3HSHA

Crystal structure of human collagen xviii trimerization domain (tetragonal crystal form)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
56
structure length
56
Chain Sequence
GSSGVRLWATRQAMLGQVHEVPEGWLIFVAEQEELYVRVQNGFRKVQLEARTPLPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Collagen alpha-1(XVIII) chain
publication title Crystal structure of human collagen XVIII trimerization domain: A novel collagen trimerization Fold.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 13
structure length 56
sequence length 56
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-06-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.50 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 3hshA00
3N3FA 3HSHA 3HONA
chains in the Genus database with same CATH superfamily
4Z2KA 2UWXA 4OJOA 5BPVA 1AIWA 2Y2MA 1PDCA 3WD4A 4IBJA 1L6JA 4HMEA 4OJ6A 1YU3A 4IBKA 4GHAA 2XD1A 2V5OA 3L28A 4IBBA 1GOIA 4IBCA 2Y2QA 2Y2KA 1E6ZA 1W1PA 1EAKA 1UR9A 4IBFA 4NY2A 4NZ1A 4OJPA 2Y2JA 4IBIA 2Y2IA 1GXDA 4OJLA 3L29A 1H0IA 2Y2PA 2Y2GA 4GH9A 1E88A 1J7MA 1W1VA 1E15A 4QNLA 2JE5A 3WD0A 3WD2A 4IBGA 4IJFA 4GHLA 1YU4A 4MB5A 4IBEA 1OGGA 2XD5A 3MQLA 1O6IA 3FKEA 1UR8A 3KS4A 4Z2GA 3WD1A 3L27A 2Y2OA 1YUEA 2Y2HA 2Y2LA 1GPFA 4MB4A 3L2AA 2Y2NA 4NZ4A 1W1YA 3KS8A 3M7PA 2BG1A 3WX7A 4NZ3A 1OGBA 4IBDA 2JCHA 1QO6A 4Z2HA 1CXWA 1CK7A 4HMCA 1E8BA 1E6PA 3L26A 3HONA 4OUIA 4TX8A 1ED7A 2RTSA 1KS0A 4IJEA 1YU0A 1YU1A 1E6RA 1W1TA 1YU2A 2FN2A 1H0GA 2D49A 3HSHA 4Z2JA 4Z2LA 4NYYA 4LG2A 4NYUA 2FFFB 2IOUA 4OJ5A 1H8PA 3N3FA 1E6NA 3WD3A 4Z2IA 3L25A 4HMDA 4NZ5A 4MB3A
chains in the Genus database with same CATH topology
2Y2JA 2XD5A 4IBIA 2UWXA 2Y2IA 3FKEA 4OJOA 5BPVA 4OJLA 2Y2MA 4IJEA 3KS4A 1YU0A 3L29A 1YU1A 3L27A 1YU2A 2Y2OA 1YUEA 2Y2HA 3HSHA 2Y2PA 2Y2LA 4IBJA 4NZ5A 4OJ6A 3L2AA 2Y2NA 1YU3A 4IBKA 4NZ4A 2XD1A 4NYYA 3KS8A 4IBBA 2Y2GA 3L28A 4GH9A 4IBCA 2BG1A 2Y2QA 3WX7A 4LG2A 4NYUA 4NZ3A 2FFFB 2IOUA 4IBDA 4QNLA 2JCHA 2Y2KA 2JE5A 4OJ5A 4IBGA 3N3FA 4IJFA 3L25A 4GHLA 4IBFA 1YU4A 4NY2A 4GHAA 3L26A 4NZ1A 4IBEA 3HONA 4OUIA 4OJPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N3F A;  3HSH A;  3HON A; 
#chains in the Genus database with same CATH topology
 4Z2K A;  2UWX A;  4OJO A;  5BPV A;  1AIW A;  2Y2M A;  1PDC A;  3WD4 A;  4IBJ A;  1L6J A;  4HME A;  4OJ6 A;  1YU3 A;  4IBK A;  4GHA A;  2XD1 A;  2V5O A;  3L28 A;  4IBB A;  1GOI A;  4IBC A;  2Y2Q A;  2Y2K A;  1E6Z A;  1W1P A;  1EAK A;  1UR9 A;  4IBF A;  4NY2 A;  4NZ1 A;  4OJP A;  2Y2J A;  4IBI A;  2Y2I A;  1GXD A;  4OJL A;  3L29 A;  1H0I A;  2Y2P A;  2Y2G A;  4GH9 A;  1E88 A;  1J7M A;  1W1V A;  1E15 A;  4QNL A;  2JE5 A;  3WD0 A;  3WD2 A;  4IBG A;  4IJF A;  4GHL A;  1YU4 A;  4MB5 A;  4IBE A;  1OGG A;  2XD5 A;  3MQL A;  1O6I A;  3FKE A;  1UR8 A;  3KS4 A;  4Z2G A;  3WD1 A;  3L27 A;  2Y2O A;  1YUE A;  2Y2H A;  2Y2L A;  1GPF A;  4MB4 A;  3L2A A;  2Y2N A;  4NZ4 A;  1W1Y A;  3KS8 A;  3M7P A;  2BG1 A;  3WX7 A;  4NZ3 A;  1OGB A;  4IBD A;  2JCH A;  1QO6 A;  4Z2H A;  1CXW A;  1CK7 A;  4HMC A;  1E8B A;  1E6P A;  3L26 A;  3HON A;  4OUI A;  4TX8 A;  1ED7 A;  2RTS A;  1KS0 A;  4IJE A;  1YU0 A;  1YU1 A;  1E6R A;  1W1T A;  1YU2 A;  2FN2 A;  1H0G A;  2D49 A;  3HSH A;  4Z2J A;  4Z2L A;  4NYY A;  4LG2 A;  4NYU A;  2FFF B;  2IOU A;  4OJ5 A;  1H8P A;  3N3F A;  1E6N A;  3WD3 A;  4Z2I A;  3L25 A;  4HMD A;  4NZ5 A;  4MB3 A; 
#chains in the Genus database with same CATH homology
 2Y2J A;  2XD5 A;  4IBI A;  2UWX A;  2Y2I A;  3FKE A;  4OJO A;  5BPV A;  4OJL A;  2Y2M A;  4IJE A;  3KS4 A;  1YU0 A;  3L29 A;  1YU1 A;  3L27 A;  1YU2 A;  2Y2O A;  1YUE A;  2Y2H A;  3HSH A;  2Y2P A;  2Y2L A;  4IBJ A;  4NZ5 A;  4OJ6 A;  3L2A A;  2Y2N A;  1YU3 A;  4IBK A;  4NZ4 A;  2XD1 A;  4NYY A;  3KS8 A;  4IBB A;  2Y2G A;  3L28 A;  4GH9 A;  4IBC A;  2BG1 A;  2Y2Q A;  3WX7 A;  4LG2 A;  4NYU A;  4NZ3 A;  2FFF B;  2IOU A;  4IBD A;  4QNL A;  2JCH A;  2Y2K A;  2JE5 A;  4OJ5 A;  4IBG A;  3N3F A;  4IJF A;  3L25 A;  4GHL A;  4IBF A;  1YU4 A;  4NY2 A;  4GHA A;  3L26 A;  4NZ1 A;  4IBE A;  3HON A;  4OUI A;  4OJP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...