1H8PA

Bull seminal plasma pdc-109 fibronectin type ii module
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
88
structure length
88
Chain Sequence
EECVFPFVYRNRKHFDCTVHGSLFPWCSLDADYVGRWKYCAQRDYAKCVFPFIYGGKKYETCTKIGSMWMSWCSLSPNYDKDRAWKYC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SEMINAL PLASMA PROTEIN PDC-109
publication title Sperm Coating Mechanism from the 1.8 A Crystal Structure of Pdc-109-Phosphorylcholine Complex
pubmed doi rcsb
molecule tags Phosphorylcholine-binding protein
total genus 18
structure length 88
sequence length 88
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00040 fn2 Fibronectin type II domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.10 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Fibronectin, type II, collagen-binding 1h8pA02
2.10.10.10 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Fibronectin, type II, collagen-binding 1h8pA01
1CXWA 1EAKA 3M7PA 3MQLA 1GXDA 2FN2A 1PDCA 1QO6A 1E88A 1L6JA 1CK7A 1KS0A 1E8BA 1H8PA 2V5OA 1J7MA
chains in the Genus database with same CATH superfamily
2XD1A 5BPVA 1E15A 3L29A 1J7MA 1W1TA 3HSHA 1YUEA 2Y2GA 1UR9A 3HONA 1OGGA 4OJ5A 3L26A 4IJEA 4IJFA 4MB4A 1E6RA 2RTSA 1YU0A 1CK7A 4NZ5A 4IBEA 4Z2JA 3N3FA 3WD4A 1YU4A 1E6PA 2Y2PA 4TX8A 2V5OA 2FFFB 3M7PA 4NYYA 2XD5A 1E88A 1W1PA 1E8BA 4IBIA 4HMCA 1QO6A 4NZ3A 2Y2IA 2Y2NA 2Y2MA 1GOIA 4Z2IA 1OGBA 1L6JA 4IBFA 1H8PA 3L2AA 4OJLA 2Y2LA 1H0GA 4IBDA 3WD0A 3WD3A 3WD2A 1YU1A 4LG2A 1AIWA 3L25A 2Y2OA 1YU2A 3L28A 3WD1A 1GXDA 1PDCA 1E6NA 4GHAA 2Y2JA 2IOUA 1EAKA 2Y2QA 4HMEA 4NYUA 2JCHA 4OJPA 3KS4A 3KS8A 4GH9A 3WX7A 4MB5A 2Y2KA 3FKEA 4NY2A 4IBGA 2BG1A 4Z2GA 1GPFA 3L27A 1CXWA 1H0IA 3MQLA 1E6ZA 2Y2HA 2UWXA 4GHLA 4Z2KA 2JE5A 4OUIA 2FN2A 4Z2HA 4IBCA 1UR8A 1W1VA 4QNLA 1YU3A 4IBKA 1O6IA 4MB3A 4IBJA 1ED7A 4NZ1A 2D49A 4HMDA 4OJOA 1W1YA 4IBBA 4NZ4A 4Z2LA 1KS0A 4OJ6A
chains in the Genus database with same CATH topology
1CXWA 1EAKA 3M7PA 3MQLA 1GXDA 2FN2A 1PDCA 1QO6A 1E88A 1L6JA 1CK7A 1KS0A 1E8BA 1H8PA 2V5OA 1J7MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CXW A;  1EAK A;  3M7P A;  3MQL A;  1GXD A;  2FN2 A;  1PDC A;  1QO6 A;  1E88 A;  1L6J A;  1CK7 A;  1KS0 A;  1E8B A;  1H8P A;  2V5O A;  1J7M A; 
#chains in the Genus database with same CATH topology
 2XD1 A;  5BPV A;  1E15 A;  3L29 A;  1J7M A;  1W1T A;  3HSH A;  1YUE A;  2Y2G A;  1UR9 A;  3HON A;  1OGG A;  4OJ5 A;  3L26 A;  4IJE A;  4IJF A;  4MB4 A;  1E6R A;  2RTS A;  1YU0 A;  1CK7 A;  4NZ5 A;  4IBE A;  4Z2J A;  3N3F A;  3WD4 A;  1YU4 A;  1E6P A;  2Y2P A;  4TX8 A;  2V5O A;  2FFF B;  3M7P A;  4NYY A;  2XD5 A;  1E88 A;  1W1P A;  1E8B A;  4IBI A;  4HMC A;  1QO6 A;  4NZ3 A;  2Y2I A;  2Y2N A;  2Y2M A;  1GOI A;  4Z2I A;  1OGB A;  1L6J A;  4IBF A;  1H8P A;  3L2A A;  4OJL A;  2Y2L A;  1H0G A;  4IBD A;  3WD0 A;  3WD3 A;  3WD2 A;  1YU1 A;  4LG2 A;  1AIW A;  3L25 A;  2Y2O A;  1YU2 A;  3L28 A;  3WD1 A;  1GXD A;  1PDC A;  1E6N A;  4GHA A;  2Y2J A;  2IOU A;  1EAK A;  2Y2Q A;  4HME A;  4NYU A;  2JCH A;  4OJP A;  3KS4 A;  3KS8 A;  4GH9 A;  3WX7 A;  4MB5 A;  2Y2K A;  3FKE A;  4NY2 A;  4IBG A;  2BG1 A;  4Z2G A;  1GPF A;  3L27 A;  1CXW A;  1H0I A;  3MQL A;  1E6Z A;  2Y2H A;  2UWX A;  4GHL A;  4Z2K A;  2JE5 A;  4OUI A;  2FN2 A;  4Z2H A;  4IBC A;  1UR8 A;  1W1V A;  4QNL A;  1YU3 A;  4IBK A;  1O6I A;  4MB3 A;  4IBJ A;  1ED7 A;  4NZ1 A;  2D49 A;  4HMD A;  4OJO A;  1W1Y A;  4IBB A;  4NZ4 A;  4Z2L A;  1KS0 A;  4OJ6 A; 
#chains in the Genus database with same CATH homology
 1CXW A;  1EAK A;  3M7P A;  3MQL A;  1GXD A;  2FN2 A;  1PDC A;  1QO6 A;  1E88 A;  1L6J A;  1CK7 A;  1KS0 A;  1E8B A;  1H8P A;  2V5O A;  1J7M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...