4NY2A

Structure of vibrio cholerae chitin de-n-acetylase in complex with acetate ion (act) in p 21
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
404
structure length
404
Chain Sequence
b'PKGTIYLTFDDGPVNASVEVIKVLNQGGVKATFYFNAWHLDGIGDENEDRALEALKLALDSGHIVGNHSYDHMIHNCVEEFGPTSGADCNATGNHQIHSYQDPVRDAASFEQNLITLEKYLPTIRSYPNYKGYELARLPYTNGWRVTKHFQADGLCATSDNLKPWEPGYVCDPANPSNSVKASIQVQNILANQGYQTHGWDVDWAPENWGIPMPANSLTEAVPFLAYVDKALNSCSPTTIEPINSKTQEFPCGTPLHADKVIVLTHDFLFEDGKRGMGATQNLPKLAEFIRIAKEAGYVFDTMDNYTPRWSVGKTYQAGEYVLYQGVVYKAVISHTAQQDWAPSSTSSLWTNADPATNWTLNVSYEQGDIVNYKGKRYLVSVPHVSQQDWTPDTQNTLFTALEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Deacetylase DA1
publication title Structural basis of chitin oligosaccharide deacetylation.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Hydrolase
total genus 147
structure length 404
sequence length 404
chains with identical sequence B
ec nomenclature ec 3.5.1.41: Chitin deacetylase.
pdb deposition date 2013-12-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.90 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4ny2A02
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 4ny2A01
4NYUA 4F9DA 2J13A 2Y8UA 4U10A 2C1GA 2VYOA 4NY2A 5JMUA 1W1A1 4HD5A 4V33A 3CL7A 3QBUA 4L1GA 2NLYA 2CC0A 4NZ4A 2C71A 4NZ5A 1XW8A 1V6TA 1W1B1 2W3ZA 2E67A 3HFTA 2C1IA 3CL6A 2DFAA 3S6OA 4F9JA 3WX7A 4NZ1A 2I5IA 4M1BA 4WCJA 3RXZA 2IW0A 3VUSA 1NY1A 2QV5A 2C79A 2XU2A 3CL8A 1Z7AA 4LY4A 4NZ3A 5BU6A 1W17A 4NYYA 4OUIA
chains in the Genus database with same CATH superfamily
3G8RA 5I09A 3O6DA 5LNRA 1A5CA 3SUVA 3N73A 1WXYA 3FAXA 3RILA 4RLIA 3T42A 3UR7A 4XZWA 3EDDA 4GINA 1QATA 2R24A 4DB7A 1NWSA 4Q4PA 3W07A 2NQZA 3BGAA 4F2UA 4XUYA 3CUIA 5IBXA 3BCFA 3RRXA 2PS2A 2YSWA 4PCTA 3RPDA 1UUQA 3B05A 2FZMA 2YBTA 3MCMA 3ZR6A 1RBAA 3WH6A 1A47A 1BGAA 1GJPA 4LTSA 1V0LA 1SFSA 3L0KA 4D6DA 1XYFA 3IVTA 1PAMA 2Y7FA 4E8CA 3QSTA 3IS4A 1TPC1 2ZCGA 1TVNA 2CXGA 3EKLA 1DTUA 3W4RA 1TZ7A 3N3MA 3W74A 3WJWA 4NZ4A 1W2PA 3K1DA 2VEMA 3N2XA 1K70A 3SJ3A 3T7VA 3KBWA 2PEVA 1LT8A 4G8TA 4FIRA 1A5MC 3MUXA 4PZVA 3GAKA 1JZ8A 3W1RA 2A5HA 3CZKA 2DZBA 2FFCA 4IBKA 4XIMA 4G1NA 1Q6FA 4QDMA 1M5WA 3EX1A 4JIEA 5A8PA 3I3DA 2JGYA 4DN1A 5I3HA 4NRSA 4IIDA 3UY7A 2Q8XA 4GUFA 3TN6A 3P67A 3VUSA 3PUGA 2CIPA 1W1YA 1S3HA 2ALRA 1XJBA 4UQAA 3AYRA 4O8AA 4O52A 2PWUA 1TO3A 4ZL1A 1RJPA 1QW8A 1E1CA 4N9BA 1XYCA 4JXCA 4RXGA 2DQWA 4QNEA 4HPGA 1JDCA 3A64A 1VCVA 5I24A 2QJHA 1JYWA 2VX5A 4FZIA 3R10A 5AZ1A 1GQIA 3ITLA 4FX6M 4PTMA 2E8YA 3ARZA 3UBPC 1B57A 1GCYA 2YL5A 3WLNA 2AL2B 2OXNA 4Y90A 1XG4A 4AMAA 4DM2A 4K37A 3TTQA 4O12A 1WUFA 3SCSA 2NX9A 1S2VA 2OGJA 1F3TA 4GZEA 1QI3A 3WCZA 3MV01 4FNRA 1RLCL 2XZ9A 3HG5A 3BOFA 1LLZA 3AOFA 4PMUA 4M1BA 5KZDA 3QR1A 2PE4A 1O95A 1WBHA 1T8QA 1UZHA 3OQ8A 3CL7A 1L6FA 1LL4A 2E5CA 2HQAA 1W9DM 1JRCA 2VENA 3VOIA 4MKNA 3ATZA 3EWZA 3MPGA 4NRRA 5D33A 2J88A 2CU0A 3UGVA 4FX8A 3WFZA 3OB8A 4OHQA 4UQDA 1DWFM 1GHSA 1J93A 1KRCC 1QPRA 4OZOA 4QSFA 1MW3A 1NF0A 3P5ZA 2QAPA 3RNDA 1I8JA 1I2RA 2A7PA 3E5PA 2QHAA 3DN5A 3KUMA 3WO8A 4PMVA 5I2UA 3W7KA 4IBCA 2OT1A 3V18A 4U2ZA 4LF1A 2QZRA 5FF7A 3FFSA 4Y6GA 1YU2A 1FFRA 1DOSA 1K1DA 4PUUA 4K3ZA 4HP5A 3OZOA 4A05A 5LNUA 1FHLA 4B16A 1DQUA 2X09A 4CN1A 3AWOA 4DWSA 4MFDA 1HP4A 3RPMA 5BOEA 5HNUA 2XG9A 4UR7A 1DHKA 4F0LA 3W01A 1GONA 3GXIA 3IJ7A 4LUTB 3IIOA 2YBUA 4Q22A 1EB3A 4FLSA 3LGDA 3NQAA 5TAOA 3W28A 2VDGA 4WDTA 4DJDC 2PTWA 3FXYA 1M7OA 1P6CA 4DUXA 3V36A 4J3UA 1GJUA 1XLCA 5F4XA 3DG7A 1L0PA 2X1TA 4MYAA 1QPKA 3QVQA 1CTNA 1J5TA 2X05A 3TKFA 1HJSA 1ZALA 2QJIA 5E0CA 3W7MA 3EPMA 3NNTA 4DBWA 1Q13A 1RBLA 2OEKA 1GWJA 3GZ3A 4ALDA 4C6FA 1XLDA 2VZVA 1PTAA 4AZIA 1TREA 3MUCA 4AB4A 1IE7C 2Y2QA 1HT6A 5HK4A 3VIGA 1D9EA 1XCWA 2G96A 1RJQA 3RFAA 2Q3RA 4UC5A 1SO6A 4S3EA 2D0GA 2YIHA 4IZGA 4W4QA 5TNVA 3CQKA 3RUBL 5GNXA 3QPZA 2PTZA 2NW0A 3W1XA 5IDIA 5AHLA 2D24A 3L5MA 3C2OA 4ORMA 1E15A 5I3IA 3GG8A 1IT0A 4MJMA 1MEHA 1EUNA 3GNDA 3O05A 3FJLA 4IP7A 3PN8A 4QE4A 3FS2A 1ZZMA 3TOPA 2Q3OA 5D9OA 3Q65A 2D0HA 1R9YA 4AZGA 4NJKA 3IJ9A 3LPGA 1YDOA 1XPGA 3HPSA 5DMNA 5BU6A 3CB8A 2P10A 2OYKA 2V5BA 5EMUA 3CC1A 2WZEA 2VQTA 1XLLA 3S6TA 4PULA 3EXSA 3UY8A 2NQ9A 3LV6A 3LXBA 3EOLA 2E67A 1CGWA 1B3ZA 1KTNA 3VNLA 3QGKC 1UA7A 3V35A 5AVNA 3GH5A 3KAOA 3ZWTA 4OJOA 2WMIB 3BWWA 1EJSC 3DIPA 2ZTJA 1W1TA 3FDKA 3SRDA 1NFGA 3BAIA 1WOBA 4JTTA 4JFUA 4I7VA 1VRXA 3VZYA 4HT3A 1CNVA 5E70A 2AL2A 3SUTA 4V27A 4MAZA 3MT1A 3HB9A 1FWRA 1UP0A 3Q37A 1C9DA 4PMZA 1JEZA 1ISVA 1RCOB 3DXIA 3C2EA 3W7EA 3M6YA 1IR2A 3M47A 2VT0A 4XX6A 1TRIA 3SSZA 4HCHA 1QHOA 1H5YA 3DH7A 2OO0A 3SRFA 3I6TA 4HYVA 4OTKA 1DIKA 3STGA 2OR2A 1BWKA 1J0ZA 4TX8A 5DMMA 4MB3A 1AJ2A 3VU2A 2ZZ6A 3UT0A 2QKFA 2WLYA 4YVXA 1ITUA 4B90A 4IIEA 2E9LA 1WX0A 4G7FA 3M46A 3K4AA 4C6BA 5HINA 4GXPA 1OCNA 4NJGA 2P0IA 4BS0A 1AFSA 4ZQMA 3OQEA 2VFHA 1GVIA 3TVAA 2YCEA 3B8DA 4NHVA 3TC7A 1S5NA 3BUVA 3TXVA 3AMKA 1NOFA 3VIPA 2Y2JA 5FAGA 2HDJA 4UUIA 4AXKA 4W7UA 3NO1A 1ITCA 2XUCA 4IBGA 1OFRA 1AZ1A 1IIHA 3LNMA 1N7KA 2J24A 3R0KA 1UIOA 3OVQA 4BQ3A 1JPKA 3WQPA 2V69A 4CNNA 3R7MA 1ZENA 1R38A 1UG6A 4PSPA 2KX9A 3GG1A 4GI9A 5DO8A 3TW6A 1R3YA 3PB2A 4IPNB 4O15A 4PUDA 4LUTA 3HG4A 1EXBA 1VENA 2G50A 1TB3A 2ZX8A 1C7SA 4Q8NA 4C1KA 4O53A 1GKPA 1EOMA 2QULA 3NL6A 2Y7GA 2POTA 2WSYA 1BF2A 1EC8A 4ROPA 4A22A 1K8XA 1DIDA 1CGUA 2GQ9A 3W71A 3G1XA 3LCIA 4YS1A 1B54A 2QDDA 1OX6A 3HQNA 4QE1A 1SPQA 3AMGA 4WD0A 4RPPA 2YA0A 4EXQA 3T2OA 1JDDA 1UR0A 3VAVA 3MBDA 2HSAA 5HNTA 1YNPA 1TE1A 1EFZA 3G0UA 4QLLA 1OWQA 4GO9A 1JI1A 4TTUA 3TN4A 4J3XA 3CUZA 2HS6A 2IUZA 3TWAA 4HOWA 1VYSX 4N6EA 1UZ1A 3PBUA 3IPWA 1H50A 2VFDA 4N9EA 1Q2RA 1C8XA 3M0VA 2DZXA 4V28A 3JZUA 2I14A 3RHGA 1B4EA 4HNCA 4RR4A 1P1XA 2D23A 2HE5A 2PDPA 3ZJ7A 3TNBA 3TSDA 4O17A 4IPLA 4A6GA 3WD3A 1XBZA 3MYOA 3H12A 1QK0A 3T2QA 1RJRA 2Q09A 3IIPA 4LOCA 4IJFA 1JZ2A 3BLKA 1ZU8A 3TOYA 3ZT7A 4JZ5A 3UJ2A 2V67A 3Q45A 3LCFA 4KS0A 3I68A 2G3MA 2PDIA 3OU8A 3WDQA 1IXOA 3AI0A 5EMMA 1A50A 3K8LA 3WDPP 3BVJA 3ABRA 3EOOA 3G8EA 3IGSA 3TXZA 2E9BA 1A5AA 3QBUA 3SN4A 2VDIA 1EWDA 4XBKA 3F1QA 4A3RA 4EPKA 4TMBA 3KS5A 1DWIM 3KCJA 1DORA 2YW3A 4ZB0A 3STEA 3B06A 2VCAA 3A13A 3MV11 4GJJA 1XUZA 2ZKMX 1EJ7L 2ZRYA 1NM9A 3TR2A 4JHMA 4JYFA 3MMTA 2ZA1A 1L8PA 1QNOA 2HXUA 3KDNA 3M0IA 1BWLA 2E6AA 3GG0A 1DXEA 4WY0B 1DWHM 1UQZA 6REQB 1DWJM 3OG3A 4UR8A 3TMLA 2PDXA 4WIWA 1ZCCA 1HX0A 3SUUA 3UU0A 3CUXA 1E6PA 2IKGA 1O60A 2CHNA 2QGYA 1QW7A 2SFPA 1O66A 3UPWA 2VRKA 3GY1A 5AECA 1JYVA 3U0HA 2YDRA 5E5CA 1AW2A 1SUXA 3P62A 4LNYA 3LY0A 1KFWA 4ZQPA 3F7JA 2E40A 8TIMA 2Z2AA 1XIJA 2WHMA 2ISDA 2EPHA 3CPUA 4QM1A 2PFHA 2ZYFA 4DO5A 3EEZA 1TE6A 4DJFD 1AQHA 5EMKA 3NQDA 1TR9A 4LYKA 4G1KA 2JF7A 4Z1BA 2BGSA 2WMJA 4X9SA 3AIRA 5HPCA 3W2MA 2Z25A 3C2FA 4OOZA 2PC4A 1EO5A 2JFEX 2QGHA 3H54A 5KEZA 5FEPA 1RAKA 2GOUA 4IXHA 3QEZA 1HL8A 4UZSA 3EOUA 1XD1A 3SBFA 3S5NA 3QOKA 3ZMRA 1BSLA 1C8YA 3HMJG 2A3LA 1IEXA 4FB7A 5FA5A 3O15A 4X63A 2TRSA 1WUEA 2YW4A 4JIRA 1OZQA 1MI3A 1AZ2A 2PD5A 3IAQA 5CKSA 5E09A 4GABA 4MUPA 3P74A 5LNVA 1OX5A 3M07A 3TQ0A 5F4SA 1F3WA 1MNSA 3QHMA 2HNHA 2G97A 3SGZA 2VOTA 4K7VA 4GNKB 3MDUA 1JCNA 1XD0A 3E0IA 1W9VA 3PPGA 4BF9A 2C1IA 4HSNA 1FCBA 3PUDA 2D73A 1UJPA 1EDQA 3ICJA 4OT7A 4G2DA 1AL8A 3CAVA 3A5VA 1KM1A 1GOKA 3MSYA 3W73A 3BQ6A 2VURA 3OYZA 4WHBA 3UCDA 4IMCA 1CYGA 1W3HA 1DHPA 1GQNA 2CWNA 5XIMA 3W3OA 2JIEA 5HR7A 3MZ2A 4FXSA 3MHFA 4PL1A 5DT5A 4ZSTA 4FX7A 4I90A 1UKQA 3QH2A 1GTEA 4PMJA 1G4TA 1LTDA 1S2UA 4A3QA 1PKYA 1W3LA 3W0KA 3FA3A 5BWAA 1XDMA 4LAUA 3ZLGA 3ONCA 4JQ2A 3SRKA 4PEEA 2O92A 3CZLA 1FP8A 3W88A 4D6GA 2B7QA 1RD5A 4HNOA 1VGAA 4C6EA 1YUEA 1P7TB 1DQWA 4PRWA 4CGTA 4DJEC 3TZNA 1T6MA 2DZVA 4AYGA 1ODUA 1TJRA 1S5WA 2RKXA 5GJNA 3MCOA 4IQDA 4Y7EA 4J2PA 4GD0A 3MI2A 4RV8A 1XSKA 1YXYA 2YZ5A 4FEZA 3BGJA 3A4JA 5EGRA 1W1PA 1W2VA 2ZUNA 4V1XA 4WZHA 1CWYA 1SZEA 1US2A 1I0BA 3L0GA 2CLEA 7TAAA 2Z28A 4W86A 3CMJA 4OU1A 4FMVA 3UYCA 2QLYA 5EA9A 1B5TA 1KR0A 4Z1CA 2Y61A 4AZHA 3USBA 3TZFA 3FEQA 3MQLA 1EJTC 3KM8A 1TWWA 1GZJA 4JIQA 4WY0A 6REQA 2YFOA 4IL2A 2DSUA 5FJUA 2XGBA 3GB6A 5FKYA 4MLJA 3ZQ9A 4AD1A 3B3DA 4KESA 1UWSA 3F4CA 4A21A 4KEUA 2G3NA 1WE5A 4ATLA 3IIXA 4UTJA 2WC7A 2AGKA 4M24A 3DHUA 4PRTA 1I75A 1WDPA 1F6KA 3CV2A 3FY1A 3OVGA 3FOKA 4E2BA 1EX5A 3PM6A 4RE4A 4L64A 1HJXA 3A3XA 5AOUA 1JCYA 2E3ZA 3EWCA 3L2IA 2DH3A 1TPEA 1N55A 4FALA 4EKJA 1E70M 3OZYA 3QHOA 4QR6A 4LYPA 1CGVA 3TYCA 1KM3A 3OLDA 1J7MA 2PF0A 4D6FA 1R30A 1VIWA 3L29A 1VFHA 3G3DA 4JEJA 2Y2KA 4HMEA 2OQYA 1J79A 4OFCA 1NARA 3VDAA 3CTTA 1R3WA 4MB4A 1VJIA 1PE1A 1QR7A 4UFHA 3VPLA 4NVTA 1ZAJA 5CPOA 3L4WA 4OE7A 3VD7A 2CLLA 1NDYA 3VGFA 5DX7A 1YE6A 1YRRA 2DW6A 3S9YA 4DWDA 4PL2A 4W7VA 1RA5A 1XC4A 4WF7A 2PDFA 3URBA 1FWAC 2GFTA 2OX1A 4MDOA 3UWUA 2VRJA 1TKKA 4IGSA 4WKFA 1HL9A 4XZ9A 1XPYA 3QV6A 5EBAA 5BU9A 4AF0B 3FYOA 3UNTA 3SQLA 4RW5A 4V2XA 1D2KA 2GWNA 5K9CA 4NF7A 2W92A 1W9XA 4PMRA 4KWUA 2FMNA 1EA0A 1A3WA 4M0XA 5FJJA 1JAKA 4ORIA 2FJUB 3UG8A 4AY8A 5DCBA 3GKFA 4OJPA 3QXBA 2GK1B 1J01A 1YXCA 4FF7A 4E3VA 1KCLA 4MWAD 4OVXA 1GEHA 4GQBA 3CM4A 2FYMA 3HIJA 1R86A 2VVNA 1NDZA 3WDRA 2PWDA 2FQIA 2QCCA 2VEPA 3NM3A 2OKOA 1MVYA 3S5YA 1XRTA 3F4DA 5CEWA 1E6XM 2CLPA 1UZDA 3JUGA 2BHZA 2Z1XA 1BWVA 3UPBA 3HA1A 2E77A 3H4GA 3EEGA 3FYPA 1E4NA 3LGEA 1PIFA 1CLKA 2I5QA 5AKQA 3M43A 1RD6A 3EDFA 2FFIA 1D8WA 3H6OA 2BVDA 4JTRA 4ADTA 5H91A 3CUJA 3QQ1A 4L4MA 5HATA 2G0WA 3WLSA 3V5CA 1P7TA 3FHAA 1IZKA 2Y63A 3AO0A 5FEXA 3PY2A 4L80A 1AVAA 5CBBA 3N04A 2VC6A 2X0YA 2VGFA 1RQBA 4QS5A 3TYZA 4N4QA 2ACSA 2WZIA 2L5HA 4MM1A 1FQ0A 3UXIA 2J7CA 4UFLA 3MHUA 2NQLA 1VZWA 3PFRA 1HZYA 3VM5A 1Q63A 1D7KA 3VZXA 2XN2A 2VFEA 2VZUA 1ZBKA 3QC0A 1ZBVA 2MNRA 5HBFA 4AVOA 4UTWC 1KV8A 2WQDA 3MYPA 5I3GA 1GJWA 3NQ2A 1QU4A 5JBDA 2RTSA 3EZ4A 3QLLA 1R85A 2DVXA 5I3FA 1G94A 3DYMA 3T08A 3FHQA 4TVUA 3QYSA 1UR4A 3K2GA 1F3XA 5H8UA 4IBDA 4MJ4A 3HO8A 3AIWA 3PPFA 2DJXA 1JGMA 2DV0A 4IBIA 3PZMA 4O28A 4H8UA 3E2SA 1QAPA 4FNTA 1EOKA 5FEWA 2PGWA 4AX7A 4HIBA 2OQHA 2D49A 4H00A 4FLQA 5DEZA 3TFCA 2UY4A 3EA3A 1H62A 4PCPA 3T0BA 3A22A 5LA1A 1G4PA 1XIDA 1Y5VA 2VYOA 5F2MA 1BVWA 3W7DA 4O1AA 3GR4A 4OECA 4Y9AA 5IOBA 3SQMA 4A8RA 1OT1A 4HK7A 1O4UA 4K1GA 5CSSA 4A4AA 4CQAA 3O2LA 2CLFA 2WKJA 3B8SA 2WC3A 2D20A 3KRSA 2X7VA 4AD0A 3N2TA 3KVKA 3QY8A 1KWGA 2NX3A 3KL3A 1UWAA 2V8ZA 1E88A 1UIPA 2I16A 3U48A 3L4UA 4HNUA 5BROA 4DRSA 4H41A 1BG4A 3AYSA 2PRMA 4WDXA 1C8VA 4KCTA 2YL6A 1O5XA 4RW3A 5D4YA 3TP4A 3TYEA 1LBLA 3C3UA 4TIMA 1RK6A 1PX4A 3IV3A 4XZNX 3PB0A 3SFWA 1ED7A 2V30A 2GGGA 1XH2A 2NSOA 3F4VA 1OK6A 3VM7A 3H8AA 2JEQA 4ZXLA 4YTTA 1GVOA 1THFD 1QNSA 4DYJA 3HV8A 3DC8A 5CGMA 1IF2A 4Z1DA 4NY2A 1J0JA 2GDVA 4AF0A 1RXOB 2RDTA 1G5AA 4JL2A 1FXPA 1LOSA 1SO3A 1B90A 2GJNA 4UQ9A 4AQLA 4EF8A 1ADOA 1JFHA 3HMCA 4Q4KA 3ZFHA 3VINA 2DIKA 2GK1A 4CQCA 5A2BA 2YL8A 3OJGA 4TV5A 1AQMA 2VMFA 5HWNA 2Y4SA 1OABA 4HU3A 2YCLB 4QEEA 1DJNA 1ISWA 3HG3A 3ZVIA 4A35A 2WAGA 3CTLA 5HPOA 5I3JA 2PP0A 1VS1A 2OLAA 4N9DA 2V9DA 1TELA 1Y65A 3HPZA 5D03A 3KLLA 2EJAA 3MZNA 3AXKA 2NQ5A 1IIGA 3P2VA 2WKGA 3BAJA 2F84A 2Z27A 3DZ1A 3N18A 3C2RA 4XTDA 1H8PA 3LDVA 3VOCA 4XAZA 2ZZ7A 1T99A 1Q3NA 3KFTA 4X2RA 1V0NA 4RZBA 3E49A 3QR0A 3DFHA 1PDCA 1KO0A 4AZBA 4H6RA 3UWWA 4LFYA 3CQIA 2OEJA 1DIOA 3ES8A 4CD4A 4AH7A 3ZJ8A 2EPKX 5EFFA 4UTKA 1FKXA 1LWIA 2V5LA 4IMDA 3W82A 2X16A 2VKZG 4W5ZA 2Y24A 1RBOB 4HJWA 3HGJA 1X1ZA 2Y8VA 1AH4A 1VPXA 3ABOA 3UP8A 2UY3A 4E4UA 1V5XA 1DXIA 1MSSA 3GU1A 3URNA 3C2YA 4HSHA 1NY1A 3WMLA 2PPGA 1MFUA 1WNOA 2G3FA 4GQ0A 2BS9A 2WNWA 4O14A 3LLDA 4MPQA 3G1SA 3NYZA 1HGYA 3BOXA 3G1HA 4XB3A 1OC7A 4GG9A 1W0MA 2D3NA 3CUGA 3P8JA 3V4BA 3WBAA 2YYUA 3SFKA 1QFEA 3HPFA 1E51A 3G0SA 3R5EA 3EDJA 4O19A 5BRQA 3WMCA 5BMXA 1FWNA 1GKQA 5CG7A 3VKKA 3ZJ6A 1MXGA 1BTCA 2NV9A 5A6AA 4ZZ9A 3POCA 1UW9A 2WSRA 3DG6A 1KB3A 4OV4A 3U4FA 3WYZA 3N4AA 3WL1A 3AZTA 4YVPA 3ZWSA 3ELFA 3PBGA 3SY1A 1I2QA 4HYWA 3WQDA 2PRLA 1XKYA 3NQMA 4MB1A 5F1UA 3CQHA 2CKRA 1CK7A 3MI6A 1YPIA 1VKFA 1C90A 1TQXA 1HGWA 1IHIA 4PUNA 1X97A 4H8HA 3S9IA 4LB3A 4DQWA 2C1GA 5CZTA 2C14A 4GI8A 6ENLA 1WDRA 1JZ5A 4LYQA 1XP3A 2Z2BA 4BZYA 3P6LA 1JF5A 2VZTA 5A2AA 3AIBA 5K2ZA 1PJ9A 4LPCA 3W7CA 1HP5A 1JD7A 1J6PA 1Z7AA 3G0XA 1M6JA 3MCNA 4D6EA 4LVDA 3CU2A 4B91A 3GIPA 3WBYA 1T41A 3H2AA 4EP8C 4MADA 2GGJA 2QCFA 1JXJA 3WKZA 4B3KA 4LS2A 1FWBC 3H2EA 2ZC1A 4PCFA 4DWSC 4Q7IA 4PFMA 1YMYA 4H3DA 3N6HA 4O10A 4AWEA 4J40A 1BVNP 4QLJA 4ZMGA 2R14A 2CCRA 2LLEA 2OWWA 1UKOA 2G3IA 5CJNA 1ICQA 1BHGA 3WNLA 1V3IA 2X1UA 2CLHA 4H2CA 4EF9A 1MW0A 1EEPA 2YZRA 4ZB2A 1PWLA 3VE9A 4P61A 1UP2A 1E56A 4LVGA 3OOQA 7ODCA 5JH1A 7A3HA 4EAYA 4WDWA 3A4WA 1W8SA 3WZ0E 4R7OA 4F79A 1H60A 2HVOA 4JY8A 3L2AA 2PWGA 2YCLA 1Q6EA 3CIXA 1DIEA 2WSKA 3H22A 2G37A 2I17A 3A4XA 3F5JA 3MY9A 4BEQA 1MUWA 4V33A 1YU4A 1UPPA 4JTSA 5CJMA 3EB3A 3PZ9A 1HVQA 1EYEA 4MY8A 4XD4A 2VP8A 2QUTA 1JZ6A 2X42A 3CWHA 1ME8A 3C8NA 1FKWA 3UW6A 1SQ7A 1X7FA 4QJ3B 3GH4A 3VVGA 2VO5A 8CGTA 5HOSA 3LLFA 1TPWA 1EA9C 4C90A 5TF0A 1TIWA 3WSUA 2G95A 4H83A 4C7DA 3ES7A 1A4LA 4K36A 2P3EA 1GNXA 2PDYA 4C6NA 2XH7A 1UR9A 2YLLA 1PEZA 3DOPA 4O1FA 3GNXA 3UXKA 3UYIA 5CSRA 4UTTA 4M1RA 2ZZ1A 3TYBA 2FHCA 4HZ8A 1UA3A 5JIWA 1R2TA 2R94A 4JTHA 1FWEC 2PC8A 1G6CA 4NI8A 1LYXA 3RAOA 3CQJA 5FF2A 3W7OA 1H3GA 1E6SM 4JR5A 1JULA 4IG2B 3U4AA 3P0XA 1ZS2A 3BAWA 4A8LA 2Y8UA 3T44A 1XLAA 4H1ZA 3K5XA 2XFFA 2VUNA 3J7HA 2NUXA 2GYIA 4KT2A 3ITOA 3HG2A 1RPXA 2H9AB 1W5NA 1PCKA 5T9CE 5BCAA 3TH6A 1QOQA 3VDGA 4DJFA 1NOUA 1AQFA 1Q45A 3TAOA 2WSPA 1TWDA 3O63A 1UR8A 3RITA 1E4MM 4E2VA 1F07A 1ME9A 2UZ9A 2XSXA 4UOJA 4JQ3A 1K9EA 5FACA 1VPYA 2YYTA 1UOZA 1EJVC 4RE3A 3AMDA 4MFEA 2A3EA 4W7WA 4AY1A 3WNPA 3B4YA 4PRRA 4A2RA 3OW1A 4IJBA 5I0DA 4UNKA 1KM2A 3FA4A 1CX9A 2OFJA 2PTDA 4NT0A 3KVMA 2YLAA 2WW5A 3PP7A 5HMFA 5LIUX 3NQ8A 2Z1VA 2F2KA 1E73M 3N17A 3P60A 1EP1A 3WN6A 4JCMA 5XIAA 1AL7A 1WXZA 2FGLA 1AD4A 2Y89A 3PG9A 4GUGA 5IDZA 2PCEA 4WR3A 1PV8A 2DIEA 4MNKA 3M9YA 1C91A 4TX9A 4MWAB 4NZ5A 2HK0A 3EXRA 5FD0A 1YDYA 2PLJA 2VJXA 4H9UA 2OLSA 1SJCA 2G41A 3GX9A 3M7PA 3L28A 2XN0A 3MMWA 3H23A 3IJLA 3SCWA 2QCDA 1JCXA 3NL3A 4AD3A 3DHDA 4D71A 1F3EA 3LI1A 4GO8A 2UBPC 4PUWA 2EQDA 4QTGA 3PZOA 1JYXA 2ZX7A 1S46A 3L27A 5B7YA 3R43A 3MP4A 2J6XA 5GJMA 3ARPA 3TROA 4CCZA 3L5AA 2A21A 3U7VA 5TD4A 4QE5A 1JUEA 3MJYA 4MJ2A 5HXMA 3IK4A 1MXSA 4DVOA 4H6KA 1A5LC 4I6VA 2V5CA 1EUAA 2PWHA 5AC8A 4O1EA 3VIIA 4NNAA 5CCZA 3OODA 2FZ8A 4WOZA 1W1VA 2VR2A 5IFPA 4B9YA 4PB3A 3CZJA 3BAXA 3GG7A 3Q2DA 1V0MA 2CZVA 4ZVJA 3CHCA 1W56A 4BF5A 4F9DA 3CWNA 4HZ7A 3UJFA 4PMQA 4YTQA 2Y7EA 1H61A 2DUZA 5CZ0A 1RQHA 4S1FA 3OGSA 3UXDA 4CQDA 1TRDA 1XYAA 1DE5A 1DP0A 4Z17A 4B5VA 1XLFA 3NWRA 5F7UA 3MC5A 1QPOA 1NWRA 1XSIA 5GPRA 3EWYA 3UQNA 3GSMA 3UJEA 5E93A 2ABBA 1DVJA 4HD5A 2J9ZA 3TJLA 3KRUA 1Q8JA 4RZ5A 5C2XA 3HSHA 1VB9A 3KRBA 3GC4A 3IV8A 3NAVA 3DBNA 3T4WA 3IJDA 3KX6A 3LM7A 3NDZA 2ZDSA 4NJHA 2O56A 3T78A 3VNIA 2ZX5A 2BXVA 1H49A 3BJSA 2VX4A 4NNBA 6TAAA 4JX5A 4HZ6A 3DHFA 1JCMP 2J7GA 4W93A 4O57A 3M5YA 3W02A 1LWJA 3WF1A 2A7RA 2FMOA 4G7EA 4WSHA 1JDFA 5IHRA 4DX3A 2CZ5A 4AC1X 3T0AA 3GBDA 1LUCB 2C6QA 4JCLA 4HPXA 2OQLA 3KL5A 5J5RA 2DSZA 3KEHA 1RSCA 3WQ4A 2TYSA 3E0VA 2H9AA 1SJDA 2JKPA 4GCAA 4AIEA 2VWTA 1TR1A 4PTXA 3ARYA 3WG6A 5RUBA 3NEHA 2E6DA 3GM8A 4BQ4A 1UB3A 1TPVA 4CU7A 1YXDA 2A85A 3W1QA 2EBNA 3MKKA 1VBHA 4Q8MA 3T0TA 4ENLA 4QG6A 1K8ZA 2WJFA 3QKZA 4LS1A 4CD7A 3N9KA 1OX4A 2B7PA 2P5NA 3C3NA 3R2GA 1UYQA 1OIMA 3W00A 3WJZA 4LVBA 3I4EA 3CMFA 4AVNA 3GZAA 2V5KA 2QJNA 4GUIA 4JNZA 4GYPA 1B4KA 2XPKA 2ACRA 3B40A 4HMNA 3PR2A 2YJQA 1HJWA 1TJPA 4IUGA 3OA3A 1DYSA 5BRPA 2QCEA 4AISA 1TIMA 2G4FA 3GE7A 4IHCA 2Y2OA 1U1JA 4GGHA 1REQA 4F9JA 4I3GA 2V0TA 3MJMA 4DF1A 2OWXA 2A3AA 1XYLA 5AVHA 2C8NA 3RDKA 2PDCA 1W8GA 1CXLA 1P0EA 5C9UA 1YPFA 2P50A 3FX4A 4HMDA 1ISZA 4MTVA 1UD8A 1VPQA 3G1FA 3KOXA 4QXIA 3QMSA 3SB0A 4MWAA 2PU1A 1KBKA 3FV9A 1OADA 3E2RA 3C86A 1P48A 1DJYA 3VE7A 2FVMA 3PVFA 1UR2A 1UWRA 1S2TA 3OVPA 4GYJA 3CHEA 3ARWA 4KEZA 3S1VA 2JIWA 2XSBA 3DG3A 4JDBA 3MKVA 4I7UA 4WXZA 3NYDA 2E09A 3W84A 4P8UA 3CBWA 3R13A 3VD3A 2QCHA 3THUA 4QS6A 4UOZA 3CEUA 1F8IA 2R1MA 2CITA 3AU6A 1KNWA 3LCHA 1ZAHA 1FOBA 2QF7A 2ISFA 4XAYA 4H9XA 1Q66A 4UIOA 1WPCA 2PDJA 5B80A 2OO6A 4P7QA 2Y2HA 3D3AA 3CYVA 1QWKA 1KCKA 2FZDA 3PJUA 3C61A 3QC3A 2BASA 3PBWA 4N02A 3M16A 3VILA 5E9XA 4RUBA 6XIMA 1L6SA 1A5KC 3WFAA 3M0ZA 2XFYA 3JZEA 3TCEA 1XIMA 3ALGA 3LBOA 2GVGA 2BP1A 3CASA 4HHHA 1TWIA 1WCGA 4OQVA 1KBLA 3S8HA 4XWUA 3VNZA 4R7JA 1R9XA 4CD8A 4MSSA 4K8GA 3LUTA 4KETA 1CECA 2VC7A 3H4WA 3BCJA 3W1UA 1UC5A 3BW4A 1Z32X 4KMQA 2QXWA 1UKPA 5CAHA 5HWMA 4GX8A 1MQQA 2QJMA 2W27A 4O13A 3LYEA 3JVAA 4HKPA 1Q7MA 2PGFA 2E5DA 2GJPA 3N19B 1SJBA 1QBBA 1XYBA 3KWSA 3BLPX 3BTNA 4TU1A 6A3HA 2FZ9A 1M9HA 3C0SA 4ICNA 4H2HA 4RZ6A 1OQFA 1WZAA 5J8LA 1QUMA 5CPQA 3NURA 3RCYA 1XRFA 3HV9A 3E2QA 5FF3A 1FX6A 3WLHA 3B0XA 2XM1A 1BQCA 4I8DA 4OWGA 3B0VC 1Z9AA 4UQCA 3C0QA 1LUCA 1S5VA 5HJXA 4W89A 5LHFA 1JR1A 1CI1A 5J5DA 5H6HA 1M41A 1Z42A 2BXZA 4FHAA 3RO8A 3DECA 3GNNA 1Z69A 2XJ7A 2BX7A 4OBRA 3RR4A 1GUVA 2GJXB 4TXEA 1QI5A 2INEA 3APYA 3CV1A 2VGBA 1AW5A 1JJKA 2BOGX 1W1B1 3AWNA 1VR6A 2O9TA 3RG6A 1Q6QA 4E4FA 8XIAA 4DBUA 3VD4A 2DT2A 3GS6A 5CGQA 3BDKA 3WD0A 4YJ5A 3VI2A 5KITA 4NUWA 3REQB 3O0FA 3SCPA 3NXFA 2OEMA 3HN3A 3ZIZA 5KETA 1QNRA 2W0UA 1L8NA 2OVLA 3ZS4A 4FR1A 5G2WA 4LG2A 4NNCA 3CV7A 3GR7A 1Z48A 1TPH1 1HNYA 2DW7A 4Q8QA 1CXFA 3LCGA 3V7PA 2ZE0A 3SADA 4IISA 3VIHA 3BXWA 1U5VA 1SR9A 2WMGA 2UV8G 2CKSA 2F6UA 1OC5A 3GDTA 4H9ZA 1KLYA 2QDGA 2Y0FA 1IXNA 1L9WA 2GGEA 3H4XA 3ZSSA 5JIPA 4H7CA 5DY2A 1J96A 3T40A 4Q8TA 4RX0A 3ARQA 1HJQA 3ZR5A 4WX2A 2QPUA 1PS9A 4D6HA 1WKEA 1CT5A 1TWZA 1ADDA 3GVGA 2PDNA 1EZWA 1X8FA 1TPFA 3B97A 4MG4A 1KFBA 4CQ9A 2W61A 3HPXA 3QJAA 2NUYA 3HJZA 1TMQA 3LPFA 3CV6A 2CZFA 4AEEA 4C65A 3EPNA 1XGDA 4QP0A 3CXOA 3CGTA 2OWCA 1FBAA 1R87A 3AYTA 1V0KA 5BMWA 4CNOA 1PIGA 4HCLA 4PTDA 4D2JA 1YPXA 5KZEA 1YQ2A 1QO6A 2FH8A 5A6LA 4J7RA 2A79A 3MANA 1GQLA 4KCUA 4WKAA 3EX3A 5E6YA 3AHXA 1WQ5A 2C18A 3QKEA 1HQTA 1UKSA 4NJJA 4F2BA 3PBVA 3W38A 3OO2A 2I57A 1LRNA 3LN3A 3CLMA 3VMOA 4S23A 4FAMA 4BR1A 3STCA 3KWXA 1VEPA 2YOCA 6CGTA 1KA9F 4ADUA 1SGJA 5I6SA 3ZXWA 2F61A 5C5YA 5DF0A 5K4XA 4DO6A 2A6NA 3W2LA 3WLOA 3XIMA 5I3KA 1VFTA 4RDVA 3V1PA 3SSJA 5DFAA 4E8DA 3AIQA 4J3TA 1LROA 4DJED 3MHGA 3AS3A 3LNPA 4QITA 5M3WA 3GFZA 4FLOA 3OZMA 4L4PA 1QI2A 5FIPA 2XINA 2VOMA 3BE7A 3LCWA 4S3CA 2XU2A 3LMZA 1EZ2A 3ARXA 4LVAA 1PZ3A 3ZSTA 4GQQA 1GVFA 1XICA 5KZ6A 3TTEA 2V5JA 1PHWA 4FSAA 1WDSA 4S3KA 3UG3A 3DI1A 4RV3A 3EMCA 5A95A 1UZ4A 4NAFB 2X40A 3VD9A 4JHZA 4KRZA 3B04A 3W7LA 4JTKA 3T07A 1M68A 4LXFA 2XDFA 3A24A 2TSYA 2PTXA 3LGGA 4Q8VA 4AG0A 3NVTA 4AWTA 3O6AA 1H2JA 1LLOA 2GVLA 2FTWA 4CU8A 1OGGA 2R1NA 1EO7A 3IUDA 5FL1A 2E6YA 3GRIA 3P0WA 3HJEA 4LAKA 2Q01A 4XO7A 1WDWA 2IKHA 1HF6A 3DESA 2Q8LA 1CGYA 2GJXA 4LVFA 1DJZA 4DI8A 1EPXA 5EKYA 1WXJA 1SSDA 4Y8EA 1P0DA 1RQEA 3W1LA 3W2NA 3R4IA 3GR8A 3LU2A 4BY3A 3QMTA 2J47A 1IEVA 5CZKA 1DJGA 2Y85A 2Z29A 1ICSA 3REQA 1AK5A 2BVYA 2WMHA 4GNVA 3VGBA 4LV9A 1TTIA 3NZPA 4LUSB 1VBRA 2POZA 1ZBWA 2PAJA 4L4OA 3TJIA 4IBJA 1UOKA 2HRWA 2DZSA 3BQ5A 2FB2A 3I6RA 1JG9A 1W17A 4UB9A 1E3XA 2C3ZA 4D6CA 4FLRA 3MMUA 4GFIA 4YIWA 4ZTYA 3LBCA 1RK5A 1P0NA 4LUYA 4OJYA 3D0CA 3R0UA 1Z41A 4XZMX 3B8IA 3MMDA 3P80A 3LK6A 4R9OA 2CLKA 2E1DA 3R8HA 5C9XA 4IXXA 3CHDA 4J35A 5LGZA 4JAWA 3W6LA 3N4FA 4XQ6A 4C6IA 2IOUA 1JCTA 1XIFA 3ZT6A 3GDMA 3V75A 1HKJA 5H8MA 4LAZA 1US3A 4GQGA 5CPMA 1EAKA 2WVVB 1BVZA 2PGEA 3BLOA 5JU6A 1P0KA 1I1WA 4JKKA 1G1YA 3EX4A 1K77A 5AY7A 4L6DA 1M1BA 1ZB5A 1V3KA 4KIEA 3ABSA 4M56A 3VIOA 5C71A 3UWYA 1ZJAA 9RUBA 4IPJA 2A2IA 2HMCA 2X2YA 4WY0F 1GG0A 1ZNNA 4FO4A 4QX4A 2Q71A 1OHLA 2WWDA 1R3TA 2E7FA 1JDAA 1JI2A 3OLGA 3W26A 2VZOA 2OB3A 2PRHA 4IIGA 1ALDA 2IXVA 4EWND 4UCFA 4DM1A 1E55A 3ITCA 4GVIA 3KVJA 4R9XA 1Y5XA 1KFEA 1MEWA 4MF4A 2ZIDA 1CGXA 5FSEC 3VFCA 3F4NA 3NQFA 5EU9A 1A53A 2CERA 3MO7A 2FJKA 3WQ6A 1V3LA 1W3JA 2FZNA 5CC7A 3P8IA 2HCVA 1PZ2A 2ZUWA 5BXRA 1JPHA 3BG9A 2WQPA 2DZTA 1CGTA 1FCQA 3EX6A 3C56A 3MUZ1 4GOAA 3BSGA 4GWEA 2XIQA 5DLCA 3SZ8A 3IJ6A 3GTIA 3W70A 4YCPA 3TTYA 2ZUSA 2PURA 2V81A 4FA3A 3E02A 4Q6JA 1TYGA 4D6IA 1S5TA 2X1SA 3IGHX 1EGMA 5H2ZA 1M7JA 4GJIA 4JX4A 1OVDA 1LDCA 1OF8A 3N3TA 2NX1A 3SRHA 1DV7A 2J27A 4HHPA 4GFSA 4MKSA 4DZAA 2KZHA 3W24A 4H7VA 5A6KA 1RUSA 1E71M 2VL4A 4NAFA 5DMLA 3W81A 3BW3A 2ON3A 2HROA 3KLKA 4PSRA 3AIEA 5PTDA 3GH7A 4W5UA 2OPJA 2WPBA 1EP2A 3MBFA 2GGHA 4ERAA 4NXKA 1BAGA 1E6NA 3BAYA 4P8VA 2XIOA 4GXMA 4NP7A 5EBUA 2IPFA 1UROA 3K13A 4L9ZA 1VFFA 3MWAA 4WXYA 3RYSA 1ISXA 4N0RA 3APTA 4C5ZA 1JFXA 8XIMA 3NSNA 2Y5JA 2B4GA 3A3WA 4DBDA 1JXKA 1MZRA 3BO9A 3O7UA 4J5NA 4MYXA 3PJWA 3CZGA 3QGAC 5H1WA 1W5MA 4UCGA 5CC6A 5BXPA 2NLYA 4XK2A 3KBVA 3RM8A 3WBXA 4IIHA 2W91A 4WDUA 3NSMA 4DJDA 2R1LA 4P7OA 4LUSA 3SO7A 2WO5A 1XCFA 1U1HA 4YCOA 2I9EA 3WDHA 4NZCA 3BARA 4RKAA 2A4AA 3TJXA 5IXEA 3KBNA 4L1GA 2QCLA 1VAHA 4F4RA 5HQLA 3CEPA 1HKKA 1TPUA 2A3HA 4X3ZA 3VFLA 4M7SA 2OOGA 3WF3A 3W22A 2VFIA 1J0HA 3C4UA 1Y0EA 3SGGA 1OFBA 1TV5A 1GOMA 1V3MA 4J27A 3ANVA 1Q7QA 4IIFA 2AAMA 2PMQA 5C6MA 3R8RA 1WDDA 2J4GA 3COTA 2J66A 2QMKA 1VCGA 2VD9A 2Y70A 4MNMA 3A5FA 4F66A 1ZRQA 3GBEA 3HTWA 2Z0IA 5AHMA 4JN6A 3MP5A 5AC6A 3G18A 1XLHA 4Q32A 2WM1A 4MAVA 3CT2A 2WVVA 5HQMA 1DWAM 3GIYA 4JQ4A 3TQPA 3V0SA 3G1AA 4W8AA 5DRIA 1ZP4A 4MLRA 4U28A 2RDXA 4BK9A 5D2XA 3ALFA 1JRBA 4NI3A 1ENUA 2AQOA 4H04A 3DFYA 2D3LA 4TMCA 5JVLA 4BFAA 5I3DA 4HK5A 1WAUA 2AKZA 1W3NA 3TR9A 3T55A 4JYEA 2X0HA 2AMGA 4LGXA 2Y88A 2XN1A 4E3TA 1ECQA 3ID7A 1C92A 1JCJA 4K8EA 2AQWA 4MOZA 1N8WA 4HNLA 4FOJA 3LBMA 4US5D 3VK5A 2HNEA 3RRAA 3DHPA 1G67A 1XC6A 4AD2A 3OHMB 4KW2A 4U5KA 5DN1A 3CT7A 3M0MA 4HOZA 1XYMA 1MYRA 1YIXA 1U30A 3N12A 1GYNA 4HMCA 3SW6A 4GZ7A 3EMQA 5HULA 5KZMA 3CHVA 1PDYA 4GYFA 2DSWA 1TFVA 2WJZA 4JICA 3L2MA 1J5SA 1QTWA 1A5NC 2PWFA 1Q5MA 2DVTA 3GVQA 1B3YA 1R0MA 1H4PA 3H21A 4O16A 1NVMA 2BGQA 1XKJA 2VEKA 4XZIA 3QFWA 5U4NA 1V02A 2OGYA 3WBWA 4QEHA 1FWJC 5DY3A 3M5VA 3SI9A 4PMXA 8RUCA 3NZGA 4RXFA 3UZXA 3L68A 1X6NA 4GY0A 4PCSA 1NSJA 4KFOA 1U83A 5CJ5A 5JH2A 5J04A 3E38A 1S2AA 4KWSA 1V6TA 1XIIA 3D6NA 3ZLHA 3AFBA 4V1YA 3V0UA 4JIHA 4ZQOA 4MZ1A 2HVMA 2R1PA 4JTGA 5K3VA 3ATYA 3KCOA 3L12A 4A3HA 3NZQA 3RMEA 1KKOA 4JGDA 5D09A 3M0JA 2NWSA 3G22A 3NFUA 3P82A 3LMYA 2O7QA 5U7SA 4E0CA 3KL0A 4KWWA 2REQB 1SYTA 4OBTA 3T0CA 1NF7A 5C0QA 1IXPA 1CB7B 4NYYA 4JFWA 4E6MA 3UFYA 4RZ4A 1AIWA 2J6VA 3L4YA 4D9PA 1A49A 5TBOA 5AYBA 3W37A 3BGGA 2ZXAA 4KGLA 3THAA 1OZMA 7ENLA 4TTGA 4U31A 2NZLA 3DFTA 4N9CA 4ML9A 4Z2HA 1EJXC 3URQA 3G2GA 2C71A 2VCCA 3STPA 1GHRA 5IFTA 4ICCX 5ECUA 4JTJA 4MY1A 4E8GA 3RLVA 1A5UA 1XFCA 4C6DA 4HYRA 4RNJA 1XH1A 5CPLA 4L6HA 1NTHA 2CWXA 3SR7A 4DWSD 4J3ZA 5JXQA 4KFNA 3PBMA 4GHLA 4XBSA 3TN5A 3GWQA 7PTDA 2YX0A 3TWBA 2BWGA 4QDWA 1SZRA 3MB9A 2VGGA 4EIVA 5EL1A 4XD3A 4O11A 1VFSA 4AHPA 3KVLA 4WJ8A 2Z1SA 4ZOAA 2BVTA 4KEVA 4G5DA 2GUYA 3AS2A 3G1VA 3CO4A 1RVKA 2BODX 4MIMA 1E9IA 2DJLA 1V3JA 4W88A 1K9DA 1KBJA 3QQ0A 1LOQA 2RH9A 1I2PA 3S0CA 4XZLX 1D7FA 2OODA 3VUPA 3TYAA 1SR0A 2EPMX 3TE9A 4G9PA 1MDRA 3PANA 1SZFA 3WH9A 2UY2A 2J75A 5K7JA 3AU2A 1MRAA 3BZJA 1VBGA 1W9UA 2R6OA 4H7ZA 3WD2A 5MHBA 3HQPA 1E0VA 4REQB 1OCJA 1W3IA 2QYGA 1K7EA 3DC0A 1B9BA 4CNSA 3DUGA 1CLXA 1E6QM 4PN2A 1I45A 3L4TA 4AIUA 5T26A 3MS8A 1KFKA 2VFGA 2YCIX 3JRKA 4JIPA 2XVNA 4UTFA 2WVSA 1V6UA 5ABTA 3HGOA 1W3TA 4FXJA 4CQBA 5IRPA 5H8PA 5AHFA 2QEZA 3WEZA 2CBVA 1LG2A 1UD2A 1KW1A 1PXGA 1GZGA 5HDRA 1QO5A 3RLHA 5EFDA 3GKAA 2X30A 3AHZA 4ZOEA 3WLIA 2JBMA 4HK6A 3S4TA 4KKXA 3BCDA 4JTUA 3ABQA 3YPIA 2JQXA 3LTSA 3UVAA 2BTMA 1BFNA 1H1NA 3GVRA 4IJCA 5CSYA 1HKIA 3G1YA 4GVFA 1TA3B 2OOFA 2ZXDA 3S46A 1PDZA 4DEFA 3GU9A 5T9BG 4XSLA 2W62A 1HO1A 3WQWA 3B8TA 5BYWA 5JMUA 3EAUA 3HQ1A 4JOMA 3S47A 3W83A 2GDUA 4DZIA 5CBJA 4ZCWA 3NJ3A 2X2GA 5A8MA 2J8GA 5DXYA 3WX7A 4NZ1A 4TR9A 2BHYA 3F5KA 3DU0A 2GZXA 4XZHA 3BL3A 3WBEA 3VC5A 1BXCA 2VR5A 2FN2A 4HU8A 1Q6DA 1PO9A 3GYCA 4BWLC 3AROA 1DTNA 4P7LA 5A69A 3D5HA 1KFJA 1VH7A 1WAWA 3L4XA 3WF0A 1X7IA 3ARSA 1MUMA 1HO4A 4FK9A 1QNVA 3H2CA 3AMLA 1BF6A 2OKTA 1SO5A 5AHEA 4R85A 1E9ZB 3LERA 3QZEA 4DPPA 1G7VA 5A6BD 4B3LA 2QUMA 2BXYA 5HQEA 1NP0A 1TCMA 2OU4A 2YFNA 4ZQRA 2BSLA 4JQ1A 3HF3A 1W31A 3ABZA 4IQLA 2QUUA 3LRKA 3S42A 1MUCA 1Q6CA 3WL0A 3SEPA 4I5RA 5D38A 3B9DA 3N25A 4NG3A 4EACA 5B7ZA 3VIFA 4OV9A 4S3DA 3SECA 1RZMA 4GUHA 3PPCA 3THCA 3B9AA 3BOLA 3UR5A 2NLIA 3N29A 4ZOBA 4PGLA 2NXGA 1BGGA 5AYXA 2A6LA 1QK2A 3ITYA 2E28A 4L4LA 1ZGDA 3GNRA 1SFJA 1UH4A 2IXUA 3FKRA 4X0VA 1O7AA 4NAEB 1SJAA 3RX4A 3PWGA 3LS9A 2BNJA 2WOQA 1R2RA 1I4NA 2ZRVA 5C2GA 4N6FA 1RY0A 4UWMA 3V1HA 1OYBA 4ONVA 1LQ0A 3W1NA 3RN6A 1LOLA 1XUUA 1Y7VA 1R6WA 1XLEA 2WMIA 4RDZA 4QROA 8A3HA 4CNUA 3OHIA 4DJEA 2VFFA 1TV8A 1SFLA 3W75A 3LHZA 1KCXA 1F5ZA 4CLMA 4REQA 4RNFA 1AH3A 3N6QA 1MEIA 3CAKA 2ZRUA 5ECVA 3IJQA 4WSKA 1TZZA 2AGTA 2EEXA 2D2OA 4BCEA 5K9XA 2E8ZA 3LHTA 3BMWA 4IH3A 3POHA 2IPWA 1SZNA 1TPDA 1WZLA 2J77A 1HG3A 1RCXB 5KTLA 3OIHA 4BHYA 5FJPA 2VCBA 4R53A 5A2CA 1BD0A 3FIGA 2BG1A 1QBAA 2E68A 2OYMA 3N2CA 4I9JA 1LF1A 4ACZB 4YTRA 3WQOA 2QS8A 3ZOAA 1V08A 1G9HA 2J7HA 3LZ3A 3E12A 3PTDA 1KXHA 3W25A 3LG3A 2FLIA 3FDGA 3PK7A 5D32A 2PSNA 1ZCOA 2BOFX 2Z1WA 4I9MA 4K2SA 2PP1A 4IPPA 2Z7GA 4M51A 1EBGA 3NQGA 5E9AA 1TV7A 1C9WA 4HNTA 4OJ6A 1H7PA 4DUWA 5G1YA 3W7HA 2E4TA 4S3JA 1JCLA 4D8LA 1PSCA 4JX6A 5D37A 3BG3A 2PGRA 3LQGA 3LHUA 3NL5A 4QQ3A 1GVSA 3GHUA 3GVWA 1UUMA 1OF6A 3XISA 1MFVA 1ELSA 5JBEA 3SCRA 4MMWA 4IIBA 4LY8A 4ZE4A 3D47A 4O1DA 1TV3A 1OBAA 1WYIA 3W7RA 3C0LA 3S3GA 1F2JA 3LD5A 4U3CA 2OZ8A 1GTHA 4GQRA 4C7FA 1FY6A 1BSIA 4YHGA 3QY6A 1PVNA 4ERIA 1OGBA 1DBTA 3VKBA 4J4KA 3VGHA 4LH8A 1H7RA 5FJOA 1P6BA 3VIKA 5HA7A 1ZHAA 1SW3A 4Z2LA 3H53A 2TODA 3WIJA 1TG7A 3RXZA 1TCDA 1YBQB 2VXNA 3AYVA 3NGJA 2ZOXA 3GK0A 5G2IA 4L61A 2PDGA 2J13A 1MO0A 2WHLA 3KOFA 4Z0SA 4JTCA 3IVUA 3O8AA 4PUEA 3VIMA 2H6RA 2XH0A 4J2MA 1OINA 1LP6A 2EPOA 3MA8A 2RUSA 5CLWA 3NR0A 1B0IA 3GU2A 3LLXA 3VCRA 2ZXQA 4HHLA 3QW3A 1QMLA 3LI0A 1B2YA 1JQVA 3EA1A 1GKRA 1HIZA 1FH7A 2NXIA 4DO4A 4MPKA 3PTMA 3NO3A 4QG9A 2YDAA 1Y8BA 4ZTXA 2UY5A 3AUOA 4HJFA 4LSBA 1F61A 4NAEA 4RDWA 4Q7NA 3T81A 4OKDA 9CGTA 5FI8A 3A47A 1GVRA 1I6NA 4PBGA 4BI7A 4UTHA 6PTDA 3AC0A 5G4WA 3ONBA 3PTQA 1DKWA 3QN3A 1FVPA 1V4YA 1EL3A 2VHLA 3GXDA 3TYDA 3L4ZA 1WBJA 4KFPA 1UCWA 2ZX9A 4ROQA 1LJYA 3AIVA 1AMKA 1YDVA 4PEKA 2J8FA 1EGVA 3U2ZA 4GI6A 3Q58A 4TQTA 4UTIA 1ZQ5A 3T09A 4LANA 2CBUA 3QM3A 1N8IA 1VP5A 3AS0A 4DYKA 2QDHA 1XSJA 1PX3A 2VQUA 4LUJA 4NIRA 4YYCA 1C3FA 2V3DA 3TAKA 1XF0A 1A80A 1B31A 1FWCC 4Y96A 3LPPA 5DT7A 3WLRA 3QHNA 4QQUA 4Y9OA 3QTPA 4KRUA 4CQ8A 4AU0A 1IT7A 2ASHA 1JNDA 4R27A 5DXXA 1FWWA 4M80A 3NPVA 2GQ8A 4UTWA 2ZBTA 4HPHA 4GE8A 2Y1HA 3OGRA 3L21A 4Q7BA 4YNGA 2EG6A 4DF0A 1L6WA 3OGVA 1UD5A 3CYJA 3GXNA 3WELA 3W87A 2BY0A 9XIMA 4B5UA 1BKHA 1TJ0A 4J1OA 3TC6A 1K8CA 4ACYA 3WLPA 4FXRA 1Q4NX 4ILSA 4GH1A 2JGQA 2CZDA 4PBEA 3N6JA 1QNPA 2DGAA 1OGSA 4JL1A 4AMCA 3F5LA 3PAOA 5FOOA 2DDXA 3H7UA 2H3BA 4GRSA 2FZBA 4EWJA 2GGIA 3CMGA 2ATSA 3SUWA 5ABGA 5JUVA 4Q8UA 3TEVA 4H6EA 1XCXA 1J6OA 3VKDA 1P6WA 1KGUA 4W8BA 2OT0A 3SGUA 3PF3A 4A3YA 1UASA 4XVDA 3IRSA 1CBGA 1YU1A 1N8FA 3N13A 4C1LA 3WJSA 3WD4A 1XQLA 3DAQA 3RX3A 1W32A 3BLEA 3W23A 4O4VA 4GKLA 3RIKA 1BYDA 1A0DA 1Q6RA 3OA5A 1O5RA 4X9YA 3HU7A 3UA3A 2J74A 1AJ0A 4B5WA 1XG3A 3BJFA 3UZYA 4IBFA 3W29A 1QVBA 3FCPA 2IQDA 2O9PA 5FJTA 2C0AA 4DWSB 1K3UA 1XRSA 3ZT5A 1I0DA 5DBTA 5AC7A 3HGSA 5FCZA 3L26A 3AS1A 1S38A 3HPAA 3UWZA 3F2DA 3WJXA 3AXIA 4PA8A 1YBQA 1G01A 2ZRZA 2BLEA 1OFQA 1S5MA 3WQ5A 1L2QA 1JIBA 1K8YA 3B8VA 3EX2A 4XD5A 4MNLA 5M2FX 2RJGA 2WZTA 3OYXA 5I5RA 5D8ZA 2YXXA 2YPIA 4GY1A 5M5DA 4DZ5A 4JTIA 3GVVA 3PG8A 1IEWA 3GDBA 3DYPA 1BG9A 3MSGA 1V79A 4XD6A 4I7WA 2JALA 4FPSA 1UMLA 1JZ7A 3WQGA 5I02A 4PTWA 2GWGA 4OUIA 1J18A 4PR4A 3JS3A 4M29A 4OIFA 2AKMA 2PA6A 2DUAA 3R94A 3BK0A 1UWUA 4IGMA 1VFLA 3PZNA 1AODA 4US5A 1EF3A 2HBXA 2OSWA 3WF2A 1W5PA 1XLJA 1RCQA 3KS8A 1HN1A 3UG5A 1GEQA 3M7SA 2V6AA 3KS6A 4BKNA 2W66A 1UQYA 4L56A 4ZGYA 3TV8A 1YX1A 2Y2LA 1PYFA 3UZWA 4DYEA 4HN8A 5I00A 2CLIA 2F38A 5CXPA 2TPSA 4JFTA 4X61A 5D2TA 4C1NB 2R1KA 3CO8A 4C6PA 1W3KA 3M6DA 4S3BA 1DQXA 3BC9A 1W9PA 1VJSA 2CESA 4RL3A 2EGZA 1B30A 2GQ3A 3PJTA 4M6UA 3U6WA 4AIBA 3SM0A 1ZP3A 3PZTA 3NVDA 3TW7A 1LL6A 3ARRA 3CJPA 4PBFA 3OP2A 4QSHA 4GLEA 4GACA 2WV8A 4Z2JA 3VO0A 1G0CA 1G4EA 2QUNA 3O6YX 3UJSA 1L6YA 2C1HA 1JGIA 3AIUA 2AL1A 1RV8A 3W86A 1J2BA 4GH9A 5A5WA 2RDWA 2EJ1A 4KERA 4R33A 3SIMA 3SCVA 4AZ5A 1OY0A 4L65A 2HEJA 2W4XA 1RP8A 5XINA 3T0DA 3NA8A 4KH2A 3HGRA 4YHEA 4GIYA 2A7NA 3U9IA 2IW0A 2IQ0A 3RCMA 1OFOA 3KBJA 4U2YA 4AXNA 2HVNA 3IK2A 1H7XA 1YE4A 3WK3A 3RK8A 3EXTA 5A1AA 1ZJIA 4UQEA 4GI4A 3KOWA 3S83A 4FS9A 1BXBA 2D22A 3CNYA 3S1WA 3PNUA 3THQA 2RFGA 1YTDA 3UXAA 1XL9A 1RVGA 4UOQA 4QCFA 4O50A 4YU1A 3E9AA 3T8QA 4EX4A 2X7WA 2IQTA 3UGRA 3GTFA 3L0NA 3L25A 4YVVA 1D8CA 1RP9A 1EDGA 1V8EA 4ZODA 5LYRA 3EOSA 4ZO9A 1MDLA 4QG8A 4FXFA 4JFVA 3OPSA 3M0HA 3OEXA 5G5IA 1E6ZA 1TJ2A 2Y5EA 4M19A 3MU7A 4RE2A 1G7UA 2HV5A 3V0TA 3TN3A 2J9XA 4DXVA 5AC5A 4PTVA 3UWVA 5IBXC 1M7PA 4GCXA 4HU0A 4DF2A 4S3FA 5LHEA 1FTXA 3ANYA 4LCRA 4MKVA 4YTUA 3M0KA 4QRNA 4TVDA 3TA9A 4U3AA 1XH0A 5E1QA 2NQJA 2A0NA 1EH9A 1G4SA 3EA2A 1UWIA 3B8UA 7XIMA 3P3BA 2ACQA 2XVKA 1CEOA 2XYLA 3VMNA 2WSQA 3B0YA 2W6RA 3BH4A 1A5BA 3I10A 3ME3A 1EJUC 3E0WA 1I2NA 4QCEA 4NZJA 3AISA 3B8WA 1I60A 4JIIX 4EOUA 3NOYA 4FNQA 3LXAA 3W72A 4NYUA 4ZOCA 2Z00A 1SMAA 1YDNA 1HUVA 3O0KA 4OGZA 3VDBA 3VKJA 1X8CA 2A3CA 2I5IA 4JN7A 3VNJA 2VRQA 3VD5A 3L7RA 1MQPA 1NELA 4EVZA 3WQCA 1GVYA 1BYBA 3ORWA 3P93A 3NXLA 4HA0A 1KXQA 2OLHA 3NDYA 3RCNA 2PD9A 2OG9A 3LHWA 5DMYA 3RU6A 1EJWC 2WNZA 4Y9PA 1I1XA 4IPIA 4ES4A 1M03A 1E1FA 3L5LA 2VVSA 2QF8A 3Q4DA 4H6QA 3VCCA 3IUIA 3TJ4A 1VEOA 5HWJA 4C1NA 7CGTA 1K4HA 2DU2A 3TX9A 3AUJA 5CZSA 1WB0A 4IBEA 3QFEA 4F0RA 1QHPA 3RGTA 4GYKA 3R11A 3BICA 3FSUA 1GOWA 3L67A 1EYWA 1AH0A 3UWQA 1EPVA 4IUOA 2WXDM 1ZL1A 5F2GA 3LZ5A 4UTLA 3AXHA 1YTKA 2R82A 3CUHA 5CSUA 1J9YA 2PWVA 1H51A 1RHCA 2VR4A 4Z2IA 4C6JA 3UNDA 1XW8A 1YYAA 4HHMA 2W3ZA 3F2BA 2P76A 2I56A 1ONRA 4K39A 4UFIA 5FSDC 3WH8A 1SO4A 4U5IA 2FH6A 2Z1BA 4NQ1A 1UD4A 1V7AA 4JKMA 4XBJA 1BYAA 1KQYA 1XV8A 3URAA 1QOPA 3KCLA 3KRZA 5FL0A 1PYMA 3DFQA 1VYPX 3W7NA 3F2CA 4FOKA 2R91A 2VX6A 1LRTA 3S1XA 3GDRA 4B9ZA 3BV7A 1NJJA 4EXBA 1NAL1 4YMZA 3GXPA 1GG1A 2QJGA 3WUEA 4R88A 1H1YA 1J11A 3BJTA 1PKMA 3WEOA 4GHRA 4GY7A 4LALA 3I65A 4GGBA 3RU8X 2OX4A 1KM4A 1CENA 2CNCA 3WY1A 5C55A 5CPTA 2NVDA 3KZSA 3GW3A 3LV5A 5LIYX 2FVKA 3SQSA 4PB5A 3PWAA 5A6BA 3QW4B 4JPGA 1O1ZA 5A8NA 4DUOA 1W5QA 2FHFA 2FGBA 2Z4GA 4O8RA 1LT7A 4POCA 3GTXA 3UZJA 3H7VA 1KC7A 5ABFB 2V3FA 3QQWA 5LSMA 3PTKA 2HPMA 4L1XA 1CB2A 2ZZ5A 4P8WA 3H55A 4O1CA 1EKOA 1KR1A 1U5HA 2XFRA 5A3HA 1V51A 3CZ8A 5AFDA 1BKSA 3R25A 1CXIA 4IF2A 1SW0A 1YKWA 1GZ1A 2X1IA 2HTMA 4LYRA 4JY9A 2X41A 1E3ZA 1Q65A 3TDFA 1PX8A 2PI6A 5CZJA 1S3TC 1QCWA 3UD6A 3FLUA 5T91A 5I79A 4H8VA 3KW3A 1YNYA 1KXTA 3NZRA 5LIWX 4PH6A 4FNUA 2FPYA 3PC0A 3IGUA 4PYSA 3WH7A 2IPJA 4B5XA 3N2MA 3BAKA 3JU2A 2UWXA 3NPUA 2YA1A 2P53A 1PKLA 2QPXA 1BRLB 3KTSA 5M1TA 3E0LA 3MVTA 5BXSA 2WCSA 3VNKA 1DJWA 1GGOA 4UMAA 4ZEPA 3MVIA 2YXOA 4UTUA 3DKLA 3RJXA 3HQOA 3E74A 1C8QA 3MUIA 4F2TA 4UFKA 4LT9A 2ZFAA 5HMSA 4JEQA 3IWPA 5HMDA 3F4WA 3HONA 1Y5WA 2PDWA 2PDHA 1LL7A 3QMRA 1TUXA 4XSMA 3VCNA 3NQCA 3I3EA 1X96A 1M65A 1OFAA 1NDVA 1HKVA 4B4HA 1GQKA 2ZDRA 2O55A 1PWMA 2Y8KA 1LWHA 4E2DA 2XISA 1R5YA 1W1IE 1H09A 1RA0A 1UUOA 1F8MA 1UWTA 2XFWA 3H2MA 4GXWA 3BLDA 5HUPA 6TIMA 1UWQA 2PU0A 4I6KA 2W79A 3CQ0A 2E5BA 2WJEA 1O6IA 1HKWA 3EOEA 3VOFA 2PDLA 4HQVA 1K9TA 1JL8A 2INZA 1H5VA 2XSAA 3MO4A 4PMYA 1F4AA 2WNQA 1JNEA 1OK4A 2MANA 1NQ6A 4J28A 4S2BA 2XD5A 1JPDX 4W8LA 3WLMA 4PTNA 2YBVA 1V3HA 4WCJA 1R8LA 3U57A 3P61A 2ESCA 3MUY1 1R2SA 2XD1A 1K9FA 3IJ8A 3ZVHB 2DZPA 4F0KA 3RO6A 3B03A 5CBIA 4CD6A 3UWEA 2B81A 3T2PA 1HJUA 2RGLA 3VGDA 9XIAA 2V82A 2XVLA 2PP3A 1PZ0A 1Z8AA 4D72A 2C13A 1TX0A 1H1ZA 4HB7A 4ATDA 3WLKX 5KMYA 3H2NA 2Y5SA 1LQ2A 1S39A 2C91A 4GPNA 3T9PA 3GDLA 3RM4A 3A4AA 2PDMA 3HOJA 2ZC8A 4K8HA 1MQRA 4YTSA 1HTIA 3RMJA 1R7OA 1GVQA 1H0IA 2IMRA 4C91A 1OJXA 1T96A 4I5UA 4C60A 4AWSA 4EAMA 3FKEA 3DFPA 2PUZA 1MZHA 4GA8A 4TVCA 3EMZA 3E6EA 5GNZA 3SAZA 1H7WA 3GNPA 2AAAA 3UZZA 3DI0A 1J0YA 2J8TA 1R46A 2F8QA 3W85A 4PMOA 3PHAA 3VYLA 1NEYA 4US6A 2YCJA 3WQFA 4BF7A 3W2UA 3M0YA 1FWSA 3MTWA 3WQEA 3T4CA 4Q6XA 4PC8A 4L9YA 1ZPTA 2CBIA 4LS0A 1IXQA 2DPEA 2I7GA 2ISWA 5CGTA 2CHOA 1YNQA 2JE8A 1LG1A 1VHCA 5D30A 1IR1A 5ABFA 4AHQA 3P5YA 3KHJA 4EXAA 3XINA 4MGGA 2OSYA 2DT1A 4HBKA 5F2LA 3UETA 2BHUA 3H7RA 1VYRA 2V68A 3N9RA 4J3VA 1VF8A 4LAMA 1NIUA 3NPWA 4Z1AA 1FCUA 2WCAA 3QRHA 1TPB1 1BXNA 1KFLA 2PBOA 4O0ZA 2QMJA 4CVWA 4UNIA 4GKTA 3QZ6A 4ZBCA 3AXXA 2V2CA 4DNHA 2PLMA 1VRDA 4AZ6A 2CBJA 3M5ZA 4PMDA 3OTRA 1LZOA 4Q4OA 3K30A 3T1GA 3OLEA 4D8AA 2Y6ZA 1O5QA 3E96A 2XH4A 2GQAA 5FF4A 4OOUA 3K4WA 1BRLA 2QW5A 3ZLFA 2DORA 2CYGA 3DKJA 3H26A 2VNCA 4IT1A 1XLKA 3NUKA 3ITGA 5CC5A 1HXJA 1TJ1A 3C0JA 4H9TA 1B1YA 4KPLA 4CKQA 1U1UA 1VC4A 3ZZ1A 3M7WA 4HA1A 3AZSA 1UHVA 2FGZA 1QXLA 4DLFA 1J10A 3TLLA 2Y2PA 2EPNA 4Z08A 1AA1B 3E3HA 2CXEA 1ZY9A 4WJXA 1J2WA 4AZ7A 2V38A 4L7ZA 3W7QA 4XVEA 5C70A 2VEIA 1IT8A 1IGSA 1GQJA 4D6JA 3G1DA 3TW9A 1J0IA 4ZO8A 4IG2A 1X6LA 1M7XA 2J7BA 3IRDA 2D0FA 3W1TA 2H90A 1KQZA 5LKYA 4UZUA 4M5PA 4JN8A 2H8XA 4NASA 2ZRWA 2ADAA 3I6EA 3AQUA 4IMAA 3QYQA 4O4WA 1XM3A 3UPMA 1R3QA 3F03K 1LRQA 3G3MA 1F74A 1ITQA 4ZQNA 5D9PA 3WUBA 4KWVA 2W5FA 4B2DD 2H3DA 4PFHA 3WJYA 4JQAA 4JYDA 3SDOA 1XQKA 2HXTA 5BOFA 3NOEA 1XHGA 4GVHA 4GNJA 4XISA 1S2WA 3EKGA 4R34A 1K7XA 1XBVA 4MY9A 4B15A 3UA4A 3ZVHA 2ISVA 3WNKA 4PUMA 4Z0JA 4WOQA 1QRQA 3SJNA 4YYFA 1QWGA 3S6DA 3RJYA 1XDJA 3FYYA 3O6CA 4XAFA 3WK2A 1FUYA 2EG7A 1EC7A 1B3XA 4M8UA 1H41A 3WNOA 1PHQA 1RPKA 4QDPA 4NL1A 3O07A 1XLMA 1TWSA 2WZMA 2QR6A 2EKCA 3CZEA 5A6MA 3BSMA 2P3ZA 4H8NA 2ANUA 3P81A 3ZR4A 1Z3NA 2FKPA 3AZRA 3B4UA 3ERPA 2XTKA 2Y2WA 1H7NA 1Q7ZA 1V6XA 1DJQA 1T7LA 5BW6A 1WZKA 5AHNA 1F6PA 1EGZA 2AQVA 5C9ZA 3FSTA 2VC5A 3BLLA 4WEVX 1ZSXA 4QJ1A 3TNOA 5L6UA 3MSDA 3SIZA 2CHRA 3AICA 1E0WA 4M81A 3VZZA 1HVXA 1WZMA 4BEUA 4W85A 3GTNA 5FAJA 3WD1A 1QO2A 1GW1A 1CCWB 3VC6A 4D1JA 4MVAA 4C6MA 1E9LA 4IICA 3DGRA 4ZB5A 4WQ6A 2JKEA 1KWKA 3QV8A 3BURA 4QHRA 2V63A 1MW1A 1FXQA 4HTYA 1P4CA 2IS7A 2XIBA 4JDYA 1FRBA 3LQLA 4ZSUA 4UR9A 1JQXA 1EJRC 4H9YA 1H0GA 4XG1A 3H2OA 4NX5A 2Q8ZA 4BQ2A 2DH2A 2A1YA 4MUZA 2YB1A 3VABA 5G1TA 3W1PA 2FVLA 2DEPA 1UMYA 2J7DA 2VX7A 4HN4A 4LWWA 2XWEA 3I4KA 4ZR8A 1OD8A 2XM2A 2GSJA 5M03A 2VDHA 1WKDA 3LOTA 3TSBA 4Q4RA 2GVJA 4E5TA 3VOJA 5DANA 1XR2A 4C6CA 1DJHA 3E1F1 3KTXA 4IBBA 3KBSA 1E8BA 3R89A 3WLTA 1ONWA 4DY1A 4AC7C 2JEPA 4CEUC 1GYLA 1EF2A 4DZHA 3QV9A 2XHYA 2V2HA 4IL0A 3WNMA 3L9CA 4DIAA 4C7GA 4S3AA 1ICPA 4LY4A 2ZICA 3CK5A 1AW1A 3GXFA 3MKCA 3JR2A 2DUXA 4AIOA 3W7IA 3PZVA 4NXSA 1I9CB 1Q6OA 3NGFA 4CN6A 4GZJA 2ZZ4A 2EPLX 2I1OA 1VBUA 1ZJHA 3O16A 3B9NA 3HFYA 4EPBC 4UMCA 4LBSA 4J3WA 3TCSA 3APGA 1QI0A 2HJPA 2BZNA 4HCDA 2IKJA 4AW7A 4GK8A 5D8WA 2NT1A 3EBVA 1TTPA 3PAJA 3HURA 1DEDA 4IGNA 2Q02A 2VC9A 4IFOA 4JTDA 1W9BM 3W7PA 3A3HA 4FIQA 2ZWZA 2JK2A 1TV4A 3HBLA 1FDZA 2ZWYA 1FWGC 3K1GA 2EF9A 3CPRA 5CAKA 1D3HA 1PL9A 3H24A 1AQ0A 1ZAIA 4XAPA 5EMJA 2G5WA 2XIMA 5CPNA 4ATWA 2DSKA 4LQ1A 3IACA 1VFMA 2INFA 4CCEA 1Q6GA 3OIXA 3EGJA 1YADA 3BPWA 3UZ5A 3DERA 4LAOA 2RHGA 1A3HA 2ZX6A 1PTGA 2CZEA 2NUWA 1G69A 4FI4A 5HAOA 4LF2A 3IIZA 1DJIA 1T0OA 3UVIA 1GT8A 2ICSA 4KWOA 1U22A 1UBSA 2FB3A 3GAYA 4DXXA 1JUKA 4E2OA 4ZQCA 1VLWA 1S1RA 4FP1A 4TV6A 2W9MA 2XWDA 4DNMA 2GUBA 2V2DA 3O1NA 4Y9NA 3CUFA 5F4WA 3B0UX 2QPSA 1KKRA 3VX0A 1ODZA 1R47A 7TIMA 2C19A 1F76A 4LC6A 1X38A 4ZO6A 3FA5A 1E1EA 4DPQA 1M01A 2PZ0A 1GYMA 5HJLA 1AD1A 4LNCA 3G5EA 4NSBA 1W91A 2EKGA 1VFUA 1GPFA 2CETA 2HISA 2Z26A 3U2EA 4GIAA 2W67A 1S2CA 2BB0A 2WVTA 4BI6A 4AD5A 1B3VA 2Z6IA 1EC9A 3WK0A 1SVDA 5AB3A 3NL2A 4LX4A 1PBGA 3FVDA 4G56A 1FWFC 3DCPA 3TTSA 3ANUA 2ZUUA 1E0XA 3NIYA 1GOIA 3GQYA 1W5OA 2WVUA 3HM7A 4HVXA 2PDKA 3AHVA 4MHBA 3NQBA 2P8CA 1EIBA 4L6OA 4NX0A 3PULA 1L2UA 2VUYA 3W9ZA 4EANA 4XZBA 5C54A 2OSXA 3BMXA 7REQB 2XGIA 3S2NA 1E4IA 2C16A 3ZO9A 2ABAA 2WWCA 3CH0A 1JYNA 1XIEA 2YB4A 2EHHA 5LXXA 4UBPC 3W1MA 5DBUA 1U5JA 1ZLPA 1KRMA 1UD3A 4WUIA 5HMEA 1JPMA 1MW2A 1E9YB 4O54A 3TFXA 3PZUA 3I7SA 1UR3M 2OYLA 5C9WA 3NO5A 1IWAA 3GXMA 1A4MA 2JKAA 4PCNA 4A3UA 2F6XA 4LCQA 1EQCA 3HZ3A 3WEMA 2RJHA 1VLIA 1DJXA 2DFAA 4LEQA 3GHTA 3GC5A 2W63A 5JBFA 2J7FA 4XUGA 1J8VA 4CNTA 2YDSA 4A29A 1HJVA 1KXVA 1SZGA 4U10A 1DL3A 4QBXA 5MF5A 2Z2UA 1VFOA 2NWRA 3V3WA 2P0OA 3UEQA 4M6VA 3R0DA 3VKAA 5A6TC 1E6RA 2B7NA 4C6LA 3ARTA 1HFBA 1PPIA 3S6OA 4ZFMA 4QNWA 2BDQA 2DVUA 5CPSA 5ENLA 4B5NA 3GFYA 1IZCA 1CXEA 2HPIA 1KM6A 1Q8AA 1XLBA 1XFBA 3LPOA 1M04A 3HFTA 5I06A 3R79A 3N3FA 3IUHA 3V5FA 5AN7A 3KXQA 2J79A 3V5OA 5LNSA 1K7FA 1OSEA 4IFRA 4GBUA 5HR6A 1KCZA 1TMHA 1U2YA 3TUUA 4FOUA 1M53A 4I8YA 1W1ZA 1XLGA 3A12A 1RALA 1UH2A 3MDWA 3EWBX 3TQVA 2E25A 1XS2A 1FA2A 2GPTA 3MP3A 5I78A 3ABXA 3P14A 3NEVA 3LRLA 1X6UA 1P43A 1D3CA 3PPHA 3RPTA 4HA3A 1XGEA 3SY8A 3GC2A 1F9CA 4LRSA 2Y2MA 5A6SA 4FR6A 5HNRA 1J4EA 4HZMA 3WFLA 3GUGA 3R6IA 2VZSA 3LRMA 3EWWA 1A5SA 1R3VA 1OYCA 1QJWA 2BY1A 2XVGA 3VGEA 1RR2A 2FPVA 1WKYA 4ZFCA 3K8KA 3UJRA 2FIQA 5DRCA 4JTEA 4PUKA 3GW0A 5D2VA 4HNVA 1CXWA 1VEMA 3GNOA 4M7TA 4WGHA 5IHSA 1RY8A 4IFKB 3U5YA 3VKCA 4GHAA 4P2VA 3PFMA 3R1ZA 2NVCA 2VD8A 3ARUA 1YHTA 4DLMA 3N15A 1YEYA 3QTGA 1V6WA 3V16A 1UR1A 1V93A 2JF6A 3W76A 1CW2A 4IJEA 1O5KA 1GK8A 2TAAA 5GVJA 3DFNA 4S38A 4AFYA 4RCXA 1CIUA 3K46A 4HGXA 3QLDA 3FJ6A 4QJ5B 1KD0A 3W2KA 1E5NA 2XZ7A 2WCGA 2QCMA 5AZ0A 3T6CA 2NXHA 2ZA2A 4A2SA 1OG6A 4L5ZA 1R3RA 4LBRA 1KM0A 3BANA 1TVLA 4K68A 2V5OA 2FDSA 5BZAA 1UD6A 3B0PA 4TOQA 3M41A 3N9SA 3W6MA 3ZM8A 4C6OA 3VNYA 3A6OA 2BY3A 3WF4A 4C6KA 1LORA 3U7BA 2CPUA 4GIRA 4IX0A 4HPJA 2WLZA 2WYSA 3VIJA 2E0PA 5EYWA 1FWHC 1XX1A 3NTYA 2Q6ZA 3U3HA 4K6AA 4X22A 4AEOA 1XI3A 5L9FA 3K8MA 4Q8WA 4QAIA 3VOHA 2Z6JA 7REQA 5IM51 3GUWA 2QCDB 3PJXA 4B5SA 4AZCB 1X1OA 4IGHA 2CFFA 1DPMA 2NVAA 1GOQA 2ZQ0A 1NP2A 1XIHA 4IQJA 3NG3A 4MNJA 2J62A 3EKZA 1H7OA 3NQ7A 1Q6LA 3NZ1A 4UMBA 3A9BA 2HZGA 3SN0A 2HWGA 2GVEA 4NZFA 4ZXOA 3IARA 4AYSA 2P88A 2QVHA 4U4MA 1T5AA 2WANA 3A23A 1QNQA 3FVMA 2VI0A 5C2CA 1OB0A 4OUEA 3MUAA 3M5XA 1OD0A 4U33A 2O9RA 1FH9A 3LCXA 5ABEA 3QSRA 4HA4A 1ML1A 3SUSA 3QV7A 4B92A 1KBBA 5AYYA 1KBIA 3I7QA 3II1A 4QJ4B 1K4GA 4M3PA 4WSJA 3MWCA 2YCKX 3QZAA 1NDWA 4IMGA 3OLIA 1IEIA 1POJA 3UG4A 3S2MA 1XLIA 3VTRA 3UR2A 1JD9A 2GLKA 3WDJA 1RH9A 3VXGA 4WLCA 1SFTA 1E0TA 3PBYA 4V15A 1W37A 5CLTA 3G6LA 3S5OA 1EEXA 3SCNA 3FNDA 3IEBA 4KCVA 4A8NA 2BY2A 5LXEA 1XISA 1OCQA 2VWSA 5BXTA 4F40A 3LX9A 1AJZA 3P84A 2FTPA 5C7VA 2J25A 4Q4QA 4RK8A 1W6TA 4Q8PA 5REQB 3PUEA 3BZGA 1QT1A 4FNPA 3CPGA 3BSHA 3GLCA 1VD6A 4G7EB 4WRHA 3TONA 4F48A 1K6WA 1ZJBA 2VEGA 1UP3A 2GOKA 2QCGA 3S9ZA 5AC4A 4QLKA 4JNMA 3JW7A 2ZUTA 3CS2A 1KS0A 3WK1A 2PDUA 4KIRA 4LC8A 4J9JA 2F9RA 3VMPA 3KTCA 1PCWA 3R12A 3CLWA 5F2IA 1OFDA 2FDMA 2V5DA 3PS7A 1QI4A 4LEFA 1ONEA 3UCQA 3SCTA 1GPWA 1I2OA 1HKMA 3N34A 3GTHA 3SY5A 4WVXA 5FJRA 3N14A 1SMDA 1SSGA 4E4PA 3QGVA 4GZIA 2IPGA 1JVNA 1E4LA 5GQBA 5SWUA 4CUCA 1Z6KA 3UF9A 3TC3A 4TO8A 1FWIC 4TUFA 4ECLA 3S2LA 4B4FA 4IFKA 1XYZA 4ML4A 3BMVA 5K9DA 4ADSA 2QV4A 2GSHA 4PUJA 1WP6A 4RDYA 2OJPA 1OM0A 2OZTA 3OBAA 1OX4B 2KAUC 3THDA 4GC3A 2QVNA 1NFBA 5I03A 2WB5A 3OBEA 1FH8A 4MWAE 5EMLA 4GMEA 2PBGA 3G24A 3WLLA 3N4EA 1K6AA 2D1ZA 1EQPA 3PNZA 1CPUA 4XO6A 2HS8A 1X1NA 2PODA 1FDYA 3VNDA 1REQB 3TQKA 4LU0A 2DZUA 4G6CA 4YWIA 4HTBA 1PUDA 3CAQA 4M6QA 2XIJA 2Z7KA 1Q2SA 3LHYA 3FKKA 1XIGA 1V03A 3G77A 4DJDD 2CC0A 1DE6A 4ASTA 3WQVA 4DBSA 3U2OA 4IX2A 2D2JA 5GNYA 5FF0A 4UFJA 3ITTA 2QIWA 1WKFA 1CLVA 2G3JA 3VDCA 5KINA 4RNIA 4D8ZA 4JNYA 1GXDA 4NJIA 1CDGA 3KBMA 4X0NA 4P8XA 4CVUA 4AZCA 4MZ8A 3P7YA 2WKLA 3C6CA 3DYOA 4PB4A 2NQHA 2ZE3A 4W87A 4BJHA 4CEXC 3KS4A 4PE8A 1AG1O 1MMFA 4JFSA 3E0FA 3LEPA 3O06A 5BRBA 4XTIA 4JKLA 1GOOA 1FFQA 2WJDA 1KGWA 3W7GA 2CLMA 1EDTA 4AUBA 5HUOA 3EYPA 5D9NA 3R8GA 3GD6A 3VGGA 2DZAA 1O1HA 2BOEX 1F7BA 4E38A 4OJLA 2J9YA 1VCFA 1EX1A 1ITXA 3IGXA 1E40A 1H11A 2PDQA 3PZQA 4ICMA 1J0KA 4I5XA 4J3SA 4GIEA 3ITXA 3S5ZA 4ZO7A 4HOXA 1BPLB 1FWDC 3AMCA 4Y2WA 3T8LA 3N11A 4Y8FA 5HNNA 4B2DA 3EB2A 4UTTC 3IAPA 3R58A 1K02A 2EAWA 4LW7A 3EWUA 3L66A 3D3FA 1C29A 3TK7A 5DQPA 4F8XA 2WK2A 3NQEA 3A9IA 2R9RA 3TSMA 4CN4A 1P5BA 1F05A 4INFA 3WLJA 2YKKA 4DI9A 3QR3A 3O9NA 1EHNA 1OEPA 1TSIA 1IWBA 3VOGA 4XAGA 3TA6A 1VBJA 2YDQA 2VM8A 2X1RA 3ZJKA 3OBKA 4YWSA 1XINA 2F2HA 2QDEA 4Y9MA 5A94A 4F0HA 4K38A 4R5EA 5REQA 5D2YA 2Z1KA 4IM4A 4DJFC 1K03A 2ZXBA 5EPDA 5TQLA 6XIAA 4AHOA 2NV1A 1F4HA 2C0HA 2ALDA 3SCOA 2DT3A 1W1A1 4W84A 5D04C 1GW9A 1SM9A 2CW6A 3FAWA 3AXMA 3T05A 5MKGB 4BWLA 3WUFA 3VNMA 3CIVA 5TIMA 1ADSA 1ESWA 3WH5A 1KLZA 2ATMA 2NSXA 2IKIA 2VELA 3RLUA 2D69A 4IJRA 4GISA 2WPGA 1B3OA 3DX5A 4I9AA 1IV8A 1LLWA 5JQ9A 1MWOA 1JAEA 5G2HA 4K1WA 3RM9A 2RGMA 2QIIA 5EY5A 1XGZA 1VHNA 3LA4A 2UWFA 1PKNA 2B7OA 5CH9A 3U2CA 3B9OA 1EWEA 1QDSA 3EDEA 2VTFA 1F73A 5DCDA 2DT0A 1UH3A 1KRAC 1JDEA 4EE9A 3W7JA 3GXTA 2PTYA 3U8GA 3SCQA 3AALA 2G8ZA 2EG8A 3WNNA 4YL2A 4CNPA 3M44A 2F6KA 3Q67A 4AD4A 4GVGA 3WLQA 2C15A 2H8ZA 1KV5A 2OTDA 1P1MA 4KGJA 3GYEA 2WHJA 2GJRA 3ENLA 3W2JA 2ZZ3A 4M82A 2ZADA 5HANA 5GJPA 2BMBA 2HE8A 3QY7A 3E2VA 3WDIA 5C9RA 4FF5A 1JF6A 1P0BA 1NQKA 4FNSA 1FHVA 3EPOA 1UKTA 4A8IA 2NV2A 2XH2A 3L65A 3AJ7A 3FJ4A 1B9ZA 4DHGA 3AHTA 4JTQA 4DAFA 1V77A 3S5SA 3GO2A 3BV4A 2DY3A 4WGXA 1A0CA 3L23A 1ZTVA 1YW1A 1LQAA 4KEMA 5E0KA 3ITVA 4CCCA 4F3HA 2X0SA 4DBEA 4Z1YA 2B0MA 2ZVIA 4OJ5A 2ZRXA 2AMXA 1S1PA 3FGCB 3I7RA 1TTQA 1EXPA 3UR8A 4QNLA 4IMFA 3EDKA 5M17A 4GUJA 2PZNA 1H63A 3NSXA 4KRTA 1Q85A 3ISIX 4W9TA 2BVWA 4WJEA 1X39A 5I07A 2WBKA 1CXHA 4B3ZA 3CAWA 1YU3A 5FJIA 4XKYB 3QPEA 2ZA3A 1R9ZA 2WMKA 4O18A 1KFCA 3CWOX 1OCBA 4UNLA 2GUUA 2J7EA 1TVPA 3MI3A 4H9VA 2PLCA 4LB4A 1LBFA 4IWWA 5I77A 4HPNA 2NT0A 4WKHA 4LJ3A 4F0SA 4OBSA 4MB5A 3GIQA 3N2BA 1ME7A