3L29A

Crystal structure of zaire ebola vp35 interferon inhibitory domain k319a/r322a mutant
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
123
structure length
123
Chain Sequence
DISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPAIDAGWVCVFQLQDGKTLGLKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mutations abrogating VP35 interaction with double-stranded RNA render ebola virus avirulent in guinea pigs.
pubmed doi rcsb
source organism Zaire ebolavirus
molecule tags Rna binding protein
molecule keywords Polymerase cofactor VP35
total genus 43
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3l29A01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 3l29A02
4GHAA 3L2AA 4IBIA 4GH9A 4GHLA 4LG2A 4IBBA 4IBCA 4IBJA 3FKEA 4IBEA 3L26A 5BPVA 3KS4A 4IBFA 3L29A 3L28A 3KS8A 4IJFA 4IBGA 3L27A 4IJEA 4IBKA 3L25A 4IBDA
chains in the Genus database with same CATH superfamily
1MX0A 1NVMA 3GPPA 3Q8XA 1JR3D 2Y2QA 1AUAA 3WHLA 4PD2A 4D81A 4F1IA 4LJ5A 1XNRM 1H0GA 3SAUA 3BXWA 4I5SA 4LFAM 3GPXA 1W1VA 3T38A 3U5ZB 1WJ7A 4LJAA 4YHHM 3U6CA 4JI3M 1HQYE 2OOAA 3V76A 5KO3A 3GO8A 1IN8A 4DV7M 1GL7A 1E94E 4NYYA 3SYKA 2UXCM 1R6BX 2Q2EB 2KA6B 4KODA 1HT1E 4LF8M 1G41A 2ZTCA 3MHVC 1K3XA 2CUZA 3SARA 1L2BA 2IOUA 2DVWB 2V1CA 4QOZC 2BWEA 2CRUA 2O5RA 4GRIA 4A3VB 3GLIA 1IN7A 3TL4X 1GO5A 2EA0A 3AJIB 3GP1A 5FTLA 3WX7A 1BVSA 1XMOM 2KRUA 3HJSA 1R2ZA 1ZAEA 3GQ4A 4Z2GA 1XHBA 2F5PA 3FUVA 4FCVA 4DR6M 3SFZA 3KP1E 2JY5A 2Z4RA 4NRWA 2N35A 1UR8A 1QAOA 1YE9A 2KXEA 3A98B 1WGLA 2VF8A 2DHYA 1L2CA 4AKHA 4NL4H 3GRUA 4EIWA 2DHRA 2DAEA 4B7GA 5BPVA 4GKJM 1NHGC 4Z2LA 2FH0A 4JI7M 2F5NA 1HQCA 1IN6A 2DWMA 2C9OA 3AKZA 2QQ8A 2WZJA 1OKSA 2JY8A 1GLNA 2DWNA 3L27A 4IJEA 4RF1A 4DV3M 3A45A 2DAIA 5DNYA 1OJLA 3GPUA 3U6LA 3R9XB 1EIJA 3SMSA 2XH9A 4IBIA 5KPTA 3AOGA 4LY6A 3HU2A 2VQEM 4G4NA 1Q3BA 3U6PA 2Y2IA 5DYGA 1HJPA 3GLFA 1NHWC 3K9OA 5KPRA 4IBCA 1N32M 3W0LB 1W5SA 4D80A 2EO2A 3FKEA 5FTMA 1NNJA 2XZFA 3B7ZA 1R2YA 1IY1A 3NWLA 4B7HA 2KEBA 2OO9A 2Y0QA 3K92A 4MGHA 4Y28F 1XNQM 3C3DA 5GKNA 2MH8A 4B08A 4G4QA 1SG9A 3KVWA 3L29A 3RGPA 2DAGA 4LF7M 4LRTA 4X62M 3HONA 3LCVB 2LVPC 4G4OA 4GC5A 4MM3B 3PXGA 4LRSA 5FLXS 3BBZA 4FCWA 4KLNA 4XK8F 3K1JA 4CHTB 4DR2M 4DV5M 2BG1A 2KHHA 3U61B 3FUXA 5IWAM 1OFHA 4G3OA 5FTKA 2DAMA 2LHCA 2OQ4A 4DV2M 2F4VM 3JAMS 2JY6B 1JR3A 3LMMA 2Z3XA 3VDPA 4LGYA 3WD2A 4FW9A 3C9PA 1NY5A 2EKKA 2R65A 2YFQA 4MB4A 2Y21A 8CATA 2Z7JA 2O25A 1IBKM 2O01F 3J7BA 1QVRA 2Y2GA 3HSHA 4LF5M 3GLIE 3UMMA 4REZA 4PCZA 3KXEC 2LXEA 4MH0E 1TH3A 4IJFA 1J7KA 3AV0A 1E8BA 2DZNB 4HL4A 1VG5A 4LCBA 3WD3A 1QZEA 2HKJA 4DR3M 3HKPA 2DZOB 2EKFA 5ITTA 1UM8A 1SXJB 3VLFB 2KRKA 2D7EA 2X8AA 4GH9A 2BWBA 3SHFA 1Z5AA 2QENA 4OJLA 3DZDA 3SHGB 2VIIA 4LGMA 2LVOC 1GOIA 3HU3A 2XF3A 1T43A 3KSJA 4LZJA 1I94M 2XEPA 3UZUA 2VF7A 2JWSA 4NOOB 1QANA 3LVWA 4PDGA 1IBLM 2RGHA 1L6JA 2HCBA 1IN5A 2C98A 2DKLA 4HEOA 1HT2E 4IBFA 3C3EA 2QSFX 4I4LA 4NSOB 5EXTA 5FTNA 3F92A 5JI2E 3DOAA 4B3MM 2QBYA 1G4AE 5ITXA 1VEKA 1W1PA 5IT9S 4FCTA 2FFFB 4LJ4A 3T15A 1QAQA 2B3TA 1JB0F 2OPFA 3K8ZA 3U6MA 2Y20A 3VKHA 2CV2A 2KNVA 2LHGA 1NSFA 5KQ8A 1H0IA 2A5YB 1Z59A 3VK8A 2K47A 1H8PA 4QHSA 4QNMA 5EP3A 1OIPA 3TWLA 4BLCA 2RGOA 3AFHA 1L1ZA 4LFBM 1IXSB 2R62A 2H1RA 4WURA 5ITUA 5BR8M 1IN4A 4MGIE 5ITXE 4JI4M 1XXHB 2EJSA 4HLQA 5KPZA 1MU5A 5EJCA 2XGNA 1PRBA 1VQ1A 4RNAA 4R3DA 3W0FA 4DV1M 1KS0A 1VEGA 2Y2HA 3DA1A 3KOYE 4L15A 2FOIC 1L2DA 4R71A 2R0IA 2XD1A 3HHXA 2JE5A 1EFUB 3KW6A 4X66M 2QBYB 4JYAM 1A5TA 1QYRA 1DGFA 1IY0A 4UN2B 3GLGE 2FE8A 1KSFX 3I4VA 2L7IA 1J7MA 4JXJA 4NZ3A 1E6ZA 4ANRA 3I04M 3DFZA 4LJ9A 1QDTA 2R44A 3GRVA 1IBMM 3M7PA 4M0WA 2D7GA 4B7FA 2DWLA 4Z2HA 4I8OA 3W67A 1OTRA 3GLGA 2C5RA 3FTEA 2CHGA 3I51A 4IBBA 1Z6TA 1ZMUA 2JP7A 2Z4SA 4FWDA 4L4UA 1DGGA 1HNZM 1V33A 2LVQD 2G8LA 3KFUG 3LQQA 2Y2NA 3ZC7B 2ZM6M 1V34A 4NRVA 4OVZA 1D0KA 5KQDA 2LH0A 3AL0C 4NZ4A 2Z8YM 2LVNC 2M60A 3LCUA 3K9PA 3PFIA 4IIWA 1GL6A 4PT5A 1NNUC 2CV0A 1UFZA 4LJ8A 3U6QA 4B3SM 1EE8A 1C1KA 4OX9M 1CXWA 1PJTA 1JQJC 2H5XA 2VQFM 3HX3A 4NC6A 1QQWA 1EAKA 4QNLA 1TH2A 2RRUA 3D8LA 2DAKA 4IBKA 1Q02A 2W82A 3GRRA 4DR4M 1P3QQ 1Z5BA 4D82A 3MJ5A 2HHHM 2FN2A 1ZV1A 1F4IA 1XC8A 3H4JA 1PJIA 2XFTA 4DR1M 1E88A 2X4AA 4L6V6 2JUJA 2CFOA 2LTUA 4XGIA 3RFWA 3N3FA 1GJTA 1XXHE 3FYDA 4AQYM 1E15A 4NZ5A 2L09A 4MGKE 3E4RA 3HU1A 3L26A 1CUKA 2XFSA 3FUUA 3B89A 3WHKA 2Y2PA 1O6IA 2JA2A 4M9SA 4WP2A 3A42A 1IM2A 2XLJA 3AOEC 1KFVA 1OGGA 3GLGB 5DFLA 3CTWB 4GIPA 4XBOA 3U6DA 3KS8A 4IBGA 3J27B 4NXMM 2UUCM 4NZ1A 2KW0A 1KYIA 4AI6A 1L8QA 3HY5A 1YU0A 1QUSA 1NY6A 4GMQA 4AKIA 3SBJA 3VK7A 1HNWM 2G3QA 4B3RM 1GABA 3C58A 1VEJA 4JI8M 3J2PB 5FTJA 2GQFA 4DV6M 2D49A 7CATA 3U6OA 2Y2LA 3I01M 3U60B 3VFDA 1IY2A 1XXHA 1V92A 3QAUA 5F3WA 1WGNA 2P5TA 1AIPC 1PJJA 2F5QA 4JV5M 1K82A 2KZSA 2UXDM 5EP1A 2L4FA 3J7AS 4MB7A 4NYUA 4GC9A 3GLHE 3HHZA 4YY3M 1N34M 3E9SA 1QDRA 2L6OA 5IZ7D 4ZPXA 1E9RA 4JI1M 1ZMWA 2XSZA 1E32A 5JI3E 1SXJD 3HWSA 1QAMA 4BB9A 1N75A 1OFIA 2FFJA 4FWHA 1YU3A 2R6FA 3LVVA 2Y2KA 1L1TA 4BBAA 2UUBM 4OU7A 3B7NA 4GEWA 3TPZA 3U61A 4QOSA 2ZANA 3ILKA 4GITA 2R46A 3J81S 3GLFB 4P17A 1TR8A 3PNYA 1GXDA 4Z2KA 2QP9X 5LMNM 3MK6A 2R45A 2ZBKB 3CF2A 3NBIA 1G71A 4IBJA 1PDCA 4NY2A 2K0BX 2APLA 1Q3CA 2UWXA 1DO2A 3Q8GA 4Z2JA 4CIZA 4LFCM 2R18A 1TTEA 3IHPA 2CHQA 3GLHA 3GRYA 1R5LA 4L16A 4LJ6A 3T6PA 4MB5A 2YNMD 4KT0F 4HMEA 3JR5A 4M0DA 1S3SA 4OJ6A 4Z2IA 1ZMVA 1QO6A 3FUWA 1NV9A 2EUCA 1N77A 3GQ3A 1NV8A 4QHTA 3K2LA 4GHAA 4OJPA 4CISA 1NO1A 2K6BA 2DZLA 5FSWA 3FTDA 4WW0A 2V1UA 3ZQJA 3M6AA 4JI2M 2CP8A 1OIZA 1G59A 1TH4A 2KNZA 2KNAA 3OTOM 5C1BA 1R7RA 1Y8GA 2GNOA 3FTCA 5EXPA 3TWKA 2RTSA 4W5WA 4KO8A 5IREB 1FNNA 1GVNA 4M9ZA 4OUIA 3QYEA 1T3TA 2Y2OA 2Y2MA 2UXBM 2MGWA 3SAWA 1LTMA 1VDLA 3L28A 3B74A 4DBGB 3GLIB 2QHOB 4I81A 2ZTDA 3LQRA 1D2NA 1W5TA 3HHYA 4B3TM 1OQYA 5E26A 1OGBA 1IQPA 1SXJE 2CHVA 3THGA 1E6NA 3EIHA 4HMDA 1GJSA 2KZUA 5DYIA 1J09A 1DGHB 3FYCA 4AZFA 2VDBB 3RE8A 5LMUM 3ZH9B 3T1HM 3SATA 4TX8A 4JN6A 1OAIA 3M0EA 4X65M 2LBCA 3J80S 1YLAA 3PNVA 1HNXM 4OVZB 2DI0A 4ITQA 1LV7A 3AOEA 3KOZE 4S12A 2XZUA 2F5OA 2UU9M 1MN3A 4OW0A 2JY7A 3VDUA 4L78A 4DR7M 1YU4A 1Z5CA 2Y0TA 2ZAMA 3HGIA 3IG5A 4M9XA 4AG6A 2MJ5B 3M7GA 3U5ZA 2CWBA 2CV1A 1D0LA 1WHCA 3SMPA 1SXJC 1WIVA 2XSZD 2QPAA 3W68A 5L8RF 5EXXA 3L25A 2ZAOA 4AW4A 2K9DA 3RGSA 1SXJA 3H4MA 1ZQ9A 3L2AA 4NSRA 3IG8A 3HHWA 1N36M 3E46A 4NXNM 2KDLA 1ORYB 2RKOA 2UUAM 4LG2A 4TUWA 1Q39A 2WSFF 3CGWA 5C18A 4KHPM 1JR3E 3JR4A 1YUBA 4F2LA 1E6RA 2CE7A 3CF0A 1ED7A 2JZ0A 3ZCBB 1DO0A 4JI6M 3HJQA 1HR0M 1X37A 3T1YM 5ITYA 1XB2B 1N33M 1OAOC 4FVMA 1TDZA 2DWZB 2C9CA 4OJ5A 1PJQA 1G8PA 2D7HA 3B9PA 2MROB 3NBXX 1TGUA 2L2DA 1YU2A 3GQ5A 3U6EA 1CK7A 2AHMA 2ERCA 3HZJA 2V6ZM 1W1YA 1WR1B 1D0MA 1R4GA 4RKUF 1IXRC 4IBDA 3SC3A 2BJWA 4DUZM 3B7QA 4X64M 1I4WA 1TDHA 4LJ7A 4OJOA 4GHLA 5EXSA 1E6PA 4LZZA 3FUTA 2M5ZA 1G3IA 2FS1A 2MR9A 3QWLA 5EQTA 5A2QS 1QUTA 4FWGA 3FTFA 1W1TA 2XD5A 4HMCA 4G4RA 2BJVA 3FRIA 2Y2JA 2HL7A 3WD4A 1E9SA 4P16A 3R8FA 3TE6A 4LF6M 4DV0M 3I4YA 2L7HA 1XMQM 2C96A 2FNAA 3U60A 3SYLA 5EP2A 4DV4M 4MGZE 2OOBA 2R4EA 3WD0A 1MJGM 2L4EA 2WSEF 4Z6YA 3EIEA 3KOWE 1FJGM 1PJSA 3KOXE 4AKGA 4CGYB 5ITRA 2I7NA 4RF0A 4L8RC 5ITQA 3KP0E 4FD2A 1H6UA 4QNRA 4LF4M 3FD9A 2QNJA 3SAVA 4AG5A 3SASA 3UJNA 1DV0A 3KDSE 4G6ZA 2NQ8C 2F5SA 3FRHA 4MB3A 4LF9M 2QZ4A 3KSXA 1NJFA 3UGJA 1WXQA 2LWXA 3TQSA 4K0KM 2J5YA 1IXSA 3GLHB 3CF6E 1AIWA 4DUYM 1GKIA 1J5EM 3IECA 2JNHA 1TF0B 1XWIA 2BNKA 2JZ1A 3HJ8A 2YR0A 1YUEA 3D8BA 1DGBA 1RU3A 1UR9A 4CJ6A 2E5LM 1C7YA 2G5GX 4R7GA 1NJGA 1YSYA 2R4JA 2DENA 5EP4A 2YQZA 3FE3A 3TWMA 2J7OA 2C99A 3BOSA 2X49A 4Q7JA 2DNAA 3GLFE 3VKGA 3MMPA 1N78A 2DXIA 1GPFA 2HWJA 3A46A 2JCHA 1K3WA 1PGYA 4MGYE 3GPYA 2QCUA 4IBEA 4Z8XA 3UK6A 3E21A 3WD1A 2V5OA 2JXNA 3LW5F 1VDDA 3KS4A 4DR5M 2LNHC 1YU1A 2J7NA 1T6OA 2HAKA 4II7A 1IFYA 5E6JA 1DGHA 2LVAA 4PDIA 2I7PA 4GKKM 4JI5M 4JI0M 2WSCF 3MQLA 1QZMA 3QYBA 3U6SA 5H37D 2CEAA 1PM5A 3PVSA 1IXZA
chains in the Genus database with same CATH topology
1MX0A 1NVMA 3GPPA 3Q8XA 1JR3D 2Y2QA 3WHLA 4PD2A 4D81A 4LJ5A 1XNRM 3SAUA 4I5SA 4LFAM 3GPXA 3T38A 3U5ZB 4LJAA 4YHHM 3U6CA 4JI3M 1HQYE 5KO3A 3GO8A 1IN8A 4DV7M 1GL7A 1E94E 3SYKA 2UXCM 1R6BX 2Q2EB 2KA6B 4KODA 1HT1E 4LF8M 1G41A 3MHVC 1K3XA 2CUZA 3SARA 1L2BA 2IOUA 2DVWB 2V1CA 4QOZC 2O5RA 4GRIA 4A3VB 3GLIA 1IN7A 3TL4X 2EA0A 3AJIB 3GP1A 5FTLA 3WX7A 1XMOM 2KRUA 3HJSA 1R2ZA 1ZAEA 3GQ4A 1XHBA 2F5PA 3FUVA 4FCVA 4DR6M 3SFZA 3KP1E 2Z4RA 4NRWA 1QAOA 1YE9A 2KXEA 3A98B 1L2CA 4AKHA 4NL4H 3GRUA 4EIWA 2DHRA 4B7GA 5BPVA 4GKJM 1NHGC 4JI7M 2F5NA 1HQCA 1IN6A 2DWMA 2C9OA 3AKZA 1GLNA 2DWNA 3L27A 4IJEA 4RF1A 4DV3M 3A45A 5DNYA 1OJLA 3GPUA 3U6LA 3R9XB 3SMSA 2XH9A 4IBIA 5KPTA 3AOGA 4LY6A 3HU2A 2VQEM 4G4NA 1Q3BA 3U6PA 2Y2IA 5DYGA 3GLFA 1NHWC 5KPRA 4IBCA 1N32M 3W0LB 1W5SA 4D80A 2EO2A 3FKEA 5FTMA 1NNJA 2XZFA 1R2YA 1IY1A 3NWLA 4B7HA 2KEBA 2Y0QA 3K92A 4MGHA 1XNQM 5GKNA 4B08A 4G4QA 3KVWA 3L29A 3RGPA 4LF7M 4LRTA 4X62M 3HONA 4G4OA 4GC5A 4MM3B 3PXGA 4LRSA 5FLXS 4DR2M 4FCWA 4KLNA 3K1JA 4CHTB 4DV5M 2BG1A 3U61B 3FUXA 5IWAM 1OFHA 5FTKA 2OQ4A 4DV2M 2F4VM 3JAMS 1JR3A 3LMMA 2Z3XA 3VDPA 4LGYA 4FW9A 1NY5A 2R65A 2YFQA 2Y21A 8CATA 2Z7JA 1IBKM 3J7BA 1QVRA 2Y2GA 3HSHA 4LF5M 3UMMA 4REZA 4PCZA 3KXEC 2LXEA 4MH0E 1TH3A 4IJFA 1J7KA 3AV0A 2DZNB 4HL4A 4LCBA 2HKJA 4DR3M 3HKPA 2DZOB 5ITTA 1UM8A 1SXJB 3VLFB 2KRKA 2D7EA 2X8AA 4GH9A 3SHFA 4OJLA 1Z5AA 2QENA 3DZDA 3SHGB 2VIIA 4LGMA 3HU3A 2XF3A 3KSJA 4LZJA 1I94M 2XEPA 3UZUA 4NOOB 1QANA 3LVWA 4PDGA 1IBLM 2RGHA 2HCBA 1IN5A 2C98A 5EXTA 1HT2E 4IBFA 4NSOB 4I4LA 5FTNA 5JI2E 4B3MM 3DOAA 2QBYA 1G4AE 5ITXA 5IT9S 4FCTA 2FFFB 4LJ4A 3T15A 1QAQA 2OPFA 3VKHA 3K8ZA 3U6MA 2Y20A 2CV2A 1NSFA 5KQ8A 2A5YB 1Z59A 3VK8A 2K47A 4QHSA 4QNMA 5EP3A 3TWLA 4BLCA 2RGOA 3AFHA 1L1ZA 4LFBM 1IXSB 2R62A 2H1RA 4WURA 5ITUA 5BR8M 1IN4A 4MGIE 5ITXE 4JI4M 1XXHB 4HLQA 5KPZA 1MU5A 5EJCA 2XGNA 4RNAA 3W0FA 4R3DA 4DV1M 2Y2HA 3DA1A 3KOYE 4L15A 2FOIC 1L2DA 2XD1A 3HHXA 2JE5A 3KW6A 4X66M 4JYAM 2QBYB 1QYRA 1DGFA 1IY0A 2FE8A 1KSFX 3I4VA 2L7IA 4JXJA 4NZ3A 3DFZA 4LJ9A 3GRVA 1IBMM 4M0WA 2D7GA 4B7FA 2DWLA 4I8OA 3GLGA 2C5RA 3FTEA 2CHGA 3I51A 4IBBA 1Z6TA 1HNZM 2Z4SA 4L4UA 4FWDA 1DGGA 2G8LA 3KFUG 3LQQA 2Y2NA 3ZC7B 2ZM6M 4NRVA 5KQDA 4OVZA 3AL0C 4NZ4A 2LH0A 2M60A 4PT5A 3PFIA 4IIWA 1GL6A 1NNUC 2CV0A 3U6QA 4LJ8A 4B3SM 1EE8A 1C1KA 4OX9M 1JQJC 2VQFM 1QQWA 4QNLA 1TH2A 3D8LA 4IBKA 2W82A 3GRRA 4DR4M 1Z5BA 4D82A 3MJ5A 2HHHM 1XC8A 1PJIA 2XFTA 4DR1M 2X4AA 3RFWA 2CFOA 4XGIA 3N3FA 3FYDA 4AQYM 4NZ5A 2L09A 4MGKE 3E4RA 3HU1A 3L26A 2XFSA 3FUUA 3WHKA 2Y2PA 2JA2A 4M9SA 3A42A 1IM2A 2XLJA 3AOEC 1KFVA 3GLGB 3CTWB 4GIPA 4XBOA 3U6DA 3KS8A 4IBGA 3J27B 4NXMM 2UUCM 4NZ1A 2KW0A 1KYIA 4AI6A 1L8QA 1YU0A 1NY6A 4GMQA 4AKIA 3SBJA 3VK7A 1HNWM 4B3RM 3C58A 4JI8M 3J2PB 5FTJA 4DV6M 2Y2LA 7CATA 3U6OA 3U60B 3VFDA 1IY2A 1XXHA 3QAUA 5F3WA 1PJJA 2P5TA 2F5QA 4JV5M 1K82A 2KZSA 2UXDM 5EP1A 4NYUA 3J7AS 4MB7A 4GC9A 3HHZA 4YY3M 1N34M 3E9SA 2L6OA 5IZ7D 4ZPXA 1E9RA 4JI1M 2XSZA 1E32A 5JI3E 1SXJD 3HWSA 1QAMA 4BB9A 1N75A 1OFIA 2FFJA 4FWHA 1YU3A 3LVVA 2Y2KA 1L1TA 4BBAA 2UUBM 4OU7A 3TPZA 3U61A 4QOSA 2ZANA 3ILKA 4GITA 2R46A 3J81S 3GLFB 3PNYA 2QP9X 5LMNM 3MK6A 2R45A 2ZBKB 3CF2A 3NBIA 4IBJA 4NY2A 2UWXA 1Q3CA 1DO2A 4LFCM 2R18A 2CHQA 3GLHA 3GRYA 4LJ6A 4L16A 2YNMD 3JR5A 4M0DA 1S3SA 4OJ6A 3FUWA 2EUCA 1N77A 3GQ3A 4QHTA 3K2LA 4GHAA 4OJPA 4CISA 5FSWA 3FTDA 4WW0A 2V1UA 3M6AA 4JI2M 1G59A 1TH4A 3OTOM 5C1BA 1R7RA 3FTCA 3TWKA 5EXPA 4W5WA 4KO8A 5IREB 1FNNA 1GVNA 4M9ZA 4OUIA 1T3TA 2Y2OA 2Y2MA 2UXBM 3SAWA 3L28A 3GLIB 4I81A 3LQRA 1D2NA 1W5TA 3HHYA 4B3TM 5E26A 1IQPA 1SXJE 2CHVA 3THGA 3EIHA 2KZUA 5DYIA 1J09A 1DGHB 3FYCA 4AZFA 3RE8A 5LMUM 3T1HM 3ZH9B 3SATA 4JN6A 3M0EA 4X65M 3J80S 3PNVA 1HNXM 4OVZB 4ITQA 1LV7A 3AOEA 3KOZE 4S12A 2XZUA 2F5OA 2UU9M 4OW0A 3VDUA 4L78A 4DR7M 1YU4A 1Z5CA 2Y0TA 2ZAMA 3HGIA 3IG5A 4M9XA 4AG6A 3M7GA 3U5ZA 2CV1A 3SMPA 1SXJC 2XSZD 2QPAA 3L25A 5EXXA 2ZAOA 4AW4A 3RGSA 1SXJA 3H4MA 1ZQ9A 3L2AA 4NSRA 3IG8A 3HHWA 1N36M 4NXNM 1ORYB 2RKOA 2UUAM 4LG2A 4TUWA 1Q39A 5C18A 4KHPM 3JR4A 1YUBA 2CE7A 3CF0A 3ZCBB 1DO0A 4JI6M 3HJQA 1HR0M 1X37A 3T1YM 5ITYA 1N33M 4FVMA 1TDZA 2DWZB 2C9CA 4OJ5A 1G8PA 2D7HA 3B9PA 1TGUA 1YU2A 3GQ5A 3U6EA 2AHMA 2ERCA 2V6ZM 1IXRC 4IBDA 3SC3A 2BJWA 4DUZM 4X64M 1I4WA 1TDHA 4LJ7A 4OJOA 4GHLA 5EXSA 4LZZA 3FUTA 1G3IA 2M5ZA 5EQTA 5A2QS 3QWLA 3FTFA 4NYYA 4FWGA 2XD5A 4G4RA 2BJVA 2Y2JA 2HL7A 1E9SA 4P16A 3R8FA 3TE6A 4LF6M 4DV0M 3I4YA 2L7HA 1XMQM 2C96A 2FNAA 3U60A 3SYLA 5EP2A 4DV4M 4MGZE 2R4EA 4Z6YA 3EIEA 3KOWE 1FJGM 3KOXE 4AKGA 4CGYB 5ITRA 2I7NA 4RF0A 4L8RC 5ITQA 3KP0E 4FD2A 1H6UA 4QNRA 4LF4M 3FD9A 3SAVA 4AG5A 3SASA 3UJNA 3KDSE 4G6ZA 2NQ8C 2F5SA 4LF9M 2QZ4A 3KSXA 1NJFA 3UGJA 1WXQA 2LWXA 3TQSA 4K0KM 3GLHB 3CF6E 4DUYM 1GKIA 1J5EM 1XWIA 2BNKA 3HJ8A 1YUEA 2YR0A 3D8BA 1DGBA 2E5LM 2G5GX 4R7GA 1NJGA 1YSYA 2R4JA 5EP4A 2YQZA 3TWMA 2J7OA 2C99A 3BOSA 2X49A 3VKGA 1N78A 2DXIA 3A46A 2JCHA 1K3WA 4MGYE 3GPYA 2QCUA 4IBEA 4Z8XA 3UK6A 1VDDA 3KS4A 4DR5M 2LNHC 1YU1A 2J7NA 4II7A 5E6JA 1DGHA 4PDIA 2I7PA 4GKKM 4JI5M 4JI0M 1QZMA 3U6SA 5H37D 2CEAA 1PM5A 3PVSA 1IXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GHA A;  3L2A A;  4IBI A;  4GH9 A;  4GHL A;  4LG2 A;  4IBB A;  4IBC A;  4IBJ A;  3FKE A;  4IBE A;  3L26 A;  5BPV A;  3KS4 A;  4IBF A;  3L29 A;  3L28 A;  3KS8 A;  4IJF A;  4IBG A;  3L27 A;  4IJE A;  4IBK A;  3L25 A;  4IBD A; 
#chains in the Genus database with same CATH topology
 1MX0 A;  1NVM A;  3GPP A;  3Q8X A;  1JR3 D;  2Y2Q A;  1AUA A;  3WHL A;  4PD2 A;  4D81 A;  4F1I A;  4LJ5 A;  1XNR M;  1H0G A;  3SAU A;  3BXW A;  4I5S A;  4LFA M;  3GPX A;  1W1V A;  3T38 A;  3U5Z B;  1WJ7 A;  4LJA A;  4YHH M;  3U6C A;  4JI3 M;  1HQY E;  2OOA A;  3V76 A;  5KO3 A;  3GO8 A;  1IN8 A;  4DV7 M;  1GL7 A;  1E94 E;  4NYY A;  3SYK A;  2UXC M;  1R6B X;  2Q2E B;  2KA6 B;  4KOD A;  1HT1 E;  4LF8 M;  1G41 A;  2ZTC A;  3MHV C;  1K3X A;  2CUZ A;  3SAR A;  1L2B A;  2IOU A;  2DVW B;  2V1C A;  4QOZ C;  2BWE A;  2CRU A;  2O5R A;  4GRI A;  4A3V B;  3GLI A;  1IN7 A;  3TL4 X;  1GO5 A;  2EA0 A;  3AJI B;  3GP1 A;  5FTL A;  3WX7 A;  1BVS A;  1XMO M;  2KRU A;  3HJS A;  1R2Z A;  1ZAE A;  3GQ4 A;  4Z2G A;  1XHB A;  2F5P A;  3FUV A;  4FCV A;  4DR6 M;  3SFZ A;  3KP1 E;  2JY5 A;  2Z4R A;  4NRW A;  2N35 A;  1UR8 A;  1QAO A;  1YE9 A;  2KXE A;  3A98 B;  1WGL A;  2VF8 A;  2DHY A;  1L2C A;  4AKH A;  4NL4 H;  3GRU A;  4EIW A;  2DHR A;  2DAE A;  4B7G A;  5BPV A;  4GKJ M;  1NHG C;  4Z2L A;  2FH0 A;  4JI7 M;  2F5N A;  1HQC A;  1IN6 A;  2DWM A;  2C9O A;  3AKZ A;  2QQ8 A;  2WZJ A;  1OKS A;  2JY8 A;  1GLN A;  2DWN A;  3L27 A;  4IJE A;  4RF1 A;  4DV3 M;  3A45 A;  2DAI A;  5DNY A;  1OJL A;  3GPU A;  3U6L A;  3R9X B;  1EIJ A;  3SMS A;  2XH9 A;  4IBI A;  5KPT A;  3AOG A;  4LY6 A;  3HU2 A;  2VQE M;  4G4N A;  1Q3B A;  3U6P A;  2Y2I A;  5DYG A;  1HJP A;  3GLF A;  1NHW C;  3K9O A;  5KPR A;  4IBC A;  1N32 M;  3W0L B;  1W5S A;  4D80 A;  2EO2 A;  3FKE A;  5FTM A;  1NNJ A;  2XZF A;  3B7Z A;  1R2Y A;  1IY1 A;  3NWL A;  4B7H A;  2KEB A;  2OO9 A;  2Y0Q A;  3K92 A;  4MGH A;  4Y28 F;  1XNQ M;  3C3D A;  5GKN A;  2MH8 A;  4B08 A;  4G4Q A;  1SG9 A;  3KVW A;  3L29 A;  3RGP A;  2DAG A;  4LF7 M;  4LRT A;  4X62 M;  3HON A;  3LCV B;  2LVP C;  4G4O A;  4GC5 A;  4MM3 B;  3PXG A;  4LRS A;  5FLX S;  3BBZ A;  4FCW A;  4KLN A;  4XK8 F;  3K1J A;  4CHT B;  4DR2 M;  4DV5 M;  2BG1 A;  2KHH A;  3U61 B;  3FUX A;  5IWA M;  1OFH A;  4G3O A;  5FTK A;  2DAM A;  2LHC A;  2OQ4 A;  4DV2 M;  2F4V M;  3JAM S;  2JY6 B;  1JR3 A;  3LMM A;  2Z3X A;  3VDP A;  4LGY A;  3WD2 A;  4FW9 A;  3C9P A;  1NY5 A;  2EKK A;  2R65 A;  2YFQ A;  4MB4 A;  2Y21 A;  8CAT A;  2Z7J A;  2O25 A;  1IBK M;  2O01 F;  3J7B A;  1QVR A;  2Y2G A;  3HSH A;  4LF5 M;  3GLI E;  3UMM A;  4REZ A;  4PCZ A;  3KXE C;  2LXE A;  4MH0 E;  1TH3 A;  4IJF A;  1J7K A;  3AV0 A;  1E8B A;  2DZN B;  4HL4 A;  1VG5 A;  4LCB A;  3WD3 A;  1QZE A;  2HKJ A;  4DR3 M;  3HKP A;  2DZO B;  2EKF A;  5ITT A;  1UM8 A;  1SXJ B;  3VLF B;  2KRK A;  2D7E A;  2X8A A;  4GH9 A;  2BWB A;  3SHF A;  1Z5A A;  2QEN A;  4OJL A;  3DZD A;  3SHG B;  2VII A;  4LGM A;  2LVO C;  1GOI A;  3HU3 A;  2XF3 A;  1T43 A;  3KSJ A;  4LZJ A;  1I94 M;  2XEP A;  3UZU A;  2VF7 A;  2JWS A;  4NOO B;  1QAN A;  3LVW A;  4PDG A;  1IBL M;  2RGH A;  1L6J A;  2HCB A;  1IN5 A;  2C98 A;  2DKL A;  4HEO A;  1HT2 E;  4IBF A;  3C3E A;  2QSF X;  4I4L A;  4NSO B;  5EXT A;  5FTN A;  3F92 A;  5JI2 E;  3DOA A;  4B3M M;  2QBY A;  1G4A E;  5ITX A;  1VEK A;  1W1P A;  5IT9 S;  4FCT A;  2FFF B;  4LJ4 A;  3T15 A;  1QAQ A;  2B3T A;  1JB0 F;  2OPF A;  3K8Z A;  3U6M A;  2Y20 A;  3VKH A;  2CV2 A;  2KNV A;  2LHG A;  1NSF A;  5KQ8 A;  1H0I A;  2A5Y B;  1Z59 A;  3VK8 A;  2K47 A;  1H8P A;  4QHS A;  4QNM A;  5EP3 A;  1OIP A;  3TWL A;  4BLC A;  2RGO A;  3AFH A;  1L1Z A;  4LFB M;  1IXS B;  2R62 A;  2H1R A;  4WUR A;  5ITU A;  5BR8 M;  1IN4 A;  4MGI E;  5ITX E;  4JI4 M;  1XXH B;  2EJS A;  4HLQ A;  5KPZ A;  1MU5 A;  5EJC A;  2XGN A;  1PRB A;  1VQ1 A;  4RNA A;  4R3D A;  3W0F A;  4DV1 M;  1KS0 A;  1VEG A;  2Y2H A;  3DA1 A;  3KOY E;  4L15 A;  2FOI C;  1L2D A;  4R71 A;  2R0I A;  2XD1 A;  3HHX A;  2JE5 A;  1EFU B;  3KW6 A;  4X66 M;  2QBY B;  4JYA M;  1A5T A;  1QYR A;  1DGF A;  1IY0 A;  4UN2 B;  3GLG E;  2FE8 A;  1KSF X;  3I4V A;  2L7I A;  1J7M A;  4JXJ A;  4NZ3 A;  1E6Z A;  4ANR A;  3I04 M;  3DFZ A;  4LJ9 A;  1QDT A;  2R44 A;  3GRV A;  1IBM M;  3M7P A;  4M0W A;  2D7G A;  4B7F A;  2DWL A;  4Z2H A;  4I8O A;  3W67 A;  1OTR A;  3GLG A;  2C5R A;  3FTE A;  2CHG A;  3I51 A;  4IBB A;  1Z6T A;  1ZMU A;  2JP7 A;  2Z4S A;  4FWD A;  4L4U A;  1DGG A;  1HNZ M;  1V33 A;  2LVQ D;  2G8L A;  3KFU G;  3LQQ A;  2Y2N A;  3ZC7 B;  2ZM6 M;  1V34 A;  4NRV A;  4OVZ A;  1D0K A;  5KQD A;  2LH0 A;  3AL0 C;  4NZ4 A;  2Z8Y M;  2LVN C;  2M60 A;  3LCU A;  3K9P A;  3PFI A;  4IIW A;  1GL6 A;  4PT5 A;  1NNU C;  2CV0 A;  1UFZ A;  4LJ8 A;  3U6Q A;  4B3S M;  1EE8 A;  1C1K A;  4OX9 M;  1CXW A;  1PJT A;  1JQJ C;  2H5X A;  2VQF M;  3HX3 A;  4NC6 A;  1QQW A;  1EAK A;  4QNL A;  1TH2 A;  2RRU A;  3D8L A;  2DAK A;  4IBK A;  1Q02 A;  2W82 A;  3GRR A;  4DR4 M;  1P3Q Q;  1Z5B A;  4D82 A;  3MJ5 A;  2HHH M;  2FN2 A;  1ZV1 A;  1F4I A;  1XC8 A;  3H4J A;  1PJI A;  2XFT A;  4DR1 M;  1E88 A;  2X4A A;  4L6V 6;  2JUJ A;  2CFO A;  2LTU A;  4XGI A;  3RFW A;  3N3F A;  1GJT A;  1XXH E;  3FYD A;  4AQY M;  1E15 A;  4NZ5 A;  2L09 A;  4MGK E;  3E4R A;  3HU1 A;  3L26 A;  1CUK A;  2XFS A;  3FUU A;  3B89 A;  3WHK A;  2Y2P A;  1O6I A;  2JA2 A;  4M9S A;  4WP2 A;  3A42 A;  1IM2 A;  2XLJ A;  3AOE C;  1KFV A;  1OGG A;  3GLG B;  5DFL A;  3CTW B;  4GIP A;  4XBO A;  3U6D A;  3KS8 A;  4IBG A;  3J27 B;  4NXM M;  2UUC M;  4NZ1 A;  2KW0 A;  1KYI A;  4AI6 A;  1L8Q A;  3HY5 A;  1YU0 A;  1QUS A;  1NY6 A;  4GMQ A;  4AKI A;  3SBJ A;  3VK7 A;  1HNW M;  2G3Q A;  4B3R M;  1GAB A;  3C58 A;  1VEJ A;  4JI8 M;  3J2P B;  5FTJ A;  2GQF A;  4DV6 M;  2D49 A;  7CAT A;  3U6O A;  2Y2L A;  3I01 M;  3U60 B;  3VFD A;  1IY2 A;  1XXH A;  1V92 A;  3QAU A;  5F3W A;  1WGN A;  2P5T A;  1AIP C;  1PJJ A;  2F5Q A;  4JV5 M;  1K82 A;  2KZS A;  2UXD M;  5EP1 A;  2L4F A;  3J7A S;  4MB7 A;  4NYU A;  4GC9 A;  3GLH E;  3HHZ A;  4YY3 M;  1N34 M;  3E9S A;  1QDR A;  2L6O A;  5IZ7 D;  4ZPX A;  1E9R A;  4JI1 M;  1ZMW A;  2XSZ A;  1E32 A;  5JI3 E;  1SXJ D;  3HWS A;  1QAM A;  4BB9 A;  1N75 A;  1OFI A;  2FFJ A;  4FWH A;  1YU3 A;  2R6F A;  3LVV A;  2Y2K A;  1L1T A;  4BBA A;  2UUB M;  4OU7 A;  3B7N A;  4GEW A;  3TPZ A;  3U61 A;  4QOS A;  2ZAN A;  3ILK A;  4GIT A;  2R46 A;  3J81 S;  3GLF B;  4P17 A;  1TR8 A;  3PNY A;  1GXD A;  4Z2K A;  2QP9 X;  5LMN M;  3MK6 A;  2R45 A;  2ZBK B;  3CF2 A;  3NBI A;  1G71 A;  4IBJ A;  1PDC A;  4NY2 A;  2K0B X;  2APL A;  1Q3C A;  2UWX A;  1DO2 A;  3Q8G A;  4Z2J A;  4CIZ A;  4LFC M;  2R18 A;  1TTE A;  3IHP A;  2CHQ A;  3GLH A;  3GRY A;  1R5L A;  4L16 A;  4LJ6 A;  3T6P A;  4MB5 A;  2YNM D;  4KT0 F;  4HME A;  3JR5 A;  4M0D A;  1S3S A;  4OJ6 A;  4Z2I A;  1ZMV A;  1QO6 A;  3FUW A;  1NV9 A;  2EUC A;  1N77 A;  3GQ3 A;  1NV8 A;  4QHT A;  3K2L A;  4GHA A;  4OJP A;  4CIS A;  1NO1 A;  2K6B A;  2DZL A;  5FSW A;  3FTD A;  4WW0 A;  2V1U A;  3ZQJ A;  3M6A A;  4JI2 M;  2CP8 A;  1OIZ A;  1G59 A;  1TH4 A;  2KNZ A;  2KNA A;  3OTO M;  5C1B A;  1R7R A;  1Y8G A;  2GNO A;  3FTC A;  5EXP A;  3TWK A;  2RTS A;  4W5W A;  4KO8 A;  5IRE B;  1FNN A;  1GVN A;  4M9Z A;  4OUI A;  3QYE A;  1T3T A;  2Y2O A;  2Y2M A;  2UXB M;  2MGW A;  3SAW A;  1LTM A;  1VDL A;  3L28 A;  3B74 A;  4DBG B;  3GLI B;  2QHO B;  4I81 A;  2ZTD A;  3LQR A;  1D2N A;  1W5T A;  3HHY A;  4B3T M;  1OQY A;  5E26 A;  1OGB A;  1IQP A;  1SXJ E;  2CHV A;  3THG A;  1E6N A;  3EIH A;  4HMD A;  1GJS A;  2KZU A;  5DYI A;  1J09 A;  1DGH B;  3FYC A;  4AZF A;  2VDB B;  3RE8 A;  5LMU M;  3ZH9 B;  3T1H M;  3SAT A;  4TX8 A;  4JN6 A;  1OAI A;  3M0E A;  4X65 M;  2LBC A;  3J80 S;  1YLA A;  3PNV A;  1HNX M;  4OVZ B;  2DI0 A;  4ITQ A;  1LV7 A;  3AOE A;  3KOZ E;  4S12 A;  2XZU A;  2F5O A;  2UU9 M;  1MN3 A;  4OW0 A;  2JY7 A;  3VDU A;  4L78 A;  4DR7 M;  1YU4 A;  1Z5C A;  2Y0T A;  2ZAM A;  3HGI A;  3IG5 A;  4M9X A;  4AG6 A;  2MJ5 B;  3M7G A;  3U5Z A;  2CWB A;  2CV1 A;  1D0L A;  1WHC A;  3SMP A;  1SXJ C;  1WIV A;  2XSZ D;  2QPA A;  3W68 A;  5L8R F;  5EXX A;  3L25 A;  2ZAO A;  4AW4 A;  2K9D A;  3RGS A;  1SXJ A;  3H4M A;  1ZQ9 A;  3L2A A;  4NSR A;  3IG8 A;  3HHW A;  1N36 M;  3E46 A;  4NXN M;  2KDL A;  1ORY B;  2RKO A;  2UUA M;  4LG2 A;  4TUW A;  1Q39 A;  2WSF F;  3CGW A;  5C18 A;  4KHP M;  1JR3 E;  3JR4 A;  1YUB A;  4F2L A;  1E6R A;  2CE7 A;  3CF0 A;  1ED7 A;  2JZ0 A;  3ZCB B;  1DO0 A;  4JI6 M;  3HJQ A;  1HR0 M;  1X37 A;  3T1Y M;  5ITY A;  1XB2 B;  1N33 M;  1OAO C;  4FVM A;  1TDZ A;  2DWZ B;  2C9C A;  4OJ5 A;  1PJQ A;  1G8P A;  2D7H A;  3B9P A;  2MRO B;  3NBX X;  1TGU A;  2L2D A;  1YU2 A;  3GQ5 A;  3U6E A;  1CK7 A;  2AHM A;  2ERC A;  3HZJ A;  2V6Z M;  1W1Y A;  1WR1 B;  1D0M A;  1R4G A;  4RKU F;  1IXR C;  4IBD A;  3SC3 A;  2BJW A;  4DUZ M;  3B7Q A;  4X64 M;  1I4W A;  1TDH A;  4LJ7 A;  4OJO A;  4GHL A;  5EXS A;  1E6P A;  4LZZ A;  3FUT A;  2M5Z A;  1G3I A;  2FS1 A;  2MR9 A;  3QWL A;  5EQT A;  5A2Q S;  1QUT A;  4FWG A;  3FTF A;  1W1T A;  2XD5 A;  4HMC A;  4G4R A;  2BJV A;  3FRI A;  2Y2J A;  2HL7 A;  3WD4 A;  1E9S A;  4P16 A;  3R8F A;  3TE6 A;  4LF6 M;  4DV0 M;  3I4Y A;  2L7H A;  1XMQ M;  2C96 A;  2FNA A;  3U60 A;  3SYL A;  5EP2 A;  4DV4 M;  4MGZ E;  2OOB A;  2R4E A;  3WD0 A;  1MJG M;  2L4E A;  2WSE F;  4Z6Y A;  3EIE A;  3KOW E;  1FJG M;  1PJS A;  3KOX E;  4AKG A;  4CGY B;  5ITR A;  2I7N A;  4RF0 A;  4L8R C;  5ITQ A;  3KP0 E;  4FD2 A;  1H6U A;  4QNR A;  4LF4 M;  3FD9 A;  2QNJ A;  3SAV A;  4AG5 A;  3SAS A;  3UJN A;  1DV0 A;  3KDS E;  4G6Z A;  2NQ8 C;  2F5S A;  3FRH A;  4MB3 A;  4LF9 M;  2QZ4 A;  3KSX A;  1NJF A;  3UGJ A;  1WXQ A;  2LWX A;  3TQS A;  4K0K M;  2J5Y A;  1IXS A;  3GLH B;  3CF6 E;  1AIW A;  4DUY M;  1GKI A;  1J5E M;  3IEC A;  2JNH A;  1TF0 B;  1XWI A;  2BNK A;  2JZ1 A;  3HJ8 A;  2YR0 A;  1YUE A;  3D8B A;  1DGB A;  1RU3 A;  1UR9 A;  4CJ6 A;  2E5L M;  1C7Y A;  2G5G X;  4R7G A;  1NJG A;  1YSY A;  2R4J A;  2DEN A;  5EP4 A;  2YQZ A;  3FE3 A;  3TWM A;  2J7O A;  2C99 A;  3BOS A;  2X49 A;  4Q7J A;  2DNA A;  3GLF E;  3VKG A;  3MMP A;  1N78 A;  2DXI A;  1GPF A;  2HWJ A;  3A46 A;  2JCH A;  1K3W A;  1PGY A;  4MGY E;  3GPY A;  2QCU A;  4IBE A;  4Z8X A;  3UK6 A;  3E21 A;  3WD1 A;  2V5O A;  2JXN A;  3LW5 F;  1VDD A;  3KS4 A;  4DR5 M;  2LNH C;  1YU1 A;  2J7N A;  1T6O A;  2HAK A;  4II7 A;  1IFY A;  5E6J A;  1DGH A;  2LVA A;  4PDI A;  2I7P A;  4GKK M;  4JI5 M;  4JI0 M;  2WSC F;  3MQL A;  1QZM A;  3QYB A;  3U6S A;  5H37 D;  2CEA A;  1PM5 A;  3PVS A;  1IXZ A; 
#chains in the Genus database with same CATH homology
 1MX0 A;  1NVM A;  3GPP A;  3Q8X A;  1JR3 D;  2Y2Q A;  3WHL A;  4PD2 A;  4D81 A;  4LJ5 A;  1XNR M;  3SAU A;  4I5S A;  4LFA M;  3GPX A;  3T38 A;  3U5Z B;  4LJA A;  4YHH M;  3U6C A;  4JI3 M;  1HQY E;  5KO3 A;  3GO8 A;  1IN8 A;  4DV7 M;  1GL7 A;  1E94 E;  3SYK A;  2UXC M;  1R6B X;  2Q2E B;  2KA6 B;  4KOD A;  1HT1 E;  4LF8 M;  1G41 A;  3MHV C;  1K3X A;  2CUZ A;  3SAR A;  1L2B A;  2IOU A;  2DVW B;  2V1C A;  4QOZ C;  2O5R A;  4GRI A;  4A3V B;  3GLI A;  1IN7 A;  3TL4 X;  2EA0 A;  3AJI B;  3GP1 A;  5FTL A;  3WX7 A;  1XMO M;  2KRU A;  3HJS A;  1R2Z A;  1ZAE A;  3GQ4 A;  1XHB A;  2F5P A;  3FUV A;  4FCV A;  4DR6 M;  3SFZ A;  3KP1 E;  2Z4R A;  4NRW A;  1QAO A;  1YE9 A;  2KXE A;  3A98 B;  1L2C A;  4AKH A;  4NL4 H;  3GRU A;  4EIW A;  2DHR A;  4B7G A;  5BPV A;  4GKJ M;  1NHG C;  4JI7 M;  2F5N A;  1HQC A;  1IN6 A;  2DWM A;  2C9O A;  3AKZ A;  1GLN A;  2DWN A;  3L27 A;  4IJE A;  4RF1 A;  4DV3 M;  3A45 A;  5DNY A;  1OJL A;  3GPU A;  3U6L A;  3R9X B;  3SMS A;  2XH9 A;  4IBI A;  5KPT A;  3AOG A;  4LY6 A;  3HU2 A;  2VQE M;  4G4N A;  1Q3B A;  3U6P A;  2Y2I A;  5DYG A;  3GLF A;  1NHW C;  5KPR A;  4IBC A;  1N32 M;  3W0L B;  1W5S A;  4D80 A;  2EO2 A;  3FKE A;  5FTM A;  1NNJ A;  2XZF A;  1R2Y A;  1IY1 A;  3NWL A;  4B7H A;  2KEB A;  2Y0Q A;  3K92 A;  4MGH A;  1XNQ M;  5GKN A;  4B08 A;  4G4Q A;  3KVW A;  3L29 A;  3RGP A;  4LF7 M;  4LRT A;  4X62 M;  3HON A;  4G4O A;  4GC5 A;  4MM3 B;  3PXG A;  4LRS A;  5FLX S;  4DR2 M;  4FCW A;  4KLN A;  3K1J A;  4CHT B;  4DV5 M;  2BG1 A;  3U61 B;  3FUX A;  5IWA M;  1OFH A;  5FTK A;  2OQ4 A;  4DV2 M;  2F4V M;  3JAM S;  1JR3 A;  3LMM A;  2Z3X A;  3VDP A;  4LGY A;  4FW9 A;  1NY5 A;  2R65 A;  2YFQ A;  2Y21 A;  8CAT A;  2Z7J A;  1IBK M;  3J7B A;  1QVR A;  2Y2G A;  3HSH A;  4LF5 M;  3UMM A;  4REZ A;  4PCZ A;  3KXE C;  2LXE A;  4MH0 E;  1TH3 A;  4IJF A;  1J7K A;  3AV0 A;  2DZN B;  4HL4 A;  4LCB A;  2HKJ A;  4DR3 M;  3HKP A;  2DZO B;  5ITT A;  1UM8 A;  1SXJ B;  3VLF B;  2KRK A;  2D7E A;  2X8A A;  4GH9 A;  3SHF A;  4OJL A;  1Z5A A;  2QEN A;  3DZD A;  3SHG B;  2VII A;  4LGM A;  3HU3 A;  2XF3 A;  3KSJ A;  4LZJ A;  1I94 M;  2XEP A;  3UZU A;  4NOO B;  1QAN A;  3LVW A;  4PDG A;  1IBL M;  2RGH A;  2HCB A;  1IN5 A;  2C98 A;  5EXT A;  1HT2 E;  4IBF A;  4NSO B;  4I4L A;  5FTN A;  5JI2 E;  4B3M M;  3DOA A;  2QBY A;  1G4A E;  5ITX A;  5IT9 S;  4FCT A;  2FFF B;  4LJ4 A;  3T15 A;  1QAQ A;  2OPF A;  3VKH A;  3K8Z A;  3U6M A;  2Y20 A;  2CV2 A;  1NSF A;  5KQ8 A;  2A5Y B;  1Z59 A;  3VK8 A;  2K47 A;  4QHS A;  4QNM A;  5EP3 A;  3TWL A;  4BLC A;  2RGO A;  3AFH A;  1L1Z A;  4LFB M;  1IXS B;  2R62 A;  2H1R A;  4WUR A;  5ITU A;  5BR8 M;  1IN4 A;  4MGI E;  5ITX E;  4JI4 M;  1XXH B;  4HLQ A;  5KPZ A;  1MU5 A;  5EJC A;  2XGN A;  4RNA A;  3W0F A;  4R3D A;  4DV1 M;  2Y2H A;  3DA1 A;  3KOY E;  4L15 A;  2FOI C;  1L2D A;  2XD1 A;  3HHX A;  2JE5 A;  3KW6 A;  4X66 M;  4JYA M;  2QBY B;  1QYR A;  1DGF A;  1IY0 A;  2FE8 A;  1KSF X;  3I4V A;  2L7I A;  4JXJ A;  4NZ3 A;  3DFZ A;  4LJ9 A;  3GRV A;  1IBM M;  4M0W A;  2D7G A;  4B7F A;  2DWL A;  4I8O A;  3GLG A;  2C5R A;  3FTE A;  2CHG A;  3I51 A;  4IBB A;  1Z6T A;  1HNZ M;  2Z4S A;  4L4U A;  4FWD A;  1DGG A;  2G8L A;  3KFU G;  3LQQ A;  2Y2N A;  3ZC7 B;  2ZM6 M;  4NRV A;  5KQD A;  4OVZ A;  3AL0 C;  4NZ4 A;  2LH0 A;  2M60 A;  4PT5 A;  3PFI A;  4IIW A;  1GL6 A;  1NNU C;  2CV0 A;  3U6Q A;  4LJ8 A;  4B3S M;  1EE8 A;  1C1K A;  4OX9 M;  1JQJ C;  2VQF M;  1QQW A;  4QNL A;  1TH2 A;  3D8L A;  4IBK A;  2W82 A;  3GRR A;  4DR4 M;  1Z5B A;  4D82 A;  3MJ5 A;  2HHH M;  1XC8 A;  1PJI A;  2XFT A;  4DR1 M;  2X4A A;  3RFW A;  2CFO A;  4XGI A;  3N3F A;  3FYD A;  4AQY M;  4NZ5 A;  2L09 A;  4MGK E;  3E4R A;  3HU1 A;  3L26 A;  2XFS A;  3FUU A;  3WHK A;  2Y2P A;  2JA2 A;  4M9S A;  3A42 A;  1IM2 A;  2XLJ A;  3AOE C;  1KFV A;  3GLG B;  3CTW B;  4GIP A;  4XBO A;  3U6D A;  3KS8 A;  4IBG A;  3J27 B;  4NXM M;  2UUC M;  4NZ1 A;  2KW0 A;  1KYI A;  4AI6 A;  1L8Q A;  1YU0 A;  1NY6 A;  4GMQ A;  4AKI A;  3SBJ A;  3VK7 A;  1HNW M;  4B3R M;  3C58 A;  4JI8 M;  3J2P B;  5FTJ A;  4DV6 M;  2Y2L A;  7CAT A;  3U6O A;  3U60 B;  3VFD A;  1IY2 A;  1XXH A;  3QAU A;  5F3W A;  1PJJ A;  2P5T A;  2F5Q A;  4JV5 M;  1K82 A;  2KZS A;  2UXD M;  5EP1 A;  4NYU A;  3J7A S;  4MB7 A;  4GC9 A;  3HHZ A;  4YY3 M;  1N34 M;  3E9S A;  2L6O A;  5IZ7 D;  4ZPX A;  1E9R A;  4JI1 M;  2XSZ A;  1E32 A;  5JI3 E;  1SXJ D;  3HWS A;  1QAM A;  4BB9 A;  1N75 A;  1OFI A;  2FFJ A;  4FWH A;  1YU3 A;  3LVV A;  2Y2K A;  1L1T A;  4BBA A;  2UUB M;  4OU7 A;  3TPZ A;  3U61 A;  4QOS A;  2ZAN A;  3ILK A;  4GIT A;  2R46 A;  3J81 S;  3GLF B;  3PNY A;  2QP9 X;  5LMN M;  3MK6 A;  2R45 A;  2ZBK B;  3CF2 A;  3NBI A;  4IBJ A;  4NY2 A;  2UWX A;  1Q3C A;  1DO2 A;  4LFC M;  2R18 A;  2CHQ A;  3GLH A;  3GRY A;  4LJ6 A;  4L16 A;  2YNM D;  3JR5 A;  4M0D A;  1S3S A;  4OJ6 A;  3FUW A;  2EUC A;  1N77 A;  3GQ3 A;  4QHT A;  3K2L A;  4GHA A;  4OJP A;  4CIS A;  5FSW A;  3FTD A;  4WW0 A;  2V1U A;  3M6A A;  4JI2 M;  1G59 A;  1TH4 A;  3OTO M;  5C1B A;  1R7R A;  3FTC A;  3TWK A;  5EXP A;  4W5W A;  4KO8 A;  5IRE B;  1FNN A;  1GVN A;  4M9Z A;  4OUI A;  1T3T A;  2Y2O A;  2Y2M A;  2UXB M;  3SAW A;  3L28 A;  3GLI B;  4I81 A;  3LQR A;  1D2N A;  1W5T A;  3HHY A;  4B3T M;  5E26 A;  1IQP A;  1SXJ E;  2CHV A;  3THG A;  3EIH A;  2KZU A;  5DYI A;  1J09 A;  1DGH B;  3FYC A;  4AZF A;  3RE8 A;  5LMU M;  3T1H M;  3ZH9 B;  3SAT A;  4JN6 A;  3M0E A;  4X65 M;  3J80 S;  3PNV A;  1HNX M;  4OVZ B;  4ITQ A;  1LV7 A;  3AOE A;  3KOZ E;  4S12 A;  2XZU A;  2F5O A;  2UU9 M;  4OW0 A;  3VDU A;  4L78 A;  4DR7 M;  1YU4 A;  1Z5C A;  2Y0T A;  2ZAM A;  3HGI A;  3IG5 A;  4M9X A;  4AG6 A;  3M7G A;  3U5Z A;  2CV1 A;  3SMP A;  1SXJ C;  2XSZ D;  2QPA A;  3L25 A;  5EXX A;  2ZAO A;  4AW4 A;  3RGS A;  1SXJ A;  3H4M A;  1ZQ9 A;  3L2A A;  4NSR A;  3IG8 A;  3HHW A;  1N36 M;  4NXN M;  1ORY B;  2RKO A;  2UUA M;  4LG2 A;  4TUW A;  1Q39 A;  5C18 A;  4KHP M;  3JR4 A;  1YUB A;  2CE7 A;  3CF0 A;  3ZCB B;  1DO0 A;  4JI6 M;  3HJQ A;  1HR0 M;  1X37 A;  3T1Y M;  5ITY A;  1N33 M;  4FVM A;  1TDZ A;  2DWZ B;  2C9C A;  4OJ5 A;  1G8P A;  2D7H A;  3B9P A;  1TGU A;  1YU2 A;  3GQ5 A;  3U6E A;  2AHM A;  2ERC A;  2V6Z M;  1IXR C;  4IBD A;  3SC3 A;  2BJW A;  4DUZ M;  4X64 M;  1I4W A;  1TDH A;  4LJ7 A;  4OJO A;  4GHL A;  5EXS A;  4LZZ A;  3FUT A;  1G3I A;  2M5Z A;  5EQT A;  5A2Q S;  3QWL A;  3FTF A;  4NYY A;  4FWG A;  2XD5 A;  4G4R A;  2BJV A;  2Y2J A;  2HL7 A;  1E9S A;  4P16 A;  3R8F A;  3TE6 A;  4LF6 M;  4DV0 M;  3I4Y A;  2L7H A;  1XMQ M;  2C96 A;  2FNA A;  3U60 A;  3SYL A;  5EP2 A;  4DV4 M;  4MGZ E;  2R4E A;  4Z6Y A;  3EIE A;  3KOW E;  1FJG M;  3KOX E;  4AKG A;  4CGY B;  5ITR A;  2I7N A;  4RF0 A;  4L8R C;  5ITQ A;  3KP0 E;  4FD2 A;  1H6U A;  4QNR A;  4LF4 M;  3FD9 A;  3SAV A;  4AG5 A;  3SAS A;  3UJN A;  3KDS E;  4G6Z A;  2NQ8 C;  2F5S A;  4LF9 M;  2QZ4 A;  3KSX A;  1NJF A;  3UGJ A;  1WXQ A;  2LWX A;  3TQS A;  4K0K M;  3GLH B;  3CF6 E;  4DUY M;  1GKI A;  1J5E M;  1XWI A;  2BNK A;  3HJ8 A;  1YUE A;  2YR0 A;  3D8B A;  1DGB A;  2E5L M;  2G5G X;  4R7G A;  1NJG A;  1YSY A;  2R4J A;  5EP4 A;  2YQZ A;  3TWM A;  2J7O A;  2C99 A;  3BOS A;  2X49 A;  3VKG A;  1N78 A;  2DXI A;  3A46 A;  2JCH A;  1K3W A;  4MGY E;  3GPY A;  2QCU A;  4IBE A;  4Z8X A;  3UK6 A;  1VDD A;  3KS4 A;  4DR5 M;  2LNH C;  1YU1 A;  2J7N A;  4II7 A;  5E6J A;  1DGH A;  4PDI A;  2I7P A;  4GKK M;  4JI5 M;  4JI0 M;  1QZM A;  3U6S A;  5H37 D;  2CEA A;  1PM5 A;  3PVS A;  1IXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...