3L29A

Crystal structure of zaire ebola vp35 interferon inhibitory domain k319a/r322a mutant
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
123
structure length
123
Chain Sequence
b'DISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPAIDAGWVCVFQLQDGKTLGLKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polymerase cofactor VP35
publication title Mutations abrogating VP35 interaction with double-stranded RNA render ebola virus avirulent in guinea pigs.
pubmed doi rcsb
source organism Zaire ebolavirus
molecule tags Rna binding protein
total genus 43
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3l29A01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 3l29A02
5BPVA 3L28A 3L25A 4IBCA 4GHAA 4IBBA 3KS8A 4LG2A 4GHLA 4IBJA 4IBGA 4IBDA 4IBIA 4IJEA 4IJFA 3KS4A 3L2AA 4IBFA 4IBEA 3L27A 3L29A 3FKEA 4IBKA 4GH9A 3L26A
chains in the Genus database with same CATH superfamily
1E6RA 1AUAA 1OGGA 1IM2A 4UN2B 4NSOB 3TWLA 2EKFA 2F4VM 3WD4A 1YSYA 3HY5A 1V92A 4LRSA 4LF7M 2KW0A 4DV5M 4G4RA 4GEWA 4LG2A 4TX8A 1T3TA 1QANA 4Z6YA 2JA2A 1JR3D 4XBOA 2R4JA 4MGKE 4PDGA 4AZFA 3J81S 1PGYA 2ZAMA 3JR5A 4DV1M 3C3DA 4FW9A 3SC3A 1X37A 4HMCA 3WX7A 4AKIA 2Y2HA 3U6SA 2DVWB 1XXHB 1R2ZA 2QNJA 1IN8A 2O5RA 4QOZC 1NJGA 4JI7M 4LCBA 4R7GA 2ZTDA 2BJVA 4B7FA 1RU3A 1YUEA 1CXWA 1HNZM 1XNRM 3RFWA 2J7OA 3GLIB 3KP0E 4DR4M 2C98A 1IXSB 5EP4A 4DBGB 4F2LA 2XD1A 4MH0E 1UR8A 1GLNA 3GLIE 2DI0A 1MJGM 2L2DA 3LQRA 3PVSA 3GLFB 1L2DA 1D0KA 5ITXE 2Y2PA 3QYBA 2CRUA 3T15A 1L6JA 2JY5A 4DUYM 4DR2M 3GLFE 1I94M 4LJ6A 4HMDA 1L2BA 3FUTA 1NHGC 3HHYA 1SXJE 1MU5A 3CF0A 1EIJA 3K9OA 2LBCA 3GLGE 3VDUA 3UZUA 1L8QA 1HJPA 3EIEA 4WURA 5FTLA 2CHQA 1OKSA 2GNOA 4B3MM 3KFUG 1VQ1A 2L7IA 1PJTA 3HHXA 2HAKA 3U61B 1J5EM 1DO0A 2EA0A 4NRWA 1L2CA 2DNAA 1YU0A 2X8AA 3CF6E 3GLHA 1HQCA 1NV9A 5C18A 1Y8GA 2FFJA 1FJGM 3HJQA 3ZQJA 2XFSA 5EP1A 3WD3A 4G6ZA 1T43A 5ITYA 2WSCF 4OVZB 1IBMM 5DYIA 1ZAEA 1NVMA 2J5YA 1ZQ9A 3KS4A 4IJEA 4FVMA 4MM3B 4JI1M 1PJIA 1OTRA 2L4EA 4MGHA 2XEPA 3A42A 4B3RM 2Y2KA 3HHWA 1ZV1A 4LFBM 2Y2MA 1BVSA 4DV6M 2D49A 2LTUA 3HU3A 3GQ5A 2VF8A 4I5SA 2FH0A 5C1BA 3LW5F 1E9RA 1NY6A 4RF1A 2R0IA 5L8RF 3I04M 2LVQD 2Y2NA 1UFZA 3B74A 2L4FA 4M0DA 2FS1A 5ITUA 4DV4M 1IFYA 1XXHA 1O6IA 4NYUA 2LH0A 2QPAA 2UUAM 4M9SA 1PJQA 3LCVB 1N75A 1ZMWA 2EJSA 4AQYM 4NSRA 4GKKM 3U60B 3UK6A 4IBDA 4MGYE 1R4GA 3U5ZA 1F4IA 3M7GA 2DAGA 4Z8XA 1WGNA 2JY6B 3D8LA 2EUCA 1G41A 3GLIA 1C1KA 2FE8A 3NBIA 2JCHA 2NQ8C 3WD1A 3FYDA 2JZ0A 3M6AA 3TE6A 4D82A 1HNXM 4JI4M 3JAMS 1YU1A 5ITXA 4IBEA 3KOXE 4AG5A 3FUUA 2JWSA 1N34M 3ILKA 1OFIA 3KVWA 3W67A 4LF5M 2I7NA 5DFLA 1VEJA 3GLFA 1MN3A 2K0BX 1Z5CA 2DAMA 3AFHA 2JP7A 1IXRC 1V33A 1QAMA 2VIIA 5F3WA 2LNHC 1ORYB 1GOIA 1SXJA 4B08A 1GKIA 3GO8A 1ZMVA 3QAUA 2CFOA 3T1HM 1H0GA 3GRYA 1W1TA 4LJ9A 1AIPC 4GC5A 3W0FA 3KSXA 3GPUA 2UXDM 4NC6A 1EAKA 2HL7A 1DGGA 1IN6A 4GRIA 1IN7A 2OOBA 4JI3M 2L6OA 2L7HA 2XD5A 2LWXA 1IN4A 3BOSA 1GO5A 3FYCA 4DV3M 1OAIA 1Z5AA 2DAIA 1QZMA 4BB9A 3U61A 2UXCM 2FN2A 3FRHA 2Y2IA 3AV0A 2OOAA 1C7YA 2JE5A 1W5TA 3V76A 4KO8A 3TWMA 2DAEA 3VK7A 4Y28F 2R45A 4OVZA 1G4AE 1FNNA 5ITTA 4FCVA 1P3QQ 5EQTA 3RGPA 1NV8A 4MB5A 3B7QA 1IQPA 2QHOB 2CP8A 2BJWA 3CF2A 1SXJD 2H1RA 4PCZA 4XGIA 4TUWA 1XB2B 1H8PA 5FTKA 3C3EA 1IY0A 3ZC7B 2FFFB 5KPRA 2UUBM 2IOUA 4LJ5A 3VFDA 3EIHA 2UUCM 3SFZA 4GHLA 4M0WA 1E8BA 3SAWA 2P5TA 2WSEF 2BWEA 5LMNM 2I7PA 1SG9A 4DV0M 2QSFX 2DKLA 3U6QA 1OJLA 3WD2A 4NZ3A 3L29A 4AG6A 2VQEM 2E5LM 2DXIA 2KA6B 1N36M 3DFZA 4IBKA 1QDTA 5ITQA 3U60A 2DZOB 1QZEA 2A5YB 4FD2A 2G8LA 5FLXS 4MGZE 3U5ZB 3PNVA 4LRTA 2VQFM 3B89A 2Z7JA 2D7HA 1DGHB 2XSZA 1JQJC 2M5ZA 3L25A 2FOIC 2R62A 4CISA 1W5SA 4I4LA 2Y0TA 3HJ8A 3A46A 2D7GA 4L78A 2HCBA 1GXDA 2UWXA 1QDRA 3KOZE 4HL4A 1WHCA 3SBJA 2F5QA 5H37D 1DGBA 4KT0F 5EJCA 2Y2JA 1Q3BA 4G3OA 3SATA 1E88A 4DR6M 1A5TA 2CWBA 3Q8GA 4JI6M 1VG5A 2YNMD 1SXJB 4Z2GA 5JI3E 4FWGA 2JY7A 3TWKA 3GLGB 1E9SA 2AHMA 2C99A 2HWJA 3B9PA 3SYKA 4CJ6A 2DZNB 3GPXA 3KOYE 3KW6A 3B7NA 1LTMA 5EXTA 1NO1A 1CUKA 4X62M 2R18A 3R9XB 3LQQA 3VKHA 1J09A 2Q2EB 4OU7A 2F5OA 2XSZD 2Z8YM 4NRVA 1TTEA 1OIZA 1QAOA 2CHGA 4ITQA 1QUSA 2R46A 3MHVC 5EP3A 3TL4X 1GL7A 1WXQA 1WGLA 1GJTA 2QQ8A 1LV7A 5JI2E 4LZZA 2CV1A 4LJAA 2DHYA 2DAKA 4Z2HA 3AL0C 4LFAM 5EP2A 4G4QA 2KEBA 4L6V6 1YU4A 3RGSA 1D0MA 8CATA 1JR3E 5A2QS 3R8FA 4I8OA 1H0IA 1W1YA 2K9DA 1R2YA 2DHRA 3HSHA 2F5PA 4G4OA 3HJSA 4L4UA 5EXXA 4ANRA 4YHHM 4IBBA 1PJJA 1MX0A 4X66M 3UMMA 3KS8A 4IBJA 1HT1E 1J7MA 5KQ8A 1DV0A 1QAQA 1KSFX 2BWBA 3I01M 3K92A 3HHZA 3SAUA 5IREB 4Z2JA 2XFTA 1XMOM 4FWDA 1DGHA 2QCUA 3GRUA 3IG8A 3GPYA 3L27A 3IG5A 4Z2LA 3H4MA 2KHHA 3FUXA 3J80S 2RRUA 1NSFA 1PRBA 2R65A 2KXEA 2FNAA 1QO6A 1XHBA 2OPFA 2XZUA 4LJ4A 3SYLA 3QWLA 2Z4RA 4DR5M 2Z3XA 3WHKA 3U6LA 1R5LA 4QNMA 7CATA 2EKKA 4L16A 3GLGA 4IIWA 4MGIE 4EIWA 3BXWA 4B3SM 3THGA 3AJIB 4DR1M 1V34A 1Q39A 5DNYA 5BR8M 3GPPA 1W1PA 3AKZA 2X4AA 4IBGA 2ZAOA 1Q02A 2DWNA 2F5SA 3UGJA 2XZFA 4JI8M 3W0LB 4DR3M 4IJFA 1YU2A 1T6OA 3H4JA 2W82A 3HKPA 4NZ1A 1GVNA 3DOAA 1VDDA 1E32A 1N33M 4IBFA 3T1YM 1WJ7A 2G5GX 2DWMA 1XMQM 3I51A 1D0LA 4BBAA 1IN5A 3SMPA 5LMUM 2Y2LA 4QHTA 3I4VA 3E4RA 2XLJA 2JNHA 4LGMA 1VEKA 2VF7A 1OFHA 1TDHA 2M60A 1QVRA 5IWAM 5EXPA 3AOEA 1XWIA 1YLAA 3D8BA 4GHAA 1KS0A 4R3DA 2V6ZM 4OW0A 1D2NA 4JI0M 1R6BX 1ZMUA 4JN6A 1K82A 2QZ4A 3E9SA 2KRKA 3QYEA 4KODA 3K2LA 3J27B 2QBYB 4BLCA 2KZUA 3GQ3A 2RTSA 1WIVA 2LHGA 4DR7M 3KOWE 4LZJA 4NZ4A 1TR8A 1G3IA 3U6MA 1QUTA 3GRRA 2BG1A 2R4EA 4XK8F 2Y20A 3K9PA 2DENA 1IY1A 4YY3M 1N77A 1GJSA 3GLHE 2DWZB 2WSFF 3J7BA 4LGYA 4QNLA 3HGIA 1TH3A 4S12A 4JI2M 4LY6A 1YE9A 2MROB 4KLNA 5KO3A 3K1JA 4L15A 4LF9M 5IZ7D 3T6PA 2OQ4A 3FTEA 3W68A 2K47A 2ZM6M 2JZ1A 2OO9A 4PT5A 1KYIA 1HNWM 3M7PA 4II7A 4OJ6A 3UJNA 2UXBM 4G4NA 1GABA 2D7EA 3C9PA 2CE7A 3J7AS 3OTOM 3IHPA 1NJFA 1Z6TA 4I81A 4AKGA 1SXJC 3C58A 4LF8M 4Z2IA 3VDPA 4RF0A 3SHGB 1JB0F 2KNVA 4W5WA 5E6JA 2C5RA 1XC8A 3AOGA 2VDBB 1E6PA 4Q7JA 1EFUB 4B7GA 1XXHE 2O01F 2UU9M 3U6OA 1NNUC 1VEGA 4AKHA 2R6FA 5E26A 4P17A 2B3TA 1E6NA 4X64M 1Z59A 1CK7A 4D80A 4GITA 2RGHA 4CHTB 1G59A 1IBKM 3VLFB 1XNQM 1NNJA 4REZA 3RE8A 3SAVA 3FUWA 4GKJM 4NY2A 2C9OA 4JI5M 1GL6A 4GC9A 4OUIA 3KSJA 4PD2A 3CTWB 1R7RA 1GPFA 1OGBA 1L1TA 1N78A 4GMQA 1HT2E 4QOSA 1WR1B 2K6BA 3M0EA 3FTFA 2Y2QA 4NXMM 3T38A 2QP9X 2G3QA 3AOEC 2KDLA 1IXZA 3KP1E 3CGWA 1G8PA 3HWSA 4HEOA 1W1VA 2KNZA 3N3FA 5EXSA 1TGUA 2J7NA 3F92A 3U6EA 4M9ZA 3SARA 2DZLA 2RGOA 5FTMA 2WZJA 2MH8A 2GQFA 4GH9A 3L26A 2YR0A 3E46A 3I4YA 1TH2A 4JXJA 3L28A 2QBYA 5ITRA 1J7KA 1NY5A 3MQLA 4IBCA 3SASA 2C9CA 1UR9A 1OAOC 3TQSA 1YU3A 3HU2A 2LHCA 5KQDA 4F1IA 3MJ5A 4QHSA 2BNKA 4NL4H 4OJOA 1DGFA 3FUVA 4FWHA 1TF0B 3SHFA 2XGNA 3BBZA 1K3WA 4RKUF 3HONA 4IBIA 4RNAA 1VDLA 3LCUA 4P16A 4OJPA 2LXEA 3L2AA 4MB4A 4A3VB 4AW4A 3WHLA 4D81A 2ZANA 2ZBKB 2F5NA 2V1CA 3FTCA 4QNRA 4FCWA 4NXNM 5KPTA 4DV7M 1TDZA 3PNYA 4LF4M 2EO2A 3A45A 5IT9S 3DA1A 3ZH9B 3LVWA 3MMPA 4AI6A 4WW0A 4PDIA 4HLQA 2CV2A 4L8RC 1N32M 1AIWA 4NZ5A 4OX9M 2Y2GA 2V5OA 2YFQA 4ZPXA 3FRIA 3JR4A 3Q8XA 3SMSA 4R71A 4B7HA 5FSWA 3FE3A 1IY2A 5GKNA 1IBLM 2Y2OA 3ZCBB 3GP1A 3U6DA 4Z2KA 2Z4SA 4WP2A 3NBXX 1HR0M 2MJ5B 3A98B 2XH9A 2N35A 2YQZA 2ZTCA 2KRUA 3PXGA 2HHHM 4JV5M 4K0KM 4GIPA 2RKOA 1IXSA 2LVOC 2Y0QA 5FTNA 2CV0A 4CGYB 2V1UA 1TH4A 2JXNA 1PM5A 4KHPM 4LFCM 2CEAA 5FTJA 1EE8A 4HMEA 3FKEA 3K8ZA 4OJLA 3HX3A 2LVNC 2JUJA 1Q3CA 2X49A 3B7ZA 1QQWA 4MB3A 2CHVA 1ED7A 3VK8A 1E6ZA 1HQYE 1G71A 4DUZM 5BPVA 3E21A 1E94E 4X65M 1NHWC 3LMMA 3PFIA 2L09A 4LF6M 3HU1A 2CUZA 2MGWA 3VKGA 2DWLA 1JR3A 1E15A 1UM8A 3MK6A 4LJ7A 2LVAA 1OIPA 2KZSA 3NWLA 4M9XA 3TPZA 3U6PA 5KPZA 4B3TM 4LJ8A 5DYGA 3KDSE 1L1ZA 3HZJA 2Y21A 1K3XA 1PDCA 1H6UA 1S3SA 3FD9A 2ERCA 1Z5BA 2H5XA 2APLA 4CIZA 3IECA 2MR9A 1DO2A 2XF3A 3DZDA 1KFVA 4OJ5A 2HKJA 2LVPC 3GLHB 4NOOB 2JY8A 1OQYA 2O25A 3GRVA 1YUBA 2R44A 3FTDA 3J2PB 3U6CA 4MB7A 1I4WA 1QYRA 2KNAA 4FCTA 1PJSA 3WD0A 4DV2M 2QENA 3GQ4A 4JYAM 4NYYA 2C96A 3KXEC 3LVVA
chains in the Genus database with same CATH topology
1IM2A 3TWLA 4NSOB 2F4VM 1YSYA 4LRSA 4LF7M 2KW0A 4DV5M 4G4RA 4LG2A 1T3TA 1QANA 4Z6YA 2JA2A 1JR3D 4XBOA 2R4JA 4MGKE 4PDGA 4AZFA 3J81S 2ZAMA 3JR5A 4DV1M 4FW9A 3SC3A 1X37A 3WX7A 4AKIA 3U6SA 2DVWB 1XXHB 1R2ZA 1IN8A 2O5RA 4QOZC 1NJGA 4JI7M 4LCBA 4R7GA 2BJVA 4B7FA 1YUEA 1HNZM 1XNRM 3RFWA 2J7OA 3GLIB 3KP0E 4DR4M 2C98A 1IXSB 5EP4A 2XD1A 4MH0E 1GLNA 3LQRA 3PVSA 3GLFB 1L2DA 5ITXE 2Y2PA 3T15A 4DUYM 4DR2M 1I94M 4LJ6A 1L2BA 3FUTA 1NHGC 3HHYA 1SXJE 1MU5A 3CF0A 3VDUA 3UZUA 1L8QA 4WURA 3EIEA 5FTLA 2CHQA 4B3MM 3KFUG 2L7IA 3U61B 3HHXA 1J5EM 4NRWA 2Y2QA 1DO0A 2EA0A 1YU0A 1L2CA 2X8AA 3CF6E 3GLHA 1HQCA 5C18A 2FFJA 1FJGM 3HJQA 2XFSA 5EP1A 4G6ZA 5ITYA 1IBMM 4OVZB 5DYIA 1ZAEA 1NVMA 1ZQ9A 3KS4A 4IJEA 4FVMA 4MM3B 4JI1M 1PJIA 4MGHA 2XEPA 3A42A 4B3RM 2Y2KA 3HHWA 4LFBM 2Y2MA 4DV6M 3HU3A 3GQ5A 4I5SA 5C1BA 4RF1A 1NY6A 1E9RA 5ITUA 4M0DA 4DV4M 4NYUA 1XXHA 2LH0A 2QPAA 2UUAM 4M9SA 1N75A 4GKKM 4AQYM 4NSRA 3U60B 3UK6A 4IBDA 4MGYE 3U5ZA 3M7GA 4Z8XA 3D8LA 1G41A 2EUCA 3GLIA 1C1KA 2FE8A 3NBIA 2JCHA 2NQ8C 3FYDA 3M6AA 3TE6A 4D82A 4JI4M 1HNXM 1YU1A 3JAMS 5ITXA 4IBEA 3KOXE 4AG5A 3FUUA 1N34M 3ILKA 1OFIA 3KVWA 4LF5M 2I7NA 3GLFA 1Z5CA 3AFHA 1IXRC 1QAMA 2VIIA 5F3WA 2LNHC 1ORYB 1SXJA 4B08A 1GKIA 3GO8A 3QAUA 2CFOA 3T1HM 3GRYA 4LJ9A 4GC5A 3W0FA 3KSXA 3GPUA 2UXDM 2HL7A 1DGGA 1IN6A 4GRIA 1IN7A 4JI3M 2L6OA 2L7HA 2XD5A 2LWXA 1IN4A 3BOSA 3FYCA 4DV3M 1Z5AA 1QZMA 4BB9A 3U61A 2UXCM 2Y2IA 3AV0A 2JE5A 1W5TA 4KO8A 3TWMA 3VK7A 2R45A 4OVZA 1G4AE 1FNNA 5ITTA 4FCVA 5EQTA 3RGPA 1IQPA 2BJWA 3CF2A 1SXJD 2H1RA 4PCZA 4XGIA 4TUWA 2FFFB 5FTKA 1IY0A 3ZC7B 5KPRA 2UUBM 2IOUA 4LJ5A 3VFDA 3EIHA 2UUCM 3SFZA 4GHLA 4M0WA 3SAWA 2P5TA 5LMNM 2I7PA 4DV0M 3U6QA 1OJLA 4NZ3A 3L29A 4AG6A 2VQEM 2E5LM 2DXIA 2KA6B 1N36M 3DFZA 4IBKA 5ITQA 3U60A 2DZOB 4FD2A 2A5YB 5FLXS 2G8LA 3U5ZB 4MGZE 2BG1A 3PNVA 4LRTA 2VQFM 2Z7JA 2D7HA 1DGHB 2XSZA 1JQJC 2M5ZA 3L25A 2FOIC 2R62A 4CISA 1W5SA 4I4LA 2Y0TA 3HJ8A 3A46A 2D7GA 4L78A 2HCBA 2UWXA 4HL4A 3KOZE 2F5QA 3SBJA 5H37D 1DGBA 5EJCA 2Y2JA 1Q3BA 3SATA 4DR6M 4JI6M 2YNMD 1SXJB 5JI3E 4FWGA 3GLGB 3TWKA 2XZUA 1E9SA 2AHMA 2C99A 3B9PA 3SYKA 3GPXA 2Y2NA 2DZNB 3KOYE 3KW6A 5EXTA 4X62M 2R18A 3R9XB 3LQQA 3VKHA 1J09A 2Q2EB 4OU7A 2F5OA 2XSZD 4NRVA 1QAOA 2CHGA 4ITQA 2R46A 3MHVC 5EP3A 3TL4X 1GL7A 1WXQA 1LV7A 5JI2E 4LZZA 2CV1A 4LJAA 3AL0C 4LFAM 5EP2A 4G4QA 2KEBA 1YU4A 3RGSA 8CATA 5A2QS 3R8FA 4I8OA 1R2YA 2DHRA 3HSHA 2F5PA 4G4OA 3HJSA 4L4UA 5EXXA 4YHHM 4IBBA 1PJJA 1MX0A 4X66M 3UMMA 3KS8A 4IBJA 1HT1E 5KQ8A 1QAQA 1KSFX 3K92A 3HHZA 3SAUA 5IREB 2XFTA 1XMOM 4FWDA 1DGHA 2QCUA 3GRUA 3IG8A 3GPYA 3L27A 3IG5A 3H4MA 3FUXA 3J80S 1NSFA 2R65A 2KXEA 2FNAA 1XHBA 2OPFA 4LJ4A 3SYLA 3QWLA 2Z4RA 4DR5M 2Z3XA 3WHKA 3U6LA 4QNMA 7CATA 4L16A 3GLGA 4IIWA 4MGIE 4EIWA 4B3SM 3THGA 3AJIB 4DR1M 1Q39A 5DNYA 5BR8M 3GPPA 3AKZA 2X4AA 4IBGA 2ZAOA 2DWNA 2F5SA 3UGJA 2XZFA 4JI8M 3W0LB 4DR3M 4IJFA 1YU2A 2W82A 3HKPA 4NZ1A 1GVNA 3DOAA 1VDDA 1E32A 1N33M 4IBFA 3T1YM 2G5GX 2DWMA 1XMQM 3I51A 4BBAA 1IN5A 3SMPA 5LMUM 2Y2LA 4QHTA 3I4VA 3E4RA 2XLJA 4LGMA 1OFHA 1TDHA 2M60A 1QVRA 5IWAM 5EXPA 3AOEA 1XWIA 4GHAA 3D8BA 4R3DA 2V6ZM 4OW0A 1D2NA 4JI0M 1R6BX 4JN6A 1K82A 2QZ4A 3E9SA 2KRKA 4KODA 3K2LA 3J27B 2QBYB 4BLCA 2KZUA 3GQ3A 4DR7M 3KOWE 4LZJA 4NZ4A 1G3IA 3U6MA 3GRRA 2R4EA 2Y20A 4YY3M 1IY1A 1N77A 2DWZB 3J7BA 4LGYA 4QNLA 3HGIA 1TH3A 4S12A 4JI2M 4LY6A 1YE9A 4KLNA 5KO3A 3K1JA 4L15A 4LF9M 5IZ7D 2OQ4A 3FTEA 2K47A 2ZM6M 1HNWM 4PT5A 1KYIA 4II7A 4OJ6A 3UJNA 2UXBM 4G4NA 2D7EA 2CE7A 3J7AS 3OTOM 1NJFA 1Z6TA 4I81A 4AKGA 1SXJC 3C58A 4LF8M 3VDPA 4RF0A 3SHGB 4W5WA 5E6JA 2C5RA 1XC8A 3AOGA 4B7GA 2UU9M 3U6OA 1NNUC 4AKHA 5E26A 4X64M 1Z59A 4D80A 4GITA 2RGHA 4CHTB 1G59A 1IBKM 3VLFB 1XNQM 1NNJA 4REZA 3RE8A 3SAVA 3FUWA 4GKJM 4NY2A 2C9OA 4JI5M 1GL6A 4GC9A 4OUIA 3KSJA 4PD2A 3CTWB 1R7RA 1L1TA 1N78A 4GMQA 1HT2E 4QOSA 3M0EA 3FTFA 4NXMM 3T38A 2QP9X 3AOEC 1IXZA 3KP1E 3N3FA 1G8PA 3HWSA 5EXSA 1TGUA 2J7NA 3U6EA 4M9ZA 3SARA 5FTMA 2RGOA 4GH9A 3L26A 2YR0A 3I4YA 2QBYA 1TH2A 4JXJA 3L28A 5ITRA 1J7KA 1NY5A 4IBCA 3SASA 2C9CA 1YU3A 3TQSA 3HU2A 5KQDA 3MJ5A 4QHSA 2BNKA 4NL4H 4OJOA 1DGFA 3FUVA 4FWHA 1K3WA 3SHFA 2XGNA 3HONA 4IBIA 4RNAA 4P16A 4OJPA 2LXEA 3L2AA 4A3VB 4AW4A 3WHLA 4D81A 2ZANA 2ZBKB 2F5NA 2V1CA 3FTCA 4QNRA 4FCWA 4NXNM 5KPTA 4DV7M 1TDZA 3PNYA 4LF4M 2EO2A 3A45A 5IT9S 3DA1A 3ZH9B 3LVWA 4AI6A 4WW0A 4PDIA 4HLQA 2CV2A 4L8RC 1N32M 4NZ5A 4OX9M 2Y2GA 2YFQA 4ZPXA 3JR4A 3Q8XA 3SMSA 2Y2HA 4B7HA 5FSWA 5GKNA 1IY2A 1IBLM 2Y2OA 3ZCBB 3GP1A 3U6DA 2Z4SA 1HR0M 3A98B 2XH9A 2HHHM 2YQZA 3PXGA 2KRUA 4JV5M 4K0KM 4GIPA 2RKOA 2Y0QA 2CV0A 2V1UA 5FTNA 4CGYB 1TH4A 4KHPM 1PM5A 4LFCM 2CEAA 5FTJA 1EE8A 4OJLA 3FKEA 3K8ZA 1Q3CA 2X49A 1QQWA 2CHVA 3VK8A 1HQYE 4DUZM 5BPVA 1E94E 4X65M 1NHWC 3LMMA 3PFIA 2L09A 4LF6M 3HU1A 2CUZA 3VKGA 2DWLA 1JR3A 1UM8A 3MK6A 4LJ7A 3NWLA 2KZSA 4M9XA 3TPZA 4B3TM 3U6PA 5KPZA 4LJ8A 5DYGA 3KDSE 1L1ZA 1K3XA 2Y21A 1H6UA 1S3SA 3FD9A 2ERCA 1Z5BA 2XF3A 1DO2A 3DZDA 1KFVA 4OJ5A 2HKJA 3GLHB 4NOOB 3GRVA 3J2PB 1YUBA 3FTDA 3U6CA 4MB7A 1I4WA 1QYRA 4FCTA 4DV2M 2QENA 3GQ4A 4JYAM 4NYYA 2C96A 3KXEC 3LVVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BPV A;  3L28 A;  3L25 A;  4IBC A;  4GHA A;  4IBB A;  3KS8 A;  4LG2 A;  4GHL A;  4IBJ A;  4IBG A;  4IBD A;  4IBI A;  4IJE A;  4IJF A;  3KS4 A;  3L2A A;  4IBF A;  4IBE A;  3L27 A;  3L29 A;  3FKE A;  4IBK A;  4GH9 A;  3L26 A; 
#chains in the Genus database with same CATH topology
 1E6R A;  1AUA A;  1OGG A;  1IM2 A;  4UN2 B;  4NSO B;  3TWL A;  2EKF A;  2F4V M;  3WD4 A;  1YSY A;  3HY5 A;  1V92 A;  4LRS A;  4LF7 M;  2KW0 A;  4DV5 M;  4G4R A;  4GEW A;  4LG2 A;  4TX8 A;  1T3T A;  1QAN A;  4Z6Y A;  2JA2 A;  1JR3 D;  4XBO A;  2R4J A;  4MGK E;  4PDG A;  4AZF A;  3J81 S;  1PGY A;  2ZAM A;  3JR5 A;  4DV1 M;  3C3D A;  4FW9 A;  3SC3 A;  1X37 A;  4HMC A;  3WX7 A;  4AKI A;  2Y2H A;  3U6S A;  2DVW B;  1XXH B;  1R2Z A;  2QNJ A;  1IN8 A;  2O5R A;  4QOZ C;  1NJG A;  4JI7 M;  4LCB A;  4R7G A;  2ZTD A;  2BJV A;  4B7F A;  1RU3 A;  1YUE A;  1CXW A;  1HNZ M;  1XNR M;  3RFW A;  2J7O A;  3GLI B;  3KP0 E;  4DR4 M;  2C98 A;  1IXS B;  5EP4 A;  4DBG B;  4F2L A;  2XD1 A;  4MH0 E;  1UR8 A;  1GLN A;  3GLI E;  2DI0 A;  1MJG M;  2L2D A;  3LQR A;  3PVS A;  3GLF B;  1L2D A;  1D0K A;  5ITX E;  2Y2P A;  3QYB A;  2CRU A;  3T15 A;  1L6J A;  2JY5 A;  4DUY M;  4DR2 M;  3GLF E;  1I94 M;  4LJ6 A;  4HMD A;  1L2B A;  3FUT A;  1NHG C;  3HHY A;  1SXJ E;  1MU5 A;  3CF0 A;  1EIJ A;  3K9O A;  2LBC A;  3GLG E;  3VDU A;  3UZU A;  1L8Q A;  1HJP A;  3EIE A;  4WUR A;  5FTL A;  2CHQ A;  1OKS A;  2GNO A;  4B3M M;  3KFU G;  1VQ1 A;  2L7I A;  1PJT A;  3HHX A;  2HAK A;  3U61 B;  1J5E M;  1DO0 A;  2EA0 A;  4NRW A;  1L2C A;  2DNA A;  1YU0 A;  2X8A A;  3CF6 E;  3GLH A;  1HQC A;  1NV9 A;  5C18 A;  1Y8G A;  2FFJ A;  1FJG M;  3HJQ A;  3ZQJ A;  2XFS A;  5EP1 A;  3WD3 A;  4G6Z A;  1T43 A;  5ITY A;  2WSC F;  4OVZ B;  1IBM M;  5DYI A;  1ZAE A;  1NVM A;  2J5Y A;  1ZQ9 A;  3KS4 A;  4IJE A;  4FVM A;  4MM3 B;  4JI1 M;  1PJI A;  1OTR A;  2L4E A;  4MGH A;  2XEP A;  3A42 A;  4B3R M;  2Y2K A;  3HHW A;  1ZV1 A;  4LFB M;  2Y2M A;  1BVS A;  4DV6 M;  2D49 A;  2LTU A;  3HU3 A;  3GQ5 A;  2VF8 A;  4I5S A;  2FH0 A;  5C1B A;  3LW5 F;  1E9R A;  1NY6 A;  4RF1 A;  2R0I A;  5L8R F;  3I04 M;  2LVQ D;  2Y2N A;  1UFZ A;  3B74 A;  2L4F A;  4M0D A;  2FS1 A;  5ITU A;  4DV4 M;  1IFY A;  1XXH A;  1O6I A;  4NYU A;  2LH0 A;  2QPA A;  2UUA M;  4M9S A;  1PJQ A;  3LCV B;  1N75 A;  1ZMW A;  2EJS A;  4AQY M;  4NSR A;  4GKK M;  3U60 B;  3UK6 A;  4IBD A;  4MGY E;  1R4G A;  3U5Z A;  1F4I A;  3M7G A;  2DAG A;  4Z8X A;  1WGN A;  2JY6 B;  3D8L A;  2EUC A;  1G41 A;  3GLI A;  1C1K A;  2FE8 A;  3NBI A;  2JCH A;  2NQ8 C;  3WD1 A;  3FYD A;  2JZ0 A;  3M6A A;  3TE6 A;  4D82 A;  1HNX M;  4JI4 M;  3JAM S;  1YU1 A;  5ITX A;  4IBE A;  3KOX E;  4AG5 A;  3FUU A;  2JWS A;  1N34 M;  3ILK A;  1OFI A;  3KVW A;  3W67 A;  4LF5 M;  2I7N A;  5DFL A;  1VEJ A;  3GLF A;  1MN3 A;  2K0B X;  1Z5C A;  2DAM A;  3AFH A;  2JP7 A;  1IXR C;  1V33 A;  1QAM A;  2VII A;  5F3W A;  2LNH C;  1ORY B;  1GOI A;  1SXJ A;  4B08 A;  1GKI A;  3GO8 A;  1ZMV A;  3QAU A;  2CFO A;  3T1H M;  1H0G A;  3GRY A;  1W1T A;  4LJ9 A;  1AIP C;  4GC5 A;  3W0F A;  3KSX A;  3GPU A;  2UXD M;  4NC6 A;  1EAK A;  2HL7 A;  1DGG A;  1IN6 A;  4GRI A;  1IN7 A;  2OOB A;  4JI3 M;  2L6O A;  2L7H A;  2XD5 A;  2LWX A;  1IN4 A;  3BOS A;  1GO5 A;  3FYC A;  4DV3 M;  1OAI A;  1Z5A A;  2DAI A;  1QZM A;  4BB9 A;  3U61 A;  2UXC M;  2FN2 A;  3FRH A;  2Y2I A;  3AV0 A;  2OOA A;  1C7Y A;  2JE5 A;  1W5T A;  3V76 A;  4KO8 A;  3TWM A;  2DAE A;  3VK7 A;  4Y28 F;  2R45 A;  4OVZ A;  1G4A E;  1FNN A;  5ITT A;  4FCV A;  1P3Q Q;  5EQT A;  3RGP A;  1NV8 A;  4MB5 A;  3B7Q A;  1IQP A;  2QHO B;  2CP8 A;  2BJW A;  3CF2 A;  1SXJ D;  2H1R A;  4PCZ A;  4XGI A;  4TUW A;  1XB2 B;  1H8P A;  5FTK A;  3C3E A;  1IY0 A;  3ZC7 B;  2FFF B;  5KPR A;  2UUB M;  2IOU A;  4LJ5 A;  3VFD A;  3EIH A;  2UUC M;  3SFZ A;  4GHL A;  4M0W A;  1E8B A;  3SAW A;  2P5T A;  2WSE F;  2BWE A;  5LMN M;  2I7P A;  1SG9 A;  4DV0 M;  2QSF X;  2DKL A;  3U6Q A;  1OJL A;  3WD2 A;  4NZ3 A;  3L29 A;  4AG6 A;  2VQE M;  2E5L M;  2DXI A;  2KA6 B;  1N36 M;  3DFZ A;  4IBK A;  1QDT A;  5ITQ A;  3U60 A;  2DZO B;  1QZE A;  2A5Y B;  4FD2 A;  2G8L A;  5FLX S;  4MGZ E;  3U5Z B;  3PNV A;  4LRT A;  2VQF M;  3B89 A;  2Z7J A;  2D7H A;  1DGH B;  2XSZ A;  1JQJ C;  2M5Z A;  3L25 A;  2FOI C;  2R62 A;  4CIS A;  1W5S A;  4I4L A;  2Y0T A;  3HJ8 A;  3A46 A;  2D7G A;  4L78 A;  2HCB A;  1GXD A;  2UWX A;  1QDR A;  3KOZ E;  4HL4 A;  1WHC A;  3SBJ A;  2F5Q A;  5H37 D;  1DGB A;  4KT0 F;  5EJC A;  2Y2J A;  1Q3B A;  4G3O A;  3SAT A;  1E88 A;  4DR6 M;  1A5T A;  2CWB A;  3Q8G A;  4JI6 M;  1VG5 A;  2YNM D;  1SXJ B;  4Z2G A;  5JI3 E;  4FWG A;  2JY7 A;  3TWK A;  3GLG B;  1E9S A;  2AHM A;  2C99 A;  2HWJ A;  3B9P A;  3SYK A;  4CJ6 A;  2DZN B;  3GPX A;  3KOY E;  3KW6 A;  3B7N A;  1LTM A;  5EXT A;  1NO1 A;  1CUK A;  4X62 M;  2R18 A;  3R9X B;  3LQQ A;  3VKH A;  1J09 A;  2Q2E B;  4OU7 A;  2F5O A;  2XSZ D;  2Z8Y M;  4NRV A;  1TTE A;  1OIZ A;  1QAO A;  2CHG A;  4ITQ A;  1QUS A;  2R46 A;  3MHV C;  5EP3 A;  3TL4 X;  1GL7 A;  1WXQ A;  1WGL A;  1GJT A;  2QQ8 A;  1LV7 A;  5JI2 E;  4LZZ A;  2CV1 A;  4LJA A;  2DHY A;  2DAK A;  4Z2H A;  3AL0 C;  4LFA M;  5EP2 A;  4G4Q A;  2KEB A;  4L6V 6;  1YU4 A;  3RGS A;  1D0M A;  8CAT A;  1JR3 E;  5A2Q S;  3R8F A;  4I8O A;  1H0I A;  1W1Y A;  2K9D A;  1R2Y A;  2DHR A;  3HSH A;  2F5P A;  4G4O A;  3HJS A;  4L4U A;  5EXX A;  4ANR A;  4YHH M;  4IBB A;  1PJJ A;  1MX0 A;  4X66 M;  3UMM A;  3KS8 A;  4IBJ A;  1HT1 E;  1J7M A;  5KQ8 A;  1DV0 A;  1QAQ A;  1KSF X;  2BWB A;  3I01 M;  3K92 A;  3HHZ A;  3SAU A;  5IRE B;  4Z2J A;  2XFT A;  1XMO M;  4FWD A;  1DGH A;  2QCU A;  3GRU A;  3IG8 A;  3GPY A;  3L27 A;  3IG5 A;  4Z2L A;  3H4M A;  2KHH A;  3FUX A;  3J80 S;  2RRU A;  1NSF A;  1PRB A;  2R65 A;  2KXE A;  2FNA A;  1QO6 A;  1XHB A;  2OPF A;  2XZU A;  4LJ4 A;  3SYL A;  3QWL A;  2Z4R A;  4DR5 M;  2Z3X A;  3WHK A;  3U6L A;  1R5L A;  4QNM A;  7CAT A;  2EKK A;  4L16 A;  3GLG A;  4IIW A;  4MGI E;  4EIW A;  3BXW A;  4B3S M;  3THG A;  3AJI B;  4DR1 M;  1V34 A;  1Q39 A;  5DNY A;  5BR8 M;  3GPP A;  1W1P A;  3AKZ A;  2X4A A;  4IBG A;  2ZAO A;  1Q02 A;  2DWN A;  2F5S A;  3UGJ A;  2XZF A;  4JI8 M;  3W0L B;  4DR3 M;  4IJF A;  1YU2 A;  1T6O A;  3H4J A;  2W82 A;  3HKP A;  4NZ1 A;  1GVN A;  3DOA A;  1VDD A;  1E32 A;  1N33 M;  4IBF A;  3T1Y M;  1WJ7 A;  2G5G X;  2DWM A;  1XMQ M;  3I51 A;  1D0L A;  4BBA A;  1IN5 A;  3SMP A;  5LMU M;  2Y2L A;  4QHT A;  3I4V A;  3E4R A;  2XLJ A;  2JNH A;  4LGM A;  1VEK A;  2VF7 A;  1OFH A;  1TDH A;  2M60 A;  1QVR A;  5IWA M;  5EXP A;  3AOE A;  1XWI A;  1YLA A;  3D8B A;  4GHA A;  1KS0 A;  4R3D A;  2V6Z M;  4OW0 A;  1D2N A;  4JI0 M;  1R6B X;  1ZMU A;  4JN6 A;  1K82 A;  2QZ4 A;  3E9S A;  2KRK A;  3QYE A;  4KOD A;  3K2L A;  3J27 B;  2QBY B;  4BLC A;  2KZU A;  3GQ3 A;  2RTS A;  1WIV A;  2LHG A;  4DR7 M;  3KOW E;  4LZJ A;  4NZ4 A;  1TR8 A;  1G3I A;  3U6M A;  1QUT A;  3GRR A;  2BG1 A;  2R4E A;  4XK8 F;  2Y20 A;  3K9P A;  2DEN A;  1IY1 A;  4YY3 M;  1N77 A;  1GJS A;  3GLH E;  2DWZ B;  2WSF F;  3J7B A;  4LGY A;  4QNL A;  3HGI A;  1TH3 A;  4S12 A;  4JI2 M;  4LY6 A;  1YE9 A;  2MRO B;  4KLN A;  5KO3 A;  3K1J A;  4L15 A;  4LF9 M;  5IZ7 D;  3T6P A;  2OQ4 A;  3FTE A;  3W68 A;  2K47 A;  2ZM6 M;  2JZ1 A;  2OO9 A;  4PT5 A;  1KYI A;  1HNW M;  3M7P A;  4II7 A;  4OJ6 A;  3UJN A;  2UXB M;  4G4N A;  1GAB A;  2D7E A;  3C9P A;  2CE7 A;  3J7A S;  3OTO M;  3IHP A;  1NJF A;  1Z6T A;  4I81 A;  4AKG A;  1SXJ C;  3C58 A;  4LF8 M;  4Z2I A;  3VDP A;  4RF0 A;  3SHG B;  1JB0 F;  2KNV A;  4W5W A;  5E6J A;  2C5R A;  1XC8 A;  3AOG A;  2VDB B;  1E6P A;  4Q7J A;  1EFU B;  4B7G A;  1XXH E;  2O01 F;  2UU9 M;  3U6O A;  1NNU C;  1VEG A;  4AKH A;  2R6F A;  5E26 A;  4P17 A;  2B3T A;  1E6N A;  4X64 M;  1Z59 A;  1CK7 A;  4D80 A;  4GIT A;  2RGH A;  4CHT B;  1G59 A;  1IBK M;  3VLF B;  1XNQ M;  1NNJ A;  4REZ A;  3RE8 A;  3SAV A;  3FUW A;  4GKJ M;  4NY2 A;  2C9O A;  4JI5 M;  1GL6 A;  4GC9 A;  4OUI A;  3KSJ A;  4PD2 A;  3CTW B;  1R7R A;  1GPF A;  1OGB A;  1L1T A;  1N78 A;  4GMQ A;  1HT2 E;  4QOS A;  1WR1 B;  2K6B A;  3M0E A;  3FTF A;  2Y2Q A;  4NXM M;  3T38 A;  2QP9 X;  2G3Q A;  3AOE C;  2KDL A;  1IXZ A;  3KP1 E;  3CGW A;  1G8P A;  3HWS A;  4HEO A;  1W1V A;  2KNZ A;  3N3F A;  5EXS A;  1TGU A;  2J7N A;  3F92 A;  3U6E A;  4M9Z A;  3SAR A;  2DZL A;  2RGO A;  5FTM A;  2WZJ A;  2MH8 A;  2GQF A;  4GH9 A;  3L26 A;  2YR0 A;  3E46 A;  3I4Y A;  1TH2 A;  4JXJ A;  3L28 A;  2QBY A;  5ITR A;  1J7K A;  1NY5 A;  3MQL A;  4IBC A;  3SAS A;  2C9C A;  1UR9 A;  1OAO C;  3TQS A;  1YU3 A;  3HU2 A;  2LHC A;  5KQD A;  4F1I A;  3MJ5 A;  4QHS A;  2BNK A;  4NL4 H;  4OJO A;  1DGF A;  3FUV A;  4FWH A;  1TF0 B;  3SHF A;  2XGN A;  3BBZ A;  1K3W A;  4RKU F;  3HON A;  4IBI A;  4RNA A;  1VDL A;  3LCU A;  4P16 A;  4OJP A;  2LXE A;  3L2A A;  4MB4 A;  4A3V B;  4AW4 A;  3WHL A;  4D81 A;  2ZAN A;  2ZBK B;  2F5N A;  2V1C A;  3FTC A;  4QNR A;  4FCW A;  4NXN M;  5KPT A;  4DV7 M;  1TDZ A;  3PNY A;  4LF4 M;  2EO2 A;  3A45 A;  5IT9 S;  3DA1 A;  3ZH9 B;  3LVW A;  3MMP A;  4AI6 A;  4WW0 A;  4PDI A;  4HLQ A;  2CV2 A;  4L8R C;  1N32 M;  1AIW A;  4NZ5 A;  4OX9 M;  2Y2G A;  2V5O A;  2YFQ A;  4ZPX A;  3FRI A;  3JR4 A;  3Q8X A;  3SMS A;  4R71 A;  4B7H A;  5FSW A;  3FE3 A;  1IY2 A;  5GKN A;  1IBL M;  2Y2O A;  3ZCB B;  3GP1 A;  3U6D A;  4Z2K A;  2Z4S A;  4WP2 A;  3NBX X;  1HR0 M;  2MJ5 B;  3A98 B;  2XH9 A;  2N35 A;  2YQZ A;  2ZTC A;  2KRU A;  3PXG A;  2HHH M;  4JV5 M;  4K0K M;  4GIP A;  2RKO A;  1IXS A;  2LVO C;  2Y0Q A;  5FTN A;  2CV0 A;  4CGY B;  2V1U A;  1TH4 A;  2JXN A;  1PM5 A;  4KHP M;  4LFC M;  2CEA A;  5FTJ A;  1EE8 A;  4HME A;  3FKE A;  3K8Z A;  4OJL A;  3HX3 A;  2LVN C;  2JUJ A;  1Q3C A;  2X49 A;  3B7Z A;  1QQW A;  4MB3 A;  2CHV A;  1ED7 A;  3VK8 A;  1E6Z A;  1HQY E;  1G71 A;  4DUZ M;  5BPV A;  3E21 A;  1E94 E;  4X65 M;  1NHW C;  3LMM A;  3PFI A;  2L09 A;  4LF6 M;  3HU1 A;  2CUZ A;  2MGW A;  3VKG A;  2DWL A;  1JR3 A;  1E15 A;  1UM8 A;  3MK6 A;  4LJ7 A;  2LVA A;  1OIP A;  2KZS A;  3NWL A;  4M9X A;  3TPZ A;  3U6P A;  5KPZ A;  4B3T M;  4LJ8 A;  5DYG A;  3KDS E;  1L1Z A;  3HZJ A;  2Y21 A;  1K3X A;  1PDC A;  1H6U A;  1S3S A;  3FD9 A;  2ERC A;  1Z5B A;  2H5X A;  2APL A;  4CIZ A;  3IEC A;  2MR9 A;  1DO2 A;  2XF3 A;  3DZD A;  1KFV A;  4OJ5 A;  2HKJ A;  2LVP C;  3GLH B;  4NOO B;  2JY8 A;  1OQY A;  2O25 A;  3GRV A;  1YUB A;  2R44 A;  3FTD A;  3J2P B;  3U6C A;  4MB7 A;  1I4W A;  1QYR A;  2KNA A;  4FCT A;  1PJS A;  3WD0 A;  4DV2 M;  2QEN A;  3GQ4 A;  4JYA M;  4NYY A;  2C96 A;  3KXE C;  3LVV A; 
#chains in the Genus database with same CATH homology
 1IM2 A;  3TWL A;  4NSO B;  2F4V M;  1YSY A;  4LRS A;  4LF7 M;  2KW0 A;  4DV5 M;  4G4R A;  4LG2 A;  1T3T A;  1QAN A;  4Z6Y A;  2JA2 A;  1JR3 D;  4XBO A;  2R4J A;  4MGK E;  4PDG A;  4AZF A;  3J81 S;  2ZAM A;  3JR5 A;  4DV1 M;  4FW9 A;  3SC3 A;  1X37 A;  3WX7 A;  4AKI A;  3U6S A;  2DVW B;  1XXH B;  1R2Z A;  1IN8 A;  2O5R A;  4QOZ C;  1NJG A;  4JI7 M;  4LCB A;  4R7G A;  2BJV A;  4B7F A;  1YUE A;  1HNZ M;  1XNR M;  3RFW A;  2J7O A;  3GLI B;  3KP0 E;  4DR4 M;  2C98 A;  1IXS B;  5EP4 A;  2XD1 A;  4MH0 E;  1GLN A;  3LQR A;  3PVS A;  3GLF B;  1L2D A;  5ITX E;  2Y2P A;  3T15 A;  4DUY M;  4DR2 M;  1I94 M;  4LJ6 A;  1L2B A;  3FUT A;  1NHG C;  3HHY A;  1SXJ E;  1MU5 A;  3CF0 A;  3VDU A;  3UZU A;  1L8Q A;  4WUR A;  3EIE A;  5FTL A;  2CHQ A;  4B3M M;  3KFU G;  2L7I A;  3U61 B;  3HHX A;  1J5E M;  4NRW A;  2Y2Q A;  1DO0 A;  2EA0 A;  1YU0 A;  1L2C A;  2X8A A;  3CF6 E;  3GLH A;  1HQC A;  5C18 A;  2FFJ A;  1FJG M;  3HJQ A;  2XFS A;  5EP1 A;  4G6Z A;  5ITY A;  1IBM M;  4OVZ B;  5DYI A;  1ZAE A;  1NVM A;  1ZQ9 A;  3KS4 A;  4IJE A;  4FVM A;  4MM3 B;  4JI1 M;  1PJI A;  4MGH A;  2XEP A;  3A42 A;  4B3R M;  2Y2K A;  3HHW A;  4LFB M;  2Y2M A;  4DV6 M;  3HU3 A;  3GQ5 A;  4I5S A;  5C1B A;  4RF1 A;  1NY6 A;  1E9R A;  5ITU A;  4M0D A;  4DV4 M;  4NYU A;  1XXH A;  2LH0 A;  2QPA A;  2UUA M;  4M9S A;  1N75 A;  4GKK M;  4AQY M;  4NSR A;  3U60 B;  3UK6 A;  4IBD A;  4MGY E;  3U5Z A;  3M7G A;  4Z8X A;  3D8L A;  1G41 A;  2EUC A;  3GLI A;  1C1K A;  2FE8 A;  3NBI A;  2JCH A;  2NQ8 C;  3FYD A;  3M6A A;  3TE6 A;  4D82 A;  4JI4 M;  1HNX M;  1YU1 A;  3JAM S;  5ITX A;  4IBE A;  3KOX E;  4AG5 A;  3FUU A;  1N34 M;  3ILK A;  1OFI A;  3KVW A;  4LF5 M;  2I7N A;  3GLF A;  1Z5C A;  3AFH A;  1IXR C;  1QAM A;  2VII A;  5F3W A;  2LNH C;  1ORY B;  1SXJ A;  4B08 A;  1GKI A;  3GO8 A;  3QAU A;  2CFO A;  3T1H M;  3GRY A;  4LJ9 A;  4GC5 A;  3W0F A;  3KSX A;  3GPU A;  2UXD M;  2HL7 A;  1DGG A;  1IN6 A;  4GRI A;  1IN7 A;  4JI3 M;  2L6O A;  2L7H A;  2XD5 A;  2LWX A;  1IN4 A;  3BOS A;  3FYC A;  4DV3 M;  1Z5A A;  1QZM A;  4BB9 A;  3U61 A;  2UXC M;  2Y2I A;  3AV0 A;  2JE5 A;  1W5T A;  4KO8 A;  3TWM A;  3VK7 A;  2R45 A;  4OVZ A;  1G4A E;  1FNN A;  5ITT A;  4FCV A;  5EQT A;  3RGP A;  1IQP A;  2BJW A;  3CF2 A;  1SXJ D;  2H1R A;  4PCZ A;  4XGI A;  4TUW A;  2FFF B;  5FTK A;  1IY0 A;  3ZC7 B;  5KPR A;  2UUB M;  2IOU A;  4LJ5 A;  3VFD A;  3EIH A;  2UUC M;  3SFZ A;  4GHL A;  4M0W A;  3SAW A;  2P5T A;  5LMN M;  2I7P A;  4DV0 M;  3U6Q A;  1OJL A;  4NZ3 A;  3L29 A;  4AG6 A;  2VQE M;  2E5L M;  2DXI A;  2KA6 B;  1N36 M;  3DFZ A;  4IBK A;  5ITQ A;  3U60 A;  2DZO B;  4FD2 A;  2A5Y B;  5FLX S;  2G8L A;  3U5Z B;  4MGZ E;  2BG1 A;  3PNV A;  4LRT A;  2VQF M;  2Z7J A;  2D7H A;  1DGH B;  2XSZ A;  1JQJ C;  2M5Z A;  3L25 A;  2FOI C;  2R62 A;  4CIS A;  1W5S A;  4I4L A;  2Y0T A;  3HJ8 A;  3A46 A;  2D7G A;  4L78 A;  2HCB A;  2UWX A;  4HL4 A;  3KOZ E;  2F5Q A;  3SBJ A;  5H37 D;  1DGB A;  5EJC A;  2Y2J A;  1Q3B A;  3SAT A;  4DR6 M;  4JI6 M;  2YNM D;  1SXJ B;  5JI3 E;  4FWG A;  3GLG B;  3TWK A;  2XZU A;  1E9S A;  2AHM A;  2C99 A;  3B9P A;  3SYK A;  3GPX A;  2Y2N A;  2DZN B;  3KOY E;  3KW6 A;  5EXT A;  4X62 M;  2R18 A;  3R9X B;  3LQQ A;  3VKH A;  1J09 A;  2Q2E B;  4OU7 A;  2F5O A;  2XSZ D;  4NRV A;  1QAO A;  2CHG A;  4ITQ A;  2R46 A;  3MHV C;  5EP3 A;  3TL4 X;  1GL7 A;  1WXQ A;  1LV7 A;  5JI2 E;  4LZZ A;  2CV1 A;  4LJA A;  3AL0 C;  4LFA M;  5EP2 A;  4G4Q A;  2KEB A;  1YU4 A;  3RGS A;  8CAT A;  5A2Q S;  3R8F A;  4I8O A;  1R2Y A;  2DHR A;  3HSH A;  2F5P A;  4G4O A;  3HJS A;  4L4U A;  5EXX A;  4YHH M;  4IBB A;  1PJJ A;  1MX0 A;  4X66 M;  3UMM A;  3KS8 A;  4IBJ A;  1HT1 E;  5KQ8 A;  1QAQ A;  1KSF X;  3K92 A;  3HHZ A;  3SAU A;  5IRE B;  2XFT A;  1XMO M;  4FWD A;  1DGH A;  2QCU A;  3GRU A;  3IG8 A;  3GPY A;  3L27 A;  3IG5 A;  3H4M A;  3FUX A;  3J80 S;  1NSF A;  2R65 A;  2KXE A;  2FNA A;  1XHB A;  2OPF A;  4LJ4 A;  3SYL A;  3QWL A;  2Z4R A;  4DR5 M;  2Z3X A;  3WHK A;  3U6L A;  4QNM A;  7CAT A;  4L16 A;  3GLG A;  4IIW A;  4MGI E;  4EIW A;  4B3S M;  3THG A;  3AJI B;  4DR1 M;  1Q39 A;  5DNY A;  5BR8 M;  3GPP A;  3AKZ A;  2X4A A;  4IBG A;  2ZAO A;  2DWN A;  2F5S A;  3UGJ A;  2XZF A;  4JI8 M;  3W0L B;  4DR3 M;  4IJF A;  1YU2 A;  2W82 A;  3HKP A;  4NZ1 A;  1GVN A;  3DOA A;  1VDD A;  1E32 A;  1N33 M;  4IBF A;  3T1Y M;  2G5G X;  2DWM A;  1XMQ M;  3I51 A;  4BBA A;  1IN5 A;  3SMP A;  5LMU M;  2Y2L A;  4QHT A;  3I4V A;  3E4R A;  2XLJ A;  4LGM A;  1OFH A;  1TDH A;  2M60 A;  1QVR A;  5IWA M;  5EXP A;  3AOE A;  1XWI A;  4GHA A;  3D8B A;  4R3D A;  2V6Z M;  4OW0 A;  1D2N A;  4JI0 M;  1R6B X;  4JN6 A;  1K82 A;  2QZ4 A;  3E9S A;  2KRK A;  4KOD A;  3K2L A;  3J27 B;  2QBY B;  4BLC A;  2KZU A;  3GQ3 A;  4DR7 M;  3KOW E;  4LZJ A;  4NZ4 A;  1G3I A;  3U6M A;  3GRR A;  2R4E A;  2Y20 A;  4YY3 M;  1IY1 A;  1N77 A;  2DWZ B;  3J7B A;  4LGY A;  4QNL A;  3HGI A;  1TH3 A;  4S12 A;  4JI2 M;  4LY6 A;  1YE9 A;  4KLN A;  5KO3 A;  3K1J A;  4L15 A;  4LF9 M;  5IZ7 D;  2OQ4 A;  3FTE A;  2K47 A;  2ZM6 M;  1HNW M;  4PT5 A;  1KYI A;  4II7 A;  4OJ6 A;  3UJN A;  2UXB M;  4G4N A;  2D7E A;  2CE7 A;  3J7A S;  3OTO M;  1NJF A;  1Z6T A;  4I81 A;  4AKG A;  1SXJ C;  3C58 A;  4LF8 M;  3VDP A;  4RF0 A;  3SHG B;  4W5W A;  5E6J A;  2C5R A;  1XC8 A;  3AOG A;  4B7G A;  2UU9 M;  3U6O A;  1NNU C;  4AKH A;  5E26 A;  4X64 M;  1Z59 A;  4D80 A;  4GIT A;  2RGH A;  4CHT B;  1G59 A;  1IBK M;  3VLF B;  1XNQ M;  1NNJ A;  4REZ A;  3RE8 A;  3SAV A;  3FUW A;  4GKJ M;  4NY2 A;  2C9O A;  4JI5 M;  1GL6 A;  4GC9 A;  4OUI A;  3KSJ A;  4PD2 A;  3CTW B;  1R7R A;  1L1T A;  1N78 A;  4GMQ A;  1HT2 E;  4QOS A;  3M0E A;  3FTF A;  4NXM M;  3T38 A;  2QP9 X;  3AOE C;  1IXZ A;  3KP1 E;  3N3F A;  1G8P A;  3HWS A;  5EXS A;  1TGU A;  2J7N A;  3U6E A;  4M9Z A;  3SAR A;  5FTM A;  2RGO A;  4GH9 A;  3L26 A;  2YR0 A;  3I4Y A;  2QBY A;  1TH2 A;  4JXJ A;  3L28 A;  5ITR A;  1J7K A;  1NY5 A;  4IBC A;  3SAS A;  2C9C A;  1YU3 A;  3TQS A;  3HU2 A;  5KQD A;  3MJ5 A;  4QHS A;  2BNK A;  4NL4 H;  4OJO A;  1DGF A;  3FUV A;  4FWH A;  1K3W A;  3SHF A;  2XGN A;  3HON A;  4IBI A;  4RNA A;  4P16 A;  4OJP A;  2LXE A;  3L2A A;  4A3V B;  4AW4 A;  3WHL A;  4D81 A;  2ZAN A;  2ZBK B;  2F5N A;  2V1C A;  3FTC A;  4QNR A;  4FCW A;  4NXN M;  5KPT A;  4DV7 M;  1TDZ A;  3PNY A;  4LF4 M;  2EO2 A;  3A45 A;  5IT9 S;  3DA1 A;  3ZH9 B;  3LVW A;  4AI6 A;  4WW0 A;  4PDI A;  4HLQ A;  2CV2 A;  4L8R C;  1N32 M;  4NZ5 A;  4OX9 M;  2Y2G A;  2YFQ A;  4ZPX A;  3JR4 A;  3Q8X A;  3SMS A;  2Y2H A;  4B7H A;  5FSW A;  5GKN A;  1IY2 A;  1IBL M;  2Y2O A;  3ZCB B;  3GP1 A;  3U6D A;  2Z4S A;  1HR0 M;  3A98 B;  2XH9 A;  2HHH M;  2YQZ A;  3PXG A;  2KRU A;  4JV5 M;  4K0K M;  4GIP A;  2RKO A;  2Y0Q A;  2CV0 A;  2V1U A;  5FTN A;  4CGY B;  1TH4 A;  4KHP M;  1PM5 A;  4LFC M;  2CEA A;  5FTJ A;  1EE8 A;  4OJL A;  3FKE A;  3K8Z A;  1Q3C A;  2X49 A;  1QQW A;  2CHV A;  3VK8 A;  1HQY E;  4DUZ M;  5BPV A;  1E94 E;  4X65 M;  1NHW C;  3LMM A;  3PFI A;  2L09 A;  4LF6 M;  3HU1 A;  2CUZ A;  3VKG A;  2DWL A;  1JR3 A;  1UM8 A;  3MK6 A;  4LJ7 A;  3NWL A;  2KZS A;  4M9X A;  3TPZ A;  4B3T M;  3U6P A;  5KPZ A;  4LJ8 A;  5DYG A;  3KDS E;  1L1Z A;  1K3X A;  2Y21 A;  1H6U A;  1S3S A;  3FD9 A;  2ERC A;  1Z5B A;  2XF3 A;  1DO2 A;  3DZD A;  1KFV A;  4OJ5 A;  2HKJ A;  3GLH B;  4NOO B;  3GRV A;  3J2P B;  1YUB A;  3FTD A;  3U6C A;  4MB7 A;  1I4W A;  1QYR A;  4FCT A;  4DV2 M;  2QEN A;  3GQ4 A;  4JYA M;  4NYY A;  2C96 A;  3KXE C;  3LVV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...