2Y2NA

Penicillin-binding protein 1b (pbp-1b) in complex with an alkyl boronate (e07)
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
488
structure length
468
Chain Sequence
b'ISEITYSDGTVIASIDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTGQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PENICILLIN-BINDING PROTEIN 1B
molecule tags Transferase
source organism Streptococcus pneumoniae
publication title Structure-Guided Design of Cell Wall Biosynthesis Inhibitors that Overcome Beta-Lactam Resistance in Staphylococcus Aureus (Mrsa).
pubmed doi rcsb
total genus 160
structure length 468
sequence length 488
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2y2nA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2y2nA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2y2nA02
2X71A 5FI6A 1QMFA 5GHZA 1W79A 4UA9A 4DDYA 5CTNA 1CEFA 2E8IA 5DF7A 4HEFA 1W7FA 4ZDXA 4GKUA 4GDBA 5EVID 5TR7A 4KQRA 3ZCZA 1IYOA 3G2YA 1FSWA 1S0WA 4E6WA 1KGGA 3AGFA 3IXDA 2A3UA 2OV5A 3IXGA 1YLTA 3LCEA 1K55C 2QPNA 4LV0A 4XUZA 1IKIA 4GDNA 4Y0OA 5EUAA 1PWDA 3IXBA 4WZ4A 1TDLA 2ZLYA 4RYEA 4WEKA 4JPMA 1YMXA 2ZC3B 4XXRA 4Y0TA 5HL1A 5FSRA 3EQVA 2WGWA 5F1FA 3GSGA 4QU3A 1DJAA 4S2IA 3TG9A 1BULA 3OC2A 3OCLA 4PM7A 5GLCA 5E43A 2BG1A 2Y2OA 3S1YA 3MXSA 3OPPA 4PM8A 5AQAA 5CEBA 4XUXA 4IVKA 2ZQDA 3N8LA 5JYPA 2Y2LA 1K55A 3HBRA 2Y59A 3IHAA 2H10A 3A3IA 3N7WA 4KQQA 4U0XA 1FSYA 4EWFA 1KDWA 3HLFA 3IF6B 3BFCA 3FWLA 3BYDA 1L0FA 2Y2GA 2BLSA 1E4DA 4Y7PA 4KQOA 5GHYA 2Y2QA 2QZ6A 4H8RA 4YFMA 2G2UA 2DNSA 3VFHA 5HAPA 3NY4A 4ID4A 4K0XA 3Q1FA 1JTDA 4IBXA 3N8RA 3V5MA 3WRZA 3O86A 4WEJA 1LI0A 4RX3A 3IF6A 1RGYA 2JBFA 4Y0UA 1RGZA 4ZJ3A 3V3SA 3BEBA 5HARA 4ZJ1A 4K91A 2WYXA 1WYCA 4RX2A 3VOZA 4GD6A 1LL5A 1IKGA 2ZM2A 4OQ0A 5DF8A 4ZAMA 1Q2QA 5GL9A 2VGKA 4C3QA 4MEZA 3GR2A 1NY0A 1SDEA 2H0TA 2J9PA 4OPZA 2WKHA 1XA1A 4QHCA 5TGFA 1L0GA 1ERQA 2Y91A 3ZDJA 2ZQAA 3M2KA 4LV3A 3WS5A 3GMWA 4LENA 5HAIA 2V20A 1PW8A 4LV2A 1NZOA 3GRJA 5FQIA 4B88A 3G32A 1EI5A 3OPHA 4RVAA 5FQ9A 3IHBA 4OLDA 2OLVA 3ITAA 1TDGA 3MBZA 2XR0A 4E3KA 1NYYA 4KG5A 4IBRA 4OOYA 1Q2PA 3PTEA 4R23A 3VSLA 3ZG0A 2EX9A 5EVIB 3Q81A 5HW3A 4IVIA 2ZC5B 4WZ5A 2VGJA 1MBLA 1E3UA 3UO9A 3C4OA 1VQQA 5CGXA 2JCHA 3NC8A 5FQJA 4BLMA 5DVAA 5EPHA 1K54A 1W8YA 3IWIA 3Q7ZA 3Q7VB 3G34A 3ZNTA 3NBLA 3ZVWA 4D2OA 1TEMA 2ZJ9A 4N9KA 1ES4A 4JLFA 3C5AA 1L2SA 4KZBA 3SH8A 4S2PA 1SHVA 1PW1A 1NRFA 3MXRA 4OPQA 4DF6A 3VOYA 2JE5A 3O88A 3SH7A 1U60A 4X69A 5FDHA 1H5XA 3C7UA 2V1ZA 5TFQA 2XQZA 3DW0A 5EVIA 4MBFA 3SOIA 3UDXA 4WELA 4OQGA 2Y2PA 3GTCA 2Y55A 2EFXA 1JWVA 2XGNA 1ES2A 3G30A 3IWOA 1G6AA 3MZFA 4FCFA 4NK3A 3W8KA 4QY6A 1GA9A 1GHMA 1FCOA 4OPRA 1GHIA 4L0LA 5EECA 2HDUA 3RXWA 4X6TA 1M6KA 3MZEA 4FH4A 3UN7A 3W4OA 2WK0A 5F82A 4E3LA 2H5SA 4R4RA 4GD8A 1DJBA 4DKIA 1MWRA 5A91A 4JKTA 4OQIA 4EBLA 2P9VB 4HESA 4WYYA 1C3BA 1DJCA 1ZKJA 2HP9A 3BFEA 5FQMA 1FOFA 1YMSA 3DWZA 4B4ZA 2X01A 3Q07A 1NYMA 3WS0A 2WGIA 1XGIA 5CECA 4LV1A 4Z9QA 3C4PA 1YLJA 4DE0A 3IH9A 3NI9A 1JWZA 3QNBA 5FI2A 4DDSA 1BUEA 3BLMA 4UA7A 3HUMA 4WBGA 4JBFA 1CI8A 3SS3A 1N4OA 2XD5A 2ZM0A 4A5RA 4UA6A 1PYYA 4R0QA 4EV4A 5KSHA 4QB8A 2HP5A 4KZAA 2XD1A 1MWSA 5FQQA 4CPKA 3NCKA 1ONHA 3D4FA 4PM9A 1E25A 1ZC2A 3WS1A 4MBKA 3UE1A 3BRMA 3I7JA 4WZ5C 2OLUA 3ZHHA 1NJ4A 3IF6C 4CJNA 2WAFA 4X56A 1XGJA 2DCFA 4N1XA 4OP5A 3IT9A 4JXGA 2FFYA 5DTTA 4UAAA 4EUZA 3BLSA 2C6WB 1K6RA 2GDNA 1FR6A 1W8QA 2P9VA 1ZG6A 5FATA 5GHXA 3BECA 5AQBA 1MWTA 4QD4A 1K4EA 1KE4A 4DXBA 1LI9A 1WE4A 5EE8A 3WS2A 1YM1A 2RL3A 4P6BA 1BLCA 1K56A 4R1GA 4S2JA 4EBPA 4MLLA 3V3RA 5CGSA 4B4XA 3ZFZA 1I2SA 1BLPA 1ERMA 4R3BA 2Y2HA 3ZGAB 4GN2A 4S2NC 5DF9A 3IH8A 2XH9A 3LEZA 4S2KA 3WRTA 1JTGA 2IWCA 4JXSA 3PBNA 3UDIA 1Z6FA 3RXXA 4KG2A 3A3EA 2B5RA 5I94A 3FZCA 4DE2A 1ES3A 4X68A 5J8XA 1ES5A 4U0TA 1LL9A 3S4XA 1O07A 1PIOA 4N9LA 1NXYA 4KZ8A 4QJGA 3Q7VA 2V2FF 1PZPA 2EX2A 5FASA 2XLNA 1MXOA 1K25A 1WYBA 3HUOA 1Y54A 1RP5A 1BTLA 2WADA 2X02A 3VP2A 3G2ZA 3TOIA 2WKIA 3LO7A 2WZZA 1JWPA 2Q9NA 4JXVA 4EQIA 3HL9A 1S6RA 2DRWA 4UHUA 3WS4A 3SS5A 3FYZA 4DE1A 4U3TA 1XP4A 3LY3A 1BZAA 4LCMA 4OP8A 3UE3A 3OZHA 3ITBA 3GVBA 1GA0A 3G35A 5KMWA 2WZXA 1PZOA 3EQUA 1SDNA 2XF3A 3UPNA 4PM6A 5HAQA 2A49A 3V39A 2Y2IA 4KZ3A 3G31A 4S2NA 5E2HA 3A3FA 3PAEA 1K54C 2IWDA 4BD1A 3ZNYA 2ZQ8A 1BLHA 3E2KA 3A3DA 3M6BA 2XFSA 2EXAA 5E2EA 3ZG5A 5KZHA 4R3JA 2EXBA 1K57A 2Q9MA 5FI7A 2ZQ9A 5EOEA 1EWZA 2Y2MA 3FKWA 3ZG9B 3S22A 1MPLA 1FR1A 4YINA 3IWQA 1HTZA 3M6HA 5CRFA 4HBTA 2PU4A 1IYSA 1N9BA 3MKEA 3HLGA 3TSGA 1KVLA 1K57C 2C5WB 3ZG7B 3GV9A 2WAEA 4EBNA 2Y2KA 3HREA 5HFOA 4BJPA 2P74A 3M2JA 4ZJ2A 3VP4A 4RA7A 1KE3A 1YQSA 3DWKA 4NETA 2Z2LB 1L0DA 3UDFA 3N6IA 1ESUA 3E2LA 4KZ9A 4WMCA 3MZDA 5CHMA 5CHJA 3HVFA 4FH2A 4OONA 3SH9A 4JXWA 4WMCD 1J9MA 4E3JA 2EX6A 2HP6A 2Z2MB 3VP1A 5JYOA 1ZG4A 2R9XA 3OPRA 5L2FA 3C7VA 3HLCA 5BOHA 3OPLA 4PMAA 3PAGA 2XEPA 4MBHA 4DXCA 2Y2JA 3O3VA 1I2WA 2HDSA 3OCNA 1XX2A 2ZQCA 1YT4A 5E2FA 4OPYA 4BQMA 1BSGA 5CGWA 1GCEA 2QMIA 2ZM8A 3ZG8B 1OMEA 2OSUA 1BLSA 1YLYA 3HLEA 3MFDA 4OOMA 3G4PA 4GNUA 1ESIA 2XFTA 1IYQA 3BFGA 1SCWA 1FQGA 1QMEA 3PBOA 5DTKA 5FAOA 3B3XA 3PBQA 1I5QA 4X53A 1VM1A 4E3NA 2HPBA 3VMAA 5FAQA 1HD8A 5F1GA 4Q8IA 4QY5A 3ZVTA 4BL2A 5DTSA 2HDRA 3NDGA 4OLGA 4BENA 1FCNA 3CJMA 3CG5A 4WM9A 2ZQ7A 1KGFA 2WKEA 4KENB 1IELA 2I72A 1DY6A 5IHVA 4MNRA 4F94A 1XKZA 3V50A 4P0MA 4JF6A 4O7DA 3N8SA 2ZMAA 4BL3A 3VP3A 4S2LA 1XXMA 1BT5A 2EFUA 5F83A 2Y4AA 3UE0A 5CXWA 4BD0A 1LLBA 1H8ZA 2RCXA 5EVLA 2WUQA 4S2OA 2ZC7A 3BFFA 1MY8A 3A3JA 4FD8A 2WGVA 5CTMA 3VSKA 4E3IA 1LHYA 4HBUA 2PBYA 3HLDA 4GZBA 4OQHA 3P98A 4KZ6A 5U47A 1KDSA 5AQ7A 5GLAA 4N1HA 3PBTA 3BM6A 1TVFA 2JC7A 4GB7A 1G68A 1ONGA 1NZUA 3CZDA 4LCLA 4E3MA 3UPOA 1MKIA 4PPRA 1KGEA 3IF5A 1YLPA 3SS4A 2EX8A 3P09A 4ZTKA 1KVMA 5FAPA 4DRTA 4OOLA 1YLZA 4ZBEA 1PI4A 2WGWB 2ZC6B 4JF4A 4E6XA 4OVDA 3BFDA 4C75A 2R9WA 3HUNA 5M18A 1L0EA 1ALQA 5KSCA 1O7EA 3UNWA 5FQKA 5D3OA 4X55A 2XK1A 4K0WA 3DTMA 1RCJA 2XDMA 3Q82A 3NIAA 3PBRA 4C6YA 3IXHA 1XA7A 5G18A 5M19A 4OH0A 1CK3A 3IQAA 3JYIA 3NDEA 4IEDA 3UY6A 3RJUA 1IYPA 5GLDA 2ZD8A 1HZOA 2H0YA 1K4FA 4M3KA 4DE3A 3FV7A 2J8YA 2Y2NA 5M1AA 2J9OA 4OKPA 5A90A 1KE0A 1SKFA 3MKFA 2IWBA 3WWXA 3O87A 5AQ9A 1PWCA 1K6SA 4E3OA 3HLWA 3HLBA 5A93A 3PBSA 1M40A 3QHYA 5EVIC 5EOOA 4PM5A 3W4QA 4FSFA 1CI9A 1JVJA 1K38A 1MWUA 2FFFB 2J7VA 4S2MA 3UPPA 5FA7A 1FCMA 2PU2A 1CEGA 1H8YA 1HVBA 1W5DA 5CERA 1PWGA 4KZ7A 3AGEA 4KG6A 4P87A 4KZ4A 2HDQA 3N4IA 3QNCA 3W4PA 4N92A 1GHPA 3CMZA 5CHUA 2G2WA 3VP0A 1PI5A 1K56D 5GLBA 5A92A 3GQZA 2CC1A 3AGDA 2ZC4B 1IEMA 4KZ5A 1AXBA 4P85A 1YLWA 1EROA 4R4SA 1E3UD 1XPBA 3LY4A 3VFFA 3FKVA 5CEDA 4JF5A 2UWXA 3ISGA 5E2GA 5HX9A 4GOGA
chains in the Genus database with same CATH superfamily
1YU4A 4DDYA 1YSQA 1AIWA 4P6ZS 3L7HA 4HEFA 3B6FB 1JNUA 4GDBA 5EVID 2V0WA 2G7UA 3AGFA 3O5YA 1YLTA 4LV0A 2QPNA 2F8NA 1BYWA 3SW1A 5AV9C 4J8WA 1CQAA 4Y0OA 5B0YD 3KUYA 4RYEA 4GH9A 3BQAA 2ZC3B 3AN2A 4XXRA 4Z2KA 5AV5B 4CLCD 4KGCC 1W63M 2W1TA 5HD3A 1ID3D 5CPJD 4I5SA 4IBGA 2B18A 2VLGA 4G91B 3MXSA 1PRQA 4UPKA 5CEBA 1HQ3A 2ZQDA 3X1UB 5AV9B 4JJND 4BWIA 1TS8A 3IHAA 3N7WA 1EQZC 3AZIA 4EWFA 3HLFA 3A0VA 5AY8A 1L0FA 4GJ4A 4KQOA 5GHYA 2Y2QA 3T4KA 4YFMA 5BO0A 1KX5A 1KX4B 2DNSA 4X1LA 3AZGB 2JBFA 4WL9A 5HARA 5HZHA 2HUEC 2XSSA 5KDMA 2WYXA 3B6GB 1LT0A 3B33A 1LL5A 1EQZA 1IKGA 4OQ0A 1NY0A 5TBMB 2H0TA 2V9AA 4NZ4A 3NQJB 1KX5B 2J80A 3B47A 3M2KA 3OLOA 4R8PB 5HAIA 1MC0A 3LI9A 4H9RA 1LSVA 2NQBB 2AROD 1M18D 1P3AC 4HJ4A 3MQ0A 3IHBA 4ZRRA 3ITAA 4WLAA 4WU8B 2XR0A 3MBZA 4G3WA 5GT3C 1EW0A 1NYYA 4H9SC 2EX9A 5HW3A 1B6WA 4H9OA 3WAAA 3AYWD 1LL8A 1P3PB 3MVDB 1VQQA 5GXQC 1ZHHB 5CGXA 5B33A 3MNND 3ULFA 1TEMA 1S32B 1P3LA 1E6ZA 4YWZA 1L2SA 3AV2D 1SHVA 4EESA 3R7WA 3HCYA 4YNRA 1H8PA 3K3CA 4DF6A 3O88A 3T4OA 1U60A 2L0WA 4O8GA 3SZTA 3REJC 4H9QA 4CAYB 1VHMA 2YFWA 1E8BA 3MZFA 4GW9A 4FCFA 3A6NB 3AZJC 1FCOA 2QWSA 3AZHB 4X6TA 3W4OA 4FH4A 4QLCD 4AWLC 3LR3A 1BH9A 2WK0A 4J8VD 5GT0C 5A91A 3T4SA 1U35A 4HESA 3BFEA 1DJCA 2PHYA 2NQBA 5FQMA 4EW7A 4XUJB 4B4ZA 3F1OB 2X01A 3WS0A 4Y2FA 5AV5D 4HJ3A 5CPID 1YLJA 3W97A 3KXBC 3IH9A 4QLCC 1VETA 4HQAA 4IBIA 4HP9A 1CI8A 3SS3A 3NOUC 2ZM0A 4A5RA 4UA6A 1YU2A 4R0QA 4EV4A 3F1PA 5B31G 3AZND 5JRGC 3WKJD 4Q0JA 4NXGA 2PAVP 3BRMA 4Y5FA 3MGQB 2OLUA 1NJ4A 3IF6C 3E4QA 1P3MA 4LRYC 1XFNA 4EQ1A 2DCFA 5GSUA 4X23A 4Z5TA 2G5IC 1ZG6A 4KHAB 1KE4A 5B0ZC 2WKRA 4YM6D 3KWQB 5EE8A 1YM1A 3LIBA 3WTPD 1S1ZA 2Z6DA 1M1AC 1TZYB 5CGSA 4HI4A 3WA9D 1YU0A 3G6OA 2V1AA 4NZ1A 3OBFA 4S2NC 5DF9A 3IH8A 1DP8A 1P9WA 1M19A 1P3AD 3LEZA 3WRTA 3UDIA 4NE3A 3A3EA 2PRFA 3PHYA 3W96C 3FZCA 5DNNA 3KWQC 3MF0A 3T4JA 5J8XA 4U0TA 2VV8A 3S4XA 4N9LA 3RELD 4KZ8A 4QJGA 4X23B 3Q7VA 2OWHA 2EX2A 2XLNA 2X02A 1E88A 3HL9A 5AVBC 1W1TA 1QO6A 4NE6A 3AZKA 4FUWA 2IA2A 3UE3A 3OZHA 2WZXA 1PZOA 1SDNA 1TZYA 3W99A 5HAQA 2Y2IA 2VX8A 4S2NA 5E2HA 3LIEA 3ZNYA 3AZJA 3C1BA 5B31B 5B24C 4OJOA 3M6BA 5KZHA 5DNNB 3QP6A 5F99C 4Z2LA 2EXBA 3KYEA 4R3JA 5GT0A 4QLCB 5CPJC 4H9PB 1YUEA 2BYKB 3S22A 3M7PA 3UB8A 1FR1A 3IWQA 4HBTA 1XJ2A 1XFQA 3MKEA 3MGPB 4MB4A 3KS4A 4Z66C 4M6BA 5CPIB 2WAEA 3WTPE 3MGQC 3HREA 4BJPA 1JFIA 3AV1B 4CLCB 1DP6A 1KE3A 1S4RA 1NRJA 1OTAA 4NETA 3UDFA 1P34A 3N6IA 1ESUA 4OJLA 4WNNB 5CHMA 4MB5A 3HVFA 4OONA 5B1MA 2VV7A 2R78A 4JXWA 1J9MA 5CPKA 4G3KA 3E4PA 1N9OA 5BOHA 3TU4A 1F5MA 1K0KA 4II7A 5I5LA 3PAGA 3X1VC 1M1AB 3UTAC 2Y2JA 1NWZA 5J3WA 3WA9A 2ZQCA 3AV1A 4Z2JA 1BSGA 1GSVA 2NUPC 2VK3A 3AFAB 3MGSD 2QMIA 3QP8A 3UMEA 1OMEA 4OOMA 3AZGD 4WNNA 5FAOA 2WKPA 3B3XA 3P7NA 1VM1A 1Y28A 3PYPA 1B67A 2OOLA 5BNVA 5B0ZB 3AV2A 3TU4C 5AV5C 1FCNA 3P01A 5AJGA 4WM9A 2ZQ7A 3WA9B 1IELA 4LPZA 5HPFA 3MGSC 4MB3A 2I72A 5IS1A 3L9KA 4R6LA 1ACFA 3DTKA 4HY8A 4CLCE 4O7DA 1P3MB 2ZMAA 3KUYD 2AROB 2KDKA 2XA7S 2EFUA 5CXWA 1LLBA 1H8ZA 3C1CA 2ZC7A 1OGGA 1F9IA 3BFFA 5CTMA 4E3IA 4HBUA 3LZ0B 2NUTC 3HLDA 5G49B 1T1AA 4GZBA 5DNMD 3P98A 3F1NB 4KZ6A 5AQ7A 1KX3B 3C1BD 3BM6A 2L5AA 4R70A 3MVDD 1NZUA 3UPOA 1AOIA 4B9OA 1D7EA 2XROA 1H0GA 2ZMVA 3IF5A 3MMHA 3SS4A 3KUYC 1KVMA 4DRTA 5HWVA 3AN2B 2PYOD 2WGWB 4JF4A 4OVDA 3T4QA 3REIC 5L09A 3VE4A 1MKMA 5D3OA 3B0CW 2D02A 5C3IC 1RCJA 1Z2CB 3IS2B 2H28A 4C6YA 3IQAA 3NDEA 5FL3A 4XZQA 3WA9C 5B2IC 4MMNA 3CITA 1IYPA 2QHKA 5AVFA 4ZUXC 4M3KA 4DE3A 4MN6A 4Z2MH 2J9OA 5A90A 4R38A 2IWBA 3O87A 5AQ9A 1PWCA 4E3OA 2PYPA 5A93A 2F8NB 2DF4C 1NLZA 4FSFA 2J7VA 2F8NH 4PHTA 2W3GA 1Z09A 3A0SA 4S2MA 3FDDA 1UR8A 5GXQB 1GSXA 3LEQA 2AROA 1HVBA 3AV1D 5B32G 4KZ7A 5AVCD 2HDQA 3W4PA 1P3LC 1PI5A 3GQZA 4HP4A 3LELA 3R45A 2CC1A 2XRNA 1W1PA 2ZC4B 3O62B 1IEMA 4NG2A 4G91C 1P3BD 1T1CA 1E3UD 1XPBA 3LY4A 3VFFA 5BPVA 1U35C 2YKFA 3ISGA 3AZNB 1W79A 5CTNA 4Z2IA 2E8IA 3REHB 3K2NA 1W7FA 4GKUA 5TR7A 3KSFA 3ZCZA 1IYOA 3G2YA 3CLOA 1KGGA 5IU1A 3WX7A 5B24D 3IXDA 3MNNC 1LSWA 4XUZA 3AZGC 4ETZA 3FKEA 4WZ4A 4WV4B 5HL1A 3T1XA 5FSRA 1NLYA 5CPJA 3UTBD 3AZMD 5B1LD 4NZ5A 5F1FA 1L6JA 4S2IA 1TF1A 3TG9A 2V8FA 2P08A 2RVQD 4WU9A 3AZLB 3OC2A 4Z2GA 4PM7A 5GLCA 3VH6W 5E43A 3QP5A 2BG1A 1SZVA 3BQ8A 3OPPA 1TZYD 2O99A 1KX5C 1OPXA 4J8VA 3TU4B 3NECA 1K55A 3TJZC 2H10A 1P3LB 2VEAA 3A3IA 3FG8A 4YOFA 3AZJD 4ARZB 4J8XB 3UB5P 3FWLA 3BYDA 2BLSA 4AFIA 1E4DA 4ZBJC 2WKQA 4Y7PA 2F2AC 5BNXA 1P3KD 3W98C 4IBJA 3NY4A 4K0XA 1JTDA 3WRZA 3V5MA 3O86A 4RX3A 3IF6A 4Y0UA 3V3SA 3BEBA 1HQ3B 4ZJ1A 4K91A 4NXBA 4ZAMA 5DF8A 3AZHA 4NXEA 3WKJA 4J8XA 5B40C 3GR2A 1YSPA 4MEZA 1P3FA 4JJNC 2J9PA 2WKHA 1XA1A 3T50A 4Z66B 2ACGA 2IOUA 5BT1D 2NZDC 4Z1WA 4LV3A 4XZQC 4Q0HA 4Z5TD 4B88A 3F1PB 3UT9D 4ARZA 2J8PA 3W97B 3PTEA 4R23A 3DAVA 5EVIB 2W3HA 3EOIA 4WZ5A 1E3UA 3C4OA 2V1BA 3NC8A 5FQJA 5AY8B 1G6OA 4DQYB 1W8YA 3HJIA 3Q7ZA 3ZNTA 4BBUA 2HIOA 2VJWA 3X1TC 3MGPD 4N9KA 1ES4A 5DJTA 3C5AA 2PD8A 2VA0A 3SH8A 4S2PA 5E5AC 2INWA 2JE5A 2O9CA 5GT3A 3RTYA 4X69A 5MC7A 5AV8A 5TFQA 3O62D 2XQZA 3DW0A 5EVIA 3RELA 1P3BB 4MBFA 3L2AA 4F3LB 4HHDA 1BH8B 1V9YA 2EA9A 4OQGA 3X1UD 3D72A 2Y55A 3G30A 4JJNB 3WD2A 1UWNX 5JA4B 5DNMC 4L0LA 2W27A 3RXWA 3CWFA 3HSHA 3MGQA 2ZY4A 1P3GC 5DNNC 5F82A 2H5SA 4R4RA 3C1CD 4KUDD 1DJBA 1ED7A 3MJQA 4JGRA 5L8MA 4WU8A 1P3BC 4WYYA 1ZKJA 2HP9A 1FOFA 3Q07A 3AZMC 2PYRA 4EU0A 3C4PA 1AOID 3LGOA 4DE0A 3AZID 4GHIB 3MQQA 4IJFA 1Q9CA 2FJ7D 3ICYA 5FI2A 1BUEA 1G28A 5A8BA 2HF6A 1KX5D 5KSHA 4QB8A 4KZAA 2XD1A 4B93A 1T1BA 1F66D 3NCKA 2OAQ1 1ONHA 2W3FA 3D4FA 2W3EA 4KHAA 3C38A 3LR0A 3S7NA 3WS1A 4MBKA 2M7UA 2M1CA 3UE1A 3ZHHA 4YS3A 5GSUD 4LLOB 4CJNA 4X56A 4JXGA 2FFYA 4UAAA 4EUZA 2W0NA 1K6RA 2P9VA 5GHXA 4KUOA 4DXBA 1P3GB 5B1MD 1LI9A 2DQNC 3LIDA 4P6BA 1K56A 4EBPA 3S7OA 3KSIA 4MLLA 3CAXA 1VEUB 4R8PA 1TAFA 1E6RA 5AV9A 4B4XA 5AVBD 3V9RB 1F66C 1P3AA 1I2SA 1ERMA 4GN2A 4MN5A 3MGPA 2XH9A 4S2KA 2KLIA 4DMZA 3LJAC 3NQUB 4PKYA 3PBNA 3QP4A 2B5RA 5I94A 2IO5B 4H9OB 4DE2A 3KXBD 3MGRB 1ES5A 1LL9A 5DKKA 3T4LA 5B32D 2V2FF 4DRBA 5C5KA 5FASA 3EPLA 1K25A 1RP5A 4KUKA 3AFAA 5B24A 2WZZA 2Q9NA 2F8ND 1H3QA 5EV0A 3CPTB 3WS4A 3FYZA 4OP8A 3GVBA 3OOVA 4KUDA 3EPJA 3REKA 2HJEA 4LFUA 3G31A 4Y13A 2YFWB 2YFVB 3A3FA 3PAEA 5JRGA 1T19A 1N9LA 5HPIA 3REIB 5DNMA 1KX4C 3AZHC 2ZY5A 2EXAA 4Z2MG 1K57A 1P34C 5B2JA 3REHD 4KUDB 3B6GC 3C1CC 1P3KA 1HTZA 3M6HA 1YU3A 1D06A 2PU4A 4NE5A 1P3IB 1K57C 3W98B 1OGBA 4YM6B 2JKTM 1AOIB 5AV8B 4UUZA 4JGOA 3MXQA 2PYOC 3UTBB 5BNVB 1EQZD 3DWKA 2Z2LB 1P3FD 5JRGB 3AZKB 1WWIA 1AWIA 3LJAA 3REIA 2J3TD 3EPHA 4FH2A 4FTXA 3C1BC 3L29A 3SH9A 4WMCD 3X1SA 2EWWA 3VP1A 3TU4D 3OPRA 3OPLA 2CV5D 3CUEA 4MBHA 4WN5A 4DXCA 2HDSA 5F69A 4NYYA 4OPYA 1MZUA 4OJ5A 1XJ3A 2ZM8A 3AZKC 4G92C 1BLSA 3HLEA 3EGXC 4GNUA 2XFTA 3BFGA 1SCWA 3N3FA 5DTKA 3MNNA 3PXPA 5B1MC 3F6TA 1VETB 1BFMA 4KUDC 3X1SB 2HPBA 2K7SA 3VMAA 5FAQA 4Q8IA 4QY5A 3ZVTA 2HDRA 3ZQ5A 1P3IC 3AN2C 4OLGA 1D1JA 3CJMA 3CG5A 2KX6A 1KGFA 2EWVA 1N1JB 5F99D 4FOFA 3V50A 4AWLB 4P0MA 4CLCA 5EVEA 3ZYTA 3N8SA 5B31D 3X1VB 1XXMA 3CUEC 3X1TA 1LSXA 2RCXA 2ZL1A 2WUQA 3A3JA 5B1LA 3VSKA 1LHYA 3IBRA 4CSRA 2E8JA 2V5OA 4OQHA 4WU9D 4N1HA 3PBTA 3U2AA 4GB7A 1G68A 3CZDA 3X1UC 5AY8D 2PYOA 3P09A 5FAPA 5TJJA 2JHEA 1F98A 4E6XA 5AV5A 4P6ZM 3BFDA 3HUNA 4XT2A 1OT6A 1ALQA 2D49A 3DTMA 4LGWA 4G3VA 2XDMA 5CPKC 4BBTA 5M19A 4OH0A 4IEDA 4OUIA 3EEAA 5GLDA 2ZD8A 3FV7A 1M1AD 2J8YA 2QYBA 3WWXA 1M40A 5HDDA 2LY8A 3W4QA 2JKTI 5B32C 1CI9A 1JVJA 1G5UA 5FA7A 1FCMA 3UMDA 3E0YA 1H8YA 5CERA 4IUKA 3H82A 1EQZB 3AZIB 2G2WA 1K56D 3AZLA 4IUHA 4MCWA 2W1RA 3W96B 3AGDA 1CJFA 5AV9D 1AXBA 3LZ1A 3NHQA 2PD7A 4BBVA 2QJ5A 2UWXA 5E2GA 2BYKA 5FI6A 1QMFA 4NEED 1F66B 1CEFA 5DF7A 3IX3A 2V0UA 1ZLAB 4J8UB 4E6WA 1SKOA 3LZ0D 1W63Q 2ZOHA 4KGCA 2A3UA 4Y15A 2OV5A 4UUZB 1IKIA 5B32A 3NULA 1KX3D 2JN7A 3IXBA 3T1RA 1GOIA 1TDLA 3C2WA 2ZLYA 4WEKA 4JPMA 1YMXA 5B2ID 3GSGA 4QU3A 4IBCA 3HJKA 1CK7A 3AN2D 1HLUP 3F1OA 3UE6A 1H3OB 4L9EA 2O0YA 3T1SA 5B40B 2Y2OA 5F99B 3S1YA 5AV6C 4DN0A 5FEGA 4XUXA 4IVKA 2NZDB 5JYPA 2BTFP 3HBRA 4KQQA 2Y59A 1BH8A 4U0XA 2ZMFA 1KDWA 3IF6B 3BFCA 4UQIM 5B33B 3A6NA 2F8NG 4MN7A 3AYWB 2QZ6A 3GDIA 3KXBB 2G2UA 3MGRD 5HAPA 3Q1FA 3UT9C 4OJ6A 5B2JD 4J8WC 4WU9C 1LI0A 3BY8A 1RGYA 3L27A 1RGZA 3AV2B 1M19C 2BYMA 4HOIA 1J3WA 2HIOC 3H7WA 1WYCA 4H9RB 5GXQD 4L9FA 3VOZA 2ZM2A 5GL9A 3DTIA 1TD5A 3AZLC 1SDEA 3KYQA 3A6NC 4QHCA 5AV6A 3LR5A 1L0GA 1ID3B 3KS8A 2Y91A 2O9BA 2ZQAA 3WS5A 3GMWA 4LENA 4F3LA 1PW8A 3B6GA 1NZOA 1EI5A 3WTPA 1P3PA 3REID 1R4VA 4DJ3A 1TDGA 4E3KA 2HIOB 4KG5A 4IBRA 4J8VB 5CX7A 5CHLB 1P3OC 4IVIA 4YS3C 4HJ6A 2JCHA 4BLMA 5G4ZA 3UTAD 5EPHA 5CP6D 1K54A 3WD0A 2J3WA 3Q7VB 3G34A 2D01A 3NBLA 4D2OA 4LRZE 3AYWC 4HNBA 3UB6A 2ZJ9A 1P3ID 4JLFA 3C8CA 4KZBA 3B6FC 2M7VA 1PW1A 4ZUXA 1WA9A 3AZMB 3MXRA 5F5YA 1ZLAC 4CQHA 4Y17A 3KXBA 2A2LA 4O01A 1M18C 1H5XA 3C7UA 5B31C 3UDXA 3X1UA 3JVUA 3V9RA 4XZQB 1BH9B 4WELA 3WKJB 3GTCA 5TBMA 2EFXA 1ES2A 3IWOA 2GZAA 3D9YA 3MGQD 1GA9A 3H7WB 2PDRA 4OPRA 5BO0B 5B31A 1ZLAD 4J8UD 3UN7A 3AZMA 2CV5B 3S7PA 4E3LA 4QWOA 5AV6B 4E04A 4GD8A 3RFBA 3R4KA 3EWKA 2LB9A 4OQIA 5B0YC 2P9VB 3B0CT 1E6PA 1YMSA 2XA7M 4OJPA 1P3GA 1HQ3D 1XGIA 5C3IB 2WGIA 3BY9A 4LV1A 4Z9QA 4JJNA 4ME4A 3MGRA 3NI9A 1JWZA 4YM6C 3QNBA 2L4RA 4DDSA 1S32A 3HUMA 3AZNA 2XD5A 1PYYA 1F66A 2NZDD 3B0DC 3WD4A 2A24A 1MWSA 5F6AA 5FQQA 2PBDP 3TRCA 4CPKA 4PM9A 3RELB 3T4TA 3I7JA 4WZ5C 4GLQA 2CWEA 4X23D 4PKYG 4GHIA 3AZHD 2WAFA 5HWWA 4OP5A 2C6WB 2GDNA 3GECA 2NQBC 2YKHA 5CPKD 3BECA 5AQBA 1PNEA 3KX0X 1MWTA 4QD4A 1K4EA 2P7JA 3LICA 1WE4A 2JKRM 1ZTUA 2PR5A 4PAUA 3WS2A 2RL3A 1BLCA 4R1GA 1H0IA 4S2JA 1U35B 2HUEB 3REJA 5AVCA 2O9AA 4H9QB 4WUJA 1P3MC 3ZGAB 1P3IA 3IX8A 5EFWA 2JSSA 2IWCA 4JXSA 5BNXB 5DNND 1Z6FA 2HIOD 4X1MA 4Z2HA 3MSHA 1O07A 3MQOA 4WU8C 3WD3A 1TAFB 5B0YA 3REJB 2VGLS 3LR4A 3C1CB 3HUOA 2WADA 5CP6B 3VP2A 3VH6T 4JXVA 4EQIA 2DRWA 1KX3A 4UHUA 3SS5A 4Z66A 3IX4A 1BZAA 4LCMA 5AV8C 3REKD 1OJ5A 3KWQD 5KMWA 1S32C 5AVEA 3EQUA 3X1TD 1V9ZA 2A49A 2IWDA 4O0PA 4BD1A 3LJAB 1YU1A 1OTDA 2G5HC 5CP6C 2FZ0A 5KIZA 4UQIS 3AFAC 1BLHA 3A3DA 3D3OA 2XFSA 1TZYC 1DRMA 5E2EA 2Q9MA 4WF0A 5GSUB 3EPKA 4NYUA 5HDCA 3ZG9B 3W2ZA 5GT0D 1MPLA 4YINA 2FJ7A 5B1LC 4CSRB 3L26A 1IYSA 4QNLA 1N9BA 3HLGA 3QP2A 3F1NA 3TSGA 3MR0A 2JKRI 3ZG7B 3GV9A 3X1VA 5B1MB 4I3AA 4H9PA 2Y2KA 3M2JA 4EO5C 4ZJ2A 5B2IB 2K31A 3VP4A 5EM0A 1YQSA 5AVBB 3AZEC 3E2LA 3CPTA 4KZ9A 1OTIA 2Q0OA 3NJAA 2Z2MB 5JYOA 2R9XA 4D60A 2I9VA 1STZA 3HLCA 1OTEA 1P34B 4K08A 3B0BA 2XEPA 3VH5A 3OCNA 4R3AA 2HJ9C 5E2FA 4BQMA 4EETB 2OSUA 1YLYA 3MFDA 3G4PA 1ESIA 4J8VC 4NXFA 5HSQA 3AZGA 2PYOB 4X53A 3UTBC 2VQRA 5F1GA 4BL2A 3MGPC 3NDGA 4Z5TC 3VH5W 4KENB 5EM1A 2W1TB 5IHVA 5CPIC 4F94A 3LZ0A 3UTBA 4JGPA 4BL3A 4S2LA 4QLCA 1CF0A 1BT5A 2Y4AA 4DJ2A 5EVLA 4S2OA 2WGVA 1P3KC 3WKJC 1DP9A 2PBYA 1F1EA 1ZLAA 1KDSA 5GLAA 5DJUA 2F8NK 4IJEA 2B02A 1OJGA 3MGSB 4ESPA 2JC7A 3L25A 4LCLA 3A1IA 5CPIA 3UTAB 4LD9C 4PPRA 3KYZA 1KGEA 1YLPA 2EX8A 4ZTKA 3REKB 4OOLA 4ZBEA 1PI4A 5CPJB 3H9WA 3KSHA 4C75A 5M18A 3HONA 5KSCA 5B0ZD 1O7EA 4X55A 2XK1A 4K0WA 2P04A 3REHA 4GS9B 3LELC 3NIAA 2J3TC 3PBRA 4XZQD 5HL6A 1CK3A 3JYIA 2ZY3A 1P3MD 3KUYB 2H0YA 5IT5A 1KX4D 5B24B 5AY8C 1TS7A 1KE0A 1SKFA 3H82B 3VE3A 3MS6A 3LIFA 4KQDA 1K6SA 2BASA 2MJ6A 3HLWA 1M18A 3PBSA 5AV6D 3UT9A 4ETXA 4PM5A 4HH2A 3LELB 1MWUA 4HMCA 5B1LB 4HIAA 3B6GD 2PU2A 3LZ1C 3KSGA 1W5DA 2YFVA 3X1SD 3AZLD 3AGEA 3AYWA 4KG6A 4KZ4A 4L9GA 4P87A 3QNCA 4N92A 5FDSA 5B40A 4J8XC 3AZED 4LD9B 4R8PD 4KZ5A 4I39A 3AZFC 4P85A 3EG5B 1P3LD 2ZBBA 1YLWA 1M18B 3UB9A 5CEDA 3FKVA 4JF5A 3UTAA 3TE8A 2X71A 5GHZA 4UA9A 5K5BA 1PDCA 2KOIA 5GT3D 1OT9A 3WTPC 4ZDXA 3O62A 5E5AB 2Y8HA 4KQRA 1FSWA 1S0WA 2VGLM 3VH6A 3DTEA 3IXGA 3LCEA 3PR6A 1K55C 4WU9B 2FH5A 3E98A 4GDNA 5EUAA 1PWDA 3IP4C 3NQJA 1FIKA 4Y0TA 3KFUG 4IBEA 4ZBJB 2WGWA 3EQVA 3K3DA 1DJAA 3EEHA 2RTSA 4Z66D 3REHC 1BULA 3OCLA 1E6NA 2OAP1 1U35D 2VV6A 4PM8A 3LFVA 3MQLA 5AQAA 1S4SA 3N8LA 3QP1A 2Y2LA 3FPVA 3W97D 3A6ND 1FSYA 1P9RA 2ZL1B 3R45B 1FILA 2Y2GA 2LB5A 2V8CA 3RH8B 4EXOA 3BWLA 1VB6A 4TX8A 4H8RA 3A1KA 3VFHA 4ID4A 2Z6CA 4IBXA 3R7WB 4NFTA 3N8RA 2W8SA 1P3OB 4WEJA 1P3PC 3CI6A 2GX5A 4ZJ3A 1T18A 4XUJD 2NZDA 1GXDA 1W2EA 4RX2A 5HD5A 4GD6A 1KX4A 4EEPA 3VH5T 5DFXA 4C3QA 1KU5A 4KGCB 4ZUXB 1Q2QA 2VGKA 1UR9A 3H0RC 3LUQA 4OPZA 1A0KA 1S1YA 5TGFA 5BS7A 1ERQA 5FUGA 3ZDJA 3W96D 3MFXA 4E44A 2V20A 4LV2A 3GRJA 5FQIA 3H0LC 3LJAD 3G32A 3OPHA 4IBFA 4RVAA 5FQ9A 4OLDA 2OLVA 3AZJB 4OOYA 1Q2PA 3VSLA 3ZG0A 5J7EA 3Q81A 2CV5A 2ZC5B 2W3DA 2VGJA 1MBLA 5L10A 3UO9A 2PR6A 5GT0B 3WAAD 5FUGB 1YAXA 5DVAA 3LELD 3IWIA 4X23C 3ZVWA 4WZSB 1KS0A 3LZ1D 2JKGA 5HDSA 3WTPB 5DFYA 1NRFA 1W1YA 1TS0A 4OPQA 2IO5C 4UEYA 3VOYA 3JPUA 5BS7C 3MGRC 3SH7A 2GNXA 5FDHA 4LD9D 3LIAA 2BYMB 5B2JC 4J8WD 2V1ZA 1HQ3C 2PT7A 4R8PC 3SOIA 3AZFD 1P3AB 2Y2PA 1JWVA 2A24B 3B0DB 2XGNA 4NK3A 3O62C 1G6AA 4Z5TB 3W8KA 4QY6A 5GT3B 1GHMA 1GHIA 5EECA 2HDUA 3RELC 4IHQA 5E5AD 1KOUA 1M6KA 3MZEA 3AZNC 2L1MA 2OWJA 3KWQA 4DKIA 1MWRA 4EUVA 3MVDA 3V67A 5G4YA 5B2JB 4JKTA 4EBLA 1P3GD 1O6IA 1C3BA 5KDMB 3CHWP 2FJ7C 3DWZA 4GHLA 1NYMA 5CECA 3LZ0C 1P0ZA 3IBJA 3A0RA 1IFQA 3VV4A 3LI8A 3BLMA 4UA7A 4WBGA 3C30A 4JBFA 1N4OA 4XUJA 5B0ZA 2HP5A 1S67L 1ULYA 1XJ6A 2QKPA 1XJ4A 3B6FD 4YS3D 1E25A 1P97A 1ZC2A 1AOIC 2CV5C 2VZWA 5B32B 3EGDC 1XGJA 4N1XA 3IT9A 1Y4OA 5DTTA 1M19B 5B0YB 1P3OD 1PFLA 3BLSA 5FEFA 3NOPC 1FR6A 1W8QA 2DMWA 5FATA 4CAYA 3UB7A 1CXWA 2CMNA 2FN2A 3NQUA 4YM6A 5F68A 1S66L 4I38A 4NKPA 4EEUA 1J7MA 4I3JA 3V3RA 3ZFZA 2FJ7B 1BLPA 4R3BA 2B95A 2Y2HA 3S7QA 3AZEA 1JTGA 1N1JA 4X25A 3RXXA 1L3LA 4KG2A 5CP6A 1VEUA 4HH3A 1ES3A 4X68A 3X1SC 4HMEA 3W99B 1PIOA 2AROC 1NXYA 4IBKA 4IJGA 3KSYA 1T3UA 3AFAD 1PZPA 5J4EA 1MXOA 1WYBA 4E45A 5BT1C 1Y54A 1BTLA 3G2ZA 3TOIA 3W98D 2WKIA 3LO7A 4IBDA 1JWPA 2AVXA 1S6RA 4DE1A 1ID3A 1A7WA 1XP4A 2RIQA 2K2NA 3LY3A 4U3TA 3ITBA 1GA0A 3G35A 5B2IA 5JRGD 3UPNA 2XF3A 4PM6A 3V39A 4KZ3A 5B33C 4LG2A 1K54C 2NQBD 4XT2B 3AZEB 2HV1A 4QPRA 3NOTC 2ZQ8A 4M4XA 4H6JB 4WU8D 3E2KA 3E4OA 1JFIB 3ZG5A 5FI7A 2ZQ9A 1ODVA 5EOEA 1EWZA 2Y2MA 2GJ3A 2RVQC 3FKWA 4Q0IA 1UGUA 5DNMB 2ZOIA 1X0OA 3C1BB 5CRFA 4HGAC 1S32D 1KVLA 5CPKB 2C5WB 1ID3C 1EAKA 4H9SA 3BJNA 1M1AA 4EBNA 5HFOA 2P74A 4NY2A 4NZ3A 4RA7A 1TS6A 2UV0E 1L0DA 4I3IA 4WMCA 3MZDA 5CHJA 4GS9A 1F2KA 4E3JA 2EX6A 1UWPX 2HP6A 4YS3B 5DKLA 1ZG4A 2ZY2A 4GCZA 4JGQA 4LRXC 4GHAA 3C7VA 5L2FA 1GPFA 5GSUC 4PMAA 1W1VA 3O3VA 1I2WA 4WJ3C 1XX2A 1YT4A 1M19D 3P5JB 1P3FC 5CGWA 3FPWA 1GCEA 3REJD 5AVBA 2VKSA 5HWTA 3ZG8B 1KX3C 3AL0C 3VOLA 1IYQA 3PBOA 1FQGA 1QMEA 4H6JA 3PBQA 3AV1C 1I5QA 4EERA 4IBBA 3W99C 5AVCB 3FC7A 4E3NA 4CLCC 3REKC 1HD8A 5AV8D 5DTSA 1E15A 4KGCD 4RQ9A 4ZUXD 4BENA 3TW8A 3X1TB 3T1QB 3W98A 2WKEA 1N9NA 3DBAA 2JKFA 1H3OA 1DY6A 1PZRA 4MNRA 3WAAC 1P3FB 4LD9A 1XKZA 3AZKD 5F99A 4JF6A 3AZFA 4HMDA 3VP3A 4H9NA 3KO6A 3UE0A 5F83A 3W99D 3L28A 4BD0A 3WD1A 5AVCC 4FD8A 1MY8A 3T12B 4XUJC 5L07A 4BMWA 5E5AA 4J8UA 3AV2C 5U47A 2ZM5A 1TVFA 1ONGA 4E3MA 3WAAB 3LYXA 1YPRA 1MKIA 3LZ1B 1YLZA 1OTBA 1YKDA 2ZC6B 2R9WA 4Y3IA 1L0EA 3U4LP 3BW6A 3UNWA 5FQKA 4HGAB 1WWSA 4J8WB 3Q82A 4J8UC 3H0MC 2HGVA 3IXHA 5GXQA 1XA7A 3B42A 3AZFB 1SKOB 5G18A 4J8XD 3UY6A 3RJUA 5LBRA 3AZIC 1HZOA 1P34D 3B6FA 1K4FA 1P3KB 3X1VD 2Y2NA 3IS2A 5M1AA 4OKPA 3W97C 3MKFA 5JA4A 3HLBA 4DRAA 1P3PD 3QHYA 5EVIC 5EOOA 2HZ5A 3MNNB 3W96A 1P3OA 1K38A 3UPPA 2Y79A 2FFFB 4EO5B 1CEGA 4H9NB 1PWGA 2QJ7A 5B40D 3N4IA 1IOUA 3MGSA 1GHPA 3CMZA 5CHUA 1H8MA 1H0MA 3VP0A 5GLBA 5A92A 3JVVA 5G49A 4G92B 1GSWA 1HTAA 3MVDC 1EROA 4R4SA 4MDZA 3UT9B 1P3BA 5B33D 5HX9A 4GOGA
chains in the Genus database with same CATH topology
1YU4A 4DDYA 4HEFA 3B6FB 4GDBA 5EVID 3AGFA 1YLTA 4LV0A 2QPNA 2F8NA 5AV9C 4J8WA 4Y0OA 5B0YD 3KUYA 4RYEA 4GH9A 2ZC3B 3AN2A 4XXRA 5AV5B 4KGCC 1ID3D 5CPJD 4IBGA 4G91B 3MXSA 4UPKA 5CEBA 1HQ3A 2ZQDA 3X1UB 5AV9B 4JJND 3IHAA 3N7WA 1EQZC 3AZIA 4EWFA 3HLFA 5AY8A 1L0FA 4KQOA 5GHYA 2Y2QA 4YFMA 5BO0A 1KX5A 1KX4B 2DNSA 3AZGB 2JBFA 5HARA 2HUEC 5KDMA 2WYXA 3B6GB 1LL5A 1EQZA 1IKGA 4OQ0A 1NY0A 2H0TA 4NZ4A 3NQJB 1KX5B 3M2KA 4R8PB 5HAIA 4H9RA 2NQBB 2AROD 1M18D 1P3AC 3IHBA 3ITAA 4WU8B 2XR0A 3MBZA 5GT3C 1NYYA 4H9SC 2EX9A 5HW3A 1B6WA 4H9OA 3WAAA 3AYWD 1P3PB 3MVDB 1VQQA 5GXQC 5CGXA 5B33A 3MNND 1TEMA 1S32B 1P3LA 1L2SA 3AV2D 1SHVA 4DF6A 3O88A 1U60A 3REJC 4H9QA 4CAYB 2YFWA 3MZFA 4FCFA 3A6NB 3AZJC 1FCOA 3AZHB 4X6TA 3W4OA 4FH4A 4QLCD 4AWLC 1BH9A 2WK0A 4J8VD 5GT0C 5A91A 1U35A 4HESA 3BFEA 1DJCA 5FQMA 2NQBA 4XUJB 4B4ZA 2X01A 3WS0A 5AV5D 5CPID 1YLJA 3W97A 3KXBC 3IH9A 4QLCC 4IBIA 1CI8A 3SS3A 2ZM0A 4A5RA 4UA6A 1YU2A 4R0QA 4EV4A 5B31G 3AZND 5JRGC 3WKJD 3BRMA 3MGQB 2OLUA 1NJ4A 3IF6C 1P3MA 2DCFA 5GSUA 4X23A 4Z5TA 2G5IC 1ZG6A 4KHAB 1KE4A 5B0ZC 4YM6D 3KWQB 5EE8A 1YM1A 3WTPD 1M1AC 1TZYB 5CGSA 3WA9D 1YU0A 4NZ1A 4S2NC 5DF9A 3IH8A 1M19A 1P3AD 3LEZA 3WRTA 3UDIA 4NE3A 3A3EA 3W96C 3FZCA 5DNNA 3KWQC 5J8XA 4U0TA 3S4XA 4N9LA 3RELD 4KZ8A 4QJGA 4X23B 3Q7VA 2EX2A 2XLNA 2X02A 3HL9A 5AVBC 4NE6A 3AZKA 3UE3A 3OZHA 2WZXA 1PZOA 1SDNA 1TZYA 3W99A 5HAQA 2Y2IA 4S2NA 5E2HA 3ZNYA 3AZJA 3C1BA 5B31B 5B24C 4OJOA 3M6BA 5KZHA 5DNNB 4R3JA 5F99C 2EXBA 5GT0A 4QLCB 5CPJC 4H9PB 1YUEA 2BYKB 3S22A 1FR1A 3IWQA 4HBTA 3MKEA 3MGPB 3KS4A 4Z66C 4M6BA 5CPIB 2WAEA 3WTPE 3MGQC 3HREA 4BJPA 1JFIA 3AV1B 1KE3A 4NETA 3UDFA 1P34A 3N6IA 1ESUA 4OJLA 4WNNB 5CHMA 3HVFA 4OONA 5B1MA 4JXWA 1J9MA 5CPKA 5BOHA 3TU4A 3PAGA 3X1VC 1M1AB 3UTAC 2Y2JA 3WA9A 2ZQCA 3AV1A 1BSGA 3AFAB 3MGSD 2QMIA 1OMEA 4OOMA 3AZGD 4WNNA 5FAOA 3B3XA 1VM1A 1B67A 5BNVA 5B0ZB 3AV2A 3TU4C 5AV5C 1FCNA 4WM9A 2ZQ7A 3WA9B 1IELA 3MGSC 2I72A 4O7DA 1P3MB 2ZMAA 3KUYD 2AROB 2EFUA 5CXWA 1LLBA 1H8ZA 3C1CA 2ZC7A 3BFFA 5CTMA 4E3IA 4HBUA 3LZ0B 3HLDA 5G49B 4GZBA 5DNMD 3P98A 4KZ6A 5AQ7A 1KX3B 3C1BD 3BM6A 2L5AA 3MVDD 1NZUA 3UPOA 1AOIA 3IF5A 3SS4A 3KUYC 1KVMA 4DRTA 3AN2B 2PYOD 2WGWB 4JF4A 4OVDA 3REIC 5D3OA 3B0CW 5C3IC 1RCJA 1Z2CB 4C6YA 3IQAA 3NDEA 4XZQA 3WA9C 5B2IC 1IYPA 4ZUXC 4M3KA 4DE3A 4Z2MH 2J9OA 5A90A 2IWBA 3O87A 5AQ9A 1PWCA 4E3OA 5A93A 2F8NB 2DF4C 4FSFA 2J7VA 2F8NH 4S2MA 3FDDA 5GXQB 2AROA 1HVBA 3AV1D 5B32G 4KZ7A 5AVCD 2HDQA 3W4PA 1P3LC 1PI5A 3GQZA 3LELA 3R45A 2CC1A 2ZC4B 3O62B 1IEMA 4G91C 1P3BD 1E3UD 1XPBA 3LY4A 3VFFA 5BPVA 1U35C 3ISGA 3AZNB 1W79A 5CTNA 2E8IA 3REHB 1W7FA 4GKUA 5TR7A 3ZCZA 1IYOA 3G2YA 1KGGA 3WX7A 5B24D 3IXDA 3MNNC 4XUZA 3AZGC 3FKEA 4WZ4A 4WV4B 5HL1A 5FSRA 5CPJA 3UTBD 3AZMD 5B1LD 4NZ5A 5F1FA 4S2IA 3TG9A 2RVQD 4WU9A 3AZLB 3OC2A 4PM7A 5GLCA 3VH6W 5E43A 2BG1A 3OPPA 1TZYD 1KX5C 4J8VA 3TU4B 1K55A 2H10A 1P3LB 3A3IA 3AZJD 4J8XB 3FWLA 3BYDA 2BLSA 1E4DA 4ZBJC 4Y7PA 2F2AC 5BNXA 1P3KD 3W98C 4IBJA 3NY4A 4K0XA 1JTDA 3WRZA 3V5MA 3O86A 4RX3A 3IF6A 4Y0UA 3V3SA 3BEBA 1HQ3B 4ZJ1A 4K91A 4ZAMA 5DF8A 3AZHA 3WKJA 4MEZA 4J8XA 5B40C 3GR2A 1P3FA 4JJNC 2J9PA 2WKHA 1XA1A 4Z66B 2IOUA 5BT1D 2NZDC 4LV3A 4XZQC 4Z5TD 4B88A 3UT9D 2J8PA 3W97B 3PTEA 4R23A 5EVIB 4WZ5A 1E3UA 3C4OA 3NC8A 5FQJA 5AY8B 4DQYB 1W8YA 3Q7ZA 3ZNTA 2HIOA 3X1TC 3MGPD 4N9KA 1ES4A 3C5AA 3SH8A 4S2PA 5E5AC 2JE5A 5GT3A 4X69A 5AV8A 5TFQA 3O62D 2XQZA 3DW0A 5EVIA 3RELA 1P3BB 4MBFA 3L2AA 1BH8B 4OQGA 3X1UD 2Y55A 3G30A 4JJNB 5JA4B 5DNMC 4L0LA 3RXWA 3HSHA 3MGQA 2ZY4A 1P3GC 5DNNC 5F82A 2H5SA 4R4RA 3C1CD 4KUDD 1DJBA 4WU8A 1P3BC 4WYYA 1ZKJA 2HP9A 1FOFA 3Q07A 3AZMC 3C4PA 1AOID 4DE0A 3AZID 4IJFA 1Q9CA 2FJ7D 5FI2A 1BUEA 1KX5D 5KSHA 4QB8A 4KZAA 2XD1A 1F66D 3NCKA 1ONHA 3D4FA 4KHAA 3WS1A 4MBKA 3UE1A 3ZHHA 4YS3A 5GSUD 4CJNA 4X56A 4JXGA 2FFYA 4UAAA 4EUZA 1K6RA 2P9VA 5GHXA 4DXBA 1P3GB 5B1MD 1LI9A 2DQNC 4P6BA 1K56A 4EBPA 4MLLA 4R8PA 1TAFA 5AV9A 4B4XA 5AVBD 3V9RB 1F66C 1P3AA 1I2SA 1ERMA 4GN2A 3MGPA 2XH9A 4S2KA 3LJAC 3NQUB 3PBNA 2B5RA 5I94A 2IO5B 4H9OB 4DE2A 3KXBD 3MGRB 1ES5A 1LL9A 5B32D 2V2FF 4DRBA 5FASA 3EPLA 1K25A 1RP5A 3AFAA 5B24A 2WZZA 2Q9NA 2F8ND 3WS4A 3FYZA 4OP8A 3GVBA 4KUDA 3EPJA 3REKA 3G31A 2YFWB 2YFVB 3A3FA 3PAEA 5JRGA 3REIB 5DNMA 1KX4C 3AZHC 2ZY5A 2EXAA 4Z2MG 1K57A 1P34C 5B2JA 3REHD 4KUDB 3B6GC 3C1CC 1P3KA 1HTZA 3M6HA 1YU3A 2PU4A 4NE5A 1P3IB 1K57C 3W98B 4YM6B 1AOIB 5AV8B 4UUZA 2PYOC 3UTBB 5BNVB 1EQZD 3DWKA 2Z2LB 1P3FD 5JRGB 3AZKB 1WWIA 3LJAA 3REIA 3EPHA 4FH2A 3C1BC 3L29A 3SH9A 4WMCD 3X1SA 3VP1A 3TU4D 3OPRA 3OPLA 2CV5D 4MBHA 4DXCA 2HDSA 4NYYA 4OPYA 4OJ5A 2ZM8A 3AZKC 4G92C 1BLSA 3HLEA 4GNUA 2XFTA 3BFGA 1SCWA 3N3FA 5DTKA 3MNNA 5B1MC 3F6TA 1BFMA 4KUDC 3X1SB 2HPBA 3VMAA 5FAQA 4Q8IA 4QY5A 3ZVTA 2HDRA 1P3IC 3AN2C 4OLGA 3CJMA 3CG5A 1KGFA 1N1JB 5F99D 3V50A 4AWLB 4P0MA 3N8SA 5B31D 3X1VB 1XXMA 3X1TA 2RCXA 2WUQA 3A3JA 5B1LA 3VSKA 1LHYA 4CSRA 4OQHA 4WU9D 4N1HA 3PBTA 4GB7A 1G68A 3CZDA 3X1UC 5AY8D 2PYOA 3P09A 5FAPA 4E6XA 5AV5A 3BFDA 3HUNA 1ALQA 3DTMA 2XDMA 5CPKC 5M19A 4OH0A 4IEDA 4OUIA 5GLDA 2ZD8A 3FV7A 1M1AD 2J8YA 3WWXA 1M40A 2LY8A 3W4QA 5B32C 1CI9A 1JVJA 5FA7A 1FCMA 1H8YA 5CERA 1EQZB 3AZIB 2G2WA 1K56D 3AZLA 3W96B 3AGDA 5AV9D 1AXBA 3LZ1A 2UWXA 5E2GA 2BYKA 5FI6A 1QMFA 1F66B 1CEFA 5DF7A 1ZLAB 4J8UB 4E6WA 3LZ0D 4KGCA 2A3UA 2OV5A 4UUZB 1IKIA 5B32A 1KX3D 3IXBA 1TDLA 2ZLYA 4WEKA 4JPMA 1YMXA 5B2ID 3GSGA 4QU3A 4IBCA 3AN2D 1H3OB 5B40B 2Y2OA 5F99B 3S1YA 5AV6C 4XUXA 4IVKA 2NZDB 5JYPA 3HBRA 4KQQA 2Y59A 1BH8A 4U0XA 1KDWA 3IF6B 3BFCA 5B33B 3A6NA 2F8NG 3AYWB 2QZ6A 3KXBB 2G2UA 3MGRD 5HAPA 3Q1FA 3UT9C 4OJ6A 5B2JD 4J8WC 4WU9C 1LI0A 1RGYA 3L27A 1RGZA 3AV2B 1M19C 2BYMA 2HIOC 1WYCA 4H9RB 5GXQD 3VOZA 2ZM2A 5GL9A 3AZLC 1SDEA 3A6NC 4QHCA 5AV6A 1L0GA 1ID3B 3KS8A 2Y91A 2ZQAA 3WS5A 3GMWA 4LENA 1PW8A 3B6GA 1NZOA 1EI5A 3WTPA 1P3PA 3REID 1R4VA 1TDGA 4E3KA 2HIOB 4KG5A 4IBRA 4J8VB 5CHLB 1P3OC 4IVIA 4YS3C 2JCHA 4BLMA 3UTAD 5EPHA 5CP6D 1K54A 3Q7VB 3G34A 3NBLA 4D2OA 3AYWC 2ZJ9A 1P3ID 4JLFA 4KZBA 3B6FC 1PW1A 4ZUXA 3AZMB 3MXRA 1ZLAC 3KXBA 1M18C 1H5XA 3C7UA 5B31C 3UDXA 3X1UA 3V9RA 4XZQB 1BH9B 4WELA 3WKJB 3GTCA 2EFXA 1ES2A 3IWOA 3MGQD 1GA9A 4OPRA 5BO0B 5B31A 1ZLAD 4J8UD 3UN7A 3AZMA 2CV5B 4E3LA 5AV6B 4GD8A 4OQIA 5B0YC 2P9VB 3B0CT 1YMSA 4OJPA 1P3GA 1HQ3D 1XGIA 5C3IB 2WGIA 4LV1A 4Z9QA 4JJNA 3MGRA 3NI9A 1JWZA 4YM6C 3QNBA 4DDSA 1S32A 3HUMA 3AZNA 2XD5A 1PYYA 1F66A 2NZDD 3B0DC 1MWSA 5FQQA 4CPKA 4PM9A 3RELB 3I7JA 4WZ5C 2CWEA 4X23D 3AZHD 2WAFA 4OP5A 2C6WB 2GDNA 2NQBC 5CPKD 3BECA 5AQBA 1MWTA 4QD4A 1K4EA 1WE4A 3WS2A 2RL3A 1BLCA 4R1GA 4S2JA 1U35B 2HUEB 3REJA 5AVCA 4H9QB 1P3MC 3ZGAB 1P3IA 2JSSA 2IWCA 4JXSA 5BNXB 5DNND 1Z6FA 2HIOD 1O07A 4WU8C 1TAFB 5B0YA 3REJB 3C1CB 3HUOA 2WADA 5CP6B 3VP2A 3VH6T 4JXVA 4EQIA 2DRWA 1KX3A 4UHUA 3SS5A 4Z66A 1BZAA 4LCMA 5AV8C 3REKD 3KWQD 5KMWA 1S32C 3EQUA 3X1TD 2A49A 2IWDA 4BD1A 3LJAB 1YU1A 2G5HC 5CP6C 3AFAC 1BLHA 3A3DA 2XFSA 1TZYC 5E2EA 2Q9MA 5GSUB 3EPKA 4NYUA 3ZG9B 5GT0D 1MPLA 4YINA 2FJ7A 5B1LC 4CSRB 3L26A 1IYSA 4QNLA 1N9BA 3HLGA 3TSGA 3ZG7B 3GV9A 3X1VA 5B1MB 4H9PA 2Y2KA 3M2JA 4EO5C 4ZJ2A 5B2IB 3VP4A 1YQSA 5AVBB 3AZEC 3E2LA 4KZ9A 2Z2MB 5JYOA 2R9XA 3HLCA 1P34B 3B0BA 2XEPA 3VH5A 3OCNA 5E2FA 4BQMA 2OSUA 1YLYA 3MFDA 3G4PA 1ESIA 4J8VC 3AZGA 2PYOB 4X53A 3UTBC 2VQRA 5F1GA 4BL2A 3MGPC 3NDGA 4Z5TC 3VH5W 4KENB 5IHVA 5CPIC 4F94A 3LZ0A 3UTBA 4BL3A 4S2LA 4QLCA 1BT5A 2Y4AA 5EVLA 4S2OA 2WGVA 1P3KC 3WKJC 2PBYA 1F1EA 1ZLAA 1KDSA 5GLAA 2F8NK 4IJEA 3MGSB 2JC7A 3L25A 4LCLA 3A1IA 5CPIA 3UTAB 4LD9C 4PPRA 1KGEA 1YLPA 2EX8A 4ZTKA 3REKB 4OOLA 4ZBEA 1PI4A 5CPJB 4C75A 5M18A 3HONA 5KSCA 5B0ZD 1O7EA 4X55A 2XK1A 4K0WA 3REHA 3LELC 3NIAA 3PBRA 4XZQD 1CK3A 3JYIA 2ZY3A 1P3MD 3KUYB 2H0YA 1KX4D 5B24B 5AY8C 1KE0A 1SKFA 1K6SA 3HLWA 1M18A 3PBSA 5AV6D 3UT9A 4PM5A 3LELB 1MWUA 5B1LB 3B6GD 2PU2A 3LZ1C 1W5DA 2YFVA 3X1SD 3AZLD 3AGEA 3AYWA 4KG6A 4KZ4A 4P87A 3QNCA 4N92A 5B40A 4J8XC 3AZED 4LD9B 4R8PD 4KZ5A 3AZFC 4P85A 3EG5B 1P3LD 1YLWA 1M18B 5CEDA 3FKVA 4JF5A 3UTAA 2X71A 5GHZA 4UA9A 5GT3D 3WTPC 4ZDXA 3O62A 5E5AB 4KQRA 1FSWA 1S0WA 3VH6A 3IXGA 3LCEA 1K55C 4WU9B 4GDNA 5EUAA 1PWDA 3IP4C 3NQJA 4Y0TA 3KFUG 4IBEA 4ZBJB 2WGWA 3EQVA 1DJAA 4Z66D 3REHC 1BULA 3OCLA 1U35D 4PM8A 5AQAA 3N8LA 2Y2LA 3W97D 3A6ND 1FSYA 3R45B 2Y2GA 4H8RA 3A1KA 3VFHA 4ID4A 4IBXA 4NFTA 3N8RA 2W8SA 1P3OB 4WEJA 1P3PC 4ZJ3A 4XUJD 2NZDA 1W2EA 4RX2A 4GD6A 1KX4A 3VH5T 4C3QA 1KU5A 4KGCB 4ZUXB 1Q2QA 2VGKA 3H0RC 4OPZA 5TGFA 5BS7A 1ERQA 5FUGA 3ZDJA 3W96D 4E44A 2V20A 4LV2A 3GRJA 5FQIA 3H0LC 3LJAD 3G32A 3OPHA 4IBFA 4RVAA 5FQ9A 4OLDA 2OLVA 3AZJB 4OOYA 1Q2PA 3VSLA 3ZG0A 3Q81A 2CV5A 2ZC5B 2VGJA 1MBLA 3UO9A 5GT0B 3WAAD 5FUGB 5DVAA 3LELD 3IWIA 4X23C 3ZVWA 4WZSB 3LZ1D 3WTPB 1NRFA 4OPQA 2IO5C 3VOYA 5BS7C 3MGRC 3SH7A 5FDHA 4LD9D 2BYMB 5B2JC 4J8WD 2V1ZA 1HQ3C 4R8PC 3SOIA 3AZFD 1P3AB 2Y2PA 1JWVA 2XGNA 3B0DB 4NK3A 3O62C 1G6AA 4Z5TB 3W8KA 4QY6A 5GT3B 1GHMA 1GHIA 5EECA 2HDUA 3RELC 5E5AD 1M6KA 3MZEA 3AZNC 3KWQA 4DKIA 1MWRA 3MVDA 5B2JB 4JKTA 4EBLA 1P3GD 1C3BA 5KDMB 2FJ7C 3DWZA 4GHLA 1NYMA 5CECA 3LZ0C 3BLMA 4UA7A 4WBGA 4JBFA 1N4OA 4XUJA 5B0ZA 2HP5A 1ULYA 3B6FD 4YS3D 1E25A 1ZC2A 1AOIC 2CV5C 5B32B 1XGJA 4N1XA 3IT9A 5DTTA 1M19B 5B0YB 1P3OD 3BLSA 1FR6A 1W8QA 5FATA 4CAYA 3NQUA 4YM6A 3V3RA 3ZFZA 2FJ7B 1BLPA 4R3BA 2Y2HA 3AZEA 1JTGA 1N1JA 3RXXA 4KG2A 5CP6A 1ES3A 4X68A 3X1SC 3W99B 1PIOA 2AROC 1NXYA 4IBKA 3KSYA 1T3UA 3AFAD 1PZPA 1MXOA 1WYBA 4E45A 5BT1C 1Y54A 1BTLA 3G2ZA 3TOIA 3W98D 2WKIA 3LO7A 4IBDA 1JWPA 1S6RA 4DE1A 1ID3A 1A7WA 1XP4A 2RIQA 3LY3A 4U3TA 3ITBA 1GA0A 3G35A 5B2IA 5JRGD 3UPNA 2XF3A 4PM6A 3V39A 4KZ3A 5B33C 4LG2A 1K54C 2NQBD 3AZEB 2ZQ8A 4WU8D 3E2KA 1JFIB 3ZG5A 5FI7A 2ZQ9A 5EOEA 1EWZA 2Y2MA 3FKWA 2RVQC 5DNMB 3C1BB 5CRFA 4HGAC 1S32D 1KVLA 5CPKB 2C5WB 1ID3C 4H9SA 1M1AA 4EBNA 5HFOA 2P74A 4NY2A 4NZ3A 4RA7A 1L0DA 4WMCA 3MZDA 5CHJA 4E3JA 2EX6A 2HP6A 4YS3B 1ZG4A 2ZY2A 5L2FA 4GHAA 3C7VA 5GSUC 4PMAA 3O3VA 1I2WA 4WJ3C 1XX2A 1YT4A 1M19D 3P5JB 1P3FC 5CGWA 1GCEA 3REJD 5AVBA 3ZG8B 1KX3C 3AL0C 1IYQA 3PBOA 1FQGA 1QMEA 3PBQA 3AV1C 1I5QA 4IBBA 3W99C 5AVCB 4E3NA 3REKC 1HD8A 5AV8D 5DTSA 4KGCD 4ZUXD 4BENA 3X1TB 3W98A 2WKEA 1H3OA 1DY6A 1PZRA 4MNRA 3WAAC 1P3FB 4LD9A 1XKZA 3AZKD 5F99A 4JF6A 3AZFA 3VP3A 4H9NA 3UE0A 5F83A 3W99D 3L28A 4BD0A 5AVCC 4FD8A 1MY8A 4XUJC 5E5AA 4J8UA 3AV2C 5U47A 2ZM5A 1TVFA 1ONGA 4E3MA 3WAAB 1MKIA 3LZ1B 1YLZA 2ZC6B 2R9WA 1L0EA 3UNWA 5FQKA 4HGAB 1WWSA 4J8WB 3Q82A 4J8UC 3H0MC 3IXHA 5GXQA 1XA7A 3AZFB 5G18A 4J8XD 3UY6A 3RJUA 3AZIC 1HZOA 1P34D 3B6FA 1K4FA 1P3KB 3X1VD 2Y2NA 5M1AA 4OKPA 3W97C 3MKFA 5JA4A 3HLBA 4DRAA 1P3PD 3QHYA 5EVIC 5EOOA 3MNNB 3W96A 1P3OA 1K38A 3UPPA 2FFFB 4EO5B 1CEGA 4H9NB 1PWGA 5B40D 3N4IA 3MGSA 1GHPA 3CMZA 5CHUA 3VP0A 5GLBA 5A92A 5G49A 4G92B 1HTAA 3MVDC 1EROA 4R4SA 3UT9B 1P3BA 5B33D 5HX9A 4GOGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X71 A;  5FI6 A;  1QMF A;  5GHZ A;  1W79 A;  4UA9 A;  4DDY A;  5CTN A;  1CEF A;  2E8I A;  5DF7 A;  4HEF A;  1W7F A;  4ZDX A;  4GKU A;  4GDB A;  5EVI D;  5TR7 A;  4KQR A;  3ZCZ A;  1IYO A;  3G2Y A;  1FSW A;  1S0W A;  4E6W A;  1KGG A;  3AGF A;  3IXD A;  2A3U A;  2OV5 A;  3IXG A;  1YLT A;  3LCE A;  1K55 C;  2QPN A;  4LV0 A;  4XUZ A;  1IKI A;  4GDN A;  4Y0O A;  5EUA A;  1PWD A;  3IXB A;  4WZ4 A;  1TDL A;  2ZLY A;  4RYE A;  4WEK A;  4JPM A;  1YMX A;  2ZC3 B;  4XXR A;  4Y0T A;  5HL1 A;  5FSR A;  3EQV A;  2WGW A;  5F1F A;  3GSG A;  4QU3 A;  1DJA A;  4S2I A;  3TG9 A;  1BUL A;  3OC2 A;  3OCL A;  4PM7 A;  5GLC A;  5E43 A;  2BG1 A;  2Y2O A;  3S1Y A;  3MXS A;  3OPP A;  4PM8 A;  5AQA A;  5CEB A;  4XUX A;  4IVK A;  2ZQD A;  3N8L A;  5JYP A;  2Y2L A;  1K55 A;  3HBR A;  2Y59 A;  3IHA A;  2H10 A;  3A3I A;  3N7W A;  4KQQ A;  4U0X A;  1FSY A;  4EWF A;  1KDW A;  3HLF A;  3IF6 B;  3BFC A;  3FWL A;  3BYD A;  1L0F A;  2Y2G A;  2BLS A;  1E4D A;  4Y7P A;  4KQO A;  5GHY A;  2Y2Q A;  2QZ6 A;  4H8R A;  4YFM A;  2G2U A;  2DNS A;  3VFH A;  5HAP A;  3NY4 A;  4ID4 A;  4K0X A;  3Q1F A;  1JTD A;  4IBX A;  3N8R A;  3V5M A;  3WRZ A;  3O86 A;  4WEJ A;  1LI0 A;  4RX3 A;  3IF6 A;  1RGY A;  2JBF A;  4Y0U A;  1RGZ A;  4ZJ3 A;  3V3S A;  3BEB A;  5HAR A;  4ZJ1 A;  4K91 A;  2WYX A;  1WYC A;  4RX2 A;  3VOZ A;  4GD6 A;  1LL5 A;  1IKG A;  2ZM2 A;  4OQ0 A;  5DF8 A;  4ZAM A;  1Q2Q A;  5GL9 A;  2VGK A;  4C3Q A;  4MEZ A;  3GR2 A;  1NY0 A;  1SDE A;  2H0T A;  2J9P A;  4OPZ A;  2WKH A;  1XA1 A;  4QHC A;  5TGF A;  1L0G A;  1ERQ A;  2Y91 A;  3ZDJ A;  2ZQA A;  3M2K A;  4LV3 A;  3WS5 A;  3GMW A;  4LEN A;  5HAI A;  2V20 A;  1PW8 A;  4LV2 A;  1NZO A;  3GRJ A;  5FQI A;  4B88 A;  3G32 A;  1EI5 A;  3OPH A;  4RVA A;  5FQ9 A;  3IHB A;  4OLD A;  2OLV A;  3ITA A;  1TDG A;  3MBZ A;  2XR0 A;  4E3K A;  1NYY A;  4KG5 A;  4IBR A;  4OOY A;  1Q2P A;  3PTE A;  4R23 A;  3VSL A;  3ZG0 A;  2EX9 A;  5EVI B;  3Q81 A;  5HW3 A;  4IVI A;  2ZC5 B;  4WZ5 A;  2VGJ A;  1MBL A;  1E3U A;  3UO9 A;  3C4O A;  1VQQ A;  5CGX A;  2JCH A;  3NC8 A;  5FQJ A;  4BLM A;  5DVA A;  5EPH A;  1K54 A;  1W8Y A;  3IWI A;  3Q7Z A;  3Q7V B;  3G34 A;  3ZNT A;  3NBL A;  3ZVW A;  4D2O A;  1TEM A;  2ZJ9 A;  4N9K A;  1ES4 A;  4JLF A;  3C5A A;  1L2S A;  4KZB A;  3SH8 A;  4S2P A;  1SHV A;  1PW1 A;  1NRF A;  3MXR A;  4OPQ A;  4DF6 A;  3VOY A;  2JE5 A;  3O88 A;  3SH7 A;  1U60 A;  4X69 A;  5FDH A;  1H5X A;  3C7U A;  2V1Z A;  5TFQ A;  2XQZ A;  3DW0 A;  5EVI A;  4MBF A;  3SOI A;  3UDX A;  4WEL A;  4OQG A;  2Y2P A;  3GTC A;  2Y55 A;  2EFX A;  1JWV A;  2XGN A;  1ES2 A;  3G30 A;  3IWO A;  1G6A A;  3MZF A;  4FCF A;  4NK3 A;  3W8K A;  4QY6 A;  1GA9 A;  1GHM A;  1FCO A;  4OPR A;  1GHI A;  4L0L A;  5EEC A;  2HDU A;  3RXW A;  4X6T A;  1M6K A;  3MZE A;  4FH4 A;  3UN7 A;  3W4O A;  2WK0 A;  5F82 A;  4E3L A;  2H5S A;  4R4R A;  4GD8 A;  1DJB A;  4DKI A;  1MWR A;  5A91 A;  4JKT A;  4OQI A;  4EBL A;  2P9V B;  4HES A;  4WYY A;  1C3B A;  1DJC A;  1ZKJ A;  2HP9 A;  3BFE A;  5FQM A;  1FOF A;  1YMS A;  3DWZ A;  4B4Z A;  2X01 A;  3Q07 A;  1NYM A;  3WS0 A;  2WGI A;  1XGI A;  5CEC A;  4LV1 A;  4Z9Q A;  3C4P A;  1YLJ A;  4DE0 A;  3IH9 A;  3NI9 A;  1JWZ A;  3QNB A;  5FI2 A;  4DDS A;  1BUE A;  3BLM A;  4UA7 A;  3HUM A;  4WBG A;  4JBF A;  1CI8 A;  3SS3 A;  1N4O A;  2XD5 A;  2ZM0 A;  4A5R A;  4UA6 A;  1PYY A;  4R0Q A;  4EV4 A;  5KSH A;  4QB8 A;  2HP5 A;  4KZA A;  2XD1 A;  1MWS A;  5FQQ A;  4CPK A;  3NCK A;  1ONH A;  3D4F A;  4PM9 A;  1E25 A;  1ZC2 A;  3WS1 A;  4MBK A;  3UE1 A;  3BRM A;  3I7J A;  4WZ5 C;  2OLU A;  3ZHH A;  1NJ4 A;  3IF6 C;  4CJN A;  2WAF A;  4X56 A;  1XGJ A;  2DCF A;  4N1X A;  4OP5 A;  3IT9 A;  4JXG A;  2FFY A;  5DTT A;  4UAA A;  4EUZ A;  3BLS A;  2C6W B;  1K6R A;  2GDN A;  1FR6 A;  1W8Q A;  2P9V A;  1ZG6 A;  5FAT A;  5GHX A;  3BEC A;  5AQB A;  1MWT A;  4QD4 A;  1K4E A;  1KE4 A;  4DXB A;  1LI9 A;  1WE4 A;  5EE8 A;  3WS2 A;  1YM1 A;  2RL3 A;  4P6B A;  1BLC A;  1K56 A;  4R1G A;  4S2J A;  4EBP A;  4MLL A;  3V3R A;  5CGS A;  4B4X A;  3ZFZ A;  1I2S A;  1BLP A;  1ERM A;  4R3B A;  2Y2H A;  3ZGA B;  4GN2 A;  4S2N C;  5DF9 A;  3IH8 A;  2XH9 A;  3LEZ A;  4S2K A;  3WRT A;  1JTG A;  2IWC A;  4JXS A;  3PBN A;  3UDI A;  1Z6F A;  3RXX A;  4KG2 A;  3A3E A;  2B5R A;  5I94 A;  3FZC A;  4DE2 A;  1ES3 A;  4X68 A;  5J8X A;  1ES5 A;  4U0T A;  1LL9 A;  3S4X A;  1O07 A;  1PIO A;  4N9L A;  1NXY A;  4KZ8 A;  4QJG A;  3Q7V A;  2V2F F;  1PZP A;  2EX2 A;  5FAS A;  2XLN A;  1MXO A;  1K25 A;  1WYB A;  3HUO A;  1Y54 A;  1RP5 A;  1BTL A;  2WAD A;  2X02 A;  3VP2 A;  3G2Z A;  3TOI A;  2WKI A;  3LO7 A;  2WZZ A;  1JWP A;  2Q9N A;  4JXV A;  4EQI A;  3HL9 A;  1S6R A;  2DRW A;  4UHU A;  3WS4 A;  3SS5 A;  3FYZ A;  4DE1 A;  4U3T A;  1XP4 A;  3LY3 A;  1BZA A;  4LCM A;  4OP8 A;  3UE3 A;  3OZH A;  3ITB A;  3GVB A;  1GA0 A;  3G35 A;  5KMW A;  2WZX A;  1PZO A;  3EQU A;  1SDN A;  2XF3 A;  3UPN A;  4PM6 A;  5HAQ A;  2A49 A;  3V39 A;  2Y2I A;  4KZ3 A;  3G31 A;  4S2N A;  5E2H A;  3A3F A;  3PAE A;  1K54 C;  2IWD A;  4BD1 A;  3ZNY A;  2ZQ8 A;  1BLH A;  3E2K A;  3A3D A;  3M6B A;  2XFS A;  2EXA A;  5E2E A;  3ZG5 A;  5KZH A;  4R3J A;  2EXB A;  1K57 A;  2Q9M A;  5FI7 A;  2ZQ9 A;  5EOE A;  1EWZ A;  2Y2M A;  3FKW A;  3ZG9 B;  3S22 A;  1MPL A;  1FR1 A;  4YIN A;  3IWQ A;  1HTZ A;  3M6H A;  5CRF A;  4HBT A;  2PU4 A;  1IYS A;  1N9B A;  3MKE A;  3HLG A;  3TSG A;  1KVL A;  1K57 C;  2C5W B;  3ZG7 B;  3GV9 A;  2WAE A;  4EBN A;  2Y2K A;  3HRE A;  5HFO A;  4BJP A;  2P74 A;  3M2J A;  4ZJ2 A;  3VP4 A;  4RA7 A;  1KE3 A;  1YQS A;  3DWK A;  4NET A;  2Z2L B;  1L0D A;  3UDF A;  3N6I A;  1ESU A;  3E2L A;  4KZ9 A;  4WMC A;  3MZD A;  5CHM A;  5CHJ A;  3HVF A;  4FH2 A;  4OON A;  3SH9 A;  4JXW A;  4WMC D;  1J9M A;  4E3J A;  2EX6 A;  2HP6 A;  2Z2M B;  3VP1 A;  5JYO A;  1ZG4 A;  2R9X A;  3OPR A;  5L2F A;  3C7V A;  3HLC A;  5BOH A;  3OPL A;  4PMA A;  3PAG A;  2XEP A;  4MBH A;  4DXC A;  2Y2J A;  3O3V A;  1I2W A;  2HDS A;  3OCN A;  1XX2 A;  2ZQC A;  1YT4 A;  5E2F A;  4OPY A;  4BQM A;  1BSG A;  5CGW A;  1GCE A;  2QMI A;  2ZM8 A;  3ZG8 B;  1OME A;  2OSU A;  1BLS A;  1YLY A;  3HLE A;  3MFD A;  4OOM A;  3G4P A;  4GNU A;  1ESI A;  2XFT A;  1IYQ A;  3BFG A;  1SCW A;  1FQG A;  1QME A;  3PBO A;  5DTK A;  5FAO A;  3B3X A;  3PBQ A;  1I5Q A;  4X53 A;  1VM1 A;  4E3N A;  2HPB A;  3VMA A;  5FAQ A;  1HD8 A;  5F1G A;  4Q8I A;  4QY5 A;  3ZVT A;  4BL2 A;  5DTS A;  2HDR A;  3NDG A;  4OLG A;  4BEN A;  1FCN A;  3CJM A;  3CG5 A;  4WM9 A;  2ZQ7 A;  1KGF A;  2WKE A;  4KEN B;  1IEL A;  2I72 A;  1DY6 A;  5IHV A;  4MNR A;  4F94 A;  1XKZ A;  3V50 A;  4P0M A;  4JF6 A;  4O7D A;  3N8S A;  2ZMA A;  4BL3 A;  3VP3 A;  4S2L A;  1XXM A;  1BT5 A;  2EFU A;  5F83 A;  2Y4A A;  3UE0 A;  5CXW A;  4BD0 A;  1LLB A;  1H8Z A;  2RCX A;  5EVL A;  2WUQ A;  4S2O A;  2ZC7 A;  3BFF A;  1MY8 A;  3A3J A;  4FD8 A;  2WGV A;  5CTM A;  3VSK A;  4E3I A;  1LHY A;  4HBU A;  2PBY A;  3HLD A;  4GZB A;  4OQH A;  3P98 A;  4KZ6 A;  5U47 A;  1KDS A;  5AQ7 A;  5GLA A;  4N1H A;  3PBT A;  3BM6 A;  1TVF A;  2JC7 A;  4GB7 A;  1G68 A;  1ONG A;  1NZU A;  3CZD A;  4LCL A;  4E3M A;  3UPO A;  1MKI A;  4PPR A;  1KGE A;  3IF5 A;  1YLP A;  3SS4 A;  2EX8 A;  3P09 A;  4ZTK A;  1KVM A;  5FAP A;  4DRT A;  4OOL A;  1YLZ A;  4ZBE A;  1PI4 A;  2WGW B;  2ZC6 B;  4JF4 A;  4E6X A;  4OVD A;  3BFD A;  4C75 A;  2R9W A;  3HUN A;  5M18 A;  1L0E A;  1ALQ A;  5KSC A;  1O7E A;  3UNW A;  5FQK A;  5D3O A;  4X55 A;  2XK1 A;  4K0W A;  3DTM A;  1RCJ A;  2XDM A;  3Q82 A;  3NIA A;  3PBR A;  4C6Y A;  3IXH A;  1XA7 A;  5G18 A;  5M19 A;  4OH0 A;  1CK3 A;  3IQA A;  3JYI A;  3NDE A;  4IED A;  3UY6 A;  3RJU A;  1IYP A;  5GLD A;  2ZD8 A;  1HZO A;  2H0Y A;  1K4F A;  4M3K A;  4DE3 A;  3FV7 A;  2J8Y A;  2Y2N A;  5M1A A;  2J9O A;  4OKP A;  5A90 A;  1KE0 A;  1SKF A;  3MKF A;  2IWB A;  3WWX A;  3O87 A;  5AQ9 A;  1PWC A;  1K6S A;  4E3O A;  3HLW A;  3HLB A;  5A93 A;  3PBS A;  1M40 A;  3QHY A;  5EVI C;  5EOO A;  4PM5 A;  3W4Q A;  4FSF A;  1CI9 A;  1JVJ A;  1K38 A;  1MWU A;  2FFF B;  2J7V A;  4S2M A;  3UPP A;  5FA7 A;  1FCM A;  2PU2 A;  1CEG A;  1H8Y A;  1HVB A;  1W5D A;  5CER A;  1PWG A;  4KZ7 A;  3AGE A;  4KG6 A;  4P87 A;  4KZ4 A;  2HDQ A;  3N4I A;  3QNC A;  3W4P A;  4N92 A;  1GHP A;  3CMZ A;  5CHU A;  2G2W A;  3VP0 A;  1PI5 A;  1K56 D;  5GLB A;  5A92 A;  3GQZ A;  2CC1 A;  3AGD A;  2ZC4 B;  1IEM A;  4KZ5 A;  1AXB A;  4P85 A;  1YLW A;  1ERO A;  4R4S A;  1E3U D;  1XPB A;  3LY4 A;  3VFF A;  3FKV A;  5CED A;  4JF5 A;  2UWX A;  3ISG A;  5E2G A;  5HX9 A;  4GOG A; 
#chains in the Genus database with same CATH topology
 1YU4 A;  4DDY A;  1YSQ A;  1AIW A;  4P6Z S;  3L7H A;  4HEF A;  3B6F B;  1JNU A;  4GDB A;  5EVI D;  2V0W A;  2G7U A;  3AGF A;  3O5Y A;  1YLT A;  4LV0 A;  2QPN A;  2F8N A;  1BYW A;  3SW1 A;  5AV9 C;  4J8W A;  1CQA A;  4Y0O A;  5B0Y D;  3KUY A;  4RYE A;  4GH9 A;  3BQA A;  2ZC3 B;  3AN2 A;  4XXR A;  4Z2K A;  5AV5 B;  4CLC D;  4KGC C;  1W63 M;  2W1T A;  5HD3 A;  1ID3 D;  5CPJ D;  4I5S A;  4IBG A;  2B18 A;  2VLG A;  4G91 B;  3MXS A;  1PRQ A;  4UPK A;  5CEB A;  1HQ3 A;  2ZQD A;  3X1U B;  5AV9 B;  4JJN D;  4BWI A;  1TS8 A;  3IHA A;  3N7W A;  1EQZ C;  3AZI A;  4EWF A;  3HLF A;  3A0V A;  5AY8 A;  1L0F A;  4GJ4 A;  4KQO A;  5GHY A;  2Y2Q A;  3T4K A;  4YFM A;  5BO0 A;  1KX5 A;  1KX4 B;  2DNS A;  4X1L A;  3AZG B;  2JBF A;  4WL9 A;  5HAR A;  5HZH A;  2HUE C;  2XSS A;  5KDM A;  2WYX A;  3B6G B;  1LT0 A;  3B33 A;  1LL5 A;  1EQZ A;  1IKG A;  4OQ0 A;  1NY0 A;  5TBM B;  2H0T A;  2V9A A;  4NZ4 A;  3NQJ B;  1KX5 B;  2J80 A;  3B47 A;  3M2K A;  3OLO A;  4R8P B;  5HAI A;  1MC0 A;  3LI9 A;  4H9R A;  1LSV A;  2NQB B;  2ARO D;  1M18 D;  1P3A C;  4HJ4 A;  3MQ0 A;  3IHB A;  4ZRR A;  3ITA A;  4WLA A;  4WU8 B;  2XR0 A;  3MBZ A;  4G3W A;  5GT3 C;  1EW0 A;  1NYY A;  4H9S C;  2EX9 A;  5HW3 A;  1B6W A;  4H9O A;  3WAA A;  3AYW D;  1LL8 A;  1P3P B;  3MVD B;  1VQQ A;  5GXQ C;  1ZHH B;  5CGX A;  5B33 A;  3MNN D;  3ULF A;  1TEM A;  1S32 B;  1P3L A;  1E6Z A;  4YWZ A;  1L2S A;  3AV2 D;  1SHV A;  4EES A;  3R7W A;  3HCY A;  4YNR A;  1H8P A;  3K3C A;  4DF6 A;  3O88 A;  3T4O A;  1U60 A;  2L0W A;  4O8G A;  3SZT A;  3REJ C;  4H9Q A;  4CAY B;  1VHM A;  2YFW A;  1E8B A;  3MZF A;  4GW9 A;  4FCF A;  3A6N B;  3AZJ C;  1FCO A;  2QWS A;  3AZH B;  4X6T A;  3W4O A;  4FH4 A;  4QLC D;  4AWL C;  3LR3 A;  1BH9 A;  2WK0 A;  4J8V D;  5GT0 C;  5A91 A;  3T4S A;  1U35 A;  4HES A;  3BFE A;  1DJC A;  2PHY A;  2NQB A;  5FQM A;  4EW7 A;  4XUJ B;  4B4Z A;  3F1O B;  2X01 A;  3WS0 A;  4Y2F A;  5AV5 D;  4HJ3 A;  5CPI D;  1YLJ A;  3W97 A;  3KXB C;  3IH9 A;  4QLC C;  1VET A;  4HQA A;  4IBI A;  4HP9 A;  1CI8 A;  3SS3 A;  3NOU C;  2ZM0 A;  4A5R A;  4UA6 A;  1YU2 A;  4R0Q A;  4EV4 A;  3F1P A;  5B31 G;  3AZN D;  5JRG C;  3WKJ D;  4Q0J A;  4NXG A;  2PAV P;  3BRM A;  4Y5F A;  3MGQ B;  2OLU A;  1NJ4 A;  3IF6 C;  3E4Q A;  1P3M A;  4LRY C;  1XFN A;  4EQ1 A;  2DCF A;  5GSU A;  4X23 A;  4Z5T A;  2G5I C;  1ZG6 A;  4KHA B;  1KE4 A;  5B0Z C;  2WKR A;  4YM6 D;  3KWQ B;  5EE8 A;  1YM1 A;  3LIB A;  3WTP D;  1S1Z A;  2Z6D A;  1M1A C;  1TZY B;  5CGS A;  4HI4 A;  3WA9 D;  1YU0 A;  3G6O A;  2V1A A;  4NZ1 A;  3OBF A;  4S2N C;  5DF9 A;  3IH8 A;  1DP8 A;  1P9W A;  1M19 A;  1P3A D;  3LEZ A;  3WRT A;  3UDI A;  4NE3 A;  3A3E A;  2PRF A;  3PHY A;  3W96 C;  3FZC A;  5DNN A;  3KWQ C;  3MF0 A;  3T4J A;  5J8X A;  4U0T A;  2VV8 A;  3S4X A;  4N9L A;  3REL D;  4KZ8 A;  4QJG A;  4X23 B;  3Q7V A;  2OWH A;  2EX2 A;  2XLN A;  2X02 A;  1E88 A;  3HL9 A;  5AVB C;  1W1T A;  1QO6 A;  4NE6 A;  3AZK A;  4FUW A;  2IA2 A;  3UE3 A;  3OZH A;  2WZX A;  1PZO A;  1SDN A;  1TZY A;  3W99 A;  5HAQ A;  2Y2I A;  2VX8 A;  4S2N A;  5E2H A;  3LIE A;  3ZNY A;  3AZJ A;  3C1B A;  5B31 B;  5B24 C;  4OJO A;  3M6B A;  5KZH A;  5DNN B;  3QP6 A;  5F99 C;  4Z2L A;  2EXB A;  3KYE A;  4R3J A;  5GT0 A;  4QLC B;  5CPJ C;  4H9P B;  1YUE A;  2BYK B;  3S22 A;  3M7P A;  3UB8 A;  1FR1 A;  3IWQ A;  4HBT A;  1XJ2 A;  1XFQ A;  3MKE A;  3MGP B;  4MB4 A;  3KS4 A;  4Z66 C;  4M6B A;  5CPI B;  2WAE A;  3WTP E;  3MGQ C;  3HRE A;  4BJP A;  1JFI A;  3AV1 B;  4CLC B;  1DP6 A;  1KE3 A;  1S4R A;  1NRJ A;  1OTA A;  4NET A;  3UDF A;  1P34 A;  3N6I A;  1ESU A;  4OJL A;  4WNN B;  5CHM A;  4MB5 A;  3HVF A;  4OON A;  5B1M A;  2VV7 A;  2R78 A;  4JXW A;  1J9M A;  5CPK A;  4G3K A;  3E4P A;  1N9O A;  5BOH A;  3TU4 A;  1F5M A;  1K0K A;  4II7 A;  5I5L A;  3PAG A;  3X1V C;  1M1A B;  3UTA C;  2Y2J A;  1NWZ A;  5J3W A;  3WA9 A;  2ZQC A;  3AV1 A;  4Z2J A;  1BSG A;  1GSV A;  2NUP C;  2VK3 A;  3AFA B;  3MGS D;  2QMI A;  3QP8 A;  3UME A;  1OME A;  4OOM A;  3AZG D;  4WNN A;  5FAO A;  2WKP A;  3B3X A;  3P7N A;  1VM1 A;  1Y28 A;  3PYP A;  1B67 A;  2OOL A;  5BNV A;  5B0Z B;  3AV2 A;  3TU4 C;  5AV5 C;  1FCN A;  3P01 A;  5AJG A;  4WM9 A;  2ZQ7 A;  3WA9 B;  1IEL A;  4LPZ A;  5HPF A;  3MGS C;  4MB3 A;  2I72 A;  5IS1 A;  3L9K A;  4R6L A;  1ACF A;  3DTK A;  4HY8 A;  4CLC E;  4O7D A;  1P3M B;  2ZMA A;  3KUY D;  2ARO B;  2KDK A;  2XA7 S;  2EFU A;  5CXW A;  1LLB A;  1H8Z A;  3C1C A;  2ZC7 A;  1OGG A;  1F9I A;  3BFF A;  5CTM A;  4E3I A;  4HBU A;  3LZ0 B;  2NUT C;  3HLD A;  5G49 B;  1T1A A;  4GZB A;  5DNM D;  3P98 A;  3F1N B;  4KZ6 A;  5AQ7 A;  1KX3 B;  3C1B D;  3BM6 A;  2L5A A;  4R70 A;  3MVD D;  1NZU A;  3UPO A;  1AOI A;  4B9O A;  1D7E A;  2XRO A;  1H0G A;  2ZMV A;  3IF5 A;  3MMH A;  3SS4 A;  3KUY C;  1KVM A;  4DRT A;  5HWV A;  3AN2 B;  2PYO D;  2WGW B;  4JF4 A;  4OVD A;  3T4Q A;  3REI C;  5L09 A;  3VE4 A;  1MKM A;  5D3O A;  3B0C W;  2D02 A;  5C3I C;  1RCJ A;  1Z2C B;  3IS2 B;  2H28 A;  4C6Y A;  3IQA A;  3NDE A;  5FL3 A;  4XZQ A;  3WA9 C;  5B2I C;  4MMN A;  3CIT A;  1IYP A;  2QHK A;  5AVF A;  4ZUX C;  4M3K A;  4DE3 A;  4MN6 A;  4Z2M H;  2J9O A;  5A90 A;  4R38 A;  2IWB A;  3O87 A;  5AQ9 A;  1PWC A;  4E3O A;  2PYP A;  5A93 A;  2F8N B;  2DF4 C;  1NLZ A;  4FSF A;  2J7V A;  2F8N H;  4PHT A;  2W3G A;  1Z09 A;  3A0S A;  4S2M A;  3FDD A;  1UR8 A;  5GXQ B;  1GSX A;  3LEQ A;  2ARO A;  1HVB A;  3AV1 D;  5B32 G;  4KZ7 A;  5AVC D;  2HDQ A;  3W4P A;  1P3L C;  1PI5 A;  3GQZ A;  4HP4 A;  3LEL A;  3R45 A;  2CC1 A;  2XRN A;  1W1P A;  2ZC4 B;  3O62 B;  1IEM A;  4NG2 A;  4G91 C;  1P3B D;  1T1C A;  1E3U D;  1XPB A;  3LY4 A;  3VFF A;  5BPV A;  1U35 C;  2YKF A;  3ISG A;  3AZN B;  1W79 A;  5CTN A;  4Z2I A;  2E8I A;  3REH B;  3K2N A;  1W7F A;  4GKU A;  5TR7 A;  3KSF A;  3ZCZ A;  1IYO A;  3G2Y A;  3CLO A;  1KGG A;  5IU1 A;  3WX7 A;  5B24 D;  3IXD A;  3MNN C;  1LSW A;  4XUZ A;  3AZG C;  4ETZ A;  3FKE A;  4WZ4 A;  4WV4 B;  5HL1 A;  3T1X A;  5FSR A;  1NLY A;  5CPJ A;  3UTB D;  3AZM D;  5B1L D;  4NZ5 A;  5F1F A;  1L6J A;  4S2I A;  1TF1 A;  3TG9 A;  2V8F A;  2P08 A;  2RVQ D;  4WU9 A;  3AZL B;  3OC2 A;  4Z2G A;  4PM7 A;  5GLC A;  3VH6 W;  5E43 A;  3QP5 A;  2BG1 A;  1SZV A;  3BQ8 A;  3OPP A;  1TZY D;  2O99 A;  1KX5 C;  1OPX A;  4J8V A;  3TU4 B;  3NEC A;  1K55 A;  3TJZ C;  2H10 A;  1P3L B;  2VEA A;  3A3I A;  3FG8 A;  4YOF A;  3AZJ D;  4ARZ B;  4J8X B;  3UB5 P;  3FWL A;  3BYD A;  2BLS A;  4AFI A;  1E4D A;  4ZBJ C;  2WKQ A;  4Y7P A;  2F2A C;  5BNX A;  1P3K D;  3W98 C;  4IBJ A;  3NY4 A;  4K0X A;  1JTD A;  3WRZ A;  3V5M A;  3O86 A;  4RX3 A;  3IF6 A;  4Y0U A;  3V3S A;  3BEB A;  1HQ3 B;  4ZJ1 A;  4K91 A;  4NXB A;  4ZAM A;  5DF8 A;  3AZH A;  4NXE A;  3WKJ A;  4J8X A;  5B40 C;  3GR2 A;  1YSP A;  4MEZ A;  1P3F A;  4JJN C;  2J9P A;  2WKH A;  1XA1 A;  3T50 A;  4Z66 B;  2ACG A;  2IOU A;  5BT1 D;  2NZD C;  4Z1W A;  4LV3 A;  4XZQ C;  4Q0H A;  4Z5T D;  4B88 A;  3F1P B;  3UT9 D;  4ARZ A;  2J8P A;  3W97 B;  3PTE A;  4R23 A;  3DAV A;  5EVI B;  2W3H A;  3EOI A;  4WZ5 A;  1E3U A;  3C4O A;  2V1B A;  3NC8 A;  5FQJ A;  5AY8 B;  1G6O A;  4DQY B;  1W8Y A;  3HJI A;  3Q7Z A;  3ZNT A;  4BBU A;  2HIO A;  2VJW A;  3X1T C;  3MGP D;  4N9K A;  1ES4 A;  5DJT A;  3C5A A;  2PD8 A;  2VA0 A;  3SH8 A;  4S2P A;  5E5A C;  2INW A;  2JE5 A;  2O9C A;  5GT3 A;  3RTY A;  4X69 A;  5MC7 A;  5AV8 A;  5TFQ A;  3O62 D;  2XQZ A;  3DW0 A;  5EVI A;  3REL A;  1P3B B;  4MBF A;  3L2A A;  4F3L B;  4HHD A;  1BH8 B;  1V9Y A;  2EA9 A;  4OQG A;  3X1U D;  3D72 A;  2Y55 A;  3G30 A;  4JJN B;  3WD2 A;  1UWN X;  5JA4 B;  5DNM C;  4L0L A;  2W27 A;  3RXW A;  3CWF A;  3HSH A;  3MGQ A;  2ZY4 A;  1P3G C;  5DNN C;  5F82 A;  2H5S A;  4R4R A;  3C1C D;  4KUD D;  1DJB A;  1ED7 A;  3MJQ A;  4JGR A;  5L8M A;  4WU8 A;  1P3B C;  4WYY A;  1ZKJ A;  2HP9 A;  1FOF A;  3Q07 A;  3AZM C;  2PYR A;  4EU0 A;  3C4P A;  1AOI D;  3LGO A;  4DE0 A;  3AZI D;  4GHI B;  3MQQ A;  4IJF A;  1Q9C A;  2FJ7 D;  3ICY A;  5FI2 A;  1BUE A;  1G28 A;  5A8B A;  2HF6 A;  1KX5 D;  5KSH A;  4QB8 A;  4KZA A;  2XD1 A;  4B93 A;  1T1B A;  1F66 D;  3NCK A;  2OAQ 1;  1ONH A;  2W3F A;  3D4F A;  2W3E A;  4KHA A;  3C38 A;  3LR0 A;  3S7N A;  3WS1 A;  4MBK A;  2M7U A;  2M1C A;  3UE1 A;  3ZHH A;  4YS3 A;  5GSU D;  4LLO B;  4CJN A;  4X56 A;  4JXG A;  2FFY A;  4UAA A;  4EUZ A;  2W0N A;  1K6R A;  2P9V A;  5GHX A;  4KUO A;  4DXB A;  1P3G B;  5B1M D;  1LI9 A;  2DQN C;  3LID A;  4P6B A;  1K56 A;  4EBP A;  3S7O A;  3KSI A;  4MLL A;  3CAX A;  1VEU B;  4R8P A;  1TAF A;  1E6R A;  5AV9 A;  4B4X A;  5AVB D;  3V9R B;  1F66 C;  1P3A A;  1I2S A;  1ERM A;  4GN2 A;  4MN5 A;  3MGP A;  2XH9 A;  4S2K A;  2KLI A;  4DMZ A;  3LJA C;  3NQU B;  4PKY A;  3PBN A;  3QP4 A;  2B5R A;  5I94 A;  2IO5 B;  4H9O B;  4DE2 A;  3KXB D;  3MGR B;  1ES5 A;  1LL9 A;  5DKK A;  3T4L A;  5B32 D;  2V2F F;  4DRB A;  5C5K A;  5FAS A;  3EPL A;  1K25 A;  1RP5 A;  4KUK A;  3AFA A;  5B24 A;  2WZZ A;  2Q9N A;  2F8N D;  1H3Q A;  5EV0 A;  3CPT B;  3WS4 A;  3FYZ A;  4OP8 A;  3GVB A;  3OOV A;  4KUD A;  3EPJ A;  3REK A;  2HJE A;  4LFU A;  3G31 A;  4Y13 A;  2YFW B;  2YFV B;  3A3F A;  3PAE A;  5JRG A;  1T19 A;  1N9L A;  5HPI A;  3REI B;  5DNM A;  1KX4 C;  3AZH C;  2ZY5 A;  2EXA A;  4Z2M G;  1K57 A;  1P34 C;  5B2J A;  3REH D;  4KUD B;  3B6G C;  3C1C C;  1P3K A;  1HTZ A;  3M6H A;  1YU3 A;  1D06 A;  2PU4 A;  4NE5 A;  1P3I B;  1K57 C;  3W98 B;  1OGB A;  4YM6 B;  2JKT M;  1AOI B;  5AV8 B;  4UUZ A;  4JGO A;  3MXQ A;  2PYO C;  3UTB B;  5BNV B;  1EQZ D;  3DWK A;  2Z2L B;  1P3F D;  5JRG B;  3AZK B;  1WWI A;  1AWI A;  3LJA A;  3REI A;  2J3T D;  3EPH A;  4FH2 A;  4FTX A;  3C1B C;  3L29 A;  3SH9 A;  4WMC D;  3X1S A;  2EWW A;  3VP1 A;  3TU4 D;  3OPR A;  3OPL A;  2CV5 D;  3CUE A;  4MBH A;  4WN5 A;  4DXC A;  2HDS A;  5F69 A;  4NYY A;  4OPY A;  1MZU A;  4OJ5 A;  1XJ3 A;  2ZM8 A;  3AZK C;  4G92 C;  1BLS A;  3HLE A;  3EGX C;  4GNU A;  2XFT A;  3BFG A;  1SCW A;  3N3F A;  5DTK A;  3MNN A;  3PXP A;  5B1M C;  3F6T A;  1VET B;  1BFM A;  4KUD C;  3X1S B;  2HPB A;  2K7S A;  3VMA A;  5FAQ A;  4Q8I A;  4QY5 A;  3ZVT A;  2HDR A;  3ZQ5 A;  1P3I C;  3AN2 C;  4OLG A;  1D1J A;  3CJM A;  3CG5 A;  2KX6 A;  1KGF A;  2EWV A;  1N1J B;  5F99 D;  4FOF A;  3V50 A;  4AWL B;  4P0M A;  4CLC A;  5EVE A;  3ZYT A;  3N8S A;  5B31 D;  3X1V B;  1XXM A;  3CUE C;  3X1T A;  1LSX A;  2RCX A;  2ZL1 A;  2WUQ A;  3A3J A;  5B1L A;  3VSK A;  1LHY A;  3IBR A;  4CSR A;  2E8J A;  2V5O A;  4OQH A;  4WU9 D;  4N1H A;  3PBT A;  3U2A A;  4GB7 A;  1G68 A;  3CZD A;  3X1U C;  5AY8 D;  2PYO A;  3P09 A;  5FAP A;  5TJJ A;  2JHE A;  1F98 A;  4E6X A;  5AV5 A;  4P6Z M;  3BFD A;  3HUN A;  4XT2 A;  1OT6 A;  1ALQ A;  2D49 A;  3DTM A;  4LGW A;  4G3V A;  2XDM A;  5CPK C;  4BBT A;  5M19 A;  4OH0 A;  4IED A;  4OUI A;  3EEA A;  5GLD A;  2ZD8 A;  3FV7 A;  1M1A D;  2J8Y A;  2QYB A;  3WWX A;  1M40 A;  5HDD A;  2LY8 A;  3W4Q A;  2JKT I;  5B32 C;  1CI9 A;  1JVJ A;  1G5U A;  5FA7 A;  1FCM A;  3UMD A;  3E0Y A;  1H8Y A;  5CER A;  4IUK A;  3H82 A;  1EQZ B;  3AZI B;  2G2W A;  1K56 D;  3AZL A;  4IUH A;  4MCW A;  2W1R A;  3W96 B;  3AGD A;  1CJF A;  5AV9 D;  1AXB A;  3LZ1 A;  3NHQ A;  2PD7 A;  4BBV A;  2QJ5 A;  2UWX A;  5E2G A;  2BYK A;  5FI6 A;  1QMF A;  4NEE D;  1F66 B;  1CEF A;  5DF7 A;  3IX3 A;  2V0U A;  1ZLA B;  4J8U B;  4E6W A;  1SKO A;  3LZ0 D;  1W63 Q;  2ZOH A;  4KGC A;  2A3U A;  4Y15 A;  2OV5 A;  4UUZ B;  1IKI A;  5B32 A;  3NUL A;  1KX3 D;  2JN7 A;  3IXB A;  3T1R A;  1GOI A;  1TDL A;  3C2W A;  2ZLY A;  4WEK A;  4JPM A;  1YMX A;  5B2I D;  3GSG A;  4QU3 A;  4IBC A;  3HJK A;  1CK7 A;  3AN2 D;  1HLU P;  3F1O A;  3UE6 A;  1H3O B;  4L9E A;  2O0Y A;  3T1S A;  5B40 B;  2Y2O A;  5F99 B;  3S1Y A;  5AV6 C;  4DN0 A;  5FEG A;  4XUX A;  4IVK A;  2NZD B;  5JYP A;  2BTF P;  3HBR A;  4KQQ A;  2Y59 A;  1BH8 A;  4U0X A;  2ZMF A;  1KDW A;  3IF6 B;  3BFC A;  4UQI M;  5B33 B;  3A6N A;  2F8N G;  4MN7 A;  3AYW B;  2QZ6 A;  3GDI A;  3KXB B;  2G2U A;  3MGR D;  5HAP A;  3Q1F A;  3UT9 C;  4OJ6 A;  5B2J D;  4J8W C;  4WU9 C;  1LI0 A;  3BY8 A;  1RGY A;  3L27 A;  1RGZ A;  3AV2 B;  1M19 C;  2BYM A;  4HOI A;  1J3W A;  2HIO C;  3H7W A;  1WYC A;  4H9R B;  5GXQ D;  4L9F A;  3VOZ A;  2ZM2 A;  5GL9 A;  3DTI A;  1TD5 A;  3AZL C;  1SDE A;  3KYQ A;  3A6N C;  4QHC A;  5AV6 A;  3LR5 A;  1L0G A;  1ID3 B;  3KS8 A;  2Y91 A;  2O9B A;  2ZQA A;  3WS5 A;  3GMW A;  4LEN A;  4F3L A;  1PW8 A;  3B6G A;  1NZO A;  1EI5 A;  3WTP A;  1P3P A;  3REI D;  1R4V A;  4DJ3 A;  1TDG A;  4E3K A;  2HIO B;  4KG5 A;  4IBR A;  4J8V B;  5CX7 A;  5CHL B;  1P3O C;  4IVI A;  4YS3 C;  4HJ6 A;  2JCH A;  4BLM A;  5G4Z A;  3UTA D;  5EPH A;  5CP6 D;  1K54 A;  3WD0 A;  2J3W A;  3Q7V B;  3G34 A;  2D01 A;  3NBL A;  4D2O A;  4LRZ E;  3AYW C;  4HNB A;  3UB6 A;  2ZJ9 A;  1P3I D;  4JLF A;  3C8C A;  4KZB A;  3B6F C;  2M7V A;  1PW1 A;  4ZUX A;  1WA9 A;  3AZM B;  3MXR A;  5F5Y A;  1ZLA C;  4CQH A;  4Y17 A;  3KXB A;  2A2L A;  4O01 A;  1M18 C;  1H5X A;  3C7U A;  5B31 C;  3UDX A;  3X1U A;  3JVU A;  3V9R A;  4XZQ B;  1BH9 B;  4WEL A;  3WKJ B;  3GTC A;  5TBM A;  2EFX A;  1ES2 A;  3IWO A;  2GZA A;  3D9Y A;  3MGQ D;  1GA9 A;  3H7W B;  2PDR A;  4OPR A;  5BO0 B;  5B31 A;  1ZLA D;  4J8U D;  3UN7 A;  3AZM A;  2CV5 B;  3S7P A;  4E3L A;  4QWO A;  5AV6 B;  4E04 A;  4GD8 A;  3RFB A;  3R4K A;  3EWK A;  2LB9 A;  4OQI A;  5B0Y C;  2P9V B;  3B0C T;  1E6P A;  1YMS A;  2XA7 M;  4OJP A;  1P3G A;  1HQ3 D;  1XGI A;  5C3I B;  2WGI A;  3BY9 A;  4LV1 A;  4Z9Q A;  4JJN A;  4ME4 A;  3MGR A;  3NI9 A;  1JWZ A;  4YM6 C;  3QNB A;  2L4R A;  4DDS A;  1S32 A;  3HUM A;  3AZN A;  2XD5 A;  1PYY A;  1F66 A;  2NZD D;  3B0D C;  3WD4 A;  2A24 A;  1MWS A;  5F6A A;  5FQQ A;  2PBD P;  3TRC A;  4CPK A;  4PM9 A;  3REL B;  3T4T A;  3I7J A;  4WZ5 C;  4GLQ A;  2CWE A;  4X23 D;  4PKY G;  4GHI A;  3AZH D;  2WAF A;  5HWW A;  4OP5 A;  2C6W B;  2GDN A;  3GEC A;  2NQB C;  2YKH A;  5CPK D;  3BEC A;  5AQB A;  1PNE A;  3KX0 X;  1MWT A;  4QD4 A;  1K4E A;  2P7J A;  3LIC A;  1WE4 A;  2JKR M;  1ZTU A;  2PR5 A;  4PAU A;  3WS2 A;  2RL3 A;  1BLC A;  4R1G A;  1H0I A;  4S2J A;  1U35 B;  2HUE B;  3REJ A;  5AVC A;  2O9A A;  4H9Q B;  4WUJ A;  1P3M C;  3ZGA B;  1P3I A;  3IX8 A;  5EFW A;  2JSS A;  2IWC A;  4JXS A;  5BNX B;  5DNN D;  1Z6F A;  2HIO D;  4X1M A;  4Z2H A;  3MSH A;  1O07 A;  3MQO A;  4WU8 C;  3WD3 A;  1TAF B;  5B0Y A;  3REJ B;  2VGL S;  3LR4 A;  3C1C B;  3HUO A;  2WAD A;  5CP6 B;  3VP2 A;  3VH6 T;  4JXV A;  4EQI A;  2DRW A;  1KX3 A;  4UHU A;  3SS5 A;  4Z66 A;  3IX4 A;  1BZA A;  4LCM A;  5AV8 C;  3REK D;  1OJ5 A;  3KWQ D;  5KMW A;  1S32 C;  5AVE A;  3EQU A;  3X1T D;  1V9Z A;  2A49 A;  2IWD A;  4O0P A;  4BD1 A;  3LJA B;  1YU1 A;  1OTD A;  2G5H C;  5CP6 C;  2FZ0 A;  5KIZ A;  4UQI S;  3AFA C;  1BLH A;  3A3D A;  3D3O A;  2XFS A;  1TZY C;  1DRM A;  5E2E A;  2Q9M A;  4WF0 A;  5GSU B;  3EPK A;  4NYU A;  5HDC A;  3ZG9 B;  3W2Z A;  5GT0 D;  1MPL A;  4YIN A;  2FJ7 A;  5B1L C;  4CSR B;  3L26 A;  1IYS A;  4QNL A;  1N9B A;  3HLG A;  3QP2 A;  3F1N A;  3TSG A;  3MR0 A;  2JKR I;  3ZG7 B;  3GV9 A;  3X1V A;  5B1M B;  4I3A A;  4H9P A;  2Y2K A;  3M2J A;  4EO5 C;  4ZJ2 A;  5B2I B;  2K31 A;  3VP4 A;  5EM0 A;  1YQS A;  5AVB B;  3AZE C;  3E2L A;  3CPT A;  4KZ9 A;  1OTI A;  2Q0O A;  3NJA A;  2Z2M B;  5JYO A;  2R9X A;  4D60 A;  2I9V A;  1STZ A;  3HLC A;  1OTE A;  1P34 B;  4K08 A;  3B0B A;  2XEP A;  3VH5 A;  3OCN A;  4R3A A;  2HJ9 C;  5E2F A;  4BQM A;  4EET B;  2OSU A;  1YLY A;  3MFD A;  3G4P A;  1ESI A;  4J8V C;  4NXF A;  5HSQ A;  3AZG A;  2PYO B;  4X53 A;  3UTB C;  2VQR A;  5F1G A;  4BL2 A;  3MGP C;  3NDG A;  4Z5T C;  3VH5 W;  4KEN B;  5EM1 A;  2W1T B;  5IHV A;  5CPI C;  4F94 A;  3LZ0 A;  3UTB A;  4JGP A;  4BL3 A;  4S2L A;  4QLC A;  1CF0 A;  1BT5 A;  2Y4A A;  4DJ2 A;  5EVL A;  4S2O A;  2WGV A;  1P3K C;  3WKJ C;  1DP9 A;  2PBY A;  1F1E A;  1ZLA A;  1KDS A;  5GLA A;  5DJU A;  2F8N K;  4IJE A;  2B02 A;  1OJG A;  3MGS B;  4ESP A;  2JC7 A;  3L25 A;  4LCL A;  3A1I A;  5CPI A;  3UTA B;  4LD9 C;  4PPR A;  3KYZ A;  1KGE A;  1YLP A;  2EX8 A;  4ZTK A;  3REK B;  4OOL A;  4ZBE A;  1PI4 A;  5CPJ B;  3H9W A;  3KSH A;  4C75 A;  5M18 A;  3HON A;  5KSC A;  5B0Z D;  1O7E A;  4X55 A;  2XK1 A;  4K0W A;  2P04 A;  3REH A;  4GS9 B;  3LEL C;  3NIA A;  2J3T C;  3PBR A;  4XZQ D;  5HL6 A;  1CK3 A;  3JYI A;  2ZY3 A;  1P3M D;  3KUY B;  2H0Y A;  5IT5 A;  1KX4 D;  5B24 B;  5AY8 C;  1TS7 A;  1KE0 A;  1SKF A;  3H82 B;  3VE3 A;  3MS6 A;  3LIF A;  4KQD A;  1K6S A;  2BAS A;  2MJ6 A;  3HLW A;  1M18 A;  3PBS A;  5AV6 D;  3UT9 A;  4ETX A;  4PM5 A;  4HH2 A;  3LEL B;  1MWU A;  4HMC A;  5B1L B;  4HIA A;  3B6G D;  2PU2 A;  3LZ1 C;  3KSG A;  1W5D A;  2YFV A;  3X1S D;  3AZL D;  3AGE A;  3AYW A;  4KG6 A;  4KZ4 A;  4L9G A;  4P87 A;  3QNC A;  4N92 A;  5FDS A;  5B40 A;  4J8X C;  3AZE D;  4LD9 B;  4R8P D;  4KZ5 A;  4I39 A;  3AZF C;  4P85 A;  3EG5 B;  1P3L D;  2ZBB A;  1YLW A;  1M18 B;  3UB9 A;  5CED A;  3FKV A;  4JF5 A;  3UTA A;  3TE8 A;  2X71 A;  5GHZ A;  4UA9 A;  5K5B A;  1PDC A;  2KOI A;  5GT3 D;  1OT9 A;  3WTP C;  4ZDX A;  3O62 A;  5E5A B;  2Y8H A;  4KQR A;  1FSW A;  1S0W A;  2VGL M;  3VH6 A;  3DTE A;  3IXG A;  3LCE A;  3PR6 A;  1K55 C;  4WU9 B;  2FH5 A;  3E98 A;  4GDN A;  5EUA A;  1PWD A;  3IP4 C;  3NQJ A;  1FIK A;  4Y0T A;  3KFU G;  4IBE A;  4ZBJ B;  2WGW A;  3EQV A;  3K3D A;  1DJA A;  3EEH A;  2RTS A;  4Z66 D;  3REH C;  1BUL A;  3OCL A;  1E6N A;  2OAP 1;  1U35 D;  2VV6 A;  4PM8 A;  3LFV A;  3MQL A;  5AQA A;  1S4S A;  3N8L A;  3QP1 A;  2Y2L A;  3FPV A;  3W97 D;  3A6N D;  1FSY A;  1P9R A;  2ZL1 B;  3R45 B;  1FIL A;  2Y2G A;  2LB5 A;  2V8C A;  3RH8 B;  4EXO A;  3BWL A;  1VB6 A;  4TX8 A;  4H8R A;  3A1K A;  3VFH A;  4ID4 A;  2Z6C A;  4IBX A;  3R7W B;  4NFT A;  3N8R A;  2W8S A;  1P3O B;  4WEJ A;  1P3P C;  3CI6 A;  2GX5 A;  4ZJ3 A;  1T18 A;  4XUJ D;  2NZD A;  1GXD A;  1W2E A;  4RX2 A;  5HD5 A;  4GD6 A;  1KX4 A;  4EEP A;  3VH5 T;  5DFX A;  4C3Q A;  1KU5 A;  4KGC B;  4ZUX B;  1Q2Q A;  2VGK A;  1UR9 A;  3H0R C;  3LUQ A;  4OPZ A;  1A0K A;  1S1Y A;  5TGF A;  5BS7 A;  1ERQ A;  5FUG A;  3ZDJ A;  3W96 D;  3MFX A;  4E44 A;  2V20 A;  4LV2 A;  3GRJ A;  5FQI A;  3H0L C;  3LJA D;  3G32 A;  3OPH A;  4IBF A;  4RVA A;  5FQ9 A;  4OLD A;  2OLV A;  3AZJ B;  4OOY A;  1Q2P A;  3VSL A;  3ZG0 A;  5J7E A;  3Q81 A;  2CV5 A;  2ZC5 B;  2W3D A;  2VGJ A;  1MBL A;  5L10 A;  3UO9 A;  2PR6 A;  5GT0 B;  3WAA D;  5FUG B;  1YAX A;  5DVA A;  3LEL D;  3IWI A;  4X23 C;  3ZVW A;  4WZS B;  1KS0 A;  3LZ1 D;  2JKG A;  5HDS A;  3WTP B;  5DFY A;  1NRF A;  1W1Y A;  1TS0 A;  4OPQ A;  2IO5 C;  4UEY A;  3VOY A;  3JPU A;  5BS7 C;  3MGR C;  3SH7 A;  2GNX A;  5FDH A;  4LD9 D;  3LIA A;  2BYM B;  5B2J C;  4J8W D;  2V1Z A;  1HQ3 C;  2PT7 A;  4R8P C;  3SOI A;  3AZF D;  1P3A B;  2Y2P A;  1JWV A;  2A24 B;  3B0D B;  2XGN A;  4NK3 A;  3O62 C;  1G6A A;  4Z5T B;  3W8K A;  4QY6 A;  5GT3 B;  1GHM A;  1GHI A;  5EEC A;  2HDU A;  3REL C;  4IHQ A;  5E5A D;  1KOU A;  1M6K A;  3MZE A;  3AZN C;  2L1M A;  2OWJ A;  3KWQ A;  4DKI A;  1MWR A;  4EUV A;  3MVD A;  3V67 A;  5G4Y A;  5B2J B;  4JKT A;  4EBL A;  1P3G D;  1O6I A;  1C3B A;  5KDM B;  3CHW P;  2FJ7 C;  3DWZ A;  4GHL A;  1NYM A;  5CEC A;  3LZ0 C;  1P0Z A;  3IBJ A;  3A0R A;  1IFQ A;  3VV4 A;  3LI8 A;  3BLM A;  4UA7 A;  4WBG A;  3C30 A;  4JBF A;  1N4O A;  4XUJ A;  5B0Z A;  2HP5 A;  1S67 L;  1ULY A;  1XJ6 A;  2QKP A;  1XJ4 A;  3B6F D;  4YS3 D;  1E25 A;  1P97 A;  1ZC2 A;  1AOI C;  2CV5 C;  2VZW A;  5B32 B;  3EGD C;  1XGJ A;  4N1X A;  3IT9 A;  1Y4O A;  5DTT A;  1M19 B;  5B0Y B;  1P3O D;  1PFL A;  3BLS A;  5FEF A;  3NOP C;  1FR6 A;  1W8Q A;  2DMW A;  5FAT A;  4CAY A;  3UB7 A;  1CXW A;  2CMN A;  2FN2 A;  3NQU A;  4YM6 A;  5F68 A;  1S66 L;  4I38 A;  4NKP A;  4EEU A;  1J7M A;  4I3J A;  3V3R A;  3ZFZ A;  2FJ7 B;  1BLP A;  4R3B A;  2B95 A;  2Y2H A;  3S7Q A;  3AZE A;  1JTG A;  1N1J A;  4X25 A;  3RXX A;  1L3L A;  4KG2 A;  5CP6 A;  1VEU A;  4HH3 A;  1ES3 A;  4X68 A;  3X1S C;  4HME A;  3W99 B;  1PIO A;  2ARO C;  1NXY A;  4IBK A;  4IJG A;  3KSY A;  1T3U A;  3AFA D;  1PZP A;  5J4E A;  1MXO A;  1WYB A;  4E45 A;  5BT1 C;  1Y54 A;  1BTL A;  3G2Z A;  3TOI A;  3W98 D;  2WKI A;  3LO7 A;  4IBD A;  1JWP A;  2AVX A;  1S6R A;  4DE1 A;  1ID3 A;  1A7W A;  1XP4 A;  2RIQ A;  2K2N A;  3LY3 A;  4U3T A;  3ITB A;  1GA0 A;  3G35 A;  5B2I A;  5JRG D;  3UPN A;  2XF3 A;  4PM6 A;  3V39 A;  4KZ3 A;  5B33 C;  4LG2 A;  1K54 C;  2NQB D;  4XT2 B;  3AZE B;  2HV1 A;  4QPR A;  3NOT C;  2ZQ8 A;  4M4X A;  4H6J B;  4WU8 D;  3E2K A;  3E4O A;  1JFI B;  3ZG5 A;  5FI7 A;  2ZQ9 A;  1ODV A;  5EOE A;  1EWZ A;  2Y2M A;  2GJ3 A;  2RVQ C;  3FKW A;  4Q0I A;  1UGU A;  5DNM B;  2ZOI A;  1X0O A;  3C1B B;  5CRF A;  4HGA C;  1S32 D;  1KVL A;  5CPK B;  2C5W B;  1ID3 C;  1EAK A;  4H9S A;  3BJN A;  1M1A A;  4EBN A;  5HFO A;  2P74 A;  4NY2 A;  4NZ3 A;  4RA7 A;  1TS6 A;  2UV0 E;  1L0D A;  4I3I A;  4WMC A;  3MZD A;  5CHJ A;  4GS9 A;  1F2K A;  4E3J A;  2EX6 A;  1UWP X;  2HP6 A;  4YS3 B;  5DKL A;  1ZG4 A;  2ZY2 A;  4GCZ A;  4JGQ A;  4LRX C;  4GHA A;  3C7V A;  5L2F A;  1GPF A;  5GSU C;  4PMA A;  1W1V A;  3O3V A;  1I2W A;  4WJ3 C;  1XX2 A;  1YT4 A;  1M19 D;  3P5J B;  1P3F C;  5CGW A;  3FPW A;  1GCE A;  3REJ D;  5AVB A;  2VKS A;  5HWT A;  3ZG8 B;  1KX3 C;  3AL0 C;  3VOL A;  1IYQ A;  3PBO A;  1FQG A;  1QME A;  4H6J A;  3PBQ A;  3AV1 C;  1I5Q A;  4EER A;  4IBB A;  3W99 C;  5AVC B;  3FC7 A;  4E3N A;  4CLC C;  3REK C;  1HD8 A;  5AV8 D;  5DTS A;  1E15 A;  4KGC D;  4RQ9 A;  4ZUX D;  4BEN A;  3TW8 A;  3X1T B;  3T1Q B;  3W98 A;  2WKE A;  1N9N A;  3DBA A;  2JKF A;  1H3O A;  1DY6 A;  1PZR A;  4MNR A;  3WAA C;  1P3F B;  4LD9 A;  1XKZ A;  3AZK D;  5F99 A;  4JF6 A;  3AZF A;  4HMD A;  3VP3 A;  4H9N A;  3KO6 A;  3UE0 A;  5F83 A;  3W99 D;  3L28 A;  4BD0 A;  3WD1 A;  5AVC C;  4FD8 A;  1MY8 A;  3T12 B;  4XUJ C;  5L07 A;  4BMW A;  5E5A A;  4J8U A;  3AV2 C;  5U47 A;  2ZM5 A;  1TVF A;  1ONG A;  4E3M A;  3WAA B;  3LYX A;  1YPR A;  1MKI A;  3LZ1 B;  1YLZ A;  1OTB A;  1YKD A;  2ZC6 B;  2R9W A;  4Y3I A;  1L0E A;  3U4L P;  3BW6 A;  3UNW A;  5FQK A;  4HGA B;  1WWS A;  4J8W B;  3Q82 A;  4J8U C;  3H0M C;  2HGV A;  3IXH A;  5GXQ A;  1XA7 A;  3B42 A;  3AZF B;  1SKO B;  5G18 A;  4J8X D;  3UY6 A;  3RJU A;  5LBR A;  3AZI C;  1HZO A;  1P34 D;  3B6F A;  1K4F A;  1P3K B;  3X1V D;  2Y2N A;  3IS2 A;  5M1A A;  4OKP A;  3W97 C;  3MKF A;  5JA4 A;  3HLB A;  4DRA A;  1P3P D;  3QHY A;  5EVI C;  5EOO A;  2HZ5 A;  3MNN B;  3W96 A;  1P3O A;  1K38 A;  3UPP A;  2Y79 A;  2FFF B;  4EO5 B;  1CEG A;  4H9N B;  1PWG A;  2QJ7 A;  5B40 D;  3N4I A;  1IOU A;  3MGS A;  1GHP A;  3CMZ A;  5CHU A;  1H8M A;  1H0M A;  3VP0 A;  5GLB A;  5A92 A;  3JVV A;  5G49 A;  4G92 B;  1GSW A;  1HTA A;  3MVD C;  1ERO A;  4R4S A;  4MDZ A;  3UT9 B;  1P3B A;  5B33 D;  5HX9 A;  4GOG A; 
#chains in the Genus database with same CATH homology
 1YU4 A;  4DDY A;  4HEF A;  3B6F B;  4GDB A;  5EVI D;  3AGF A;  1YLT A;  4LV0 A;  2QPN A;  2F8N A;  5AV9 C;  4J8W A;  4Y0O A;  5B0Y D;  3KUY A;  4RYE A;  4GH9 A;  2ZC3 B;  3AN2 A;  4XXR A;  5AV5 B;  4KGC C;  1ID3 D;  5CPJ D;  4IBG A;  4G91 B;  3MXS A;  4UPK A;  5CEB A;  1HQ3 A;  2ZQD A;  3X1U B;  5AV9 B;  4JJN D;  3IHA A;  3N7W A;  1EQZ C;  3AZI A;  4EWF A;  3HLF A;  5AY8 A;  1L0F A;  4KQO A;  5GHY A;  2Y2Q A;  4YFM A;  5BO0 A;  1KX5 A;  1KX4 B;  2DNS A;  3AZG B;  2JBF A;  5HAR A;  2HUE C;  5KDM A;  2WYX A;  3B6G B;  1LL5 A;  1EQZ A;  1IKG A;  4OQ0 A;  1NY0 A;  2H0T A;  4NZ4 A;  3NQJ B;  1KX5 B;  3M2K A;  4R8P B;  5HAI A;  4H9R A;  2NQB B;  2ARO D;  1M18 D;  1P3A C;  3IHB A;  3ITA A;  4WU8 B;  2XR0 A;  3MBZ A;  5GT3 C;  1NYY A;  4H9S C;  2EX9 A;  5HW3 A;  1B6W A;  4H9O A;  3WAA A;  3AYW D;  1P3P B;  3MVD B;  1VQQ A;  5GXQ C;  5CGX A;  5B33 A;  3MNN D;  1TEM A;  1S32 B;  1P3L A;  1L2S A;  3AV2 D;  1SHV A;  4DF6 A;  3O88 A;  1U60 A;  3REJ C;  4H9Q A;  4CAY B;  2YFW A;  3MZF A;  4FCF A;  3A6N B;  3AZJ C;  1FCO A;  3AZH B;  4X6T A;  3W4O A;  4FH4 A;  4QLC D;  4AWL C;  1BH9 A;  2WK0 A;  4J8V D;  5GT0 C;  5A91 A;  1U35 A;  4HES A;  3BFE A;  1DJC A;  5FQM A;  2NQB A;  4XUJ B;  4B4Z A;  2X01 A;  3WS0 A;  5AV5 D;  5CPI D;  1YLJ A;  3W97 A;  3KXB C;  3IH9 A;  4QLC C;  4IBI A;  1CI8 A;  3SS3 A;  2ZM0 A;  4A5R A;  4UA6 A;  1YU2 A;  4R0Q A;  4EV4 A;  5B31 G;  3AZN D;  5JRG C;  3WKJ D;  3BRM A;  3MGQ B;  2OLU A;  1NJ4 A;  3IF6 C;  1P3M A;  2DCF A;  5GSU A;  4X23 A;  4Z5T A;  2G5I C;  1ZG6 A;  4KHA B;  1KE4 A;  5B0Z C;  4YM6 D;  3KWQ B;  5EE8 A;  1YM1 A;  3WTP D;  1M1A C;  1TZY B;  5CGS A;  3WA9 D;  1YU0 A;  4NZ1 A;  4S2N C;  5DF9 A;  3IH8 A;  1M19 A;  1P3A D;  3LEZ A;  3WRT A;  3UDI A;  4NE3 A;  3A3E A;  3W96 C;  3FZC A;  5DNN A;  3KWQ C;  5J8X A;  4U0T A;  3S4X A;  4N9L A;  3REL D;  4KZ8 A;  4QJG A;  4X23 B;  3Q7V A;  2EX2 A;  2XLN A;  2X02 A;  3HL9 A;  5AVB C;  4NE6 A;  3AZK A;  3UE3 A;  3OZH A;  2WZX A;  1PZO A;  1SDN A;  1TZY A;  3W99 A;  5HAQ A;  2Y2I A;  4S2N A;  5E2H A;  3ZNY A;  3AZJ A;  3C1B A;  5B31 B;  5B24 C;  4OJO A;  3M6B A;  5KZH A;  5DNN B;  4R3J A;  5F99 C;  2EXB A;  5GT0 A;  4QLC B;  5CPJ C;  4H9P B;  1YUE A;  2BYK B;  3S22 A;  1FR1 A;  3IWQ A;  4HBT A;  3MKE A;  3MGP B;  3KS4 A;  4Z66 C;  4M6B A;  5CPI B;  2WAE A;  3WTP E;  3MGQ C;  3HRE A;  4BJP A;  1JFI A;  3AV1 B;  1KE3 A;  4NET A;  3UDF A;  1P34 A;  3N6I A;  1ESU A;  4OJL A;  4WNN B;  5CHM A;  3HVF A;  4OON A;  5B1M A;  4JXW A;  1J9M A;  5CPK A;  5BOH A;  3TU4 A;  3PAG A;  3X1V C;  1M1A B;  3UTA C;  2Y2J A;  3WA9 A;  2ZQC A;  3AV1 A;  1BSG A;  3AFA B;  3MGS D;  2QMI A;  1OME A;  4OOM A;  3AZG D;  4WNN A;  5FAO A;  3B3X A;  1VM1 A;  1B67 A;  5BNV A;  5B0Z B;  3AV2 A;  3TU4 C;  5AV5 C;  1FCN A;  4WM9 A;  2ZQ7 A;  3WA9 B;  1IEL A;  3MGS C;  2I72 A;  4O7D A;  1P3M B;  2ZMA A;  3KUY D;  2ARO B;  2EFU A;  5CXW A;  1LLB A;  1H8Z A;  3C1C A;  2ZC7 A;  3BFF A;  5CTM A;  4E3I A;  4HBU A;  3LZ0 B;  3HLD A;  5G49 B;  4GZB A;  5DNM D;  3P98 A;  4KZ6 A;  5AQ7 A;  1KX3 B;  3C1B D;  3BM6 A;  2L5A A;  3MVD D;  1NZU A;  3UPO A;  1AOI A;  3IF5 A;  3SS4 A;  3KUY C;  1KVM A;  4DRT A;  3AN2 B;  2PYO D;  2WGW B;  4JF4 A;  4OVD A;  3REI C;  5D3O A;  3B0C W;  5C3I C;  1RCJ A;  1Z2C B;  4C6Y A;  3IQA A;  3NDE A;  4XZQ A;  3WA9 C;  5B2I C;  1IYP A;  4ZUX C;  4M3K A;  4DE3 A;  4Z2M H;  2J9O A;  5A90 A;  2IWB A;  3O87 A;  5AQ9 A;  1PWC A;  4E3O A;  5A93 A;  2F8N B;  2DF4 C;  4FSF A;  2J7V A;  2F8N H;  4S2M A;  3FDD A;  5GXQ B;  2ARO A;  1HVB A;  3AV1 D;  5B32 G;  4KZ7 A;  5AVC D;  2HDQ A;  3W4P A;  1P3L C;  1PI5 A;  3GQZ A;  3LEL A;  3R45 A;  2CC1 A;  2ZC4 B;  3O62 B;  1IEM A;  4G91 C;  1P3B D;  1E3U D;  1XPB A;  3LY4 A;  3VFF A;  5BPV A;  1U35 C;  3ISG A;  3AZN B;  1W79 A;  5CTN A;  2E8I A;  3REH B;  1W7F A;  4GKU A;  5TR7 A;  3ZCZ A;  1IYO A;  3G2Y A;  1KGG A;  3WX7 A;  5B24 D;  3IXD A;  3MNN C;  4XUZ A;  3AZG C;  3FKE A;  4WZ4 A;  4WV4 B;  5HL1 A;  5FSR A;  5CPJ A;  3UTB D;  3AZM D;  5B1L D;  4NZ5 A;  5F1F A;  4S2I A;  3TG9 A;  2RVQ D;  4WU9 A;  3AZL B;  3OC2 A;  4PM7 A;  5GLC A;  3VH6 W;  5E43 A;  2BG1 A;  3OPP A;  1TZY D;  1KX5 C;  4J8V A;  3TU4 B;  1K55 A;  2H10 A;  1P3L B;  3A3I A;  3AZJ D;  4J8X B;  3FWL A;  3BYD A;  2BLS A;  1E4D A;  4ZBJ C;  4Y7P A;  2F2A C;  5BNX A;  1P3K D;  3W98 C;  4IBJ A;  3NY4 A;  4K0X A;  1JTD A;  3WRZ A;  3V5M A;  3O86 A;  4RX3 A;  3IF6 A;  4Y0U A;  3V3S A;  3BEB A;  1HQ3 B;  4ZJ1 A;  4K91 A;  4ZAM A;  5DF8 A;  3AZH A;  3WKJ A;  4MEZ A;  4J8X A;  5B40 C;  3GR2 A;  1P3F A;  4JJN C;  2J9P A;  2WKH A;  1XA1 A;  4Z66 B;  2IOU A;  5BT1 D;  2NZD C;  4LV3 A;  4XZQ C;  4Z5T D;  4B88 A;  3UT9 D;  2J8P A;  3W97 B;  3PTE A;  4R23 A;  5EVI B;  4WZ5 A;  1E3U A;  3C4O A;  3NC8 A;  5FQJ A;  5AY8 B;  4DQY B;  1W8Y A;  3Q7Z A;  3ZNT A;  2HIO A;  3X1T C;  3MGP D;  4N9K A;  1ES4 A;  3C5A A;  3SH8 A;  4S2P A;  5E5A C;  2JE5 A;  5GT3 A;  4X69 A;  5AV8 A;  5TFQ A;  3O62 D;  2XQZ A;  3DW0 A;  5EVI A;  3REL A;  1P3B B;  4MBF A;  3L2A A;  1BH8 B;  4OQG A;  3X1U D;  2Y55 A;  3G30 A;  4JJN B;  5JA4 B;  5DNM C;  4L0L A;  3RXW A;  3HSH A;  3MGQ A;  2ZY4 A;  1P3G C;  5DNN C;  5F82 A;  2H5S A;  4R4R A;  3C1C D;  4KUD D;  1DJB A;  4WU8 A;  1P3B C;  4WYY A;  1ZKJ A;  2HP9 A;  1FOF A;  3Q07 A;  3AZM C;  3C4P A;  1AOI D;  4DE0 A;  3AZI D;  4IJF A;  1Q9C A;  2FJ7 D;  5FI2 A;  1BUE A;  1KX5 D;  5KSH A;  4QB8 A;  4KZA A;  2XD1 A;  1F66 D;  3NCK A;  1ONH A;  3D4F A;  4KHA A;  3WS1 A;  4MBK A;  3UE1 A;  3ZHH A;  4YS3 A;  5GSU D;  4CJN A;  4X56 A;  4JXG A;  2FFY A;  4UAA A;  4EUZ A;  1K6R A;  2P9V A;  5GHX A;  4DXB A;  1P3G B;  5B1M D;  1LI9 A;  2DQN C;  4P6B A;  1K56 A;  4EBP A;  4MLL A;  4R8P A;  1TAF A;  5AV9 A;  4B4X A;  5AVB D;  3V9R B;  1F66 C;  1P3A A;  1I2S A;  1ERM A;  4GN2 A;  3MGP A;  2XH9 A;  4S2K A;  3LJA C;  3NQU B;  3PBN A;  2B5R A;  5I94 A;  2IO5 B;  4H9O B;  4DE2 A;  3KXB D;  3MGR B;  1ES5 A;  1LL9 A;  5B32 D;  2V2F F;  4DRB A;  5FAS A;  3EPL A;  1K25 A;  1RP5 A;  3AFA A;  5B24 A;  2WZZ A;  2Q9N A;  2F8N D;  3WS4 A;  3FYZ A;  4OP8 A;  3GVB A;  4KUD A;  3EPJ A;  3REK A;  3G31 A;  2YFW B;  2YFV B;  3A3F A;  3PAE A;  5JRG A;  3REI B;  5DNM A;  1KX4 C;  3AZH C;  2ZY5 A;  2EXA A;  4Z2M G;  1K57 A;  1P34 C;  5B2J A;  3REH D;  4KUD B;  3B6G C;  3C1C C;  1P3K A;  1HTZ A;  3M6H A;  1YU3 A;  2PU4 A;  4NE5 A;  1P3I B;  1K57 C;  3W98 B;  4YM6 B;  1AOI B;  5AV8 B;  4UUZ A;  2PYO C;  3UTB B;  5BNV B;  1EQZ D;  3DWK A;  2Z2L B;  1P3F D;  5JRG B;  3AZK B;  1WWI A;  3LJA A;  3REI A;  3EPH A;  4FH2 A;  3C1B C;  3L29 A;  3SH9 A;  4WMC D;  3X1S A;  3VP1 A;  3TU4 D;  3OPR A;  3OPL A;  2CV5 D;  4MBH A;  4DXC A;  2HDS A;  4NYY A;  4OPY A;  4OJ5 A;  2ZM8 A;  3AZK C;  4G92 C;  1BLS A;  3HLE A;  4GNU A;  2XFT A;  3BFG A;  1SCW A;  3N3F A;  5DTK A;  3MNN A;  5B1M C;  3F6T A;  1BFM A;  4KUD C;  3X1S B;  2HPB A;  3VMA A;  5FAQ A;  4Q8I A;  4QY5 A;  3ZVT A;  2HDR A;  1P3I C;  3AN2 C;  4OLG A;  3CJM A;  3CG5 A;  1KGF A;  1N1J B;  5F99 D;  3V50 A;  4AWL B;  4P0M A;  3N8S A;  5B31 D;  3X1V B;  1XXM A;  3X1T A;  2RCX A;  2WUQ A;  3A3J A;  5B1L A;  3VSK A;  1LHY A;  4CSR A;  4OQH A;  4WU9 D;  4N1H A;  3PBT A;  4GB7 A;  1G68 A;  3CZD A;  3X1U C;  5AY8 D;  2PYO A;  3P09 A;  5FAP A;  4E6X A;  5AV5 A;  3BFD A;  3HUN A;  1ALQ A;  3DTM A;  2XDM A;  5CPK C;  5M19 A;  4OH0 A;  4IED A;  4OUI A;  5GLD A;  2ZD8 A;  3FV7 A;  1M1A D;  2J8Y A;  3WWX A;  1M40 A;  2LY8 A;  3W4Q A;  5B32 C;  1CI9 A;  1JVJ A;  5FA7 A;  1FCM A;  1H8Y A;  5CER A;  1EQZ B;  3AZI B;  2G2W A;  1K56 D;  3AZL A;  3W96 B;  3AGD A;  5AV9 D;  1AXB A;  3LZ1 A;  2UWX A;  5E2G A;  2BYK A;  5FI6 A;  1QMF A;  1F66 B;  1CEF A;  5DF7 A;  1ZLA B;  4J8U B;  4E6W A;  3LZ0 D;  4KGC A;  2A3U A;  2OV5 A;  4UUZ B;  1IKI A;  5B32 A;  1KX3 D;  3IXB A;  1TDL A;  2ZLY A;  4WEK A;  4JPM A;  1YMX A;  5B2I D;  3GSG A;  4QU3 A;  4IBC A;  3AN2 D;  1H3O B;  5B40 B;  2Y2O A;  5F99 B;  3S1Y A;  5AV6 C;  4XUX A;  4IVK A;  2NZD B;  5JYP A;  3HBR A;  4KQQ A;  2Y59 A;  1BH8 A;  4U0X A;  1KDW A;  3IF6 B;  3BFC A;  5B33 B;  3A6N A;  2F8N G;  3AYW B;  2QZ6 A;  3KXB B;  2G2U A;  3MGR D;  5HAP A;  3Q1F A;  3UT9 C;  4OJ6 A;  5B2J D;  4J8W C;  4WU9 C;  1LI0 A;  1RGY A;  3L27 A;  1RGZ A;  3AV2 B;  1M19 C;  2BYM A;  2HIO C;  1WYC A;  4H9R B;  5GXQ D;  3VOZ A;  2ZM2 A;  5GL9 A;  3AZL C;  1SDE A;  3A6N C;  4QHC A;  5AV6 A;  1L0G A;  1ID3 B;  3KS8 A;  2Y91 A;  2ZQA A;  3WS5 A;  3GMW A;  4LEN A;  1PW8 A;  3B6G A;  1NZO A;  1EI5 A;  3WTP A;  1P3P A;  3REI D;  1R4V A;  1TDG A;  4E3K A;  2HIO B;  4KG5 A;  4IBR A;  4J8V B;  5CHL B;  1P3O C;  4IVI A;  4YS3 C;  2JCH A;  4BLM A;  3UTA D;  5EPH A;  5CP6 D;  1K54 A;  3Q7V B;  3G34 A;  3NBL A;  4D2O A;  3AYW C;  2ZJ9 A;  1P3I D;  4JLF A;  4KZB A;  3B6F C;  1PW1 A;  4ZUX A;  3AZM B;  3MXR A;  1ZLA C;  3KXB A;  1M18 C;  1H5X A;  3C7U A;  5B31 C;  3UDX A;  3X1U A;  3V9R A;  4XZQ B;  1BH9 B;  4WEL A;  3WKJ B;  3GTC A;  2EFX A;  1ES2 A;  3IWO A;  3MGQ D;  1GA9 A;  4OPR A;  5BO0 B;  5B31 A;  1ZLA D;  4J8U D;  3UN7 A;  3AZM A;  2CV5 B;  4E3L A;  5AV6 B;  4GD8 A;  4OQI A;  5B0Y C;  2P9V B;  3B0C T;  1YMS A;  4OJP A;  1P3G A;  1HQ3 D;  1XGI A;  5C3I B;  2WGI A;  4LV1 A;  4Z9Q A;  4JJN A;  3MGR A;  3NI9 A;  1JWZ A;  4YM6 C;  3QNB A;  4DDS A;  1S32 A;  3HUM A;  3AZN A;  2XD5 A;  1PYY A;  1F66 A;  2NZD D;  3B0D C;  1MWS A;  5FQQ A;  4CPK A;  4PM9 A;  3REL B;  3I7J A;  4WZ5 C;  2CWE A;  4X23 D;  3AZH D;  2WAF A;  4OP5 A;  2C6W B;  2GDN A;  2NQB C;  5CPK D;  3BEC A;  5AQB A;  1MWT A;  4QD4 A;  1K4E A;  1WE4 A;  3WS2 A;  2RL3 A;  1BLC A;  4R1G A;  4S2J A;  1U35 B;  2HUE B;  3REJ A;  5AVC A;  4H9Q B;  1P3M C;  3ZGA B;  1P3I A;  2JSS A;  2IWC A;  4JXS A;  5BNX B;  5DNN D;  1Z6F A;  2HIO D;  1O07 A;  4WU8 C;  1TAF B;  5B0Y A;  3REJ B;  3C1C B;  3HUO A;  2WAD A;  5CP6 B;  3VP2 A;  3VH6 T;  4JXV A;  4EQI A;  2DRW A;  1KX3 A;  4UHU A;  3SS5 A;  4Z66 A;  1BZA A;  4LCM A;  5AV8 C;  3REK D;  3KWQ D;  5KMW A;  1S32 C;  3EQU A;  3X1T D;  2A49 A;  2IWD A;  4BD1 A;  3LJA B;  1YU1 A;  2G5H C;  5CP6 C;  3AFA C;  1BLH A;  3A3D A;  2XFS A;  1TZY C;  5E2E A;  2Q9M A;  5GSU B;  3EPK A;  4NYU A;  3ZG9 B;  5GT0 D;  1MPL A;  4YIN A;  2FJ7 A;  5B1L C;  4CSR B;  3L26 A;  1IYS A;  4QNL A;  1N9B A;  3HLG A;  3TSG A;  3ZG7 B;  3GV9 A;  3X1V A;  5B1M B;  4H9P A;  2Y2K A;  3M2J A;  4EO5 C;  4ZJ2 A;  5B2I B;  3VP4 A;  1YQS A;  5AVB B;  3AZE C;  3E2L A;  4KZ9 A;  2Z2M B;  5JYO A;  2R9X A;  3HLC A;  1P34 B;  3B0B A;  2XEP A;  3VH5 A;  3OCN A;  5E2F A;  4BQM A;  2OSU A;  1YLY A;  3MFD A;  3G4P A;  1ESI A;  4J8V C;  3AZG A;  2PYO B;  4X53 A;  3UTB C;  2VQR A;  5F1G A;  4BL2 A;  3MGP C;  3NDG A;  4Z5T C;  3VH5 W;  4KEN B;  5IHV A;  5CPI C;  4F94 A;  3LZ0 A;  3UTB A;  4BL3 A;  4S2L A;  4QLC A;  1BT5 A;  2Y4A A;  5EVL A;  4S2O A;  2WGV A;  1P3K C;  3WKJ C;  2PBY A;  1F1E A;  1ZLA A;  1KDS A;  5GLA A;  2F8N K;  4IJE A;  3MGS B;  2JC7 A;  3L25 A;  4LCL A;  3A1I A;  5CPI A;  3UTA B;  4LD9 C;  4PPR A;  1KGE A;  1YLP A;  2EX8 A;  4ZTK A;  3REK B;  4OOL A;  4ZBE A;  1PI4 A;  5CPJ B;  4C75 A;  5M18 A;  3HON A;  5KSC A;  5B0Z D;  1O7E A;  4X55 A;  2XK1 A;  4K0W A;  3REH A;  3LEL C;  3NIA A;  3PBR A;  4XZQ D;  1CK3 A;  3JYI A;  2ZY3 A;  1P3M D;  3KUY B;  2H0Y A;  1KX4 D;  5B24 B;  5AY8 C;  1KE0 A;  1SKF A;  1K6S A;  3HLW A;  1M18 A;  3PBS A;  5AV6 D;  3UT9 A;  4PM5 A;  3LEL B;  1MWU A;  5B1L B;  3B6G D;  2PU2 A;  3LZ1 C;  1W5D A;  2YFV A;  3X1S D;  3AZL D;  3AGE A;  3AYW A;  4KG6 A;  4KZ4 A;  4P87 A;  3QNC A;  4N92 A;  5B40 A;  4J8X C;  3AZE D;  4LD9 B;  4R8P D;  4KZ5 A;  3AZF C;  4P85 A;  3EG5 B;  1P3L D;  1YLW A;  1M18 B;  5CED A;  3FKV A;  4JF5 A;  3UTA A;  2X71 A;  5GHZ A;  4UA9 A;  5GT3 D;  3WTP C;  4ZDX A;  3O62 A;  5E5A B;  4KQR A;  1FSW A;  1S0W A;  3VH6 A;  3IXG A;  3LCE A;  1K55 C;  4WU9 B;  4GDN A;  5EUA A;  1PWD A;  3IP4 C;  3NQJ A;  4Y0T A;  3KFU G;  4IBE A;  4ZBJ B;  2WGW A;  3EQV A;  1DJA A;  4Z66 D;  3REH C;  1BUL A;  3OCL A;  1U35 D;  4PM8 A;  5AQA A;  3N8L A;  2Y2L A;  3W97 D;  3A6N D;  1FSY A;  3R45 B;  2Y2G A;  4H8R A;  3A1K A;  3VFH A;  4ID4 A;  4IBX A;  4NFT A;  3N8R A;  2W8S A;  1P3O B;  4WEJ A;  1P3P C;  4ZJ3 A;  4XUJ D;  2NZD A;  1W2E A;  4RX2 A;  4GD6 A;  1KX4 A;  3VH5 T;  4C3Q A;  1KU5 A;  4KGC B;  4ZUX B;  1Q2Q A;  2VGK A;  3H0R C;  4OPZ A;  5TGF A;  5BS7 A;  1ERQ A;  5FUG A;  3ZDJ A;  3W96 D;  4E44 A;  2V20 A;  4LV2 A;  3GRJ A;  5FQI A;  3H0L C;  3LJA D;  3G32 A;  3OPH A;  4IBF A;  4RVA A;  5FQ9 A;  4OLD A;  2OLV A;  3AZJ B;  4OOY A;  1Q2P A;  3VSL A;  3ZG0 A;  3Q81 A;  2CV5 A;  2ZC5 B;  2VGJ A;  1MBL A;  3UO9 A;  5GT0 B;  3WAA D;  5FUG B;  5DVA A;  3LEL D;  3IWI A;  4X23 C;  3ZVW A;  4WZS B;  3LZ1 D;  3WTP B;  1NRF A;  4OPQ A;  2IO5 C;  3VOY A;  5BS7 C;  3MGR C;  3SH7 A;  5FDH A;  4LD9 D;  2BYM B;  5B2J C;  4J8W D;  2V1Z A;  1HQ3 C;  4R8P C;  3SOI A;  3AZF D;  1P3A B;  2Y2P A;  1JWV A;  2XGN A;  3B0D B;  4NK3 A;  3O62 C;  1G6A A;  4Z5T B;  3W8K A;  4QY6 A;  5GT3 B;  1GHM A;  1GHI A;  5EEC A;  2HDU A;  3REL C;  5E5A D;  1M6K A;  3MZE A;  3AZN C;  3KWQ A;  4DKI A;  1MWR A;  3MVD A;  5B2J B;  4JKT A;  4EBL A;  1P3G D;  1C3B A;  5KDM B;  2FJ7 C;  3DWZ A;  4GHL A;  1NYM A;  5CEC A;  3LZ0 C;  3BLM A;  4UA7 A;  4WBG A;  4JBF A;  1N4O A;  4XUJ A;  5B0Z A;  2HP5 A;  1ULY A;  3B6F D;  4YS3 D;  1E25 A;  1ZC2 A;  1AOI C;  2CV5 C;  5B32 B;  1XGJ A;  4N1X A;  3IT9 A;  5DTT A;  1M19 B;  5B0Y B;  1P3O D;  3BLS A;  1FR6 A;  1W8Q A;  5FAT A;  4CAY A;  3NQU A;  4YM6 A;  3V3R A;  3ZFZ A;  2FJ7 B;  1BLP A;  4R3B A;  2Y2H A;  3AZE A;  1JTG A;  1N1J A;  3RXX A;  4KG2 A;  5CP6 A;  1ES3 A;  4X68 A;  3X1S C;  3W99 B;  1PIO A;  2ARO C;  1NXY A;  4IBK A;  3KSY A;  1T3U A;  3AFA D;  1PZP A;  1MXO A;  1WYB A;  4E45 A;  5BT1 C;  1Y54 A;  1BTL A;  3G2Z A;  3TOI A;  3W98 D;  2WKI A;  3LO7 A;  4IBD A;  1JWP A;  1S6R A;  4DE1 A;  1ID3 A;  1A7W A;  1XP4 A;  2RIQ A;  3LY3 A;  4U3T A;  3ITB A;  1GA0 A;  3G35 A;  5B2I A;  5JRG D;  3UPN A;  2XF3 A;  4PM6 A;  3V39 A;  4KZ3 A;  5B33 C;  4LG2 A;  1K54 C;  2NQB D;  3AZE B;  2ZQ8 A;  4WU8 D;  3E2K A;  1JFI B;  3ZG5 A;  5FI7 A;  2ZQ9 A;  5EOE A;  1EWZ A;  2Y2M A;  3FKW A;  2RVQ C;  5DNM B;  3C1B B;  5CRF A;  4HGA C;  1S32 D;  1KVL A;  5CPK B;  2C5W B;  1ID3 C;  4H9S A;  1M1A A;  4EBN A;  5HFO A;  2P74 A;  4NY2 A;  4NZ3 A;  4RA7 A;  1L0D A;  4WMC A;  3MZD A;  5CHJ A;  4E3J A;  2EX6 A;  2HP6 A;  4YS3 B;  1ZG4 A;  2ZY2 A;  5L2F A;  4GHA A;  3C7V A;  5GSU C;  4PMA A;  3O3V A;  1I2W A;  4WJ3 C;  1XX2 A;  1YT4 A;  1M19 D;  3P5J B;  1P3F C;  5CGW A;  1GCE A;  3REJ D;  5AVB A;  3ZG8 B;  1KX3 C;  3AL0 C;  1IYQ A;  3PBO A;  1FQG A;  1QME A;  3PBQ A;  3AV1 C;  1I5Q A;  4IBB A;  3W99 C;  5AVC B;  4E3N A;  3REK C;  1HD8 A;  5AV8 D;  5DTS A;  4KGC D;  4ZUX D;  4BEN A;  3X1T B;  3W98 A;  2WKE A;  1H3O A;  1DY6 A;  1PZR A;  4MNR A;  3WAA C;  1P3F B;  4LD9 A;  1XKZ A;  3AZK D;  5F99 A;  4JF6 A;  3AZF A;  3VP3 A;  4H9N A;  3UE0 A;  5F83 A;  3W99 D;  3L28 A;  4BD0 A;  5AVC C;  4FD8 A;  1MY8 A;  4XUJ C;  5E5A A;  4J8U A;  3AV2 C;  5U47 A;  2ZM5 A;  1TVF A;  1ONG A;  4E3M A;  3WAA B;  1MKI A;  3LZ1 B;  1YLZ A;  2ZC6 B;  2R9W A;  1L0E A;  3UNW A;  5FQK A;  4HGA B;  1WWS A;  4J8W B;  3Q82 A;  4J8U C;  3H0M C;  3IXH A;  5GXQ A;  1XA7 A;  3AZF B;  5G18 A;  4J8X D;  3UY6 A;  3RJU A;  3AZI C;  1HZO A;  1P34 D;  3B6F A;  1K4F A;  1P3K B;  3X1V D;  2Y2N A;  5M1A A;  4OKP A;  3W97 C;  3MKF A;  5JA4 A;  3HLB A;  4DRA A;  1P3P D;  3QHY A;  5EVI C;  5EOO A;  3MNN B;  3W96 A;  1P3O A;  1K38 A;  3UPP A;  2FFF B;  4EO5 B;  1CEG A;  4H9N B;  1PWG A;  5B40 D;  3N4I A;  3MGS A;  1GHP A;  3CMZ A;  5CHU A;  3VP0 A;  5GLB A;  5A92 A;  5G49 A;  4G92 B;  1HTA A;  3MVD C;  1ERO A;  4R4S A;  3UT9 B;  1P3B A;  5B33 D;  5HX9 A;  4GOG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...