4IBEA

Ebola virus vp35 bound to small molecule
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
123
structure length
123
Chain Sequence
DISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title In Silico Derived Small Molecules Bind the Filovirus VP35 Protein and Inhibit Its Polymerase Cofactor Activity.
pubmed doi rcsb
source organism Ebola virus
molecule tags Transcription/transcription inhibitor
molecule keywords Polymerase cofactor VP35
total genus 42
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ibeA01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4ibeA02
3FKEA 3L28A 3L29A 4LG2A 4IBDA 5BPVA 4IBCA 4GH9A 4GHAA 4IJFA 4IBGA 4IBFA 3KS8A 4IBBA 4IBKA 3L26A 3L27A 4GHLA 4IBEA 3L25A 3L2AA 4IJEA 3KS4A 4IBIA 4IBJA
chains in the Genus database with same CATH superfamily
3SHFA 1L2DA 2RTSA 3TPZA 1QVRA 2DZNB 2K47A 4LGYA 2DAKA 4JI4M 1E6NA 1T43A 3FUVA 3MQLA 1VDDA 2JZ1A 1TH3A 3HU2A 3KP1E 1N36M 4S12A 3RFWA 1R6BX 5IWAM 3AKZA 4OU7A 5ITQA 3WD2A 3HHZA 3HGIA 1L1TA 2R0IA 4GKJM 2FFFB 3H4MA 4OJOA 1OAIA 2Y2NA 4LJ9A 2QQ8A 3LCUA 2D7EA 3GLIB 2JP7A 3U6LA 2C99A 1K3XA 3WHKA 1TR8A 2LVQD 4AG5A 3V76A 3U6QA 3I51A 5E6JA 4G4QA 2WSFF 3K9PA 3AFHA 1EIJA 1UFZA 3L2AA 2F5PA 3LCVB 1R4GA 1IY2A 2CHQA 2DENA 2JA2A 2OO9A 4FWDA 4II7A 5KO3A 4G3OA 5ITXA 4GEWA 7CATA 2F5OA 3UZUA 2KRUA 2V5OA 3HKPA 2F5NA 1W5TA 2DWZB 3J7AS 2KEBA 3FUWA 4IBDA 4MB5A 2G8LA 4IJFA 3AOEA 2C5RA 2Y2QA 2LVNC 2FFJA 1MN3A 4ANRA 2YQZA 1NHWC 2L6OA 1ZQ9A 2R6FA 4D80A 3GPUA 1SG9A 4L15A 5FSWA 1GPFA 1WJ7A 4LZZA 1J09A 3N3FA 2VIIA 4REZA 3U60A 2MROB 4JI7M 1WXQA 4Z2JA 2CV0A 1G8PA 4XGIA 2DI0A 2Y2KA 4F2LA 1VQ1A 1DGFA 3B7NA 2LXEA 2OOBA 5ITUA 3K1JA 2GNOA 1W1VA 1OTRA 3CGWA 1TTEA 4JI6M 1YSYA 3NBXX 4LFAM 4D81A 3FE3A 3K92A 1Z5BA 2CHGA 3B7QA 4LRSA 4CISA 4HMEA 4DUYM 2XZFA 1EE8A 2X49A 3WD0A 1XXHA 2O25A 2Q2EB 2ZTDA 1YU3A 2Y20A 1GXDA 1GJSA 1L2BA 2KHHA 2XGNA 1I4WA 4LFBM 1XMQM 1IXSB 4GRIA 2N35A 5C1BA 1YU0A 1T3TA 4QHTA 3AV0A 4DV5M 2UXDM 1E6ZA 1WGLA 2YNMD 4P16A 1V92A 4LJAA 3KOYE 3ZH9B 4XK8F 5KQDA 4AQYM 4B3MM 4LF8M 4GHLA 4Z8XA 1QAMA 2HHHM 4NSOB 3ZC7B 2LVPC 2Y2HA 5LMNM 1N32M 3GPYA 3AJIB 1IN7A 4OVZB 2KDLA 2UXCM 4LJ7A 4XBOA 1DGHB 3FRIA 5FTMA 2FNAA 3HJ8A 2Y2MA 2UWXA 3F92A 2Y2GA 3B89A 4MB7A 4HL4A 1D0MA 2Y2PA 4LJ4A 1L6JA 3SATA 3U6PA 3QWLA 4LF7M 1JR3D 2XEPA 1K82A 4KHPM 4QOZC 2LNHC 4TUWA 3GLFE 3H4JA 4A3VB 3VK8A 4MGZE 4NSRA 3U61A 2Y2JA 2C96A 4LCBA 1GLNA 3E46A 3I4YA 4PDGA 4CGYB 4NZ5A 1E15A 1ZAEA 1PRBA 4EIWA 4PT5A 4DV3M 4PDIA 2BJVA 3GRYA 4JI2M 5EP4A 3GLFA 3VFDA 4JI3M 3W0LB 4WP2A 5EXXA 1OFHA 1QZEA 3Q8XA 4AW4A 5L8RF 2I7PA 2Z3XA 1HJPA 2KA6B 4RKUF 4WW0A 4Z2GA 2UUCM 3WX7A 4DV1M 2VDBB 5EP1A 3M6AA 3RGPA 4FCVA 3HJQA 1VEJA 2EJSA 2CP8A 2WSCF 2Z8YM 1ZMWA 3AOGA 4ZPXA 3C58A 4I8OA 3PFIA 2R65A 3L27A 4W5WA 3GP1A 1S3SA 3R8FA 1E9RA 4ITQA 3HHXA 1N34M 2KXEA 3W68A 1H0GA 1GL6A 4IBEA 1VEKA 3KXEC 4DR6M 1W1YA 3DA1A 3TWMA 1LV7A 1H0IA 4LF9M 3J27B 4F1IA 1J7MA 5KQ8A 2ZAMA 1MU5A 8CATA 3K8ZA 4DV0M 3KSXA 2W82A 3FTEA 3BXWA 1E9SA 4RF1A 3GRVA 4MH0E 1W1PA 2CV1A 3TWKA 2DAEA 2R18A 1I94M 4Z2IA 2FE8A 2QSFX 2Y2LA 1XNQM 2XFTA 1ORYB 1AIWA 4DV2M 3VKHA 4MGYE 4TX8A 4MGKE 1OFIA 2I7NA 3AL0C 3B7ZA 3FTFA 2Y2OA 3K2LA 3KOXE 4BLCA 3TQSA 2L7HA 3NBIA 2DXIA 1XNRM 1DV0A 5IT9S 2ERCA 1DO2A 4CJ6A 2KZUA 1KYIA 2JZ0A 4QNMA 3U6MA 1GVNA 2HL7A 4LFCM 4NY2A 2HKJA 2VQFM 4P17A 2KZSA 2R44A 2KRKA 3IG8A 3SAUA 3IHPA 3JR5A 3TL4X 3SFZA 3UGJA 1R7RA 2JY5A 4LF6M 1YUBA 3KVWA 2EA0A 4HLQA 1OGBA 2QPAA 3HY5A 4JI8M 3E21A 1UR9A 5EJCA 2XSZD 2G5GX 3I4VA 1G3IA 2MH8A 3FUUA 1H8PA 1W5SA 3PNVA 5C18A 3DZDA 1H6UA 2D49A 3HONA 5GKNA 3VDUA 4DR4M 1YU4A 1P3QQ 3U6DA 3GLGB 2LHCA 3R9XB 2JY7A 4B3RM 4FVMA 4NZ4A 3PVSA 3FD9A 1TH4A 3THGA 3U6CA 2DZLA 2XF3A 3NWLA 5EP3A 4NXMM 5IZ7D 1G59A 5ITYA 5ITXE 2RRUA 4B7FA 4G6ZA 3L26A 2JXNA 3FUTA 3MMPA 2UUAM 4UN2B 4NZ1A 1D0LA 3IG5A 4LZJA 2R46A 4KODA 2Z7JA 1YE9A 4FCTA 3E9SA 3T6PA 1KSFX 4Z2LA 4PD2A 5EP2A 1LTMA 4CIZA 1QDTA 2Z4RA 2C98A 1XWIA 2LVOC 1D0KA 2WSEF 3HX3A 4GC5A 4MGIE 5EXSA 2DNAA 1SXJE 3GPPA 3WD1A 2XSZA 2EUCA 5H37D 1QQWA 4R7GA 2V1CA 1XB2B 3EIHA 1CUKA 2BNKA 3E4RA 3VKGA 4Z2KA 1QANA 4NOOB 4AKGA 5FLXS 3HU1A 3GLHB 5IREB 1IBMM 4AI6A 5ITRA 1MX0A 4DR7M 1HNWM 3DFZA 2LHGA 1WHCA 3FTDA 4NL4H 4JXJA 4MGHA 1EAKA 2AHMA 2FOIC 3LVWA 4DV4M 1HT1E 4OVZA 1KFVA 2L4EA 1HQYE 2C9OA 5EXTA 1SXJD 3A98B 2BJWA 2MR9A 2XZUA 1Z6TA 3SARA 4X65M 1DO0A 3HHWA 1N77A 2KNAA 3GQ4A 2LBCA 3U5ZA 4IBJA 2JY6B 3T38A 4D82A 3J7BA 4DUZM 4I4LA 1IN4A 1AUAA 3GLFB 2ZAOA 2NQ8C 3GLHA 5DFLA 2DVWB 3SAVA 1XMOM 4DR1M 2HCBA 1YU2A 2RKOA 4L6V6 4NC6A 1T6OA 2Y21A 4G4NA 1JR3A 1ED7A 4JI5M 1BVSA 3PXGA 2F4VM 2JWSA 1R5LA 3GRUA 3AOEC 2ZANA 4QNLA 3B9PA 2YR0A 5EXPA 1FJGM 4FW9A 4GIPA 3WHLA 1NVMA 2R45A 1A5TA 2M5ZA 3RGSA 1ZV1A 2CWBA 3Q8GA 3U5ZB 4GKKM 1J7KA 5FTKA 4FCWA 4KT0F 2WZJA 2MJ5B 4DR5M 2P5TA 3ZCBB 1NHGC 2OQ4A 4DBGB 2HAKA 1Y8GA 4AZFA 1SXJA 2JE5A 3CF2A 2ZTCA 3L28A 3LQQA 3A45A 4NRVA 4Z6YA 1E32A 4LG2A 3KDSE 4LGMA 3RE8A 2CFOA 3VLFB 1K3WA 1E8BA 1IBLM 4LF4M 2J5YA 4MM3B 3A46A 2UUBM 3SC3A 2H5XA 1IN8A 1OIZA 1PJJA 2R4JA 5JI3E 3QYEA 3SAWA 4GMQA 3TE6A 3GLGA 5KPRA 3QAUA 2DKLA 3A42A 3J81S 1Q3CA 1Q02A 1N33M 3U60B 3BBZA 1C1KA 1IXRC 3C9PA 3QYBA 2VQEM 2F5SA 1GOIA 1QDRA 2DHYA 3W67A 5BR8M 3J2PB 4QOSA 1TH2A 1DGBA 1VDLA 3GQ5A 1SXJC 1OAOC 3T1YM 4KO8A 2L2DA 2F5QA 4IBIA 1OIPA 2XD1A 1KS0A 1PGYA 1CK7A 3I01M 1N75A 2C9CA 3FYCA 5ITTA 2DWLA 2DWNA 3SYLA 3GLIA 2XD5A 1FNNA 4GH9A 5E26A 2CUZA 2Y0QA 3HJSA 5FTLA 3C3EA 1HR0M 1HQCA 4MB4A 4IIWA 1TF0B 2BWBA 3GPXA 1IXSA 1JQJC 4OJPA 3CF6E 1NSFA 1ZMVA 2RGHA 4I5SA 3KSJA 2QP9X 2CV2A 1N78A 1ZMUA 4BB9A 1NV9A 2K9DA 3GLHE 1HT2E 3UK6A 4FD2A 1Z59A 2ZM6M 1IN5A 3CF0A 3KOWE 3FTCA 3HU3A 5A2QS 3I04M 3HHYA 2L09A 1X37A 4DR2M 2BWEA 4NYYA 4Y28F 5JI2E 1E6PA 3KOZE 3GLIE 2CEAA 2LH0A 4JYAM 1IQPA 3VDPA 4NXNM 4L4UA 3JR4A 3LQRA 3EIEA 2OOAA 4FWHA 3SMSA 3D8LA 1NNJA 2VF7A 4LF5M 4M9XA 2HWJA 3UJNA 4DV6M 1E6RA 2J7OA 4NYUA 3W0FA 4CHTB 4M9SA 4AG6A 1QAOA 1G71A 3VK7A 1RU3A 2YFQA 4LJ8A 2JUJA 4IBKA 1IN6A 1QUTA 4B3TM 1D2NA 2A5YB 1NJFA 2APLA 4QNRA 2E5LM 2QHOB 4X62M 1IM2A 4I81A 1XC8A 4Q7JA 1AIPC 4M9ZA 1GL7A 2ZBKB 4B7HA 3WD4A 2G3QA 4LJ5A 5F3WA 4L8RC 4IBCA 1OKSA 3SYKA 3U6SA 2MGWA 1O6IA 2Y2IA 1E88A 4OJ5A 3KW6A 2IOUA 1NY6A 3MJ5A 3MK6A 3OTOM 1F4IA 2QCUA 5DYIA 4X66M 3D8BA 2QNJA 3FRHA 1G4AE 4DR3M 2FS1A 1E94E 3HWSA 4R71A 3SASA 4GHAA 2UU9M 4IBGA 4AKHA 4WURA 2LVAA 2DAGA 4QHSA 5KPTA 3GO8A 4K0KM 1PDCA 4HMDA 3M7PA 1GO5A 1HNXM 2R62A 4LY6A 5FTJA 5LMUM 1DGHA 2L4FA 4LJ6A 4JV5M 3FUXA 1YU1A 3J80S 1YUEA 3HZJA 2KNVA 2DWMA 3L25A 1UM8A 4M0WA 4OUIA 4JN6A 1R2YA 3KS4A 1EFUB 1NY5A 4G4RA 2Y0TA 1UR8A 1WR1B 1IXZA 1JB0F 4L78A 1IBKM 1V33A 3C3DA 2DAMA 2JCHA 1QYRA 2Z4SA 3DOAA 2LTUA 1L8QA 4B3SM 1NJGA 1OJLA 1PJQA 4GC9A 2XFSA 4B7GA 2DHRA 3HSHA 2K0BX 2EKFA 1NNUC 1PJSA 1IFYA 1G41A 4M0DA 2XLJA 1XXHB 1L1ZA 2V6ZM 1QAQA 2O01F 4OW0A 3LVVA 2O5RA 1QO6A 1GKIA 3U6EA 1TDZA 3ILKA 1L2CA 3KP0E 1W1TA 4Z2HA 3T15A 1WIVA 3WD3A 4YY3M 2K6BA 2RGOA 3B74A 3ZQJA 2QBYB 4HMCA 4IJEA 4AKIA 4MB3A 4OX9M 3M7GA 1QZMA 3M0EA 1J5EM 1OGGA 1IY1A 3L29A 4JI1M 1XXHE 1GABA 1OQYA 2BG1A 5DYGA 5BPVA 2GQFA 2LWXA 1JR3E 2KW0A 1PJIA 4HEOA 4IBFA 1TGUA 4KLNA 2EKKA 1VEGA 4R3DA 3T1HM 3UMMA 1WGNA 1Z5AA 4L16A 2XH9A 1IY0A 2R4EA 2OPFA 2FH0A 1SXJB 2L7IA 2QZ4A 4PCZA 1C7YA 2QBYA 3LW5F 3IECA 2B3TA 2H1RA 2DZOB 2CRUA 1PJTA 2D7HA 1GJTA 3TWLA 4LRTA 1MJGM 4FWGA 2KNZA 4NZ3A 4BBAA 1Z5CA 2M60A 4B08A 3U61B 2UXBM 2FN2A 3K9OA 1PM5A 3FKEA 4X64M 1Q3BA 1QUSA 2CHVA 4DV7M 4G4OA 2X8AA 4RF0A 3JAMS 4YHHM 5DNYA 3GRRA 1HNZM 1XHBA 3GQ3A 1NV8A 4NRWA 1TDHA 4OJLA 1CXWA 2CE7A 1Q39A 1V34A 1YLAA 2JY8A 3MHVC 4JI0M 4IBBA 2V1UA 3KS8A 3PNYA 3GLGE 3U6OA 2DAIA 3LMMA 1R2ZA 1VG5A 5FTNA 1NO1A 2J7NA 4GITA 2X4AA 3FYDA 5EQTA 1DGGA 3SHGB 3SBJA 2EO2A 4RNAA 3KFUG 3CTWB 4OJ6A 3BOSA 5KPZA 2VF8A 2D7GA 2QENA 3SMPA 2JNHA
chains in the Genus database with same CATH topology
3SHFA 1L2DA 3TPZA 1QVRA 2DZNB 2K47A 4LGYA 4JI4M 3FUVA 1VDDA 1TH3A 3HU2A 3KP1E 1N36M 4S12A 3RFWA 1R6BX 5IWAM 3AKZA 4OU7A 5ITQA 3HHZA 3HGIA 1L1TA 4GKJM 4OJOA 2FFFB 3H4MA 2Y2NA 4LJ9A 2D7EA 3GLIB 3U6LA 2C99A 1K3XA 3WHKA 4AG5A 3U6QA 3I51A 5E6JA 4G4QA 3AFHA 3L2AA 2F5PA 4II7A 1IY2A 2CHQA 2JA2A 4FWDA 5KO3A 5ITXA 2F5OA 7CATA 3UZUA 2KRUA 3HKPA 2F5NA 1W5TA 2DWZB 3J7AS 2KEBA 3FUWA 4IBDA 2G8LA 4IJFA 3AOEA 2C5RA 2Y2QA 2FFJA 2YQZA 1NHWC 2L6OA 1ZQ9A 4D80A 3GPUA 4L15A 5FSWA 4LZZA 1J09A 3N3FA 2VIIA 4REZA 3U60A 4JI7M 1WXQA 2CV0A 1G8PA 4XGIA 2Y2KA 1DGFA 5ITUA 2LXEA 3K1JA 4JI6M 1YSYA 4LFAM 4D81A 3K92A 1Z5BA 2CHGA 4LRSA 4CISA 4DUYM 2XZFA 1EE8A 2X49A 1XXHA 2Q2EB 1YU3A 2Y20A 1L2BA 2XGNA 1I4WA 4LFBM 1XMQM 1IXSB 4GRIA 5C1BA 1YU0A 1T3TA 4QHTA 3AV0A 4DV5M 2UXDM 2YNMD 4P16A 4LJAA 3KOYE 3ZH9B 4AQYM 5KQDA 4B3MM 4LF8M 4GHLA 4Z8XA 1QAMA 2HHHM 4NSOB 3ZC7B 2Y2HA 5LMNM 1N32M 3GPYA 3AJIB 1IN7A 4OVZB 2UXCM 4LJ7A 4XBOA 1DGHB 5FTMA 2FNAA 3HJ8A 2Y2MA 2UWXA 2Y2GA 4MB7A 4HL4A 2Y2PA 4LJ4A 3SATA 3U6PA 3QWLA 4LF7M 1JR3D 2XEPA 1K82A 4KHPM 4QOZC 2LNHC 4TUWA 3VK8A 4A3VB 4MGZE 4NSRA 3U61A 2Y2JA 2C96A 4LCBA 1GLNA 3I4YA 4PDGA 4CGYB 4NZ5A 1ZAEA 4EIWA 4PT5A 4DV3M 4PDIA 2BJVA 3GRYA 4JI2M 5EP4A 3GLFA 3VFDA 4JI3M 3W0LB 5EXXA 1OFHA 3Q8XA 4AW4A 2Z3XA 2I7PA 2KA6B 4WW0A 2UUCM 3WX7A 4DV1M 5EP1A 3M6AA 3RGPA 4FCVA 3HJQA 3C58A 3AOGA 4ZPXA 4I8OA 3PFIA 2R65A 3L27A 4W5WA 3GP1A 1S3SA 3R8FA 1E9RA 4ITQA 3HHXA 1N34M 2KXEA 1GL6A 4IBEA 3KXEC 4DR6M 3DA1A 3TWMA 1LV7A 4LF9M 3J27B 5KQ8A 2ZAMA 1MU5A 8CATA 3K8ZA 4DV0M 3KSXA 2W82A 3FTEA 1E9SA 4RF1A 3GRVA 4MH0E 2CV1A 3TWKA 1I94M 2R18A 2FE8A 2Y2LA 1XNQM 2XFTA 1ORYB 4DV2M 3VKHA 4MGYE 4MGKE 1OFIA 2I7NA 3AL0C 3FTFA 2Y2OA 3K2LA 3KOXE 4BLCA 3TQSA 2L7HA 3NBIA 2DXIA 1XNRM 5IT9S 2ERCA 1DO2A 2KZUA 1KYIA 4QNMA 3U6MA 1GVNA 2HL7A 4LFCM 4NY2A 2HKJA 2VQFM 2KZSA 2KRKA 3IG8A 3SAUA 3JR5A 3TL4X 3SFZA 3UGJA 1R7RA 4LF6M 1YUBA 3KVWA 2EA0A 4HLQA 2QPAA 4JI8M 5EJCA 2XSZD 2G5GX 3I4VA 1G3IA 3FUUA 1W5SA 3PNVA 5C18A 3DZDA 1H6UA 3HONA 5GKNA 3VDUA 4DR4M 1YU4A 3U6DA 3GLGB 3R9XB 4B3RM 4FVMA 4NZ4A 3PVSA 3FD9A 1TH4A 3THGA 3U6CA 2XF3A 3NWLA 5EP3A 4NXMM 5IZ7D 1G59A 5ITYA 5ITXE 4B7FA 4G6ZA 3L26A 3FUTA 2UUAM 4NZ1A 3IG5A 4LZJA 2R46A 4KODA 2Z7JA 1YE9A 4FCTA 3E9SA 1KSFX 4PD2A 5EP2A 2Z4RA 2C98A 1XWIA 4GC5A 4MGIE 5EXSA 1SXJE 3GPPA 2XSZA 2EUCA 5H37D 1QQWA 4R7GA 2V1CA 3EIHA 2BNKA 3E4RA 3VKGA 1QANA 4NOOB 4AKGA 5FLXS 3HU1A 3GLHB 5IREB 1IBMM 4AI6A 5ITRA 1MX0A 4DR7M 1HNWM 3DFZA 3FTDA 4NL4H 4JXJA 4MGHA 2AHMA 2FOIC 3LVWA 4DV4M 1HT1E 4OVZA 1KFVA 1HQYE 2C9OA 5EXTA 1SXJD 3A98B 2BJWA 2XZUA 3SARA 1Z6TA 4X65M 1DO0A 3HHWA 1N77A 3GQ4A 3U5ZA 4IBJA 3T38A 4D82A 3J7BA 4DUZM 4I4LA 1IN4A 3GLFB 2ZAOA 2NQ8C 3GLHA 2DVWB 3SAVA 1XMOM 4DR1M 2HCBA 1YU2A 2RKOA 2Y21A 4G4NA 1JR3A 4JI5M 3PXGA 2F4VM 3GRUA 3AOEC 2ZANA 4QNLA 3B9PA 2YR0A 5EXPA 1FJGM 4FW9A 4GIPA 3WHLA 1NVMA 2R45A 3RGSA 2M5ZA 3U5ZB 4GKKM 1J7KA 5FTKA 4FCWA 4DR5M 2P5TA 3ZCBB 1NHGC 2OQ4A 4AZFA 1SXJA 2JE5A 3CF2A 3L28A 3LQQA 3A45A 4NRVA 4Z6YA 1E32A 4LG2A 3KDSE 4LGMA 3RE8A 2CFOA 3VLFB 1K3WA 1IBLM 4LF4M 2UUBM 4MM3B 3A46A 3SC3A 1IN8A 1PJJA 2R4JA 5JI3E 3SAWA 4GMQA 3TE6A 3GLGA 5KPRA 3QAUA 3J81S 3A42A 1Q3CA 1N33M 3U60B 1C1KA 1IXRC 2VQEM 2F5SA 5BR8M 3J2PB 4QOSA 1TH2A 1DGBA 3T1YM 3GQ5A 1SXJC 4KO8A 2F5QA 4IBIA 2XD1A 1N75A 2C9CA 3FYCA 5ITTA 2DWLA 2DWNA 3SYLA 3GLIA 2XD5A 1FNNA 4GH9A 5E26A 2CUZA 2Y0QA 3HJSA 5FTLA 1HR0M 1HQCA 4IIWA 3GPXA 1JQJC 4OJPA 3CF6E 1NSFA 2RGHA 4I5SA 3KSJA 2QP9X 2CV2A 1N78A 4BB9A 1HT2E 3UK6A 4FD2A 1Z59A 2ZM6M 1IN5A 3CF0A 3KOWE 3FTCA 3HU3A 5A2QS 3HHYA 2L09A 1X37A 4DR2M 4NYYA 5JI2E 3KOZE 2CEAA 2LH0A 4JYAM 1IQPA 3VDPA 4NXNM 4L4UA 3JR4A 3LQRA 3EIEA 4FWHA 3SMSA 3D8LA 1NNJA 4LF5M 4M9XA 3UJNA 4DV6M 2J7OA 4NYUA 3W0FA 4CHTB 4M9SA 4AG6A 1QAOA 3VK7A 2YFQA 4LJ8A 4IBKA 1IN6A 4B3TM 1D2NA 2A5YB 1NJFA 4QNRA 2E5LM 4X62M 1IM2A 4I81A 1XC8A 4M9ZA 1GL7A 2ZBKB 4B7HA 4LJ5A 5F3WA 4L8RC 4IBCA 3U6SA 3SYKA 2Y2IA 4OJ5A 3KW6A 2IOUA 1NY6A 3MK6A 3MJ5A 3OTOM 2QCUA 5DYIA 4X66M 3D8BA 1G4AE 4DR3M 3HWSA 1E94E 3SASA 4GHAA 2UU9M 4IBGA 4AKHA 4WURA 4K0KM 4QHSA 5KPTA 3GO8A 1HNXM 2R62A 4LY6A 5FTJA 5LMUM 1DGHA 4LJ6A 4JV5M 3FUXA 1YU1A 3J80S 1YUEA 2DWMA 3L25A 1UM8A 4M0WA 4OUIA 4JN6A 1R2YA 3KS4A 1NY5A 4G4RA 2Y0TA 1IXZA 4L78A 1IBKM 2JCHA 1QYRA 2Z4SA 3DOAA 4B3SM 1L8QA 1NJGA 1OJLA 4GC9A 2XFSA 4B7GA 2DHRA 3HSHA 1NNUC 1G41A 4M0DA 2XLJA 1XXHB 1L1ZA 2V6ZM 1QAQA 4OW0A 3LVVA 2O5RA 1GKIA 3U6EA 1TDZA 3ILKA 1L2CA 3KP0E 3T15A 4YY3M 2RGOA 2QBYB 4IJEA 4AKIA 4OX9M 3M7GA 1QZMA 3M0EA 1J5EM 1IY1A 3L29A 4JI1M 2BG1A 5DYGA 5BPVA 2LWXA 2KW0A 1PJIA 4IBFA 1TGUA 4KLNA 3T1HM 4R3DA 3UMMA 1Z5AA 4L16A 2XH9A 1IY0A 2R4EA 2OPFA 2QZ4A 1SXJB 2L7IA 4PCZA 2QBYA 2H1RA 2DZOB 2D7HA 3TWLA 4LRTA 4FWGA 4NZ3A 4BBAA 1Z5CA 2M60A 4B08A 3U61B 2UXBM 1PM5A 3FKEA 4X64M 1Q3BA 2CHVA 4DV7M 4G4OA 2X8AA 4RF0A 3JAMS 4YHHM 5DNYA 3GRRA 1HNZM 1XHBA 3GQ3A 4NRWA 1TDHA 4OJLA 2CE7A 1Q39A 3MHVC 4JI0M 3KS8A 4IBBA 2V1UA 3PNYA 3U6OA 1R2ZA 3LMMA 5FTNA 2J7NA 4GITA 2X4AA 3FYDA 5EQTA 1DGGA 3SHGB 3SBJA 2EO2A 4RNAA 3KFUG 3CTWB 4OJ6A 3BOSA 5KPZA 2D7GA 2QENA 3SMPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FKE A;  3L28 A;  3L29 A;  4LG2 A;  4IBD A;  5BPV A;  4IBC A;  4GH9 A;  4GHA A;  4IJF A;  4IBG A;  4IBF A;  3KS8 A;  4IBB A;  4IBK A;  3L26 A;  3L27 A;  4GHL A;  4IBE A;  3L25 A;  3L2A A;  4IJE A;  3KS4 A;  4IBI A;  4IBJ A; 
#chains in the Genus database with same CATH topology
 3SHF A;  1L2D A;  2RTS A;  3TPZ A;  1QVR A;  2DZN B;  2K47 A;  4LGY A;  2DAK A;  4JI4 M;  1E6N A;  1T43 A;  3FUV A;  3MQL A;  1VDD A;  2JZ1 A;  1TH3 A;  3HU2 A;  3KP1 E;  1N36 M;  4S12 A;  3RFW A;  1R6B X;  5IWA M;  3AKZ A;  4OU7 A;  5ITQ A;  3WD2 A;  3HHZ A;  3HGI A;  1L1T A;  2R0I A;  4GKJ M;  2FFF B;  3H4M A;  4OJO A;  1OAI A;  2Y2N A;  4LJ9 A;  2QQ8 A;  3LCU A;  2D7E A;  3GLI B;  2JP7 A;  3U6L A;  2C99 A;  1K3X A;  3WHK A;  1TR8 A;  2LVQ D;  4AG5 A;  3V76 A;  3U6Q A;  3I51 A;  5E6J A;  4G4Q A;  2WSF F;  3K9P A;  3AFH A;  1EIJ A;  1UFZ A;  3L2A A;  2F5P A;  3LCV B;  1R4G A;  1IY2 A;  2CHQ A;  2DEN A;  2JA2 A;  2OO9 A;  4FWD A;  4II7 A;  5KO3 A;  4G3O A;  5ITX A;  4GEW A;  7CAT A;  2F5O A;  3UZU A;  2KRU A;  2V5O A;  3HKP A;  2F5N A;  1W5T A;  2DWZ B;  3J7A S;  2KEB A;  3FUW A;  4IBD A;  4MB5 A;  2G8L A;  4IJF A;  3AOE A;  2C5R A;  2Y2Q A;  2LVN C;  2FFJ A;  1MN3 A;  4ANR A;  2YQZ A;  1NHW C;  2L6O A;  1ZQ9 A;  2R6F A;  4D80 A;  3GPU A;  1SG9 A;  4L15 A;  5FSW A;  1GPF A;  1WJ7 A;  4LZZ A;  1J09 A;  3N3F A;  2VII A;  4REZ A;  3U60 A;  2MRO B;  4JI7 M;  1WXQ A;  4Z2J A;  2CV0 A;  1G8P A;  4XGI A;  2DI0 A;  2Y2K A;  4F2L A;  1VQ1 A;  1DGF A;  3B7N A;  2LXE A;  2OOB A;  5ITU A;  3K1J A;  2GNO A;  1W1V A;  1OTR A;  3CGW A;  1TTE A;  4JI6 M;  1YSY A;  3NBX X;  4LFA M;  4D81 A;  3FE3 A;  3K92 A;  1Z5B A;  2CHG A;  3B7Q A;  4LRS A;  4CIS A;  4HME A;  4DUY M;  2XZF A;  1EE8 A;  2X49 A;  3WD0 A;  1XXH A;  2O25 A;  2Q2E B;  2ZTD A;  1YU3 A;  2Y20 A;  1GXD A;  1GJS A;  1L2B A;  2KHH A;  2XGN A;  1I4W A;  4LFB M;  1XMQ M;  1IXS B;  4GRI A;  2N35 A;  5C1B A;  1YU0 A;  1T3T A;  4QHT A;  3AV0 A;  4DV5 M;  2UXD M;  1E6Z A;  1WGL A;  2YNM D;  4P16 A;  1V92 A;  4LJA A;  3KOY E;  3ZH9 B;  4XK8 F;  5KQD A;  4AQY M;  4B3M M;  4LF8 M;  4GHL A;  4Z8X A;  1QAM A;  2HHH M;  4NSO B;  3ZC7 B;  2LVP C;  2Y2H A;  5LMN M;  1N32 M;  3GPY A;  3AJI B;  1IN7 A;  4OVZ B;  2KDL A;  2UXC M;  4LJ7 A;  4XBO A;  1DGH B;  3FRI A;  5FTM A;  2FNA A;  3HJ8 A;  2Y2M A;  2UWX A;  3F92 A;  2Y2G A;  3B89 A;  4MB7 A;  4HL4 A;  1D0M A;  2Y2P A;  4LJ4 A;  1L6J A;  3SAT A;  3U6P A;  3QWL A;  4LF7 M;  1JR3 D;  2XEP A;  1K82 A;  4KHP M;  4QOZ C;  2LNH C;  4TUW A;  3GLF E;  3H4J A;  4A3V B;  3VK8 A;  4MGZ E;  4NSR A;  3U61 A;  2Y2J A;  2C96 A;  4LCB A;  1GLN A;  3E46 A;  3I4Y A;  4PDG A;  4CGY B;  4NZ5 A;  1E15 A;  1ZAE A;  1PRB A;  4EIW A;  4PT5 A;  4DV3 M;  4PDI A;  2BJV A;  3GRY A;  4JI2 M;  5EP4 A;  3GLF A;  3VFD A;  4JI3 M;  3W0L B;  4WP2 A;  5EXX A;  1OFH A;  1QZE A;  3Q8X A;  4AW4 A;  5L8R F;  2I7P A;  2Z3X A;  1HJP A;  2KA6 B;  4RKU F;  4WW0 A;  4Z2G A;  2UUC M;  3WX7 A;  4DV1 M;  2VDB B;  5EP1 A;  3M6A A;  3RGP A;  4FCV A;  3HJQ A;  1VEJ A;  2EJS A;  2CP8 A;  2WSC F;  2Z8Y M;  1ZMW A;  3AOG A;  4ZPX A;  3C58 A;  4I8O A;  3PFI A;  2R65 A;  3L27 A;  4W5W A;  3GP1 A;  1S3S A;  3R8F A;  1E9R A;  4ITQ A;  3HHX A;  1N34 M;  2KXE A;  3W68 A;  1H0G A;  1GL6 A;  4IBE A;  1VEK A;  3KXE C;  4DR6 M;  1W1Y A;  3DA1 A;  3TWM A;  1LV7 A;  1H0I A;  4LF9 M;  3J27 B;  4F1I A;  1J7M A;  5KQ8 A;  2ZAM A;  1MU5 A;  8CAT A;  3K8Z A;  4DV0 M;  3KSX A;  2W82 A;  3FTE A;  3BXW A;  1E9S A;  4RF1 A;  3GRV A;  4MH0 E;  1W1P A;  2CV1 A;  3TWK A;  2DAE A;  2R18 A;  1I94 M;  4Z2I A;  2FE8 A;  2QSF X;  2Y2L A;  1XNQ M;  2XFT A;  1ORY B;  1AIW A;  4DV2 M;  3VKH A;  4MGY E;  4TX8 A;  4MGK E;  1OFI A;  2I7N A;  3AL0 C;  3B7Z A;  3FTF A;  2Y2O A;  3K2L A;  3KOX E;  4BLC A;  3TQS A;  2L7H A;  3NBI A;  2DXI A;  1XNR M;  1DV0 A;  5IT9 S;  2ERC A;  1DO2 A;  4CJ6 A;  2KZU A;  1KYI A;  2JZ0 A;  4QNM A;  3U6M A;  1GVN A;  2HL7 A;  4LFC M;  4NY2 A;  2HKJ A;  2VQF M;  4P17 A;  2KZS A;  2R44 A;  2KRK A;  3IG8 A;  3SAU A;  3IHP A;  3JR5 A;  3TL4 X;  3SFZ A;  3UGJ A;  1R7R A;  2JY5 A;  4LF6 M;  1YUB A;  3KVW A;  2EA0 A;  4HLQ A;  1OGB A;  2QPA A;  3HY5 A;  4JI8 M;  3E21 A;  1UR9 A;  5EJC A;  2XSZ D;  2G5G X;  3I4V A;  1G3I A;  2MH8 A;  3FUU A;  1H8P A;  1W5S A;  3PNV A;  5C18 A;  3DZD A;  1H6U A;  2D49 A;  3HON A;  5GKN A;  3VDU A;  4DR4 M;  1YU4 A;  1P3Q Q;  3U6D A;  3GLG B;  2LHC A;  3R9X B;  2JY7 A;  4B3R M;  4FVM A;  4NZ4 A;  3PVS A;  3FD9 A;  1TH4 A;  3THG A;  3U6C A;  2DZL A;  2XF3 A;  3NWL A;  5EP3 A;  4NXM M;  5IZ7 D;  1G59 A;  5ITY A;  5ITX E;  2RRU A;  4B7F A;  4G6Z A;  3L26 A;  2JXN A;  3FUT A;  3MMP A;  2UUA M;  4UN2 B;  4NZ1 A;  1D0L A;  3IG5 A;  4LZJ A;  2R46 A;  4KOD A;  2Z7J A;  1YE9 A;  4FCT A;  3E9S A;  3T6P A;  1KSF X;  4Z2L A;  4PD2 A;  5EP2 A;  1LTM A;  4CIZ A;  1QDT A;  2Z4R A;  2C98 A;  1XWI A;  2LVO C;  1D0K A;  2WSE F;  3HX3 A;  4GC5 A;  4MGI E;  5EXS A;  2DNA A;  1SXJ E;  3GPP A;  3WD1 A;  2XSZ A;  2EUC A;  5H37 D;  1QQW A;  4R7G A;  2V1C A;  1XB2 B;  3EIH A;  1CUK A;  2BNK A;  3E4R A;  3VKG A;  4Z2K A;  1QAN A;  4NOO B;  4AKG A;  5FLX S;  3HU1 A;  3GLH B;  5IRE B;  1IBM M;  4AI6 A;  5ITR A;  1MX0 A;  4DR7 M;  1HNW M;  3DFZ A;  2LHG A;  1WHC A;  3FTD A;  4NL4 H;  4JXJ A;  4MGH A;  1EAK A;  2AHM A;  2FOI C;  3LVW A;  4DV4 M;  1HT1 E;  4OVZ A;  1KFV A;  2L4E A;  1HQY E;  2C9O A;  5EXT A;  1SXJ D;  3A98 B;  2BJW A;  2MR9 A;  2XZU A;  1Z6T A;  3SAR A;  4X65 M;  1DO0 A;  3HHW A;  1N77 A;  2KNA A;  3GQ4 A;  2LBC A;  3U5Z A;  4IBJ A;  2JY6 B;  3T38 A;  4D82 A;  3J7B A;  4DUZ M;  4I4L A;  1IN4 A;  1AUA A;  3GLF B;  2ZAO A;  2NQ8 C;  3GLH A;  5DFL A;  2DVW B;  3SAV A;  1XMO M;  4DR1 M;  2HCB A;  1YU2 A;  2RKO A;  4L6V 6;  4NC6 A;  1T6O A;  2Y21 A;  4G4N A;  1JR3 A;  1ED7 A;  4JI5 M;  1BVS A;  3PXG A;  2F4V M;  2JWS A;  1R5L A;  3GRU A;  3AOE C;  2ZAN A;  4QNL A;  3B9P A;  2YR0 A;  5EXP A;  1FJG M;  4FW9 A;  4GIP A;  3WHL A;  1NVM A;  2R45 A;  1A5T A;  2M5Z A;  3RGS A;  1ZV1 A;  2CWB A;  3Q8G A;  3U5Z B;  4GKK M;  1J7K A;  5FTK A;  4FCW A;  4KT0 F;  2WZJ A;  2MJ5 B;  4DR5 M;  2P5T A;  3ZCB B;  1NHG C;  2OQ4 A;  4DBG B;  2HAK A;  1Y8G A;  4AZF A;  1SXJ A;  2JE5 A;  3CF2 A;  2ZTC A;  3L28 A;  3LQQ A;  3A45 A;  4NRV A;  4Z6Y A;  1E32 A;  4LG2 A;  3KDS E;  4LGM A;  3RE8 A;  2CFO A;  3VLF B;  1K3W A;  1E8B A;  1IBL M;  4LF4 M;  2J5Y A;  4MM3 B;  3A46 A;  2UUB M;  3SC3 A;  2H5X A;  1IN8 A;  1OIZ A;  1PJJ A;  2R4J A;  5JI3 E;  3QYE A;  3SAW A;  4GMQ A;  3TE6 A;  3GLG A;  5KPR A;  3QAU A;  2DKL A;  3A42 A;  3J81 S;  1Q3C A;  1Q02 A;  1N33 M;  3U60 B;  3BBZ A;  1C1K A;  1IXR C;  3C9P A;  3QYB A;  2VQE M;  2F5S A;  1GOI A;  1QDR A;  2DHY A;  3W67 A;  5BR8 M;  3J2P B;  4QOS A;  1TH2 A;  1DGB A;  1VDL A;  3GQ5 A;  1SXJ C;  1OAO C;  3T1Y M;  4KO8 A;  2L2D A;  2F5Q A;  4IBI A;  1OIP A;  2XD1 A;  1KS0 A;  1PGY A;  1CK7 A;  3I01 M;  1N75 A;  2C9C A;  3FYC A;  5ITT A;  2DWL A;  2DWN A;  3SYL A;  3GLI A;  2XD5 A;  1FNN A;  4GH9 A;  5E26 A;  2CUZ A;  2Y0Q A;  3HJS A;  5FTL A;  3C3E A;  1HR0 M;  1HQC A;  4MB4 A;  4IIW A;  1TF0 B;  2BWB A;  3GPX A;  1IXS A;  1JQJ C;  4OJP A;  3CF6 E;  1NSF A;  1ZMV A;  2RGH A;  4I5S A;  3KSJ A;  2QP9 X;  2CV2 A;  1N78 A;  1ZMU A;  4BB9 A;  1NV9 A;  2K9D A;  3GLH E;  1HT2 E;  3UK6 A;  4FD2 A;  1Z59 A;  2ZM6 M;  1IN5 A;  3CF0 A;  3KOW E;  3FTC A;  3HU3 A;  5A2Q S;  3I04 M;  3HHY A;  2L09 A;  1X37 A;  4DR2 M;  2BWE A;  4NYY A;  4Y28 F;  5JI2 E;  1E6P A;  3KOZ E;  3GLI E;  2CEA A;  2LH0 A;  4JYA M;  1IQP A;  3VDP A;  4NXN M;  4L4U A;  3JR4 A;  3LQR A;  3EIE A;  2OOA A;  4FWH A;  3SMS A;  3D8L A;  1NNJ A;  2VF7 A;  4LF5 M;  4M9X A;  2HWJ A;  3UJN A;  4DV6 M;  1E6R A;  2J7O A;  4NYU A;  3W0F A;  4CHT B;  4M9S A;  4AG6 A;  1QAO A;  1G71 A;  3VK7 A;  1RU3 A;  2YFQ A;  4LJ8 A;  2JUJ A;  4IBK A;  1IN6 A;  1QUT A;  4B3T M;  1D2N A;  2A5Y B;  1NJF A;  2APL A;  4QNR A;  2E5L M;  2QHO B;  4X62 M;  1IM2 A;  4I81 A;  1XC8 A;  4Q7J A;  1AIP C;  4M9Z A;  1GL7 A;  2ZBK B;  4B7H A;  3WD4 A;  2G3Q A;  4LJ5 A;  5F3W A;  4L8R C;  4IBC A;  1OKS A;  3SYK A;  3U6S A;  2MGW A;  1O6I A;  2Y2I A;  1E88 A;  4OJ5 A;  3KW6 A;  2IOU A;  1NY6 A;  3MJ5 A;  3MK6 A;  3OTO M;  1F4I A;  2QCU A;  5DYI A;  4X66 M;  3D8B A;  2QNJ A;  3FRH A;  1G4A E;  4DR3 M;  2FS1 A;  1E94 E;  3HWS A;  4R71 A;  3SAS A;  4GHA A;  2UU9 M;  4IBG A;  4AKH A;  4WUR A;  2LVA A;  2DAG A;  4QHS A;  5KPT A;  3GO8 A;  4K0K M;  1PDC A;  4HMD A;  3M7P A;  1GO5 A;  1HNX M;  2R62 A;  4LY6 A;  5FTJ A;  5LMU M;  1DGH A;  2L4F A;  4LJ6 A;  4JV5 M;  3FUX A;  1YU1 A;  3J80 S;  1YUE A;  3HZJ A;  2KNV A;  2DWM A;  3L25 A;  1UM8 A;  4M0W A;  4OUI A;  4JN6 A;  1R2Y A;  3KS4 A;  1EFU B;  1NY5 A;  4G4R A;  2Y0T A;  1UR8 A;  1WR1 B;  1IXZ A;  1JB0 F;  4L78 A;  1IBK M;  1V33 A;  3C3D A;  2DAM A;  2JCH A;  1QYR A;  2Z4S A;  3DOA A;  2LTU A;  1L8Q A;  4B3S M;  1NJG A;  1OJL A;  1PJQ A;  4GC9 A;  2XFS A;  4B7G A;  2DHR A;  3HSH A;  2K0B X;  2EKF A;  1NNU C;  1PJS A;  1IFY A;  1G41 A;  4M0D A;  2XLJ A;  1XXH B;  1L1Z A;  2V6Z M;  1QAQ A;  2O01 F;  4OW0 A;  3LVV A;  2O5R A;  1QO6 A;  1GKI A;  3U6E A;  1TDZ A;  3ILK A;  1L2C A;  3KP0 E;  1W1T A;  4Z2H A;  3T15 A;  1WIV A;  3WD3 A;  4YY3 M;  2K6B A;  2RGO A;  3B74 A;  3ZQJ A;  2QBY B;  4HMC A;  4IJE A;  4AKI A;  4MB3 A;  4OX9 M;  3M7G A;  1QZM A;  3M0E A;  1J5E M;  1OGG A;  1IY1 A;  3L29 A;  4JI1 M;  1XXH E;  1GAB A;  1OQY A;  2BG1 A;  5DYG A;  5BPV A;  2GQF A;  2LWX A;  1JR3 E;  2KW0 A;  1PJI A;  4HEO A;  4IBF A;  1TGU A;  4KLN A;  2EKK A;  1VEG A;  4R3D A;  3T1H M;  3UMM A;  1WGN A;  1Z5A A;  4L16 A;  2XH9 A;  1IY0 A;  2R4E A;  2OPF A;  2FH0 A;  1SXJ B;  2L7I A;  2QZ4 A;  4PCZ A;  1C7Y A;  2QBY A;  3LW5 F;  3IEC A;  2B3T A;  2H1R A;  2DZO B;  2CRU A;  1PJT A;  2D7H A;  1GJT A;  3TWL A;  4LRT A;  1MJG M;  4FWG A;  2KNZ A;  4NZ3 A;  4BBA A;  1Z5C A;  2M60 A;  4B08 A;  3U61 B;  2UXB M;  2FN2 A;  3K9O A;  1PM5 A;  3FKE A;  4X64 M;  1Q3B A;  1QUS A;  2CHV A;  4DV7 M;  4G4O A;  2X8A A;  4RF0 A;  3JAM S;  4YHH M;  5DNY A;  3GRR A;  1HNZ M;  1XHB A;  3GQ3 A;  1NV8 A;  4NRW A;  1TDH A;  4OJL A;  1CXW A;  2CE7 A;  1Q39 A;  1V34 A;  1YLA A;  2JY8 A;  3MHV C;  4JI0 M;  4IBB A;  2V1U A;  3KS8 A;  3PNY A;  3GLG E;  3U6O A;  2DAI A;  3LMM A;  1R2Z A;  1VG5 A;  5FTN A;  1NO1 A;  2J7N A;  4GIT A;  2X4A A;  3FYD A;  5EQT A;  1DGG A;  3SHG B;  3SBJ A;  2EO2 A;  4RNA A;  3KFU G;  3CTW B;  4OJ6 A;  3BOS A;  5KPZ A;  2VF8 A;  2D7G A;  2QEN A;  3SMP A;  2JNH A; 
#chains in the Genus database with same CATH homology
 3SHF A;  1L2D A;  3TPZ A;  1QVR A;  2DZN B;  2K47 A;  4LGY A;  4JI4 M;  3FUV A;  1VDD A;  1TH3 A;  3HU2 A;  3KP1 E;  1N36 M;  4S12 A;  3RFW A;  1R6B X;  5IWA M;  3AKZ A;  4OU7 A;  5ITQ A;  3HHZ A;  3HGI A;  1L1T A;  4GKJ M;  4OJO A;  2FFF B;  3H4M A;  2Y2N A;  4LJ9 A;  2D7E A;  3GLI B;  3U6L A;  2C99 A;  1K3X A;  3WHK A;  4AG5 A;  3U6Q A;  3I51 A;  5E6J A;  4G4Q A;  3AFH A;  3L2A A;  2F5P A;  4II7 A;  1IY2 A;  2CHQ A;  2JA2 A;  4FWD A;  5KO3 A;  5ITX A;  2F5O A;  7CAT A;  3UZU A;  2KRU A;  3HKP A;  2F5N A;  1W5T A;  2DWZ B;  3J7A S;  2KEB A;  3FUW A;  4IBD A;  2G8L A;  4IJF A;  3AOE A;  2C5R A;  2Y2Q A;  2FFJ A;  2YQZ A;  1NHW C;  2L6O A;  1ZQ9 A;  4D80 A;  3GPU A;  4L15 A;  5FSW A;  4LZZ A;  1J09 A;  3N3F A;  2VII A;  4REZ A;  3U60 A;  4JI7 M;  1WXQ A;  2CV0 A;  1G8P A;  4XGI A;  2Y2K A;  1DGF A;  5ITU A;  2LXE A;  3K1J A;  4JI6 M;  1YSY A;  4LFA M;  4D81 A;  3K92 A;  1Z5B A;  2CHG A;  4LRS A;  4CIS A;  4DUY M;  2XZF A;  1EE8 A;  2X49 A;  1XXH A;  2Q2E B;  1YU3 A;  2Y20 A;  1L2B A;  2XGN A;  1I4W A;  4LFB M;  1XMQ M;  1IXS B;  4GRI A;  5C1B A;  1YU0 A;  1T3T A;  4QHT A;  3AV0 A;  4DV5 M;  2UXD M;  2YNM D;  4P16 A;  4LJA A;  3KOY E;  3ZH9 B;  4AQY M;  5KQD A;  4B3M M;  4LF8 M;  4GHL A;  4Z8X A;  1QAM A;  2HHH M;  4NSO B;  3ZC7 B;  2Y2H A;  5LMN M;  1N32 M;  3GPY A;  3AJI B;  1IN7 A;  4OVZ B;  2UXC M;  4LJ7 A;  4XBO A;  1DGH B;  5FTM A;  2FNA A;  3HJ8 A;  2Y2M A;  2UWX A;  2Y2G A;  4MB7 A;  4HL4 A;  2Y2P A;  4LJ4 A;  3SAT A;  3U6P A;  3QWL A;  4LF7 M;  1JR3 D;  2XEP A;  1K82 A;  4KHP M;  4QOZ C;  2LNH C;  4TUW A;  3VK8 A;  4A3V B;  4MGZ E;  4NSR A;  3U61 A;  2Y2J A;  2C96 A;  4LCB A;  1GLN A;  3I4Y A;  4PDG A;  4CGY B;  4NZ5 A;  1ZAE A;  4EIW A;  4PT5 A;  4DV3 M;  4PDI A;  2BJV A;  3GRY A;  4JI2 M;  5EP4 A;  3GLF A;  3VFD A;  4JI3 M;  3W0L B;  5EXX A;  1OFH A;  3Q8X A;  4AW4 A;  2Z3X A;  2I7P A;  2KA6 B;  4WW0 A;  2UUC M;  3WX7 A;  4DV1 M;  5EP1 A;  3M6A A;  3RGP A;  4FCV A;  3HJQ A;  3C58 A;  3AOG A;  4ZPX A;  4I8O A;  3PFI A;  2R65 A;  3L27 A;  4W5W A;  3GP1 A;  1S3S A;  3R8F A;  1E9R A;  4ITQ A;  3HHX A;  1N34 M;  2KXE A;  1GL6 A;  4IBE A;  3KXE C;  4DR6 M;  3DA1 A;  3TWM A;  1LV7 A;  4LF9 M;  3J27 B;  5KQ8 A;  2ZAM A;  1MU5 A;  8CAT A;  3K8Z A;  4DV0 M;  3KSX A;  2W82 A;  3FTE A;  1E9S A;  4RF1 A;  3GRV A;  4MH0 E;  2CV1 A;  3TWK A;  1I94 M;  2R18 A;  2FE8 A;  2Y2L A;  1XNQ M;  2XFT A;  1ORY B;  4DV2 M;  3VKH A;  4MGY E;  4MGK E;  1OFI A;  2I7N A;  3AL0 C;  3FTF A;  2Y2O A;  3K2L A;  3KOX E;  4BLC A;  3TQS A;  2L7H A;  3NBI A;  2DXI A;  1XNR M;  5IT9 S;  2ERC A;  1DO2 A;  2KZU A;  1KYI A;  4QNM A;  3U6M A;  1GVN A;  2HL7 A;  4LFC M;  4NY2 A;  2HKJ A;  2VQF M;  2KZS A;  2KRK A;  3IG8 A;  3SAU A;  3JR5 A;  3TL4 X;  3SFZ A;  3UGJ A;  1R7R A;  4LF6 M;  1YUB A;  3KVW A;  2EA0 A;  4HLQ A;  2QPA A;  4JI8 M;  5EJC A;  2XSZ D;  2G5G X;  3I4V A;  1G3I A;  3FUU A;  1W5S A;  3PNV A;  5C18 A;  3DZD A;  1H6U A;  3HON A;  5GKN A;  3VDU A;  4DR4 M;  1YU4 A;  3U6D A;  3GLG B;  3R9X B;  4B3R M;  4FVM A;  4NZ4 A;  3PVS A;  3FD9 A;  1TH4 A;  3THG A;  3U6C A;  2XF3 A;  3NWL A;  5EP3 A;  4NXM M;  5IZ7 D;  1G59 A;  5ITY A;  5ITX E;  4B7F A;  4G6Z A;  3L26 A;  3FUT A;  2UUA M;  4NZ1 A;  3IG5 A;  4LZJ A;  2R46 A;  4KOD A;  2Z7J A;  1YE9 A;  4FCT A;  3E9S A;  1KSF X;  4PD2 A;  5EP2 A;  2Z4R A;  2C98 A;  1XWI A;  4GC5 A;  4MGI E;  5EXS A;  1SXJ E;  3GPP A;  2XSZ A;  2EUC A;  5H37 D;  1QQW A;  4R7G A;  2V1C A;  3EIH A;  2BNK A;  3E4R A;  3VKG A;  1QAN A;  4NOO B;  4AKG A;  5FLX S;  3HU1 A;  3GLH B;  5IRE B;  1IBM M;  4AI6 A;  5ITR A;  1MX0 A;  4DR7 M;  1HNW M;  3DFZ A;  3FTD A;  4NL4 H;  4JXJ A;  4MGH A;  2AHM A;  2FOI C;  3LVW A;  4DV4 M;  1HT1 E;  4OVZ A;  1KFV A;  1HQY E;  2C9O A;  5EXT A;  1SXJ D;  3A98 B;  2BJW A;  2XZU A;  3SAR A;  1Z6T A;  4X65 M;  1DO0 A;  3HHW A;  1N77 A;  3GQ4 A;  3U5Z A;  4IBJ A;  3T38 A;  4D82 A;  3J7B A;  4DUZ M;  4I4L A;  1IN4 A;  3GLF B;  2ZAO A;  2NQ8 C;  3GLH A;  2DVW B;  3SAV A;  1XMO M;  4DR1 M;  2HCB A;  1YU2 A;  2RKO A;  2Y21 A;  4G4N A;  1JR3 A;  4JI5 M;  3PXG A;  2F4V M;  3GRU A;  3AOE C;  2ZAN A;  4QNL A;  3B9P A;  2YR0 A;  5EXP A;  1FJG M;  4FW9 A;  4GIP A;  3WHL A;  1NVM A;  2R45 A;  3RGS A;  2M5Z A;  3U5Z B;  4GKK M;  1J7K A;  5FTK A;  4FCW A;  4DR5 M;  2P5T A;  3ZCB B;  1NHG C;  2OQ4 A;  4AZF A;  1SXJ A;  2JE5 A;  3CF2 A;  3L28 A;  3LQQ A;  3A45 A;  4NRV A;  4Z6Y A;  1E32 A;  4LG2 A;  3KDS E;  4LGM A;  3RE8 A;  2CFO A;  3VLF B;  1K3W A;  1IBL M;  4LF4 M;  2UUB M;  4MM3 B;  3A46 A;  3SC3 A;  1IN8 A;  1PJJ A;  2R4J A;  5JI3 E;  3SAW A;  4GMQ A;  3TE6 A;  3GLG A;  5KPR A;  3QAU A;  3J81 S;  3A42 A;  1Q3C A;  1N33 M;  3U60 B;  1C1K A;  1IXR C;  2VQE M;  2F5S A;  5BR8 M;  3J2P B;  4QOS A;  1TH2 A;  1DGB A;  3T1Y M;  3GQ5 A;  1SXJ C;  4KO8 A;  2F5Q A;  4IBI A;  2XD1 A;  1N75 A;  2C9C A;  3FYC A;  5ITT A;  2DWL A;  2DWN A;  3SYL A;  3GLI A;  2XD5 A;  1FNN A;  4GH9 A;  5E26 A;  2CUZ A;  2Y0Q A;  3HJS A;  5FTL A;  1HR0 M;  1HQC A;  4IIW A;  3GPX A;  1JQJ C;  4OJP A;  3CF6 E;  1NSF A;  2RGH A;  4I5S A;  3KSJ A;  2QP9 X;  2CV2 A;  1N78 A;  4BB9 A;  1HT2 E;  3UK6 A;  4FD2 A;  1Z59 A;  2ZM6 M;  1IN5 A;  3CF0 A;  3KOW E;  3FTC A;  3HU3 A;  5A2Q S;  3HHY A;  2L09 A;  1X37 A;  4DR2 M;  4NYY A;  5JI2 E;  3KOZ E;  2CEA A;  2LH0 A;  4JYA M;  1IQP A;  3VDP A;  4NXN M;  4L4U A;  3JR4 A;  3LQR A;  3EIE A;  4FWH A;  3SMS A;  3D8L A;  1NNJ A;  4LF5 M;  4M9X A;  3UJN A;  4DV6 M;  2J7O A;  4NYU A;  3W0F A;  4CHT B;  4M9S A;  4AG6 A;  1QAO A;  3VK7 A;  2YFQ A;  4LJ8 A;  4IBK A;  1IN6 A;  4B3T M;  1D2N A;  2A5Y B;  1NJF A;  4QNR A;  2E5L M;  4X62 M;  1IM2 A;  4I81 A;  1XC8 A;  4M9Z A;  1GL7 A;  2ZBK B;  4B7H A;  4LJ5 A;  5F3W A;  4L8R C;  4IBC A;  3U6S A;  3SYK A;  2Y2I A;  4OJ5 A;  3KW6 A;  2IOU A;  1NY6 A;  3MK6 A;  3MJ5 A;  3OTO M;  2QCU A;  5DYI A;  4X66 M;  3D8B A;  1G4A E;  4DR3 M;  3HWS A;  1E94 E;  3SAS A;  4GHA A;  2UU9 M;  4IBG A;  4AKH A;  4WUR A;  4K0K M;  4QHS A;  5KPT A;  3GO8 A;  1HNX M;  2R62 A;  4LY6 A;  5FTJ A;  5LMU M;  1DGH A;  4LJ6 A;  4JV5 M;  3FUX A;  1YU1 A;  3J80 S;  1YUE A;  2DWM A;  3L25 A;  1UM8 A;  4M0W A;  4OUI A;  4JN6 A;  1R2Y A;  3KS4 A;  1NY5 A;  4G4R A;  2Y0T A;  1IXZ A;  4L78 A;  1IBK M;  2JCH A;  1QYR A;  2Z4S A;  3DOA A;  4B3S M;  1L8Q A;  1NJG A;  1OJL A;  4GC9 A;  2XFS A;  4B7G A;  2DHR A;  3HSH A;  1NNU C;  1G41 A;  4M0D A;  2XLJ A;  1XXH B;  1L1Z A;  2V6Z M;  1QAQ A;  4OW0 A;  3LVV A;  2O5R A;  1GKI A;  3U6E A;  1TDZ A;  3ILK A;  1L2C A;  3KP0 E;  3T15 A;  4YY3 M;  2RGO A;  2QBY B;  4IJE A;  4AKI A;  4OX9 M;  3M7G A;  1QZM A;  3M0E A;  1J5E M;  1IY1 A;  3L29 A;  4JI1 M;  2BG1 A;  5DYG A;  5BPV A;  2LWX A;  2KW0 A;  1PJI A;  4IBF A;  1TGU A;  4KLN A;  3T1H M;  4R3D A;  3UMM A;  1Z5A A;  4L16 A;  2XH9 A;  1IY0 A;  2R4E A;  2OPF A;  2QZ4 A;  1SXJ B;  2L7I A;  4PCZ A;  2QBY A;  2H1R A;  2DZO B;  2D7H A;  3TWL A;  4LRT A;  4FWG A;  4NZ3 A;  4BBA A;  1Z5C A;  2M60 A;  4B08 A;  3U61 B;  2UXB M;  1PM5 A;  3FKE A;  4X64 M;  1Q3B A;  2CHV A;  4DV7 M;  4G4O A;  2X8A A;  4RF0 A;  3JAM S;  4YHH M;  5DNY A;  3GRR A;  1HNZ M;  1XHB A;  3GQ3 A;  4NRW A;  1TDH A;  4OJL A;  2CE7 A;  1Q39 A;  3MHV C;  4JI0 M;  3KS8 A;  4IBB A;  2V1U A;  3PNY A;  3U6O A;  1R2Z A;  3LMM A;  5FTN A;  2J7N A;  4GIT A;  2X4A A;  3FYD A;  5EQT A;  1DGG A;  3SHG B;  3SBJ A;  2EO2 A;  4RNA A;  3KFU G;  3CTW B;  4OJ6 A;  3BOS A;  5KPZ A;  2D7G A;  2QEN A;  3SMP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...