2Y2OA

Penicillin-binding protein 1b (pbp-1b) in complex with an alkyl boronate (eo9)
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
489
structure length
471
Chain Sequence
ISEITYSDGTVIASISRDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTGQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PENICILLIN-BINDING PROTEIN 1B
publication title Structure-Guided Design of Cell Wall Biosynthesis Inhibitors that Overcome Beta-Lactam Resistance in Staphylococcus Aureus (Mrsa).
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
total genus 165
structure length 471
sequence length 489
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2y2oA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2y2oA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2y2oA02
1MBLA 3C7VA 3BRMA 4JXSA 1BULA 3ISGA 1G68A 3BLSA 2XR0A 1SDEA 3N8RA 2Y2LA 1WYCA 4BL3A 3AGFA 4DKIA 5EVIA 2ZM0A 1ESIA 1YLYA 4U0XA 5KMWA 1ZG6A 3N8LA 5CHJA 5DF7A 4DDSA 2JCHA 1ERQA 2Y2KA 2DNSA 2EX2A 2H0TA 2ZQDA 2ZC3B 3A3IA 4GD6A 1YLTA 3HLCA 5EECA 4GDNA 2EX9A 2J7VA 4GN2A 3VMAA 2WZXA 4JLFA 3SH8A 2Y2PA 1IELA 1PI4A 1MY8A 4MBHA 4U0TA 4MNRA 4ZJ3A 4S2NA 3Q7ZA 4LV3A 3UE0A 5EVID 4EWFA 1LI0A 1DJBA 2X02A 5GLDA 4UA7A 3G4PA 1JWVA 2HDSA 1PZPA 4Y0OA 3UPPA 1HTZA 4C3QA 1YLZA 3Q81A 2DCFA 1PW8A 5D3OA 3W4OA 4PM9A 3GTCA 3CJMA 4DXBA 4S2LA 1KVLA 4KQOA 4GKUA 3VSKA 4FCFA 4WEJA 5EOOA 1HZOA 1SCWA 3A3JA 1SDNA 1K6SA 1LI9A 3G2YA 1XGJA 1NRFA 2Y2JA 2I72A 5FAQA 3S4XA 3LY4A 5IHVA 3V3SA 5EUAA 3JYIA 2HP6A 2HDRA 2ZC7A 3LO7A 5HFOA 4ZJ1A 1I2SA 3W8KA 5I94A 1YMXA 3NIAA 3PAGA 1DY6A 1NZUA 3WRTA 4WZ5C 1ZC2A 3IWIA 1L0DA 2J9OA 2J9PA 3BFGA 4WBGA 1YLPA 3NDGA 1XXMA 3BLMA 3WRZA 3HREA 4KZ5A 3S1YA 2EXBA 4FSFA 1NJ4A 1BLSA 1LLBA 4EQIA 3B3XA 4JBFA 1HVBA 3Q07A 4P6BA 4YINA 3UE1A 4QJGA 3N8SA 2ZC6B 5GLBA 3RXXA 1KE3A 2ZLYA 2ZJ9A 4R0QA 3G2ZA 4WEKA 3DWKA 5EVIC 1E4DA 5FQIA 1K57A 1NXYA 2X71A 3M6BA 3SS3A 4N9LA 3ZVTA 3V39A 3EQUA 3BFDA 4OKPA 3G30A 1BT5A 2HDQA 4KQQA 5E2GA 3NC8A 2OLUA 2FFFB 3UDXA 1SKFA 2WKHA 4KZAA 4XUZA 4GB7A 4EBPA 1AXBA 3IQAA 1PIOA 2XK1A 4S2MA 3ZFZA 4DXCA 1KE4A 4N92A 4S2NC 4IBRA 4KG6A 1Q2PA 4EUZA 1RP5A 2H10A 3NDEA 3GSGA 4GNUA 4PMAA 1BSGA 1ONHA 1L0GA 5E43A 1GHIA 2ZC5B 4S2OA 5CECA 4ID4A 1KDSA 2ZQAA 3ZG8B 1K38A 3WS5A 3HLBA 4OLGA 3N7WA 1XA1A 4BD1A 3MXSA 1YT4A 2XFTA 5G18A 1Z6FA 2Q9MA 4PM8A 4S2KA 2WGWA 4QD4A 2PU2A 4KENB 3HLEA 1OMEA 1BUEA 4BL2A 1HD8A 5FQJA 1K25A 1MWRA 5DTSA 5GLCA 4OVDA 4R3JA 1NYMA 2ZQCA 3MBZA 5CRFA 4CPKA 4JF4A 4IVIA 3UPOA 3G35A 4ZAMA 2JBFA 4E3JA 4WELA 4JXVA 1PZOA 1BLPA 3GMWA 4S2IA 3ZHHA 4OPRA 5FDHA 5A92A 3WS0A 2V2FF 2A49A 4FH2A 3ZG9B 5KSHA 4X69A 5DVAA 2WKEA 4HBTA 2Y2GA 2XDMA 1PYYA 4X6TA 3VP3A 4HBUA 3MKEA 3MZDA 3MZEA 3IXDA 4JXWA 2XQZA 3UN7A 5CHUA 1XP4A 3QNCA 3BM6A 1K57C 2Y2QA 1ES5A 1JWZA 3OC2A 3OPRA 1NYYA 4EBLA 5FI2A 1K54A 1H5XA 3UE3A 1MWSA 5HAPA 5GL9A 1ES3A 3PAEA 5CHMA 1YLWA 2XGNA 4C75A 4WMCA 5HL1A 1YQSA 4IBXA 3C4PA 4DDYA 4LENA 1ALQA 1GHMA 3ZNYA 4Y0TA 4OOMA 3TOIA 4N1XA 4OP8A 5EE8A 4P85A 4RX3A 4OOLA 2P74A 4HEFA 5FQMA 1KVMA 1MKIA 1ONGA 2ZD8A 4R3BA 3HBRA 3C7UA 5FQ9A 5JYPA 1XKZA 5FSRA 2JC7A 1I2WA 4A5RA 5CTNA 4WYYA 4B4ZA 3VFHA 3VP4A 5GHZA 2EFUA 3HLGA 4CJNA 4WMCD 3TSGA 4KZ7A 3MFDA 3V3RA 5CEBA 1GCEA 4C6YA 1KGGA 1LHYA 2G2UA 3N6IA 4MLLA 4OQIA 1TVFA 3GRJA 3ZDJA 4S2PA 4OQHA 3O86A 4LCMA 4OQGA 4ZBEA 2XLNA 1ES2A 3BYDA 3MKFA 2RCXA 4MBFA 1W5DA 5EPHA 2R9XA 4K0XA 2ZQ8A 2XEPA 4OONA 3HLWA 3O3VA 5CGSA 3UPNA 4BD0A 1O07A 3BFCA 5GHXA 1BLHA 3ZG0A 4D2OA 5FAOA 4P0MA 3BFEA 2WGIA 3IF6A 3HUOA 3IXGA 3PBQA 4R1GA 2DRWA 1JWPA 1W8YA 3OZHA 4UA9A 1E3UA 3HLFA 4X55A 5AQ7A 3TG9A 2P9VB 1E25A 3Q7VB 4P87A 5CGXA 2WKIA 3I7JA 1IYPA 4OLDA 3A3FA 4DF6A 5JYOA 1RGYA 2EX8A 4Y0UA 1EI5A 2HDUA 4LCLA 3O87A 4U3TA 3M2KA 4PM6A 1K54C 1CK3A 3NI9A 5CGWA 3O88A 4IVKA 5EVIB 4JKTA 4R23A 1E3UD 3HUNA 5AQAA 1K6RA 4DE3A 1FR6A 2JE5A 2XD5A 5FI6A 3VP2A 4E3IA 4GZBA 4PPRA 3IHBA 4KZ8A 2X01A 4JXGA 4BQMA 1M40A 1M6KA 1YLJA 3ZCZA 4KZ9A 4H8RA 2Y2HA 1GA9A 3BEBA 3CMZA 4UHUA 4E6XA 1K4FA 5M1AA 3FZCA 3C5AA 5J8XA 2ZMAA 4LV0A 2WUQA 2XF3A 3VFFA 5AQ9A 3V5MA 4QY6A 5F1FA 1ESUA 4PM5A 4FH4A 1FCOA 5F83A 1S0WA 3MXRA 4BENA 2HP5A 3GQZA 4GD8A 5FATA 1BLCA 3HLDA 3SS4A 2Y4AA 2ZQ7A 1CEGA 2Z2LB 5A91A 2WZZA 5F1GA 5FA7A 3UDFA 1H8YA 5BOHA 1C3BA 2H5SA 1MWUA 5FQKA 4X53A 1IYSA 2WAEA 4RYEA 1WE4A 2XD1A 1H8ZA 1FSWA 2PU4A 2BG1A 2Y2OA 2VGKA 4DE0A 4HESA 4KZ4A 4WZ4A 4GOGA 1O7EA 3AGEA 5U47A 4KZBA 1NZOA 1IKIA 2Y2NA 4RA7A 5CXWA 4ZDXA 3FKWA 3IF6C 4KG2A 5HAIA 4M3KA 5GHYA 4FD8A 1W7FA 1FSYA 3OCNA 3P98A 1BTLA 4K91A 4B4XA 4X68A 3OPHA 5HAQA 3LCEA 5E2FA 2Y2IA 4OPYA 3IH9A 3UNWA 1J9MA 1U60A 4JPMA 4Z9QA 5DF9A 5DTTA 3IT9A 5HX9A 1IYOA 2UWXA 3HL9A 3A3DA 3NY4A 1ES4A 3PBSA 5HW3A 2VGJA 4LV2A 1S6RA 3VP1A 2EXAA 1MXOA 3ZGAB 2CC1A 3IF6B 1SHVA 2E8IA 3HUMA 5FI7A 2J8YA 1ERMA 4X56A 3ZVWA 1NY0A 3Q1FA 2BLSA 5TR7A 5CERA 5HARA 1FCMA 4E3NA 3VOYA 3GR2A 1PW1A 4RX2A 4F94A 1PWGA 2Z2MB 5EVLA 3IWQA 4E6WA 3C4OA 2C5WB 4GDBA 3IXHA 3UY6A 1VQQA 3ITAA 3VP0A 2XFSA 1Y54A 2WGVA 5FQQA 1G6AA 4EBNA 2Q9NA 1PWDA 5CEDA 1IKGA 1W8QA 1EWZA 3NBLA 3BFFA 3G32A 3IF5A 1FQGA 3SH7A 1JVJA 3V50A 4R4RA 5KSCA 4WM9A 2GDNA 1W79A 2PBYA 2WYXA 1DJAA 1Q2QA 2QZ6A 2Y55A 5CTMA 2R9WA 1DJCA 3HVFA 3IHAA 4DE2A 1I5QA 1JTDA 2Y91A 3IXBA 3OPPA 4IEDA 1VM1A 1FCNA 4L0LA 1KGFA 5E2EA 2Y59A 5DF8A 3S22A 1L2SA 3PBTA 1KE0A 1YM1A 4LV1A 3UO9A 3Q82A 2C6WB 1FR1A 4OP5A 4N9KA 2WGWB 3IH8A 5TGFA 1ZG4A 4QB8A 3AGDA 4JF5A 4UAAA 4YFMA 3ZNTA 1JTGA 2HPBA 1GA0A 3G34A 3QHYA 5A90A 1KGEA 1K55A 3GV9A 1TDGA 4BLMA 1K4EA 1TDLA 2ZM2A 5FAPA 3E2LA 3PBNA 3PBRA 4E3KA 1K56A 2A3UA 5EOEA 3OPLA 4NETA 4KZ3A 1L0FA 1IEMA 2V1ZA 5KZHA 5TFQA 3UDIA 1N4OA 1GHPA 1PI5A 1YMSA 1N9BA 2EX6A 4XXRA 4XUXA 1IYQA 1LL5A 4MEZA 4DRTA 4K0WA 3E2KA 4Q8IA 2H0YA 2OSUA 1EROA 3OCLA 1ZKJA 3LEZA 4OPZA 5GLAA 3WS1A 3FYZA 4NK3A 4QY5A 1K56D 4MBKA 3FWLA 3D4FA 4KG5A 3N4IA 4S2JA 5DTKA 5FASA 3M6HA 5F82A 1XX2A 2ZM8A 1LL9A 2WAFA 4E3OA 4KQRA 4O7DA 4ZTKA 3DTMA 4QU3A 3VOZA 1L0EA 3QNBA 4QHCA 2FFYA 3A3EA 3DWZA 1RGZA 3P09A 1CEFA 4R4SA 3G31A 2QMIA 3W4PA 1PWCA 4OOYA 2IWCA 4E3MA 5E2HA 1CI8A 3W4QA 2IWDA 4DE1A 3LY3A 3WWXA 2Y2MA 3FKVA 3SOIA 2RL3A 1FOFA 3ZG7B 2WK0A 2ZQ9A 3GVBA 3SS5A 2ZC4B 2QPNA 1XA7A 3DW0A 1MPLA 1TEMA 2EFXA 5A93A 1CI9A 3WS4A 3WS2A 3SH9A 2HP9A 1MWTA 3IWOA 1QMFA 4KZ6A 4RVAA 4Y7PA 3BECA 3MZFA 3EQVA 4N1HA 4BJPA 1WYBA 3ITBA 2XH9A 4OQ0A 3M2JA 4OH0A 2V20A 1XPBA 4EV4A 1QMEA 4JF6A 1KDWA 1BZAA 4ZJ2A 1K55C 2OLVA 3CZDA 3FV7A 4E3LA 3VSLA 4UA6A 5M18A 4WZ5A 2B5RA 5L2FA 3NCKA 2P9VA 3Q7VA 4OPQA 5AQBA 3PTEA 5M19A 3RJUA 3PBOA 1RCJA 2G2WA 3ZG5A 3RXWA 2IWBA 2WADA 3CG5A 2OV5A 1XGIA 4PM7A 4B88A
chains in the Genus database with same CATH superfamily
4Z2LA 3AZJB 1M19A 5AV8B 4NXGA 3L27A 3N8RA 1SDEA 3REHA 4BL3A 4J8VA 2ZM0A 1ESIA 5F5YA 1P3GA 2Y2KA 2H0TA 1U35C 3MQOA 2ZL1B 2RVQD 5EECA 3REIC 5E5AB 3AFAB 3C1CD 1EAKA 2WZXA 3SH8A 3KS4A 4XZQC 4ZJ3A 4S2NA 3NJAA 4LV3A 3UE0A 5EVID 3IX3A 4G3KA 3CLOA 2CV5A 1DJBA 2X02A 1S32B 4BWIA 4X25A 4Y0OA 1PZPA 3B6GA 1E15A 1P3BD 3UPPA 1P3FD 1YLZA 3Q81A 4F3LB 5D3OA 3BWLA 1PZRA 3TW8A 3VSKA 4WEJA 3IS2A 2PT7A 4LRXC 3A3JA 3EEAA 3KUYD 1W63M 1XJ2A 3G2YA 4EEPA 3AZEA 3NOPC 1NRFA 4IJEA 1KX4A 1F98A 4CAYA 4YS3A 1M18D 5I94A 3W8KA 5GT0B 1DY6A 1NZUA 3WRTA 2J9PA 1H0IA 3BFGA 4MDZA 3NDGA 3KSYA 2VZWA 1XXMA 2XRNA 3BLMA 4NG2A 1DP6A 1NJ4A 4ETXA 2RVQC 3B3XA 3Q07A 4YINA 3C1CC 3UE1A 4QJGA 3N8SA 5GLBA 3OOVA 2W3DA 4R0QA 5EVIC 4HGAB 1NXYA 3M6BA 3V39A 5AV6A 4OKPA 4Z66B 1P3FC 5E2GA 2OLUA 1HLUP 4KGCD 2V0UA 2Z6DA 3MGQB 1SKFA 2WKHA 5B33A 3FDDA 4S2MA 3KUYC 4DXCA 1KE4A 3SW1A 4IBRA 1P3OA 1P3IA 2H10A 2JKGA 5BO0B 1P3GB 3WAAD 1ONHA 3NOUC 5J7EA 5E43A 2ZC5B 4S2OA 1M18C 1V9ZA 3LGOA 4ID4A 1KDSA 2ZQAA 1XA1A 1YT4A 2Z6CA 3E0YA 5G18A 4PM8A 4EXOA 2PU2A 4KENB 3AZHD 1S1YA 3WTPE 1IFQA 1K25A 5CPJB 3B6GB 4JJNA 1P3MD 3MBZA 3X1UD 5CRFA 4CPKA 4IVIA 3E4QA 1B67A 4WELA 3IS2B 3GMWA 4XUJA 2YFVB 4OJLA 2F8NK 5A92A 5B2IA 4H9OB 2A49A 5F99D 4KGCC 1KX4B 4CAYB 3KXBA 3HONA 4YS3B 2VEAA 5DVAA 5B0ZA 3A6ND 3ZQ5A 2W27A 4DRAA 3WD3A 3MZDA 4WL9A 3IXDA 5BNVA 1CF0A 4JXWA 1G28A 1XP4A 3QNCA 1K57C 2Y2QA 1S1ZA 1P3KB 5GL9A 4CSRB 4ZUXA 1CXWA 1YQSA 4IBXA 4OUIA 4OOMA 3TU4A 3VOLA 4N1XA 4UUZA 3AZHC 4RX3A 4OJPA 3VV4A 5DFYA 2P74A 5AV6B 3E4PA 3RH8B 3UT9D 1MKIA 3MVDA 1ONGA 1P3MC 3C7UA 5FQ9A 2ZY4A 3X1UC 4YNRA 1PNEA 3F1OA 4NZ1A 1I2WA 5L10A 5CTNA 2AROD 5B33B 3VP4A 2BYKA 4CJNA 2OAP1 1YSQA 2KDKA 1P3AA 5F99C 1P3IB 1ID3D 1AOIB 1N9OA 3GRJA 3LICA 4S2PA 5FEGA 3LELD 3A6NC 2RTSA 4NE3A 3LR4A 3MKFA 5EPHA 2ZQ8A 1TS8A 1DP9A 1O07A 1DRMA 5GHXA 5IU1A 4D2OA 2HJ9C 5FAOA 4Y3IA 2G5HC 3LJAA 3HUOA 4R1GA 2Y8HA 2DRWA 4UA9A 2NQBD 3TJZC 2P9VB 1E25A 2JKFA 1ZLAA 1IYPA 2D49A 5CP6B 1TD5A 2JKTI 3A3FA 2GZAA 5JYOA 1W2EA 4XUJB 1KX5A 4DQYB 3UT9C 3LIDA 1EI5A 2HDUA 5B2IB 4LCLA 3O87A 4U3TA 4PM6A 1K54C 3K3DA 1TZYD 3NI9A 2AROC 5B0ZB 5CGWA 3O88A 3AZJD 3X1SA 3G6OA 3KYQA 3LI9A 1ID3C 4BQMA 3LELC 4J8XD 2JN7A 4KZ9A 2NZDA 1GA9A 4UHUA 5FUGA 3FZCA 4DRBA 3FC7A 3VFFA 5HPFA 1P9RA 4KUDA 2VKSA 1ESUA 1S0WA 3AFAD 2P08A 3AYWB 2J3WA 4UUZB 5FATA 5A8BA 2ZQ7A 2PYOA 3F1NA 1ULYA 1H8YA 3MVDB 3B6FA 2H5SA 1MWUA 2NQBC 5J4EA 2WAEA 1A0KA 4RYEA 2XD1A 2BYKB 2PU4A 2VGKA 3AZNA 3MGSA 4KZ4A 3B0DC 1P3AB 3AGEA 1F1EA 1TZYC 2UV0E 3LZ0A 2A24B 2YFWA 5B1LA 4FOFA 1W7FA 3AZJC 3P98A 5IS1A 3EEHA 4K91A 4B4XA 1Z09A 5E2FA 3HSHA 4OPYA 1J9MA 1U60A 1TAFB 3EPHA 5B31G 5DTTA 1NLZA 5HW3A 1ES4A 4J8XC 3AZMB 1TF1A 3LIFA 2QYBA 2CC1A 4NZ4A 5FI7A 1ERMA 5AJGA 3KO6A 3Q1FA 5TR7A 5HWWA 2NUTC 4E3NA 4G3VA 3AFAC 4R8PB 3KWQD 4F94A 3NQJA 1PWGA 2Z2MB 3IWQA 4NXFA 4GDBA 3WTPD 1P3BA 1VQQA 3IBJA 4NEED 1Y54A 3MQLA 1PWDA 4LRYC 2XROA 1D7EA 3S7QA 3G32A 3MGQD 3R7WA 3SH7A 3X1SB 1JVJA 3VH6W 2WKQA 1W79A 1DJAA 4PHTA 4J8WB 1I5QA 3BY9A 4IEDA 2J8PA 1FCNA 3T4TA 1KGFA 2Y59A 2NZDB 5EVEA 1KE0A 4LV1A 1XJ4A 3UO9A 1SKOB 2C6WB 3REKA 5B31B 5JRGB 4N9KA 4HH3A 1LT0A 1ZG4A 3AN2A 3AGDA 4JF5A 3MNNB 3KYZA 1LSXA 3G34A 3QHYA 1K55A 3B6FB 2ZM2A 3E2LA 5DNNA 5CPJD 2A3UA 5EM1A 3KWQC 2V1ZA 5KZHA 4H9RB 3CWFA 3AZNB 3F6TA 1N4OA 3WTPC 1GHPA 1CJFA 1PI5A 1YMSA 4XXRA 4HGAC 4BBUA 1LL5A 4MEZA 4DRTA 3LZ0B 3C1BA 3P7NA 3OCLA 4MN7A 4GS9A 4I3JA 5KDMB 4QPRA 5AVCA 3MGQC 4EO5B 3LI8A 5AVFA 2VA0A 3FWLA 4KG5A 3WAAA 1EQZB 5F82A 2GX5A 4HJ4A 4X23B 2BYMB 4O7DA 4ZTKA 3VOZA 4QU3A 1P3KD 3W97B 3NHQA 3H9WA 2F8NG 1KX3B 3G31A 5B40D 2YKFA 3NQJB 5B2JA 2FJ7B 2HUEB 5HWVA 3DAVA 4HH2A 2EWWA 4DE1A 5BNXA 3UTAB 4MB5A 1YUEA 4X1LA 5CPJC 2HIOB 1S4SA 2ZMFA 1TEMA 1CI9A 3WS2A 3REJA 2HP9A 3AV2B 3IWOA 4KZ6A 4RVAA 4Y7PA 4YWZA 2XH9A 4I3AA 4OQ0A 2V20A 4EV4A 4WNNA 4JF6A 1BH8B 3A1KA 4E3LA 3VSLA 1AOID 1JFIB 2DMWA 2B5RA 4WZ5A 3B0CT 3NCKA 3Q7VA 3RXWA 3FPVA 2OV5A 1XGIA 4CQHA 1UR8A 2F2AC 4PM7A 4AWLB 5B32D 3BRMA 1BULA 1P3KC 1BYWA 5EM0A 2O9BA 2F8NB 2XR0A 5DNNB 2Y2LA 4P6ZS 3AZFB 5B40C 1YLYA 1ZG6A 3T4LA 4PKYA 3N8LA 4DDSA 5CP6D 2DNSA 3A3IA 1H8PA 4DJ3A 1YLTA 3HLCA 4GDNA 3W98B 3QP4A 4GS9B 3O5YA 3VMAA 3T50A 1A7WA 1IELA 1PI4A 1MY8A 2VGLS 5AV5A 4MNRA 3Q7ZA 4EWFA 1OT9A 1LI0A 4IJFA 5KIZA 4UA7A 3MGPA 4C3QA 5GXQA 1AOIC 3GTCA 3CJMA 4S2LA 3LZ1A 5DJUA 3L29A 1K6SA 5B32C 2I72A 5FAQA 4PKYG 3E98A 3AYWD 1UGUA 3LY4A 3V3SA 3QP6A 4WU8A 5HFOA 4ZJ1A 3NIAA 3C30A 4LLOB 3IWIA 4MN5A 5CP6C 4LGWA 3S1YA 3P5JB 3VH6T 1HQ3A 4JBFA 2OWHA 5L09A 1T1CA 1KE3A 2ZJ9A 3VOYA 3SS3A 1L3LA 4E44A 2X71A 4GHIB 3W99A 3BFDA 5GSUA 1BT5A 3UTBB 2HDQA 4KUKA 3L26A 3AZMD 2PD8A 4CLCB 1JNUA 3S7NA 1PIOA 2XK1A 4KG6A 3HJIA 3B47A 1E6PA 1TS0A 4R8PD 3NDEA 3AYWC 4PMAA 3MGRD 4IBEA 4LG2A 2V1AA 4KUOA 4KHAA 1DP8A 3AZIB 3W96A 3ZG8B 1P0ZA 3X1TA 3HJKA 4UQIS 5AV5B 3CUEA 2IA2A 2WGWA 3DTIA 1OMEA 4BL2A 5DTSA 5LBRA 5GLCA 3T4QA 1NYMA 5DJTA 3RELA 4J8WD 1VHMA 4L9FA 4YOFA 2PDRA 3G35A 3A0VA 2K2NA 1BLPA 4S2IA 3KSFA 3VE4A 5B31D 3T1RA 5JRGD 1S67L 4FH2A 3ZG9B 1KS0A 4X69A 3AZMC 4H9SA 3MNND 2WKEA 4HBTA 4WU8B 4X1MA 4HNBA 4X6TA 4QLCB 4HOIA 4H9NA 2XQZA 5CHUA 4R8PC 3M7PA 1Y28A 5JA4A 3WKJB 3MGRC 4EQ1A 3T4OA 4IBKA 5HAPA 5AVBB 1BH9A 1B6WA 2XGNA 1W63Q 4WMCA 3PXPA 5HL1A 3CHWP 1GHMA 5L8MA 5I5LA 4Y0TA 3TOIA 4Z5TA 4OP8A 4IUKA 1H3OB 4H9PA 5B0YA 1EQZD 4J8WC 1YU2A 2JC7A 1ZTUA 2CMNA 3VFHA 2KLIA 4IBJA 3HLGA 5CPIA 3W97D 3TSGA 3O62A 5B31C 4WU9A 3CPTB 5JRGC 5HPIA 4C6YA 1KX3D 1KGGA 2FZ0A 3MNNC 2FJ7D 1TVFA 4LCMA 5CPKA 4KHAB 1ES2A 2RCXA 4MBFA 3UTAD 1W5DA 3A0SA 5CGSA 1E6RA 2HIOD 3HLWA 3UPNA 5F69A 1NWZA 3BFCA 2VQRA 3X1VA 3AV2D 3T1QB 2WGIA 1STZA 3PBQA 3WD2A 3AZKB 1E3UA 3TG9A 4NKPA 3H82B 2JKRI 3I7JA 4Y5FA 4DF6A 5HSQA 4Z2GA 4NE5A 4NZ5A 1EQZC 3L25A 1CK3A 1M19B 4X23C 1P3LD 3REHB 3LYXA 4GW9A 4J8VB 3W97C 4R23A 5AQAA 2F8ND 1K6RA 4EERA 1W1PA 5AV9A 3AZFD 1KX3C 1AWIA 3VP2A 2FJ7C 2X01A 1M40A 1F66D 1XJ6A 1LSWA 3CMZA 1K4FA 5M1AA 1BH9B 3UTAC 1PDCA 3N3FA 2HIOC 3R45A 5AQ9A 4UPKA 3W98D 4MB4A 3QP8A 3MXRA 2HP5A 3GQZA 4GD8A 2V5OA 2CV5B 4H9PB 3IP4C 5DNMA 3AV2C 4OJ5A 2Y4AA 3DTKA 4G92B 1CEGA 2Z2LB 1MZUA 2ZY2A 1C3BA 2PR6A 5FQKA 2QJ5A 3UB8A 1WE4A 5L07A 1H8ZA 3BQ8A 2Y2OA 4IBBA 4DE0A 2G7UA 5F68A 5TBMA 4WU9B 3WA9A 3AZEB 4GOGA 3PYPA 1O7EA 2IO5B 5AY8A 2Y2NA 5EV0A 5B1MA 4ZDXA 1P3LC 3EWKA 5B24A 3FKWA 3IF6C 4GJ4A 5GHYA 3OCNA 3OPHA 5HAQA 3LCEA 2Y2IA 4NY2A 3IH9A 3AZFC 1N9LA 4JPMA 5DF9A 5HX9A 1IYOA 2UWXA 3HL9A 5GT3A 3A3DA 4EUVA 3PBSA 1GSXA 1F66C 4LV2A 4J8UA 2EXAA 5BS7A 4HJ3A 1SHVA 3HUMA 3LEQA 4I39A 4X56A 3ZVWA 1E6NA 2O9AA 1ED7A 5DKKA 3W98C 4E45A 4MN6A 4FTXA 4ARZA 3C4OA 2J80A 2ZMVA 4IBFA 4LD9A 3VP0A 1Z2CB 2WGVA 1G6AA 4EBNA 2Q9NA 5CEDA 3UTBD 1P34A 3BFFA 5HD3A 3KX0X 1P3PD 4CLCD 3V50A 4NE6A 4R4RA 3AZLA 4WM9A 2GDNA 4B9OA 3EPJA 1P3OB 1GXDA 1IOUA 2R9WA 3HVFA 3IHAA 1JTDA 3IXBA 3OPPA 4YM6A 1VM1A 3CAXA 4JGRA 5E2EA 5DF8A 3S22A 1L2SA 3PBTA 4R70A 3HCYA 3AV1A 4Z2MH 4OP5A 2JSSA 3R45B 3AZID 2FH5A 5TGFA 1E8BA 4QB8A 3MSHA 4YFMA 3ZNTA 5DNMB 1GA0A 2NUPC 5A90A 3VH5A 1KGEA 3JVVA 4WLAA 4JJNB 3AZGA 4E04A 4HI4A 3KSHA 3PBNA 5IT5A 3PBRA 4E3KA 5FEFA 1VB6A 4Q0IA 1IEMA 1M1AA 3UDIA 5TBMB 2I9VA 2HF6A 5HD5A 5AY8B 3KXBB 4Q8IA 5B1MB 4NXBA 4H9QA 1EROA 5B24B 3UTBC 1P3PC 4Y15A 5AV8D 5GLAA 4CLCC 2P04A 5BNVB 1K56D 3D4FA 3B0CW 4QLCD 1U35A 4J8UB 3WKJD 3REIA 3DTMA 2HZ5A 4ZUXB 4Z1WA 3QNBA 3VH6A 3R4KA 4GHAA 3A3EA 3A0RA 1OJGA 2W3HA 4XZQA 3GDIA 5AVBD 5E5AD 3AZIC 2ZBBA 3EOIA 3TU4B 3NQUA 2IWCA 1EW0A 4E3MA 1J3WA 4ME4A 4LD9B 2RL3A 3SOIA 1S32D 3F1OB 3MQQA 3SS5A 1XA7A 1P34B 1MPLA 2EFXA 3F1PA 2W3FA 3SH9A 1MWTA 2XA7S 3AZLB 4H6JA 4BJPA 2M7VA 4WF0A 3ITBA 1TS7A 4YM6B 1QMEA 3FV7A 3VH5W 5AV8C 4DJ2A 3AV1B 4K08A 1W1YA 5GT0D 4OJ6A 3PBOA 4L9EA 4QLCC 2IWBA 2WADA 3CG5A 3QP1A 3EPLA 1CK7A 3WKJC 1MBLA 3C7VA 3LJAB 2DF4C 4JXSA 3C1CA 3ISGA 3TE8A 3BLSA 5AVBC 5E5AC 2QJ7A 4DKIA 3AZKD 1ZLAB 5EVIA 2YKHA 4EW7A 4DN0A 1M1AB 1KX5B 1F2KA 1LSVA 4XT2A 4Y17A 1P3FA 2JCHA 1ERQA 1S32C 2ZOIA 4H9QB 3S7OA 4Z66D 4IJGA 5CHLB 2EX9A 2J7VA 4GN2A 4PAUA 4JLFA 1M19D 2Y2PA 3KUYA 4MBHA 3REHD 4J8VD 1N9NA 3FKEA 4Z2MG 1U35B 1M18A 1P3GD 5FUGB 3W4OA 4PM9A 4DXBA 1H8MA 3IX4A 1KVLA 4KQOA 4FCFA 2IOUA 4KUDB 5GT0C 5EOOA 1HZOA 2OWJA 2ZM5A 2PYOB 3F1NB 3S4XA 2CV5D 2HDRA 3LO7A 1I2SA 3B6GD 3AZKC 2L5AA 1OTDA 4RQ9A 1L0DA 3F1PB 3MGSB 1VETA 4WBGA 1YLPA 3B33A 3UB7A 3WRZA 3HREA 4HP4A 4H6JB 4KGCA 4FSFA 1LLBA 3NULA 4Z66C 3AZED 2YFWB 5B1LB 1K0KA 1HVBA 4P6BA 4WZSB 1KX4D 3LR3A 4YS3D 1M19C 2LB9A 3RXXA 3REHC 5DFXA 2ZLYA 4WEKA 3K3CA 3G2ZA 4J8VC 3DWKA 3ZVTA 1E4DA 1K57A 1KOUA 3W2ZA 3EQUA 2L0WA 3RTYA 1P3GC 3MS6A 4I5SA 4KQQA 2PYPA 3UDXA 4WJ3C 4KZAA 4WUJA 5HDSA 5HWTA 4GB7A 4EBPA 1AXBA 3IQAA 3AZHA 1Y4OA 3ZFZA 1T1BA 1V9YA 4N92A 4S2NC 4EUZA 1Q2PA 1RP5A 1P3BB 3FPWA 1P3FB 1P3MA 1L0GA 1BSGA 2CV5C 3X1UA 5AV6D 5CECA 5BT1D 3B6GC 1OGBA 3WD1A 1XJ3A 3WS5A 4BD1A 3R7WB 3KUYB 5B33D 2OAQ1 2XFTA 2Q9MA 1T19A 5F99A 4S2KA 4ETZA 4IBIA 2CWEA 2EA9A 1BUEA 1HD8A 1D1JA 3AZEC 1MWRA 2VLGA 4UEYA 3A6NA 1P3OD 3H0MC 1P3ID 1KX4C 4R3JA 4YS3C 4HJ6A 4HMCA 3UPOA 3REKB 3OBFA 2OOLA 3H7WA 3AN2B 3D3OA 3ZHHA 4OPRA 3WS0A 5KSHA 2Y2GA 2PHYA 1PYYA 4JJND 2GNXA 1YSPA 2W3EA 3EPKA 3MZEA 3UT9A 1VETB 3LIEA 3BM6A 1JWZA 1ES5A 3KSIA 1NYYA 4Z2IA 5AV6C 5FI2A 4XUJD 1K54A 5G49A 5BT1C 3C1BB 3UE3A 5B2ID 2AROA 2ZY3A 1ES3A 2AVXA 5CHMA 2H28A 4C75A 3KXBD 5AVCB 3C4PA 4DDYA 5B33C 1ALQA 5B0ZD 3ZNYA 5EE8A 3WAAB 1ID3A 3VH5T 2M1CA 4HEFA 3LELA 1P3OC 4GH9A 1P3IC 3JPUA 5JYPA 1XKZA 4OJOA 4A5RA 4WYYA 4ZUXD 5GHZA 1CQAA 2EFUA 1G5UA 5B2JB 4KZ7A 4ZRRA 5CEBA 1LHYA 3TU4D 5BNXB 4Y2FA 2G2UA 3ZDJA 4OQIA 2B95A 3X1UB 2LB5A 2NQBA 4OQHA 1YU0A 2XLNA 3KYEA 4ZBEA 3MVDD 4JJNC 2HGVA 4K0XA 3REJB 5TJJA 2XEPA 3O3VA 5F99B 4XUJC 1TZYA 4GCZA 1KU5A 5B2IC 3BFEA 3WX7A 1P3AD 1N1JA 4WNNB 3A6NB 3AZJA 1OTIA 3KXBC 5B1MC 4X55A 3HLFA 3B42A 5B0ZC 3Q7VB 4OLDA 1L6JA 3H7WB 1RGYA 4J8XA 3T4KA 1WWSA 3M2KA 3BY8A 2ZL1A 3LJAD 4ZUXC 4IVKA 2W1RA 3AFAA 4JKTA 2VV8A 3HUNA 4DE3A 4IUHA 3UT9B 1T18A 3TU4C 1ZLAD 3ICYA 5FI6A 4GZBA 3L9KA 3IHBA 4JXGA 1OTAA 1KX5D 2VK3A 1YLJA 3MVDC 2PYRA 4F3LA 3K2NA 4E6XA 2WUQA 2XF3A 3V5MA 4PM5A 4FH4A 4BENA 3X1SD 1BLCA 3KSGA 1P3AC 3MGPB 5A91A 5FA7A 3CI6A 5GXQB 3JVUA 3LZ1B 2NZDD 3EG5B 3WD4A 4CLCE 2BG1A 4O8GA 4HESA 4KUDD 4KZBA 2B02A 1IKIA 4RA7A 5CXWA 1UR9A 4KG2A 2PYOD 3LJAC 2JKTM 4FD8A 3KWQA 3B6FD 4X68A 5G4ZA 1H3QA 3UNWA 1BFMA 3WTPA 4Z9QA 1ZLAC 4I3IA 3B0DB 3T12B 1X0OA 3NY4A 3AZND 1KX5C 2VGJA 3MGSD 3CITA 3VP1A 3ZGAB 1MXOA 4P6ZM 1N1JB 1HQ3B 2J8YA 3SZTA 3LZ0D 3MGQA 3A1IA 5B1LD 3DTEA 4Q0HA 3MF0A 4RX2A 3X1SC 2E8JA 4J8XB 3W99B 4Z2HA 5GSUB 5BO0A 1GPFA 2XFSA 2V0WA 3WD0A 2L1MA 3ULFA 4X23D 2VGLM 2Q0OA 2PRFA 2NZDC 1W8QA 2PAVP 3QP5A 1EWZA 3NBLA 3IF5A 3UB5P 4M4XA 4KUDC 1Q2QA 1DJCA 4DE2A 2Y91A 2PYOC 4L0LA 5CPJA 3B6FC 3W96B 1YM1A 3X1TB 1OTBA 4Y13A 1FR1A 4EESA 2WGWB 4NYUA 3AZNC 2YFVA 3MGSC 1JTGA 2HPBA 4H9OA 3H0RC 3EGDC 3GV9A 3V67A 3RELB 3LZ0C 1TDGA 1K4EA 1TDLA 5MC7A 2Y79A 2LY8A 5B1LC 5EOEA 4NETA 2K31A 1ODVA 4EO5C 3REKD 4LRZE 4XUXA 1IYQA 4MMNA 4K0WA 3AN2D 1P3KA 2H0YA 3UE6A 1T1AA 2W1TA 2EWVA 4ZBJB 1ZKJA 4CSRA 3T1SA 3KWQB 5B40A 5DNND 4NK3A 4QY5A 4H9NB 3WTPB 1YU1A 5JA4B 4S2JA 3M6HA 2HUEC 2ZM8A 1E6ZA 3UB6A 4E3OA 1P3BC 2WAFA 1WA9A 5J3WA 1YU3A 1Q9CA 3NECA 3C1BD 1RGZA 1CEFA 2D02A 4R4SA 2QMIA 4Z5TB 3W4PA 5AVCD 4OOYA 1VEUA 3OLOA 5B0YB 5E2HA 1CI8A 3W4QA 3V9RA 3LY3A 3WWXA 2INWA 1FOFA 1AOIA 4GHLA 2ZQ9A 4HQAA 4UQIM 3GVBA 4EU0A 2ZC4B 2QPNA 1H0GA 3DW0A 3GECA 1HTAA 5CPIB 3WS4A 3O62B 3REKC 4QNLA 5B32A 3MZFA 4N1HA 3AN2C 1WYBA 4GLQA 5B2JD 4OH0A 4AWLC 5CPKB 1BZAA 2L4RA 5EFWA 1K55C 3CZDA 2HJEA 4UA6A 5FDSA 5M18A 1O6IA 5L2FA 2V9AA 5DNNC 2P9VA 4OPQA 5AQBA 3PTEA 3RJUA 5CP6A 1RCJA 1S66L 2G2WA 1R4VA 3X1VB 2ZY5A 3REJD 2RIQA 4B88A 4EETB 1G68A 3C1BC 1WYCA 3AGFA 1F9IA 3VE3A 5AVCC 4U0XA 5KMWA 5DKLA 5CHJA 5DF7A 4Z2JA 3WAAC 1WWIA 5B32G 2EX2A 2ZQDA 2ZC3B 4GD6A 2W1TB 5B40B 4Z2KA 4FUWA 4U0TA 5AV9B 3T4SA 3AYWA 5B2JC 4LPZA 5GLDA 3G4PA 1JWVA 2HDSA 1HTZA 2DCFA 1PW8A 2VX8A 5FL3A 4GKUA 1SCWA 2R78A 1SDNA 4HIAA 3REJC 1VEUB 1LI9A 3PHYA 1XGJA 5AV5D 2Y2JA 3V9RB 1OT6A 3C2WA 5IHVA 5EUAA 3JYIA 2HP6A 2ZC7A 2A24A 3MGPD 1YMXA 3PAGA 5GXQD 4WZ5C 1ZC2A 2JHEA 4HP9A 2J9OA 4TX8A 3LZ1D 3WA9B 1TAFA 2PD7A 2ACGA 5B32B 4KZ5A 2EXBA 3AZMA 1BLSA 3LFVA 4EQIA 3AL0C 2ZC6B 4WU8D 4R8PA 5FQIA 4N9LA 3MGRA 5GT3B 4B93A 2GJ3A 3G30A 4IBGA 3NC8A 2FFFB 4XUZA 1HQ3D 4JGPA 3S7PA 2HV1A 4ARZB 1UWNX 5AV5C 4O0PA 2W3GA 3GSGA 4GNUA 3BW6A 4J8WA 1ZHHB 1GHIA 2W0NA 3MGPC 3W99D 5GSUD 1XFQA 3DBAA 1YAXA 1K38A 5GXQC 3HLBA 4OLGA 3N7WA 4HHDA 3MXSA 1SKOA 3LZ1C 5B31A 5JRGA 1Z6FA 1GSVA 4QD4A 2XSSA 4ESPA 3HLEA 3MNNA 4IHQA 1YPRA 5FQJA 4G3WA 2PR5A 4OVDA 2W8SA 2VJWA 2F8NH 2ZQCA 5C3IB 4G91B 4WU8C 4JF4A 4ZAMA 2JBFA 4E3JA 2BASA 3PR6A 3W96D 1PZOA 4JXVA 4QWOA 4MCWA 4H9RA 3X1TD 5FDHA 1UWPX 2V2FF 4NZ3A 4II7A 3AZGB 1XFNA 2XDMA 1HQ3C 5BPVA 5KDMA 3RELD 3BJNA 3LR0A 3TRCA 3VP3A 4HBUA 3MKEA 1T3UA 3UN7A 2M7UA 3OC2A 2J3TD 1QO6A 1EQZA 3OPRA 4EBLA 1H5XA 3W99C 4X23A 2BYMA 1MWSA 5GSUC 1W1VA 3U2AA 3PAEA 1YLWA 3W97A 4WV4B 4LENA 1MKMA 1KX3A 2DQNC 4P85A 4OOLA 2FJ7A 3MGRB 4IBDA 2O9CA 5FQMA 1KVMA 4R3BA 2ZD8A 3HBRA 3REIB 1J7MA 5FSRA 3UTAA 4HMDA 1S4RA 2HIOA 2O99A 4XZQB 4B4ZA 2QHKA 3W96C 3D72A 4NXEA 3NQUB 3X1TC 4WMCD 3MFDA 3V3RA 3AV2A 1GCEA 3CUEC 4Z5TD 4R38A 3N6IA 4MLLA 5B0YD 3D9YA 3O86A 4OQGA 1BH8A 4O01A 3BYDA 3RELC 1JFIA 2R9XA 4OONA 4BD0A 2QKPA 2J3TC 4HY8A 5CPID 3ZG0A 1BLHA 3O62D 4WU9D 4P0MA 1P3LA 3FG8A 3IF6A 5F6AA 1F5MA 3P01A 3IXGA 4EEUA 1JWPA 4H9SC 1W8YA 3OZHA 5AQ7A 2F8NA 5CPKD 4P87A 4ZBJC 3AZFA 4JGOA 5CGXA 2WKIA 1PFLA 2ZOHA 2EX8A 1F66A 4Y0UA 3L28A 1SZVA 3E4OA 3C1CB 1OTEA 3X1VD 1YU4A 1OPXA 3W98A 1E88A 5EVIB 3MQ0A 1E3UD 1FR6A 4XT2B 2JE5A 2XD5A 4Z5TC 4E3IA 4PPRA 5B0YC 4KZ8A 4G92C 1M6KA 3ZCZA 3ZYTA 4H8RA 2Y2HA 3BEBA 5J8XA 3C5AA 5AVEA 2ZMAA 4LV0A 3MR0A 3H0LC 4Q0JA 4QY6A 5F1FA 1FCOA 1FILA 5F83A 5CPIC 3O62C 3HLDA 2KOIA 4WU9C 3SS4A 1M18B 5AV9D 2IO5C 2WZZA 5F1GA 3UDFA 5BOHA 1OJ5A 2V1BA 4MB3A 3MXQA 1IYSA 5CPKC 4X53A 2XA7M 3UB9A 1FSWA 2KX6A 1LL8A 5CX7A 4WZ4A 5U47A 1NZOA 4LFUA 5HDDA 3X1VC 4IBCA 5DNMD 2JKRM 5HAIA 4M3KA 3B0BA 1FSYA 3LR5A 1BTLA 2O0YA 3L7HA 1MC0A 3IT9A 4KGCB 4GHIA 1FIKA 1S6RA 3WA9D 1P3LB 3IF6B 3UTBA 2E8IA 2VV7A 5AY8D 2V8CA 5B1MD 1P3PA 1NY0A 1G6OA 2A2LA 2BLSA 5CERA 4CLCA 5B24D 5HARA 1FCMA 3C38A 3GR2A 1YKDA 1PW1A 1P9WA 3IBRA 5EVLA 4E6WA 5AV9C 2C5WB 1F66B 3IXHA 3UY6A 4JGQA 3ITAA 5GT3D 5K5BA 5FQQA 4J8UD 1ACFA 4I38A 1IKGA 3UMDA 3AZIA 5HL6A 1P97A 3AZHB 1FQGA 1H0MA 5KSCA 3NOTC 2PBYA 2QZ6A 2WYXA 2Y55A 5C5KA 5CTMA 5HDCA 1P3MB 5DNMC 3MFXA 2WKPA 2VV6A 1GSWA 4M6BA 4LD9D 3U4LP 3KFUG 1NLYA 3Q82A 1W1TA 1P34D 2FN2A 2WKRA 3IH8A 5G4YA 4UAAA 4D60A 3WA9C 3AZLD 2PBDP 5AY8C 4BLMA 5AV8A 5FAPA 2K7SA 5B24C 4YM6D 1GOIA 1K56A 4BMWA 4KQDA 3KS8A 3OPLA 4KZ3A 1L0FA 4L9GA 5TFQA 4QLCA 3AV1D 1N9BA 2EX6A 2V8FA 3WKJA 5GT3C 3E2KA 2OSUA 4J8UC 1D06A 3RFBA 5BS7C 1OGGA 5AVBA 5E5AA 3UMEA 3LEZA 3AZGD 4OPZA 4NFTA 3MJQA 3WS1A 3FYZA 3QP2A 4MBKA 2MJ6A 3N4IA 1PRQA 1H3OA 5DTKA 5FASA 1S32A 1M1AD 1AIWA 1XX2A 5G49B 4BBVA 1LL9A 2AROB 2BTFP 4KQRA 4LD9C 3BQAA 1L0EA 4QHCA 4WN5A 2FFYA 1P3PB 3DWZA 3P09A 1P34C 1PWCA 1ID3B 2QWSA 3AZLC 3CPTA 3MMHA 3LELB 2IWDA 3EGXC 2P7JA 2Y2MA 3FKVA 3T1XA 3ZG7B 2WK0A 5HZHA 3IX8A 4YM6C 1U35D 3LUQA 4DMZA 3REID 5GT0A 2D01A 5C3IC 5A93A 4G91C 3AV1C 3L2AA 4AFIA 1TS6A 4XZQD 1QMFA 3T4JA 3BECA 4HMEA 3EQVA 4R3AA 4NYYA 3LIAA 3LIBA 3M2JA 2NQBB 1XPBA 1KDWA 4ZJ2A 2G5IC 2OLVA 3AZKA 3AZGC 1NRJA 3H82A 5M19A 2B18A 3ZG5A 1M1AC 1TZYB 3C8CA 4BBTA 4Z66A 4R6LA
chains in the Genus database with same CATH topology
3AZJB 1M19A 5AV8B 3L27A 3N8RA 1SDEA 3REHA 4BL3A 4J8VA 2ZM0A 1ESIA 1P3GA 2Y2KA 2H0TA 1U35C 2RVQD 5EECA 3REIC 5E5AB 3AFAB 3C1CD 2WZXA 3SH8A 3KS4A 4XZQC 4ZJ3A 4S2NA 3UE0A 4LV3A 5EVID 2CV5A 1DJBA 2X02A 1S32B 4Y0OA 1PZPA 3B6GA 3UPPA 1P3BD 1P3FD 1YLZA 3Q81A 5D3OA 1PZRA 3VSKA 4WEJA 3A3JA 3KUYD 3G2YA 3AZEA 1NRFA 4IJEA 1KX4A 4CAYA 4YS3A 1M18D 5I94A 3W8KA 5GT0B 1DY6A 1NZUA 3WRTA 2J9PA 3BFGA 3NDGA 3KSYA 1XXMA 3BLMA 1NJ4A 2RVQC 3B3XA 3Q07A 4YINA 3C1CC 3UE1A 4QJGA 3N8SA 5GLBA 4R0QA 5EVIC 4HGAB 1NXYA 3M6BA 3V39A 5AV6A 4OKPA 4Z66B 1P3FC 5E2GA 2OLUA 4KGCD 3MGQB 1SKFA 2WKHA 5B33A 3FDDA 4S2MA 3KUYC 4DXCA 1KE4A 4IBRA 1P3OA 1P3IA 2H10A 5BO0B 1P3GB 3WAAD 1ONHA 5E43A 2ZC5B 4S2OA 1M18C 4ID4A 1KDSA 2ZQAA 1XA1A 1YT4A 5G18A 4PM8A 2PU2A 4KENB 3AZHD 3WTPE 1K25A 5CPJB 3B6GB 4JJNA 1P3MD 3MBZA 3X1UD 5CRFA 4CPKA 4IVIA 1B67A 4WELA 3GMWA 4XUJA 2YFVB 4OJLA 2F8NK 5A92A 5B2IA 4H9OB 2A49A 5F99D 4KGCC 1KX4B 4CAYB 3KXBA 3HONA 4YS3B 5DVAA 5B0ZA 3A6ND 4DRAA 3MZDA 3IXDA 5BNVA 4JXWA 1XP4A 3QNCA 1K57C 2Y2QA 1P3KB 5GL9A 4CSRB 4ZUXA 1YQSA 4IBXA 4OUIA 4OOMA 3TU4A 4N1XA 4UUZA 3AZHC 4RX3A 4OJPA 2P74A 5AV6B 3UT9D 1MKIA 3MVDA 1ONGA 1P3MC 3C7UA 5FQ9A 2ZY4A 3X1UC 4NZ1A 1I2WA 5CTNA 2AROD 5B33B 3VP4A 2BYKA 4CJNA 1P3AA 5F99C 1P3IB 1ID3D 1AOIB 3GRJA 4S2PA 3LELD 3A6NC 3MKFA 4NE3A 5EPHA 2ZQ8A 1O07A 5GHXA 4D2OA 5FAOA 2G5HC 3LJAA 3HUOA 4R1GA 2DRWA 4UA9A 2NQBD 2P9VB 1E25A 1ZLAA 1IYPA 5CP6B 3A3FA 5JYOA 1W2EA 4XUJB 1KX5A 4DQYB 3UT9C 1EI5A 2HDUA 5B2IB 4LCLA 3O87A 4U3TA 4PM6A 1K54C 1TZYD 3NI9A 2AROC 5B0ZB 5CGWA 3O88A 3AZJD 3X1SA 1ID3C 4BQMA 3LELC 4J8XD 4KZ9A 2NZDA 1GA9A 4UHUA 5FUGA 3FZCA 4DRBA 3VFFA 4KUDA 1ESUA 1S0WA 3AFAD 3AYWB 4UUZB 5FATA 2ZQ7A 2PYOA 1ULYA 1H8YA 3MVDB 3B6FA 2H5SA 1MWUA 2NQBC 2WAEA 4RYEA 2XD1A 2BYKB 2PU4A 2VGKA 3AZNA 3MGSA 4KZ4A 3B0DC 1P3AB 3AGEA 1F1EA 1TZYC 3LZ0A 2YFWA 5B1LA 1W7FA 3AZJC 3P98A 4K91A 4B4XA 5E2FA 3HSHA 4OPYA 1J9MA 1U60A 1TAFB 3EPHA 5B31G 5DTTA 5HW3A 1ES4A 4J8XC 3AZMB 2CC1A 4NZ4A 5FI7A 1ERMA 3Q1FA 5TR7A 4E3NA 3AFAC 4R8PB 3KWQD 4F94A 3NQJA 1PWGA 2Z2MB 3IWQA 4GDBA 3WTPD 1P3BA 1VQQA 1Y54A 1PWDA 3G32A 3MGQD 3SH7A 3X1SB 1JVJA 3VH6W 1W79A 1DJAA 4J8WB 1I5QA 4IEDA 2J8PA 1FCNA 1KGFA 2Y59A 2NZDB 1KE0A 4LV1A 3UO9A 2C6WB 3REKA 5B31B 5JRGB 4N9KA 1ZG4A 3AN2A 3AGDA 4JF5A 3MNNB 3G34A 3QHYA 1K55A 3B6FB 2ZM2A 3E2LA 5DNNA 5CPJD 2A3UA 3KWQC 2V1ZA 5KZHA 4H9RB 3AZNB 3F6TA 1N4OA 3WTPC 1GHPA 1PI5A 1YMSA 4XXRA 4HGAC 1LL5A 4MEZA 4DRTA 3LZ0B 3C1BA 3OCLA 5KDMB 5AVCA 3MGQC 4EO5B 3FWLA 4KG5A 3WAAA 1EQZB 5F82A 4X23B 2BYMB 4O7DA 4ZTKA 3VOZA 4QU3A 1P3KD 3W97B 2F8NG 1KX3B 3G31A 5B40D 3NQJB 5B2JA 2FJ7B 2HUEB 4DE1A 5BNXA 3UTAB 1YUEA 5CPJC 2HIOB 1TEMA 1CI9A 3WS2A 3REJA 2HP9A 3AV2B 3IWOA 4KZ6A 4RVAA 4Y7PA 2XH9A 4OQ0A 2V20A 4EV4A 4WNNA 4JF6A 1BH8B 3A1KA 4E3LA 3VSLA 1AOID 1JFIB 4WZ5A 2B5RA 3B0CT 3NCKA 3Q7VA 3RXWA 2OV5A 1XGIA 4PM7A 2F2AC 4AWLB 5B32D 3BRMA 1BULA 1P3KC 2F8NB 2XR0A 5DNNB 2Y2LA 3AZFB 5B40C 1YLYA 1ZG6A 3N8LA 4DDSA 5CP6D 2DNSA 3A3IA 1YLTA 3HLCA 4GDNA 3W98B 3VMAA 1A7WA 1IELA 1PI4A 1MY8A 5AV5A 4MNRA 3Q7ZA 4EWFA 1LI0A 4IJFA 4UA7A 3MGPA 4C3QA 5GXQA 1AOIC 3GTCA 3CJMA 4S2LA 3LZ1A 3L29A 1K6SA 5B32C 2I72A 5FAQA 3AYWD 3LY4A 3V3SA 4WU8A 5HFOA 4ZJ1A 3NIAA 3IWIA 5CP6C 3S1YA 3P5JB 3VH6T 1HQ3A 4JBFA 1KE3A 2ZJ9A 3VOYA 3SS3A 4E44A 2X71A 3W99A 3BFDA 5GSUA 1BT5A 3UTBB 2HDQA 3L26A 3AZMD 1PIOA 2XK1A 4KG6A 4R8PD 3NDEA 3AYWC 4PMAA 3MGRD 4IBEA 4LG2A 4KHAA 3AZIB 3W96A 3ZG8B 3X1TA 5AV5B 2WGWA 1OMEA 4BL2A 5DTSA 5GLCA 1NYMA 3RELA 4J8WD 3G35A 1BLPA 4S2IA 5B31D 5JRGD 4FH2A 3ZG9B 4X69A 3AZMC 4H9SA 3MNND 2WKEA 4HBTA 4WU8B 4X6TA 4QLCB 4H9NA 2XQZA 5CHUA 4R8PC 5JA4A 3WKJB 3MGRC 4IBKA 5HAPA 5AVBB 1BH9A 1B6WA 2XGNA 4WMCA 5HL1A 1GHMA 4Y0TA 3TOIA 4Z5TA 4OP8A 1H3OB 4H9PA 5B0YA 1EQZD 4J8WC 1YU2A 2JC7A 3VFHA 4IBJA 3HLGA 5CPIA 3W97D 3TSGA 3O62A 5B31C 4WU9A 5JRGC 4C6YA 1KX3D 1KGGA 3MNNC 2FJ7D 1TVFA 4LCMA 5CPKA 4KHAB 1ES2A 2RCXA 4MBFA 3UTAD 1W5DA 5CGSA 2HIOD 3HLWA 3UPNA 3BFCA 2VQRA 3X1VA 3AV2D 2WGIA 3PBQA 3AZKB 1E3UA 3TG9A 3I7JA 4DF6A 4NE5A 4NZ5A 1EQZC 3L25A 1CK3A 1M19B 4X23C 1P3LD 3REHB 4J8VB 3W97C 4R23A 5AQAA 2F8ND 1K6RA 5AV9A 3AZFD 1KX3C 3VP2A 2FJ7C 2X01A 1M40A 1F66D 3CMZA 1K4FA 5M1AA 1BH9B 3UTAC 3N3FA 2HIOC 3R45A 5AQ9A 4UPKA 3W98D 3MXRA 2HP5A 3GQZA 4GD8A 2CV5B 4H9PB 3IP4C 5DNMA 3AV2C 4OJ5A 2Y4AA 4G92B 1CEGA 2Z2LB 2ZY2A 1C3BA 5FQKA 1WE4A 1H8ZA 2Y2OA 4IBBA 4DE0A 4WU9B 3WA9A 3AZEB 4GOGA 1O7EA 2IO5B 5AY8A 2Y2NA 5B1MA 4ZDXA 1P3LC 5B24A 3FKWA 3IF6C 5GHYA 3OCNA 3OPHA 5HAQA 3LCEA 2Y2IA 4NY2A 3IH9A 3AZFC 4JPMA 5DF9A 5HX9A 1IYOA 2UWXA 3HL9A 5GT3A 3A3DA 3PBSA 1F66C 4LV2A 4J8UA 2EXAA 5BS7A 1SHVA 3HUMA 4X56A 3ZVWA 3W98C 4E45A 3C4OA 4IBFA 4LD9A 3VP0A 1Z2CB 2WGVA 1G6AA 4EBNA 2Q9NA 5CEDA 3UTBD 1P34A 3BFFA 1P3PD 3V50A 4NE6A 4R4RA 3AZLA 4WM9A 2GDNA 3EPJA 1P3OB 2R9WA 3HVFA 3IHAA 1JTDA 3IXBA 3OPPA 4YM6A 1VM1A 5E2EA 5DF8A 3S22A 1L2SA 3PBTA 3AV1A 4Z2MH 4OP5A 2JSSA 3R45B 3AZID 5TGFA 4QB8A 4YFMA 3ZNTA 5DNMB 1GA0A 5A90A 3VH5A 1KGEA 4JJNB 3AZGA 3PBNA 3PBRA 4E3KA 1IEMA 1M1AA 3UDIA 5AY8B 3KXBB 4Q8IA 5B1MB 4H9QA 1EROA 5B24B 3UTBC 1P3PC 5AV8D 5GLAA 5BNVB 1K56D 3D4FA 3B0CW 4QLCD 1U35A 4J8UB 3WKJD 3REIA 3DTMA 4ZUXB 3QNBA 3VH6A 4GHAA 3A3EA 4XZQA 5AVBD 5E5AD 3AZIC 3TU4B 3NQUA 2IWCA 4E3MA 4LD9B 2RL3A 3SOIA 1S32D 3SS5A 1XA7A 1P34B 1MPLA 2EFXA 3SH9A 1MWTA 3AZLB 4BJPA 3ITBA 4YM6B 1QMEA 3FV7A 3VH5W 5AV8C 3AV1B 5GT0D 4OJ6A 3PBOA 4QLCC 2IWBA 2WADA 3CG5A 3EPLA 3WKJC 1MBLA 3C7VA 3LJAB 2DF4C 4JXSA 3C1CA 3ISGA 3BLSA 5AVBC 5E5AC 4DKIA 3AZKD 1ZLAB 5EVIA 1M1AB 1KX5B 1P3FA 2JCHA 1ERQA 1S32C 4H9QB 4Z66D 5CHLB 2EX9A 2J7VA 4GN2A 4JLFA 1M19D 2Y2PA 3KUYA 4MBHA 3REHD 4J8VD 3FKEA 4Z2MG 1U35B 1M18A 1P3GD 5FUGB 3W4OA 4PM9A 4DXBA 1KVLA 4KQOA 4FCFA 2IOUA 4KUDB 5GT0C 5EOOA 1HZOA 2ZM5A 2PYOB 3S4XA 2CV5D 2HDRA 3LO7A 1I2SA 3B6GD 3AZKC 2L5AA 1L0DA 3MGSB 4WBGA 1YLPA 3WRZA 3HREA 4KGCA 4FSFA 1LLBA 4Z66C 3AZED 2YFWB 5B1LB 1HVBA 4P6BA 4WZSB 1KX4D 4YS3D 1M19C 3RXXA 3REHC 2ZLYA 4WEKA 3G2ZA 4J8VC 3DWKA 3ZVTA 1E4DA 1K57A 3EQUA 1P3GC 4KQQA 3UDXA 4WJ3C 4KZAA 4GB7A 4EBPA 1AXBA 3IQAA 3AZHA 3ZFZA 4S2NC 4N92A 4EUZA 1Q2PA 1RP5A 1P3BB 1P3FB 1P3MA 1L0GA 1BSGA 2CV5C 3X1UA 5AV6D 5CECA 5BT1D 3B6GC 3WS5A 4BD1A 3KUYB 5B33D 2XFTA 2Q9MA 5F99A 4S2KA 4IBIA 2CWEA 1BUEA 1HD8A 3AZEC 1MWRA 3A6NA 1P3OD 3H0MC 1P3ID 1KX4C 4R3JA 4YS3C 3UPOA 3REKB 3AN2B 3ZHHA 4OPRA 3WS0A 5KSHA 2Y2GA 1PYYA 4JJND 3MZEA 3EPKA 3UT9A 3BM6A 1JWZA 1ES5A 1NYYA 5AV6C 5FI2A 4XUJD 1K54A 5G49A 5BT1C 3C1BB 3UE3A 5B2ID 2AROA 2ZY3A 1ES3A 5CHMA 4C75A 3KXBD 5AVCB 3C4PA 4DDYA 5B33C 1ALQA 5B0ZD 3ZNYA 5EE8A 3WAAB 1ID3A 3VH5T 4HEFA 3LELA 1P3OC 4GH9A 1P3IC 5JYPA 1XKZA 4OJOA 4A5RA 4WYYA 4ZUXD 5GHZA 2EFUA 5B2JB 4KZ7A 5CEBA 1LHYA 3TU4D 5BNXB 2G2UA 3ZDJA 4OQIA 3X1UB 2NQBA 4OQHA 1YU0A 2XLNA 4ZBEA 3MVDD 4JJNC 4K0XA 3REJB 2XEPA 3O3VA 5F99B 4XUJC 1TZYA 1KU5A 5B2IC 3BFEA 3WX7A 1P3AD 1N1JA 4WNNB 3A6NB 3AZJA 3KXBC 5B1MC 4X55A 3HLFA 5B0ZC 3Q7VB 4OLDA 1RGYA 4J8XA 1WWSA 3M2KA 3LJAD 4ZUXC 4IVKA 3AFAA 4JKTA 3HUNA 4DE3A 3UT9B 3TU4C 1ZLAD 5FI6A 4GZBA 3IHBA 4JXGA 1KX5D 1YLJA 3MVDC 4E6XA 2WUQA 2XF3A 3V5MA 4PM5A 4FH4A 4BENA 3X1SD 1BLCA 1P3AC 3MGPB 5A91A 5FA7A 5GXQB 3LZ1B 2NZDD 3EG5B 2BG1A 4HESA 4KUDD 4KZBA 1IKIA 4RA7A 5CXWA 4KG2A 2PYOD 3LJAC 4FD8A 3KWQA 3B6FD 4X68A 3UNWA 1BFMA 3WTPA 4Z9QA 1ZLAC 3B0DB 3NY4A 3AZND 1KX5C 2VGJA 3MGSD 3VP1A 3ZGAB 1MXOA 1N1JB 1HQ3B 2J8YA 3LZ0D 3MGQA 3A1IA 5B1LD 4RX2A 3X1SC 4J8XB 3W99B 5GSUB 5BO0A 2XFSA 4X23D 2NZDC 1W8QA 1EWZA 3NBLA 3IF5A 4KUDC 1Q2QA 1DJCA 4DE2A 2Y91A 2PYOC 4L0LA 5CPJA 3B6FC 3W96B 1YM1A 3X1TB 1FR1A 2WGWB 4NYUA 3AZNC 2YFVA 3MGSC 1JTGA 2HPBA 4H9OA 3H0RC 3GV9A 3RELB 3LZ0C 1TDGA 1K4EA 1TDLA 2LY8A 5B1LC 5EOEA 4NETA 4EO5C 3REKD 4XUXA 1IYQA 4K0WA 3AN2D 1P3KA 2H0YA 4ZBJB 1ZKJA 4CSRA 3KWQB 5B40A 5DNND 4NK3A 4QY5A 4H9NB 3WTPB 1YU1A 5JA4B 4S2JA 3M6HA 2HUEC 2ZM8A 4E3OA 1P3BC 2WAFA 1YU3A 1Q9CA 3C1BD 1RGZA 1CEFA 4R4SA 2QMIA 4Z5TB 3W4PA 5AVCD 4OOYA 5B0YB 5E2HA 1CI8A 3W4QA 3V9RA 3LY3A 3WWXA 1FOFA 1AOIA 4GHLA 2ZQ9A 3GVBA 2ZC4B 2QPNA 3DW0A 1HTAA 5CPIB 3WS4A 3O62B 3REKC 4QNLA 5B32A 3MZFA 4N1HA 3AN2C 1WYBA 5B2JD 4OH0A 4AWLC 5CPKB 1BZAA 1K55C 3CZDA 4UA6A 5M18A 5L2FA 5DNNC 2P9VA 4OPQA 5AQBA 3PTEA 3RJUA 5CP6A 1RCJA 2G2WA 1R4VA 3X1VB 2ZY5A 3REJD 2RIQA 4B88A 1G68A 3C1BC 1WYCA 3AGFA 5AVCC 4U0XA 5KMWA 5CHJA 5DF7A 3WAAC 1WWIA 5B32G 2EX2A 2ZQDA 2ZC3B 4GD6A 5B40B 4U0TA 5AV9B 3AYWA 5B2JC 5GLDA 3G4PA 1JWVA 2HDSA 1HTZA 2DCFA 1PW8A 4GKUA 1SCWA 1SDNA 3REJC 1LI9A 1XGJA 5AV5D 2Y2JA 3V9RB 5IHVA 5EUAA 3JYIA 2HP6A 2ZC7A 3MGPD 1YMXA 3PAGA 5GXQD 4WZ5C 1ZC2A 2J9OA 3LZ1D 3WA9B 1TAFA 5B32B 4KZ5A 2EXBA 3AZMA 1BLSA 4EQIA 3AL0C 2ZC6B 4WU8D 4R8PA 5FQIA 4N9LA 3MGRA 5GT3B 3G30A 4IBGA 3NC8A 2FFFB 4XUZA 1HQ3D 5AV5C 3GSGA 4GNUA 4J8WA 1GHIA 3MGPC 3W99D 5GSUD 1K38A 5GXQC 3HLBA 4OLGA 3N7WA 3MXSA 3LZ1C 5B31A 5JRGA 1Z6FA 4QD4A 3HLEA 3MNNA 5FQJA 4OVDA 2W8SA 2F8NH 2ZQCA 5C3IB 4G91B 4WU8C 4JF4A 4ZAMA 2JBFA 4E3JA 3W96D 1PZOA 4JXVA 4H9RA 3X1TD 5FDHA 2V2FF 4NZ3A 3AZGB 2XDMA 1HQ3C 5BPVA 5KDMA 3RELD 3VP3A 4HBUA 3MKEA 1T3UA 3UN7A 3OC2A 1EQZA 3OPRA 4EBLA 1H5XA 3W99C 4X23A 2BYMA 1MWSA 5GSUC 3PAEA 1YLWA 3W97A 4WV4B 4LENA 1KX3A 2DQNC 4P85A 4OOLA 2FJ7A 3MGRB 4IBDA 5FQMA 1KVMA 4R3BA 2ZD8A 3HBRA 3REIB 5FSRA 3UTAA 2HIOA 4B4ZA 4XZQB 3W96C 3NQUB 3X1TC 4WMCD 3MFDA 3V3RA 3AV2A 1GCEA 4Z5TD 3N6IA 4MLLA 5B0YD 3O86A 4OQGA 1BH8A 3BYDA 3RELC 1JFIA 2R9XA 4OONA 4BD0A 5CPID 3ZG0A 1BLHA 3O62D 4WU9D 4P0MA 1P3LA 3IF6A 3IXGA 1JWPA 4H9SC 1W8YA 3OZHA 5AQ7A 2F8NA 5CPKD 4P87A 4ZBJC 3AZFA 5CGXA 2WKIA 2EX8A 1F66A 4Y0UA 3L28A 3C1CB 3X1VD 1YU4A 3W98A 5EVIB 1E3UD 1FR6A 2JE5A 2XD5A 4Z5TC 4E3IA 4PPRA 5B0YC 4KZ8A 4G92C 1M6KA 3ZCZA 4H8RA 2Y2HA 3BEBA 5J8XA 3C5AA 2ZMAA 4LV0A 3H0LC 4QY6A 5F1FA 1FCOA 5F83A 5CPIC 3O62C 3HLDA 4WU9C 3SS4A 1M18B 5AV9D 2IO5C 2WZZA 5F1GA 3UDFA 5BOHA 4X53A 1IYSA 5CPKC 1FSWA 4WZ4A 5U47A 1NZOA 3X1VC 4IBCA 5DNMD 5HAIA 4M3KA 3B0BA 1FSYA 1BTLA 3IT9A 4KGCB 1S6RA 3WA9D 1P3LB 3IF6B 3UTBA 2E8IA 5AY8D 5B1MD 1P3PA 1NY0A 2BLSA 5CERA 5B24D 5HARA 1FCMA 3GR2A 1PW1A 5EVLA 4E6WA 5AV9C 2C5WB 1F66B 3IXHA 3UY6A 3ITAA 5GT3D 5FQQA 4J8UD 1IKGA 3AZIA 3AZHB 1FQGA 5KSCA 2PBYA 2QZ6A 2WYXA 2Y55A 5CTMA 1P3MB 5DNMC 4M6BA 4LD9D 3KFUG 3Q82A 1P34D 3IH8A 4UAAA 3WA9C 3AZLD 5AY8C 4BLMA 5AV8A 5FAPA 5B24C 4YM6D 1K56A 3KS8A 3OPLA 4KZ3A 1L0FA 5TFQA 4QLCA 3AV1D 1N9BA 2EX6A 3WKJA 5GT3C 3E2KA 2OSUA 4J8UC 5BS7C 5AVBA 5E5AA 3LEZA 3AZGD 4OPZA 4NFTA 3WS1A 3FYZA 4MBKA 3N4IA 1H3OA 5DTKA 5FASA 1S32A 1M1AD 1XX2A 5G49B 1LL9A 2AROB 4KQRA 4LD9C 1L0EA 4QHCA 2FFYA 1P3PB 3DWZA 3P09A 1P34C 1PWCA 1ID3B 3AZLC 3LELB 2IWDA 2Y2MA 3FKVA 3ZG7B 2WK0A 4YM6C 1U35D 3REID 5GT0A 5C3IC 5A93A 4G91C 3AV1C 3L2AA 4XZQD 1QMFA 3BECA 3EQVA 4NYYA 3M2JA 2NQBB 1XPBA 1KDWA 4ZJ2A 2G5IC 2OLVA 3AZKA 3AZGC 5M19A 3ZG5A 1M1AC 1TZYB 4Z66A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MBL A;  3C7V A;  3BRM A;  4JXS A;  1BUL A;  3ISG A;  1G68 A;  3BLS A;  2XR0 A;  1SDE A;  3N8R A;  2Y2L A;  1WYC A;  4BL3 A;  3AGF A;  4DKI A;  5EVI A;  2ZM0 A;  1ESI A;  1YLY A;  4U0X A;  5KMW A;  1ZG6 A;  3N8L A;  5CHJ A;  5DF7 A;  4DDS A;  2JCH A;  1ERQ A;  2Y2K A;  2DNS A;  2EX2 A;  2H0T A;  2ZQD A;  2ZC3 B;  3A3I A;  4GD6 A;  1YLT A;  3HLC A;  5EEC A;  4GDN A;  2EX9 A;  2J7V A;  4GN2 A;  3VMA A;  2WZX A;  4JLF A;  3SH8 A;  2Y2P A;  1IEL A;  1PI4 A;  1MY8 A;  4MBH A;  4U0T A;  4MNR A;  4ZJ3 A;  4S2N A;  3Q7Z A;  4LV3 A;  3UE0 A;  5EVI D;  4EWF A;  1LI0 A;  1DJB A;  2X02 A;  5GLD A;  4UA7 A;  3G4P A;  1JWV A;  2HDS A;  1PZP A;  4Y0O A;  3UPP A;  1HTZ A;  4C3Q A;  1YLZ A;  3Q81 A;  2DCF A;  1PW8 A;  5D3O A;  3W4O A;  4PM9 A;  3GTC A;  3CJM A;  4DXB A;  4S2L A;  1KVL A;  4KQO A;  4GKU A;  3VSK A;  4FCF A;  4WEJ A;  5EOO A;  1HZO A;  1SCW A;  3A3J A;  1SDN A;  1K6S A;  1LI9 A;  3G2Y A;  1XGJ A;  1NRF A;  2Y2J A;  2I72 A;  5FAQ A;  3S4X A;  3LY4 A;  5IHV A;  3V3S A;  5EUA A;  3JYI A;  2HP6 A;  2HDR A;  2ZC7 A;  3LO7 A;  5HFO A;  4ZJ1 A;  1I2S A;  3W8K A;  5I94 A;  1YMX A;  3NIA A;  3PAG A;  1DY6 A;  1NZU A;  3WRT A;  4WZ5 C;  1ZC2 A;  3IWI A;  1L0D A;  2J9O A;  2J9P A;  3BFG A;  4WBG A;  1YLP A;  3NDG A;  1XXM A;  3BLM A;  3WRZ A;  3HRE A;  4KZ5 A;  3S1Y A;  2EXB A;  4FSF A;  1NJ4 A;  1BLS A;  1LLB A;  4EQI A;  3B3X A;  4JBF A;  1HVB A;  3Q07 A;  4P6B A;  4YIN A;  3UE1 A;  4QJG A;  3N8S A;  2ZC6 B;  5GLB A;  3RXX A;  1KE3 A;  2ZLY A;  2ZJ9 A;  4R0Q A;  3G2Z A;  4WEK A;  3DWK A;  5EVI C;  1E4D A;  5FQI A;  1K57 A;  1NXY A;  2X71 A;  3M6B A;  3SS3 A;  4N9L A;  3ZVT A;  3V39 A;  3EQU A;  3BFD A;  4OKP A;  3G30 A;  1BT5 A;  2HDQ A;  4KQQ A;  5E2G A;  3NC8 A;  2OLU A;  2FFF B;  3UDX A;  1SKF A;  2WKH A;  4KZA A;  4XUZ A;  4GB7 A;  4EBP A;  1AXB A;  3IQA A;  1PIO A;  2XK1 A;  4S2M A;  3ZFZ A;  4DXC A;  1KE4 A;  4N92 A;  4S2N C;  4IBR A;  4KG6 A;  1Q2P A;  4EUZ A;  1RP5 A;  2H10 A;  3NDE A;  3GSG A;  4GNU A;  4PMA A;  1BSG A;  1ONH A;  1L0G A;  5E43 A;  1GHI A;  2ZC5 B;  4S2O A;  5CEC A;  4ID4 A;  1KDS A;  2ZQA A;  3ZG8 B;  1K38 A;  3WS5 A;  3HLB A;  4OLG A;  3N7W A;  1XA1 A;  4BD1 A;  3MXS A;  1YT4 A;  2XFT A;  5G18 A;  1Z6F A;  2Q9M A;  4PM8 A;  4S2K A;  2WGW A;  4QD4 A;  2PU2 A;  4KEN B;  3HLE A;  1OME A;  1BUE A;  4BL2 A;  1HD8 A;  5FQJ A;  1K25 A;  1MWR A;  5DTS A;  5GLC A;  4OVD A;  4R3J A;  1NYM A;  2ZQC A;  3MBZ A;  5CRF A;  4CPK A;  4JF4 A;  4IVI A;  3UPO A;  3G35 A;  4ZAM A;  2JBF A;  4E3J A;  4WEL A;  4JXV A;  1PZO A;  1BLP A;  3GMW A;  4S2I A;  3ZHH A;  4OPR A;  5FDH A;  5A92 A;  3WS0 A;  2V2F F;  2A49 A;  4FH2 A;  3ZG9 B;  5KSH A;  4X69 A;  5DVA A;  2WKE A;  4HBT A;  2Y2G A;  2XDM A;  1PYY A;  4X6T A;  3VP3 A;  4HBU A;  3MKE A;  3MZD A;  3MZE A;  3IXD A;  4JXW A;  2XQZ A;  3UN7 A;  5CHU A;  1XP4 A;  3QNC A;  3BM6 A;  1K57 C;  2Y2Q A;  1ES5 A;  1JWZ A;  3OC2 A;  3OPR A;  1NYY A;  4EBL A;  5FI2 A;  1K54 A;  1H5X A;  3UE3 A;  1MWS A;  5HAP A;  5GL9 A;  1ES3 A;  3PAE A;  5CHM A;  1YLW A;  2XGN A;  4C75 A;  4WMC A;  5HL1 A;  1YQS A;  4IBX A;  3C4P A;  4DDY A;  4LEN A;  1ALQ A;  1GHM A;  3ZNY A;  4Y0T A;  4OOM A;  3TOI A;  4N1X A;  4OP8 A;  5EE8 A;  4P85 A;  4RX3 A;  4OOL A;  2P74 A;  4HEF A;  5FQM A;  1KVM A;  1MKI A;  1ONG A;  2ZD8 A;  4R3B A;  3HBR A;  3C7U A;  5FQ9 A;  5JYP A;  1XKZ A;  5FSR A;  2JC7 A;  1I2W A;  4A5R A;  5CTN A;  4WYY A;  4B4Z A;  3VFH A;  3VP4 A;  5GHZ A;  2EFU A;  3HLG A;  4CJN A;  4WMC D;  3TSG A;  4KZ7 A;  3MFD A;  3V3R A;  5CEB A;  1GCE A;  4C6Y A;  1KGG A;  1LHY A;  2G2U A;  3N6I A;  4MLL A;  4OQI A;  1TVF A;  3GRJ A;  3ZDJ A;  4S2P A;  4OQH A;  3O86 A;  4LCM A;  4OQG A;  4ZBE A;  2XLN A;  1ES2 A;  3BYD A;  3MKF A;  2RCX A;  4MBF A;  1W5D A;  5EPH A;  2R9X A;  4K0X A;  2ZQ8 A;  2XEP A;  4OON A;  3HLW A;  3O3V A;  5CGS A;  3UPN A;  4BD0 A;  1O07 A;  3BFC A;  5GHX A;  1BLH A;  3ZG0 A;  4D2O A;  5FAO A;  4P0M A;  3BFE A;  2WGI A;  3IF6 A;  3HUO A;  3IXG A;  3PBQ A;  4R1G A;  2DRW A;  1JWP A;  1W8Y A;  3OZH A;  4UA9 A;  1E3U A;  3HLF A;  4X55 A;  5AQ7 A;  3TG9 A;  2P9V B;  1E25 A;  3Q7V B;  4P87 A;  5CGX A;  2WKI A;  3I7J A;  1IYP A;  4OLD A;  3A3F A;  4DF6 A;  5JYO A;  1RGY A;  2EX8 A;  4Y0U A;  1EI5 A;  2HDU A;  4LCL A;  3O87 A;  4U3T A;  3M2K A;  4PM6 A;  1K54 C;  1CK3 A;  3NI9 A;  5CGW A;  3O88 A;  4IVK A;  5EVI B;  4JKT A;  4R23 A;  1E3U D;  3HUN A;  5AQA A;  1K6R A;  4DE3 A;  1FR6 A;  2JE5 A;  2XD5 A;  5FI6 A;  3VP2 A;  4E3I A;  4GZB A;  4PPR A;  3IHB A;  4KZ8 A;  2X01 A;  4JXG A;  4BQM A;  1M40 A;  1M6K A;  1YLJ A;  3ZCZ A;  4KZ9 A;  4H8R A;  2Y2H A;  1GA9 A;  3BEB A;  3CMZ A;  4UHU A;  4E6X A;  1K4F A;  5M1A A;  3FZC A;  3C5A A;  5J8X A;  2ZMA A;  4LV0 A;  2WUQ A;  2XF3 A;  3VFF A;  5AQ9 A;  3V5M A;  4QY6 A;  5F1F A;  1ESU A;  4PM5 A;  4FH4 A;  1FCO A;  5F83 A;  1S0W A;  3MXR A;  4BEN A;  2HP5 A;  3GQZ A;  4GD8 A;  5FAT A;  1BLC A;  3HLD A;  3SS4 A;  2Y4A A;  2ZQ7 A;  1CEG A;  2Z2L B;  5A91 A;  2WZZ A;  5F1G A;  5FA7 A;  3UDF A;  1H8Y A;  5BOH A;  1C3B A;  2H5S A;  1MWU A;  5FQK A;  4X53 A;  1IYS A;  2WAE A;  4RYE A;  1WE4 A;  2XD1 A;  1H8Z A;  1FSW A;  2PU4 A;  2BG1 A;  2Y2O A;  2VGK A;  4DE0 A;  4HES A;  4KZ4 A;  4WZ4 A;  4GOG A;  1O7E A;  3AGE A;  5U47 A;  4KZB A;  1NZO A;  1IKI A;  2Y2N A;  4RA7 A;  5CXW A;  4ZDX A;  3FKW A;  3IF6 C;  4KG2 A;  5HAI A;  4M3K A;  5GHY A;  4FD8 A;  1W7F A;  1FSY A;  3OCN A;  3P98 A;  1BTL A;  4K91 A;  4B4X A;  4X68 A;  3OPH A;  5HAQ A;  3LCE A;  5E2F A;  2Y2I A;  4OPY A;  3IH9 A;  3UNW A;  1J9M A;  1U60 A;  4JPM A;  4Z9Q A;  5DF9 A;  5DTT A;  3IT9 A;  5HX9 A;  1IYO A;  2UWX A;  3HL9 A;  3A3D A;  3NY4 A;  1ES4 A;  3PBS A;  5HW3 A;  2VGJ A;  4LV2 A;  1S6R A;  3VP1 A;  2EXA A;  1MXO A;  3ZGA B;  2CC1 A;  3IF6 B;  1SHV A;  2E8I A;  3HUM A;  5FI7 A;  2J8Y A;  1ERM A;  4X56 A;  3ZVW A;  1NY0 A;  3Q1F A;  2BLS A;  5TR7 A;  5CER A;  5HAR A;  1FCM A;  4E3N A;  3VOY A;  3GR2 A;  1PW1 A;  4RX2 A;  4F94 A;  1PWG A;  2Z2M B;  5EVL A;  3IWQ A;  4E6W A;  3C4O A;  2C5W B;  4GDB A;  3IXH A;  3UY6 A;  1VQQ A;  3ITA A;  3VP0 A;  2XFS A;  1Y54 A;  2WGV A;  5FQQ A;  1G6A A;  4EBN A;  2Q9N A;  1PWD A;  5CED A;  1IKG A;  1W8Q A;  1EWZ A;  3NBL A;  3BFF A;  3G32 A;  3IF5 A;  1FQG A;  3SH7 A;  1JVJ A;  3V50 A;  4R4R A;  5KSC A;  4WM9 A;  2GDN A;  1W79 A;  2PBY A;  2WYX A;  1DJA A;  1Q2Q A;  2QZ6 A;  2Y55 A;  5CTM A;  2R9W A;  1DJC A;  3HVF A;  3IHA A;  4DE2 A;  1I5Q A;  1JTD A;  2Y91 A;  3IXB A;  3OPP A;  4IED A;  1VM1 A;  1FCN A;  4L0L A;  1KGF A;  5E2E A;  2Y59 A;  5DF8 A;  3S22 A;  1L2S A;  3PBT A;  1KE0 A;  1YM1 A;  4LV1 A;  3UO9 A;  3Q82 A;  2C6W B;  1FR1 A;  4OP5 A;  4N9K A;  2WGW B;  3IH8 A;  5TGF A;  1ZG4 A;  4QB8 A;  3AGD A;  4JF5 A;  4UAA A;  4YFM A;  3ZNT A;  1JTG A;  2HPB A;  1GA0 A;  3G34 A;  3QHY A;  5A90 A;  1KGE A;  1K55 A;  3GV9 A;  1TDG A;  4BLM A;  1K4E A;  1TDL A;  2ZM2 A;  5FAP A;  3E2L A;  3PBN A;  3PBR A;  4E3K A;  1K56 A;  2A3U A;  5EOE A;  3OPL A;  4NET A;  4KZ3 A;  1L0F A;  1IEM A;  2V1Z A;  5KZH A;  5TFQ A;  3UDI A;  1N4O A;  1GHP A;  1PI5 A;  1YMS A;  1N9B A;  2EX6 A;  4XXR A;  4XUX A;  1IYQ A;  1LL5 A;  4MEZ A;  4DRT A;  4K0W A;  3E2K A;  4Q8I A;  2H0Y A;  2OSU A;  1ERO A;  3OCL A;  1ZKJ A;  3LEZ A;  4OPZ A;  5GLA A;  3WS1 A;  3FYZ A;  4NK3 A;  4QY5 A;  1K56 D;  4MBK A;  3FWL A;  3D4F A;  4KG5 A;  3N4I A;  4S2J A;  5DTK A;  5FAS A;  3M6H A;  5F82 A;  1XX2 A;  2ZM8 A;  1LL9 A;  2WAF A;  4E3O A;  4KQR A;  4O7D A;  4ZTK A;  3DTM A;  4QU3 A;  3VOZ A;  1L0E A;  3QNB A;  4QHC A;  2FFY A;  3A3E A;  3DWZ A;  1RGZ A;  3P09 A;  1CEF A;  4R4S A;  3G31 A;  2QMI A;  3W4P A;  1PWC A;  4OOY A;  2IWC A;  4E3M A;  5E2H A;  1CI8 A;  3W4Q A;  2IWD A;  4DE1 A;  3LY3 A;  3WWX A;  2Y2M A;  3FKV A;  3SOI A;  2RL3 A;  1FOF A;  3ZG7 B;  2WK0 A;  2ZQ9 A;  3GVB A;  3SS5 A;  2ZC4 B;  2QPN A;  1XA7 A;  3DW0 A;  1MPL A;  1TEM A;  2EFX A;  5A93 A;  1CI9 A;  3WS4 A;  3WS2 A;  3SH9 A;  2HP9 A;  1MWT A;  3IWO A;  1QMF A;  4KZ6 A;  4RVA A;  4Y7P A;  3BEC A;  3MZF A;  3EQV A;  4N1H A;  4BJP A;  1WYB A;  3ITB A;  2XH9 A;  4OQ0 A;  3M2J A;  4OH0 A;  2V20 A;  1XPB A;  4EV4 A;  1QME A;  4JF6 A;  1KDW A;  1BZA A;  4ZJ2 A;  1K55 C;  2OLV A;  3CZD A;  3FV7 A;  4E3L A;  3VSL A;  4UA6 A;  5M18 A;  4WZ5 A;  2B5R A;  5L2F A;  3NCK A;  2P9V A;  3Q7V A;  4OPQ A;  5AQB A;  3PTE A;  5M19 A;  3RJU A;  3PBO A;  1RCJ A;  2G2W A;  3ZG5 A;  3RXW A;  2IWB A;  2WAD A;  3CG5 A;  2OV5 A;  1XGI A;  4PM7 A;  4B88 A; 
#chains in the Genus database with same CATH topology
 4Z2L A;  3AZJ B;  1M19 A;  5AV8 B;  4NXG A;  3L27 A;  3N8R A;  1SDE A;  3REH A;  4BL3 A;  4J8V A;  2ZM0 A;  1ESI A;  5F5Y A;  1P3G A;  2Y2K A;  2H0T A;  1U35 C;  3MQO A;  2ZL1 B;  2RVQ D;  5EEC A;  3REI C;  5E5A B;  3AFA B;  3C1C D;  1EAK A;  2WZX A;  3SH8 A;  3KS4 A;  4XZQ C;  4ZJ3 A;  4S2N A;  3NJA A;  4LV3 A;  3UE0 A;  5EVI D;  3IX3 A;  4G3K A;  3CLO A;  2CV5 A;  1DJB A;  2X02 A;  1S32 B;  4BWI A;  4X25 A;  4Y0O A;  1PZP A;  3B6G A;  1E15 A;  1P3B D;  3UPP A;  1P3F D;  1YLZ A;  3Q81 A;  4F3L B;  5D3O A;  3BWL A;  1PZR A;  3TW8 A;  3VSK A;  4WEJ A;  3IS2 A;  2PT7 A;  4LRX C;  3A3J A;  3EEA A;  3KUY D;  1W63 M;  1XJ2 A;  3G2Y A;  4EEP A;  3AZE A;  3NOP C;  1NRF A;  4IJE A;  1KX4 A;  1F98 A;  4CAY A;  4YS3 A;  1M18 D;  5I94 A;  3W8K A;  5GT0 B;  1DY6 A;  1NZU A;  3WRT A;  2J9P A;  1H0I A;  3BFG A;  4MDZ A;  3NDG A;  3KSY A;  2VZW A;  1XXM A;  2XRN A;  3BLM A;  4NG2 A;  1DP6 A;  1NJ4 A;  4ETX A;  2RVQ C;  3B3X A;  3Q07 A;  4YIN A;  3C1C C;  3UE1 A;  4QJG A;  3N8S A;  5GLB A;  3OOV A;  2W3D A;  4R0Q A;  5EVI C;  4HGA B;  1NXY A;  3M6B A;  3V39 A;  5AV6 A;  4OKP A;  4Z66 B;  1P3F C;  5E2G A;  2OLU A;  1HLU P;  4KGC D;  2V0U A;  2Z6D A;  3MGQ B;  1SKF A;  2WKH A;  5B33 A;  3FDD A;  4S2M A;  3KUY C;  4DXC A;  1KE4 A;  3SW1 A;  4IBR A;  1P3O A;  1P3I A;  2H10 A;  2JKG A;  5BO0 B;  1P3G B;  3WAA D;  1ONH A;  3NOU C;  5J7E A;  5E43 A;  2ZC5 B;  4S2O A;  1M18 C;  1V9Z A;  3LGO A;  4ID4 A;  1KDS A;  2ZQA A;  1XA1 A;  1YT4 A;  2Z6C A;  3E0Y A;  5G18 A;  4PM8 A;  4EXO A;  2PU2 A;  4KEN B;  3AZH D;  1S1Y A;  3WTP E;  1IFQ A;  1K25 A;  5CPJ B;  3B6G B;  4JJN A;  1P3M D;  3MBZ A;  3X1U D;  5CRF A;  4CPK A;  4IVI A;  3E4Q A;  1B67 A;  4WEL A;  3IS2 B;  3GMW A;  4XUJ A;  2YFV B;  4OJL A;  2F8N K;  5A92 A;  5B2I A;  4H9O B;  2A49 A;  5F99 D;  4KGC C;  1KX4 B;  4CAY B;  3KXB A;  3HON A;  4YS3 B;  2VEA A;  5DVA A;  5B0Z A;  3A6N D;  3ZQ5 A;  2W27 A;  4DRA A;  3WD3 A;  3MZD A;  4WL9 A;  3IXD A;  5BNV A;  1CF0 A;  4JXW A;  1G28 A;  1XP4 A;  3QNC A;  1K57 C;  2Y2Q A;  1S1Z A;  1P3K B;  5GL9 A;  4CSR B;  4ZUX A;  1CXW A;  1YQS A;  4IBX A;  4OUI A;  4OOM A;  3TU4 A;  3VOL A;  4N1X A;  4UUZ A;  3AZH C;  4RX3 A;  4OJP A;  3VV4 A;  5DFY A;  2P74 A;  5AV6 B;  3E4P A;  3RH8 B;  3UT9 D;  1MKI A;  3MVD A;  1ONG A;  1P3M C;  3C7U A;  5FQ9 A;  2ZY4 A;  3X1U C;  4YNR A;  1PNE A;  3F1O A;  4NZ1 A;  1I2W A;  5L10 A;  5CTN A;  2ARO D;  5B33 B;  3VP4 A;  2BYK A;  4CJN A;  2OAP 1;  1YSQ A;  2KDK A;  1P3A A;  5F99 C;  1P3I B;  1ID3 D;  1AOI B;  1N9O A;  3GRJ A;  3LIC A;  4S2P A;  5FEG A;  3LEL D;  3A6N C;  2RTS A;  4NE3 A;  3LR4 A;  3MKF A;  5EPH A;  2ZQ8 A;  1TS8 A;  1DP9 A;  1O07 A;  1DRM A;  5GHX A;  5IU1 A;  4D2O A;  2HJ9 C;  5FAO A;  4Y3I A;  2G5H C;  3LJA A;  3HUO A;  4R1G A;  2Y8H A;  2DRW A;  4UA9 A;  2NQB D;  3TJZ C;  2P9V B;  1E25 A;  2JKF A;  1ZLA A;  1IYP A;  2D49 A;  5CP6 B;  1TD5 A;  2JKT I;  3A3F A;  2GZA A;  5JYO A;  1W2E A;  4XUJ B;  1KX5 A;  4DQY B;  3UT9 C;  3LID A;  1EI5 A;  2HDU A;  5B2I B;  4LCL A;  3O87 A;  4U3T A;  4PM6 A;  1K54 C;  3K3D A;  1TZY D;  3NI9 A;  2ARO C;  5B0Z B;  5CGW A;  3O88 A;  3AZJ D;  3X1S A;  3G6O A;  3KYQ A;  3LI9 A;  1ID3 C;  4BQM A;  3LEL C;  4J8X D;  2JN7 A;  4KZ9 A;  2NZD A;  1GA9 A;  4UHU A;  5FUG A;  3FZC A;  4DRB A;  3FC7 A;  3VFF A;  5HPF A;  1P9R A;  4KUD A;  2VKS A;  1ESU A;  1S0W A;  3AFA D;  2P08 A;  3AYW B;  2J3W A;  4UUZ B;  5FAT A;  5A8B A;  2ZQ7 A;  2PYO A;  3F1N A;  1ULY A;  1H8Y A;  3MVD B;  3B6F A;  2H5S A;  1MWU A;  2NQB C;  5J4E A;  2WAE A;  1A0K A;  4RYE A;  2XD1 A;  2BYK B;  2PU4 A;  2VGK A;  3AZN A;  3MGS A;  4KZ4 A;  3B0D C;  1P3A B;  3AGE A;  1F1E A;  1TZY C;  2UV0 E;  3LZ0 A;  2A24 B;  2YFW A;  5B1L A;  4FOF A;  1W7F A;  3AZJ C;  3P98 A;  5IS1 A;  3EEH A;  4K91 A;  4B4X A;  1Z09 A;  5E2F A;  3HSH A;  4OPY A;  1J9M A;  1U60 A;  1TAF B;  3EPH A;  5B31 G;  5DTT A;  1NLZ A;  5HW3 A;  1ES4 A;  4J8X C;  3AZM B;  1TF1 A;  3LIF A;  2QYB A;  2CC1 A;  4NZ4 A;  5FI7 A;  1ERM A;  5AJG A;  3KO6 A;  3Q1F A;  5TR7 A;  5HWW A;  2NUT C;  4E3N A;  4G3V A;  3AFA C;  4R8P B;  3KWQ D;  4F94 A;  3NQJ A;  1PWG A;  2Z2M B;  3IWQ A;  4NXF A;  4GDB A;  3WTP D;  1P3B A;  1VQQ A;  3IBJ A;  4NEE D;  1Y54 A;  3MQL A;  1PWD A;  4LRY C;  2XRO A;  1D7E A;  3S7Q A;  3G32 A;  3MGQ D;  3R7W A;  3SH7 A;  3X1S B;  1JVJ A;  3VH6 W;  2WKQ A;  1W79 A;  1DJA A;  4PHT A;  4J8W B;  1I5Q A;  3BY9 A;  4IED A;  2J8P A;  1FCN A;  3T4T A;  1KGF A;  2Y59 A;  2NZD B;  5EVE A;  1KE0 A;  4LV1 A;  1XJ4 A;  3UO9 A;  1SKO B;  2C6W B;  3REK A;  5B31 B;  5JRG B;  4N9K A;  4HH3 A;  1LT0 A;  1ZG4 A;  3AN2 A;  3AGD A;  4JF5 A;  3MNN B;  3KYZ A;  1LSX A;  3G34 A;  3QHY A;  1K55 A;  3B6F B;  2ZM2 A;  3E2L A;  5DNN A;  5CPJ D;  2A3U A;  5EM1 A;  3KWQ C;  2V1Z A;  5KZH A;  4H9R B;  3CWF A;  3AZN B;  3F6T A;  1N4O A;  3WTP C;  1GHP A;  1CJF A;  1PI5 A;  1YMS A;  4XXR A;  4HGA C;  4BBU A;  1LL5 A;  4MEZ A;  4DRT A;  3LZ0 B;  3C1B A;  3P7N A;  3OCL A;  4MN7 A;  4GS9 A;  4I3J A;  5KDM B;  4QPR A;  5AVC A;  3MGQ C;  4EO5 B;  3LI8 A;  5AVF A;  2VA0 A;  3FWL A;  4KG5 A;  3WAA A;  1EQZ B;  5F82 A;  2GX5 A;  4HJ4 A;  4X23 B;  2BYM B;  4O7D A;  4ZTK A;  3VOZ A;  4QU3 A;  1P3K D;  3W97 B;  3NHQ A;  3H9W A;  2F8N G;  1KX3 B;  3G31 A;  5B40 D;  2YKF A;  3NQJ B;  5B2J A;  2FJ7 B;  2HUE B;  5HWV A;  3DAV A;  4HH2 A;  2EWW A;  4DE1 A;  5BNX A;  3UTA B;  4MB5 A;  1YUE A;  4X1L A;  5CPJ C;  2HIO B;  1S4S A;  2ZMF A;  1TEM A;  1CI9 A;  3WS2 A;  3REJ A;  2HP9 A;  3AV2 B;  3IWO A;  4KZ6 A;  4RVA A;  4Y7P A;  4YWZ A;  2XH9 A;  4I3A A;  4OQ0 A;  2V20 A;  4EV4 A;  4WNN A;  4JF6 A;  1BH8 B;  3A1K A;  4E3L A;  3VSL A;  1AOI D;  1JFI B;  2DMW A;  2B5R A;  4WZ5 A;  3B0C T;  3NCK A;  3Q7V A;  3RXW A;  3FPV A;  2OV5 A;  1XGI A;  4CQH A;  1UR8 A;  2F2A C;  4PM7 A;  4AWL B;  5B32 D;  3BRM A;  1BUL A;  1P3K C;  1BYW A;  5EM0 A;  2O9B A;  2F8N B;  2XR0 A;  5DNN B;  2Y2L A;  4P6Z S;  3AZF B;  5B40 C;  1YLY A;  1ZG6 A;  3T4L A;  4PKY A;  3N8L A;  4DDS A;  5CP6 D;  2DNS A;  3A3I A;  1H8P A;  4DJ3 A;  1YLT A;  3HLC A;  4GDN A;  3W98 B;  3QP4 A;  4GS9 B;  3O5Y A;  3VMA A;  3T50 A;  1A7W A;  1IEL A;  1PI4 A;  1MY8 A;  2VGL S;  5AV5 A;  4MNR A;  3Q7Z A;  4EWF A;  1OT9 A;  1LI0 A;  4IJF A;  5KIZ A;  4UA7 A;  3MGP A;  4C3Q A;  5GXQ A;  1AOI C;  3GTC A;  3CJM A;  4S2L A;  3LZ1 A;  5DJU A;  3L29 A;  1K6S A;  5B32 C;  2I72 A;  5FAQ A;  4PKY G;  3E98 A;  3AYW D;  1UGU A;  3LY4 A;  3V3S A;  3QP6 A;  4WU8 A;  5HFO A;  4ZJ1 A;  3NIA A;  3C30 A;  4LLO B;  3IWI A;  4MN5 A;  5CP6 C;  4LGW A;  3S1Y A;  3P5J B;  3VH6 T;  1HQ3 A;  4JBF A;  2OWH A;  5L09 A;  1T1C A;  1KE3 A;  2ZJ9 A;  3VOY A;  3SS3 A;  1L3L A;  4E44 A;  2X71 A;  4GHI B;  3W99 A;  3BFD A;  5GSU A;  1BT5 A;  3UTB B;  2HDQ A;  4KUK A;  3L26 A;  3AZM D;  2PD8 A;  4CLC B;  1JNU A;  3S7N A;  1PIO A;  2XK1 A;  4KG6 A;  3HJI A;  3B47 A;  1E6P A;  1TS0 A;  4R8P D;  3NDE A;  3AYW C;  4PMA A;  3MGR D;  4IBE A;  4LG2 A;  2V1A A;  4KUO A;  4KHA A;  1DP8 A;  3AZI B;  3W96 A;  3ZG8 B;  1P0Z A;  3X1T A;  3HJK A;  4UQI S;  5AV5 B;  3CUE A;  2IA2 A;  2WGW A;  3DTI A;  1OME A;  4BL2 A;  5DTS A;  5LBR A;  5GLC A;  3T4Q A;  1NYM A;  5DJT A;  3REL A;  4J8W D;  1VHM A;  4L9F A;  4YOF A;  2PDR A;  3G35 A;  3A0V A;  2K2N A;  1BLP A;  4S2I A;  3KSF A;  3VE4 A;  5B31 D;  3T1R A;  5JRG D;  1S67 L;  4FH2 A;  3ZG9 B;  1KS0 A;  4X69 A;  3AZM C;  4H9S A;  3MNN D;  2WKE A;  4HBT A;  4WU8 B;  4X1M A;  4HNB A;  4X6T A;  4QLC B;  4HOI A;  4H9N A;  2XQZ A;  5CHU A;  4R8P C;  3M7P A;  1Y28 A;  5JA4 A;  3WKJ B;  3MGR C;  4EQ1 A;  3T4O A;  4IBK A;  5HAP A;  5AVB B;  1BH9 A;  1B6W A;  2XGN A;  1W63 Q;  4WMC A;  3PXP A;  5HL1 A;  3CHW P;  1GHM A;  5L8M A;  5I5L A;  4Y0T A;  3TOI A;  4Z5T A;  4OP8 A;  4IUK A;  1H3O B;  4H9P A;  5B0Y A;  1EQZ D;  4J8W C;  1YU2 A;  2JC7 A;  1ZTU A;  2CMN A;  3VFH A;  2KLI A;  4IBJ A;  3HLG A;  5CPI A;  3W97 D;  3TSG A;  3O62 A;  5B31 C;  4WU9 A;  3CPT B;  5JRG C;  5HPI A;  4C6Y A;  1KX3 D;  1KGG A;  2FZ0 A;  3MNN C;  2FJ7 D;  1TVF A;  4LCM A;  5CPK A;  4KHA B;  1ES2 A;  2RCX A;  4MBF A;  3UTA D;  1W5D A;  3A0S A;  5CGS A;  1E6R A;  2HIO D;  3HLW A;  3UPN A;  5F69 A;  1NWZ A;  3BFC A;  2VQR A;  3X1V A;  3AV2 D;  3T1Q B;  2WGI A;  1STZ A;  3PBQ A;  3WD2 A;  3AZK B;  1E3U A;  3TG9 A;  4NKP A;  3H82 B;  2JKR I;  3I7J A;  4Y5F A;  4DF6 A;  5HSQ A;  4Z2G A;  4NE5 A;  4NZ5 A;  1EQZ C;  3L25 A;  1CK3 A;  1M19 B;  4X23 C;  1P3L D;  3REH B;  3LYX A;  4GW9 A;  4J8V B;  3W97 C;  4R23 A;  5AQA A;  2F8N D;  1K6R A;  4EER A;  1W1P A;  5AV9 A;  3AZF D;  1KX3 C;  1AWI A;  3VP2 A;  2FJ7 C;  2X01 A;  1M40 A;  1F66 D;  1XJ6 A;  1LSW A;  3CMZ A;  1K4F A;  5M1A A;  1BH9 B;  3UTA C;  1PDC A;  3N3F A;  2HIO C;  3R45 A;  5AQ9 A;  4UPK A;  3W98 D;  4MB4 A;  3QP8 A;  3MXR A;  2HP5 A;  3GQZ A;  4GD8 A;  2V5O A;  2CV5 B;  4H9P B;  3IP4 C;  5DNM A;  3AV2 C;  4OJ5 A;  2Y4A A;  3DTK A;  4G92 B;  1CEG A;  2Z2L B;  1MZU A;  2ZY2 A;  1C3B A;  2PR6 A;  5FQK A;  2QJ5 A;  3UB8 A;  1WE4 A;  5L07 A;  1H8Z A;  3BQ8 A;  2Y2O A;  4IBB A;  4DE0 A;  2G7U A;  5F68 A;  5TBM A;  4WU9 B;  3WA9 A;  3AZE B;  4GOG A;  3PYP A;  1O7E A;  2IO5 B;  5AY8 A;  2Y2N A;  5EV0 A;  5B1M A;  4ZDX A;  1P3L C;  3EWK A;  5B24 A;  3FKW A;  3IF6 C;  4GJ4 A;  5GHY A;  3OCN A;  3OPH A;  5HAQ A;  3LCE A;  2Y2I A;  4NY2 A;  3IH9 A;  3AZF C;  1N9L A;  4JPM A;  5DF9 A;  5HX9 A;  1IYO A;  2UWX A;  3HL9 A;  5GT3 A;  3A3D A;  4EUV A;  3PBS A;  1GSX A;  1F66 C;  4LV2 A;  4J8U A;  2EXA A;  5BS7 A;  4HJ3 A;  1SHV A;  3HUM A;  3LEQ A;  4I39 A;  4X56 A;  3ZVW A;  1E6N A;  2O9A A;  1ED7 A;  5DKK A;  3W98 C;  4E45 A;  4MN6 A;  4FTX A;  4ARZ A;  3C4O A;  2J80 A;  2ZMV A;  4IBF A;  4LD9 A;  3VP0 A;  1Z2C B;  2WGV A;  1G6A A;  4EBN A;  2Q9N A;  5CED A;  3UTB D;  1P34 A;  3BFF A;  5HD3 A;  3KX0 X;  1P3P D;  4CLC D;  3V50 A;  4NE6 A;  4R4R A;  3AZL A;  4WM9 A;  2GDN A;  4B9O A;  3EPJ A;  1P3O B;  1GXD A;  1IOU A;  2R9W A;  3HVF A;  3IHA A;  1JTD A;  3IXB A;  3OPP A;  4YM6 A;  1VM1 A;  3CAX A;  4JGR A;  5E2E A;  5DF8 A;  3S22 A;  1L2S A;  3PBT A;  4R70 A;  3HCY A;  3AV1 A;  4Z2M H;  4OP5 A;  2JSS A;  3R45 B;  3AZI D;  2FH5 A;  5TGF A;  1E8B A;  4QB8 A;  3MSH A;  4YFM A;  3ZNT A;  5DNM B;  1GA0 A;  2NUP C;  5A90 A;  3VH5 A;  1KGE A;  3JVV A;  4WLA A;  4JJN B;  3AZG A;  4E04 A;  4HI4 A;  3KSH A;  3PBN A;  5IT5 A;  3PBR A;  4E3K A;  5FEF A;  1VB6 A;  4Q0I A;  1IEM A;  1M1A A;  3UDI A;  5TBM B;  2I9V A;  2HF6 A;  5HD5 A;  5AY8 B;  3KXB B;  4Q8I A;  5B1M B;  4NXB A;  4H9Q A;  1ERO A;  5B24 B;  3UTB C;  1P3P C;  4Y15 A;  5AV8 D;  5GLA A;  4CLC C;  2P04 A;  5BNV B;  1K56 D;  3D4F A;  3B0C W;  4QLC D;  1U35 A;  4J8U B;  3WKJ D;  3REI A;  3DTM A;  2HZ5 A;  4ZUX B;  4Z1W A;  3QNB A;  3VH6 A;  3R4K A;  4GHA A;  3A3E A;  3A0R A;  1OJG A;  2W3H A;  4XZQ A;  3GDI A;  5AVB D;  5E5A D;  3AZI C;  2ZBB A;  3EOI A;  3TU4 B;  3NQU A;  2IWC A;  1EW0 A;  4E3M A;  1J3W A;  4ME4 A;  4LD9 B;  2RL3 A;  3SOI A;  1S32 D;  3F1O B;  3MQQ A;  3SS5 A;  1XA7 A;  1P34 B;  1MPL A;  2EFX A;  3F1P A;  2W3F A;  3SH9 A;  1MWT A;  2XA7 S;  3AZL B;  4H6J A;  4BJP A;  2M7V A;  4WF0 A;  3ITB A;  1TS7 A;  4YM6 B;  1QME A;  3FV7 A;  3VH5 W;  5AV8 C;  4DJ2 A;  3AV1 B;  4K08 A;  1W1Y A;  5GT0 D;  4OJ6 A;  3PBO A;  4L9E A;  4QLC C;  2IWB A;  2WAD A;  3CG5 A;  3QP1 A;  3EPL A;  1CK7 A;  3WKJ C;  1MBL A;  3C7V A;  3LJA B;  2DF4 C;  4JXS A;  3C1C A;  3ISG A;  3TE8 A;  3BLS A;  5AVB C;  5E5A C;  2QJ7 A;  4DKI A;  3AZK D;  1ZLA B;  5EVI A;  2YKH A;  4EW7 A;  4DN0 A;  1M1A B;  1KX5 B;  1F2K A;  1LSV A;  4XT2 A;  4Y17 A;  1P3F A;  2JCH A;  1ERQ A;  1S32 C;  2ZOI A;  4H9Q B;  3S7O A;  4Z66 D;  4IJG A;  5CHL B;  2EX9 A;  2J7V A;  4GN2 A;  4PAU A;  4JLF A;  1M19 D;  2Y2P A;  3KUY A;  4MBH A;  3REH D;  4J8V D;  1N9N A;  3FKE A;  4Z2M G;  1U35 B;  1M18 A;  1P3G D;  5FUG B;  3W4O A;  4PM9 A;  4DXB A;  1H8M A;  3IX4 A;  1KVL A;  4KQO A;  4FCF A;  2IOU A;  4KUD B;  5GT0 C;  5EOO A;  1HZO A;  2OWJ A;  2ZM5 A;  2PYO B;  3F1N B;  3S4X A;  2CV5 D;  2HDR A;  3LO7 A;  1I2S A;  3B6G D;  3AZK C;  2L5A A;  1OTD A;  4RQ9 A;  1L0D A;  3F1P B;  3MGS B;  1VET A;  4WBG A;  1YLP A;  3B33 A;  3UB7 A;  3WRZ A;  3HRE A;  4HP4 A;  4H6J B;  4KGC A;  4FSF A;  1LLB A;  3NUL A;  4Z66 C;  3AZE D;  2YFW B;  5B1L B;  1K0K A;  1HVB A;  4P6B A;  4WZS B;  1KX4 D;  3LR3 A;  4YS3 D;  1M19 C;  2LB9 A;  3RXX A;  3REH C;  5DFX A;  2ZLY A;  4WEK A;  3K3C A;  3G2Z A;  4J8V C;  3DWK A;  3ZVT A;  1E4D A;  1K57 A;  1KOU A;  3W2Z A;  3EQU A;  2L0W A;  3RTY A;  1P3G C;  3MS6 A;  4I5S A;  4KQQ A;  2PYP A;  3UDX A;  4WJ3 C;  4KZA A;  4WUJ A;  5HDS A;  5HWT A;  4GB7 A;  4EBP A;  1AXB A;  3IQA A;  3AZH A;  1Y4O A;  3ZFZ A;  1T1B A;  1V9Y A;  4N92 A;  4S2N C;  4EUZ A;  1Q2P A;  1RP5 A;  1P3B B;  3FPW A;  1P3F B;  1P3M A;  1L0G A;  1BSG A;  2CV5 C;  3X1U A;  5AV6 D;  5CEC A;  5BT1 D;  3B6G C;  1OGB A;  3WD1 A;  1XJ3 A;  3WS5 A;  4BD1 A;  3R7W B;  3KUY B;  5B33 D;  2OAQ 1;  2XFT A;  2Q9M A;  1T19 A;  5F99 A;  4S2K A;  4ETZ A;  4IBI A;  2CWE A;  2EA9 A;  1BUE A;  1HD8 A;  1D1J A;  3AZE C;  1MWR A;  2VLG A;  4UEY A;  3A6N A;  1P3O D;  3H0M C;  1P3I D;  1KX4 C;  4R3J A;  4YS3 C;  4HJ6 A;  4HMC A;  3UPO A;  3REK B;  3OBF A;  2OOL A;  3H7W A;  3AN2 B;  3D3O A;  3ZHH A;  4OPR A;  3WS0 A;  5KSH A;  2Y2G A;  2PHY A;  1PYY A;  4JJN D;  2GNX A;  1YSP A;  2W3E A;  3EPK A;  3MZE A;  3UT9 A;  1VET B;  3LIE A;  3BM6 A;  1JWZ A;  1ES5 A;  3KSI A;  1NYY A;  4Z2I A;  5AV6 C;  5FI2 A;  4XUJ D;  1K54 A;  5G49 A;  5BT1 C;  3C1B B;  3UE3 A;  5B2I D;  2ARO A;  2ZY3 A;  1ES3 A;  2AVX A;  5CHM A;  2H28 A;  4C75 A;  3KXB D;  5AVC B;  3C4P A;  4DDY A;  5B33 C;  1ALQ A;  5B0Z D;  3ZNY A;  5EE8 A;  3WAA B;  1ID3 A;  3VH5 T;  2M1C A;  4HEF A;  3LEL A;  1P3O C;  4GH9 A;  1P3I C;  3JPU A;  5JYP A;  1XKZ A;  4OJO A;  4A5R A;  4WYY A;  4ZUX D;  5GHZ A;  1CQA A;  2EFU A;  1G5U A;  5B2J B;  4KZ7 A;  4ZRR A;  5CEB A;  1LHY A;  3TU4 D;  5BNX B;  4Y2F A;  2G2U A;  3ZDJ A;  4OQI A;  2B95 A;  3X1U B;  2LB5 A;  2NQB A;  4OQH A;  1YU0 A;  2XLN A;  3KYE A;  4ZBE A;  3MVD D;  4JJN C;  2HGV A;  4K0X A;  3REJ B;  5TJJ A;  2XEP A;  3O3V A;  5F99 B;  4XUJ C;  1TZY A;  4GCZ A;  1KU5 A;  5B2I C;  3BFE A;  3WX7 A;  1P3A D;  1N1J A;  4WNN B;  3A6N B;  3AZJ A;  1OTI A;  3KXB C;  5B1M C;  4X55 A;  3HLF A;  3B42 A;  5B0Z C;  3Q7V B;  4OLD A;  1L6J A;  3H7W B;  1RGY A;  4J8X A;  3T4K A;  1WWS A;  3M2K A;  3BY8 A;  2ZL1 A;  3LJA D;  4ZUX C;  4IVK A;  2W1R A;  3AFA A;  4JKT A;  2VV8 A;  3HUN A;  4DE3 A;  4IUH A;  3UT9 B;  1T18 A;  3TU4 C;  1ZLA D;  3ICY A;  5FI6 A;  4GZB A;  3L9K A;  3IHB A;  4JXG A;  1OTA A;  1KX5 D;  2VK3 A;  1YLJ A;  3MVD C;  2PYR A;  4F3L A;  3K2N A;  4E6X A;  2WUQ A;  2XF3 A;  3V5M A;  4PM5 A;  4FH4 A;  4BEN A;  3X1S D;  1BLC A;  3KSG A;  1P3A C;  3MGP B;  5A91 A;  5FA7 A;  3CI6 A;  5GXQ B;  3JVU A;  3LZ1 B;  2NZD D;  3EG5 B;  3WD4 A;  4CLC E;  2BG1 A;  4O8G A;  4HES A;  4KUD D;  4KZB A;  2B02 A;  1IKI A;  4RA7 A;  5CXW A;  1UR9 A;  4KG2 A;  2PYO D;  3LJA C;  2JKT M;  4FD8 A;  3KWQ A;  3B6F D;  4X68 A;  5G4Z A;  1H3Q A;  3UNW A;  1BFM A;  3WTP A;  4Z9Q A;  1ZLA C;  4I3I A;  3B0D B;  3T12 B;  1X0O A;  3NY4 A;  3AZN D;  1KX5 C;  2VGJ A;  3MGS D;  3CIT A;  3VP1 A;  3ZGA B;  1MXO A;  4P6Z M;  1N1J B;  1HQ3 B;  2J8Y A;  3SZT A;  3LZ0 D;  3MGQ A;  3A1I A;  5B1L D;  3DTE A;  4Q0H A;  3MF0 A;  4RX2 A;  3X1S C;  2E8J A;  4J8X B;  3W99 B;  4Z2H A;  5GSU B;  5BO0 A;  1GPF A;  2XFS A;  2V0W A;  3WD0 A;  2L1M A;  3ULF A;  4X23 D;  2VGL M;  2Q0O A;  2PRF A;  2NZD C;  1W8Q A;  2PAV P;  3QP5 A;  1EWZ A;  3NBL A;  3IF5 A;  3UB5 P;  4M4X A;  4KUD C;  1Q2Q A;  1DJC A;  4DE2 A;  2Y91 A;  2PYO C;  4L0L A;  5CPJ A;  3B6F C;  3W96 B;  1YM1 A;  3X1T B;  1OTB A;  4Y13 A;  1FR1 A;  4EES A;  2WGW B;  4NYU A;  3AZN C;  2YFV A;  3MGS C;  1JTG A;  2HPB A;  4H9O A;  3H0R C;  3EGD C;  3GV9 A;  3V67 A;  3REL B;  3LZ0 C;  1TDG A;  1K4E A;  1TDL A;  5MC7 A;  2Y79 A;  2LY8 A;  5B1L C;  5EOE A;  4NET A;  2K31 A;  1ODV A;  4EO5 C;  3REK D;  4LRZ E;  4XUX A;  1IYQ A;  4MMN A;  4K0W A;  3AN2 D;  1P3K A;  2H0Y A;  3UE6 A;  1T1A A;  2W1T A;  2EWV A;  4ZBJ B;  1ZKJ A;  4CSR A;  3T1S A;  3KWQ B;  5B40 A;  5DNN D;  4NK3 A;  4QY5 A;  4H9N B;  3WTP B;  1YU1 A;  5JA4 B;  4S2J A;  3M6H A;  2HUE C;  2ZM8 A;  1E6Z A;  3UB6 A;  4E3O A;  1P3B C;  2WAF A;  1WA9 A;  5J3W A;  1YU3 A;  1Q9C A;  3NEC A;  3C1B D;  1RGZ A;  1CEF A;  2D02 A;  4R4S A;  2QMI A;  4Z5T B;  3W4P A;  5AVC D;  4OOY A;  1VEU A;  3OLO A;  5B0Y B;  5E2H A;  1CI8 A;  3W4Q A;  3V9R A;  3LY3 A;  3WWX A;  2INW A;  1FOF A;  1AOI A;  4GHL A;  2ZQ9 A;  4HQA A;  4UQI M;  3GVB A;  4EU0 A;  2ZC4 B;  2QPN A;  1H0G A;  3DW0 A;  3GEC A;  1HTA A;  5CPI B;  3WS4 A;  3O62 B;  3REK C;  4QNL A;  5B32 A;  3MZF A;  4N1H A;  3AN2 C;  1WYB A;  4GLQ A;  5B2J D;  4OH0 A;  4AWL C;  5CPK B;  1BZA A;  2L4R A;  5EFW A;  1K55 C;  3CZD A;  2HJE A;  4UA6 A;  5FDS A;  5M18 A;  1O6I A;  5L2F A;  2V9A A;  5DNN C;  2P9V A;  4OPQ A;  5AQB A;  3PTE A;  3RJU A;  5CP6 A;  1RCJ A;  1S66 L;  2G2W A;  1R4V A;  3X1V B;  2ZY5 A;  3REJ D;  2RIQ A;  4B88 A;  4EET B;  1G68 A;  3C1B C;  1WYC A;  3AGF A;  1F9I A;  3VE3 A;  5AVC C;  4U0X A;  5KMW A;  5DKL A;  5CHJ A;  5DF7 A;  4Z2J A;  3WAA C;  1WWI A;  5B32 G;  2EX2 A;  2ZQD A;  2ZC3 B;  4GD6 A;  2W1T B;  5B40 B;  4Z2K A;  4FUW A;  4U0T A;  5AV9 B;  3T4S A;  3AYW A;  5B2J C;  4LPZ A;  5GLD A;  3G4P A;  1JWV A;  2HDS A;  1HTZ A;  2DCF A;  1PW8 A;  2VX8 A;  5FL3 A;  4GKU A;  1SCW A;  2R78 A;  1SDN A;  4HIA A;  3REJ C;  1VEU B;  1LI9 A;  3PHY A;  1XGJ A;  5AV5 D;  2Y2J A;  3V9R B;  1OT6 A;  3C2W A;  5IHV A;  5EUA A;  3JYI A;  2HP6 A;  2ZC7 A;  2A24 A;  3MGP D;  1YMX A;  3PAG A;  5GXQ D;  4WZ5 C;  1ZC2 A;  2JHE A;  4HP9 A;  2J9O A;  4TX8 A;  3LZ1 D;  3WA9 B;  1TAF A;  2PD7 A;  2ACG A;  5B32 B;  4KZ5 A;  2EXB A;  3AZM A;  1BLS A;  3LFV A;  4EQI A;  3AL0 C;  2ZC6 B;  4WU8 D;  4R8P A;  5FQI A;  4N9L A;  3MGR A;  5GT3 B;  4B93 A;  2GJ3 A;  3G30 A;  4IBG A;  3NC8 A;  2FFF B;  4XUZ A;  1HQ3 D;  4JGP A;  3S7P A;  2HV1 A;  4ARZ B;  1UWN X;  5AV5 C;  4O0P A;  2W3G A;  3GSG A;  4GNU A;  3BW6 A;  4J8W A;  1ZHH B;  1GHI A;  2W0N A;  3MGP C;  3W99 D;  5GSU D;  1XFQ A;  3DBA A;  1YAX A;  1K38 A;  5GXQ C;  3HLB A;  4OLG A;  3N7W A;  4HHD A;  3MXS A;  1SKO A;  3LZ1 C;  5B31 A;  5JRG A;  1Z6F A;  1GSV A;  4QD4 A;  2XSS A;  4ESP A;  3HLE A;  3MNN A;  4IHQ A;  1YPR A;  5FQJ A;  4G3W A;  2PR5 A;  4OVD A;  2W8S A;  2VJW A;  2F8N H;  2ZQC A;  5C3I B;  4G91 B;  4WU8 C;  4JF4 A;  4ZAM A;  2JBF A;  4E3J A;  2BAS A;  3PR6 A;  3W96 D;  1PZO A;  4JXV A;  4QWO A;  4MCW A;  4H9R A;  3X1T D;  5FDH A;  1UWP X;  2V2F F;  4NZ3 A;  4II7 A;  3AZG B;  1XFN A;  2XDM A;  1HQ3 C;  5BPV A;  5KDM A;  3REL D;  3BJN A;  3LR0 A;  3TRC A;  3VP3 A;  4HBU A;  3MKE A;  1T3U A;  3UN7 A;  2M7U A;  3OC2 A;  2J3T D;  1QO6 A;  1EQZ A;  3OPR A;  4EBL A;  1H5X A;  3W99 C;  4X23 A;  2BYM A;  1MWS A;  5GSU C;  1W1V A;  3U2A A;  3PAE A;  1YLW A;  3W97 A;  4WV4 B;  4LEN A;  1MKM A;  1KX3 A;  2DQN C;  4P85 A;  4OOL A;  2FJ7 A;  3MGR B;  4IBD A;  2O9C A;  5FQM A;  1KVM A;  4R3B A;  2ZD8 A;  3HBR A;  3REI B;  1J7M A;  5FSR A;  3UTA A;  4HMD A;  1S4R A;  2HIO A;  2O99 A;  4XZQ B;  4B4Z A;  2QHK A;  3W96 C;  3D72 A;  4NXE A;  3NQU B;  3X1T C;  4WMC D;  3MFD A;  3V3R A;  3AV2 A;  1GCE A;  3CUE C;  4Z5T D;  4R38 A;  3N6I A;  4MLL A;  5B0Y D;  3D9Y A;  3O86 A;  4OQG A;  1BH8 A;  4O01 A;  3BYD A;  3REL C;  1JFI A;  2R9X A;  4OON A;  4BD0 A;  2QKP A;  2J3T C;  4HY8 A;  5CPI D;  3ZG0 A;  1BLH A;  3O62 D;  4WU9 D;  4P0M A;  1P3L A;  3FG8 A;  3IF6 A;  5F6A A;  1F5M A;  3P01 A;  3IXG A;  4EEU A;  1JWP A;  4H9S C;  1W8Y A;  3OZH A;  5AQ7 A;  2F8N A;  5CPK D;  4P87 A;  4ZBJ C;  3AZF A;  4JGO A;  5CGX A;  2WKI A;  1PFL A;  2ZOH A;  2EX8 A;  1F66 A;  4Y0U A;  3L28 A;  1SZV A;  3E4O A;  3C1C B;  1OTE A;  3X1V D;  1YU4 A;  1OPX A;  3W98 A;  1E88 A;  5EVI B;  3MQ0 A;  1E3U D;  1FR6 A;  4XT2 B;  2JE5 A;  2XD5 A;  4Z5T C;  4E3I A;  4PPR A;  5B0Y C;  4KZ8 A;  4G92 C;  1M6K A;  3ZCZ A;  3ZYT A;  4H8R A;  2Y2H A;  3BEB A;  5J8X A;  3C5A A;  5AVE A;  2ZMA A;  4LV0 A;  3MR0 A;  3H0L C;  4Q0J A;  4QY6 A;  5F1F A;  1FCO A;  1FIL A;  5F83 A;  5CPI C;  3O62 C;  3HLD A;  2KOI A;  4WU9 C;  3SS4 A;  1M18 B;  5AV9 D;  2IO5 C;  2WZZ A;  5F1G A;  3UDF A;  5BOH A;  1OJ5 A;  2V1B A;  4MB3 A;  3MXQ A;  1IYS A;  5CPK C;  4X53 A;  2XA7 M;  3UB9 A;  1FSW A;  2KX6 A;  1LL8 A;  5CX7 A;  4WZ4 A;  5U47 A;  1NZO A;  4LFU A;  5HDD A;  3X1V C;  4IBC A;  5DNM D;  2JKR M;  5HAI A;  4M3K A;  3B0B A;  1FSY A;  3LR5 A;  1BTL A;  2O0Y A;  3L7H A;  1MC0 A;  3IT9 A;  4KGC B;  4GHI A;  1FIK A;  1S6R A;  3WA9 D;  1P3L B;  3IF6 B;  3UTB A;  2E8I A;  2VV7 A;  5AY8 D;  2V8C A;  5B1M D;  1P3P A;  1NY0 A;  1G6O A;  2A2L A;  2BLS A;  5CER A;  4CLC A;  5B24 D;  5HAR A;  1FCM A;  3C38 A;  3GR2 A;  1YKD A;  1PW1 A;  1P9W A;  3IBR A;  5EVL A;  4E6W A;  5AV9 C;  2C5W B;  1F66 B;  3IXH A;  3UY6 A;  4JGQ A;  3ITA A;  5GT3 D;  5K5B A;  5FQQ A;  4J8U D;  1ACF A;  4I38 A;  1IKG A;  3UMD A;  3AZI A;  5HL6 A;  1P97 A;  3AZH B;  1FQG A;  1H0M A;  5KSC A;  3NOT C;  2PBY A;  2QZ6 A;  2WYX A;  2Y55 A;  5C5K A;  5CTM A;  5HDC A;  1P3M B;  5DNM C;  3MFX A;  2WKP A;  2VV6 A;  1GSW A;  4M6B A;  4LD9 D;  3U4L P;  3KFU G;  1NLY A;  3Q82 A;  1W1T A;  1P34 D;  2FN2 A;  2WKR A;  3IH8 A;  5G4Y A;  4UAA A;  4D60 A;  3WA9 C;  3AZL D;  2PBD P;  5AY8 C;  4BLM A;  5AV8 A;  5FAP A;  2K7S A;  5B24 C;  4YM6 D;  1GOI A;  1K56 A;  4BMW A;  4KQD A;  3KS8 A;  3OPL A;  4KZ3 A;  1L0F A;  4L9G A;  5TFQ A;  4QLC A;  3AV1 D;  1N9B A;  2EX6 A;  2V8F A;  3WKJ A;  5GT3 C;  3E2K A;  2OSU A;  4J8U C;  1D06 A;  3RFB A;  5BS7 C;  1OGG A;  5AVB A;  5E5A A;  3UME A;  3LEZ A;  3AZG D;  4OPZ A;  4NFT A;  3MJQ A;  3WS1 A;  3FYZ A;  3QP2 A;  4MBK A;  2MJ6 A;  3N4I A;  1PRQ A;  1H3O A;  5DTK A;  5FAS A;  1S32 A;  1M1A D;  1AIW A;  1XX2 A;  5G49 B;  4BBV A;  1LL9 A;  2ARO B;  2BTF P;  4KQR A;  4LD9 C;  3BQA A;  1L0E A;  4QHC A;  4WN5 A;  2FFY A;  1P3P B;  3DWZ A;  3P09 A;  1P34 C;  1PWC A;  1ID3 B;  2QWS A;  3AZL C;  3CPT A;  3MMH A;  3LEL B;  2IWD A;  3EGX C;  2P7J A;  2Y2M A;  3FKV A;  3T1X A;  3ZG7 B;  2WK0 A;  5HZH A;  3IX8 A;  4YM6 C;  1U35 D;  3LUQ A;  4DMZ A;  3REI D;  5GT0 A;  2D01 A;  5C3I C;  5A93 A;  4G91 C;  3AV1 C;  3L2A A;  4AFI A;  1TS6 A;  4XZQ D;  1QMF A;  3T4J A;  3BEC A;  4HME A;  3EQV A;  4R3A A;  4NYY A;  3LIA A;  3LIB A;  3M2J A;  2NQB B;  1XPB A;  1KDW A;  4ZJ2 A;  2G5I C;  2OLV A;  3AZK A;  3AZG C;  1NRJ A;  3H82 A;  5M19 A;  2B18 A;  3ZG5 A;  1M1A C;  1TZY B;  3C8C A;  4BBT A;  4Z66 A;  4R6L A; 
#chains in the Genus database with same CATH homology
 3AZJ B;  1M19 A;  5AV8 B;  3L27 A;  3N8R A;  1SDE A;  3REH A;  4BL3 A;  4J8V A;  2ZM0 A;  1ESI A;  1P3G A;  2Y2K A;  2H0T A;  1U35 C;  2RVQ D;  5EEC A;  3REI C;  5E5A B;  3AFA B;  3C1C D;  2WZX A;  3SH8 A;  3KS4 A;  4XZQ C;  4ZJ3 A;  4S2N A;  3UE0 A;  4LV3 A;  5EVI D;  2CV5 A;  1DJB A;  2X02 A;  1S32 B;  4Y0O A;  1PZP A;  3B6G A;  3UPP A;  1P3B D;  1P3F D;  1YLZ A;  3Q81 A;  5D3O A;  1PZR A;  3VSK A;  4WEJ A;  3A3J A;  3KUY D;  3G2Y A;  3AZE A;  1NRF A;  4IJE A;  1KX4 A;  4CAY A;  4YS3 A;  1M18 D;  5I94 A;  3W8K A;  5GT0 B;  1DY6 A;  1NZU A;  3WRT A;  2J9P A;  3BFG A;  3NDG A;  3KSY A;  1XXM A;  3BLM A;  1NJ4 A;  2RVQ C;  3B3X A;  3Q07 A;  4YIN A;  3C1C C;  3UE1 A;  4QJG A;  3N8S A;  5GLB A;  4R0Q A;  5EVI C;  4HGA B;  1NXY A;  3M6B A;  3V39 A;  5AV6 A;  4OKP A;  4Z66 B;  1P3F C;  5E2G A;  2OLU A;  4KGC D;  3MGQ B;  1SKF A;  2WKH A;  5B33 A;  3FDD A;  4S2M A;  3KUY C;  4DXC A;  1KE4 A;  4IBR A;  1P3O A;  1P3I A;  2H10 A;  5BO0 B;  1P3G B;  3WAA D;  1ONH A;  5E43 A;  2ZC5 B;  4S2O A;  1M18 C;  4ID4 A;  1KDS A;  2ZQA A;  1XA1 A;  1YT4 A;  5G18 A;  4PM8 A;  2PU2 A;  4KEN B;  3AZH D;  3WTP E;  1K25 A;  5CPJ B;  3B6G B;  4JJN A;  1P3M D;  3MBZ A;  3X1U D;  5CRF A;  4CPK A;  4IVI A;  1B67 A;  4WEL A;  3GMW A;  4XUJ A;  2YFV B;  4OJL A;  2F8N K;  5A92 A;  5B2I A;  4H9O B;  2A49 A;  5F99 D;  4KGC C;  1KX4 B;  4CAY B;  3KXB A;  3HON A;  4YS3 B;  5DVA A;  5B0Z A;  3A6N D;  4DRA A;  3MZD A;  3IXD A;  5BNV A;  4JXW A;  1XP4 A;  3QNC A;  1K57 C;  2Y2Q A;  1P3K B;  5GL9 A;  4CSR B;  4ZUX A;  1YQS A;  4IBX A;  4OUI A;  4OOM A;  3TU4 A;  4N1X A;  4UUZ A;  3AZH C;  4RX3 A;  4OJP A;  2P74 A;  5AV6 B;  3UT9 D;  1MKI A;  3MVD A;  1ONG A;  1P3M C;  3C7U A;  5FQ9 A;  2ZY4 A;  3X1U C;  4NZ1 A;  1I2W A;  5CTN A;  2ARO D;  5B33 B;  3VP4 A;  2BYK A;  4CJN A;  1P3A A;  5F99 C;  1P3I B;  1ID3 D;  1AOI B;  3GRJ A;  4S2P A;  3LEL D;  3A6N C;  3MKF A;  4NE3 A;  5EPH A;  2ZQ8 A;  1O07 A;  5GHX A;  4D2O A;  5FAO A;  2G5H C;  3LJA A;  3HUO A;  4R1G A;  2DRW A;  4UA9 A;  2NQB D;  2P9V B;  1E25 A;  1ZLA A;  1IYP A;  5CP6 B;  3A3F A;  5JYO A;  1W2E A;  4XUJ B;  1KX5 A;  4DQY B;  3UT9 C;  1EI5 A;  2HDU A;  5B2I B;  4LCL A;  3O87 A;  4U3T A;  4PM6 A;  1K54 C;  1TZY D;  3NI9 A;  2ARO C;  5B0Z B;  5CGW A;  3O88 A;  3AZJ D;  3X1S A;  1ID3 C;  4BQM A;  3LEL C;  4J8X D;  4KZ9 A;  2NZD A;  1GA9 A;  4UHU A;  5FUG A;  3FZC A;  4DRB A;  3VFF A;  4KUD A;  1ESU A;  1S0W A;  3AFA D;  3AYW B;  4UUZ B;  5FAT A;  2ZQ7 A;  2PYO A;  1ULY A;  1H8Y A;  3MVD B;  3B6F A;  2H5S A;  1MWU A;  2NQB C;  2WAE A;  4RYE A;  2XD1 A;  2BYK B;  2PU4 A;  2VGK A;  3AZN A;  3MGS A;  4KZ4 A;  3B0D C;  1P3A B;  3AGE A;  1F1E A;  1TZY C;  3LZ0 A;  2YFW A;  5B1L A;  1W7F A;  3AZJ C;  3P98 A;  4K91 A;  4B4X A;  5E2F A;  3HSH A;  4OPY A;  1J9M A;  1U60 A;  1TAF B;  3EPH A;  5B31 G;  5DTT A;  5HW3 A;  1ES4 A;  4J8X C;  3AZM B;  2CC1 A;  4NZ4 A;  5FI7 A;  1ERM A;  3Q1F A;  5TR7 A;  4E3N A;  3AFA C;  4R8P B;  3KWQ D;  4F94 A;  3NQJ A;  1PWG A;  2Z2M B;  3IWQ A;  4GDB A;  3WTP D;  1P3B A;  1VQQ A;  1Y54 A;  1PWD A;  3G32 A;  3MGQ D;  3SH7 A;  3X1S B;  1JVJ A;  3VH6 W;  1W79 A;  1DJA A;  4J8W B;  1I5Q A;  4IED A;  2J8P A;  1FCN A;  1KGF A;  2Y59 A;  2NZD B;  1KE0 A;  4LV1 A;  3UO9 A;  2C6W B;  3REK A;  5B31 B;  5JRG B;  4N9K A;  1ZG4 A;  3AN2 A;  3AGD A;  4JF5 A;  3MNN B;  3G34 A;  3QHY A;  1K55 A;  3B6F B;  2ZM2 A;  3E2L A;  5DNN A;  5CPJ D;  2A3U A;  3KWQ C;  2V1Z A;  5KZH A;  4H9R B;  3AZN B;  3F6T A;  1N4O A;  3WTP C;  1GHP A;  1PI5 A;  1YMS A;  4XXR A;  4HGA C;  1LL5 A;  4MEZ A;  4DRT A;  3LZ0 B;  3C1B A;  3OCL A;  5KDM B;  5AVC A;  3MGQ C;  4EO5 B;  3FWL A;  4KG5 A;  3WAA A;  1EQZ B;  5F82 A;  4X23 B;  2BYM B;  4O7D A;  4ZTK A;  3VOZ A;  4QU3 A;  1P3K D;  3W97 B;  2F8N G;  1KX3 B;  3G31 A;  5B40 D;  3NQJ B;  5B2J A;  2FJ7 B;  2HUE B;  4DE1 A;  5BNX A;  3UTA B;  1YUE A;  5CPJ C;  2HIO B;  1TEM A;  1CI9 A;  3WS2 A;  3REJ A;  2HP9 A;  3AV2 B;  3IWO A;  4KZ6 A;  4RVA A;  4Y7P A;  2XH9 A;  4OQ0 A;  2V20 A;  4EV4 A;  4WNN A;  4JF6 A;  1BH8 B;  3A1K A;  4E3L A;  3VSL A;  1AOI D;  1JFI B;  4WZ5 A;  2B5R A;  3B0C T;  3NCK A;  3Q7V A;  3RXW A;  2OV5 A;  1XGI A;  4PM7 A;  2F2A C;  4AWL B;  5B32 D;  3BRM A;  1BUL A;  1P3K C;  2F8N B;  2XR0 A;  5DNN B;  2Y2L A;  3AZF B;  5B40 C;  1YLY A;  1ZG6 A;  3N8L A;  4DDS A;  5CP6 D;  2DNS A;  3A3I A;  1YLT A;  3HLC A;  4GDN A;  3W98 B;  3VMA A;  1A7W A;  1IEL A;  1PI4 A;  1MY8 A;  5AV5 A;  4MNR A;  3Q7Z A;  4EWF A;  1LI0 A;  4IJF A;  4UA7 A;  3MGP A;  4C3Q A;  5GXQ A;  1AOI C;  3GTC A;  3CJM A;  4S2L A;  3LZ1 A;  3L29 A;  1K6S A;  5B32 C;  2I72 A;  5FAQ A;  3AYW D;  3LY4 A;  3V3S A;  4WU8 A;  5HFO A;  4ZJ1 A;  3NIA A;  3IWI A;  5CP6 C;  3S1Y A;  3P5J B;  3VH6 T;  1HQ3 A;  4JBF A;  1KE3 A;  2ZJ9 A;  3VOY A;  3SS3 A;  4E44 A;  2X71 A;  3W99 A;  3BFD A;  5GSU A;  1BT5 A;  3UTB B;  2HDQ A;  3L26 A;  3AZM D;  1PIO A;  2XK1 A;  4KG6 A;  4R8P D;  3NDE A;  3AYW C;  4PMA A;  3MGR D;  4IBE A;  4LG2 A;  4KHA A;  3AZI B;  3W96 A;  3ZG8 B;  3X1T A;  5AV5 B;  2WGW A;  1OME A;  4BL2 A;  5DTS A;  5GLC A;  1NYM A;  3REL A;  4J8W D;  3G35 A;  1BLP A;  4S2I A;  5B31 D;  5JRG D;  4FH2 A;  3ZG9 B;  4X69 A;  3AZM C;  4H9S A;  3MNN D;  2WKE A;  4HBT A;  4WU8 B;  4X6T A;  4QLC B;  4H9N A;  2XQZ A;  5CHU A;  4R8P C;  5JA4 A;  3WKJ B;  3MGR C;  4IBK A;  5HAP A;  5AVB B;  1BH9 A;  1B6W A;  2XGN A;  4WMC A;  5HL1 A;  1GHM A;  4Y0T A;  3TOI A;  4Z5T A;  4OP8 A;  1H3O B;  4H9P A;  5B0Y A;  1EQZ D;  4J8W C;  1YU2 A;  2JC7 A;  3VFH A;  4IBJ A;  3HLG A;  5CPI A;  3W97 D;  3TSG A;  3O62 A;  5B31 C;  4WU9 A;  5JRG C;  4C6Y A;  1KX3 D;  1KGG A;  3MNN C;  2FJ7 D;  1TVF A;  4LCM A;  5CPK A;  4KHA B;  1ES2 A;  2RCX A;  4MBF A;  3UTA D;  1W5D A;  5CGS A;  2HIO D;  3HLW A;  3UPN A;  3BFC A;  2VQR A;  3X1V A;  3AV2 D;  2WGI A;  3PBQ A;  3AZK B;  1E3U A;  3TG9 A;  3I7J A;  4DF6 A;  4NE5 A;  4NZ5 A;  1EQZ C;  3L25 A;  1CK3 A;  1M19 B;  4X23 C;  1P3L D;  3REH B;  4J8V B;  3W97 C;  4R23 A;  5AQA A;  2F8N D;  1K6R A;  5AV9 A;  3AZF D;  1KX3 C;  3VP2 A;  2FJ7 C;  2X01 A;  1M40 A;  1F66 D;  3CMZ A;  1K4F A;  5M1A A;  1BH9 B;  3UTA C;  3N3F A;  2HIO C;  3R45 A;  5AQ9 A;  4UPK A;  3W98 D;  3MXR A;  2HP5 A;  3GQZ A;  4GD8 A;  2CV5 B;  4H9P B;  3IP4 C;  5DNM A;  3AV2 C;  4OJ5 A;  2Y4A A;  4G92 B;  1CEG A;  2Z2L B;  2ZY2 A;  1C3B A;  5FQK A;  1WE4 A;  1H8Z A;  2Y2O A;  4IBB A;  4DE0 A;  4WU9 B;  3WA9 A;  3AZE B;  4GOG A;  1O7E A;  2IO5 B;  5AY8 A;  2Y2N A;  5B1M A;  4ZDX A;  1P3L C;  5B24 A;  3FKW A;  3IF6 C;  5GHY A;  3OCN A;  3OPH A;  5HAQ A;  3LCE A;  2Y2I A;  4NY2 A;  3IH9 A;  3AZF C;  4JPM A;  5DF9 A;  5HX9 A;  1IYO A;  2UWX A;  3HL9 A;  5GT3 A;  3A3D A;  3PBS A;  1F66 C;  4LV2 A;  4J8U A;  2EXA A;  5BS7 A;  1SHV A;  3HUM A;  4X56 A;  3ZVW A;  3W98 C;  4E45 A;  3C4O A;  4IBF A;  4LD9 A;  3VP0 A;  1Z2C B;  2WGV A;  1G6A A;  4EBN A;  2Q9N A;  5CED A;  3UTB D;  1P34 A;  3BFF A;  1P3P D;  3V50 A;  4NE6 A;  4R4R A;  3AZL A;  4WM9 A;  2GDN A;  3EPJ A;  1P3O B;  2R9W A;  3HVF A;  3IHA A;  1JTD A;  3IXB A;  3OPP A;  4YM6 A;  1VM1 A;  5E2E A;  5DF8 A;  3S22 A;  1L2S A;  3PBT A;  3AV1 A;  4Z2M H;  4OP5 A;  2JSS A;  3R45 B;  3AZI D;  5TGF A;  4QB8 A;  4YFM A;  3ZNT A;  5DNM B;  1GA0 A;  5A90 A;  3VH5 A;  1KGE A;  4JJN B;  3AZG A;  3PBN A;  3PBR A;  4E3K A;  1IEM A;  1M1A A;  3UDI A;  5AY8 B;  3KXB B;  4Q8I A;  5B1M B;  4H9Q A;  1ERO A;  5B24 B;  3UTB C;  1P3P C;  5AV8 D;  5GLA A;  5BNV B;  1K56 D;  3D4F A;  3B0C W;  4QLC D;  1U35 A;  4J8U B;  3WKJ D;  3REI A;  3DTM A;  4ZUX B;  3QNB A;  3VH6 A;  4GHA A;  3A3E A;  4XZQ A;  5AVB D;  5E5A D;  3AZI C;  3TU4 B;  3NQU A;  2IWC A;  4E3M A;  4LD9 B;  2RL3 A;  3SOI A;  1S32 D;  3SS5 A;  1XA7 A;  1P34 B;  1MPL A;  2EFX A;  3SH9 A;  1MWT A;  3AZL B;  4BJP A;  3ITB A;  4YM6 B;  1QME A;  3FV7 A;  3VH5 W;  5AV8 C;  3AV1 B;  5GT0 D;  4OJ6 A;  3PBO A;  4QLC C;  2IWB A;  2WAD A;  3CG5 A;  3EPL A;  3WKJ C;  1MBL A;  3C7V A;  3LJA B;  2DF4 C;  4JXS A;  3C1C A;  3ISG A;  3BLS A;  5AVB C;  5E5A C;  4DKI A;  3AZK D;  1ZLA B;  5EVI A;  1M1A B;  1KX5 B;  1P3F A;  2JCH A;  1ERQ A;  1S32 C;  4H9Q B;  4Z66 D;  5CHL B;  2EX9 A;  2J7V A;  4GN2 A;  4JLF A;  1M19 D;  2Y2P A;  3KUY A;  4MBH A;  3REH D;  4J8V D;  3FKE A;  4Z2M G;  1U35 B;  1M18 A;  1P3G D;  5FUG B;  3W4O A;  4PM9 A;  4DXB A;  1KVL A;  4KQO A;  4FCF A;  2IOU A;  4KUD B;  5GT0 C;  5EOO A;  1HZO A;  2ZM5 A;  2PYO B;  3S4X A;  2CV5 D;  2HDR A;  3LO7 A;  1I2S A;  3B6G D;  3AZK C;  2L5A A;  1L0D A;  3MGS B;  4WBG A;  1YLP A;  3WRZ A;  3HRE A;  4KGC A;  4FSF A;  1LLB A;  4Z66 C;  3AZE D;  2YFW B;  5B1L B;  1HVB A;  4P6B A;  4WZS B;  1KX4 D;  4YS3 D;  1M19 C;  3RXX A;  3REH C;  2ZLY A;  4WEK A;  3G2Z A;  4J8V C;  3DWK A;  3ZVT A;  1E4D A;  1K57 A;  3EQU A;  1P3G C;  4KQQ A;  3UDX A;  4WJ3 C;  4KZA A;  4GB7 A;  4EBP A;  1AXB A;  3IQA A;  3AZH A;  3ZFZ A;  4S2N C;  4N92 A;  4EUZ A;  1Q2P A;  1RP5 A;  1P3B B;  1P3F B;  1P3M A;  1L0G A;  1BSG A;  2CV5 C;  3X1U A;  5AV6 D;  5CEC A;  5BT1 D;  3B6G C;  3WS5 A;  4BD1 A;  3KUY B;  5B33 D;  2XFT A;  2Q9M A;  5F99 A;  4S2K A;  4IBI A;  2CWE A;  1BUE A;  1HD8 A;  3AZE C;  1MWR A;  3A6N A;  1P3O D;  3H0M C;  1P3I D;  1KX4 C;  4R3J A;  4YS3 C;  3UPO A;  3REK B;  3AN2 B;  3ZHH A;  4OPR A;  3WS0 A;  5KSH A;  2Y2G A;  1PYY A;  4JJN D;  3MZE A;  3EPK A;  3UT9 A;  3BM6 A;  1JWZ A;  1ES5 A;  1NYY A;  5AV6 C;  5FI2 A;  4XUJ D;  1K54 A;  5G49 A;  5BT1 C;  3C1B B;  3UE3 A;  5B2I D;  2ARO A;  2ZY3 A;  1ES3 A;  5CHM A;  4C75 A;  3KXB D;  5AVC B;  3C4P A;  4DDY A;  5B33 C;  1ALQ A;  5B0Z D;  3ZNY A;  5EE8 A;  3WAA B;  1ID3 A;  3VH5 T;  4HEF A;  3LEL A;  1P3O C;  4GH9 A;  1P3I C;  5JYP A;  1XKZ A;  4OJO A;  4A5R A;  4WYY A;  4ZUX D;  5GHZ A;  2EFU A;  5B2J B;  4KZ7 A;  5CEB A;  1LHY A;  3TU4 D;  5BNX B;  2G2U A;  3ZDJ A;  4OQI A;  3X1U B;  2NQB A;  4OQH A;  1YU0 A;  2XLN A;  4ZBE A;  3MVD D;  4JJN C;  4K0X A;  3REJ B;  2XEP A;  3O3V A;  5F99 B;  4XUJ C;  1TZY A;  1KU5 A;  5B2I C;  3BFE A;  3WX7 A;  1P3A D;  1N1J A;  4WNN B;  3A6N B;  3AZJ A;  3KXB C;  5B1M C;  4X55 A;  3HLF A;  5B0Z C;  3Q7V B;  4OLD A;  1RGY A;  4J8X A;  1WWS A;  3M2K A;  3LJA D;  4ZUX C;  4IVK A;  3AFA A;  4JKT A;  3HUN A;  4DE3 A;  3UT9 B;  3TU4 C;  1ZLA D;  5FI6 A;  4GZB A;  3IHB A;  4JXG A;  1KX5 D;  1YLJ A;  3MVD C;  4E6X A;  2WUQ A;  2XF3 A;  3V5M A;  4PM5 A;  4FH4 A;  4BEN A;  3X1S D;  1BLC A;  1P3A C;  3MGP B;  5A91 A;  5FA7 A;  5GXQ B;  3LZ1 B;  2NZD D;  3EG5 B;  2BG1 A;  4HES A;  4KUD D;  4KZB A;  1IKI A;  4RA7 A;  5CXW A;  4KG2 A;  2PYO D;  3LJA C;  4FD8 A;  3KWQ A;  3B6F D;  4X68 A;  3UNW A;  1BFM A;  3WTP A;  4Z9Q A;  1ZLA C;  3B0D B;  3NY4 A;  3AZN D;  1KX5 C;  2VGJ A;  3MGS D;  3VP1 A;  3ZGA B;  1MXO A;  1N1J B;  1HQ3 B;  2J8Y A;  3LZ0 D;  3MGQ A;  3A1I A;  5B1L D;  4RX2 A;  3X1S C;  4J8X B;  3W99 B;  5GSU B;  5BO0 A;  2XFS A;  4X23 D;  2NZD C;  1W8Q A;  1EWZ A;  3NBL A;  3IF5 A;  4KUD C;  1Q2Q A;  1DJC A;  4DE2 A;  2Y91 A;  2PYO C;  4L0L A;  5CPJ A;  3B6F C;  3W96 B;  1YM1 A;  3X1T B;  1FR1 A;  2WGW B;  4NYU A;  3AZN C;  2YFV A;  3MGS C;  1JTG A;  2HPB A;  4H9O A;  3H0R C;  3GV9 A;  3REL B;  3LZ0 C;  1TDG A;  1K4E A;  1TDL A;  2LY8 A;  5B1L C;  5EOE A;  4NET A;  4EO5 C;  3REK D;  4XUX A;  1IYQ A;  4K0W A;  3AN2 D;  1P3K A;  2H0Y A;  4ZBJ B;  1ZKJ A;  4CSR A;  3KWQ B;  5B40 A;  5DNN D;  4NK3 A;  4QY5 A;  4H9N B;  3WTP B;  1YU1 A;  5JA4 B;  4S2J A;  3M6H A;  2HUE C;  2ZM8 A;  4E3O A;  1P3B C;  2WAF A;  1YU3 A;  1Q9C A;  3C1B D;  1RGZ A;  1CEF A;  4R4S A;  2QMI A;  4Z5T B;  3W4P A;  5AVC D;  4OOY A;  5B0Y B;  5E2H A;  1CI8 A;  3W4Q A;  3V9R A;  3LY3 A;  3WWX A;  1FOF A;  1AOI A;  4GHL A;  2ZQ9 A;  3GVB A;  2ZC4 B;  2QPN A;  3DW0 A;  1HTA A;  5CPI B;  3WS4 A;  3O62 B;  3REK C;  4QNL A;  5B32 A;  3MZF A;  4N1H A;  3AN2 C;  1WYB A;  5B2J D;  4OH0 A;  4AWL C;  5CPK B;  1BZA A;  1K55 C;  3CZD A;  4UA6 A;  5M18 A;  5L2F A;  5DNN C;  2P9V A;  4OPQ A;  5AQB A;  3PTE A;  3RJU A;  5CP6 A;  1RCJ A;  2G2W A;  1R4V A;  3X1V B;  2ZY5 A;  3REJ D;  2RIQ A;  4B88 A;  1G68 A;  3C1B C;  1WYC A;  3AGF A;  5AVC C;  4U0X A;  5KMW A;  5CHJ A;  5DF7 A;  3WAA C;  1WWI A;  5B32 G;  2EX2 A;  2ZQD A;  2ZC3 B;  4GD6 A;  5B40 B;  4U0T A;  5AV9 B;  3AYW A;  5B2J C;  5GLD A;  3G4P A;  1JWV A;  2HDS A;  1HTZ A;  2DCF A;  1PW8 A;  4GKU A;  1SCW A;  1SDN A;  3REJ C;  1LI9 A;  1XGJ A;  5AV5 D;  2Y2J A;  3V9R B;  5IHV A;  5EUA A;  3JYI A;  2HP6 A;  2ZC7 A;  3MGP D;  1YMX A;  3PAG A;  5GXQ D;  4WZ5 C;  1ZC2 A;  2J9O A;  3LZ1 D;  3WA9 B;  1TAF A;  5B32 B;  4KZ5 A;  2EXB A;  3AZM A;  1BLS A;  4EQI A;  3AL0 C;  2ZC6 B;  4WU8 D;  4R8P A;  5FQI A;  4N9L A;  3MGR A;  5GT3 B;  3G30 A;  4IBG A;  3NC8 A;  2FFF B;  4XUZ A;  1HQ3 D;  5AV5 C;  3GSG A;  4GNU A;  4J8W A;  1GHI A;  3MGP C;  3W99 D;  5GSU D;  1K38 A;  5GXQ C;  3HLB A;  4OLG A;  3N7W A;  3MXS A;  3LZ1 C;  5B31 A;  5JRG A;  1Z6F A;  4QD4 A;  3HLE A;  3MNN A;  5FQJ A;  4OVD A;  2W8S A;  2F8N H;  2ZQC A;  5C3I B;  4G91 B;  4WU8 C;  4JF4 A;  4ZAM A;  2JBF A;  4E3J A;  3W96 D;  1PZO A;  4JXV A;  4H9R A;  3X1T D;  5FDH A;  2V2F F;  4NZ3 A;  3AZG B;  2XDM A;  1HQ3 C;  5BPV A;  5KDM A;  3REL D;  3VP3 A;  4HBU A;  3MKE A;  1T3U A;  3UN7 A;  3OC2 A;  1EQZ A;  3OPR A;  4EBL A;  1H5X A;  3W99 C;  4X23 A;  2BYM A;  1MWS A;  5GSU C;  3PAE A;  1YLW A;  3W97 A;  4WV4 B;  4LEN A;  1KX3 A;  2DQN C;  4P85 A;  4OOL A;  2FJ7 A;  3MGR B;  4IBD A;  5FQM A;  1KVM A;  4R3B A;  2ZD8 A;  3HBR A;  3REI B;  5FSR A;  3UTA A;  2HIO A;  4B4Z A;  4XZQ B;  3W96 C;  3NQU B;  3X1T C;  4WMC D;  3MFD A;  3V3R A;  3AV2 A;  1GCE A;  4Z5T D;  3N6I A;  4MLL A;  5B0Y D;  3O86 A;  4OQG A;  1BH8 A;  3BYD A;  3REL C;  1JFI A;  2R9X A;  4OON A;  4BD0 A;  5CPI D;  3ZG0 A;  1BLH A;  3O62 D;  4WU9 D;  4P0M A;  1P3L A;  3IF6 A;  3IXG A;  1JWP A;  4H9S C;  1W8Y A;  3OZH A;  5AQ7 A;  2F8N A;  5CPK D;  4P87 A;  4ZBJ C;  3AZF A;  5CGX A;  2WKI A;  2EX8 A;  1F66 A;  4Y0U A;  3L28 A;  3C1C B;  3X1V D;  1YU4 A;  3W98 A;  5EVI B;  1E3U D;  1FR6 A;  2JE5 A;  2XD5 A;  4Z5T C;  4E3I A;  4PPR A;  5B0Y C;  4KZ8 A;  4G92 C;  1M6K A;  3ZCZ A;  4H8R A;  2Y2H A;  3BEB A;  5J8X A;  3C5A A;  2ZMA A;  4LV0 A;  3H0L C;  4QY6 A;  5F1F A;  1FCO A;  5F83 A;  5CPI C;  3O62 C;  3HLD A;  4WU9 C;  3SS4 A;  1M18 B;  5AV9 D;  2IO5 C;  2WZZ A;  5F1G A;  3UDF A;  5BOH A;  4X53 A;  1IYS A;  5CPK C;  1FSW A;  4WZ4 A;  5U47 A;  1NZO A;  3X1V C;  4IBC A;  5DNM D;  5HAI A;  4M3K A;  3B0B A;  1FSY A;  1BTL A;  3IT9 A;  4KGC B;  1S6R A;  3WA9 D;  1P3L B;  3IF6 B;  3UTB A;  2E8I A;  5AY8 D;  5B1M D;  1P3P A;  1NY0 A;  2BLS A;  5CER A;  5B24 D;  5HAR A;  1FCM A;  3GR2 A;  1PW1 A;  5EVL A;  4E6W A;  5AV9 C;  2C5W B;  1F66 B;  3IXH A;  3UY6 A;  3ITA A;  5GT3 D;  5FQQ A;  4J8U D;  1IKG A;  3AZI A;  3AZH B;  1FQG A;  5KSC A;  2PBY A;  2QZ6 A;  2WYX A;  2Y55 A;  5CTM A;  1P3M B;  5DNM C;  4M6B A;  4LD9 D;  3KFU G;  3Q82 A;  1P34 D;  3IH8 A;  4UAA A;  3WA9 C;  3AZL D;  5AY8 C;  4BLM A;  5AV8 A;  5FAP A;  5B24 C;  4YM6 D;  1K56 A;  3KS8 A;  3OPL A;  4KZ3 A;  1L0F A;  5TFQ A;  4QLC A;  3AV1 D;  1N9B A;  2EX6 A;  3WKJ A;  5GT3 C;  3E2K A;  2OSU A;  4J8U C;  5BS7 C;  5AVB A;  5E5A A;  3LEZ A;  3AZG D;  4OPZ A;  4NFT A;  3WS1 A;  3FYZ A;  4MBK A;  3N4I A;  1H3O A;  5DTK A;  5FAS A;  1S32 A;  1M1A D;  1XX2 A;  5G49 B;  1LL9 A;  2ARO B;  4KQR A;  4LD9 C;  1L0E A;  4QHC A;  2FFY A;  1P3P B;  3DWZ A;  3P09 A;  1P34 C;  1PWC A;  1ID3 B;  3AZL C;  3LEL B;  2IWD A;  2Y2M A;  3FKV A;  3ZG7 B;  2WK0 A;  4YM6 C;  1U35 D;  3REI D;  5GT0 A;  5C3I C;  5A93 A;  4G91 C;  3AV1 C;  3L2A A;  4XZQ D;  1QMF A;  3BEC A;  3EQV A;  4NYY A;  3M2J A;  2NQB B;  1XPB A;  1KDW A;  4ZJ2 A;  2G5I C;  2OLV A;  3AZK A;  3AZG C;  5M19 A;  3ZG5 A;  1M1A C;  1TZY B;  4Z66 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...