3L29A

Crystal structure of zaire ebola vp35 interferon inhibitory domain k319a/r322a mutant
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
123
structure length
123
Chain Sequence
DISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPAIDAGWVCVFQLQDGKTLGLKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords Polymerase cofactor VP35
publication title Mutations abrogating VP35 interaction with double-stranded RNA render ebola virus avirulent in guinea pigs.
pubmed doi rcsb
source organism Zaire ebolavirus
total genus 43
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3l29A01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 3l29A02
3FKEA 4IBJA 3L29A 4IBIA 4IBEA 5BPVA 3KS4A 4IBGA 4IBBA 3L28A 3L25A 3L27A 4GHAA 3L2AA 3KS8A 4IJEA 4GH9A 4IBKA 4IBDA 4GHLA 3L26A 4IBFA 4IJFA 4LG2A 4IBCA
chains in the Genus database with same CATH superfamily
4CHTB 1OGGA 4R71A 1R6BX 1IN8A 4K0KM 2F5SA 2J7OA 4P17A 3FTEA 1YU1A 3DFZA 4A3VB 4OUIA 4DR3M 3LCUA 2J5YA 2YNMD 1HT2E 1AUAA 5DFLA 1Z6TA 2D49A 2QENA 3UZUA 2JY6B 4HMDA 4CIZA 1K3XA 3AOEA 2LHGA 3FUTA 2KW0A 2XD5A 1Z5CA 1NSFA 2W82A 1W5TA 2JY8A 2LVPC 3T38A 4X64M 2Y2KA 4M0DA 4PCZA 1PJJA 2QCUA 3AOEC 3GPPA 3WHKA 3M7PA 4TX8A 2VF8A 3I4YA 4D82A 2QBYA 3U6QA 1G71A 3TE6A 1QVRA 4G4OA 3HONA 3CTWB 1NY6A 5LMUM 1E6ZA 1J7MA 4NYYA 1TGUA 2WSEF 2DI0A 4BB9A 5KPTA 1JQJC 2DAGA 2X49A 1E8BA 4DV6M 1ZMUA 1HT1E 3U5ZB 1HR0M 4ITQA 1Z5AA 2DWNA 4FCVA 4KODA 4AKIA 5EP2A 1S3SA 4LJ7A 3LCVB 2DWMA 4II7A 4AW4A 4F1IA 2C9OA 4DV7M 3W0LB 3GQ4A 3FTCA 1WGNA 3K8ZA 4MH0E 2OOBA 2CE7A 2Y2HA 3HU1A 4NY2A 5IZ7D 3ZH9B 1XNRM 2Y2IA 1UFZA 2NQ8C 4NZ4A 2BG1A 2R6FA 4QOZC 4JI7M 1NV8A 3SC3A 4LJAA 2DKLA 4FCTA 2ZTCA 4X62M 2CV0A 4X66M 2RKOA 3UGJA 4WURA 3U61B 4JI1M 2MH8A 2L6OA 4GC5A 4LF7M 4FWGA 5BPVA 1I94M 2QP9X 2YR0A 1E94E 1XB2B 1YSYA 4Z2HA 5L8RF 4I8OA 2WSFF 1OFHA 3BBZA 5ITUA 1IBMM 1MX0A 2LH0A 1C7YA 2EKKA 2CHQA 1PJSA 3K9OA 3E21A 1NHGC 3ZQJA 1N75A 4GHAA 2Y2OA 3DA1A 2JZ1A 3SATA 3WHLA 2VDBB 2LBCA 3M0EA 4IBKA 4GHLA 2R18A 1NY5A 4Z2JA 1OTRA 3U6EA 2QSFX 2F5PA 2XZFA 1P3QQ 1GL7A 2LHCA 4LFAM 2KRUA 2L2DA 5FTNA 1DGFA 1A5TA 1DGHB 1DV0A 1IFYA 2XLJA 3VKGA 1ZQ9A 4OJPA 3AL0C 1Q02A 1QZMA 1VDDA 2MROB 1TR8A 3J80S 5H37D 3ZCBB 2XZUA 1QUTA 3U5ZA 2UXCM 1G41A 1E6PA 3VFDA 1CK7A 4AZFA 4G4RA 2UWXA 2J7NA 1QAOA 4KT0F 1ZV1A 1FJGM 5EP3A 1Q39A 2C99A 4MB7A 4QNMA 4KLNA 4JI8M 4L78A 1LV7A 2XD1A 3JAMS 2LNHC 2Y2QA 4FCWA 3MJ5A 4DR7M 4G3OA 3J27B 3K92A 4OJ5A 2FH0A 3L2AA 2JWSA 2DAMA 1PM5A 2UXBM 1OQYA 3FYDA 3K9PA 3IHPA 4GH9A 1WGLA 4F2LA 1H0GA 2OO9A 1W1VA 4PT5A 3T15A 4LJ9A 1HNWM 2EUCA 5FTLA 2FFJA 3GRVA 5ITRA 4HMCA 3U61A 4NL4H 1L2CA 2QNJA 1YLAA 5GKNA 5EP1A 7CATA 1NNJA 4RF1A 2DXIA 1R2YA 3K1JA 3MQLA 4QNLA 3PXGA 4MB4A 1ORYB 3GLIB 2OPFA 4D80A 2JA2A 3FYCA 2CV2A 2FN2A 3JR4A 2K9DA 1OKSA 2XH9A 3UK6A 1N36M 3EIHA 4RNAA 2Y2PA 4RF0A 3RFWA 1KS0A 1GLNA 4LF8M 2DZNB 2JZ0A 1TH2A 3N3FA 1DO0A 1YU4A 3A98B 4AG6A 4DV0M 5KPZA 4JN6A 3AOGA 2EA0A 3WD0A 1DGHA 1PGYA 2LWXA 4FW9A 4HMEA 3R8FA 3SYKA 1XMQM 3BXWA 3GRYA 4Q7JA 3W67A 1QDRA 3B7QA 3TL4X 4CJ6A 1TTEA 1N78A 3I4VA 2QPAA 3HHZA 1LTMA 1D0KA 3LQRA 3HHYA 2Z4SA 1XMOM 4LF6M 3WD3A 2RGOA 1L8QA 2A5YB 1J7KA 3ILKA 3HGIA 3A46A 4DUZM 2F4VM 1YU2A 4NSOB 1XWIA 1IN5A 2QQ8A 2ZAOA 3LVVA 4JI2M 4LCBA 3EIEA 2Y2JA 3B9PA 2KZUA 1ZAEA 8CATA 1F4IA 1NV9A 4CISA 1IBLM 4DUYM 2L4EA 3UJNA 3GPXA 3GLIE 3FTFA 1D2NA 1AIWA 2CFOA 5ITXE 5ITTA 1DGBA 1NO1A 3CF2A 1XC8A 3DOAA 5A2QS 2I7NA 1XNQM 2KNAA 4PDGA 4B3MM 1WR1B 3IG5A 4I5SA 3FKEA 1NNUC 3SHGB 3GLIA 1O6IA 1GABA 1IN7A 5ITXA 5BR8M 4NRWA 3KS4A 4YY3M 1XHBA 2RTSA 3QYEA 1GXDA 1QDTA 3SMPA 1HJPA 4M9SA 1V34A 2R4EA 3VDUA 1E88A 3RGPA 2Y2GA 1GVNA 2ZAMA 4LF5M 2HAKA 1VQ1A 3TWMA 3GQ3A 4NZ1A 4LJ8A 1T3TA 3KP1E 3HWSA 3KVWA 3L26A 1K3WA 2XF3A 2B3TA 1RU3A 5EXSA 4Z6YA 4OU7A 1GOIA 3FRHA 2JY5A 2CRUA 2Y20A 4JI5M 4M9ZA 2Y2LA 3L29A 1N33M 3C3EA 1K82A 1HQYE 1QZEA 2O25A 2Z7JA 4IBEA 2ZM6M 2DAIA 2Q2EB 5DNYA 4DR1M 3U6OA 3CF0A 1NVMA 2G8LA 2HCBA 1ZMVA 4DV1M 2JNHA 2JY7A 4HLQA 5ITQA 2VIIA 4QHSA 1J09A 3QYBA 2Y0QA 2UUCM 1YU3A 1IM2A 2Z4RA 3TWKA 4AKGA 1E15A 3J7BA 2ERCA 3Q8XA 2I7PA 1NJGA 5LMNM 2CWBA 4GRIA 4B3RM 3FRIA 1H6UA 2DNAA 4G6ZA 4FD2A 2UXDM 1CUKA 1VDLA 2HL7A 2YFQA 1VG5A 4MB3A 1HNXM 2K6BA 1EE8A 3SAVA 1KYIA 2JE5A 1J5EM 3FUVA 3FE3A 1GPFA 1N77A 3FTDA 2KZSA 1UM8A 4GMQA 2OQ4A 3KOXE 1JB0F 3HX3A 1VEKA 4IBIA 3T6PA 1BVSA 3HJSA 1GL6A 2L7HA 3VDPA 2XSZA 1OIPA 2KDLA 4NSRA 4DR4M 4YHHM 5E6JA 3GRUA 4GITA 1VEJA 4B3SM 5C1BA 4X65M 2LVOC 3KP0E 4AG5A 2OOAA 3PFIA 2EJSA 1OAOC 2M60A 1L2BA 4LRSA 3I51A 3KOZE 4LJ4A 3AJIB 3GRRA 4LZJA 4QOSA 4JI6M 4OJLA 2P5TA 2KA6B 1E32A 1W5SA 1MJGM 2FE8A 3L27A 4MGKE 3RE8A 5JI2E 4NXMM 1L1TA 1SXJC 3C58A 3SAUA 3SARA 4JI0M 2DHYA 3AV0A 2R45A 4IJFA 4I81A 1G59A 3GQ5A 5EXPA 4IBCA 4NXNM 2QHOB 1G3IA 3D8LA 4XK8F 1D0LA 1YE9A 2DZOB 4ZPXA 3U6SA 4OJ6A 2DAKA 4B7FA 1Z59A 3J2PB 4TUWA 5F3WA 3SYLA 3AFHA 2FFFB 2XFSA 1EAKA 4NYUA 2GQFA 4AI6A 1QAQA 2CEAA 2WSCF 1VEGA 2CP8A 2HKJA 3VK8A 2V1CA 2K47A 4FVMA 4GKJM 4DR6M 3E4RA 3QWLA 1IXRC 4Z2KA 1HQCA 1JR3E 2LVQD 2VF7A 2CV1A 1XXHB 2ZTDA 2XSZD 3SBJA 2UUAM 2RRUA 2XEPA 4BLCA 1WIVA 3WD4A 3WX7A 1TDHA 1X37A 2XGNA 3TPZA 3FUXA 1JR3A 1SXJD 3RGSA 5KO3A 4L15A 2YQZA 2VQFM 2Z8YM 3U6PA 1DGGA 2V5OA 1E9RA 4DR5M 1OFIA 2D7EA 4WW0A 3HJQA 3FUUA 3C3DA 2R0IA 4JV5M 2CUZA 5IWAM 4OW0A 2G3QA 4HL4A 2ZANA 1L1ZA 4Z2LA 1IXZA 5IT9S 2HWJA 3MK6A 3FD9A 4CGYB 2DWLA 2BWEA 2L7IA 2JXNA 2R4JA 2DENA 2G5GX 4DBGB 4LZZA 4GEWA 2N35A 1IXSB 3E46A 4XBOA 3E9SA 4OJOA 1QYRA 3W68A 3GPYA 1IY1A 3MMPA 4G4QA 1SG9A 3LQQA 3WD1A 1G8PA 3HKPA 3HZJA 1XXHE 1IN6A 2DWZB 3HU2A 1MU5A 1QO6A 5ITYA 5JI3E 3T1YM 2EO2A 3U6MA 1E6RA 3R9XB 2K0BX 4OVZB 1TDZA 4LF9M 4R7GA 3WD2A 4B08A 2X8AA 3KOYE 2DZLA 4OX9M 2H5XA 3UMMA 3PNVA 3GP1A 3PVSA 3CGWA 3I01M 5EXXA 3TQSA 3TWLA 1W1TA 4FWDA 4S12A 3SAWA 3MHVC 2V1UA 2JUJA 2H1RA 4NOOB 1Y8GA 3DZDA 3SHFA 1Q3BA 1XXHA 1N32M 4Z2GA 1L2DA 4GKKM 1GJTA 4L6V6 1JR3D 4B7HA 2MR9A 5KPRA 2HHHM 3KFUG 3L25A 4HEOA 1Z5BA 1SXJB 1Q3CA 2APLA 2C96A 3HHWA 4MGHA 2UU9M 1T43A 3JR5A 2LTUA 1IQPA 1T6OA 3J81S 4JI3M 1PRBA 1GJSA 1YUEA 4LGYA 3U6LA 1EFUB 1HNZM 1OGBA 2L09A 4IIWA 3V76A 1NJFA 3VKHA 3KDSE 4AQYM 2Y2NA 2Y0TA 4MGYE 4W5WA 2MJ5B 3H4MA 3NBXX 3Q8GA 4GIPA 2C98A 1AIPC 2DAEA 2GNOA 4DV5M 2R65A 4LRTA 3B7NA 3I04M 3QAUA 3VLFB 5IREB 1ED7A 4I4LA 4IBGA 2Y21A 5FLXS 1OIZA 2KNZA 2XFTA 4QHTA 1IN4A 3KSJA 4IBBA 2BJWA 4L4UA 1IXSA 3CF6E 5FSWA 3L28A 2MGWA 1TH4A 2FOIC 3M6AA 4LF4M 4M0WA 4PDIA 4NC6A 1W1YA 1FNNA 1WXQA 3B89A 3LVWA 1PDCA 4PD2A 1PJQA 4LJ5A 4IBFA 1YU0A 4NZ3A 1YUBA 1IY2A 3GLHB 1CXWA 1R2ZA 1R7RA 3OTOM 1H8PA 2CHGA 4OVZA 1SXJE 3KW6A 4IBJA 1R4GA 4MM3B 4JYAM 3J7AS 2IOUA 2ZBKB 2KNVA 1TH3A 3U6CA 1IBKM 5FTMA 1GO5A 2M5ZA 4Y28F 3HSHA 1D0MA 5FTJA 3GLFB 1MN3A 5DYIA 3SFZA 1L6JA 2E5LM 3K2LA 4AKHA 3A42A 1UR9A 1W1PA 3HU3A 2DVWB 3NWLA 2LVNC 1NHWC 1QANA 2AHMA 2EKFA 4ANRA 3U6DA 3BOSA 1SXJA 1WHCA 4LJ6A 4FWHA 1DO2A 4NRVA 2Z3XA 3U60B 2F5QA 5E26A 1GKIA 2X4AA 4XGIA 2D7HA 4WP2A 3KS8A 3HY5A 3T1HM 1OAIA 2D7GA 5KQ8A 1E6NA 2C9CA 1QAMA 2JP7A 4JI4M 4G4NA 3GLGB 2KRKA 1V33A 2KHHA 3M7GA 4LFCM 2KEBA 3KOWE 4L16A 3SASA 5KQDA 4LGMA 3FUWA 1WJ7A 5EQTA 4B7GA 3PNYA 4BBAA 3GLHE 2WZJA 1PJTA 2UUBM 3C9PA 4NZ5A 2KXEA 3H4JA 1QUSA 4QNRA 1N34M 3F92A 2BWBA 4JXJA 5EXTA 2QZ4A 2FNAA 4R3DA 3IG8A 1E9SA 5DYGA 3HJ8A 2DHRA 4DV4M 2BJVA 1G4AE 2O01F 2RGHA 4UN2B 2VQEM 5EP4A 4MGIE 2C5RA 3GLFE 3KXEC 3GLHA 4MGZE 4Z2IA 4KO8A 1I4WA 4P16A 3KSXA 4RKUF 1PJIA 2F5OA 2LVAA 3THGA 1IY0A 3LW5F 3W0FA 2Y2MA 2CHVA 1QQWA 4EIWA 5C18A 4REZA 1TF0B 4MB5A 1V92A 2QBYB 4DR2M 3AKZA 4LFBM 3GLFA 4B3TM 1EIJA 2FS1A 2V6ZM 2LXEA 3D8BA 2L4FA 3ZC7B 3GLGE 3SMSA 3HHXA 3B74A 3VK7A 1ZMWA 1C1KA 2F5NA 3B7ZA 3GPUA 4DV2M 3U60A 4GC9A 1OJLA 5FTKA 4KHPM 1KFVA 1KSFX 4L8RC 4M9XA 1UR8A 3LMMA 4IJEA 4Z8XA 1R5LA 4LY6A 3GLGA 5EJCA 4IBDA 2R44A 3NBIA 2BNKA 4D81A 3GO8A 2R46A 4LG2A 1H0IA 2R62A 2JCHA 3IECA 3A45A 2O5RA 4DV3M
chains in the Genus database with same CATH topology
4CHTB 1R6BX 1IN8A 4K0KM 2F5SA 2J7OA 3FTEA 1YU1A 3DFZA 4A3VB 4OUIA 4DR3M 2YNMD 1HT2E 1Z6TA 2QENA 3UZUA 1K3XA 3AOEA 3FUTA 2KW0A 2XD5A 1Z5CA 1NSFA 2W82A 1W5TA 3T38A 4X64M 2Y2KA 4M0DA 4PCZA 1PJJA 2QCUA 3AOEC 3GPPA 3WHKA 3I4YA 4D82A 2QBYA 3U6QA 3TE6A 4G4OA 1QVRA 3HONA 3CTWB 1NY6A 5LMUM 4NYYA 1TGUA 4BB9A 5KPTA 1JQJC 2X49A 4DV6M 4ITQA 1HT1E 3U5ZB 1HR0M 1Z5AA 2DWNA 4FCVA 4KODA 4AKIA 5EP2A 1S3SA 4LJ7A 2DWMA 4II7A 4AW4A 2C9OA 4DV7M 3W0LB 3GQ4A 3FTCA 3K8ZA 4MH0E 4NY2A 2CE7A 2Y2HA 3HU1A 5IZ7D 3ZH9B 1XNRM 2Y2IA 2NQ8C 4NZ4A 2BG1A 4QOZC 4JI7M 3SC3A 4LJAA 4FCTA 4X62M 2CV0A 4X66M 2RKOA 3UGJA 4WURA 3U61B 4JI1M 2L6OA 4GC5A 4LF7M 4FWGA 5BPVA 1I94M 2QP9X 2YR0A 1E94E 1YSYA 4I8OA 1OFHA 5ITUA 1IBMM 1MX0A 2LH0A 2CHQA 1NHGC 1N75A 4GHAA 2Y2OA 3DA1A 3SATA 3WHLA 3M0EA 4IBKA 4GHLA 2R18A 1NY5A 3U6EA 2F5PA 2XZFA 1GL7A 4LFAM 2KRUA 5FTNA 1DGFA 3VKGA 1DGHB 4OJPA 2XLJA 1ZQ9A 3AL0C 1QZMA 1VDDA 3J80S 5H37D 2UXCM 4NYUA 3ZCBB 2XZUA 3U5ZA 1G41A 3VFDA 4AZFA 4G4RA 2UWXA 2J7NA 1QAOA 1FJGM 5EP3A 1Q39A 2C99A 4MB7A 4QNMA 4KLNA 4JI8M 4L78A 1LV7A 2XD1A 3JAMS 2LNHC 2Y2QA 4FCWA 3MJ5A 4DR7M 3J27B 3K92A 4OJ5A 3L2AA 2UXBM 1PM5A 3FYDA 4GH9A 4PT5A 3T15A 4LJ9A 1HNWM 2EUCA 5FTLA 2FFJA 3GRVA 5ITRA 3U61A 4NL4H 1L2CA 5GKNA 5EP1A 7CATA 1NNJA 4RF1A 2DXIA 1R2YA 3K1JA 4QNLA 3PXGA 1ORYB 3GLIB 2OPFA 4D80A 2JA2A 3FYCA 2CV2A 3JR4A 2XH9A 3UK6A 1N36M 3EIHA 4RNAA 2Y2PA 4RF0A 3RFWA 1GLNA 4LF8M 2DZNB 1TH2A 3N3FA 1DO0A 1YU4A 3A98B 4AG6A 4DV0M 5KPZA 4JN6A 3AOGA 2EA0A 1DGHA 2LWXA 4FW9A 3R8FA 3SYKA 1XMQM 3GRYA 3TL4X 1N78A 3I4VA 2QPAA 3HHZA 3LQRA 4LF6M 3HHYA 2Z4SA 1XMOM 2RGOA 1L8QA 2A5YB 1J7KA 3ILKA 3HGIA 3A46A 4DUZM 2F4VM 1YU2A 4NSOB 1XWIA 1IN5A 2ZAOA 3LVVA 4JI2M 4LCBA 3EIEA 2Y2JA 3B9PA 1ZAEA 2KZUA 8CATA 4CISA 1IBLM 4DUYM 3UJNA 3GPXA 3FTFA 1D2NA 2CFOA 5ITXE 5ITTA 1DGBA 3CF2A 1XC8A 3DOAA 5A2QS 2I7NA 1XNQM 4PDGA 4B3MM 3IG5A 4I5SA 3FKEA 1NNUC 3SHGB 3GLIA 1IN7A 5ITXA 5BR8M 4NRWA 3KS4A 4YY3M 1XHBA 3SMPA 4M9SA 2R4EA 3VDUA 3RGPA 2Y2GA 1GVNA 2ZAMA 4LF5M 3TWMA 3GQ3A 4NZ1A 4LJ8A 1T3TA 3KP1E 3HWSA 3KVWA 3L26A 1K3WA 2XF3A 5EXSA 4Z6YA 4OU7A 2Y20A 4JI5M 4M9ZA 2Y2LA 3L29A 1N33M 1K82A 1HQYE 4IBEA 2Z7JA 2ZM6M 2Q2EB 5DNYA 4DR1M 3U6OA 3CF0A 1NVMA 2G8LA 2HCBA 4DV1M 4HLQA 5ITQA 2VIIA 4QHSA 1J09A 2Y0QA 2UUCM 1YU3A 1IM2A 2Z4RA 3TWKA 4AKGA 3J7BA 2ERCA 3Q8XA 2I7PA 1NJGA 5LMNM 4B3RM 4GRIA 1H6UA 4G6ZA 4FD2A 2UXDM 2HL7A 2YFQA 1HNXM 1EE8A 3SAVA 1KYIA 2JE5A 1J5EM 3FUVA 1N77A 3FTDA 2KZSA 1UM8A 4GMQA 2OQ4A 3KOXE 4IBIA 3VDPA 3HJSA 1GL6A 2L7HA 4DR4M 2XSZA 4NSRA 4YHHM 5E6JA 3GRUA 4GITA 4B3SM 5C1BA 4X65M 3KP0E 4AG5A 3PFIA 2M60A 1L2BA 4LRSA 3I51A 3KOZE 4LJ4A 3AJIB 3GRRA 4LZJA 4QOSA 4JI6M 4OJLA 2P5TA 2KA6B 1E32A 1W5SA 2FE8A 3L27A 3RE8A 4MGKE 5JI2E 4NXMM 1L1TA 1SXJC 3C58A 3SAUA 3SARA 4JI0M 3AV0A 2R45A 4IJFA 4I81A 1G59A 3GQ5A 5EXPA 4IBCA 4NXNM 3U6SA 1G3IA 3D8LA 4OJ6A 1YE9A 4ZPXA 2DZOB 4B7FA 1Z59A 3J2PB 4TUWA 5F3WA 3SYLA 3AFHA 2FFFB 2XFSA 4AI6A 1QAQA 2CEAA 2HKJA 3VK8A 2V1CA 2K47A 4FVMA 4GKJM 4DR6M 3E4RA 3QWLA 1IXRC 1HQCA 2CV1A 1XXHB 2XSZD 3SBJA 2UUAM 2XEPA 4BLCA 3WX7A 1TDHA 1X37A 2XGNA 3TPZA 3FUXA 1JR3A 1SXJD 3RGSA 5KO3A 4L15A 2YQZA 2VQFM 3U6PA 1DGGA 1E9RA 4DR5M 1OFIA 2D7EA 4WW0A 3HJQA 3FUUA 4JV5M 2CUZA 5IWAM 4OW0A 4HL4A 2ZANA 1L1ZA 1IXZA 5IT9S 3MK6A 4CGYB 3FD9A 2DWLA 2L7IA 2R4JA 2G5GX 4LZZA 1IXSB 4XBOA 4OJOA 3E9SA 1QYRA 3GPYA 1IY1A 4G4QA 3LQQA 1G8PA 3HKPA 1IN6A 2DWZB 3HU2A 1MU5A 5ITYA 5JI3E 3T1YM 2EO2A 3U6MA 3R9XB 4OVZB 1TDZA 4LF9M 4R7GA 4B08A 2X8AA 3KOYE 4OX9M 3UMMA 3GP1A 3PNVA 3PVSA 5EXXA 3TQSA 3TWLA 4FWDA 4S12A 3SAWA 3MHVC 2V1UA 2H1RA 4NOOB 3SHFA 3DZDA 1N32M 1Q3BA 1XXHA 1L2DA 4GKKM 5KPRA 2HHHM 1JR3D 4B7HA 3KFUG 3L25A 1Z5BA 1SXJB 1Q3CA 2C96A 3HHWA 4MGHA 2UU9M 3JR5A 1IQPA 3J81S 4JI3M 1YUEA 4LGYA 3U6LA 1HNZM 2L09A 4IIWA 3VKHA 1NJFA 3KDSE 4AQYM 2Y2NA 2Y0TA 4MGYE 4W5WA 3H4MA 4GIPA 2C98A 4DV5M 2R65A 4LRTA 3QAUA 3VLFB 5IREB 4I4LA 4IBGA 2Y21A 5FLXS 2XFTA 4QHTA 1IN4A 3KSJA 4IBBA 2BJWA 4L4UA 5FSWA 3CF6E 3L28A 1TH4A 2FOIC 3M6AA 4LF4M 4M0WA 4PDIA 1FNNA 1WXQA 3LVWA 4PD2A 4LJ5A 4IBFA 1YU0A 4NZ3A 1YUBA 1IY2A 3GLHB 1R2ZA 1R7RA 3OTOM 2CHGA 4OVZA 1SXJE 3KW6A 4IBJA 4JYAM 4MM3B 2IOUA 3J7AS 2ZBKB 1TH3A 3U6CA 1IBKM 5FTMA 2M5ZA 3HSHA 5FTJA 3GLFB 5DYIA 3SFZA 2E5LM 3K2LA 4AKHA 3A42A 3HU3A 2DVWB 3NWLA 3U6DA 1NHWC 1QANA 2AHMA 3BOSA 1SXJA 4LJ6A 4FWHA 1DO2A 4NRVA 2Z3XA 3U60B 2F5QA 5E26A 1GKIA 2X4AA 4XGIA 2D7HA 3KS8A 3T1HM 2D7GA 5KQ8A 2C9CA 1QAMA 4JI4M 4G4NA 3GLGB 2KRKA 3M7GA 4LFCM 2KEBA 3KOWE 4L16A 3SASA 5KQDA 4LGMA 3FUWA 5EQTA 4B7GA 4BBAA 3PNYA 2UUBM 4NZ5A 2KXEA 4QNRA 1N34M 4JXJA 5EXTA 2QZ4A 2FNAA 4R3DA 3IG8A 1E9SA 5DYGA 3HJ8A 2DHRA 4DV4M 2BJVA 1G4AE 2RGHA 2VQEM 5EP4A 4MGIE 2C5RA 3KXEC 3GLHA 4MGZE 4KO8A 1I4WA 4P16A 3KSXA 1PJIA 2F5OA 3THGA 2Y2MA 1IY0A 3W0FA 2CHVA 1QQWA 4EIWA 5C18A 4REZA 2QBYB 4DR2M 3AKZA 4LFBM 3GLFA 4B3TM 2V6ZM 2LXEA 3D8BA 3ZC7B 3SMSA 3HHXA 3VK7A 1C1KA 2F5NA 3GPUA 4DV2M 3U60A 4GC9A 1OJLA 5FTKA 4KHPM 1KFVA 1KSFX 4L8RC 4M9XA 3LMMA 4IJEA 4Z8XA 4LY6A 3GLGA 5EJCA 4IBDA 3NBIA 4D81A 2BNKA 3GO8A 4LG2A 2R46A 2R62A 2JCHA 3A45A 2O5RA 4DV3M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FKE A;  4IBJ A;  3L29 A;  4IBI A;  4IBE A;  5BPV A;  3KS4 A;  4IBG A;  4IBB A;  3L28 A;  3L25 A;  3L27 A;  4GHA A;  3L2A A;  3KS8 A;  4IJE A;  4GH9 A;  4IBK A;  4IBD A;  4GHL A;  3L26 A;  4IBF A;  4IJF A;  4LG2 A;  4IBC A; 
#chains in the Genus database with same CATH topology
 4CHT B;  1OGG A;  4R71 A;  1R6B X;  1IN8 A;  4K0K M;  2F5S A;  2J7O A;  4P17 A;  3FTE A;  1YU1 A;  3DFZ A;  4A3V B;  4OUI A;  4DR3 M;  3LCU A;  2J5Y A;  2YNM D;  1HT2 E;  1AUA A;  5DFL A;  1Z6T A;  2D49 A;  2QEN A;  3UZU A;  2JY6 B;  4HMD A;  4CIZ A;  1K3X A;  3AOE A;  2LHG A;  3FUT A;  2KW0 A;  2XD5 A;  1Z5C A;  1NSF A;  2W82 A;  1W5T A;  2JY8 A;  2LVP C;  3T38 A;  4X64 M;  2Y2K A;  4M0D A;  4PCZ A;  1PJJ A;  2QCU A;  3AOE C;  3GPP A;  3WHK A;  3M7P A;  4TX8 A;  2VF8 A;  3I4Y A;  4D82 A;  2QBY A;  3U6Q A;  1G71 A;  3TE6 A;  1QVR A;  4G4O A;  3HON A;  3CTW B;  1NY6 A;  5LMU M;  1E6Z A;  1J7M A;  4NYY A;  1TGU A;  2WSE F;  2DI0 A;  4BB9 A;  5KPT A;  1JQJ C;  2DAG A;  2X49 A;  1E8B A;  4DV6 M;  1ZMU A;  1HT1 E;  3U5Z B;  1HR0 M;  4ITQ A;  1Z5A A;  2DWN A;  4FCV A;  4KOD A;  4AKI A;  5EP2 A;  1S3S A;  4LJ7 A;  3LCV B;  2DWM A;  4II7 A;  4AW4 A;  4F1I A;  2C9O A;  4DV7 M;  3W0L B;  3GQ4 A;  3FTC A;  1WGN A;  3K8Z A;  4MH0 E;  2OOB A;  2CE7 A;  2Y2H A;  3HU1 A;  4NY2 A;  5IZ7 D;  3ZH9 B;  1XNR M;  2Y2I A;  1UFZ A;  2NQ8 C;  4NZ4 A;  2BG1 A;  2R6F A;  4QOZ C;  4JI7 M;  1NV8 A;  3SC3 A;  4LJA A;  2DKL A;  4FCT A;  2ZTC A;  4X62 M;  2CV0 A;  4X66 M;  2RKO A;  3UGJ A;  4WUR A;  3U61 B;  4JI1 M;  2MH8 A;  2L6O A;  4GC5 A;  4LF7 M;  4FWG A;  5BPV A;  1I94 M;  2QP9 X;  2YR0 A;  1E94 E;  1XB2 B;  1YSY A;  4Z2H A;  5L8R F;  4I8O A;  2WSF F;  1OFH A;  3BBZ A;  5ITU A;  1IBM M;  1MX0 A;  2LH0 A;  1C7Y A;  2EKK A;  2CHQ A;  1PJS A;  3K9O A;  3E21 A;  1NHG C;  3ZQJ A;  1N75 A;  4GHA A;  2Y2O A;  3DA1 A;  2JZ1 A;  3SAT A;  3WHL A;  2VDB B;  2LBC A;  3M0E A;  4IBK A;  4GHL A;  2R18 A;  1NY5 A;  4Z2J A;  1OTR A;  3U6E A;  2QSF X;  2F5P A;  2XZF A;  1P3Q Q;  1GL7 A;  2LHC A;  4LFA M;  2KRU A;  2L2D A;  5FTN A;  1DGF A;  1A5T A;  1DGH B;  1DV0 A;  1IFY A;  2XLJ A;  3VKG A;  1ZQ9 A;  4OJP A;  3AL0 C;  1Q02 A;  1QZM A;  1VDD A;  2MRO B;  1TR8 A;  3J80 S;  5H37 D;  3ZCB B;  2XZU A;  1QUT A;  3U5Z A;  2UXC M;  1G41 A;  1E6P A;  3VFD A;  1CK7 A;  4AZF A;  4G4R A;  2UWX A;  2J7N A;  1QAO A;  4KT0 F;  1ZV1 A;  1FJG M;  5EP3 A;  1Q39 A;  2C99 A;  4MB7 A;  4QNM A;  4KLN A;  4JI8 M;  4L78 A;  1LV7 A;  2XD1 A;  3JAM S;  2LNH C;  2Y2Q A;  4FCW A;  3MJ5 A;  4DR7 M;  4G3O A;  3J27 B;  3K92 A;  4OJ5 A;  2FH0 A;  3L2A A;  2JWS A;  2DAM A;  1PM5 A;  2UXB M;  1OQY A;  3FYD A;  3K9P A;  3IHP A;  4GH9 A;  1WGL A;  4F2L A;  1H0G A;  2OO9 A;  1W1V A;  4PT5 A;  3T15 A;  4LJ9 A;  1HNW M;  2EUC A;  5FTL A;  2FFJ A;  3GRV A;  5ITR A;  4HMC A;  3U61 A;  4NL4 H;  1L2C A;  2QNJ A;  1YLA A;  5GKN A;  5EP1 A;  7CAT A;  1NNJ A;  4RF1 A;  2DXI A;  1R2Y A;  3K1J A;  3MQL A;  4QNL A;  3PXG A;  4MB4 A;  1ORY B;  3GLI B;  2OPF A;  4D80 A;  2JA2 A;  3FYC A;  2CV2 A;  2FN2 A;  3JR4 A;  2K9D A;  1OKS A;  2XH9 A;  3UK6 A;  1N36 M;  3EIH A;  4RNA A;  2Y2P A;  4RF0 A;  3RFW A;  1KS0 A;  1GLN A;  4LF8 M;  2DZN B;  2JZ0 A;  1TH2 A;  3N3F A;  1DO0 A;  1YU4 A;  3A98 B;  4AG6 A;  4DV0 M;  5KPZ A;  4JN6 A;  3AOG A;  2EA0 A;  3WD0 A;  1DGH A;  1PGY A;  2LWX A;  4FW9 A;  4HME A;  3R8F A;  3SYK A;  1XMQ M;  3BXW A;  3GRY A;  4Q7J A;  3W67 A;  1QDR A;  3B7Q A;  3TL4 X;  4CJ6 A;  1TTE A;  1N78 A;  3I4V A;  2QPA A;  3HHZ A;  1LTM A;  1D0K A;  3LQR A;  3HHY A;  2Z4S A;  1XMO M;  4LF6 M;  3WD3 A;  2RGO A;  1L8Q A;  2A5Y B;  1J7K A;  3ILK A;  3HGI A;  3A46 A;  4DUZ M;  2F4V M;  1YU2 A;  4NSO B;  1XWI A;  1IN5 A;  2QQ8 A;  2ZAO A;  3LVV A;  4JI2 M;  4LCB A;  3EIE A;  2Y2J A;  3B9P A;  2KZU A;  1ZAE A;  8CAT A;  1F4I A;  1NV9 A;  4CIS A;  1IBL M;  4DUY M;  2L4E A;  3UJN A;  3GPX A;  3GLI E;  3FTF A;  1D2N A;  1AIW A;  2CFO A;  5ITX E;  5ITT A;  1DGB A;  1NO1 A;  3CF2 A;  1XC8 A;  3DOA A;  5A2Q S;  2I7N A;  1XNQ M;  2KNA A;  4PDG A;  4B3M M;  1WR1 B;  3IG5 A;  4I5S A;  3FKE A;  1NNU C;  3SHG B;  3GLI A;  1O6I A;  1GAB A;  1IN7 A;  5ITX A;  5BR8 M;  4NRW A;  3KS4 A;  4YY3 M;  1XHB A;  2RTS A;  3QYE A;  1GXD A;  1QDT A;  3SMP A;  1HJP A;  4M9S A;  1V34 A;  2R4E A;  3VDU A;  1E88 A;  3RGP A;  2Y2G A;  1GVN A;  2ZAM A;  4LF5 M;  2HAK A;  1VQ1 A;  3TWM A;  3GQ3 A;  4NZ1 A;  4LJ8 A;  1T3T A;  3KP1 E;  3HWS A;  3KVW A;  3L26 A;  1K3W A;  2XF3 A;  2B3T A;  1RU3 A;  5EXS A;  4Z6Y A;  4OU7 A;  1GOI A;  3FRH A;  2JY5 A;  2CRU A;  2Y20 A;  4JI5 M;  4M9Z A;  2Y2L A;  3L29 A;  1N33 M;  3C3E A;  1K82 A;  1HQY E;  1QZE A;  2O25 A;  2Z7J A;  4IBE A;  2ZM6 M;  2DAI A;  2Q2E B;  5DNY A;  4DR1 M;  3U6O A;  3CF0 A;  1NVM A;  2G8L A;  2HCB A;  1ZMV A;  4DV1 M;  2JNH A;  2JY7 A;  4HLQ A;  5ITQ A;  2VII A;  4QHS A;  1J09 A;  3QYB A;  2Y0Q A;  2UUC M;  1YU3 A;  1IM2 A;  2Z4R A;  3TWK A;  4AKG A;  1E15 A;  3J7B A;  2ERC A;  3Q8X A;  2I7P A;  1NJG A;  5LMN M;  2CWB A;  4GRI A;  4B3R M;  3FRI A;  1H6U A;  2DNA A;  4G6Z A;  4FD2 A;  2UXD M;  1CUK A;  1VDL A;  2HL7 A;  2YFQ A;  1VG5 A;  4MB3 A;  1HNX M;  2K6B A;  1EE8 A;  3SAV A;  1KYI A;  2JE5 A;  1J5E M;  3FUV A;  3FE3 A;  1GPF A;  1N77 A;  3FTD A;  2KZS A;  1UM8 A;  4GMQ A;  2OQ4 A;  3KOX E;  1JB0 F;  3HX3 A;  1VEK A;  4IBI A;  3T6P A;  1BVS A;  3HJS A;  1GL6 A;  2L7H A;  3VDP A;  2XSZ A;  1OIP A;  2KDL A;  4NSR A;  4DR4 M;  4YHH M;  5E6J A;  3GRU A;  4GIT A;  1VEJ A;  4B3S M;  5C1B A;  4X65 M;  2LVO C;  3KP0 E;  4AG5 A;  2OOA A;  3PFI A;  2EJS A;  1OAO C;  2M60 A;  1L2B A;  4LRS A;  3I51 A;  3KOZ E;  4LJ4 A;  3AJI B;  3GRR A;  4LZJ A;  4QOS A;  4JI6 M;  4OJL A;  2P5T A;  2KA6 B;  1E32 A;  1W5S A;  1MJG M;  2FE8 A;  3L27 A;  4MGK E;  3RE8 A;  5JI2 E;  4NXM M;  1L1T A;  1SXJ C;  3C58 A;  3SAU A;  3SAR A;  4JI0 M;  2DHY A;  3AV0 A;  2R45 A;  4IJF A;  4I81 A;  1G59 A;  3GQ5 A;  5EXP A;  4IBC A;  4NXN M;  2QHO B;  1G3I A;  3D8L A;  4XK8 F;  1D0L A;  1YE9 A;  2DZO B;  4ZPX A;  3U6S A;  4OJ6 A;  2DAK A;  4B7F A;  1Z59 A;  3J2P B;  4TUW A;  5F3W A;  3SYL A;  3AFH A;  2FFF B;  2XFS A;  1EAK A;  4NYU A;  2GQF A;  4AI6 A;  1QAQ A;  2CEA A;  2WSC F;  1VEG A;  2CP8 A;  2HKJ A;  3VK8 A;  2V1C A;  2K47 A;  4FVM A;  4GKJ M;  4DR6 M;  3E4R A;  3QWL A;  1IXR C;  4Z2K A;  1HQC A;  1JR3 E;  2LVQ D;  2VF7 A;  2CV1 A;  1XXH B;  2ZTD A;  2XSZ D;  3SBJ A;  2UUA M;  2RRU A;  2XEP A;  4BLC A;  1WIV A;  3WD4 A;  3WX7 A;  1TDH A;  1X37 A;  2XGN A;  3TPZ A;  3FUX A;  1JR3 A;  1SXJ D;  3RGS A;  5KO3 A;  4L15 A;  2YQZ A;  2VQF M;  2Z8Y M;  3U6P A;  1DGG A;  2V5O A;  1E9R A;  4DR5 M;  1OFI A;  2D7E A;  4WW0 A;  3HJQ A;  3FUU A;  3C3D A;  2R0I A;  4JV5 M;  2CUZ A;  5IWA M;  4OW0 A;  2G3Q A;  4HL4 A;  2ZAN A;  1L1Z A;  4Z2L A;  1IXZ A;  5IT9 S;  2HWJ A;  3MK6 A;  3FD9 A;  4CGY B;  2DWL A;  2BWE A;  2L7I A;  2JXN A;  2R4J A;  2DEN A;  2G5G X;  4DBG B;  4LZZ A;  4GEW A;  2N35 A;  1IXS B;  3E46 A;  4XBO A;  3E9S A;  4OJO A;  1QYR A;  3W68 A;  3GPY A;  1IY1 A;  3MMP A;  4G4Q A;  1SG9 A;  3LQQ A;  3WD1 A;  1G8P A;  3HKP A;  3HZJ A;  1XXH E;  1IN6 A;  2DWZ B;  3HU2 A;  1MU5 A;  1QO6 A;  5ITY A;  5JI3 E;  3T1Y M;  2EO2 A;  3U6M A;  1E6R A;  3R9X B;  2K0B X;  4OVZ B;  1TDZ A;  4LF9 M;  4R7G A;  3WD2 A;  4B08 A;  2X8A A;  3KOY E;  2DZL A;  4OX9 M;  2H5X A;  3UMM A;  3PNV A;  3GP1 A;  3PVS A;  3CGW A;  3I01 M;  5EXX A;  3TQS A;  3TWL A;  1W1T A;  4FWD A;  4S12 A;  3SAW A;  3MHV C;  2V1U A;  2JUJ A;  2H1R A;  4NOO B;  1Y8G A;  3DZD A;  3SHF A;  1Q3B A;  1XXH A;  1N32 M;  4Z2G A;  1L2D A;  4GKK M;  1GJT A;  4L6V 6;  1JR3 D;  4B7H A;  2MR9 A;  5KPR A;  2HHH M;  3KFU G;  3L25 A;  4HEO A;  1Z5B A;  1SXJ B;  1Q3C A;  2APL A;  2C96 A;  3HHW A;  4MGH A;  2UU9 M;  1T43 A;  3JR5 A;  2LTU A;  1IQP A;  1T6O A;  3J81 S;  4JI3 M;  1PRB A;  1GJS A;  1YUE A;  4LGY A;  3U6L A;  1EFU B;  1HNZ M;  1OGB A;  2L09 A;  4IIW A;  3V76 A;  1NJF A;  3VKH A;  3KDS E;  4AQY M;  2Y2N A;  2Y0T A;  4MGY E;  4W5W A;  2MJ5 B;  3H4M A;  3NBX X;  3Q8G A;  4GIP A;  2C98 A;  1AIP C;  2DAE A;  2GNO A;  4DV5 M;  2R65 A;  4LRT A;  3B7N A;  3I04 M;  3QAU A;  3VLF B;  5IRE B;  1ED7 A;  4I4L A;  4IBG A;  2Y21 A;  5FLX S;  1OIZ A;  2KNZ A;  2XFT A;  4QHT A;  1IN4 A;  3KSJ A;  4IBB A;  2BJW A;  4L4U A;  1IXS A;  3CF6 E;  5FSW A;  3L28 A;  2MGW A;  1TH4 A;  2FOI C;  3M6A A;  4LF4 M;  4M0W A;  4PDI A;  4NC6 A;  1W1Y A;  1FNN A;  1WXQ A;  3B89 A;  3LVW A;  1PDC A;  4PD2 A;  1PJQ A;  4LJ5 A;  4IBF A;  1YU0 A;  4NZ3 A;  1YUB A;  1IY2 A;  3GLH B;  1CXW A;  1R2Z A;  1R7R A;  3OTO M;  1H8P A;  2CHG A;  4OVZ A;  1SXJ E;  3KW6 A;  4IBJ A;  1R4G A;  4MM3 B;  4JYA M;  3J7A S;  2IOU A;  2ZBK B;  2KNV A;  1TH3 A;  3U6C A;  1IBK M;  5FTM A;  1GO5 A;  2M5Z A;  4Y28 F;  3HSH A;  1D0M A;  5FTJ A;  3GLF B;  1MN3 A;  5DYI A;  3SFZ A;  1L6J A;  2E5L M;  3K2L A;  4AKH A;  3A42 A;  1UR9 A;  1W1P A;  3HU3 A;  2DVW B;  3NWL A;  2LVN C;  1NHW C;  1QAN A;  2AHM A;  2EKF A;  4ANR A;  3U6D A;  3BOS A;  1SXJ A;  1WHC A;  4LJ6 A;  4FWH A;  1DO2 A;  4NRV A;  2Z3X A;  3U60 B;  2F5Q A;  5E26 A;  1GKI A;  2X4A A;  4XGI A;  2D7H A;  4WP2 A;  3KS8 A;  3HY5 A;  3T1H M;  1OAI A;  2D7G A;  5KQ8 A;  1E6N A;  2C9C A;  1QAM A;  2JP7 A;  4JI4 M;  4G4N A;  3GLG B;  2KRK A;  1V33 A;  2KHH A;  3M7G A;  4LFC M;  2KEB A;  3KOW E;  4L16 A;  3SAS A;  5KQD A;  4LGM A;  3FUW A;  1WJ7 A;  5EQT A;  4B7G A;  3PNY A;  4BBA A;  3GLH E;  2WZJ A;  1PJT A;  2UUB M;  3C9P A;  4NZ5 A;  2KXE A;  3H4J A;  1QUS A;  4QNR A;  1N34 M;  3F92 A;  2BWB A;  4JXJ A;  5EXT A;  2QZ4 A;  2FNA A;  4R3D A;  3IG8 A;  1E9S A;  5DYG A;  3HJ8 A;  2DHR A;  4DV4 M;  2BJV A;  1G4A E;  2O01 F;  2RGH A;  4UN2 B;  2VQE M;  5EP4 A;  4MGI E;  2C5R A;  3GLF E;  3KXE C;  3GLH A;  4MGZ E;  4Z2I A;  4KO8 A;  1I4W A;  4P16 A;  3KSX A;  4RKU F;  1PJI A;  2F5O A;  2LVA A;  3THG A;  1IY0 A;  3LW5 F;  3W0F A;  2Y2M A;  2CHV A;  1QQW A;  4EIW A;  5C18 A;  4REZ A;  1TF0 B;  4MB5 A;  1V92 A;  2QBY B;  4DR2 M;  3AKZ A;  4LFB M;  3GLF A;  4B3T M;  1EIJ A;  2FS1 A;  2V6Z M;  2LXE A;  3D8B A;  2L4F A;  3ZC7 B;  3GLG E;  3SMS A;  3HHX A;  3B74 A;  3VK7 A;  1ZMW A;  1C1K A;  2F5N A;  3B7Z A;  3GPU A;  4DV2 M;  3U60 A;  4GC9 A;  1OJL A;  5FTK A;  4KHP M;  1KFV A;  1KSF X;  4L8R C;  4M9X A;  1UR8 A;  3LMM A;  4IJE A;  4Z8X A;  1R5L A;  4LY6 A;  3GLG A;  5EJC A;  4IBD A;  2R44 A;  3NBI A;  2BNK A;  4D81 A;  3GO8 A;  2R46 A;  4LG2 A;  1H0I A;  2R62 A;  2JCH A;  3IEC A;  3A45 A;  2O5R A;  4DV3 M; 
#chains in the Genus database with same CATH homology
 4CHT B;  1R6B X;  1IN8 A;  4K0K M;  2F5S A;  2J7O A;  3FTE A;  1YU1 A;  3DFZ A;  4A3V B;  4OUI A;  4DR3 M;  2YNM D;  1HT2 E;  1Z6T A;  2QEN A;  3UZU A;  1K3X A;  3AOE A;  3FUT A;  2KW0 A;  2XD5 A;  1Z5C A;  1NSF A;  2W82 A;  1W5T A;  3T38 A;  4X64 M;  2Y2K A;  4M0D A;  4PCZ A;  1PJJ A;  2QCU A;  3AOE C;  3GPP A;  3WHK A;  3I4Y A;  4D82 A;  2QBY A;  3U6Q A;  3TE6 A;  4G4O A;  1QVR A;  3HON A;  3CTW B;  1NY6 A;  5LMU M;  4NYY A;  1TGU A;  4BB9 A;  5KPT A;  1JQJ C;  2X49 A;  4DV6 M;  4ITQ A;  1HT1 E;  3U5Z B;  1HR0 M;  1Z5A A;  2DWN A;  4FCV A;  4KOD A;  4AKI A;  5EP2 A;  1S3S A;  4LJ7 A;  2DWM A;  4II7 A;  4AW4 A;  2C9O A;  4DV7 M;  3W0L B;  3GQ4 A;  3FTC A;  3K8Z A;  4MH0 E;  4NY2 A;  2CE7 A;  2Y2H A;  3HU1 A;  5IZ7 D;  3ZH9 B;  1XNR M;  2Y2I A;  2NQ8 C;  4NZ4 A;  2BG1 A;  4QOZ C;  4JI7 M;  3SC3 A;  4LJA A;  4FCT A;  4X62 M;  2CV0 A;  4X66 M;  2RKO A;  3UGJ A;  4WUR A;  3U61 B;  4JI1 M;  2L6O A;  4GC5 A;  4LF7 M;  4FWG A;  5BPV A;  1I94 M;  2QP9 X;  2YR0 A;  1E94 E;  1YSY A;  4I8O A;  1OFH A;  5ITU A;  1IBM M;  1MX0 A;  2LH0 A;  2CHQ A;  1NHG C;  1N75 A;  4GHA A;  2Y2O A;  3DA1 A;  3SAT A;  3WHL A;  3M0E A;  4IBK A;  4GHL A;  2R18 A;  1NY5 A;  3U6E A;  2F5P A;  2XZF A;  1GL7 A;  4LFA M;  2KRU A;  5FTN A;  1DGF A;  3VKG A;  1DGH B;  4OJP A;  2XLJ A;  1ZQ9 A;  3AL0 C;  1QZM A;  1VDD A;  3J80 S;  5H37 D;  2UXC M;  4NYU A;  3ZCB B;  2XZU A;  3U5Z A;  1G41 A;  3VFD A;  4AZF A;  4G4R A;  2UWX A;  2J7N A;  1QAO A;  1FJG M;  5EP3 A;  1Q39 A;  2C99 A;  4MB7 A;  4QNM A;  4KLN A;  4JI8 M;  4L78 A;  1LV7 A;  2XD1 A;  3JAM S;  2LNH C;  2Y2Q A;  4FCW A;  3MJ5 A;  4DR7 M;  3J27 B;  3K92 A;  4OJ5 A;  3L2A A;  2UXB M;  1PM5 A;  3FYD A;  4GH9 A;  4PT5 A;  3T15 A;  4LJ9 A;  1HNW M;  2EUC A;  5FTL A;  2FFJ A;  3GRV A;  5ITR A;  3U61 A;  4NL4 H;  1L2C A;  5GKN A;  5EP1 A;  7CAT A;  1NNJ A;  4RF1 A;  2DXI A;  1R2Y A;  3K1J A;  4QNL A;  3PXG A;  1ORY B;  3GLI B;  2OPF A;  4D80 A;  2JA2 A;  3FYC A;  2CV2 A;  3JR4 A;  2XH9 A;  3UK6 A;  1N36 M;  3EIH A;  4RNA A;  2Y2P A;  4RF0 A;  3RFW A;  1GLN A;  4LF8 M;  2DZN B;  1TH2 A;  3N3F A;  1DO0 A;  1YU4 A;  3A98 B;  4AG6 A;  4DV0 M;  5KPZ A;  4JN6 A;  3AOG A;  2EA0 A;  1DGH A;  2LWX A;  4FW9 A;  3R8F A;  3SYK A;  1XMQ M;  3GRY A;  3TL4 X;  1N78 A;  3I4V A;  2QPA A;  3HHZ A;  3LQR A;  4LF6 M;  3HHY A;  2Z4S A;  1XMO M;  2RGO A;  1L8Q A;  2A5Y B;  1J7K A;  3ILK A;  3HGI A;  3A46 A;  4DUZ M;  2F4V M;  1YU2 A;  4NSO B;  1XWI A;  1IN5 A;  2ZAO A;  3LVV A;  4JI2 M;  4LCB A;  3EIE A;  2Y2J A;  3B9P A;  1ZAE A;  2KZU A;  8CAT A;  4CIS A;  1IBL M;  4DUY M;  3UJN A;  3GPX A;  3FTF A;  1D2N A;  2CFO A;  5ITX E;  5ITT A;  1DGB A;  3CF2 A;  1XC8 A;  3DOA A;  5A2Q S;  2I7N A;  1XNQ M;  4PDG A;  4B3M M;  3IG5 A;  4I5S A;  3FKE A;  1NNU C;  3SHG B;  3GLI A;  1IN7 A;  5ITX A;  5BR8 M;  4NRW A;  3KS4 A;  4YY3 M;  1XHB A;  3SMP A;  4M9S A;  2R4E A;  3VDU A;  3RGP A;  2Y2G A;  1GVN A;  2ZAM A;  4LF5 M;  3TWM A;  3GQ3 A;  4NZ1 A;  4LJ8 A;  1T3T A;  3KP1 E;  3HWS A;  3KVW A;  3L26 A;  1K3W A;  2XF3 A;  5EXS A;  4Z6Y A;  4OU7 A;  2Y20 A;  4JI5 M;  4M9Z A;  2Y2L A;  3L29 A;  1N33 M;  1K82 A;  1HQY E;  4IBE A;  2Z7J A;  2ZM6 M;  2Q2E B;  5DNY A;  4DR1 M;  3U6O A;  3CF0 A;  1NVM A;  2G8L A;  2HCB A;  4DV1 M;  4HLQ A;  5ITQ A;  2VII A;  4QHS A;  1J09 A;  2Y0Q A;  2UUC M;  1YU3 A;  1IM2 A;  2Z4R A;  3TWK A;  4AKG A;  3J7B A;  2ERC A;  3Q8X A;  2I7P A;  1NJG A;  5LMN M;  4B3R M;  4GRI A;  1H6U A;  4G6Z A;  4FD2 A;  2UXD M;  2HL7 A;  2YFQ A;  1HNX M;  1EE8 A;  3SAV A;  1KYI A;  2JE5 A;  1J5E M;  3FUV A;  1N77 A;  3FTD A;  2KZS A;  1UM8 A;  4GMQ A;  2OQ4 A;  3KOX E;  4IBI A;  3VDP A;  3HJS A;  1GL6 A;  2L7H A;  4DR4 M;  2XSZ A;  4NSR A;  4YHH M;  5E6J A;  3GRU A;  4GIT A;  4B3S M;  5C1B A;  4X65 M;  3KP0 E;  4AG5 A;  3PFI A;  2M60 A;  1L2B A;  4LRS A;  3I51 A;  3KOZ E;  4LJ4 A;  3AJI B;  3GRR A;  4LZJ A;  4QOS A;  4JI6 M;  4OJL A;  2P5T A;  2KA6 B;  1E32 A;  1W5S A;  2FE8 A;  3L27 A;  3RE8 A;  4MGK E;  5JI2 E;  4NXM M;  1L1T A;  1SXJ C;  3C58 A;  3SAU A;  3SAR A;  4JI0 M;  3AV0 A;  2R45 A;  4IJF A;  4I81 A;  1G59 A;  3GQ5 A;  5EXP A;  4IBC A;  4NXN M;  3U6S A;  1G3I A;  3D8L A;  4OJ6 A;  1YE9 A;  4ZPX A;  2DZO B;  4B7F A;  1Z59 A;  3J2P B;  4TUW A;  5F3W A;  3SYL A;  3AFH A;  2FFF B;  2XFS A;  4AI6 A;  1QAQ A;  2CEA A;  2HKJ A;  3VK8 A;  2V1C A;  2K47 A;  4FVM A;  4GKJ M;  4DR6 M;  3E4R A;  3QWL A;  1IXR C;  1HQC A;  2CV1 A;  1XXH B;  2XSZ D;  3SBJ A;  2UUA M;  2XEP A;  4BLC A;  3WX7 A;  1TDH A;  1X37 A;  2XGN A;  3TPZ A;  3FUX A;  1JR3 A;  1SXJ D;  3RGS A;  5KO3 A;  4L15 A;  2YQZ A;  2VQF M;  3U6P A;  1DGG A;  1E9R A;  4DR5 M;  1OFI A;  2D7E A;  4WW0 A;  3HJQ A;  3FUU A;  4JV5 M;  2CUZ A;  5IWA M;  4OW0 A;  4HL4 A;  2ZAN A;  1L1Z A;  1IXZ A;  5IT9 S;  3MK6 A;  4CGY B;  3FD9 A;  2DWL A;  2L7I A;  2R4J A;  2G5G X;  4LZZ A;  1IXS B;  4XBO A;  4OJO A;  3E9S A;  1QYR A;  3GPY A;  1IY1 A;  4G4Q A;  3LQQ A;  1G8P A;  3HKP A;  1IN6 A;  2DWZ B;  3HU2 A;  1MU5 A;  5ITY A;  5JI3 E;  3T1Y M;  2EO2 A;  3U6M A;  3R9X B;  4OVZ B;  1TDZ A;  4LF9 M;  4R7G A;  4B08 A;  2X8A A;  3KOY E;  4OX9 M;  3UMM A;  3GP1 A;  3PNV A;  3PVS A;  5EXX A;  3TQS A;  3TWL A;  4FWD A;  4S12 A;  3SAW A;  3MHV C;  2V1U A;  2H1R A;  4NOO B;  3SHF A;  3DZD A;  1N32 M;  1Q3B A;  1XXH A;  1L2D A;  4GKK M;  5KPR A;  2HHH M;  1JR3 D;  4B7H A;  3KFU G;  3L25 A;  1Z5B A;  1SXJ B;  1Q3C A;  2C96 A;  3HHW A;  4MGH A;  2UU9 M;  3JR5 A;  1IQP A;  3J81 S;  4JI3 M;  1YUE A;  4LGY A;  3U6L A;  1HNZ M;  2L09 A;  4IIW A;  3VKH A;  1NJF A;  3KDS E;  4AQY M;  2Y2N A;  2Y0T A;  4MGY E;  4W5W A;  3H4M A;  4GIP A;  2C98 A;  4DV5 M;  2R65 A;  4LRT A;  3QAU A;  3VLF B;  5IRE B;  4I4L A;  4IBG A;  2Y21 A;  5FLX S;  2XFT A;  4QHT A;  1IN4 A;  3KSJ A;  4IBB A;  2BJW A;  4L4U A;  5FSW A;  3CF6 E;  3L28 A;  1TH4 A;  2FOI C;  3M6A A;  4LF4 M;  4M0W A;  4PDI A;  1FNN A;  1WXQ A;  3LVW A;  4PD2 A;  4LJ5 A;  4IBF A;  1YU0 A;  4NZ3 A;  1YUB A;  1IY2 A;  3GLH B;  1R2Z A;  1R7R A;  3OTO M;  2CHG A;  4OVZ A;  1SXJ E;  3KW6 A;  4IBJ A;  4JYA M;  4MM3 B;  2IOU A;  3J7A S;  2ZBK B;  1TH3 A;  3U6C A;  1IBK M;  5FTM A;  2M5Z A;  3HSH A;  5FTJ A;  3GLF B;  5DYI A;  3SFZ A;  2E5L M;  3K2L A;  4AKH A;  3A42 A;  3HU3 A;  2DVW B;  3NWL A;  3U6D A;  1NHW C;  1QAN A;  2AHM A;  3BOS A;  1SXJ A;  4LJ6 A;  4FWH A;  1DO2 A;  4NRV A;  2Z3X A;  3U60 B;  2F5Q A;  5E26 A;  1GKI A;  2X4A A;  4XGI A;  2D7H A;  3KS8 A;  3T1H M;  2D7G A;  5KQ8 A;  2C9C A;  1QAM A;  4JI4 M;  4G4N A;  3GLG B;  2KRK A;  3M7G A;  4LFC M;  2KEB A;  3KOW E;  4L16 A;  3SAS A;  5KQD A;  4LGM A;  3FUW A;  5EQT A;  4B7G A;  4BBA A;  3PNY A;  2UUB M;  4NZ5 A;  2KXE A;  4QNR A;  1N34 M;  4JXJ A;  5EXT A;  2QZ4 A;  2FNA A;  4R3D A;  3IG8 A;  1E9S A;  5DYG A;  3HJ8 A;  2DHR A;  4DV4 M;  2BJV A;  1G4A E;  2RGH A;  2VQE M;  5EP4 A;  4MGI E;  2C5R A;  3KXE C;  3GLH A;  4MGZ E;  4KO8 A;  1I4W A;  4P16 A;  3KSX A;  1PJI A;  2F5O A;  3THG A;  2Y2M A;  1IY0 A;  3W0F A;  2CHV A;  1QQW A;  4EIW A;  5C18 A;  4REZ A;  2QBY B;  4DR2 M;  3AKZ A;  4LFB M;  3GLF A;  4B3T M;  2V6Z M;  2LXE A;  3D8B A;  3ZC7 B;  3SMS A;  3HHX A;  3VK7 A;  1C1K A;  2F5N A;  3GPU A;  4DV2 M;  3U60 A;  4GC9 A;  1OJL A;  5FTK A;  4KHP M;  1KFV A;  1KSF X;  4L8R C;  4M9X A;  3LMM A;  4IJE A;  4Z8X A;  4LY6 A;  3GLG A;  5EJC A;  4IBD A;  3NBI A;  4D81 A;  2BNK A;  3GO8 A;  4LG2 A;  2R46 A;  2R62 A;  2JCH A;  3A45 A;  2O5R A;  4DV3 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...