4IBEA

Ebola virus vp35 bound to small molecule
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
123
structure length
123
Chain Sequence
DISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polymerase cofactor VP35
publication title In Silico Derived Small Molecules Bind the Filovirus VP35 Protein and Inhibit Its Polymerase Cofactor Activity.
pubmed doi rcsb
source organism Ebola virus
molecule tags Transcription/transcription inhibitor
total genus 42
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ibeA01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4ibeA02
3KS8A 3L27A 3L28A 3L29A 3KS4A 4IBIA 4IBDA 4IBJA 4IJFA 3L2AA 3L26A 5BPVA 4GHLA 3FKEA 4IBBA 4GHAA 4IJEA 3L25A 4GH9A 4IBFA 4IBCA 4IBKA 4IBGA 4IBEA 4LG2A
chains in the Genus database with same CATH superfamily
1R5LA 3VKGA 1YU2A 4NZ1A 5KPRA 2ZM6M 3WX7A 4K0KM 4AI6A 2L4FA 1EAKA 1TGUA 3QYBA 1G59A 4NXMM 5KO3A 4D81A 2Y2KA 3UK6A 5FSWA 3GLGB 4HMCA 1PJTA 3JR4A 4LJ7A 2JY6B 4DUZM 2HAKA 3F92A 1AUAA 1J7KA 1NSFA 1WGNA 2KZUA 4RNAA 4ANRA 3SYLA 3FUWA 1IBLM 4X65M 2CEAA 4R71A 2DKLA 3NWLA 3KOWE 3E46A 4GH9A 2CHGA 2JUJA 4DUYM 2R4JA 3J2PB 1IBKM 1NO1A 1OJLA 2JXNA 3FTEA 4OU7A 1JR3A 4R7GA 5FTMA 5H37D 4RF1A 2L6OA 3BOSA 2EUCA 2HHHM 2KA6B 4IJFA 2GQFA 3A45A 3WD1A 2I7NA 2DWZB 3SAUA 2BJVA 3IHPA 2L09A 4LZZA 3VFDA 3GP1A 1WHCA 3TWMA 2QCUA 4HL4A 1GLNA 1HNZM 1G8PA 1R6BX 2H5XA 2F4VM 3KP1E 5JI3E 4DV6M 4NXNM 4QNLA 2LVOC 1E6ZA 3U6LA 1L2DA 1PJIA 2BWEA 3J7AS 2CE7A 3A98B 2CWBA 4Z8XA 1OTRA 3JAMS 4M0DA 4PD2A 4LRTA 4RF0A 2UXBM 3U5ZA 2Y2QA 4DR2M 2DWMA 4JN6A 2Q2EB 3LCUA 4MGZE 1T43A 3MK6A 4LJAA 2WSEF 3DOAA 2R45A 3NBIA 4L6V6 4DBGB 3GLIB 2X4AA 2LVPC 2CHVA 4L8RC 2XSZD 2J5YA 5F3WA 1GJSA 1IM2A 2MR9A 1E94E 1I94M 3ZCBB 4QOZC 4OJ6A 4F1IA 3GLGA 2XFSA 4OJ5A 1YU0A 1IXRC 4AW4A 2JWSA 2QZ4A 3B7NA 4I8OA 3SHGB 4LJ6A 2Y2JA 3VDUA 1QZEA 3U6MA 1NV8A 1ZMVA 4JI3M 3UGJA 4TUWA 1HQCA 4LCBA 2C98A 3GPXA 3VK8A 2OO9A 3Q8XA 4B7FA 4WP2A 4JI6M 4Z2JA 2ZBKB 4QHTA 1KS0A 2KNAA 4KLNA 3U6EA 2UWXA 4JI1M 2QQ8A 4B08A 1QANA 4IBDA 4LRSA 1UFZA 1ORYB 2KEBA 4GC5A 3ZC7B 2K0BX 2DI0A 3K1JA 3A42A 3CTWB 5BPVA 1R7RA 1XXHE 5FTLA 1D2NA 4OJOA 2XLJA 3I4VA 1E9SA 1QUTA 4GRIA 4G4OA 3FTFA 2Y2PA 1HNXM 5EP3A 2EO2A 3GPYA 2JY7A 2J7NA 3KP0E 1RU3A 3UMMA 3SAVA 1Z6TA 2JNHA 4M9SA 3E4RA 3J81S 1K3XA 1ZQ9A 4CISA 5GKNA 3T1HM 1W1VA 2XZFA 3M0EA 1JQJC 3GLFB 5FTJA 1C7YA 4HEOA 1CK7A 4B7GA 1QO6A 1OAIA 1NJFA 4JYAM 4II7A 3D8LA 3HZJA 3L29A 5KQ8A 2FFFB 3M7PA 4FCTA 1R2ZA 3FD9A 2ZAOA 4DR5M 3K2LA 3FRHA 1W1PA 2LVNC 1QDTA 1Z5BA 2QSFX 3I04M 3AOEA 3MQLA 4S12A 4JXJA 2G3QA 1XB2B 3C9PA 8CATA 3CGWA 3WD3A 3FRIA 1DGFA 1VQ1A 3A46A 1OGGA 1ZMWA 4PT5A 4CIZA 2LWXA 3NBXX 3K9PA 1YUEA 1G41A 3HWSA 1T3TA 2P5TA 1T6OA 1X37A 3HY5A 1DV0A 3PVSA 1IFYA 1L2BA 5EP1A 1HJPA 1Q39A 2I7PA 3IECA 1A5TA 1ED7A 4GC9A 2DAGA 3GRRA 3U5ZB 2CV2A 2R44A 2XSZA 4QNMA 4GITA 1TH3A 2L2DA 2C9OA 4JI0M 1XC8A 3T15A 2L7IA 4W5WA 1F4IA 4MM3B 1HT2E 1BVSA 3FYCA 2G8LA 3E21A 1G71A 5LMUM 1J5EM 1SXJA 2OQ4A 4LF8M 1LV7A 1XNRM 2KNVA 4LF4M 3HJSA 1V34A 2QENA 2VDBB 1V92A 3EIEA 4ZPXA 3H4JA 3R8FA 4FD2A 2R18A 3B9PA 4NZ3A 1E9RA 5EXPA 2A5YB 5ITQA 4NYYA 2L4EA 4YHHM 2Y21A 2OPFA 4ITQA 2MGWA 4AKIA 4NYUA 3HU2A 1UM8A 4GEWA 2FE8A 1SG9A 3OTOM 4B3SM 1GXDA 5E6JA 3M6AA 2QP9X 2Y2HA 4P16A 4JI5M 1XNQM 2VQEM 3I01M 2ERCA 4MB5A 2DXIA 2KRUA 2LNHC 1P3QQ 1Q3CA 1YE9A 2YQZA 3UJNA 2FN2A 3U6PA 1E88A 1Z5CA 2R65A 3B89A 1OIZA 3ZH9B 2DAKA 2K47A 3K92A 2QPAA 3GLFA 1GL6A 3FTDA 3FUTA 3QYEA 4FCVA 3J27B 1QUSA 4JI7M 2D49A 2HWJA 3SC3A 2XD1A 3C58A 3HGIA 3FE3A 4DR4M 1PJSA 1EIJA 4FCWA 3THGA 2Y2NA 3HKPA 2DVWB 3GLHB 4MGHA 1HR0M 1DGHA 4KT0F 3CF0A 1KFVA 4L16A 3L25A 1CXWA 1E6NA 3WD4A 3B7QA 3DA1A 1K82A 4Z2GA 4LF6M 4A3VB 2CV0A 1EFUB 4LG2A 1QVRA 4B7HA 3SAWA 4NSOB 1PDCA 3SYKA 1IXSA 1E6PA 1UR8A 1AIPC 3K9OA 1YSYA 1TTEA 3B7ZA 4LGMA 1IN5A 3W67A 3LVVA 5C18A 1R2YA 1QZMA 5EXSA 4LFAM 1W1TA 3AKZA 2CFOA 5C1BA 4PCZA 1MX0A 3V76A 3KSJA 4FVMA 2AHMA 3VDPA 1O6IA 3GQ3A 2MH8A 4AKGA 2JE5A 2DAEA 3U6CA 3M7GA 3AJIB 1Y8GA 1OAOC 3BBZA 3U61B 2E5LM 2NQ8C 3KXEC 1FJGM 5DNYA 1MJGM 2KRKA 2KZSA 2YR0A 2ZANA 2R4EA 4KO8A 5LMNM 2UUBM 5ITXA 4LF7M 1MN3A 5KPZA 2LXEA 1VEGA 2V6ZM 1L6JA 1TDZA 1TH4A 3C3EA 1GO5A 4PDIA 1GPFA 4Z2KA 1EE8A 3LCVB 1SXJB 2EKFA 3LW5F 3L28A 3T1YM 1IY1A 2V5OA 4IBJA 3GLGE 3VLFB 4XGIA 2DWNA 2KW0A 3K8ZA 2G5GX 4M9XA 2Z8YM 4OJLA 2BJWA 3IG8A 3SATA 4B3RM 1N77A 1TH2A 3ILKA 2RTSA 1G4AE 1YUBA 1N34M 1QAOA 1V33A 3WHLA 3HONA 2UXDM 3RFWA 4AG6A 1NNJA 4JI4M 1IXZA 4LF5M 3KFUG 1IY2A 2X8AA 2KNZA 2QHOB 3AOEC 2JCHA 4NZ4A 2N35A 1FNNA 3GPUA 3GLHA 2LBCA 3FYDA 3BXWA 3W0FA 3RE8A 5ITYA 2Y2MA 3KOZE 2UU9M 4NRVA 4MGIE 3Q8GA 4TX8A 1G3IA 3GRUA 1E6RA 4Z2LA 4OJPA 1YU4A 4Y28F 1NHGC 2VF7A 5E26A 1N33M 2K9DA 2HKJA 2F5PA 2Y2GA 2FH0A 1L1TA 4Z2HA 3FUUA 1DGHB 1OKSA 2DAMA 2XH9A 4LJ5A 1E32A 3SASA 4GHAA 5A2QS 1C1KA 1NJGA 1SXJC 3HHXA 4LF9M 2Y2OA 4BBAA 3WD0A 1N78A 1L2CA 1IXSB 2VIIA 3U6SA 1QAQA 3KW6A 3U61A 1XMQM 3WHKA 4X66M 5EJCA 5EXXA 5ITUA 2XZUA 2L7HA 3R9XB 2DHYA 3VKHA 4DR6M 1YU1A 3HSHA 3FTCA 3U6OA 3KS8A 4OUIA 2O25A 1J09A 2D7EA 3KS4A 4KODA 3AL0C 2XEPA 1E8BA 5KQDA 3GLIE 5BR8M 2BG1A 3MMPA 4LJ8A 2Z4RA 3AOGA 1H6UA 2APLA 2GNOA 3TWLA 4OX9M 5FTKA 4LFBM 4CHTB 4NL4H 2C99A 5JI2E 2F5OA 1GKIA 4I81A 2DZOB 2UUCM 3LMMA 1NY5A 3SMPA 3GRVA 1I4WA 1QYRA 4IBBA 5IZ7D 3ZQJA 1H0IA 4LZJA 5ITRA 4MB3A 2Z4SA 2Y20A 1QAMA 4DV3M 2LHCA 4DR1M 2V1UA 2HL7A 2XD5A 3U6QA 3DZDA 2CP8A 1SXJE 2OOAA 3B74A 1N75A 3KDSE 4GKKM 1WXQA 4IBEA 1N32M 3N3FA 2F5QA 3CF6E 4BLCA 1DO0A 2R62A 4OW0A 4QNRA 2FNAA 4B3MM 4IBIA 1D0LA 3SBJA 1NNUC 1TR8A 3AFHA 3AV0A 2O01F 3QWLA 3KOXE 4MGKE 1NY6A 1R4GA 2FFJA 4FWDA 2Y0QA 1D0MA 3HX3A 1IN8A 2V1CA 3KSXA 4UN2B 1HQYE 2YNMD 4B3TM 1UR9A 2BWBA 3SHFA 4G4NA 1PRBA 3RGPA 1DGGA 2DHRA 1WGLA 1XXHB 4M0WA 3FKEA 1KSFX 1W5TA 3HU1A 5L8RF 4LJ9A 2ZTCA 4LFCM 1E15A 2Y2IA 4OVZB 3JR5A 1IQPA 1JR3E 4P17A 5ITTA 4LJ4A 3E9SA 4L78A 2Z3XA 2ZTDA 4IBCA 3HHWA 4QHSA 5DYGA 4D80A 3I4YA 3GLFE 3W68A 1NHWC 4IBKA 4DR7M 2R46A 1ZMUA 4IBGA 1OFIA 4G4RA 4G3OA 1PJQA 4HLQA 3SARA 3WD2A 5EP2A 5EP4A 3IG5A 2XF3A 1OQYA 3HJQA 4NC6A 4EIWA 1QQWA 2M60A 1NV9A 1TF0B 1PGYA 5EXTA 4X64M 2EJSA 4X62M 3TWKA 2DWLA 1PM5A 4G6ZA 4RKUF 4GKJM 2B3TA 3FUVA 4XBOA 4PDGA 2KDLA 1N36M 4Z6YA 1XHBA 2VQFM 4AQYM 2LTUA 1OFHA 2VF8A 4M9ZA 2RRUA 7CATA 1YU3A 4AG5A 2Z7JA 1Q02A 3D8BA 3HHZA 2ZAMA 4L4UA 2QBYB 1W1YA 4MB4A 2RGHA 2M5ZA 5IREB 2JY8A 2X49A 1VDDA 4WURA 1KYIA 1LTMA 1H8PA 3PNYA 2D7HA 4REZA 3U60B 2IOUA 1NVMA 5KPTA 4NRWA 4F2LA 2C96A 3LVWA 4D82A 2DNAA 2MROB 3GQ5A 3VK7A 4DV7M 2CHQA 2DZNB 1L8QA 3L2AA 2WSFF 5FTNA 5IWAM 2KXEA 4NSRA 3L26A 2KHHA 3W0LB 1W5SA 1IN6A 1GVNA 2EKKA 2HCBA 2JP7A 1OIPA 4R3DA 5ITXE 4NZ5A 3MJ5A 2EA0A 4Q7JA 2WSCF 3RGSA 2C5RA 2JY5A 3T38A 3J80S 3KVWA 3TL4X 4I5SA 4HMDA 4WW0A 2CRUA 1IY0A 2LH0A 3HJ8A 3C3DA 3LQQA 2LVAA 3LQRA 1GL7A 3MHVC 4IIWA 3TPZA 4DV1M 4AKHA 2Y2LA 1Z59A 3CF2A 4MH0E 1VEKA 4AZFA 1PJJA 1DO2A 1XXHA 1SXJD 1IN4A 4XK8F 5DFLA 4JI2M 4DV5M 2UUAM 4JV5M 5IT9S 4MGYE 2OOBA 4QOSA 4OVZA 4GMQA 1Q3BA 3GO8A 4YY3M 1HNWM 4DR3M 1OGBA 1AIWA 4BB9A 1QDRA 4Z2IA 2F5SA 1L1ZA 2MJ5B 2BNKA 4L15A 3PNVA 2JZ1A 2O5RA 3H4MA 3I51A 3HHYA 3UZUA 1TDHA 1YLAA 1IN7A 1WR1B 3PXGA 2UXCM 2Y0TA 4DV4M 3GLHE 4GIPA 3FUXA 4MB7A 2CV1A 1JR3D 1VEJA 1VG5A 1GOIA 1K3WA 1GJTA 2W82A 1Z5AA 2RKOA 3PFIA 5DYIA 3TE6A 1ZAEA 3QAUA 4IBFA 1J7MA 2H1RA 3TQSA 3HU3A 4HMEA 2R6FA 4KHPM 4DV0M 3SMSA 2QBYA 3U6DA 4CJ6A 4JI8M 2J7OA 1D0KA 1CUKA 4FWHA 1DGBA 3L27A 4NOOB 2QNJA 5EQTA 4FWGA 1XMOM 2D7GA 3U60A 4LY6A 2DZLA 2RGOA 5FLXS 2FS1A 2F5NA 3KOYE 3DFZA 1IBMM 2LVQD 3SFZA 2R0IA 2XGNA 2DAIA 2JZ0A 2JA2A 4GHLA 1S3SA 1H0GA 1JB0F 3GLIA 1ZV1A 4LGYA 1MU5A 3EIHA 4I4LA 4IJEA 2K6BA 4CGYB 4G4QA 1GABA 1XWIA 3GRYA 1VDLA 4DV2M 1WJ7A 3GQ4A 1HT1E 4FW9A 2C9CA 2YFQA 3J7BA 2CUZA 4NY2A 2XFTA 2WZJA 3T6PA 2DENA 3GPPA 2FOIC 2LHGA 1WIVA
chains in the Genus database with same CATH topology
3VKGA 1YU2A 4NZ1A 5KPRA 2ZM6M 3WX7A 4K0KM 4AI6A 1TGUA 1G59A 4NXMM 5KO3A 4D81A 2Y2KA 3UK6A 5FSWA 3GLGB 3JR4A 4LJ7A 4DUZM 1J7KA 1NSFA 2KZUA 4RNAA 3SYLA 3FUWA 1IBLM 4X65M 2CEAA 3NWLA 3KOWE 4GH9A 2CHGA 4DUYM 2R4JA 3J2PB 1IBKM 1OJLA 3FTEA 4OU7A 1JR3A 4R7GA 5FTMA 5H37D 4RF1A 2L6OA 3BOSA 2EUCA 2HHHM 2KA6B 4IJFA 3A45A 2I7NA 2DWZB 3SAUA 2BJVA 2L09A 4LZZA 3VFDA 3GP1A 3TWMA 2QCUA 4HL4A 1GLNA 1HNZM 1G8PA 1R6BX 2F4VM 3KP1E 5JI3E 4DV6M 4NXNM 4QNLA 3U6LA 1L2DA 1PJIA 3J7AS 2CE7A 3A98B 4Z8XA 3JAMS 4M0DA 4PD2A 4LRTA 4RF0A 2UXBM 3U5ZA 2Y2QA 4DR2M 2DWMA 4JN6A 2Q2EB 4MGZE 3MK6A 4LJAA 3DOAA 2R45A 3NBIA 3GLIB 2X4AA 4L8RC 2CHVA 2XSZD 5F3WA 1IM2A 1E94E 1I94M 3ZCBB 4QOZC 4OJ6A 3GLGA 2XFSA 4OJ5A 1YU0A 1IXRC 4AW4A 2QZ4A 4I8OA 3SHGB 4LJ6A 2Y2JA 3VDUA 3U6MA 4JI3M 3UGJA 4TUWA 1HQCA 4LCBA 2C98A 3GPXA 3VK8A 3Q8XA 4B7FA 4JI6M 2ZBKB 4QHTA 4KLNA 3U6EA 4JI1M 4B08A 1QANA 4IBDA 4LRSA 4GC5A 1ORYB 2KEBA 3ZC7B 3K1JA 3A42A 3CTWB 5BPVA 1R7RA 5FTLA 4OJOA 1D2NA 2XLJA 3I4VA 1E9SA 4GRIA 4G4OA 3FTFA 2Y2PA 1HNXM 5EP3A 2EO2A 3GPYA 2J7NA 3KP0E 3UMMA 3SAVA 1Z6TA 1K3XA 4M9SA 3E4RA 3J81S 1ZQ9A 4CISA 5GKNA 3T1HM 2XZFA 3M0EA 1JQJC 3GLFB 5FTJA 4B7GA 1NJFA 4JYAM 4II7A 3D8LA 3L29A 5KQ8A 2FFFB 4FCTA 1R2ZA 3FD9A 2ZAOA 4DR5M 3K2LA 1Z5BA 3AOEA 4S12A 4JXJA 8CATA 1DGFA 3A46A 4PT5A 2LWXA 1YUEA 1G41A 3HWSA 1T3TA 2P5TA 1X37A 3PVSA 1L2BA 5EP1A 2I7PA 1Q39A 4GC9A 3GRRA 3U5ZB 2CV2A 2XSZA 4QNMA 4GITA 1TH3A 2C9OA 4JI0M 1XC8A 3T15A 2L7IA 4W5WA 4MM3B 1HT2E 3FYCA 2G8LA 5LMUM 1J5EM 1SXJA 2OQ4A 4LF8M 1LV7A 1XNRM 4LF4M 3HJSA 2QENA 4ZPXA 3EIEA 1YU4A 4NZ3A 3R8FA 4FD2A 2R18A 3B9PA 1E9RA 5EXPA 2A5YB 5ITQA 4NYYA 2OPFA 4YHHM 2Y21A 4AKIA 4ITQA 4NYUA 3HU2A 1UM8A 2FE8A 4B3SM 3OTOM 5E6JA 3M6AA 2QP9X 2Y2HA 4P16A 4JI5M 1XNQM 2VQEM 2ERCA 2DXIA 2KRUA 2LNHC 1Q3CA 1YE9A 2YQZA 3UJNA 3U6PA 1Z5CA 2R65A 3ZH9B 2K47A 3K92A 2QPAA 3GLFA 1GL6A 3FTDA 3FUTA 4FCVA 3J27B 4JI7M 3SC3A 2XD1A 3C58A 3HGIA 4DR4M 4FCWA 3THGA 2Y2NA 3HKPA 2DVWB 3GLHB 4MGHA 1HR0M 1DGHA 3CF0A 1KFVA 4L16A 3L25A 3DA1A 1K82A 4LF6M 4A3VB 2CV0A 4LG2A 1QVRA 4B7HA 3SAWA 4NSOB 2UWXA 3SYKA 1YSYA 4LGMA 1IN5A 5C18A 3LVVA 1R2YA 1QZMA 5EXSA 4LFAM 3AKZA 2CFOA 5C1BA 4PCZA 1MX0A 3KSJA 4FVMA 2AHMA 3VDPA 3GQ3A 4AKGA 2JE5A 3U6CA 3M7GA 3AJIB 3U61B 2E5LM 2NQ8C 3KXEC 1FJGM 5DNYA 2KZSA 2KRKA 2YR0A 2ZANA 2UUBM 2R4EA 4KO8A 5LMNM 4LF7M 5ITXA 5KPZA 2LXEA 2V6ZM 1TDZA 1TH4A 4PDIA 1EE8A 1SXJB 3T1YM 3L28A 1IY1A 4IBJA 3VLFB 4XGIA 2DWNA 2KW0A 3K8ZA 2G5GX 4M9XA 4OJLA 2BJWA 3IG8A 3SATA 4B3RM 1N77A 1TH2A 3ILKA 1G4AE 1YUBA 1N34M 1QAOA 3WHLA 3HONA 2UXDM 3RFWA 4AG6A 1NNJA 4JI4M 1IXZA 4LF5M 3KFUG 1IY2A 2X8AA 3AOEC 2JCHA 4NZ4A 1FNNA 3GPUA 3GLHA 3FYDA 3W0FA 3RE8A 5ITYA 2Y2MA 3KOZE 2UU9M 4NRVA 4MGIE 1G3IA 3GRUA 4OJPA 5E26A 1NHGC 1N33M 2HKJA 2F5PA 2Y2GA 1L1TA 3FUUA 1DGHB 2XH9A 4LJ5A 1E32A 3SASA 4GHAA 5A2QS 1C1KA 1NJGA 1SXJC 3HHXA 2Y2OA 4BBAA 1N78A 1L2CA 1IXSB 2VIIA 3U6SA 1QAQA 3KW6A 3U61A 1XMQM 3WHKA 4X66M 5EJCA 5EXXA 5ITUA 2XZUA 2L7HA 3R9XB 3VKHA 1YU1A 4DR6M 3HSHA 3FTCA 3U6OA 3KS8A 4OUIA 1J09A 2D7EA 3KS4A 4KODA 3AL0C 2XEPA 5KQDA 5BR8M 2BG1A 4OX9M 4LJ8A 2Z4RA 3AOGA 1H6UA 3TWLA 5FTKA 4LFBM 4CHTB 4NL4H 2C99A 5JI2E 2F5OA 1GKIA 4I81A 2DZOB 2UUCM 3LMMA 1NY5A 3SMPA 3GRVA 1I4WA 1QYRA 4IBBA 5IZ7D 4LZJA 5ITRA 2Z4SA 2Y20A 1QAMA 4DV3M 4DR1M 2V1UA 2HL7A 2XD5A 3U6QA 3DZDA 3KDSE 1SXJE 4GKKM 1N75A 1WXQA 4IBEA 3N3FA 2F5QA 3CF6E 4BLCA 1DO0A 2R62A 4OW0A 4QNRA 2FNAA 4B3MM 4IBIA 3SBJA 1NNUC 3AFHA 3AV0A 3QWLA 4MGKE 3KOXE 1NY6A 2FFJA 4FWDA 2Y0QA 1IN8A 2V1CA 3KSXA 4B3TM 1HQYE 2YNMD 3SHFA 4G4NA 3RGPA 1DGGA 1XXHB 2DHRA 4M0WA 3FKEA 1KSFX 1W5TA 3HU1A 4LFCM 4LJ9A 2Y2IA 4OVZB 3JR5A 1IQPA 5ITTA 4LJ4A 3E9SA 4L78A 4IBCA 3HHWA 4QHSA 5DYGA 4D80A 3I4YA 1NHWC 4IBKA 4DR7M 2R46A 4IBGA 1OFIA 4G4RA 3SARA 4HLQA 5EP2A 5EP4A 3IG5A 2XF3A 3HJQA 4EIWA 1QQWA 2M60A 4X64M 5EXTA 4X62M 2DWLA 3TWKA 4GKJM 1PM5A 4G6ZA 3FUVA 4XBOA 4PDGA 1N36M 4Z6YA 1XHBA 2VQFM 4AQYM 1OFHA 4M9ZA 7CATA 1YU3A 4AG5A 2Z7JA 3D8BA 3HHZA 2ZAMA 4L4UA 2QBYB 2RGHA 2M5ZA 5IREB 2X49A 1VDDA 4WURA 1KYIA 3PNYA 2D7HA 4REZA 3U60B 2IOUA 1NVMA 5KPTA 4NRWA 2C96A 3LVWA 4D82A 3VK7A 3GQ5A 4DV7M 2CHQA 2DZNB 1L8QA 3L2AA 5FTNA 5IWAM 3L26A 2KXEA 4NSRA 1N32M 3W0LB 2Z3XA 1W5SA 1IN6A 1GVNA 2HCBA 4R3DA 5ITXE 4NZ5A 3MJ5A 2EA0A 3RGSA 2C5RA 3T38A 3TL4X 3J80S 3KVWA 4I5SA 4WW0A 1IY0A 2LH0A 3HJ8A 3LQQA 3MHVC 4IIWA 3LQRA 1GL7A 4DV1M 3TPZA 4LF9M 4AKHA 2Y2LA 1Z59A 3CF2A 4MH0E 4AZFA 1PJJA 1DO2A 1XXHA 1SXJD 1IN4A 4JI2M 4DV5M 2UUAM 4JV5M 5IT9S 4MGYE 4QOSA 4OVZA 4GMQA 1Q3BA 3GO8A 4YY3M 1HNWM 4DR3M 4BB9A 2F5SA 1L1ZA 2BNKA 4L15A 3PNVA 2O5RA 3H4MA 3I51A 3HHYA 3UZUA 1TDHA 1IN7A 3PXGA 2UXCM 2Y0TA 4DV4M 4GIPA 3FUXA 4MB7A 2CV1A 1JR3D 1K3WA 2W82A 1Z5AA 2RKOA 3PFIA 5DYIA 3TE6A 1ZAEA 3QAUA 4IBFA 2H1RA 3TQSA 3HU3A 4KHPM 4DV0M 3SMSA 2QBYA 3U6DA 4JI8M 2J7OA 4FWHA 1DGBA 3L27A 4NOOB 5EQTA 4FWGA 1XMOM 2D7GA 3U60A 4LY6A 2RGOA 5FLXS 2F5NA 3KOYE 3DFZA 1IBMM 3SFZA 2XGNA 2JA2A 4GHLA 1S3SA 3GLIA 4LGYA 1MU5A 3EIHA 4I4LA 4IJEA 4CGYB 4G4QA 1XWIA 3GRYA 4DV2M 3GQ4A 1HT1E 4FW9A 2C9CA 2YFQA 3J7BA 2CUZA 4NY2A 2XFTA 3GPPA 2FOIC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KS8 A;  3L27 A;  3L28 A;  3L29 A;  3KS4 A;  4IBI A;  4IBD A;  4IBJ A;  4IJF A;  3L2A A;  3L26 A;  5BPV A;  4GHL A;  3FKE A;  4IBB A;  4GHA A;  4IJE A;  3L25 A;  4GH9 A;  4IBF A;  4IBC A;  4IBK A;  4IBG A;  4IBE A;  4LG2 A; 
#chains in the Genus database with same CATH topology
 1R5L A;  3VKG A;  1YU2 A;  4NZ1 A;  5KPR A;  2ZM6 M;  3WX7 A;  4K0K M;  4AI6 A;  2L4F A;  1EAK A;  1TGU A;  3QYB A;  1G59 A;  4NXM M;  5KO3 A;  4D81 A;  2Y2K A;  3UK6 A;  5FSW A;  3GLG B;  4HMC A;  1PJT A;  3JR4 A;  4LJ7 A;  2JY6 B;  4DUZ M;  2HAK A;  3F92 A;  1AUA A;  1J7K A;  1NSF A;  1WGN A;  2KZU A;  4RNA A;  4ANR A;  3SYL A;  3FUW A;  1IBL M;  4X65 M;  2CEA A;  4R71 A;  2DKL A;  3NWL A;  3KOW E;  3E46 A;  4GH9 A;  2CHG A;  2JUJ A;  4DUY M;  2R4J A;  3J2P B;  1IBK M;  1NO1 A;  1OJL A;  2JXN A;  3FTE A;  4OU7 A;  1JR3 A;  4R7G A;  5FTM A;  5H37 D;  4RF1 A;  2L6O A;  3BOS A;  2EUC A;  2HHH M;  2KA6 B;  4IJF A;  2GQF A;  3A45 A;  3WD1 A;  2I7N A;  2DWZ B;  3SAU A;  2BJV A;  3IHP A;  2L09 A;  4LZZ A;  3VFD A;  3GP1 A;  1WHC A;  3TWM A;  2QCU A;  4HL4 A;  1GLN A;  1HNZ M;  1G8P A;  1R6B X;  2H5X A;  2F4V M;  3KP1 E;  5JI3 E;  4DV6 M;  4NXN M;  4QNL A;  2LVO C;  1E6Z A;  3U6L A;  1L2D A;  1PJI A;  2BWE A;  3J7A S;  2CE7 A;  3A98 B;  2CWB A;  4Z8X A;  1OTR A;  3JAM S;  4M0D A;  4PD2 A;  4LRT A;  4RF0 A;  2UXB M;  3U5Z A;  2Y2Q A;  4DR2 M;  2DWM A;  4JN6 A;  2Q2E B;  3LCU A;  4MGZ E;  1T43 A;  3MK6 A;  4LJA A;  2WSE F;  3DOA A;  2R45 A;  3NBI A;  4L6V 6;  4DBG B;  3GLI B;  2X4A A;  2LVP C;  2CHV A;  4L8R C;  2XSZ D;  2J5Y A;  5F3W A;  1GJS A;  1IM2 A;  2MR9 A;  1E94 E;  1I94 M;  3ZCB B;  4QOZ C;  4OJ6 A;  4F1I A;  3GLG A;  2XFS A;  4OJ5 A;  1YU0 A;  1IXR C;  4AW4 A;  2JWS A;  2QZ4 A;  3B7N A;  4I8O A;  3SHG B;  4LJ6 A;  2Y2J A;  3VDU A;  1QZE A;  3U6M A;  1NV8 A;  1ZMV A;  4JI3 M;  3UGJ A;  4TUW A;  1HQC A;  4LCB A;  2C98 A;  3GPX A;  3VK8 A;  2OO9 A;  3Q8X A;  4B7F A;  4WP2 A;  4JI6 M;  4Z2J A;  2ZBK B;  4QHT A;  1KS0 A;  2KNA A;  4KLN A;  3U6E A;  2UWX A;  4JI1 M;  2QQ8 A;  4B08 A;  1QAN A;  4IBD A;  4LRS A;  1UFZ A;  1ORY B;  2KEB A;  4GC5 A;  3ZC7 B;  2K0B X;  2DI0 A;  3K1J A;  3A42 A;  3CTW B;  5BPV A;  1R7R A;  1XXH E;  5FTL A;  1D2N A;  4OJO A;  2XLJ A;  3I4V A;  1E9S A;  1QUT A;  4GRI A;  4G4O A;  3FTF A;  2Y2P A;  1HNX M;  5EP3 A;  2EO2 A;  3GPY A;  2JY7 A;  2J7N A;  3KP0 E;  1RU3 A;  3UMM A;  3SAV A;  1Z6T A;  2JNH A;  4M9S A;  3E4R A;  3J81 S;  1K3X A;  1ZQ9 A;  4CIS A;  5GKN A;  3T1H M;  1W1V A;  2XZF A;  3M0E A;  1JQJ C;  3GLF B;  5FTJ A;  1C7Y A;  4HEO A;  1CK7 A;  4B7G A;  1QO6 A;  1OAI A;  1NJF A;  4JYA M;  4II7 A;  3D8L A;  3HZJ A;  3L29 A;  5KQ8 A;  2FFF B;  3M7P A;  4FCT A;  1R2Z A;  3FD9 A;  2ZAO A;  4DR5 M;  3K2L A;  3FRH A;  1W1P A;  2LVN C;  1QDT A;  1Z5B A;  2QSF X;  3I04 M;  3AOE A;  3MQL A;  4S12 A;  4JXJ A;  2G3Q A;  1XB2 B;  3C9P A;  8CAT A;  3CGW A;  3WD3 A;  3FRI A;  1DGF A;  1VQ1 A;  3A46 A;  1OGG A;  1ZMW A;  4PT5 A;  4CIZ A;  2LWX A;  3NBX X;  3K9P A;  1YUE A;  1G41 A;  3HWS A;  1T3T A;  2P5T A;  1T6O A;  1X37 A;  3HY5 A;  1DV0 A;  3PVS A;  1IFY A;  1L2B A;  5EP1 A;  1HJP A;  1Q39 A;  2I7P A;  3IEC A;  1A5T A;  1ED7 A;  4GC9 A;  2DAG A;  3GRR A;  3U5Z B;  2CV2 A;  2R44 A;  2XSZ A;  4QNM A;  4GIT A;  1TH3 A;  2L2D A;  2C9O A;  4JI0 M;  1XC8 A;  3T15 A;  2L7I A;  4W5W A;  1F4I A;  4MM3 B;  1HT2 E;  1BVS A;  3FYC A;  2G8L A;  3E21 A;  1G71 A;  5LMU M;  1J5E M;  1SXJ A;  2OQ4 A;  4LF8 M;  1LV7 A;  1XNR M;  2KNV A;  4LF4 M;  3HJS A;  1V34 A;  2QEN A;  2VDB B;  1V92 A;  3EIE A;  4ZPX A;  3H4J A;  3R8F A;  4FD2 A;  2R18 A;  3B9P A;  4NZ3 A;  1E9R A;  5EXP A;  2A5Y B;  5ITQ A;  4NYY A;  2L4E A;  4YHH M;  2Y21 A;  2OPF A;  4ITQ A;  2MGW A;  4AKI A;  4NYU A;  3HU2 A;  1UM8 A;  4GEW A;  2FE8 A;  1SG9 A;  3OTO M;  4B3S M;  1GXD A;  5E6J A;  3M6A A;  2QP9 X;  2Y2H A;  4P16 A;  4JI5 M;  1XNQ M;  2VQE M;  3I01 M;  2ERC A;  4MB5 A;  2DXI A;  2KRU A;  2LNH C;  1P3Q Q;  1Q3C A;  1YE9 A;  2YQZ A;  3UJN A;  2FN2 A;  3U6P A;  1E88 A;  1Z5C A;  2R65 A;  3B89 A;  1OIZ A;  3ZH9 B;  2DAK A;  2K47 A;  3K92 A;  2QPA A;  3GLF A;  1GL6 A;  3FTD A;  3FUT A;  3QYE A;  4FCV A;  3J27 B;  1QUS A;  4JI7 M;  2D49 A;  2HWJ A;  3SC3 A;  2XD1 A;  3C58 A;  3HGI A;  3FE3 A;  4DR4 M;  1PJS A;  1EIJ A;  4FCW A;  3THG A;  2Y2N A;  3HKP A;  2DVW B;  3GLH B;  4MGH A;  1HR0 M;  1DGH A;  4KT0 F;  3CF0 A;  1KFV A;  4L16 A;  3L25 A;  1CXW A;  1E6N A;  3WD4 A;  3B7Q A;  3DA1 A;  1K82 A;  4Z2G A;  4LF6 M;  4A3V B;  2CV0 A;  1EFU B;  4LG2 A;  1QVR A;  4B7H A;  3SAW A;  4NSO B;  1PDC A;  3SYK A;  1IXS A;  1E6P A;  1UR8 A;  1AIP C;  3K9O A;  1YSY A;  1TTE A;  3B7Z A;  4LGM A;  1IN5 A;  3W67 A;  3LVV A;  5C18 A;  1R2Y A;  1QZM A;  5EXS A;  4LFA M;  1W1T A;  3AKZ A;  2CFO A;  5C1B A;  4PCZ A;  1MX0 A;  3V76 A;  3KSJ A;  4FVM A;  2AHM A;  3VDP A;  1O6I A;  3GQ3 A;  2MH8 A;  4AKG A;  2JE5 A;  2DAE A;  3U6C A;  3M7G A;  3AJI B;  1Y8G A;  1OAO C;  3BBZ A;  3U61 B;  2E5L M;  2NQ8 C;  3KXE C;  1FJG M;  5DNY A;  1MJG M;  2KRK A;  2KZS A;  2YR0 A;  2ZAN A;  2R4E A;  4KO8 A;  5LMN M;  2UUB M;  5ITX A;  4LF7 M;  1MN3 A;  5KPZ A;  2LXE A;  1VEG A;  2V6Z M;  1L6J A;  1TDZ A;  1TH4 A;  3C3E A;  1GO5 A;  4PDI A;  1GPF A;  4Z2K A;  1EE8 A;  3LCV B;  1SXJ B;  2EKF A;  3LW5 F;  3L28 A;  3T1Y M;  1IY1 A;  2V5O A;  4IBJ A;  3GLG E;  3VLF B;  4XGI A;  2DWN A;  2KW0 A;  3K8Z A;  2G5G X;  4M9X A;  2Z8Y M;  4OJL A;  2BJW A;  3IG8 A;  3SAT A;  4B3R M;  1N77 A;  1TH2 A;  3ILK A;  2RTS A;  1G4A E;  1YUB A;  1N34 M;  1QAO A;  1V33 A;  3WHL A;  3HON A;  2UXD M;  3RFW A;  4AG6 A;  1NNJ A;  4JI4 M;  1IXZ A;  4LF5 M;  3KFU G;  1IY2 A;  2X8A A;  2KNZ A;  2QHO B;  3AOE C;  2JCH A;  4NZ4 A;  2N35 A;  1FNN A;  3GPU A;  3GLH A;  2LBC A;  3FYD A;  3BXW A;  3W0F A;  3RE8 A;  5ITY A;  2Y2M A;  3KOZ E;  2UU9 M;  4NRV A;  4MGI E;  3Q8G A;  4TX8 A;  1G3I A;  3GRU A;  1E6R A;  4Z2L A;  4OJP A;  1YU4 A;  4Y28 F;  1NHG C;  2VF7 A;  5E26 A;  1N33 M;  2K9D A;  2HKJ A;  2F5P A;  2Y2G A;  2FH0 A;  1L1T A;  4Z2H A;  3FUU A;  1DGH B;  1OKS A;  2DAM A;  2XH9 A;  4LJ5 A;  1E32 A;  3SAS A;  4GHA A;  5A2Q S;  1C1K A;  1NJG A;  1SXJ C;  3HHX A;  4LF9 M;  2Y2O A;  4BBA A;  3WD0 A;  1N78 A;  1L2C A;  1IXS B;  2VII A;  3U6S A;  1QAQ A;  3KW6 A;  3U61 A;  1XMQ M;  3WHK A;  4X66 M;  5EJC A;  5EXX A;  5ITU A;  2XZU A;  2L7H A;  3R9X B;  2DHY A;  3VKH A;  4DR6 M;  1YU1 A;  3HSH A;  3FTC A;  3U6O A;  3KS8 A;  4OUI A;  2O25 A;  1J09 A;  2D7E A;  3KS4 A;  4KOD A;  3AL0 C;  2XEP A;  1E8B A;  5KQD A;  3GLI E;  5BR8 M;  2BG1 A;  3MMP A;  4LJ8 A;  2Z4R A;  3AOG A;  1H6U A;  2APL A;  2GNO A;  3TWL A;  4OX9 M;  5FTK A;  4LFB M;  4CHT B;  4NL4 H;  2C99 A;  5JI2 E;  2F5O A;  1GKI A;  4I81 A;  2DZO B;  2UUC M;  3LMM A;  1NY5 A;  3SMP A;  3GRV A;  1I4W A;  1QYR A;  4IBB A;  5IZ7 D;  3ZQJ A;  1H0I A;  4LZJ A;  5ITR A;  4MB3 A;  2Z4S A;  2Y20 A;  1QAM A;  4DV3 M;  2LHC A;  4DR1 M;  2V1U A;  2HL7 A;  2XD5 A;  3U6Q A;  3DZD A;  2CP8 A;  1SXJ E;  2OOA A;  3B74 A;  1N75 A;  3KDS E;  4GKK M;  1WXQ A;  4IBE A;  1N32 M;  3N3F A;  2F5Q A;  3CF6 E;  4BLC A;  1DO0 A;  2R62 A;  4OW0 A;  4QNR A;  2FNA A;  4B3M M;  4IBI A;  1D0L A;  3SBJ A;  1NNU C;  1TR8 A;  3AFH A;  3AV0 A;  2O01 F;  3QWL A;  3KOX E;  4MGK E;  1NY6 A;  1R4G A;  2FFJ A;  4FWD A;  2Y0Q A;  1D0M A;  3HX3 A;  1IN8 A;  2V1C A;  3KSX A;  4UN2 B;  1HQY E;  2YNM D;  4B3T M;  1UR9 A;  2BWB A;  3SHF A;  4G4N A;  1PRB A;  3RGP A;  1DGG A;  2DHR A;  1WGL A;  1XXH B;  4M0W A;  3FKE A;  1KSF X;  1W5T A;  3HU1 A;  5L8R F;  4LJ9 A;  2ZTC A;  4LFC M;  1E15 A;  2Y2I A;  4OVZ B;  3JR5 A;  1IQP A;  1JR3 E;  4P17 A;  5ITT A;  4LJ4 A;  3E9S A;  4L78 A;  2Z3X A;  2ZTD A;  4IBC A;  3HHW A;  4QHS A;  5DYG A;  4D80 A;  3I4Y A;  3GLF E;  3W68 A;  1NHW C;  4IBK A;  4DR7 M;  2R46 A;  1ZMU A;  4IBG A;  1OFI A;  4G4R A;  4G3O A;  1PJQ A;  4HLQ A;  3SAR A;  3WD2 A;  5EP2 A;  5EP4 A;  3IG5 A;  2XF3 A;  1OQY A;  3HJQ A;  4NC6 A;  4EIW A;  1QQW A;  2M60 A;  1NV9 A;  1TF0 B;  1PGY A;  5EXT A;  4X64 M;  2EJS A;  4X62 M;  3TWK A;  2DWL A;  1PM5 A;  4G6Z A;  4RKU F;  4GKJ M;  2B3T A;  3FUV A;  4XBO A;  4PDG A;  2KDL A;  1N36 M;  4Z6Y A;  1XHB A;  2VQF M;  4AQY M;  2LTU A;  1OFH A;  2VF8 A;  4M9Z A;  2RRU A;  7CAT A;  1YU3 A;  4AG5 A;  2Z7J A;  1Q02 A;  3D8B A;  3HHZ A;  2ZAM A;  4L4U A;  2QBY B;  1W1Y A;  4MB4 A;  2RGH A;  2M5Z A;  5IRE B;  2JY8 A;  2X49 A;  1VDD A;  4WUR A;  1KYI A;  1LTM A;  1H8P A;  3PNY A;  2D7H A;  4REZ A;  3U60 B;  2IOU A;  1NVM A;  5KPT A;  4NRW A;  4F2L A;  2C96 A;  3LVW A;  4D82 A;  2DNA A;  2MRO B;  3GQ5 A;  3VK7 A;  4DV7 M;  2CHQ A;  2DZN B;  1L8Q A;  3L2A A;  2WSF F;  5FTN A;  5IWA M;  2KXE A;  4NSR A;  3L26 A;  2KHH A;  3W0L B;  1W5S A;  1IN6 A;  1GVN A;  2EKK A;  2HCB A;  2JP7 A;  1OIP A;  4R3D A;  5ITX E;  4NZ5 A;  3MJ5 A;  2EA0 A;  4Q7J A;  2WSC F;  3RGS A;  2C5R A;  2JY5 A;  3T38 A;  3J80 S;  3KVW A;  3TL4 X;  4I5S A;  4HMD A;  4WW0 A;  2CRU A;  1IY0 A;  2LH0 A;  3HJ8 A;  3C3D A;  3LQQ A;  2LVA A;  3LQR A;  1GL7 A;  3MHV C;  4IIW A;  3TPZ A;  4DV1 M;  4AKH A;  2Y2L A;  1Z59 A;  3CF2 A;  4MH0 E;  1VEK A;  4AZF A;  1PJJ A;  1DO2 A;  1XXH A;  1SXJ D;  1IN4 A;  4XK8 F;  5DFL A;  4JI2 M;  4DV5 M;  2UUA M;  4JV5 M;  5IT9 S;  4MGY E;  2OOB A;  4QOS A;  4OVZ A;  4GMQ A;  1Q3B A;  3GO8 A;  4YY3 M;  1HNW M;  4DR3 M;  1OGB A;  1AIW A;  4BB9 A;  1QDR A;  4Z2I A;  2F5S A;  1L1Z A;  2MJ5 B;  2BNK A;  4L15 A;  3PNV A;  2JZ1 A;  2O5R A;  3H4M A;  3I51 A;  3HHY A;  3UZU A;  1TDH A;  1YLA A;  1IN7 A;  1WR1 B;  3PXG A;  2UXC M;  2Y0T A;  4DV4 M;  3GLH E;  4GIP A;  3FUX A;  4MB7 A;  2CV1 A;  1JR3 D;  1VEJ A;  1VG5 A;  1GOI A;  1K3W A;  1GJT A;  2W82 A;  1Z5A A;  2RKO A;  3PFI A;  5DYI A;  3TE6 A;  1ZAE A;  3QAU A;  4IBF A;  1J7M A;  2H1R A;  3TQS A;  3HU3 A;  4HME A;  2R6F A;  4KHP M;  4DV0 M;  3SMS A;  2QBY A;  3U6D A;  4CJ6 A;  4JI8 M;  2J7O A;  1D0K A;  1CUK A;  4FWH A;  1DGB A;  3L27 A;  4NOO B;  2QNJ A;  5EQT A;  4FWG A;  1XMO M;  2D7G A;  3U60 A;  4LY6 A;  2DZL A;  2RGO A;  5FLX S;  2FS1 A;  2F5N A;  3KOY E;  3DFZ A;  1IBM M;  2LVQ D;  3SFZ A;  2R0I A;  2XGN A;  2DAI A;  2JZ0 A;  2JA2 A;  4GHL A;  1S3S A;  1H0G A;  1JB0 F;  3GLI A;  1ZV1 A;  4LGY A;  1MU5 A;  3EIH A;  4I4L A;  4IJE A;  2K6B A;  4CGY B;  4G4Q A;  1GAB A;  1XWI A;  3GRY A;  1VDL A;  4DV2 M;  1WJ7 A;  3GQ4 A;  1HT1 E;  4FW9 A;  2C9C A;  2YFQ A;  3J7B A;  2CUZ A;  4NY2 A;  2XFT A;  2WZJ A;  3T6P A;  2DEN A;  3GPP A;  2FOI C;  2LHG A;  1WIV A; 
#chains in the Genus database with same CATH homology
 3VKG A;  1YU2 A;  4NZ1 A;  5KPR A;  2ZM6 M;  3WX7 A;  4K0K M;  4AI6 A;  1TGU A;  1G59 A;  4NXM M;  5KO3 A;  4D81 A;  2Y2K A;  3UK6 A;  5FSW A;  3GLG B;  3JR4 A;  4LJ7 A;  4DUZ M;  1J7K A;  1NSF A;  2KZU A;  4RNA A;  3SYL A;  3FUW A;  1IBL M;  4X65 M;  2CEA A;  3NWL A;  3KOW E;  4GH9 A;  2CHG A;  4DUY M;  2R4J A;  3J2P B;  1IBK M;  1OJL A;  3FTE A;  4OU7 A;  1JR3 A;  4R7G A;  5FTM A;  5H37 D;  4RF1 A;  2L6O A;  3BOS A;  2EUC A;  2HHH M;  2KA6 B;  4IJF A;  3A45 A;  2I7N A;  2DWZ B;  3SAU A;  2BJV A;  2L09 A;  4LZZ A;  3VFD A;  3GP1 A;  3TWM A;  2QCU A;  4HL4 A;  1GLN A;  1HNZ M;  1G8P A;  1R6B X;  2F4V M;  3KP1 E;  5JI3 E;  4DV6 M;  4NXN M;  4QNL A;  3U6L A;  1L2D A;  1PJI A;  3J7A S;  2CE7 A;  3A98 B;  4Z8X A;  3JAM S;  4M0D A;  4PD2 A;  4LRT A;  4RF0 A;  2UXB M;  3U5Z A;  2Y2Q A;  4DR2 M;  2DWM A;  4JN6 A;  2Q2E B;  4MGZ E;  3MK6 A;  4LJA A;  3DOA A;  2R45 A;  3NBI A;  3GLI B;  2X4A A;  4L8R C;  2CHV A;  2XSZ D;  5F3W A;  1IM2 A;  1E94 E;  1I94 M;  3ZCB B;  4QOZ C;  4OJ6 A;  3GLG A;  2XFS A;  4OJ5 A;  1YU0 A;  1IXR C;  4AW4 A;  2QZ4 A;  4I8O A;  3SHG B;  4LJ6 A;  2Y2J A;  3VDU A;  3U6M A;  4JI3 M;  3UGJ A;  4TUW A;  1HQC A;  4LCB A;  2C98 A;  3GPX A;  3VK8 A;  3Q8X A;  4B7F A;  4JI6 M;  2ZBK B;  4QHT A;  4KLN A;  3U6E A;  4JI1 M;  4B08 A;  1QAN A;  4IBD A;  4LRS A;  4GC5 A;  1ORY B;  2KEB A;  3ZC7 B;  3K1J A;  3A42 A;  3CTW B;  5BPV A;  1R7R A;  5FTL A;  4OJO A;  1D2N A;  2XLJ A;  3I4V A;  1E9S A;  4GRI A;  4G4O A;  3FTF A;  2Y2P A;  1HNX M;  5EP3 A;  2EO2 A;  3GPY A;  2J7N A;  3KP0 E;  3UMM A;  3SAV A;  1Z6T A;  1K3X A;  4M9S A;  3E4R A;  3J81 S;  1ZQ9 A;  4CIS A;  5GKN A;  3T1H M;  2XZF A;  3M0E A;  1JQJ C;  3GLF B;  5FTJ A;  4B7G A;  1NJF A;  4JYA M;  4II7 A;  3D8L A;  3L29 A;  5KQ8 A;  2FFF B;  4FCT A;  1R2Z A;  3FD9 A;  2ZAO A;  4DR5 M;  3K2L A;  1Z5B A;  3AOE A;  4S12 A;  4JXJ A;  8CAT A;  1DGF A;  3A46 A;  4PT5 A;  2LWX A;  1YUE A;  1G41 A;  3HWS A;  1T3T A;  2P5T A;  1X37 A;  3PVS A;  1L2B A;  5EP1 A;  2I7P A;  1Q39 A;  4GC9 A;  3GRR A;  3U5Z B;  2CV2 A;  2XSZ A;  4QNM A;  4GIT A;  1TH3 A;  2C9O A;  4JI0 M;  1XC8 A;  3T15 A;  2L7I A;  4W5W A;  4MM3 B;  1HT2 E;  3FYC A;  2G8L A;  5LMU M;  1J5E M;  1SXJ A;  2OQ4 A;  4LF8 M;  1LV7 A;  1XNR M;  4LF4 M;  3HJS A;  2QEN A;  4ZPX A;  3EIE A;  1YU4 A;  4NZ3 A;  3R8F A;  4FD2 A;  2R18 A;  3B9P A;  1E9R A;  5EXP A;  2A5Y B;  5ITQ A;  4NYY A;  2OPF A;  4YHH M;  2Y21 A;  4AKI A;  4ITQ A;  4NYU A;  3HU2 A;  1UM8 A;  2FE8 A;  4B3S M;  3OTO M;  5E6J A;  3M6A A;  2QP9 X;  2Y2H A;  4P16 A;  4JI5 M;  1XNQ M;  2VQE M;  2ERC A;  2DXI A;  2KRU A;  2LNH C;  1Q3C A;  1YE9 A;  2YQZ A;  3UJN A;  3U6P A;  1Z5C A;  2R65 A;  3ZH9 B;  2K47 A;  3K92 A;  2QPA A;  3GLF A;  1GL6 A;  3FTD A;  3FUT A;  4FCV A;  3J27 B;  4JI7 M;  3SC3 A;  2XD1 A;  3C58 A;  3HGI A;  4DR4 M;  4FCW A;  3THG A;  2Y2N A;  3HKP A;  2DVW B;  3GLH B;  4MGH A;  1HR0 M;  1DGH A;  3CF0 A;  1KFV A;  4L16 A;  3L25 A;  3DA1 A;  1K82 A;  4LF6 M;  4A3V B;  2CV0 A;  4LG2 A;  1QVR A;  4B7H A;  3SAW A;  4NSO B;  2UWX A;  3SYK A;  1YSY A;  4LGM A;  1IN5 A;  5C18 A;  3LVV A;  1R2Y A;  1QZM A;  5EXS A;  4LFA M;  3AKZ A;  2CFO A;  5C1B A;  4PCZ A;  1MX0 A;  3KSJ A;  4FVM A;  2AHM A;  3VDP A;  3GQ3 A;  4AKG A;  2JE5 A;  3U6C A;  3M7G A;  3AJI B;  3U61 B;  2E5L M;  2NQ8 C;  3KXE C;  1FJG M;  5DNY A;  2KZS A;  2KRK A;  2YR0 A;  2ZAN A;  2UUB M;  2R4E A;  4KO8 A;  5LMN M;  4LF7 M;  5ITX A;  5KPZ A;  2LXE A;  2V6Z M;  1TDZ A;  1TH4 A;  4PDI A;  1EE8 A;  1SXJ B;  3T1Y M;  3L28 A;  1IY1 A;  4IBJ A;  3VLF B;  4XGI A;  2DWN A;  2KW0 A;  3K8Z A;  2G5G X;  4M9X A;  4OJL A;  2BJW A;  3IG8 A;  3SAT A;  4B3R M;  1N77 A;  1TH2 A;  3ILK A;  1G4A E;  1YUB A;  1N34 M;  1QAO A;  3WHL A;  3HON A;  2UXD M;  3RFW A;  4AG6 A;  1NNJ A;  4JI4 M;  1IXZ A;  4LF5 M;  3KFU G;  1IY2 A;  2X8A A;  3AOE C;  2JCH A;  4NZ4 A;  1FNN A;  3GPU A;  3GLH A;  3FYD A;  3W0F A;  3RE8 A;  5ITY A;  2Y2M A;  3KOZ E;  2UU9 M;  4NRV A;  4MGI E;  1G3I A;  3GRU A;  4OJP A;  5E26 A;  1NHG C;  1N33 M;  2HKJ A;  2F5P A;  2Y2G A;  1L1T A;  3FUU A;  1DGH B;  2XH9 A;  4LJ5 A;  1E32 A;  3SAS A;  4GHA A;  5A2Q S;  1C1K A;  1NJG A;  1SXJ C;  3HHX A;  2Y2O A;  4BBA A;  1N78 A;  1L2C A;  1IXS B;  2VII A;  3U6S A;  1QAQ A;  3KW6 A;  3U61 A;  1XMQ M;  3WHK A;  4X66 M;  5EJC A;  5EXX A;  5ITU A;  2XZU A;  2L7H A;  3R9X B;  3VKH A;  1YU1 A;  4DR6 M;  3HSH A;  3FTC A;  3U6O A;  3KS8 A;  4OUI A;  1J09 A;  2D7E A;  3KS4 A;  4KOD A;  3AL0 C;  2XEP A;  5KQD A;  5BR8 M;  2BG1 A;  4OX9 M;  4LJ8 A;  2Z4R A;  3AOG A;  1H6U A;  3TWL A;  5FTK A;  4LFB M;  4CHT B;  4NL4 H;  2C99 A;  5JI2 E;  2F5O A;  1GKI A;  4I81 A;  2DZO B;  2UUC M;  3LMM A;  1NY5 A;  3SMP A;  3GRV A;  1I4W A;  1QYR A;  4IBB A;  5IZ7 D;  4LZJ A;  5ITR A;  2Z4S A;  2Y20 A;  1QAM A;  4DV3 M;  4DR1 M;  2V1U A;  2HL7 A;  2XD5 A;  3U6Q A;  3DZD A;  3KDS E;  1SXJ E;  4GKK M;  1N75 A;  1WXQ A;  4IBE A;  3N3F A;  2F5Q A;  3CF6 E;  4BLC A;  1DO0 A;  2R62 A;  4OW0 A;  4QNR A;  2FNA A;  4B3M M;  4IBI A;  3SBJ A;  1NNU C;  3AFH A;  3AV0 A;  3QWL A;  4MGK E;  3KOX E;  1NY6 A;  2FFJ A;  4FWD A;  2Y0Q A;  1IN8 A;  2V1C A;  3KSX A;  4B3T M;  1HQY E;  2YNM D;  3SHF A;  4G4N A;  3RGP A;  1DGG A;  1XXH B;  2DHR A;  4M0W A;  3FKE A;  1KSF X;  1W5T A;  3HU1 A;  4LFC M;  4LJ9 A;  2Y2I A;  4OVZ B;  3JR5 A;  1IQP A;  5ITT A;  4LJ4 A;  3E9S A;  4L78 A;  4IBC A;  3HHW A;  4QHS A;  5DYG A;  4D80 A;  3I4Y A;  1NHW C;  4IBK A;  4DR7 M;  2R46 A;  4IBG A;  1OFI A;  4G4R A;  3SAR A;  4HLQ A;  5EP2 A;  5EP4 A;  3IG5 A;  2XF3 A;  3HJQ A;  4EIW A;  1QQW A;  2M60 A;  4X64 M;  5EXT A;  4X62 M;  2DWL A;  3TWK A;  4GKJ M;  1PM5 A;  4G6Z A;  3FUV A;  4XBO A;  4PDG A;  1N36 M;  4Z6Y A;  1XHB A;  2VQF M;  4AQY M;  1OFH A;  4M9Z A;  7CAT A;  1YU3 A;  4AG5 A;  2Z7J A;  3D8B A;  3HHZ A;  2ZAM A;  4L4U A;  2QBY B;  2RGH A;  2M5Z A;  5IRE B;  2X49 A;  1VDD A;  4WUR A;  1KYI A;  3PNY A;  2D7H A;  4REZ A;  3U60 B;  2IOU A;  1NVM A;  5KPT A;  4NRW A;  2C96 A;  3LVW A;  4D82 A;  3VK7 A;  3GQ5 A;  4DV7 M;  2CHQ A;  2DZN B;  1L8Q A;  3L2A A;  5FTN A;  5IWA M;  3L26 A;  2KXE A;  4NSR A;  1N32 M;  3W0L B;  2Z3X A;  1W5S A;  1IN6 A;  1GVN A;  2HCB A;  4R3D A;  5ITX E;  4NZ5 A;  3MJ5 A;  2EA0 A;  3RGS A;  2C5R A;  3T38 A;  3TL4 X;  3J80 S;  3KVW A;  4I5S A;  4WW0 A;  1IY0 A;  2LH0 A;  3HJ8 A;  3LQQ A;  3MHV C;  4IIW A;  3LQR A;  1GL7 A;  4DV1 M;  3TPZ A;  4LF9 M;  4AKH A;  2Y2L A;  1Z59 A;  3CF2 A;  4MH0 E;  4AZF A;  1PJJ A;  1DO2 A;  1XXH A;  1SXJ D;  1IN4 A;  4JI2 M;  4DV5 M;  2UUA M;  4JV5 M;  5IT9 S;  4MGY E;  4QOS A;  4OVZ A;  4GMQ A;  1Q3B A;  3GO8 A;  4YY3 M;  1HNW M;  4DR3 M;  4BB9 A;  2F5S A;  1L1Z A;  2BNK A;  4L15 A;  3PNV A;  2O5R A;  3H4M A;  3I51 A;  3HHY A;  3UZU A;  1TDH A;  1IN7 A;  3PXG A;  2UXC M;  2Y0T A;  4DV4 M;  4GIP A;  3FUX A;  4MB7 A;  2CV1 A;  1JR3 D;  1K3W A;  2W82 A;  1Z5A A;  2RKO A;  3PFI A;  5DYI A;  3TE6 A;  1ZAE A;  3QAU A;  4IBF A;  2H1R A;  3TQS A;  3HU3 A;  4KHP M;  4DV0 M;  3SMS A;  2QBY A;  3U6D A;  4JI8 M;  2J7O A;  4FWH A;  1DGB A;  3L27 A;  4NOO B;  5EQT A;  4FWG A;  1XMO M;  2D7G A;  3U60 A;  4LY6 A;  2RGO A;  5FLX S;  2F5N A;  3KOY E;  3DFZ A;  1IBM M;  3SFZ A;  2XGN A;  2JA2 A;  4GHL A;  1S3S A;  3GLI A;  4LGY A;  1MU5 A;  3EIH A;  4I4L A;  4IJE A;  4CGY B;  4G4Q A;  1XWI A;  3GRY A;  4DV2 M;  3GQ4 A;  1HT1 E;  4FW9 A;  2C9C A;  2YFQ A;  3J7B A;  2CUZ A;  4NY2 A;  2XFT A;  3GPP A;  2FOI C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...