4IBEA

Ebola virus vp35 bound to small molecule
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
123
structure length
123
Chain Sequence
DISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title In Silico Derived Small Molecules Bind the Filovirus VP35 Protein and Inhibit Its Polymerase Cofactor Activity.
pubmed doi rcsb
source organism Ebola virus
molecule tags Transcription/transcription inhibitor
molecule keywords Polymerase cofactor VP35
total genus 42
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ibeA01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4ibeA02
4IBGA 3L27A 3L26A 4IBFA 4GH9A 3L28A 3KS4A 4GHAA 4IBEA 4IBIA 3L29A 4LG2A 4GHLA 4IBJA 4IBDA 4IBBA 4IBKA 3L2AA 3KS8A 4IJEA 4IBCA 4IJFA 5BPVA 3FKEA 3L25A
chains in the Genus database with same CATH superfamily
1PJSA 3TPZA 1HNZM 5EP1A 2FFFB 4G4NA 1QUSA 1QDRA 2VQEM 2GNOA 2JP7A 3SHFA 5C18A 5KQDA 3Q8GA 3WHKA 3GPPA 3U5ZB 5ITYA 2KEBA 1IN8A 2DENA 4B7HA 5EXTA 2HWJA 3MHVC 3J7AS 1QZMA 4GEWA 3PNYA 4QOZC 4GITA 4WP2A 2QENA 4LG2A 1W5TA 2XLJA 1E6ZA 1L2BA 4B3MM 3Q8XA 1E6RA 4AZFA 2J7OA 2JCHA 4JXJA 1OQYA 3TE6A 3HU3A 4UN2B 4TUWA 3DOAA 4JI2M 4LCBA 3FUWA 3LVVA 2Z7JA 5EXXA 4BLCA 1PM5A 2CEAA 4HMDA 2LXEA 4G4OA 2O25A 1HT1E 3K9PA 3U6QA 2KZUA 3SYLA 3TQSA 1YU0A 1IXZA 2XFSA 1TF0B 2Q2EB 2J5YA 3ZCBB 1T6OA 3KOZE 1L6JA 1Z6TA 1HQCA 3HZJA 2UWXA 2Z8YM 3FUTA 2NQ8C 4X62M 1DGGA 1QDTA 3ILKA 4IBEA 5DNYA 1G4AE 3ZC7B 4W5WA 4NSOB 2UUBM 4Z2IA 3LCUA 2VIIA 3LMMA 4IBBA 5E26A 4BB9A 2FFJA 3VKHA 3N3FA 4LF4M 1EAKA 1N33M 1Z5CA 2FNAA 4LZJA 1L8QA 2KRKA 3VFDA 3GQ4A 1IBMM 3T6PA 2BNKA 1G59A 2FE8A 1H0GA 3V76A 3FTFA 4IIWA 3AFHA 1NV9A 3FD9A 3FUVA 5DYIA 4Z2HA 1Q3BA 1QAMA 4LZZA 1MX0A 1IN5A 1ZQ9A 1CXWA 2LVQD 4QOSA 2LTUA 2F5SA 2O01F 1PGYA 4OVZB 1OAIA 3L28A 3LCVB 4LJAA 3W68A 1AIPC 4ANRA 3HJQA 1YUBA 4GRIA 1IBLM 4G3OA 2CHQA 1SXJD 2LWXA 4RF1A 1Q3CA 1HT2E 4JV5M 4HLQA 4HL4A 2KA6B 5A2QS 4D80A 2V5OA 4NZ5A 3FYDA 2OPFA 1A5TA 2W82A 4DBGB 1YU2A 1HJPA 2DKLA 1WHCA 2ZANA 2Y2JA 2UU9M 4LF7M 2UXBM 4YY3M 2DWNA 2ZM6M 3AJIB 1IXSA 4OUIA 3WD3A 3LQQA 4L6V6 2H1RA 1KSFX 3RGSA 1ZMUA 5LMNM 3SAWA 2R18A 3VK8A 2KXEA 2R6FA 3J81S 2RGHA 3I4YA 5IREB 2O5RA 1NNJA 4DR4M 2OOAA 4IBGA 3U60B 1IFYA 2KZSA 4FWDA 4MB4A 1ZMVA 2JWSA 2CFOA 1SXJC 5EP2A 4G4RA 2YFQA 3SASA 4Z2LA 4L78A 4MGKE 3KOWE 3GLFB 1GLNA 3VLFB 1Y8GA 4WURA 4DUZM 4NYYA 1IXRC 3TWMA 3FRHA 4DR2M 2DWMA 4DV0M 3U6EA 1TH4A 3GLFE 2XSZA 1W1YA 4NXMM 1GJTA 2QZ4A 3GP1A 2MROB 3W67A 2BJWA 4PDGA 3UK6A 3H4MA 4L8RC 2X8AA 1NY6A 2QQ8A 5KO3A 3CF0A 4JI7M 3C9PA 3GRYA 2Y0QA 3HJ8A 1WR1B 4IBKA 2YQZA 3SMSA 4D82A 5KPZA 2JNHA 4NL4H 3KS8A 1NHGC 1DGHB 5JI3E 1GKIA 4IJFA 3VDUA 5BPVA 2XH9A 1GVNA 4NZ4A 4AI6A 1QQWA 3HGIA 3L26A 4IBFA 3FTCA 1OIPA 2R45A 2LNHC 3U61A 4M0DA 2G8LA 3DA1A 1K82A 3GLGA 1XWIA 4RKUF 4IBIA 5ITUA 1TGUA 3E46A 1PJIA 2K6BA 4Z2KA 3SARA 4REZA 5FTLA 3GPXA 3J27B 2L4FA 2X49A 2VDBB 3GLFA 1WXQA 1FJGM 4DR6M 1EIJA 1YU3A 4DV1M 4F2LA 2ZTCA 4B7FA 3B89A 1MJGM 1NY5A 3MK6A 2C5RA 4LF8M 1UR9A 3B7NA 1W1PA 2XFTA 2DAMA 1OIZA 4LJ5A 3GRUA 3J7BA 1E9SA 2Y0TA 3L25A 2ZAMA 1GL6A 4NRVA 1LTMA 1UM8A 1XXHB 2LVAA 3KP0E 1GABA 1XC8A 1KS0A 2R4JA 4MB7A 2L4EA 3U6PA 4OJPA 2C9CA 1G3IA 4XGIA 4CJ6A 2MH8A 4DV7M 1T43A 2KNAA 3T1YM 3D8LA 5LMUM 2B3TA 1FNNA 5EJCA 2CV2A 1VDDA 1TDHA 3FUUA 1HQYE 3A45A 4FVMA 4LJ8A 1DGFA 2K47A 4AKHA 2I7NA 2Y2MA 2DAIA 2LVOC 3SAUA 3HY5A 2ZBKB 2JY6B 4LFBM 2D7HA 1E6PA 3WD0A 2R44A 2UUCM 1N32M 1J09A 1OFIA 2Y21A 2C96A 4LRSA 1Q02A 4HMCA 2DZNB 1N36M 1OAOC 1J7KA 1JR3E 4AW4A 2EA0A 4G4QA 2E5LM 4LF9M 1SG9A 4R71A 4FCWA 3H4JA 1N78A 2EO2A 3W0FA 4DV4M 2Y2KA 2P5TA 2M5ZA 2OOBA 4DR1M 1ED7A 2JY5A 1JB0F 3U6CA 1L2DA 1GPFA 1ZAEA 2JY8A 2ZAOA 3QWLA 3UMMA 5KPTA 1UR8A 2RKOA 2QBYB 2LVPC 3B74A 2QPAA 1GXDA 1KYIA 4NC6A 3A98B 2JZ0A 1TR8A 1W5SA 4HMEA 3LQRA 3L2AA 4WW0A 5ITXE 1DO0A 4DR5M 3CF2A 1PJQA 1E94E 3M6AA 4I81A 2LHGA 4LJ9A 4DUYM 1Z5BA 1X37A 2YR0A 4S12A 1R2ZA 1PDCA 5EQTA 5FTMA 2L7HA 1VEKA 4GMQA 2CV0A 2LHCA 2YNMD 4Z2GA 3PXGA 1AUAA 2KNVA 2LH0A 2V1CA 4XK8F 2J7NA 3HX3A 1YLAA 2L6OA 2CUZA 1QO6A 1YU4A 1D0MA 1G71A 5H37D 4AQYM 1R4GA 3GQ5A 3CTWB 2DXIA 1I94M 1GOIA 4OU7A 3KP1E 1YUEA 1N75A 2V6ZM 1K3XA 4JI5M 1MU5A 1K3WA 2DWZB 1C7YA 4D81A 4LFAM 4X64M 5F3WA 2G3QA 3AV0A 3U6SA 2IOUA 3SFZA 4NY2A 2RTSA 4I4LA 2XGNA 3A42A 1G41A 2HL7A 4FWHA 5C1BA 1L1ZA 4OW0A 2F4VM 4MM3B 2FS1A 4R3DA 4GKKM 2LBCA 3F92A 3GPYA 3KOYE 3TWKA 2GQFA 1WJ7A 2R62A 2C9OA 2KDLA 1J7MA 1OFHA 4DV6M 4NYUA 1V33A 1SXJA 2UXDM 2Y2IA 3K1JA 1E9RA 2V1UA 1IY0A 3U6LA 3KXEC 1N34M 1OGBA 4NZ3A 4LY6A 1NO1A 3BOSA 3HHYA 4KO8A 1NV8A 1XMQM 2F5QA 2A5YB 1ZV1A 1WGNA 2HCBA 2HKJA 4NSRA 3RGPA 2QSFX 2Y2OA 4MGYE 1QAOA 3C3EA 1D0KA 1TH2A 3JR4A 7CATA 4L16A 4M9ZA 1GJSA 4X66M 4EIWA 2AHMA 3GLIA 2CHGA 2FOIC 4QHSA 2Y2HA 1TDZA 5FSWA 1WIVA 3GLHA 2UUAM 1JR3D 4M9XA 2XZFA 1P3QQ 3BXWA 2Y2NA 4QHTA 4JI8M 1XXHE 4IBCA 2XD5A 2F5NA 2HHHM 3K2LA 3PNVA 4M9SA 4AKIA 4QNRA 1Q39A 3UJNA 3K9OA 3GLIB 3RE8A 4B7GA 5ITRA 2DHRA 2XZUA 3WHLA 2UXCM 3KFUG 1O6IA 3VDPA 1IN4A 2KW0A 5FLXS 1E8BA 2Y2PA 2WSCF 4B3RM 3HSHA 2DAEA 2WSFF 4LJ7A 1MN3A 2DVWB 2EJSA 1VDLA 1EE8A 2DAKA 3C3DA 4II7A 2QNJA 5EP4A 3SMPA 4A3VB 2QCUA 4AKGA 3DZDA 5IZ7D 4DV3M 1PJJA 1XMOM 4MGHA 1QANA 4GHLA 5EP3A 1TTEA 1Z5AA 2JXNA 1NJGA 4FWGA 3U60A 3KW6A 5EXSA 2QP9X 3W0LB 4MH0E 3GLHB 4PDIA 3R8FA 1IBKM 1W1VA 3AKZA 1R5LA 2D7EA 2DZOB 5EXPA 1V92A 3THGA 2CE7A 1YSYA 5ITQA 1DGHA 3HHZA 5KPRA 1HNXM 3AOGA 4CHTB 1YU1A 2G5GX 3U6MA 2D7GA 3WD1A 3WX7A 1D0LA 4LJ6A 5L8RF 3FYCA 2BWEA 1T3TA 2K9DA 4ZPXA 1NJFA 2VQFM 2Y2GA 4OVZA 4CGYB 3GPUA 3QYEA 4GIPA 2JUJA 4IBDA 4GKJM 4QNLA 1IM2A 3SC3A 2VF8A 1IQPA 2Y2QA 1F4IA 1YE9A 4Q7JA 1IY2A 3M0EA 2JZ1A 2KHHA 2EKFA 2L2DA 1EFUB 3C58A 1HNWM 2MR9A 4LF5M 3U6OA 3E9SA 1SXJB 2JE5A 1PRBA 3TL4X 3E21A 3GLGB 1XHBA 3EIHA 1XB2B 2L7IA 2VF7A 3PVSA 4I5SA 3QYBA 1IXSB 1SXJE 4CISA 4OJ5A 2DNAA 2RRUA 3B9PA 3LW5F 1QUTA 5GKNA 4OX9M 4JYAM 1TH3A 3UZUA 3NBIA 4Y28F 2Y2LA 3R9XB 2DAGA 2EUCA 2QHOB 3IECA 1OJLA 4K0KM 2Z3XA 4RF0A 4IBJA 4XBOA 4L4UA 1S3SA 4QNMA 4OJOA 4PCZA 3M7PA 2F5OA 3CF6E 3HHWA 3U6DA 1IN6A 3K8ZA 1L1TA 4MB5A 2APLA 2WSEF 3AOEC 2R0IA 3T38A 1NNUC 4DR3M 4GC5A 2XSZD 1XNRM 2BJVA 4Z6YA 2XF3A 4L15A 1OKSA 4MGIE 1H6UA 3NWLA 3U61B 4CIZA 2LVNC 3GO8A 3L27A 3B7ZA 4X65M 2X4AA 3IG5A 4JI0M 4FCTA 2XEPA 4R7GA 4FD2A 3TWLA 1Z59A 1QYRA 3KSJA 1R7RA 3I51A 3MMPA 3VKGA 3HU1A 3WD4A 1IY1A 3B7QA 5ITXA 4NZ1A 4DV2M 1HR0M 1QAQA 1V34A 1R2YA 4HEOA 3U5ZA 1QVRA 1R6BX 1XNQM 5IT9S 3JAMS 3T1HM 4MB3A 5BR8M 1J5EM 2ZTDA 2CV1A 3GRVA 1KFVA 4IJEA 1OGGA 2KNZA 1WGLA 3HKPA 1VEGA 4KODA 5JI2E 3MQLA 4B08A 1N77A 2D49A 2CP8A 4GH9A 2FH0A 3KS4A 4GC9A 3HONA 4KHPM 1H0IA 1GL7A 3J80S 1BVSA 1JQJC 2C99A 4LRTA 8CATA 3UGJA 2K0BX 4LGYA 5IWAM 4B3TM 2ERCA 3FTDA 4JN6A 2OO9A 4M0WA 4NOOB 3GQ3A 3I4VA 5FTKA 2DZLA 4Z8XA 2M60A 2L09A 5DYGA 3A46A 2XD1A 3SBJA 4KT0F 4OJLA 1AIWA 1JR3A 3BBZA 3WD2A 2N35A 3KDSE 3NBXX 3FE3A 3GLHE 4P16A 2H5XA 5ITTA 1W1TA 2CRUA 3VK7A 3HWSA 1D2NA 2Z4SA 2KRUA 1I4WA 4LF6M 1DGBA 1L2CA 4NXNM 3KVWA 4FW9A 2OQ4A 3AL0C 3IHPA 3I04M 3MJ5A 2BG1A 5E6JA 2WZJA 3SAVA 4ITQA 1IN7A 3JR5A 2HAKA 4JI3M 4LFCM 3HJSA 1NVMA 3GLIE 4GHAA 1VG5A 4G6ZA 4FCVA 5FTNA 2R46A 1C1KA 1E32A 3E4RA 3IG8A 3GRRA 3L29A 4LGMA 4MGZE 4NRWA 2DWLA 3T15A 3PFIA 2I7PA 3OTOM 4DR7M 1VQ1A 1G8PA 1E15A 3LVWA 1UFZA 3I01M 1H8PA 2R4EA 3D8BA 3SATA 3J2PB 3ZQJA 4YHHM 3RFWA 4JI6M 2Z4RA 3HU2A 2MJ5B 1RU3A 2JY7A 1CUKA 3KSXA 1DO2A 3M7GA 3SYKA 3GLGE 2QBYA 4KLNA 1QZEA 2C98A 3FKEA 1GO5A 1E6NA 1NHWC 3HHXA 4I8OA 2DHYA 1LV7A 5KQ8A 1DV0A 1XXHA 2DI0A 1CK7A 4AG5A 2R65A 1ORYB 4DV5M 1VEJA 4PT5A 5FTJA 1ZMWA 4TX8A 3ZH9B 2MGWA 1PJTA 3QAUA 2EKKA 2Y20A 2CWBA 1OTRA 4LJ4A 2CHVA 3SHGB 3AOEA 3K92A 5DFLA 4AG6A 4Z2JA 4PD2A 2F5PA 1NSFA 2BWBA 4P17A 3FUXA 4B3SM 3FTEA 3FRIA 3DFZA 2JA2A 2RGOA 4RNAA 4F1IA 4BBAA 4OJ6A 1E88A 3EIEA 3CGWA 4JI1M 3KOXE 4JI4M 2FN2A
chains in the Genus database with same CATH topology
3TPZA 1HNZM 2FFFB 5EP1A 4G4NA 2VQEM 3SHFA 5C18A 5KQDA 3WHKA 3U5ZB 3GPPA 5ITYA 2KEBA 1IN8A 4B7HA 5EXTA 3MHVC 3J7AS 1QZMA 4QOZC 3PNYA 4GITA 2QENA 4LG2A 1W5TA 2XLJA 1L2BA 4B3MM 3Q8XA 4AZFA 2J7OA 2JCHA 4JXJA 3HU3A 4TUWA 3DOAA 4JI2M 4LCBA 3FUWA 3LVVA 2Z7JA 5EXXA 4BLCA 1PM5A 2CEAA 2LXEA 4G4OA 1HT1E 3U6QA 2KZUA 3SYLA 3TQSA 1YU0A 1IXZA 2XFSA 2Q2EB 3ZCBB 3KOZE 1Z6TA 1HQCA 2UWXA 3FUTA 2NQ8C 4X62M 1DGGA 3ILKA 4IBEA 5DNYA 1G4AE 3ZC7B 4W5WA 4NSOB 2UUBM 2VIIA 3LMMA 4IBBA 5E26A 4BB9A 2FFJA 3VKHA 3N3FA 4LF4M 1N33M 1Z5CA 2FNAA 4LZJA 1L8QA 2KRKA 3VFDA 3GQ4A 1IBMM 2BNKA 1G59A 2FE8A 3FTFA 4IIWA 3AFHA 3FD9A 3FUVA 5DYIA 1Q3BA 1QAMA 4LZZA 1MX0A 1IN5A 1ZQ9A 4QOSA 2F5SA 4OVZB 4LJAA 3L28A 3HJQA 1YUBA 4GRIA 1IBLM 2CHQA 1SXJD 2LWXA 4RF1A 1Q3CA 1HT2E 4JV5M 4HLQA 4HL4A 2KA6B 5A2QS 4D80A 4NZ5A 3FYDA 2OPFA 2W82A 1YU2A 2ZANA 2Y2JA 2UU9M 4LF7M 2UXBM 4YY3M 2DWNA 2ZM6M 3AJIB 4OUIA 3LQQA 2H1RA 1KSFX 3RGSA 5LMNM 3SAWA 3VK8A 2R18A 2KXEA 3J81S 3I4YA 2RGHA 5IREB 2O5RA 1NNJA 4DR4M 4IBGA 3U60B 2KZSA 4FWDA 2CFOA 1SXJC 5EP2A 4G4RA 2YFQA 3SASA 4L78A 4MGKE 3KOWE 3GLFB 1GLNA 3VLFB 4NYYA 4WURA 4DUZM 1IXRC 3TWMA 2DWMA 4DV0M 3U6EA 1TH4A 2XSZA 4NXMM 2QZ4A 3GP1A 2BJWA 4PDGA 3UK6A 3H4MA 4L8RC 2X8AA 1NY6A 4JI7M 5KO3A 3CF0A 3GRYA 2Y0QA 3HJ8A 4IBKA 4DR2M 2YQZA 3SMSA 4D82A 5KPZA 4NL4H 3KS8A 1NHGC 1DGHB 5JI3E 1GKIA 4IJFA 3VDUA 5BPVA 2XH9A 1GVNA 4AI6A 1QQWA 3HGIA 3L26A 4IBFA 3FTCA 2R45A 2LNHC 3U61A 4M0DA 2G8LA 3DA1A 1K82A 3GLGA 1XWIA 4IBIA 5ITUA 1TGUA 1PJIA 3SARA 4REZA 5FTLA 3GPXA 3J27B 4DR6M 2X49A 3GLFA 1FJGM 1WXQA 1YU3A 4DV1M 4B7FA 3MK6A 1NY5A 2C5RA 4LF8M 2XFTA 4LJ5A 3GRUA 3J7BA 1E9SA 2Y0TA 3L25A 2ZAMA 1GL6A 4NRVA 1XXHB 1UM8A 3KP0E 1XC8A 2R4JA 4MB7A 3U6PA 4OJPA 2C9CA 1G3IA 4XGIA 4DV7M 3T1YM 3D8LA 5LMUM 1FNNA 5EJCA 2CV2A 1VDDA 1TDHA 3FUUA 1HQYE 3A45A 4FVMA 4LJ8A 1DGFA 2K47A 4AKHA 2I7NA 2Y2MA 3SAUA 2ZBKB 4LFBM 2D7HA 2UUCM 1N32M 1J09A 1OFIA 2Y21A 2C96A 4LRSA 2DZNB 1N36M 1J7KA 4G4QA 4AW4A 2EA0A 4LF9M 2E5LM 4FCWA 1N78A 2EO2A 3W0FA 4DV4M 2Y2KA 2M5ZA 2P5TA 4DR1M 3U6CA 1L2DA 1ZAEA 2ZAOA 3QWLA 3UMMA 5KPTA 2RKOA 2QBYB 2QPAA 1KYIA 3A98B 1W5SA 3LQRA 3L2AA 4WW0A 5ITXE 1DO0A 4DR5M 3CF2A 1E94E 3M6AA 4I81A 4LJ9A 4DUYM 1Z5BA 1X37A 2YR0A 4S12A 1R2ZA 5EQTA 5FTMA 2L7HA 4GMQA 2CV0A 2YNMD 3PXGA 2LH0A 2V1CA 2J7NA 2L6OA 2CUZA 1YU4A 5H37D 4AQYM 3GQ5A 3CTWB 2DXIA 1I94M 1YUEA 4OU7A 3KP1E 1N75A 2V6ZM 1K3XA 4JI5M 1MU5A 1K3WA 2DWZB 4D81A 4LFAM 4X64M 5F3WA 3AV0A 3U6SA 2IOUA 3SFZA 4NY2A 4I4LA 4FWHA 2XGNA 1G41A 2HL7A 3A42A 5C1BA 1L1ZA 4OW0A 2F4VM 4MM3B 4R3DA 4GKKM 3GPYA 3KOYE 3TWKA 2R62A 2C9OA 1OFHA 4DV6M 4NYUA 1SXJA 2UXDM 2Y2IA 3K1JA 1E9RA 2V1UA 1IY0A 3U6LA 3KXEC 1N34M 4NZ3A 4LY6A 3BOSA 3HHYA 4KO8A 1XMQM 2F5QA 2A5YB 2HCBA 2HKJA 4NSRA 3RGPA 2Y2OA 4MGYE 1QAOA 1TH2A 3JR4A 7CATA 4L16A 4M9ZA 4X66M 4EIWA 2AHMA 3GLIA 2CHGA 2FOIC 4QHSA 1TDZA 3GLHA 2UUAM 1JR3D 4M9XA 2XZFA 2Y2NA 4QHTA 4JI8M 4IBCA 2XD5A 2F5NA 2HHHM 3K2LA 3PNVA 4M9SA 4AKIA 4QNRA 1Q39A 3UJNA 3GLIB 3RE8A 4B7GA 5ITRA 2DHRA 2XZUA 2UXCM 3KFUG 3VDPA 1IN4A 2KW0A 5FLXS 2Y2PA 3HSHA 4B3RM 4NZ4A 4LJ7A 3WHLA 2DVWB 3SMPA 4II7A 3TE6A 1EE8A 5FSWA 4AKGA 2Y2HA 5EP4A 4A3VB 2QCUA 3DZDA 5IZ7D 4DV3M 1PJJA 1XMOM 4MGHA 1QANA 4GHLA 5EP3A 1Z5AA 1NJGA 4FWGA 3U60A 3KW6A 5EXSA 2QP9X 3W0LB 4MH0E 3GLHB 4PDIA 3R8FA 1IBKM 3AKZA 2D7EA 2DZOB 5EXPA 3THGA 2CE7A 1YSYA 5ITQA 1DGHA 3HHZA 5KPRA 1HNXM 3AOGA 4CHTB 1YU1A 2G5GX 3U6MA 2D7GA 3WX7A 4LJ6A 3FYCA 1T3TA 4ZPXA 1NJFA 2VQFM 2Y2GA 4OVZA 4CGYB 3GPUA 4GIPA 4IBDA 4GKJM 4QNLA 1IM2A 3SC3A 1IQPA 2Y2QA 1YE9A 1IY2A 3M0EA 3C58A 1HNWM 4LF5M 3U6OA 3E9SA 1SXJB 2JE5A 3TL4X 3GLGB 1XHBA 3EIHA 3PVSA 2L7IA 4I5SA 1IXSB 1SXJE 4CISA 4OJ5A 3B9PA 5GKNA 4OX9M 4JYAM 1TH3A 3UZUA 3NBIA 2Y2LA 3R9XB 2EUCA 1OJLA 4K0KM 2Z3XA 4RF0A 4IBJA 4XBOA 4L4UA 1S3SA 4QNMA 4OJOA 4PCZA 2F5OA 3CF6E 3HHWA 3U6DA 1IN6A 3K8ZA 1L1TA 3AOEC 3T38A 1NNUC 4DR3M 4GC5A 2XSZD 1XNRM 2BJVA 4Z6YA 2XF3A 4L15A 4MGIE 1H6UA 3NWLA 3U61B 3GO8A 3L27A 4X65M 2X4AA 3IG5A 4JI0M 4FCTA 2XEPA 4R7GA 4FD2A 3TWLA 1Z59A 1QYRA 3KSJA 1R7RA 3I51A 3VKGA 3HU1A 1IY1A 5ITXA 4NZ1A 4DV2M 1HR0M 1QAQA 1R2YA 3U5ZA 1QVRA 1R6BX 1XNQM 5IT9S 3JAMS 3T1HM 5BR8M 1J5EM 2CV1A 3GRVA 1KFVA 4IJEA 3HKPA 4KODA 5JI2E 4B08A 1N77A 4GH9A 3KS4A 4GC9A 3HONA 4KHPM 1GL7A 3J80S 4LRTA 1JQJC 2C99A 8CATA 3UGJA 4LGYA 5IWAM 4B3TM 2ERCA 3FTDA 4JN6A 4M0WA 4NOOB 3GQ3A 3I4VA 5FTKA 3A46A 4Z8XA 2M60A 2L09A 5DYGA 2XD1A 3SBJA 4OJLA 1JR3A 3KDSE 4P16A 5ITTA 3VK7A 3HWSA 1D2NA 2Z4SA 2KRUA 1I4WA 4LF6M 1DGBA 1L2CA 4NXNM 3KVWA 4FW9A 2OQ4A 3AL0C 3MJ5A 2BG1A 5E6JA 3SAVA 4ITQA 1IN7A 3JR5A 4JI3M 4LFCM 3HJSA 1NVMA 4GHAA 4G6ZA 4FCVA 5FTNA 2R46A 1C1KA 1E32A 3E4RA 3IG8A 3GRRA 3L29A 4LGMA 4MGZE 4NRWA 2DWLA 3T15A 3PFIA 2I7PA 3OTOM 4DR7M 1G8PA 3LVWA 2R4EA 3D8BA 3SATA 3J2PB 4JI6M 4YHHM 3RFWA 2Z4RA 3HU2A 3KSXA 3M7GA 3SYKA 1DO2A 2QBYA 4KLNA 2C98A 3FKEA 1NHWC 3HHXA 4I8OA 1LV7A 5KQ8A 1XXHA 4AG5A 2R65A 1ORYB 4DV5M 4PT5A 5FTJA 3ZH9B 3QAUA 2Y20A 4LJ4A 3SHGB 2CHVA 3AOEA 3K92A 4AG6A 4PD2A 2F5PA 1NSFA 3FUXA 4B3SM 3FTEA 3DFZA 2JA2A 2RGOA 4RNAA 4BBAA 4OJ6A 3EIEA 4JI1M 3KOXE 4JI4M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IBG A;  3L27 A;  3L26 A;  4IBF A;  4GH9 A;  3L28 A;  3KS4 A;  4GHA A;  4IBE A;  4IBI A;  3L29 A;  4LG2 A;  4GHL A;  4IBJ A;  4IBD A;  4IBB A;  4IBK A;  3L2A A;  3KS8 A;  4IJE A;  4IBC A;  4IJF A;  5BPV A;  3FKE A;  3L25 A; 
#chains in the Genus database with same CATH topology
 1PJS A;  3TPZ A;  1HNZ M;  5EP1 A;  2FFF B;  4G4N A;  1QUS A;  1QDR A;  2VQE M;  2GNO A;  2JP7 A;  3SHF A;  5C18 A;  5KQD A;  3Q8G A;  3WHK A;  3GPP A;  3U5Z B;  5ITY A;  2KEB A;  1IN8 A;  2DEN A;  4B7H A;  5EXT A;  2HWJ A;  3MHV C;  3J7A S;  1QZM A;  4GEW A;  3PNY A;  4QOZ C;  4GIT A;  4WP2 A;  2QEN A;  4LG2 A;  1W5T A;  2XLJ A;  1E6Z A;  1L2B A;  4B3M M;  3Q8X A;  1E6R A;  4AZF A;  2J7O A;  2JCH A;  4JXJ A;  1OQY A;  3TE6 A;  3HU3 A;  4UN2 B;  4TUW A;  3DOA A;  4JI2 M;  4LCB A;  3FUW A;  3LVV A;  2Z7J A;  5EXX A;  4BLC A;  1PM5 A;  2CEA A;  4HMD A;  2LXE A;  4G4O A;  2O25 A;  1HT1 E;  3K9P A;  3U6Q A;  2KZU A;  3SYL A;  3TQS A;  1YU0 A;  1IXZ A;  2XFS A;  1TF0 B;  2Q2E B;  2J5Y A;  3ZCB B;  1T6O A;  3KOZ E;  1L6J A;  1Z6T A;  1HQC A;  3HZJ A;  2UWX A;  2Z8Y M;  3FUT A;  2NQ8 C;  4X62 M;  1DGG A;  1QDT A;  3ILK A;  4IBE A;  5DNY A;  1G4A E;  3ZC7 B;  4W5W A;  4NSO B;  2UUB M;  4Z2I A;  3LCU A;  2VII A;  3LMM A;  4IBB A;  5E26 A;  4BB9 A;  2FFJ A;  3VKH A;  3N3F A;  4LF4 M;  1EAK A;  1N33 M;  1Z5C A;  2FNA A;  4LZJ A;  1L8Q A;  2KRK A;  3VFD A;  3GQ4 A;  1IBM M;  3T6P A;  2BNK A;  1G59 A;  2FE8 A;  1H0G A;  3V76 A;  3FTF A;  4IIW A;  3AFH A;  1NV9 A;  3FD9 A;  3FUV A;  5DYI A;  4Z2H A;  1Q3B A;  1QAM A;  4LZZ A;  1MX0 A;  1IN5 A;  1ZQ9 A;  1CXW A;  2LVQ D;  4QOS A;  2LTU A;  2F5S A;  2O01 F;  1PGY A;  4OVZ B;  1OAI A;  3L28 A;  3LCV B;  4LJA A;  3W68 A;  1AIP C;  4ANR A;  3HJQ A;  1YUB A;  4GRI A;  1IBL M;  4G3O A;  2CHQ A;  1SXJ D;  2LWX A;  4RF1 A;  1Q3C A;  1HT2 E;  4JV5 M;  4HLQ A;  4HL4 A;  2KA6 B;  5A2Q S;  4D80 A;  2V5O A;  4NZ5 A;  3FYD A;  2OPF A;  1A5T A;  2W82 A;  4DBG B;  1YU2 A;  1HJP A;  2DKL A;  1WHC A;  2ZAN A;  2Y2J A;  2UU9 M;  4LF7 M;  2UXB M;  4YY3 M;  2DWN A;  2ZM6 M;  3AJI B;  1IXS A;  4OUI A;  3WD3 A;  3LQQ A;  4L6V 6;  2H1R A;  1KSF X;  3RGS A;  1ZMU A;  5LMN M;  3SAW A;  2R18 A;  3VK8 A;  2KXE A;  2R6F A;  3J81 S;  2RGH A;  3I4Y A;  5IRE B;  2O5R A;  1NNJ A;  4DR4 M;  2OOA A;  4IBG A;  3U60 B;  1IFY A;  2KZS A;  4FWD A;  4MB4 A;  1ZMV A;  2JWS A;  2CFO A;  1SXJ C;  5EP2 A;  4G4R A;  2YFQ A;  3SAS A;  4Z2L A;  4L78 A;  4MGK E;  3KOW E;  3GLF B;  1GLN A;  3VLF B;  1Y8G A;  4WUR A;  4DUZ M;  4NYY A;  1IXR C;  3TWM A;  3FRH A;  4DR2 M;  2DWM A;  4DV0 M;  3U6E A;  1TH4 A;  3GLF E;  2XSZ A;  1W1Y A;  4NXM M;  1GJT A;  2QZ4 A;  3GP1 A;  2MRO B;  3W67 A;  2BJW A;  4PDG A;  3UK6 A;  3H4M A;  4L8R C;  2X8A A;  1NY6 A;  2QQ8 A;  5KO3 A;  3CF0 A;  4JI7 M;  3C9P A;  3GRY A;  2Y0Q A;  3HJ8 A;  1WR1 B;  4IBK A;  2YQZ A;  3SMS A;  4D82 A;  5KPZ A;  2JNH A;  4NL4 H;  3KS8 A;  1NHG C;  1DGH B;  5JI3 E;  1GKI A;  4IJF A;  3VDU A;  5BPV A;  2XH9 A;  1GVN A;  4NZ4 A;  4AI6 A;  1QQW A;  3HGI A;  3L26 A;  4IBF A;  3FTC A;  1OIP A;  2R45 A;  2LNH C;  3U61 A;  4M0D A;  2G8L A;  3DA1 A;  1K82 A;  3GLG A;  1XWI A;  4RKU F;  4IBI A;  5ITU A;  1TGU A;  3E46 A;  1PJI A;  2K6B A;  4Z2K A;  3SAR A;  4REZ A;  5FTL A;  3GPX A;  3J27 B;  2L4F A;  2X49 A;  2VDB B;  3GLF A;  1WXQ A;  1FJG M;  4DR6 M;  1EIJ A;  1YU3 A;  4DV1 M;  4F2L A;  2ZTC A;  4B7F A;  3B89 A;  1MJG M;  1NY5 A;  3MK6 A;  2C5R A;  4LF8 M;  1UR9 A;  3B7N A;  1W1P A;  2XFT A;  2DAM A;  1OIZ A;  4LJ5 A;  3GRU A;  3J7B A;  1E9S A;  2Y0T A;  3L25 A;  2ZAM A;  1GL6 A;  4NRV A;  1LTM A;  1UM8 A;  1XXH B;  2LVA A;  3KP0 E;  1GAB A;  1XC8 A;  1KS0 A;  2R4J A;  4MB7 A;  2L4E A;  3U6P A;  4OJP A;  2C9C A;  1G3I A;  4XGI A;  4CJ6 A;  2MH8 A;  4DV7 M;  1T43 A;  2KNA A;  3T1Y M;  3D8L A;  5LMU M;  2B3T A;  1FNN A;  5EJC A;  2CV2 A;  1VDD A;  1TDH A;  3FUU A;  1HQY E;  3A45 A;  4FVM A;  4LJ8 A;  1DGF A;  2K47 A;  4AKH A;  2I7N A;  2Y2M A;  2DAI A;  2LVO C;  3SAU A;  3HY5 A;  2ZBK B;  2JY6 B;  4LFB M;  2D7H A;  1E6P A;  3WD0 A;  2R44 A;  2UUC M;  1N32 M;  1J09 A;  1OFI A;  2Y21 A;  2C96 A;  4LRS A;  1Q02 A;  4HMC A;  2DZN B;  1N36 M;  1OAO C;  1J7K A;  1JR3 E;  4AW4 A;  2EA0 A;  4G4Q A;  2E5L M;  4LF9 M;  1SG9 A;  4R71 A;  4FCW A;  3H4J A;  1N78 A;  2EO2 A;  3W0F A;  4DV4 M;  2Y2K A;  2P5T A;  2M5Z A;  2OOB A;  4DR1 M;  1ED7 A;  2JY5 A;  1JB0 F;  3U6C A;  1L2D A;  1GPF A;  1ZAE A;  2JY8 A;  2ZAO A;  3QWL A;  3UMM A;  5KPT A;  1UR8 A;  2RKO A;  2QBY B;  2LVP C;  3B74 A;  2QPA A;  1GXD A;  1KYI A;  4NC6 A;  3A98 B;  2JZ0 A;  1TR8 A;  1W5S A;  4HME A;  3LQR A;  3L2A A;  4WW0 A;  5ITX E;  1DO0 A;  4DR5 M;  3CF2 A;  1PJQ A;  1E94 E;  3M6A A;  4I81 A;  2LHG A;  4LJ9 A;  4DUY M;  1Z5B A;  1X37 A;  2YR0 A;  4S12 A;  1R2Z A;  1PDC A;  5EQT A;  5FTM A;  2L7H A;  1VEK A;  4GMQ A;  2CV0 A;  2LHC A;  2YNM D;  4Z2G A;  3PXG A;  1AUA A;  2KNV A;  2LH0 A;  2V1C A;  4XK8 F;  2J7N A;  3HX3 A;  1YLA A;  2L6O A;  2CUZ A;  1QO6 A;  1YU4 A;  1D0M A;  1G71 A;  5H37 D;  4AQY M;  1R4G A;  3GQ5 A;  3CTW B;  2DXI A;  1I94 M;  1GOI A;  4OU7 A;  3KP1 E;  1YUE A;  1N75 A;  2V6Z M;  1K3X A;  4JI5 M;  1MU5 A;  1K3W A;  2DWZ B;  1C7Y A;  4D81 A;  4LFA M;  4X64 M;  5F3W A;  2G3Q A;  3AV0 A;  3U6S A;  2IOU A;  3SFZ A;  4NY2 A;  2RTS A;  4I4L A;  2XGN A;  3A42 A;  1G41 A;  2HL7 A;  4FWH A;  5C1B A;  1L1Z A;  4OW0 A;  2F4V M;  4MM3 B;  2FS1 A;  4R3D A;  4GKK M;  2LBC A;  3F92 A;  3GPY A;  3KOY E;  3TWK A;  2GQF A;  1WJ7 A;  2R62 A;  2C9O A;  2KDL A;  1J7M A;  1OFH A;  4DV6 M;  4NYU A;  1V33 A;  1SXJ A;  2UXD M;  2Y2I A;  3K1J A;  1E9R A;  2V1U A;  1IY0 A;  3U6L A;  3KXE C;  1N34 M;  1OGB A;  4NZ3 A;  4LY6 A;  1NO1 A;  3BOS A;  3HHY A;  4KO8 A;  1NV8 A;  1XMQ M;  2F5Q A;  2A5Y B;  1ZV1 A;  1WGN A;  2HCB A;  2HKJ A;  4NSR A;  3RGP A;  2QSF X;  2Y2O A;  4MGY E;  1QAO A;  3C3E A;  1D0K A;  1TH2 A;  3JR4 A;  7CAT A;  4L16 A;  4M9Z A;  1GJS A;  4X66 M;  4EIW A;  2AHM A;  3GLI A;  2CHG A;  2FOI C;  4QHS A;  2Y2H A;  1TDZ A;  5FSW A;  1WIV A;  3GLH A;  2UUA M;  1JR3 D;  4M9X A;  2XZF A;  1P3Q Q;  3BXW A;  2Y2N A;  4QHT A;  4JI8 M;  1XXH E;  4IBC A;  2XD5 A;  2F5N A;  2HHH M;  3K2L A;  3PNV A;  4M9S A;  4AKI A;  4QNR A;  1Q39 A;  3UJN A;  3K9O A;  3GLI B;  3RE8 A;  4B7G A;  5ITR A;  2DHR A;  2XZU A;  3WHL A;  2UXC M;  3KFU G;  1O6I A;  3VDP A;  1IN4 A;  2KW0 A;  5FLX S;  1E8B A;  2Y2P A;  2WSC F;  4B3R M;  3HSH A;  2DAE A;  2WSF F;  4LJ7 A;  1MN3 A;  2DVW B;  2EJS A;  1VDL A;  1EE8 A;  2DAK A;  3C3D A;  4II7 A;  2QNJ A;  5EP4 A;  3SMP A;  4A3V B;  2QCU A;  4AKG A;  3DZD A;  5IZ7 D;  4DV3 M;  1PJJ A;  1XMO M;  4MGH A;  1QAN A;  4GHL A;  5EP3 A;  1TTE A;  1Z5A A;  2JXN A;  1NJG A;  4FWG A;  3U60 A;  3KW6 A;  5EXS A;  2QP9 X;  3W0L B;  4MH0 E;  3GLH B;  4PDI A;  3R8F A;  1IBK M;  1W1V A;  3AKZ A;  1R5L A;  2D7E A;  2DZO B;  5EXP A;  1V92 A;  3THG A;  2CE7 A;  1YSY A;  5ITQ A;  1DGH A;  3HHZ A;  5KPR A;  1HNX M;  3AOG A;  4CHT B;  1YU1 A;  2G5G X;  3U6M A;  2D7G A;  3WD1 A;  3WX7 A;  1D0L A;  4LJ6 A;  5L8R F;  3FYC A;  2BWE A;  1T3T A;  2K9D A;  4ZPX A;  1NJF A;  2VQF M;  2Y2G A;  4OVZ A;  4CGY B;  3GPU A;  3QYE A;  4GIP A;  2JUJ A;  4IBD A;  4GKJ M;  4QNL A;  1IM2 A;  3SC3 A;  2VF8 A;  1IQP A;  2Y2Q A;  1F4I A;  1YE9 A;  4Q7J A;  1IY2 A;  3M0E A;  2JZ1 A;  2KHH A;  2EKF A;  2L2D A;  1EFU B;  3C58 A;  1HNW M;  2MR9 A;  4LF5 M;  3U6O A;  3E9S A;  1SXJ B;  2JE5 A;  1PRB A;  3TL4 X;  3E21 A;  3GLG B;  1XHB A;  3EIH A;  1XB2 B;  2L7I A;  2VF7 A;  3PVS A;  4I5S A;  3QYB A;  1IXS B;  1SXJ E;  4CIS A;  4OJ5 A;  2DNA A;  2RRU A;  3B9P A;  3LW5 F;  1QUT A;  5GKN A;  4OX9 M;  4JYA M;  1TH3 A;  3UZU A;  3NBI A;  4Y28 F;  2Y2L A;  3R9X B;  2DAG A;  2EUC A;  2QHO B;  3IEC A;  1OJL A;  4K0K M;  2Z3X A;  4RF0 A;  4IBJ A;  4XBO A;  4L4U A;  1S3S A;  4QNM A;  4OJO A;  4PCZ A;  3M7P A;  2F5O A;  3CF6 E;  3HHW A;  3U6D A;  1IN6 A;  3K8Z A;  1L1T A;  4MB5 A;  2APL A;  2WSE F;  3AOE C;  2R0I A;  3T38 A;  1NNU C;  4DR3 M;  4GC5 A;  2XSZ D;  1XNR M;  2BJV A;  4Z6Y A;  2XF3 A;  4L15 A;  1OKS A;  4MGI E;  1H6U A;  3NWL A;  3U61 B;  4CIZ A;  2LVN C;  3GO8 A;  3L27 A;  3B7Z A;  4X65 M;  2X4A A;  3IG5 A;  4JI0 M;  4FCT A;  2XEP A;  4R7G A;  4FD2 A;  3TWL A;  1Z59 A;  1QYR A;  3KSJ A;  1R7R A;  3I51 A;  3MMP A;  3VKG A;  3HU1 A;  3WD4 A;  1IY1 A;  3B7Q A;  5ITX A;  4NZ1 A;  4DV2 M;  1HR0 M;  1QAQ A;  1V34 A;  1R2Y A;  4HEO A;  3U5Z A;  1QVR A;  1R6B X;  1XNQ M;  5IT9 S;  3JAM S;  3T1H M;  4MB3 A;  5BR8 M;  1J5E M;  2ZTD A;  2CV1 A;  3GRV A;  1KFV A;  4IJE A;  1OGG A;  2KNZ A;  1WGL A;  3HKP A;  1VEG A;  4KOD A;  5JI2 E;  3MQL A;  4B08 A;  1N77 A;  2D49 A;  2CP8 A;  4GH9 A;  2FH0 A;  3KS4 A;  4GC9 A;  3HON A;  4KHP M;  1H0I A;  1GL7 A;  3J80 S;  1BVS A;  1JQJ C;  2C99 A;  4LRT A;  8CAT A;  3UGJ A;  2K0B X;  4LGY A;  5IWA M;  4B3T M;  2ERC A;  3FTD A;  4JN6 A;  2OO9 A;  4M0W A;  4NOO B;  3GQ3 A;  3I4V A;  5FTK A;  2DZL A;  4Z8X A;  2M60 A;  2L09 A;  5DYG A;  3A46 A;  2XD1 A;  3SBJ A;  4KT0 F;  4OJL A;  1AIW A;  1JR3 A;  3BBZ A;  3WD2 A;  2N35 A;  3KDS E;  3NBX X;  3FE3 A;  3GLH E;  4P16 A;  2H5X A;  5ITT A;  1W1T A;  2CRU A;  3VK7 A;  3HWS A;  1D2N A;  2Z4S A;  2KRU A;  1I4W A;  4LF6 M;  1DGB A;  1L2C A;  4NXN M;  3KVW A;  4FW9 A;  2OQ4 A;  3AL0 C;  3IHP A;  3I04 M;  3MJ5 A;  2BG1 A;  5E6J A;  2WZJ A;  3SAV A;  4ITQ A;  1IN7 A;  3JR5 A;  2HAK A;  4JI3 M;  4LFC M;  3HJS A;  1NVM A;  3GLI E;  4GHA A;  1VG5 A;  4G6Z A;  4FCV A;  5FTN A;  2R46 A;  1C1K A;  1E32 A;  3E4R A;  3IG8 A;  3GRR A;  3L29 A;  4LGM A;  4MGZ E;  4NRW A;  2DWL A;  3T15 A;  3PFI A;  2I7P A;  3OTO M;  4DR7 M;  1VQ1 A;  1G8P A;  1E15 A;  3LVW A;  1UFZ A;  3I01 M;  1H8P A;  2R4E A;  3D8B A;  3SAT A;  3J2P B;  3ZQJ A;  4YHH M;  3RFW A;  4JI6 M;  2Z4R A;  3HU2 A;  2MJ5 B;  1RU3 A;  2JY7 A;  1CUK A;  3KSX A;  1DO2 A;  3M7G A;  3SYK A;  3GLG E;  2QBY A;  4KLN A;  1QZE A;  2C98 A;  3FKE A;  1GO5 A;  1E6N A;  1NHW C;  3HHX A;  4I8O A;  2DHY A;  1LV7 A;  5KQ8 A;  1DV0 A;  1XXH A;  2DI0 A;  1CK7 A;  4AG5 A;  2R65 A;  1ORY B;  4DV5 M;  1VEJ A;  4PT5 A;  5FTJ A;  1ZMW A;  4TX8 A;  3ZH9 B;  2MGW A;  1PJT A;  3QAU A;  2EKK A;  2Y20 A;  2CWB A;  1OTR A;  4LJ4 A;  2CHV A;  3SHG B;  3AOE A;  3K92 A;  5DFL A;  4AG6 A;  4Z2J A;  4PD2 A;  2F5P A;  1NSF A;  2BWB A;  4P17 A;  3FUX A;  4B3S M;  3FTE A;  3FRI A;  3DFZ A;  2JA2 A;  2RGO A;  4RNA A;  4F1I A;  4BBA A;  4OJ6 A;  1E88 A;  3EIE A;  3CGW A;  4JI1 M;  3KOX E;  4JI4 M;  2FN2 A; 
#chains in the Genus database with same CATH homology
 3TPZ A;  1HNZ M;  2FFF B;  5EP1 A;  4G4N A;  2VQE M;  3SHF A;  5C18 A;  5KQD A;  3WHK A;  3U5Z B;  3GPP A;  5ITY A;  2KEB A;  1IN8 A;  4B7H A;  5EXT A;  3MHV C;  3J7A S;  1QZM A;  4QOZ C;  3PNY A;  4GIT A;  2QEN A;  4LG2 A;  1W5T A;  2XLJ A;  1L2B A;  4B3M M;  3Q8X A;  4AZF A;  2J7O A;  2JCH A;  4JXJ A;  3HU3 A;  4TUW A;  3DOA A;  4JI2 M;  4LCB A;  3FUW A;  3LVV A;  2Z7J A;  5EXX A;  4BLC A;  1PM5 A;  2CEA A;  2LXE A;  4G4O A;  1HT1 E;  3U6Q A;  2KZU A;  3SYL A;  3TQS A;  1YU0 A;  1IXZ A;  2XFS A;  2Q2E B;  3ZCB B;  3KOZ E;  1Z6T A;  1HQC A;  2UWX A;  3FUT A;  2NQ8 C;  4X62 M;  1DGG A;  3ILK A;  4IBE A;  5DNY A;  1G4A E;  3ZC7 B;  4W5W A;  4NSO B;  2UUB M;  2VII A;  3LMM A;  4IBB A;  5E26 A;  4BB9 A;  2FFJ A;  3VKH A;  3N3F A;  4LF4 M;  1N33 M;  1Z5C A;  2FNA A;  4LZJ A;  1L8Q A;  2KRK A;  3VFD A;  3GQ4 A;  1IBM M;  2BNK A;  1G59 A;  2FE8 A;  3FTF A;  4IIW A;  3AFH A;  3FD9 A;  3FUV A;  5DYI A;  1Q3B A;  1QAM A;  4LZZ A;  1MX0 A;  1IN5 A;  1ZQ9 A;  4QOS A;  2F5S A;  4OVZ B;  4LJA A;  3L28 A;  3HJQ A;  1YUB A;  4GRI A;  1IBL M;  2CHQ A;  1SXJ D;  2LWX A;  4RF1 A;  1Q3C A;  1HT2 E;  4JV5 M;  4HLQ A;  4HL4 A;  2KA6 B;  5A2Q S;  4D80 A;  4NZ5 A;  3FYD A;  2OPF A;  2W82 A;  1YU2 A;  2ZAN A;  2Y2J A;  2UU9 M;  4LF7 M;  2UXB M;  4YY3 M;  2DWN A;  2ZM6 M;  3AJI B;  4OUI A;  3LQQ A;  2H1R A;  1KSF X;  3RGS A;  5LMN M;  3SAW A;  3VK8 A;  2R18 A;  2KXE A;  3J81 S;  3I4Y A;  2RGH A;  5IRE B;  2O5R A;  1NNJ A;  4DR4 M;  4IBG A;  3U60 B;  2KZS A;  4FWD A;  2CFO A;  1SXJ C;  5EP2 A;  4G4R A;  2YFQ A;  3SAS A;  4L78 A;  4MGK E;  3KOW E;  3GLF B;  1GLN A;  3VLF B;  4NYY A;  4WUR A;  4DUZ M;  1IXR C;  3TWM A;  2DWM A;  4DV0 M;  3U6E A;  1TH4 A;  2XSZ A;  4NXM M;  2QZ4 A;  3GP1 A;  2BJW A;  4PDG A;  3UK6 A;  3H4M A;  4L8R C;  2X8A A;  1NY6 A;  4JI7 M;  5KO3 A;  3CF0 A;  3GRY A;  2Y0Q A;  3HJ8 A;  4IBK A;  4DR2 M;  2YQZ A;  3SMS A;  4D82 A;  5KPZ A;  4NL4 H;  3KS8 A;  1NHG C;  1DGH B;  5JI3 E;  1GKI A;  4IJF A;  3VDU A;  5BPV A;  2XH9 A;  1GVN A;  4AI6 A;  1QQW A;  3HGI A;  3L26 A;  4IBF A;  3FTC A;  2R45 A;  2LNH C;  3U61 A;  4M0D A;  2G8L A;  3DA1 A;  1K82 A;  3GLG A;  1XWI A;  4IBI A;  5ITU A;  1TGU A;  1PJI A;  3SAR A;  4REZ A;  5FTL A;  3GPX A;  3J27 B;  4DR6 M;  2X49 A;  3GLF A;  1FJG M;  1WXQ A;  1YU3 A;  4DV1 M;  4B7F A;  3MK6 A;  1NY5 A;  2C5R A;  4LF8 M;  2XFT A;  4LJ5 A;  3GRU A;  3J7B A;  1E9S A;  2Y0T A;  3L25 A;  2ZAM A;  1GL6 A;  4NRV A;  1XXH B;  1UM8 A;  3KP0 E;  1XC8 A;  2R4J A;  4MB7 A;  3U6P A;  4OJP A;  2C9C A;  1G3I A;  4XGI A;  4DV7 M;  3T1Y M;  3D8L A;  5LMU M;  1FNN A;  5EJC A;  2CV2 A;  1VDD A;  1TDH A;  3FUU A;  1HQY E;  3A45 A;  4FVM A;  4LJ8 A;  1DGF A;  2K47 A;  4AKH A;  2I7N A;  2Y2M A;  3SAU A;  2ZBK B;  4LFB M;  2D7H A;  2UUC M;  1N32 M;  1J09 A;  1OFI A;  2Y21 A;  2C96 A;  4LRS A;  2DZN B;  1N36 M;  1J7K A;  4G4Q A;  4AW4 A;  2EA0 A;  4LF9 M;  2E5L M;  4FCW A;  1N78 A;  2EO2 A;  3W0F A;  4DV4 M;  2Y2K A;  2M5Z A;  2P5T A;  4DR1 M;  3U6C A;  1L2D A;  1ZAE A;  2ZAO A;  3QWL A;  3UMM A;  5KPT A;  2RKO A;  2QBY B;  2QPA A;  1KYI A;  3A98 B;  1W5S A;  3LQR A;  3L2A A;  4WW0 A;  5ITX E;  1DO0 A;  4DR5 M;  3CF2 A;  1E94 E;  3M6A A;  4I81 A;  4LJ9 A;  4DUY M;  1Z5B A;  1X37 A;  2YR0 A;  4S12 A;  1R2Z A;  5EQT A;  5FTM A;  2L7H A;  4GMQ A;  2CV0 A;  2YNM D;  3PXG A;  2LH0 A;  2V1C A;  2J7N A;  2L6O A;  2CUZ A;  1YU4 A;  5H37 D;  4AQY M;  3GQ5 A;  3CTW B;  2DXI A;  1I94 M;  1YUE A;  4OU7 A;  3KP1 E;  1N75 A;  2V6Z M;  1K3X A;  4JI5 M;  1MU5 A;  1K3W A;  2DWZ B;  4D81 A;  4LFA M;  4X64 M;  5F3W A;  3AV0 A;  3U6S A;  2IOU A;  3SFZ A;  4NY2 A;  4I4L A;  4FWH A;  2XGN A;  1G41 A;  2HL7 A;  3A42 A;  5C1B A;  1L1Z A;  4OW0 A;  2F4V M;  4MM3 B;  4R3D A;  4GKK M;  3GPY A;  3KOY E;  3TWK A;  2R62 A;  2C9O A;  1OFH A;  4DV6 M;  4NYU A;  1SXJ A;  2UXD M;  2Y2I A;  3K1J A;  1E9R A;  2V1U A;  1IY0 A;  3U6L A;  3KXE C;  1N34 M;  4NZ3 A;  4LY6 A;  3BOS A;  3HHY A;  4KO8 A;  1XMQ M;  2F5Q A;  2A5Y B;  2HCB A;  2HKJ A;  4NSR A;  3RGP A;  2Y2O A;  4MGY E;  1QAO A;  1TH2 A;  3JR4 A;  7CAT A;  4L16 A;  4M9Z A;  4X66 M;  4EIW A;  2AHM A;  3GLI A;  2CHG A;  2FOI C;  4QHS A;  1TDZ A;  3GLH A;  2UUA M;  1JR3 D;  4M9X A;  2XZF A;  2Y2N A;  4QHT A;  4JI8 M;  4IBC A;  2XD5 A;  2F5N A;  2HHH M;  3K2L A;  3PNV A;  4M9S A;  4AKI A;  4QNR A;  1Q39 A;  3UJN A;  3GLI B;  3RE8 A;  4B7G A;  5ITR A;  2DHR A;  2XZU A;  2UXC M;  3KFU G;  3VDP A;  1IN4 A;  2KW0 A;  5FLX S;  2Y2P A;  3HSH A;  4B3R M;  4NZ4 A;  4LJ7 A;  3WHL A;  2DVW B;  3SMP A;  4II7 A;  3TE6 A;  1EE8 A;  5FSW A;  4AKG A;  2Y2H A;  5EP4 A;  4A3V B;  2QCU A;  3DZD A;  5IZ7 D;  4DV3 M;  1PJJ A;  1XMO M;  4MGH A;  1QAN A;  4GHL A;  5EP3 A;  1Z5A A;  1NJG A;  4FWG A;  3U60 A;  3KW6 A;  5EXS A;  2QP9 X;  3W0L B;  4MH0 E;  3GLH B;  4PDI A;  3R8F A;  1IBK M;  3AKZ A;  2D7E A;  2DZO B;  5EXP A;  3THG A;  2CE7 A;  1YSY A;  5ITQ A;  1DGH A;  3HHZ A;  5KPR A;  1HNX M;  3AOG A;  4CHT B;  1YU1 A;  2G5G X;  3U6M A;  2D7G A;  3WX7 A;  4LJ6 A;  3FYC A;  1T3T A;  4ZPX A;  1NJF A;  2VQF M;  2Y2G A;  4OVZ A;  4CGY B;  3GPU A;  4GIP A;  4IBD A;  4GKJ M;  4QNL A;  1IM2 A;  3SC3 A;  1IQP A;  2Y2Q A;  1YE9 A;  1IY2 A;  3M0E A;  3C58 A;  1HNW M;  4LF5 M;  3U6O A;  3E9S A;  1SXJ B;  2JE5 A;  3TL4 X;  3GLG B;  1XHB A;  3EIH A;  3PVS A;  2L7I A;  4I5S A;  1IXS B;  1SXJ E;  4CIS A;  4OJ5 A;  3B9P A;  5GKN A;  4OX9 M;  4JYA M;  1TH3 A;  3UZU A;  3NBI A;  2Y2L A;  3R9X B;  2EUC A;  1OJL A;  4K0K M;  2Z3X A;  4RF0 A;  4IBJ A;  4XBO A;  4L4U A;  1S3S A;  4QNM A;  4OJO A;  4PCZ A;  2F5O A;  3CF6 E;  3HHW A;  3U6D A;  1IN6 A;  3K8Z A;  1L1T A;  3AOE C;  3T38 A;  1NNU C;  4DR3 M;  4GC5 A;  2XSZ D;  1XNR M;  2BJV A;  4Z6Y A;  2XF3 A;  4L15 A;  4MGI E;  1H6U A;  3NWL A;  3U61 B;  3GO8 A;  3L27 A;  4X65 M;  2X4A A;  3IG5 A;  4JI0 M;  4FCT A;  2XEP A;  4R7G A;  4FD2 A;  3TWL A;  1Z59 A;  1QYR A;  3KSJ A;  1R7R A;  3I51 A;  3VKG A;  3HU1 A;  1IY1 A;  5ITX A;  4NZ1 A;  4DV2 M;  1HR0 M;  1QAQ A;  1R2Y A;  3U5Z A;  1QVR A;  1R6B X;  1XNQ M;  5IT9 S;  3JAM S;  3T1H M;  5BR8 M;  1J5E M;  2CV1 A;  3GRV A;  1KFV A;  4IJE A;  3HKP A;  4KOD A;  5JI2 E;  4B08 A;  1N77 A;  4GH9 A;  3KS4 A;  4GC9 A;  3HON A;  4KHP M;  1GL7 A;  3J80 S;  4LRT A;  1JQJ C;  2C99 A;  8CAT A;  3UGJ A;  4LGY A;  5IWA M;  4B3T M;  2ERC A;  3FTD A;  4JN6 A;  4M0W A;  4NOO B;  3GQ3 A;  3I4V A;  5FTK A;  3A46 A;  4Z8X A;  2M60 A;  2L09 A;  5DYG A;  2XD1 A;  3SBJ A;  4OJL A;  1JR3 A;  3KDS E;  4P16 A;  5ITT A;  3VK7 A;  3HWS A;  1D2N A;  2Z4S A;  2KRU A;  1I4W A;  4LF6 M;  1DGB A;  1L2C A;  4NXN M;  3KVW A;  4FW9 A;  2OQ4 A;  3AL0 C;  3MJ5 A;  2BG1 A;  5E6J A;  3SAV A;  4ITQ A;  1IN7 A;  3JR5 A;  4JI3 M;  4LFC M;  3HJS A;  1NVM A;  4GHA A;  4G6Z A;  4FCV A;  5FTN A;  2R46 A;  1C1K A;  1E32 A;  3E4R A;  3IG8 A;  3GRR A;  3L29 A;  4LGM A;  4MGZ E;  4NRW A;  2DWL A;  3T15 A;  3PFI A;  2I7P A;  3OTO M;  4DR7 M;  1G8P A;  3LVW A;  2R4E A;  3D8B A;  3SAT A;  3J2P B;  4JI6 M;  4YHH M;  3RFW A;  2Z4R A;  3HU2 A;  3KSX A;  3M7G A;  3SYK A;  1DO2 A;  2QBY A;  4KLN A;  2C98 A;  3FKE A;  1NHW C;  3HHX A;  4I8O A;  1LV7 A;  5KQ8 A;  1XXH A;  4AG5 A;  2R65 A;  1ORY B;  4DV5 M;  4PT5 A;  5FTJ A;  3ZH9 B;  3QAU A;  2Y20 A;  4LJ4 A;  3SHG B;  2CHV A;  3AOE A;  3K92 A;  4AG6 A;  4PD2 A;  2F5P A;  1NSF A;  3FUX A;  4B3S M;  3FTE A;  3DFZ A;  2JA2 A;  2RGO A;  4RNA A;  4BBA A;  4OJ6 A;  3EIE A;  4JI1 M;  3KOX E;  4JI4 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...