2Y2OA

Penicillin-binding protein 1b (pbp-1b) in complex with an alkyl boronate (eo9)
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
489
structure length
471
Chain Sequence
ISEITYSDGTVIASISRDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTGQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Guided Design of Cell Wall Biosynthesis Inhibitors that Overcome Beta-Lactam Resistance in Staphylococcus Aureus (Mrsa).
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
molecule keywords PENICILLIN-BINDING PROTEIN 1B
total genus 165
structure length 471
sequence length 489
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2y2oA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2y2oA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2y2oA02
3M6HA 1PZPA 3QNBA 5HX9A 4WZ5A 1IYSA 1GHIA 3GMWA 3Q7ZA 3UNWA 5GHZA 4IVKA 2ZLYA 4BD1A 1CI9A 2Y2QA 3Q07A 1ERQA 1FOFA 4N1HA 4FSFA 2Q9NA 2J9OA 4YFMA 3M2JA 4MBKA 1JWZA 1BZAA 2G2UA 2ZMAA 3LY3A 4JF6A 3GSGA 1XXMA 4B4ZA 4OLGA 1YM1A 1YLZA 3VP1A 5GHXA 4S2OA 1KE4A 2Y2JA 1W8YA 1PZOA 2WZZA 2H5SA 3CZDA 2ZJ9A 4B4XA 1K56A 1PIOA 1HVBA 2RL3A 3OZHA 5TR7A 1RGYA 3HLCA 3OCLA 3QNCA 2C6WB 4WYYA 3IF6B 4C6YA 4QY6A 2XLNA 5EVID 2EXBA 3E2LA 3N6IA 1ZG4A 4UA9A 2IWBA 3V39A 5FATA 4DE3A 1LL9A 3MXSA 3HLBA 4GB7A 4OQ0A 3ZGAB 4U3TA 3ZFZA 4GOGA 3O3VA 1GHMA 4JF5A 1XX2A 2Y2KA 4RX2A 1RP5A 4MLLA 1Z6FA 1L2SA 1ES2A 5M19A 3HUMA 1PYYA 4R4SA 4C3QA 1BSGA 3DW0A 3W8KA 2WAFA 4DE2A 4U0XA 1IYQA 4ZJ3A 1BULA 1DJAA 2C5WB 1XGJA 5CHJA 1K56D 1NJ4A 1U60A 3IHAA 5GLBA 1KDWA 2H0YA 5FI6A 3HLGA 1IKIA 1SDNA 3OPHA 4GDBA 5EVIA 3BLSA 1VM1A 2XEPA 3Q7VB 4XUZA 3GQZA 5DTKA 1HD8A 5E2HA 5U47A 1VQQA 3ZVTA 2XGNA 1ESIA 4FD8A 3G30A 1K54A 5KSHA 2A3UA 3FV7A 5CECA 4IVIA 3QHYA 1CI8A 3UE0A 3C5AA 2WK0A 1BT5A 2XQZA 4H8RA 4XUXA 3B3XA 3IWQA 4PM8A 5CTMA 5FQQA 5A93A 1IYPA 1MPLA 4LCLA 3RXWA 5M18A 4GNUA 4FH4A 3ZHHA 4LENA 4OONA 4UA7A 2BLSA 4E3IA 1K54C 2P9VB 1MWRA 5G18A 3BYDA 1KE0A 5EVIC 5CRFA 4C75A 2X02A 1KDSA 3OCNA 3HLFA 2X01A 4IEDA 5HW3A 4JF4A 1CEGA 5EPHA 1ZG6A 2WGVA 3N4IA 4U0TA 4WM9A 1O07A 3NC8A 1PWCA 3PBNA 4OOYA 1E3UA 2PU2A 5D3OA 3OPPA 4OPYA 4WZ5C 2XK1A 5DVAA 2FFFB 5F82A 1EROA 3CJMA 3NIAA 4KG2A 4OOMA 3IXGA 2ZC3B 3HL9A 2R9WA 3BECA 5KZHA 4HEFA 1L0DA 1FCMA 3G32A 5GLDA 2Y2MA 1BTLA 3GVBA 3NBLA 2EXAA 3EQVA 1BLHA 1KGFA 4N9LA 4X53A 4EWFA 4WEJA 1MWTA 4BQMA 3SH9A 3UDFA 5KMWA 5CHMA 1K6RA 3OPRA 4KZ4A 1IYOA 1JVJA 1YMSA 3G34A 4KQOA 5CERA 1NXYA 3A3FA 4PM6A 3ZG7B 1QMFA 5EE8A 3C7VA 3G2YA 4R23A 3VP4A 3UE1A 2Z2LB 3UPNA 2ZC5B 4BJPA 4R4RA 3PBSA 5FI2A 3PBQA 2Y2OA 1MKIA 5J8XA 3ZCZA 3DWKA 2V20A 4EV4A 3AGEA 3MKFA 2Y2HA 4HESA 5DTTA 3VP2A 3BFEA 3HVFA 1JTGA 2XD5A 3IWOA 2WGWA 2XD1A 4KQQA 4S2MA 3SS3A 1ES3A 5CGXA 2IWCA 4KZ7A 5JYPA 3N8SA 2HP5A 3M6BA 3IHBA 3UPPA 3PBOA 1GCEA 2OSUA 2IWDA 4X55A 5F83A 2ZM8A 1Q2PA 5FQKA 1K4EA 4X56A 3A3IA 4BL3A 4KZBA 2PU4A 3I7JA 4O7DA 2EFUA 3TSGA 5EOOA 4E3JA 1FR1A 5GLCA 3UE3A 4ZJ2A 3WS2A 4OLDA 1YLJA 2H10A 3G4PA 3ZG0A 1I2SA 2ZQDA 4WZ4A 4DDSA 3WRTA 5EUAA 2WAEA 3Q81A 1W7FA 2ZQCA 1PW8A 2EX9A 3HUOA 4ZBEA 5TFQA 4BENA 1Q2QA 3MZFA 3VSLA 3IH9A 3UDIA 3IF6C 5AQBA 3UO9A 4DRTA 5A92A 5HAPA 1GA9A 1PI5A 3OPLA 4E3OA 3V50A 5IHVA 1YLYA 2A49A 1NZOA 4OQIA 5M1AA 3IT9A 5E2FA 1WYCA 1YQSA 4M3KA 3PAEA 1IKGA 1XGIA 2XFTA 3VMAA 4S2KA 3W4PA 4WELA 3LEZA 2ZQ7A 3IXBA 2ZC6B 3G35A 3WS0A 1O7EA 1W8QA 4KG5A 4ZAMA 2WYXA 4Y0UA 5EVIB 2HDSA 4E3LA 5DF9A 4BLMA 1SKFA 4NK3A 2V2FF 4KENB 1L0GA 3WRZA 2JCHA 1E3UD 5E2EA 4P6BA 3TOIA 3BFCA 3ZG9B 4X6TA 2HP6A 3SOIA 2WKHA 3GTCA 3Q1FA 4N9KA 5CEDA 5KSCA 3EQUA 4PM7A 1W79A 1EWZA 2FFYA 2Y59A 2XF3A 5TGFA 1JWVA 2EFXA 4ZTKA 5DF7A 3VOYA 4E6XA 5FSRA 3VFFA 1HTZA 4WMCD 5FA7A 1FSWA 1FR6A 5FQ9A 3GRJA 2EX8A 5FAPA 4E6WA 3D4FA 3MFDA 5E43A 4NETA 1EI5A 3W4QA 1E25A 1K55C 1RCJA 1I2WA 1KE3A 1JTDA 3DWZA 3GV9A 2XH9A 3SS4A 2G2WA 2HDRA 3FKVA 4MNRA 1SHVA 1DJCA 2Y2LA 1PW1A 4Y7PA 3IF5A 5HL1A 3Q7VA 4KZ6A 2Y2PA 1MWSA 2HDUA 4YINA 3UDXA 4EQIA 3IWIA 2WUQA 1I5QA 1H5XA 2J7VA 4RA7A 3M2KA 4EBPA 5GL9A 2OLUA 3NDGA 4GD8A 1K4FA 3W4OA 2Y2IA 4OQHA 4UHUA 5FDHA 3NY4A 4OPQA 4KZ8A 1M6KA 3DTMA 4PM5A 4WMCA 4WBGA 4K0WA 3P09A 2OLVA 4JBFA 4LV0A 5FAQA 3UN7A 1Y54A 3HUNA 4E3NA 5FI7A 4KZAA 1QMEA 1BLPA 1LLBA 1LL5A 1ALQA 4A5RA 3ZNTA 1PWDA 4CJNA 4S2PA 1YMXA 4B88A 3ISGA 2EX2A 3CMZA 3UPOA 4LCMA 5CGSA 5A91A 1MXOA 3C4PA 4HBTA 5HARA 4EBLA 1DY6A 3ITBA 1FSYA 4GKUA 1OMEA 1K57C 1KVMA 4RX3A 3JYIA 2OV5A 3VP3A 2WZXA 1MWUA 1WE4A 4DE0A 4Z9QA 4EUZA 3WS1A 2Y4AA 2V1ZA 4P0MA 2JBFA 1ERMA 1ES4A 1XA1A 4RVAA 1N4OA 4QD4A 5FQMA 3WWXA 3VSKA 1YT4A 2VGJA 3MBZA 4N92A 5L2FA 2WKIA 4KZ5A 3HLEA 1L0EA 1XP4A 5AQ9A 1FQGA 5GHYA 2GDNA 2ZM2A 4FH2A 3V3SA 1G68A 4QHCA 2WADA 3Q82A 5FAOA 2HPBA 3BEBA 4DE1A 4QU3A 3N8LA 5CEBA 2JC7A 5CXWA 1KVLA 2Y91A 1AXBA 3IH8A 5DTSA 5BOHA 4UAAA 1K38A 3PAGA 1XKZA 3PBRA 4DKIA 4PMAA 5CTNA 4XXRA 1K55A 3NCKA 3LCEA 2Q9MA 4JPMA 3MZEA 3ZDJA 2H0TA 3FZCA 2BG1A 4P85A 2EX6A 1ESUA 4ID4A 3MXRA 1BLSA 3IXHA 1E4DA 1C3BA 3VFHA 2JE5A 2ZQ9A 1FCOA 3WS4A 1G6AA 1MY8A 3PBTA 3A3EA 5HAQA 1KGEA 4IBXA 4E3MA 3SS5A 1NRFA 3BRMA 2P74A 4F94A 1MBLA 3N7WA 4BD0A 4MBFA 4OVDA 2UWXA 3NDEA 1SDEA 3GR2A 4GN2A 3TG9A 4EBNA 4R3JA 1ZKJA 2X71A 4JXWA 2WKEA 3AGFA 1JWPA 3NI9A 1L0FA 1H8ZA 4BL2A 4Q8IA 4PPRA 1LI0A 3ZG8B 5CGWA 2ZM0A 3G2ZA 2Y55A 1CEFA 5EVLA 1H8YA 4RYEA 4X69A 3SH7A 2J8YA 1S6RA 4MBHA 4E3KA 3HREA 1TVFA 4OQGA 1FCNA 4PM9A 4S2IA 4KG6A 5FQJA 4QY5A 1LHYA 5F1GA 4JKTA 3FWLA 5I94A 1RGZA 2PBYA 3FKWA 4JXGA 1W5DA 1ES5A 1XPBA 4S2LA 3LO7A 4JXSA 3RXXA 2I72A 4D2OA 1ZC2A 1NYMA 2ZC4B 3HLDA 4OKPA 4R3BA 4L0LA 1WYBA 4UA6A 4OH0A 4S2NA 4K0XA 3V5MA 4GD6A 1YLTA 1BLCA 5EECA 4QJGA 2DCFA 2ZD8A 2ZQ8A 1XA7A 2QMIA 3IF6A 3V3RA 4DDYA 3MZDA 4MEZA 2VGKA 3O88A 2ZQAA 2R9XA 3OC2A 1KGGA 1ONHA 1SCWA 2DRWA 3C4OA 4OOLA 1GHPA 4S2NC 2Y2GA 1IEMA 1NYYA 2RCXA 3O87A 2WGWB 2ZC7A 4X68A 1LI9A 4WEKA 3VOZA 4OPRA 1DJBA 4JLFA 4OP8A 5E2GA 5AQ7A 4QB8A 5FQIA 2DNSA 1K57A 3ZNYA 3ITAA 4N1XA 5F1FA 4Y0OA 3S4XA 2J9PA 4GDNA 3A3JA 5GLAA 4ZJ1A 1K6SA 3IXDA 1IELA 1S0WA 4OPZA 2Y2NA 2QPNA 4KZ3A 4DXCA 4Y0TA 1J9MA 1TDGA 3CG5A 1PI4A 1BUEA 3AGDA 1M40A 4CPKA 2XR0A 5DF8A 3BFFA 4LV2A 3S22A 1NY0A 3BM6A 4R0QA 3HLWA 5AQAA 1HZOA 4KZ9A 1PWGA 5EOEA 2XFSA 3BFDA 3E2KA 4JXVA 4ZDXA 3VP0A 1YLWA 4IBRA 4LV3A 3IQAA 1N9BA 5CHUA 1NZUA 2B5RA 2XDMA 3SH8A 4DF6A 4DXBA 4HBUA 1CK3A 3PTEA 3WS5A 1K25A 3BLMA 2P9VA 3N8RA 4R1GA 3ZVWA 3S1YA 5FASA 3LY4A 5HAIA 2WGIA 4LV1A 4S2JA 3FYZA 4P87A 3BFGA 3ZG5A 4OP5A 5JYOA 2HP9A 2QZ6A 3A3DA 4K91A 4FCFA 3HBRA 3P98A 2E8IA 2CC1A 3MKEA 5HFOA 1TEMA 3O86A 3G31A 3UY6A 2HDQA 1YLPA 5A90A 1ONGA 2Z2MB 4GZBA 3C7UA 3RJUA 4KQRA 1TDLA 1GA0A
chains in the Genus database with same CATH superfamily
3UTAB 4Q0HA 1P3ID 1IYSA 3GMWA 3Q7ZA 4Z1WA 4IVKA 2ZLYA 4BD1A 3REKA 1CI9A 1EAKA 3P5JB 3UTBD 1HQ3A 2BYMB 1H3OA 3RELD 5AY8B 1VB6A 3AZFA 5AVCB 1M18A 5I5LA 3VH6W 4E44A 4ME4A 1XJ4A 4L9FA 2F8NG 5KIZA 1P3PB 4AWLC 4S2OA 3CZDA 2ZJ9A 4B4XA 1HVBA 4AFIA 3R7WB 2ZY5A 1XFQA 2EXBA 4UA9A 2IO5B 3O62D 3LZ0A 3MF0A 3ZGAB 4U3TA 1GHMA 2EA9A 3AZKB 4IBFA 4FUWA 5BT1D 4J8WD 3LI9A 3AZJD 1Z6FA 3MR0A 3LJAA 2J3TD 2WAFA 1IYQA 1DJAA 1XGJA 5CHJA 4X23C 1K56D 1P3OD 1U60A 4YS3B 3IHAA 5KDMA 1SDNA 5EVIA 3MGPC 3LYXA 3X1UB 2XEPA 3AZLD 4XUZA 3GQZA 3B0DC 2O9AA 3X1TA 4Z2JA 1G6OA 1BH9B 4MMNA 3TU4D 3KSFA 3IS2A 4XZQB 2D49A 4PM8A 5M18A 3W97B 2PD8A 5E5AB 4GLQA 1SZVA 3FPVA 4LENA 1ZHHB 4JJNB 1MWRA 3B0CT 3KX0X 1T3UA 3LZ1B 3AV1B 2VKSA 5GSUC 1P3PC 1D06A 1ZG6A 4IBDA 2WGVA 1MZUA 3PBNA 4WU8C 4IBKA 4H9NA 4WU9C 4OPYA 5DVAA 3MGSC 4WZ5C 3MGRD 3NOUC 4KG2A 3N3FA 4JGOA 4CLCC 2Y2MA 3GECA 4QLCB 1P3IA 3M7PA 2EXAA 1VHMA 3REKD 1D7EA 5DNMC 2V9AA 4BQMA 3AN2D 1W1TA 3HONA 3TJZC 3FDDA 1H3OB 1JVJA 4KUKA 4KQOA 4HMCA 2VV7A 3AYWD 4PM6A 1P3AB 1DP9A 1QMFA 3ZG7B 3KS4A 3G2YA 3X1VB 3UE1A 2Z2LB 3W98A 4BJPA 2HV1A 3PBQA 3VE4A 1MKIA 3ZCZA 1BYWA 3T12B 5B1LD 1P3KA 2Y2HA 5B2JB 3WA9C 3BFEA 3HVFA 1JTGA 2AROA 2XD5A 2WGWA 2F2AC 3KYEA 4KZ7A 3N8SA 5JYPA 2NQBD 1CXWA 4Z2KA 3IHBA 1N9LA 3LGOA 3MNNB 5GXQB 5F83A 2ZM8A 4PKYA 1YU3A 3I7JA 3VH5W 3TSGA 5CPIC 5GLCA 4GHAA 2E8JA 4OLDA 3LR5A 3DBAA 3ZG0A 4H9QA 4WZ4A 5CP6D 3MQOA 3W2ZA 3Q81A 1WWSA 1PW8A 3HUOA 4BENA 3KUYB 3VSLA 3D72A 1KOUA 5HAPA 1P3OC 2BYKB 1PI5A 3V50A 4OQIA 2HIOD 5A8BA 4M3KA 3PAEA 4S2KA 3LICA 2A24B 2CMNA 4ARZA 4KG5A 4Y0UA 1R4VA 2HDSA 1E6PA 2L5AA 4OJPA 1SKFA 2V2FF 1L0GA 3H0LC 2VX8A 3WAAB 4XT2B 3ZG9B 5BO0A 4X6TA 1S4SA 3LJAB 4N9KA 5KSCA 2QWSA 4EV4A 5TGFA 2XF3A 3DTEA 4XUJA 1YU2A 4R70A 1D1JA 2WKQA 3GRJA 2VZWA 5FAPA 5L09A 1P3KC 3BWLA 1Q9CA 1TS7A 3CI6A 3DWZA 3GV9A 2XH9A 1P3MC 4Y7PA 2VGLM 4X1LA 3PHYA 4GJ4A 5AV5D 4RA7A 5F99C 3AV2A 4HH3A 3L7HA 4UHUA 5FDHA 3K3DA 3NY4A 3L26A 3DTMA 2PYRA 4WBGA 4K0WA 3P09A 5AVEA 5FAQA 4E3NA 3EEAA 5DNNC 4KZAA 4Y15A 1VEUA 4X23B 4KGCD 4IBIA 4IBBA 3LELB 3ICYA 3UPOA 4LPZA 3CMZA 5B0ZA 4WU8D 4UQIS 5B32C 4LRXC 5A91A 1MXOA 4HJ6A 3F1PA 4WF0A 1WE4A 2F8ND 2F8NH 5FQMA 3LJAC 1N4OA 3VSKA 2W0NA 1UWPX 4KQDA 3AZNA 1GPFA 1FQGA 4OJOA 4FH2A 1KX5B 4B9OA 1KX4A 4J8XD 1P34A 4HJ3A 5DJUA 1P3LA 3REIC 4EEPA 3LZ1C 5CXWA 4WL9A 1PFLA 5GSUB 5DTSA 1K38A 3JPUA 5AY8C 3IX4A 2BG1A 3L27A 1S1ZA 2FJ7B 2V0WA 3K2NA 3B6GB 3WS4A 5EVEA 3KWQA 4HJ4A 4E3MA 2GNXA 2P74A 1P34B 3N7WA 1P3PA 3NDEA 4J8WB 4JXWA 1Y4OA 1JWPA 1L0FA 1ID3B 5EVLA 2F8NK 1EQZB 4E3KA 4BBTA 3R7WA 3BY9A 2VLGA 3KWQD 3AZMC 1CK7A 1T18A 2HGVA 5I94A 4YM6B 4WU9A 3T4QA 1ES5A 4S2LA 4Z2HA 3X1UC 5AVBB 1GSWA 1AIWA 2W1TA 4LRYC 2LB9A 1ZC2A 5AY8D 1F98A 4H9PB 3HLDA 4OKPA 4R3BA 1M1AC 3MQQA 3T1RA 4OH0A 3V5MA 3AZEB 2VV8A 4GD6A 4QJGA 2YFWA 4HGAB 1P3AA 1CJFA 3C1CD 1KGGA 4H9RA 2DRWA 1P3LC 3C4OA 1TZYD 5B33D 4EEUA 5B33C 1TS6A 4S2NC 5J4EA 1IEMA 1NYYA 3O87A 1SKOA 2WGWB 2ZC7A 2ZL1B 4WEKA 3VOZA 1NWZA 4OPRA 2FJ7C 1DJBA 3E4PA 5E2GA 5AY8A 1K57A 4Y0OA 4ZJ1A 3CHWP 1K6SA 3IXDA 4UQIM 4OPZA 1S0WA 3H0RC 2Y2NA 4KZ3A 1TDGA 3X1SC 1T1CA 3KYQA 4H9NB 4NE3A 4MN5A 2XR0A 2Z6DA 3S22A 1NY0A 5B0YD 1E6NA 4R0QA 3JVUA 3TU4C 5AV8D 4KZ9A 2F8NA 4JXVA 1S67L 4H9OA 5TBMA 4LV3A 3A0VA 3SH8A 2ZMVA 4WJ3C 3W97C 4HBUA 4YM6C 1W63M 3PTEA 1U35D 3WS5A 4KHAB 1YU1A 3WX7A 1IFQA 4PAUA 4R1GA 5GT0D 1MC0A 2WGIA 5AJGA 5B2JC 3MQ0A 2XA7S 3BFGA 3UT9C 5JYOA 1P3GC 3EGXC 3X1SA 3AYWA 2HJEA 3MVDB 3AZJC 3MNND 2E8IA 3MKEA 1TEMA 5AV9A 1M19B 4J8UB 2W3DA 3X1TB 3T4SA 3WAAA 2Z2MB 4CLCB 4Z2MH 3RJUA 4MCWA 1M19D 4CPKA 3AZGB 4XUJC 3L2AA 3M6HA 2ZY4A 1HQ3C 3LZ0D 1FOFA 4FSFA 4YM6A 1P3AC 1UR8A 1JWZA 1BZAA 2ZMAA 4JF6A 2OAP1 4B4ZA 5K5BA 4BBVA 5EM0A 3RELB 5GHXA 3AYWB 3LR0A 3RH8B 4HHDA 3W98D 1KE4A 1NRJA 3F1OA 1HTAA 3H7WA 1PZOA 2H5SA 1K56A 1S32D 2RL3A 1F9IA 2ACGA 3OZHA 5TR7A 1YAXA 4JGRA 3MQLA 5AV9B 1M19A 2K2NA 3LZ0C 3IF6B 1ED7A 3E2LA 1T19A 1ZG4A 3N6IA 5FATA 4DJ2A 5B33A 4GB7A 3ZFZA 3KUYA 3OLOA 5B2IB 1XX2A 2Y2KA 3EOIA 3IP4C 1RP5A 2GX5A 2NZDA 5M19A 1L2SA 2HZ5A 2V0UA 1PYYA 3EEHA 4R4SA 4C3QA 1OPXA 5B1LC 1P3GD 3HSHA 3KXBD 1P3BB 5GLBA 2H0YA 3W99C 5JA4A 4DJ3A 4GDBA 4WNNA 1P3KB 4Z5TB 3KXBB 3Q7VB 5B0YA 2V8CA 1Y28A 3B6GC 3EGDC 3QP1A 2XGNA 1ESIA 4OUIA 3G30A 3WD0A 1K54A 5KSHA 3FV7A 3NQUA 3QHYA 1CI8A 2WK0A 1BT5A 3WD2A 1OTDA 5FQQA 5A93A 3W97A 1P3LB 4LCLA 3RXWA 2NUPC 4GNUA 4OONA 1KX4B 4UA7A 5G18A 3RTYA 3MGRC 5CRFA 4C75A 1KDSA 3OCNA 2D01A 3A1KA 3WKJD 3QP2A 5EPHA 1TF1A 1TAFA 3NC8A 3C1CA 3LUQA 3OPPA 3AV1D 5F82A 5AVFA 4WV4B 4ZUXA 3NIAA 3E98A 5GT3B 1FCMA 3G32A 3CUEC 1BTLA 5DNMA 3NBLA 3MGSD 5B31C 1F66A 5HWVA 5MC7A 2M1CA 4X53A 4N9LA 1KGFA 4EWFA 4UEYA 4WEJA 1MWTA 5B32G 1P3FD 3SH9A 2FN2A 1OGBA 1S66L 5JRGC 3D3OA 5CHMA 5KMWA 4ARZB 4KZ4A 1IYOA 3H7WB 5CERA 3FPWA 3E0YA 3HCYA 5EE8A 5B1MC 3VP4A 3T4KA 3UB7A 2K31A 3PBSA 5AV8A 3WD3A 5J8XA 1X0OA 4Z66B 4HESA 5HPIA 3IWOA 4GS9B 1BH9A 1AOIB 2IWCA 3LR3A 2BYMA 3M6BA 4KGCA 3UPPA 4X23D 5BNVB 4NFTA 4EERA 5AV6C 1Q2PA 2AVXA 5FQKA 4KZBA 1IOUA 5HSQA 2EFUA 2B02A 5EOOA 3EPJA 1P0ZA 5BT1C 4J8WC 1FR1A 3UE3A 5B31D 3AL0C 4NXGA 3WS2A 5CPJA 2ZOHA 3MMHA 2D02A 2HUEB 2O9CA 1I2SA 5EUAA 2WAEA 1W7FA 2W1RA 5TFQA 3MZFA 4IJGA 2EWWA 4DRTA 3LZ0B 3IF6C 3UO9A 5A92A 2W27A 1GA9A 5JRGB 4EQ1A 4E3OA 2PBDP 5IHVA 1YLYA 2A49A 5M1AA 3UE6A 1KX3A 3SZTA 3VMAA 3K3CA 4WELA 3CPTB 3LEZA 3B0BA 1E88A 3REID 3D9YA 3WS0A 4ZAMA 2WYXA 5B1MD 5EVIB 2P7JA 2Q0OA 4X1MA 1HLUP 1M1AB 2QJ7A 5DF9A 4NK3A 3UTAA 5B1LB 4KENB 2ZM5A 1M18C 5E2EA 1GSVA 3TOIA 2V1AA 5LBRA 1L6JA 4WU9D 3TU4A 3AZKD 1P34C 3A0RA 4G91B 2VEAA 3U2AA 4PM7A 1EWZA 2Y59A 3EWKA 2HIOA 4ZTKA 3R4KA 3LJAD 5FA7A 1FSWA 1FR6A 3CAXA 2CV5C 2EX8A 3AFAA 3AZFC 4E6WA 3D4FA 5E43A 1KX3C 3W4QA 1E25A 1P3MA 1EQZC 2EWVA 5GSUA 3FKVA 1SHVA 3BW6A 1DJCA 3HJKA 1PW1A 4L9GA 4ETXA 4KZ6A 3AV1A 3AZMB 2HDUA 2OOLA 3UDXA 3LFVA 3LELC 3VH6T 3AV2B 4O01A 1I5QA 1H5XA 2J7VA 4EBPA 1F1EA 5GL9A 4L9EA 4I3JA 4GD8A 1K4FA 2Y2IA 1VETA 4QLCA 4PHTA 4OPQA 2G5HC 4KUOA 4R8PD 3UN7A 1E6ZA 5F99D 1YU0A 1Y54A 1P3MB 3WA9B 2Y8HA 4LD9C 1BLPA 1LLBA 4O0PA 4PKYG 1ALQA 1GSXA 4CJNA 4JJND 1YMXA 2FZ0A 3ISGA 2BTFP 4LCMA 3EG5B 1LT0A 5CGSA 4J8VA 3KXBC 3VP3A 3WAAD 1MWUA 3AZID 3MS6A 4ZUXD 2V1ZA 5DNMB 2Y4AA 4P0MA 1ERMA 1XA1A 2XA7M 3WWXA 4K08A 5GT3A 1YT4A 3MBZA 1M19C 1L0EA 5AQ9A 5B24A 5GHYA 2GDNA 4IUKA 3V3SA 1G68A 5BNXB 1GXDA 4QHCA 1Z09A 4OJ5A 3X1SB 3BEBA 2NQBA 4J8XB 1STZA 4QU3A 3V9RA 3N8LA 5J7EA 1P9WA 5IT5A 1P3FB 4LD9A 2Y91A 4BBUA 3T4LA 2J3WA 3PAGA 5GT0C 4J8VB 3AZEA 5CTNA 5CPIA 1K55A 3R45A 4XXRA 4DQYB 3EPKA 4WLAA 3MZEA 3ZDJA 3FZCA 3E4OA 3C1BD 1ID3C 2JKGA 2JE5A 2ZQ9A 4Z66A 1MY8A 2A2LA 5HAQA 2JKRI 4KUDD 1KGEA 3SS5A 1NRFA 3BRMA 4M6BA 1MBLA 4BD0A 3KSYA 1SDEA 4EBNA 3TG9A 4R3JA 3NQJB 1KX3D 3AZJB 2X71A 2WKEA 2W3HA 1H8ZA 1LI0A 3A6NB 2ZM0A 3G2ZA 5CPID 1CEFA 2Y55A 4Q0JA 4II7A 3H0MC 3SH7A 2J8YA 3KUYC 2JHEA 3HREA 3UTAD 4MB4A 1AWIA 5B31A 1F66C 3F1PB 4PM9A 4S2IA 2VQRA 3O62A 1LHYA 5F1GA 2DQNC 3FWLA 4P6ZM 4JXGA 3WTPE 4TX8A 4YM6D 1Z2CB 2DF4C 4JXSA 4BWIA 4Z5TC 5AVCA 2AROB 1M18B 4QLCC 1JFIA 4L0LA 3AYWC 1WYBA 4K0XA 5JA4B 3P01A 5B0YC 1K0KA 1YLTA 1YPRA 2ZQ8A 4IJEA 4JJNA 4NYYA 3V3RA 3B33A 4MEZA 2VGKA 2ZQAA 2R9XA 3OC2A 3IX8A 1ONHA 1YSPA 2JKTI 1OTAA 2L4RA 3MGRB 3O62B 1GHPA 2Y2GA 4X68A 4IBEA 3AZGA 3B6FD 1ODVA 4QLCD 4QB8A 3AZEC 3ZNYA 1N1JA 5J3WA 3S4XA 5CPKB 3A3JA 3PYPA 2OAQ1 5HZHA 4DXCA 5BNXA 4Y0TA 5C5KA 1J9MA 4M4XA 3X1VA 4WUJA 1KX5C 5B0ZB 1M40A 4YS3D 4HIAA 5DF8A 1LSVA 3BFFA 1O6IA 5GSUD 2KDKA 1HZOA 4NXBA 2PD7A 4EO5B 2WKRA 1F66B 4IBRA 3IQAA 2NZDC 1NZUA 2B5RA 2XDMA 3UB6A 4MN7A 4DXBA 1PZRA 5DJTA 2YFVB 1E8BA 2P9VA 3KFUG 3S1YA 3LY4A 5FL3A 4LV1A 3CUEA 4MN6A 5CHLB 1EW0A 1H3QA 3C1BC 2QZ6A 3OBFA 3RFBA 1XJ3A 3HBRA 3WKJB 2CC1A 1AOIC 4JGQA 3ZYTA 4J8XC 3REJD 2XRNA 3O86A 2IOUA 1G5UA 2HDQA 1YLPA 4GZBA 3WD1A 3MGQB 3JVVA 4G3KA 1GA0A 5B31B 3QNBA 3O62C 5HX9A 3MGSA 4WZ5A 1QO6A 1GHIA 2OWHA 5B24B 5HD3A 5AV9C 1P3FA 2Q9NA 3F1NA 3M2JA 5AVBC 5AVCD 2G2UA 3LY3A 3GSGA 3S7OA 3EPLA 3AV1C 1YLZA 3VP1A 1WWIA 1W1PA 2Y2JA 1W8YA 3DAVA 4G92C 3AZED 4D60A 4LLOB 4CSRB 3HLCA 3OCLA 2C6WB 3W98B 3OOVA 2XLNA 5EVID 2IWBA 3AZNB 3IBRA 3C1CB 3AZMA 1LL9A 4EO5C 3B6GD 4GOGA 5B33B 3O3VA 5F6AA 5CPJC 2P04A 3F6TA 3DTKA 3WA9A 5AV6B 4E45A 1BSGA 4BMWA 4DE2A 4U0XA 3DTIA 3CPTA 1W63Q 4ZJ3A 1BULA 2C5WB 3MFXA 1NJ4A 5BS7C 3A0SA 4YWZA 5B31G 1TD5A 1KDWA 5FI6A 1P3BA 3HLGA 3P7NA 1IKIA 2PRFA 3VH6A 3AZLB 2CV5B 4NYUA 3BLSA 3QP4A 2HF6A 4I38A 4H9RB 1HD8A 5CP6A 5E2HA 1VQQA 5B0YB 3C30A 3KWQB 3QP6A 3T4JA 4XZQD 3UE0A 3TU4B 5HWWA 2XQZA 2O0YA 4H8RA 4XUXA 3B3XA 3IWQA 3AFAB 5CTMA 1IYPA 1LSWA 4FH4A 3ZHHA 5E5AD 4E3IA 2PYOB 3A6NC 1K54C 2P9VB 3REHD 4R8PB 3AN2A 3BYDA 4Z2LA 5EVIC 4H9SA 3REIB 1UGUA 2X02A 1P3MD 2HIOC 2X01A 4IEDA 2L0WA 3N4IA 4KUDC 1O07A 4OOYA 5B40C 2PU2A 5KDMB 1E6RA 2RVQC 2PDRA 1OJGA 3IXGA 5CP6C 4OOMA 5B2IA 5CPJB 5KZHA 4HEFA 5GLDA 4J8UC 4XUJB 4HOIA 4R8PA 3NQJA 3AN2B 4G3VA 1OJ5A 4ZUXC 4CAYA 3UTBB 3UDFA 3S7PA 3G34A 3X1VD 1NXYA 3A3FA 3UPNA 4FOFA 2QKPA 5FI2A 2Y2OA 2ZY2A 3DWKA 5B2JD 1ZLAD 5TJJA 3MKFA 4LFUA 3AZHB 5DTTA 1N9NA 3VP2A 5B40D 4Z66D 2XROA 4H9QB 5FUGA 2R78A 4S2MA 4LD9B 3NOPC 4KGCB 2PR6A 1U35B 3LI8A 4JJNC 5GT0A 2NZDD 3LELD 3REHC 2NQBB 1GCEA 2OSUA 2VA0A 2IWDA 5E5AC 1YUEA 4LD9D 1H0IA 2I9VA 2PHYA 3MVDD 3A3IA 4BL3A 2QJ5A 5FEGA 4Y3IA 3T1QB 3QP5A 4O7DA 3AZIA 3KS8A 4H9OB 3UT9A 1YLJA 3L9KA 4CLCD 3WRTA 4XT2A 2ZQCA 5CP6B 2EX9A 3C8CA 4ZBJC 1Q2QA 2JKRM 3IH9A 4Z2IA 4Z2GA 3OPLA 3AZNC 1NZOA 3MVDA 3IT9A 1M18D 2V1BA 2O9BA 5CPKA 2XFTA 3W4PA 3FC7A 5E5AA 3A6NA 3IXBA 3C2WA 4NZ1A 3A1IA 5G49B 5EFWA 1O7EA 5DFXA 1H0GA 3MXQA 4E3LA 4R38A 4NZ3A 3FG8A 5DKKA 4BLMA 1S32B 3WRZA 2JCHA 2V5OA 1TS0A 4P6BA 3BFCA 2WKHA 2ZL1A 3GTCA 5B2ID 2YKHA 4MB5A 3EQUA 1W79A 2FFYA 4CLCE 5DF7A 1KS0A 3KWQC 5FSRA 5FQ9A 3BQ8A 4WN5A 3MFDA 4NETA 1K55C 1RCJA 3LIFA 4YS3A 1KE3A 1JTDA 2J3TC 2HDRA 2Y2LA 3IF5A 5B0ZD 4NEED 2PYOC 1ZTUA 3AZLA 4YINA 2CV5A 2AROC 1H8PA 3IS2B 3IWIA 2WUQA 1MKMA 5AVBA 3NDGA 5F5YA 1DP6A 4OQHA 1N9OA 3VV4A 1U35A 4KZ8A 1M6KA 4WMCA 2OLVA 4JBFA 1KU5A 4QWOA 3HUNA 3NHQA 4LG2A 1KX4D 1V9YA 5JRGA 3PR6A 3LZ1D 1PWDA 3W96D 4S2PA 4B88A 4UUZB 3PXPA 3C4PA 4HBTA 4QPRA 5HARA 4EBLA 2LY8A 2OV5A 4GKUA 1OMEA 1K57C 1A7WA 2WZXA 4EUZA 4CSRA 1P3IB 4FTXA 3WS1A 4RVAA 5CPKC 4QD4A 3SW1A 3B6FA 2VGJA 3NULA 2HUEC 5L2FA 2WKIA 4KZ5A 3HLEA 3ULFA 5DNNA 3B42A 1H8MA 2ZM2A 3L29A 5FAOA 3C38A 1KX5D 4DE1A 3T1XA 5CEBA 2JC7A 4GHIA 2A24A 3V9RB 2HIOB 1OT6A 2LB5A 1JNUA 3IH8A 5AV6A 2NUTC 4HGAC 3PBRA 3UB5P 4PMAA 4ZRRA 5G49A 3LCEA 3MGQA 2H0TA 5IU1A 3TE8A 4P85A 5F69A 5DNND 5HPFA 3MXRA 1BLSA 1C3BA 5G4ZA 4IBGA 2MJ6A 3CWFA 3A3EA 3PBTA 4IBXA 2VGLS 5GXQD 1J3WA 4OVDA 2UWXA 2YKFA 5FDSA 4KHAA 4GN2A 2W1TB 1W1VA 2VK3A 3UMDA 4EETB 3AGFA 3MNNA 3W99D 4PPRA 3ZG8B 4Q8IA 5CGWA 3REJA 3O5YA 1P3OB 4X69A 5B1MA 1KX3B 1P3BD 4IBCA 4NXFA 1B6WA 4OQGA 1EQZD 4EU0A 3BJNA 5FQJA 4QY5A 4CLCA 2CV5D 2ZOIA 1RGZA 3FKWA 5AVCC 3KUYD 5AVBD 5AV5B 1XPBA 3NECA 5DKLA 3RXXA 2I72A 1SKOB 4J8WA 1B67A 4D2OA 5BNVA 4NY2A 1NYMA 2ZC4B 3VH5A 2JN7A 3F1OB 4UA6A 3WTPA 3UB9A 1BLCA 5EECA 1VEUB 2DCFA 2ZD8A 3B0CW 1XA7A 2QMIA 3IF6A 3W98C 3REJC 3O88A 2PR5A 4G91C 5B1MB 3W96C 4CQHA 3R45B 1UWNX 4OOLA 4X25A 3X1TC 3X1TD 4Q0IA 2RVQD 2RCXA 5FUGB 1KX4C 5BO0B 2RTSA 4WU9B 1XFNA 2DNSA 3KSHA 3B6FB 1DP8A 2J9PA 4GDNA 5GLAA 4XUJD 5HDCA 4DRBA 3WTPD 1GOIA 1KX5A 2G7UA 3WTPB 4GHLA 4HP9A 1W2EA 1P3AD 4LV2A 5AV8B 3BM6A 4J8UA 2PYPA 3HLWA 4XZQC 5AQAA 1PWGA 5EOEA 2FJ7A 3AFAC 3BFDA 3IBJA 3VP0A 1YLWA 1OGGA 5CHUA 4YOFA 5B40A 2AROD 3W97D 4NG2A 1K25A 3BLMA 3ZVWA 5B2IC 5FASA 5HAIA 4S2JA 3FYZA 4P87A 3ZG5A 4OP5A 2HP9A 3A3DA 4K91A 1H0MA 4FCFA 3P98A 4WU8B 3NJAA 4HMDA 3KO6A 2F8NB 5HFOA 3W96B 3REKC 3IX3A 3MGRA 5A90A 3REJB 2IA2A 4R3AA 5FEFA 3FKEA 3C7UA 4AWLB 4IJFA 1CQAA 2FH5A 5DNMD 4ZUXB 1PZPA 4EXOA 1L3LA 3UNWA 1P3FC 3BY8A 5GHZA 1BH8A 2UV0E 3Q07A 2Y2QA 2WKPA 1ERQA 4N1HA 2J9OA 4YFMA 2IO5C 5EV0A 4MBKA 1P3PD 4MB3A 4H9SC 1XXMA 3AZJA 1P3LD 3X1SD 1YM1A 4OLGA 4ZBJB 5B32B 4Z2MG 3LIBA 4ESPA 2WZZA 1PIOA 3KXBA 3LIDA 4NE6A 5B32D 1RGYA 3QNCA 4WYYA 4C6YA 4QY6A 1M1AD 4KGCC 3V39A 4DE3A 5BPVA 1YKDA 3MXSA 3HLBA 4OQ0A 1ULYA 4ETZA 3AZLC 4JF5A 2Z6CA 4RX2A 3B0DB 1AOID 4MLLA 1ES2A 3HUMA 1YU4A 4NXEA 1P3GB 3DW0A 3W8KA 1ID3A 2K7SA 3UB8A 5CPIB 5IS1A 3KSGA 1S32A 5B32A 2B18A 3X1UD 3WKJA 3OPHA 3BQAA 1S1YA 1VM1A 3NOTC 4LRZE 5DTKA 3AZMD 5U47A 3ZVTA 4FD8A 3EPHA 2A3UA 3S7NA 5CECA 4IVIA 5F68A 5L8MA 3C5AA 1WA9A 1MPLA 4GHIB 1N1JB 4YS3C 3B47A 4H9PA 2BLSA 3AFAD 1V9ZA 1KE0A 5HL6A 5CX7A 3AZIC 3L25A 4QNLA 3HLFA 5DFYA 5HW3A 3WAAC 4OJLA 4JF4A 1CEGA 3RELC 1S32C 4U0TA 3UTBC 4WM9A 1PWCA 1E3UA 5D3OA 2XK1A 2B95A 2FFFB 1EROA 2INWA 3CJMA 2W3FA 2KX6A 2ZC3B 3HL9A 2R9WA 3AZKA 3BECA 1L0DA 5G4YA 3GVBA 3KYZA 4R8PC 3T1SA 3EQVA 1BLHA 4NZ4A 1TS8A 4Y2FA 1P3IC 2PT7A 1HQ3D 2KLIA 5C3IB 5JRGD 1K6RA 3OPRA 1FILA 4NE5A 3LELA 1PDCA 1YMSA 4EUVA 3C7VA 4R23A 4Z5TD 2ZC5B 4R4RA 4HI4A 3MNNC 2PAVP 4HMEA 2V20A 5TBMB 3AGEA 3UT9D 4HH2A 1F66D 2Y79A 3C1BB 2XD1A 1ZLAB 5DNNB 4KQQA 3VOLA 3SS3A 1ES3A 3WKJC 5CGXA 5GT0B 4J8VC 3H9WA 2HP5A 1LSXA 3WA9D 3PBOA 3LZ1A 4X55A 3W96A 3MGQC 3W99A 1K4EA 3GDIA 4X56A 4Y17A 5L07A 5AV8C 2PU4A 3AZIB 5B24C 3VH5T 4E3JA 4ZJ2A 3MGQD 5B1LA 1P3KD 5HWTA 2YFWB 1LL8A 1BH8B 5GT3D 2H10A 3G4PA 4GW9A 1M1AA 3C1BA 3NQUB 2ZQDA 4DDSA 4I5SA 3E4QA 4DMZA 5GXQC 2J80A 4ZBEA 3UMEA 4EESA 4J8XA 3UDIA 5AQBA 4CAYB 3UTBA 5C3IC 4X23A 4OJ6A 4RQ9A 2W3GA 2M7VA 3TW8A 4WZSB 5E2FA 2RIQA 1WYCA 1YQSA 1IKGA 1XGIA 1T1AA 2ZQ7A 2ZC6B 3G35A 3C1CC 1W8QA 4H6JA 4I39A 1EQZA 3H82A 2ZBBA 1TAFB 1E3UD 5B40B 3MSHA 2BASA 2HP6A 3SOIA 4XZQA 3Q1FA 3MGSB 2NZDB 5CEDA 3CITA 4E6XA 3VOYA 1JWVA 2EFXA 2ZMFA 4I3IA 1HTZA 5CPKD 3VFFA 4WMCD 2G5IC 3A6ND 3MGPB 4LGWA 1P3GA 1EI5A 1I2WA 4H6JB 3SS4A 3MGPD 2PYOA 2G2WA 4O8GA 4MNRA 1P9RA 5L10A 4G3WA 5HL1A 4Z5TA 1A0KA 3Q7VA 2Y2PA 1MWSA 3T4TA 4IHQA 4WNNB 3G6OA 4EQIA 2O99A 5HDDA 3M2KA 4HY8A 2OLUA 2VV6A 3W4OA 1G28A 2H28A 3AZHC 5B0ZC 4PM5A 5HD5A 4LV0A 3ZQ5A 4KUDB 1NLYA 5FI7A 1QMEA 2DMWA 4NKPA 2BYKA 1OTEA 1LL5A 1UR9A 3MGPA 2PYOD 4A5RA 4P6ZS 4UUZA 3ZNTA 3REHB 2NQBC 2EX2A 1XJ2A 1U35C 5BS7A 1FIKA 4IUHA 4MDZA 1DY6A 1T1BA 1FSYA 3ITBA 4RX3A 1KVMA 4HP4A 3JYIA 4G92B 3B6FC 4DE0A 4Z9QA 3TRCA 3AN2C 2JBFA 1ES4A 3AZGD 2P08A 4N92A 3REKB 1XP4A 1ACFA 3AZHA 2WADA 3Q82A 2HPBA 4HNBA 3AZGC 1W1YA 3L28A 2VJWA 3HJIA 1HQ3B 4EW7A 1KVLA 1AXBA 5BOHA 4UAAA 1XKZA 3UTAC 4DKIA 5AV9D 3V67A 2FJ7D 3NCKA 2Q9MA 4JPMA 4HQAA 4I3AA 2KOIA 2EX6A 1TZYC 1ZLAA 1ESUA 3AZND 4GCZA 4ID4A 3IXHA 1E4DA 3VFHA 3UT9B 1FCOA 1G6AA 3AZHD 3KSIA 1AOIA 4F94A 3RELA 4MBFA 3VE3A 1NLZA 5AV6D 3GR2A 4Y5FA 1ID3D 3MVDC 1ZKJA 5AV5C 3NI9A 4BL2A 1YSQA 3WD4A 1P3OA 1H8YA 4RYEA 3X1UA 1S6RA 4MBHA 3QP8A 1TVFA 5EM1A 3U4LP 1OT9A 2JKTM 1FCNA 4Z66C 4F3LB 4KG6A 4JKTA 1TZYA 2PBYA 1ZLAC 3F1NB 1W5DA 4YNRA 3AV2D 3LO7A 2J8PA 1S4RA 4JGPA 1F2KA 5F99B 3LR4A 4E04A 1PNEA 3REHA 4S2NA 3REIA 2ZY3A 1XJ6A 4UPKA 4DDYA 3MZDA 3X1VC 1TZYB 1SCWA 4J8UD 3B6GA 3WTPC 3H82B 4F3LA 3MJQA 2OWJA 2JSSA 3LEQA 4IBJA 2GJ3A 4GS9A 1LI9A 2M7UA 4DN0A 2YFVA 4JLFA 4OP8A 5AQ7A 5FQIA 3ITAA 4N1XA 2HJ9C 5F1FA 5B24D 3T50A 1P3BC 1JFIB 3T4OA 5F99A 3AV2C 1PRQA 1IELA 3W99B 2QPNA 5GT3C 3CG5A 1PI4A 1BUEA 5HDSA 4B93A 3AGDA 4Y13A 4J8VD 4GH9A 1F5MA 2L1MA 2XFSA 3E2KA 5B2JA 2QHKA 4ZDXA 5AV5A 1OTBA 2W8SA 1CF0A 1N9BA 4NZ5A 3S7QA 4R6LA 1VETB 4DF6A 1CK3A 2QYBA 1J7MA 3N8RA 2GZAA 3AZKC 1P34D 4KUDA 3AZFB 2JKFA 2XSSA 5GXQA 3LIEA 1OTIA 2W3EA 1P97A 3AZFD 4DRAA 3CLOA 1BFMA 4WU8A 2V8FA 3G31A 3UY6A 3LIAA 1DRMA 1ONGA 5CPJD 4KQRA 1TDLA 1E15A 2CWEA
chains in the Genus database with same CATH topology
3UTAB 1P3ID 1IYSA 3GMWA 3Q7ZA 4IVKA 2ZLYA 4BD1A 3REKA 1CI9A 3P5JB 3UTBD 1HQ3A 2BYMB 1H3OA 3RELD 5AY8B 3AZFA 5AVCB 1M18A 3VH6W 4E44A 2F8NG 1P3PB 4AWLC 4S2OA 3CZDA 2ZJ9A 4B4XA 1HVBA 2ZY5A 2EXBA 4UA9A 2IO5B 3O62D 3LZ0A 3ZGAB 4U3TA 1GHMA 3AZKB 4IBFA 5BT1D 4J8WD 3AZJD 1Z6FA 3LJAA 2WAFA 1IYQA 1DJAA 1XGJA 5CHJA 4X23C 1K56D 1P3OD 1U60A 4YS3B 3IHAA 5KDMA 1SDNA 5EVIA 3MGPC 3X1UB 2XEPA 3AZLD 4XUZA 3GQZA 3B0DC 3X1TA 1BH9B 3TU4D 4XZQB 4PM8A 5M18A 3W97B 5E5AB 4LENA 4JJNB 1MWRA 3B0CT 1T3UA 3LZ1B 3AV1B 5GSUC 1P3PC 1ZG6A 4IBDA 2WGVA 3PBNA 4WU8C 4IBKA 4H9NA 4WU9C 4OPYA 5DVAA 3MGSC 4WZ5C 3MGRD 4KG2A 3N3FA 2Y2MA 4QLCB 1P3IA 2EXAA 3REKD 5DNMC 4BQMA 3AN2D 3HONA 3FDDA 1H3OB 1JVJA 4KQOA 3AYWD 4PM6A 1P3AB 3ZG7B 1QMFA 3KS4A 3G2YA 3X1VB 3UE1A 2Z2LB 3W98A 4BJPA 3PBQA 1MKIA 3ZCZA 5B1LD 1P3KA 2Y2HA 5B2JB 3WA9C 3BFEA 3HVFA 1JTGA 2AROA 2XD5A 2WGWA 2F2AC 4KZ7A 5JYPA 3N8SA 2NQBD 3IHBA 3MNNB 5GXQB 5F83A 2ZM8A 1YU3A 3I7JA 3VH5W 3TSGA 5CPIC 5GLCA 4GHAA 4OLDA 3ZG0A 4H9QA 4WZ4A 5CP6D 3Q81A 1WWSA 1PW8A 3HUOA 4BENA 3KUYB 3VSLA 5HAPA 1P3OC 2BYKB 1PI5A 3V50A 4OQIA 2HIOD 4M3KA 3PAEA 4S2KA 4KG5A 4Y0UA 1R4VA 2HDSA 2L5AA 4OJPA 1SKFA 2V2FF 1L0GA 3H0LC 3WAAB 3ZG9B 5BO0A 4X6TA 3LJAB 4N9KA 5KSCA 4EV4A 5TGFA 2XF3A 4XUJA 1YU2A 3GRJA 5FAPA 1P3KC 1Q9CA 3DWZA 3GV9A 2XH9A 1P3MC 4Y7PA 5AV5D 4RA7A 5F99C 3AV2A 4UHUA 5FDHA 3NY4A 3L26A 3DTMA 4WBGA 4K0WA 3P09A 5FAQA 4E3NA 5DNNC 4KZAA 4X23B 4KGCD 4IBIA 4IBBA 3LELB 3UPOA 3CMZA 5B0ZA 4WU8D 5A91A 5B32C 1MXOA 1WE4A 2F8ND 2F8NH 5FQMA 3LJAC 1N4OA 3VSKA 3AZNA 1FQGA 4OJOA 4FH2A 1KX5B 1KX4A 4J8XD 1P34A 1P3LA 3REIC 3LZ1C 5CXWA 5GSUB 5DTSA 1K38A 5AY8C 2BG1A 3L27A 2FJ7B 3B6GB 3WS4A 3KWQA 4E3MA 2P74A 1P34B 3N7WA 1P3PA 3NDEA 4J8WB 4JXWA 1JWPA 1L0FA 1ID3B 5EVLA 2F8NK 1EQZB 4E3KA 3KWQD 3AZMC 5I94A 4YM6B 4WU9A 1ES5A 4S2LA 3X1UC 5AVBB 1ZC2A 5AY8D 4H9PB 3HLDA 4OKPA 4R3BA 1M1AC 4OH0A 3V5MA 3AZEB 4GD6A 4QJGA 2YFWA 4HGAB 1P3AA 3C1CD 1KGGA 4H9RA 2DRWA 3C4OA 1P3LC 1TZYD 5B33D 5B33C 4S2NC 1IEMA 1NYYA 3O87A 2WGWB 2ZC7A 4WEKA 3VOZA 4OPRA 2FJ7C 1DJBA 5E2GA 5AY8A 1K57A 4Y0OA 4ZJ1A 1K6SA 3IXDA 4OPZA 1S0WA 3H0RC 2Y2NA 4KZ3A 1TDGA 3X1SC 4H9NB 4NE3A 2XR0A 3S22A 1NY0A 5B0YD 4R0QA 3TU4C 5AV8D 4KZ9A 2F8NA 4JXVA 4H9OA 4LV3A 3SH8A 4WJ3C 3W97C 4HBUA 4YM6C 3PTEA 1U35D 3WS5A 4KHAB 1YU1A 3WX7A 4R1GA 5GT0D 2WGIA 5B2JC 3BFGA 3UT9C 5JYOA 1P3GC 3X1SA 3AYWA 3MVDB 3AZJC 3MNND 2E8IA 3MKEA 1TEMA 5AV9A 1M19B 4J8UB 3X1TB 3WAAA 2Z2MB 4Z2MH 3RJUA 1M19D 4CPKA 3AZGB 4XUJC 3L2AA 3M6HA 2ZY4A 1HQ3C 3LZ0D 1FOFA 4FSFA 4YM6A 1P3AC 1JWZA 1BZAA 2ZMAA 4JF6A 4B4ZA 3RELB 5GHXA 3AYWB 3W98D 1KE4A 1HTAA 1PZOA 2H5SA 1K56A 1S32D 2RL3A 3OZHA 5TR7A 5AV9B 1M19A 3LZ0C 3IF6B 3E2LA 3N6IA 1ZG4A 5FATA 5B33A 4GB7A 3ZFZA 3KUYA 5B2IB 1XX2A 2Y2KA 3IP4C 1RP5A 2NZDA 5M19A 1L2SA 1PYYA 4R4SA 4C3QA 5B1LC 1P3GD 3HSHA 3KXBD 1P3BB 5GLBA 2H0YA 3W99C 5JA4A 4GDBA 4WNNA 1P3KB 4Z5TB 3KXBB 3Q7VB 5B0YA 3B6GC 2XGNA 1ESIA 4OUIA 3G30A 1K54A 5KSHA 3FV7A 3NQUA 3QHYA 1CI8A 2WK0A 1BT5A 5FQQA 5A93A 3W97A 1P3LB 4LCLA 3RXWA 4GNUA 4OONA 1KX4B 4UA7A 5G18A 3MGRC 5CRFA 4C75A 1KDSA 3OCNA 3A1KA 3WKJD 5EPHA 1TAFA 3NC8A 3C1CA 3OPPA 3AV1D 5F82A 4WV4B 4ZUXA 3NIAA 5GT3B 1FCMA 3G32A 1BTLA 5DNMA 3NBLA 3MGSD 5B31C 1F66A 4X53A 4N9LA 1KGFA 4EWFA 4WEJA 1MWTA 5B32G 1P3FD 3SH9A 5JRGC 5KMWA 5CHMA 4KZ4A 1IYOA 5CERA 5EE8A 5B1MC 3VP4A 3PBSA 5AV8A 5J8XA 4Z66B 4HESA 3IWOA 1BH9A 1AOIB 2IWCA 2BYMA 3M6BA 4KGCA 3UPPA 4X23D 5BNVB 4NFTA 5AV6C 1Q2PA 5FQKA 4KZBA 2EFUA 5EOOA 3EPJA 5BT1C 4J8WC 1FR1A 3UE3A 5B31D 3AL0C 3WS2A 5CPJA 2HUEB 1I2SA 5EUAA 2WAEA 1W7FA 5TFQA 3MZFA 4DRTA 3LZ0B 3IF6C 3UO9A 5A92A 1GA9A 5JRGB 4E3OA 5IHVA 1YLYA 2A49A 5M1AA 1KX3A 3VMAA 4WELA 3LEZA 3B0BA 3REID 3WS0A 4ZAMA 2WYXA 5B1MD 5EVIB 1M1AB 5DF9A 4NK3A 3UTAA 5B1LB 4KENB 2ZM5A 1M18C 5E2EA 3TOIA 4WU9D 3TU4A 3AZKD 1P34C 4G91B 4PM7A 1EWZA 2Y59A 2HIOA 4ZTKA 3LJAD 5FA7A 1FSWA 1FR6A 2CV5C 2EX8A 3AFAA 3AZFC 4E6WA 3D4FA 5E43A 1KX3C 3W4QA 1E25A 1P3MA 1EQZC 5GSUA 3FKVA 1SHVA 1DJCA 1PW1A 4KZ6A 3AV1A 3AZMB 2HDUA 3UDXA 3LELC 3VH6T 3AV2B 1I5QA 1H5XA 2J7VA 4EBPA 1F1EA 5GL9A 4GD8A 1K4FA 2Y2IA 4QLCA 4OPQA 2G5HC 4R8PD 3UN7A 5F99D 1YU0A 1Y54A 1P3MB 3WA9B 4LD9C 1BLPA 1LLBA 1ALQA 4CJNA 4JJND 1YMXA 3ISGA 4LCMA 3EG5B 5CGSA 4J8VA 3KXBC 3VP3A 3WAAD 1MWUA 3AZID 4ZUXD 2V1ZA 2Y4AA 5DNMB 4P0MA 1ERMA 1XA1A 3WWXA 5GT3A 1YT4A 3MBZA 1M19C 1L0EA 5AQ9A 5B24A 5GHYA 2GDNA 3V3SA 1G68A 5BNXB 4QHCA 4OJ5A 3X1SB 3BEBA 2NQBA 4J8XB 4QU3A 3V9RA 3N8LA 1P3FB 4LD9A 2Y91A 3PAGA 5GT0C 4J8VB 3AZEA 5CTNA 5CPIA 1K55A 3R45A 4XXRA 4DQYB 3EPKA 3MZEA 3ZDJA 3FZCA 3C1BD 1ID3C 2JE5A 2ZQ9A 4Z66A 1MY8A 5HAQA 4KUDD 1KGEA 3SS5A 1NRFA 3BRMA 4M6BA 1MBLA 4BD0A 3KSYA 1SDEA 4EBNA 3TG9A 4R3JA 3NQJB 1KX3D 3AZJB 2X71A 2WKEA 1H8ZA 1LI0A 3A6NB 2ZM0A 3G2ZA 5CPID 1CEFA 2Y55A 3H0MC 3SH7A 2J8YA 3KUYC 3HREA 3UTAD 5B31A 1F66C 4PM9A 4S2IA 2VQRA 3O62A 1LHYA 5F1GA 2DQNC 3FWLA 4JXGA 3WTPE 4YM6D 1Z2CB 2DF4C 4JXSA 4Z5TC 5AVCA 2AROB 1M18B 4QLCC 1JFIA 4L0LA 3AYWC 1WYBA 4K0XA 5JA4B 5B0YC 1YLTA 2ZQ8A 4IJEA 4JJNA 4NYYA 3V3RA 4MEZA 2VGKA 2ZQAA 2R9XA 3OC2A 1ONHA 3MGRB 3O62B 1GHPA 2Y2GA 4X68A 4IBEA 3AZGA 3B6FD 4QLCD 4QB8A 3AZEC 3ZNYA 1N1JA 3S4XA 5CPKB 3A3JA 4DXCA 5BNXA 4Y0TA 1J9MA 3X1VA 1KX5C 5B0ZB 1M40A 4YS3D 5DF8A 3BFFA 5GSUD 1HZOA 4EO5B 1F66B 4IBRA 3IQAA 2NZDC 1NZUA 2B5RA 2XDMA 4DXBA 1PZRA 2YFVB 2P9VA 3KFUG 3S1YA 3LY4A 4LV1A 5CHLB 3C1BC 2QZ6A 3HBRA 3WKJB 2CC1A 1AOIC 4J8XC 3REJD 3O86A 2IOUA 2HDQA 1YLPA 4GZBA 3MGQB 1GA0A 5B31B 3QNBA 3O62C 5HX9A 3MGSA 4WZ5A 1GHIA 5B24B 5AV9C 1P3FA 2Q9NA 3M2JA 5AVBC 5AVCD 2G2UA 3LY3A 3GSGA 3EPLA 3AV1C 1YLZA 3VP1A 1WWIA 2Y2JA 1W8YA 4G92C 3AZED 4CSRB 3HLCA 3OCLA 2C6WB 3W98B 2XLNA 5EVID 2IWBA 3AZNB 3C1CB 3AZMA 1LL9A 4EO5C 3B6GD 4GOGA 5B33B 3O3VA 5CPJC 3F6TA 3WA9A 5AV6B 4E45A 1BSGA 4DE2A 4U0XA 4ZJ3A 1BULA 2C5WB 1NJ4A 5BS7C 5B31G 1KDWA 5FI6A 1P3BA 3HLGA 1IKIA 3VH6A 3AZLB 2CV5B 4NYUA 3BLSA 4H9RB 1HD8A 5CP6A 5E2HA 1VQQA 5B0YB 3KWQB 4XZQD 3UE0A 3TU4B 2XQZA 4H8RA 4XUXA 3B3XA 3IWQA 3AFAB 5CTMA 1IYPA 4FH4A 3ZHHA 5E5AD 4E3IA 2PYOB 3A6NC 1K54C 2P9VB 3REHD 4R8PB 3AN2A 3BYDA 5EVIC 4H9SA 3REIB 2X02A 1P3MD 2HIOC 2X01A 4IEDA 3N4IA 4KUDC 1O07A 4OOYA 5B40C 2PU2A 5KDMB 2RVQC 4OOMA 3IXGA 5CP6C 5B2IA 5CPJB 5KZHA 4HEFA 5GLDA 4J8UC 4XUJB 4R8PA 3NQJA 3AN2B 4ZUXC 4CAYA 3UTBB 3UDFA 3G34A 3X1VD 1NXYA 3A3FA 3UPNA 5FI2A 2Y2OA 2ZY2A 3DWKA 5B2JD 1ZLAD 3MKFA 3AZHB 5DTTA 3VP2A 5B40D 4Z66D 4H9QB 5FUGA 4S2MA 4LD9B 4KGCB 1U35B 4JJNC 5GT0A 2NZDD 3LELD 3REHC 2NQBB 1GCEA 2OSUA 1YUEA 2IWDA 5E5AC 4LD9D 3MVDD 3A3IA 4BL3A 4O7DA 3AZIA 3KS8A 4H9OB 3UT9A 1YLJA 3WRTA 2ZQCA 5CP6B 2EX9A 4ZBJC 1Q2QA 3IH9A 3OPLA 3AZNC 1NZOA 3MVDA 3IT9A 1M18D 5CPKA 2XFTA 3W4PA 5E5AA 3A6NA 3IXBA 4NZ1A 3A1IA 5G49B 1O7EA 4E3LA 4NZ3A 4BLMA 1S32B 3WRZA 2JCHA 4P6BA 3BFCA 2WKHA 3GTCA 5B2ID 3EQUA 1W79A 2FFYA 5DF7A 3KWQC 5FSRA 5FQ9A 3MFDA 4NETA 1K55C 1RCJA 4YS3A 1KE3A 1JTDA 2HDRA 2Y2LA 3IF5A 5B0ZD 2PYOC 4YINA 3AZLA 2CV5A 2AROC 3IWIA 2WUQA 5AVBA 3NDGA 4OQHA 1U35A 4KZ8A 1M6KA 4WMCA 2OLVA 4JBFA 1KU5A 3HUNA 4LG2A 1KX4D 5JRGA 3LZ1D 1PWDA 3W96D 4S2PA 4B88A 4UUZB 3C4PA 4HBTA 5HARA 4EBLA 2LY8A 2OV5A 4GKUA 1OMEA 1K57C 1A7WA 2WZXA 4EUZA 4CSRA 1P3IB 3WS1A 4RVAA 5CPKC 4QD4A 3B6FA 2VGJA 5L2FA 2HUEC 2WKIA 4KZ5A 3HLEA 5DNNA 2ZM2A 3L29A 5FAOA 1KX5D 4DE1A 5CEBA 2JC7A 3V9RB 2HIOB 3IH8A 5AV6A 4HGAC 3PBRA 4PMAA 5G49A 3LCEA 3MGQA 2H0TA 4P85A 5DNND 3MXRA 1BLSA 1C3BA 4IBGA 3PBTA 3A3EA 4IBXA 5GXQD 4OVDA 2UWXA 4KHAA 4GN2A 3AGFA 3MNNA 3W99D 4PPRA 3ZG8B 4Q8IA 5CGWA 3REJA 1P3OB 4X69A 5B1MA 1KX3B 1P3BD 4IBCA 1B6WA 4OQGA 1EQZD 5FQJA 4QY5A 2CV5D 1RGZA 3FKWA 5AVCC 3KUYD 5AVBD 5AV5B 1XPBA 3RXXA 2I72A 4J8WA 1B67A 4D2OA 5BNVA 4NY2A 1NYMA 2ZC4B 3VH5A 4UA6A 3WTPA 1BLCA 5EECA 2DCFA 2ZD8A 3B0CW 1XA7A 2QMIA 3IF6A 3W98C 3REJC 3O88A 4G91C 5B1MB 3W96C 3R45B 4OOLA 3X1TC 3X1TD 2RVQD 2RCXA 5FUGB 1KX4C 5BO0B 4WU9B 2DNSA 3B6FB 4GDNA 2J9PA 5GLAA 4XUJD 4DRBA 3WTPD 1KX5A 3WTPB 4GHLA 1W2EA 1P3AD 4LV2A 5AV8B 3BM6A 4J8UA 3HLWA 5AQAA 4XZQC 1PWGA 5EOEA 2FJ7A 3AFAC 3BFDA 3VP0A 1YLWA 5CHUA 5B40A 2AROD 3W97D 1K25A 3BLMA 3ZVWA 5B2IC 5FASA 5HAIA 4S2JA 3FYZA 4P87A 3ZG5A 4OP5A 2HP9A 3A3DA 4K91A 4FCFA 3P98A 4WU8B 2F8NB 5HFOA 3W96B 3REKC 3MGRA 5A90A 3REJB 3FKEA 3C7UA 4AWLB 4IJFA 5DNMD 4ZUXB 1PZPA 3UNWA 1P3FC 5GHZA 1BH8A 3Q07A 2Y2QA 1ERQA 4N1HA 2J9OA 4YFMA 2IO5C 4MBKA 1P3PD 4H9SC 1XXMA 3AZJA 1P3LD 3X1SD 1YM1A 4OLGA 4ZBJB 5B32B 4Z2MG 2WZZA 1PIOA 3KXBA 4NE6A 5B32D 1RGYA 3QNCA 4WYYA 4C6YA 4QY6A 1M1AD 4KGCC 3V39A 4DE3A 5BPVA 3MXSA 3HLBA 4OQ0A 1ULYA 3AZLC 4JF5A 4RX2A 3B0DB 1AOID 4MLLA 1ES2A 3HUMA 1YU4A 1P3GB 3DW0A 3W8KA 1ID3A 5CPIB 1S32A 5B32A 3X1UD 3WKJA 3OPHA 1VM1A 5DTKA 3AZMD 5U47A 3ZVTA 4FD8A 3EPHA 2A3UA 5CECA 4IVIA 3C5AA 1MPLA 1N1JB 4YS3C 4H9PA 2BLSA 3AFAD 1KE0A 3AZIC 3L25A 4QNLA 3HLFA 5HW3A 3WAAC 4JF4A 4OJLA 1CEGA 3RELC 1S32C 4U0TA 3UTBC 4WM9A 1PWCA 1E3UA 5D3OA 2XK1A 2FFFB 1EROA 3CJMA 2ZC3B 3HL9A 2R9WA 3AZKA 3BECA 1L0DA 3GVBA 4R8PC 3EQVA 1BLHA 4NZ4A 1P3IC 1HQ3D 5C3IB 5JRGD 1K6RA 3OPRA 4NE5A 3LELA 1YMSA 3C7VA 4R23A 4Z5TD 2ZC5B 4R4RA 3MNNC 2V20A 3AGEA 3UT9D 1F66D 3C1BB 2XD1A 1ZLAB 5DNNB 4KQQA 3SS3A 1ES3A 3WKJC 5CGXA 5GT0B 4J8VC 2HP5A 3WA9D 3PBOA 3LZ1A 4X55A 3W96A 3MGQC 3W99A 1K4EA 4X56A 5AV8C 2PU4A 3AZIB 5B24C 3VH5T 4E3JA 4ZJ2A 3MGQD 5B1LA 1P3KD 2YFWB 1BH8B 5GT3D 2H10A 3G4PA 1M1AA 3C1BA 3NQUB 2ZQDA 4DDSA 5GXQC 4ZBEA 4J8XA 3UDIA 5AQBA 4CAYB 3UTBA 5C3IC 4X23A 4OJ6A 4WZSB 5E2FA 2RIQA 1WYCA 1YQSA 1IKGA 1XGIA 2ZQ7A 2ZC6B 3G35A 3C1CC 1W8QA 1EQZA 1TAFB 1E3UD 5B40B 2HP6A 3SOIA 4XZQA 3Q1FA 3MGSB 2NZDB 5CEDA 4E6XA 3VOYA 1JWVA 2EFXA 3VFFA 1HTZA 5CPKD 4WMCD 2G5IC 3A6ND 3MGPB 1P3GA 1EI5A 1I2WA 3SS4A 3MGPD 2PYOA 2G2WA 4MNRA 5HL1A 4Z5TA 3Q7VA 2Y2PA 1MWSA 4WNNB 4EQIA 3M2KA 2OLUA 3W4OA 3AZHC 5B0ZC 4PM5A 4LV0A 4KUDB 5FI7A 1QMEA 2BYKA 1LL5A 3MGPA 2PYOD 4A5RA 3ZNTA 4UUZA 3REHB 2NQBC 2EX2A 1U35C 5BS7A 1DY6A 3ITBA 1FSYA 4RX3A 1KVMA 3JYIA 4G92B 3B6FC 4DE0A 4Z9QA 3AN2C 2JBFA 1ES4A 3AZGD 4N92A 3REKB 1XP4A 3AZHA 2WADA 3Q82A 2HPBA 3AZGC 3L28A 1HQ3B 1KVLA 1AXBA 5BOHA 4UAAA 1XKZA 3UTAC 4DKIA 5AV9D 2FJ7D 3NCKA 2Q9MA 4JPMA 2EX6A 1TZYC 1ZLAA 1ESUA 3AZND 4ID4A 3IXHA 1E4DA 3VFHA 3UT9B 1FCOA 1G6AA 3AZHD 1AOIA 4F94A 3RELA 4MBFA 5AV6D 3GR2A 1ID3D 3MVDC 1ZKJA 5AV5C 3NI9A 4BL2A 1P3OA 1H8YA 4RYEA 3X1UA 1S6RA 4MBHA 1TVFA 1FCNA 4Z66C 4KG6A 4JKTA 1TZYA 1ZLAC 2PBYA 1W5DA 3AV2D 3LO7A 2J8PA 5F99B 3REHA 4S2NA 3REIA 2ZY3A 4UPKA 4DDYA 3MZDA 3X1VC 1TZYB 1SCWA 4J8UD 3B6GA 3WTPC 2JSSA 4IBJA 1LI9A 2YFVA 4JLFA 4OP8A 5AQ7A 5FQIA 3ITAA 4N1XA 5F1FA 5B24D 1P3BC 1JFIB 5F99A 3AV2C 1IELA 3W99B 2QPNA 5GT3C 3CG5A 1PI4A 1BUEA 3AGDA 4J8VD 4GH9A 2XFSA 3E2KA 5B2JA 4ZDXA 5AV5A 2W8SA 1N9BA 4NZ5A 4DF6A 1CK3A 3N8RA 3AZKC 1P34D 4KUDA 3AZFB 5GXQA 3AZFD 4DRAA 1BFMA 4WU8A 3G31A 3UY6A 1ONGA 5CPJD 4KQRA 1TDLA 2CWEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M6H A;  1PZP A;  3QNB A;  5HX9 A;  4WZ5 A;  1IYS A;  1GHI A;  3GMW A;  3Q7Z A;  3UNW A;  5GHZ A;  4IVK A;  2ZLY A;  4BD1 A;  1CI9 A;  2Y2Q A;  3Q07 A;  1ERQ A;  1FOF A;  4N1H A;  4FSF A;  2Q9N A;  2J9O A;  4YFM A;  3M2J A;  4MBK A;  1JWZ A;  1BZA A;  2G2U A;  2ZMA A;  3LY3 A;  4JF6 A;  3GSG A;  1XXM A;  4B4Z A;  4OLG A;  1YM1 A;  1YLZ A;  3VP1 A;  5GHX A;  4S2O A;  1KE4 A;  2Y2J A;  1W8Y A;  1PZO A;  2WZZ A;  2H5S A;  3CZD A;  2ZJ9 A;  4B4X A;  1K56 A;  1PIO A;  1HVB A;  2RL3 A;  3OZH A;  5TR7 A;  1RGY A;  3HLC A;  3OCL A;  3QNC A;  2C6W B;  4WYY A;  3IF6 B;  4C6Y A;  4QY6 A;  2XLN A;  5EVI D;  2EXB A;  3E2L A;  3N6I A;  1ZG4 A;  4UA9 A;  2IWB A;  3V39 A;  5FAT A;  4DE3 A;  1LL9 A;  3MXS A;  3HLB A;  4GB7 A;  4OQ0 A;  3ZGA B;  4U3T A;  3ZFZ A;  4GOG A;  3O3V A;  1GHM A;  4JF5 A;  1XX2 A;  2Y2K A;  4RX2 A;  1RP5 A;  4MLL A;  1Z6F A;  1L2S A;  1ES2 A;  5M19 A;  3HUM A;  1PYY A;  4R4S A;  4C3Q A;  1BSG A;  3DW0 A;  3W8K A;  2WAF A;  4DE2 A;  4U0X A;  1IYQ A;  4ZJ3 A;  1BUL A;  1DJA A;  2C5W B;  1XGJ A;  5CHJ A;  1K56 D;  1NJ4 A;  1U60 A;  3IHA A;  5GLB A;  1KDW A;  2H0Y A;  5FI6 A;  3HLG A;  1IKI A;  1SDN A;  3OPH A;  4GDB A;  5EVI A;  3BLS A;  1VM1 A;  2XEP A;  3Q7V B;  4XUZ A;  3GQZ A;  5DTK A;  1HD8 A;  5E2H A;  5U47 A;  1VQQ A;  3ZVT A;  2XGN A;  1ESI A;  4FD8 A;  3G30 A;  1K54 A;  5KSH A;  2A3U A;  3FV7 A;  5CEC A;  4IVI A;  3QHY A;  1CI8 A;  3UE0 A;  3C5A A;  2WK0 A;  1BT5 A;  2XQZ A;  4H8R A;  4XUX A;  3B3X A;  3IWQ A;  4PM8 A;  5CTM A;  5FQQ A;  5A93 A;  1IYP A;  1MPL A;  4LCL A;  3RXW A;  5M18 A;  4GNU A;  4FH4 A;  3ZHH A;  4LEN A;  4OON A;  4UA7 A;  2BLS A;  4E3I A;  1K54 C;  2P9V B;  1MWR A;  5G18 A;  3BYD A;  1KE0 A;  5EVI C;  5CRF A;  4C75 A;  2X02 A;  1KDS A;  3OCN A;  3HLF A;  2X01 A;  4IED A;  5HW3 A;  4JF4 A;  1CEG A;  5EPH A;  1ZG6 A;  2WGV A;  3N4I A;  4U0T A;  4WM9 A;  1O07 A;  3NC8 A;  1PWC A;  3PBN A;  4OOY A;  1E3U A;  2PU2 A;  5D3O A;  3OPP A;  4OPY A;  4WZ5 C;  2XK1 A;  5DVA A;  2FFF B;  5F82 A;  1ERO A;  3CJM A;  3NIA A;  4KG2 A;  4OOM A;  3IXG A;  2ZC3 B;  3HL9 A;  2R9W A;  3BEC A;  5KZH A;  4HEF A;  1L0D A;  1FCM A;  3G32 A;  5GLD A;  2Y2M A;  1BTL A;  3GVB A;  3NBL A;  2EXA A;  3EQV A;  1BLH A;  1KGF A;  4N9L A;  4X53 A;  4EWF A;  4WEJ A;  1MWT A;  4BQM A;  3SH9 A;  3UDF A;  5KMW A;  5CHM A;  1K6R A;  3OPR A;  4KZ4 A;  1IYO A;  1JVJ A;  1YMS A;  3G34 A;  4KQO A;  5CER A;  1NXY A;  3A3F A;  4PM6 A;  3ZG7 B;  1QMF A;  5EE8 A;  3C7V A;  3G2Y A;  4R23 A;  3VP4 A;  3UE1 A;  2Z2L B;  3UPN A;  2ZC5 B;  4BJP A;  4R4R A;  3PBS A;  5FI2 A;  3PBQ A;  2Y2O A;  1MKI A;  5J8X A;  3ZCZ A;  3DWK A;  2V20 A;  4EV4 A;  3AGE A;  3MKF A;  2Y2H A;  4HES A;  5DTT A;  3VP2 A;  3BFE A;  3HVF A;  1JTG A;  2XD5 A;  3IWO A;  2WGW A;  2XD1 A;  4KQQ A;  4S2M A;  3SS3 A;  1ES3 A;  5CGX A;  2IWC A;  4KZ7 A;  5JYP A;  3N8S A;  2HP5 A;  3M6B A;  3IHB A;  3UPP A;  3PBO A;  1GCE A;  2OSU A;  2IWD A;  4X55 A;  5F83 A;  2ZM8 A;  1Q2P A;  5FQK A;  1K4E A;  4X56 A;  3A3I A;  4BL3 A;  4KZB A;  2PU4 A;  3I7J A;  4O7D A;  2EFU A;  3TSG A;  5EOO A;  4E3J A;  1FR1 A;  5GLC A;  3UE3 A;  4ZJ2 A;  3WS2 A;  4OLD A;  1YLJ A;  2H10 A;  3G4P A;  3ZG0 A;  1I2S A;  2ZQD A;  4WZ4 A;  4DDS A;  3WRT A;  5EUA A;  2WAE A;  3Q81 A;  1W7F A;  2ZQC A;  1PW8 A;  2EX9 A;  3HUO A;  4ZBE A;  5TFQ A;  4BEN A;  1Q2Q A;  3MZF A;  3VSL A;  3IH9 A;  3UDI A;  3IF6 C;  5AQB A;  3UO9 A;  4DRT A;  5A92 A;  5HAP A;  1GA9 A;  1PI5 A;  3OPL A;  4E3O A;  3V50 A;  5IHV A;  1YLY A;  2A49 A;  1NZO A;  4OQI A;  5M1A A;  3IT9 A;  5E2F A;  1WYC A;  1YQS A;  4M3K A;  3PAE A;  1IKG A;  1XGI A;  2XFT A;  3VMA A;  4S2K A;  3W4P A;  4WEL A;  3LEZ A;  2ZQ7 A;  3IXB A;  2ZC6 B;  3G35 A;  3WS0 A;  1O7E A;  1W8Q A;  4KG5 A;  4ZAM A;  2WYX A;  4Y0U A;  5EVI B;  2HDS A;  4E3L A;  5DF9 A;  4BLM A;  1SKF A;  4NK3 A;  2V2F F;  4KEN B;  1L0G A;  3WRZ A;  2JCH A;  1E3U D;  5E2E A;  4P6B A;  3TOI A;  3BFC A;  3ZG9 B;  4X6T A;  2HP6 A;  3SOI A;  2WKH A;  3GTC A;  3Q1F A;  4N9K A;  5CED A;  5KSC A;  3EQU A;  4PM7 A;  1W79 A;  1EWZ A;  2FFY A;  2Y59 A;  2XF3 A;  5TGF A;  1JWV A;  2EFX A;  4ZTK A;  5DF7 A;  3VOY A;  4E6X A;  5FSR A;  3VFF A;  1HTZ A;  4WMC D;  5FA7 A;  1FSW A;  1FR6 A;  5FQ9 A;  3GRJ A;  2EX8 A;  5FAP A;  4E6W A;  3D4F A;  3MFD A;  5E43 A;  4NET A;  1EI5 A;  3W4Q A;  1E25 A;  1K55 C;  1RCJ A;  1I2W A;  1KE3 A;  1JTD A;  3DWZ A;  3GV9 A;  2XH9 A;  3SS4 A;  2G2W A;  2HDR A;  3FKV A;  4MNR A;  1SHV A;  1DJC A;  2Y2L A;  1PW1 A;  4Y7P A;  3IF5 A;  5HL1 A;  3Q7V A;  4KZ6 A;  2Y2P A;  1MWS A;  2HDU A;  4YIN A;  3UDX A;  4EQI A;  3IWI A;  2WUQ A;  1I5Q A;  1H5X A;  2J7V A;  4RA7 A;  3M2K A;  4EBP A;  5GL9 A;  2OLU A;  3NDG A;  4GD8 A;  1K4F A;  3W4O A;  2Y2I A;  4OQH A;  4UHU A;  5FDH A;  3NY4 A;  4OPQ A;  4KZ8 A;  1M6K A;  3DTM A;  4PM5 A;  4WMC A;  4WBG A;  4K0W A;  3P09 A;  2OLV A;  4JBF A;  4LV0 A;  5FAQ A;  3UN7 A;  1Y54 A;  3HUN A;  4E3N A;  5FI7 A;  4KZA A;  1QME A;  1BLP A;  1LLB A;  1LL5 A;  1ALQ A;  4A5R A;  3ZNT A;  1PWD A;  4CJN A;  4S2P A;  1YMX A;  4B88 A;  3ISG A;  2EX2 A;  3CMZ A;  3UPO A;  4LCM A;  5CGS A;  5A91 A;  1MXO A;  3C4P A;  4HBT A;  5HAR A;  4EBL A;  1DY6 A;  3ITB A;  1FSY A;  4GKU A;  1OME A;  1K57 C;  1KVM A;  4RX3 A;  3JYI A;  2OV5 A;  3VP3 A;  2WZX A;  1MWU A;  1WE4 A;  4DE0 A;  4Z9Q A;  4EUZ A;  3WS1 A;  2Y4A A;  2V1Z A;  4P0M A;  2JBF A;  1ERM A;  1ES4 A;  1XA1 A;  4RVA A;  1N4O A;  4QD4 A;  5FQM A;  3WWX A;  3VSK A;  1YT4 A;  2VGJ A;  3MBZ A;  4N92 A;  5L2F A;  2WKI A;  4KZ5 A;  3HLE A;  1L0E A;  1XP4 A;  5AQ9 A;  1FQG A;  5GHY A;  2GDN A;  2ZM2 A;  4FH2 A;  3V3S A;  1G68 A;  4QHC A;  2WAD A;  3Q82 A;  5FAO A;  2HPB A;  3BEB A;  4DE1 A;  4QU3 A;  3N8L A;  5CEB A;  2JC7 A;  5CXW A;  1KVL A;  2Y91 A;  1AXB A;  3IH8 A;  5DTS A;  5BOH A;  4UAA A;  1K38 A;  3PAG A;  1XKZ A;  3PBR A;  4DKI A;  4PMA A;  5CTN A;  4XXR A;  1K55 A;  3NCK A;  3LCE A;  2Q9M A;  4JPM A;  3MZE A;  3ZDJ A;  2H0T A;  3FZC A;  2BG1 A;  4P85 A;  2EX6 A;  1ESU A;  4ID4 A;  3MXR A;  1BLS A;  3IXH A;  1E4D A;  1C3B A;  3VFH A;  2JE5 A;  2ZQ9 A;  1FCO A;  3WS4 A;  1G6A A;  1MY8 A;  3PBT A;  3A3E A;  5HAQ A;  1KGE A;  4IBX A;  4E3M A;  3SS5 A;  1NRF A;  3BRM A;  2P74 A;  4F94 A;  1MBL A;  3N7W A;  4BD0 A;  4MBF A;  4OVD A;  2UWX A;  3NDE A;  1SDE A;  3GR2 A;  4GN2 A;  3TG9 A;  4EBN A;  4R3J A;  1ZKJ A;  2X71 A;  4JXW A;  2WKE A;  3AGF A;  1JWP A;  3NI9 A;  1L0F A;  1H8Z A;  4BL2 A;  4Q8I A;  4PPR A;  1LI0 A;  3ZG8 B;  5CGW A;  2ZM0 A;  3G2Z A;  2Y55 A;  1CEF A;  5EVL A;  1H8Y A;  4RYE A;  4X69 A;  3SH7 A;  2J8Y A;  1S6R A;  4MBH A;  4E3K A;  3HRE A;  1TVF A;  4OQG A;  1FCN A;  4PM9 A;  4S2I A;  4KG6 A;  5FQJ A;  4QY5 A;  1LHY A;  5F1G A;  4JKT A;  3FWL A;  5I94 A;  1RGZ A;  2PBY A;  3FKW A;  4JXG A;  1W5D A;  1ES5 A;  1XPB A;  4S2L A;  3LO7 A;  4JXS A;  3RXX A;  2I72 A;  4D2O A;  1ZC2 A;  1NYM A;  2ZC4 B;  3HLD A;  4OKP A;  4R3B A;  4L0L A;  1WYB A;  4UA6 A;  4OH0 A;  4S2N A;  4K0X A;  3V5M A;  4GD6 A;  1YLT A;  1BLC A;  5EEC A;  4QJG A;  2DCF A;  2ZD8 A;  2ZQ8 A;  1XA7 A;  2QMI A;  3IF6 A;  3V3R A;  4DDY A;  3MZD A;  4MEZ A;  2VGK A;  3O88 A;  2ZQA A;  2R9X A;  3OC2 A;  1KGG A;  1ONH A;  1SCW A;  2DRW A;  3C4O A;  4OOL A;  1GHP A;  4S2N C;  2Y2G A;  1IEM A;  1NYY A;  2RCX A;  3O87 A;  2WGW B;  2ZC7 A;  4X68 A;  1LI9 A;  4WEK A;  3VOZ A;  4OPR A;  1DJB A;  4JLF A;  4OP8 A;  5E2G A;  5AQ7 A;  4QB8 A;  5FQI A;  2DNS A;  1K57 A;  3ZNY A;  3ITA A;  4N1X A;  5F1F A;  4Y0O A;  3S4X A;  2J9P A;  4GDN A;  3A3J A;  5GLA A;  4ZJ1 A;  1K6S A;  3IXD A;  1IEL A;  1S0W A;  4OPZ A;  2Y2N A;  2QPN A;  4KZ3 A;  4DXC A;  4Y0T A;  1J9M A;  1TDG A;  3CG5 A;  1PI4 A;  1BUE A;  3AGD A;  1M40 A;  4CPK A;  2XR0 A;  5DF8 A;  3BFF A;  4LV2 A;  3S22 A;  1NY0 A;  3BM6 A;  4R0Q A;  3HLW A;  5AQA A;  1HZO A;  4KZ9 A;  1PWG A;  5EOE A;  2XFS A;  3BFD A;  3E2K A;  4JXV A;  4ZDX A;  3VP0 A;  1YLW A;  4IBR A;  4LV3 A;  3IQA A;  1N9B A;  5CHU A;  1NZU A;  2B5R A;  2XDM A;  3SH8 A;  4DF6 A;  4DXB A;  4HBU A;  1CK3 A;  3PTE A;  3WS5 A;  1K25 A;  3BLM A;  2P9V A;  3N8R A;  4R1G A;  3ZVW A;  3S1Y A;  5FAS A;  3LY4 A;  5HAI A;  2WGI A;  4LV1 A;  4S2J A;  3FYZ A;  4P87 A;  3BFG A;  3ZG5 A;  4OP5 A;  5JYO A;  2HP9 A;  2QZ6 A;  3A3D A;  4K91 A;  4FCF A;  3HBR A;  3P98 A;  2E8I A;  2CC1 A;  3MKE A;  5HFO A;  1TEM A;  3O86 A;  3G31 A;  3UY6 A;  2HDQ A;  1YLP A;  5A90 A;  1ONG A;  2Z2M B;  4GZB A;  3C7U A;  3RJU A;  4KQR A;  1TDL A;  1GA0 A; 
#chains in the Genus database with same CATH topology
 3UTA B;  4Q0H A;  1P3I D;  1IYS A;  3GMW A;  3Q7Z A;  4Z1W A;  4IVK A;  2ZLY A;  4BD1 A;  3REK A;  1CI9 A;  1EAK A;  3P5J B;  3UTB D;  1HQ3 A;  2BYM B;  1H3O A;  3REL D;  5AY8 B;  1VB6 A;  3AZF A;  5AVC B;  1M18 A;  5I5L A;  3VH6 W;  4E44 A;  4ME4 A;  1XJ4 A;  4L9F A;  2F8N G;  5KIZ A;  1P3P B;  4AWL C;  4S2O A;  3CZD A;  2ZJ9 A;  4B4X A;  1HVB A;  4AFI A;  3R7W B;  2ZY5 A;  1XFQ A;  2EXB A;  4UA9 A;  2IO5 B;  3O62 D;  3LZ0 A;  3MF0 A;  3ZGA B;  4U3T A;  1GHM A;  2EA9 A;  3AZK B;  4IBF A;  4FUW A;  5BT1 D;  4J8W D;  3LI9 A;  3AZJ D;  1Z6F A;  3MR0 A;  3LJA A;  2J3T D;  2WAF A;  1IYQ A;  1DJA A;  1XGJ A;  5CHJ A;  4X23 C;  1K56 D;  1P3O D;  1U60 A;  4YS3 B;  3IHA A;  5KDM A;  1SDN A;  5EVI A;  3MGP C;  3LYX A;  3X1U B;  2XEP A;  3AZL D;  4XUZ A;  3GQZ A;  3B0D C;  2O9A A;  3X1T A;  4Z2J A;  1G6O A;  1BH9 B;  4MMN A;  3TU4 D;  3KSF A;  3IS2 A;  4XZQ B;  2D49 A;  4PM8 A;  5M18 A;  3W97 B;  2PD8 A;  5E5A B;  4GLQ A;  1SZV A;  3FPV A;  4LEN A;  1ZHH B;  4JJN B;  1MWR A;  3B0C T;  3KX0 X;  1T3U A;  3LZ1 B;  3AV1 B;  2VKS A;  5GSU C;  1P3P C;  1D06 A;  1ZG6 A;  4IBD A;  2WGV A;  1MZU A;  3PBN A;  4WU8 C;  4IBK A;  4H9N A;  4WU9 C;  4OPY A;  5DVA A;  3MGS C;  4WZ5 C;  3MGR D;  3NOU C;  4KG2 A;  3N3F A;  4JGO A;  4CLC C;  2Y2M A;  3GEC A;  4QLC B;  1P3I A;  3M7P A;  2EXA A;  1VHM A;  3REK D;  1D7E A;  5DNM C;  2V9A A;  4BQM A;  3AN2 D;  1W1T A;  3HON A;  3TJZ C;  3FDD A;  1H3O B;  1JVJ A;  4KUK A;  4KQO A;  4HMC A;  2VV7 A;  3AYW D;  4PM6 A;  1P3A B;  1DP9 A;  1QMF A;  3ZG7 B;  3KS4 A;  3G2Y A;  3X1V B;  3UE1 A;  2Z2L B;  3W98 A;  4BJP A;  2HV1 A;  3PBQ A;  3VE4 A;  1MKI A;  3ZCZ A;  1BYW A;  3T12 B;  5B1L D;  1P3K A;  2Y2H A;  5B2J B;  3WA9 C;  3BFE A;  3HVF A;  1JTG A;  2ARO A;  2XD5 A;  2WGW A;  2F2A C;  3KYE A;  4KZ7 A;  3N8S A;  5JYP A;  2NQB D;  1CXW A;  4Z2K A;  3IHB A;  1N9L A;  3LGO A;  3MNN B;  5GXQ B;  5F83 A;  2ZM8 A;  4PKY A;  1YU3 A;  3I7J A;  3VH5 W;  3TSG A;  5CPI C;  5GLC A;  4GHA A;  2E8J A;  4OLD A;  3LR5 A;  3DBA A;  3ZG0 A;  4H9Q A;  4WZ4 A;  5CP6 D;  3MQO A;  3W2Z A;  3Q81 A;  1WWS A;  1PW8 A;  3HUO A;  4BEN A;  3KUY B;  3VSL A;  3D72 A;  1KOU A;  5HAP A;  1P3O C;  2BYK B;  1PI5 A;  3V50 A;  4OQI A;  2HIO D;  5A8B A;  4M3K A;  3PAE A;  4S2K A;  3LIC A;  2A24 B;  2CMN A;  4ARZ A;  4KG5 A;  4Y0U A;  1R4V A;  2HDS A;  1E6P A;  2L5A A;  4OJP A;  1SKF A;  2V2F F;  1L0G A;  3H0L C;  2VX8 A;  3WAA B;  4XT2 B;  3ZG9 B;  5BO0 A;  4X6T A;  1S4S A;  3LJA B;  4N9K A;  5KSC A;  2QWS A;  4EV4 A;  5TGF A;  2XF3 A;  3DTE A;  4XUJ A;  1YU2 A;  4R70 A;  1D1J A;  2WKQ A;  3GRJ A;  2VZW A;  5FAP A;  5L09 A;  1P3K C;  3BWL A;  1Q9C A;  1TS7 A;  3CI6 A;  3DWZ A;  3GV9 A;  2XH9 A;  1P3M C;  4Y7P A;  2VGL M;  4X1L A;  3PHY A;  4GJ4 A;  5AV5 D;  4RA7 A;  5F99 C;  3AV2 A;  4HH3 A;  3L7H A;  4UHU A;  5FDH A;  3K3D A;  3NY4 A;  3L26 A;  3DTM A;  2PYR A;  4WBG A;  4K0W A;  3P09 A;  5AVE A;  5FAQ A;  4E3N A;  3EEA A;  5DNN C;  4KZA A;  4Y15 A;  1VEU A;  4X23 B;  4KGC D;  4IBI A;  4IBB A;  3LEL B;  3ICY A;  3UPO A;  4LPZ A;  3CMZ A;  5B0Z A;  4WU8 D;  4UQI S;  5B32 C;  4LRX C;  5A91 A;  1MXO A;  4HJ6 A;  3F1P A;  4WF0 A;  1WE4 A;  2F8N D;  2F8N H;  5FQM A;  3LJA C;  1N4O A;  3VSK A;  2W0N A;  1UWP X;  4KQD A;  3AZN A;  1GPF A;  1FQG A;  4OJO A;  4FH2 A;  1KX5 B;  4B9O A;  1KX4 A;  4J8X D;  1P34 A;  4HJ3 A;  5DJU A;  1P3L A;  3REI C;  4EEP A;  3LZ1 C;  5CXW A;  4WL9 A;  1PFL A;  5GSU B;  5DTS A;  1K38 A;  3JPU A;  5AY8 C;  3IX4 A;  2BG1 A;  3L27 A;  1S1Z A;  2FJ7 B;  2V0W A;  3K2N A;  3B6G B;  3WS4 A;  5EVE A;  3KWQ A;  4HJ4 A;  4E3M A;  2GNX A;  2P74 A;  1P34 B;  3N7W A;  1P3P A;  3NDE A;  4J8W B;  4JXW A;  1Y4O A;  1JWP A;  1L0F A;  1ID3 B;  5EVL A;  2F8N K;  1EQZ B;  4E3K A;  4BBT A;  3R7W A;  3BY9 A;  2VLG A;  3KWQ D;  3AZM C;  1CK7 A;  1T18 A;  2HGV A;  5I94 A;  4YM6 B;  4WU9 A;  3T4Q A;  1ES5 A;  4S2L A;  4Z2H A;  3X1U C;  5AVB B;  1GSW A;  1AIW A;  2W1T A;  4LRY C;  2LB9 A;  1ZC2 A;  5AY8 D;  1F98 A;  4H9P B;  3HLD A;  4OKP A;  4R3B A;  1M1A C;  3MQQ A;  3T1R A;  4OH0 A;  3V5M A;  3AZE B;  2VV8 A;  4GD6 A;  4QJG A;  2YFW A;  4HGA B;  1P3A A;  1CJF A;  3C1C D;  1KGG A;  4H9R A;  2DRW A;  1P3L C;  3C4O A;  1TZY D;  5B33 D;  4EEU A;  5B33 C;  1TS6 A;  4S2N C;  5J4E A;  1IEM A;  1NYY A;  3O87 A;  1SKO A;  2WGW B;  2ZC7 A;  2ZL1 B;  4WEK A;  3VOZ A;  1NWZ A;  4OPR A;  2FJ7 C;  1DJB A;  3E4P A;  5E2G A;  5AY8 A;  1K57 A;  4Y0O A;  4ZJ1 A;  3CHW P;  1K6S A;  3IXD A;  4UQI M;  4OPZ A;  1S0W A;  3H0R C;  2Y2N A;  4KZ3 A;  1TDG A;  3X1S C;  1T1C A;  3KYQ A;  4H9N B;  4NE3 A;  4MN5 A;  2XR0 A;  2Z6D A;  3S22 A;  1NY0 A;  5B0Y D;  1E6N A;  4R0Q A;  3JVU A;  3TU4 C;  5AV8 D;  4KZ9 A;  2F8N A;  4JXV A;  1S67 L;  4H9O A;  5TBM A;  4LV3 A;  3A0V A;  3SH8 A;  2ZMV A;  4WJ3 C;  3W97 C;  4HBU A;  4YM6 C;  1W63 M;  3PTE A;  1U35 D;  3WS5 A;  4KHA B;  1YU1 A;  3WX7 A;  1IFQ A;  4PAU A;  4R1G A;  5GT0 D;  1MC0 A;  2WGI A;  5AJG A;  5B2J C;  3MQ0 A;  2XA7 S;  3BFG A;  3UT9 C;  5JYO A;  1P3G C;  3EGX C;  3X1S A;  3AYW A;  2HJE A;  3MVD B;  3AZJ C;  3MNN D;  2E8I A;  3MKE A;  1TEM A;  5AV9 A;  1M19 B;  4J8U B;  2W3D A;  3X1T B;  3T4S A;  3WAA A;  2Z2M B;  4CLC B;  4Z2M H;  3RJU A;  4MCW A;  1M19 D;  4CPK A;  3AZG B;  4XUJ C;  3L2A A;  3M6H A;  2ZY4 A;  1HQ3 C;  3LZ0 D;  1FOF A;  4FSF A;  4YM6 A;  1P3A C;  1UR8 A;  1JWZ A;  1BZA A;  2ZMA A;  4JF6 A;  2OAP 1;  4B4Z A;  5K5B A;  4BBV A;  5EM0 A;  3REL B;  5GHX A;  3AYW B;  3LR0 A;  3RH8 B;  4HHD A;  3W98 D;  1KE4 A;  1NRJ A;  3F1O A;  1HTA A;  3H7W A;  1PZO A;  2H5S A;  1K56 A;  1S32 D;  2RL3 A;  1F9I A;  2ACG A;  3OZH A;  5TR7 A;  1YAX A;  4JGR A;  3MQL A;  5AV9 B;  1M19 A;  2K2N A;  3LZ0 C;  3IF6 B;  1ED7 A;  3E2L A;  1T19 A;  1ZG4 A;  3N6I A;  5FAT A;  4DJ2 A;  5B33 A;  4GB7 A;  3ZFZ A;  3KUY A;  3OLO A;  5B2I B;  1XX2 A;  2Y2K A;  3EOI A;  3IP4 C;  1RP5 A;  2GX5 A;  2NZD A;  5M19 A;  1L2S A;  2HZ5 A;  2V0U A;  1PYY A;  3EEH A;  4R4S A;  4C3Q A;  1OPX A;  5B1L C;  1P3G D;  3HSH A;  3KXB D;  1P3B B;  5GLB A;  2H0Y A;  3W99 C;  5JA4 A;  4DJ3 A;  4GDB A;  4WNN A;  1P3K B;  4Z5T B;  3KXB B;  3Q7V B;  5B0Y A;  2V8C A;  1Y28 A;  3B6G C;  3EGD C;  3QP1 A;  2XGN A;  1ESI A;  4OUI A;  3G30 A;  3WD0 A;  1K54 A;  5KSH A;  3FV7 A;  3NQU A;  3QHY A;  1CI8 A;  2WK0 A;  1BT5 A;  3WD2 A;  1OTD A;  5FQQ A;  5A93 A;  3W97 A;  1P3L B;  4LCL A;  3RXW A;  2NUP C;  4GNU A;  4OON A;  1KX4 B;  4UA7 A;  5G18 A;  3RTY A;  3MGR C;  5CRF A;  4C75 A;  1KDS A;  3OCN A;  2D01 A;  3A1K A;  3WKJ D;  3QP2 A;  5EPH A;  1TF1 A;  1TAF A;  3NC8 A;  3C1C A;  3LUQ A;  3OPP A;  3AV1 D;  5F82 A;  5AVF A;  4WV4 B;  4ZUX A;  3NIA A;  3E98 A;  5GT3 B;  1FCM A;  3G32 A;  3CUE C;  1BTL A;  5DNM A;  3NBL A;  3MGS D;  5B31 C;  1F66 A;  5HWV A;  5MC7 A;  2M1C A;  4X53 A;  4N9L A;  1KGF A;  4EWF A;  4UEY A;  4WEJ A;  1MWT A;  5B32 G;  1P3F D;  3SH9 A;  2FN2 A;  1OGB A;  1S66 L;  5JRG C;  3D3O A;  5CHM A;  5KMW A;  4ARZ B;  4KZ4 A;  1IYO A;  3H7W B;  5CER A;  3FPW A;  3E0Y A;  3HCY A;  5EE8 A;  5B1M C;  3VP4 A;  3T4K A;  3UB7 A;  2K31 A;  3PBS A;  5AV8 A;  3WD3 A;  5J8X A;  1X0O A;  4Z66 B;  4HES A;  5HPI A;  3IWO A;  4GS9 B;  1BH9 A;  1AOI B;  2IWC A;  3LR3 A;  2BYM A;  3M6B A;  4KGC A;  3UPP A;  4X23 D;  5BNV B;  4NFT A;  4EER A;  5AV6 C;  1Q2P A;  2AVX A;  5FQK A;  4KZB A;  1IOU A;  5HSQ A;  2EFU A;  2B02 A;  5EOO A;  3EPJ A;  1P0Z A;  5BT1 C;  4J8W C;  1FR1 A;  3UE3 A;  5B31 D;  3AL0 C;  4NXG A;  3WS2 A;  5CPJ A;  2ZOH A;  3MMH A;  2D02 A;  2HUE B;  2O9C A;  1I2S A;  5EUA A;  2WAE A;  1W7F A;  2W1R A;  5TFQ A;  3MZF A;  4IJG A;  2EWW A;  4DRT A;  3LZ0 B;  3IF6 C;  3UO9 A;  5A92 A;  2W27 A;  1GA9 A;  5JRG B;  4EQ1 A;  4E3O A;  2PBD P;  5IHV A;  1YLY A;  2A49 A;  5M1A A;  3UE6 A;  1KX3 A;  3SZT A;  3VMA A;  3K3C A;  4WEL A;  3CPT B;  3LEZ A;  3B0B A;  1E88 A;  3REI D;  3D9Y A;  3WS0 A;  4ZAM A;  2WYX A;  5B1M D;  5EVI B;  2P7J A;  2Q0O A;  4X1M A;  1HLU P;  1M1A B;  2QJ7 A;  5DF9 A;  4NK3 A;  3UTA A;  5B1L B;  4KEN B;  2ZM5 A;  1M18 C;  5E2E A;  1GSV A;  3TOI A;  2V1A A;  5LBR A;  1L6J A;  4WU9 D;  3TU4 A;  3AZK D;  1P34 C;  3A0R A;  4G91 B;  2VEA A;  3U2A A;  4PM7 A;  1EWZ A;  2Y59 A;  3EWK A;  2HIO A;  4ZTK A;  3R4K A;  3LJA D;  5FA7 A;  1FSW A;  1FR6 A;  3CAX A;  2CV5 C;  2EX8 A;  3AFA A;  3AZF C;  4E6W A;  3D4F A;  5E43 A;  1KX3 C;  3W4Q A;  1E25 A;  1P3M A;  1EQZ C;  2EWV A;  5GSU A;  3FKV A;  1SHV A;  3BW6 A;  1DJC A;  3HJK A;  1PW1 A;  4L9G A;  4ETX A;  4KZ6 A;  3AV1 A;  3AZM B;  2HDU A;  2OOL A;  3UDX A;  3LFV A;  3LEL C;  3VH6 T;  3AV2 B;  4O01 A;  1I5Q A;  1H5X A;  2J7V A;  4EBP A;  1F1E A;  5GL9 A;  4L9E A;  4I3J A;  4GD8 A;  1K4F A;  2Y2I A;  1VET A;  4QLC A;  4PHT A;  4OPQ A;  2G5H C;  4KUO A;  4R8P D;  3UN7 A;  1E6Z A;  5F99 D;  1YU0 A;  1Y54 A;  1P3M B;  3WA9 B;  2Y8H A;  4LD9 C;  1BLP A;  1LLB A;  4O0P A;  4PKY G;  1ALQ A;  1GSX A;  4CJN A;  4JJN D;  1YMX A;  2FZ0 A;  3ISG A;  2BTF P;  4LCM A;  3EG5 B;  1LT0 A;  5CGS A;  4J8V A;  3KXB C;  3VP3 A;  3WAA D;  1MWU A;  3AZI D;  3MS6 A;  4ZUX D;  2V1Z A;  5DNM B;  2Y4A A;  4P0M A;  1ERM A;  1XA1 A;  2XA7 M;  3WWX A;  4K08 A;  5GT3 A;  1YT4 A;  3MBZ A;  1M19 C;  1L0E A;  5AQ9 A;  5B24 A;  5GHY A;  2GDN A;  4IUK A;  3V3S A;  1G68 A;  5BNX B;  1GXD A;  4QHC A;  1Z09 A;  4OJ5 A;  3X1S B;  3BEB A;  2NQB A;  4J8X B;  1STZ A;  4QU3 A;  3V9R A;  3N8L A;  5J7E A;  1P9W A;  5IT5 A;  1P3F B;  4LD9 A;  2Y91 A;  4BBU A;  3T4L A;  2J3W A;  3PAG A;  5GT0 C;  4J8V B;  3AZE A;  5CTN A;  5CPI A;  1K55 A;  3R45 A;  4XXR A;  4DQY B;  3EPK A;  4WLA A;  3MZE A;  3ZDJ A;  3FZC A;  3E4O A;  3C1B D;  1ID3 C;  2JKG A;  2JE5 A;  2ZQ9 A;  4Z66 A;  1MY8 A;  2A2L A;  5HAQ A;  2JKR I;  4KUD D;  1KGE A;  3SS5 A;  1NRF A;  3BRM A;  4M6B A;  1MBL A;  4BD0 A;  3KSY A;  1SDE A;  4EBN A;  3TG9 A;  4R3J A;  3NQJ B;  1KX3 D;  3AZJ B;  2X71 A;  2WKE A;  2W3H A;  1H8Z A;  1LI0 A;  3A6N B;  2ZM0 A;  3G2Z A;  5CPI D;  1CEF A;  2Y55 A;  4Q0J A;  4II7 A;  3H0M C;  3SH7 A;  2J8Y A;  3KUY C;  2JHE A;  3HRE A;  3UTA D;  4MB4 A;  1AWI A;  5B31 A;  1F66 C;  3F1P B;  4PM9 A;  4S2I A;  2VQR A;  3O62 A;  1LHY A;  5F1G A;  2DQN C;  3FWL A;  4P6Z M;  4JXG A;  3WTP E;  4TX8 A;  4YM6 D;  1Z2C B;  2DF4 C;  4JXS A;  4BWI A;  4Z5T C;  5AVC A;  2ARO B;  1M18 B;  4QLC C;  1JFI A;  4L0L A;  3AYW C;  1WYB A;  4K0X A;  5JA4 B;  3P01 A;  5B0Y C;  1K0K A;  1YLT A;  1YPR A;  2ZQ8 A;  4IJE A;  4JJN A;  4NYY A;  3V3R A;  3B33 A;  4MEZ A;  2VGK A;  2ZQA A;  2R9X A;  3OC2 A;  3IX8 A;  1ONH A;  1YSP A;  2JKT I;  1OTA A;  2L4R A;  3MGR B;  3O62 B;  1GHP A;  2Y2G A;  4X68 A;  4IBE A;  3AZG A;  3B6F D;  1ODV A;  4QLC D;  4QB8 A;  3AZE C;  3ZNY A;  1N1J A;  5J3W A;  3S4X A;  5CPK B;  3A3J A;  3PYP A;  2OAQ 1;  5HZH A;  4DXC A;  5BNX A;  4Y0T A;  5C5K A;  1J9M A;  4M4X A;  3X1V A;  4WUJ A;  1KX5 C;  5B0Z B;  1M40 A;  4YS3 D;  4HIA A;  5DF8 A;  1LSV A;  3BFF A;  1O6I A;  5GSU D;  2KDK A;  1HZO A;  4NXB A;  2PD7 A;  4EO5 B;  2WKR A;  1F66 B;  4IBR A;  3IQA A;  2NZD C;  1NZU A;  2B5R A;  2XDM A;  3UB6 A;  4MN7 A;  4DXB A;  1PZR A;  5DJT A;  2YFV B;  1E8B A;  2P9V A;  3KFU G;  3S1Y A;  3LY4 A;  5FL3 A;  4LV1 A;  3CUE A;  4MN6 A;  5CHL B;  1EW0 A;  1H3Q A;  3C1B C;  2QZ6 A;  3OBF A;  3RFB A;  1XJ3 A;  3HBR A;  3WKJ B;  2CC1 A;  1AOI C;  4JGQ A;  3ZYT A;  4J8X C;  3REJ D;  2XRN A;  3O86 A;  2IOU A;  1G5U A;  2HDQ A;  1YLP A;  4GZB A;  3WD1 A;  3MGQ B;  3JVV A;  4G3K A;  1GA0 A;  5B31 B;  3QNB A;  3O62 C;  5HX9 A;  3MGS A;  4WZ5 A;  1QO6 A;  1GHI A;  2OWH A;  5B24 B;  5HD3 A;  5AV9 C;  1P3F A;  2Q9N A;  3F1N A;  3M2J A;  5AVB C;  5AVC D;  2G2U A;  3LY3 A;  3GSG A;  3S7O A;  3EPL A;  3AV1 C;  1YLZ A;  3VP1 A;  1WWI A;  1W1P A;  2Y2J A;  1W8Y A;  3DAV A;  4G92 C;  3AZE D;  4D60 A;  4LLO B;  4CSR B;  3HLC A;  3OCL A;  2C6W B;  3W98 B;  3OOV A;  2XLN A;  5EVI D;  2IWB A;  3AZN B;  3IBR A;  3C1C B;  3AZM A;  1LL9 A;  4EO5 C;  3B6G D;  4GOG A;  5B33 B;  3O3V A;  5F6A A;  5CPJ C;  2P04 A;  3F6T A;  3DTK A;  3WA9 A;  5AV6 B;  4E45 A;  1BSG A;  4BMW A;  4DE2 A;  4U0X A;  3DTI A;  3CPT A;  1W63 Q;  4ZJ3 A;  1BUL A;  2C5W B;  3MFX A;  1NJ4 A;  5BS7 C;  3A0S A;  4YWZ A;  5B31 G;  1TD5 A;  1KDW A;  5FI6 A;  1P3B A;  3HLG A;  3P7N A;  1IKI A;  2PRF A;  3VH6 A;  3AZL B;  2CV5 B;  4NYU A;  3BLS A;  3QP4 A;  2HF6 A;  4I38 A;  4H9R B;  1HD8 A;  5CP6 A;  5E2H A;  1VQQ A;  5B0Y B;  3C30 A;  3KWQ B;  3QP6 A;  3T4J A;  4XZQ D;  3UE0 A;  3TU4 B;  5HWW A;  2XQZ A;  2O0Y A;  4H8R A;  4XUX A;  3B3X A;  3IWQ A;  3AFA B;  5CTM A;  1IYP A;  1LSW A;  4FH4 A;  3ZHH A;  5E5A D;  4E3I A;  2PYO B;  3A6N C;  1K54 C;  2P9V B;  3REH D;  4R8P B;  3AN2 A;  3BYD A;  4Z2L A;  5EVI C;  4H9S A;  3REI B;  1UGU A;  2X02 A;  1P3M D;  2HIO C;  2X01 A;  4IED A;  2L0W A;  3N4I A;  4KUD C;  1O07 A;  4OOY A;  5B40 C;  2PU2 A;  5KDM B;  1E6R A;  2RVQ C;  2PDR A;  1OJG A;  3IXG A;  5CP6 C;  4OOM A;  5B2I A;  5CPJ B;  5KZH A;  4HEF A;  5GLD A;  4J8U C;  4XUJ B;  4HOI A;  4R8P A;  3NQJ A;  3AN2 B;  4G3V A;  1OJ5 A;  4ZUX C;  4CAY A;  3UTB B;  3UDF A;  3S7P A;  3G34 A;  3X1V D;  1NXY A;  3A3F A;  3UPN A;  4FOF A;  2QKP A;  5FI2 A;  2Y2O A;  2ZY2 A;  3DWK A;  5B2J D;  1ZLA D;  5TJJ A;  3MKF A;  4LFU A;  3AZH B;  5DTT A;  1N9N A;  3VP2 A;  5B40 D;  4Z66 D;  2XRO A;  4H9Q B;  5FUG A;  2R78 A;  4S2M A;  4LD9 B;  3NOP C;  4KGC B;  2PR6 A;  1U35 B;  3LI8 A;  4JJN C;  5GT0 A;  2NZD D;  3LEL D;  3REH C;  2NQB B;  1GCE A;  2OSU A;  2VA0 A;  2IWD A;  5E5A C;  1YUE A;  4LD9 D;  1H0I A;  2I9V A;  2PHY A;  3MVD D;  3A3I A;  4BL3 A;  2QJ5 A;  5FEG A;  4Y3I A;  3T1Q B;  3QP5 A;  4O7D A;  3AZI A;  3KS8 A;  4H9O B;  3UT9 A;  1YLJ A;  3L9K A;  4CLC D;  3WRT A;  4XT2 A;  2ZQC A;  5CP6 B;  2EX9 A;  3C8C A;  4ZBJ C;  1Q2Q A;  2JKR M;  3IH9 A;  4Z2I A;  4Z2G A;  3OPL A;  3AZN C;  1NZO A;  3MVD A;  3IT9 A;  1M18 D;  2V1B A;  2O9B A;  5CPK A;  2XFT A;  3W4P A;  3FC7 A;  5E5A A;  3A6N A;  3IXB A;  3C2W A;  4NZ1 A;  3A1I A;  5G49 B;  5EFW A;  1O7E A;  5DFX A;  1H0G A;  3MXQ A;  4E3L A;  4R38 A;  4NZ3 A;  3FG8 A;  5DKK A;  4BLM A;  1S32 B;  3WRZ A;  2JCH A;  2V5O A;  1TS0 A;  4P6B A;  3BFC A;  2WKH A;  2ZL1 A;  3GTC A;  5B2I D;  2YKH A;  4MB5 A;  3EQU A;  1W79 A;  2FFY A;  4CLC E;  5DF7 A;  1KS0 A;  3KWQ C;  5FSR A;  5FQ9 A;  3BQ8 A;  4WN5 A;  3MFD A;  4NET A;  1K55 C;  1RCJ A;  3LIF A;  4YS3 A;  1KE3 A;  1JTD A;  2J3T C;  2HDR A;  2Y2L A;  3IF5 A;  5B0Z D;  4NEE D;  2PYO C;  1ZTU A;  3AZL A;  4YIN A;  2CV5 A;  2ARO C;  1H8P A;  3IS2 B;  3IWI A;  2WUQ A;  1MKM A;  5AVB A;  3NDG A;  5F5Y A;  1DP6 A;  4OQH A;  1N9O A;  3VV4 A;  1U35 A;  4KZ8 A;  1M6K A;  4WMC A;  2OLV A;  4JBF A;  1KU5 A;  4QWO A;  3HUN A;  3NHQ A;  4LG2 A;  1KX4 D;  1V9Y A;  5JRG A;  3PR6 A;  3LZ1 D;  1PWD A;  3W96 D;  4S2P A;  4B88 A;  4UUZ B;  3PXP A;  3C4P A;  4HBT A;  4QPR A;  5HAR A;  4EBL A;  2LY8 A;  2OV5 A;  4GKU A;  1OME A;  1K57 C;  1A7W A;  2WZX A;  4EUZ A;  4CSR A;  1P3I B;  4FTX A;  3WS1 A;  4RVA A;  5CPK C;  4QD4 A;  3SW1 A;  3B6F A;  2VGJ A;  3NUL A;  2HUE C;  5L2F A;  2WKI A;  4KZ5 A;  3HLE A;  3ULF A;  5DNN A;  3B42 A;  1H8M A;  2ZM2 A;  3L29 A;  5FAO A;  3C38 A;  1KX5 D;  4DE1 A;  3T1X A;  5CEB A;  2JC7 A;  4GHI A;  2A24 A;  3V9R B;  2HIO B;  1OT6 A;  2LB5 A;  1JNU A;  3IH8 A;  5AV6 A;  2NUT C;  4HGA C;  3PBR A;  3UB5 P;  4PMA A;  4ZRR A;  5G49 A;  3LCE A;  3MGQ A;  2H0T A;  5IU1 A;  3TE8 A;  4P85 A;  5F69 A;  5DNN D;  5HPF A;  3MXR A;  1BLS A;  1C3B A;  5G4Z A;  4IBG A;  2MJ6 A;  3CWF A;  3A3E A;  3PBT A;  4IBX A;  2VGL S;  5GXQ D;  1J3W A;  4OVD A;  2UWX A;  2YKF A;  5FDS A;  4KHA A;  4GN2 A;  2W1T B;  1W1V A;  2VK3 A;  3UMD A;  4EET B;  3AGF A;  3MNN A;  3W99 D;  4PPR A;  3ZG8 B;  4Q8I A;  5CGW A;  3REJ A;  3O5Y A;  1P3O B;  4X69 A;  5B1M A;  1KX3 B;  1P3B D;  4IBC A;  4NXF A;  1B6W A;  4OQG A;  1EQZ D;  4EU0 A;  3BJN A;  5FQJ A;  4QY5 A;  4CLC A;  2CV5 D;  2ZOI A;  1RGZ A;  3FKW A;  5AVC C;  3KUY D;  5AVB D;  5AV5 B;  1XPB A;  3NEC A;  5DKL A;  3RXX A;  2I72 A;  1SKO B;  4J8W A;  1B67 A;  4D2O A;  5BNV A;  4NY2 A;  1NYM A;  2ZC4 B;  3VH5 A;  2JN7 A;  3F1O B;  4UA6 A;  3WTP A;  3UB9 A;  1BLC A;  5EEC A;  1VEU B;  2DCF A;  2ZD8 A;  3B0C W;  1XA7 A;  2QMI A;  3IF6 A;  3W98 C;  3REJ C;  3O88 A;  2PR5 A;  4G91 C;  5B1M B;  3W96 C;  4CQH A;  3R45 B;  1UWN X;  4OOL A;  4X25 A;  3X1T C;  3X1T D;  4Q0I A;  2RVQ D;  2RCX A;  5FUG B;  1KX4 C;  5BO0 B;  2RTS A;  4WU9 B;  1XFN A;  2DNS A;  3KSH A;  3B6F B;  1DP8 A;  2J9P A;  4GDN A;  5GLA A;  4XUJ D;  5HDC A;  4DRB A;  3WTP D;  1GOI A;  1KX5 A;  2G7U A;  3WTP B;  4GHL A;  4HP9 A;  1W2E A;  1P3A D;  4LV2 A;  5AV8 B;  3BM6 A;  4J8U A;  2PYP A;  3HLW A;  4XZQ C;  5AQA A;  1PWG A;  5EOE A;  2FJ7 A;  3AFA C;  3BFD A;  3IBJ A;  3VP0 A;  1YLW A;  1OGG A;  5CHU A;  4YOF A;  5B40 A;  2ARO D;  3W97 D;  4NG2 A;  1K25 A;  3BLM A;  3ZVW A;  5B2I C;  5FAS A;  5HAI A;  4S2J A;  3FYZ A;  4P87 A;  3ZG5 A;  4OP5 A;  2HP9 A;  3A3D A;  4K91 A;  1H0M A;  4FCF A;  3P98 A;  4WU8 B;  3NJA A;  4HMD A;  3KO6 A;  2F8N B;  5HFO A;  3W96 B;  3REK C;  3IX3 A;  3MGR A;  5A90 A;  3REJ B;  2IA2 A;  4R3A A;  5FEF A;  3FKE A;  3C7U A;  4AWL B;  4IJF A;  1CQA A;  2FH5 A;  5DNM D;  4ZUX B;  1PZP A;  4EXO A;  1L3L A;  3UNW A;  1P3F C;  3BY8 A;  5GHZ A;  1BH8 A;  2UV0 E;  3Q07 A;  2Y2Q A;  2WKP A;  1ERQ A;  4N1H A;  2J9O A;  4YFM A;  2IO5 C;  5EV0 A;  4MBK A;  1P3P D;  4MB3 A;  4H9S C;  1XXM A;  3AZJ A;  1P3L D;  3X1S D;  1YM1 A;  4OLG A;  4ZBJ B;  5B32 B;  4Z2M G;  3LIB A;  4ESP A;  2WZZ A;  1PIO A;  3KXB A;  3LID A;  4NE6 A;  5B32 D;  1RGY A;  3QNC A;  4WYY A;  4C6Y A;  4QY6 A;  1M1A D;  4KGC C;  3V39 A;  4DE3 A;  5BPV A;  1YKD A;  3MXS A;  3HLB A;  4OQ0 A;  1ULY A;  4ETZ A;  3AZL C;  4JF5 A;  2Z6C A;  4RX2 A;  3B0D B;  1AOI D;  4MLL A;  1ES2 A;  3HUM A;  1YU4 A;  4NXE A;  1P3G B;  3DW0 A;  3W8K A;  1ID3 A;  2K7S A;  3UB8 A;  5CPI B;  5IS1 A;  3KSG A;  1S32 A;  5B32 A;  2B18 A;  3X1U D;  3WKJ A;  3OPH A;  3BQA A;  1S1Y A;  1VM1 A;  3NOT C;  4LRZ E;  5DTK A;  3AZM D;  5U47 A;  3ZVT A;  4FD8 A;  3EPH A;  2A3U A;  3S7N A;  5CEC A;  4IVI A;  5F68 A;  5L8M A;  3C5A A;  1WA9 A;  1MPL A;  4GHI B;  1N1J B;  4YS3 C;  3B47 A;  4H9P A;  2BLS A;  3AFA D;  1V9Z A;  1KE0 A;  5HL6 A;  5CX7 A;  3AZI C;  3L25 A;  4QNL A;  3HLF A;  5DFY A;  5HW3 A;  3WAA C;  4OJL A;  4JF4 A;  1CEG A;  3REL C;  1S32 C;  4U0T A;  3UTB C;  4WM9 A;  1PWC A;  1E3U A;  5D3O A;  2XK1 A;  2B95 A;  2FFF B;  1ERO A;  2INW A;  3CJM A;  2W3F A;  2KX6 A;  2ZC3 B;  3HL9 A;  2R9W A;  3AZK A;  3BEC A;  1L0D A;  5G4Y A;  3GVB A;  3KYZ A;  4R8P C;  3T1S A;  3EQV A;  1BLH A;  4NZ4 A;  1TS8 A;  4Y2F A;  1P3I C;  2PT7 A;  1HQ3 D;  2KLI A;  5C3I B;  5JRG D;  1K6R A;  3OPR A;  1FIL A;  4NE5 A;  3LEL A;  1PDC A;  1YMS A;  4EUV A;  3C7V A;  4R23 A;  4Z5T D;  2ZC5 B;  4R4R A;  4HI4 A;  3MNN C;  2PAV P;  4HME A;  2V20 A;  5TBM B;  3AGE A;  3UT9 D;  4HH2 A;  1F66 D;  2Y79 A;  3C1B B;  2XD1 A;  1ZLA B;  5DNN B;  4KQQ A;  3VOL A;  3SS3 A;  1ES3 A;  3WKJ C;  5CGX A;  5GT0 B;  4J8V C;  3H9W A;  2HP5 A;  1LSX A;  3WA9 D;  3PBO A;  3LZ1 A;  4X55 A;  3W96 A;  3MGQ C;  3W99 A;  1K4E A;  3GDI A;  4X56 A;  4Y17 A;  5L07 A;  5AV8 C;  2PU4 A;  3AZI B;  5B24 C;  3VH5 T;  4E3J A;  4ZJ2 A;  3MGQ D;  5B1L A;  1P3K D;  5HWT A;  2YFW B;  1LL8 A;  1BH8 B;  5GT3 D;  2H10 A;  3G4P A;  4GW9 A;  1M1A A;  3C1B A;  3NQU B;  2ZQD A;  4DDS A;  4I5S A;  3E4Q A;  4DMZ A;  5GXQ C;  2J80 A;  4ZBE A;  3UME A;  4EES A;  4J8X A;  3UDI A;  5AQB A;  4CAY B;  3UTB A;  5C3I C;  4X23 A;  4OJ6 A;  4RQ9 A;  2W3G A;  2M7V A;  3TW8 A;  4WZS B;  5E2F A;  2RIQ A;  1WYC A;  1YQS A;  1IKG A;  1XGI A;  1T1A A;  2ZQ7 A;  2ZC6 B;  3G35 A;  3C1C C;  1W8Q A;  4H6J A;  4I39 A;  1EQZ A;  3H82 A;  2ZBB A;  1TAF B;  1E3U D;  5B40 B;  3MSH A;  2BAS A;  2HP6 A;  3SOI A;  4XZQ A;  3Q1F A;  3MGS B;  2NZD B;  5CED A;  3CIT A;  4E6X A;  3VOY A;  1JWV A;  2EFX A;  2ZMF A;  4I3I A;  1HTZ A;  5CPK D;  3VFF A;  4WMC D;  2G5I C;  3A6N D;  3MGP B;  4LGW A;  1P3G A;  1EI5 A;  1I2W A;  4H6J B;  3SS4 A;  3MGP D;  2PYO A;  2G2W A;  4O8G A;  4MNR A;  1P9R A;  5L10 A;  4G3W A;  5HL1 A;  4Z5T A;  1A0K A;  3Q7V A;  2Y2P A;  1MWS A;  3T4T A;  4IHQ A;  4WNN B;  3G6O A;  4EQI A;  2O99 A;  5HDD A;  3M2K A;  4HY8 A;  2OLU A;  2VV6 A;  3W4O A;  1G28 A;  2H28 A;  3AZH C;  5B0Z C;  4PM5 A;  5HD5 A;  4LV0 A;  3ZQ5 A;  4KUD B;  1NLY A;  5FI7 A;  1QME A;  2DMW A;  4NKP A;  2BYK A;  1OTE A;  1LL5 A;  1UR9 A;  3MGP A;  2PYO D;  4A5R A;  4P6Z S;  4UUZ A;  3ZNT A;  3REH B;  2NQB C;  2EX2 A;  1XJ2 A;  1U35 C;  5BS7 A;  1FIK A;  4IUH A;  4MDZ A;  1DY6 A;  1T1B A;  1FSY A;  3ITB A;  4RX3 A;  1KVM A;  4HP4 A;  3JYI A;  4G92 B;  3B6F C;  4DE0 A;  4Z9Q A;  3TRC A;  3AN2 C;  2JBF A;  1ES4 A;  3AZG D;  2P08 A;  4N92 A;  3REK B;  1XP4 A;  1ACF A;  3AZH A;  2WAD A;  3Q82 A;  2HPB A;  4HNB A;  3AZG C;  1W1Y A;  3L28 A;  2VJW A;  3HJI A;  1HQ3 B;  4EW7 A;  1KVL A;  1AXB A;  5BOH A;  4UAA A;  1XKZ A;  3UTA C;  4DKI A;  5AV9 D;  3V67 A;  2FJ7 D;  3NCK A;  2Q9M A;  4JPM A;  4HQA A;  4I3A A;  2KOI A;  2EX6 A;  1TZY C;  1ZLA A;  1ESU A;  3AZN D;  4GCZ A;  4ID4 A;  3IXH A;  1E4D A;  3VFH A;  3UT9 B;  1FCO A;  1G6A A;  3AZH D;  3KSI A;  1AOI A;  4F94 A;  3REL A;  4MBF A;  3VE3 A;  1NLZ A;  5AV6 D;  3GR2 A;  4Y5F A;  1ID3 D;  3MVD C;  1ZKJ A;  5AV5 C;  3NI9 A;  4BL2 A;  1YSQ A;  3WD4 A;  1P3O A;  1H8Y A;  4RYE A;  3X1U A;  1S6R A;  4MBH A;  3QP8 A;  1TVF A;  5EM1 A;  3U4L P;  1OT9 A;  2JKT M;  1FCN A;  4Z66 C;  4F3L B;  4KG6 A;  4JKT A;  1TZY A;  2PBY A;  1ZLA C;  3F1N B;  1W5D A;  4YNR A;  3AV2 D;  3LO7 A;  2J8P A;  1S4R A;  4JGP A;  1F2K A;  5F99 B;  3LR4 A;  4E04 A;  1PNE A;  3REH A;  4S2N A;  3REI A;  2ZY3 A;  1XJ6 A;  4UPK A;  4DDY A;  3MZD A;  3X1V C;  1TZY B;  1SCW A;  4J8U D;  3B6G A;  3WTP C;  3H82 B;  4F3L A;  3MJQ A;  2OWJ A;  2JSS A;  3LEQ A;  4IBJ A;  2GJ3 A;  4GS9 A;  1LI9 A;  2M7U A;  4DN0 A;  2YFV A;  4JLF A;  4OP8 A;  5AQ7 A;  5FQI A;  3ITA A;  4N1X A;  2HJ9 C;  5F1F A;  5B24 D;  3T50 A;  1P3B C;  1JFI B;  3T4O A;  5F99 A;  3AV2 C;  1PRQ A;  1IEL A;  3W99 B;  2QPN A;  5GT3 C;  3CG5 A;  1PI4 A;  1BUE A;  5HDS A;  4B93 A;  3AGD A;  4Y13 A;  4J8V D;  4GH9 A;  1F5M A;  2L1M A;  2XFS A;  3E2K A;  5B2J A;  2QHK A;  4ZDX A;  5AV5 A;  1OTB A;  2W8S A;  1CF0 A;  1N9B A;  4NZ5 A;  3S7Q A;  4R6L A;  1VET B;  4DF6 A;  1CK3 A;  2QYB A;  1J7M A;  3N8R A;  2GZA A;  3AZK C;  1P34 D;  4KUD A;  3AZF B;  2JKF A;  2XSS A;  5GXQ A;  3LIE A;  1OTI A;  2W3E A;  1P97 A;  3AZF D;  4DRA A;  3CLO A;  1BFM A;  4WU8 A;  2V8F A;  3G31 A;  3UY6 A;  3LIA A;  1DRM A;  1ONG A;  5CPJ D;  4KQR A;  1TDL A;  1E15 A;  2CWE A; 
#chains in the Genus database with same CATH homology
 3UTA B;  1P3I D;  1IYS A;  3GMW A;  3Q7Z A;  4IVK A;  2ZLY A;  4BD1 A;  3REK A;  1CI9 A;  3P5J B;  3UTB D;  1HQ3 A;  2BYM B;  1H3O A;  3REL D;  5AY8 B;  3AZF A;  5AVC B;  1M18 A;  3VH6 W;  4E44 A;  2F8N G;  1P3P B;  4AWL C;  4S2O A;  3CZD A;  2ZJ9 A;  4B4X A;  1HVB A;  2ZY5 A;  2EXB A;  4UA9 A;  2IO5 B;  3O62 D;  3LZ0 A;  3ZGA B;  4U3T A;  1GHM A;  3AZK B;  4IBF A;  5BT1 D;  4J8W D;  3AZJ D;  1Z6F A;  3LJA A;  2WAF A;  1IYQ A;  1DJA A;  1XGJ A;  5CHJ A;  4X23 C;  1K56 D;  1P3O D;  1U60 A;  4YS3 B;  3IHA A;  5KDM A;  1SDN A;  5EVI A;  3MGP C;  3X1U B;  2XEP A;  3AZL D;  4XUZ A;  3GQZ A;  3B0D C;  3X1T A;  1BH9 B;  3TU4 D;  4XZQ B;  4PM8 A;  5M18 A;  3W97 B;  5E5A B;  4LEN A;  4JJN B;  1MWR A;  3B0C T;  1T3U A;  3LZ1 B;  3AV1 B;  5GSU C;  1P3P C;  1ZG6 A;  4IBD A;  2WGV A;  3PBN A;  4WU8 C;  4IBK A;  4H9N A;  4WU9 C;  4OPY A;  5DVA A;  3MGS C;  4WZ5 C;  3MGR D;  4KG2 A;  3N3F A;  2Y2M A;  4QLC B;  1P3I A;  2EXA A;  3REK D;  5DNM C;  4BQM A;  3AN2 D;  3HON A;  3FDD A;  1H3O B;  1JVJ A;  4KQO A;  3AYW D;  4PM6 A;  1P3A B;  3ZG7 B;  1QMF A;  3KS4 A;  3G2Y A;  3X1V B;  3UE1 A;  2Z2L B;  3W98 A;  4BJP A;  3PBQ A;  1MKI A;  3ZCZ A;  5B1L D;  1P3K A;  2Y2H A;  5B2J B;  3WA9 C;  3BFE A;  3HVF A;  1JTG A;  2ARO A;  2XD5 A;  2WGW A;  2F2A C;  4KZ7 A;  5JYP A;  3N8S A;  2NQB D;  3IHB A;  3MNN B;  5GXQ B;  5F83 A;  2ZM8 A;  1YU3 A;  3I7J A;  3VH5 W;  3TSG A;  5CPI C;  5GLC A;  4GHA A;  4OLD A;  3ZG0 A;  4H9Q A;  4WZ4 A;  5CP6 D;  3Q81 A;  1WWS A;  1PW8 A;  3HUO A;  4BEN A;  3KUY B;  3VSL A;  5HAP A;  1P3O C;  2BYK B;  1PI5 A;  3V50 A;  4OQI A;  2HIO D;  4M3K A;  3PAE A;  4S2K A;  4KG5 A;  4Y0U A;  1R4V A;  2HDS A;  2L5A A;  4OJP A;  1SKF A;  2V2F F;  1L0G A;  3H0L C;  3WAA B;  3ZG9 B;  5BO0 A;  4X6T A;  3LJA B;  4N9K A;  5KSC A;  4EV4 A;  5TGF A;  2XF3 A;  4XUJ A;  1YU2 A;  3GRJ A;  5FAP A;  1P3K C;  1Q9C A;  3DWZ A;  3GV9 A;  2XH9 A;  1P3M C;  4Y7P A;  5AV5 D;  4RA7 A;  5F99 C;  3AV2 A;  4UHU A;  5FDH A;  3NY4 A;  3L26 A;  3DTM A;  4WBG A;  4K0W A;  3P09 A;  5FAQ A;  4E3N A;  5DNN C;  4KZA A;  4X23 B;  4KGC D;  4IBI A;  4IBB A;  3LEL B;  3UPO A;  3CMZ A;  5B0Z A;  4WU8 D;  5A91 A;  5B32 C;  1MXO A;  1WE4 A;  2F8N D;  2F8N H;  5FQM A;  3LJA C;  1N4O A;  3VSK A;  3AZN A;  1FQG A;  4OJO A;  4FH2 A;  1KX5 B;  1KX4 A;  4J8X D;  1P34 A;  1P3L A;  3REI C;  3LZ1 C;  5CXW A;  5GSU B;  5DTS A;  1K38 A;  5AY8 C;  2BG1 A;  3L27 A;  2FJ7 B;  3B6G B;  3WS4 A;  3KWQ A;  4E3M A;  2P74 A;  1P34 B;  3N7W A;  1P3P A;  3NDE A;  4J8W B;  4JXW A;  1JWP A;  1L0F A;  1ID3 B;  5EVL A;  2F8N K;  1EQZ B;  4E3K A;  3KWQ D;  3AZM C;  5I94 A;  4YM6 B;  4WU9 A;  1ES5 A;  4S2L A;  3X1U C;  5AVB B;  1ZC2 A;  5AY8 D;  4H9P B;  3HLD A;  4OKP A;  4R3B A;  1M1A C;  4OH0 A;  3V5M A;  3AZE B;  4GD6 A;  4QJG A;  2YFW A;  4HGA B;  1P3A A;  3C1C D;  1KGG A;  4H9R A;  2DRW A;  3C4O A;  1P3L C;  1TZY D;  5B33 D;  5B33 C;  4S2N C;  1IEM A;  1NYY A;  3O87 A;  2WGW B;  2ZC7 A;  4WEK A;  3VOZ A;  4OPR A;  2FJ7 C;  1DJB A;  5E2G A;  5AY8 A;  1K57 A;  4Y0O A;  4ZJ1 A;  1K6S A;  3IXD A;  4OPZ A;  1S0W A;  3H0R C;  2Y2N A;  4KZ3 A;  1TDG A;  3X1S C;  4H9N B;  4NE3 A;  2XR0 A;  3S22 A;  1NY0 A;  5B0Y D;  4R0Q A;  3TU4 C;  5AV8 D;  4KZ9 A;  2F8N A;  4JXV A;  4H9O A;  4LV3 A;  3SH8 A;  4WJ3 C;  3W97 C;  4HBU A;  4YM6 C;  3PTE A;  1U35 D;  3WS5 A;  4KHA B;  1YU1 A;  3WX7 A;  4R1G A;  5GT0 D;  2WGI A;  5B2J C;  3BFG A;  3UT9 C;  5JYO A;  1P3G C;  3X1S A;  3AYW A;  3MVD B;  3AZJ C;  3MNN D;  2E8I A;  3MKE A;  1TEM A;  5AV9 A;  1M19 B;  4J8U B;  3X1T B;  3WAA A;  2Z2M B;  4Z2M H;  3RJU A;  1M19 D;  4CPK A;  3AZG B;  4XUJ C;  3L2A A;  3M6H A;  2ZY4 A;  1HQ3 C;  3LZ0 D;  1FOF A;  4FSF A;  4YM6 A;  1P3A C;  1JWZ A;  1BZA A;  2ZMA A;  4JF6 A;  4B4Z A;  3REL B;  5GHX A;  3AYW B;  3W98 D;  1KE4 A;  1HTA A;  1PZO A;  2H5S A;  1K56 A;  1S32 D;  2RL3 A;  3OZH A;  5TR7 A;  5AV9 B;  1M19 A;  3LZ0 C;  3IF6 B;  3E2L A;  3N6I A;  1ZG4 A;  5FAT A;  5B33 A;  4GB7 A;  3ZFZ A;  3KUY A;  5B2I B;  1XX2 A;  2Y2K A;  3IP4 C;  1RP5 A;  2NZD A;  5M19 A;  1L2S A;  1PYY A;  4R4S A;  4C3Q A;  5B1L C;  1P3G D;  3HSH A;  3KXB D;  1P3B B;  5GLB A;  2H0Y A;  3W99 C;  5JA4 A;  4GDB A;  4WNN A;  1P3K B;  4Z5T B;  3KXB B;  3Q7V B;  5B0Y A;  3B6G C;  2XGN A;  1ESI A;  4OUI A;  3G30 A;  1K54 A;  5KSH A;  3FV7 A;  3NQU A;  3QHY A;  1CI8 A;  2WK0 A;  1BT5 A;  5FQQ A;  5A93 A;  3W97 A;  1P3L B;  4LCL A;  3RXW A;  4GNU A;  4OON A;  1KX4 B;  4UA7 A;  5G18 A;  3MGR C;  5CRF A;  4C75 A;  1KDS A;  3OCN A;  3A1K A;  3WKJ D;  5EPH A;  1TAF A;  3NC8 A;  3C1C A;  3OPP A;  3AV1 D;  5F82 A;  4WV4 B;  4ZUX A;  3NIA A;  5GT3 B;  1FCM A;  3G32 A;  1BTL A;  5DNM A;  3NBL A;  3MGS D;  5B31 C;  1F66 A;  4X53 A;  4N9L A;  1KGF A;  4EWF A;  4WEJ A;  1MWT A;  5B32 G;  1P3F D;  3SH9 A;  5JRG C;  5KMW A;  5CHM A;  4KZ4 A;  1IYO A;  5CER A;  5EE8 A;  5B1M C;  3VP4 A;  3PBS A;  5AV8 A;  5J8X A;  4Z66 B;  4HES A;  3IWO A;  1BH9 A;  1AOI B;  2IWC A;  2BYM A;  3M6B A;  4KGC A;  3UPP A;  4X23 D;  5BNV B;  4NFT A;  5AV6 C;  1Q2P A;  5FQK A;  4KZB A;  2EFU A;  5EOO A;  3EPJ A;  5BT1 C;  4J8W C;  1FR1 A;  3UE3 A;  5B31 D;  3AL0 C;  3WS2 A;  5CPJ A;  2HUE B;  1I2S A;  5EUA A;  2WAE A;  1W7F A;  5TFQ A;  3MZF A;  4DRT A;  3LZ0 B;  3IF6 C;  3UO9 A;  5A92 A;  1GA9 A;  5JRG B;  4E3O A;  5IHV A;  1YLY A;  2A49 A;  5M1A A;  1KX3 A;  3VMA A;  4WEL A;  3LEZ A;  3B0B A;  3REI D;  3WS0 A;  4ZAM A;  2WYX A;  5B1M D;  5EVI B;  1M1A B;  5DF9 A;  4NK3 A;  3UTA A;  5B1L B;  4KEN B;  2ZM5 A;  1M18 C;  5E2E A;  3TOI A;  4WU9 D;  3TU4 A;  3AZK D;  1P34 C;  4G91 B;  4PM7 A;  1EWZ A;  2Y59 A;  2HIO A;  4ZTK A;  3LJA D;  5FA7 A;  1FSW A;  1FR6 A;  2CV5 C;  2EX8 A;  3AFA A;  3AZF C;  4E6W A;  3D4F A;  5E43 A;  1KX3 C;  3W4Q A;  1E25 A;  1P3M A;  1EQZ C;  5GSU A;  3FKV A;  1SHV A;  1DJC A;  1PW1 A;  4KZ6 A;  3AV1 A;  3AZM B;  2HDU A;  3UDX A;  3LEL C;  3VH6 T;  3AV2 B;  1I5Q A;  1H5X A;  2J7V A;  4EBP A;  1F1E A;  5GL9 A;  4GD8 A;  1K4F A;  2Y2I A;  4QLC A;  4OPQ A;  2G5H C;  4R8P D;  3UN7 A;  5F99 D;  1YU0 A;  1Y54 A;  1P3M B;  3WA9 B;  4LD9 C;  1BLP A;  1LLB A;  1ALQ A;  4CJN A;  4JJN D;  1YMX A;  3ISG A;  4LCM A;  3EG5 B;  5CGS A;  4J8V A;  3KXB C;  3VP3 A;  3WAA D;  1MWU A;  3AZI D;  4ZUX D;  2V1Z A;  2Y4A A;  5DNM B;  4P0M A;  1ERM A;  1XA1 A;  3WWX A;  5GT3 A;  1YT4 A;  3MBZ A;  1M19 C;  1L0E A;  5AQ9 A;  5B24 A;  5GHY A;  2GDN A;  3V3S A;  1G68 A;  5BNX B;  4QHC A;  4OJ5 A;  3X1S B;  3BEB A;  2NQB A;  4J8X B;  4QU3 A;  3V9R A;  3N8L A;  1P3F B;  4LD9 A;  2Y91 A;  3PAG A;  5GT0 C;  4J8V B;  3AZE A;  5CTN A;  5CPI A;  1K55 A;  3R45 A;  4XXR A;  4DQY B;  3EPK A;  3MZE A;  3ZDJ A;  3FZC A;  3C1B D;  1ID3 C;  2JE5 A;  2ZQ9 A;  4Z66 A;  1MY8 A;  5HAQ A;  4KUD D;  1KGE A;  3SS5 A;  1NRF A;  3BRM A;  4M6B A;  1MBL A;  4BD0 A;  3KSY A;  1SDE A;  4EBN A;  3TG9 A;  4R3J A;  3NQJ B;  1KX3 D;  3AZJ B;  2X71 A;  2WKE A;  1H8Z A;  1LI0 A;  3A6N B;  2ZM0 A;  3G2Z A;  5CPI D;  1CEF A;  2Y55 A;  3H0M C;  3SH7 A;  2J8Y A;  3KUY C;  3HRE A;  3UTA D;  5B31 A;  1F66 C;  4PM9 A;  4S2I A;  2VQR A;  3O62 A;  1LHY A;  5F1G A;  2DQN C;  3FWL A;  4JXG A;  3WTP E;  4YM6 D;  1Z2C B;  2DF4 C;  4JXS A;  4Z5T C;  5AVC A;  2ARO B;  1M18 B;  4QLC C;  1JFI A;  4L0L A;  3AYW C;  1WYB A;  4K0X A;  5JA4 B;  5B0Y C;  1YLT A;  2ZQ8 A;  4IJE A;  4JJN A;  4NYY A;  3V3R A;  4MEZ A;  2VGK A;  2ZQA A;  2R9X A;  3OC2 A;  1ONH A;  3MGR B;  3O62 B;  1GHP A;  2Y2G A;  4X68 A;  4IBE A;  3AZG A;  3B6F D;  4QLC D;  4QB8 A;  3AZE C;  3ZNY A;  1N1J A;  3S4X A;  5CPK B;  3A3J A;  4DXC A;  5BNX A;  4Y0T A;  1J9M A;  3X1V A;  1KX5 C;  5B0Z B;  1M40 A;  4YS3 D;  5DF8 A;  3BFF A;  5GSU D;  1HZO A;  4EO5 B;  1F66 B;  4IBR A;  3IQA A;  2NZD C;  1NZU A;  2B5R A;  2XDM A;  4DXB A;  1PZR A;  2YFV B;  2P9V A;  3KFU G;  3S1Y A;  3LY4 A;  4LV1 A;  5CHL B;  3C1B C;  2QZ6 A;  3HBR A;  3WKJ B;  2CC1 A;  1AOI C;  4J8X C;  3REJ D;  3O86 A;  2IOU A;  2HDQ A;  1YLP A;  4GZB A;  3MGQ B;  1GA0 A;  5B31 B;  3QNB A;  3O62 C;  5HX9 A;  3MGS A;  4WZ5 A;  1GHI A;  5B24 B;  5AV9 C;  1P3F A;  2Q9N A;  3M2J A;  5AVB C;  5AVC D;  2G2U A;  3LY3 A;  3GSG A;  3EPL A;  3AV1 C;  1YLZ A;  3VP1 A;  1WWI A;  2Y2J A;  1W8Y A;  4G92 C;  3AZE D;  4CSR B;  3HLC A;  3OCL A;  2C6W B;  3W98 B;  2XLN A;  5EVI D;  2IWB A;  3AZN B;  3C1C B;  3AZM A;  1LL9 A;  4EO5 C;  3B6G D;  4GOG A;  5B33 B;  3O3V A;  5CPJ C;  3F6T A;  3WA9 A;  5AV6 B;  4E45 A;  1BSG A;  4DE2 A;  4U0X A;  4ZJ3 A;  1BUL A;  2C5W B;  1NJ4 A;  5BS7 C;  5B31 G;  1KDW A;  5FI6 A;  1P3B A;  3HLG A;  1IKI A;  3VH6 A;  3AZL B;  2CV5 B;  4NYU A;  3BLS A;  4H9R B;  1HD8 A;  5CP6 A;  5E2H A;  1VQQ A;  5B0Y B;  3KWQ B;  4XZQ D;  3UE0 A;  3TU4 B;  2XQZ A;  4H8R A;  4XUX A;  3B3X A;  3IWQ A;  3AFA B;  5CTM A;  1IYP A;  4FH4 A;  3ZHH A;  5E5A D;  4E3I A;  2PYO B;  3A6N C;  1K54 C;  2P9V B;  3REH D;  4R8P B;  3AN2 A;  3BYD A;  5EVI C;  4H9S A;  3REI B;  2X02 A;  1P3M D;  2HIO C;  2X01 A;  4IED A;  3N4I A;  4KUD C;  1O07 A;  4OOY A;  5B40 C;  2PU2 A;  5KDM B;  2RVQ C;  4OOM A;  3IXG A;  5CP6 C;  5B2I A;  5CPJ B;  5KZH A;  4HEF A;  5GLD A;  4J8U C;  4XUJ B;  4R8P A;  3NQJ A;  3AN2 B;  4ZUX C;  4CAY A;  3UTB B;  3UDF A;  3G34 A;  3X1V D;  1NXY A;  3A3F A;  3UPN A;  5FI2 A;  2Y2O A;  2ZY2 A;  3DWK A;  5B2J D;  1ZLA D;  3MKF A;  3AZH B;  5DTT A;  3VP2 A;  5B40 D;  4Z66 D;  4H9Q B;  5FUG A;  4S2M A;  4LD9 B;  4KGC B;  1U35 B;  4JJN C;  5GT0 A;  2NZD D;  3LEL D;  3REH C;  2NQB B;  1GCE A;  2OSU A;  1YUE A;  2IWD A;  5E5A C;  4LD9 D;  3MVD D;  3A3I A;  4BL3 A;  4O7D A;  3AZI A;  3KS8 A;  4H9O B;  3UT9 A;  1YLJ A;  3WRT A;  2ZQC A;  5CP6 B;  2EX9 A;  4ZBJ C;  1Q2Q A;  3IH9 A;  3OPL A;  3AZN C;  1NZO A;  3MVD A;  3IT9 A;  1M18 D;  5CPK A;  2XFT A;  3W4P A;  5E5A A;  3A6N A;  3IXB A;  4NZ1 A;  3A1I A;  5G49 B;  1O7E A;  4E3L A;  4NZ3 A;  4BLM A;  1S32 B;  3WRZ A;  2JCH A;  4P6B A;  3BFC A;  2WKH A;  3GTC A;  5B2I D;  3EQU A;  1W79 A;  2FFY A;  5DF7 A;  3KWQ C;  5FSR A;  5FQ9 A;  3MFD A;  4NET A;  1K55 C;  1RCJ A;  4YS3 A;  1KE3 A;  1JTD A;  2HDR A;  2Y2L A;  3IF5 A;  5B0Z D;  2PYO C;  4YIN A;  3AZL A;  2CV5 A;  2ARO C;  3IWI A;  2WUQ A;  5AVB A;  3NDG A;  4OQH A;  1U35 A;  4KZ8 A;  1M6K A;  4WMC A;  2OLV A;  4JBF A;  1KU5 A;  3HUN A;  4LG2 A;  1KX4 D;  5JRG A;  3LZ1 D;  1PWD A;  3W96 D;  4S2P A;  4B88 A;  4UUZ B;  3C4P A;  4HBT A;  5HAR A;  4EBL A;  2LY8 A;  2OV5 A;  4GKU A;  1OME A;  1K57 C;  1A7W A;  2WZX A;  4EUZ A;  4CSR A;  1P3I B;  3WS1 A;  4RVA A;  5CPK C;  4QD4 A;  3B6F A;  2VGJ A;  5L2F A;  2HUE C;  2WKI A;  4KZ5 A;  3HLE A;  5DNN A;  2ZM2 A;  3L29 A;  5FAO A;  1KX5 D;  4DE1 A;  5CEB A;  2JC7 A;  3V9R B;  2HIO B;  3IH8 A;  5AV6 A;  4HGA C;  3PBR A;  4PMA A;  5G49 A;  3LCE A;  3MGQ A;  2H0T A;  4P85 A;  5DNN D;  3MXR A;  1BLS A;  1C3B A;  4IBG A;  3PBT A;  3A3E A;  4IBX A;  5GXQ D;  4OVD A;  2UWX A;  4KHA A;  4GN2 A;  3AGF A;  3MNN A;  3W99 D;  4PPR A;  3ZG8 B;  4Q8I A;  5CGW A;  3REJ A;  1P3O B;  4X69 A;  5B1M A;  1KX3 B;  1P3B D;  4IBC A;  1B6W A;  4OQG A;  1EQZ D;  5FQJ A;  4QY5 A;  2CV5 D;  1RGZ A;  3FKW A;  5AVC C;  3KUY D;  5AVB D;  5AV5 B;  1XPB A;  3RXX A;  2I72 A;  4J8W A;  1B67 A;  4D2O A;  5BNV A;  4NY2 A;  1NYM A;  2ZC4 B;  3VH5 A;  4UA6 A;  3WTP A;  1BLC A;  5EEC A;  2DCF A;  2ZD8 A;  3B0C W;  1XA7 A;  2QMI A;  3IF6 A;  3W98 C;  3REJ C;  3O88 A;  4G91 C;  5B1M B;  3W96 C;  3R45 B;  4OOL A;  3X1T C;  3X1T D;  2RVQ D;  2RCX A;  5FUG B;  1KX4 C;  5BO0 B;  4WU9 B;  2DNS A;  3B6F B;  4GDN A;  2J9P A;  5GLA A;  4XUJ D;  4DRB A;  3WTP D;  1KX5 A;  3WTP B;  4GHL A;  1W2E A;  1P3A D;  4LV2 A;  5AV8 B;  3BM6 A;  4J8U A;  3HLW A;  5AQA A;  4XZQ C;  1PWG A;  5EOE A;  2FJ7 A;  3AFA C;  3BFD A;  3VP0 A;  1YLW A;  5CHU A;  5B40 A;  2ARO D;  3W97 D;  1K25 A;  3BLM A;  3ZVW A;  5B2I C;  5FAS A;  5HAI A;  4S2J A;  3FYZ A;  4P87 A;  3ZG5 A;  4OP5 A;  2HP9 A;  3A3D A;  4K91 A;  4FCF A;  3P98 A;  4WU8 B;  2F8N B;  5HFO A;  3W96 B;  3REK C;  3MGR A;  5A90 A;  3REJ B;  3FKE A;  3C7U A;  4AWL B;  4IJF A;  5DNM D;  4ZUX B;  1PZP A;  3UNW A;  1P3F C;  5GHZ A;  1BH8 A;  3Q07 A;  2Y2Q A;  1ERQ A;  4N1H A;  2J9O A;  4YFM A;  2IO5 C;  4MBK A;  1P3P D;  4H9S C;  1XXM A;  3AZJ A;  1P3L D;  3X1S D;  1YM1 A;  4OLG A;  4ZBJ B;  5B32 B;  4Z2M G;  2WZZ A;  1PIO A;  3KXB A;  4NE6 A;  5B32 D;  1RGY A;  3QNC A;  4WYY A;  4C6Y A;  4QY6 A;  1M1A D;  4KGC C;  3V39 A;  4DE3 A;  5BPV A;  3MXS A;  3HLB A;  4OQ0 A;  1ULY A;  3AZL C;  4JF5 A;  4RX2 A;  3B0D B;  1AOI D;  4MLL A;  1ES2 A;  3HUM A;  1YU4 A;  1P3G B;  3DW0 A;  3W8K A;  1ID3 A;  5CPI B;  1S32 A;  5B32 A;  3X1U D;  3WKJ A;  3OPH A;  1VM1 A;  5DTK A;  3AZM D;  5U47 A;  3ZVT A;  4FD8 A;  3EPH A;  2A3U A;  5CEC A;  4IVI A;  3C5A A;  1MPL A;  1N1J B;  4YS3 C;  4H9P A;  2BLS A;  3AFA D;  1KE0 A;  3AZI C;  3L25 A;  4QNL A;  3HLF A;  5HW3 A;  3WAA C;  4JF4 A;  4OJL A;  1CEG A;  3REL C;  1S32 C;  4U0T A;  3UTB C;  4WM9 A;  1PWC A;  1E3U A;  5D3O A;  2XK1 A;  2FFF B;  1ERO A;  3CJM A;  2ZC3 B;  3HL9 A;  2R9W A;  3AZK A;  3BEC A;  1L0D A;  3GVB A;  4R8P C;  3EQV A;  1BLH A;  4NZ4 A;  1P3I C;  1HQ3 D;  5C3I B;  5JRG D;  1K6R A;  3OPR A;  4NE5 A;  3LEL A;  1YMS A;  3C7V A;  4R23 A;  4Z5T D;  2ZC5 B;  4R4R A;  3MNN C;  2V20 A;  3AGE A;  3UT9 D;  1F66 D;  3C1B B;  2XD1 A;  1ZLA B;  5DNN B;  4KQQ A;  3SS3 A;  1ES3 A;  3WKJ C;  5CGX A;  5GT0 B;  4J8V C;  2HP5 A;  3WA9 D;  3PBO A;  3LZ1 A;  4X55 A;  3W96 A;  3MGQ C;  3W99 A;  1K4E A;  4X56 A;  5AV8 C;  2PU4 A;  3AZI B;  5B24 C;  3VH5 T;  4E3J A;  4ZJ2 A;  3MGQ D;  5B1L A;  1P3K D;  2YFW B;  1BH8 B;  5GT3 D;  2H10 A;  3G4P A;  1M1A A;  3C1B A;  3NQU B;  2ZQD A;  4DDS A;  5GXQ C;  4ZBE A;  4J8X A;  3UDI A;  5AQB A;  4CAY B;  3UTB A;  5C3I C;  4X23 A;  4OJ6 A;  4WZS B;  5E2F A;  2RIQ A;  1WYC A;  1YQS A;  1IKG A;  1XGI A;  2ZQ7 A;  2ZC6 B;  3G35 A;  3C1C C;  1W8Q A;  1EQZ A;  1TAF B;  1E3U D;  5B40 B;  2HP6 A;  3SOI A;  4XZQ A;  3Q1F A;  3MGS B;  2NZD B;  5CED A;  4E6X A;  3VOY A;  1JWV A;  2EFX A;  3VFF A;  1HTZ A;  5CPK D;  4WMC D;  2G5I C;  3A6N D;  3MGP B;  1P3G A;  1EI5 A;  1I2W A;  3SS4 A;  3MGP D;  2PYO A;  2G2W A;  4MNR A;  5HL1 A;  4Z5T A;  3Q7V A;  2Y2P A;  1MWS A;  4WNN B;  4EQI A;  3M2K A;  2OLU A;  3W4O A;  3AZH C;  5B0Z C;  4PM5 A;  4LV0 A;  4KUD B;  5FI7 A;  1QME A;  2BYK A;  1LL5 A;  3MGP A;  2PYO D;  4A5R A;  3ZNT A;  4UUZ A;  3REH B;  2NQB C;  2EX2 A;  1U35 C;  5BS7 A;  1DY6 A;  3ITB A;  1FSY A;  4RX3 A;  1KVM A;  3JYI A;  4G92 B;  3B6F C;  4DE0 A;  4Z9Q A;  3AN2 C;  2JBF A;  1ES4 A;  3AZG D;  4N92 A;  3REK B;  1XP4 A;  3AZH A;  2WAD A;  3Q82 A;  2HPB A;  3AZG C;  3L28 A;  1HQ3 B;  1KVL A;  1AXB A;  5BOH A;  4UAA A;  1XKZ A;  3UTA C;  4DKI A;  5AV9 D;  2FJ7 D;  3NCK A;  2Q9M A;  4JPM A;  2EX6 A;  1TZY C;  1ZLA A;  1ESU A;  3AZN D;  4ID4 A;  3IXH A;  1E4D A;  3VFH A;  3UT9 B;  1FCO A;  1G6A A;  3AZH D;  1AOI A;  4F94 A;  3REL A;  4MBF A;  5AV6 D;  3GR2 A;  1ID3 D;  3MVD C;  1ZKJ A;  5AV5 C;  3NI9 A;  4BL2 A;  1P3O A;  1H8Y A;  4RYE A;  3X1U A;  1S6R A;  4MBH A;  1TVF A;  1FCN A;  4Z66 C;  4KG6 A;  4JKT A;  1TZY A;  1ZLA C;  2PBY A;  1W5D A;  3AV2 D;  3LO7 A;  2J8P A;  5F99 B;  3REH A;  4S2N A;  3REI A;  2ZY3 A;  4UPK A;  4DDY A;  3MZD A;  3X1V C;  1TZY B;  1SCW A;  4J8U D;  3B6G A;  3WTP C;  2JSS A;  4IBJ A;  1LI9 A;  2YFV A;  4JLF A;  4OP8 A;  5AQ7 A;  5FQI A;  3ITA A;  4N1X A;  5F1F A;  5B24 D;  1P3B C;  1JFI B;  5F99 A;  3AV2 C;  1IEL A;  3W99 B;  2QPN A;  5GT3 C;  3CG5 A;  1PI4 A;  1BUE A;  3AGD A;  4J8V D;  4GH9 A;  2XFS A;  3E2K A;  5B2J A;  4ZDX A;  5AV5 A;  2W8S A;  1N9B A;  4NZ5 A;  4DF6 A;  1CK3 A;  3N8R A;  3AZK C;  1P34 D;  4KUD A;  3AZF B;  5GXQ A;  3AZF D;  4DRA A;  1BFM A;  4WU8 A;  3G31 A;  3UY6 A;  1ONG A;  5CPJ D;  4KQR A;  1TDL A;  2CWE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...