 A;  1KE3 A;  4MLL A;  3RXW A;  3MZE A;  2HPB A;  4OLD A;  4GD6 A;  3SS5 A;  3ZG5 A;  3FWL A;  2HDS A;  3PBR A;  2P74 A;  2WZZ A;  5CHU A;  4IVI A;  4UAA A;  5BOH A;  3G4P A;  4X69 A;  4X68 A;  4N9K A;  2C5W B;  3MKF A;  5FAQ A;  3HLD A;  1C3B A;  3IXB A;  1CI9 A;  3LEZ A;  3PBQ A;  2DNS A;  5FQI A;  2J9P A;  2JBF A;  1KGE A;  2Y2P A;  4KZB A;  1ERQ A;  3N8S A;  2DRW A;  4N1X A;  3VSL A;  4E3K A;  5EVL A;  5GHY A;  1MY8 A;  4RX2 A;  3RJU A;  3UPN A;  4U0X A;  2A49 A;  3OCN A;  4K0W A;  3IXG A;  4E6X A;  1H8Y A;  1BLC A;  4OOL A;  2ZQD A;  4X53 A;  5EE8 A;  1ZKJ A;  3BLS A;  3M2J A;  3VP2 A;  2H0T A;  4OH0 A;  1XXM A;  2ZM0 A;  2IWD A;  2Q9M A;  3IT9 A;  3IWQ A;  4WM9 A;  4WMC D;  3PTE A;  4B88 A;  5A92 A;  1XKZ A;  5HAP A;  3VP3 A;  2EX9 A;  1IEL A;  1PI4 A;  1H5X A;  4FH4 A;  1TDG A;  2HP9 A;  4E3J A;  4WEJ A;  4KZ9 A;  2HDQ A;  2ZD8 A;  3OC2 A;  2XH9 A;  3N8L A;  2J9O A;  3LCE A;  3W8K A;  3BFD A;  3TG9 A;  1TEM A;  5GHZ A;  3OPL A;  2EXA A;  5CXW A;  1KE4 A;  4P6B A;  2BLS A;  4BJP A;  4ZJ2 A;  3BYD A;  4H8R A;  3WS2 A;  5JYP A;  1JTG A;  3PBS A;  3M2K A;  3M6B A;  3SOI A;  2UWX A;  4U3T A;  3ZDJ A;  1IKI A;  4RVA A;  3ZGA B;  5FAS A;  4NK3 A;  1XA1 A;  2EFX A;  5E2E A;  4KG6 A;  4DDY A;  1W7F A;  5IHV A;  3SS3 A;  3IWO A;  4PM9 A;  3OPR A;  2XFS A;  2WK0 A;  4C6Y A;  2Y2J A;  3FKW A;  2ZMA A;  1QME A;  4MBK A;  5FQQ A;  3AGF A;  1Q2P A;  4GDB A;  3EQU A;  3IWI A;  3V5M A;  3VOY A;  3D4F A;  1K56 A;  1YMX A;  2ZC4 B;  3Q1F A;  5M19 A;  1BLP A;  1Y54 A;  5FAT A;  3G35 A;  3BFE A;  1L0F A;  5E43 A;  2WGV A;  2XR0 A;  2XD1 A;  2QZ6 A;  1PYY A;  1RCJ A;  1N4O A;  1RGZ A;  5F1G A;  1K57 A;  3O87 A;  1CI8 A;  4HBT A;  4HES A;  3A3D A;  4HEF A;  4KQQ A;  1IEM A;  4DXC A;  5EVI B;  2A3U A;  4GZB A;  4Y0O A;  2JCH A;  3E2L A;  3MZD A;  4QU3 A;  1L0G A;  1LL5 A;  1WE4 A;  3P09 A;  4MBH A;  3UDI A;  1RP5 A;  4KQO A;  4BL3 A;  2WAE A;  4JXG A;  5FAO A;  5E2G A;  5DVA A;  3BFC A;  5G18 A;  3BLM A;  1GHI A;  4OOY A;  3V3S A;  3W4O A;  2WGW A;  4Y0T A;  3ZG9 B;  3G31 A;  3GMW A;  1GHP A;  4E3M A;  5A91 A;  3HUO A;  1NY0 A;  5FA7 A;  5KSH A;  3MFD A;  1BLS A;  1G6A A;  4PM8 A;  5FQK A;  4QJG A;  4EUZ A;  2VGJ A;  5EPH A;  2EX8 A;  3NC8 A;  1YLW A;  5AQA A;  4OP5 A;  2V2F F;  1J9M A;  1MWR A;  4JXV A;  3GR2 A;  1ESI A;  1DY6 A;  2EFU A;  4X55 A;  4BEN A;  4QY6 A;  4JPM A;  4DDS A;  3MZF A;  3HLE A;  3IF6 C;  4PMA A;  3UN7 A;  3ZNT A;  1KVL A;  3BFG A;  1IYQ A;  3NY4 A;  3BM6 A;  3S1Y A;  1YMS A;  2H10 A;  1ZG6 A;  3N7W A;  1LI9 A;  2XD5 A;  3WWX A;  1QMF A;  2Y2H A;  1K54 A;  4F94 A;  5EOE A;  4KZ8 A;  1YT4 A;  5GLD A;  1PZO A;  2WGW B;  5TFQ A;  1MPL A;  1BLH A;  3WRT A;  4S2N C;  1BUL A;  2ZC5 B;  4YIN A;  3NIA A;  2R9X A;  2PBY A;  2HDR A;  4PM6 A;  2X02 A;  3UY6 A;  5FQM A;  5KZH A;  1BTL A;  5FI2 A;  3ZVT A;  3GV9 A;  5CTN A;  4E3I A;  4GD8 A;  4BQM A;  1NRF A;  4DKI A;  1JTD A;  1O07 A;  3UO9 A;  1K38 A;  4L0L A;  5FAP A;  4OLG A;  3WS5 A;  5KSC A;  1E3U D;  4FCF A;  3ZG0 A;  3O3V A;  4MEZ A;  4XUX A;  4S2O A;  1KE0 A;  2G2U A;  5U47 A;  2FFF B;  4PPR A;  2RL3 A;  3QNC A;  4C75 A;  1GA9 A;  1K57 C;  3N8R A;  2EX6 A;  3UNW A;  1I5Q A;  3G2Y A;  4PM7 A;  2QMI A;  2Q9N A;  4IBR A;  4R4R A;  3S4X A;  3WRZ A;  5E2F A;  5EUA A;  1WYC A;  4WZ4 A;  1ES5 A;  4WEK A;  3LY3 A;  1MWS A;  2EX2 A;  5CRF A;  1FSW A;  5EOO A;  1EWZ A;  3S22 A;  3UE1 A;  1K25 A;  5HW3 A;  1DJC A;  3UE3 A;  3DTM A;  3A3F A;  5GLA A;  1EI5 A;  4JXW A;  5HAI A;  2HP6 A;  4MBF A;  1IYS A;  4X56 A;  2XK1 A;  2Y2O A;  2XF3 A;  2XQZ A;  1YLP A;  4ZJ3 A;  4BLM A;  5CHJ A;  4KZ3 A;  4CJN A;  4OPY A;  5F1F A;  2WKI A;  5F82 A;  3Q82 A;  4EV4 A;  1FQG A;  1VM1 A;  1FCN A;  2WKH A;  3ZFZ A;  5EVI A;  4Q8I A;  5HAR A;  3NDG A;  3VP1 A;  4S2L A;  4E6W A;  1XP4 A;  1ES3 A;  4WYY A;  3C4O A;  3GTC A;  1PWG A;  4OKP A;  2V20 A;  4QB8 A;  3M6H A;  4PM5 A;  3CJM A;  1H8Z A;  3HLG A;  4KG5 A;  4U0T A;  4GNU A;  1KDS A;  4FSF A;  2XFT A;  3W4P A;  2Y59 A;  3O88 A;  3Q7Z A;  4KZ7 A;  3HLF A;  1GCE A;  3VFF A;  3HLW A;  3DW0 A;  3FZC A;  4DF6 A;  3GSG A;  4K0X A;  1LHY A;  3A3J A;  3BEC A;  2H5S A;  2ZC6 B;  4N9L A;  4R1G A;  4C3Q A;  3OPH A;  4DE2 A;  1PZP A;  3NDE A;  1VQQ A;  1OME A;  1Q2Q A;  3FYZ A;  4FD8 A;  1IYP A;  2XDM A;  1ZG4 A;  1DJA A;  3BFF A;  4UA7 A;  2ZC7 A;  1PI5 A;  4WEL A;  4D2O A;  3ZG7 B;  5GHX A;  4KZA A;  1M6K A;  1GA0 A;  4XXR A;  5HAQ A;  2Z2M B;  3CMZ A;  3HBR A;  4WMC A;  1S6R A;  1IYO A;  1BT5 A;  4KEN B;  5M18 A;  2WYX A;  1KGF A;  1W8Q A;  2ZQ7 A;  3RXX A;  3OCL A;  2J7V A;  3VFH A;  1W79 A;  2ZLY A;  1XGJ A;  4IVK A;  4OQ0 A;  2WGI A;  2ZM2 A;  3HVF A;  4LCL A;  3ITB A;  1W5D A;  1YM1 A;  4IBX A;  1W8Y A;  1CEG A;  1XGI A;  3C7V A;  5DTK A;  1S0W A;  1FR1 A;  1ONH A;  5A90 A;  1FR6 A;  3MKE A;  3VMA A;  1E25 A;  1DJB A;  1JWV A;  3GRJ A;  1WYB A;  3GQZ A;  3HUN A;  3IXD A;  4P0M A;  4BL2 A;  3IHA A;  1K6R A;  1KDW A;  1I2W A;  1PW1 A;  1SDN A;  3C5A A;  4ZJ1 A;  1CK3 A;  4UHU A;  3UPP A;  4GB7 A;  5DF9 A;  4N92 A;  4R4S A;  3PBN A;  4BD0 A;  3Q7V B;  1MBL A;  4KQR A;  4JLF A;  3C7U A;  1ERO A;  1JVJ A;  3ZNY A;  3SH7 A;  1ONG A;  3WS1 A;  4UA9 A;  3GVB A;  5EVI C;  3LY4 A;  4KZ6 A;  2Y4A A;  1YLZ A;  4FH2 A;  4ID4 A;  4MNR A;  4JF5 A;  3EQV A;  4A5R A;  4OON A;  2OLU A;  1NXY A;  4Y0U A;  2C6W B;  4GKU A;  5GLB A;  3AGD A;  1MWU A;  1NYY A;  3Q81 A;  1SCW A;  2G2W A;  2ZM8 A;  3N4I A;  2R9W A;  5FI6 A;  3VOZ A;  4DRT A;  3V50 A;  5M1A A;  4R0Q A;  4UA6 A;  1Z6F A;  4WBG A;  1YLY A;  2QPN A;  3SH8 A;  4BD1 A;  2WKE A;  3QHY A;  2VGK A;  5GL9 A;  5JYO A;  2CC1 A;  5GLC A;  2EXB A;  2B5R A;  3IXH A;  4GOG A;  4IED A;  3NBL A;  1KGG A;  4OVD A;  4ZBE A;  2Y2M A;  5L2F A;  5EVI D;  1ESU A;  2ZJ9 A;  4LV1 A;  2I72 A;  3PAG A;  3IQA A;  2OSU A;  4OQI A;  3G32 A;  5DTT A;  2PU2 A;  1ERM A;  3HUM A;  1FCM A;  5AQ9 A;  4EBL A;  4QHC A;  1IKG A;  3I7J A;  3VP0 A;  4N1H A;  4R23 A;  4JBF A;  3VSK A;  5AQ7 A;  5DF8 A;  1K56 D;  1M40 A;  3BRM A;  4S2K A;  4YFM A;  3ZVW A;  4OPQ A;  1K55 A;  3FV7 A;  5CEC A;  3SS4 A;  5J8X A;  4KZ4 A;  3HLC A;  2Y2Q A;  2WZX A;  3G2Z A;  2ZQ9 A;  4JF6 A;  2X71 A;  3ITA A;  1TVF A;  1K6S A;  1FCO A;  1PWD A;  1N9B A;  4JXS A;  4DXB A;  1CEF A;  2Z2L B;  3AGE A;  3UE0 A;  1RGY A;  1K4E A;  2XGN A;  4OP8 A;  4OQG A;  1ES4 A;  4GDN A;  2ZQC A;  4JF4 A;  3PAE A;  1JWZ A;  1L0E A;  1XX2 A;  3HLB A;  3A3E A;  4R3J A;  5DF7 A;  1LI0 A;  1E4D A;  1MWT A;  3FKV A;  4QY5 A;  1XPB A;  3JYI A;  5DTS A;  3ZHH A;  4ZTK A;  1KVM A;  1YLJ A;  5HX9 A;  2ZQA A;  2IWB A;  1TDL A;  3V3R A;  3G34 A;  4XUZ A;  2JC7 A;  4OPR A;  1PIO A;  3IHB A;  3PBO A;  2WAD A;  3IF6 A;  1K4F A;  4KG2 A;  2ZQ8 A;  3G30 A;  4NET A;  1K54 C;  2H0Y A;  3A3I A;  4P85 A;  5D3O A;  3SH9 A;  2DCF A;  3DWK A;  4GN2 A;  4QD4 A;  3TOI A;  4EBN A;  2FFY A;  2Y2K A;  4B4X A;  1AXB A;  1E3U A;  2Y2I A;  1L0D A;  1XA7 A;  1NJ4 A;  5CGS A;  2IWC A;  2Y2G A;  1FOF A;  3LO7 A;  4WZ5 A;  3ZCZ A;  4R3B A;  4K91 A;  4B4Z A;  3Q07 A;  4LV3 A;  5FI7 A;  3IF5 A;  4S2N A;  2WUQ A;  3MXR A;  4DE3 A;  5FQ9 A;  3ZG8 B;  3OZH A;  1HVB A;  4ZAM A;  4ZDX A;  3HL9 A;  3O86 A;  4JKT A;  3Q7V A;  4P87 A;  2P9V A;  3PBT A;  5FDH A;  4S2J A;  2Y2N A;  1O7E A;  1BSG A;  2HP5 A;  5TGF A;  3NI9 A;  4M3K A;  1ZC2 A;  4OPZ A;  5F83 A;  5CGW A;  1BUE A;  5HL1 A;  2XLN A;  2V1Z A;  2Y2L A;  4RA7 A;  2Y55 A;  1JWP A;  5AQB A;  4E3L A;  1ALQ A;  1MXO A;  4OOM A;  3E2K A;  3IF6 B;  4LCM A;  3UDF A;  2WAF A;  1PW8 A;  4KZ5 A;  5TR7 A;  1SHV A;  4DE1 A;  1PWC A;  1U60 A;  3CZD A;  5CTM A;  5FQJ A;  4S2M A;  2ZC3 B;  5CEB A;  4O7D A;  2X01 A;  1BZA A;  1K55 C;  2PU4 A;  5FSR A;  1SDE A;  3TSG A;  1YQS A;  3WS4 A;  4DE0 A;  1NZO A;  2RCX A;  2J8Y A;  2GDN A;  1MKI A;  3P98 A;  3NCK A;  4Y7P A;  4EBP A;  1I2S A;  5I94 A;  4S2P A;  2HDU A;  4Z9Q A;  1HTZ A;  2Y91 A;  2OV5 A;  2XEP A;  3DWZ A;  2OLV A;  4CPK A;  3C4P A;  5E2H A;  3WS0 A;  3BEB A;  5EEC A;  1HD8 A;  3VP4 A;  3MBZ A;  2P9V B;  1SKF A;  1NZU A;  3N6I A;  4LEN A;  4LV2 A;  3QNB A;  5KMW A;  3UDX A;  4S2I A; 
#chains in the Genus database with same CATH topology
 2YFV A;  2XRO A;  4E3O A;  1OTA A;  5CGX A;  3IH9 A;  3IH8 A;  3F1P B;  3AZH A;  4X6T A;  3K3D A;  2OAP 1;  4XT2 B;  3VH6 W;  2PR6 A;  1LLB A;  4IUK A;  4PKY G;  1DP9 A;  2D02 A;  4J8V C;  5CPJ B;  2W1T B;  4I3J A;  4GHI B;  3ISG A;  1F9I A;  1TD5 A;  4BMW A;  1KE3 A;  3B6G D;  4MLL A;  5GSU A;  3RXW A;  3MZE A;  1AOI D;  4HNB A;  3AZI D;  3C1C C;  3SS5 A;  4YS3 B;  2VV7 A;  4X69 A;  1H0I A;  2C5W B;  3F1N A;  1AIW A;  3MKF A;  3X1T A;  1NRJ A;  2DNS A;  4XUJ C;  4AWL B;  4DQY B;  1KGE A;  3REH B;  3MQQ A;  3UPN A;  3T4O A;  4NG2 A;  3JPU A;  4I3A A;  2F8N G;  3VE4 A;  1H8Y A;  2D01 A;  1FIL A;  2W3F A;  3M2J A;  3IWQ A;  3UTB C;  5A92 A;  4B88 A;  5GXQ D;  4CLC A;  5HAP A;  1P3B B;  4AFI A;  4FH4 A;  1EQZ B;  3LEQ A;  4E3J A;  1VEU A;  3MF0 A;  2K2N A;  3BFD A;  4WU9 A;  5GHZ A;  2EXA A;  1XJ6 A;  1ID3 C;  2QHK A;  4H8R A;  4JJN A;  1XFN A;  1P9W A;  3CI6 A;  3M6B A;  3IS2 A;  4RVA A;  2F8N D;  2EFX A;  5E2E A;  3AZF C;  3UB9 A;  2Y2J A;  5AVC A;  3FKW A;  3WKJ B;  2ZMA A;  4GDB A;  2ARO A;  3D4F A;  1K56 A;  3A6N B;  5M19 A;  3CIT A;  4ZRR A;  3G35 A;  3W2Z A;  3UB5 P;  2WGV A;  1N4O A;  5B0Y B;  1GSX A;  5EVI B;  2A3U A;  4GZB A;  2F8N H;  5A8B A;  1P3G A;  5HWW A;  1GSW A;  1E88 A;  5DVA A;  5G18 A;  3X1U B;  3REK C;  3W4O A;  4Y0T A;  1P3L C;  1P97 A;  3W97 B;  3MGR C;  3MFD A;  1BLS A;  2NZD D;  1PRQ A;  4PM8 A;  4EUZ A;  3C1B A;  4NE3 A;  4ARZ B;  2EX8 A;  3A0S A;  1YLW A;  3H0L C;  5AQA A;  1SZV A;  4XZQ D;  3X1S C;  3GR2 A;  2L0W A;  1DY6 A;  2Y8H A;  4JPM A;  4DDS A;  5B40 A;  2GNX A;  5GT3 D;  2W0N A;  3MMH A;  3IF6 C;  1TZY A;  5KDM B;  3A1K A;  4HGA C;  3ZNT A;  3OOV A;  3LR0 A;  3BM6 A;  3X1V C;  2P08 A;  1YMS A;  3N7W A;  1DP8 A;  5EOE A;  1YT4 A;  2WGW B;  3WRT A;  4S2N C;  3MVD C;  2ZC5 B;  3NIA A;  1VHM A;  2PBY A;  3E4O A;  4PM6 A;  3ZVT A;  2HGV A;  2A24 A;  3DBA A;  5B0Z A;  1UR9 A;  5BT1 D;  2JKT I;  4L0L A;  4FCF A;  3ZG0 A;  3O3V A;  4XUX A;  4J8V D;  5U47 A;  2RL3 A;  1F66 A;  3QNC A;  1GA9 A;  1K57 C;  3T4S A;  3UNW A;  3NOT C;  4PM7 A;  1V9Z A;  2Q9N A;  3WRZ A;  5E2F A;  2HUE B;  4YNR A;  5CRF A;  1M1A A;  3B6F A;  5AV8 B;  2PHY A;  3WD1 A;  1EWZ A;  2W3G A;  4XUJ D;  3UE3 A;  2FZ0 A;  1EI5 A;  1MC0 A;  4JXW A;  5HAI A;  1LSV A;  1P3A D;  1P3I B;  5DNM C;  5B33 C;  2XF3 A;  4ZJ3 A;  5AVB C;  3WA9 B;  3W96 C;  5B31 B;  4OPY A;  5CHJ A;  5F1F A;  3AV1 D;  5F82 A;  1FQG A;  2WKH A;  1FCN A;  3ZFZ A;  4Q8I A;  3UTB D;  3NDG A;  4YM6 B;  1PWG A;  1AOI A;  2M7U A;  4QB8 A;  1OPX A;  3M6H A;  3AZI A;  3LFV A;  4PM5 A;  2KOI A;  4DJ3 A;  3AZN C;  5IU1 A;  2J80 A;  5B2I C;  5MC7 A;  4IBG A;  1ID3 D;  5CPK A;  4KZ7 A;  4R8P C;  5GSU C;  1GCE A;  4ZUX D;  4R6L A;  4DF6 A;  5B1L A;  2YFW B;  4R1G A;  2HV1 A;  1V9Y A;  4O01 A;  3FYZ A;  5CX7 A;  2XDM A;  1ZG4 A;  4PKY A;  4UA7 A;  2ZC7 A;  4WZS B;  4WEL A;  3ZG7 B;  3X1T C;  4XXR A;  4H9S A;  2B02 A;  2FJ7 D;  3HBR A;  1YSP A;  4H9N A;  5GXQ A;  3KSF A;  4Z66 B;  3B0C W;  4KEN B;  3UMD A;  4MB5 A;  1N9O A;  4WU8 C;  5M18 A;  1YU1 A;  2J7V A;  5CPI D;  4WJ3 C;  2JKR M;  4Z2G A;  1PZR A;  2ZM2 A;  5F68 A;  4LD9 C;  4JGQ A;  1VET B;  2ZY4 A;  1CEG A;  1XGI A;  1GXD A;  4MN7 A;  1FR6 A;  3O62 B;  3MGQ D;  1DJB A;  3P7N A;  3GRJ A;  3HUN A;  1W1Y A;  3W99 B;  4KUD B;  3IHA A;  1KDW A;  5AY8 C;  1SDN A;  3C5A A;  1O6I A;  4ZJ1 A;  1CK3 A;  5DF9 A;  1JNU A;  4H9Q A;  1P3P B;  1MBL A;  4KQR A;  1F5M A;  1ERO A;  3KUY D;  2Z6C A;  5AV9 B;  3GVB A;  4X23 D;  1YLZ A;  4ID4 A;  3UTA B;  4JF5 A;  5GT0 B;  3EQV A;  4A5R A;  4Q0I A;  2PDR A;  5GLB A;  4O0P A;  3AGD A;  1MWU A;  5AVC C;  3AZL B;  2ZM8 A;  3N4I A;  2ARO C;  4UA6 A;  4BD1 A;  3K2N A;  2FN2 A;  5JYO A;  1P34 B;  3L28 A;  2CC1 A;  2EXB A;  3NBL A;  3AZJ A;  1KX5 B;  5F69 A;  1HQ3 C;  4PHT A;  1G28 A;  3PAG A;  5G4Z A;  3NJA A;  4I3I A;  4OQI A;  2PU2 A;  1SKO B;  3HUM A;  5AQ9 A;  4Z2M H;  1IKG A;  3I7J A;  3LIF A;  4Q0J A;  3VSK A;  3LZ0 B;  3AZM B;  1M40 A;  3FPW A;  3ZVW A;  4OPQ A;  2PYO D;  2V8F A;  3HLC A;  2JSS A;  3AYW B;  4E04 A;  4J8U C;  2EA9 A;  3G2Z A;  5C5K A;  5E5A D;  1Y28 A;  5GT3 A;  4JXS A;  1CJF A;  3C1B C;  3LZ1 B;  1CEF A;  1TF1 A;  2Z2L B;  2PR5 A;  2IOU A;  1XJ4 A;  1T1B A;  3PAE A;  3REL A;  5G49 B;  1JWZ A;  1L0E A;  3HLB A;  3B33 A;  3MQ0 A;  5B40 C;  1KX4 B;  5DTS A;  1TZY C;  2F2A C;  4ZTK A;  1M18 D;  5HX9 A;  1ZHH B;  4XUZ A;  2JC7 A;  3PBO A;  4HH3 A;  4RQ9 A;  5C3I C;  4UQI S;  1K4F A;  5AVB D;  3A3I A;  5D3O A;  3W96 D;  4QD4 A;  2BYM A;  3TOI A;  1E8B A;  2O99 A;  4J8V A;  4WNN B;  5CGS A;  3AZG C;  4NZ5 A;  3IX3 A;  5FI7 A;  3H7W A;  5B0Z C;  3MXR A;  4WUJ A;  5FQ9 A;  4ZAM A;  4JKT A;  5B24 C;  3CLO A;  4P87 A;  5B2I D;  4L9E A;  4S2J A;  1H3O A;  1BSG A;  3VOL A;  5B2J D;  1OT9 A;  1KU5 A;  2LY8 A;  5AVF A;  5HL1 A;  2Y2L A;  4UEY A;  4IHQ A;  4XUJ A;  2Y55 A;  5AQB A;  2WAF A;  1P3A A;  1U60 A;  5FQJ A;  1CQA A;  4NE6 A;  3RFB A;  2ZC3 B;  1DRM A;  4O7D A;  5HWT A;  1BZA A;  4JJN B;  2X01 A;  5CEB A;  3B6F C;  1SDE A;  2RCX A;  3AZE B;  4Y7P A;  5AV6 D;  3AV1 A;  2RTS A;  1S4R A;  3UTB A;  1HTZ A;  4CPK A;  5E2H A;  3WS0 A;  1E15 A;  3PXP A;  1B6W A;  3MBZ A;  5CP6 D;  1SKF A;  5B32 B;  4YOF A;  4LEN A;  3FG8 A;  1LL8 A;  5KMW A;  3UDX A;  1ID3 A;  1P3M D;  3MJQ A;  1NYM A;  3B6G C;  3VH5 W;  2INW A;  4LV0 A;  4GLQ A;  4ZUX A;  1FSY A;  3AZI C;  1P0Z A;  3R7W B;  5AY8 D;  2F8N K;  3KXB B;  2DMW A;  1LL9 A;  3LEL B;  4LFU A;  5F99 B;  4IBK A;  4OQH A;  4HI4 A;  3HRE A;  3LJA B;  2FJ7 A;  5A93 A;  4HBU A;  3OPP A;  3UPO A;  3CG5 A;  2VJW A;  4GD6 A;  4G91 C;  3BQ8 A;  5CPI A;  2ZM5 A;  3FWL A;  3JVU A;  2HDS A;  4H9S C;  2P74 A;  2WZZ A;  5B1M B;  3MNN D;  5BOH A;  3G4P A;  3KWQ D;  4N9K A;  5FAQ A;  1C3B A;  3LEZ A;  3AFA C;  1CI9 A;  4G92 B;  1HQ3 D;  4HME A;  4Z5T B;  4QLC D;  3LIC A;  3N8S A;  2D49 A;  2DRW A;  5F6A A;  3VSL A;  1MY8 A;  4RX2 A;  3RJU A;  2O0Y A;  3B0B A;  2Y79 A;  1ODV A;  3MGP D;  1ZLA B;  3OCN A;  2W27 A;  4NZ4 A;  4OJO A;  3TU4 D;  1S32 D;  3KUY A;  5JRG B;  1P9R A;  3MGS D;  3IT9 A;  3REI D;  1A0K A;  2IWD A;  2Q9M A;  3BW6 A;  1P3F B;  1CXW A;  3QP8 A;  3TW8 A;  1XKZ A;  2IO5 C;  4X23 A;  2HP9 A;  4WEJ A;  4KZ9 A;  2ZD8 A;  2XH9 A;  3N8L A;  3LCE A;  3W8K A;  3REJ B;  3TG9 A;  4UUZ B;  4P6B A;  1UGU A;  2Q0O A;  1W1P A;  3OBF A;  3WS2 A;  5JYP A;  4U3T A;  4GS9 B;  5FAS A;  4NK3 A;  4KG6 A;  5IHV A;  3IWO A;  4F3L B;  3OPR A;  2XFS A;  5FEF A;  2CV5 B;  3MVD A;  5FUG A;  2VKS A;  5FQQ A;  1M1A B;  1Q2P A;  1E6Z A;  4O8G A;  3EQU A;  3T12 B;  4X25 A;  1YMX A;  3Q1F A;  5L8M A;  4M6B A;  1Y54 A;  1KX3 D;  2PYO A;  1G6O A;  5TBM B;  2XR0 A;  5E5A A;  1PYY A;  1RCJ A;  3W98 D;  5F1G A;  1K57 A;  2NZD C;  2K7S A;  3FC7 A;  3O87 A;  4HES A;  4HEF A;  2OOL A;  3A1I A;  4KQQ A;  3WD4 A;  1W2E A;  5B24 D;  4XZQ C;  3FKE A;  4ZBJ C;  3MZD A;  3E2L A;  5DNN B;  4QU3 A;  3AV2 B;  3P09 A;  3UDI A;  3MXQ A;  4JXG A;  5GT3 C;  5E2G A;  4OJL A;  1M18 A;  3MQL A;  3V3S A;  3G6O A;  4E3M A;  5A91 A;  1NY0 A;  3AZK D;  5CPK B;  1G6A A;  1M19 B;  5AVB A;  2G5I C;  3NC8 A;  3S7Q A;  5B1L B;  3A6N C;  3W96 A;  1J9M A;  2V2F F;  1MWR A;  3EEA A;  3PHY A;  1ESI A;  3WAA D;  2VGL S;  3MZF A;  3O5Y A;  2W3H A;  4G3W A;  5BT1 C;  3S1Y A;  3AZN A;  2B95 A;  4H9N B;  5B2I A;  1LI9 A;  3IX8 A;  1LSX A;  4KZ8 A;  5B2J A;  5GLD A;  1PZO A;  4R8P A;  4JGO A;  3NQJ A;  1BUL A;  4KHA B;  1ULY A;  5DJU A;  2V1A A;  2X02 A;  3UY6 A;  5KZH A;  5FI2 A;  4M4X A;  2K31 A;  5TJJ A;  4J8X D;  4GD8 A;  1NRF A;  2NQB B;  5HPI A;  3AN2 B;  1K38 A;  5FAP A;  4OLG A;  3B47 A;  5J7E A;  2J8P A;  5AV6 A;  1E3U D;  4HMD A;  1N9L A;  4S2O A;  3T1Q B;  4PPR A;  1P3A C;  4HQA A;  4H9Q B;  1MZU A;  3KSI A;  1I5Q A;  4WU8 A;  4KGC D;  1G5U A;  3H0M C;  1P3K B;  4IBD A;  2VK3 A;  4R4R A;  5CP6 A;  3L2A A;  1J3W A;  3AV1 C;  4EEP A;  1MWS A;  5BNV A;  4LD9 A;  1FSW A;  3AFA D;  4LG2 A;  3UT9 D;  1P3M A;  3KS4 A;  3S22 A;  3LGO A;  5GLA A;  5AY8 A;  4MBF A;  1IYS A;  2XQZ A;  3AZJ B;  4H9O A;  4KZ3 A;  1YU4 A;  4ZUX C;  4EV4 A;  1ED7 A;  4HHD A;  4IBE A;  4S2L A;  5CPJ D;  3F1O B;  3GTC A;  1JFI B;  2QJ7 A;  3ULF A;  4OKP A;  4UQI M;  2L1M A;  3DAV A;  3HLG A;  1U35 B;  3UB8 A;  4YS3 D;  3MNN A;  2FJ7 C;  4GNU A;  4II7 A;  2DF4 C;  3S7P A;  2XFT A;  1YPR A;  3KWQ A;  2HUE C;  2Y59 A;  3O88 A;  3Q7Z A;  3HLW A;  4EUV A;  3DW0 A;  3FZC A;  1GSV A;  5CPI C;  4HP9 A;  1HQ3 A;  3A3J A;  3BEC A;  4DJ2 A;  2J3W A;  4QLC A;  4C3Q A;  1OME A;  4NEE D;  1IYP A;  3WTP B;  4DRB A;  3MGP A;  3REH D;  4D2O A;  1BYW A;  5GHX A;  1M6K A;  3TU4 A;  3MGQ C;  3REL B;  1S32 A;  4HOI A;  1P3O B;  2Z2M B;  3MGS A;  1S6R A;  3R45 B;  1IYO A;  1L6J A;  1BT5 A;  4G3V A;  2WYX A;  1KGF A;  1W8Q A;  3P5J B;  1P3B D;  2A2L A;  4J8U A;  3OCL A;  3RXX A;  2V1B A;  3EWK A;  5KIZ A;  1W79 A;  1EQZ D;  3KUY C;  4OQ0 A;  2WGI A;  1YU0 A;  3L27 A;  3HVF A;  1YM1 A;  4IBX A;  1W8Y A;  1FR1 A;  4X23 C;  3LI8 A;  3NQU A;  3MKE A;  1OGB A;  3VMA A;  3GQZ A;  3IXD A;  2KDK A;  5LBR A;  2EWW A;  1K6R A;  1X0O A;  1I2W A;  1PW1 A;  3H7W B;  4MMN A;  3LID A;  2GJ3 A;  2P04 A;  3L9K A;  3C1C B;  4GHL A;  4G3K A;  4GB7 A;  1TAF B;  5F5Y A;  3CHW P;  1JVJ A;  3ZNY A;  3LR4 A;  3KYQ A;  3WKJ D;  4KZ6 A;  4FH2 A;  4EES A;  3A6N D;  1KX3 A;  2C6W B;  4GKU A;  1S66 L;  2BYK B;  1NYY A;  3VOZ A;  3AZG A;  2ZL1 B;  2JKR I;  4B93 A;  5B0Y D;  2QPN A;  4J8W B;  3QHY A;  2PYO C;  3LI9 A;  5GLC A;  4ZBE A;  3IXH A;  4LRY C;  4JGR A;  1KGG A;  5L2F A;  5B24 A;  2Y2M A;  3BY8 A;  5EVI D;  1ESU A;  5E5A C;  2ZJ9 A;  4LV1 A;  5JA4 A;  4OUI A;  4NY2 A;  5HPF A;  5L09 A;  3IQA A;  3GEC A;  5DTT A;  1ERM A;  1FCM A;  3X1U D;  4QHC A;  3LUQ A;  3VP0 A;  1P3P C;  4N1H A;  2W1R A;  4R23 A;  3AZK A;  3W97 D;  4S2K A;  5AV9 C;  3S7N A;  5CEC A;  1M18 C;  3FDD A;  2QKP A;  5GT0 C;  2Y2Q A;  3ITA A;  3AZF B;  3WD0 A;  3C30 A;  3N3F A;  3V67 A;  4DXB A;  2V9A A;  3UE0 A;  5HWV A;  5BO0 A;  1K4E A;  4OQG A;  3A3E A;  1LI0 A;  4H9P A;  4HH2 A;  3HON A;  3QP4 A;  3ZHH A;  3B6G A;  1KVM A;  5DFY A;  4EER A;  1YLJ A;  1TS0 A;  2ZQA A;  2IWB A;  4KUO A;  3T4J A;  1PIO A;  1FIK A;  2WAD A;  3EPH A;  2ZQ8 A;  3G30 A;  4J8X A;  1H8M A;  4HJ6 A;  5FL3 A;  5B2J C;  3SH9 A;  2DCF A;  4GN2 A;  2FFY A;  1OGG A;  2KLI A;  2PD8 A;  3T1X A;  3TE8 A;  1BH9 A;  1E3U A;  4I38 A;  1NJ4 A;  4H6J A;  2IWC A;  4MB3 A;  3REK B;  2PAV P;  5B31 G;  2E8J A;  2HJ9 C;  4Y17 A;  1P3L B;  4B4Z A;  3IF5 A;  4KGC A;  3MGR B;  4DE3 A;  1HVB A;  3LZ1 C;  3O86 A;  3Q7V A;  2P9V A;  3PBT A;  5AV6 C;  2Y2N A;  4FUW A;  1KOU A;  2V0U A;  3X1S B;  1BUE A;  3AFA A;  3SW1 A;  4Z2M G;  3UT9 A;  1T1A A;  2AVX A;  2V1Z A;  5AV8 D;  1MXO A;  5CP6 C;  3E2K A;  3IF6 B;  4LCM A;  3UDF A;  1PW8 A;  3C8C A;  1PWC A;  5CTM A;  4MN6 A;  1YU2 A;  1P3I D;  4H9R B;  3X1V B;  3TSG A;  1P3M C;  1YQS A;  2V0W A;  3WS4 A;  1PNE A;  3F1P A;  4XT2 A;  2ZY2 A;  5AV5 B;  3WA9 D;  3T4T A;  5B31 D;  4EBP A;  4S2P A;  3L29 A;  2HDU A;  1T3U A;  2XEP A;  2F8N A;  3MVD B;  1BH8 B;  5CPJ A;  2W1T A;  4GHI A;  4YM6 D;  1NZU A;  2HIO B;  4WL9 A;  3BJN A;  4Z2I A;  2W3D A;  3H82 B;  4YS3 A;  3QNB A;  4S2I A;  3KO6 A;  1A7W A;  1N1J B;  2VGL M;  3MXS A;  5HFO A;  1ES2 A;  3MNN C;  1DP6 A;  1H8P A;  3KWQ C;  3REH A;  3KSH A;  3V39 A;  2E8I A;  1YSQ A;  5BNX B;  4QLC C;  1HZO A;  3QP1 A;  2WKR A;  4IJE A;  3K3C A;  2HPB A;  3MGP C;  4Z66 D;  3PBR A;  5DNM B;  3TU4 C;  1S32 C;  5B33 B;  3V9R B;  1EQZ A;  5CHU A;  5B32 C;  4BWI A;  4Z2L A;  2NZD A;  3MGS C;  2YFV B;  3REI C;  2PYR A;  3IXB A;  4IBJ A;  1S4S A;  3IBJ A;  5FQI A;  4XZQ A;  2J9P A;  3O62 D;  2JBF A;  2Y2P A;  4KZB A;  1ERQ A;  2JN7 A;  4E3K A;  3DTE A;  3W99 D;  3AZH B;  4KUD D;  2ZMV A;  4KUK A;  4NXG A;  2G7U A;  3CPT A;  2CWE A;  2A49 A;  3AZN B;  3IXG A;  4E6X A;  2ZOH A;  1P3P D;  1ZKJ A;  3VP2 A;  3CUE C;  5F99 C;  3U2A A;  4R8P B;  5GSU B;  1J7M A;  3LYX A;  4X1L A;  3NQJ B;  5AV9 D;  3LJA C;  1OJ5 A;  3A6N A;  3VP3 A;  5AJG A;  3UTA D;  1WA9 A;  5GT0 D;  1H5X A;  1TDG A;  2HDQ A;  3KYE A;  3F1N B;  3AZL D;  3OPL A;  5CXW A;  3X1T B;  1KE4 A;  5B1M C;  5B0Y A;  1KX3 C;  1UWP X;  4ZJ2 A;  3HCY A;  1P34 D;  2M7V A;  2UWX A;  1IKI A;  2CMN A;  4WU8 B;  1KX5 D;  1XA1 A;  3E4P A;  2ZBB A;  3W98 C;  1W7F A;  4Z5T C;  4PM9 A;  2WK0 A;  2O9B A;  1ZLA C;  3NEC A;  1QME A;  4LD9 B;  4MBK A;  3PYP A;  1GPF A;  4CLC B;  3W97 A;  4PAU A;  1B67 A;  3V5M A;  3VOY A;  4E44 A;  1E6P A;  3VH6 A;  1BLP A;  1T19 A;  3LZ0 D;  3AZM D;  5FAT A;  5DKK A;  1P3F C;  1T18 A;  1VEU B;  4ARZ A;  3L26 A;  5E43 A;  3AYW D;  2QZ6 A;  4WU9 B;  1RGZ A;  1TS7 A;  3AZK C;  5HD5 A;  5KDM A;  4DXC A;  3IS2 B;  3LZ1 D;  4L9G A;  4Y0O A;  2JCH A;  1L0G A;  4CLC E;  1WE4 A;  4MBH A;  3E0Y A;  3WAA C;  4KQO A;  5FAO A;  3BFC A;  5AVC B;  3BLM A;  1GHI A;  4OOY A;  1KX4 D;  2WGW A;  3G31 A;  3GMW A;  1GHP A;  3E4Q A;  5KSH A;  2ARO B;  3B42 A;  1Q9C A;  4NYU A;  1F98 A;  2O9C A;  2WKP A;  2V5O A;  4QJG A;  1H0G A;  2VGJ A;  4OP5 A;  1IOU A;  4JXV A;  2EFU A;  5HDD A;  1NLY A;  1OJG A;  3KS8 A;  3HLE A;  4LRZ E;  4WV4 B;  3UN7 A;  4J8X C;  4I5S A;  1KVL A;  1P3G B;  3UE6 A;  3BFG A;  4CAY A;  1ZG6 A;  2XD5 A;  3MS6 A;  3WWX A;  1QMF A;  3IP4 C;  2Y2H A;  5EM1 A;  4F94 A;  5B32 G;  4J8U B;  1MPL A;  2V8C A;  5AV8 A;  4KGC C;  1PDC A;  3KSY A;  3C1B B;  3GV9 A;  4E3I A;  3H9W A;  4BQM A;  4HJ3 A;  4DKI A;  2MJ6 A;  1O07 A;  1LT0 A;  3UO9 A;  4BBU A;  3UT9 C;  4JJN D;  3MGQ A;  5B40 B;  3WA9 A;  5B31 A;  3AZE D;  1TZY B;  1KE0 A;  1PFL A;  2G2U A;  2FFF B;  4C75 A;  3KSG A;  2EX6 A;  1D06 A;  3G2Y A;  4YM6 A;  4OJ5 A;  4NXF A;  5C3I B;  5B32 D;  4WZ4 A;  2EX2 A;  2ZY5 A;  3QP2 A;  3MSH A;  3WD2 A;  5EOO A;  5CPJ C;  1W1V A;  1DJC A;  1H3Q A;  3DTM A;  3A3F A;  3ZQ5 A;  3AZG B;  2HP6 A;  2A24 B;  5B0Z B;  4IBF A;  4YS3 C;  4P6Z S;  2XK1 A;  1YLP A;  3KXB D;  4BLM A;  4CJN A;  3B0D B;  3LEL D;  3Q82 A;  5F99 D;  4E45 A;  1F66 B;  4NZ3 A;  1IFQ A;  3FPV A;  5HAR A;  3LJA D;  4HY8 A;  4E6W A;  4AWL C;  1ES3 A;  4WYY A;  3C4O A;  4B9O A;  1ACF A;  4L9F A;  5DJT A;  1VB6 A;  4Z66 A;  3REH C;  1OTB A;  1H8Z A;  3CJM A;  4GJ4 A;  1W63 Q;  3B6F B;  1KDS A;  2QJ5 A;  4FSF A;  3EG5 B;  5B1M D;  3LIA A;  3TJZ C;  1VET A;  3RTY A;  4WN5 A;  1P3B C;  1YU3 A;  3O62 A;  4MB4 A;  4NYY A;  2ZC6 B;  1EQZ C;  4Z5T D;  3W99 A;  4KUD A;  1Q2Q A;  2ZY3 A;  3BFF A;  1PI5 A;  1ZLA D;  1GA0 A;  3PR6 A;  5HAQ A;  1P3P A;  1Z2C B;  3CMZ A;  1OTD A;  5JRG D;  3B6G B;  2KX6 A;  1AOI B;  5AV9 A;  3AZI B;  1P3F D;  5GT0 A;  3GDI A;  3A0V A;  1S67 L;  1XGJ A;  2FH5 A;  3NOU C;  3AZL A;  3WKJ C;  1NWZ A;  3ITB A;  1W5D A;  3REJ D;  3C7V A;  5DTK A;  3R4K A;  1P34 A;  4P0M A;  1F66 D;  1KX5 A;  2YKF A;  4UHU A;  4G91 B;  3HSH A;  3NHQ A;  4N92 A;  4R4S A;  5B0Y C;  3Q7V B;  4GHA A;  4JLF A;  4EU0 A;  3D3O A;  2CV5 D;  1SKO A;  1AWI A;  2BAS A;  4UA9 A;  5GXQ B;  5EVI C;  3LY4 A;  1P3O C;  1M1A D;  3C38 A;  3LZ0 A;  3AZM A;  2EWV A;  2OLU A;  4Y0U A;  5K5B A;  5I5L A;  3MR0 A;  4LGW A;  3X1U C;  1F2K A;  3AYW A;  2R9W A;  3CAX A;  4EXO A;  1EW0 A;  5M1A A;  3W97 C;  4R0Q A;  1Z6F A;  4WBG A;  1YLY A;  1S1Z A;  3SH8 A;  5GL9 A;  4GOG A;  4OVD A;  3H0R C;  3LZ1 A;  3OLO A;  4IBC A;  1UWN X;  3T50 A;  2IO5 B;  2F8N B;  4UPK A;  4KQD A;  5DNN D;  3AV2 D;  4OJ6 A;  1W63 M;  3L7H A;  2OSU A;  5G49 A;  1KX4 A;  4EBL A;  4JBF A;  5AQ7 A;  3EOI A;  3T4Q A;  3BRM A;  2W8S A;  5CPK D;  2VQR A;  4IBI A;  3FV7 A;  3SS4 A;  1M19 D;  5B1L D;  2WZX A;  2ZQ9 A;  4Z2J A;  1TVF A;  1K6S A;  1FCO A;  1PWD A;  4WNN A;  4LRX C;  2IA2 A;  3AGE A;  4OP8 A;  4J8W C;  1ES4 A;  1K0K A;  2ZQC A;  3T1S A;  1XX2 A;  4Y2F A;  4BBT A;  5DF7 A;  3EPJ A;  1MWT A;  1E4D A;  4QY5 A;  3FKV A;  1XPB A;  2WKQ A;  3D72 A;  3JYI A;  5FDS A;  4HIA A;  2NZD B;  1ZTU A;  2XA7 S;  4EO5 B;  4NET A;  4XZQ B;  4ZBJ B;  3DWK A;  2NQB D;  2Y2K A;  5AV8 C;  2VX8 A;  1AXB A;  3AN2 D;  1XA7 A;  5GT3 B;  1L0D A;  3AZE A;  3CPT B;  1FOF A;  3LO7 A;  3LR5 A;  4MCW A;  1P3I C;  3Q07 A;  4GW9 A;  3UB6 A;  4ZDX A;  1P3K D;  3HL9 A;  5HDS A;  3EPL A;  5FDH A;  5B32 A;  4CQH A;  3WA9 C;  5B31 C;  5TGF A;  3WX7 A;  3REI A;  4CSR A;  4OPZ A;  5F83 A;  2HJE A;  2JKG A;  2QWS A;  3B0C T;  4RA7 A;  4YM6 C;  3VE3 A;  2HF6 A;  1ALQ A;  1STZ A;  4OOM A;  1SHV A;  3LIE A;  2LB5 A;  4DE1 A;  4EEU A;  3R7W A;  3WTP E;  2BYM B;  1K55 C;  3KXB A;  2PU4 A;  4DE0 A;  1NZO A;  2J8Y A;  3AZJ D;  4J8V B;  1MKI A;  3LEL A;  3NCK A;  3P98 A;  4NXE A;  1I2S A;  3CUE A;  5F99 A;  2Y91 A;  2RIQ A;  2OV5 A;  3LJA A;  2ZOI A;  4GCZ A;  5EEC A;  3VP4 A;  3JVV A;  3N6I A;  1H3O B;  3LIB A;  5CHL B;  1U35 D;  1H0M A;  1HLU P;  5B1M A;  3V3R A;  4XUJ B;  1YLT A;  3EGD C;  3BWL A;  4EQI A;  5J3W A;  4Z66 C;  1P3A B;  4EWF A;  4RX3 A;  4RYE A;  5CHM A;  5L07 A;  4E3N A;  2R78 A;  3W4Q A;  3W98 A;  1G68 A;  4Z5T A;  2BG1 A;  1L2S A;  4JGP A;  5CER A;  3ICY A;  4Z2H A;  2JE5 A;  3WTP D;  3AV1 B;  2OWJ A;  5CED A;  1ZLA A;  3UTB B;  2RVQ D;  1GHM A;  1D7E A;  3O62 C;  3REL D;  3B3X A;  1P3O D;  5AV5 C;  5JRG A;  4WZ5 C;  3W99 C;  4KUD C;  3CWF A;  1P3F A;  5FEG A;  4OLD A;  3ZG5 A;  4Z1W A;  5HDC A;  1N9N A;  4IBB A;  4OJP A;  2YKH A;  4IVI A;  4UAA A;  2HIO C;  2VA0 A;  1ID3 B;  4R3A A;  4X68 A;  2VZW A;  3REJ A;  3HLD A;  3SZT A;  4UUZ A;  4ZUX B;  1E6R A;  3PBQ A;  3UTA C;  4ETZ A;  3WAA A;  4N1X A;  4GS9 A;  5EVL A;  5GHY A;  3VV4 A;  3AZL C;  3KX0 X;  4U0X A;  1R4V A;  4CAY B;  4K0W A;  3C1C D;  4F3L A;  1BLC A;  4OOL A;  2FJ7 B;  2ZQD A;  4X53 A;  2CV5 A;  5EE8 A;  3BLS A;  1P34 C;  2VV6 A;  2H0T A;  4OH0 A;  1XXM A;  2ZM0 A;  4WMC D;  4WM9 A;  3PTE A;  1KX5 C;  3D9Y A;  5CPI B;  3KYZ A;  2EX9 A;  1IEL A;  3DTK A;  1PI4 A;  4P6Z M;  3OC2 A;  5TBM A;  2J9O A;  4ETX A;  4EET B;  1TEM A;  3MGQ B;  2BLS A;  4DRA A;  4BJP A;  3LZ0 C;  3AZM C;  3TRC A;  4J8W D;  3BYD A;  1JTG A;  3PBS A;  3M2K A;  3SOI A;  3ZDJ A;  3AYW C;  3ZGA B;  4DMZ A;  5DNN A;  3VH5 A;  3AV2 A;  4DDY A;  3SS3 A;  1MKM A;  3AZH C;  4C6Y A;  3KUY B;  5DKL A;  3AGF A;  3IBR A;  3T4K A;  5DFX A;  3BY9 A;  4X23 B;  3IWI A;  2LB9 A;  2ZC4 B;  2L5A A;  4MN5 A;  3DTI A;  1M19 A;  3BFE A;  1KX4 C;  1L0F A;  4ESP A;  2XD1 A;  1NLZ A;  4R38 A;  2XSS A;  3WD3 A;  4HGA B;  3AZF D;  4IJG A;  1CI8 A;  4HBT A;  3A3D A;  1IEM A;  5EFW A;  1LL5 A;  4BL3 A;  1RP5 A;  2QYB A;  3NUL A;  4LLO B;  2WAE A;  2O9A A;  4QPR A;  1UR8 A;  2UV0 E;  5FUG B;  2J3T C;  3ZG9 B;  3HUO A;  5FA7 A;  4EQ1 A;  4KHA A;  2PYO B;  5FQK A;  2JKT M;  3E98 A;  5EPH A;  4CLC C;  5E5A B;  1CF0 A;  2NQB A;  3VH5 T;  3EPK A;  4X55 A;  3AN2 A;  4BEN A;  4QY6 A;  1WWI A;  4WU9 C;  2XRN A;  3UME A;  3HJI A;  3REK D;  4PMA A;  4Y3I A;  4DN0 A;  1P3L D;  1IYQ A;  3NY4 A;  3MGR D;  4JJN C;  1P3K A;  2H10 A;  1W1T A;  3AZE C;  1M18 B;  1K54 A;  5TFQ A;  1BLH A;  3X1S D;  3RH8 B;  1CK7 A;  1P3B A;  4YIN A;  5BS7 A;  2R9X A;  2HDR A;  5FQM A;  1BTL A;  1YUE A;  3MFX A;  5AVB B;  5CTN A;  3W96 B;  4HP4 A;  1JTD A;  2PYP A;  3X1V D;  2NUT C;  3WS5 A;  5KSC A;  2M1C A;  4MEZ A;  4MDZ A;  5AV5 D;  2H28 A;  1XJ3 A;  3N8R A;  3MVD D;  2JKF A;  5AVE A;  3KXB C;  2QMI A;  4IJF A;  3F1O A;  4IBR A;  1JFI A;  5B2I B;  3S4X A;  5EUA A;  4QWO A;  3LEL C;  1WYC A;  2PBD P;  1P3G C;  1ES5 A;  2HIO D;  4WEK A;  5B2J B;  3WKJ A;  3LY3 A;  1D1J A;  1T1C A;  1U35 A;  2JHE A;  3UE1 A;  1K25 A;  5HW3 A;  5EV0 A;  1S1Y A;  3S7O A;  1WWS A;  1OT6 A;  4WLA A;  2BTF P;  3QP5 A;  4X56 A;  5EVE A;  3T1R A;  2Y2O A;  4I39 A;  5AV6 B;  3WTP A;  2WKI A;  2L4R A;  1VM1 A;  5EVI A;  4G92 C;  1P3O A;  3VP1 A;  2GX5 A;  3M7P A;  1XP4 A;  5CP6 B;  3R45 A;  2ACG A;  2V20 A;  5BPV A;  2XA7 M;  3X1U A;  5EM0 A;  4KG5 A;  5BNV B;  4HJ4 A;  4U0T A;  5DNM D;  5B33 D;  1P3M B;  3W4P A;  5JRG C;  4K08 A;  3HLF A;  4Z2K A;  3VFF A;  2PD7 A;  5AY8 B;  3GSG A;  4K0X A;  1LHY A;  4Y13 A;  2H5S A;  4YWZ A;  4N9L A;  4NXB A;  3OPH A;  4DE2 A;  1PZP A;  3NDE A;  1VQQ A;  4FD8 A;  4H9O B;  3AZH D;  2VLG A;  3REJ C;  1DJA A;  3C1C A;  1XJ2 A;  4KZA A;  1TAF A;  3AZN D;  1HTA A;  3UB7 A;  2OAQ 1;  3B0D C;  4WMC A;  1F66 C;  4R8P D;  5GSU D;  5L10 A;  2ZQ7 A;  1TS6 A;  1KS0 A;  3MNN B;  3MQO A;  4IUH A;  2CV5 C;  2ZLY A;  3VFH A;  4IVK A;  3KWQ B;  2BYK A;  4LCL A;  1M1A C;  2ZL1 A;  1S0W A;  5HL6 A;  1ONH A;  5A90 A;  3X1T D;  4D60 A;  1HQ3 B;  4J8W A;  1E25 A;  1JWV A;  4QLC B;  1WYB A;  5J4E A;  4FTX A;  4BL2 A;  3MGP B;  5HD3 A;  3UPP A;  4WU8 D;  3TU4 B;  1S32 B;  2OWH A;  3PBN A;  4FOF A;  2HZ5 A;  2J3T D;  3T4L A;  4BD0 A;  3C7U A;  3SH7 A;  3MGS B;  1ONG A;  3REI B;  3VH6 T;  4CSR B;  1YAX A;  3WS1 A;  4LD9 D;  2Y4A A;  4CLC D;  5DNN C;  3AV2 C;  4MNR A;  4OON A;  1NXY A;  1AOI C;  3A0R A;  1YKD A;  3Q81 A;  4EW7 A;  1SCW A;  2G2W A;  2NUP C;  4DRT A;  5FI6 A;  3V50 A;  4WU9 D;  3NQU B;  3AZF A;  1P3I A;  2WKE A;  5CPK C;  2VGK A;  2B5R A;  4IED A;  4X1M A;  1M19 C;  2G5H C;  1EAK A;  5B1L C;  2PRF A;  5IT5 A;  2I72 A;  4NE5 A;  3G32 A;  1LSW A;  3BQA A;  5AVC D;  4BBV A;  2W3E A;  4GH9 A;  3ZYT A;  2ARO D;  5DF8 A;  1K56 D;  1KX3 B;  4YFM A;  2B18 A;  5GXQ C;  3KFU G;  1K55 A;  4Q0H A;  2P7J A;  5J8X A;  4KZ4 A;  4HMC A;  4JF6 A;  4LPZ A;  2X71 A;  3W98 B;  3F6T A;  3LR3 A;  2PT7 A;  1E6N A;  1GOI A;  2YFW A;  2I9V A;  1N9B A;  1F1E A;  3REK A;  1TS8 A;  5B24 B;  1RGY A;  1P3L A;  2XGN A;  5JA4 B;  3MGR A;  2NQB C;  1P3G D;  4GDN A;  5HZH A;  4JF4 A;  3AN2 C;  4WF0 A;  3NOP C;  4R3J A;  4Y15 A;  2VEA A;  4Y5F A;  4J8U D;  3X1S A;  3AZK B;  1TDL A;  3G34 A;  3HJK A;  1P3K C;  4OPR A;  1OTE A;  3IHB A;  3EGX C;  2Z6D A;  3IF6 A;  3C2W A;  4R70 A;  4KG2 A;  3C1B D;  1Y4O A;  1K54 C;  2H0Y A;  2VV8 A;  4P85 A;  3QP6 A;  4ME4 A;  4EBN A;  4H9R A;  3X1V A;  3WAA B;  4B4X A;  5BS7 C;  2Y2I A;  5AV5 A;  2Y2G A;  5B40 D;  4WZ5 A;  3U4L P;  3ZCZ A;  1L3L A;  1TZY D;  4R3B A;  4QNL A;  5BO0 B;  4K91 A;  4LV3 A;  4S2N A;  2WUQ A;  1BH8 A;  3ZG8 B;  3OZH A;  3AZJ C;  2HIO A;  4H9P B;  1O7E A;  2HP5 A;  3NI9 A;  3P01 A;  4M3K A;  1ZC2 A;  3L25 A;  1OTI A;  3H82 A;  5CGW A;  2XLN A;  3AL0 C;  5HSQ A;  4NFT A;  3UTA A;  1JWP A;  2ZMF A;  4E3L A;  5IS1 A;  1N1J A;  1XFQ A;  4KZ5 A;  5TR7 A;  3AZG D;  4J8X B;  3CZD A;  4NZ1 A;  4S2M A;  5B0Z D;  1U35 C;  4EO5 C;  1BFM A;  5FSR A;  1BH9 B;  4TX8 A;  2GDN A;  4H6J B;  5G4Y A;  5I94 A;  2GZA A;  3IX4 A;  4Z9Q A;  4KGC B;  3DWZ A;  2OLV A;  3C4P A;  5BNX A;  3BEB A;  1QO6 A;  1HD8 A;  2P9V B;  3EEH A;  3WTP C;  1Z09 A;  4LV2 A;  2RVQ C;  4NKP A;  5DNM A;  5B33 A;  2DQN C;  3V9R A;  3AFA B;  3REL C;  3UT9 B;  3B6F D; 
#chains in the Genus database with same CATH homology
 2YFV A;  4E3O A;  5CGX A;  3IH9 A;  3IH8 A;  3AZH A;  4X6T A;  3VH6 W;  1LLB A;  4J8V C;  5CPJ B;  3ISG A;  1KE3 A;  3B6G D;  4MLL A;  5GSU A;  3RXW A;  3MZE A;  1AOI D;  3AZI D;  3C1C C;  3SS5 A;  4YS3 B;  4X69 A;  2C5W B;  3MKF A;  3X1T A;  2DNS A;  4XUJ C;  4AWL B;  4DQY B;  1KGE A;  3REH B;  3UPN A;  2F8N G;  1H8Y A;  3M2J A;  3IWQ A;  3UTB C;  5A92 A;  4B88 A;  5GXQ D;  5HAP A;  1P3B B;  4FH4 A;  1EQZ B;  4E3J A;  3BFD A;  4WU9 A;  5GHZ A;  2EXA A;  1ID3 C;  4H8R A;  4JJN A;  3M6B A;  4RVA A;  2F8N D;  2EFX A;  5E2E A;  3AZF C;  2Y2J A;  5AVC A;  3FKW A;  3WKJ B;  2ZMA A;  4GDB A;  2ARO A;  3D4F A;  1K56 A;  3A6N B;  5M19 A;  3G35 A;  2WGV A;  1N4O A;  5B0Y B;  5EVI B;  2A3U A;  4GZB A;  2F8N H;  1P3G A;  5DVA A;  5G18 A;  3X1U B;  3REK C;  3W4O A;  4Y0T A;  1P3L C;  3W97 B;  3MGR C;  3MFD A;  1BLS A;  2NZD D;  4PM8 A;  4EUZ A;  3C1B A;  4NE3 A;  2EX8 A;  1YLW A;  3H0L C;  5AQA A;  4XZQ D;  3X1S C;  3GR2 A;  1DY6 A;  4JPM A;  4DDS A;  5B40 A;  5GT3 D;  3IF6 C;  1TZY A;  5KDM B;  3A1K A;  4HGA C;  3ZNT A;  3BM6 A;  3X1V C;  1YMS A;  3N7W A;  5EOE A;  1YT4 A;  2WGW B;  3WRT A;  4S2N C;  3MVD C;  2ZC5 B;  3NIA A;  2PBY A;  4PM6 A;  3ZVT A;  5B0Z A;  5BT1 D;  4L0L A;  4FCF A;  3ZG0 A;  3O3V A;  4XUX A;  4J8V D;  5U47 A;  2RL3 A;  1F66 A;  3QNC A;  1GA9 A;  1K57 C;  3UNW A;  4PM7 A;  2Q9N A;  3WRZ A;  5E2F A;  2HUE B;  5CRF A;  1M1A A;  3B6F A;  5AV8 B;  1EWZ A;  4XUJ D;  3UE3 A;  1EI5 A;  4JXW A;  5HAI A;  1P3A D;  1P3I B;  5DNM C;  5B33 C;  2XF3 A;  4ZJ3 A;  5AVB C;  3WA9 B;  3W96 C;  5B31 B;  4OPY A;  5CHJ A;  5F1F A;  3AV1 D;  5F82 A;  1FQG A;  2WKH A;  1FCN A;  3ZFZ A;  4Q8I A;  3UTB D;  3NDG A;  4YM6 B;  1PWG A;  1AOI A;  4QB8 A;  3M6H A;  3AZI A;  4PM5 A;  3AZN C;  5B2I C;  4IBG A;  1ID3 D;  5CPK A;  4KZ7 A;  4R8P C;  5GSU C;  1GCE A;  4ZUX D;  4DF6 A;  5B1L A;  2YFW B;  4R1G A;  3FYZ A;  2XDM A;  1ZG4 A;  4UA7 A;  2ZC7 A;  4WZS B;  4WEL A;  3ZG7 B;  3X1T C;  4XXR A;  4H9S A;  2FJ7 D;  3HBR A;  4H9N A;  5GXQ A;  4Z66 B;  3B0C W;  4KEN B;  4WU8 C;  5M18 A;  1YU1 A;  2J7V A;  5CPI D;  4WJ3 C;  1PZR A;  2ZM2 A;  4LD9 C;  2ZY4 A;  1CEG A;  1XGI A;  1FR6 A;  3O62 B;  3MGQ D;  1DJB A;  3GRJ A;  3HUN A;  3W99 B;  4KUD B;  3IHA A;  1KDW A;  5AY8 C;  1SDN A;  3C5A A;  4ZJ1 A;  1CK3 A;  5DF9 A;  4H9Q A;  1P3P B;  1MBL A;  4KQR A;  1ERO A;  3KUY D;  5AV9 B;  3GVB A;  4X23 D;  1YLZ A;  4ID4 A;  3UTA B;  4JF5 A;  5GT0 B;  3EQV A;  4A5R A;  5GLB A;  3AGD A;  1MWU A;  5AVC C;  3AZL B;  2ZM8 A;  3N4I A;  2ARO C;  4UA6 A;  4BD1 A;  5JYO A;  1P34 B;  3L28 A;  2CC1 A;  2EXB A;  3NBL A;  3AZJ A;  1KX5 B;  1HQ3 C;  3PAG A;  4OQI A;  2PU2 A;  3HUM A;  5AQ9 A;  4Z2M H;  1IKG A;  3I7J A;  3VSK A;  3LZ0 B;  3AZM B;  1M40 A;  3ZVW A;  4OPQ A;  2PYO D;  3HLC A;  2JSS A;  3AYW B;  4J8U C;  3G2Z A;  5E5A D;  5GT3 A;  4JXS A;  3C1B C;  3LZ1 B;  1CEF A;  2Z2L B;  2IOU A;  3PAE A;  3REL A;  5G49 B;  1JWZ A;  1L0E A;  3HLB A;  5B40 C;  1KX4 B;  5DTS A;  1TZY C;  2F2A C;  4ZTK A;  1M18 D;  5HX9 A;  4XUZ A;  2JC7 A;  3PBO A;  5C3I C;  1K4F A;  5AVB D;  3A3I A;  5D3O A;  3W96 D;  4QD4 A;  2BYM A;  3TOI A;  4J8V A;  4WNN B;  5CGS A;  3AZG C;  4NZ5 A;  5FI7 A;  5B0Z C;  3MXR A;  5FQ9 A;  4ZAM A;  4JKT A;  5B24 C;  4P87 A;  5B2I D;  4S2J A;  1H3O A;  1BSG A;  5B2J D;  1KU5 A;  2LY8 A;  5HL1 A;  2Y2L A;  4XUJ A;  2Y55 A;  5AQB A;  2WAF A;  1P3A A;  1U60 A;  5FQJ A;  4NE6 A;  2ZC3 B;  5CEB A;  4O7D A;  2X01 A;  1BZA A;  4JJN B;  3B6F C;  1SDE A;  2RCX A;  3AZE B;  4Y7P A;  5AV6 D;  3AV1 A;  3UTB A;  1HTZ A;  4CPK A;  5E2H A;  3WS0 A;  1B6W A;  3MBZ A;  5CP6 D;  1SKF A;  5B32 B;  4LEN A;  5KMW A;  3UDX A;  1ID3 A;  1P3M D;  1NYM A;  3B6G C;  3VH5 W;  4LV0 A;  4ZUX A;  1FSY A;  3AZI C;  5AY8 D;  2F8N K;  3KXB B;  1LL9 A;  3LEL B;  5F99 B;  4IBK A;  4OQH A;  3HRE A;  3LJA B;  2FJ7 A;  5A93 A;  4HBU A;  3OPP A;  3UPO A;  3CG5 A;  4GD6 A;  4G91 C;  5CPI A;  2ZM5 A;  3FWL A;  2HDS A;  4H9S C;  2P74 A;  2WZZ A;  5B1M B;  3MNN D;  5BOH A;  3G4P A;  3KWQ D;  4N9K A;  5FAQ A;  1C3B A;  3LEZ A;  3AFA C;  1CI9 A;  4G92 B;  1HQ3 D;  4Z5T B;  4QLC D;  3N8S A;  2DRW A;  3VSL A;  1MY8 A;  4RX2 A;  3RJU A;  3B0B A;  3MGP D;  1ZLA B;  3OCN A;  4NZ4 A;  4OJO A;  3TU4 D;  1S32 D;  3KUY A;  5JRG B;  3MGS D;  3IT9 A;  3REI D;  2IWD A;  2Q9M A;  1P3F B;  1XKZ A;  2IO5 C;  4X23 A;  2HP9 A;  4WEJ A;  4KZ9 A;  2ZD8 A;  2XH9 A;  3N8L A;  3LCE A;  3W8K A;  3REJ B;  3TG9 A;  4UUZ B;  4P6B A;  3WS2 A;  5JYP A;  4U3T A;  5FAS A;  4NK3 A;  4KG6 A;  5IHV A;  3IWO A;  3OPR A;  2XFS A;  2CV5 B;  3MVD A;  5FUG A;  5FQQ A;  1M1A B;  1Q2P A;  3EQU A;  1YMX A;  3Q1F A;  4M6B A;  1Y54 A;  1KX3 D;  2PYO A;  2XR0 A;  5E5A A;  1PYY A;  1RCJ A;  3W98 D;  5F1G A;  1K57 A;  2NZD C;  3O87 A;  4HES A;  4HEF A;  3A1I A;  4KQQ A;  1W2E A;  5B24 D;  4XZQ C;  3FKE A;  4ZBJ C;  3MZD A;  3E2L A;  5DNN B;  4QU3 A;  3AV2 B;  3P09 A;  3UDI A;  4JXG A;  5GT3 C;  5E2G A;  4OJL A;  1M18 A;  3V3S A;  4E3M A;  5A91 A;  1NY0 A;  3AZK D;  5CPK B;  1G6A A;  1M19 B;  5AVB A;  2G5I C;  3NC8 A;  5B1L B;  3A6N C;  3W96 A;  1J9M A;  2V2F F;  1MWR A;  1ESI A;  3WAA D;  3MZF A;  5BT1 C;  3S1Y A;  3AZN A;  4H9N B;  5B2I A;  1LI9 A;  4KZ8 A;  5B2J A;  5GLD A;  1PZO A;  4R8P A;  3NQJ A;  1BUL A;  4KHA B;  1ULY A;  2X02 A;  3UY6 A;  5KZH A;  5FI2 A;  4J8X D;  4GD8 A;  1NRF A;  2NQB B;  3AN2 B;  1K38 A;  5FAP A;  4OLG A;  2J8P A;  5AV6 A;  1E3U D;  4S2O A;  4PPR A;  1P3A C;  4H9Q B;  1I5Q A;  4WU8 A;  4KGC D;  3H0M C;  1P3K B;  4IBD A;  4R4R A;  5CP6 A;  3L2A A;  3AV1 C;  1MWS A;  5BNV A;  4LD9 A;  1FSW A;  3AFA D;  4LG2 A;  3UT9 D;  1P3M A;  3KS4 A;  3S22 A;  5GLA A;  5AY8 A;  4MBF A;  1IYS A;  2XQZ A;  3AZJ B;  4H9O A;  4KZ3 A;  1YU4 A;  4ZUX C;  4EV4 A;  4IBE A;  4S2L A;  5CPJ D;  3GTC A;  1JFI B;  4OKP A;  3HLG A;  1U35 B;  4YS3 D;  3MNN A;  2FJ7 C;  4GNU A;  2DF4 C;  2XFT A;  3KWQ A;  2HUE C;  2Y59 A;  3O88 A;  3Q7Z A;  3HLW A;  3DW0 A;  3FZC A;  5CPI C;  1HQ3 A;  3A3J A;  3BEC A;  4C3Q A;  4QLC A;  1OME A;  1IYP A;  3WTP B;  4DRB A;  3MGP A;  3REH D;  4D2O A;  5GHX A;  1M6K A;  3TU4 A;  3MGQ C;  3REL B;  1S32 A;  1P3O B;  2Z2M B;  3MGS A;  1S6R A;  3R45 B;  1IYO A;  1BT5 A;  2WYX A;  1KGF A;  1W8Q A;  3P5J B;  1P3B D;  3OCL A;  4J8U A;  3RXX A;  1W79 A;  1EQZ D;  3KUY C;  4OQ0 A;  2WGI A;  1YU0 A;  3L27 A;  3HVF A;  1YM1 A;  4IBX A;  1W8Y A;  1FR1 A;  4X23 C;  3NQU A;  3MKE A;  3VMA A;  3GQZ A;  3IXD A;  1K6R A;  1I2W A;  1PW1 A;  3C1C B;  4GHL A;  4GB7 A;  1TAF B;  1JVJ A;  3ZNY A;  3WKJ D;  4KZ6 A;  4FH2 A;  3A6N D;  1KX3 A;  2C6W B;  4GKU A;  2BYK B;  1NYY A;  3VOZ A;  3AZG A;  5B0Y D;  2QPN A;  4J8W B;  3QHY A;  2PYO C;  5GLC A;  4ZBE A;  3IXH A;  1KGG A;  5L2F A;  5B24 A;  2Y2M A;  5EVI D;  1ESU A;  5E5A C;  2ZJ9 A;  4LV1 A;  5JA4 A;  4OUI A;  4NY2 A;  3IQA A;  5DTT A;  1ERM A;  1FCM A;  3X1U D;  4QHC A;  3VP0 A;  1P3P C;  4N1H A;  4R23 A;  3AZK A;  3W97 D;  4S2K A;  5AV9 C;  5CEC A;  1M18 C;  3FDD A;  5GT0 C;  2Y2Q A;  3ITA A;  3AZF B;  3N3F A;  4DXB A;  3UE0 A;  5BO0 A;  1K4E A;  4OQG A;  3A3E A;  1LI0 A;  4H9P A;  3HON A;  3ZHH A;  3B6G A;  1KVM A;  1YLJ A;  2ZQA A;  2IWB A;  1PIO A;  2WAD A;  3EPH A;  2ZQ8 A;  3G30 A;  4J8X A;  5B2J C;  3SH9 A;  2DCF A;  4GN2 A;  2FFY A;  1BH9 A;  1E3U A;  1NJ4 A;  2IWC A;  3REK B;  5B31 G;  1P3L B;  4B4Z A;  3IF5 A;  4KGC A;  3MGR B;  4DE3 A;  1HVB A;  3LZ1 C;  3O86 A;  3Q7V A;  2P9V A;  3PBT A;  5AV6 C;  2Y2N A;  3X1S B;  1BUE A;  3AFA A;  4Z2M G;  3UT9 A;  2V1Z A;  5AV8 D;  1MXO A;  5CP6 C;  3E2K A;  3IF6 B;  4LCM A;  3UDF A;  1PW8 A;  1PWC A;  5CTM A;  1YU2 A;  1P3I D;  4H9R B;  3X1V B;  3TSG A;  1P3M C;  1YQS A;  3WS4 A;  2ZY2 A;  5AV5 B;  3WA9 D;  4EBP A;  5B31 D;  4S2P A;  3L29 A;  2HDU A;  1T3U A;  2XEP A;  2F8N A;  3MVD B;  1BH8 B;  5CPJ A;  4YM6 D;  1NZU A;  2HIO B;  4YS3 A;  3QNB A;  4S2I A;  1A7W A;  1N1J B;  3MXS A;  5HFO A;  1ES2 A;  3MNN C;  3KWQ C;  3REH A;  3V39 A;  2E8I A;  5BNX B;  4QLC C;  1HZO A;  4IJE A;  2HPB A;  3MGP C;  4Z66 D;  3PBR A;  5DNM B;  3TU4 C;  1S32 C;  5B33 B;  3V9R B;  1EQZ A;  5CHU A;  5B32 C;  2NZD A;  3MGS C;  2YFV B;  3REI C;  3IXB A;  4IBJ A;  5FQI A;  4XZQ A;  2J9P A;  3O62 D;  2JBF A;  2Y2P A;  4KZB A;  1ERQ A;  4E3K A;  3W99 D;  3AZH B;  4KUD D;  2CWE A;  2A49 A;  3AZN B;  3IXG A;  4E6X A;  1P3P D;  1ZKJ A;  3VP2 A;  5F99 C;  4R8P B;  5GSU B;  3NQJ B;  5AV9 D;  3LJA C;  3A6N A;  3VP3 A;  3UTA D;  5GT0 D;  1H5X A;  1TDG A;  2HDQ A;  3AZL D;  3OPL A;  5CXW A;  3X1T B;  1KE4 A;  5B1M C;  5B0Y A;  1KX3 C;  4ZJ2 A;  1P34 D;  2UWX A;  1IKI A;  4WU8 B;  1KX5 D;  1XA1 A;  3W98 C;  1W7F A;  4Z5T C;  4PM9 A;  2WK0 A;  1ZLA C;  1QME A;  4LD9 B;  4MBK A;  3W97 A;  1B67 A;  3V5M A;  3VOY A;  4E44 A;  3VH6 A;  1BLP A;  3LZ0 D;  3AZM D;  5FAT A;  1P3F C;  3L26 A;  5E43 A;  3AYW D;  2QZ6 A;  4WU9 B;  1RGZ A;  3AZK C;  5KDM A;  4DXC A;  3LZ1 D;  4Y0O A;  2JCH A;  1L0G A;  1WE4 A;  4MBH A;  3WAA C;  4KQO A;  5FAO A;  3BFC A;  5AVC B;  3BLM A;  1GHI A;  4OOY A;  1KX4 D;  2WGW A;  3G31 A;  3GMW A;  1GHP A;  5KSH A;  2ARO B;  1Q9C A;  4NYU A;  4QJG A;  2VGJ A;  4OP5 A;  4JXV A;  2EFU A;  3KS8 A;  3HLE A;  4WV4 B;  3UN7 A;  4J8X C;  1KVL A;  1P3G B;  3BFG A;  4CAY A;  1ZG6 A;  2XD5 A;  3WWX A;  1QMF A;  3IP4 C;  2Y2H A;  4F94 A;  5B32 G;  4J8U B;  1MPL A;  5AV8 A;  4KGC C;  3KSY A;  3C1B B;  3GV9 A;  4E3I A;  4BQM A;  4DKI A;  3UO9 A;  1O07 A;  3UT9 C;  4JJN D;  3MGQ A;  5B40 B;  3WA9 A;  5B31 A;  3AZE D;  1TZY B;  1KE0 A;  2G2U A;  2FFF B;  4C75 A;  2EX6 A;  3G2Y A;  4YM6 A;  4OJ5 A;  5C3I B;  5B32 D;  4WZ4 A;  2EX2 A;  2ZY5 A;  5EOO A;  5CPJ C;  1DJC A;  3DTM A;  3A3F A;  3AZG B;  2HP6 A;  5B0Z B;  4IBF A;  4YS3 C;  2XK1 A;  1YLP A;  3KXB D;  4BLM A;  4CJN A;  3B0D B;  3LEL D;  3Q82 A;  5F99 D;  4E45 A;  1F66 B;  4NZ3 A;  5HAR A;  3LJA D;  4E6W A;  4AWL C;  1ES3 A;  4WYY A;  3C4O A;  4Z66 A;  3REH C;  3CJM A;  1H8Z A;  3B6F B;  1KDS A;  4FSF A;  3EG5 B;  5B1M D;  1P3B C;  1YU3 A;  3O62 A;  2ZC6 B;  4NYY A;  1EQZ C;  4Z5T D;  3W99 A;  4KUD A;  1Q2Q A;  2ZY3 A;  3BFF A;  1PI5 A;  1ZLA D;  1GA0 A;  5HAQ A;  1P3P A;  1Z2C B;  3CMZ A;  5JRG D;  3B6G B;  1AOI B;  5AV9 A;  3AZI B;  1P3F D;  5GT0 A;  1XGJ A;  3AZL A;  3WKJ C;  3ITB A;  1W5D A;  3REJ D;  3C7V A;  5DTK A;  1P34 A;  4P0M A;  1F66 D;  1KX5 A;  4UHU A;  4G91 B;  3HSH A;  4N92 A;  4R4S A;  5B0Y C;  3Q7V B;  4GHA A;  4JLF A;  2CV5 D;  4UA9 A;  5GXQ B;  5EVI C;  3LY4 A;  1P3O C;  1M1A D;  3LZ0 A;  3AZM A;  2OLU A;  4Y0U A;  3X1U C;  3AYW A;  2R9W A;  5M1A A;  3W97 C;  4R0Q A;  1Z6F A;  4WBG A;  1YLY A;  3SH8 A;  5GL9 A;  4GOG A;  4OVD A;  3H0R C;  3LZ1 A;  4IBC A;  2IO5 B;  2F8N B;  4UPK A;  5DNN D;  3AV2 D;  4OJ6 A;  2OSU A;  5G49 A;  1KX4 A;  4EBL A;  4JBF A;  5AQ7 A;  3BRM A;  2W8S A;  5CPK D;  2VQR A;  4IBI A;  3FV7 A;  3SS4 A;  1M19 D;  5B1L D;  2WZX A;  2ZQ9 A;  1TVF A;  1K6S A;  1FCO A;  1PWD A;  4WNN A;  3AGE A;  4OP8 A;  4J8W C;  1ES4 A;  2ZQC A;  1XX2 A;  5DF7 A;  3EPJ A;  1MWT A;  1E4D A;  4QY5 A;  3FKV A;  1XPB A;  3JYI A;  2NZD B;  4EO5 B;  4NET A;  4XZQ B;  4ZBJ B;  3DWK A;  2NQB D;  2Y2K A;  5AV8 C;  1AXB A;  3AN2 D;  1XA7 A;  5GT3 B;  1L0D A;  3AZE A;  1FOF A;  3LO7 A;  1P3I C;  3Q07 A;  4ZDX A;  1P3K D;  3HL9 A;  3EPL A;  5FDH A;  5B32 A;  3WA9 C;  5B31 C;  5TGF A;  3WX7 A;  3REI A;  4CSR A;  4OPZ A;  5F83 A;  3B0C T;  4RA7 A;  4YM6 C;  1ALQ A;  4OOM A;  1SHV A;  4DE1 A;  3WTP E;  2BYM B;  1K55 C;  3KXB A;  2PU4 A;  4DE0 A;  1NZO A;  2J8Y A;  3AZJ D;  4J8V B;  3LEL A;  1MKI A;  3NCK A;  3P98 A;  1I2S A;  5F99 A;  2Y91 A;  2RIQ A;  2OV5 A;  3LJA A;  5EEC A;  3VP4 A;  3N6I A;  1H3O B;  5CHL B;  1U35 D;  5B1M A;  3V3R A;  4XUJ B;  1YLT A;  4EQI A;  4Z66 C;  1P3A B;  4EWF A;  4RX3 A;  4RYE A;  5CHM A;  4E3N A;  3W4Q A;  3W98 A;  1G68 A;  4Z5T A;  2BG1 A;  1L2S A;  5CER A;  2JE5 A;  3WTP D;  3AV1 B;  5CED A;  1ZLA A;  3UTB B;  2RVQ D;  1GHM A;  3O62 C;  3REL D;  3B3X A;  1P3O D;  5AV5 C;  5JRG A;  4WZ5 C;  3W99 C;  4KUD C;  1P3F A;  4OLD A;  3ZG5 A;  4IBB A;  4OJP A;  4IVI A;  4UAA A;  2HIO C;  1ID3 B;  4X68 A;  3REJ A;  3HLD A;  4UUZ A;  4ZUX B;  3PBQ A;  3UTA C;  3WAA A;  4N1X A;  5EVL A;  5GHY A;  3AZL C;  4U0X A;  1R4V A;  4CAY B;  4K0W A;  3C1C D;  1BLC A;  4OOL A;  2FJ7 B;  2ZQD A;  4X53 A;  2CV5 A;  5EE8 A;  3BLS A;  1P34 C;  2H0T A;  4OH0 A;  1XXM A;  2ZM0 A;  4WMC D;  4WM9 A;  3PTE A;  1KX5 C;  5CPI B;  2EX9 A;  1IEL A;  1PI4 A;  3OC2 A;  2J9O A;  1TEM A;  3MGQ B;  2BLS A;  4DRA A;  4BJP A;  3LZ0 C;  3AZM C;  4J8W D;  3BYD A;  1JTG A;  3PBS A;  3M2K A;  3SOI A;  3ZDJ A;  3AYW C;  3ZGA B;  5DNN A;  3VH5 A;  3AV2 A;  4DDY A;  3SS3 A;  3AZH C;  4C6Y A;  3KUY B;  3AGF A;  4X23 B;  3IWI A;  2ZC4 B;  2L5A A;  1M19 A;  3BFE A;  1KX4 C;  1L0F A;  2XD1 A;  4HGA B;  3AZF D;  1CI8 A;  4HBT A;  3A3D A;  1IEM A;  4BL3 A;  1LL5 A;  1RP5 A;  2WAE A;  5FUG B;  3ZG9 B;  3HUO A;  5FA7 A;  4KHA A;  2PYO B;  5FQK A;  5EPH A;  5E5A B;  2NQB A;  3VH5 T;  3EPK A;  4X55 A;  3AN2 A;  4BEN A;  4QY6 A;  1WWI A;  4WU9 C;  4PMA A;  3REK D;  1P3L D;  1IYQ A;  3NY4 A;  3MGR D;  4JJN C;  1P3K A;  2H10 A;  3AZE C;  1M18 B;  1K54 A;  5TFQ A;  1BLH A;  3X1S D;  1P3B A;  4YIN A;  5BS7 A;  2R9X A;  2HDR A;  5FQM A;  1BTL A;  1YUE A;  5AVB B;  5CTN A;  3W96 B;  1JTD A;  3X1V D;  3WS5 A;  5KSC A;  4MEZ A;  5AV5 D;  3N8R A;  3MVD D;  3KXB C;  2QMI A;  4IJF A;  4IBR A;  3S4X A;  1JFI A;  5B2I B;  5EUA A;  3LEL C;  1WYC A;  1P3G C;  1ES5 A;  2HIO D;  4WEK A;  5B2J B;  3WKJ A;  3LY3 A;  1U35 A;  3UE1 A;  1K25 A;  5HW3 A;  1WWS A;  4X56 A;  2Y2O A;  5AV6 B;  3WTP A;  2WKI A;  1VM1 A;  5EVI A;  4G92 C;  1P3O A;  3VP1 A;  1XP4 A;  5CP6 B;  3R45 A;  2V20 A;  5BPV A;  3X1U A;  4KG5 A;  5BNV B;  4U0T A;  5DNM D;  5B33 D;  1P3M B;  3W4P A;  5JRG C;  3HLF A;  3VFF A;  5AY8 B;  3GSG A;  4K0X A;  1LHY A;  2H5S A;  4N9L A;  3OPH A;  4DE2 A;  1PZP A;  3NDE A;  1VQQ A;  4FD8 A;  4H9O B;  3AZH D;  3REJ C;  1DJA A;  3C1C A;  4KZA A;  1TAF A;  3AZN D;  1HTA A;  3B0D C;  4WMC A;  1F66 C;  4R8P D;  5GSU D;  2ZQ7 A;  3MNN B;  3VFH A;  2CV5 C;  2ZLY A;  4IVK A;  3KWQ B;  2BYK A;  4LCL A;  1M1A C;  1S0W A;  1ONH A;  5A90 A;  3X1T D;  1HQ3 B;  4J8W A;  1E25 A;  1JWV A;  4QLC B;  1WYB A;  4BL2 A;  3MGP B;  3UPP A;  4WU8 D;  3TU4 B;  1S32 B;  3PBN A;  4BD0 A;  3C7U A;  3SH7 A;  3MGS B;  1ONG A;  3REI B;  3VH6 T;  4CSR B;  3WS1 A;  4LD9 D;  2Y4A A;  5DNN C;  3AV2 C;  4MNR A;  4OON A;  1NXY A;  1AOI C;  3Q81 A;  1SCW A;  2G2W A;  4DRT A;  5FI6 A;  3V50 A;  4WU9 D;  3NQU B;  3AZF A;  1P3I A;  2WKE A;  5CPK C;  2VGK A;  2B5R A;  4IED A;  1M19 C;  2G5H C;  5B1L C;  2I72 A;  4NE5 A;  3G32 A;  5AVC D;  4GH9 A;  2ARO D;  5DF8 A;  1K56 D;  1KX3 B;  4YFM A;  5GXQ C;  3KFU G;  1K55 A;  5J8X A;  4KZ4 A;  4JF6 A;  2X71 A;  3W98 B;  3F6T A;  2YFW A;  1N9B A;  1F1E A;  3REK A;  5B24 B;  1RGY A;  1P3L A;  2XGN A;  5JA4 B;  3MGR A;  2NQB C;  1P3G D;  4GDN A;  4JF4 A;  3AN2 C;  4R3J A;  4J8U D;  3X1S A;  3AZK B;  1TDL A;  3G34 A;  1P3K C;  4OPR A;  3IHB A;  3IF6 A;  4KG2 A;  3C1B D;  1K54 C;  2H0Y A;  4P85 A;  4EBN A;  4H9R A;  3X1V A;  3WAA B;  4B4X A;  5BS7 C;  2Y2I A;  5AV5 A;  2Y2G A;  5B40 D;  4WZ5 A;  3ZCZ A;  1TZY D;  4R3B A;  4QNL A;  5BO0 B;  4K91 A;  4LV3 A;  4S2N A;  2WUQ A;  1BH8 A;  3ZG8 B;  3OZH A;  3AZJ C;  2HIO A;  4H9P B;  1O7E A;  2HP5 A;  3NI9 A;  4M3K A;  1ZC2 A;  3L25 A;  5CGW A;  2XLN A;  3AL0 C;  4NFT A;  3UTA A;  1JWP A;  4E3L A;  1N1J A;  4KZ5 A;  5TR7 A;  3AZG D;  4J8X B;  3CZD A;  4NZ1 A;  4S2M A;  5B0Z D;  1U35 C;  4EO5 C;  1BFM A;  5FSR A;  1BH9 B;  2GDN A;  5I94 A;  4Z9Q A;  4KGC B;  3DWZ A;  2OLV A;  3C4P A;  5BNX A;  3BEB A;  1HD8 A;  2P9V B;  3WTP C;  4LV2 A;  2RVQ C;  5DNM A;  5B33 A;  2DQN C;  3V9R A;  3AFA B;  3REL C;  3UT9 B;  3B6F D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...