4IBEA

Ebola virus vp35 bound to small molecule
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
123
structure length
123
Chain Sequence
DISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/transcription inhibitor
molecule keywords Polymerase cofactor VP35
publication title In Silico Derived Small Molecules Bind the Filovirus VP35 Protein and Inhibit Its Polymerase Cofactor Activity.
pubmed doi rcsb
source organism Ebola virus
total genus 42
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ibeA01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4ibeA02
4IBJA 4IBGA 3L28A 3L2AA 3L26A 3FKEA 4GH9A 3KS4A 3KS8A 4IBKA 5BPVA 4GHAA 4IBCA 4IBDA 4IJFA 3L25A 4GHLA 4IBEA 4IBIA 4IBBA 3L29A 4IJEA 3L27A 4LG2A 4IBFA
chains in the Genus database with same CATH superfamily
1GXDA 3SMPA 2LHCA 4DR5M 2N35A 1X37A 2CV2A 4L4UA 3E46A 4QHSA 4B3MM 2H1RA 2R18A 1L1ZA 4LJ6A 3HU2A 1HQYE 2QNJA 4GITA 1TDHA 3GRYA 3SAWA 2UUAM 4L8RC 4LF7M 1GABA 3K1JA 4LZJA 3BBZA 3THGA 4IIWA 4PDGA 1XMQM 3HHWA 2UUBM 2V6ZM 4Q7JA 4FWDA 4IBCA 5A2QS 2Y2JA 1OIZA 1G3IA 3NWLA 2HAKA 3A46A 2EKFA 3GQ4A 2E5LM 1IM2A 1ORYB 1VDDA 1AIPC 5KPZA 2KZSA 2BWEA 4KO8A 2LVPC 2C5RA 4LF8M 1H8PA 2DWMA 4I4LA 3B7QA 4XBOA 4OU7A 2XZUA 1L8QA 2UXBM 4JI3M 3U60B 2Q2EB 2RRUA 3GLFE 5ITYA 2QPAA 3B7NA 4OUIA 3H4JA 2I7NA 1ZAEA 3SARA 4AZFA 1Q3BA 3K2LA 4GKJM 3GLIE 1SXJB 2BJWA 2VIIA 1V33A 5GKNA 1E6NA 3WD4A 3F92A 3L25A 1RU3A 1I4WA 3PNVA 3GPUA 1C7YA 5FSWA 4Z8XA 3HJQA 4IBBA 3GPXA 4PDIA 2DAMA 3VK7A 1TDZA 2CWBA 2F5SA 2UU9M 1PJTA 2LHGA 5LMUM 3BOSA 1LTMA 4FW9A 4XK8F 3C9PA 2MH8A 1TH2A 3JR4A 4DV1M 4GKKM 4KHPM 3E21A 5IT9S 1GOIA 4BBAA 1EE8A 2VF8A 3TWKA 3WD3A 2L09A 3GLFA 1K3XA 2CV1A 2DHRA 1NJFA 1XNQM 1T6OA 2DZNB 3GLHA 4DV5M 2K0BX 3HGIA 4FCTA 3B89A 3SHFA 4MH0E 1QDRA 2OOBA 1AUAA 3NBIA 3GLIB 1CUKA 2G8LA 2LXEA 4LGYA 3K8ZA 3KOWE 4FWGA 4IBKA 4FD2A 1IFYA 2JCHA 1SG9A 1SXJC 4D80A 4QNLA 4GC5A 3RFWA 3W68A 2I7PA 2VF7A 1JB0F 1TH4A 1D0LA 3U6SA 4QOSA 4NYYA 4DUYM 4NY2A 2XEPA 1XMOM 1D0MA 4TX8A 2DAIA 3ZCBB 2XZFA 3R9XB 2CHGA 1NV8A 3SATA 3LVWA 1YE9A 3U6CA 1NNJA 1UR8A 4IBGA 2RGOA 1GL6A 1XXHE 4MB5A 3ZH9B 5ITQA 2QHOB 5BR8M 3I04M 4AQYM 4WW0A 5ITUA 3WHKA 4OVZA 4G4RA 1N77A 4Z2JA 2EO2A 2H5XA 1YU3A 4GMQA 3LMMA 4LZZA 5C1BA 3J27B 4B7FA 3UK6A 2DWZB 2K6BA 1GJSA 2C99A 3KSXA 4AKHA 2Y2QA 1QANA 2GQFA 2Y21A 1TTEA 3GRUA 3U61A 2DAKA 3U6LA 1KS0A 4B7HA 1S3SA 5FTMA 3VFDA 4OJOA 2JZ1A 4L16A 1J7KA 2BWBA 2LWXA 2R44A 1WR1B 4IJEA 3KP1E 3CF0A 2YFQA 4R7GA 1EFUB 3GQ3A 4AG5A 4LFCM 3AOGA 4JYAM 1VDLA 4KLNA 2DHYA 3K92A 5JI3E 3B74A 3NBXX 3U6OA 1XXHA 5FTJA 3AKZA 4JI4M 1Z6TA 1VEJA 1L1TA 3J81S 4FVMA 4II7A 2DWLA 4LF4M 4BLCA 3FRHA 3JR5A 4ANRA 2XH9A 3TPZA 2XSZA 4I8OA 4WP2A 3J80S 2XD1A 4OJ5A 1IY0A 1PDCA 5IZ7D 3KVWA 1FJGM 2YNMD 4LGMA 3FTEA 3KFUG 2KZUA 2YR0A 1E6ZA 4MB4A 4NZ3A 1YU1A 1V92A 4LJ7A 4LY6A 1G41A 3DA1A 3T15A 4LF5M 2CP8A 1TR8A 4LJ4A 1N33M 3J2PB 3M6AA 1EIJA 2P5TA 2OO9A 3SYLA 2CUZA 2QBYB 1FNNA 3GLGB 2UXCM 4CIZA 2DVWB 4Z2IA 4B08A 4G4OA 1VEGA 4LRTA 1W1PA 4NC6A 3TQSA 2K9DA 3J7BA 3GQ5A 2FFFB 2X8AA 3EIHA 4Y28F 1MU5A 5F3WA 2V1CA 1WGNA 2UWXA 4FCVA 3QYEA 5E26A 3AV0A 3TWMA 2C98A 3GP1A 4ZPXA 1VG5A 4CGYB 1SXJD 1KSFX 3CF6E 4X64M 1NVMA 2KNVA 3HU3A 4DV4M 2C9CA 4G3OA 2OQ4A 2M5ZA 1A5TA 2JXNA 4G6ZA 4MGZE 3PVSA 2JY7A 4MGKE 3HX3A 3IG8A 4IBDA 4LJ5A 2Y2KA 2L4FA 4Z6YA 1GO5A 1DGHA 2R62A 2XLJA 2Y2PA 2ZTCA 4DV3M 3E9SA 4JI1M 3E4RA 4LG2A 2ZTDA 3LCUA 4Z2GA 2L2DA 3U6PA 3OTOM 1IXSB 4DV2M 2V5OA 3MQLA 5DYIA 1PJSA 3WD2A 3VKGA 2LBCA 3C3DA 3K9PA 3UGJA 1DGBA 3W67A 1L6JA 2B3TA 2DENA 2KA6B 2LVQD 3UMMA 4A3VB 4HL4A 3SAUA 4NXMM 1XNRM 3GLHE 5KPRA 1H0IA 2K47A 4Z2LA 1OJLA 4IJFA 1T3TA 2Y0TA 1WXQA 4DV0M 2KNAA 3H4MA 4K0KM 1N78A 1OAIA 1C1KA 1Y8GA 2EUCA 5KPTA 2LVAA 4REZA 1WJ7A 1K3WA 2JY8A 2MGWA 2JZ0A 3FTDA 1W5SA 1IXRC 3U60A 3SMSA 3SYKA 1DO0A 1N36M 1H0GA 2EA0A 1OTRA 4QNMA 1YLAA 3WD1A 2ZAOA 1IN8A 2EKKA 3ZC7B 1IQPA 4X65M 1JR3D 3M7PA 3GLFB 4HEOA 2XFSA 1MX0A 4MGIE 1TH3A 1PJJA 2JY5A 4QOZC 1WIVA 4L6V6 1Z5AA 1IN6A 3FUVA 4RF1A 4TUWA 4B3RM 2LTUA 2X4AA 2WZJA 4NYUA 2DZOB 3U6MA 1XWIA 3BXWA 4JI7M 4DV6M 1IXZA 1GVNA 3HJSA 4LF9M 1TGUA 3KSJA 2KDLA 3ZQJA 1YSYA 4DR2M 2CRUA 1L2CA 3DFZA 2D7HA 4B7GA 8CATA 3I4VA 2Y2OA 3AOEA 4MGYE 1R2ZA 5KQ8A 5KO3A 2X49A 1QQWA 2V1UA 1QUTA 1QZEA 5FLXS 3L26A 2UUCM 2WSFF 4JI0M 2OOAA 2XSZD 5ITTA 2JUJA 4OJLA 4AW4A 5H37D 2QSFX 1KFVA 3W0LB 1PGYA 4JI5M 1Z59A 1KYIA 3PNYA 1PRBA 3Q8XA 4L15A 2DAEA 4M0WA 4OVZB 1OIPA 2CE7A 2LNHC 4GHAA 4B3SM 2CEAA 3SFZA 2G3QA 2HKJA 1YU4A 1DO2A 3MMPA 1DGFA 4IBIA 5EP1A 2FFJA 5L8RF 1MN3A 3HONA 2Y2IA 4JI6M 4D81A 3A42A 5ITRA 1G59A 1QUSA 2Z8YM 2DWNA 1E94E 1LV7A 3ILKA 3T1YM 2JY6B 2Y2LA 1ZV1A 3HJ8A 2WSEF 3UZUA 2HCBA 3PFIA 2VQEM 1W5TA 4G4QA 5EP4A 3VDUA 1XXHB 1NV9A 5FTKA 1OAOC 4DR3M 4AKGA 1XC8A 1OGBA 2ERCA 4S12A 1E88A 1QYRA 1QVRA 1L2BA 5EXSA 3A98B 2KNZA 4QNRA 3EIEA 1IN5A 3SBJA 2LVOC 1ZMUA 2FOIC 2R65A 1HQCA 2XGNA 3Q8GA 1HR0M 3U6QA 4F1IA 2EJSA 3CTWB 2C9OA 1TF0B 4PCZA 4IBFA 4LF6M 5IREB 3UJNA 3FUUA 5C18A 1QAOA 2MJ5B 3FYCA 5EJCA 4AI6A 2R6FA 3C3EA 1OKSA 2Z7JA 4MB7A 4RF0A 1XHBA 1QZMA 1VEKA 1GL7A 1Q3CA 1NNUC 1Z5BA 2YQZA 4WURA 1YUBA 2DAGA 4KT0F 1T43A 2HWJA 2NQ8C 3KOYE 4MB3A 1IN4A 1NHGC 1Q02A 3RE8A 3HU1A 4BB9A 3VK8A 3RGSA 3U5ZA 4DR7M 1ED7A 1N34M 5ITXE 4DV7M 1D2NA 1JQJC 3D8LA 4LRSA 1QAMA 5DYGA 3R8FA 2QBYA 1WHCA 4JI8M 1W1VA 3LQRA 2Y2MA 2F5PA 2VQFM 1EAKA 2BNKA 4UN2B 1G4AE 2LVNC 3L28A 4FWHA 1HT1E 4P16A 2KRUA 2MROB 3LCVB 2RGHA 2ZAMA 3U6DA 3TE6A 1VQ1A 5EXXA 1YU0A 3KDSE 4F2LA 3DOAA 4JN6A 4L78A 3B9PA 4M9ZA 3VKHA 1DV0A 3FTFA 2HHHM 5FTLA 1SXJE 2O5RA 5IWAM 3KS4A 7CATA 3HHYA 3C58A 2XD5A 1QO6A 1L2DA 1I94M 4OJPA 3KS8A 4MGHA 1HNZM 5ITXA 3TWLA 2D49A 1D0KA 3FUWA 4W5WA 3T1HM 4GHLA 3WHLA 2FN2A 2QQ8A 3A45A 3J7AS 2Y2NA 2R4JA 1MJGM 1XB2B 1IXSA 5EXTA 3U6EA 1ZMWA 1E9RA 4X66M 2O25A 4DR4M 1CXWA 1NHWC 1NY5A 5EQTA 4AG6A 2F5NA 3GO8A 3KOZE 2R0IA 4I5SA 3KXEC 3W0FA 4AKIA 3HZJA 1W1YA 3FE3A 1HNWM 2CHVA 2AHMA 1QAQA 4Z2KA 2IOUA 4LFBM 1E32A 3HSHA 2W82A 2FE8A 1SXJA 1OGGA 1R2YA 5E6JA 3MK6A 4B3TM 1OFHA 1GJTA 1QDTA 2KEBA 3GLHB 4M9SA 2Z4SA 4M0DA 5EP3A 3HY5A 1WGLA 2ZBKB 2APLA 2QENA 3SHGB 2Y0QA 3IECA 2QZ4A 2R4EA 1F4IA 1R4GA 3B7ZA 2JP7A 3LVVA 1HNXM 3HHXA 1OFIA 4DR1M 4X62M 4NRWA 1PJQA 1HJPA 2L7IA 4NOOB 5JI2E 3LW5F 1Q39A 3FTCA 2F4VM 4PT5A 3D8BA 3FRIA 3KW6A 1GLNA 1Z5CA 4HLQA 4IBJA 1K82A 2JE5A 3WX7A 1P3QQ 4I81A 5DFLA 4CISA 1BVSA 3I01M 3FKEA 4P17A 5FTNA 3FYDA 3TL4X 1PM5A 4OW0A 4DUZM 3M0EA 3QWLA 4GH9A 2Z4RA 4NZ1A 4NSOB 1JR3E 1N75A 2Z3XA 4LFAM 3GLIA 2QCUA 4M9XA 2L4EA 3MJ5A 3T38A 4NZ5A 1N32M 4CHTB 3IG5A 2RKOA 4FCWA 2G5GX 3QYBA 4KODA 4NXNM 4NL4H 4PD2A 1YU2A 4Z2HA 2Y2HA 3HHZA 5EXPA 3V76A 4YY3M 2F5QA 4HMCA 3WD0A 2XFTA 4RNAA 3AJIB 3KP0E 4HMEA 1NJGA 4DBGB 1UFZA 3I51A 3FUXA 3U61B 4NZ4A 2DXIA 1IY1A 3K9OA 4YHHM 2OPFA 2A5YB 2Y20A 3L29A 4D82A 2CHQA 2MR9A 3CF2A 3KOXE 1NO1A 3L27A 2KHHA 2WSCF 2GNOA 4QHTA 3PXGA 4JV5M 3GRRA 1G8PA 4OX9M 2XF3A 2O01F 3M7GA 4GC9A 3L2AA 3RGPA 2JA2A 2ZM6M 4LJ9A 2J7NA 3HWSA 3QAUA 1G71A 3AOEC 4CJ6A 2L7HA 1GKIA 2FS1A 2JNHA 1JR3A 2R46A 3HKPA 1YUEA 3GPYA 1ZQ9A 3JAMS 2JWSA 4XGIA 3AFHA 1IY2A 2HL7A 1CK7A 3FUTA 1NY6A 4GIPA 4JI2M 1E8BA 1IN7A 2ZANA 2BJVA 3LQQA 2BG1A 1J5EM 2RTSA 2KXEA 2DKLA 4NSRA 2DZLA 2R45A 4GRIA 4IBEA 4LJ8A 3T6PA 3VLFB 1UR9A 4LJAA 3GLGE 2F5OA 2VDBB 5LMNM 1R7RA 2QP9X 3DZDA 4EIWA 1HT2E 2D7EA 2CFOA 5KQDA 5DNYA 1V34A 3SC3A 1E9SA 1AIWA 1R5LA 1ZMVA 1UM8A 1DGGA 5EP2A 4HMDA 2M60A 3MHVC 4JXJA 2KRKA 2FNAA 1PJIA 1J09A 1E15A 4OJ6A 3N3FA 2J5YA 4GEWA 3SAVA 1W1TA 2FH0A 2KW0A 1NSFA 2LH0A 4MM3B 1IBKM 1GPFA 1OQYA 4LCBA 1O6IA 4G4NA 1IBLM 4R71A 3VDPA 4DR6M 5BPVA 2D7GA 3FD9A 1H6UA 2C96A 3AL0C 1E6PA 3GRVA 1J7MA 4R3DA 3GLGA 3U5ZB 1E6RA 2DNAA 2L6OA 2CV0A 3SASA 1IBMM 3GPPA 1R6BX 2DI0A 3I4YA 3CGWA 3IHPA 4RKUF 2UXDM 1DGHB 4NRVA 4ITQA 2Y2GA 2J7OA
chains in the Genus database with same CATH topology
3SMPA 4DR5M 1X37A 2CV2A 4L4UA 4B3MM 4QHSA 2H1RA 2R18A 1L1ZA 4LJ6A 3HU2A 1HQYE 4GITA 1TDHA 3GRYA 3SAWA 2UUAM 4L8RC 4LF7M 3K1JA 4LZJA 3THGA 4IIWA 4PDGA 1XMQM 3HHWA 2UUBM 2V6ZM 4FWDA 4IBCA 5A2QS 2Y2JA 1G3IA 3NWLA 3A46A 3GQ4A 2E5LM 1IM2A 1ORYB 1VDDA 5KPZA 2KZSA 4KO8A 2C5RA 4LF8M 2DWMA 4I4LA 4XBOA 4OU7A 2XZUA 1L8QA 2UXBM 4JI3M 3U60B 2Q2EB 5ITYA 2QPAA 4OUIA 2I7NA 1ZAEA 3SARA 4AZFA 1Q3BA 3K2LA 4GKJM 1SXJB 2BJWA 2VIIA 5GKNA 3L25A 1I4WA 3PNVA 3GPUA 5FSWA 4Z8XA 3HJQA 4IBBA 3GPXA 4PDIA 3VK7A 1TDZA 2F5SA 2UU9M 5LMUM 3BOSA 4FW9A 1TH2A 3JR4A 4DV1M 4GKKM 4KHPM 5IT9S 4BBAA 1EE8A 3TWKA 2L09A 3GLFA 1K3XA 2CV1A 2DHRA 1NJFA 1XNQM 2DZNB 3GLHA 4DV5M 3HGIA 4FCTA 3SHFA 4MH0E 3NBIA 3GLIB 2G8LA 2LXEA 4LGYA 3K8ZA 3KOWE 4FWGA 4IBKA 4FD2A 2JCHA 4QNLA 1SXJC 4D80A 4GC5A 3RFWA 2I7PA 1TH4A 3U6SA 4QOSA 4NYYA 4DUYM 4NY2A 2XEPA 1XMOM 3ZCBB 2XZFA 3R9XB 2CHGA 3SATA 3LVWA 1YE9A 3U6CA 1NNJA 4IBGA 2RGOA 1GL6A 3ZH9B 5ITQA 5BR8M 4AQYM 4WW0A 5ITUA 3WHKA 4OVZA 4G4RA 1N77A 2EO2A 1YU3A 4GMQA 3LMMA 4LZZA 5C1BA 3J27B 4B7FA 3UK6A 2DWZB 4AKHA 2C99A 3KSXA 2Y2QA 1QANA 2Y21A 3GRUA 3U61A 3U6LA 4B7HA 1S3SA 5FTMA 3VFDA 4OJOA 4L16A 1J7KA 2LWXA 4IJEA 3KP1E 3CF0A 2YFQA 4R7GA 3GQ3A 4LFCM 4AG5A 3AOGA 4JYAM 4KLNA 3K92A 5JI3E 3U6OA 1XXHA 5FTJA 3AKZA 4JI4M 1Z6TA 1L1TA 3J81S 4FVMA 4II7A 2DWLA 4LF4M 4BLCA 3JR5A 2XH9A 3TPZA 2XSZA 4I8OA 3J80S 2XD1A 4OJ5A 1IY0A 5IZ7D 3KVWA 1FJGM 2YNMD 4LGMA 3FTEA 3KFUG 2KZUA 2YR0A 4NZ3A 1YU1A 4LJ7A 4LY6A 1G41A 3DA1A 3T15A 4LF5M 4LJ4A 1N33M 3J2PB 3M6AA 2P5TA 3SYLA 2CUZA 2QBYB 1FNNA 3GLGB 2UXCM 2DVWB 4B08A 4G4OA 4LRTA 3TQSA 3J7BA 3GQ5A 2FFFB 2X8AA 3EIHA 5F3WA 1MU5A 2V1CA 2UWXA 4FCVA 5E26A 3AV0A 3TWMA 2C98A 3GP1A 4ZPXA 4CGYB 1SXJD 1KSFX 3CF6E 4X64M 1NVMA 3HU3A 4DV4M 2C9CA 2OQ4A 2M5ZA 4MGZE 4G6ZA 3PVSA 4MGKE 3IG8A 4IBDA 4LJ5A 2Y2KA 4Z6YA 1DGHA 2R62A 2XLJA 2Y2PA 4DV3M 3E9SA 4JI1M 3E4RA 4LG2A 3U6PA 3OTOM 1IXSB 4DV2M 5DYIA 3VKGA 3UGJA 1DGBA 2KA6B 1XNRM 3UMMA 4A3VB 4HL4A 3SAUA 4NXMM 5KPRA 2K47A 1OJLA 4IJFA 1T3TA 2Y0TA 1WXQA 4DV0M 3H4MA 4K0KM 1N78A 1C1KA 2EUCA 5KPTA 1K3WA 3FTDA 1W5SA 1IXRC 3U60A 3SMSA 3SYKA 1DO0A 1N36M 2EA0A 4QNMA 2ZAOA 1IN8A 3ZC7B 1IQPA 4X65M 1JR3D 3GLFB 2XFSA 1MX0A 4MGIE 1TH3A 1PJJA 4QOZC 1Z5AA 1IN6A 3FUVA 4RF1A 4TUWA 4B3RM 4NYUA 2X4AA 2DZOB 3U6MA 1XWIA 4JI7M 4DV6M 1IXZA 1GVNA 3HJSA 4LF9M 1TGUA 3KSJA 1YSYA 4DR2M 1L2CA 3DFZA 2D7HA 4B7GA 8CATA 3I4VA 2Y2OA 3AOEA 4MGYE 1R2ZA 5KQ8A 5KO3A 2X49A 1QQWA 2V1UA 5FLXS 3L26A 2UUCM 4JI0M 2XSZD 5ITTA 4OJLA 4AW4A 5H37D 1KFVA 3W0LB 4JI5M 1Z59A 1KYIA 3PNYA 3Q8XA 4L15A 4M0WA 4OVZB 4REZA 4X66M 2CE7A 2LNHC 4GHAA 4B3SM 2CEAA 3SFZA 2HKJA 1YU4A 1DO2A 1DGFA 4IBIA 5EP1A 2FFJA 3HONA 2Y2IA 4JI6M 4D81A 3A42A 5ITRA 1G59A 2DWNA 1E94E 1LV7A 3ILKA 3T1YM 2Y2LA 3HJ8A 3UZUA 2HCBA 3PFIA 2VQEM 1W5TA 4G4QA 5EP4A 3VDUA 1XXHB 4DR3M 5FTKA 4AKGA 1XC8A 2ERCA 4S12A 1QYRA 1QVRA 1L2BA 5EXSA 3A98B 4QNRA 3EIEA 1IN5A 3SBJA 2R65A 2FOIC 2XGNA 1HQCA 1HR0M 3U6QA 3CTWB 2C9OA 4PCZA 4IBFA 4LF6M 5IREB 3UJNA 3FUUA 5C18A 1QAOA 4AI6A 3FYCA 5EJCA 2Z7JA 4MB7A 4RF0A 1XHBA 1QZMA 1GL7A 1Q3CA 1NNUC 1Z5BA 2YQZA 4WURA 1YUBA 2NQ8C 3KOYE 1IN4A 1NHGC 4BB9A 3RE8A 3HU1A 3VK8A 4DR7M 3RGSA 3U5ZA 1N34M 5ITXE 4DV7M 1D2NA 1JQJC 3D8LA 4LRSA 1QAMA 5DYGA 3R8FA 2QBYA 4JI8M 3LQRA 2Y2MA 2F5PA 2VQFM 2BNKA 1G4AE 3L28A 4FWHA 1HT1E 4P16A 2KRUA 2RGHA 2ZAMA 3U6DA 3TE6A 5EXXA 1YU0A 3KDSE 3DOAA 4JN6A 4L78A 3B9PA 4M9ZA 3VKHA 3FTFA 2HHHM 5FTLA 1SXJE 2O5RA 5IWAM 3KS4A 7CATA 3HHYA 3C58A 2XD5A 1L2DA 1I94M 4OJPA 3KS8A 4MGHA 1HNZM 5ITXA 3TWLA 3FUWA 4W5WA 3T1HM 4GHLA 3WHLA 3A45A 3J7AS 2Y2NA 2R4JA 5EXTA 3U6EA 1E9RA 4DR4M 1NHWC 1NY5A 5EQTA 4AG6A 2F5NA 3GO8A 3KOZE 4I5SA 3KXEC 3W0FA 4AKIA 1HNWM 2CHVA 2AHMA 1QAQA 2IOUA 4LFBM 1E32A 3HSHA 2W82A 2FE8A 1SXJA 1R2YA 5E6JA 3MK6A 4B3TM 1OFHA 2KEBA 3GLHB 4M9SA 2Z4SA 4M0DA 5EP3A 2ZBKB 2QENA 3SHGB 2Y0QA 2QZ4A 2R4EA 3LVVA 1HNXM 3HHXA 1OFIA 4DR1M 4X62M 4NRWA 2L7IA 4NOOB 5JI2E 1Q39A 3FTCA 2F4VM 4PT5A 3D8BA 1K82A 3KW6A 1GLNA 1Z5CA 4HLQA 4IBJA 2JE5A 3WX7A 4I81A 4CISA 3FKEA 5FTNA 3TL4X 3FYDA 1PM5A 4OW0A 4DUZM 3M0EA 3QWLA 4GH9A 2Z4RA 4NZ1A 4NSOB 1N75A 2Z3XA 4LFAM 3GLIA 2QCUA 4M9XA 3MJ5A 3T38A 4NZ5A 1N32M 4CHTB 3IG5A 2RKOA 4FCWA 2G5GX 4KODA 4NXNM 4PD2A 4NL4H 1YU2A 2Y2HA 3HHZA 5EXPA 4YY3M 2F5QA 2XFTA 4RNAA 3AJIB 3KP0E 1NJGA 3I51A 3FUXA 3U61B 4NZ4A 2DXIA 1IY1A 4YHHM 2OPFA 2A5YB 2Y20A 3L29A 4D82A 2CHQA 3CF2A 3KOXE 3L27A 4QHTA 3PXGA 4JV5M 3GRRA 1G8PA 4OX9M 2XF3A 4GC9A 3M7GA 3RGPA 3L2AA 2ZM6M 2JA2A 4LJ9A 2J7NA 3HWSA 3QAUA 3AOEC 2L7HA 1GKIA 2R46A 1JR3A 3HKPA 1YUEA 3GPYA 1ZQ9A 3JAMS 4XGIA 3AFHA 1IY2A 2HL7A 3FUTA 1NY6A 4GIPA 4JI2M 1IN7A 2ZANA 2BJVA 3LQQA 2BG1A 1J5EM 2KXEA 4NSRA 2R45A 4GRIA 4IBEA 4LJ8A 3VLFB 4LJAA 2F5OA 5LMNM 1R7RA 2QP9X 3DZDA 4EIWA 1HT2E 2D7EA 2CFOA 5KQDA 5DNYA 3SC3A 1E9SA 1UM8A 1DGGA 5EP2A 2M60A 3MHVC 4JXJA 2KRKA 2FNAA 1PJIA 1J09A 4OJ6A 3N3FA 3SAVA 2KW0A 1NSFA 2LH0A 4MM3B 1IBKM 4LCBA 4G4NA 1IBLM 4DR6M 3VDPA 5BPVA 2D7GA 3FD9A 1H6UA 2C96A 3AL0C 3GRVA 4R3DA 3GLGA 3U5ZB 2L6OA 2CV0A 3SASA 1IBMM 3GPPA 1R6BX 3I4YA 2UXDM 1DGHB 4NRVA 4ITQA 2Y2GA 2J7OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IBJ A;  4IBG A;  3L28 A;  3L2A A;  3L26 A;  3FKE A;  4GH9 A;  3KS4 A;  3KS8 A;  4IBK A;  5BPV A;  4GHA A;  4IBC A;  4IBD A;  4IJF A;  3L25 A;  4GHL A;  4IBE A;  4IBI A;  4IBB A;  3L29 A;  4IJE A;  3L27 A;  4LG2 A;  4IBF A; 
#chains in the Genus database with same CATH topology
 1GXD A;  3SMP A;  2LHC A;  4DR5 M;  2N35 A;  1X37 A;  2CV2 A;  4L4U A;  3E46 A;  4QHS A;  4B3M M;  2H1R A;  2R18 A;  1L1Z A;  4LJ6 A;  3HU2 A;  1HQY E;  2QNJ A;  4GIT A;  1TDH A;  3GRY A;  3SAW A;  2UUA M;  4L8R C;  4LF7 M;  1GAB A;  3K1J A;  4LZJ A;  3BBZ A;  3THG A;  4IIW A;  4PDG A;  1XMQ M;  3HHW A;  2UUB M;  2V6Z M;  4Q7J A;  4FWD A;  4IBC A;  5A2Q S;  2Y2J A;  1OIZ A;  1G3I A;  3NWL A;  2HAK A;  3A46 A;  2EKF A;  3GQ4 A;  2E5L M;  1IM2 A;  1ORY B;  1VDD A;  1AIP C;  5KPZ A;  2KZS A;  2BWE A;  4KO8 A;  2LVP C;  2C5R A;  4LF8 M;  1H8P A;  2DWM A;  4I4L A;  3B7Q A;  4XBO A;  4OU7 A;  2XZU A;  1L8Q A;  2UXB M;  4JI3 M;  3U60 B;  2Q2E B;  2RRU A;  3GLF E;  5ITY A;  2QPA A;  3B7N A;  4OUI A;  3H4J A;  2I7N A;  1ZAE A;  3SAR A;  4AZF A;  1Q3B A;  3K2L A;  4GKJ M;  3GLI E;  1SXJ B;  2BJW A;  2VII A;  1V33 A;  5GKN A;  1E6N A;  3WD4 A;  3F92 A;  3L25 A;  1RU3 A;  1I4W A;  3PNV A;  3GPU A;  1C7Y A;  5FSW A;  4Z8X A;  3HJQ A;  4IBB A;  3GPX A;  4PDI A;  2DAM A;  3VK7 A;  1TDZ A;  2CWB A;  2F5S A;  2UU9 M;  1PJT A;  2LHG A;  5LMU M;  3BOS A;  1LTM A;  4FW9 A;  4XK8 F;  3C9P A;  2MH8 A;  1TH2 A;  3JR4 A;  4DV1 M;  4GKK M;  4KHP M;  3E21 A;  5IT9 S;  1GOI A;  4BBA A;  1EE8 A;  2VF8 A;  3TWK A;  3WD3 A;  2L09 A;  3GLF A;  1K3X A;  2CV1 A;  2DHR A;  1NJF A;  1XNQ M;  1T6O A;  2DZN B;  3GLH A;  4DV5 M;  2K0B X;  3HGI A;  4FCT A;  3B89 A;  3SHF A;  4MH0 E;  1QDR A;  2OOB A;  1AUA A;  3NBI A;  3GLI B;  1CUK A;  2G8L A;  2LXE A;  4LGY A;  3K8Z A;  3KOW E;  4FWG A;  4IBK A;  4FD2 A;  1IFY A;  2JCH A;  1SG9 A;  1SXJ C;  4D80 A;  4QNL A;  4GC5 A;  3RFW A;  3W68 A;  2I7P A;  2VF7 A;  1JB0 F;  1TH4 A;  1D0L A;  3U6S A;  4QOS A;  4NYY A;  4DUY M;  4NY2 A;  2XEP A;  1XMO M;  1D0M A;  4TX8 A;  2DAI A;  3ZCB B;  2XZF A;  3R9X B;  2CHG A;  1NV8 A;  3SAT A;  3LVW A;  1YE9 A;  3U6C A;  1NNJ A;  1UR8 A;  4IBG A;  2RGO A;  1GL6 A;  1XXH E;  4MB5 A;  3ZH9 B;  5ITQ A;  2QHO B;  5BR8 M;  3I04 M;  4AQY M;  4WW0 A;  5ITU A;  3WHK A;  4OVZ A;  4G4R A;  1N77 A;  4Z2J A;  2EO2 A;  2H5X A;  1YU3 A;  4GMQ A;  3LMM A;  4LZZ A;  5C1B A;  3J27 B;  4B7F A;  3UK6 A;  2DWZ B;  2K6B A;  1GJS A;  2C99 A;  3KSX A;  4AKH A;  2Y2Q A;  1QAN A;  2GQF A;  2Y21 A;  1TTE A;  3GRU A;  3U61 A;  2DAK A;  3U6L A;  1KS0 A;  4B7H A;  1S3S A;  5FTM A;  3VFD A;  4OJO A;  2JZ1 A;  4L16 A;  1J7K A;  2BWB A;  2LWX A;  2R44 A;  1WR1 B;  4IJE A;  3KP1 E;  3CF0 A;  2YFQ A;  4R7G A;  1EFU B;  3GQ3 A;  4AG5 A;  4LFC M;  3AOG A;  4JYA M;  1VDL A;  4KLN A;  2DHY A;  3K92 A;  5JI3 E;  3B74 A;  3NBX X;  3U6O A;  1XXH A;  5FTJ A;  3AKZ A;  4JI4 M;  1Z6T A;  1VEJ A;  1L1T A;  3J81 S;  4FVM A;  4II7 A;  2DWL A;  4LF4 M;  4BLC A;  3FRH A;  3JR5 A;  4ANR A;  2XH9 A;  3TPZ A;  2XSZ A;  4I8O A;  4WP2 A;  3J80 S;  2XD1 A;  4OJ5 A;  1IY0 A;  1PDC A;  5IZ7 D;  3KVW A;  1FJG M;  2YNM D;  4LGM A;  3FTE A;  3KFU G;  2KZU A;  2YR0 A;  1E6Z A;  4MB4 A;  4NZ3 A;  1YU1 A;  1V92 A;  4LJ7 A;  4LY6 A;  1G41 A;  3DA1 A;  3T15 A;  4LF5 M;  2CP8 A;  1TR8 A;  4LJ4 A;  1N33 M;  3J2P B;  3M6A A;  1EIJ A;  2P5T A;  2OO9 A;  3SYL A;  2CUZ A;  2QBY B;  1FNN A;  3GLG B;  2UXC M;  4CIZ A;  2DVW B;  4Z2I A;  4B08 A;  4G4O A;  1VEG A;  4LRT A;  1W1P A;  4NC6 A;  3TQS A;  2K9D A;  3J7B A;  3GQ5 A;  2FFF B;  2X8A A;  3EIH A;  4Y28 F;  1MU5 A;  5F3W A;  2V1C A;  1WGN A;  2UWX A;  4FCV A;  3QYE A;  5E26 A;  3AV0 A;  3TWM A;  2C98 A;  3GP1 A;  4ZPX A;  1VG5 A;  4CGY B;  1SXJ D;  1KSF X;  3CF6 E;  4X64 M;  1NVM A;  2KNV A;  3HU3 A;  4DV4 M;  2C9C A;  4G3O A;  2OQ4 A;  2M5Z A;  1A5T A;  2JXN A;  4G6Z A;  4MGZ E;  3PVS A;  2JY7 A;  4MGK E;  3HX3 A;  3IG8 A;  4IBD A;  4LJ5 A;  2Y2K A;  2L4F A;  4Z6Y A;  1GO5 A;  1DGH A;  2R62 A;  2XLJ A;  2Y2P A;  2ZTC A;  4DV3 M;  3E9S A;  4JI1 M;  3E4R A;  4LG2 A;  2ZTD A;  3LCU A;  4Z2G A;  2L2D A;  3U6P A;  3OTO M;  1IXS B;  4DV2 M;  2V5O A;  3MQL A;  5DYI A;  1PJS A;  3WD2 A;  3VKG A;  2LBC A;  3C3D A;  3K9P A;  3UGJ A;  1DGB A;  3W67 A;  1L6J A;  2B3T A;  2DEN A;  2KA6 B;  2LVQ D;  3UMM A;  4A3V B;  4HL4 A;  3SAU A;  4NXM M;  1XNR M;  3GLH E;  5KPR A;  1H0I A;  2K47 A;  4Z2L A;  1OJL A;  4IJF A;  1T3T A;  2Y0T A;  1WXQ A;  4DV0 M;  2KNA A;  3H4M A;  4K0K M;  1N78 A;  1OAI A;  1C1K A;  1Y8G A;  2EUC A;  5KPT A;  2LVA A;  4REZ A;  1WJ7 A;  1K3W A;  2JY8 A;  2MGW A;  2JZ0 A;  3FTD A;  1W5S A;  1IXR C;  3U60 A;  3SMS A;  3SYK A;  1DO0 A;  1N36 M;  1H0G A;  2EA0 A;  1OTR A;  4QNM A;  1YLA A;  3WD1 A;  2ZAO A;  1IN8 A;  2EKK A;  3ZC7 B;  1IQP A;  4X65 M;  1JR3 D;  3M7P A;  3GLF B;  4HEO A;  2XFS A;  1MX0 A;  4MGI E;  1TH3 A;  1PJJ A;  2JY5 A;  4QOZ C;  1WIV A;  4L6V 6;  1Z5A A;  1IN6 A;  3FUV A;  4RF1 A;  4TUW A;  4B3R M;  2LTU A;  2X4A A;  2WZJ A;  4NYU A;  2DZO B;  3U6M A;  1XWI A;  3BXW A;  4JI7 M;  4DV6 M;  1IXZ A;  1GVN A;  3HJS A;  4LF9 M;  1TGU A;  3KSJ A;  2KDL A;  3ZQJ A;  1YSY A;  4DR2 M;  2CRU A;  1L2C A;  3DFZ A;  2D7H A;  4B7G A;  8CAT A;  3I4V A;  2Y2O A;  3AOE A;  4MGY E;  1R2Z A;  5KQ8 A;  5KO3 A;  2X49 A;  1QQW A;  2V1U A;  1QUT A;  1QZE A;  5FLX S;  3L26 A;  2UUC M;  2WSF F;  4JI0 M;  2OOA A;  2XSZ D;  5ITT A;  2JUJ A;  4OJL A;  4AW4 A;  5H37 D;  2QSF X;  1KFV A;  3W0L B;  1PGY A;  4JI5 M;  1Z59 A;  1KYI A;  3PNY A;  1PRB A;  3Q8X A;  4L15 A;  2DAE A;  4M0W A;  4OVZ B;  1OIP A;  2CE7 A;  2LNH C;  4GHA A;  4B3S M;  2CEA A;  3SFZ A;  2G3Q A;  2HKJ A;  1YU4 A;  1DO2 A;  3MMP A;  1DGF A;  4IBI A;  5EP1 A;  2FFJ A;  5L8R F;  1MN3 A;  3HON A;  2Y2I A;  4JI6 M;  4D81 A;  3A42 A;  5ITR A;  1G59 A;  1QUS A;  2Z8Y M;  2DWN A;  1E94 E;  1LV7 A;  3ILK A;  3T1Y M;  2JY6 B;  2Y2L A;  1ZV1 A;  3HJ8 A;  2WSE F;  3UZU A;  2HCB A;  3PFI A;  2VQE M;  1W5T A;  4G4Q A;  5EP4 A;  3VDU A;  1XXH B;  1NV9 A;  5FTK A;  1OAO C;  4DR3 M;  4AKG A;  1XC8 A;  1OGB A;  2ERC A;  4S12 A;  1E88 A;  1QYR A;  1QVR A;  1L2B A;  5EXS A;  3A98 B;  2KNZ A;  4QNR A;  3EIE A;  1IN5 A;  3SBJ A;  2LVO C;  1ZMU A;  2FOI C;  2R65 A;  1HQC A;  2XGN A;  3Q8G A;  1HR0 M;  3U6Q A;  4F1I A;  2EJS A;  3CTW B;  2C9O A;  1TF0 B;  4PCZ A;  4IBF A;  4LF6 M;  5IRE B;  3UJN A;  3FUU A;  5C18 A;  1QAO A;  2MJ5 B;  3FYC A;  5EJC A;  4AI6 A;  2R6F A;  3C3E A;  1OKS A;  2Z7J A;  4MB7 A;  4RF0 A;  1XHB A;  1QZM A;  1VEK A;  1GL7 A;  1Q3C A;  1NNU C;  1Z5B A;  2YQZ A;  4WUR A;  1YUB A;  2DAG A;  4KT0 F;  1T43 A;  2HWJ A;  2NQ8 C;  3KOY E;  4MB3 A;  1IN4 A;  1NHG C;  1Q02 A;  3RE8 A;  3HU1 A;  4BB9 A;  3VK8 A;  3RGS A;  3U5Z A;  4DR7 M;  1ED7 A;  1N34 M;  5ITX E;  4DV7 M;  1D2N A;  1JQJ C;  3D8L A;  4LRS A;  1QAM A;  5DYG A;  3R8F A;  2QBY A;  1WHC A;  4JI8 M;  1W1V A;  3LQR A;  2Y2M A;  2F5P A;  2VQF M;  1EAK A;  2BNK A;  4UN2 B;  1G4A E;  2LVN C;  3L28 A;  4FWH A;  1HT1 E;  4P16 A;  2KRU A;  2MRO B;  3LCV B;  2RGH A;  2ZAM A;  3U6D A;  3TE6 A;  1VQ1 A;  5EXX A;  1YU0 A;  3KDS E;  4F2L A;  3DOA A;  4JN6 A;  4L78 A;  3B9P A;  4M9Z A;  3VKH A;  1DV0 A;  3FTF A;  2HHH M;  5FTL A;  1SXJ E;  2O5R A;  5IWA M;  3KS4 A;  7CAT A;  3HHY A;  3C58 A;  2XD5 A;  1QO6 A;  1L2D A;  1I94 M;  4OJP A;  3KS8 A;  4MGH A;  1HNZ M;  5ITX A;  3TWL A;  2D49 A;  1D0K A;  3FUW A;  4W5W A;  3T1H M;  4GHL A;  3WHL A;  2FN2 A;  2QQ8 A;  3A45 A;  3J7A S;  2Y2N A;  2R4J A;  1MJG M;  1XB2 B;  1IXS A;  5EXT A;  3U6E A;  1ZMW A;  1E9R A;  4X66 M;  2O25 A;  4DR4 M;  1CXW A;  1NHW C;  1NY5 A;  5EQT A;  4AG6 A;  2F5N A;  3GO8 A;  3KOZ E;  2R0I A;  4I5S A;  3KXE C;  3W0F A;  4AKI A;  3HZJ A;  1W1Y A;  3FE3 A;  1HNW M;  2CHV A;  2AHM A;  1QAQ A;  4Z2K A;  2IOU A;  4LFB M;  1E32 A;  3HSH A;  2W82 A;  2FE8 A;  1SXJ A;  1OGG A;  1R2Y A;  5E6J A;  3MK6 A;  4B3T M;  1OFH A;  1GJT A;  1QDT A;  2KEB A;  3GLH B;  4M9S A;  2Z4S A;  4M0D A;  5EP3 A;  3HY5 A;  1WGL A;  2ZBK B;  2APL A;  2QEN A;  3SHG B;  2Y0Q A;  3IEC A;  2QZ4 A;  2R4E A;  1F4I A;  1R4G A;  3B7Z A;  2JP7 A;  3LVV A;  1HNX M;  3HHX A;  1OFI A;  4DR1 M;  4X62 M;  4NRW A;  1PJQ A;  1HJP A;  2L7I A;  4NOO B;  5JI2 E;  3LW5 F;  1Q39 A;  3FTC A;  2F4V M;  4PT5 A;  3D8B A;  3FRI A;  3KW6 A;  1GLN A;  1Z5C A;  4HLQ A;  4IBJ A;  1K82 A;  2JE5 A;  3WX7 A;  1P3Q Q;  4I81 A;  5DFL A;  4CIS A;  1BVS A;  3I01 M;  3FKE A;  4P17 A;  5FTN A;  3FYD A;  3TL4 X;  1PM5 A;  4OW0 A;  4DUZ M;  3M0E A;  3QWL A;  4GH9 A;  2Z4R A;  4NZ1 A;  4NSO B;  1JR3 E;  1N75 A;  2Z3X A;  4LFA M;  3GLI A;  2QCU A;  4M9X A;  2L4E A;  3MJ5 A;  3T38 A;  4NZ5 A;  1N32 M;  4CHT B;  3IG5 A;  2RKO A;  4FCW A;  2G5G X;  3QYB A;  4KOD A;  4NXN M;  4NL4 H;  4PD2 A;  1YU2 A;  4Z2H A;  2Y2H A;  3HHZ A;  5EXP A;  3V76 A;  4YY3 M;  2F5Q A;  4HMC A;  3WD0 A;  2XFT A;  4RNA A;  3AJI B;  3KP0 E;  4HME A;  1NJG A;  4DBG B;  1UFZ A;  3I51 A;  3FUX A;  3U61 B;  4NZ4 A;  2DXI A;  1IY1 A;  3K9O A;  4YHH M;  2OPF A;  2A5Y B;  2Y20 A;  3L29 A;  4D82 A;  2CHQ A;  2MR9 A;  3CF2 A;  3KOX E;  1NO1 A;  3L27 A;  2KHH A;  2WSC F;  2GNO A;  4QHT A;  3PXG A;  4JV5 M;  3GRR A;  1G8P A;  4OX9 M;  2XF3 A;  2O01 F;  3M7G A;  4GC9 A;  3L2A A;  3RGP A;  2JA2 A;  2ZM6 M;  4LJ9 A;  2J7N A;  3HWS A;  3QAU A;  1G71 A;  3AOE C;  4CJ6 A;  2L7H A;  1GKI A;  2FS1 A;  2JNH A;  1JR3 A;  2R46 A;  3HKP A;  1YUE A;  3GPY A;  1ZQ9 A;  3JAM S;  2JWS A;  4XGI A;  3AFH A;  1IY2 A;  2HL7 A;  1CK7 A;  3FUT A;  1NY6 A;  4GIP A;  4JI2 M;  1E8B A;  1IN7 A;  2ZAN A;  2BJV A;  3LQQ A;  2BG1 A;  1J5E M;  2RTS A;  2KXE A;  2DKL A;  4NSR A;  2DZL A;  2R45 A;  4GRI A;  4IBE A;  4LJ8 A;  3T6P A;  3VLF B;  1UR9 A;  4LJA A;  3GLG E;  2F5O A;  2VDB B;  5LMN M;  1R7R A;  2QP9 X;  3DZD A;  4EIW A;  1HT2 E;  2D7E A;  2CFO A;  5KQD A;  5DNY A;  1V34 A;  3SC3 A;  1E9S A;  1AIW A;  1R5L A;  1ZMV A;  1UM8 A;  1DGG A;  5EP2 A;  4HMD A;  2M60 A;  3MHV C;  4JXJ A;  2KRK A;  2FNA A;  1PJI A;  1J09 A;  1E15 A;  4OJ6 A;  3N3F A;  2J5Y A;  4GEW A;  3SAV A;  1W1T A;  2FH0 A;  2KW0 A;  1NSF A;  2LH0 A;  4MM3 B;  1IBK M;  1GPF A;  1OQY A;  4LCB A;  1O6I A;  4G4N A;  1IBL M;  4R71 A;  3VDP A;  4DR6 M;  5BPV A;  2D7G A;  3FD9 A;  1H6U A;  2C96 A;  3AL0 C;  1E6P A;  3GRV A;  1J7M A;  4R3D A;  3GLG A;  3U5Z B;  1E6R A;  2DNA A;  2L6O A;  2CV0 A;  3SAS A;  1IBM M;  3GPP A;  1R6B X;  2DI0 A;  3I4Y A;  3CGW A;  3IHP A;  4RKU F;  2UXD M;  1DGH B;  4NRV A;  4ITQ A;  2Y2G A;  2J7O A; 
#chains in the Genus database with same CATH homology
 3SMP A;  4DR5 M;  1X37 A;  2CV2 A;  4L4U A;  4B3M M;  4QHS A;  2H1R A;  2R18 A;  1L1Z A;  4LJ6 A;  3HU2 A;  1HQY E;  4GIT A;  1TDH A;  3GRY A;  3SAW A;  2UUA M;  4L8R C;  4LF7 M;  3K1J A;  4LZJ A;  3THG A;  4IIW A;  4PDG A;  1XMQ M;  3HHW A;  2UUB M;  2V6Z M;  4FWD A;  4IBC A;  5A2Q S;  2Y2J A;  1G3I A;  3NWL A;  3A46 A;  3GQ4 A;  2E5L M;  1IM2 A;  1ORY B;  1VDD A;  5KPZ A;  2KZS A;  4KO8 A;  2C5R A;  4LF8 M;  2DWM A;  4I4L A;  4XBO A;  4OU7 A;  2XZU A;  1L8Q A;  2UXB M;  4JI3 M;  3U60 B;  2Q2E B;  5ITY A;  2QPA A;  4OUI A;  2I7N A;  1ZAE A;  3SAR A;  4AZF A;  1Q3B A;  3K2L A;  4GKJ M;  1SXJ B;  2BJW A;  2VII A;  5GKN A;  3L25 A;  1I4W A;  3PNV A;  3GPU A;  5FSW A;  4Z8X A;  3HJQ A;  4IBB A;  3GPX A;  4PDI A;  3VK7 A;  1TDZ A;  2F5S A;  2UU9 M;  5LMU M;  3BOS A;  4FW9 A;  1TH2 A;  3JR4 A;  4DV1 M;  4GKK M;  4KHP M;  5IT9 S;  4BBA A;  1EE8 A;  3TWK A;  2L09 A;  3GLF A;  1K3X A;  2CV1 A;  2DHR A;  1NJF A;  1XNQ M;  2DZN B;  3GLH A;  4DV5 M;  3HGI A;  4FCT A;  3SHF A;  4MH0 E;  3NBI A;  3GLI B;  2G8L A;  2LXE A;  4LGY A;  3K8Z A;  3KOW E;  4FWG A;  4IBK A;  4FD2 A;  2JCH A;  4QNL A;  1SXJ C;  4D80 A;  4GC5 A;  3RFW A;  2I7P A;  1TH4 A;  3U6S A;  4QOS A;  4NYY A;  4DUY M;  4NY2 A;  2XEP A;  1XMO M;  3ZCB B;  2XZF A;  3R9X B;  2CHG A;  3SAT A;  3LVW A;  1YE9 A;  3U6C A;  1NNJ A;  4IBG A;  2RGO A;  1GL6 A;  3ZH9 B;  5ITQ A;  5BR8 M;  4AQY M;  4WW0 A;  5ITU A;  3WHK A;  4OVZ A;  4G4R A;  1N77 A;  2EO2 A;  1YU3 A;  4GMQ A;  3LMM A;  4LZZ A;  5C1B A;  3J27 B;  4B7F A;  3UK6 A;  2DWZ B;  4AKH A;  2C99 A;  3KSX A;  2Y2Q A;  1QAN A;  2Y21 A;  3GRU A;  3U61 A;  3U6L A;  4B7H A;  1S3S A;  5FTM A;  3VFD A;  4OJO A;  4L16 A;  1J7K A;  2LWX A;  4IJE A;  3KP1 E;  3CF0 A;  2YFQ A;  4R7G A;  3GQ3 A;  4LFC M;  4AG5 A;  3AOG A;  4JYA M;  4KLN A;  3K92 A;  5JI3 E;  3U6O A;  1XXH A;  5FTJ A;  3AKZ A;  4JI4 M;  1Z6T A;  1L1T A;  3J81 S;  4FVM A;  4II7 A;  2DWL A;  4LF4 M;  4BLC A;  3JR5 A;  2XH9 A;  3TPZ A;  2XSZ A;  4I8O A;  3J80 S;  2XD1 A;  4OJ5 A;  1IY0 A;  5IZ7 D;  3KVW A;  1FJG M;  2YNM D;  4LGM A;  3FTE A;  3KFU G;  2KZU A;  2YR0 A;  4NZ3 A;  1YU1 A;  4LJ7 A;  4LY6 A;  1G41 A;  3DA1 A;  3T15 A;  4LF5 M;  4LJ4 A;  1N33 M;  3J2P B;  3M6A A;  2P5T A;  3SYL A;  2CUZ A;  2QBY B;  1FNN A;  3GLG B;  2UXC M;  2DVW B;  4B08 A;  4G4O A;  4LRT A;  3TQS A;  3J7B A;  3GQ5 A;  2FFF B;  2X8A A;  3EIH A;  5F3W A;  1MU5 A;  2V1C A;  2UWX A;  4FCV A;  5E26 A;  3AV0 A;  3TWM A;  2C98 A;  3GP1 A;  4ZPX A;  4CGY B;  1SXJ D;  1KSF X;  3CF6 E;  4X64 M;  1NVM A;  3HU3 A;  4DV4 M;  2C9C A;  2OQ4 A;  2M5Z A;  4MGZ E;  4G6Z A;  3PVS A;  4MGK E;  3IG8 A;  4IBD A;  4LJ5 A;  2Y2K A;  4Z6Y A;  1DGH A;  2R62 A;  2XLJ A;  2Y2P A;  4DV3 M;  3E9S A;  4JI1 M;  3E4R A;  4LG2 A;  3U6P A;  3OTO M;  1IXS B;  4DV2 M;  5DYI A;  3VKG A;  3UGJ A;  1DGB A;  2KA6 B;  1XNR M;  3UMM A;  4A3V B;  4HL4 A;  3SAU A;  4NXM M;  5KPR A;  2K47 A;  1OJL A;  4IJF A;  1T3T A;  2Y0T A;  1WXQ A;  4DV0 M;  3H4M A;  4K0K M;  1N78 A;  1C1K A;  2EUC A;  5KPT A;  1K3W A;  3FTD A;  1W5S A;  1IXR C;  3U60 A;  3SMS A;  3SYK A;  1DO0 A;  1N36 M;  2EA0 A;  4QNM A;  2ZAO A;  1IN8 A;  3ZC7 B;  1IQP A;  4X65 M;  1JR3 D;  3GLF B;  2XFS A;  1MX0 A;  4MGI E;  1TH3 A;  1PJJ A;  4QOZ C;  1Z5A A;  1IN6 A;  3FUV A;  4RF1 A;  4TUW A;  4B3R M;  4NYU A;  2X4A A;  2DZO B;  3U6M A;  1XWI A;  4JI7 M;  4DV6 M;  1IXZ A;  1GVN A;  3HJS A;  4LF9 M;  1TGU A;  3KSJ A;  1YSY A;  4DR2 M;  1L2C A;  3DFZ A;  2D7H A;  4B7G A;  8CAT A;  3I4V A;  2Y2O A;  3AOE A;  4MGY E;  1R2Z A;  5KQ8 A;  5KO3 A;  2X49 A;  1QQW A;  2V1U A;  5FLX S;  3L26 A;  2UUC M;  4JI0 M;  2XSZ D;  5ITT A;  4OJL A;  4AW4 A;  5H37 D;  1KFV A;  3W0L B;  4JI5 M;  1Z59 A;  1KYI A;  3PNY A;  3Q8X A;  4L15 A;  4M0W A;  4OVZ B;  4REZ A;  4X66 M;  2CE7 A;  2LNH C;  4GHA A;  4B3S M;  2CEA A;  3SFZ A;  2HKJ A;  1YU4 A;  1DO2 A;  1DGF A;  4IBI A;  5EP1 A;  2FFJ A;  3HON A;  2Y2I A;  4JI6 M;  4D81 A;  3A42 A;  5ITR A;  1G59 A;  2DWN A;  1E94 E;  1LV7 A;  3ILK A;  3T1Y M;  2Y2L A;  3HJ8 A;  3UZU A;  2HCB A;  3PFI A;  2VQE M;  1W5T A;  4G4Q A;  5EP4 A;  3VDU A;  1XXH B;  4DR3 M;  5FTK A;  4AKG A;  1XC8 A;  2ERC A;  4S12 A;  1QYR A;  1QVR A;  1L2B A;  5EXS A;  3A98 B;  4QNR A;  3EIE A;  1IN5 A;  3SBJ A;  2R65 A;  2FOI C;  2XGN A;  1HQC A;  1HR0 M;  3U6Q A;  3CTW B;  2C9O A;  4PCZ A;  4IBF A;  4LF6 M;  5IRE B;  3UJN A;  3FUU A;  5C18 A;  1QAO A;  4AI6 A;  3FYC A;  5EJC A;  2Z7J A;  4MB7 A;  4RF0 A;  1XHB A;  1QZM A;  1GL7 A;  1Q3C A;  1NNU C;  1Z5B A;  2YQZ A;  4WUR A;  1YUB A;  2NQ8 C;  3KOY E;  1IN4 A;  1NHG C;  4BB9 A;  3RE8 A;  3HU1 A;  3VK8 A;  4DR7 M;  3RGS A;  3U5Z A;  1N34 M;  5ITX E;  4DV7 M;  1D2N A;  1JQJ C;  3D8L A;  4LRS A;  1QAM A;  5DYG A;  3R8F A;  2QBY A;  4JI8 M;  3LQR A;  2Y2M A;  2F5P A;  2VQF M;  2BNK A;  1G4A E;  3L28 A;  4FWH A;  1HT1 E;  4P16 A;  2KRU A;  2RGH A;  2ZAM A;  3U6D A;  3TE6 A;  5EXX A;  1YU0 A;  3KDS E;  3DOA A;  4JN6 A;  4L78 A;  3B9P A;  4M9Z A;  3VKH A;  3FTF A;  2HHH M;  5FTL A;  1SXJ E;  2O5R A;  5IWA M;  3KS4 A;  7CAT A;  3HHY A;  3C58 A;  2XD5 A;  1L2D A;  1I94 M;  4OJP A;  3KS8 A;  4MGH A;  1HNZ M;  5ITX A;  3TWL A;  3FUW A;  4W5W A;  3T1H M;  4GHL A;  3WHL A;  3A45 A;  3J7A S;  2Y2N A;  2R4J A;  5EXT A;  3U6E A;  1E9R A;  4DR4 M;  1NHW C;  1NY5 A;  5EQT A;  4AG6 A;  2F5N A;  3GO8 A;  3KOZ E;  4I5S A;  3KXE C;  3W0F A;  4AKI A;  1HNW M;  2CHV A;  2AHM A;  1QAQ A;  2IOU A;  4LFB M;  1E32 A;  3HSH A;  2W82 A;  2FE8 A;  1SXJ A;  1R2Y A;  5E6J A;  3MK6 A;  4B3T M;  1OFH A;  2KEB A;  3GLH B;  4M9S A;  2Z4S A;  4M0D A;  5EP3 A;  2ZBK B;  2QEN A;  3SHG B;  2Y0Q A;  2QZ4 A;  2R4E A;  3LVV A;  1HNX M;  3HHX A;  1OFI A;  4DR1 M;  4X62 M;  4NRW A;  2L7I A;  4NOO B;  5JI2 E;  1Q39 A;  3FTC A;  2F4V M;  4PT5 A;  3D8B A;  1K82 A;  3KW6 A;  1GLN A;  1Z5C A;  4HLQ A;  4IBJ A;  2JE5 A;  3WX7 A;  4I81 A;  4CIS A;  3FKE A;  5FTN A;  3TL4 X;  3FYD A;  1PM5 A;  4OW0 A;  4DUZ M;  3M0E A;  3QWL A;  4GH9 A;  2Z4R A;  4NZ1 A;  4NSO B;  1N75 A;  2Z3X A;  4LFA M;  3GLI A;  2QCU A;  4M9X A;  3MJ5 A;  3T38 A;  4NZ5 A;  1N32 M;  4CHT B;  3IG5 A;  2RKO A;  4FCW A;  2G5G X;  4KOD A;  4NXN M;  4PD2 A;  4NL4 H;  1YU2 A;  2Y2H A;  3HHZ A;  5EXP A;  4YY3 M;  2F5Q A;  2XFT A;  4RNA A;  3AJI B;  3KP0 E;  1NJG A;  3I51 A;  3FUX A;  3U61 B;  4NZ4 A;  2DXI A;  1IY1 A;  4YHH M;  2OPF A;  2A5Y B;  2Y20 A;  3L29 A;  4D82 A;  2CHQ A;  3CF2 A;  3KOX E;  3L27 A;  4QHT A;  3PXG A;  4JV5 M;  3GRR A;  1G8P A;  4OX9 M;  2XF3 A;  4GC9 A;  3M7G A;  3RGP A;  3L2A A;  2ZM6 M;  2JA2 A;  4LJ9 A;  2J7N A;  3HWS A;  3QAU A;  3AOE C;  2L7H A;  1GKI A;  2R46 A;  1JR3 A;  3HKP A;  1YUE A;  3GPY A;  1ZQ9 A;  3JAM S;  4XGI A;  3AFH A;  1IY2 A;  2HL7 A;  3FUT A;  1NY6 A;  4GIP A;  4JI2 M;  1IN7 A;  2ZAN A;  2BJV A;  3LQQ A;  2BG1 A;  1J5E M;  2KXE A;  4NSR A;  2R45 A;  4GRI A;  4IBE A;  4LJ8 A;  3VLF B;  4LJA A;  2F5O A;  5LMN M;  1R7R A;  2QP9 X;  3DZD A;  4EIW A;  1HT2 E;  2D7E A;  2CFO A;  5KQD A;  5DNY A;  3SC3 A;  1E9S A;  1UM8 A;  1DGG A;  5EP2 A;  2M60 A;  3MHV C;  4JXJ A;  2KRK A;  2FNA A;  1PJI A;  1J09 A;  4OJ6 A;  3N3F A;  3SAV A;  2KW0 A;  1NSF A;  2LH0 A;  4MM3 B;  1IBK M;  4LCB A;  4G4N A;  1IBL M;  4DR6 M;  3VDP A;  5BPV A;  2D7G A;  3FD9 A;  1H6U A;  2C96 A;  3AL0 C;  3GRV A;  4R3D A;  3GLG A;  3U5Z B;  2L6O A;  2CV0 A;  3SAS A;  1IBM M;  3GPP A;  1R6B X;  3I4Y A;  2UXD M;  1DGH B;  4NRV A;  4ITQ A;  2Y2G A;  2J7O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...