2Y2OA

Penicillin-binding protein 1b (pbp-1b) in complex with an alkyl boronate (eo9)
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
489
structure length
471
Chain Sequence
ISEITYSDGTVIASISRDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTGQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PENICILLIN-BINDING PROTEIN 1B
publication title Structure-Guided Design of Cell Wall Biosynthesis Inhibitors that Overcome Beta-Lactam Resistance in Staphylococcus Aureus (Mrsa).
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
total genus 165
structure length 471
sequence length 489
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2y2oA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2y2oA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2y2oA02
1E3UD 4R1GA 4DDSA 4S2PA 4E3KA 4ZJ1A 2ZQDA 2Y2JA 2IWBA 2Y4AA 3SH9A 5EOEA 2EFUA 3PAGA 4X68A 2WAEA 4OONA 2JCHA 4P87A 4S2NC 2Y2KA 3IWQA 4K0XA 1LI9A 1W8YA 3HVFA 5CTMA 4DE3A 4KZ4A 4JXSA 2IWCA 4IVIA 5BOHA 4PMAA 5HARA 3HLDA 3UDFA 3NCKA 1LLBA 5CTNA 1NZOA 2PU4A 3NDGA 2EXBA 3M6HA 3UPPA 4BENA 1ERQA 1GCEA 5EOOA 4UA6A 1ZG4A 2J7VA 3GVBA 1W5DA 2ZQAA 4KZ3A 5A91A 4GZBA 4H8RA 4JXGA 3AGFA 5CHJA 1L2SA 4OLGA 4N9LA 4R4RA 3S22A 4F94A 5EVLA 3BEBA 2Y2PA 3MXRA 3HREA 1IKGA 1EI5A 4WYYA 3WS2A 1KDWA 5CXWA 4QY5A 3BM6A 4GD8A 2X02A 2J8YA 1RGZA 2BG1A 4FH2A 3PBQA 3HUMA 5E43A 1S0WA 3DW0A 4KQOA 4YFMA 3WS4A 1PW1A 2CC1A 3ZNTA 4WMCA 4GOGA 3DWZA 5FQJA 3AGEA 4IBXA 2EX2A 3MXSA 1HTZA 3EQUA 1K55A 3BFGA 1ES4A 5I94A 4R0QA 4PM5A 1TDLA 2HDQA 3G4PA 4IVKA 1TDGA 2ZC6B 4KG2A 1W79A 1FCOA 1YLJA 2WAFA 2HP9A 4KZ8A 4EUZA 1NXYA 4EWFA 5KMWA 3ISGA 2PU2A 1EROA 2ZC4B 4LV3A 2GDNA 2R9XA 2JC7A 4KG6A 4WZ5C 2WKHA 1K54C 1KDSA 1TVFA 2XD5A 1FR1A 3VP1A 4YINA 5DF9A 5DF7A 2Q9MA 3BFFA 3VP2A 5FQMA 4S2JA 1NY0A 2XD1A 5KZHA 3DTMA 2A49A 5JYPA 1ESIA 1W7FA 1XA1A 2ZC3B 3MZDA 4BD1A 3FKWA 4Y0UA 3Q82A 1MPLA 1YT4A 1WYBA 2OLUA 2JE5A 2VGJA 4NK3A 1BLCA 1SKFA 3HUOA 5GLDA 4JF6A 4KZBA 4B4ZA 3GSGA 4E3IA 5CECA 4UA7A 4JF4A 4U3TA 2WZZA 1VQQA 3O87A 4OVDA 4EQIA 1CK3A 1VM1A 3PBNA 3IT9A 3MBZA 4FCFA 3V3SA 3A3IA 2V1ZA 4WBGA 1NYMA 2EFXA 1BTLA 1YLWA 4OOYA 3UDXA 5DTKA 2Y2NA 5FQQA 2XR0A 1I2SA 3QNBA 5CGWA 1ZC2A 4S2IA 3ZHHA 4QJGA 5E2GA 2EX8A 3IH8A 1IYQA 1C3BA 2HDUA 2H5SA 3N8SA 5EECA 5AQBA 2UWXA 2BLSA 1JWVA 4JF5A 4JPMA 3HLEA 2G2WA 5E2FA 4OQHA 2Y2MA 1PWGA 1YMSA 3PBOA 5DTTA 4ZBEA 3VSKA 3OCLA 4IEDA 4CJNA 2V2FF 2XH9A 4MEZA 3OZHA 3Q7ZA 1H8ZA 3BFEA 1PI5A 1MWUA 4Z9QA 2B5RA 3LY3A 4HEFA 4A5RA 3SS4A 2FFYA 2H10A 4K0WA 2I72A 4XUXA 1G6AA 4WELA 1SCWA 1BLHA 4EBPA 1LI0A 3IXHA 4UAAA 4ZDXA 5FDHA 5CGXA 2Y2QA 1Q2QA 5EPHA 3BECA 5CERA 1MBLA 4UHUA 4C6YA 1BT5A 2HP6A 4PM7A 1AXBA 3VFFA 2ZQCA 3S4XA 3FYZA 3PTEA 2J9OA 2XK1A 4WMCD 1N9BA 3MZFA 3SS5A 4GKUA 3ZDJA 1MY8A 4FH4A 3OC2A 1K56D 3PAEA 2XFSA 4KZ6A 5HAPA 4EV4A 1K57A 2WGVA 1HVBA 1SHVA 2DRWA 1KVLA 1CI9A 2Z2LB 1JTDA 2ZM0A 4RX3A 4E3MA 2X01A 4OPYA 3UNWA 1ERMA 2WADA 2HDRA 1IYPA 1ZG6A 1FR6A 3OPPA 4OKPA 3UN7A 4P0MA 5HAQA 5FAPA 1M40A 4L0LA 3V39A 4D2OA 1YMXA 4OQIA 5EE8A 3BFDA 2QZ6A 5M19A 5JYOA 1ALQA 3G34A 2Y2GA 3LO7A 3MKFA 3LEZA 4KENB 3W4PA 3ZG8B 2WKEA 2HDSA 3ZG9B 4GNUA 4KQQA 3NI9A 4BLMA 4LV2A 1E25A 4R3JA 3BRMA 1GHPA 3ZG7B 2ZJ9A 3CJMA 3GTCA 5G18A 5GL9A 4DE0A 1LL9A 3Q7VB 1CI8A 1K38A 4DDYA 3IXBA 3BLMA 2EX6A 1WYCA 3W4OA 3HLGA 1YLTA 1HZOA 1FCMA 5GLCA 3C7UA 2EX9A 1TEMA 4PPRA 4QY6A 4LENA 5HL1A 4JBFA 1KGFA 4O7DA 3VP0A 1E3UA 3GV9A 5EVIC 1RCJA 4GD6A 4LCLA 1XXMA 3O88A 3IF6C 3ZFZA 2P9VA 1ES2A 1S6RA 1IYOA 1BLPA 2WUQA 4KZ7A 3I7JA 2OV5A 5GHZA 2WGWA 2ZC7A 1KE4A 3C4OA 2Y2HA 5IHVA 1K6RA 1MWRA 1K4EA 5EVIB 3V5MA 1YQSA 5FATA 3VOYA 3UPOA 4DE1A 3IF6B 3C7VA 4X56A 5GLBA 2RCXA 2XFTA 4ZAMA 4RA7A 1JVJA 5CEBA 1KE3A 1L0GA 3NIAA 1K57C 1MWTA 4DXCA 2OSUA 4WM9A 5HX9A 3PBTA 3BYDA 3LCEA 4GN2A 4R23A 1MKIA 5F82A 5EVID 1DJCA 4P85A 3NDEA 4U0TA 4P6BA 2HP5A 2V20A 1PYYA 1K4FA 5HAIA 1JWPA 4S2NA 2PBYA 3AGDA 5AQ7A 5M18A 1WE4A 1XP4A 1JTGA 1Y54A 5FI2A 3VFHA 1XPBA 2Y2IA 1O07A 5A93A 4S2MA 1H8YA 2Y2OA 1PZPA 4IBRA 4XXRA 3UDIA 4BJPA 5DVAA 2Y59A 4DRTA 1ZKJA 1OMEA 2EXAA 1ES3A 3M2JA 4QHCA 5FSRA 1LL5A 4BL3A 4E3OA 5F1FA 1W8QA 5FQKA 3G2ZA 1DJAA 5E2HA 5KSHA 3MFDA 3VP3A 5FAOA 3HLWA 4XUZA 4JLFA 4JXVA 1K55C 1BULA 1GA0A 5EUAA 4QU3A 3WRTA 5KSCA 3IHBA 3P09A 3SOIA 2Y91A 2C6WB 3UE0A 3V50A 1G68A 1PWDA 4OPRA 3QHYA 3Q1FA 5FA7A 3SH8A 4UA9A 5TFQA 2ZM8A 3ZG5A 3S1YA 3WWXA 4GB7A 3V3RA 3GMWA 3NC8A 4ZTKA 1PW8A 5TR7A 1N4OA 4N9KA 3O3VA 3NY4A 1K6SA 4OOMA 4DXBA 3BFCA 3C4PA 3BLSA 3FV7A 3Q07A 2QPNA 1XKZA 2WZXA 1RGYA 3HBRA 3SH7A 3W8KA 3HLCA 3OPLA 1CEFA 1KE0A 2XDMA 3CG5A 3GR2A 2ZQ9A 5CHMA 3FZCA 5HW3A 3ITBA 3VSLA 4KQRA 3LY4A 2P9VB 4GDNA 2H0YA 3HLBA 4E3NA 3ZGAB 4ZJ3A 3ZG0A 2RL3A 4DKIA 3IXGA 1YLPA 3VP4A 1Z6FA 2H0TA 4Y0OA 3OPRA 1PIOA 3IWIA 3ITAA 4HBUA 4X6TA 2JBFA 3UY6A 4RX2A 4C3QA 4WZ5A 1EWZA 3G30A 1K54A 4S2LA 1H5XA 1FOFA 1FSYA 4B88A 3M6BA 4E3JA 1JWZA 3A3FA 1L0FA 2XF3A 1GHMA 4MNRA 4NETA 5E2EA 3RXWA 1NZUA 2A3UA 3A3DA 1PWCA 1NJ4A 1O7EA 2E8IA 3TSGA 3WRZA 1BSGA 4M3KA 4DF6A 3G2YA 1DY6A 5A90A 5A92A 1RP5A 1XX2A 1IKIA 5DTSA 3QNCA 1GA9A 3RXXA 3O86A 4QD4A 3TG9A 3WS1A 4R4SA 1KGGA 1I2WA 2C5WB 4BL2A 3D4FA 4PM9A 1NYYA 3IF5A 2FFFB 1SDEA 2P74A 2XGNA 2XLNA 4OQGA 2DCFA 3IQAA 3C5AA 1YM1A 4LV0A 3ZVWA 3FKVA 4EBNA 2WGIA 4S2KA 1PI4A 5FAQA 5U47A 4JKTA 3HLFA 4E3LA 4OPQA 4Q8IA 2QMIA 1M6KA 1FSWA 4OP5A 3W4QA 4N92A 4K91A 1CEGA 5TGFA 3E2LA 2VGKA 2IWDA 5J8XA 2ZM2A 3IHAA 3GQZA 5CRFA 4ID4A 4OLDA 1HD8A 3CMZA 4X55A 1ES5A 2R9WA 3GRJA 4RYEA 4ZJ2A 3MZEA 1ESUA 4FSFA 3CZDA 2WKIA 4BD0A 3ZNYA 2OLVA 1J9MA 4X69A 1ONGA 1K56A 5DF8A 5M1AA 3EQVA 3G32A 4KG5A 4QB8A 4MBFA 3N8RA 3ZCZA 3SS3A 3P98A 5D3OA 5AQ9A 4KZ5A 3ZVTA 1XGJA 4HBTA 5CGSA 1YLZA 4WEJA 5F83A 4LCMA 1XGIA 4JXWA 1BUEA 1MXOA 4OQ0A 5AQAA 2ZQ7A 3A3EA 4OP8A 2X71A 3MKEA 3DWKA 3IH9A 4B4XA 3RJUA 2ZLYA 3PBRA 1LHYA 3N4IA 2ZQ8A 1L0DA 1QMEA 4Y0TA 3B3XA 3G31A 4BQMA 2Y55A 1U60A 2J9PA 4N1XA 3UE3A 2ZD8A 3VMAA 5GHXA 2XEPA 3E2KA 5HFOA 5FI7A 1FCNA 4N1HA 5FQ9A 5CEDA 5L2FA 1QMFA 2G2UA 3IWOA 4KZ9A 4WZ4A 5FQIA 5GHYA 2Z2MB 4R3BA 1IYSA 2WK0A 3HUNA 4S2OA 1IELA 1BZAA 3G35A 5CHUA 2HPBA 2DNSA 3UE1A 2Y2LA 3UPNA 5F1GA 3VOZA 4PM8A 2WYXA 3UO9A 3Q7VA 4LV1A 4OOLA 4E6WA 1I5QA 1ONHA 1FQGA 1GHIA 4OPZA 4U0XA 4GDBA 1SDNA 5GLAA 5FI6A 4X53A 4C75A 3N7WA 1PZOA 3Q81A 1NRFA 1BLSA 1KVMA 4RVAA 3N8LA 4MBKA 4FD8A 2XQZA 3HL9A 1K25A 3M2KA 4Y7PA 2ZC5B 1XA7A 3WS5A 3A3JA 4MLLA 4OH0A 3WS0A 3OPHA 3OCNA 2ZMAA 1IEMA 1MWSA 3N6IA 4CPKA 1KGEA 4HESA 3IXDA 1L0EA 3TOIA 1DJBA 4E6XA 4KZAA 5EVIA 4DE2A 4MBHA 2Q9NA 3JYIA 2WGWB 1YLYA 3IF6A 4WEKA 5FASA 1Q2PA 3FWLA 4PM6A 4EBLA 3NBLA 1E4DA 3PBSA
chains in the Genus database with same CATH superfamily
1KX3B 1B6WA 4S2PA 2ZQDA 2Y2JA 5EOEA 4NE6A 1UR9A 3PAGA 2NUPC 4P87A 2Y2KA 5C3IB 5B24B 3HVFA 4KZ4A 1F98A 1OJGA 2IWCA 4IVIA 3AZGD 2PU4A 1Z09A 4BENA 5IU1A 1P9WA 5EOOA 5BNXB 1ZG4A 5AV6D 3X1VA 2ZQAA 5AV8C 4KZ3A 4GZBA 3AV1D 4JXGA 1L2SA 4OLGA 4N9LA 4R4RA 3LELC 5GT3A 4XT2A 2Y2PA 5DNMA 1MC0A 3MXRA 5HDDA 3M7PA 4J8WB 2AVXA 1KDWA 3BM6A 2X02A 3CITA 2BG1A 2H28A 1P3AB 3T50A 4KQOA 4O0PA 3ZNTA 4NXEA 3UB5P 4UUZB 2LB5A 3IBRA 2ZY4A 3AZIC 3AGEA 4WU9D 4XUJD 2F8NK 4NZ1A 4Y13A 4IBEA 4KG2A 4KUOA 1NWZA 1YLJA 1DP8A 1JNUA 1T19A 4NKPA 1NXYA 3WAAA 5HPIA 3LZ1A 4LGWA 5AV9B 4Z5TD 1EROA 4LV3A 2GDNA 2R9XA 4KG6A 2PR5A 4F3LB 2WKHA 2ZL1A 1K54C 1M18A 4YM6D 3RH8B 1TZYC 2XD5A 2O99A 3VP1A 5DF7A 4J8XB 3KUYC 3VP2A 2J8PA 1KX5A 4JJNA 1NY0A 5GSUD 3MQQA 2A2LA 1ESIA 1XA1A 3MZDA 4BD1A 2QJ7A 2VGLM 4ARZB 4Y0UA 1F66D 3F1PB 3B0DB 2VJWA 5GLDA 3VH6W 3LJAA 4JF6A 4JGRA 5DJUA 3C1BD 5B31C 1S1ZA 5DNND 4JF4A 3C1CD 4EQIA 5F68A 3AZFA 3H0LC 3A3IA 5G4ZA 4OOYA 2Y2NA 4HP9A 1S4RA 1P3OD 3REHD 5CGWA 3IH8A 4IUKA 1IYQA 5AQBA 3MQ0A 2BLSA 5DNMB 3B47A 4ZUXC 2E8JA 4OQHA 4O8GA 3VSKA 4Z66D 3WTPD 4MEZA 4I3JA 1H8ZA 5B2IA 2F8NH 2NQBB 4HEFA 1UWPX 3SS4A 2FFYA 4H9PA 1BLHA 3MQOA 2QWSA 5CGXA 1Q2QA 5EPHA 1AOIA 4UHUA 4EW7A 3B0CW 2HF6A 2YKFA 2ZQCA 1R4VA 1OT6A 3PTEA 2J9OA 2XK1A 4II7A 1N9BA 3ZDJA 1W1PA 3BQ8A 3IX4A 1M18B 3UB6A 2BYMA 1KVLA 2X01A 4OPYA 1U35C 1KX5B 3ULFA 4JJNB 3UN7A 3AZHD 3V39A 4MMNA 4OQIA 1CXWA 2YFWA 3WA9A 3S7QA 1YU4A 5MC7A 5FDSA 5B33D 2J80A 3BY8A 4HMDA 3MGPA 3LEZA 4KENB 3REJD 3CI6A 2HDSA 3ZG9B 4GNUA 3U4LP 3UT9A 1NRJA 3NI9A 4BLMA 3MF0A 3BRMA 1GHPA 2ZJ9A 3CJMA 3GTCA 4H9RA 3AZFB 3Q7VB 3MGRC 3WD4A 1WYCA 3HLGA 1YLTA 4Q0HA 1P3KD 1KS0A 4X23A 3R45A 4PPRA 3VH6A 3UB8A 3LYXA 3LGOA 1KGFA 3VP0A 4ZBJC 2NZDC 5EVIC 3LELD 1MZUA 1XXMA 4YS3B 3W99C 2GNXA 3HJIA 1J7MA 2WUQA 4KZ7A 4H9NA 3C4OA 2Y2HA 1M19D 2AROB 3UB9A 1MWRA 5B2IB 3A6NB 4NYYA 3X1TB 4IBJA 3IF6B 4DE1A 4QWOA 5GLBA 3WD2A 3W96B 4H9PB 5AV6A 4MB4A 4ZAMA 2L4RA 3AV1A 2G7UA 4FOFA 3G6OA 1K57C 1MWTA 3AN2B 3MFXA 3K3CA 3MSHA 4NE3A 3LCEA 3L28A 4Z2IA 1P3GC 3X1VC 2HP5A 3BJNA 2EA9A 2Y8HA 1K4FA 5HAIA 5M18A 1GSVA 3LZ0B 2BYMB 5AY8D 2Y2IA 2WKRA 1PZPA 3EEHA 3UDIA 2Y59A 4WU9A 4XUJA 4CQHA 2EXAA 1ES3A 5DKKA 1DP9A 4E3OA 1W8QA 1YPRA 1DJAA 2B02A 5KSHA 5B0YD 4JLFA 4LPZA 2JKGA 5F99D 3WRTA 4QU3A 3REID 3JVUA 4Z5TA 1PWDA 4UA9A 3WWXA 3V3RA 5B32C 4YM6A 3WAAC 1XJ2A 5TJJA 5HZHA 3T1SA 3LZ1C 3NY4A 3BLSA 3CAXA 4O01A 3P5JB 5GSUA 3D9YA 1RGYA 3HBRA 5L07A 4R70A 4QLCC 2BTFP 4M4XA 1F66A 2W27A 3X1SD 3GR2A 2ZM5A 4E3NA 3V67A 2V8CA 3C1BA 1P3BD 3IXGA 3T4LA 3VP4A 4LRZE 3C1CA 5B0ZB 2P08A 1PIOA 3KWQD 2M7UA 3UY6A 4WZ5A 3LJAC 1H5XA 4E3JA 4G92C 1GHMA 4R6LA 4Y5FA 3AZJD 1P3OA 5B40D 2VV8A 2E8IA 1BSGA 4JGPA 3LR4A 3RXXA 1GPFA 1GA9A 3O86A 2RIQA 4LG2A 3WS1A 4MN6A 4EQ1A 3REKC 3DAVA 1NYYA 3IF5A 2P74A 4I5SA 4Z66A 3WTPA 3C5AA 4PKYG 1YU2A 1PI4A 1ZLAC 5BNVA 5U47A 4JKTA 4OPQA 1FSWA 3HONA 2IWDA 5FEGA 3GQZA 4ID4A 1ID3D 1P3ID 3GRJA 4EXOA 4FSFA 4IJFA 2KDKA 4WU8D 2W1TB 1AOIC 3G32A 3UTAC 4YM6B 3ZCZA 2G5IC 3P98A 5AQ9A 3IX8A 2DMWA 4WEJA 5F83A 3O62D 3AZLD 5GSUB 3AZHA 1MXOA 3KYZA 4OQ0A 5AQAA 3AFAB 1UR8A 2VZWA 5B33A 2DF4C 2ZLYA 1LHYA 2VK3A 4NY2A 4BQMA 1XJ3A 3WA9C 1U60A 2ACGA 1P3FB 2NUTC 3UTBD 3VMAA 5HFOA 3MGPC 3AZNC 4N1HA 4BMWA 4GW9A 1GXDA 3TU4D 3UT9C 3IWOA 1P3KA 5GHYA 2Z2MB 4R3BA 1IYSA 4EO5B 2WK0A 1P3OB 5CHUA 2DNSA 2GZAA 2Y2LA 3UPNA 3LELA 4YNRA 2HIOD 2PYOD 3EPLA 4X23C 4E6WA 1I5QA 1FQGA 5AVCD 5L10A 4CLCE 4Z66B 3F1NB 5E5AD 4GDBA 1M19A 5GLAA 2W3EA 2KX6A 5B2JD 4H6JA 1NRFA 1KVMA 1P3MC 3N8LA 4FD8A 4KUDB 1K25A 4Y7PA 4MLLA 3W97B 4OH0A 1P3LB 3UE6A 3AZGC 3OCNA 2QYBA 4Y15A 5DFYA 2PD8A 1A7WA 1L0EA 3MGQB 4KZAA 5AV6C 4DJ2A 3JYIA 3WD1A 3PHYA 3AV1C 1M1AC 3PXPA 3NULA 5B32D 4ZJ1A 2IWBA 2Y4AA 3SH9A 5AY8A 2EFUA 3LR5A 2WAEA 5CP6B 3AZHB 3FG8A 3IWQA 1LI9A 1W8YA 4DE3A 2FH5A 4QLCD 4HMCA 1NZOA 5CTNA 5B0YA 3B6FC 3RELD 2XROA 3UPPA 5F99A 3IS2A 4WU9C 4XUJC 3REIA 3N3FA 3VH5T 4UA6A 3L26A 3GVBA 5HDSA 1W5DA 3A1KA 3DTKA 3S22A 5G49B 5EVLA 4Z5TC 1HQ3D 3WS2A 2O9BA 5AV8B 2J8YA 1RGZA 1ACFA 2W3DA 1F2KA 5E43A 4NZ3A 3X1SA 1PW1A 1A0KA 2BYKA 4WMCA 4GOGA 1N1JB 1HTZA 3REKD 1K55A 1P3BA 2J3WA 3BFGA 1ES4A 5I94A 2W1RA 3B33A 1TF1A 1F66C 1TDLA 2HDQA 4IVKA 4EU0A 2W3HA 3JVVA 1IOUA 2D49A 4X1LA 1FIKA 1ZLAD 4H6JB 2WAFA 2HP9A 1G6OA 3C1BC 5J4EA 4EWFA 5DNNC 3AZIB 2FJ7C 3C1CC 1ULYA 2ZC4B 5B40A 1W1VA 4WZ5C 3NHQA 2Z6DA 1KDSA 1FR1A 5DF9A 4JGOA 3BFFA 4X1MA 1OGBA 2Q0OA 3REHC 5FQMA 3S7NA 2XD1A 3DTMA 1YSQA 3FKWA 4GS9A 4Z2MG 1MPLA 1YT4A 2INWA 3F1OA 1TZYB 2JE5A 1SKFA 3KUYB 2D01A 3WTPC 1U35A 3LIBA 3GSGA 5CECA 1TD5A 1UGUA 2WZZA 1ID3A 4OVDA 2ZY3A 1P3IA 3IT9A 1HTAA 3MBZA 4FCFA 2V1ZA 4WBGA 1NYMA 1BTLA 5FQQA 2VA0A 1SKOA 4WU8A 5B31B 1ZC2A 4S2IA 5E2GA 4KHAA 3AV2D 3AZND 1JWVA 3PR6A 3MR0A 4R3AA 3H0RC 4JPMA 3TE8A 3AZLA 2G2WA 4GHIA 1S32B 5DTTA 1BH9B 1TS8A 3OCLA 3KSHA 2V2FF 1TS0A 3Q7ZA 5JRGD 4OJOA 3BFEA 1MWUA 4Z9QA 2F8ND 1B67A 3LY3A 5AVBD 4ZUXB 4A5RA 1UWNX 2H10A 2I72A 4XUXA 4WELA 3NQJA 4EBPA 2PD7A 5B33C 4ZDXA 1P34D 4C6YA 3BECA 1MBLA 2HUEC 2O9AA 1AXBA 5HSQA 1P3MD 3NQUB 3REJC 1VEUA 4GKUA 4OUIA 2PYRA 2KLIA 1K56D 3QP5A 4LFUA 5TBMB 2CV5D 4J8VD 2HZ5A 1K57A 2DRWA 4GJ4A 2Z2LB 2PYOA 1P3KC 2WKQA 2ZM0A 4HOIA 5L8MA 3UNWA 1P3GA 2HDRA 1IYPA 5AVCA 5E5AA 3UMDA 5HDCA 4G3VA 1YMXA 5EE8A 2V1AA 1M1AD 5B2JA 3G34A 2O0YA 3F1OB 3LO7A 1HLUP 3W4PA 1U35B 4Z2JA 1M19C 4DMZA 4HJ6A 1E25A 1BH8A 1DRMA 4R3JA 3WKJD 3U2AA 3B6FD 1CI8A 1K38A 3BLMA 4M6BA 5BT1D 3EGXC 1LT0A 4KGCD 1HZOA 3C7UA 4QY6A 3AZMD 3AZED 4LENA 5HL1A 3BWLA 3L9KA 5B32A 3GV9A 5EV0A 1RCJA 3VH5W 1TAFB 3MGRB 3KYQA 3O88A 2XA7S 4GHIB 1ES2A 1GSWA 2V5OA 2WGWA 2ZC7A 5IHVA 3IP4C 5L09A 4XZQC 3LFVA 4QLCA 5AY8C 3MNND 4ZBJB 2NZDB 5EVIB 4H9OB 1YQSA 3UPOA 1GSXA 1W63M 1E15A 4FTXA 3W99B 2RCXA 1H0MA 5B0YC 1BFMA 5F99C 3REIC 3BYDA 1T1CA 1MKIA 5F82A 3L7HA 3S7PA 4NXFA 4MB3A 1HQ3A 3NDEA 4U0TA 4P6BA 2FJ7D 5BPVA 2V20A 4ETZA 2CMNA 1N9NA 4S2NA 1OGGA 2PBYA 3AGDA 5FEFA 1JTGA 3BW6A 2CWEA 5B1LC 3REKA 3X1VB 1P3GB 4TX8A 3L29A 3M2JA 2LY8A 3X1SC 5KIZA 5GT3B 4XT2B 3G2ZA 1ZLAA 3ZYTA 4JXVA 1K55C 1P3BC 1GA0A 3P09A 3SOIA 2Y91A 2QHKA 3H9WA 4GH9A 1G68A 3KWQC 1BH8B 5HWTA 5TFQA 3ZG5A 1YKDA 2JKRI 5TR7A 4IUHA 1K6SA 3AZJC 4DXBA 1OT9A 5B40C 3C8CA 2YFVA 4EUVA 3Q07A 5B32G 2QKPA 2P7JA 4WF0A 3KYEA 4DRBA 3UTAA 5DFXA 3WAAB 5CHMA 3FZCA 3LZ1B 1E6PA 3ITBA 4KQRA 2H0YA 3ZGAB 4ME4A 2ZL1B 1E6RA 2IOUA 1Z6FA 2PYPA 4HMEA 4Y0OA 3OPRA 4HBUA 4QLCB 2JBFA 4AWLC 2GJ3A 3FC7A 1FOFA 1FSYA 4B88A 3M6BA 4IBKA 1JWZA 1L0FA 2XF3A 3VH5A 3W98D 5E2EA 1ID3C 3ICYA 1P3IC 4HNBA 3C30A 3G2YA 5A92A 4I39A 3AV2A 4PM5A 1IKIA 4H9SA 3AZNA 3X1UD 3LJAB 1KGGA 4WU8C 3D4FA 4PM9A 4G92B 2XGNA 1YM1A 3ZVWA 1PRQA 2WGIA 5BS7A 5JRGA 3O62C 4Q8IA 3AZLC 4OP5A 5AVBA 4K91A 5TGFA 5GT0D 3V9RA 3REKB 3C2WA 1KX4D 1PDCA 3QP1A 4L9GA 3NOUC 1GOIA 1P34A 2V0WA 4EERA 1ZLAB 3UB7A 3CMZA 1ES5A 2R9WA 4RYEA 1P3MA 4GLQA 2WKIA 4J8UD 4Y3IA 4IJEA 3KSIA 4R8PD 3UTBC 1K56A 4X69A 3AZGA 2CV5A 4J8VA 3KS4A 5M1AA 3AYWD 3SS3A 2L1MA 3TU4C 4LD9D 5HD3A 2YFVB 2P04A 3MGSD 4IBIA 4NXBA 2ZQ7A 3A3EA 1AOIB 2X71A 3KXBD 3MKEA 3UTAB 4HY8A 2HIOC 2PYOC 1M1AA 3DWKA 1P97A 3IH9A 5AVCC 3RJUA 3PBRA 5E5AC 4NFTA 5JA4A 3B6GC 1OTAA 4LRYC 3B3XA 5B2JC 4PAUA 3E2KA 4UQIS 3WKJA 4ZRRA 4XZQD 4IBDA 3E0YA 3B6FA 1FCNA 3E4PA 4PKYA 5FQ9A 1D06A 1NLYA 2G2UA 4WZ4A 4KGCA 4KZ9A 4JGQA 3HUNA 4IJGA 4GHAA 1IELA 1EQZD 3AZMA 2YFWB 3WA9B 3CHWP 3G35A 3UE1A 2VQRA 3MGPB 3AZNB 4LV1A 5GXQD 4KQDA 3UT9B 4H9QA 2F8NG 1PFLA 1SDNA 4H9RB 2RTSA 2VX8A 3MNNA 1PZOA 4HIAA 3HL9A 4X23B 5CPID 1XA7A 5FL3A 3R45B 3JPUA 3SW1A 5B1LD 2NQBC 3BQAA 4IBCA 1IEMA 1MWSA 3RELC 4IBFA 1CJFA 3IXDA 1H3OA 3T12B 3GDIA 4MBHA 1Q9CA 5DNNA 4H9NB 1ZHHB 2FJ7A 1H0IA 3AZGB 4EBLA 3PBSA 3S7OA 1WWIA 4E3KA 4DDSA 1HQ3C 3A0SA 5CPJD 5AV6B 3AZKC 2FN2A 3REHA 1JFIA 4S2NC 4K0XA 3AV1B 4EEUA 4OJPA 5CTMA 4DJ3A 1F1EA 1T18A 1M1AB 1LLBA 2IO5C 4G3WA 3NDGA 4NE5A 5AV5C 1KX3D 1ERQA 4Z2KA 4DQYB 5A91A 5B24D 4H8RA 3AGFA 3B6FB 4WU9B 4XUJB 1XJ4A 3HREA 4WLAA 3R7WA 4QY5A 4ESPA 5BO0A 1Y4OA 3NOPC 4FH2A 3HUMA 3DW0A 4YFMA 1XFQA 3CLOA 3DWZA 3WX7A 5FQJA 2OOLA 4Z5TB 3EQUA 4MN7A 4J8WD 4R0QA 3G4PA 1TDGA 1BYWA 3OLOA 4E45A 1P3AD 4EUZA 3K3DA 5KMWA 3W98A 3NJAA 2O9CA 1F66B 3W2ZA 3X1UA 4YINA 4WZSB 3REJA 2V8FA 3C1BB 2A24A 5DNNB 2FJ7B 4Y2FA 3C1CB 1PNEA 2A49A 5JYPA 2ZC3B 1E88A 5AV9D 3A1IA 3AV2C 4H9SC 4MDZA 1WYBA 2VEAA 2VGJA 3HUOA 2UV0E 2OWHA 5GT0A 4J8XD 3IX3A 3REHB 1KX4A 1JFIB 4LLOB 3D72A 5BS7C 5JRGC 4UA7A 3H82A 4U3TA 1VQQA 3FKEA 2HGVA 1CK3A 5AVBC 4IBBA 2EFXA 3UDXA 3VV4A 3TRCA 4J8UA 3WTPB 1IFQA 1QO6A 4R8PA 3B6GD 2XR0A 1P34C 4NXGA 1I2SA 3QNBA 4HI4A 5BNVB 4Q0JA 3AYWA 4NYUA 3N8SA 1C3BA 2HDUA 4LD9A 2UWXA 4DRAA 4JF5A 2W0NA 3A0VA 3D3OA 2CV5C 4J8VC 3MGSA 3R7WB 2Y2MA 1YMSA 1O6IA 2XH9A 2PT7A 3H0MC 3NECA 3KXBA 2B5RA 5DNMD 3KSFA 3F6TA 1G6AA 4CAYA 1SCWA 1KU5A 1F5MA 1OTIA 5FDHA 4XZQA 5F5YA 3O5YA 1KOUA 4PM7A 4HH3A 4GHLA 3FYZA 3MZFA 1ED7A 1MY8A 4FH4A 2NQBD 3WKJC 1EQZA 4EV4A 3LR0A 5B33B 5HWVA 1HVBA 2PDRA 5BT1C 3HSHA 1SHVA 2HUEB 1JTDA 4KGCC 3LIDA 4E3MA 3REJB 5GXQA 1EW0A 1W1YA 1ERMA 4OKPA 3AZMC 3OPPA 3AZEC 4P0MA 1Z2CB 5HAQA 5FAPA 4D2OA 2PRFA 3BFDA 2QZ6A 2YKHA 3BY9A 5M19A 1ALQA 5B1MC 2Y2GA 2MJ6A 4BBVA 2QJ5A 1P3KB 3MKFA 5CPIA 3ZG8B 3AZKD 2WKEA 3QP4A 5B1LA 4KQQA 1KX5D 3MNNC 3H82B 5KDMA 4DE0A 3LELB 5G18A 1LL9A 4G91C 5AV5D 3IXBA 2EX6A 3T4JA 3W4OA 1FCMA 1M19B 2EX9A 1TEMA 4UEYA 3KWQA 1XJ6A 4BBUA 4LCLA 1ZTUA 3AZFD 3AZJA 1S6RA 1IYOA 1BLPA 2HV1A 3I7JA 2OV5A 1KE4A 2Z6CA 4L9EA 4CLCC 3WD0A 1K4EA 3FPWA 1STZA 3OBFA 4X56A 3C7VA 4YS3D 1S1YA 1TS6A 5CEBA 1LSXA 1L0GA 3NIAA 1P3FC 4XZQB 5AY8B 4WNNA 4WM9A 5HX9A 2AROD 3LIAA 1TS7A 3KFUG 3A6ND 3X1TD 3EG5B 4E44A 4B9OA 3MVDC 5BNXA 3W96D 3SZTA 3IBJA 3LUQA 2XA7M 5B0YB 1XP4A 5CX7A 1OTDA 5F99B 3IS2B 3AN2D 3REIB 1Y54A 4WN5A 5A93A 2Y2OA 4IBRA 5DVAA 4LRXC 4DRTA 1ZKJA 2L5AA 1LL5A 2JKRM 5F1FA 2W8SA 5E2HA 3MFDA 1P3AA 3LZ0D 3VP3A 3HLWA 4XUZA 3O62A 2LB9A 1BULA 5KSCA 3IHBA 2G5HC 4OPRA 4EESA 3QHYA 3Q1FA 5FA7A 3SH8A 5KDMB 3X1SB 2BYKB 4Z2GA 1W2EA 3NC8A 1PW8A 1H8PA 4N9KA 3W98C 4OOMA 1P3BB 3BFCA 2JN7A 2QPNA 2WZXA 3UTBA 2VLGA 3KWQB 2R78A 1KE0A 1E6ZA 3X1UC 3CG5A 4F3LA 5CPKC 3TU4A 3AZJB 2XRNA 3LY4A 4P6ZS 4J8XA 3HLBA 5B40B 4GDNA 4NG2A 3VSLA 4MB5A 1YLPA 1CK7A 2H0TA 3KO6A 2HIOA 2W3GA 3ITAA 3IWIA 4X6TA 4RX2A 5GT0C 4ARZA 1KX4C 3F1PA 3H7WA 2V0UA 4DN0A 4HQAA 3RXWA 3B6GA 2JKTI 3DBAA 4GS9B 3TSGA 1E6NA 4DF6A 5A90A 1RP5A 4WNNB 1XX2A 5B0ZD 4AWLB 4J8UC 4R8PC 4R4SA 1I2WA 2C5WB 4BL2A 1P3PC 2FFFB 3KSYA 1SDEA 4EETB 2DCFA 1ID3B 3AYWC 4LV0A 3LI9A 1P3IB 1CF0A 4LD9C 4EBNA 4S2KA 5FAQA 3KSGA 3HLFA 5EFWA 2QMIA 4IBGA 3MGSC 2ZBBA 3W4QA 1SKOB 2HJ9C 4WU8B 3E2LA 3KXBC 2ZM2A 3IHAA 2J3TD 4KHAB 1EAKA 5CRFA 4OLDA 1HD8A 4X55A 5B1MD 4ZJ2A 3MZEA 3O62B 3AZLB 4QPRA 4X25A 2ZOIA 2KOIA 3CZDA 5J7EA 2OLVA 1J9MA 4CSRA 2NQBA 1S4SA 5DF8A 2K7SA 4KG5A 3RELA 2EWWA 3E98A 3RFBA 1PZRA 5D3OA 4KZ5A 3VE3A 1T1BA 4HBTA 5CGSA 2ZY2A 4LCMA 1XGIA 3NQJB 1VB6A 1EQZC 4JXWA 1H8MA 3UTBB 4OP8A 1YU0A 5GXQC 1VEUB 3TU4B 4AFIA 3AZKA 3N4IA 1L0DA 1QMEA 4Y0TA 3G31A 2Y55A 4N1XA 2J9PA 3UE3A 2ZD8A 2XEPA 5DKLA 2HIOB 2PYOB 4NEED 3AFAD 4CLCD 5CPIC 1V9ZA 5CEDA 5AV5A 5L2FA 5AVCB 3H7WB 3MMHA 4HGAC 5E5AB 3B6GB 4S2OA 1BZAA 5B2JB 3VOLA 3T4KA 3CUEC 1P3FD 5F1GA 4D60A 1XFNA 2WYXA 3UO9A 5HWWA 3Q7VA 4OOLA 1X0OA 2W3FA 2Y79A 5FUGA 1ONHA 3AL0C 1S32C 3C38A 3MVDD 3FPVA 5EM0A 1D7EA 2RVQD 5FI6A 4X53A 4C75A 5CPJC 3N7WA 3Q81A 3QP6A 4RQ9A 1BLSA 1WA9A 4MBKA 2XQZA 2PBDP 3M2KA 2ZC5B 4UQIM 3WS5A 3A3JA 3WS0A 4YS3A 3OPHA 4I3IA 3OOVA 2ZMAA 3E4QA 5C5KA 5B32B 4HESA 1KX3C 1DJBA 2AROA 4E6XA 4K08A 4DE2A 1YAXA 3A6NA 4KUDD 2WGWB 5C3IC 4CSRB 5B24C 3X1TA 1YLYA 2JHEA 3IF6A 5DJTA 3W97D 3W96A 1P3LD 3GECA 3RELB 1E3UD 4R1GA 5CHLB 3AN2A 3MGQD 4X68A 4OONA 2JCHA 4JXSA 5BOHA 4PMAA 2PHYA 5HARA 3HLDA 3UDFA 3NCKA 3LZ0A 2EXBA 5CPKD 3M6HA 1HQ3B 1GCEA 3AZKB 5LBRA 4J8WC 3NOTC 2J7VA 5CP6D 4QNLA 2B18A 1P3AC 5CHJA 3L25A 2F8NA 4F94A 2IO5B 3BEBA 5AV5B 1VETA 1LSVA 1IKGA 1EI5A 4WYYA 2IA2A 5CXWA 4GD8A 2EWVA 3PBQA 1S0WA 3WS4A 2CC1A 3KS8A 4IBXA 4MCWA 2EX2A 3MXSA 5FUGB 5AV9C 2VGLS 1P3PD 4OJ6A 3KX0X 1YUEA 2M7VA 5HD5A 2ZC6B 5AV8D 3DTIA 4WJ3C 1W79A 1FCOA 1OPXA 4J8XC 4KZ8A 3QP2A 4HH2A 3ISGA 1P9RA 2PU2A 3LR3A 1AWIA 1W63Q 2JC7A 1FILA 1YU3A 4I38A 5B0ZA 1TVFA 3EWKA 3B0DC 2Q9MA 4S2JA 5KZHA 1T3UA 3AZID 1W7FA 3T4QA 3FDDA 1T1AA 3Q82A 1K0KA 2K31A 2OLUA 4OJ5A 1OTEA 4NK3A 1BLCA 3EOIA 4KZBA 4B4ZA 4E3IA 4NZ4A 3AZEA 3EPHA 3P01A 3AV2B 3O87A 2V9AA 1L3LA 1VM1A 5B1MA 3PBNA 5GT3C 3V3SA 5DNMC 1YLWA 4WL9A 2V1BA 5DTKA 1TZYD 5AVFA 2JSSA 1OTBA 2WKPA 3KUYD 5EVEA 3L27A 3B42A 5JRGB 5AVEA 4I3AA 2F8NB 4QJGA 1F9IA 3ZHHA 3TJZC 2EX8A 1L6JA 5EECA 2H5SA 5AVBB 1H0GA 1VETB 3V9RB 3MQLA 2K2NA 3HLEA 5E2FA 1PWGA 3PBOA 4ZBEA 1P34B 4CJNA 4IEDA 3OZHA 2W1TA 5B31D 1P3MB 2HJEA 1PI5A 1V9YA 1LL8A 5I5LA 1DP6A 1S66L 4ETXA 4K0WA 2CV5B 4J8VB 1LI0A 1S32D 2XSSA 3IXHA 4UAAA 2Y2QA 1M18C 4Q0IA 5CERA 1Y28A 3AFAA 1BT5A 2HP6A 4CLCA 3B0BA 3VFFA 3S4XA 2VV7A 4G3KA 3T4SA 3T1XA 1KX5C 4WMCD 3SS5A 4JJNC 4ZUXD 3OC2A 3PAEA 5K5BA 2XFSA 3QP8A 4KZ6A 4YWZA 5HAPA 2I9VA 2WGVA 1P3FA 3T1QB 3EGDC 1CI9A 4RX3A 3K2NA 5JA4B 3WD3A 4WV4B 2WADA 1ZG6A 1FR6A 3MJQA 3L2AA 1M40A 3MVDA 3WKJB 4L0LA 5JYOA 3AZFC 3HCYA 4KGCB 5J3WA 3AZMB 3AZEB 4LV2A 3PYPA 3F1NA 3ZG7B 5GL9A 3MS6A 5B1MB 1OJ5A 4DDYA 4YS3C 4H9QB 4KUDA 2ZMFA 3EEAA 5GLCA 4L9FA 1U35D 3W97A 2ZOHA 1P3LA 1VHMA 3MNNB 4JBFA 2AROC 1MKMA 4O7DA 4MN5A 1E3UA 5B2IC 4GD6A 4G91B 3A6NC 3X1TC 3MGQA 3IF6C 3ZFZA 2P9VA 5IS1A 3W96C 1LSWA 5F69A 2FZ0A 5GHZA 4NZ5A 3AN2C 1K6RA 1H3OB 3V5MA 5FATA 3VOYA 5CPKA 3MGRD 3T1RA 2XFTA 2F2AC 5CP6A 3HJKA 1JVJA 3LEQA 4RA7A 1KE3A 3LZ0C 2DQNC 4DXCA 2OSUA 4CLCB 3PBTA 4KUKA 4R23A 4GN2A 2NZDD 5EVID 2PR6A 3T4OA 1DJCA 4P85A 1P0ZA 1PYYA 3W99D 1JWPA 5AQ7A 1WE4A 4EEPA 5FI2A 3VFHA 1XPBA 5G49A 1SZVA 1O07A 4S2MA 1H8YA 4XXRA 4BJPA 1P3PA 4GCZA 1OMEA 2ZY5A 4Z2MH 3MVDB 4QHCA 2OAP1 5FSRA 4BL3A 5FQKA 2BASA 5AV8A 3CPTA 5FAOA 1G28A 5EUAA 1S67L 5HPFA 1AIWA 4FUWA 2C6WB 3UE0A 3V50A 1N1JA 5BO0B 1P3GD 3X1VD 2ZM8A 3S1YA 4GB7A 3A0RA 3GMWA 4ZTKA 4WUJA 5A8BA 5GT3D 1N4OA 2PAVP 3O3VA 1E8BA 3C4PA 3DTEA 3FV7A 1XKZA 3AZIA 3SH7A 3W8KA 4Z1WA 3HLCA 3OPLA 1CEFA 2OWJA 4HP4A 3P7NA 5B0ZC 3WTPE 4BWIA 2XDMA 1W1TA 2ZQ9A 5HW3A 3W98B 4HJ3A 2P9VB 2JKTM 3LIEA 1WWSA 4ZJ3A 3ZG0A 2RL3A 4DKIA 5IT5A 3LICA 3MXQA 3X1UB 2A24B 4C3QA 5CPKB 1EWZA 3G30A 1K54A 4S2LA 3WAAD 1TZYA 3R4KA 3A3FA 4NETA 3LZ1D 3KUYA 4OJLA 2J3TC 4MNRA 2D02A 1NZUA 2A3UA 2M1CA 3LIFA 1G5UA 3VE4A 3A3DA 1PWCA 1NJ4A 1O7EA 4HJ4A 3WRZA 3E4OA 4M3KA 1M18D 1DY6A 2ZMVA 2VKSA 5DTSA 3QNCA 4QD4A 5GT0B 3TG9A 1KX4B 2JKFA 4JJND 4OQGA 3CWFA 2XLNA 3IQAA 1CQAA 3FKVA 5B31A 4P6ZM 3CUEA 5HL6A 4E3LA 2VV6A 1M6KA 4J8UB 4R8PB 4N92A 1CEGA 3LJAD 1P3PB 2VGKA 5J8XA 3AYWB 1S32A 5F6AA 2L0WA 5G4YA 1BH9A 4LD9B 4YM6C 5CPJA 3CPTB 5AJGA 1ESUA 3MGSB 3LI8A 4BD0A 5GSUC 2B95A 3ZNYA 4ZUXA 1ONGA 3KXBB 3VH6T 3AFAC 3EPJA 4YOFA 3EQVA 5EM1A 4QB8A 4MBFA 4UPKA 3N8RA 1KX3A 3ZVTA 1XGJA 1YLZA 4CAYB 3NQUA 1BUEA 5B24A 4Z2LA 5TBMA 3TW8A 1YSPA 2OAQ1 5B2ID 4B4XA 2GX5A 1EQZB 4EO5C 2ZQ8A 1P3OC 2RVQC 4E04A 5GHXA 1NLZA 1H3QA 1AOID 4HHDA 1N9OA 5FI7A 4BBTA 3UTAD 5GXQB 1QMFA 3RTYA 4J8WA 5FQIA 4Z66C 4PHTA 2HPBA 4B93A 3VOZA 4PM8A 5CPIB 4KUDC 4UUZA 5B1LB 5B31G 4R38A 3W97C 4HGAB 3B0CT 1P3LC 1ODVA 1GHIA 4OPZA 4U0XA 1J3WA 3WA9D 3ZQ5A 3MGQC 4RVAA 3UMEA 1N9LA 3MGPD 3EPKA 3MGRA 1TAFA 5AV9A 4Z2HA 3UT9D 4Y17A 3N6IA 4CPKA 1KGEA 3TOIA 5CPJB 1D1JA 1YU1A 2NZDA 4IHQA 5EVIA 4H9OA 2Q9NA 5CP6C 3AZHC 4X23D 4WEKA 3T4TA 5FASA 1Q2PA 3W99A 3FWLA 4PM6A 3NBLA 1E4DA
chains in the Genus database with same CATH topology
1KX3B 1B6WA 4S2PA 2ZQDA 2Y2JA 5EOEA 4NE6A 3PAGA 4P87A 2Y2KA 5C3IB 5B24B 3HVFA 4KZ4A 2IWCA 4IVIA 3AZGD 2PU4A 4BENA 5EOOA 5BNXB 1ZG4A 5AV6D 3X1VA 2ZQAA 5AV8C 4KZ3A 4GZBA 3AV1D 4JXGA 1L2SA 4OLGA 4N9LA 4R4RA 3LELC 5GT3A 2Y2PA 5DNMA 3MXRA 4J8WB 1KDWA 3BM6A 2X02A 2BG1A 1P3AB 4KQOA 3ZNTA 4UUZB 2ZY4A 3AZIC 3AGEA 4WU9D 4XUJD 2F8NK 4NZ1A 4IBEA 4KG2A 1YLJA 1NXYA 3WAAA 3LZ1A 5AV9B 4Z5TD 1EROA 4LV3A 2GDNA 2R9XA 4KG6A 2WKHA 1K54C 1M18A 4YM6D 1TZYC 2XD5A 3VP1A 5DF7A 4J8XB 3KUYC 3VP2A 2J8PA 1KX5A 4JJNA 1NY0A 5GSUD 1ESIA 1XA1A 3MZDA 4BD1A 4Y0UA 1F66D 3B0DB 5GLDA 3VH6W 3LJAA 4JF6A 3C1BD 5B31C 5DNND 4JF4A 3C1CD 4EQIA 3AZFA 3H0LC 3A3IA 4OOYA 2Y2NA 1P3OD 3REHD 5CGWA 3IH8A 1IYQA 5AQBA 2BLSA 5DNMB 4ZUXC 4OQHA 3VSKA 4Z66D 3WTPD 4MEZA 1H8ZA 5B2IA 2F8NH 2NQBB 4HEFA 3SS4A 2FFYA 4H9PA 1BLHA 5CGXA 1Q2QA 5EPHA 1AOIA 4UHUA 3B0CW 2ZQCA 1R4VA 3PTEA 2J9OA 2XK1A 1N9BA 3ZDJA 1M18B 2BYMA 1KVLA 2X01A 4OPYA 1U35C 1KX5B 4JJNB 3UN7A 3AZHD 3V39A 4OQIA 2YFWA 3WA9A 1YU4A 5B33D 3MGPA 3LEZA 4KENB 3REJD 2HDSA 3ZG9B 4GNUA 3UT9A 3NI9A 4BLMA 3BRMA 1GHPA 2ZJ9A 3CJMA 3GTCA 4H9RA 3AZFB 3Q7VB 3MGRC 1WYCA 3HLGA 1YLTA 1P3KD 4X23A 3R45A 4PPRA 3VH6A 1KGFA 3VP0A 4ZBJC 2NZDC 5EVIC 3LELD 1XXMA 4YS3B 3W99C 2WUQA 4KZ7A 4H9NA 3C4OA 2Y2HA 1M19D 2AROB 1MWRA 5B2IB 3A6NB 4NYYA 3X1TB 4IBJA 3IF6B 4DE1A 5GLBA 3W96B 4H9PB 5AV6A 4ZAMA 3AV1A 1K57C 1MWTA 3AN2B 4NE3A 3LCEA 3L28A 1P3GC 3X1VC 2HP5A 1K4FA 5HAIA 5M18A 3LZ0B 2BYMB 5AY8D 2Y2IA 1PZPA 3UDIA 2Y59A 4WU9A 4XUJA 2EXAA 1ES3A 4E3OA 1W8QA 1DJAA 5KSHA 5B0YD 4JLFA 5F99D 3WRTA 4QU3A 3REID 4Z5TA 1PWDA 4UA9A 3WWXA 3V3RA 5B32C 4YM6A 3WAAC 3LZ1C 3NY4A 3BLSA 3P5JB 5GSUA 1RGYA 3HBRA 4QLCC 1F66A 3GR2A 3X1SD 2ZM5A 4E3NA 3C1BA 1P3BD 3IXGA 3VP4A 3C1CA 5B0ZB 1PIOA 3KWQD 3UY6A 4WZ5A 3LJAC 1H5XA 4E3JA 4G92C 1GHMA 3AZJD 1P3OA 5B40D 2E8IA 1BSGA 3RXXA 1GA9A 3O86A 2RIQA 4LG2A 3WS1A 3REKC 1NYYA 3IF5A 2P74A 4Z66A 3WTPA 3C5AA 1YU2A 1PI4A 1ZLAC 5BNVA 5U47A 4JKTA 4OPQA 1FSWA 3HONA 2IWDA 3GQZA 4ID4A 1ID3D 1P3ID 3GRJA 4FSFA 4IJFA 4WU8D 1AOIC 3G32A 3UTAC 4YM6B 3ZCZA 2G5IC 3P98A 5AQ9A 4WEJA 5F83A 3O62D 3AZLD 5GSUB 3AZHA 1MXOA 4OQ0A 5AQAA 3AFAB 5B33A 2DF4C 2ZLYA 1LHYA 4NY2A 4BQMA 3WA9C 1U60A 1P3FB 3UTBD 3VMAA 5HFOA 3MGPC 3AZNC 4N1HA 3TU4D 3UT9C 3IWOA 1P3KA 5GHYA 2Z2MB 4R3BA 1IYSA 4EO5B 2WK0A 1P3OB 5CHUA 2DNSA 2Y2LA 3UPNA 3LELA 2HIOD 2PYOD 3EPLA 4X23C 4E6WA 1I5QA 1FQGA 5AVCD 4Z66B 5E5AD 4GDBA 1M19A 5GLAA 5B2JD 1NRFA 1KVMA 1P3MC 3N8LA 4FD8A 4KUDB 1K25A 4Y7PA 4MLLA 3W97B 4OH0A 1P3LB 3AZGC 3OCNA 1A7WA 1L0EA 3MGQB 4KZAA 5AV6C 3JYIA 3AV1C 1M1AC 5B32D 4ZJ1A 2IWBA 2Y4AA 3SH9A 5AY8A 2EFUA 2WAEA 5CP6B 3AZHB 3IWQA 1LI9A 1W8YA 4DE3A 4QLCD 5CTNA 1NZOA 5B0YA 3B6FC 3RELD 3UPPA 5F99A 4WU9C 4XUJC 3REIA 3N3FA 3VH5T 4UA6A 3L26A 3GVBA 1W5DA 3A1KA 3S22A 5G49B 5EVLA 4Z5TC 1HQ3D 3WS2A 5AV8B 2J8YA 1RGZA 5E43A 4NZ3A 3X1SA 1PW1A 2BYKA 4WMCA 4GOGA 1N1JB 1HTZA 3REKD 1K55A 1P3BA 3BFGA 1ES4A 5I94A 1F66C 1TDLA 2HDQA 4IVKA 1ZLAD 2WAFA 2HP9A 3C1BC 4EWFA 5DNNC 3AZIB 2FJ7C 3C1CC 1ULYA 2ZC4B 5B40A 4WZ5C 1KDSA 1FR1A 5DF9A 3BFFA 5FQMA 3REHC 2XD1A 3DTMA 3FKWA 4Z2MG 1MPLA 1YT4A 1TZYB 2JE5A 1SKFA 3KUYB 3WTPC 1U35A 3GSGA 5CECA 2WZZA 1ID3A 4OVDA 2ZY3A 1P3IA 3IT9A 1HTAA 3MBZA 4FCFA 2V1ZA 4WBGA 1NYMA 1BTLA 5FQQA 4WU8A 5B31B 1ZC2A 4S2IA 5E2GA 4KHAA 3AV2D 3AZND 1JWVA 3H0RC 4JPMA 3AZLA 2G2WA 1S32B 5DTTA 1BH9B 3OCLA 2V2FF 3Q7ZA 5JRGD 4OJOA 3BFEA 1MWUA 4Z9QA 2F8ND 1B67A 3LY3A 5AVBD 4ZUXB 4A5RA 2H10A 2I72A 4XUXA 4WELA 3NQJA 4EBPA 5B33C 4ZDXA 1P34D 4C6YA 3BECA 1MBLA 2HUEC 1AXBA 1P3MD 3NQUB 3REJC 4GKUA 4OUIA 1K56D 2CV5D 4J8VD 1K57A 2DRWA 2Z2LB 2PYOA 1P3KC 2ZM0A 3UNWA 1P3GA 2HDRA 1IYPA 5AVCA 5E5AA 1YMXA 5EE8A 1M1AD 5B2JA 3G34A 3LO7A 3W4PA 1U35B 1M19C 1E25A 1BH8A 4R3JA 3WKJD 3B6FD 1CI8A 1K38A 3BLMA 4M6BA 5BT1D 4KGCD 1HZOA 3C7UA 4QY6A 3AZMD 3AZED 4LENA 5HL1A 5B32A 3GV9A 1RCJA 3VH5W 1TAFB 3MGRB 3O88A 1ES2A 2WGWA 2ZC7A 5IHVA 3IP4C 4XZQC 4QLCA 5AY8C 3MNND 4ZBJB 2NZDB 5EVIB 4H9OB 1YQSA 3UPOA 3W99B 2RCXA 5B0YC 1BFMA 5F99C 3REIC 3BYDA 1MKIA 5F82A 1HQ3A 3NDEA 4U0TA 4P6BA 2FJ7D 5BPVA 2V20A 4S2NA 2PBYA 3AGDA 1JTGA 2CWEA 5B1LC 3REKA 3X1VB 1P3GB 3L29A 3M2JA 2LY8A 3X1SC 5GT3B 3G2ZA 1ZLAA 4JXVA 1K55C 1P3BC 1GA0A 3P09A 3SOIA 2Y91A 4GH9A 1G68A 3KWQC 1BH8B 5TFQA 3ZG5A 5TR7A 1K6SA 3AZJC 4DXBA 5B40C 2YFVA 3Q07A 5B32G 4DRBA 3UTAA 3WAAB 5CHMA 3FZCA 3LZ1B 3ITBA 4KQRA 2H0YA 3ZGAB 2IOUA 1Z6FA 4Y0OA 3OPRA 4HBUA 4QLCB 2JBFA 4AWLC 1FOFA 1FSYA 4B88A 3M6BA 4IBKA 1JWZA 1L0FA 2XF3A 3VH5A 3W98D 5E2EA 1ID3C 1P3IC 3G2YA 5A92A 3AV2A 4PM5A 1IKIA 4H9SA 3AZNA 3X1UD 3LJAB 1KGGA 4WU8C 3D4FA 4PM9A 4G92B 2XGNA 1YM1A 3ZVWA 2WGIA 5BS7A 5JRGA 3O62C 4Q8IA 3AZLC 4OP5A 5AVBA 4K91A 5TGFA 5GT0D 3V9RA 3REKB 1KX4D 1P34A 1ZLAB 3CMZA 1ES5A 2R9WA 4RYEA 1P3MA 2WKIA 4J8UD 4IJEA 4R8PD 3UTBC 1K56A 4X69A 3AZGA 2CV5A 4J8VA 3KS4A 5M1AA 3AYWD 3SS3A 3TU4C 4LD9D 2YFVB 3MGSD 4IBIA 2ZQ7A 3A3EA 1AOIB 2X71A 3KXBD 3MKEA 3UTAB 2HIOC 2PYOC 1M1AA 3DWKA 3IH9A 5AVCC 3RJUA 3PBRA 5E5AC 4NFTA 5JA4A 3B6GC 3B3XA 5B2JC 3E2KA 3WKJA 4XZQD 4IBDA 3B6FA 1FCNA 5FQ9A 2G2UA 4WZ4A 4KGCA 4KZ9A 3HUNA 4GHAA 1IELA 1EQZD 3AZMA 2YFWB 3WA9B 3G35A 3UE1A 2VQRA 3MGPB 3AZNB 4LV1A 5GXQD 3UT9B 4H9QA 2F8NG 1SDNA 4H9RB 3MNNA 1PZOA 3HL9A 4X23B 5CPID 1XA7A 3R45B 5B1LD 2NQBC 4IBCA 1IEMA 1MWSA 3RELC 4IBFA 3IXDA 1H3OA 4MBHA 1Q9CA 5DNNA 4H9NB 2FJ7A 3AZGB 4EBLA 3PBSA 1WWIA 4E3KA 4DDSA 1HQ3C 5CPJD 5AV6B 3AZKC 3REHA 1JFIA 4S2NC 4K0XA 3AV1B 4OJPA 5CTMA 1F1EA 1M1AB 1LLBA 2IO5C 3NDGA 4NE5A 5AV5C 1KX3D 1ERQA 4DQYB 5A91A 5B24D 4H8RA 3AGFA 3B6FB 4WU9B 4XUJB 3HREA 4QY5A 5BO0A 4FH2A 3HUMA 3DW0A 4YFMA 3DWZA 3WX7A 5FQJA 4Z5TB 3EQUA 4J8WD 4R0QA 3G4PA 1TDGA 4E45A 1P3AD 4EUZA 5KMWA 3W98A 1F66B 3X1UA 4YINA 4WZSB 3REJA 3C1BB 5DNNB 2FJ7B 3C1CB 2A49A 5JYPA 2ZC3B 5AV9D 3A1IA 3AV2C 4H9SC 1WYBA 2VGJA 3HUOA 5GT0A 4J8XD 3REHB 1KX4A 1JFIB 5BS7C 5JRGC 4UA7A 4U3TA 1VQQA 3FKEA 1CK3A 5AVBC 4IBBA 2EFXA 3UDXA 4J8UA 3WTPB 4R8PA 3B6GD 2XR0A 1P34C 1I2SA 3QNBA 5BNVB 3AYWA 4NYUA 3N8SA 1C3BA 2HDUA 4LD9A 2UWXA 4DRAA 4JF5A 2CV5C 4J8VC 3MGSA 2Y2MA 1YMSA 2XH9A 3H0MC 3KXBA 2B5RA 5DNMD 3F6TA 1G6AA 4CAYA 1SCWA 1KU5A 5FDHA 4XZQA 4PM7A 4GHLA 3FYZA 3MZFA 1MY8A 4FH4A 2NQBD 3WKJC 1EQZA 4EV4A 5B33B 1HVBA 5BT1C 3HSHA 1SHVA 2HUEB 1JTDA 4KGCC 4E3MA 3REJB 5GXQA 1ERMA 4OKPA 3AZMC 3OPPA 3AZEC 4P0MA 1Z2CB 5HAQA 5FAPA 4D2OA 3BFDA 2QZ6A 5M19A 1ALQA 5B1MC 2Y2GA 3MKFA 1P3KB 5CPIA 3ZG8B 3AZKD 2WKEA 5B1LA 4KQQA 1KX5D 3MNNC 5KDMA 4DE0A 3LELB 5G18A 1LL9A 4G91C 5AV5D 3IXBA 2EX6A 3W4OA 1FCMA 1M19B 2EX9A 1TEMA 3KWQA 4LCLA 3AZFD 3AZJA 1S6RA 1IYOA 1BLPA 3I7JA 2OV5A 1KE4A 1K4EA 4X56A 3C7VA 4YS3D 5CEBA 1L0GA 3NIAA 1P3FC 4XZQB 5AY8B 4WNNA 4WM9A 5HX9A 2AROD 3KFUG 3A6ND 3X1TD 3EG5B 4E44A 3MVDC 5BNXA 3W96D 5B0YB 1XP4A 5F99B 3AN2D 3REIB 1Y54A 5A93A 2Y2OA 4IBRA 5DVAA 4DRTA 1ZKJA 2L5AA 1LL5A 5F1FA 2W8SA 5E2HA 3MFDA 1P3AA 3LZ0D 3VP3A 3HLWA 4XUZA 3O62A 1BULA 5KSCA 3IHBA 2G5HC 4OPRA 3QHYA 3Q1FA 5FA7A 3SH8A 5KDMB 3X1SB 2BYKB 1W2EA 3NC8A 1PW8A 4N9KA 3W98C 4OOMA 1P3BB 3BFCA 2QPNA 2WZXA 3UTBA 3KWQB 1KE0A 3X1UC 3CG5A 5CPKC 3TU4A 3AZJB 3VSLA 3LY4A 4J8XA 3HLBA 5B40B 4GDNA 1YLPA 2H0TA 2HIOA 3IWIA 3ITAA 4X6TA 4RX2A 5GT0C 1KX4C 3RXWA 3B6GA 3TSGA 4DF6A 5A90A 1RP5A 4WNNB 1XX2A 5B0ZD 4AWLB 4J8UC 4R8PC 4R4SA 1I2WA 2C5WB 4BL2A 1P3PC 2FFFB 3KSYA 1SDEA 2DCFA 1ID3B 3AYWC 4LV0A 1P3IB 4LD9C 4EBNA 4S2KA 5FAQA 3HLFA 2QMIA 4IBGA 3MGSC 3W4QA 4WU8B 3E2LA 3KXBC 2ZM2A 3IHAA 4KHAB 5CRFA 4OLDA 1HD8A 4X55A 5B1MD 4ZJ2A 3MZEA 3O62B 3AZLB 3CZDA 2OLVA 1J9MA 4CSRA 2NQBA 5DF8A 4KG5A 3RELA 1PZRA 5D3OA 4KZ5A 4HBTA 5CGSA 2ZY2A 4LCMA 1XGIA 3NQJB 4JXWA 1EQZC 3UTBB 4OP8A 1YU0A 5GXQC 3TU4B 3AZKA 3N4IA 1L0DA 1QMEA 4Y0TA 3G31A 2Y55A 4N1XA 2J9PA 3UE3A 2ZD8A 2XEPA 2HIOB 2PYOB 3AFAD 5CPIC 5CEDA 5AV5A 5L2FA 5AVCB 4HGAC 5E5AB 3B6GB 4S2OA 1BZAA 5B2JB 1P3FD 5F1GA 2WYXA 3UO9A 3Q7VA 4OOLA 5FUGA 1ONHA 3AL0C 1S32C 3MVDD 2RVQD 5FI6A 4X53A 4C75A 5CPJC 3N7WA 3Q81A 1BLSA 4MBKA 3M2KA 2XQZA 2ZC5B 3WS5A 3A3JA 3WS0A 4YS3A 3OPHA 2ZMAA 5B32B 4HESA 1KX3C 1DJBA 2AROA 4E6XA 4DE2A 3A6NA 4KUDD 2WGWB 5C3IC 4CSRB 5B24C 3X1TA 1YLYA 3IF6A 3W97D 3W96A 1P3LD 3RELB 1E3UD 4R1GA 5CHLB 3AN2A 3MGQD 4X68A 4OONA 2JCHA 4JXSA 5BOHA 4PMAA 5HARA 3HLDA 3UDFA 3NCKA 3LZ0A 2EXBA 5CPKD 3M6HA 1HQ3B 1GCEA 3AZKB 4J8WC 2J7VA 5CP6D 4QNLA 1P3AC 5CHJA 3L25A 2F8NA 4F94A 2IO5B 3BEBA 5AV5B 1IKGA 1EI5A 4WYYA 5CXWA 4GD8A 3PBQA 1S0WA 3WS4A 2CC1A 3KS8A 4IBXA 2EX2A 3MXSA 5FUGB 5AV9C 1P3PD 4OJ6A 1YUEA 2ZC6B 5AV8D 4WJ3C 1W79A 1FCOA 4J8XC 4KZ8A 3ISGA 2PU2A 2JC7A 1YU3A 5B0ZA 1TVFA 3B0DC 2Q9MA 4S2JA 5KZHA 1T3UA 3AZID 1W7FA 3FDDA 3Q82A 2OLUA 4OJ5A 4NK3A 1BLCA 4KZBA 4B4ZA 4E3IA 4NZ4A 3AZEA 3EPHA 3AV2B 3O87A 1VM1A 5B1MA 3PBNA 5GT3C 3V3SA 5DNMC 1YLWA 5DTKA 1TZYD 2JSSA 3KUYD 3L27A 5JRGB 2F8NB 4QJGA 3ZHHA 2EX8A 5EECA 2H5SA 5AVBB 3V9RB 3HLEA 5E2FA 1PWGA 3PBOA 4ZBEA 1P34B 4CJNA 4IEDA 3OZHA 5B31D 1P3MB 1PI5A 4K0WA 2CV5B 4J8VB 1LI0A 1S32D 3IXHA 4UAAA 2Y2QA 1M18C 5CERA 3AFAA 1BT5A 2HP6A 3B0BA 3VFFA 3S4XA 1KX5C 4WMCD 3SS5A 4JJNC 4ZUXD 3OC2A 3PAEA 2XFSA 4KZ6A 5HAPA 2WGVA 1P3FA 1CI9A 4RX3A 5JA4B 4WV4B 2WADA 1ZG6A 1FR6A 3L2AA 1M40A 3MVDA 3WKJB 4L0LA 5JYOA 3AZFC 4KGCB 3AZMB 3AZEB 4LV2A 3ZG7B 5GL9A 5B1MB 4DDYA 4YS3C 4H9QB 4KUDA 5GLCA 1U35D 3W97A 1P3LA 3MNNB 4JBFA 2AROC 4O7DA 1E3UA 5B2IC 4GD6A 4G91B 3A6NC 3X1TC 3MGQA 3IF6C 3ZFZA 2P9VA 3W96C 5GHZA 4NZ5A 3AN2C 1K6RA 1H3OB 3V5MA 5FATA 3VOYA 5CPKA 3MGRD 2XFTA 2F2AC 5CP6A 4RA7A 1JVJA 1KE3A 3LZ0C 2DQNC 4DXCA 2OSUA 3PBTA 4R23A 4GN2A 2NZDD 5EVID 1DJCA 4P85A 1PYYA 3W99D 1JWPA 5AQ7A 1WE4A 5FI2A 3VFHA 1XPBA 5G49A 1O07A 4S2MA 1H8YA 4XXRA 4BJPA 1P3PA 1OMEA 2ZY5A 4Z2MH 3MVDB 4QHCA 5FSRA 4BL3A 5FQKA 5AV8A 5FAOA 5EUAA 2C6WB 3UE0A 3V50A 1N1JA 5BO0B 1P3GD 3X1VD 2ZM8A 3S1YA 4GB7A 3GMWA 4ZTKA 5GT3D 1N4OA 3O3VA 3C4PA 3FV7A 1XKZA 3AZIA 3SH7A 3W8KA 3HLCA 3OPLA 1CEFA 5B0ZC 3WTPE 2XDMA 2ZQ9A 5HW3A 3W98B 2P9VB 1WWSA 4ZJ3A 3ZG0A 2RL3A 4DKIA 3X1UB 4C3QA 5CPKB 1EWZA 3G30A 1K54A 4S2LA 3WAAD 1TZYA 3A3FA 4NETA 3LZ1D 3KUYA 4OJLA 4MNRA 1NZUA 2A3UA 3A3DA 1PWCA 1NJ4A 1O7EA 3WRZA 4M3KA 1M18D 1DY6A 5DTSA 3QNCA 4QD4A 5GT0B 3TG9A 1KX4B 4JJND 4OQGA 2XLNA 3IQAA 3FKVA 5B31A 4E3LA 1M6KA 4J8UB 4R8PB 4N92A 1CEGA 3LJAD 1P3PB 2VGKA 5J8XA 3AYWB 1S32A 1BH9A 4LD9B 4YM6C 5CPJA 1ESUA 3MGSB 4BD0A 5GSUC 3ZNYA 4ZUXA 1ONGA 3KXBB 3VH6T 3AFAC 3EPJA 3EQVA 4QB8A 4MBFA 4UPKA 3N8RA 1KX3A 3ZVTA 1XGJA 1YLZA 4CAYB 3NQUA 1BUEA 5B24A 5B2ID 4B4XA 1EQZB 4EO5C 2ZQ8A 1P3OC 2RVQC 5GHXA 1AOID 5FI7A 3UTAD 5GXQB 1QMFA 4J8WA 5FQIA 4Z66C 2HPBA 3VOZA 4PM8A 5CPIB 4KUDC 4UUZA 5B1LB 5B31G 3W97C 4HGAB 3B0CT 1P3LC 1GHIA 4OPZA 4U0XA 3WA9D 3MGQC 4RVAA 3MGPD 3EPKA 3MGRA 1TAFA 5AV9A 3UT9D 3N6IA 4CPKA 1KGEA 3TOIA 5CPJB 1YU1A 2NZDA 5EVIA 4H9OA 2Q9NA 5CP6C 3AZHC 4X23D 4WEKA 5FASA 1Q2PA 3W99A 3FWLA 4PM6A 3NBLA 1E4DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E3U D;  4R1G A;  4DDS A;  4S2P A;  4E3K A;  4ZJ1 A;  2ZQD A;  2Y2J A;  2IWB A;  2Y4A A;  3SH9 A;  5EOE A;  2EFU A;  3PAG A;  4X68 A;  2WAE A;  4OON A;  2JCH A;  4P87 A;  4S2N C;  2Y2K A;  3IWQ A;  4K0X A;  1LI9 A;  1W8Y A;  3HVF A;  5CTM A;  4DE3 A;  4KZ4 A;  4JXS A;  2IWC A;  4IVI A;  5BOH A;  4PMA A;  5HAR A;  3HLD A;  3UDF A;  3NCK A;  1LLB A;  5CTN A;  1NZO A;  2PU4 A;  3NDG A;  2EXB A;  3M6H A;  3UPP A;  4BEN A;  1ERQ A;  1GCE A;  5EOO A;  4UA6 A;  1ZG4 A;  2J7V A;  3GVB A;  1W5D A;  2ZQA A;  4KZ3 A;  5A91 A;  4GZB A;  4H8R A;  4JXG A;  3AGF A;  5CHJ A;  1L2S A;  4OLG A;  4N9L A;  4R4R A;  3S22 A;  4F94 A;  5EVL A;  3BEB A;  2Y2P A;  3MXR A;  3HRE A;  1IKG A;  1EI5 A;  4WYY A;  3WS2 A;  1KDW A;  5CXW A;  4QY5 A;  3BM6 A;  4GD8 A;  2X02 A;  2J8Y A;  1RGZ A;  2BG1 A;  4FH2 A;  3PBQ A;  3HUM A;  5E43 A;  1S0W A;  3DW0 A;  4KQO A;  4YFM A;  3WS4 A;  1PW1 A;  2CC1 A;  3ZNT A;  4WMC A;  4GOG A;  3DWZ A;  5FQJ A;  3AGE A;  4IBX A;  2EX2 A;  3MXS A;  1HTZ A;  3EQU A;  1K55 A;  3BFG A;  1ES4 A;  5I94 A;  4R0Q A;  4PM5 A;  1TDL A;  2HDQ A;  3G4P A;  4IVK A;  1TDG A;  2ZC6 B;  4KG2 A;  1W79 A;  1FCO A;  1YLJ A;  2WAF A;  2HP9 A;  4KZ8 A;  4EUZ A;  1NXY A;  4EWF A;  5KMW A;  3ISG A;  2PU2 A;  1ERO A;  2ZC4 B;  4LV3 A;  2GDN A;  2R9X A;  2JC7 A;  4KG6 A;  4WZ5 C;  2WKH A;  1K54 C;  1KDS A;  1TVF A;  2XD5 A;  1FR1 A;  3VP1 A;  4YIN A;  5DF9 A;  5DF7 A;  2Q9M A;  3BFF A;  3VP2 A;  5FQM A;  4S2J A;  1NY0 A;  2XD1 A;  5KZH A;  3DTM A;  2A49 A;  5JYP A;  1ESI A;  1W7F A;  1XA1 A;  2ZC3 B;  3MZD A;  4BD1 A;  3FKW A;  4Y0U A;  3Q82 A;  1MPL A;  1YT4 A;  1WYB A;  2OLU A;  2JE5 A;  2VGJ A;  4NK3 A;  1BLC A;  1SKF A;  3HUO A;  5GLD A;  4JF6 A;  4KZB A;  4B4Z A;  3GSG A;  4E3I A;  5CEC A;  4UA7 A;  4JF4 A;  4U3T A;  2WZZ A;  1VQQ A;  3O87 A;  4OVD A;  4EQI A;  1CK3 A;  1VM1 A;  3PBN A;  3IT9 A;  3MBZ A;  4FCF A;  3V3S A;  3A3I A;  2V1Z A;  4WBG A;  1NYM A;  2EFX A;  1BTL A;  1YLW A;  4OOY A;  3UDX A;  5DTK A;  2Y2N A;  5FQQ A;  2XR0 A;  1I2S A;  3QNB A;  5CGW A;  1ZC2 A;  4S2I A;  3ZHH A;  4QJG A;  5E2G A;  2EX8 A;  3IH8 A;  1IYQ A;  1C3B A;  2HDU A;  2H5S A;  3N8S A;  5EEC A;  5AQB A;  2UWX A;  2BLS A;  1JWV A;  4JF5 A;  4JPM A;  3HLE A;  2G2W A;  5E2F A;  4OQH A;  2Y2M A;  1PWG A;  1YMS A;  3PBO A;  5DTT A;  4ZBE A;  3VSK A;  3OCL A;  4IED A;  4CJN A;  2V2F F;  2XH9 A;  4MEZ A;  3OZH A;  3Q7Z A;  1H8Z A;  3BFE A;  1PI5 A;  1MWU A;  4Z9Q A;  2B5R A;  3LY3 A;  4HEF A;  4A5R A;  3SS4 A;  2FFY A;  2H10 A;  4K0W A;  2I72 A;  4XUX A;  1G6A A;  4WEL A;  1SCW A;  1BLH A;  4EBP A;  1LI0 A;  3IXH A;  4UAA A;  4ZDX A;  5FDH A;  5CGX A;  2Y2Q A;  1Q2Q A;  5EPH A;  3BEC A;  5CER A;  1MBL A;  4UHU A;  4C6Y A;  1BT5 A;  2HP6 A;  4PM7 A;  1AXB A;  3VFF A;  2ZQC A;  3S4X A;  3FYZ A;  3PTE A;  2J9O A;  2XK1 A;  4WMC D;  1N9B A;  3MZF A;  3SS5 A;  4GKU A;  3ZDJ A;  1MY8 A;  4FH4 A;  3OC2 A;  1K56 D;  3PAE A;  2XFS A;  4KZ6 A;  5HAP A;  4EV4 A;  1K57 A;  2WGV A;  1HVB A;  1SHV A;  2DRW A;  1KVL A;  1CI9 A;  2Z2L B;  1JTD A;  2ZM0 A;  4RX3 A;  4E3M A;  2X01 A;  4OPY A;  3UNW A;  1ERM A;  2WAD A;  2HDR A;  1IYP A;  1ZG6 A;  1FR6 A;  3OPP A;  4OKP A;  3UN7 A;  4P0M A;  5HAQ A;  5FAP A;  1M40 A;  4L0L A;  3V39 A;  4D2O A;  1YMX A;  4OQI A;  5EE8 A;  3BFD A;  2QZ6 A;  5M19 A;  5JYO A;  1ALQ A;  3G34 A;  2Y2G A;  3LO7 A;  3MKF A;  3LEZ A;  4KEN B;  3W4P A;  3ZG8 B;  2WKE A;  2HDS A;  3ZG9 B;  4GNU A;  4KQQ A;  3NI9 A;  4BLM A;  4LV2 A;  1E25 A;  4R3J A;  3BRM A;  1GHP A;  3ZG7 B;  2ZJ9 A;  3CJM A;  3GTC A;  5G18 A;  5GL9 A;  4DE0 A;  1LL9 A;  3Q7V B;  1CI8 A;  1K38 A;  4DDY A;  3IXB A;  3BLM A;  2EX6 A;  1WYC A;  3W4O A;  3HLG A;  1YLT A;  1HZO A;  1FCM A;  5GLC A;  3C7U A;  2EX9 A;  1TEM A;  4PPR A;  4QY6 A;  4LEN A;  5HL1 A;  4JBF A;  1KGF A;  4O7D A;  3VP0 A;  1E3U A;  3GV9 A;  5EVI C;  1RCJ A;  4GD6 A;  4LCL A;  1XXM A;  3O88 A;  3IF6 C;  3ZFZ A;  2P9V A;  1ES2 A;  1S6R A;  1IYO A;  1BLP A;  2WUQ A;  4KZ7 A;  3I7J A;  2OV5 A;  5GHZ A;  2WGW A;  2ZC7 A;  1KE4 A;  3C4O A;  2Y2H A;  5IHV A;  1K6R A;  1MWR A;  1K4E A;  5EVI B;  3V5M A;  1YQS A;  5FAT A;  3VOY A;  3UPO A;  4DE1 A;  3IF6 B;  3C7V A;  4X56 A;  5GLB A;  2RCX A;  2XFT A;  4ZAM A;  4RA7 A;  1JVJ A;  5CEB A;  1KE3 A;  1L0G A;  3NIA A;  1K57 C;  1MWT A;  4DXC A;  2OSU A;  4WM9 A;  5HX9 A;  3PBT A;  3BYD A;  3LCE A;  4GN2 A;  4R23 A;  1MKI A;  5F82 A;  5EVI D;  1DJC A;  4P85 A;  3NDE A;  4U0T A;  4P6B A;  2HP5 A;  2V20 A;  1PYY A;  1K4F A;  5HAI A;  1JWP A;  4S2N A;  2PBY A;  3AGD A;  5AQ7 A;  5M18 A;  1WE4 A;  1XP4 A;  1JTG A;  1Y54 A;  5FI2 A;  3VFH A;  1XPB A;  2Y2I A;  1O07 A;  5A93 A;  4S2M A;  1H8Y A;  2Y2O A;  1PZP A;  4IBR A;  4XXR A;  3UDI A;  4BJP A;  5DVA A;  2Y59 A;  4DRT A;  1ZKJ A;  1OME A;  2EXA A;  1ES3 A;  3M2J A;  4QHC A;  5FSR A;  1LL5 A;  4BL3 A;  4E3O A;  5F1F A;  1W8Q A;  5FQK A;  3G2Z A;  1DJA A;  5E2H A;  5KSH A;  3MFD A;  3VP3 A;  5FAO A;  3HLW A;  4XUZ A;  4JLF A;  4JXV A;  1K55 C;  1BUL A;  1GA0 A;  5EUA A;  4QU3 A;  3WRT A;  5KSC A;  3IHB A;  3P09 A;  3SOI A;  2Y91 A;  2C6W B;  3UE0 A;  3V50 A;  1G68 A;  1PWD A;  4OPR A;  3QHY A;  3Q1F A;  5FA7 A;  3SH8 A;  4UA9 A;  5TFQ A;  2ZM8 A;  3ZG5 A;  3S1Y A;  3WWX A;  4GB7 A;  3V3R A;  3GMW A;  3NC8 A;  4ZTK A;  1PW8 A;  5TR7 A;  1N4O A;  4N9K A;  3O3V A;  3NY4 A;  1K6S A;  4OOM A;  4DXB A;  3BFC A;  3C4P A;  3BLS A;  3FV7 A;  3Q07 A;  2QPN A;  1XKZ A;  2WZX A;  1RGY A;  3HBR A;  3SH7 A;  3W8K A;  3HLC A;  3OPL A;  1CEF A;  1KE0 A;  2XDM A;  3CG5 A;  3GR2 A;  2ZQ9 A;  5CHM A;  3FZC A;  5HW3 A;  3ITB A;  3VSL A;  4KQR A;  3LY4 A;  2P9V B;  4GDN A;  2H0Y A;  3HLB A;  4E3N A;  3ZGA B;  4ZJ3 A;  3ZG0 A;  2RL3 A;  4DKI A;  3IXG A;  1YLP A;  3VP4 A;  1Z6F A;  2H0T A;  4Y0O A;  3OPR A;  1PIO A;  3IWI A;  3ITA A;  4HBU A;  4X6T A;  2JBF A;  3UY6 A;  4RX2 A;  4C3Q A;  4WZ5 A;  1EWZ A;  3G30 A;  1K54 A;  4S2L A;  1H5X A;  1FOF A;  1FSY A;  4B88 A;  3M6B A;  4E3J A;  1JWZ A;  3A3F A;  1L0F A;  2XF3 A;  1GHM A;  4MNR A;  4NET A;  5E2E A;  3RXW A;  1NZU A;  2A3U A;  3A3D A;  1PWC A;  1NJ4 A;  1O7E A;  2E8I A;  3TSG A;  3WRZ A;  1BSG A;  4M3K A;  4DF6 A;  3G2Y A;  1DY6 A;  5A90 A;  5A92 A;  1RP5 A;  1XX2 A;  1IKI A;  5DTS A;  3QNC A;  1GA9 A;  3RXX A;  3O86 A;  4QD4 A;  3TG9 A;  3WS1 A;  4R4S A;  1KGG A;  1I2W A;  2C5W B;  4BL2 A;  3D4F A;  4PM9 A;  1NYY A;  3IF5 A;  2FFF B;  1SDE A;  2P74 A;  2XGN A;  2XLN A;  4OQG A;  2DCF A;  3IQA A;  3C5A A;  1YM1 A;  4LV0 A;  3ZVW A;  3FKV A;  4EBN A;  2WGI A;  4S2K A;  1PI4 A;  5FAQ A;  5U47 A;  4JKT A;  3HLF A;  4E3L A;  4OPQ A;  4Q8I A;  2QMI A;  1M6K A;  1FSW A;  4OP5 A;  3W4Q A;  4N92 A;  4K91 A;  1CEG A;  5TGF A;  3E2L A;  2VGK A;  2IWD A;  5J8X A;  2ZM2 A;  3IHA A;  3GQZ A;  5CRF A;  4ID4 A;  4OLD A;  1HD8 A;  3CMZ A;  4X55 A;  1ES5 A;  2R9W A;  3GRJ A;  4RYE A;  4ZJ2 A;  3MZE A;  1ESU A;  4FSF A;  3CZD A;  2WKI A;  4BD0 A;  3ZNY A;  2OLV A;  1J9M A;  4X69 A;  1ONG A;  1K56 A;  5DF8 A;  5M1A A;  3EQV A;  3G32 A;  4KG5 A;  4QB8 A;  4MBF A;  3N8R A;  3ZCZ A;  3SS3 A;  3P98 A;  5D3O A;  5AQ9 A;  4KZ5 A;  3ZVT A;  1XGJ A;  4HBT A;  5CGS A;  1YLZ A;  4WEJ A;  5F83 A;  4LCM A;  1XGI A;  4JXW A;  1BUE A;  1MXO A;  4OQ0 A;  5AQA A;  2ZQ7 A;  3A3E A;  4OP8 A;  2X71 A;  3MKE A;  3DWK A;  3IH9 A;  4B4X A;  3RJU A;  2ZLY A;  3PBR A;  1LHY A;  3N4I A;  2ZQ8 A;  1L0D A;  1QME A;  4Y0T A;  3B3X A;  3G31 A;  4BQM A;  2Y55 A;  1U60 A;  2J9P A;  4N1X A;  3UE3 A;  2ZD8 A;  3VMA A;  5GHX A;  2XEP A;  3E2K A;  5HFO A;  5FI7 A;  1FCN A;  4N1H A;  5FQ9 A;  5CED A;  5L2F A;  1QMF A;  2G2U A;  3IWO A;  4KZ9 A;  4WZ4 A;  5FQI A;  5GHY A;  2Z2M B;  4R3B A;  1IYS A;  2WK0 A;  3HUN A;  4S2O A;  1IEL A;  1BZA A;  3G35 A;  5CHU A;  2HPB A;  2DNS A;  3UE1 A;  2Y2L A;  3UPN A;  5F1G A;  3VOZ A;  4PM8 A;  2WYX A;  3UO9 A;  3Q7V A;  4LV1 A;  4OOL A;  4E6W A;  1I5Q A;  1ONH A;  1FQG A;  1GHI A;  4OPZ A;  4U0X A;  4GDB A;  1SDN A;  5GLA A;  5FI6 A;  4X53 A;  4C75 A;  3N7W A;  1PZO A;  3Q81 A;  1NRF A;  1BLS A;  1KVM A;  4RVA A;  3N8L A;  4MBK A;  4FD8 A;  2XQZ A;  3HL9 A;  1K25 A;  3M2K A;  4Y7P A;  2ZC5 B;  1XA7 A;  3WS5 A;  3A3J A;  4MLL A;  4OH0 A;  3WS0 A;  3OPH A;  3OCN A;  2ZMA A;  1IEM A;  1MWS A;  3N6I A;  4CPK A;  1KGE A;  4HES A;  3IXD A;  1L0E A;  3TOI A;  1DJB A;  4E6X A;  4KZA A;  5EVI A;  4DE2 A;  4MBH A;  2Q9N A;  3JYI A;  2WGW B;  1YLY A;  3IF6 A;  4WEK A;  5FAS A;  1Q2P A;  3FWL A;  4PM6 A;  4EBL A;  3NBL A;  1E4D A;  3PBS A; 
#chains in the Genus database with same CATH topology
 1KX3 B;  1B6W A;  4S2P A;  2ZQD A;  2Y2J A;  5EOE A;  4NE6 A;  1UR9 A;  3PAG A;  2NUP C;  4P87 A;  2Y2K A;  5C3I B;  5B24 B;  3HVF A;  4KZ4 A;  1F98 A;  1OJG A;  2IWC A;  4IVI A;  3AZG D;  2PU4 A;  1Z09 A;  4BEN A;  5IU1 A;  1P9W A;  5EOO A;  5BNX B;  1ZG4 A;  5AV6 D;  3X1V A;  2ZQA A;  5AV8 C;  4KZ3 A;  4GZB A;  3AV1 D;  4JXG A;  1L2S A;  4OLG A;  4N9L A;  4R4R A;  3LEL C;  5GT3 A;  4XT2 A;  2Y2P A;  5DNM A;  1MC0 A;  3MXR A;  5HDD A;  3M7P A;  4J8W B;  2AVX A;  1KDW A;  3BM6 A;  2X02 A;  3CIT A;  2BG1 A;  2H28 A;  1P3A B;  3T50 A;  4KQO A;  4O0P A;  3ZNT A;  4NXE A;  3UB5 P;  4UUZ B;  2LB5 A;  3IBR A;  2ZY4 A;  3AZI C;  3AGE A;  4WU9 D;  4XUJ D;  2F8N K;  4NZ1 A;  4Y13 A;  4IBE A;  4KG2 A;  4KUO A;  1NWZ A;  1YLJ A;  1DP8 A;  1JNU A;  1T19 A;  4NKP A;  1NXY A;  3WAA A;  5HPI A;  3LZ1 A;  4LGW A;  5AV9 B;  4Z5T D;  1ERO A;  4LV3 A;  2GDN A;  2R9X A;  4KG6 A;  2PR5 A;  4F3L B;  2WKH A;  2ZL1 A;  1K54 C;  1M18 A;  4YM6 D;  3RH8 B;  1TZY C;  2XD5 A;  2O99 A;  3VP1 A;  5DF7 A;  4J8X B;  3KUY C;  3VP2 A;  2J8P A;  1KX5 A;  4JJN A;  1NY0 A;  5GSU D;  3MQQ A;  2A2L A;  1ESI A;  1XA1 A;  3MZD A;  4BD1 A;  2QJ7 A;  2VGL M;  4ARZ B;  4Y0U A;  1F66 D;  3F1P B;  3B0D B;  2VJW A;  5GLD A;  3VH6 W;  3LJA A;  4JF6 A;  4JGR A;  5DJU A;  3C1B D;  5B31 C;  1S1Z A;  5DNN D;  4JF4 A;  3C1C D;  4EQI A;  5F68 A;  3AZF A;  3H0L C;  3A3I A;  5G4Z A;  4OOY A;  2Y2N A;  4HP9 A;  1S4R A;  1P3O D;  3REH D;  5CGW A;  3IH8 A;  4IUK A;  1IYQ A;  5AQB A;  3MQ0 A;  2BLS A;  5DNM B;  3B47 A;  4ZUX C;  2E8J A;  4OQH A;  4O8G A;  3VSK A;  4Z66 D;  3WTP D;  4MEZ A;  4I3J A;  1H8Z A;  5B2I A;  2F8N H;  2NQB B;  4HEF A;  1UWP X;  3SS4 A;  2FFY A;  4H9P A;  1BLH A;  3MQO A;  2QWS A;  5CGX A;  1Q2Q A;  5EPH A;  1AOI A;  4UHU A;  4EW7 A;  3B0C W;  2HF6 A;  2YKF A;  2ZQC A;  1R4V A;  1OT6 A;  3PTE A;  2J9O A;  2XK1 A;  4II7 A;  1N9B A;  3ZDJ A;  1W1P A;  3BQ8 A;  3IX4 A;  1M18 B;  3UB6 A;  2BYM A;  1KVL A;  2X01 A;  4OPY A;  1U35 C;  1KX5 B;  3ULF A;  4JJN B;  3UN7 A;  3AZH D;  3V39 A;  4MMN A;  4OQI A;  1CXW A;  2YFW A;  3WA9 A;  3S7Q A;  1YU4 A;  5MC7 A;  5FDS A;  5B33 D;  2J80 A;  3BY8 A;  4HMD A;  3MGP A;  3LEZ A;  4KEN B;  3REJ D;  3CI6 A;  2HDS A;  3ZG9 B;  4GNU A;  3U4L P;  3UT9 A;  1NRJ A;  3NI9 A;  4BLM A;  3MF0 A;  3BRM A;  1GHP A;  2ZJ9 A;  3CJM A;  3GTC A;  4H9R A;  3AZF B;  3Q7V B;  3MGR C;  3WD4 A;  1WYC A;  3HLG A;  1YLT A;  4Q0H A;  1P3K D;  1KS0 A;  4X23 A;  3R45 A;  4PPR A;  3VH6 A;  3UB8 A;  3LYX A;  3LGO A;  1KGF A;  3VP0 A;  4ZBJ C;  2NZD C;  5EVI C;  3LEL D;  1MZU A;  1XXM A;  4YS3 B;  3W99 C;  2GNX A;  3HJI A;  1J7M A;  2WUQ A;  4KZ7 A;  4H9N A;  3C4O A;  2Y2H A;  1M19 D;  2ARO B;  3UB9 A;  1MWR A;  5B2I B;  3A6N B;  4NYY A;  3X1T B;  4IBJ A;  3IF6 B;  4DE1 A;  4QWO A;  5GLB A;  3WD2 A;  3W96 B;  4H9P B;  5AV6 A;  4MB4 A;  4ZAM A;  2L4R A;  3AV1 A;  2G7U A;  4FOF A;  3G6O A;  1K57 C;  1MWT A;  3AN2 B;  3MFX A;  3K3C A;  3MSH A;  4NE3 A;  3LCE A;  3L28 A;  4Z2I A;  1P3G C;  3X1V C;  2HP5 A;  3BJN A;  2EA9 A;  2Y8H A;  1K4F A;  5HAI A;  5M18 A;  1GSV A;  3LZ0 B;  2BYM B;  5AY8 D;  2Y2I A;  2WKR A;  1PZP A;  3EEH A;  3UDI A;  2Y59 A;  4WU9 A;  4XUJ A;  4CQH A;  2EXA A;  1ES3 A;  5DKK A;  1DP9 A;  4E3O A;  1W8Q A;  1YPR A;  1DJA A;  2B02 A;  5KSH A;  5B0Y D;  4JLF A;  4LPZ A;  2JKG A;  5F99 D;  3WRT A;  4QU3 A;  3REI D;  3JVU A;  4Z5T A;  1PWD A;  4UA9 A;  3WWX A;  3V3R A;  5B32 C;  4YM6 A;  3WAA C;  1XJ2 A;  5TJJ A;  5HZH A;  3T1S A;  3LZ1 C;  3NY4 A;  3BLS A;  3CAX A;  4O01 A;  3P5J B;  5GSU A;  3D9Y A;  1RGY A;  3HBR A;  5L07 A;  4R70 A;  4QLC C;  2BTF P;  4M4X A;  1F66 A;  2W27 A;  3X1S D;  3GR2 A;  2ZM5 A;  4E3N A;  3V67 A;  2V8C A;  3C1B A;  1P3B D;  3IXG A;  3T4L A;  3VP4 A;  4LRZ E;  3C1C A;  5B0Z B;  2P08 A;  1PIO A;  3KWQ D;  2M7U A;  3UY6 A;  4WZ5 A;  3LJA C;  1H5X A;  4E3J A;  4G92 C;  1GHM A;  4R6L A;  4Y5F A;  3AZJ D;  1P3O A;  5B40 D;  2VV8 A;  2E8I A;  1BSG A;  4JGP A;  3LR4 A;  3RXX A;  1GPF A;  1GA9 A;  3O86 A;  2RIQ A;  4LG2 A;  3WS1 A;  4MN6 A;  4EQ1 A;  3REK C;  3DAV A;  1NYY A;  3IF5 A;  2P74 A;  4I5S A;  4Z66 A;  3WTP A;  3C5A A;  4PKY G;  1YU2 A;  1PI4 A;  1ZLA C;  5BNV A;  5U47 A;  4JKT A;  4OPQ A;  1FSW A;  3HON A;  2IWD A;  5FEG A;  3GQZ A;  4ID4 A;  1ID3 D;  1P3I D;  3GRJ A;  4EXO A;  4FSF A;  4IJF A;  2KDK A;  4WU8 D;  2W1T B;  1AOI C;  3G32 A;  3UTA C;  4YM6 B;  3ZCZ A;  2G5I C;  3P98 A;  5AQ9 A;  3IX8 A;  2DMW A;  4WEJ A;  5F83 A;  3O62 D;  3AZL D;  5GSU B;  3AZH A;  1MXO A;  3KYZ A;  4OQ0 A;  5AQA A;  3AFA B;  1UR8 A;  2VZW A;  5B33 A;  2DF4 C;  2ZLY A;  1LHY A;  2VK3 A;  4NY2 A;  4BQM A;  1XJ3 A;  3WA9 C;  1U60 A;  2ACG A;  1P3F B;  2NUT C;  3UTB D;  3VMA A;  5HFO A;  3MGP C;  3AZN C;  4N1H A;  4BMW A;  4GW9 A;  1GXD A;  3TU4 D;  3UT9 C;  3IWO A;  1P3K A;  5GHY A;  2Z2M B;  4R3B A;  1IYS A;  4EO5 B;  2WK0 A;  1P3O B;  5CHU A;  2DNS A;  2GZA A;  2Y2L A;  3UPN A;  3LEL A;  4YNR A;  2HIO D;  2PYO D;  3EPL A;  4X23 C;  4E6W A;  1I5Q A;  1FQG A;  5AVC D;  5L10 A;  4CLC E;  4Z66 B;  3F1N B;  5E5A D;  4GDB A;  1M19 A;  5GLA A;  2W3E A;  2KX6 A;  5B2J D;  4H6J A;  1NRF A;  1KVM A;  1P3M C;  3N8L A;  4FD8 A;  4KUD B;  1K25 A;  4Y7P A;  4MLL A;  3W97 B;  4OH0 A;  1P3L B;  3UE6 A;  3AZG C;  3OCN A;  2QYB A;  4Y15 A;  5DFY A;  2PD8 A;  1A7W A;  1L0E A;  3MGQ B;  4KZA A;  5AV6 C;  4DJ2 A;  3JYI A;  3WD1 A;  3PHY A;  3AV1 C;  1M1A C;  3PXP A;  3NUL A;  5B32 D;  4ZJ1 A;  2IWB A;  2Y4A A;  3SH9 A;  5AY8 A;  2EFU A;  3LR5 A;  2WAE A;  5CP6 B;  3AZH B;  3FG8 A;  3IWQ A;  1LI9 A;  1W8Y A;  4DE3 A;  2FH5 A;  4QLC D;  4HMC A;  1NZO A;  5CTN A;  5B0Y A;  3B6F C;  3REL D;  2XRO A;  3UPP A;  5F99 A;  3IS2 A;  4WU9 C;  4XUJ C;  3REI A;  3N3F A;  3VH5 T;  4UA6 A;  3L26 A;  3GVB A;  5HDS A;  1W5D A;  3A1K A;  3DTK A;  3S22 A;  5G49 B;  5EVL A;  4Z5T C;  1HQ3 D;  3WS2 A;  2O9B A;  5AV8 B;  2J8Y A;  1RGZ A;  1ACF A;  2W3D A;  1F2K A;  5E43 A;  4NZ3 A;  3X1S A;  1PW1 A;  1A0K A;  2BYK A;  4WMC A;  4GOG A;  1N1J B;  1HTZ A;  3REK D;  1K55 A;  1P3B A;  2J3W A;  3BFG A;  1ES4 A;  5I94 A;  2W1R A;  3B33 A;  1TF1 A;  1F66 C;  1TDL A;  2HDQ A;  4IVK A;  4EU0 A;  2W3H A;  3JVV A;  1IOU A;  2D49 A;  4X1L A;  1FIK A;  1ZLA D;  4H6J B;  2WAF A;  2HP9 A;  1G6O A;  3C1B C;  5J4E A;  4EWF A;  5DNN C;  3AZI B;  2FJ7 C;  3C1C C;  1ULY A;  2ZC4 B;  5B40 A;  1W1V A;  4WZ5 C;  3NHQ A;  2Z6D A;  1KDS A;  1FR1 A;  5DF9 A;  4JGO A;  3BFF A;  4X1M A;  1OGB A;  2Q0O A;  3REH C;  5FQM A;  3S7N A;  2XD1 A;  3DTM A;  1YSQ A;  3FKW A;  4GS9 A;  4Z2M G;  1MPL A;  1YT4 A;  2INW A;  3F1O A;  1TZY B;  2JE5 A;  1SKF A;  3KUY B;  2D01 A;  3WTP C;  1U35 A;  3LIB A;  3GSG A;  5CEC A;  1TD5 A;  1UGU A;  2WZZ A;  1ID3 A;  4OVD A;  2ZY3 A;  1P3I A;  3IT9 A;  1HTA A;  3MBZ A;  4FCF A;  2V1Z A;  4WBG A;  1NYM A;  1BTL A;  5FQQ A;  2VA0 A;  1SKO A;  4WU8 A;  5B31 B;  1ZC2 A;  4S2I A;  5E2G A;  4KHA A;  3AV2 D;  3AZN D;  1JWV A;  3PR6 A;  3MR0 A;  4R3A A;  3H0R C;  4JPM A;  3TE8 A;  3AZL A;  2G2W A;  4GHI A;  1S32 B;  5DTT A;  1BH9 B;  1TS8 A;  3OCL A;  3KSH A;  2V2F F;  1TS0 A;  3Q7Z A;  5JRG D;  4OJO A;  3BFE A;  1MWU A;  4Z9Q A;  2F8N D;  1B67 A;  3LY3 A;  5AVB D;  4ZUX B;  4A5R A;  1UWN X;  2H10 A;  2I72 A;  4XUX A;  4WEL A;  3NQJ A;  4EBP A;  2PD7 A;  5B33 C;  4ZDX A;  1P34 D;  4C6Y A;  3BEC A;  1MBL A;  2HUE C;  2O9A A;  1AXB A;  5HSQ A;  1P3M D;  3NQU B;  3REJ C;  1VEU A;  4GKU A;  4OUI A;  2PYR A;  2KLI A;  1K56 D;  3QP5 A;  4LFU A;  5TBM B;  2CV5 D;  4J8V D;  2HZ5 A;  1K57 A;  2DRW A;  4GJ4 A;  2Z2L B;  2PYO A;  1P3K C;  2WKQ A;  2ZM0 A;  4HOI A;  5L8M A;  3UNW A;  1P3G A;  2HDR A;  1IYP A;  5AVC A;  5E5A A;  3UMD A;  5HDC A;  4G3V A;  1YMX A;  5EE8 A;  2V1A A;  1M1A D;  5B2J A;  3G34 A;  2O0Y A;  3F1O B;  3LO7 A;  1HLU P;  3W4P A;  1U35 B;  4Z2J A;  1M19 C;  4DMZ A;  4HJ6 A;  1E25 A;  1BH8 A;  1DRM A;  4R3J A;  3WKJ D;  3U2A A;  3B6F D;  1CI8 A;  1K38 A;  3BLM A;  4M6B A;  5BT1 D;  3EGX C;  1LT0 A;  4KGC D;  1HZO A;  3C7U A;  4QY6 A;  3AZM D;  3AZE D;  4LEN A;  5HL1 A;  3BWL A;  3L9K A;  5B32 A;  3GV9 A;  5EV0 A;  1RCJ A;  3VH5 W;  1TAF B;  3MGR B;  3KYQ A;  3O88 A;  2XA7 S;  4GHI B;  1ES2 A;  1GSW A;  2V5O A;  2WGW A;  2ZC7 A;  5IHV A;  3IP4 C;  5L09 A;  4XZQ C;  3LFV A;  4QLC A;  5AY8 C;  3MNN D;  4ZBJ B;  2NZD B;  5EVI B;  4H9O B;  1YQS A;  3UPO A;  1GSX A;  1W63 M;  1E15 A;  4FTX A;  3W99 B;  2RCX A;  1H0M A;  5B0Y C;  1BFM A;  5F99 C;  3REI C;  3BYD A;  1T1C A;  1MKI A;  5F82 A;  3L7H A;  3S7P A;  4NXF A;  4MB3 A;  1HQ3 A;  3NDE A;  4U0T A;  4P6B A;  2FJ7 D;  5BPV A;  2V20 A;  4ETZ A;  2CMN A;  1N9N A;  4S2N A;  1OGG A;  2PBY A;  3AGD A;  5FEF A;  1JTG A;  3BW6 A;  2CWE A;  5B1L C;  3REK A;  3X1V B;  1P3G B;  4TX8 A;  3L29 A;  3M2J A;  2LY8 A;  3X1S C;  5KIZ A;  5GT3 B;  4XT2 B;  3G2Z A;  1ZLA A;  3ZYT A;  4JXV A;  1K55 C;  1P3B C;  1GA0 A;  3P09 A;  3SOI A;  2Y91 A;  2QHK A;  3H9W A;  4GH9 A;  1G68 A;  3KWQ C;  1BH8 B;  5HWT A;  5TFQ A;  3ZG5 A;  1YKD A;  2JKR I;  5TR7 A;  4IUH A;  1K6S A;  3AZJ C;  4DXB A;  1OT9 A;  5B40 C;  3C8C A;  2YFV A;  4EUV A;  3Q07 A;  5B32 G;  2QKP A;  2P7J A;  4WF0 A;  3KYE A;  4DRB A;  3UTA A;  5DFX A;  3WAA B;  5CHM A;  3FZC A;  3LZ1 B;  1E6P A;  3ITB A;  4KQR A;  2H0Y A;  3ZGA B;  4ME4 A;  2ZL1 B;  1E6R A;  2IOU A;  1Z6F A;  2PYP A;  4HME A;  4Y0O A;  3OPR A;  4HBU A;  4QLC B;  2JBF A;  4AWL C;  2GJ3 A;  3FC7 A;  1FOF A;  1FSY A;  4B88 A;  3M6B A;  4IBK A;  1JWZ A;  1L0F A;  2XF3 A;  3VH5 A;  3W98 D;  5E2E A;  1ID3 C;  3ICY A;  1P3I C;  4HNB A;  3C30 A;  3G2Y A;  5A92 A;  4I39 A;  3AV2 A;  4PM5 A;  1IKI A;  4H9S A;  3AZN A;  3X1U D;  3LJA B;  1KGG A;  4WU8 C;  3D4F A;  4PM9 A;  4G92 B;  2XGN A;  1YM1 A;  3ZVW A;  1PRQ A;  2WGI A;  5BS7 A;  5JRG A;  3O62 C;  4Q8I A;  3AZL C;  4OP5 A;  5AVB A;  4K91 A;  5TGF A;  5GT0 D;  3V9R A;  3REK B;  3C2W A;  1KX4 D;  1PDC A;  3QP1 A;  4L9G A;  3NOU C;  1GOI A;  1P34 A;  2V0W A;  4EER A;  1ZLA B;  3UB7 A;  3CMZ A;  1ES5 A;  2R9W A;  4RYE A;  1P3M A;  4GLQ A;  2WKI A;  4J8U D;  4Y3I A;  4IJE A;  3KSI A;  4R8P D;  3UTB C;  1K56 A;  4X69 A;  3AZG A;  2CV5 A;  4J8V A;  3KS4 A;  5M1A A;  3AYW D;  3SS3 A;  2L1M A;  3TU4 C;  4LD9 D;  5HD3 A;  2YFV B;  2P04 A;  3MGS D;  4IBI A;  4NXB A;  2ZQ7 A;  3A3E A;  1AOI B;  2X71 A;  3KXB D;  3MKE A;  3UTA B;  4HY8 A;  2HIO C;  2PYO C;  1M1A A;  3DWK A;  1P97 A;  3IH9 A;  5AVC C;  3RJU A;  3PBR A;  5E5A C;  4NFT A;  5JA4 A;  3B6G C;  1OTA A;  4LRY C;  3B3X A;  5B2J C;  4PAU A;  3E2K A;  4UQI S;  3WKJ A;  4ZRR A;  4XZQ D;  4IBD A;  3E0Y A;  3B6F A;  1FCN A;  3E4P A;  4PKY A;  5FQ9 A;  1D06 A;  1NLY A;  2G2U A;  4WZ4 A;  4KGC A;  4KZ9 A;  4JGQ A;  3HUN A;  4IJG A;  4GHA A;  1IEL A;  1EQZ D;  3AZM A;  2YFW B;  3WA9 B;  3CHW P;  3G35 A;  3UE1 A;  2VQR A;  3MGP B;  3AZN B;  4LV1 A;  5GXQ D;  4KQD A;  3UT9 B;  4H9Q A;  2F8N G;  1PFL A;  1SDN A;  4H9R B;  2RTS A;  2VX8 A;  3MNN A;  1PZO A;  4HIA A;  3HL9 A;  4X23 B;  5CPI D;  1XA7 A;  5FL3 A;  3R45 B;  3JPU A;  3SW1 A;  5B1L D;  2NQB C;  3BQA A;  4IBC A;  1IEM A;  1MWS A;  3REL C;  4IBF A;  1CJF A;  3IXD A;  1H3O A;  3T12 B;  3GDI A;  4MBH A;  1Q9C A;  5DNN A;  4H9N B;  1ZHH B;  2FJ7 A;  1H0I A;  3AZG B;  4EBL A;  3PBS A;  3S7O A;  1WWI A;  4E3K A;  4DDS A;  1HQ3 C;  3A0S A;  5CPJ D;  5AV6 B;  3AZK C;  2FN2 A;  3REH A;  1JFI A;  4S2N C;  4K0X A;  3AV1 B;  4EEU A;  4OJP A;  5CTM A;  4DJ3 A;  1F1E A;  1T18 A;  1M1A B;  1LLB A;  2IO5 C;  4G3W A;  3NDG A;  4NE5 A;  5AV5 C;  1KX3 D;  1ERQ A;  4Z2K A;  4DQY B;  5A91 A;  5B24 D;  4H8R A;  3AGF A;  3B6F B;  4WU9 B;  4XUJ B;  1XJ4 A;  3HRE A;  4WLA A;  3R7W A;  4QY5 A;  4ESP A;  5BO0 A;  1Y4O A;  3NOP C;  4FH2 A;  3HUM A;  3DW0 A;  4YFM A;  1XFQ A;  3CLO A;  3DWZ A;  3WX7 A;  5FQJ A;  2OOL A;  4Z5T B;  3EQU A;  4MN7 A;  4J8W D;  4R0Q A;  3G4P A;  1TDG A;  1BYW A;  3OLO A;  4E45 A;  1P3A D;  4EUZ A;  3K3D A;  5KMW A;  3W98 A;  3NJA A;  2O9C A;  1F66 B;  3W2Z A;  3X1U A;  4YIN A;  4WZS B;  3REJ A;  2V8F A;  3C1B B;  2A24 A;  5DNN B;  2FJ7 B;  4Y2F A;  3C1C B;  1PNE A;  2A49 A;  5JYP A;  2ZC3 B;  1E88 A;  5AV9 D;  3A1I A;  3AV2 C;  4H9S C;  4MDZ A;  1WYB A;  2VEA A;  2VGJ A;  3HUO A;  2UV0 E;  2OWH A;  5GT0 A;  4J8X D;  3IX3 A;  3REH B;  1KX4 A;  1JFI B;  4LLO B;  3D72 A;  5BS7 C;  5JRG C;  4UA7 A;  3H82 A;  4U3T A;  1VQQ A;  3FKE A;  2HGV A;  1CK3 A;  5AVB C;  4IBB A;  2EFX A;  3UDX A;  3VV4 A;  3TRC A;  4J8U A;  3WTP B;  1IFQ A;  1QO6 A;  4R8P A;  3B6G D;  2XR0 A;  1P34 C;  4NXG A;  1I2S A;  3QNB A;  4HI4 A;  5BNV B;  4Q0J A;  3AYW A;  4NYU A;  3N8S A;  1C3B A;  2HDU A;  4LD9 A;  2UWX A;  4DRA A;  4JF5 A;  2W0N A;  3A0V A;  3D3O A;  2CV5 C;  4J8V C;  3MGS A;  3R7W B;  2Y2M A;  1YMS A;  1O6I A;  2XH9 A;  2PT7 A;  3H0M C;  3NEC A;  3KXB A;  2B5R A;  5DNM D;  3KSF A;  3F6T A;  1G6A A;  4CAY A;  1SCW A;  1KU5 A;  1F5M A;  1OTI A;  5FDH A;  4XZQ A;  5F5Y A;  3O5Y A;  1KOU A;  4PM7 A;  4HH3 A;  4GHL A;  3FYZ A;  3MZF A;  1ED7 A;  1MY8 A;  4FH4 A;  2NQB D;  3WKJ C;  1EQZ A;  4EV4 A;  3LR0 A;  5B33 B;  5HWV A;  1HVB A;  2PDR A;  5BT1 C;  3HSH A;  1SHV A;  2HUE B;  1JTD A;  4KGC C;  3LID A;  4E3M A;  3REJ B;  5GXQ A;  1EW0 A;  1W1Y A;  1ERM A;  4OKP A;  3AZM C;  3OPP A;  3AZE C;  4P0M A;  1Z2C B;  5HAQ A;  5FAP A;  4D2O A;  2PRF A;  3BFD A;  2QZ6 A;  2YKH A;  3BY9 A;  5M19 A;  1ALQ A;  5B1M C;  2Y2G A;  2MJ6 A;  4BBV A;  2QJ5 A;  1P3K B;  3MKF A;  5CPI A;  3ZG8 B;  3AZK D;  2WKE A;  3QP4 A;  5B1L A;  4KQQ A;  1KX5 D;  3MNN C;  3H82 B;  5KDM A;  4DE0 A;  3LEL B;  5G18 A;  1LL9 A;  4G91 C;  5AV5 D;  3IXB A;  2EX6 A;  3T4J A;  3W4O A;  1FCM A;  1M19 B;  2EX9 A;  1TEM A;  4UEY A;  3KWQ A;  1XJ6 A;  4BBU A;  4LCL A;  1ZTU A;  3AZF D;  3AZJ A;  1S6R A;  1IYO A;  1BLP A;  2HV1 A;  3I7J A;  2OV5 A;  1KE4 A;  2Z6C A;  4L9E A;  4CLC C;  3WD0 A;  1K4E A;  3FPW A;  1STZ A;  3OBF A;  4X56 A;  3C7V A;  4YS3 D;  1S1Y A;  1TS6 A;  5CEB A;  1LSX A;  1L0G A;  3NIA A;  1P3F C;  4XZQ B;  5AY8 B;  4WNN A;  4WM9 A;  5HX9 A;  2ARO D;  3LIA A;  1TS7 A;  3KFU G;  3A6N D;  3X1T D;  3EG5 B;  4E44 A;  4B9O A;  3MVD C;  5BNX A;  3W96 D;  3SZT A;  3IBJ A;  3LUQ A;  2XA7 M;  5B0Y B;  1XP4 A;  5CX7 A;  1OTD A;  5F99 B;  3IS2 B;  3AN2 D;  3REI B;  1Y54 A;  4WN5 A;  5A93 A;  2Y2O A;  4IBR A;  5DVA A;  4LRX C;  4DRT A;  1ZKJ A;  2L5A A;  1LL5 A;  2JKR M;  5F1F A;  2W8S A;  5E2H A;  3MFD A;  1P3A A;  3LZ0 D;  3VP3 A;  3HLW A;  4XUZ A;  3O62 A;  2LB9 A;  1BUL A;  5KSC A;  3IHB A;  2G5H C;  4OPR A;  4EES A;  3QHY A;  3Q1F A;  5FA7 A;  3SH8 A;  5KDM B;  3X1S B;  2BYK B;  4Z2G A;  1W2E A;  3NC8 A;  1PW8 A;  1H8P A;  4N9K A;  3W98 C;  4OOM A;  1P3B B;  3BFC A;  2JN7 A;  2QPN A;  2WZX A;  3UTB A;  2VLG A;  3KWQ B;  2R78 A;  1KE0 A;  1E6Z A;  3X1U C;  3CG5 A;  4F3L A;  5CPK C;  3TU4 A;  3AZJ B;  2XRN A;  3LY4 A;  4P6Z S;  4J8X A;  3HLB A;  5B40 B;  4GDN A;  4NG2 A;  3VSL A;  4MB5 A;  1YLP A;  1CK7 A;  2H0T A;  3KO6 A;  2HIO A;  2W3G A;  3ITA A;  3IWI A;  4X6T A;  4RX2 A;  5GT0 C;  4ARZ A;  1KX4 C;  3F1P A;  3H7W A;  2V0U A;  4DN0 A;  4HQA A;  3RXW A;  3B6G A;  2JKT I;  3DBA A;  4GS9 B;  3TSG A;  1E6N A;  4DF6 A;  5A90 A;  1RP5 A;  4WNN B;  1XX2 A;  5B0Z D;  4AWL B;  4J8U C;  4R8P C;  4R4S A;  1I2W A;  2C5W B;  4BL2 A;  1P3P C;  2FFF B;  3KSY A;  1SDE A;  4EET B;  2DCF A;  1ID3 B;  3AYW C;  4LV0 A;  3LI9 A;  1P3I B;  1CF0 A;  4LD9 C;  4EBN A;  4S2K A;  5FAQ A;  3KSG A;  3HLF A;  5EFW A;  2QMI A;  4IBG A;  3MGS C;  2ZBB A;  3W4Q A;  1SKO B;  2HJ9 C;  4WU8 B;  3E2L A;  3KXB C;  2ZM2 A;  3IHA A;  2J3T D;  4KHA B;  1EAK A;  5CRF A;  4OLD A;  1HD8 A;  4X55 A;  5B1M D;  4ZJ2 A;  3MZE A;  3O62 B;  3AZL B;  4QPR A;  4X25 A;  2ZOI A;  2KOI A;  3CZD A;  5J7E A;  2OLV A;  1J9M A;  4CSR A;  2NQB A;  1S4S A;  5DF8 A;  2K7S A;  4KG5 A;  3REL A;  2EWW A;  3E98 A;  3RFB A;  1PZR A;  5D3O A;  4KZ5 A;  3VE3 A;  1T1B A;  4HBT A;  5CGS A;  2ZY2 A;  4LCM A;  1XGI A;  3NQJ B;  1VB6 A;  1EQZ C;  4JXW A;  1H8M A;  3UTB B;  4OP8 A;  1YU0 A;  5GXQ C;  1VEU B;  3TU4 B;  4AFI A;  3AZK A;  3N4I A;  1L0D A;  1QME A;  4Y0T A;  3G31 A;  2Y55 A;  4N1X A;  2J9P A;  3UE3 A;  2ZD8 A;  2XEP A;  5DKL A;  2HIO B;  2PYO B;  4NEE D;  3AFA D;  4CLC D;  5CPI C;  1V9Z A;  5CED A;  5AV5 A;  5L2F A;  5AVC B;  3H7W B;  3MMH A;  4HGA C;  5E5A B;  3B6G B;  4S2O A;  1BZA A;  5B2J B;  3VOL A;  3T4K A;  3CUE C;  1P3F D;  5F1G A;  4D60 A;  1XFN A;  2WYX A;  3UO9 A;  5HWW A;  3Q7V A;  4OOL A;  1X0O A;  2W3F A;  2Y79 A;  5FUG A;  1ONH A;  3AL0 C;  1S32 C;  3C38 A;  3MVD D;  3FPV A;  5EM0 A;  1D7E A;  2RVQ D;  5FI6 A;  4X53 A;  4C75 A;  5CPJ C;  3N7W A;  3Q81 A;  3QP6 A;  4RQ9 A;  1BLS A;  1WA9 A;  4MBK A;  2XQZ A;  2PBD P;  3M2K A;  2ZC5 B;  4UQI M;  3WS5 A;  3A3J A;  3WS0 A;  4YS3 A;  3OPH A;  4I3I A;  3OOV A;  2ZMA A;  3E4Q A;  5C5K A;  5B32 B;  4HES A;  1KX3 C;  1DJB A;  2ARO A;  4E6X A;  4K08 A;  4DE2 A;  1YAX A;  3A6N A;  4KUD D;  2WGW B;  5C3I C;  4CSR B;  5B24 C;  3X1T A;  1YLY A;  2JHE A;  3IF6 A;  5DJT A;  3W97 D;  3W96 A;  1P3L D;  3GEC A;  3REL B;  1E3U D;  4R1G A;  5CHL B;  3AN2 A;  3MGQ D;  4X68 A;  4OON A;  2JCH A;  4JXS A;  5BOH A;  4PMA A;  2PHY A;  5HAR A;  3HLD A;  3UDF A;  3NCK A;  3LZ0 A;  2EXB A;  5CPK D;  3M6H A;  1HQ3 B;  1GCE A;  3AZK B;  5LBR A;  4J8W C;  3NOT C;  2J7V A;  5CP6 D;  4QNL A;  2B18 A;  1P3A C;  5CHJ A;  3L25 A;  2F8N A;  4F94 A;  2IO5 B;  3BEB A;  5AV5 B;  1VET A;  1LSV A;  1IKG A;  1EI5 A;  4WYY A;  2IA2 A;  5CXW A;  4GD8 A;  2EWV A;  3PBQ A;  1S0W A;  3WS4 A;  2CC1 A;  3KS8 A;  4IBX A;  4MCW A;  2EX2 A;  3MXS A;  5FUG B;  5AV9 C;  2VGL S;  1P3P D;  4OJ6 A;  3KX0 X;  1YUE A;  2M7V A;  5HD5 A;  2ZC6 B;  5AV8 D;  3DTI A;  4WJ3 C;  1W79 A;  1FCO A;  1OPX A;  4J8X C;  4KZ8 A;  3QP2 A;  4HH2 A;  3ISG A;  1P9R A;  2PU2 A;  3LR3 A;  1AWI A;  1W63 Q;  2JC7 A;  1FIL A;  1YU3 A;  4I38 A;  5B0Z A;  1TVF A;  3EWK A;  3B0D C;  2Q9M A;  4S2J A;  5KZH A;  1T3U A;  3AZI D;  1W7F A;  3T4Q A;  3FDD A;  1T1A A;  3Q82 A;  1K0K A;  2K31 A;  2OLU A;  4OJ5 A;  1OTE A;  4NK3 A;  1BLC A;  3EOI A;  4KZB A;  4B4Z A;  4E3I A;  4NZ4 A;  3AZE A;  3EPH A;  3P01 A;  3AV2 B;  3O87 A;  2V9A A;  1L3L A;  1VM1 A;  5B1M A;  3PBN A;  5GT3 C;  3V3S A;  5DNM C;  1YLW A;  4WL9 A;  2V1B A;  5DTK A;  1TZY D;  5AVF A;  2JSS A;  1OTB A;  2WKP A;  3KUY D;  5EVE A;  3L27 A;  3B42 A;  5JRG B;  5AVE A;  4I3A A;  2F8N B;  4QJG A;  1F9I A;  3ZHH A;  3TJZ C;  2EX8 A;  1L6J A;  5EEC A;  2H5S A;  5AVB B;  1H0G A;  1VET B;  3V9R B;  3MQL A;  2K2N A;  3HLE A;  5E2F A;  1PWG A;  3PBO A;  4ZBE A;  1P34 B;  4CJN A;  4IED A;  3OZH A;  2W1T A;  5B31 D;  1P3M B;  2HJE A;  1PI5 A;  1V9Y A;  1LL8 A;  5I5L A;  1DP6 A;  1S66 L;  4ETX A;  4K0W A;  2CV5 B;  4J8V B;  1LI0 A;  1S32 D;  2XSS A;  3IXH A;  4UAA A;  2Y2Q A;  1M18 C;  4Q0I A;  5CER A;  1Y28 A;  3AFA A;  1BT5 A;  2HP6 A;  4CLC A;  3B0B A;  3VFF A;  3S4X A;  2VV7 A;  4G3K A;  3T4S A;  3T1X A;  1KX5 C;  4WMC D;  3SS5 A;  4JJN C;  4ZUX D;  3OC2 A;  3PAE A;  5K5B A;  2XFS A;  3QP8 A;  4KZ6 A;  4YWZ A;  5HAP A;  2I9V A;  2WGV A;  1P3F A;  3T1Q B;  3EGD C;  1CI9 A;  4RX3 A;  3K2N A;  5JA4 B;  3WD3 A;  4WV4 B;  2WAD A;  1ZG6 A;  1FR6 A;  3MJQ A;  3L2A A;  1M40 A;  3MVD A;  3WKJ B;  4L0L A;  5JYO A;  3AZF C;  3HCY A;  4KGC B;  5J3W A;  3AZM B;  3AZE B;  4LV2 A;  3PYP A;  3F1N A;  3ZG7 B;  5GL9 A;  3MS6 A;  5B1M B;  1OJ5 A;  4DDY A;  4YS3 C;  4H9Q B;  4KUD A;  2ZMF A;  3EEA A;  5GLC A;  4L9F A;  1U35 D;  3W97 A;  2ZOH A;  1P3L A;  1VHM A;  3MNN B;  4JBF A;  2ARO C;  1MKM A;  4O7D A;  4MN5 A;  1E3U A;  5B2I C;  4GD6 A;  4G91 B;  3A6N C;  3X1T C;  3MGQ A;  3IF6 C;  3ZFZ A;  2P9V A;  5IS1 A;  3W96 C;  1LSW A;  5F69 A;  2FZ0 A;  5GHZ A;  4NZ5 A;  3AN2 C;  1K6R A;  1H3O B;  3V5M A;  5FAT A;  3VOY A;  5CPK A;  3MGR D;  3T1R A;  2XFT A;  2F2A C;  5CP6 A;  3HJK A;  1JVJ A;  3LEQ A;  4RA7 A;  1KE3 A;  3LZ0 C;  2DQN C;  4DXC A;  2OSU A;  4CLC B;  3PBT A;  4KUK A;  4R23 A;  4GN2 A;  2NZD D;  5EVI D;  2PR6 A;  3T4O A;  1DJC A;  4P85 A;  1P0Z A;  1PYY A;  3W99 D;  1JWP A;  5AQ7 A;  1WE4 A;  4EEP A;  5FI2 A;  3VFH A;  1XPB A;  5G49 A;  1SZV A;  1O07 A;  4S2M A;  1H8Y A;  4XXR A;  4BJP A;  1P3P A;  4GCZ A;  1OME A;  2ZY5 A;  4Z2M H;  3MVD B;  4QHC A;  2OAP 1;  5FSR A;  4BL3 A;  5FQK A;  2BAS A;  5AV8 A;  3CPT A;  5FAO A;  1G28 A;  5EUA A;  1S67 L;  5HPF A;  1AIW A;  4FUW A;  2C6W B;  3UE0 A;  3V50 A;  1N1J A;  5BO0 B;  1P3G D;  3X1V D;  2ZM8 A;  3S1Y A;  4GB7 A;  3A0R A;  3GMW A;  4ZTK A;  4WUJ A;  5A8B A;  5GT3 D;  1N4O A;  2PAV P;  3O3V A;  1E8B A;  3C4P A;  3DTE A;  3FV7 A;  1XKZ A;  3AZI A;  3SH7 A;  3W8K A;  4Z1W A;  3HLC A;  3OPL A;  1CEF A;  2OWJ A;  4HP4 A;  3P7N A;  5B0Z C;  3WTP E;  4BWI A;  2XDM A;  1W1T A;  2ZQ9 A;  5HW3 A;  3W98 B;  4HJ3 A;  2P9V B;  2JKT M;  3LIE A;  1WWS A;  4ZJ3 A;  3ZG0 A;  2RL3 A;  4DKI A;  5IT5 A;  3LIC A;  3MXQ A;  3X1U B;  2A24 B;  4C3Q A;  5CPK B;  1EWZ A;  3G30 A;  1K54 A;  4S2L A;  3WAA D;  1TZY A;  3R4K A;  3A3F A;  4NET A;  3LZ1 D;  3KUY A;  4OJL A;  2J3T C;  4MNR A;  2D02 A;  1NZU A;  2A3U A;  2M1C A;  3LIF A;  1G5U A;  3VE4 A;  3A3D A;  1PWC A;  1NJ4 A;  1O7E A;  4HJ4 A;  3WRZ A;  3E4O A;  4M3K A;  1M18 D;  1DY6 A;  2ZMV A;  2VKS A;  5DTS A;  3QNC A;  4QD4 A;  5GT0 B;  3TG9 A;  1KX4 B;  2JKF A;  4JJN D;  4OQG A;  3CWF A;  2XLN A;  3IQA A;  1CQA A;  3FKV A;  5B31 A;  4P6Z M;  3CUE A;  5HL6 A;  4E3L A;  2VV6 A;  1M6K A;  4J8U B;  4R8P B;  4N92 A;  1CEG A;  3LJA D;  1P3P B;  2VGK A;  5J8X A;  3AYW B;  1S32 A;  5F6A A;  2L0W A;  5G4Y A;  1BH9 A;  4LD9 B;  4YM6 C;  5CPJ A;  3CPT B;  5AJG A;  1ESU A;  3MGS B;  3LI8 A;  4BD0 A;  5GSU C;  2B95 A;  3ZNY A;  4ZUX A;  1ONG A;  3KXB B;  3VH6 T;  3AFA C;  3EPJ A;  4YOF A;  3EQV A;  5EM1 A;  4QB8 A;  4MBF A;  4UPK A;  3N8R A;  1KX3 A;  3ZVT A;  1XGJ A;  1YLZ A;  4CAY B;  3NQU A;  1BUE A;  5B24 A;  4Z2L A;  5TBM A;  3TW8 A;  1YSP A;  2OAQ 1;  5B2I D;  4B4X A;  2GX5 A;  1EQZ B;  4EO5 C;  2ZQ8 A;  1P3O C;  2RVQ C;  4E04 A;  5GHX A;  1NLZ A;  1H3Q A;  1AOI D;  4HHD A;  1N9O A;  5FI7 A;  4BBT A;  3UTA D;  5GXQ B;  1QMF A;  3RTY A;  4J8W A;  5FQI A;  4Z66 C;  4PHT A;  2HPB A;  4B93 A;  3VOZ A;  4PM8 A;  5CPI B;  4KUD C;  4UUZ A;  5B1L B;  5B31 G;  4R38 A;  3W97 C;  4HGA B;  3B0C T;  1P3L C;  1ODV A;  1GHI A;  4OPZ A;  4U0X A;  1J3W A;  3WA9 D;  3ZQ5 A;  3MGQ C;  4RVA A;  3UME A;  1N9L A;  3MGP D;  3EPK A;  3MGR A;  1TAF A;  5AV9 A;  4Z2H A;  3UT9 D;  4Y17 A;  3N6I A;  4CPK A;  1KGE A;  3TOI A;  5CPJ B;  1D1J A;  1YU1 A;  2NZD A;  4IHQ A;  5EVI A;  4H9O A;  2Q9N A;  5CP6 C;  3AZH C;  4X23 D;  4WEK A;  3T4T A;  5FAS A;  1Q2P A;  3W99 A;  3FWL A;  4PM6 A;  3NBL A;  1E4D A; 
#chains in the Genus database with same CATH homology
 1KX3 B;  1B6W A;  4S2P A;  2ZQD A;  2Y2J A;  5EOE A;  4NE6 A;  3PAG A;  4P87 A;  2Y2K A;  5C3I B;  5B24 B;  3HVF A;  4KZ4 A;  2IWC A;  4IVI A;  3AZG D;  2PU4 A;  4BEN A;  5EOO A;  5BNX B;  1ZG4 A;  5AV6 D;  3X1V A;  2ZQA A;  5AV8 C;  4KZ3 A;  4GZB A;  3AV1 D;  4JXG A;  1L2S A;  4OLG A;  4N9L A;  4R4R A;  3LEL C;  5GT3 A;  2Y2P A;  5DNM A;  3MXR A;  4J8W B;  1KDW A;  3BM6 A;  2X02 A;  2BG1 A;  1P3A B;  4KQO A;  3ZNT A;  4UUZ B;  2ZY4 A;  3AZI C;  3AGE A;  4WU9 D;  4XUJ D;  2F8N K;  4NZ1 A;  4IBE A;  4KG2 A;  1YLJ A;  1NXY A;  3WAA A;  3LZ1 A;  5AV9 B;  4Z5T D;  1ERO A;  4LV3 A;  2GDN A;  2R9X A;  4KG6 A;  2WKH A;  1K54 C;  1M18 A;  4YM6 D;  1TZY C;  2XD5 A;  3VP1 A;  5DF7 A;  4J8X B;  3KUY C;  3VP2 A;  2J8P A;  1KX5 A;  4JJN A;  1NY0 A;  5GSU D;  1ESI A;  1XA1 A;  3MZD A;  4BD1 A;  4Y0U A;  1F66 D;  3B0D B;  5GLD A;  3VH6 W;  3LJA A;  4JF6 A;  3C1B D;  5B31 C;  5DNN D;  4JF4 A;  3C1C D;  4EQI A;  3AZF A;  3H0L C;  3A3I A;  4OOY A;  2Y2N A;  1P3O D;  3REH D;  5CGW A;  3IH8 A;  1IYQ A;  5AQB A;  2BLS A;  5DNM B;  4ZUX C;  4OQH A;  3VSK A;  4Z66 D;  3WTP D;  4MEZ A;  1H8Z A;  5B2I A;  2F8N H;  2NQB B;  4HEF A;  3SS4 A;  2FFY A;  4H9P A;  1BLH A;  5CGX A;  1Q2Q A;  5EPH A;  1AOI A;  4UHU A;  3B0C W;  2ZQC A;  1R4V A;  3PTE A;  2J9O A;  2XK1 A;  1N9B A;  3ZDJ A;  1M18 B;  2BYM A;  1KVL A;  2X01 A;  4OPY A;  1U35 C;  1KX5 B;  4JJN B;  3UN7 A;  3AZH D;  3V39 A;  4OQI A;  2YFW A;  3WA9 A;  1YU4 A;  5B33 D;  3MGP A;  3LEZ A;  4KEN B;  3REJ D;  2HDS A;  3ZG9 B;  4GNU A;  3UT9 A;  3NI9 A;  4BLM A;  3BRM A;  1GHP A;  2ZJ9 A;  3CJM A;  3GTC A;  4H9R A;  3AZF B;  3Q7V B;  3MGR C;  1WYC A;  3HLG A;  1YLT A;  1P3K D;  4X23 A;  3R45 A;  4PPR A;  3VH6 A;  1KGF A;  3VP0 A;  4ZBJ C;  2NZD C;  5EVI C;  3LEL D;  1XXM A;  4YS3 B;  3W99 C;  2WUQ A;  4KZ7 A;  4H9N A;  3C4O A;  2Y2H A;  1M19 D;  2ARO B;  1MWR A;  5B2I B;  3A6N B;  4NYY A;  3X1T B;  4IBJ A;  3IF6 B;  4DE1 A;  5GLB A;  3W96 B;  4H9P B;  5AV6 A;  4ZAM A;  3AV1 A;  1K57 C;  1MWT A;  3AN2 B;  4NE3 A;  3LCE A;  3L28 A;  1P3G C;  3X1V C;  2HP5 A;  1K4F A;  5HAI A;  5M18 A;  3LZ0 B;  2BYM B;  5AY8 D;  2Y2I A;  1PZP A;  3UDI A;  2Y59 A;  4WU9 A;  4XUJ A;  2EXA A;  1ES3 A;  4E3O A;  1W8Q A;  1DJA A;  5KSH A;  5B0Y D;  4JLF A;  5F99 D;  3WRT A;  4QU3 A;  3REI D;  4Z5T A;  1PWD A;  4UA9 A;  3WWX A;  3V3R A;  5B32 C;  4YM6 A;  3WAA C;  3LZ1 C;  3NY4 A;  3BLS A;  3P5J B;  5GSU A;  1RGY A;  3HBR A;  4QLC C;  1F66 A;  3GR2 A;  3X1S D;  2ZM5 A;  4E3N A;  3C1B A;  1P3B D;  3IXG A;  3VP4 A;  3C1C A;  5B0Z B;  1PIO A;  3KWQ D;  3UY6 A;  4WZ5 A;  3LJA C;  1H5X A;  4E3J A;  4G92 C;  1GHM A;  3AZJ D;  1P3O A;  5B40 D;  2E8I A;  1BSG A;  3RXX A;  1GA9 A;  3O86 A;  2RIQ A;  4LG2 A;  3WS1 A;  3REK C;  1NYY A;  3IF5 A;  2P74 A;  4Z66 A;  3WTP A;  3C5A A;  1YU2 A;  1PI4 A;  1ZLA C;  5BNV A;  5U47 A;  4JKT A;  4OPQ A;  1FSW A;  3HON A;  2IWD A;  3GQZ A;  4ID4 A;  1ID3 D;  1P3I D;  3GRJ A;  4FSF A;  4IJF A;  4WU8 D;  1AOI C;  3G32 A;  3UTA C;  4YM6 B;  3ZCZ A;  2G5I C;  3P98 A;  5AQ9 A;  4WEJ A;  5F83 A;  3O62 D;  3AZL D;  5GSU B;  3AZH A;  1MXO A;  4OQ0 A;  5AQA A;  3AFA B;  5B33 A;  2DF4 C;  2ZLY A;  1LHY A;  4NY2 A;  4BQM A;  3WA9 C;  1U60 A;  1P3F B;  3UTB D;  3VMA A;  5HFO A;  3MGP C;  3AZN C;  4N1H A;  3TU4 D;  3UT9 C;  3IWO A;  1P3K A;  5GHY A;  2Z2M B;  4R3B A;  1IYS A;  4EO5 B;  2WK0 A;  1P3O B;  5CHU A;  2DNS A;  2Y2L A;  3UPN A;  3LEL A;  2HIO D;  2PYO D;  3EPL A;  4X23 C;  4E6W A;  1I5Q A;  1FQG A;  5AVC D;  4Z66 B;  5E5A D;  4GDB A;  1M19 A;  5GLA A;  5B2J D;  1NRF A;  1KVM A;  1P3M C;  3N8L A;  4FD8 A;  4KUD B;  1K25 A;  4Y7P A;  4MLL A;  3W97 B;  4OH0 A;  1P3L B;  3AZG C;  3OCN A;  1A7W A;  1L0E A;  3MGQ B;  4KZA A;  5AV6 C;  3JYI A;  3AV1 C;  1M1A C;  5B32 D;  4ZJ1 A;  2IWB A;  2Y4A A;  3SH9 A;  5AY8 A;  2EFU A;  2WAE A;  5CP6 B;  3AZH B;  3IWQ A;  1LI9 A;  1W8Y A;  4DE3 A;  4QLC D;  5CTN A;  1NZO A;  5B0Y A;  3B6F C;  3REL D;  3UPP A;  5F99 A;  4WU9 C;  4XUJ C;  3REI A;  3N3F A;  3VH5 T;  4UA6 A;  3L26 A;  3GVB A;  1W5D A;  3A1K A;  3S22 A;  5G49 B;  5EVL A;  4Z5T C;  1HQ3 D;  3WS2 A;  5AV8 B;  2J8Y A;  1RGZ A;  5E43 A;  4NZ3 A;  3X1S A;  1PW1 A;  2BYK A;  4WMC A;  4GOG A;  1N1J B;  1HTZ A;  3REK D;  1K55 A;  1P3B A;  3BFG A;  1ES4 A;  5I94 A;  1F66 C;  1TDL A;  2HDQ A;  4IVK A;  1ZLA D;  2WAF A;  2HP9 A;  3C1B C;  4EWF A;  5DNN C;  3AZI B;  2FJ7 C;  3C1C C;  1ULY A;  2ZC4 B;  5B40 A;  4WZ5 C;  1KDS A;  1FR1 A;  5DF9 A;  3BFF A;  5FQM A;  3REH C;  2XD1 A;  3DTM A;  3FKW A;  4Z2M G;  1MPL A;  1YT4 A;  1TZY B;  2JE5 A;  1SKF A;  3KUY B;  3WTP C;  1U35 A;  3GSG A;  5CEC A;  2WZZ A;  1ID3 A;  4OVD A;  2ZY3 A;  1P3I A;  3IT9 A;  1HTA A;  3MBZ A;  4FCF A;  2V1Z A;  4WBG A;  1NYM A;  1BTL A;  5FQQ A;  4WU8 A;  5B31 B;  1ZC2 A;  4S2I A;  5E2G A;  4KHA A;  3AV2 D;  3AZN D;  1JWV A;  3H0R C;  4JPM A;  3AZL A;  2G2W A;  1S32 B;  5DTT A;  1BH9 B;  3OCL A;  2V2F F;  3Q7Z A;  5JRG D;  4OJO A;  3BFE A;  1MWU A;  4Z9Q A;  2F8N D;  1B67 A;  3LY3 A;  5AVB D;  4ZUX B;  4A5R A;  2H10 A;  2I72 A;  4XUX A;  4WEL A;  3NQJ A;  4EBP A;  5B33 C;  4ZDX A;  1P34 D;  4C6Y A;  3BEC A;  1MBL A;  2HUE C;  1AXB A;  1P3M D;  3NQU B;  3REJ C;  4GKU A;  4OUI A;  1K56 D;  2CV5 D;  4J8V D;  1K57 A;  2DRW A;  2Z2L B;  2PYO A;  1P3K C;  2ZM0 A;  3UNW A;  1P3G A;  2HDR A;  1IYP A;  5AVC A;  5E5A A;  1YMX A;  5EE8 A;  1M1A D;  5B2J A;  3G34 A;  3LO7 A;  3W4P A;  1U35 B;  1M19 C;  1E25 A;  1BH8 A;  4R3J A;  3WKJ D;  3B6F D;  1CI8 A;  1K38 A;  3BLM A;  4M6B A;  5BT1 D;  4KGC D;  1HZO A;  3C7U A;  4QY6 A;  3AZM D;  3AZE D;  4LEN A;  5HL1 A;  5B32 A;  3GV9 A;  1RCJ A;  3VH5 W;  1TAF B;  3MGR B;  3O88 A;  1ES2 A;  2WGW A;  2ZC7 A;  5IHV A;  3IP4 C;  4XZQ C;  4QLC A;  5AY8 C;  3MNN D;  4ZBJ B;  2NZD B;  5EVI B;  4H9O B;  1YQS A;  3UPO A;  3W99 B;  2RCX A;  5B0Y C;  1BFM A;  5F99 C;  3REI C;  3BYD A;  1MKI A;  5F82 A;  1HQ3 A;  3NDE A;  4U0T A;  4P6B A;  2FJ7 D;  5BPV A;  2V20 A;  4S2N A;  2PBY A;  3AGD A;  1JTG A;  2CWE A;  5B1L C;  3REK A;  3X1V B;  1P3G B;  3L29 A;  3M2J A;  2LY8 A;  3X1S C;  5GT3 B;  3G2Z A;  1ZLA A;  4JXV A;  1K55 C;  1P3B C;  1GA0 A;  3P09 A;  3SOI A;  2Y91 A;  4GH9 A;  1G68 A;  3KWQ C;  1BH8 B;  5TFQ A;  3ZG5 A;  5TR7 A;  1K6S A;  3AZJ C;  4DXB A;  5B40 C;  2YFV A;  3Q07 A;  5B32 G;  4DRB A;  3UTA A;  3WAA B;  5CHM A;  3FZC A;  3LZ1 B;  3ITB A;  4KQR A;  2H0Y A;  3ZGA B;  2IOU A;  1Z6F A;  4Y0O A;  3OPR A;  4HBU A;  4QLC B;  2JBF A;  4AWL C;  1FOF A;  1FSY A;  4B88 A;  3M6B A;  4IBK A;  1JWZ A;  1L0F A;  2XF3 A;  3VH5 A;  3W98 D;  5E2E A;  1ID3 C;  1P3I C;  3G2Y A;  5A92 A;  3AV2 A;  4PM5 A;  1IKI A;  4H9S A;  3AZN A;  3X1U D;  3LJA B;  1KGG A;  4WU8 C;  3D4F A;  4PM9 A;  4G92 B;  2XGN A;  1YM1 A;  3ZVW A;  2WGI A;  5BS7 A;  5JRG A;  3O62 C;  4Q8I A;  3AZL C;  4OP5 A;  5AVB A;  4K91 A;  5TGF A;  5GT0 D;  3V9R A;  3REK B;  1KX4 D;  1P34 A;  1ZLA B;  3CMZ A;  1ES5 A;  2R9W A;  4RYE A;  1P3M A;  2WKI A;  4J8U D;  4IJE A;  4R8P D;  3UTB C;  1K56 A;  4X69 A;  3AZG A;  2CV5 A;  4J8V A;  3KS4 A;  5M1A A;  3AYW D;  3SS3 A;  3TU4 C;  4LD9 D;  2YFV B;  3MGS D;  4IBI A;  2ZQ7 A;  3A3E A;  1AOI B;  2X71 A;  3KXB D;  3MKE A;  3UTA B;  2HIO C;  2PYO C;  1M1A A;  3DWK A;  3IH9 A;  5AVC C;  3RJU A;  3PBR A;  5E5A C;  4NFT A;  5JA4 A;  3B6G C;  3B3X A;  5B2J C;  3E2K A;  3WKJ A;  4XZQ D;  4IBD A;  3B6F A;  1FCN A;  5FQ9 A;  2G2U A;  4WZ4 A;  4KGC A;  4KZ9 A;  3HUN A;  4GHA A;  1IEL A;  1EQZ D;  3AZM A;  2YFW B;  3WA9 B;  3G35 A;  3UE1 A;  2VQR A;  3MGP B;  3AZN B;  4LV1 A;  5GXQ D;  3UT9 B;  4H9Q A;  2F8N G;  1SDN A;  4H9R B;  3MNN A;  1PZO A;  3HL9 A;  4X23 B;  5CPI D;  1XA7 A;  3R45 B;  5B1L D;  2NQB C;  4IBC A;  1IEM A;  1MWS A;  3REL C;  4IBF A;  3IXD A;  1H3O A;  4MBH A;  1Q9C A;  5DNN A;  4H9N B;  2FJ7 A;  3AZG B;  4EBL A;  3PBS A;  1WWI A;  4E3K A;  4DDS A;  1HQ3 C;  5CPJ D;  5AV6 B;  3AZK C;  3REH A;  1JFI A;  4S2N C;  4K0X A;  3AV1 B;  4OJP A;  5CTM A;  1F1E A;  1M1A B;  1LLB A;  2IO5 C;  3NDG A;  4NE5 A;  5AV5 C;  1KX3 D;  1ERQ A;  4DQY B;  5A91 A;  5B24 D;  4H8R A;  3AGF A;  3B6F B;  4WU9 B;  4XUJ B;  3HRE A;  4QY5 A;  5BO0 A;  4FH2 A;  3HUM A;  3DW0 A;  4YFM A;  3DWZ A;  3WX7 A;  5FQJ A;  4Z5T B;  3EQU A;  4J8W D;  4R0Q A;  3G4P A;  1TDG A;  4E45 A;  1P3A D;  4EUZ A;  5KMW A;  3W98 A;  1F66 B;  3X1U A;  4YIN A;  4WZS B;  3REJ A;  3C1B B;  5DNN B;  2FJ7 B;  3C1C B;  2A49 A;  5JYP A;  2ZC3 B;  5AV9 D;  3A1I A;  3AV2 C;  4H9S C;  1WYB A;  2VGJ A;  3HUO A;  5GT0 A;  4J8X D;  3REH B;  1KX4 A;  1JFI B;  5BS7 C;  5JRG C;  4UA7 A;  4U3T A;  1VQQ A;  3FKE A;  1CK3 A;  5AVB C;  4IBB A;  2EFX A;  3UDX A;  4J8U A;  3WTP B;  4R8P A;  3B6G D;  2XR0 A;  1P34 C;  1I2S A;  3QNB A;  5BNV B;  3AYW A;  4NYU A;  3N8S A;  1C3B A;  2HDU A;  4LD9 A;  2UWX A;  4DRA A;  4JF5 A;  2CV5 C;  4J8V C;  3MGS A;  2Y2M A;  1YMS A;  2XH9 A;  3H0M C;  3KXB A;  2B5R A;  5DNM D;  3F6T A;  1G6A A;  4CAY A;  1SCW A;  1KU5 A;  5FDH A;  4XZQ A;  4PM7 A;  4GHL A;  3FYZ A;  3MZF A;  1MY8 A;  4FH4 A;  2NQB D;  3WKJ C;  1EQZ A;  4EV4 A;  5B33 B;  1HVB A;  5BT1 C;  3HSH A;  1SHV A;  2HUE B;  1JTD A;  4KGC C;  4E3M A;  3REJ B;  5GXQ A;  1ERM A;  4OKP A;  3AZM C;  3OPP A;  3AZE C;  4P0M A;  1Z2C B;  5HAQ A;  5FAP A;  4D2O A;  3BFD A;  2QZ6 A;  5M19 A;  1ALQ A;  5B1M C;  2Y2G A;  3MKF A;  1P3K B;  5CPI A;  3ZG8 B;  3AZK D;  2WKE A;  5B1L A;  4KQQ A;  1KX5 D;  3MNN C;  5KDM A;  4DE0 A;  3LEL B;  5G18 A;  1LL9 A;  4G91 C;  5AV5 D;  3IXB A;  2EX6 A;  3W4O A;  1FCM A;  1M19 B;  2EX9 A;  1TEM A;  3KWQ A;  4LCL A;  3AZF D;  3AZJ A;  1S6R A;  1IYO A;  1BLP A;  3I7J A;  2OV5 A;  1KE4 A;  1K4E A;  4X56 A;  3C7V A;  4YS3 D;  5CEB A;  1L0G A;  3NIA A;  1P3F C;  4XZQ B;  5AY8 B;  4WNN A;  4WM9 A;  5HX9 A;  2ARO D;  3KFU G;  3A6N D;  3X1T D;  3EG5 B;  4E44 A;  3MVD C;  5BNX A;  3W96 D;  5B0Y B;  1XP4 A;  5F99 B;  3AN2 D;  3REI B;  1Y54 A;  5A93 A;  2Y2O A;  4IBR A;  5DVA A;  4DRT A;  1ZKJ A;  2L5A A;  1LL5 A;  5F1F A;  2W8S A;  5E2H A;  3MFD A;  1P3A A;  3LZ0 D;  3VP3 A;  3HLW A;  4XUZ A;  3O62 A;  1BUL A;  5KSC A;  3IHB A;  2G5H C;  4OPR A;  3QHY A;  3Q1F A;  5FA7 A;  3SH8 A;  5KDM B;  3X1S B;  2BYK B;  1W2E A;  3NC8 A;  1PW8 A;  4N9K A;  3W98 C;  4OOM A;  1P3B B;  3BFC A;  2QPN A;  2WZX A;  3UTB A;  3KWQ B;  1KE0 A;  3X1U C;  3CG5 A;  5CPK C;  3TU4 A;  3AZJ B;  3VSL A;  3LY4 A;  4J8X A;  3HLB A;  5B40 B;  4GDN A;  1YLP A;  2H0T A;  2HIO A;  3IWI A;  3ITA A;  4X6T A;  4RX2 A;  5GT0 C;  1KX4 C;  3RXW A;  3B6G A;  3TSG A;  4DF6 A;  5A90 A;  1RP5 A;  4WNN B;  1XX2 A;  5B0Z D;  4AWL B;  4J8U C;  4R8P C;  4R4S A;  1I2W A;  2C5W B;  4BL2 A;  1P3P C;  2FFF B;  3KSY A;  1SDE A;  2DCF A;  1ID3 B;  3AYW C;  4LV0 A;  1P3I B;  4LD9 C;  4EBN A;  4S2K A;  5FAQ A;  3HLF A;  2QMI A;  4IBG A;  3MGS C;  3W4Q A;  4WU8 B;  3E2L A;  3KXB C;  2ZM2 A;  3IHA A;  4KHA B;  5CRF A;  4OLD A;  1HD8 A;  4X55 A;  5B1M D;  4ZJ2 A;  3MZE A;  3O62 B;  3AZL B;  3CZD A;  2OLV A;  1J9M A;  4CSR A;  2NQB A;  5DF8 A;  4KG5 A;  3REL A;  1PZR A;  5D3O A;  4KZ5 A;  4HBT A;  5CGS A;  2ZY2 A;  4LCM A;  1XGI A;  3NQJ B;  4JXW A;  1EQZ C;  3UTB B;  4OP8 A;  1YU0 A;  5GXQ C;  3TU4 B;  3AZK A;  3N4I A;  1L0D A;  1QME A;  4Y0T A;  3G31 A;  2Y55 A;  4N1X A;  2J9P A;  3UE3 A;  2ZD8 A;  2XEP A;  2HIO B;  2PYO B;  3AFA D;  5CPI C;  5CED A;  5AV5 A;  5L2F A;  5AVC B;  4HGA C;  5E5A B;  3B6G B;  4S2O A;  1BZA A;  5B2J B;  1P3F D;  5F1G A;  2WYX A;  3UO9 A;  3Q7V A;  4OOL A;  5FUG A;  1ONH A;  3AL0 C;  1S32 C;  3MVD D;  2RVQ D;  5FI6 A;  4X53 A;  4C75 A;  5CPJ C;  3N7W A;  3Q81 A;  1BLS A;  4MBK A;  3M2K A;  2XQZ A;  2ZC5 B;  3WS5 A;  3A3J A;  3WS0 A;  4YS3 A;  3OPH A;  2ZMA A;  5B32 B;  4HES A;  1KX3 C;  1DJB A;  2ARO A;  4E6X A;  4DE2 A;  3A6N A;  4KUD D;  2WGW B;  5C3I C;  4CSR B;  5B24 C;  3X1T A;  1YLY A;  3IF6 A;  3W97 D;  3W96 A;  1P3L D;  3REL B;  1E3U D;  4R1G A;  5CHL B;  3AN2 A;  3MGQ D;  4X68 A;  4OON A;  2JCH A;  4JXS A;  5BOH A;  4PMA A;  5HAR A;  3HLD A;  3UDF A;  3NCK A;  3LZ0 A;  2EXB A;  5CPK D;  3M6H A;  1HQ3 B;  1GCE A;  3AZK B;  4J8W C;  2J7V A;  5CP6 D;  4QNL A;  1P3A C;  5CHJ A;  3L25 A;  2F8N A;  4F94 A;  2IO5 B;  3BEB A;  5AV5 B;  1IKG A;  1EI5 A;  4WYY A;  5CXW A;  4GD8 A;  3PBQ A;  1S0W A;  3WS4 A;  2CC1 A;  3KS8 A;  4IBX A;  2EX2 A;  3MXS A;  5FUG B;  5AV9 C;  1P3P D;  4OJ6 A;  1YUE A;  2ZC6 B;  5AV8 D;  4WJ3 C;  1W79 A;  1FCO A;  4J8X C;  4KZ8 A;  3ISG A;  2PU2 A;  2JC7 A;  1YU3 A;  5B0Z A;  1TVF A;  3B0D C;  2Q9M A;  4S2J A;  5KZH A;  1T3U A;  3AZI D;  1W7F A;  3FDD A;  3Q82 A;  2OLU A;  4OJ5 A;  4NK3 A;  1BLC A;  4KZB A;  4B4Z A;  4E3I A;  4NZ4 A;  3AZE A;  3EPH A;  3AV2 B;  3O87 A;  1VM1 A;  5B1M A;  3PBN A;  5GT3 C;  3V3S A;  5DNM C;  1YLW A;  5DTK A;  1TZY D;  2JSS A;  3KUY D;  3L27 A;  5JRG B;  2F8N B;  4QJG A;  3ZHH A;  2EX8 A;  5EEC A;  2H5S A;  5AVB B;  3V9R B;  3HLE A;  5E2F A;  1PWG A;  3PBO A;  4ZBE A;  1P34 B;  4CJN A;  4IED A;  3OZH A;  5B31 D;  1P3M B;  1PI5 A;  4K0W A;  2CV5 B;  4J8V B;  1LI0 A;  1S32 D;  3IXH A;  4UAA A;  2Y2Q A;  1M18 C;  5CER A;  3AFA A;  1BT5 A;  2HP6 A;  3B0B A;  3VFF A;  3S4X A;  1KX5 C;  4WMC D;  3SS5 A;  4JJN C;  4ZUX D;  3OC2 A;  3PAE A;  2XFS A;  4KZ6 A;  5HAP A;  2WGV A;  1P3F A;  1CI9 A;  4RX3 A;  5JA4 B;  4WV4 B;  2WAD A;  1ZG6 A;  1FR6 A;  3L2A A;  1M40 A;  3MVD A;  3WKJ B;  4L0L A;  5JYO A;  3AZF C;  4KGC B;  3AZM B;  3AZE B;  4LV2 A;  3ZG7 B;  5GL9 A;  5B1M B;  4DDY A;  4YS3 C;  4H9Q B;  4KUD A;  5GLC A;  1U35 D;  3W97 A;  1P3L A;  3MNN B;  4JBF A;  2ARO C;  4O7D A;  1E3U A;  5B2I C;  4GD6 A;  4G91 B;  3A6N C;  3X1T C;  3MGQ A;  3IF6 C;  3ZFZ A;  2P9V A;  3W96 C;  5GHZ A;  4NZ5 A;  3AN2 C;  1K6R A;  1H3O B;  3V5M A;  5FAT A;  3VOY A;  5CPK A;  3MGR D;  2XFT A;  2F2A C;  5CP6 A;  4RA7 A;  1JVJ A;  1KE3 A;  3LZ0 C;  2DQN C;  4DXC A;  2OSU A;  3PBT A;  4R23 A;  4GN2 A;  2NZD D;  5EVI D;  1DJC A;  4P85 A;  1PYY A;  3W99 D;  1JWP A;  5AQ7 A;  1WE4 A;  5FI2 A;  3VFH A;  1XPB A;  5G49 A;  1O07 A;  4S2M A;  1H8Y A;  4XXR A;  4BJP A;  1P3P A;  1OME A;  2ZY5 A;  4Z2M H;  3MVD B;  4QHC A;  5FSR A;  4BL3 A;  5FQK A;  5AV8 A;  5FAO A;  5EUA A;  2C6W B;  3UE0 A;  3V50 A;  1N1J A;  5BO0 B;  1P3G D;  3X1V D;  2ZM8 A;  3S1Y A;  4GB7 A;  3GMW A;  4ZTK A;  5GT3 D;  1N4O A;  3O3V A;  3C4P A;  3FV7 A;  1XKZ A;  3AZI A;  3SH7 A;  3W8K A;  3HLC A;  3OPL A;  1CEF A;  5B0Z C;  3WTP E;  2XDM A;  2ZQ9 A;  5HW3 A;  3W98 B;  2P9V B;  1WWS A;  4ZJ3 A;  3ZG0 A;  2RL3 A;  4DKI A;  3X1U B;  4C3Q A;  5CPK B;  1EWZ A;  3G30 A;  1K54 A;  4S2L A;  3WAA D;  1TZY A;  3A3F A;  4NET A;  3LZ1 D;  3KUY A;  4OJL A;  4MNR A;  1NZU A;  2A3U A;  3A3D A;  1PWC A;  1NJ4 A;  1O7E A;  3WRZ A;  4M3K A;  1M18 D;  1DY6 A;  5DTS A;  3QNC A;  4QD4 A;  5GT0 B;  3TG9 A;  1KX4 B;  4JJN D;  4OQG A;  2XLN A;  3IQA A;  3FKV A;  5B31 A;  4E3L A;  1M6K A;  4J8U B;  4R8P B;  4N92 A;  1CEG A;  3LJA D;  1P3P B;  2VGK A;  5J8X A;  3AYW B;  1S32 A;  1BH9 A;  4LD9 B;  4YM6 C;  5CPJ A;  1ESU A;  3MGS B;  4BD0 A;  5GSU C;  3ZNY A;  4ZUX A;  1ONG A;  3KXB B;  3VH6 T;  3AFA C;  3EPJ A;  3EQV A;  4QB8 A;  4MBF A;  4UPK A;  3N8R A;  1KX3 A;  3ZVT A;  1XGJ A;  1YLZ A;  4CAY B;  3NQU A;  1BUE A;  5B24 A;  5B2I D;  4B4X A;  1EQZ B;  4EO5 C;  2ZQ8 A;  1P3O C;  2RVQ C;  5GHX A;  1AOI D;  5FI7 A;  3UTA D;  5GXQ B;  1QMF A;  4J8W A;  5FQI A;  4Z66 C;  2HPB A;  3VOZ A;  4PM8 A;  5CPI B;  4KUD C;  4UUZ A;  5B1L B;  5B31 G;  3W97 C;  4HGA B;  3B0C T;  1P3L C;  1GHI A;  4OPZ A;  4U0X A;  3WA9 D;  3MGQ C;  4RVA A;  3MGP D;  3EPK A;  3MGR A;  1TAF A;  5AV9 A;  3UT9 D;  3N6I A;  4CPK A;  1KGE A;  3TOI A;  5CPJ B;  1YU1 A;  2NZD A;  5EVI A;  4H9O A;  2Q9N A;  5CP6 C;  3AZH C;  4X23 D;  4WEK A;  5FAS A;  1Q2P A;  3W99 A;  3FWL A;  4PM6 A;  3NBL A;  1E4D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...