2Y2NA

Penicillin-binding protein 1b (pbp-1b) in complex with an alkyl boronate (e07)
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
488
structure length
468
Chain Sequence
ISEITYSDGTVIASIDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTGQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Guided Design of Cell Wall Biosynthesis Inhibitors that Overcome Beta-Lactam Resistance in Staphylococcus Aureus (Mrsa).
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
molecule keywords PENICILLIN-BINDING PROTEIN 1B
total genus 160
structure length 468
sequence length 488
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2y2nA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2y2nA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2y2nA02
1ALQA 3PAEA 4Q8IA 3GTCA 3FYZA 1H8YA 2C5WB 1W8QA 3GV9A 4U3TA 2WKHA 2ZC5B 1ZKJA 3HREA 3NC8A 4GDBA 5FQJA 3WRZA 3IXGA 2QZ6A 5GHXA 3WS0A 4OKPA 5HX9A 2A3UA 4KZAA 1YQSA 4PM9A 3LO7A 5GLBA 4S2KA 3UPOA 3IWOA 4EQIA 4LV2A 1ONHA 3V39A 3LEZA 4OPQA 3E2KA 2XDMA 2EX9A 1IEMA 4JBFA 3TOIA 3PBSA 4QD4A 4ID4A 1MWTA 1JWPA 4WZ4A 1MWSA 5FQIA 4DF6A 1SDNA 3NIAA 5KSCA 1Z6FA 3S22A 1E25A 4WZ5C 1PI4A 2ZM8A 4KZ4A 4JLFA 3IXHA 3UDIA 4MBHA 1NYYA 4E3IA 2EXAA 4GD6A 1TEMA 4BD0A 1K54A 1JTGA 3A3FA 4OPYA 1BSGA 3N8SA 4M3KA 3QNBA 5F83A 3SH7A 4EWFA 3MBZA 1K4FA 3UDXA 3LCEA 1FOFA 4PM6A 1I2WA 4UA9A 3ZCZA 5AQ9A 5DVAA 1Y54A 4HBUA 1RCJA 3GSGA 4OQIA 4OOLA 4Y0OA 2Y2IA 1BULA 1FCMA 2P9VB 5A92A 2RCXA 3GQZA 4FCFA 1W5DA 1EI5A 3G34A 3GVBA 4WBGA 1L0EA 2R9XA 5EPHA 2X02A 5JYOA 1IKGA 2P74A 1JWZA 4R0QA 3C4PA 3ZVTA 4E6XA 1XP4A 2FFYA 2BG1A 4DRTA 3OPRA 3Q81A 4BLMA 3BFFA 2QMIA 3ZG7B 1YLPA 5EVIA 4DDSA 5E43A 1YMXA 3ISGA 4E3NA 1K56A 3VP4A 4XUZA 1M6KA 1MXOA 4GOGA 1PWCA 1K4EA 5A91A 3SS5A 5HAIA 3C7VA 5FASA 2HDUA 2XFTA 3MKFA 1PYYA 4Y0UA 4F94A 1K56D 3JYIA 3IHAA 4Y7PA 1YLYA 5FI7A 1VQQA 5HFOA 3FZCA 4R23A 5DTSA 1E3UA 3HLDA 3VSLA 2ZQ8A 1K55C 3LY4A 2G2UA 3BFEA 1LI9A 2WADA 1W79A 4KZ6A 4KQQA 2Y2QA 4DE2A 2Z2LB 1KDSA 3DW0A 1PW8A 3IWIA 2HP5A 4XXRA 3ZGAB 4EBNA 3MZDA 5EE8A 1H5XA 1ES4A 3IH9A 4WMCD 1E4DA 1HZOA 4KQOA 5DTKA 1EROA 1PI5A 5E2GA 4KZ8A 5FQKA 4GZBA 4ZAMA 3MZFA 4WELA 3OPHA 4N1XA 4OQHA 2ZM2A 4ZJ1A 1G6AA 3O3VA 1BLSA 3BYDA 5GLDA 2XQZA 1G68A 3IF5A 4X6TA 1RP5A 5EVID 3O86A 4QJGA 2PBYA 4E3LA 2WGVA 4GDNA 2Y2JA 3HUNA 1XGJA 3CZDA 3DWKA 1TDLA 3BFGA 5D3OA 1MY8A 5E2HA 5FQMA 5HL1A 2ZQCA 3EQUA 2WZZA 4DXBA 1BLPA 1NRFA 5HARA 4HESA 5M19A 2I72A 4ZJ2A 2HDRA 3CG5A 3Q1FA 4BD1A 4JXVA 4DE3A 4BJPA 2A49A 2ZD8A 2ZQ9A 3WWXA 2XD5A 3WS2A 4C75A 1WYCA 1K57A 5GHZA 1E3UD 5L2FA 1QMEA 4OLDA 5EOOA 5CTNA 2JE5A 1IELA 1KE0A 1VM1A 4S2JA 1NZOA 5HW3A 1DJAA 1PZPA 3IF6B 1L0FA 4R3BA 3W4QA 4X69A 4MEZA 1S6RA 2ZC7A 3G4PA 4KZ9A 1N4OA 4PPRA 1KVMA 4GKUA 1XGIA 4JKTA 4DE1A 5KMWA 4LENA 4S2OA 1GHMA 2OSUA 2FFFB 4UAAA 5FQ9A 1NYMA 1EWZA 4OLGA 3VP2A 1SKFA 4WZ5A 2IWCA 4R3JA 1CEGA 5FI6A 3ZHHA 2C6WB 4U0XA 4JXGA 3UE3A 2Y2HA 3OZHA 1LL9A 3VMAA 1H8ZA 3MXSA 4DKIA 4IBXA 1PW1A 3UN7A 5CEDA 3ZG0A 2WKIA 2V2FF 3O87A 4LV1A 4ZTKA 4OONA 1L2SA 2JC7A 3VP1A 2H0TA 3PBTA 3IXDA 1WYBA 4YINA 3ZFZA 4GD8A 1XXMA 4RA7A 4FH2A 1HD8A 4ZBEA 4EV4A 1PWDA 5A90A 1TVFA 3OCNA 3OC2A 4JF4A 4IVKA 5DF8A 5CTMA 5EECA 4JPMA 1OMEA 3AGEA 3BECA 3ITBA 3QHYA 3LY3A 4BENA 4JF6A 5CXWA 2JCHA 1SHVA 5F1FA 1DJBA 2G2WA 4K91A 4OP8A 3N8RA 5FQQA 4DDYA 4P87A 2Y2GA 3IH8A 4OPZA 1DY6A 1ESUA 1YM1A 5GLAA 1ZG4A 4S2PA 3SS3A 3SS4A 3WS4A 2EFUA 4S2NC 1JTDA 5DTTA 3C7UA 3SH9A 5U47A 3G35A 3V3SA 2ZQ7A 1JVJA 3G30A 3IT9A 4MBFA 2VGJA 3IF6C 5GHYA 1K38A 3ZG9B 4C3QA 4C6YA 1XPBA 4WEJA 2HP6A 4IEDA 2EXBA 2Y91A 1ONGA 3FKVA 1YLTA 3PBRA 1J9MA 1W8YA 5TR7A 2GDNA 2HDSA 3NY4A 4NK3A 2WUQA 2Y2NA 4BL2A 3M2KA 2X71A 4ZDXA 4LCLA 5EVLA 3M2JA 4LCMA 3VSKA 3IQAA 4ZJ3A 2EX6A 4PMAA 1BTLA 2QPNA 4RYEA 1QMFA 2XGNA 4OOYA 3A3EA 3UPPA 1FSYA 3ITAA 4JF5A 5FAOA 5F1GA 3HLBA 4GN2A 3V50A 3IXBA 3HLGA 4E6WA 1BLHA 3W8KA 3N4IA 3E2LA 1YLJA 4P6BA 3UE1A 3VP3A 3G32A 3HLEA 5E2EA 1IYSA 4BQMA 2IWBA 1XA7A 3UO9A 1YMSA 2ZM0A 4GNUA 2XFSA 3HL9A 2ZC3B 3NDGA 1XA1A 4PM7A 5CRFA 4X56A 5FATA 3DTMA 1W7FA 5CGXA 3HVFA 2J9PA 2H0YA 4A5RA 3BLMA 4E3KA 3RXWA 3PTEA 2RL3A 1FQGA 5G18A 3ZNTA 1GA0A 1ZG6A 2ZLYA 1TDGA 1K6SA 5TFQA 1ZC2A 5KZHA 1CK3A 4LV0A 4FSFA 1XKZA 3MZEA 5FA7A 2B5RA 4OVDA 3PBNA 3ZG8B 5EOEA 3S4XA 4Z9QA 3A3IA 4MLLA 4X68A 2OLUA 4PM5A 1HTZA 4IBRA 3N8LA 4MNRA 1NXYA 3IHBA 3BM6A 2Q9MA 3Q07A 2EFXA 1CEFA 3N6IA 2Y4AA 4RX3A 3S1YA 1MBLA 3BFDA 1IYQA 4H8RA 4N92A 1YLWA 4K0WA 3UPNA 5CGWA 3G31A 1KE3A 3D4FA 4IVIA 4WYYA 2EX8A 1K6RA 3Q7VB 2WGWA 2H10A 2V1ZA 2WZXA 2JBFA 1GHPA 1FSWA 1K54C 4S2MA 4E3MA 1WE4A 1GCEA 5CERA 3BRMA 3ZG5A 5HAPA 1KGFA 5DF9A 2HPBA 3N7WA 1CI9A 4X53A 4S2LA 2Y2KA 2Y2LA 4QY5A 3DWZA 5CGSA 4S2NA 1BT5A 3GRJA 2WGWB 4LV3A 4N9LA 2WAEA 2VGKA 3B3XA 2ZMAA 1NZUA 1U60A 4EBPA 4QB8A 3FV7A 4KZ5A 5FSRA 1PWGA 1PIOA 4KG5A 1KDWA 3RJUA 3HLWA 4OH0A 3G2YA 3BLSA 1ESIA 3SOIA 1RGYA 3PAGA 1I2SA 1FR1A 2P9VA 5CHJA 3TSGA 2R9WA 3FWLA 2ZQDA 4QHCA 5IHVA 4P85A 4OQ0A 4RX2A 3A3DA 4WEKA 4K0XA 5M18A 1PZOA 5GLCA 3W4PA 5EVIC 3IWQA 3RXXA 1KVLA 1IYOA 1KGGA 1AXBA 1C3BA 5JYPA 3GR2A 2H5SA 1NJ4A 1LI0A 3HLFA 2XR0A 3OPLA 5I94A 5KSHA 3SH8A 2ZC4B 3AGDA 4UHUA 4WMCA 5FAPA 3UE0A 3A3JA 1FR6A 3IF6A 4JXWA 4DXCA 1GHIA 1NY0A 1GA9A 1ERQA 2DCFA 4YFMA 1L0DA 1FCOA 5CHMA 1XX2A 3EQVA 3QNCA 1BZAA 4PM8A 3UNWA 1KE4A 2UWXA 4D2OA 1MWUA 3P98A 3WRTA 1CI8A 2Z2MB 2ZJ9A 3VOZA 1ERMA 3OPPA 2CC1A 2DRWA 1MPLA 2XK1A 4X55A 2X01A 4UA6A 3AGFA 2J8YA 5HAQA 2Y2PA 1JWVA 3Q7ZA 3C4OA 2WYXA 4UA7A 3VFHA 4OOMA 3BEBA 5E2FA 4EBLA 4B4ZA 5FAQA 1Q2PA 1SCWA 3O88A 4U0TA 2DNSA 3VFFA 4QY6A 5AQ7A 2WAFA 4KZ3A 2WK0A 2J9OA 1ES5A 1O7EA 4R1GA 4Y0TA 4FH4A 4E3JA 1Q2QA 2ZQAA 3HBRA 4OPRA 4QU3A 2Q9NA 1SDEA 1K25A 3M6HA 4KG6A 2E8IA 1ES2A 4N1HA 3UY6A 3ZVWA 5DF7A 2BLSA 1HVBA 2Y2OA 1LL5A 4P0MA 3NBLA 2Y59A 4NETA 5M1AA 3CMZA 3NDEA 5CEBA 2Y2MA 1LLBA 5GL9A 5BOHA 1MKIA 1N9BA 1FCNA 4JXSA 2HDQA 5FI2A 1LHYA 4L0LA 3HUMA 4OP5A 1DJCA 1K57C 2PU2A 1L0GA 1YLZA 4KZBA 3HUOA 4R4SA 1IKIA 4XUXA 3TG9A 2XD1A 3HLCA 1IYPA 2V20A 5FDHA 2OLVA 3MXRA 5CECA 4B88A 5F82A 5TGFA 2WKEA 4O7DA 4EUZA 5EUAA 5CHUA 4HBTA 2OV5A 1KGEA 4CPKA 3Q7VA 4RVAA 3V5MA 3VOYA 1O07A 3ZDJA 5A93A 5AQBA 4N9KA 3NI9A 1MWRA 3GMWA 3OCLA 2Y55A 4FD8A 2XLNA 4WM9A 4KG2A 4S2IA 3PBOA 4CJNA 4B4XA 1S0WA 2XF3A 3UDFA 3M6BA 4R4RA 3ZNYA 4BL3A 2IWDA 1M40A 3P09A 4DE0A 3BFCA 5EVIB 4E3OA 4OQGA 4GB7A 2HP9A 3WS5A 3PBQA 2PU4A 1BLCA 1I5QA 3V3RA 1ES3A 3G2ZA 4KQRA 5J8XA 5AQAA 4HEFA 4KENB 4MBKA 1K55A 2XEPA 3Q82A 3WS1A 3MFDA 3MKEA 2EX2A 3FKWA 3W4OA 3VP0A 2J7VA 3C5AA 2WGIA 2ZC6B 4KZ7A 3NCKA 2XH9A 1BUEA 3CJMA 1YT4A 3I7JA 1RGZA
chains in the Genus database with same CATH superfamily
1ALQA 3WAAA 1W8QA 3GV9A 5B2IB 3B6GB 2ZC5B 1ZKJA 3NC8A 4L9GA 4GDBA 2QZ6A 4QLCC 5HX9A 4KZAA 5B31G 3E4OA 3C1CD 4S2KA 3HJIA 4LV2A 3LEZA 4OPQA 2ZM5A 1P3PA 3MMHA 2W1TB 4JBFA 3TOIA 1E88A 4EEUA 1MWSA 5GXQD 5CPKC 2FZ0A 5KSCA 1Z6FA 3S22A 4L9EA 4Y5FA 4WZ5C 3GECA 4G91C 4KZ4A 5BO0A 4MBHA 1KX4D 3AZKD 3KFUG 1TEMA 3LR0A 3TJZC 1KX5D 3QNBA 2YFWB 5B0YA 1F9IA 4NZ5A 1FOFA 3LZ0A 3IX3A 5AQ9A 3AZGC 3WAAD 4HBUA 3LR3A 4Y0OA 3GQZA 2ZL1B 1W5DA 1EI5A 2YKFA 3G34A 4FOFA 1L0EA 4EETB 2R9XA 3CITA 3REKC 1ID3A 1IKGA 3T50A 2ZMVA 4Z1WA 1P3GC 4E6XA 4J8WA 5AV9B 4NKPA 4WU8C 2K31A 3OPRA 1YSPA 2HZ5A 5FL3A 3WKJB 4WJ3C 5GXQA 3WTPD 3F1PA 4XUZA 3UTBC 4GOGA 3AZMA 3V67A 3SS5A 3MGPA 3C7VA 1EW0A 5HAIA 2V1AA 5B1MB 3MKFA 4F94A 1OTIA 1P3KB 1YLYA 1F66B 3AV1A 5DTSA 4DRAA 4JGOA 3VSLA 2ZQ8A 2VQRA 4FTXA 2D01A 2Y2QA 3CUEC 2Z2LB 3QP6A 5HD3A 3EEHA 1PW8A 3IWIA 2HP5A 3MZDA 1H5XA 2A24A 4LD9A 3OPHA 4N1XA 3AZHA 3X1SC 4OQHA 3T4QA 1AOID 3T1SA 4ZJ1A 3IF5A 3H0LC 5EVID 1P0ZA 2PBYA 3AZJA 1XGJA 3DWKA 2MJ6A 5D3OA 1MY8A 1TF1A 1ZLAC 5AVEA 1BLPA 2RIQA 5B0YB 3X1SD 5B2JD 3BW6A 5TBMB 4HESA 5M19A 5CX7A 2HDRA 1P3ID 3Q1FA 1VHMA 4KUDA 5DNMD 4OJLA 3E0YA 2XD5A 4C75A 5L2FA 3UTBD 1QMEA 4ESPA 4JJNB 1MKMA 4QLCA 1KE0A 5HW3A 3W4QA 4X69A 1HQ3A 2NQBA 1N4OA 2FN2A 1MZUA 4JGRA 2VKSA 4X1MA 5AVFA 5L8MA 1DRMA 3MQQA 3AL0C 2IWCA 1M1AB 4Z5TC 4JXGA 1DP9A 2Y2HA 3AZKB 3OZHA 3PR6A 4HNBA 5DKKA 4IBXA 3ZG0A 3MGRB 5CPJA 3C1BA 3FKEA 4Z5TB 1KX5C 4H6JA 3LJAD 1VEUA 4NZ4A 5CPID 3VP1A 4M6BA 4H9SA 4ETZA 3UT9B 5EFWA 4EV4A 4FH2A 1W2EA 3KXBA 3MGSB 1TVFA 3OCNA 3B0CT 2K2NA 4IVKA 4JF4A 4J8XC 4XZQB 5EECA 4X23B 3AGEA 3QHYA 3ITBA 4HMCA 2NUTC 1HQ3D 2NQBD 5F1FA 1K0KA 4J8XD 2QYBA 4K91A 5AV9D 3E4QA 3IH8A 4DMZA 5BT1D 5GSUD 1YM1A 1KX4C 4QLCD 4S2PA 5LBRA 3N3FA 5U47A 4C3QA 4BWIA 1GSWA 5BT1C 5DNND 1XPBA 3D72A 2HIOA 4NYYA 3B33A 4BBVA 2E8JA 3FKVA 1P3BC 3NQUA 4WU8B 5TR7A 2GDNA 3C1CC 2HDSA 3NY4A 1PNEA 1XJ2A 2JKRM 5J3WA 4BL2A 4G3KA 1TS8A 4TX8A 4LCMA 5GT0A 1HLUP 4HI4A 4CAYB 1XJ4A 5DJTA 3A1IA 3ITAA 4JF5A 2DF4C 3LICA 4BBUA 3RTYA 1SKOB 3WD2A 1P3LD 5EM1A 3HLGA 1BLHA 3U4LP 4Z5TD 2L4RA 1P3IB 4WNNB 3T1QB 3VP3A 1CQAA 3F1OA 3S7OA 3K3CA 1H8PA 3LIDA 3HL9A 3NDGA 5FATA 3DTMA 2VV6A 4IBCA 3PTEA 1ZLAD 1FQGA 5G18A 4GH9A 1TDGA 4J8XB 5B2JA 5TFQA 4FSFA 1XKZA 3LELA 5L09A 2B5RA 3T12B 3AV2A 2VV8A 2QWSA 4J8UA 2EFXA 3N6IA 2GX5A 2Y4AA 4RX3A 1YU0A 5B2JC 1MBLA 3S7QA 3BFDA 1P3LA 2K7SA 1YLWA 3UPNA 4IBDA 5CGWA 5B40C 1K6RA 3AFAA 4Y3IA 2H10A 5GT0D 2ZY4A 1GHPA 1WE4A 4Z2IA 1M1AD 1GCEA 3BRMA 3W98A 3AZIA 5CGSA 4S2NA 5AVBB 5GT3B 3TE8A 3AFAB 5J4EA 4EBPA 4KZ5A 3W99B 1PIOA 5HWTA 4OH0A 5J7EA 4UPKA 3V9RB 3SOIA 1RGYA 3PAGA 4ZRRA 1P3AB 1FR1A 5CHJA 5B24B 5DNNB 4DJ3A 3FWLA 4QHCA 1STZA 4J8UB 4Z2JA 4WEKA 4EUVA 4K0XA 5M18A 1PZOA 2PYOA 1KVLA 4KUOA 4Y13A 1IFQA 3OPLA 4ZUXB 2ZC4B 3AGDA 4WMCA 3MGRA 4I3AA 5BPVA 1CF0A 1GA9A 5CHMA 5F6AA 1XX2A 3EQVA 4D2OA 1KE4A 4QNLA 3VOZA 1ERMA 3R7WA 2HUEC 2DRWA 2XK1A 3B47A 4XUJC 3KSHA 3W97C 1M18A 1M19B 3VFHA 5GXQC 5B1LD 1TS6A 5CPJC 3WAAC 3AZGD 1Q2PA 4NZ3A 3W2ZA 4IBKA 3AN2A 3R45B 4QY6A 3F6TA 4JJNA 1D7EA 3WKJD 4Y0TA 4JGPA 1BYWA 4KQDA 4Z2MH 2Q9NA 3NQUB 3P7NA 2E8IA 2LB9A 4Y17A 4N1HA 4WLAA 3UY6A 3AZMD 3ZVWA 3X1UA 3NBLA 2Y59A 3CWFA 4IUKA 1GSXA 4AFIA 4ZBJC 3NDEA 3TU4D 4NE3A 5BOHA 1ID3B 1YU1A 1H8MA 4JXSA 1FCNA 4PKYG 5FI2A 5AV5D 3KSYA 1L0GA 1Z2CB 1IKIA 4R6LA 3KXBB 2JN7A 3LZ0B 3TG9A 2O99A 3UT9A 5I5LA 5CECA 2Q0OA 2L1MA 2J3TC 2WKEA 5AVCC 4H9RA 1XFQA 4GS9A 4ARZA 4CPKA 3AZNC 1KGEA 3V5MA 4B93A 4YS3A 1P3KA 5AQBA 4F3LB 1MWRA 3AZKA 2Y55A 3RELD 3EWKA 4FD8A 4CJNA 3MNNB 4H9RB 3REID 5FUGB 1M40A 5GT3D 2FJ7C 3LIEA 5AV6A 1ES3A 1AIWA 5TJJA 2ZY2A 2W0NA 5J8XA 3H7WA 4HEFA 4WU9C 3Q82A 4KENB 4MBKA 3PHYA 3MXQA 3FKWA 3F1NA 2UV0E 2WGIA 5F99B 3CJMA 3I7JA 1RGZA 3GTCA 4U3TA 3AZHD 2WKHA 1CXWA 3HREA 3WRZA 3IXGA 4BMWA 2A3UA 2JKTI 4WL9A 4O8GA 3UPOA 1P3OC 3V39A 4ZUXC 5DNNA 2XDMA 4IBFA 1IEMA 1P3MC 3PBSA 4QD4A 1OTBA 3EOIA 5IU1A 1JWPA 3AZLB 2P7JA 1CJFA 2PD8A 2NUPC 3AN2B 1E25A 1PI4A 1P3PB 4JLFA 3LR5A 4K08A 5HPIA 1F2KA 4E3IA 2EXAA 5AV8C 2L0WA 4BD0A 1JTGA 3A3FA 1KX4B 4EWFA 3SH7A 4M3KA 1X0OA 3VV4A 3UDXA 1UR8A 3LCEA 3MFXA 3AZND 3ZCZA 1KX3A 3X1UC 1Y54A 1RCJA 2B02A 2OOLA 3O62B 4H9OB 4LD9C 4EQ1A 3UTAD 3WAAB 4FCFA 5F69A 1OT6A 1M18D 3MGSC 3B6FA 3NECA 3MVDC 5DNMA 4O0PA 3REKA 2CV5D 1JWZA 3C4PA 1XP4A 1KX5B 5FEFA 3AZMB 3KYZA 2NZDD 4DRTA 3Q81A 3BFFA 3MR0A 5EVIA 3RH8B 5BS7A 3KSGA 5E43A 2G7UA 1YMXA 3ISGA 1M6KA 4EU0A 4J8WB 1N9LA 1OJ5A 5A91A 2HDUA 2XFTA 4WUJA 1PYYA 4Y0UA 4G92B 4KUKA 3JYIA 1O6IA 5AV6D 5HFOA 3FZCA 3MNND 3MNNC 3T4OA 1KX3D 1K55C 4HMEA 3BFEA 3X1UB 4DE2A 4EBNA 4JJNC 1PRQA 1BH9B 3IH9A 3QP4A 5FQKA 1EROA 3IBRA 4J8XA 2JHEA 4GZBA 4ZAMA 5B31A 3W97D 3TW8A 2NZDB 3O3VA 1BLSA 3AYWB 3O62D 3C1BC 4J8VA 3ZQ5A 1FIKA 3HUNA 3PXPA 3CZDA 4J8WD 4Z2MG 3EQUA 3WA9B 4DXBA 1NRFA 5E5AD 1EQZB 5B33D 2I72A 4ZJ2A 3AZIC 5B2JB 4DE3A 3W96D 4BJPA 2ZQ9A 4J8VB 1TS7A 3LIAA 3WS2A 1P3BB 3UMDA 5GHZA 5DJUA 3MQLA 3KYEA 3H0RC 1V9YA 5EOOA 3WD1A 4DRBA 2QJ5A 4NXBA 2B95A 1EAKA 1PZPA 1L0FA 1S6RA 2ZC7A 3G4PA 3IX8A 4PPRA 4Z66C 2J3WA 4JKTA 2R78A 4H9QB 4UAAA 2IO5B 5B1MC 1EWZA 3LYXA 5HDDA 2BASA 4H6JB 3ZHHA 5IT5A 2BYKB 4Z5TA 5B24A 3UE3A 3B6FC 1F5MA 3MXSA 2YKHA 5GT0C 1H0GA 1PW1A 3CLOA 4J8VC 5HL6A 4X23A 4LV1A 1F66D 1EQZC 3AZIB 3MS6A 1WYBA 1ZTUA 1YU4A 1XXMA 4RA7A 4WU9D 4ZBEA 5DF8A 2WKPA 5CTMA 3C1BB 3LY3A 2WKRA 4JF6A 5CXWA 2JCHA 4LPZA 5B32A 4CLCE 1DJBA 2G2WA 3N8RA 3LZ1D 4WN5A 2JKFA 5GLAA 3WS4A 2EFUA 4S2NC 5JRGC 2BTFP 4H9OA 3G35A 1CK7A 5GHYA 5G4ZA 3V3SA 4MBFA 2VGJA 1K38A 4G91B 4C6YA 2PRFA 4GLQA 4WEJA 3RELA 3KS4A 1E8BA 3PBRA 1J9MA 5KDMB 2DMWA 4X23C 2F2AC 5AV8A 3X1SA 5L10A 4NK3A 4LRXC 1P3LC 3SZTA 2JSSA 2X71A 4LCLA 3WD0A 3AZHB 1BFMA 2XGNA 3UPPA 5F1GA 1P9WA 2AROC 3V50A 3IXBA 3W97B 3QP1A 4P6BA 3TU4A 5AY8A 3LZ1B 3G32A 5E2EA 4BQMA 3UO9A 3ULFA 3AZMC 4ETXA 1XA1A 5CRFA 4X56A 4A5RA 1MC0A 4YM6D 2O9AA 1OTAA 2RL3A 1GA0A 3LELD 3QP2A 2BYMB 3S7PA 1ZC2A 1F66C 4Z2LA 4LV0A 1S32B 3BWLA 3LJAB 3H82A 1B67A 3CAXA 3A3IA 4MLLA 4PM5A 4MNRA 3BM6A 1P3OA 4I3IA 2Q9MA 3MNNA 1CEFA 3WTPB 4EEPA 3HSHA 3AN2C 4HP9A 4R8PA 3T4TA 1KE3A 4WYYA 1ODVA 1P3KD 5AY8C 4HMDA 2WGWA 2V1ZA 1FSWA 1LSVA 2HIOC 1N1JA 2F8NB 1U35B 5CERA 3ZG5A 5HAPA 2HPBA 4S2LA 2Y2KA 3O5YA 4QY5A 2YFWA 1BT5A 2WGWB 4Q0JA 2EA9A 3A6NA 3ICYA 2Y79A 1F66A 3D3OA 1U60A 4QB8A 1D1JA 4EXOA 3FV7A 5B1MA 5F99C 4KG5A 1KDWA 3RJUA 3K3DA 3HLWA 2AROB 5DNMB 2XA7S 2ZQDA 3SW1A 1NLYA 1P3KC 3W4PA 3RXXA 4UUZB 3C2WA 1IYOA 3M7PA 5JYPA 3JPUA 3GR2A 4X25A 1LI0A 3HLFA 5JRGA 5AV9A 3UE6A 4XZQC 5EV0A 3A3JA 3IF6A 4DXCA 2V8FA 2DCFA 3B0DB 1L0DA 1Y4OA 1QO6A 1UWNX 1P3AD 1S1ZA 4YWZA 1P3FB 2JKRI 3UNWA 4IBEA 3QNCA 4PM8A 2W3EA 2UWXA 3P98A 1CI8A 2ZJ9A 5JRGB 1MPLA 2X01A 3MGQA 1JFIB 4X55A 3WA9C 2J8YA 4M4XA 5HAQA 4IJGA 4YM6C 1JWVA 1YUEA 3C4OA 3EPHA 3LZ0C 2OAQ1 4OOMA 4Q0IA 5E2FA 4B9OA 1S67L 1SCWA 3O88A 1UGUA 3VFFA 2AROA 5AQ7A 4I39A 5F99A 1W63M 3AV2D 1U35C 4FH4A 4OPRA 4ZUXA 3KUYD 1OJGA 5B31D 4MB3A 3FPWA 3EPKA 1SDEA 3M6HA 1NWZA 3UB7A 3W98C 4HGAB 2W3FA 1W1YA 1HVBA 1P3FD 1LL5A 4P0MA 3WTPC 3B0BA 4NETA 3CMZA 4G92C 2HJ9C 1MKIA 2HDQA 5EVEA 4WU8D 4L0LA 3HUMA 1DJCA 2PD7A 4R4SA 2G5HC 1UR9A 5GXQB 3LEQA 5HWWA 5FDHA 4B88A 1U35A 4NY2A 5F5YA 1N1JB 1S66L 1TD5A 5CPIA 4HBTA 2BYMA 5BNXB 1ID3D 4NXFA 4RVAA 1S4SA 1P34C 3AFAD 1P97A 5G4YA 3BQAA 3VH6T 1L6JA 5BNVB 3PYPA 3AZKC 4WM9A 2BYKA 2F8ND 2XLNA 3PBOA 2XF3A 5AY8B 3AV2B 4DE0A 5B0ZA 3BFCA 1YSQA 2FH5A 3VH6A 3WS5A 3PBQA 4OJ5A 2GNXA 1LL8A 2L5AA 3QP8A 5L07A 3G6OA 1P3PC 4KQRA 5AQAA 1K55A 1S1YA 3MFDA 3MKEA 2EX2A 4CLCA 3C5AA 2ZC6B 4IBIA 2XH9A 3LJAC 3R45A 3REHB 2PT7A 1TZYA 2CWEA 1P3BA 5GT3C 3AZGA 3PAEA 3FYZA 2C5WB 1P3OB 4RQ9A 2XROA 3L28A 4H9PB 1EQZA 4XUJA 3WA9A 1H0IA 4PHTA 1YQSA 3LO7A 5GLBA 1J3WA 3IWOA 4EQIA 1P3GA 5B1LB 1A7WA 3E2KA 5IS1A 1TZYB 2EX9A 5B32C 1MWTA 5FQIA 3T4KA 3MVDA 1SDNA 5E5AC 3HCYA 3HJKA 3UDIA 3IXHA 3KYQA 4P6ZM 5B0YD 3X1SB 1NYYA 4R38A 4GD6A 4OPYA 3N8SA 5F83A 4E44A 3LGOA 4LGWA 3MBZA 4NYUA 5B0ZB 5AV5C 1I2WA 4UA9A 5DVAA 3TU4C 3AV1D 1FCMA 3AZNA 2RCXA 1NRJA 1F98A 4NXEA 4WBGA 3UTAB 1W63Q 1P3AA 2JKTM 4CLCC 4KUDD 5JYOA 3LIBA 3X1VA 2P74A 4R0QA 3ZVTA 2VX8A 2FFYA 4XZQA 5AVCB 3MGSA 3UTBB 2QMIA 3ZG7B 3L25A 1YLPA 3LFVA 4H9QA 3WKJC 1L3LA 4X1LA 4OJOA 4E3NA 1K56A 3VP4A 2F8NK 3WTPE 1MXOA 4OJ6A 5CPJD 1P34A 2VGLS 4YNRA 1M19D 1K56D 5CP6B 3L27A 5E5AA 3KWQB 3A6ND 3A0VA 1PFLA 1PZRA 1XJ6A 3LY4A 1KX3B 2G2UA 4KZ6A 1LI9A 2WADA 4KQQA 1KDSA 3DW0A 3ZGAB 4XXRA 2A2LA 2FJ7A 3KSIA 1UWPX 5DTKA 3MGRD 1HZOA 4KQOA 1PI5A 4KZ8A 1OT9A 1H0MA 3MZFA 1E6RA 4UQIM 3X1VB 3MGPC 1ZHHB 2ZM2A 1G6AA 4R8PC 4XT2A 2XQZA 1G68A 1RP5A 4CLCB 5FEGA 4QJGA 4KUDB 2Y2JA 2IOUA 1TDLA 3F1OB 3LI9A 5E2HA 4CSRB 5FQMA 2ZQCA 1P3IA 2WZZA 5AV5B 3BJNA 4BD1A 3CG5A 1AWIA 1T3UA 4JXVA 4EW7A 2A49A 2ZD8A 4AWLC 3MGRC 1E3UD 3D9YA 3S7NA 5CTNA 4NG2A 1DJAA 3IF6B 5B40A 4WV4B 3H7WB 4R3BA 4MEZA 4KZ9A 3AZHC 1XJ3A 4GKUA 1XGIA 3EPLA 2PBDP 2PYRA 3T4JA 2FFFB 3VE4A 1NYMA 3W96B 1WWSA 1TS0A 4OLGA 3VP2A 3VOLA 1SKFA 2B18A 4WZ5A 3OLOA 4KUDC 1E6ZA 1CEGA 4ZBJB 4HQAA 5FI6A 1LL9A 4KGCD 3VMAA 1PDCA 2V8CA 4DKIA 3MGPB 3UN7A 4FUWA 3X1TD 2V2FF 5AVBC 4ZTKA 1L2SA 5B0YC 2JC7A 2XA7M 2KOIA 3IXDA 2LB5A 3RELC 3ZFZA 5A90A 1PWDA 1ZLAB 3OC2A 2QJ7A 1OPXA 3DTEA 4BBTA 1OMEA 1H3OB 1H3QA 5CPJB 5BNVA 5AVCD 2J3TD 4DDYA 1DY6A 1ESUA 1ZG4A 3SS4A 4E6WA 2ZQ7A 3ZG9B 3IT9A 3CI6A 3O62A 3EGDC 3C8CA 2HP6A 3B0CW 4IEDA 2EXBA 2KLIA 2Y8HA 3X1TA 1KX5A 1A0KA 4MCWA 2W3GA 2GJ3A 3MF0A 2P08A 5C5KA 3E4PA 2Y2NA 4LRZE 1P3BD 2O9CA 3M2JA 3IQAA 5AVBD 2EX6A 4ZJ3A 2OWJA 4PMAA 4J8UC 4GHIA 2QPNA 4RYEA 1QMFA 3TU4B 5DNNC 4OOYA 2Z6CA 5B24C 2J8PA 2PYPA 4GN2A 4UEYA 4UUZA 5GSUC 5B2IA 3B6GA 3AZLC 4IBJA 5B33B 1GSVA 3UE1A 3AFAC 4MMNA 1HQ3C 1R4VA 2NQBC 3KXBD 1VETA 1XA7A 1YMSA 4PM7A 5HZHA 1W7FA 2J9PA 1JNUA 1GPFA 2H0YA 5BS7C 3BLMA 4F3LA 3RXWA 1KOUA 5B33A 1CK3A 2A24B 3MZEA 4OVDA 2IA2A 3RELB 3ZG8B 3S4XA 1ID3C 1HTZA 4IBRA 4R8PD 3IHBA 5FUGA 3Q07A 4GHIB 1YU2A 2XSSA 3DAVA 3REHC 1P3FC 3LI8A 1NLZA 3G31A 3P5JB 4IVIA 3B0DC 1T1AA 2EX8A 2H28A 4NE5A 5GT3A 3WTPA 5AVBA 4ARZB 2JBFA 4S2MA 2GZAA 3NULA 3F1PB 3WD4A 4HH2A 4UQIS 1KGFA 3VH5T 3N7WA 5B2IC 3B6GC 3KS8A 1CI9A 5DF9A 2Y2LA 3AV2C 3L29A 4E45A 4LV3A 3A0SA 2WAEA 2VGKA 3B3XA 4HHDA 1PWGA 2ZBBA 2V0UA 3G2YA 3BLSA 4GHAA 3KUYC 1ESIA 1H3OA 4O01A 1M1AC 2P9VA 2QHKA 2O0YA 2ZL1A 3L7HA 1U35D 4P85A 4OQ0A 2AVXA 5GLCA 5EVIC 1SZVA 3W97A 1ULYA 2H5SA 2XR0A 2RVQC 5KSHA 4UHUA 3X1VD 5FAPA 3UE0A 3C1CB 1FR6A 4JXWA 2YFVB 1GHIA 1ERQA 4YFMA 4R8PB 4XT2B 1FCOA 1E15A 1BZAA 1MWUA 3WRTA 4MN6A 3NQJB 3BY9A 5AV8B 3AZEA 3AZFB 1P3AC 1G6OA 3OPPA 2CC1A 4KGCA 3T4LA 4HGAC 4UA6A 3AGFA 2VV7A 2PYOC 3Q7ZA 1SKOA 4YM6A 5K5BA 4HJ4A 2M1CA 3NOTC 4WF0A 2HV1A 5HPFA 4EBLA 5B32D 1W1VA 3NHQA 2W3DA 4HIAA 4HP4A 2WAFA 2QKPA 2WK0A 2NZDA 3LUQA 3W99A 1ES5A 4GW9A 3UT9C 4R1GA 1P34B 2ZY3A 3UB5P 2ZQAA 3EPJA 3H9WA 1K25A 1ES2A 4CQHA 5CHLB 2PHYA 4I38A 4HOIA 2Y2OA 5MC7A 2W3HA 1T1CA 2ACGA 2Y2MA 5GL9A 4OJPA 4EESA 1P3LB 4OP5A 1DP8A 1K57C 2PU2A 1YLZA 3HUOA 4PKYA 3AYWD 3LELC 2G5IC 4Q0HA 2HGVA 1ZLAA 4XUXA 2XD1A 1KS0A 1IYPA 3AN2D 3W98B 2V20A 2OLVA 3C30A 3W99C 1VEUB 1P3PD 5TGFA 5AV9C 4O7DA 1P9RA 5DKLA 5EUAA 5CHUA 4EUZA 1OGBA 4Z2GA 3TRCA 3REKB 5E5AB 3NI9A 3AZJD 3DBAA 1N9NA 5B32B 3GMWA 3OCLA 2AROD 4KG2A 1M1AA 5CPIC 1ED7A 1KU5A 3M6BA 4BL3A 4NFTA 2IWDA 4HY8A 3P09A 1XFNA 4WNNA 4OQGA 1P34D 4YM6B 1BLCA 1I5QA 3V3RA 4QWOA 1KX4A 3REJD 3IS2A 1HQ3B 2NQBB 4Y2FA 2XEPA 3W4OA 5GT0B 3VP0A 4KZ7A 4GHLA 3AYWA 3MJQA 1YT4A 4LENA 3UTAA 1LT0A 3JVUA 3VH5W 2YFVA 4Q8IA 3U2AA 3C1CA 1H8YA 2P04A 4IBGA 2VZWA 5B31C 5JRGD 5FQJA 1BH9A 3MQ0A 3WS0A 5GHXA 2IO5C 4OKPA 3UB6A 5GSUA 4L9FA 4PM9A 4KGCB 1ONHA 4Z2KA 2OWHA 3REJC 2ZY5A 4R70A 3W98D 4ID4A 5DNMC 4WZ4A 4DF6A 4PAUA 3NIAA 1P3IC 4HH3A 4MDZA 2HUEB 2ZM8A 5B32G 4MB5A 5B1LA 3CHWP 1K54A 1BSGA 1DP6A 4J8VD 1K4FA 2PR6A 3LIFA 4PM6A 2HIOB 2KDKA 2INWA 3AZFA 3GSGA 4OQIA 3B6FD 4OOLA 2Y2IA 1AOIC 1BULA 2EWVA 3LZ0D 2P9VB 5A92A 3GVBA 4XZQD 3WA9D 5EPHA 2X02A 1EQZD 4YS3B 4IJEA 5B31B 3AZED 5DFYA 1TAFB 2BG1A 2I9VA 4BLMA 3NJAA 3T1XA 4HJ3A 4G3WA 4DDSA 1W1PA 3REIA 1S32C 3KO6A 1VB6A 3RFBA 3UTBA 2PAVP 2VLGA 4YOFA 1PWCA 1K4EA 5B1MD 1ACFA 4MB4A 5FASA 3W96C 4H9NA 2CMNA 3IHAA 4EO5C 3AZLA 4Y7PA 4QLCB 3KUYA 1VQQA 2V1BA 5DFXA 5FI7A 4R23A 5CPIB 4J8WC 1E3UA 3HLDA 4IJFA 3UT9D 5F99D 1W79A 5AY8D 1P3GD 3C1BD 3REKD 5EE8A 1ES4A 4WMCD 1E4DA 5E2GA 4ME4A 1AOIA 4AWLB 4WELA 3AZJB 1S32D 2PYOD 3E98A 2HIOD 3UB8A 3BYDA 5GLDA 3B6FB 4GCZA 3MVDB 1FILA 2W1TA 4X6TA 3F1NB 1VETB 3O86A 3AZEC 4E3LA 2WGVA 4KHAB 3O62C 4LD9B 4GDNA 1YPRA 2JKGA 1OTDA 2LY8A 1M18B 3BFGA 4MN7A 5HL1A 2WKQA 5CPKA 5HARA 5AV6C 3R7WB 3X1VC 5CPKD 1D06A 4H9PA 5B0ZD 1B6WA 4LRYC 3DTKA 3WWXA 1WYCA 1K57A 4JJND 4G3VA 3AV1B 4OLDA 5FDSA 3EGXC 3KX0X 2JE5A 4P6ZS 3MSHA 1IELA 4S2JA 1VM1A 4DJ2A 1NZOA 1KX3C 4GJ4A 2F8NH 3R4KA 1KVMA 4GS9B 4DE1A 4S2OA 1GHMA 5KIZA 2OSUA 5FQ9A 3MGQB 1JFIA 3NOPC 3T4SA 3MVDD 1T19A 4R3JA 3MGSD 2C6WB 5B2ID 3B6GD 4U0XA 1P3MA 4X23D 4LD9D 3A1KA 3FDDA 1GOIA 3X1UD 4H9NB 1H8ZA 2NZDC 4QPRA 5CEDA 3AZFC 2WKIA 3O87A 5CP6D 3OOVA 3KWQD 3WD3A 4Z66A 1F1EA 4OONA 5AV6B 2H0TA 3PBTA 4H9SC 3REHD 3VE3A 4JGQA 4YINA 3WKJA 1M18C 4GD8A 1HD8A 3UTAC 1LSXA 1TAFA 4JPMA 4Z66B 3BECA 4YS3D 4BENA 4LFUA 1SHVA 3IX4A 2M7VA 4ZUXD 2OAP1 3CUEA 4OP8A 3P01A 5FQQA 4D60A 4P87A 2Y2GA 4OPZA 2M7UA 3SS3A 3SH9A 1JTDA 3A0RA 3C7UA 5DTTA 1JVJA 3G30A 3LZ1C 3IF6C 3AZJC 3W96A 3B42A 5HWVA 4R3AA 2Y91A 2F8NA 3OBFA 5AV5A 4I5SA 1ONGA 3IP4C 3KXBC 1YLTA 4CSRA 1TZYC 2ZOIA 1W8YA 3EG5B 3W99D 3UMEA 4MN5A 1G28A 5BO0B 2WUQA 3BQ8A 1TZYD 2VK3A 3M2KA 3AYWC 2ZMFA 5B24D 2W27A 4ZDXA 5EVLA 3VSKA 2PR5A 4J8UD 1BTLA 3VH6W 3IBJA 1T1BA 5C3IC 3A3EA 1FSYA 4E04A 5FAOA 5KDMA 2PDRA 3HLBA 2PYOB 1E6NA 3W8KA 5CPKB 4HJ6A 3N4IA 4NZ1A 1YLJA 2V9AA 3E2LA 1G5UA 3JVVA 5HSQA 4CAYA 3HLEA 4KHAA 1IYSA 2IWBA 2FJ7D 2ZM0A 4GNUA 2XFSA 5KMWA 1LSWA 2ZC3B 4YS3C 3V9RA 1P3FA 3HVFA 5CGXA 3AZID 4Z66D 4E3KA 3REIC 4IHQA 4NE6A 3KSFA 3ZNTA 1GXDA 1ZG6A 2ZLYA 3LZ1A 1K6SA 3KWQC 1AOIB 5KZHA 1M19A 4DQYB 3X1TB 5FA7A 3PBNA 1N9OA 1HTAA 4NXGA 5EOEA 4Z9QA 4X68A 2OLUA 3BY8A 5G49B 3N8LA 1NXYA 5JA4A 4WZSB 5B33C 1OGGA 1BH8A 3S1YA 1IYQA 2V0WA 4H8RA 4N92A 3KUYB 3MQOA 4K0WA 5HDCA 2F8NG 1WA9A 3D4FA 1Z09A 3REJB 3X1TC 3Q7VB 3MGQD 2WZXA 3A6NB 2O9BA 1K54C 4KGCC 4E3MA 2VJWA 2FJ7B 2V5OA 3REIB 2J80A 1S4RA 4X53A 3DWZA 2D02A 3GRJA 2RVQD 2RTSA 4N9LA 3L2AA 2ZMAA 3KWQA 1NZUA 5B0ZC 5CP6A 3CPTA 5FSRA 3ZYTA 1I2SA 3AZNB 4IUHA 3TSGA 5C3IB 2R9WA 4IBBA 5IHVA 1P3GB 5G49A 3L9KA 4RX2A 3MGQC 3A3DA 5HDSA 3IWQA 1KGGA 1AXBA 1C3BA 3LJAA 3H82B 1NJ4A 1S32A 5I94A 5AVCA 5B1LC 3SH8A 1OTEA 2CV5A 3FPVA 4WU9A 3AZGB 4EERA 4XUJD 5B40B 1NY0A 3FG8A 5A8BA 4WU9B 2DQNC 2Z2MB 2CV5C 3FC7A 5AJGA 5AV8D 3UB9A 3QP5A 5TBMA 2HF6A 3MGPD 2Y2PA 5GSUB 3LELB 2W1RA 2WYXA 4UA7A 3BEBA 3AZEB 4B4ZA 5FAQA 3NQJA 3WX7A 3REHA 4U0TA 2DNSA 4I3JA 1P3OD 4KZ3A 3HONA 2J9OA 3C38A 4LG2A 1O7EA 3K2NA 4E3JA 2W8SA 1Q2QA 3HBRA 5BNXA 3A6NC 4QU3A 2CV5B 1M19C 3EEAA 3T1RA 3IS2B 4KG6A 1P3MD 5B40D 4XUJB 1YAXA 4LLOB 2XRNA 5DF7A 2BLSA 2KX6A 5M1AA 3AZLD 1IOUA 1Q9CA 5CEBA 4EO5B 1LLBA 1W1TA 5HD5A 1N9BA 1LHYA 1BH8B 4WU8A 4Z2HA 4KZBA 4NEED 4CLCD 3HLCA 3MXRA 5F82A 3NOUC 3AV1C 3L26A 2OV5A 3Q7VA 1E6PA 3VOYA 1O07A 2D49A 3ZDJA 5A93A 4N9KA 1T18A 3CPTB 3GDIA 4DN0A 2Z6DA 2VA0A 1J7MA 2HJEA 3H0MC 1P3MB 1Y28A 2ZOHA 1YKDA 4S2IA 1YU3A 4B4XA 1S0WA 4II7A 3UDFA 4R4RA 5JA4B 3ZNYA 5CP6C 3VH5A 5EVIB 4E3OA 4GB7A 3AZFD 2HP9A 5EM0A 2PU4A 3G2ZA 2VEAA 1WWIA 2EWWA 1V9ZA 5F68A 3REJA 4OUIA 3WS1A 2VGLM 4Y15A 2J7VA 3LR4A 3NCKA 1BUEA 3DTIA
chains in the Genus database with same CATH topology
1ALQA 3WAAA 1W8QA 3GV9A 5B2IB 3B6GB 2ZC5B 1ZKJA 3NC8A 4GDBA 2QZ6A 4QLCC 5HX9A 4KZAA 5B31G 3C1CD 4S2KA 4LV2A 3LEZA 4OPQA 2ZM5A 1P3PA 4JBFA 3TOIA 1MWSA 5GXQD 5CPKC 5KSCA 1Z6FA 3S22A 4WZ5C 4G91C 4KZ4A 5BO0A 4MBHA 1KX4D 3AZKD 3KFUG 1TEMA 1KX5D 3QNBA 2YFWB 5B0YA 4NZ5A 1FOFA 3LZ0A 5AQ9A 3AZGC 3WAAD 4HBUA 4Y0OA 3GQZA 1W5DA 1EI5A 3G34A 1L0EA 2R9XA 3REKC 1ID3A 1IKGA 1P3GC 4E6XA 4J8WA 5AV9B 4WU8C 3OPRA 3WKJB 4WJ3C 5GXQA 3WTPD 4XUZA 3UTBC 4GOGA 3AZMA 3SS5A 3MGPA 3C7VA 5HAIA 5B1MB 3MKFA 4F94A 1P3KB 1YLYA 1F66B 3AV1A 5DTSA 4DRAA 3VSLA 2ZQ8A 2VQRA 2Y2QA 2Z2LB 1PW8A 3IWIA 2HP5A 3MZDA 1H5XA 4LD9A 3OPHA 4N1XA 3AZHA 3X1SC 4OQHA 1AOID 4ZJ1A 3IF5A 3H0LC 5EVID 2PBYA 3AZJA 1XGJA 3DWKA 5D3OA 1MY8A 1ZLAC 1BLPA 2RIQA 5B0YB 3X1SD 5B2JD 4HESA 5M19A 2HDRA 3Q1FA 1P3ID 4KUDA 5DNMD 4OJLA 2XD5A 4C75A 5L2FA 3UTBD 1QMEA 4JJNB 4QLCA 1KE0A 5HW3A 3W4QA 4X69A 1HQ3A 2NQBA 1N4OA 3AL0C 2IWCA 1M1AB 4Z5TC 4JXGA 2Y2HA 3AZKB 3OZHA 4IBXA 3ZG0A 3MGRB 5CPJA 3C1BA 3FKEA 4Z5TB 1KX5C 3LJAD 4NZ4A 5CPID 3VP1A 4M6BA 4H9SA 3UT9B 4EV4A 4FH2A 1W2EA 3KXBA 3MGSB 1TVFA 3OCNA 4JF4A 3B0CT 4IVKA 4J8XC 4XZQB 5EECA 4X23B 3AGEA 3QHYA 3ITBA 1HQ3D 2NQBD 5F1FA 4J8XD 4K91A 5AV9D 3IH8A 5BT1D 5GSUD 1YM1A 1KX4C 4QLCD 4S2PA 3N3FA 5U47A 4C3QA 5BT1C 5DNND 1XPBA 2HIOA 4NYYA 3FKVA 1P3BC 3NQUA 4WU8B 5TR7A 2GDNA 3C1CC 2HDSA 3NY4A 4BL2A 4LCMA 5GT0A 4CAYB 3A1IA 3ITAA 4JF5A 2DF4C 1P3LD 3HLGA 1BLHA 4Z5TD 1P3IB 4WNNB 3VP3A 3NDGA 3HL9A 5FATA 3DTMA 4IBCA 3PTEA 1ZLAD 1FQGA 5G18A 4GH9A 1TDGA 4J8XB 5B2JA 5TFQA 4FSFA 1XKZA 3LELA 2B5RA 3AV2A 4J8UA 2EFXA 3N6IA 2Y4AA 4RX3A 1YU0A 5B2JC 1MBLA 3BFDA 1P3LA 1YLWA 3UPNA 4IBDA 5CGWA 5B40C 1K6RA 3AFAA 2H10A 5GT0D 2ZY4A 1GHPA 1WE4A 1GCEA 1M1AD 3BRMA 3W98A 3AZIA 5CGSA 4S2NA 5AVBB 5GT3B 3AFAB 4EBPA 4KZ5A 3W99B 1PIOA 4OH0A 4UPKA 3V9RB 3SOIA 1RGYA 3PAGA 1P3AB 1FR1A 5CHJA 5B24B 5DNNB 3FWLA 4QHCA 4J8UB 4WEKA 4K0XA 5M18A 1PZOA 2PYOA 1KVLA 3OPLA 4ZUXB 2ZC4B 3AGDA 4WMCA 3MGRA 5BPVA 1GA9A 5CHMA 1XX2A 3EQVA 4D2OA 1KE4A 4QNLA 3VOZA 1ERMA 2HUEC 2DRWA 2XK1A 4XUJC 3W97C 1M18A 1M19B 3VFHA 5GXQC 5B1LD 5CPJC 3WAAC 3AZGD 1Q2PA 4NZ3A 4IBKA 3AN2A 3R45B 4QY6A 3F6TA 4JJNA 3WKJD 4Y0TA 4Z2MH 2Q9NA 3NQUB 2E8IA 4N1HA 3UY6A 3AZMD 3ZVWA 3X1UA 3NBLA 2Y59A 4ZBJC 3NDEA 3TU4D 4NE3A 5BOHA 1ID3B 1YU1A 4JXSA 1FCNA 5FI2A 5AV5D 3KSYA 1L0GA 1Z2CB 1IKIA 3KXBB 3LZ0B 3TG9A 3UT9A 5CECA 2WKEA 5AVCC 4H9RA 4CPKA 3AZNC 1KGEA 3V5MA 4YS3A 1P3KA 5AQBA 1MWRA 3AZKA 2Y55A 3RELD 4FD8A 4CJNA 3MNNB 4H9RB 3REID 5FUGB 1M40A 5GT3D 2FJ7C 5AV6A 1ES3A 2ZY2A 5J8XA 4HEFA 4KENB 4WU9C 3Q82A 4MBKA 3FKWA 2WGIA 5F99B 3CJMA 3I7JA 1RGZA 3GTCA 4U3TA 3AZHD 2WKHA 3HREA 3WRZA 3IXGA 2A3UA 3UPOA 1P3OC 3V39A 4ZUXC 5DNNA 2XDMA 4IBFA 1IEMA 1P3MC 3PBSA 4QD4A 1JWPA 3AZLB 3AN2B 1E25A 1PI4A 1P3PB 4JLFA 4E3IA 2EXAA 5AV8C 4BD0A 1JTGA 3A3FA 1KX4B 4EWFA 3SH7A 4M3KA 3UDXA 3LCEA 3AZND 3ZCZA 1KX3A 3X1UC 1Y54A 1RCJA 3O62B 4H9OB 4LD9C 3UTAD 3WAAB 4FCFA 1M18D 3MGSC 3B6FA 3MVDC 5DNMA 3REKA 2CV5D 1JWZA 3C4PA 1XP4A 1KX5B 3AZMB 2NZDD 4DRTA 3Q81A 3BFFA 5EVIA 5BS7A 5E43A 1YMXA 3ISGA 1M6KA 4J8WB 5A91A 2HDUA 2XFTA 1PYYA 4Y0UA 4G92B 3JYIA 5AV6D 5HFOA 3FZCA 3MNND 3MNNC 1KX3D 1K55C 3BFEA 3X1UB 4DE2A 4EBNA 4JJNC 1BH9B 3IH9A 5FQKA 1EROA 4J8XA 4GZBA 4ZAMA 5B31A 3W97D 2NZDB 3O3VA 1BLSA 3AYWB 3O62D 3C1BC 4J8VA 3HUNA 3CZDA 4J8WD 4Z2MG 3EQUA 3WA9B 4DXBA 1NRFA 5E5AD 1EQZB 5B33D 2I72A 4ZJ2A 3AZIC 5B2JB 4DE3A 3W96D 4BJPA 2ZQ9A 4J8VB 3WS2A 1P3BB 5GHZA 5EOOA 3H0RC 4DRBA 1PZPA 1L0FA 1S6RA 2ZC7A 3G4PA 4PPRA 4Z66C 4JKTA 4H9QB 4UAAA 2IO5B 5B1MC 1EWZA 3ZHHA 2BYKB 4Z5TA 5B24A 3UE3A 3B6FC 3MXSA 5GT0C 1PW1A 4J8VC 4X23A 4LV1A 1F66D 1EQZC 3AZIB 1WYBA 1YU4A 1XXMA 4RA7A 4WU9D 4ZBEA 5DF8A 5CTMA 3C1BB 3LY3A 4JF6A 5CXWA 2JCHA 5B32A 1DJBA 2G2WA 3N8RA 3LZ1D 5GLAA 3WS4A 2EFUA 4S2NC 5JRGC 4H9OA 3G35A 5GHYA 3V3SA 4MBFA 2VGJA 1K38A 4G91B 4C6YA 4WEJA 3RELA 3KS4A 3PBRA 1J9MA 5KDMB 4X23C 2F2AC 5AV8A 3X1SA 4NK3A 1P3LC 2JSSA 2X71A 4LCLA 3AZHB 1BFMA 2XGNA 3UPPA 5F1GA 2AROC 3V50A 3IXBA 3W97B 4P6BA 3TU4A 5AY8A 3LZ1B 3G32A 5E2EA 4BQMA 3UO9A 3AZMC 1XA1A 5CRFA 4X56A 4A5RA 4YM6D 2RL3A 1GA0A 3LELD 2BYMB 1ZC2A 1F66C 4LV0A 1S32B 3LJAB 1B67A 3A3IA 4MLLA 4PM5A 4MNRA 3BM6A 1P3OA 2Q9MA 3MNNA 1CEFA 3WTPB 3HSHA 3AN2C 4R8PA 1KE3A 4WYYA 1P3KD 5AY8C 2WGWA 2V1ZA 1FSWA 2HIOC 1N1JA 2F8NB 1U35B 5CERA 3ZG5A 5HAPA 2HPBA 4S2LA 2Y2KA 4QY5A 2YFWA 1BT5A 2WGWB 3A6NA 1F66A 1U60A 4QB8A 3FV7A 5B1MA 5F99C 4KG5A 1KDWA 3RJUA 3HLWA 2AROB 5DNMB 2ZQDA 1P3KC 3W4PA 3RXXA 4UUZB 1IYOA 5JYPA 3GR2A 1LI0A 3HLFA 5JRGA 5AV9A 4XZQC 3A3JA 3IF6A 4DXCA 2DCFA 3B0DB 1L0DA 1P3AD 1P3FB 3UNWA 4IBEA 3QNCA 4PM8A 2UWXA 3P98A 1CI8A 2ZJ9A 5JRGB 1MPLA 2X01A 3MGQA 1JFIB 4X55A 3WA9C 2J8YA 5HAQA 4YM6C 1JWVA 1YUEA 3C4OA 3EPHA 3LZ0C 4OOMA 5E2FA 1SCWA 3O88A 3VFFA 2AROA 5AQ7A 5F99A 3AV2D 1U35C 4FH4A 4OPRA 4ZUXA 3KUYD 5B31D 3EPKA 1SDEA 3M6HA 3W98C 4HGAB 1HVBA 1P3FD 1LL5A 4P0MA 3WTPC 3B0BA 4NETA 3CMZA 4G92C 1MKIA 2HDQA 4WU8D 4L0LA 3HUMA 1DJCA 4R4SA 2G5HC 5GXQB 5FDHA 4B88A 1U35A 4NY2A 1N1JB 5CPIA 4HBTA 2BYMA 5BNXB 1ID3D 4RVAA 1P34C 3AFAD 3VH6T 5BNVB 3AZKC 4WM9A 2BYKA 2F8ND 2XLNA 3PBOA 2XF3A 5AY8B 3AV2B 4DE0A 5B0ZA 3BFCA 3VH6A 3WS5A 3PBQA 4OJ5A 2L5AA 4KQRA 1P3PC 5AQAA 1K55A 3MFDA 3MKEA 2EX2A 3C5AA 2ZC6B 4IBIA 2XH9A 3LJAC 3R45A 3REHB 1TZYA 2CWEA 1P3BA 5GT3C 3AZGA 3PAEA 3FYZA 2C5WB 1P3OB 3L28A 4H9PB 1EQZA 4XUJA 3WA9A 1YQSA 3LO7A 5GLBA 3IWOA 4EQIA 1P3GA 5B1LB 1A7WA 3E2KA 1TZYB 2EX9A 5B32C 1MWTA 5FQIA 3MVDA 1SDNA 5E5AC 3UDIA 3IXHA 5B0YD 3X1SB 1NYYA 4GD6A 4OPYA 3N8SA 5F83A 4E44A 3MBZA 4NYUA 5B0ZB 5AV5C 1I2WA 4UA9A 5DVAA 3TU4C 3AV1D 1FCMA 3AZNA 2RCXA 4WBGA 3UTAB 1P3AA 4KUDD 5JYOA 3X1VA 2P74A 4R0QA 3ZVTA 2FFYA 4XZQA 5AVCB 3MGSA 3UTBB 2QMIA 3ZG7B 3L25A 1YLPA 4H9QA 3WKJC 4OJOA 4E3NA 1K56A 3VP4A 2F8NK 3WTPE 1MXOA 4OJ6A 5CPJD 1P34A 1M19D 1K56D 5CP6B 3L27A 5E5AA 3KWQB 3A6ND 1PZRA 3LY4A 1KX3B 2G2UA 4KZ6A 1LI9A 2WADA 4KQQA 1KDSA 3DW0A 3ZGAB 4XXRA 2FJ7A 5DTKA 3MGRD 1HZOA 4KQOA 1PI5A 4KZ8A 3MZFA 3X1VB 3MGPC 2ZM2A 1G6AA 4R8PC 2XQZA 1G68A 1RP5A 4QJGA 4KUDB 2Y2JA 2IOUA 1TDLA 5E2HA 5FQMA 4CSRB 2ZQCA 1P3IA 2WZZA 5AV5B 4BD1A 3CG5A 1T3UA 4JXVA 2A49A 2ZD8A 4AWLC 3MGRC 1E3UD 5CTNA 1DJAA 3IF6B 5B40A 4WV4B 4R3BA 4MEZA 4KZ9A 3AZHC 4GKUA 1XGIA 3EPLA 2FFFB 1NYMA 3W96B 1WWSA 4OLGA 3VP2A 1SKFA 4WZ5A 4KUDC 1CEGA 4ZBJB 5FI6A 1LL9A 4KGCD 3VMAA 4DKIA 3MGPB 3UN7A 3X1TD 2V2FF 5AVBC 4ZTKA 1L2SA 5B0YC 2JC7A 3IXDA 3RELC 3ZFZA 5A90A 1PWDA 1ZLAB 3OC2A 1OMEA 1H3OB 5CPJB 5BNVA 5AVCD 4DDYA 1DY6A 1ESUA 1ZG4A 3SS4A 4E6WA 2ZQ7A 3ZG9B 3IT9A 3O62A 2HP6A 3B0CW 4IEDA 2EXBA 3X1TA 1KX5A 2Y2NA 1P3BD 3M2JA 3IQAA 5AVBD 2EX6A 4ZJ3A 4PMAA 4J8UC 2QPNA 4RYEA 1QMFA 3TU4B 5DNNC 4OOYA 5B24C 2J8PA 4GN2A 4UUZA 5GSUC 5B2IA 3B6GA 3AZLC 4IBJA 5B33B 3UE1A 3AFAC 1HQ3C 1R4VA 2NQBC 3KXBD 1XA7A 1YMSA 4PM7A 1W7FA 2J9PA 2H0YA 5BS7C 3BLMA 3RXWA 5B33A 1CK3A 3MZEA 4OVDA 3RELB 3ZG8B 3S4XA 1ID3C 1HTZA 4IBRA 4R8PD 3IHBA 5FUGA 3Q07A 1YU2A 3REHC 1P3FC 3G31A 3P5JB 4IVIA 3B0DC 2EX8A 4NE5A 5GT3A 3WTPA 5AVBA 2JBFA 4S2MA 1KGFA 3VH5T 3N7WA 5B2IC 3B6GC 3KS8A 1CI9A 5DF9A 2Y2LA 3AV2C 3L29A 4E45A 4LV3A 2WAEA 2VGKA 3B3XA 1PWGA 3G2YA 3BLSA 4GHAA 3KUYC 1ESIA 1H3OA 1M1AC 2P9VA 1U35D 4P85A 4OQ0A 5GLCA 5EVIC 3W97A 1ULYA 2H5SA 2XR0A 2RVQC 5KSHA 4UHUA 3X1VD 5FAPA 3UE0A 3C1CB 1FR6A 4JXWA 2YFVB 1GHIA 1ERQA 4YFMA 4R8PB 1FCOA 1BZAA 1MWUA 3WRTA 3NQJB 5AV8B 3AZEA 3AZFB 1P3AC 3OPPA 2CC1A 4KGCA 4HGAC 4UA6A 3AGFA 2PYOC 3Q7ZA 4YM6A 4EBLA 5B32D 2WAFA 2WK0A 2NZDA 3W99A 1ES5A 3UT9C 4R1GA 1P34B 2ZY3A 2ZQAA 3EPJA 1K25A 1ES2A 5CHLB 2Y2OA 2Y2MA 5GL9A 4OJPA 1P3LB 4OP5A 1K57C 2PU2A 1YLZA 3HUOA 3AYWD 3LELC 2G5IC 1ZLAA 4XUXA 2XD1A 1IYPA 3AN2D 3W98B 2V20A 2OLVA 3W99C 1P3PD 5TGFA 5AV9C 4O7DA 4EUZA 5EUAA 5CHUA 3REKB 5E5AB 3NI9A 3AZJD 3GMWA 5B32B 3OCLA 2AROD 4KG2A 1M1AA 5CPIC 1KU5A 3M6BA 4BL3A 4NFTA 2IWDA 3P09A 4WNNA 4OQGA 1P34D 4YM6B 1BLCA 1I5QA 3V3RA 1KX4A 3REJD 1HQ3B 2NQBB 2XEPA 3W4OA 5GT0B 3VP0A 4KZ7A 4GHLA 3AYWA 1YT4A 4LENA 3UTAA 3VH5W 2YFVA 4Q8IA 3C1CA 1H8YA 4IBGA 5B31C 5JRGD 5FQJA 1BH9A 3WS0A 5GHXA 2IO5C 4OKPA 5GSUA 4PM9A 4KGCB 1ONHA 3REJC 2ZY5A 3W98D 4ID4A 5DNMC 4WZ4A 4DF6A 3NIAA 1P3IC 2HUEB 2ZM8A 5B32G 5B1LA 1K54A 1BSGA 4J8VD 1K4FA 4PM6A 2HIOB 3AZFA 3GSGA 4OQIA 3B6FD 4OOLA 2Y2IA 1AOIC 1BULA 3LZ0D 2P9VB 5A92A 3GVBA 4XZQD 3WA9D 5EPHA 2X02A 1EQZD 4YS3B 4IJEA 5B31B 3AZED 1TAFB 2BG1A 4BLMA 4DDSA 3REIA 1S32C 3UTBA 1PWCA 1K4EA 5B1MD 5FASA 3W96C 4H9NA 3IHAA 4EO5C 3AZLA 4Y7PA 4QLCB 3KUYA 1VQQA 5FI7A 4R23A 5CPIB 4J8WC 1E3UA 3HLDA 4IJFA 3UT9D 5F99D 1W79A 5AY8D 1P3GD 3C1BD 3REKD 5EE8A 1ES4A 4WMCD 1E4DA 5E2GA 1AOIA 4AWLB 4WELA 3AZJB 1S32D 2PYOD 2HIOD 3BYDA 5GLDA 3B6FB 3MVDB 4X6TA 3O86A 3AZEC 4E3LA 2WGVA 4KHAB 3O62C 4LD9B 4GDNA 3BFGA 2LY8A 1M18B 5HL1A 5CPKA 5HARA 5AV6C 3X1VC 5CPKD 4H9PA 5B0ZD 1B6WA 3WWXA 1WYCA 1K57A 4JJND 3AV1B 4OLDA 2JE5A 1IELA 4S2JA 1VM1A 1NZOA 1KX3C 2F8NH 1KVMA 4DE1A 4S2OA 1GHMA 2OSUA 5FQ9A 3MGQB 1JFIA 3MVDD 4R3JA 3MGSD 2C6WB 5B2ID 3B6GD 4U0XA 1P3MA 4X23D 4LD9D 3A1KA 3FDDA 3X1UD 4H9NB 1H8ZA 2NZDC 5CEDA 3AZFC 2WKIA 3O87A 5CP6D 3KWQD 4OONA 4Z66A 1F1EA 5AV6B 2H0TA 3PBTA 4H9SC 3REHD 4YINA 3WKJA 1M18C 4GD8A 1HD8A 3UTAC 1TAFA 4JPMA 4Z66B 3BECA 4YS3D 4BENA 1SHVA 4ZUXD 4OP8A 5FQQA 4P87A 2Y2GA 4OPZA 3SS3A 3SH9A 1JTDA 5DTTA 3C7UA 1JVJA 3G30A 3LZ1C 3IF6C 3AZJC 3W96A 2Y91A 2F8NA 5AV5A 1ONGA 3IP4C 3KXBC 1YLTA 4CSRA 1TZYC 1W8YA 3EG5B 3W99D 5BO0B 2WUQA 1TZYD 3M2KA 3AYWC 5B24D 4ZDXA 5EVLA 3VSKA 4J8UD 1BTLA 3VH6W 5C3IC 3A3EA 1FSYA 5FAOA 5KDMA 3HLBA 2PYOB 3W8KA 5CPKB 3N4IA 4NZ1A 1YLJA 3E2LA 4CAYA 3HLEA 4KHAA 1IYSA 2IWBA 2FJ7D 2ZM0A 4GNUA 2XFSA 5KMWA 2ZC3B 4YS3C 3V9RA 1P3FA 3HVFA 5CGXA 3AZID 4Z66D 4E3KA 3REIC 4NE6A 3ZNTA 1ZG6A 2ZLYA 3LZ1A 1K6SA 3KWQC 1AOIB 5KZHA 1M19A 4DQYB 3X1TB 5FA7A 3PBNA 1HTAA 5EOEA 4Z9QA 4X68A 2OLUA 5G49B 3N8LA 1NXYA 5JA4A 4WZSB 5B33C 1BH8A 3S1YA 1IYQA 4H8RA 4N92A 3KUYB 4K0WA 2F8NG 3D4FA 3REJB 3X1TC 3Q7VB 3MGQD 2WZXA 3A6NB 1K54C 4KGCC 4E3MA 2FJ7B 3REIB 4X53A 3DWZA 3GRJA 2RVQD 4N9LA 3L2AA 2ZMAA 3KWQA 1NZUA 5B0ZC 5CP6A 5FSRA 1I2SA 3AZNB 3TSGA 5C3IB 2R9WA 4IBBA 5IHVA 1P3GB 5G49A 4RX2A 3MGQC 3A3DA 3IWQA 1KGGA 1AXBA 1C3BA 3LJAA 1NJ4A 1S32A 5I94A 5AVCA 5B1LC 3SH8A 2CV5A 4WU9A 3AZGB 4XUJD 5B40B 1NY0A 4WU9B 2DQNC 2Z2MB 2CV5C 5AV8D 3MGPD 2Y2PA 5GSUB 3LELB 2WYXA 4UA7A 3BEBA 3AZEB 4B4ZA 5FAQA 3NQJA 3WX7A 3REHA 4U0TA 2DNSA 1P3OD 4KZ3A 3HONA 2J9OA 4LG2A 1O7EA 4E3JA 2W8SA 1Q2QA 3HBRA 5BNXA 3A6NC 4QU3A 2CV5B 1M19C 4KG6A 1P3MD 5B40D 4XUJB 5DF7A 2BLSA 5M1AA 3AZLD 1Q9CA 5CEBA 4EO5B 1LLBA 1N9BA 1LHYA 1BH8B 4WU8A 4KZBA 3HLCA 3MXRA 5F82A 3AV1C 3L26A 2OV5A 3Q7VA 3VOYA 1O07A 3ZDJA 5A93A 4N9KA 3H0MC 1P3MB 4S2IA 1YU3A 4B4XA 1S0WA 3UDFA 4R4RA 5JA4B 3ZNYA 5CP6C 3VH5A 5EVIB 4E3OA 4GB7A 3AZFD 2HP9A 2PU4A 3G2ZA 1WWIA 3REJA 4OUIA 3WS1A 2J7VA 3NCKA 1BUEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ALQ A;  3PAE A;  4Q8I A;  3GTC A;  3FYZ A;  1H8Y A;  2C5W B;  1W8Q A;  3GV9 A;  4U3T A;  2WKH A;  2ZC5 B;  1ZKJ A;  3HRE A;  3NC8 A;  4GDB A;  5FQJ A;  3WRZ A;  3IXG A;  2QZ6 A;  5GHX A;  3WS0 A;  4OKP A;  5HX9 A;  2A3U A;  4KZA A;  1YQS A;  4PM9 A;  3LO7 A;  5GLB A;  4S2K A;  3UPO A;  3IWO A;  4EQI A;  4LV2 A;  1ONH A;  3V39 A;  3LEZ A;  4OPQ A;  3E2K A;  2XDM A;  2EX9 A;  1IEM A;  4JBF A;  3TOI A;  3PBS A;  4QD4 A;  4ID4 A;  1MWT A;  1JWP A;  4WZ4 A;  1MWS A;  5FQI A;  4DF6 A;  1SDN A;  3NIA A;  5KSC A;  1Z6F A;  3S22 A;  1E25 A;  4WZ5 C;  1PI4 A;  2ZM8 A;  4KZ4 A;  4JLF A;  3IXH A;  3UDI A;  4MBH A;  1NYY A;  4E3I A;  2EXA A;  4GD6 A;  1TEM A;  4BD0 A;  1K54 A;  1JTG A;  3A3F A;  4OPY A;  1BSG A;  3N8S A;  4M3K A;  3QNB A;  5F83 A;  3SH7 A;  4EWF A;  3MBZ A;  1K4F A;  3UDX A;  3LCE A;  1FOF A;  4PM6 A;  1I2W A;  4UA9 A;  3ZCZ A;  5AQ9 A;  5DVA A;  1Y54 A;  4HBU A;  1RCJ A;  3GSG A;  4OQI A;  4OOL A;  4Y0O A;  2Y2I A;  1BUL A;  1FCM A;  2P9V B;  5A92 A;  2RCX A;  3GQZ A;  4FCF A;  1W5D A;  1EI5 A;  3G34 A;  3GVB A;  4WBG A;  1L0E A;  2R9X A;  5EPH A;  2X02 A;  5JYO A;  1IKG A;  2P74 A;  1JWZ A;  4R0Q A;  3C4P A;  3ZVT A;  4E6X A;  1XP4 A;  2FFY A;  2BG1 A;  4DRT A;  3OPR A;  3Q81 A;  4BLM A;  3BFF A;  2QMI A;  3ZG7 B;  1YLP A;  5EVI A;  4DDS A;  5E43 A;  1YMX A;  3ISG A;  4E3N A;  1K56 A;  3VP4 A;  4XUZ A;  1M6K A;  1MXO A;  4GOG A;  1PWC A;  1K4E A;  5A91 A;  3SS5 A;  5HAI A;  3C7V A;  5FAS A;  2HDU A;  2XFT A;  3MKF A;  1PYY A;  4Y0U A;  4F94 A;  1K56 D;  3JYI A;  3IHA A;  4Y7P A;  1YLY A;  5FI7 A;  1VQQ A;  5HFO A;  3FZC A;  4R23 A;  5DTS A;  1E3U A;  3HLD A;  3VSL A;  2ZQ8 A;  1K55 C;  3LY4 A;  2G2U A;  3BFE A;  1LI9 A;  2WAD A;  1W79 A;  4KZ6 A;  4KQQ A;  2Y2Q A;  4DE2 A;  2Z2L B;  1KDS A;  3DW0 A;  1PW8 A;  3IWI A;  2HP5 A;  4XXR A;  3ZGA B;  4EBN A;  3MZD A;  5EE8 A;  1H5X A;  1ES4 A;  3IH9 A;  4WMC D;  1E4D A;  1HZO A;  4KQO A;  5DTK A;  1ERO A;  1PI5 A;  5E2G A;  4KZ8 A;  5FQK A;  4GZB A;  4ZAM A;  3MZF A;  4WEL A;  3OPH A;  4N1X A;  4OQH A;  2ZM2 A;  4ZJ1 A;  1G6A A;  3O3V A;  1BLS A;  3BYD A;  5GLD A;  2XQZ A;  1G68 A;  3IF5 A;  4X6T A;  1RP5 A;  5EVI D;  3O86 A;  4QJG A;  2PBY A;  4E3L A;  2WGV A;  4GDN A;  2Y2J A;  3HUN A;  1XGJ A;  3CZD A;  3DWK A;  1TDL A;  3BFG A;  5D3O A;  1MY8 A;  5E2H A;  5FQM A;  5HL1 A;  2ZQC A;  3EQU A;  2WZZ A;  4DXB A;  1BLP A;  1NRF A;  5HAR A;  4HES A;  5M19 A;  2I72 A;  4ZJ2 A;  2HDR A;  3CG5 A;  3Q1F A;  4BD1 A;  4JXV A;  4DE3 A;  4BJP A;  2A49 A;  2ZD8 A;  2ZQ9 A;  3WWX A;  2XD5 A;  3WS2 A;  4C75 A;  1WYC A;  1K57 A;  5GHZ A;  1E3U D;  5L2F A;  1QME A;  4OLD A;  5EOO A;  5CTN A;  2JE5 A;  1IEL A;  1KE0 A;  1VM1 A;  4S2J A;  1NZO A;  5HW3 A;  1DJA A;  1PZP A;  3IF6 B;  1L0F A;  4R3B A;  3W4Q A;  4X69 A;  4MEZ A;  1S6R A;  2ZC7 A;  3G4P A;  4KZ9 A;  1N4O A;  4PPR A;  1KVM A;  4GKU A;  1XGI A;  4JKT A;  4DE1 A;  5KMW A;  4LEN A;  4S2O A;  1GHM A;  2OSU A;  2FFF B;  4UAA A;  5FQ9 A;  1NYM A;  1EWZ A;  4OLG A;  3VP2 A;  1SKF A;  4WZ5 A;  2IWC A;  4R3J A;  1CEG A;  5FI6 A;  3ZHH A;  2C6W B;  4U0X A;  4JXG A;  3UE3 A;  2Y2H A;  3OZH A;  1LL9 A;  3VMA A;  1H8Z A;  3MXS A;  4DKI A;  4IBX A;  1PW1 A;  3UN7 A;  5CED A;  3ZG0 A;  2WKI A;  2V2F F;  3O87 A;  4LV1 A;  4ZTK A;  4OON A;  1L2S A;  2JC7 A;  3VP1 A;  2H0T A;  3PBT A;  3IXD A;  1WYB A;  4YIN A;  3ZFZ A;  4GD8 A;  1XXM A;  4RA7 A;  4FH2 A;  1HD8 A;  4ZBE A;  4EV4 A;  1PWD A;  5A90 A;  1TVF A;  3OCN A;  3OC2 A;  4JF4 A;  4IVK A;  5DF8 A;  5CTM A;  5EEC A;  4JPM A;  1OME A;  3AGE A;  3BEC A;  3ITB A;  3QHY A;  3LY3 A;  4BEN A;  4JF6 A;  5CXW A;  2JCH A;  1SHV A;  5F1F A;  1DJB A;  2G2W A;  4K91 A;  4OP8 A;  3N8R A;  5FQQ A;  4DDY A;  4P87 A;  2Y2G A;  3IH8 A;  4OPZ A;  1DY6 A;  1ESU A;  1YM1 A;  5GLA A;  1ZG4 A;  4S2P A;  3SS3 A;  3SS4 A;  3WS4 A;  2EFU A;  4S2N C;  1JTD A;  5DTT A;  3C7U A;  3SH9 A;  5U47 A;  3G35 A;  3V3S A;  2ZQ7 A;  1JVJ A;  3G30 A;  3IT9 A;  4MBF A;  2VGJ A;  3IF6 C;  5GHY A;  1K38 A;  3ZG9 B;  4C3Q A;  4C6Y A;  1XPB A;  4WEJ A;  2HP6 A;  4IED A;  2EXB A;  2Y91 A;  1ONG A;  3FKV A;  1YLT A;  3PBR A;  1J9M A;  1W8Y A;  5TR7 A;  2GDN A;  2HDS A;  3NY4 A;  4NK3 A;  2WUQ A;  2Y2N A;  4BL2 A;  3M2K A;  2X71 A;  4ZDX A;  4LCL A;  5EVL A;  3M2J A;  4LCM A;  3VSK A;  3IQA A;  4ZJ3 A;  2EX6 A;  4PMA A;  1BTL A;  2QPN A;  4RYE A;  1QMF A;  2XGN A;  4OOY A;  3A3E A;  3UPP A;  1FSY A;  3ITA A;  4JF5 A;  5FAO A;  5F1G A;  3HLB A;  4GN2 A;  3V50 A;  3IXB A;  3HLG A;  4E6W A;  1BLH A;  3W8K A;  3N4I A;  3E2L A;  1YLJ A;  4P6B A;  3UE1 A;  3VP3 A;  3G32 A;  3HLE A;  5E2E A;  1IYS A;  4BQM A;  2IWB A;  1XA7 A;  3UO9 A;  1YMS A;  2ZM0 A;  4GNU A;  2XFS A;  3HL9 A;  2ZC3 B;  3NDG A;  1XA1 A;  4PM7 A;  5CRF A;  4X56 A;  5FAT A;  3DTM A;  1W7F A;  5CGX A;  3HVF A;  2J9P A;  2H0Y A;  4A5R A;  3BLM A;  4E3K A;  3RXW A;  3PTE A;  2RL3 A;  1FQG A;  5G18 A;  3ZNT A;  1GA0 A;  1ZG6 A;  2ZLY A;  1TDG A;  1K6S A;  5TFQ A;  1ZC2 A;  5KZH A;  1CK3 A;  4LV0 A;  4FSF A;  1XKZ A;  3MZE A;  5FA7 A;  2B5R A;  4OVD A;  3PBN A;  3ZG8 B;  5EOE A;  3S4X A;  4Z9Q A;  3A3I A;  4MLL A;  4X68 A;  2OLU A;  4PM5 A;  1HTZ A;  4IBR A;  3N8L A;  4MNR A;  1NXY A;  3IHB A;  3BM6 A;  2Q9M A;  3Q07 A;  2EFX A;  1CEF A;  3N6I A;  2Y4A A;  4RX3 A;  3S1Y A;  1MBL A;  3BFD A;  1IYQ A;  4H8R A;  4N92 A;  1YLW A;  4K0W A;  3UPN A;  5CGW A;  3G31 A;  1KE3 A;  3D4F A;  4IVI A;  4WYY A;  2EX8 A;  1K6R A;  3Q7V B;  2WGW A;  2H10 A;  2V1Z A;  2WZX A;  2JBF A;  1GHP A;  1FSW A;  1K54 C;  4S2M A;  4E3M A;  1WE4 A;  1GCE A;  5CER A;  3BRM A;  3ZG5 A;  5HAP A;  1KGF A;  5DF9 A;  2HPB A;  3N7W A;  1CI9 A;  4X53 A;  4S2L A;  2Y2K A;  2Y2L A;  4QY5 A;  3DWZ A;  5CGS A;  4S2N A;  1BT5 A;  3GRJ A;  2WGW B;  4LV3 A;  4N9L A;  2WAE A;  2VGK A;  3B3X A;  2ZMA A;  1NZU A;  1U60 A;  4EBP A;  4QB8 A;  3FV7 A;  4KZ5 A;  5FSR A;  1PWG A;  1PIO A;  4KG5 A;  1KDW A;  3RJU A;  3HLW A;  4OH0 A;  3G2Y A;  3BLS A;  1ESI A;  3SOI A;  1RGY A;  3PAG A;  1I2S A;  1FR1 A;  2P9V A;  5CHJ A;  3TSG A;  2R9W A;  3FWL A;  2ZQD A;  4QHC A;  5IHV A;  4P85 A;  4OQ0 A;  4RX2 A;  3A3D A;  4WEK A;  4K0X A;  5M18 A;  1PZO A;  5GLC A;  3W4P A;  5EVI C;  3IWQ A;  3RXX A;  1KVL A;  1IYO A;  1KGG A;  1AXB A;  1C3B A;  5JYP A;  3GR2 A;  2H5S A;  1NJ4 A;  1LI0 A;  3HLF A;  2XR0 A;  3OPL A;  5I94 A;  5KSH A;  3SH8 A;  2ZC4 B;  3AGD A;  4UHU A;  4WMC A;  5FAP A;  3UE0 A;  3A3J A;  1FR6 A;  3IF6 A;  4JXW A;  4DXC A;  1GHI A;  1NY0 A;  1GA9 A;  1ERQ A;  2DCF A;  4YFM A;  1L0D A;  1FCO A;  5CHM A;  1XX2 A;  3EQV A;  3QNC A;  1BZA A;  4PM8 A;  3UNW A;  1KE4 A;  2UWX A;  4D2O A;  1MWU A;  3P98 A;  3WRT A;  1CI8 A;  2Z2M B;  2ZJ9 A;  3VOZ A;  1ERM A;  3OPP A;  2CC1 A;  2DRW A;  1MPL A;  2XK1 A;  4X55 A;  2X01 A;  4UA6 A;  3AGF A;  2J8Y A;  5HAQ A;  2Y2P A;  1JWV A;  3Q7Z A;  3C4O A;  2WYX A;  4UA7 A;  3VFH A;  4OOM A;  3BEB A;  5E2F A;  4EBL A;  4B4Z A;  5FAQ A;  1Q2P A;  1SCW A;  3O88 A;  4U0T A;  2DNS A;  3VFF A;  4QY6 A;  5AQ7 A;  2WAF A;  4KZ3 A;  2WK0 A;  2J9O A;  1ES5 A;  1O7E A;  4R1G A;  4Y0T A;  4FH4 A;  4E3J A;  1Q2Q A;  2ZQA A;  3HBR A;  4OPR A;  4QU3 A;  2Q9N A;  1SDE A;  1K25 A;  3M6H A;  4KG6 A;  2E8I A;  1ES2 A;  4N1H A;  3UY6 A;  3ZVW A;  5DF7 A;  2BLS A;  1HVB A;  2Y2O A;  1LL5 A;  4P0M A;  3NBL A;  2Y59 A;  4NET A;  5M1A A;  3CMZ A;  3NDE A;  5CEB A;  2Y2M A;  1LLB A;  5GL9 A;  5BOH A;  1MKI A;  1N9B A;  1FCN A;  4JXS A;  2HDQ A;  5FI2 A;  1LHY A;  4L0L A;  3HUM A;  4OP5 A;  1DJC A;  1K57 C;  2PU2 A;  1L0G A;  1YLZ A;  4KZB A;  3HUO A;  4R4S A;  1IKI A;  4XUX A;  3TG9 A;  2XD1 A;  3HLC A;  1IYP A;  2V20 A;  5FDH A;  2OLV A;  3MXR A;  5CEC A;  4B88 A;  5F82 A;  5TGF A;  2WKE A;  4O7D A;  4EUZ A;  5EUA A;  5CHU A;  4HBT A;  2OV5 A;  1KGE A;  4CPK A;  3Q7V A;  4RVA A;  3V5M A;  3VOY A;  1O07 A;  3ZDJ A;  5A93 A;  5AQB A;  4N9K A;  3NI9 A;  1MWR A;  3GMW A;  3OCL A;  2Y55 A;  4FD8 A;  2XLN A;  4WM9 A;  4KG2 A;  4S2I A;  3PBO A;  4CJN A;  4B4X A;  1S0W A;  2XF3 A;  3UDF A;  3M6B A;  4R4R A;  3ZNY A;  4BL3 A;  2IWD A;  1M40 A;  3P09 A;  4DE0 A;  3BFC A;  5EVI B;  4E3O A;  4OQG A;  4GB7 A;  2HP9 A;  3WS5 A;  3PBQ A;  2PU4 A;  1BLC A;  1I5Q A;  3V3R A;  1ES3 A;  3G2Z A;  4KQR A;  5J8X A;  5AQA A;  4HEF A;  4KEN B;  4MBK A;  1K55 A;  2XEP A;  3Q82 A;  3WS1 A;  3MFD A;  3MKE A;  2EX2 A;  3FKW A;  3W4O A;  3VP0 A;  2J7V A;  3C5A A;  2WGI A;  2ZC6 B;  4KZ7 A;  3NCK A;  2XH9 A;  1BUE A;  3CJM A;  1YT4 A;  3I7J A;  1RGZ A; 
#chains in the Genus database with same CATH topology
 1ALQ A;  3WAA A;  1W8Q A;  3GV9 A;  5B2I B;  3B6G B;  2ZC5 B;  1ZKJ A;  3NC8 A;  4L9G A;  4GDB A;  2QZ6 A;  4QLC C;  5HX9 A;  4KZA A;  5B31 G;  3E4O A;  3C1C D;  4S2K A;  3HJI A;  4LV2 A;  3LEZ A;  4OPQ A;  2ZM5 A;  1P3P A;  3MMH A;  2W1T B;  4JBF A;  3TOI A;  1E88 A;  4EEU A;  1MWS A;  5GXQ D;  5CPK C;  2FZ0 A;  5KSC A;  1Z6F A;  3S22 A;  4L9E A;  4Y5F A;  4WZ5 C;  3GEC A;  4G91 C;  4KZ4 A;  5BO0 A;  4MBH A;  1KX4 D;  3AZK D;  3KFU G;  1TEM A;  3LR0 A;  3TJZ C;  1KX5 D;  3QNB A;  2YFW B;  5B0Y A;  1F9I A;  4NZ5 A;  1FOF A;  3LZ0 A;  3IX3 A;  5AQ9 A;  3AZG C;  3WAA D;  4HBU A;  3LR3 A;  4Y0O A;  3GQZ A;  2ZL1 B;  1W5D A;  1EI5 A;  2YKF A;  3G34 A;  4FOF A;  1L0E A;  4EET B;  2R9X A;  3CIT A;  3REK C;  1ID3 A;  1IKG A;  3T50 A;  2ZMV A;  4Z1W A;  1P3G C;  4E6X A;  4J8W A;  5AV9 B;  4NKP A;  4WU8 C;  2K31 A;  3OPR A;  1YSP A;  2HZ5 A;  5FL3 A;  3WKJ B;  4WJ3 C;  5GXQ A;  3WTP D;  3F1P A;  4XUZ A;  3UTB C;  4GOG A;  3AZM A;  3V67 A;  3SS5 A;  3MGP A;  3C7V A;  1EW0 A;  5HAI A;  2V1A A;  5B1M B;  3MKF A;  4F94 A;  1OTI A;  1P3K B;  1YLY A;  1F66 B;  3AV1 A;  5DTS A;  4DRA A;  4JGO A;  3VSL A;  2ZQ8 A;  2VQR A;  4FTX A;  2D01 A;  2Y2Q A;  3CUE C;  2Z2L B;  3QP6 A;  5HD3 A;  3EEH A;  1PW8 A;  3IWI A;  2HP5 A;  3MZD A;  1H5X A;  2A24 A;  4LD9 A;  3OPH A;  4N1X A;  3AZH A;  3X1S C;  4OQH A;  3T4Q A;  1AOI D;  3T1S A;  4ZJ1 A;  3IF5 A;  3H0L C;  5EVI D;  1P0Z A;  2PBY A;  3AZJ A;  1XGJ A;  3DWK A;  2MJ6 A;  5D3O A;  1MY8 A;  1TF1 A;  1ZLA C;  5AVE A;  1BLP A;  2RIQ A;  5B0Y B;  3X1S D;  5B2J D;  3BW6 A;  5TBM B;  4HES A;  5M19 A;  5CX7 A;  2HDR A;  1P3I D;  3Q1F A;  1VHM A;  4KUD A;  5DNM D;  4OJL A;  3E0Y A;  2XD5 A;  4C75 A;  5L2F A;  3UTB D;  1QME A;  4ESP A;  4JJN B;  1MKM A;  4QLC A;  1KE0 A;  5HW3 A;  3W4Q A;  4X69 A;  1HQ3 A;  2NQB A;  1N4O A;  2FN2 A;  1MZU A;  4JGR A;  2VKS A;  4X1M A;  5AVF A;  5L8M A;  1DRM A;  3MQQ A;  3AL0 C;  2IWC A;  1M1A B;  4Z5T C;  4JXG A;  1DP9 A;  2Y2H A;  3AZK B;  3OZH A;  3PR6 A;  4HNB A;  5DKK A;  4IBX A;  3ZG0 A;  3MGR B;  5CPJ A;  3C1B A;  3FKE A;  4Z5T B;  1KX5 C;  4H6J A;  3LJA D;  1VEU A;  4NZ4 A;  5CPI D;  3VP1 A;  4M6B A;  4H9S A;  4ETZ A;  3UT9 B;  5EFW A;  4EV4 A;  4FH2 A;  1W2E A;  3KXB A;  3MGS B;  1TVF A;  3OCN A;  3B0C T;  2K2N A;  4IVK A;  4JF4 A;  4J8X C;  4XZQ B;  5EEC A;  4X23 B;  3AGE A;  3QHY A;  3ITB A;  4HMC A;  2NUT C;  1HQ3 D;  2NQB D;  5F1F A;  1K0K A;  4J8X D;  2QYB A;  4K91 A;  5AV9 D;  3E4Q A;  3IH8 A;  4DMZ A;  5BT1 D;  5GSU D;  1YM1 A;  1KX4 C;  4QLC D;  4S2P A;  5LBR A;  3N3F A;  5U47 A;  4C3Q A;  4BWI A;  1GSW A;  5BT1 C;  5DNN D;  1XPB A;  3D72 A;  2HIO A;  4NYY A;  3B33 A;  4BBV A;  2E8J A;  3FKV A;  1P3B C;  3NQU A;  4WU8 B;  5TR7 A;  2GDN A;  3C1C C;  2HDS A;  3NY4 A;  1PNE A;  1XJ2 A;  2JKR M;  5J3W A;  4BL2 A;  4G3K A;  1TS8 A;  4TX8 A;  4LCM A;  5GT0 A;  1HLU P;  4HI4 A;  4CAY B;  1XJ4 A;  5DJT A;  3A1I A;  3ITA A;  4JF5 A;  2DF4 C;  3LIC A;  4BBU A;  3RTY A;  1SKO B;  3WD2 A;  1P3L D;  5EM1 A;  3HLG A;  1BLH A;  3U4L P;  4Z5T D;  2L4R A;  1P3I B;  4WNN B;  3T1Q B;  3VP3 A;  1CQA A;  3F1O A;  3S7O A;  3K3C A;  1H8P A;  3LID A;  3HL9 A;  3NDG A;  5FAT A;  3DTM A;  2VV6 A;  4IBC A;  3PTE A;  1ZLA D;  1FQG A;  5G18 A;  4GH9 A;  1TDG A;  4J8X B;  5B2J A;  5TFQ A;  4FSF A;  1XKZ A;  3LEL A;  5L09 A;  2B5R A;  3T12 B;  3AV2 A;  2VV8 A;  2QWS A;  4J8U A;  2EFX A;  3N6I A;  2GX5 A;  2Y4A A;  4RX3 A;  1YU0 A;  5B2J C;  1MBL A;  3S7Q A;  3BFD A;  1P3L A;  2K7S A;  1YLW A;  3UPN A;  4IBD A;  5CGW A;  5B40 C;  1K6R A;  3AFA A;  4Y3I A;  2H10 A;  5GT0 D;  2ZY4 A;  1GHP A;  1WE4 A;  4Z2I A;  1M1A D;  1GCE A;  3BRM A;  3W98 A;  3AZI A;  5CGS A;  4S2N A;  5AVB B;  5GT3 B;  3TE8 A;  3AFA B;  5J4E A;  4EBP A;  4KZ5 A;  3W99 B;  1PIO A;  5HWT A;  4OH0 A;  5J7E A;  4UPK A;  3V9R B;  3SOI A;  1RGY A;  3PAG A;  4ZRR A;  1P3A B;  1FR1 A;  5CHJ A;  5B24 B;  5DNN B;  4DJ3 A;  3FWL A;  4QHC A;  1STZ A;  4J8U B;  4Z2J A;  4WEK A;  4EUV A;  4K0X A;  5M18 A;  1PZO A;  2PYO A;  1KVL A;  4KUO A;  4Y13 A;  1IFQ A;  3OPL A;  4ZUX B;  2ZC4 B;  3AGD A;  4WMC A;  3MGR A;  4I3A A;  5BPV A;  1CF0 A;  1GA9 A;  5CHM A;  5F6A A;  1XX2 A;  3EQV A;  4D2O A;  1KE4 A;  4QNL A;  3VOZ A;  1ERM A;  3R7W A;  2HUE C;  2DRW A;  2XK1 A;  3B47 A;  4XUJ C;  3KSH A;  3W97 C;  1M18 A;  1M19 B;  3VFH A;  5GXQ C;  5B1L D;  1TS6 A;  5CPJ C;  3WAA C;  3AZG D;  1Q2P A;  4NZ3 A;  3W2Z A;  4IBK A;  3AN2 A;  3R45 B;  4QY6 A;  3F6T A;  4JJN A;  1D7E A;  3WKJ D;  4Y0T A;  4JGP A;  1BYW A;  4KQD A;  4Z2M H;  2Q9N A;  3NQU B;  3P7N A;  2E8I A;  2LB9 A;  4Y17 A;  4N1H A;  4WLA A;  3UY6 A;  3AZM D;  3ZVW A;  3X1U A;  3NBL A;  2Y59 A;  3CWF A;  4IUK A;  1GSX A;  4AFI A;  4ZBJ C;  3NDE A;  3TU4 D;  4NE3 A;  5BOH A;  1ID3 B;  1YU1 A;  1H8M A;  4JXS A;  1FCN A;  4PKY G;  5FI2 A;  5AV5 D;  3KSY A;  1L0G A;  1Z2C B;  1IKI A;  4R6L A;  3KXB B;  2JN7 A;  3LZ0 B;  3TG9 A;  2O99 A;  3UT9 A;  5I5L A;  5CEC A;  2Q0O A;  2L1M A;  2J3T C;  2WKE A;  5AVC C;  4H9R A;  1XFQ A;  4GS9 A;  4ARZ A;  4CPK A;  3AZN C;  1KGE A;  3V5M A;  4B93 A;  4YS3 A;  1P3K A;  5AQB A;  4F3L B;  1MWR A;  3AZK A;  2Y55 A;  3REL D;  3EWK A;  4FD8 A;  4CJN A;  3MNN B;  4H9R B;  3REI D;  5FUG B;  1M40 A;  5GT3 D;  2FJ7 C;  3LIE A;  5AV6 A;  1ES3 A;  1AIW A;  5TJJ A;  2ZY2 A;  2W0N A;  5J8X A;  3H7W A;  4HEF A;  4WU9 C;  3Q82 A;  4KEN B;  4MBK A;  3PHY A;  3MXQ A;  3FKW A;  3F1N A;  2UV0 E;  2WGI A;  5F99 B;  3CJM A;  3I7J A;  1RGZ A;  3GTC A;  4U3T A;  3AZH D;  2WKH A;  1CXW A;  3HRE A;  3WRZ A;  3IXG A;  4BMW A;  2A3U A;  2JKT I;  4WL9 A;  4O8G A;  3UPO A;  1P3O C;  3V39 A;  4ZUX C;  5DNN A;  2XDM A;  4IBF A;  1IEM A;  1P3M C;  3PBS A;  4QD4 A;  1OTB A;  3EOI A;  5IU1 A;  1JWP A;  3AZL B;  2P7J A;  1CJF A;  2PD8 A;  2NUP C;  3AN2 B;  1E25 A;  1PI4 A;  1P3P B;  4JLF A;  3LR5 A;  4K08 A;  5HPI A;  1F2K A;  4E3I A;  2EXA A;  5AV8 C;  2L0W A;  4BD0 A;  1JTG A;  3A3F A;  1KX4 B;  4EWF A;  3SH7 A;  4M3K A;  1X0O A;  3VV4 A;  3UDX A;  1UR8 A;  3LCE A;  3MFX A;  3AZN D;  3ZCZ A;  1KX3 A;  3X1U C;  1Y54 A;  1RCJ A;  2B02 A;  2OOL A;  3O62 B;  4H9O B;  4LD9 C;  4EQ1 A;  3UTA D;  3WAA B;  4FCF A;  5F69 A;  1OT6 A;  1M18 D;  3MGS C;  3B6F A;  3NEC A;  3MVD C;  5DNM A;  4O0P A;  3REK A;  2CV5 D;  1JWZ A;  3C4P A;  1XP4 A;  1KX5 B;  5FEF A;  3AZM B;  3KYZ A;  2NZD D;  4DRT A;  3Q81 A;  3BFF A;  3MR0 A;  5EVI A;  3RH8 B;  5BS7 A;  3KSG A;  5E43 A;  2G7U A;  1YMX A;  3ISG A;  1M6K A;  4EU0 A;  4J8W B;  1N9L A;  1OJ5 A;  5A91 A;  2HDU A;  2XFT A;  4WUJ A;  1PYY A;  4Y0U A;  4G92 B;  4KUK A;  3JYI A;  1O6I A;  5AV6 D;  5HFO A;  3FZC A;  3MNN D;  3MNN C;  3T4O A;  1KX3 D;  1K55 C;  4HME A;  3BFE A;  3X1U B;  4DE2 A;  4EBN A;  4JJN C;  1PRQ A;  1BH9 B;  3IH9 A;  3QP4 A;  5FQK A;  1ERO A;  3IBR A;  4J8X A;  2JHE A;  4GZB A;  4ZAM A;  5B31 A;  3W97 D;  3TW8 A;  2NZD B;  3O3V A;  1BLS A;  3AYW B;  3O62 D;  3C1B C;  4J8V A;  3ZQ5 A;  1FIK A;  3HUN A;  3PXP A;  3CZD A;  4J8W D;  4Z2M G;  3EQU A;  3WA9 B;  4DXB A;  1NRF A;  5E5A D;  1EQZ B;  5B33 D;  2I72 A;  4ZJ2 A;  3AZI C;  5B2J B;  4DE3 A;  3W96 D;  4BJP A;  2ZQ9 A;  4J8V B;  1TS7 A;  3LIA A;  3WS2 A;  1P3B B;  3UMD A;  5GHZ A;  5DJU A;  3MQL A;  3KYE A;  3H0R C;  1V9Y A;  5EOO A;  3WD1 A;  4DRB A;  2QJ5 A;  4NXB A;  2B95 A;  1EAK A;  1PZP A;  1L0F A;  1S6R A;  2ZC7 A;  3G4P A;  3IX8 A;  4PPR A;  4Z66 C;  2J3W A;  4JKT A;  2R78 A;  4H9Q B;  4UAA A;  2IO5 B;  5B1M C;  1EWZ A;  3LYX A;  5HDD A;  2BAS A;  4H6J B;  3ZHH A;  5IT5 A;  2BYK B;  4Z5T A;  5B24 A;  3UE3 A;  3B6F C;  1F5M A;  3MXS A;  2YKH A;  5GT0 C;  1H0G A;  1PW1 A;  3CLO A;  4J8V C;  5HL6 A;  4X23 A;  4LV1 A;  1F66 D;  1EQZ C;  3AZI B;  3MS6 A;  1WYB A;  1ZTU A;  1YU4 A;  1XXM A;  4RA7 A;  4WU9 D;  4ZBE A;  5DF8 A;  2WKP A;  5CTM A;  3C1B B;  3LY3 A;  2WKR A;  4JF6 A;  5CXW A;  2JCH A;  4LPZ A;  5B32 A;  4CLC E;  1DJB A;  2G2W A;  3N8R A;  3LZ1 D;  4WN5 A;  2JKF A;  5GLA A;  3WS4 A;  2EFU A;  4S2N C;  5JRG C;  2BTF P;  4H9O A;  3G35 A;  1CK7 A;  5GHY A;  5G4Z A;  3V3S A;  4MBF A;  2VGJ A;  1K38 A;  4G91 B;  4C6Y A;  2PRF A;  4GLQ A;  4WEJ A;  3REL A;  3KS4 A;  1E8B A;  3PBR A;  1J9M A;  5KDM B;  2DMW A;  4X23 C;  2F2A C;  5AV8 A;  3X1S A;  5L10 A;  4NK3 A;  4LRX C;  1P3L C;  3SZT A;  2JSS A;  2X71 A;  4LCL A;  3WD0 A;  3AZH B;  1BFM A;  2XGN A;  3UPP A;  5F1G A;  1P9W A;  2ARO C;  3V50 A;  3IXB A;  3W97 B;  3QP1 A;  4P6B A;  3TU4 A;  5AY8 A;  3LZ1 B;  3G32 A;  5E2E A;  4BQM A;  3UO9 A;  3ULF A;  3AZM C;  4ETX A;  1XA1 A;  5CRF A;  4X56 A;  4A5R A;  1MC0 A;  4YM6 D;  2O9A A;  1OTA A;  2RL3 A;  1GA0 A;  3LEL D;  3QP2 A;  2BYM B;  3S7P A;  1ZC2 A;  1F66 C;  4Z2L A;  4LV0 A;  1S32 B;  3BWL A;  3LJA B;  3H82 A;  1B67 A;  3CAX A;  3A3I A;  4MLL A;  4PM5 A;  4MNR A;  3BM6 A;  1P3O A;  4I3I A;  2Q9M A;  3MNN A;  1CEF A;  3WTP B;  4EEP A;  3HSH A;  3AN2 C;  4HP9 A;  4R8P A;  3T4T A;  1KE3 A;  4WYY A;  1ODV A;  1P3K D;  5AY8 C;  4HMD A;  2WGW A;  2V1Z A;  1FSW A;  1LSV A;  2HIO C;  1N1J A;  2F8N B;  1U35 B;  5CER A;  3ZG5 A;  5HAP A;  2HPB A;  4S2L A;  2Y2K A;  3O5Y A;  4QY5 A;  2YFW A;  1BT5 A;  2WGW B;  4Q0J A;  2EA9 A;  3A6N A;  3ICY A;  2Y79 A;  1F66 A;  3D3O A;  1U60 A;  4QB8 A;  1D1J A;  4EXO A;  3FV7 A;  5B1M A;  5F99 C;  4KG5 A;  1KDW A;  3RJU A;  3K3D A;  3HLW A;  2ARO B;  5DNM B;  2XA7 S;  2ZQD A;  3SW1 A;  1NLY A;  1P3K C;  3W4P A;  3RXX A;  4UUZ B;  3C2W A;  1IYO A;  3M7P A;  5JYP A;  3JPU A;  3GR2 A;  4X25 A;  1LI0 A;  3HLF A;  5JRG A;  5AV9 A;  3UE6 A;  4XZQ C;  5EV0 A;  3A3J A;  3IF6 A;  4DXC A;  2V8F A;  2DCF A;  3B0D B;  1L0D A;  1Y4O A;  1QO6 A;  1UWN X;  1P3A D;  1S1Z A;  4YWZ A;  1P3F B;  2JKR I;  3UNW A;  4IBE A;  3QNC A;  4PM8 A;  2W3E A;  2UWX A;  3P98 A;  1CI8 A;  2ZJ9 A;  5JRG B;  1MPL A;  2X01 A;  3MGQ A;  1JFI B;  4X55 A;  3WA9 C;  2J8Y A;  4M4X A;  5HAQ A;  4IJG A;  4YM6 C;  1JWV A;  1YUE A;  3C4O A;  3EPH A;  3LZ0 C;  2OAQ 1;  4OOM A;  4Q0I A;  5E2F A;  4B9O A;  1S67 L;  1SCW A;  3O88 A;  1UGU A;  3VFF A;  2ARO A;  5AQ7 A;  4I39 A;  5F99 A;  1W63 M;  3AV2 D;  1U35 C;  4FH4 A;  4OPR A;  4ZUX A;  3KUY D;  1OJG A;  5B31 D;  4MB3 A;  3FPW A;  3EPK A;  1SDE A;  3M6H A;  1NWZ A;  3UB7 A;  3W98 C;  4HGA B;  2W3F A;  1W1Y A;  1HVB A;  1P3F D;  1LL5 A;  4P0M A;  3WTP C;  3B0B A;  4NET A;  3CMZ A;  4G92 C;  2HJ9 C;  1MKI A;  2HDQ A;  5EVE A;  4WU8 D;  4L0L A;  3HUM A;  1DJC A;  2PD7 A;  4R4S A;  2G5H C;  1UR9 A;  5GXQ B;  3LEQ A;  5HWW A;  5FDH A;  4B88 A;  1U35 A;  4NY2 A;  5F5Y A;  1N1J B;  1S66 L;  1TD5 A;  5CPI A;  4HBT A;  2BYM A;  5BNX B;  1ID3 D;  4NXF A;  4RVA A;  1S4S A;  1P34 C;  3AFA D;  1P97 A;  5G4Y A;  3BQA A;  3VH6 T;  1L6J A;  5BNV B;  3PYP A;  3AZK C;  4WM9 A;  2BYK A;  2F8N D;  2XLN A;  3PBO A;  2XF3 A;  5AY8 B;  3AV2 B;  4DE0 A;  5B0Z A;  3BFC A;  1YSQ A;  2FH5 A;  3VH6 A;  3WS5 A;  3PBQ A;  4OJ5 A;  2GNX A;  1LL8 A;  2L5A A;  3QP8 A;  5L07 A;  3G6O A;  1P3P C;  4KQR A;  5AQA A;  1K55 A;  1S1Y A;  3MFD A;  3MKE A;  2EX2 A;  4CLC A;  3C5A A;  2ZC6 B;  4IBI A;  2XH9 A;  3LJA C;  3R45 A;  3REH B;  2PT7 A;  1TZY A;  2CWE A;  1P3B A;  5GT3 C;  3AZG A;  3PAE A;  3FYZ A;  2C5W B;  1P3O B;  4RQ9 A;  2XRO A;  3L28 A;  4H9P B;  1EQZ A;  4XUJ A;  3WA9 A;  1H0I A;  4PHT A;  1YQS A;  3LO7 A;  5GLB A;  1J3W A;  3IWO A;  4EQI A;  1P3G A;  5B1L B;  1A7W A;  3E2K A;  5IS1 A;  1TZY B;  2EX9 A;  5B32 C;  1MWT A;  5FQI A;  3T4K A;  3MVD A;  1SDN A;  5E5A C;  3HCY A;  3HJK A;  3UDI A;  3IXH A;  3KYQ A;  4P6Z M;  5B0Y D;  3X1S B;  1NYY A;  4R38 A;  4GD6 A;  4OPY A;  3N8S A;  5F83 A;  4E44 A;  3LGO A;  4LGW A;  3MBZ A;  4NYU A;  5B0Z B;  5AV5 C;  1I2W A;  4UA9 A;  5DVA A;  3TU4 C;  3AV1 D;  1FCM A;  3AZN A;  2RCX A;  1NRJ A;  1F98 A;  4NXE A;  4WBG A;  3UTA B;  1W63 Q;  1P3A A;  2JKT M;  4CLC C;  4KUD D;  5JYO A;  3LIB A;  3X1V A;  2P74 A;  4R0Q A;  3ZVT A;  2VX8 A;  2FFY A;  4XZQ A;  5AVC B;  3MGS A;  3UTB B;  2QMI A;  3ZG7 B;  3L25 A;  1YLP A;  3LFV A;  4H9Q A;  3WKJ C;  1L3L A;  4X1L A;  4OJO A;  4E3N A;  1K56 A;  3VP4 A;  2F8N K;  3WTP E;  1MXO A;  4OJ6 A;  5CPJ D;  1P34 A;  2VGL S;  4YNR A;  1M19 D;  1K56 D;  5CP6 B;  3L27 A;  5E5A A;  3KWQ B;  3A6N D;  3A0V A;  1PFL A;  1PZR A;  1XJ6 A;  3LY4 A;  1KX3 B;  2G2U A;  4KZ6 A;  1LI9 A;  2WAD A;  4KQQ A;  1KDS A;  3DW0 A;  3ZGA B;  4XXR A;  2A2L A;  2FJ7 A;  3KSI A;  1UWP X;  5DTK A;  3MGR D;  1HZO A;  4KQO A;  1PI5 A;  4KZ8 A;  1OT9 A;  1H0M A;  3MZF A;  1E6R A;  4UQI M;  3X1V B;  3MGP C;  1ZHH B;  2ZM2 A;  1G6A A;  4R8P C;  4XT2 A;  2XQZ A;  1G68 A;  1RP5 A;  4CLC B;  5FEG A;  4QJG A;  4KUD B;  2Y2J A;  2IOU A;  1TDL A;  3F1O B;  3LI9 A;  5E2H A;  4CSR B;  5FQM A;  2ZQC A;  1P3I A;  2WZZ A;  5AV5 B;  3BJN A;  4BD1 A;  3CG5 A;  1AWI A;  1T3U A;  4JXV A;  4EW7 A;  2A49 A;  2ZD8 A;  4AWL C;  3MGR C;  1E3U D;  3D9Y A;  3S7N A;  5CTN A;  4NG2 A;  1DJA A;  3IF6 B;  5B40 A;  4WV4 B;  3H7W B;  4R3B A;  4MEZ A;  4KZ9 A;  3AZH C;  1XJ3 A;  4GKU A;  1XGI A;  3EPL A;  2PBD P;  2PYR A;  3T4J A;  2FFF B;  3VE4 A;  1NYM A;  3W96 B;  1WWS A;  1TS0 A;  4OLG A;  3VP2 A;  3VOL A;  1SKF A;  2B18 A;  4WZ5 A;  3OLO A;  4KUD C;  1E6Z A;  1CEG A;  4ZBJ B;  4HQA A;  5FI6 A;  1LL9 A;  4KGC D;  3VMA A;  1PDC A;  2V8C A;  4DKI A;  3MGP B;  3UN7 A;  4FUW A;  3X1T D;  2V2F F;  5AVB C;  4ZTK A;  1L2S A;  5B0Y C;  2JC7 A;  2XA7 M;  2KOI A;  3IXD A;  2LB5 A;  3REL C;  3ZFZ A;  5A90 A;  1PWD A;  1ZLA B;  3OC2 A;  2QJ7 A;  1OPX A;  3DTE A;  4BBT A;  1OME A;  1H3O B;  1H3Q A;  5CPJ B;  5BNV A;  5AVC D;  2J3T D;  4DDY A;  1DY6 A;  1ESU A;  1ZG4 A;  3SS4 A;  4E6W A;  2ZQ7 A;  3ZG9 B;  3IT9 A;  3CI6 A;  3O62 A;  3EGD C;  3C8C A;  2HP6 A;  3B0C W;  4IED A;  2EXB A;  2KLI A;  2Y8H A;  3X1T A;  1KX5 A;  1A0K A;  4MCW A;  2W3G A;  2GJ3 A;  3MF0 A;  2P08 A;  5C5K A;  3E4P A;  2Y2N A;  4LRZ E;  1P3B D;  2O9C A;  3M2J A;  3IQA A;  5AVB D;  2EX6 A;  4ZJ3 A;  2OWJ A;  4PMA A;  4J8U C;  4GHI A;  2QPN A;  4RYE A;  1QMF A;  3TU4 B;  5DNN C;  4OOY A;  2Z6C A;  5B24 C;  2J8P A;  2PYP A;  4GN2 A;  4UEY A;  4UUZ A;  5GSU C;  5B2I A;  3B6G A;  3AZL C;  4IBJ A;  5B33 B;  1GSV A;  3UE1 A;  3AFA C;  4MMN A;  1HQ3 C;  1R4V A;  2NQB C;  3KXB D;  1VET A;  1XA7 A;  1YMS A;  4PM7 A;  5HZH A;  1W7F A;  2J9P A;  1JNU A;  1GPF A;  2H0Y A;  5BS7 C;  3BLM A;  4F3L A;  3RXW A;  1KOU A;  5B33 A;  1CK3 A;  2A24 B;  3MZE A;  4OVD A;  2IA2 A;  3REL B;  3ZG8 B;  3S4X A;  1ID3 C;  1HTZ A;  4IBR A;  4R8P D;  3IHB A;  5FUG A;  3Q07 A;  4GHI B;  1YU2 A;  2XSS A;  3DAV A;  3REH C;  1P3F C;  3LI8 A;  1NLZ A;  3G31 A;  3P5J B;  4IVI A;  3B0D C;  1T1A A;  2EX8 A;  2H28 A;  4NE5 A;  5GT3 A;  3WTP A;  5AVB A;  4ARZ B;  2JBF A;  4S2M A;  2GZA A;  3NUL A;  3F1P B;  3WD4 A;  4HH2 A;  4UQI S;  1KGF A;  3VH5 T;  3N7W A;  5B2I C;  3B6G C;  3KS8 A;  1CI9 A;  5DF9 A;  2Y2L A;  3AV2 C;  3L29 A;  4E45 A;  4LV3 A;  3A0S A;  2WAE A;  2VGK A;  3B3X A;  4HHD A;  1PWG A;  2ZBB A;  2V0U A;  3G2Y A;  3BLS A;  4GHA A;  3KUY C;  1ESI A;  1H3O A;  4O01 A;  1M1A C;  2P9V A;  2QHK A;  2O0Y A;  2ZL1 A;  3L7H A;  1U35 D;  4P85 A;  4OQ0 A;  2AVX A;  5GLC A;  5EVI C;  1SZV A;  3W97 A;  1ULY A;  2H5S A;  2XR0 A;  2RVQ C;  5KSH A;  4UHU A;  3X1V D;  5FAP A;  3UE0 A;  3C1C B;  1FR6 A;  4JXW A;  2YFV B;  1GHI A;  1ERQ A;  4YFM A;  4R8P B;  4XT2 B;  1FCO A;  1E15 A;  1BZA A;  1MWU A;  3WRT A;  4MN6 A;  3NQJ B;  3BY9 A;  5AV8 B;  3AZE A;  3AZF B;  1P3A C;  1G6O A;  3OPP A;  2CC1 A;  4KGC A;  3T4L A;  4HGA C;  4UA6 A;  3AGF A;  2VV7 A;  2PYO C;  3Q7Z A;  1SKO A;  4YM6 A;  5K5B A;  4HJ4 A;  2M1C A;  3NOT C;  4WF0 A;  2HV1 A;  5HPF A;  4EBL A;  5B32 D;  1W1V A;  3NHQ A;  2W3D A;  4HIA A;  4HP4 A;  2WAF A;  2QKP A;  2WK0 A;  2NZD A;  3LUQ A;  3W99 A;  1ES5 A;  4GW9 A;  3UT9 C;  4R1G A;  1P34 B;  2ZY3 A;  3UB5 P;  2ZQA A;  3EPJ A;  3H9W A;  1K25 A;  1ES2 A;  4CQH A;  5CHL B;  2PHY A;  4I38 A;  4HOI A;  2Y2O A;  5MC7 A;  2W3H A;  1T1C A;  2ACG A;  2Y2M A;  5GL9 A;  4OJP A;  4EES A;  1P3L B;  4OP5 A;  1DP8 A;  1K57 C;  2PU2 A;  1YLZ A;  3HUO A;  4PKY A;  3AYW D;  3LEL C;  2G5I C;  4Q0H A;  2HGV A;  1ZLA A;  4XUX A;  2XD1 A;  1KS0 A;  1IYP A;  3AN2 D;  3W98 B;  2V20 A;  2OLV A;  3C30 A;  3W99 C;  1VEU B;  1P3P D;  5TGF A;  5AV9 C;  4O7D A;  1P9R A;  5DKL A;  5EUA A;  5CHU A;  4EUZ A;  1OGB A;  4Z2G A;  3TRC A;  3REK B;  5E5A B;  3NI9 A;  3AZJ D;  3DBA A;  1N9N A;  5B32 B;  3GMW A;  3OCL A;  2ARO D;  4KG2 A;  1M1A A;  5CPI C;  1ED7 A;  1KU5 A;  3M6B A;  4BL3 A;  4NFT A;  2IWD A;  4HY8 A;  3P09 A;  1XFN A;  4WNN A;  4OQG A;  1P34 D;  4YM6 B;  1BLC A;  1I5Q A;  3V3R A;  4QWO A;  1KX4 A;  3REJ D;  3IS2 A;  1HQ3 B;  2NQB B;  4Y2F A;  2XEP A;  3W4O A;  5GT0 B;  3VP0 A;  4KZ7 A;  4GHL A;  3AYW A;  3MJQ A;  1YT4 A;  4LEN A;  3UTA A;  1LT0 A;  3JVU A;  3VH5 W;  2YFV A;  4Q8I A;  3U2A A;  3C1C A;  1H8Y A;  2P04 A;  4IBG A;  2VZW A;  5B31 C;  5JRG D;  5FQJ A;  1BH9 A;  3MQ0 A;  3WS0 A;  5GHX A;  2IO5 C;  4OKP A;  3UB6 A;  5GSU A;  4L9F A;  4PM9 A;  4KGC B;  1ONH A;  4Z2K A;  2OWH A;  3REJ C;  2ZY5 A;  4R70 A;  3W98 D;  4ID4 A;  5DNM C;  4WZ4 A;  4DF6 A;  4PAU A;  3NIA A;  1P3I C;  4HH3 A;  4MDZ A;  2HUE B;  2ZM8 A;  5B32 G;  4MB5 A;  5B1L A;  3CHW P;  1K54 A;  1BSG A;  1DP6 A;  4J8V D;  1K4F A;  2PR6 A;  3LIF A;  4PM6 A;  2HIO B;  2KDK A;  2INW A;  3AZF A;  3GSG A;  4OQI A;  3B6F D;  4OOL A;  2Y2I A;  1AOI C;  1BUL A;  2EWV A;  3LZ0 D;  2P9V B;  5A92 A;  3GVB A;  4XZQ D;  3WA9 D;  5EPH A;  2X02 A;  1EQZ D;  4YS3 B;  4IJE A;  5B31 B;  3AZE D;  5DFY A;  1TAF B;  2BG1 A;  2I9V A;  4BLM A;  3NJA A;  3T1X A;  4HJ3 A;  4G3W A;  4DDS A;  1W1P A;  3REI A;  1S32 C;  3KO6 A;  1VB6 A;  3RFB A;  3UTB A;  2PAV P;  2VLG A;  4YOF A;  1PWC A;  1K4E A;  5B1M D;  1ACF A;  4MB4 A;  5FAS A;  3W96 C;  4H9N A;  2CMN A;  3IHA A;  4EO5 C;  3AZL A;  4Y7P A;  4QLC B;  3KUY A;  1VQQ A;  2V1B A;  5DFX A;  5FI7 A;  4R23 A;  5CPI B;  4J8W C;  1E3U A;  3HLD A;  4IJF A;  3UT9 D;  5F99 D;  1W79 A;  5AY8 D;  1P3G D;  3C1B D;  3REK D;  5EE8 A;  1ES4 A;  4WMC D;  1E4D A;  5E2G A;  4ME4 A;  1AOI A;  4AWL B;  4WEL A;  3AZJ B;  1S32 D;  2PYO D;  3E98 A;  2HIO D;  3UB8 A;  3BYD A;  5GLD A;  3B6F B;  4GCZ A;  3MVD B;  1FIL A;  2W1T A;  4X6T A;  3F1N B;  1VET B;  3O86 A;  3AZE C;  4E3L A;  2WGV A;  4KHA B;  3O62 C;  4LD9 B;  4GDN A;  1YPR A;  2JKG A;  1OTD A;  2LY8 A;  1M18 B;  3BFG A;  4MN7 A;  5HL1 A;  2WKQ A;  5CPK A;  5HAR A;  5AV6 C;  3R7W B;  3X1V C;  5CPK D;  1D06 A;  4H9P A;  5B0Z D;  1B6W A;  4LRY C;  3DTK A;  3WWX A;  1WYC A;  1K57 A;  4JJN D;  4G3V A;  3AV1 B;  4OLD A;  5FDS A;  3EGX C;  3KX0 X;  2JE5 A;  4P6Z S;  3MSH A;  1IEL A;  4S2J A;  1VM1 A;  4DJ2 A;  1NZO A;  1KX3 C;  4GJ4 A;  2F8N H;  3R4K A;  1KVM A;  4GS9 B;  4DE1 A;  4S2O A;  1GHM A;  5KIZ A;  2OSU A;  5FQ9 A;  3MGQ B;  1JFI A;  3NOP C;  3T4S A;  3MVD D;  1T19 A;  4R3J A;  3MGS D;  2C6W B;  5B2I D;  3B6G D;  4U0X A;  1P3M A;  4X23 D;  4LD9 D;  3A1K A;  3FDD A;  1GOI A;  3X1U D;  4H9N B;  1H8Z A;  2NZD C;  4QPR A;  5CED A;  3AZF C;  2WKI A;  3O87 A;  5CP6 D;  3OOV A;  3KWQ D;  3WD3 A;  4Z66 A;  1F1E A;  4OON A;  5AV6 B;  2H0T A;  3PBT A;  4H9S C;  3REH D;  3VE3 A;  4JGQ A;  4YIN A;  3WKJ A;  1M18 C;  4GD8 A;  1HD8 A;  3UTA C;  1LSX A;  1TAF A;  4JPM A;  4Z66 B;  3BEC A;  4YS3 D;  4BEN A;  4LFU A;  1SHV A;  3IX4 A;  2M7V A;  4ZUX D;  2OAP 1;  3CUE A;  4OP8 A;  3P01 A;  5FQQ A;  4D60 A;  4P87 A;  2Y2G A;  4OPZ A;  2M7U A;  3SS3 A;  3SH9 A;  1JTD A;  3A0R A;  3C7U A;  5DTT A;  1JVJ A;  3G30 A;  3LZ1 C;  3IF6 C;  3AZJ C;  3W96 A;  3B42 A;  5HWV A;  4R3A A;  2Y91 A;  2F8N A;  3OBF A;  5AV5 A;  4I5S A;  1ONG A;  3IP4 C;  3KXB C;  1YLT A;  4CSR A;  1TZY C;  2ZOI A;  1W8Y A;  3EG5 B;  3W99 D;  3UME A;  4MN5 A;  1G28 A;  5BO0 B;  2WUQ A;  3BQ8 A;  1TZY D;  2VK3 A;  3M2K A;  3AYW C;  2ZMF A;  5B24 D;  2W27 A;  4ZDX A;  5EVL A;  3VSK A;  2PR5 A;  4J8U D;  1BTL A;  3VH6 W;  3IBJ A;  1T1B A;  5C3I C;  3A3E A;  1FSY A;  4E04 A;  5FAO A;  5KDM A;  2PDR A;  3HLB A;  2PYO B;  1E6N A;  3W8K A;  5CPK B;  4HJ6 A;  3N4I A;  4NZ1 A;  1YLJ A;  2V9A A;  3E2L A;  1G5U A;  3JVV A;  5HSQ A;  4CAY A;  3HLE A;  4KHA A;  1IYS A;  2IWB A;  2FJ7 D;  2ZM0 A;  4GNU A;  2XFS A;  5KMW A;  1LSW A;  2ZC3 B;  4YS3 C;  3V9R A;  1P3F A;  3HVF A;  5CGX A;  3AZI D;  4Z66 D;  4E3K A;  3REI C;  4IHQ A;  4NE6 A;  3KSF A;  3ZNT A;  1GXD A;  1ZG6 A;  2ZLY A;  3LZ1 A;  1K6S A;  3KWQ C;  1AOI B;  5KZH A;  1M19 A;  4DQY B;  3X1T B;  5FA7 A;  3PBN A;  1N9O A;  1HTA A;  4NXG A;  5EOE A;  4Z9Q A;  4X68 A;  2OLU A;  3BY8 A;  5G49 B;  3N8L A;  1NXY A;  5JA4 A;  4WZS B;  5B33 C;  1OGG A;  1BH8 A;  3S1Y A;  1IYQ A;  2V0W A;  4H8R A;  4N92 A;  3KUY B;  3MQO A;  4K0W A;  5HDC A;  2F8N G;  1WA9 A;  3D4F A;  1Z09 A;  3REJ B;  3X1T C;  3Q7V B;  3MGQ D;  2WZX A;  3A6N B;  2O9B A;  1K54 C;  4KGC C;  4E3M A;  2VJW A;  2FJ7 B;  2V5O A;  3REI B;  2J80 A;  1S4R A;  4X53 A;  3DWZ A;  2D02 A;  3GRJ A;  2RVQ D;  2RTS A;  4N9L A;  3L2A A;  2ZMA A;  3KWQ A;  1NZU A;  5B0Z C;  5CP6 A;  3CPT A;  5FSR A;  3ZYT A;  1I2S A;  3AZN B;  4IUH A;  3TSG A;  5C3I B;  2R9W A;  4IBB A;  5IHV A;  1P3G B;  5G49 A;  3L9K A;  4RX2 A;  3MGQ C;  3A3D A;  5HDS A;  3IWQ A;  1KGG A;  1AXB A;  1C3B A;  3LJA A;  3H82 B;  1NJ4 A;  1S32 A;  5I94 A;  5AVC A;  5B1L C;  3SH8 A;  1OTE A;  2CV5 A;  3FPV A;  4WU9 A;  3AZG B;  4EER A;  4XUJ D;  5B40 B;  1NY0 A;  3FG8 A;  5A8B A;  4WU9 B;  2DQN C;  2Z2M B;  2CV5 C;  3FC7 A;  5AJG A;  5AV8 D;  3UB9 A;  3QP5 A;  5TBM A;  2HF6 A;  3MGP D;  2Y2P A;  5GSU B;  3LEL B;  2W1R A;  2WYX A;  4UA7 A;  3BEB A;  3AZE B;  4B4Z A;  5FAQ A;  3NQJ A;  3WX7 A;  3REH A;  4U0T A;  2DNS A;  4I3J A;  1P3O D;  4KZ3 A;  3HON A;  2J9O A;  3C38 A;  4LG2 A;  1O7E A;  3K2N A;  4E3J A;  2W8S A;  1Q2Q A;  3HBR A;  5BNX A;  3A6N C;  4QU3 A;  2CV5 B;  1M19 C;  3EEA A;  3T1R A;  3IS2 B;  4KG6 A;  1P3M D;  5B40 D;  4XUJ B;  1YAX A;  4LLO B;  2XRN A;  5DF7 A;  2BLS A;  2KX6 A;  5M1A A;  3AZL D;  1IOU A;  1Q9C A;  5CEB A;  4EO5 B;  1LLB A;  1W1T A;  5HD5 A;  1N9B A;  1LHY A;  1BH8 B;  4WU8 A;  4Z2H A;  4KZB A;  4NEE D;  4CLC D;  3HLC A;  3MXR A;  5F82 A;  3NOU C;  3AV1 C;  3L26 A;  2OV5 A;  3Q7V A;  1E6P A;  3VOY A;  1O07 A;  2D49 A;  3ZDJ A;  5A93 A;  4N9K A;  1T18 A;  3CPT B;  3GDI A;  4DN0 A;  2Z6D A;  2VA0 A;  1J7M A;  2HJE A;  3H0M C;  1P3M B;  1Y28 A;  2ZOH A;  1YKD A;  4S2I A;  1YU3 A;  4B4X A;  1S0W A;  4II7 A;  3UDF A;  4R4R A;  5JA4 B;  3ZNY A;  5CP6 C;  3VH5 A;  5EVI B;  4E3O A;  4GB7 A;  3AZF D;  2HP9 A;  5EM0 A;  2PU4 A;  3G2Z A;  2VEA A;  1WWI A;  2EWW A;  1V9Z A;  5F68 A;  3REJ A;  4OUI A;  3WS1 A;  2VGL M;  4Y15 A;  2J7V A;  3LR4 A;  3NCK A;  1BUE A;  3DTI A; 
#chains in the Genus database with same CATH homology
 1ALQ A;  3WAA A;  1W8Q A;  3GV9 A;  5B2I B;  3B6G B;  2ZC5 B;  1ZKJ A;  3NC8 A;  4GDB A;  2QZ6 A;  4QLC C;  5HX9 A;  4KZA A;  5B31 G;  3C1C D;  4S2K A;  4LV2 A;  3LEZ A;  4OPQ A;  2ZM5 A;  1P3P A;  4JBF A;  3TOI A;  1MWS A;  5GXQ D;  5CPK C;  5KSC A;  1Z6F A;  3S22 A;  4WZ5 C;  4G91 C;  4KZ4 A;  5BO0 A;  4MBH A;  1KX4 D;  3AZK D;  3KFU G;  1TEM A;  1KX5 D;  3QNB A;  2YFW B;  5B0Y A;  4NZ5 A;  1FOF A;  3LZ0 A;  5AQ9 A;  3AZG C;  3WAA D;  4HBU A;  4Y0O A;  3GQZ A;  1W5D A;  1EI5 A;  3G34 A;  1L0E A;  2R9X A;  3REK C;  1ID3 A;  1IKG A;  1P3G C;  4E6X A;  4J8W A;  5AV9 B;  4WU8 C;  3OPR A;  3WKJ B;  4WJ3 C;  5GXQ A;  3WTP D;  4XUZ A;  3UTB C;  4GOG A;  3AZM A;  3SS5 A;  3MGP A;  3C7V A;  5HAI A;  5B1M B;  3MKF A;  4F94 A;  1P3K B;  1YLY A;  1F66 B;  3AV1 A;  5DTS A;  4DRA A;  3VSL A;  2ZQ8 A;  2VQR A;  2Y2Q A;  2Z2L B;  1PW8 A;  3IWI A;  2HP5 A;  3MZD A;  1H5X A;  4LD9 A;  3OPH A;  4N1X A;  3AZH A;  3X1S C;  4OQH A;  1AOI D;  4ZJ1 A;  3IF5 A;  3H0L C;  5EVI D;  2PBY A;  3AZJ A;  1XGJ A;  3DWK A;  5D3O A;  1MY8 A;  1ZLA C;  1BLP A;  2RIQ A;  5B0Y B;  3X1S D;  5B2J D;  4HES A;  5M19 A;  2HDR A;  3Q1F A;  1P3I D;  4KUD A;  5DNM D;  4OJL A;  2XD5 A;  4C75 A;  5L2F A;  3UTB D;  1QME A;  4JJN B;  4QLC A;  1KE0 A;  5HW3 A;  3W4Q A;  4X69 A;  1HQ3 A;  2NQB A;  1N4O A;  3AL0 C;  2IWC A;  1M1A B;  4Z5T C;  4JXG A;  2Y2H A;  3AZK B;  3OZH A;  4IBX A;  3ZG0 A;  3MGR B;  5CPJ A;  3C1B A;  3FKE A;  4Z5T B;  1KX5 C;  3LJA D;  4NZ4 A;  5CPI D;  3VP1 A;  4M6B A;  4H9S A;  3UT9 B;  4EV4 A;  4FH2 A;  1W2E A;  3KXB A;  3MGS B;  1TVF A;  3OCN A;  4JF4 A;  3B0C T;  4IVK A;  4J8X C;  4XZQ B;  5EEC A;  4X23 B;  3AGE A;  3QHY A;  3ITB A;  1HQ3 D;  2NQB D;  5F1F A;  4J8X D;  4K91 A;  5AV9 D;  3IH8 A;  5BT1 D;  5GSU D;  1YM1 A;  1KX4 C;  4QLC D;  4S2P A;  3N3F A;  5U47 A;  4C3Q A;  5BT1 C;  5DNN D;  1XPB A;  2HIO A;  4NYY A;  3FKV A;  1P3B C;  3NQU A;  4WU8 B;  5TR7 A;  2GDN A;  3C1C C;  2HDS A;  3NY4 A;  4BL2 A;  4LCM A;  5GT0 A;  4CAY B;  3A1I A;  3ITA A;  4JF5 A;  2DF4 C;  1P3L D;  3HLG A;  1BLH A;  4Z5T D;  1P3I B;  4WNN B;  3VP3 A;  3NDG A;  3HL9 A;  5FAT A;  3DTM A;  4IBC A;  3PTE A;  1ZLA D;  1FQG A;  5G18 A;  4GH9 A;  1TDG A;  4J8X B;  5B2J A;  5TFQ A;  4FSF A;  1XKZ A;  3LEL A;  2B5R A;  3AV2 A;  4J8U A;  2EFX A;  3N6I A;  2Y4A A;  4RX3 A;  1YU0 A;  5B2J C;  1MBL A;  3BFD A;  1P3L A;  1YLW A;  3UPN A;  4IBD A;  5CGW A;  5B40 C;  1K6R A;  3AFA A;  2H10 A;  5GT0 D;  2ZY4 A;  1GHP A;  1WE4 A;  1GCE A;  1M1A D;  3BRM A;  3W98 A;  3AZI A;  5CGS A;  4S2N A;  5AVB B;  5GT3 B;  3AFA B;  4EBP A;  4KZ5 A;  3W99 B;  1PIO A;  4OH0 A;  4UPK A;  3V9R B;  3SOI A;  1RGY A;  3PAG A;  1P3A B;  1FR1 A;  5CHJ A;  5B24 B;  5DNN B;  3FWL A;  4QHC A;  4J8U B;  4WEK A;  4K0X A;  5M18 A;  1PZO A;  2PYO A;  1KVL A;  3OPL A;  4ZUX B;  2ZC4 B;  3AGD A;  4WMC A;  3MGR A;  5BPV A;  1GA9 A;  5CHM A;  1XX2 A;  3EQV A;  4D2O A;  1KE4 A;  4QNL A;  3VOZ A;  1ERM A;  2HUE C;  2DRW A;  2XK1 A;  4XUJ C;  3W97 C;  1M18 A;  1M19 B;  3VFH A;  5GXQ C;  5B1L D;  5CPJ C;  3WAA C;  3AZG D;  1Q2P A;  4NZ3 A;  4IBK A;  3AN2 A;  3R45 B;  4QY6 A;  3F6T A;  4JJN A;  3WKJ D;  4Y0T A;  4Z2M H;  2Q9N A;  3NQU B;  2E8I A;  4N1H A;  3UY6 A;  3AZM D;  3ZVW A;  3X1U A;  3NBL A;  2Y59 A;  4ZBJ C;  3NDE A;  3TU4 D;  4NE3 A;  5BOH A;  1ID3 B;  1YU1 A;  4JXS A;  1FCN A;  5FI2 A;  5AV5 D;  3KSY A;  1L0G A;  1Z2C B;  1IKI A;  3KXB B;  3LZ0 B;  3TG9 A;  3UT9 A;  5CEC A;  2WKE A;  5AVC C;  4H9R A;  4CPK A;  3AZN C;  1KGE A;  3V5M A;  4YS3 A;  1P3K A;  5AQB A;  1MWR A;  3AZK A;  2Y55 A;  3REL D;  4FD8 A;  4CJN A;  3MNN B;  4H9R B;  3REI D;  5FUG B;  1M40 A;  5GT3 D;  2FJ7 C;  5AV6 A;  1ES3 A;  2ZY2 A;  5J8X A;  4HEF A;  4KEN B;  4WU9 C;  3Q82 A;  4MBK A;  3FKW A;  2WGI A;  5F99 B;  3CJM A;  3I7J A;  1RGZ A;  3GTC A;  4U3T A;  3AZH D;  2WKH A;  3HRE A;  3WRZ A;  3IXG A;  2A3U A;  3UPO A;  1P3O C;  3V39 A;  4ZUX C;  5DNN A;  2XDM A;  4IBF A;  1IEM A;  1P3M C;  3PBS A;  4QD4 A;  1JWP A;  3AZL B;  3AN2 B;  1E25 A;  1PI4 A;  1P3P B;  4JLF A;  4E3I A;  2EXA A;  5AV8 C;  4BD0 A;  1JTG A;  3A3F A;  1KX4 B;  4EWF A;  3SH7 A;  4M3K A;  3UDX A;  3LCE A;  3AZN D;  3ZCZ A;  1KX3 A;  3X1U C;  1Y54 A;  1RCJ A;  3O62 B;  4H9O B;  4LD9 C;  3UTA D;  3WAA B;  4FCF A;  1M18 D;  3MGS C;  3B6F A;  3MVD C;  5DNM A;  3REK A;  2CV5 D;  1JWZ A;  3C4P A;  1XP4 A;  1KX5 B;  3AZM B;  2NZD D;  4DRT A;  3Q81 A;  3BFF A;  5EVI A;  5BS7 A;  5E43 A;  1YMX A;  3ISG A;  1M6K A;  4J8W B;  5A91 A;  2HDU A;  2XFT A;  1PYY A;  4Y0U A;  4G92 B;  3JYI A;  5AV6 D;  5HFO A;  3FZC A;  3MNN D;  3MNN C;  1KX3 D;  1K55 C;  3BFE A;  3X1U B;  4DE2 A;  4EBN A;  4JJN C;  1BH9 B;  3IH9 A;  5FQK A;  1ERO A;  4J8X A;  4GZB A;  4ZAM A;  5B31 A;  3W97 D;  2NZD B;  3O3V A;  1BLS A;  3AYW B;  3O62 D;  3C1B C;  4J8V A;  3HUN A;  3CZD A;  4J8W D;  4Z2M G;  3EQU A;  3WA9 B;  4DXB A;  1NRF A;  5E5A D;  1EQZ B;  5B33 D;  2I72 A;  4ZJ2 A;  3AZI C;  5B2J B;  4DE3 A;  3W96 D;  4BJP A;  2ZQ9 A;  4J8V B;  3WS2 A;  1P3B B;  5GHZ A;  5EOO A;  3H0R C;  4DRB A;  1PZP A;  1L0F A;  1S6R A;  2ZC7 A;  3G4P A;  4PPR A;  4Z66 C;  4JKT A;  4H9Q B;  4UAA A;  2IO5 B;  5B1M C;  1EWZ A;  3ZHH A;  2BYK B;  4Z5T A;  5B24 A;  3UE3 A;  3B6F C;  3MXS A;  5GT0 C;  1PW1 A;  4J8V C;  4X23 A;  4LV1 A;  1F66 D;  1EQZ C;  3AZI B;  1WYB A;  1YU4 A;  1XXM A;  4RA7 A;  4WU9 D;  4ZBE A;  5DF8 A;  5CTM A;  3C1B B;  3LY3 A;  4JF6 A;  5CXW A;  2JCH A;  5B32 A;  1DJB A;  2G2W A;  3N8R A;  3LZ1 D;  5GLA A;  3WS4 A;  2EFU A;  4S2N C;  5JRG C;  4H9O A;  3G35 A;  5GHY A;  3V3S A;  4MBF A;  2VGJ A;  1K38 A;  4G91 B;  4C6Y A;  4WEJ A;  3REL A;  3KS4 A;  3PBR A;  1J9M A;  5KDM B;  4X23 C;  2F2A C;  5AV8 A;  3X1S A;  4NK3 A;  1P3L C;  2JSS A;  2X71 A;  4LCL A;  3AZH B;  1BFM A;  2XGN A;  3UPP A;  5F1G A;  2ARO C;  3V50 A;  3IXB A;  3W97 B;  4P6B A;  3TU4 A;  5AY8 A;  3LZ1 B;  3G32 A;  5E2E A;  4BQM A;  3UO9 A;  3AZM C;  1XA1 A;  5CRF A;  4X56 A;  4A5R A;  4YM6 D;  2RL3 A;  1GA0 A;  3LEL D;  2BYM B;  1ZC2 A;  1F66 C;  4LV0 A;  1S32 B;  3LJA B;  1B67 A;  3A3I A;  4MLL A;  4PM5 A;  4MNR A;  3BM6 A;  1P3O A;  2Q9M A;  3MNN A;  1CEF A;  3WTP B;  3HSH A;  3AN2 C;  4R8P A;  1KE3 A;  4WYY A;  1P3K D;  5AY8 C;  2WGW A;  2V1Z A;  1FSW A;  2HIO C;  1N1J A;  2F8N B;  1U35 B;  5CER A;  3ZG5 A;  5HAP A;  2HPB A;  4S2L A;  2Y2K A;  4QY5 A;  2YFW A;  1BT5 A;  2WGW B;  3A6N A;  1F66 A;  1U60 A;  4QB8 A;  3FV7 A;  5B1M A;  5F99 C;  4KG5 A;  1KDW A;  3RJU A;  3HLW A;  2ARO B;  5DNM B;  2ZQD A;  1P3K C;  3W4P A;  3RXX A;  4UUZ B;  1IYO A;  5JYP A;  3GR2 A;  1LI0 A;  3HLF A;  5JRG A;  5AV9 A;  4XZQ C;  3A3J A;  3IF6 A;  4DXC A;  2DCF A;  3B0D B;  1L0D A;  1P3A D;  1P3F B;  3UNW A;  4IBE A;  3QNC A;  4PM8 A;  2UWX A;  3P98 A;  1CI8 A;  2ZJ9 A;  5JRG B;  1MPL A;  2X01 A;  3MGQ A;  1JFI B;  4X55 A;  3WA9 C;  2J8Y A;  5HAQ A;  4YM6 C;  1JWV A;  1YUE A;  3C4O A;  3EPH A;  3LZ0 C;  4OOM A;  5E2F A;  1SCW A;  3O88 A;  3VFF A;  2ARO A;  5AQ7 A;  5F99 A;  3AV2 D;  1U35 C;  4FH4 A;  4OPR A;  4ZUX A;  3KUY D;  5B31 D;  3EPK A;  1SDE A;  3M6H A;  3W98 C;  4HGA B;  1HVB A;  1P3F D;  1LL5 A;  4P0M A;  3WTP C;  3B0B A;  4NET A;  3CMZ A;  4G92 C;  1MKI A;  2HDQ A;  4WU8 D;  4L0L A;  3HUM A;  1DJC A;  4R4S A;  2G5H C;  5GXQ B;  5FDH A;  4B88 A;  1U35 A;  4NY2 A;  1N1J B;  5CPI A;  4HBT A;  2BYM A;  5BNX B;  1ID3 D;  4RVA A;  1P34 C;  3AFA D;  3VH6 T;  5BNV B;  3AZK C;  4WM9 A;  2BYK A;  2F8N D;  2XLN A;  3PBO A;  2XF3 A;  5AY8 B;  3AV2 B;  4DE0 A;  5B0Z A;  3BFC A;  3VH6 A;  3WS5 A;  3PBQ A;  4OJ5 A;  2L5A A;  4KQR A;  1P3P C;  5AQA A;  1K55 A;  3MFD A;  3MKE A;  2EX2 A;  3C5A A;  2ZC6 B;  4IBI A;  2XH9 A;  3LJA C;  3R45 A;  3REH B;  1TZY A;  2CWE A;  1P3B A;  5GT3 C;  3AZG A;  3PAE A;  3FYZ A;  2C5W B;  1P3O B;  3L28 A;  4H9P B;  1EQZ A;  4XUJ A;  3WA9 A;  1YQS A;  3LO7 A;  5GLB A;  3IWO A;  4EQI A;  1P3G A;  5B1L B;  1A7W A;  3E2K A;  1TZY B;  2EX9 A;  5B32 C;  1MWT A;  5FQI A;  3MVD A;  1SDN A;  5E5A C;  3UDI A;  3IXH A;  5B0Y D;  3X1S B;  1NYY A;  4GD6 A;  4OPY A;  3N8S A;  5F83 A;  4E44 A;  3MBZ A;  4NYU A;  5B0Z B;  5AV5 C;  1I2W A;  4UA9 A;  5DVA A;  3TU4 C;  3AV1 D;  1FCM A;  3AZN A;  2RCX A;  4WBG A;  3UTA B;  1P3A A;  4KUD D;  5JYO A;  3X1V A;  2P74 A;  4R0Q A;  3ZVT A;  2FFY A;  4XZQ A;  5AVC B;  3MGS A;  3UTB B;  2QMI A;  3ZG7 B;  3L25 A;  1YLP A;  4H9Q A;  3WKJ C;  4OJO A;  4E3N A;  1K56 A;  3VP4 A;  2F8N K;  3WTP E;  1MXO A;  4OJ6 A;  5CPJ D;  1P34 A;  1M19 D;  1K56 D;  5CP6 B;  3L27 A;  5E5A A;  3KWQ B;  3A6N D;  1PZR A;  3LY4 A;  1KX3 B;  2G2U A;  4KZ6 A;  1LI9 A;  2WAD A;  4KQQ A;  1KDS A;  3DW0 A;  3ZGA B;  4XXR A;  2FJ7 A;  5DTK A;  3MGR D;  1HZO A;  4KQO A;  1PI5 A;  4KZ8 A;  3MZF A;  3X1V B;  3MGP C;  2ZM2 A;  1G6A A;  4R8P C;  2XQZ A;  1G68 A;  1RP5 A;  4QJG A;  4KUD B;  2Y2J A;  2IOU A;  1TDL A;  5E2H A;  5FQM A;  4CSR B;  2ZQC A;  1P3I A;  2WZZ A;  5AV5 B;  4BD1 A;  3CG5 A;  1T3U A;  4JXV A;  2A49 A;  2ZD8 A;  4AWL C;  3MGR C;  1E3U D;  5CTN A;  1DJA A;  3IF6 B;  5B40 A;  4WV4 B;  4R3B A;  4MEZ A;  4KZ9 A;  3AZH C;  4GKU A;  1XGI A;  3EPL A;  2FFF B;  1NYM A;  3W96 B;  1WWS A;  4OLG A;  3VP2 A;  1SKF A;  4WZ5 A;  4KUD C;  1CEG A;  4ZBJ B;  5FI6 A;  1LL9 A;  4KGC D;  3VMA A;  4DKI A;  3MGP B;  3UN7 A;  3X1T D;  2V2F F;  5AVB C;  4ZTK A;  1L2S A;  5B0Y C;  2JC7 A;  3IXD A;  3REL C;  3ZFZ A;  5A90 A;  1PWD A;  1ZLA B;  3OC2 A;  1OME A;  1H3O B;  5CPJ B;  5BNV A;  5AVC D;  4DDY A;  1DY6 A;  1ESU A;  1ZG4 A;  3SS4 A;  4E6W A;  2ZQ7 A;  3ZG9 B;  3IT9 A;  3O62 A;  2HP6 A;  3B0C W;  4IED A;  2EXB A;  3X1T A;  1KX5 A;  2Y2N A;  1P3B D;  3M2J A;  3IQA A;  5AVB D;  2EX6 A;  4ZJ3 A;  4PMA A;  4J8U C;  2QPN A;  4RYE A;  1QMF A;  3TU4 B;  5DNN C;  4OOY A;  5B24 C;  2J8P A;  4GN2 A;  4UUZ A;  5GSU C;  5B2I A;  3B6G A;  3AZL C;  4IBJ A;  5B33 B;  3UE1 A;  3AFA C;  1HQ3 C;  1R4V A;  2NQB C;  3KXB D;  1XA7 A;  1YMS A;  4PM7 A;  1W7F A;  2J9P A;  2H0Y A;  5BS7 C;  3BLM A;  3RXW A;  5B33 A;  1CK3 A;  3MZE A;  4OVD A;  3REL B;  3ZG8 B;  3S4X A;  1ID3 C;  1HTZ A;  4IBR A;  4R8P D;  3IHB A;  5FUG A;  3Q07 A;  1YU2 A;  3REH C;  1P3F C;  3G31 A;  3P5J B;  4IVI A;  3B0D C;  2EX8 A;  4NE5 A;  5GT3 A;  3WTP A;  5AVB A;  2JBF A;  4S2M A;  1KGF A;  3VH5 T;  3N7W A;  5B2I C;  3B6G C;  3KS8 A;  1CI9 A;  5DF9 A;  2Y2L A;  3AV2 C;  3L29 A;  4E45 A;  4LV3 A;  2WAE A;  2VGK A;  3B3X A;  1PWG A;  3G2Y A;  3BLS A;  4GHA A;  3KUY C;  1ESI A;  1H3O A;  1M1A C;  2P9V A;  1U35 D;  4P85 A;  4OQ0 A;  5GLC A;  5EVI C;  3W97 A;  1ULY A;  2H5S A;  2XR0 A;  2RVQ C;  5KSH A;  4UHU A;  3X1V D;  5FAP A;  3UE0 A;  3C1C B;  1FR6 A;  4JXW A;  2YFV B;  1GHI A;  1ERQ A;  4YFM A;  4R8P B;  1FCO A;  1BZA A;  1MWU A;  3WRT A;  3NQJ B;  5AV8 B;  3AZE A;  3AZF B;  1P3A C;  3OPP A;  2CC1 A;  4KGC A;  4HGA C;  4UA6 A;  3AGF A;  2PYO C;  3Q7Z A;  4YM6 A;  4EBL A;  5B32 D;  2WAF A;  2WK0 A;  2NZD A;  3W99 A;  1ES5 A;  3UT9 C;  4R1G A;  1P34 B;  2ZY3 A;  2ZQA A;  3EPJ A;  1K25 A;  1ES2 A;  5CHL B;  2Y2O A;  2Y2M A;  5GL9 A;  4OJP A;  1P3L B;  4OP5 A;  1K57 C;  2PU2 A;  1YLZ A;  3HUO A;  3AYW D;  3LEL C;  2G5I C;  1ZLA A;  4XUX A;  2XD1 A;  1IYP A;  3AN2 D;  3W98 B;  2V20 A;  2OLV A;  3W99 C;  1P3P D;  5TGF A;  5AV9 C;  4O7D A;  4EUZ A;  5EUA A;  5CHU A;  3REK B;  5E5A B;  3NI9 A;  3AZJ D;  3GMW A;  5B32 B;  3OCL A;  2ARO D;  4KG2 A;  1M1A A;  5CPI C;  1KU5 A;  3M6B A;  4BL3 A;  4NFT A;  2IWD A;  3P09 A;  4WNN A;  4OQG A;  1P34 D;  4YM6 B;  1BLC A;  1I5Q A;  3V3R A;  1KX4 A;  3REJ D;  1HQ3 B;  2NQB B;  2XEP A;  3W4O A;  5GT0 B;  3VP0 A;  4KZ7 A;  4GHL A;  3AYW A;  1YT4 A;  4LEN A;  3UTA A;  3VH5 W;  2YFV A;  4Q8I A;  3C1C A;  1H8Y A;  4IBG A;  5B31 C;  5JRG D;  5FQJ A;  1BH9 A;  3WS0 A;  5GHX A;  2IO5 C;  4OKP A;  5GSU A;  4PM9 A;  4KGC B;  1ONH A;  3REJ C;  2ZY5 A;  3W98 D;  4ID4 A;  5DNM C;  4WZ4 A;  4DF6 A;  3NIA A;  1P3I C;  2HUE B;  2ZM8 A;  5B32 G;  5B1L A;  1K54 A;  1BSG A;  4J8V D;  1K4F A;  4PM6 A;  2HIO B;  3AZF A;  3GSG A;  4OQI A;  3B6F D;  4OOL A;  2Y2I A;  1AOI C;  1BUL A;  3LZ0 D;  2P9V B;  5A92 A;  3GVB A;  4XZQ D;  3WA9 D;  5EPH A;  2X02 A;  1EQZ D;  4YS3 B;  4IJE A;  5B31 B;  3AZE D;  1TAF B;  2BG1 A;  4BLM A;  4DDS A;  3REI A;  1S32 C;  3UTB A;  1PWC A;  1K4E A;  5B1M D;  5FAS A;  3W96 C;  4H9N A;  3IHA A;  4EO5 C;  3AZL A;  4Y7P A;  4QLC B;  3KUY A;  1VQQ A;  5FI7 A;  4R23 A;  5CPI B;  4J8W C;  1E3U A;  3HLD A;  4IJF A;  3UT9 D;  5F99 D;  1W79 A;  5AY8 D;  1P3G D;  3C1B D;  3REK D;  5EE8 A;  1ES4 A;  4WMC D;  1E4D A;  5E2G A;  1AOI A;  4AWL B;  4WEL A;  3AZJ B;  1S32 D;  2PYO D;  2HIO D;  3BYD A;  5GLD A;  3B6F B;  3MVD B;  4X6T A;  3O86 A;  3AZE C;  4E3L A;  2WGV A;  4KHA B;  3O62 C;  4LD9 B;  4GDN A;  3BFG A;  2LY8 A;  1M18 B;  5HL1 A;  5CPK A;  5HAR A;  5AV6 C;  3X1V C;  5CPK D;  4H9P A;  5B0Z D;  1B6W A;  3WWX A;  1WYC A;  1K57 A;  4JJN D;  3AV1 B;  4OLD A;  2JE5 A;  1IEL A;  4S2J A;  1VM1 A;  1NZO A;  1KX3 C;  2F8N H;  1KVM A;  4DE1 A;  4S2O A;  1GHM A;  2OSU A;  5FQ9 A;  3MGQ B;  1JFI A;  3MVD D;  4R3J A;  3MGS D;  2C6W B;  5B2I D;  3B6G D;  4U0X A;  1P3M A;  4X23 D;  4LD9 D;  3A1K A;  3FDD A;  3X1U D;  4H9N B;  1H8Z A;  2NZD C;  5CED A;  3AZF C;  2WKI A;  3O87 A;  5CP6 D;  3KWQ D;  4OON A;  4Z66 A;  1F1E A;  5AV6 B;  2H0T A;  3PBT A;  4H9S C;  3REH D;  4YIN A;  3WKJ A;  1M18 C;  4GD8 A;  1HD8 A;  3UTA C;  1TAF A;  4JPM A;  4Z66 B;  3BEC A;  4YS3 D;  4BEN A;  1SHV A;  4ZUX D;  4OP8 A;  5FQQ A;  4P87 A;  2Y2G A;  4OPZ A;  3SS3 A;  3SH9 A;  1JTD A;  5DTT A;  3C7U A;  1JVJ A;  3G30 A;  3LZ1 C;  3IF6 C;  3AZJ C;  3W96 A;  2Y91 A;  2F8N A;  5AV5 A;  1ONG A;  3IP4 C;  3KXB C;  1YLT A;  4CSR A;  1TZY C;  1W8Y A;  3EG5 B;  3W99 D;  5BO0 B;  2WUQ A;  1TZY D;  3M2K A;  3AYW C;  5B24 D;  4ZDX A;  5EVL A;  3VSK A;  4J8U D;  1BTL A;  3VH6 W;  5C3I C;  3A3E A;  1FSY A;  5FAO A;  5KDM A;  3HLB A;  2PYO B;  3W8K A;  5CPK B;  3N4I A;  4NZ1 A;  1YLJ A;  3E2L A;  4CAY A;  3HLE A;  4KHA A;  1IYS A;  2IWB A;  2FJ7 D;  2ZM0 A;  4GNU A;  2XFS A;  5KMW A;  2ZC3 B;  4YS3 C;  3V9R A;  1P3F A;  3HVF A;  5CGX A;  3AZI D;  4Z66 D;  4E3K A;  3REI C;  4NE6 A;  3ZNT A;  1ZG6 A;  2ZLY A;  3LZ1 A;  1K6S A;  3KWQ C;  1AOI B;  5KZH A;  1M19 A;  4DQY B;  3X1T B;  5FA7 A;  3PBN A;  1HTA A;  5EOE A;  4Z9Q A;  4X68 A;  2OLU A;  5G49 B;  3N8L A;  1NXY A;  5JA4 A;  4WZS B;  5B33 C;  1BH8 A;  3S1Y A;  1IYQ A;  4H8R A;  4N92 A;  3KUY B;  4K0W A;  2F8N G;  3D4F A;  3REJ B;  3X1T C;  3Q7V B;  3MGQ D;  2WZX A;  3A6N B;  1K54 C;  4KGC C;  4E3M A;  2FJ7 B;  3REI B;  4X53 A;  3DWZ A;  3GRJ A;  2RVQ D;  4N9L A;  3L2A A;  2ZMA A;  3KWQ A;  1NZU A;  5B0Z C;  5CP6 A;  5FSR A;  1I2S A;  3AZN B;  3TSG A;  5C3I B;  2R9W A;  4IBB A;  5IHV A;  1P3G B;  5G49 A;  4RX2 A;  3MGQ C;  3A3D A;  3IWQ A;  1KGG A;  1AXB A;  1C3B A;  3LJA A;  1NJ4 A;  1S32 A;  5I94 A;  5AVC A;  5B1L C;  3SH8 A;  2CV5 A;  4WU9 A;  3AZG B;  4XUJ D;  5B40 B;  1NY0 A;  4WU9 B;  2DQN C;  2Z2M B;  2CV5 C;  5AV8 D;  3MGP D;  2Y2P A;  5GSU B;  3LEL B;  2WYX A;  4UA7 A;  3BEB A;  3AZE B;  4B4Z A;  5FAQ A;  3NQJ A;  3WX7 A;  3REH A;  4U0T A;  2DNS A;  1P3O D;  4KZ3 A;  3HON A;  2J9O A;  4LG2 A;  1O7E A;  4E3J A;  2W8S A;  1Q2Q A;  3HBR A;  5BNX A;  3A6N C;  4QU3 A;  2CV5 B;  1M19 C;  4KG6 A;  1P3M D;  5B40 D;  4XUJ B;  5DF7 A;  2BLS A;  5M1A A;  3AZL D;  1Q9C A;  5CEB A;  4EO5 B;  1LLB A;  1N9B A;  1LHY A;  1BH8 B;  4WU8 A;  4KZB A;  3HLC A;  3MXR A;  5F82 A;  3AV1 C;  3L26 A;  2OV5 A;  3Q7V A;  3VOY A;  1O07 A;  3ZDJ A;  5A93 A;  4N9K A;  3H0M C;  1P3M B;  4S2I A;  1YU3 A;  4B4X A;  1S0W A;  3UDF A;  4R4R A;  5JA4 B;  3ZNY A;  5CP6 C;  3VH5 A;  5EVI B;  4E3O A;  4GB7 A;  3AZF D;  2HP9 A;  2PU4 A;  3G2Z A;  1WWI A;  3REJ A;  4OUI A;  3WS1 A;  2J7V A;  3NCK A;  1BUE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...