2Y2NA

Penicillin-binding protein 1b (pbp-1b) in complex with an alkyl boronate (e07)
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
488
structure length
468
Chain Sequence
ISEITYSDGTVIASIDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTGQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Guided Design of Cell Wall Biosynthesis Inhibitors that Overcome Beta-Lactam Resistance in Staphylococcus Aureus (Mrsa).
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
molecule keywords PENICILLIN-BINDING PROTEIN 1B
total genus 160
structure length 468
sequence length 488
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2y2nA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2y2nA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2y2nA02
3UE1A 4Y0TA 1ERQA 4ZDXA 2WGWB 4E3JA 2ZC4B 2XK1A 3C4OA 4D2OA 3OZHA 4N1HA 3ITAA 4N9LA 1E4DA 1GHPA 1K54C 1GHIA 1K54A 2DNSA 4KQQA 3C4PA 1CEGA 1Y54A 2ZD8A 5DVAA 4R23A 1YMXA 4DE0A 3MFDA 3IF6A 3GTCA 3IF6C 4OLGA 4U0XA 3WS1A 2QMIA 4KZ5A 4MBFA 4UA6A 5F1GA 3IT9A 1LI0A 3BEBA 3FWLA 4EWFA 1BZAA 4JBFA 5GLAA 2HP5A 3NDEA 3OPRA 2WAFA 2JC7A 2OV5A 4KZ7A 5TR7A 1FSWA 3UDXA 3MZEA 1W5DA 3A3IA 3HUOA 1TDLA 3ZG0A 2WZZA 4DE3A 1MWTA 4MNRA 1IYQA 1AXBA 3EQVA 4GZBA 2R9XA 4IBRA 3QNBA 3S4XA 3VSLA 3PAEA 4P6BA 1YLJA 4YINA 5HARA 3BFFA 1XP4A 4DE2A 5E43A 1IKIA 3IF6B 3HLWA 3V5MA 1JWZA 5FSRA 1M40A 3IHAA 2H10A 5EVIB 4KZ9A 3GR2A 2PBYA 2HP9A 3G4PA 3RXXA 4N9KA 1FCMA 1CI9A 3JYIA 3AGDA 5DF9A 4R4RA 2XD1A 1JVJA 1SKFA 3N8RA 2Y2IA 3DWZA 4RVAA 4OOMA 4S2MA 5FDHA 4B4ZA 3NIAA 1RGYA 3IH9A 4RX3A 2OLVA 2ZM8A 2WYXA 3C5AA 4GDBA 4OQIA 4ZTKA 5FAOA 3VFFA 2J7VA 2H0YA 1K55C 3SS3A 1FQGA 3HLDA 3LY3A 5EPHA 2Y2GA 4HBUA 5FAPA 3IWIA 3N8SA 4WYYA 4EUZA 3IXGA 4KZ4A 3IWOA 4IEDA 1FCOA 3DW0A 3GQZA 2ZM2A 5KMWA 3ZNTA 1ONGA 3IQAA 5FA7A 3HLFA 1CEFA 4OQGA 3Q1FA 4X56A 1YT4A 1ALQA 2EFUA 1BULA 1PW1A 5M18A 2DCFA 4JXVA 3Q81A 2R9WA 1L0GA 4OOYA 1BT5A 3BFDA 5JYOA 4QJGA 4DRTA 3V50A 2UWXA 2ZQDA 3ZVTA 1MWUA 2EX2A 4OPQA 2ZQ9A 1PZOA 3O86A 3PAGA 5F83A 1W8QA 1DJCA 1PW8A 1BTLA 2G2WA 3MBZA 3UO9A 4EBPA 3G32A 1PIOA 4HBTA 2EFXA 1VM1A 2EX9A 4E3NA 5BOHA 2IWCA 1PYYA 3HLEA 3PTEA 5CGWA 2B5RA 2V2FF 1KDWA 4WZ4A 3VP0A 4XUXA 1K56A 1K57C 2WAEA 4Y7PA 5HAIA 3N6IA 1NYMA 3VMAA 1KE3A 4C75A 5G18A 3D4FA 4JF4A 2A49A 1NXYA 2EX8A 3N8LA 1MXOA 3HUMA 2H0TA 1KGEA 4K91A 3ZHHA 4JXSA 4PM9A 3LY4A 1E3UD 4XUZA 3WS5A 4M3KA 1YLYA 5A90A 2XDMA 2ZQAA 1O07A 4GD6A 2XGNA 1BLCA 4GKUA 2QPNA 4R3BA 3Q7ZA 4ID4A 3GRJA 4LENA 3A3DA 2XFSA 2WGVA 1K55A 5A93A 3O3VA 1DJBA 5FQMA 2X01A 1NY0A 3MZDA 3QNCA 5AQAA 3Q07A 1OMEA 1PI5A 4BLMA 5F82A 4CJNA 3UPOA 3IHBA 3E2KA 4DKIA 1HVBA 3HUNA 5M19A 3WRTA 1IYSA 3VP1A 3OPLA 3HLBA 4NETA 5KZHA 4PPRA 4UHUA 1IYOA 1SDNA 1YM1A 5HAQA 3OCLA 2Y2JA 1FR1A 3PBNA 4Y0UA 5D3OA 3ZG5A 3SH8A 1EROA 5L2FA 2EXAA 4B88A 1MWRA 1MWSA 2ZQCA 5HX9A 3ITBA 5E2FA 5FASA 4ZJ1A 1ES3A 3MXRA 4H8RA 1ZG4A 3O87A 4OPYA 4JPMA 4DE1A 4BD1A 2P9VA 5U47A 2VGKA 5AQ9A 1NYYA 2RL3A 4OP5A 5CHUA 5FI6A 3MKEA 4S2PA 1PWGA 3OPHA 1PWDA 1S6RA 4KG2A 4KENB 1BSGA 5CTNA 3IXHA 3HREA 4OVDA 5CHMA 5DTSA 4R0QA 1IYPA 1SCWA 4UAAA 2WADA 1ZKJA 3C7VA 5EOOA 1GHMA 1WE4A 1YLWA 5CGSA 5EE8A 3MKFA 3WS4A 2Z2LB 1GCEA 3ZG8B 5FI2A 2X71A 5GL9A 1HTZA 2Q9MA 4PMAA 3HL9A 1M6KA 1FCNA 3WS0A 1G68A 5CXWA 1JTGA 4X68A 1BUEA 3EQUA 3Q82A 1FOFA 5E2EA 2J9OA 4JF5A 3OC2A 5E2GA 4S2IA 1YMSA 1BLSA 4WM9A 1IELA 3HLCA 5DTTA 2DRWA 1FSYA 2XQZA 4RYEA 3C7UA 3FKVA 3ZNYA 1LI9A 1PWCA 3UPNA 1W8YA 4LV2A 4QU3A 3PBRA 2EXBA 5IHVA 4OOLA 5EUAA 3IXBA 1N9BA 2G2UA 2HDQA 3FV7A 5FQ9A 4E6XA 5KSHA 2X02A 1W79A 1ESUA 2Y2HA 5AQBA 4OKPA 3BFCA 1I5QA 3S1YA 4GN2A 2Y2NA 1KVMA 3ZCZA 4KG6A 4IVIA 4WZ5C 2Y2MA 3M2KA 4OH0A 4WELA 1ES4A 1KDSA 4UA7A 5JYPA 1GA0A 1BLHA 1K6SA 3VOYA 3W4OA 2WGWA 3DWKA 1TDGA 3A3JA 1JTDA 1ZC2A 1NZUA 3LCEA 5TFQA 2Q9NA 3SH9A 1RGZA 3NI9A 1XGJA 2C5WB 1E3UA 1RP5A 1K4EA 4WMCD 2BLSA 2HDUA 3LEZA 4MEZA 1H5XA 3SH7A 4OONA 3IXDA 1TEMA 2V1ZA 1HD8A 4NK3A 1K6RA 4YFMA 1KE0A 4RX2A 1ZG6A 5CGXA 4BENA 2Y2PA 4PM8A 4BQMA 4Q8IA 5HAPA 1XGIA 4P87A 5GLBA 3ZG9B 1XX2A 4HEFA 4PM6A 4U0TA 1E25A 5EVIA 2Y2KA 4R4SA 4O7DA 4BD0A 5FAQA 3BYDA 4OPZA 5GHYA 1ESIA 3PBTA 4JXGA 3G2YA 1MY8A 3GMWA 2IWBA 3GVBA 3GSGA 2XH9A 4CPKA 3N4IA 4KG5A 2ZC3B 2Y2QA 4OP8A 2J9PA 2WZXA 3B3XA 3UPPA 4GDNA 3UN7A 3AGEA 1L0DA 3QHYA 2JCHA 5EECA 5A91A 1K25A 1YLZA 1GA9A 3G31A 2XFTA 2OLUA 3NC8A 4N1XA 4QY5A 5CHJA 3BFGA 1CK3A 1WYCA 3WRZA 3M6HA 3HBRA 2HPBA 3TG9A 3GV9A 1TVFA 2J8YA 4MLLA 1KE4A 4QY6A 4MBHA 4S2KA 2ZMAA 4KZ8A 3CZDA 2Y2OA 1XPBA 4KQRA 5FQJA 2XD5A 1BLPA 2Y55A 2ZC7A 5HW3A 1LLBA 2OSUA 4X55A 1KVLA 5FATA 3M6BA 5EVLA 3WS2A 3NCKA 5DF8A 4EV4A 4KZBA 5CEDA 1G6AA 2WUQA 4P0MA 1ERMA 1LL9A 3TOIA 3BFEA 3BM6A 3Q7VB 1K4FA 4JF6A 1YLTA 2PU4A 4WBGA 3PBQA 3UY6A 4HESA 3UDIA 2HDSA 1PZPA 2ZC6B 1K57A 4FSFA 4E3KA 3CMZA 5FQKA 2PU2A 1H8ZA 3Q7VA 2P74A 1Z6FA 3AGFA 4QB8A 1I2WA 4UA9A 4GB7A 4DF6A 4E3IA 4K0WA 3VP2A 4JLFA 5GHXA 4C6YA 1QMFA 1S0WA 4BL2A 1Q2PA 4GOGA 5CECA 3ZGAB 2XF3A 2Y4AA 3NY4A 4KZ3A 4R1GA 2JE5A 2FFYA 2IWDA 3A3FA 3LO7A 3N7WA 4B4XA 5DTKA 3SS4A 3VFHA 1VQQA 3VP3A 1C3BA 4EBLA 4WEKA 2VGJA 3OPPA 3WWXA 4EBNA 3RXWA 5CRFA 3A3EA 5CEBA 2ZQ7A 2WGIA 1DJAA 4WEJA 3RJUA 3NBLA 4WMCA 4BL3A 4LV3A 5GHZA 2HDRA 2JBFA 2WKIA 4ZJ2A 1U60A 1J9MA 3E2LA 4BJPA 1ONHA 3MXSA 5HL1A 1ES2A 4E3MA 2P9VB 3UE0A 1DY6A 3CG5A 2ZQ8A 2E8IA 3ZG7B 2WKHA 3BLMA 3G35A 3FZCA 3P09A 4ZBEA 4XXRA 2XEPA 2Y91A 4S2JA 1O7EA 1EWZA 1KGFA 3DTMA 3BLSA 3IH8A 3IWQA 4JKTA 5CERA 2RCXA 4FD8A 4ZAMA 3V3SA 2ZJ9A 1KGGA 4X6TA 2GDNA 2Y59A 3W4QA 1L2SA 4PM5A 5F1FA 5CTMA 1QMEA 1IKGA 5EVIC 5HFOA 4OQHA 1NRFA 4KZAA 1K38A 3V3RA 3PBSA 3VOZA 3OCNA 3ZVWA 4A5RA 4S2NA 3UNWA 1HZOA 4OPRA 3G30A 1PI4A 2H5SA 3HVFA 3ZFZA 5FQQA 1Q2QA 2V20A 4KZ6A 3FKWA 2C6WB 4WZ5A 1NZOA 5E2HA 3ZDJA 4S2LA 1SHVA 4IVKA 5DF7A 1YQSA 1IEMA 2ZM0A 4E3LA 3TSGA 5M1AA 4ZJ3A 4DXCA 3W4PA 1W7FA 4K0XA 1MBLA 1JWPA 4OLDA 1FR6A 5KSCA 2HP6A 4FCFA 4MBKA 1CI8A 3MZFA 5TGFA 2A3UA 4QHCA 5FQIA 4IBXA 1LHYA 4X53A 1YLPA 4P85A 4QD4A 5FI7A 4DDYA 2BG1A 2WKEA 5GLDA 4Y0OA 4Z9QA 5AQ7A 1N4OA 3HLGA 3S22A 1JWVA 4GD8A 4PM7A 5A92A 3G34A 3FYZA 1LL5A 5I94A 3I7JA 1RCJA 4DDSA 4DXBA 4LV1A 3NDGA 5J8XA 5EVID 4S2NC 1WYBA 3SS5A 1I2SA 1MKIA 1XA1A 1XA7A 4U3TA 1XXMA 4X69A 3O88A 3M2JA 2XR0A 3PBOA 1MPLA 4JXWA 3VSKA 3UE3A 4C3QA 2Y2LA 3G2ZA 4E3OA 4F94A 5EOEA 2ZLYA 4LCLA 2FFFB 4N92A 2EX6A 4S2OA 1L0FA 2QZ6A 3BRMA 4E6WA 4RA7A 4LV0A 4FH4A 3IF5A 3SOIA 2XLNA 1EI5A 4KQOA 4OQ0A 2Z2MB 4R3JA 3UDFA 4EQIA 2CC1A 3BECA 1H8YA 1ES5A 5GLCA 1XKZA 4GNUA 3V39A 3P98A 3ISGA 1L0EA 4FH2A 2ZC5B 3W8KA 3CJMA 3VP4A 4LCMA 2WK0A 4L0LA 1SDEA 1NJ4A 1K56D 2I72A
chains in the Genus database with same CATH superfamily
3UE1A 2V8CA 3O5YA 4EESA 4Y0TA 1KS0A 3UB7A 2WGWB 4E3JA 5B2IB 3ITAA 4NXFA 2PDRA 1E4DA 1GHPA 1K54C 1CEGA 4DE0A 1E8BA 4MDZA 4B9OA 1SZVA 2VA0A 4J8VB 3GTCA 3TU4D 1OTDA 2QMIA 4HH2A 5CPJC 5F1GA 1LI0A 2O9AA 5GLAA 3X1SB 5HDDA 4Z2GA 2FJ7A 2JC7A 3UTBD 2OV5A 3REHA 4KGCA 5DJUA 4UUZB 3HUOA 3ZG0A 4HP4A 5B0YD 1A7WA 4MNRA 1AXBA 5B2JD 1OTAA 2R9XA 4IBRA 3VSLA 5AVEA 5AV9D 4P6BA 3FPVA 3B33A 1XP4A 1IKIA 2VKSA 3AV2D 4EW7A 5F99C 3V5MA 1KX3A 3VH5W 4J8WB 4HGAC 3RXXA 5GT0C 4HIAA 4EXOA 2XD1A 4MB5A 1SKFA 3DWZA 4OOMA 3NIAA 5G49B 4WU8C 2ZM8A 2WYXA 4L9FA 5B31A 2H0YA 3SS3A 3IX8A 3LY3A 3CUEC 1ID3B 2W3DA 4KHAB 5CPKB 3ULFA 5AV5A 4OJ5A 3DTIA 2E8JA 3N8SA 3WAAA 4WYYA 3B6FB 4MN5A 3C1BC 2W3EA 1FCOA 3VH6W 3DW0A 3GQZA 2FN2A 5GT0B 1EQZA 1CEFA 4X56A 3U2AA 3AV1B 2EFUA 1PW1A 3WKJA 1OTIA 2DCFA 5EV0A 3Q81A 3LR3A 1OJ5A 3UE6A 1L0GA 1BH9A 1KU5A 1BT5A 2B02A 2UWXA 3AYWD 2EX2A 3BJNA 1PZOA 3O62D 1OTBA 2V0UA 5AVBA 3B6GC 3WA9C 1BTLA 3F1PB 1PIOA 4HBTA 4NG2A 3B0BA 4E3NA 5BOHA 1LT0A 4JGPA 1PYYA 3HLEA 3PTEA 3AV1C 1KDWA 4WZ4A 3T4JA 3PYPA 1J7MA 4Z2HA 3L25A 3TW8A 3L9KA 1AOIA 5HAIA 3N6IA 1NYMA 4I3JA 4JJND 3RELB 5B31D 4E44A 2A49A 4EO5C 1P3LB 1NXYA 3AYWB 2QJ5A 4H9SA 3K3DA 3HUMA 3MGQA 3LY4A 1LSWA 3BQ8A 4XUZA 3L7HA 3FKEA 2XDMA 2CV5C 3REID 5AV5D 3H82B 2XGNA 1BLCA 3MGRD 2YKHA 4R3BA 2ACGA 3Q7ZA 3MGQD 3T4LA 5B0ZB 4IBFA 5FQMA 4CJNA 1PI5A 1GPFA 1HVBA 1B67A 1N9OA 5M19A 5B2ID 1IYSA 1IYOA 4UEYA 1SDNA 5HAQA 4Y0UA 3L26A 5HL6A 1EROA 2W0NA 1XFQA 2EXAA 4GS9A 3KSFA 2W8SA 5E2FA 5FASA 2AROD 3S7QA 1ZG4A 1H3OB 1JNUA 5BT1C 2P9VA 4YM6D 2VGKA 5AQ9A 2PD8A 4OP5A 3LELC 3REHC 5FI6A 3AZJA 4J8VC 3KSYA 4ETZA 4Z5TA 1HLUP 4KG2A 5B2JB 4GHLA 4KENB 2HIOA 5CHMA 5B0ZA 2V9AA 1ZLAC 1PNEA 4OJOA 1ZKJA 1WE4A 5CGSA 4J8WD 3MKFA 2Z2LB 5BNVA 5FI2A 5GL9A 1CJFA 1HTZA 3HL9A 3W96D 4CLCE 4EETB 5CXWA 1GOIA 3EQUA 3RELA 5E2EA 3FG8A 2G5HC 2A24B 4S2IA 1YMSA 1BLSA 5DTTA 4RYEA 1NWZA 3EPHA 3C7UA 3FKVA 2GNXA 3ZNYA 5GXQA 3KWQC 3TJZC 5GT0D 4QU3A 3PBRA 4Y13A 2BASA 1EAKA 2EXBA 3IXBA 4AWLB 1S67L 3FV7A 4E6XA 2HJEA 3AZID 5B1LC 3BFCA 1I5QA 1LSXA 4KG6A 5AVCC 1OT6A 4QNLA 3AZIA 4WZ5C 3AV1D 2Y2MA 3M2KA 4WELA 5CPJA 2WKRA 4G91B 4XZQA 1OGBA 3L27A 2WGWA 3EOIA 1JTDA 3F1NA 3WAAB 3MVDA 2BTFP 3MQ0A 3B6FA 3NI9A 1H0GA 3W98A 2VX8A 2C5WB 5B31B 4EQ1A 1ULYA 3IXDA 2V1ZA 1KX3C 4NK3A 3ZQ5A 3LICA 4Z5TC 4RX2A 1ZG6A 5CGXA 2XROA 2Y2PA 1T19A 5HAPA 5B32A 3UTAD 3ZG9B 4PM6A 3RELD 1E25A 4UQIS 3MGSD 3D72A 3REKB 1ESIA 3X1VC 3BY8A 3PBTA 1MY8A 3GVBA 4HMEA 3GSGA 3OOVA 2XH9A 3B47A 4CPKA 3N4IA 4XUJB 4OP8A 2J9PA 4BBUA 3UN7A 2JCHA 1K25A 3LUQA 1GA9A 2XFTA 2OLUA 3NC8A 1P3PD 4Q0HA 3MNNC 5CHJA 4H9QA 3BFGA 3M6HA 3A1IA 4Z66C 5BT1D 1P3GA 5F6AA 3X1SA 1KOUA 4WUJA 4MBHA 2LB5A 4S2KA 3E4QA 4J8VA 5B33D 3VH5A 4XUJC 4R8PB 3CZDA 3SZTA 4X25A 3T4TA 2XD5A 1BLPA 2OAP1 2PRFA 5GT3C 1LLBA 3UMDA 1TD5A 5EVLA 4DQYB 4ZBJC 3W97A 3CAXA 2WUQA 3EEHA 3LJAC 4KUOA 2W1TA 3BFEA 1JFIA 5HSQA 4GHIA 2PU4A 3AZKD 4BWIA 4LD9A 3UY6A 1AOIC 1PZPA 1K57A 5FUGB 2PYOA 1P3AA 3MMHA 3Q7VA 2P74A 1Z6FA 4QB8A 1I2WA 3LI8A 3AZMB 5F99A 4X1MA 3NQUA 2K2NA 4XZQB 1W1TA 3T4QA 2JSSA 1YU2A 5CECA 2YFVB 2XF3A 5CPIC 1VEUB 3N7WA 3KS8A 1BYWA 5DTKA 3VFHA 3RH8B 3VP3A 1S32C 4EBNA 5CRFA 3A3EA 3AZMC 1DJAA 5BO0B 3RJUA 1TS7A 2J3TD 4IBDA 4G3KA 2HDRA 2JBFA 1ONHA 3MXSA 1ES2A 4NEED 3UE0A 2A24A 1P3BC 4ZBEA 2XEPA 1TZYA 4S2JA 1KGFA 3WD3A 4FD8A 3AZFA 4YM6A 4J8XB 2GDNA 2WKQA 3W4QA 5TJJA 4ZRRA 4PM5A 3KYEA 5EVIC 4NYYA 4OQHA 4KZAA 3SW1A 2ZL1B 4WN5A 1G6OA 3OCNA 3MGSC 2KOIA 4OPRA 1XJ3A 4KUKA 3HVFA 3KXBC 1S66L 1Q2QA 5B2JA 3IS2B 3R7WA 3UTAB 5DNMD 5MC7A 4YS3C 5AJGA 3K2NA 4J8XD 1SHVA 2OWHA 1YQSA 3REKD 4ME4A 3AZEC 2G5IC 3MGPC 1FILA 4ZJ3A 4CSRA 4OLDA 4MBKA 3REJB 3VE3A 1KX3D 2J80A 4QHCA 4G3WA 4R3AA 3AZLC 2WKEA 4Z9QA 4JJNB 3G34A 3X1VD 5CP6D 1H3QA 4DDSA 1CQAA 5B33B 1I2SA 1P9RA 4U3TA 4X69A 2XR0A 3VSKA 1MPLA 3REIB 3P5JB 4J8UC 3UE3A 4J8UA 4X23D 4E3OA 3LEQA 3MNND 5DKKA 2EX6A 3BRMA 5B40C 2QHKA 4HH3A 4EQIA 3AYWA 3BECA 1ES5A 3MXQA 4ZUXC 2HUEB 3V39A 4NY2A 2WK0A 5CPIA 1NJ4A 3QP1A 2BYKA 4GHIB 1K56D 4M6BA 3X1TC 3C4OA 3A6NC 2ZM5A 4I3IA 3OZHA 3JPUA 2Y8HA 1Y54A 1YU3A 5DVAA 1DP8A 1YKDA 1X0OA 3IF6C 3WS1A 4KZ5A 3B0CW 4WV4B 4MBFA 3IT9A 5AY8A 3B0CT 3FWLA 2W3FA 1P3MD 1BZAA 2WAFA 1P97A 4CAYB 4R70A 5TR7A 4JJNA 1FSWA 3UDXA 3A3IA 1KX5C 1KX5A 1IYQA 4KHAA 1F66A 4GZBA 2BYMA 5AV8A 3S4XA 1M19D 1SKOB 1UGUA 3E0YA 3E4OA 3PAEA 4YINA 3WKJC 4XUJA 4IBBA 3EEAA 3T4OA 3IF6B 4HP9A 5FSRA 1VHMA 1P3FD 3KX0X 4KZ9A 3GR2A 4N9KA 3W97C 3AGDA 3AN2A 1JVJA 1VB6A 4RVAA 1F5MA 5FDHA 1M18B 2DMWA 2OLVA 4OQIA 2IOUA 4ZTKA 5FAOA 3VFFA 4H9OB 1K55C 3HLDA 1YAXA 2Y2GA 1M19B 4HBUA 4H9NB 4F3LB 5AV6C 3IX3A 1DP6A 5FAPA 4AFIA 4EUZA 2W1TB 3AYWC 3IXGA 4CQHA 3X1UD 3MVDD 1M1AD 3W97B 2ZY4A 4HMDA 2AROA 1ONGA 3IBRA 3IQAA 2HIOD 5FA7A 3W98C 2D49A 3MGPA 3MQOA 1FIKA 4OQGA 1BULA 5B24D 4IHQA 1M1AA 1IFQA 5I5LA 4OOYA 3AZJD 3BFDA 5JYOA 5AV6B 4DRTA 4HMCA 5B2IC 3MGPB 4OPQA 3KSHA 1QO6A 3X1UB 1W63Q 5F83A 1W8QA 4J8UD 2BYKB 2EX9A 4QLCB 5B1LA 5GXQB 4HJ6A 3VP0A 2B5RA 1F1EA 4NXEA 3RFBA 3X1SC 3KUYD 4Y17A 5JRGA 4OJPA 3W99D 4Y7PA 5DKLA 5CP6B 1HQ3B 4JF4A 4WNNB 2ZOHA 1TZYC 2EX8A 3FC7A 4X1LA 3N8LA 3W99A 4R6LA 3NHQA 4K91A 1WA9A 5IS1A 1E3UD 3UT9B 4J8UB 2QKPA 5F99B 3LIFA 3AN2C 2PR6A 5GXQD 2QPNA 4ID4A 3GRJA 4LENA 3D3OA 2XFSA 2WGVA 1B6WA 5A93A 1F66B 1DJBA 1NY0A 3MZDA 1OMEA 3IHBA 1YU1A 1P3KA 2QYBA 3WRTA 4KUDB 4NETA 3HLBA 5HDSA 3VP1A 1LL8A 4UHUA 5D3OA 3PBNA 1P3MC 4H9RA 3B6FC 3ZG5A 3CPTB 3SH8A 1ZTUA 5L2FA 4II7A 5HX9A 3AZHA 4OPYA 1F66C 4JPMA 2F8NK 4WU8B 3LR4A 3BY9A 3WAAD 3LYXA 2RL3A 1EW0A 3MKEA 3EWKA 3OPHA 3LZ1B 1PWDA 2CWEA 2V8FA 2NQBD 2PHYA 3HREA 3X1VA 5DTSA 1P3KD 4O0PA 1SCWA 2VV7A 3C7VA 5DFYA 1YLWA 3D9YA 5GT3A 2F8ND 4WU8D 3DTKA 3C8CA 5E5AB 4PMAA 1ID3C 1M18D 4GCZA 1FCNA 3WS0A 1G68A 2JKTI 2PAVP 3VE4A 3Q82A 3AZIC 3MVDC 2J9OA 3MQQA 3OC2A 4JF5A 5E2GA 2V0WA 2DRWA 1FSYA 2WKPA 2XQZA 4G92C 1T1AA 1LI9A 1PWCA 4LV2A 3W97D 4JGQA 2ZOIA 4LG2A 5E5AC 3DTEA 4Z2JA 1P3AD 2G2UA 2FZ0A 2HDQA 5FQ9A 5KSHA 5CX7A 4Z2LA 3H9WA 1YSPA 4LD9D 1ESUA 2Y2HA 4I3AA 4OKPA 4NXGA 5EFWA 5AV6D 3O62C 4GN2A 2Y2NA 1KVMA 3ZCZA 3X1TA 4IVIA 1PZRA 4NYUA 2VV6A 4E45A 4Q0IA 4OH0A 1ES4A 2P04A 3C2WA 2QWSA 5A8BA 4UA7A 5JYPA 5DNNA 1E6ZA 3AZNC 1GA0A 5EVEA 3N3FA 3AZLA 1TDGA 3A3JA 5TFQA 1ZC2A 3OBFA 2Q9NA 3CITA 3B0DB 4DRBA 1RP5A 1K4EA 2BLSA 3LEZA 4MEZA 3BWLA 3E4PA 4XZQD 4QLCC 1TEMA 1K6RA 3FPWA 1XGIA 3MGRC 4O01A 4YM6B 4J8XA 4HEFA 4IJEA 2W1RA 5EVIA 3NOPC 3KFUG 4J8WA 4O7DA 4Z66D 1TZYB 4R8PA 3G2YA 3L2AA 3GMWA 1P3OC 2VV8A 2R78A 2Y2QA 2F2AC 5F99D 1UR9A 4RQ9A 2A2LA 2VGLS 4GDNA 3CHWP 3LJAA 5GT3D 2F8NA 3G31A 3ZYTA 1YU4A 1WYCA 1UWNX 2FJ7B 5B1MA 3GV9A 1N9NA 3AZEA 2J8YA 5HD5A 3C30A 2P08A 1KX4C 5KDMB 5G4ZA 2NZDA 4KZ8A 1P3OB 1DP9A 4GLQA 2NUPC 4KQRA 2J3TC 5B2JC 3VH5T 1P3KC 4X55A 3M6BA 3JVVA 1EQZB 4GH9A 5DF8A 4HGAB 5GT0A 3AV2C 2NQBB 4KZBA 3AZMA 4CLCA 4OJLA 1BH8B 3VH6A 1K4FA 1YLTA 3NQJB 5CPKA 4HESA 5F5YA 3UDIA 5JRGD 2K31A 4FSFA 3LZ1C 4E3KA 2PU2A 3E98A 4MN6A 1BH8A 3LIEA 3F1NB 5G49A 4DF6A 4NZ4A 1STZA 4K0WA 3VP2A 1EQZD 4JLFA 5GHXA 1TS0A 4BL2A 1Q2PA 4G91C 4QWOA 1KX3B 4GJ4A 4KZ3A 5E5AD 2JE5A 3A3FA 5AVFA 3NJAA 4B4XA 3CI6A 5B0ZD 1VQQA 4GW9A 3MGSA 1VETA 1C3BA 5JRGB 4XT2A 3OPPA 5B1LB 3X1VB 1E6NA 5CEBA 3AZED 4YS3B 4LV3A 3BW6A 5B1MC 5AV8D 5HL1A 4E3MA 3WX7A 4X23B 3MGQC 2E8IA 2RVQC 5B32D 1R4VA 3FZCA 3V9RA 4ARZB 3HJKA 2Y91A 2PR5A 1O7EA 1EWZA 3DTMA 3IWQA 3IH8A 2RCXA 4ZAMA 5B0YA 2ZJ9A 5DNMC 5DNMA 4KUDA 3EGDC 1QMEA 1IKGA 1H8MA 2XSSA 4CLCC 3V3RA 2G7UA 1G28A 4X23C 1V9YA 1CK7A 1MC0A 1S32A 3LR0A 4S2NA 1HZOA 3G30A 3ZFZA 2H5SA 4R8PD 3REIC 4MCWA 3VV4A 2V20A 4KZ6A 3FKWA 2C6WB 5HWTA 3REHD 5KIZA 4KGCD 4J8VD 4OJ6A 2VGLM 3ZDJA 4IVKA 1PDCA 3T4KA 3R45A 4NZ5A 5M1AA 4DXCA 2HUEC 3IP4C 1TAFB 3AZKB 2HP6A 4DJ2A 3MZFA 4MN7A 4QLCD 1T18A 4P6ZS 4DDYA 3LGOA 2PBDP 3REHB 1JWVA 4GD8A 5A92A 4NE3A 1P3GD 1LL5A 4PAUA 5I94A 1RCJA 1VETB 4LV1A 3TU4A 4LPZA 4ZUXD 2Z6CA 5B31G 5AV6A 1XXMA 1S4SA 5B32G 3O88A 4C3QA 2Y2LA 3G2ZA 4WU9B 3NULA 2FFFB 3AV2A 1L0FA 2QZ6A 4JGRA 2M7UA 4LV0A 4Z2MG 5B0YC 3IF5A 4KQOA 4R3JA 2Z2MB 2ZY3A 1N1JB 3L29A 3MNNA 3BQAA 3CUEA 1EQZC 3P98A 3IBJA 3CJMA 3VP4A 2JN7A 3C1CB 4F3LA 4LCMA 3C1BA 2HIOB 1PFLA 1D06A 2NQBA 2XK1A 4H9PA 3MGRA 4Z2IA 4Y5FA 4AWLC 4N1HA 1GHIA 1K54A 2DNSA 4KQQA 3C4PA 3MS6A 3DBAA 2RIQA 5AV9A 2D01A 4R23A 4GHAA 1YMXA 3A0RA 3LIAA 1P3OA 1E6PA 3MFDA 2JKRI 4GS9B 1M19C 3AV1A 4OLGA 3AZEB 4UA6A 3BEBA 4EWFA 5BNXB 3WA9A 2RVQD 2HP5A 3NDEA 3KS4A 3QP8A 2F8NB 3KSGA 4ZUXA 4O8GA 5F69A 4WL9A 1W5DA 3T50A 1TDLA 1MWTA 5BNXA 3EQVA 5GSUD 4DMZA 2J3WA 3RTYA 5HARA 5AVCB 3BFFA 1D7EA 4DE2A 3HLWA 3WTPC 5AVBD 5EVIB 3B6GD 4HNBA 3MGQB 2HP9A 2VEAA 1S1ZA 1FCMA 1ZLAA 3JYIA 3KUYC 1T1CA 4R4RA 1M1AC 3N8RA 3KXBD 4B4ZA 3IH9A 1P3IA 4Y15A 4RX3A 5HDCA 5CP6A 3UTAC 4JJNC 2J7VA 5B31C 1FQGA 1YU0A 3VH6T 5EPHA 3MF0A 3EPLA 2V1BA 2MJ6A 3IWIA 4KGCB 3IWOA 2NUTC 4IEDA 3MNNB 3P01A 5KMWA 4M4XA 2CV5D 2H28A 3AFAA 1WWIA 3Q1FA 5L09A 1ALQA 1P3PC 1UR8A 2VJWA 2LB9A 5HPIA 4R8PC 4LGWA 4Q0JA 3V50A 3ZVTA 1MWUA 4NE5A 5B33C 3UMEA 3O86A 3PAGA 3NECA 1DJCA 1PW8A 3MBZA 4EBPA 3G32A 2EFXA 2F8NG 1Z2CB 5CGWA 4I38A 2AROC 1K56A 4H9NA 1P34B 3KXBA 1TF1A 1K57C 2INWA 2WAEA 3W96B 2OAQ1 4C75A 4LFUA 1S4RA 5J3WA 2H0TA 3AZNA 4ZBJB 1KGEA 1GSVA 3WS5A 5FEFA 2W3GA 4GD6A 1K0KA 3O62A 4IBIA 3T1SA 2OOLA 2DQNC 4I39A 3A6NB 1GXDA 1KX5B 2X01A 5CPID 1M18C 4BLMA 5DNND 1CF0A 3LZ1A 3E2KA 4DKIA 3HUNA 1P3FB 4L9EA 3OPLA 3C1CC 5CPKD 3WA9D 2Y2JA 3OCLA 1ZHHB 4FTXA 4IJFA 4B88A 1MWRA 1MWSA 2ZQCA 3REJD 4ZJ1A 1ES3A 3MXRA 4H8RA 3LFVA 2JKRM 1P3AC 4BD1A 5U47A 3G6OA 3AFAB 1NYYA 5CHUA 4J8XC 4IUHA 3R4KA 2O0YA 1S6RA 2HF6A 5AVBC 5GSUB 3B6GA 2XA7S 4YS3A 1BSGA 4I5SA 4OVDA 3EPJA 1M19A 5B24B 3O62B 3HONA 3MGSB 3GDIA 4UAAA 2WADA 3S7NA 5EOOA 1GHMA 3P7NA 3WS4A 4MMNA 1GCEA 3ZG8B 3WD2A 3AZNB 2Q9MA 1M6KA 1P3IC 1JTGA 1HQ3A 3AZGB 4YS3D 4X68A 2AVXA 1FOFA 4QPRA 3KUYB 3KXBB 2Y79A 5AV8B 3W98B 1Y4OA 1W8YA 1JFIB 3AL0C 3X1UA 4YM6C 5EUAA 2K7SA 3VOLA 1N9BA 3AZLD 5IU1A 3H7WB 3UB9A 5AQBA 3A1KA 3S1YA 4WZSB 1ODVA 1P3MB 2IO5B 5G4YA 3WD4A 2B95A 4J8WC 3W4OA 3DWKA 5AV9C 3AZHD 2FJ7C 1NZUA 4R38A 3EGXC 1RGZA 1XGJA 3A6NA 4NXBA 1W63M 1H5XA 5JA4B 1GSXA 1U35D 1HD8A 5CPJD 3AN2B 2IO5C 4YNRA 1XJ2A 4BQMA 4Q8IA 5B40B 5F68A 1XX2A 3UTBC 2NZDC 4WU9A 5DNNC 5FAQA 5GHYA 4JXGA 5FL3A 1BFMA 3A6ND 5B1LD 4KG5A 2ZC3B 5CPKC 3LIDA 3TU4B 3B3XA 5AY8C 1L0DA 5EECA 1U35B 5DJTA 4N1XA 4QY5A 3MVDB 5IT5A 1CK3A 1XFNA 3WA9B 3HBRA 2HPBA 3TG9A 2Z6DA 1TVFA 2JKTM 5DNNB 1KE4A 2YKFA 4G92B 1S32D 4HJ4A 1H3OA 2KDKA 3ICYA 2Y2OA 5C3IB 1XPBA 4LRZE 5LBRA 5FQJA 2ZC7A 5HW3A 3TE8A 1OJGA 5FATA 1KVLA 3HCYA 3C1CD 4EV4A 4WF0A 5CEDA 3QP6A 4P0MA 1ERMA 1DRMA 2O99A 3LZ0C 3BM6A 1P3AB 3Q7VB 4DJ3A 4NZ1A 2EA9A 1P3BD 5J4EA 4LD9B 2HDSA 3T1XA 3KO6A 5C3IC 1HQ3D 3F1OA 1H8ZA 3CWFA 3AGFA 3WTPA 2OWJA 4CLCD 1E88A 4C6YA 4WJ3C 3AZGD 4GOGA 4BMWA 1P3LA 2Y4AA 4R1GA 3V9RB 2IWDA 3SS4A 3NOUC 5B32C 4WEKA 2VGJA 2GZAA 3WWXA 1P3GB 3B0DC 2I9VA 4WEJA 1D1JA 3NBLA 1Y28A 4WMCA 2WKIA 4ZJ2A 3LJAD 4IBJA 2P9VB 5AV5C 1DY6A 2ZMFA 3ZG7B 2WKHA 4PHTA 1O6IA 4NKPA 3AZKC 1TAFA 3AZKA 3REKA 2HJ9C 3BLSA 5CERA 1KX4B 4Z66A 1P3GC 3LELB 2Y59A 3AZFC 5BS7A 1ZLAD 3PHYA 1P3PA 5CTMA 1AIWA 3IS2A 3U4LP 2JHEA 1P3KB 2CMNA 5FUGA 2PYOB 4H6JB 5AV5B 3ZVWA 4A5RA 2NZDD 3UNWA 5FQQA 1T3UA 5GSUA 2GJ3A 5B40D 3S7PA 3AZHC 1NZOA 2M1CA 3AZFB 1YPRA 1NRJA 3LELD 4LRXC 5B0YB 1TS8A 1YUEA 5CPJB 2ZM0A 2V5OA 3TSGA 4E3LA 2PYOC 1NLYA 1MBLA 4K0XA 1JWPA 5KSCA 4ARZA 5TGFA 2NZDB 1L3LA 5FQIA 4IBXA 4X23A 2Q0OA 2BG1A 4PKYG 4QLCA 4Y0OA 5GLDA 1N4OA 4KUDC 5BO0A 5CHLB 3S22A 2KX6A 3LIBA 3PXPA 3FYZA 5AVCD 3I7JA 4XT2B 1AWIA 2D02A 3NDGA 1H0IA 5EVID 5DFXA 4S2NC 3SS5A 4YOFA 1XA7A 5AY8D 2EWWA 3PBOA 4YWZA 3MR0A 3R45B 4F94A 2ZLYA 4LCLA 4P6ZM 3T1RA 4N92A 3KWQD 4S2OA 4RA7A 1KX5D 3UDFA 1EI5A 5JRGC 3H0LC 1H8YA 4EUVA 1UWPX 4DN0A 5GLCA 3REKC 2PYRA 1XKZA 4GNUA 4BBVA 1P34A 3W8KA 1OPXA 3QP4A 4H6JA 1MZUA 4L0LA 4EU0A 2CV5B 5HD3A 3W2ZA 1CXWA 2I72A 2VK3A 4Z5TB 4CLCB 3AZJB 3L28A 1ERQA 4ZDXA 2ZC4B 4D2OA 3LZ0D 5B0ZC 4Z66B 4N9LA 4EO5B 3AZIB 2ZD8A 3IF6A 5KDMA 4U0XA 4ETXA 2YFWA 2ZY2A 4H9SC 2W3HA 1T1BA 5B1MB 4JBFA 2XRNA 3OPRA 1TS6A 4KZ7A 4HJ3A 1Q9CA 3RELC 4KQDA 3LJAB 3MZEA 3MFXA 1P3LC 2WZZA 4DE3A 1P3OD 5BPVA 3QNBA 1YLJA 5E43A 3KWQA 1JWZA 1M40A 3IHAA 2H10A 4MB4A 1ZLAB 4DRAA 2PBYA 3G4PA 4Y2FA 1CI9A 4XZQC 5DF9A 5FEGA 1A0KA 5B40A 2Y2IA 5BNVB 4S2MA 1KX4D 1RGYA 1J3WA 4LRYC 5AVCA 1W1VA 3C5AA 5JA4A 4GDBA 1E6RA 5CPIB 1AOIB 3UB5P 2O9BA 4XUJD 3W96C 2ZY5A 2PYOD 4KZ4A 3F1PA 4NE6A 2ZM2A 3ZNTA 4K08A 1WWSA 3HLFA 1Z09A 4IBKA 1YT4A 1KX4A 5HPFA 2EWVA 4HQAA 4EEUA 2GX5A 4JXVA 5EM1A 5M18A 3AZHB 2O9CA 4JGOA 2R9WA 3AFAD 3LZ1D 4QJGA 1AOID 3C38A 5J7EA 3WKJD 4H9RB 3H7WA 2ZQDA 2ZQ9A 4UPKA 1H8PA 1P3FC 4Z2KA 1H0MA 3HSHA 2G2WA 1P0ZA 4PKYA 3UO9A 4D60A 1VM1A 2V1AA 2IWCA 2V2FF 4XUXA 4Z1WA 1ID3A 3TRCA 3VMAA 5HWWA 3WAAC 1GSWA 1KE3A 5G18A 3D4FA 1N1JA 1MXOA 2RTSA 4JXSA 3AV2B 2NQBC 4PM9A 3ZHHA 1G5UA 4M3KA 1YLYA 3WTPB 5A90A 2ZQAA 2HIOC 4FUWA 3KWQB 1O07A 4GKUA 3LZ0A 3F1OB 1NLZA 5B24C 3A3DA 3REJC 5B24A 4IUKA 1K55A 3O3VA 2VQRA 3QNCA 5AQAA 3Q07A 4UUZA 5F82A 3UPOA 1ID3D 3AZLB 3B6GB 2PYPA 5KZHA 4PPRA 2B18A 1YM1A 1P3MA 1FR1A 4MB3A 2L4RA 4WU8A 3ITBA 1BH9B 1MKMA 2HZ5A 1M1AB 2L5AA 3O87A 5EM0A 5AV8C 4DE1A 3CPTA 5B2IA 3H0RC 4S2PA 1PWGA 1P3FA 2CV5A 4HI4A 1U35A 3IXHA 5CTNA 4E04A 3H0MC 3B42A 3MGPD 3WTPE 4R0QA 3AN2D 1IYPA 4FOFA 5C5KA 5EE8A 1VEUA 1OTEA 1P3PB 5DNMB 2X71A 3QP5A 3W99B 2DF4C 3UB6A 3EPKA 4HY8A 1BUEA 5GT3B 4KGCC 4NZ3A 3A0VA 3X1TD 3W96A 1P34D 1IELA 3HLCA 2ZMVA 4WM9A 3FDDA 3UT9D 3UPNA 4CAYA 5IHVA 4OOLA 2X02A 1W79A 3K3CA 1OGGA 3WKJB 2JKGA 3IX4A 1KDSA 4WU9C 2AROB 1BLHA 1K6SA 3VOYA 1P3BB 4EERA 2ZBBA 3UB8A 3LCEA 3SH9A 3T1QB 4IJGA 3AFAC 1E3UA 4WMCD 2M7VA 2HDUA 4H9OA 1W1PA 3SH7A 4OONA 1ACFA 1HTAA 4YFMA 1M18A 1KE0A 4BENA 4PM8A 3UT9A 5HZHA 4P87A 5GLBA 3LELA 4U0TA 5TBMB 4Z2MH 3HJIA 2Y2KA 4R4SA 4BD0A 3BYDA 4OPZA 3LR5A 1L6JA 2IWBA 3REIA 2UV0E 1SKOA 3MJQA 4LLOB 4LD9C 1ED7A 3WTPD 3WD1A 2L0WA 2WZXA 5B33A 3UPPA 3EG5B 3AGEA 3QHYA 3AZGC 5A91A 1YLZA 4BBTA 3T4SA 1N9LA 5BS7C 3WRZA 3AZND 3F6TA 4MLLA 4QY6A 2VLGA 4WLAA 4IBCA 2ZMAA 3REJA 1E15A 5L10A 2VZWA 5CP6C 2Y55A 3KYZA 5GSUC 2OSUA 3WS2A 4G3VA 3NCKA 3MSHA 3X1UC 2PT7A 1G6AA 1LL9A 4ESPA 3TOIA 4Z5TD 2PD7A 3UTAA 3T12B 2P7JA 4JF6A 4WBGA 3PBQA 1F2KA 2JKFA 2ZC6B 3CMZA 5FQKA 3AZFD 1P3IB 4UA9A 4GB7A 1XJ6A 3A0SA 1V9ZA 4Y3IA 4E3IA 1F98A 3CLOA 5FDSA 2XA7M 3UT9C 1QMFA 1S0WA 2IA2A 3ZGAB 3X1TB 3NY4A 1XJ4A 3JVUA 2FFYA 2J8PA 3LO7A 5HWVA 2L1MA 3X1SD 1LSVA 3W99C 3UTBB 4EBLA 2BYMB 3RXWA 1TZYD 4ZUXB 2ZQ7A 2WGIA 4BL3A 2F8NH 1F9IA 5GHZA 3M7PA 3TU4C 2HV1A 5AY8B 1U60A 1J9MA 3E2LA 4BJPA 4WU9D 1W1YA 3CG5A 1P34C 2ZQ8A 3KYQA 3BLMA 4EEPA 3G35A 3P09A 5AV9B 4XXRA 2FJ7D 2FH5A 2YFVA 4JKTA 2KLIA 3V3SA 3V67A 5L8MA 5E5AA 1KGGA 4X6TA 5K5BA 1L2SA 5F1FA 5HFOA 1U35C 1IOUA 1NRFA 1K38A 3C1BB 3B6FD 1PRQA 3DAVA 3C1CA 3PBSA 3VOZA 1P9WA 4B93A 1S32B 2ZL1A 1PI4A 4L9GA 4OUIA 3LZ0B 1F66D 3H82A 1P3BA 4WZ5A 5E2HA 4S2LA 4NFTA 1W2EA 4IBEA 5DF7A 4KUDD 1IEMA 3AZMD 3W4PA 1W7FA 3C1BD 1FR6A 5B1MD 4FCFA 1CI8A 2LY8A 3OLOA 3W98D 2A3UA 1YSQA 2QJ7A 1LHYA 4X53A 1YLPA 4IBGA 4P85A 4QD4A 5FI7A 4HOIA 2W27A 5AQ7A 3HLGA 3AZJC 2HGVA 4H9QB 3S7OA 1OT9A 4PM7A 5L07A 5AVBB 4UQIM 4DXBA 3UTBA 3WD0A 5J8XA 3QP2A 3KUYA 2YFWB 1WYBA 3NOTC 1MKIA 1XA1A 3MQLA 4CSRB 3M2JA 4JXWA 3AZGA 3KSIA 5EOEA 1P3LD 4TX8A 1S1YA 5TBMA 3NQUB 4E6WA 4H9PB 3MGRB 4FH4A 3SOIA 2XLNA 4OQ0A 5B32B 1HQ3C 4WNNA 2CC1A 3R7WB 3LI9A 3ISGA 3PR6A 1L0EA 4FH2A 2ZC5B 1P3ID 4HHDA 3NQJA 1SDEA 5GXQC 3GECA
chains in the Genus database with same CATH topology
3UE1A 4Y0TA 2WGWB 4E3JA 5B2IB 3ITAA 1E4DA 1GHPA 1K54C 1CEGA 4DE0A 4J8VB 3GTCA 3TU4D 2QMIA 5CPJC 5F1GA 1LI0A 5GLAA 3X1SB 2FJ7A 2JC7A 3UTBD 2OV5A 3REHA 4KGCA 4UUZB 3HUOA 3ZG0A 5B0YD 1A7WA 4MNRA 1AXBA 5B2JD 2R9XA 4IBRA 3VSLA 5AV9D 4P6BA 1XP4A 1IKIA 3AV2D 5F99C 3V5MA 1KX3A 3VH5W 4J8WB 4HGAC 3RXXA 5GT0C 2XD1A 1SKFA 3DWZA 4OOMA 3NIAA 5G49B 4WU8C 2ZM8A 2WYXA 5B31A 2H0YA 3SS3A 3LY3A 1ID3B 4KHAB 5CPKB 5AV5A 4OJ5A 3N8SA 4WYYA 3WAAA 3B6FB 3C1BC 1FCOA 3VH6W 3DW0A 3GQZA 5GT0B 1EQZA 1CEFA 4X56A 3AV1B 2EFUA 1PW1A 3WKJA 2DCFA 3Q81A 1L0GA 1BH9A 1KU5A 1BT5A 2UWXA 3AYWD 2EX2A 1PZOA 3O62D 5AVBA 3B6GC 3WA9C 1BTLA 1PIOA 4HBTA 3B0BA 4E3NA 5BOHA 1PYYA 3HLEA 3PTEA 3AV1C 1KDWA 4WZ4A 3L25A 1AOIA 5HAIA 3N6IA 1NYMA 4JJND 3RELB 5B31D 4E44A 2A49A 4EO5C 1P3LB 1NXYA 3AYWB 4H9SA 3HUMA 3MGQA 3LY4A 4XUZA 3FKEA 2XDMA 2CV5C 3REID 5AV5D 2XGNA 1BLCA 3MGRD 4R3BA 3Q7ZA 3MGQD 5B0ZB 4IBFA 5FQMA 4CJNA 1PI5A 1HVBA 1B67A 5M19A 5B2ID 1IYSA 1IYOA 1SDNA 5HAQA 4Y0UA 3L26A 1EROA 2EXAA 2W8SA 5E2FA 5FASA 2AROD 1ZG4A 1H3OB 5BT1C 2P9VA 4YM6D 2VGKA 5AQ9A 4OP5A 3LELC 3REHC 5FI6A 3AZJA 4J8VC 3KSYA 4Z5TA 4KG2A 5B2JB 4GHLA 4KENB 2HIOA 5CHMA 5B0ZA 1ZLAC 4OJOA 1ZKJA 1WE4A 5CGSA 4J8WD 3MKFA 2Z2LB 5BNVA 5FI2A 5GL9A 1HTZA 3HL9A 3W96D 5CXWA 3EQUA 3RELA 5E2EA 2G5HC 4S2IA 1YMSA 1BLSA 5DTTA 4RYEA 3EPHA 3C7UA 3FKVA 3ZNYA 5GXQA 3KWQC 5GT0D 4QU3A 3PBRA 2EXBA 3IXBA 4AWLB 3FV7A 4E6XA 3AZID 5B1LC 3BFCA 1I5QA 4KG6A 5AVCC 4QNLA 3AZIA 4WZ5C 3AV1D 2Y2MA 3M2KA 4WELA 5CPJA 4G91B 4XZQA 3L27A 2WGWA 1JTDA 3WAAB 3MVDA 3NI9A 3B6FA 3W98A 2C5WB 5B31B 1ULYA 3IXDA 2V1ZA 1KX3C 4NK3A 4Z5TC 4RX2A 1ZG6A 5CGXA 2Y2PA 5HAPA 5B32A 3UTAD 3ZG9B 4PM6A 3RELD 1E25A 3MGSD 3REKB 3PBTA 1ESIA 3X1VC 1MY8A 3GVBA 3GSGA 2XH9A 4CPKA 3N4IA 4XUJB 4OP8A 2J9PA 3UN7A 2JCHA 1K25A 1GA9A 3NC8A 2OLUA 2XFTA 1P3PD 3MNNC 5CHJA 4H9QA 3BFGA 3M6HA 3A1IA 4Z66C 5BT1D 1P3GA 3X1SA 4MBHA 4S2KA 4J8VA 5B33D 3VH5A 4XUJC 4R8PB 3CZDA 2XD5A 1BLPA 5GT3C 1LLBA 5EVLA 4DQYB 4ZBJC 3W97A 2WUQA 3LJAC 3BFEA 1JFIA 2PU4A 3AZKD 4LD9A 3UY6A 1AOIC 1PZPA 1K57A 5FUGB 2PYOA 1P3AA 3Q7VA 2P74A 1Z6FA 4QB8A 1I2WA 3AZMB 5F99A 3NQUA 4XZQB 2JSSA 1YU2A 5CECA 2YFVB 2XF3A 5CPIC 3N7WA 3KS8A 5DTKA 3VFHA 3VP3A 1S32C 4EBNA 5CRFA 3A3EA 3AZMC 1DJAA 5BO0B 3RJUA 4IBDA 2HDRA 2JBFA 1ONHA 3MXSA 1ES2A 3UE0A 1P3BC 4ZBEA 2XEPA 1TZYA 4S2JA 1KGFA 4FD8A 3AZFA 4YM6A 4J8XB 2GDNA 3W4QA 4PM5A 5EVIC 4NYYA 4OQHA 4KZAA 3OCNA 3MGSC 4OPRA 3HVFA 3KXBC 1Q2QA 5B2JA 3UTAB 5DNMD 4YS3C 4J8XD 1SHVA 1YQSA 3REKD 3AZEC 2G5IC 3MGPC 4ZJ3A 4CSRA 4OLDA 4MBKA 3REJB 1KX3D 4QHCA 3AZLC 2WKEA 4Z9QA 4JJNB 3G34A 3X1VD 5CP6D 4DDSA 5B33B 1I2SA 4U3TA 4X69A 2XR0A 3VSKA 1MPLA 3REIB 3P5JB 4J8UC 3UE3A 4J8UA 4X23D 4E3OA 3MNND 2EX6A 3BRMA 5B40C 4EQIA 3AYWA 3BECA 1ES5A 4ZUXC 2HUEB 3V39A 4NY2A 2WK0A 5CPIA 1NJ4A 2BYKA 1K56D 4M6BA 3X1TC 3C4OA 3A6NC 2ZM5A 3OZHA 1Y54A 1YU3A 5DVAA 3IF6C 3WS1A 4KZ5A 3B0CW 4WV4B 4MBFA 3IT9A 5AY8A 3B0CT 3FWLA 1P3MD 1BZAA 2WAFA 4CAYB 5TR7A 4JJNA 1FSWA 3UDXA 3A3IA 1KX5C 1KX5A 1IYQA 4KHAA 1F66A 4GZBA 2BYMA 5AV8A 3S4XA 1M19D 3PAEA 4YINA 3WKJC 4XUJA 4IBBA 3IF6B 5FSRA 1P3FD 4KZ9A 3GR2A 4N9KA 3W97C 3AGDA 3AN2A 1JVJA 4RVAA 5FDHA 1M18B 2OLVA 4OQIA 4ZTKA 2IOUA 5FAOA 3VFFA 4H9OB 1K55C 3HLDA 2Y2GA 1M19B 4HBUA 4H9NB 5AV6C 5FAPA 4EUZA 3AYWC 3IXGA 3X1UD 3MVDD 1M1AD 3W97B 2ZY4A 1ONGA 2AROA 3IQAA 2HIOD 5FA7A 3W98C 3MGPA 4OQGA 1BULA 5B24D 1M1AA 4OOYA 3AZJD 3BFDA 5JYOA 5AV6B 4DRTA 5B2IC 3MGPB 4OPQA 3X1UB 5F83A 1W8QA 4J8UD 2BYKB 2EX9A 4QLCB 5B1LA 5GXQB 3VP0A 2B5RA 1F1EA 3X1SC 3KUYD 5JRGA 4OJPA 3W99D 4Y7PA 5CP6B 1HQ3B 4JF4A 4WNNB 1TZYC 2EX8A 3N8LA 3W99A 4K91A 1E3UD 3UT9B 4J8UB 5F99B 3AN2C 5GXQD 2QPNA 4ID4A 3GRJA 4LENA 2XFSA 2WGVA 1B6WA 5A93A 1F66B 1DJBA 1NY0A 3MZDA 1OMEA 3IHBA 1YU1A 1P3KA 3WRTA 4KUDB 4NETA 3HLBA 3VP1A 4UHUA 5D3OA 3PBNA 1P3MC 4H9RA 3B6FC 3ZG5A 3SH8A 5L2FA 5HX9A 3AZHA 4OPYA 1F66C 4JPMA 2F8NK 4WU8B 3WAAD 2RL3A 3MKEA 3OPHA 3LZ1B 1PWDA 2CWEA 2NQBD 3HREA 3X1VA 5DTSA 1P3KD 1SCWA 3C7VA 1YLWA 5GT3A 2F8ND 4WU8D 5E5AB 4PMAA 1ID3C 1M18D 1FCNA 3WS0A 1G68A 3Q82A 3AZIC 3MVDC 2J9OA 4JF5A 3OC2A 5E2GA 2DRWA 1FSYA 2XQZA 4G92C 1LI9A 1PWCA 4LV2A 3W97D 4LG2A 5E5AC 1P3AD 2G2UA 2HDQA 5FQ9A 5KSHA 4LD9D 1ESUA 2Y2HA 4OKPA 5AV6D 3O62C 4GN2A 2Y2NA 1KVMA 3ZCZA 3X1TA 4IVIA 1PZRA 4NYUA 4E45A 4OH0A 1ES4A 4UA7A 5JYPA 5DNNA 3AZNC 1GA0A 3N3FA 3AZLA 1TDGA 3A3JA 5TFQA 1ZC2A 2Q9NA 3B0DB 4DRBA 1RP5A 1K4EA 2BLSA 3LEZA 4MEZA 4XZQD 4QLCC 1TEMA 1K6RA 1XGIA 3MGRC 4YM6B 4J8XA 4HEFA 4IJEA 5EVIA 3KFUG 4J8WA 4O7DA 4Z66D 1TZYB 4R8PA 3G2YA 3L2AA 3GMWA 1P3OC 2Y2QA 2F2AC 5F99D 4GDNA 3LJAA 5GT3D 2F8NA 3G31A 1YU4A 1WYCA 2FJ7B 3GV9A 5B1MA 3AZEA 2J8YA 1KX4C 5KDMB 2NZDA 4KZ8A 1P3OB 4KQRA 5B2JC 3VH5T 1P3KC 4X55A 3M6BA 1EQZB 4GH9A 5DF8A 4HGAB 5GT0A 3AV2C 2NQBB 4KZBA 3AZMA 4OJLA 1BH8B 3VH6A 1K4FA 1YLTA 3NQJB 5CPKA 4HESA 3UDIA 5JRGD 4FSFA 3LZ1C 4E3KA 2PU2A 1BH8A 5G49A 4DF6A 4NZ4A 4K0WA 3VP2A 1EQZD 4JLFA 5GHXA 4BL2A 1Q2PA 4G91C 1KX3B 4KZ3A 5E5AD 2JE5A 3A3FA 4B4XA 5B0ZD 1VQQA 3MGSA 1C3BA 5JRGB 3OPPA 5B1LB 3X1VB 5CEBA 3AZED 4YS3B 4LV3A 5B1MC 5AV8D 5HL1A 4E3MA 3WX7A 4X23B 3MGQC 2E8IA 2RVQC 5B32D 1R4VA 3FZCA 3V9RA 2Y91A 1O7EA 1EWZA 3DTMA 3IWQA 3IH8A 2RCXA 4ZAMA 5B0YA 2ZJ9A 5DNMC 5DNMA 4KUDA 1QMEA 1IKGA 3V3RA 4X23C 1S32A 4S2NA 1HZOA 3G30A 3ZFZA 2H5SA 4R8PD 3REIC 2V20A 4KZ6A 3FKWA 2C6WB 3REHD 4KGCD 4J8VD 4OJ6A 3ZDJA 4IVKA 3R45A 4NZ5A 5M1AA 4DXCA 2HUEC 3IP4C 1TAFB 3AZKB 2HP6A 3MZFA 4QLCD 4DDYA 3REHB 1JWVA 4GD8A 5A92A 4NE3A 1P3GD 1LL5A 5I94A 1RCJA 4LV1A 3TU4A 4ZUXD 5B31G 5AV6A 1XXMA 3O88A 5B32G 4C3QA 2Y2LA 3G2ZA 4WU9B 2FFFB 3AV2A 1L0FA 2QZ6A 4LV0A 4Z2MG 5B0YC 3IF5A 4KQOA 4R3JA 2Z2MB 2ZY3A 1N1JB 3L29A 3MNNA 1EQZC 3P98A 3CJMA 3VP4A 3C1CB 4LCMA 3C1BA 2HIOB 2NQBA 2XK1A 4H9PA 3MGRA 4AWLC 4N1HA 1GHIA 1K54A 2DNSA 4KQQA 3C4PA 2RIQA 5AV9A 4R23A 4GHAA 1YMXA 1P3OA 3MFDA 1M19C 3AV1A 4OLGA 3AZEB 4UA6A 3BEBA 4EWFA 5BNXB 3WA9A 2RVQD 2HP5A 3NDEA 3KS4A 2F8NB 4ZUXA 1W5DA 1TDLA 1MWTA 5BNXA 3EQVA 5GSUD 5HARA 5AVCB 3BFFA 4DE2A 3HLWA 3WTPC 5AVBD 5EVIB 3B6GD 3MGQB 2HP9A 1FCMA 1ZLAA 3JYIA 3KUYC 4R4RA 1M1AC 3N8RA 3KXBD 4B4ZA 3IH9A 1P3IA 4RX3A 5CP6A 3UTAC 4JJNC 2J7VA 5B31C 1FQGA 1YU0A 3VH6T 5EPHA 3EPLA 3IWIA 4KGCB 3IWOA 4IEDA 3MNNB 5KMWA 2CV5D 3AFAA 1WWIA 3Q1FA 1ALQA 1P3PC 4R8PC 3V50A 3ZVTA 1MWUA 4NE5A 5B33C 3O86A 3PAGA 1DJCA 1PW8A 3MBZA 4EBPA 3G32A 2EFXA 2F8NG 1Z2CB 5CGWA 2AROC 1K56A 4H9NA 1P34B 3KXBA 1K57C 2WAEA 3W96B 4C75A 2H0TA 3AZNA 4ZBJB 1KGEA 3WS5A 4GD6A 3O62A 4IBIA 2DQNC 3A6NB 1KX5B 2X01A 5CPID 1M18C 4BLMA 5DNND 3LZ1A 3E2KA 4DKIA 3HUNA 1P3FB 3OPLA 3C1CC 5CPKD 3WA9D 2Y2JA 3OCLA 4IJFA 4B88A 1MWRA 1MWSA 2ZQCA 3REJD 4ZJ1A 1ES3A 3MXRA 4H8RA 1P3AC 4BD1A 5U47A 3AFAB 1NYYA 5CHUA 4J8XC 1S6RA 5AVBC 5GSUB 3B6GA 4YS3A 1BSGA 4OVDA 3EPJA 1M19A 5B24B 3O62B 3HONA 3MGSB 4UAAA 2WADA 5EOOA 1GHMA 3WS4A 1GCEA 3ZG8B 3AZNB 2Q9MA 1M6KA 1P3IC 1JTGA 1HQ3A 3AZGB 4YS3D 4X68A 1FOFA 3KUYB 3KXBB 5AV8B 3W98B 1W8YA 1JFIB 3AL0C 3X1UA 4YM6C 5EUAA 1N9BA 3AZLD 5AQBA 3A1KA 3S1YA 4WZSB 1P3MB 2IO5B 4J8WC 3W4OA 3DWKA 5AV9C 3AZHD 2FJ7C 1NZUA 1RGZA 1XGJA 3A6NA 1H5XA 5JA4B 1U35D 1HD8A 5CPJD 3AN2B 2IO5C 4BQMA 4Q8IA 5B40B 1XX2A 3UTBC 2NZDC 4WU9A 5DNNC 5FAQA 5GHYA 4JXGA 1BFMA 3A6ND 5B1LD 4KG5A 2ZC3B 5CPKC 3TU4B 3B3XA 5AY8C 1L0DA 5EECA 1U35B 4N1XA 4QY5A 3MVDB 1CK3A 3WA9B 3HBRA 2HPBA 3TG9A 1TVFA 5DNNB 1KE4A 4G92B 1S32D 1H3OA 2Y2OA 5C3IB 1XPBA 5FQJA 2ZC7A 5HW3A 5FATA 1KVLA 3C1CD 4EV4A 5CEDA 4P0MA 1ERMA 3LZ0C 3BM6A 1P3AB 3Q7VB 4NZ1A 1P3BD 4LD9B 2HDSA 5C3IC 1HQ3D 1H8ZA 3AGFA 3WTPA 4C6YA 4WJ3C 3AZGD 4GOGA 1P3LA 2Y4AA 4R1GA 3V9RB 2IWDA 3SS4A 5B32C 4WEKA 2VGJA 3WWXA 1P3GB 3B0DC 4WEJA 3NBLA 4WMCA 2WKIA 4ZJ2A 3LJAD 4IBJA 2P9VB 5AV5C 1DY6A 3ZG7B 2WKHA 3AZKC 1TAFA 3AZKA 3REKA 3BLSA 5CERA 1KX4B 4Z66A 1P3GC 3LELB 2Y59A 3AZFC 5BS7A 1ZLAD 1P3PA 5CTMA 1P3KB 5FUGA 2PYOB 5AV5B 3ZVWA 4A5RA 2NZDD 3UNWA 5FQQA 1T3UA 5GSUA 5B40D 3AZHC 1NZOA 3AZFB 3LELD 5B0YB 1YUEA 5CPJB 2ZM0A 4E3LA 3TSGA 2PYOC 4K0XA 1MBLA 1JWPA 5KSCA 5TGFA 2NZDB 5FQIA 4IBXA 4X23A 2BG1A 5GLDA 4QLCA 4Y0OA 1N4OA 4KUDC 5BO0A 5CHLB 3S22A 3FYZA 5AVCD 3I7JA 3NDGA 5EVID 4S2NC 3SS5A 1XA7A 5AY8D 3PBOA 3R45B 4F94A 2ZLYA 4LCLA 4N92A 3KWQD 4S2OA 4RA7A 1KX5D 3UDFA 1EI5A 5JRGC 3H0LC 1H8YA 5GLCA 3REKC 1XKZA 4GNUA 1P34A 3W8KA 4L0LA 2CV5B 2I72A 4Z5TB 3AZJB 3L28A 1ERQA 4ZDXA 2ZC4B 4D2OA 3LZ0D 5B0ZC 4Z66B 4N9LA 4EO5B 3AZIB 2ZD8A 3IF6A 5KDMA 4U0XA 2YFWA 2ZY2A 4H9SC 5B1MB 4JBFA 3OPRA 4KZ7A 1Q9CA 3RELC 3LJAB 3MZEA 1P3LC 2WZZA 4DE3A 1P3OD 5BPVA 3QNBA 1YLJA 5E43A 3KWQA 1JWZA 1M40A 3IHAA 2H10A 1ZLAB 4DRAA 2PBYA 3G4PA 1CI9A 4XZQC 5DF9A 5B40A 2Y2IA 5BNVB 4S2MA 1KX4D 1RGYA 5AVCA 3C5AA 4GDBA 5JA4A 5CPIB 1AOIB 4XUJD 3W96C 2ZY5A 2PYOD 4KZ4A 4NE6A 2ZM2A 3ZNTA 1WWSA 3HLFA 4IBKA 1YT4A 1KX4A 5M18A 4JXVA 3AZHB 2R9WA 3AFAD 3LZ1D 4QJGA 1AOID 3WKJD 4H9RB 2ZQDA 2ZQ9A 4UPKA 1P3FC 3HSHA 2G2WA 3UO9A 1VM1A 2IWCA 2V2FF 4XUXA 1ID3A 3VMAA 3WAAC 1KE3A 5G18A 3D4FA 1N1JA 1MXOA 3ZHHA 4JXSA 3AV2B 2NQBC 4PM9A 4M3KA 1YLYA 3WTPB 5A90A 2ZQAA 2HIOC 3KWQB 1O07A 4GKUA 3LZ0A 5B24C 3A3DA 3REJC 5B24A 1K55A 3O3VA 2VQRA 3QNCA 5AQAA 3Q07A 4UUZA 5F82A 3UPOA 1ID3D 3AZLB 3B6GB 5KZHA 4PPRA 1YM1A 1P3MA 1FR1A 4WU8A 3ITBA 1BH9B 1M1AB 2L5AA 3O87A 5AV8C 4DE1A 5B2IA 3H0RC 4S2PA 1PWGA 1P3FA 2CV5A 1U35A 3IXHA 5CTNA 3H0MC 3MGPD 3WTPE 4R0QA 3AN2D 1IYPA 5EE8A 1P3PB 5DNMB 2X71A 3W99B 2DF4C 3EPKA 1BUEA 5GT3B 4KGCC 4NZ3A 3X1TD 3W96A 1P34D 1IELA 3HLCA 4WM9A 3FDDA 3UT9D 3UPNA 4CAYA 5IHVA 4OOLA 2X02A 1W79A 3WKJB 1KDSA 4WU9C 2AROB 1BLHA 1K6SA 3VOYA 1P3BB 3LCEA 3SH9A 3AFAC 1E3UA 4WMCD 2HDUA 4H9OA 3SH7A 4OONA 1HTAA 4YFMA 1M18A 1KE0A 4BENA 4PM8A 3UT9A 4P87A 5GLBA 3LELA 4U0TA 4Z2MH 2Y2KA 4R4SA 4BD0A 3BYDA 4OPZA 2IWBA 3REIA 4LD9C 3WTPD 2WZXA 5B33A 3UPPA 3EG5B 3AGEA 3QHYA 3AZGC 5A91A 1YLZA 5BS7C 3WRZA 3AZND 3F6TA 4MLLA 4QY6A 4IBCA 2ZMAA 3REJA 5CP6C 2Y55A 5GSUC 2OSUA 3WS2A 3NCKA 3X1UC 1G6AA 1LL9A 3TOIA 4Z5TD 3UTAA 4JF6A 4WBGA 3PBQA 2ZC6B 3CMZA 5FQKA 3AZFD 1P3IB 4UA9A 4GB7A 4E3IA 3UT9C 1QMFA 1S0WA 3ZGAB 3X1TB 3NY4A 2FFYA 2J8PA 3LO7A 3X1SD 3W99C 3UTBB 4EBLA 2BYMB 3RXWA 1TZYD 4ZUXB 2ZQ7A 2WGIA 4BL3A 2F8NH 5GHZA 3TU4C 5AY8B 1U60A 1J9MA 3E2LA 4BJPA 4WU9D 3CG5A 1P34C 2ZQ8A 3BLMA 3G35A 3P09A 5AV9B 4XXRA 2FJ7D 2YFVA 4JKTA 3V3SA 5E5AA 1KGGA 4X6TA 1L2SA 5F1FA 5HFOA 1U35C 1NRFA 1K38A 3C1BB 3B6FD 3C1CA 3PBSA 3VOZA 1S32B 1PI4A 4OUIA 3LZ0B 1F66D 1P3BA 4WZ5A 5E2HA 4S2LA 4NFTA 1W2EA 4IBEA 5DF7A 4KUDD 1IEMA 3AZMD 3W4PA 1W7FA 3C1BD 1FR6A 5B1MD 4FCFA 1CI8A 2LY8A 3W98D 2A3UA 1LHYA 4X53A 1YLPA 4IBGA 4P85A 4QD4A 5FI7A 5AQ7A 3HLGA 3AZJC 4H9QB 4PM7A 5AVBB 4DXBA 3UTBA 5J8XA 3KUYA 2YFWB 1WYBA 1MKIA 1XA1A 4CSRB 3M2JA 4JXWA 3AZGA 5EOEA 1P3LD 4E6WA 3NQUB 4H9PB 4FH4A 3MGRB 3SOIA 2XLNA 4OQ0A 5B32B 1HQ3C 4WNNA 2CC1A 3ISGA 1L0EA 4FH2A 2ZC5B 1P3ID 3NQJA 1SDEA 5GXQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UE1 A;  4Y0T A;  1ERQ A;  4ZDX A;  2WGW B;  4E3J A;  2ZC4 B;  2XK1 A;  3C4O A;  4D2O A;  3OZH A;  4N1H A;  3ITA A;  4N9L A;  1E4D A;  1GHP A;  1K54 C;  1GHI A;  1K54 A;  2DNS A;  4KQQ A;  3C4P A;  1CEG A;  1Y54 A;  2ZD8 A;  5DVA A;  4R23 A;  1YMX A;  4DE0 A;  3MFD A;  3IF6 A;  3GTC A;  3IF6 C;  4OLG A;  4U0X A;  3WS1 A;  2QMI A;  4KZ5 A;  4MBF A;  4UA6 A;  5F1G A;  3IT9 A;  1LI0 A;  3BEB A;  3FWL A;  4EWF A;  1BZA A;  4JBF A;  5GLA A;  2HP5 A;  3NDE A;  3OPR A;  2WAF A;  2JC7 A;  2OV5 A;  4KZ7 A;  5TR7 A;  1FSW A;  3UDX A;  3MZE A;  1W5D A;  3A3I A;  3HUO A;  1TDL A;  3ZG0 A;  2WZZ A;  4DE3 A;  1MWT A;  4MNR A;  1IYQ A;  1AXB A;  3EQV A;  4GZB A;  2R9X A;  4IBR A;  3QNB A;  3S4X A;  3VSL A;  3PAE A;  4P6B A;  1YLJ A;  4YIN A;  5HAR A;  3BFF A;  1XP4 A;  4DE2 A;  5E43 A;  1IKI A;  3IF6 B;  3HLW A;  3V5M A;  1JWZ A;  5FSR A;  1M40 A;  3IHA A;  2H10 A;  5EVI B;  4KZ9 A;  3GR2 A;  2PBY A;  2HP9 A;  3G4P A;  3RXX A;  4N9K A;  1FCM A;  1CI9 A;  3JYI A;  3AGD A;  5DF9 A;  4R4R A;  2XD1 A;  1JVJ A;  1SKF A;  3N8R A;  2Y2I A;  3DWZ A;  4RVA A;  4OOM A;  4S2M A;  5FDH A;  4B4Z A;  3NIA A;  1RGY A;  3IH9 A;  4RX3 A;  2OLV A;  2ZM8 A;  2WYX A;  3C5A A;  4GDB A;  4OQI A;  4ZTK A;  5FAO A;  3VFF A;  2J7V A;  2H0Y A;  1K55 C;  3SS3 A;  1FQG A;  3HLD A;  3LY3 A;  5EPH A;  2Y2G A;  4HBU A;  5FAP A;  3IWI A;  3N8S A;  4WYY A;  4EUZ A;  3IXG A;  4KZ4 A;  3IWO A;  4IED A;  1FCO A;  3DW0 A;  3GQZ A;  2ZM2 A;  5KMW A;  3ZNT A;  1ONG A;  3IQA A;  5FA7 A;  3HLF A;  1CEF A;  4OQG A;  3Q1F A;  4X56 A;  1YT4 A;  1ALQ A;  2EFU A;  1BUL A;  1PW1 A;  5M18 A;  2DCF A;  4JXV A;  3Q81 A;  2R9W A;  1L0G A;  4OOY A;  1BT5 A;  3BFD A;  5JYO A;  4QJG A;  4DRT A;  3V50 A;  2UWX A;  2ZQD A;  3ZVT A;  1MWU A;  2EX2 A;  4OPQ A;  2ZQ9 A;  1PZO A;  3O86 A;  3PAG A;  5F83 A;  1W8Q A;  1DJC A;  1PW8 A;  1BTL A;  2G2W A;  3MBZ A;  3UO9 A;  4EBP A;  3G32 A;  1PIO A;  4HBT A;  2EFX A;  1VM1 A;  2EX9 A;  4E3N A;  5BOH A;  2IWC A;  1PYY A;  3HLE A;  3PTE A;  5CGW A;  2B5R A;  2V2F F;  1KDW A;  4WZ4 A;  3VP0 A;  4XUX A;  1K56 A;  1K57 C;  2WAE A;  4Y7P A;  5HAI A;  3N6I A;  1NYM A;  3VMA A;  1KE3 A;  4C75 A;  5G18 A;  3D4F A;  4JF4 A;  2A49 A;  1NXY A;  2EX8 A;  3N8L A;  1MXO A;  3HUM A;  2H0T A;  1KGE A;  4K91 A;  3ZHH A;  4JXS A;  4PM9 A;  3LY4 A;  1E3U D;  4XUZ A;  3WS5 A;  4M3K A;  1YLY A;  5A90 A;  2XDM A;  2ZQA A;  1O07 A;  4GD6 A;  2XGN A;  1BLC A;  4GKU A;  2QPN A;  4R3B A;  3Q7Z A;  4ID4 A;  3GRJ A;  4LEN A;  3A3D A;  2XFS A;  2WGV A;  1K55 A;  5A93 A;  3O3V A;  1DJB A;  5FQM A;  2X01 A;  1NY0 A;  3MZD A;  3QNC A;  5AQA A;  3Q07 A;  1OME A;  1PI5 A;  4BLM A;  5F82 A;  4CJN A;  3UPO A;  3IHB A;  3E2K A;  4DKI A;  1HVB A;  3HUN A;  5M19 A;  3WRT A;  1IYS A;  3VP1 A;  3OPL A;  3HLB A;  4NET A;  5KZH A;  4PPR A;  4UHU A;  1IYO A;  1SDN A;  1YM1 A;  5HAQ A;  3OCL A;  2Y2J A;  1FR1 A;  3PBN A;  4Y0U A;  5D3O A;  3ZG5 A;  3SH8 A;  1ERO A;  5L2F A;  2EXA A;  4B88 A;  1MWR A;  1MWS A;  2ZQC A;  5HX9 A;  3ITB A;  5E2F A;  5FAS A;  4ZJ1 A;  1ES3 A;  3MXR A;  4H8R A;  1ZG4 A;  3O87 A;  4OPY A;  4JPM A;  4DE1 A;  4BD1 A;  2P9V A;  5U47 A;  2VGK A;  5AQ9 A;  1NYY A;  2RL3 A;  4OP5 A;  5CHU A;  5FI6 A;  3MKE A;  4S2P A;  1PWG A;  3OPH A;  1PWD A;  1S6R A;  4KG2 A;  4KEN B;  1BSG A;  5CTN A;  3IXH A;  3HRE A;  4OVD A;  5CHM A;  5DTS A;  4R0Q A;  1IYP A;  1SCW A;  4UAA A;  2WAD A;  1ZKJ A;  3C7V A;  5EOO A;  1GHM A;  1WE4 A;  1YLW A;  5CGS A;  5EE8 A;  3MKF A;  3WS4 A;  2Z2L B;  1GCE A;  3ZG8 B;  5FI2 A;  2X71 A;  5GL9 A;  1HTZ A;  2Q9M A;  4PMA A;  3HL9 A;  1M6K A;  1FCN A;  3WS0 A;  1G68 A;  5CXW A;  1JTG A;  4X68 A;  1BUE A;  3EQU A;  3Q82 A;  1FOF A;  5E2E A;  2J9O A;  4JF5 A;  3OC2 A;  5E2G A;  4S2I A;  1YMS A;  1BLS A;  4WM9 A;  1IEL A;  3HLC A;  5DTT A;  2DRW A;  1FSY A;  2XQZ A;  4RYE A;  3C7U A;  3FKV A;  3ZNY A;  1LI9 A;  1PWC A;  3UPN A;  1W8Y A;  4LV2 A;  4QU3 A;  3PBR A;  2EXB A;  5IHV A;  4OOL A;  5EUA A;  3IXB A;  1N9B A;  2G2U A;  2HDQ A;  3FV7 A;  5FQ9 A;  4E6X A;  5KSH A;  2X02 A;  1W79 A;  1ESU A;  2Y2H A;  5AQB A;  4OKP A;  3BFC A;  1I5Q A;  3S1Y A;  4GN2 A;  2Y2N A;  1KVM A;  3ZCZ A;  4KG6 A;  4IVI A;  4WZ5 C;  2Y2M A;  3M2K A;  4OH0 A;  4WEL A;  1ES4 A;  1KDS A;  4UA7 A;  5JYP A;  1GA0 A;  1BLH A;  1K6S A;  3VOY A;  3W4O A;  2WGW A;  3DWK A;  1TDG A;  3A3J A;  1JTD A;  1ZC2 A;  1NZU A;  3LCE A;  5TFQ A;  2Q9N A;  3SH9 A;  1RGZ A;  3NI9 A;  1XGJ A;  2C5W B;  1E3U A;  1RP5 A;  1K4E A;  4WMC D;  2BLS A;  2HDU A;  3LEZ A;  4MEZ A;  1H5X A;  3SH7 A;  4OON A;  3IXD A;  1TEM A;  2V1Z A;  1HD8 A;  4NK3 A;  1K6R A;  4YFM A;  1KE0 A;  4RX2 A;  1ZG6 A;  5CGX A;  4BEN A;  2Y2P A;  4PM8 A;  4BQM A;  4Q8I A;  5HAP A;  1XGI A;  4P87 A;  5GLB A;  3ZG9 B;  1XX2 A;  4HEF A;  4PM6 A;  4U0T A;  1E25 A;  5EVI A;  2Y2K A;  4R4S A;  4O7D A;  4BD0 A;  5FAQ A;  3BYD A;  4OPZ A;  5GHY A;  1ESI A;  3PBT A;  4JXG A;  3G2Y A;  1MY8 A;  3GMW A;  2IWB A;  3GVB A;  3GSG A;  2XH9 A;  4CPK A;  3N4I A;  4KG5 A;  2ZC3 B;  2Y2Q A;  4OP8 A;  2J9P A;  2WZX A;  3B3X A;  3UPP A;  4GDN A;  3UN7 A;  3AGE A;  1L0D A;  3QHY A;  2JCH A;  5EEC A;  5A91 A;  1K25 A;  1YLZ A;  1GA9 A;  3G31 A;  2XFT A;  2OLU A;  3NC8 A;  4N1X A;  4QY5 A;  5CHJ A;  3BFG A;  1CK3 A;  1WYC A;  3WRZ A;  3M6H A;  3HBR A;  2HPB A;  3TG9 A;  3GV9 A;  1TVF A;  2J8Y A;  4MLL A;  1KE4 A;  4QY6 A;  4MBH A;  4S2K A;  2ZMA A;  4KZ8 A;  3CZD A;  2Y2O A;  1XPB A;  4KQR A;  5FQJ A;  2XD5 A;  1BLP A;  2Y55 A;  2ZC7 A;  5HW3 A;  1LLB A;  2OSU A;  4X55 A;  1KVL A;  5FAT A;  3M6B A;  5EVL A;  3WS2 A;  3NCK A;  5DF8 A;  4EV4 A;  4KZB A;  5CED A;  1G6A A;  2WUQ A;  4P0M A;  1ERM A;  1LL9 A;  3TOI A;  3BFE A;  3BM6 A;  3Q7V B;  1K4F A;  4JF6 A;  1YLT A;  2PU4 A;  4WBG A;  3PBQ A;  3UY6 A;  4HES A;  3UDI A;  2HDS A;  1PZP A;  2ZC6 B;  1K57 A;  4FSF A;  4E3K A;  3CMZ A;  5FQK A;  2PU2 A;  1H8Z A;  3Q7V A;  2P74 A;  1Z6F A;  3AGF A;  4QB8 A;  1I2W A;  4UA9 A;  4GB7 A;  4DF6 A;  4E3I A;  4K0W A;  3VP2 A;  4JLF A;  5GHX A;  4C6Y A;  1QMF A;  1S0W A;  4BL2 A;  1Q2P A;  4GOG A;  5CEC A;  3ZGA B;  2XF3 A;  2Y4A A;  3NY4 A;  4KZ3 A;  4R1G A;  2JE5 A;  2FFY A;  2IWD A;  3A3F A;  3LO7 A;  3N7W A;  4B4X A;  5DTK A;  3SS4 A;  3VFH A;  1VQQ A;  3VP3 A;  1C3B A;  4EBL A;  4WEK A;  2VGJ A;  3OPP A;  3WWX A;  4EBN A;  3RXW A;  5CRF A;  3A3E A;  5CEB A;  2ZQ7 A;  2WGI A;  1DJA A;  4WEJ A;  3RJU A;  3NBL A;  4WMC A;  4BL3 A;  4LV3 A;  5GHZ A;  2HDR A;  2JBF A;  2WKI A;  4ZJ2 A;  1U60 A;  1J9M A;  3E2L A;  4BJP A;  1ONH A;  3MXS A;  5HL1 A;  1ES2 A;  4E3M A;  2P9V B;  3UE0 A;  1DY6 A;  3CG5 A;  2ZQ8 A;  2E8I A;  3ZG7 B;  2WKH A;  3BLM A;  3G35 A;  3FZC A;  3P09 A;  4ZBE A;  4XXR A;  2XEP A;  2Y91 A;  4S2J A;  1O7E A;  1EWZ A;  1KGF A;  3DTM A;  3BLS A;  3IH8 A;  3IWQ A;  4JKT A;  5CER A;  2RCX A;  4FD8 A;  4ZAM A;  3V3S A;  2ZJ9 A;  1KGG A;  4X6T A;  2GDN A;  2Y59 A;  3W4Q A;  1L2S A;  4PM5 A;  5F1F A;  5CTM A;  1QME A;  1IKG A;  5EVI C;  5HFO A;  4OQH A;  1NRF A;  4KZA A;  1K38 A;  3V3R A;  3PBS A;  3VOZ A;  3OCN A;  3ZVW A;  4A5R A;  4S2N A;  3UNW A;  1HZO A;  4OPR A;  3G30 A;  1PI4 A;  2H5S A;  3HVF A;  3ZFZ A;  5FQQ A;  1Q2Q A;  2V20 A;  4KZ6 A;  3FKW A;  2C6W B;  4WZ5 A;  1NZO A;  5E2H A;  3ZDJ A;  4S2L A;  1SHV A;  4IVK A;  5DF7 A;  1YQS A;  1IEM A;  2ZM0 A;  4E3L A;  3TSG A;  5M1A A;  4ZJ3 A;  4DXC A;  3W4P A;  1W7F A;  4K0X A;  1MBL A;  1JWP A;  4OLD A;  1FR6 A;  5KSC A;  2HP6 A;  4FCF A;  4MBK A;  1CI8 A;  3MZF A;  5TGF A;  2A3U A;  4QHC A;  5FQI A;  4IBX A;  1LHY A;  4X53 A;  1YLP A;  4P85 A;  4QD4 A;  5FI7 A;  4DDY A;  2BG1 A;  2WKE A;  5GLD A;  4Y0O A;  4Z9Q A;  5AQ7 A;  1N4O A;  3HLG A;  3S22 A;  1JWV A;  4GD8 A;  4PM7 A;  5A92 A;  3G34 A;  3FYZ A;  1LL5 A;  5I94 A;  3I7J A;  1RCJ A;  4DDS A;  4DXB A;  4LV1 A;  3NDG A;  5J8X A;  5EVI D;  4S2N C;  1WYB A;  3SS5 A;  1I2S A;  1MKI A;  1XA1 A;  1XA7 A;  4U3T A;  1XXM A;  4X69 A;  3O88 A;  3M2J A;  2XR0 A;  3PBO A;  1MPL A;  4JXW A;  3VSK A;  3UE3 A;  4C3Q A;  2Y2L A;  3G2Z A;  4E3O A;  4F94 A;  5EOE A;  2ZLY A;  4LCL A;  2FFF B;  4N92 A;  2EX6 A;  4S2O A;  1L0F A;  2QZ6 A;  3BRM A;  4E6W A;  4RA7 A;  4LV0 A;  4FH4 A;  3IF5 A;  3SOI A;  2XLN A;  1EI5 A;  4KQO A;  4OQ0 A;  2Z2M B;  4R3J A;  3UDF A;  4EQI A;  2CC1 A;  3BEC A;  1H8Y A;  1ES5 A;  5GLC A;  1XKZ A;  4GNU A;  3V39 A;  3P98 A;  3ISG A;  1L0E A;  4FH2 A;  2ZC5 B;  3W8K A;  3CJM A;  3VP4 A;  4LCM A;  2WK0 A;  4L0L A;  1SDE A;  1NJ4 A;  1K56 D;  2I72 A; 
#chains in the Genus database with same CATH topology
 3UE1 A;  2V8C A;  3O5Y A;  4EES A;  4Y0T A;  1KS0 A;  3UB7 A;  2WGW B;  4E3J A;  5B2I B;  3ITA A;  4NXF A;  2PDR A;  1E4D A;  1GHP A;  1K54 C;  1CEG A;  4DE0 A;  1E8B A;  4MDZ A;  4B9O A;  1SZV A;  2VA0 A;  4J8V B;  3GTC A;  3TU4 D;  1OTD A;  2QMI A;  4HH2 A;  5CPJ C;  5F1G A;  1LI0 A;  2O9A A;  5GLA A;  3X1S B;  5HDD A;  4Z2G A;  2FJ7 A;  2JC7 A;  3UTB D;  2OV5 A;  3REH A;  4KGC A;  5DJU A;  4UUZ B;  3HUO A;  3ZG0 A;  4HP4 A;  5B0Y D;  1A7W A;  4MNR A;  1AXB A;  5B2J D;  1OTA A;  2R9X A;  4IBR A;  3VSL A;  5AVE A;  5AV9 D;  4P6B A;  3FPV A;  3B33 A;  1XP4 A;  1IKI A;  2VKS A;  3AV2 D;  4EW7 A;  5F99 C;  3V5M A;  1KX3 A;  3VH5 W;  4J8W B;  4HGA C;  3RXX A;  5GT0 C;  4HIA A;  4EXO A;  2XD1 A;  4MB5 A;  1SKF A;  3DWZ A;  4OOM A;  3NIA A;  5G49 B;  4WU8 C;  2ZM8 A;  2WYX A;  4L9F A;  5B31 A;  2H0Y A;  3SS3 A;  3IX8 A;  3LY3 A;  3CUE C;  1ID3 B;  2W3D A;  4KHA B;  5CPK B;  3ULF A;  5AV5 A;  4OJ5 A;  3DTI A;  2E8J A;  3N8S A;  3WAA A;  4WYY A;  3B6F B;  4MN5 A;  3C1B C;  2W3E A;  1FCO A;  3VH6 W;  3DW0 A;  3GQZ A;  2FN2 A;  5GT0 B;  1EQZ A;  1CEF A;  4X56 A;  3U2A A;  3AV1 B;  2EFU A;  1PW1 A;  3WKJ A;  1OTI A;  2DCF A;  5EV0 A;  3Q81 A;  3LR3 A;  1OJ5 A;  3UE6 A;  1L0G A;  1BH9 A;  1KU5 A;  1BT5 A;  2B02 A;  2UWX A;  3AYW D;  2EX2 A;  3BJN A;  1PZO A;  3O62 D;  1OTB A;  2V0U A;  5AVB A;  3B6G C;  3WA9 C;  1BTL A;  3F1P B;  1PIO A;  4HBT A;  4NG2 A;  3B0B A;  4E3N A;  5BOH A;  1LT0 A;  4JGP A;  1PYY A;  3HLE A;  3PTE A;  3AV1 C;  1KDW A;  4WZ4 A;  3T4J A;  3PYP A;  1J7M A;  4Z2H A;  3L25 A;  3TW8 A;  3L9K A;  1AOI A;  5HAI A;  3N6I A;  1NYM A;  4I3J A;  4JJN D;  3REL B;  5B31 D;  4E44 A;  2A49 A;  4EO5 C;  1P3L B;  1NXY A;  3AYW B;  2QJ5 A;  4H9S A;  3K3D A;  3HUM A;  3MGQ A;  3LY4 A;  1LSW A;  3BQ8 A;  4XUZ A;  3L7H A;  3FKE A;  2XDM A;  2CV5 C;  3REI D;  5AV5 D;  3H82 B;  2XGN A;  1BLC A;  3MGR D;  2YKH A;  4R3B A;  2ACG A;  3Q7Z A;  3MGQ D;  3T4L A;  5B0Z B;  4IBF A;  5FQM A;  4CJN A;  1PI5 A;  1GPF A;  1HVB A;  1B67 A;  1N9O A;  5M19 A;  5B2I D;  1IYS A;  1IYO A;  4UEY A;  1SDN A;  5HAQ A;  4Y0U A;  3L26 A;  5HL6 A;  1ERO A;  2W0N A;  1XFQ A;  2EXA A;  4GS9 A;  3KSF A;  2W8S A;  5E2F A;  5FAS A;  2ARO D;  3S7Q A;  1ZG4 A;  1H3O B;  1JNU A;  5BT1 C;  2P9V A;  4YM6 D;  2VGK A;  5AQ9 A;  2PD8 A;  4OP5 A;  3LEL C;  3REH C;  5FI6 A;  3AZJ A;  4J8V C;  3KSY A;  4ETZ A;  4Z5T A;  1HLU P;  4KG2 A;  5B2J B;  4GHL A;  4KEN B;  2HIO A;  5CHM A;  5B0Z A;  2V9A A;  1ZLA C;  1PNE A;  4OJO A;  1ZKJ A;  1WE4 A;  5CGS A;  4J8W D;  3MKF A;  2Z2L B;  5BNV A;  5FI2 A;  5GL9 A;  1CJF A;  1HTZ A;  3HL9 A;  3W96 D;  4CLC E;  4EET B;  5CXW A;  1GOI A;  3EQU A;  3REL A;  5E2E A;  3FG8 A;  2G5H C;  2A24 B;  4S2I A;  1YMS A;  1BLS A;  5DTT A;  4RYE A;  1NWZ A;  3EPH A;  3C7U A;  3FKV A;  2GNX A;  3ZNY A;  5GXQ A;  3KWQ C;  3TJZ C;  5GT0 D;  4QU3 A;  3PBR A;  4Y13 A;  2BAS A;  1EAK A;  2EXB A;  3IXB A;  4AWL B;  1S67 L;  3FV7 A;  4E6X A;  2HJE A;  3AZI D;  5B1L C;  3BFC A;  1I5Q A;  1LSX A;  4KG6 A;  5AVC C;  1OT6 A;  4QNL A;  3AZI A;  4WZ5 C;  3AV1 D;  2Y2M A;  3M2K A;  4WEL A;  5CPJ A;  2WKR A;  4G91 B;  4XZQ A;  1OGB A;  3L27 A;  2WGW A;  3EOI A;  1JTD A;  3F1N A;  3WAA B;  3MVD A;  2BTF P;  3MQ0 A;  3B6F A;  3NI9 A;  1H0G A;  3W98 A;  2VX8 A;  2C5W B;  5B31 B;  4EQ1 A;  1ULY A;  3IXD A;  2V1Z A;  1KX3 C;  4NK3 A;  3ZQ5 A;  3LIC A;  4Z5T C;  4RX2 A;  1ZG6 A;  5CGX A;  2XRO A;  2Y2P A;  1T19 A;  5HAP A;  5B32 A;  3UTA D;  3ZG9 B;  4PM6 A;  3REL D;  1E25 A;  4UQI S;  3MGS D;  3D72 A;  3REK B;  1ESI A;  3X1V C;  3BY8 A;  3PBT A;  1MY8 A;  3GVB A;  4HME A;  3GSG A;  3OOV A;  2XH9 A;  3B47 A;  4CPK A;  3N4I A;  4XUJ B;  4OP8 A;  2J9P A;  4BBU A;  3UN7 A;  2JCH A;  1K25 A;  3LUQ A;  1GA9 A;  2XFT A;  2OLU A;  3NC8 A;  1P3P D;  4Q0H A;  3MNN C;  5CHJ A;  4H9Q A;  3BFG A;  3M6H A;  3A1I A;  4Z66 C;  5BT1 D;  1P3G A;  5F6A A;  3X1S A;  1KOU A;  4WUJ A;  4MBH A;  2LB5 A;  4S2K A;  3E4Q A;  4J8V A;  5B33 D;  3VH5 A;  4XUJ C;  4R8P B;  3CZD A;  3SZT A;  4X25 A;  3T4T A;  2XD5 A;  1BLP A;  2OAP 1;  2PRF A;  5GT3 C;  1LLB A;  3UMD A;  1TD5 A;  5EVL A;  4DQY B;  4ZBJ C;  3W97 A;  3CAX A;  2WUQ A;  3EEH A;  3LJA C;  4KUO A;  2W1T A;  3BFE A;  1JFI A;  5HSQ A;  4GHI A;  2PU4 A;  3AZK D;  4BWI A;  4LD9 A;  3UY6 A;  1AOI C;  1PZP A;  1K57 A;  5FUG B;  2PYO A;  1P3A A;  3MMH A;  3Q7V A;  2P74 A;  1Z6F A;  4QB8 A;  1I2W A;  3LI8 A;  3AZM B;  5F99 A;  4X1M A;  3NQU A;  2K2N A;  4XZQ B;  1W1T A;  3T4Q A;  2JSS A;  1YU2 A;  5CEC A;  2YFV B;  2XF3 A;  5CPI C;  1VEU B;  3N7W A;  3KS8 A;  1BYW A;  5DTK A;  3VFH A;  3RH8 B;  3VP3 A;  1S32 C;  4EBN A;  5CRF A;  3A3E A;  3AZM C;  1DJA A;  5BO0 B;  3RJU A;  1TS7 A;  2J3T D;  4IBD A;  4G3K A;  2HDR A;  2JBF A;  1ONH A;  3MXS A;  1ES2 A;  4NEE D;  3UE0 A;  2A24 A;  1P3B C;  4ZBE A;  2XEP A;  1TZY A;  4S2J A;  1KGF A;  3WD3 A;  4FD8 A;  3AZF A;  4YM6 A;  4J8X B;  2GDN A;  2WKQ A;  3W4Q A;  5TJJ A;  4ZRR A;  4PM5 A;  3KYE A;  5EVI C;  4NYY A;  4OQH A;  4KZA A;  3SW1 A;  2ZL1 B;  4WN5 A;  1G6O A;  3OCN A;  3MGS C;  2KOI A;  4OPR A;  1XJ3 A;  4KUK A;  3HVF A;  3KXB C;  1S66 L;  1Q2Q A;  5B2J A;  3IS2 B;  3R7W A;  3UTA B;  5DNM D;  5MC7 A;  4YS3 C;  5AJG A;  3K2N A;  4J8X D;  1SHV A;  2OWH A;  1YQS A;  3REK D;  4ME4 A;  3AZE C;  2G5I C;  3MGP C;  1FIL A;  4ZJ3 A;  4CSR A;  4OLD A;  4MBK A;  3REJ B;  3VE3 A;  1KX3 D;  2J80 A;  4QHC A;  4G3W A;  4R3A A;  3AZL C;  2WKE A;  4Z9Q A;  4JJN B;  3G34 A;  3X1V D;  5CP6 D;  1H3Q A;  4DDS A;  1CQA A;  5B33 B;  1I2S A;  1P9R A;  4U3T A;  4X69 A;  2XR0 A;  3VSK A;  1MPL A;  3REI B;  3P5J B;  4J8U C;  3UE3 A;  4J8U A;  4X23 D;  4E3O A;  3LEQ A;  3MNN D;  5DKK A;  2EX6 A;  3BRM A;  5B40 C;  2QHK A;  4HH3 A;  4EQI A;  3AYW A;  3BEC A;  1ES5 A;  3MXQ A;  4ZUX C;  2HUE B;  3V39 A;  4NY2 A;  2WK0 A;  5CPI A;  1NJ4 A;  3QP1 A;  2BYK A;  4GHI B;  1K56 D;  4M6B A;  3X1T C;  3C4O A;  3A6N C;  2ZM5 A;  4I3I A;  3OZH A;  3JPU A;  2Y8H A;  1Y54 A;  1YU3 A;  5DVA A;  1DP8 A;  1YKD A;  1X0O A;  3IF6 C;  3WS1 A;  4KZ5 A;  3B0C W;  4WV4 B;  4MBF A;  3IT9 A;  5AY8 A;  3B0C T;  3FWL A;  2W3F A;  1P3M D;  1BZA A;  2WAF A;  1P97 A;  4CAY B;  4R70 A;  5TR7 A;  4JJN A;  1FSW A;  3UDX A;  3A3I A;  1KX5 C;  1KX5 A;  1IYQ A;  4KHA A;  1F66 A;  4GZB A;  2BYM A;  5AV8 A;  3S4X A;  1M19 D;  1SKO B;  1UGU A;  3E0Y A;  3E4O A;  3PAE A;  4YIN A;  3WKJ C;  4XUJ A;  4IBB A;  3EEA A;  3T4O A;  3IF6 B;  4HP9 A;  5FSR A;  1VHM A;  1P3F D;  3KX0 X;  4KZ9 A;  3GR2 A;  4N9K A;  3W97 C;  3AGD A;  3AN2 A;  1JVJ A;  1VB6 A;  4RVA A;  1F5M A;  5FDH A;  1M18 B;  2DMW A;  2OLV A;  4OQI A;  2IOU A;  4ZTK A;  5FAO A;  3VFF A;  4H9O B;  1K55 C;  3HLD A;  1YAX A;  2Y2G A;  1M19 B;  4HBU A;  4H9N B;  4F3L B;  5AV6 C;  3IX3 A;  1DP6 A;  5FAP A;  4AFI A;  4EUZ A;  2W1T B;  3AYW C;  3IXG A;  4CQH A;  3X1U D;  3MVD D;  1M1A D;  3W97 B;  2ZY4 A;  4HMD A;  2ARO A;  1ONG A;  3IBR A;  3IQA A;  2HIO D;  5FA7 A;  3W98 C;  2D49 A;  3MGP A;  3MQO A;  1FIK A;  4OQG A;  1BUL A;  5B24 D;  4IHQ A;  1M1A A;  1IFQ A;  5I5L A;  4OOY A;  3AZJ D;  3BFD A;  5JYO A;  5AV6 B;  4DRT A;  4HMC A;  5B2I C;  3MGP B;  4OPQ A;  3KSH A;  1QO6 A;  3X1U B;  1W63 Q;  5F83 A;  1W8Q A;  4J8U D;  2BYK B;  2EX9 A;  4QLC B;  5B1L A;  5GXQ B;  4HJ6 A;  3VP0 A;  2B5R A;  1F1E A;  4NXE A;  3RFB A;  3X1S C;  3KUY D;  4Y17 A;  5JRG A;  4OJP A;  3W99 D;  4Y7P A;  5DKL A;  5CP6 B;  1HQ3 B;  4JF4 A;  4WNN B;  2ZOH A;  1TZY C;  2EX8 A;  3FC7 A;  4X1L A;  3N8L A;  3W99 A;  4R6L A;  3NHQ A;  4K91 A;  1WA9 A;  5IS1 A;  1E3U D;  3UT9 B;  4J8U B;  2QKP A;  5F99 B;  3LIF A;  3AN2 C;  2PR6 A;  5GXQ D;  2QPN A;  4ID4 A;  3GRJ A;  4LEN A;  3D3O A;  2XFS A;  2WGV A;  1B6W A;  5A93 A;  1F66 B;  1DJB A;  1NY0 A;  3MZD A;  1OME A;  3IHB A;  1YU1 A;  1P3K A;  2QYB A;  3WRT A;  4KUD B;  4NET A;  3HLB A;  5HDS A;  3VP1 A;  1LL8 A;  4UHU A;  5D3O A;  3PBN A;  1P3M C;  4H9R A;  3B6F C;  3ZG5 A;  3CPT B;  3SH8 A;  1ZTU A;  5L2F A;  4II7 A;  5HX9 A;  3AZH A;  4OPY A;  1F66 C;  4JPM A;  2F8N K;  4WU8 B;  3LR4 A;  3BY9 A;  3WAA D;  3LYX A;  2RL3 A;  1EW0 A;  3MKE A;  3EWK A;  3OPH A;  3LZ1 B;  1PWD A;  2CWE A;  2V8F A;  2NQB D;  2PHY A;  3HRE A;  3X1V A;  5DTS A;  1P3K D;  4O0P A;  1SCW A;  2VV7 A;  3C7V A;  5DFY A;  1YLW A;  3D9Y A;  5GT3 A;  2F8N D;  4WU8 D;  3DTK A;  3C8C A;  5E5A B;  4PMA A;  1ID3 C;  1M18 D;  4GCZ A;  1FCN A;  3WS0 A;  1G68 A;  2JKT I;  2PAV P;  3VE4 A;  3Q82 A;  3AZI C;  3MVD C;  2J9O A;  3MQQ A;  3OC2 A;  4JF5 A;  5E2G A;  2V0W A;  2DRW A;  1FSY A;  2WKP A;  2XQZ A;  4G92 C;  1T1A A;  1LI9 A;  1PWC A;  4LV2 A;  3W97 D;  4JGQ A;  2ZOI A;  4LG2 A;  5E5A C;  3DTE A;  4Z2J A;  1P3A D;  2G2U A;  2FZ0 A;  2HDQ A;  5FQ9 A;  5KSH A;  5CX7 A;  4Z2L A;  3H9W A;  1YSP A;  4LD9 D;  1ESU A;  2Y2H A;  4I3A A;  4OKP A;  4NXG A;  5EFW A;  5AV6 D;  3O62 C;  4GN2 A;  2Y2N A;  1KVM A;  3ZCZ A;  3X1T A;  4IVI A;  1PZR A;  4NYU A;  2VV6 A;  4E45 A;  4Q0I A;  4OH0 A;  1ES4 A;  2P04 A;  3C2W A;  2QWS A;  5A8B A;  4UA7 A;  5JYP A;  5DNN A;  1E6Z A;  3AZN C;  1GA0 A;  5EVE A;  3N3F A;  3AZL A;  1TDG A;  3A3J A;  5TFQ A;  1ZC2 A;  3OBF A;  2Q9N A;  3CIT A;  3B0D B;  4DRB A;  1RP5 A;  1K4E A;  2BLS A;  3LEZ A;  4MEZ A;  3BWL A;  3E4P A;  4XZQ D;  4QLC C;  1TEM A;  1K6R A;  3FPW A;  1XGI A;  3MGR C;  4O01 A;  4YM6 B;  4J8X A;  4HEF A;  4IJE A;  2W1R A;  5EVI A;  3NOP C;  3KFU G;  4J8W A;  4O7D A;  4Z66 D;  1TZY B;  4R8P A;  3G2Y A;  3L2A A;  3GMW A;  1P3O C;  2VV8 A;  2R78 A;  2Y2Q A;  2F2A C;  5F99 D;  1UR9 A;  4RQ9 A;  2A2L A;  2VGL S;  4GDN A;  3CHW P;  3LJA A;  5GT3 D;  2F8N A;  3G31 A;  3ZYT A;  1YU4 A;  1WYC A;  1UWN X;  2FJ7 B;  5B1M A;  3GV9 A;  1N9N A;  3AZE A;  2J8Y A;  5HD5 A;  3C30 A;  2P08 A;  1KX4 C;  5KDM B;  5G4Z A;  2NZD A;  4KZ8 A;  1P3O B;  1DP9 A;  4GLQ A;  2NUP C;  4KQR A;  2J3T C;  5B2J C;  3VH5 T;  1P3K C;  4X55 A;  3M6B A;  3JVV A;  1EQZ B;  4GH9 A;  5DF8 A;  4HGA B;  5GT0 A;  3AV2 C;  2NQB B;  4KZB A;  3AZM A;  4CLC A;  4OJL A;  1BH8 B;  3VH6 A;  1K4F A;  1YLT A;  3NQJ B;  5CPK A;  4HES A;  5F5Y A;  3UDI A;  5JRG D;  2K31 A;  4FSF A;  3LZ1 C;  4E3K A;  2PU2 A;  3E98 A;  4MN6 A;  1BH8 A;  3LIE A;  3F1N B;  5G49 A;  4DF6 A;  4NZ4 A;  1STZ A;  4K0W A;  3VP2 A;  1EQZ D;  4JLF A;  5GHX A;  1TS0 A;  4BL2 A;  1Q2P A;  4G91 C;  4QWO A;  1KX3 B;  4GJ4 A;  4KZ3 A;  5E5A D;  2JE5 A;  3A3F A;  5AVF A;  3NJA A;  4B4X A;  3CI6 A;  5B0Z D;  1VQQ A;  4GW9 A;  3MGS A;  1VET A;  1C3B A;  5JRG B;  4XT2 A;  3OPP A;  5B1L B;  3X1V B;  1E6N A;  5CEB A;  3AZE D;  4YS3 B;  4LV3 A;  3BW6 A;  5B1M C;  5AV8 D;  5HL1 A;  4E3M A;  3WX7 A;  4X23 B;  3MGQ C;  2E8I A;  2RVQ C;  5B32 D;  1R4V A;  3FZC A;  3V9R A;  4ARZ B;  3HJK A;  2Y91 A;  2PR5 A;  1O7E A;  1EWZ A;  3DTM A;  3IWQ A;  3IH8 A;  2RCX A;  4ZAM A;  5B0Y A;  2ZJ9 A;  5DNM C;  5DNM A;  4KUD A;  3EGD C;  1QME A;  1IKG A;  1H8M A;  2XSS A;  4CLC C;  3V3R A;  2G7U A;  1G28 A;  4X23 C;  1V9Y A;  1CK7 A;  1MC0 A;  1S32 A;  3LR0 A;  4S2N A;  1HZO A;  3G30 A;  3ZFZ A;  2H5S A;  4R8P D;  3REI C;  4MCW A;  3VV4 A;  2V20 A;  4KZ6 A;  3FKW A;  2C6W B;  5HWT A;  3REH D;  5KIZ A;  4KGC D;  4J8V D;  4OJ6 A;  2VGL M;  3ZDJ A;  4IVK A;  1PDC A;  3T4K A;  3R45 A;  4NZ5 A;  5M1A A;  4DXC A;  2HUE C;  3IP4 C;  1TAF B;  3AZK B;  2HP6 A;  4DJ2 A;  3MZF A;  4MN7 A;  4QLC D;  1T18 A;  4P6Z S;  4DDY A;  3LGO A;  2PBD P;  3REH B;  1JWV A;  4GD8 A;  5A92 A;  4NE3 A;  1P3G D;  1LL5 A;  4PAU A;  5I94 A;  1RCJ A;  1VET B;  4LV1 A;  3TU4 A;  4LPZ A;  4ZUX D;  2Z6C A;  5B31 G;  5AV6 A;  1XXM A;  1S4S A;  5B32 G;  3O88 A;  4C3Q A;  2Y2L A;  3G2Z A;  4WU9 B;  3NUL A;  2FFF B;  3AV2 A;  1L0F A;  2QZ6 A;  4JGR A;  2M7U A;  4LV0 A;  4Z2M G;  5B0Y C;  3IF5 A;  4KQO A;  4R3J A;  2Z2M B;  2ZY3 A;  1N1J B;  3L29 A;  3MNN A;  3BQA A;  3CUE A;  1EQZ C;  3P98 A;  3IBJ A;  3CJM A;  3VP4 A;  2JN7 A;  3C1C B;  4F3L A;  4LCM A;  3C1B A;  2HIO B;  1PFL A;  1D06 A;  2NQB A;  2XK1 A;  4H9P A;  3MGR A;  4Z2I A;  4Y5F A;  4AWL C;  4N1H A;  1GHI A;  1K54 A;  2DNS A;  4KQQ A;  3C4P A;  3MS6 A;  3DBA A;  2RIQ A;  5AV9 A;  2D01 A;  4R23 A;  4GHA A;  1YMX A;  3A0R A;  3LIA A;  1P3O A;  1E6P A;  3MFD A;  2JKR I;  4GS9 B;  1M19 C;  3AV1 A;  4OLG A;  3AZE B;  4UA6 A;  3BEB A;  4EWF A;  5BNX B;  3WA9 A;  2RVQ D;  2HP5 A;  3NDE A;  3KS4 A;  3QP8 A;  2F8N B;  3KSG A;  4ZUX A;  4O8G A;  5F69 A;  4WL9 A;  1W5D A;  3T50 A;  1TDL A;  1MWT A;  5BNX A;  3EQV A;  5GSU D;  4DMZ A;  2J3W A;  3RTY A;  5HAR A;  5AVC B;  3BFF A;  1D7E A;  4DE2 A;  3HLW A;  3WTP C;  5AVB D;  5EVI B;  3B6G D;  4HNB A;  3MGQ B;  2HP9 A;  2VEA A;  1S1Z A;  1FCM A;  1ZLA A;  3JYI A;  3KUY C;  1T1C A;  4R4R A;  1M1A C;  3N8R A;  3KXB D;  4B4Z A;  3IH9 A;  1P3I A;  4Y15 A;  4RX3 A;  5HDC A;  5CP6 A;  3UTA C;  4JJN C;  2J7V A;  5B31 C;  1FQG A;  1YU0 A;  3VH6 T;  5EPH A;  3MF0 A;  3EPL A;  2V1B A;  2MJ6 A;  3IWI A;  4KGC B;  3IWO A;  2NUT C;  4IED A;  3MNN B;  3P01 A;  5KMW A;  4M4X A;  2CV5 D;  2H28 A;  3AFA A;  1WWI A;  3Q1F A;  5L09 A;  1ALQ A;  1P3P C;  1UR8 A;  2VJW A;  2LB9 A;  5HPI A;  4R8P C;  4LGW A;  4Q0J A;  3V50 A;  3ZVT A;  1MWU A;  4NE5 A;  5B33 C;  3UME A;  3O86 A;  3PAG A;  3NEC A;  1DJC A;  1PW8 A;  3MBZ A;  4EBP A;  3G32 A;  2EFX A;  2F8N G;  1Z2C B;  5CGW A;  4I38 A;  2ARO C;  1K56 A;  4H9N A;  1P34 B;  3KXB A;  1TF1 A;  1K57 C;  2INW A;  2WAE A;  3W96 B;  2OAQ 1;  4C75 A;  4LFU A;  1S4R A;  5J3W A;  2H0T A;  3AZN A;  4ZBJ B;  1KGE A;  1GSV A;  3WS5 A;  5FEF A;  2W3G A;  4GD6 A;  1K0K A;  3O62 A;  4IBI A;  3T1S A;  2OOL A;  2DQN C;  4I39 A;  3A6N B;  1GXD A;  1KX5 B;  2X01 A;  5CPI D;  1M18 C;  4BLM A;  5DNN D;  1CF0 A;  3LZ1 A;  3E2K A;  4DKI A;  3HUN A;  1P3F B;  4L9E A;  3OPL A;  3C1C C;  5CPK D;  3WA9 D;  2Y2J A;  3OCL A;  1ZHH B;  4FTX A;  4IJF A;  4B88 A;  1MWR A;  1MWS A;  2ZQC A;  3REJ D;  4ZJ1 A;  1ES3 A;  3MXR A;  4H8R A;  3LFV A;  2JKR M;  1P3A C;  4BD1 A;  5U47 A;  3G6O A;  3AFA B;  1NYY A;  5CHU A;  4J8X C;  4IUH A;  3R4K A;  2O0Y A;  1S6R A;  2HF6 A;  5AVB C;  5GSU B;  3B6G A;  2XA7 S;  4YS3 A;  1BSG A;  4I5S A;  4OVD A;  3EPJ A;  1M19 A;  5B24 B;  3O62 B;  3HON A;  3MGS B;  3GDI A;  4UAA A;  2WAD A;  3S7N A;  5EOO A;  1GHM A;  3P7N A;  3WS4 A;  4MMN A;  1GCE A;  3ZG8 B;  3WD2 A;  3AZN B;  2Q9M A;  1M6K A;  1P3I C;  1JTG A;  1HQ3 A;  3AZG B;  4YS3 D;  4X68 A;  2AVX A;  1FOF A;  4QPR A;  3KUY B;  3KXB B;  2Y79 A;  5AV8 B;  3W98 B;  1Y4O A;  1W8Y A;  1JFI B;  3AL0 C;  3X1U A;  4YM6 C;  5EUA A;  2K7S A;  3VOL A;  1N9B A;  3AZL D;  5IU1 A;  3H7W B;  3UB9 A;  5AQB A;  3A1K A;  3S1Y A;  4WZS B;  1ODV A;  1P3M B;  2IO5 B;  5G4Y A;  3WD4 A;  2B95 A;  4J8W C;  3W4O A;  3DWK A;  5AV9 C;  3AZH D;  2FJ7 C;  1NZU A;  4R38 A;  3EGX C;  1RGZ A;  1XGJ A;  3A6N A;  4NXB A;  1W63 M;  1H5X A;  5JA4 B;  1GSX A;  1U35 D;  1HD8 A;  5CPJ D;  3AN2 B;  2IO5 C;  4YNR A;  1XJ2 A;  4BQM A;  4Q8I A;  5B40 B;  5F68 A;  1XX2 A;  3UTB C;  2NZD C;  4WU9 A;  5DNN C;  5FAQ A;  5GHY A;  4JXG A;  5FL3 A;  1BFM A;  3A6N D;  5B1L D;  4KG5 A;  2ZC3 B;  5CPK C;  3LID A;  3TU4 B;  3B3X A;  5AY8 C;  1L0D A;  5EEC A;  1U35 B;  5DJT A;  4N1X A;  4QY5 A;  3MVD B;  5IT5 A;  1CK3 A;  1XFN A;  3WA9 B;  3HBR A;  2HPB A;  3TG9 A;  2Z6D A;  1TVF A;  2JKT M;  5DNN B;  1KE4 A;  2YKF A;  4G92 B;  1S32 D;  4HJ4 A;  1H3O A;  2KDK A;  3ICY A;  2Y2O A;  5C3I B;  1XPB A;  4LRZ E;  5LBR A;  5FQJ A;  2ZC7 A;  5HW3 A;  3TE8 A;  1OJG A;  5FAT A;  1KVL A;  3HCY A;  3C1C D;  4EV4 A;  4WF0 A;  5CED A;  3QP6 A;  4P0M A;  1ERM A;  1DRM A;  2O99 A;  3LZ0 C;  3BM6 A;  1P3A B;  3Q7V B;  4DJ3 A;  4NZ1 A;  2EA9 A;  1P3B D;  5J4E A;  4LD9 B;  2HDS A;  3T1X A;  3KO6 A;  5C3I C;  1HQ3 D;  3F1O A;  1H8Z A;  3CWF A;  3AGF A;  3WTP A;  2OWJ A;  4CLC D;  1E88 A;  4C6Y A;  4WJ3 C;  3AZG D;  4GOG A;  4BMW A;  1P3L A;  2Y4A A;  4R1G A;  3V9R B;  2IWD A;  3SS4 A;  3NOU C;  5B32 C;  4WEK A;  2VGJ A;  2GZA A;  3WWX A;  1P3G B;  3B0D C;  2I9V A;  4WEJ A;  1D1J A;  3NBL A;  1Y28 A;  4WMC A;  2WKI A;  4ZJ2 A;  3LJA D;  4IBJ A;  2P9V B;  5AV5 C;  1DY6 A;  2ZMF A;  3ZG7 B;  2WKH A;  4PHT A;  1O6I A;  4NKP A;  3AZK C;  1TAF A;  3AZK A;  3REK A;  2HJ9 C;  3BLS A;  5CER A;  1KX4 B;  4Z66 A;  1P3G C;  3LEL B;  2Y59 A;  3AZF C;  5BS7 A;  1ZLA D;  3PHY A;  1P3P A;  5CTM A;  1AIW A;  3IS2 A;  3U4L P;  2JHE A;  1P3K B;  2CMN A;  5FUG A;  2PYO B;  4H6J B;  5AV5 B;  3ZVW A;  4A5R A;  2NZD D;  3UNW A;  5FQQ A;  1T3U A;  5GSU A;  2GJ3 A;  5B40 D;  3S7P A;  3AZH C;  1NZO A;  2M1C A;  3AZF B;  1YPR A;  1NRJ A;  3LEL D;  4LRX C;  5B0Y B;  1TS8 A;  1YUE A;  5CPJ B;  2ZM0 A;  2V5O A;  3TSG A;  4E3L A;  2PYO C;  1NLY A;  1MBL A;  4K0X A;  1JWP A;  5KSC A;  4ARZ A;  5TGF A;  2NZD B;  1L3L A;  5FQI A;  4IBX A;  4X23 A;  2Q0O A;  2BG1 A;  4PKY G;  4QLC A;  4Y0O A;  5GLD A;  1N4O A;  4KUD C;  5BO0 A;  5CHL B;  3S22 A;  2KX6 A;  3LIB A;  3PXP A;  3FYZ A;  5AVC D;  3I7J A;  4XT2 B;  1AWI A;  2D02 A;  3NDG A;  1H0I A;  5EVI D;  5DFX A;  4S2N C;  3SS5 A;  4YOF A;  1XA7 A;  5AY8 D;  2EWW A;  3PBO A;  4YWZ A;  3MR0 A;  3R45 B;  4F94 A;  2ZLY A;  4LCL A;  4P6Z M;  3T1R A;  4N92 A;  3KWQ D;  4S2O A;  4RA7 A;  1KX5 D;  3UDF A;  1EI5 A;  5JRG C;  3H0L C;  1H8Y A;  4EUV A;  1UWP X;  4DN0 A;  5GLC A;  3REK C;  2PYR A;  1XKZ A;  4GNU A;  4BBV A;  1P34 A;  3W8K A;  1OPX A;  3QP4 A;  4H6J A;  1MZU A;  4L0L A;  4EU0 A;  2CV5 B;  5HD3 A;  3W2Z A;  1CXW A;  2I72 A;  2VK3 A;  4Z5T B;  4CLC B;  3AZJ B;  3L28 A;  1ERQ A;  4ZDX A;  2ZC4 B;  4D2O A;  3LZ0 D;  5B0Z C;  4Z66 B;  4N9L A;  4EO5 B;  3AZI B;  2ZD8 A;  3IF6 A;  5KDM A;  4U0X A;  4ETX A;  2YFW A;  2ZY2 A;  4H9S C;  2W3H A;  1T1B A;  5B1M B;  4JBF A;  2XRN A;  3OPR A;  1TS6 A;  4KZ7 A;  4HJ3 A;  1Q9C A;  3REL C;  4KQD A;  3LJA B;  3MZE A;  3MFX A;  1P3L C;  2WZZ A;  4DE3 A;  1P3O D;  5BPV A;  3QNB A;  1YLJ A;  5E43 A;  3KWQ A;  1JWZ A;  1M40 A;  3IHA A;  2H10 A;  4MB4 A;  1ZLA B;  4DRA A;  2PBY A;  3G4P A;  4Y2F A;  1CI9 A;  4XZQ C;  5DF9 A;  5FEG A;  1A0K A;  5B40 A;  2Y2I A;  5BNV B;  4S2M A;  1KX4 D;  1RGY A;  1J3W A;  4LRY C;  5AVC A;  1W1V A;  3C5A A;  5JA4 A;  4GDB A;  1E6R A;  5CPI B;  1AOI B;  3UB5 P;  2O9B A;  4XUJ D;  3W96 C;  2ZY5 A;  2PYO D;  4KZ4 A;  3F1P A;  4NE6 A;  2ZM2 A;  3ZNT A;  4K08 A;  1WWS A;  3HLF A;  1Z09 A;  4IBK A;  1YT4 A;  1KX4 A;  5HPF A;  2EWV A;  4HQA A;  4EEU A;  2GX5 A;  4JXV A;  5EM1 A;  5M18 A;  3AZH B;  2O9C A;  4JGO A;  2R9W A;  3AFA D;  3LZ1 D;  4QJG A;  1AOI D;  3C38 A;  5J7E A;  3WKJ D;  4H9R B;  3H7W A;  2ZQD A;  2ZQ9 A;  4UPK A;  1H8P A;  1P3F C;  4Z2K A;  1H0M A;  3HSH A;  2G2W A;  1P0Z A;  4PKY A;  3UO9 A;  4D60 A;  1VM1 A;  2V1A A;  2IWC A;  2V2F F;  4XUX A;  4Z1W A;  1ID3 A;  3TRC A;  3VMA A;  5HWW A;  3WAA C;  1GSW A;  1KE3 A;  5G18 A;  3D4F A;  1N1J A;  1MXO A;  2RTS A;  4JXS A;  3AV2 B;  2NQB C;  4PM9 A;  3ZHH A;  1G5U A;  4M3K A;  1YLY A;  3WTP B;  5A90 A;  2ZQA A;  2HIO C;  4FUW A;  3KWQ B;  1O07 A;  4GKU A;  3LZ0 A;  3F1O B;  1NLZ A;  5B24 C;  3A3D A;  3REJ C;  5B24 A;  4IUK A;  1K55 A;  3O3V A;  2VQR A;  3QNC A;  5AQA A;  3Q07 A;  4UUZ A;  5F82 A;  3UPO A;  1ID3 D;  3AZL B;  3B6G B;  2PYP A;  5KZH A;  4PPR A;  2B18 A;  1YM1 A;  1P3M A;  1FR1 A;  4MB3 A;  2L4R A;  4WU8 A;  3ITB A;  1BH9 B;  1MKM A;  2HZ5 A;  1M1A B;  2L5A A;  3O87 A;  5EM0 A;  5AV8 C;  4DE1 A;  3CPT A;  5B2I A;  3H0R C;  4S2P A;  1PWG A;  1P3F A;  2CV5 A;  4HI4 A;  1U35 A;  3IXH A;  5CTN A;  4E04 A;  3H0M C;  3B42 A;  3MGP D;  3WTP E;  4R0Q A;  3AN2 D;  1IYP A;  4FOF A;  5C5K A;  5EE8 A;  1VEU A;  1OTE A;  1P3P B;  5DNM B;  2X71 A;  3QP5 A;  3W99 B;  2DF4 C;  3UB6 A;  3EPK A;  4HY8 A;  1BUE A;  5GT3 B;  4KGC C;  4NZ3 A;  3A0V A;  3X1T D;  3W96 A;  1P34 D;  1IEL A;  3HLC A;  2ZMV A;  4WM9 A;  3FDD A;  3UT9 D;  3UPN A;  4CAY A;  5IHV A;  4OOL A;  2X02 A;  1W79 A;  3K3C A;  1OGG A;  3WKJ B;  2JKG A;  3IX4 A;  1KDS A;  4WU9 C;  2ARO B;  1BLH A;  1K6S A;  3VOY A;  1P3B B;  4EER A;  2ZBB A;  3UB8 A;  3LCE A;  3SH9 A;  3T1Q B;  4IJG A;  3AFA C;  1E3U A;  4WMC D;  2M7V A;  2HDU A;  4H9O A;  1W1P A;  3SH7 A;  4OON A;  1ACF A;  1HTA A;  4YFM A;  1M18 A;  1KE0 A;  4BEN A;  4PM8 A;  3UT9 A;  5HZH A;  4P87 A;  5GLB A;  3LEL A;  4U0T A;  5TBM B;  4Z2M H;  3HJI A;  2Y2K A;  4R4S A;  4BD0 A;  3BYD A;  4OPZ A;  3LR5 A;  1L6J A;  2IWB A;  3REI A;  2UV0 E;  1SKO A;  3MJQ A;  4LLO B;  4LD9 C;  1ED7 A;  3WTP D;  3WD1 A;  2L0W A;  2WZX A;  5B33 A;  3UPP A;  3EG5 B;  3AGE A;  3QHY A;  3AZG C;  5A91 A;  1YLZ A;  4BBT A;  3T4S A;  1N9L A;  5BS7 C;  3WRZ A;  3AZN D;  3F6T A;  4MLL A;  4QY6 A;  2VLG A;  4WLA A;  4IBC A;  2ZMA A;  3REJ A;  1E15 A;  5L10 A;  2VZW A;  5CP6 C;  2Y55 A;  3KYZ A;  5GSU C;  2OSU A;  3WS2 A;  4G3V A;  3NCK A;  3MSH A;  3X1U C;  2PT7 A;  1G6A A;  1LL9 A;  4ESP A;  3TOI A;  4Z5T D;  2PD7 A;  3UTA A;  3T12 B;  2P7J A;  4JF6 A;  4WBG A;  3PBQ A;  1F2K A;  2JKF A;  2ZC6 B;  3CMZ A;  5FQK A;  3AZF D;  1P3I B;  4UA9 A;  4GB7 A;  1XJ6 A;  3A0S A;  1V9Z A;  4Y3I A;  4E3I A;  1F98 A;  3CLO A;  5FDS A;  2XA7 M;  3UT9 C;  1QMF A;  1S0W A;  2IA2 A;  3ZGA B;  3X1T B;  3NY4 A;  1XJ4 A;  3JVU A;  2FFY A;  2J8P A;  3LO7 A;  5HWV A;  2L1M A;  3X1S D;  1LSV A;  3W99 C;  3UTB B;  4EBL A;  2BYM B;  3RXW A;  1TZY D;  4ZUX B;  2ZQ7 A;  2WGI A;  4BL3 A;  2F8N H;  1F9I A;  5GHZ A;  3M7P A;  3TU4 C;  2HV1 A;  5AY8 B;  1U60 A;  1J9M A;  3E2L A;  4BJP A;  4WU9 D;  1W1Y A;  3CG5 A;  1P34 C;  2ZQ8 A;  3KYQ A;  3BLM A;  4EEP A;  3G35 A;  3P09 A;  5AV9 B;  4XXR A;  2FJ7 D;  2FH5 A;  2YFV A;  4JKT A;  2KLI A;  3V3S A;  3V67 A;  5L8M A;  5E5A A;  1KGG A;  4X6T A;  5K5B A;  1L2S A;  5F1F A;  5HFO A;  1U35 C;  1IOU A;  1NRF A;  1K38 A;  3C1B B;  3B6F D;  1PRQ A;  3DAV A;  3C1C A;  3PBS A;  3VOZ A;  1P9W A;  4B93 A;  1S32 B;  2ZL1 A;  1PI4 A;  4L9G A;  4OUI A;  3LZ0 B;  1F66 D;  3H82 A;  1P3B A;  4WZ5 A;  5E2H A;  4S2L A;  4NFT A;  1W2E A;  4IBE A;  5DF7 A;  4KUD D;  1IEM A;  3AZM D;  3W4P A;  1W7F A;  3C1B D;  1FR6 A;  5B1M D;  4FCF A;  1CI8 A;  2LY8 A;  3OLO A;  3W98 D;  2A3U A;  1YSQ A;  2QJ7 A;  1LHY A;  4X53 A;  1YLP A;  4IBG A;  4P85 A;  4QD4 A;  5FI7 A;  4HOI A;  2W27 A;  5AQ7 A;  3HLG A;  3AZJ C;  2HGV A;  4H9Q B;  3S7O A;  1OT9 A;  4PM7 A;  5L07 A;  5AVB B;  4UQI M;  4DXB A;  3UTB A;  3WD0 A;  5J8X A;  3QP2 A;  3KUY A;  2YFW B;  1WYB A;  3NOT C;  1MKI A;  1XA1 A;  3MQL A;  4CSR B;  3M2J A;  4JXW A;  3AZG A;  3KSI A;  5EOE A;  1P3L D;  4TX8 A;  1S1Y A;  5TBM A;  3NQU B;  4E6W A;  4H9P B;  3MGR B;  4FH4 A;  3SOI A;  2XLN A;  4OQ0 A;  5B32 B;  1HQ3 C;  4WNN A;  2CC1 A;  3R7W B;  3LI9 A;  3ISG A;  3PR6 A;  1L0E A;  4FH2 A;  2ZC5 B;  1P3I D;  4HHD A;  3NQJ A;  1SDE A;  5GXQ C;  3GEC A; 
#chains in the Genus database with same CATH homology
 3UE1 A;  4Y0T A;  2WGW B;  4E3J A;  5B2I B;  3ITA A;  1E4D A;  1GHP A;  1K54 C;  1CEG A;  4DE0 A;  4J8V B;  3GTC A;  3TU4 D;  2QMI A;  5CPJ C;  5F1G A;  1LI0 A;  5GLA A;  3X1S B;  2FJ7 A;  2JC7 A;  3UTB D;  2OV5 A;  3REH A;  4KGC A;  4UUZ B;  3HUO A;  3ZG0 A;  5B0Y D;  1A7W A;  4MNR A;  1AXB A;  5B2J D;  2R9X A;  4IBR A;  3VSL A;  5AV9 D;  4P6B A;  1XP4 A;  1IKI A;  3AV2 D;  5F99 C;  3V5M A;  1KX3 A;  3VH5 W;  4J8W B;  4HGA C;  3RXX A;  5GT0 C;  2XD1 A;  1SKF A;  3DWZ A;  4OOM A;  3NIA A;  5G49 B;  4WU8 C;  2ZM8 A;  2WYX A;  5B31 A;  2H0Y A;  3SS3 A;  3LY3 A;  1ID3 B;  4KHA B;  5CPK B;  5AV5 A;  4OJ5 A;  3N8S A;  4WYY A;  3WAA A;  3B6F B;  3C1B C;  1FCO A;  3VH6 W;  3DW0 A;  3GQZ A;  5GT0 B;  1EQZ A;  1CEF A;  4X56 A;  3AV1 B;  2EFU A;  1PW1 A;  3WKJ A;  2DCF A;  3Q81 A;  1L0G A;  1BH9 A;  1KU5 A;  1BT5 A;  2UWX A;  3AYW D;  2EX2 A;  1PZO A;  3O62 D;  5AVB A;  3B6G C;  3WA9 C;  1BTL A;  1PIO A;  4HBT A;  3B0B A;  4E3N A;  5BOH A;  1PYY A;  3HLE A;  3PTE A;  3AV1 C;  1KDW A;  4WZ4 A;  3L25 A;  1AOI A;  5HAI A;  3N6I A;  1NYM A;  4JJN D;  3REL B;  5B31 D;  4E44 A;  2A49 A;  4EO5 C;  1P3L B;  1NXY A;  3AYW B;  4H9S A;  3HUM A;  3MGQ A;  3LY4 A;  4XUZ A;  3FKE A;  2XDM A;  2CV5 C;  3REI D;  5AV5 D;  2XGN A;  1BLC A;  3MGR D;  4R3B A;  3Q7Z A;  3MGQ D;  5B0Z B;  4IBF A;  5FQM A;  4CJN A;  1PI5 A;  1HVB A;  1B67 A;  5M19 A;  5B2I D;  1IYS A;  1IYO A;  1SDN A;  5HAQ A;  4Y0U A;  3L26 A;  1ERO A;  2EXA A;  2W8S A;  5E2F A;  5FAS A;  2ARO D;  1ZG4 A;  1H3O B;  5BT1 C;  2P9V A;  4YM6 D;  2VGK A;  5AQ9 A;  4OP5 A;  3LEL C;  3REH C;  5FI6 A;  3AZJ A;  4J8V C;  3KSY A;  4Z5T A;  4KG2 A;  5B2J B;  4GHL A;  4KEN B;  2HIO A;  5CHM A;  5B0Z A;  1ZLA C;  4OJO A;  1ZKJ A;  1WE4 A;  5CGS A;  4J8W D;  3MKF A;  2Z2L B;  5BNV A;  5FI2 A;  5GL9 A;  1HTZ A;  3HL9 A;  3W96 D;  5CXW A;  3EQU A;  3REL A;  5E2E A;  2G5H C;  4S2I A;  1YMS A;  1BLS A;  5DTT A;  4RYE A;  3EPH A;  3C7U A;  3FKV A;  3ZNY A;  5GXQ A;  3KWQ C;  5GT0 D;  4QU3 A;  3PBR A;  2EXB A;  3IXB A;  4AWL B;  3FV7 A;  4E6X A;  3AZI D;  5B1L C;  3BFC A;  1I5Q A;  4KG6 A;  5AVC C;  4QNL A;  3AZI A;  4WZ5 C;  3AV1 D;  2Y2M A;  3M2K A;  4WEL A;  5CPJ A;  4G91 B;  4XZQ A;  3L27 A;  2WGW A;  1JTD A;  3WAA B;  3MVD A;  3NI9 A;  3B6F A;  3W98 A;  2C5W B;  5B31 B;  1ULY A;  3IXD A;  2V1Z A;  1KX3 C;  4NK3 A;  4Z5T C;  4RX2 A;  1ZG6 A;  5CGX A;  2Y2P A;  5HAP A;  5B32 A;  3UTA D;  3ZG9 B;  4PM6 A;  3REL D;  1E25 A;  3MGS D;  3REK B;  3PBT A;  1ESI A;  3X1V C;  1MY8 A;  3GVB A;  3GSG A;  2XH9 A;  4CPK A;  3N4I A;  4XUJ B;  4OP8 A;  2J9P A;  3UN7 A;  2JCH A;  1K25 A;  1GA9 A;  3NC8 A;  2OLU A;  2XFT A;  1P3P D;  3MNN C;  5CHJ A;  4H9Q A;  3BFG A;  3M6H A;  3A1I A;  4Z66 C;  5BT1 D;  1P3G A;  3X1S A;  4MBH A;  4S2K A;  4J8V A;  5B33 D;  3VH5 A;  4XUJ C;  4R8P B;  3CZD A;  2XD5 A;  1BLP A;  5GT3 C;  1LLB A;  5EVL A;  4DQY B;  4ZBJ C;  3W97 A;  2WUQ A;  3LJA C;  3BFE A;  1JFI A;  2PU4 A;  3AZK D;  4LD9 A;  3UY6 A;  1AOI C;  1PZP A;  1K57 A;  5FUG B;  2PYO A;  1P3A A;  3Q7V A;  2P74 A;  1Z6F A;  4QB8 A;  1I2W A;  3AZM B;  5F99 A;  3NQU A;  4XZQ B;  2JSS A;  1YU2 A;  5CEC A;  2YFV B;  2XF3 A;  5CPI C;  3N7W A;  3KS8 A;  5DTK A;  3VFH A;  3VP3 A;  1S32 C;  4EBN A;  5CRF A;  3A3E A;  3AZM C;  1DJA A;  5BO0 B;  3RJU A;  4IBD A;  2HDR A;  2JBF A;  1ONH A;  3MXS A;  1ES2 A;  3UE0 A;  1P3B C;  4ZBE A;  2XEP A;  1TZY A;  4S2J A;  1KGF A;  4FD8 A;  3AZF A;  4YM6 A;  4J8X B;  2GDN A;  3W4Q A;  4PM5 A;  5EVI C;  4NYY A;  4OQH A;  4KZA A;  3OCN A;  3MGS C;  4OPR A;  3HVF A;  3KXB C;  1Q2Q A;  5B2J A;  3UTA B;  5DNM D;  4YS3 C;  4J8X D;  1SHV A;  1YQS A;  3REK D;  3AZE C;  2G5I C;  3MGP C;  4ZJ3 A;  4CSR A;  4OLD A;  4MBK A;  3REJ B;  1KX3 D;  4QHC A;  3AZL C;  2WKE A;  4Z9Q A;  4JJN B;  3G34 A;  3X1V D;  5CP6 D;  4DDS A;  5B33 B;  1I2S A;  4U3T A;  4X69 A;  2XR0 A;  3VSK A;  1MPL A;  3REI B;  3P5J B;  4J8U C;  3UE3 A;  4J8U A;  4X23 D;  4E3O A;  3MNN D;  2EX6 A;  3BRM A;  5B40 C;  4EQI A;  3AYW A;  3BEC A;  1ES5 A;  4ZUX C;  2HUE B;  3V39 A;  4NY2 A;  2WK0 A;  5CPI A;  1NJ4 A;  2BYK A;  1K56 D;  4M6B A;  3X1T C;  3C4O A;  3A6N C;  2ZM5 A;  3OZH A;  1Y54 A;  1YU3 A;  5DVA A;  3IF6 C;  3WS1 A;  4KZ5 A;  3B0C W;  4WV4 B;  4MBF A;  3IT9 A;  5AY8 A;  3B0C T;  3FWL A;  1P3M D;  1BZA A;  2WAF A;  4CAY B;  5TR7 A;  4JJN A;  1FSW A;  3UDX A;  3A3I A;  1KX5 C;  1KX5 A;  1IYQ A;  4KHA A;  1F66 A;  4GZB A;  2BYM A;  5AV8 A;  3S4X A;  1M19 D;  3PAE A;  4YIN A;  3WKJ C;  4XUJ A;  4IBB A;  3IF6 B;  5FSR A;  1P3F D;  4KZ9 A;  3GR2 A;  4N9K A;  3W97 C;  3AGD A;  3AN2 A;  1JVJ A;  4RVA A;  5FDH A;  1M18 B;  2OLV A;  4OQI A;  4ZTK A;  2IOU A;  5FAO A;  3VFF A;  4H9O B;  1K55 C;  3HLD A;  2Y2G A;  1M19 B;  4HBU A;  4H9N B;  5AV6 C;  5FAP A;  4EUZ A;  3AYW C;  3IXG A;  3X1U D;  3MVD D;  1M1A D;  3W97 B;  2ZY4 A;  1ONG A;  2ARO A;  3IQA A;  2HIO D;  5FA7 A;  3W98 C;  3MGP A;  4OQG A;  1BUL A;  5B24 D;  1M1A A;  4OOY A;  3AZJ D;  3BFD A;  5JYO A;  5AV6 B;  4DRT A;  5B2I C;  3MGP B;  4OPQ A;  3X1U B;  5F83 A;  1W8Q A;  4J8U D;  2BYK B;  2EX9 A;  4QLC B;  5B1L A;  5GXQ B;  3VP0 A;  2B5R A;  1F1E A;  3X1S C;  3KUY D;  5JRG A;  4OJP A;  3W99 D;  4Y7P A;  5CP6 B;  1HQ3 B;  4JF4 A;  4WNN B;  1TZY C;  2EX8 A;  3N8L A;  3W99 A;  4K91 A;  1E3U D;  3UT9 B;  4J8U B;  5F99 B;  3AN2 C;  5GXQ D;  2QPN A;  4ID4 A;  3GRJ A;  4LEN A;  2XFS A;  2WGV A;  1B6W A;  5A93 A;  1F66 B;  1DJB A;  1NY0 A;  3MZD A;  1OME A;  3IHB A;  1YU1 A;  1P3K A;  3WRT A;  4KUD B;  4NET A;  3HLB A;  3VP1 A;  4UHU A;  5D3O A;  3PBN A;  1P3M C;  4H9R A;  3B6F C;  3ZG5 A;  3SH8 A;  5L2F A;  5HX9 A;  3AZH A;  4OPY A;  1F66 C;  4JPM A;  2F8N K;  4WU8 B;  3WAA D;  2RL3 A;  3MKE A;  3OPH A;  3LZ1 B;  1PWD A;  2CWE A;  2NQB D;  3HRE A;  3X1V A;  5DTS A;  1P3K D;  1SCW A;  3C7V A;  1YLW A;  5GT3 A;  2F8N D;  4WU8 D;  5E5A B;  4PMA A;  1ID3 C;  1M18 D;  1FCN A;  3WS0 A;  1G68 A;  3Q82 A;  3AZI C;  3MVD C;  2J9O A;  4JF5 A;  3OC2 A;  5E2G A;  2DRW A;  1FSY A;  2XQZ A;  4G92 C;  1LI9 A;  1PWC A;  4LV2 A;  3W97 D;  4LG2 A;  5E5A C;  1P3A D;  2G2U A;  2HDQ A;  5FQ9 A;  5KSH A;  4LD9 D;  1ESU A;  2Y2H A;  4OKP A;  5AV6 D;  3O62 C;  4GN2 A;  2Y2N A;  1KVM A;  3ZCZ A;  3X1T A;  4IVI A;  1PZR A;  4NYU A;  4E45 A;  4OH0 A;  1ES4 A;  4UA7 A;  5JYP A;  5DNN A;  3AZN C;  1GA0 A;  3N3F A;  3AZL A;  1TDG A;  3A3J A;  5TFQ A;  1ZC2 A;  2Q9N A;  3B0D B;  4DRB A;  1RP5 A;  1K4E A;  2BLS A;  3LEZ A;  4MEZ A;  4XZQ D;  4QLC C;  1TEM A;  1K6R A;  1XGI A;  3MGR C;  4YM6 B;  4J8X A;  4HEF A;  4IJE A;  5EVI A;  3KFU G;  4J8W A;  4O7D A;  4Z66 D;  1TZY B;  4R8P A;  3G2Y A;  3L2A A;  3GMW A;  1P3O C;  2Y2Q A;  2F2A C;  5F99 D;  4GDN A;  3LJA A;  5GT3 D;  2F8N A;  3G31 A;  1YU4 A;  1WYC A;  2FJ7 B;  3GV9 A;  5B1M A;  3AZE A;  2J8Y A;  1KX4 C;  5KDM B;  2NZD A;  4KZ8 A;  1P3O B;  4KQR A;  5B2J C;  3VH5 T;  1P3K C;  4X55 A;  3M6B A;  1EQZ B;  4GH9 A;  5DF8 A;  4HGA B;  5GT0 A;  3AV2 C;  2NQB B;  4KZB A;  3AZM A;  4OJL A;  1BH8 B;  3VH6 A;  1K4F A;  1YLT A;  3NQJ B;  5CPK A;  4HES A;  3UDI A;  5JRG D;  4FSF A;  3LZ1 C;  4E3K A;  2PU2 A;  1BH8 A;  5G49 A;  4DF6 A;  4NZ4 A;  4K0W A;  3VP2 A;  1EQZ D;  4JLF A;  5GHX A;  4BL2 A;  1Q2P A;  4G91 C;  1KX3 B;  4KZ3 A;  5E5A D;  2JE5 A;  3A3F A;  4B4X A;  5B0Z D;  1VQQ A;  3MGS A;  1C3B A;  5JRG B;  3OPP A;  5B1L B;  3X1V B;  5CEB A;  3AZE D;  4YS3 B;  4LV3 A;  5B1M C;  5AV8 D;  5HL1 A;  4E3M A;  3WX7 A;  4X23 B;  3MGQ C;  2E8I A;  2RVQ C;  5B32 D;  1R4V A;  3FZC A;  3V9R A;  2Y91 A;  1O7E A;  1EWZ A;  3DTM A;  3IWQ A;  3IH8 A;  2RCX A;  4ZAM A;  5B0Y A;  2ZJ9 A;  5DNM C;  5DNM A;  4KUD A;  1QME A;  1IKG A;  3V3R A;  4X23 C;  1S32 A;  4S2N A;  1HZO A;  3G30 A;  3ZFZ A;  2H5S A;  4R8P D;  3REI C;  2V20 A;  4KZ6 A;  3FKW A;  2C6W B;  3REH D;  4KGC D;  4J8V D;  4OJ6 A;  3ZDJ A;  4IVK A;  3R45 A;  4NZ5 A;  5M1A A;  4DXC A;  2HUE C;  3IP4 C;  1TAF B;  3AZK B;  2HP6 A;  3MZF A;  4QLC D;  4DDY A;  3REH B;  1JWV A;  4GD8 A;  5A92 A;  4NE3 A;  1P3G D;  1LL5 A;  5I94 A;  1RCJ A;  4LV1 A;  3TU4 A;  4ZUX D;  5B31 G;  5AV6 A;  1XXM A;  3O88 A;  5B32 G;  4C3Q A;  2Y2L A;  3G2Z A;  4WU9 B;  2FFF B;  3AV2 A;  1L0F A;  2QZ6 A;  4LV0 A;  4Z2M G;  5B0Y C;  3IF5 A;  4KQO A;  4R3J A;  2Z2M B;  2ZY3 A;  1N1J B;  3L29 A;  3MNN A;  1EQZ C;  3P98 A;  3CJM A;  3VP4 A;  3C1C B;  4LCM A;  3C1B A;  2HIO B;  2NQB A;  2XK1 A;  4H9P A;  3MGR A;  4AWL C;  4N1H A;  1GHI A;  1K54 A;  2DNS A;  4KQQ A;  3C4P A;  2RIQ A;  5AV9 A;  4R23 A;  4GHA A;  1YMX A;  1P3O A;  3MFD A;  1M19 C;  3AV1 A;  4OLG A;  3AZE B;  4UA6 A;  3BEB A;  4EWF A;  5BNX B;  3WA9 A;  2RVQ D;  2HP5 A;  3NDE A;  3KS4 A;  2F8N B;  4ZUX A;  1W5D A;  1TDL A;  1MWT A;  5BNX A;  3EQV A;  5GSU D;  5HAR A;  5AVC B;  3BFF A;  4DE2 A;  3HLW A;  3WTP C;  5AVB D;  5EVI B;  3B6G D;  3MGQ B;  2HP9 A;  1FCM A;  1ZLA A;  3JYI A;  3KUY C;  4R4R A;  1M1A C;  3N8R A;  3KXB D;  4B4Z A;  3IH9 A;  1P3I A;  4RX3 A;  5CP6 A;  3UTA C;  4JJN C;  2J7V A;  5B31 C;  1FQG A;  1YU0 A;  3VH6 T;  5EPH A;  3EPL A;  3IWI A;  4KGC B;  3IWO A;  4IED A;  3MNN B;  5KMW A;  2CV5 D;  3AFA A;  1WWI A;  3Q1F A;  1ALQ A;  1P3P C;  4R8P C;  3V50 A;  3ZVT A;  1MWU A;  4NE5 A;  5B33 C;  3O86 A;  3PAG A;  1DJC A;  1PW8 A;  3MBZ A;  4EBP A;  3G32 A;  2EFX A;  2F8N G;  1Z2C B;  5CGW A;  2ARO C;  1K56 A;  4H9N A;  1P34 B;  3KXB A;  1K57 C;  2WAE A;  3W96 B;  4C75 A;  2H0T A;  3AZN A;  4ZBJ B;  1KGE A;  3WS5 A;  4GD6 A;  3O62 A;  4IBI A;  2DQN C;  3A6N B;  1KX5 B;  2X01 A;  5CPI D;  1M18 C;  4BLM A;  5DNN D;  3LZ1 A;  3E2K A;  4DKI A;  3HUN A;  1P3F B;  3OPL A;  3C1C C;  5CPK D;  3WA9 D;  2Y2J A;  3OCL A;  4IJF A;  4B88 A;  1MWR A;  1MWS A;  2ZQC A;  3REJ D;  4ZJ1 A;  1ES3 A;  3MXR A;  4H8R A;  1P3A C;  4BD1 A;  5U47 A;  3AFA B;  1NYY A;  5CHU A;  4J8X C;  1S6R A;  5AVB C;  5GSU B;  3B6G A;  4YS3 A;  1BSG A;  4OVD A;  3EPJ A;  1M19 A;  5B24 B;  3O62 B;  3HON A;  3MGS B;  4UAA A;  2WAD A;  5EOO A;  1GHM A;  3WS4 A;  1GCE A;  3ZG8 B;  3AZN B;  2Q9M A;  1M6K A;  1P3I C;  1JTG A;  1HQ3 A;  3AZG B;  4YS3 D;  4X68 A;  1FOF A;  3KUY B;  3KXB B;  5AV8 B;  3W98 B;  1W8Y A;  1JFI B;  3AL0 C;  3X1U A;  4YM6 C;  5EUA A;  1N9B A;  3AZL D;  5AQB A;  3A1K A;  3S1Y A;  4WZS B;  1P3M B;  2IO5 B;  4J8W C;  3W4O A;  3DWK A;  5AV9 C;  3AZH D;  2FJ7 C;  1NZU A;  1RGZ A;  1XGJ A;  3A6N A;  1H5X A;  5JA4 B;  1U35 D;  1HD8 A;  5CPJ D;  3AN2 B;  2IO5 C;  4BQM A;  4Q8I A;  5B40 B;  1XX2 A;  3UTB C;  2NZD C;  4WU9 A;  5DNN C;  5FAQ A;  5GHY A;  4JXG A;  1BFM A;  3A6N D;  5B1L D;  4KG5 A;  2ZC3 B;  5CPK C;  3TU4 B;  3B3X A;  5AY8 C;  1L0D A;  5EEC A;  1U35 B;  4N1X A;  4QY5 A;  3MVD B;  1CK3 A;  3WA9 B;  3HBR A;  2HPB A;  3TG9 A;  1TVF A;  5DNN B;  1KE4 A;  4G92 B;  1S32 D;  1H3O A;  2Y2O A;  5C3I B;  1XPB A;  5FQJ A;  2ZC7 A;  5HW3 A;  5FAT A;  1KVL A;  3C1C D;  4EV4 A;  5CED A;  4P0M A;  1ERM A;  3LZ0 C;  3BM6 A;  1P3A B;  3Q7V B;  4NZ1 A;  1P3B D;  4LD9 B;  2HDS A;  5C3I C;  1HQ3 D;  1H8Z A;  3AGF A;  3WTP A;  4C6Y A;  4WJ3 C;  3AZG D;  4GOG A;  1P3L A;  2Y4A A;  4R1G A;  3V9R B;  2IWD A;  3SS4 A;  5B32 C;  4WEK A;  2VGJ A;  3WWX A;  1P3G B;  3B0D C;  4WEJ A;  3NBL A;  4WMC A;  2WKI A;  4ZJ2 A;  3LJA D;  4IBJ A;  2P9V B;  5AV5 C;  1DY6 A;  3ZG7 B;  2WKH A;  3AZK C;  1TAF A;  3AZK A;  3REK A;  3BLS A;  5CER A;  1KX4 B;  4Z66 A;  1P3G C;  3LEL B;  2Y59 A;  3AZF C;  5BS7 A;  1ZLA D;  1P3P A;  5CTM A;  1P3K B;  5FUG A;  2PYO B;  5AV5 B;  3ZVW A;  4A5R A;  2NZD D;  3UNW A;  5FQQ A;  1T3U A;  5GSU A;  5B40 D;  3AZH C;  1NZO A;  3AZF B;  3LEL D;  5B0Y B;  1YUE A;  5CPJ B;  2ZM0 A;  4E3L A;  3TSG A;  2PYO C;  4K0X A;  1MBL A;  1JWP A;  5KSC A;  5TGF A;  2NZD B;  5FQI A;  4IBX A;  4X23 A;  2BG1 A;  5GLD A;  4QLC A;  4Y0O A;  1N4O A;  4KUD C;  5BO0 A;  5CHL B;  3S22 A;  3FYZ A;  5AVC D;  3I7J A;  3NDG A;  5EVI D;  4S2N C;  3SS5 A;  1XA7 A;  5AY8 D;  3PBO A;  3R45 B;  4F94 A;  2ZLY A;  4LCL A;  4N92 A;  3KWQ D;  4S2O A;  4RA7 A;  1KX5 D;  3UDF A;  1EI5 A;  5JRG C;  3H0L C;  1H8Y A;  5GLC A;  3REK C;  1XKZ A;  4GNU A;  1P34 A;  3W8K A;  4L0L A;  2CV5 B;  2I72 A;  4Z5T B;  3AZJ B;  3L28 A;  1ERQ A;  4ZDX A;  2ZC4 B;  4D2O A;  3LZ0 D;  5B0Z C;  4Z66 B;  4N9L A;  4EO5 B;  3AZI B;  2ZD8 A;  3IF6 A;  5KDM A;  4U0X A;  2YFW A;  2ZY2 A;  4H9S C;  5B1M B;  4JBF A;  3OPR A;  4KZ7 A;  1Q9C A;  3REL C;  3LJA B;  3MZE A;  1P3L C;  2WZZ A;  4DE3 A;  1P3O D;  5BPV A;  3QNB A;  1YLJ A;  5E43 A;  3KWQ A;  1JWZ A;  1M40 A;  3IHA A;  2H10 A;  1ZLA B;  4DRA A;  2PBY A;  3G4P A;  1CI9 A;  4XZQ C;  5DF9 A;  5B40 A;  2Y2I A;  5BNV B;  4S2M A;  1KX4 D;  1RGY A;  5AVC A;  3C5A A;  4GDB A;  5JA4 A;  5CPI B;  1AOI B;  4XUJ D;  3W96 C;  2ZY5 A;  2PYO D;  4KZ4 A;  4NE6 A;  2ZM2 A;  3ZNT A;  1WWS A;  3HLF A;  4IBK A;  1YT4 A;  1KX4 A;  5M18 A;  4JXV A;  3AZH B;  2R9W A;  3AFA D;  3LZ1 D;  4QJG A;  1AOI D;  3WKJ D;  4H9R B;  2ZQD A;  2ZQ9 A;  4UPK A;  1P3F C;  3HSH A;  2G2W A;  3UO9 A;  1VM1 A;  2IWC A;  2V2F F;  4XUX A;  1ID3 A;  3VMA A;  3WAA C;  1KE3 A;  5G18 A;  3D4F A;  1N1J A;  1MXO A;  3ZHH A;  4JXS A;  3AV2 B;  2NQB C;  4PM9 A;  4M3K A;  1YLY A;  3WTP B;  5A90 A;  2ZQA A;  2HIO C;  3KWQ B;  1O07 A;  4GKU A;  3LZ0 A;  5B24 C;  3A3D A;  3REJ C;  5B24 A;  1K55 A;  3O3V A;  2VQR A;  3QNC A;  5AQA A;  3Q07 A;  4UUZ A;  5F82 A;  3UPO A;  1ID3 D;  3AZL B;  3B6G B;  5KZH A;  4PPR A;  1YM1 A;  1P3M A;  1FR1 A;  4WU8 A;  3ITB A;  1BH9 B;  1M1A B;  2L5A A;  3O87 A;  5AV8 C;  4DE1 A;  5B2I A;  3H0R C;  4S2P A;  1PWG A;  1P3F A;  2CV5 A;  1U35 A;  3IXH A;  5CTN A;  3H0M C;  3MGP D;  3WTP E;  4R0Q A;  3AN2 D;  1IYP A;  5EE8 A;  1P3P B;  5DNM B;  2X71 A;  3W99 B;  2DF4 C;  3EPK A;  1BUE A;  5GT3 B;  4KGC C;  4NZ3 A;  3X1T D;  3W96 A;  1P34 D;  1IEL A;  3HLC A;  4WM9 A;  3FDD A;  3UT9 D;  3UPN A;  4CAY A;  5IHV A;  4OOL A;  2X02 A;  1W79 A;  3WKJ B;  1KDS A;  4WU9 C;  2ARO B;  1BLH A;  1K6S A;  3VOY A;  1P3B B;  3LCE A;  3SH9 A;  3AFA C;  1E3U A;  4WMC D;  2HDU A;  4H9O A;  3SH7 A;  4OON A;  1HTA A;  4YFM A;  1M18 A;  1KE0 A;  4BEN A;  4PM8 A;  3UT9 A;  4P87 A;  5GLB A;  3LEL A;  4U0T A;  4Z2M H;  2Y2K A;  4R4S A;  4BD0 A;  3BYD A;  4OPZ A;  2IWB A;  3REI A;  4LD9 C;  3WTP D;  2WZX A;  5B33 A;  3UPP A;  3EG5 B;  3AGE A;  3QHY A;  3AZG C;  5A91 A;  1YLZ A;  5BS7 C;  3WRZ A;  3AZN D;  3F6T A;  4MLL A;  4QY6 A;  4IBC A;  2ZMA A;  3REJ A;  5CP6 C;  2Y55 A;  5GSU C;  2OSU A;  3WS2 A;  3NCK A;  3X1U C;  1G6A A;  1LL9 A;  3TOI A;  4Z5T D;  3UTA A;  4JF6 A;  4WBG A;  3PBQ A;  2ZC6 B;  3CMZ A;  5FQK A;  3AZF D;  1P3I B;  4UA9 A;  4GB7 A;  4E3I A;  3UT9 C;  1QMF A;  1S0W A;  3ZGA B;  3X1T B;  3NY4 A;  2FFY A;  2J8P A;  3LO7 A;  3X1S D;  3W99 C;  3UTB B;  4EBL A;  2BYM B;  3RXW A;  1TZY D;  4ZUX B;  2ZQ7 A;  2WGI A;  4BL3 A;  2F8N H;  5GHZ A;  3TU4 C;  5AY8 B;  1U60 A;  1J9M A;  3E2L A;  4BJP A;  4WU9 D;  3CG5 A;  1P34 C;  2ZQ8 A;  3BLM A;  3G35 A;  3P09 A;  5AV9 B;  4XXR A;  2FJ7 D;  2YFV A;  4JKT A;  3V3S A;  5E5A A;  1KGG A;  4X6T A;  1L2S A;  5F1F A;  5HFO A;  1U35 C;  1NRF A;  1K38 A;  3C1B B;  3B6F D;  3C1C A;  3PBS A;  3VOZ A;  1S32 B;  1PI4 A;  4OUI A;  3LZ0 B;  1F66 D;  1P3B A;  4WZ5 A;  5E2H A;  4S2L A;  4NFT A;  1W2E A;  4IBE A;  5DF7 A;  4KUD D;  1IEM A;  3AZM D;  3W4P A;  1W7F A;  3C1B D;  1FR6 A;  5B1M D;  4FCF A;  1CI8 A;  2LY8 A;  3W98 D;  2A3U A;  1LHY A;  4X53 A;  1YLP A;  4IBG A;  4P85 A;  4QD4 A;  5FI7 A;  5AQ7 A;  3HLG A;  3AZJ C;  4H9Q B;  4PM7 A;  5AVB B;  4DXB A;  3UTB A;  5J8X A;  3KUY A;  2YFW B;  1WYB A;  1MKI A;  1XA1 A;  4CSR B;  3M2J A;  4JXW A;  3AZG A;  5EOE A;  1P3L D;  4E6W A;  3NQU B;  4H9P B;  4FH4 A;  3MGR B;  3SOI A;  2XLN A;  4OQ0 A;  5B32 B;  1HQ3 C;  4WNN A;  2CC1 A;  3ISG A;  1L0E A;  4FH2 A;  2ZC5 B;  1P3I D;  3NQJ A;  1SDE A;  5GXQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...