2Y2NA

Penicillin-binding protein 1b (pbp-1b) in complex with an alkyl boronate (e07)
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
488
structure length
468
Chain Sequence
b'ISEITYSDGTVIASIDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTGQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PENICILLIN-BINDING PROTEIN 1B
publication title Structure-Guided Design of Cell Wall Biosynthesis Inhibitors that Overcome Beta-Lactam Resistance in Staphylococcus Aureus (Mrsa).
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
total genus 160
structure length 468
sequence length 488
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2y2nA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2y2nA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2y2nA02
3CZDA 2J9PA 3G2ZA 2BLSA 3A3IA 3O88A 1SHVA 1S6RA 2Y2PA 4GKUA 1ES4A 4GNUA 1CI8A 3SH7A 1RP5A 1BULA 4LENA 2XGNA 3NI9A 1XX2A 1ERQA 1PYYA 5KMWA 2OLVA 2Y2NA 5DTTA 3ZGAB 2PU2A 2Z2MB 3Q7ZA 5F83A 4ZJ3A 1ZC2A 1G68A 3MZFA 4OOLA 5EECA 1IYQA 5FAQA 4DDYA 1Y54A 3GVBA 2Y59A 2EX2A 1NRFA 5G18A 2X71A 3UDXA 2Y91A 2WZXA 4HESA 5CEDA 2JC7A 5CECA 5HAPA 3BEBA 1YLYA 4LCLA 3A3JA 4GDBA 4UA7A 3ZG0A 3HLFA 4OPQA 2EX9A 1YM1A 2EXAA 3MXRA 4S2IA 5GLBA 4BL3A 1DJAA 4U0XA 2JBFA 4DE2A 4K0WA 1FCMA 1PZOA 5EE8A 5EVIC 5M1AA 4S2PA 2ZQDA 3IWQA 4S2NC 4U0TA 5F82A 1JWZA 4KQQA 4X53A 3V3RA 3A3DA 4OLGA 4P87A 4UAAA 5FA7A 3LEZA 4KZ8A 3EQVA 3C4OA 3C7UA 2J8YA 1TVFA 3NY4A 1ES3A 3IHAA 3WRZA 5HX9A 1EWZA 4PM8A 3CMZA 4EBLA 4OQ0A 3O87A 2R9XA 5FSRA 2Y2KA 3GSGA 2VGKA 1YQSA 2ZM8A 5AQBA 5FASA 1E3UA 2HP6A 2XDMA 2XH9A 4ZJ2A 1JTGA 1YLWA 2XFSA 1RGZA 4OQHA 1LLBA 3FWLA 1H5XA 1PWCA 4L0LA 4RYEA 5EVIA 4S2NA 4DE3A 4GOGA 4WM9A 3HLBA 3G32A 1W79A 4OQGA 3ITAA 4GZBA 5FI2A 1H8YA 1AXBA 4Q8IA 1E3UD 5KSHA 4KZBA 4EBPA 3JYIA 2OV5A 2ZJ9A 4EWFA 2V2FF 5JYOA 1QMEA 5CHMA 1SDEA 2ZD8A 5EVID 5DF9A 4P85A 1NXYA 3NDEA 4JF4A 5CERA 3PBNA 1DJCA 1K56D 2ZC5B 4JKTA 4NK3A 1K57C 4Y0OA 4FSFA 2IWBA 3BLMA 5CGSA 2V1ZA 3HLDA 1TDLA 2WYXA 4BQMA 4OP5A 3PBTA 3MKEA 4X6TA 2I72A 4X55A 2GDNA 3S1YA 4X69A 2XR0A 1K6SA 2H0TA 3IF6B 4N9LA 4N1HA 4N92A 2P74A 4R0QA 4QY6A 3IH9A 3BFGA 1ERMA 2Q9NA 5TGFA 3ZVWA 3IHBA 4S2OA 2A3UA 1KE3A 3PBSA 3N8RA 4KZ6A 5F1GA 3SS4A 5CEBA 5M19A 1BLCA 2ZQCA 5GHYA 3ZG9B 4IVIA 2HP5A 1ONHA 3GMWA 3ITBA 3MXSA 3NCKA 3ZFZA 2X02A 3IXGA 1CI9A 5DTKA 1K4EA 2ZLYA 1L0EA 1K57A 1VM1A 3BECA 1WE4A 3HUOA 3OCLA 1WYBA 3SS3A 3W8KA 3C4PA 4XUZA 1JTDA 1W8YA 4C75A 1LI9A 5EUAA 4DDSA 2J7VA 3UPOA 1GHIA 1W7FA 2FFYA 4KG5A 3QNBA 3VP2A 3S4XA 4DF6A 5FQQA 3CG5A 5CTNA 4QB8A 4FH4A 5HFOA 3VOYA 1W8QA 2FFFB 2DRWA 1IYPA 3N8LA 1LL5A 1M40A 3DWKA 1SDNA 3MZEA 1FCNA 4BL2A 5AQAA 2PBYA 4E3NA 4BENA 2RL3A 1ES5A 1K54C 1SKFA 3N8SA 3OZHA 1MWTA 4PMAA 4QU3A 4WBGA 5EOOA 3RXWA 3VP4A 2WAEA 3ZG7B 4DE1A 5CHJA 2WAFA 5EVLA 3QNCA 4JBFA 3UN7A 3VP3A 4Y7PA 1DJBA 1ZG4A 2XK1A 4MBKA 5L2FA 3HUNA 1WYCA 2Y55A 1E4DA 1BLHA 4IVKA 3UPNA 1FQGA 1BUEA 5A92A 4GN2A 2EXBA 1I2SA 4LV3A 1IYSA 4HEFA 1PWDA 2WGIA 2WZZA 1NZUA 4KZ3A 4WMCA 1L0GA 3N7WA 4MBHA 3HLGA 2WGWA 4NETA 4RX3A 1YT4A 4DE0A 5AQ9A 3WS1A 5FDHA 3IT9A 3ZNYA 3UDIA 2ZC6B 2G2WA 3Q7VA 3QHYA 5FQKA 4DKIA 4BLMA 3EQUA 1BLSA 4KZ9A 5KZHA 4FD8A 1MPLA 3C7VA 4P0MA 4PM7A 3Q82A 4WMCD 1RCJA 3RJUA 3UE0A 3BFCA 4MEZA 3FV7A 4WZ4A 3SH8A 4E6XA 4KG6A 1M6KA 2ZC3B 3W4QA 2HDSA 1PIOA 1MWSA 4EQIA 2HP9A 2XD1A 3IF5A 3ZVTA 4DXBA 2XEPA 1KDSA 1YLJA 3IWOA 4ID4A 3MZDA 2EFUA 4OLDA 2ZQ8A 2XF3A 1C3BA 3WRTA 2J9OA 4BD0A 5AQ7A 3G2YA 3RXXA 4ZDXA 1MWRA 1NJ4A 1NY0A 3PBRA 1IKGA 4LCMA 1FSYA 3LCEA 3GRJA 4OPRA 5EOEA 5FAOA 4JF6A 1MBLA 1PW1A 4S2KA 3N4IA 1CEFA 5JYPA 4R4SA 3UY6A 1EI5A 3AGFA 1K56A 2WKEA 4B88A 4JXSA 4IEDA 3V3SA 5GHXA 1KGFA 1OMEA 1XP4A 3UNWA 2VGJA 4OPZA 3OPPA 1YLTA 1Q2PA 2WGWB 1W5DA 4KG2A 1XXMA 4MLLA 3NDGA 4ZBEA 3IXHA 2OSUA 2XD5A 3DWZA 1K6RA 4B4ZA 1ESIA 3Q7VB 5EPHA 5TFQA 4K0XA 2WKIA 4JF5A 4Y0UA 5HL1A 3OCNA 3Q07A 5GLAA 3S22A 3PBQA 1YMXA 3AGDA 1K55C 4X56A 1HVBA 4OQIA 4LV0A 3BRMA 4Z9QA 1KE0A 4KZAA 3N6IA 3PBOA 4KZ4A 1CEGA 4PM9A 5DF7A 3MBZA 4YFMA 4JPMA 1XGJA 3A3FA 3V50A 5CGXA 4OP8A 1PW8A 2G2UA 4MBFA 5EVIB 4FH2A 1KVLA 1H8ZA 2DNSA 5HAIA 2B5RA 1PWGA 5FI6A 3O86A 1XKZA 2V20A 3LO7A 4GDNA 2WKHA 4DRTA 3LY4A 3M6HA 1JVJA 4UA6A 4C3QA 1JWVA 3V39A 3WWXA 4S2JA 3UE1A 3VSKA 1KE4A 3HBRA 2ZMAA 1XA1A 1BLPA 4PM5A 3M2JA 3P98A 3ZDJA 3DTMA 1DY6A 4QJGA 2Y2OA 2EX6A 1GA9A 1I2WA 3UO9A 1K38A 1L0DA 2Y2GA 3G31A 4OPYA 3Q81A 3MFDA 2H5SA 1ALQA 2Y2LA 1YMSA 3NBLA 4GB7A 5GLDA 5A93A 3G4PA 2ZQ7A 5HARA 4UHUA 1ZKJA 4B4XA 5FATA 4R4RA 2DCFA 4ZJ1A 3W4OA 4LV2A 5GHZA 5I94A 5A91A 5DVAA 1KGGA 3GQZA 3UDFA 2P9VA 2Y2JA 4M3KA 4ZAMA 1EROA 4WEKA 1VQQA 5IHVA 2WUQA 3G30A 2HDQA 4WEJA 5GLCA 2ZQAA 4A5RA 1ZG6A 3A3EA 1IKIA 4XXRA 5E2FA 3HUMA 1PI5A 1HZOA 5FI7A 2H0YA 1L2SA 1L0FA 3V5MA 3BM6A 3TSGA 3VMAA 4EV4A 4UA9A 1FOFA 3B3XA 3NC8A 5GL9A 3SS5A 3HLEA 1MXOA 1BT5A 4E3MA 1O07A 4N1XA 1JWPA 2E8IA 3D4FA 4HBUA 2UWXA 1BTLA 4E3OA 1YLZA 2H10A 3Q1FA 5FQ9A 2JE5A 5FQMA 1BZAA 4LV1A 2HDUA 4QY5A 3GR2A 4C6YA 4IBXA 1E25A 4KQRA 5D3OA 1K54A 1FR1A 2Y2HA 1XPBA 3HL9A 3ISGA 2Q9MA 5FQIA 5DF8A 2OLUA 1K25A 3SH9A 1G6AA 3E2LA 3ZG8B 4OVDA 2WADA 1ES2A 3OPHA 3ZNTA 4JLFA 4BD1A 1YLPA 1PZPA 5CTMA 1N9BA 2P9VB 3IF6C 3BLSA 1J9MA 4ZTKA 4YINA 2HPBA 4CPKA 4Y0TA 2XFTA 3P09A 3UPPA 5F1FA 3BFFA 5HW3A 4S2LA 2QMIA 3WS2A 4R3BA 5E2EA 5A90A 2Y2MA 1IYOA 1MKIA 2JCHA 2Z2LB 3FYZA 2A49A 3GV9A 5KSCA 1FCOA 1IEMA 3ZCZA 1KDWA 3C5AA 3FKVA 4E3IA 3PTEA 1ESUA 5FAPA 3DW0A 3TOIA 2R9WA 3WS5A 2EFXA 2Y2QA 4R23A 3GTCA 3M2KA 5CGWA 3BYDA 4WYYA 4OKPA 3G34A 5BOHA 2ZQ9A 4OONA 4RX2A 3W4PA 4RVAA 3IF6A 1FSWA 5CRFA 3BFDA 3IQAA 3O3VA 3FZCA 4EBNA 4WZ5C 4GD6A 1K4FA 1NYYA 1IELA 1LHYA 4GD8A 5TR7A 4E3KA 1SCWA 1Z6FA 2QZ6A 4HBTA 5E43A 5U47A 1TEMA 2C5WB 2C6WB 4WELA 4E3LA 4H8RA 3PAGA 5DTSA 2RCXA 3IWIA 3OPRA 3ZHHA 2CC1A 3OPLA 3G35A 4OOMA 3VFFA 2Y4AA 1CK3A 2ZM2A 1GHPA 3NIAA 4D2OA 4EUZA 2QPNA 5E2GA 1TDGA 4JXGA 4QD4A 4S2MA 3VP0A 3IXBA 1LL9A 3BFEA 1NYMA 3VFHA 1S0WA 3E2KA 5HAQA 4WZ5A 4JXWA 2PU4A 1FR6A 3AGEA 4O7DA 2Y2IA 2X01A 1KGEA 2ZC4B 3M6BA 4JXVA 1RGYA 3LY3A 5CXWA 4CJNA 3FKWA 2WK0A 5M18A 4QHCA 1NZOA 4E6WA 1MWUA 1K55A 3OC2A 1HTZA 2HDRA 3VOZA 1O7EA 4OOYA 3IH8A 1HD8A 5E2HA 3CJMA 4R3JA 1Q2QA 1PI4A 5CHUA 3WS0A 2IWDA 1KVMA 4KQOA 4DXCA 4IBRA 3HLCA 3PAEA 1MY8A 1GHMA 1BSGA 2IWCA 2XLNA 4PM6A 4R1GA 4OH0A 3VSLA 2BG1A 3MKFA 4PPRA 3HVFA 1LI0A 3I7JA 3SOIA 4KZ7A 3ZG5A 4K91A 4P6BA 4RA7A 3IXDA 3HREA 1GCEA 1U60A 4KENB 4FCFA 4U3TA 1QMFA 1GA0A 1I5QA 4XUXA 1XA7A 2EX8A 2XQZA 4X68A 4E3JA 2ZC7A 4N9KA 3UE3A 4F94A 1N4OA 3HLWA 4KZ5A 1XGIA 3WS4A 4BJPA 3VP1A 1ONGA 3TG9A 2WGVA 4MNRA 2ZM0A 5J8XA 5FQJA
chains in the Genus database with same CATH superfamily
2F8NH 1SHVA 4GKUA 1ES4A 4WUJA 5CPKB 4GNUA 3UE6A 5AV5B 3A6NA 3LELD 4LG2A 1XX2A 1ERQA 4H9RB 1VB6A 3F1PA 3U2AA 2PU2A 3Q7ZA 3B0DC 5TJJA 4DMZA 4QLCB 4HMEA 1M19D 3MGSC 5EECA 4DDYA 1L6JA 3GVBA 3UMEA 2EX2A 3IP4C 5F99C 2X71A 3UDXA 4HESA 3LR5A 3MMHA 2ZBBA 3F6TA 2HV1A 5GT3C 4R6LA 1XJ2A 4GDBA 3ZG0A 3HLFA 2EX9A 1DP9A 1TAFB 5FUGB 5C3IB 2JBFA 4K0WA 1HQ3C 5B2IC 4NKPA 2ZQDA 2HIOD 1JWZA 4KQQA 4X53A 5AY8D 4HH3A 1U35A 4OLGA 1P3BC 4HI4A 3WRZA 2BTFP 1P3FA 2NQBA 1EWZA 3CMZA 1GSXA 4WU8A 4GS9A 3T50A 4R8PD 4OQ0A 3WTPB 3UTAD 4CLCB 2P7JA 3GSGA 2V1BA 2ZM8A 4ZJ2A 1LLBA 5EVIA 2PD7A 1OTIA 2XSSA 1W79A 2P04A 3WAAC 2M7UA 2PYOB 5CP6A 4L9GA 4Q8IA 5KSHA 3B42A 1ZLAA 3JPUA 4EBPA 3JYIA 3NULA 4ARZB 1P3KC 2OAQ1 1QMEA 3REIB 1P3OC 4P85A 1NXYA 1NLYA 5A8BA 3EWKA 2NZDA 4G92B 4J8UC 3D9YA 4XT2B 4JKTA 4MMNA 3O62B 1TDLA 4BQMA 4OP5A 2Z6CA 3R45A 3REKA 4X69A 1P34A 1YSPA 4N9LA 1BH8B 5BS7C 2P74A 4NEED 1O6IA 1P3PD 3C1BA 3VE4A 2OAP1 5HPFA 3MGQA 3FDDA 3PBSA 4KZ6A 5M19A 4WU9B 2JKGA 2CV5D 3MXSA 4XUJD 3ITBA 3NCKA 1KX3B 2X02A 1UR8A 4Z66A 2GNXA 1STZA 1VETB 3AZIA 2A24B 1K57A 3BECA 2G5IC 3OCLA 1WWSA 4J8VD 3W8KA 3RTYA 4C75A 4DDSA 1ZHHB 3HSHA 3JVVA 5B31A 5FQQA 3KFUG 4EO5B 3MR0A 4ETXA 2G5HC 5HFOA 4F3LA 2FJ7B 3B0CT 1IYPA 5G4ZA 1P3GC 5AQAA 2PBYA 5FEGA 4J8WA 5F6AA 3AZHB 1Q9CA 3QP2A 1A7WA 5CPIA 2L1MA 4JBFA 3UN7A 3VH5A 4HP4A 5L2FA 5E5AD 1XFNA 1R4VA 3HUNA 1WYCA 3AZGB 1E4DA 4G91C 3UTBD 1BLHA 4IVKA 3T1QB 1I2SA 4LV3A 5G49B 5B33A 2WZZA 5B32A 4KZ3A 3UB8A 4OJLA 3AFAB 4MBHA 4NETA 1YT4A 4EEPA 4I3JA 5B2JD 1JFIA 1PZRA 4Z5TC 3V9RB 3QHYA 5FQKA 5GSUA 5KZHA 4KZ9A 4FD8A 3C7VA 3A6NB 4P0MA 1RCJA 4IBGA 1E8BA 4MEZA 4WZ4A 4E6XA 4KG6A 5IU1A 1Z09A 1W1VA 2HP9A 3IWOA 1TS8A 5AVBA 4ZBJC 1C3BA 4KUDC 2ZY2A 5B40A 3G2YA 4ZDXA 1NY0A 3PBRA 1FSYA 3LCEA 2WKRA 4GW9A 4OPRA 1MBLA 3MGRA 4S2KA 2V0WA 3W96D 3UY6A 3EEHA 4JJNA 4JXSA 3RELD 3V3SA 5AVEA 1OMEA 4OPZA 3MXQA 4ESPA 2WGWB 1W5DA 4MLLA 3NDGA 4X23A 3IXHA 4J8XA 1U35B 5CPJD 4JF5A 3OLOA 5HL1A 3Q07A 5F69A 5GT0C 3PBQA 1YMXA 1P3FB 2O9BA 4WU8B 3AZEB 4GS9B 3KUYD 3N3FA 3X1SC 1CEGA 4PM9A 2W3EA 2O99A 3KXBC 5CGXA 4OP8A 3MGPA 4KGCC 1G28A 4FH2A 5EVIB 4UQIS 3TU4A 1XKZA 4GDNA 4H9OA 4UA6A 4C3QA 3EPHA 3V39A 3AZMA 5CP6B 4I39A 1BLPA 3AZJC 3W99C 3M2JA 3P98A 4EERA 2LB5A 1DY6A 4QJGA 5DNNC 2YKHA 1GA9A 4NXGA 4H9QB 3T4QA 5AVCB 1L0DA 1AOID 5GXQD 4JGQA 4CAYB 1P3IC 1ALQA 1YMSA 3G4PA 5HARA 5DFXA 3MJQA 1XJ6A 5FATA 4B4XA 3AL0C 3W4OA 3REKB 3CPTA 5GHZA 4IBBA 5A91A 3UB5P 1EAKA 3AYWA 3LYXA 3WA9A 1VEUB 5IHVA 4WEKA 1VQQA 2WUQA 3C1BB 2HDQA 3B6FD 2ZQAA 5DFYA 1KS0A 2QYBA 1IKIA 1HZOA 5FI7A 2PR5A 2VQRA 1L0FA 3VMAA 2W3HA 3BM6A 1M1AC 1AOIB 1Y4OA 5GL9A 4HJ6A 1MXOA 4H6JA 4E3MA 3F1OA 3EG5B 1YLZA 3WD1A 5FQMA 4LV1A 4NYYA 1YAXA 2HDUA 4QY5A 1GPFA 4KQRA 1K54A 5B31B 2Y2HA 3X1UC 1FILA 3CWFA 1ACFA 1K25A 3VOLA 1B6WA 3ZNTA 3AV1B 1QO6A 4BD1A 5BT1D 4YWZA 4MB3A 2NQBC 3IF6C 1J9MA 4ZTKA 4YINA 4J8WB 4Y0TA 1TZYA 3C38A 3UPPA 5F1FA 5B1LD 4S2LA 4HMDA 4HMCA 2QMIA 1T1BA 5A90A 1IYOA 3AN2D 1IEMA 2O0YA 3C5AA 3PTEA 3P01A 3WS5A 3BWLA 1CQAA 2EFXA 3W98C 4KUOA 3M2KA 5CGWA 3DBAA 1ZLAC 4AWLC 3G34A 2ZQ9A 3W4PA 4RVAA 2K7SA 1FSWA 5CRFA 4NE3A 3AZKC 3O3VA 1K4FA 1NYYA 4HQAA 5TR7A 3LUQA 1SCWA 1TEMA 1JFIB 4D60A 2RCXA 3ZHHA 5B1MD 5GSUB 3H7WA 1X0OA 3VFFA 3AZNB 3A0VA 1P34C 3LFVA 2QPNA 3E4OA 3AZFA 4YM6A 1TDGA 1ID3D 3VP0A 1PRQA 3LZ0C 2QWSA 1LL9A 3MGQC 3BFEA 4NE5A 3X1TD 2PU4A 1GXDA 4Z66C 1LL8A 3ZQ5A 4WNNA 3AZIC 1KGEA 1RGYA 3MGRB 3PXPA 4CJNA 2WK0A 5CPKA 5AV8A 4JJNB 3LJAA 1O7EA 1HD8A 5E2HA 2CWEA 3AZLA 1PI4A 2VGLM 5HDDA 4H9SA 1KX4A 4DRBA 3B6GC 4H9RA 3PAEA 3QP5A 4OJOA 4YS3C 4X23B 1BSGA 2B18A 4EEUA 1MKMA 4GCZA 3MKFA 4PPRA 4J8XB 3WKJA 3DTIA 3REHD 4K91A 4P6BA 2ZMVA 1P0ZA 4R38A 1U60A 3L25A 4U3TA 1QMFA 1GA0A 4MN6A 5JRGD 1YKDA 4Y15A 2EX8A 4UUZA 2VLGA 4F94A 1N4OA 1XGIA 4BJPA 1T3UA 2FN2A 5EM1A 3TG9A 5J4EA 2IOUA 3MGPB 2ZM0A 5FUGA 3X1VB 5FQJA 4Q0HA 3TU4B 2LB9A 3ULFA 4H9OB 1D06A 3AZMB 1M19A 1RP5A 5B33C 3E4PA 2P08A 5B24C 1BULA 3AV2D 5B32C 2XGNA 2OLVA 2Y2NA 3ZGAB 4ZJ3A 4H9PA 1G68A 4Z2LA 5B0YC 3G6OA 1IYQA 4EXOA 2IO5B 3P7NA 5FAQA 1E6NA 5G18A 3NQUB 1E88A 1DRMA 4WZSB 4LD9D 1V9YA 1YU1A 5C5KA 5CECA 3AYWB 4GH9A 1YLYA 1EQZD 2ZMFA 1T18A 2V8CA 3A1IA 5AVBC 5AV9C 4ARZA 1YM1A 4ZUXC 4S2IA 4Z2JA 5B40C 1FCMA 1H8MA 4S2PA 1P3MC 4S2NC 4R8PA 3V3RA 4JGRA 2JHEA 4XT2A 3LEZA 4KZ8A 1E6PA 3F1OB 2HUEB 1OTAA 1ES3A 2V5OA 3IHAA 4Z2MH 4PM8A 1S1ZA 4EBLA 2VA0A 2ZY5A 5FSRA 2R9XA 3MGSD 1D1JA 3IS2A 3KSIA 2AROC 5F99D 2XDMA 2W8SA 3DTEA 4L0LA 1KX3A 4GOGA 3KWQC 5GT3D 1VETA 2A24A 4KHAA 3ITAA 1YU3A 1AXBA 1E3UD 4KZBA 4EWFA 1HQ3D 5B2ID 2ZD8A 3VH6A 2FH5A 2JKTM 4JF4A 4Q0JA 4XZQC 1P3BD 1DJCA 1K56D 1P3PA 5B0ZB 3MNNC 4FSFA 5DNMC 2IWBA 5BO0A 5DJUA 3PBTA 3MKEA 3QP8A 2I72A 3R4KA 4AFIA 2FJ7A 3S1YA 3NOTC 2CV5A 4XUJA 2XR0A 3MFXA 1F98A 2VGLS 4QY6A 2Q9NA 3IHBA 4Y17A 5KIZA 4J8VA 4O01A 3N8RA 5CEBA 1BYWA 3AZHA 4HGAB 3H7WB 2GJ3A 3WAAD 5DTKA 1K4EA 1L0EA 4EQ1A 5J3WA 3HUOA 3AZFB 2F8NK 1P3KD 3E4QA 3WA9C 3KS4A 4MN7A 1P3OD 3C4PA 5G49A 1IFQA 1JTDA 1W8YA 4J8UD 5EFWA 2HF6A 2FFYA 3AFAA 4HJ3A 3LZ1C 3VP2A 4WNNB 3FC7A 3CG5A 3LIAA 5CTNA 1P97A 4FH4A 3V9RA 3IX4A 5AV8B 2QJ5A 3MF0A 2XRNA 3LJAB 1LL5A 1T1AA 1M40A 1SDNA 3AZLB 1FCNA 4BL2A 4NZ4A 1KX4B 1KX5B 3LI8A 3UTBA 2L0WA 4BENA 2RL3A 1ES5A 1K54C 3OZHA 3VP4A 2EWVA 3WKJB 5AV6C 5EVLA 3VP3A 3KSHA 4Y7PA 2XK1A 3T1SA 5TBMA 3PHYA 4IUHA 3UPNA 2D01A 5B2JA 3T4TA 2EXBA 4UUZB 1IYSA 1PWDA 3LIDA 2WGIA 4NXFA 3KYEA 3CUEC 3BQAA 3LELB 2WGWA 1F66C 2PRFA 3WS1A 3VH5W 1GSVA 5IT5A 3W97C 1P3GD 1E6ZA 1P3AC 1M19B 3Q82A 3UE0A 3RJUA 3FV7A 3SH8A 5BNXA 3W4QA 4EQIA 3AZEA 3IF5A 3REJD 5EVEA 4H9PB 1KDSA 1YLJA 1HTAA 2EFUA 3C1CC 3MVDC 3RELA 3UMDA 1NLZA 1S66L 4NFTA 1IKGA 5EOEA 5FAOA 2RIQA 4JF6A 2W1RA 4YM6C 2HIOB 3N4IA 5AY8B 2WKEA 2J3TC 5CPJA 1F5MA 2J8PA 1J3WA 5GHXA 4H9QA 5AVCA 3FPWA 3MSHA 1XXMA 4Z5TD 3IX8A 4R8PB 3REJB 3DWZA 1W1TA 3UTAB 1IOUA 5TFQA 3BY9A 5EPHA 4NYUA 4CAYA 4K0XA 2WKIA 5CPKC 5AV5C 1HVBA 5KDMA 3H0LC 4Q0IA 4RQ9A 4NY2A 1KE0A 2XA7M 4KZAA 3PBOA 1VEUA 4KUDD 3IS2B 4YFMA 4QLCC 1XGJA 3A3FA 3NQJB 1N9LA 1PW8A 2JKTI 2YFVA 3VV4A 1KVLA 1H8ZA 5HAIA 5HD3A 5FI6A 2ZM5A 2V20A 1AOIA 2GZAA 3M6HA 1JVJA 4KHAB 3P5JB 5GXQA 4S2JA 3UE1A 3HBRA 4PM5A 3ZDJA 2Y2OA 2EX6A 3MS6A 1I2WA 3UO9A 1K38A 5C3IC 2Y2GA 3G31A 3MFDA 5GT0D 1P3PB 4GB7A 5MC7A 3B6FA 5BO0B 5B32G 1ZKJA 2DCFA 3AV1A 2CV5B 4XUJB 1UGUA 5DVAA 4NXEA 1KGGA 3KXBD 2ZY3A 1H3OB 4M3KA 1EROA 3WTPC 2K2NA 3W2ZA 4OJ6A 4CLCC 4HP9A 4J8VB 4KGCD 1ZG6A 3A3EA 4XXRA 5E2FA 2BYMA 2H0YA 2UV0E 3NC8A 2M1CA 3AZJD 3W99D 4LRZE 5DNND 2PYOC 2E8IA 3D4FA 4E3OA 1CXWA 5FQ9A 2JE5A 3KO6A 3REIC 1P3ID 4JGOA 4M6BA 4G3KA 4I38A 2PR6A 3L26A 4GJ4A 3BY8A 1OT9A 3PYPA 3HL9A 1TS7A 4B9OA 4I5SA 3E2LA 3O62C 4OVDA 1ES2A 3OPHA 2GX5A 3AN2A 2DQNC 3AZNA 1N9BA 2G7UA 2O9AA 2P9VB 5E5AB 3BLSA 3TW8A 1SKOA 3UTBB 2HPBA 4CPKA 2XFTA 3M7PA 2PT7A 1M1AD 4R3BA 1EW0A 3U4LP 4WU9C 2JCHA 3FYZA 2A49A 4IJGA 1KX3C 5TBMB 3DW0A 4K08A 5B2JB 4OKPA 2VJWA 5B1MA 5BOHA 4RX2A 3EGXC 3BFDA 3X1UD 5G4YA 1YPRA 1LHYA 4E3KA 1ID3A 4WELA 3PAGA 2V9AA 3FG8A 3OPRA 4EO5C 2CC1A 3OPLA 2NQBD 1GOIA 2FJ7C 2ZM2A 3X1TA 5BNXB 3C8CA 4DQYB 1KOUA 4S2MA 2XA7S 3W96B 3VFHA 3E2KA 3AZHC 5HAQA 3RELB 4WZ5A 3WD0A 3W98D 3X1VA 2Y2IA 3NOPC 2X01A 2ZC4B 3M6BA 3AZGC 1ZLAD 5CXWA 4QHCA 1NZOA 2KDKA 5CPJB 3AZKD 1K55A 3REHA 3ZYTA 4OUIA 4NG2A 1KVMA 1JNUA 4DXCA 4IBRA 3AFAC 3CITA 3B0BA 5JRGA 1B67A 3KUYB 2BG1A 4IJFA 1P34D 3K2NA 3IXDA 3HREA 2DMWA 3A6NC 4IUKA 3NQUA 3W98B 1OGGA 5KDMB 4EESA 3LZ0D 3MGQD 4E3JA 2ZC7A 1S67L 3VP1A 2WGVA 4Z66D 4FUWA 3AZID 2YFVB 5L10A 5J8XA 4BLMA 3MQOA 3CZDA 2J9PA 3KX0X 3G2ZA 2BLSA 4IBFA 4NXBA 1MZUA 2Y2PA 5GXQB 3SH7A 3B6GD 3HJKA 4LENA 1HLUP 3NI9A 4YS3D 4DJ3A 2Z2MB 5F83A 1ZC2A 4OOLA 1EQZA 2Y8HA 2E8JA 3B6FB 1U35C 5L07A 2Y59A 4L9EA 1T1CA 4PHTA 3L28A 2Y91A 1DP8A 2JC7A 1P3FC 1WWIA 3K3DA 4WU8C 3AZEC 3BEBA 3A3JA 4OPQA 3JVUA 1S1YA 2MJ6A 3RH8B 4X1MA 4BL3A 1DJAA 4U0XA 2BYMB 2WKPA 4DE2A 2F8NG 5BNVA 5EE8A 5EVIC 5F82A 3MGSA 3IBRA 5B33D 4P87A 5B0ZA 5B24D 4UAAA 5FA7A 5B32D 1UR9A 1F9IA 2AVXA 5F99A 3C4OA 3C7UA 2J8YA 3EQVA 5CP6C 3NY4A 5HX9A 5EV0A 5GT3A 5AVCC 5B0YD 2NZDC 4Z2IA 2VGKA 1M18D 1YQSA 1E3UA 2PYRA 1JTGA 2XFSA 1RGZA 1HQ3A 5B1LB 3FWLA 1H5XA 4RYEA 2JKFA 4DE3A 3AN2B 3REKC 3HLBA 3IX3A 2DF4C 4OQGA 5AV9D 3EPLA 1P3BA 1SKOB 1H8YA 4GZBA 5FI2A 4ZUXD 2I9VA 3NECA 3CLOA 2VEAA 5B40D 3C1BC 2V2FF 1SDEA 1H0GA 3T1RA 1P3MD 5CERA 3UT9D 3PBNA 3WX7A 1OJGA 5DJTA 2ZC5B 1AOIC 4NK3A 1K57C 4Y0OA 1M18B 3BLMA 2V1ZA 2WYXA 4X6TA 4X55A 4WJ3C 3UB9A 5B1MB 1K6SA 2HJEA 2AROD 1P3LD 4R0QA 1KX5A 2Y79A 3BFGA 3IH9A 5TGFA 1Z2CB 1KE3A 1ID3B 3KS8A 5B31C 3EOIA 3SS4A 1P3OA 4GLQA 5GHYA 3KWQD 4CSRB 4IVIA 3GMWA 2YKFA 2W1TB 3IXGA 4J8UA 1CI9A 1TS6A 3AV1C 3UT9B 4KQDA 3X1TB 3FPVA 1PDCA 2ZOIA 5F5YA 1S32D 3NJAA 3SS3A 3LGOA 4J8WC 4BWIA 5CX7A 4YNRA 5BS7A 1L3LA 4XZQD 1OTBA 2J7VA 3UPOA 5CPIC 1GHIA 3LELA 4KG5A 3MNND 5DNMD 1P3LB 3QNBA 3S4XA 4E45A 2PBDP 4EW7A 4LGWA 1CJFA 1W8QA 3HJIA 5HDSA 3N8LA 3REHB 1D7EA 4P6ZM 1OTEA 2JKRI 4HHDA 2HZ5A 2KLIA 5BPVA 5JRGB 1S32B 1SKFA 1MWTA 3RXWA 2W3GA 4DE1A 3LR0A 2WAFA 2ZL1A 4MCWA 3A0SA 4XZQB 1DJBA 5GSUC 5AJGA 3WA9D 3AZNC 2Y55A 1W63Q 1CK7A 1BUEA 2HIOA 3SW1A 5AY8A 1P3GA 4M4XA 1NZUA 2ACGA 3LZ1D 3AV2B 3HLGA 1W2EA 2OWHA 5AQ9A 4IBIA 3REJA 3UTAA 3MGRC 3H82B 4DKIA 1BLSA 2H28A 4PM7A 4WMCD 4JJNC 3LIEA 1M6KA 3PR6A 4ME4A 2ZC3B 4G3VA 2HDSA 1PIOA 1MWSA 4LPZA 2XD1A 4LD9B 5AV6D 2Z6DA 4R70A 3ZVTA 2OWJA 4X23C 4OLDA 4PAUA 4QPRA 2ZQ8A 1EQZB 2XF3A 4J8XC 3A0RA 3NQJA 1MWRA 1NJ4A 1OGBA 2JN7A 3L2AA 4Z5TA 1N9OA 1PW1A 3O5YA 5JYPA 5L09A 1YU2A 1KGFA 1F66D 1XP4A 4JGPA 3UNWA 1YLTA 4WF0A 4B93A 3B0DB 4KG2A 3MGPC 5BNVB 3QP4A 3W97D 4ZBEA 3X1VC 1P3AD 2OSUA 2XD5A 3MGSB 1ESIA 3Q7VB 3TU4C 4KUDA 4Y0UA 5F99B 1YSQA 5FEFA 3AZMC 1K55C 4X56A 1XJ4A 3C2WA 4Z1WA 2R78A 5GT3B 1PFLA 3N6IA 1H3OA 4KZ4A 3TE8A 5DF7A 3C1CD 3MVDD 2VKSA 3MBZA 2VX8A 5HSQA 3NOUC 3BQ8A 3V50A 4E04A 1HQ3B 2F8ND 2IO5C 1OT6A 5B2IB 2DNSA 4YM6D 1N1JB 5HZHA 4L9FA 2B5RA 2K31A 2D49A 3O86A 2J3TD 2WKHA 4DRTA 1LSVA 3LY4A 4LRYC 1JWVA 1P9RA 5GT0A 1P3BB 1VHMA 3AYWC 1KE4A 4MB4A 1BH9A 4HOIA 3KXBA 3R7WB 3Q81A 5CPKD 3C1CB 2H5SA 4Z2KA 5GLDA 5AV5D 1H0MA 4KGCA 4UHUA 3WTPE 4CLCE 4R4RA 2HUEC 4LV2A 5I94A 3WAAB 4LFUA 4P6ZS 3T4KA 4QLCD 2P9VA 5E5AA 2BYKB 2Y2JA 3AZJA 3W99A 1G6OA 1H3QA 2V0UA 4ZAMA 1P3KB 4WEJA 4H9NA 5GLCA 1P3OB 4WL9A 1PI5A 4KUKA 1L2SA 3TSGA 4J8UB 1FOFA 4PKYA 3L9KA 1P3IA 3LEQA 3HLEA 1KU5A 2HJ9C 1ZTUA 1BT5A 1T19A 1AWIA 4N1XA 1JWPA 1TZYC 3NHQA 3L27A 2H10A 1DP6A 4C6YA 1W63M 1E25A 3CI6A 3EPJA 3ISGA 4WLAA 5B0ZC 4IBCA 2Q9MA 5FQIA 3SH9A 3ZG8B 1G6AA 4UEYA 1M1AA 2WADA 4JLFA 1YLPA 3HCYA 3WTPD 5CTMA 4CLCD 4HY8A 3W96A 3OBFA 2PHYA 3WS2A 5E2EA 2Y2MA 2ZL1B 3GV9A 4HGAC 1FCOA 3ZCZA 2RTSA 1KDWA 1SZVA 3X1UA 2WKQA 4ZRRA 2PYOD 4IJEA 2YFWB 3GTCA 1XJ3A 3AZFC 1E15A 5DKKA 3REID 1P3GB 2VV8A 3EEAA 3IF6A 1UWPX 3IQAA 3FZCA 1OPXA 4EBNA 4GD6A 4GD8A 1A0KA 3FKEA 5E43A 3O62D 5U47A 2C5WB 2C6WB 1WA9A 3KUYA 3LIFA 4E3LA 5DTSA 1W1PA 2RVQC 5AV8C 2Y4AA 4G91B 3LJAC 3ICYA 4D2OA 4EUZA 3W98A 3AZLC 5E2GA 2B95A 4H9SC 1KX4C 4JXGA 5B31G 1KX5C 4QD4A 3VH5T 4WU9D 3IXBA 1GSWA 3B0CW 1KX3D 1NYMA 1S0WA 3AZKA 2QJ7A 3WKJC 4JXWA 3AGEA 3DTKA 4BMWA 4JXVA 4Z5TB 5F68A 4LRXC 2EA9A 1HTZA 2HDRA 1TD5A 4OOYA 3IH8A 4EUVA 5CHUA 1Q2QA 3WS0A 3LELC 1GHMA 3LZ0A 2IWCA 4PM6A 4R1GA 4ZBJB 2FJ7D 2VK3A 1OTDA 4KUDB 3HVFA 4KZ7A 5L8MA 4UQIM 5J7EA 4RA7A 1M19C 2ZOHA 5I5LA 1G5UA 1GCEA 4KENB 4FCFA 1I5QA 3X1SD 4XUXA 3AZHD 4N9KA 3HLWA 3CHWP 4CQHA 3KSFA 3H0RC 3B6GA 3C30A 4MNRA 1ULYA 4YS3A 3AZGD 4NZ1A 3T4LA 2VV6A 3MQ0A 3A3IA 3O88A 4ETZA 1S6RA 1H0IA 5GT0B 2HIOC 1CI8A 2A2LA 5AY8C 2OOLA 3AFAD 5KMWA 1PYYA 3T12B 1BH9B 5DTTA 3S7PA 3X1SB 1J7MA 3KXBB 4IHQA 3MZFA 4G92C 4R8PC 3REJC 3UTAC 2W3DA 2L5AA 3A6ND 4KGCB 1Y54A 1H8PA 3KSYA 5B1LA 1NRFA 2WZXA 5CEDA 5DKLA 4II7A 5HAPA 1NWZA 3AZJB 3W99B 3S7NA 1ED7A 4LCLA 5B24A 4UA7A 5DNNB 4H9NB 2EXAA 3MXRA 3V67A 4G3WA 5GLBA 1PZOA 5M1AA 3T4SA 3IWQA 4U0TA 1P3IB 3S7OA 5B0YA 1N9NA 2V1AA 3A3DA 4UPKA 1M18A 2KX6A 1TVFA 3LR4A 2IA2A 3F1PB 1YUEA 5HWTA 3O87A 2Y2KA 1YU0A 1U35D 5AV9A 2O9CA 4ZUXA 5AQBA 5FASA 2HP6A 2XH9A 1P3PC 1V9ZA 1YLWA 4MB5A 4IBJA 4OQHA 1P3FD 4CSRA 1M1AB 1PWCA 5HL6A 1LSWA 3F1NA 1P3MA 4S2NA 2W1TA 4WM9A 4WU8D 3AZED 2CV5C 3UT9A 4XUJC 3G32A 2NUTC 1AIWA 2J80A 1Y28A 4OJPA 4GHLA 2VV7A 2OV5A 2ZJ9A 5JYOA 1F1EA 5FDSA 3T1XA 4J8VC 5CHMA 5EVID 5DF9A 3NDEA 3X1UB 2AROA 1P3LA 1ODVA 4Y3IA 5CP6D 5HD5A 4I3AA 5CGSA 3HLDA 2LY8A 2GDNA 3RFBA 4Z2MG 3KWQA 5AVCD 2NQBB 4WN5A 2H0TA 2NZDD 3IF6B 4N1HA 4N92A 1LT0A 3ZVWA 1ERMA 5JA4A 1S32A 2A3UA 4S2OA 2NUPC 5F1GA 1BLCA 2W3FA 2ZQCA 3REKD 3ZG9B 2HP5A 1ONHA 3ZFZA 3E0YA 4XZQA 2ZLYA 1VM1A 3MNNA 5DNMA 4Z2GA 2JKRM 1WE4A 3C1BD 5E5AC 1WYBA 1ZLAB 4AWLB 3UTBC 4Y5FA 2D02A 4XUZA 1LI9A 3KYQA 3AZKB 5EUAA 2NZDB 4GHAA 1W7FA 3AV2A 4EETB 4DF6A 4IBDA 4QB8A 4HJ4A 1PNEA 3VOYA 3R45B 5B2JC 2EWWA 2FFFB 3H82A 2DRWA 3L7HA 1P34B 3DWKA 5HWVA 3MZEA 3WD4A 4BBVA 3D72A 4E3NA 5B31D 4PMAA 4LD9A 3N8SA 3LZ0B 4WBGA 3MGQB 4QU3A 5EOOA 5EM0A 2WAEA 3ZG7B 5CHJA 3AV1D 3QNCA 4Z66B 3LZ1A 1ZG4A 3AZIB 4MBKA 4EU0A 2PYPA 4J8WD 1FQGA 5A92A 4GN2A 5HPIA 3GECA 4HEFA 3D3OA 5CPID 1S4RA 3W96C 1XFQA 4WMCA 1L0GA 3N7WA 3B6GB 3RELC 4YS3B 4RX3A 2PD8A 4DE0A 5AVFA 5FDHA 3IT9A 5AV6A 4TX8A 4NE6A 3ZNYA 3UDIA 4F3LB 2ZC6B 2G2WA 3Q7VA 3EPKA 3EQUA 1MPLA 5HWWA 5CPJC 3BFCA 3KYZA 3BJNA 2FZ0A 4DXBA 2XEPA 4ID4A 3MZDA 5GSUD 3KUYC 3CUEA 3T4JA 5CPIB 3GDIA 3WRTA 3AZND 2J9OA 4BD0A 1F66A 5AQ7A 3L29A 3RXXA 5B2IA 1N1JA 4LCMA 3GRJA 1S4SA 3W97A 1P3AA 1CEFA 4NZ3A 4R4SA 1EI5A 5AVBD 1W1YA 3AGFA 1K56A 5B33B 2PDRA 4R3AA 5B24B 2ZY4A 4B88A 5B32B 4IEDA 3LI9A 1CF0A 2VGJA 3OPPA 1Q2PA 2V8FA 3MGRD 3VE3A 3LIBA 5B0YB 1K6RA 3R7WA 4B4ZA 5IS1A 3MQQA 4GHIA 3C1CA 3MVDA 4O8GA 4JJND 3OCNA 5GLAA 5GXQC 3S22A 3WD2A 3AGDA 2F8NA 4OQIA 4X23D 3WAAA 4LV0A 3BRMA 1BFMA 4Z9QA 3B47A 1OJ5A 2BYKA 4YOFA 4IBKA 4J8XD 3S7QA 5AVBB 5AV9B 1P3KA 4JPMA 3VH6W 4ZUXB 4Y13A 5B40B 2G2UA 3B6FC 3OOVA 2Q0OA 3K3CA 4MBFA 4MN5A 3F1NB 1P3MB 1PWGA 3LO7A 1TS0A 4QNLA 3WWXA 3T4OA 3VSKA 2ZMAA 1XA1A 5AV5A 2F2AC 2M7VA 3DTMA 4E44A 3MGPD 4FOFA 3X1VD 3HONA 3TU4D 2JSSA 4OPYA 4QLCA 2AROB 2W27A 5FL3A 3AZMD 2Y2LA 3WD3A 3NBLA 4BBUA 2PAVP 5A93A 2ZQ7A 4X25A 4ZJ1A 3KWQB 2L4RA 3GQZA 3UDFA 5BT1C 4HIAA 2QHKA 2BASA 1MC0A 3G30A 5JA4B 5CHLB 2VZWA 4A5RA 3HUMA 1TAFA 3TRCA 2HGVA 3UB7A 3V5MA 5B1LC 4EV4A 3TJZC 4UA9A 3B3XA 3AYWD 3SS5A 3AN2C 3MNNB 5DNMB 3LICA 3IBJA 3A1KA 2XROA 5K5BA 3VH6T 2YFWA 1O07A 4HBUA 2UWXA 1BTLA 3Q1FA 1BZAA 3GR2A 4IBXA 3WTPA 4CLCA 5D3OA 4I3IA 1FR1A 1XPBA 4O0PA 2INWA 1M18C 2OLUA 3CAXA 5DF8A 2KOIA 3CPTB 5LBRA 5HDCA 1PZPA 5B1MC 1LSXA 3WA9B 2PYOA 3P09A 1E6RA 1YU4A 3BFFA 5HW3A 1ID3C 3EGDC 3REIA 2QKPA 2CMNA 1MKIA 2Z2LB 3SZTA 5KSCA 3LZ1B 3FKVA 4E3IA 1ESUA 5FAPA 4HH2A 3UT9C 3TOIA 3X1TC 2R9WA 1TZYD 2Y2QA 1NRJA 4H6JB 4R23A 4Y2FA 3O62A 3BYDA 4WYYA 2B02A 4OONA 4X1LA 1BH8A 4DRAA 4WZ5C 1IELA 5B0ZD 1P9WA 3QP1A 1Z6FA 1P3LC 2QZ6A 4HBTA 5AV6B 4H8RA 4WU9A 3IWIA 3MQLA 3G35A 4OOMA 4Z2HA 1CK3A 3REHC 1GHPA 3BW6A 3NIAA 4HNBA 1TF1A 1TZYB 3LR3A 4IBEA 1UWNX 2W0NA 5JRGC 1S32C 1FIKA 1F66B 1FR6A 3KSGA 4O7DA 3E98A 3AZFD 3LY3A 3W97B 1P3AB 3FKWA 5M18A 4BBTA 4E6WA 3DAVA 1MWUA 3OC2A 1K0KA 3VOZA 3H9WA 3H0MC 3CJMA 4R3JA 2IWDA 4PKYG 4KQOA 3HLCA 3AV2C 1MY8A 3X1SA 2XLNA 4QWOA 3B33A 4OH0A 4MDZA 3VSLA 4DN0A 4NZ5A 4GHIB 2RVQD 5AV8D 3MVDB 1LI0A 3I7JA 3SOIA 3LJAD 3ZG5A 4FTXA 1F2KA 3AZLD 1KX4D 2F8NB 1KX5D 3AZGA 4WV4B 4YM6B 4LLOB 1XA7A 4OJ5A 2XQZA 4X68A 4LD9C 3UE3A 3WKJD 3WS4A 4KZ5A 5DNNA 1ONGA 3QP6A 4DJ2A 1EQZC 2J3WA 3UB6A
chains in the Genus database with same CATH topology
2F8NH 1SHVA 4GKUA 1ES4A 5CPKB 4GNUA 5AV5B 3A6NA 3LELD 4LG2A 1XX2A 1ERQA 4H9RB 2PU2A 3Q7ZA 3B0DC 4QLCB 1M19D 3MGSC 5EECA 4DDYA 3GVBA 2EX2A 3IP4C 5F99C 2X71A 3UDXA 4HESA 3F6TA 5GT3C 4GDBA 3ZG0A 3HLFA 2EX9A 1TAFB 5FUGB 5C3IB 2JBFA 4K0WA 1HQ3C 5B2IC 2ZQDA 2HIOD 1JWZA 4KQQA 4X53A 5AY8D 4OLGA 1U35A 1P3BC 3WRZA 1P3FA 2NQBA 1EWZA 3CMZA 4WU8A 4R8PD 4OQ0A 3WTPB 3UTAD 3GSGA 2ZM8A 4ZJ2A 1LLBA 5EVIA 1W79A 3WAAC 2PYOB 5CP6A 4Q8IA 5KSHA 1ZLAA 4EBPA 3JYIA 1P3KC 1QMEA 3REIB 1P3OC 4P85A 1NXYA 2NZDA 4G92B 4J8UC 4JKTA 3O62B 1TDLA 4BQMA 4OP5A 3R45A 3REKA 4X69A 1P34A 4N9LA 1BH8B 5BS7C 2P74A 1P3PD 3C1BA 3MGQA 3FDDA 3PBSA 4KZ6A 5M19A 4WU9B 2CV5D 3MXSA 4XUJD 3ITBA 3NCKA 1KX3B 2X02A 4Z66A 3AZIA 1K57A 3BECA 2G5IC 3OCLA 1WWSA 4J8VD 3W8KA 4C75A 4DDSA 3HSHA 5B31A 5FQQA 3KFUG 4EO5B 2G5HC 5HFOA 2FJ7B 3B0CT 1IYPA 1P3GC 5AQAA 2PBYA 4J8WA 3AZHB 1Q9CA 1A7WA 5CPIA 4JBFA 3UN7A 3VH5A 5L2FA 5E5AD 3HUNA 1R4VA 1WYCA 3AZGB 1E4DA 4G91C 3UTBD 1BLHA 4IVKA 1I2SA 4LV3A 5G49B 5B33A 2WZZA 5B32A 4KZ3A 4OJLA 3AFAB 4MBHA 4NETA 1YT4A 5B2JD 1JFIA 1PZRA 4Z5TC 3V9RB 3QHYA 5FQKA 5GSUA 5KZHA 4KZ9A 4FD8A 3C7VA 3A6NB 4P0MA 1RCJA 4IBGA 4MEZA 4WZ4A 4E6XA 4KG6A 2HP9A 3IWOA 5AVBA 4ZBJC 1C3BA 4KUDC 2ZY2A 5B40A 3G2YA 4ZDXA 1NY0A 3PBRA 1FSYA 3LCEA 4OPRA 1MBLA 3MGRA 4S2KA 3W96D 3UY6A 4JJNA 4JXSA 3RELD 3V3SA 1OMEA 4OPZA 2WGWB 1W5DA 4MLLA 3NDGA 4X23A 3IXHA 4J8XA 1U35B 5CPJD 4JF5A 5HL1A 3Q07A 5GT0C 3PBQA 1YMXA 1P3FB 4WU8B 3AZEB 3KUYD 3N3FA 3X1SC 1CEGA 4PM9A 3KXBC 5CGXA 4OP8A 3MGPA 4KGCC 4FH2A 5EVIB 3TU4A 1XKZA 4GDNA 4H9OA 4UA6A 4C3QA 3EPHA 3V39A 3AZMA 5CP6B 1BLPA 3AZJC 3W99C 3M2JA 3P98A 1DY6A 4QJGA 5DNNC 1GA9A 4H9QB 5AVCB 1L0DA 1AOID 5GXQD 4CAYB 1P3IC 1ALQA 1YMSA 3G4PA 5HARA 4B4XA 5FATA 3AL0C 3W4OA 3REKB 5GHZA 4IBBA 5A91A 3AYWA 3WA9A 5IHVA 4WEKA 1VQQA 2WUQA 3C1BB 2HDQA 3B6FD 2ZQAA 1IKIA 1HZOA 5FI7A 2VQRA 1L0FA 3VMAA 3BM6A 1M1AC 1AOIB 5GL9A 1MXOA 4E3MA 3EG5B 1YLZA 5FQMA 4LV1A 4NYYA 2HDUA 4QY5A 4KQRA 1K54A 5B31B 2Y2HA 3X1UC 1K25A 1B6WA 3ZNTA 3AV1B 4BD1A 5BT1D 2NQBC 3IF6C 1J9MA 4ZTKA 4YINA 4J8WB 4Y0TA 1TZYA 3UPPA 5F1FA 5B1LD 4S2LA 2QMIA 5A90A 1IYOA 3AN2D 1IEMA 3C5AA 3PTEA 3WS5A 2EFXA 3W98C 3M2KA 5CGWA 1ZLAC 4AWLC 3G34A 2ZQ9A 3W4PA 4RVAA 1FSWA 5CRFA 4NE3A 3AZKC 3O3VA 1K4FA 1NYYA 5TR7A 1SCWA 1TEMA 1JFIB 2RCXA 3ZHHA 5B1MD 5GSUB 3VFFA 3AZNB 1P34C 2QPNA 3AZFA 4YM6A 1TDGA 1ID3D 3VP0A 3LZ0C 1LL9A 3MGQC 3BFEA 4NE5A 3X1TD 2PU4A 4Z66C 4WNNA 3AZIC 1KGEA 1RGYA 3MGRB 4CJNA 2WK0A 5CPKA 5AV8A 4JJNB 3LJAA 1O7EA 1HD8A 5E2HA 2CWEA 3AZLA 1PI4A 4H9SA 1KX4A 4DRBA 3B6GC 4H9RA 3PAEA 4OJOA 4YS3C 4X23B 1BSGA 3MKFA 4PPRA 4J8XB 3WKJA 3REHD 4K91A 4P6BA 1U60A 3L25A 4U3TA 1QMFA 1GA0A 5JRGD 2EX8A 4UUZA 4F94A 1N4OA 1XGIA 4BJPA 1T3UA 3TG9A 2IOUA 3MGPB 2ZM0A 5FUGA 3X1VB 5FQJA 3TU4B 4H9OB 3AZMB 1M19A 1RP5A 5B33C 5B24C 1BULA 3AV2D 5B32C 2XGNA 2OLVA 2Y2NA 3ZGAB 4ZJ3A 4H9PA 1G68A 5B0YC 1IYQA 2IO5B 5FAQA 5G18A 3NQUB 4WZSB 4LD9D 1YU1A 5CECA 3AYWB 4GH9A 1YLYA 1EQZD 3A1IA 5AVBC 5AV9C 1YM1A 4ZUXC 4S2IA 5B40C 1FCMA 4S2PA 1P3MC 4S2NC 4R8PA 3V3RA 3LEZA 4KZ8A 2HUEB 1ES3A 3IHAA 4Z2MH 4PM8A 4EBLA 2ZY5A 5FSRA 2R9XA 3MGSD 2AROC 5F99D 2XDMA 2W8SA 4L0LA 1KX3A 4GOGA 3KWQC 5GT3D 4KHAA 3ITAA 1YU3A 1AXBA 1E3UD 4KZBA 4EWFA 1HQ3D 5B2ID 2ZD8A 3VH6A 4JF4A 4XZQC 1P3BD 1DJCA 1K56D 1P3PA 5B0ZB 3MNNC 4FSFA 5DNMC 2IWBA 5BO0A 3PBTA 3MKEA 2I72A 2FJ7A 3S1YA 2CV5A 4XUJA 2XR0A 4QY6A 2Q9NA 3IHBA 4J8VA 3N8RA 5CEBA 3AZHA 4HGAB 3WAAD 5DTKA 1K4EA 1L0EA 3HUOA 3AZFB 2F8NK 1P3KD 3WA9C 3KS4A 1P3OD 3C4PA 5G49A 1JTDA 1W8YA 4J8UD 3AFAA 2FFYA 3LZ1C 3VP2A 4WNNB 3CG5A 5CTNA 4FH4A 3V9RA 5AV8B 3LJAB 1LL5A 1M40A 1SDNA 3AZLB 1FCNA 4BL2A 4NZ4A 1KX4B 1KX5B 3UTBA 4BENA 2RL3A 1ES5A 1K54C 3OZHA 3VP4A 3WKJB 5AV6C 5EVLA 3VP3A 4Y7PA 2XK1A 3UPNA 5B2JA 2EXBA 4UUZB 1IYSA 1PWDA 2WGIA 3LELB 2WGWA 1F66C 3WS1A 3VH5W 3W97C 1P3GD 1P3AC 1M19B 3Q82A 3UE0A 3RJUA 3FV7A 3SH8A 5BNXA 3W4QA 4EQIA 3AZEA 3IF5A 3REJD 4H9PB 1KDSA 1YLJA 1HTAA 2EFUA 3C1CC 3MVDC 3RELA 4NFTA 1IKGA 5EOEA 5FAOA 2RIQA 4JF6A 4YM6C 2HIOB 3N4IA 5AY8B 2WKEA 5CPJA 2J8PA 5GHXA 4H9QA 5AVCA 1XXMA 4Z5TD 4R8PB 3REJB 3DWZA 3UTAB 5TFQA 5EPHA 4NYUA 4CAYA 4K0XA 2WKIA 5CPKC 5AV5C 1HVBA 5KDMA 3H0LC 4NY2A 1KE0A 4KZAA 3PBOA 4KUDD 4YFMA 4QLCC 1XGJA 3A3FA 3NQJB 1PW8A 2YFVA 1KVLA 1H8ZA 5HAIA 5FI6A 2ZM5A 2V20A 1AOIA 3M6HA 1JVJA 4KHAB 3P5JB 5GXQA 4S2JA 3UE1A 3HBRA 4PM5A 3ZDJA 2Y2OA 2EX6A 1I2WA 3UO9A 1K38A 5C3IC 2Y2GA 3G31A 3MFDA 5GT0D 1P3PB 4GB7A 3B6FA 5BO0B 5B32G 1ZKJA 2DCFA 3AV1A 2CV5B 4XUJB 5DVAA 1KGGA 3KXBD 2ZY3A 1H3OB 4M3KA 1EROA 3WTPC 4OJ6A 4J8VB 4KGCD 1ZG6A 3A3EA 4XXRA 5E2FA 2BYMA 2H0YA 3NC8A 3AZJD 3W99D 5DNND 2PYOC 2E8IA 3D4FA 4E3OA 5FQ9A 2JE5A 3REIC 1P3ID 4M6BA 3L26A 3HL9A 3E2LA 3O62C 4OVDA 1ES2A 3OPHA 3AN2A 2DQNC 3AZNA 1N9BA 2P9VB 5E5AB 3BLSA 3UTBB 2HPBA 4CPKA 2XFTA 1M1AD 4R3BA 4WU9C 2JCHA 3FYZA 2A49A 1KX3C 3DW0A 5B2JB 4OKPA 5B1MA 5BOHA 4RX2A 3BFDA 3X1UD 1LHYA 4E3KA 1ID3A 4WELA 3PAGA 3OPRA 4EO5C 2CC1A 3OPLA 2NQBD 2FJ7C 2ZM2A 3X1TA 5BNXB 4DQYB 4S2MA 3W96B 3VFHA 3E2KA 3AZHC 5HAQA 3RELB 4WZ5A 3W98D 3X1VA 2Y2IA 2X01A 2ZC4B 3M6BA 3AZGC 1ZLAD 5CXWA 4QHCA 1NZOA 5CPJB 3AZKD 1K55A 3REHA 4OUIA 1KVMA 4DXCA 4IBRA 3AFAC 3B0BA 5JRGA 1B67A 3KUYB 2BG1A 4IJFA 1P34D 3IXDA 3HREA 3A6NC 3NQUA 3W98B 5KDMB 3LZ0D 3MGQD 4E3JA 2ZC7A 3VP1A 2WGVA 4Z66D 3AZID 2YFVB 5J8XA 4BLMA 3CZDA 2J9PA 3G2ZA 2BLSA 4IBFA 2Y2PA 5GXQB 3SH7A 3B6GD 4LENA 3NI9A 4YS3D 2Z2MB 5F83A 1ZC2A 4OOLA 1EQZA 3B6FB 1U35C 2Y59A 3L28A 2Y91A 2JC7A 1P3FC 1WWIA 4WU8C 3AZEC 3BEBA 3A3JA 4OPQA 4BL3A 1DJAA 4U0XA 2BYMB 4DE2A 2F8NG 5BNVA 5EE8A 5EVIC 5F82A 3MGSA 5B33D 4P87A 5B0ZA 5B24D 4UAAA 5FA7A 5B32D 5F99A 3C4OA 3C7UA 2J8YA 3EQVA 5CP6C 3NY4A 5HX9A 5GT3A 5AVCC 5B0YD 2NZDC 2VGKA 1M18D 1YQSA 1E3UA 1JTGA 2XFSA 1RGZA 1HQ3A 5B1LB 3FWLA 1H5XA 4RYEA 4DE3A 3AN2B 3REKC 3HLBA 2DF4C 4OQGA 5AV9D 3EPLA 1P3BA 4GZBA 1H8YA 5FI2A 4ZUXD 5B40D 3C1BC 2V2FF 1SDEA 1P3MD 5CERA 3UT9D 3PBNA 3WX7A 2ZC5B 1AOIC 4NK3A 1K57C 4Y0OA 1M18B 3BLMA 2V1ZA 2WYXA 4X6TA 4X55A 4WJ3C 5B1MB 1K6SA 2AROD 1P3LD 4R0QA 1KX5A 3IH9A 3BFGA 5TGFA 1Z2CB 1KE3A 1ID3B 3KS8A 5B31C 3SS4A 1P3OA 5GHYA 3KWQD 4CSRB 4IVIA 3GMWA 3IXGA 4J8UA 1CI9A 3AV1C 3UT9B 3X1TB 1S32D 3SS3A 4J8WC 5BS7A 4XZQD 2J7VA 3UPOA 5CPIC 1GHIA 3LELA 4KG5A 3MNND 5DNMD 1P3LB 3QNBA 3S4XA 4E45A 1W8QA 3N8LA 3REHB 5BPVA 5JRGB 1S32B 1SKFA 1MWTA 3RXWA 4DE1A 2WAFA 4XZQB 1DJBA 5GSUC 3WA9D 3AZNC 2Y55A 1BUEA 2HIOA 5AY8A 1P3GA 1NZUA 3LZ1D 3AV2B 3HLGA 1W2EA 5AQ9A 4IBIA 3REJA 3UTAA 3MGRC 4DKIA 1BLSA 4PM7A 4WMCD 4JJNC 1M6KA 2ZC3B 2HDSA 1PIOA 1MWSA 2XD1A 4LD9B 5AV6D 3ZVTA 4X23C 4OLDA 2ZQ8A 1EQZB 2XF3A 4J8XC 3NQJA 1MWRA 1NJ4A 3L2AA 4Z5TA 1PW1A 5JYPA 1YU2A 1KGFA 1F66D 1XP4A 3UNWA 1YLTA 3B0DB 4KG2A 3MGPC 5BNVB 3W97D 4ZBEA 3X1VC 1P3AD 2OSUA 2XD5A 3MGSB 1ESIA 3Q7VB 3TU4C 4KUDA 4Y0UA 5F99B 3AZMC 1K55C 4X56A 5GT3B 3N6IA 4KZ4A 1H3OA 5DF7A 3C1CD 3MVDD 3MBZA 3V50A 1HQ3B 2F8ND 2IO5C 5B2IB 2DNSA 4YM6D 1N1JB 2B5RA 3O86A 2WKHA 4DRTA 3LY4A 1JWVA 5GT0A 1P3BB 3AYWC 1KE4A 1BH9A 3KXBA 3Q81A 5CPKD 3C1CB 2H5SA 5GLDA 5AV5D 4KGCA 4UHUA 3WTPE 4R4RA 2HUEC 4LV2A 5I94A 3WAAB 4QLCD 2P9VA 5E5AA 2BYKB 2Y2JA 3AZJA 3W99A 4ZAMA 1P3KB 4WEJA 4H9NA 5GLCA 1P3OB 1PI5A 1L2SA 3TSGA 4J8UB 1FOFA 1P3IA 3HLEA 1KU5A 1BT5A 4N1XA 1JWPA 1TZYC 3L27A 2H10A 4C6YA 1E25A 3EPJA 3ISGA 5B0ZC 4IBCA 2Q9MA 5FQIA 3SH9A 3ZG8B 1G6AA 1M1AA 2WADA 4JLFA 1YLPA 3WTPD 5CTMA 3W96A 3WS2A 5E2EA 3GV9A 2Y2MA 4HGAC 1FCOA 3ZCZA 1KDWA 3X1UA 2PYOD 4IJEA 2YFWB 3GTCA 3AZFC 3REID 1P3GB 3IF6A 3IQAA 4EBNA 3FZCA 4GD6A 4GD8A 3FKEA 5E43A 3O62D 5U47A 2C5WB 2C6WB 4E3LA 3KUYA 5DTSA 2RVQC 5AV8C 2Y4AA 4G91B 3LJAC 4D2OA 4EUZA 3W98A 3AZLC 5E2GA 4H9SC 1KX4C 4JXGA 5B31G 1KX5C 4QD4A 3VH5T 4WU9D 3IXBA 3B0CW 1KX3D 1NYMA 1S0WA 3AZKA 3WKJC 4JXWA 3AGEA 4JXVA 4Z5TB 1HTZA 2HDRA 4OOYA 3IH8A 5CHUA 1Q2QA 3WS0A 3LELC 1GHMA 3LZ0A 2IWCA 4PM6A 4R1GA 4ZBJB 2FJ7D 4KUDB 3HVFA 4KZ7A 4RA7A 1M19C 1GCEA 4KENB 4FCFA 1I5QA 3X1SD 4XUXA 3AZHD 4N9KA 3HLWA 3H0RC 3B6GA 4MNRA 1ULYA 4YS3A 3AZGD 4NZ1A 3A3IA 3O88A 1S6RA 5GT0B 2HIOC 1CI8A 5AY8C 3AFAD 5KMWA 1PYYA 1BH9B 5DTTA 3X1SB 3KXBB 3MZFA 4G92C 4R8PC 3REJC 3UTAC 2L5AA 3A6ND 4KGCB 1Y54A 3KSYA 5B1LA 1NRFA 2WZXA 5CEDA 5HAPA 3AZJB 3W99B 4LCLA 5B24A 4UA7A 5DNNB 4H9NB 2EXAA 3MXRA 5GLBA 1PZOA 5M1AA 3IWQA 4U0TA 1P3IB 5B0YA 3A3DA 4UPKA 1M18A 1TVFA 1YUEA 3O87A 2Y2KA 1YU0A 1U35D 5AV9A 4ZUXA 5AQBA 5FASA 2HP6A 2XH9A 1P3PC 1YLWA 4IBJA 4OQHA 1P3FD 4CSRA 1M1AB 1PWCA 1P3MA 4S2NA 4WM9A 4WU8D 3AZED 2CV5C 3UT9A 4XUJC 3G32A 4OJPA 4GHLA 2OV5A 2ZJ9A 5JYOA 1F1EA 4J8VC 5CHMA 5EVID 5DF9A 3NDEA 3X1UB 2AROA 1P3LA 5CP6D 5CGSA 3HLDA 2LY8A 2GDNA 4Z2MG 3KWQA 5AVCD 2NQBB 2H0TA 2NZDD 3IF6B 4N1HA 4N92A 3ZVWA 1ERMA 5JA4A 1S32A 2A3UA 4S2OA 5F1GA 1BLCA 2ZQCA 3REKD 3ZG9B 2HP5A 1ONHA 3ZFZA 4XZQA 2ZLYA 1VM1A 3MNNA 5DNMA 1WE4A 3C1BD 5E5AC 1WYBA 1ZLAB 4AWLB 3UTBC 4XUZA 1LI9A 3AZKB 5EUAA 2NZDB 4GHAA 1W7FA 3AV2A 4DF6A 4IBDA 4QB8A 3VOYA 3R45B 5B2JC 2FFFB 2DRWA 1P34B 3DWKA 3MZEA 4E3NA 5B31D 4PMAA 4LD9A 3N8SA 3LZ0B 4WBGA 3MGQB 4QU3A 5EOOA 2WAEA 3ZG7B 5CHJA 3AV1D 3QNCA 4Z66B 3LZ1A 1ZG4A 3AZIB 4MBKA 4J8WD 1FQGA 5A92A 4GN2A 4HEFA 5CPID 3W96C 4WMCA 1L0GA 3N7WA 3B6GB 3RELC 4YS3B 4RX3A 4DE0A 5FDHA 3IT9A 5AV6A 4NE6A 3ZNYA 3UDIA 2ZC6B 2G2WA 3Q7VA 3EPKA 3EQUA 1MPLA 5CPJC 3BFCA 4DXBA 2XEPA 4ID4A 3MZDA 5GSUD 3KUYC 5CPIB 3WRTA 3AZND 2J9OA 4BD0A 1F66A 5AQ7A 3L29A 3RXXA 5B2IA 1N1JA 4LCMA 3GRJA 3W97A 1P3AA 1CEFA 4NZ3A 4R4SA 1EI5A 5AVBD 3AGFA 1K56A 5B33B 4B88A 5B24B 2ZY4A 5B32B 4IEDA 2VGJA 3OPPA 1Q2PA 3MGRD 5B0YB 1K6RA 4B4ZA 3C1CA 3MVDA 4JJND 3OCNA 5GLAA 5GXQC 3S22A 3AGDA 2F8NA 4OQIA 4X23D 3WAAA 4LV0A 3BRMA 1BFMA 4Z9QA 2BYKA 4IBKA 4J8XD 5AVBB 5AV9B 1P3KA 4JPMA 3VH6W 4ZUXB 5B40B 2G2UA 3B6FC 4MBFA 1P3MB 1PWGA 3LO7A 4QNLA 3WWXA 3VSKA 2ZMAA 1XA1A 5AV5A 2F2AC 3DTMA 4E44A 3MGPD 3X1VD 3HONA 3TU4D 2JSSA 4OPYA 4QLCA 2AROB 3AZMD 2Y2LA 3NBLA 5A93A 2ZQ7A 4ZJ1A 3KWQB 3GQZA 3UDFA 5BT1C 3G30A 5JA4B 5CHLB 4A5RA 3HUMA 1TAFA 3V5MA 5B1LC 4EV4A 4UA9A 3B3XA 3AYWD 3SS5A 3AN2C 3MNNB 5DNMB 3A1KA 3VH6T 2YFWA 1O07A 4HBUA 2UWXA 1BTLA 3Q1FA 1BZAA 3GR2A 4IBXA 3WTPA 5D3OA 1FR1A 1XPBA 1M18C 2OLUA 5DF8A 1PZPA 5B1MC 3WA9B 2PYOA 3P09A 1YU4A 3BFFA 5HW3A 1ID3C 3REIA 1MKIA 2Z2LB 5KSCA 3LZ1B 3FKVA 4E3IA 1ESUA 5FAPA 3UT9C 3TOIA 3X1TC 2R9WA 1TZYD 2Y2QA 4R23A 3O62A 3BYDA 4WYYA 4OONA 1BH8A 4DRAA 4WZ5C 1IELA 5B0ZD 1Z6FA 1P3LC 2QZ6A 4HBTA 5AV6B 4H8RA 4WU9A 3IWIA 3G35A 4OOMA 1CK3A 3REHC 1GHPA 3NIAA 1TZYB 4IBEA 5JRGC 1S32C 1F66B 1FR6A 4O7DA 3AZFD 3LY3A 3W97B 1P3AB 3FKWA 5M18A 4E6WA 1MWUA 3OC2A 3VOZA 3H0MC 3CJMA 4R3JA 2IWDA 4KQOA 3HLCA 3AV2C 1MY8A 3X1SA 2XLNA 4OH0A 3VSLA 4NZ5A 2RVQD 5AV8D 3MVDB 1LI0A 3I7JA 3SOIA 3LJAD 3ZG5A 3AZLD 1KX4D 2F8NB 1KX5D 3AZGA 4WV4B 4YM6B 1XA7A 4OJ5A 2XQZA 4X68A 4LD9C 3UE3A 3WKJD 3WS4A 4KZ5A 5DNNA 1ONGA 1EQZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CZD A;  2J9P A;  3G2Z A;  2BLS A;  3A3I A;  3O88 A;  1SHV A;  1S6R A;  2Y2P A;  4GKU A;  1ES4 A;  4GNU A;  1CI8 A;  3SH7 A;  1RP5 A;  1BUL A;  4LEN A;  2XGN A;  3NI9 A;  1XX2 A;  1ERQ A;  1PYY A;  5KMW A;  2OLV A;  2Y2N A;  5DTT A;  3ZGA B;  2PU2 A;  2Z2M B;  3Q7Z A;  5F83 A;  4ZJ3 A;  1ZC2 A;  1G68 A;  3MZF A;  4OOL A;  5EEC A;  1IYQ A;  5FAQ A;  4DDY A;  1Y54 A;  3GVB A;  2Y59 A;  2EX2 A;  1NRF A;  5G18 A;  2X71 A;  3UDX A;  2Y91 A;  2WZX A;  4HES A;  5CED A;  2JC7 A;  5CEC A;  5HAP A;  3BEB A;  1YLY A;  4LCL A;  3A3J A;  4GDB A;  4UA7 A;  3ZG0 A;  3HLF A;  4OPQ A;  2EX9 A;  1YM1 A;  2EXA A;  3MXR A;  4S2I A;  5GLB A;  4BL3 A;  1DJA A;  4U0X A;  2JBF A;  4DE2 A;  4K0W A;  1FCM A;  1PZO A;  5EE8 A;  5EVI C;  5M1A A;  4S2P A;  2ZQD A;  3IWQ A;  4S2N C;  4U0T A;  5F82 A;  1JWZ A;  4KQQ A;  4X53 A;  3V3R A;  3A3D A;  4OLG A;  4P87 A;  4UAA A;  5FA7 A;  3LEZ A;  4KZ8 A;  3EQV A;  3C4O A;  3C7U A;  2J8Y A;  1TVF A;  3NY4 A;  1ES3 A;  3IHA A;  3WRZ A;  5HX9 A;  1EWZ A;  4PM8 A;  3CMZ A;  4EBL A;  4OQ0 A;  3O87 A;  2R9X A;  5FSR A;  2Y2K A;  3GSG A;  2VGK A;  1YQS A;  2ZM8 A;  5AQB A;  5FAS A;  1E3U A;  2HP6 A;  2XDM A;  2XH9 A;  4ZJ2 A;  1JTG A;  1YLW A;  2XFS A;  1RGZ A;  4OQH A;  1LLB A;  3FWL A;  1H5X A;  1PWC A;  4L0L A;  4RYE A;  5EVI A;  4S2N A;  4DE3 A;  4GOG A;  4WM9 A;  3HLB A;  3G32 A;  1W79 A;  4OQG A;  3ITA A;  4GZB A;  5FI2 A;  1H8Y A;  1AXB A;  4Q8I A;  1E3U D;  5KSH A;  4KZB A;  4EBP A;  3JYI A;  2OV5 A;  2ZJ9 A;  4EWF A;  2V2F F;  5JYO A;  1QME A;  5CHM A;  1SDE A;  2ZD8 A;  5EVI D;  5DF9 A;  4P85 A;  1NXY A;  3NDE A;  4JF4 A;  5CER A;  3PBN A;  1DJC A;  1K56 D;  2ZC5 B;  4JKT A;  4NK3 A;  1K57 C;  4Y0O A;  4FSF A;  2IWB A;  3BLM A;  5CGS A;  2V1Z A;  3HLD A;  1TDL A;  2WYX A;  4BQM A;  4OP5 A;  3PBT A;  3MKE A;  4X6T A;  2I72 A;  4X55 A;  2GDN A;  3S1Y A;  4X69 A;  2XR0 A;  1K6S A;  2H0T A;  3IF6 B;  4N9L A;  4N1H A;  4N92 A;  2P74 A;  4R0Q A;  4QY6 A;  3IH9 A;  3BFG A;  1ERM A;  2Q9N A;  5TGF A;  3ZVW A;  3IHB A;  4S2O A;  2A3U A;  1KE3 A;  3PBS A;  3N8R A;  4KZ6 A;  5F1G A;  3SS4 A;  5CEB A;  5M19 A;  1BLC A;  2ZQC A;  5GHY A;  3ZG9 B;  4IVI A;  2HP5 A;  1ONH A;  3GMW A;  3ITB A;  3MXS A;  3NCK A;  3ZFZ A;  2X02 A;  3IXG A;  1CI9 A;  5DTK A;  1K4E A;  2ZLY A;  1L0E A;  1K57 A;  1VM1 A;  3BEC A;  1WE4 A;  3HUO A;  3OCL A;  1WYB A;  3SS3 A;  3W8K A;  3C4P A;  4XUZ A;  1JTD A;  1W8Y A;  4C75 A;  1LI9 A;  5EUA A;  4DDS A;  2J7V A;  3UPO A;  1GHI A;  1W7F A;  2FFY A;  4KG5 A;  3QNB A;  3VP2 A;  3S4X A;  4DF6 A;  5FQQ A;  3CG5 A;  5CTN A;  4QB8 A;  4FH4 A;  5HFO A;  3VOY A;  1W8Q A;  2FFF B;  2DRW A;  1IYP A;  3N8L A;  1LL5 A;  1M40 A;  3DWK A;  1SDN A;  3MZE A;  1FCN A;  4BL2 A;  5AQA A;  2PBY A;  4E3N A;  4BEN A;  2RL3 A;  1ES5 A;  1K54 C;  1SKF A;  3N8S A;  3OZH A;  1MWT A;  4PMA A;  4QU3 A;  4WBG A;  5EOO A;  3RXW A;  3VP4 A;  2WAE A;  3ZG7 B;  4DE1 A;  5CHJ A;  2WAF A;  5EVL A;  3QNC A;  4JBF A;  3UN7 A;  3VP3 A;  4Y7P A;  1DJB A;  1ZG4 A;  2XK1 A;  4MBK A;  5L2F A;  3HUN A;  1WYC A;  2Y55 A;  1E4D A;  1BLH A;  4IVK A;  3UPN A;  1FQG A;  1BUE A;  5A92 A;  4GN2 A;  2EXB A;  1I2S A;  4LV3 A;  1IYS A;  4HEF A;  1PWD A;  2WGI A;  2WZZ A;  1NZU A;  4KZ3 A;  4WMC A;  1L0G A;  3N7W A;  4MBH A;  3HLG A;  2WGW A;  4NET A;  4RX3 A;  1YT4 A;  4DE0 A;  5AQ9 A;  3WS1 A;  5FDH A;  3IT9 A;  3ZNY A;  3UDI A;  2ZC6 B;  2G2W A;  3Q7V A;  3QHY A;  5FQK A;  4DKI A;  4BLM A;  3EQU A;  1BLS A;  4KZ9 A;  5KZH A;  4FD8 A;  1MPL A;  3C7V A;  4P0M A;  4PM7 A;  3Q82 A;  4WMC D;  1RCJ A;  3RJU A;  3UE0 A;  3BFC A;  4MEZ A;  3FV7 A;  4WZ4 A;  3SH8 A;  4E6X A;  4KG6 A;  1M6K A;  2ZC3 B;  3W4Q A;  2HDS A;  1PIO A;  1MWS A;  4EQI A;  2HP9 A;  2XD1 A;  3IF5 A;  3ZVT A;  4DXB A;  2XEP A;  1KDS A;  1YLJ A;  3IWO A;  4ID4 A;  3MZD A;  2EFU A;  4OLD A;  2ZQ8 A;  2XF3 A;  1C3B A;  3WRT A;  2J9O A;  4BD0 A;  5AQ7 A;  3G2Y A;  3RXX A;  4ZDX A;  1MWR A;  1NJ4 A;  1NY0 A;  3PBR A;  1IKG A;  4LCM A;  1FSY A;  3LCE A;  3GRJ A;  4OPR A;  5EOE A;  5FAO A;  4JF6 A;  1MBL A;  1PW1 A;  4S2K A;  3N4I A;  1CEF A;  5JYP A;  4R4S A;  3UY6 A;  1EI5 A;  3AGF A;  1K56 A;  2WKE A;  4B88 A;  4JXS A;  4IED A;  3V3S A;  5GHX A;  1KGF A;  1OME A;  1XP4 A;  3UNW A;  2VGJ A;  4OPZ A;  3OPP A;  1YLT A;  1Q2P A;  2WGW B;  1W5D A;  4KG2 A;  1XXM A;  4MLL A;  3NDG A;  4ZBE A;  3IXH A;  2OSU A;  2XD5 A;  3DWZ A;  1K6R A;  4B4Z A;  1ESI A;  3Q7V B;  5EPH A;  5TFQ A;  4K0X A;  2WKI A;  4JF5 A;  4Y0U A;  5HL1 A;  3OCN A;  3Q07 A;  5GLA A;  3S22 A;  3PBQ A;  1YMX A;  3AGD A;  1K55 C;  4X56 A;  1HVB A;  4OQI A;  4LV0 A;  3BRM A;  4Z9Q A;  1KE0 A;  4KZA A;  3N6I A;  3PBO A;  4KZ4 A;  1CEG A;  4PM9 A;  5DF7 A;  3MBZ A;  4YFM A;  4JPM A;  1XGJ A;  3A3F A;  3V50 A;  5CGX A;  4OP8 A;  1PW8 A;  2G2U A;  4MBF A;  5EVI B;  4FH2 A;  1KVL A;  1H8Z A;  2DNS A;  5HAI A;  2B5R A;  1PWG A;  5FI6 A;  3O86 A;  1XKZ A;  2V20 A;  3LO7 A;  4GDN A;  2WKH A;  4DRT A;  3LY4 A;  3M6H A;  1JVJ A;  4UA6 A;  4C3Q A;  1JWV A;  3V39 A;  3WWX A;  4S2J A;  3UE1 A;  3VSK A;  1KE4 A;  3HBR A;  2ZMA A;  1XA1 A;  1BLP A;  4PM5 A;  3M2J A;  3P98 A;  3ZDJ A;  3DTM A;  1DY6 A;  4QJG A;  2Y2O A;  2EX6 A;  1GA9 A;  1I2W A;  3UO9 A;  1K38 A;  1L0D A;  2Y2G A;  3G31 A;  4OPY A;  3Q81 A;  3MFD A;  2H5S A;  1ALQ A;  2Y2L A;  1YMS A;  3NBL A;  4GB7 A;  5GLD A;  5A93 A;  3G4P A;  2ZQ7 A;  5HAR A;  4UHU A;  1ZKJ A;  4B4X A;  5FAT A;  4R4R A;  2DCF A;  4ZJ1 A;  3W4O A;  4LV2 A;  5GHZ A;  5I94 A;  5A91 A;  5DVA A;  1KGG A;  3GQZ A;  3UDF A;  2P9V A;  2Y2J A;  4M3K A;  4ZAM A;  1ERO A;  4WEK A;  1VQQ A;  5IHV A;  2WUQ A;  3G30 A;  2HDQ A;  4WEJ A;  5GLC A;  2ZQA A;  4A5R A;  1ZG6 A;  3A3E A;  1IKI A;  4XXR A;  5E2F A;  3HUM A;  1PI5 A;  1HZO A;  5FI7 A;  2H0Y A;  1L2S A;  1L0F A;  3V5M A;  3BM6 A;  3TSG A;  3VMA A;  4EV4 A;  4UA9 A;  1FOF A;  3B3X A;  3NC8 A;  5GL9 A;  3SS5 A;  3HLE A;  1MXO A;  1BT5 A;  4E3M A;  1O07 A;  4N1X A;  1JWP A;  2E8I A;  3D4F A;  4HBU A;  2UWX A;  1BTL A;  4E3O A;  1YLZ A;  2H10 A;  3Q1F A;  5FQ9 A;  2JE5 A;  5FQM A;  1BZA A;  4LV1 A;  2HDU A;  4QY5 A;  3GR2 A;  4C6Y A;  4IBX A;  1E25 A;  4KQR A;  5D3O A;  1K54 A;  1FR1 A;  2Y2H A;  1XPB A;  3HL9 A;  3ISG A;  2Q9M A;  5FQI A;  5DF8 A;  2OLU A;  1K25 A;  3SH9 A;  1G6A A;  3E2L A;  3ZG8 B;  4OVD A;  2WAD A;  1ES2 A;  3OPH A;  3ZNT A;  4JLF A;  4BD1 A;  1YLP A;  1PZP A;  5CTM A;  1N9B A;  2P9V B;  3IF6 C;  3BLS A;  1J9M A;  4ZTK A;  4YIN A;  2HPB A;  4CPK A;  4Y0T A;  2XFT A;  3P09 A;  3UPP A;  5F1F A;  3BFF A;  5HW3 A;  4S2L A;  2QMI A;  3WS2 A;  4R3B A;  5E2E A;  5A90 A;  2Y2M A;  1IYO A;  1MKI A;  2JCH A;  2Z2L B;  3FYZ A;  2A49 A;  3GV9 A;  5KSC A;  1FCO A;  1IEM A;  3ZCZ A;  1KDW A;  3C5A A;  3FKV A;  4E3I A;  3PTE A;  1ESU A;  5FAP A;  3DW0 A;  3TOI A;  2R9W A;  3WS5 A;  2EFX A;  2Y2Q A;  4R23 A;  3GTC A;  3M2K A;  5CGW A;  3BYD A;  4WYY A;  4OKP A;  3G34 A;  5BOH A;  2ZQ9 A;  4OON A;  4RX2 A;  3W4P A;  4RVA A;  3IF6 A;  1FSW A;  5CRF A;  3BFD A;  3IQA A;  3O3V A;  3FZC A;  4EBN A;  4WZ5 C;  4GD6 A;  1K4F A;  1NYY A;  1IEL A;  1LHY A;  4GD8 A;  5TR7 A;  4E3K A;  1SCW A;  1Z6F A;  2QZ6 A;  4HBT A;  5E43 A;  5U47 A;  1TEM A;  2C5W B;  2C6W B;  4WEL A;  4E3L A;  4H8R A;  3PAG A;  5DTS A;  2RCX A;  3IWI A;  3OPR A;  3ZHH A;  2CC1 A;  3OPL A;  3G35 A;  4OOM A;  3VFF A;  2Y4A A;  1CK3 A;  2ZM2 A;  1GHP A;  3NIA A;  4D2O A;  4EUZ A;  2QPN A;  5E2G A;  1TDG A;  4JXG A;  4QD4 A;  4S2M A;  3VP0 A;  3IXB A;  1LL9 A;  3BFE A;  1NYM A;  3VFH A;  1S0W A;  3E2K A;  5HAQ A;  4WZ5 A;  4JXW A;  2PU4 A;  1FR6 A;  3AGE A;  4O7D A;  2Y2I A;  2X01 A;  1KGE A;  2ZC4 B;  3M6B A;  4JXV A;  1RGY A;  3LY3 A;  5CXW A;  4CJN A;  3FKW A;  2WK0 A;  5M18 A;  4QHC A;  1NZO A;  4E6W A;  1MWU A;  1K55 A;  3OC2 A;  1HTZ A;  2HDR A;  3VOZ A;  1O7E A;  4OOY A;  3IH8 A;  1HD8 A;  5E2H A;  3CJM A;  4R3J A;  1Q2Q A;  1PI4 A;  5CHU A;  3WS0 A;  2IWD A;  1KVM A;  4KQO A;  4DXC A;  4IBR A;  3HLC A;  3PAE A;  1MY8 A;  1GHM A;  1BSG A;  2IWC A;  2XLN A;  4PM6 A;  4R1G A;  4OH0 A;  3VSL A;  2BG1 A;  3MKF A;  4PPR A;  3HVF A;  1LI0 A;  3I7J A;  3SOI A;  4KZ7 A;  3ZG5 A;  4K91 A;  4P6B A;  4RA7 A;  3IXD A;  3HRE A;  1GCE A;  1U60 A;  4KEN B;  4FCF A;  4U3T A;  1QMF A;  1GA0 A;  1I5Q A;  4XUX A;  1XA7 A;  2EX8 A;  2XQZ A;  4X68 A;  4E3J A;  2ZC7 A;  4N9K A;  3UE3 A;  4F94 A;  1N4O A;  3HLW A;  4KZ5 A;  1XGI A;  3WS4 A;  4BJP A;  3VP1 A;  1ONG A;  3TG9 A;  2WGV A;  4MNR A;  2ZM0 A;  5J8X A;  5FQJ A; 
#chains in the Genus database with same CATH topology
 2F8N H;  1SHV A;  4GKU A;  1ES4 A;  4WUJ A;  5CPK B;  4GNU A;  3UE6 A;  5AV5 B;  3A6N A;  3LEL D;  4LG2 A;  1XX2 A;  1ERQ A;  4H9R B;  1VB6 A;  3F1P A;  3U2A A;  2PU2 A;  3Q7Z A;  3B0D C;  5TJJ A;  4DMZ A;  4QLC B;  4HME A;  1M19 D;  3MGS C;  5EEC A;  4DDY A;  1L6J A;  3GVB A;  3UME A;  2EX2 A;  3IP4 C;  5F99 C;  2X71 A;  3UDX A;  4HES A;  3LR5 A;  3MMH A;  2ZBB A;  3F6T A;  2HV1 A;  5GT3 C;  4R6L A;  1XJ2 A;  4GDB A;  3ZG0 A;  3HLF A;  2EX9 A;  1DP9 A;  1TAF B;  5FUG B;  5C3I B;  2JBF A;  4K0W A;  1HQ3 C;  5B2I C;  4NKP A;  2ZQD A;  2HIO D;  1JWZ A;  4KQQ A;  4X53 A;  5AY8 D;  4HH3 A;  1U35 A;  4OLG A;  1P3B C;  4HI4 A;  3WRZ A;  2BTF P;  1P3F A;  2NQB A;  1EWZ A;  3CMZ A;  1GSX A;  4WU8 A;  4GS9 A;  3T50 A;  4R8P D;  4OQ0 A;  3WTP B;  3UTA D;  4CLC B;  2P7J A;  3GSG A;  2V1B A;  2ZM8 A;  4ZJ2 A;  1LLB A;  5EVI A;  2PD7 A;  1OTI A;  2XSS A;  1W79 A;  2P04 A;  3WAA C;  2M7U A;  2PYO B;  5CP6 A;  4L9G A;  4Q8I A;  5KSH A;  3B42 A;  1ZLA A;  3JPU A;  4EBP A;  3JYI A;  3NUL A;  4ARZ B;  1P3K C;  2OAQ 1;  1QME A;  3REI B;  1P3O C;  4P85 A;  1NXY A;  1NLY A;  5A8B A;  3EWK A;  2NZD A;  4G92 B;  4J8U C;  3D9Y A;  4XT2 B;  4JKT A;  4MMN A;  3O62 B;  1TDL A;  4BQM A;  4OP5 A;  2Z6C A;  3R45 A;  3REK A;  4X69 A;  1P34 A;  1YSP A;  4N9L A;  1BH8 B;  5BS7 C;  2P74 A;  4NEE D;  1O6I A;  1P3P D;  3C1B A;  3VE4 A;  2OAP 1;  5HPF A;  3MGQ A;  3FDD A;  3PBS A;  4KZ6 A;  5M19 A;  4WU9 B;  2JKG A;  2CV5 D;  3MXS A;  4XUJ D;  3ITB A;  3NCK A;  1KX3 B;  2X02 A;  1UR8 A;  4Z66 A;  2GNX A;  1STZ A;  1VET B;  3AZI A;  2A24 B;  1K57 A;  3BEC A;  2G5I C;  3OCL A;  1WWS A;  4J8V D;  3W8K A;  3RTY A;  4C75 A;  4DDS A;  1ZHH B;  3HSH A;  3JVV A;  5B31 A;  5FQQ A;  3KFU G;  4EO5 B;  3MR0 A;  4ETX A;  2G5H C;  5HFO A;  4F3L A;  2FJ7 B;  3B0C T;  1IYP A;  5G4Z A;  1P3G C;  5AQA A;  2PBY A;  5FEG A;  4J8W A;  5F6A A;  3AZH B;  1Q9C A;  3QP2 A;  1A7W A;  5CPI A;  2L1M A;  4JBF A;  3UN7 A;  3VH5 A;  4HP4 A;  5L2F A;  5E5A D;  1XFN A;  1R4V A;  3HUN A;  1WYC A;  3AZG B;  1E4D A;  4G91 C;  3UTB D;  1BLH A;  4IVK A;  3T1Q B;  1I2S A;  4LV3 A;  5G49 B;  5B33 A;  2WZZ A;  5B32 A;  4KZ3 A;  3UB8 A;  4OJL A;  3AFA B;  4MBH A;  4NET A;  1YT4 A;  4EEP A;  4I3J A;  5B2J D;  1JFI A;  1PZR A;  4Z5T C;  3V9R B;  3QHY A;  5FQK A;  5GSU A;  5KZH A;  4KZ9 A;  4FD8 A;  3C7V A;  3A6N B;  4P0M A;  1RCJ A;  4IBG A;  1E8B A;  4MEZ A;  4WZ4 A;  4E6X A;  4KG6 A;  5IU1 A;  1Z09 A;  1W1V A;  2HP9 A;  3IWO A;  1TS8 A;  5AVB A;  4ZBJ C;  1C3B A;  4KUD C;  2ZY2 A;  5B40 A;  3G2Y A;  4ZDX A;  1NY0 A;  3PBR A;  1FSY A;  3LCE A;  2WKR A;  4GW9 A;  4OPR A;  1MBL A;  3MGR A;  4S2K A;  2V0W A;  3W96 D;  3UY6 A;  3EEH A;  4JJN A;  4JXS A;  3REL D;  3V3S A;  5AVE A;  1OME A;  4OPZ A;  3MXQ A;  4ESP A;  2WGW B;  1W5D A;  4MLL A;  3NDG A;  4X23 A;  3IXH A;  4J8X A;  1U35 B;  5CPJ D;  4JF5 A;  3OLO A;  5HL1 A;  3Q07 A;  5F69 A;  5GT0 C;  3PBQ A;  1YMX A;  1P3F B;  2O9B A;  4WU8 B;  3AZE B;  4GS9 B;  3KUY D;  3N3F A;  3X1S C;  1CEG A;  4PM9 A;  2W3E A;  2O99 A;  3KXB C;  5CGX A;  4OP8 A;  3MGP A;  4KGC C;  1G28 A;  4FH2 A;  5EVI B;  4UQI S;  3TU4 A;  1XKZ A;  4GDN A;  4H9O A;  4UA6 A;  4C3Q A;  3EPH A;  3V39 A;  3AZM A;  5CP6 B;  4I39 A;  1BLP A;  3AZJ C;  3W99 C;  3M2J A;  3P98 A;  4EER A;  2LB5 A;  1DY6 A;  4QJG A;  5DNN C;  2YKH A;  1GA9 A;  4NXG A;  4H9Q B;  3T4Q A;  5AVC B;  1L0D A;  1AOI D;  5GXQ D;  4JGQ A;  4CAY B;  1P3I C;  1ALQ A;  1YMS A;  3G4P A;  5HAR A;  5DFX A;  3MJQ A;  1XJ6 A;  5FAT A;  4B4X A;  3AL0 C;  3W4O A;  3REK B;  3CPT A;  5GHZ A;  4IBB A;  5A91 A;  3UB5 P;  1EAK A;  3AYW A;  3LYX A;  3WA9 A;  1VEU B;  5IHV A;  4WEK A;  1VQQ A;  2WUQ A;  3C1B B;  2HDQ A;  3B6F D;  2ZQA A;  5DFY A;  1KS0 A;  2QYB A;  1IKI A;  1HZO A;  5FI7 A;  2PR5 A;  2VQR A;  1L0F A;  3VMA A;  2W3H A;  3BM6 A;  1M1A C;  1AOI B;  1Y4O A;  5GL9 A;  4HJ6 A;  1MXO A;  4H6J A;  4E3M A;  3F1O A;  3EG5 B;  1YLZ A;  3WD1 A;  5FQM A;  4LV1 A;  4NYY A;  1YAX A;  2HDU A;  4QY5 A;  1GPF A;  4KQR A;  1K54 A;  5B31 B;  2Y2H A;  3X1U C;  1FIL A;  3CWF A;  1ACF A;  1K25 A;  3VOL A;  1B6W A;  3ZNT A;  3AV1 B;  1QO6 A;  4BD1 A;  5BT1 D;  4YWZ A;  4MB3 A;  2NQB C;  3IF6 C;  1J9M A;  4ZTK A;  4YIN A;  4J8W B;  4Y0T A;  1TZY A;  3C38 A;  3UPP A;  5F1F A;  5B1L D;  4S2L A;  4HMD A;  4HMC A;  2QMI A;  1T1B A;  5A90 A;  1IYO A;  3AN2 D;  1IEM A;  2O0Y A;  3C5A A;  3PTE A;  3P01 A;  3WS5 A;  3BWL A;  1CQA A;  2EFX A;  3W98 C;  4KUO A;  3M2K A;  5CGW A;  3DBA A;  1ZLA C;  4AWL C;  3G34 A;  2ZQ9 A;  3W4P A;  4RVA A;  2K7S A;  1FSW A;  5CRF A;  4NE3 A;  3AZK C;  3O3V A;  1K4F A;  1NYY A;  4HQA A;  5TR7 A;  3LUQ A;  1SCW A;  1TEM A;  1JFI B;  4D60 A;  2RCX A;  3ZHH A;  5B1M D;  5GSU B;  3H7W A;  1X0O A;  3VFF A;  3AZN B;  3A0V A;  1P34 C;  3LFV A;  2QPN A;  3E4O A;  3AZF A;  4YM6 A;  1TDG A;  1ID3 D;  3VP0 A;  1PRQ A;  3LZ0 C;  2QWS A;  1LL9 A;  3MGQ C;  3BFE A;  4NE5 A;  3X1T D;  2PU4 A;  1GXD A;  4Z66 C;  1LL8 A;  3ZQ5 A;  4WNN A;  3AZI C;  1KGE A;  1RGY A;  3MGR B;  3PXP A;  4CJN A;  2WK0 A;  5CPK A;  5AV8 A;  4JJN B;  3LJA A;  1O7E A;  1HD8 A;  5E2H A;  2CWE A;  3AZL A;  1PI4 A;  2VGL M;  5HDD A;  4H9S A;  1KX4 A;  4DRB A;  3B6G C;  4H9R A;  3PAE A;  3QP5 A;  4OJO A;  4YS3 C;  4X23 B;  1BSG A;  2B18 A;  4EEU A;  1MKM A;  4GCZ A;  3MKF A;  4PPR A;  4J8X B;  3WKJ A;  3DTI A;  3REH D;  4K91 A;  4P6B A;  2ZMV A;  1P0Z A;  4R38 A;  1U60 A;  3L25 A;  4U3T A;  1QMF A;  1GA0 A;  4MN6 A;  5JRG D;  1YKD A;  4Y15 A;  2EX8 A;  4UUZ A;  2VLG A;  4F94 A;  1N4O A;  1XGI A;  4BJP A;  1T3U A;  2FN2 A;  5EM1 A;  3TG9 A;  5J4E A;  2IOU A;  3MGP B;  2ZM0 A;  5FUG A;  3X1V B;  5FQJ A;  4Q0H A;  3TU4 B;  2LB9 A;  3ULF A;  4H9O B;  1D06 A;  3AZM B;  1M19 A;  1RP5 A;  5B33 C;  3E4P A;  2P08 A;  5B24 C;  1BUL A;  3AV2 D;  5B32 C;  2XGN A;  2OLV A;  2Y2N A;  3ZGA B;  4ZJ3 A;  4H9P A;  1G68 A;  4Z2L A;  5B0Y C;  3G6O A;  1IYQ A;  4EXO A;  2IO5 B;  3P7N A;  5FAQ A;  1E6N A;  5G18 A;  3NQU B;  1E88 A;  1DRM A;  4WZS B;  4LD9 D;  1V9Y A;  1YU1 A;  5C5K A;  5CEC A;  3AYW B;  4GH9 A;  1YLY A;  1EQZ D;  2ZMF A;  1T18 A;  2V8C A;  3A1I A;  5AVB C;  5AV9 C;  4ARZ A;  1YM1 A;  4ZUX C;  4S2I A;  4Z2J A;  5B40 C;  1FCM A;  1H8M A;  4S2P A;  1P3M C;  4S2N C;  4R8P A;  3V3R A;  4JGR A;  2JHE A;  4XT2 A;  3LEZ A;  4KZ8 A;  1E6P A;  3F1O B;  2HUE B;  1OTA A;  1ES3 A;  2V5O A;  3IHA A;  4Z2M H;  4PM8 A;  1S1Z A;  4EBL A;  2VA0 A;  2ZY5 A;  5FSR A;  2R9X A;  3MGS D;  1D1J A;  3IS2 A;  3KSI A;  2ARO C;  5F99 D;  2XDM A;  2W8S A;  3DTE A;  4L0L A;  1KX3 A;  4GOG A;  3KWQ C;  5GT3 D;  1VET A;  2A24 A;  4KHA A;  3ITA A;  1YU3 A;  1AXB A;  1E3U D;  4KZB A;  4EWF A;  1HQ3 D;  5B2I D;  2ZD8 A;  3VH6 A;  2FH5 A;  2JKT M;  4JF4 A;  4Q0J A;  4XZQ C;  1P3B D;  1DJC A;  1K56 D;  1P3P A;  5B0Z B;  3MNN C;  4FSF A;  5DNM C;  2IWB A;  5BO0 A;  5DJU A;  3PBT A;  3MKE A;  3QP8 A;  2I72 A;  3R4K A;  4AFI A;  2FJ7 A;  3S1Y A;  3NOT C;  2CV5 A;  4XUJ A;  2XR0 A;  3MFX A;  1F98 A;  2VGL S;  4QY6 A;  2Q9N A;  3IHB A;  4Y17 A;  5KIZ A;  4J8V A;  4O01 A;  3N8R A;  5CEB A;  1BYW A;  3AZH A;  4HGA B;  3H7W B;  2GJ3 A;  3WAA D;  5DTK A;  1K4E A;  1L0E A;  4EQ1 A;  5J3W A;  3HUO A;  3AZF B;  2F8N K;  1P3K D;  3E4Q A;  3WA9 C;  3KS4 A;  4MN7 A;  1P3O D;  3C4P A;  5G49 A;  1IFQ A;  1JTD A;  1W8Y A;  4J8U D;  5EFW A;  2HF6 A;  2FFY A;  3AFA A;  4HJ3 A;  3LZ1 C;  3VP2 A;  4WNN B;  3FC7 A;  3CG5 A;  3LIA A;  5CTN A;  1P97 A;  4FH4 A;  3V9R A;  3IX4 A;  5AV8 B;  2QJ5 A;  3MF0 A;  2XRN A;  3LJA B;  1LL5 A;  1T1A A;  1M40 A;  1SDN A;  3AZL B;  1FCN A;  4BL2 A;  4NZ4 A;  1KX4 B;  1KX5 B;  3LI8 A;  3UTB A;  2L0W A;  4BEN A;  2RL3 A;  1ES5 A;  1K54 C;  3OZH A;  3VP4 A;  2EWV A;  3WKJ B;  5AV6 C;  5EVL A;  3VP3 A;  3KSH A;  4Y7P A;  2XK1 A;  3T1S A;  5TBM A;  3PHY A;  4IUH A;  3UPN A;  2D01 A;  5B2J A;  3T4T A;  2EXB A;  4UUZ B;  1IYS A;  1PWD A;  3LID A;  2WGI A;  4NXF A;  3KYE A;  3CUE C;  3BQA A;  3LEL B;  2WGW A;  1F66 C;  2PRF A;  3WS1 A;  3VH5 W;  1GSV A;  5IT5 A;  3W97 C;  1P3G D;  1E6Z A;  1P3A C;  1M19 B;  3Q82 A;  3UE0 A;  3RJU A;  3FV7 A;  3SH8 A;  5BNX A;  3W4Q A;  4EQI A;  3AZE A;  3IF5 A;  3REJ D;  5EVE A;  4H9P B;  1KDS A;  1YLJ A;  1HTA A;  2EFU A;  3C1C C;  3MVD C;  3REL A;  3UMD A;  1NLZ A;  1S66 L;  4NFT A;  1IKG A;  5EOE A;  5FAO A;  2RIQ A;  4JF6 A;  2W1R A;  4YM6 C;  2HIO B;  3N4I A;  5AY8 B;  2WKE A;  2J3T C;  5CPJ A;  1F5M A;  2J8P A;  1J3W A;  5GHX A;  4H9Q A;  5AVC A;  3FPW A;  3MSH A;  1XXM A;  4Z5T D;  3IX8 A;  4R8P B;  3REJ B;  3DWZ A;  1W1T A;  3UTA B;  1IOU A;  5TFQ A;  3BY9 A;  5EPH A;  4NYU A;  4CAY A;  4K0X A;  2WKI A;  5CPK C;  5AV5 C;  1HVB A;  5KDM A;  3H0L C;  4Q0I A;  4RQ9 A;  4NY2 A;  1KE0 A;  2XA7 M;  4KZA A;  3PBO A;  1VEU A;  4KUD D;  3IS2 B;  4YFM A;  4QLC C;  1XGJ A;  3A3F A;  3NQJ B;  1N9L A;  1PW8 A;  2JKT I;  2YFV A;  3VV4 A;  1KVL A;  1H8Z A;  5HAI A;  5HD3 A;  5FI6 A;  2ZM5 A;  2V20 A;  1AOI A;  2GZA A;  3M6H A;  1JVJ A;  4KHA B;  3P5J B;  5GXQ A;  4S2J A;  3UE1 A;  3HBR A;  4PM5 A;  3ZDJ A;  2Y2O A;  2EX6 A;  3MS6 A;  1I2W A;  3UO9 A;  1K38 A;  5C3I C;  2Y2G A;  3G31 A;  3MFD A;  5GT0 D;  1P3P B;  4GB7 A;  5MC7 A;  3B6F A;  5BO0 B;  5B32 G;  1ZKJ A;  2DCF A;  3AV1 A;  2CV5 B;  4XUJ B;  1UGU A;  5DVA A;  4NXE A;  1KGG A;  3KXB D;  2ZY3 A;  1H3O B;  4M3K A;  1ERO A;  3WTP C;  2K2N A;  3W2Z A;  4OJ6 A;  4CLC C;  4HP9 A;  4J8V B;  4KGC D;  1ZG6 A;  3A3E A;  4XXR A;  5E2F A;  2BYM A;  2H0Y A;  2UV0 E;  3NC8 A;  2M1C A;  3AZJ D;  3W99 D;  4LRZ E;  5DNN D;  2PYO C;  2E8I A;  3D4F A;  4E3O A;  1CXW A;  5FQ9 A;  2JE5 A;  3KO6 A;  3REI C;  1P3I D;  4JGO A;  4M6B A;  4G3K A;  4I38 A;  2PR6 A;  3L26 A;  4GJ4 A;  3BY8 A;  1OT9 A;  3PYP A;  3HL9 A;  1TS7 A;  4B9O A;  4I5S A;  3E2L A;  3O62 C;  4OVD A;  1ES2 A;  3OPH A;  2GX5 A;  3AN2 A;  2DQN C;  3AZN A;  1N9B A;  2G7U A;  2O9A A;  2P9V B;  5E5A B;  3BLS A;  3TW8 A;  1SKO A;  3UTB B;  2HPB A;  4CPK A;  2XFT A;  3M7P A;  2PT7 A;  1M1A D;  4R3B A;  1EW0 A;  3U4L P;  4WU9 C;  2JCH A;  3FYZ A;  2A49 A;  4IJG A;  1KX3 C;  5TBM B;  3DW0 A;  4K08 A;  5B2J B;  4OKP A;  2VJW A;  5B1M A;  5BOH A;  4RX2 A;  3EGX C;  3BFD A;  3X1U D;  5G4Y A;  1YPR A;  1LHY A;  4E3K A;  1ID3 A;  4WEL A;  3PAG A;  2V9A A;  3FG8 A;  3OPR A;  4EO5 C;  2CC1 A;  3OPL A;  2NQB D;  1GOI A;  2FJ7 C;  2ZM2 A;  3X1T A;  5BNX B;  3C8C A;  4DQY B;  1KOU A;  4S2M A;  2XA7 S;  3W96 B;  3VFH A;  3E2K A;  3AZH C;  5HAQ A;  3REL B;  4WZ5 A;  3WD0 A;  3W98 D;  3X1V A;  2Y2I A;  3NOP C;  2X01 A;  2ZC4 B;  3M6B A;  3AZG C;  1ZLA D;  5CXW A;  4QHC A;  1NZO A;  2KDK A;  5CPJ B;  3AZK D;  1K55 A;  3REH A;  3ZYT A;  4OUI A;  4NG2 A;  1KVM A;  1JNU A;  4DXC A;  4IBR A;  3AFA C;  3CIT A;  3B0B A;  5JRG A;  1B67 A;  3KUY B;  2BG1 A;  4IJF A;  1P34 D;  3K2N A;  3IXD A;  3HRE A;  2DMW A;  3A6N C;  4IUK A;  3NQU A;  3W98 B;  1OGG A;  5KDM B;  4EES A;  3LZ0 D;  3MGQ D;  4E3J A;  2ZC7 A;  1S67 L;  3VP1 A;  2WGV A;  4Z66 D;  4FUW A;  3AZI D;  2YFV B;  5L10 A;  5J8X A;  4BLM A;  3MQO A;  3CZD A;  2J9P A;  3KX0 X;  3G2Z A;  2BLS A;  4IBF A;  4NXB A;  1MZU A;  2Y2P A;  5GXQ B;  3SH7 A;  3B6G D;  3HJK A;  4LEN A;  1HLU P;  3NI9 A;  4YS3 D;  4DJ3 A;  2Z2M B;  5F83 A;  1ZC2 A;  4OOL A;  1EQZ A;  2Y8H A;  2E8J A;  3B6F B;  1U35 C;  5L07 A;  2Y59 A;  4L9E A;  1T1C A;  4PHT A;  3L28 A;  2Y91 A;  1DP8 A;  2JC7 A;  1P3F C;  1WWI A;  3K3D A;  4WU8 C;  3AZE C;  3BEB A;  3A3J A;  4OPQ A;  3JVU A;  1S1Y A;  2MJ6 A;  3RH8 B;  4X1M A;  4BL3 A;  1DJA A;  4U0X A;  2BYM B;  2WKP A;  4DE2 A;  2F8N G;  5BNV A;  5EE8 A;  5EVI C;  5F82 A;  3MGS A;  3IBR A;  5B33 D;  4P87 A;  5B0Z A;  5B24 D;  4UAA A;  5FA7 A;  5B32 D;  1UR9 A;  1F9I A;  2AVX A;  5F99 A;  3C4O A;  3C7U A;  2J8Y A;  3EQV A;  5CP6 C;  3NY4 A;  5HX9 A;  5EV0 A;  5GT3 A;  5AVC C;  5B0Y D;  2NZD C;  4Z2I A;  2VGK A;  1M18 D;  1YQS A;  1E3U A;  2PYR A;  1JTG A;  2XFS A;  1RGZ A;  1HQ3 A;  5B1L B;  3FWL A;  1H5X A;  4RYE A;  2JKF A;  4DE3 A;  3AN2 B;  3REK C;  3HLB A;  3IX3 A;  2DF4 C;  4OQG A;  5AV9 D;  3EPL A;  1P3B A;  1SKO B;  1H8Y A;  4GZB A;  5FI2 A;  4ZUX D;  2I9V A;  3NEC A;  3CLO A;  2VEA A;  5B40 D;  3C1B C;  2V2F F;  1SDE A;  1H0G A;  3T1R A;  1P3M D;  5CER A;  3UT9 D;  3PBN A;  3WX7 A;  1OJG A;  5DJT A;  2ZC5 B;  1AOI C;  4NK3 A;  1K57 C;  4Y0O A;  1M18 B;  3BLM A;  2V1Z A;  2WYX A;  4X6T A;  4X55 A;  4WJ3 C;  3UB9 A;  5B1M B;  1K6S A;  2HJE A;  2ARO D;  1P3L D;  4R0Q A;  1KX5 A;  2Y79 A;  3BFG A;  3IH9 A;  5TGF A;  1Z2C B;  1KE3 A;  1ID3 B;  3KS8 A;  5B31 C;  3EOI A;  3SS4 A;  1P3O A;  4GLQ A;  5GHY A;  3KWQ D;  4CSR B;  4IVI A;  3GMW A;  2YKF A;  2W1T B;  3IXG A;  4J8U A;  1CI9 A;  1TS6 A;  3AV1 C;  3UT9 B;  4KQD A;  3X1T B;  3FPV A;  1PDC A;  2ZOI A;  5F5Y A;  1S32 D;  3NJA A;  3SS3 A;  3LGO A;  4J8W C;  4BWI A;  5CX7 A;  4YNR A;  5BS7 A;  1L3L A;  4XZQ D;  1OTB A;  2J7V A;  3UPO A;  5CPI C;  1GHI A;  3LEL A;  4KG5 A;  3MNN D;  5DNM D;  1P3L B;  3QNB A;  3S4X A;  4E45 A;  2PBD P;  4EW7 A;  4LGW A;  1CJF A;  1W8Q A;  3HJI A;  5HDS A;  3N8L A;  3REH B;  1D7E A;  4P6Z M;  1OTE A;  2JKR I;  4HHD A;  2HZ5 A;  2KLI A;  5BPV A;  5JRG B;  1S32 B;  1SKF A;  1MWT A;  3RXW A;  2W3G A;  4DE1 A;  3LR0 A;  2WAF A;  2ZL1 A;  4MCW A;  3A0S A;  4XZQ B;  1DJB A;  5GSU C;  5AJG A;  3WA9 D;  3AZN C;  2Y55 A;  1W63 Q;  1CK7 A;  1BUE A;  2HIO A;  3SW1 A;  5AY8 A;  1P3G A;  4M4X A;  1NZU A;  2ACG A;  3LZ1 D;  3AV2 B;  3HLG A;  1W2E A;  2OWH A;  5AQ9 A;  4IBI A;  3REJ A;  3UTA A;  3MGR C;  3H82 B;  4DKI A;  1BLS A;  2H28 A;  4PM7 A;  4WMC D;  4JJN C;  3LIE A;  1M6K A;  3PR6 A;  4ME4 A;  2ZC3 B;  4G3V A;  2HDS A;  1PIO A;  1MWS A;  4LPZ A;  2XD1 A;  4LD9 B;  5AV6 D;  2Z6D A;  4R70 A;  3ZVT A;  2OWJ A;  4X23 C;  4OLD A;  4PAU A;  4QPR A;  2ZQ8 A;  1EQZ B;  2XF3 A;  4J8X C;  3A0R A;  3NQJ A;  1MWR A;  1NJ4 A;  1OGB A;  2JN7 A;  3L2A A;  4Z5T A;  1N9O A;  1PW1 A;  3O5Y A;  5JYP A;  5L09 A;  1YU2 A;  1KGF A;  1F66 D;  1XP4 A;  4JGP A;  3UNW A;  1YLT A;  4WF0 A;  4B93 A;  3B0D B;  4KG2 A;  3MGP C;  5BNV B;  3QP4 A;  3W97 D;  4ZBE A;  3X1V C;  1P3A D;  2OSU A;  2XD5 A;  3MGS B;  1ESI A;  3Q7V B;  3TU4 C;  4KUD A;  4Y0U A;  5F99 B;  1YSQ A;  5FEF A;  3AZM C;  1K55 C;  4X56 A;  1XJ4 A;  3C2W A;  4Z1W A;  2R78 A;  5GT3 B;  1PFL A;  3N6I A;  1H3O A;  4KZ4 A;  3TE8 A;  5DF7 A;  3C1C D;  3MVD D;  2VKS A;  3MBZ A;  2VX8 A;  5HSQ A;  3NOU C;  3BQ8 A;  3V50 A;  4E04 A;  1HQ3 B;  2F8N D;  2IO5 C;  1OT6 A;  5B2I B;  2DNS A;  4YM6 D;  1N1J B;  5HZH A;  4L9F A;  2B5R A;  2K31 A;  2D49 A;  3O86 A;  2J3T D;  2WKH A;  4DRT A;  1LSV A;  3LY4 A;  4LRY C;  1JWV A;  1P9R A;  5GT0 A;  1P3B B;  1VHM A;  3AYW C;  1KE4 A;  4MB4 A;  1BH9 A;  4HOI A;  3KXB A;  3R7W B;  3Q81 A;  5CPK D;  3C1C B;  2H5S A;  4Z2K A;  5GLD A;  5AV5 D;  1H0M A;  4KGC A;  4UHU A;  3WTP E;  4CLC E;  4R4R A;  2HUE C;  4LV2 A;  5I94 A;  3WAA B;  4LFU A;  4P6Z S;  3T4K A;  4QLC D;  2P9V A;  5E5A A;  2BYK B;  2Y2J A;  3AZJ A;  3W99 A;  1G6O A;  1H3Q A;  2V0U A;  4ZAM A;  1P3K B;  4WEJ A;  4H9N A;  5GLC A;  1P3O B;  4WL9 A;  1PI5 A;  4KUK A;  1L2S A;  3TSG A;  4J8U B;  1FOF A;  4PKY A;  3L9K A;  1P3I A;  3LEQ A;  3HLE A;  1KU5 A;  2HJ9 C;  1ZTU A;  1BT5 A;  1T19 A;  1AWI A;  4N1X A;  1JWP A;  1TZY C;  3NHQ A;  3L27 A;  2H10 A;  1DP6 A;  4C6Y A;  1W63 M;  1E25 A;  3CI6 A;  3EPJ A;  3ISG A;  4WLA A;  5B0Z C;  4IBC A;  2Q9M A;  5FQI A;  3SH9 A;  3ZG8 B;  1G6A A;  4UEY A;  1M1A A;  2WAD A;  4JLF A;  1YLP A;  3HCY A;  3WTP D;  5CTM A;  4CLC D;  4HY8 A;  3W96 A;  3OBF A;  2PHY A;  3WS2 A;  5E2E A;  2Y2M A;  2ZL1 B;  3GV9 A;  4HGA C;  1FCO A;  3ZCZ A;  2RTS A;  1KDW A;  1SZV A;  3X1U A;  2WKQ A;  4ZRR A;  2PYO D;  4IJE A;  2YFW B;  3GTC A;  1XJ3 A;  3AZF C;  1E15 A;  5DKK A;  3REI D;  1P3G B;  2VV8 A;  3EEA A;  3IF6 A;  1UWP X;  3IQA A;  3FZC A;  1OPX A;  4EBN A;  4GD6 A;  4GD8 A;  1A0K A;  3FKE A;  5E43 A;  3O62 D;  5U47 A;  2C5W B;  2C6W B;  1WA9 A;  3KUY A;  3LIF A;  4E3L A;  5DTS A;  1W1P A;  2RVQ C;  5AV8 C;  2Y4A A;  4G91 B;  3LJA C;  3ICY A;  4D2O A;  4EUZ A;  3W98 A;  3AZL C;  5E2G A;  2B95 A;  4H9S C;  1KX4 C;  4JXG A;  5B31 G;  1KX5 C;  4QD4 A;  3VH5 T;  4WU9 D;  3IXB A;  1GSW A;  3B0C W;  1KX3 D;  1NYM A;  1S0W A;  3AZK A;  2QJ7 A;  3WKJ C;  4JXW A;  3AGE A;  3DTK A;  4BMW A;  4JXV A;  4Z5T B;  5F68 A;  4LRX C;  2EA9 A;  1HTZ A;  2HDR A;  1TD5 A;  4OOY A;  3IH8 A;  4EUV A;  5CHU A;  1Q2Q A;  3WS0 A;  3LEL C;  1GHM A;  3LZ0 A;  2IWC A;  4PM6 A;  4R1G A;  4ZBJ B;  2FJ7 D;  2VK3 A;  1OTD A;  4KUD B;  3HVF A;  4KZ7 A;  5L8M A;  4UQI M;  5J7E A;  4RA7 A;  1M19 C;  2ZOH A;  5I5L A;  1G5U A;  1GCE A;  4KEN B;  4FCF A;  1I5Q A;  3X1S D;  4XUX A;  3AZH D;  4N9K A;  3HLW A;  3CHW P;  4CQH A;  3KSF A;  3H0R C;  3B6G A;  3C30 A;  4MNR A;  1ULY A;  4YS3 A;  3AZG D;  4NZ1 A;  3T4L A;  2VV6 A;  3MQ0 A;  3A3I A;  3O88 A;  4ETZ A;  1S6R A;  1H0I A;  5GT0 B;  2HIO C;  1CI8 A;  2A2L A;  5AY8 C;  2OOL A;  3AFA D;  5KMW A;  1PYY A;  3T12 B;  1BH9 B;  5DTT A;  3S7P A;  3X1S B;  1J7M A;  3KXB B;  4IHQ A;  3MZF A;  4G92 C;  4R8P C;  3REJ C;  3UTA C;  2W3D A;  2L5A A;  3A6N D;  4KGC B;  1Y54 A;  1H8P A;  3KSY A;  5B1L A;  1NRF A;  2WZX A;  5CED A;  5DKL A;  4II7 A;  5HAP A;  1NWZ A;  3AZJ B;  3W99 B;  3S7N A;  1ED7 A;  4LCL A;  5B24 A;  4UA7 A;  5DNN B;  4H9N B;  2EXA A;  3MXR A;  3V67 A;  4G3W A;  5GLB A;  1PZO A;  5M1A A;  3T4S A;  3IWQ A;  4U0T A;  1P3I B;  3S7O A;  5B0Y A;  1N9N A;  2V1A A;  3A3D A;  4UPK A;  1M18 A;  2KX6 A;  1TVF A;  3LR4 A;  2IA2 A;  3F1P B;  1YUE A;  5HWT A;  3O87 A;  2Y2K A;  1YU0 A;  1U35 D;  5AV9 A;  2O9C A;  4ZUX A;  5AQB A;  5FAS A;  2HP6 A;  2XH9 A;  1P3P C;  1V9Z A;  1YLW A;  4MB5 A;  4IBJ A;  4OQH A;  1P3F D;  4CSR A;  1M1A B;  1PWC A;  5HL6 A;  1LSW A;  3F1N A;  1P3M A;  4S2N A;  2W1T A;  4WM9 A;  4WU8 D;  3AZE D;  2CV5 C;  3UT9 A;  4XUJ C;  3G32 A;  2NUT C;  1AIW A;  2J80 A;  1Y28 A;  4OJP A;  4GHL A;  2VV7 A;  2OV5 A;  2ZJ9 A;  5JYO A;  1F1E A;  5FDS A;  3T1X A;  4J8V C;  5CHM A;  5EVI D;  5DF9 A;  3NDE A;  3X1U B;  2ARO A;  1P3L A;  1ODV A;  4Y3I A;  5CP6 D;  5HD5 A;  4I3A A;  5CGS A;  3HLD A;  2LY8 A;  2GDN A;  3RFB A;  4Z2M G;  3KWQ A;  5AVC D;  2NQB B;  4WN5 A;  2H0T A;  2NZD D;  3IF6 B;  4N1H A;  4N92 A;  1LT0 A;  3ZVW A;  1ERM A;  5JA4 A;  1S32 A;  2A3U A;  4S2O A;  2NUP C;  5F1G A;  1BLC A;  2W3F A;  2ZQC A;  3REK D;  3ZG9 B;  2HP5 A;  1ONH A;  3ZFZ A;  3E0Y A;  4XZQ A;  2ZLY A;  1VM1 A;  3MNN A;  5DNM A;  4Z2G A;  2JKR M;  1WE4 A;  3C1B D;  5E5A C;  1WYB A;  1ZLA B;  4AWL B;  3UTB C;  4Y5F A;  2D02 A;  4XUZ A;  1LI9 A;  3KYQ A;  3AZK B;  5EUA A;  2NZD B;  4GHA A;  1W7F A;  3AV2 A;  4EET B;  4DF6 A;  4IBD A;  4QB8 A;  4HJ4 A;  1PNE A;  3VOY A;  3R45 B;  5B2J C;  2EWW A;  2FFF B;  3H82 A;  2DRW A;  3L7H A;  1P34 B;  3DWK A;  5HWV A;  3MZE A;  3WD4 A;  4BBV A;  3D72 A;  4E3N A;  5B31 D;  4PMA A;  4LD9 A;  3N8S A;  3LZ0 B;  4WBG A;  3MGQ B;  4QU3 A;  5EOO A;  5EM0 A;  2WAE A;  3ZG7 B;  5CHJ A;  3AV1 D;  3QNC A;  4Z66 B;  3LZ1 A;  1ZG4 A;  3AZI B;  4MBK A;  4EU0 A;  2PYP A;  4J8W D;  1FQG A;  5A92 A;  4GN2 A;  5HPI A;  3GEC A;  4HEF A;  3D3O A;  5CPI D;  1S4R A;  3W96 C;  1XFQ A;  4WMC A;  1L0G A;  3N7W A;  3B6G B;  3REL C;  4YS3 B;  4RX3 A;  2PD8 A;  4DE0 A;  5AVF A;  5FDH A;  3IT9 A;  5AV6 A;  4TX8 A;  4NE6 A;  3ZNY A;  3UDI A;  4F3L B;  2ZC6 B;  2G2W A;  3Q7V A;  3EPK A;  3EQU A;  1MPL A;  5HWW A;  5CPJ C;  3BFC A;  3KYZ A;  3BJN A;  2FZ0 A;  4DXB A;  2XEP A;  4ID4 A;  3MZD A;  5GSU D;  3KUY C;  3CUE A;  3T4J A;  5CPI B;  3GDI A;  3WRT A;  3AZN D;  2J9O A;  4BD0 A;  1F66 A;  5AQ7 A;  3L29 A;  3RXX A;  5B2I A;  1N1J A;  4LCM A;  3GRJ A;  1S4S A;  3W97 A;  1P3A A;  1CEF A;  4NZ3 A;  4R4S A;  1EI5 A;  5AVB D;  1W1Y A;  3AGF A;  1K56 A;  5B33 B;  2PDR A;  4R3A A;  5B24 B;  2ZY4 A;  4B88 A;  5B32 B;  4IED A;  3LI9 A;  1CF0 A;  2VGJ A;  3OPP A;  1Q2P A;  2V8F A;  3MGR D;  3VE3 A;  3LIB A;  5B0Y B;  1K6R A;  3R7W A;  4B4Z A;  5IS1 A;  3MQQ A;  4GHI A;  3C1C A;  3MVD A;  4O8G A;  4JJN D;  3OCN A;  5GLA A;  5GXQ C;  3S22 A;  3WD2 A;  3AGD A;  2F8N A;  4OQI A;  4X23 D;  3WAA A;  4LV0 A;  3BRM A;  1BFM A;  4Z9Q A;  3B47 A;  1OJ5 A;  2BYK A;  4YOF A;  4IBK A;  4J8X D;  3S7Q A;  5AVB B;  5AV9 B;  1P3K A;  4JPM A;  3VH6 W;  4ZUX B;  4Y13 A;  5B40 B;  2G2U A;  3B6F C;  3OOV A;  2Q0O A;  3K3C A;  4MBF A;  4MN5 A;  3F1N B;  1P3M B;  1PWG A;  3LO7 A;  1TS0 A;  4QNL A;  3WWX A;  3T4O A;  3VSK A;  2ZMA A;  1XA1 A;  5AV5 A;  2F2A C;  2M7V A;  3DTM A;  4E44 A;  3MGP D;  4FOF A;  3X1V D;  3HON A;  3TU4 D;  2JSS A;  4OPY A;  4QLC A;  2ARO B;  2W27 A;  5FL3 A;  3AZM D;  2Y2L A;  3WD3 A;  3NBL A;  4BBU A;  2PAV P;  5A93 A;  2ZQ7 A;  4X25 A;  4ZJ1 A;  3KWQ B;  2L4R A;  3GQZ A;  3UDF A;  5BT1 C;  4HIA A;  2QHK A;  2BAS A;  1MC0 A;  3G30 A;  5JA4 B;  5CHL B;  2VZW A;  4A5R A;  3HUM A;  1TAF A;  3TRC A;  2HGV A;  3UB7 A;  3V5M A;  5B1L C;  4EV4 A;  3TJZ C;  4UA9 A;  3B3X A;  3AYW D;  3SS5 A;  3AN2 C;  3MNN B;  5DNM B;  3LIC A;  3IBJ A;  3A1K A;  2XRO A;  5K5B A;  3VH6 T;  2YFW A;  1O07 A;  4HBU A;  2UWX A;  1BTL A;  3Q1F A;  1BZA A;  3GR2 A;  4IBX A;  3WTP A;  4CLC A;  5D3O A;  4I3I A;  1FR1 A;  1XPB A;  4O0P A;  2INW A;  1M18 C;  2OLU A;  3CAX A;  5DF8 A;  2KOI A;  3CPT B;  5LBR A;  5HDC A;  1PZP A;  5B1M C;  1LSX A;  3WA9 B;  2PYO A;  3P09 A;  1E6R A;  1YU4 A;  3BFF A;  5HW3 A;  1ID3 C;  3EGD C;  3REI A;  2QKP A;  2CMN A;  1MKI A;  2Z2L B;  3SZT A;  5KSC A;  3LZ1 B;  3FKV A;  4E3I A;  1ESU A;  5FAP A;  4HH2 A;  3UT9 C;  3TOI A;  3X1T C;  2R9W A;  1TZY D;  2Y2Q A;  1NRJ A;  4H6J B;  4R23 A;  4Y2F A;  3O62 A;  3BYD A;  4WYY A;  2B02 A;  4OON A;  4X1L A;  1BH8 A;  4DRA A;  4WZ5 C;  1IEL A;  5B0Z D;  1P9W A;  3QP1 A;  1Z6F A;  1P3L C;  2QZ6 A;  4HBT A;  5AV6 B;  4H8R A;  4WU9 A;  3IWI A;  3MQL A;  3G35 A;  4OOM A;  4Z2H A;  1CK3 A;  3REH C;  1GHP A;  3BW6 A;  3NIA A;  4HNB A;  1TF1 A;  1TZY B;  3LR3 A;  4IBE A;  1UWN X;  2W0N A;  5JRG C;  1S32 C;  1FIK A;  1F66 B;  1FR6 A;  3KSG A;  4O7D A;  3E98 A;  3AZF D;  3LY3 A;  3W97 B;  1P3A B;  3FKW A;  5M18 A;  4BBT A;  4E6W A;  3DAV A;  1MWU A;  3OC2 A;  1K0K A;  3VOZ A;  3H9W A;  3H0M C;  3CJM A;  4R3J A;  2IWD A;  4PKY G;  4KQO A;  3HLC A;  3AV2 C;  1MY8 A;  3X1S A;  2XLN A;  4QWO A;  3B33 A;  4OH0 A;  4MDZ A;  3VSL A;  4DN0 A;  4NZ5 A;  4GHI B;  2RVQ D;  5AV8 D;  3MVD B;  1LI0 A;  3I7J A;  3SOI A;  3LJA D;  3ZG5 A;  4FTX A;  1F2K A;  3AZL D;  1KX4 D;  2F8N B;  1KX5 D;  3AZG A;  4WV4 B;  4YM6 B;  4LLO B;  1XA7 A;  4OJ5 A;  2XQZ A;  4X68 A;  4LD9 C;  3UE3 A;  3WKJ D;  3WS4 A;  4KZ5 A;  5DNN A;  1ONG A;  3QP6 A;  4DJ2 A;  1EQZ C;  2J3W A;  3UB6 A; 
#chains in the Genus database with same CATH homology
 2F8N H;  1SHV A;  4GKU A;  1ES4 A;  5CPK B;  4GNU A;  5AV5 B;  3A6N A;  3LEL D;  4LG2 A;  1XX2 A;  1ERQ A;  4H9R B;  2PU2 A;  3Q7Z A;  3B0D C;  4QLC B;  1M19 D;  3MGS C;  5EEC A;  4DDY A;  3GVB A;  2EX2 A;  3IP4 C;  5F99 C;  2X71 A;  3UDX A;  4HES A;  3F6T A;  5GT3 C;  4GDB A;  3ZG0 A;  3HLF A;  2EX9 A;  1TAF B;  5FUG B;  5C3I B;  2JBF A;  4K0W A;  1HQ3 C;  5B2I C;  2ZQD A;  2HIO D;  1JWZ A;  4KQQ A;  4X53 A;  5AY8 D;  4OLG A;  1U35 A;  1P3B C;  3WRZ A;  1P3F A;  2NQB A;  1EWZ A;  3CMZ A;  4WU8 A;  4R8P D;  4OQ0 A;  3WTP B;  3UTA D;  3GSG A;  2ZM8 A;  4ZJ2 A;  1LLB A;  5EVI A;  1W79 A;  3WAA C;  2PYO B;  5CP6 A;  4Q8I A;  5KSH A;  1ZLA A;  4EBP A;  3JYI A;  1P3K C;  1QME A;  3REI B;  1P3O C;  4P85 A;  1NXY A;  2NZD A;  4G92 B;  4J8U C;  4JKT A;  3O62 B;  1TDL A;  4BQM A;  4OP5 A;  3R45 A;  3REK A;  4X69 A;  1P34 A;  4N9L A;  1BH8 B;  5BS7 C;  2P74 A;  1P3P D;  3C1B A;  3MGQ A;  3FDD A;  3PBS A;  4KZ6 A;  5M19 A;  4WU9 B;  2CV5 D;  3MXS A;  4XUJ D;  3ITB A;  3NCK A;  1KX3 B;  2X02 A;  4Z66 A;  3AZI A;  1K57 A;  3BEC A;  2G5I C;  3OCL A;  1WWS A;  4J8V D;  3W8K A;  4C75 A;  4DDS A;  3HSH A;  5B31 A;  5FQQ A;  3KFU G;  4EO5 B;  2G5H C;  5HFO A;  2FJ7 B;  3B0C T;  1IYP A;  1P3G C;  5AQA A;  2PBY A;  4J8W A;  3AZH B;  1Q9C A;  1A7W A;  5CPI A;  4JBF A;  3UN7 A;  3VH5 A;  5L2F A;  5E5A D;  3HUN A;  1R4V A;  1WYC A;  3AZG B;  1E4D A;  4G91 C;  3UTB D;  1BLH A;  4IVK A;  1I2S A;  4LV3 A;  5G49 B;  5B33 A;  2WZZ A;  5B32 A;  4KZ3 A;  4OJL A;  3AFA B;  4MBH A;  4NET A;  1YT4 A;  5B2J D;  1JFI A;  1PZR A;  4Z5T C;  3V9R B;  3QHY A;  5FQK A;  5GSU A;  5KZH A;  4KZ9 A;  4FD8 A;  3C7V A;  3A6N B;  4P0M A;  1RCJ A;  4IBG A;  4MEZ A;  4WZ4 A;  4E6X A;  4KG6 A;  2HP9 A;  3IWO A;  5AVB A;  4ZBJ C;  1C3B A;  4KUD C;  2ZY2 A;  5B40 A;  3G2Y A;  4ZDX A;  1NY0 A;  3PBR A;  1FSY A;  3LCE A;  4OPR A;  1MBL A;  3MGR A;  4S2K A;  3W96 D;  3UY6 A;  4JJN A;  4JXS A;  3REL D;  3V3S A;  1OME A;  4OPZ A;  2WGW B;  1W5D A;  4MLL A;  3NDG A;  4X23 A;  3IXH A;  4J8X A;  1U35 B;  5CPJ D;  4JF5 A;  5HL1 A;  3Q07 A;  5GT0 C;  3PBQ A;  1YMX A;  1P3F B;  4WU8 B;  3AZE B;  3KUY D;  3N3F A;  3X1S C;  1CEG A;  4PM9 A;  3KXB C;  5CGX A;  4OP8 A;  3MGP A;  4KGC C;  4FH2 A;  5EVI B;  3TU4 A;  1XKZ A;  4GDN A;  4H9O A;  4UA6 A;  4C3Q A;  3EPH A;  3V39 A;  3AZM A;  5CP6 B;  1BLP A;  3AZJ C;  3W99 C;  3M2J A;  3P98 A;  1DY6 A;  4QJG A;  5DNN C;  1GA9 A;  4H9Q B;  5AVC B;  1L0D A;  1AOI D;  5GXQ D;  4CAY B;  1P3I C;  1ALQ A;  1YMS A;  3G4P A;  5HAR A;  4B4X A;  5FAT A;  3AL0 C;  3W4O A;  3REK B;  5GHZ A;  4IBB A;  5A91 A;  3AYW A;  3WA9 A;  5IHV A;  4WEK A;  1VQQ A;  2WUQ A;  3C1B B;  2HDQ A;  3B6F D;  2ZQA A;  1IKI A;  1HZO A;  5FI7 A;  2VQR A;  1L0F A;  3VMA A;  3BM6 A;  1M1A C;  1AOI B;  5GL9 A;  1MXO A;  4E3M A;  3EG5 B;  1YLZ A;  5FQM A;  4LV1 A;  4NYY A;  2HDU A;  4QY5 A;  4KQR A;  1K54 A;  5B31 B;  2Y2H A;  3X1U C;  1K25 A;  1B6W A;  3ZNT A;  3AV1 B;  4BD1 A;  5BT1 D;  2NQB C;  3IF6 C;  1J9M A;  4ZTK A;  4YIN A;  4J8W B;  4Y0T A;  1TZY A;  3UPP A;  5F1F A;  5B1L D;  4S2L A;  2QMI A;  5A90 A;  1IYO A;  3AN2 D;  1IEM A;  3C5A A;  3PTE A;  3WS5 A;  2EFX A;  3W98 C;  3M2K A;  5CGW A;  1ZLA C;  4AWL C;  3G34 A;  2ZQ9 A;  3W4P A;  4RVA A;  1FSW A;  5CRF A;  4NE3 A;  3AZK C;  3O3V A;  1K4F A;  1NYY A;  5TR7 A;  1SCW A;  1TEM A;  1JFI B;  2RCX A;  3ZHH A;  5B1M D;  5GSU B;  3VFF A;  3AZN B;  1P34 C;  2QPN A;  3AZF A;  4YM6 A;  1TDG A;  1ID3 D;  3VP0 A;  3LZ0 C;  1LL9 A;  3MGQ C;  3BFE A;  4NE5 A;  3X1T D;  2PU4 A;  4Z66 C;  4WNN A;  3AZI C;  1KGE A;  1RGY A;  3MGR B;  4CJN A;  2WK0 A;  5CPK A;  5AV8 A;  4JJN B;  3LJA A;  1O7E A;  1HD8 A;  5E2H A;  2CWE A;  3AZL A;  1PI4 A;  4H9S A;  1KX4 A;  4DRB A;  3B6G C;  4H9R A;  3PAE A;  4OJO A;  4YS3 C;  4X23 B;  1BSG A;  3MKF A;  4PPR A;  4J8X B;  3WKJ A;  3REH D;  4K91 A;  4P6B A;  1U60 A;  3L25 A;  4U3T A;  1QMF A;  1GA0 A;  5JRG D;  2EX8 A;  4UUZ A;  4F94 A;  1N4O A;  1XGI A;  4BJP A;  1T3U A;  3TG9 A;  2IOU A;  3MGP B;  2ZM0 A;  5FUG A;  3X1V B;  5FQJ A;  3TU4 B;  4H9O B;  3AZM B;  1M19 A;  1RP5 A;  5B33 C;  5B24 C;  1BUL A;  3AV2 D;  5B32 C;  2XGN A;  2OLV A;  2Y2N A;  3ZGA B;  4ZJ3 A;  4H9P A;  1G68 A;  5B0Y C;  1IYQ A;  2IO5 B;  5FAQ A;  5G18 A;  3NQU B;  4WZS B;  4LD9 D;  1YU1 A;  5CEC A;  3AYW B;  4GH9 A;  1YLY A;  1EQZ D;  3A1I A;  5AVB C;  5AV9 C;  1YM1 A;  4ZUX C;  4S2I A;  5B40 C;  1FCM A;  4S2P A;  1P3M C;  4S2N C;  4R8P A;  3V3R A;  3LEZ A;  4KZ8 A;  2HUE B;  1ES3 A;  3IHA A;  4Z2M H;  4PM8 A;  4EBL A;  2ZY5 A;  5FSR A;  2R9X A;  3MGS D;  2ARO C;  5F99 D;  2XDM A;  2W8S A;  4L0L A;  1KX3 A;  4GOG A;  3KWQ C;  5GT3 D;  4KHA A;  3ITA A;  1YU3 A;  1AXB A;  1E3U D;  4KZB A;  4EWF A;  1HQ3 D;  5B2I D;  2ZD8 A;  3VH6 A;  4JF4 A;  4XZQ C;  1P3B D;  1DJC A;  1K56 D;  1P3P A;  5B0Z B;  3MNN C;  4FSF A;  5DNM C;  2IWB A;  5BO0 A;  3PBT A;  3MKE A;  2I72 A;  2FJ7 A;  3S1Y A;  2CV5 A;  4XUJ A;  2XR0 A;  4QY6 A;  2Q9N A;  3IHB A;  4J8V A;  3N8R A;  5CEB A;  3AZH A;  4HGA B;  3WAA D;  5DTK A;  1K4E A;  1L0E A;  3HUO A;  3AZF B;  2F8N K;  1P3K D;  3WA9 C;  3KS4 A;  1P3O D;  3C4P A;  5G49 A;  1JTD A;  1W8Y A;  4J8U D;  3AFA A;  2FFY A;  3LZ1 C;  3VP2 A;  4WNN B;  3CG5 A;  5CTN A;  4FH4 A;  3V9R A;  5AV8 B;  3LJA B;  1LL5 A;  1M40 A;  1SDN A;  3AZL B;  1FCN A;  4BL2 A;  4NZ4 A;  1KX4 B;  1KX5 B;  3UTB A;  4BEN A;  2RL3 A;  1ES5 A;  1K54 C;  3OZH A;  3VP4 A;  3WKJ B;  5AV6 C;  5EVL A;  3VP3 A;  4Y7P A;  2XK1 A;  3UPN A;  5B2J A;  2EXB A;  4UUZ B;  1IYS A;  1PWD A;  2WGI A;  3LEL B;  2WGW A;  1F66 C;  3WS1 A;  3VH5 W;  3W97 C;  1P3G D;  1P3A C;  1M19 B;  3Q82 A;  3UE0 A;  3RJU A;  3FV7 A;  3SH8 A;  5BNX A;  3W4Q A;  4EQI A;  3AZE A;  3IF5 A;  3REJ D;  4H9P B;  1KDS A;  1YLJ A;  1HTA A;  2EFU A;  3C1C C;  3MVD C;  3REL A;  4NFT A;  1IKG A;  5EOE A;  5FAO A;  2RIQ A;  4JF6 A;  4YM6 C;  2HIO B;  3N4I A;  5AY8 B;  2WKE A;  5CPJ A;  2J8P A;  5GHX A;  4H9Q A;  5AVC A;  1XXM A;  4Z5T D;  4R8P B;  3REJ B;  3DWZ A;  3UTA B;  5TFQ A;  5EPH A;  4NYU A;  4CAY A;  4K0X A;  2WKI A;  5CPK C;  5AV5 C;  1HVB A;  5KDM A;  3H0L C;  4NY2 A;  1KE0 A;  4KZA A;  3PBO A;  4KUD D;  4YFM A;  4QLC C;  1XGJ A;  3A3F A;  3NQJ B;  1PW8 A;  2YFV A;  1KVL A;  1H8Z A;  5HAI A;  5FI6 A;  2ZM5 A;  2V20 A;  1AOI A;  3M6H A;  1JVJ A;  4KHA B;  3P5J B;  5GXQ A;  4S2J A;  3UE1 A;  3HBR A;  4PM5 A;  3ZDJ A;  2Y2O A;  2EX6 A;  1I2W A;  3UO9 A;  1K38 A;  5C3I C;  2Y2G A;  3G31 A;  3MFD A;  5GT0 D;  1P3P B;  4GB7 A;  3B6F A;  5BO0 B;  5B32 G;  1ZKJ A;  2DCF A;  3AV1 A;  2CV5 B;  4XUJ B;  5DVA A;  1KGG A;  3KXB D;  2ZY3 A;  1H3O B;  4M3K A;  1ERO A;  3WTP C;  4OJ6 A;  4J8V B;  4KGC D;  1ZG6 A;  3A3E A;  4XXR A;  5E2F A;  2BYM A;  2H0Y A;  3NC8 A;  3AZJ D;  3W99 D;  5DNN D;  2PYO C;  2E8I A;  3D4F A;  4E3O A;  5FQ9 A;  2JE5 A;  3REI C;  1P3I D;  4M6B A;  3L26 A;  3HL9 A;  3E2L A;  3O62 C;  4OVD A;  1ES2 A;  3OPH A;  3AN2 A;  2DQN C;  3AZN A;  1N9B A;  2P9V B;  5E5A B;  3BLS A;  3UTB B;  2HPB A;  4CPK A;  2XFT A;  1M1A D;  4R3B A;  4WU9 C;  2JCH A;  3FYZ A;  2A49 A;  1KX3 C;  3DW0 A;  5B2J B;  4OKP A;  5B1M A;  5BOH A;  4RX2 A;  3BFD A;  3X1U D;  1LHY A;  4E3K A;  1ID3 A;  4WEL A;  3PAG A;  3OPR A;  4EO5 C;  2CC1 A;  3OPL A;  2NQB D;  2FJ7 C;  2ZM2 A;  3X1T A;  5BNX B;  4DQY B;  4S2M A;  3W96 B;  3VFH A;  3E2K A;  3AZH C;  5HAQ A;  3REL B;  4WZ5 A;  3W98 D;  3X1V A;  2Y2I A;  2X01 A;  2ZC4 B;  3M6B A;  3AZG C;  1ZLA D;  5CXW A;  4QHC A;  1NZO A;  5CPJ B;  3AZK D;  1K55 A;  3REH A;  4OUI A;  1KVM A;  4DXC A;  4IBR A;  3AFA C;  3B0B A;  5JRG A;  1B67 A;  3KUY B;  2BG1 A;  4IJF A;  1P34 D;  3IXD A;  3HRE A;  3A6N C;  3NQU A;  3W98 B;  5KDM B;  3LZ0 D;  3MGQ D;  4E3J A;  2ZC7 A;  3VP1 A;  2WGV A;  4Z66 D;  3AZI D;  2YFV B;  5J8X A;  4BLM A;  3CZD A;  2J9P A;  3G2Z A;  2BLS A;  4IBF A;  2Y2P A;  5GXQ B;  3SH7 A;  3B6G D;  4LEN A;  3NI9 A;  4YS3 D;  2Z2M B;  5F83 A;  1ZC2 A;  4OOL A;  1EQZ A;  3B6F B;  1U35 C;  2Y59 A;  3L28 A;  2Y91 A;  2JC7 A;  1P3F C;  1WWI A;  4WU8 C;  3AZE C;  3BEB A;  3A3J A;  4OPQ A;  4BL3 A;  1DJA A;  4U0X A;  2BYM B;  4DE2 A;  2F8N G;  5BNV A;  5EE8 A;  5EVI C;  5F82 A;  3MGS A;  5B33 D;  4P87 A;  5B0Z A;  5B24 D;  4UAA A;  5FA7 A;  5B32 D;  5F99 A;  3C4O A;  3C7U A;  2J8Y A;  3EQV A;  5CP6 C;  3NY4 A;  5HX9 A;  5GT3 A;  5AVC C;  5B0Y D;  2NZD C;  2VGK A;  1M18 D;  1YQS A;  1E3U A;  1JTG A;  2XFS A;  1RGZ A;  1HQ3 A;  5B1L B;  3FWL A;  1H5X A;  4RYE A;  4DE3 A;  3AN2 B;  3REK C;  3HLB A;  2DF4 C;  4OQG A;  5AV9 D;  3EPL A;  1P3B A;  4GZB A;  1H8Y A;  5FI2 A;  4ZUX D;  5B40 D;  3C1B C;  2V2F F;  1SDE A;  1P3M D;  5CER A;  3UT9 D;  3PBN A;  3WX7 A;  2ZC5 B;  1AOI C;  4NK3 A;  1K57 C;  4Y0O A;  1M18 B;  3BLM A;  2V1Z A;  2WYX A;  4X6T A;  4X55 A;  4WJ3 C;  5B1M B;  1K6S A;  2ARO D;  1P3L D;  4R0Q A;  1KX5 A;  3IH9 A;  3BFG A;  5TGF A;  1Z2C B;  1KE3 A;  1ID3 B;  3KS8 A;  5B31 C;  3SS4 A;  1P3O A;  5GHY A;  3KWQ D;  4CSR B;  4IVI A;  3GMW A;  3IXG A;  4J8U A;  1CI9 A;  3AV1 C;  3UT9 B;  3X1T B;  1S32 D;  3SS3 A;  4J8W C;  5BS7 A;  4XZQ D;  2J7V A;  3UPO A;  5CPI C;  1GHI A;  3LEL A;  4KG5 A;  3MNN D;  5DNM D;  1P3L B;  3QNB A;  3S4X A;  4E45 A;  1W8Q A;  3N8L A;  3REH B;  5BPV A;  5JRG B;  1S32 B;  1SKF A;  1MWT A;  3RXW A;  4DE1 A;  2WAF A;  4XZQ B;  1DJB A;  5GSU C;  3WA9 D;  3AZN C;  2Y55 A;  1BUE A;  2HIO A;  5AY8 A;  1P3G A;  1NZU A;  3LZ1 D;  3AV2 B;  3HLG A;  1W2E A;  5AQ9 A;  4IBI A;  3REJ A;  3UTA A;  3MGR C;  4DKI A;  1BLS A;  4PM7 A;  4WMC D;  4JJN C;  1M6K A;  2ZC3 B;  2HDS A;  1PIO A;  1MWS A;  2XD1 A;  4LD9 B;  5AV6 D;  3ZVT A;  4X23 C;  4OLD A;  2ZQ8 A;  1EQZ B;  2XF3 A;  4J8X C;  3NQJ A;  1MWR A;  1NJ4 A;  3L2A A;  4Z5T A;  1PW1 A;  5JYP A;  1YU2 A;  1KGF A;  1F66 D;  1XP4 A;  3UNW A;  1YLT A;  3B0D B;  4KG2 A;  3MGP C;  5BNV B;  3W97 D;  4ZBE A;  3X1V C;  1P3A D;  2OSU A;  2XD5 A;  3MGS B;  1ESI A;  3Q7V B;  3TU4 C;  4KUD A;  4Y0U A;  5F99 B;  3AZM C;  1K55 C;  4X56 A;  5GT3 B;  3N6I A;  4KZ4 A;  1H3O A;  5DF7 A;  3C1C D;  3MVD D;  3MBZ A;  3V50 A;  1HQ3 B;  2F8N D;  2IO5 C;  5B2I B;  2DNS A;  4YM6 D;  1N1J B;  2B5R A;  3O86 A;  2WKH A;  4DRT A;  3LY4 A;  1JWV A;  5GT0 A;  1P3B B;  3AYW C;  1KE4 A;  1BH9 A;  3KXB A;  3Q81 A;  5CPK D;  3C1C B;  2H5S A;  5GLD A;  5AV5 D;  4KGC A;  4UHU A;  3WTP E;  4R4R A;  2HUE C;  4LV2 A;  5I94 A;  3WAA B;  4QLC D;  2P9V A;  5E5A A;  2BYK B;  2Y2J A;  3AZJ A;  3W99 A;  4ZAM A;  1P3K B;  4WEJ A;  4H9N A;  5GLC A;  1P3O B;  1PI5 A;  1L2S A;  3TSG A;  4J8U B;  1FOF A;  1P3I A;  3HLE A;  1KU5 A;  1BT5 A;  4N1X A;  1JWP A;  1TZY C;  3L27 A;  2H10 A;  4C6Y A;  1E25 A;  3EPJ A;  3ISG A;  5B0Z C;  4IBC A;  2Q9M A;  5FQI A;  3SH9 A;  3ZG8 B;  1G6A A;  1M1A A;  2WAD A;  4JLF A;  1YLP A;  3WTP D;  5CTM A;  3W96 A;  3WS2 A;  5E2E A;  3GV9 A;  2Y2M A;  4HGA C;  1FCO A;  3ZCZ A;  1KDW A;  3X1U A;  2PYO D;  4IJE A;  2YFW B;  3GTC A;  3AZF C;  3REI D;  1P3G B;  3IF6 A;  3IQA A;  4EBN A;  3FZC A;  4GD6 A;  4GD8 A;  3FKE A;  5E43 A;  3O62 D;  5U47 A;  2C5W B;  2C6W B;  4E3L A;  3KUY A;  5DTS A;  2RVQ C;  5AV8 C;  2Y4A A;  4G91 B;  3LJA C;  4D2O A;  4EUZ A;  3W98 A;  3AZL C;  5E2G A;  4H9S C;  1KX4 C;  4JXG A;  5B31 G;  1KX5 C;  4QD4 A;  3VH5 T;  4WU9 D;  3IXB A;  3B0C W;  1KX3 D;  1NYM A;  1S0W A;  3AZK A;  3WKJ C;  4JXW A;  3AGE A;  4JXV A;  4Z5T B;  1HTZ A;  2HDR A;  4OOY A;  3IH8 A;  5CHU A;  1Q2Q A;  3WS0 A;  3LEL C;  1GHM A;  3LZ0 A;  2IWC A;  4PM6 A;  4R1G A;  4ZBJ B;  2FJ7 D;  4KUD B;  3HVF A;  4KZ7 A;  4RA7 A;  1M19 C;  1GCE A;  4KEN B;  4FCF A;  1I5Q A;  3X1S D;  4XUX A;  3AZH D;  4N9K A;  3HLW A;  3H0R C;  3B6G A;  4MNR A;  1ULY A;  4YS3 A;  3AZG D;  4NZ1 A;  3A3I A;  3O88 A;  1S6R A;  5GT0 B;  2HIO C;  1CI8 A;  5AY8 C;  3AFA D;  5KMW A;  1PYY A;  1BH9 B;  5DTT A;  3X1S B;  3KXB B;  3MZF A;  4G92 C;  4R8P C;  3REJ C;  3UTA C;  2L5A A;  3A6N D;  4KGC B;  1Y54 A;  3KSY A;  5B1L A;  1NRF A;  2WZX A;  5CED A;  5HAP A;  3AZJ B;  3W99 B;  4LCL A;  5B24 A;  4UA7 A;  5DNN B;  4H9N B;  2EXA A;  3MXR A;  5GLB A;  1PZO A;  5M1A A;  3IWQ A;  4U0T A;  1P3I B;  5B0Y A;  3A3D A;  4UPK A;  1M18 A;  1TVF A;  1YUE A;  3O87 A;  2Y2K A;  1YU0 A;  1U35 D;  5AV9 A;  4ZUX A;  5AQB A;  5FAS A;  2HP6 A;  2XH9 A;  1P3P C;  1YLW A;  4IBJ A;  4OQH A;  1P3F D;  4CSR A;  1M1A B;  1PWC A;  1P3M A;  4S2N A;  4WM9 A;  4WU8 D;  3AZE D;  2CV5 C;  3UT9 A;  4XUJ C;  3G32 A;  4OJP A;  4GHL A;  2OV5 A;  2ZJ9 A;  5JYO A;  1F1E A;  4J8V C;  5CHM A;  5EVI D;  5DF9 A;  3NDE A;  3X1U B;  2ARO A;  1P3L A;  5CP6 D;  5CGS A;  3HLD A;  2LY8 A;  2GDN A;  4Z2M G;  3KWQ A;  5AVC D;  2NQB B;  2H0T A;  2NZD D;  3IF6 B;  4N1H A;  4N92 A;  3ZVW A;  1ERM A;  5JA4 A;  1S32 A;  2A3U A;  4S2O A;  5F1G A;  1BLC A;  2ZQC A;  3REK D;  3ZG9 B;  2HP5 A;  1ONH A;  3ZFZ A;  4XZQ A;  2ZLY A;  1VM1 A;  3MNN A;  5DNM A;  1WE4 A;  3C1B D;  5E5A C;  1WYB A;  1ZLA B;  4AWL B;  3UTB C;  4XUZ A;  1LI9 A;  3AZK B;  5EUA A;  2NZD B;  4GHA A;  1W7F A;  3AV2 A;  4DF6 A;  4IBD A;  4QB8 A;  3VOY A;  3R45 B;  5B2J C;  2FFF B;  2DRW A;  1P34 B;  3DWK A;  3MZE A;  4E3N A;  5B31 D;  4PMA A;  4LD9 A;  3N8S A;  3LZ0 B;  4WBG A;  3MGQ B;  4QU3 A;  5EOO A;  2WAE A;  3ZG7 B;  5CHJ A;  3AV1 D;  3QNC A;  4Z66 B;  3LZ1 A;  1ZG4 A;  3AZI B;  4MBK A;  4J8W D;  1FQG A;  5A92 A;  4GN2 A;  4HEF A;  5CPI D;  3W96 C;  4WMC A;  1L0G A;  3N7W A;  3B6G B;  3REL C;  4YS3 B;  4RX3 A;  4DE0 A;  5FDH A;  3IT9 A;  5AV6 A;  4NE6 A;  3ZNY A;  3UDI A;  2ZC6 B;  2G2W A;  3Q7V A;  3EPK A;  3EQU A;  1MPL A;  5CPJ C;  3BFC A;  4DXB A;  2XEP A;  4ID4 A;  3MZD A;  5GSU D;  3KUY C;  5CPI B;  3WRT A;  3AZN D;  2J9O A;  4BD0 A;  1F66 A;  5AQ7 A;  3L29 A;  3RXX A;  5B2I A;  1N1J A;  4LCM A;  3GRJ A;  3W97 A;  1P3A A;  1CEF A;  4NZ3 A;  4R4S A;  1EI5 A;  5AVB D;  3AGF A;  1K56 A;  5B33 B;  4B88 A;  5B24 B;  2ZY4 A;  5B32 B;  4IED A;  2VGJ A;  3OPP A;  1Q2P A;  3MGR D;  5B0Y B;  1K6R A;  4B4Z A;  3C1C A;  3MVD A;  4JJN D;  3OCN A;  5GLA A;  5GXQ C;  3S22 A;  3AGD A;  2F8N A;  4OQI A;  4X23 D;  3WAA A;  4LV0 A;  3BRM A;  1BFM A;  4Z9Q A;  2BYK A;  4IBK A;  4J8X D;  5AVB B;  5AV9 B;  1P3K A;  4JPM A;  3VH6 W;  4ZUX B;  5B40 B;  2G2U A;  3B6F C;  4MBF A;  1P3M B;  1PWG A;  3LO7 A;  4QNL A;  3WWX A;  3VSK A;  2ZMA A;  1XA1 A;  5AV5 A;  2F2A C;  3DTM A;  4E44 A;  3MGP D;  3X1V D;  3HON A;  3TU4 D;  2JSS A;  4OPY A;  4QLC A;  2ARO B;  3AZM D;  2Y2L A;  3NBL A;  5A93 A;  2ZQ7 A;  4ZJ1 A;  3KWQ B;  3GQZ A;  3UDF A;  5BT1 C;  3G30 A;  5JA4 B;  5CHL B;  4A5R A;  3HUM A;  1TAF A;  3V5M A;  5B1L C;  4EV4 A;  4UA9 A;  3B3X A;  3AYW D;  3SS5 A;  3AN2 C;  3MNN B;  5DNM B;  3A1K A;  3VH6 T;  2YFW A;  1O07 A;  4HBU A;  2UWX A;  1BTL A;  3Q1F A;  1BZA A;  3GR2 A;  4IBX A;  3WTP A;  5D3O A;  1FR1 A;  1XPB A;  1M18 C;  2OLU A;  5DF8 A;  1PZP A;  5B1M C;  3WA9 B;  2PYO A;  3P09 A;  1YU4 A;  3BFF A;  5HW3 A;  1ID3 C;  3REI A;  1MKI A;  2Z2L B;  5KSC A;  3LZ1 B;  3FKV A;  4E3I A;  1ESU A;  5FAP A;  3UT9 C;  3TOI A;  3X1T C;  2R9W A;  1TZY D;  2Y2Q A;  4R23 A;  3O62 A;  3BYD A;  4WYY A;  4OON A;  1BH8 A;  4DRA A;  4WZ5 C;  1IEL A;  5B0Z D;  1Z6F A;  1P3L C;  2QZ6 A;  4HBT A;  5AV6 B;  4H8R A;  4WU9 A;  3IWI A;  3G35 A;  4OOM A;  1CK3 A;  3REH C;  1GHP A;  3NIA A;  1TZY B;  4IBE A;  5JRG C;  1S32 C;  1F66 B;  1FR6 A;  4O7D A;  3AZF D;  3LY3 A;  3W97 B;  1P3A B;  3FKW A;  5M18 A;  4E6W A;  1MWU A;  3OC2 A;  3VOZ A;  3H0M C;  3CJM A;  4R3J A;  2IWD A;  4KQO A;  3HLC A;  3AV2 C;  1MY8 A;  3X1S A;  2XLN A;  4OH0 A;  3VSL A;  4NZ5 A;  2RVQ D;  5AV8 D;  3MVD B;  1LI0 A;  3I7J A;  3SOI A;  3LJA D;  3ZG5 A;  3AZL D;  1KX4 D;  2F8N B;  1KX5 D;  3AZG A;  4WV4 B;  4YM6 B;  1XA7 A;  4OJ5 A;  2XQZ A;  4X68 A;  4LD9 C;  3UE3 A;  3WKJ D;  3WS4 A;  4KZ5 A;  5DNN A;  1ONG A;  1EQZ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...