1J7MA

The third fibronectin type ii module from human matrix metalloproteinase 2
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
60
structure length
60
Chain Sequence
SWMSTVGGNSGGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MATRIX METALLOPROTEINASE 2
publication title Gelatin-binding region of human matrix metalloproteinase-2: solution structure, dynamics, and function of the COL-23 two-domain construct.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 7
structure length 60
sequence length 60
ec nomenclature ec 3.4.24.24: Gelatinase A.
pdb deposition date 2001-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00040 fn2 Fibronectin type II domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.10 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Fibronectin, type II, collagen-binding 1j7mA00
2FN2A 1GXDA 2V5OA 1E88A 1CXWA 1E8BA 1CK7A 1H8PA 1L6JA 3MQLA 1KS0A 1EAKA 1J7MA 1QO6A 3M7PA 1PDCA
chains in the Genus database with same CATH superfamily
4MB3A 4MB5A 2XD5A 3KS4A 2XD1A 4NYYA 1L6JA 3MQLA 1YU3A 1KS0A 4Z2GA 2Y2QA 1E88A 1W1YA 4GH9A 5BPVA 1H0GA 2FFFB 4NZ5A 4IBEA 1OGBA 2FN2A 2JE5A 3L29A 4Z2KA 1E6ZA 3KS8A 4GHLA 1PDCA 1GXDA 2V5OA 2IOUA 1GOIA 1O6IA 4Z2HA 1YUEA 4OUIA 4OJOA 4IBCA 2Y2GA 3HONA 4LG2A 3WD4A 2RTSA 2Y2LA 2Y2KA 3L2AA 4OJ6A 1W1TA 2Y2PA 3N3FA 1ED7A 4NY2A 4NZ4A 3HSHA 1UR9A 4HMDA 2Y2MA 3WX7A 2Y2OA 4MB4A 1AIWA 1YU0A 1E6RA 2BG1A 4IJEA 1E6PA 1W1PA 1EAKA 4NYUA 2D49A 4Z2IA 3WD0A 2JCHA 3WD2A 3WD3A 1J7MA 1E15A 1YU2A 1OGGA 1UR8A 4HMEA 4IBIA 4IBBA 3L26A 2Y2JA 4NZ3A 4Z2LA 4QNLA 4OJPA 3M7PA 4IBKA 1YU1A 1H0IA 1YU4A 3FKEA 1W1VA 3L28A 4HMCA 2Y2NA 1GPFA 1CXWA 4OJLA 4IBJA 4GHAA 3L27A 4OJ5A 2Y2IA 1CK7A 1H8PA 4IBFA 2Y2HA 4IBGA 4IJFA 3L25A 1E6NA 4NZ1A 1E8BA 4Z2JA 2UWXA 3WD1A 4IBDA 1QO6A 4TX8A
chains in the Genus database with same CATH topology
2FN2A 1GXDA 2V5OA 1E88A 1CXWA 1E8BA 1CK7A 1H8PA 1L6JA 3MQLA 1KS0A 1EAKA 1J7MA 1QO6A 3M7PA 1PDCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FN2 A;  1GXD A;  2V5O A;  1E88 A;  1CXW A;  1E8B A;  1CK7 A;  1H8P A;  1L6J A;  3MQL A;  1KS0 A;  1EAK A;  1J7M A;  1QO6 A;  3M7P A;  1PDC A; 
#chains in the Genus database with same CATH topology
 4MB3 A;  4MB5 A;  2XD5 A;  3KS4 A;  2XD1 A;  4NYY A;  1L6J A;  3MQL A;  1YU3 A;  1KS0 A;  4Z2G A;  2Y2Q A;  1E88 A;  1W1Y A;  4GH9 A;  5BPV A;  1H0G A;  2FFF B;  4NZ5 A;  4IBE A;  1OGB A;  2FN2 A;  2JE5 A;  3L29 A;  4Z2K A;  1E6Z A;  3KS8 A;  4GHL A;  1PDC A;  1GXD A;  2V5O A;  2IOU A;  1GOI A;  1O6I A;  4Z2H A;  1YUE A;  4OUI A;  4OJO A;  4IBC A;  2Y2G A;  3HON A;  4LG2 A;  3WD4 A;  2RTS A;  2Y2L A;  2Y2K A;  3L2A A;  4OJ6 A;  1W1T A;  2Y2P A;  3N3F A;  1ED7 A;  4NY2 A;  4NZ4 A;  3HSH A;  1UR9 A;  4HMD A;  2Y2M A;  3WX7 A;  2Y2O A;  4MB4 A;  1AIW A;  1YU0 A;  1E6R A;  2BG1 A;  4IJE A;  1E6P A;  1W1P A;  1EAK A;  4NYU A;  2D49 A;  4Z2I A;  3WD0 A;  2JCH A;  3WD2 A;  3WD3 A;  1J7M A;  1E15 A;  1YU2 A;  1OGG A;  1UR8 A;  4HME A;  4IBI A;  4IBB A;  3L26 A;  2Y2J A;  4NZ3 A;  4Z2L A;  4QNL A;  4OJP A;  3M7P A;  4IBK A;  1YU1 A;  1H0I A;  1YU4 A;  3FKE A;  1W1V A;  3L28 A;  4HMC A;  2Y2N A;  1GPF A;  1CXW A;  4OJL A;  4IBJ A;  4GHA A;  3L27 A;  4OJ5 A;  2Y2I A;  1CK7 A;  1H8P A;  4IBF A;  2Y2H A;  4IBG A;  4IJF A;  3L25 A;  1E6N A;  4NZ1 A;  1E8B A;  4Z2J A;  2UWX A;  3WD1 A;  4IBD A;  1QO6 A;  4TX8 A; 
#chains in the Genus database with same CATH homology
 2FN2 A;  1GXD A;  2V5O A;  1E88 A;  1CXW A;  1E8B A;  1CK7 A;  1H8P A;  1L6J A;  3MQL A;  1KS0 A;  1EAK A;  1J7M A;  1QO6 A;  3M7P A;  1PDC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...