4NY2A

Structure of vibrio cholerae chitin de-n-acetylase in complex with acetate ion (act) in p 21
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
404
structure length
404
Chain Sequence
PKGTIYLTFDDGPVNASVEVIKVLNQGGVKATFYFNAWHLDGIGDENEDRALEALKLALDSGHIVGNHSYDHMIHNCVEEFGPTSGADCNATGNHQIHSYQDPVRDAASFEQNLITLEKYLPTIRSYPNYKGYELARLPYTNGWRVTKHFQADGLCATSDNLKPWEPGYVCDPANPSNSVKASIQVQNILANQGYQTHGWDVDWAPENWGIPMPANSLTEAVPFLAYVDKALNSCSPTTIEPINSKTQEFPCGTPLHADKVIVLTHDFLFEDGKRGMGATQNLPKLAEFIRIAKEAGYVFDTMDNYTPRWSVGKTYQAGEYVLYQGVVYKAVISHTAQQDWAPSSTSSLWTNADPATNWTLNVSYEQGDIVNYKGKRYLVSVPHVSQQDWTPDTQNTLFTALEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Deacetylase DA1
publication title Structural basis of chitin oligosaccharide deacetylation.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Hydrolase
total genus 147
structure length 404
sequence length 404
chains with identical sequence B
ec nomenclature ec 3.5.1.41: Chitin deacetylase.
pdb deposition date 2013-12-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.90 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4ny2A02
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 4ny2A01
1Z7AA 4NYUA 1W1B1 4U10A 4NZ3A 2W3ZA 3RXZA 1NY1A 4WCJA 2Y8UA 2NLYA 2XU2A 1W1A1 2E67A 2C1GA 5BU6A 2I5IA 2C79A 4V33A 4M1BA 4F9DA 4NZ4A 4NZ5A 3WX7A 5JMUA 3VUSA 3S6OA 2C1IA 1W17A 3CL6A 4NZ1A 3HFTA 4L1GA 3CL8A 4OUIA 2C71A 2CC0A 2VYOA 1XW8A 4HD5A 4NYYA 2IW0A 3CL7A 4LY4A 3QBUA 4NY2A 2J13A 2QV5A 4F9JA 2DFAA 1V6TA
chains in the Genus database with same CATH superfamily
3GBDA 1DWIM 1TIWA 3CMFA 5E0FA 4PRRA 4ZE4A 4L65A 4H9TA 4O10A 4R34A 5FF3A 4QFUA 2W5FA 2XGZA 4OIFA 1DVJA 3WH5A 3DECA 3LLDA 1ZCOA 2RDTA 3L4VA 4HYRA 1J2BA 1TUFA 1J96A 4FALA 1IT0A 1OYCA 1E6QM 1AVAA 4DAFA 2A3BA 4EVZA 1I6NA 3CLWA 4ZSUA 3U57A 4EE9A 4K1WA 3A9BA 3ARYA 4XZNX 3AWNA 2A21A 2Y7GA 5DMLA 2WMHA 1H8PA 3K13A 5DT5A 1RBOB 4NUWA 1X7FA 4O1EA 3U2ZA 4REQB 4K6AA 5CZ0A 5AOUA 2D0HA 2TSYA 4F48A 1BTCA 2J47A 4C6EA 3ZSTA 1QO5A 4GRSA 3MC5A 1JXJA 2QCEA 1XICA 3LBOA 1WNOA 5FF0A 2C91A 1FWDC 4UR7A 1VCVA 3B9NA 1LF1A 2Y2MA 3POHA 1CGYA 1LBLA 2QCHA 1PAMA 4IBIA 1KFCA 1DXEA 4DJEC 3EPOA 3B03A 3TX9A 3CK5A 2RDXA 3U2EA 2CKRA 4QCEA 3G2GA 2Y2JA 3TKFA 1Z44A 2O55A 1H61A 1R30A 4Q4QA 3R0KA 2Q3OA 1XQKA 1WE5A 2XIJA 1BGGA 1GTEA 1BYDA 4RW5A 3P74A 4ML9A 3NQ8A 1I2PA 2OYMA 1WQ5A 4WRHA 2DV0A 1LG1A 3GHRA 3DZ1A 4FK9A 3W7HA 3TCSA 5C2GA 1XHGA 1C8QA 1XCFA 3G3DA 4L5ZA 4I90A 1H41A 4GX8A 4PE8A 4BJHA 3L0GA 4IFKA 2WO5A 2G96A 3DG7A 4D9PA 2YFOA 1WYIA 5D32A 3SUTA 4O18A 2PP0A 5A6SA 1M7PA 1BYBA 1F3WA 5D9MA 3TR2A 4MDPA 1XXXA 1YXCA 3GIYA 4IL2A 2GGEA 4YCPA 1A47A 1E3ZA 1DP0A 3H22A 2E40A 1ISYA 3AIWA 2OELA 4P2VA 4DQWA 3BO9A 1E88A 4ZOAA 1E5JA 2Y63A 3WFZA 1M04A 3TN4A 1H50A 3OEXA 3TAKA 2QJIA 4HU8A 3CO4A 1H1NA 4GY1A 4KCTA 3TQPA 1EZ2A 4O15A 5D9PA 1JZ4A 2XVKA 1Q63A 1FXQA 2Y5JA 3LI1A 4LG2A 1BTMA 4OZOA 3UESA 1DOSA 1LLOA 1NWUA 5FF7A 4XD5A 4X61A 5CAHA 3MMWA 3N29A 5GPRA 3OBKA 1DWJM 2ZWYA 5DFAA 2HJPA 1GVIA 3EWZA 4QE4A 1YU3A 1JAEA 1DJGA 3GW0A 5TQLA 7XIMA 1FUYA 1UJPA 3C4UA 3RITA 1V93A 4MWAA 1K02A 1W91A 4NG3A 1B5TA 2RFGA 4QE1A 4CQCA 5BROA 4AZ5A 1YQ2A 1KGWA 3PN8A 1FDJA 1KA9F 2PDBA 4IL0A 5HXMA 1F07A 1R3QA 1R46A 4ALDA 3P67A 1F5ZA 1VFMA 4EOUA 1VBJA 3OTRA 4HHLA 3S9YA 3QMSA 3PULA 2WANA 3IJQA 2JBMA 5FJOA 2Y0FA 5DX7A 3TYEA 2KX9A 1ZP4A 1YU0A 1VRXA 3SSZA 2G37A 1PKNA 4H8NA 4FNUA 3U2OA 5A6TC 3NR0A 3QYSA 1SO5A 4IMAA 4WR3A 2NXGA 1RQEA 2HNHA 1S2UA 1EXPA 4F0MA 2RHGA 3LPFA 1EA9C 5T26A 3N4FA 4OTKA 3SCSA 3W7OA 2G8ZA 5AHFA 2WMGA 2PDWA 1XD0A 1S5VA 1G1YA 4F8XA 3EYPA 1RCOB 3EOSA 3GVGA 1KTNA 5CGMA 4X0NA 2IS7A 4CVUA 2OQHA 5F2IA 2SFPA 1R3RA 4LS0A 2QF7A 4D6IA 4JL2A 3NNTA 1CECA 4PMVA 3LHVA 3UXKA 2E6YA 2YYTA 3IIXA 1V7AA 2EO7A 3B4YA 4OFCA 3P5ZA 1KM3A 1PB0A 1GQIA 2VP8A 1NF7A 3LD5A 3OJGA 4WLCA 3VKBA 3C2FA 1TR1A 2PD9A 2XUCA 4AFYA 5HNRA 1EIXA 4DHGA 1B9ZA 2NLYA 1EUAA 4WDXA 1TREA 3VNZA 3PTMA 3OQEA 1LWJA 3B8IA 4YLWA 3GXPA 1XH2A 2CW6A 2WSRA 3OVQA 5CXPA 1X6NA 2O0TA 2Y8VA 4LF2A 1JI1A 5L9FA 4PSRA 1CBGA 4KWVA 1K9DA 4ZOEA 3AIRA 4AZBA 4BS0A 5CSUA 1UA3A 3SB0A 1AQMA 2PB1A 1GYNA 2VR4A 3WUGA 1V79A 1W31A 3NCOA 3VMOA 3U4AA 3VE9A 3WUEA 1KM1A 5AECA 2I14A 4YVVA 3L5MA 3VE7A 2G95A 3MS8A 4PL2A 1UC4A 4XZLX 3QLLA 3HGOA 3VKDA 2BLEA 1Q6EA 1E3XA 3WUFA 3EB3A 5DMNA 2CLOA 1QRQA 2UBPC 3BW2A 4Z1YA 4P5UA 1EWDA 4CCZA 1NARA 5I24A 3WMCA 5AFDA 4BWLA 4P61A 4K68A 3VIIA 5CGQA 4B4FA 1JL8A 3NEVA 3P62A 4PULA 1LP6A 2YL9A 1L9WA 1CDGA 2VVSA 1JUKA 1ZRQA 2GL5A 3ARUA 4AIOA 2V5BA 2FDMA 3WLRA 4CN4A 3RFAA 2J79A 4V2XA 1ZCCA 3EEZA 1I1XA 5I3JA 1KFJA 1XBXA 2E3ZA 2ODOA 1RCQA 3S2NA 3PBGA 4QG8A 1RSCA 4NRSA 5LA2A 4DY1A 5A94A 1NDYA 5LNWA 4EACA 5HNTA 3VGGA 3PAJA 3L2IA 1F7BA 2X1IA 4ROQA 4Q6JA 1XJBA 2CBVA 3TEVA 2VT0A 1JDEA 2DVXA 1K3UA 4B5XA 1HF6A 3DHFA 2I16A 1GQLA 3QW4B 2OTDA 4QRNA 4K8EA 4E2BA 2HRWA 3ZLHA 2CLKA 3BV4A 3SCTA 1XISA 1YNQA 4PRWA 3OBAA 3W7EA 2DH2A 3DG3A 3W27A 3NYZA 1O94A 1RAKA 3VCNA 3G6LA 4AF0B 1OX6A 4WDUA 1R9ZA 3ZZ1A 4UTFA 4N02A 3VGBA 1QTWA 2QCMA 3VIJA 4I3GA 1RUSA 3RNDA 3LXAA 4H9VA 3EKGA 1UWQA 5F4WA 5KETA 2XFRA 2Z1KA 1QK0A 1BLIA 2X05A 3EWXA 3DG6A 4XSMA 3C5QA 5AYIA 3TP4A 1OC6A 4GJJA 1M7OA 2AKMA 3UYCA 1UH2A 1UD2A 4F0HA 1ENUA 4Q8QA 1V6VA 8A3HA 4JHOA 3RMEA 5CEWA 1ZUAX 3KUMA 5BPVA 1W2VA 1G4EA 1IEXA 5JBEA 2RGMA 3K1DA 3BWWA 5H91A 3W1MA 2HK1A 2NWRA 4WSHA 1R8LA 3PZNA 4NKCA 1FHVA 1K6AA 1WDQA 1SJAA 3WENA 3ZT5A 5AN7A 4HCLA 4I7VA 2FZNA 1K8ZA 3FXGA 1GVFA 4UZUA 4ZQCA 4NZ3A 1K03A 3D6NA 1G4TA 1Z69A 1Q7MA 1W1A1 3FS2A 1IQ8A 1EEXA 3H7RA 3K8LA 3KL3A 5GVJA 2WJDA 1B3OA 4HPNA 3W4RA 4GISA 1KCZA 1TJ0A 1U5HA 1L6WA 4PUUA 4PMJA 4AWSA 4DX3A 1JG9A 1KB3A 2VEIA 4IBKA 2W6RA 3SFWA 5LHFA 2JF7A 2R82A 4RCXA 3MW7A 2PGEA 4HVXA 1VLIA 2W91A 1PBGA 2YA1A 5DEZA 4ZVJA 1UZ1A 3NQFA 3WY1A 1QNSA 3HQOA 3VI2A 3C6CA 2VX7A 4FMVA 2W63A 4CQ9A 4M19A 4JTKA 1RP9A 3CUGA 2FTPA 1UKOA 1AK5A 3A12A 2QGHA 1FP8A 3PPGA 1C29A 3W23A 1F74A 1VB9A 3G22A 2X1RA 3KFTA 3T0TA 4DYJA 1YPFA 1NSJA 2QCFA 1W5OA 2YB4A 5I02A 1TA3A 3T44A 4E0CA 4LPCA 1GOOA 4F9DA 3PWGA 4D6HA 3MCOA 4DJDC 1PIFA 2G0WA 1WXZA 2QJMA 5LIKX 3WDRA 1BQCA 3W1PA 1SO4A 2D0GA 1KXHA 2XZ9A 5REQB 1JZ8A 1XDMA 3U6WA 2DZSA 1EHNA 1W3TA 4C7FA 4UTIA 2ZE3A 3CUFA 5HQEA 1RK5A 3GS6A 1JF6A 4W9TA 2OZTA 2YYUA 4AU0A 2WC7A 1VLWA 4HTBA 3O0FA 1J0ZA 2F6XA 3I6EA 3M6DA 3EX1A 3R0UA 4EXBA 1CI1A 1OX4A 4KRUA 4B4HA 1H1YA 1V6TA 5JQ9A 1XLLA 1ZPTA 3HMJG 5ABFA 1I2OA 3NPXA 3RAOA 5BW6A 5BU6A 3ALGA 2X1TA 3BMXA 2E77A 3NVTA 1O68A 3B06A 4D1IA 2I5QA 1W9UA 1ZS2A 3BLDA 4MKSA 3VGHA 1PCKA 3REQB 3AJXA 3URAA 2WPBA 1GOMA 1OK4A 2OSYA 3VD4A 4FOJA 1Q6FA 4IPNB 4MUPA 1UR1A 5FESA 4FNSA 4IJEA 2ZZ5A 3DBNA 3LXCA 2VFDA 5AC8A 5ENLA 5A3HA 1XPYA 1QWGA 2V5JA 3R43A 3GHUA 1K7XA 3FFSA 5J04A 1YKWA 2GJXA 2Y61A 4H2CA 2H6RA 4GKLA 2NXHA 4J3VA 3CEUA 3B8WA 2VFIA 4X9SA 1QHZA 4FA3A 2EPKX 2XFFA 2VRQA 1EPVA 4CLMA 2FZ9A 3SR7A 4QLKA 4QSHA 5G2IA 4CVWA 1FH9A 2QYGA 5H6HA 1RALA 4UR9A 3IS4A 1BYAA 1AD4A 3E5PA 4DUOA 2D3LA 3UGRA 3W2UA 2PWDA 5BRBA 3AYRA 2A3CA 3WSUA 5EYWA 1WB0A 1FDZA 3KTCA 4ZE5A 5AC6A 4JHMA 2FZMA 3V75A 4X22A 1E1FA 1PTDA 3BG3A 5I79A 2OWXA 3H2CA 4ICNA 4HA3A 1E1CA 3KLKA 3WLOA 1J12A 2BFGA 2YDQA 5CZSA 3MVTA 1E5NA 2O9RA 2Y7DA 1FKWA 3HURA 2P3ZA 4LCRA 5XIAA 1IR2A 1T99A 4G7EA 2BWGA 1TV2A 1FWEC 1BXNA 4OU1A 4G1KA 1EWEA 4L1WA 1Y5XA 4B2DA 4A3QA 2CZDA 3NQGA 2V3FA 2GWNA 4NZJA 4PA8A 2Z1XA 2XJ7A 5IHSA 2XD5A 3UZJA 4GA8A 4A8RA 1AUSL 3N18A 1E4IA 3I65A 5FL1A 1SJCA 3C0SA 2VUYA 2I5IA 3UZYA 2QGYA 1OK6A 5AB3A 1WCGA 3W53A 1HKWA 5G4WA 1QPKA 1VCGA 5D03A 5A6KA 3NQ6A 3LPGA 4IMDA 2WAGA 2DZWA 2BHYA 1WOAA 1LL4A 3NO1A 1EPXA 4HPJA 2WOQA 3B0PA 4KF1A 2R94A 3QHMA 2JK2A 2JKPA 3F5JA 2QJHA 1JZ2A 4LFYA 2Z25A 1DJWA 1SO6A 2ZRVA 4WJXA 5U7SA 3NDZA 2JGQA 5EB8A 2VX5A 1YTDA 1ITQA 1F4AA 3GVRA 3VMNA 4JFTA 4GYPC 3I7RA 4MMWA 2A7RA 1Q2SA 3IGHX 4GNJA 2H9AB 1FOBA 4ZXOA 4PN2A 4ZFCA 2PDNA 3UEQA 3WLJA 3UJ2A 1A0DA 4X60A 4AMAA 1XIDA 3N9RA 2XVPA 1IEIA 1AW5A 2VGFA 4HU4A 2P8CA 1B9BA 1DQWA 1GOXA 3SFKA 5A8QA 2GK1A 2J7EA 3UXLA 3V35A 2ZX7A 4QNEA 4LUTB 3KP1A 4J3ZA 3W2JA 2EGZA 2VM8A 2MNRA 1K8XA 4TV6A 1W2PA 4YMZA 5HWMA 2HNEA 1ALDA 4PUEA 2BHZA 3WD1A 1W9VA 4GXPA 2OODA 2ISVA 4KS0A 1Q85A 2ZVRA 3GB6A 2YCLA 3P7YA 1NQ6A 1OFQA 2EG7A 3C61A 1M53A 4RNFA 2E68A 4JTCA 4H01A 2V3GA 3AZTA 1FFQA 4NYYA 4W8BA 1JZ6A 1O5QA 4E4FA 5IM51 1E0VA 4NNBA 1KD0A 1XUZA 2A7PA 4DM1A 1PSCA 4ZO6A 2PDUA 3H2AA 4U4MA 5CZJA 3APTA 2V69A 3WG6A 4Q4RA 3IVTA 2HWGA 2ZTKA 4LVBA 3DHPA 4Z1CA 2IKHA 4GC3A 3CASA 3EDKA 1BXCA 2NV2A 2PAJA 1TTQA 4Q8UA 3VFLA 2DP3A 3OLGA 1XYMA 1S2CA 4CNPA 2QZRA 4FXFA 4YXGA 1XI3A 2C71A 4RV3A 2J62A 3JW7A 1KFEA 2WXDM 3CM4A 1GJPA 4TXEA 4QIUA 5AKQA 1IE7C 3BW4A 3MO7A 4TOQA 1ZNNA 3MSYA 5DF0A 1W3IA 4MLJA 4HN4A 3BOFA 1SU5A 6REQA 3NIYA 1I75A 1R3WA 2VD9A 3B0UX 4O54A 4LC8A 4S3GA 1OGGA 3CIWA 3VMPA 1E6PA 2D22A 1D2KA 4P8XA 4Q8MA 2IQTA 1FTXA 3RXZA 3TZNA 2Z24A 4WUIA 1GZGA 3NSNA 4KCWA 4GIEA 2NV1A 4Q33A 3S1GA 2X2GA 5LIYX 4HGXA 2UWXA 1KLYA 3U7VA 5F2GA 3TYZA 4EAMA 5BOEA 3EWUA 1VJSA 2DZPA 4CNNA 4KEVA 4DF0A 3SIZA 2DW6A 4GH1A 4UQ9A 4J3UA 2PTYA 3SZ8A 2Z00A 4H7ZA 4UIOA 1O5KA 3NAVA 1UASA 3LGGA 4AIEA 3BLPX 1CX9A 4IBJA 3WQPA 3GTXA 1EJSC 1QW7A 2ISDA 4AD3A 4Q8WA 4ZO8A 1OT2A 2WV8A 3R79A 1UKQA 3MB9A 1A49A 3IANA 4HYVA 1J10A 3T8LA 1Q8AA 1WKFA 3VOIA 1G0CA 1NFPA 3BG5A 2VZTA 1UIPA 3CT7A 4GI6A 1D8WA 4Q7NA 5CC6A 1K9EA 3NQBA 3CBWA 2CLIA 4XBKA 2GOUA 1TVLA 3G1SA 1X97A 3I68A 3PG9A 4B5VA 1UD6A 4ZEPA 1XLJA 3KS6A 3B9OA 1KCLA 3AHYA 3VM7A 1ZBCA 3VDBA 4DXKA 3UFYA 3WD3A 5A2BA 1A3WA 1HJWA 4ADSA 4JY9A 3H53A 3UR8A 4D8LA 1IEVA 1SFJA 1TSIA 3BMWA 3LZ5A 1BXBA 1FWJC 2VDGA 1S46A 3I3DA 4HTYA 3VDCA 4KIEA 1XSJA 1UR2A 1S3HA 1KM0A 4Z2GA 5LKYA 1MRAA 2AMGA 4JIHA 2YDAA 1DJZA 1YNYA 2CZEA 2DPEA 3L4TA 5KTLA 1EZWA 4S3FA 2YDSA 1X39A 1VR6A 2R1LA 1G9HA 3TTOA 1J0HA 3M41A 1Q65A 1VPQA 3OIHA 2VL4A 3PZIA 2IUZA 3QPZA 2VI0A 1DTUA 1W1PA 1IGSA 4PCSA 3O6YX 3VC6A 3FN9A 1E4MM 2OO0A 1W5QA 3HF3A 1O60A 3NWRA 4NT0A 3FK4A 3W2MA 3VNJA 4MAZA 4G5DA 3KDNA 4TX9A 3TW7A 1QOQA 4UTUA 1CLKA 2WJZA 4US5A 2GJPA 1A4MA 4AZCA 3SY1A 3PSWA 1M1BA 4R7OA 4GO9A 2WC4A 5BOOA 3DFNA 2WVVA 4ZENA 1IT8A 4AUBA 4NNAA 4W5UA 3AI0A 2UWFA 3A4JA 2J66A 1DJYA 3U8GA 4FZIA 4HCDA 1ITUA 2Z7KA 1TPUA 1UR8A 2F7FA 1FFRA 2Y70A 3PP7A 3H2MA 3WQ8A 7REQB 3MWCA 1JD9A 1HN1A 1SMDA 3AS0A 4O8RA 4GG9A 3KBMA 3N3FA 2OJPA 1BPLB 2C8NA 2JKEA 3STCA 4JYFA 5B7ZA 1B90A 2PEVA 2RKXA 1BF2A 2UY4A 5A5WA 5I07A 5CAKA 1UG6A 4XSLA 4A29A 5E9XA 4HU3A 3WF0A 3KRZA 4IISA 4JDBA 1QPOA 1GG0A 1YTEA 4H9UA 2P8BA 4F4RA 4JXCA 4K2SA 3E0LA 3QTPA 3VD9A 2WPGA 3WDJA 2BZNA 3USBA 1UMYA 4ERAA 1UZHA 2F2KA 1OGBA 3ORWA 5IDZA 5LIWX 3W7RA 3IV3A 2H3BA 1PCWA 1PJ9A 2GGIA 4QBXA 3TJXA 3N2BA 1YTKA 4IP4A 3OG2A 4HIBA 5K2ZA 2IQDA 4DBDA 1WOBA 2DU2A 4C1LA 3HONA 3BAYA 3O15A 2VKZG 3UPBA 2XIMA 3L4UA 1DWFM 3ITVA 4DZHA 4JTUA 2GQAA 4FB7A 1M41A 1GQJA 1N8FA 2ISSA 4GBUA 1XGEA 1C8YA 2YB1A 3UBPC 4HOZA 2OO6A 2MUCA 1TPFA 3ARSA 2RDWA 4DNMA 4Q8PA 3CHDA 1I1WA 4KPLA 1DEDA 4AY1A 1RPKA 1DJQA 2HCVA 2G3FA 5AYXA 1H7XA 4H9ZA 4ADUA 4CD5A 3NQMA 1OABA 2Z1WA 2R91A 4EP8C 1FWCC 3Q58A 1WUEA 1I45A 3B9AA 4H8VA 4IFKB 2ZUSA 3I4EA 5DXXA 1XRVA 3GVQA 3RPTA 3S46A 3L2AA 3V0TA 3WJYA 5I06A 1CNVA 2V68A 3SAZA 1LORA 3L0KA 1E56A 3WH6A 1HKKA 4NASA 1OSEA 4RDYA 1R3SA 4M24A 2GSEA 5J8LA 2CHRA 3W7KA 3CHVA 1LROA 5IFPA 3T2QA 3VU2A 1JZ3A 1TFVA 2Y5SA 3P14A 2Q6ZA 7TIMA 5EBAA 2OMAA 2X0SA 4M0XA 5KZMA 3PJUA 4KMQA 4BQ5A 2YCEA 1F6PA 2Y2NA 4DELA 2XPKA 1E55A 3M9YA 1MSSA 3DUGA 3MBDA 4S2CA 2NVCA 5LXXA 2NV9A 3CZKA 1YYAA 2QLYA 3KBNA 3ITYA 4GVIA 5HANA 2OVLA 3GAKA 5LSMA 3FHQA 2NQJA 2FH8A 3ZIZA 3R2GA 4CQAA 1GYMA 4WDWA 1L6SA 1C93A 4BF7A 4L9XA 2I1OA 1HGYA 1W5PA 4GMEA 2DH3A 6ENLA 4V27A 3GDRA 4E2DA 4BA0A 5HQMA 4MNJA 4L4MA 3UJSA 4MF4A 4L1XA 4LX4A 4Z2LA 1TKKA 2PUZA 4G7FA 4LRSA 1SW3A 3GDBA 1MMFA 4REQA 3TSDA 4LYQA 4C6QA 4RNHA 2ZADA 3ANYA 1O1ZA 3KRBA 1F05A 2VEMA 1PO9A 3TU9A 2VENA 3E0IA 2D2OA 2E1DA 1EHAA 3SCNA 4YVXA 1A5SA 2IQ0A 1F6KA 3FJLA 1KBBA 1UR9A 1U30A 1HX0A 2WCAA 1VJIA 5G4HC 1HP4A 2E28A 2BBFA 4CQDA 1ESWA 4W84A 3N73A 6XIAA 3VCCA 3PZGA 5JU6A 1RH9A 1CXLA 3WF2A 1ZBKA 5BRQA 2V5DA 1A3HA 1ZAHA 2VEPA 4A4AA 1T5AA 4BQ3A 1UC5A 3H70A 1TIMA 3KHDA 4M6QA 5DY3A 4Z1BA 4D1JA 2Y1HA 3ABRA 1UKSA 4IIDA 5MHBA 3RO8A 1W9BM 3O63A 4YJ5A 2ZDSA 1PUDA 4RK8A 1TZ9A 3RHGA 3UW6A 1HJUA 4OGZA 4CUCA 5JBDA 3BOXA 1R38A 4JBRA 2AGTA 2IPJA 3C2EA 3WN6A 1E51A 2X8RA 1TG7A 3IUIA 4DI8A 4XIMA 1R87A 1NEYA 4UTJA 4RE0A 4XO7A 2DJXA 4OECA 5CBIA 1VFTA 5HATA 3SCPA 2NLIA 3ZLFA 2C18A 2HE8A 4IJCA 2X42A 4W4QA 3W1TA 4A8IA 3DERA 4F9JA 2JIWA 1FHLA 2ZQ0A 3H7UA 4M51A 4OJPA 5FAJA 2QDEA 1XLEA 4JQAA 3QKZA 3WNLA 1E4LA 3ZSSA 1VBGA 1R47A 3EX4A 3CL7A 1OY0A 3QBUA 3M4HA 4EPDC 2AL2B 3DC8A 2AAMA 3H2FA 4F0KA 3W7PA 1KTBA 2FGBA 4I9MA 3Q37A 3CWNA 2FPVA 3KHJA 3AICA 4A3YA 1F3TA 2DUAA 4LALA 2DIKA 4H8UA 1TVPA 3TSBA 2ZC8A 2A5HA 1CLVA 1GHSA 3TJLA 1REQB 3GU9A 1TJ1A 2VTFA 3T40A 1SW7A 5CJNA 2VO5A 5I3DA 3ARRA 1B31A 3ARTA 3TH6A 4N7QA 2HISA 3PR2A 4J4KA 5HBFA 2E67A 3OODA 1ZZMA 2O7SA 4UTMA 1XLBA 3VTRA 1S1RA 2HVMA 5HULA 4O19A 4YIWA 2W79A 3PJTA 3A4AA 1Z6KA 1KBLA 4Q8TA 4UOQA 2W62A 1VYPX 1GORA 1DWGM 4GI9A 4QQUA 4LYKA 2AQWA 1MQRA 3TFXA 3H2OA 3WD0A 4O57A 1HJXA 4MADA 5A8PA 3HG2A 1XS2A 2FGLA 3O0KA 4S38A 3G0UA 3B8UA 2VFGA 3AUJA 3BSGA 1TV5A 3GQYA 1GVQA 4JTFA 2G3MA 2PP1A 3W7NA 2DZAA 1IXPA 1H1ZA 1W1IE 1E9LA 3LBCA 2B7OA 2PGWA 4M81A 3AHVA 3GUGA 4DJFD 2I5GA 5T91A 3QKEA 4QGCA 4GYKA 4Q7BA 5MKGB 2FFCA 4JTLA 2ON3A 3F1QA 2PCQA 2GSJA 3R10A 2EKGA 1OCBA 4IBGA 2FZBA 2ZOXA 1S1PA 3LBMA 3ZOAA 4MG4A 1QMLA 3ABZA 3FJ6A 4NHVA 1FY6A 4Z1AA 1W5MA 3FKRA 4FNTA 3BMVA 2J7GA 1V3MA 1W54A 5A6AA 3HOJA 3HG4A 3LRMA 4P7QA 3SCUA 3N9SA 3EDDA 1JI2A 3TMQA 4GPNA 3ZVIA 3B9DA 2HPMA 2R1KA 5BWFA 3R89A 3TTYA 4H9YA 3LGDA 4FX8A 1UWAA 1EO5A 3H7VA 1Y5VA 3NUKA 4G6CA 3V16A 4CD4A 3N15A 1H7PA 2EQDA 4PCNA 1FWSA 3WD4A 4HHMA 3T42A 3LHUA 3SCQA 2CFFA 3WNNA 3KW3A 4GJ1A 5EGRA 2DZTA 3VO0A 3RR4A 1E6XM 3UYIA 5FOOA 1CXWA 1UR3M 4UTKA 4WZHA 3RLUA 1MXSA 4LYRA 5AHMA 4MKNA 4X63A 1OC7A 3IIOA 4OJOA 3UERA 1RXOB 1A0CA 4AIBA 4NYUA 1X98A 3HQNA 4B91A 2DQXA 5LIXX 4H2HA 2Z1SA 3GK0A 1SFSA 4ZB5A 5BRPA 1R3YA 2CHNA 3W81A 4CEUC 3LQGA 3H6OA 5HINA 1ADSA 3PZMA 3WH8A 4IP5A 4GWEA 1KFWA 3GNRA 2WKGA 3J7HA 1ME7A 1MUCA 1HT6A 4WKHA 2B7QA 4UQDA 3VD7A 4AYSA 1CZ1A 2OQLA 3G24A 4A8NA 3TWBA 1EF3A 5AY7A 1FRBA 4RNJA 1D3GA 1VJZA 3FA3A 1Q7QA 2ZRXA 1LDCA 2FMNA 3CT2A 3ITCA 4JIPA 2YKKA 3T0BA 4JTDA 4FR6A 3GH5A 3MKVA 4ROPA 4IQEA 3R12A 3JVAA 3B8TA 1VGAA 3QY8A 3CUHA 3KS5A 1LOSA 2R6OA 1ONEA 4EX4A 1LL6A 3FHAA 4QITA 2HXTA 4FOUA 5DRIA 1KR1A 5CC5A 3EX3A 4O1CA 3RCNA 7CGTA 3N14A 4LBSA 3FSTA 4HMDA 1GJUA 2YBUA 4GNKB 2VGGA 1K7EA 1MYRA 1VEMA 3CXOA 3EEGA 3M7PA 3QYQA 4MYXA 1XH0A 3A24A 1R7OA 2X7WA 3CQIA 5G1YA 4JFWA 4XTDA 4MLRA 4IICA 2VRJA 2YX0A 4HJFA 1EP2A 2FVKA 2VR5A 4GIRA 1VHNA 3VNIA 1LJYA 1K1DA 4AF0A 1MO0A 1G01A 3W75A 4MB3A 2DEPA 4L1GA 5T8GA 1AW2A 1FWHC 3DXIA 4HYWA 3PFMA 2Y7FA 1YDYA 3JUGA 4KRZA 3O6CA 1W3KA 2WBGA 3ALFA 3WMLA 3HGJA 4HU0A 1Y8BA 3CQKA 3KBVA 1QASA 1Z9AA 4S3KA 2YR1A 1RVKA 1VFFA 3VGDA 2Z6JA 4AC1X 1PPIA 3VKAA 1HQTA 1TWDA 3MTWA 1HJQA 4B3ZA 2RTSA 1M6JA 5DO8A 3W1UA 4XAGA 1PWMA 2WVSA 1DORA 3A3HA 1HL9A 1VFSA 2XN1A 2GJXB 4ACZB 4C7GA 3W6LA 3P8JA 3GTFA 1R2SA 2VEFA 1PDZA 4WX2A 1QOPA 3TFCA 1XSIA 4A21A 1XYZA 3AC0A 1U33A 1UKPA 3W1NA 4H3DA 1MW3A 4S3BA 4V15A 3RM9A 1IXOA 3LS9A 2D2HA 3E1F1 3IGXA 4XZ9A 1HVQA 1THFD 2VELA 1E71M 4D6JA 3R94A 3I3BA 4C6FA 3AMLA 3MMUA 4M82A 3TCEA 1JVNA 1GZJA 3DKLA 3KVKA 3QH2A 4NAEB 3SGUA 1FP9A 3GG7A 3LPPA 3G8RA 2JFEX 1KWKA 1GW1A 4IX0A 1P0BA 4N6EA 1S5MA 1H09A 3QPEA 1QVBA 2XYLA 1WXJA 1OFBA 4C6OA 4QEHA 1E0UA 4FNQA 1TMHA 5D02A 3PWAA 2C6QA 2H3DA 3KCJA 4GBDA 4DJDD 3B0XA 2WKLA 4GZIA 4H00A 4ZXLA 4ZSTA 4JTAA 2OGYA 4FIQA 3ZR5A 2Z1BA 4AVFA 1CPUA 2CXGA 3AAMA 4P8UA 2V3DA 4BQ2A 4RW3A 2B31A 3WLQA 4MKVA 1RD6A 4QG9A 4TVDA 3ZO9A 3W7MA 1X6UA 3SQLA 3T0DA 4GIAA 4A3UA 4JYEA 2EPOA 1L0PA 3S5OA 4AYGA 3CPGA 3FDKA 2R8WA 3RLVA 3TOPA 3CTTA 2J74A 4JX5A 3WD2A 4MJ2A 4RPQA 1XLHA 2ACSA 4AD4A 5DQPA 4WF7A 1E72M 1IYXA 5REQA 3BLFA 3U0HA 2J9ZA 3LCIA 3NSMA 2DJLA 2B81A 3TAOA 4LUSB 4CQBA 4L6DA 3O6AA 3W3OA 1K8CA 4A35A 3KS8A 1BWVA 5ABGA 3LY0A 3W00A 4GZEA 3T05A 2GVEA 3CIVA 4WOZA 3B97A 4B5WA 4CU6A 3W86A 2FPYA 4ZR8A 3RCYA 4HNNA 4MY9A 3O16A 2D1ZA 2DZUA 2WM0A 2IW0A 3M64A 4ORIA 1AH4A 4JN7A 2X1SA 1U1JA 2GJNA 3MZ2A 2QUMA 3REQA 5G2WA 4Z1DA 3CV1A 4JEJA 5JIPA 2DVTA 3W07A 3V1HA 4Y9MA 2WSYA 4NI3A 4DJDA 1B3WA 1PEZA 2W0UA 1XIBA 4HCHA 1EEPA 3C0LA 4C1NB 2XGIA 1VRDA 1TQXA 5DELA 3RYSA 2DUZA 1H49A 3MHGA 4Y90A 3GKFA 1HKMA 1PZ2A 2BY3A 1VF8A 1KCXA 1OB0A 3IJIA 3G77A 4Z2IA 5HJYA 4DUVA 1ED7A 1YE6A 3MI2A 5DLCA 2ZUTA 2NQ9A 1R85A 1OFEA 5IXEA 4XO6A 2WMJA 3NQDA 1NFGA 3APGA 4NZFA 5J5DA 1TZ7A 1V3IA 2E6DA 4TR9A 2REQB 1XFBA 5DCBA 5EFDA 5C7HA 1TJPA 1GYLA 2G3JA 4MNMA 4GQGA 3WDPP 5FA5A 1M01A 3I6RA 4YTSA 2ZUWA 3DDMA 2PMQA 5CPLA 4AG0A 1IWPA 3KX6A 4ZQNA 4W93A 4MUZA 3W24A 2ZZ7A 5A2AA 1BWLA 1P1MA 1BQGA 1C3FA 3DFSA 1ME9A 1W17A 4I7WA 4U5IA 5HPCA 3ERPA 4FX6M 3PK7A 2PU1A 1GW9A 1TE6A 1FWWA 4UTLA 3MMTA 1UR0A 3CWOX 1PZ0A 3IACA 4UNIA 1A5KC 1KWGA 3PVFA 2VCBA 3EOLA 2F2HA 4EXQA 4IFRA 1GHRA 2EJ1A 1ZB5A 1XC6A 1TCDA 3P84A 2J6XA 1JYXA 2HROA 3RJYA 3THQA 1LT7A 5CLWA 1P1XA 4GZ7A 4QSFA 1A5BA 4LAMA 5DBTA 3PBYA 4H1ZA 4U33A 1ME8A 3PAOA 3VXGA 2GYIA 5DXYA 5C7VA 2PRLA 3LXBA 4B3KA 4L64A 1KO0A 4GXWA 4H6RA 5IDIA 1X8FA 4GY0A 4WIWA 3LYEA 4J3SA 3QC0A 2NX1A 3N6HA 3ABOA 1RJQA 4PMRA 3VD5A 1OJXA 4O50A 5CC7A 1L2QA 3AXMA 2KZHA 4UB9A 4L4PA 2NUYA 3U4FA 2PLMA 2PDXA 3LLXA 1V0LA 4WY0F 2Y8KA 5CSRA 4XTIA 1S5NA 2AL1A 2CESA 3LTSA 3AU2A 4GD0A 4KWUA 1QNOA 5EA9A 1VIZA 4JIQA 3GKAA 4Y9PA 2VZSA 4YTUA 1TWIA 3WJWA 1JQXA 3L4YA 1XW8A 2EPLX 1MNZA 2V63A 5C9WA 2D2JA 3SRKA 2H9AA 3GVWA 3UCDA 2RUSA 3DYMA 2BVTA 4UQAA 1WV2A 1CWYA 1LLZA 2EPMX 2OLAA 3ZYZA 1HVXA 2XVGA 3HQPA 4CNSA 3A4WA 1IEQA 3LMYA 4CD7A 5DN1A 5FF4A 3H8AA 3FJNA 3PB0A 2Q71A 2ZTJA 4LUTA 3LCFA 4KBXA 4PBEA 4FO4A 3AROA 3SRHA 5LA0A 4JN6A 5D9NA 4H7CA 4M6VA 4HSNA 2XIQA 4EWND 2C15A 2J7CA 2D0FA 3VKJA 3ARZA 4P8WA 1JGIA 3CHEA 1RHCA 2QW5A 5A6BD 1BYCA 4RPPA 1FH7A 1VPXA 2UY5A 2V3EA 5AYBA 3BG9A 1W6TA 1AQFA 2DDXA 3TK7A 3MYOA 3TW6A 1UJQA 4IPLA 5IFTA 3M0KA 1Q13A 3W28A 4F2UA 1T0OA 2VZVA 4BI7A 3VA8A 4BI5A 4N9BA 3VGEA 2ACRA 1MQPA 1CK7A 1YU4A 4WJ8A 2WCGA 3HGRA 4Q4OA 3GXMA 1P6CA 2EKCA 5CG7A 4ATWA 2EG8A 4EPBC 3VM5A 1TO3A 5HR7A 3A4XA 3P61A 4AEFA 3TWAA 4GACA 3LV6A 4AZCB 4AZIA 2VZUA 1QT1A 5C2XA 3GNNA 3H24A 1SPQA 1Z7AA 4GNVA 5C2CA 2B4GA 4PBGA 3C2OA 1DIOA 3I6TA 4UFLA 2WSKA 4BR1A 2Q09A 2J8TA 4XK2A 4I9AA 2F61A 4DZIA 4W87A 1QXLA 4LCSA 4IQLA 4HA4A 3F5LA 3WEOA 3AZRA 4UNLA 2X40A 2V82A 2OT0A 3AYSA 2Z6IA 3HO8A 5M17A 4WJEA 3UJFA 3L21A 2E7FA 4MFEA 1TPWA 4NX5A 1LZOA 3VIHA 3HQ1A 4I5UA 2BY1A 3M0JA 2OWCA 3NGJA 3OGSA 4U10A 5CKSA 4JTEA 2QCGA 1RP8A 4GH3A 4KEZA 4W8AA 4KT2A 1KGUA 2GPTA 3BC9A 4LEFA 3BGAA 2QDGA 3KWXA 1EQCA 4AEEA 4IWWA 4LVFA 4M1RA 1J2WA 1AZ2A 1P43A 4B92A 1ZSXA 3L5AA 1OCJA 3LRKA 4AH7A 5A6BA 2CHOA 3AIQA 5HMEA 1XSKA 3NQVA 3FCPA 5BZAA 4IMEA 3CMGA 4J40A 4KEMA 1F8MA 4PMDA 1TPB1 2FLIA 3IJ7A 4A8LA 2VFEA 1D7KA 4EWJA 1VEOA 4YTQA 4CNOA 1NDVA 5I78A 1Q6CA 1EP3A 4LVDA 3WMBA 1WP6A 3WF1A 3TJ4A 4JD4A 1BD0A 1OHLA 2BGQA 2XG9A 2JEPA 5D2VA 1EF2A 3NQ2A 4AWUA 3UNTA 1ZP3A 2E6AA 3UU0A 4TX8A 2TAAA 1JPHA 3KOFA 3LNPA 1SYTA 4K8GA 1ISZA 4O1DA 3W25A 2OGJA 1TZZA 3GNPA 3DH7A 3LLFA 5ECVA 5M3WA 1EBGA 4BY3A 3VIKA 4G56A 4QJ3B 3HJZA 5BXPA 1KKOA 2FDSA 1DWAM 4JNMA 4UC5A 2RJHA 3UWUA 4HNCA 2VC7A 3W7IA 1J79A 2OYLA 3NXLA 1LRQA 3QVQA 2JE5A 4YWIA 5TAOA 1GK8A 1MI3A 3QPYA 4QX4A 5LGZA 1KTCA 3DFTA 3IEBA 1Q4NX 4D6EA 3KCLA 3GC5A 1SFLA 4IMFA 4ICMA 3CQ0A 2R14A 4W7VA 2EJAA 5LXEA 1B4KA 2XWEA 1RZMA 4FOKA 1HTIA 1WKEA 3CYVA 3ZJ6A 4AHOA 1XKYA 1TX0A 5D09A 3NL5A 1JJKA 3LTPA 4ICCX 7PTDA 1R6WA 1UA7A 4UFKA 4OVXA 1W1ZA 3CNYA 3UZZA 3GUWA 3BAIA 3ZQ9A 3BOLA 1XLFA 1J6PA 4WGHA 4KWOA 1P6BA 1XIMA 1F8IA 2ZICA 3LCXA 4H6KA 3C56A 2FQIA 1XYFA 2W3ZA 1F6YA 4N2YA 1C7TA 3BLIA 3JR2A 3ES8A 1W1VA 4B16A 3CZJA 2ABAA 1JPDX 2L5HA 1AJ2A 4H9XA 4F0LA 3DYPA 1PKMA 4GGHA 3W2KA 5A6LA 3BJSA 2WHLA 4JQ2A 7REQA 2Z28A 3IJ9A 5A1AA 2GGJA 1NIUA 4WVXA 5GQBA 1KW1A 4MNKA 5I77A 1ECQA 3GFZA 1EGVA 3AMDA 4TU1A 4K8HA 1MNSA 3EGJA 3VIMA 1PX4A 3RU6A 3EMCA 1XDJA 2I57A 3MUIA 3ZJ7A 4DXXA 1J9YA 4LWWA 1Y65A 3E2QA 5BCAA 1I2RA 5LNRA 4LGXA 2WQPA 1FCUA 3ID7A 1HKIA 2NQ5A 2VQTA 4DBEA 5K9DA 3V5FA 2J9YA 5IRPA 2DSVA 2PS2A 2YGYA 3EMZA 3V5CA 1GOKA 3MDUA 2WLZA 3I7QA 4PTXA 4IJBA 2WNQA 4CCCA 2FVLA 3BGGA 3WEZA 1JYVA 4S2BA 1LM1A 3O3RA 2JCHA 2UZ9A 4MYAA 4GI8A 3AMGA 1O66A 1J0KA 9CGTA 1Z42A 3PJWA 3UA4A 3AALA 3T9PA 4C60A 2Q02A 1W8GA 4DI9A 4JICA 3VVGA 4QE5A 1SM9A 2IPWA 1BRLB 4PMQA 2GUUA 3URNA 3VOHA 3PTDA 4W86A 1BHGA 4ZQOA 1ZHAA 3IGSA 3QZEA 3WQFA 3OZOA 1MQQA 1A50A 3XINA 2D73A 4GFSA 3SIMA 4HPXA 1L6GA 3KOYA 1RJPA 3HPAA 2OT1A 3BQ6A 1P0DA 5DMMA 4RZ6A 2O56A 2HE5A 5JXQA 1EC9A 4JNZA 3GDLA 1EOKA 1B3ZA 2ZKMX 5MF5A 3INPA 4ZB2A 4HZ8A 4NP7A 4UTHA 4R3UA 3N4EA 2NSXA 3W2LA 1RD5A 4J3XA 1V0NA 4E8DA 4CN1A 3GHTA 3WJSA 1QK2A 1E9IA 2VZOA 5IBXC 1ONRA 5LNVA 4HK5A 1NH6A 4JX6A 4JL1A 3CZLA 3NDYA 4IP7A 1QFEA 1DIKA 4FLSA 3WLKX 3JS3A 1YLVA 5F1VA 1GGOA 3NOEA 4MHBA 4NQ1A 1QR7A 1S2VA 3PZTA 1WDWA 2DORA 3HGSA 3NG3A 3S5YA 1TWZA 5CJ5A 3M0MA 3VIFA 3LM7A 2QPSA 5DBUA 2Y2GA 1UKTA 4WSKA 3F03K 3S9IA 2OLHA 3SGGA 3VOFA 1X1OA 3L4ZA 3HSHA 4RL3A 1YDNA 4PODA 1J5SA 1U83A 3KAOA 4M29A 3VAVA 2BXVA 4HMEA 4JS3A 1CGTA 3UZ5A 2V0TA 5EMKA 1DKWA 1OBAA 4MZ1A 3GXFA 3TSMA 2PLKA 4I5RA 1FXPA 2WLYA 5A69A 3UPMA 4IBCA 5J5RA 3PZVA 4AWTA 4Y9NA 3ZLGA 2FJUB 1G6CA 3S6TA 3UWZA 3RRAA 4NI8A 4AW7A 2EF9A 5HDRA 3OGVA 1V6YA 3OW1A 2PDYA 2WHKA 4R7WA 3PY2A 3DI1A 3T07A 3SRDA 4V33A 3ARXA 4HNVA 2J24A 1V02A 2WNNA 1AMKA 3O07A 3PNUA 1EDTA 1EP1A 1QNPA 3QW3A 2VDHA 4DO6A 1TB3A 2QMKA 4C6LA 1XL9A 3GXNA 1Q6LA 1P0EA 3N2TA 1CGWA 3L25A 2WYSA 2C13A 3A3WA 3TMLA 3TOYA 2PGRA 2LLEA 5K9XA 1OZQA 3SEPA 3IAQA 5G1MA 4DYEA 3N34A 3WBEA 5K3VA 4X9YA 1DHPA 1OYAA 3W01A 4GE8A 2DUXA 1DXIA 2PDGA 3OBEA 2ZZ2A 5BXSA 1DXFA 4GYFA 5D38A 1G69A 2GJLA 1UZ4A 4N9EA 4RKAA 2ZZ3A 4MWAE 1ZAJA 2V5LA 2VQUA 3OQ8A 2YCIX 3EBVA 1V08A 2Q8LA 3VIPA 4MY8A 1RK6A 1L8NA 1ZBWA 2PF8A 2WC3A 2DSWA 4AWEA 4WK9A 7ODCA 2W66A 1C92A 1V8EA 1R0MA 4PTDA 1CXEA 4IJFA 2DZVA 5TIMA 1Z32X 1A5CA 4M1BA 4IXXA 1EJ7L 2PURA 3TJIA 1FCVA 1R86A 3MYPA 4PEKA 4PB5A 4TQTA 3WK3A 1Q5MA 4NXKA 4R53A 1KV5A 5GJPA 4UTWC 3EB4A 4DJFC 3LDVA 4QAWA 1VFUA 5KZ6A 2Y4SA 1TX2A 4AZGA 4K1GA 1CXKA 1AJ0A 4Q4PA 3WJXA 3T09A 4C1KA 3VCRA 4C5ZA 5H2ZA 3KTSA 1W1TA 1KBJA 4YYFA 4F0RA 4MJMA 1EJWC 1OADA 2BDQA 4DYKA 2XZ7A 6ALDA 4GUHA 4JY8A 2C1HA 1JULA 1OWQA 3CUJA 5HNNA 3G18A 2ZE0A 3E9AA 2Y2PA 3SADA 3TTEA 3BANA 2FMOA 2W4XA 5EL1A 1A5UA 2AL2A 4G1NA 1HO1A 5JIWA 4AHQA 1SO3A 1KRAC 4XISA 1N55A 1QHPA 3N13A 4MTVA 3SO7A 3WBXA 5D2YA 3MHUA 5FEWA 4JTQA 2ZDRA 4X2PA 2RGLA 2XTKA 4YNGA 3W7DA 1FBAA 4WDTA 4LY8A 1GEHA 4D6DA 2DSKA 3CL8A 5AYYA 1AG1O 3TQVA 1B57A 4AQLA 1REQA 2AKZA 1LWIA 1WO2A 2HK0A 4CQ8A 3RILA 2OU4A 5FEPA 3T6CA 4R5EA 1KC7A 4PB3A 2OFJA 2IKJA 4UMCA 5CJMA 1NJJA 4Z0SA 3D3FA 4KEUA 1S2AA 3T1GA 3UWEA 3HG3A 2BS9A 2PWVA 4OE7A 4LT9A 4XVEA 2XIOA 4CU8A 3L4WA 2C0HA 3POCA 4EKJA 3WELA 3A5VA 1OF6A 3AIEA 1PVNA 3RR1A 3T0CA 1PV8A 2NT1A 3LCGA 3T2OA 3VOJA 2WSQA 4J27A 3PG8A 5FI8A 5FACA 1C8XA 1VFHA 3STEA 1C9DA 3QQWA 2G50A 3BLLA 3MSDA 4C6NA 4QM1A 2QUTA 1GVOA 1IWBA 4PR4A 5A8MA 5AYZA 2NVDA 1DWHM 3LHYA 2CEQA 3N3TA 3RPMA 1PDYA 1IZCA 1HUVA 4Y8EA 2PI6A 5MKGA 3IVUA 1UD8A 3LTYA 2BVDA 4GOAA 2GGGA 3NEHA 3H12A 1ICSA 1I60A 2G97A 3S5SA 2CWNA 1LLWA 3OP2A 2OOFA 4PBFA 3VD3A 5E5CA 4FXSA 3PUGA 3FY1A 1E4NA 4W8LA 2ISFA 3ECQA 5BMWA 2CC0A 2PBOA 4N9CA 1KM6A 1F3XA 3MPGA 5AC4A 3WQWA 1M65A 4KGLA 5FSDC 1IIHA 3PHAA 2WZEA 4OKDA 2YBVA 2GLKA 2Y8UA 3K4AA 4RE4A 4HNUA 5L6UA 4FP1A 3NVDA 3WQCA 2FPTA 3IRDA 3T2PA 1A0EA 3IJ8A 1TWSA 3XIMA 3UXAA 4TTGA 2E8YA 3N2CA 2YA2A 2D3NA 3ZM8A 2BGSA 4ENLA 1XBZA 1PKYA 3KCOA 3WCZA 3MA8A 2I17A 1OQFA 3BCFA 4L80A 1DJNA 2E6FA 2YXXA 2HZGA 3MV11 2WMIB 4YHGA 3NL2A 5EKYA 2P10A 3CU2A 3VUPA 4XZBA 3LX9A 3CB3A 5CBJA 4WY0B 2ZA3A 2INFA 1TMQA 5GJNA 1BG9A 1W0MA 2C14A 4QLJA 4H83A 1PYFA 2H8XA 3PS7A 1L6YA 3CAWA 4Q8OA 3L5LA 5C6MA 4FS9A 1TPDA 4R27A 3T4CA 2YXOA 5H8UA 2YOCA 4LNYA 1A5MC 4QJ1A 3CLMA 5H1WA 1JNDA 2DGAA 3O06A 4FI4A 4JYDA 1W3JA 3FA4A 3QOKA 3FLUA 1EL3A 5F2LA 1EDQA 2QIIA 3KTXA 2IOUA 4Y8FA 4DBSA 5I3GA 3RUBL 1C7SA 1OGSA 3LGEA 2HSAA 3CWHA 4XZIA 5EY5A 2GDVA 3WK0A 1GOQA 1VFOA 5GNXA 4UQBA 2P0IA 5FJJA 4X2RA 3SCRA 4GHRA 4PMXA 3S6OA 4IX2A 4D8AA 3K4WA 5LNSA 4URIA 1QW9A 4NU7A 4NJJA 4G8TA 3M5VA 3KXQA 3PPHA 1VP5A 2ZA1A 3TTSA 1IGWA 4UQCA 4A2SA 1EIBA 4AMCA 2TODA 4HT3A 2PDFA 1XUUA 3AHZA 1KLZA 4NVTA 1H63A 2ZXQA 4C7DA 2AGKA 3CPRA 4RE3A 4HOXA 3S1XA 2QCLA 3AZSA 1AIWA 2ATSA 1CENA 4E4UA 4CU7A 3VNYA 3UXIA 4DVOA 1W37A 8TIMA 3NFUA 2PF0A 5C71A 1FHDA 1S5TA 3M0LA 4PGLA 4C6IA 4ZTXA 5HQLA 3LHZA 4KH2A 3H4XA 4ZODA 1JGMA 3S1VA 1WBHA 2VGBA 1IHIA 4PMUA 1SZEA 5A8GA 3MSRA 4RXFA 3M0HA 2C7FA 1CTNA 4LVAA 2CLFA 1DJHA 1VS1A 2FZDA 3L28A 3VILA 2FFIA 4IF2A 2CYGA 2PD5A 1MW1A 1XLGA 3UG4A 3GR7A 5CPOA 3TN6A 2E1WA 4PL1A 3XISA 4ACZA 1XG4A 3FGCB 4ZMGA 3WQOA 4PB4A 4NJHA 4M80A 4C6DA 3DGBA 1J4EA 2BXZA 3W26A 3I10A 1Q2RA 4HHHA 5I7GA 5HOSA 1CB2A 3M07A 4OJ6A 4KGJA 3IVSA 3K46A 1R2TA 2XSAA 2C16A 4QQ3A 4WCJA 3EX6A 3AS3A 1P0NA 3VZZA 3BQ5A 4K39A 4NAEA 3TC3A 4N0RA 1T7LA 2ZBTA 3NL3A 4OT7A 4QCFA 2OX4A 3WYZA 4GJIA 3QTGA 3WNOA 3WK2A 4MY1A 4DAIA 1EJUC 5D05A 4ZQMA 1TTPA 3R1ZA 5GJMA 4NJGA 5K9CA 4OOZA 3KL5A 4AZHA 2VXNA 2XU2A 3BUVA 3HIJA 3WF3A 1U22A 1KXTA 3THCA 4XAYA 3HPXA 1XQLA 3O6DA 1JIBA 4INFA 3VZXA 3FX4A 3QV7A 1WZLA 4QS5A 1X38A 2XISA 2J7FA 3UPWA 2HQAA 1J11A 2E9MA 1SJDA 3NL6A 3LU2A 1KFKA 4JGDA 1HP5A 3GLCA 1O5XA 2A4AA 4RR4A 1KM5A 1J5TA 1NP2A 1MZHA 2X0HA 2FYMA 1I9CB 3T81A 1ONWA 5TD4A 4Z2KA 1S2WA 3OVRA 4FF5A 2J7DA 2XVLA 5CPSA 4XZHA 5AHEA 1MXGA 3C0QA 1J7MA 1LQ2A 1FWBC 3WH7A 1YDVA 4H4IA 4K38A 3CQHA 3LMZA 4Q3MA 5FJTA 1JQVA 2GVJA 3TE9A 3B8SA 1ADDA 1KQYA 1VEPA 4XQ6A 1P7TB 4O17A 3SCOA 4IIEA 3W2NA 4L7ZA 2ZX8A 2PWGA 1FCQA 4EANA 4JNYA 1FWGC 3K4DA 1OFRA 4LUSA 2O9OA 5EPDA 3CH0A 3EPMA 1KFBA 3ZMRA 1E6SM 1RQHA 4A05A 3B0YA 1IZJA 3MMDA 2WVUA 1M7JA 5A2CA 2PDHA 1EX5A 3W82A 4NJKA 3GZAA 1EB3A 2WZMA 1HGWA 3B04A 3ZXWA 2DT2A 2OSWA 1UQZA 3RM4A 4YYCA 2FB2A 3FYOA 4QEEA 3ITGA 4YS1A 2AQOA 5C9XA 1XCWA 3W74A 3DHUA 1OD0A 3I3EA 5KSWA 3E2RA 3S8HA 1E0WA 1F9CA 3T08A 1UP3A 5BXRA 3NZGA 1JNEA 3TIMA 4NZ4A 3LHTA 3KWSA 2PRHA 3W7JA 3WJZA 3AISA 2Z27A 4C1NA 4MGGA 2Z7GA 5FF2A 3B4UA 1Z89A 5BWAA 1TTIA 3KBJA 3NM3A 1JCMP 3SQMA 3YPIA 1JUBA 2QCDB 1H7RA 3SN0A 2UV8G 2Z26A 2WK2A 2YIHA 3QZAA 5FJUA 2GUBA 3URQA 5A95A 1D7FA 3DIPA 2O92A 2XDFA 3OVGA 3W1XA 1E6NA 4M5PA 3VNKA 2REQA 1Y0EA 5LIUX 1UYQA 3PZ9A 4ACYA 4D72A 1E15A 2XINA 1ITCA 2YBTA 1WXYA 4DM2A 5DANA 4JOMA 4XKMA 3S5NA 3KM8A 3WQ6A 1ICPA 4FXJA 1W9PA 3SDOA 1DQXA 3AXKA 5IHRA 1R7AA 3QSRA 3NPWA 4ADTA 5CQ1A 1PWLA 3MU7A 5FL0A 3PPCA 1VYSX 3ITXA 3NQCA 3R25A 2QULA 3O2LA 1V6UA 3GDTA 3W29A 3MUZ1 3R8GA 1MDRA 4QHRA 2OOGA 4O53A 2XH2A 2P88A 4CEXC 2QDDA 4E3VA 4AVOA 2ZA2A 1UD4A 1VBRA 3GTHA 1SZRA 4LRTA 5JVLA 4AX6A 2F8QA 1AA1B 5KINA 4LNCA 1MFUA 3LRLA 1VIWA 4E6MA 1QHOA 1BFNA 4DZ5A 1RY8A 4HJWA 1E0TA 3MT1A 5AVHA 1RV8A 5AVNA 7A3HA 2WWCA 3GDMA 1ODZA 3MUAA 4UCFA 2YA0A 1QWKA 4LU0A 1X7IA 1UWSA 2PPGA 5DCDA 2VJXA 2QXWA 2PWFA 3WLHA 2GVYA 1CGXA 4GZJA 4C6PA 4Z42C 4JQ1A 4MIMA 4EAYA 3QMTA 4UQEA 1PX3A 3V0SA 4RE2A 2GJRA 5I0DA 5KEZA 3N3MA 3MUXA 4NAFA 3C0JA 1F61A 4TVCA 2VEGA 3NO3A 1TMLA 3UETA 3W9ZA 1JFXA 2ACQA 3QHOA 1VCFA 3N17A 1GJWA 1E8BA 1GOWA 4PZVA 4UFMA 2W61A 3TN3A 4Z2HA 3P2VA 1QI3A 5BXTA 3L67A 4HNOA 2HS6A 3STFA 1JPIA 4LW7A 1U1HA 3S47A 4O0ZA 3NPUA 4GXMA 1XGZA 3DFYA 2PDIA 5D04C 1NWTA 1QCWA 2Y2LA 3NQ7A 4J5NA 4TUFA 1YE4A 2X41A 3ENLA 1EDGA 3RO6A 3LERA 1LBFA 1JF5A 3AXXA 3OO2A 4GUJA 2BNJA 3SECA 3JZEA 4I7UA 2OZ8A 1LWHA 3UG3A 4XWUA 2D24A 4IGHA 3PTQA 3B9EA 2O9TA 4HMCA 2V5KA 4F79A 2IPGA 3QR0A 4PCPA 1ODUA 3WNMA 1EC7A 1OCQA 3OPSA 3V4BA 6PTDA 3E0FA 1P0KA 1OC5A 1T6MA 1WZKA 4MWAD 1E1EA 2BVWA 3KE0A 4IBEA 4EK7A 3G1YA 2NW0A 3CO8A 1CGUA 4D71A 1QO6A 3MJYA 3W0KA 3H23A 2QV4A 1ML1A 2PDCA 4GO8A 4KIRA 5D33A 4UFHA 2ZRZA 1KS0A 4Q32A 2BOGX 3MVIA 1AL8A 2QNEA 3G1HA 2POZA 1NF0A 4MAVA 5D2WA 4RZBA 1XWYA 3VNMA 3D0CA 2QS8A 4OBSA 3VNDA 4MPQA 1QNVA 3G0SA 3W87A 2B7PA 2A85A 4ZB0A 1BVZA 4PUMA 3M46A 3WLNA 4PEEA 2PU0A 1YXDA 3MJMA 4R9OA 4Y6GA 4Q6XA 4NSBA 4YL2A 5GNZA 2J7BA 3P0XA 2PDQA 3QJAA 3V0UA 3GNDA 3UWQA 3LCLA 3GDKA 4S39A 1VKFA 1K8YA 3FDGA 1EH9A 3EKLA 1W1B1 4UXDA 3S2MA 4XAPA 1GPFA 1NDWA 1VQTA 1ZJHA 3PZOA 5AZ0A 3V36A 4M8UA 1HW6A 2PWHA 1UPPA 1D3CA 2R1NA 2Y88A 2HVOA 3D5HA 2VGIA 3QY7A 1DHKA 4JCLA 1JR1A 4CN6A 4FSAA 3WQGA 1RLDA 4ILSA 3GR4A 1N2VA 3SN4A 2W92A 1TRDA 4IT1A 6TIMA 4QG6A 1DL3A 2D69A 2INEA 1ZL1A 2FHBA 1AH3A 4CD8A 3LHWA 3IWPA 2DFAA 5BU9A 3C8NA 2P5NA 2AAAA 1GVSA 1MEIA 1CXIA 4IH3A 4LEQA 3G1VA 4Y2WA 3TYCA 4LV4A 3HG5A 5HNUA 1POJA 1HIZA 5CG0A 2HPIA 1WDDA 1GT8A 3TDFA 1QAPA 4UMAA 5A8OA 5TF0A 2CBUA 1W56A 3VDHA 3QN3A 3UCCA 3S2JA 3PC0A 1LOLA 3WK1A 3VZYA 3N19B 2WMKA 5AHIA 5D2XA 2CLPA 4LXFA 5LHEA 4LVGA 1CIUA 4I9JA 1V51A 1WBJA 4KCVA 3N6QA 4GH9A 4ATDA 9XIMA 3NOYA 3BSHA 3PF3A 1QDSA 1TV8A 4WD0A 2HTMA 3PZUA 1CEOA 3L2LA 4A6GA 3N4AA 4UZSA 3M6YA 3MBFA 4V1YA 1SVDA 1DQUA 4XIAA 4HPHA 3FEQA 3TROA 4PTVA 2FGZA 3W88A 1EJVC 3BLKA 4LUYA 1EJXC 3H2EA 4L4LA 5CZTA 2WW5A 1ZAIA 3G1AA 4BKNA 4ZTYA 1IT7A 1YBQB 2C19A 1K6WA 5ABEA 2PDKA 2E9LA 1BSIA 1H3GA 3KRUA 3ZVHB 1UH3A 3S5ZA 1YDOA 1XF0A 1GWJA 4PFMA 4GHLA 5M2FX 4V28A 4PFHA 4Q4MA 4X0VA 5KZEA 3F4WA 3CUXA 3BURA 5HMDA 4HZMA 1GPWA 1DPMA 1DYSA 3QQ1A 1G7VA 1SSGA 1HL2A 5FKYA 4B9YA 3W84A 1GZ1A 3BZGA 5CSSA 4XV0A 1SR0A 5FJRA 5CBBA 3ES7A 2PC8A 1VD6A 2A6LA 4UTTC 1GKPA 1YX1A 4ASTA 1TVNA 3KDOA 3DEQA 4TIMA 2ZRUA 3A23A 2XH0A 1SMAA 2JEQA 2Q3RA 5I23A 2W67A 3CV6A 5DY2A 1R3TA 2J8GA 3GXTA 1IV8A 3F5KA 3RRXA 1V6WA 5C0QA 3OG3A 2Q8XA 1X1NA 3G1DA 3DN5A 3Q67A 1B3YA 2JQXA 1TV7A 1FA2A 4FIRA 4N4QA 1U1UA 1KNWA 5LYRA 4NZ1A 1XCXA 3I4KA 2YW3A 5K7JA 3T8QA 2QUNA 4QAIA 4P7OA 4IM4A 4PMZA 1WKDA 2CERA 4QR6A 1UIOA 1MEWA 5C5YA 3BAKA 1DTNA 2I56A 2WWDA 3COTA 3T78A 1LRTA 4LYPA 4DO4A 2FZ8A 1AODA 2OLSA 3SY5A 1N82A 1VYRA 1PZ1A 1KXQA 3C2VA 5CPMA 4UR8A 4ATLA 4D8ZA 1IEWA 2PTZA 4G2DA 3TYBA 1SZNA 1HJVA 1BEUA 3E02A 5SWUA 4ZA0A 4F2BA 3VIOA 1NOWA 2ZZ6A 1VENA 4RDVA 5DT7A 3AIUA 2JIEA 4E8GA 1H51A 4FF7A 1I0BA 2CLHA 3RCMA 3MO4A 4C65A 1Q6DA 3WBWA 4XAFA 2PCEA 4GHAA 1XIIA 1Z3NA 3CC1A 4JFVA 1CLXA 4HP5A 1BRLA 4P7NA 4QNWA 5B7YA 4WKAA 1H11A 3W02A 1ZJBA 3FA5A 4ZO7A 4GQ0A 2D23A 2WZIA 5F2MA 3NZPA 3LPOA 1SFTA 3PTKA 3ATZA 4D6CA 1FWRA 4FEZA 3N6JA 1Z8AA 2QMJA 2YL6A 3UVAA 1JYNA 4Q4SA 4TO8A 3S83A 4QJ5B 4GCAA 3G8EA 1XIEA 1VBHA 2QEZA 3O7UA 1A5OC 2QPUA 1H0IA 5T9BG 3CHFA 4OJLA 5D37A 4JR5A 1FCBA 1GG1A 5D30A 1GVRA 1RVGA 2DQWA 4AC7C 4HNLA 4DEFA 5PTDA 4FR1A 3CZEA 5HPOA 4H41A 4JHZA 5CPQA 2YL8A 2E5BA 3S1WA 1M9HA 2QAPA 4HOWA 4PH6A 1JPKA 3MUY1 2ZUVA 3WX7A 2QJGA 1EAKA 3WUBA 3NGFA 3QGAC 2BOEX 1XH1A 3VYLA 1TJRA 4MM1A 5D8WA 3WEMA 4MJZA 2XHYA 1B2YA 1F73A 3ITOA 4JKMA 2PDJA 3PB2A 4PUKA 3OU8A 4R7JA 5I3FA 1XBVA 3BLEA 3GX9A 3AFBA 3HPSA 4DUXA 4ZQRA 1W3NA 3BE7A 2XH7A 3UR5A 3DI0A 2QV5A 5C9UA 3N12A 2OZ3A 1ZY9A 1YHTA 4JTJA 3TQ0A 3UY7A 3L9CA 3SGZA 1YPIA 2EPNA 3UVIA 2WBKA 3MDWA 5G2HA 3SCVA 6XIMA 4M7TA 5DCEA 4B5SA 3UF9A 1GVEA 3VKKA 3U48A 1IF2A 2A79A 2GQ9A 1UCWA 1NQKA 4QXIA 3RLGA 1A3XA 4JPGA 5IBXA 3VFCA 3GXDA 2CBJA 3E2VA 4HQVA 3BCJA 2VCCA 3UXDA 2Z2BA 1GOIA 4U2YA 3KOXA 2XM1A 3URBA 3W1LA 1PTGA 2EPHA 4HMNA 2VWSA 1C8VA 4PSPA 3H26A 2HVNA 2FHFA 1G94A 3OHMB 3MP3A 1TRIA 5LA1A 4DLMA 4MVAA 4W7UA 4NIRA 1HNYA 1KFLA 3CIXA 2ASHA 1W3HA 3FNDA 3II1A 3M7WA 3TN5A 3M0IA 4IIGA 1OIMA 1JDCA 4Y9AA 2VHLA 4IQDA 2HBXA 4U31A 3GG8A 4Q7IA 2NX9A 2OCZA 4LUJA 2NVAA 3M0ZA 3IAPA 2J6VA 5AC5A 4PTWA 2DT1A 2XM2A 3KVLA 3GG0A 1EJRC 1D3HA 4JKLA 3M7SA 3MZNA 3FIGA 3AYVA 2ICSA 4DXVA 3PZQA 1QPQA 4DWSC 1KM4A 1W8SA 3PUOA 3SCWA 2VFHA 4RXGA 1XLMA 4RNIA 3THDA 4IGSA 2P53A 3MCNA 2JKAA 5AHNA 4J3TA 1KRCC 3C2RA 2WSPA 1ADOA 4ZOCA 3WBAA 3WFAA 1K4HA 1XRTA 3R11A 1PHQA 1QBBA 1SR9A 3GFXA 2PLJA 2J4GA 3W1QA 4D6FA 3E3HA 4GI4A 4FNRA 3ZS4A 1ZFJA 1I8JA 4B2DD 2VWTA 4AXNA 1B30A 1C91A 3C86A 4JEQA 4IIHA 3RPDA 4P7LA 1E6RA 2X0YA 4HBKA 3SI9A 2BV9A 1EXBA 3MQTA 1GKRA 4AAJA 1HKJA 2HXUA 2C3ZA 1RR2A 3WQ5A 2X30A 1SGJA 3RN6A 2C79A 4CNUA 4DPQA 2NWSA 3B8VA 4HZ6A 2CITA 4E3TA 3UA3A 1V3HA 1GTHA 3BJTA 8RUCA 4GYJA 5F4SA 1KBIA 3ICJA 2Y89A 1JRCA 2RJGA 5XINA 3EA3A 1TCMA 3BPWA 1P48A 2WM1A 1EGZA 3IGUA 4DWSB 3GG1A 1NTHA 2XH4A 4NX0A 3GE7A 2IKGA 3OZMA 1NWRA 1UW9A 3VUSA 4L9ZA 4ZCWA 3BTNA 4E38A 3Q45A 4OQVA 3MP4A 4FNPA 3TYDA 1UOKA 4JCMA 2QT3A 5FCZA 4H9MA 2ALRA 3DKJA 4NRRA 3C3NA 3AMKA 3DCPA 1JYWA 4F0SA 3G5EA 1TV4A 4UUIA 4XAZA 4UFJA 4DO7A 4I6KA 2D49A 1T96A 3OLEA 3MKKA 3THUA 1OG0A 2OQYA 4JTTA 3CTLA 3KL0A 2CU0A 3QXBA 3RM8A 4BF9A 1V0MA 3G1FA 3UNDA 2CETA 1J8VA 2ALDA 4QS6A 3KLLA 1T41A 4PMYA 3FXYA 4UTWA 1QU4A 3SUVA 4DJFA 3OGRA 4UNKA 1MUWA 1FX6A 3IV8A 3AS1A 3WMSA 4JDYA 1AD1A 3MY9A 2INZA 2J78A 2TRSA 4CGTA 1UP0A 4C6CA 3L23A 3P82A 3EOEA 2BVYA 1J0JA 4GLEA 1J0IA 2XGBA 4B90A 2BXYA 3TXZA 2PDLA 1U5VA 4B5TA 3U7BA 5E0CA 3FKEA 3NA8A 4JQ4A 4A3HA 1H2JA 3WLPA 1NP0A 3EMQA 4OBTA 4GKTA 3R13A 2QUUA 2OEJA 3LSBA 5I3HA 4PCFA 3UGVA 4GK8A 4PMOA 3EDFA 4E5TA 3P93A 1KQZA 1XDLA 1ELSA 4IBBA 2FH6A 2WJFA 3BJFA 3LENA 2HDJA 2JGYA 4A3RA 1JDFA 8XIAA 5I09A 5JH2A 4O28A 5JH1A 1Q45A 2PODA 1HG3A 3LB0A 4YPJA 3UWWA 1UWRA 3UWYA 1HL8A 3DAQA 4WHBA 1P6WA 3CPUA 4LOCA 2O4MA 1FHUA 1T8XA 1RCXB 1E70M 4OBRA 1GEQA 3CUZA 3N2MA 2QVNA 2DT0A 3UR2A 1G5AA 4ONVA 1IWAA 5K4XA 3M44A 3MQLA 3ONCA 4I8DA 1E73M 4ERGA 2Y2WA 4XD6A 3GC4A 3GBEA 4EPEC 4AY8A 4F3HA 2YLAA 2E25A 3UZWA 3A3XA 4AVNA 3WQ4A 3FAWA 1I2NA 2YZRA 2X1UA 4CD6A 2HS8A 1ISWA 2FTYA 1LUCB 1CXFA 4LC6A 3THAA 2PWUA 1QOXA 4K7YA 4WSJA 2ZXBA 5D2TA 3LG3A 1S5WA 4WQ6A 3EX2A 1UROA 3QV8A 4YWSA 4QISA 4BI6A 1RQBA 3GNOA 3W72A 5AC7A 4AD2A 3UR7A 3W83A 3QFWA 2RH9A 3K30A 1F3EA 3VK5A 4U2ZA 3T4WA 4S3AA 3LCWA 1YMYA 4ZFMA 3EB2A 3UWVA 5H8PA 3NTYA 4XKYA 1NY1A 2WMIA 3W7GA 4D2JA 3EPNA 1QW8A 1NFBA 2PTDA 1ZALA 4W5ZA 2GUYA 3GH7A 3G1RA 4KRTA 3NYDA 5E70A 4LBUA 2DIJA 4WY0A 1B3VA 1JCTA 4BEQA 4YU1A 3HB9A 3LSCA 5M5DA 3STPA 2J88A 4CCEA 4PUNA 3A5FA 2O4QA 3TVAA 4Q8NA 4GGBA 3F2BA 2XFYA 4UOJA 1TPVA 4W88A 2A1YA 5M1TA 1BAGA 5EU9A 4WGXA 4IG2B 3CV2A 2QPXA 1H7WA 4GQQA 6A3HA 3MV01 3GIQA 4PTNA 5BNKA 1J6OA 4ES4A 4EIVA 3W37A 3FVMA 2OPJA 3QSTA 1UH4A 3SUSA 1T40A 4N6FA 1PXGA 1V77A 1WDSA 3EA1A 4LANA 4MNLA 1AFSA 2OWWA 3C52A 3U5UA 5A6JA 3WLMA 1GXDA 3MHFA 2YPIA 3W1RA 2XIBA 3WQVA 3L2MA 2BOFX 3KOZA 5BMXA 5T9CE 1NU5A 3AIVA 1ZQ5A 4ECLA 4A2RA 4FPSA 1YPXA 3KZPA 5EMJA 2TYSA 1UWTA 4NF7A 4JQ3A 1XFCA 3VX0A 3IJLA 4IUGA 4EXAA 2UY2A 2Z2UA 2OYKA 3DU0A 4G9PA 4BFAA 4LSBA 1B54A 4HB7A 3GSMA 1YNPA 4DBUA 4V1XA 4GQBA 1E40A 1FKXA 1ZENA 3OIXA 1FWFC 1KKRA 3GIPA 1WDPA 3A22A 3WLLA 5LNUA 4US5D 1RBLA 2A3EA 3R58A 1WUFA 2YDRA 4XUGA 5AZ1A 3HV8A 4B15A 4FX7A 1AZ1A 1LQAA 2QQ6A 3R8RA 2ZRWA 3SW6A 2YZ5A 1S38A 4DBWA 3RDKA 1Y7VA 3B8DA 1A53A 2DSUA 3UCQA 4EPKA 3AJ7A 4KFPA 1A80A 4O1AA 3GU1A 3L65A 3P6LA 4XD3A 3FEMA 1CYGA 3RMJA 4E4PA 3R7MA 3CHCA 1ITXA 5I2UA 1ZJAA 4IIFA 2DSZA 5TNVA 3CZGA 1M5WA 3FGCA 3NZ1A 3VGFA 3S2LA 1O6IA 1MFVA 4IPIA 2GWGA 1VPYA 4HHPA 1KV8A 1JZ7A 4XUYA 5EMMA 4W89A 2GDQA 1M03A 4U3AA 1JCXA 3N25A 3IIZA 2CIPA 3M1ZA 2VC5A 2VFFA 1V3JA 3D3AA 4HA1A 1X1ZA 4IBDA 1X96A 4DB7A 1H60A 1Q6GA 1JCLA 4HK6A 1H62A 1OINA 3ZT6A 1OX5A 3BCDA 3E0VA 3M5ZA 2GVLA 3OB8A 4L61A 3TA9A 3NZQA 2Q8ZA 1NWSA 3U9IA 4ZZ9A 4QTGA 5EBUA 4O16A 3ITLA 1TQJA 2ANUA 2VD8A 3QM3A 2DZBA 3ARQA 1UMLA 3EKZA 4LS2A 4L6OA 2ACUA 3ABQA 3DENA 1QO2A 3L29A 1WZAA 3KS4A 1DE5A 1EQPA 3KOWA 3QGKC 4KW2A 3M0XA 3QFEA 2CKSA 3AHXA 3TQKA 1LT8A 1I4NA 2NXIA 4TMCA 3SN1A 4QJ4B 3TTQA 1YRRA 1BGAA 4AZ6A 3LI0A 4N9DA 3W6MA 5A8NA 3IJDA 2FIQA 4W85A 3W22A 1UBPC 3GTNA 1SQ7A 3GXIA 2GVGA 3QLDA 1XIGA 3AHTA 1E9ZB 3UG5A 1GQNA 2CZVA 2ZX9A 1XKJA 2ZFAA 3WO8A 2BP1A 3VOGA 4M56A 2RAGA 3EOUA 4E8CA 2ZUUA 5D4YA 1POKA 4F2TA 5EMYA 1P7TA 3R6IA 1MXDA 2C1IA 1KGXA 5C8BB 2CZ5A 2PWEA 3SJNA 3K8KA 4ML4A 3ZWTA 3F4DA 1YW1A 4IPJA 4NY2A 4R9XA 4OV9A 4NAFB 3EWBX 4AD5A 2WQDA 2YCJA 3EDJA 1ZBVA 5JUVA 3LM3A 2CBIA 3QOMA 1XP3A 2OR2A 2ZZ1A 1WAUA 2DT3A 1DBTA 2VNCA 2I9EA 3OVPA 2WNWA 5C9RA 1FVPA 4GY7A 1FWIC 1QATA 4S3CA 2PTXA 4D6GA 4WXYA 4PYSA 3ABXA 1VH7A 4MZYA 1P5BA 1XG3A 3N1AA 1VZWA 4O14A 4Z2JA 2BY0A 5D8ZA 4BCEA 4YN5A 4AB4A 1CGVA 3E12A 2CCRA 5H8MA 4QROA 5F1UA 1X8CA 2YLLA 3PSVA 3TLQA 2CLEA 3UZXA 3MCMA 5G5IA 3TW9A 9XIAA 1U5JA 5CSYA 4GABA 2BG1A 1US2A 4O0QA 3FKKA 2F84A 3BV7A 3O1NA 1UPMB 2QCDA 3PM6A 4S23A 4UMBA 1QPRA 4AY7A 3O05A 4AIUA 1G4PA 2MANA 3NO5A 4J28A 3SQSA 1W32A 3VKCA 1M3UA 1IZKA 4LB4A 4AD0A 2FJKA 3PFRA 3DESA 4RDWA 4JZ5A 3RK8A 4Z08A 4MPKA 2BG5A 2VURA 4L9YA 3UY8A 3BAJA 1MVYA 4N4PA 1XYLA 3APYA 3CGTA 5I6SA 4RV8A 5HAOA 2WNZA 1EGMA 3TNOA 4BHYA 4LS1A 3SUUA 4DNHA 4MB1A 4GVHA 2WJEA 1VAHA 4US6A 2GGHA 3IJ6A 3M16A 4OUIA 4AZ7A 1JZ5A 4MWAC 3FYYA 4Z17A 2Y2KA 3WIJA 5AHLA 4LY4A 3AWOA 3H55A 2VCAA 1JAKA 3GW3A 4B5UA 3HBLA 1EKOA 1EX1A 2P3EA 5E0KA 5E1QA 3PPFA 1Q7ZA 2VOMA 4C6MA 4BF5A 1J93A 3IK2A 4GVGA 3BH4A 4JFUA 3BSMA 1RLCL 1E9YB 3QF0A 4O4VA 3WFLA 3EA2A 5G1TA 1JRBA 4KWWA 4WKFA 2CLMA 3CAVA 1UWUA 4MB5A 4LAKA 4HPGA 4PUJA 1N7KA 2PE4A 1TPH1 3P81A 4DZAA 3EXRA 5E6ZA 1FH8A 2V6AA 1M7XA 1CB7B 3AXIA 2OXNA 1UWIA 3VOCA 3DFPA 3R0DA 2E9BA 1QI2A 2ABBA 3CZ8A 3DFQA 3USZA 1YADA 3STGA 4FHAA 3OOQA 3E2SA 1D8CA 5C55A 4J3WA 4MWAB 1F76A 2V30A 3IIPA 2AQVA 3C3UA 1W9DM 5FEXA 4JX4A 4DJED 2G5WA 1H7OA 4MB4A 2CZFA 4KERA 3BL3A 3PBVA 1GNXA 1L6JA 5KMYA 2DY3A 1WKYA 4S3DA 3MKCA 5A6MA 4IBFA 2ONEA 3OLIA 2VMFA 3GR8A 1WA3A 3GM8A 1MWOA 3M47A 2J27A 4PC8A 1YIXA 3WL1A 3EWCA 4NNCA 3H2NA 4ERIA 3GH4A 2E09A 3L26A 3NQAA 3G0XA 1S3TC 3SY8A 5B80A 3NDOA 3TV8A 1L2UA 1EOMA 1ZLPA 4YTTA 1XLDA 4POCA 3GHSA 3W7QA 3JU2A 2XIIA 5FJIA 3IUDA 3W71A 2NT0A 3KRSA 3CL6A 4O4WA 3I7SA 1OG6A 4F66A 5C9ZA 1TV3A 1O5RA 4JTGA 1ICQA 2P76A 4YVPA 2QDHA 1F2JA 1E6ZA 1PL9A 4HSOA 3S1UA 1XC4A 2QKFA 3DBPA 1AQ0A 1WAWA 2A2IA 1PDCA 1Z48A 1TR9A 1OM0A 3WLSA 3U2CA 3BARA 3H54A 3QV9A 5I3IA 2J13A 4BWLC 2FTWA 4H7VA 1US3A 2XFWA 2C1GA 4IZGA 4IOTA 1TE1A 1TPEA 2ZIDA 1LOQA 3AQUA 4IUOA 3LCHA 3FV9A 4KESA 3EWYA 4DJEA 2V9DA 1PTAA 3UT0A 1BVWA 1NDZA 1ZGDA 4LBRA 5FSEC 1XIFA 3FYPA 3ZR4A 5HA7A 2G41A 5JBFA 1BG4A 2V5OA 1PE1A 1KRMA 1B0IA 3PBWA 2G4FA 4MFDA 3SUWA 1OFOA 1IIGA 3KP0A 2TMDA 1GUVA 3HA1A 3L0NA 4DPPA 7ENLA 1NAL1 4GINA 2WMFA 1MDLA 2NZLA 3U5YA 3OYXA 2BTMA 3BK0A 5BOFA 4AX7A 3RX4A 2PDPA 1EJTC 3BAXA 1RJRA 4OV4A 3AXHA 3K8MA 3R5EA 3TXVA 1B3XA 4XG1A 3IIVA 2HV5A 1QI4A 5CGTA 4WOQA 1V03A 2ZVIA 4PCTA 4DO5A 1PIIA 4GVFA 3OA5A 3TC6A 3H21A 1YU2A 2E5CA 3WBYA 1H7NA 4U3CA 1ZU8A 2Z2AA 1EA0A 4FLQA 4H6QA 3K5XA 4AISA 4U28A 2EXOA 3UJRA 2IKIA 3H4WA 2OKTA 3WDHA 4L6HA 1XV8A 3LEPA 1QJWA 1R9YA 2CXEA 5U4NA 3PBMA 3PUDA 1OF8A 1T8QA 1H5YA 5KZDA 4W7WA 2QAFA 2OEMA 1PYMA 1K70A 1EUNA 1C9WA 3Q4DA 1VBUA 3T55A 1S39A 4LAOA 3V3WA 4IQJA 2Y6ZA 3IPWA 2EG6A 3TA6A 3HPFA 1L6FA 3ANVA 2XVNA 4CCDA 2V2CA 1RA5A 4LCQA 3WLIA 2WKJA 1EFZA 2J7HA 1A5AA 4JN8A 4EF8A 1R3VA 1OYBA 3CEPA 1MUMA 1IXQA 1PS9A 3W7LA 3LQLA 3E38A 2NUWA 4DF1A 2ZUNA 4FLOA 2Y5EA 1XINA 3K1GA 4AHPA 3MSGA 4FLRA 1MZRA 3C8FA 1VHCA 4UCGA 3TONA 1OD8A 6TAAA 1XD1A 4OHQA 4L56A 1GKQA 1ZTVA 4JIEA 1R5YA 3ZR6A 5EMUA 4KFNA 1YBQA 3SM0A 3QRHA 4NL1A 1K77A 2V2HA 3VDGA 4LAUA 3A47A 2A0NA 2GQ3A 3AU6A 3CB8A 4Q8VA 1AH0A 3ZVHA 3KVMA 1XR2A 5E9AA 4UFIA 3NM1A 2ZRYA 3B0VC 4GUGA 1TYGA 3BICA 2QF8A 2ISWA 4J9JA 2IMRA 2Z1VA 1WPCA 2ADAA 3E5BA 4R33A 1O4UA 3FSUA 3WKZA 3M0VA 3TYUA 2B0MA 4CKQA 2X7VA 3JZUA 4JIIX 3RF9A 3W73A 3ZFHA 2CPUA 4WEVX 1XX1A 3P60A 1Z41A 1FWAC 3D47A 5I03A 1VFLA 2D20A 1JPMA 1O7AA 1K9TA 4C6JA 3QGVA 4NILA 3G3MA 2R9RA 5EFFA 2O7QA 2YL5A 3LN3A 4DLFA 1Q6OA 4UOZA 3NURA 3Q2DA 4JTIA 3EDEA 3EOOA 2YW4A 5CZKA 2Y24A 1QPNA 4B3LA 4TV5A 3W85A 4M6PA 3C2YA 4AXKA 3GRIA 2ATMA 4LV9A 3LA4A 1HKVA 1H4PA 3QR1A 3ZJKA 4IHCA 3P0WA 4TVUA 4XB3A 2PGFA 3P80A 1HXJA 1ZJIA 4Y96A 4M6UA 4H6EA 4RLIA 2B7NA 2V2DA 3M5XA 5HUPA 3S42A 2OEKA 5ABTA 2QVHA 5I5RA 1JFHA 3NXFA 3CQJA 3WQDA 4I9TA 2EAWA 3DOPA 4K36A 1C90A 1DJXA 2HBVA 3F2DA 2KAUC 3IUHA 3SBFA 4XZWA 4B9ZA 1QNQA 1JCNA 4UTTA 2WZTA 3WH9A 4RX0A 1OEPA 2Q01A 5E93A 4GCXA 2P1FA 4ZBCA 4Y7EA 4JKKA 1LL7A 4XBJA 4ZO9A 4IGMA 1XBYA 1UOZA 2D2GA 4MOZA 5LGXA 3GNXA 1NM9A 1TA3B 1AMYA 4JTHA 1XM3A 1TTJA 4O13A 2J25A 1K9FA 4IIBA 1US0A 2ZYFA 3LNMA 5I00A 2YSWA 4B5NA 4GQRA 3WDIA 1Q66A 2DW7A 4LUIA 3HZ3A 3HN3A 4S3JA 3BXWA 2OZ0A 1A5NC 3BLOA 2V81A 3CUIA 3CH9A 4PTMA 1V5XA 1B4EA 1G4SA 1OX4B 1A5LC 4M7SA 2R1MA 3M5YA 5M03A 3TNBA 5ABFB 2ZWZA 3CS2A 4OJYA 2A3LA 3F2CA 3K2GA 3IRSA 3G1XA 4MSSA 1M68A 3GZ3A 1H0GA 4MJ4A 3ABSA 1ECEA 2H90A 4ORMA 5E09A 1QBAA 1UUOA 1U2YA 3GTIA 2IPFA 1LTDA 1E0XA 1V02E 3HM7A 3ARVA 1JEZA 4PUWA 5HR6A 2J8FA 4C6KA 4GUIA 2W9MA 4DUWA 2BSLA 3NQEA 3QZ6A 4LTSA 2GOKA 4HNTA 3PNZA 1XIJA 1JCYA 4XZMX 4O12A 1GVYA 2G3NA 3VPLA 4DWDA 3RIKA 3B40A 3GU2A 1BSLA 3L12A 3DGRA 3OLDA 3Q65A 3AO0A 3R4IA 3ZWSA 1GQKA 1KXVA 2P50A 3ZT7A 2NQLA 1EO7A 1CCWB 4I8YA 4NZ5A 5JMUA 2EBNA 1KRBC 3HV9A 2O9PA 5HJXA 1O95A 5EMLA 5HWJA 1J0YA 1RA0A 1UD5A 1LBMA 3VC5A 4QDPA 1SUXA 2FB3A 4QNLA 3PJXA 3ARPA 2CLLA 2NUXA 2GZXA 2BB0A 1FWNA 1KM2A 2ZX5A 4KQNA 2NQHA 1V7YA 5HJLA 1LCOA 3LV5A 3QV6A 2Y2IA 3L7RA 2ZXDA 4UWMA 3U3HA 4EF9A 3T0AA 3ARWA 5HMFA 1E1CB 4ZGYA 1UUQA 3SRFA 4O8AA 3RG6A 2XWDA 3B05A 4CNTA 4QLLA 1HFBA 2F6UA 2EHHA 5F7UA 1OIFA 3SSJA 4G7EB 1QNRA 3GD6A 1I2QA 3LK6A 4KFOA 3RJXA 4X3ZA 3GWQA 1VC4A 4QP0A 3HJEA 4S3EA 2CWXA 4P7RA 4DWSD 3EXTA 3QEZA 4C6BA 5E6YA 3W76A 2FHCA 3DX5A 3ISIX 3OHIA 4J2MA 2QJJA 4JTRA 3L68A 1L8PA 2OSXA 3AIBA 4C90A 2AMXA 1EYEA 4J1OA 2YFNA 1GCYA 3HU7A 2CNCA 4OUEA 3CV7A 3WDQA 3E0WA 3A9IA 3BDKA 2BODX 3OA3A 1XRSA 2Y2OA 3GO2A 1DE6A 3ONBA 3PBUA 3FW6A 4Y9OA 3GC2A 4P8VA 1Q3NA 5XIMA 4NXSA 2VR2A 3AS2A 4HN8A 2PLCA 4PRTA 2E4TA 2HEJA 4JAWA 1EBHA 1O12A 3DC0A 3M0YA