4NZ5A

Structure of vibrio cholerae chitin de-n-acetylase in complex with 2-(acetylamino)-2-deoxy-a-d-glucopyranose (ndg) and cadmium ion
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
403
structure length
403
Chain Sequence
PKGTIYLTFDDGPVNASVEVIKVLNQGGVKATFYFNAWHLDGIGDENEDRALEALKLALDSGHIVGNHSYDHMIHNCVEEFGPTSGADCNATGNHQIHSYQDPVRDAASFEQNLITLEKYLPTIRSYPNYKGYELARLPYTNGWRVTKHFQADGLCATSDNLKPWEPGYVCDPANPSNSVKASIQVQNILANQGYQTHGWDVDWAPENWGIPMPANSLTEAVPFLAYVDKALNSCSPTTIEPINSKTQEFPCGTPLHADKVIVLTHDFLFEDGKRGMGATQNLPKLAEFIRIAKEAGYVFDTMDNYTPRWSVGKTYQAGEYVLYQGVVYKAVISHTAQQDWAPSSTSSLWTNADPATNWTLNVSYEQGDIVNYKGKRYLVSVPHVSQQDWTPDTQNTLFTALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Deacetylase DA1
publication title Vibrio cholerae protein
rcsb
source organism Vibrio cholerae
total genus 145
structure length 403
sequence length 403
chains with identical sequence B
ec nomenclature ec 3.5.1.41: Chitin deacetylase.
pdb deposition date 2013-12-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.90 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4nz5A02
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 4nz5A01
4HD5A 1XW8A 3QBUA 4LY4A 2VYOA 4F9JA 3CL8A 4F9DA 4NYUA 2C71A 3WX7A 1W1B1 2W3ZA 4NY2A 2C1GA 2I5IA 3CL7A 2C1IA 2E67A 1W1A1 2Y8UA 1W17A 3RXZA 2C79A 4NZ1A 4NZ3A 3CL6A 4M1BA 4NZ4A 4L1GA 5JMUA 1Z7AA 2J13A 4NZ5A 4OUIA 2NLYA 3S6OA 3VUSA 2XU2A 2QV5A 4U10A 2DFAA 5BU6A 1NY1A 4V33A 4NYYA 3HFTA 4WCJA 2CC0A 1V6TA 2IW0A
chains in the Genus database with same CATH superfamily
2BXYA 1W0MA 3CO4A 4UMCA 3MUZ1 1QI0A 1KCKA 3EWDA 1Z32X 3TTSA 3K2GA 2DP3A 2BY2A 3R13A 4QCEA 1GJPA 4WLCA 3DYPA 1SUXA 3K8MA 4JD4A 3CUGA 3ZJ8A 3ABZA 4GA8A 2FDSA 4O17A 2QGYA 4JN7A 4PUEA 4L1WA 3CXOA 3MI2A 5C54A 3MCNA 2JKAA 4Y96A 1QNSA 3W7GA 1YPXA 5C70A 1SSDA 3P74A 1QBBA 3L5AA 4PN2A 3CIVA 3V0TA 2LLEA 2XYLA 3I65A 1IXOA 3U2OA 3WQPA 2Y85A 1B4KA 2V5DA 3CMGA 3KW3A 1TPH1 3ISIX 4YNGA 1PB0A 2YB4A 1HZYA 1HO4A 1XRTA 3N1AA 4OQVA 3FOKA 3WZ0E 1H09A 1B54A 4HNUA 3B9NA 2VMFA 4O8RA 4LAOA 4DJDA 3SECA 4RW5A 2X42A 3V36A 2JK2A 5HK4A 2X1UA 2VEIA 4A3QA 5FKYA 2NV9A 3W86A 4HMNA 4IMEA 4HTBA 2QDDA 3TJIA 1F7BA 3W2KA 1IT7A 3ATYA 1FXPA 6ALDA 2Y2KA 4Q7IA 2YBUA 4XUGA 3JZEA 4HPNA 3IIPA 1CGYA 5DY3A 4O57A 1GEHA 3VNDA 1QU4A 1D3GA 1O6IA 2YCLA 1QOPA 3H55A 1UP3A 3QV8A 3NPXA 2A7NA 2Z29A 3SN4A 4K7VA 1RLDA 3NYDA 3TU9A 3G77A 2EPMX 3W1AA 4GXPA 2CZ5A 3XIMA 2YL5A 1J4EA 1EWEA 1RALA 2AGKA 3MSRA 4OJOA 1J0YA 1FWIC 3W7NA 1VHCA 3KEHA 3KOXA 3DCPA 3IIZA 2PDGA 4XZBA 4QXIA 2E09A 3BXWA 5D8WA 1CXHA 2Y5JA 1DXEA 2PAJA 5IDZA 1ZJAA 2XZ7A 3AMCA 3NQAA 1L6SA 2OEMA 3L67A 3B0XA 3HGJA 3BZGA 2GJXB 4QG9A 5D09A 2ALRA 4NG3A 1VFMA 3GZAA 1DKWA 1P7TA 3VD4A 1TWWA 1UIPA 1DORA 1D2KA 2VELA 3PJWA 3MT1A 1Z41A 2EKGA 4H9UA 4QDMA 5T9BG 1E9YB 2D69A 4JN8A 4QJ1A 2WLZA 1Z89A 2QUMA 4GZJA 3PBMA 3A6OA 3BWWA 4JKMA 1S5WA 2E6FA 4J3SA 2XVKA 3FYOA 4RDZA 3L4VA 1DWIM 3SW6A 4CVUA 1GQKA 3ONBA 4LV9A 3KL3A 1V6YA 3EZ4A 4DWSA 1J93A 3CTLA 1CIUA 4DAFA 3I3BA 2VFHA 2HVOA 4ZXLA 2QGHA 4PFMA 1SM9A 2YZRA 5C55A 2WANA 3G1DA 4JFTA 3VKJA 3WLQA 4ZBCA 2VEMA 1N7KA 3KHDA 4M56A 2PB1A 5LYRA 1QK0A 3W7IA 2BOEX 2QVNA 3ZO9A 1TREA 4LC6A 4JX5A 2Q09A 4LAZA 5CKSA 1TA3B 4DQWA 2QV5A 3QH2A 4IG2A 3VCRA 2PSNA 2DJLA 1V3LA 5TAOA 3WG6A 5JXQA 2V68A 1SFSA 1EGZA 1KFLA 2J7GA 4Z1DA 3SIMA 5C0QA 1JDCA 1J0KA 3IJ7A 2BG5A 4S2BA 4JY9A 2PDIA 3KRZA 2PUZA 4N9EA 3UNTA 4GQBA 3N15A 3TW6A 1FOBA 3VUSA 3SGUA 2NQLA 3W73A 3H2EA 4AF0A 1F8MA 3OTRA 2XD5A 1IZKA 4M6PA 1TTPA 3AIUA 1QO5A 4PMZA 4U2YA 1DTUA 5HDRA 5CCZA 1SO4A 3GBDA 4LCSA 4ZE4A 1B30A 4DX3A 3AWOA 4D6HA 2FFFB 2WVVA 3AFBA 1DPMA 3LI0A 1HQTA 4B90A 1I0DA 2GGHA 1CPUA 3MDUA 1W1YA 2HXUA 1J96A 2QAFA 3FY1A 3W6YA 2Y8UA 1TR1A 4ICCX 3ZVIA 4IPPA 1OGBA 2Z6JA 3W85A 4MWAB 3WYZA 1O1ZA 4M80A 4FS9A 2NX1A 4IMAA 2F84A 4ECLA 4LNYA 2DORA 3M0ZA 3E5PA 1YEYA 2FFIA 3LCLA 3AJ7A 4IISA 4P61A 2O55A 1P0KA 4FMVA 3LYEA 5I7GA 4JPGA 5FOOA 2A3AA 3ABOA 2FGBA 4QROA 4LVAA 4FX7A 3TQ0A 2C14A 1QNQA 2Q8LA 2FPTA 1RBAA 1XFBA 3EWXA 2OKOA 3EDJA 4QJ4B 3SN0A 2E3ZA 2Z1WA 1JYWA 2V30A 1LG2A 1W5PA 3BCFA 2Y2PA 3CQHA 4JL2A 4H83A 3BL3A 4HKPA 3IJ8A 3O05A 3AICA 3PM6A 4W7UA 2Z26A 3ENLA 4WDXA 4FXSA 1CXFA 1GOKA 3LCIA 4RW3A 3H2FA 4CQCA 1PWMA 3BQ5A 4OHQA 3WNNA 3CEPA 4AVFA 4F4RA 3TFCA 1SJAA 5C5YA 1EIBA 3GAKA 4L4LA 5CJMA 4FI4A 4E8CA 5KINA 1XLLA 2VVSA 2OZ8A 3POCA 3CZJA 2DZXA 1DJZA 1XICA 1Y65A 2GQ9A 2ZBTA 3ZT7A 4HZ8A 4US6A 3T78A 2DV0A 3NUKA 1YTEA 4JYDA 5I78A 3NYZA 1FCVA 1OC5A 4GMEA 3LRMA 3O9NA 2PDKA 4G7EA 5I6SA 4KEVA 1XBYA 1EH9A 1K3UA 6TAAA 3OLEA 3PNUA 5TF0A 4PCPA 3THDA 3REQB 1OGGA 4DZAA 1XDLA 1R2RA 1H41A 1BHGA 1R3TA 3I4KA 1QRQA 1K02A 3UD6A 1NWSA 1VLIA 4B5WA 2QXWA 1Z69A 5HJLA 2FHFA 1C93A 3AUJA 2GVJA 3PWAA 4MKVA 5HMSA 1PIIA 4I7UA 5H2ZA 4Q4PA 1K7XA 1QPKA 2WBGA 3IGUA 5I3GA 5A6KA 2CZDA 2J66A 3BURA 4I9JA 2CLFA 1ODUA 3EXRA 1JZ8A 1OGSA 3ARUA 3KTSA 2Y8VA 3HMCA 1AZ2A 1UYQA 3ARZA 4O19A 1A0DA 3L65A 4C1NA 2JF6A 2VFDA 4J3TA 5T91A 4CD8A 2EGZA 2F8QA 1OM0A 3UA4A 2PGWA 3NQVA 1UR9A 1K9TA 3WJYA 4EPEC 1XLEA 4DUOA 4PUKA 3ITYA 3KCJA 2XN0A 2I14A 4QG6A 5H91A 4PTMA 2J79A 3PPHA 5I23A 2EEXA 3VDBA 1HUVA 2AQOA 1JCXA 1X1OA 4FHAA 3ZZ1A 4KEMA 4QEHA 4NZJA 1ZNNA 4EXAA 2UY5A 2Y63A 3WO8A 2QMKA 2V82A 3B3DA 4B5XA 3TW9A 5KETA 4E2OA 4KFOA 1FX6A 2HWGA 1WKYA 2PDNA 3FXGA 3EWYA 2VX7A 2FFCA 4IPJA 3UR2A 3ZXWA 2E1WA 4ZQCA 1NWRA 5BU6A 5FD0A 3E5BA 2RJHA 4MF4A 2G95A 4MB4A 4JYFA 3EXTA 4UTTC 1TV3A 4HT3A 4BY3A 2HCVA 1G69A 1Q85A 1KO0A 4TX6A 4X0NA 3U8GA 3WF1A 4UMAA 2ZCGA 2QDHA 2HBXA 4Y9MA 1HFBA 5G4HC 4S3FA 1M6JA 4H9XA 5CJNA 3D3FA 3NO5A 3S6DA 2QCLA 3MHUA 4JGDA 4EXBA 3TTQA 1MSSA 1UR1A 3G0SA 4PC8A 1AH0A 3TN4A 1VFOA 5ECVA 1XCWA 4O54A 1W1B1 4F48A 3VX1A 1QNVA 1I2QA 1FCQA 5GNXA 4QIUA 5IFPA 3CTTA 1A5SA 1PO9A 6REQA 5CC6A 2DY3A 3RM8A 4X3ZA 3KS8A 2PS2A 1QW8A 4M6VA 3VNYA 1IF2A 1XBXA 2DGAA 4MB3A 4A6GA 5LKYA 1HW6A 1F07A 2OX1A 1BG9A 4HHMA 4L9XA 1NFBA 4F2TA 4P8UA 4KWUA 4YJ5A 3VABA 2QJGA 1ADOA 3WLSA 2FZ9A 4E3VA 3IAQA 2D20A 4DBSA 3LG3A 3GC4A 2DSKA 4N9DA 4UQCA 3STGA 3QN3A 5F4WA 3ID7A 3AHZA 1BKSA 1CLVA 3ORWA 4GJJA 5DXXA 3S5ZA 2B4GA 3ANUA 2J77A 1XG4A 2VJXA 2VX4A 3UFYA 5EBUA 4K68A 1RCQA 3TR2A 1XQKA 2PDUA 4MMWA 3AZSA 1OFRA 4CNUA 2VQUA 2NT1A 3RX3A 1V51A 3GTFA 2VGGA 3BSGA 2PDFA 2J7EA 3F4CA 5AY7A 3NVTA 4A21A 3USBA 3VKBA 3TZFA 3ITGA 4GVHA 1D7FA 4BKNA 4JTIA 3PTDA 4GOAA 1T41A 3RJXA 2WCGA 4QQ3A 3TA9A 3SCQA 1Z3NA 3EB2A 4G8TA 1W9DM 3MV01 1TTIA 2C1HA 1OIFA 2WVSA 4JFUA 2QCMA 2VR5A 4ZTXA 1ITXA 2A2IA 1FKWA 1TVPA 1EAKA 3K1GA 4QR6A 2YA1A 2CLPA 2ZZ5A 1MO0A 4TV5A 3URAA 3UR8A 5E9AA 2TMDA 4GNKB 2Z4GA 4JIIX 2YBVA 4C6DA 3SGZA 3KBVA 4L4MA 1TV5A 2Q6ZA 3GUWA 4R53A 1Q4NX 2ZUWA 4NP7A 1UBPC 1KRAC 1BWVA 2RH9A 1XLMA 4OJPA 3BSMA 4DJEA 3QC3A 3IAPA 1NWUA 1TQXA 3IVSA 3I7RA 8XIMA 3NR0A 3W1UA 4MJ2A 5GNYA 4B3ZA 3AOFA 3H54A 5A6MA 1UP2A 3TKFA 1EJVC 3HFTA 3QYSA 3HOJA 4IX0A 2BODX 4HA4A 1GVIA 5H1WA 1H11A 1XC4A 2TYSA 1BPLB 2BV9A 1KD0A 1WDRA 1H63A 2CNCA 3B4YA 6ENLA 3TQKA 5CG7A 4J2MA 2C15A 1LLWA 4I3GA 5AB3A 3EOSA 3MQTA 2WWDA 1PSCA 3B8IA 3T81A 5I3JA 1WDDA 1LRQA 4XVDA 4C6MA 2YDSA 3PUDA 4WRHA 3FA3A 4DWSC 2GUUA 1MYRA 4UQDA 3UBPC 1XJBA 3I7QA 3LX9A 3DN5A 3Q37A 1JUEA 3DFPA 3WF0A 2ACSA 3FGCB 1I1WA 4G2DA 1TVLA 4E2BA 4Q4KA 2J9YA 2OVLA 1OT1A 2E9BA 3GG7A 4O1DA 5ABFA 3PP7A 4PODA 4WQ6A 3OGVA 4EACA 5T8GA 1RJQA 1XUZA 1WBHA 3H21A 1EO5A 3E96A 3WEOA 3TN6A 1WP6A 2Q02A 4XVEA 4IBKA 3R8HA 1S3TC 2PWDA 2NV1A 1R3QA 2W62A 4F0RA 3PB0A 5F2MA 2G8ZA 1VLWA 1M7XA 3WNMA 3WQ8A 1LQ2A 4S23A 5DBTA 4LT9A 1P0BA 2IKIA 3M43A 3EX2A 3U7BA 3W71A 3HA1A 4ZQOA 4NJGA 3W7RA 4N02A 3EMCA 4JTEA 2PCQA 2XN2A 4I5RA 3VKKA 3HMJG 4N2YA 3MWAA 2BOGX 3WNKA 5XIMA 3OLGA 2DQWA 1AW1A 3C2RA 2NT0A 2YKKA 2GGGA 2NX9A 1W37A 2INZA 5EKYA 4EPDC 3ABRA 4HPHA 3PWGA 4C6CA 3TYCA 3HPFA 1HJSA 3Q4DA 1DWJM 4RPQA 3C6CA 4ZE5A 4L65A 4P2VA 3VGFA 5A6LA 5JIWA 2NQZA 1XD1A 5CAKA 2AAMA 5JBDA 2GL5A 3KL5A 5K9DA 4CCCA 1IGSA 3THCA 2BFGA 4XTIA 3WY1A 4HHPA 3CWOX 2TSYA 2P1FA 1ADSA 3V7PA 1NSJA 3UJEA 4AD3A 4M1RA 2O4MA 3VDCA 1P6CA 4UQBA 3L4UA 1SR9A 4TVDA 2QQ6A 3OVPA 3EDKA 3L28A 1XISA 3OODA 1AL8A 3W1NA 1KM5A 3W23A 1CXLA 4CU6A 4A8RA 2ZADA 2CERA 4O52A 4AY8A 4AH7A 3A5FA 1IEQA 2ADAA 3M6DA 3CUXA 1KC7A 3ARRA 3EWZA 4NSBA 3WLPA 1M03A 3PTMA 1PDYA 5FSDC 4URIA 1BXNA 1ECEA 4Z1YA 1XLAA 3JZUA 1FWEC 1KQYA 3PC0A 3L4TA 4JQ3A 1S5TA 4PMOA 4FNTA 1IZCA 1UZHA 4FLQA 3QHOA 3EKGA 4GJ1A 3IRDA 2DUZA 4RKAA 5FEZA 2Y61A 2VRQA 2QCEA 4EX4A 2YLAA 4HPJA 3TX9A 4IIDA 4RLIA 3WK3A 3NQCA 4HOZA 1LBLA 1CB2A 3ABQA 4K8EA 2X1SA 2RGMA 1AMKA 3S1UA 2AQWA 4WSHA 3VZXA 2Y2WA 1VBJA 4ACZB 3TSBA 4RV3A 3HG4A 2VX5A 3LTYA 2PDWA 2PLJA 3WUGA 1EPXA 5B80A 1PYMA 1EP2A 1VBGA 3W7PA 1JIBA 4AX7A 1ODZA 1WUFA 5A8QA 2E6AA 3I3DA 1QTWA 1EDTA 3MVIA 2OJPA 4QM1A 1LUCB 2X0YA 4CVWA 5JMUA 4W5UA 1S38A 3RO8A 2OGYA 3S3GA 1F4AA 1RLCL 5F2IA 4UNKA 1H4PA 4HNLA 1A3XA 1U5VA 4JIQA 5F1VA 3G24A 1JDFA 3CC1A 1E1CA 1E5JA 2Z2UA 3MC5A 1J7MA 3C56A 3IUDA 3VD9A 2O9OA 3P84A 3EPMA 3CLWA 4WUIA 3WLMA 4FNUA 4RDYA 1RA0A 4LCQA 3M7PA 4DJED 3QMTA 3QPEA 2WB5A 3ERPA 1PIGA 3D5HA 1ZQ5A 4DYKA 2PLCA 2QPUA 3TYUA 4LUYA 3SZ8A 4FX6M 1EDGA 1K03A 1X6NA 1SMDA 3SFWA 4E6MA 4C5ZA 3L26A 1VFUA 5CSUA 3WBYA 3WUFA 4L9ZA 1BWLA 4IXHA 2A85A 2I57A 3G1FA 1C9WA 3KDOA 3GH5A 4WKAA 2VTFA 1H7XA 3VDAA 3BH4A 2DSZA 4IHCA 1UWTA 1H61A 3H4WA 1Z48A 3L2AA 1XYBA 1HNYA 4IJRA 4PB4A 1T8XA 2W6RA 3MJMA 1PPIA 1DWGM 3ZS4A 4LBSA 4TVUA 5FEWA 3GC2A 5EMJA 1QW9A 3ZSSA 1MRQA 2XVLA 2DVTA 3BG3A 3O0KA 2Y8KA 3ZM8A 4ENLA 1Q65A 3T2QA 3RRXA 1KNWA 4GCAA 1LL4A 3P61A 3OZPA 1UJPA 2Z28A 3MVTA 1BTMA 6CGTA 2XINA 4KETA 4ZQNA 3ALGA 4GG9A 1J0JA 4ML9A 4I9TA 1K8CA 5FJRA 4NHVA 3PNZA 3BANA 4CQ9A 1CXEA 3KOYA 1DP0A 2RDXA 4FOJA 3T0DA 4FO4A 1V4YA 4REQA 1K9DA 5EFFA 4JBRA 2FZBA 3HGOA 2VVNA 5DELA 2W91A 5CZ0A 2IPFA 3ZT6A 1AQFA 3M5VA 1RP8A 4H7ZA 2DW6A 4FXRA 4O4VA 2EG6A 3CAQA 2GZXA 2XFYA 1V6TA 4MFEA 3W87A 2UY4A 3IJ6A 4GYKA 1AQ0A 3O0FA 3FDGA 2OSYA 3S2NA 1DWHM 2E5CA 1V6UA 4UWMA 3O15A 9RUBA 5BWAA 3A22A 3SRFA 3W00A 3FFSA 4R7OA 3WF2A 3CJPA 3BO9A 4UR7A 3K4WA 3QRHA 2NXGA 4DWSB 1QHOA 4KIEA 4UQEA 5HQEA 5G4WA 5BW6A 5AYBA 1OFDA 3EDDA 3UEQA 1A5BA 3APYA 2F9RA 4F0MA 2AOSA 1KS0A 1BYBA 2OODA 4MOZA 2HPIA 3VFLA 1JPMA 2Y1HA 3VPLA 4KT2A 4B9ZA 3VGEA 5I79A 1HJQA 4GUJA 3F2BA 3W2JA 3AU6A 3HQOA 4WSJA 1REQB 3OGRA 1BLIA 3VVGA 3MQLA 1OFEA 1TZ9A 3M0HA 4PR4A 3DFSA 5EMUA 5JH1A 1XYLA 2Z1SA 3CHEA 3STCA 1O5RA 4LS1A 4A8LA 1RAKA 2A1YA 3OYZA 1CGTA 3F4NA 5EU9A 2VENA 5A8MA 5HUPA 1FBAA 3W25A 3LMZA 1R3VA 3EGJA 1T99A 4Y8EA 1GZ1A 4LS0A 4IGNA 4LVBA 3AWNA 7ODCA 3OBKA 3UXIA 3UWWA 1TPUA 1J0HA 5LSMA 2VDGA 3M4HA 3MANA 1J0ZA 1IE7C 3E0FA 3GDRA 1VS1A 1JJKA 1M3UA 2AQVA 3URBA 4HBKA 1Q66A 4OGZA 1MW2A 1E8BA 1S2UA 1EA9C 3T9PA 1I1XA 2VRJA 4DELA 4GH9A 2WM1A 2WVVB 2Y2MA 1XV8A 3KP0A 1U2YA 3NOEA 3P6LA 3FJNA 4DJFA 3U5UA 3HURA 2ZVRA 1ML1A 5A2CA 4JNYA 5K3VA 1Q13A 1A5NC 3GTIA 2WHKA 3RU6A 3QSTA 3VMOA 1FP8A 1W54A 3KZPA 1K9FA 3M7SA 1XIFA 1OVDA 3G3DA 3DAQA 4ZSUA 5E6ZA 3E6EA 4IBIA 4HTYA 1NFPA 4PZVA 3NXLA 3P60A 4GNVA 1AMYA 1E6PA 4L4PA 1KLZA 3C2YA 1AA1B 4B5TA 9CGTA 3CHVA 3A24A 1UROA 3SCTA 4X2RA 4OT7A 4I9AA 3UWQA 1YMYA 1XYMA 3EBVA 4FZIA 3GE7A 2EAWA 1HJWA 1HTIA 1VEOA 1HT6A 4N9BA 1CT5A 1KCLA 2QUTA 1ZUAX 4L56A 2H6RA 5CAHA 2WM0A 5EPDA 3WLHA 2JQXA 4WF7A 3W7JA 3MMDA 3GG0A 1LWHA 1TIMA 3P2VA 4GINA 3A21A 3CT2A 1K7FA 1OYCA 4IL2A 3D0CA 2ABBA 3LM3A 5B7YA 2VD9A 5D8ZA 4AFYA 1CEOA 4J28A 2C1IA 3L2MA 4GC4A 3UPBA 1WV2A 1T7LA 1DQUA 2QJIA 4WOZA 4BF7A 3ARYA 1QI4A 1Z44A 3C0LA 1S2AA 3GAYA 2R1PA 3K8KA 1I4NA 4UFLA 1V93A 3M0XA 2CWXA 2UBPC 5CZSA 2F6KA 1QW7A 3GNNA 3WQ4A 4X61A 3B97A 3NQMA 3ZFHA 2QIWA 2X0SA 1Q2SA 4U10A 2ZWYA 2GDQA 2WMHA 3HBLA 2RFGA 4U4MA 3NSMA 3NQEA 2V8ZA 5C9ZA 5HNUA 1A4MA 5CC3A 5IM51 2GWGA 4J3XA 3GR8A 2ZRXA 3FS2A 2R8WA 3WLTA 4ZA0A 1HKJA 1A5MC 4YIWA 1Q5MA 2ZA1A 4QS6A 1K77A 3NOYA 4RDWA 4JL1A 1UQYA 3PG9A 1N82A 3MKCA 4PH6A 3RCNA 4JX4A 3N4EA 4MZYA 1WKDA 4HK5A 5E5CA 3TV8A 4MFDA 2WJEA 3LNPA 5REQA 4P7QA 2QVHA 2NQHA 2HBVA 1TJRA 2UY2A 5FL0A 3GD6A 4X60A 2ISVA 3TMLA 3L2LA 4Z0JA 3IWPA 1RVKA 3UXKA 4NZ4A 4AIOA 4M6QA 2NWSA 4E2VA 4CCDA 1GPWA 1Y5VA 1ZB5A 2X8RA 2D23A 1R7AA 3V5CA 1UOKA 3CS2A 2ZRZA 5IDIA 4OJ6A 2HRWA 3T0TA 4KCVA 1VGAA 1YDNA 3WQ6A 3GVRA 1TKKA 1HP5A 4MB5A 3WL1A 4O28A 2V0TA 3FA5A 4DI9A 4NAEB 5D04C 2QKFA 5D02A 3VIOA 4BEQA 4GYJA 2H3DA 4LVDA 1B2YA 4AZIA 5HR6A 4W88A 1HVQA 4B4FA 2VFFA 5CG0A 3ES8A 2GLKA 1AJ0A 1V0LA 1V0KA 1FA2A 4M82A 1POKA 4A4AA 1L9WA 3WD1A 1TCDA 2HS6A 5GVJA 1OCJA 5A8OA 1JI1A 5D30A 4IM4A 1P1XA 3GDMA 3OEXA 4H2CA 1L6JA 2ZFAA 2FVKA 5ECUA 2V9DA 7REQB 4PBEA 4FSAA 4GX9A 2BASA 3LQGA 2IQTA 2VQTA 1BSLA 3RILA 1V3IA 1EJUC 4UC5A 1OZMA 5G1YA 1E4NA 1MEHA 1CK7A 3TYEA 2FJKA 1E6QM 6A3HA 3HG5A 3S5OA 3PHAA 1F6YA 4O1EA 1MNSA 4MYAA 5C9WA 1P0EA 4YS1A 4ALDA 1A0CA 4LCRA 4GBUA 4M7SA 4XZ9A 5KZMA 4RE4A 2R1NA 4EAMA 3N13A 1QOXA 1TPDA 1VIWA 1FCBA 1Q6FA 3GH7A 1R9XA 3GIPA 4KCTA 1TMHA 1VPXA 3AIBA 5D33A 2YX0A 5K9XA 4ZO8A 3DC8A 5D2VA 2WSRA 2BWGA 3ES7A 2Y7EA 5TNVA 4KF1A 1SJCA 3LBCA 5G2HA 3BAIA 1ISYA 1XSJA 4XX6A 3TK7A 3F03K 3R5EA 2VM8A 3M5XA 1O5XA 1ZJHA 1WOBA 3N18A 5EFDA 3UP8A 4YPJA 4AEOA 4FOUA 4DBUA 2DQXA 1H8PA 1DJXA 1X96A 3W3OA 2RDTA 1FXQA 1SJDA 3FKRA 2W27A 1KCXA 3NM1A 4JIPA 2HV5A 3M47A 3AHTA 3AQUA 3RCYA 2TODA 2PDXA 4UFIA 1JXJA 2CLKA 2KZHA 4NASA 4QLJA 4OUEA 3QY6A 3HIJA 2PPGA 1GVQA 4H6QA 1GW9A 5AC8A 1DXFA 1FWFC 3PPFA 4C7DA 5H8MA 1KBLA 4KWOA 5C2GA 3ITCA 2WPBA 3N9RA 4NX0A 2EHHA 4S39A 1BRLB 2Z27A 3D3AA 1VYRA 2PURA 4H8HA 4IUGA 3W88A 1I0BA 5BCAA 2PP3A 5A69A 4QQUA 3B0YA 4BHYA 2OWXA 3GBEA 4AZ5A 1CDGA 3OP2A 2ZX9A 2ZRUA 3SCOA 3GR7A 3L5MA 6XIMA 1EPVA 2JKPA 3IJQA 1CTNA 1ICSA 1LDCA 3BOLA 3AS3A 2GGIA 2OEKA 3BLEA 1SR0A 3O1NA 4RNHA 1X1NA 1BWKA 4MLJA 4WKHA 2DZAA 4TTUA 1WDPA 2YOCA 3H53A 4JOMA 1E43A 3W02A 2WNQA 1QNOA 2JALA 2EO7A 3BW2A 3HG2A 4K3ZA 3F4WA 2Y6ZA 4PULA 3NGJA 3MWCA 1UWAA 4N4QA 1VBUA 4IP5A 4YU1A 4GVFA 1C8VA 2I56A 4RE0A 2XGBA 2YBTA 3BJFA 4S3GA 3SQSA 1WKFA 1YDOA 2OYKA 2G3NA 3WMBA 2DEPA 5FJOA 3KL0A 3EB4A 1V5XA 1GZJA 3QMRA 1BF2A 2CU0A 4PMYA 4A3UA 1VFFA 2X16A 3FXYA 2YPIA 2JCHA 9XIAA 1P48A 4WD0A 3INPA 1OG0A 2HNEA 1YE4A 2VCBA 4LNCA 3RO6A 4MNMA 3IK2A 4E4PA 4BI7A 3FDKA 3FAXA 3AAMA 5LNWA 4XK2A 2H90A 1HIZA 1EBGA 1PCWA 1J79A 3UQNA 1UCWA 3HQPA 4MYXA 4IGSA 1F3EA 3EOEA 4B5VA 3MTWA 1VCGA 4LYQA 5D2WA 1M04A 1DIDA 3N3FA 1TJ1A 3OU8A 4NL1A 1E71M 4QNLA 3VKCA 3QPZA 2J25A 2BDQA 4OOZA 4PCNA 1DWAM 1GOQA 1K70A 4L61A 3Q2DA 2VO5A 4GVGA 3MSDA 1QATA 4D72A 2L5HA 4M6UA 4JTUA 1R38A 3UETA 7XIMA 1ZALA 1UWRA 3TIMA 2HK0A 1H1ZA 4JX6A 4F9DA 1GJWA 2ZA2A 3RAOA 1E4LA 4M1BA 1W1PA 4RNFA 1MNZA 5EL1A 1JCLA 4WDUA 3VNKA 4RZBA 3W7KA 1GOXA 2C91A 2V3DA 1OCNA 4H9VA 4H9TA 1SZNA 3W24A 5BXRA 4MWAE 2D2GA 1JQVA 3HV8A 3R4IA 3NL5A 1YU2A 3AIVA 3LK6A 3B9AA 3BSHA 2O7QA 4HNTA 3C2OA 1F73A 1W6TA 1FQ0A 1NDZA 4JXCA 1TTQA 4DPQA 1CB7B 1LL6A 4P8VA 5KEZA 2Y2OA 2ZRVA 4DF2A 3M41A 4GNJA 3SCWA 2Y24A 1C3FA 3URQA 1W8GA 1TZZA 1U1UA 4FPSA 2RKXA 1UR8A 1ONRA 4IMCA 4BCEA 4J3WA 5G5IA 1FWDC 1QBAA 4B15A 4LG2A 1TA3A 4JNZA 1TFVA 3WQEA 4IQJA 3SAZA 3FJ4A 4IWWA 1LOLA 2PRHA 4PUJA 1JZ5A 3L25A 1YXDA 3AS1A 4AZ7A 3M0IA 2W4XA 3WBEA 3ZWTA 3N4FA 3II1A 3LBMA 4O8AA 2G0WA 4KRUA 3UJ2A 3A5VA 4J9JA 2Z1VA 3BK0A 4XAGA 2VGBA 3BJTA 4DI8A 1CCWB 3VILA 4UTKA 3O07A 3CAVA 3LHYA 3WH6A 3S46A 3LHVA 3BCJA 3DOPA 1CLXA 2PGRA 4K2SA 1LBFA 1XLKA 4E3TA 3CK5A 5HWMA 2P3ZA 3HJZA 5DT5A 4EVZA 1R87A 1A0EA 4DXVA 3W7HA 1H7OA 3E2QA 5A6TC 1D7KA 5CPNA 3MO7A 1A50A 3CQIA 1R3YA 3NO3A 1TRDA 2WKLA 3T09A 3GU9A 1UBSA 4LU0A 1GKRA 3CL7A 1CYGA 3W74A 1EF2A 4WOQA 1F6PA 2PRMA 1ME8A 2OWWA 1J2WA 3P82A 3ARQA 3EAUA 4IGMA 3NDYA 1SPQA 1PDZA 1XCFA 2QCCA 2BNJA 1GHSA 4Q8WA 4LSBA 4A8IA 3YPIA 3WJSA 4F79A 2FJUB 4XB3A 4GY0A 3RFAA 3B8VA 4NZ3A 4CLMA 2QF7A 1YDVA 2A3LA 2DVUA 1QI5A 4GD0A 1EJTC 3RITA 4PTNA 1E72M 3MSYA 4ZENA 1VBRA 1YBQA 3MS8A 4D1JA 1YX1A 2WW5A 2D1ZA 2OTDA 3VGGA 4AEEA 1RQHA 3E0WA 5JUVA 4IBFA 1TCMA 1VKFA 1JPDX 1GYMA 3LHWA 3TR9A 1ELSA 1W9VA 1UUMA 1LYXA 1PTAA 2QPSA 1FCUA 2DIJA 3L4ZA 4M51A 5FAJA 1P1MA 2GVEA 1HL9A 2C71A 4IJBA 2YR1A 3RR1A 1QO6A 3AZTA 1I75A 2QUUA 3GVGA 4ML4A 1OYBA 4CNOA 4DXKA 4PBFA 3H2NA 2HQAA 2J8GA 4X22A 4AC7C 2PDHA 3WJXA 3REQA 1O1HA 4K38A 3K8LA 4WIWA 4AZGA 3HSHA 3C8FA 1GORA 1X39A 1X38A 2H9AB 1VJZA 4V1XA 1XP3A 3OVQA 2B0MA 1VFHA 3LERA 3NSXA 5CSYA 1XBZA 3V5OA 4UTHA 1SW7A 4GI9A 1EQCA 3MZNA 1M5WA 4XZMX 1JL8A 2A21A 1SZFA 1O95A 3SUSA 3ABSA 3EA3A 3W4RA 3EXSA 4D6EA 3WDPP 5D2YA 4S3AA 2C7FA 5E1QA 3VDHA 4FNPA 1SW3A 4IPIA 2IKGA 5M03A 1UR4A 3WQWA 4RX0A 4C60A 2ONEA 4IMDA 4DF1A 1AG1O 3QFWA 3S6TA 5XINA 4GVIA 1SYTA 2J24A 1VAHA 4N7QA 1PZ1A 2F38A 3GDLA 3FYYA 3M0JA 4C6OA 4QNEA 2UZ9A 1MVYA 2W9MA 4LY4A 1TE6A 3NQ6A 1XLDA 1GYLA 2JEPA 3RDKA 4GZEA 3SSZA 2XG9A 4PCSA 3FVDA 1ZBVA 2Y7GA 4LW7A 1Y5WA 3AO0A 4XUYA 2WZTA 4P8WA 3W6MA 1YNYA 2P76A 1NJJA 2W63A 3C8NA 1XINA 2ZUMA 4MNLA 5HUOA 4ZO7A 3W0KA 3UPMA 3DI0A 3R12A 2ANUA 5BNKA 3TA6A 3Q65A 2D0GA 2VEPA 2PWGA 3W7OA 4GIEA 3QGVA 2CLHA 2FPVA 3T2PA 5LIKX 3UVIA 5DMYA 3WNPA 4CNSA 4WZHA 3NQGA 3KCOA 2J7HA 2PZNA 2QCGA 2A4AA 1UWIA 5I0DA 2VZOA 3TYBA 4PTWA 3OBEA 2C0AA 3VOHA 1OK6A 4U5KA 3B8UA 3WBAA 1ITUA 5LIUX 4P5UA 3W72A 1QAPA 2E0PA 2WZMA 3O8AA 3S2JA 1WZAA 2ATSA 1Y8BA 2DH3A 3LPGA 4E2DA 5ABTA 4WY0B 2VZTA 2AKZA 4DAIA 1W17A 3G8EA 2G4FA 3R79A 2A7RA 1EF3A 1R5YA 4EE9A 2RDWA 2XTKA 2VI0A 3S1VA 3BQ6A 5BOEA 1TSIA 1KR0A 1ISVA 1YNPA 2PD5A 1TELA 4Q6XA 3GHUA 2OCZA 5D9OA 1ZJIA 4FP1A 1JULA 3TROA 1U22A 4ADUA 5ABEA 1LM1A 2XWEA 4K8GA 2WMIB 3DFTA 3CL8A 4NILA 4H04A 4Q8MA 1OHLA 4GXWA 3LCWA 4MWAD 3LPOA 3UESA 4H6EA 3GG1A 1EP1A 3ZR6A 4QNWA 3NA8A 2QHAA 1PE1A 3P14A 1PS9A 2V2DA 1TPWA 3KS5A 1R8LA 3IUHA 4K1GA 4PL2A 1NOWA 2FQIA 2WSPA 3B9OA 3T07A 2DPEA 1G4EA 5EYWA 1OFAA 3MP4A 1ZAHA 4E0CA 3L27A 1L6YA 4A2RA 4DPPA 4ILSA 3OHMB 2EBNA 1R2SA 3S0CA 1SU5A 4O13A 3W38A 3VOCA 3LCFA 1TPC1 3A9IA 1IV8A 1CGVA 3KRUA 1OD0A 1OF8A 3QGAC 4V28A 5E70A 4IBEA 2J9XA 4GBDA 2XH2A 1R47A 3GHTA 1XKYA 1JD7A 5CGMA 2WAGA 2ZZ7A 2PDCA 3BOFA 4HU3A 2GVYA 4D6JA 2VP8A 3W84A 1AH3A 4UOZA 1KXHA 3AMDA 1E0UA 1TWIA 3POHA 1EYWA 4BJHA 1JUKA 2X05A 3LHZA 3WD4A 4TXEA 4RV8A 4UR9A 4AYGA 2GPTA 3LV6A 3N3TA 3SJ3A 4BR1A 1J0IA 1SFJA 3W81A 1SJBA 1XIJA 3QTPA 4U3CA 2V63A 3LPFA 1VFLA 2YW4A 2V2CA 1TQJA 4KRTA 3UPWA 3CASA 1I45A 4ZQPA 1QNRA 3FSTA 2PWHA 4IFRA 4O14A 2GK1B 4FR1A 2PDJA 4ZR8A 1OIMA 4JEQA 3BMXA 3TH6A 3MO4A 4E8GA 4S3JA 2BY3A 4MKSA 3ZJ6A 2VR2A 5HPCA 3DKJA 1IEXA 5IHSA 5MF5A 1TYGA 2Z2BA 2WMGA 4LPCA 1B31A 3V0SA 4UB9A 3MHFA 2AL1A 7PTDA 2POTA 1N2VA 2PTZA 1UC5A 3DERA 4AQLA 2NVDA 3Q67A 4FIRA 4CNPA 5G1MA 3SRHA 5AC7A 3EWCA 1NWTA 1FKXA 3BLLA 2V5CA 4LVFA 4NZ5A 3RN6A 3ZOAA 1A3HA 1RJRA 2PD9A 2IKHA 3QFEA 5LXXA 4RR4A 4YTSA 1G67A 3WFAA 5H6HA 1KTCA 3PTKA 4AZHA 2MANA 3NAVA 1O7AA 3K4DA 7TAAA 2VZSA 3ITVA 1VRXA 4JR5A 1YQ2A 3SCUA 1GPFA 5I09A 2VC7A 4GZIA 1T96A 1VR6A 5FJPA 2ZKMX 3ELFA 4ZO9A 2XFFA 8CGTA 4H8UA 1X7FA 1GVRA 3SGGA 4GYPC 1AH4A 3LENA 4UZSA 3IGSA 3AHYA 2NV2A 1OC6A 1M68A 3A4JA 3MBDA 4XZNX 3SN1A 1O66A 1PVNA 5D2XA 3WNLA 5AHEA 2XIJA 3DFOA 3MJYA 1AJ2A 3WQCA 4CQDA 3D46A 4PEKA 1EO7A 3KWSA 4LYPA 4N6EA 3RXZA 4F0SA 3VD5A 3CYVA 4FLRA 2DZBA 1UA3A 4HSNA 2OZTA 3KBWA 1EJRC 4DBDA 4EKJA 2VHLA 3WJZA 2VD8A 4J3ZA 1R86A 1N55A 2GUYA 1BFNA 4O16A 3DEQA 3ZVHB 4PBGA 4KQNA 1TMQA 3CUIA 1FWBC 3JUGA 3LEPA 4HNNA 1UJQA 3E49A 3H4XA 3SEPA 3I6TA 5AYYA 4PTDA 3VZYA 4DWDA 4FK9A 5EB8A 1K8ZA 3F5LA 4IIEA 1ISXA 2V5LA 3SIZA 1HN1A 1C92A 3PSWA 3VINA 2V5OA 3LSBA 3LTSA 1KM6A 5FF7A 3LGDA 1PAMA 3QW3A 3W75A 3QYQA 1LWIA 4H2HA 4R9XA 1BGGA 3B06A 5M3WA 4QS5A 1ZRQA 1QWGA 2DZWA 2FIQA 4Y9AA 5CPMA 3TONA 4OWGA 2DZPA 3VOGA 1GONA 1Z6KA 3NZ1A 1G01A 3BAJA 1XFCA 2Z7GA 3N11A 1YPIA 2OPJA 3AXMA 4HA3A 1AQMA 4IMFA 2ZRYA 1R3WA 3VTRA 1ZFJA 3EA2A 4W9TA 4JN6A 3N4AA 4UTTA 4L4OA 3VIFA 2VX6A 1V7AA 1LF1A 2CBJA 4BWLC 1DQXA 2YXXA 1W5QA 3VA8A 1ZAJA 1GQJA 3W2UA 1P6BA 5AHIA 2NSOA 3R25A 3PVFA 4YMZA 4HNVA 3B05A 4ACZA 1QJWA 5A6BA 3DYOA 3UWEA 2HSAA 3QJAA 1IXPA 1KV8A 4YXGA 1PX8A 4PCTA 3CZKA 5DXYA 4F8XA 1LUCA 1DJQA 2O9PA 3KBNA 2XGZA 4EP8C 1R3RA 2W5FA 1IEIA 4PB3A 1XLGA 4O10A 1VC4A 1Q8JA 2W3ZA 1EC9A 3MSGA 1OX4B 1WPCA 1DQWA 4PA8A 1X7IA 4X63A 1S5NA 3AISA 3AJXA 3RX4A 1TJPA 2V6AA 3VIJA 2UWFA 4IQDA 1O60A 1B9ZA 3QOKA 3OW1A 5BU9A 2NXIA 2OYMA 4OJYA 5CGQA 3N73A 4DUWA 4RE3A 4CD6A 3T7VA 4TTGA 2XGIA 4E38A 3R94A 2ACUA 1VQTA 2NLYA 4U31A 3RM4A 2QZRA 2YL6A 3LU2A 3RPTA 2OU4A 4S3BA 3H7UA 3WD0A 3TEVA 1W1TA 4RPPA 1JZ4A 5CPQA 2XVPA 1S2CA 1TZ7A 3PUOA 4GH1A 4GY1A 1CX9A 2YCKX 1XPYA 1F05A 3PBWA 4M5PA 4UTIA 1BG4A 2H8ZA 4NJHA 3I3EA 3QHMA 1H1YA 3PZQA 4PMQA 3MKKA 3W70A 3T1GA 2D2JA 1H0IA 3N14A 5BMWA 5G2IA 2ZTJA 5E0CA 1MMFA 1K4GA 2BMBA 3FKEA 2UWXA 4FALA 2ZICA 1XG3A 4LTSA 2AGTA 1RJPA 2XISA 1W3JA 3HFYA 3DGRA 3ICJA 5IXEA 1E51A 4Q8OA 1XKJA 2YA2A 2EPKX 2AKMA 4GC3A 3VI2A 3HPSA 3B40A 3IV8A 4H1ZA 4JICA 5AN7A 3VM7A 2VNCA 1TRIA 3GNOA 3DU0A 5BXPA 4FLSA 2PDBA 3BGAA 3VC5A 3QF0A 4GQRA 4RCXA 1NP0A 4HYRA 3LBOA 4Q6JA 4EOUA 1E3XA 3E2SA 5I2UA 4K8HA 4GO9A 3MYPA 1LQAA 3TZNA 3M0YA 2DH2A 3EDEA 3M46A 4ASTA 4YLWA 1GVSA 3ZR4A 3BLKA 1WDWA 2WPGA 1E4MM 1BF6A 3DUGA 2GVGA 2E9LA 1MFVA 2PTDA 3G0XA 4GGHA 3MZ2A 3F4DA 5LA1A 3MB9A 4LUSB 1UD8A 3WH7A 2YFOA 4X0VA 1L8PA 5LXEA 4JCLA 2HXTA 3EX3A 3HPXA 4B5SA 1ZY9A 3G3MA 1MZHA 3W7LA 1J2BA 1W1VA 1NY1A 2FLIA 3AMKA 4OJ5A 2W66A 4DLFA 1CGWA 4S1FA 4C5YA 1XX1A 2GQAA 5FEXA 2HS8A 1GVYA 3OG3A 4QG8A 1QNPA 4JQ1A 3AS2A 2HE8A 5AZ0A 1REQA 3LM7A 2IKJA 1KV5A 1JRBA 3RYSA 1TPVA 4JTKA 5GJMA 1N8WA 4O0QA 3UXDA 3DC0A 3GTNA 2QCDB 5CBJA 3KFTA 2VFIA 3UZJA 3U0HA 1RH9A 4HOWA 4GUIA 3WBXA 4WHBA 4AHOA 2YCIX 1U1JA 3GNPA 3K5XA 3L9CA 4DBEA 4US5A 4W89A 4R7JA 2XFRA 1OFBA 3ANYA 3AYSA 3I6EA 3VNZA 5C9XA 1YU0A 2W0UA 3LY0A 1SSGA 4O12A 2QCNA 3SCPA 2DW7A 2I9EA 1Q6RA 4YCOA 2OXNA 5I00A 3DHFA 3KM8A 4OE7A 4D6GA 1E6SM 5LIYX 5DT7A 1KGXA 3LHUA 1GQNA 2A5HA 2BVTA 4AG0A 4XIAA 3OBAA 1QDSA 5A6BD 3GUGA 3B0PA 1OFOA 1OCQA 1L6FA 2WNZA 3KVJA 4GI8A 4H8VA 3GVQA 2FTYA 1MQQA 4B2DA 3F4VA 1DEDA 1NF0A 3EMZA 3E3HA 4H01A 2EG7A 2XIIA 3N29A 2Y4SA 3QLLA 1KA9F 4MADA 5BWFA 3M44A 3LGGA 4M0XA 5HMFA 2YXGA 2PC4A 3T44A 3WDQA 1K8YA 1T5AA 1CWYA 1O4UA 3ANVA 4O4WA 3GS6A 4AIUA 4ZOAA 1PKYA 2IMRA 3BLIA 4GQGA 4D8ZA 4NJJA 3GHRA 1OG6A 5DQPA 3VXGA 2G50A 4O50A 1YU3A 4LALA 2OKTA 1M41A 3HGSA 1B0IA 3VIKA 3IJ9A 1YBQB 4DJDD 5C71A 1LOQA 4JYEA 1E1EA 3P8IA 3OLIA 1EJSC 3CL6A 1H2JA 1NM9A 1ZS2A 3OOQA 3SRDA 5FF0A 3NQFA 2JE5A 3VE9A 3WFZA 4BZYA 4TX8A 1H5VA 1C8YA 5BMXA 1V0NA 1XDJA 1D8WA 2B7PA 4I7WA 2P10A 3ITLA 5J04A 2ODOA 2XN1A 2CITA 4MVAA 4FB7A 4QTGA 2GQ8A 3PZTA 4J4KA 2QIIA 3HU7A 4Z1CA 1QHZA 1QPRA 3LXCA 3V18A 2GJLA 5LIWX 3KVLA 1XH1A 2ZUNA 5HQLA 3UXAA 4AUBA 3CWHA 4QLKA 3L0GA 1W3NA 2E4TA 3P62A 1XS2A 3CM4A 4QBXA 4PE8A 3NCOA 4QAIA 3HG3A 1OINA 3VOJA 1ZU8A 3PZUA 1WB0A 3NPWA 2ZWZA 2GGJA 3O3RA 1F2JA 1ADDA 1MDRA 2Y5SA 5J5DA 2Q8XA 5CSRA 5LZLA 2P0OA 1ESWA 4KGJA 3FCPA 3TN3A 2WBKA 3PULA 3TCEA 3S9ZA 1XLJA 5HJXA 3SO7A 4WDWA 4X9SA 5KSWA 5I03A 3KOFA 4ZQRA 5T9CE 1ECQA 4IJEA 4RXGA 4PUNA 3K46A 2WKGA 4K6AA 3AMLA 5LIXX 3SSJA 3TSDA 4ORIA 3T8QA 2HDJA 4W8AA 1GEQA 2VZUA 4OVXA 1MDLA 4UCFA 4GYFA 2FVLA 2NLIA 2ZZ2A 2FZNA 4GXMA 1ONXA 1EZ2A 2E7FA 1FHUA 2YYUA 3R10A 2WK2A 3H4GA 3PPCA 3N3MA 3W22A 4AWSA 3DBPA 4GUGA 3W53A 4QSHA 4MUZA 3MU7A 1B57A 3RIKA 3GSMA 3O6DA 5A1AA 2WJDA 1MWOA 3VOFA 4DWSD 3EA1A 2TAAA 3DIPA 4NAEA 1E6RA 1MFUA 3W7DA 1Q6DA 3LHTA 2OQYA 1HGWA 2WJFA 2J6XA 1Q3NA 4N4PA 1W3KA 2WQDA 4EWND 1KM1A 2Y2IA 4GZ7A 3T0BA 1M7PA 4YTUA 3W1LA 1G4SA 4CU7A 2WCAA 2HROA 2J62A 5A3HA 3L68A 2BBFA 4KKXA 5KZ6A 1PDCA 1VZWA 5DBUA 3P8JA 3KTXA 7REQA 1MEIA 1MUCA 1K1DA 3ZYZA 1LJYA 4FXFA 4J35A 3E74A 1OX5A 1EP3A 1EC7A 1UKOA 4AMAA 1JRCA 1XGEA 2G37A 2C19A 2ATMA 5KMYA 1QOQA 3VO0A 4CD4A 1XIDA 1UOZA 4US5D 4Q8NA 4Y6GA 4UQ9A 4XKYB 4R34A 4UTUA 4NI3A 2YLLA 2XSXA 3HO8A 3GDBA 4JCMA 1E40A 1BQGA 3PBGA 1U30A 2J7DA 3WIJA 3NPUA 1PX4A 3H24A 3BCDA 1MQPA 5GJNA 4MKNA 1PZ3A 4N6FA 3N6HA 5F7UA 2CLOA 2D0HA 3OQ8A 3UG5A 3TNOA 3IK4A 2EG8A 1Q6GA 3DGBA 1QPNA 4IPLA 1X1ZA 3GO2A 2OO0A 5HMDA 1RZMA 4DZIA 2CZFA 1RD6A 3IS4A 4B2DD 4WXYA 1NU5A 4FNRA 2DT3A 2VEGA 4UUIA 3BW4A 2W79A 4JQAA 2NSXA 2POZA 4J3VA 4GI4A 4IP7A 4XBKA 3GNDA 4L6HA 3PBVA 1VFTA 1S2WA 4O1BA 1SFTA 4YVPA 1XLCA 4WGHA 4D6FA 1FWRA 4C1LA 3TAOA 1G6CA 1N8FA 4NX5A 1ALDA 1YE6A 3LUTA 2UY3A 4XQ6A 3TYDA 3T55A 3CIWA 1BRLA 3WDHA 3PBYA 1ZHAA 3ABXA 1TIWA 4GHAA 3FN9A 4LYKA 1P43A 5E0KA 4ES4A 3GY1A 3WLNA 4TMCA 5G1TA 3KS4A 2XM2A 2BTMA 4MJZA 4I9MA 1WAUA 3GDTA 2VOMA 3UVAA 4KPLA 4Z2IA 1EBHA 1POJA 3JRKA 2E67A 4GUHA 3EDFA 4FIQA 2IQDA 5IRPA 3COTA 1B3YA 1FFQA 1UD4A 2W61A 3EX4A 3JW7A 3R2GA 5HR7A 2XFWA 2PGEA 3VX0A 1Q2RA 2PBOA 4HD5A 2R14A 1RQEA 3KTCA 3PG8A 4NY2A 5GPRA 3W7CA 1G9HA 4HA0A 4IQEA 3NZQA 3UNDA 1XF0A 2QT3A 5BRBA 2O92A 3MCMA 1ITCA 1V6WA 3G1SA 2Z1BA 4NIRA 3LN3A 1TX2A 1UHVA 1BGAA 2PA6A 1B5TA 5IBXC 2PWVA 1OD8A 1I9CB 1OWQA 2DZTA 5B7ZA 3FA4A 2Z0IA 2IXUA 4XAYA 3MCOA 5AC4A 1CXIA 4H9MA 4HCDA 2J8TA 4AWEA 1EGMA 4U33A 1KGUA 1H7PA 1E6NA 3AXKA 5RUBA 2R82A 2PFHA 4Q32A 2XIOA 1KWKA 1A4LA 1IT0A 2DZVA 4C6EA 5LNSA 2AMXA 4JDYA 1EKOA 4NQ1A 2V69A 3WQGA 1F74A 2EPHA 3S2MA 4YVVA 2V3GA 4FXJA 4R3UA 4V33A 1YKWA 1NFGA 4YYFA 1AVAA 1SMAA 2A3CA 3TUUA 3TDFA 4AX6A 1SVDA 1XW8A 4A3HA 1UB3A 5L6UA 1XYFA 2QDGA 4ZSTA 5I3FA 1V0MA 1G7VA 3FX4A 4RE2A 2JIWA 1Q7QA 2HVMA 1OC7A 3Q94A 3WN6A 1J8VA 1RPKA 1GZGA 2OB3A 4QITA 2VEFA 4H9ZA 3U3HA 1HVXA 4LH8A 3CAWA 3RLUA 3GFYA 2GFTA 2XM1A 3ZJKA 5CBIA 3H6OA 1V02E 3WMLA 1IYXA 4O18A 2I16A 3U5YA 3P5ZA 2DZUA 1UH2A 1PUDA 1HG3A 5K4XA 5LHEA 5DCDA 3CUHA 2OELA 2XVGA 3CU2A 2HE5A 4RUBA 2IPGA 2FB2A 5A95A 3BLFA 1ITQA 1JQXA 5HNNA 7TIMA 4Q4MA 1QASA 1E9LA 1HKKA 1G4PA 3CV1A 4MNJA 1R3SA 4G6CA 2Y2GA 1SGJA 2XIBA 2VC5A 3AYTA 1NF7A 3GC5A 5I5RA 5F2LA 2ZZ6A 4C6FA 3B8DA 1OZQA 1IHIA 2BG1A 1VYSX 3BAWA 1IWBA 3EB3A 3L23A 4M29A 1NIUA 1Q7MA 1XC6A 1RV8A 1E56A 3APTA 3HZ3A 3CHDA 5HOSA 3UJSA 2WC7A 1XLFA 3T0AA 2RAGA 3DBNA 3RGTA 1BKHA 4DF0A 4E5TA 3HPZA 1XUUA 3QGKC 3F5KA 2TRSA 3C61A 1R30A 4JS3A 3LI1A 2YA0A 4UQAA 4YHGA 4XO6A 2CBUA 5TD4A 4DHGA 1GXDA 4R27A 4Q33A 1KKOA 4AISA 4DVOA 4ONVA 1YTKA 1ZP3A 2F6UA 5FESA 1W2VA 5FA5A 1EGVA 3CUFA 3ARXA 3EOOA 1ICQA 2G41A 4DXXA 1Q6OA 1A5UA 1TR9A 1GOOA 1LROA 3LV5A 2ISFA 1DJYA 1FWAC 1J6OA 4Q7BA 4PTXA 1EB3A 4ZB0A 4BF9A 4B16A 1V02A 3BV7A 4HCLA 4NYUA 2OQHA 5AYIA 3AXXA 4HNOA 4O11A 2PGFA 3S83A 1DOSA 5A2BA 2X7WA 4M19A 1AD4A 1AFSA 3UYIA 1HL2A 1UP0A 2Z24A 1KM4A 2D3LA 1X6LA 5T26A 3TNBA 2X7VA 4NU7A 4PMVA 3CHFA 3R11A 4R85A 2NUWA 1BSIA 1NQ6A 1JCNA 3AYVA 2DZSA 3QMSA 4UMBA 3W82A 1T6MA 2BXZA 2NW0A 1M1BA 1GOMA 3UWVA 3KS6A 4ICNA 3B4UA 5DO8A 5C9RA 4JTTA 2ABAA 3M5YA 2P50A 3IPWA 4PUWA 2E8ZA 4EF9A 3GXMA 2OEJA 2EPOA 1BQCA 3CH0A 1LLZA 4GIYA 1J6PA 1QI2A 4QEEA 4BF5A 2B7QA 3M16A 1MXDA 2XHYA 2QR6A 1LRNA 5CEWA 1KQZA 5ABGA 1S3HA 4JZ5A 2AMGA 2PDLA 4FNSA 3AMGA 2IOUA 3MUIA 4LVGA 4ACYA 3W1QA 3DFQA 3APGA 3BG5A 4H19A 4GHLA 2DJXA 3A9BA 5DMMA 1Y7VA 3DENA 3KXQA 2ESCA 3GNXA 4CGTA 3MV11 2BP1A 4UFJA 3B8WA 1I2PA 4O53A 3N9SA 4IUOA 3SRKA 2ZC8A 4MY1A 2VKZG 5HINA 5EMMA 3T4CA 3WH8A 4NYYA 3OZOA 2I5GA 3CBWA 1I6NA 2RHGA 1J11A 2VYOA 1TTJA 5DF0A 1A5LC 3S9IA 2X1TA 4PYSA 4S3DA 2PMQA 3KOZA 1XSIA 3O7UA 4PRRA 3W7EA 3OIXA 1KTBA 3UR7A 1V77A 1O5QA 3SCSA 5JH2A 3ALFA 1ZBKA 1W1IE 3GWQA 3IRSA 1M65A 3T8LA 3TC6A 1KXVA 1HJVA 4GUFA 5XIAA 2V3FA 1ZP4A 2PDYA 3WELA 3R1ZA 1D8CA 2H9AA 4DIAA 3PS7A 1A5AA 1W3LA 7ENLA 3MP5A 5D9PA 3EWUA 1UD6A 3O2LA 3A3HA 1J5SA 1HGYA 1NDWA 1ZTVA 3VU2A 3CEUA 2DSUA 4GI6A 4H6RA 3UZXA 3N2BA 2WMFA 4O1FA 1ZSXA 1XRVA 1PIFA 2RJGA 4ZMGA 4A05A 2WYSA 4LB3A 5BXSA 3EEZA 1WXJA 4XZHA 1JNEA 1DJIA 2CHRA 1VRDA 5FAGA 4QE5A 4HMEA 3W37A 3LCXA 4PMUA 3W1MA 3IIXA 1TV7A 1A5KC 1RCXB 1UD5A 4IJCA 3M9YA 4H00A 4MLRA 2GSHA 1BVWA 2RDUA 4ZGYA 4AD2A 3R8GA 2DT0A 5CQ1A 5GNZA 4ZODA 2PTWA 1GUVA 3LXBA 3KHJA 1ZGDA 3NPVA 3WNOA 4WJXA 3SY1A 1GG0A 5AZ1A 2YSWA 2OX4A 3STEA 3BVJA 1QHPA 4LUIA 2NVAA 3FEQA 3NQ2A 3ZT5A 3OGSA 2JBMA 3PN8A 3B0UX 1R9ZA 3L2IA 4Z2KA 4XBJA 1SO6A 2F7FA 1N8IA 4BS0A 3DECA 4IIHA 4OV4A 4O15A 4CNTA 5JBEA 1JEZA 2D22A 1SO5A 1JFXA 3PAOA 1A80A 1US3A 4J3UA 2NX3A 1RCOB 2QNEA 3L4WA 3WL0A 2V3EA 1TO3A 3W83A 3WQDA 4Y7EA 1UZ1A 3A4XA 1B3XA 3S42A 3W28A 5LNRA 4P8XA 2FHBA 2E25A 2FPYA 4H9YA 3WLJA 4OKDA 3IEBA 1BYDA 3UZWA 2Y89A 2DSWA 3F5JA 2NUYA 3TQVA 4ZTYA 4LB4A 2GSJA 5FI8A 3G22A 2INFA 4IX2A 1CENA 3N34A 1KM3A 4IP4A 3QQ1A 7A3HA 1GKQA 4NXKA 1HF6A 3UWUA 3D47A 4WY0A 1FH7A 1R9YA 5JU6A 3UA3A 4XAFA 4O1CA 1IXNA 1IIGA 2YDQA 4JKLA 4IIFA 1DHKA 4V1YA 5AVNA 3OIHA 5A5WA 3BV4A 2WSYA 3WEMA 1IEVA 3R6IA 1JNDA 3DESA 4HVXA 2CHOA 4QDPA 1KFJA 4IL0A 1ISWA 3RRAA 1XD0A 3R58A 4KS0A 1E6XM 4J1OA 4JEJA 3RM9A 3QPYA 3AALA 2NQ5A 3VFCA 4Z2HA 1C29A 1JG9A 4GWEA 1K4HA 2WOQA 2QCFA 1E0VA 1MW3A 3B03A 3S5SA 5EA9A 3H7VA 1BVZA 4HU4A 3ONCA 4I7VA 3KAOA 1L2QA 3GXFA 2VEKA 4N9CA 1ZL1A 3GRIA 2WMIA 4HZMA 4Q8PA 4G56A 1EXBA 2ZUTA 5TQLA 5CC7A 3E2VA 1KM2A 1A5CA 4YHEA 2R1KA 2YDRA 4CCEA 1JZ6A 4YYCA 3H2OA 5ENLA 2ZUUA 5AC5A 1AL7A 3WDRA 3IUIA 3MP3A 3UG4A 1DVJA 3P0WA 4C7GA 3DH7A 3V4BA 5C8BB 4LAKA 3IARA 3M64A 3EKLA 4GO8A 3RNDA 3GFXA 2YL8A 1R6WA 1C9DA 3IVUA 4YVXA 1YNQA 4P7LA 1F5ZA 2YDAA 1WDSA 2E28A 2HK1A 4LQ1A 3TJXA 3OA3A 5CPLA 3VMPA 2DUAA 1P6WA 1K6WA 2OWCA 3IJIA 1WBJA 4KERA 1Z8AA 5HWNA 3KBJA 1EOKA 4MZ1A 1RK6A 4UNIA 4XBSA 1EFZA 1X8FA 2ZE3A 1FDYA 3ITXA 1TJ0A 4ZL1A 5PTDA 4R5EA 5K7JA 4QHRA 3G18A 4OZOA 4OIFA 2CZVA 2I1OA 1CZ1A 3M1ZA 1K7EA 2E68A 5TIMA 4AD0A 5HBFA 5DMLA 4HMDA 3JU2A 2REQB 3VIPA 4QCFA 3G5EA 1W5NA 3A47A 1OBAA 2AL2B 2Y2LA 3H2MA 3C0JA 5I07A 1CLKA 2X09A 3S5YA 2O7SA 4C6KA 2GSEA 4IZGA 1QPOA 3QHNA 2FTPA 4GY7A 1W3HA 4D8AA 4QFUA 3TOPA 2EJ1A 2FGLA 4ADTA 3CZLA 4FNQA 4CQAA 5CLTA 2F61A 1V79A 1OYAA 1R85A 1WKEA 4C6LA 3TTYA 4C6JA 2VGIA 4ZO6A 3SURA 1QPQA 3TC7A 3H23A 3THAA 5A8PA 4MGGA 3WMCA 3U7VA 3SM0A 2FH6A 3CV2A 1QMLA 1XQLA 4IT1A 2GK1A 3UZYA 3I68A 3TFXA 4KEZA 4WKFA 2J88A 4XKMA 2PF0A 4WY0F 3QY8A 3SI9A 5MHBA 4GE8A 3QOMA 2FMOA 4AZCB 1J9YA 1YTDA 2EF9A 3FJ6A 1UD3A 5A2AA 1IIHA 3GTXA 4I8DA 1MW0A 2P3EA 4IFKB 4R33A 1LT8A 2BOFX 2B81A 1A53A 1S39A 2WO5A 3C0QA 3WQVA 3BJSA 1VJSA 1BEUA 2V5KA 3PUEA 3GIQA 2J8FA 4UTJA 2ISDA 3U9IA 3KE0A 5KTLA 3A64A 2DFAA 1J18A 1AW2A 4DM1A 3PTQA 3W6LA 3PZVA 1R0MA 5D9MA 3G1YA 3LMYA 2X40A 1RVGA 2GDUA 3KWXA 3HV9A 1Z9AA 2BXVA 3IGXA 3AUOA 1A5OC 1F6KA 2DU2A 3C2VA 2XD1A 2BZNA 1GQIA 1WQ5A 5C7HA 1H1NA 1L8NA 4NAFB 4IBBA 1VIZA 1B3WA 3O06A 4DYJA 3DZ1A 1PX3A 5D38A 1E9ZB 4I90A 4NRSA 3USZA 1TB3A 2J27A 4PMXA 1FWHC 3LLDA 4JTQA 1XM3A 3BPWA 1VHNA 4JHZA 1KXQA 3NEHA 1I60A 4U5IA 4UIOA 1XLHA 4ZVJA 1OFQA 4HSHA 4LANA 3TYZA 2Z7KA 3TXZA 4GFSA 4ERGA 3WD3A 3LGEA 5DN1A 3ZLHA 4C7FA 2XDFA 1C8XA 1PKMA 2OO6A 3VGHA 1V3MA 3RR4A 2QAPA 2WNNA 4I8YA 3CQJA 1G94A 1GT8A 4DO7A 4G5DA 2QS8A 4QP0A 1RA5A 3LA4A 1CW2A 4NRRA 2Q3RA 2P8CA 3GZ3A 2ZX6A 4S3KA 3UXLA 2QCHA 3THQA 3WD2A 1OY0A 3PJXA 2DSVA 5U7SA 3S1WA 4NI8A 4M3PA 3TAKA 1QCWA 2WZHA 1OX6A 3PZNA 3TTEA 4UTLA 2PEVA 4NXSA 4Q3MA 3TQPA 1RP9A 3ZVHA 2BHYA 1FH9A 5DFAA 2BGSA 3L12A 3QV9A 4XWUA 1JFHA 1AZ1A 2ZXDA 4AIEA 2IPWA 3KLKA 4JTCA 2OGJA 5H8PA 3WFLA 3O6CA 5LGZA 4GGBA 2H3BA 2OLAA 4J27A 4LBUA 4Q7NA 4GQQA 3WH5A 5U4NA 1KKRA 3N6JA 3SUWA 4WJEA 3EPNA 1UR3M 2D24A 2INEA 2I9UA 5LA0A 5FF4A 3RMEA 4F0LA 3RF9A 4RNJA 2QUVA 3NSNA 1GCYA 4DJFD 3JS3A 2BX7A 3MI6A 2QDEA 4W7WA 1RY8A 4XZLX 4JIHA 2VWSA 1R7OA 4WK9A 4E4UA 4IPNB 3ZMRA 3VKAA 1WOAA 4KFPA 4ATLA 3EWWA 4HGXA 4H7CA 5JVLA 2HISA 1RBLA 3KVKA 4Z2GA 3SCRA 3ARTA 4GK8A 1DL3A 1RD5A 4D6CA 1GTEA 2D0FA 5E6YA 4OBTA 1U83A 1MXGA 3VC6A 2O0TA 3MYOA 1XI3A 4CCZA 1UQZA 1ZJBA 3STFA 2J7CA 1XIEA 2OFJA 4U28A 2PU0A 3VIIA 1MRAA 1LRTA 2PWEA 3GXTA 1I2RA 1DV7A 3VCCA 4YTRA 3J7HA 4WVXA 1SFLA 2R1MA 3LDVA 2X41A 3N25A 3SDOA 2PTYA 3B9EA 3E0LA 4O1AA 3FJLA 4D2JA 1FWCC 3G6LA 4G7FA 3ZR5A 3DFHA 4DJDC 3NL3A 4HYWA 2BY0A 4AWTA 4ZZ9A 2QW5A 3N2OA 3NZGA 2V38A 4W8LA 2ZVIA 3GXNA 4LS2A 3M7WA 4Q8QA 1E0WA 1M01A 2QMJA 3WUBA 4CEXC 4BEUA 4F0HA 4NZ1A 1OX4A 1OB0A 1Q6EA 1S1PA 3UR5A 4LWWA 5LA2A 1TWZA 3OZYA 3IANA 5AVHA 5E0FA 1EWDA 4CKQA 3GG8A 5L9FA 2A6NA 3D6NA 1EEXA 3TCSA 4E8DA 1EX1A 1JDEA 4PUDA 2HJPA 1J10A 1JXKA 3BW3A 4R9OA 1YPFA 3PJTA 3FAWA 3G6MA 2OSXA 1VENA 1ZCCA 3PK7A 2DDXA 3T40A 4HNCA 1VB9A 1BD0A 4UFKA 6PTDA 2GOKA 1RR2A 3DG6A 2X2YA 3A3WA 4BQ3A 2YCJA 1EJ7L 4HCHA 4YTQA 4AZ6A 2D2OA 1PYFA 3I4EA 2Q71A 3O63A 2WHJA 3QZEA 4A3YA 4B91A 1XXXA 2ACRA 3EKZA 3EEGA 3IV3A 4PMJA 4LUJA 1XDMA 3W76A 1Q7ZA 4QISA 3PANA 3NJ3A 1PXGA 2FN2A 1IQ8A 3NL2A 2R6OA 4UBPC 1YADA 4E4FA 3Q45A 4S3CA 2GQ3A 4J5NA 4PRWA 3VK5A 1U1HA 2FZMA 2XJ7A 2PBGA 5G2WA 2XSBA 4JY8A 1KRMA 1DBTA 6TIMA 4NVTA 1IGWA 5D32A 5AHNA 1W32A 4X2PA 4MPQA 1US2A 5CC5A 3HQNA 2OZ0A 4IBGA 3RMJA 3R89A 1JF5A 4GABA 2D3NA 2Z1KA 4Z1BA 2PODA 4ORMA 4JTSA 2IUZA 5C2XA 2XZ9A 1QFEA 3HB9A 4MM1A 3EWBX 2ASHA 3PBUA 3S2LA 1ISZA 2YW3A 5E09A 4TVCA 4CN6A 1WNOA 1KRCC 1VFSA 2XH7A 1J01A 2J6VA 2WSKA 1EHAA 4PUMA 3TP4A 2YIHA 3I6RA 1PV8A 4DBWA 2A3EA 3G1RA 3FHQA 1LP6A 5BXTA 3FVMA 1SZGA 2QJNA 5D2TA 2VUYA 5HMEA 2WHLA 4Y9NA 5HNTA 1WZLA 3TE9A 3E02A 3T05A 1V08A 1DIOA 3KRSA 4AXKA 2CESA 1EL3A 2BS9A 1QWKA 5AHMA 1BYCA 3CV6A 1RY0A 4FEZA 1I2NA 3IACA 4LUSA 4ZQMA 3G1AA 3UJRA 5AYZA 3GHSA 3TJ4A 1NEYA 1YDYA 4ZB5A 1JZ7A 5DCBA 1DJGA 3CT7A 1O94A 3KBMA 4NZCA 3DHDA 2DIKA 4BK9A 1Y5XA 1GGOA 2JGQA 3LZ3A 1UH4A 1WYIA 3UJFA 4YCPA 1KBBA 4NJKA 4DM2A 4CD5A 2B31A 2GYIA 2P53A 3E0VA 3AC0A 1EA0A 3VCNA 3UYCA 2QPXA 3GW0A 1WXYA 2GOUA 3QVQA 4AD5A 4AMCA 2ZOXA 2YCEA 4FR6A 3N2TA 4KRZA 4GYPA 1G1YA 2QCDA 4KESA 1WCGA 2WCSA 5E93A 5JBFA 3BOXA 5FJUA 1UWSA 4YTTA 3N6QA 2PLMA 4RZ4A 3W26A 3PZOA 1KR1A 2GJNA 3PJUA 1NELA 3A23A 1UZ4A 2Q3OA 1KBIA 3AHXA 4AHQA 3FSUA 4LOCA 4DB7A 2CLLA 1C8QA 4Z2JA 3PWIA 3NTYA 4MG4A 4NT0A 3AU2A 2VDHA 3R8RA 1PKNA 2MUCA 1W3TA 3QR3A 5DLCA 1XYAA 4AB4A 2WMKA 1WA3A 5D37A 3QZ6A 2OOGA 3N9KA 1FDJA 2WC4A 3A3XA 3MMWA 3T08A 3V75A 5DEZA 3Q58A 1FDZA 1KRBC 5MKGB 3MY9A 3C0SA 3QBUA 3UWZA 4B4HA 1XBVA 3DHUA 1IEWA 3N19B 2OQLA 4JTLA 1U33A 1MQRA 5K2ZA 3VNIA 3T4WA 1TMLA 2C18A 3RG6A 2QJMA 1NVMA 4F40A 3GVWA 1QT1A 4NNAA 4Q4RA 3GU1A 3BAYA 5D03A 2ZX5A 1F3WA 4C65A 3PF3A 2XIQA 1CXWA 2CBVA 1W5OA 2I5IA 4I6KA 4LUTB 3WUEA 1KB3A 8A3HA 5DMNA 4ZOBA 4AEFA 1YRRA 4MZ8A 4YL2A 4F2UA 4HZ6A 3VUPA 3P5YA 4HB7A 2CWNA 5M2FX 2PC8A 3NDZA 1W91A 2E8YA 4J7RA 5EBAA 1XRFA 1VPYA 1H7NA 1AODA 5KITA 2GUBA 3ARWA 2W92A 4IQLA 3V35A 3WLRA 1F61A 4PRTA 1OQFA 3B04A 3PZMA 4XG1A 3BZJA 1DJWA 4BWLA 1UUQA 1XIHA 3WLIA 1LLOA 3G1HA 2VFEA 4GKTA 5BROA 1GNXA 4AY1A 1FHLA 1S5MA 1TWSA 2UV8G 1UD2A 4GLEA 4L1XA 4QGCA 2VUNA 3WQFA 2CCRA 3IVTA 3AIWA 1P0NA 1XWYA 3HPAA 3TW7A 2VCCA 1CNVA 1UR2A 3UG8A 3KZSA 1G4TA 3V16A 2FZDA 3NVDA 5DX7A 2PCEA 3C52A 1AW5A 4AAJA 1UASA 4Z42C 3IIOA 4P7RA 1VBHA 3P3BA 1ONEA 4MIMA 5F2GA 5I06A 4PSRA 1R2TA 4PGLA 4J2PA 1QXLA 1B1YA 2VCAA 3DDMA 4XTDA 1UA7A 5LGXA 1Q45A 1EUNA 3NZPA 1NARA 1K8XA 3LOTA 4Y90A 2XPKA 4Z2LA 3STPA 4R7WA 3W1TA 4HSOA 4D6IA 2YCLB 1GTHA 1ICPA 2G3JA 4RZ6A 3SUVA 3PR2A 4C6BA 1OABA 1BXBA 3UY7A 4AXNA 4JFSA 2E77A 1HKIA 3EOLA 1P5BA 5HAOA 3CIXA 4EXQA 1S5VA 2G3MA 3QY7A 1QR7A 1E70M 4W84A 3DXIA 1XSKA 2HZGA 2YGYA 1C91A 2Y2JA 3PUGA 4JTRA 2E6DA 1M53A 3UG3A 1H51A 3FW6A 2J9ZA 1G7UA 3KBSA 1W3IA 2Z25A 1E73M 3W07A 4Q8TA 4LRTA 3BAXA 3CQ0A 4OUIA 2XWDA 2V5JA 3WKZA 4C1KA 4DN1A 4BQ5A 2VWTA 4XD6A 1VH7A 2ZZ1A 3WLKX 3N2MA 4S38A 4UNLA 3C2EA 4PL1A 5BRPA 1P7TB 3RCMA 4RXFA 4TO8A 4QSFA 3N04A 2XU2A 5TBOA 4IMGA 4KIRA 4MB1A 1XL9A 2O9TA 1KFEA 4H7VA 1PKLA 4TIMA 3HTWA 4BQ4A 1T0OA 1B9BA 4C6QA 3U4AA 4MHBA 3F2DA 1WXZA 4AD4A 1OT2A 3AIRA 3CGTA 4MTVA 4W86A 4C6NA 4DRSA 1A47A 1EXPA 3V3WA 5CGTA 2DVXA 1H0GA 3EPOA 4UXDA 1NQKA 4XKYA 3CQKA 1HJUA 2J74A 5I3IA 3PZGA 5CSSA 3FYPA 3AXIA 1E0TA 4C6IA 3AS0A 4MAZA 2PP1A 1BAGA 4HPXA 1FUYA 3QC0A 3MUAA 2HEJA 2CKRA 1F8IA 3C5QA 2AAAA 1OFPA 4KW2A 5IFTA 2ISSA 4P7OA 3VKDA 2ISWA 3M0MA 3LXAA 3QEZA 2BVWA 1DXIA 2G4JA 3WK2A 4IG2B 4LAMA 4OECA 3CV7A 2XVNA 4M24A 1JCMP 4BA0A 3FIGA 1DWFM 4HOXA 1UPPA 3F7JA 4CNNA 4HN8A 1JCTA 2O56A 1UKPA 3BC9A 1JZ3A 2OG9A 2CXGA 3U6WA 3RHGA 2OYLA 4KCWA 2R91A 3SB0A 1VYPX 1TJ2A 4AF0B 4U3AA 1J12A 2G5WA 5CZKA 3PPGA 5D4YA 1Q6LA 5A94A 2PP0A 1MXSA 3U48A 4LEFA 4AYSA 1LOSA 3CB8A 4TMBA 3OYXA 3BMVA 3LB0A 2ZXQA 4D1IA 1RQBA 2ZZ4A 2IW0A 1J5TA 4V2XA 1THFD 1R46A 4JTGA 4XSMA 2OOFA 2ZTKA 4JTJA 5CPSA 1JR1A 3V1HA 2GVLA 3THUA 4OFCA 1OADA 1Y0EA 4DJEC 1SW0A 2CKSA 4HIBA 3HJEA 3NO1A 2TPSA 1RK5A 2B7OA 2VOTA 3V5FA 3K4AA 1KXTA 1W31A 2WMJA 3L4YA 3DFNA 2CIPA 3R0KA 2YZ5A 1JPHA 2J7FA 3NQ7A 4KGLA 1RPXA 3M6YA 3WBWA 4PTVA 3AIQA 1E3ZA 3KCLA 5HWJA 5CXPA 4LGXA 1E88A 4DZ5A 1MW1A 5C7VA 3CO8A 3QQWA 4AZBA 2CETA 3ZIZA 3E38A 2EPLX 4NNBA 3PZIA 3QKEA 1NTHA 3NQBA 3CUJA 1ED7A 3N12A 2GDVA 1RBOB 3SADA 3H7RA 5I24A 1KW1A 3QR0A 1TWDA 2C3ZA 3K1DA 3LS9A 4IBJA 4AU0A 5BPVA 1YU1A 2ON3A 5HANA 4QRNA 1HL8A 3WSUA 1LWJA 3K13A 1MUWA 3TYAA 3SR7A 2WVTA 1EIXA 1BYAA 4H41A 1GVEA 4AIBA 1S2TA 4XZWA 1UUOA 9XIMA 2P5NA 3NGFA 1CECA 2V2HA 2CYGA 3WX7A 1E5NA 3BE7A 4G7EB 1XIGA 3VIGA 4A2SA 3SY5A 2CLEA 2VURA 3GIYA 3PZ9A 3H70A 4XAPA 1GQLA 1JD9A 1OF6A 1UPMB 5GQBA 1IT8A 1HKVA 4UZUA 4TUFA 4Y2WA 4LF1A 2RTSA 4XD4A 4Z17A 1W5MA 2WC3A 5F4XA 1IZJA 3TWAA 3NURA 4UFHA 2V81A 3OJGA 3T0CA 4HN4A 1RSCA 1TV8A 1TG7A 1H3GA 2XSAA 3JR2A 1SQ7A 3SY8A 1O5KA 4ZXOA 1FY6A 3M5ZA 4CN1A 1Q6QA 1DIKA 1GG1A 3C4UA 1RHCA 4FX8A 2CLMA 3HONA 1UMLA 5FIPA 2Y7FA 3LCGA 3OG2A 5FJTA 1WX0A 2I7GA 1L0PA 5AHFA 3GH4A 4C1NB 5M17A 2OLHA 4F9JA 2PWFA 1LQ0A 2FVMA 2HTMA 2OMAA 3RK8A 3TXVA 1F76A 2OR2A 3G1VA 1P4CA 5EY5A 1E6ZA 5EGRA 2EXOA 3FNDA 4IBCA 3CYJA 1AQHA 4UFMA 2WNWA 5M1TA 2CFFA 4KFNA 4UR8A 3B8TA 4GFIA 4BQ2A 1XLIA 4K7YA 3ME3A 1EOMA 2Y70A 3IIVA 4GHRA 1WZKA 2NVCA 3C3NA 4FF7A 4PFHA 2PLKA 4D6DA 1PHWA 3VD7A 4MSSA 1LBMA 3BLPX 4DNHA 1GVOA 1GVFA 1KFKA 3LSCA 4ROQA 3GYCA 2P8BA 1JDDA 3OPSA 4KWVA 2SFPA 3QM3A 4Z0SA 1E15A 2CW6A 2JF7A 3FHAA 4LF2A 1IWAA 4PSPA 6XIAA 2C0HA 3NZRA 1HP4A 4WGXA 2Z6IA 4HYVA 4AVNA 2HNHA 3B8SA 1YUEA 3TTOA 4DO5A 1W9BM 4G9PA 3O6YX 5GJPA 3WQ5A 1XRSA 2OT0A 4JTHA 4INFA 3GK0A 1VP5A 1FVPA 2CPUA 1MI3A 2WKJA 1DTNA 1UR0A 4L64A 3KX6A 1F3TA 1TPB1 2I5QA 3FK4A 2YXOA 5EMYA 5I3HA 2J78A 1PTGA 1JPIA 1VD6A 3KOWA 3VZZA 1GOWA 4IIBA 5F4SA 1X98A 4ATDA 1H62A 1Q8AA 1F3XA 3TOYA 3LNMA 1W1A1 4TU1A 5AC6A 3IJDA 2WSQA 1KFCA 1JGIA 5FF2A 4GJIA 4GX8A 2GJRA 4Y8FA 2PI6A 1XYZA 3BARA 1P0DA 1T8QA 4OU1A 4JFWA 2C1GA 2EPNA 1SZRA 4ICMA 6REQB 3R0UA 1MEWA 1B3ZA 2FHCA 4F3HA 2Y2HA 2J7BA 1ZBWA 1K6AA 2E1DA 4HJFA 4IBDA 3QQ0A 5A8NA 5A6JA 1YYAA 4EPBC 4JIEA 3ARPA 4XD5A 2JKEA 3VNLA 2IXVA 3VE7A 2EJAA 2H8XA 4JDBA 1ZCOA 1U5HA 4Y9OA 1UKQA 5CJ5A 1L6WA 1VCVA 2FB3A 3VGBA 2BVDA 3VIHA 5BYWA 4HK6A 2VZVA 3SJNA 3PAJA 4XO7A 1V6VA 4CUCA 1C7TA 3B0VC 3GFZA 1KBJA 3MPGA 2F2KA 5I3DA 4D9PA 2WQPA 2ZC1A 4LX4A 3CZ8A 2VC6A 4MUPA 1UC4A 1PJ9A 5IOBA 4B9YA 1CXKA 3CMJA 4TX9A 2KAUC 1T40A 1X8CA 4CEUC 1F9CA 1A3WA 4L5ZA 1XIBA 3CH9A 5CZJA 1XGDA 4YWIA 3S5NA 4HHLA 3CPGA 1C90A 2P88A 3BUVA 3E1F1 1JVNA 1YLVA 2XH4A 2C16A 5IHRA 4L6DA 3OA5A 1JUBA 4RZ5A 1O12A 2WHMA 1QVBA 5ABHA 4GISA 5BZAA 1FP9A 3EX6A 1H7WA 4NNCA 3VNJA 1X6UA 4C6PA 1XIMA 3WMSA 1V3HA 4Z1AA 3BDKA 4XSLA 3UGRA 8TIMA 3UCQA 3AYRA 4MJMA 1JZ2A 3OB8A 3BGGA 2OSWA 3KUMA 4HMCA 3R7MA 3U2EA 4ZFCA 4NUWA 3A13A 3WJWA 1TUFA 2O9RA 4IJFA 3HGRA 2PE4A 3MBFA 3GU2A 1V3KA 2B7NA 5AECA 3LLFA 4TV6A 4ZOCA 2DT1A 3UERA 2VXNA 3F2CA 2QEZA 4UTWA 2E5DA 3AROA 2ZIDA 2Y88A 4B3KA 5FJIA 2ZX7A 3VIMA 3GVVA 3TJLA 2X30A 3GTHA 3M0KA 5BOOA 1WE5A 1AIWA 3M0LA 1UWUA 1QUMA 1DE6A 3TN5A 1LZOA 3SQLA 1XLBA 2R24A 4EANA 2FZ8A 2G3IA 1Q63A 4RL3A 3L0KA 1W8SA 1MZRA 5CLWA 1QI3A 3QLDA 1WUEA 2A6LA 3NNTA 3LRKA 3WCZA 3KP1A 3L29A 3RU8X 3UU0A 2F6XA 1TV2A 4EIVA 3P81A 3MI3A 2W67A 2PWUA 3KVMA 2FYMA 3LPPA 3A4WA 4JKKA 3VDGA 1YXCA 1XH2A 4XV0A 4EWJA 1AJZA 1KTNA 1GOIA 4L80A 3TLLA 5AOUA 3UGVA 1ZBCA 3CPRA 5IBXA 3XINA 4ATWA 3L7RA 5ABFB 4I5XA 3M0VA 4HU0A 1B3OA 4OOUA 4KBXA 1H49A 4QLLA 1G0CA 1FWSA 4W87A 4AVOA 3NIYA 3U4FA 1BXCA 3GM8A 1D9EA 2X2GA 5DANA 5FSEC 2WXDM 2OT1A 4IFOA 4LV4A 1TVNA 1TUXA 2Z1XA 3HM7A 4ZCWA 4DUXA 4LEQA 2CBIA 3LCHA 3QKZA 3MW7A 2C8NA 4RDVA 1DYSA 4U2ZA 2ZRWA 2GJXA 3S2CA 4P7NA 1CI1A 3S8HA 3SUTA 4O0KA 1JAKA 1UW9A 2YYTA 1KM0A 2Q01A 4ERIA 2BGNE 4GCXA 4F2BA 1H7RA 4PB5A 4WJ8A 1ME7A 1ONWA 1ZLPA 2XUCA 1EJWC 4EF8A 1E4IA 2R9RA 1W9UA 1PWLA 5FEPA 3CZEA 1NAL1 1VEPA 4GIAA 1VCFA 5EMKA 4D71A 4DJFC 5FACA 3AIEA 4IXXA 3K30A 4LC8A 5BRQA 1NDYA 2E9MA 1NOFA 4UTMA 4I6VA 3NG3A 1D3CA 3GKAA 4A35A 1OJXA 3SBFA 3G8RA 5C2CA 5DCEA 2PU1A 3DFYA 3U57A 2QJHA 4RNIA 2XIMA 1FHDA 1NP2A 2I17A 4UTFA 1EJXC 5D9NA 2CLIA 3CMFA 5HPOA 1KFWA 2C79A 4A3RA 3IJLA 3VAVA 1H5YA 2J75A 3AHVA 1KLYA 2JEQA 3N2XA 4FLOA 1L6GA 1EDQA 1JF6A 3M07A 1GW1A 5A6SA 1WO2A 1PCKA 4PMRA 3GDKA 4K36A 2WLYA 3R0DA 3RPDA 2J4GA 3H2AA 3GB6A 3UCCA 3PB2A 2ZUVA 4HQVA 1BTCA 1ZZMA 2Y2NA 1RXOB 3UZZA 1M9HA 2JE8A 4XZIA 3VGDA 3TWBA 4O0ZA 1W56A 4W93A 3KDNA 4LXFA 4MY8A 4AHPA 4ZB2A 3HF3A 1W9XA 2CEQA 3S1XA 2FTWA 1HKMA 1YHTA 3KRBA 3S47A 1FTXA 2ZXBA 1UWQA 4JHOA 2QULA 3CPUA 5SWUA 2JGYA 3BG9A 4QDWA 4OBSA 1GYNA 1UMYA 2A7PA 2GJPA 3H26A 4ADSA 2RUSA 4R88A 3QW4B 1W1ZA 1FWTA 3CNYA 3GYEA 4MWAA 3W1XA 3W29A 1F4HA 3MDWA 4Q8UA 5M5DA 1O68A 3H2CA 3FKKA 1E0XA 2REQA 3NXFA 3BTNA 4TOQA 4PMDA 3T6CA 3QTGA 3ITTA 3W7MA 3MMUA 2AL2A 3WH9A 2GWNA 2NQJA 4Y9PA 4WDTA 4TR9A 4MAVA 4QE4A 5K4ZA 3LD5A 5G4EA 3GW3A 3QR1A 2KX9A 1E1CB 4K39A 4UOQA 1VEMA 1YIXA 2QJJA 1MUMA 4V27A 4JQ4A 2VL4A 1YXYA 2OLSA 3V1PA 5KZEA 1UG6A 4MJ4A 1KGWA 1JYNA 3CB3A 1JGMA 3U2ZA 1C7SA 3HN3A 3I10A 4QX4A 2VFGA 1V03A 2DIEA 4IIGA 3NQDA 1KBKA 4IH3A 2CC0A 1PHQA 3E0IA 5C6MA 1XYCA 4XIMA 1TPFA 3L5LA 1FWWA 3R43A 1FHVA 3WENA 4XD3A 2BB0A 2NUXA 4IOTA 3T42A 2FKPA 4JAWA 3PFRA 3S1GA 3LZ5A 1JCJA 3B9DA 2Y0FA 3DX5A 4AZCA 4DNMA 2ZYFA 1EEPA 1EUAA 2ZA3A 3W2NA 3W7QA 2CXEA 2BY1A 2G3FA 3CUZA 2XH0A 3XISA 4IFKA 1PZ2A 4ROPA 3QSRA 4ZOEA 3C86A 3O16A 4OTKA 3L66A 5A6AA 3GXDA 2WJZA 1HX0A 5CZTA 1KWGA 4HHHA 1VJIA 3TVAA 2HVNA 4KH2A 5DRCA 1NOUA 4MY9A 1W2PA 2DUXA 1FWNA 3LTPA 1YU4A 2WVUA 5AYXA 4M7TA 5HQMA 2J13A 4DZHA 4BI5A 5HXMA 2F2HA 1E55A 4Q4OA 1IXQA 4OJLA 4NAFA 2ZDSA 2HMCA