3L29A

Crystal structure of zaire ebola vp35 interferon inhibitory domain k319a/r322a mutant
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
123
structure length
123
Chain Sequence
DISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPAIDAGWVCVFQLQDGKTLGLKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mutations abrogating VP35 interaction with double-stranded RNA render ebola virus avirulent in guinea pigs.
pubmed doi rcsb
source organism Zaire ebolavirus
molecule tags Rna binding protein
molecule keywords Polymerase cofactor VP35
total genus 43
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3l29A01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 3l29A02
4IBJA 3FKEA 4IBEA 4IJFA 4LG2A 4IBFA 4IBBA 3KS8A 4IBCA 3L29A 3L2AA 3L26A 4IBIA 4GHAA 4GHLA 3KS4A 3L25A 4IBKA 3L28A 3L27A 4IBGA 4IJEA 4IBDA 5BPVA 4GH9A
chains in the Genus database with same CATH superfamily
4REZA 2X49A 3SATA 4RF0A 4B3RM 3RGPA 2RGOA 4DR5M 4IBBA 3RGSA 2C96A 5ITYA 4D80A 1XHBA 2HL7A 2I7PA 1ZV1A 5IZ7D 1OKSA 3CTWB 3OTOM 1OGBA 3K9OA 2QPAA 2JY7A 2K9DA 2O5RA 1XB2B 1W1YA 4Z8XA 3SYLA 3PVSA 1ZMVA 3TL4X 1YUEA 2ZAOA 3IG8A 1YU0A 3T1HM 3K92A 1E6PA 1E94E 1IXRC 3NWLA 4QNRA 2DAEA 3HY5A 2MH8A 5EXPA 1QDTA 1NHGC 2Z4RA 3TWMA 2H5XA 1VEGA 2ZANA 1QUTA 1WHCA 3FUWA 3KXEC 4S12A 3R9XB 1V33A 2EKFA 2DAKA 3H4JA 1XXHB 4R7GA 3U6EA 2XF3A 5EQTA 5LMUM 1KS0A 1ZMUA 5F3WA 1N33M 4B7HA 4GMQA 3W67A 1VQ1A 2D7GA 1GL7A 1JQJC 3IG5A 4FW9A 3KFUG 5FTJA 4GKJM 3SFZA 3BOSA 3VK8A 4JI7M 1GJSA 8CATA 1NHWC 2DWLA 2RTSA 1OFIA 1TH3A 2V6ZM 3GPYA 1YSYA 2LHCA 5IT9S 2VF8A 4OJPA 4MM3B 1YE9A 4M0DA 4NYUA 2C9CA 4Y28F 2Y2QA 2QBYA 4LF8M 2Y2IA 3ZH9B 5KPZA 4LGMA 1OIZA 3E4RA 3SAVA 1F4IA 1L2CA 1G41A 5EP4A 2XLJA 2FFFB 3SAWA 3EIEA 2OQ4A 2DAGA 3D8LA 4X66M 4PCZA 1IN7A 4AG6A 4CJ6A 4IBFA 2LH0A 3ZCBB 4DBGB 4JN6A 2R18A 4L16A 4JI0M 1QDRA 2R65A 1J7KA 3J27B 3HHZA 3W0FA 4AQYM 1NY6A 2JCHA 4NSOB 3GQ5A 2J5YA 1P3QQ 4JXJA 3JAMS 2Y2OA 1YLAA 3WX7A 4M9SA 2X4AA 3WHKA 2Y2GA 1GPFA 1OAIA 4F1IA 4OJLA 1PRBA 3T15A 2EA0A 2HCBA 1QZMA 3I4YA 3KP1E 2C98A 2MR9A 2W82A 4JI5M 3VKHA 3E46A 3GRYA 3UJNA 3FTEA 2UXCM 3ILKA 4DV0M 1NJGA 3GLHB 3PXGA 2O01F 1OAOC 2DWNA 4QOZC 2FE8A 3VKGA 1PJTA 4JI2M 4HEOA 3SHGB 3QWLA 2R62A 1JR3E 4F2LA 2C5RA 1IN4A 3MMPA 1XMQM 1PDCA 2DZOB 1GKIA 3AOEA 2E5LM 3KS8A 3FYCA 3Q8GA 5LMNM 2JP7A 4L6V6 4CHTB 3GPPA 4G3OA 1J7MA 3FRIA 5H37D 3DOAA 1E6NA 3IHPA 1W5SA 3ZQJA 1IXZA 1TTEA 1QANA 2XSZD 4L8RC 1IXSA 2QQ8A 3GO8A 1Q02A 2N35A 2A5YB 4MGHA 1KYIA 3HZJA 3KP0E 3U6SA 1VG5A 3EIHA 3B9PA 3GRRA 2LVAA 1NY5A 3K9PA 2MROB 3FD9A 1JB0F 2QCUA 3FTCA 3LCUA 3NBXX 4LJ9A 4B7FA 3U6PA 1IBKM 5DYGA 1HNXM 3HU3A 4IBJA 2JZ0A 3FKEA 1X37A 1D2NA 4HMCA 4ZPXA 4HL4A 5ITQA 1NJFA 5KPRA 5DNYA 1AIWA 2XFTA 1HNZM 5DYIA 1SXJE 4JI4M 2L6OA 1H8PA 1E9RA 3AKZA 4QOSA 2LXEA 4QNMA 3AJIB 3M7GA 4GRIA 4KODA 3GPUA 1S3SA 2WZJA 1CUKA 4PDGA 2J7NA 1WR1B 2VIIA 4P16A 1AIPC 3HKPA 3RFWA 3THGA 3W0LB 2LVOC 2VDBB 1EFUB 2JXNA 3AOEC 3AFHA 4LJ6A 4ITQA 1G8PA 4JI1M 4QNLA 2DAMA 2B3TA 1XWIA 2WSEF 2YNMD 4LFAM 3FTFA 4KT0F 4HMEA 1WGLA 1HQCA 1BVSA 3QAUA 4W5WA 3TQSA 2DI0A 4IJFA 1NNUC 3H4MA 2LWXA 4UN2B 4M9XA 1OJLA 4LG2A 3WD0A 1DO2A 3GLFA 1WXQA 2ZTDA 4FCTA 3FUUA 1I94M 2JNHA 2F5NA 1R6BX 3CGWA 1H0IA 3DFZA 4NZ5A 2CP8A 4LJ8A 3MHVC 2CWBA 2EKKA 4B08A 3UK6A 4AKHA 2K0BX 1LV7A 2KRUA 2JE5A 3AV0A 2BNKA 3W68A 3UGJA 5KO3A 2KXEA 2ZAMA 3C9PA 3KS4A 2CEAA 4OJ5A 5KQ8A 2Y2JA 3Q8XA 2MGWA 4B7GA 1Q3BA 3QYEA 2VQFM 1AUAA 4TUWA 4M0WA 4GIPA 4L15A 3SC3A 1N34M 1L2DA 2CRUA 4LF6M 2XZUA 4MB3A 2LVQD 3KOWE 4JI3M 3GLFB 4DUYM 1GOIA 1OFHA 4RF1A 4DR4M 4DV2M 2XD1A 2G8LA 3GLIA 3U61B 1V92A 3HSHA 5ITRA 5BR8M 2HWJA 2D49A 1W1VA 5C1BA 3JR4A 2LVNC 4PD2A 2RRUA 1LTMA 3QYBA 3KSJA 4LJ5A 1I4WA 3U6OA 1R2ZA 1N36M 4G4RA 3FUVA 5FSWA 5JI3E 2L7HA 1K82A 2HAKA 4LFCM 3AL0C 2Y2KA 2H1RA 2Z7JA 4WW0A 4MGKE 1YU4A 3N3FA 4IBKA 4DV3M 1Q3CA 1L6JA 1R5LA 4IIWA 1OTRA 2EUCA 1EE8A 3I04M 5FTKA 2D7HA 2FOIC 4WP2A 1N75A 4R3DA 3LVVA 1J5EM 1HR0M 4X64M 4DV4M 1H0GA 2Y2HA 2BWBA 4IJEA 3PNVA 1DGFA 3IECA 1E9SA 4NSRA 4LF7M 1DGHB 4NZ1A 3SMPA 4IBEA 1TH4A 2Y2MA 2Y2NA 1PJQA 4LCBA 3GP1A 4G4QA 4B3MM 1PGYA 1FNNA 2ZM6M 2CV0A 3HGIA 3LCVB 4NRVA 1W1PA 1VEJA 3AOGA 4IBIA 1PJJA 4DUZM 1QO6A 3WD1A 4Q7JA 4LF5M 2FH0A 3T38A 4Z2IA 2V1CA 3U60B 4AKIA 1DV0A 4K0KM 3B7ZA 4Z2LA 4WURA 4NYYA 1IY2A 2P5TA 3HWSA 1HT2E 1C7YA 2Y0TA 2M5ZA 3E9SA 4L78A 2KEBA 3SARA 2LNHC 3J81S 3GLHA 1NV8A 5FTNA 1GJTA 2JA2A 2CV1A 2UUCM 3B7NA 1GL6A 4B3SM 3U6DA 1XMOM 1QAMA 1IN6A 4I81A 7CATA 4KHPM 3BXWA 3WD2A 2RKOA 3KVWA 1UFZA 1E6RA 1A5TA 1MX0A 1SXJB 3CF2A 5EXSA 3MJ5A 1TR8A 3TWLA 5KPTA 1L2BA 2R4EA 3SASA 4P17A 1L1TA 1ORYB 1N32M 2I7NA 2Z8YM 2OPFA 3L26A 3GQ4A 4JI8M 4JV5M 4Z2KA 4A3VB 3U61A 1Z59A 2L7IA 1E8BA 1R4GA 5ITXA 2UWXA 5JI2E 1EIJA 4Z6YA 1YUBA 1E32A 2R46A 4MGIE 3U6QA 4YY3M 2C9OA 3C3DA 1GABA 3BBZA 1SXJA 3HJSA 3GLGE 4QHSA 3PNYA 3TE6A 3VDPA 4G4NA 1TGUA 1NNJA 2Y20A 5ITUA 4DV6M 1Z5BA 2CHVA 3LQQA 2DWMA 4HMDA 1WGNA 5FTMA 4RNAA 2D7EA 1Q39A 2QBYB 1UR9A 2JY8A 1TDHA 2CHGA 3D8BA 4BBAA 3TPZA 4I8OA 5IREB 2V1UA 3J2PB 2R4JA 3VDUA 3KOXE 4EIWA 3LMMA 2JWSA 1IM2A 3A46A 4JI6M 3GQ3A 3C58A 4NZ4A 4KLNA 2UUAM 4OVZB 2UXDM 4BB9A 3SBJA 4GC5A 1DGHA 3GLFE 1PJSA 3B74A 3B7QA 3WD4A 1E88A 4NXNM 3HONA 1K3WA 3U6LA 2M60A 4MB5A 2JY6B 5IWAM 1XNQM 1T3TA 2LTUA 4FD2A 5ITXE 4L4UA 4GKKM 4NOOB 3U6MA 1E15A 3KW6A 2DVWB 1NV9A 1V34A 3UMMA 2KHHA 2CV2A 3FYDA 4XK8F 1WJ7A 4G4OA 3J7BA 2APLA 1PM5A 2KZSA 4X62M 2Z3XA 3U5ZB 4MB7A 1SXJC 2UUBM 2AHMA 2NQ8C 2L09A 3KSXA 2KW0A 1D0LA 2K6BA 3E21A 2CFOA 5EP1A 4MGZE 3GLIE 1D0KA 1SXJD 3CF6E 4GITA 4AI6A 4FCWA 2LBCA 1CK7A 2FS1A 1JR3D 2DHRA 4LFBM 4NZ3A 3WD3A 2LHGA 4DR3M 1JR3A 4DR2M 1YU1A 2XFSA 3FRHA 4LJ4A 4NXMM 4LZJA 2QHOB 2BJVA 3T6PA 3J7AS 3FUXA 4IBDA 3KOYE 4FCVA 4HLQA 4GH9A 3UZUA 1NO1A 1N78A 4AKGA 2DZLA 4OX9M 4LY6A 2DENA 3HU1A 3C3EA 2RGHA 2XGNA 1QAOA 2OO9A 5E26A 2UU9M 1IY1A 3LVWA 2FNAA 2VF7A 3K8ZA 2KNAA 3HJQA 2KRKA 3SAUA 3J80S 2F5SA 1QAQA 1TDZA 5KQDA 1D0MA 1IFYA 4GHLA 3JR5A 1YU2A 2JY5A 1XXHE 2DZNB 5EP2A 4Z2JA 3HHYA 2KA6B 3MQLA 3M0EA 3I4VA 4R71A 1RU3A 2OOBA 1IBLM 3DZDA 2L4FA 2O25A 1MN3A 1OIPA 2EO2A 2CE7A 5EXTA 2HKJA 2F5OA 1QYRA 4LJ7A 3K1JA 4I5SA 2QP9X 4NC6A 3M6AA 2Q2EB 2KDLA 4IBGA 3SHFA 4NY2A 3SYKA 3M7PA 3A98B 3U6CA 2Y0QA 2ERCA 1PJIA 2KZUA 1GXDA 4D82A 3MK6A 2K47A 3PFIA 4GEWA 3HJ8A 3VK7A 1G59A 1IN5A 1QQWA 2YQZA 2WSCF 2L2DA 4FWHA 4CISA 2ZTCA 2ZBKB 2Y2PA 4LRSA 3R8FA 1EAKA 2HHHM 2EJSA 1KFVA 2R0IA 1GVNA 1ZMWA 2GNOA 3T1YM 4DR6M 2DXIA 1L8QA 4LF4M 4OJOA 4B3TM 2IOUA 1VEKA 3GRUA 4MH0E 1ED7A 1QUSA 1O6IA 2F5QA 1W1TA 4AW4A 3I01M 1T6OA 2Y2LA 2OOAA 4D81A 1K3XA 4PT5A 4AZFA 2Y21A 3FUTA 1QVRA 4LZZA 3U60A 4OUIA 1VDLA 1TF0B 3FTDA 2F5PA 1IXSB 3WHLA 3A45A 1IQPA 3GLGA 3A42A 3KDSE 4OU7A 2VQEM 4BLCA 3GLGB 1DGBA 3F92A 4IBCA 2XH9A 4DV1M 3L29A 1HQYE 4CGYB 1TH2A 1VDDA 4GHAA 4Z2HA 4DV5M 1QZEA 4KO8A 4DR1M 1J09A 1MJGM 3VFDA 3L25A 2BG1A 4TX8A 2CUZA 2XEPA 3GRVA 1YU3A 4DR7M 2JUJA 4ANRA 1L1ZA 5C18A 1G3IA 2WSFF 2YR0A 1ZQ9A 2QZ4A 1Y8GA 3GPXA 2DAIA 1HJPA 1KSFX 2KNZA 2L4EA 4CIZA 3FE3A 2MJ5B 1IBMM 3HX3A 2G3QA 1N77A 2QSFX 4LF9M 3HHXA 2DWZB 4MB4A 1DO0A 2DKLA 2R45A 4FWGA 4G6ZA 3U5ZA 1G4AE 5L8RF 4X65M 3K2LA 4RKUF 5DFLA 3RE8A 1XNRM 1UR8A 2Z4SA 2R44A 4FVMA 5FLXS 2FN2A 1Z5AA 1IN8A 2X8AA 1GLNA 3KOZE 4FWDA 2CHQA 4XGIA 1G71A 1T43A 4M9ZA 5EJCA 2FFJA 1HNWM 1Z6TA 2LVPC 3LW5F 2UXBM 3GLIB 2GQFA 2F4VM 2BJWA 3L27A 4JYAM 2XSZA 1R7RA 4I4LA 4OW0A 4NRWA 2XZFA 4OVZA 1MU5A 3TWKA 1NSFA 3I51A 2DNAA 4LGYA 3ZC7B 4AG5A 5ITTA 4GC9A 2V5OA 2YFQA 4LJAA 2QENA 5EP3A 3SMSA 2XD5A 3B89A 5GKNA 4II7A 4OJ6A 1NVMA 2QNJA 1FJGM 5FTLA 1OGGA 2BWEA 4Z2GA 2R6FA 3CF0A 4QHTA 3NBIA 3L2AA 1E6ZA 3VLFB 1CXWA 2J7OA 3GLHE 2DHYA 4PDIA 1OQYA 4YHHM 1DGGA 2KNVA 1IY0A 1WIVA 2JZ1A 3HHWA 4NL4H 1ZAEA 3DA1A 1UM8A 3LQRA 4LRTA 4MGYE 5EXXA 5A2QS 2G5GX 4XBOA 3L28A 1C1KA 3HU2A 1XC8A 1W5TA 4DV7M 1Z5CA 1R2YA 1H6UA 5E6JA 1SG9A 1XXHA 3V76A 1GO5A 5BPVA 1HT1E 2C99A
chains in the Genus database with same CATH topology
4REZA 2X49A 3SATA 4RF0A 4B3RM 3RGPA 2RGOA 4DR5M 4IBBA 3RGSA 2C96A 5ITYA 4D80A 1XHBA 2HL7A 2I7PA 5IZ7D 3OTOM 3CTWB 2QPAA 2O5RA 4Z8XA 3SYLA 3PVSA 3TL4X 1YUEA 2ZAOA 3IG8A 1YU0A 3T1HM 3K92A 1E94E 1IXRC 3NWLA 4QNRA 5EXPA 1NHGC 2Z4RA 3TWMA 2ZANA 3FUWA 3KXEC 4S12A 3R9XB 3U6EA 1XXHB 4R7GA 2XF3A 5EQTA 5LMUM 5F3WA 1N33M 4B7HA 4GMQA 2D7GA 1GL7A 1JQJC 3IG5A 4FW9A 5FTJA 4GKJM 3SFZA 3BOSA 3VK8A 4JI7M 8CATA 1NHWC 2DWLA 1OFIA 1TH3A 2V6ZM 3GPYA 1YSYA 5IT9S 4OJPA 4MM3B 1YE9A 4M0DA 4NYUA 2C9CA 2Y2QA 2QBYA 4LF8M 2Y2IA 3ZH9B 5KPZA 4LGMA 3E4RA 3SAVA 1L2CA 1G41A 5EP4A 2XLJA 2FFFB 3SAWA 3EIEA 2OQ4A 3D8LA 4X66M 4PCZA 1IN7A 4AG6A 4IBFA 2LH0A 3ZCBB 4JI1M 4JN6A 2R18A 4L16A 4JI0M 3HHZA 2R65A 1J7KA 3J27B 2JCHA 3W0FA 4AQYM 1NY6A 2Y2GA 4NSOB 3GQ5A 4JXJA 3JAMS 2Y2OA 3WX7A 4M9SA 2X4AA 3WHKA 4OJLA 3T15A 2EA0A 2HCBA 1QZMA 3I4YA 3KP1E 2C98A 2W82A 4JI5M 3VKHA 3GRYA 3UJNA 3FTEA 2UXCM 3ILKA 4DV0M 1NJGA 3GLHB 3PXGA 2DWNA 4QOZC 3VKGA 2FE8A 2Y2JA 4JI2M 3SHGB 3QWLA 2R62A 2C5RA 1IN4A 1XMQM 2DZOB 1GKIA 3AOEA 2E5LM 3KS8A 3FYCA 5LMNM 4CHTB 3GPPA 5H37D 3DOAA 1W5SA 1IXZA 1QANA 2XSZD 4L8RC 3GO8A 2A5YB 4MGHA 1KYIA 3KP0E 3U6SA 3EIHA 3B9PA 3GRRA 1NY5A 4AI6A 3FD9A 4LJ9A 2QCUA 3FTCA 3U6PA 1IBKM 4B7FA 1HNXM 5DYGA 3HU3A 4IBJA 3FKEA 1X37A 1D2NA 4ZPXA 4HL4A 5ITQA 1NJFA 5KPRA 5DNYA 2XFTA 1HNZM 5DYIA 1SXJE 4JI4M 2L6OA 1E9RA 3AKZA 4QOSA 2LXEA 4QNMA 3AJIB 3M7GA 4GRIA 4KODA 3GPUA 1S3SA 4PDGA 2CV0A 2J7NA 2VIIA 4P16A 3HKPA 3RFWA 3THGA 3W0LB 3AOEC 4ITQA 3AFHA 4LJ6A 1G8PA 4QNLA 4LFAM 1XWIA 2YNMD 3FTFA 1HQCA 3QAUA 4W5WA 3TQSA 4IJFA 1NNUC 3H4MA 2LWXA 4LG2A 4M9XA 1OJLA 1DO2A 3GLFA 1WXQA 4FCTA 1I94M 3FUUA 2F5NA 1R6BX 3DFZA 4NZ5A 4LJ8A 3MHVC 4B08A 3UK6A 4AKHA 1LV7A 2KRUA 2JE5A 3AV0A 2BNKA 3UGJA 5KO3A 2KXEA 2ZAMA 3KS4A 2CEAA 4OJ5A 5KQ8A 3Q8XA 4B7GA 1Q3BA 2VQFM 4TUWA 4M0WA 4GIPA 4L15A 3SC3A 1N34M 1L2DA 4LF6M 2XZUA 4JI3M 3KOWE 3GLFB 4DUYM 1OFHA 4RF1A 4DR4M 4DV2M 2XD1A 2G8LA 3GLIA 3U61B 3HSHA 5ITRA 5BR8M 5C1BA 3JR4A 4PD2A 3KSJA 4LJ5A 1I4WA 3U6OA 1R2ZA 1N36M 4G4RA 3FUVA 5FSWA 5JI3E 2L7HA 1K82A 4LFCM 3AL0C 2Y2KA 2H1RA 2Z7JA 4WW0A 4MGKE 1YU4A 3N3FA 4IBKA 4DV3M 1Q3CA 4IIWA 2EUCA 1EE8A 5FTKA 2D7HA 2FOIC 1N75A 4R3DA 3LVVA 1J5EM 1HR0M 4X64M 4DV4M 2Y2HA 4IJEA 3PNVA 1DGFA 1E9SA 4NSRA 4LF7M 1DGHB 4NZ1A 3SMPA 4IBEA 1TH4A 2Y2MA 2Y2NA 4LCBA 3GP1A 4G4QA 4B3MM 1FNNA 2ZM6M 3HGIA 4NRVA 3AOGA 4IBIA 1PJJA 4DUZM 4LF5M 3T38A 2V1CA 3U60B 4AKIA 4K0KM 4WURA 4NYYA 1IY2A 3HWSA 2P5TA 1HT2E 2Y0TA 2M5ZA 3E9SA 4L78A 2KEBA 3SARA 2LNHC 3J81S 3GLHA 2CV1A 5FTNA 2UUCM 2JA2A 1GL6A 4B3SM 3U6DA 1XMOM 1IN6A 1QAMA 4I81A 7CATA 4KHPM 2RKOA 3KVWA 1SXJB 1MX0A 3CF2A 5EXSA 3MJ5A 3TWLA 5KPTA 1L2BA 2R4EA 3SASA 1L1TA 1ORYB 1N32M 2I7NA 2OPFA 3L26A 3GQ4A 4JI8M 4JV5M 4A3VB 3U61A 1Z59A 2L7IA 5ITXA 2UWXA 5JI2E 4Z6YA 1YUBA 1E32A 2R46A 4MGIE 3U6QA 4YY3M 2C9OA 1SXJA 3HJSA 4G4NA 4QHSA 3PNYA 3TE6A 3VDPA 1TGUA 1NNJA 2Y20A 5ITUA 4DV6M 1Z5BA 2CHVA 3LQQA 2DWMA 5FTMA 4RNAA 2D7EA 1Q39A 2QBYB 1TDHA 2CHGA 3D8BA 4BBAA 3TPZA 4I8OA 5IREB 2V1UA 3J2PB 2R4JA 3VDUA 3KOXE 4EIWA 3LMMA 1IM2A 3A46A 4JI6M 3GQ3A 3C58A 4NZ4A 4KLNA 2UUAM 4OVZB 2UXDM 4BB9A 3SBJA 4GC5A 1DGHA 4NXNM 3HONA 1K3WA 3U6LA 2M60A 5IWAM 1XNQM 1T3TA 4FD2A 5ITXE 4L4UA 4GKKM 4NOOB 3U6MA 3KW6A 2DVWB 3UMMA 2CV2A 3FYDA 4G4OA 3KFUG 1PM5A 3J7BA 2KZSA 4X62M 2Z3XA 3U5ZB 4MB7A 1SXJC 2UUBM 2AHMA 2NQ8C 2L09A 3KSXA 2KW0A 5EP1A 2CFOA 4MGZE 1SXJD 3CF6E 4GITA 4FCWA 4NZ3A 1JR3D 2DHRA 4LFBM 4DR3M 1JR3A 4DR2M 1YU1A 2XFSA 4LJ4A 4NXMM 4LZJA 2BJVA 3J7AS 3FUXA 4IBDA 3KOYE 4FCVA 4HLQA 4GH9A 3UZUA 1N78A 4AKGA 4OX9M 4LY6A 3HU1A 2RGHA 2XGNA 1QAOA 5E26A 2UU9M 1IY1A 3LVWA 2FNAA 3K8ZA 3HJQA 2KRKA 3SAUA 3J80S 2F5SA 1QAQA 1TDZA 5KQDA 4GHLA 3JR5A 1YU2A 2DZNB 5EP2A 3HHYA 2KA6B 3M0EA 3I4VA 1IBLM 3DZDA 2F5OA 5EXTA 2EO2A 2CE7A 2HKJA 1QYRA 4LJ7A 3K1JA 4I5SA 2QP9X 3M6AA 2Q2EB 4IBGA 3SHFA 4NY2A 3SYKA 3A98B 3U6CA 2Y0QA 2ERCA 1PJIA 2KZUA 4D82A 3MK6A 2K47A 3PFIA 1G59A 3HJ8A 3VK7A 1IN5A 1QQWA 2YQZA 4FWHA 4CISA 2ZBKB 2Y2PA 4LRSA 3R8FA 2HHHM 1KFVA 1GVNA 3T1YM 4DR6M 2DXIA 1L8QA 4LF4M 4OJOA 4B3TM 2IOUA 3GRUA 4MH0E 2F5QA 4AW4A 2Y2LA 4D81A 1K3XA 4PT5A 4AZFA 2Y21A 3FUTA 1QVRA 4LZZA 3U60A 4OUIA 3FTDA 2F5PA 1IXSB 3WHLA 3A45A 1IQPA 3GLGA 3A42A 3KDSE 4OU7A 2VQEM 4BLCA 3GLGB 1DGBA 4IBCA 4DV1M 2XH9A 3L29A 1HQYE 4CGYB 1TH2A 1VDDA 4GHAA 4DV5M 4KO8A 4DR1M 1J09A 3VFDA 3L25A 2BG1A 2CUZA 2XEPA 3GRVA 1YU3A 4DR7M 1L1ZA 5C18A 1G3IA 2YR0A 1ZQ9A 2QZ4A 3GPXA 1KSFX 1IBMM 1N77A 4LF9M 3HHXA 2DWZB 1DO0A 4FWGA 2R45A 4G6ZA 3U5ZA 1G4AE 4X65M 3K2LA 3RE8A 1XNRM 2Z4SA 4FVMA 5FLXS 1Z5AA 1IN8A 2X8AA 1GLNA 3KOZE 4FWDA 2CHQA 4XGIA 4M9ZA 5EJCA 2FFJA 1HNWM 1Z6TA 2UXBM 3GLIB 2F4VM 2BJWA 3L27A 4JYAM 2XSZA 1R7RA 4I4LA 4OW0A 4NRWA 2XZFA 4OVZA 1MU5A 3TWKA 1NSFA 3I51A 4LGYA 3ZC7B 4AG5A 5ITTA 4GC9A 2YFQA 4LJAA 2QENA 5EP3A 3SMSA 2XD5A 5GKNA 4II7A 4OJ6A 1NVMA 1FJGM 5FTLA 3CF0A 4QHTA 3NBIA 3L2AA 3VLFB 2J7OA 4PDIA 4YHHM 1DGGA 1IY0A 3HHWA 4NL4H 1ZAEA 3DA1A 1UM8A 3LQRA 4LRTA 4MGYE 5EXXA 5A2QS 2G5GX 4XBOA 3L28A 1C1KA 3HU2A 1XC8A 1W5TA 4DV7M 1Z5CA 1R2YA 1H6UA 5E6JA 1XXHA 5BPVA 1HT1E 2C99A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IBJ A;  3FKE A;  4IBE A;  4IJF A;  4LG2 A;  4IBF A;  4IBB A;  3KS8 A;  4IBC A;  3L29 A;  3L2A A;  3L26 A;  4IBI A;  4GHA A;  4GHL A;  3KS4 A;  3L25 A;  4IBK A;  3L28 A;  3L27 A;  4IBG A;  4IJE A;  4IBD A;  5BPV A;  4GH9 A; 
#chains in the Genus database with same CATH topology
 4REZ A;  2X49 A;  3SAT A;  4RF0 A;  4B3R M;  3RGP A;  2RGO A;  4DR5 M;  4IBB A;  3RGS A;  2C96 A;  5ITY A;  4D80 A;  1XHB A;  2HL7 A;  2I7P A;  1ZV1 A;  5IZ7 D;  1OKS A;  3CTW B;  3OTO M;  1OGB A;  3K9O A;  2QPA A;  2JY7 A;  2K9D A;  2O5R A;  1XB2 B;  1W1Y A;  4Z8X A;  3SYL A;  3PVS A;  1ZMV A;  3TL4 X;  1YUE A;  2ZAO A;  3IG8 A;  1YU0 A;  3T1H M;  3K92 A;  1E6P A;  1E94 E;  1IXR C;  3NWL A;  4QNR A;  2DAE A;  3HY5 A;  2MH8 A;  5EXP A;  1QDT A;  1NHG C;  2Z4R A;  3TWM A;  2H5X A;  1VEG A;  2ZAN A;  1QUT A;  1WHC A;  3FUW A;  3KXE C;  4S12 A;  3R9X B;  1V33 A;  2EKF A;  2DAK A;  3H4J A;  1XXH B;  4R7G A;  3U6E A;  2XF3 A;  5EQT A;  5LMU M;  1KS0 A;  1ZMU A;  5F3W A;  1N33 M;  4B7H A;  4GMQ A;  3W67 A;  1VQ1 A;  2D7G A;  1GL7 A;  1JQJ C;  3IG5 A;  4FW9 A;  3KFU G;  5FTJ A;  4GKJ M;  3SFZ A;  3BOS A;  3VK8 A;  4JI7 M;  1GJS A;  8CAT A;  1NHW C;  2DWL A;  2RTS A;  1OFI A;  1TH3 A;  2V6Z M;  3GPY A;  1YSY A;  2LHC A;  5IT9 S;  2VF8 A;  4OJP A;  4MM3 B;  1YE9 A;  4M0D A;  4NYU A;  2C9C A;  4Y28 F;  2Y2Q A;  2QBY A;  4LF8 M;  2Y2I A;  3ZH9 B;  5KPZ A;  4LGM A;  1OIZ A;  3E4R A;  3SAV A;  1F4I A;  1L2C A;  1G41 A;  5EP4 A;  2XLJ A;  2FFF B;  3SAW A;  3EIE A;  2OQ4 A;  2DAG A;  3D8L A;  4X66 M;  4PCZ A;  1IN7 A;  4AG6 A;  4CJ6 A;  4IBF A;  2LH0 A;  3ZCB B;  4DBG B;  4JN6 A;  2R18 A;  4L16 A;  4JI0 M;  1QDR A;  2R65 A;  1J7K A;  3J27 B;  3HHZ A;  3W0F A;  4AQY M;  1NY6 A;  2JCH A;  4NSO B;  3GQ5 A;  2J5Y A;  1P3Q Q;  4JXJ A;  3JAM S;  2Y2O A;  1YLA A;  3WX7 A;  4M9S A;  2X4A A;  3WHK A;  2Y2G A;  1GPF A;  1OAI A;  4F1I A;  4OJL A;  1PRB A;  3T15 A;  2EA0 A;  2HCB A;  1QZM A;  3I4Y A;  3KP1 E;  2C98 A;  2MR9 A;  2W82 A;  4JI5 M;  3VKH A;  3E46 A;  3GRY A;  3UJN A;  3FTE A;  2UXC M;  3ILK A;  4DV0 M;  1NJG A;  3GLH B;  3PXG A;  2O01 F;  1OAO C;  2DWN A;  4QOZ C;  2FE8 A;  3VKG A;  1PJT A;  4JI2 M;  4HEO A;  3SHG B;  3QWL A;  2R62 A;  1JR3 E;  4F2L A;  2C5R A;  1IN4 A;  3MMP A;  1XMQ M;  1PDC A;  2DZO B;  1GKI A;  3AOE A;  2E5L M;  3KS8 A;  3FYC A;  3Q8G A;  5LMN M;  2JP7 A;  4L6V 6;  4CHT B;  3GPP A;  4G3O A;  1J7M A;  3FRI A;  5H37 D;  3DOA A;  1E6N A;  3IHP A;  1W5S A;  3ZQJ A;  1IXZ A;  1TTE A;  1QAN A;  2XSZ D;  4L8R C;  1IXS A;  2QQ8 A;  3GO8 A;  1Q02 A;  2N35 A;  2A5Y B;  4MGH A;  1KYI A;  3HZJ A;  3KP0 E;  3U6S A;  1VG5 A;  3EIH A;  3B9P A;  3GRR A;  2LVA A;  1NY5 A;  3K9P A;  2MRO B;  3FD9 A;  1JB0 F;  2QCU A;  3FTC A;  3LCU A;  3NBX X;  4LJ9 A;  4B7F A;  3U6P A;  1IBK M;  5DYG A;  1HNX M;  3HU3 A;  4IBJ A;  2JZ0 A;  3FKE A;  1X37 A;  1D2N A;  4HMC A;  4ZPX A;  4HL4 A;  5ITQ A;  1NJF A;  5KPR A;  5DNY A;  1AIW A;  2XFT A;  1HNZ M;  5DYI A;  1SXJ E;  4JI4 M;  2L6O A;  1H8P A;  1E9R A;  3AKZ A;  4QOS A;  2LXE A;  4QNM A;  3AJI B;  3M7G A;  4GRI A;  4KOD A;  3GPU A;  1S3S A;  2WZJ A;  1CUK A;  4PDG A;  2J7N A;  1WR1 B;  2VII A;  4P16 A;  1AIP C;  3HKP A;  3RFW A;  3THG A;  3W0L B;  2LVO C;  2VDB B;  1EFU B;  2JXN A;  3AOE C;  3AFH A;  4LJ6 A;  4ITQ A;  1G8P A;  4JI1 M;  4QNL A;  2DAM A;  2B3T A;  1XWI A;  2WSE F;  2YNM D;  4LFA M;  3FTF A;  4KT0 F;  4HME A;  1WGL A;  1HQC A;  1BVS A;  3QAU A;  4W5W A;  3TQS A;  2DI0 A;  4IJF A;  1NNU C;  3H4M A;  2LWX A;  4UN2 B;  4M9X A;  1OJL A;  4LG2 A;  3WD0 A;  1DO2 A;  3GLF A;  1WXQ A;  2ZTD A;  4FCT A;  3FUU A;  1I94 M;  2JNH A;  2F5N A;  1R6B X;  3CGW A;  1H0I A;  3DFZ A;  4NZ5 A;  2CP8 A;  4LJ8 A;  3MHV C;  2CWB A;  2EKK A;  4B08 A;  3UK6 A;  4AKH A;  2K0B X;  1LV7 A;  2KRU A;  2JE5 A;  3AV0 A;  2BNK A;  3W68 A;  3UGJ A;  5KO3 A;  2KXE A;  2ZAM A;  3C9P A;  3KS4 A;  2CEA A;  4OJ5 A;  5KQ8 A;  2Y2J A;  3Q8X A;  2MGW A;  4B7G A;  1Q3B A;  3QYE A;  2VQF M;  1AUA A;  4TUW A;  4M0W A;  4GIP A;  4L15 A;  3SC3 A;  1N34 M;  1L2D A;  2CRU A;  4LF6 M;  2XZU A;  4MB3 A;  2LVQ D;  3KOW E;  4JI3 M;  3GLF B;  4DUY M;  1GOI A;  1OFH A;  4RF1 A;  4DR4 M;  4DV2 M;  2XD1 A;  2G8L A;  3GLI A;  3U61 B;  1V92 A;  3HSH A;  5ITR A;  5BR8 M;  2HWJ A;  2D49 A;  1W1V A;  5C1B A;  3JR4 A;  2LVN C;  4PD2 A;  2RRU A;  1LTM A;  3QYB A;  3KSJ A;  4LJ5 A;  1I4W A;  3U6O A;  1R2Z A;  1N36 M;  4G4R A;  3FUV A;  5FSW A;  5JI3 E;  2L7H A;  1K82 A;  2HAK A;  4LFC M;  3AL0 C;  2Y2K A;  2H1R A;  2Z7J A;  4WW0 A;  4MGK E;  1YU4 A;  3N3F A;  4IBK A;  4DV3 M;  1Q3C A;  1L6J A;  1R5L A;  4IIW A;  1OTR A;  2EUC A;  1EE8 A;  3I04 M;  5FTK A;  2D7H A;  2FOI C;  4WP2 A;  1N75 A;  4R3D A;  3LVV A;  1J5E M;  1HR0 M;  4X64 M;  4DV4 M;  1H0G A;  2Y2H A;  2BWB A;  4IJE A;  3PNV A;  1DGF A;  3IEC A;  1E9S A;  4NSR A;  4LF7 M;  1DGH B;  4NZ1 A;  3SMP A;  4IBE A;  1TH4 A;  2Y2M A;  2Y2N A;  1PJQ A;  4LCB A;  3GP1 A;  4G4Q A;  4B3M M;  1PGY A;  1FNN A;  2ZM6 M;  2CV0 A;  3HGI A;  3LCV B;  4NRV A;  1W1P A;  1VEJ A;  3AOG A;  4IBI A;  1PJJ A;  4DUZ M;  1QO6 A;  3WD1 A;  4Q7J A;  4LF5 M;  2FH0 A;  3T38 A;  4Z2I A;  2V1C A;  3U60 B;  4AKI A;  1DV0 A;  4K0K M;  3B7Z A;  4Z2L A;  4WUR A;  4NYY A;  1IY2 A;  2P5T A;  3HWS A;  1HT2 E;  1C7Y A;  2Y0T A;  2M5Z A;  3E9S A;  4L78 A;  2KEB A;  3SAR A;  2LNH C;  3J81 S;  3GLH A;  1NV8 A;  5FTN A;  1GJT A;  2JA2 A;  2CV1 A;  2UUC M;  3B7N A;  1GL6 A;  4B3S M;  3U6D A;  1XMO M;  1QAM A;  1IN6 A;  4I81 A;  7CAT A;  4KHP M;  3BXW A;  3WD2 A;  2RKO A;  3KVW A;  1UFZ A;  1E6R A;  1A5T A;  1MX0 A;  1SXJ B;  3CF2 A;  5EXS A;  3MJ5 A;  1TR8 A;  3TWL A;  5KPT A;  1L2B A;  2R4E A;  3SAS A;  4P17 A;  1L1T A;  1ORY B;  1N32 M;  2I7N A;  2Z8Y M;  2OPF A;  3L26 A;  3GQ4 A;  4JI8 M;  4JV5 M;  4Z2K A;  4A3V B;  3U61 A;  1Z59 A;  2L7I A;  1E8B A;  1R4G A;  5ITX A;  2UWX A;  5JI2 E;  1EIJ A;  4Z6Y A;  1YUB A;  1E32 A;  2R46 A;  4MGI E;  3U6Q A;  4YY3 M;  2C9O A;  3C3D A;  1GAB A;  3BBZ A;  1SXJ A;  3HJS A;  3GLG E;  4QHS A;  3PNY A;  3TE6 A;  3VDP A;  4G4N A;  1TGU A;  1NNJ A;  2Y20 A;  5ITU A;  4DV6 M;  1Z5B A;  2CHV A;  3LQQ A;  2DWM A;  4HMD A;  1WGN A;  5FTM A;  4RNA A;  2D7E A;  1Q39 A;  2QBY B;  1UR9 A;  2JY8 A;  1TDH A;  2CHG A;  3D8B A;  4BBA A;  3TPZ A;  4I8O A;  5IRE B;  2V1U A;  3J2P B;  2R4J A;  3VDU A;  3KOX E;  4EIW A;  3LMM A;  2JWS A;  1IM2 A;  3A46 A;  4JI6 M;  3GQ3 A;  3C58 A;  4NZ4 A;  4KLN A;  2UUA M;  4OVZ B;  2UXD M;  4BB9 A;  3SBJ A;  4GC5 A;  1DGH A;  3GLF E;  1PJS A;  3B74 A;  3B7Q A;  3WD4 A;  1E88 A;  4NXN M;  3HON A;  1K3W A;  3U6L A;  2M60 A;  4MB5 A;  2JY6 B;  5IWA M;  1XNQ M;  1T3T A;  2LTU A;  4FD2 A;  5ITX E;  4L4U A;  4GKK M;  4NOO B;  3U6M A;  1E15 A;  3KW6 A;  2DVW B;  1NV9 A;  1V34 A;  3UMM A;  2KHH A;  2CV2 A;  3FYD A;  4XK8 F;  1WJ7 A;  4G4O A;  3J7B A;  2APL A;  1PM5 A;  2KZS A;  4X62 M;  2Z3X A;  3U5Z B;  4MB7 A;  1SXJ C;  2UUB M;  2AHM A;  2NQ8 C;  2L09 A;  3KSX A;  2KW0 A;  1D0L A;  2K6B A;  3E21 A;  2CFO A;  5EP1 A;  4MGZ E;  3GLI E;  1D0K A;  1SXJ D;  3CF6 E;  4GIT A;  4AI6 A;  4FCW A;  2LBC A;  1CK7 A;  2FS1 A;  1JR3 D;  2DHR A;  4LFB M;  4NZ3 A;  3WD3 A;  2LHG A;  4DR3 M;  1JR3 A;  4DR2 M;  1YU1 A;  2XFS A;  3FRH A;  4LJ4 A;  4NXM M;  4LZJ A;  2QHO B;  2BJV A;  3T6P A;  3J7A S;  3FUX A;  4IBD A;  3KOY E;  4FCV A;  4HLQ A;  4GH9 A;  3UZU A;  1NO1 A;  1N78 A;  4AKG A;  2DZL A;  4OX9 M;  4LY6 A;  2DEN A;  3HU1 A;  3C3E A;  2RGH A;  2XGN A;  1QAO A;  2OO9 A;  5E26 A;  2UU9 M;  1IY1 A;  3LVW A;  2FNA A;  2VF7 A;  3K8Z A;  2KNA A;  3HJQ A;  2KRK A;  3SAU A;  3J80 S;  2F5S A;  1QAQ A;  1TDZ A;  5KQD A;  1D0M A;  1IFY A;  4GHL A;  3JR5 A;  1YU2 A;  2JY5 A;  1XXH E;  2DZN B;  5EP2 A;  4Z2J A;  3HHY A;  2KA6 B;  3MQL A;  3M0E A;  3I4V A;  4R71 A;  1RU3 A;  2OOB A;  1IBL M;  3DZD A;  2L4F A;  2O25 A;  1MN3 A;  1OIP A;  2EO2 A;  2CE7 A;  5EXT A;  2HKJ A;  2F5O A;  1QYR A;  4LJ7 A;  3K1J A;  4I5S A;  2QP9 X;  4NC6 A;  3M6A A;  2Q2E B;  2KDL A;  4IBG A;  3SHF A;  4NY2 A;  3SYK A;  3M7P A;  3A98 B;  3U6C A;  2Y0Q A;  2ERC A;  1PJI A;  2KZU A;  1GXD A;  4D82 A;  3MK6 A;  2K47 A;  3PFI A;  4GEW A;  3HJ8 A;  3VK7 A;  1G59 A;  1IN5 A;  1QQW A;  2YQZ A;  2WSC F;  2L2D A;  4FWH A;  4CIS A;  2ZTC A;  2ZBK B;  2Y2P A;  4LRS A;  3R8F A;  1EAK A;  2HHH M;  2EJS A;  1KFV A;  2R0I A;  1GVN A;  1ZMW A;  2GNO A;  3T1Y M;  4DR6 M;  2DXI A;  1L8Q A;  4LF4 M;  4OJO A;  4B3T M;  2IOU A;  1VEK A;  3GRU A;  4MH0 E;  1ED7 A;  1QUS A;  1O6I A;  2F5Q A;  1W1T A;  4AW4 A;  3I01 M;  1T6O A;  2Y2L A;  2OOA A;  4D81 A;  1K3X A;  4PT5 A;  4AZF A;  2Y21 A;  3FUT A;  1QVR A;  4LZZ A;  3U60 A;  4OUI A;  1VDL A;  1TF0 B;  3FTD A;  2F5P A;  1IXS B;  3WHL A;  3A45 A;  1IQP A;  3GLG A;  3A42 A;  3KDS E;  4OU7 A;  2VQE M;  4BLC A;  3GLG B;  1DGB A;  3F92 A;  4IBC A;  2XH9 A;  4DV1 M;  3L29 A;  1HQY E;  4CGY B;  1TH2 A;  1VDD A;  4GHA A;  4Z2H A;  4DV5 M;  1QZE A;  4KO8 A;  4DR1 M;  1J09 A;  1MJG M;  3VFD A;  3L25 A;  2BG1 A;  4TX8 A;  2CUZ A;  2XEP A;  3GRV A;  1YU3 A;  4DR7 M;  2JUJ A;  4ANR A;  1L1Z A;  5C18 A;  1G3I A;  2WSF F;  2YR0 A;  1ZQ9 A;  2QZ4 A;  1Y8G A;  3GPX A;  2DAI A;  1HJP A;  1KSF X;  2KNZ A;  2L4E A;  4CIZ A;  3FE3 A;  2MJ5 B;  1IBM M;  3HX3 A;  2G3Q A;  1N77 A;  2QSF X;  4LF9 M;  3HHX A;  2DWZ B;  4MB4 A;  1DO0 A;  2DKL A;  2R45 A;  4FWG A;  4G6Z A;  3U5Z A;  1G4A E;  5L8R F;  4X65 M;  3K2L A;  4RKU F;  5DFL A;  3RE8 A;  1XNR M;  1UR8 A;  2Z4S A;  2R44 A;  4FVM A;  5FLX S;  2FN2 A;  1Z5A A;  1IN8 A;  2X8A A;  1GLN A;  3KOZ E;  4FWD A;  2CHQ A;  4XGI A;  1G71 A;  1T43 A;  4M9Z A;  5EJC A;  2FFJ A;  1HNW M;  1Z6T A;  2LVP C;  3LW5 F;  2UXB M;  3GLI B;  2GQF A;  2F4V M;  2BJW A;  3L27 A;  4JYA M;  2XSZ A;  1R7R A;  4I4L A;  4OW0 A;  4NRW A;  2XZF A;  4OVZ A;  1MU5 A;  3TWK A;  1NSF A;  3I51 A;  2DNA A;  4LGY A;  3ZC7 B;  4AG5 A;  5ITT A;  4GC9 A;  2V5O A;  2YFQ A;  4LJA A;  2QEN A;  5EP3 A;  3SMS A;  2XD5 A;  3B89 A;  5GKN A;  4II7 A;  4OJ6 A;  1NVM A;  2QNJ A;  1FJG M;  5FTL A;  1OGG A;  2BWE A;  4Z2G A;  2R6F A;  3CF0 A;  4QHT A;  3NBI A;  3L2A A;  1E6Z A;  3VLF B;  1CXW A;  2J7O A;  3GLH E;  2DHY A;  4PDI A;  1OQY A;  4YHH M;  1DGG A;  2KNV A;  1IY0 A;  1WIV A;  2JZ1 A;  3HHW A;  4NL4 H;  1ZAE A;  3DA1 A;  1UM8 A;  3LQR A;  4LRT A;  4MGY E;  5EXX A;  5A2Q S;  2G5G X;  4XBO A;  3L28 A;  1C1K A;  3HU2 A;  1XC8 A;  1W5T A;  4DV7 M;  1Z5C A;  1R2Y A;  1H6U A;  5E6J A;  1SG9 A;  1XXH A;  3V76 A;  1GO5 A;  5BPV A;  1HT1 E;  2C99 A; 
#chains in the Genus database with same CATH homology
 4REZ A;  2X49 A;  3SAT A;  4RF0 A;  4B3R M;  3RGP A;  2RGO A;  4DR5 M;  4IBB A;  3RGS A;  2C96 A;  5ITY A;  4D80 A;  1XHB A;  2HL7 A;  2I7P A;  5IZ7 D;  3OTO M;  3CTW B;  2QPA A;  2O5R A;  4Z8X A;  3SYL A;  3PVS A;  3TL4 X;  1YUE A;  2ZAO A;  3IG8 A;  1YU0 A;  3T1H M;  3K92 A;  1E94 E;  1IXR C;  3NWL A;  4QNR A;  5EXP A;  1NHG C;  2Z4R A;  3TWM A;  2ZAN A;  3FUW A;  3KXE C;  4S12 A;  3R9X B;  3U6E A;  1XXH B;  4R7G A;  2XF3 A;  5EQT A;  5LMU M;  5F3W A;  1N33 M;  4B7H A;  4GMQ A;  2D7G A;  1GL7 A;  1JQJ C;  3IG5 A;  4FW9 A;  5FTJ A;  4GKJ M;  3SFZ A;  3BOS A;  3VK8 A;  4JI7 M;  8CAT A;  1NHW C;  2DWL A;  1OFI A;  1TH3 A;  2V6Z M;  3GPY A;  1YSY A;  5IT9 S;  4OJP A;  4MM3 B;  1YE9 A;  4M0D A;  4NYU A;  2C9C A;  2Y2Q A;  2QBY A;  4LF8 M;  2Y2I A;  3ZH9 B;  5KPZ A;  4LGM A;  3E4R A;  3SAV A;  1L2C A;  1G41 A;  5EP4 A;  2XLJ A;  2FFF B;  3SAW A;  3EIE A;  2OQ4 A;  3D8L A;  4X66 M;  4PCZ A;  1IN7 A;  4AG6 A;  4IBF A;  2LH0 A;  3ZCB B;  4JI1 M;  4JN6 A;  2R18 A;  4L16 A;  4JI0 M;  3HHZ A;  2R65 A;  1J7K A;  3J27 B;  2JCH A;  3W0F A;  4AQY M;  1NY6 A;  2Y2G A;  4NSO B;  3GQ5 A;  4JXJ A;  3JAM S;  2Y2O A;  3WX7 A;  4M9S A;  2X4A A;  3WHK A;  4OJL A;  3T15 A;  2EA0 A;  2HCB A;  1QZM A;  3I4Y A;  3KP1 E;  2C98 A;  2W82 A;  4JI5 M;  3VKH A;  3GRY A;  3UJN A;  3FTE A;  2UXC M;  3ILK A;  4DV0 M;  1NJG A;  3GLH B;  3PXG A;  2DWN A;  4QOZ C;  3VKG A;  2FE8 A;  2Y2J A;  4JI2 M;  3SHG B;  3QWL A;  2R62 A;  2C5R A;  1IN4 A;  1XMQ M;  2DZO B;  1GKI A;  3AOE A;  2E5L M;  3KS8 A;  3FYC A;  5LMN M;  4CHT B;  3GPP A;  5H37 D;  3DOA A;  1W5S A;  1IXZ A;  1QAN A;  2XSZ D;  4L8R C;  3GO8 A;  2A5Y B;  4MGH A;  1KYI A;  3KP0 E;  3U6S A;  3EIH A;  3B9P A;  3GRR A;  1NY5 A;  4AI6 A;  3FD9 A;  4LJ9 A;  2QCU A;  3FTC A;  3U6P A;  1IBK M;  4B7F A;  1HNX M;  5DYG A;  3HU3 A;  4IBJ A;  3FKE A;  1X37 A;  1D2N A;  4ZPX A;  4HL4 A;  5ITQ A;  1NJF A;  5KPR A;  5DNY A;  2XFT A;  1HNZ M;  5DYI A;  1SXJ E;  4JI4 M;  2L6O A;  1E9R A;  3AKZ A;  4QOS A;  2LXE A;  4QNM A;  3AJI B;  3M7G A;  4GRI A;  4KOD A;  3GPU A;  1S3S A;  4PDG A;  2CV0 A;  2J7N A;  2VII A;  4P16 A;  3HKP A;  3RFW A;  3THG A;  3W0L B;  3AOE C;  4ITQ A;  3AFH A;  4LJ6 A;  1G8P A;  4QNL A;  4LFA M;  1XWI A;  2YNM D;  3FTF A;  1HQC A;  3QAU A;  4W5W A;  3TQS A;  4IJF A;  1NNU C;  3H4M A;  2LWX A;  4LG2 A;  4M9X A;  1OJL A;  1DO2 A;  3GLF A;  1WXQ A;  4FCT A;  1I94 M;  3FUU A;  2F5N A;  1R6B X;  3DFZ A;  4NZ5 A;  4LJ8 A;  3MHV C;  4B08 A;  3UK6 A;  4AKH A;  1LV7 A;  2KRU A;  2JE5 A;  3AV0 A;  2BNK A;  3UGJ A;  5KO3 A;  2KXE A;  2ZAM A;  3KS4 A;  2CEA A;  4OJ5 A;  5KQ8 A;  3Q8X A;  4B7G A;  1Q3B A;  2VQF M;  4TUW A;  4M0W A;  4GIP A;  4L15 A;  3SC3 A;  1N34 M;  1L2D A;  4LF6 M;  2XZU A;  4JI3 M;  3KOW E;  3GLF B;  4DUY M;  1OFH A;  4RF1 A;  4DR4 M;  4DV2 M;  2XD1 A;  2G8L A;  3GLI A;  3U61 B;  3HSH A;  5ITR A;  5BR8 M;  5C1B A;  3JR4 A;  4PD2 A;  3KSJ A;  4LJ5 A;  1I4W A;  3U6O A;  1R2Z A;  1N36 M;  4G4R A;  3FUV A;  5FSW A;  5JI3 E;  2L7H A;  1K82 A;  4LFC M;  3AL0 C;  2Y2K A;  2H1R A;  2Z7J A;  4WW0 A;  4MGK E;  1YU4 A;  3N3F A;  4IBK A;  4DV3 M;  1Q3C A;  4IIW A;  2EUC A;  1EE8 A;  5FTK A;  2D7H A;  2FOI C;  1N75 A;  4R3D A;  3LVV A;  1J5E M;  1HR0 M;  4X64 M;  4DV4 M;  2Y2H A;  4IJE A;  3PNV A;  1DGF A;  1E9S A;  4NSR A;  4LF7 M;  1DGH B;  4NZ1 A;  3SMP A;  4IBE A;  1TH4 A;  2Y2M A;  2Y2N A;  4LCB A;  3GP1 A;  4G4Q A;  4B3M M;  1FNN A;  2ZM6 M;  3HGI A;  4NRV A;  3AOG A;  4IBI A;  1PJJ A;  4DUZ M;  4LF5 M;  3T38 A;  2V1C A;  3U60 B;  4AKI A;  4K0K M;  4WUR A;  4NYY A;  1IY2 A;  3HWS A;  2P5T A;  1HT2 E;  2Y0T A;  2M5Z A;  3E9S A;  4L78 A;  2KEB A;  3SAR A;  2LNH C;  3J81 S;  3GLH A;  2CV1 A;  5FTN A;  2UUC M;  2JA2 A;  1GL6 A;  4B3S M;  3U6D A;  1XMO M;  1IN6 A;  1QAM A;  4I81 A;  7CAT A;  4KHP M;  2RKO A;  3KVW A;  1SXJ B;  1MX0 A;  3CF2 A;  5EXS A;  3MJ5 A;  3TWL A;  5KPT A;  1L2B A;  2R4E A;  3SAS A;  1L1T A;  1ORY B;  1N32 M;  2I7N A;  2OPF A;  3L26 A;  3GQ4 A;  4JI8 M;  4JV5 M;  4A3V B;  3U61 A;  1Z59 A;  2L7I A;  5ITX A;  2UWX A;  5JI2 E;  4Z6Y A;  1YUB A;  1E32 A;  2R46 A;  4MGI E;  3U6Q A;  4YY3 M;  2C9O A;  1SXJ A;  3HJS A;  4G4N A;  4QHS A;  3PNY A;  3TE6 A;  3VDP A;  1TGU A;  1NNJ A;  2Y20 A;  5ITU A;  4DV6 M;  1Z5B A;  2CHV A;  3LQQ A;  2DWM A;  5FTM A;  4RNA A;  2D7E A;  1Q39 A;  2QBY B;  1TDH A;  2CHG A;  3D8B A;  4BBA A;  3TPZ A;  4I8O A;  5IRE B;  2V1U A;  3J2P B;  2R4J A;  3VDU A;  3KOX E;  4EIW A;  3LMM A;  1IM2 A;  3A46 A;  4JI6 M;  3GQ3 A;  3C58 A;  4NZ4 A;  4KLN A;  2UUA M;  4OVZ B;  2UXD M;  4BB9 A;  3SBJ A;  4GC5 A;  1DGH A;  4NXN M;  3HON A;  1K3W A;  3U6L A;  2M60 A;  5IWA M;  1XNQ M;  1T3T A;  4FD2 A;  5ITX E;  4L4U A;  4GKK M;  4NOO B;  3U6M A;  3KW6 A;  2DVW B;  3UMM A;  2CV2 A;  3FYD A;  4G4O A;  3KFU G;  1PM5 A;  3J7B A;  2KZS A;  4X62 M;  2Z3X A;  3U5Z B;  4MB7 A;  1SXJ C;  2UUB M;  2AHM A;  2NQ8 C;  2L09 A;  3KSX A;  2KW0 A;  5EP1 A;  2CFO A;  4MGZ E;  1SXJ D;  3CF6 E;  4GIT A;  4FCW A;  4NZ3 A;  1JR3 D;  2DHR A;  4LFB M;  4DR3 M;  1JR3 A;  4DR2 M;  1YU1 A;  2XFS A;  4LJ4 A;  4NXM M;  4LZJ A;  2BJV A;  3J7A S;  3FUX A;  4IBD A;  3KOY E;  4FCV A;  4HLQ A;  4GH9 A;  3UZU A;  1N78 A;  4AKG A;  4OX9 M;  4LY6 A;  3HU1 A;  2RGH A;  2XGN A;  1QAO A;  5E26 A;  2UU9 M;  1IY1 A;  3LVW A;  2FNA A;  3K8Z A;  3HJQ A;  2KRK A;  3SAU A;  3J80 S;  2F5S A;  1QAQ A;  1TDZ A;  5KQD A;  4GHL A;  3JR5 A;  1YU2 A;  2DZN B;  5EP2 A;  3HHY A;  2KA6 B;  3M0E A;  3I4V A;  1IBL M;  3DZD A;  2F5O A;  5EXT A;  2EO2 A;  2CE7 A;  2HKJ A;  1QYR A;  4LJ7 A;  3K1J A;  4I5S A;  2QP9 X;  3M6A A;  2Q2E B;  4IBG A;  3SHF A;  4NY2 A;  3SYK A;  3A98 B;  3U6C A;  2Y0Q A;  2ERC A;  1PJI A;  2KZU A;  4D82 A;  3MK6 A;  2K47 A;  3PFI A;  1G59 A;  3HJ8 A;  3VK7 A;  1IN5 A;  1QQW A;  2YQZ A;  4FWH A;  4CIS A;  2ZBK B;  2Y2P A;  4LRS A;  3R8F A;  2HHH M;  1KFV A;  1GVN A;  3T1Y M;  4DR6 M;  2DXI A;  1L8Q A;  4LF4 M;  4OJO A;  4B3T M;  2IOU A;  3GRU A;  4MH0 E;  2F5Q A;  4AW4 A;  2Y2L A;  4D81 A;  1K3X A;  4PT5 A;  4AZF A;  2Y21 A;  3FUT A;  1QVR A;  4LZZ A;  3U60 A;  4OUI A;  3FTD A;  2F5P A;  1IXS B;  3WHL A;  3A45 A;  1IQP A;  3GLG A;  3A42 A;  3KDS E;  4OU7 A;  2VQE M;  4BLC A;  3GLG B;  1DGB A;  4IBC A;  4DV1 M;  2XH9 A;  3L29 A;  1HQY E;  4CGY B;  1TH2 A;  1VDD A;  4GHA A;  4DV5 M;  4KO8 A;  4DR1 M;  1J09 A;  3VFD A;  3L25 A;  2BG1 A;  2CUZ A;  2XEP A;  3GRV A;  1YU3 A;  4DR7 M;  1L1Z A;  5C18 A;  1G3I A;  2YR0 A;  1ZQ9 A;  2QZ4 A;  3GPX A;  1KSF X;  1IBM M;  1N77 A;  4LF9 M;  3HHX A;  2DWZ B;  1DO0 A;  4FWG A;  2R45 A;  4G6Z A;  3U5Z A;  1G4A E;  4X65 M;  3K2L A;  3RE8 A;  1XNR M;  2Z4S A;  4FVM A;  5FLX S;  1Z5A A;  1IN8 A;  2X8A A;  1GLN A;  3KOZ E;  4FWD A;  2CHQ A;  4XGI A;  4M9Z A;  5EJC A;  2FFJ A;  1HNW M;  1Z6T A;  2UXB M;  3GLI B;  2F4V M;  2BJW A;  3L27 A;  4JYA M;  2XSZ A;  1R7R A;  4I4L A;  4OW0 A;  4NRW A;  2XZF A;  4OVZ A;  1MU5 A;  3TWK A;  1NSF A;  3I51 A;  4LGY A;  3ZC7 B;  4AG5 A;  5ITT A;  4GC9 A;  2YFQ A;  4LJA A;  2QEN A;  5EP3 A;  3SMS A;  2XD5 A;  5GKN A;  4II7 A;  4OJ6 A;  1NVM A;  1FJG M;  5FTL A;  3CF0 A;  4QHT A;  3NBI A;  3L2A A;  3VLF B;  2J7O A;  4PDI A;  4YHH M;  1DGG A;  1IY0 A;  3HHW A;  4NL4 H;  1ZAE A;  3DA1 A;  1UM8 A;  3LQR A;  4LRT A;  4MGY E;  5EXX A;  5A2Q S;  2G5G X;  4XBO A;  3L28 A;  1C1K A;  3HU2 A;  1XC8 A;  1W5T A;  4DV7 M;  1Z5C A;  1R2Y A;  1H6U A;  5E6J A;  1XXH A;  5BPV A;  1HT1 E;  2C99 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...