4NY2A

Structure of vibrio cholerae chitin de-n-acetylase in complex with acetate ion (act) in p 21
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
404
structure length
404
Chain Sequence
PKGTIYLTFDDGPVNASVEVIKVLNQGGVKATFYFNAWHLDGIGDENEDRALEALKLALDSGHIVGNHSYDHMIHNCVEEFGPTSGADCNATGNHQIHSYQDPVRDAASFEQNLITLEKYLPTIRSYPNYKGYELARLPYTNGWRVTKHFQADGLCATSDNLKPWEPGYVCDPANPSNSVKASIQVQNILANQGYQTHGWDVDWAPENWGIPMPANSLTEAVPFLAYVDKALNSCSPTTIEPINSKTQEFPCGTPLHADKVIVLTHDFLFEDGKRGMGATQNLPKLAEFIRIAKEAGYVFDTMDNYTPRWSVGKTYQAGEYVLYQGVVYKAVISHTAQQDWAPSSTSSLWTNADPATNWTLNVSYEQGDIVNYKGKRYLVSVPHVSQQDWTPDTQNTLFTALEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Deacetylase DA1
publication title Structural basis of chitin oligosaccharide deacetylation.
pubmed doi rcsb
source organism Vibrio cholerae
total genus 147
structure length 404
sequence length 404
chains with identical sequence B
ec nomenclature ec 3.5.1.41: Chitin deacetylase.
pdb deposition date 2013-12-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.90 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4ny2A02
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 4ny2A01
2C1GA 4NZ1A 4NYYA 3RXZA 1NY1A 4WCJA 4M1BA 2E67A 2VYOA 4OUIA 1XW8A 2I5IA 4NY2A 4NZ4A 3VUSA 2QV5A 1W1B1 2DFAA 4LY4A 3QBUA 2C79A 2Y8UA 4HD5A 3WX7A 2NLYA 4V33A 1W1A1 5BU6A 2XU2A 2IW0A 5JMUA 2C71A 1Z7AA 4NZ5A 2W3ZA 4U10A 1W17A 3HFTA 4F9JA 2C1IA 2J13A 3CL8A 2CC0A 4F9DA 3CL7A 4NZ3A 4NYUA 3CL6A 3S6OA 4L1GA 1V6TA
chains in the Genus database with same CATH superfamily
4B3KA 4NG3A 1JJKA 3CZEA 3CHVA 2VYOA 1OEPA 4LRSA 4XAFA 3W1XA 5JBEA 4R7WA 5DMNA 1O4UA 3PAJA 1B3WA 1H7OA 5KETA 1JXKA 4XB3A 1KTCA 1P0KA 3LCHA 2EG8A 3WLKX 4O8RA 4PTNA 4FOKA 3GR8A 3O6AA 4CQDA 3DGRA 4KCTA 3W1TA 3A9BA 3R0DA 4OGZA 2ZTKA 2YLAA 4BQ5A 1GVFA 2NZLA 3UGRA 4QNLA 4NXSA 4D72A 1M65A 1QRQA 8CGTA 4M51A 3LN3A 3LLDA 2VFFA 2OMAA 3CZJA 3AICA 3VMPA 3JUGA 2GQ3A 3WLIA 1EYWA 3O6CA 4DYKA 1PVNA 3OP2A 5J5DA 4MVAA 4L65A 4XV0A 2E9LA 2GPTA 1T8XA 1WUFA 3N1AA 5DT5A 1OY0A 2PTZA 3MI3A 4JYFA 3WLJA 4JTTA 4GMEA 4UQDA 4WUIA 4OJ6A 1QVBA 4AZ5A 3VILA 2QPXA 3T0DA 1HNYA 2IS7A 3UEQA 3WNMA 3BV7A 3BCDA 3AC0A 2PWEA 1XXXA 3AIVA 4Z08A 1IF2A 4IIHA 1YEYA 1XRVA 4TVUA 3WQFA 2YFNA 3EDDA 1KV8A 1FWBC 4AISA 4CCEA 4QRNA 4C6CA 4BI5A 4PN2A 4QAWA 4AYSA 5FSDC 4B16A 3N3FA 3FKKA 1H11A 1PKNA 4QISA 5KZMA 2DUXA 3OZPA 4BA0A 3RJYA 5D8WA 2O9OA 5I3DA 3I68A 5D05A 1ZL1A 3KTXA 1O5KA 1VCGA 4XO7A 1JZ4A 2OEJA 1ONEA 5A2CA 2D2OA 2XH0A 1XDMA 4EAYA 2QW5A 1WZLA 1N82A 2QCGA 4BQ4A 1QASA 4OT7A 3UG3A 2Z1XA 1THFD 5AYZA 1W6TA 4FNSA 3S5OA 3WQ8A 4HPGA 4GYFA 2CBUA 3P7YA 1H51A 4LF1A 4GBDA 2D2GA 3COTA 4YCOA 2YGYA 4NZ1A 1R3VA 3P0WA 4C6QA 4DLFA 2VUNA 3EAUA 1U5HA 1SR9A 1T7LA 3C2VA 3ZJ7A 3I4KA 4Q8OA 2J8FA 2O56A 4M6PA 2W66A 3U7BA 3BZGA 2ZXQA 4RE0A 3ANYA 5CZ0A 1S46A 3AHVA 1T96A 1QHPA 1EQPA 1GW1A 3PZVA 4B9YA 3LSBA 3E0FA 4AX6A 4QDWA 1EKOA 1FHDA 3QSTA 2GQ8A 2YYTA 1FDJA 4GIEA 3QMRA 1AQ0A 3ZT6A 2CLOA 3U2EA 5BYWA 3UESA 4B3ZA 1LYXA 1EJ7L 3A4AA 3AWOA 2KZHA 4IPJA 1H0GA 3N2TA 2E8ZA 4PCNA 1KQZA 3HV9A 3HFYA 1JCXA 2WOQA 3MO7A 4B92A 1YU4A 3UWZA 3K8LA 3HN3A 1QW7A 1XLGA 2WCGA 4W5ZA 1EJUC 3DX5A 1GQIA 4CD8A 1TV5A 3UERA 5I07A 2DZWA 3RF9A 3IJ7A 4GQRA 3A47A 3UJFA 1RVKA 3ITGA 4MLJA 1O60A 1MDRA 2OPJA 2A6LA 4R5EA 2XPKA 2G3MA 3K4DA 1W8SA 3URAA 1RQEA 1UP3A 4JEQA 4J9JA 3MB9A 4V28A 4W88A 2PP1A 4UCGA 1DJZA 4EX4A 3O06A 2VJXA 3OHIA 1VQTA 1RPXA 2XZ7A 4AB4A 2FVMA 5CBIA 4A3HA 4BHYA 2V5CA 5CAKA 3ZVHB 3P61A 1XRTA 4GQ0A 1IWPA 3R0UA 1OM0A 2UY2A 1GVEA 4HHMA 4A8NA 1X6UA 3CNYA 3M64A 3FGCA 1C7TA 4MFEA 1RAKA 5JUVA 4AEOA 4O8AA 1XJBA 3BCFA 2JKEA 1HX0A 4WGHA 3LTSA 4P8UA 4G1KA 3NTYA 2XWDA 4GQBA 5M1TA 3TC3A 1LWHA 1J79A 2VVSA 4H6QA 2CHRA 1NY1A 4BI7A 2OYKA 4Z17A 3WBXA 2Y5EA 1PB0A 2E28A 1FXPA 3L2AA 1W5MA 2FIQA 5RUBA 2E77A 1XLAA 2QAPA 1CW2A 2A21A 1F4AA 4W9TA 1ZGDA 5M3WA 1VHNA 3O3RA 2X0SA 4H1ZA 2CESA 2WC7A 4DHGA 3AYTA 3LMZA 1PHQA 3SURA 1S2CA 1UOKA 1PBGA 1MFVA 4GIAA 4J3SA 4B90A 3RLGA 2DW6A 1US3A 1VFLA 5EA9A 4GK8A 3ITOA 3CL6A 1OYBA 2E09A 3NO3A 2Q71A 4W86A 3AZRA 3O2LA 4ENLA 5BW6A 2Y1HA 3LPOA 1U1UA 3HGRA 3PTKA 5BROA 1F8IA 3AZSA 1XLJA 1CXLA 4O1AA 2CLKA 2BGNE 1FWGC 3DFYA 3S1GA 2JE8A 1DJXA 5CPMA 4HYVA 2VL4A 1X8CA 3BG5A 3TC6A 5C70A 3DC8A 4FNTA 1TPWA 1NAL1 1KFWA 4MMWA 4HA0A 3NR0A 3Q37A 2HTMA 4R85A 3BZJA 2OU4A 3FDGA 3WYZA 3W71A 4C5ZA 3AQUA 2IPGA 1SZFA 5AC6A 3BL3A 3C6CA 3WQCA 3DBPA 4M7SA 4QTGA 3LU2A 2OLAA 5H8PA 4GABA 3E0LA 3DFTA 1W9UA 1JIBA 5A6JA 1BQGA 4JTHA 4DXKA 4PUDA 1MRQA 1VEPA 1MXSA 4Z1BA 3SCNA 2YA1A 4XZMX 4C6NA 4HNNA 1QAPA 4HN8A 1H41A 1W3KA 5C7HA 4GNVA 3GHRA 4EPKA 4FLQA 2Y2NA 3JVAA 3PANA 1QO5A 1W3LA 2XM2A 3NSMA 4DF1A 3H55A 1XLEA 1ODZA 3EPOA 2PFHA 1VFTA 1E4MM 3VIMA 1ISXA 4FNRA 4K7VA 1K7XA 4ZB2A 4DBWA 3NAVA 3W2LA 5AECA 5E93A 1LG2A 4Q8VA 1NJJA 1UD2A 1N8FA 4JIIX 1Q2SA 3DYOA 3FAWA 5E6ZA 2UY5A 1H2JA 1K03A 3E5BA 2PWHA 1XFCA 1CDGA 1TQJA 3HOJA 3HPZA 4MY9A 3NQFA 4C6EA 4S1FA 3SBFA 1JAEA 3QJAA 3V3WA 3P60A 4IG2A 3IUDA 1EGMA 1O66A 3SCTA 3K30A 1JF5A 4PCFA 4IFKB 3WBEA 3VNKA 1XYLA 2OWWA 4JTRA 3VNIA 4CD4A 1RD5A 3W1UA 3HGSA 4K8GA 1IHIA 2EHHA 1OCNA 1GJPA 4F8XA 3OQ8A 4KMQA 1BG9A 2PB1A 3C8NA 1A5CA 4CN1A 3QSRA 1H49A 3N15A 1EEPA 3S83A 5I23A 3I6TA 3G8RA 3SSJA 2Y8KA 5HBFA 3EWCA 3IIOA 1HN1A 4IP5A 2J24A 1R9YA 3EMQA 1XBVA 1RSCA 5CPTA 1V93A 2J74A 3BAJA 1ENUA 1HO4A 3GDTA 3NGJA 3LX9A 3WQDA 4P7NA 7TAAA 1LLZA 4NU7A 3TQVA 2P0IA 3U48A 1YE6A 3C0LA 4U5IA 4UOJA 2E0PA 1MNZA 3DN5A 2PGEA 2IQ0A 3VGBA 2XJ7A 3A5VA 2P8CA 2G5WA 4N4PA 1A3XA 1IT0A 5C55A 2DVTA 2HPIA 2QYGA 5LYRA 1AQHA 1W1A1 1KM4A 3OZMA 3ES8A 3ES7A 3IJQA 2XH7A 1E71M 2YCLA 4GYPC 4YWIA 3GTXA 5TNVA 5ABGA 5DBTA 5F1VA 5CPLA 2V5LA 3B40A 1GG1A 3W2MA 3GNXA 2J79A 4WJEA 3TQKA 3C2OA 3UY7A 1QOPA 2E6AA 1H8PA 4F2TA 2PDYA 4E4UA 3BLDA 4RV3A 1XFBA 3LQGA 1YMYA 1FY6A 1Q8JA 3MBFA 3JW7A 1IR1A 1R0MA 3UNTA 4YJ5A 4IBFA 3E1F1 4WVXA 3SQMA 1L6YA 3M44A 4DJDC 4CUCA 3PBMA 3S6TA 4WDUA 1Q6LA 4EKJA 3STPA 4XIAA 1C8VA 2BTMA 3W1AA 1JCNA 3SIZA 4K36A 3J7HA 2BWGA 2JEPA 2CBJA 3G1RA 3PWAA 2CCRA 1Z48A 2BODX 1VCFA 1RALA 3LI0A 1A80A 3VD9A 4MFDA 3SW6A 1PAMA 1E0WA 1W1IE 4JTLA 2I1OA 4U31A 1QU4A 1AW2A 1VBHA 1E6ZA 5AHIA 2F61A 3UR2A 4BK9A 2RUSA 2ZCGA 4JFSA 3C3UA 3KE0A 4FX6M 1WKFA 1BWLA 1AVAA 3CEUA 2JALA 3DU0A 4H6EA 4AG0A 1PHWA 2Z7GA 3G5EA 4TX8A 3CEPA 1ISYA 3WNPA 5ENLA 3OLGA 4AWUA 4WEVX 3M0YA 4PE8A 1LL7A 4A05A 3VD7A 1YTEA 5I0DA 3L65A 2XVKA 2PLKA 1W31A 1PDZA 4PMVA 1C7SA 3RU6A 3IJ6A 1TA3A 4WJ8A 2DUZA 1JGMA 3RR4A 3W81A 3II1A 1ODUA 1SJAA 1EBGA 3BWWA 2GJNA 1JL8A 1W3IA 1O68A 3LXBA 5CEWA 1FHUA 2H6RA 3DEQA 5FF7A 4QDMA 3QKZA 4U3AA 1Y0EA 2QDEA 1CNVA 4BR1A 4LBSA 3L4UA 2XIBA 2ZUUA 3HB9A 1FWNA 5I00A 3U2ZA 2H8ZA 1ECQA 1XIEA 4JICA 4MY8A 1XV8A 3FA4A 3BJFA 5G4HC 4S23A 4FF7A 3QF0A 4K38A 1OFEA 1KB3A 4H8HA 2ISVA 4LUSB 2CXGA 3SJ3A 3C61A 1H7XA 1WPCA 4XO6A 3N6QA 1VR6A 3ZIZA 1DJQA 1QI5A 3CQIA 3HG4A 1ZHAA 2XIQA 1J0HA 4PL2A 2Y88A 2F6XA 1M53A 3RG6A 5J04A 3BVJA 3INPA 3H7VA 3PZMA 5DBUA 1U33A 1CGWA 3WIJA 4DUXA 1AODA 5CZTA 4DNHA 4KBXA 4NSBA 3THAA 3CLWA 3QPEA 3P93A 3LDVA 3HFTA 4RJEA 2GQAA 3A4JA 2PU0A 2PU1A 3SEPA 1PEZA 3RO6A 4ZFMA 3R7MA 5K3VA 3FX4A 3PK7A 3ZOAA 1CEOA 1I60A 4H83A 2C1HA 5T9CE 3CUIA 2J8GA 2BBFA 3K46A 4L4PA 1B31A 3DUGA 4IBJA 3FAXA 1TPC1 3QHOA 4A8RA 4QNEA 3GAKA 5A8NA 4D2JA 3Q45A 5DXYA 2E9MA 3B05A 1H7PA 4INFA 3BLIA 1XWYA 4GPNA 2OODA 1GVSA 4UFIA 2FQIA 3QOMA 1JNEA 2P3EA 5EMYA 1MQRA 3VNJA 1H60A 4J40A 3W24A 5DANA 3GKFA 1E6QM 3KDOA 1JUKA 4GY0A 4MB1A 4QS5A 3AS1A 2WLYA 2V5KA 4UQCA 1DHKA 4KFPA 4E4FA 3L5LA 4NVTA 3ARSA 1W9PA 1EOKA 5F2MA 5DRCA 4MGGA 3MSGA 1M7JA 2FLIA 2XTKA 4CEXC 3DDMA 1W9BM 1E1EA 3AU6A 1F74A 3B8VA 3SCWA 2VEMA 3K4AA 1FQ0A 2HS8A 2ZX6A 1UR2A 3IARA 5G4EA 4DB7A 3OLIA 2D2JA 4WRHA 1ITXA 1TX0A 2NSOA 1ADDA 1XUUA 3VNMA 1BF2A 1TV3A 2E9BA 6TIMA 4AWEA 2ADAA 3LGDA 4PB3A 2P76A 4PUNA 1EA0A 1FHVA 3MC5A 3ATZA 4QEEA 2DSUA 3N9SA 4DWSA 1CB2A 5AVNA 1FWEC 2WVTA 3SCSA 1KA9F 1XLLA 3LOTA 2C8NA 4ZCWA 2ZC1A 2FFFB 2ATMA 4QJ4B 3AROA 3P0XA 1KKOA 2A79A 2ABBA 3M0ZA 3NZ1A 1R6WA 3UJSA 1VJIA 3H7RA 4OU1A 1XGZA 5EFDA 5HMFA 3VDAA 4CN4A 1MFUA 3QLLA 3HURA 3VINA 4HPHA 1UJPA 3MV11 4XD4A 3HPXA 2DORA 1PWLA 1WDQA 2Q09A 5FJTA 1H1YA 3ME3A 5FKYA 1TG7A 2C1IA 2BXZA 1J8VA 4PRTA 2VD8A 3PBGA 1F3EA 4JKKA 2Q8ZA 5EU9A 3PG8A 4GUFA 3DIPA 1OBAA 4HGXA 2P53A 4PTVA 2JF7A 4JKLA 3OGVA 5D8ZA 3H4GA 1AL8A 1ZJHA 3ZVIA 3ZR4A 1MUWA 4P5UA 3WEZA 3OBAA 3W7NA 1XF0A 2PLJA 3N19B 5KZEA 2J7DA 1IXQA 4PCSA 1I6NA 2ABAA 1J0JA 3ITYA 4Q8UA 3BSHA 3IAQA 5DCBA 3CPGA 3BCJA 1WBJA 3GFXA 2OKTA 4OV9A 1WDPA 3PVFA 1D3HA 1J0KA 4NASA 3W07A 4UTKA 3O07A 4W84A 4JQ1A 4OBRA 1VP5A 2AAAA 2XIJA 4QLJA 1KD0A 6ALDA 4EF9A 1F2JA 4NAFA 1BVZA 3I6EA 3CJPA 4UQAA 4YYCA 1PX4A 4DO7A 4IF2A 2WQPA 4MB3A 2H90A 2Y2JA 1YBQA 1A47A 4NNBA 1T99A 4CQ9A 1EWEA 4LYPA 5D03A 3ARQA 1F05A 1ECEA 1W32A 3WJZA 2GOKA 3TA9A 4KCVA 3E2VA 1KFEA 4ZXOA 3P3BA 3RLVA 1NTHA 1B57A 1W17A 2DVUA 2OX1A 3ARPA 4DUWA 4HNUA 5A8QA 2D24A 4KCUA 1KBJA 3GVVA 2GVEA 3BE7A 2EG7A 3SUVA 2Y2IA 3L9CA 2I56A 3S1WA 3LM3A 3W9ZA 4UTTA 3K2GA 3DKLA 2FGZA 2OLHA 3LRLA 3I65A 2XFWA 1EO5A 2ZUSA 2BZNA 2VTFA 1X38A 3MWAA 4FF5A 3JR2A 1NWTA 2FZ9A 1J11A 2QCMA 1SGJA 5FF3A 3AJ7A 3LXCA 1XM3A 1BXNA 2DJXA 4QX4A 1J2BA 1GKQA 3L4VA 3GU2A 2V6AA 4AZIA 1PKMA 4GY7A 3NQ8A 2PDNA 4MKNA 2VC7A 3S5NA 1I2OA 4ES4A 4OIFA 2VZUA 4AAJA 2VQUA 5FAJA 4AVOA 5DMMA 5EGRA 4LVGA 4R3UA 4U2YA 5MKGA 4GH1A 3HU7A 1SO3A 1XSIA 1UZDA 3GDBA 3V7PA 3WMBA 2QMKA 2ZZ6A 1JD7A 3KS4A 1UH3A 3EA3A 5FA5A 3EDEA 4YMZA 3A4XA 1Q8AA 2R1MA 3CTLA 4CCDA 1KR0A 4WXYA 3BLFA 2HVOA 4IPIA 3S9ZA 4MM1A 2FZBA 3AIRA 1JFHA 4MWAD 4L6OA 5BPVA 5A1AA 2CEQA 3G1FA 3EWBX 3AALA 3ZQ9A 3C4UA 1XLBA 4ZOCA 2CPUA 1RQHA 3LA4A 3ABZA 2PSNA 2E5DA 3AMKA 4PFMA 3KLLA 2RFGA 3S42A 1JYWA 3EZ4A 1EP1A 5A95A 3B9EA 3PZGA 3M0IA 4O4VA 3PBVA 1PTGA 2Z2AA 2PDCA 2ZRVA 1H0IA 4EACA 2UWXA 4DYEA 2ZWYA 2EXOA 1OF8A 1LP6A 4LCSA 4JHOA 1YX1A 1VEOA 4IIBA 2WWCA 4M80A 1KM5A 2DW7A 3VOCA 4HNOA 2TAAA 3NVDA 1XSKA 2LLEA 2XN1A 1BEUA 4NX5A 1QI4A 5CPOA 4AXKA 1W37A 2DY3A 1EP3A 2AGTA 4AIUA 1ZPTA 4NRSA 1PE1A 3G1YA 4A3YA 6XIAA 1GK8A 1ITUA 5G2HA 3QKEA 3LG3A 3SI9A 4IXHA 2IKJA 3VZZA 1E6NA 4PTDA 1NVMA 5T8GA 3BLOA 1DWHM 3W83A 7XIMA 4KEUA 4W8AA 3EWWA 1M7XA 3U4FA 2I5QA 2NT0A 1KM3A 3OB8A 3STFA 4LTSA 5BXPA 1VFOA 4PUEA 3MI6A 2JGQA 5D4YA 3LCIA 4G8TA 4W8LA 2GQ9A 3E49A 3H8AA 3LD5A 2GGJA 1YRRA 4IBGA 1NDZA 4PBEA 1DWFM 4ADSA 2XSBA 2Z28A 3PNZA 4GO9A 2R1LA 3S8HA 5PTDA 3OHMB 1I2QA 3P2VA 1AMKA 4ZSTA 4FR1A 1NIUA 2PWUA 3B06A 4MAVA 3CYJA 4NX0A 3T2OA 2BV9A 2X1RA 4ZSUA 3EPNA 4NILA 5HR7A 1JPIA 2D23A 2Q01A 2QCHA 1QT1A 4D1JA 4L1GA 4GVIA 4AH7A 2AMXA 1G7VA 2VEKA 3VGDA 3M7PA 1W54A 5CC3A 3A3WA 4W8BA 2FDMA 1VF8A 4HB7A 2BOGX 1S39A 4FS9A 4IUGA 2ZX5A 1RBOB 1E73M 1RP8A 1VHCA 4GNJA 4XIMA 2PF8A 3HV8A 4Z1CA 1A5UA 3UP8A 1UD6A 3ECQA 2PRMA 2OO6A 2V68A 4Y96A 1BVNP 3EA1A 5IHSA 1XICA 1W3HA 3BSMA 3NEVA 5I3IA 2QLYA 3TH6A 1RD6A 3M0MA 4N6EA 4TMCA 1S2WA 1AJ0A 3M41A 2DH3A 3DBNA 4MNKA 3GM8A 3IVUA 3BSGA 3R6IA 4F0RA 1S1RA 3WLLA 1O6IA 1I2NA 1E51A 5B7YA 1EF2A 5IDZA 1J12A 3ZWSA 3UETA 3PBYA 4KRTA 3TDFA 3UG4A 4X22A 4NZCA 2PDIA 3ARWA 2KX9A 1V6YA 4Q6JA 4D1IA 2OT0A 4ZFCA 1VBJA 1GPFA 4ATWA 4OUIA 2G4FA 2ACUA 1TE6A 1J96A 3U6WA 2IKHA 4XSLA 3WY1A 1UBPC 3WD1A 3REQB 5BNKA 4PMNA 4IX0A 2JGYA 3OGSA 1EYEA 3RCNA 4LUTB 4AC7C 1DJNA 3MUZ1 2ZUNA 5I3HA 2INFA 4Y9OA 2NVAA 5FJUA 2ZUVA 1IIHA 1SO6A 5DCDA 3NVTA 3P81A 3UU0A 4IQJA 4YVVA 2VZOA 2IPFA 3QR0A 4I9JA 1JDAA 1G9HA 5IXEA 1REQA 1BGAA 2OLSA 1Q6RA 1S2AA 5D2VA 4PRRA 3FA5A 3RHGA 2BS9A 4JGDA 4HZ7A 4WQ6A 4XSMA 1EHAA 1X96A 5AYBA 5FL1A 1ME9A 4AZGA 4E8GA 5G1YA 3MQLA 3WDJA 4ZQCA 3G2GA 3LPGA 2NV1A 1OCQA 3GU1A 1K7FA 3RR1A 1C8XA 2FJKA 4DJEC 4JZ5A 3ITTA 3EB3A 3PFMA 3M5ZA 3PUDA 4MWAE 5FSEC 2WW5A 3LS9A 1O5RA 3UGVA 1F76A 4A2SA 2Z25A 1IQ8A 1DQWA 3H2FA 1OC5A 4C6BA 1E40A 2A85A 2NUYA 2OYMA 1J6OA 2VEPA 4R53A 1QNRA 5LXEA 4YNGA 2BVYA 1C90A 1MXDA 1YTDA 3PN8A 1K9DA 4YTUA 1GJUA 3H2NA 1LRQA 4FA3A 2VDGA 2ISWA 1AFSA 4KGJA 2QS8A 2A6NA 4RZ5A 1TTJA 1SUXA 4ADUA 2TMDA 1PPIA 1TSIA 3N12A 2YXOA 3MA8A 2J62A 1JDFA 5I5RA 4JIHA 4HD5A 3QQ1A 4PEEA 3NM1A 3T0TA 4BF5A 3F4WA 3T40A 3VM5A 2G3NA 1XCXA 5DO8A 4Q7BA 3OVQA 3ZS4A 1NDVA 1W5PA 3MWCA 4A6GA 2CZFA 3IUIA 3PB2A 3SFWA 3WLNA 2ACQA 3APTA 2YL6A 3CMGA 1B3XA 3QBUA 3S6DA 2I9EA 3MYOA 3G6LA 3GLCA 3NO5A 5C8BB 3WLTA 4GI8A 4JXCA 4ORMA 4CVWA 1QK0A 5BU9A 4JY8A 2I57A 1V0LA 1E0XA 3T08A 1TPH1 3W25A 3I7RA 3WL1A 1PZ3A 1OB0A 2WM0A 3N18A 4DBSA 1L6JA 1WAUA 3JZEA 5AHLA 1V6TA 2XVGA 3UVAA 4YTRA 4GI9A 2JQXA 3WDHA 8A3HA 3AYRA 2B7NA 1JGIA 3B8UA 2OGYA 5LA1A 1I9CB 3HQOA 3O0FA 3JZUA 4Z0JA 2YA0A 2ZA2A 3QFEA 2XGIA 1ONWA 5EKYA 3NPXA 2YDRA 3A24A 2Z7KA 2Z24A 4L6HA 1D3CA 5HANA 1R8LA 2J9XA 3IGXA 4JN7A 3N14A 1MUCA 3NQAA 1R9ZA 3ID7A 5AHFA 3CUXA 1SZGA 5C2XA 5LIUX 1LT7A 1WXZA 1XC4A 2BSLA 2QUUA 2AKMA 1GWJA 2Y7GA 4TV6A 3UWYA 4HU3A 3G0XA 2QVNA 4BWLA 3S46A 1SZRA 4ROPA 1YDVA 1TJPA 2BLEA 1HIZA 1XI3A 1UJQA 1A5LC 2PDGA 3W1PA 3O6YX 1WDSA 4REQB 5HOSA 4MOZA 1IXOA 4L1XA 4B4FA 1FH8A 1PZ1A 3MUY1 3AWNA 4WK9A 2XGBA 4KEMA 2WO5A 5HA7A 3RGTA 4JBRA 1UC5A 1OWQA 3F03K 4FI4A 1PIFA 1I1WA 3RJXA 3ICJA 3AFBA 4K3ZA 4HMCA 1V3HA 2ZOXA 2JBMA 3FOKA 4GUHA 3EKZA 5BMXA 1PV8A 1GUVA 2Y70A 3HPFA 2EBNA 5KZDA 8TIMA 3W2JA 3W4RA 1TWDA 3MS8A 1Q7ZA 3LLFA 3B8DA 1R3WA 5E0CA 2ACRA 1UMLA 3SFKA 2BHUA 3WK3A 3DHFA 1PCKA 4GIYA 2WPBA 4WF7A 2PGFA 2Y2GA 4H2CA 3BW3A 4AHPA 5IFPA 1WUEA 4I7VA 5ABFB 1RQBA 5IDIA 2CZ5A 4JDYA 1OK6A 4CCZA 1OYCA 2V5BA 1TYGA 3SRFA 4LS0A 3WZ0E 2Y0FA 1EXPA 3YPIA 3GXMA 3DKJA 5D2TA 3TV8A 1O95A 1IR2A 1NDYA 3W0KA 1U22A 1AA1B 4LSBA 3I10A 1ZQ5A 1HXJA 4H7CA 1PSCA 3GX9A 1HJSA 3KBMA 1V0KA 3KW3A 1LJYA 3VGGA 1JYXA 1BXBA 3WD4A 3AIBA 4MNLA 1JVNA 5AHNA 4LT9A 4LJ3A 3AXMA 4Y9PA 4Y9MA 2ZWZA 3FXGA 4PC8A 1W1ZA 4FNUA 3EMCA 3HQ1A 3VD4A 2WANA 4PUUA 4CVUA 4KF1A 3TOYA 1R3QA 3CUGA 4ZA0A 3O9NA 1J6PA 4AYGA 4YHGA 4IXXA 5C54A 1OT2A 3KLKA 4MKSA 1ZFJA 3AO0A 3O05A 1XBXA 3P5YA 4G9PA 3EOUA 3LXAA 5DY2A 3AIQA 1KRBC 1MW2A 4IPLA 1ZALA 1XYAA 4QXIA 1QNSA 2DZAA 2XIMA 3BOFA 4X2RA 1QWGA 3VGFA 1FFRA 1TV8A 4I5UA 1EA9C 1P4CA 1OX4B 1P43A 3VKBA 2CYGA 4XTIA 4Z2HA 1G67A 1H5YA 2FGLA 2Y89A 4RK8A 3W1LA 3W7KA 1B2YA 4DXXA 4W89A 3TU9A 3W7CA 2QCEA 1A53A 5B80A 4M24A 4ZQRA 4AEFA 2P0OA 1WXYA 3UJRA 1ED7A 1W9DM 6REQA 5DELA 5EB8A 4PUMA 4C6DA 3TSBA 4AVNA 1GZGA 1K3UA 2VR5A 3VE7A 2EGZA 4LAMA 3VNLA 4MKVA 4ZL1A 1CGUA 5CKSA 4UIOA 2HXUA 4GG9A 4DBEA 4JS3A 3TJIA 3KOYA 3QN3A 1EGVA 4ZQNA 5DRIA 2BG5A 3R8RA 3VKDA 4AIEA 2NWSA 5H91A 1DXIA 3TYZA 5CQ1A 5I02A 5ECUA 1QMLA 3WQ5A 1OABA 1OD0A 1UG6A 3H2AA 4GYJA 3OBKA 4DZ5A 1QK2A 1NARA 5FI8A 4TO8A 3I6RA 2Z4GA 2EKGA 3D6NA 3MZ2A 4K2SA 3NQ7A 4GUGA 4GIRA 1TPEA 2QQ6A 4NJGA 2CLLA 1TPDA 4RV8A 3MSDA 2PWDA 4WDXA 4C60A 1MQPA 3B9OA 4MWAC 1L6FA 3KZSA 2HNHA 2WVVB 3H6OA 1PXGA 3QVQA 2AMGA 3VIKA 3T09A 5BWFA 1KBLA 1RLDA 1JZ2A 3BW2A 3WLOA 4LY4A 1EF3A 4BQ3A 2FB2A 3NZRA 3B0PA 4PB4A 2B0MA 2GDUA 3SRHA 4E2BA 2YZ5A 3QOKA 2I7GA 2XVPA 3UYIA 4XZIA 1UPMB 4ZE5A 1UWSA 4F0HA 2IMRA 3OW1A 2GGGA 1S2UA 4FX7A 1BPLB 4J2PA 4JYDA 1FHLA 1WZAA 3DYMA 1Q6EA 3E0WA 1SR0A 1MXGA 4HK5A 2G8ZA 2O9PA 5LIKX 1KGWA 1FFQA 3W70A 3LYEA 4YU1A 2FGBA 1TPVA 1W0MA 1K77A 1EC7A 1FWFC 3WQOA 2E5CA 2O4MA 3A6OA 3WQVA 4PMQA 4PCPA 3IK2A 1GYLA 1EUAA 2OSYA 4HYWA 4PL1A 1YADA 5FJPA 4K7YA 3GR7A 3VAVA 2WNZA 1VB9A 3ITLA 2ODOA 1EL3A 5IRPA 4ZO7A 4C7DA 3C86A 3UPBA 2NX9A 4GZEA 5XIAA 2B7OA 4GACA 4EPBC 4Q8NA 1GOOA 1B54A 3O6DA 4HHHA 1KM2A 2BP1A 3PBUA 1LOQA 3N04A 4JTCA 4GC4A 1QBBA 3ZM8A 3RLHA 3AHYA 5DT7A 4W4QA 1HGWA 4B15A 3P8JA 3S3GA 1E4NA 1Q7QA 2OX4A 6A3HA 1JPKA 1P1MA 4ILSA 3WUGA 1A50A 5HJLA 2WQDA 4KRZA 5CSUA 1B1YA 4O18A 3TC7A 1FX6A 4GRSA 4HK7A 2UWFA 3O7UA 1UWIA 1W3NA 2PDLA 1RJQA 4HP5A 2WB5A 3P67A 3SCRA 5BXTA 4AD0A 1MO0A 3GD6A 4GX9A 4M82A 3W22A 1S5VA 1ICSA 2WJEA 1ZTVA 5EBAA 1NFGA 4EF8A 4FNPA 2PDBA 2CU0A 4HJWA 1KFBA 2YOCA 4XQ6A 4UTFA 1UD8A 4XAPA 4JTGA 2WXDM 2I14A 1AQMA 3GUWA 1SJDA 4N9CA 1DXFA 4E6MA 4C1NB 1SSGA 2AQVA 2NX3A 2R91A 4J5NA 4MUZA 3W1MA 4DZHA 3PZTA 1XL9A 3BG3A 2NQLA 4N9BA 4P8WA 3FJ4A 3V5OA 2HROA 2NVCA 4JPGA 4H7VA 1EB3A 4NIRA 4I9MA 2VKZG 4WY0B 2GWNA 3LV6A 3SR7A 2I5IA 2DT1A 3GNOA 1J9YA 5M17A 1SU5A 1ME8A 1KFLA 4FOUA 1Q4NX 2AGKA 3UG8A 3UZ5A 1TMHA 3QTPA 4R9XA 3KBJA 1BYBA 4IBCA 4QJ5B 3WK0A 4XTDA 4Z0SA 2EJAA 3CYVA 4GISA 1AIWA 1V77A 3OG3A 2O7SA 4K1WA 2C0AA 2QF7A 3N4FA 1DIEA 5BXRA 5BOFA 3IUHA 2YFOA 1XC6A 4H00A 2W61A 4M6VA 2FH8A 5GVJA 2V3FA 1SFLA 3W84A 4NP7A 3KL3A 4ZMGA 4US6A 4AUBA 2GGHA 4OFCA 3F4DA 1XIFA 3TX9A 4B2DD 4ZE4A 2YCEA 3PJUA 3FHQA 2DZTA 3UNDA 2QCDA 2NQHA 4L56A 3KTCA 1OVDA 4M5PA 4H6KA 4OBTA 4DO6A 1V3MA 4MTVA 4J3WA 3SUUA 1JZ3A 1DPMA 1UR0A 1OZMA 3Q4DA 4A3RA 1F3WA 1Z89A 3G1AA 3QPYA 2FTWA 1PZ2A 3MUIA 3N3MA 1E0TA 1LG1A 1W9VA 2PS2A 3P80A 4RE2A 3VFLA 3D46A 2HXTA 1GYMA 1N7KA 4O53A 4UQ9A 1TTPA 4IGMA 2QJGA 1QWKA 3N4AA 5AYIA 1DP0A 1ML1A 4P61A 4MNJA 1XIDA 2FFIA 3W7GA 1UD3A 4UTIA 4H7ZA 3G3DA 4GUJA 4H41A 3FLUA 1OFRA 5D32A 3OVGA 4QROA 2ONEA 1GOQA 3OIHA 4AX7A 1N55A 4UR9A 3UWQA 1KC7A 1UMYA 3TN4A 3DESA 2QVHA 3NXFA 5FCZA 4E3VA 3WH9A 3ALFA 1JUEA 2EPOA 4LYRA 3ITVA 4ZB5A 4FR6A 5IBXA 4CNTA 1VKFA 3TR9A 1C8YA 2X42A 3HZ3A 3HO8A 1J18A 3AMCA 4UTUA 1GONA 5E1QA 2RJHA 3NPWA 2ZRZA 4DO5A 1CLXA 2WNQA 1SJBA 3C2RA 2IUZA 3M47A 1VZWA 5GJPA 5CSRA 1BXCA 1O1ZA 1DIKA 3CO4A 4LAZA 3TTOA 4BY3A 3VUPA 1UYQA 1NOUA 2XIIA 2ESCA 2PGWA 3G18A 4QQ3A 4DO4A 4A2RA 3SUWA 4MPQA 2ZRYA 5BCAA 1PUDA 1Z41A 3WF1A 5GPRA 3V35A 1W91A 3KP0A 2UV8G 2ZE0A 1NP0A 4DPQA 4IFRA 2VENA 3ZJ6A 2V82A 3W37A 2QT3A 1XG3A 4UQEA 3KCLA 1A5MC 3BJSA 4LVAA 2WMIB 2B7QA 1GCYA 5FJRA 3WFLA 5E9XA 3B03A 1XYBA 3GXNA 4NJIA 3HIJA 4LEQA 2R94A 5E5CA 3PULA 4I8DA 2P5NA 2DZSA 4H19A 3FS2A 3S0CA 3WDQA 2GLKA 3V36A 4M3PA 3GXFA 3M0KA 3OU8A 3MP3A 4FLOA 3WQ6A 4GC3A 4XBSA 3CL8A 3CGTA 5IOBA 3R12A 3G1SA 3FKEA 4N7QA 4QJ3B 2VGIA 2FYMA 2VX7A 3AAMA 4DNMA 1SFJA 3SCOA 2XYLA 3APGA 3EX2A 4XZBA 3FEQA 1RLCL 1FWDC 4G7EA 3KOWA 1QDSA 2EEXA 3OEXA 5HQEA 3CXOA 5HUOA 1ITQA 4NZFA 3TTSA 3NQVA 3CHEA 1IXPA 4LEFA 3STCA 4PMYA 5G5IA 4MJ2A 3P74A 3AISA 4HA3A 5KITA 1E9YB 3OPSA 1UQYA 1K9EA 4PULA 3QFWA 4F3HA 4CCCA 3M4HA 1NFBA 1XYMA 2J7FA 3K5XA 2Y7DA 3F2DA 3APYA 1FWTA 1F3XA 5HR6A 3BAYA 1DYSA 1UWAA 4DUOA 4Q7IA 4XKMA 1IYXA 5LIYX 4CN6A 3PY2A 1JXJA 1CB7B 1KS0A 3MV01 1DJIA 3OGRA 5KMYA 3UA4A 3N9KA 1VC4A 3W1QA 4GH9A 4LAUA 3DAQA 3UPMA 1Q6QA 4OV4A 4KFOA 4AZBA 1H09A 4S3DA 4I9AA 3WEOA 3GW0A 4GHAA 3KBNA 2VRQA 5CLWA 4ZGYA 4S3BA 2CXEA 3CU2A 3RM4A 3VTRA 3M9YA 2J7CA 1S5TA 1UR4A 2J66A 5H6HA 3T78A 1GKPA 3VCRA 2VM8A 3SAZA 1IEVA 2OTDA 4L9XA 4W7WA 4W87A 1J01A 2YB1A 1TTIA 1E56A 5DF0A 1TIWA 4XZLX 1W8GA 1R3YA 1U83A 3S1VA 1SO4A 2FFCA 3URQA 3L12A 1FKXA 3VX1A 5AHMA 1XLDA 3HBLA 4IUOA 1SSDA 4L7ZA 1HKVA 3GXDA 3OLEA 4Y9NA 3W00A 4NZ3A 4WY0F 5DCEA 1Z6KA 4OKDA 2Y5JA 1ZBWA 1NQ6A 5TAOA 3VC6A 4ADTA 2A3LA 4F40A 4AD1A 3NZQA 3ITXA 4WDTA 1R85A 4XZNX 1AQFA 1R46A 1FDZA 3CS2A 3ABSA 4UXDA 1X7IA 2VUYA 4IQEA 2G4JA 4JTFA 3CV2A 1GQJA 1GKRA 4G2DA 1R87A 2ATSA 1WV2A 4S3CA 3DFPA 1CIUA 5K9DA 1IEIA 3T7VA 4R7JA 2WSYA 2QJIA 3ZR6A 2D20A 2PDPA 4DPPA 4S3AA 4FIRA 3GVGA 3HF3A 2ZA3A 3IJLA 4HK6A 4L4MA 3SGUA 3W6YA 1XIIA 3FSUA 1TFVA 4JIQA 3PFRA 3WD0A 1VCVA 3GR4A 3O1NA 4WR3A 4EWND 3IV3A 3MI2A 1I75A 3TZFA 3FGCB 2J25A 2XFYA 2OQYA 4Z1DA 3S1XA 4ALDA 1TZZA 2C1GA 3E74A 3L66A 4TV5A 4ZOEA 1OCBA 4F2UA 3M07A 2BY1A 2WKGA 1IZJA 2FKPA 4HT3A 4IIDA 3NIYA 2JFEX 1YPXA 4PTXA 1RP9A 3GUGA 5TF0A 4YIWA 1E6RA 1YTKA 3QXBA 3NDOA 1QPRA 4ICCX 1Z3NA 4J7RA 3KS8A 2Z2BA 1XD0A 5JH1A 3EEGA 2EPMX 5B7ZA 3G1DA 1XIMA 2BGQA 5FACA 3W29A 3WF0A 2C15A 3GBEA 1RA5A 3R2GA 3BC9A 3TP4A 4IFOA 1Q2RA 2CZVA 1OC6A 1VLIA 4H04A 2WSPA 1Q6DA 4H9MA 5LIXX 4L1WA 4K39A 4J3VA 2PLCA 3WD3A 2FPTA 1W1YA 3NCOA 3BGGA 3V5FA 2PBOA 3H24A 4ORIA 1HGYA 4D8AA 4WX2A 3GTNA 2XHYA 3QHNA 4U4MA 1T41A 4W93A 4DJDD 4RDWA 3PWGA 2NVDA 2NQJA 2GK1A 2RH9A 1JEZA 1P1XA 1G0CA 5FEXA 3WF4A 3RIKA 1UIPA 2Y7FA 1RHCA 4JAWA 5M5DA 4S2BA 4M6UA 1H63A 4R88A 3HJZA 2VOMA 3RMJA 1BD0A 1YHTA 3LPFA 2X40A 3HA1A 4CU7A 3UCDA 3ZMRA 3W74A 4B5NA 3WJYA 3ZYZA 3KCJA 1C93A 3WX7A 2WZIA 1HL2A 4CNNA 3MCMA 3BLLA 4U3CA 2FVLA 4IMAA 2VWTA 4FXRA 3VYLA 5BRBA 3VABA 2DGAA 3CAWA 4G6CA 2PTWA 3NSNA 1UA3A 4L9YA 3WDPP 3U4AA 3F4VA 1EQCA 2PDJA 2PGRA 4DJDA 5I3FA 3B4YA 1G6CA 2PDMA 2CC0A 2VZSA 1CYGA 1XPGA 4O28A 4V27A 4DJFC 3G1XA 3QC0A 1UKOA 4NHVA 2X16A 1BSIA 1P48A 3F1QA 3KBSA 4MIMA 3TJXA 4UR8A 1RUSA 4BJHA 3T42A 2X1SA 4JIPA 5G4WA 2G97A 2W91A 4HTYA 1EDGA 3ZSTA 1W3JA 1L0PA 3D3AA 1PYFA 3KP1A 4JQAA 4LCQA 4IG2B 1Y5XA 4CQCA 1F6KA 5LNVA 2DEPA 2JKAA 3VDCA 4UTMA 2E6DA 5C5YA 2IKIA 3OYXA 4Z2LA 4C6FA 2CKSA 2CZDA 4WKHA 2W6RA 3UFYA 1SYTA 3BO9A 3U9IA 1A5SA 3OBEA 3C2FA 5HK4A 4G1NA 3IJIA 3V16A 4JTQA 2QCNA 1ZAIA 4JX5A 4FXSA 5AC5A 5EY5A 4UUIA 2PP0A 3OIXA 3BLPX 2OB3A 5AOUA 4O0ZA 3ISIX 3HG2A 2VGGA 3ARVA 4UMCA 3BUVA 1E3ZA 3MHUA 1DWIM 5MHBA 5CC5A 2QPUA 2ANUA 8RUCA 3TTYA 4UTHA 1KBBA 1MUMA 3KX6A 3NQ2A 2W3ZA 2ZX7A 3WH6A 3T81A 4D9PA 4ZENA 3UG5A 3WLPA 3WDIA 3GWQA 1OCJA 3B9DA 2VFHA 4LY8A 3F4NA 4Q4PA 1MVYA 2V5OA 2YCLB 3B4UA 2NV9A 2FTPA 2ZVIA 4J27A 3GHUA 1SW3A 1MMFA 4O14A 1LM1A 4NKCA 2ZDRA 4ZQPA 2Y62A 1XIGA 1LBFA 4EXBA 2HK1A 3WH8A 4QITA 2O7QA 3FYOA 2QCLA 2J7EA 3CUHA 1NF0A 1W1PA 4GKLA 5I2UA 3K4WA 1P6WA 4QJ1A 4O15A 1YPIA 4C6MA 1W5QA 5IBXC 3DYPA 1DHPA 3ARYA 3VMNA 2CLPA 2VGFA 2OQHA 5FF4A 2BHYA 1TJ2A 5EL1A 2YLLA 3C8FA 2YKKA 5D09A 1GOKA 2V2HA 4AW7A 2E40A 2W67A 1QHZA 3PSWA 1UH4A 4ZVJA 1XH0A 4XX6A 2IQTA 5L6UA 2AL2A 2WMHA 3O63A 1K8YA 3LHUA 1TV7A 3MW7A 4TQTA 5F4WA 4EANA 2PC8A 3NA8A 3S9IA 3HGOA 4WOQA 3REQA 5I3JA 3ARRA 2R24A 4ICNA 3VIHA 3WG6A 3VIOA 4EK7A 3KOFA 2XN2A 4LUTA 1LTDA 4TU1A 2WCSA 1BYCA 3L4TA 2XH4A 1XD1A 3QHMA 5CBJA 1IIGA 4H9ZA 2QEZA 1ZCOA 2YBUA 4PTWA 4H2HA 3UT0A 4M81A 2QJHA 1TIMA 1UWQA 3LI1A 4FB7A 4DZAA 5C7VA 1E43A 5EBUA 2YA2A 2ZIDA 3LUTA 4H3DA 4MYXA 4PH6A 1A4LA 2HCVA 4RNFA 4M19A 5CG7A 1TA3B 4RDZA 3CT2A 4XWUA 3VE9A 2PDXA 1PO9A 1SJCA 3PTMA 5EMLA 5CCZA 1J10A 2VDHA 4Q8TA 1F73A 1ISVA 2C13A 4BFAA 1B90A 2WNWA 3BH4A 5D2WA 1M41A 1U5VA 4LG2A 4NAEA 4E5TA 1B0IA 5D37A 4ECLA 1OG0A 3GKAA 3B8IA 3D5HA 1OC7A 5LXXA 1UZHA 3NO1A 4UZUA 3MMWA 1ZY9A 3GO2A 4HSNA 1UUMA 5D30A 3R4IA 4M8UA 1WAWA 3DG6A 2OVLA 3A5FA 3IGHX 3LB0A 3T1GA 1M7OA 1EX1A 4LWWA 3ZLGA 1FWJC 4GFSA 1G1YA 4Q7NA 3BAWA 4FK9A 4LYQA 2ZRXA 2ZDSA 4K8HA 1CX9A 2QCFA 4DM1A 4Z1AA 2WYSA 4YTQA 4PMUA 2WNNA 5A2BA 2QR6A 3WN6A 3RFAA 1O1HA 2J9YA 4LOCA 4DY1A 4B5XA 5LNUA 2ZZ2A 2QF8A 1LQ0A 5FL0A 4NJHA 2OWXA 3QMTA 4O11A 4RCXA 3SCQA 3TMQA 4GNKB 1QHOA 1VEMA 3U7VA 2VRJA 1EXBA 4CNSA 7A3HA 2VHLA 3EXSA 3PTQA 2PRLA 3EOSA 2Y2LA 3WNLA 1JCTA 1GXDA 3NYZA 4IIFA 1Q65A 1SVDA 1PDYA 3DFNA 1QTWA 1AMYA 3M0VA 3TYUA 1NWSA 4PMXA 4O0QA 2R14A 2JE5A 1WB0A 2C7FA 3IVSA 3ZT7A 1B4KA 3TJLA 2ON3A 2MNRA 3IACA 1VRXA 3W26A 2BOFX 1P7TA 4QAIA 4CLMA 1XIBA 3MKKA 3GE7A 1FKWA 2QIIA 2ZZ4A 3PBWA 4C6IA 3OJGA 1QOQA 1C92A 1HP5A 1XS2A 4NY2A 4LU0A 1AD4A 3G0UA 3N25A 5C71A 2G3JA 3UWWA 4HOXA 2ZRWA 4FXFA 4JL2A 4GH3A 2D3LA 2VT0A 3R43A 4GCXA 4DWSB 3GVRA 1GZ1A 3KBWA 4RZ6A 2OSWA 1XIJA 4XZWA 1X6LA 4M0XA 1N8WA 4YS1A 4NXKA 2YZRA 1ADSA 1UD4A 3U2CA 3M0XA 4TTUA 3E38A 3CZGA 3GH7A 2FPVA 3T0AA 3QW4B 3GRIA 3MCNA 1POJA 4ATDA 4NJJA 4O1DA 4UTWA 2V63A 3EWDA 2DT0A 3SECA 2Q3OA 3W88A 4LVFA 1AW5A 3HM7A 4ZO8A 3PNUA 1UH2A 4JTUA 1B3YA 4QHRA 3VXGA 1W9XA 1UWRA 5ABHA 4CU6A 2XINA 1POKA 3G77A 2QHAA 3B97A 2PMQA 4D6GA 7REQA 2ZVRA 4GVFA 4Q8PA 2NW0A 3RCYA 1FWHC 1RY0A 1UOZA 2YIHA 4X2PA 5K4XA 4PMJA 1Q7MA 1JF6A 4JNZA 4FZIA 5DXXA 1GG0A 1H5VA 1U30A 2TSYA 3B0YA 1MZHA 3RRAA 3IGSA 4IP7A 3CPUA 4GCAA 4MADA 4UZSA 3UXLA 1R2TA 1VLWA 3MO4A 4XZ9A 5I78A 1NDWA 5CG0A 1YQ2A 4W85A 3U5UA 4I90A 4ZXLA 4L80A 3L23A 1TELA 1WKYA 3GIPA 5JMUA 2BFGA 4PMRA 4NT0A 1US2A 2GOUA 5GNYA 4TTGA 5I06A 1E70M 2FVKA 2J88A 3TNBA 1VRDA 4DX3A 4DBUA 4K37A 3CPRA 5HNUA 2FMOA 1WOBA 1QJWA 1EFZA 4NAFB 2O4QA 3QW3A 3OLDA 1DTUA 2QNEA 9XIMA 5I09A 2DDXA 3MUCA 1FUYA 2ZTJA 1KW1A 4CGTA 4YCPA 1WKDA 1P6CA 1K70A 4H9TA 2WSQA 3IAPA 1E5JA 2J4GA 1CTNA 3MVTA 3UW6A 3LHTA 4D6HA 2A4AA 4HU4A 4JTSA 9XIAA 1XYCA 5U4NA 3ARZA 3NQCA 4WDWA 4Y8FA 1AW1A 3KHJA 1VBRA 5K4ZA 4GWEA 4NNAA 3T07A 4PB5A 1E88A 1H1NA 4ROQA 1GTEA 4OJLA 1X97A 2FB3A 3TLLA 5G2WA 1BKSA 2HE5A 3QV7A 1A5NC 4C90A 1P0EA 4KFNA 3TK7A 5CGMA 2WLZA 1GOXA 3GQYA 3W27A 4IZGA 4HZ6A 1Q5MA 3BK0A 4GKTA 2ZYFA 1DIDA 4JCMA 3ENLA 2O55A 2FDSA 5AKQA 2XWEA 1EPVA 4OQVA 4OJ5A 3N34A 2QUTA 3WNKA 1Y5VA 3LEPA 4H9VA 1LBLA 1EJTC 2RAGA 3MBDA 3E96A 3N2BA 4HCHA 1KCKA 3WF3A 1OX4A 3AHZA 1ZUAX 1VJSA 3TOPA 3PB0A 2X1IA 3O0KA 2X7VA 4F9JA 4MYAA 1WXJA 3BANA 2VELA 1RBLA 1UKQA 1ZAJA 5I03A 4C6OA 2B7PA 4ZZ9A 1I8JA 4HMNA 1OF6A 4O12A 4MJZA 2PODA 1EAKA 5CPQA 4EPDC 5MKGB 3TXVA 1C9DA 4TVDA 2WC4A 3N29A 3L29A 3QPZA 4PEKA 3PC0A 1QNVA 4AY1A 3I7SA 4U5KA 3NGFA 4P8XA 4PRWA 2WJFA 1GT8A 3A3HA 2QPSA 1JQXA 1EH9A 1W56A 3AUOA 2D2HA 4BF9A 4EXAA 2WKLA 1TCDA 2XD1A 1ONRA 2E6FA 5CC7A 3CTTA 3SO7A 5AYYA 1Q66A 4JTDA 1D7KA 3GDRA 1S2VA 2J7HA 2REQB 2OELA 1H7NA 4RXGA 3ARTA 3WO8A 5LA2A 2WVVA 1J0ZA 2G95A 1V6UA 5C9RA 5K9CA 3LCLA 1VFHA 1Q45A 3BPWA 1VAHA 3G22A 3MP5A 3FKRA 2NQ5A 1EUNA 1MDLA 1CXWA 1HVQA 2PEVA 3LM7A 4G5DA 1MEHA 1LT8A 1WA3A 2F84A 4DJED 2OO0A 1V3LA 3PG9A 4HSHA 3PPHA 4UQBA 2OZ0A 4RXFA 2Z26A 3VNDA 4E3TA 1T8QA 1KWGA 4ZQMA 1BG4A 1OIFA 4XAGA 1GZJA 1N8IA 5IM51 5FEWA 3UD6A 2PD9A 4HBKA 3NPUA 5CZKA 3UXAA 3V0SA 5A8MA 1XBYA 1TR9A 4TXEA 4JR5A 1V3IA 1Z42A 2XUCA 3DFOA 4GYKA 2Q3RA 5BOEA 5D9PA 4UFKA 2QIWA 4HQVA 3QRHA 1TR1A 3SQSA 2OOGA 2QUMA 4TIMA 3AXKA 2BY3A 3P5ZA 3GK0A 3ANVA 1JPHA 1M01A 7ODCA 3LPPA 5F2LA 3CHFA 3V4BA 4DJEA 2NV2A 1K1DA 1GQKA 4R33A 5AC7A 1QO2A 3ZO9A 1PKYA 1I4NA 3PS7A 5CJNA 1JRCA 2XSAA 3DGBA 1LBMA 3DECA 3VOFA 2QKFA 1U1HA 1UIOA 4KCWA 3QH2A 5HMEA 3W28A 4Q22A 1NWUA 1DORA 1M3UA 3C52A 3LBOA 3MKCA 2G0WA 2GUBA 1ZS2A 1R2RA 4XAYA 4HNTA 1RH9A 4O4WA 5HNNA 1VH7A 3WMCA 2YW3A 3F5KA 1JNDA 1JAKA 1AK5A 4WIWA 3LHYA 3TSMA 1OX5A 3CUJA 3W86A 2VR2A 1FOBA 1DWJM 5A3HA 4K1GA 1CXFA 4LX4A 2NX1A 5A69A 4Q4KA 1XW8A 2JIWA 2BX7A 2X8RA 1FP8A 2ZUTA 1BWKA 2HVMA 2PF0A 3HQNA 2I5GA 4C1NA 3TAOA 3TQPA 4FPSA 3H21A 2OOFA 3B8TA 1T0OA 3V75A 4DI8A 5J8LA 5CSYA 4EXQA 5FOOA 1KLZA 4N6FA 3TLQA 1C3FA 3ZFHA 1LL4A 3Q2DA 3ONBA 4ICMA 4G56A 1GHRA 2BASA 4WY0A 4LS1A 4MSSA 4DQWA 1E9LA 1UKSA 3DH7A 1MRAA 1JYVA 1FP9A 4DVOA 5FF2A 5GJNA 1RJRA 2GZXA 1GNXA 1E0UA 4GI6A 1X98A 3M16A 1Q6GA 4XD6A 3IK4A 5F7UA 2ZXAA 4HIBA 4HNCA 3GC5A 3PHAA 1GEHA 3L4WA 1QO6A 3CO8A 4LFYA 2P3ZA 2G96A 2NXHA 1DV7A 2GSHA 4ERIA 2QJMA 4UCFA 3M6YA 4A22A 2PCQA 3RN6A 3BAXA 3TKFA 1SFSA 3VOHA 1HZYA 5BZAA 4HNLA 1KXHA 4QG9A 1RK5A 5JVLA 2P10A 4LBRA 4F48A 3RU8X 3T05A 1REQB 4GGBA 3TJ4A 3TONA 4QM1A 4L61A 4P7LA 4YTTA 3SY8A 1D3GA 1JDDA 1FWCC 4UNLA 1L2UA 2V67A 1GYNA 2PD5A 4HPXA 2VVNA 1Z8AA 3GNPA 1V03A 4TX9A 2PPGA 2Y6ZA 1MSSA 3CWNA 1YXCA 1E6PA 1B30A 2O0TA 3W7QA 2D1ZA 2D49A 4Q4MA 3AIEA 3QY7A 1FWAC 3OO2A 5G2IA 1IV8A 4LAOA 1U2YA 5D02A 1G94A 1I0BA 3W73A 3BGJA 3G8EA 4Z2GA 1NH6A 2ZZ1A 3NM3A 4AXNA 1M6JA 3TN6A 2YX0A 4PCTA 3TYEA 4LQ1A 3TN5A 3AMLA 3EB4A 2OKOA 1L6WA 5DMYA 3LHZA 1FWIC 4EP8C 2Y85A 3AZTA 4J3UA 1DE6A 6XIMA 3KWXA 2E8YA 1WKEA 5FF0A 4X63A 4UTJA 2BY0A 2A3HA 1DJHA 3WD2A 2NXGA 1H50A 4LV4A 3LGEA 3AYSA 5HPCA 2XM1A 2HPMA 1RV8A 3AHTA 3S6OA 4LS2A 3C0JA 1SW0A 4JIEA 4RNJA 4LC6A 3TYDA 1KM0A 3U0HA 1PIIA 1Z9AA 5AYXA 4HPJA 1ZP4A 4OBSA 2ZKMX 1UW9A 2PDHA 2W92A 2PTYA 3WF2A 2Y61A 4XZHA 1NP2A 3IV8A 3WUEA 3B04A 3LTYA 2FH6A 2QV4A 3L2LA 3TVAA 2DH2A 3GSMA 3ZLFA 3H23A 1SZEA 4C65A 1C8QA 5A6LA 4E38A 3FVMA 2VI0A 2OSXA 5FEZA 3VIIA 4KIEA 1TPFA 4Q33A 2RDWA 4HJFA 1H1ZA 5D9OA 3G24A 2C6QA 1OSEA 1KCXA 1G4TA 3KHDA 3GIYA 4B5UA 4D6EA 1NEYA 5CJ5A 1XPYA 2A0NA 4WZHA 3VNYA 6CGTA 4QFUA 3W6MA 4M56A 4UTWC 3QR1A 1TRIA 1A4MA 2ICSA 3T8QA 1XKJA 3FW6A 3TA6A 1UR1A 1S38A 3HQPA 1J2WA 4HSOA 3W7HA 2E4TA 5I77A 2DU2A 3NSXA 1M7PA 4OUEA 2WMIA 4JHMA 1CGTA 4KW2A 5D38A 1IEXA 3VKJA 3M46A 4O17A 2TRSA 2VZVA 3VCCA 3V1HA 3FCPA 4EOUA 1ZCCA 1V3KA 1BTCA 1F6PA 1WOAA 3W1NA 3VUSA 3CBWA 2ZQ0A 3JS3A 3ZXWA 1U5JA 4MJ4A 3MP4A 5C9ZA 2VFEA 1A5BA 5FEPA 3A4WA 4JNYA 2FHCA 3W6LA 3M0HA 4MJMA 1G7UA 4CNUA 5AY7A 1V0MA 3GC2A 3IIVA 1HQTA 2C18A 4AF0A 3DC0A 4YWSA 3DG7A 5XINA 4GX8A 4CQAA 4I6VA 3EWUA 3SM0A 3W75A 1HF6A 2CW6A 4B5SA 1B3OA 4QSFA 4F79A 3JRKA 1YDNA 1B4EA 3LV5A 4MY1A 2Y24A 4FALA 2Y2HA 2NWRA 1A3WA 1HFBA 2GGEA 3DENA 3GY1A 2HWGA 1C91A 3R8HA 1P0BA 5TD4A 3AJXA 2DSKA 4ZOBA 3RK8A 4DWDA 3XIMA 3ZR5A 1DJWA 1EJSC 1UA7A 3CAKA 1V6XA 3RX2A 4MWAA 2V3GA 3VOGA 5HNTA 3DXIA 4FMVA 1V51A 4RZBA 2YDQA 5HJXA 1L8NA 2BVTA 2INZA 1VGAA 1Y65A 1X7FA 1HJQA 2Z6JA 1ISZA 2R1NA 1PCWA 3L5MA 3RYSA 4KWVA 2X1UA 2PDKA 2GJRA 1X1OA 2SFPA 2NXIA 4S38A 2XFFA 1DQXA 3GFYA 3QV8A 4N02A 1VYPX 1KXVA 2DUAA 3CUZA 1OIMA 4WJXA 3WNOA 3EX1A 4L6DA 1BRLB 2PZ0A 2V3DA 3FXYA 2PDFA 1KM6A 2BXYA 4IIGA 3R58A 3VVGA 4JN8A 3ONCA 5HUPA 4M7TA 2GGIA 3GXIA 2VCCA 1BFNA 1FCBA 1V5XA 2DSVA 3QZEA 3IEBA 2WMFA 2WPGA 4AHOA 1ZP3A 2IPWA 5F4SA 4JHZA 2QDGA 3RXZA 4DAIA 3PZ9A 3VM7A 5LNRA 4XVDA 4POCA 1W2PA 3THUA 1N2VA 1JCLA 3BLEA 1KBKA 1KQYA 2NQ9A 4IOTA 1GOMA 2J7GA 4DN1A 3EGJA 1V3JA 1H3GA 3VNZA 1XLIA 2JKPA 1IT8A 1UR8A 3GH5A 3WCZA 3LZ5A 2YR1A 3A9IA 2HVNA 2R1PA 1EC8A 2C16A 2CETA 1YLVA 3GVWA 4XISA 1MQQA 1JZ8A 6REQB 3CL7A 3GXPA 4F4RA 4LALA 4QBXA 2PZNA 2QGHA 4WXZA 4A35A 1EX5A 1BF6A 1EPXA 1F07A 3EMZA 3N13A 3NQEA 3TQ0A 4AU0A 4E2DA 3SQLA 1R7OA 4IICA 1AJ2A 5A6KA 4PUWA 5C2CA 1UC4A 2BY2A 3HTWA 2YBTA 2POTA 4LYKA 3QYQA 1NQKA 3R79A 3W7IA 2PWVA 4AIOA 3QGAC 2X0YA 1LCOA 4Y7EA 2WHKA 2HNEA 3DG3A 2B81A 2ZZ5A 2Y4SA 2J7BA 4MAZA 3WLQA 3NWRA 4UWMA 1QPNA 5CXPA 4QG6A 1OFPA 4IJFA 1L9WA 3LHWA 1CGYA 1XGEA 4URIA 3UZXA 1G4SA 4MDOA 4QCEA 1DBTA 2NLIA 2GVJA 2VX4A 1TPUA 2DZPA 3KOZA 3PJXA 2XD5A 1E1FA 5REQB 3G6MA 5AB3A 3LENA 4C91A 2EPNA 2KAUC 1ITCA 1TZ9A 4E0CA 4LUYA 4UTLA 4UMBA 4ACZA 3H4WA 4BKNA 4Z2IA 4L5ZA 1JZ7A 3WQ4A 3S9YA 5JU6A 1WCGA 4XKYA 3IVTA 1QI3A 4UB9A 3PPGA 5FD0A 3E12A 3EOEA 3U8GA 2O9RA 2WSKA 2ISSA 2R82A 1J5TA 1ZAHA 3RX3A 3AXIA 3CH9A 1YUEA 1WYIA 2O92A 3AIWA 3LSCA 3OYZA 5KINA 1ISWA 2P50A 4XVEA 2B4GA 3NZPA 2WSRA 3AS2A 3KVMA 1MEWA 1V7YA 1CGXA 1WX0A 2WHMA 4U28A 2C19A 1FCVA 1S5NA 4LVDA 5AVHA 1IZCA 3MHFA 3FSTA 3WBYA 4OZOA 1UZ4A 2ZXDA 4NQ1A 2CFFA 1OX6A 2XDFA 3AI0A 1HP4A 2V5DA 1VFFA 1J4EA 3ZJKA 4IM4A 4DUVA 4X60A 3F4CA 3LMYA 4E8DA 3PPFA 2A7NA 4MZ8A 1K8CA 5K9XA 4CD5A 1KLYA 3ZJ8A 3KRZA 3VKAA 4RPQA 4OHQA 4S3KA 4PFHA 5FIPA 4IIEA 4HNVA 1DE5A 4HMEA 1IWBA 4RNIA 3AS3A 4GQQA 1LRNA 1EJRC 3SCUA 3RNDA 1VYRA 1A5AA 1PZ0A 4B5WA 2DIJA 1CBGA 2DQWA 4A4AA 1EJXC 2HISA 3C56A 3UR8A 1UQZA 3CK5A 1QFEA 2Y2OA 1GJWA 1MWOA 4RX0A 1PKLA 3IIZA 3QR3A 3L4XA 4EPEC 5HWMA 2F2KA 5E0KA 1F3TA 2D0HA 1EEXA 1JI1A 1JUBA 3L4ZA 2OJPA 5CSSA 3UA3A 5CPNA 1PX8A 1JCJA 4BCEA 2GJLA 4E4PA 5HQLA 4A8LA 5KSWA 3MZNA 5I7GA 3OVPA 5HPOA 4IBBA 5JBFA 1MEIA 1JPDX 2J13A 2Z1WA 1XYZA 3A3XA 3P84A 1Q85A 3O16A 2ISFA 3A22A 4JKMA 3KVJA 2Z1KA 2WCAA 2C14A 1UB3A 4I7UA 5C9UA 3LZ3A 2TODA 4KH2A 3FFSA 1VBGA 5F4XA 4LW7A 4JTIA 2FZ8A 2ASHA 1L2QA 4QE5A 3L7RA 2VQTA 5ABEA 5DY3A 4B3LA 4JCLA 1JULA 4NJKA 5CJMA 4V15A 4M1RA 1R3SA 1LZOA 4RW3A 3N2MA 3D0CA 1UASA 1WE5A 3T55A 1OFBA 1TUFA 2DZUA 2XFRA 1LL6A 1OFDA 1EOMA 3CAVA 1EDQA 3RLUA 2PDQA 4D6CA 1OT1A 3VIFA 1TJ1A 4UR7A 3UQNA 1MZRA 1KRCC 2R1KA 5A94A 4Y6GA 4EVZA 3FEMA 1GOIA 2RDXA 1BYDA 4BF7A 3PTDA 4R34A 3NPVA 3MHGA 2NSXA 1RBAA 2YL9A 2QCDB 3P62A 1O5XA 2JF6A 2CKRA 3I3BA 3V5CA 3LERA 1S1PA 2A7RA 1XP3A 3OA3A 3LGGA 3VIPA 2WZMA 3BMWA 4JEJA 3WLHA 4GE8A 1OFOA 1R47A 1V7AA 2V30A 1TWIA 1YNQA 3P8IA 4HYRA 2W4XA 3GU9A 1QOXA 2E1DA 1LLOA 4R7OA 3BTNA 1X1ZA 3UXIA 3UF9A 5LHEA 1DXEA 3W82A 1RCQA 3GBDA 1ZJAA 2R8WA 3NYDA 2YCJA 3CQHA 2EF9A 3MVIA 4AZCB 5HULA 4DAFA 1A0EA 3VKCA 4O10A 3W7RA 2D69A 3H53A 4AZ7A 4FX8A 3IRDA 3L0KA 2ALRA 1WZKA 1R5YA 5AFDA 2RDUA 3TFCA 1BAGA 1QPKA 2F9RA 3FHAA 4GO8A 2Q8LA 1AG1O 2WMJA 4HZMA 2WM1A 4Z42C 3BARA 4NI8A 1G5AA 4D6FA 3WEMA 4GD0A 4Q8WA 4HZ8A 2J8TA 2PDUA 3FA3A 3AS0A 4JN6A 3PF3A 3K8MA 3B9AA 4V33A 1JZ5A 3LCFA 3W1RA 4PTMA 2YB4A 1CENA 1I2RA 4HU0A 4OECA 3BOLA 4CU8A 1XINA 4S3JA 1E72M 3N4EA 3FN9A 1VENA 1G01A 2DQXA 5TBOA 3AIUA 3RX4A 3I7QA 2CLHA 3MCOA 2HS6A 3N11A 3UJ2A 4RE4A 3EBVA 5JQ9A 2W0UA 4HA1A 4IL0A 5JIPA 4Q3MA 4EE9A 3PJWA 1OFAA 1AUSL 4NYUA 2CLIA 1A5KC 4FHAA 1E6XM 4I6KA 2VCBA 3S4TA 4S3EA 1Q6FA 5GNXA 3DFQA 1Y7VA 1YXDA 2IPJA 1EBHA 1V02A 2OR2A 4OE7A 1T40A 5JH2A 4LV9A 1KGXA 3H26A 5LGXA 1VIWA 4XK2A 3CIVA 1OGSA 4KIRA 4AMAA 5C0QA 3GTFA 1UBSA 2QDHA 1D8CA 2VEGA 1CLKA 3M43A 3QM3A 5EYWA 3ALGA 3B3DA 2XZ9A 4EAMA 4QIUA 4FEZA 2P88A 5E09A 3TMLA 4KWOA 4TMBA 3ZVHA 1FH7A 2CHOA 3M7SA 2D0GA 3MPGA 4MF4A 4WSHA 3KCOA 1J93A 3EKGA 3TAKA 3W01A 2G37A 4FLSA 2TPSA 3MDUA 3BV4A 5JXQA 2PURA 1G69A 4HOWA 3RCMA 1PX3A 5H1WA 3EB2A 2HJPA 4I9TA 1B9BA 1P5BA 3QQWA 4Y9AA 3SRDA 1M68A 4M6QA 5T91A 3L67A 1RVGA 4AD4A 4QS6A 1NWRA 4G7EB 2UY4A 2E1WA 4DRSA 4LNYA 3L0NA 3GW3A 3T44A 3JU2A 5A6TC 3U3HA 1R86A 1ZB5A 2HBXA 1KGUA 1KCLA 2VFDA 4OOZA 1VD6A 4PSRA 4C6KA 3GC4A 3W2KA 2ZZ3A 2X7WA 4DWSD 3VD5A 1RZMA 4LB4A 1MYRA 2EPLX 3ARXA 3W2NA 1LROA 5DQPA 3SN4A 1RR2A 1XLHA 3NL2A 2GJXB 4KT2A 4KEVA 4AC1X 4ZO6A 8XIMA 5FJJA 5E6YA 4NL1A 1CXKA 1JCYA 3VDHA 1B5TA 5BRPA 1QR7A 1J0YA 2Y8VA 1KO0A 1DKWA 4O57A 3EYPA 2QV5A 4U33A 3ABXA 3VOJA 1KV5A 3E2SA 2J27A 1CXHA 1IEWA 3PUGA 2P1FA 4O50A 4IWWA 1E4LA 1HJUA 2DZXA 2EKCA 1KBIA 4LCRA 3EWYA 4YL2A 3S2MA 5ECVA 3B0UX 1TMQA 2ZICA 2VWSA 4WLCA 2V5JA 4PGLA 2BVDA 4J3TA 1GTHA 3PWIA 4L64A 3T6CA 5L9FA 4GLEA 3S5YA 2HSAA 3TWAA 2C3ZA 4LGXA 3LRMA 4IMEA 2FJUB 5D2YA 1W1TA 2W5FA 3E2RA 1QNOA 3Q67A 3OODA 1DJYA 2INEA 3SUTA 2P8BA 4GI4A 2G3IA 1EZWA 4DJFD 2Z1VA 3QC3A 3G0SA 1GQNA 4AWSA 3UBPC 3DERA 4HMDA 1RY8A 1UUQA 2FPYA 1TE1A 3THDA 2E3ZA 3EDFA 1M1BA 3GTIA 2OYLA 4V1XA 1TKKA 1EGZA 5AC8A 1J0IA 4GHRA 1V8EA 3C2YA 2VX6A 1V6VA 3RITA 3OZYA 1SW7A 5I24A 3CMJA 1EC9A 3CV1A 2YL8A 4CQ8A 1ZSXA 2DFAA 1YE4A 2C79A 5D9MA 2Y2PA 5BRQA 3W85A 5G1TA 1V02E 3H2EA 3HMJG 4DEFA 1MW3A 2G41A 3BOXA 3VKKA 3L26A 5HWNA 3IPWA 3EWZA 1JYNA 4TVCA 1M03A 3WFZA 4MB4A 1TVLA 4DJFA 3UXKA 4J3ZA 2D22A 2VEIA 4PR4A 4IFKA 4KPLA 4HOZA 2V0TA 1R3TA 4JL1A 1LOSA 3KAOA 2QUVA 2HV5A 3L21A 3SJNA 1EJVC 1GW9A 3NQBA 2YXGA 2FHBA 1HKJA 2F8QA 1PTAA 4AD2A 3AUJA 4IJRA 2NQZA 2WKJA 1NF7A 3WLRA 3PUOA 2EG6A 3PJTA 2V8ZA 2VZTA 3TW6A 4RNHA 3GZ3A 3WKZA 4C5YA 3VGHA 1W3TA 1JI2A 3N2OA 4UFHA 4GJJA 1Q13A 1GOWA 4K68A 4IGNA 5D2XA 3FYYA 3NXLA 5DX7A 3O8AA 5CH9A 3THQA 3GHTA 2W9MA 1HJWA 1PL9A 4W7UA 1PS9A 2DIKA 1XDLA 3IIPA 4XG1A 4DXVA 1OADA 3BDKA 4Q4SA 4F9DA 1LUCB 3SZ8A 1E1CB 1TZ7A 3HMCA 1WO2A 3PP7A 3HONA 3F2CA 1YDOA 3V0TA 1FTXA 3UPWA 2H8XA 4CKQA 1XLMA 2Z0IA 2V3EA 5AZ0A 4ZR8A 4OJYA 4IPNB 2DIEA 2ZX9A 3HPAA 4DELA 2WMKA 4I8YA 1TUXA 4FO4A 5LNWA 4XUYA 4N9EA 3HGJA 3N6HA 2GDVA 1A3HA 3E9AA 4IT1A 2GK1B 2YBVA 4UOQA 3R94A 4H9XA 2PA6A 4JY9A 3WQGA 3EPMA 4FSAA 4GQGA 3LCGA 4PODA 2D73A 1E8BA 3EXRA 4KWSA 3KS6A 4RZ4A 5LZLA 4ZB0A 2RGMA 3QTGA 1WDDA 1LDCA 4B2DA 3WJSA 1BKHA 3ABOA 2EJ1A 4QEHA 4UNIA 3S2NA 3NDZA 3L27A 4HA4A 3SUSA 3L28A 1S5WA 1W5NA 2EPHA 2OT1A 2OZTA 4N0RA 4AD3A 5H8UA 2Y2QA 2RGLA 3N73A 4H4IA 4PUJA 4P2VA 1BSLA 3BXWA 1I2PA 3FYPA 5C9WA 3SGZA 3DHPA 4RR4A 2Z1BA 5A2AA 3CZLA 3UZJA 2REQA 6ENLA 3VMOA 4NZ4A 3VPLA 2YXXA 4D8ZA 5HATA 2PWGA 1MI3A 4P8VA 1K6AA 1TO3A 3VOIA 4JX4A 4HHLA 3T4CA 1FCQA 2GUUA 4NNCA 3H2CA 3RILA 1DQUA 3M0JA 4E2VA 4CEUC 3QEZA 2H9AB 1QW8A 5HAOA 3W53A 4C1LA 1CCWB 3GNNA 3NDYA 3DI1A 4ZBCA 1V0NA 4OTKA 2GSEA 3LK6A 2V81A 4FIQA 1PYMA 9CGTA 4NYYA 2J75A 3T2PA 3EA2A 1A49A 2XGZA 3CASA 4BEQA 3N2CA 4MLRA 4YVPA 1JDEA 3L68A 5A8OA 4FNQA 2WJZA 4IJEA 4H9YA 4N42A 3UZYA 4HCLA 3BG9A 3FJ6A 2OZ3A 2J47A 4I5XA 1B9ZA 1HTIA 4JD4A 3Q58A 4K6AA 1US0A 4LUSA 1AJZA 2AKZA 4N4QA 1ONXA 4F2BA 1OGBA 5HDRA 2I16A 2VXNA 3URNA 2BVWA 2JIEA 1QUMA 1LOLA 1S5MA 3CV6A 1JDCA 3LBCA 1HKWA 2ACSA 3QGVA 4GZJA 1LQAA 2PP3A 4YN5A 4FXJA 3VFCA 4KWWA 3URBA 1OGGA 3ABRA 1SZNA 1E9IA 3PR2A 3T9PA 1ZJIA 2W79A 5E0FA 2CERA 2QJJA 3EXTA 4QLKA 3BAIA 4KWUA 3ZSSA 2D0FA 4BI6A 1BWVA 3VZYA 2WBGA 3F2BA 3H2MA 1TCMA 2DZBA 1TJ0A 1YPFA 1AD1A 1EWDA 1QATA 2Z1SA 3L0GA 1YU3A 3L2IA 3UYCA 1M9HA 3I4EA 5M03A 4JFUA 5MF5A 1GVYA 4JQ4A 1K7EA 2CITA 1HVXA 2JEQA 1PWMA 1TPB1 1E0VA 3MJYA 2DZVA 4ZQOA 1UD5A 4YTSA 2CWXA 3TFXA 3CAQA 3S2JA 2A1YA 1H7WA 2RKXA 2W63A 1D7FA 1LORA 4YYFA 2RTSA 2IQDA 1GHSA 4HU8A 1O7AA 3RRXA 4PUKA 7ENLA 2BGSA 3WELA 3USBA 3CQJA 1E4IA 1VS1A 3UWEA 3R1ZA 4D6DA 1XQLA 1ZBCA 2ZE3A 5A6MA 1YIXA 1UKTA 2YL5A 1BYAA 4ERAA 4QR6A 4ML9A 1VPQA 4F66A 4A8IA 3LCWA 2X1TA 1RK6A 1FWWA 2XIOA 3IJDA 4QLLA 1WNOA 3VC5A 5EFFA 4IBEA 4LRTA 3QLDA 1RA0A 1P0NA 3UJEA 2AL2B 1UHVA 2VEFA 2X2YA 2MUCA 3LRKA 3HG3A 3H54A 1TTQA 3ABQA 1J5SA 4LH8A 1E5NA 4RLIA 2VR4A 1EZ2A 2NUWA 1CLVA 3CM4A 4PMZA 3NFUA 3FJLA 2WWDA 3UVIA 1XCWA 3ZZ1A 5M2FX 5LIWX 3I3EA 3MT1A 4IMFA 4H01A 3UCCA 2AOSA 3H4XA 3RM8A 3CWOX 5FESA 4D6IA 4X9YA 1UZ1A 1HL9A 4HKPA 2AL1A 2G3FA 4CNPA 2F7FA 4PSPA 1XR2A 4DZIA 3BQ6A 3DHDA 3POHA 2ISDA 4QG8A 3D3FA 3TZNA 4ZO9A 1W5OA 4YPJA 3RAOA 2X05A 3UY8A 3NUKA 5EPDA 3DOPA 3TIMA 3B9NA 1ELSA 2J9ZA 3MMTA 1XIHA 1XHGA 2J6VA 3IIXA 3W72A 3MDWA 2VX5A 4IISA 4NAEB 1IE7C 1F7BA 2CLFA 5I3GA 3S2LA 1EIXA 4AIBA 3SN0A 1ZLPA 4GVHA 3BJTA 4YXGA 2A3BA 4M29A 3GG0A 3CHCA 2OWCA 3KM8A 1DWAM 3DCPA 1FA2A 1XYFA 2D3NA 2OZ8A 3W76A 3VIJA 3STEA 3TYAA 5KEZA 3BURA 1KFJA 1TB3A 5I3KA 4KKXA 2ZA1A 1FCUA 2DT2A 3EOOA 1EP2A 3OTRA 1EIBA 4ZTXA 1TWZA 4QQUA 1CT5A 1TWSA 3M7WA 1QNQA 3R8GA 3W7EA 1UPPA 9RUBA 3B0XA 3MMUA 2HEJA 4BQ2A 4X3ZA 2E5BA 3CQKA 2VDIA 1EO7A 2Y5SA 3RDKA 4NRRA 3W7OA 4Q32A 2C0HA 3SDOA 3GH4A 4O1BA 4B91A 4A29A 3AXHA 5ABTA 2FZDA 2GYIA 1KWKA 1QNPA 3G1HA 4S39A 2YDSA 5K2ZA 1HJVA 4M1BA 1SFTA 3E0VA 2POZA 5CGQA 4KEZA 5G1MA 5AC4A 4DWSC 2BXVA 3W7PA 3M5XA 1BVWA 3USZA 3AYVA 1X6NA 4TX6A 4J35A 4Q4QA 8XIAA 4GINA 4B5TA 4OJOA 1P7TB 2OGJA 1QCWA 1HUVA 3IS4A 1TV2A 3R0KA 5D9NA 4LF2A 4DF0A 3BLKA 2PI6A 4X9SA 3NL5A 2JCHA 1NOWA 2C71A 3A64A 1LQ2A 2FN2A 1UR9A 1JZ6A 4LANA 3CHDA 4TOQA 3GVQA 3AMGA 2FHFA 1KM1A 1I0DA 4DYJA 3PZUA 4QE4A 4IGSA 3WQEA 1V79A 3DFSA 2PWFA 4KETA 3C2EA 1ZBKA 3SSZA 3WBAA 5LGZA 2OEMA 4DM2A 1KTNA 2YJQA 3UWUA 3L25A 2HQAA 4PMOA 4W7VA 2HK0A 1O5QA 4MB5A 4C1KA 3MYPA 3P14A 2QXWA 4QDPA 1QPOA 4GOAA 4MUPA 1HJXA 3PSVA 2ZXBA 2IW0A 1Q6CA 4O1FA 3RM9A 3FNDA 3TW9A 1NOFA 3D47A 3MUAA 2DPEA 3Q65A 1FRBA 4FP1A 3PPCA 1FH9A 1CXEA 3EKLA 3AU2A 4GXWA 4JOMA 7REQB 2E25A 4J3XA 3ORWA 1XLCA 3A13A 3GS6A 1YW1A 3C0SA 1T6MA 4IQLA 5IHRA 4B5VA 4L4OA 3T0BA 4WHBA 4IBKA 1XH2A 4F0KA 1E55A 1UP0A 5CLTA 1ZJBA 3LQLA 1RJPA 1UROA 4WOZA 4C7FA 3CIWA 1BQCA 3TUUA 2EPKX 2DSWA 4LB3A 3FDKA 1DEDA 4LVBA 3A23A 2CBVA 1K9FA 3VCNA 1UUOA 3L5AA 1NFPA 3CIXA 5DFAA 2WBKA 2B31A 4H8UA 3CH0A 7CGTA 2XH2A 3KDNA 2I17A 2PRHA 3W2UA 1F9CA 2IKGA 1PTDA 1KRAC 5T9BG 2A3EA 4F0LA 3TNOA 4UTTC 1NSJA 3RPMA 5LA0A 3XINA 4ERGA 2VFIA 4JFVA 5KTLA 3IANA 4A21A 4R9OA 1YU2A 1BRLA 5J5RA 2HRWA 2ZBTA 3N3TA 5JIWA 3W7MA 3DHUA 2UZ9A 5CPSA 5C6MA 3P82A 2WZEA 1FDYA 1GORA 4AFYA 2XISA 4UMAA 3OG2A 1NM9A 2RDTA 3TSDA 4H8VA 3BAKA 2HMCA 4KS0A 4GA8A 3OZOA 3EX6A 2DVXA 4D8LA 3ARUA 3T2QA 3F7JA 1XKYA 1G4EA 2QZRA 3UCQA 3MTWA 2EQDA 3BMVA 4ZODA 5BMWA 1M5WA 1SMAA 3TROA 2A7PA 1KXQA 3FK4A 3RPDA 1XX1A 4QE1A 5CAHA 1Q63A 4WD0A 3QZAA 3H22A 4PYSA 4GFIA 3NQGA 2GSJA 2CWNA 1E6SM 3SGGA 3SIMA 3HSHA 1SO5A 2PAJA 1ICQA 5GNZA 2HE8A 1NELA 4L4LA 5A6BD 1P0DA 3M5VA 2O9TA 3TXZA 1OINA 4Q8MA 4OWGA 4FAMA 1CZ1A 2Z29A 5DEZA 3KOXA 2W62A 1E15A 2AQWA 3W87A 1VPXA 5E70A 1YU0A 3KS5A 1XBZA 5A6AA 2WC3A 1CECA 4GGHA 2CZEA 2DSZA 4PBFA 3EEZA 4W5UA 3GNDA 3W3OA 3KFTA 1YDYA 1PJ9A 4Y90A 1RPKA 2FZNA 3THCA 1R7AA 2G50A 3N17A 1FBAA 1FWSA 1ZENA 3WUFA 1QI0A 5DLCA 2VCAA 1PDCA 2VC9A 4IBDA 4PZVA 1KFCA 5BXSA 1LF1A 1EJWC 5TQLA 3CUFA 1CWYA 3PM6A 1GGOA 3BW4A 3TTQA 3GDMA 2YSWA 3KL0A 5A6BA 4O1CA 3KUMA 3QV6A 2ZUWA 3QV9A 1SM9A 1ADOA 3SN1A 4GY1A 3UR7A 1JCMP 3WLMA 1R2SA 4IJCA 1A5OC 2Y2WA 1FVPA 3GB6A 2WAGA 2MANA 1ALDA 4LNCA 4IMGA 1WQ5A 2QAFA 3S2CA 3TCSA 1V08A 5FAGA 4E8CA 4LXFA 4HVXA 3BMXA 1LRTA 3R5EA 4UFJA 5REQA 1H61A 2PCEA 3QY8A 1RXOB 3M0LA 3QGKC 5LNSA 5C2GA 1TWWA 1TX2A 1GEQA 1ZZMA 3LTPA 1X1NA 2CIPA 4IH3A 2XVNA 3H2OA 2X2GA 3K8KA 1K9TA 2VRKA 1L8PA 3S5ZA 1IZKA 1WDWA 3S47A 1XISA 1CXIA 5HQMA 1A0CA 2IXVA 1XH1A 3WQWA 1ZNNA 2CLEA 2E68A 3R11A 3MANA 3A12A 2GJPA 3C5QA 1ZRQA 4X61A 1UR3M 2F2HA 2Z2UA 3SADA 4OVXA 3WLSA 3S5SA 1BTMA 3WH5A 4NI3A 4MG4A 5A6SA 3NOEA 2R6OA 3GAYA 2XU2A 1X39A 3L2MA 3MKVA 3KVLA 3GNRA 4AY7A 3GDKA 3LCXA 2PE4A 1TREA 1OZQA 2OFJA 2BMBA 5AHEA 2X30A 2WHLA 1AH0A 3SY5A 3CC1A 3STGA 1VFUA 3VI2A 5HMSA 4R27A 5I79A 4O1EA 4CQBA 1HO1A 1E9ZB 1LWJA 3LHVA 3RMEA 2GUYA 3MJMA 4DBDA 1D8WA 5U7SA 2VOTA 3TYCA 2JK2A 2PTDA 1UWTA 2XN0A 3W7DA 2QCCA 1LLWA 3MMDA 4NUWA 1GVIA 1TVPA 1VBUA 2H3BA 3FV9A 4N2YA 3PZQA 3BGAA 5D33A 3ATYA 2QMJA 5EMMA 1K4HA 1Z7AA 3Q94A 3TE9A 4GJIA 2VURA 2V2CA 4HHPA 3QQ0A 3CZ8A 4O0KA 2TYSA 5AN7A 4S3GA 5LHFA 2OG9A 1DWGM 3HPSA 3KRUA 4CNOA 4JTAA 4IMDA 3I3DA 4JFTA 1IGWA 1ICPA 2XSXA 3H7UA 3OQEA 1DVJA 4Z2KA 1DOSA 5KZ6A 3DZ1A 1LWIA 4MDPA 2VC6A 1MNSA 3TEVA 1TRDA 4I7WA 2ALDA 1E3XA 4HCDA 1P6BA 1K4GA 2X41A 3E6EA 3FJNA 3LNPA 4GXPA 1IWAA 3CQ0A 4MZYA 2I9UA 5E9AA 5F2GA 5GJMA 4P7RA 4GZ7A 1DIOA 1V6WA 1D9EA 3FY1A 4J28A 3PZOA 2ZRUA 1JFXA 1S3TC 3CB3A 4QP0A 4AVFA 1BHGA 4IP4A 2OEKA 3MU7A 3L4YA 5T26A 1Q6OA 2FTYA 3WQPA 4IHCA 2Y63A 1FWRA 3RPTA 4ASTA 4FOJA 4C6PA 4C7GA 1Z44A 2E67A 3T0CA 2PUZA 3VK5A 1W1B1 2BG1A 1NU5A 3AXXA 2BOEX 5H8MA 4A3UA 5A8PA 2OQLA 1G4PA 1OHLA 4MNMA 4XBJA 4V1YA 4JTKA 1T5AA 3K1DA 4REQA 1YNPA 3M6DA 1W1VA 1GPWA 2Y8UA 2AQOA 4NZJA 3WENA 4DI9A 1KR1A 1GQLA 4BS0A 1AH4A 2GVYA 2Y2KA 1R9XA 2Z27A 4RW5A 3TWBA 2QJNA 4RPPA 1XDJA 3VDBA 3SB0A 4D6JA 3NOYA 1CK7A 1KXTA 1QBAA 4QSHA 2YYUA 4RKAA 2Q02A 5H2ZA 1KKRA 1GVQA 2NLYA 1YYAA 1JR1A 3EOLA 6PTDA 1AZ2A 4EWJA 5HJYA 2V2DA 1UKPA 4XAZA 4J2MA 4XD5A 3WL0A 3A21A 3EDKA 4XUGA 1F5ZA 2FMNA 2OXNA 3C0QA 1TMLA 3G1VA 4AZ6A 2ZADA 4AQLA 3IWPA 4IGHA 5ABFA 2HZGA 1H62A 3K1GA 2RJGA 1EHNA 3GDLA 3K13A 4MPKA 1GVOA 1F61A 3UXDA 5EMJA 3W7JA 1OG6A 4K8EA 3V18A 4AZCA 3VDGA 5CGTA </