2Y2NA

Penicillin-binding protein 1b (pbp-1b) in complex with an alkyl boronate (e07)
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
488
structure length
468
Chain Sequence
ISEITYSDGTVIASIDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTGQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PENICILLIN-BINDING PROTEIN 1B
publication title Structure-Guided Design of Cell Wall Biosynthesis Inhibitors that Overcome Beta-Lactam Resistance in Staphylococcus Aureus (Mrsa).
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 160
structure length 468
sequence length 488
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2y2nA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2y2nA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2y2nA02
2Q9NA 1JWVA 3B3XA 2Y2PA 1IYQA 1MWTA 2XDMA 2UWXA 2Y2LA 1DJBA 4RX3A 5IHVA 3HLWA 1FR6A 4GKUA 4KZ4A 4OP5A 4ZBEA 1PW8A 3C4OA 3WRTA 4MBKA 2EX2A 3N8LA 4OOLA 3FKVA 3HUNA 3PTEA 3BFCA 4OLDA 4S2OA 3WS0A 5EVIC 5CXWA 3NDGA 4F94A 1YLTA 3NY4A 4N9LA 4ZJ3A 4JXWA 4U0TA 1K54C 4QB8A 3HLGA 3M6BA 4KZAA 3MKFA 4N1XA 2WUQA 4DDYA 4S2JA 4Q8IA 2B5RA 1BLPA 4DXCA 2G2WA 2WZXA 3O87A 1KE0A 4NK3A 4BL3A 5A91A 2RCXA 2ZM2A 3RXXA 5CEBA 4C3QA 4BJPA 5GLAA 2X01A 1LHYA 4MBHA 2HP6A 2Y55A 4N1HA 5TGFA 1XGIA 2BG1A 3OPRA 5FAOA 5HAIA 1FR1A 5FQQA 4EBPA 2HPBA 1ZG6A 2EXBA 3G35A 2EX9A 3OPHA 5HX9A 1BSGA 1W8QA 1N9BA 2JBFA 4R3JA 3V39A 1FSWA 2EX8A 3ZG8B 4DRTA 2Y2GA 2ZMAA 1L0FA 4GN2A 3Q82A 1K25A 4S2PA 1FOFA 3GVBA 3IF5A 2HDUA 1Z6FA 3AGFA 1IELA 3HLCA 5E2GA 1ZC2A 2P9VA 2Y4AA 4S2NC 3W4PA 1I2SA 1XP4A 3DW0A 1NY0A 5A92A 5CHUA 1WYCA 2WGIA 1PZOA 3ITBA 1L0GA 3HLDA 4GDBA 4PPRA 5E2HA 1BT5A 4GZBA 3V5MA 2EFXA 1XGJA 3RJUA 1YLJA 3ZDJA 4JXVA 4MEZA 1I2WA 5CERA 4DE2A 5HW3A 2IWDA 1YMSA 1KDSA 3NBLA 4E3NA 3MZDA 3VOYA 3CG5A 3NCKA 5EVIB 2H5SA 2XLNA 5KSHA 2JE5A 1SDNA 3IXBA 1W7FA 3FZCA 4S2NA 4A5RA 3A3DA 4DDSA 5KZHA 1TEMA 1ES2A 2H10A 2X02A 3AGDA 4LV2A 2Y2NA 2ZQ8A 5FASA 4RX2A 5FQIA 4HBUA 3TG9A 4WM9A 5CECA 5FI2A 4X53A 5M18A 4P87A 1CI9A 3NI9A 4OQIA 2Y2QA 1RP5A 3CJMA 5EOOA 3FV7A 4BLMA 4QJGA 3WS1A 1BLCA 1Q2PA 4OH0A 5DTSA 4E3KA 4LV1A 3IWQA 2WADA 3BYDA 3Q7ZA 1J9MA 1K55C 3PBRA 3GMWA 2P9VB 4OOMA 5EECA 4R23A 2ZM0A 4R0QA 1BULA 5A93A 2JCHA 5TR7A 5FQKA 3RXWA 3VSLA 3MFDA 4S2KA 5HL1A 4IVIA 1S6RA 4Y0OA 1PI5A 2Y59A 5EVLA 3WS5A 3BM6A 4KENB 5EUAA 2XFTA 4JLFA 4R4RA 1AXBA 3LEZA 2JC7A 4U0XA 1SHVA 4UA6A 4GDNA 2Z2LB 3S4XA 3HUMA 2WYXA 5CEDA 3BECA 4QY5A 2Y2JA 3OCLA 3IXGA 3ZHHA 3A3IA 3PAEA 3BFFA 3UO9A 3IH8A 2WAFA 1K56D 3N4IA 3OCNA 1KVLA 4HESA 5D3OA 5F82A 4PM5A 1NZUA 3VFHA 1GHMA 2ZC6B 2CC1A 2DRWA 3IXDA 4OPQA 4UHUA 5M19A 3ZNTA 1LI0A 4E3LA 3PBTA 4KZ8A 3IF6A 2Y2OA 3W8KA 2OLUA 4ZTKA 2OV5A 1EROA 4MBFA 2J9OA 4C75A 1PYYA 4WEJA 4KZBA 4FCFA 4MNRA 4DE1A 4EQIA 1BZAA 3C4PA 4L0LA 3PBQA 5FDHA 5E43A 1N4OA 3PBOA 2ZQ7A 1GCEA 2FFYA 4X69A 3SH8A 4JF6A 4FD8A 3JYIA 3QNCA 5F1FA 3M2JA 1KGEA 4OPZA 3OPPA 2GDNA 3AGEA 2RL3A 3FWLA 3LY3A 2V1ZA 3HLEA 4KZ9A 5GLCA 1JWPA 5AQ7A 4H8RA 5HARA 3VP4A 4ID4A 3WS4A 2XFSA 3HBRA 5U47A 1ZG4A 1EWZA 4GD8A 1KVMA 1L0DA 1MWRA 4MLLA 4KQQA 5TFQA 3UN7A 1ES4A 3S1YA 4K0XA 3UPNA 2R9WA 3ZG9B 4OQHA 3UE3A 3GQZA 3UY6A 5CRFA 1DJAA 3IHAA 1BLHA 1XA1A 1MPLA 2Z2MB 3IXHA 2QMIA 1KE3A 1VM1A 2ZQ9A 4OVDA 2VGJA 1HTZA 5DF9A 3CZDA 1FSYA 1SDEA 5L2FA 2WK0A 3IH9A 1FQGA 1QMFA 4LV3A 3G34A 4KZ3A 1NYMA 2EX6A 2HDQA 2Y91A 4ZAMA 3ZVTA 4DXBA 1I5QA 4X56A 3BLMA 4D2OA 3A3EA 1IEMA 3VP3A 1H8ZA 2ZC7A 4BD1A 1W8YA 4LCLA 4OLGA 1ZKJA 3NC8A 4E6XA 3A3JA 3N8RA 5DF7A 5JYPA 1HZOA 3O3VA 1M6KA 3V50A 3O88A 1YMXA 4K0WA 4RVAA 4X6TA 4DE0A 3M6HA 4N92A 4UA9A 1E25A 4B88A 2H0YA 2A49A 4P0MA 4JF5A 5HFOA 4OOYA 1KDWA 3LY4A 3OPLA 3UE0A 1FCNA 1XKZA 3NIAA 3G32A 1YLPA 2ZC4B 4YINA 1SCWA 3E2KA 3V3RA 1G6AA 3EQVA 4R4SA 4E3JA 2R9XA 1PIOA 3ZNYA 2XQZA 3O86A 2ZJ9A 4X68A 1K4EA 2WGVA 4BD0A 4WZ5A 1E3UA 3GTCA 1Y54A 4JPMA 4CJNA 4GD6A 1BUEA 4P6BA 4PM8A 3SS4A 2A3UA 3MKEA 1BLSA 2WKIA 2PBYA 2IWCA 3E2LA 3ZG7B 1G68A 1L2SA 3ISGA 3LO7A 3C5AA 3N8SA 1ERQA 1IKGA 1ONGA 2ZQDA 4E6WA 3CMZA 5E2EA 2HDSA 2QPNA 5DTTA 1GHIA 1RCJA 2EXAA 2OLVA 4KG5A 3WS2A 1WE4A 2XK1A 4NETA 2G2UA 1E3UD 3S22A 2E8IA 3N6IA 2WGWA 3OC2A 5GHYA 4KQRA 1K6SA 5F1GA 3IF6C 3HL9A 1YT4A 2V20A 5DTKA 4B4ZA 1ALQA 3UPPA 5CGSA 1W5DA 5FSRA 4LENA 3UNWA 4DF6A 3TOIA 4X55A 1CI8A 1ES3A 1YQSA 4WBGA 3G2YA 2WKEA 1XPBA 5AQAA 2ZQAA 1MBLA 1FCOA 3UDXA 5G18A 3VMAA 3ZVWA 1PWDA 2Y2IA 3G30A 3G2ZA 1U60A 4KZ5A 4R1GA 4WEKA 5CHMA 1TDLA 4FH4A 4EWFA 4HEFA 1YM1A 3NDEA 5FI7A 4UA7A 3BFEA 4XXRA 2ZLYA 4KZ7A 4UAAA 5FAQA 3Q07A 3WWXA 4EBLA 4WELA 3GRJA 5GLDA 2WAEA 3SH7A 3SS5A 4S2MA 3SOIA 2WKHA 2Y2MA 3MZEA 1GHPA 1QMEA 3I7JA 3HLBA 3P09A 3Q1FA 3MZFA 2WGWB 5M1AA 5KMWA 5FATA 4XUZA 2WZZA 1ESIA 4IVKA 3BEBA 1LI9A 3DWKA 2ZC3B 4BENA 4EUZA 3IQAA 2Q9MA 1H5XA 1HVBA 4RYEA 3C7UA 1C3BA 1E4DA 4BQMA 1NYYA 2XH9A 2J8YA 3SS3A 3UPOA 3UDIA 4RA7A 3Q7VA 1CEFA 3MBZA 1PZPA 4KG6A 1K57A 2P74A 3IF6B 3HUOA 3ZCZA 3ZG5A 1SKFA 4FH2A 2X71A 1CEGA 3MXSA 3G4PA 2FFFB 2HP5A 5EE8A 4Y0UA 2XD5A 4WYYA 4EBNA 3ITAA 3HVFA 1IYSA 3IWIA 3BFDA 3OZHA 4E3MA 1VQQA 3W4QA 3HLFA 2HDRA 1GA9A 3DWZA 5EOEA 2J9PA 5FAPA 2QZ6A 3VOZA 3G31A 4OKPA 5EVIA 1CK3A 3PBSA 4S2LA 3W4OA 2I72A 4GB7A 4OPRA 5AQBA 3A3FA 1K54A 1MWSA 3LCEA 4WZ5C 3IHBA 1DJCA 4IBXA 1M40A 4HBTA 5I94A 3VP2A 5EPHA 1LL9A 3FKWA 1NRFA 3BLSA 1XA7A 4Y7PA 5FQ9A 5FQMA 3QNBA 3VSKA 3M2KA 4E3OA 3ZFZA 4OP8A 4CPKA 3Q7VB 4PM9A 2ZQCA 4P85A 3ZGAB 4Y0TA 5CTMA 3HREA 4IBRA 5EVID 2XGNA 3MXRA 1L0EA 1ESUA 4FSFA 4OONA 1LL5A 2V2FF 3QHYA 1PI4A 1XX2A 3N7WA 5FA7A 3VP0A 3WRZA 2PU4A 1WYBA 1O7EA 1TDGA 1OMEA 4BL2A 4Z9QA 1MXOA 5GHZA 3D4FA 5JYOA 2H0TA 4JBFA 4OPYA 1MWUA 3PAGA 3FYZA 1PWCA 4GOGA 5HAQA 3Q81A 5GLBA 1W79A 1XXMA 4IEDA 4KG2A 3ZG0A 2DCFA 4QU3A 1NXYA 1JVJA 1O07A 4LCMA 2XEPA 1IKIA 5BOHA 5KSCA 4KQOA 4S2IA 4PM6A 4O7DA 2PU2A 3DTMA 2VGKA 2ZC5B 1TVFA 1RGZA 4B4XA 1YLZA 4ZDXA 1JTGA 3UE1A 1EI5A 3P98A 1IYPA 4EV4A 1K38A 2XR0A 3GSGA 3VFFA 3SH9A 3VP1A 1H8YA 3GV9A 1GA0A 4PM7A 5J8XA 2C5WB 5CGXA 5GL9A 4ZJ2A 2HP9A 3UDFA 1S0WA 2DNSA 4GNUA 2XF3A 3V3SA 1K6RA 1YLYA 2ZM8A 2Y2HA 4JKTA 2C6WB 1ERMA 1PWGA 3GR2A 4JXGA 4PMAA 1K56A 1MY8A 4XUXA 4WMCA 4R3BA 3EQUA 1DY6A 5FI6A 4KZ6A 4OQ0A 4QD4A 4QHCA 3BRMA 4OQGA 4N9KA 4WZ4A 4ZJ1A 2ZD8A 1JTDA 1NJ4A 5DVAA 1KGFA 4JF4A 1KE4A 1IYOA 1YLWA 1NZOA 4JXSA 4LV0A 1PW1A 1K4FA 1Q2QA 1RGYA 3BFGA 5E2FA 4DE3A 4QY6A 2Y2KA 4E3IA 1K55A 5DF8A 1BTLA 2J7VA 5HAPA 1HD8A 2IWBA 3PBNA 2XD1A 5GHXA 1FCMA 5FQJA 2BLSA 2EFUA 5AQ9A 1ES5A 3TSGA 1ONHA 4WMCD 5F83A 4M3KA 5CTNA 2OSUA 1KGGA 4K91A 4U3TA 1LLBA 1K57C 3IT9A 3IWOA 4C6YA 5A90A 4YFMA 5CGWA 3C7VA 1MKIA 4DKIA 1JWZA 5CHJA
chains in the Genus database with same CATH superfamily
2XDMA 5IHVA 4GKUA 1FR6A 1T1CA 3A6ND 2PR5A 4ZBEA 1DRMA 4ZRRA 2EX2A 4OOLA 1DP6A 1G6OA 3BFCA 3WS0A 5AY8A 4XUJB 4F94A 3L25A 2P04A 4N9LA 5B0ZC 3REJA 4Q0JA 3IP4C 2HGVA 4QB8A 3HLGA 4KZAA 4MN5A 4N1XA 4QLCD 4Q8IA 3T1SA 2B5RA 1BLPA 2JKTI 2JKTM 2V1AA 4NK3A 5A91A 2RCXA 3RXXA 2QHKA 3RELB 3AZIA 2Y55A 4N1HA 5TGFA 4EBPA 5HAIA 2G5HC 2HPBA 3G35A 4Z5TA 2EX9A 3CHWP 5HX9A 4R3JA 5FEGA 4I3AA 2Y2GA 5AV6A 3C30A 4ZBJB 4EEUA 4PKYG 2RIQA 4GHIA 4E44A 1U35D 3D9YA 4X23B 1IELA 3HLCA 4PKYA 5L09A 1DP8A 2IOUA 3NQJA 3DW0A 3EPHA 5A92A 4I3JA 1WYCA 1L0GA 1ZLAC 1G5UA 1PZOA 3ITBA 4II7A 5TJJA 4GDBA 4DJ2A 5B2IC 4AWLC 3W97C 1BT5A 3V5MA 5AV5C 3AYWD 1XFNA 4JXVA 4MEZA 1I2WA 4J8XC 2L0WA 5DJTA 3LR4A 3MZDA 3NCKA 1P9WA 1P3LD 1P3MA 2V9AA 3WKJC 4ZUXB 1W7FA 5L2FA 5AV8A 3AZMD 3VE3A 4E04A 4J8WB 1EQZB 5CECA 5EM1A 4X53A 4P87A 4LPZA 5AV5A 4WU8B 3UT9D 3FV7A 5EOOA 1P3KB 1PDCA 4XT2A 4BLMA 3H0RC 4H9RB 4E3KA 5JRGD 2WADA 1P3IB 3PYPA 2P9VB 4JGQA 3RTYA 4R0QA 5TR7A 1P3BA 3MFDA 4IVIA 3AV2A 5EVLA 3REHA 2ZY3A 1MZUA 1OJ5A 5EUAA 4JLFA 5CPKD 3LEZA 2JC7A 4GDNA 3S4XA 3HUMA 3C1CA 2V8FA 1H8PA 3BECA 3CUEA 5G49A 3LYXA 5BO0B 5GT0D 3X1TC 3UO9A 3IH8A 3WTPC 2AROA 3MGSA 1K56D 3N4IA 1KVLA 5D3OA 1P3GB 3W2ZA 2J3TC 1K0KA 3VFHA 3IXDA 4UHUA 3B6FA 4YS3B 3AZHB 3IF6A 3LI9A 4J8VB 4Y13A 2B02A 2OLUA 3FC7A 3S7NA 2OV5A 5CPIB 4MBFA 2RVQC 4C75A 4DE1A 4KZBA 4FCFA 4EQIA 4Z66D 4GH9A 1BZAA 5GXQD 3C4PA 3PBQA 3JPUA 3B33A 2VZWA 3PBOA 5FDHA 3AZKD 4JF6A 5JA4A 3QNCA 4NE5A 3B0CW 3OPPA 3AGEA 3FWLA 2V1ZA 1P3FD 4HQAA 2M1CA 3WTPE 3HBRA 1YU2A 3A6NB 4MLLA 4WU9A 5BNXA 5TFQA 3UTBC 4K0XA 1OJGA 2R9WA 3DBAA 3AFAD 3CPTB 5B1MA 3EG5B 3B6GD 1M18C 5FEFA 5IT5A 5BPVA 3E4PA 4O01A 5F69A 1XA1A 4DRBA 2Z2MB 4OVDA 1KE3A 1N1JB 1HTZA 1OT9A 1YSPA 3KXBB 1FSYA 5HWWA 5DNMD 4LV3A 5KIZA 1KX5A 1NYMA 2ZMFA 2Y91A 3X1VC 4ZAMA 3ZVTA 4RQ9A 1I5QA 4X56A 3QP1A 3TRCA 3REID 1P3OD 2VK3A 5B40D 3AN2D 3ICYA 1F66A 4EW7A 3A3JA 3O3VA 3A0RA 3M6HA 4N92A 1TZYA 3IX3A 2H0YA 5GSUB 3UE0A 3NIAA 3UTAB 1VEUA 2ZC4B 4X1MA 4QNLA 1HLUP 4KGCA 4YM6C 2JSSA 3O86A 2P7JA 1S1ZA 1F1EA 3S7OA 3AYWB 2YFVB 2KDKA 1BUEA 3ZYTA 2A3UA 3MKEA 1BLSA 2WKIA 1H0MA 1P3LB 2IWCA 3E2LA 4Z2KA 1L2SA 3ISGA 3LO7A 1IKGA 4GS9A 5C3IC 5AV9B 4XZQC 2K7SA 2ZOIA 5IU1A 2EXAA 2OLVA 4OJ5A 2XK1A 3UT9B 5GHYA 2WGWA 3OC2A 4NXGA 1K6SA 3A0SA 3HL9A 1M19D 1YT4A 3WAAC 5B33D 3TU4A 4WF0A 4X55A 2YFWB 4HMDA 3VH5A 1ES3A 3WA9A 5AQAA 1FCOA 1PWDA 3G30A 3O5YA 1KX4B 4ETXA 5B2JC 2NQBB 3WAAA 4ME4A 4HEFA 4B9OA 1YM1A 3NDEA 2Y8HA 4O8GA 3MGRD 4KZ7A 4UAAA 5FAQA 1P97A 4NG2A 2JKFA 4WELA 5GLDA 4S2MA 2HIOC 2DMWA 1QMEA 4LGWA 5BT1D 2CV5B 1KU5A 5B24B 1LI9A 1D06A 4IVKA 4EUZA 3H7WB 3D72A 2Q9MA 1N9LA 3W98B 3LUQA 4R70A 3T4KA 2XH9A 3MGQB 5HZHA 3L2AA 1CEFA 4HJ3A 3MGPC 3ZCZA 1CEGA 4QWOA 2FFFB 2HP5A 2XD5A 3AZJB 5IS1A 3QP8A 4YNRA 1AOID 3IWIA 3BFDA 5CP6D 3OZHA 2VV8A 3DAVA 5LBRA 3REKC 1OTAA 5B31C 3B6GB 3HLFA 2HDRA 2QZ6A 3VOZA 1ID3A 3PBSA 4HY8A 3C8CA 3LR3A 2F8NG 4OPRA 2IO5C 1JNUA 1K54A 3LCEA 4WZ5C 1A0KA 5B31G 1YUEA 1DJCA 1M40A 1P34D 3VP2A 1NRFA 3QNBA 3REIB 4WU8A 3M2KA 1P3KA 1OTIA 2EWVA 3FDDA 5B40B 3AN2B 1MKMA 3ZFZA 1TS7A 4FTXA 4CPKA 4H9RA 5CTMA 1S67L 3HREA 2XGNA 1ESUA 3LIFA 4MN7A 1KX3D 2PU4A 1O7EA 4GLQA 2PYRA 5AVCC 2H0TA 3FYZA 1OTDA 5HAQA 3Q81A 4KG2A 4HH3A 4J8UC 1NXYA 1JVJA 4LCMA 4UQIS 1PZRA 4HIAA 5B0ZB 2W27A 4IUHA 2ZC5B 2XROA 2A24A 5AVCA 1TAFB 3UE1A 1EI5A 5DJUA 3QP5A 1P3PA 5GT3C 2XR0A 3VFFA 4PM7A 2C5WB 4IBIA 3UDFA 2W3DA 4PMAA 2Y2HA 1PWGA 3TW8A 5F99C 3KUYA 4OJOA 2FJ7C 4KZ6A 4OQ0A 4WLAA 2GZAA 3AZLC 3NULA 4N9KA 1JTDA 1KE4A 1IYOA 4LV0A 1BH9B 4H9SC 3BY8A 1PW1A 1Q2QA 1RGYA 5E2FA 5BNVB 4DE3A 5HDDA 4YWZA 5B33B 2J7VA 3FG8A 5HAPA 1HD8A 3PBNA 4QLCC 2XD1A 5BS7A 5FQJA 3A6NA 1VETB 3C1BC 4F3LB 3KWQC 3VH6T 3TSGA 1ONHA 4WMCD 5B2IB 4AWLB 3W97B 1KGGA 2OSUA 5CTNA 4IJFA 5F5YA 4J8XB 1K57C 3IT9A 4BMWA 1F5MA 5CGWA 4XUJD 4YFMA 5B0YD 5HWVA 2E8JA 3L26A 3K3CA 3MGRB 2Q9NA 1N1JA 1JWVA 4QLCA 2UWXA 2Y2LA 4IJGA 4KZ4A 1BYWA 3C4OA 1U35C 3WRTA 4MBKA 4LD9D 3SW1A 3FKVA 1LSWA 5EVIC 5G4YA 3IBJA 3NDGA 5DNNC 3LIEA 1Z2CB 3RELD 1E6NA 4TX8A 4U0TA 3KX0X 3MKFA 2HUEC 2W3EA 2G2WA 1U35A 2WZXA 1S32B 3O87A 3B0DC 5B32D 4BL3A 5GLAA 3W96D 4HP9A 4X23D 1FR1A 1J3WA 1VB6A 2EXBA 3OPHA 1AOIB 3V39A 3MVDC 2PYOB 1FSWA 1W2EA 3AYWA 3U2AA 3W99B 1A7WA 2ZMAA 3V67A 3KSFA 1P3LA 1YPRA 1FOFA 1Z6FA 3X1SD 4Y5FA 3PR6A 1ZC2A 4ZUXD 3AZMA 2Y4AA 3JVVA 1NY0A 5CHUA 3MNNC 3LEQA 3LZ1C 3HLDA 4J8WD 4PPRA 4M6BA 1EQZD 3D3OA 2NZDC 3UT9A 1XGJA 5CERA 3ULFA 4DE2A 1G28A 5HW3A 2IWDA 5JRGA 2XLNA 5KSHA 3B0BA 2WKQA 1P3ID 1M1AD 2V8CA 4DDSA 5CPJC 4JJNC 1KX3B 2X02A 4LV2A 4RX2A 4CLCD 1Z09A 1AIWA 2VV7A 3NQUA 5M18A 4OQIA 2RTSA 3CJMA 3UTBB 3O62C 3AL0C 3MJQA 4OUIA 5CPKA 1E15A 1BLCA 4MCWA 5DTSA 1H3QA 2JN7A 1HTAA 4CSRB 1J9MA 5GT0A 3T1RA 3GMWA 3AV1D 4Z66C 1TF1A 5F6AA 3EEHA 4R23A 4Y17A 3AZKC 3AZNC 2J80A 3L9KA 2Z6DA 3KS4A 1H3OA 5HL1A 4NE6A 1P3AC 1P3GD 5J4EA 1D1JA 2O9AA 4CAYB 4YS3D 4KENB 3AZHD 1AXBA 2W3GA 3F1PA 4R4RA 4U0XA 4J8VD 2PYPA 5EM0A 2Y2JA 4Z66A 2OOLA 5GXQA 5CPID 3ZHHA 3A3IA 3PAEA 4R8PD 2WAFA 3AZKA 2QJ7A 4QPRA 1HQ3D 1DP9A 2XA7S 3CAXA 2ZC6B 1P3FA 3KSHA 4X1LA 3ZNTA 1LI0A 5AY8C 3FKEA 3PBTA 2W3HA 5HPFA 3LZ0B 4I39A 3KYZA 5FUGB 2L1MA 3W8KA 3T4JA 3REJC 4HJ6A 1EROA 3KSIA 2J9OA 4OJLA 1PYYA 4NXFA 3WD2A 4L0LA 4DN0A 4FD8A 3JYIA 3AFAA 3NECA 5F1FA 2ZBBA 3B6GA 2VQRA 1P3OC 2HF6A 5GLCA 1S1YA 3AZIC 5B0YB 4H8RA 4H9NB 2NUPC 3EPLA 4ID4A 4Z5TC 4XZQB 1CQAA 3V9RA 2XFSA 4WV4B 2B18A 4H9QB 5DNMA 1ZG4A 3MQOA 3OOVA 5U47A 4GD8A 1V9YA 3KXBD 1EAKA 5AV6C 1ES4A 3S1YA 4LD9B 5HSQA 3MSHA 3REIA 2ZL1B 3T4OA 1P3OA 5B40A 3AN2A 3UY6A 5CRFA 3IHAA 4HGAC 1J7MA 3IXHA 5DF9A 2GX5A 3DTKA 3CI6A 2WK0A 3FPWA 2V0WA 3AZGB 4NZ4A 5B32B 2EX6A 5GSUD 4DXBA 3VP3A 3W96B 3UTAD 1P3MC 4BD1A 1W8YA 4OLGA 2D49A 1ZKJA 3NC8A 5B2JB 5JYPA 5AV8C 3V50A 4JGPA 1SKOB 1ZHHB 5HFOA 4LRYC 1XKZA 4HMEA 3G32A 1M19C 3X1SB 3E2KA 1G6AA 3HJIA 2OWJA 2W1RA 1EW0A 3MR0A 1E6ZA 5AV9D 2XQZA 3C2WA 1X0OA 1CK7A 4BD0A 4JGRA 1P3BC 4GD6A 3AV2C 3MQ0A 1M19A 3REHC 1OGBA 3B42A 1G68A 3GECA 5A8BA 2G5IC 5BNVA 3MGPB 1M1AB 1ERQA 3C1CC 3AZFB 3N8SA 5B33A 1BH8A 2V5OA 3CUEC 3MFXA 5AVBD 4CLCB 5DTTA 1VHMA 4KG5A 4GHLA 3WS2A 2AROC 3MGSC 3FPVA 3T1XA 2G2UA 2L5AA 3KSGA 5BT1C 3N6IA 3B6FC 4KQRA 3REKB 3X1UB 5L8MA 3EPJA 3IF6C 2ZY4A 2V20A 1KX4D 5DTKA 3AV1B 2NQBD 3MGRA 2FN2A 1W5DA 4G92C 2F8NH 4DF6A 5KDMB 1E8BA 1XJ3A 1CI8A 4EEPA 1YQSA 4LFUA 4WBGA 2WKEA 1ACFA 3VMAA 3A1KA 4NE3A 3G2ZA 1U60A 2CV5D 5B24D 4FH4A 4EWFA 4R8PB 4UA7A 4G3VA 1HQ3B 3W98D 1UR8A 4WU9C 3IS2A 3Q07A 1GPFA 3SH7A 1MC0A 5B1LD 3MGQD 5B1MC 3Q1FA 4HNBA 1Y4OA 3VH5T 5TBMB 5FATA 5HL6A 3R4KA 1ESIA 3BWLA 3BEBA 2PDRA 5AVFA 1AOIA 3AZJD 1HVBA 2F2AC 3KYQA 5CP6A 4IBKA 4G3KA 1KX5C 2QKPA 3SS3A 3LGOA 3Q7VA 4OJPA 3R7WA 3ZG5A 4WNNA 1F66C 3IX8A 4FH2A 2A2LA 2K2NA 4Y0UA 5HWTA 4HOIA 1P34A 4NZ1A 3HVFA 1TZYC 1XFQA 5F99B 4E3MA 2FJ7B 3W4QA 1GA9A 4KUDD 5EVEA 1CK3A 4KGCC 3A3FA 1TS0A 1KX3A 1MWSA 2NUTC 3IHBA 5I94A 1UWPX 3C1BB 3FKWA 3L29A 3KWQB 3B47A 2PT7A 3LELB 3VSKA 4I5SA 4Y0TA 4H6JA 2VGLS 1T18A 4HP4A 1L0EA 1XJ2A 4FSFA 4NYUA 4OONA 3QHYA 5B0ZD 4KUOA 3VP0A 3WRZA 1OMEA 4Z9QA 1MXOA 3D4FA 1MWUA 1PWCA 1YU1A 2BYKA 2DCFA 4QU3A 5BOHA 5DNNB 1F98A 3F1NA 4FOFA 1JFIB 4PM6A 4S2IA 4H9OB 3UMDA 3TU4C 1GXDA 2VGKA 3LJAB 2HUEB 2YKHA 3P98A 3WA9C 1PNEA 2HJ9C 1H8YA 4P6ZS 3B0DB 1GA0A 5J8XA 5CGXA 3IBRA 5AVBB 2DNSA 2XF3A 3NHQA 4WN5A 1YLYA 2ZM8A 5MC7A 2C6WB 1ERMA 4WMCA 1DY6A 5FI6A 3AZEB 1CJFA 1ZLAD 4JGOA 2PRFA 3BRMA 1SZVA 5B2ID 1NJ4A 4KHAB 1KGFA 3W97D 2CWEA 4JF4A 1YLWA 2J8PA 4XUJA 1FILA 5B0YA 1K4FA 3BFGA 4J8XD 4ESPA 1T1AA 2Y2KA 1K55A 5DF8A 1BTLA 3WKJD 1BFMA 2QJ5A 1FCMA 2EFUA 5AQ9A 3LZ1B 2XSSA 4LD9A 4ZBJC 2NZDB 2ZL1A 3H9WA 4Q0IA 4X23C 3RELA 4C6YA 4HH2A 3C7VA 2M7UA 4DKIA 4I3IA 2ZM5A 4IJEA 3B3XA 1MWTA 4JJNB 1B67A 5B1LB 4RX3A 4OP5A 5B32A 1P0ZA 1S32D 4NKPA 5CX7A 4YOFA 3F1OB 4OLDA 3W96A 1ID3C 5CXWA 4X23A 1YLTA 4MB3A 3CWFA 1K54C 2W1TB 2WUQA 2PAVP 3AZNB 2WKRA 3X1TD 2PYOD 2VLGA 3WTPD 4WU8C 1R4VA 3W99D 1P3KC 1KE0A 1P3AB 2J3TD 3X1SA 5E5AB 1LHYA 3DTEA 4ZUXA 3BJNA 1XGIA 2BG1A 5FAOA 4J8WA 1EQZA 1W8QA 1N9BA 2RVQD 2EX8A 3ZG8B 2YKFA 4DRTA 1GSVA 4KUDB 1L0FA 4GN2A 1WWIA 1K25A 3IF5A 2L4RA 1P3IA 1M1AA 3AGFA 5E2GA 2P9VA 3MF0A 2V1BA 3W4PA 4CLCA 3REJB 1I2SA 1XP4A 1YU4A 1GSWA 5E2HA 4GZBA 5HDCA 1P3PC 2M7VA 3RJUA 3UTBD 3AZHC 2BYMB 4E3NA 2ACGA 3VOYA 1F9IA 4J8VC 3AV1A 2DF4C 1SDNA 5DFYA 4UPKA 5CPIC 1M18D 5BO0A 3AGDA 1ES2A 2Y2NA 2ZQ8A 3BW6A 5FQIA 5FASA 4HBUA 3KUYC 3TG9A 4WM9A 5FI2A 1P3GA 3NI9A 3T4TA 5AV6B 5K5BA 4YS3A 3PHYA 4GHIB 3AZHA 3X1VD 4OH0A 3UE6A 4J8VA 4LV1A 1V9ZA 1YKDA 3NOUC 5CPIA 4R8PA 3TE8A 5J7EA 5BS7C 1IOUA 3A6NC 2PBDP 1HQ3A 3NQJB 1BULA 2FH5A 2XRNA 4ARZB 5A93A 3G6OA 3VSLA 3RXWA 4S2KA 4Z2HA 3QP4A 2Y59A 3WS5A 3SZTA 1SHVA 4NXBA 3LZ0D 5AV8B 3NOTC 1ZLAB 1PRQA 3OCNA 1ODVA 2HZ5A 5F82A 4GJ4A 1GHMA 3CPTA 2CC1A 2DRWA 5AV5B 2OAP1 5M19A 3HSHA 4XT2B 4KZ8A 3WKJB 4ZTKA 1GSXA 3KXBA 4WEJA 4XZQD 1LSVA 5E43A 4Z2MG 1GCEA 2ZQ7A 3M2JA 1KGEA 2RL3A 3UTAC 4NXEA 1YSQA 4Z2JA 4PAUA 3R45B 5HARA 3VP4A 3NOPC 1Y28A 3WS4A 3C1CB 4BBUA 5HD5A 5G49B 4ETZA 5L07A 1EWZA 2IA2A 1KVMA 1L0DA 4B93A 3AYWC 2AROB 5GSUA 3DTIA 3T4LA 3AZGD 3MMHA 3UTAA 1P3LC 3B6FB 4OQHA 2Y79A 3UE3A 3GQZA 1DJAA 4PHTA 4GHAA 3AZMC 3BY9A 2QMIA 5B2JD 1VM1A 4O0PA 4Z1WA 4LRXC 4G92B 3X1TB 3WTPB 4IBJA 2YFVA 3UT9C 3G34A 4KZ3A 5JA4B 3HONA 2HDQA 4Y3IA 1CXWA 2HIOD 4D2OA 5JRGC 2ZC7A 2INWA 2PHYA 4LCLA 4E6XA 5AV9A 5DF7A 3N8RA 4MN6A 5DKKA 1M6KA 3O88A 3A0VA 1YMXA 4K0WA 3H82B 4RVAA 5C5KA 4DE0A 1H0GA 4B88A 4WU9B 3OLOA 2A49A 5BNXB 1TS6A 4JF5A 4P0MA 3IX4A 1KDWA 4OOYA 1FCNA 3M7PA 5CPKC 5B1MB 1KX4C 3EQVA 4R4SA 1TD5A 3EEAA 5AVBA 4E3JA 5GT0C 3MGPD 3AZFD 1PIOA 2KOIA 4X68A 2WGVA 4MB4A 3GTCA 2YFWA 4JPMA 4IBCA 1UR9A 1KX5B 2HJEA 4CJNA 3E4QA 2F8ND 4PM8A 2CV5C 2PBYA 4CQHA 3REKD 1KX4A 3X1UD 5B31D 3ZG7B 2NQBA 1M18B 3C5AA 2CMNA 2PR6A 5E2EA 2HDSA 1F66B 5GXQC 1CF0A 3K2NA 1RCJA 1D7EA 4BBVA 1TZYB 3MGQC 4NETA 1E3UD 3S22A 1P3FC 3T12B 4EERA 3X1VB 2CV5A 5B24A 1VEUB 3H7WA 3GDIA 4HI4A 3UPPA 1ULYA 5CGSA 3AZJC 4KGCB 3W98A 1XJ6A 1LT0A 3B0CT 5FSRA 5B1LA 1H8MA 3TOIA 3AFAC 3MGQA 3B6GC 3G2YA 2LB9A 1XPBA 3ZVWA 2ZQAA 4KZ5A 5FL3A 4R1GA 5CHMA 1TDLA 1L6JA 4J8UD 1STZA 3AZJA 1OPXA 4DJ3A 4YM6B 5DNMC 3BFEA 4XXRA 2ZLYA 3CLOA 1OT6A 3WWXA 4EBLA 3GRJA 3SOIA 2WKHA 3MZEA 3REIC 3I7JA 1GOIA 3HLBA 3P09A 5B40C 3AN2C 2WGWB 3UB9A 5KMWA 5GT3D 3DWKA 4BENA 5C3IB 1H5XA 3EGXC 2JKRM 3KFUG 3TU4B 3C7UA 1C3BA 3T4QA 4BQMA 3C38A 1NYYA 2V0UA 5F99D 4KUDA 3T50A 3UPOA 2FJ7D 3VH6W 3WA9B 4RA7A 3S7QA 3AZLD 1PZPA 2P74A 3HUOA 2VJWA 3E4OA 3QP2A 1OTBA 4R38A 2X71A 3MXSA 3WAAB 5EE8A 4WYYA 3ITAA 4Z2LA 3C1BD 3KWQD 1VQQA 5EOEA 3LELD 5FAPA 2J9PA 4Z2GA 2BYMA 3LR0A 3G31A 1FIKA 4S2LA 2I72A 2P08A 4GB7A 4Z2IA 1H0IA 5B0ZA 2QWSA 4IBXA 4HBTA 2PD7A 1TAFA 5EPHA 3BLSA 2HIOB 5FQMA 4HMCA 4E3OA 4OP8A 4PM9A 3ZGAB 2ZQCA 4NZ5A 3VOLA 2KX6A 5B33C 5EVID 2GJ3A 1S4RA 3MXRA 5DNND 1XX2A 3N7WA 4ARZA 4LRZE 1TDGA 3WD0A 5HD3A 3LJAD 4BL2A 5GHZA 4GW9A 4BWIA 4EUVA 5JYOA 3PAGA 1BH9A 1XXMA 1L3LA 3ZG0A 1O07A 1ID3B 4UQIM 2KLIA 1IKIA 3MGRC 4L9EA 4KQOA 5KSCA 1P9RA 2PU2A 3DTMA 3LFVA 1VETA 2K31A 4F3LA 1ZLAA 1TVFA 5B2IA 2F8NB 3MVDD 3W97A 3AZED 1IYPA 4EV4A 1UGUA 3GSGA 3VP1A 4IBDA 5B31B 3SH9A 4J8XA 1WWSA 1W63M 3JVUA 2VX8A 4HJ4A 2OAQ1 5CHLB 3WKJA 3V3SA 2IO5B 1E88A 1NLZA 1K6RA 3A1IA 4R3BA 1E6RA 3MNND 4QD4A 1S32C 4QHCA 3LZ1D 4OQGA 2ZD8A 4NZ3A 5DVAA 4OJ6A 2NZDD 2DQNC 4MB5A 3PXPA 3T4SA 1NZOA 3R45A 3MQLA 4QY6A 1XJ4A 4EO5C 1AOIC 5GHXA 2PYOC 5CP6C 5CPJD 4JJND 3W99C 2A24B 5AVCB 1S32A 4K91A 1P3PB 1LLBA 3O62D 2HV1A 3IWOA 4J8UB 5A90A 1MKIA 1JWZA 1P34C 2Y2PA 1IYQA 3X1TA 2PYOA 1DJBA 3WTPA 3HLWA 4E45A 2JKGA 3KUYB 3W99A 3AZND 3BQ8A 1PW8A 3QP6A 3N8LA 5GT3B 3HUNA 1OTEA 3LICA 3PTEA 1P3AD 4S2OA 2MJ6A 5E5AD 3NY4A 4ZJ3A 4JXWA 1KX3C 3M6BA 3H82A 4DDYA 4S2JA 4DXCA 3NJAA 4D60A 3AZLB 5CEBA 2ZM2A 3T1QB 4C3QA 4EQ1A 4BJPA 2X01A 1W1YA 4MBHA 2HP6A 2O0YA 5AY8D 3OPRA 1KOUA 5FQQA 1ZG6A 1YU3A 5F68A 4GCZA 3P5JB 3OBFA 3REJD 4QLCB 1BSGA 2JBFA 5J3WA 3UTBA 2F8NK 4WUJA 3Q82A 4S2PA 1F2KA 3GVBA 2HDUA 1M18A 4CSRA 2LB5A 3AZID 1N9NA 4S2NC 3VE4A 4Z5TD 2WGIA 3UB7A 1QO6A 4G91C 1OGGA 1T3UA 4Z2MH 2EFXA 4WL9A 1U35B 3X1VA 5AV6D 1YLJA 3ZDJA 4EXOA 4CAYA 4H9PB 1YMSA 1KDSA 3NBLA 3WX7A 3CG5A 5EVIB 2H5SA 3LZ0C 2JE5A 2BTFP 3IXBA 3FZCA 4S2NA 4A5RA 3A3DA 5KZHA 1TEMA 2H10A 3KYEA 4G3WA 5HPIA 5HDSA 1CI9A 2Y2QA 1RP5A 3KSYA 2Z6CA 4Q0HA 4XUJC 3WD3A 4NYYA 5B0YC 4QJGA 3WS1A 4KQDA 1Q2PA 2D02A 3LZ0A 3IWQA 3L28A 5FUGA 3BYDA 3Q7ZA 3U4LP 1K55C 3PBRA 1P3MD 4Y15A 4YM6A 3N3FA 2O9CA 3AZMB 4EU0A 4OOMA 5EECA 2ZM0A 5AV8D 2JCHA 1NWZA 3MVDB 4LD9C 5FQKA 1S6RA 4MDZA 4Y0OA 1PI5A 1PFLA 5AV5D 4IBGA 2OWHA 3BM6A 3RELC 4DRAA 4H9NA 5JRGB 2XFTA 4EETB 2H28A 4UA6A 2Z2LB 2WYXA 5CEDA 4QY5A 4XZQA 3OCLA 3E0YA 4H9QA 3IXGA 3MS6A 3BFFA 2ZY2A 3MNNB 3L7HA 3AZGC 2XA7M 5B32C 4HESA 3NQUB 4PM5A 1NZUA 2R78A 1P3BD 1YU0A 4OPQA 3W96C 4E3LA 3AV2D 5CPKB 3H0LC 3REHD 1N9OA 2Y2OA 5B32G 5GT0B 2EWWA 3C1CD 4UUZB 4MNRA 5CPJB 5L10A 3F6TA 4NY2A 1N4OA 4X69A 2FFYA 3AZGA 3SH8A 4DMZA 5DFXA 1H3OB 2AROD 3MGSD 4OPZA 2JHEA 2GDNA 3LY3A 3O62B 3EWKA 3X1SC 3HLEA 4KZ9A 4WJ3C 3B6FD 1JWPA 2PD8A 4ZUXC 5AQ7A 1S66L 3F1PB 5B2JA 4KUKA 1T1BA 5AJGA 5EV0A 4AFIA 1SKOA 4Z66B 4J8WC 1EQZC 5GXQB 2LY8A 3AZKB 1MWRA 4KQQA 3UN7A 2HIOA 3UPNA 3ZG9B 4R6LA 1P3FB 1P3IC 1M1AC 3AZFC 1BLHA 3VH5W 1MPLA 2Q0OA 4CLCC 2ZQ9A 2VGJA 3CZDA 3EPKA 2FZ0A 1SDEA 3BQAA 3IH9A 1FQGA 1QMFA 1ZTUA 4LG2A 4WU9D 3AFAB 3X1UC 3BLMA 3A3EA 1IEMA 1H8ZA 5AY8B 3LIDA 5B1MD 4IBFA 3MGPA 3AZFA 3AV1C 3L27A 1HZOA 1W1TA 3K3DA 3V9RB 4X6TA 5DNMB 1P3GC 4UA9A 1E25A 3P7NA 1YAXA 2F8NA 3LY4A 3OPLA 4YS3C 1KX5D 3REKA 3X1UA 5B31A 1IFQA 1P3OB 4L9GA 1YLPA 3V3RA 2AVXA 1B6WA 1SCWA 4YINA 2EA9A 3AZIB 4IUKA 4CLCE 4R8PC 2R9XA 3ZNYA 4Z5TB 1F66D 2ZJ9A 3WD1A 1K4EA 3LIBA 1HQ3C 4Y2FA 2VV6A 3KO6A 4WZ5A 5KDMA 1E3UA 4NFTA 1Y54A 4K08A 2QYBA 1TZYD 3TJZC 3LR5A 1Q9CA 4P6BA 1W63Q 3SS4A 2W3FA 2WKPA 1O6IA 2ZQDA 1ONGA 4E6WA 1S4SA 3CMZA 4HGAB 2QPNA 4KGCD 1GHIA 3EGDC 1WE4A 2VA0A 1NLYA 2ZOHA 2E8IA 3HJKA 5TBMA 5F1GA 4J8UA 4M4XA 4MMNA 1P3MB 2B95A 4B4ZA 2UV0E 1ALQA 2BASA 3KXBC 4YM6D 4LENA 3UNWA 3UDXA 5GT3A 1MBLA 5G18A 3UB8A 2Y2IA 3S7PA 1M19B 3CITA 4WEKA 5DKLA 3UMEA 1BH8B 5FI7A 5GSUC 5F99A 3TU4D 2WAEA 3SS5A 1P3BB 2FJ7A 2Y2MA 1GHPA 3LELC 4BBTA 3AZLA 1ED7A 3MZFA 5M1AA 3AV2B 3RFBA 3WA9D 3REHB 4XUZA 2WZZA 2GNXA 4H9SA 1LL8A 2ZC3B 3IQAA 3WAAD 4L9FA 4RYEA 1E4DA 3MGSB 3C1BA 3KWQA 3E98A 2J8YA 3LELA 4IHQA 1T19A 4NEED 3UDIA 5FDSA 3MBZA 4KG6A 1K57A 3IF6B 1NRJA 5AV9C 1SKFA 3G4PA 2O9BA 1WA9A 4EBNA 3LJAC 3UB6A 1IYSA 3IS2B 3DWZA 4H9PA 4OKPA 5EVIA 5AVBC 3W4OA 5DNNA 1JFIA 4R3AA 1E6PA 4H9OA 5AQBA 4EO5B 3LJAA 3WD4A 3VV4A 5EFWA 3AZEC 5CP6B 1LL9A 4Y7PA 1XA7A 5FQ9A 4EESA 2VKSA 4UEYA 3MQQA 3Q7VB 2W8SA 4P85A 2NQBC 2VGLM 3R7WB 4IBRA 1ID3D 4WNNB 1LL5A 2V2FF 1PI4A 1P34B 4IBBA 5FA7A 5G4ZA 1WYBA 3MVDA 4DQYB 3AZEA 2D01A 3UB5P 4JBFA 4OPYA 4KHAA 2I9VA 4GOGA 5GLBA 5B24C 1W79A 4IEDA 4WU8D 1P3KD 2O99A 2XEPA 3W98C 4O7DA 5B1LC 3MNNA 2ZMVA 3LZ1A 1RGZA 4B4XA 1YLZA 2G7UA 4ZDXA 1JTGA 1LSXA 2NZDA 4I38A 1K38A 1KS0A 4LLOB 4P6ZM 3GV9A 5GL9A 2ZY5A 4H6JB 4ZJ2A 2HP9A 1S0WA 1AWIA 4GNUA 3HCYA 3VH6A 4JKTA 4UUZA 4JXGA 5CPJA 4JJNA 3GR2A 1W1VA 4IBEA 3H0MC 1K56A 1MY8A 4XUXA 1TS8A 3EQUA 3LIAA 4ZJ1A 4WZ4A 5AVCD 4FUWA 3F1OA 3O62A 5AVEA 3KS8A 5E5AC 1P3PD 4JXSA 1UWNX 2BYKB 3P01A 4X25A 2VEAA 3EOIA 4GS9B 4E3IA 3F1NB 2W1TA 2IWBA 3ZQ5A 2BLSA 3AZNA 3RH8B 1ES5A 3LI8A 1W1PA 4KUDC 3KUYD 5F83A 4M3KA 4WZSB 1P3AA 4G91B 4U3TA 5I5LA 4HHDA 5E5AA 3MXQA 2W0NA 2J3WA 5CHJA 2JKRI
chains in the Genus database with same CATH topology
2XDMA 5IHVA 4GKUA 1FR6A 3A6ND 4ZBEA 2EX2A 4OOLA 3BFCA 3WS0A 5AY8A 4XUJB 4F94A 3L25A 4N9LA 5B0ZC 3REJA 3IP4C 4QB8A 3HLGA 4KZAA 4N1XA 4QLCD 4Q8IA 2B5RA 1BLPA 4NK3A 5A91A 2RCXA 3RXXA 3RELB 3AZIA 2Y55A 4N1HA 5TGFA 4EBPA 5HAIA 2G5HC 2HPBA 3G35A 4Z5TA 2EX9A 5HX9A 4R3JA 2Y2GA 5AV6A 4ZBJB 2RIQA 4E44A 1U35D 4X23B 1IELA 3HLCA 2IOUA 3NQJA 3DW0A 3EPHA 5A92A 1WYCA 1L0GA 1ZLAC 1PZOA 3ITBA 4GDBA 5B2IC 4AWLC 3W97C 1BT5A 3V5MA 5AV5C 3AYWD 4JXVA 4MEZA 1I2WA 4J8XC 3MZDA 3NCKA 1P3LD 1P3MA 3WKJC 4ZUXB 1W7FA 5L2FA 5AV8A 3AZMD 4J8WB 1EQZB 5CECA 4X53A 4P87A 5AV5A 4WU8B 3UT9D 3FV7A 5EOOA 1P3KB 4BLMA 3H0RC 4H9RB 4E3KA 5JRGD 2WADA 1P3IB 2P9VB 4R0QA 5TR7A 1P3BA 3MFDA 4IVIA 3AV2A 5EVLA 3REHA 2ZY3A 5EUAA 4JLFA 5CPKD 3LEZA 2JC7A 4GDNA 3S4XA 3HUMA 3C1CA 3BECA 5G49A 5BO0B 5GT0D 3X1TC 3UO9A 3IH8A 3WTPC 2AROA 3MGSA 1K56D 3N4IA 1KVLA 5D3OA 1P3GB 3VFHA 3IXDA 4UHUA 3B6FA 4YS3B 3AZHB 3IF6A 4J8VB 2OLUA 2OV5A 5CPIB 4MBFA 2RVQC 4C75A 4DE1A 4KZBA 4FCFA 4EQIA 4Z66D 4GH9A 1BZAA 5GXQD 3C4PA 3PBQA 5FDHA 3PBOA 3AZKD 4JF6A 5JA4A 3QNCA 4NE5A 3B0CW 3OPPA 3AGEA 3FWLA 2V1ZA 1P3FD 3WTPE 3HBRA 1YU2A 3A6NB 4MLLA 4WU9A 5BNXA 5TFQA 3UTBC 4K0XA 2R9WA 3AFAD 5B1MA 3EG5B 3B6GD 1M18C 5BPVA 1XA1A 4DRBA 2Z2MB 4OVDA 1KE3A 1N1JB 1HTZA 3KXBB 1FSYA 5DNMD 4LV3A 1KX5A 1NYMA 2Y91A 3X1VC 4ZAMA 3ZVTA 1I5QA 4X56A 3REID 1P3OD 5B40D 3AN2D 1F66A 3A3JA 3O3VA 3M6HA 4N92A 1TZYA 2H0YA 5GSUB 3UE0A 3NIAA 3UTAB 2ZC4B 4QNLA 4KGCA 4YM6C 2JSSA 3O86A 1F1EA 3AYWB 2YFVB 1BUEA 2A3UA 3MKEA 1BLSA 2WKIA 1P3LB 2IWCA 3E2LA 1L2SA 3ISGA 3LO7A 1IKGA 5C3IC 5AV9B 4XZQC 2EXAA 2OLVA 4OJ5A 2XK1A 3UT9B 5GHYA 2WGWA 3OC2A 1K6SA 3HL9A 1M19D 1YT4A 3WAAC 5B33D 3TU4A 4X55A 2YFWB 1ES3A 3VH5A 3WA9A 5AQAA 1FCOA 1PWDA 3G30A 1KX4B 5B2JC 2NQBB 3WAAA 4HEFA 1YM1A 3NDEA 3MGRD 4KZ7A 4UAAA 5FAQA 4WELA 5GLDA 4S2MA 2HIOC 1QMEA 5BT1D 2CV5B 1KU5A 5B24B 1LI9A 4IVKA 4EUZA 2Q9MA 3W98B 2XH9A 3MGQB 3L2AA 1CEFA 3MGPC 3ZCZA 1CEGA 2FFFB 2HP5A 2XD5A 3AZJB 1AOID 3IWIA 3BFDA 5CP6D 3OZHA 3REKC 5B31C 3B6GB 3HLFA 2HDRA 2QZ6A 3VOZA 1ID3A 3PBSA 2F8NG 4OPRA 2IO5C 1K54A 3LCEA 4WZ5C 5B31G 1YUEA 1DJCA 1M40A 1P34D 3VP2A 1NRFA 3QNBA 3REIB 4WU8A 3M2KA 1P3KA 3FDDA 5B40B 3AN2B 3ZFZA 4CPKA 4H9RA 5CTMA 3HREA 2XGNA 1ESUA 1KX3D 2PU4A 1O7EA 5AVCC 2H0TA 3FYZA 5HAQA 3Q81A 4KG2A 4J8UC 1NXYA 1JVJA 4LCMA 1PZRA 5B0ZB 2ZC5B 5AVCA 1TAFB 3UE1A 1EI5A 1P3PA 5GT3C 2XR0A 3VFFA 4PM7A 2C5WB 4IBIA 3UDFA 4PMAA 2Y2HA 1PWGA 5F99C 3KUYA 4OJOA 2FJ7C 4KZ6A 4OQ0A 3AZLC 4N9KA 1JTDA 1KE4A 1IYOA 4LV0A 1BH9B 4H9SC 1PW1A 1Q2QA 1RGYA 5E2FA 5BNVB 4DE3A 5B33B 2J7VA 5HAPA 1HD8A 3PBNA 4QLCC 2XD1A 5BS7A 5FQJA 3A6NA 3C1BC 3KWQC 3VH6T 3TSGA 1ONHA 4WMCD 5B2IB 4AWLB 3W97B 1KGGA 2OSUA 5CTNA 4IJFA 4J8XB 1K57C 3IT9A 4YFMA 5CGWA 4XUJD 5B0YD 3L26A 3MGRB 2Q9NA 1N1JA 1JWVA 4QLCA 2UWXA 2Y2LA 4KZ4A 3C4OA 1U35C 3WRTA 4MBKA 4LD9D 3FKVA 5EVIC 3NDGA 5DNNC 1Z2CB 3RELD 4U0TA 3MKFA 2HUEC 2G2WA 1U35A 2WZXA 1S32B 3O87A 3B0DC 5B32D 4BL3A 5GLAA 3W96D 4X23D 1FR1A 2EXBA 3OPHA 1AOIB 3V39A 3MVDC 2PYOB 1FSWA 1W2EA 3AYWA 3W99B 1A7WA 2ZMAA 1P3LA 1FOFA 1Z6FA 3X1SD 1ZC2A 4ZUXD 3AZMA 2Y4AA 1NY0A 5CHUA 3MNNC 3LZ1C 3HLDA 4J8WD 4PPRA 4M6BA 1EQZD 2NZDC 3UT9A 1XGJA 5CERA 4DE2A 5HW3A 2IWDA 5JRGA 2XLNA 5KSHA 3B0BA 1P3ID 1M1AD 4DDSA 5CPJC 4JJNC 1KX3B 2X02A 4LV2A 4RX2A 3NQUA 5M18A 4OQIA 3CJMA 3UTBB 3O62C 3AL0C 4OUIA 5CPKA 1BLCA 5DTSA 1HTAA 4CSRB 1J9MA 5GT0A 3GMWA 3AV1D 4Z66C 4R23A 3AZKC 3AZNC 3KS4A 1H3OA 5HL1A 4NE6A 1P3AC 1P3GD 4KENB 4CAYB 4YS3D 3AZHD 1AXBA 4R4RA 4U0XA 4J8VD 2Y2JA 4Z66A 5GXQA 5CPID 3ZHHA 3A3IA 3PAEA 4R8PD 2WAFA 3AZKA 1HQ3D 2ZC6B 1P3FA 3ZNTA 1LI0A 5AY8C 3FKEA 3PBTA 3LZ0B 5FUGB 3W8KA 3REJC 1EROA 2J9OA 4OJLA 1PYYA 4L0LA 4FD8A 3JYIA 3AFAA 5F1FA 3B6GA 2VQRA 1P3OC 5GLCA 3AZIC 5B0YB 4H8RA 4H9NB 3EPLA 4ID4A 4Z5TC 4XZQB 2XFSA 3V9RA 4WV4B 5U47A 4H9QB 5DNMA 1ZG4A 4GD8A 3KXBD 5AV6C 1ES4A 3S1YA 4LD9B 3REIA 1P3OA 5B40A 3AN2A 3UY6A 5CRFA 3IHAA 4HGAC 3IXHA 5DF9A 2WK0A 3AZGB 4NZ4A 5B32B 2EX6A 5GSUD 4DXBA 3VP3A 3W96B 3UTAD 1P3MC 4BD1A 1W8YA 4OLGA 1ZKJA 3NC8A 5B2JB 5JYPA 5AV8C 3V50A 5HFOA 1XKZA 3G32A 1M19C 3X1SB 3E2KA 1G6AA 5AV9D 2XQZA 4BD0A 1P3BC 4GD6A 3AV2C 1M19A 3REHC 1G68A 2G5IC 5BNVA 3MGPB 1M1AB 1ERQA 3C1CC 3AZFB 3N8SA 5B33A 1BH8A 5AVBD 5DTTA 4KG5A 4GHLA 3WS2A 2AROC 3MGSC 2G2UA 2L5AA 5BT1C 3N6IA 3B6FC 4KQRA 3REKB 3X1UB 3EPJA 3IF6C 2ZY4A 2V20A 1KX4D 5DTKA 3AV1B 2NQBD 3MGRA 1W5DA 4G92C 2F8NH 4DF6A 5KDMB 1CI8A 1YQSA 4WBGA 2WKEA 3VMAA 3A1KA 4NE3A 3G2ZA 1U60A 2CV5D 5B24D 4FH4A 4EWFA 4R8PB 4UA7A 1HQ3B 3W98D 3Q07A 4WU9C 3SH7A 5B1LD 3MGQD 5B1MC 3Q1FA 3VH5T 5FATA 1ESIA 3BEBA 1AOIA 3AZJD 1HVBA 2F2AC 5CP6A 4IBKA 1KX5C 3SS3A 3Q7VA 4OJPA 3ZG5A 4WNNA 1F66C 4FH2A 4Y0UA 1P34A 4NZ1A 3HVFA 1TZYC 5F99B 4E3MA 2FJ7B 3W4QA 1GA9A 4KUDD 1CK3A 4KGCC 3A3FA 1KX3A 1MWSA 3IHBA 5I94A 3C1BB 3FKWA 3L29A 3KWQB 3LELB 3VSKA 4Y0TA 1L0EA 4FSFA 4NYUA 4OONA 3QHYA 5B0ZD 3VP0A 3WRZA 1OMEA 4Z9QA 1MXOA 3D4FA 1MWUA 1PWCA 1YU1A 2BYKA 2DCFA 4QU3A 5BOHA 5DNNB 4S2IA 1JFIB 4PM6A 4H9OB 3TU4C 2VGKA 3LJAB 2HUEB 3P98A 3WA9C 1H8YA 3B0DB 1GA0A 5J8XA 5CGXA 5AVBB 2DNSA 2XF3A 2ZM8A 1YLYA 2C6WB 1ERMA 4WMCA 1DY6A 5FI6A 3AZEB 1ZLAD 3BRMA 5B2ID 1NJ4A 4KHAB 1KGFA 3W97D 2CWEA 4JF4A 1YLWA 2J8PA 4XUJA 5B0YA 1K4FA 3BFGA 4J8XD 2Y2KA 1K55A 5DF8A 1BTLA 3WKJD 1BFMA 1FCMA 2EFUA 5AQ9A 3LZ1B 4LD9A 4ZBJC 2NZDB 4X23C 3RELA 4C6YA 3C7VA 4DKIA 2ZM5A 4IJEA 3B3XA 1MWTA 4JJNB 1B67A 5B1LB 4RX3A 4OP5A 5B32A 1S32D 4OLDA 3W96A 1ID3C 5CXWA 4X23A 1YLTA 1K54C 2WUQA 3AZNB 3X1TD 2PYOD 3WTPD 4WU8C 1R4VA 3W99D 1P3KC 1KE0A 1P3AB 3X1SA 5E5AB 1LHYA 4ZUXA 1XGIA 2BG1A 5FAOA 4J8WA 1EQZA 1W8QA 1N9BA 2RVQD 2EX8A 3ZG8B 4DRTA 4KUDB 1L0FA 4GN2A 1WWIA 1K25A 3IF5A 1P3IA 1M1AA 3AGFA 5E2GA 2P9VA 3W4PA 3REJB 1I2SA 1XP4A 1YU4A 5E2HA 4GZBA 1P3PC 3RJUA 3UTBD 3AZHC 2BYMB 4E3NA 3VOYA 4J8VC 3AV1A 2DF4C 1SDNA 4UPKA 5CPIC 1M18D 5BO0A 3AGDA 1ES2A 2Y2NA 2ZQ8A 5FASA 5FQIA 4HBUA 3KUYC 3TG9A 4WM9A 5FI2A 1P3GA 3NI9A 5AV6B 4YS3A 3AZHA 3X1VD 4OH0A 4J8VA 4LV1A 5CPIA 4R8PA 5BS7C 3A6NC 1HQ3A 3NQJB 1BULA 5A93A 3VSLA 3RXWA 4S2KA 2Y59A 3WS5A 1SHVA 3LZ0D 5AV8B 1ZLAB 3OCNA 5F82A 1GHMA 2CC1A 2DRWA 5AV5B 5M19A 3HSHA 4KZ8A 3WKJB 4ZTKA 3KXBA 4WEJA 4XZQD 5E43A 4Z2MG 1GCEA 2ZQ7A 3M2JA 1KGEA 2RL3A 3UTAC 3R45B 5HARA 3VP4A 3WS4A 3C1CB 5G49B 1EWZA 1KVMA 1L0DA 3AYWC 2AROB 5GSUA 3AZGD 3UTAA 1P3LC 3B6FB 4OQHA 3UE3A 3GQZA 1DJAA 4GHAA 3AZMC 2QMIA 5B2JD 1VM1A 4G92B 3X1TB 3WTPB 4IBJA 2YFVA 3UT9C 3G34A 4KZ3A 5JA4B 3HONA 2HDQA 2HIOD 4D2OA 5JRGC 2ZC7A 4LCLA 4E6XA 5AV9A 5DF7A 3N8RA 1M6KA 3O88A 1YMXA 4K0WA 4RVAA 4DE0A 4B88A 4WU9B 2A49A 5BNXB 4JF5A 4P0MA 4OOYA 1KDWA 1FCNA 5CPKC 5B1MB 1KX4C 3EQVA 4R4SA 5AVBA 4E3JA 5GT0C 3MGPD 3AZFD 1PIOA 4X68A 2WGVA 3GTCA 2YFWA 4JPMA 4IBCA 4CJNA 1KX5B 2F8ND 4PM8A 2CV5C 2PBYA 3REKD 1KX4A 3X1UD 5B31D 3ZG7B 2NQBA 1M18B 3C5AA 5E2EA 2HDSA 1F66B 5GXQC 1RCJA 1TZYB 3MGQC 4NETA 1E3UD 3S22A 1P3FC 3X1VB 2CV5A 5B24A 3UPPA 1ULYA 5CGSA 3AZJC 4KGCB 3W98A 3B0CT 5FSRA 5B1LA 3TOIA 3AFAC 3MGQA 3B6GC 3G2YA 1XPBA 3ZVWA 2ZQAA 4KZ5A 4R1GA 5CHMA 1TDLA 4J8UD 3AZJA 4YM6B 5DNMC 3BFEA 4XXRA 2ZLYA 3WWXA 4EBLA 3GRJA 3SOIA 2WKHA 3MZEA 3REIC 3I7JA 3HLBA 3P09A 5B40C 3AN2C 2WGWB 5KMWA 5GT3D 3DWKA 4BENA 5C3IB 1H5XA 3KFUG 3TU4B 3C7UA 1C3BA 4BQMA 1NYYA 5F99D 4KUDA 3UPOA 2FJ7D 3VH6W 3WA9B 4RA7A 3AZLD 1PZPA 2P74A 3HUOA 2X71A 3MXSA 3WAAB 5EE8A 4WYYA 3ITAA 3C1BD 3KWQD 1VQQA 5EOEA 3LELD 5FAPA 2J9PA 2BYMA 3G31A 4S2LA 2I72A 4GB7A 5B0ZA 4IBXA 4HBTA 1TAFA 5EPHA 3BLSA 2HIOB 5FQMA 4E3OA 4OP8A 4PM9A 3ZGAB 2ZQCA 4NZ5A 5B33C 5EVID 3MXRA 5DNND 1XX2A 3N7WA 1TDGA 3LJAD 4BL2A 5GHZA 5JYOA 3PAGA 1BH9A 1XXMA 3ZG0A 1O07A 1ID3B 1IKIA 3MGRC 5KSCA 4KQOA 2PU2A 3DTMA 1ZLAA 1TVFA 5B2IA 2F8NB 3MVDD 3W97A 3AZED 1IYPA 4EV4A 3GSGA 3VP1A 4IBDA 5B31B 3SH9A 4J8XA 1WWSA 5CHLB 3WKJA 3V3SA 2IO5B 1K6RA 3A1IA 4R3BA 4QD4A 3MNND 1S32C 4QHCA 3LZ1D 4OQGA 2ZD8A 4NZ3A 5DVAA 2NZDD 2DQNC 4OJ6A 1NZOA 3R45A 4QY6A 4EO5C 1AOIC 5GHXA 2PYOC 5CP6C 5CPJD 4JJND 3W99C 5AVCB 1S32A 4K91A 1P3PB 1LLBA 3O62D 3IWOA 4J8UB 5A90A 1MKIA 1JWZA 1P34C 2Y2PA 1IYQA 3X1TA 2PYOA 1DJBA 3WTPA 3HLWA 4E45A 3KUYB 3W99A 3AZND 1PW8A 3N8LA 5GT3B 3HUNA 3PTEA 1P3AD 4S2OA 5E5AD 3NY4A 4ZJ3A 4JXWA 1KX3C 3M6BA 4DDYA 4S2JA 4DXCA 3AZLB 5CEBA 2ZM2A 4C3QA 4BJPA 2X01A 4MBHA 2HP6A 5AY8D 3OPRA 5FQQA 1ZG6A 1YU3A 3P5JB 3REJD 4QLCB 1BSGA 2JBFA 3UTBA 2F8NK 3Q82A 4S2PA 3GVBA 2HDUA 1M18A 4CSRA 3AZID 4S2NC 4Z5TD 2WGIA 4G91C 1T3UA 4Z2MH 2EFXA 1U35B 3X1VA 5AV6D 1YLJA 3ZDJA 4CAYA 4H9PB 1YMSA 1KDSA 3NBLA 3WX7A 3CG5A 5EVIB 2H5SA 3LZ0C 2JE5A 3IXBA 3FZCA 4S2NA 4A5RA 3A3DA 5KZHA 1TEMA 2H10A 1CI9A 2Y2QA 1RP5A 3KSYA 4XUJC 4NYYA 5B0YC 4QJGA 3WS1A 1Q2PA 3IWQA 3LZ0A 3L28A 5FUGA 3BYDA 3Q7ZA 1K55C 3PBRA 1P3MD 4YM6A 3N3FA 3AZMB 4OOMA 5EECA 2ZM0A 5AV8D 2JCHA 3MVDB 4LD9C 5FQKA 1S6RA 4Y0OA 1PI5A 5AV5D 4IBGA 3BM6A 3RELC 4DRAA 4H9NA 5JRGB 2XFTA 4UA6A 2Z2LB 2WYXA 5CEDA 4QY5A 4XZQA 3OCLA 4H9QA 3IXGA 3BFFA 2ZY2A 3MNNB 3AZGC 5B32C 4HESA 3NQUB 4PM5A 1NZUA 1P3BD 1YU0A 4OPQA 3W96C 4E3LA 3AV2D 5CPKB 3H0LC 3REHD 2Y2OA 5B32G 5GT0B 3C1CD 4UUZB 4MNRA 5CPJB 3F6TA 4NY2A 1N4OA 4X69A 2FFYA 3AZGA 3SH8A 1H3OB 2AROD 3MGSD 4OPZA 2GDNA 3LY3A 3O62B 3X1SC 3HLEA 4KZ9A 4WJ3C 3B6FD 1JWPA 5AQ7A 4ZUXC 5B2JA 4Z66B 4J8WC 1EQZC 5GXQB 2LY8A 3AZKB 1MWRA 4KQQA 3UN7A 2HIOA 3UPNA 3ZG9B 1P3FB 1P3IC 1M1AC 3AZFC 1BLHA 3VH5W 1MPLA 2ZQ9A 2VGJA 3CZDA 3EPKA 1SDEA 3IH9A 1FQGA 1QMFA 4LG2A 4WU9D 3AFAB 3X1UC 3BLMA 3A3EA 1IEMA 1H8ZA 5AY8B 5B1MD 4IBFA 3MGPA 3AZFA 3AV1C 3L27A 1HZOA 3V9RB 4X6TA 5DNMB 1P3GC 4UA9A 1E25A 2F8NA 3LY4A 3OPLA 4YS3C 1KX5D 3REKA 3X1UA 5B31A 1P3OB 1YLPA 3V3RA 4YINA 1B6WA 1SCWA 3AZIB 4R8PC 2R9XA 3ZNYA 4Z5TB 1F66D 2ZJ9A 1K4EA 1HQ3C 4WZ5A 5KDMA 1E3UA 4NFTA 1Y54A 1TZYD 1Q9CA 4P6BA 3SS4A 2ZQDA 1ONGA 4E6WA 3CMZA 4HGAB 2QPNA 4KGCD 1GHIA 1WE4A 2E8IA 5F1GA 4J8UA 1P3MB 4B4ZA 1ALQA 3KXBC 4YM6D 4LENA 3UNWA 3UDXA 5GT3A 1MBLA 5G18A 2Y2IA 1M19B 4WEKA 1BH8B 5FI7A 5GSUC 5F99A 3TU4D 2WAEA 3SS5A 1P3BB 2FJ7A 2Y2MA 1GHPA 3LELC 3AZLA 3MZFA 5M1AA 3AV2B 3WA9D 3REHB 4XUZA 2WZZA 4H9SA 2ZC3B 3IQAA 3WAAD 4RYEA 1E4DA 3MGSB 3C1BA 3KWQA 2J8YA 3LELA 3UDIA 3MBZA 4KG6A 1K57A 3IF6B 5AV9C 1SKFA 3G4PA 4EBNA 3LJAC 1IYSA 3DWZA 4H9PA 4OKPA 5EVIA 5AVBC 3W4OA 5DNNA 1JFIA 4H9OA 5AQBA 4EO5B 3LJAA 3AZEC 5CP6B 1LL9A 4Y7PA 1XA7A 5FQ9A 3Q7VB 2W8SA 4P85A 2NQBC 4IBRA 1ID3D 4WNNB 1LL5A 2V2FF 1PI4A 1P34B 4IBBA 5FA7A 1WYBA 3MVDA 4DQYB 3AZEA 4JBFA 4OPYA 4KHAA 4GOGA 5GLBA 5B24C 1W79A 4IEDA 4WU8D 1P3KD 2XEPA 3W98C 4O7DA 5B1LC 3MNNA 3LZ1A 1RGZA 4B4XA 1YLZA 4ZDXA 1JTGA 2NZDA 1K38A 3GV9A 5GL9A 2ZY5A 4ZJ2A 2HP9A 1S0WA 4GNUA 3VH6A 4JKTA 4UUZA 4JXGA 5CPJA 4JJNA 3GR2A 4XUXA 4IBEA 3H0MC 1K56A 1MY8A 3EQUA 4ZJ1A 4WZ4A 5AVCD 3O62A 3KS8A 5E5AC 1P3PD 4JXSA 2BYKB 4E3IA 2IWBA 2BLSA 3AZNA 1ES5A 4KUDC 3KUYD 5F83A 4M3KA 4WZSB 1P3AA 4G91B 4U3TA 5E5AA 5CHJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q9N A;  1JWV A;  3B3X A;  2Y2P A;  1IYQ A;  1MWT A;  2XDM A;  2UWX A;  2Y2L A;  1DJB A;  4RX3 A;  5IHV A;  3HLW A;  1FR6 A;  4GKU A;  4KZ4 A;  4OP5 A;  4ZBE A;  1PW8 A;  3C4O A;  3WRT A;  4MBK A;  2EX2 A;  3N8L A;  4OOL A;  3FKV A;  3HUN A;  3PTE A;  3BFC A;  4OLD A;  4S2O A;  3WS0 A;  5EVI C;  5CXW A;  3NDG A;  4F94 A;  1YLT A;  3NY4 A;  4N9L A;  4ZJ3 A;  4JXW A;  4U0T A;  1K54 C;  4QB8 A;  3HLG A;  3M6B A;  4KZA A;  3MKF A;  4N1X A;  2WUQ A;  4DDY A;  4S2J A;  4Q8I A;  2B5R A;  1BLP A;  4DXC A;  2G2W A;  2WZX A;  3O87 A;  1KE0 A;  4NK3 A;  4BL3 A;  5A91 A;  2RCX A;  2ZM2 A;  3RXX A;  5CEB A;  4C3Q A;  4BJP A;  5GLA A;  2X01 A;  1LHY A;  4MBH A;  2HP6 A;  2Y55 A;  4N1H A;  5TGF A;  1XGI A;  2BG1 A;  3OPR A;  5FAO A;  5HAI A;  1FR1 A;  5FQQ A;  4EBP A;  2HPB A;  1ZG6 A;  2EXB A;  3G35 A;  2EX9 A;  3OPH A;  5HX9 A;  1BSG A;  1W8Q A;  1N9B A;  2JBF A;  4R3J A;  3V39 A;  1FSW A;  2EX8 A;  3ZG8 B;  4DRT A;  2Y2G A;  2ZMA A;  1L0F A;  4GN2 A;  3Q82 A;  1K25 A;  4S2P A;  1FOF A;  3GVB A;  3IF5 A;  2HDU A;  1Z6F A;  3AGF A;  1IEL A;  3HLC A;  5E2G A;  1ZC2 A;  2P9V A;  2Y4A A;  4S2N C;  3W4P A;  1I2S A;  1XP4 A;  3DW0 A;  1NY0 A;  5A92 A;  5CHU A;  1WYC A;  2WGI A;  1PZO A;  3ITB A;  1L0G A;  3HLD A;  4GDB A;  4PPR A;  5E2H A;  1BT5 A;  4GZB A;  3V5M A;  2EFX A;  1XGJ A;  3RJU A;  1YLJ A;  3ZDJ A;  4JXV A;  4MEZ A;  1I2W A;  5CER A;  4DE2 A;  5HW3 A;  2IWD A;  1YMS A;  1KDS A;  3NBL A;  4E3N A;  3MZD A;  3VOY A;  3CG5 A;  3NCK A;  5EVI B;  2H5S A;  2XLN A;  5KSH A;  2JE5 A;  1SDN A;  3IXB A;  1W7F A;  3FZC A;  4S2N A;  4A5R A;  3A3D A;  4DDS A;  5KZH A;  1TEM A;  1ES2 A;  2H10 A;  2X02 A;  3AGD A;  4LV2 A;  2Y2N A;  2ZQ8 A;  5FAS A;  4RX2 A;  5FQI A;  4HBU A;  3TG9 A;  4WM9 A;  5CEC A;  5FI2 A;  4X53 A;  5M18 A;  4P87 A;  1CI9 A;  3NI9 A;  4OQI A;  2Y2Q A;  1RP5 A;  3CJM A;  5EOO A;  3FV7 A;  4BLM A;  4QJG A;  3WS1 A;  1BLC A;  1Q2P A;  4OH0 A;  5DTS A;  4E3K A;  4LV1 A;  3IWQ A;  2WAD A;  3BYD A;  3Q7Z A;  1J9M A;  1K55 C;  3PBR A;  3GMW A;  2P9V B;  4OOM A;  5EEC A;  4R23 A;  2ZM0 A;  4R0Q A;  1BUL A;  5A93 A;  2JCH A;  5TR7 A;  5FQK A;  3RXW A;  3VSL A;  3MFD A;  4S2K A;  5HL1 A;  4IVI A;  1S6R A;  4Y0O A;  1PI5 A;  2Y59 A;  5EVL A;  3WS5 A;  3BM6 A;  4KEN B;  5EUA A;  2XFT A;  4JLF A;  4R4R A;  1AXB A;  3LEZ A;  2JC7 A;  4U0X A;  1SHV A;  4UA6 A;  4GDN A;  2Z2L B;  3S4X A;  3HUM A;  2WYX A;  5CED A;  3BEC A;  4QY5 A;  2Y2J A;  3OCL A;  3IXG A;  3ZHH A;  3A3I A;  3PAE A;  3BFF A;  3UO9 A;  3IH8 A;  2WAF A;  1K56 D;  3N4I A;  3OCN A;  1KVL A;  4HES A;  5D3O A;  5F82 A;  4PM5 A;  1NZU A;  3VFH A;  1GHM A;  2ZC6 B;  2CC1 A;  2DRW A;  3IXD A;  4OPQ A;  4UHU A;  5M19 A;  3ZNT A;  1LI0 A;  4E3L A;  3PBT A;  4KZ8 A;  3IF6 A;  2Y2O A;  3W8K A;  2OLU A;  4ZTK A;  2OV5 A;  1ERO A;  4MBF A;  2J9O A;  4C75 A;  1PYY A;  4WEJ A;  4KZB A;  4FCF A;  4MNR A;  4DE1 A;  4EQI A;  1BZA A;  3C4P A;  4L0L A;  3PBQ A;  5FDH A;  5E43 A;  1N4O A;  3PBO A;  2ZQ7 A;  1GCE A;  2FFY A;  4X69 A;  3SH8 A;  4JF6 A;  4FD8 A;  3JYI A;  3QNC A;  5F1F A;  3M2J A;  1KGE A;  4OPZ A;  3OPP A;  2GDN A;  3AGE A;  2RL3 A;  3FWL A;  3LY3 A;  2V1Z A;  3HLE A;  4KZ9 A;  5GLC A;  1JWP A;  5AQ7 A;  4H8R A;  5HAR A;  3VP4 A;  4ID4 A;  3WS4 A;  2XFS A;  3HBR A;  5U47 A;  1ZG4 A;  1EWZ A;  4GD8 A;  1KVM A;  1L0D A;  1MWR A;  4MLL A;  4KQQ A;  5TFQ A;  3UN7 A;  1ES4 A;  3S1Y A;  4K0X A;  3UPN A;  2R9W A;  3ZG9 B;  4OQH A;  3UE3 A;  3GQZ A;  3UY6 A;  5CRF A;  1DJA A;  3IHA A;  1BLH A;  1XA1 A;  1MPL A;  2Z2M B;  3IXH A;  2QMI A;  1KE3 A;  1VM1 A;  2ZQ9 A;  4OVD A;  2VGJ A;  1HTZ A;  5DF9 A;  3CZD A;  1FSY A;  1SDE A;  5L2F A;  2WK0 A;  3IH9 A;  1FQG A;  1QMF A;  4LV3 A;  3G34 A;  4KZ3 A;  1NYM A;  2EX6 A;  2HDQ A;  2Y91 A;  4ZAM A;  3ZVT A;  4DXB A;  1I5Q A;  4X56 A;  3BLM A;  4D2O A;  3A3E A;  1IEM A;  3VP3 A;  1H8Z A;  2ZC7 A;  4BD1 A;  1W8Y A;  4LCL A;  4OLG A;  1ZKJ A;  3NC8 A;  4E6X A;  3A3J A;  3N8R A;  5DF7 A;  5JYP A;  1HZO A;  3O3V A;  1M6K A;  3V50 A;  3O88 A;  1YMX A;  4K0W A;  4RVA A;  4X6T A;  4DE0 A;  3M6H A;  4N92 A;  4UA9 A;  1E25 A;  4B88 A;  2H0Y A;  2A49 A;  4P0M A;  4JF5 A;  5HFO A;  4OOY A;  1KDW A;  3LY4 A;  3OPL A;  3UE0 A;  1FCN A;  1XKZ A;  3NIA A;  3G32 A;  1YLP A;  2ZC4 B;  4YIN A;  1SCW A;  3E2K A;  3V3R A;  1G6A A;  3EQV A;  4R4S A;  4E3J A;  2R9X A;  1PIO A;  3ZNY A;  2XQZ A;  3O86 A;  2ZJ9 A;  4X68 A;  1K4E A;  2WGV A;  4BD0 A;  4WZ5 A;  1E3U A;  3GTC A;  1Y54 A;  4JPM A;  4CJN A;  4GD6 A;  1BUE A;  4P6B A;  4PM8 A;  3SS4 A;  2A3U A;  3MKE A;  1BLS A;  2WKI A;  2PBY A;  2IWC A;  3E2L A;  3ZG7 B;  1G68 A;  1L2S A;  3ISG A;  3LO7 A;  3C5A A;  3N8S A;  1ERQ A;  1IKG A;  1ONG A;  2ZQD A;  4E6W A;  3CMZ A;  5E2E A;  2HDS A;  2QPN A;  5DTT A;  1GHI A;  1RCJ A;  2EXA A;  2OLV A;  4KG5 A;  3WS2 A;  1WE4 A;  2XK1 A;  4NET A;  2G2U A;  1E3U D;  3S22 A;  2E8I A;  3N6I A;  2WGW A;  3OC2 A;  5GHY A;  4KQR A;  1K6S A;  5F1G A;  3IF6 C;  3HL9 A;  1YT4 A;  2V20 A;  5DTK A;  4B4Z A;  1ALQ A;  3UPP A;  5CGS A;  1W5D A;  5FSR A;  4LEN A;  3UNW A;  4DF6 A;  3TOI A;  4X55 A;  1CI8 A;  1ES3 A;  1YQS A;  4WBG A;  3G2Y A;  2WKE A;  1XPB A;  5AQA A;  2ZQA A;  1MBL A;  1FCO A;  3UDX A;  5G18 A;  3VMA A;  3ZVW A;  1PWD A;  2Y2I A;  3G30 A;  3G2Z A;  1U60 A;  4KZ5 A;  4R1G A;  4WEK A;  5CHM A;  1TDL A;  4FH4 A;  4EWF A;  4HEF A;  1YM1 A;  3NDE A;  5FI7 A;  4UA7 A;  3BFE A;  4XXR A;  2ZLY A;  4KZ7 A;  4UAA A;  5FAQ A;  3Q07 A;  3WWX A;  4EBL A;  4WEL A;  3GRJ A;  5GLD A;  2WAE A;  3SH7 A;  3SS5 A;  4S2M A;  3SOI A;  2WKH A;  2Y2M A;  3MZE A;  1GHP A;  1QME A;  3I7J A;  3HLB A;  3P09 A;  3Q1F A;  3MZF A;  2WGW B;  5M1A A;  5KMW A;  5FAT A;  4XUZ A;  2WZZ A;  1ESI A;  4IVK A;  3BEB A;  1LI9 A;  3DWK A;  2ZC3 B;  4BEN A;  4EUZ A;  3IQA A;  2Q9M A;  1H5X A;  1HVB A;  4RYE A;  3C7U A;  1C3B A;  1E4D A;  4BQM A;  1NYY A;  2XH9 A;  2J8Y A;  3SS3 A;  3UPO A;  3UDI A;  4RA7 A;  3Q7V A;  1CEF A;  3MBZ A;  1PZP A;  4KG6 A;  1K57 A;  2P74 A;  3IF6 B;  3HUO A;  3ZCZ A;  3ZG5 A;  1SKF A;  4FH2 A;  2X71 A;  1CEG A;  3MXS A;  3G4P A;  2FFF B;  2HP5 A;  5EE8 A;  4Y0U A;  2XD5 A;  4WYY A;  4EBN A;  3ITA A;  3HVF A;  1IYS A;  3IWI A;  3BFD A;  3OZH A;  4E3M A;  1VQQ A;  3W4Q A;  3HLF A;  2HDR A;  1GA9 A;  3DWZ A;  5EOE A;  2J9P A;  5FAP A;  2QZ6 A;  3VOZ A;  3G31 A;  4OKP A;  5EVI A;  1CK3 A;  3PBS A;  4S2L A;  3W4O A;  2I72 A;  4GB7 A;  4OPR A;  5AQB A;  3A3F A;  1K54 A;  1MWS A;  3LCE A;  4WZ5 C;  3IHB A;  1DJC A;  4IBX A;  1M40 A;  4HBT A;  5I94 A;  3VP2 A;  5EPH A;  1LL9 A;  3FKW A;  1NRF A;  3BLS A;  1XA7 A;  4Y7P A;  5FQ9 A;  5FQM A;  3QNB A;  3VSK A;  3M2K A;  4E3O A;  3ZFZ A;  4OP8 A;  4CPK A;  3Q7V B;  4PM9 A;  2ZQC A;  4P85 A;  3ZGA B;  4Y0T A;  5CTM A;  3HRE A;  4IBR A;  5EVI D;  2XGN A;  3MXR A;  1L0E A;  1ESU A;  4FSF A;  4OON A;  1LL5 A;  2V2F F;  3QHY A;  1PI4 A;  1XX2 A;  3N7W A;  5FA7 A;  3VP0 A;  3WRZ A;  2PU4 A;  1WYB A;  1O7E A;  1TDG A;  1OME A;  4BL2 A;  4Z9Q A;  1MXO A;  5GHZ A;  3D4F A;  5JYO A;  2H0T A;  4JBF A;  4OPY A;  1MWU A;  3PAG A;  3FYZ A;  1PWC A;  4GOG A;  5HAQ A;  3Q81 A;  5GLB A;  1W79 A;  1XXM A;  4IED A;  4KG2 A;  3ZG0 A;  2DCF A;  4QU3 A;  1NXY A;  1JVJ A;  1O07 A;  4LCM A;  2XEP A;  1IKI A;  5BOH A;  5KSC A;  4KQO A;  4S2I A;  4PM6 A;  4O7D A;  2PU2 A;  3DTM A;  2VGK A;  2ZC5 B;  1TVF A;  1RGZ A;  4B4X A;  1YLZ A;  4ZDX A;  1JTG A;  3UE1 A;  1EI5 A;  3P98 A;  1IYP A;  4EV4 A;  1K38 A;  2XR0 A;  3GSG A;  3VFF A;  3SH9 A;  3VP1 A;  1H8Y A;  3GV9 A;  1GA0 A;  4PM7 A;  5J8X A;  2C5W B;  5CGX A;  5GL9 A;  4ZJ2 A;  2HP9 A;  3UDF A;  1S0W A;  2DNS A;  4GNU A;  2XF3 A;  3V3S A;  1K6R A;  1YLY A;  2ZM8 A;  2Y2H A;  4JKT A;  2C6W B;  1ERM A;  1PWG A;  3GR2 A;  4JXG A;  4PMA A;  1K56 A;  1MY8 A;  4XUX A;  4WMC A;  4R3B A;  3EQU A;  1DY6 A;  5FI6 A;  4KZ6 A;  4OQ0 A;  4QD4 A;  4QHC A;  3BRM A;  4OQG A;  4N9K A;  4WZ4 A;  4ZJ1 A;  2ZD8 A;  1JTD A;  1NJ4 A;  5DVA A;  1KGF A;  4JF4 A;  1KE4 A;  1IYO A;  1YLW A;  1NZO A;  4JXS A;  4LV0 A;  1PW1 A;  1K4F A;  1Q2Q A;  1RGY A;  3BFG A;  5E2F A;  4DE3 A;  4QY6 A;  2Y2K A;  4E3I A;  1K55 A;  5DF8 A;  1BTL A;  2J7V A;  5HAP A;  1HD8 A;  2IWB A;  3PBN A;  2XD1 A;  5GHX A;  1FCM A;  5FQJ A;  2BLS A;  2EFU A;  5AQ9 A;  1ES5 A;  3TSG A;  1ONH A;  4WMC D;  5F83 A;  4M3K A;  5CTN A;  2OSU A;  1KGG A;  4K91 A;  4U3T A;  1LLB A;  1K57 C;  3IT9 A;  3IWO A;  4C6Y A;  5A90 A;  4YFM A;  5CGW A;  3C7V A;  1MKI A;  4DKI A;  1JWZ A;  5CHJ A; 
#chains in the Genus database with same CATH topology
 2XDM A;  5IHV A;  4GKU A;  1FR6 A;  1T1C A;  3A6N D;  2PR5 A;  4ZBE A;  1DRM A;  4ZRR A;  2EX2 A;  4OOL A;  1DP6 A;  1G6O A;  3BFC A;  3WS0 A;  5AY8 A;  4XUJ B;  4F94 A;  3L25 A;  2P04 A;  4N9L A;  5B0Z C;  3REJ A;  4Q0J A;  3IP4 C;  2HGV A;  4QB8 A;  3HLG A;  4KZA A;  4MN5 A;  4N1X A;  4QLC D;  4Q8I A;  3T1S A;  2B5R A;  1BLP A;  2JKT I;  2JKT M;  2V1A A;  4NK3 A;  5A91 A;  2RCX A;  3RXX A;  2QHK A;  3REL B;  3AZI A;  2Y55 A;  4N1H A;  5TGF A;  4EBP A;  5HAI A;  2G5H C;  2HPB A;  3G35 A;  4Z5T A;  2EX9 A;  3CHW P;  5HX9 A;  4R3J A;  5FEG A;  4I3A A;  2Y2G A;  5AV6 A;  3C30 A;  4ZBJ B;  4EEU A;  4PKY G;  2RIQ A;  4GHI A;  4E44 A;  1U35 D;  3D9Y A;  4X23 B;  1IEL A;  3HLC A;  4PKY A;  5L09 A;  1DP8 A;  2IOU A;  3NQJ A;  3DW0 A;  3EPH A;  5A92 A;  4I3J A;  1WYC A;  1L0G A;  1ZLA C;  1G5U A;  1PZO A;  3ITB A;  4II7 A;  5TJJ A;  4GDB A;  4DJ2 A;  5B2I C;  4AWL C;  3W97 C;  1BT5 A;  3V5M A;  5AV5 C;  3AYW D;  1XFN A;  4JXV A;  4MEZ A;  1I2W A;  4J8X C;  2L0W A;  5DJT A;  3LR4 A;  3MZD A;  3NCK A;  1P9W A;  1P3L D;  1P3M A;  2V9A A;  3WKJ C;  4ZUX B;  1W7F A;  5L2F A;  5AV8 A;  3AZM D;  3VE3 A;  4E04 A;  4J8W B;  1EQZ B;  5CEC A;  5EM1 A;  4X53 A;  4P87 A;  4LPZ A;  5AV5 A;  4WU8 B;  3UT9 D;  3FV7 A;  5EOO A;  1P3K B;  1PDC A;  4XT2 A;  4BLM A;  3H0R C;  4H9R B;  4E3K A;  5JRG D;  2WAD A;  1P3I B;  3PYP A;  2P9V B;  4JGQ A;  3RTY A;  4R0Q A;  5TR7 A;  1P3B A;  3MFD A;  4IVI A;  3AV2 A;  5EVL A;  3REH A;  2ZY3 A;  1MZU A;  1OJ5 A;  5EUA A;  4JLF A;  5CPK D;  3LEZ A;  2JC7 A;  4GDN A;  3S4X A;  3HUM A;  3C1C A;  2V8F A;  1H8P A;  3BEC A;  3CUE A;  5G49 A;  3LYX A;  5BO0 B;  5GT0 D;  3X1T C;  3UO9 A;  3IH8 A;  3WTP C;  2ARO A;  3MGS A;  1K56 D;  3N4I A;  1KVL A;  5D3O A;  1P3G B;  3W2Z A;  2J3T C;  1K0K A;  3VFH A;  3IXD A;  4UHU A;  3B6F A;  4YS3 B;  3AZH B;  3IF6 A;  3LI9 A;  4J8V B;  4Y13 A;  2B02 A;  2OLU A;  3FC7 A;  3S7N A;  2OV5 A;  5CPI B;  4MBF A;  2RVQ C;  4C75 A;  4DE1 A;  4KZB A;  4FCF A;  4EQI A;  4Z66 D;  4GH9 A;  1BZA A;  5GXQ D;  3C4P A;  3PBQ A;  3JPU A;  3B33 A;  2VZW A;  3PBO A;  5FDH A;  3AZK D;  4JF6 A;  5JA4 A;  3QNC A;  4NE5 A;  3B0C W;  3OPP A;  3AGE A;  3FWL A;  2V1Z A;  1P3F D;  4HQA A;  2M1C A;  3WTP E;  3HBR A;  1YU2 A;  3A6N B;  4MLL A;  4WU9 A;  5BNX A;  5TFQ A;  3UTB C;  4K0X A;  1OJG A;  2R9W A;  3DBA A;  3AFA D;  3CPT B;  5B1M A;  3EG5 B;  3B6G D;  1M18 C;  5FEF A;  5IT5 A;  5BPV A;  3E4P A;  4O01 A;  5F69 A;  1XA1 A;  4DRB A;  2Z2M B;  4OVD A;  1KE3 A;  1N1J B;  1HTZ A;  1OT9 A;  1YSP A;  3KXB B;  1FSY A;  5HWW A;  5DNM D;  4LV3 A;  5KIZ A;  1KX5 A;  1NYM A;  2ZMF A;  2Y91 A;  3X1V C;  4ZAM A;  3ZVT A;  4RQ9 A;  1I5Q A;  4X56 A;  3QP1 A;  3TRC A;  3REI D;  1P3O D;  2VK3 A;  5B40 D;  3AN2 D;  3ICY A;  1F66 A;  4EW7 A;  3A3J A;  3O3V A;  3A0R A;  3M6H A;  4N92 A;  1TZY A;  3IX3 A;  2H0Y A;  5GSU B;  3UE0 A;  3NIA A;  3UTA B;  1VEU A;  2ZC4 B;  4X1M A;  4QNL A;  1HLU P;  4KGC A;  4YM6 C;  2JSS A;  3O86 A;  2P7J A;  1S1Z A;  1F1E A;  3S7O A;  3AYW B;  2YFV B;  2KDK A;  1BUE A;  3ZYT A;  2A3U A;  3MKE A;  1BLS A;  2WKI A;  1H0M A;  1P3L B;  2IWC A;  3E2L A;  4Z2K A;  1L2S A;  3ISG A;  3LO7 A;  1IKG A;  4GS9 A;  5C3I C;  5AV9 B;  4XZQ C;  2K7S A;  2ZOI A;  5IU1 A;  2EXA A;  2OLV A;  4OJ5 A;  2XK1 A;  3UT9 B;  5GHY A;  2WGW A;  3OC2 A;  4NXG A;  1K6S A;  3A0S A;  3HL9 A;  1M19 D;  1YT4 A;  3WAA C;  5B33 D;  3TU4 A;  4WF0 A;  4X55 A;  2YFW B;  4HMD A;  3VH5 A;  1ES3 A;  3WA9 A;  5AQA A;  1FCO A;  1PWD A;  3G30 A;  3O5Y A;  1KX4 B;  4ETX A;  5B2J C;  2NQB B;  3WAA A;  4ME4 A;  4HEF A;  4B9O A;  1YM1 A;  3NDE A;  2Y8H A;  4O8G A;  3MGR D;  4KZ7 A;  4UAA A;  5FAQ A;  1P97 A;  4NG2 A;  2JKF A;  4WEL A;  5GLD A;  4S2M A;  2HIO C;  2DMW A;  1QME A;  4LGW A;  5BT1 D;  2CV5 B;  1KU5 A;  5B24 B;  1LI9 A;  1D06 A;  4IVK A;  4EUZ A;  3H7W B;  3D72 A;  2Q9M A;  1N9L A;  3W98 B;  3LUQ A;  4R70 A;  3T4K A;  2XH9 A;  3MGQ B;  5HZH A;  3L2A A;  1CEF A;  4HJ3 A;  3MGP C;  3ZCZ A;  1CEG A;  4QWO A;  2FFF B;  2HP5 A;  2XD5 A;  3AZJ B;  5IS1 A;  3QP8 A;  4YNR A;  1AOI D;  3IWI A;  3BFD A;  5CP6 D;  3OZH A;  2VV8 A;  3DAV A;  5LBR A;  3REK C;  1OTA A;  5B31 C;  3B6G B;  3HLF A;  2HDR A;  2QZ6 A;  3VOZ A;  1ID3 A;  3PBS A;  4HY8 A;  3C8C A;  3LR3 A;  2F8N G;  4OPR A;  2IO5 C;  1JNU A;  1K54 A;  3LCE A;  4WZ5 C;  1A0K A;  5B31 G;  1YUE A;  1DJC A;  1M40 A;  1P34 D;  3VP2 A;  1NRF A;  3QNB A;  3REI B;  4WU8 A;  3M2K A;  1P3K A;  1OTI A;  2EWV A;  3FDD A;  5B40 B;  3AN2 B;  1MKM A;  3ZFZ A;  1TS7 A;  4FTX A;  4CPK A;  4H9R A;  5CTM A;  1S67 L;  3HRE A;  2XGN A;  1ESU A;  3LIF A;  4MN7 A;  1KX3 D;  2PU4 A;  1O7E A;  4GLQ A;  2PYR A;  5AVC C;  2H0T A;  3FYZ A;  1OTD A;  5HAQ A;  3Q81 A;  4KG2 A;  4HH3 A;  4J8U C;  1NXY A;  1JVJ A;  4LCM A;  4UQI S;  1PZR A;  4HIA A;  5B0Z B;  2W27 A;  4IUH A;  2ZC5 B;  2XRO A;  2A24 A;  5AVC A;  1TAF B;  3UE1 A;  1EI5 A;  5DJU A;  3QP5 A;  1P3P A;  5GT3 C;  2XR0 A;  3VFF A;  4PM7 A;  2C5W B;  4IBI A;  3UDF A;  2W3D A;  4PMA A;  2Y2H A;  1PWG A;  3TW8 A;  5F99 C;  3KUY A;  4OJO A;  2FJ7 C;  4KZ6 A;  4OQ0 A;  4WLA A;  2GZA A;  3AZL C;  3NUL A;  4N9K A;  1JTD A;  1KE4 A;  1IYO A;  4LV0 A;  1BH9 B;  4H9S C;  3BY8 A;  1PW1 A;  1Q2Q A;  1RGY A;  5E2F A;  5BNV B;  4DE3 A;  5HDD A;  4YWZ A;  5B33 B;  2J7V A;  3FG8 A;  5HAP A;  1HD8 A;  3PBN A;  4QLC C;  2XD1 A;  5BS7 A;  5FQJ A;  3A6N A;  1VET B;  3C1B C;  4F3L B;  3KWQ C;  3VH6 T;  3TSG A;  1ONH A;  4WMC D;  5B2I B;  4AWL B;  3W97 B;  1KGG A;  2OSU A;  5CTN A;  4IJF A;  5F5Y A;  4J8X B;  1K57 C;  3IT9 A;  4BMW A;  1F5M A;  5CGW A;  4XUJ D;  4YFM A;  5B0Y D;  5HWV A;  2E8J A;  3L26 A;  3K3C A;  3MGR B;  2Q9N A;  1N1J A;  1JWV A;  4QLC A;  2UWX A;  2Y2L A;  4IJG A;  4KZ4 A;  1BYW A;  3C4O A;  1U35 C;  3WRT A;  4MBK A;  4LD9 D;  3SW1 A;  3FKV A;  1LSW A;  5EVI C;  5G4Y A;  3IBJ A;  3NDG A;  5DNN C;  3LIE A;  1Z2C B;  3REL D;  1E6N A;  4TX8 A;  4U0T A;  3KX0 X;  3MKF A;  2HUE C;  2W3E A;  2G2W A;  1U35 A;  2WZX A;  1S32 B;  3O87 A;  3B0D C;  5B32 D;  4BL3 A;  5GLA A;  3W96 D;  4HP9 A;  4X23 D;  1FR1 A;  1J3W A;  1VB6 A;  2EXB A;  3OPH A;  1AOI B;  3V39 A;  3MVD C;  2PYO B;  1FSW A;  1W2E A;  3AYW A;  3U2A A;  3W99 B;  1A7W A;  2ZMA A;  3V67 A;  3KSF A;  1P3L A;  1YPR A;  1FOF A;  1Z6F A;  3X1S D;  4Y5F A;  3PR6 A;  1ZC2 A;  4ZUX D;  3AZM A;  2Y4A A;  3JVV A;  1NY0 A;  5CHU A;  3MNN C;  3LEQ A;  3LZ1 C;  3HLD A;  4J8W D;  4PPR A;  4M6B A;  1EQZ D;  3D3O A;  2NZD C;  3UT9 A;  1XGJ A;  5CER A;  3ULF A;  4DE2 A;  1G28 A;  5HW3 A;  2IWD A;  5JRG A;  2XLN A;  5KSH A;  3B0B A;  2WKQ A;  1P3I D;  1M1A D;  2V8C A;  4DDS A;  5CPJ C;  4JJN C;  1KX3 B;  2X02 A;  4LV2 A;  4RX2 A;  4CLC D;  1Z09 A;  1AIW A;  2VV7 A;  3NQU A;  5M18 A;  4OQI A;  2RTS A;  3CJM A;  3UTB B;  3O62 C;  3AL0 C;  3MJQ A;  4OUI A;  5CPK A;  1E15 A;  1BLC A;  4MCW A;  5DTS A;  1H3Q A;  2JN7 A;  1HTA A;  4CSR B;  1J9M A;  5GT0 A;  3T1R A;  3GMW A;  3AV1 D;  4Z66 C;  1TF1 A;  5F6A A;  3EEH A;  4R23 A;  4Y17 A;  3AZK C;  3AZN C;  2J80 A;  3L9K A;  2Z6D A;  3KS4 A;  1H3O A;  5HL1 A;  4NE6 A;  1P3A C;  1P3G D;  5J4E A;  1D1J A;  2O9A A;  4CAY B;  4YS3 D;  4KEN B;  3AZH D;  1AXB A;  2W3G A;  3F1P A;  4R4R A;  4U0X A;  4J8V D;  2PYP A;  5EM0 A;  2Y2J A;  4Z66 A;  2OOL A;  5GXQ A;  5CPI D;  3ZHH A;  3A3I A;  3PAE A;  4R8P D;  2WAF A;  3AZK A;  2QJ7 A;  4QPR A;  1HQ3 D;  1DP9 A;  2XA7 S;  3CAX A;  2ZC6 B;  1P3F A;  3KSH A;  4X1L A;  3ZNT A;  1LI0 A;  5AY8 C;  3FKE A;  3PBT A;  2W3H A;  5HPF A;  3LZ0 B;  4I39 A;  3KYZ A;  5FUG B;  2L1M A;  3W8K A;  3T4J A;  3REJ C;  4HJ6 A;  1ERO A;  3KSI A;  2J9O A;  4OJL A;  1PYY A;  4NXF A;  3WD2 A;  4L0L A;  4DN0 A;  4FD8 A;  3JYI A;  3AFA A;  3NEC A;  5F1F A;  2ZBB A;  3B6G A;  2VQR A;  1P3O C;  2HF6 A;  5GLC A;  1S1Y A;  3AZI C;  5B0Y B;  4H8R A;  4H9N B;  2NUP C;  3EPL A;  4ID4 A;  4Z5T C;  4XZQ B;  1CQA A;  3V9R A;  2XFS A;  4WV4 B;  2B18 A;  4H9Q B;  5DNM A;  1ZG4 A;  3MQO A;  3OOV A;  5U47 A;  4GD8 A;  1V9Y A;  3KXB D;  1EAK A;  5AV6 C;  1ES4 A;  3S1Y A;  4LD9 B;  5HSQ A;  3MSH A;  3REI A;  2ZL1 B;  3T4O A;  1P3O A;  5B40 A;  3AN2 A;  3UY6 A;  5CRF A;  3IHA A;  4HGA C;  1J7M A;  3IXH A;  5DF9 A;  2GX5 A;  3DTK A;  3CI6 A;  2WK0 A;  3FPW A;  2V0W A;  3AZG B;  4NZ4 A;  5B32 B;  2EX6 A;  5GSU D;  4DXB A;  3VP3 A;  3W96 B;  3UTA D;  1P3M C;  4BD1 A;  1W8Y A;  4OLG A;  2D49 A;  1ZKJ A;  3NC8 A;  5B2J B;  5JYP A;  5AV8 C;  3V50 A;  4JGP A;  1SKO B;  1ZHH B;  5HFO A;  4LRY C;  1XKZ A;  4HME A;  3G32 A;  1M19 C;  3X1S B;  3E2K A;  1G6A A;  3HJI A;  2OWJ A;  2W1R A;  1EW0 A;  3MR0 A;  1E6Z A;  5AV9 D;  2XQZ A;  3C2W A;  1X0O A;  1CK7 A;  4BD0 A;  4JGR A;  1P3B C;  4GD6 A;  3AV2 C;  3MQ0 A;  1M19 A;  3REH C;  1OGB A;  3B42 A;  1G68 A;  3GEC A;  5A8B A;  2G5I C;  5BNV A;  3MGP B;  1M1A B;  1ERQ A;  3C1C C;  3AZF B;  3N8S A;  5B33 A;  1BH8 A;  2V5O A;  3CUE C;  3MFX A;  5AVB D;  4CLC B;  5DTT A;  1VHM A;  4KG5 A;  4GHL A;  3WS2 A;  2ARO C;  3MGS C;  3FPV A;  3T1X A;  2G2U A;  2L5A A;  3KSG A;  5BT1 C;  3N6I A;  3B6F C;  4KQR A;  3REK B;  3X1U B;  5L8M A;  3EPJ A;  3IF6 C;  2ZY4 A;  2V20 A;  1KX4 D;  5DTK A;  3AV1 B;  2NQB D;  3MGR A;  2FN2 A;  1W5D A;  4G92 C;  2F8N H;  4DF6 A;  5KDM B;  1E8B A;  1XJ3 A;  1CI8 A;  4EEP A;  1YQS A;  4LFU A;  4WBG A;  2WKE A;  1ACF A;  3VMA A;  3A1K A;  4NE3 A;  3G2Z A;  1U60 A;  2CV5 D;  5B24 D;  4FH4 A;  4EWF A;  4R8P B;  4UA7 A;  4G3V A;  1HQ3 B;  3W98 D;  1UR8 A;  4WU9 C;  3IS2 A;  3Q07 A;  1GPF A;  3SH7 A;  1MC0 A;  5B1L D;  3MGQ D;  5B1M C;  3Q1F A;  4HNB A;  1Y4O A;  3VH5 T;  5TBM B;  5FAT A;  5HL6 A;  3R4K A;  1ESI A;  3BWL A;  3BEB A;  2PDR A;  5AVF A;  1AOI A;  3AZJ D;  1HVB A;  2F2A C;  3KYQ A;  5CP6 A;  4IBK A;  4G3K A;  1KX5 C;  2QKP A;  3SS3 A;  3LGO A;  3Q7V A;  4OJP A;  3R7W A;  3ZG5 A;  4WNN A;  1F66 C;  3IX8 A;  4FH2 A;  2A2L A;  2K2N A;  4Y0U A;  5HWT A;  4HOI A;  1P34 A;  4NZ1 A;  3HVF A;  1TZY C;  1XFQ A;  5F99 B;  4E3M A;  2FJ7 B;  3W4Q A;  1GA9 A;  4KUD D;  5EVE A;  1CK3 A;  4KGC C;  3A3F A;  1TS0 A;  1KX3 A;  1MWS A;  2NUT C;  3IHB A;  5I94 A;  1UWP X;  3C1B B;  3FKW A;  3L29 A;  3KWQ B;  3B47 A;  2PT7 A;  3LEL B;  3VSK A;  4I5S A;  4Y0T A;  4H6J A;  2VGL S;  1T18 A;  4HP4 A;  1L0E A;  1XJ2 A;  4FSF A;  4NYU A;  4OON A;  3QHY A;  5B0Z D;  4KUO A;  3VP0 A;  3WRZ A;  1OME A;  4Z9Q A;  1MXO A;  3D4F A;  1MWU A;  1PWC A;  1YU1 A;  2BYK A;  2DCF A;  4QU3 A;  5BOH A;  5DNN B;  1F98 A;  3F1N A;  4FOF A;  1JFI B;  4PM6 A;  4S2I A;  4H9O B;  3UMD A;  3TU4 C;  1GXD A;  2VGK A;  3LJA B;  2HUE B;  2YKH A;  3P98 A;  3WA9 C;  1PNE A;  2HJ9 C;  1H8Y A;  4P6Z S;  3B0D B;  1GA0 A;  5J8X A;  5CGX A;  3IBR A;  5AVB B;  2DNS A;  2XF3 A;  3NHQ A;  4WN5 A;  1YLY A;  2ZM8 A;  5MC7 A;  2C6W B;  1ERM A;  4WMC A;  1DY6 A;  5FI6 A;  3AZE B;  1CJF A;  1ZLA D;  4JGO A;  2PRF A;  3BRM A;  1SZV A;  5B2I D;  1NJ4 A;  4KHA B;  1KGF A;  3W97 D;  2CWE A;  4JF4 A;  1YLW A;  2J8P A;  4XUJ A;  1FIL A;  5B0Y A;  1K4F A;  3BFG A;  4J8X D;  4ESP A;  1T1A A;  2Y2K A;  1K55 A;  5DF8 A;  1BTL A;  3WKJ D;  1BFM A;  2QJ5 A;  1FCM A;  2EFU A;  5AQ9 A;  3LZ1 B;  2XSS A;  4LD9 A;  4ZBJ C;  2NZD B;  2ZL1 A;  3H9W A;  4Q0I A;  4X23 C;  3REL A;  4C6Y A;  4HH2 A;  3C7V A;  2M7U A;  4DKI A;  4I3I A;  2ZM5 A;  4IJE A;  3B3X A;  1MWT A;  4JJN B;  1B67 A;  5B1L B;  4RX3 A;  4OP5 A;  5B32 A;  1P0Z A;  1S32 D;  4NKP A;  5CX7 A;  4YOF A;  3F1O B;  4OLD A;  3W96 A;  1ID3 C;  5CXW A;  4X23 A;  1YLT A;  4MB3 A;  3CWF A;  1K54 C;  2W1T B;  2WUQ A;  2PAV P;  3AZN B;  2WKR A;  3X1T D;  2PYO D;  2VLG A;  3WTP D;  4WU8 C;  1R4V A;  3W99 D;  1P3K C;  1KE0 A;  1P3A B;  2J3T D;  3X1S A;  5E5A B;  1LHY A;  3DTE A;  4ZUX A;  3BJN A;  1XGI A;  2BG1 A;  5FAO A;  4J8W A;  1EQZ A;  1W8Q A;  1N9B A;  2RVQ D;  2EX8 A;  3ZG8 B;  2YKF A;  4DRT A;  1GSV A;  4KUD B;  1L0F A;  4GN2 A;  1WWI A;  1K25 A;  3IF5 A;  2L4R A;  1P3I A;  1M1A A;  3AGF A;  5E2G A;  2P9V A;  3MF0 A;  2V1B A;  3W4P A;  4CLC A;  3REJ B;  1I2S A;  1XP4 A;  1YU4 A;  1GSW A;  5E2H A;  4GZB A;  5HDC A;  1P3P C;  2M7V A;  3RJU A;  3UTB D;  3AZH C;  2BYM B;  4E3N A;  2ACG A;  3VOY A;  1F9I A;  4J8V C;  3AV1 A;  2DF4 C;  1SDN A;  5DFY A;  4UPK A;  5CPI C;  1M18 D;  5BO0 A;  3AGD A;  1ES2 A;  2Y2N A;  2ZQ8 A;  3BW6 A;  5FQI A;  5FAS A;  4HBU A;  3KUY C;  3TG9 A;  4WM9 A;  5FI2 A;  1P3G A;  3NI9 A;  3T4T A;  5AV6 B;  5K5B A;  4YS3 A;  3PHY A;  4GHI B;  3AZH A;  3X1V D;  4OH0 A;  3UE6 A;  4J8V A;  4LV1 A;  1V9Z A;  1YKD A;  3NOU C;  5CPI A;  4R8P A;  3TE8 A;  5J7E A;  5BS7 C;  1IOU A;  3A6N C;  2PBD P;  1HQ3 A;  3NQJ B;  1BUL A;  2FH5 A;  2XRN A;  4ARZ B;  5A93 A;  3G6O A;  3VSL A;  3RXW A;  4S2K A;  4Z2H A;  3QP4 A;  2Y59 A;  3WS5 A;  3SZT A;  1SHV A;  4NXB A;  3LZ0 D;  5AV8 B;  3NOT C;  1ZLA B;  1PRQ A;  3OCN A;  1ODV A;  2HZ5 A;  5F82 A;  4GJ4 A;  1GHM A;  3CPT A;  2CC1 A;  2DRW A;  5AV5 B;  2OAP 1;  5M19 A;  3HSH A;  4XT2 B;  4KZ8 A;  3WKJ B;  4ZTK A;  1GSX A;  3KXB A;  4WEJ A;  4XZQ D;  1LSV A;  5E43 A;  4Z2M G;  1GCE A;  2ZQ7 A;  3M2J A;  1KGE A;  2RL3 A;  3UTA C;  4NXE A;  1YSQ A;  4Z2J A;  4PAU A;  3R45 B;  5HAR A;  3VP4 A;  3NOP C;  1Y28 A;  3WS4 A;  3C1C B;  4BBU A;  5HD5 A;  5G49 B;  4ETZ A;  5L07 A;  1EWZ A;  2IA2 A;  1KVM A;  1L0D A;  4B93 A;  3AYW C;  2ARO B;  5GSU A;  3DTI A;  3T4L A;  3AZG D;  3MMH A;  3UTA A;  1P3L C;  3B6F B;  4OQH A;  2Y79 A;  3UE3 A;  3GQZ A;  1DJA A;  4PHT A;  4GHA A;  3AZM C;  3BY9 A;  2QMI A;  5B2J D;  1VM1 A;  4O0P A;  4Z1W A;  4LRX C;  4G92 B;  3X1T B;  3WTP B;  4IBJ A;  2YFV A;  3UT9 C;  3G34 A;  4KZ3 A;  5JA4 B;  3HON A;  2HDQ A;  4Y3I A;  1CXW A;  2HIO D;  4D2O A;  5JRG C;  2ZC7 A;  2INW A;  2PHY A;  4LCL A;  4E6X A;  5AV9 A;  5DF7 A;  3N8R A;  4MN6 A;  5DKK A;  1M6K A;  3O88 A;  3A0V A;  1YMX A;  4K0W A;  3H82 B;  4RVA A;  5C5K A;  4DE0 A;  1H0G A;  4B88 A;  4WU9 B;  3OLO A;  2A49 A;  5BNX B;  1TS6 A;  4JF5 A;  4P0M A;  3IX4 A;  1KDW A;  4OOY A;  1FCN A;  3M7P A;  5CPK C;  5B1M B;  1KX4 C;  3EQV A;  4R4S A;  1TD5 A;  3EEA A;  5AVB A;  4E3J A;  5GT0 C;  3MGP D;  3AZF D;  1PIO A;  2KOI A;  4X68 A;  2WGV A;  4MB4 A;  3GTC A;  2YFW A;  4JPM A;  4IBC A;  1UR9 A;  1KX5 B;  2HJE A;  4CJN A;  3E4Q A;  2F8N D;  4PM8 A;  2CV5 C;  2PBY A;  4CQH A;  3REK D;  1KX4 A;  3X1U D;  5B31 D;  3ZG7 B;  2NQB A;  1M18 B;  3C5A A;  2CMN A;  2PR6 A;  5E2E A;  2HDS A;  1F66 B;  5GXQ C;  1CF0 A;  3K2N A;  1RCJ A;  1D7E A;  4BBV A;  1TZY B;  3MGQ C;  4NET A;  1E3U D;  3S22 A;  1P3F C;  3T12 B;  4EER A;  3X1V B;  2CV5 A;  5B24 A;  1VEU B;  3H7W A;  3GDI A;  4HI4 A;  3UPP A;  1ULY A;  5CGS A;  3AZJ C;  4KGC B;  3W98 A;  1XJ6 A;  1LT0 A;  3B0C T;  5FSR A;  5B1L A;  1H8M A;  3TOI A;  3AFA C;  3MGQ A;  3B6G C;  3G2Y A;  2LB9 A;  1XPB A;  3ZVW A;  2ZQA A;  4KZ5 A;  5FL3 A;  4R1G A;  5CHM A;  1TDL A;  1L6J A;  4J8U D;  1STZ A;  3AZJ A;  1OPX A;  4DJ3 A;  4YM6 B;  5DNM C;  3BFE A;  4XXR A;  2ZLY A;  3CLO A;  1OT6 A;  3WWX A;  4EBL A;  3GRJ A;  3SOI A;  2WKH A;  3MZE A;  3REI C;  3I7J A;  1GOI A;  3HLB A;  3P09 A;  5B40 C;  3AN2 C;  2WGW B;  3UB9 A;  5KMW A;  5GT3 D;  3DWK A;  4BEN A;  5C3I B;  1H5X A;  3EGX C;  2JKR M;  3KFU G;  3TU4 B;  3C7U A;  1C3B A;  3T4Q A;  4BQM A;  3C38 A;  1NYY A;  2V0U A;  5F99 D;  4KUD A;  3T50 A;  3UPO A;  2FJ7 D;  3VH6 W;  3WA9 B;  4RA7 A;  3S7Q A;  3AZL D;  1PZP A;  2P74 A;  3HUO A;  2VJW A;  3E4O A;  3QP2 A;  1OTB A;  4R38 A;  2X71 A;  3MXS A;  3WAA B;  5EE8 A;  4WYY A;  3ITA A;  4Z2L A;  3C1B D;  3KWQ D;  1VQQ A;  5EOE A;  3LEL D;  5FAP A;  2J9P A;  4Z2G A;  2BYM A;  3LR0 A;  3G31 A;  1FIK A;  4S2L A;  2I72 A;  2P08 A;  4GB7 A;  4Z2I A;  1H0I A;  5B0Z A;  2QWS A;  4IBX A;  4HBT A;  2PD7 A;  1TAF A;  5EPH A;  3BLS A;  2HIO B;  5FQM A;  4HMC A;  4E3O A;  4OP8 A;  4PM9 A;  3ZGA B;  2ZQC A;  4NZ5 A;  3VOL A;  2KX6 A;  5B33 C;  5EVI D;  2GJ3 A;  1S4R A;  3MXR A;  5DNN D;  1XX2 A;  3N7W A;  4ARZ A;  4LRZ E;  1TDG A;  3WD0 A;  5HD3 A;  3LJA D;  4BL2 A;  5GHZ A;  4GW9 A;  4BWI A;  4EUV A;  5JYO A;  3PAG A;  1BH9 A;  1XXM A;  1L3L A;  3ZG0 A;  1O07 A;  1ID3 B;  4UQI M;  2KLI A;  1IKI A;  3MGR C;  4L9E A;  4KQO A;  5KSC A;  1P9R A;  2PU2 A;  3DTM A;  3LFV A;  1VET A;  2K31 A;  4F3L A;  1ZLA A;  1TVF A;  5B2I A;  2F8N B;  3MVD D;  3W97 A;  3AZE D;  1IYP A;  4EV4 A;  1UGU A;  3GSG A;  3VP1 A;  4IBD A;  5B31 B;  3SH9 A;  4J8X A;  1WWS A;  1W63 M;  3JVU A;  2VX8 A;  4HJ4 A;  2OAQ 1;  5CHL B;  3WKJ A;  3V3S A;  2IO5 B;  1E88 A;  1NLZ A;  1K6R A;  3A1I A;  4R3B A;  1E6R A;  3MNN D;  4QD4 A;  1S32 C;  4QHC A;  3LZ1 D;  4OQG A;  2ZD8 A;  4NZ3 A;  5DVA A;  4OJ6 A;  2NZD D;  2DQN C;  4MB5 A;  3PXP A;  3T4S A;  1NZO A;  3R45 A;  3MQL A;  4QY6 A;  1XJ4 A;  4EO5 C;  1AOI C;  5GHX A;  2PYO C;  5CP6 C;  5CPJ D;  4JJN D;  3W99 C;  2A24 B;  5AVC B;  1S32 A;  4K91 A;  1P3P B;  1LLB A;  3O62 D;  2HV1 A;  3IWO A;  4J8U B;  5A90 A;  1MKI A;  1JWZ A;  1P34 C;  2Y2P A;  1IYQ A;  3X1T A;  2PYO A;  1DJB A;  3WTP A;  3HLW A;  4E45 A;  2JKG A;  3KUY B;  3W99 A;  3AZN D;  3BQ8 A;  1PW8 A;  3QP6 A;  3N8L A;  5GT3 B;  3HUN A;  1OTE A;  3LIC A;  3PTE A;  1P3A D;  4S2O A;  2MJ6 A;  5E5A D;  3NY4 A;  4ZJ3 A;  4JXW A;  1KX3 C;  3M6B A;  3H82 A;  4DDY A;  4S2J A;  4DXC A;  3NJA A;  4D60 A;  3AZL B;  5CEB A;  2ZM2 A;  3T1Q B;  4C3Q A;  4EQ1 A;  4BJP A;  2X01 A;  1W1Y A;  4MBH A;  2HP6 A;  2O0Y A;  5AY8 D;  3OPR A;  1KOU A;  5FQQ A;  1ZG6 A;  1YU3 A;  5F68 A;  4GCZ A;  3P5J B;  3OBF A;  3REJ D;  4QLC B;  1BSG A;  2JBF A;  5J3W A;  3UTB A;  2F8N K;  4WUJ A;  3Q82 A;  4S2P A;  1F2K A;  3GVB A;  2HDU A;  1M18 A;  4CSR A;  2LB5 A;  3AZI D;  1N9N A;  4S2N C;  3VE4 A;  4Z5T D;  2WGI A;  3UB7 A;  1QO6 A;  4G91 C;  1OGG A;  1T3U A;  4Z2M H;  2EFX A;  4WL9 A;  1U35 B;  3X1V A;  5AV6 D;  1YLJ A;  3ZDJ A;  4EXO A;  4CAY A;  4H9P B;  1YMS A;  1KDS A;  3NBL A;  3WX7 A;  3CG5 A;  5EVI B;  2H5S A;  3LZ0 C;  2JE5 A;  2BTF P;  3IXB A;  3FZC A;  4S2N A;  4A5R A;  3A3D A;  5KZH A;  1TEM A;  2H10 A;  3KYE A;  4G3W A;  5HPI A;  5HDS A;  1CI9 A;  2Y2Q A;  1RP5 A;  3KSY A;  2Z6C A;  4Q0H A;  4XUJ C;  3WD3 A;  4NYY A;  5B0Y C;  4QJG A;  3WS1 A;  4KQD A;  1Q2P A;  2D02 A;  3LZ0 A;  3IWQ A;  3L28 A;  5FUG A;  3BYD A;  3Q7Z A;  3U4L P;  1K55 C;  3PBR A;  1P3M D;  4Y15 A;  4YM6 A;  3N3F A;  2O9C A;  3AZM B;  4EU0 A;  4OOM A;  5EEC A;  2ZM0 A;  5AV8 D;  2JCH A;  1NWZ A;  3MVD B;  4LD9 C;  5FQK A;  1S6R A;  4MDZ A;  4Y0O A;  1PI5 A;  1PFL A;  5AV5 D;  4IBG A;  2OWH A;  3BM6 A;  3REL C;  4DRA A;  4H9N A;  5JRG B;  2XFT A;  4EET B;  2H28 A;  4UA6 A;  2Z2L B;  2WYX A;  5CED A;  4QY5 A;  4XZQ A;  3OCL A;  3E0Y A;  4H9Q A;  3IXG A;  3MS6 A;  3BFF A;  2ZY2 A;  3MNN B;  3L7H A;  3AZG C;  2XA7 M;  5B32 C;  4HES A;  3NQU B;  4PM5 A;  1NZU A;  2R78 A;  1P3B D;  1YU0 A;  4OPQ A;  3W96 C;  4E3L A;  3AV2 D;  5CPK B;  3H0L C;  3REH D;  1N9O A;  2Y2O A;  5B32 G;  5GT0 B;  2EWW A;  3C1C D;  4UUZ B;  4MNR A;  5CPJ B;  5L10 A;  3F6T A;  4NY2 A;  1N4O A;  4X69 A;  2FFY A;  3AZG A;  3SH8 A;  4DMZ A;  5DFX A;  1H3O B;  2ARO D;  3MGS D;  4OPZ A;  2JHE A;  2GDN A;  3LY3 A;  3O62 B;  3EWK A;  3X1S C;  3HLE A;  4KZ9 A;  4WJ3 C;  3B6F D;  1JWP A;  2PD8 A;  4ZUX C;  5AQ7 A;  1S66 L;  3F1P B;  5B2J A;  4KUK A;  1T1B A;  5AJG A;  5EV0 A;  4AFI A;  1SKO A;  4Z66 B;  4J8W C;  1EQZ C;  5GXQ B;  2LY8 A;  3AZK B;  1MWR A;  4KQQ A;  3UN7 A;  2HIO A;  3UPN A;  3ZG9 B;  4R6L A;  1P3F B;  1P3I C;  1M1A C;  3AZF C;  1BLH A;  3VH5 W;  1MPL A;  2Q0O A;  4CLC C;  2ZQ9 A;  2VGJ A;  3CZD A;  3EPK A;  2FZ0 A;  1SDE A;  3BQA A;  3IH9 A;  1FQG A;  1QMF A;  1ZTU A;  4LG2 A;  4WU9 D;  3AFA B;  3X1U C;  3BLM A;  3A3E A;  1IEM A;  1H8Z A;  5AY8 B;  3LID A;  5B1M D;  4IBF A;  3MGP A;  3AZF A;  3AV1 C;  3L27 A;  1HZO A;  1W1T A;  3K3D A;  3V9R B;  4X6T A;  5DNM B;  1P3G C;  4UA9 A;  1E25 A;  3P7N A;  1YAX A;  2F8N A;  3LY4 A;  3OPL A;  4YS3 C;  1KX5 D;  3REK A;  3X1U A;  5B31 A;  1IFQ A;  1P3O B;  4L9G A;  1YLP A;  3V3R A;  2AVX A;  1B6W A;  1SCW A;  4YIN A;  2EA9 A;  3AZI B;  4IUK A;  4CLC E;  4R8P C;  2R9X A;  3ZNY A;  4Z5T B;  1F66 D;  2ZJ9 A;  3WD1 A;  1K4E A;  3LIB A;  1HQ3 C;  4Y2F A;  2VV6 A;  3KO6 A;  4WZ5 A;  5KDM A;  1E3U A;  4NFT A;  1Y54 A;  4K08 A;  2QYB A;  1TZY D;  3TJZ C;  3LR5 A;  1Q9C A;  4P6B A;  1W63 Q;  3SS4 A;  2W3F A;  2WKP A;  1O6I A;  2ZQD A;  1ONG A;  4E6W A;  1S4S A;  3CMZ A;  4HGA B;  2QPN A;  4KGC D;  1GHI A;  3EGD C;  1WE4 A;  2VA0 A;  1NLY A;  2ZOH A;  2E8I A;  3HJK A;  5TBM A;  5F1G A;  4J8U A;  4M4X A;  4MMN A;  1P3M B;  2B95 A;  4B4Z A;  2UV0 E;  1ALQ A;  2BAS A;  3KXB C;  4YM6 D;  4LEN A;  3UNW A;  3UDX A;  5GT3 A;  1MBL A;  5G18 A;  3UB8 A;  2Y2I A;  3S7P A;  1M19 B;  3CIT A;  4WEK A;  5DKL A;  3UME A;  1BH8 B;  5FI7 A;  5GSU C;  5F99 A;  3TU4 D;  2WAE A;  3SS5 A;  1P3B B;  2FJ7 A;  2Y2M A;  1GHP A;  3LEL C;  4BBT A;  3AZL A;  1ED7 A;  3MZF A;  5M1A A;  3AV2 B;  3RFB A;  3WA9 D;  3REH B;  4XUZ A;  2WZZ A;  2GNX A;  4H9S A;  1LL8 A;  2ZC3 B;  3IQA A;  3WAA D;  4L9F A;  4RYE A;  1E4D A;  3MGS B;  3C1B A;  3KWQ A;  3E98 A;  2J8Y A;  3LEL A;  4IHQ A;  1T19 A;  4NEE D;  3UDI A;  5FDS A;  3MBZ A;  4KG6 A;  1K57 A;  3IF6 B;  1NRJ A;  5AV9 C;  1SKF A;  3G4P A;  2O9B A;  1WA9 A;  4EBN A;  3LJA C;  3UB6 A;  1IYS A;  3IS2 B;  3DWZ A;  4H9P A;  4OKP A;  5EVI A;  5AVB C;  3W4O A;  5DNN A;  1JFI A;  4R3A A;  1E6P A;  4H9O A;  5AQB A;  4EO5 B;  3LJA A;  3WD4 A;  3VV4 A;  5EFW A;  3AZE C;  5CP6 B;  1LL9 A;  4Y7P A;  1XA7 A;  5FQ9 A;  4EES A;  2VKS A;  4UEY A;  3MQQ A;  3Q7V B;  2W8S A;  4P85 A;  2NQB C;  2VGL M;  3R7W B;  4IBR A;  1ID3 D;  4WNN B;  1LL5 A;  2V2F F;  1PI4 A;  1P34 B;  4IBB A;  5FA7 A;  5G4Z A;  1WYB A;  3MVD A;  4DQY B;  3AZE A;  2D01 A;  3UB5 P;  4JBF A;  4OPY A;  4KHA A;  2I9V A;  4GOG A;  5GLB A;  5B24 C;  1W79 A;  4IED A;  4WU8 D;  1P3K D;  2O99 A;  2XEP A;  3W98 C;  4O7D A;  5B1L C;  3MNN A;  2ZMV A;  3LZ1 A;  1RGZ A;  4B4X A;  1YLZ A;  2G7U A;  4ZDX A;  1JTG A;  1LSX A;  2NZD A;  4I38 A;  1K38 A;  1KS0 A;  4LLO B;  4P6Z M;  3GV9 A;  5GL9 A;  2ZY5 A;  4H6J B;  4ZJ2 A;  2HP9 A;  1S0W A;  1AWI A;  4GNU A;  3HCY A;  3VH6 A;  4JKT A;  4UUZ A;  4JXG A;  5CPJ A;  4JJN A;  3GR2 A;  1W1V A;  4IBE A;  3H0M C;  1K56 A;  1MY8 A;  4XUX A;  1TS8 A;  3EQU A;  3LIA A;  4ZJ1 A;  4WZ4 A;  5AVC D;  4FUW A;  3F1O A;  3O62 A;  5AVE A;  3KS8 A;  5E5A C;  1P3P D;  4JXS A;  1UWN X;  2BYK B;  3P01 A;  4X25 A;  2VEA A;  3EOI A;  4GS9 B;  4E3I A;  3F1N B;  2W1T A;  2IWB A;  3ZQ5 A;  2BLS A;  3AZN A;  3RH8 B;  1ES5 A;  3LI8 A;  1W1P A;  4KUD C;  3KUY D;  5F83 A;  4M3K A;  4WZS B;  1P3A A;  4G91 B;  4U3T A;  5I5L A;  4HHD A;  5E5A A;  3MXQ A;  2W0N A;  2J3W A;  5CHJ A;  2JKR I; 
#chains in the Genus database with same CATH homology
 2XDM A;  5IHV A;  4GKU A;  1FR6 A;  3A6N D;  4ZBE A;  2EX2 A;  4OOL A;  3BFC A;  3WS0 A;  5AY8 A;  4XUJ B;  4F94 A;  3L25 A;  4N9L A;  5B0Z C;  3REJ A;  3IP4 C;  4QB8 A;  3HLG A;  4KZA A;  4N1X A;  4QLC D;  4Q8I A;  2B5R A;  1BLP A;  4NK3 A;  5A91 A;  2RCX A;  3RXX A;  3REL B;  3AZI A;  2Y55 A;  4N1H A;  5TGF A;  4EBP A;  5HAI A;  2G5H C;  2HPB A;  3G35 A;  4Z5T A;  2EX9 A;  5HX9 A;  4R3J A;  2Y2G A;  5AV6 A;  4ZBJ B;  2RIQ A;  4E44 A;  1U35 D;  4X23 B;  1IEL A;  3HLC A;  2IOU A;  3NQJ A;  3DW0 A;  3EPH A;  5A92 A;  1WYC A;  1L0G A;  1ZLA C;  1PZO A;  3ITB A;  4GDB A;  5B2I C;  4AWL C;  3W97 C;  1BT5 A;  3V5M A;  5AV5 C;  3AYW D;  4JXV A;  4MEZ A;  1I2W A;  4J8X C;  3MZD A;  3NCK A;  1P3L D;  1P3M A;  3WKJ C;  4ZUX B;  1W7F A;  5L2F A;  5AV8 A;  3AZM D;  4J8W B;  1EQZ B;  5CEC A;  4X53 A;  4P87 A;  5AV5 A;  4WU8 B;  3UT9 D;  3FV7 A;  5EOO A;  1P3K B;  4BLM A;  3H0R C;  4H9R B;  4E3K A;  5JRG D;  2WAD A;  1P3I B;  2P9V B;  4R0Q A;  5TR7 A;  1P3B A;  3MFD A;  4IVI A;  3AV2 A;  5EVL A;  3REH A;  2ZY3 A;  5EUA A;  4JLF A;  5CPK D;  3LEZ A;  2JC7 A;  4GDN A;  3S4X A;  3HUM A;  3C1C A;  3BEC A;  5G49 A;  5BO0 B;  5GT0 D;  3X1T C;  3UO9 A;  3IH8 A;  3WTP C;  2ARO A;  3MGS A;  1K56 D;  3N4I A;  1KVL A;  5D3O A;  1P3G B;  3VFH A;  3IXD A;  4UHU A;  3B6F A;  4YS3 B;  3AZH B;  3IF6 A;  4J8V B;  2OLU A;  2OV5 A;  5CPI B;  4MBF A;  2RVQ C;  4C75 A;  4DE1 A;  4KZB A;  4FCF A;  4EQI A;  4Z66 D;  4GH9 A;  1BZA A;  5GXQ D;  3C4P A;  3PBQ A;  5FDH A;  3PBO A;  3AZK D;  4JF6 A;  5JA4 A;  3QNC A;  4NE5 A;  3B0C W;  3OPP A;  3AGE A;  3FWL A;  2V1Z A;  1P3F D;  3WTP E;  3HBR A;  1YU2 A;  3A6N B;  4MLL A;  4WU9 A;  5BNX A;  5TFQ A;  3UTB C;  4K0X A;  2R9W A;  3AFA D;  5B1M A;  3EG5 B;  3B6G D;  1M18 C;  5BPV A;  1XA1 A;  4DRB A;  2Z2M B;  4OVD A;  1KE3 A;  1N1J B;  1HTZ A;  3KXB B;  1FSY A;  5DNM D;  4LV3 A;  1KX5 A;  1NYM A;  2Y91 A;  3X1V C;  4ZAM A;  3ZVT A;  1I5Q A;  4X56 A;  3REI D;  1P3O D;  5B40 D;  3AN2 D;  1F66 A;  3A3J A;  3O3V A;  3M6H A;  4N92 A;  1TZY A;  2H0Y A;  5GSU B;  3UE0 A;  3NIA A;  3UTA B;  2ZC4 B;  4QNL A;  4KGC A;  4YM6 C;  2JSS A;  3O86 A;  1F1E A;  3AYW B;  2YFV B;  1BUE A;  2A3U A;  3MKE A;  1BLS A;  2WKI A;  1P3L B;  2IWC A;  3E2L A;  1L2S A;  3ISG A;  3LO7 A;  1IKG A;  5C3I C;  5AV9 B;  4XZQ C;  2EXA A;  2OLV A;  4OJ5 A;  2XK1 A;  3UT9 B;  5GHY A;  2WGW A;  3OC2 A;  1K6S A;  3HL9 A;  1M19 D;  1YT4 A;  3WAA C;  5B33 D;  3TU4 A;  4X55 A;  2YFW B;  1ES3 A;  3VH5 A;  3WA9 A;  5AQA A;  1FCO A;  1PWD A;  3G30 A;  1KX4 B;  5B2J C;  2NQB B;  3WAA A;  4HEF A;  1YM1 A;  3NDE A;  3MGR D;  4KZ7 A;  4UAA A;  5FAQ A;  4WEL A;  5GLD A;  4S2M A;  2HIO C;  1QME A;  5BT1 D;  2CV5 B;  1KU5 A;  5B24 B;  1LI9 A;  4IVK A;  4EUZ A;  2Q9M A;  3W98 B;  2XH9 A;  3MGQ B;  3L2A A;  1CEF A;  3MGP C;  3ZCZ A;  1CEG A;  2FFF B;  2HP5 A;  2XD5 A;  3AZJ B;  1AOI D;  3IWI A;  3BFD A;  5CP6 D;  3OZH A;  3REK C;  5B31 C;  3B6G B;  3HLF A;  2HDR A;  2QZ6 A;  3VOZ A;  1ID3 A;  3PBS A;  2F8N G;  4OPR A;  2IO5 C;  1K54 A;  3LCE A;  4WZ5 C;  5B31 G;  1YUE A;  1DJC A;  1M40 A;  1P34 D;  3VP2 A;  1NRF A;  3QNB A;  3REI B;  4WU8 A;  3M2K A;  1P3K A;  3FDD A;  5B40 B;  3AN2 B;  3ZFZ A;  4CPK A;  4H9R A;  5CTM A;  3HRE A;  2XGN A;  1ESU A;  1KX3 D;  2PU4 A;  1O7E A;  5AVC C;  2H0T A;  3FYZ A;  5HAQ A;  3Q81 A;  4KG2 A;  4J8U C;  1NXY A;  1JVJ A;  4LCM A;  1PZR A;  5B0Z B;  2ZC5 B;  5AVC A;  1TAF B;  3UE1 A;  1EI5 A;  1P3P A;  5GT3 C;  2XR0 A;  3VFF A;  4PM7 A;  2C5W B;  4IBI A;  3UDF A;  4PMA A;  2Y2H A;  1PWG A;  5F99 C;  3KUY A;  4OJO A;  2FJ7 C;  4KZ6 A;  4OQ0 A;  3AZL C;  4N9K A;  1JTD A;  1KE4 A;  1IYO A;  4LV0 A;  1BH9 B;  4H9S C;  1PW1 A;  1Q2Q A;  1RGY A;  5E2F A;  5BNV B;  4DE3 A;  5B33 B;  2J7V A;  5HAP A;  1HD8 A;  3PBN A;  4QLC C;  2XD1 A;  5BS7 A;  5FQJ A;  3A6N A;  3C1B C;  3KWQ C;  3VH6 T;  3TSG A;  1ONH A;  4WMC D;  5B2I B;  4AWL B;  3W97 B;  1KGG A;  2OSU A;  5CTN A;  4IJF A;  4J8X B;  1K57 C;  3IT9 A;  4YFM A;  5CGW A;  4XUJ D;  5B0Y D;  3L26 A;  3MGR B;  2Q9N A;  1N1J A;  1JWV A;  4QLC A;  2UWX A;  2Y2L A;  4KZ4 A;  3C4O A;  1U35 C;  3WRT A;  4MBK A;  4LD9 D;  3FKV A;  5EVI C;  3NDG A;  5DNN C;  1Z2C B;  3REL D;  4U0T A;  3MKF A;  2HUE C;  2G2W A;  1U35 A;  2WZX A;  1S32 B;  3O87 A;  3B0D C;  5B32 D;  4BL3 A;  5GLA A;  3W96 D;  4X23 D;  1FR1 A;  2EXB A;  3OPH A;  1AOI B;  3V39 A;  3MVD C;  2PYO B;  1FSW A;  1W2E A;  3AYW A;  3W99 B;  1A7W A;  2ZMA A;  1P3L A;  1FOF A;  1Z6F A;  3X1S D;  1ZC2 A;  4ZUX D;  3AZM A;  2Y4A A;  1NY0 A;  5CHU A;  3MNN C;  3LZ1 C;  3HLD A;  4J8W D;  4PPR A;  4M6B A;  1EQZ D;  2NZD C;  3UT9 A;  1XGJ A;  5CER A;  4DE2 A;  5HW3 A;  2IWD A;  5JRG A;  2XLN A;  5KSH A;  3B0B A;  1P3I D;  1M1A D;  4DDS A;  5CPJ C;  4JJN C;  1KX3 B;  2X02 A;  4LV2 A;  4RX2 A;  3NQU A;  5M18 A;  4OQI A;  3CJM A;  3UTB B;  3O62 C;  3AL0 C;  4OUI A;  5CPK A;  1BLC A;  5DTS A;  1HTA A;  4CSR B;  1J9M A;  5GT0 A;  3GMW A;  3AV1 D;  4Z66 C;  4R23 A;  3AZK C;  3AZN C;  3KS4 A;  1H3O A;  5HL1 A;  4NE6 A;  1P3A C;  1P3G D;  4KEN B;  4CAY B;  4YS3 D;  3AZH D;  1AXB A;  4R4R A;  4U0X A;  4J8V D;  2Y2J A;  4Z66 A;  5GXQ A;  5CPI D;  3ZHH A;  3A3I A;  3PAE A;  4R8P D;  2WAF A;  3AZK A;  1HQ3 D;  2ZC6 B;  1P3F A;  3ZNT A;  1LI0 A;  5AY8 C;  3FKE A;  3PBT A;  3LZ0 B;  5FUG B;  3W8K A;  3REJ C;  1ERO A;  2J9O A;  4OJL A;  1PYY A;  4L0L A;  4FD8 A;  3JYI A;  3AFA A;  5F1F A;  3B6G A;  2VQR A;  1P3O C;  5GLC A;  3AZI C;  5B0Y B;  4H8R A;  4H9N B;  3EPL A;  4ID4 A;  4Z5T C;  4XZQ B;  2XFS A;  3V9R A;  4WV4 B;  5U47 A;  4H9Q B;  5DNM A;  1ZG4 A;  4GD8 A;  3KXB D;  5AV6 C;  1ES4 A;  3S1Y A;  4LD9 B;  3REI A;  1P3O A;  5B40 A;  3AN2 A;  3UY6 A;  5CRF A;  3IHA A;  4HGA C;  3IXH A;  5DF9 A;  2WK0 A;  3AZG B;  4NZ4 A;  5B32 B;  2EX6 A;  5GSU D;  4DXB A;  3VP3 A;  3W96 B;  3UTA D;  1P3M C;  4BD1 A;  1W8Y A;  4OLG A;  1ZKJ A;  3NC8 A;  5B2J B;  5JYP A;  5AV8 C;  3V50 A;  5HFO A;  1XKZ A;  3G32 A;  1M19 C;  3X1S B;  3E2K A;  1G6A A;  5AV9 D;  2XQZ A;  4BD0 A;  1P3B C;  4GD6 A;  3AV2 C;  1M19 A;  3REH C;  1G68 A;  2G5I C;  5BNV A;  3MGP B;  1M1A B;  1ERQ A;  3C1C C;  3AZF B;  3N8S A;  5B33 A;  1BH8 A;  5AVB D;  5DTT A;  4KG5 A;  4GHL A;  3WS2 A;  2ARO C;  3MGS C;  2G2U A;  2L5A A;  5BT1 C;  3N6I A;  3B6F C;  4KQR A;  3REK B;  3X1U B;  3EPJ A;  3IF6 C;  2ZY4 A;  2V20 A;  1KX4 D;  5DTK A;  3AV1 B;  2NQB D;  3MGR A;  1W5D A;  4G92 C;  2F8N H;  4DF6 A;  5KDM B;  1CI8 A;  1YQS A;  4WBG A;  2WKE A;  3VMA A;  3A1K A;  4NE3 A;  3G2Z A;  1U60 A;  2CV5 D;  5B24 D;  4FH4 A;  4EWF A;  4R8P B;  4UA7 A;  1HQ3 B;  3W98 D;  3Q07 A;  4WU9 C;  3SH7 A;  5B1L D;  3MGQ D;  5B1M C;  3Q1F A;  3VH5 T;  5FAT A;  1ESI A;  3BEB A;  1AOI A;  3AZJ D;  1HVB A;  2F2A C;  5CP6 A;  4IBK A;  1KX5 C;  3SS3 A;  3Q7V A;  4OJP A;  3ZG5 A;  4WNN A;  1F66 C;  4FH2 A;  4Y0U A;  1P34 A;  4NZ1 A;  3HVF A;  1TZY C;  5F99 B;  4E3M A;  2FJ7 B;  3W4Q A;  1GA9 A;  4KUD D;  1CK3 A;  4KGC C;  3A3F A;  1KX3 A;  1MWS A;  3IHB A;  5I94 A;  3C1B B;  3FKW A;  3L29 A;  3KWQ B;  3LEL B;  3VSK A;  4Y0T A;  1L0E A;  4FSF A;  4NYU A;  4OON A;  3QHY A;  5B0Z D;  3VP0 A;  3WRZ A;  1OME A;  4Z9Q A;  1MXO A;  3D4F A;  1MWU A;  1PWC A;  1YU1 A;  2BYK A;  2DCF A;  4QU3 A;  5BOH A;  5DNN B;  4S2I A;  1JFI B;  4PM6 A;  4H9O B;  3TU4 C;  2VGK A;  3LJA B;  2HUE B;  3P98 A;  3WA9 C;  1H8Y A;  3B0D B;  1GA0 A;  5J8X A;  5CGX A;  5AVB B;  2DNS A;  2XF3 A;  2ZM8 A;  1YLY A;  2C6W B;  1ERM A;  4WMC A;  1DY6 A;  5FI6 A;  3AZE B;  1ZLA D;  3BRM A;  5B2I D;  1NJ4 A;  4KHA B;  1KGF A;  3W97 D;  2CWE A;  4JF4 A;  1YLW A;  2J8P A;  4XUJ A;  5B0Y A;  1K4F A;  3BFG A;  4J8X D;  2Y2K A;  1K55 A;  5DF8 A;  1BTL A;  3WKJ D;  1BFM A;  1FCM A;  2EFU A;  5AQ9 A;  3LZ1 B;  4LD9 A;  4ZBJ C;  2NZD B;  4X23 C;  3REL A;  4C6Y A;  3C7V A;  4DKI A;  2ZM5 A;  4IJE A;  3B3X A;  1MWT A;  4JJN B;  1B67 A;  5B1L B;  4RX3 A;  4OP5 A;  5B32 A;  1S32 D;  4OLD A;  3W96 A;  1ID3 C;  5CXW A;  4X23 A;  1YLT A;  1K54 C;  2WUQ A;  3AZN B;  3X1T D;  2PYO D;  3WTP D;  4WU8 C;  1R4V A;  3W99 D;  1P3K C;  1KE0 A;  1P3A B;  3X1S A;  5E5A B;  1LHY A;  4ZUX A;  1XGI A;  2BG1 A;  5FAO A;  4J8W A;  1EQZ A;  1W8Q A;  1N9B A;  2RVQ D;  2EX8 A;  3ZG8 B;  4DRT A;  4KUD B;  1L0F A;  4GN2 A;  1WWI A;  1K25 A;  3IF5 A;  1P3I A;  1M1A A;  3AGF A;  5E2G A;  2P9V A;  3W4P A;  3REJ B;  1I2S A;  1XP4 A;  1YU4 A;  5E2H A;  4GZB A;  1P3P C;  3RJU A;  3UTB D;  3AZH C;  2BYM B;  4E3N A;  3VOY A;  4J8V C;  3AV1 A;  2DF4 C;  1SDN A;  4UPK A;  5CPI C;  1M18 D;  5BO0 A;  3AGD A;  1ES2 A;  2Y2N A;  2ZQ8 A;  5FAS A;  5FQI A;  4HBU A;  3KUY C;  3TG9 A;  4WM9 A;  5FI2 A;  1P3G A;  3NI9 A;  5AV6 B;  4YS3 A;  3AZH A;  3X1V D;  4OH0 A;  4J8V A;  4LV1 A;  5CPI A;  4R8P A;  5BS7 C;  3A6N C;  1HQ3 A;  3NQJ B;  1BUL A;  5A93 A;  3VSL A;  3RXW A;  4S2K A;  2Y59 A;  3WS5 A;  1SHV A;  3LZ0 D;  5AV8 B;  1ZLA B;  3OCN A;  5F82 A;  1GHM A;  2CC1 A;  2DRW A;  5AV5 B;  5M19 A;  3HSH A;  4KZ8 A;  3WKJ B;  4ZTK A;  3KXB A;  4WEJ A;  4XZQ D;  5E43 A;  4Z2M G;  1GCE A;  2ZQ7 A;  3M2J A;  1KGE A;  2RL3 A;  3UTA C;  3R45 B;  5HAR A;  3VP4 A;  3WS4 A;  3C1C B;  5G49 B;  1EWZ A;  1KVM A;  1L0D A;  3AYW C;  2ARO B;  5GSU A;  3AZG D;  3UTA A;  1P3L C;  3B6F B;  4OQH A;  3UE3 A;  3GQZ A;  1DJA A;  4GHA A;  3AZM C;  2QMI A;  5B2J D;  1VM1 A;  4G92 B;  3X1T B;  3WTP B;  4IBJ A;  2YFV A;  3UT9 C;  3G34 A;  4KZ3 A;  5JA4 B;  3HON A;  2HDQ A;  2HIO D;  4D2O A;  5JRG C;  2ZC7 A;  4LCL A;  4E6X A;  5AV9 A;  5DF7 A;  3N8R A;  1M6K A;  3O88 A;  1YMX A;  4K0W A;  4RVA A;  4DE0 A;  4B88 A;  4WU9 B;  2A49 A;  5BNX B;  4JF5 A;  4P0M A;  4OOY A;  1KDW A;  1FCN A;  5CPK C;  5B1M B;  1KX4 C;  3EQV A;  4R4S A;  5AVB A;  4E3J A;  5GT0 C;  3MGP D;  3AZF D;  1PIO A;  4X68 A;  2WGV A;  3GTC A;  2YFW A;  4JPM A;  4IBC A;  4CJN A;  1KX5 B;  2F8N D;  4PM8 A;  2CV5 C;  2PBY A;  3REK D;  1KX4 A;  3X1U D;  5B31 D;  3ZG7 B;  2NQB A;  1M18 B;  3C5A A;  5E2E A;  2HDS A;  1F66 B;  5GXQ C;  1RCJ A;  1TZY B;  3MGQ C;  4NET A;  1E3U D;  3S22 A;  1P3F C;  3X1V B;  2CV5 A;  5B24 A;  3UPP A;  1ULY A;  5CGS A;  3AZJ C;  4KGC B;  3W98 A;  3B0C T;  5FSR A;  5B1L A;  3TOI A;  3AFA C;  3MGQ A;  3B6G C;  3G2Y A;  1XPB A;  3ZVW A;  2ZQA A;  4KZ5 A;  4R1G A;  5CHM A;  1TDL A;  4J8U D;  3AZJ A;  4YM6 B;  5DNM C;  3BFE A;  4XXR A;  2ZLY A;  3WWX A;  4EBL A;  3GRJ A;  3SOI A;  2WKH A;  3MZE A;  3REI C;  3I7J A;  3HLB A;  3P09 A;  5B40 C;  3AN2 C;  2WGW B;  5KMW A;  5GT3 D;  3DWK A;  4BEN A;  5C3I B;  1H5X A;  3KFU G;  3TU4 B;  3C7U A;  1C3B A;  4BQM A;  1NYY A;  5F99 D;  4KUD A;  3UPO A;  2FJ7 D;  3VH6 W;  3WA9 B;  4RA7 A;  3AZL D;  1PZP A;  2P74 A;  3HUO A;  2X71 A;  3MXS A;  3WAA B;  5EE8 A;  4WYY A;  3ITA A;  3C1B D;  3KWQ D;  1VQQ A;  5EOE A;  3LEL D;  5FAP A;  2J9P A;  2BYM A;  3G31 A;  4S2L A;  2I72 A;  4GB7 A;  5B0Z A;  4IBX A;  4HBT A;  1TAF A;  5EPH A;  3BLS A;  2HIO B;  5FQM A;  4E3O A;  4OP8 A;  4PM9 A;  3ZGA B;  2ZQC A;  4NZ5 A;  5B33 C;  5EVI D;  3MXR A;  5DNN D;  1XX2 A;  3N7W A;  1TDG A;  3LJA D;  4BL2 A;  5GHZ A;  5JYO A;  3PAG A;  1BH9 A;  1XXM A;  3ZG0 A;  1O07 A;  1ID3 B;  1IKI A;  3MGR C;  5KSC A;  4KQO A;  2PU2 A;  3DTM A;  1ZLA A;  1TVF A;  5B2I A;  2F8N B;  3MVD D;  3W97 A;  3AZE D;  1IYP A;  4EV4 A;  3GSG A;  3VP1 A;  4IBD A;  5B31 B;  3SH9 A;  4J8X A;  1WWS A;  5CHL B;  3WKJ A;  3V3S A;  2IO5 B;  1K6R A;  3A1I A;  4R3B A;  4QD4 A;  3MNN D;  1S32 C;  4QHC A;  3LZ1 D;  4OQG A;  2ZD8 A;  4NZ3 A;  5DVA A;  2NZD D;  2DQN C;  4OJ6 A;  1NZO A;  3R45 A;  4QY6 A;  4EO5 C;  1AOI C;  5GHX A;  2PYO C;  5CP6 C;  5CPJ D;  4JJN D;  3W99 C;  5AVC B;  1S32 A;  4K91 A;  1P3P B;  1LLB A;  3O62 D;  3IWO A;  4J8U B;  5A90 A;  1MKI A;  1JWZ A;  1P34 C;  2Y2P A;  1IYQ A;  3X1T A;  2PYO A;  1DJB A;  3WTP A;  3HLW A;  4E45 A;  3KUY B;  3W99 A;  3AZN D;  1PW8 A;  3N8L A;  5GT3 B;  3HUN A;  3PTE A;  1P3A D;  4S2O A;  5E5A D;  3NY4 A;  4ZJ3 A;  4JXW A;  1KX3 C;  3M6B A;  4DDY A;  4S2J A;  4DXC A;  3AZL B;  5CEB A;  2ZM2 A;  4C3Q A;  4BJP A;  2X01 A;  4MBH A;  2HP6 A;  5AY8 D;  3OPR A;  5FQQ A;  1ZG6 A;  1YU3 A;  3P5J B;  3REJ D;  4QLC B;  1BSG A;  2JBF A;  3UTB A;  2F8N K;  3Q82 A;  4S2P A;  3GVB A;  2HDU A;  1M18 A;  4CSR A;  3AZI D;  4S2N C;  4Z5T D;  2WGI A;  4G91 C;  1T3U A;  4Z2M H;  2EFX A;  1U35 B;  3X1V A;  5AV6 D;  1YLJ A;  3ZDJ A;  4CAY A;  4H9P B;  1YMS A;  1KDS A;  3NBL A;  3WX7 A;  3CG5 A;  5EVI B;  2H5S A;  3LZ0 C;  2JE5 A;  3IXB A;  3FZC A;  4S2N A;  4A5R A;  3A3D A;  5KZH A;  1TEM A;  2H10 A;  1CI9 A;  2Y2Q A;  1RP5 A;  3KSY A;  4XUJ C;  4NYY A;  5B0Y C;  4QJG A;  3WS1 A;  1Q2P A;  3IWQ A;  3LZ0 A;  3L28 A;  5FUG A;  3BYD A;  3Q7Z A;  1K55 C;  3PBR A;  1P3M D;  4YM6 A;  3N3F A;  3AZM B;  4OOM A;  5EEC A;  2ZM0 A;  5AV8 D;  2JCH A;  3MVD B;  4LD9 C;  5FQK A;  1S6R A;  4Y0O A;  1PI5 A;  5AV5 D;  4IBG A;  3BM6 A;  3REL C;  4DRA A;  4H9N A;  5JRG B;  2XFT A;  4UA6 A;  2Z2L B;  2WYX A;  5CED A;  4QY5 A;  4XZQ A;  3OCL A;  4H9Q A;  3IXG A;  3BFF A;  2ZY2 A;  3MNN B;  3AZG C;  5B32 C;  4HES A;  3NQU B;  4PM5 A;  1NZU A;  1P3B D;  1YU0 A;  4OPQ A;  3W96 C;  4E3L A;  3AV2 D;  5CPK B;  3H0L C;  3REH D;  2Y2O A;  5B32 G;  5GT0 B;  3C1C D;  4UUZ B;  4MNR A;  5CPJ B;  3F6T A;  4NY2 A;  1N4O A;  4X69 A;  2FFY A;  3AZG A;  3SH8 A;  1H3O B;  2ARO D;  3MGS D;  4OPZ A;  2GDN A;  3LY3 A;  3O62 B;  3X1S C;  3HLE A;  4KZ9 A;  4WJ3 C;  3B6F D;  1JWP A;  5AQ7 A;  4ZUX C;  5B2J A;  4Z66 B;  4J8W C;  1EQZ C;  5GXQ B;  2LY8 A;  3AZK B;  1MWR A;  4KQQ A;  3UN7 A;  2HIO A;  3UPN A;  3ZG9 B;  1P3F B;  1P3I C;  1M1A C;  3AZF C;  1BLH A;  3VH5 W;  1MPL A;  2ZQ9 A;  2VGJ A;  3CZD A;  3EPK A;  1SDE A;  3IH9 A;  1FQG A;  1QMF A;  4LG2 A;  4WU9 D;  3AFA B;  3X1U C;  3BLM A;  3A3E A;  1IEM A;  1H8Z A;  5AY8 B;  5B1M D;  4IBF A;  3MGP A;  3AZF A;  3AV1 C;  3L27 A;  1HZO A;  3V9R B;  4X6T A;  5DNM B;  1P3G C;  4UA9 A;  1E25 A;  2F8N A;  3LY4 A;  3OPL A;  4YS3 C;  1KX5 D;  3REK A;  3X1U A;  5B31 A;  1P3O B;  1YLP A;  3V3R A;  4YIN A;  1B6W A;  1SCW A;  3AZI B;  4R8P C;  2R9X A;  3ZNY A;  4Z5T B;  1F66 D;  2ZJ9 A;  1K4E A;  1HQ3 C;  4WZ5 A;  5KDM A;  1E3U A;  4NFT A;  1Y54 A;  1TZY D;  1Q9C A;  4P6B A;  3SS4 A;  2ZQD A;  1ONG A;  4E6W A;  3CMZ A;  4HGA B;  2QPN A;  4KGC D;  1GHI A;  1WE4 A;  2E8I A;  5F1G A;  4J8U A;  1P3M B;  4B4Z A;  1ALQ A;  3KXB C;  4YM6 D;  4LEN A;  3UNW A;  3UDX A;  5GT3 A;  1MBL A;  5G18 A;  2Y2I A;  1M19 B;  4WEK A;  1BH8 B;  5FI7 A;  5GSU C;  5F99 A;  3TU4 D;  2WAE A;  3SS5 A;  1P3B B;  2FJ7 A;  2Y2M A;  1GHP A;  3LEL C;  3AZL A;  3MZF A;  5M1A A;  3AV2 B;  3WA9 D;  3REH B;  4XUZ A;  2WZZ A;  4H9S A;  2ZC3 B;  3IQA A;  3WAA D;  4RYE A;  1E4D A;  3MGS B;  3C1B A;  3KWQ A;  2J8Y A;  3LEL A;  3UDI A;  3MBZ A;  4KG6 A;  1K57 A;  3IF6 B;  5AV9 C;  1SKF A;  3G4P A;  4EBN A;  3LJA C;  1IYS A;  3DWZ A;  4H9P A;  4OKP A;  5EVI A;  5AVB C;  3W4O A;  5DNN A;  1JFI A;  4H9O A;  5AQB A;  4EO5 B;  3LJA A;  3AZE C;  5CP6 B;  1LL9 A;  4Y7P A;  1XA7 A;  5FQ9 A;  3Q7V B;  2W8S A;  4P85 A;  2NQB C;  4IBR A;  1ID3 D;  4WNN B;  1LL5 A;  2V2F F;  1PI4 A;  1P34 B;  4IBB A;  5FA7 A;  1WYB A;  3MVD A;  4DQY B;  3AZE A;  4JBF A;  4OPY A;  4KHA A;  4GOG A;  5GLB A;  5B24 C;  1W79 A;  4IED A;  4WU8 D;  1P3K D;  2XEP A;  3W98 C;  4O7D A;  5B1L C;  3MNN A;  3LZ1 A;  1RGZ A;  4B4X A;  1YLZ A;  4ZDX A;  1JTG A;  2NZD A;  1K38 A;  3GV9 A;  5GL9 A;  2ZY5 A;  4ZJ2 A;  2HP9 A;  1S0W A;  4GNU A;  3VH6 A;  4JKT A;  4UUZ A;  4JXG A;  5CPJ A;  4JJN A;  3GR2 A;  4XUX A;  4IBE A;  3H0M C;  1K56 A;  1MY8 A;  3EQU A;  4ZJ1 A;  4WZ4 A;  5AVC D;  3O62 A;  3KS8 A;  5E5A C;  1P3P D;  4JXS A;  2BYK B;  4E3I A;  2IWB A;  2BLS A;  3AZN A;  1ES5 A;  4KUD C;  3KUY D;  5F83 A;  4M3K A;  4WZS B;  1P3A A;  4G91 B;  4U3T A;  5E5A A;  5CHJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...