3L29A

Crystal structure of zaire ebola vp35 interferon inhibitory domain k319a/r322a mutant
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
123
structure length
123
Chain Sequence
DISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPAIDAGWVCVFQLQDGKTLGLKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polymerase cofactor VP35
publication title Mutations abrogating VP35 interaction with double-stranded RNA render ebola virus avirulent in guinea pigs.
pubmed doi rcsb
source organism Zaire ebolavirus
molecule tags Rna binding protein
total genus 43
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3l29A01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 3l29A02
4IJFA 3L28A 4GHAA 4LG2A 4IJEA 3KS4A 4GH9A 4IBKA 4IBFA 3L2AA 4IBJA 5BPVA 4GHLA 3L25A 3KS8A 4IBDA 4IBCA 3L26A 4IBEA 3L27A 4IBBA 3L29A 3FKEA 4IBIA 4IBGA
chains in the Genus database with same CATH superfamily
3GLIA 2V1UA 4B3MM 3SYKA 1H0IA 1A5TA 1QO6A 1DV0A 3JAMS 1YU3A 1JB0F 3LVWA 1E6PA 1XB2B 4GMQA 1G8PA 4GH9A 5DYIA 3KP0E 1TH2A 2LHGA 2QBYB 5EP1A 3ZCBB 3KDSE 3HHYA 1QAOA 1BVSA 2JA2A 1W5SA 2LVQD 4LJ9A 4II7A 1OAIA 3KXEC 4HEOA 1WR1B 1GLNA 1NNUC 5E26A 1YSYA 2R62A 2JY6B 1D0KA 1G71A 2C9OA 4DBGB 2KRKA 3PFIA 3L26A 2CUZA 4R71A 2Y2KA 1QAQA 3F92A 3FTDA 4I8OA 3U6DA 1UR9A 1LV7A 1E8BA 4CISA 2Y2HA 4GEWA 2G8LA 2Z3XA 2VF8A 2XSZA 3BOSA 1PM5A 1V92A 1N77A 2CWBA 1GPFA 5BR8M 2F5QA 4NOOB 2EUCA 2Y2NA 5KPTA 4L16A 3VDUA 2F5NA 1YU4A 1ED7A 4LZZA 5EXSA 3SASA 3KSJA 2XFSA 2HAKA 3HWSA 5LMNM 4IBKA 2XLJA 2XZFA 4NRVA 2Y2GA 1TDZA 1IM2A 2Y2IA 1OAOC 1R4GA 2LWXA 1JR3E 1T43A 1NVMA 2KZUA 5KO3A 4LF5M 2C99A 3L25A 3VKHA 1FNNA 1G3IA 3VDPA 3T15A 2F5OA 1E6RA 1G41A 2VF7A 4FWGA 4NRWA 1EIJA 1HR0M 2JCHA 2O5RA 4MB7A 1N34M 1Y8GA 3WD2A 3FRHA 5KQDA 2XSZD 2L6OA 4B7HA 2HKJA 1PGYA 2L7IA 4FCVA 1TH4A 2DKLA 2X4AA 1IN7A 2LVPC 1E9SA 1KYIA 1N78A 3THGA 4LF6M 1SXJB 3FD9A 3U6EA 3LQQA 4LFBM 2Y2PA 1P3QQ 3V76A 2L7HA 3KS4A 4CJ6A 1C7YA 4F2LA 1IXZA 1VQ1A 2DAKA 2DZLA 2JP7A 3FUVA 3UZUA 3WHKA 3U6PA 3TWLA 1KFVA 1IY0A 4BBAA 2L09A 1Q3BA 3B7QA 2JZ0A 3QYEA 3VKGA 3I4YA 1Z5CA 2J5YA 3VLFB 2VIIA 3I4VA 2KXEA 1W1PA 4RF0A 1OIPA 1DGHB 1UFZA 4MGZE 3SMSA 3SHGB 2XGNA 2Y21A 4MB4A 2XEPA 5C1BA 1YUBA 1QANA 2H1RA 4IBEA 4OJOA 1WXQA 2Y2QA 1DGGA 1Q3CA 2R6FA 1XMOM 3LMMA 2KZSA 3WHLA 4LGMA 4HMEA 1GL6A 4DR5M 1YU2A 2C98A 2OQ4A 2V6ZM 2CV0A 2CHVA 1OQYA 4XBOA 4HMCA 3GP1A 4AG6A 2KHHA 4GHAA 4JYAM 2C5RA 5EQTA 2DNAA 4IJEA 4DV1M 1IN6A 3SYLA 2UWXA 4GIPA 3CF2A 2Y2LA 2KRUA 4OJ5A 4OUIA 3RGSA 4OU7A 2C96A 3GQ3A 4GHLA 3Q8GA 4LF9M 2LTUA 3DZDA 2FS1A 2XH9A 2FH0A 3W0FA 1NO1A 1E15A 1WGNA 1Q39A 4WURA 1E9RA 3KVWA 1HNZM 4KHPM 2Z8YM 1L2CA 2D7HA 1QUTA 4QOZC 3GLFE 2APLA 3MQLA 4LY6A 2F5PA 1VDLA 2R44A 3U6MA 2VQFM 2CFOA 3GLGA 4CHTB 2R4EA 1LTMA 4FCWA 4GKKM 1YLAA 2XF3A 3LQRA 2DWNA 2Y2JA 3W67A 4KT0F 1TGUA 3K2LA 4OJPA 5FTMA 1W1YA 2R65A 4Z2HA 2HCBA 2GNOA 4QOSA 1R2ZA 3AJIB 3U6CA 5BPVA 3J2PB 1PRBA 2DZOB 1XMQM 1GABA 2UUAM 4X66M 5EP3A 5DNYA 3GLHB 3PXGA 3C3DA 2QPAA 1VEKA 4G4RA 3ZC7B 4G4NA 1GOIA 3Q8XA 3T1YM 2D49A 4Z8XA 4LJ8A 2EKKA 3CGWA 4M9XA 4D81A 3L29A 4G4OA 1XC8A 4JI6M 1XHBA 3AL0C 1PJSA 3U6SA 3T38A 3TPZA 5EXXA 4NYYA 4BB9A 1E32A 1OGBA 3AV0A 4LRTA 4JI5M 3MMPA 4DR1M 2QHOB 1PJJA 3U61A 3NBXX 1IXSB 1E94E 2D7EA 1AIPC 2CE7A 2BG1A 3QAUA 2QZ4A 4QHTA 4D80A 1GO5A 4AI6A 2DXIA 2Z4RA 4REZA 2KNVA 3U60B 1G59A 4TX8A 2F4VM 3KS8A 4RNAA 3IG8A 1R7RA 1R6BX 2OOBA 2L2DA 1OGGA 4Q7JA 2D7GA 3I04M 3MHVC 1H0GA 3M7PA 3GPYA 4AW4A 3FUXA 2KEBA 1XNQM 1Z5BA 3LW5F 4LJ4A 2ERCA 3K9OA 3SATA 2YFQA 1K3WA 2ZAOA 4OW0A 4DV5M 1JQJC 4NYUA 1QDTA 1QQWA 4S12A 3ILKA 3LCUA 2VDBB 3EIHA 4FWHA 2EA0A 3FTFA 2KNAA 4X64M 1CXWA 2R18A 3DOAA 4Z2JA 2DAGA 2L4FA 4NXMM 4PDGA 1J09A 3WD0A 3L2AA 3WX7A 5DYGA 4Z2IA 4GKJM 4LFCM 3HJQA 1L8QA 1VDDA 3SMPA 2DAMA 1NV9A 4LJAA 4PD2A 3GPUA 4NZ5A 1K3XA 4AKIA 2RGHA 2ZANA 3HJSA 3QWLA 5IWAM 3GO8A 3RFWA 2W82A 4B3RM 3E46A 1SG9A 1NJGA 1WJ7A 3K92A 2UU9M 2EO2A 1EE8A 2FN2A 3R8FA 2V1CA 1JR3D 3HKPA 3GQ4A 5FTLA 2DWZB 3HHZA 2N35A 2M5ZA 5FTJA 2P5TA 4M0WA 3HY5A 3I51A 1PJIA 4NXNM 2G5GX 2WSCF 2ZTCA 3LCVB 5KPZA 4DUZM 4MH0E 2E5LM 3L28A 4QNRA 2RGOA 1QVRA 4LGYA 5C18A 1D0MA 2LH0A 2KA6B 1WGLA 2C9CA 1OJLA 3FUUA 2DWLA 3GLHE 1XXHA 3SFZA 1NHWC 2MJ5B 2CV2A 2ZM6M 2I7NA 4B3TM 1NY6A 1EAKA 1AUAA 1T6OA 3GLGB 4JI7M 2UXDM 1OTRA 4IBDA 1E6NA 5IZ7D 4X62M 4I4LA 2JE5A 1HQYE 1N32M 2CHQA 3WD4A 2G3QA 2M60A 4G3OA 4M9ZA 2JWSA 2J7OA 2QP9X 3EIEA 4OJ6A 3D8LA 3TL4X 3GRVA 2RRUA 4K0KM 4G4QA 4FCTA 1CUKA 3A98B 2WZJA 3KOWE 4M0DA 4LZJA 3PNYA 4DR2M 1TR8A 3KOZE 1TH3A 4AQYM 1CK7A 1V33A 2O01F 4DR6M 2L4EA 3AOGA 1C1KA 1IFYA 1GKIA 4L15A 3VFDA 1YU1A 3GLFA 2UUBM 4LJ7A 1J7MA 2JY8A 4PT5A 2LXEA 4GITA 2BNKA 1I94M 2H5XA 4L6V6 3HZJA 3WD3A 1OFHA 3KP1E 3GRUA 2FNAA 4HMDA 1YE9A 3D8BA 1L6JA 1ZAEA 3KOXE 3UGJA 3AOEA 5ITUA 3J7BA 2MGWA 3GLIB 1TF0B 2X8AA 1S3SA 2ZBKB 4LFAM 3U61B 3W0LB 2DVWB 2YNMD 5E6JA 2DAIA 3VK7A 3DA1A 3DFZA 3T6PA 2LVOC 2YR0A 3KSXA 3SHFA 2Y2MA 2CRUA 3M7GA 4P17A 2K0BX 1IBMM 1SXJC 3HX3A 3FRIA 3TWMA 4JXJA 2LHCA 1QYRA 1J5EM 2KNZA 1HT1E 2YQZA 4B7FA 3M6AA 1NSFA 3K1JA 2JNHA 1UM8A 2B3TA 2XZUA 4IBFA 4MGIE 5EP4A 3FUWA 3A42A 2BWEA 3SAWA 1W5TA 4RKUF 4Y28F 2OO9A 1IXRC 3E21A 4FD2A 5FTKA 3SC3A 5KPRA 1H8PA 3TQSA 4I5SA 4ZPXA 1GXDA 3MJ5A 4OJLA 2JUJA 3IECA 4IBCA 4F1IA 1PJQA 4LF8M 4AKGA 4NC6A 3TE6A 5ITTA 1VEGA 4D82A 4JI8M 1NJFA 1IN5A 1SXJE 7CATA 4NL4H 1HNWM 4LF4M 1W1VA 3HONA 4DV6M 3U6LA 3RGPA 1I4WA 5EJCA 4MB5A 1HNXM 5ITXE 3SAUA 2HHHM 2DI0A 2VQEM 3HU1A 1GVNA 2Q2EB 3PNVA 4LCBA 5LMUM 4DV0M 3GLGE 4EIWA 4DV7M 2CHGA 1IY2A 3BBZA 1VEJA 3NBIA 4JI4M 4Z6YA 4FVMA 1HT2E 1L2DA 1D0LA 2OOAA 3FYCA 4TUWA 2FOIC 1XNRM 2HWJA 8CATA 1T3TA 2K9DA 3MK6A 4WP2A 1HJPA 2Y0QA 4GRIA 1ZMUA 4OVZA 5EXTA 2K6BA 3LVVA 2RKOA 4NSOB 5EP2A 2EKFA 1MJGM 2NQ8C 3GRYA 4M9SA 4MM3B 5F3WA 3HHWA 2JY5A 4QHSA 3HHXA 3ZH9B 3HU3A 4OX9M 3M0EA 3U5ZA 4AKHA 5JI2E 3SBJA 1IQPA 1DO0A 4ITQA 1WHCA 4ANRA 1GL7A 2MR9A 1JR3A 2LNHC 1XXHB 4MGHA 1ZQ9A 3FTEA 2FFFB 3C3EA 2Y20A 3PVSA 1QZMA 3A45A 3FE3A 2IOUA 3GRRA 2Y2OA 4B3SM 4HLQA 2R4JA 5L8RF 3H4JA 1OFIA 5FLXS 4PCZA 3J81S 3SAVA 2V5OA 4B7GA 4RF1A 4CGYB 3GLIE 1N36M 1O6IA 1GJTA 3J80S 3U6QA 1OIZA 3B7ZA 3E9SA 2CP8A 3UMMA 4GC5A 2DZNB 3HJ8A 1UR8A 2Z7JA 2JXNA 2QCUA 4QNLA 3TWKA 4IBIA 3FKEA 1YUEA 1IN8A 2KDLA 3B7NA 3A46A 2MH8A 2F5SA 4X65M 3GLHA 3GLFB 4P16A 1ZV1A 2QQ8A 3B89A 3FUTA 4MGYE 4NZ3A 4GC9A 2BJWA 3SARA 1V34A 1DGFA 4B08A 1TDHA 1L2BA 3IG5A 4KODA 4LG2A 1PDCA 1N75A 4R3DA 3BXWA 2XD5A 1QZEA 2O25A 3C9PA 4DR7M 1IXSA 1QDRA 3W68A 1E88A 3B74A 4WW0A 1NV8A 5EXPA 4NZ4A 2AHMA 2DHRA 5DFLA 1Q02A 2DAEA 2R45A 2UXBM 3K9PA 1YU0A 3FYDA 3QYBA 4QNMA 3R9XB 2I7PA 1RU3A 3CTWB 3K8ZA 3L27A 4AZFA 2UUCM 1X37A 4AG5A 4KO8A 4UN2B 5ITRA 4DUYM 3U60A 1IBKM 1DGBA 2QBYA 1E6ZA 2JY7A 4JI2M 2KW0A 1AIWA 4IIWA 1KSFX 5A2QS 1ZMVA 1MU5A 3CF0A 5FTNA 2HL7A 4LRSA 4Z2KA 3KFUG 2DHYA 3NWLA 2QSFX 5H37D 1Z59A 4NZ1A 1PJTA 3KOYE 4BLCA 3UK6A 4CIZA 3ZQJA 4MGKE 5IREB 1IBLM 2XFTA 4LJ5A 4JI3M 3GQ5A 2BWBA 4FW9A 2CEAA 1TTEA 1Z6TA 1ORYB 2LBCA 2CV1A 3CF6E 2R46A 4YHHM 4LF7M 2WSFF 1J7KA 1R2YA 1N33M 2R0IA 2BJVA 5IT9S 4IBBA 2Y0TA 3OTOM 1XXHE 3JR4A 3UJNA 2DWMA 4JN6A 2ZTDA 4W5WA 1NHGC 3GPPA 4NSRA 2DENA 2ZAMA 3HGIA 2OPFA 3WD1A 3N3FA 1H6UA 3IHPA 4KLNA 3J7AS 1Z5AA 3AOEC 4I81A 4OVZB 4DR4M 1EFUB 1NNJA 4NY2A 2QENA 4Z2LA 4FWDA 1FJGM 3J27B 4IBJA 4JI0M 1NY5A 1SXJA 4L78A 2RTSA 4R7GA 5ITYA 2LVAA 3HU2A 3U5ZB 1G4AE 2JZ1A 5GKNA 4JI1M 4HL4A 5ITXA 3FTCA 4LJ6A 1L1TA 2Z4SA 1K82A 1GJSA 2GQFA 1DO2A 1IY1A 2A5YB 1L1ZA 2FFJA 1DGHA 1VG5A 3AFHA 4XGIA 1QUSA 1R5LA 3RE8A 5FSWA 4DV3M 4IJFA 3U6OA 1W1TA 3KW6A 3JR5A 1MN3A 4L8RC 2FE8A 5ITQA 3T1HM 2X49A 1HQCA 1IN4A 1MX0A 4DV2M 3HSHA 4PDIA 3B9PA 2K47A 1SXJD 4L4UA 3GPXA 2XD1A 1OKSA 4DR3M 1D2NA 2QNJA 4MB3A 4A3VB 3C58A 3AKZA 4JV5M 3I01M 2MROB 3H4MA 2J7NA 1KS0A 5KQ8A 1WIVA 4YY3M 1QAMA 3E4RA 1ZMWA 3VK8A 4XK8F 4Z2GA 1XWIA 2UXCM 5JI3E 2EJSA 2WSEF 4G6ZA 1F4IA 2LVNC 4IBGA 4DV4M
chains in the Genus database with same CATH topology
3GLIA 2V1UA 4B3MM 3SYKA 3JAMS 1YU3A 3LVWA 4GMQA 1G8PA 4GH9A 5DYIA 3KP0E 1TH2A 2QBYB 5EP1A 3ZCBB 3KDSE 3HHYA 1QAOA 2JA2A 1W5SA 4LJ9A 4II7A 3KXEC 1GLNA 1NNUC 5E26A 1YSYA 2R62A 2C9OA 3L26A 2KRKA 3PFIA 2CUZA 2Y2KA 1QAQA 3FTDA 3U6DA 4I8OA 1LV7A 4CISA 2Y2HA 2G8LA 2Z3XA 2XSZA 3BOSA 1PM5A 1N77A 5BR8M 2F5QA 4NOOB 2EUCA 2Y2NA 5KPTA 4L16A 3VDUA 2F5NA 1YU4A 4LZZA 5EXSA 3SASA 3KSJA 2XFSA 3HWSA 5LMNM 4IBKA 2XLJA 2XZFA 4NRVA 2Y2GA 1TDZA 1IM2A 2Y2IA 2LWXA 4LF5M 2KZUA 1NVMA 3VKHA 5KO3A 3L25A 2C99A 1FNNA 1G3IA 3VDPA 3T15A 2F5OA 1G41A 4FWGA 4NRWA 1HR0M 2JCHA 2O5RA 4MB7A 1N34M 5KQDA 2XSZD 2L6OA 4B7HA 2HKJA 2L7IA 4FCVA 1TH4A 2X4AA 1IN7A 1E9SA 1KYIA 1N78A 3THGA 4LF6M 1SXJB 3FD9A 3U6EA 3LQQA 4LFBM 2L7HA 3KS4A 1IXZA 3FUVA 3UZUA 3WHKA 3U6PA 3TWLA 1KFVA 1IY0A 4BBAA 2L09A 1Q3BA 3VKGA 3I4YA 1Z5CA 3VLFB 2VIIA 3I4VA 2KXEA 4RF0A 4MGZE 1DGHB 3SMSA 3SHGB 2XGNA 2Y21A 2XEPA 5C1BA 1YUBA 1QANA 2H1RA 4IBEA 4OJOA 1WXQA 2Y2QA 1DGGA 1Q3CA 1XMOM 3LMMA 2KZSA 3WHLA 4LGMA 1GL6A 4DR5M 1YU2A 2C98A 2OQ4A 2V6ZM 2CV0A 2CHVA 4XBOA 3GP1A 4AG6A 4GHAA 4JYAM 2C5RA 5EQTA 4IJEA 4DV1M 1IN6A 3SYLA 2UWXA 4GIPA 3CF2A 2Y2LA 2KRUA 4OJ5A 4OUIA 3RGSA 4OU7A 2C96A 3GQ3A 4GHLA 4LF9M 3DZDA 3W0FA 2XH9A 1Q39A 4WURA 1E9RA 3KVWA 1HNZM 4KHPM 1L2CA 2D7HA 4QOZC 4LY6A 2F5PA 3U6MA 2VQFM 2CFOA 3GLGA 4CHTB 2R4EA 4FCWA 4GKKM 2XF3A 3LQRA 2DWNA 2Y2JA 1TGUA 3K2LA 4OJPA 5FTMA 2R65A 2HCBA 4QOSA 1R2ZA 3AJIB 3U6CA 5BPVA 3J2PB 2DZOB 1XMQM 2UUAM 4X66M 5EP3A 5DNYA 3GLHB 3PXGA 2QPAA 4G4RA 3ZC7B 4G4NA 3Q8XA 3T1YM 4Z8XA 4LJ8A 4G4OA 4M9XA 4D81A 3L29A 1XC8A 3AL0C 4JI6M 1XHBA 3U6SA 3T38A 3TPZA 5EXXA 4NYYA 4BB9A 1E32A 3AV0A 4LRTA 4JI5M 4DR1M 1PJJA 3U61A 1IXSB 1E94E 2D7EA 2BG1A 2CE7A 3QAUA 2QZ4A 4QHTA 4D80A 4AI6A 2DXIA 2Z4RA 4REZA 3U60B 1G59A 2F4VM 3KS8A 4RNAA 3IG8A 1R7RA 1R6BX 2D7GA 3MHVC 3GPYA 4AW4A 3FUXA 2KEBA 1XNQM 1Z5BA 4LJ4A 2ERCA 3SATA 2YFQA 1K3WA 2ZAOA 4OW0A 4DV5M 1JQJC 4NYUA 1QQWA 4S12A 3ILKA 4FWHA 3EIHA 3FTFA 2EA0A 4X64M 2R18A 3DOAA 4NXMM 4PDGA 1J09A 3L2AA 3WX7A 5DYGA 4GKJM 4LFCM 3HJQA 1L8QA 1VDDA 3SMPA 4LJAA 4PD2A 3GPUA 4NZ5A 1K3XA 4AKIA 2RGHA 2ZANA 3HJSA 3QWLA 5IWAM 3GO8A 3RFWA 2W82A 4B3RM 3K92A 1NJGA 2UU9M 2EO2A 1EE8A 3R8FA 2V1CA 1JR3D 3HKPA 3GQ4A 5FTLA 2DWZB 3HHZA 2M5ZA 5FTJA 2P5TA 4M0WA 3I51A 1PJIA 4NXNM 2G5GX 5KPZA 4DUZM 4MH0E 2E5LM 3L28A 4QNRA 2RGOA 1QVRA 4LGYA 5C18A 2LH0A 2KA6B 2C9CA 1OJLA 3FUUA 2DWLA 1XXHA 3SFZA 1NHWC 2CV2A 2ZM6M 2I7NA 4B3TM 1NY6A 3GLGB 4JI7M 2UXDM 4IBDA 5IZ7D 4X62M 4I4LA 2JE5A 1HQYE 1N32M 2CHQA 2M60A 4M9ZA 2J7OA 2QP9X 3EIEA 4OJ6A 3D8LA 3TL4X 3GRVA 4K0KM 4G4QA 4FCTA 3A98B 3KOWE 4M0DA 4LZJA 3PNYA 4DR2M 3KOZE 4AQYM 1TH3A 4DR6M 3AOGA 1C1KA 1GKIA 4L15A 3VFDA 1YU1A 3GLFA 2UUBM 4LJ7A 4PT5A 2LXEA 4GITA 2BNKA 1I94M 1OFHA 3KP1E 3GRUA 2FNAA 1YE9A 3D8BA 3KOXE 1ZAEA 3UGJA 3AOEA 5ITUA 3J7BA 3GLIB 2X8AA 1S3SA 2ZBKB 4LFAM 3U61B 3W0LB 2DVWB 2YNMD 5E6JA 3VK7A 3DA1A 3DFZA 2YR0A 3KSXA 3SHFA 2Y2MA 3M7GA 1IBMM 1SXJC 3TWMA 4JXJA 1J5EM 1QYRA 4B7FA 1HT1E 2YQZA 3M6AA 1NSFA 3K1JA 1UM8A 2XZUA 4IBFA 4MGIE 5EP4A 3FUWA 3A42A 3SAWA 1W5TA 5FTKA 5KPRA 1IXRC 4FD2A 3SC3A 3TQSA 4I5SA 4ZPXA 3MJ5A 4OJLA 4LF8M 4IBCA 4AKGA 3TE6A 5ITTA 4D82A 4JI8M 1NJFA 1IN5A 1SXJE 7CATA 4NL4H 1HNWM 4LF4M 3HONA 4DV6M 3U6LA 3RGPA 1I4WA 5EJCA 1HNXM 5ITXE 3SAUA 2HHHM 2VQEM 3HU1A 1GVNA 2Q2EB 3PNVA 4LCBA 5LMUM 4DV0M 4DV7M 4EIWA 4JI4M 2CHGA 1IY2A 3NBIA 4Z6YA 4FVMA 1HT2E 1L2DA 4TUWA 3FYCA 2FOIC 1XNRM 8CATA 1T3TA 3MK6A 2Y0QA 4GRIA 4OVZA 5EXTA 3LVVA 2RKOA 4NSOB 5EP2A 2NQ8C 3GRYA 4M9SA 4MM3B 5F3WA 3HHWA 4QHSA 3HHXA 3ZH9B 3HU3A 4OX9M 3M0EA 3U5ZA 4AKHA 5JI2E 3SBJA 1IQPA 1DO0A 4ITQA 1GL7A 1JR3A 2LNHC 1XXHB 4MGHA 1ZQ9A 3FTEA 2FFFB 2Y20A 3PVSA 1QZMA 3A45A 2IOUA 3GRRA 2Y2OA 4B3SM 4HLQA 2R4JA 3SAVA 1OFIA 5FLXS 4PCZA 3J81S 4B7GA 4RF1A 4CGYB 1N36M 3J80S 3U6QA 3E9SA 3UMMA 4GC5A 2DZNB 3HJ8A 2Z7JA 2QCUA 4QNLA 3TWKA 4IBIA 3FKEA 1IN8A 3A46A 2F5SA 4X65M 3GLHA 3GLFB 4P16A 4MGYE 3FUTA 4NZ3A 4GC9A 2BJWA 3SARA 1DGFA 4B08A 1TDHA 1L2BA 3IG5A 4KODA 4LG2A 1N75A 4R3DA 2XD5A 4DR7M 4WW0A 5EXPA 4NZ4A 2AHMA 2DHRA 1YU0A 2R45A 2UXBM 3FYDA 4QNMA 3R9XB 2I7PA 3K8ZA 3CTWB 3L27A 1YUEA 4AZFA 2UUCM 1X37A 4AG5A 4KO8A 5ITRA 4DUYM 3U60A 1IBKM 2QBYA 1DGBA 3N3FA 4JI2M 2KW0A 4IIWA 1KSFX 5A2QS 1MU5A 3CF0A 5FTNA 2HL7A 4LRSA 3KFUG 3NWLA 5H37D 1Z59A 4NZ1A 3KOYE 4BLCA 3UK6A 4MGKE 5IREB 1IBLM 2XFTA 4LJ5A 4JI3M 3GQ5A 4FW9A 2CEAA 1Z6TA 1ORYB 2CV1A 3CF6E 2R46A 4YHHM 4LF7M 1J7KA 1R2YA 1N33M 2BJVA 5IT9S 4IBBA 2Y0TA 3OTOM 3JR4A 3UJNA 2DWMA 4JN6A 4W5WA 1NHGC 3GPPA 4NSRA 2ZAMA 3HGIA 2OPFA 1H6UA 4KLNA 3J7AS 1Z5AA 3AOEC 4I81A 4OVZB 4DR4M 4NY2A 1NNJA 2QENA 4FWDA 1FJGM 3J27B 4IBJA 4JI0M 1NY5A 1SXJA 4L78A 4R7GA 5ITYA 3HU2A 3U5ZB 1G4AE 5GKNA 4JI1M 4HL4A 5ITXA 3FTCA 4LJ6A 1L1TA 2Z4SA 1K82A 1DO2A 1IY1A 2A5YB 1L1ZA 2FFJA 1DGHA 3AFHA 4XGIA 3RE8A 5FSWA 4DV3M 4IJFA 3U6OA 3KW6A 3JR5A 4L8RC 2FE8A 5ITQA 3T1HM 2X49A 1HQCA 1IN4A 1MX0A 4DV2M 3HSHA 4PDIA 3B9PA 2K47A 1SXJD 4L4UA 3GPXA 2XD1A 4DR3M 1D2NA 4A3VB 3C58A 3AKZA 4JV5M 3H4MA 2J7NA 5KQ8A 4YY3M 1QAMA 3E4RA 3VK8A 1XWIA 2UXCM 5JI3E 4G6ZA 2Y2PA 4IBGA 4DV4M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IJF A;  3L28 A;  4GHA A;  4LG2 A;  4IJE A;  3KS4 A;  4GH9 A;  4IBK A;  4IBF A;  3L2A A;  4IBJ A;  5BPV A;  4GHL A;  3L25 A;  3KS8 A;  4IBD A;  4IBC A;  3L26 A;  4IBE A;  3L27 A;  4IBB A;  3L29 A;  3FKE A;  4IBI A;  4IBG A; 
#chains in the Genus database with same CATH topology
 3GLI A;  2V1U A;  4B3M M;  3SYK A;  1H0I A;  1A5T A;  1QO6 A;  1DV0 A;  3JAM S;  1YU3 A;  1JB0 F;  3LVW A;  1E6P A;  1XB2 B;  4GMQ A;  1G8P A;  4GH9 A;  5DYI A;  3KP0 E;  1TH2 A;  2LHG A;  2QBY B;  5EP1 A;  3ZCB B;  3KDS E;  3HHY A;  1QAO A;  1BVS A;  2JA2 A;  1W5S A;  2LVQ D;  4LJ9 A;  4II7 A;  1OAI A;  3KXE C;  4HEO A;  1WR1 B;  1GLN A;  1NNU C;  5E26 A;  1YSY A;  2R62 A;  2JY6 B;  1D0K A;  1G71 A;  2C9O A;  4DBG B;  2KRK A;  3PFI A;  3L26 A;  2CUZ A;  4R71 A;  2Y2K A;  1QAQ A;  3F92 A;  3FTD A;  4I8O A;  3U6D A;  1UR9 A;  1LV7 A;  1E8B A;  4CIS A;  2Y2H A;  4GEW A;  2G8L A;  2Z3X A;  2VF8 A;  2XSZ A;  3BOS A;  1PM5 A;  1V92 A;  1N77 A;  2CWB A;  1GPF A;  5BR8 M;  2F5Q A;  4NOO B;  2EUC A;  2Y2N A;  5KPT A;  4L16 A;  3VDU A;  2F5N A;  1YU4 A;  1ED7 A;  4LZZ A;  5EXS A;  3SAS A;  3KSJ A;  2XFS A;  2HAK A;  3HWS A;  5LMN M;  4IBK A;  2XLJ A;  2XZF A;  4NRV A;  2Y2G A;  1TDZ A;  1IM2 A;  2Y2I A;  1OAO C;  1R4G A;  2LWX A;  1JR3 E;  1T43 A;  1NVM A;  2KZU A;  5KO3 A;  4LF5 M;  2C99 A;  3L25 A;  3VKH A;  1FNN A;  1G3I A;  3VDP A;  3T15 A;  2F5O A;  1E6R A;  1G41 A;  2VF7 A;  4FWG A;  4NRW A;  1EIJ A;  1HR0 M;  2JCH A;  2O5R A;  4MB7 A;  1N34 M;  1Y8G A;  3WD2 A;  3FRH A;  5KQD A;  2XSZ D;  2L6O A;  4B7H A;  2HKJ A;  1PGY A;  2L7I A;  4FCV A;  1TH4 A;  2DKL A;  2X4A A;  1IN7 A;  2LVP C;  1E9S A;  1KYI A;  1N78 A;  3THG A;  4LF6 M;  1SXJ B;  3FD9 A;  3U6E A;  3LQQ A;  4LFB M;  2Y2P A;  1P3Q Q;  3V76 A;  2L7H A;  3KS4 A;  4CJ6 A;  1C7Y A;  4F2L A;  1IXZ A;  1VQ1 A;  2DAK A;  2DZL A;  2JP7 A;  3FUV A;  3UZU A;  3WHK A;  3U6P A;  3TWL A;  1KFV A;  1IY0 A;  4BBA A;  2L09 A;  1Q3B A;  3B7Q A;  2JZ0 A;  3QYE A;  3VKG A;  3I4Y A;  1Z5C A;  2J5Y A;  3VLF B;  2VII A;  3I4V A;  2KXE A;  1W1P A;  4RF0 A;  1OIP A;  1DGH B;  1UFZ A;  4MGZ E;  3SMS A;  3SHG B;  2XGN A;  2Y21 A;  4MB4 A;  2XEP A;  5C1B A;  1YUB A;  1QAN A;  2H1R A;  4IBE A;  4OJO A;  1WXQ A;  2Y2Q A;  1DGG A;  1Q3C A;  2R6F A;  1XMO M;  3LMM A;  2KZS A;  3WHL A;  4LGM A;  4HME A;  1GL6 A;  4DR5 M;  1YU2 A;  2C98 A;  2OQ4 A;  2V6Z M;  2CV0 A;  2CHV A;  1OQY A;  4XBO A;  4HMC A;  3GP1 A;  4AG6 A;  2KHH A;  4GHA A;  4JYA M;  2C5R A;  5EQT A;  2DNA A;  4IJE A;  4DV1 M;  1IN6 A;  3SYL A;  2UWX A;  4GIP A;  3CF2 A;  2Y2L A;  2KRU A;  4OJ5 A;  4OUI A;  3RGS A;  4OU7 A;  2C96 A;  3GQ3 A;  4GHL A;  3Q8G A;  4LF9 M;  2LTU A;  3DZD A;  2FS1 A;  2XH9 A;  2FH0 A;  3W0F A;  1NO1 A;  1E15 A;  1WGN A;  1Q39 A;  4WUR A;  1E9R A;  3KVW A;  1HNZ M;  4KHP M;  2Z8Y M;  1L2C A;  2D7H A;  1QUT A;  4QOZ C;  3GLF E;  2APL A;  3MQL A;  4LY6 A;  2F5P A;  1VDL A;  2R44 A;  3U6M A;  2VQF M;  2CFO A;  3GLG A;  4CHT B;  2R4E A;  1LTM A;  4FCW A;  4GKK M;  1YLA A;  2XF3 A;  3LQR A;  2DWN A;  2Y2J A;  3W67 A;  4KT0 F;  1TGU A;  3K2L A;  4OJP A;  5FTM A;  1W1Y A;  2R65 A;  4Z2H A;  2HCB A;  2GNO A;  4QOS A;  1R2Z A;  3AJI B;  3U6C A;  5BPV A;  3J2P B;  1PRB A;  2DZO B;  1XMQ M;  1GAB A;  2UUA M;  4X66 M;  5EP3 A;  5DNY A;  3GLH B;  3PXG A;  3C3D A;  2QPA A;  1VEK A;  4G4R A;  3ZC7 B;  4G4N A;  1GOI A;  3Q8X A;  3T1Y M;  2D49 A;  4Z8X A;  4LJ8 A;  2EKK A;  3CGW A;  4M9X A;  4D81 A;  3L29 A;  4G4O A;  1XC8 A;  4JI6 M;  1XHB A;  3AL0 C;  1PJS A;  3U6S A;  3T38 A;  3TPZ A;  5EXX A;  4NYY A;  4BB9 A;  1E32 A;  1OGB A;  3AV0 A;  4LRT A;  4JI5 M;  3MMP A;  4DR1 M;  2QHO B;  1PJJ A;  3U61 A;  3NBX X;  1IXS B;  1E94 E;  2D7E A;  1AIP C;  2CE7 A;  2BG1 A;  3QAU A;  2QZ4 A;  4QHT A;  4D80 A;  1GO5 A;  4AI6 A;  2DXI A;  2Z4R A;  4REZ A;  2KNV A;  3U60 B;  1G59 A;  4TX8 A;  2F4V M;  3KS8 A;  4RNA A;  3IG8 A;  1R7R A;  1R6B X;  2OOB A;  2L2D A;  1OGG A;  4Q7J A;  2D7G A;  3I04 M;  3MHV C;  1H0G A;  3M7P A;  3GPY A;  4AW4 A;  3FUX A;  2KEB A;  1XNQ M;  1Z5B A;  3LW5 F;  4LJ4 A;  2ERC A;  3K9O A;  3SAT A;  2YFQ A;  1K3W A;  2ZAO A;  4OW0 A;  4DV5 M;  1JQJ C;  4NYU A;  1QDT A;  1QQW A;  4S12 A;  3ILK A;  3LCU A;  2VDB B;  3EIH A;  4FWH A;  2EA0 A;  3FTF A;  2KNA A;  4X64 M;  1CXW A;  2R18 A;  3DOA A;  4Z2J A;  2DAG A;  2L4F A;  4NXM M;  4PDG A;  1J09 A;  3WD0 A;  3L2A A;  3WX7 A;  5DYG A;  4Z2I A;  4GKJ M;  4LFC M;  3HJQ A;  1L8Q A;  1VDD A;  3SMP A;  2DAM A;  1NV9 A;  4LJA A;  4PD2 A;  3GPU A;  4NZ5 A;  1K3X A;  4AKI A;  2RGH A;  2ZAN A;  3HJS A;  3QWL A;  5IWA M;  3GO8 A;  3RFW A;  2W82 A;  4B3R M;  3E46 A;  1SG9 A;  1NJG A;  1WJ7 A;  3K92 A;  2UU9 M;  2EO2 A;  1EE8 A;  2FN2 A;  3R8F A;  2V1C A;  1JR3 D;  3HKP A;  3GQ4 A;  5FTL A;  2DWZ B;  3HHZ A;  2N35 A;  2M5Z A;  5FTJ A;  2P5T A;  4M0W A;  3HY5 A;  3I51 A;  1PJI A;  4NXN M;  2G5G X;  2WSC F;  2ZTC A;  3LCV B;  5KPZ A;  4DUZ M;  4MH0 E;  2E5L M;  3L28 A;  4QNR A;  2RGO A;  1QVR A;  4LGY A;  5C18 A;  1D0M A;  2LH0 A;  2KA6 B;  1WGL A;  2C9C A;  1OJL A;  3FUU A;  2DWL A;  3GLH E;  1XXH A;  3SFZ A;  1NHW C;  2MJ5 B;  2CV2 A;  2ZM6 M;  2I7N A;  4B3T M;  1NY6 A;  1EAK A;  1AUA A;  1T6O A;  3GLG B;  4JI7 M;  2UXD M;  1OTR A;  4IBD A;  1E6N A;  5IZ7 D;  4X62 M;  4I4L A;  2JE5 A;  1HQY E;  1N32 M;  2CHQ A;  3WD4 A;  2G3Q A;  2M60 A;  4G3O A;  4M9Z A;  2JWS A;  2J7O A;  2QP9 X;  3EIE A;  4OJ6 A;  3D8L A;  3TL4 X;  3GRV A;  2RRU A;  4K0K M;  4G4Q A;  4FCT A;  1CUK A;  3A98 B;  2WZJ A;  3KOW E;  4M0D A;  4LZJ A;  3PNY A;  4DR2 M;  1TR8 A;  3KOZ E;  1TH3 A;  4AQY M;  1CK7 A;  1V33 A;  2O01 F;  4DR6 M;  2L4E A;  3AOG A;  1C1K A;  1IFY A;  1GKI A;  4L15 A;  3VFD A;  1YU1 A;  3GLF A;  2UUB M;  4LJ7 A;  1J7M A;  2JY8 A;  4PT5 A;  2LXE A;  4GIT A;  2BNK A;  1I94 M;  2H5X A;  4L6V 6;  3HZJ A;  3WD3 A;  1OFH A;  3KP1 E;  3GRU A;  2FNA A;  4HMD A;  1YE9 A;  3D8B A;  1L6J A;  1ZAE A;  3KOX E;  3UGJ A;  3AOE A;  5ITU A;  3J7B A;  2MGW A;  3GLI B;  1TF0 B;  2X8A A;  1S3S A;  2ZBK B;  4LFA M;  3U61 B;  3W0L B;  2DVW B;  2YNM D;  5E6J A;  2DAI A;  3VK7 A;  3DA1 A;  3DFZ A;  3T6P A;  2LVO C;  2YR0 A;  3KSX A;  3SHF A;  2Y2M A;  2CRU A;  3M7G A;  4P17 A;  2K0B X;  1IBM M;  1SXJ C;  3HX3 A;  3FRI A;  3TWM A;  4JXJ A;  2LHC A;  1QYR A;  1J5E M;  2KNZ A;  1HT1 E;  2YQZ A;  4B7F A;  3M6A A;  1NSF A;  3K1J A;  2JNH A;  1UM8 A;  2B3T A;  2XZU A;  4IBF A;  4MGI E;  5EP4 A;  3FUW A;  3A42 A;  2BWE A;  3SAW A;  1W5T A;  4RKU F;  4Y28 F;  2OO9 A;  1IXR C;  3E21 A;  4FD2 A;  5FTK A;  3SC3 A;  5KPR A;  1H8P A;  3TQS A;  4I5S A;  4ZPX A;  1GXD A;  3MJ5 A;  4OJL A;  2JUJ A;  3IEC A;  4IBC A;  4F1I A;  1PJQ A;  4LF8 M;  4AKG A;  4NC6 A;  3TE6 A;  5ITT A;  1VEG A;  4D82 A;  4JI8 M;  1NJF A;  1IN5 A;  1SXJ E;  7CAT A;  4NL4 H;  1HNW M;  4LF4 M;  1W1V A;  3HON A;  4DV6 M;  3U6L A;  3RGP A;  1I4W A;  5EJC A;  4MB5 A;  1HNX M;  5ITX E;  3SAU A;  2HHH M;  2DI0 A;  2VQE M;  3HU1 A;  1GVN A;  2Q2E B;  3PNV A;  4LCB A;  5LMU M;  4DV0 M;  3GLG E;  4EIW A;  4DV7 M;  2CHG A;  1IY2 A;  3BBZ A;  1VEJ A;  3NBI A;  4JI4 M;  4Z6Y A;  4FVM A;  1HT2 E;  1L2D A;  1D0L A;  2OOA A;  3FYC A;  4TUW A;  2FOI C;  1XNR M;  2HWJ A;  8CAT A;  1T3T A;  2K9D A;  3MK6 A;  4WP2 A;  1HJP A;  2Y0Q A;  4GRI A;  1ZMU A;  4OVZ A;  5EXT A;  2K6B A;  3LVV A;  2RKO A;  4NSO B;  5EP2 A;  2EKF A;  1MJG M;  2NQ8 C;  3GRY A;  4M9S A;  4MM3 B;  5F3W A;  3HHW A;  2JY5 A;  4QHS A;  3HHX A;  3ZH9 B;  3HU3 A;  4OX9 M;  3M0E A;  3U5Z A;  4AKH A;  5JI2 E;  3SBJ A;  1IQP A;  1DO0 A;  4ITQ A;  1WHC A;  4ANR A;  1GL7 A;  2MR9 A;  1JR3 A;  2LNH C;  1XXH B;  4MGH A;  1ZQ9 A;  3FTE A;  2FFF B;  3C3E A;  2Y20 A;  3PVS A;  1QZM A;  3A45 A;  3FE3 A;  2IOU A;  3GRR A;  2Y2O A;  4B3S M;  4HLQ A;  2R4J A;  5L8R F;  3H4J A;  1OFI A;  5FLX S;  4PCZ A;  3J81 S;  3SAV A;  2V5O A;  4B7G A;  4RF1 A;  4CGY B;  3GLI E;  1N36 M;  1O6I A;  1GJT A;  3J80 S;  3U6Q A;  1OIZ A;  3B7Z A;  3E9S A;  2CP8 A;  3UMM A;  4GC5 A;  2DZN B;  3HJ8 A;  1UR8 A;  2Z7J A;  2JXN A;  2QCU A;  4QNL A;  3TWK A;  4IBI A;  3FKE A;  1YUE A;  1IN8 A;  2KDL A;  3B7N A;  3A46 A;  2MH8 A;  2F5S A;  4X65 M;  3GLH A;  3GLF B;  4P16 A;  1ZV1 A;  2QQ8 A;  3B89 A;  3FUT A;  4MGY E;  4NZ3 A;  4GC9 A;  2BJW A;  3SAR A;  1V34 A;  1DGF A;  4B08 A;  1TDH A;  1L2B A;  3IG5 A;  4KOD A;  4LG2 A;  1PDC A;  1N75 A;  4R3D A;  3BXW A;  2XD5 A;  1QZE A;  2O25 A;  3C9P A;  4DR7 M;  1IXS A;  1QDR A;  3W68 A;  1E88 A;  3B74 A;  4WW0 A;  1NV8 A;  5EXP A;  4NZ4 A;  2AHM A;  2DHR A;  5DFL A;  1Q02 A;  2DAE A;  2R45 A;  2UXB M;  3K9P A;  1YU0 A;  3FYD A;  3QYB A;  4QNM A;  3R9X B;  2I7P A;  1RU3 A;  3CTW B;  3K8Z A;  3L27 A;  4AZF A;  2UUC M;  1X37 A;  4AG5 A;  4KO8 A;  4UN2 B;  5ITR A;  4DUY M;  3U60 A;  1IBK M;  1DGB A;  2QBY A;  1E6Z A;  2JY7 A;  4JI2 M;  2KW0 A;  1AIW A;  4IIW A;  1KSF X;  5A2Q S;  1ZMV A;  1MU5 A;  3CF0 A;  5FTN A;  2HL7 A;  4LRS A;  4Z2K A;  3KFU G;  2DHY A;  3NWL A;  2QSF X;  5H37 D;  1Z59 A;  4NZ1 A;  1PJT A;  3KOY E;  4BLC A;  3UK6 A;  4CIZ A;  3ZQJ A;  4MGK E;  5IRE B;  1IBL M;  2XFT A;  4LJ5 A;  4JI3 M;  3GQ5 A;  2BWB A;  4FW9 A;  2CEA A;  1TTE A;  1Z6T A;  1ORY B;  2LBC A;  2CV1 A;  3CF6 E;  2R46 A;  4YHH M;  4LF7 M;  2WSF F;  1J7K A;  1R2Y A;  1N33 M;  2R0I A;  2BJV A;  5IT9 S;  4IBB A;  2Y0T A;  3OTO M;  1XXH E;  3JR4 A;  3UJN A;  2DWM A;  4JN6 A;  2ZTD A;  4W5W A;  1NHG C;  3GPP A;  4NSR A;  2DEN A;  2ZAM A;  3HGI A;  2OPF A;  3WD1 A;  3N3F A;  1H6U A;  3IHP A;  4KLN A;  3J7A S;  1Z5A A;  3AOE C;  4I81 A;  4OVZ B;  4DR4 M;  1EFU B;  1NNJ A;  4NY2 A;  2QEN A;  4Z2L A;  4FWD A;  1FJG M;  3J27 B;  4IBJ A;  4JI0 M;  1NY5 A;  1SXJ A;  4L78 A;  2RTS A;  4R7G A;  5ITY A;  2LVA A;  3HU2 A;  3U5Z B;  1G4A E;  2JZ1 A;  5GKN A;  4JI1 M;  4HL4 A;  5ITX A;  3FTC A;  4LJ6 A;  1L1T A;  2Z4S A;  1K82 A;  1GJS A;  2GQF A;  1DO2 A;  1IY1 A;  2A5Y B;  1L1Z A;  2FFJ A;  1DGH A;  1VG5 A;  3AFH A;  4XGI A;  1QUS A;  1R5L A;  3RE8 A;  5FSW A;  4DV3 M;  4IJF A;  3U6O A;  1W1T A;  3KW6 A;  3JR5 A;  1MN3 A;  4L8R C;  2FE8 A;  5ITQ A;  3T1H M;  2X49 A;  1HQC A;  1IN4 A;  1MX0 A;  4DV2 M;  3HSH A;  4PDI A;  3B9P A;  2K47 A;  1SXJ D;  4L4U A;  3GPX A;  2XD1 A;  1OKS A;  4DR3 M;  1D2N A;  2QNJ A;  4MB3 A;  4A3V B;  3C58 A;  3AKZ A;  4JV5 M;  3I01 M;  2MRO B;  3H4M A;  2J7N A;  1KS0 A;  5KQ8 A;  1WIV A;  4YY3 M;  1QAM A;  3E4R A;  1ZMW A;  3VK8 A;  4XK8 F;  4Z2G A;  1XWI A;  2UXC M;  5JI3 E;  2EJS A;  2WSE F;  4G6Z A;  1F4I A;  2LVN C;  4IBG A;  4DV4 M; 
#chains in the Genus database with same CATH homology
 3GLI A;  2V1U A;  4B3M M;  3SYK A;  3JAM S;  1YU3 A;  3LVW A;  4GMQ A;  1G8P A;  4GH9 A;  5DYI A;  3KP0 E;  1TH2 A;  2QBY B;  5EP1 A;  3ZCB B;  3KDS E;  3HHY A;  1QAO A;  2JA2 A;  1W5S A;  4LJ9 A;  4II7 A;  3KXE C;  1GLN A;  1NNU C;  5E26 A;  1YSY A;  2R62 A;  2C9O A;  3L26 A;  2KRK A;  3PFI A;  2CUZ A;  2Y2K A;  1QAQ A;  3FTD A;  3U6D A;  4I8O A;  1LV7 A;  4CIS A;  2Y2H A;  2G8L A;  2Z3X A;  2XSZ A;  3BOS A;  1PM5 A;  1N77 A;  5BR8 M;  2F5Q A;  4NOO B;  2EUC A;  2Y2N A;  5KPT A;  4L16 A;  3VDU A;  2F5N A;  1YU4 A;  4LZZ A;  5EXS A;  3SAS A;  3KSJ A;  2XFS A;  3HWS A;  5LMN M;  4IBK A;  2XLJ A;  2XZF A;  4NRV A;  2Y2G A;  1TDZ A;  1IM2 A;  2Y2I A;  2LWX A;  4LF5 M;  2KZU A;  1NVM A;  3VKH A;  5KO3 A;  3L25 A;  2C99 A;  1FNN A;  1G3I A;  3VDP A;  3T15 A;  2F5O A;  1G41 A;  4FWG A;  4NRW A;  1HR0 M;  2JCH A;  2O5R A;  4MB7 A;  1N34 M;  5KQD A;  2XSZ D;  2L6O A;  4B7H A;  2HKJ A;  2L7I A;  4FCV A;  1TH4 A;  2X4A A;  1IN7 A;  1E9S A;  1KYI A;  1N78 A;  3THG A;  4LF6 M;  1SXJ B;  3FD9 A;  3U6E A;  3LQQ A;  4LFB M;  2L7H A;  3KS4 A;  1IXZ A;  3FUV A;  3UZU A;  3WHK A;  3U6P A;  3TWL A;  1KFV A;  1IY0 A;  4BBA A;  2L09 A;  1Q3B A;  3VKG A;  3I4Y A;  1Z5C A;  3VLF B;  2VII A;  3I4V A;  2KXE A;  4RF0 A;  4MGZ E;  1DGH B;  3SMS A;  3SHG B;  2XGN A;  2Y21 A;  2XEP A;  5C1B A;  1YUB A;  1QAN A;  2H1R A;  4IBE A;  4OJO A;  1WXQ A;  2Y2Q A;  1DGG A;  1Q3C A;  1XMO M;  3LMM A;  2KZS A;  3WHL A;  4LGM A;  1GL6 A;  4DR5 M;  1YU2 A;  2C98 A;  2OQ4 A;  2V6Z M;  2CV0 A;  2CHV A;  4XBO A;  3GP1 A;  4AG6 A;  4GHA A;  4JYA M;  2C5R A;  5EQT A;  4IJE A;  4DV1 M;  1IN6 A;  3SYL A;  2UWX A;  4GIP A;  3CF2 A;  2Y2L A;  2KRU A;  4OJ5 A;  4OUI A;  3RGS A;  4OU7 A;  2C96 A;  3GQ3 A;  4GHL A;  4LF9 M;  3DZD A;  3W0F A;  2XH9 A;  1Q39 A;  4WUR A;  1E9R A;  3KVW A;  1HNZ M;  4KHP M;  1L2C A;  2D7H A;  4QOZ C;  4LY6 A;  2F5P A;  3U6M A;  2VQF M;  2CFO A;  3GLG A;  4CHT B;  2R4E A;  4FCW A;  4GKK M;  2XF3 A;  3LQR A;  2DWN A;  2Y2J A;  1TGU A;  3K2L A;  4OJP A;  5FTM A;  2R65 A;  2HCB A;  4QOS A;  1R2Z A;  3AJI B;  3U6C A;  5BPV A;  3J2P B;  2DZO B;  1XMQ M;  2UUA M;  4X66 M;  5EP3 A;  5DNY A;  3GLH B;  3PXG A;  2QPA A;  4G4R A;  3ZC7 B;  4G4N A;  3Q8X A;  3T1Y M;  4Z8X A;  4LJ8 A;  4G4O A;  4M9X A;  4D81 A;  3L29 A;  1XC8 A;  3AL0 C;  4JI6 M;  1XHB A;  3U6S A;  3T38 A;  3TPZ A;  5EXX A;  4NYY A;  4BB9 A;  1E32 A;  3AV0 A;  4LRT A;  4JI5 M;  4DR1 M;  1PJJ A;  3U61 A;  1IXS B;  1E94 E;  2D7E A;  2BG1 A;  2CE7 A;  3QAU A;  2QZ4 A;  4QHT A;  4D80 A;  4AI6 A;  2DXI A;  2Z4R A;  4REZ A;  3U60 B;  1G59 A;  2F4V M;  3KS8 A;  4RNA A;  3IG8 A;  1R7R A;  1R6B X;  2D7G A;  3MHV C;  3GPY A;  4AW4 A;  3FUX A;  2KEB A;  1XNQ M;  1Z5B A;  4LJ4 A;  2ERC A;  3SAT A;  2YFQ A;  1K3W A;  2ZAO A;  4OW0 A;  4DV5 M;  1JQJ C;  4NYU A;  1QQW A;  4S12 A;  3ILK A;  4FWH A;  3EIH A;  3FTF A;  2EA0 A;  4X64 M;  2R18 A;  3DOA A;  4NXM M;  4PDG A;  1J09 A;  3L2A A;  3WX7 A;  5DYG A;  4GKJ M;  4LFC M;  3HJQ A;  1L8Q A;  1VDD A;  3SMP A;  4LJA A;  4PD2 A;  3GPU A;  4NZ5 A;  1K3X A;  4AKI A;  2RGH A;  2ZAN A;  3HJS A;  3QWL A;  5IWA M;  3GO8 A;  3RFW A;  2W82 A;  4B3R M;  3K92 A;  1NJG A;  2UU9 M;  2EO2 A;  1EE8 A;  3R8F A;  2V1C A;  1JR3 D;  3HKP A;  3GQ4 A;  5FTL A;  2DWZ B;  3HHZ A;  2M5Z A;  5FTJ A;  2P5T A;  4M0W A;  3I51 A;  1PJI A;  4NXN M;  2G5G X;  5KPZ A;  4DUZ M;  4MH0 E;  2E5L M;  3L28 A;  4QNR A;  2RGO A;  1QVR A;  4LGY A;  5C18 A;  2LH0 A;  2KA6 B;  2C9C A;  1OJL A;  3FUU A;  2DWL A;  1XXH A;  3SFZ A;  1NHW C;  2CV2 A;  2ZM6 M;  2I7N A;  4B3T M;  1NY6 A;  3GLG B;  4JI7 M;  2UXD M;  4IBD A;  5IZ7 D;  4X62 M;  4I4L A;  2JE5 A;  1HQY E;  1N32 M;  2CHQ A;  2M60 A;  4M9Z A;  2J7O A;  2QP9 X;  3EIE A;  4OJ6 A;  3D8L A;  3TL4 X;  3GRV A;  4K0K M;  4G4Q A;  4FCT A;  3A98 B;  3KOW E;  4M0D A;  4LZJ A;  3PNY A;  4DR2 M;  3KOZ E;  4AQY M;  1TH3 A;  4DR6 M;  3AOG A;  1C1K A;  1GKI A;  4L15 A;  3VFD A;  1YU1 A;  3GLF A;  2UUB M;  4LJ7 A;  4PT5 A;  2LXE A;  4GIT A;  2BNK A;  1I94 M;  1OFH A;  3KP1 E;  3GRU A;  2FNA A;  1YE9 A;  3D8B A;  3KOX E;  1ZAE A;  3UGJ A;  3AOE A;  5ITU A;  3J7B A;  3GLI B;  2X8A A;  1S3S A;  2ZBK B;  4LFA M;  3U61 B;  3W0L B;  2DVW B;  2YNM D;  5E6J A;  3VK7 A;  3DA1 A;  3DFZ A;  2YR0 A;  3KSX A;  3SHF A;  2Y2M A;  3M7G A;  1IBM M;  1SXJ C;  3TWM A;  4JXJ A;  1J5E M;  1QYR A;  4B7F A;  1HT1 E;  2YQZ A;  3M6A A;  1NSF A;  3K1J A;  1UM8 A;  2XZU A;  4IBF A;  4MGI E;  5EP4 A;  3FUW A;  3A42 A;  3SAW A;  1W5T A;  5FTK A;  5KPR A;  1IXR C;  4FD2 A;  3SC3 A;  3TQS A;  4I5S A;  4ZPX A;  3MJ5 A;  4OJL A;  4LF8 M;  4IBC A;  4AKG A;  3TE6 A;  5ITT A;  4D82 A;  4JI8 M;  1NJF A;  1IN5 A;  1SXJ E;  7CAT A;  4NL4 H;  1HNW M;  4LF4 M;  3HON A;  4DV6 M;  3U6L A;  3RGP A;  1I4W A;  5EJC A;  1HNX M;  5ITX E;  3SAU A;  2HHH M;  2VQE M;  3HU1 A;  1GVN A;  2Q2E B;  3PNV A;  4LCB A;  5LMU M;  4DV0 M;  4DV7 M;  4EIW A;  4JI4 M;  2CHG A;  1IY2 A;  3NBI A;  4Z6Y A;  4FVM A;  1HT2 E;  1L2D A;  4TUW A;  3FYC A;  2FOI C;  1XNR M;  8CAT A;  1T3T A;  3MK6 A;  2Y0Q A;  4GRI A;  4OVZ A;  5EXT A;  3LVV A;  2RKO A;  4NSO B;  5EP2 A;  2NQ8 C;  3GRY A;  4M9S A;  4MM3 B;  5F3W A;  3HHW A;  4QHS A;  3HHX A;  3ZH9 B;  3HU3 A;  4OX9 M;  3M0E A;  3U5Z A;  4AKH A;  5JI2 E;  3SBJ A;  1IQP A;  1DO0 A;  4ITQ A;  1GL7 A;  1JR3 A;  2LNH C;  1XXH B;  4MGH A;  1ZQ9 A;  3FTE A;  2FFF B;  2Y20 A;  3PVS A;  1QZM A;  3A45 A;  2IOU A;  3GRR A;  2Y2O A;  4B3S M;  4HLQ A;  2R4J A;  3SAV A;  1OFI A;  5FLX S;  4PCZ A;  3J81 S;  4B7G A;  4RF1 A;  4CGY B;  1N36 M;  3J80 S;  3U6Q A;  3E9S A;  3UMM A;  4GC5 A;  2DZN B;  3HJ8 A;  2Z7J A;  2QCU A;  4QNL A;  3TWK A;  4IBI A;  3FKE A;  1IN8 A;  3A46 A;  2F5S A;  4X65 M;  3GLH A;  3GLF B;  4P16 A;  4MGY E;  3FUT A;  4NZ3 A;  4GC9 A;  2BJW A;  3SAR A;  1DGF A;  4B08 A;  1TDH A;  1L2B A;  3IG5 A;  4KOD A;  4LG2 A;  1N75 A;  4R3D A;  2XD5 A;  4DR7 M;  4WW0 A;  5EXP A;  4NZ4 A;  2AHM A;  2DHR A;  1YU0 A;  2R45 A;  2UXB M;  3FYD A;  4QNM A;  3R9X B;  2I7P A;  3K8Z A;  3CTW B;  3L27 A;  1YUE A;  4AZF A;  2UUC M;  1X37 A;  4AG5 A;  4KO8 A;  5ITR A;  4DUY M;  3U60 A;  1IBK M;  2QBY A;  1DGB A;  3N3F A;  4JI2 M;  2KW0 A;  4IIW A;  1KSF X;  5A2Q S;  1MU5 A;  3CF0 A;  5FTN A;  2HL7 A;  4LRS A;  3KFU G;  3NWL A;  5H37 D;  1Z59 A;  4NZ1 A;  3KOY E;  4BLC A;  3UK6 A;  4MGK E;  5IRE B;  1IBL M;  2XFT A;  4LJ5 A;  4JI3 M;  3GQ5 A;  4FW9 A;  2CEA A;  1Z6T A;  1ORY B;  2CV1 A;  3CF6 E;  2R46 A;  4YHH M;  4LF7 M;  1J7K A;  1R2Y A;  1N33 M;  2BJV A;  5IT9 S;  4IBB A;  2Y0T A;  3OTO M;  3JR4 A;  3UJN A;  2DWM A;  4JN6 A;  4W5W A;  1NHG C;  3GPP A;  4NSR A;  2ZAM A;  3HGI A;  2OPF A;  1H6U A;  4KLN A;  3J7A S;  1Z5A A;  3AOE C;  4I81 A;  4OVZ B;  4DR4 M;  4NY2 A;  1NNJ A;  2QEN A;  4FWD A;  1FJG M;  3J27 B;  4IBJ A;  4JI0 M;  1NY5 A;  1SXJ A;  4L78 A;  4R7G A;  5ITY A;  3HU2 A;  3U5Z B;  1G4A E;  5GKN A;  4JI1 M;  4HL4 A;  5ITX A;  3FTC A;  4LJ6 A;  1L1T A;  2Z4S A;  1K82 A;  1DO2 A;  1IY1 A;  2A5Y B;  1L1Z A;  2FFJ A;  1DGH A;  3AFH A;  4XGI A;  3RE8 A;  5FSW A;  4DV3 M;  4IJF A;  3U6O A;  3KW6 A;  3JR5 A;  4L8R C;  2FE8 A;  5ITQ A;  3T1H M;  2X49 A;  1HQC A;  1IN4 A;  1MX0 A;  4DV2 M;  3HSH A;  4PDI A;  3B9P A;  2K47 A;  1SXJ D;  4L4U A;  3GPX A;  2XD1 A;  4DR3 M;  1D2N A;  4A3V B;  3C58 A;  3AKZ A;  4JV5 M;  3H4M A;  2J7N A;  5KQ8 A;  4YY3 M;  1QAM A;  3E4R A;  3VK8 A;  1XWI A;  2UXC M;  5JI3 E;  4G6Z A;  2Y2P A;  4IBG A;  4DV4 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...