2Y2OA

Penicillin-binding protein 1b (pbp-1b) in complex with an alkyl boronate (eo9)
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
489
structure length
471
Chain Sequence
ISEITYSDGTVIASISRDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTGQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PENICILLIN-BINDING PROTEIN 1B
publication title Structure-Guided Design of Cell Wall Biosynthesis Inhibitors that Overcome Beta-Lactam Resistance in Staphylococcus Aureus (Mrsa).
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 165
structure length 471
sequence length 489
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2y2oA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2y2oA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2y2oA02
1KVLA 3C4PA 5J8XA 2Y2IA 4ZJ2A 4CPKA 2ZQ7A 1CI9A 1K25A 4C75A 5IHVA 2JCHA 5FI6A 4E3KA 4GOGA 1MWSA 4P0MA 4BL2A 1YMXA 2WZZA 3FKVA 3IH8A 1PWCA 3CMZA 4K0WA 3TOIA 1MWRA 4S2KA 5CRFA 1PI4A 3MXRA 1RP5A 1FR1A 3S4XA 1EROA 5FI2A 3BLMA 4HEFA 4OLGA 5TFQA 4KQQA 3A3IA 5CHJA 5TGFA 3S22A 4X69A 5FQKA 1CEGA 3AGEA 4KZ7A 2Y2HA 2J8YA 3BM6A 3G2YA 5FQMA 3VFFA 4BD1A 4BQMA 5EE8A 1PWDA 2EXBA 2ZQ8A 1K4EA 2ZQAA 3RXXA 4A5RA 4UA6A 3SS3A 3V50A 4M3KA 5HW3A 1PYYA 4UA7A 1QMEA 1K54A 1IYSA 3GSGA 4OP8A 5AQAA 4X68A 5JYPA 1NRFA 3IT9A 2EX9A 2WUQA 1LLBA 1BZAA 2X01A 3WS5A 3Q7VB 1YLZA 1KDSA 3ZNYA 3E2KA 3RXWA 1YLTA 2WAEA 5E2FA 1W8YA 4JKTA 2ZC6B 5A93A 5KMWA 3IF5A 4JF5A 4XUXA 4P87A 2WGWA 3M2JA 4KZ4A 3BFGA 5BOHA 3G35A 4KZ3A 3CJMA 3E2LA 3UE1A 1GHIA 3BYDA 4P85A 1DY6A 4QHCA 2WYXA 2EX2A 4MLLA 1BLHA 1SHVA 4OLDA 3SS5A 3VOZA 1RGYA 3HUNA 5FDHA 3EQVA 5HFOA 4KZ9A 2WKEA 2Y2QA 2Y2LA 1HTZA 2V20A 5DVAA 2PU4A 3VSLA 4WMCD 2IWBA 3WS1A 4EV4A 3ZG7B 1ES4A 1HD8A 3IWOA 4EBLA 4PPRA 2Y91A 4LENA 1LL9A 5I94A 1AXBA 3MZDA 3C7VA 4JXVA 3LEZA 2XD1A 3G4PA 4EBPA 3HBRA 1YMSA 4ZDXA 4LV0A 5KZHA 4WZ5A 4LCLA 3BLSA 3PBNA 1GHPA 3UE0A 1BUEA 3IXGA 3MKEA 2XR0A 2ZD8A 4BLMA 4R23A 3ZVWA 3ZVTA 3P09A 1ONHA 4OOMA 3TSGA 3FKWA 3IHBA 3IWIA 4N92A 4WEKA 4Y0OA 4PM5A 5TR7A 3WS4A 1QMFA 1L0EA 1ZC2A 3MFDA 3QNCA 2WKHA 1W79A 3HLFA 5E2GA 2A3UA 5A90A 1KE3A 4RA7A 3EQUA 2R9WA 5EECA 4QY6A 2HDRA 1NXYA 4R4SA 2X71A 3BECA 2IWCA 3GTCA 4GDNA 2XLNA 4X53A 1ESUA 1L0FA 5EVIB 4EQIA 5A91A 4E3NA 1LL5A 3GR2A 3P98A 4UAAA 3MZEA 2WZXA 3BFEA 5CGSA 3N6IA 1ZG6A 1MKIA 3PBQA 4LV2A 4E3IA 4E3MA 1IYQA 1MBLA 2ZM8A 3UPNA 4JLFA 1FOFA 1HZOA 4BL3A 3AGDA 4OOYA 4JF6A 3IF6C 4KZAA 3HLBA 5HL1A 2WGVA 3Q7VA 5KSCA 3N7WA 2ZQCA 3ZCZA 1BULA 4OONA 1XPBA 1C3BA 3B3XA 3NI9A 1KE0A 2EXAA 3JYIA 4GB7A 1ES2A 4C3QA 3M6HA 3HL9A 4B4ZA 2V1ZA 4GNUA 2ZM2A 4XUZA 1IELA 3UN7A 5CEBA 1YT4A 4IBRA 3O3VA 3ZG0A 2E8IA 4YINA 3N8RA 4GDBA 4MNRA 1U60A 1HVBA 4ZAMA 4Y7PA 3HVFA 3BRMA 1I2SA 1IYPA 2ZMAA 5F1GA 1BTLA 3UDXA 4RX3A 5GLDA 4EUZA 2Y59A 4S2IA 1KVMA 5JYOA 2P9VB 1OMEA 2Y2MA 3Q82A 1IEMA 5HX9A 2WKIA 3O87A 3DWKA 3OZHA 3UO9A 4YFMA 1CI8A 1NZUA 1TVFA 4N9KA 3GQZA 2Z2LB 2XGNA 3LCEA 3PTEA 1YLJA 1H8ZA 1LI9A 1WYBA 1N9BA 3G34A 3HUOA 1Z6FA 3ZG8B 4N9LA 4U0TA 4QY5A 3VOYA 3GRJA 5FQIA 1K56A 2WK0A 3SH8A 2G2UA 2H5SA 1Y54A 5GHZA 5EPHA 4FH2A 2Y2OA 3UDFA 5EOEA 3MKFA 5AQ7A 5CEDA 3HLGA 3PBRA 1W8QA 1K55A 2OLUA 1XGJA 3M2KA 4JBFA 4EWFA 1JTDA 4S2PA 4RX2A 1ESIA 3GMWA 4N1HA 4B4XA 2R9XA 3QNBA 3S1YA 1Q2QA 3UPPA 2XQZA 1MPLA 5E43A 1RCJA 4QU3A 5FSRA 2HDSA 1K54C 4WYYA 1GA9A 1TEMA 4D2OA 3BFCA 4S2OA 4DE0A 3PBTA 2CC1A 5HAQA 1VM1A 4GN2A 5E2HA 3D4FA 4QB8A 5EVIA 1DJCA 3VP3A 4R4RA 3NIAA 1MXOA 2DNSA 1O7EA 4ZTKA 2EFXA 2BLSA 4IVKA 3LY4A 1I2WA 5FI7A 3SS4A 3W4OA 2QPNA 1SDNA 2Y2GA 3UPOA 2XFTA 4PM6A 3UNWA 4MBFA 4WMCA 5EOOA 4FSFA 1XP4A 2ZJ9A 4WELA 4DE2A 1XKZA 3FWLA 3NBLA 5CXWA 4HESA 4UHUA 1IKGA 4IVIA 4BENA 2WADA 1K6RA 2VGKA 5CGXA 4DKIA 3C4OA 3HREA 2GDNA 5CERA 4MBKA 2DCFA 2EX8A 4N1XA 4S2LA 4WZ4A 3ZNTA 2J9PA 3A3JA 4KG6A 1XA1A 5GHXA 3FZCA 3HLEA 4QJGA 1I5QA 4WZ5C 3ZDJA 1E3UA 1ZG4A 3SH9A 2P9VA 3NCKA 4C6YA 1BLCA 1JWPA 1SCWA 3WS2A 1YLPA 2Z2MB 1ALQA 3C7UA 3N8LA 4ID4A 5CGWA 5FQQA 3W4QA 5KSHA 5M18A 3A3EA 5A92A 5HAIA 3GV9A 3V3RA 1FQGA 4OQHA 5FAQA 2JBFA 3G30A 2I72A 2ZM0A 3HLDA 3O86A 1WYCA 1TDGA 5G18A 1FSWA 4LV3A 4JXWA 2Y2KA 4R3BA 3I7JA 1W7FA 4KZ5A 2FFFB 3UDIA 2ZC4B 1JTGA 4PMAA 3W8KA 3OPHA 4ZJ3A 4PM9A 1DJAA 3N4IA 3TG9A 5DTSA 3HLWA 1KGEA 1MWTA 4O7DA 3V5MA 4RYEA 4KZ6A 1N4OA 3IH9A 3VP2A 3PBOA 1PZPA 3NY4A 1KDWA 2P74A 2H10A 1BT5A 1K57A 4KQRA 4ZJ1A 5AQBA 3ITAA 4OH0A 1PW1A 1FCNA 4Z9QA 1XX2A 3IHAA 2EFUA 1JVJA 2HDQA 3LY3A 1SDEA 4OQGA 3SOIA 1BLSA 1G6AA 4HBTA 3HLCA 1JWZA 2A49A 2C5WB 3N8SA 3OPLA 4PM8A 4DDYA 4UA9A 2FFYA 1XA7A 1ZKJA 3ISGA 2ZQDA 4WBGA 5GLAA 3A3FA 3A3DA 1H5XA 2RL3A 1G68A 3DWZA 3O88A 3M6BA 3ZHHA 2ZC7A 4H8RA 5CECA 1PIOA 4ZBEA 4PM7A 3VP1A 2OSUA 2XDMA 4MBHA 3VP4A 1M6KA 1NJ4A 2Q9MA 4KQOA 2Q9NA 5DF7A 4KG5A 2HP5A 3G2ZA 3MBZA 2VGJA 4E6WA 1FCMA 5GLCA 4JXSA 4OPYA 3Q1FA 1FCOA 3AGFA 4KZ8A 3IXDA 5CTNA 5AQ9A 4R0QA 1SKFA 2ZC5B 4OQ0A 3BEBA 4WM9A 1PWGA 3VMAA 5F82A 1KGFA 1K56D 4CJNA 1LI0A 2EX6A 3IF6B 1ES3A 1O07A 1H8YA 4OPZA 4OQIA 3QHYA 2OV5A 3G32A 1IKIA 3NC8A 3WRZA 1S0WA 4OVDA 1K55C 4FD8A 1FSYA 3BFDA 2J7VA 2WGIA 3OCLA 4FCFA 4E3LA 1LHYA 4OOLA 4B88A 5F1FA 4X6TA 1PW8A 1VQQA 2J9OA 4LCMA 3MXSA 1KGGA 4NK3A 1ES5A 2OLVA 1CK3A 1GA0A 1BLPA 1YM1A 3Q07A 1BSGA 3C5AA 1M40A 5DF8A 3VFHA 4JF4A 4RVAA 4KZBA 4LV1A 4DRTA 3GVBA 2JE5A 4F94A 5FAPA 1L0DA 1YQSA 5EVIC 5EVID 3IQAA 2H0TA 2XEPA 3OCNA 2HP6A 3OPPA 3WS0A 5M19A 2V2FF 3FV7A 4OPRA 2PBYA 3HUMA 1XGIA 4P6BA 5FASA 2XD5A 2Y2PA 1K6SA 1EI5A 3ZG5A 5EVLA 2PU2A 4KG2A 2X02A 1TDLA 4EBNA 5EUAA 3OC2A 4DE1A 2XF3A 2QZ6A 4S2MA 3ZFZA 2IWDA 3OPRA 1L0GA 4R1GA 1NYYA 4GZBA 1WE4A 2Y55A 5FATA 5HAPA 2BG1A 3VP0A 2B5RA 5CHUA 4NETA 2XK1A 1NY0A 2XFSA 4HBUA 1E25A 1CEFA 2HDUA 2HPBA 4JPMA 4BD0A 5DTTA 1K38A 4DXBA 5DF9A 3IXBA 1YLYA 4Y0UA 1GHMA 1RGZA 3ZG9B 3G31A 1W5DA 4XXRA 5CTMA 4X56A 2Y2NA 1S6RA 3IXHA 3MZFA 5FA7A 3V39A 3NDGA 4OP5A 2WAFA 1MY8A 2ZLYA 3LO7A 5E2EA 4BJPA 4GKUA 4IEDA 2DRWA 4S2JA 5F83A 5HARA 1EWZA 4E3JA 1ERQA 4L0LA 3UY6A 3PAGA 5DTKA 4Y0TA 1E3UD 2C6WB 2HP9A 5GHYA 3PBSA 4GD6A 3Q81A 2ZQ9A 4QD4A 4MEZA 1E4DA 5FQJA 1PZOA 2Y2JA 1J9MA 5D3OA 4S2NA 4K0XA 1GCEA 3V3SA 2G2WA 3W4PA 3WRTA 1JWVA 4OKPA 4IBXA 5GLBA 5L2FA 3FYZA 4GD8A 4U0XA 4U3TA 3SH7A 2WGWB 4X55A 1FR6A 1KE4A 5CHMA 1K4FA 3WWXA 4Q8IA 3RJUA 3CG5A 1NYMA 3PAEA 4DF6A 3IF6A 1L2SA 1MWUA 4WEJA 5GL9A 3VSKA 4S2NC 5M1AA 4FH4A 3CZDA 1XXMA 4R3JA 3NDEA 1IYOA 1ONGA 1YLWA 3DW0A 3UE3A 1ERMA 1NZOA 1Q2PA 4KENB 2JC7A 2ZC3B 4E6XA 2H0YA 2XH9A 3IWQA 4K91A 2UWXA 4DE3A 2Y4AA 1DJBA 3DTMA 3BFFA 1K57C 2RCXA 4JXGA 1PI5A 3ITBA 2QMIA 4DDSA 5FAOA 3Q7ZA 4OPQA 5U47A 4DXCA 5FQ9A 4E3OA 3ZGAB
chains in the Genus database with same CATH superfamily
1OGGA 3KSFA 4CPKA 2ZQ7A 1CI9A 1OJ5A 3AFAB 4C75A 1MWSA 1XJ6A 1YMXA 3IH8A 3FKVA 4K0WA 1P3AD 3TOIA 5HWWA 1MWRA 2IA2A 5CRFA 3AZNB 3WD1A 1RP5A 1S32D 3BLMA 2QKPA 2P7JA 3IP4C 5BPVA 5B33B 3A3IA 5CHJA 5FQKA 3AGEA 2Y2HA 2K31A 1M1AD 2NUTC 3AZFD 2J8YA 3BM6A 3CAXA 3G2YA 3VFFA 3W96A 4BQMA 3MGSB 1EQZB 2EXBA 2ZQ8A 3RXXA 3TE8A 3B6GC 5HW3A 4HJ3A 3REIB 3F1NB 1IYSA 3GSGA 4J8WD 4X68A 4NZ1A 5JYPA 3L29A 2EX9A 3BJNA 1ODVA 1AOIA 1U35B 3Q7VB 2PYOA 1M19D 4HY8A 2BYKA 1JFIB 1W8YA 1A7WA 5A93A 4I5SA 4KGCD 2ZOHA 4JF5A 4XUXA 2WGWA 5HWTA 3BFGA 4MN5A 2M7UA 3G35A 4KZ3A 4GCZA 2HUEB 1GHIA 4P85A 3W97D 1BLHA 4NZ3A 3SS5A 4EO5C 1XJ3A 4Y15A 4WU9D 3HUNA 4MMNA 5HFOA 4NXBA 2Y2QA 1HTZA 3HJKA 1P9RA 5DVAA 3VE4A 5E5AB 3ZG7B 1ES4A 4LENA 4WN5A 3F1OB 1LL9A 3MGRD 1CF0A 5G49A 3ZQ5A 3MZDA 3LIAA 5AV8A 3KSHA 1YMSA 4GLQA 3WTPB 4LV0A 5J7EA 5KZHA 2NZDA 3UB7A 5TJJA 2ZD8A 4BLMA 3MQOA 3AZGB 3TSGA 4L9EA 2V1AA 1QMFA 1P3GA 5B32C 5B24C 3HLFA 2PBDP 2RVQD 3NQJA 3AFAC 2NQBB 4X1LA 4R4SA 3LIBA 2HGVA 2IWCA 1S66L 3KXBD 3GTCA 5C5KA 1L6JA 5F69A 4UUZB 4CSRB 1ESUA 4CLCB 3LELA 5B40A 3KS4A 4JJNC 2BYMB 1D1JA 1P3OB 1ZG6A 3PBQA 4E3LA 5B33C 1MBLA 5DNNC 5DFXA 1EW0A 3EGDC 1P3KD 1UWPX 4OOYA 3V67A 4E04A 1TZYB 3QP2A 1SKOB 1LL8A 4R3AA 4HJ4A 4OONA 1XPBA 1P3FB 3B3XA 5AVCC 3KSGA 1P3BA 4B4ZA 2ZM2A 1P34B 4IBRA 4LD9A 4YINA 2Z6DA 4Z5TB 3UT9D 4RX3A 4I3IA 1KVMA 1MKMA 1HQ3A 1IEMA 3AZHB 2WKIA 3DWKA 4YFMA 4N9KA 3MGPB 3C2WA 4H9OA 5GT3B 2HJEA 3PTEA 1PDCA 1M18D 1YLJA 5DNMA 1NLZA 3HUOA 1TS0A 3ZG8B 4U0TA 5B1LC 1YSQA 3GRJA 3O62C 4J8XA 2HJ9C 5E5AC 1W63M 3LZ1B 1Y54A 5EPHA 3KWQB 3MKFA 5B2IA 5CEDA 1K55A 4LRYC 3WKJA 1XGJA 3UTAA 4JBFA 1JTDA 2L4RA 3AZJD 4RX2A 1ESIA 3LIFA 4EW7A 2XQZA 1KS0A 4F3LA 2F8NH 1TEMA 4D2OA 1CQAA 5CP6D 4DQYB 4S2OA 4DE0A 1W1YA 3UMEA 1P3PA 3B6FA 3X1VA 2PYRA 1DJCA 3ULFA 4R4RA 4IBIA 4Z2JA 3EPJA 2PYPA 3REHB 5G4ZA 2EFXA 2BLSA 4IVKA 5B31A 1H8PA 2EWVA 2NQBC 1OTIA 3SS4A 1BH8A 5L07A 1P3LB 2Y2GA 5DJUA 2XFTA 3OOVA 4PM6A 5CPKC 4MBFA 4NE5A 4WMCA 3B47A 5B2JB 3RELB 3CUEA 3CLOA 1XP4A 1WWIA 2ZJ9A 1DP9A 1XJ4A 3FWLA 3NBLA 3B0CT 3X1TC 4BENA 2WADA 5I5LA 2K2NA 1KX4D 2A24B 3C1CC 3C4OA 4CAYB 2GDNA 1P3IB 4WZ4A 5F99D 3FZCA 1F1EA 2LB5A 3F1PB 5B24D 5JRGB 3EPHA 3KX0X 1SCWA 3WS2A 3P7NA 2Z2MB 3W4QA 3AFAD 4I3JA 3W2ZA 3NULA 4Z2IA 3AZIC 4OQHA 4FUWA 4G91C 2I72A 2ZM0A 3HLDA 3AZND 3O86A 1WYCA 5CPJA 4LV3A 2VZWA 4H9RA 4H9NB 5G18A 1P3MB 5TBMB 4R3BA 3T1RA 1CK7A 3UDIA 2OWHA 2PDRA 5B33D 2O0YA 4ZJ3A 4PM9A 1OT9A 5DTSA 1KGEA 3MGSD 3A6NB 4KZ6A 3IH9A 2BASA 3VP2A 2AROB 5AVCD 1G6OA 2RIQA 1PZPA 3REID 5C3IC 4KQRA 5BO0A 3BQAA 3WTPE 2HDQA 1IFQA 3LY3A 3R7WB 4NFTA 1U35D 5AY8A 1G6AA 2JN7A 4PM8A 5GSUB 4DDYA 2YFVB 2V0UA 2FFYA 1XA7A 5EM0A 3CITA 2P04A 4L9FA 3A3DA 2KLIA 1G68A 2RL3A 1HLUP 4OUIA 3O88A 3A0VA 2QJ7A 2ZC7A 3T1SA 2ZY5A 3MR0A 3NQUB 5L09A 4KUDB 3VP4A 2Q9MA 4TX8A 1LSWA 5DF7A 2HP5A 5B1LD 4Q0JA 5E5AD 4CLCE 4I38A 4KZ8A 1E6PA 5AQ9A 1H3OA 4WU8B 3WD4A 1H0MA 4WZSB 1CXWA 4OQ0A 4WM9A 4J8VB 5AV9A 3WTPD 4GHIB 1LI0A 4GS9B 1CJFA 1ES3A 1P0ZA 4K08A 2QJ5A 4OPZA 3QHYA 3AZMA 3AZGD 2J7VA 1LHYA 4B88A 3L28A 5F1FA 3LJAA 1VQQA 5JRGC 3A0RA 3MXSA 2NQBD 3KUYB 3AV2A 1YM1A 3AN2C 5DF8A 1M40A 2HIOC 3VH6W 4RVAA 4KZBA 1OJGA 3GVBA 2JE5A 5FAPA 1L0DA 5CPKD 4CLCD 2XEPA 3OPPA 3AZLC 4HMEA 2Y79A 5M19A 3HUMA 1P3OD 4HQAA 4P6BA 2XD5A 1BYWA 5EVLA 2PU2A 1TZYD 5FL3A 3ZFZA 1TS8A 3A6NC 4R1GA 1WE4A 2Y55A 5FATA 5HAPA 2BG1A 1P3FD 2B5RA 5CHUA 2K7SA 3VP0A 4B93A 2AROC 4EBPA 3PYPA 3W96B 2V5OA 4DXBA 3QP1A 1UWNX 4XXRA 2IO5B 1P34D 5CTMA 3VH5T 4OP5A 2RTSA 2J3TC 4BJPA 4S2JA 4Z5TD 4E3JA 1EWZA 4L0LA 4Y0TA 2C6WB 4GD6A 1P97A 3Q81A 2WKRA 1AOIB 3AZHD 4MEZA 2ACGA 2BYKB 4YS3A 2Y2JA 5D3OA 3MNNC 2G2WA 3WRTA 5GT3D 3FYZA 4MB4A 2WGWB 2PT7A 2VV7A 1LSXA 4Z66B 3WWXA 4Q8IA 5BT1D 4NYUA 3RJUA 1NYMA 1MWUA 3LZ1D 3TU4C 3KWQD 1VETA 4O01A 4X23C 1DP6A 3CPTA 3FC7A 2EWWA 1STZA 3LR5A 5AVBC 1T1BA 2V0WA 1NZOA 3EEHA 3VH5A 1ID3A 4E6XA 3AYWC 1DJBA 5G49B 3BFFA 3VV4A 3AZEC 5AV8B 2EA9A 4YM6A 2QMIA 4ETXA 5FQ9A 3ZGAB 3C4PA 1XFQA 2Y2IA 2NZDB 4ZJ2A 1F66A 4UEYA 3REHD 4GJ4A 4BL2A 4XUJA 4ZUXC 3LICA 3CMZA 1P3GB 1TF1A 3MXRA 1S32C 3UTBA 1EROA 2J80A 5FI2A 4HEFA 5BNXA 2W3EA 5B2JD 3NQJB 3RELD 1Q9CA 4NYYA 4NEED 1T1CA 2NUPC 3BWLA 2PAVP 5FQMA 4H6JA 1V9YA 5EE8A 4A5RA 5B40B 4X25A 1Y4OA 4UA7A 1K54A 5B0YA 3FKEA 2WUQA 5JRGD 3W98A 4QNLA 4P6ZM 1LSVA 1YLZA 1KDSA 3ZNYA 3E2KA 1M19C 2IO5C 3MXQA 4JKTA 1P3BB 5F6AA 5AVFA 3AV1C 4KGCC 3IF5A 3M2JA 3CJMA 1P3MD 3REJA 3AZLD 4LD9B 2XA7M 2V1BA 3TRCA 4HMDA 4MLLA 3W97C 3MVDB 1KX3A 4OLDA 1RGYA 4WU9C 3FPWA 5FDHA 3EQVA 3FG8A 1HQ3B 3VSLA 3NOTC 2PU4A 3A6ND 2IWBA 3WS1A 1HD8A 4Z66C 1KX5A 2AROD 2PR6A 3S7NA 2DQNC 4H9OB 4J8UA 3C7VA 5CPIA 1E6NA 5DNMB 4II7A 2I9VA 3BW6A 4ZDXA 4LCLA 4J8XB 1GHPA 5B2IB 4R23A 5GSUD 5L10A 3P09A 1ONHA 3WKJB 4OOMA 5AV8C 3U2AA 5HDDA 1L0EA 3C30A 3MNND 1W79A 4F3LB 3JVVA 5AJGA 4DMZA 4MB3A 4RA7A 3EQUA 1KU5A 1NXYA 1P3PB 3B6FB 2X71A 3BECA 2JHEA 3L27A 3KXBC 3X1VB 4X53A 3KSIA 1L0FA 2ZL1A 3TU4D 3GR2A 4UAAA 3E4PA 4NE6A 3BFEA 5B31B 5CGSA 4R8PC 5HPFA 5CHLB 1FILA 4LV2A 4E3MA 1BH8B 4ZBJB 4JLFA 4EERA 4J8VD 2A2LA 3AGDA 2JKRI 5B0ZB 3DTEA 1O6IA 4JF6A 3IF6C 5KSCA 1KE0A 4BWIA 1ES2A 3KYEA 3M6HA 3HL9A 4IBEA 4XUZA 3AZKC 1UGUA 2HZ5A 4QLCA 1OTAA 5CEBA 4L9GA 3RH8B 4ZUXD 2E8IA 4GDBA 4ZAMA 1YU3A 2ZMAA 3UT9C 3X1UA 4S2IA 2Y2MA 5HX9A 4QWOA 3O87A 3UO9A 3OZHA 4D60A 1CI8A 1NZUA 4Z1WA 5DJTA 3MVDC 2XGNA 1QO6A 3LCEA 1M18C 3WAAA 5CPJB 4H9RB 4N9LA 3E4QA 3C1BA 1M1AA 3SH8A 3AZFA 2G2UA 3JVUA 5GHZA 3UDFA 5EOEA 5AQ7A 3T1QB 3DTKA 3H0MC 3W96D 2XROA 4S2PA 3AZJC 3GMWA 4R6LA 3QNBA 3S1YA 4WNNA 3UPPA 1PZRA 5E43A 2F8NK 4QU3A 2HDSA 4IBCA 1EAKA 3AV1D 2CMNA 2W3DA 5CP6C 3BFCA 5IU1A 5BO0B 3T4TA 4GH9A 3D4FA 1Y28A 5FDSA 5AY8B 5EVIA 1N9OA 3BY9A 3NIAA 4IUKA 4LRXC 1I2WA 1PRQA 5FI7A 1F98A 3W4OA 1SDNA 5EFWA 3VOLA 4WL9A 4Z66D 3IX3A 3UPOA 4Y3IA 3SZTA 3WA9B 2DF4C 5AV5A 3K3CA 3QP6A 4ARZA 5IT5A 1IKGA 3MQLA 5B0ZC 1K6RA 1H3OB 1KX4C 2VGKA 5CGXA 5AV8D 3LFVA 4MBKA 5CX7A 2DCFA 4N1XA 4FOFA 3KYZA 5F99C 5AV9B 1XA1A 5GHXA 3HLEA 3FDDA 4DN0A 3P01A 4WZ5C 5GT0C 3GDIA 3ZDJA 3X1SB 2ZM5A 3SH9A 2NZDD 4C6YA 3MGQA 4FTXA 3LUQA 1ALQA 5FQQA 3N8LA 4ID4A 5KSHA 3AZMB 5M18A 5HAIA 3GV9A 2O9BA 3G30A 4NZ5A 3AZNC 1P3GD 3LJAB 1TDGA 1KOUA 4JXWA 1W7FA 4R8PD 3CWFA 4H9QA 3AV2B 2ZC4B 4PMAA 3N4IA 3HLWA 3MGSC 1EQZC 3V5MA 5B40D 4JGQA 1P3KA 5HSQA 3PBOA 3B42A 4HIAA 3RFBA 3REIC 3NY4A 5F68A 4ZJ1A 3ITAA 3AZKD 1FCNA 4WUJA 1JVJA 4NY2A 1U35C 1SDEA 4OQGA 2IOUA 3OPLA 1P3BD 4MB5A 3ISGA 1H5XA 3AL0C 2HUEC 5CECA 4ZBEA 4R38A 2XDMA 2DMWA 3F6TA 3MVDD 1NJ4A 2F2AC 3B0BA 4KG5A 3G2ZA 3MBZA 1FCMA 4LFUA 4JXSA 1HQ3D 4HMCA 3LIDA 4YS3B 3Q1FA 1S4RA 5B1MB 5CTNA 3B6GA 4R0QA 4Z2MG 3WA9C 3BQ8A 1T3UA 2ZC5B 5DNMD 1PWGA 3WTPC 1KGFA 2EX6A 3NJAA 1VETB 5B2ID 3NC8A 3WRZA 2G7UA 1S0WA 3CPTB 5BS7C 4H9SC 3AZGC 3WKJD 4FCFA 2GX5A 3NECA 1X0OA 1ID3B 3HSHA 3MJQA 1KGGA 3X1SC 1ES5A 4G92B 1CK3A 4YM6B 4X1MA 1BSGA 3B6FD 3VFHA 4HJ6A 4DRTA 4F94A 4OJOA 1F66B 1YQSA 5EV0A 4CLCC 2V2FF 1W1TA 4XUJB 3C38A 1P3OC 3AV2C 1ULYA 1EI5A 3UTBB 2X02A 1TDLA 5B0ZD 5EUAA 4DE1A 1TZYC 1MZUA 2XF3A 2W3HA 5BNXB 3VH6T 4S2MA 3P5JB 3LZ0A 1GSWA 3FPVA 4UQIM 1P3FC 4H9PB 1NY0A 5GT0D 4I39A 5DTTA 4H6JB 1K38A 2B18A 1RGZA 3ZG9B 4AWLB 1P34C 5B32A 3MZFA 3NDGA 3W99A 4HI4A 5B0YB 2WKPA 4GKUA 4IEDA 5F83A 4Z5TC 5HARA 1W63Q 3PAGA 5DTKA 3W98B 4Y5FA 4JGOA 3MQ0A 1WA9A 4EETB 3AZHC 5F5YA 5FQJA 1J9MA 1VHMA 1GCEA 4JJNA 3MGPC 4IBXA 5GT3C 4CQHA 2VK3A 5CPJD 5DNNA 1EQZD 1FR6A 4PKYA 2OWJA 3REJB 3VH6A 5BT1C 3CG5A 4WEJA 3LZ1C 1KX3B 3KWQC 5B1MC 3M7PA 3T4OA 1YLWA 5AVCA 2WKQA 4KENB 2JC7A 2ZC3B 4XZQB 2H0YA 2XH9A 3IWQA 3UB8A 1KX5B 2Y4AA 4WF0A 1XFNA 3DTMA 1S4SA 3EOIA 4J8UB 5HD5A 1K57C 3B33A 1H8MA 5CPIB 4OJ6A 4JXGA 3ITBA 1JFIA 2G5HC 1MC0A 4E3OA 1KVLA 5J8XA 1ID3C 1K25A 3REHC 4HH3A 2JCHA 5FI6A 4E3KA 4GOGA 4G92C 1P3LC 3D72A 1PI4A 1YUEA 4AFIA 1FR1A 3LR0A 3A1KA 1F66C 5TFQA 5B1LA 3O62A 2HV1A 3H9WA 4E45A 5B2JC 3RELC 5E5AA 3WA9D 5TGFA 4X69A 3H82A 3LIEA 1ACFA 3L26A 1T18A 4BD1A 2ZL1B 2INWA 1PWDA 1S67L 2ZQAA 1K4EA 3E0YA 4UA6A 3V50A 4M3KA 4Z2GA 1PYYA 1P3IC 5AQAA 3S7QA 3X1SD 2X01A 1P9WA 4RQ9A 2V9AA 3RXWA 3AZMD 4AWLC 1ZHHB 2ZC6B 3NHQA 3EEAA 5FUGA 5KMWA 2NQBA 4P87A 2YFWA 4QLCB 4KZ4A 3ZYTA 5BOHA 3W98C 1P3MC 3E2LA 2W8SA 3UE1A 3BYDA 4IJEA 1DY6A 4QHCA 1TS6A 5AV6A 3AV2D 2EX2A 4B9OA 5CPKA 4NG2A 1OTDA 2D01A 3VOZA 3X1UB 3B0CW 1Z09A 2WKEA 2Y2LA 2PR5A 3UB6A 3X1TA 2VJWA 2VGLM 4EV4A 4EBLA 3IWOA 2Y91A 2F8NA 5I94A 1AXBA 3C1CA 2W27A 1YAXA 2XD1A 2JSSA 3WAAB 3MF0A 3C1BB 1M1AB 3BLSA 3PBNA 3AZFB 1BUEA 3MKEA 2V8CA 4EEUA 1AWIA 4XZQC 2JKGA 3R4KA 5GSUC 5B31G 3ZVTA 3FKWA 3AZIA 3L9KA 4WEKA 2V8FA 2CV5A 2PYOB 3WS4A 1H0IA 1ZC2A 4WNNB 3QNCA 3D9YA 2WKHA 5E2GA 3MGPD 2A3UA 4KUDC 1LT0A 1H3QA 2R9WA 4LRZE 2HDRA 2CWEA 2FH5A 3REKA 3QP8A 3SW1A 4YS3D 5EVIB 4EQIA 3L25A 4JGPA 5B1MD 3MZEA 4WU8C 5DKKA 3N6IA 1MKIA 3NOPC 1IYQA 2ZM8A 1FOFA 4G3VA 4J8VC 1JNUA 4BL3A 4QPRA 4OJLA 1L3LA 3HLBA 5HL1A 2WGVA 2ZMFA 3N7WA 3IBJA 1BULA 5B32G 5AV5B 3NI9A 3JYIA 4EUVA 4GB7A 4ARZB 4EXOA 2V1ZA 1ID3D 3CI6A 3UN7A 3E4OA 3KFUG 1YT4A 4ESPA 5GXQA 3ZG0A 3N8RA 4MNRA 1U60A 1HVBA 4Y7PA 3HVFA 3IBRA 3KUYC 1IYPA 5F1GA 1P3LD 3OLOA 1BTLA 4EUZA 4HGAB 1PNEA 2Y59A 1F66D 4ETZA 3MGQB 3UB5P 4Y13A 1E8BA 4PKYG 2R78A 3KS8A 1TVFA 3GQZA 2Z2LB 4EEPA 4P6ZS 1LI9A 2OAP1 1WYBA 3LELB 2JKFA 3G34A 2O9CA 5FQIA 4NKPA 1J7MA 1K56A 4H9QB 2W0NA 1P3ID 3ICYA 1W8QA 4EWFA 3W96C 2XA7S 3WAAC 2FJ7A 4B4XA 2UV0E 1Q2QA 2ZMVA 1MPLA 5JRGA 4WYYA 5B0YD 3LR3A 3PBTA 2CC1A 3AN2A 5HAQA 3W98D 2HIOA 4IJGA 1AOIC 3QP5A 2PYOC 3L7HA 4QB8A 3MQQA 2J8PA 3AZLA 2Z6CA 1NLYA 4HNBA 2L1MA 4MCWA 2QPNA 5K5BA 5HWVA 1A0KA 1GPFA 1OTBA 2XSSA 3H0RC 1KX3D 3A6NA 2VV8A 2ZY3A 3EPKA 2OOLA 5EOOA 3K2NA 4WELA 2AROA 4DE2A 4LLOB 5CXWA 3T4QA 4UHUA 4R70A 1VB6A 4XZQD 1UR8A 3PXPA 4IVIA 4KUKA 4NXEA 1KX5D 3B6GB 5G4YA 4J8UD 3UTAB 2PD7A 4NZ4A 2EX8A 3UMDA 3ZNTA 3A3JA 3T4KA 1I5QA 1NRJA 4HP9A 1GSVA 4ME4A 3WX7A 1E3UA 2P9VA 2NZDC 3NCKA 1JWPA 4KUDD 1YLPA 3C7UA 5CGWA 3MNNA 1YU0A 4XT2A 1FQGA 5FAQA 1BFMA 1P3GC 3PHYA 4HGAC 3LGOA 4WU8D 2FN2A 3I7JA 4KZ5A 4WJ3C 2FFFB 1JTGA 3TU4A 4EO5B 2F8NG 1R4VA 5LBRA 3R45A 1N1JA 4X23A 1DJAA 2QHKA 1BH9A 5AVBA 4O7DA 1MWTA 3LELC 5B40C 3AYWA 4MN6A 5HD3A 2P74A 3AZEA 2H10A 1BT5A 1ZLAA 1XX2A 3IHAA 2EFUA 4O0PA 4BBVA 3LZ0B 3SOIA 3KUYD 1S1YA 3HLCA 2C5WB 3K3DA 1P3BC 4ZUXA 2ZQDA 4WBGA 5GLAA 3A3FA 1P3AA 5B32B 1S32A 4LD9C 3ZHHA 4H8RA 1PIOA 3W99B 2QYBA 4MBHA 4KQOA 2Q9NA 3X1UD 4Y17A 2VGJA 4KUOA 1HQ3C 1B67A 2O9AA 4OPYA 1FCOA 4JJNB 2L5AA 4IBBA 1SKFA 3WAAD 4WV4B 5DNMC 5DNNB 3H7WA 3UB9A 4J8WA 1YU1A 3C1BD 4CJNA 4J8XC 3L2AA 2W1TA 1H8YA 1S1ZA 1N9NA 3G32A 5B2IC 1M19A 1N9LA 4OVDA 1K55C 3MSHA 5FEFA 3WKJC 3UTAC 5AVCB 1AOID 3AV1A 2PYOD 4KGCA 3T12B 4X6TA 5EM1A 4LCMA 4OJPA 4NK3A 4IBDA 1GA0A 3W97A 3Q07A 4GW9A 4DRBA 1P3PC 3B6FC 4WU9A 5A8BA 4LV1A 3LI8A 3X1VC 5EVID 3QP4A 2H0TA 2HP6A 3WS0A 4Z66A 5B31C 3FV7A 2PBYA 3MGRA 1E15A 4ZBJC 3ZG5A 2O99A 4YOFA 5MC7A 5B1LB 3O62B 2IWDA 3OPRA 1L0GA 3CUEC 4HOIA 4M6BA 4GZBA 1TD5A 3H82B 3MMHA 5EVEA 5AV5D 4NETA 4JPMA 2P08A 4KQDA 2HDUA 3EG5B 1SZVA 3IXBA 1GHMA 3G31A 5FA7A 3IXHA 4IBKA 2GZAA 3V39A 3LZ0C 1D06A 2WAFA 1MY8A 2ZLYA 3GECA 5E2EA 1ERQA 2M1CA 2W1RA 2HP9A 5GHYA 3PBSA 1GSXA 3MGQD 3KXBA 4IBFA 5FEGA 4S2NA 3V3SA 2ZBBA 3W99C 3W4PA 5FUGB 1FIKA 5L2FA 5GLBA 4R8PA 3T50A 2VQRA 4GD8A 4OJ5A 4X55A 2YFWB 4Y2FA 5CPJC 3LELD 1K4FA 3PAEA 4DF6A 3IF6A 5AV6B 1L2SA 5CPKB 1XXMA 1ONGA 3S7PA 3UE3A 1ERMA 3X1TB 3VE3A 1NWZA 3IS2A 3AZKA 2F8NB 4K91A 2UWXA 4DE3A 3WD2A 2D49A 2ZOIA 3C1CB 2W3FA 5HDCA 4DDSA 4Z2HA 3Q7ZA 4OPQA 2W3GA 5U47A 3UT9A 3KO6A 4DXCA 4LD9D 3UE6A 5AY8C 5IHVA 4P0MA 5JA4A 3IX4A 3AZIB 2WZZA 1PWCA 4G91B 3MVDA 3V9RA 2CV5B 1H0GA 4S2KA 1M18A 1W1PA 3S4XA 4BMWA 4OLGA 1OT6A 4WLAA 4YWZA 4KQQA 3S22A 2J3WA 4LGWA 1CEGA 3REKB 4KZ7A 4J8XD 3NOUC 2XRNA 3AZJA 2L0WA 2VLGA 1G28A 3SS3A 3B6GD 4PHTA 4DJ2A 3UTAD 1QMEA 1DP8A 4OP8A 5C3IB 5KDMA 2YKFA 3JPUA 5AV9C 5CP6A 1NRFA 3IT9A 3MS6A 1LLBA 1BZAA 3EGXC 4IUHA 3WS5A 1YLTA 2WAEA 3AZMC 5E2FA 4LG2A 1P3PD 1YPRA 3MFXA 3X1VD 3TW8A 3LJAC 2LY8A 2MJ6A 3LYXA 1TAFA 4UQIS 5B31D 5GXQB 5BNVA 1TS7A 2WYXA 1SHVA 3T1XA 2Q0OA 4UPKA 3OBFA 4KZ9A 1VEUA 3WD3A 2V20A 1W2EA 4WMCD 1V9ZA 4KHAA 4PPRA 5B0ZA 2PHYA 3DTIA 2QWSA 1KX4A 5AV6C 3G6OA 4JXVA 3HJIA 3LEZA 3G4PA 2Y8HA 3HBRA 5F99A 4WZ5A 5GT0A 5B24A 3LZ0D 1WWSA 3UE0A 1OPXA 3IXGA 2XR0A 3AFAA 1D7EA 3ZVWA 3S7OA 3IHBA 3IWIA 4N92A 4Y0OA 4PM5A 2FJ7B 5TR7A 1J3WA 3AZNA 3MFDA 5B32D 1K0KA 3W99D 5A90A 1KE3A 4YNRA 5EECA 5B33A 4QY6A 3AN2B 2HIOB 2LB9A 4GDNA 2XLNA 2CV5C 4YS3C 4M4XA 5A91A 4E3NA 3MGSA 1EQZA 1LL5A 3P98A 4JJND 3AZLB 2WZXA 1YU4A 3KYQA 4E3IA 3REIA 3F1NA 3UPNA 5DNND 4O8GA 1HZOA 3REKC 4KZAA 1U35A 3Q7VA 2ZQCA 3ZCZA 4HP4A 1C3BA 2EXAA 4C3QA 4IJFA 4GNUA 5AY8D 1IELA 4G3WA 3T4SA 2E8JA 1Z2CB 4JGRA 3O3VA 3N3FA 5J3WA 4YM6C 1F5MA 1AIWA 1I2SA 3BRMA 3UDXA 4NE3A 5GLDA 4HH2A 5JYOA 2P9VB 1OMEA 2KDKA 3Q82A 2KOIA 3A0SA 3MNNB 5GXQC 3IX8A 4XUJC 3F1OA 4XT2B 1ED7A 3BY8A 4Z2KA 3WA9A 3UTBC 1H8ZA 1N9BA 1Z6FA 3WTPA 3VOYA 4QY5A 1E88A 3O62D 2OAQ1 2WK0A 5L8MA 2H5SA 4FH2A 2Y2OA 3TU4B 5AV9D 3R45B 1N1JB 4X23B 3HLGA 3PBRA 2OLUA 1BH9B 5BS7A 4H9SA 3AZGA 3M2KA 5AVBB 4N1HA 2R9XA 2G5IC 4ZRRA 3AYWB 1RCJA 5FSRA 3X1SA 4IBGA 1K54C 1OTEA 3AZEB 1GA9A 5B0YC 3H0LC 3KSYA 3LJAD 1ZLAB 4IHQA 3C8CA 2VGLS 2PD8A 1VM1A 4GN2A 2FJ7C 4UUZA 5E2HA 3EWKA 2YKHA 4CSRA 2M7VA 3VP3A 1E6ZA 1MXOA 2DNSA 1O7EA 4CLCA 1UR9A 4ZTKA 2VV6A 2BYMA 3LY4A 3B0DB 4ZUXB 1P3OA 1P3AB 1YKDA 3REJC 1S32B 4G3KA 3D3OA 1TZYA 1SKOA 5AV6D 3UNWA 1KX3C 3CHWP 1HTAA 4FSFA 3WD0A 1P3FA 3T4JA 1XKZA 3X1TD 4HESA 2PRFA 2JKTM 2F8ND 2GJ3A 1KX5C 1P34A 3DBAA 1GXDA 4DKIA 3C1CD 4J8UC 1PFLA 3HREA 5CERA 2HF6A 5CPIC 4GHLA 4S2LA 3H7WB 4Q0HA 4J8WB 2J9PA 4KG6A 4QJGA 4Z5TA 2W1TB 1ZG4A 1GOIA 1BLCA 2ZY2A 3AZHA 1DRMA 1M19B 4Z2MH 3A3EA 5A92A 3V3RA 4EESA 3AZID 2JBFA 1ZTUA 3MGPA 3AV1B 2CV5D 5GT3A 4KGCB 5HPIA 1FSWA 4EU0A 2Y2KA 4NXFA 4MN7A 3W97B 3LZ1A 3W8KA 3KWQA 3OPHA 3T4LA 3REKD 4WU9B 3TG9A 5B1MA 1T1AA 4LPZA 4RYEA 1F2KA 1N4OA 3EPLA 2JKTI 3MGRB 1KDWA 2BTFP 1K57A 2FZ0A 5AQBA 4OH0A 4BBUA 2VEAA 1PW1A 4Z9QA 3U4LP 2H28A 4MDZA 4YM6D 1BLSA 4HBTA 1JWZA 2A49A 1F9IA 3N8SA 3REHA 2ZY4A 4UA9A 1ZKJA 1ZLAC 5HDSA 4QLCC 3DWZA 1P3LA 3M6BA 5GXQD 5HL6A 4XUJD 4PM7A 3VP1A 2OSUA 1M6KA 5B2JA 3RELA 3X1UC 3UTBD 4E6WA 3B0DC 5GLCA 3KXBB 1IOUA 1P3AC 2GNXA 3HCYA 5KIZA 4PAUA 4DJ3A 3AGFA 2KX6A 3IXDA 2A24A 4R8PB 4CAYA 1P3IA 3BEBA 3VMAA 4H9PA 5F82A 1P3KB 3C1BC 3F1PA 1M1AC 1K56D 5DFYA 3AZFC 3IF6B 2VA0A 1O07A 4OQIA 2VKSA 2OV5A 1IKIA 4FD8A 1FSYA 3BFDA 3OCLA 2WGIA 4OOLA 2FJ7D 4GHAA 4J8WC 3IS2B 3AZKB 1T19A 3LEQA 4I3AA 1PW8A 2J9OA 4H9NA 3HONA 1P3MA 5TBMA 2D02A 2OLVA 1BLPA 3AN2D 3C5AA 2HIOD 3UT9B 4JF4A 3REJD 4IBJA 2B95A 3O5YA 3TJZC 1G5UA 5EVIC 2B02A 3IQAA 3OCNA 4OPRA 5DKLA 5JA4B 1XGIA 5FASA 3V9RB 4HHDA 2Y2PA 1K6SA 1M18B 3VH5W 4KG2A 4EBNA 3OC2A 5HZHA 2QZ6A 3R7WA 4NXGA 5CPID 1NYYA 4E44A 4XZQA 3RTYA 5AV5C 1YSPA 3MGRC 1YU2A 2XFSA 1E25A 1CEFA 2HPBA 2XK1A 5GSUA 4HBUA 2YFVA 4BD0A 3DAVA 2JKRM 5DF9A 3AZJB 4Y0UA 1E6RA 1YLYA 1W5DA 4X56A 2Y2NA 1S6RA 4BBTA 5J4EA 3NQUA 3LO7A 4KUDA 5KDMB 2J3TD 4EQ1A 5CP6B 2DRWA 3UY6A 1E3UD 2AVXA 4DRAA 4QD4A 3MGQC 2ZQ9A 4Z2LA 1E4DA 1PZOA 4K0XA 4WU8A 1JWVA 4OKPA 4U0XA 4U3TA 2RVQC 3SH7A 1KE4A 5CHMA 4J8VA 1TAFB 3LI9A 4GHIA 1B6WA 3PR6A 5BNVB 4GS9A 5GL9A 3VSKA 5IS1A 4S2NC 5M1AA 4FH4A 3CZDA 4X23D 4R3JA 3NDEA 1IYOA 3LR4A 1VEUB 3DW0A 5AVBD 5AVEA 1Q2PA 3E98A 4KHAB 1P3KC 3AYWD 3A1IA 1W1VA 1XJ2A 1KX4B 3AZED 2RCXA 4Q0IA 1PI5A 1ZLAD 2VX8A 3KUYA 4QLCD 1OGBA 5F99B 5FAOA 5GT0B 5B24B
chains in the Genus database with same CATH topology
4CPKA 2ZQ7A 1CI9A 3AFAB 4C75A 1MWSA 1YMXA 3IH8A 3FKVA 4K0WA 1P3AD 3TOIA 1MWRA 5CRFA 3AZNB 1RP5A 1S32D 3BLMA 3IP4C 5BPVA 5B33B 3A3IA 5CHJA 5FQKA 3AGEA 2Y2HA 1M1AD 3AZFD 2J8YA 3BM6A 3G2YA 3VFFA 3W96A 4BQMA 3MGSB 1EQZB 2EXBA 2ZQ8A 3RXXA 3B6GC 5HW3A 3REIB 1IYSA 3GSGA 4J8WD 4X68A 4NZ1A 5JYPA 3L29A 2EX9A 1AOIA 1U35B 3Q7VB 2PYOA 1M19D 2BYKA 1JFIB 1W8YA 1A7WA 5A93A 4KGCD 4JF5A 4XUXA 2WGWA 3BFGA 3G35A 4KZ3A 2HUEB 1GHIA 4P85A 3W97D 1BLHA 4NZ3A 3SS5A 4EO5C 4WU9D 3HUNA 5HFOA 2Y2QA 1HTZA 5DVAA 5E5AB 3ZG7B 1ES4A 4LENA 1LL9A 3MGRD 5G49A 3MZDA 5AV8A 1YMSA 3WTPB 4LV0A 5KZHA 2NZDA 2ZD8A 4BLMA 3AZGB 3TSGA 1QMFA 1P3GA 5B32C 5B24C 3HLFA 2RVQD 3NQJA 3AFAC 2NQBB 4R4SA 2IWCA 3KXBD 3GTCA 4UUZB 4CSRB 1ESUA 3LELA 5B40A 3KS4A 4JJNC 2BYMB 1P3OB 1ZG6A 3PBQA 4E3LA 5B33C 1MBLA 5DNNC 1P3KD 4OOYA 1TZYB 4OONA 1XPBA 1P3FB 3B3XA 5AVCC 1P3BA 4B4ZA 2ZM2A 1P34B 4IBRA 4LD9A 4YINA 4Z5TB 3UT9D 4RX3A 1KVMA 1HQ3A 1IEMA 3AZHB 2WKIA 3DWKA 4YFMA 4N9KA 3MGPB 4H9OA 5GT3B 3PTEA 1M18D 1YLJA 5DNMA 3HUOA 3ZG8B 4U0TA 5B1LC 3GRJA 3O62C 4J8XA 5E5AC 1Y54A 3LZ1B 5EPHA 3KWQB 3MKFA 5B2IA 5CEDA 1K55A 3WKJA 1XGJA 3UTAA 4JBFA 1JTDA 3AZJD 4RX2A 1ESIA 2XQZA 2F8NH 1TEMA 4D2OA 5CP6D 4DQYB 4S2OA 4DE0A 1P3PA 3B6FA 3X1VA 1DJCA 4R4RA 4IBIA 3EPJA 3REHB 2EFXA 2BLSA 4IVKA 5B31A 2NQBC 3SS4A 1BH8A 1P3LB 2Y2GA 2XFTA 4PM6A 5CPKC 4MBFA 4NE5A 4WMCA 5B2JB 3RELB 1XP4A 1WWIA 2ZJ9A 3FWLA 3NBLA 3B0CT 3X1TC 4BENA 2WADA 1KX4D 3C1CC 3C4OA 4CAYB 2GDNA 1P3IB 4WZ4A 5F99D 3FZCA 1F1EA 5B24D 5JRGB 3EPHA 1SCWA 3WS2A 2Z2MB 3W4QA 3AFAD 3AZIC 4OQHA 4G91C 2I72A 2ZM0A 3HLDA 3AZND 3O86A 1WYCA 5CPJA 4LV3A 5G18A 4H9RA 4H9NB 1P3MB 4R3BA 3UDIA 5B33D 4ZJ3A 4PM9A 5DTSA 1KGEA 3MGSD 3A6NB 4KZ6A 3IH9A 3VP2A 2AROB 5AVCD 1PZPA 2RIQA 3REID 5C3IC 4KQRA 5BO0A 3WTPE 2HDQA 3LY3A 4NFTA 1U35D 5AY8A 1G6AA 4PM8A 5GSUB 4DDYA 2YFVB 2FFYA 1XA7A 3A3DA 2RL3A 1G68A 4OUIA 3O88A 2ZC7A 2ZY5A 3NQUB 4KUDB 3VP4A 2Q9MA 5DF7A 2HP5A 5B1LD 5E5AD 4KZ8A 5AQ9A 1H3OA 4WU8B 4WZSB 4OQ0A 4WM9A 4J8VB 5AV9A 3WTPD 1LI0A 1ES3A 4OPZA 3QHYA 3AZMA 3AZGD 2J7VA 1LHYA 4B88A 3L28A 5F1FA 3LJAA 1VQQA 5JRGC 3MXSA 2NQBD 3KUYB 3AV2A 1YM1A 3AN2C 5DF8A 1M40A 2HIOC 3VH6W 4RVAA 4KZBA 3GVBA 2JE5A 5FAPA 1L0DA 5CPKD 2XEPA 3OPPA 3AZLC 5M19A 3HUMA 1P3OD 4P6BA 2XD5A 5EVLA 2PU2A 1TZYD 3ZFZA 3A6NC 4R1GA 1WE4A 2Y55A 5FATA 5HAPA 2BG1A 1P3FD 2B5RA 5CHUA 3VP0A 4EBPA 2AROC 3W96B 4DXBA 4XXRA 2IO5B 1P34D 5CTMA 3VH5T 4OP5A 4BJPA 4S2JA 4Z5TD 4E3JA 1EWZA 4L0LA 4Y0TA 2C6WB 4GD6A 3Q81A 1AOIB 3AZHD 4MEZA 2BYKB 4YS3A 2Y2JA 5D3OA 3MNNC 2G2WA 3WRTA 5GT3D 3FYZA 2WGWB 3WWXA 4Z66B 4Q8IA 5BT1D 4NYUA 3RJUA 1NYMA 1MWUA 3LZ1D 3TU4C 3KWQD 4X23C 5AVBC 1NZOA 3VH5A 1ID3A 4E6XA 3AYWC 1DJBA 5G49B 3BFFA 3AZEC 5AV8B 4YM6A 2QMIA 5FQ9A 3ZGAB 3C4PA 2Y2IA 2NZDB 4ZJ2A 1F66A 3REHD 4BL2A 4XUJA 4ZUXC 3CMZA 1P3GB 3MXRA 1S32C 3UTBA 1EROA 5FI2A 4HEFA 5BNXA 5B2JD 3NQJB 3RELD 1Q9CA 4NYYA 5FQMA 5EE8A 4A5RA 5B40B 4UA7A 1K54A 5B0YA 3FKEA 2WUQA 5JRGD 3W98A 4QNLA 1YLZA 1KDSA 3ZNYA 3E2KA 1M19C 2IO5C 4JKTA 1P3BB 3AV1C 4KGCC 3IF5A 3M2JA 3CJMA 1P3MD 3REJA 3AZLD 4LD9B 4MLLA 3W97C 3MVDB 1KX3A 4OLDA 1RGYA 4WU9C 5FDHA 3EQVA 1HQ3B 3VSLA 2PU4A 3A6ND 2IWBA 3WS1A 1HD8A 4Z66C 1KX5A 2AROD 2DQNC 4H9OB 4J8UA 3C7VA 5CPIA 5DNMB 4ZDXA 4LCLA 4J8XB 1GHPA 5B2IB 4R23A 5GSUD 3P09A 1ONHA 3WKJB 4OOMA 5AV8C 1L0EA 3MNND 1W79A 4RA7A 3EQUA 1KU5A 1NXYA 1P3PB 3B6FB 2X71A 3BECA 3L27A 3KXBC 3X1VB 4X53A 1L0FA 3TU4D 3GR2A 4UAAA 4NE6A 3BFEA 5B31B 5CGSA 4R8PC 5CHLB 4LV2A 4E3MA 1BH8B 4ZBJB 4JLFA 4J8VD 3AGDA 5B0ZB 4JF6A 3IF6C 5KSCA 1KE0A 1ES2A 3M6HA 3HL9A 4IBEA 4XUZA 3AZKC 4QLCA 5CEBA 4ZUXD 2E8IA 4GDBA 4ZAMA 1YU3A 2ZMAA 3UT9C 3X1UA 4S2IA 2Y2MA 5HX9A 3O87A 3UO9A 3OZHA 1CI8A 1NZUA 3MVDC 2XGNA 3LCEA 1M18C 3WAAA 5CPJB 4H9RB 4N9LA 3C1BA 1M1AA 3SH8A 3AZFA 2G2UA 5GHZA 3UDFA 5EOEA 5AQ7A 3H0MC 3W96D 4S2PA 3AZJC 3GMWA 3QNBA 3S1YA 4WNNA 3UPPA 1PZRA 5E43A 2F8NK 4QU3A 2HDSA 4IBCA 3AV1D 3BFCA 5CP6C 5BO0B 4GH9A 3D4FA 5AY8B 5EVIA 3NIAA 1I2WA 5FI7A 3W4OA 1SDNA 4Z66D 3UPOA 3WA9B 2DF4C 5AV5A 1IKGA 5B0ZC 1K6RA 1H3OB 1KX4C 2VGKA 5CGXA 5AV8D 4MBKA 2DCFA 4N1XA 5F99C 5AV9B 1XA1A 5GHXA 3HLEA 3FDDA 4WZ5C 5GT0C 3ZDJA 3X1SB 2ZM5A 3SH9A 2NZDD 4C6YA 3MGQA 1ALQA 5FQQA 3N8LA 4ID4A 5KSHA 3AZMB 5M18A 5HAIA 3GV9A 3G30A 4NZ5A 3AZNC 1P3GD 3LJAB 1TDGA 4JXWA 1W7FA 4R8PD 4H9QA 3AV2B 2ZC4B 4PMAA 3N4IA 3HLWA 3MGSC 1EQZC 3V5MA 5B40D 1P3KA 3PBOA 3REIC 3NY4A 4ZJ1A 3ITAA 3AZKD 1FCNA 1JVJA 4NY2A 1U35C 1SDEA 4OQGA 2IOUA 3OPLA 1P3BD 3ISGA 1H5XA 3AL0C 2HUEC 5CECA 4ZBEA 2XDMA 3F6TA 3MVDD 1NJ4A 2F2AC 3B0BA 4KG5A 3G2ZA 3MBZA 1FCMA 4JXSA 1HQ3D 4YS3B 3Q1FA 5B1MB 5CTNA 3B6GA 4R0QA 4Z2MG 3WA9C 1T3UA 2ZC5B 5DNMD 1PWGA 3WTPC 1KGFA 2EX6A 5B2ID 3NC8A 3WRZA 1S0WA 5BS7C 4H9SC 3AZGC 3WKJD 4FCFA 1ID3B 3HSHA 1KGGA 3X1SC 1ES5A 4G92B 1CK3A 4YM6B 1BSGA 3B6FD 3VFHA 4DRTA 4F94A 4OJOA 1F66B 1YQSA 2V2FF 4XUJB 1P3OC 3AV2C 1ULYA 1EI5A 3UTBB 2X02A 1TDLA 5B0ZD 5EUAA 4DE1A 1TZYC 2XF3A 5BNXB 3VH6T 4S2MA 3P5JB 3LZ0A 1P3FC 4H9PB 1NY0A 5GT0D 5DTTA 1K38A 1RGZA 3ZG9B 4AWLB 1P34C 5B32A 3MZFA 3NDGA 3W99A 5B0YB 4GKUA 4IEDA 5F83A 5HARA 4Z5TC 3PAGA 5DTKA 3W98B 3AZHC 5FQJA 1J9MA 1GCEA 4JJNA 3MGPC 4IBXA 5GT3C 5CPJD 5DNNA 1EQZD 1FR6A 3REJB 3VH6A 5BT1C 3CG5A 4WEJA 3LZ1C 1KX3B 3KWQC 5B1MC 1YLWA 5AVCA 4KENB 2JC7A 2ZC3B 4XZQB 3IWQA 2H0YA 2XH9A 1KX5B 2Y4AA 3DTMA 4J8UB 1K57C 4JXGA 5CPIB 4OJ6A 3ITBA 1JFIA 2G5HC 4E3OA 1KVLA 5J8XA 1ID3C 1K25A 3REHC 2JCHA 5FI6A 4E3KA 4GOGA 4G92C 1P3LC 1PI4A 1YUEA 1FR1A 3A1KA 1F66C 5TFQA 5B1LA 3O62A 4E45A 5B2JC 3RELC 5E5AA 3WA9D 5TGFA 4X69A 3L26A 4BD1A 1PWDA 2ZQAA 1K4EA 4UA6A 3V50A 4M3KA 1PYYA 1P3IC 5AQAA 3X1SD 2X01A 3RXWA 3AZMD 4AWLC 2ZC6B 5FUGA 5KMWA 2NQBA 4P87A 2YFWA 4QLCB 4KZ4A 5BOHA 3W98C 1P3MC 3E2LA 2W8SA 3UE1A 3BYDA 4IJEA 1DY6A 4QHCA 2EX2A 5AV6A 3AV2D 5CPKA 3VOZA 3X1UB 3B0CW 2WKEA 2Y2LA 3X1TA 4EV4A 4EBLA 3IWOA 2Y91A 2F8NA 5I94A 1AXBA 3C1CA 2XD1A 2JSSA 3WAAB 3C1BB 1M1AB 3BLSA 3PBNA 3AZFB 1BUEA 3MKEA 4XZQC 5GSUC 5B31G 3ZVTA 3FKWA 3AZIA 4WEKA 2CV5A 2PYOB 3WS4A 1ZC2A 4WNNB 3QNCA 2WKHA 5E2GA 3MGPD 2A3UA 4KUDC 2R9WA 2HDRA 2CWEA 3REKA 4YS3D 5EVIB 4EQIA 3L25A 5B1MD 3MZEA 4WU8C 3N6IA 1MKIA 1IYQA 2ZM8A 1FOFA 4BL3A 4J8VC 4OJLA 3HLBA 5HL1A 2WGVA 3N7WA 1BULA 5B32G 5AV5B 3NI9A 3JYIA 4GB7A 2V1ZA 1ID3D 3UN7A 3KFUG 1YT4A 5GXQA 3ZG0A 3N8RA 4MNRA 1U60A 1HVBA 4Y7PA 3HVFA 3KUYC 1IYPA 5F1GA 1P3LD 1BTLA 4EUZA 4HGAB 2Y59A 1F66D 3MGQB 3KS8A 1TVFA 3GQZA 2Z2LB 1LI9A 1WYBA 3LELB 3G34A 5FQIA 1K56A 4H9QB 1P3ID 1W8QA 4EWFA 3W96C 3WAAC 2FJ7A 4B4XA 1Q2QA 1MPLA 5JRGA 4WYYA 5B0YD 3PBTA 2CC1A 3AN2A 5HAQA 3W98D 2HIOA 1AOIC 2PYOC 4QB8A 2J8PA 3AZLA 2QPNA 3H0RC 1KX3D 3A6NA 2ZY3A 3EPKA 5EOOA 4WELA 2AROA 4DE2A 5CXWA 4UHUA 4XZQD 4IVIA 1KX5D 3B6GB 4J8UD 3UTAB 4NZ4A 2EX8A 3ZNTA 3A3JA 1I5QA 3WX7A 1E3UA 2P9VA 2NZDC 3NCKA 1JWPA 4KUDD 1YLPA 3C7UA 5CGWA 3MNNA 1YU0A 1FQGA 5FAQA 1BFMA 1P3GC 4HGAC 4WU8D 3I7JA 4KZ5A 4WJ3C 2FFFB 1JTGA 3TU4A 4EO5B 2F8NG 1R4VA 3R45A 1N1JA 4X23A 1DJAA 1BH9A 5AVBA 4O7DA 1MWTA 3LELC 5B40C 3AYWA 2P74A 3AZEA 2H10A 1BT5A 1ZLAA 1XX2A 3IHAA 2EFUA 3LZ0B 3SOIA 3KUYD 3HLCA 2C5WB 1P3BC 4ZUXA 2ZQDA 4WBGA 5GLAA 3A3FA 1P3AA 5B32B 1S32A 4LD9C 3ZHHA 4H8RA 1PIOA 3W99B 4MBHA 4KQOA 2Q9NA 3X1UD 2VGJA 1HQ3C 1B67A 4OPYA 1FCOA 4JJNB 2L5AA 4IBBA 1SKFA 3WAAD 4WV4B 5DNMC 5DNNB 4J8WA 1YU1A 3C1BD 4CJNA 4J8XC 3L2AA 1H8YA 3G32A 5B2IC 1M19A 4OVDA 1K55C 3WKJC 3UTAC 5AVCB 1AOID 3AV1A 2PYOD 4KGCA 4X6TA 4LCMA 4OJPA 4NK3A 4IBDA 1GA0A 3W97A 3Q07A 4DRBA 1P3PC 3B6FC 4WU9A 4LV1A 3X1VC 5EVID 2H0TA 2HP6A 3WS0A 4Z66A 5B31C 3FV7A 2PBYA 3MGRA 4ZBJC 3ZG5A 5B1LB 3O62B 2IWDA 3OPRA 1L0GA 4M6BA 4GZBA 5AV5D 4NETA 4JPMA 2HDUA 3EG5B 3IXBA 1GHMA 3G31A 5FA7A 3IXHA 4IBKA 3V39A 3LZ0C 2WAFA 1MY8A 2ZLYA 5E2EA 1ERQA 2HP9A 5GHYA 3PBSA 3MGQD 3KXBA 4IBFA 4S2NA 3V3SA 3W99C 3W4PA 5FUGB 5L2FA 5GLBA 4R8PA 2VQRA 4GD8A 4OJ5A 4X55A 2YFWB 5CPJC 3LELD 1K4FA 3PAEA 4DF6A 3IF6A 5AV6B 1L2SA 5CPKB 1XXMA 1ONGA 3UE3A 1ERMA 3X1TB 3AZKA 2F8NB 4K91A 2UWXA 4DE3A 3C1CB 4DDSA 3Q7ZA 4OPQA 5U47A 4DXCA 3UT9A 4LD9D 5AY8C 5IHVA 4P0MA 5JA4A 3AZIB 2WZZA 1PWCA 4G91B 3MVDA 3V9RA 2CV5B 4S2KA 1M18A 3S4XA 4OLGA 4KQQA 3S22A 1CEGA 3REKB 4KZ7A 4J8XD 3AZJA 3SS3A 3B6GD 3UTAD 1QMEA 4OP8A 5C3IB 5KDMA 5AV9C 5CP6A 1NRFA 3IT9A 1LLBA 1BZAA 3WS5A 1YLTA 2WAEA 3AZMC 5E2FA 4LG2A 1P3PD 3X1VD 3LJAC 2LY8A 1TAFA 5B31D 5GXQB 5BNVA 2WYXA 1SHVA 4UPKA 4KZ9A 2V20A 1W2EA 4WMCD 4KHAA 4PPRA 5B0ZA 1KX4A 5AV6C 4JXVA 3LEZA 3G4PA 3HBRA 5F99A 4WZ5A 5GT0A 5B24A 3LZ0D 1WWSA 3UE0A 3IXGA 2XR0A 3AFAA 3ZVWA 3IHBA 3IWIA 4N92A 4Y0OA 4PM5A 2FJ7B 5TR7A 3AZNA 3MFDA 5B32D 3W99D 5A90A 1KE3A 5EECA 5B33A 4QY6A 3AN2B 2HIOB 4GDNA 2XLNA 2CV5C 4YS3C 5A91A 4E3NA 3MGSA 1EQZA 1LL5A 3P98A 4JJND 3AZLB 2WZXA 1YU4A 4E3IA 3REIA 3UPNA 5DNND 1HZOA 3REKC 4KZAA 1U35A 3Q7VA 2ZQCA 3ZCZA 1C3BA 2EXAA 4C3QA 4IJFA 4GNUA 5AY8D 1IELA 1Z2CB 3O3VA 3N3FA 4YM6C 3BRMA 1I2SA 3UDXA 4NE3A 5GLDA 5JYOA 2P9VB 1OMEA 3Q82A 3MNNB 5GXQC 4XUJC 3WA9A 3UTBC 1H8ZA 1N9BA 1Z6FA 3WTPA 3VOYA 4QY5A 3O62D 2WK0A 2H5SA 4FH2A 2Y2OA 3TU4B 5AV9D 3R45B 1N1JB 4X23B 3HLGA 3PBRA 2OLUA 1BH9B 5BS7A 4H9SA 3AZGA 3M2KA 5AVBB 4N1HA 2R9XA 2G5IC 3AYWB 1RCJA 5FSRA 3X1SA 4IBGA 1K54C 3AZEB 1GA9A 5B0YC 3H0LC 3KSYA 3LJAD 1ZLAB 1VM1A 4GN2A 2FJ7C 4UUZA 5E2HA 4CSRA 3VP3A 1MXOA 2DNSA 1O7EA 4ZTKA 2BYMA 3LY4A 3B0DB 4ZUXB 1P3OA 1P3AB 3REJC 1S32B 1TZYA 5AV6D 3UNWA 1KX3C 1HTAA 4FSFA 1P3FA 1XKZA 3X1TD 4HESA 2F8ND 1KX5C 1P34A 4DKIA 3C1CD 4J8UC 3HREA 5CERA 5CPIC 4GHLA 4S2LA 4J8WB 2J9PA 4KG6A 4QJGA 4Z5TA 1ZG4A 1BLCA 2ZY2A 3AZHA 1M19B 4Z2MH 3A3EA 5A92A 3V3RA 3AZID 2JBFA 3MGPA 3AV1B 2CV5D 5GT3A 4KGCB 1FSWA 2Y2KA 3W97B 3LZ1A 3W8KA 3KWQA 3OPHA 3REKD 4WU9B 3TG9A 5B1MA 4RYEA 1N4OA 3EPLA 3MGRB 1KDWA 1K57A 5AQBA 4OH0A 1PW1A 4Z9QA 4YM6D 1BLSA 4HBTA 1JWZA 2A49A 3N8SA 3REHA 2ZY4A 4UA9A 1ZKJA 1ZLAC 4QLCC 3DWZA 1P3LA 3M6BA 5GXQD 4XUJD 4PM7A 3VP1A 2OSUA 1M6KA 5B2JA 3RELA 3X1UC 3UTBD 4E6WA 3B0DC 5GLCA 3KXBB 1P3AC 3AGFA 3IXDA 4R8PB 4CAYA 1P3IA 3BEBA 3VMAA 4H9PA 5F82A 1P3KB 3C1BC 1M1AC 1K56D 3AZFC 3IF6B 1O07A 4OQIA 2OV5A 1IKIA 4FD8A 1FSYA 3BFDA 3OCLA 2WGIA 4OOLA 2FJ7D 4GHAA 4J8WC 3AZKB 1PW8A 2J9OA 4H9NA 3HONA 1P3MA 2OLVA 1BLPA 3AN2D 3C5AA 2HIOD 3UT9B 4JF4A 3REJD 4IBJA 5EVIC 3IQAA 3OCNA 4OPRA 5JA4B 1XGIA 5FASA 3V9RB 2Y2PA 1K6SA 1M18B 3VH5W 4KG2A 4EBNA 3OC2A 2QZ6A 5CPID 1NYYA 4E44A 4XZQA 5AV5C 2XK1A 3MGRC 2XFSA 1YU2A 1E25A 1CEFA 2HPBA 4HBUA 5GSUA 4BD0A 2YFVA 5DF9A 3AZJB 4Y0UA 1YLYA 1W5DA 4X56A 2Y2NA 1S6RA 3NQUA 3LO7A 4KUDA 5KDMB 5CP6B 2DRWA 3UY6A 1E3UD 4DRAA 4QD4A 3MGQC 2ZQ9A 1E4DA 1PZOA 4K0XA 4WU8A 1JWVA 4OKPA 4U0XA 4U3TA 2RVQC 3SH7A 1KE4A 5CHMA 4J8VA 1TAFB 1B6WA 5BNVB 5GL9A 3VSKA 4S2NC 5M1AA 4FH4A 3CZDA 4X23D 4R3JA 3NDEA 1IYOA 3DW0A 5AVBD 1Q2PA 4KHAB 1P3KC 3AYWD 3A1IA 1KX4B 3AZED 2RCXA 1PI5A 1ZLAD 3KUYA 4QLCD 5F99B 5FAOA 5GT0B 5B24B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KVL A;  3C4P A;  5J8X A;  2Y2I A;  4ZJ2 A;  4CPK A;  2ZQ7 A;  1CI9 A;  1K25 A;  4C75 A;  5IHV A;  2JCH A;  5FI6 A;  4E3K A;  4GOG A;  1MWS A;  4P0M A;  4BL2 A;  1YMX A;  2WZZ A;  3FKV A;  3IH8 A;  1PWC A;  3CMZ A;  4K0W A;  3TOI A;  1MWR A;  4S2K A;  5CRF A;  1PI4 A;  3MXR A;  1RP5 A;  1FR1 A;  3S4X A;  1ERO A;  5FI2 A;  3BLM A;  4HEF A;  4OLG A;  5TFQ A;  4KQQ A;  3A3I A;  5CHJ A;  5TGF A;  3S22 A;  4X69 A;  5FQK A;  1CEG A;  3AGE A;  4KZ7 A;  2Y2H A;  2J8Y A;  3BM6 A;  3G2Y A;  5FQM A;  3VFF A;  4BD1 A;  4BQM A;  5EE8 A;  1PWD A;  2EXB A;  2ZQ8 A;  1K4E A;  2ZQA A;  3RXX A;  4A5R A;  4UA6 A;  3SS3 A;  3V50 A;  4M3K A;  5HW3 A;  1PYY A;  4UA7 A;  1QME A;  1K54 A;  1IYS A;  3GSG A;  4OP8 A;  5AQA A;  4X68 A;  5JYP A;  1NRF A;  3IT9 A;  2EX9 A;  2WUQ A;  1LLB A;  1BZA A;  2X01 A;  3WS5 A;  3Q7V B;  1YLZ A;  1KDS A;  3ZNY A;  3E2K A;  3RXW A;  1YLT A;  2WAE A;  5E2F A;  1W8Y A;  4JKT A;  2ZC6 B;  5A93 A;  5KMW A;  3IF5 A;  4JF5 A;  4XUX A;  4P87 A;  2WGW A;  3M2J A;  4KZ4 A;  3BFG A;  5BOH A;  3G35 A;  4KZ3 A;  3CJM A;  3E2L A;  3UE1 A;  1GHI A;  3BYD A;  4P85 A;  1DY6 A;  4QHC A;  2WYX A;  2EX2 A;  4MLL A;  1BLH A;  1SHV A;  4OLD A;  3SS5 A;  3VOZ A;  1RGY A;  3HUN A;  5FDH A;  3EQV A;  5HFO A;  4KZ9 A;  2WKE A;  2Y2Q A;  2Y2L A;  1HTZ A;  2V20 A;  5DVA A;  2PU4 A;  3VSL A;  4WMC D;  2IWB A;  3WS1 A;  4EV4 A;  3ZG7 B;  1ES4 A;  1HD8 A;  3IWO A;  4EBL A;  4PPR A;  2Y91 A;  4LEN A;  1LL9 A;  5I94 A;  1AXB A;  3MZD A;  3C7V A;  4JXV A;  3LEZ A;  2XD1 A;  3G4P A;  4EBP A;  3HBR A;  1YMS A;  4ZDX A;  4LV0 A;  5KZH A;  4WZ5 A;  4LCL A;  3BLS A;  3PBN A;  1GHP A;  3UE0 A;  1BUE A;  3IXG A;  3MKE A;  2XR0 A;  2ZD8 A;  4BLM A;  4R23 A;  3ZVW A;  3ZVT A;  3P09 A;  1ONH A;  4OOM A;  3TSG A;  3FKW A;  3IHB A;  3IWI A;  4N92 A;  4WEK A;  4Y0O A;  4PM5 A;  5TR7 A;  3WS4 A;  1QMF A;  1L0E A;  1ZC2 A;  3MFD A;  3QNC A;  2WKH A;  1W79 A;  3HLF A;  5E2G A;  2A3U A;  5A90 A;  1KE3 A;  4RA7 A;  3EQU A;  2R9W A;  5EEC A;  4QY6 A;  2HDR A;  1NXY A;  4R4S A;  2X71 A;  3BEC A;  2IWC A;  3GTC A;  4GDN A;  2XLN A;  4X53 A;  1ESU A;  1L0F A;  5EVI B;  4EQI A;  5A91 A;  4E3N A;  1LL5 A;  3GR2 A;  3P98 A;  4UAA A;  3MZE A;  2WZX A;  3BFE A;  5CGS A;  3N6I A;  1ZG6 A;  1MKI A;  3PBQ A;  4LV2 A;  4E3I A;  4E3M A;  1IYQ A;  1MBL A;  2ZM8 A;  3UPN A;  4JLF A;  1FOF A;  1HZO A;  4BL3 A;  3AGD A;  4OOY A;  4JF6 A;  3IF6 C;  4KZA A;  3HLB A;  5HL1 A;  2WGV A;  3Q7V A;  5KSC A;  3N7W A;  2ZQC A;  3ZCZ A;  1BUL A;  4OON A;  1XPB A;  1C3B A;  3B3X A;  3NI9 A;  1KE0 A;  2EXA A;  3JYI A;  4GB7 A;  1ES2 A;  4C3Q A;  3M6H A;  3HL9 A;  4B4Z A;  2V1Z A;  4GNU A;  2ZM2 A;  4XUZ A;  1IEL A;  3UN7 A;  5CEB A;  1YT4 A;  4IBR A;  3O3V A;  3ZG0 A;  2E8I A;  4YIN A;  3N8R A;  4GDB A;  4MNR A;  1U60 A;  1HVB A;  4ZAM A;  4Y7P A;  3HVF A;  3BRM A;  1I2S A;  1IYP A;  2ZMA A;  5F1G A;  1BTL A;  3UDX A;  4RX3 A;  5GLD A;  4EUZ A;  2Y59 A;  4S2I A;  1KVM A;  5JYO A;  2P9V B;  1OME A;  2Y2M A;  3Q82 A;  1IEM A;  5HX9 A;  2WKI A;  3O87 A;  3DWK A;  3OZH A;  3UO9 A;  4YFM A;  1CI8 A;  1NZU A;  1TVF A;  4N9K A;  3GQZ A;  2Z2L B;  2XGN A;  3LCE A;  3PTE A;  1YLJ A;  1H8Z A;  1LI9 A;  1WYB A;  1N9B A;  3G34 A;  3HUO A;  1Z6F A;  3ZG8 B;  4N9L A;  4U0T A;  4QY5 A;  3VOY A;  3GRJ A;  5FQI A;  1K56 A;  2WK0 A;  3SH8 A;  2G2U A;  2H5S A;  1Y54 A;  5GHZ A;  5EPH A;  4FH2 A;  2Y2O A;  3UDF A;  5EOE A;  3MKF A;  5AQ7 A;  5CED A;  3HLG A;  3PBR A;  1W8Q A;  1K55 A;  2OLU A;  1XGJ A;  3M2K A;  4JBF A;  4EWF A;  1JTD A;  4S2P A;  4RX2 A;  1ESI A;  3GMW A;  4N1H A;  4B4X A;  2R9X A;  3QNB A;  3S1Y A;  1Q2Q A;  3UPP A;  2XQZ A;  1MPL A;  5E43 A;  1RCJ A;  4QU3 A;  5FSR A;  2HDS A;  1K54 C;  4WYY A;  1GA9 A;  1TEM A;  4D2O A;  3BFC A;  4S2O A;  4DE0 A;  3PBT A;  2CC1 A;  5HAQ A;  1VM1 A;  4GN2 A;  5E2H A;  3D4F A;  4QB8 A;  5EVI A;  1DJC A;  3VP3 A;  4R4R A;  3NIA A;  1MXO A;  2DNS A;  1O7E A;  4ZTK A;  2EFX A;  2BLS A;  4IVK A;  3LY4 A;  1I2W A;  5FI7 A;  3SS4 A;  3W4O A;  2QPN A;  1SDN A;  2Y2G A;  3UPO A;  2XFT A;  4PM6 A;  3UNW A;  4MBF A;  4WMC A;  5EOO A;  4FSF A;  1XP4 A;  2ZJ9 A;  4WEL A;  4DE2 A;  1XKZ A;  3FWL A;  3NBL A;  5CXW A;  4HES A;  4UHU A;  1IKG A;  4IVI A;  4BEN A;  2WAD A;  1K6R A;  2VGK A;  5CGX A;  4DKI A;  3C4O A;  3HRE A;  2GDN A;  5CER A;  4MBK A;  2DCF A;  2EX8 A;  4N1X A;  4S2L A;  4WZ4 A;  3ZNT A;  2J9P A;  3A3J A;  4KG6 A;  1XA1 A;  5GHX A;  3FZC A;  3HLE A;  4QJG A;  1I5Q A;  4WZ5 C;  3ZDJ A;  1E3U A;  1ZG4 A;  3SH9 A;  2P9V A;  3NCK A;  4C6Y A;  1BLC A;  1JWP A;  1SCW A;  3WS2 A;  1YLP A;  2Z2M B;  1ALQ A;  3C7U A;  3N8L A;  4ID4 A;  5CGW A;  5FQQ A;  3W4Q A;  5KSH A;  5M18 A;  3A3E A;  5A92 A;  5HAI A;  3GV9 A;  3V3R A;  1FQG A;  4OQH A;  5FAQ A;  2JBF A;  3G30 A;  2I72 A;  2ZM0 A;  3HLD A;  3O86 A;  1WYC A;  1TDG A;  5G18 A;  1FSW A;  4LV3 A;  4JXW A;  2Y2K A;  4R3B A;  3I7J A;  1W7F A;  4KZ5 A;  2FFF B;  3UDI A;  2ZC4 B;  1JTG A;  4PMA A;  3W8K A;  3OPH A;  4ZJ3 A;  4PM9 A;  1DJA A;  3N4I A;  3TG9 A;  5DTS A;  3HLW A;  1KGE A;  1MWT A;  4O7D A;  3V5M A;  4RYE A;  4KZ6 A;  1N4O A;  3IH9 A;  3VP2 A;  3PBO A;  1PZP A;  3NY4 A;  1KDW A;  2P74 A;  2H10 A;  1BT5 A;  1K57 A;  4KQR A;  4ZJ1 A;  5AQB A;  3ITA A;  4OH0 A;  1PW1 A;  1FCN A;  4Z9Q A;  1XX2 A;  3IHA A;  2EFU A;  1JVJ A;  2HDQ A;  3LY3 A;  1SDE A;  4OQG A;  3SOI A;  1BLS A;  1G6A A;  4HBT A;  3HLC A;  1JWZ A;  2A49 A;  2C5W B;  3N8S A;  3OPL A;  4PM8 A;  4DDY A;  4UA9 A;  2FFY A;  1XA7 A;  1ZKJ A;  3ISG A;  2ZQD A;  4WBG A;  5GLA A;  3A3F A;  3A3D A;  1H5X A;  2RL3 A;  1G68 A;  3DWZ A;  3O88 A;  3M6B A;  3ZHH A;  2ZC7 A;  4H8R A;  5CEC A;  1PIO A;  4ZBE A;  4PM7 A;  3VP1 A;  2OSU A;  2XDM A;  4MBH A;  3VP4 A;  1M6K A;  1NJ4 A;  2Q9M A;  4KQO A;  2Q9N A;  5DF7 A;  4KG5 A;  2HP5 A;  3G2Z A;  3MBZ A;  2VGJ A;  4E6W A;  1FCM A;  5GLC A;  4JXS A;  4OPY A;  3Q1F A;  1FCO A;  3AGF A;  4KZ8 A;  3IXD A;  5CTN A;  5AQ9 A;  4R0Q A;  1SKF A;  2ZC5 B;  4OQ0 A;  3BEB A;  4WM9 A;  1PWG A;  3VMA A;  5F82 A;  1KGF A;  1K56 D;  4CJN A;  1LI0 A;  2EX6 A;  3IF6 B;  1ES3 A;  1O07 A;  1H8Y A;  4OPZ A;  4OQI A;  3QHY A;  2OV5 A;  3G32 A;  1IKI A;  3NC8 A;  3WRZ A;  1S0W A;  4OVD A;  1K55 C;  4FD8 A;  1FSY A;  3BFD A;  2J7V A;  2WGI A;  3OCL A;  4FCF A;  4E3L A;  1LHY A;  4OOL A;  4B88 A;  5F1F A;  4X6T A;  1PW8 A;  1VQQ A;  2J9O A;  4LCM A;  3MXS A;  1KGG A;  4NK3 A;  1ES5 A;  2OLV A;  1CK3 A;  1GA0 A;  1BLP A;  1YM1 A;  3Q07 A;  1BSG A;  3C5A A;  1M40 A;  5DF8 A;  3VFH A;  4JF4 A;  4RVA A;  4KZB A;  4LV1 A;  4DRT A;  3GVB A;  2JE5 A;  4F94 A;  5FAP A;  1L0D A;  1YQS A;  5EVI C;  5EVI D;  3IQA A;  2H0T A;  2XEP A;  3OCN A;  2HP6 A;  3OPP A;  3WS0 A;  5M19 A;  2V2F F;  3FV7 A;  4OPR A;  2PBY A;  3HUM A;  1XGI A;  4P6B A;  5FAS A;  2XD5 A;  2Y2P A;  1K6S A;  1EI5 A;  3ZG5 A;  5EVL A;  2PU2 A;  4KG2 A;  2X02 A;  1TDL A;  4EBN A;  5EUA A;  3OC2 A;  4DE1 A;  2XF3 A;  2QZ6 A;  4S2M A;  3ZFZ A;  2IWD A;  3OPR A;  1L0G A;  4R1G A;  1NYY A;  4GZB A;  1WE4 A;  2Y55 A;  5FAT A;  5HAP A;  2BG1 A;  3VP0 A;  2B5R A;  5CHU A;  4NET A;  2XK1 A;  1NY0 A;  2XFS A;  4HBU A;  1E25 A;  1CEF A;  2HDU A;  2HPB A;  4JPM A;  4BD0 A;  5DTT A;  1K38 A;  4DXB A;  5DF9 A;  3IXB A;  1YLY A;  4Y0U A;  1GHM A;  1RGZ A;  3ZG9 B;  3G31 A;  1W5D A;  4XXR A;  5CTM A;  4X56 A;  2Y2N A;  1S6R A;  3IXH A;  3MZF A;  5FA7 A;  3V39 A;  3NDG A;  4OP5 A;  2WAF A;  1MY8 A;  2ZLY A;  3LO7 A;  5E2E A;  4BJP A;  4GKU A;  4IED A;  2DRW A;  4S2J A;  5F83 A;  5HAR A;  1EWZ A;  4E3J A;  1ERQ A;  4L0L A;  3UY6 A;  3PAG A;  5DTK A;  4Y0T A;  1E3U D;  2C6W B;  2HP9 A;  5GHY A;  3PBS A;  4GD6 A;  3Q81 A;  2ZQ9 A;  4QD4 A;  4MEZ A;  1E4D A;  5FQJ A;  1PZO A;  2Y2J A;  1J9M A;  5D3O A;  4S2N A;  4K0X A;  1GCE A;  3V3S A;  2G2W A;  3W4P A;  3WRT A;  1JWV A;  4OKP A;  4IBX A;  5GLB A;  5L2F A;  3FYZ A;  4GD8 A;  4U0X A;  4U3T A;  3SH7 A;  2WGW B;  4X55 A;  1FR6 A;  1KE4 A;  5CHM A;  1K4F A;  3WWX A;  4Q8I A;  3RJU A;  3CG5 A;  1NYM A;  3PAE A;  4DF6 A;  3IF6 A;  1L2S A;  1MWU A;  4WEJ A;  5GL9 A;  3VSK A;  4S2N C;  5M1A A;  4FH4 A;  3CZD A;  1XXM A;  4R3J A;  3NDE A;  1IYO A;  1ONG A;  1YLW A;  3DW0 A;  3UE3 A;  1ERM A;  1NZO A;  1Q2P A;  4KEN B;  2JC7 A;  2ZC3 B;  4E6X A;  2H0Y A;  2XH9 A;  3IWQ A;  4K91 A;  2UWX A;  4DE3 A;  2Y4A A;  1DJB A;  3DTM A;  3BFF A;  1K57 C;  2RCX A;  4JXG A;  1PI5 A;  3ITB A;  2QMI A;  4DDS A;  5FAO A;  3Q7Z A;  4OPQ A;  5U47 A;  4DXC A;  5FQ9 A;  4E3O A;  3ZGA B; 
#chains in the Genus database with same CATH topology
 1OGG A;  3KSF A;  4CPK A;  2ZQ7 A;  1CI9 A;  1OJ5 A;  3AFA B;  4C75 A;  1MWS A;  1XJ6 A;  1YMX A;  3IH8 A;  3FKV A;  4K0W A;  1P3A D;  3TOI A;  5HWW A;  1MWR A;  2IA2 A;  5CRF A;  3AZN B;  3WD1 A;  1RP5 A;  1S32 D;  3BLM A;  2QKP A;  2P7J A;  3IP4 C;  5BPV A;  5B33 B;  3A3I A;  5CHJ A;  5FQK A;  3AGE A;  2Y2H A;  2K31 A;  1M1A D;  2NUT C;  3AZF D;  2J8Y A;  3BM6 A;  3CAX A;  3G2Y A;  3VFF A;  3W96 A;  4BQM A;  3MGS B;  1EQZ B;  2EXB A;  2ZQ8 A;  3RXX A;  3TE8 A;  3B6G C;  5HW3 A;  4HJ3 A;  3REI B;  3F1N B;  1IYS A;  3GSG A;  4J8W D;  4X68 A;  4NZ1 A;  5JYP A;  3L29 A;  2EX9 A;  3BJN A;  1ODV A;  1AOI A;  1U35 B;  3Q7V B;  2PYO A;  1M19 D;  4HY8 A;  2BYK A;  1JFI B;  1W8Y A;  1A7W A;  5A93 A;  4I5S A;  4KGC D;  2ZOH A;  4JF5 A;  4XUX A;  2WGW A;  5HWT A;  3BFG A;  4MN5 A;  2M7U A;  3G35 A;  4KZ3 A;  4GCZ A;  2HUE B;  1GHI A;  4P85 A;  3W97 D;  1BLH A;  4NZ3 A;  3SS5 A;  4EO5 C;  1XJ3 A;  4Y15 A;  4WU9 D;  3HUN A;  4MMN A;  5HFO A;  4NXB A;  2Y2Q A;  1HTZ A;  3HJK A;  1P9R A;  5DVA A;  3VE4 A;  5E5A B;  3ZG7 B;  1ES4 A;  4LEN A;  4WN5 A;  3F1O B;  1LL9 A;  3MGR D;  1CF0 A;  5G49 A;  3ZQ5 A;  3MZD A;  3LIA A;  5AV8 A;  3KSH A;  1YMS A;  4GLQ A;  3WTP B;  4LV0 A;  5J7E A;  5KZH A;  2NZD A;  3UB7 A;  5TJJ A;  2ZD8 A;  4BLM A;  3MQO A;  3AZG B;  3TSG A;  4L9E A;  2V1A A;  1QMF A;  1P3G A;  5B32 C;  5B24 C;  3HLF A;  2PBD P;  2RVQ D;  3NQJ A;  3AFA C;  2NQB B;  4X1L A;  4R4S A;  3LIB A;  2HGV A;  2IWC A;  1S66 L;  3KXB D;  3GTC A;  5C5K A;  1L6J A;  5F69 A;  4UUZ B;  4CSR B;  1ESU A;  4CLC B;  3LEL A;  5B40 A;  3KS4 A;  4JJN C;  2BYM B;  1D1J A;  1P3O B;  1ZG6 A;  3PBQ A;  4E3L A;  5B33 C;  1MBL A;  5DNN C;  5DFX A;  1EW0 A;  3EGD C;  1P3K D;  1UWP X;  4OOY A;  3V67 A;  4E04 A;  1TZY B;  3QP2 A;  1SKO B;  1LL8 A;  4R3A A;  4HJ4 A;  4OON A;  1XPB A;  1P3F B;  3B3X A;  5AVC C;  3KSG A;  1P3B A;  4B4Z A;  2ZM2 A;  1P34 B;  4IBR A;  4LD9 A;  4YIN A;  2Z6D A;  4Z5T B;  3UT9 D;  4RX3 A;  4I3I A;  1KVM A;  1MKM A;  1HQ3 A;  1IEM A;  3AZH B;  2WKI A;  3DWK A;  4YFM A;  4N9K A;  3MGP B;  3C2W A;  4H9O A;  5GT3 B;  2HJE A;  3PTE A;  1PDC A;  1M18 D;  1YLJ A;  5DNM A;  1NLZ A;  3HUO A;  1TS0 A;  3ZG8 B;  4U0T A;  5B1L C;  1YSQ A;  3GRJ A;  3O62 C;  4J8X A;  2HJ9 C;  5E5A C;  1W63 M;  3LZ1 B;  1Y54 A;  5EPH A;  3KWQ B;  3MKF A;  5B2I A;  5CED A;  1K55 A;  4LRY C;  3WKJ A;  1XGJ A;  3UTA A;  4JBF A;  1JTD A;  2L4R A;  3AZJ D;  4RX2 A;  1ESI A;  3LIF A;  4EW7 A;  2XQZ A;  1KS0 A;  4F3L A;  2F8N H;  1TEM A;  4D2O A;  1CQA A;  5CP6 D;  4DQY B;  4S2O A;  4DE0 A;  1W1Y A;  3UME A;  1P3P A;  3B6F A;  3X1V A;  2PYR A;  1DJC A;  3ULF A;  4R4R A;  4IBI A;  4Z2J A;  3EPJ A;  2PYP A;  3REH B;  5G4Z A;  2EFX A;  2BLS A;  4IVK A;  5B31 A;  1H8P A;  2EWV A;  2NQB C;  1OTI A;  3SS4 A;  1BH8 A;  5L07 A;  1P3L B;  2Y2G A;  5DJU A;  2XFT A;  3OOV A;  4PM6 A;  5CPK C;  4MBF A;  4NE5 A;  4WMC A;  3B47 A;  5B2J B;  3REL B;  3CUE A;  3CLO A;  1XP4 A;  1WWI A;  2ZJ9 A;  1DP9 A;  1XJ4 A;  3FWL A;  3NBL A;  3B0C T;  3X1T C;  4BEN A;  2WAD A;  5I5L A;  2K2N A;  1KX4 D;  2A24 B;  3C1C C;  3C4O A;  4CAY B;  2GDN A;  1P3I B;  4WZ4 A;  5F99 D;  3FZC A;  1F1E A;  2LB5 A;  3F1P B;  5B24 D;  5JRG B;  3EPH A;  3KX0 X;  1SCW A;  3WS2 A;  3P7N A;  2Z2M B;  3W4Q A;  3AFA D;  4I3J A;  3W2Z A;  3NUL A;  4Z2I A;  3AZI C;  4OQH A;  4FUW A;  4G91 C;  2I72 A;  2ZM0 A;  3HLD A;  3AZN D;  3O86 A;  1WYC A;  5CPJ A;  4LV3 A;  2VZW A;  4H9R A;  4H9N B;  5G18 A;  1P3M B;  5TBM B;  4R3B A;  3T1R A;  1CK7 A;  3UDI A;  2OWH A;  2PDR A;  5B33 D;  2O0Y A;  4ZJ3 A;  4PM9 A;  1OT9 A;  5DTS A;  1KGE A;  3MGS D;  3A6N B;  4KZ6 A;  3IH9 A;  2BAS A;  3VP2 A;  2ARO B;  5AVC D;  1G6O A;  2RIQ A;  1PZP A;  3REI D;  5C3I C;  4KQR A;  5BO0 A;  3BQA A;  3WTP E;  2HDQ A;  1IFQ A;  3LY3 A;  3R7W B;  4NFT A;  1U35 D;  5AY8 A;  1G6A A;  2JN7 A;  4PM8 A;  5GSU B;  4DDY A;  2YFV B;  2V0U A;  2FFY A;  1XA7 A;  5EM0 A;  3CIT A;  2P04 A;  4L9F A;  3A3D A;  2KLI A;  1G68 A;  2RL3 A;  1HLU P;  4OUI A;  3O88 A;  3A0V A;  2QJ7 A;  2ZC7 A;  3T1S A;  2ZY5 A;  3MR0 A;  3NQU B;  5L09 A;  4KUD B;  3VP4 A;  2Q9M A;  4TX8 A;  1LSW A;  5DF7 A;  2HP5 A;  5B1L D;  4Q0J A;  5E5A D;  4CLC E;  4I38 A;  4KZ8 A;  1E6P A;  5AQ9 A;  1H3O A;  4WU8 B;  3WD4 A;  1H0M A;  4WZS B;  1CXW A;  4OQ0 A;  4WM9 A;  4J8V B;  5AV9 A;  3WTP D;  4GHI B;  1LI0 A;  4GS9 B;  1CJF A;  1ES3 A;  1P0Z A;  4K08 A;  2QJ5 A;  4OPZ A;  3QHY A;  3AZM A;  3AZG D;  2J7V A;  1LHY A;  4B88 A;  3L28 A;  5F1F A;  3LJA A;  1VQQ A;  5JRG C;  3A0R A;  3MXS A;  2NQB D;  3KUY B;  3AV2 A;  1YM1 A;  3AN2 C;  5DF8 A;  1M40 A;  2HIO C;  3VH6 W;  4RVA A;  4KZB A;  1OJG A;  3GVB A;  2JE5 A;  5FAP A;  1L0D A;  5CPK D;  4CLC D;  2XEP A;  3OPP A;  3AZL C;  4HME A;  2Y79 A;  5M19 A;  3HUM A;  1P3O D;  4HQA A;  4P6B A;  2XD5 A;  1BYW A;  5EVL A;  2PU2 A;  1TZY D;  5FL3 A;  3ZFZ A;  1TS8 A;  3A6N C;  4R1G A;  1WE4 A;  2Y55 A;  5FAT A;  5HAP A;  2BG1 A;  1P3F D;  2B5R A;  5CHU A;  2K7S A;  3VP0 A;  4B93 A;  2ARO C;  4EBP A;  3PYP A;  3W96 B;  2V5O A;  4DXB A;  3QP1 A;  1UWN X;  4XXR A;  2IO5 B;  1P34 D;  5CTM A;  3VH5 T;  4OP5 A;  2RTS A;  2J3T C;  4BJP A;  4S2J A;  4Z5T D;  4E3J A;  1EWZ A;  4L0L A;  4Y0T A;  2C6W B;  4GD6 A;  1P97 A;  3Q81 A;  2WKR A;  1AOI B;  3AZH D;  4MEZ A;  2ACG A;  2BYK B;  4YS3 A;  2Y2J A;  5D3O A;  3MNN C;  2G2W A;  3WRT A;  5GT3 D;  3FYZ A;  4MB4 A;  2WGW B;  2PT7 A;  2VV7 A;  1LSX A;  4Z66 B;  3WWX A;  4Q8I A;  5BT1 D;  4NYU A;  3RJU A;  1NYM A;  1MWU A;  3LZ1 D;  3TU4 C;  3KWQ D;  1VET A;  4O01 A;  4X23 C;  1DP6 A;  3CPT A;  3FC7 A;  2EWW A;  1STZ A;  3LR5 A;  5AVB C;  1T1B A;  2V0W A;  1NZO A;  3EEH A;  3VH5 A;  1ID3 A;  4E6X A;  3AYW C;  1DJB A;  5G49 B;  3BFF A;  3VV4 A;  3AZE C;  5AV8 B;  2EA9 A;  4YM6 A;  2QMI A;  4ETX A;  5FQ9 A;  3ZGA B;  3C4P A;  1XFQ A;  2Y2I A;  2NZD B;  4ZJ2 A;  1F66 A;  4UEY A;  3REH D;  4GJ4 A;  4BL2 A;  4XUJ A;  4ZUX C;  3LIC A;  3CMZ A;  1P3G B;  1TF1 A;  3MXR A;  1S32 C;  3UTB A;  1ERO A;  2J80 A;  5FI2 A;  4HEF A;  5BNX A;  2W3E A;  5B2J D;  3NQJ B;  3REL D;  1Q9C A;  4NYY A;  4NEE D;  1T1C A;  2NUP C;  3BWL A;  2PAV P;  5FQM A;  4H6J A;  1V9Y A;  5EE8 A;  4A5R A;  5B40 B;  4X25 A;  1Y4O A;  4UA7 A;  1K54 A;  5B0Y A;  3FKE A;  2WUQ A;  5JRG D;  3W98 A;  4QNL A;  4P6Z M;  1LSV A;  1YLZ A;  1KDS A;  3ZNY A;  3E2K A;  1M19 C;  2IO5 C;  3MXQ A;  4JKT A;  1P3B B;  5F6A A;  5AVF A;  3AV1 C;  4KGC C;  3IF5 A;  3M2J A;  3CJM A;  1P3M D;  3REJ A;  3AZL D;  4LD9 B;  2XA7 M;  2V1B A;  3TRC A;  4HMD A;  4MLL A;  3W97 C;  3MVD B;  1KX3 A;  4OLD A;  1RGY A;  4WU9 C;  3FPW A;  5FDH A;  3EQV A;  3FG8 A;  1HQ3 B;  3VSL A;  3NOT C;  2PU4 A;  3A6N D;  2IWB A;  3WS1 A;  1HD8 A;  4Z66 C;  1KX5 A;  2ARO D;  2PR6 A;  3S7N A;  2DQN C;  4H9O B;  4J8U A;  3C7V A;  5CPI A;  1E6N A;  5DNM B;  4II7 A;  2I9V A;  3BW6 A;  4ZDX A;  4LCL A;  4J8X B;  1GHP A;  5B2I B;  4R23 A;  5GSU D;  5L10 A;  3P09 A;  1ONH A;  3WKJ B;  4OOM A;  5AV8 C;  3U2A A;  5HDD A;  1L0E A;  3C30 A;  3MNN D;  1W79 A;  4F3L B;  3JVV A;  5AJG A;  4DMZ A;  4MB3 A;  4RA7 A;  3EQU A;  1KU5 A;  1NXY A;  1P3P B;  3B6F B;  2X71 A;  3BEC A;  2JHE A;  3L27 A;  3KXB C;  3X1V B;  4X53 A;  3KSI A;  1L0F A;  2ZL1 A;  3TU4 D;  3GR2 A;  4UAA A;  3E4P A;  4NE6 A;  3BFE A;  5B31 B;  5CGS A;  4R8P C;  5HPF A;  5CHL B;  1FIL A;  4LV2 A;  4E3M A;  1BH8 B;  4ZBJ B;  4JLF A;  4EER A;  4J8V D;  2A2L A;  3AGD A;  2JKR I;  5B0Z B;  3DTE A;  1O6I A;  4JF6 A;  3IF6 C;  5KSC A;  1KE0 A;  4BWI A;  1ES2 A;  3KYE A;  3M6H A;  3HL9 A;  4IBE A;  4XUZ A;  3AZK C;  1UGU A;  2HZ5 A;  4QLC A;  1OTA A;  5CEB A;  4L9G A;  3RH8 B;  4ZUX D;  2E8I A;  4GDB A;  4ZAM A;  1YU3 A;  2ZMA A;  3UT9 C;  3X1U A;  4S2I A;  2Y2M A;  5HX9 A;  4QWO A;  3O87 A;  3UO9 A;  3OZH A;  4D60 A;  1CI8 A;  1NZU A;  4Z1W A;  5DJT A;  3MVD C;  2XGN A;  1QO6 A;  3LCE A;  1M18 C;  3WAA A;  5CPJ B;  4H9R B;  4N9L A;  3E4Q A;  3C1B A;  1M1A A;  3SH8 A;  3AZF A;  2G2U A;  3JVU A;  5GHZ A;  3UDF A;  5EOE A;  5AQ7 A;  3T1Q B;  3DTK A;  3H0M C;  3W96 D;  2XRO A;  4S2P A;  3AZJ C;  3GMW A;  4R6L A;  3QNB A;  3S1Y A;  4WNN A;  3UPP A;  1PZR A;  5E43 A;  2F8N K;  4QU3 A;  2HDS A;  4IBC A;  1EAK A;  3AV1 D;  2CMN A;  2W3D A;  5CP6 C;  3BFC A;  5IU1 A;  5BO0 B;  3T4T A;  4GH9 A;  3D4F A;  1Y28 A;  5FDS A;  5AY8 B;  5EVI A;  1N9O A;  3BY9 A;  3NIA A;  4IUK A;  4LRX C;  1I2W A;  1PRQ A;  5FI7 A;  1F98 A;  3W4O A;  1SDN A;  5EFW A;  3VOL A;  4WL9 A;  4Z66 D;  3IX3 A;  3UPO A;  4Y3I A;  3SZT A;  3WA9 B;  2DF4 C;  5AV5 A;  3K3C A;  3QP6 A;  4ARZ A;  5IT5 A;  1IKG A;  3MQL A;  5B0Z C;  1K6R A;  1H3O B;  1KX4 C;  2VGK A;  5CGX A;  5AV8 D;  3LFV A;  4MBK A;  5CX7 A;  2DCF A;  4N1X A;  4FOF A;  3KYZ A;  5F99 C;  5AV9 B;  1XA1 A;  5GHX A;  3HLE A;  3FDD A;  4DN0 A;  3P01 A;  4WZ5 C;  5GT0 C;  3GDI A;  3ZDJ A;  3X1S B;  2ZM5 A;  3SH9 A;  2NZD D;  4C6Y A;  3MGQ A;  4FTX A;  3LUQ A;  1ALQ A;  5FQQ A;  3N8L A;  4ID4 A;  5KSH A;  3AZM B;  5M18 A;  5HAI A;  3GV9 A;  2O9B A;  3G30 A;  4NZ5 A;  3AZN C;  1P3G D;  3LJA B;  1TDG A;  1KOU A;  4JXW A;  1W7F A;  4R8P D;  3CWF A;  4H9Q A;  3AV2 B;  2ZC4 B;  4PMA A;  3N4I A;  3HLW A;  3MGS C;  1EQZ C;  3V5M A;  5B40 D;  4JGQ A;  1P3K A;  5HSQ A;  3PBO A;  3B42 A;  4HIA A;  3RFB A;  3REI C;  3NY4 A;  5F68 A;  4ZJ1 A;  3ITA A;  3AZK D;  1FCN A;  4WUJ A;  1JVJ A;  4NY2 A;  1U35 C;  1SDE A;  4OQG A;  2IOU A;  3OPL A;  1P3B D;  4MB5 A;  3ISG A;  1H5X A;  3AL0 C;  2HUE C;  5CEC A;  4ZBE A;  4R38 A;  2XDM A;  2DMW A;  3F6T A;  3MVD D;  1NJ4 A;  2F2A C;  3B0B A;  4KG5 A;  3G2Z A;  3MBZ A;  1FCM A;  4LFU A;  4JXS A;  1HQ3 D;  4HMC A;  3LID A;  4YS3 B;  3Q1F A;  1S4R A;  5B1M B;  5CTN A;  3B6G A;  4R0Q A;  4Z2M G;  3WA9 C;  3BQ8 A;  1T3U A;  2ZC5 B;  5DNM D;  1PWG A;  3WTP C;  1KGF A;  2EX6 A;  3NJA A;  1VET B;  5B2I D;  3NC8 A;  3WRZ A;  2G7U A;  1S0W A;  3CPT B;  5BS7 C;  4H9S C;  3AZG C;  3WKJ D;  4FCF A;  2GX5 A;  3NEC A;  1X0O A;  1ID3 B;  3HSH A;  3MJQ A;  1KGG A;  3X1S C;  1ES5 A;  4G92 B;  1CK3 A;  4YM6 B;  4X1M A;  1BSG A;  3B6F D;  3VFH A;  4HJ6 A;  4DRT A;  4F94 A;  4OJO A;  1F66 B;  1YQS A;  5EV0 A;  4CLC C;  2V2F F;  1W1T A;  4XUJ B;  3C38 A;  1P3O C;  3AV2 C;  1ULY A;  1EI5 A;  3UTB B;  2X02 A;  1TDL A;  5B0Z D;  5EUA A;  4DE1 A;  1TZY C;  1MZU A;  2XF3 A;  2W3H A;  5BNX B;  3VH6 T;  4S2M A;  3P5J B;  3LZ0 A;  1GSW A;  3FPV A;  4UQI M;  1P3F C;  4H9P B;  1NY0 A;  5GT0 D;  4I39 A;  5DTT A;  4H6J B;  1K38 A;  2B18 A;  1RGZ A;  3ZG9 B;  4AWL B;  1P34 C;  5B32 A;  3MZF A;  3NDG A;  3W99 A;  4HI4 A;  5B0Y B;  2WKP A;  4GKU A;  4IED A;  5F83 A;  4Z5T C;  5HAR A;  1W63 Q;  3PAG A;  5DTK A;  3W98 B;  4Y5F A;  4JGO A;  3MQ0 A;  1WA9 A;  4EET B;  3AZH C;  5F5Y A;  5FQJ A;  1J9M A;  1VHM A;  1GCE A;  4JJN A;  3MGP C;  4IBX A;  5GT3 C;  4CQH A;  2VK3 A;  5CPJ D;  5DNN A;  1EQZ D;  1FR6 A;  4PKY A;  2OWJ A;  3REJ B;  3VH6 A;  5BT1 C;  3CG5 A;  4WEJ A;  3LZ1 C;  1KX3 B;  3KWQ C;  5B1M C;  3M7P A;  3T4O A;  1YLW A;  5AVC A;  2WKQ A;  4KEN B;  2JC7 A;  2ZC3 B;  4XZQ B;  2H0Y A;  2XH9 A;  3IWQ A;  3UB8 A;  1KX5 B;  2Y4A A;  4WF0 A;  1XFN A;  3DTM A;  1S4S A;  3EOI A;  4J8U B;  5HD5 A;  1K57 C;  3B33 A;  1H8M A;  5CPI B;  4OJ6 A;  4JXG A;  3ITB A;  1JFI A;  2G5H C;  1MC0 A;  4E3O A;  1KVL A;  5J8X A;  1ID3 C;  1K25 A;  3REH C;  4HH3 A;  2JCH A;  5FI6 A;  4E3K A;  4GOG A;  4G92 C;  1P3L C;  3D72 A;  1PI4 A;  1YUE A;  4AFI A;  1FR1 A;  3LR0 A;  3A1K A;  1F66 C;  5TFQ A;  5B1L A;  3O62 A;  2HV1 A;  3H9W A;  4E45 A;  5B2J C;  3REL C;  5E5A A;  3WA9 D;  5TGF A;  4X69 A;  3H82 A;  3LIE A;  1ACF A;  3L26 A;  1T18 A;  4BD1 A;  2ZL1 B;  2INW A;  1PWD A;  1S67 L;  2ZQA A;  1K4E A;  3E0Y A;  4UA6 A;  3V50 A;  4M3K A;  4Z2G A;  1PYY A;  1P3I C;  5AQA A;  3S7Q A;  3X1S D;  2X01 A;  1P9W A;  4RQ9 A;  2V9A A;  3RXW A;  3AZM D;  4AWL C;  1ZHH B;  2ZC6 B;  3NHQ A;  3EEA A;  5FUG A;  5KMW A;  2NQB A;  4P87 A;  2YFW A;  4QLC B;  4KZ4 A;  3ZYT A;  5BOH A;  3W98 C;  1P3M C;  3E2L A;  2W8S A;  3UE1 A;  3BYD A;  4IJE A;  1DY6 A;  4QHC A;  1TS6 A;  5AV6 A;  3AV2 D;  2EX2 A;  4B9O A;  5CPK A;  4NG2 A;  1OTD A;  2D01 A;  3VOZ A;  3X1U B;  3B0C W;  1Z09 A;  2WKE A;  2Y2L A;  2PR5 A;  3UB6 A;  3X1T A;  2VJW A;  2VGL M;  4EV4 A;  4EBL A;  3IWO A;  2Y91 A;  2F8N A;  5I94 A;  1AXB A;  3C1C A;  2W27 A;  1YAX A;  2XD1 A;  2JSS A;  3WAA B;  3MF0 A;  3C1B B;  1M1A B;  3BLS A;  3PBN A;  3AZF B;  1BUE A;  3MKE A;  2V8C A;  4EEU A;  1AWI A;  4XZQ C;  2JKG A;  3R4K A;  5GSU C;  5B31 G;  3ZVT A;  3FKW A;  3AZI A;  3L9K A;  4WEK A;  2V8F A;  2CV5 A;  2PYO B;  3WS4 A;  1H0I A;  1ZC2 A;  4WNN B;  3QNC A;  3D9Y A;  2WKH A;  5E2G A;  3MGP D;  2A3U A;  4KUD C;  1LT0 A;  1H3Q A;  2R9W A;  4LRZ E;  2HDR A;  2CWE A;  2FH5 A;  3REK A;  3QP8 A;  3SW1 A;  4YS3 D;  5EVI B;  4EQI A;  3L25 A;  4JGP A;  5B1M D;  3MZE A;  4WU8 C;  5DKK A;  3N6I A;  1MKI A;  3NOP C;  1IYQ A;  2ZM8 A;  1FOF A;  4G3V A;  4J8V C;  1JNU A;  4BL3 A;  4QPR A;  4OJL A;  1L3L A;  3HLB A;  5HL1 A;  2WGV A;  2ZMF A;  3N7W A;  3IBJ A;  1BUL A;  5B32 G;  5AV5 B;  3NI9 A;  3JYI A;  4EUV A;  4GB7 A;  4ARZ B;  4EXO A;  2V1Z A;  1ID3 D;  3CI6 A;  3UN7 A;  3E4O A;  3KFU G;  1YT4 A;  4ESP A;  5GXQ A;  3ZG0 A;  3N8R A;  4MNR A;  1U60 A;  1HVB A;  4Y7P A;  3HVF A;  3IBR A;  3KUY C;  1IYP A;  5F1G A;  1P3L D;  3OLO A;  1BTL A;  4EUZ A;  4HGA B;  1PNE A;  2Y59 A;  1F66 D;  4ETZ A;  3MGQ B;  3UB5 P;  4Y13 A;  1E8B A;  4PKY G;  2R78 A;  3KS8 A;  1TVF A;  3GQZ A;  2Z2L B;  4EEP A;  4P6Z S;  1LI9 A;  2OAP 1;  1WYB A;  3LEL B;  2JKF A;  3G34 A;  2O9C A;  5FQI A;  4NKP A;  1J7M A;  1K56 A;  4H9Q B;  2W0N A;  1P3I D;  3ICY A;  1W8Q A;  4EWF A;  3W96 C;  2XA7 S;  3WAA C;  2FJ7 A;  4B4X A;  2UV0 E;  1Q2Q A;  2ZMV A;  1MPL A;  5JRG A;  4WYY A;  5B0Y D;  3LR3 A;  3PBT A;  2CC1 A;  3AN2 A;  5HAQ A;  3W98 D;  2HIO A;  4IJG A;  1AOI C;  3QP5 A;  2PYO C;  3L7H A;  4QB8 A;  3MQQ A;  2J8P A;  3AZL A;  2Z6C A;  1NLY A;  4HNB A;  2L1M A;  4MCW A;  2QPN A;  5K5B A;  5HWV A;  1A0K A;  1GPF A;  1OTB A;  2XSS A;  3H0R C;  1KX3 D;  3A6N A;  2VV8 A;  2ZY3 A;  3EPK A;  2OOL A;  5EOO A;  3K2N A;  4WEL A;  2ARO A;  4DE2 A;  4LLO B;  5CXW A;  3T4Q A;  4UHU A;  4R70 A;  1VB6 A;  4XZQ D;  1UR8 A;  3PXP A;  4IVI A;  4KUK A;  4NXE A;  1KX5 D;  3B6G B;  5G4Y A;  4J8U D;  3UTA B;  2PD7 A;  4NZ4 A;  2EX8 A;  3UMD A;  3ZNT A;  3A3J A;  3T4K A;  1I5Q A;  1NRJ A;  4HP9 A;  1GSV A;  4ME4 A;  3WX7 A;  1E3U A;  2P9V A;  2NZD C;  3NCK A;  1JWP A;  4KUD D;  1YLP A;  3C7U A;  5CGW A;  3MNN A;  1YU0 A;  4XT2 A;  1FQG A;  5FAQ A;  1BFM A;  1P3G C;  3PHY A;  4HGA C;  3LGO A;  4WU8 D;  2FN2 A;  3I7J A;  4KZ5 A;  4WJ3 C;  2FFF B;  1JTG A;  3TU4 A;  4EO5 B;  2F8N G;  1R4V A;  5LBR A;  3R45 A;  1N1J A;  4X23 A;  1DJA A;  2QHK A;  1BH9 A;  5AVB A;  4O7D A;  1MWT A;  3LEL C;  5B40 C;  3AYW A;  4MN6 A;  5HD3 A;  2P74 A;  3AZE A;  2H10 A;  1BT5 A;  1ZLA A;  1XX2 A;  3IHA A;  2EFU A;  4O0P A;  4BBV A;  3LZ0 B;  3SOI A;  3KUY D;  1S1Y A;  3HLC A;  2C5W B;  3K3D A;  1P3B C;  4ZUX A;  2ZQD A;  4WBG A;  5GLA A;  3A3F A;  1P3A A;  5B32 B;  1S32 A;  4LD9 C;  3ZHH A;  4H8R A;  1PIO A;  3W99 B;  2QYB A;  4MBH A;  4KQO A;  2Q9N A;  3X1U D;  4Y17 A;  2VGJ A;  4KUO A;  1HQ3 C;  1B67 A;  2O9A A;  4OPY A;  1FCO A;  4JJN B;  2L5A A;  4IBB A;  1SKF A;  3WAA D;  4WV4 B;  5DNM C;  5DNN B;  3H7W A;  3UB9 A;  4J8W A;  1YU1 A;  3C1B D;  4CJN A;  4J8X C;  3L2A A;  2W1T A;  1H8Y A;  1S1Z A;  1N9N A;  3G32 A;  5B2I C;  1M19 A;  1N9L A;  4OVD A;  1K55 C;  3MSH A;  5FEF A;  3WKJ C;  3UTA C;  5AVC B;  1AOI D;  3AV1 A;  2PYO D;  4KGC A;  3T12 B;  4X6T A;  5EM1 A;  4LCM A;  4OJP A;  4NK3 A;  4IBD A;  1GA0 A;  3W97 A;  3Q07 A;  4GW9 A;  4DRB A;  1P3P C;  3B6F C;  4WU9 A;  5A8B A;  4LV1 A;  3LI8 A;  3X1V C;  5EVI D;  3QP4 A;  2H0T A;  2HP6 A;  3WS0 A;  4Z66 A;  5B31 C;  3FV7 A;  2PBY A;  3MGR A;  1E15 A;  4ZBJ C;  3ZG5 A;  2O99 A;  4YOF A;  5MC7 A;  5B1L B;  3O62 B;  2IWD A;  3OPR A;  1L0G A;  3CUE C;  4HOI A;  4M6B A;  4GZB A;  1TD5 A;  3H82 B;  3MMH A;  5EVE A;  5AV5 D;  4NET A;  4JPM A;  2P08 A;  4KQD A;  2HDU A;  3EG5 B;  1SZV A;  3IXB A;  1GHM A;  3G31 A;  5FA7 A;  3IXH A;  4IBK A;  2GZA A;  3V39 A;  3LZ0 C;  1D06 A;  2WAF A;  1MY8 A;  2ZLY A;  3GEC A;  5E2E A;  1ERQ A;  2M1C A;  2W1R A;  2HP9 A;  5GHY A;  3PBS A;  1GSX A;  3MGQ D;  3KXB A;  4IBF A;  5FEG A;  4S2N A;  3V3S A;  2ZBB A;  3W99 C;  3W4P A;  5FUG B;  1FIK A;  5L2F A;  5GLB A;  4R8P A;  3T50 A;  2VQR A;  4GD8 A;  4OJ5 A;  4X55 A;  2YFW B;  4Y2F A;  5CPJ C;  3LEL D;  1K4F A;  3PAE A;  4DF6 A;  3IF6 A;  5AV6 B;  1L2S A;  5CPK B;  1XXM A;  1ONG A;  3S7P A;  3UE3 A;  1ERM A;  3X1T B;  3VE3 A;  1NWZ A;  3IS2 A;  3AZK A;  2F8N B;  4K91 A;  2UWX A;  4DE3 A;  3WD2 A;  2D49 A;  2ZOI A;  3C1C B;  2W3F A;  5HDC A;  4DDS A;  4Z2H A;  3Q7Z A;  4OPQ A;  2W3G A;  5U47 A;  3UT9 A;  3KO6 A;  4DXC A;  4LD9 D;  3UE6 A;  5AY8 C;  5IHV A;  4P0M A;  5JA4 A;  3IX4 A;  3AZI B;  2WZZ A;  1PWC A;  4G91 B;  3MVD A;  3V9R A;  2CV5 B;  1H0G A;  4S2K A;  1M18 A;  1W1P A;  3S4X A;  4BMW A;  4OLG A;  1OT6 A;  4WLA A;  4YWZ A;  4KQQ A;  3S22 A;  2J3W A;  4LGW A;  1CEG A;  3REK B;  4KZ7 A;  4J8X D;  3NOU C;  2XRN A;  3AZJ A;  2L0W A;  2VLG A;  1G28 A;  3SS3 A;  3B6G D;  4PHT A;  4DJ2 A;  3UTA D;  1QME A;  1DP8 A;  4OP8 A;  5C3I B;  5KDM A;  2YKF A;  3JPU A;  5AV9 C;  5CP6 A;  1NRF A;  3IT9 A;  3MS6 A;  1LLB A;  1BZA A;  3EGX C;  4IUH A;  3WS5 A;  1YLT A;  2WAE A;  3AZM C;  5E2F A;  4LG2 A;  1P3P D;  1YPR A;  3MFX A;  3X1V D;  3TW8 A;  3LJA C;  2LY8 A;  2MJ6 A;  3LYX A;  1TAF A;  4UQI S;  5B31 D;  5GXQ B;  5BNV A;  1TS7 A;  2WYX A;  1SHV A;  3T1X A;  2Q0O A;  4UPK A;  3OBF A;  4KZ9 A;  1VEU A;  3WD3 A;  2V20 A;  1W2E A;  4WMC D;  1V9Z A;  4KHA A;  4PPR A;  5B0Z A;  2PHY A;  3DTI A;  2QWS A;  1KX4 A;  5AV6 C;  3G6O A;  4JXV A;  3HJI A;  3LEZ A;  3G4P A;  2Y8H A;  3HBR A;  5F99 A;  4WZ5 A;  5GT0 A;  5B24 A;  3LZ0 D;  1WWS A;  3UE0 A;  1OPX A;  3IXG A;  2XR0 A;  3AFA A;  1D7E A;  3ZVW A;  3S7O A;  3IHB A;  3IWI A;  4N92 A;  4Y0O A;  4PM5 A;  2FJ7 B;  5TR7 A;  1J3W A;  3AZN A;  3MFD A;  5B32 D;  1K0K A;  3W99 D;  5A90 A;  1KE3 A;  4YNR A;  5EEC A;  5B33 A;  4QY6 A;  3AN2 B;  2HIO B;  2LB9 A;  4GDN A;  2XLN A;  2CV5 C;  4YS3 C;  4M4X A;  5A91 A;  4E3N A;  3MGS A;  1EQZ A;  1LL5 A;  3P98 A;  4JJN D;  3AZL B;  2WZX A;  1YU4 A;  3KYQ A;  4E3I A;  3REI A;  3F1N A;  3UPN A;  5DNN D;  4O8G A;  1HZO A;  3REK C;  4KZA A;  1U35 A;  3Q7V A;  2ZQC A;  3ZCZ A;  4HP4 A;  1C3B A;  2EXA A;  4C3Q A;  4IJF A;  4GNU A;  5AY8 D;  1IEL A;  4G3W A;  3T4S A;  2E8J A;  1Z2C B;  4JGR A;  3O3V A;  3N3F A;  5J3W A;  4YM6 C;  1F5M A;  1AIW A;  1I2S A;  3BRM A;  3UDX A;  4NE3 A;  5GLD A;  4HH2 A;  5JYO A;  2P9V B;  1OME A;  2KDK A;  3Q82 A;  2KOI A;  3A0S A;  3MNN B;  5GXQ C;  3IX8 A;  4XUJ C;  3F1O A;  4XT2 B;  1ED7 A;  3BY8 A;  4Z2K A;  3WA9 A;  3UTB C;  1H8Z A;  1N9B A;  1Z6F A;  3WTP A;  3VOY A;  4QY5 A;  1E88 A;  3O62 D;  2OAQ 1;  2WK0 A;  5L8M A;  2H5S A;  4FH2 A;  2Y2O A;  3TU4 B;  5AV9 D;  3R45 B;  1N1J B;  4X23 B;  3HLG A;  3PBR A;  2OLU A;  1BH9 B;  5BS7 A;  4H9S A;  3AZG A;  3M2K A;  5AVB B;  4N1H A;  2R9X A;  2G5I C;  4ZRR A;  3AYW B;  1RCJ A;  5FSR A;  3X1S A;  4IBG A;  1K54 C;  1OTE A;  3AZE B;  1GA9 A;  5B0Y C;  3H0L C;  3KSY A;  3LJA D;  1ZLA B;  4IHQ A;  3C8C A;  2VGL S;  2PD8 A;  1VM1 A;  4GN2 A;  2FJ7 C;  4UUZ A;  5E2H A;  3EWK A;  2YKH A;  4CSR A;  2M7V A;  3VP3 A;  1E6Z A;  1MXO A;  2DNS A;  1O7E A;  4CLC A;  1UR9 A;  4ZTK A;  2VV6 A;  2BYM A;  3LY4 A;  3B0D B;  4ZUX B;  1P3O A;  1P3A B;  1YKD A;  3REJ C;  1S32 B;  4G3K A;  3D3O A;  1TZY A;  1SKO A;  5AV6 D;  3UNW A;  1KX3 C;  3CHW P;  1HTA A;  4FSF A;  3WD0 A;  1P3F A;  3T4J A;  1XKZ A;  3X1T D;  4HES A;  2PRF A;  2JKT M;  2F8N D;  2GJ3 A;  1KX5 C;  1P34 A;  3DBA A;  1GXD A;  4DKI A;  3C1C D;  4J8U C;  1PFL A;  3HRE A;  5CER A;  2HF6 A;  5CPI C;  4GHL A;  4S2L A;  3H7W B;  4Q0H A;  4J8W B;  2J9P A;  4KG6 A;  4QJG A;  4Z5T A;  2W1T B;  1ZG4 A;  1GOI A;  1BLC A;  2ZY2 A;  3AZH A;  1DRM A;  1M19 B;  4Z2M H;  3A3E A;  5A92 A;  3V3R A;  4EES A;  3AZI D;  2JBF A;  1ZTU A;  3MGP A;  3AV1 B;  2CV5 D;  5GT3 A;  4KGC B;  5HPI A;  1FSW A;  4EU0 A;  2Y2K A;  4NXF A;  4MN7 A;  3W97 B;  3LZ1 A;  3W8K A;  3KWQ A;  3OPH A;  3T4L A;  3REK D;  4WU9 B;  3TG9 A;  5B1M A;  1T1A A;  4LPZ A;  4RYE A;  1F2K A;  1N4O A;  3EPL A;  2JKT I;  3MGR B;  1KDW A;  2BTF P;  1K57 A;  2FZ0 A;  5AQB A;  4OH0 A;  4BBU A;  2VEA A;  1PW1 A;  4Z9Q A;  3U4L P;  2H28 A;  4MDZ A;  4YM6 D;  1BLS A;  4HBT A;  1JWZ A;  2A49 A;  1F9I A;  3N8S A;  3REH A;  2ZY4 A;  4UA9 A;  1ZKJ A;  1ZLA C;  5HDS A;  4QLC C;  3DWZ A;  1P3L A;  3M6B A;  5GXQ D;  5HL6 A;  4XUJ D;  4PM7 A;  3VP1 A;  2OSU A;  1M6K A;  5B2J A;  3REL A;  3X1U C;  3UTB D;  4E6W A;  3B0D C;  5GLC A;  3KXB B;  1IOU A;  1P3A C;  2GNX A;  3HCY A;  5KIZ A;  4PAU A;  4DJ3 A;  3AGF A;  2KX6 A;  3IXD A;  2A24 A;  4R8P B;  4CAY A;  1P3I A;  3BEB A;  3VMA A;  4H9P A;  5F82 A;  1P3K B;  3C1B C;  3F1P A;  1M1A C;  1K56 D;  5DFY A;  3AZF C;  3IF6 B;  2VA0 A;  1O07 A;  4OQI A;  2VKS A;  2OV5 A;  1IKI A;  4FD8 A;  1FSY A;  3BFD A;  3OCL A;  2WGI A;  4OOL A;  2FJ7 D;  4GHA A;  4J8W C;  3IS2 B;  3AZK B;  1T19 A;  3LEQ A;  4I3A A;  1PW8 A;  2J9O A;  4H9N A;  3HON A;  1P3M A;  5TBM A;  2D02 A;  2OLV A;  1BLP A;  3AN2 D;  3C5A A;  2HIO D;  3UT9 B;  4JF4 A;  3REJ D;  4IBJ A;  2B95 A;  3O5Y A;  3TJZ C;  1G5U A;  5EVI C;  2B02 A;  3IQA A;  3OCN A;  4OPR A;  5DKL A;  5JA4 B;  1XGI A;  5FAS A;  3V9R B;  4HHD A;  2Y2P A;  1K6S A;  1M18 B;  3VH5 W;  4KG2 A;  4EBN A;  3OC2 A;  5HZH A;  2QZ6 A;  3R7W A;  4NXG A;  5CPI D;  1NYY A;  4E44 A;  4XZQ A;  3RTY A;  5AV5 C;  1YSP A;  3MGR C;  1YU2 A;  2XFS A;  1E25 A;  1CEF A;  2HPB A;  2XK1 A;  5GSU A;  4HBU A;  2YFV A;  4BD0 A;  3DAV A;  2JKR M;  5DF9 A;  3AZJ B;  4Y0U A;  1E6R A;  1YLY A;  1W5D A;  4X56 A;  2Y2N A;  1S6R A;  4BBT A;  5J4E A;  3NQU A;  3LO7 A;  4KUD A;  5KDM B;  2J3T D;  4EQ1 A;  5CP6 B;  2DRW A;  3UY6 A;  1E3U D;  2AVX A;  4DRA A;  4QD4 A;  3MGQ C;  2ZQ9 A;  4Z2L A;  1E4D A;  1PZO A;  4K0X A;  4WU8 A;  1JWV A;  4OKP A;  4U0X A;  4U3T A;  2RVQ C;  3SH7 A;  1KE4 A;  5CHM A;  4J8V A;  1TAF B;  3LI9 A;  4GHI A;  1B6W A;  3PR6 A;  5BNV B;  4GS9 A;  5GL9 A;  3VSK A;  5IS1 A;  4S2N C;  5M1A A;  4FH4 A;  3CZD A;  4X23 D;  4R3J A;  3NDE A;  1IYO A;  3LR4 A;  1VEU B;  3DW0 A;  5AVB D;  5AVE A;  1Q2P A;  3E98 A;  4KHA B;  1P3K C;  3AYW D;  3A1I A;  1W1V A;  1XJ2 A;  1KX4 B;  3AZE D;  2RCX A;  4Q0I A;  1PI5 A;  1ZLA D;  2VX8 A;  3KUY A;  4QLC D;  1OGB A;  5F99 B;  5FAO A;  5GT0 B;  5B24 B; 
#chains in the Genus database with same CATH homology
 4CPK A;  2ZQ7 A;  1CI9 A;  3AFA B;  4C75 A;  1MWS A;  1YMX A;  3IH8 A;  3FKV A;  4K0W A;  1P3A D;  3TOI A;  1MWR A;  5CRF A;  3AZN B;  1RP5 A;  1S32 D;  3BLM A;  3IP4 C;  5BPV A;  5B33 B;  3A3I A;  5CHJ A;  5FQK A;  3AGE A;  2Y2H A;  1M1A D;  3AZF D;  2J8Y A;  3BM6 A;  3G2Y A;  3VFF A;  3W96 A;  4BQM A;  3MGS B;  1EQZ B;  2EXB A;  2ZQ8 A;  3RXX A;  3B6G C;  5HW3 A;  3REI B;  1IYS A;  3GSG A;  4J8W D;  4X68 A;  4NZ1 A;  5JYP A;  3L29 A;  2EX9 A;  1AOI A;  1U35 B;  3Q7V B;  2PYO A;  1M19 D;  2BYK A;  1JFI B;  1W8Y A;  1A7W A;  5A93 A;  4KGC D;  4JF5 A;  4XUX A;  2WGW A;  3BFG A;  3G35 A;  4KZ3 A;  2HUE B;  1GHI A;  4P85 A;  3W97 D;  1BLH A;  4NZ3 A;  3SS5 A;  4EO5 C;  4WU9 D;  3HUN A;  5HFO A;  2Y2Q A;  1HTZ A;  5DVA A;  5E5A B;  3ZG7 B;  1ES4 A;  4LEN A;  1LL9 A;  3MGR D;  5G49 A;  3MZD A;  5AV8 A;  1YMS A;  3WTP B;  4LV0 A;  5KZH A;  2NZD A;  2ZD8 A;  4BLM A;  3AZG B;  3TSG A;  1QMF A;  1P3G A;  5B32 C;  5B24 C;  3HLF A;  2RVQ D;  3NQJ A;  3AFA C;  2NQB B;  4R4S A;  2IWC A;  3KXB D;  3GTC A;  4UUZ B;  4CSR B;  1ESU A;  3LEL A;  5B40 A;  3KS4 A;  4JJN C;  2BYM B;  1P3O B;  1ZG6 A;  3PBQ A;  4E3L A;  5B33 C;  1MBL A;  5DNN C;  1P3K D;  4OOY A;  1TZY B;  4OON A;  1XPB A;  1P3F B;  3B3X A;  5AVC C;  1P3B A;  4B4Z A;  2ZM2 A;  1P34 B;  4IBR A;  4LD9 A;  4YIN A;  4Z5T B;  3UT9 D;  4RX3 A;  1KVM A;  1HQ3 A;  1IEM A;  3AZH B;  2WKI A;  3DWK A;  4YFM A;  4N9K A;  3MGP B;  4H9O A;  5GT3 B;  3PTE A;  1M18 D;  1YLJ A;  5DNM A;  3HUO A;  3ZG8 B;  4U0T A;  5B1L C;  3GRJ A;  3O62 C;  4J8X A;  5E5A C;  1Y54 A;  3LZ1 B;  5EPH A;  3KWQ B;  3MKF A;  5B2I A;  5CED A;  1K55 A;  3WKJ A;  1XGJ A;  3UTA A;  4JBF A;  1JTD A;  3AZJ D;  4RX2 A;  1ESI A;  2XQZ A;  2F8N H;  1TEM A;  4D2O A;  5CP6 D;  4DQY B;  4S2O A;  4DE0 A;  1P3P A;  3B6F A;  3X1V A;  1DJC A;  4R4R A;  4IBI A;  3EPJ A;  3REH B;  2EFX A;  2BLS A;  4IVK A;  5B31 A;  2NQB C;  3SS4 A;  1BH8 A;  1P3L B;  2Y2G A;  2XFT A;  4PM6 A;  5CPK C;  4MBF A;  4NE5 A;  4WMC A;  5B2J B;  3REL B;  1XP4 A;  1WWI A;  2ZJ9 A;  3FWL A;  3NBL A;  3B0C T;  3X1T C;  4BEN A;  2WAD A;  1KX4 D;  3C1C C;  3C4O A;  4CAY B;  2GDN A;  1P3I B;  4WZ4 A;  5F99 D;  3FZC A;  1F1E A;  5B24 D;  5JRG B;  3EPH A;  1SCW A;  3WS2 A;  2Z2M B;  3W4Q A;  3AFA D;  3AZI C;  4OQH A;  4G91 C;  2I72 A;  2ZM0 A;  3HLD A;  3AZN D;  3O86 A;  1WYC A;  5CPJ A;  4LV3 A;  5G18 A;  4H9R A;  4H9N B;  1P3M B;  4R3B A;  3UDI A;  5B33 D;  4ZJ3 A;  4PM9 A;  5DTS A;  1KGE A;  3MGS D;  3A6N B;  4KZ6 A;  3IH9 A;  3VP2 A;  2ARO B;  5AVC D;  1PZP A;  2RIQ A;  3REI D;  5C3I C;  4KQR A;  5BO0 A;  3WTP E;  2HDQ A;  3LY3 A;  4NFT A;  1U35 D;  5AY8 A;  1G6A A;  4PM8 A;  5GSU B;  4DDY A;  2YFV B;  2FFY A;  1XA7 A;  3A3D A;  2RL3 A;  1G68 A;  4OUI A;  3O88 A;  2ZC7 A;  2ZY5 A;  3NQU B;  4KUD B;  3VP4 A;  2Q9M A;  5DF7 A;  2HP5 A;  5B1L D;  5E5A D;  4KZ8 A;  5AQ9 A;  1H3O A;  4WU8 B;  4WZS B;  4OQ0 A;  4WM9 A;  4J8V B;  5AV9 A;  3WTP D;  1LI0 A;  1ES3 A;  4OPZ A;  3QHY A;  3AZM A;  3AZG D;  2J7V A;  1LHY A;  4B88 A;  3L28 A;  5F1F A;  3LJA A;  1VQQ A;  5JRG C;  3MXS A;  2NQB D;  3KUY B;  3AV2 A;  1YM1 A;  3AN2 C;  5DF8 A;  1M40 A;  2HIO C;  3VH6 W;  4RVA A;  4KZB A;  3GVB A;  2JE5 A;  5FAP A;  1L0D A;  5CPK D;  2XEP A;  3OPP A;  3AZL C;  5M19 A;  3HUM A;  1P3O D;  4P6B A;  2XD5 A;  5EVL A;  2PU2 A;  1TZY D;  3ZFZ A;  3A6N C;  4R1G A;  1WE4 A;  2Y55 A;  5FAT A;  5HAP A;  2BG1 A;  1P3F D;  2B5R A;  5CHU A;  3VP0 A;  4EBP A;  2ARO C;  3W96 B;  4DXB A;  4XXR A;  2IO5 B;  1P34 D;  5CTM A;  3VH5 T;  4OP5 A;  4BJP A;  4S2J A;  4Z5T D;  4E3J A;  1EWZ A;  4L0L A;  4Y0T A;  2C6W B;  4GD6 A;  3Q81 A;  1AOI B;  3AZH D;  4MEZ A;  2BYK B;  4YS3 A;  2Y2J A;  5D3O A;  3MNN C;  2G2W A;  3WRT A;  5GT3 D;  3FYZ A;  2WGW B;  3WWX A;  4Z66 B;  4Q8I A;  5BT1 D;  4NYU A;  3RJU A;  1NYM A;  1MWU A;  3LZ1 D;  3TU4 C;  3KWQ D;  4X23 C;  5AVB C;  1NZO A;  3VH5 A;  1ID3 A;  4E6X A;  3AYW C;  1DJB A;  5G49 B;  3BFF A;  3AZE C;  5AV8 B;  4YM6 A;  2QMI A;  5FQ9 A;  3ZGA B;  3C4P A;  2Y2I A;  2NZD B;  4ZJ2 A;  1F66 A;  3REH D;  4BL2 A;  4XUJ A;  4ZUX C;  3CMZ A;  1P3G B;  3MXR A;  1S32 C;  3UTB A;  1ERO A;  5FI2 A;  4HEF A;  5BNX A;  5B2J D;  3NQJ B;  3REL D;  1Q9C A;  4NYY A;  5FQM A;  5EE8 A;  4A5R A;  5B40 B;  4UA7 A;  1K54 A;  5B0Y A;  3FKE A;  2WUQ A;  5JRG D;  3W98 A;  4QNL A;  1YLZ A;  1KDS A;  3ZNY A;  3E2K A;  1M19 C;  2IO5 C;  4JKT A;  1P3B B;  3AV1 C;  4KGC C;  3IF5 A;  3M2J A;  3CJM A;  1P3M D;  3REJ A;  3AZL D;  4LD9 B;  4MLL A;  3W97 C;  3MVD B;  1KX3 A;  4OLD A;  1RGY A;  4WU9 C;  5FDH A;  3EQV A;  1HQ3 B;  3VSL A;  2PU4 A;  3A6N D;  2IWB A;  3WS1 A;  1HD8 A;  4Z66 C;  1KX5 A;  2ARO D;  2DQN C;  4H9O B;  4J8U A;  3C7V A;  5CPI A;  5DNM B;  4ZDX A;  4LCL A;  4J8X B;  1GHP A;  5B2I B;  4R23 A;  5GSU D;  3P09 A;  1ONH A;  3WKJ B;  4OOM A;  5AV8 C;  1L0E A;  3MNN D;  1W79 A;  4RA7 A;  3EQU A;  1KU5 A;  1NXY A;  1P3P B;  3B6F B;  2X71 A;  3BEC A;  3L27 A;  3KXB C;  3X1V B;  4X53 A;  1L0F A;  3TU4 D;  3GR2 A;  4UAA A;  4NE6 A;  3BFE A;  5B31 B;  5CGS A;  4R8P C;  5CHL B;  4LV2 A;  4E3M A;  1BH8 B;  4ZBJ B;  4JLF A;  4J8V D;  3AGD A;  5B0Z B;  4JF6 A;  3IF6 C;  5KSC A;  1KE0 A;  1ES2 A;  3M6H A;  3HL9 A;  4IBE A;  4XUZ A;  3AZK C;  4QLC A;  5CEB A;  4ZUX D;  2E8I A;  4GDB A;  4ZAM A;  1YU3 A;  2ZMA A;  3UT9 C;  3X1U A;  4S2I A;  2Y2M A;  5HX9 A;  3O87 A;  3UO9 A;  3OZH A;  1CI8 A;  1NZU A;  3MVD C;  2XGN A;  3LCE A;  1M18 C;  3WAA A;  5CPJ B;  4H9R B;  4N9L A;  3C1B A;  1M1A A;  3SH8 A;  3AZF A;  2G2U A;  5GHZ A;  3UDF A;  5EOE A;  5AQ7 A;  3H0M C;  3W96 D;  4S2P A;  3AZJ C;  3GMW A;  3QNB A;  3S1Y A;  4WNN A;  3UPP A;  1PZR A;  5E43 A;  2F8N K;  4QU3 A;  2HDS A;  4IBC A;  3AV1 D;  3BFC A;  5CP6 C;  5BO0 B;  4GH9 A;  3D4F A;  5AY8 B;  5EVI A;  3NIA A;  1I2W A;  5FI7 A;  3W4O A;  1SDN A;  4Z66 D;  3UPO A;  3WA9 B;  2DF4 C;  5AV5 A;  1IKG A;  5B0Z C;  1K6R A;  1H3O B;  1KX4 C;  2VGK A;  5CGX A;  5AV8 D;  4MBK A;  2DCF A;  4N1X A;  5F99 C;  5AV9 B;  1XA1 A;  5GHX A;  3HLE A;  3FDD A;  4WZ5 C;  5GT0 C;  3ZDJ A;  3X1S B;  2ZM5 A;  3SH9 A;  2NZD D;  4C6Y A;  3MGQ A;  1ALQ A;  5FQQ A;  3N8L A;  4ID4 A;  5KSH A;  3AZM B;  5M18 A;  5HAI A;  3GV9 A;  3G30 A;  4NZ5 A;  3AZN C;  1P3G D;  3LJA B;  1TDG A;  4JXW A;  1W7F A;  4R8P D;  4H9Q A;  3AV2 B;  2ZC4 B;  4PMA A;  3N4I A;  3HLW A;  3MGS C;  1EQZ C;  3V5M A;  5B40 D;  1P3K A;  3PBO A;  3REI C;  3NY4 A;  4ZJ1 A;  3ITA A;  3AZK D;  1FCN A;  1JVJ A;  4NY2 A;  1U35 C;  1SDE A;  4OQG A;  2IOU A;  3OPL A;  1P3B D;  3ISG A;  1H5X A;  3AL0 C;  2HUE C;  5CEC A;  4ZBE A;  2XDM A;  3F6T A;  3MVD D;  1NJ4 A;  2F2A C;  3B0B A;  4KG5 A;  3G2Z A;  3MBZ A;  1FCM A;  4JXS A;  1HQ3 D;  4YS3 B;  3Q1F A;  5B1M B;  5CTN A;  3B6G A;  4R0Q A;  4Z2M G;  3WA9 C;  1T3U A;  2ZC5 B;  5DNM D;  1PWG A;  3WTP C;  1KGF A;  2EX6 A;  5B2I D;  3NC8 A;  3WRZ A;  1S0W A;  5BS7 C;  4H9S C;  3AZG C;  3WKJ D;  4FCF A;  1ID3 B;  3HSH A;  1KGG A;  3X1S C;  1ES5 A;  4G92 B;  1CK3 A;  4YM6 B;  1BSG A;  3B6F D;  3VFH A;  4DRT A;  4F94 A;  4OJO A;  1F66 B;  1YQS A;  2V2F F;  4XUJ B;  1P3O C;  3AV2 C;  1ULY A;  1EI5 A;  3UTB B;  2X02 A;  1TDL A;  5B0Z D;  5EUA A;  4DE1 A;  1TZY C;  2XF3 A;  5BNX B;  3VH6 T;  4S2M A;  3P5J B;  3LZ0 A;  1P3F C;  4H9P B;  1NY0 A;  5GT0 D;  5DTT A;  1K38 A;  1RGZ A;  3ZG9 B;  4AWL B;  1P34 C;  5B32 A;  3MZF A;  3NDG A;  3W99 A;  5B0Y B;  4GKU A;  4IED A;  5F83 A;  5HAR A;  4Z5T C;  3PAG A;  5DTK A;  3W98 B;  3AZH C;  5FQJ A;  1J9M A;  1GCE A;  4JJN A;  3MGP C;  4IBX A;  5GT3 C;  5CPJ D;  5DNN A;  1EQZ D;  1FR6 A;  3REJ B;  3VH6 A;  5BT1 C;  3CG5 A;  4WEJ A;  3LZ1 C;  1KX3 B;  3KWQ C;  5B1M C;  1YLW A;  5AVC A;  4KEN B;  2JC7 A;  2ZC3 B;  4XZQ B;  3IWQ A;  2H0Y A;  2XH9 A;  1KX5 B;  2Y4A A;  3DTM A;  4J8U B;  1K57 C;  4JXG A;  5CPI B;  4OJ6 A;  3ITB A;  1JFI A;  2G5H C;  4E3O A;  1KVL A;  5J8X A;  1ID3 C;  1K25 A;  3REH C;  2JCH A;  5FI6 A;  4E3K A;  4GOG A;  4G92 C;  1P3L C;  1PI4 A;  1YUE A;  1FR1 A;  3A1K A;  1F66 C;  5TFQ A;  5B1L A;  3O62 A;  4E45 A;  5B2J C;  3REL C;  5E5A A;  3WA9 D;  5TGF A;  4X69 A;  3L26 A;  4BD1 A;  1PWD A;  2ZQA A;  1K4E A;  4UA6 A;  3V50 A;  4M3K A;  1PYY A;  1P3I C;  5AQA A;  3X1S D;  2X01 A;  3RXW A;  3AZM D;  4AWL C;  2ZC6 B;  5FUG A;  5KMW A;  2NQB A;  4P87 A;  2YFW A;  4QLC B;  4KZ4 A;  5BOH A;  3W98 C;  1P3M C;  3E2L A;  2W8S A;  3UE1 A;  3BYD A;  4IJE A;  1DY6 A;  4QHC A;  2EX2 A;  5AV6 A;  3AV2 D;  5CPK A;  3VOZ A;  3X1U B;  3B0C W;  2WKE A;  2Y2L A;  3X1T A;  4EV4 A;  4EBL A;  3IWO A;  2Y91 A;  2F8N A;  5I94 A;  1AXB A;  3C1C A;  2XD1 A;  2JSS A;  3WAA B;  3C1B B;  1M1A B;  3BLS A;  3PBN A;  3AZF B;  1BUE A;  3MKE A;  4XZQ C;  5GSU C;  5B31 G;  3ZVT A;  3FKW A;  3AZI A;  4WEK A;  2CV5 A;  2PYO B;  3WS4 A;  1ZC2 A;  4WNN B;  3QNC A;  2WKH A;  5E2G A;  3MGP D;  2A3U A;  4KUD C;  2R9W A;  2HDR A;  2CWE A;  3REK A;  4YS3 D;  5EVI B;  4EQI A;  3L25 A;  5B1M D;  3MZE A;  4WU8 C;  3N6I A;  1MKI A;  1IYQ A;  2ZM8 A;  1FOF A;  4BL3 A;  4J8V C;  4OJL A;  3HLB A;  5HL1 A;  2WGV A;  3N7W A;  1BUL A;  5B32 G;  5AV5 B;  3NI9 A;  3JYI A;  4GB7 A;  2V1Z A;  1ID3 D;  3UN7 A;  3KFU G;  1YT4 A;  5GXQ A;  3ZG0 A;  3N8R A;  4MNR A;  1U60 A;  1HVB A;  4Y7P A;  3HVF A;  3KUY C;  1IYP A;  5F1G A;  1P3L D;  1BTL A;  4EUZ A;  4HGA B;  2Y59 A;  1F66 D;  3MGQ B;  3KS8 A;  1TVF A;  3GQZ A;  2Z2L B;  1LI9 A;  1WYB A;  3LEL B;  3G34 A;  5FQI A;  1K56 A;  4H9Q B;  1P3I D;  1W8Q A;  4EWF A;  3W96 C;  3WAA C;  2FJ7 A;  4B4X A;  1Q2Q A;  1MPL A;  5JRG A;  4WYY A;  5B0Y D;  3PBT A;  2CC1 A;  3AN2 A;  5HAQ A;  3W98 D;  2HIO A;  1AOI C;  2PYO C;  4QB8 A;  2J8P A;  3AZL A;  2QPN A;  3H0R C;  1KX3 D;  3A6N A;  2ZY3 A;  3EPK A;  5EOO A;  4WEL A;  2ARO A;  4DE2 A;  5CXW A;  4UHU A;  4XZQ D;  4IVI A;  1KX5 D;  3B6G B;  4J8U D;  3UTA B;  4NZ4 A;  2EX8 A;  3ZNT A;  3A3J A;  1I5Q A;  3WX7 A;  1E3U A;  2P9V A;  2NZD C;  3NCK A;  1JWP A;  4KUD D;  1YLP A;  3C7U A;  5CGW A;  3MNN A;  1YU0 A;  1FQG A;  5FAQ A;  1BFM A;  1P3G C;  4HGA C;  4WU8 D;  3I7J A;  4KZ5 A;  4WJ3 C;  2FFF B;  1JTG A;  3TU4 A;  4EO5 B;  2F8N G;  1R4V A;  3R45 A;  1N1J A;  4X23 A;  1DJA A;  1BH9 A;  5AVB A;  4O7D A;  1MWT A;  3LEL C;  5B40 C;  3AYW A;  2P74 A;  3AZE A;  2H10 A;  1BT5 A;  1ZLA A;  1XX2 A;  3IHA A;  2EFU A;  3LZ0 B;  3SOI A;  3KUY D;  3HLC A;  2C5W B;  1P3B C;  4ZUX A;  2ZQD A;  4WBG A;  5GLA A;  3A3F A;  1P3A A;  5B32 B;  1S32 A;  4LD9 C;  3ZHH A;  4H8R A;  1PIO A;  3W99 B;  4MBH A;  4KQO A;  2Q9N A;  3X1U D;  2VGJ A;  1HQ3 C;  1B67 A;  4OPY A;  1FCO A;  4JJN B;  2L5A A;  4IBB A;  1SKF A;  3WAA D;  4WV4 B;  5DNM C;  5DNN B;  4J8W A;  1YU1 A;  3C1B D;  4CJN A;  4J8X C;  3L2A A;  1H8Y A;  3G32 A;  5B2I C;  1M19 A;  4OVD A;  1K55 C;  3WKJ C;  3UTA C;  5AVC B;  1AOI D;  3AV1 A;  2PYO D;  4KGC A;  4X6T A;  4LCM A;  4OJP A;  4NK3 A;  4IBD A;  1GA0 A;  3W97 A;  3Q07 A;  4DRB A;  1P3P C;  3B6F C;  4WU9 A;  4LV1 A;  3X1V C;  5EVI D;  2H0T A;  2HP6 A;  3WS0 A;  4Z66 A;  5B31 C;  3FV7 A;  2PBY A;  3MGR A;  4ZBJ C;  3ZG5 A;  5B1L B;  3O62 B;  2IWD A;  3OPR A;  1L0G A;  4M6B A;  4GZB A;  5AV5 D;  4NET A;  4JPM A;  2HDU A;  3EG5 B;  3IXB A;  1GHM A;  3G31 A;  5FA7 A;  3IXH A;  4IBK A;  3V39 A;  3LZ0 C;  2WAF A;  1MY8 A;  2ZLY A;  5E2E A;  1ERQ A;  2HP9 A;  5GHY A;  3PBS A;  3MGQ D;  3KXB A;  4IBF A;  4S2N A;  3V3S A;  3W99 C;  3W4P A;  5FUG B;  5L2F A;  5GLB A;  4R8P A;  2VQR A;  4GD8 A;  4OJ5 A;  4X55 A;  2YFW B;  5CPJ C;  3LEL D;  1K4F A;  3PAE A;  4DF6 A;  3IF6 A;  5AV6 B;  1L2S A;  5CPK B;  1XXM A;  1ONG A;  3UE3 A;  1ERM A;  3X1T B;  3AZK A;  2F8N B;  4K91 A;  2UWX A;  4DE3 A;  3C1C B;  4DDS A;  3Q7Z A;  4OPQ A;  5U47 A;  4DXC A;  3UT9 A;  4LD9 D;  5AY8 C;  5IHV A;  4P0M A;  5JA4 A;  3AZI B;  2WZZ A;  1PWC A;  4G91 B;  3MVD A;  3V9R A;  2CV5 B;  4S2K A;  1M18 A;  3S4X A;  4OLG A;  4KQQ A;  3S22 A;  1CEG A;  3REK B;  4KZ7 A;  4J8X D;  3AZJ A;  3SS3 A;  3B6G D;  3UTA D;  1QME A;  4OP8 A;  5C3I B;  5KDM A;  5AV9 C;  5CP6 A;  1NRF A;  3IT9 A;  1LLB A;  1BZA A;  3WS5 A;  1YLT A;  2WAE A;  3AZM C;  5E2F A;  4LG2 A;  1P3P D;  3X1V D;  3LJA C;  2LY8 A;  1TAF A;  5B31 D;  5GXQ B;  5BNV A;  2WYX A;  1SHV A;  4UPK A;  4KZ9 A;  2V20 A;  1W2E A;  4WMC D;  4KHA A;  4PPR A;  5B0Z A;  1KX4 A;  5AV6 C;  4JXV A;  3LEZ A;  3G4P A;  3HBR A;  5F99 A;  4WZ5 A;  5GT0 A;  5B24 A;  3LZ0 D;  1WWS A;  3UE0 A;  3IXG A;  2XR0 A;  3AFA A;  3ZVW A;  3IHB A;  3IWI A;  4N92 A;  4Y0O A;  4PM5 A;  2FJ7 B;  5TR7 A;  3AZN A;  3MFD A;  5B32 D;  3W99 D;  5A90 A;  1KE3 A;  5EEC A;  5B33 A;  4QY6 A;  3AN2 B;  2HIO B;  4GDN A;  2XLN A;  2CV5 C;  4YS3 C;  5A91 A;  4E3N A;  3MGS A;  1EQZ A;  1LL5 A;  3P98 A;  4JJN D;  3AZL B;  2WZX A;  1YU4 A;  4E3I A;  3REI A;  3UPN A;  5DNN D;  1HZO A;  3REK C;  4KZA A;  1U35 A;  3Q7V A;  2ZQC A;  3ZCZ A;  1C3B A;  2EXA A;  4C3Q A;  4IJF A;  4GNU A;  5AY8 D;  1IEL A;  1Z2C B;  3O3V A;  3N3F A;  4YM6 C;  3BRM A;  1I2S A;  3UDX A;  4NE3 A;  5GLD A;  5JYO A;  2P9V B;  1OME A;  3Q82 A;  3MNN B;  5GXQ C;  4XUJ C;  3WA9 A;  3UTB C;  1H8Z A;  1N9B A;  1Z6F A;  3WTP A;  3VOY A;  4QY5 A;  3O62 D;  2WK0 A;  2H5S A;  4FH2 A;  2Y2O A;  3TU4 B;  5AV9 D;  3R45 B;  1N1J B;  4X23 B;  3HLG A;  3PBR A;  2OLU A;  1BH9 B;  5BS7 A;  4H9S A;  3AZG A;  3M2K A;  5AVB B;  4N1H A;  2R9X A;  2G5I C;  3AYW B;  1RCJ A;  5FSR A;  3X1S A;  4IBG A;  1K54 C;  3AZE B;  1GA9 A;  5B0Y C;  3H0L C;  3KSY A;  3LJA D;  1ZLA B;  1VM1 A;  4GN2 A;  2FJ7 C;  4UUZ A;  5E2H A;  4CSR A;  3VP3 A;  1MXO A;  2DNS A;  1O7E A;  4ZTK A;  2BYM A;  3LY4 A;  3B0D B;  4ZUX B;  1P3O A;  1P3A B;  3REJ C;  1S32 B;  1TZY A;  5AV6 D;  3UNW A;  1KX3 C;  1HTA A;  4FSF A;  1P3F A;  1XKZ A;  3X1T D;  4HES A;  2F8N D;  1KX5 C;  1P34 A;  4DKI A;  3C1C D;  4J8U C;  3HRE A;  5CER A;  5CPI C;  4GHL A;  4S2L A;  4J8W B;  2J9P A;  4KG6 A;  4QJG A;  4Z5T A;  1ZG4 A;  1BLC A;  2ZY2 A;  3AZH A;  1M19 B;  4Z2M H;  3A3E A;  5A92 A;  3V3R A;  3AZI D;  2JBF A;  3MGP A;  3AV1 B;  2CV5 D;  5GT3 A;  4KGC B;  1FSW A;  2Y2K A;  3W97 B;  3LZ1 A;  3W8K A;  3KWQ A;  3OPH A;  3REK D;  4WU9 B;  3TG9 A;  5B1M A;  4RYE A;  1N4O A;  3EPL A;  3MGR B;  1KDW A;  1K57 A;  5AQB A;  4OH0 A;  1PW1 A;  4Z9Q A;  4YM6 D;  1BLS A;  4HBT A;  1JWZ A;  2A49 A;  3N8S A;  3REH A;  2ZY4 A;  4UA9 A;  1ZKJ A;  1ZLA C;  4QLC C;  3DWZ A;  1P3L A;  3M6B A;  5GXQ D;  4XUJ D;  4PM7 A;  3VP1 A;  2OSU A;  1M6K A;  5B2J A;  3REL A;  3X1U C;  3UTB D;  4E6W A;  3B0D C;  5GLC A;  3KXB B;  1P3A C;  3AGF A;  3IXD A;  4R8P B;  4CAY A;  1P3I A;  3BEB A;  3VMA A;  4H9P A;  5F82 A;  1P3K B;  3C1B C;  1M1A C;  1K56 D;  3AZF C;  3IF6 B;  1O07 A;  4OQI A;  2OV5 A;  1IKI A;  4FD8 A;  1FSY A;  3BFD A;  3OCL A;  2WGI A;  4OOL A;  2FJ7 D;  4GHA A;  4J8W C;  3AZK B;  1PW8 A;  2J9O A;  4H9N A;  3HON A;  1P3M A;  2OLV A;  1BLP A;  3AN2 D;  3C5A A;  2HIO D;  3UT9 B;  4JF4 A;  3REJ D;  4IBJ A;  5EVI C;  3IQA A;  3OCN A;  4OPR A;  5JA4 B;  1XGI A;  5FAS A;  3V9R B;  2Y2P A;  1K6S A;  1M18 B;  3VH5 W;  4KG2 A;  4EBN A;  3OC2 A;  2QZ6 A;  5CPI D;  1NYY A;  4E44 A;  4XZQ A;  5AV5 C;  2XK1 A;  3MGR C;  2XFS A;  1YU2 A;  1E25 A;  1CEF A;  2HPB A;  4HBU A;  5GSU A;  4BD0 A;  2YFV A;  5DF9 A;  3AZJ B;  4Y0U A;  1YLY A;  1W5D A;  4X56 A;  2Y2N A;  1S6R A;  3NQU A;  3LO7 A;  4KUD A;  5KDM B;  5CP6 B;  2DRW A;  3UY6 A;  1E3U D;  4DRA A;  4QD4 A;  3MGQ C;  2ZQ9 A;  1E4D A;  1PZO A;  4K0X A;  4WU8 A;  1JWV A;  4OKP A;  4U0X A;  4U3T A;  2RVQ C;  3SH7 A;  1KE4 A;  5CHM A;  4J8V A;  1TAF B;  1B6W A;  5BNV B;  5GL9 A;  3VSK A;  4S2N C;  5M1A A;  4FH4 A;  3CZD A;  4X23 D;  4R3J A;  3NDE A;  1IYO A;  3DW0 A;  5AVB D;  1Q2P A;  4KHA B;  1P3K C;  3AYW D;  3A1I A;  1KX4 B;  3AZE D;  2RCX A;  1PI5 A;  1ZLA D;  3KUY A;  4QLC D;  5F99 B;  5FAO A;  5GT0 B;  5B24 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...