1PDCA

Refined solution structure and ligand-binding properties of pdc-109 domain b. a collagen-binding type ii domain
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
45
structure length
45
Chain Sequence
DYAKCVFPFIYGGKKYETCTKIGSMWMSWCSLSPNYDKDRAWKYC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SEMINAL FLUID PROTEIN PDC-109
publication title Refined solution structure and ligand-binding properties of PDC-109 domain b. A collagen-binding type II domain.
pubmed doi rcsb
source organism Bos taurus
molecule tags Collagen-binding type ii domain
total genus 5
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 1991-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00040 fn2 Fibronectin type II domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.10 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Fibronectin, type II, collagen-binding 1pdcA00
3MQLA 1PDCA 1H8PA 1QO6A 1E88A 3M7PA 1L6JA 1CXWA 2V5OA 1J7MA 2FN2A 1GXDA 1E8BA 1EAKA 1CK7A 1KS0A
chains in the Genus database with same CATH superfamily
3KS8A 1UR9A 1QO6A 4NY2A 5BPVA 1L6JA 3L29A 1GOIA 4IBIA 4GHLA 4IBJA 4NZ5A 4IBGA 1J7MA 2Y2PA 4NZ3A 4OJLA 1E88A 2FFFB 4Z2GA 4Z2KA 3MQLA 1EAKA 3L27A 2IOUA 2D49A 3HSHA 2Y2LA 4Z2IA 1GPFA 4IBEA 2Y2GA 1OGGA 4GH9A 3L26A 2XD5A 1W1VA 1CXWA 4IBDA 4HMCA 2Y2KA 2JE5A 1H0GA 1UR8A 1YU2A 4IBFA 1ED7A 1YU3A 2Y2JA 4MB4A 2BG1A 4IBKA 4NZ1A 1E6NA 4Z2JA 4OJ5A 3N3FA 4LG2A 1YU4A 3WD1A 1E15A 2V5OA 2XD1A 1W1TA 4OJPA 4NZ4A 4OJOA 1GXDA 1KS0A 1OGBA 3M7PA 2Y2OA 4IBCA 4QNLA 3KS4A 1E6RA 1YU0A 4IJEA 3L28A 2RTSA 1YU1A 4IBBA 4NYYA 3L2AA 1E6PA 1H8PA 1W1YA 4MB5A 2Y2NA 4HMDA 2Y2MA 3WD4A 2UWXA 2Y2QA 3L25A 4HMEA 1H0IA 4OJ6A 2Y2HA 3WX7A 4GHAA 4IJFA 4Z2LA 3WD3A 1AIWA 3WD0A 4TX8A 1W1PA 2Y2IA 1E8BA 1PDCA 4MB3A 3WD2A 1E6ZA 4NYUA 4OUIA 2FN2A 2JCHA 1CK7A 3FKEA 1O6IA 4Z2HA 1YUEA 3HONA
chains in the Genus database with same CATH topology
3MQLA 1PDCA 1H8PA 1QO6A 1E88A 3M7PA 1L6JA 1CXWA 2V5OA 1J7MA 2FN2A 1GXDA 1E8BA 1EAKA 1CK7A 1KS0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MQL A;  1PDC A;  1H8P A;  1QO6 A;  1E88 A;  3M7P A;  1L6J A;  1CXW A;  2V5O A;  1J7M A;  2FN2 A;  1GXD A;  1E8B A;  1EAK A;  1CK7 A;  1KS0 A; 
#chains in the Genus database with same CATH topology
 3KS8 A;  1UR9 A;  1QO6 A;  4NY2 A;  5BPV A;  1L6J A;  3L29 A;  1GOI A;  4IBI A;  4GHL A;  4IBJ A;  4NZ5 A;  4IBG A;  1J7M A;  2Y2P A;  4NZ3 A;  4OJL A;  1E88 A;  2FFF B;  4Z2G A;  4Z2K A;  3MQL A;  1EAK A;  3L27 A;  2IOU A;  2D49 A;  3HSH A;  2Y2L A;  4Z2I A;  1GPF A;  4IBE A;  2Y2G A;  1OGG A;  4GH9 A;  3L26 A;  2XD5 A;  1W1V A;  1CXW A;  4IBD A;  4HMC A;  2Y2K A;  2JE5 A;  1H0G A;  1UR8 A;  1YU2 A;  4IBF A;  1ED7 A;  1YU3 A;  2Y2J A;  4MB4 A;  2BG1 A;  4IBK A;  4NZ1 A;  1E6N A;  4Z2J A;  4OJ5 A;  3N3F A;  4LG2 A;  1YU4 A;  3WD1 A;  1E15 A;  2V5O A;  2XD1 A;  1W1T A;  4OJP A;  4NZ4 A;  4OJO A;  1GXD A;  1KS0 A;  1OGB A;  3M7P A;  2Y2O A;  4IBC A;  4QNL A;  3KS4 A;  1E6R A;  1YU0 A;  4IJE A;  3L28 A;  2RTS A;  1YU1 A;  4IBB A;  4NYY A;  3L2A A;  1E6P A;  1H8P A;  1W1Y A;  4MB5 A;  2Y2N A;  4HMD A;  2Y2M A;  3WD4 A;  2UWX A;  2Y2Q A;  3L25 A;  4HME A;  1H0I A;  4OJ6 A;  2Y2H A;  3WX7 A;  4GHA A;  4IJF A;  4Z2L A;  3WD3 A;  1AIW A;  3WD0 A;  4TX8 A;  1W1P A;  2Y2I A;  1E8B A;  1PDC A;  4MB3 A;  3WD2 A;  1E6Z A;  4NYU A;  4OUI A;  2FN2 A;  2JCH A;  1CK7 A;  3FKE A;  1O6I A;  4Z2H A;  1YUE A;  3HON A; 
#chains in the Genus database with same CATH homology
 3MQL A;  1PDC A;  1H8P A;  1QO6 A;  1E88 A;  3M7P A;  1L6J A;  1CXW A;  2V5O A;  1J7M A;  2FN2 A;  1GXD A;  1E8B A;  1EAK A;  1CK7 A;  1KS0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...