The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
7
|
sequence length |
60
|
structure length |
60
|
Chain Sequence |
SWMSTVGGNSGGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQG
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Hydrolase
|
source organism |
Homo sapiens
|
publication title |
Gelatin-binding region of human matrix metalloproteinase-2: solution structure, dynamics, and function of the COL-23 two-domain construct.
pubmed doi rcsb |
molecule keywords |
MATRIX METALLOPROTEINASE 2
|
total genus |
7
|
structure length |
60
|
sequence length |
60
|
ec nomenclature |
ec
3.4.24.24: Gelatinase A. |
pdb deposition date | 2001-05-17 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00040 | fn2 | Fibronectin type II domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Ribbon | Seminal Fluid Protein PDC-109 (Domain B) | Fibronectin, type II, collagen-binding |
#chains in the Genus database with same CATH superfamily 2FN2 A; 2V5O A; 1CXW A; 1J7M A; 1EAK A; 1QO6 A; 3M7P A; 1KS0 A; 1H8P A; 1PDC A; 1L6J A; 3MQL A; 1E88 A; 1E8B A; 1CK7 A; 1GXD A; #chains in the Genus database with same CATH topology 2V5O A; 3N3F A; 2Y2N A; 3M7P A; 2RTS A; 4MB4 A; 4OJO A; 4Z2I A; 3WX7 A; 3L2A A; 1OGB A; 1E6R A; 1E6N A; 2FFF B; 3L29 A; 3KS4 A; 1GOI A; 1CK7 A; 3HON A; 1W1T A; 1ED7 A; 1YU1 A; 1YU2 A; 4GHA A; 4OJ6 A; 1AIW A; 3HSH A; 4IBE A; 1YU0 A; 1UR9 A; 1O6I A; 2Y2L A; 4NZ3 A; 3MQL A; 4IJE A; 4IBI A; 1L6J A; 1H0G A; 3L27 A; 1J7M A; 2JE5 A; 3WD3 A; 2JCH A; 2UWX A; 4Z2K A; 1GXD A; 4MB3 A; 4Z2J A; 4QNL A; 3WD0 A; 2Y2Q A; 3WD2 A; 4Z2G A; 4MB5 A; 1W1V A; 3L26 A; 4IBJ A; 2Y2O A; 4IBG A; 2Y2M A; 1CXW A; 1KS0 A; 4HME A; 4IBB A; 1PDC A; 2Y2H A; 1E8B A; 2Y2K A; 3KS8 A; 1YU3 A; 4IBK A; 1E15 A; 4NYU A; 3L25 A; 1YU4 A; 4NY2 A; 1H8P A; 4LG2 A; 4Z2L A; 4IJF A; 4GHL A; 4NZ4 A; 4TX8 A; 4OUI A; 1E6P A; 4GH9 A; 2XD1 A; 1W1Y A; 1EAK A; 4Z2H A; 1H0I A; 4NZ1 A; 3L28 A; 2Y2P A; 2D49 A; 3FKE A; 4OJ5 A; 2XD5 A; 4HMC A; 1GPF A; 2IOU A; 2FN2 A; 1W1P A; 1QO6 A; 3WD4 A; 5BPV A; 2Y2I A; 4OJL A; 4NYY A; 4IBD A; 1OGG A; 1UR8 A; 3WD1 A; 2Y2G A; 1E88 A; 1YUE A; 2Y2J A; 4HMD A; 2BG1 A; 4NZ5 A; 4OJP A; 4IBC A; 4IBF A; 1E6Z A; #chains in the Genus database with same CATH homology 2FN2 A; 2V5O A; 1CXW A; 1J7M A; 1EAK A; 1QO6 A; 3M7P A; 1KS0 A; 1H8P A; 1PDC A; 1L6J A; 3MQL A; 1E88 A; 1E8B A; 1CK7 A; 1GXD A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...