4IBEA

Ebola virus vp35 bound to small molecule
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
123
structure length
123
Chain Sequence
b'DISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polymerase cofactor VP35
molecule tags Transcription/transcription inhibitor
source organism Ebola virus
publication title In Silico Derived Small Molecules Bind the Filovirus VP35 Protein and Inhibit Its Polymerase Cofactor Activity.
pubmed doi rcsb
total genus 42
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ibeA01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4ibeA02
4IBKA 3L2AA 4IBIA 3KS4A 4IBBA 4IBDA 3FKEA 4IJEA 3L28A 4GHLA 3KS8A 4LG2A 4IBFA 4GH9A 4IBJA 4GHAA 3L25A 3L29A 4IJFA 5BPVA 3L26A 4IBCA 3L27A 4IBEA 4IBGA
chains in the Genus database with same CATH superfamily
3SAWA 1TR8A 4NC6A 5C1BA 2UXBM 5EJCA 2OO9A 3WX7A 2L4FA 1NNUC 1QZEA 4M0DA 1DGBA 4L4UA 1WR1B 4PDGA 5ITXA 1N78A 2JWSA 4XGIA 1LTMA 2RGOA 3LCUA 4D80A 1L6JA 3L28A 1PJIA 3Q8XA 4A3VB 2OQ4A 4LG2A 1IN6A 1P3QQ 1IY1A 4LF9M 4IBJA 1V33A 2DAGA 2LVAA 4DV5M 3M6AA 3J80S 1T43A 1E32A 1IFYA 2LVPC 3LVVA 4DR4M 1IY0A 3DZDA 4NYYA 3TL4X 3L26A 2FFJA 2KZSA 1JR3A 3J2PB 1XMQM 4S12A 1O6IA 3LVWA 4AKHA 2CHQA 2DNAA 2K0BX 3AFHA 2RRUA 3WHLA 1DO2A 2D49A 4DV7M 4Z2IA 1QVRA 4IBIA 1IN5A 1L2BA 1TH4A 3J81S 1NY6A 4M0WA 2CHGA 2J7OA 3MK6A 2Y2GA 1KSFX 3U6EA 2JUJA 1IXRC 4FVMA 3THGA 4AZFA 3FE3A 5KPRA 2WSEF 1F4IA 2DWZB 3IG8A 4JI4M 1E6ZA 2DXIA 4MB5A 3HGIA 7CATA 2ZANA 2J7NA 1Z5AA 2ZTDA 2LTUA 5IWAM 4FCWA 4CGYB 2FFFB 1R5LA 1NV8A 2KRKA 3L29A 4XK8F 3UZUA 3GRVA 5A2QS 3U6MA 1E8BA 1YE9A 2UU9M 3DFZA 3FUUA 2QENA 2HKJA 3NBXX 4LRTA 3EIEA 1GL7A 4BBAA 3AKZA 3U60A 4GC5A 3B7NA 2LWXA 2DI0A 2DENA 4BB9A 3GLFA 1G4AE 2BNKA 2HAKA 2BJVA 3WD3A 1AIWA 1VG5A 4RKUF 3KOZE 3ZC7B 1FNNA 5E26A 4DR6M 4NYUA 2R18A 3J27B 2L09A 3RGPA 3WD4A 1IBLM 1JB0F 3HSHA 4GMQA 1SXJA 2IOUA 3WD0A 2Z8YM 3RGSA 4HEOA 1YU4A 4LGMA 3B9PA 5EXPA 3W68A 2R0IA 4M9XA 3KS8A 2F5PA 5ITRA 2Z4RA 4LF8M 4OJPA 5FTNA 3A46A 2DZLA 2KNAA 1GO5A 4LZJA 2CFOA 2G8LA 3FRIA 1ZMUA 1XHBA 2ZTCA 3V76A 4OJ6A 1TDHA 2JE5A 2H5XA 1IXZA 2CRUA 1R6BX 3GPUA 2E5LM 1CXWA 1N34M 3LW5F 4DUYM 3SARA 3JR4A 2R44A 3KOYE 1XNRM 1DGHA 2CHVA 2JNHA 3U6CA 2V5OA 4RF1A 4LF6M 4LJAA 3W0LB 4LJ8A 1YU2A 2L7IA 3U5ZA 1W1YA 4FW9A 2XD5A 3H4MA 4IJEA 4M9ZA 4FWHA 1W1VA 3M7PA 3RE8A 4OX9M 3TQSA 3AV0A 3M0EA 2C98A 1PM5A 4CISA 5EQTA 2XSZA 1OAOC 3E9SA 2D7EA 1ZMVA 3BOSA 2XZFA 2OOAA 4GKJM 2VDBB 4JXJA 1QANA 2DZNB 2AHMA 2D7GA 3BBZA 3E21A 2N35A 2X4AA 2WSCF 4DR3M 2K47A 2BWBA 2W82A 3GRYA 4NOOB 2ZM6M 1IQPA 1IN7A 2JA2A 4DV0M 3C58A 3U5ZB 1QUTA 1OIZA 1IBKM 1E6RA 4IBCA 2LVNC 3DA1A 2F5NA 3A45A 4ITQA 1T3TA 1HQCA 1N32M 4NZ4A 4JI5M 4NY2A 4IBKA 4Z2JA 2R62A 3R8FA 1NNJA 4DV1M 4LFCM 1OGGA 1DGHB 2BG1A 4RNAA 3VKHA 3UMMA 4LJ4A 2FH0A 3I51A 3U6PA 3GP1A 4JI1M 2EKFA 2O01F 3GQ4A 1G8PA 5EP1A 1GL6A 2WZJA 1RU3A 2KA6B 2Y0QA 1JQJC 3HY5A 2B3TA 3U61A 4AKIA 1C1KA 4DR7M 3GLIA 2O5RA 1YU0A 2JXNA 1WGNA 3J7BA 1HT1E 3SC3A 2FNAA 1D0LA 1NV9A 2DKLA 3E46A 4LGYA 5EP4A 3SYKA 2LNHC 4LRSA 3NWLA 3B7ZA 1G71A 3PNVA 5F3WA 2XLJA 2LH0A 4B3MM 3QYBA 4RF0A 2LBCA 3CTWB 1BVSA 1SXJB 3A98B 4X66M 3SAUA 4G3OA 4JI7M 1J7MA 5ITQA 2D7HA 2XFTA 4HL4A 2OOBA 1X37A 3GLFE 1NJGA 3TPZA 5C18A 2UXDM 2VF8A 1Z6TA 4MM3B 3U60B 3KOWE 3U6SA 1NY5A 5DNYA 2HL7A 4I81A 5EXTA 1SXJC 1DGGA 1GLNA 4IBFA 3KXEC 1VEJA 5KPZA 4JI6M 1Q02A 2Y21A 1MN3A 2KW0A 4D81A 2Y2NA 2DHYA 2QNJA 4AG5A 5EXXA 4AKGA 2J5YA 3MMPA 3T6PA 1OJLA 1ZMWA 1G41A 1QAQA 4LJ5A 1I94M 2Z3XA 3C3EA 3K9PA 1EAKA 1Q3BA 1OTRA 3I01M 3PFIA 2JP7A 3W67A 2KEBA 4MGZE 2UUBM 2APLA 2ZAOA 3L27A 4PD2A 2YQZA 4OW0A 4I4LA 3HU2A 3FRHA 3AL0C 1GJSA 4L16A 1QAMA 3FUXA 2VF7A 1OAIA 3B89A 2R65A 4ZPXA 3TWKA 3ZH9B 5L8RF 1QYRA 4OVZA 4JV5M 4IIWA 3GLGA 3M7GA 4QNMA 1OGBA 1MU5A 4G4OA 1D0MA 4LJ9A 4B3RM 1W1PA 3H4JA 4DBGB 1W1TA 1E88A 2Y2PA 1HT2E 3SHGB 3GO8A 3L25A 3HWSA 1YUBA 1E6PA 3HONA 4NZ1A 2JCHA 1OKSA 1QDTA 3GPYA 3IECA 4GIPA 2DAIA 2XH9A 3T15A 1D0KA 5ITXE 2C9CA 4LFAM 2RTSA 4CHTB 2M60A 5LMUM 3LQQA 1C7YA 3PXGA 1HQYE 2X8AA 3E4RA 4R3DA 3FTCA 3OTOM 4GHAA 1I4WA 1H8PA 3F92A 4L78A 5EP2A 4FD2A 1H6UA 4PDIA 3HHWA 3FUWA 4LF4M 2Y20A 4IBDA 3MQLA 1IM2A 3CGWA 2Z4SA 1Y8GA 4KO8A 4MB7A 1N36M 4LCBA 1R2ZA 2YR0A 5EXSA 4G6ZA 2CWBA 5DFLA 4DR2M 2KRUA 2LHGA 2R4JA 4GC9A 2EA0A 1XC8A 4TX8A 2BJWA 1VDLA 3LMMA 2LXEA 4QNRA 4FCTA 3KP1E 5E6JA 3SMPA 2DHRA 5JI3E 4AQYM 4G4NA 1TDZA 2VIIA 2DVWB 2HCBA 1XXHA 4LJ6A 2QCUA 3VDUA 5FLXS 1MJGM 1Q3CA 1DV0A 3B74A 4Q7JA 2F4VM 3GLGB 3HU1A 3K1JA 4OVZB 4AI6A 2MH8A 2FS1A 1GKIA 5LMNM 4NL4H 4Z8XA 4HMEA 4L8RC 1HNWM 3EIHA 1N77A 3KSJA 2Y2LA 1VEKA 4GRIA 2A5YB 5GKNA 4G4RA 2I7PA 1Z5CA 4FWGA 1S3SA 4FWDA 2XF3A 1LV7A 2CE7A 4LFBM 3I4YA 5FTKA 3LCVB 1YU3A 2KZUA 4OJOA 1PJTA 3K92A 3GLHE 4R71A 2EO2A 1XWIA 1J09A 1XXHE 4HMDA 1Q39A 4KLNA 5KQ8A 1SXJE 4MH0E 1NHWC 5BPVA 5IREB 4MB3A 1GOIA 1QZMA 4X64M 2Y2MA 1VDDA 3SATA 4IBEA 2XZUA 4KT0F 4DR5M 2YNMD 4B3TM 2DWNA 2Y2JA 5KO3A 1OFIA 2C96A 2QP9X 3GLHB 1OFHA 3L2AA 4EIWA 3VK8A 2KHHA 3KS4A 4WW0A 2GQFA 4LF5M 4IBBA 3PNYA 3FYCA 4AW4A 3T1YM 1E6NA 4MGIE 4PCZA 3JAMS 1PJQA 4GHLA 3HHXA 4YHHM 4KHPM 3GRUA 1PGYA 1G59A 1HNZM 3HJQA 1SXJD 3GLGE 2QPAA 3I04M 3N3FA 1UFZA 1ZV1A 3AOEC 2DWMA 4K0KM 5DYIA 1IN4A 1QAOA 2OPFA 2MGWA 2V1CA 3SFZA 3ILKA 4GITA 1R2YA 4OJ5A 1TH3A 2XFSA 2DWLA 3C9PA 4JI8M 3GLIB 4WURA 4XBOA 1PRBA 3VFDA 4B7HA 3KFUG 3U61B 1N75A 2CV2A 2MR9A 1PJSA 2UWXA 1TTEA 3QAUA 2UUAM 4GEWA 4OJLA 4QHTA 4CJ6A 2L7HA 2I7NA 3HZJA 3C3DA 1OIPA 4GKKM 2ERCA 4G4QA 5EP3A 4DV2M 2YFQA 3SASA 4I8OA 1Z59A 3AJIB 1HNXM 3K8ZA 4JYAM 3U6DA 8CATA 4QOZC 3VK7A 3FTFA 4B7GA 5ITUA 4B7FA 1L2CA 1DGFA 1D2NA 2XSZD 3WHKA 2LVOC 2FOIC 2CEAA 1Z5BA 3HHZA 1IBMM 3GRRA 1L1ZA 5KPTA 1WXQA 2F5SA 1QDRA 2QBYA 3QWLA 3HJSA 1TF0B 2BWEA 2G3QA 4FCVA 5ITYA 4NSRA 1IXSA 4UN2B 4AG6A 1GABA 5H37D 1TH2A 4QOSA 3KW6A 3NBIA 2KXEA 3AOGA 2H1RA 5IZ7D 1E15A 3T1HM 5BR8M 2XGNA 2LHCA 4WP2A 2ZAMA 2EKKA 5KQDA 1WGLA 1QUSA 4IJFA 1YUEA 3HJ8A 1NJFA 3GPXA 3A42A 1FJGM 3VDPA 4CIZA 2CV0A 2UXCM 3HKPA 4KODA 2QSFX 3IG5A 3K9OA 1IXSB 3HX3A 4B08A 4QNLA 1J5EM 4Z2HA 1ZAEA 4IBGA 1NSFA 2QBYB 2EJSA 2KNVA 4JI3M 4MB4A 1QQWA 1UM8A 2JY8A 1OQYA 3Q8GA 1XNQM 3GPPA 3U6OA 1UR9A 3KP0E 4Z2KA 1AUAA 4REZA 1WIVA 2CP8A 3FYDA 1PJJA 2XD1A 2Y2HA 1IN8A 3WD1A 3VLFB 4Z2LA 4Z6YA 3LQRA 4LY6A 1K3WA 4NZ3A 2XEPA 3UJNA 4DV6M 2Z7JA 1EFUB 4X62M 1KFVA 3GLFB 3JR5A 4NRWA 3T38A 2QQ8A 3TE6A 1XMOM 1L1TA 3GQ3A 1VEGA 1WJ7A 4DR1M 2P5TA 1H0IA 2Y2OA 4OU7A 2C9OA 3B7QA 5ITTA 1W5SA 1WHCA 2X49A 2L2DA 1HJPA 3KOXE 1DO0A 1EIJA 4LF7M 1TGUA 3MHVC 4ANRA 3U6QA 1E9RA 3CF2A 3R9XB 2RKOA 1AIPC 1ZQ9A 2G5GX 2KDLA 1H0GA 3D8BA 1SG9A 1E94E 2KNZA 4X65M 1KS0A 1J7KA 2FE8A 2CUZA 2DAEA 1YU1A 3PVSA 4W5WA 4HMCA 1E9SA 3SAVA 3WD2A 5FTLA 2JZ1A 1ED7A 1CK7A 1JR3E 2GNOA 1NO1A 3HHYA 4F1IA 3GQ5A 3SHFA 2R45A 5JI2E 2V6ZM 4MGHA 4L15A 1GPFA 3UK6A 1T6OA 4MGKE 4JI0M 1L2DA 1V34A 1GVNA 2JY6B 2K6BA 4B3SM 1N33M 3AOEA 2Q2EB 3I4VA 4DUZM 3FTEA 2R6FA 3CF0A 3SYLA 2MROB 3GLIE 2JY5A 4JI2M 4TUWA 3KSXA 1V92A 1YSYA 3GLHA 3K2LA 2M5ZA 2O25A 2Y2QA 2WSFF 3FUTA 5FSWA 4OUIA 2NQ8C 3FKEA 1JR3D 5IT9S 4II7A 3SBJA 3U6LA 4NRVA 2R4EA 4PT5A 4NXMM 4D82A 1QO6A 2R46A 2HWJA 3ZCBB 1NVMA 1R7RA 3FTDA 1W5TA 3FD9A 3KVWA 1L8QA 2L6OA 2LVQD 2C99A 2DAKA 2RGHA 2JY7A 4LZZA 3QYEA 2JZ0A 3HU3A 4F2LA 4YY3M 4LJ7A 2F5OA 2DAMA 3J7AS 4DV4M 4NXNM 2K9DA 2QZ4A 1R4GA 4QHSA 2HHHM 2MJ5B 4JN6A 2VQFM 3TWMA 4I5SA 1VQ1A 3IHPA 3KDSE 1IY2A 3CF6E 4MGYE 3TWLA 1K3XA 1UR8A 1EE8A 4R7GA 1XXHB 2VQEM 1K82A 3DOAA 2CV1A 1G3IA 2EUCA 1CUKA 4Y28F 3UGJA 2Y2KA 1MX0A 1A5TA 3MJ5A 2L4EA 5DYGA 4P17A 3ZQJA 2Y0TA 1XB2B 2UUCM 4GH9A 1GXDA 4M9SA 2F5QA 4Z2GA 1ORYB 4P16A 1YLAA 4DV3M 1HR0M 1GJTA 3FUVA 3VKGA 3D8LA 4BLCA 4HLQA 3W0FA 2Y2IA 3BXWA 2FN2A 1PDCA 3SMSA 1KYIA 2ZBKB 4L6V6 4NZ5A 4NSOB 2DZOB 1NHGC 2V1UA 5FTMA 5FTJA 3RFWA 2QHOB 2C5RA
chains in the Genus database with same CATH topology
3SAWA 5C1BA 2UXBM 5EJCA 3WX7A 4M0DA 1NNUC 1DGBA 4L4UA 4PDGA 5ITXA 1N78A 4XGIA 2RGOA 4D80A 3L28A 1PJIA 3Q8XA 4A3VB 2OQ4A 4LG2A 1IN6A 4LF9M 1IY1A 4IBJA 4DV5M 3M6AA 3J80S 1E32A 3LVVA 4DR4M 1IY0A 3DZDA 4NYYA 3TL4X 3L26A 2FFJA 2KZSA 1JR3A 3J2PB 1XMQM 4S12A 3LVWA 4AKHA 2CHQA 3AFHA 3WHLA 1DO2A 4DV7M 1QVRA 4IBIA 1IN5A 1L2BA 1TH4A 3J81S 1NY6A 4M0WA 2CHGA 2J7OA 3MK6A 2Y2GA 1KSFX 3U6EA 4FVMA 1IXRC 3THGA 4AZFA 5KPRA 2DWZB 3IG8A 4JI4M 2DXIA 3HGIA 7CATA 2ZANA 2J7NA 1Z5AA 5IWAM 4FCWA 4CGYB 2FFFB 3L29A 2KRKA 5A2QS 3U6MA 3UZUA 3GRVA 1YE9A 2UU9M 3DFZA 3FUUA 2QENA 2HKJA 4LRTA 3EIEA 1GL7A 4BBAA 3AKZA 3U60A 4GC5A 2LWXA 4BB9A 3GLFA 1G4AE 2BNKA 2BJVA 3ZC7B 3KOZE 4NYUA 1FNNA 5E26A 4DR6M 2R18A 3J27B 2L09A 3RGPA 1IBLM 3HSHA 4GMQA 1SXJA 2IOUA 3RGSA 1YU4A 4LGMA 3B9PA 5EXPA 4M9XA 3KS8A 2F5PA 5ITRA 2Z4RA 4LF8M 4OJPA 5FTNA 3A46A 4LZJA 2CFOA 2G8LA 4OJ6A 1XHBA 1TDHA 2JE5A 1IXZA 3GPUA 1R6BX 2E5LM 1N34M 4DUYM 3SARA 3JR4A 3KOYE 1XNRM 1DGHA 2CHVA 3U6CA 4RF1A 4LF6M 4LJAA 3W0LB 4LJ8A 1YU2A 2L7IA 3U5ZA 2XD5A 4FW9A 3H4MA 4IJEA 4M9ZA 4FWHA 3RE8A 4OX9M 3TQSA 3AV0A 3M0EA 2C98A 1PM5A 4CISA 5EQTA 2XSZA 3E9SA 2D7EA 3BOSA 2XZFA 4GKJM 4JXJA 1QANA 2DZNB 2AHMA 2D7GA 2X4AA 4DR3M 2K47A 2W82A 3GRYA 4NOOB 2ZM6M 1IQPA 1IN7A 2JA2A 4DV0M 3C58A 3U5ZB 1IBKM 4IBCA 3DA1A 4ITQA 2F5NA 3A45A 1N32M 1T3TA 1HQCA 4NZ4A 4JI5M 4NY2A 4IBKA 2R62A 3R8FA 1NNJA 4DV1M 4LFCM 1DGHB 2BG1A 4RNAA 3VKHA 3UMMA 4LJ4A 3I51A 3GP1A 4JI1M 3GQ4A 1G8PA 5EP1A 1GL6A 2Y0QA 2KA6B 3U61A 4AKIA 1JQJC 1C1KA 4DR7M 3GLIA 2O5RA 1YU0A 3J7BA 1HT1E 3SC3A 2FNAA 4LGYA 5EP4A 3SYKA 2LNHC 4LRSA 3NWLA 3PNVA 5F3WA 2XLJA 2LH0A 4B3MM 4RF0A 3CTWB 1SXJB 3A98B 4X66M 3SAUA 4JI7M 5ITQA 2D7HA 2XFTA 4HL4A 1X37A 1NJGA 3TPZA 5C18A 2UXDM 1Z6TA 4MM3B 3U60B 3KOWE 3U6SA 1NY5A 5DNYA 2HL7A 4I81A 5EXTA 1SXJC 1DGGA 1GLNA 4IBFA 3KXEC 5KPZA 4JI6M 2Y21A 2KW0A 4D81A 2Y2NA 4AKGA 4AG5A 5EXXA 4NZ3A 1OJLA 4LJ5A 1G41A 1QAQA 1I94M 2Z3XA 1Q3BA 3PFIA 2KEBA 4MGZE 2UUBM 2ZAOA 3L27A 4PD2A 2YQZA 4OW0A 4I4LA 3HU2A 3AL0C 4L16A 1QAMA 3FUXA 2R65A 4ZPXA 3TWKA 3ZH9B 1QYRA 4OVZA 4JV5M 4IIWA 3GLGA 3M7GA 4QNMA 1MU5A 4G4OA 4LJ9A 4B3RM 2Y2PA 1HT2E 3SHGB 3GO8A 3L25A 3HWSA 1YUBA 4NZ1A 3HONA 2JCHA 3GPYA 4GIPA 3T15A 2XH9A 5ITXE 2C9CA 4LFAM 4CHTB 2M60A 5LMUM 3LQQA 3PXGA 1HQYE 2X8AA 3E4RA 4R3DA 3FTCA 3OTOM 4GHAA 1I4WA 4L78A 5EP2A 4FD2A 1H6UA 4PDIA 3HHWA 3FUWA 4LF4M 2Y20A 4IBDA 1IM2A 2Z4SA 4KO8A 4MB7A 1N36M 4LCBA 1R2ZA 2YR0A 5EXSA 4G6ZA 4DR2M 2KRUA 2R4JA 4GC9A 2EA0A 1XC8A 2BJWA 3LMMA 4QNRA 2LXEA 5E6JA 4FCTA 3KP1E 3SMPA 4AQYM 2DHRA 5JI3E 3U6PA 4G4NA 1TDZA 2VIIA 2DVWB 2HCBA 1XXHA 4LJ6A 2QCUA 3VDUA 5FLXS 1Q3CA 2F4VM 3GLGB 3HU1A 3K1JA 4OVZB 4AI6A 1GKIA 5LMNM 4NL4H 4Z8XA 4L8RC 1HNWM 3EIHA 1N77A 3KSJA 2Y2LA 4GRIA 5GKNA 2A5YB 4G4RA 2I7PA 1Z5CA 4FWDA 1S3SA 4FWGA 2XF3A 1LV7A 2CE7A 4LFBM 3I4YA 5FTKA 1YU3A 2KZUA 4OJOA 3K92A 2EO2A 1XWIA 1J09A 1Q39A 4KLNA 5KQ8A 1SXJE 4MH0E 1NHWC 5BPVA 5IREB 1QZMA 4X64M 2Y2MA 1VDDA 3SATA 4IBEA 2XZUA 4DR5M 4B3TM 2YNMD 2Y2JA 2DWNA 5KO3A 3L2AA 1OFIA 2C96A 2QP9X 1OFHA 3GLHB 4EIWA 3VK8A 3KS4A 4WW0A 3VK7A 4LF5M 4IBBA 3PNYA 3FYCA 4AW4A 3T1YM 4MGIE 4PCZA 3JAMS 4GHLA 3HHXA 4YHHM 4KHPM 3GRUA 1G59A 1HNZM 3HJQA 1SXJD 2QPAA 3AOEC 2DWMA 4K0KM 5DYIA 1IN4A 1QAOA 2OPFA 2V1CA 3SFZA 1R2YA 3ILKA 4GITA 4OJ5A 1TH3A 2XFSA 2DWLA 4JI8M 3GLIB 4WURA 4XBOA 3VFDA 4B7HA 3KFUG 3U61B 1N75A 2CV2A 2UWXA 3QAUA 2UUAM 4OJLA 4QHTA 2L7HA 2I7NA 4GKKM 2ERCA 4G4QA 5EP3A 4DV2M 2YFQA 3SASA 4I8OA 1Z59A 3AJIB 1HNXM 3K8ZA 4JYAM 3U6DA 8CATA 4QOZC 3FTFA 4B7GA 5ITUA 4B7FA 1L2CA 1DGFA 1D2NA 2XSZD 3WHKA 2FOIC 2CEAA 1Z5BA 3HHZA 1IBMM 3GRRA 1L1ZA 5KPTA 1WXQA 2F5SA 2QBYA 3QWLA 3HJSA 4FCVA 5ITYA 4NSRA 4AG6A 5H37D 1TH2A 4QOSA 3KW6A 3NBIA 2KXEA 3AOGA 2H1RA 5IZ7D 3T1HM 5BR8M 2XGNA 5KQDA 2ZAMA 4IJFA 1YUEA 3HJ8A 1NJFA 3GPXA 3A42A 1FJGM 3VDPA 2CV0A 2UXCM 3HKPA 4KODA 3IG5A 1IXSB 4B08A 4QNLA 1J5EM 1ZAEA 4IBGA 1NSFA 2QBYB 4JI3M 1QQWA 1UM8A 1XNQM 3GPPA 3U6OA 3KP0E 4REZA 3FYDA 1PJJA 2XD1A 2Y2HA 1IN8A 3VLFB 4Z6YA 3LQRA 4LY6A 1K3WA 2XEPA 3UJNA 4DV6M 2Z7JA 4X62M 1KFVA 3GLFB 3JR5A 4NRWA 3T38A 3TE6A 1XMOM 1L1TA 3GQ3A 4DR1M 2P5TA 2Y2OA 4OU7A 2C9OA 5ITTA 1W5SA 2X49A 3KOXE 1DO0A 4LF7M 1TGUA 3MHVC 3U6QA 1E9RA 3CF2A 3R9XB 2RKOA 1ZQ9A 2G5GX 3D8BA 1E94E 4X65M 1J7KA 2FE8A 2CUZA 1YU1A 3PVSA 4W5WA 1E9SA 3SAVA 5FTLA 3HHYA 3GQ5A 3SHFA 2R45A 5JI2E 2V6ZM 4MGHA 4L15A 3UK6A 4MGKE 4JI0M 1L2DA 1GVNA 1N33M 3N3FA 4B3SM 3AOEA 2Q2EB 3I4VA 4DUZM 3FTEA 3CF0A 3SYLA 4JI2M 4TUWA 3KSXA 3GLHA 1YSYA 3K2LA 2M5ZA 2Y2QA 3FUTA 5FSWA 4OUIA 2NQ8C 3FKEA 1JR3D 5IT9S 4II7A 3SBJA 3U6LA 4NRVA 2R4EA 4PT5A 4NXMM 4D82A 2R46A 3ZCBB 1NVMA 1R7RA 3FTDA 1W5TA 3FD9A 3KVWA 1L8QA 2L6OA 2C99A 2RGHA 4LZZA 3HU3A 4YY3M 4LJ7A 2F5OA 3J7AS 4DV4M 4NXNM 2QZ4A 4QHSA 2HHHM 4JN6A 2VQFM 3TWMA 4I5SA 3KDSE 1IY2A 3CF6E 4MGYE 3TWLA 1K3XA 1EE8A 4R7GA 1XXHB 2VQEM 1K82A 3DOAA 2CV1A 1G3IA 2EUCA 3UGJA 2Y2KA 1MX0A 3MJ5A 5DYGA 2UUCM 2Y0TA 4GH9A 4M9SA 2F5QA 1ORYB 4P16A 4DV3M 1HR0M 3FUVA 3VKGA 3D8LA 4BLCA 4HLQA 3W0FA 2Y2IA 3SMSA 1KYIA 2ZBKB 4NZ5A 4NSOB 2DZOB 1NHGC 2V1UA 5FTMA 5FTJA 3RFWA 2C5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IBK A;  3L2A A;  4IBI A;  3KS4 A;  4IBB A;  4IBD A;  3FKE A;  4IJE A;  3L28 A;  4GHL A;  3KS8 A;  4LG2 A;  4IBF A;  4GH9 A;  4IBJ A;  4GHA A;  3L25 A;  3L29 A;  4IJF A;  5BPV A;  3L26 A;  4IBC A;  3L27 A;  4IBE A;  4IBG A; 
#chains in the Genus database with same CATH topology
 3SAW A;  1TR8 A;  4NC6 A;  5C1B A;  2UXB M;  5EJC A;  2OO9 A;  3WX7 A;  2L4F A;  1NNU C;  1QZE A;  4M0D A;  1DGB A;  4L4U A;  1WR1 B;  4PDG A;  5ITX A;  1N78 A;  2JWS A;  4XGI A;  1LTM A;  2RGO A;  3LCU A;  4D80 A;  1L6J A;  3L28 A;  1PJI A;  3Q8X A;  4A3V B;  2OQ4 A;  4LG2 A;  1IN6 A;  1P3Q Q;  1IY1 A;  4LF9 M;  4IBJ A;  1V33 A;  2DAG A;  2LVA A;  4DV5 M;  3M6A A;  3J80 S;  1T43 A;  1E32 A;  1IFY A;  2LVP C;  3LVV A;  4DR4 M;  1IY0 A;  3DZD A;  4NYY A;  3TL4 X;  3L26 A;  2FFJ A;  2KZS A;  1JR3 A;  3J2P B;  1XMQ M;  4S12 A;  1O6I A;  3LVW A;  4AKH A;  2CHQ A;  2DNA A;  2K0B X;  3AFH A;  2RRU A;  3WHL A;  1DO2 A;  2D49 A;  4DV7 M;  4Z2I A;  1QVR A;  4IBI A;  1IN5 A;  1L2B A;  1TH4 A;  3J81 S;  1NY6 A;  4M0W A;  2CHG A;  2J7O A;  3MK6 A;  2Y2G A;  1KSF X;  3U6E A;  2JUJ A;  1IXR C;  4FVM A;  3THG A;  4AZF A;  3FE3 A;  5KPR A;  2WSE F;  1F4I A;  2DWZ B;  3IG8 A;  4JI4 M;  1E6Z A;  2DXI A;  4MB5 A;  3HGI A;  7CAT A;  2ZAN A;  2J7N A;  1Z5A A;  2ZTD A;  2LTU A;  5IWA M;  4FCW A;  4CGY B;  2FFF B;  1R5L A;  1NV8 A;  2KRK A;  3L29 A;  4XK8 F;  3UZU A;  3GRV A;  5A2Q S;  3U6M A;  1E8B A;  1YE9 A;  2UU9 M;  3DFZ A;  3FUU A;  2QEN A;  2HKJ A;  3NBX X;  4LRT A;  3EIE A;  1GL7 A;  4BBA A;  3AKZ A;  3U60 A;  4GC5 A;  3B7N A;  2LWX A;  2DI0 A;  2DEN A;  4BB9 A;  3GLF A;  1G4A E;  2BNK A;  2HAK A;  2BJV A;  3WD3 A;  1AIW A;  1VG5 A;  4RKU F;  3KOZ E;  3ZC7 B;  1FNN A;  5E26 A;  4DR6 M;  4NYU A;  2R18 A;  3J27 B;  2L09 A;  3RGP A;  3WD4 A;  1IBL M;  1JB0 F;  3HSH A;  4GMQ A;  1SXJ A;  2IOU A;  3WD0 A;  2Z8Y M;  3RGS A;  4HEO A;  1YU4 A;  4LGM A;  3B9P A;  5EXP A;  3W68 A;  2R0I A;  4M9X A;  3KS8 A;  2F5P A;  5ITR A;  2Z4R A;  4LF8 M;  4OJP A;  5FTN A;  3A46 A;  2DZL A;  2KNA A;  1GO5 A;  4LZJ A;  2CFO A;  2G8L A;  3FRI A;  1ZMU A;  1XHB A;  2ZTC A;  3V76 A;  4OJ6 A;  1TDH A;  2JE5 A;  2H5X A;  1IXZ A;  2CRU A;  1R6B X;  3GPU A;  2E5L M;  1CXW A;  1N34 M;  3LW5 F;  4DUY M;  3SAR A;  3JR4 A;  2R44 A;  3KOY E;  1XNR M;  1DGH A;  2CHV A;  2JNH A;  3U6C A;  2V5O A;  4RF1 A;  4LF6 M;  4LJA A;  3W0L B;  4LJ8 A;  1YU2 A;  2L7I A;  3U5Z A;  1W1Y A;  4FW9 A;  2XD5 A;  3H4M A;  4IJE A;  4M9Z A;  4FWH A;  1W1V A;  3M7P A;  3RE8 A;  4OX9 M;  3TQS A;  3AV0 A;  3M0E A;  2C98 A;  1PM5 A;  4CIS A;  5EQT A;  2XSZ A;  1OAO C;  3E9S A;  2D7E A;  1ZMV A;  3BOS A;  2XZF A;  2OOA A;  4GKJ M;  2VDB B;  4JXJ A;  1QAN A;  2DZN B;  2AHM A;  2D7G A;  3BBZ A;  3E21 A;  2N35 A;  2X4A A;  2WSC F;  4DR3 M;  2K47 A;  2BWB A;  2W82 A;  3GRY A;  4NOO B;  2ZM6 M;  1IQP A;  1IN7 A;  2JA2 A;  4DV0 M;  3C58 A;  3U5Z B;  1QUT A;  1OIZ A;  1IBK M;  1E6R A;  4IBC A;  2LVN C;  3DA1 A;  2F5N A;  3A45 A;  4ITQ A;  1T3T A;  1HQC A;  1N32 M;  4NZ4 A;  4JI5 M;  4NY2 A;  4IBK A;  4Z2J A;  2R62 A;  3R8F A;  1NNJ A;  4DV1 M;  4LFC M;  1OGG A;  1DGH B;  2BG1 A;  4RNA A;  3VKH A;  3UMM A;  4LJ4 A;  2FH0 A;  3I51 A;  3U6P A;  3GP1 A;  4JI1 M;  2EKF A;  2O01 F;  3GQ4 A;  1G8P A;  5EP1 A;  1GL6 A;  2WZJ A;  1RU3 A;  2KA6 B;  2Y0Q A;  1JQJ C;  3HY5 A;  2B3T A;  3U61 A;  4AKI A;  1C1K A;  4DR7 M;  3GLI A;  2O5R A;  1YU0 A;  2JXN A;  1WGN A;  3J7B A;  1HT1 E;  3SC3 A;  2FNA A;  1D0L A;  1NV9 A;  2DKL A;  3E46 A;  4LGY A;  5EP4 A;  3SYK A;  2LNH C;  4LRS A;  3NWL A;  3B7Z A;  1G71 A;  3PNV A;  5F3W A;  2XLJ A;  2LH0 A;  4B3M M;  3QYB A;  4RF0 A;  2LBC A;  3CTW B;  1BVS A;  1SXJ B;  3A98 B;  4X66 M;  3SAU A;  4G3O A;  4JI7 M;  1J7M A;  5ITQ A;  2D7H A;  2XFT A;  4HL4 A;  2OOB A;  1X37 A;  3GLF E;  1NJG A;  3TPZ A;  5C18 A;  2UXD M;  2VF8 A;  1Z6T A;  4MM3 B;  3U60 B;  3KOW E;  3U6S A;  1NY5 A;  5DNY A;  2HL7 A;  4I81 A;  5EXT A;  1SXJ C;  1DGG A;  1GLN A;  4IBF A;  3KXE C;  1VEJ A;  5KPZ A;  4JI6 M;  1Q02 A;  2Y21 A;  1MN3 A;  2KW0 A;  4D81 A;  2Y2N A;  2DHY A;  2QNJ A;  4AG5 A;  5EXX A;  4AKG A;  2J5Y A;  3MMP A;  3T6P A;  1OJL A;  1ZMW A;  1G41 A;  1QAQ A;  4LJ5 A;  1I94 M;  2Z3X A;  3C3E A;  3K9P A;  1EAK A;  1Q3B A;  1OTR A;  3I01 M;  3PFI A;  2JP7 A;  3W67 A;  2KEB A;  4MGZ E;  2UUB M;  2APL A;  2ZAO A;  3L27 A;  4PD2 A;  2YQZ A;  4OW0 A;  4I4L A;  3HU2 A;  3FRH A;  3AL0 C;  1GJS A;  4L16 A;  1QAM A;  3FUX A;  2VF7 A;  1OAI A;  3B89 A;  2R65 A;  4ZPX A;  3TWK A;  3ZH9 B;  5L8R F;  1QYR A;  4OVZ A;  4JV5 M;  4IIW A;  3GLG A;  3M7G A;  4QNM A;  1OGB A;  1MU5 A;  4G4O A;  1D0M A;  4LJ9 A;  4B3R M;  1W1P A;  3H4J A;  4DBG B;  1W1T A;  1E88 A;  2Y2P A;  1HT2 E;  3SHG B;  3GO8 A;  3L25 A;  3HWS A;  1YUB A;  1E6P A;  3HON A;  4NZ1 A;  2JCH A;  1OKS A;  1QDT A;  3GPY A;  3IEC A;  4GIP A;  2DAI A;  2XH9 A;  3T15 A;  1D0K A;  5ITX E;  2C9C A;  4LFA M;  2RTS A;  4CHT B;  2M60 A;  5LMU M;  3LQQ A;  1C7Y A;  3PXG A;  1HQY E;  2X8A A;  3E4R A;  4R3D A;  3FTC A;  3OTO M;  4GHA A;  1I4W A;  1H8P A;  3F92 A;  4L78 A;  5EP2 A;  4FD2 A;  1H6U A;  4PDI A;  3HHW A;  3FUW A;  4LF4 M;  2Y20 A;  4IBD A;  3MQL A;  1IM2 A;  3CGW A;  2Z4S A;  1Y8G A;  4KO8 A;  4MB7 A;  1N36 M;  4LCB A;  1R2Z A;  2YR0 A;  5EXS A;  4G6Z A;  2CWB A;  5DFL A;  4DR2 M;  2KRU A;  2LHG A;  2R4J A;  4GC9 A;  2EA0 A;  1XC8 A;  4TX8 A;  2BJW A;  1VDL A;  3LMM A;  2LXE A;  4QNR A;  4FCT A;  3KP1 E;  5E6J A;  3SMP A;  2DHR A;  5JI3 E;  4AQY M;  4G4N A;  1TDZ A;  2VII A;  2DVW B;  2HCB A;  1XXH A;  4LJ6 A;  2QCU A;  3VDU A;  5FLX S;  1MJG M;  1Q3C A;  1DV0 A;  3B74 A;  4Q7J A;  2F4V M;  3GLG B;  3HU1 A;  3K1J A;  4OVZ B;  4AI6 A;  2MH8 A;  2FS1 A;  1GKI A;  5LMN M;  4NL4 H;  4Z8X A;  4HME A;  4L8R C;  1HNW M;  3EIH A;  1N77 A;  3KSJ A;  2Y2L A;  1VEK A;  4GRI A;  2A5Y B;  5GKN A;  4G4R A;  2I7P A;  1Z5C A;  4FWG A;  1S3S A;  4FWD A;  2XF3 A;  1LV7 A;  2CE7 A;  4LFB M;  3I4Y A;  5FTK A;  3LCV B;  1YU3 A;  2KZU A;  4OJO A;  1PJT A;  3K92 A;  3GLH E;  4R71 A;  2EO2 A;  1XWI A;  1J09 A;  1XXH E;  4HMD A;  1Q39 A;  4KLN A;  5KQ8 A;  1SXJ E;  4MH0 E;  1NHW C;  5BPV A;  5IRE B;  4MB3 A;  1GOI A;  1QZM A;  4X64 M;  2Y2M A;  1VDD A;  3SAT A;  4IBE A;  2XZU A;  4KT0 F;  4DR5 M;  2YNM D;  4B3T M;  2DWN A;  2Y2J A;  5KO3 A;  1OFI A;  2C96 A;  2QP9 X;  3GLH B;  1OFH A;  3L2A A;  4EIW A;  3VK8 A;  2KHH A;  3KS4 A;  4WW0 A;  2GQF A;  4LF5 M;  4IBB A;  3PNY A;  3FYC A;  4AW4 A;  3T1Y M;  1E6N A;  4MGI E;  4PCZ A;  3JAM S;  1PJQ A;  4GHL A;  3HHX A;  4YHH M;  4KHP M;  3GRU A;  1PGY A;  1G59 A;  1HNZ M;  3HJQ A;  1SXJ D;  3GLG E;  2QPA A;  3I04 M;  3N3F A;  1UFZ A;  1ZV1 A;  3AOE C;  2DWM A;  4K0K M;  5DYI A;  1IN4 A;  1QAO A;  2OPF A;  2MGW A;  2V1C A;  3SFZ A;  3ILK A;  4GIT A;  1R2Y A;  4OJ5 A;  1TH3 A;  2XFS A;  2DWL A;  3C9P A;  4JI8 M;  3GLI B;  4WUR A;  4XBO A;  1PRB A;  3VFD A;  4B7H A;  3KFU G;  3U61 B;  1N75 A;  2CV2 A;  2MR9 A;  1PJS A;  2UWX A;  1TTE A;  3QAU A;  2UUA M;  4GEW A;  4OJL A;  4QHT A;  4CJ6 A;  2L7H A;  2I7N A;  3HZJ A;  3C3D A;  1OIP A;  4GKK M;  2ERC A;  4G4Q A;  5EP3 A;  4DV2 M;  2YFQ A;  3SAS A;  4I8O A;  1Z59 A;  3AJI B;  1HNX M;  3K8Z A;  4JYA M;  3U6D A;  8CAT A;  4QOZ C;  3VK7 A;  3FTF A;  4B7G A;  5ITU A;  4B7F A;  1L2C A;  1DGF A;  1D2N A;  2XSZ D;  3WHK A;  2LVO C;  2FOI C;  2CEA A;  1Z5B A;  3HHZ A;  1IBM M;  3GRR A;  1L1Z A;  5KPT A;  1WXQ A;  2F5S A;  1QDR A;  2QBY A;  3QWL A;  3HJS A;  1TF0 B;  2BWE A;  2G3Q A;  4FCV A;  5ITY A;  4NSR A;  1IXS A;  4UN2 B;  4AG6 A;  1GAB A;  5H37 D;  1TH2 A;  4QOS A;  3KW6 A;  3NBI A;  2KXE A;  3AOG A;  2H1R A;  5IZ7 D;  1E15 A;  3T1H M;  5BR8 M;  2XGN A;  2LHC A;  4WP2 A;  2ZAM A;  2EKK A;  5KQD A;  1WGL A;  1QUS A;  4IJF A;  1YUE A;  3HJ8 A;  1NJF A;  3GPX A;  3A42 A;  1FJG M;  3VDP A;  4CIZ A;  2CV0 A;  2UXC M;  3HKP A;  4KOD A;  2QSF X;  3IG5 A;  3K9O A;  1IXS B;  3HX3 A;  4B08 A;  4QNL A;  1J5E M;  4Z2H A;  1ZAE A;  4IBG A;  1NSF A;  2QBY B;  2EJS A;  2KNV A;  4JI3 M;  4MB4 A;  1QQW A;  1UM8 A;  2JY8 A;  1OQY A;  3Q8G A;  1XNQ M;  3GPP A;  3U6O A;  1UR9 A;  3KP0 E;  4Z2K A;  1AUA A;  4REZ A;  1WIV A;  2CP8 A;  3FYD A;  1PJJ A;  2XD1 A;  2Y2H A;  1IN8 A;  3WD1 A;  3VLF B;  4Z2L A;  4Z6Y A;  3LQR A;  4LY6 A;  1K3W A;  4NZ3 A;  2XEP A;  3UJN A;  4DV6 M;  2Z7J A;  1EFU B;  4X62 M;  1KFV A;  3GLF B;  3JR5 A;  4NRW A;  3T38 A;  2QQ8 A;  3TE6 A;  1XMO M;  1L1T A;  3GQ3 A;  1VEG A;  1WJ7 A;  4DR1 M;  2P5T A;  1H0I A;  2Y2O A;  4OU7 A;  2C9O A;  3B7Q A;  5ITT A;  1W5S A;  1WHC A;  2X49 A;  2L2D A;  1HJP A;  3KOX E;  1DO0 A;  1EIJ A;  4LF7 M;  1TGU A;  3MHV C;  4ANR A;  3U6Q A;  1E9R A;  3CF2 A;  3R9X B;  2RKO A;  1AIP C;  1ZQ9 A;  2G5G X;  2KDL A;  1H0G A;  3D8B A;  1SG9 A;  1E94 E;  2KNZ A;  4X65 M;  1KS0 A;  1J7K A;  2FE8 A;  2CUZ A;  2DAE A;  1YU1 A;  3PVS A;  4W5W A;  4HMC A;  1E9S A;  3SAV A;  3WD2 A;  5FTL A;  2JZ1 A;  1ED7 A;  1CK7 A;  1JR3 E;  2GNO A;  1NO1 A;  3HHY A;  4F1I A;  3GQ5 A;  3SHF A;  2R45 A;  5JI2 E;  2V6Z M;  4MGH A;  4L15 A;  1GPF A;  3UK6 A;  1T6O A;  4MGK E;  4JI0 M;  1L2D A;  1V34 A;  1GVN A;  2JY6 B;  2K6B A;  4B3S M;  1N33 M;  3AOE A;  2Q2E B;  3I4V A;  4DUZ M;  3FTE A;  2R6F A;  3CF0 A;  3SYL A;  2MRO B;  3GLI E;  2JY5 A;  4JI2 M;  4TUW A;  3KSX A;  1V92 A;  1YSY A;  3GLH A;  3K2L A;  2M5Z A;  2O25 A;  2Y2Q A;  2WSF F;  3FUT A;  5FSW A;  4OUI A;  2NQ8 C;  3FKE A;  1JR3 D;  5IT9 S;  4II7 A;  3SBJ A;  3U6L A;  4NRV A;  2R4E A;  4PT5 A;  4NXM M;  4D82 A;  1QO6 A;  2R46 A;  2HWJ A;  3ZCB B;  1NVM A;  1R7R A;  3FTD A;  1W5T A;  3FD9 A;  3KVW A;  1L8Q A;  2L6O A;  2LVQ D;  2C99 A;  2DAK A;  2RGH A;  2JY7 A;  4LZZ A;  3QYE A;  2JZ0 A;  3HU3 A;  4F2L A;  4YY3 M;  4LJ7 A;  2F5O A;  2DAM A;  3J7A S;  4DV4 M;  4NXN M;  2K9D A;  2QZ4 A;  1R4G A;  4QHS A;  2HHH M;  2MJ5 B;  4JN6 A;  2VQF M;  3TWM A;  4I5S A;  1VQ1 A;  3IHP A;  3KDS E;  1IY2 A;  3CF6 E;  4MGY E;  3TWL A;  1K3X A;  1UR8 A;  1EE8 A;  4R7G A;  1XXH B;  2VQE M;  1K82 A;  3DOA A;  2CV1 A;  1G3I A;  2EUC A;  1CUK A;  4Y28 F;  3UGJ A;  2Y2K A;  1MX0 A;  1A5T A;  3MJ5 A;  2L4E A;  5DYG A;  4P17 A;  3ZQJ A;  2Y0T A;  1XB2 B;  2UUC M;  4GH9 A;  1GXD A;  4M9S A;  2F5Q A;  4Z2G A;  1ORY B;  4P16 A;  1YLA A;  4DV3 M;  1HR0 M;  1GJT A;  3FUV A;  3VKG A;  3D8L A;  4BLC A;  4HLQ A;  3W0F A;  2Y2I A;  3BXW A;  2FN2 A;  1PDC A;  3SMS A;  1KYI A;  2ZBK B;  4L6V 6;  4NZ5 A;  4NSO B;  2DZO B;  1NHG C;  2V1U A;  5FTM A;  5FTJ A;  3RFW A;  2QHO B;  2C5R A; 
#chains in the Genus database with same CATH homology
 3SAW A;  5C1B A;  2UXB M;  5EJC A;  3WX7 A;  4M0D A;  1NNU C;  1DGB A;  4L4U A;  4PDG A;  5ITX A;  1N78 A;  4XGI A;  2RGO A;  4D80 A;  3L28 A;  1PJI A;  3Q8X A;  4A3V B;  2OQ4 A;  4LG2 A;  1IN6 A;  4LF9 M;  1IY1 A;  4IBJ A;  4DV5 M;  3M6A A;  3J80 S;  1E32 A;  3LVV A;  4DR4 M;  1IY0 A;  3DZD A;  4NYY A;  3TL4 X;  3L26 A;  2FFJ A;  2KZS A;  1JR3 A;  3J2P B;  1XMQ M;  4S12 A;  3LVW A;  4AKH A;  2CHQ A;  3AFH A;  3WHL A;  1DO2 A;  4DV7 M;  1QVR A;  4IBI A;  1IN5 A;  1L2B A;  1TH4 A;  3J81 S;  1NY6 A;  4M0W A;  2CHG A;  2J7O A;  3MK6 A;  2Y2G A;  1KSF X;  3U6E A;  4FVM A;  1IXR C;  3THG A;  4AZF A;  5KPR A;  2DWZ B;  3IG8 A;  4JI4 M;  2DXI A;  3HGI A;  7CAT A;  2ZAN A;  2J7N A;  1Z5A A;  5IWA M;  4FCW A;  4CGY B;  2FFF B;  3L29 A;  2KRK A;  5A2Q S;  3U6M A;  3UZU A;  3GRV A;  1YE9 A;  2UU9 M;  3DFZ A;  3FUU A;  2QEN A;  2HKJ A;  4LRT A;  3EIE A;  1GL7 A;  4BBA A;  3AKZ A;  3U60 A;  4GC5 A;  2LWX A;  4BB9 A;  3GLF A;  1G4A E;  2BNK A;  2BJV A;  3ZC7 B;  3KOZ E;  4NYU A;  1FNN A;  5E26 A;  4DR6 M;  2R18 A;  3J27 B;  2L09 A;  3RGP A;  1IBL M;  3HSH A;  4GMQ A;  1SXJ A;  2IOU A;  3RGS A;  1YU4 A;  4LGM A;  3B9P A;  5EXP A;  4M9X A;  3KS8 A;  2F5P A;  5ITR A;  2Z4R A;  4LF8 M;  4OJP A;  5FTN A;  3A46 A;  4LZJ A;  2CFO A;  2G8L A;  4OJ6 A;  1XHB A;  1TDH A;  2JE5 A;  1IXZ A;  3GPU A;  1R6B X;  2E5L M;  1N34 M;  4DUY M;  3SAR A;  3JR4 A;  3KOY E;  1XNR M;  1DGH A;  2CHV A;  3U6C A;  4RF1 A;  4LF6 M;  4LJA A;  3W0L B;  4LJ8 A;  1YU2 A;  2L7I A;  3U5Z A;  2XD5 A;  4FW9 A;  3H4M A;  4IJE A;  4M9Z A;  4FWH A;  3RE8 A;  4OX9 M;  3TQS A;  3AV0 A;  3M0E A;  2C98 A;  1PM5 A;  4CIS A;  5EQT A;  2XSZ A;  3E9S A;  2D7E A;  3BOS A;  2XZF A;  4GKJ M;  4JXJ A;  1QAN A;  2DZN B;  2AHM A;  2D7G A;  2X4A A;  4DR3 M;  2K47 A;  2W82 A;  3GRY A;  4NOO B;  2ZM6 M;  1IQP A;  1IN7 A;  2JA2 A;  4DV0 M;  3C58 A;  3U5Z B;  1IBK M;  4IBC A;  3DA1 A;  4ITQ A;  2F5N A;  3A45 A;  1N32 M;  1T3T A;  1HQC A;  4NZ4 A;  4JI5 M;  4NY2 A;  4IBK A;  2R62 A;  3R8F A;  1NNJ A;  4DV1 M;  4LFC M;  1DGH B;  2BG1 A;  4RNA A;  3VKH A;  3UMM A;  4LJ4 A;  3I51 A;  3GP1 A;  4JI1 M;  3GQ4 A;  1G8P A;  5EP1 A;  1GL6 A;  2Y0Q A;  2KA6 B;  3U61 A;  4AKI A;  1JQJ C;  1C1K A;  4DR7 M;  3GLI A;  2O5R A;  1YU0 A;  3J7B A;  1HT1 E;  3SC3 A;  2FNA A;  4LGY A;  5EP4 A;  3SYK A;  2LNH C;  4LRS A;  3NWL A;  3PNV A;  5F3W A;  2XLJ A;  2LH0 A;  4B3M M;  4RF0 A;  3CTW B;  1SXJ B;  3A98 B;  4X66 M;  3SAU A;  4JI7 M;  5ITQ A;  2D7H A;  2XFT A;  4HL4 A;  1X37 A;  1NJG A;  3TPZ A;  5C18 A;  2UXD M;  1Z6T A;  4MM3 B;  3U60 B;  3KOW E;  3U6S A;  1NY5 A;  5DNY A;  2HL7 A;  4I81 A;  5EXT A;  1SXJ C;  1DGG A;  1GLN A;  4IBF A;  3KXE C;  5KPZ A;  4JI6 M;  2Y21 A;  2KW0 A;  4D81 A;  2Y2N A;  4AKG A;  4AG5 A;  5EXX A;  4NZ3 A;  1OJL A;  4LJ5 A;  1G41 A;  1QAQ A;  1I94 M;  2Z3X A;  1Q3B A;  3PFI A;  2KEB A;  4MGZ E;  2UUB M;  2ZAO A;  3L27 A;  4PD2 A;  2YQZ A;  4OW0 A;  4I4L A;  3HU2 A;  3AL0 C;  4L16 A;  1QAM A;  3FUX A;  2R65 A;  4ZPX A;  3TWK A;  3ZH9 B;  1QYR A;  4OVZ A;  4JV5 M;  4IIW A;  3GLG A;  3M7G A;  4QNM A;  1MU5 A;  4G4O A;  4LJ9 A;  4B3R M;  2Y2P A;  1HT2 E;  3SHG B;  3GO8 A;  3L25 A;  3HWS A;  1YUB A;  4NZ1 A;  3HON A;  2JCH A;  3GPY A;  4GIP A;  3T15 A;  2XH9 A;  5ITX E;  2C9C A;  4LFA M;  4CHT B;  2M60 A;  5LMU M;  3LQQ A;  3PXG A;  1HQY E;  2X8A A;  3E4R A;  4R3D A;  3FTC A;  3OTO M;  4GHA A;  1I4W A;  4L78 A;  5EP2 A;  4FD2 A;  1H6U A;  4PDI A;  3HHW A;  3FUW A;  4LF4 M;  2Y20 A;  4IBD A;  1IM2 A;  2Z4S A;  4KO8 A;  4MB7 A;  1N36 M;  4LCB A;  1R2Z A;  2YR0 A;  5EXS A;  4G6Z A;  4DR2 M;  2KRU A;  2R4J A;  4GC9 A;  2EA0 A;  1XC8 A;  2BJW A;  3LMM A;  4QNR A;  2LXE A;  5E6J A;  4FCT A;  3KP1 E;  3SMP A;  4AQY M;  2DHR A;  5JI3 E;  3U6P A;  4G4N A;  1TDZ A;  2VII A;  2DVW B;  2HCB A;  1XXH A;  4LJ6 A;  2QCU A;  3VDU A;  5FLX S;  1Q3C A;  2F4V M;  3GLG B;  3HU1 A;  3K1J A;  4OVZ B;  4AI6 A;  1GKI A;  5LMN M;  4NL4 H;  4Z8X A;  4L8R C;  1HNW M;  3EIH A;  1N77 A;  3KSJ A;  2Y2L A;  4GRI A;  5GKN A;  2A5Y B;  4G4R A;  2I7P A;  1Z5C A;  4FWD A;  1S3S A;  4FWG A;  2XF3 A;  1LV7 A;  2CE7 A;  4LFB M;  3I4Y A;  5FTK A;  1YU3 A;  2KZU A;  4OJO A;  3K92 A;  2EO2 A;  1XWI A;  1J09 A;  1Q39 A;  4KLN A;  5KQ8 A;  1SXJ E;  4MH0 E;  1NHW C;  5BPV A;  5IRE B;  1QZM A;  4X64 M;  2Y2M A;  1VDD A;  3SAT A;  4IBE A;  2XZU A;  4DR5 M;  4B3T M;  2YNM D;  2Y2J A;  2DWN A;  5KO3 A;  3L2A A;  1OFI A;  2C96 A;  2QP9 X;  1OFH A;  3GLH B;  4EIW A;  3VK8 A;  3KS4 A;  4WW0 A;  3VK7 A;  4LF5 M;  4IBB A;  3PNY A;  3FYC A;  4AW4 A;  3T1Y M;  4MGI E;  4PCZ A;  3JAM S;  4GHL A;  3HHX A;  4YHH M;  4KHP M;  3GRU A;  1G59 A;  1HNZ M;  3HJQ A;  1SXJ D;  2QPA A;  3AOE C;  2DWM A;  4K0K M;  5DYI A;  1IN4 A;  1QAO A;  2OPF A;  2V1C A;  3SFZ A;  1R2Y A;  3ILK A;  4GIT A;  4OJ5 A;  1TH3 A;  2XFS A;  2DWL A;  4JI8 M;  3GLI B;  4WUR A;  4XBO A;  3VFD A;  4B7H A;  3KFU G;  3U61 B;  1N75 A;  2CV2 A;  2UWX A;  3QAU A;  2UUA M;  4OJL A;  4QHT A;  2L7H A;  2I7N A;  4GKK M;  2ERC A;  4G4Q A;  5EP3 A;  4DV2 M;  2YFQ A;  3SAS A;  4I8O A;  1Z59 A;  3AJI B;  1HNX M;  3K8Z A;  4JYA M;  3U6D A;  8CAT A;  4QOZ C;  3FTF A;  4B7G A;  5ITU A;  4B7F A;  1L2C A;  1DGF A;  1D2N A;  2XSZ D;  3WHK A;  2FOI C;  2CEA A;  1Z5B A;  3HHZ A;  1IBM M;  3GRR A;  1L1Z A;  5KPT A;  1WXQ A;  2F5S A;  2QBY A;  3QWL A;  3HJS A;  4FCV A;  5ITY A;  4NSR A;  4AG6 A;  5H37 D;  1TH2 A;  4QOS A;  3KW6 A;  3NBI A;  2KXE A;  3AOG A;  2H1R A;  5IZ7 D;  3T1H M;  5BR8 M;  2XGN A;  5KQD A;  2ZAM A;  4IJF A;  1YUE A;  3HJ8 A;  1NJF A;  3GPX A;  3A42 A;  1FJG M;  3VDP A;  2CV0 A;  2UXC M;  3HKP A;  4KOD A;  3IG5 A;  1IXS B;  4B08 A;  4QNL A;  1J5E M;  1ZAE A;  4IBG A;  1NSF A;  2QBY B;  4JI3 M;  1QQW A;  1UM8 A;  1XNQ M;  3GPP A;  3U6O A;  3KP0 E;  4REZ A;  3FYD A;  1PJJ A;  2XD1 A;  2Y2H A;  1IN8 A;  3VLF B;  4Z6Y A;  3LQR A;  4LY6 A;  1K3W A;  2XEP A;  3UJN A;  4DV6 M;  2Z7J A;  4X62 M;  1KFV A;  3GLF B;  3JR5 A;  4NRW A;  3T38 A;  3TE6 A;  1XMO M;  1L1T A;  3GQ3 A;  4DR1 M;  2P5T A;  2Y2O A;  4OU7 A;  2C9O A;  5ITT A;  1W5S A;  2X49 A;  3KOX E;  1DO0 A;  4LF7 M;  1TGU A;  3MHV C;  3U6Q A;  1E9R A;  3CF2 A;  3R9X B;  2RKO A;  1ZQ9 A;  2G5G X;  3D8B A;  1E94 E;  4X65 M;  1J7K A;  2FE8 A;  2CUZ A;  1YU1 A;  3PVS A;  4W5W A;  1E9S A;  3SAV A;  5FTL A;  3HHY A;  3GQ5 A;  3SHF A;  2R45 A;  5JI2 E;  2V6Z M;  4MGH A;  4L15 A;  3UK6 A;  4MGK E;  4JI0 M;  1L2D A;  1GVN A;  1N33 M;  3N3F A;  4B3S M;  3AOE A;  2Q2E B;  3I4V A;  4DUZ M;  3FTE A;  3CF0 A;  3SYL A;  4JI2 M;  4TUW A;  3KSX A;  3GLH A;  1YSY A;  3K2L A;  2M5Z A;  2Y2Q A;  3FUT A;  5FSW A;  4OUI A;  2NQ8 C;  3FKE A;  1JR3 D;  5IT9 S;  4II7 A;  3SBJ A;  3U6L A;  4NRV A;  2R4E A;  4PT5 A;  4NXM M;  4D82 A;  2R46 A;  3ZCB B;  1NVM A;  1R7R A;  3FTD A;  1W5T A;  3FD9 A;  3KVW A;  1L8Q A;  2L6O A;  2C99 A;  2RGH A;  4LZZ A;  3HU3 A;  4YY3 M;  4LJ7 A;  2F5O A;  3J7A S;  4DV4 M;  4NXN M;  2QZ4 A;  4QHS A;  2HHH M;  4JN6 A;  2VQF M;  3TWM A;  4I5S A;  3KDS E;  1IY2 A;  3CF6 E;  4MGY E;  3TWL A;  1K3X A;  1EE8 A;  4R7G A;  1XXH B;  2VQE M;  1K82 A;  3DOA A;  2CV1 A;  1G3I A;  2EUC A;  3UGJ A;  2Y2K A;  1MX0 A;  3MJ5 A;  5DYG A;  2UUC M;  2Y0T A;  4GH9 A;  4M9S A;  2F5Q A;  1ORY B;  4P16 A;  4DV3 M;  1HR0 M;  3FUV A;  3VKG A;  3D8L A;  4BLC A;  4HLQ A;  3W0F A;  2Y2I A;  3SMS A;  1KYI A;  2ZBK B;  4NZ5 A;  4NSO B;  2DZO B;  1NHG C;  2V1U A;  5FTM A;  5FTJ A;  3RFW A;  2C5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...