1PDCA

Refined solution structure and ligand-binding properties of pdc-109 domain b. a collagen-binding type ii domain
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
45
structure length
45
Chain Sequence
DYAKCVFPFIYGGKKYETCTKIGSMWMSWCSLSPNYDKDRAWKYC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SEMINAL FLUID PROTEIN PDC-109
publication title Refined solution structure and ligand-binding properties of PDC-109 domain b. A collagen-binding type II domain.
pubmed doi rcsb
source organism Bos taurus
molecule tags Collagen-binding type ii domain
total genus 5
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 1991-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00040 fn2 Fibronectin type II domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.10 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Fibronectin, type II, collagen-binding 1pdcA00
1J7MA 1CXWA 1E88A 1E8BA 1EAKA 1GXDA 1CK7A 1H8PA 2V5OA 3MQLA 3M7PA 1KS0A 1L6JA 1QO6A 1PDCA 2FN2A
chains in the Genus database with same CATH superfamily
3L27A 1EAKA 1W1YA 1H0GA 4Z2JA 4LG2A 4MB4A 3KS8A 1QO6A 1YU2A 3L28A 2JE5A 4OJOA 2Y2MA 1CXWA 1OGGA 1AIWA 2Y2PA 1GOIA 4MB5A 2D49A 4NZ1A 2Y2HA 1E6RA 2JCHA 4GHAA 2IOUA 3N3FA 1E6NA 1UR9A 4IJFA 4HMEA 1OGBA 4OJLA 1UR8A 1H0IA 4IBIA 4IBJA 1E6ZA 1E15A 2Y2OA 4IJEA 4GH9A 4IBFA 3WD1A 3M7PA 4NY2A 5BPVA 3WD0A 3L25A 4NZ5A 4MB3A 2Y2IA 3WD4A 4IBGA 3L29A 2XD5A 4HMDA 4GHLA 1W1PA 3FKEA 1YU3A 2Y2KA 1YU1A 4Z2LA 1ED7A 1CK7A 1GXDA 4IBEA 4OUIA 4Z2GA 4Z2HA 4IBBA 1J7MA 4IBDA 1YU4A 1GPFA 2FFFB 2XD1A 2Y2LA 1H8PA 2Y2NA 3L26A 3KS4A 2FN2A 1YU0A 1E8BA 4IBKA 1O6IA 4NYYA 3MQLA 4NZ3A 1L6JA 2Y2JA 3WD2A 4NYUA 3L2AA 4Z2KA 3WD3A 1W1TA 3WX7A 1YUEA 1E88A 4QNLA 1E6PA 4Z2IA 4OJPA 3HSHA 2UWXA 2Y2QA 2BG1A 4NZ4A 4TX8A 2V5OA 1KS0A 2RTSA 4HMCA 1PDCA 4IBCA 4OJ6A 3HONA 4OJ5A 2Y2GA 1W1VA
chains in the Genus database with same CATH topology
1J7MA 1CXWA 1E88A 1E8BA 1EAKA 1GXDA 1CK7A 1H8PA 2V5OA 3MQLA 3M7PA 1KS0A 1L6JA 1QO6A 1PDCA 2FN2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J7M A;  1CXW A;  1E88 A;  1E8B A;  1EAK A;  1GXD A;  1CK7 A;  1H8P A;  2V5O A;  3MQL A;  3M7P A;  1KS0 A;  1L6J A;  1QO6 A;  1PDC A;  2FN2 A; 
#chains in the Genus database with same CATH topology
 3L27 A;  1EAK A;  1W1Y A;  1H0G A;  4Z2J A;  4LG2 A;  4MB4 A;  3KS8 A;  1QO6 A;  1YU2 A;  3L28 A;  2JE5 A;  4OJO A;  2Y2M A;  1CXW A;  1OGG A;  1AIW A;  2Y2P A;  1GOI A;  4MB5 A;  2D49 A;  4NZ1 A;  2Y2H A;  1E6R A;  2JCH A;  4GHA A;  2IOU A;  3N3F A;  1E6N A;  1UR9 A;  4IJF A;  4HME A;  1OGB A;  4OJL A;  1UR8 A;  1H0I A;  4IBI A;  4IBJ A;  1E6Z A;  1E15 A;  2Y2O A;  4IJE A;  4GH9 A;  4IBF A;  3WD1 A;  3M7P A;  4NY2 A;  5BPV A;  3WD0 A;  3L25 A;  4NZ5 A;  4MB3 A;  2Y2I A;  3WD4 A;  4IBG A;  3L29 A;  2XD5 A;  4HMD A;  4GHL A;  1W1P A;  3FKE A;  1YU3 A;  2Y2K A;  1YU1 A;  4Z2L A;  1ED7 A;  1CK7 A;  1GXD A;  4IBE A;  4OUI A;  4Z2G A;  4Z2H A;  4IBB A;  1J7M A;  4IBD A;  1YU4 A;  1GPF A;  2FFF B;  2XD1 A;  2Y2L A;  1H8P A;  2Y2N A;  3L26 A;  3KS4 A;  2FN2 A;  1YU0 A;  1E8B A;  4IBK A;  1O6I A;  4NYY A;  3MQL A;  4NZ3 A;  1L6J A;  2Y2J A;  3WD2 A;  4NYU A;  3L2A A;  4Z2K A;  3WD3 A;  1W1T A;  3WX7 A;  1YUE A;  1E88 A;  4QNL A;  1E6P A;  4Z2I A;  4OJP A;  3HSH A;  2UWX A;  2Y2Q A;  2BG1 A;  4NZ4 A;  4TX8 A;  2V5O A;  1KS0 A;  2RTS A;  4HMC A;  1PDC A;  4IBC A;  4OJ6 A;  3HON A;  4OJ5 A;  2Y2G A;  1W1V A; 
#chains in the Genus database with same CATH homology
 1J7M A;  1CXW A;  1E88 A;  1E8B A;  1EAK A;  1GXD A;  1CK7 A;  1H8P A;  2V5O A;  3MQL A;  3M7P A;  1KS0 A;  1L6J A;  1QO6 A;  1PDC A;  2FN2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...