2Y2NA

Penicillin-binding protein 1b (pbp-1b) in complex with an alkyl boronate (e07)
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
488
structure length
468
Chain Sequence
ISEITYSDGTVIASIDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTGQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PENICILLIN-BINDING PROTEIN 1B
publication title Structure-Guided Design of Cell Wall Biosynthesis Inhibitors that Overcome Beta-Lactam Resistance in Staphylococcus Aureus (Mrsa).
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
total genus 160
structure length 468
sequence length 488
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2y2nA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2y2nA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2y2nA02
2WKHA 3HLWA 1QMEA 4JXGA 1E4DA 4JXVA 5TFQA 3NCKA 3HLFA 2EFUA 4ZJ1A 4EBLA 1PZOA 1JTGA 5CHMA 1GHMA 4Y0UA 4S2KA 3NIAA 3VP2A 1NYYA 2EX8A 4C3QA 2WADA 5CRFA 3ZFZA 3Q7ZA 5F82A 2JCHA 1S6RA 4E3OA 4OQHA 3V39A 1KE4A 2ZM0A 4KZ8A 2HDRA 3MZDA 4X56A 3G2ZA 5M19A 2XFSA 3PBTA 1ZC2A 1DJCA 2RL3A 5FI6A 4E3JA 2Y2KA 3DTMA 3V3RA 4UA6A 4MEZA 1PIOA 4DKIA 2Q9MA 3CZDA 3IQAA 3NI9A 5GHZA 3WWXA 3QNBA 3VOYA 2C6WB 3IXDA 3SS5A 3ISGA 2ZQAA 4IBXA 3C5AA 4BD1A 4HBTA 3SH8A 2X02A 1GA0A 1CEFA 1Y54A 5GHYA 3WS5A 4K0XA 1RP5A 1ZG4A 1ALQA 3MXSA 3OCNA 4XUXA 5DF8A 3HVFA 3FYZA 4MBHA 4KQRA 4BL2A 3BEBA 3GMWA 1L0EA 4P0MA 4S2JA 3SOIA 3G32A 4GD6A 3IHBA 4KZ6A 3GTCA 4S2OA 1XA7A 3IH9A 3P98A 4DE3A 1GCEA 1XP4A 5M1AA 4GD8A 4QU3A 4BJPA 3NY4A 4N92A 2G2UA 5HX9A 2ZC5B 3UNWA 1MBLA 3BM6A 1NZOA 4R23A 3BFFA 4U3TA 3HLDA 4PM8A 3W4OA 1ES2A 4WZ4A 3C4PA 4WZ5A 2EX6A 4Y7PA 5KMWA 1XXMA 2VGJA 3W4QA 3VP3A 4M3KA 5FATA 3QNCA 3V50A 5HARA 1DJBA 5AQ9A 5HW3A 3OPHA 4GKUA 1BLPA 1CI8A 4KZ9A 4RVAA 1BUEA 3E2KA 4JXWA 4UHUA 5A92A 4LV1A 4RYEA 4ZTKA 2Y2GA 3LO7A 4GOGA 1JWPA 4KZ7A 5FI7A 5HAQA 1ZG6A 1YLTA 1K25A 2Y2MA 1NJ4A 1LL5A 1MWTA 3OPLA 4OLDA 4R3JA 5D3OA 4E3KA 5EVIB 5JYPA 2XLNA 3Q07A 4LCLA 1DJAA 4Q8IA 4JLFA 4JXSA 1K55C 2H10A 4LV0A 4GDBA 5HAIA 4DXCA 4OH0A 4C75A 3G4PA 2PU4A 3PAEA 1EI5A 5DTSA 4WMCA 5CEDA 3S22A 1BLHA 3FZCA 1YMSA 4KZ5A 4R4RA 1MWSA 1NXYA 2ZC7A 1G6AA 1W8QA 2XF3A 5GL9A 3N8RA 5E2EA 4FSFA 2GDNA 3V5MA 2PU2A 5CGSA 2RCXA 3VP0A 4DE1A 4H8RA 1K4FA 3MXRA 1YLPA 4OOLA 2PBYA 4EWFA 4KENB 4JF6A 1J9MA 1M40A 4GB7A 4PMAA 4GDNA 3ZNYA 5GHXA 3A3FA 5EVID 1IELA 1JWZA 3D4FA 3S1YA 4A5RA 2X01A 1CK3A 1YMXA 4CJNA 4HBUA 4K0WA 3A3EA 3SS3A 2OSUA 1GA9A 1KVLA 3NDEA 3IWIA 4C6YA 3RJUA 3ZG8B 3ZGAB 3A3DA 3BRMA 5TGFA 4R0QA 4S2IA 1IYOA 5GLBA 4MNRA 5DF7A 5CECA 2Y2HA 3IXHA 1ES5A 2Y91A 3WS2A 5E2HA 4E3NA 1BLCA 5FQIA 4D2OA 5CTMA 3UE1A 3UDFA 3VFFA 3MZFA 3EQVA 4IEDA 4OPRA 4E3MA 5HFOA 1SCWA 1M6KA 2HDSA 3UY6A 2OLUA 2G2WA 1ES3A 1FSWA 2FFYA 4PM9A 3GR2A 3M2JA 3ZG9B 1AXBA 1HD8A 1C3BA 1NRFA 4KG2A 1XX2A 2WAFA 1Z6FA 3FKWA 1EWZA 3N8SA 4LV3A 1K55A 1FR1A 3FV7A 4N1HA 4S2PA 3IHAA 2J7VA 1LL9A 3C7UA 1E25A 2EX9A 1IYSA 3ZVTA 1OMEA 4DRTA 1L0FA 5AQBA 3IXBA 1KGFA 3N6IA 3OZHA 3Q82A 5AQAA 5EVIA 3HL9A 5EVLA 4GN2A 4OP8A 2EFXA 3EQUA 4DE2A 4JF4A 5A91A 5J8XA 3NDGA 3VP1A 3LEZA 2J9OA 1KDWA 1PWGA 3HUOA 5CGWA 5CERA 4DDYA 4KQQA 3ZG5A 5EUAA 2IWDA 4ZJ2A 4DXBA 4EV4A 1N9BA 2CC1A 3UDIA 3Q7VB 1PWDA 4E3LA 1ERMA 4MBKA 3VFHA 4EBNA 2Y4AA 4LENA 2IWCA 2WGVA 3ITBA 5EPHA 1W5DA 3GRJA 3IWOA 3Q1FA 2I72A 4PM7A 1FSYA 2B5RA 4OQ0A 5GLDA 1MWUA 4HESA 1FOFA 3RXXA 2V2FF 1O7EA 5G18A 2ZJ9A 1FR6A 4DDSA 4Y0TA 1LI0A 4DE0A 1E3UD 3GVBA 3OCLA 4EQIA 3NC8A 2A49A 5CHUA 4B88A 5KSCA 4R1GA 5FQQA 4S2NC 4FD8A 4WELA 1NYMA 3ITAA 4OVDA 4U0TA 3OPPA 3ZCZA 3G30A 3WRTA 5BOHA 1SHVA 1TVFA 4OLGA 1H8ZA 1SKFA 4IVKA 1CEGA 2JBFA 1K56D 2JC7A 3W8KA 3C4OA 2BLSA 3E2LA 1KE3A 3JYIA 1K54A 2WKIA 4F94A 5JYOA 4N1XA 3UE0A 2XGNA 1K6SA 3G2YA 1BSGA 2ZQ7A 1PWCA 3ZVWA 4OQIA 2A3UA 4QHCA 4E6WA 2QZ6A 2Y2NA 4E3IA 5KZHA 3FKVA 1L2SA 1I2SA 5FSRA 2E8IA 5CEBA 4WBGA 3BFDA 2UWXA 3A3JA 4LCMA 2BG1A 1U60A 2H0TA 1PI5A 2V1ZA 4O7DA 3SH9A 1K4EA 3MKEA 5EVIC 2R9WA 3UN7A 3WRZA 3IF6B 4DF6A 1PZPA 1YLJA 2WKEA 5FQ9A 1YT4A 2XQZA 2Y2QA 1NY0A 1H8YA 5IHVA 4ZDXA 2EX2A 5DVAA 2XD1A 2XK1A 4QY5A 2HP6A 1IYPA 5F83A 4KG5A 4ZBEA 3DW0A 4LV2A 3N4IA 4OQGA 1IEMA 2ZM2A 3M6BA 1BULA 3CMZA 5I94A 2JE5A 1YM1A 3SS4A 2WGWB 1E3UA 4PM5A 2Y59A 4ZAMA 3TOIA 3HLGA 5E2FA 5E2GA 1JWVA 2QMIA 3IF6C 5HL1A 1KDSA 3MZEA 3HUNA 3ZDJA 4BLMA 1ONHA 5TR7A 3UE3A 1IYQA 4OKPA 1MXOA 1K56A 4KZ3A 3UDXA 3ZG7B 1WE4A 2ZQCA 3BFCA 3FWLA 4XXRA 1KVMA 1IKGA 1LI9A 3Q7VA 2Y2IA 2ZC4B 3OC2A 3UPOA 1PW1A 2XDMA 3UPNA 1WYBA 3QHYA 4OONA 4S2NA 3OPRA 2WYXA 5A90A 3IF5A 4QJGA 2WAEA 3N7WA 1K54C 3HUMA 3MFDA 2ZLYA 2WGIA 2DRWA 1PI4A 5EOEA 2Z2MB 5FAQA 1PYYA 3BLMA 5FAPA 5FAOA 1ERQA 3AGFA 4KG6A 3VOZA 5HAPA 1BZAA 2ZC3B 2HDUA 1XKZA 2P9VB 4OOYA 3BLSA 3RXWA 1XPBA 2HPBA 4UA9A 1JVJA 4BENA 5EOOA 2FFFB 3O88A 1IKIA 1W79A 1MKIA 4QB8A 2H0YA 3PBSA 1WYCA 3NBLA 4JBFA 4XUZA 4IBRA 5FQKA 2Y2PA 3C7VA 3DWKA 3HLBA 4R4SA 1HVBA 2HDQA 4L0LA 4K91A 5KSHA 2XEPA 3PBOA 1GHIA 4NETA 1G68A 4KZ4A 4X55A 5M18A 1ESIA 3BFEA 4JKTA 3ZG0A 1ES4A 1XGJA 2J9PA 2WZZA 4IVIA 4WM9A 2OV5A 1HTZA 4UAAA 1DY6A 5EECA 2C5WB 4OP5A 4KZBA 4JPMA 4QY6A 2OLVA 3UO9A 5L2FA 2EXBA 3SH7A 3IF6A 3HLEA 2XH9A 4RX2A 4Z9QA 1BT5A 3CG5A 4U0XA 2R9XA 1K57C 3G34A 4PM6A 3GV9A 4X53A 3PAGA 3BFGA 4WMCD 2Z2LB 4GZBA 3IXGA 1XA1A 4EUZA 2J8YA 1YLZA 1SDEA 1K6RA 2IWBA 2WGWA 3PTEA 2Y2JA 3BECA 4FCFA 1LHYA 3O3VA 4WYYA 2VGKA 3LCEA 2HP5A 4PPRA 3B3XA 4WEKA 4E6XA 1YLWA 1YQSA 4JF5A 3WS4A 2WZXA 1FCNA 4MLLA 4OOMA 1FCMA 1XGIA 3PBQA 4N9KA 3VSKA 1L0DA 4ZJ3A 1FQGA 4N9LA 3ZNTA 2ZM8A 4EBPA 4Y0OA 1I2WA 2WK0A 4RA7A 5CXWA 2EXAA 4RX3A 4B4ZA 1Q2PA 1W8YA 4UA7A 1GHPA 3M2KA 1Q2QA 1KE0A 3HLCA 3PBNA 4B4XA 4S2MA 3S4XA 5FQMA 4P85A 4P87A 1K38A 3LY3A 2ZMAA 2ZQDA 4KQOA 3A3IA 3ZHHA 5U47A 1ONGA 1NZUA 2XFTA 1N4OA 3BYDA 4FH4A 5E43A 5DF9A 1RGYA 1RGZA 4X69A 1TDGA 1HZOA 2WUQA 1ESUA 1O07A 3TG9A 5GLCA 3HREA 3Q81A 2P9VA 5F1FA 1KGGA 2HP9A 2ZQ9A 3MBZA 4OPYA 5EE8A 1TDLA 2Q9NA 3VMAA 1TEMA 1QMFA 1VQQA 2P74A 3AGEA 3N8LA 1BLSA 4ID4A 3G31A 3IT9A 5CHJA 1JTDA 4KZAA 4NK3A 1YLYA 3IWQA 3M6HA 3PBRA 3I7JA 1MWRA 1MY8A 1LLBA 5F1GA 2ZQ8A 1MPLA 2Y55A 4GNUA 5FASA 1K57A 2XD5A 3O86A 5DTTA 2H5SA 3O87A 1I5QA 2DNSA 3LY4A 1H5XA 3WS0A 3GSGA 3WS1A 4P6BA 2Y2OA 4OPQA 3VP4A 2ZD8A 5GLAA 2Y2LA 1RCJA 3CJMA 1CI9A 1EROA 3AGDA 5DTKA 5A93A 4WEJA 1SDNA 5FQJA 5CGXA 4YFMA 4X6TA 3DWZA 1L0GA 4HEFA 5AQ7A 4BQMA 1PW8A 3G35A 3IH8A 4WZ5C 3UPPA 3P09A 4QD4A 1VM1A 3W4PA 4FH2A 3GQZA 1BTLA 1KGEA 4YINA 3V3SA 1W7FA 4X68A 5FDHA 3VSLA 4R3BA 4BD0A 2QPNA 2XR0A 4CPKA 1FCOA 4BL3A 4MBFA 4S2LA 2X71A 5FA7A 3TSGA 1S0WA 3MKFA 4OPZA 5FI2A 5CTNA 2ZC6B 2DCFA 3HBRA 2V20A 1ZKJA
chains in the Genus database with same CATH superfamily
2WKHA 2RIQA 4JXGA 1EAKA 4JXVA 4MCWA 3LI8A 5CHMA 5AVCB 3MGQA 1ODVA 2W0NA 3A0RA 4Y0UA 2EX8A 3IBRA 3AZLB 3UB6A 5CRFA 3ZFZA 5F82A 1S6RA 3MGPC 4Z2LA 2G5IC 4OQHA 3V39A 2ZM0A 2VQRA 4X56A 3PBTA 1KX5A 3REKC 1DJCA 4CLCD 3AV1D 1UR8A 2Y2KA 3MFXA 3DTMA 4I3AA 5HPFA 3UTAB 3KSHA 4DKIA 3CZDA 5AVCC 2VX8A 5F99A 2MJ6A 3IXDA 2ZQAA 3C5AA 4BD1A 3KYEA 3SH8A 5GHYA 4ETZA 2CV5A 5B1LB 1F66B 3EWKA 4KUKA 3BEBA 1L0EA 3SOIA 1CF0A 3UTAC 1F9IA 4G3VA 1Z09A 3LZ0A 5TBMA 5HSQA 2J3WA 3AZLD 5M1AA 4GD8A 3EOIA 2BYMA 4P6ZM 2ZC5B 3UNWA 1TAFB 1MBLA 4R23A 4EUVA 1HLUP 4NE6A 1ES2A 4NZ5A 3UTAD 3C4PA 4KUDC 3WD1A 5HARA 1P3PA 5B1LD 1F66D 5AQ9A 5HW3A 3OPHA 2J3TD 1CI8A 4P6ZS 3AZNB 1S32A 3LIFA 5HD3A 4IUKA 3BW6A 5IU1A 4GOGA 4KZ7A 1YLTA 3CPTB 4R3JA 2ZY5A 1MWTA 5D3OA 4E3KA 3AZHA 5EVIB 5JYPA 1DJAA 3UB8A 4LV0A 4X23A 1EQZB 1YAXA 2YFVA 4DXCA 4OH0A 3G4PA 3PAEA 5DNMB 3AZNC 1CXWA 1BLHA 3MMHA 5C3IB 3WD3A 4R4RA 4J8VB 3QP5A 4CSRA 1HQ3C 3FC7A 2G5HC 1W8QA 2V9AA 3H9WA 1DRMA 5E2EA 5CPIB 3V5MA 4M6BA 1EQZC 4DE1A 4IBGA 1ACFA 1LT0A 4H8RA 4LRXC 5JA4B 4QWOA 5DNNA 5B32C 3KUYB 5DNMC 2NQBB 4EWFA 4KENB 5C5KA 4J8VC 4GB7A 4GDNA 3LR3A 3MQLA 4Y2FA 5EVID 1IELA 1JWZA 2OWJA 3W98D 3S1YA 4A5RA 5CPIC 1CK3A 3SW1A 4R8PB 2NQBC 3NDEA 4C6YA 4B93A 4XZQB 1TS7A 3A3DA 3X1VD 5GLBA 2ZY2A 3KSFA 4H9SC 3AYWC 1VETB 5GXQB 3IXHA 1ES5A 1BLCA 4R38A 3UB7A 3VFFA 3KUYD 3MZFA 4OPRA 5AV6C 4OUIA 5B1MB 1SCWA 1M6KA 2V1AA 2FFYA 1YU4A 4Z5TC 4PM9A 3M2JA 3B0DB 2JKRM 5GXQC 3N8SA 4LV3A 1EWZA 1FR1A 5B40C 4R8PD 5AV8B 2W8SA 1E25A 2EX9A 5L8MA 2RVQC 1P3FD 5B1MC 4I5SA 5AQBA 4XZQD 3AN2A 4NXFA 1ZLAA 3AZGA 3WTPD 3OZHA 4ZRRA 2EFXA 3MGSB 5B2JB 4JF4A 4B9OA 4DE2A 4LRYC 4GJ4A 5CERA 1KDWA 1PWGA 3HUOA 4DDYA 2VEAA 3FKEA 5F6AA 1YPRA 1E6ZA 4LENA 3ITBA 3GRJA 5AVFA 5GT3B 5CP6A 4OQ0A 3MGSC 4HESA 5AV8D 3W96C 1FR6A 4IBBA 1LL8A 3LR5A 4Q0IA 4DE0A 5HD5A 1E3UD 4EQIA 5CPJB 5BNVA 5CHUA 5FQQA 3LR4A 4U0TA 3OPPA 4DRAA 3G30A 5B2JD 5BOHA 1H8ZA 2JKFA 2VJWA 3W8KA 1KE3A 3NULA 4F94A 4N1XA 3UE0A 3MNNB 3G2YA 1ID3A 4QHCA 5GT3D 4E6WA 3WX7A 3L25A 2CMNA 4E3IA 4MMNA 4BBVA 2BTFP 5IS1A 1T1AA 4CLCE 3SH9A 3VE3A 5CPJD 5F68A 3MNNC 2R9WA 3UN7A 4K08A 2WKEA 5FQ9A 1WWSA 1M19C 1CK7A 2XQZA 2Y2QA 5IHVA 1H8YA 3KXBC 3REIB 2EX2A 2XK1A 3MGRC 3P5JB 4KG5A 4I3IA 2ZM2A 3LIBA 1T18A 3HSHA 5I94A 3SS4A 5GT0C 3B6GD 2HUEC 1N9OA 4IBKA 4BLMA 4WZSB 3UE3A 1E15A 1MXOA 1K56A 3LJAC 4KZ3A 3UDXA 4XXRA 1KVMA 2Y2IA 1S4SA 2XDMA 1WYBA 3OPRA 4ME4A 1TZYD 3REID 4FTXA 3AZMC 2NZDB 3KWQB 1K54C 1P34A 3MFDA 3X1TC 3X1SB 5EOEA 3VH5W 5FAQA 3BLMA 5FAOA 1W63M 5MC7A 5L10A 2INWA 4NG2A 2JKTI 2IOUA 3SZTA 1XKZA 2ZY3A 5GSUC 3BLSA 2NZDC 4MN7A 4BENA 4AFIA 3R4KA 2O9BA 3L2AA 4IBRA 3H7WA 4R4SA 3HLBA 3F6TA 3W98A 3F1OB 3PBOA 4G3KA 1G68A 4KZ4A 5M18A 1ESIA 3KWQD 2WZZA 4YM6D 4WM9A 2OV5A 1HTZA 5CPKA 5AY8A 3X1SD 1H8PA 5EECA 4OP5A 5AV5C 3X1VA 1H0GA 4QY6A 3SH7A 3T1QB 3IF6A 4PAUA 4DMZA 4NE5A 3HLEA 2XH9A 4RX2A 5EVEA 2R9XA 3G34A 4PHTA 3B0CW 3KUYA 1P3MB 3PAGA 2Z2LB 3NECA 1M1AB 1XA1A 3A0VA 5L07A 1S67L 1K6RA 4NY2A 2WGWA 1P3LA 3S7OA 1ED7A 4LPZA 2VGKA 2HP5A 4WEKA 3B6FA 1GSWA 4JF5A 4MLLA 1P3MC 3L26A 1P3FA 4QPRA 3MGQB 2O9CA 1M1AC 4N9KA 1ULYA 2K7SA 1FQGA 2OOLA 3ZNTA 1STZA 3WTPA 3D9YA 5AJGA 3O62A 5CXWA 2PR6A 3AZJC 1P3MD 4Y13A 1PNEA 1Q2QA 1KE0A 1XFQA 5F99B 3S4XA 4Y5FA 3AZIB 3TRCA 1LSVA 2B02A 1M18A 5HDDA 2CV5B 1KX5C 1HZOA 2P9VA 4HGAC 1B6WA 3MGQD 3LZ0B 1TDLA 5TBMB 1QMFA 3N8LA 1P3AA 5CHJA 2BYMB 4KZAA 4BWIA 2CV5C 3IWQA 1JNUA 2W3HA 4I39A 2YKHA 2PYRA 3I7JA 4MDZA 2LY8A 1LLBA 2EWWA 5FASA 2XD5A 1XJ2A 5DTTA 5FEFA 3LY4A 5F99D 4KHAA 5HL6A 3LR0A 3AZID 3GSGA 2HF6A 4P6BA 2Y2OA 1GOIA 5GLAA 1AOIC 1P3PB 1CI9A 3H0MC 2ZOHA 1SDNA 5FQJA 5CGXA 3ZQ5A 4YFMA 1L0GA 5AQ7A 4BQMA 3G35A 3IH8A 3P09A 4QD4A 1S32B 3CAXA 3LZ0D 2I9VA 4E04A 1N1JA 3V3SA 1W7FA 5FDHA 4BD0A 3R45A 5FA7A 3AZHB 1S0WA 5FI2A 4ZUXD 1W2EA 3IP4C 1OGBA 3KS8A 3WKJD 4GN2A 4X23B 3HLWA 1QMEA 3MS6A 5TFQA 2YFVB 3HLFA 4J8WD 2EFUA 4EBLA 3W99D 1S32C 2V8CA 4HQAA 3REJC 4S2KA 3QP1A 4DQYB 5B0ZA 4CSRB 2JCHA 1P3PD 3KFUG 1KE4A 5DJUA 5BNXA 5E5AC 5BO0A 3B6GA 1ZC2A 2RL3A 5FI6A 4JJNC 1UGUA 4E3JA 3V3RA 1S4RA 5DNNB 1S32D 2Q9MA 3IQAA 4GHIA 3H0LC 3ISGA 1P0ZA 4HBTA 3C1CA 2R78A 3AZHD 1CEFA 4IUHA 5DF8A 1ALQA 4XUXA 1KS0A 5DFXA 4X23D 1TZYA 3CI6A 3HVFA 4R3AA 4UUZA 3WAAA 4S2JA 3CUEA 4XT2A 1UR9A 3RELD 4MB3A 4J8XD 2PYOD 4Z2HA 4BJPA 4N92A 4Z66C 3W2ZA 1NWZA 3HLDA 4U3TA 3W4OA 3REHD 5DNND 1OT6A 3MSHA 3X1UB 1KOUA 4Y7PA 2UV0E 5KMWA 3VP3A 4M3KA 5FATA 4NYYA 2VV6A 4GKUA 3EEAA 4H9RA 1BLPA 5IT5A 4KZ9A 5G49B 5A92A 4LV1A 2DF4C 2QJ5A 4ZTKA 4YM6A 4II7A 4GCZA 3X1SA 3LO7A 3HJKA 4FUWA 3AN2B 5FI7A 5HAQA 2Y2MA 1ZLAB 3AZGB 2HV1A 3OBFA 2JKTM 2XLNA 3S7QA 1CQAA 4LCLA 5B33C 4Q8IA 3LZ1C 3OOVA 3X1UD 2PU4A 5DTSA 5CEDA 3S22A 1YMSA 3QP8A 4KZ5A 1MWSA 4H6JA 3AN2C 1NXYA 1ZLAC 3AZGC 5FL3A 2XF3A 2P04A 4Z1WA 2W3DA 5GL9A 3MVDC 5JRGA 5CP6B 4WU9C 2GDNA 2PU2A 3D3OA 3ICYA 3VP0A 3FPVA 5BS7A 3MXRA 1YLPA 4MN5A 4OOLA 4HP9A 4EQ1A 1P3OD 1M40A 4RQ9A 3ZNYA 5BNVB 5GHXA 3A3FA 2KDKA 4IBIA 1YMXA 2VKSA 3A3EA 1BYWA 3NQJA 1KX4A 3FG8A 3RJUA 3BQAA 3DTEA 4R0QA 4MNRA 5DF7A 1ID3B 5CP6D 2Y91A 3WS2A 3AV1C 4AWLB 5E2HA 4CLCC 5FQIA 4E3NA 3TU4A 3UE1A 3UDFA 3PR6A 1AIWA 3UY6A 1ES3A 1FSWA 1TS6A 1C3BA 4J8UA 2O99A 5BT1D 1E6NA 1Z6FA 1K55A 1X0OA 4S2PA 3C1BA 3IHAA 3C7UA 1OTAA 1IYSA 3AZIA 3AZLC 2W3EA 3GECA 3WD4A 3CHWP 1ID3D 5AQAA 4G92B 3HL9A 5EVLA 5J8XA 3UMEA 3BY9A 5A91A 1P97A 3VP1A 5CGWA 3KSYA 5FDSA 2Z6CA 1ZHHB 2W1RA 2CC1A 4PKYG 3UDIA 2F8NH 4TX8A 1PWDA 1YU0A 4GS9A 4IJGA 5B1LC 1F66C 4Z2KA 2HJEA 4ZUXA 1W5DA 3Q1FA 3WKJA 2J3TC 3QP4A 3K3CA 2B5RA 3EG5B 4IBJA 3VH6T 4J8WA 1FOFA 2V2FF 3W99A 1O7EA 5G18A 2ZJ9A 1P34B 1LI0A 1WA9A 2V0UA 4HIAA 5J3WA 2A49A 3UT9A 4YS3A 4FD8A 3HONA 3TE8A 4OVDA 1BFMA 5DKLA 4NZ4A 2Y79A 3WRTA 4OLGA 2P7JA 1SKFA 4JGPA 2JBFA 1K56D 2JC7A 3JYIA 3LUQA 3H7WB 1OT9A 4ZBJB 3W98B 1MKMA 3ZVWA 4XUJA 1TS0A 3AFAA 5KZHA 3RELA 1P34D 5CPKB 5AY8B 4J8XA 2PYOA 4LCMA 2BG1A 1U60A 3AZKD 3DAVA 2B18A 3X1VB 1PI5A 3MKEA 5EVIC 3W98C 3WRZA 3IF6B 1ZTUA 3REHA 2O9AA 2XD1A 5F83A 4ZBEA 3N4IA 5C3IC 1IEMA 3NQUA 2HIOA 1YM1A 3KSIA 2WGWB 4M4XA 3X1VC 1P3LB 4ZAMA 3HLGA 5E2FA 5E2GA 2W1TA 2QMIA 3IF6C 5HL1A 3MZEA 5F5YA 3B6FB 3HUNA 3IS2A 3ZDJA 1Q9CA 4DJ2A 1BH8A 1ONHA 5TR7A 3KUYC 1IYQA 1P3FB 3IX4A 1G6OA 4OKPA 2PD8A 5CPKD 5AY8D 3CITA 3ZG7B 2ZQCA 3FWLA 5AVBA 1LI9A 1Y4OA 3Q7VA 3LEQA 3WTPB 4WLAA 3QHYA 4S2NA 3O62B 3F1PA 3LELA 3B6FC 3IX3A 5A90A 2V8FA 4R8PC 4QJGA 2WAEA 3X1UA 1P3FC 1V9YA 3AV2A 2WGIA 4XZQC 1M18B 2Z2MB 1P3LD 1PYYA 3WTPC 1E6RA 4KG6A 4WN5A 3B6FD 3T4QA 5G49A 2HDUA 2P9VB 4H9PB 3RXWA 1XPBA 4UEYA 2FFFB 3O88A 1P3KD 1U35B 1P3AB 3NBLA 1P3OA 4EXOA 4XUZA 3B0DC 4HMCA 4CAYA 1HVBA 2HDQA 3O62D 4L0LA 4K91A 1DP6A 1TD5A 2ACGA 5KSHA 4NETA 5AV8C 4X55A 4Z2MH 4JKTA 5G4YA 5I5LA 4KHAB 1XGJA 3B33A 5B0YB 1M18D 4JPMA 3UO9A 4IBDA 3EPJA 3K2NA 5B31A 5B2JC 3HJIA 2Z6DA 2XSSA 1BT5A 4PM6A 5J7EA 4GZBA 3E4PA 1N1JB 4EUZA 1U35D 1P3AD 2AROA 1SDEA 3R45B 2IWBA 4IBCA 3WA9A 1WWIA 3F1NA 4FCFA 1LHYA 3O3VA 5GT3C 5HWVA 2FJ7A 3B3XA 1E88A 1OTIA 1YLWA 1YQSA 4QLCA 1FCNA 1FCMA 1XGIA 4OJ6A 1XJ4A 3PBQA 5B0YD 2Y8HA 1S1ZA 5B0ZB 5CPJC 4ZJ3A 5BNXB 5BO0B 4Y0OA 3B6GB 3HCYA 2A2LA 4RX3A 2GX5A 4GHIB 2VV7A 4UA7A 4H9QA 2D49A 3NHQA 3T4TA 4P85A 4GH9A 5J4EA 2ZMAA 3C1CB 3C8CA 3A3IA 4FOFA 3ZHHA 5U47A 3LI9A 1ONGA 1NZUA 1N4OA 4EW7A 5DF9A 1RGYA 3B6GC 4X69A 1TDGA 1TZYB 2OAP1 1W1TA 2WUQA 4UUZB 3WAAB 3REKA 5GLCA 3HREA 3Q81A 4XT2B 2HP9A 2ZQ9A 3MBZA 4HHDA 5EE8A 3KYQA 1XJ3A 3VMAA 1P9WA 2BASA 3AGEA 1G28A 5B0ZD 1BLSA 4ID4A 3IT9A 4GHLA 4OJLA 1JTDA 4NK3A 3T4LA 4EESA 3FDDA 3M6HA 1TZYC 4IJFA 1MWRA 3REIC 2HJ9C 1P3GD 3CUEC 3O86A 2H5SA 1OTEA 2PHYA 1H0MA 2PD7A 3VP4A 3C1CD 2ZD8A 1RCJA 1EROA 3AGDA 4BBUA 5DTKA 3LICA 4H9RB 3WAAD 3V9RA 3DWZA 2KX6A 4F3LA 1DP8A 3UPPA 3W4PA 4YM6B 3V67A 4KUDA 3VOLA 1KGEA 4YINA 3AZKA 4CPKA 2Q0OA 1A0KA 3TSGA 3MKFA 5FUGA 4GHAA 2V20A 1ZKJA 3PHYA 4Y17A 1E4DA 1A7WA 3KWQC 4ZJ1A 5AV9A 1PZOA 4YM6C 3E98A 3X1SC 1GHMA 2ZBBA 4H6JB 2IO5B 3W97D 3NIAA 4C3QA 2WADA 3Q7ZA 4KZ8A 2HDRA 3AZFD 5M19A 3G2ZA 2XFSA 5JRGB 3RH8B 1PDCA 2HZ5A 4MEZA 3U4LP 3NI9A 4H9OA 2ZM5A 4I3JA 3QNBA 3VOYA 2C6WB 3SS5A 2IO5C 4IBXA 2VGLM 2FZ0A 2X02A 1Y54A 4ARZA 4WU8D 4K0XA 1HQ3A 1D1JA 3FYZA 3C38A 4BL2A 3GMWA 3L9KA 1UWNX 3G32A 3NQJB 4GD6A 3IHBA 4KZ6A 4X1LA 3VH5T 1KX4B 3GTCA 3DBAA 5B32A 1HTAA 1XA7A 3IH9A 3BWLA 1XP4A 3NY4A 5HX9A 3BM6A 5JRGD 3QP2A 4Z2IA 3TU4B 2VGLS 4HMEA 4G91B 4WZ5A 1T3UA 3KX0X 2EX6A 4UQIM 1P3KA 2LB9A 3V50A 1F98A 4J8UB 3MJQA 4H9SA 3AYWA 3C1BB 4RVAA 1BUEA 4UHUA 2KOIA 4RYEA 3MGQC 1KX4D 4OJOA 1JWPA 3T1SA 1K25A 3OPLA 4OLDA 4Z5TA 2V1BA 4UQIS 3Q07A 4NYUA 1XFNA 5B31G 3TU4D 1K55C 4JLFA 1L3LA 4H9PA 3O5YA 4GDBA 5HAIA 2OAQ1 5B40A 3WTPE 5F99C 3AZIC 3C2WA 1U35A 4GS9B 2OWHA 1G6AA 4ZUXB 4J8UD 3EPHA 3WKJB 3NOPC 5B2ID 3N8RA 1H8MA 3C1BD 2RCXA 4J8WB 3W99B 2VLGA 3LZ0C 2PBYA 5B0YA 1JFIA 2JSSA 4JF6A 3LIAA 3UT9B 3KSGA 4ZUXC 4YS3B 3D4FA 3WKJC 4CJNA 4J8WC 4HBUA 3W99C 3SS3A 2PYPA 4HY8A 4PKYA 4YWZA 2EA9A 1KVLA 3TW8A 3W96A 1NLYA 3EPKA 3ZG8B 1P3PC 3BRMA 2GJ3A 5TGFA 1IYOA 2VZWA 2Y2HA 4XUJB 2JKGA 4IBFA 1DP9A 1PRQA 3AFAB 4D2OA 5CTMA 3RELB 4OJPA 3EQVA 4IEDA 1YKDA 3AL0C 4J8XB 3UTBD 2PYOB 2OLUA 3MF0A 2G2WA 1GSXA 3E4QA 5B24D 3AZHC 3UT9D 1GXDA 4YS3D 4MN6A 3GR2A 1OJGA 1NRFA 4X23C 3FKWA 2B95A 3UB9A 3REHB 3FV7A 4N1HA 1P3GA 3RELC 1LL9A 3NOUC 3H0RC 3ZVTA 4J8XC 3NQUB 2PYOC 5CX7A 2HIOB 3IXBA 4R6LA 1KGFA 3N6IA 3JVUA 2W1TB 1TF1A 3Q82A 4XUJD 3IS2B 3AFAD 4OP8A 1BH8B 3REHC 5DNNC 2GNXA 1M19A 3KO6A 2J9OA 3KXBA 3MGRA 3ZG5A 3L28A 1N9BA 4QNLA 1XJ6A 5AVBB 3NOTC 2HIOC 3Q7VB 1BH9A 4E3LA 4MBKA 4EBNA 2W3FA 1W63Q 5GT0A 3WD2A 1H3QA 4LRZE 3F1PB 3LELB 1FSYA 4HJ3A 1PFLA 5GLDA 1MWUA 3RXXA 4DDSA 3AV2B 4Y0TA 2HIOD 3W97A 1SKOA 3GVBA 4L9EA 4GW9A 3NC8A 4B88A 5KSCA 3AZFA 3JPUA 4S2NC 1NYMA 3ZCZA 4WNNA 2D01A 2M7VA 4E44A 3X1UC 4IVKA 2NUTC 4I38A 3AZMA 1L6JA 3E2LA 5AVBD 1K54A 1P3OB 2FN2A 5JYOA 5G4ZA 2PAVP 3X1TA 2XGNA 2XROA 1BSGA 4NKPA 4WU8A 4CAYB 5HWTA 4G3WA 2ZQ7A 4NZ3A 3LELD 4OQIA 3LGOA 4Y15A 3FKVA 3EPLA 5GSUA 1L2SA 1I2SA 5FSRA 2F2AC 3AV2D 2E8IA 3CLOA 5CEBA 2UWXA 5B32G 1OTDA 3A3JA 1H3OA 1P3OC 2H0TA 2V1ZA 3U2AA 1P3BB 4DF6A 5B31B 1YLJA 1T1CA 1YT4A 4QY5A 3T4JA 2HP6A 1IFQA 2L0WA 4CQHA 5TJJA 4LV2A 4OQGA 4Q0JA 3M6BA 1BULA 1YSPA 2AROB 3CMZA 4MB5A 4D60A 2JE5A 3WA9B 2Y59A 3F1NB 4H9NA 5AV5A 4KGCD 2NUPC 1VHMA 5CP6C 3RFBA 2FJ7B 5CHLB 4QLCB 2W3GA 3E0YA 3FPWA 3A6ND 2JHEA 1WE4A 2L1MA 3BFCA 1IKGA 1KU5A 3A1IA 3IX8A 3UPOA 2ZC4B 3BJNA 3OC2A 4IHQA 1P3BD 3UPNA 5B31D 4OONA 5BT1C 4BBTA 1P3IB 2WYXA 2FJ7C 1D06A 3IF5A 3JVVA 4IJEA 5L09A 1OTBA 1PZRA 2ZL1A 4H9QB 2WKPA 4LGWA 1E6PA 2LB5A 2AROD 1SZVA 3WA9D 2VV8A 4BMWA 2CWEA 1ID3C 5FAPA 3AGFA 3MGPB 3DTIA 3VOZA 5B2IA 4AWLC 2FJ7D 3KS4A 3REKB 4QLCD 3M7PA 4NZ1A 4UA9A 1JVJA 3L29A 2PR5A 3AZJA 1N9LA 1IKIA 1W79A 3VH6W 4LD9D 2DQNC 5FQKA 2Y2PA 2QWSA 3C7VA 3DWKA 3RTYA 1P3ID 2YFWA 1GHIA 3BFEA 1ES4A 2QKPA 1DY6A 3AZEA 4KZBA 2OLVA 4G92C 3MGPD 4EEUA 3V9RB 3REKD 3UB5P 2M7UA 4F3LB 4Z9QA 3CG5A 4R70A 4U0XA 3T50A 1NRJA 4KQDA 3GV9A 5AVEA 4HJ4A 2ZMFA 5HPIA 4WMCD 4KUDB 3IXGA 3UTBA 5AVCD 3AZKB 5LBRA 5B24A 1TS8A 1AOIA 3BECA 5FUGB 1UWPX 4UPKA 1YU3A 3LCEA 3LIDA 4PPRA 5KDMA 4E6XA 1OGGA 3S7NA 3WS4A 5AV9B 1P34C 4OOMA 5FEGA 2W27A 3VSKA 3AZKC 3D72A 3T1RA 1L0DA 3LFVA 4N9LA 2ZM8A 4DJ3A 5HZHA 1I2WA 1V9ZA 4B4ZA 5AV9C 1Q2PA 4H9OB 4KUDD 5F69A 3M2KA 3HLCA 3PBNA 4S2MA 1K38A 3REJA 2ZQDA 3TJZC 4ZBJC 4ARZB 2XFTA 5E43A 3BYDA 1HQ3B 3LIEA 2KLIA 5E5AA 1ESUA 3TG9A 4JJNA 5AV9D 1KGGA 4OPYA 4HP4A 5CPKC 5AY8C 5B32B 3N3FA 1VQQA 3H82A 3G31A 2AVXA 1FILA 3PBRA 2ZY4A 5F1GA 2Y55A 1KX3A 4GNUA 1K57A 4JGRA 3MQOA 5DKKA 1I5QA 3AZND 1H5XA 1P3KB 3WS1A 1P3LC 2Y2LA 4X25A 4O0PA 3CJMA 1HQ3D 4Z66A 4WEJA 3AYWB 3C30A 4X6TA 3EEHA 4HEFA 1EQZD 1PW8A 3K3DA 3T4OA 4WZ5C 4Z2GA 3VH6A 5B32D 2G7UA 4FH2A 5DNMD 3GQZA 5AV6B 1P3KC 4L9FA 4EEPA 3VSLA 1GSVA 4J8VD 4R3BA 2QPNA 3ZYTA 4DN0A 3DTKA 1FCOA 4BL3A 4LFUA 1D7EA 4Z5TB 2V5OA 4OPZA 3O62C 2ZC6B 5KIZA 4JXSA 3MXQA 5CPID 3NCKA 2JN7A 5DFYA 5B40B 3BQ8A 1JTGA 3B47A 4O01A 2NQBD 1M18C 1MC0A 5EM1A 2F8NG 1NYYA 3VP2A 3B0BA 3ULFA 1OPXA 1S1YA 1J7MA 4E3OA 4KGCA 3MZDA 3AYWD 3A0SA 5B33A 2RTSA 3LZ1A 4UA6A 1PIOA 3A6NA 5GHZA 5AV6D 3WWXA 2VA0A 1JFIB 1U35C 1P3AC 4NEED 4Z5TD 1P3BA 1GA0A 3WS5A 4DRBA 1RP5A 1ZG4A 3MXSA 3OCNA 5GXQD 4MBHA 4KQRA 3MVDA 4WU9A 4P0MA 5HDSA 5B40D 1O6IA 1Y28A 2RVQD 4S2OA 3W96B 3T4SA 5B1MD 5B0YC 3P98A 3UMDA 4DE3A 1GCEA 2XA7M 4QU3A 2G2UA 2PBDP 3R7WA 1NZOA 3BFFA 4PM8A 4WZ4A 5HWWA 2A24A 4HNBA 1XXMA 4LD9A 2VGJA 3W4QA 2L4RA 3QNCA 3LYXA 1DJBA 1P3IA 2M1CA 1CJFA 2XA7S 4WF0A 1P3GB 4CLCA 3E2KA 3MGSD 3AV1A 4JXWA 2ZOIA 4NXEA 2DMWA 3W96D 2Y2GA 5B0ZC 1VEUA 1ZG6A 1NJ4A 1LL5A 3MGPA 1MZUA 4ESPA 2H10A 1P3GC 1M19B 3KXBB 4C75A 1EI5A 3MGRB 4WMCA 3FZCA 5AVCA 1W1VA 3CWFA 3C1CC 1BH9B 3AZLA 2ZC7A 5GT0B 1GPFA 1F5MA 3WD0A 3WAAC 1K0KA 4FSFA 4LLOB 5CGSA 2HUEB 4E45A 1K4FA 5EFWA 3T12B 3UTAA 2GZAA 3W97B 3LJAB 1SKOB 2FH5A 1J9MA 3T1XA 4PMAA 3MNND 3AZFB 5B1LA 1F66A 2X01A 4WNNB 4MB4A 1M19D 3KXBD 4K0WA 3EGXC 3AZMB 3MGRD 2OSUA 4O8GA 1GA9A 3W97C 3EGDC 3IWIA 2PDRA 3B42A 3X1TB 3ZGAB 5GT0D 2IA2A 4WU8B 2YKFA 4S2IA 5CECA 3AZFC 1TAFA 2PRFA 5GSUB 3PYPA 4Z2MG 1VB6A 4E3MA 5HFOA 1QO6A 2HDSA 3LJAD 1H3OB 1R4VA 2J80A 4WU8C 4Z2JA 3ZG9B 1AXBA 1HD8A 4KG2A 1XX2A 2WAFA 1LSXA 2J7VA 3AZMD 3AZNA 1OMEA 4DRTA 2F8NB 3MQ0A 2VK3A 1L0FA 3X1TD 3CPTA 4H9NB 5AV5B 1B67A 2L5AA 5JRGC 5EVIA 1YUEA 5BS7C 3EQUA 1EQZA 1W1PA 3NDGA 5GSUD 2V0WA 3LEZA 2NZDD 1AWIA 4NXBA 5DJTA 4KQQA 5DNMA 5EUAA 2IWDA 4ZJ2A 3VE4A 4DXBA 4EV4A 1G5UA 4J8VA 1EW0A 4X1MA 4EETB 1ERMA 3VFHA 2Y4AA 2IWCA 2WGVA 5EPHA 3IWOA 2I72A 4PM7A 2ZMVA 5CPIA 4EERA 5JA4A 1KX4C 2ZL1B 4LG2A 2BYKB 2F8ND 1OJ5A 2NQBA 3L27A 3OCLA 5AV5D 4R1GA 4WELA 5B2IB 3ITAA 3TU4C 4JGQA 4G91C 1SHVA 1TVFA 4HH2A 3AZJB 4R8PA 1CEGA 5AV6A 3C4OA 2BLSA 4EU0A 2WKIA 4NFTA 4XZQA 1YU2A 1K6SA 4J8UC 4L9GA 3B0CT 1PWCA 5B2IC 1VETA 2A3UA 5GXQA 2YFWB 3C1BC 1KX5B 2J8PA 2QZ6A 2Y2NA 3NJAA 4HGAB 1NLZA 4WBGA 5B1MA 3BFDA 3AZEB 1M1AD 4O7DA 1K4EA 1PZPA 4ZDXA 1NY0A 5DVAA 2E8JA 3AZJD 1IYPA 1S66L 5AV8A 3DW0A 3UTBB 3AZEC 4Q0HA 1E8BA 1T1BA 5B24B 4OJ5A 1E3UA 4PM5A 3TOIA 1AOIB 1JWVA 5EV0A 1KX5D 1KDSA 5KDMB 3MGSA 5B2JA 5BPVA 3UTBC 3VH5A 3AZED 5EM0A 4WJ3C 5B24C 3UT9C 4YS3C 1PW1A 2CV5D 4HJ6A 1H0IA 5GT3A 4ETXA 3N7WA 3HUMA 2ZLYA 2DRWA 2WKRA 1PI4A 3REJB 1AOID 5CPJA 4XUJC 1ERQA 3P01A 5HAPA 1BZAA 5E5AB 3AFAC 2H28A 1N9NA 2ZC3B 4JJNB 4IBEA 4OOYA 2HPBA 5EOOA 3G6OA 1MKIA 3H82B 4QB8A 2H0YA 3PBSA 1WYCA 4JBFA 3GDIA 2O0YA 5A8BA 3MNNA 2WKQA 2QYBA 2XRNA 3OLOA 2XEPA 1KX3B 4HOIA 4NE3A 3ZG0A 1Z2CB 2J9PA 4IVIA 4UAAA 3REJD 2C5WB 5L2FA 2EXBA 4Z66B 5E5AD 3S7PA 4JJND 1KX3C 2EWVA 3REIA 1K57C 4X53A 1P9RA 3BFGA 5AVBC 3LJAA 3UE6A 1YU1A 2J8YA 1YLZA 3KYZA 2D02A 2QJ7A 3IBJA 2Y2JA 3PTEA 3LELC 4WYYA 4HH3A 2HGVA 4Y3IA 1KX3D 1T19A 2WZXA 3AV2C 1FIKA 4NXGA 4WV4B 3A1KA 4KGCB 2K2NA 4Z66D 4EBPA 2WK0A 2JKRI 4RA7A 5K5BA 5B33B 4WL9A 3MQQA 2EXAA 3LZ1B 3MR0A 2NZDA 4JGOA 3A6NB 1W8YA 2F8NK 1GHPA 4B4XA 3KWQA 4YOFA 5FQMA 4P87A 3LY3A 3P7NA 1W1YA 4KQOA 4KGCC 1F2KA 4FH4A 1RGZA 4HMDA 3PXPA 4HI4A 1O07A 3MVDB 4WU9B 5F1FA 1LSWA 3A6NC 2F8NA 2Q9NA 1TEMA 2P74A 5HDCA 3VV4A 3E4OA 4YNRA 1P3BC 3QP6A 1J3WA 5B31C 1YLYA 3R7WB 4EO5B 3F1OA 1IOUA 5B33D 3BY8A 4GLQA 1MY8A 2ZQ8A 3LZ1D 1MPLA 2A24B 3O87A 2DNSA 2AROC 4LD9B 3WS0A 2P08A 3WA9C 4OPQA 3AN2D 1ZLAD 3AZGD 5A93A 4EO5C 1F1EA 4WU9D 3MVDD 4KUOA 4QLCC 4CLCB 3AV1B 4WUJA 1P3MA 1VM1A 3T4KA 2BYKA 1BTLA 2PT7A 4LD9C 1M1AA 4X68A 1VEUB 2XR0A 2K31A 4MBFA 2QHKA 2X71A 4S2LA 1YSQA 1P3IC 3L7HA 5CTNA 2DCFA 3HBRA
chains in the Genus database with same CATH topology
2WKHA 2RIQA 4JXGA 4JXVA 5CHMA 5AVCB 3MGQA 4Y0UA 2EX8A 3AZLB 5CRFA 3ZFZA 5F82A 1S6RA 3MGPC 4OQHA 2G5IC 3V39A 2ZM0A 2VQRA 4X56A 3PBTA 1KX5A 3REKC 1DJCA 3AV1D 2Y2KA 3DTMA 3UTAB 4DKIA 3CZDA 5AVCC 5F99A 3IXDA 2ZQAA 3C5AA 4BD1A 3SH8A 5GHYA 2CV5A 5B1LB 1F66B 3BEBA 1L0EA 3SOIA 3UTAC 3LZ0A 3AZLD 5M1AA 4GD8A 2BYMA 2ZC5B 3UNWA 1TAFB 1MBLA 4R23A 4NE6A 1ES2A 4NZ5A 3UTAD 3C4PA 4KUDC 5HARA 1P3PA 5B1LD 1F66D 5AQ9A 5HW3A 3OPHA 1CI8A 3AZNB 1S32A 4GOGA 4KZ7A 1YLTA 4R3JA 2ZY5A 1MWTA 5D3OA 4E3KA 3AZHA 5EVIB 5JYPA 1DJAA 4LV0A 4X23A 1EQZB 2YFVA 4DXCA 4OH0A 3G4PA 3PAEA 5DNMB 3AZNC 1BLHA 5C3IB 4R4RA 4J8VB 4CSRA 1HQ3C 2G5HC 1W8QA 5E2EA 5CPIB 3V5MA 4M6BA 1EQZC 4DE1A 4IBGA 4H8RA 5JA4B 5DNNA 5B32C 3KUYB 5DNMC 2NQBB 4EWFA 4KENB 4J8VC 4GB7A 4GDNA 5EVID 1IELA 1JWZA 3W98D 3S1YA 4A5RA 5CPIC 1CK3A 4R8PB 2NQBC 3NDEA 4C6YA 4XZQB 3A3DA 3X1VD 5GLBA 2ZY2A 4H9SC 3AYWC 5GXQB 3IXHA 1ES5A 1BLCA 3VFFA 3KUYD 3MZFA 4OPRA 5AV6C 4OUIA 5B1MB 1SCWA 1M6KA 2FFYA 1YU4A 4Z5TC 4PM9A 3M2JA 3B0DB 5GXQC 3N8SA 4LV3A 1EWZA 1FR1A 5B40C 4R8PD 5AV8B 2W8SA 1E25A 2EX9A 2RVQC 1P3FD 5B1MC 5AQBA 4XZQD 3AN2A 1ZLAA 3AZGA 3WTPD 3OZHA 2EFXA 3MGSB 5B2JB 4JF4A 4DE2A 5CERA 1KDWA 1PWGA 3HUOA 4DDYA 3FKEA 4LENA 3ITBA 3GRJA 5GT3B 5CP6A 4OQ0A 3MGSC 4HESA 5AV8D 3W96C 1FR6A 4IBBA 4DE0A 1E3UD 4EQIA 5CPJB 5BNVA 5CHUA 5FQQA 4U0TA 3OPPA 4DRAA 3G30A 5B2JD 5BOHA 1H8ZA 3W8KA 1KE3A 4F94A 4N1XA 3UE0A 3MNNB 3G2YA 1ID3A 4QHCA 5GT3D 4E6WA 3WX7A 3L25A 4E3IA 3SH9A 5CPJD 3MNNC 2R9WA 3UN7A 2WKEA 5FQ9A 1WWSA 1M19C 2XQZA 2Y2QA 5IHVA 1H8YA 3KXBC 3REIB 2EX2A 2XK1A 3MGRC 3P5JB 4KG5A 2ZM2A 3HSHA 5I94A 3SS4A 5GT0C 3B6GD 2HUEC 4IBKA 4BLMA 4WZSB 3UE3A 1MXOA 1K56A 3LJAC 4KZ3A 3UDXA 4XXRA 1KVMA 2Y2IA 2XDMA 1WYBA 3OPRA 1TZYD 3REID 3AZMC 2NZDB 3KWQB 1K54C 1P34A 3MFDA 3X1TC 3X1SB 5EOEA 3VH5W 5FAQA 3BLMA 5FAOA 2IOUA 1XKZA 2ZY3A 5GSUC 3BLSA 2NZDC 4BENA 3L2AA 4IBRA 4R4SA 3HLBA 3F6TA 3W98A 3PBOA 1G68A 4KZ4A 5M18A 1ESIA 3KWQD 2WZZA 4YM6D 4WM9A 2OV5A 1HTZA 5CPKA 5AY8A 3X1SD 5EECA 4OP5A 5AV5C 3X1VA 4QY6A 3SH7A 3IF6A 4NE5A 3HLEA 2XH9A 4RX2A 2R9XA 3G34A 3B0CW 3KUYA 1P3MB 3PAGA 2Z2LB 1M1AB 1XA1A 1K6RA 4NY2A 2WGWA 1P3LA 2VGKA 2HP5A 4WEKA 3B6FA 4JF5A 4MLLA 1P3MC 3L26A 1P3FA 3MGQB 1M1AC 4N9KA 1ULYA 1FQGA 3ZNTA 3WTPA 3O62A 5CXWA 3AZJC 1P3MD 1Q2QA 1KE0A 5F99B 3S4XA 3AZIB 1M18A 2CV5B 1KX5C 1HZOA 2P9VA 4HGAC 1B6WA 3MGQD 3LZ0B 1TDLA 1QMFA 3N8LA 1P3AA 5CHJA 2BYMB 4KZAA 2CV5C 3IWQA 3I7JA 2LY8A 1LLBA 5FASA 2XD5A 5DTTA 3LY4A 5F99D 4KHAA 3AZID 3GSGA 4P6BA 2Y2OA 5GLAA 1AOIC 1P3PB 1CI9A 3H0MC 1SDNA 5FQJA 5CGXA 4YFMA 1L0GA 5AQ7A 4BQMA 3G35A 3IH8A 3P09A 4QD4A 1S32B 3LZ0D 1N1JA 3V3SA 1W7FA 5FDHA 4BD0A 3R45A 5FA7A 3AZHB 1S0WA 5FI2A 4ZUXD 1W2EA 3IP4C 3KS8A 3WKJD 4GN2A 4X23B 3HLWA 1QMEA 5TFQA 2YFVB 3HLFA 4J8WD 2EFUA 4EBLA 3W99D 1S32C 3REJC 4S2KA 4DQYB 5B0ZA 4CSRB 2JCHA 1P3PD 3KFUG 1KE4A 5BNXA 5E5AC 5BO0A 3B6GA 1ZC2A 2RL3A 5FI6A 4JJNC 4E3JA 3V3RA 5DNNB 1S32D 2Q9MA 3IQAA 3H0LC 3ISGA 4HBTA 3C1CA 3AZHD 1CEFA 5DF8A 1ALQA 4XUXA 4X23D 1TZYA 3HVFA 4UUZA 3WAAA 4S2JA 3RELD 4J8XD 2PYOD 4BJPA 4N92A 4Z66C 4U3TA 3HLDA 3W4OA 3REHD 5DNND 3X1UB 4Y7PA 5KMWA 3VP3A 4M3KA 5FATA 4NYYA 4GKUA 4H9RA 1BLPA 4KZ9A 5G49B 5A92A 4LV1A 2DF4C 4ZTKA 4YM6A 3X1SA 3LO7A 3AN2B 5FI7A 5HAQA 2Y2MA 1ZLAB 3AZGB 2XLNA 4LCLA 5B33C 4Q8IA 3LZ1C 3X1UD 2PU4A 5DTSA 5CEDA 3S22A 1YMSA 4KZ5A 1MWSA 3AN2C 1NXYA 1ZLAC 3AZGC 2XF3A 5GL9A 3MVDC 5JRGA 5CP6B 4WU9C 2GDNA 2PU2A 3VP0A 5BS7A 3MXRA 1YLPA 4OOLA 1P3OD 1M40A 3ZNYA 5BNVB 5GHXA 3A3FA 4IBIA 1YMXA 3A3EA 3NQJA 1KX4A 3RJUA 4R0QA 4MNRA 5DF7A 1ID3B 5CP6D 2Y91A 3WS2A 3AV1C 4AWLB 5E2HA 4E3NA 5FQIA 3TU4A 3UE1A 3UDFA 3UY6A 1ES3A 1FSWA 1C3BA 4J8UA 5BT1D 1Z6FA 1K55A 4S2PA 3C1BA 3IHAA 3C7UA 1IYSA 3AZIA 3AZLC 1ID3D 5AQAA 4G92B 3HL9A 5EVLA 5J8XA 5A91A 3VP1A 5CGWA 3KSYA 2CC1A 3UDIA 2F8NH 1PWDA 1YU0A 5B1LC 1F66C 4ZUXA 1W5DA 3Q1FA 3WKJA 2B5RA 3EG5B 4IBJA 3VH6T 4J8WA 1FOFA 2V2FF 3W99A 1O7EA 5G18A 2ZJ9A 1P34B 1LI0A 2A49A 3UT9A 4YS3A 4FD8A 3HONA 4OVDA 1BFMA 4NZ4A 3WRTA 4OLGA 1SKFA 2JBFA 1K56D 2JC7A 3JYIA 4ZBJB 3W98B 3ZVWA 4XUJA 3AFAA 5KZHA 3RELA 1P34D 5CPKB 5AY8B 4J8XA 2PYOA 4LCMA 2BG1A 1U60A 3AZKD 3X1VB 1PI5A 3MKEA 5EVIC 3W98C 3WRZA 3IF6B 3REHA 2XD1A 5F83A 4ZBEA 3N4IA 5C3IC 1IEMA 3NQUA 2HIOA 1YM1A 2WGWB 3X1VC 1P3LB 4ZAMA 3HLGA 5E2FA 5E2GA 2QMIA 3IF6C 5HL1A 3MZEA 3B6FB 3HUNA 3ZDJA 1Q9CA 1BH8A 1ONHA 5TR7A 3KUYC 1IYQA 1P3FB 4OKPA 5CPKD 5AY8D 3ZG7B 2ZQCA 3FWLA 5AVBA 1LI9A 3Q7VA 3WTPB 3QHYA 4S2NA 3O62B 3LELA 3B6FC 5A90A 4R8PC 4QJGA 2WAEA 3X1UA 1P3FC 3AV2A 2WGIA 4XZQC 1M18B 2Z2MB 1P3LD 1PYYA 3WTPC 4KG6A 3B6FD 5G49A 2HDUA 2P9VB 4H9PB 3RXWA 1XPBA 2FFFB 3O88A 1P3KD 1U35B 1P3AB 3NBLA 1P3OA 4XUZA 3B0DC 4CAYA 1HVBA 2HDQA 3O62D 4L0LA 4K91A 5KSHA 4NETA 5AV8C 4X55A 4Z2MH 4JKTA 4KHAB 1XGJA 5B0YB 1M18D 4JPMA 3UO9A 4IBDA 3EPJA 5B31A 5B2JC 1BT5A 4PM6A 4GZBA 1N1JB 4EUZA 1U35D 1P3AD 2AROA 1SDEA 3R45B 2IWBA 4IBCA 3WA9A 1WWIA 4FCFA 1LHYA 3O3VA 5GT3C 2FJ7A 3B3XA 1YLWA 1YQSA 4QLCA 1FCNA 1FCMA 1XGIA 4OJ6A 3PBQA 5B0YD 5B0ZB 5CPJC 4ZJ3A 5BNXB 5BO0B 4Y0OA 3B6GB 4RX3A 4UA7A 4H9QA 4P85A 4GH9A 2ZMAA 3C1CB 3A3IA 3ZHHA 5U47A 1ONGA 1NZUA 1N4OA 5DF9A 1RGYA 3B6GC 4X69A 1TDGA 1TZYB 2WUQA 4UUZB 3WAAB 3REKA 5GLCA 3HREA 3Q81A 2HP9A 2ZQ9A 3MBZA 5EE8A 3VMAA 3AGEA 5B0ZD 1BLSA 4ID4A 3IT9A 4GHLA 4OJLA 1JTDA 4NK3A 3FDDA 3M6HA 1TZYC 4IJFA 1MWRA 3REIC 1P3GD 3O86A 2H5SA 3VP4A 3C1CD 2ZD8A 1RCJA 1EROA 3AGDA 5DTKA 4H9RB 3WAAD 3V9RA 3DWZA 3UPPA 3W4PA 4YM6B 4KUDA 1KGEA 4YINA 3AZKA 4CPKA 3TSGA 3MKFA 5FUGA 4GHAA 2V20A 1ZKJA 1E4DA 1A7WA 3KWQC 4ZJ1A 5AV9A 1PZOA 4YM6C 3X1SC 1GHMA 2IO5B 3W97D 3NIAA 4C3QA 2WADA 3Q7ZA 4KZ8A 2HDRA 3AZFD 5M19A 3G2ZA 2XFSA 5JRGB 4MEZA 3NI9A 4H9OA 2ZM5A 3QNBA 3VOYA 2C6WB 3SS5A 2IO5C 4IBXA 2X02A 1Y54A 4WU8D 4K0XA 1HQ3A 3FYZA 4BL2A 3GMWA 3G32A 3NQJB 4GD6A 3IHBA 4KZ6A 3VH5T 1KX4B 3GTCA 5B32A 1HTAA 1XA7A 3IH9A 1XP4A 3NY4A 5HX9A 3BM6A 5JRGD 3TU4B 4G91B 4WZ5A 1T3UA 2EX6A 1P3KA 3V50A 4J8UB 4H9SA 3AYWA 3C1BB 4RVAA 1BUEA 4UHUA 4RYEA 3MGQC 1KX4D 4OJOA 1JWPA 1K25A 3OPLA 4OLDA 4Z5TA 3Q07A 4NYUA 4JLFA 5B31G 3TU4D 1K55C 4H9PA 4GDBA 5HAIA 5B40A 3WTPE 5F99C 3AZIC 1U35A 1G6AA 4ZUXB 4J8UD 3EPHA 3WKJB 5B2ID 3N8RA 3C1BD 2RCXA 4J8WB 3W99B 3LZ0C 2PBYA 5B0YA 1JFIA 2JSSA 4JF6A 3UT9B 4ZUXC 4YS3B 3D4FA 3WKJC 4CJNA 4J8WC 4HBUA 3W99C 3SS3A 1KVLA 3W96A 3EPKA 3ZG8B 1P3PC 3BRMA 5TGFA 1IYOA 2Y2HA 4XUJB 4IBFA 3AFAB 4D2OA 5CTMA 3RELB 4OJPA 3EQVA 4IEDA 3AL0C 4J8XB 3UTBD 2PYOB 2OLUA 2G2WA 5B24D 3AZHC 3UT9D 4YS3D 3GR2A 1NRFA 4X23C 3FKWA 3REHB 3FV7A 4N1HA 1P3GA 3RELC 1LL9A 3H0RC 3ZVTA 4J8XC 3NQUB 2PYOC 2HIOB 3IXBA 1KGFA 3N6IA 3Q82A 4XUJD 3AFAD 4OP8A 1BH8B 3REHC 5DNNC 1M19A 2J9OA 3KXBA 3MGRA 3ZG5A 3L28A 1N9BA 4QNLA 5AVBB 2HIOC 3Q7VB 1BH9A 4E3LA 4MBKA 4EBNA 5GT0A 3LELB 1FSYA 5GLDA 1MWUA 3RXXA 4DDSA 3AV2B 4Y0TA 2HIOD 3W97A 3GVBA 3NC8A 4B88A 5KSCA 3AZFA 4S2NC 1NYMA 3ZCZA 4WNNA 4E44A 3X1UC 4IVKA 3AZMA 3E2LA 5AVBD 1K54A 1P3OB 5JYOA 3X1TA 2XGNA 1BSGA 4WU8A 4CAYB 2ZQ7A 4NZ3A 3LELD 4OQIA 3FKVA 3EPLA 5GSUA 1L2SA 1I2SA 5FSRA 2F2AC 3AV2D 2E8IA 5CEBA 2UWXA 5B32G 3A3JA 1H3OA 1P3OC 2H0TA 2V1ZA 1P3BB 4DF6A 5B31B 1YLJA 1YT4A 4QY5A 2HP6A 4LV2A 4OQGA 3M6BA 1BULA 2AROB 3CMZA 2JE5A 3WA9B 2Y59A 4H9NA 5AV5A 4KGCD 5CP6C 2FJ7B 5CHLB 4QLCB 3A6ND 1WE4A 3BFCA 1IKGA 1KU5A 3A1IA 3UPOA 2ZC4B 3OC2A 1P3BD 3UPNA 5B31D 4OONA 5BT1C 1P3IB 2WYXA 2FJ7C 3IF5A 4IJEA 1PZRA 4H9QB 2AROD 3WA9D 2CWEA 1ID3C 5FAPA 3AGFA 3MGPB 3VOZA 5B2IA 4AWLC 2FJ7D 3KS4A 3REKB 4QLCD 4NZ1A 4UA9A 1JVJA 3L29A 3AZJA 1IKIA 1W79A 3VH6W 4LD9D 2DQNC 5FQKA 2Y2PA 3C7VA 3DWKA 1P3ID 2YFWA 1GHIA 3BFEA 1ES4A 1DY6A 3AZEA 4KZBA 2OLVA 4G92C 3MGPD 3V9RB 3REKD 4Z9QA 3CG5A 4U0XA 3GV9A 4WMCD 4KUDB 3IXGA 3UTBA 5AVCD 3AZKB 5B24A 1AOIA 3BECA 5FUGB 4UPKA 1YU3A 3LCEA 4PPRA 5KDMA 4E6XA 3WS4A 5AV9B 1P34C 4OOMA 3VSKA 3AZKC 1L0DA 4N9LA 2ZM8A 1I2WA 4B4ZA 5AV9C 1Q2PA 4H9OB 4KUDD 3M2KA 3HLCA 3PBNA 4S2MA 1K38A 3REJA 2ZQDA 4ZBJC 2XFTA 5E43A 3BYDA 1HQ3B 5E5AA 1ESUA 3TG9A 4JJNA 5AV9D 1KGGA 4OPYA 5CPKC 5AY8C 5B32B 3N3FA 1VQQA 3G31A 3PBRA 2ZY4A 5F1GA 2Y55A 1KX3A 4GNUA 1K57A 1I5QA 3AZND 1H5XA 1P3KB 3WS1A 1P3LC 2Y2LA 3CJMA 1HQ3D 4Z66A 4WEJA 3AYWB 4X6TA 4HEFA 1EQZD 1PW8A 4WZ5C 3VH6A 5B32D 4FH2A 5DNMD 3GQZA 5AV6B 1P3KC 3VSLA 4R3BA 4J8VD 2QPNA 1FCOA 4BL3A 4Z5TB 4OPZA 3O62C 2ZC6B 4JXSA 5CPID 3NCKA 5B40B 1JTGA 2NQBD 1M18C 3VP2A 2F8NG 1NYYA 3B0BA 4E3OA 4KGCA 3MZDA 3AYWD 5B33A 3LZ1A 4UA6A 1PIOA 3A6NA 5GHZA 5AV6D 3WWXA 1JFIB 1U35C 1P3AC 4Z5TD 1P3BA 1GA0A 3WS5A 4DRBA 1RP5A 1ZG4A 3MXSA 3OCNA 5GXQD 4MBHA 4KQRA 3MVDA 4WU9A 4P0MA 5B40D 2RVQD 4S2OA 3W96B 5B1MD 5B0YC 3P98A 4DE3A 1GCEA 4QU3A 2G2UA 1NZOA 3BFFA 4PM8A 4WZ4A 1XXMA 4LD9A 2VGJA 3W4QA 3QNCA 1DJBA 1P3IA 1P3GB 3E2KA 3MGSD 3AV1A 4JXWA 3W96D 2Y2GA 5B0ZC 1ZG6A 1NJ4A 1LL5A 3MGPA 2H10A 1P3GC 1M19B 3KXBB 4C75A 1EI5A 3MGRB 4WMCA 3FZCA 5AVCA 3C1CC 1BH9B 3AZLA 2ZC7A 5GT0B 3WAAC 4FSFA 5CGSA 2HUEB 4E45A 1K4FA 3UTAA 3W97B 3LJAB 1J9MA 4PMAA 3MNND 3AZFB 5B1LA 1F66A 2X01A 4WNNB 1M19D 3KXBD 4K0WA 3AZMB 3MGRD 2OSUA 1GA9A 3W97C 3IWIA 3X1TB 3ZGAB 5GT0D 4WU8B 4S2IA 5CECA 3AZFC 1TAFA 5GSUB 4Z2MG 4E3MA 5HFOA 2HDSA 3LJAD 1H3OB 1R4VA 4WU8C 3ZG9B 1AXBA 1HD8A 4KG2A 1XX2A 2WAFA 2J7VA 3AZMD 3AZNA 1OMEA 4DRTA 2F8NB 1L0FA 3X1TD 4H9NB 5AV5B 1B67A 2L5AA 5JRGC 5EVIA 1YUEA 5BS7C 3EQUA 1EQZA 3NDGA 5GSUD 3LEZA 2NZDD 4KQQA 5DNMA 5EUAA 2IWDA 4ZJ2A 4DXBA 4EV4A 4J8VA 1ERMA 3VFHA 2Y4AA 2IWCA 2WGVA 5EPHA 3IWOA 2I72A 4PM7A 5CPIA 5JA4A 1KX4C 4LG2A 2BYKB 2F8ND 2NQBA 3L27A 3OCLA 5AV5D 4R1GA 4WELA 5B2IB 3ITAA 3TU4C 4G91C 1SHVA 1TVFA 3AZJB 4R8PA 1CEGA 5AV6A 3C4OA 2BLSA 2WKIA 4NFTA 4XZQA 1YU2A 1K6SA 4J8UC 3B0CT 1PWCA 5B2IC 2A3UA 5GXQA 2YFWB 3C1BC 1KX5B 2J8PA 2QZ6A 2Y2NA 4HGAB 4WBGA 5B1MA 3BFDA 3AZEB 1M1AD 4O7DA 1K4EA 1PZPA 4ZDXA 1NY0A 5DVAA 3AZJD 1IYPA 5AV8A 3DW0A 3UTBB 3AZEC 5B24B 4OJ5A 1E3UA 4PM5A 3TOIA 1AOIB 1JWVA 1KX5D 1KDSA 5KDMB 3MGSA 5B2JA 5BPVA 3UTBC 3VH5A 3AZED 4WJ3C 5B24C 3UT9C 4YS3C 1PW1A 2CV5D 5GT3A 3N7WA 3HUMA 2ZLYA 2DRWA 1PI4A 3REJB 1AOID 5CPJA 4XUJC 1ERQA 5HAPA 1BZAA 5E5AB 3AFAC 2ZC3B 4JJNB 4IBEA 4OOYA 2HPBA 5EOOA 1MKIA 4QB8A 2H0YA 3PBSA 1WYCA 4JBFA 3MNNA 2XEPA 1KX3B 4NE3A 3ZG0A 1Z2CB 2J9PA 4IVIA 4UAAA 3REJD 2C5WB 5L2FA 2EXBA 4Z66B 5E5AD 4JJND 1KX3C 3REIA 1K57C 4X53A 3BFGA 5AVBC 3LJAA 1YU1A 2J8YA 1YLZA 3PTEA 2Y2JA 3LELC 4WYYA 1KX3D 2WZXA 3AV2C 4WV4B 3A1KA 4KGCB 4Z66D 4EBPA 2WK0A 4RA7A 5B33B 2EXAA 3LZ1B 2NZDA 3A6NB 1W8YA 2F8NK 1GHPA 4B4XA 3KWQA 5FQMA 4P87A 3LY3A 4KQOA 4KGCC 4FH4A 1RGZA 1O07A 3MVDB 4WU9B 5F1FA 3A6NC 2F8NA 2Q9NA 1TEMA 2P74A 1P3BC 5B31C 1YLYA 4EO5B 5B33D 1MY8A 2ZQ8A 3LZ1D 1MPLA 3O87A 2DNSA 2AROC 4LD9B 3WS0A 3WA9C 4OPQA 3AN2D 1ZLAD 3AZGD 5A93A 4EO5C 1F1EA 4WU9D 3MVDD 4QLCC 3AV1B 1P3MA 1VM1A 2BYKA 1BTLA 4LD9C 1M1AA 4X68A 2XR0A 4MBFA 4S2LA 2X71A 1P3IC 5CTNA 2DCFA 3HBRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WKH A;  3HLW A;  1QME A;  4JXG A;  1E4D A;  4JXV A;  5TFQ A;  3NCK A;  3HLF A;  2EFU A;  4ZJ1 A;  4EBL A;  1PZO A;  1JTG A;  5CHM A;  1GHM A;  4Y0U A;  4S2K A;  3NIA A;  3VP2 A;  1NYY A;  2EX8 A;  4C3Q A;  2WAD A;  5CRF A;  3ZFZ A;  3Q7Z A;  5F82 A;  2JCH A;  1S6R A;  4E3O A;  4OQH A;  3V39 A;  1KE4 A;  2ZM0 A;  4KZ8 A;  2HDR A;  3MZD A;  4X56 A;  3G2Z A;  5M19 A;  2XFS A;  3PBT A;  1ZC2 A;  1DJC A;  2RL3 A;  5FI6 A;  4E3J A;  2Y2K A;  3DTM A;  3V3R A;  4UA6 A;  4MEZ A;  1PIO A;  4DKI A;  2Q9M A;  3CZD A;  3IQA A;  3NI9 A;  5GHZ A;  3WWX A;  3QNB A;  3VOY A;  2C6W B;  3IXD A;  3SS5 A;  3ISG A;  2ZQA A;  4IBX A;  3C5A A;  4BD1 A;  4HBT A;  3SH8 A;  2X02 A;  1GA0 A;  1CEF A;  1Y54 A;  5GHY A;  3WS5 A;  4K0X A;  1RP5 A;  1ZG4 A;  1ALQ A;  3MXS A;  3OCN A;  4XUX A;  5DF8 A;  3HVF A;  3FYZ A;  4MBH A;  4KQR A;  4BL2 A;  3BEB A;  3GMW A;  1L0E A;  4P0M A;  4S2J A;  3SOI A;  3G32 A;  4GD6 A;  3IHB A;  4KZ6 A;  3GTC A;  4S2O A;  1XA7 A;  3IH9 A;  3P98 A;  4DE3 A;  1GCE A;  1XP4 A;  5M1A A;  4GD8 A;  4QU3 A;  4BJP A;  3NY4 A;  4N92 A;  2G2U A;  5HX9 A;  2ZC5 B;  3UNW A;  1MBL A;  3BM6 A;  1NZO A;  4R23 A;  3BFF A;  4U3T A;  3HLD A;  4PM8 A;  3W4O A;  1ES2 A;  4WZ4 A;  3C4P A;  4WZ5 A;  2EX6 A;  4Y7P A;  5KMW A;  1XXM A;  2VGJ A;  3W4Q A;  3VP3 A;  4M3K A;  5FAT A;  3QNC A;  3V50 A;  5HAR A;  1DJB A;  5AQ9 A;  5HW3 A;  3OPH A;  4GKU A;  1BLP A;  1CI8 A;  4KZ9 A;  4RVA A;  1BUE A;  3E2K A;  4JXW A;  4UHU A;  5A92 A;  4LV1 A;  4RYE A;  4ZTK A;  2Y2G A;  3LO7 A;  4GOG A;  1JWP A;  4KZ7 A;  5FI7 A;  5HAQ A;  1ZG6 A;  1YLT A;  1K25 A;  2Y2M A;  1NJ4 A;  1LL5 A;  1MWT A;  3OPL A;  4OLD A;  4R3J A;  5D3O A;  4E3K A;  5EVI B;  5JYP A;  2XLN A;  3Q07 A;  4LCL A;  1DJA A;  4Q8I A;  4JLF A;  4JXS A;  1K55 C;  2H10 A;  4LV0 A;  4GDB A;  5HAI A;  4DXC A;  4OH0 A;  4C75 A;  3G4P A;  2PU4 A;  3PAE A;  1EI5 A;  5DTS A;  4WMC A;  5CED A;  3S22 A;  1BLH A;  3FZC A;  1YMS A;  4KZ5 A;  4R4R A;  1MWS A;  1NXY A;  2ZC7 A;  1G6A A;  1W8Q A;  2XF3 A;  5GL9 A;  3N8R A;  5E2E A;  4FSF A;  2GDN A;  3V5M A;  2PU2 A;  5CGS A;  2RCX A;  3VP0 A;  4DE1 A;  4H8R A;  1K4F A;  3MXR A;  1YLP A;  4OOL A;  2PBY A;  4EWF A;  4KEN B;  4JF6 A;  1J9M A;  1M40 A;  4GB7 A;  4PMA A;  4GDN A;  3ZNY A;  5GHX A;  3A3F A;  5EVI D;  1IEL A;  1JWZ A;  3D4F A;  3S1Y A;  4A5R A;  2X01 A;  1CK3 A;  1YMX A;  4CJN A;  4HBU A;  4K0W A;  3A3E A;  3SS3 A;  2OSU A;  1GA9 A;  1KVL A;  3NDE A;  3IWI A;  4C6Y A;  3RJU A;  3ZG8 B;  3ZGA B;  3A3D A;  3BRM A;  5TGF A;  4R0Q A;  4S2I A;  1IYO A;  5GLB A;  4MNR A;  5DF7 A;  5CEC A;  2Y2H A;  3IXH A;  1ES5 A;  2Y91 A;  3WS2 A;  5E2H A;  4E3N A;  1BLC A;  5FQI A;  4D2O A;  5CTM A;  3UE1 A;  3UDF A;  3VFF A;  3MZF A;  3EQV A;  4IED A;  4OPR A;  4E3M A;  5HFO A;  1SCW A;  1M6K A;  2HDS A;  3UY6 A;  2OLU A;  2G2W A;  1ES3 A;  1FSW A;  2FFY A;  4PM9 A;  3GR2 A;  3M2J A;  3ZG9 B;  1AXB A;  1HD8 A;  1C3B A;  1NRF A;  4KG2 A;  1XX2 A;  2WAF A;  1Z6F A;  3FKW A;  1EWZ A;  3N8S A;  4LV3 A;  1K55 A;  1FR1 A;  3FV7 A;  4N1H A;  4S2P A;  3IHA A;  2J7V A;  1LL9 A;  3C7U A;  1E25 A;  2EX9 A;  1IYS A;  3ZVT A;  1OME A;  4DRT A;  1L0F A;  5AQB A;  3IXB A;  1KGF A;  3N6I A;  3OZH A;  3Q82 A;  5AQA A;  5EVI A;  3HL9 A;  5EVL A;  4GN2 A;  4OP8 A;  2EFX A;  3EQU A;  4DE2 A;  4JF4 A;  5A91 A;  5J8X A;  3NDG A;  3VP1 A;  3LEZ A;  2J9O A;  1KDW A;  1PWG A;  3HUO A;  5CGW A;  5CER A;  4DDY A;  4KQQ A;  3ZG5 A;  5EUA A;  2IWD A;  4ZJ2 A;  4DXB A;  4EV4 A;  1N9B A;  2CC1 A;  3UDI A;  3Q7V B;  1PWD A;  4E3L A;  1ERM A;  4MBK A;  3VFH A;  4EBN A;  2Y4A A;  4LEN A;  2IWC A;  2WGV A;  3ITB A;  5EPH A;  1W5D A;  3GRJ A;  3IWO A;  3Q1F A;  2I72 A;  4PM7 A;  1FSY A;  2B5R A;  4OQ0 A;  5GLD A;  1MWU A;  4HES A;  1FOF A;  3RXX A;  2V2F F;  1O7E A;  5G18 A;  2ZJ9 A;  1FR6 A;  4DDS A;  4Y0T A;  1LI0 A;  4DE0 A;  1E3U D;  3GVB A;  3OCL A;  4EQI A;  3NC8 A;  2A49 A;  5CHU A;  4B88 A;  5KSC A;  4R1G A;  5FQQ A;  4S2N C;  4FD8 A;  4WEL A;  1NYM A;  3ITA A;  4OVD A;  4U0T A;  3OPP A;  3ZCZ A;  3G30 A;  3WRT A;  5BOH A;  1SHV A;  1TVF A;  4OLG A;  1H8Z A;  1SKF A;  4IVK A;  1CEG A;  2JBF A;  1K56 D;  2JC7 A;  3W8K A;  3C4O A;  2BLS A;  3E2L A;  1KE3 A;  3JYI A;  1K54 A;  2WKI A;  4F94 A;  5JYO A;  4N1X A;  3UE0 A;  2XGN A;  1K6S A;  3G2Y A;  1BSG A;  2ZQ7 A;  1PWC A;  3ZVW A;  4OQI A;  2A3U A;  4QHC A;  4E6W A;  2QZ6 A;  2Y2N A;  4E3I A;  5KZH A;  3FKV A;  1L2S A;  1I2S A;  5FSR A;  2E8I A;  5CEB A;  4WBG A;  3BFD A;  2UWX A;  3A3J A;  4LCM A;  2BG1 A;  1U60 A;  2H0T A;  1PI5 A;  2V1Z A;  4O7D A;  3SH9 A;  1K4E A;  3MKE A;  5EVI C;  2R9W A;  3UN7 A;  3WRZ A;  3IF6 B;  4DF6 A;  1PZP A;  1YLJ A;  2WKE A;  5FQ9 A;  1YT4 A;  2XQZ A;  2Y2Q A;  1NY0 A;  1H8Y A;  5IHV A;  4ZDX A;  2EX2 A;  5DVA A;  2XD1 A;  2XK1 A;  4QY5 A;  2HP6 A;  1IYP A;  5F83 A;  4KG5 A;  4ZBE A;  3DW0 A;  4LV2 A;  3N4I A;  4OQG A;  1IEM A;  2ZM2 A;  3M6B A;  1BUL A;  3CMZ A;  5I94 A;  2JE5 A;  1YM1 A;  3SS4 A;  2WGW B;  1E3U A;  4PM5 A;  2Y59 A;  4ZAM A;  3TOI A;  3HLG A;  5E2F A;  5E2G A;  1JWV A;  2QMI A;  3IF6 C;  5HL1 A;  1KDS A;  3MZE A;  3HUN A;  3ZDJ A;  4BLM A;  1ONH A;  5TR7 A;  3UE3 A;  1IYQ A;  4OKP A;  1MXO A;  1K56 A;  4KZ3 A;  3UDX A;  3ZG7 B;  1WE4 A;  2ZQC A;  3BFC A;  3FWL A;  4XXR A;  1KVM A;  1IKG A;  1LI9 A;  3Q7V A;  2Y2I A;  2ZC4 B;  3OC2 A;  3UPO A;  1PW1 A;  2XDM A;  3UPN A;  1WYB A;  3QHY A;  4OON A;  4S2N A;  3OPR A;  2WYX A;  5A90 A;  3IF5 A;  4QJG A;  2WAE A;  3N7W A;  1K54 C;  3HUM A;  3MFD A;  2ZLY A;  2WGI A;  2DRW A;  1PI4 A;  5EOE A;  2Z2M B;  5FAQ A;  1PYY A;  3BLM A;  5FAP A;  5FAO A;  1ERQ A;  3AGF A;  4KG6 A;  3VOZ A;  5HAP A;  1BZA A;  2ZC3 B;  2HDU A;  1XKZ A;  2P9V B;  4OOY A;  3BLS A;  3RXW A;  1XPB A;  2HPB A;  4UA9 A;  1JVJ A;  4BEN A;  5EOO A;  2FFF B;  3O88 A;  1IKI A;  1W79 A;  1MKI A;  4QB8 A;  2H0Y A;  3PBS A;  1WYC A;  3NBL A;  4JBF A;  4XUZ A;  4IBR A;  5FQK A;  2Y2P A;  3C7V A;  3DWK A;  3HLB A;  4R4S A;  1HVB A;  2HDQ A;  4L0L A;  4K91 A;  5KSH A;  2XEP A;  3PBO A;  1GHI A;  4NET A;  1G68 A;  4KZ4 A;  4X55 A;  5M18 A;  1ESI A;  3BFE A;  4JKT A;  3ZG0 A;  1ES4 A;  1XGJ A;  2J9P A;  2WZZ A;  4IVI A;  4WM9 A;  2OV5 A;  1HTZ A;  4UAA A;  1DY6 A;  5EEC A;  2C5W B;  4OP5 A;  4KZB A;  4JPM A;  4QY6 A;  2OLV A;  3UO9 A;  5L2F A;  2EXB A;  3SH7 A;  3IF6 A;  3HLE A;  2XH9 A;  4RX2 A;  4Z9Q A;  1BT5 A;  3CG5 A;  4U0X A;  2R9X A;  1K57 C;  3G34 A;  4PM6 A;  3GV9 A;  4X53 A;  3PAG A;  3BFG A;  4WMC D;  2Z2L B;  4GZB A;  3IXG A;  1XA1 A;  4EUZ A;  2J8Y A;  1YLZ A;  1SDE A;  1K6R A;  2IWB A;  2WGW A;  3PTE A;  2Y2J A;  3BEC A;  4FCF A;  1LHY A;  3O3V A;  4WYY A;  2VGK A;  3LCE A;  2HP5 A;  4PPR A;  3B3X A;  4WEK A;  4E6X A;  1YLW A;  1YQS A;  4JF5 A;  3WS4 A;  2WZX A;  1FCN A;  4MLL A;  4OOM A;  1FCM A;  1XGI A;  3PBQ A;  4N9K A;  3VSK A;  1L0D A;  4ZJ3 A;  1FQG A;  4N9L A;  3ZNT A;  2ZM8 A;  4EBP A;  4Y0O A;  1I2W A;  2WK0 A;  4RA7 A;  5CXW A;  2EXA A;  4RX3 A;  4B4Z A;  1Q2P A;  1W8Y A;  4UA7 A;  1GHP A;  3M2K A;  1Q2Q A;  1KE0 A;  3HLC A;  3PBN A;  4B4X A;  4S2M A;  3S4X A;  5FQM A;  4P85 A;  4P87 A;  1K38 A;  3LY3 A;  2ZMA A;  2ZQD A;  4KQO A;  3A3I A;  3ZHH A;  5U47 A;  1ONG A;  1NZU A;  2XFT A;  1N4O A;  3BYD A;  4FH4 A;  5E43 A;  5DF9 A;  1RGY A;  1RGZ A;  4X69 A;  1TDG A;  1HZO A;  2WUQ A;  1ESU A;  1O07 A;  3TG9 A;  5GLC A;  3HRE A;  3Q81 A;  2P9V A;  5F1F A;  1KGG A;  2HP9 A;  2ZQ9 A;  3MBZ A;  4OPY A;  5EE8 A;  1TDL A;  2Q9N A;  3VMA A;  1TEM A;  1QMF A;  1VQQ A;  2P74 A;  3AGE A;  3N8L A;  1BLS A;  4ID4 A;  3G31 A;  3IT9 A;  5CHJ A;  1JTD A;  4KZA A;  4NK3 A;  1YLY A;  3IWQ A;  3M6H A;  3PBR A;  3I7J A;  1MWR A;  1MY8 A;  1LLB A;  5F1G A;  2ZQ8 A;  1MPL A;  2Y55 A;  4GNU A;  5FAS A;  1K57 A;  2XD5 A;  3O86 A;  5DTT A;  2H5S A;  3O87 A;  1I5Q A;  2DNS A;  3LY4 A;  1H5X A;  3WS0 A;  3GSG A;  3WS1 A;  4P6B A;  2Y2O A;  4OPQ A;  3VP4 A;  2ZD8 A;  5GLA A;  2Y2L A;  1RCJ A;  3CJM A;  1CI9 A;  1ERO A;  3AGD A;  5DTK A;  5A93 A;  4WEJ A;  1SDN A;  5FQJ A;  5CGX A;  4YFM A;  4X6T A;  3DWZ A;  1L0G A;  4HEF A;  5AQ7 A;  4BQM A;  1PW8 A;  3G35 A;  3IH8 A;  4WZ5 C;  3UPP A;  3P09 A;  4QD4 A;  1VM1 A;  3W4P A;  4FH2 A;  3GQZ A;  1BTL A;  1KGE A;  4YIN A;  3V3S A;  1W7F A;  4X68 A;  5FDH A;  3VSL A;  4R3B A;  4BD0 A;  2QPN A;  2XR0 A;  4CPK A;  1FCO A;  4BL3 A;  4MBF A;  4S2L A;  2X71 A;  5FA7 A;  3TSG A;  1S0W A;  3MKF A;  4OPZ A;  5FI2 A;  5CTN A;  2ZC6 B;  2DCF A;  3HBR A;  2V20 A;  1ZKJ A; 
#chains in the Genus database with same CATH topology
 2WKH A;  2RIQ A;  4JXG A;  1EAK A;  4JXV A;  4MCW A;  3LI8 A;  5CHM A;  5AVC B;  3MGQ A;  1ODV A;  2W0N A;  3A0R A;  4Y0U A;  2EX8 A;  3IBR A;  3AZL B;  3UB6 A;  5CRF A;  3ZFZ A;  5F82 A;  1S6R A;  3MGP C;  4Z2L A;  2G5I C;  4OQH A;  3V39 A;  2ZM0 A;  2VQR A;  4X56 A;  3PBT A;  1KX5 A;  3REK C;  1DJC A;  4CLC D;  3AV1 D;  1UR8 A;  2Y2K A;  3MFX A;  3DTM A;  4I3A A;  5HPF A;  3UTA B;  3KSH A;  4DKI A;  3CZD A;  5AVC C;  2VX8 A;  5F99 A;  2MJ6 A;  3IXD A;  2ZQA A;  3C5A A;  4BD1 A;  3KYE A;  3SH8 A;  5GHY A;  4ETZ A;  2CV5 A;  5B1L B;  1F66 B;  3EWK A;  4KUK A;  3BEB A;  1L0E A;  3SOI A;  1CF0 A;  3UTA C;  1F9I A;  4G3V A;  1Z09 A;  3LZ0 A;  5TBM A;  5HSQ A;  2J3W A;  3AZL D;  5M1A A;  4GD8 A;  3EOI A;  2BYM A;  4P6Z M;  2ZC5 B;  3UNW A;  1TAF B;  1MBL A;  4R23 A;  4EUV A;  1HLU P;  4NE6 A;  1ES2 A;  4NZ5 A;  3UTA D;  3C4P A;  4KUD C;  3WD1 A;  5HAR A;  1P3P A;  5B1L D;  1F66 D;  5AQ9 A;  5HW3 A;  3OPH A;  2J3T D;  1CI8 A;  4P6Z S;  3AZN B;  1S32 A;  3LIF A;  5HD3 A;  4IUK A;  3BW6 A;  5IU1 A;  4GOG A;  4KZ7 A;  1YLT A;  3CPT B;  4R3J A;  2ZY5 A;  1MWT A;  5D3O A;  4E3K A;  3AZH A;  5EVI B;  5JYP A;  1DJA A;  3UB8 A;  4LV0 A;  4X23 A;  1EQZ B;  1YAX A;  2YFV A;  4DXC A;  4OH0 A;  3G4P A;  3PAE A;  5DNM B;  3AZN C;  1CXW A;  1BLH A;  3MMH A;  5C3I B;  3WD3 A;  4R4R A;  4J8V B;  3QP5 A;  4CSR A;  1HQ3 C;  3FC7 A;  2G5H C;  1W8Q A;  2V9A A;  3H9W A;  1DRM A;  5E2E A;  5CPI B;  3V5M A;  4M6B A;  1EQZ C;  4DE1 A;  4IBG A;  1ACF A;  1LT0 A;  4H8R A;  4LRX C;  5JA4 B;  4QWO A;  5DNN A;  5B32 C;  3KUY B;  5DNM C;  2NQB B;  4EWF A;  4KEN B;  5C5K A;  4J8V C;  4GB7 A;  4GDN A;  3LR3 A;  3MQL A;  4Y2F A;  5EVI D;  1IEL A;  1JWZ A;  2OWJ A;  3W98 D;  3S1Y A;  4A5R A;  5CPI C;  1CK3 A;  3SW1 A;  4R8P B;  2NQB C;  3NDE A;  4C6Y A;  4B93 A;  4XZQ B;  1TS7 A;  3A3D A;  3X1V D;  5GLB A;  2ZY2 A;  3KSF A;  4H9S C;  3AYW C;  1VET B;  5GXQ B;  3IXH A;  1ES5 A;  1BLC A;  4R38 A;  3UB7 A;  3VFF A;  3KUY D;  3MZF A;  4OPR A;  5AV6 C;  4OUI A;  5B1M B;  1SCW A;  1M6K A;  2V1A A;  2FFY A;  1YU4 A;  4Z5T C;  4PM9 A;  3M2J A;  3B0D B;  2JKR M;  5GXQ C;  3N8S A;  4LV3 A;  1EWZ A;  1FR1 A;  5B40 C;  4R8P D;  5AV8 B;  2W8S A;  1E25 A;  2EX9 A;  5L8M A;  2RVQ C;  1P3F D;  5B1M C;  4I5S A;  5AQB A;  4XZQ D;  3AN2 A;  4NXF A;  1ZLA A;  3AZG A;  3WTP D;  3OZH A;  4ZRR A;  2EFX A;  3MGS B;  5B2J B;  4JF4 A;  4B9O A;  4DE2 A;  4LRY C;  4GJ4 A;  5CER A;  1KDW A;  1PWG A;  3HUO A;  4DDY A;  2VEA A;  3FKE A;  5F6A A;  1YPR A;  1E6Z A;  4LEN A;  3ITB A;  3GRJ A;  5AVF A;  5GT3 B;  5CP6 A;  4OQ0 A;  3MGS C;  4HES A;  5AV8 D;  3W96 C;  1FR6 A;  4IBB A;  1LL8 A;  3LR5 A;  4Q0I A;  4DE0 A;  5HD5 A;  1E3U D;  4EQI A;  5CPJ B;  5BNV A;  5CHU A;  5FQQ A;  3LR4 A;  4U0T A;  3OPP A;  4DRA A;  3G30 A;  5B2J D;  5BOH A;  1H8Z A;  2JKF A;  2VJW A;  3W8K A;  1KE3 A;  3NUL A;  4F94 A;  4N1X A;  3UE0 A;  3MNN B;  3G2Y A;  1ID3 A;  4QHC A;  5GT3 D;  4E6W A;  3WX7 A;  3L25 A;  2CMN A;  4E3I A;  4MMN A;  4BBV A;  2BTF P;  5IS1 A;  1T1A A;  4CLC E;  3SH9 A;  3VE3 A;  5CPJ D;  5F68 A;  3MNN C;  2R9W A;  3UN7 A;  4K08 A;  2WKE A;  5FQ9 A;  1WWS A;  1M19 C;  1CK7 A;  2XQZ A;  2Y2Q A;  5IHV A;  1H8Y A;  3KXB C;  3REI B;  2EX2 A;  2XK1 A;  3MGR C;  3P5J B;  4KG5 A;  4I3I A;  2ZM2 A;  3LIB A;  1T18 A;  3HSH A;  5I94 A;  3SS4 A;  5GT0 C;  3B6G D;  2HUE C;  1N9O A;  4IBK A;  4BLM A;  4WZS B;  3UE3 A;  1E15 A;  1MXO A;  1K56 A;  3LJA C;  4KZ3 A;  3UDX A;  4XXR A;  1KVM A;  2Y2I A;  1S4S A;  2XDM A;  1WYB A;  3OPR A;  4ME4 A;  1TZY D;  3REI D;  4FTX A;  3AZM C;  2NZD B;  3KWQ B;  1K54 C;  1P34 A;  3MFD A;  3X1T C;  3X1S B;  5EOE A;  3VH5 W;  5FAQ A;  3BLM A;  5FAO A;  1W63 M;  5MC7 A;  5L10 A;  2INW A;  4NG2 A;  2JKT I;  2IOU A;  3SZT A;  1XKZ A;  2ZY3 A;  5GSU C;  3BLS A;  2NZD C;  4MN7 A;  4BEN A;  4AFI A;  3R4K A;  2O9B A;  3L2A A;  4IBR A;  3H7W A;  4R4S A;  3HLB A;  3F6T A;  3W98 A;  3F1O B;  3PBO A;  4G3K A;  1G68 A;  4KZ4 A;  5M18 A;  1ESI A;  3KWQ D;  2WZZ A;  4YM6 D;  4WM9 A;  2OV5 A;  1HTZ A;  5CPK A;  5AY8 A;  3X1S D;  1H8P A;  5EEC A;  4OP5 A;  5AV5 C;  3X1V A;  1H0G A;  4QY6 A;  3SH7 A;  3T1Q B;  3IF6 A;  4PAU A;  4DMZ A;  4NE5 A;  3HLE A;  2XH9 A;  4RX2 A;  5EVE A;  2R9X A;  3G34 A;  4PHT A;  3B0C W;  3KUY A;  1P3M B;  3PAG A;  2Z2L B;  3NEC A;  1M1A B;  1XA1 A;  3A0V A;  5L07 A;  1S67 L;  1K6R A;  4NY2 A;  2WGW A;  1P3L A;  3S7O A;  1ED7 A;  4LPZ A;  2VGK A;  2HP5 A;  4WEK A;  3B6F A;  1GSW A;  4JF5 A;  4MLL A;  1P3M C;  3L26 A;  1P3F A;  4QPR A;  3MGQ B;  2O9C A;  1M1A C;  4N9K A;  1ULY A;  2K7S A;  1FQG A;  2OOL A;  3ZNT A;  1STZ A;  3WTP A;  3D9Y A;  5AJG A;  3O62 A;  5CXW A;  2PR6 A;  3AZJ C;  1P3M D;  4Y13 A;  1PNE A;  1Q2Q A;  1KE0 A;  1XFQ A;  5F99 B;  3S4X A;  4Y5F A;  3AZI B;  3TRC A;  1LSV A;  2B02 A;  1M18 A;  5HDD A;  2CV5 B;  1KX5 C;  1HZO A;  2P9V A;  4HGA C;  1B6W A;  3MGQ D;  3LZ0 B;  1TDL A;  5TBM B;  1QMF A;  3N8L A;  1P3A A;  5CHJ A;  2BYM B;  4KZA A;  4BWI A;  2CV5 C;  3IWQ A;  1JNU A;  2W3H A;  4I39 A;  2YKH A;  2PYR A;  3I7J A;  4MDZ A;  2LY8 A;  1LLB A;  2EWW A;  5FAS A;  2XD5 A;  1XJ2 A;  5DTT A;  5FEF A;  3LY4 A;  5F99 D;  4KHA A;  5HL6 A;  3LR0 A;  3AZI D;  3GSG A;  2HF6 A;  4P6B A;  2Y2O A;  1GOI A;  5GLA A;  1AOI C;  1P3P B;  1CI9 A;  3H0M C;  2ZOH A;  1SDN A;  5FQJ A;  5CGX A;  3ZQ5 A;  4YFM A;  1L0G A;  5AQ7 A;  4BQM A;  3G35 A;  3IH8 A;  3P09 A;  4QD4 A;  1S32 B;  3CAX A;  3LZ0 D;  2I9V A;  4E04 A;  1N1J A;  3V3S A;  1W7F A;  5FDH A;  4BD0 A;  3R45 A;  5FA7 A;  3AZH B;  1S0W A;  5FI2 A;  4ZUX D;  1W2E A;  3IP4 C;  1OGB A;  3KS8 A;  3WKJ D;  4GN2 A;  4X23 B;  3HLW A;  1QME A;  3MS6 A;  5TFQ A;  2YFV B;  3HLF A;  4J8W D;  2EFU A;  4EBL A;  3W99 D;  1S32 C;  2V8C A;  4HQA A;  3REJ C;  4S2K A;  3QP1 A;  4DQY B;  5B0Z A;  4CSR B;  2JCH A;  1P3P D;  3KFU G;  1KE4 A;  5DJU A;  5BNX A;  5E5A C;  5BO0 A;  3B6G A;  1ZC2 A;  2RL3 A;  5FI6 A;  4JJN C;  1UGU A;  4E3J A;  3V3R A;  1S4R A;  5DNN B;  1S32 D;  2Q9M A;  3IQA A;  4GHI A;  3H0L C;  3ISG A;  1P0Z A;  4HBT A;  3C1C A;  2R78 A;  3AZH D;  1CEF A;  4IUH A;  5DF8 A;  1ALQ A;  4XUX A;  1KS0 A;  5DFX A;  4X23 D;  1TZY A;  3CI6 A;  3HVF A;  4R3A A;  4UUZ A;  3WAA A;  4S2J A;  3CUE A;  4XT2 A;  1UR9 A;  3REL D;  4MB3 A;  4J8X D;  2PYO D;  4Z2H A;  4BJP A;  4N92 A;  4Z66 C;  3W2Z A;  1NWZ A;  3HLD A;  4U3T A;  3W4O A;  3REH D;  5DNN D;  1OT6 A;  3MSH A;  3X1U B;  1KOU A;  4Y7P A;  2UV0 E;  5KMW A;  3VP3 A;  4M3K A;  5FAT A;  4NYY A;  2VV6 A;  4GKU A;  3EEA A;  4H9R A;  1BLP A;  5IT5 A;  4KZ9 A;  5G49 B;  5A92 A;  4LV1 A;  2DF4 C;  2QJ5 A;  4ZTK A;  4YM6 A;  4II7 A;  4GCZ A;  3X1S A;  3LO7 A;  3HJK A;  4FUW A;  3AN2 B;  5FI7 A;  5HAQ A;  2Y2M A;  1ZLA B;  3AZG B;  2HV1 A;  3OBF A;  2JKT M;  2XLN A;  3S7Q A;  1CQA A;  4LCL A;  5B33 C;  4Q8I A;  3LZ1 C;  3OOV A;  3X1U D;  2PU4 A;  5DTS A;  5CED A;  3S22 A;  1YMS A;  3QP8 A;  4KZ5 A;  1MWS A;  4H6J A;  3AN2 C;  1NXY A;  1ZLA C;  3AZG C;  5FL3 A;  2XF3 A;  2P04 A;  4Z1W A;  2W3D A;  5GL9 A;  3MVD C;  5JRG A;  5CP6 B;  4WU9 C;  2GDN A;  2PU2 A;  3D3O A;  3ICY A;  3VP0 A;  3FPV A;  5BS7 A;  3MXR A;  1YLP A;  4MN5 A;  4OOL A;  4HP9 A;  4EQ1 A;  1P3O D;  1M40 A;  4RQ9 A;  3ZNY A;  5BNV B;  5GHX A;  3A3F A;  2KDK A;  4IBI A;  1YMX A;  2VKS A;  3A3E A;  1BYW A;  3NQJ A;  1KX4 A;  3FG8 A;  3RJU A;  3BQA A;  3DTE A;  4R0Q A;  4MNR A;  5DF7 A;  1ID3 B;  5CP6 D;  2Y91 A;  3WS2 A;  3AV1 C;  4AWL B;  5E2H A;  4CLC C;  5FQI A;  4E3N A;  3TU4 A;  3UE1 A;  3UDF A;  3PR6 A;  1AIW A;  3UY6 A;  1ES3 A;  1FSW A;  1TS6 A;  1C3B A;  4J8U A;  2O99 A;  5BT1 D;  1E6N A;  1Z6F A;  1K55 A;  1X0O A;  4S2P A;  3C1B A;  3IHA A;  3C7U A;  1OTA A;  1IYS A;  3AZI A;  3AZL C;  2W3E A;  3GEC A;  3WD4 A;  3CHW P;  1ID3 D;  5AQA A;  4G92 B;  3HL9 A;  5EVL A;  5J8X A;  3UME A;  3BY9 A;  5A91 A;  1P97 A;  3VP1 A;  5CGW A;  3KSY A;  5FDS A;  2Z6C A;  1ZHH B;  2W1R A;  2CC1 A;  4PKY G;  3UDI A;  2F8N H;  4TX8 A;  1PWD A;  1YU0 A;  4GS9 A;  4IJG A;  5B1L C;  1F66 C;  4Z2K A;  2HJE A;  4ZUX A;  1W5D A;  3Q1F A;  3WKJ A;  2J3T C;  3QP4 A;  3K3C A;  2B5R A;  3EG5 B;  4IBJ A;  3VH6 T;  4J8W A;  1FOF A;  2V2F F;  3W99 A;  1O7E A;  5G18 A;  2ZJ9 A;  1P34 B;  1LI0 A;  1WA9 A;  2V0U A;  4HIA A;  5J3W A;  2A49 A;  3UT9 A;  4YS3 A;  4FD8 A;  3HON A;  3TE8 A;  4OVD A;  1BFM A;  5DKL A;  4NZ4 A;  2Y79 A;  3WRT A;  4OLG A;  2P7J A;  1SKF A;  4JGP A;  2JBF A;  1K56 D;  2JC7 A;  3JYI A;  3LUQ A;  3H7W B;  1OT9 A;  4ZBJ B;  3W98 B;  1MKM A;  3ZVW A;  4XUJ A;  1TS0 A;  3AFA A;  5KZH A;  3REL A;  1P34 D;  5CPK B;  5AY8 B;  4J8X A;  2PYO A;  4LCM A;  2BG1 A;  1U60 A;  3AZK D;  3DAV A;  2B18 A;  3X1V B;  1PI5 A;  3MKE A;  5EVI C;  3W98 C;  3WRZ A;  3IF6 B;  1ZTU A;  3REH A;  2O9A A;  2XD1 A;  5F83 A;  4ZBE A;  3N4I A;  5C3I C;  1IEM A;  3NQU A;  2HIO A;  1YM1 A;  3KSI A;  2WGW B;  4M4X A;  3X1V C;  1P3L B;  4ZAM A;  3HLG A;  5E2F A;  5E2G A;  2W1T A;  2QMI A;  3IF6 C;  5HL1 A;  3MZE A;  5F5Y A;  3B6F B;  3HUN A;  3IS2 A;  3ZDJ A;  1Q9C A;  4DJ2 A;  1BH8 A;  1ONH A;  5TR7 A;  3KUY C;  1IYQ A;  1P3F B;  3IX4 A;  1G6O A;  4OKP A;  2PD8 A;  5CPK D;  5AY8 D;  3CIT A;  3ZG7 B;  2ZQC A;  3FWL A;  5AVB A;  1LI9 A;  1Y4O A;  3Q7V A;  3LEQ A;  3WTP B;  4WLA A;  3QHY A;  4S2N A;  3O62 B;  3F1P A;  3LEL A;  3B6F C;  3IX3 A;  5A90 A;  2V8F A;  4R8P C;  4QJG A;  2WAE A;  3X1U A;  1P3F C;  1V9Y A;  3AV2 A;  2WGI A;  4XZQ C;  1M18 B;  2Z2M B;  1P3L D;  1PYY A;  3WTP C;  1E6R A;  4KG6 A;  4WN5 A;  3B6F D;  3T4Q A;  5G49 A;  2HDU A;  2P9V B;  4H9P B;  3RXW A;  1XPB A;  4UEY A;  2FFF B;  3O88 A;  1P3K D;  1U35 B;  1P3A B;  3NBL A;  1P3O A;  4EXO A;  4XUZ A;  3B0D C;  4HMC A;  4CAY A;  1HVB A;  2HDQ A;  3O62 D;  4L0L A;  4K91 A;  1DP6 A;  1TD5 A;  2ACG A;  5KSH A;  4NET A;  5AV8 C;  4X55 A;  4Z2M H;  4JKT A;  5G4Y A;  5I5L A;  4KHA B;  1XGJ A;  3B33 A;  5B0Y B;  1M18 D;  4JPM A;  3UO9 A;  4IBD A;  3EPJ A;  3K2N A;  5B31 A;  5B2J C;  3HJI A;  2Z6D A;  2XSS A;  1BT5 A;  4PM6 A;  5J7E A;  4GZB A;  3E4P A;  1N1J B;  4EUZ A;  1U35 D;  1P3A D;  2ARO A;  1SDE A;  3R45 B;  2IWB A;  4IBC A;  3WA9 A;  1WWI A;  3F1N A;  4FCF A;  1LHY A;  3O3V A;  5GT3 C;  5HWV A;  2FJ7 A;  3B3X A;  1E88 A;  1OTI A;  1YLW A;  1YQS A;  4QLC A;  1FCN A;  1FCM A;  1XGI A;  4OJ6 A;  1XJ4 A;  3PBQ A;  5B0Y D;  2Y8H A;  1S1Z A;  5B0Z B;  5CPJ C;  4ZJ3 A;  5BNX B;  5BO0 B;  4Y0O A;  3B6G B;  3HCY A;  2A2L A;  4RX3 A;  2GX5 A;  4GHI B;  2VV7 A;  4UA7 A;  4H9Q A;  2D49 A;  3NHQ A;  3T4T A;  4P85 A;  4GH9 A;  5J4E A;  2ZMA A;  3C1C B;  3C8C A;  3A3I A;  4FOF A;  3ZHH A;  5U47 A;  3LI9 A;  1ONG A;  1NZU A;  1N4O A;  4EW7 A;  5DF9 A;  1RGY A;  3B6G C;  4X69 A;  1TDG A;  1TZY B;  2OAP 1;  1W1T A;  2WUQ A;  4UUZ B;  3WAA B;  3REK A;  5GLC A;  3HRE A;  3Q81 A;  4XT2 B;  2HP9 A;  2ZQ9 A;  3MBZ A;  4HHD A;  5EE8 A;  3KYQ A;  1XJ3 A;  3VMA A;  1P9W A;  2BAS A;  3AGE A;  1G28 A;  5B0Z D;  1BLS A;  4ID4 A;  3IT9 A;  4GHL A;  4OJL A;  1JTD A;  4NK3 A;  3T4L A;  4EES A;  3FDD A;  3M6H A;  1TZY C;  4IJF A;  1MWR A;  3REI C;  2HJ9 C;  1P3G D;  3CUE C;  3O86 A;  2H5S A;  1OTE A;  2PHY A;  1H0M A;  2PD7 A;  3VP4 A;  3C1C D;  2ZD8 A;  1RCJ A;  1ERO A;  3AGD A;  4BBU A;  5DTK A;  3LIC A;  4H9R B;  3WAA D;  3V9R A;  3DWZ A;  2KX6 A;  4F3L A;  1DP8 A;  3UPP A;  3W4P A;  4YM6 B;  3V67 A;  4KUD A;  3VOL A;  1KGE A;  4YIN A;  3AZK A;  4CPK A;  2Q0O A;  1A0K A;  3TSG A;  3MKF A;  5FUG A;  4GHA A;  2V20 A;  1ZKJ A;  3PHY A;  4Y17 A;  1E4D A;  1A7W A;  3KWQ C;  4ZJ1 A;  5AV9 A;  1PZO A;  4YM6 C;  3E98 A;  3X1S C;  1GHM A;  2ZBB A;  4H6J B;  2IO5 B;  3W97 D;  3NIA A;  4C3Q A;  2WAD A;  3Q7Z A;  4KZ8 A;  2HDR A;  3AZF D;  5M19 A;  3G2Z A;  2XFS A;  5JRG B;  3RH8 B;  1PDC A;  2HZ5 A;  4MEZ A;  3U4L P;  3NI9 A;  4H9O A;  2ZM5 A;  4I3J A;  3QNB A;  3VOY A;  2C6W B;  3SS5 A;  2IO5 C;  4IBX A;  2VGL M;  2FZ0 A;  2X02 A;  1Y54 A;  4ARZ A;  4WU8 D;  4K0X A;  1HQ3 A;  1D1J A;  3FYZ A;  3C38 A;  4BL2 A;  3GMW A;  3L9K A;  1UWN X;  3G32 A;  3NQJ B;  4GD6 A;  3IHB A;  4KZ6 A;  4X1L A;  3VH5 T;  1KX4 B;  3GTC A;  3DBA A;  5B32 A;  1HTA A;  1XA7 A;  3IH9 A;  3BWL A;  1XP4 A;  3NY4 A;  5HX9 A;  3BM6 A;  5JRG D;  3QP2 A;  4Z2I A;  3TU4 B;  2VGL S;  4HME A;  4G91 B;  4WZ5 A;  1T3U A;  3KX0 X;  2EX6 A;  4UQI M;  1P3K A;  2LB9 A;  3V50 A;  1F98 A;  4J8U B;  3MJQ A;  4H9S A;  3AYW A;  3C1B B;  4RVA A;  1BUE A;  4UHU A;  2KOI A;  4RYE A;  3MGQ C;  1KX4 D;  4OJO A;  1JWP A;  3T1S A;  1K25 A;  3OPL A;  4OLD A;  4Z5T A;  2V1B A;  4UQI S;  3Q07 A;  4NYU A;  1XFN A;  5B31 G;  3TU4 D;  1K55 C;  4JLF A;  1L3L A;  4H9P A;  3O5Y A;  4GDB A;  5HAI A;  2OAQ 1;  5B40 A;  3WTP E;  5F99 C;  3AZI C;  3C2W A;  1U35 A;  4GS9 B;  2OWH A;  1G6A A;  4ZUX B;  4J8U D;  3EPH A;  3WKJ B;  3NOP C;  5B2I D;  3N8R A;  1H8M A;  3C1B D;  2RCX A;  4J8W B;  3W99 B;  2VLG A;  3LZ0 C;  2PBY A;  5B0Y A;  1JFI A;  2JSS A;  4JF6 A;  3LIA A;  3UT9 B;  3KSG A;  4ZUX C;  4YS3 B;  3D4F A;  3WKJ C;  4CJN A;  4J8W C;  4HBU A;  3W99 C;  3SS3 A;  2PYP A;  4HY8 A;  4PKY A;  4YWZ A;  2EA9 A;  1KVL A;  3TW8 A;  3W96 A;  1NLY A;  3EPK A;  3ZG8 B;  1P3P C;  3BRM A;  2GJ3 A;  5TGF A;  1IYO A;  2VZW A;  2Y2H A;  4XUJ B;  2JKG A;  4IBF A;  1DP9 A;  1PRQ A;  3AFA B;  4D2O A;  5CTM A;  3REL B;  4OJP A;  3EQV A;  4IED A;  1YKD A;  3AL0 C;  4J8X B;  3UTB D;  2PYO B;  2OLU A;  3MF0 A;  2G2W A;  1GSX A;  3E4Q A;  5B24 D;  3AZH C;  3UT9 D;  1GXD A;  4YS3 D;  4MN6 A;  3GR2 A;  1OJG A;  1NRF A;  4X23 C;  3FKW A;  2B95 A;  3UB9 A;  3REH B;  3FV7 A;  4N1H A;  1P3G A;  3REL C;  1LL9 A;  3NOU C;  3H0R C;  3ZVT A;  4J8X C;  3NQU B;  2PYO C;  5CX7 A;  2HIO B;  3IXB A;  4R6L A;  1KGF A;  3N6I A;  3JVU A;  2W1T B;  1TF1 A;  3Q82 A;  4XUJ D;  3IS2 B;  3AFA D;  4OP8 A;  1BH8 B;  3REH C;  5DNN C;  2GNX A;  1M19 A;  3KO6 A;  2J9O A;  3KXB A;  3MGR A;  3ZG5 A;  3L28 A;  1N9B A;  4QNL A;  1XJ6 A;  5AVB B;  3NOT C;  2HIO C;  3Q7V B;  1BH9 A;  4E3L A;  4MBK A;  4EBN A;  2W3F A;  1W63 Q;  5GT0 A;  3WD2 A;  1H3Q A;  4LRZ E;  3F1P B;  3LEL B;  1FSY A;  4HJ3 A;  1PFL A;  5GLD A;  1MWU A;  3RXX A;  4DDS A;  3AV2 B;  4Y0T A;  2HIO D;  3W97 A;  1SKO A;  3GVB A;  4L9E A;  4GW9 A;  3NC8 A;  4B88 A;  5KSC A;  3AZF A;  3JPU A;  4S2N C;  1NYM A;  3ZCZ A;  4WNN A;  2D01 A;  2M7V A;  4E44 A;  3X1U C;  4IVK A;  2NUT C;  4I38 A;  3AZM A;  1L6J A;  3E2L A;  5AVB D;  1K54 A;  1P3O B;  2FN2 A;  5JYO A;  5G4Z A;  2PAV P;  3X1T A;  2XGN A;  2XRO A;  1BSG A;  4NKP A;  4WU8 A;  4CAY B;  5HWT A;  4G3W A;  2ZQ7 A;  4NZ3 A;  3LEL D;  4OQI A;  3LGO A;  4Y15 A;  3FKV A;  3EPL A;  5GSU A;  1L2S A;  1I2S A;  5FSR A;  2F2A C;  3AV2 D;  2E8I A;  3CLO A;  5CEB A;  2UWX A;  5B32 G;  1OTD A;  3A3J A;  1H3O A;  1P3O C;  2H0T A;  2V1Z A;  3U2A A;  1P3B B;  4DF6 A;  5B31 B;  1YLJ A;  1T1C A;  1YT4 A;  4QY5 A;  3T4J A;  2HP6 A;  1IFQ A;  2L0W A;  4CQH A;  5TJJ A;  4LV2 A;  4OQG A;  4Q0J A;  3M6B A;  1BUL A;  1YSP A;  2ARO B;  3CMZ A;  4MB5 A;  4D60 A;  2JE5 A;  3WA9 B;  2Y59 A;  3F1N B;  4H9N A;  5AV5 A;  4KGC D;  2NUP C;  1VHM A;  5CP6 C;  3RFB A;  2FJ7 B;  5CHL B;  4QLC B;  2W3G A;  3E0Y A;  3FPW A;  3A6N D;  2JHE A;  1WE4 A;  2L1M A;  3BFC A;  1IKG A;  1KU5 A;  3A1I A;  3IX8 A;  3UPO A;  2ZC4 B;  3BJN A;  3OC2 A;  4IHQ A;  1P3B D;  3UPN A;  5B31 D;  4OON A;  5BT1 C;  4BBT A;  1P3I B;  2WYX A;  2FJ7 C;  1D06 A;  3IF5 A;  3JVV A;  4IJE A;  5L09 A;  1OTB A;  1PZR A;  2ZL1 A;  4H9Q B;  2WKP A;  4LGW A;  1E6P A;  2LB5 A;  2ARO D;  1SZV A;  3WA9 D;  2VV8 A;  4BMW A;  2CWE A;  1ID3 C;  5FAP A;  3AGF A;  3MGP B;  3DTI A;  3VOZ A;  5B2I A;  4AWL C;  2FJ7 D;  3KS4 A;  3REK B;  4QLC D;  3M7P A;  4NZ1 A;  4UA9 A;  1JVJ A;  3L29 A;  2PR5 A;  3AZJ A;  1N9L A;  1IKI A;  1W79 A;  3VH6 W;  4LD9 D;  2DQN C;  5FQK A;  2Y2P A;  2QWS A;  3C7V A;  3DWK A;  3RTY A;  1P3I D;  2YFW A;  1GHI A;  3BFE A;  1ES4 A;  2QKP A;  1DY6 A;  3AZE A;  4KZB A;  2OLV A;  4G92 C;  3MGP D;  4EEU A;  3V9R B;  3REK D;  3UB5 P;  2M7U A;  4F3L B;  4Z9Q A;  3CG5 A;  4R70 A;  4U0X A;  3T50 A;  1NRJ A;  4KQD A;  3GV9 A;  5AVE A;  4HJ4 A;  2ZMF A;  5HPI A;  4WMC D;  4KUD B;  3IXG A;  3UTB A;  5AVC D;  3AZK B;  5LBR A;  5B24 A;  1TS8 A;  1AOI A;  3BEC A;  5FUG B;  1UWP X;  4UPK A;  1YU3 A;  3LCE A;  3LID A;  4PPR A;  5KDM A;  4E6X A;  1OGG A;  3S7N A;  3WS4 A;  5AV9 B;  1P34 C;  4OOM A;  5FEG A;  2W27 A;  3VSK A;  3AZK C;  3D72 A;  3T1R A;  1L0D A;  3LFV A;  4N9L A;  2ZM8 A;  4DJ3 A;  5HZH A;  1I2W A;  1V9Z A;  4B4Z A;  5AV9 C;  1Q2P A;  4H9O B;  4KUD D;  5F69 A;  3M2K A;  3HLC A;  3PBN A;  4S2M A;  1K38 A;  3REJ A;  2ZQD A;  3TJZ C;  4ZBJ C;  4ARZ B;  2XFT A;  5E43 A;  3BYD A;  1HQ3 B;  3LIE A;  2KLI A;  5E5A A;  1ESU A;  3TG9 A;  4JJN A;  5AV9 D;  1KGG A;  4OPY A;  4HP4 A;  5CPK C;  5AY8 C;  5B32 B;  3N3F A;  1VQQ A;  3H82 A;  3G31 A;  2AVX A;  1FIL A;  3PBR A;  2ZY4 A;  5F1G A;  2Y55 A;  1KX3 A;  4GNU A;  1K57 A;  4JGR A;  3MQO A;  5DKK A;  1I5Q A;  3AZN D;  1H5X A;  1P3K B;  3WS1 A;  1P3L C;  2Y2L A;  4X25 A;  4O0P A;  3CJM A;  1HQ3 D;  4Z66 A;  4WEJ A;  3AYW B;  3C30 A;  4X6T A;  3EEH A;  4HEF A;  1EQZ D;  1PW8 A;  3K3D A;  3T4O A;  4WZ5 C;  4Z2G A;  3VH6 A;  5B32 D;  2G7U A;  4FH2 A;  5DNM D;  3GQZ A;  5AV6 B;  1P3K C;  4L9F A;  4EEP A;  3VSL A;  1GSV A;  4J8V D;  4R3B A;  2QPN A;  3ZYT A;  4DN0 A;  3DTK A;  1FCO A;  4BL3 A;  4LFU A;  1D7E A;  4Z5T B;  2V5O A;  4OPZ A;  3O62 C;  2ZC6 B;  5KIZ A;  4JXS A;  3MXQ A;  5CPI D;  3NCK A;  2JN7 A;  5DFY A;  5B40 B;  3BQ8 A;  1JTG A;  3B47 A;  4O01 A;  2NQB D;  1M18 C;  1MC0 A;  5EM1 A;  2F8N G;  1NYY A;  3VP2 A;  3B0B A;  3ULF A;  1OPX A;  1S1Y A;  1J7M A;  4E3O A;  4KGC A;  3MZD A;  3AYW D;  3A0S A;  5B33 A;  2RTS A;  3LZ1 A;  4UA6 A;  1PIO A;  3A6N A;  5GHZ A;  5AV6 D;  3WWX A;  2VA0 A;  1JFI B;  1U35 C;  1P3A C;  4NEE D;  4Z5T D;  1P3B A;  1GA0 A;  3WS5 A;  4DRB A;  1RP5 A;  1ZG4 A;  3MXS A;  3OCN A;  5GXQ D;  4MBH A;  4KQR A;  3MVD A;  4WU9 A;  4P0M A;  5HDS A;  5B40 D;  1O6I A;  1Y28 A;  2RVQ D;  4S2O A;  3W96 B;  3T4S A;  5B1M D;  5B0Y C;  3P98 A;  3UMD A;  4DE3 A;  1GCE A;  2XA7 M;  4QU3 A;  2G2U A;  2PBD P;  3R7W A;  1NZO A;  3BFF A;  4PM8 A;  4WZ4 A;  5HWW A;  2A24 A;  4HNB A;  1XXM A;  4LD9 A;  2VGJ A;  3W4Q A;  2L4R A;  3QNC A;  3LYX A;  1DJB A;  1P3I A;  2M1C A;  1CJF A;  2XA7 S;  4WF0 A;  1P3G B;  4CLC A;  3E2K A;  3MGS D;  3AV1 A;  4JXW A;  2ZOI A;  4NXE A;  2DMW A;  3W96 D;  2Y2G A;  5B0Z C;  1VEU A;  1ZG6 A;  1NJ4 A;  1LL5 A;  3MGP A;  1MZU A;  4ESP A;  2H10 A;  1P3G C;  1M19 B;  3KXB B;  4C75 A;  1EI5 A;  3MGR B;  4WMC A;  3FZC A;  5AVC A;  1W1V A;  3CWF A;  3C1C C;  1BH9 B;  3AZL A;  2ZC7 A;  5GT0 B;  1GPF A;  1F5M A;  3WD0 A;  3WAA C;  1K0K A;  4FSF A;  4LLO B;  5CGS A;  2HUE B;  4E45 A;  1K4F A;  5EFW A;  3T12 B;  3UTA A;  2GZA A;  3W97 B;  3LJA B;  1SKO B;  2FH5 A;  1J9M A;  3T1X A;  4PMA A;  3MNN D;  3AZF B;  5B1L A;  1F66 A;  2X01 A;  4WNN B;  4MB4 A;  1M19 D;  3KXB D;  4K0W A;  3EGX C;  3AZM B;  3MGR D;  2OSU A;  4O8G A;  1GA9 A;  3W97 C;  3EGD C;  3IWI A;  2PDR A;  3B42 A;  3X1T B;  3ZGA B;  5GT0 D;  2IA2 A;  4WU8 B;  2YKF A;  4S2I A;  5CEC A;  3AZF C;  1TAF A;  2PRF A;  5GSU B;  3PYP A;  4Z2M G;  1VB6 A;  4E3M A;  5HFO A;  1QO6 A;  2HDS A;  3LJA D;  1H3O B;  1R4V A;  2J80 A;  4WU8 C;  4Z2J A;  3ZG9 B;  1AXB A;  1HD8 A;  4KG2 A;  1XX2 A;  2WAF A;  1LSX A;  2J7V A;  3AZM D;  3AZN A;  1OME A;  4DRT A;  2F8N B;  3MQ0 A;  2VK3 A;  1L0F A;  3X1T D;  3CPT A;  4H9N B;  5AV5 B;  1B67 A;  2L5A A;  5JRG C;  5EVI A;  1YUE A;  5BS7 C;  3EQU A;  1EQZ A;  1W1P A;  3NDG A;  5GSU D;  2V0W A;  3LEZ A;  2NZD D;  1AWI A;  4NXB A;  5DJT A;  4KQQ A;  5DNM A;  5EUA A;  2IWD A;  4ZJ2 A;  3VE4 A;  4DXB A;  4EV4 A;  1G5U A;  4J8V A;  1EW0 A;  4X1M A;  4EET B;  1ERM A;  3VFH A;  2Y4A A;  2IWC A;  2WGV A;  5EPH A;  3IWO A;  2I72 A;  4PM7 A;  2ZMV A;  5CPI A;  4EER A;  5JA4 A;  1KX4 C;  2ZL1 B;  4LG2 A;  2BYK B;  2F8N D;  1OJ5 A;  2NQB A;  3L27 A;  3OCL A;  5AV5 D;  4R1G A;  4WEL A;  5B2I B;  3ITA A;  3TU4 C;  4JGQ A;  4G91 C;  1SHV A;  1TVF A;  4HH2 A;  3AZJ B;  4R8P A;  1CEG A;  5AV6 A;  3C4O A;  2BLS A;  4EU0 A;  2WKI A;  4NFT A;  4XZQ A;  1YU2 A;  1K6S A;  4J8U C;  4L9G A;  3B0C T;  1PWC A;  5B2I C;  1VET A;  2A3U A;  5GXQ A;  2YFW B;  3C1B C;  1KX5 B;  2J8P A;  2QZ6 A;  2Y2N A;  3NJA A;  4HGA B;  1NLZ A;  4WBG A;  5B1M A;  3BFD A;  3AZE B;  1M1A D;  4O7D A;  1K4E A;  1PZP A;  4ZDX A;  1NY0 A;  5DVA A;  2E8J A;  3AZJ D;  1IYP A;  1S66 L;  5AV8 A;  3DW0 A;  3UTB B;  3AZE C;  4Q0H A;  1E8B A;  1T1B A;  5B24 B;  4OJ5 A;  1E3U A;  4PM5 A;  3TOI A;  1AOI B;  1JWV A;  5EV0 A;  1KX5 D;  1KDS A;  5KDM B;  3MGS A;  5B2J A;  5BPV A;  3UTB C;  3VH5 A;  3AZE D;  5EM0 A;  4WJ3 C;  5B24 C;  3UT9 C;  4YS3 C;  1PW1 A;  2CV5 D;  4HJ6 A;  1H0I A;  5GT3 A;  4ETX A;  3N7W A;  3HUM A;  2ZLY A;  2DRW A;  2WKR A;  1PI4 A;  3REJ B;  1AOI D;  5CPJ A;  4XUJ C;  1ERQ A;  3P01 A;  5HAP A;  1BZA A;  5E5A B;  3AFA C;  2H28 A;  1N9N A;  2ZC3 B;  4JJN B;  4IBE A;  4OOY A;  2HPB A;  5EOO A;  3G6O A;  1MKI A;  3H82 B;  4QB8 A;  2H0Y A;  3PBS A;  1WYC A;  4JBF A;  3GDI A;  2O0Y A;  5A8B A;  3MNN A;  2WKQ A;  2QYB A;  2XRN A;  3OLO A;  2XEP A;  1KX3 B;  4HOI A;  4NE3 A;  3ZG0 A;  1Z2C B;  2J9P A;  4IVI A;  4UAA A;  3REJ D;  2C5W B;  5L2F A;  2EXB A;  4Z66 B;  5E5A D;  3S7P A;  4JJN D;  1KX3 C;  2EWV A;  3REI A;  1K57 C;  4X53 A;  1P9R A;  3BFG A;  5AVB C;  3LJA A;  3UE6 A;  1YU1 A;  2J8Y A;  1YLZ A;  3KYZ A;  2D02 A;  2QJ7 A;  3IBJ A;  2Y2J A;  3PTE A;  3LEL C;  4WYY A;  4HH3 A;  2HGV A;  4Y3I A;  1KX3 D;  1T19 A;  2WZX A;  3AV2 C;  1FIK A;  4NXG A;  4WV4 B;  3A1K A;  4KGC B;  2K2N A;  4Z66 D;  4EBP A;  2WK0 A;  2JKR I;  4RA7 A;  5K5B A;  5B33 B;  4WL9 A;  3MQQ A;  2EXA A;  3LZ1 B;  3MR0 A;  2NZD A;  4JGO A;  3A6N B;  1W8Y A;  2F8N K;  1GHP A;  4B4X A;  3KWQ A;  4YOF A;  5FQM A;  4P87 A;  3LY3 A;  3P7N A;  1W1Y A;  4KQO A;  4KGC C;  1F2K A;  4FH4 A;  1RGZ A;  4HMD A;  3PXP A;  4HI4 A;  1O07 A;  3MVD B;  4WU9 B;  5F1F A;  1LSW A;  3A6N C;  2F8N A;  2Q9N A;  1TEM A;  2P74 A;  5HDC A;  3VV4 A;  3E4O A;  4YNR A;  1P3B C;  3QP6 A;  1J3W A;  5B31 C;  1YLY A;  3R7W B;  4EO5 B;  3F1O A;  1IOU A;  5B33 D;  3BY8 A;  4GLQ A;  1MY8 A;  2ZQ8 A;  3LZ1 D;  1MPL A;  2A24 B;  3O87 A;  2DNS A;  2ARO C;  4LD9 B;  3WS0 A;  2P08 A;  3WA9 C;  4OPQ A;  3AN2 D;  1ZLA D;  3AZG D;  5A93 A;  4EO5 C;  1F1E A;  4WU9 D;  3MVD D;  4KUO A;  4QLC C;  4CLC B;  3AV1 B;  4WUJ A;  1P3M A;  1VM1 A;  3T4K A;  2BYK A;  1BTL A;  2PT7 A;  4LD9 C;  1M1A A;  4X68 A;  1VEU B;  2XR0 A;  2K31 A;  4MBF A;  2QHK A;  2X71 A;  4S2L A;  1YSQ A;  1P3I C;  3L7H A;  5CTN A;  2DCF A;  3HBR A; 
#chains in the Genus database with same CATH homology
 2WKH A;  2RIQ A;  4JXG A;  4JXV A;  5CHM A;  5AVC B;  3MGQ A;  4Y0U A;  2EX8 A;  3AZL B;  5CRF A;  3ZFZ A;  5F82 A;  1S6R A;  3MGP C;  4OQH A;  2G5I C;  3V39 A;  2ZM0 A;  2VQR A;  4X56 A;  3PBT A;  1KX5 A;  3REK C;  1DJC A;  3AV1 D;  2Y2K A;  3DTM A;  3UTA B;  4DKI A;  3CZD A;  5AVC C;  5F99 A;  3IXD A;  2ZQA A;  3C5A A;  4BD1 A;  3SH8 A;  5GHY A;  2CV5 A;  5B1L B;  1F66 B;  3BEB A;  1L0E A;  3SOI A;  3UTA C;  3LZ0 A;  3AZL D;  5M1A A;  4GD8 A;  2BYM A;  2ZC5 B;  3UNW A;  1TAF B;  1MBL A;  4R23 A;  4NE6 A;  1ES2 A;  4NZ5 A;  3UTA D;  3C4P A;  4KUD C;  5HAR A;  1P3P A;  5B1L D;  1F66 D;  5AQ9 A;  5HW3 A;  3OPH A;  1CI8 A;  3AZN B;  1S32 A;  4GOG A;  4KZ7 A;  1YLT A;  4R3J A;  2ZY5 A;  1MWT A;  5D3O A;  4E3K A;  3AZH A;  5EVI B;  5JYP A;  1DJA A;  4LV0 A;  4X23 A;  1EQZ B;  2YFV A;  4DXC A;  4OH0 A;  3G4P A;  3PAE A;  5DNM B;  3AZN C;  1BLH A;  5C3I B;  4R4R A;  4J8V B;  4CSR A;  1HQ3 C;  2G5H C;  1W8Q A;  5E2E A;  5CPI B;  3V5M A;  4M6B A;  1EQZ C;  4DE1 A;  4IBG A;  4H8R A;  5JA4 B;  5DNN A;  5B32 C;  3KUY B;  5DNM C;  2NQB B;  4EWF A;  4KEN B;  4J8V C;  4GB7 A;  4GDN A;  5EVI D;  1IEL A;  1JWZ A;  3W98 D;  3S1Y A;  4A5R A;  5CPI C;  1CK3 A;  4R8P B;  2NQB C;  3NDE A;  4C6Y A;  4XZQ B;  3A3D A;  3X1V D;  5GLB A;  2ZY2 A;  4H9S C;  3AYW C;  5GXQ B;  3IXH A;  1ES5 A;  1BLC A;  3VFF A;  3KUY D;  3MZF A;  4OPR A;  5AV6 C;  4OUI A;  5B1M B;  1SCW A;  1M6K A;  2FFY A;  1YU4 A;  4Z5T C;  4PM9 A;  3M2J A;  3B0D B;  5GXQ C;  3N8S A;  4LV3 A;  1EWZ A;  1FR1 A;  5B40 C;  4R8P D;  5AV8 B;  2W8S A;  1E25 A;  2EX9 A;  2RVQ C;  1P3F D;  5B1M C;  5AQB A;  4XZQ D;  3AN2 A;  1ZLA A;  3AZG A;  3WTP D;  3OZH A;  2EFX A;  3MGS B;  5B2J B;  4JF4 A;  4DE2 A;  5CER A;  1KDW A;  1PWG A;  3HUO A;  4DDY A;  3FKE A;  4LEN A;  3ITB A;  3GRJ A;  5GT3 B;  5CP6 A;  4OQ0 A;  3MGS C;  4HES A;  5AV8 D;  3W96 C;  1FR6 A;  4IBB A;  4DE0 A;  1E3U D;  4EQI A;  5CPJ B;  5BNV A;  5CHU A;  5FQQ A;  4U0T A;  3OPP A;  4DRA A;  3G30 A;  5B2J D;  5BOH A;  1H8Z A;  3W8K A;  1KE3 A;  4F94 A;  4N1X A;  3UE0 A;  3MNN B;  3G2Y A;  1ID3 A;  4QHC A;  5GT3 D;  4E6W A;  3WX7 A;  3L25 A;  4E3I A;  3SH9 A;  5CPJ D;  3MNN C;  2R9W A;  3UN7 A;  2WKE A;  5FQ9 A;  1WWS A;  1M19 C;  2XQZ A;  2Y2Q A;  5IHV A;  1H8Y A;  3KXB C;  3REI B;  2EX2 A;  2XK1 A;  3MGR C;  3P5J B;  4KG5 A;  2ZM2 A;  3HSH A;  5I94 A;  3SS4 A;  5GT0 C;  3B6G D;  2HUE C;  4IBK A;  4BLM A;  4WZS B;  3UE3 A;  1MXO A;  1K56 A;  3LJA C;  4KZ3 A;  3UDX A;  4XXR A;  1KVM A;  2Y2I A;  2XDM A;  1WYB A;  3OPR A;  1TZY D;  3REI D;  3AZM C;  2NZD B;  3KWQ B;  1K54 C;  1P34 A;  3MFD A;  3X1T C;  3X1S B;  5EOE A;  3VH5 W;  5FAQ A;  3BLM A;  5FAO A;  2IOU A;  1XKZ A;  2ZY3 A;  5GSU C;  3BLS A;  2NZD C;  4BEN A;  3L2A A;  4IBR A;  4R4S A;  3HLB A;  3F6T A;  3W98 A;  3PBO A;  1G68 A;  4KZ4 A;  5M18 A;  1ESI A;  3KWQ D;  2WZZ A;  4YM6 D;  4WM9 A;  2OV5 A;  1HTZ A;  5CPK A;  5AY8 A;  3X1S D;  5EEC A;  4OP5 A;  5AV5 C;  3X1V A;  4QY6 A;  3SH7 A;  3IF6 A;  4NE5 A;  3HLE A;  2XH9 A;  4RX2 A;  2R9X A;  3G34 A;  3B0C W;  3KUY A;  1P3M B;  3PAG A;  2Z2L B;  1M1A B;  1XA1 A;  1K6R A;  4NY2 A;  2WGW A;  1P3L A;  2VGK A;  2HP5 A;  4WEK A;  3B6F A;  4JF5 A;  4MLL A;  1P3M C;  3L26 A;  1P3F A;  3MGQ B;  1M1A C;  4N9K A;  1ULY A;  1FQG A;  3ZNT A;  3WTP A;  3O62 A;  5CXW A;  3AZJ C;  1P3M D;  1Q2Q A;  1KE0 A;  5F99 B;  3S4X A;  3AZI B;  1M18 A;  2CV5 B;  1KX5 C;  1HZO A;  2P9V A;  4HGA C;  1B6W A;  3MGQ D;  3LZ0 B;  1TDL A;  1QMF A;  3N8L A;  1P3A A;  5CHJ A;  2BYM B;  4KZA A;  2CV5 C;  3IWQ A;  3I7J A;  2LY8 A;  1LLB A;  5FAS A;  2XD5 A;  5DTT A;  3LY4 A;  5F99 D;  4KHA A;  3AZI D;  3GSG A;  4P6B A;  2Y2O A;  5GLA A;  1AOI C;  1P3P B;  1CI9 A;  3H0M C;  1SDN A;  5FQJ A;  5CGX A;  4YFM A;  1L0G A;  5AQ7 A;  4BQM A;  3G35 A;  3IH8 A;  3P09 A;  4QD4 A;  1S32 B;  3LZ0 D;  1N1J A;  3V3S A;  1W7F A;  5FDH A;  4BD0 A;  3R45 A;  5FA7 A;  3AZH B;  1S0W A;  5FI2 A;  4ZUX D;  1W2E A;  3IP4 C;  3KS8 A;  3WKJ D;  4GN2 A;  4X23 B;  3HLW A;  1QME A;  5TFQ A;  2YFV B;  3HLF A;  4J8W D;  2EFU A;  4EBL A;  3W99 D;  1S32 C;  3REJ C;  4S2K A;  4DQY B;  5B0Z A;  4CSR B;  2JCH A;  1P3P D;  3KFU G;  1KE4 A;  5BNX A;  5E5A C;  5BO0 A;  3B6G A;  1ZC2 A;  2RL3 A;  5FI6 A;  4JJN C;  4E3J A;  3V3R A;  5DNN B;  1S32 D;  2Q9M A;  3IQA A;  3H0L C;  3ISG A;  4HBT A;  3C1C A;  3AZH D;  1CEF A;  5DF8 A;  1ALQ A;  4XUX A;  4X23 D;  1TZY A;  3HVF A;  4UUZ A;  3WAA A;  4S2J A;  3REL D;  4J8X D;  2PYO D;  4BJP A;  4N92 A;  4Z66 C;  4U3T A;  3HLD A;  3W4O A;  3REH D;  5DNN D;  3X1U B;  4Y7P A;  5KMW A;  3VP3 A;  4M3K A;  5FAT A;  4NYY A;  4GKU A;  4H9R A;  1BLP A;  4KZ9 A;  5G49 B;  5A92 A;  4LV1 A;  2DF4 C;  4ZTK A;  4YM6 A;  3X1S A;  3LO7 A;  3AN2 B;  5FI7 A;  5HAQ A;  2Y2M A;  1ZLA B;  3AZG B;  2XLN A;  4LCL A;  5B33 C;  4Q8I A;  3LZ1 C;  3X1U D;  2PU4 A;  5DTS A;  5CED A;  3S22 A;  1YMS A;  4KZ5 A;  1MWS A;  3AN2 C;  1NXY A;  1ZLA C;  3AZG C;  2XF3 A;  5GL9 A;  3MVD C;  5JRG A;  5CP6 B;  4WU9 C;  2GDN A;  2PU2 A;  3VP0 A;  5BS7 A;  3MXR A;  1YLP A;  4OOL A;  1P3O D;  1M40 A;  3ZNY A;  5BNV B;  5GHX A;  3A3F A;  4IBI A;  1YMX A;  3A3E A;  3NQJ A;  1KX4 A;  3RJU A;  4R0Q A;  4MNR A;  5DF7 A;  1ID3 B;  5CP6 D;  2Y91 A;  3WS2 A;  3AV1 C;  4AWL B;  5E2H A;  4E3N A;  5FQI A;  3TU4 A;  3UE1 A;  3UDF A;  3UY6 A;  1ES3 A;  1FSW A;  1C3B A;  4J8U A;  5BT1 D;  1Z6F A;  1K55 A;  4S2P A;  3C1B A;  3IHA A;  3C7U A;  1IYS A;  3AZI A;  3AZL C;  1ID3 D;  5AQA A;  4G92 B;  3HL9 A;  5EVL A;  5J8X A;  5A91 A;  3VP1 A;  5CGW A;  3KSY A;  2CC1 A;  3UDI A;  2F8N H;  1PWD A;  1YU0 A;  5B1L C;  1F66 C;  4ZUX A;  1W5D A;  3Q1F A;  3WKJ A;  2B5R A;  3EG5 B;  4IBJ A;  3VH6 T;  4J8W A;  1FOF A;  2V2F F;  3W99 A;  1O7E A;  5G18 A;  2ZJ9 A;  1P34 B;  1LI0 A;  2A49 A;  3UT9 A;  4YS3 A;  4FD8 A;  3HON A;  4OVD A;  1BFM A;  4NZ4 A;  3WRT A;  4OLG A;  1SKF A;  2JBF A;  1K56 D;  2JC7 A;  3JYI A;  4ZBJ B;  3W98 B;  3ZVW A;  4XUJ A;  3AFA A;  5KZH A;  3REL A;  1P34 D;  5CPK B;  5AY8 B;  4J8X A;  2PYO A;  4LCM A;  2BG1 A;  1U60 A;  3AZK D;  3X1V B;  1PI5 A;  3MKE A;  5EVI C;  3W98 C;  3WRZ A;  3IF6 B;  3REH A;  2XD1 A;  5F83 A;  4ZBE A;  3N4I A;  5C3I C;  1IEM A;  3NQU A;  2HIO A;  1YM1 A;  2WGW B;  3X1V C;  1P3L B;  4ZAM A;  3HLG A;  5E2F A;  5E2G A;  2QMI A;  3IF6 C;  5HL1 A;  3MZE A;  3B6F B;  3HUN A;  3ZDJ A;  1Q9C A;  1BH8 A;  1ONH A;  5TR7 A;  3KUY C;  1IYQ A;  1P3F B;  4OKP A;  5CPK D;  5AY8 D;  3ZG7 B;  2ZQC A;  3FWL A;  5AVB A;  1LI9 A;  3Q7V A;  3WTP B;  3QHY A;  4S2N A;  3O62 B;  3LEL A;  3B6F C;  5A90 A;  4R8P C;  4QJG A;  2WAE A;  3X1U A;  1P3F C;  3AV2 A;  2WGI A;  4XZQ C;  1M18 B;  2Z2M B;  1P3L D;  1PYY A;  3WTP C;  4KG6 A;  3B6F D;  5G49 A;  2HDU A;  2P9V B;  4H9P B;  3RXW A;  1XPB A;  2FFF B;  3O88 A;  1P3K D;  1U35 B;  1P3A B;  3NBL A;  1P3O A;  4XUZ A;  3B0D C;  4CAY A;  1HVB A;  2HDQ A;  3O62 D;  4L0L A;  4K91 A;  5KSH A;  4NET A;  5AV8 C;  4X55 A;  4Z2M H;  4JKT A;  4KHA B;  1XGJ A;  5B0Y B;  1M18 D;  4JPM A;  3UO9 A;  4IBD A;  3EPJ A;  5B31 A;  5B2J C;  1BT5 A;  4PM6 A;  4GZB A;  1N1J B;  4EUZ A;  1U35 D;  1P3A D;  2ARO A;  1SDE A;  3R45 B;  2IWB A;  4IBC A;  3WA9 A;  1WWI A;  4FCF A;  1LHY A;  3O3V A;  5GT3 C;  2FJ7 A;  3B3X A;  1YLW A;  1YQS A;  4QLC A;  1FCN A;  1FCM A;  1XGI A;  4OJ6 A;  3PBQ A;  5B0Y D;  5B0Z B;  5CPJ C;  4ZJ3 A;  5BNX B;  5BO0 B;  4Y0O A;  3B6G B;  4RX3 A;  4UA7 A;  4H9Q A;  4P85 A;  4GH9 A;  2ZMA A;  3C1C B;  3A3I A;  3ZHH A;  5U47 A;  1ONG A;  1NZU A;  1N4O A;  5DF9 A;  1RGY A;  3B6G C;  4X69 A;  1TDG A;  1TZY B;  2WUQ A;  4UUZ B;  3WAA B;  3REK A;  5GLC A;  3HRE A;  3Q81 A;  2HP9 A;  2ZQ9 A;  3MBZ A;  5EE8 A;  3VMA A;  3AGE A;  5B0Z D;  1BLS A;  4ID4 A;  3IT9 A;  4GHL A;  4OJL A;  1JTD A;  4NK3 A;  3FDD A;  3M6H A;  1TZY C;  4IJF A;  1MWR A;  3REI C;  1P3G D;  3O86 A;  2H5S A;  3VP4 A;  3C1C D;  2ZD8 A;  1RCJ A;  1ERO A;  3AGD A;  5DTK A;  4H9R B;  3WAA D;  3V9R A;  3DWZ A;  3UPP A;  3W4P A;  4YM6 B;  4KUD A;  1KGE A;  4YIN A;  3AZK A;  4CPK A;  3TSG A;  3MKF A;  5FUG A;  4GHA A;  2V20 A;  1ZKJ A;  1E4D A;  1A7W A;  3KWQ C;  4ZJ1 A;  5AV9 A;  1PZO A;  4YM6 C;  3X1S C;  1GHM A;  2IO5 B;  3W97 D;  3NIA A;  4C3Q A;  2WAD A;  3Q7Z A;  4KZ8 A;  2HDR A;  3AZF D;  5M19 A;  3G2Z A;  2XFS A;  5JRG B;  4MEZ A;  3NI9 A;  4H9O A;  2ZM5 A;  3QNB A;  3VOY A;  2C6W B;  3SS5 A;  2IO5 C;  4IBX A;  2X02 A;  1Y54 A;  4WU8 D;  4K0X A;  1HQ3 A;  3FYZ A;  4BL2 A;  3GMW A;  3G32 A;  3NQJ B;  4GD6 A;  3IHB A;  4KZ6 A;  3VH5 T;  1KX4 B;  3GTC A;  5B32 A;  1HTA A;  1XA7 A;  3IH9 A;  1XP4 A;  3NY4 A;  5HX9 A;  3BM6 A;  5JRG D;  3TU4 B;  4G91 B;  4WZ5 A;  1T3U A;  2EX6 A;  1P3K A;  3V50 A;  4J8U B;  4H9S A;  3AYW A;  3C1B B;  4RVA A;  1BUE A;  4UHU A;  4RYE A;  3MGQ C;  1KX4 D;  4OJO A;  1JWP A;  1K25 A;  3OPL A;  4OLD A;  4Z5T A;  3Q07 A;  4NYU A;  4JLF A;  5B31 G;  3TU4 D;  1K55 C;  4H9P A;  4GDB A;  5HAI A;  5B40 A;  3WTP E;  5F99 C;  3AZI C;  1U35 A;  1G6A A;  4ZUX B;  4J8U D;  3EPH A;  3WKJ B;  5B2I D;  3N8R A;  3C1B D;  2RCX A;  4J8W B;  3W99 B;  3LZ0 C;  2PBY A;  5B0Y A;  1JFI A;  2JSS A;  4JF6 A;  3UT9 B;  4ZUX C;  4YS3 B;  3D4F A;  3WKJ C;  4CJN A;  4J8W C;  4HBU A;  3W99 C;  3SS3 A;  1KVL A;  3W96 A;  3EPK A;  3ZG8 B;  1P3P C;  3BRM A;  5TGF A;  1IYO A;  2Y2H A;  4XUJ B;  4IBF A;  3AFA B;  4D2O A;  5CTM A;  3REL B;  4OJP A;  3EQV A;  4IED A;  3AL0 C;  4J8X B;  3UTB D;  2PYO B;  2OLU A;  2G2W A;  5B24 D;  3AZH C;  3UT9 D;  4YS3 D;  3GR2 A;  1NRF A;  4X23 C;  3FKW A;  3REH B;  3FV7 A;  4N1H A;  1P3G A;  3REL C;  1LL9 A;  3H0R C;  3ZVT A;  4J8X C;  3NQU B;  2PYO C;  2HIO B;  3IXB A;  1KGF A;  3N6I A;  3Q82 A;  4XUJ D;  3AFA D;  4OP8 A;  1BH8 B;  3REH C;  5DNN C;  1M19 A;  2J9O A;  3KXB A;  3MGR A;  3ZG5 A;  3L28 A;  1N9B A;  4QNL A;  5AVB B;  2HIO C;  3Q7V B;  1BH9 A;  4E3L A;  4MBK A;  4EBN A;  5GT0 A;  3LEL B;  1FSY A;  5GLD A;  1MWU A;  3RXX A;  4DDS A;  3AV2 B;  4Y0T A;  2HIO D;  3W97 A;  3GVB A;  3NC8 A;  4B88 A;  5KSC A;  3AZF A;  4S2N C;  1NYM A;  3ZCZ A;  4WNN A;  4E44 A;  3X1U C;  4IVK A;  3AZM A;  3E2L A;  5AVB D;  1K54 A;  1P3O B;  5JYO A;  3X1T A;  2XGN A;  1BSG A;  4WU8 A;  4CAY B;  2ZQ7 A;  4NZ3 A;  3LEL D;  4OQI A;  3FKV A;  3EPL A;  5GSU A;  1L2S A;  1I2S A;  5FSR A;  2F2A C;  3AV2 D;  2E8I A;  5CEB A;  2UWX A;  5B32 G;  3A3J A;  1H3O A;  1P3O C;  2H0T A;  2V1Z A;  1P3B B;  4DF6 A;  5B31 B;  1YLJ A;  1YT4 A;  4QY5 A;  2HP6 A;  4LV2 A;  4OQG A;  3M6B A;  1BUL A;  2ARO B;  3CMZ A;  2JE5 A;  3WA9 B;  2Y59 A;  4H9N A;  5AV5 A;  4KGC D;  5CP6 C;  2FJ7 B;  5CHL B;  4QLC B;  3A6N D;  1WE4 A;  3BFC A;  1IKG A;  1KU5 A;  3A1I A;  3UPO A;  2ZC4 B;  3OC2 A;  1P3B D;  3UPN A;  5B31 D;  4OON A;  5BT1 C;  1P3I B;  2WYX A;  2FJ7 C;  3IF5 A;  4IJE A;  1PZR A;  4H9Q B;  2ARO D;  3WA9 D;  2CWE A;  1ID3 C;  5FAP A;  3AGF A;  3MGP B;  3VOZ A;  5B2I A;  4AWL C;  2FJ7 D;  3KS4 A;  3REK B;  4QLC D;  4NZ1 A;  4UA9 A;  1JVJ A;  3L29 A;  3AZJ A;  1IKI A;  1W79 A;  3VH6 W;  4LD9 D;  2DQN C;  5FQK A;  2Y2P A;  3C7V A;  3DWK A;  1P3I D;  2YFW A;  1GHI A;  3BFE A;  1ES4 A;  1DY6 A;  3AZE A;  4KZB A;  2OLV A;  4G92 C;  3MGP D;  3V9R B;  3REK D;  4Z9Q A;  3CG5 A;  4U0X A;  3GV9 A;  4WMC D;  4KUD B;  3IXG A;  3UTB A;  5AVC D;  3AZK B;  5B24 A;  1AOI A;  3BEC A;  5FUG B;  4UPK A;  1YU3 A;  3LCE A;  4PPR A;  5KDM A;  4E6X A;  3WS4 A;  5AV9 B;  1P34 C;  4OOM A;  3VSK A;  3AZK C;  1L0D A;  4N9L A;  2ZM8 A;  1I2W A;  4B4Z A;  5AV9 C;  1Q2P A;  4H9O B;  4KUD D;  3M2K A;  3HLC A;  3PBN A;  4S2M A;  1K38 A;  3REJ A;  2ZQD A;  4ZBJ C;  2XFT A;  5E43 A;  3BYD A;  1HQ3 B;  5E5A A;  1ESU A;  3TG9 A;  4JJN A;  5AV9 D;  1KGG A;  4OPY A;  5CPK C;  5AY8 C;  5B32 B;  3N3F A;  1VQQ A;  3G31 A;  3PBR A;  2ZY4 A;  5F1G A;  2Y55 A;  1KX3 A;  4GNU A;  1K57 A;  1I5Q A;  3AZN D;  1H5X A;  1P3K B;  3WS1 A;  1P3L C;  2Y2L A;  3CJM A;  1HQ3 D;  4Z66 A;  4WEJ A;  3AYW B;  4X6T A;  4HEF A;  1EQZ D;  1PW8 A;  4WZ5 C;  3VH6 A;  5B32 D;  4FH2 A;  5DNM D;  3GQZ A;  5AV6 B;  1P3K C;  3VSL A;  4R3B A;  4J8V D;  2QPN A;  1FCO A;  4BL3 A;  4Z5T B;  4OPZ A;  3O62 C;  2ZC6 B;  4JXS A;  5CPI D;  3NCK A;  5B40 B;  1JTG A;  2NQB D;  1M18 C;  3VP2 A;  2F8N G;  1NYY A;  3B0B A;  4E3O A;  4KGC A;  3MZD A;  3AYW D;  5B33 A;  3LZ1 A;  4UA6 A;  1PIO A;  3A6N A;  5GHZ A;  5AV6 D;  3WWX A;  1JFI B;  1U35 C;  1P3A C;  4Z5T D;  1P3B A;  1GA0 A;  3WS5 A;  4DRB A;  1RP5 A;  1ZG4 A;  3MXS A;  3OCN A;  5GXQ D;  4MBH A;  4KQR A;  3MVD A;  4WU9 A;  4P0M A;  5B40 D;  2RVQ D;  4S2O A;  3W96 B;  5B1M D;  5B0Y C;  3P98 A;  4DE3 A;  1GCE A;  4QU3 A;  2G2U A;  1NZO A;  3BFF A;  4PM8 A;  4WZ4 A;  1XXM A;  4LD9 A;  2VGJ A;  3W4Q A;  3QNC A;  1DJB A;  1P3I A;  1P3G B;  3E2K A;  3MGS D;  3AV1 A;  4JXW A;  3W96 D;  2Y2G A;  5B0Z C;  1ZG6 A;  1NJ4 A;  1LL5 A;  3MGP A;  2H10 A;  1P3G C;  1M19 B;  3KXB B;  4C75 A;  1EI5 A;  3MGR B;  4WMC A;  3FZC A;  5AVC A;  3C1C C;  1BH9 B;  3AZL A;  2ZC7 A;  5GT0 B;  3WAA C;  4FSF A;  5CGS A;  2HUE B;  4E45 A;  1K4F A;  3UTA A;  3W97 B;  3LJA B;  1J9M A;  4PMA A;  3MNN D;  3AZF B;  5B1L A;  1F66 A;  2X01 A;  4WNN B;  1M19 D;  3KXB D;  4K0W A;  3AZM B;  3MGR D;  2OSU A;  1GA9 A;  3W97 C;  3IWI A;  3X1T B;  3ZGA B;  5GT0 D;  4WU8 B;  4S2I A;  5CEC A;  3AZF C;  1TAF A;  5GSU B;  4Z2M G;  4E3M A;  5HFO A;  2HDS A;  3LJA D;  1H3O B;  1R4V A;  4WU8 C;  3ZG9 B;  1AXB A;  1HD8 A;  4KG2 A;  1XX2 A;  2WAF A;  2J7V A;  3AZM D;  3AZN A;  1OME A;  4DRT A;  2F8N B;  1L0F A;  3X1T D;  4H9N B;  5AV5 B;  1B67 A;  2L5A A;  5JRG C;  5EVI A;  1YUE A;  5BS7 C;  3EQU A;  1EQZ A;  3NDG A;  5GSU D;  3LEZ A;  2NZD D;  4KQQ A;  5DNM A;  5EUA A;  2IWD A;  4ZJ2 A;  4DXB A;  4EV4 A;  4J8V A;  1ERM A;  3VFH A;  2Y4A A;  2IWC A;  2WGV A;  5EPH A;  3IWO A;  2I72 A;  4PM7 A;  5CPI A;  5JA4 A;  1KX4 C;  4LG2 A;  2BYK B;  2F8N D;  2NQB A;  3L27 A;  3OCL A;  5AV5 D;  4R1G A;  4WEL A;  5B2I B;  3ITA A;  3TU4 C;  4G91 C;  1SHV A;  1TVF A;  3AZJ B;  4R8P A;  1CEG A;  5AV6 A;  3C4O A;  2BLS A;  2WKI A;  4NFT A;  4XZQ A;  1YU2 A;  1K6S A;  4J8U C;  3B0C T;  1PWC A;  5B2I C;  2A3U A;  5GXQ A;  2YFW B;  3C1B C;  1KX5 B;  2J8P A;  2QZ6 A;  2Y2N A;  4HGA B;  4WBG A;  5B1M A;  3BFD A;  3AZE B;  1M1A D;  4O7D A;  1K4E A;  1PZP A;  4ZDX A;  1NY0 A;  5DVA A;  3AZJ D;  1IYP A;  5AV8 A;  3DW0 A;  3UTB B;  3AZE C;  5B24 B;  4OJ5 A;  1E3U A;  4PM5 A;  3TOI A;  1AOI B;  1JWV A;  1KX5 D;  1KDS A;  5KDM B;  3MGS A;  5B2J A;  5BPV A;  3UTB C;  3VH5 A;  3AZE D;  4WJ3 C;  5B24 C;  3UT9 C;  4YS3 C;  1PW1 A;  2CV5 D;  5GT3 A;  3N7W A;  3HUM A;  2ZLY A;  2DRW A;  1PI4 A;  3REJ B;  1AOI D;  5CPJ A;  4XUJ C;  1ERQ A;  5HAP A;  1BZA A;  5E5A B;  3AFA C;  2ZC3 B;  4JJN B;  4IBE A;  4OOY A;  2HPB A;  5EOO A;  1MKI A;  4QB8 A;  2H0Y A;  3PBS A;  1WYC A;  4JBF A;  3MNN A;  2XEP A;  1KX3 B;  4NE3 A;  3ZG0 A;  1Z2C B;  2J9P A;  4IVI A;  4UAA A;  3REJ D;  2C5W B;  5L2F A;  2EXB A;  4Z66 B;  5E5A D;  4JJN D;  1KX3 C;  3REI A;  1K57 C;  4X53 A;  3BFG A;  5AVB C;  3LJA A;  1YU1 A;  2J8Y A;  1YLZ A;  3PTE A;  2Y2J A;  3LEL C;  4WYY A;  1KX3 D;  2WZX A;  3AV2 C;  4WV4 B;  3A1K A;  4KGC B;  4Z66 D;  4EBP A;  2WK0 A;  4RA7 A;  5B33 B;  2EXA A;  3LZ1 B;  2NZD A;  3A6N B;  1W8Y A;  2F8N K;  1GHP A;  4B4X A;  3KWQ A;  5FQM A;  4P87 A;  3LY3 A;  4KQO A;  4KGC C;  4FH4 A;  1RGZ A;  1O07 A;  3MVD B;  4WU9 B;  5F1F A;  3A6N C;  2F8N A;  2Q9N A;  1TEM A;  2P74 A;  1P3B C;  5B31 C;  1YLY A;  4EO5 B;  5B33 D;  1MY8 A;  2ZQ8 A;  3LZ1 D;  1MPL A;  3O87 A;  2DNS A;  2ARO C;  4LD9 B;  3WS0 A;  3WA9 C;  4OPQ A;  3AN2 D;  1ZLA D;  3AZG D;  5A93 A;  4EO5 C;  1F1E A;  4WU9 D;  3MVD D;  4QLC C;  3AV1 B;  1P3M A;  1VM1 A;  2BYK A;  1BTL A;  4LD9 C;  1M1A A;  4X68 A;  2XR0 A;  4MBF A;  4S2L A;  2X71 A;  1P3I C;  5CTN A;  2DCF A;  3HBR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...