3FKEA

Structure of the ebola vp35 interferon inhibitory domain
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
123
structure length
123
Chain Sequence
b'DISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polymerase cofactor VP35
publication title Structure of the Ebola VP35 interferon inhibitory domain.
pubmed doi rcsb
source organism Zaire ebolavirus - mayinga (zaire, 1976)
molecule tags Rna binding protein
total genus 40
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3fkeA01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 3fkeA02
4IBEA 3L29A 4GH9A 4IBGA 4IJEA 3L25A 3L27A 5BPVA 4LG2A 4IBFA 3KS8A 4IBIA 3L26A 4GHLA 4IBDA 4GHAA 4IBCA 4IJFA 3L28A 3FKEA 3KS4A 4IBKA 4IBJA 3L2AA 4IBBA
chains in the Genus database with same CATH superfamily
3SAVA 3I4YA 1I94M 4L78A 2LVQD 1SXJC 1TDHA 2Z4RA 3LMMA 3I04M 1PM5A 1IBMM 1OJLA 1IXZA 1R4GA 1VEGA 3UMMA 2K6BA 1F4IA 1NJGA 4DV1M 1ZV1A 4GC5A 3T38A 1NNUC 4OJ5A 2DHRA 2ZTCA 1YUBA 3VDUA 1R6BX 2CRUA 2K9DA 5FLXS 3M7GA 3U5ZA 3L26A 3MJ5A 4L4UA 2IOUA 1ZAEA 2CFOA 4IBDA 3C58A 4Z6YA 1OKSA 4X62M 3QWLA 3VDPA 3U6SA 4QNRA 3VFDA 4R3DA 3B74A 2JY6B 2KEBA 3LVVA 3GLFE 4GC9A 3HX3A 2RKOA 1IN5A 1WGNA 1E15A 1BVSA 3AJIB 3GPUA 1YU1A 1HT2E 5IT9S 1W1YA 3FTCA 1I4WA 4AG6A 4CHTB 2EA0A 2VQEM 2Y2JA 4LJ8A 2J7OA 3E4RA 2V1UA 3K1JA 1R2YA 1L2BA 1GXDA 1MJGM 2QPAA 5JI3E 1YE9A 2YFQA 4G4RA 3TPZA 3KDSE 1UFZA 4KT0F 3CF6E 4DR1M 3CGWA 3AKZA 1IN8A 1ZMWA 4XGIA 1OTRA 5IZ7D 4Q7JA 3MMPA 3L28A 2CE7A 2AHMA 2XSZD 4YHHM 5FTJA 1D0KA 3TE6A 4DV6M 1E8BA 3U6MA 3K9PA 3VK8A 1E9RA 3UK6A 5EXTA 4LFBM 1TF0B 3CTWB 3J80S 2Y2MA 1HNWM 4I5SA 1L1TA 1OIPA 2V6ZM 1GABA 2JUJA 4IBGA 4LRSA 1NO1A 4AKGA 4OJOA 3K9OA 4LZZA 2Y21A 4GKKM 3GLIA 1EFUB 1VQ1A 1UR9A 2EKKA 4IIWA 3HU1A 4L15A 4MGHA 2R0IA 4WP2A 4X64M 1IFYA 2C96A 4WURA 4B7HA 2Y2IA 4Z2JA 3JR4A 4AI6A 4MB3A 3B7NA 3K8ZA 4NSRA 3GLIB 1IQPA 2DVWB 2FNAA 4QHTA 2QHOB 2CEAA 2KNVA 2C5RA 5E6JA 4MB4A 4F2LA 1VG5A 4G4OA 2L7HA 4OVZA 1L6JA 3PXGA 3W67A 2KW0A 2WZJA 3ZQJA 3U61B 2O25A 4LFCM 3U61A 1N34M 4AQYM 1O6IA 2XD5A 3WD1A 3B7ZA 4LF6M 2CP8A 3A42A 3MQLA 4XK8F 1HJPA 3GPYA 1J5EM 4OVZB 1K3XA 4KHPM 3HU3A 1KYIA 5BR8M 1IBKM 3ZC7B 1J7MA 2DAGA 3FRIA 1KSFX 1OFIA 2LHGA 2JWSA 3K92A 2UWXA 3FUVA 2WSCF 4NYUA 1Q3BA 3GLHA 4JYAM 3M7PA 1IXSB 2HWJA 1XNRM 2LHCA 4RNAA 1R2ZA 3NWLA 1N36M 3R9XB 1GLNA 1N33M 4LJ4A 2G8LA 2WSEF 4FCVA 3U6QA 2DXIA 2LXEA 4WW0A 1YU2A 1QDRA 3QYEA 1YU3A 2LH0A 3AFHA 4NZ1A 4DV7M 1GL6A 1E6NA 3GO8A 1G4AE 1QO6A 1CUKA 2O5RA 4PDIA 2LWXA 2C99A 5DYIA 3UGJA 3GRRA 2QZ4A 1TH2A 1OGBA 1RU3A 3GRUA 1IN4A 3U6LA 2GQFA 2VIIA 4Y28F 4F1IA 4MB5A 4LJ6A 1YSYA 1G59A 2XEPA 3GLFB 3GLIE 1GJTA 2D7EA 5EQTA 4LF8M 1NHWC 2QQ8A 2XD1A 3EIHA 1DO0A 3GQ3A 3HHZA 4NXMM 4NY2A 5KQ8A 4LJAA 4I81A 3U6PA 3CF0A 4REZA 2CHGA 4MGZE 3HWSA 1QUTA 4MH0E 2FE8A 2F5OA 1LTMA 1DGHA 2J7NA 3SAWA 2CV1A 4GEWA 3KS4A 3M6AA 3WD4A 2UXCM 3HJ8A 1R5LA 5DYGA 3HJQA 4JI4M 1YLAA 1VEJA 2QBYA 4L6V6 5KPTA 4IBEA 3THGA 1H6UA 2LVPC 3DZDA 3IHPA 3M0EA 5LMNM 1W1VA 2KZSA 3Q8GA 3PNYA 2R62A 5DFLA 2XZUA 1WR1B 3WHLA 1IY1A 2JZ1A 1QZMA 2UUAM 3PNVA 2QBYB 1V92A 3VLFB 1TH3A 1DGGA 3FYDA 1MX0A 4CIZA 3T15A 2ZTDA 3GLHE 2CHQA 4DR4M 3SARA 4DR6M 1OIZA 4KLNA 4M9XA 1D2NA 2HAKA 2RGOA 1N77A 3JR5A 3NBXX 3C3EA 5KPRA 4FW9A 3SATA 1E6ZA 4GKJM 3N3FA 2APLA 3LVWA 4G4NA 3J7AS 5EXXA 1QZEA 3KOWE 2C9OA 4DUZM 3FE3A 3U5ZB 1PJIA 1W5SA 3C9PA 3Q8XA 2KA6B 3GPXA 4DR5M 4Z8XA 3W68A 2DKLA 2UXDM 5EXPA 4NZ5A 4D80A 1QANA 2DI0A 3KOYE 2N35A 2CV0A 1EIJA 3IG8A 4GITA 4B3TM 4NL4H 2FS1A 2K47A 4JI5M 4JI6M 2JP7A 2O01F 3FUUA 4OW0A 3T6PA 3V76A 1S3SA 2D49A 1ZMUA 3RE8A 5F3WA 1SXJA 2Y20A 4NC6A 1GO5A 2X49A 4NZ4A 4JI2M 1QAMA 2Z8YM 4Z2KA 2WSFF 3IG5A 2L2DA 2JCHA 1W5TA 5EP2A 2L7IA 4BB9A 2Z3XA 3VKHA 4NRVA 1SXJB 1XNQM 1L8QA 2L09A 2MJ5B 3KVWA 1OAOC 2L4FA 2NQ8C 2P5TA 4ITQA 1R7RA 3HSHA 3B7QA 2Y2OA 4CGYB 1WIVA 4P16A 1D0LA 1IN7A 3WD0A 5ITXA 4BLCA 1Z5BA 3AOEC 3J27B 3H4MA 4MGIE 1E88A 4LJ7A 3ZCBB 4RF0A 1AIWA 1NHGC 2R6FA 3HU2A 1MU5A 1T6OA 1UR8A 1E94E 3SHGB 2R4JA 2ZM6M 3FUTA 2Z4SA 1OQYA 1VDLA 1YUEA 3GLGA 3RGPA 2Y0QA 4LFAM 4A3VB 2OPFA 1D0MA 1Y8GA 3VKGA 4Z2IA 4GIPA 3I4VA 3HY5A 4TX8A 1WHCA 1XHBA 2D7GA 2DHYA 3PVSA 1HNZM 1T43A 5L8RF 1GPFA 3A98B 3DOAA 1IY0A 4GHLA 4G4QA 3GPPA 2Y2NA 4AZFA 4NZ3A 2XFTA 1QAQA 5ITYA 2Y0TA 3FD9A 2F5QA 2VF7A 3F92A 3KW6A 3MHVC 1IXRC 1JR3E 1NY6A 2KRKA 2M5ZA 3ILKA 1IN6A 3E9SA 3UZUA 3OTOM 3DA1A 2FN2A 4QNLA 1Q02A 1JB0F 5EP1A 2DAKA 4FCTA 2ZAMA 1IBLM 2ZBKB 3I01M 1C7YA 2W82A 3SFZA 3TQSA 3BOSA 2K0BX 5FTNA 4PD2A 4JV5M 3J2PB 1SXJE 2DZOB 1GKIA 2LTUA 2MR9A 2KXEA 3HGIA 2X8AA 2BNKA 4XBOA 1PGYA 2BJWA 2QCUA 2XF3A 4RF1A 4D81A 3RFWA 1K82A 2ZAOA 4M9SA 3SAUA 1HNXM 5EXSA 1Q3CA 2B3TA 1H0GA 4MGKE 2JY5A 3HHXA 1SXJD 4IBCA 4IJFA 4TUWA 4PDGA 1L2DA 1YU4A 2FOIC 1E6PA 2YQZA 3GQ5A 3GLHB 4FWHA 2UU9M 2XFSA 4M9ZA 3JAMS 2LNHC 4LF7M 3FTFA 5ITXE 4QOSA 4LGMA 3SASA 3GRVA 1EAKA 2YR0A 1KS0A 3L25A 2QP9X 4HMEA 1QDTA 4LCBA 4GH9A 4YY3M 1HQYE 2V5OA 1TDZA 1AUAA 1HR0M 4HMDA 1TR8A 1P3QQ 3GLGE 4OUIA 2OOAA 3WD2A 3BXWA 5KO3A 3HHYA 4X66M 4JN6A 1MN3A 5GKNA 3KOZE 2XGNA 3FUWA 3LQQA 3TWMA 1QYRA 3GP1A 1UM8A 5C1BA 3AV0A 3KP0E 2HCBA 1W1PA 2R65A 4OJ6A 5KPZA 4AKIA 2G3QA 1FJGM 3PFIA 1XXHA 5FTKA 2BWBA 3R8FA 3U6OA 1IM2A 1GL7A 3C3DA 2OOBA 4HEOA 4DV0M 5ITUA 1J09A 1K3WA 4JI0M 3KSJA 4JI7M 4LRTA 2KDLA 3LQRA 2OO9A 3J7BA 1DGHB 1N75A 1WXQA 1XXHB 2CHVA 4DV4M 2HHHM 2KHHA 4LZJA 4AW4A 4PCZA 3EIEA 4AKHA 1NY5A 4R71A 5A2QS 4P17A 5ITRA 1LV7A 1TH4A 2EO2A 4KO8A 3J81S 3T1HM 2Y2PA 4HLQA 2L6OA 4FWDA 3SMPA 3FUXA 4GRIA 1DGBA 2F4VM 4IBIA 1PRBA 1XMOM 1G3IA 1TTEA 4FVMA 4GHAA 1QUSA 2HKJA 2KZUA 1C1KA 4FCWA 4QNMA 1ED7A 3DFZA 1GVNA 1V33A 2Y2QA 3B9PA 4MM3B 5EP4A 3HONA 1Z5AA 2H5XA 4IBJA 2F5PA 1JR3A 1NSFA 1VEKA 2Y2GA 2R45A 4I8OA 4DV5M 2Y2HA 3AL0C 4AG5A 1ZMVA 1QQWA 4II7A 2CUZA 5C18A 1N78A 2Q2EB 4LY6A 3A45A 1WGLA 1WJ7A 4CISA 1DO2A 2X4AA 4K0KM 2MGWA 5DNYA 2DAMA 1PJQA 4I4LA 4NSOB 4ANRA 3HJSA 3HKPA 3W0LB 3QAUA 3TL4X 4Z2GA 4QOZC 1QVRA 4NRWA 5H37D 2EJSA 1CK7A 4DR3M 1CXWA 1JQJC 3NBIA 2J5YA 1XXHE 4IBKA 3CF2A 2UUBM 1GOIA 2UXBM 4Z2LA 1OFHA 3A46A 2L4EA 1HQCA 4PT5A 3RGSA 2JY8A 4FWGA 1NV8A 3SYLA 3D8LA 8CATA 3KXEC 5IWAM 2MROB 4CJ6A 4DUYM 4JI8M 2XLJA 4OX9M 2Y2LA 1DGFA 2QENA 4NYYA 4DBGB 3WX7A 4DR7M 4ZPXA 3IECA 2FH0A 2C98A 2DENA 2JY7A 2KNZA 1PJTA 2LVOC 7CATA 1Z6TA 2JXNA 4B3RM 3KFUG 4OU7A 4LJ9A 2HL7A 5BPVA 4LG2A 4QHSA 3SYKA 2GNOA 1T3TA 2LVAA 3KOXE 1PJSA 5E26A 1XWIA 3FRHA 2DNAA 3D8BA 2JZ0A 1YU0A 5EJCA 4FD2A 3GLGB 1XC8A 3FKEA 4B3MM 4G6ZA 4LJ5A 2OQ4A 2RRUA 4L16A 1E9SA 4OJLA 4LGYA 2JE5A 3GQ4A 2UUCM 2RTSA 2VQFM 2G5GX 4UN2B 4B7FA 3MK6A 2V1CA 2D7HA 1G71A 4X65M 1Z5CA 3K2LA 3W0FA 1AIPC 1J7KA 3SHFA 1JR3D 3LCUA 1TGUA 1N32M 1E6RA 4Z2HA 2DWZB 2JNHA 1G8PA 3AOEA 3E21A 1VDDA 4JXJA 1W1TA 3I51A 5KQDA 2R44A 5LMUM 2XZFA 2LVNC 4LF4M 3GRYA 1OGGA 1PDCA 2I7NA 1OAIA 3B89A 3BBZA 2F5NA 1Q39A 4EIWA 3VK7A 3HHWA 3KSXA 4OJPA 2C9CA 2CWBA 2QNJA 1Z59A 2CV2A 4NOOB 4B3SM 4M0DA 4R7GA 2VF8A 4RKUF 3TWKA 1L2CA 2DWMA 3L29A 3U6EA 2I7PA 4HL4A 1IXSA 4IJEA 4DV2M 4B7GA 3FTDA 4HMCA 2DAIA 3T1YM 2DWNA 2BG1A 1E32A 2H1RA 2F5SA 1XMQM 2Y2KA 2QSFX 2Z7JA 3FYCA 2BJVA 2DAEA 5ITQA 4IBFA 3KS8A 4G3OA 3U6DA 2JA2A 3WHKA 2ERCA 3FTEA 3SMSA 5ITTA 2E5LM 3SC3A 2R18A 3LCVB 2R46A 3AOGA 5FSWA 1KFVA 4W5WA 2DZNB 4M0WA 4DR2M 4LF9M 1DV0A 1A5TA 1NV9A 2EKFA 3GLFA 3L2AA 1QAOA 4D82A 1NVMA 5IREB 1L1ZA 1XB2B 4JI3M 4DV3M 2LBCA 3UJNA 2FFFB 4MB7A 2M60A 2R4EA 3HZJA 4KODA 3WD3A 3ZH9B 4L8RC 1H0IA 1IY2A 5FTLA 2YNMD 1EE8A 2ZANA 2KRUA 4S12A 5JI2E 2EUCA 3H4JA 2DWLA 4BBAA 5EP3A 3U60A 3LW5F 3L27A 3TWLA 4JI1M 2XSZA 3QYBA 1PJJA 3KP1E 1NJFA 2A5YB 4LF5M 4MGYE 3E46A 1ZQ9A 2FFJA 1X37A 4GMQA 1GJSA 2KNAA 5FTMA 2BWEA 2VDBB 3U60B 1V34A 1SG9A 1G41A 3U6CA 2XH9A 2RGHA 1H8PA 3SBJA 1NNJA 4B08A 2MH8A 1HT1E 1ORYB 1FNNA 2DZLA 4NXNM 4IBBA
chains in the Genus database with same CATH topology
3SAVA 3I4YA 1I94M 4L78A 2Z4RA 1SXJC 1TDHA 3LMMA 1PM5A 1IBMM 1OJLA 1IXZA 3UMMA 1NJGA 4DV1M 4GC5A 3T38A 1NNUC 4OJ5A 2DHRA 1YUBA 3VDUA 1R6BX 5FLXS 3M7GA 3U5ZA 3L26A 3MJ5A 4L4UA 2IOUA 1ZAEA 2CFOA 4IBDA 3C58A 4Z6YA 4X62M 3QWLA 3VDPA 3U6SA 4QNRA 3VFDA 4R3DA 3LVVA 2KEBA 4GC9A 2RKOA 1IN5A 1YU1A 3AJIB 3GPUA 1HT2E 5IT9S 3FTCA 1I4WA 4AG6A 4CHTB 2EA0A 2VQEM 2Y2JA 4LJ8A 2J7OA 3E4RA 2V1UA 3K1JA 1R2YA 1L2BA 2QPAA 5JI3E 1YE9A 2YFQA 4G4RA 3TPZA 3KDSE 4DR1M 3CF6E 3AKZA 1IN8A 4XGIA 5IZ7D 3L28A 2CE7A 2AHMA 2XSZD 4YHHM 5FTJA 3TE6A 4DV6M 3U6MA 3VK8A 1E9RA 3UK6A 5EXTA 4LFBM 3CTWB 3J80S 2Y2MA 1HNWM 4I5SA 1L1TA 2V6ZM 4IBGA 4LRSA 4AKGA 4OJOA 4LZZA 2Y21A 4GKKM 3GLIA 4IIWA 4X64M 3HU1A 4L15A 4MGHA 2C96A 4WURA 4B7HA 2Y2IA 3JR4A 4AI6A 3K8ZA 4NSRA 3GLIB 1IQPA 2DVWB 2FNAA 4QHTA 2CEAA 2C5RA 5E6JA 4G4OA 2L7HA 4OVZA 3PXGA 2KW0A 4LFCM 3U61A 1N34M 4AQYM 2XD5A 4LF6M 3A42A 3GPYA 1J5EM 4OVZB 1K3XA 4KHPM 3HU3A 1KYIA 5BR8M 1IBKM 3ZC7B 2UWXA 3K92A 1KSFX 1OFIA 3FUVA 4NYUA 1Q3BA 3GLHA 4JYAM 1IXSB 1XNRM 4RNAA 1R2ZA 3NWLA 1N36M 3R9XB 1GLNA 1N33M 4LJ4A 2G8LA 4FCVA 1YU2A 3U6QA 2DXIA 2LXEA 4WW0A 1YU3A 2LH0A 3AFHA 4NZ1A 4DV7M 1GL6A 3GO8A 1G4AE 4PDIA 2O5RA 2LWXA 2C99A 5DYIA 3UGJA 3GRRA 2QZ4A 1TH2A 3GRUA 1IN4A 3U6LA 2VIIA 4LJ6A 1YSYA 1G59A 2XEPA 3GLFB 2D7EA 5EQTA 4LF8M 1NHWC 2XD1A 3EIHA 1DO0A 3GQ3A 3HHZA 4NXMM 4NY2A 5KQ8A 4LJAA 4I81A 3U6PA 3CF0A 4REZA 2CHGA 4MGZE 3HWSA 4MH0E 2FE8A 2F5OA 1DGHA 2J7NA 3SAWA 2CV1A 3KS4A 3M6AA 2UXCM 3HJ8A 5DYGA 3HJQA 4JI4M 2QBYA 5KPTA 4IBEA 3THGA 1H6UA 3DZDA 5LMNM 3M0EA 2KZSA 3PNYA 2R62A 2XZUA 3WHLA 1IY1A 1QZMA 2UUAM 3PNVA 2QBYB 3VLFB 1TH3A 1DGGA 3FYDA 1MX0A 3T15A 2CHQA 4DR4M 3SARA 4DR6M 4M9XA 4KLNA 1D2NA 2RGOA 1N77A 3JR5A 3SATA 5KPRA 4FW9A 4GKJM 3N3FA 3LVWA 4G4NA 3J7AS 5EXXA 3KOWE 2C9OA 4DUZM 3U5ZB 1W5SA 3Q8XA 3GPXA 2KA6B 4DR5M 4Z8XA 2UXDM 5EXPA 4NZ5A 4D80A 1QANA 3KOYE 2CV0A 3IG8A 4GITA 4B3TM 4NL4H 4JI5M 2K47A 4JI6M 3FUUA 4OW0A 1S3SA 3RE8A 5F3WA 1SXJA 2Y20A 4NZ4A 2X49A 4JI2M 1QAMA 3IG5A 2JCHA 1W5TA 5EP2A 2L7IA 4BB9A 2Z3XA 3VKHA 4NRVA 1SXJB 1XNQM 1L8QA 2L09A 3KVWA 2NQ8C 2P5TA 4ITQA 1R7RA 3HSHA 2Y2OA 4CGYB 4P16A 1IN7A 5ITXA 4BLCA 1Z5BA 3AOEC 3J27B 3H4MA 4MGIE 4LJ7A 3ZCBB 4RF0A 1NHGC 3HU2A 1MU5A 1E94E 3SHGB 2R4JA 2ZM6M 3FUTA 2Z4SA 1YUEA 3GLGA 3RGPA 2Y0QA 4LFAM 4A3VB 2OPFA 3VKGA 4GIPA 3I4VA 2D7GA 1XHBA 3PVSA 1HNZM 3A98B 3DOAA 1IY0A 4GHLA 4G4QA 3GPPA 2Y2NA 4AZFA 4NZ3A 2XFTA 1QAQA 5ITYA 2Y0TA 3FD9A 2F5QA 3KW6A 3MHVC 1IXRC 1NY6A 2KRKA 3ILKA 2M5ZA 3UZUA 1IN6A 3E9SA 3OTOM 3DA1A 4QNLA 5EP1A 4FCTA 2ZAMA 1IBLM 2ZBKB 2W82A 3SFZA 3TQSA 3BOSA 5FTNA 4PD2A 4JV5M 3J2PB 1SXJE 2DZOB 1GKIA 4XBOA 3U61B 2KXEA 3HGIA 2X8AA 2BNKA 1PJIA 2BJWA 2QCUA 2XF3A 4RF1A 4D81A 3RFWA 1K82A 2ZAOA 4M9SA 3SAUA 1HNXM 5EXSA 1Q3CA 4MGKE 3HHXA 1SXJD 4IBCA 4IJFA 4TUWA 4PDGA 1L2DA 1YU4A 2FOIC 2YQZA 3GQ5A 3GLHB 2UU9M 2XFSA 4M9ZA 3JAMS 2LNHC 4LF7M 3FTFA 5ITXE 4QOSA 4LGMA 3SASA 3GRVA 2YR0A 3L25A 2QP9X 4LCBA 4GH9A 4YY3M 1HQYE 1TDZA 1HR0M 4OUIA 5KO3A 3HHYA 4X66M 4JN6A 5GKNA 3KOZE 2XGNA 3FUWA 3LQQA 3TWMA 1QYRA 3GP1A 1UM8A 5C1BA 3AV0A 3KP0E 2HCBA 4OJ6A 2R65A 5KPZA 4AKIA 1FJGM 3PFIA 1XXHA 5FTKA 3R8FA 3U6OA 1IM2A 1GL7A 4DV0M 5ITUA 1J09A 1K3WA 4JI0M 3KSJA 4JI7M 4LRTA 3LQRA 3J7BA 2HHHM 1DGHB 1N75A 1WXQA 1XXHB 2CHVA 4DV4M 4AKHA 4LZJA 4AW4A 4PCZA 3EIEA 1NY5A 5A2QS 5ITRA 1LV7A 1TH4A 2EO2A 4KO8A 3J81S 3T1HM 2Y2PA 4HLQA 2L6OA 4FWDA 3SMPA 3FUXA 4GRIA 1DGBA 2F4VM 4IBIA 1XMOM 1G3IA 4GHAA 4FVMA 2HKJA 2KZUA 1C1KA 4FCWA 4QNMA 3DFZA 1GVNA 2Y2QA 3B9PA 4MM3B 5EP4A 3HONA 1Z5AA 4IBJA 2F5PA 1JR3A 1NSFA 2Y2GA 2R45A 4I8OA 4DV5M 2Y2HA 3AL0C 4AG5A 1QQWA 4II7A 2CUZA 5C18A 1N78A 2Q2EB 4LY6A 3A45A 4CISA 1DO2A 2X4AA 4K0KM 5DNYA 4I4LA 4NSOB 3HJSA 3HKPA 3W0LB 3QAUA 3TL4X 4QOZC 1QVRA 4NRWA 5H37D 4DR3M 1JQJC 3NBIA 2UUBM 4IBKA 3CF2A 2UXBM 1OFHA 3A46A 1HQCA 4PT5A 3RGSA 3SYLA 4FWGA 5IWAM 3D8LA 8CATA 3KXEC 4DUYM 4JI8M 2XLJA 4OX9M 2Y2LA 1DGFA 2QENA 4NYYA 3WX7A 4DR7M 4ZPXA 2C98A 7CATA 1Z6TA 4B3RM 3KFUG 4OU7A 4LJ9A 2HL7A 5BPVA 4LG2A 4QHSA 3SYKA 3KOXE 1T3TA 5E26A 1XWIA 3D8BA 1YU0A 5EJCA 4FD2A 3GLGB 1XC8A 3FKEA 4B3MM 4G6ZA 4LJ5A 2OQ4A 4L16A 1E9SA 4OJLA 4LGYA 2JE5A 3GQ4A 2UUCM 2VQFM 2G5GX 4B7FA 3MK6A 2V1CA 2D7HA 4X65M 1Z5CA 3K2LA 3W0FA 1J7KA 3SHFA 1JR3D 1TGUA 1N32M 2DWZB 1G8PA 3AOEA 1VDDA 4JXJA 3I51A 5KQDA 2XZFA 5LMUM 4LF4M 3GRYA 2I7NA 2F5NA 1Q39A 4EIWA 3VK7A 3HHWA 3KSXA 4OJPA 2C9CA 1Z59A 2CV2A 4NOOB 4B3SM 4M0DA 4R7GA 3TWKA 2DWMA 1L2CA 3L29A 3U6EA 2I7PA 4HL4A 4IJEA 4DV2M 4B7GA 3FTDA 3T1YM 2DWNA 2BG1A 1E32A 2H1RA 2F5SA 1XMQM 2Y2KA 2Z7JA 3FYCA 2BJVA 5ITQA 4IBFA 3KS8A 3U6DA 2JA2A 3WHKA 2ERCA 3FTEA 3SMSA 5ITTA 2E5LM 3SC3A 2R18A 2R46A 3AOGA 5FSWA 1KFVA 4W5WA 2DZNB 4M0WA 4DR2M 4LF9M 3GLFA 3L2AA 1QAOA 4D82A 1NVMA 5IREB 1L1ZA 4JI3M 4DV3M 3UJNA 2FFFB 4MB7A 2M60A 2R4EA 4KODA 3ZH9B 4L8RC 1IY2A 5FTLA 2YNMD 1EE8A 2ZANA 2KRUA 4S12A 5JI2E 2EUCA 2DWLA 4BBAA 5EP3A 3U60A 4JI1M 3L27A 3TWLA 2XSZA 1PJJA 3KP1E 1NJFA 2A5YB 4LF5M 4MGYE 1ZQ9A 2FFJA 1X37A 4GMQA 5FTMA 3U60B 1G41A 3U6CA 2XH9A 2RGHA 3SBJA 1NNJA 4B08A 1HT1E 1ORYB 1FNNA 4FWHA 4NXNM 4IBBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IBE A;  3L29 A;  4GH9 A;  4IBG A;  4IJE A;  3L25 A;  3L27 A;  5BPV A;  4LG2 A;  4IBF A;  3KS8 A;  4IBI A;  3L26 A;  4GHL A;  4IBD A;  4GHA A;  4IBC A;  4IJF A;  3L28 A;  3FKE A;  3KS4 A;  4IBK A;  4IBJ A;  3L2A A;  4IBB A; 
#chains in the Genus database with same CATH topology
 3SAV A;  3I4Y A;  1I94 M;  4L78 A;  2LVQ D;  1SXJ C;  1TDH A;  2Z4R A;  3LMM A;  3I04 M;  1PM5 A;  1IBM M;  1OJL A;  1IXZ A;  1R4G A;  1VEG A;  3UMM A;  2K6B A;  1F4I A;  1NJG A;  4DV1 M;  1ZV1 A;  4GC5 A;  3T38 A;  1NNU C;  4OJ5 A;  2DHR A;  2ZTC A;  1YUB A;  3VDU A;  1R6B X;  2CRU A;  2K9D A;  5FLX S;  3M7G A;  3U5Z A;  3L26 A;  3MJ5 A;  4L4U A;  2IOU A;  1ZAE A;  2CFO A;  4IBD A;  3C58 A;  4Z6Y A;  1OKS A;  4X62 M;  3QWL A;  3VDP A;  3U6S A;  4QNR A;  3VFD A;  4R3D A;  3B74 A;  2JY6 B;  2KEB A;  3LVV A;  3GLF E;  4GC9 A;  3HX3 A;  2RKO A;  1IN5 A;  1WGN A;  1E15 A;  1BVS A;  3AJI B;  3GPU A;  1YU1 A;  1HT2 E;  5IT9 S;  1W1Y A;  3FTC A;  1I4W A;  4AG6 A;  4CHT B;  2EA0 A;  2VQE M;  2Y2J A;  4LJ8 A;  2J7O A;  3E4R A;  2V1U A;  3K1J A;  1R2Y A;  1L2B A;  1GXD A;  1MJG M;  2QPA A;  5JI3 E;  1YE9 A;  2YFQ A;  4G4R A;  3TPZ A;  3KDS E;  1UFZ A;  4KT0 F;  3CF6 E;  4DR1 M;  3CGW A;  3AKZ A;  1IN8 A;  1ZMW A;  4XGI A;  1OTR A;  5IZ7 D;  4Q7J A;  3MMP A;  3L28 A;  2CE7 A;  2AHM A;  2XSZ D;  4YHH M;  5FTJ A;  1D0K A;  3TE6 A;  4DV6 M;  1E8B A;  3U6M A;  3K9P A;  3VK8 A;  1E9R A;  3UK6 A;  5EXT A;  4LFB M;  1TF0 B;  3CTW B;  3J80 S;  2Y2M A;  1HNW M;  4I5S A;  1L1T A;  1OIP A;  2V6Z M;  1GAB A;  2JUJ A;  4IBG A;  4LRS A;  1NO1 A;  4AKG A;  4OJO A;  3K9O A;  4LZZ A;  2Y21 A;  4GKK M;  3GLI A;  1EFU B;  1VQ1 A;  1UR9 A;  2EKK A;  4IIW A;  3HU1 A;  4L15 A;  4MGH A;  2R0I A;  4WP2 A;  4X64 M;  1IFY A;  2C96 A;  4WUR A;  4B7H A;  2Y2I A;  4Z2J A;  3JR4 A;  4AI6 A;  4MB3 A;  3B7N A;  3K8Z A;  4NSR A;  3GLI B;  1IQP A;  2DVW B;  2FNA A;  4QHT A;  2QHO B;  2CEA A;  2KNV A;  2C5R A;  5E6J A;  4MB4 A;  4F2L A;  1VG5 A;  4G4O A;  2L7H A;  4OVZ A;  1L6J A;  3PXG A;  3W67 A;  2KW0 A;  2WZJ A;  3ZQJ A;  3U61 B;  2O25 A;  4LFC M;  3U61 A;  1N34 M;  4AQY M;  1O6I A;  2XD5 A;  3WD1 A;  3B7Z A;  4LF6 M;  2CP8 A;  3A42 A;  3MQL A;  4XK8 F;  1HJP A;  3GPY A;  1J5E M;  4OVZ B;  1K3X A;  4KHP M;  3HU3 A;  1KYI A;  5BR8 M;  1IBK M;  3ZC7 B;  1J7M A;  2DAG A;  3FRI A;  1KSF X;  1OFI A;  2LHG A;  2JWS A;  3K92 A;  2UWX A;  3FUV A;  2WSC F;  4NYU A;  1Q3B A;  3GLH A;  4JYA M;  3M7P A;  1IXS B;  2HWJ A;  1XNR M;  2LHC A;  4RNA A;  1R2Z A;  3NWL A;  1N36 M;  3R9X B;  1GLN A;  1N33 M;  4LJ4 A;  2G8L A;  2WSE F;  4FCV A;  3U6Q A;  2DXI A;  2LXE A;  4WW0 A;  1YU2 A;  1QDR A;  3QYE A;  1YU3 A;  2LH0 A;  3AFH A;  4NZ1 A;  4DV7 M;  1GL6 A;  1E6N A;  3GO8 A;  1G4A E;  1QO6 A;  1CUK A;  2O5R A;  4PDI A;  2LWX A;  2C99 A;  5DYI A;  3UGJ A;  3GRR A;  2QZ4 A;  1TH2 A;  1OGB A;  1RU3 A;  3GRU A;  1IN4 A;  3U6L A;  2GQF A;  2VII A;  4Y28 F;  4F1I A;  4MB5 A;  4LJ6 A;  1YSY A;  1G59 A;  2XEP A;  3GLF B;  3GLI E;  1GJT A;  2D7E A;  5EQT A;  4LF8 M;  1NHW C;  2QQ8 A;  2XD1 A;  3EIH A;  1DO0 A;  3GQ3 A;  3HHZ A;  4NXM M;  4NY2 A;  5KQ8 A;  4LJA A;  4I81 A;  3U6P A;  3CF0 A;  4REZ A;  2CHG A;  4MGZ E;  3HWS A;  1QUT A;  4MH0 E;  2FE8 A;  2F5O A;  1LTM A;  1DGH A;  2J7N A;  3SAW A;  2CV1 A;  4GEW A;  3KS4 A;  3M6A A;  3WD4 A;  2UXC M;  3HJ8 A;  1R5L A;  5DYG A;  3HJQ A;  4JI4 M;  1YLA A;  1VEJ A;  2QBY A;  4L6V 6;  5KPT A;  4IBE A;  3THG A;  1H6U A;  2LVP C;  3DZD A;  3IHP A;  3M0E A;  5LMN M;  1W1V A;  2KZS A;  3Q8G A;  3PNY A;  2R62 A;  5DFL A;  2XZU A;  1WR1 B;  3WHL A;  1IY1 A;  2JZ1 A;  1QZM A;  2UUA M;  3PNV A;  2QBY B;  1V92 A;  3VLF B;  1TH3 A;  1DGG A;  3FYD A;  1MX0 A;  4CIZ A;  3T15 A;  2ZTD A;  3GLH E;  2CHQ A;  4DR4 M;  3SAR A;  4DR6 M;  1OIZ A;  4KLN A;  4M9X A;  1D2N A;  2HAK A;  2RGO A;  1N77 A;  3JR5 A;  3NBX X;  3C3E A;  5KPR A;  4FW9 A;  3SAT A;  1E6Z A;  4GKJ M;  3N3F A;  2APL A;  3LVW A;  4G4N A;  3J7A S;  5EXX A;  1QZE A;  3KOW E;  2C9O A;  4DUZ M;  3FE3 A;  3U5Z B;  1PJI A;  1W5S A;  3C9P A;  3Q8X A;  2KA6 B;  3GPX A;  4DR5 M;  4Z8X A;  3W68 A;  2DKL A;  2UXD M;  5EXP A;  4NZ5 A;  4D80 A;  1QAN A;  2DI0 A;  3KOY E;  2N35 A;  2CV0 A;  1EIJ A;  3IG8 A;  4GIT A;  4B3T M;  4NL4 H;  2FS1 A;  2K47 A;  4JI5 M;  4JI6 M;  2JP7 A;  2O01 F;  3FUU A;  4OW0 A;  3T6P A;  3V76 A;  1S3S A;  2D49 A;  1ZMU A;  3RE8 A;  5F3W A;  1SXJ A;  2Y20 A;  4NC6 A;  1GO5 A;  2X49 A;  4NZ4 A;  4JI2 M;  1QAM A;  2Z8Y M;  4Z2K A;  2WSF F;  3IG5 A;  2L2D A;  2JCH A;  1W5T A;  5EP2 A;  2L7I A;  4BB9 A;  2Z3X A;  3VKH A;  4NRV A;  1SXJ B;  1XNQ M;  1L8Q A;  2L09 A;  2MJ5 B;  3KVW A;  1OAO C;  2L4F A;  2NQ8 C;  2P5T A;  4ITQ A;  1R7R A;  3HSH A;  3B7Q A;  2Y2O A;  4CGY B;  1WIV A;  4P16 A;  1D0L A;  1IN7 A;  3WD0 A;  5ITX A;  4BLC A;  1Z5B A;  3AOE C;  3J27 B;  3H4M A;  4MGI E;  1E88 A;  4LJ7 A;  3ZCB B;  4RF0 A;  1AIW A;  1NHG C;  2R6F A;  3HU2 A;  1MU5 A;  1T6O A;  1UR8 A;  1E94 E;  3SHG B;  2R4J A;  2ZM6 M;  3FUT A;  2Z4S A;  1OQY A;  1VDL A;  1YUE A;  3GLG A;  3RGP A;  2Y0Q A;  4LFA M;  4A3V B;  2OPF A;  1D0M A;  1Y8G A;  3VKG A;  4Z2I A;  4GIP A;  3I4V A;  3HY5 A;  4TX8 A;  1WHC A;  1XHB A;  2D7G A;  2DHY A;  3PVS A;  1HNZ M;  1T43 A;  5L8R F;  1GPF A;  3A98 B;  3DOA A;  1IY0 A;  4GHL A;  4G4Q A;  3GPP A;  2Y2N A;  4AZF A;  4NZ3 A;  2XFT A;  1QAQ A;  5ITY A;  2Y0T A;  3FD9 A;  2F5Q A;  2VF7 A;  3F92 A;  3KW6 A;  3MHV C;  1IXR C;  1JR3 E;  1NY6 A;  2KRK A;  2M5Z A;  3ILK A;  1IN6 A;  3E9S A;  3UZU A;  3OTO M;  3DA1 A;  2FN2 A;  4QNL A;  1Q02 A;  1JB0 F;  5EP1 A;  2DAK A;  4FCT A;  2ZAM A;  1IBL M;  2ZBK B;  3I01 M;  1C7Y A;  2W82 A;  3SFZ A;  3TQS A;  3BOS A;  2K0B X;  5FTN A;  4PD2 A;  4JV5 M;  3J2P B;  1SXJ E;  2DZO B;  1GKI A;  2LTU A;  2MR9 A;  2KXE A;  3HGI A;  2X8A A;  2BNK A;  4XBO A;  1PGY A;  2BJW A;  2QCU A;  2XF3 A;  4RF1 A;  4D81 A;  3RFW A;  1K82 A;  2ZAO A;  4M9S A;  3SAU A;  1HNX M;  5EXS A;  1Q3C A;  2B3T A;  1H0G A;  4MGK E;  2JY5 A;  3HHX A;  1SXJ D;  4IBC A;  4IJF A;  4TUW A;  4PDG A;  1L2D A;  1YU4 A;  2FOI C;  1E6P A;  2YQZ A;  3GQ5 A;  3GLH B;  4FWH A;  2UU9 M;  2XFS A;  4M9Z A;  3JAM S;  2LNH C;  4LF7 M;  3FTF A;  5ITX E;  4QOS A;  4LGM A;  3SAS A;  3GRV A;  1EAK A;  2YR0 A;  1KS0 A;  3L25 A;  2QP9 X;  4HME A;  1QDT A;  4LCB A;  4GH9 A;  4YY3 M;  1HQY E;  2V5O A;  1TDZ A;  1AUA A;  1HR0 M;  4HMD A;  1TR8 A;  1P3Q Q;  3GLG E;  4OUI A;  2OOA A;  3WD2 A;  3BXW A;  5KO3 A;  3HHY A;  4X66 M;  4JN6 A;  1MN3 A;  5GKN A;  3KOZ E;  2XGN A;  3FUW A;  3LQQ A;  3TWM A;  1QYR A;  3GP1 A;  1UM8 A;  5C1B A;  3AV0 A;  3KP0 E;  2HCB A;  1W1P A;  2R65 A;  4OJ6 A;  5KPZ A;  4AKI A;  2G3Q A;  1FJG M;  3PFI A;  1XXH A;  5FTK A;  2BWB A;  3R8F A;  3U6O A;  1IM2 A;  1GL7 A;  3C3D A;  2OOB A;  4HEO A;  4DV0 M;  5ITU A;  1J09 A;  1K3W A;  4JI0 M;  3KSJ A;  4JI7 M;  4LRT A;  2KDL A;  3LQR A;  2OO9 A;  3J7B A;  1DGH B;  1N75 A;  1WXQ A;  1XXH B;  2CHV A;  4DV4 M;  2HHH M;  2KHH A;  4LZJ A;  4AW4 A;  4PCZ A;  3EIE A;  4AKH A;  1NY5 A;  4R71 A;  5A2Q S;  4P17 A;  5ITR A;  1LV7 A;  1TH4 A;  2EO2 A;  4KO8 A;  3J81 S;  3T1H M;  2Y2P A;  4HLQ A;  2L6O A;  4FWD A;  3SMP A;  3FUX A;  4GRI A;  1DGB A;  2F4V M;  4IBI A;  1PRB A;  1XMO M;  1G3I A;  1TTE A;  4FVM A;  4GHA A;  1QUS A;  2HKJ A;  2KZU A;  1C1K A;  4FCW A;  4QNM A;  1ED7 A;  3DFZ A;  1GVN A;  1V33 A;  2Y2Q A;  3B9P A;  4MM3 B;  5EP4 A;  3HON A;  1Z5A A;  2H5X A;  4IBJ A;  2F5P A;  1JR3 A;  1NSF A;  1VEK A;  2Y2G A;  2R45 A;  4I8O A;  4DV5 M;  2Y2H A;  3AL0 C;  4AG5 A;  1ZMV A;  1QQW A;  4II7 A;  2CUZ A;  5C18 A;  1N78 A;  2Q2E B;  4LY6 A;  3A45 A;  1WGL A;  1WJ7 A;  4CIS A;  1DO2 A;  2X4A A;  4K0K M;  2MGW A;  5DNY A;  2DAM A;  1PJQ A;  4I4L A;  4NSO B;  4ANR A;  3HJS A;  3HKP A;  3W0L B;  3QAU A;  3TL4 X;  4Z2G A;  4QOZ C;  1QVR A;  4NRW A;  5H37 D;  2EJS A;  1CK7 A;  4DR3 M;  1CXW A;  1JQJ C;  3NBI A;  2J5Y A;  1XXH E;  4IBK A;  3CF2 A;  2UUB M;  1GOI A;  2UXB M;  4Z2L A;  1OFH A;  3A46 A;  2L4E A;  1HQC A;  4PT5 A;  3RGS A;  2JY8 A;  4FWG A;  1NV8 A;  3SYL A;  3D8L A;  8CAT A;  3KXE C;  5IWA M;  2MRO B;  4CJ6 A;  4DUY M;  4JI8 M;  2XLJ A;  4OX9 M;  2Y2L A;  1DGF A;  2QEN A;  4NYY A;  4DBG B;  3WX7 A;  4DR7 M;  4ZPX A;  3IEC A;  2FH0 A;  2C98 A;  2DEN A;  2JY7 A;  2KNZ A;  1PJT A;  2LVO C;  7CAT A;  1Z6T A;  2JXN A;  4B3R M;  3KFU G;  4OU7 A;  4LJ9 A;  2HL7 A;  5BPV A;  4LG2 A;  4QHS A;  3SYK A;  2GNO A;  1T3T A;  2LVA A;  3KOX E;  1PJS A;  5E26 A;  1XWI A;  3FRH A;  2DNA A;  3D8B A;  2JZ0 A;  1YU0 A;  5EJC A;  4FD2 A;  3GLG B;  1XC8 A;  3FKE A;  4B3M M;  4G6Z A;  4LJ5 A;  2OQ4 A;  2RRU A;  4L16 A;  1E9S A;  4OJL A;  4LGY A;  2JE5 A;  3GQ4 A;  2UUC M;  2RTS A;  2VQF M;  2G5G X;  4UN2 B;  4B7F A;  3MK6 A;  2V1C A;  2D7H A;  1G71 A;  4X65 M;  1Z5C A;  3K2L A;  3W0F A;  1AIP C;  1J7K A;  3SHF A;  1JR3 D;  3LCU A;  1TGU A;  1N32 M;  1E6R A;  4Z2H A;  2DWZ B;  2JNH A;  1G8P A;  3AOE A;  3E21 A;  1VDD A;  4JXJ A;  1W1T A;  3I51 A;  5KQD A;  2R44 A;  5LMU M;  2XZF A;  2LVN C;  4LF4 M;  3GRY A;  1OGG A;  1PDC A;  2I7N A;  1OAI A;  3B89 A;  3BBZ A;  2F5N A;  1Q39 A;  4EIW A;  3VK7 A;  3HHW A;  3KSX A;  4OJP A;  2C9C A;  2CWB A;  2QNJ A;  1Z59 A;  2CV2 A;  4NOO B;  4B3S M;  4M0D A;  4R7G A;  2VF8 A;  4RKU F;  3TWK A;  1L2C A;  2DWM A;  3L29 A;  3U6E A;  2I7P A;  4HL4 A;  1IXS A;  4IJE A;  4DV2 M;  4B7G A;  3FTD A;  4HMC A;  2DAI A;  3T1Y M;  2DWN A;  2BG1 A;  1E32 A;  2H1R A;  2F5S A;  1XMQ M;  2Y2K A;  2QSF X;  2Z7J A;  3FYC A;  2BJV A;  2DAE A;  5ITQ A;  4IBF A;  3KS8 A;  4G3O A;  3U6D A;  2JA2 A;  3WHK A;  2ERC A;  3FTE A;  3SMS A;  5ITT A;  2E5L M;  3SC3 A;  2R18 A;  3LCV B;  2R46 A;  3AOG A;  5FSW A;  1KFV A;  4W5W A;  2DZN B;  4M0W A;  4DR2 M;  4LF9 M;  1DV0 A;  1A5T A;  1NV9 A;  2EKF A;  3GLF A;  3L2A A;  1QAO A;  4D82 A;  1NVM A;  5IRE B;  1L1Z A;  1XB2 B;  4JI3 M;  4DV3 M;  2LBC A;  3UJN A;  2FFF B;  4MB7 A;  2M60 A;  2R4E A;  3HZJ A;  4KOD A;  3WD3 A;  3ZH9 B;  4L8R C;  1H0I A;  1IY2 A;  5FTL A;  2YNM D;  1EE8 A;  2ZAN A;  2KRU A;  4S12 A;  5JI2 E;  2EUC A;  3H4J A;  2DWL A;  4BBA A;  5EP3 A;  3U60 A;  3LW5 F;  3L27 A;  3TWL A;  4JI1 M;  2XSZ A;  3QYB A;  1PJJ A;  3KP1 E;  1NJF A;  2A5Y B;  4LF5 M;  4MGY E;  3E46 A;  1ZQ9 A;  2FFJ A;  1X37 A;  4GMQ A;  1GJS A;  2KNA A;  5FTM A;  2BWE A;  2VDB B;  3U60 B;  1V34 A;  1SG9 A;  1G41 A;  3U6C A;  2XH9 A;  2RGH A;  1H8P A;  3SBJ A;  1NNJ A;  4B08 A;  2MH8 A;  1HT1 E;  1ORY B;  1FNN A;  2DZL A;  4NXN M;  4IBB A; 
#chains in the Genus database with same CATH homology
 3SAV A;  3I4Y A;  1I94 M;  4L78 A;  2Z4R A;  1SXJ C;  1TDH A;  3LMM A;  1PM5 A;  1IBM M;  1OJL A;  1IXZ A;  3UMM A;  1NJG A;  4DV1 M;  4GC5 A;  3T38 A;  1NNU C;  4OJ5 A;  2DHR A;  1YUB A;  3VDU A;  1R6B X;  5FLX S;  3M7G A;  3U5Z A;  3L26 A;  3MJ5 A;  4L4U A;  2IOU A;  1ZAE A;  2CFO A;  4IBD A;  3C58 A;  4Z6Y A;  4X62 M;  3QWL A;  3VDP A;  3U6S A;  4QNR A;  3VFD A;  4R3D A;  3LVV A;  2KEB A;  4GC9 A;  2RKO A;  1IN5 A;  1YU1 A;  3AJI B;  3GPU A;  1HT2 E;  5IT9 S;  3FTC A;  1I4W A;  4AG6 A;  4CHT B;  2EA0 A;  2VQE M;  2Y2J A;  4LJ8 A;  2J7O A;  3E4R A;  2V1U A;  3K1J A;  1R2Y A;  1L2B A;  2QPA A;  5JI3 E;  1YE9 A;  2YFQ A;  4G4R A;  3TPZ A;  3KDS E;  4DR1 M;  3CF6 E;  3AKZ A;  1IN8 A;  4XGI A;  5IZ7 D;  3L28 A;  2CE7 A;  2AHM A;  2XSZ D;  4YHH M;  5FTJ A;  3TE6 A;  4DV6 M;  3U6M A;  3VK8 A;  1E9R A;  3UK6 A;  5EXT A;  4LFB M;  3CTW B;  3J80 S;  2Y2M A;  1HNW M;  4I5S A;  1L1T A;  2V6Z M;  4IBG A;  4LRS A;  4AKG A;  4OJO A;  4LZZ A;  2Y21 A;  4GKK M;  3GLI A;  4IIW A;  4X64 M;  3HU1 A;  4L15 A;  4MGH A;  2C96 A;  4WUR A;  4B7H A;  2Y2I A;  3JR4 A;  4AI6 A;  3K8Z A;  4NSR A;  3GLI B;  1IQP A;  2DVW B;  2FNA A;  4QHT A;  2CEA A;  2C5R A;  5E6J A;  4G4O A;  2L7H A;  4OVZ A;  3PXG A;  2KW0 A;  4LFC M;  3U61 A;  1N34 M;  4AQY M;  2XD5 A;  4LF6 M;  3A42 A;  3GPY A;  1J5E M;  4OVZ B;  1K3X A;  4KHP M;  3HU3 A;  1KYI A;  5BR8 M;  1IBK M;  3ZC7 B;  2UWX A;  3K92 A;  1KSF X;  1OFI A;  3FUV A;  4NYU A;  1Q3B A;  3GLH A;  4JYA M;  1IXS B;  1XNR M;  4RNA A;  1R2Z A;  3NWL A;  1N36 M;  3R9X B;  1GLN A;  1N33 M;  4LJ4 A;  2G8L A;  4FCV A;  1YU2 A;  3U6Q A;  2DXI A;  2LXE A;  4WW0 A;  1YU3 A;  2LH0 A;  3AFH A;  4NZ1 A;  4DV7 M;  1GL6 A;  3GO8 A;  1G4A E;  4PDI A;  2O5R A;  2LWX A;  2C99 A;  5DYI A;  3UGJ A;  3GRR A;  2QZ4 A;  1TH2 A;  3GRU A;  1IN4 A;  3U6L A;  2VII A;  4LJ6 A;  1YSY A;  1G59 A;  2XEP A;  3GLF B;  2D7E A;  5EQT A;  4LF8 M;  1NHW C;  2XD1 A;  3EIH A;  1DO0 A;  3GQ3 A;  3HHZ A;  4NXM M;  4NY2 A;  5KQ8 A;  4LJA A;  4I81 A;  3U6P A;  3CF0 A;  4REZ A;  2CHG A;  4MGZ E;  3HWS A;  4MH0 E;  2FE8 A;  2F5O A;  1DGH A;  2J7N A;  3SAW A;  2CV1 A;  3KS4 A;  3M6A A;  2UXC M;  3HJ8 A;  5DYG A;  3HJQ A;  4JI4 M;  2QBY A;  5KPT A;  4IBE A;  3THG A;  1H6U A;  3DZD A;  5LMN M;  3M0E A;  2KZS A;  3PNY A;  2R62 A;  2XZU A;  3WHL A;  1IY1 A;  1QZM A;  2UUA M;  3PNV A;  2QBY B;  3VLF B;  1TH3 A;  1DGG A;  3FYD A;  1MX0 A;  3T15 A;  2CHQ A;  4DR4 M;  3SAR A;  4DR6 M;  4M9X A;  4KLN A;  1D2N A;  2RGO A;  1N77 A;  3JR5 A;  3SAT A;  5KPR A;  4FW9 A;  4GKJ M;  3N3F A;  3LVW A;  4G4N A;  3J7A S;  5EXX A;  3KOW E;  2C9O A;  4DUZ M;  3U5Z B;  1W5S A;  3Q8X A;  3GPX A;  2KA6 B;  4DR5 M;  4Z8X A;  2UXD M;  5EXP A;  4NZ5 A;  4D80 A;  1QAN A;  3KOY E;  2CV0 A;  3IG8 A;  4GIT A;  4B3T M;  4NL4 H;  4JI5 M;  2K47 A;  4JI6 M;  3FUU A;  4OW0 A;  1S3S A;  3RE8 A;  5F3W A;  1SXJ A;  2Y20 A;  4NZ4 A;  2X49 A;  4JI2 M;  1QAM A;  3IG5 A;  2JCH A;  1W5T A;  5EP2 A;  2L7I A;  4BB9 A;  2Z3X A;  3VKH A;  4NRV A;  1SXJ B;  1XNQ M;  1L8Q A;  2L09 A;  3KVW A;  2NQ8 C;  2P5T A;  4ITQ A;  1R7R A;  3HSH A;  2Y2O A;  4CGY B;  4P16 A;  1IN7 A;  5ITX A;  4BLC A;  1Z5B A;  3AOE C;  3J27 B;  3H4M A;  4MGI E;  4LJ7 A;  3ZCB B;  4RF0 A;  1NHG C;  3HU2 A;  1MU5 A;  1E94 E;  3SHG B;  2R4J A;  2ZM6 M;  3FUT A;  2Z4S A;  1YUE A;  3GLG A;  3RGP A;  2Y0Q A;  4LFA M;  4A3V B;  2OPF A;  3VKG A;  4GIP A;  3I4V A;  2D7G A;  1XHB A;  3PVS A;  1HNZ M;  3A98 B;  3DOA A;  1IY0 A;  4GHL A;  4G4Q A;  3GPP A;  2Y2N A;  4AZF A;  4NZ3 A;  2XFT A;  1QAQ A;  5ITY A;  2Y0T A;  3FD9 A;  2F5Q A;  3KW6 A;  3MHV C;  1IXR C;  1NY6 A;  2KRK A;  3ILK A;  2M5Z A;  3UZU A;  1IN6 A;  3E9S A;  3OTO M;  3DA1 A;  4QNL A;  5EP1 A;  4FCT A;  2ZAM A;  1IBL M;  2ZBK B;  2W82 A;  3SFZ A;  3TQS A;  3BOS A;  5FTN A;  4PD2 A;  4JV5 M;  3J2P B;  1SXJ E;  2DZO B;  1GKI A;  4XBO A;  3U61 B;  2KXE A;  3HGI A;  2X8A A;  2BNK A;  1PJI A;  2BJW A;  2QCU A;  2XF3 A;  4RF1 A;  4D81 A;  3RFW A;  1K82 A;  2ZAO A;  4M9S A;  3SAU A;  1HNX M;  5EXS A;  1Q3C A;  4MGK E;  3HHX A;  1SXJ D;  4IBC A;  4IJF A;  4TUW A;  4PDG A;  1L2D A;  1YU4 A;  2FOI C;  2YQZ A;  3GQ5 A;  3GLH B;  2UU9 M;  2XFS A;  4M9Z A;  3JAM S;  2LNH C;  4LF7 M;  3FTF A;  5ITX E;  4QOS A;  4LGM A;  3SAS A;  3GRV A;  2YR0 A;  3L25 A;  2QP9 X;  4LCB A;  4GH9 A;  4YY3 M;  1HQY E;  1TDZ A;  1HR0 M;  4OUI A;  5KO3 A;  3HHY A;  4X66 M;  4JN6 A;  5GKN A;  3KOZ E;  2XGN A;  3FUW A;  3LQQ A;  3TWM A;  1QYR A;  3GP1 A;  1UM8 A;  5C1B A;  3AV0 A;  3KP0 E;  2HCB A;  4OJ6 A;  2R65 A;  5KPZ A;  4AKI A;  1FJG M;  3PFI A;  1XXH A;  5FTK A;  3R8F A;  3U6O A;  1IM2 A;  1GL7 A;  4DV0 M;  5ITU A;  1J09 A;  1K3W A;  4JI0 M;  3KSJ A;  4JI7 M;  4LRT A;  3LQR A;  3J7B A;  2HHH M;  1DGH B;  1N75 A;  1WXQ A;  1XXH B;  2CHV A;  4DV4 M;  4AKH A;  4LZJ A;  4AW4 A;  4PCZ A;  3EIE A;  1NY5 A;  5A2Q S;  5ITR A;  1LV7 A;  1TH4 A;  2EO2 A;  4KO8 A;  3J81 S;  3T1H M;  2Y2P A;  4HLQ A;  2L6O A;  4FWD A;  3SMP A;  3FUX A;  4GRI A;  1DGB A;  2F4V M;  4IBI A;  1XMO M;  1G3I A;  4GHA A;  4FVM A;  2HKJ A;  2KZU A;  1C1K A;  4FCW A;  4QNM A;  3DFZ A;  1GVN A;  2Y2Q A;  3B9P A;  4MM3 B;  5EP4 A;  3HON A;  1Z5A A;  4IBJ A;  2F5P A;  1JR3 A;  1NSF A;  2Y2G A;  2R45 A;  4I8O A;  4DV5 M;  2Y2H A;  3AL0 C;  4AG5 A;  1QQW A;  4II7 A;  2CUZ A;  5C18 A;  1N78 A;  2Q2E B;  4LY6 A;  3A45 A;  4CIS A;  1DO2 A;  2X4A A;  4K0K M;  5DNY A;  4I4L A;  4NSO B;  3HJS A;  3HKP A;  3W0L B;  3QAU A;  3TL4 X;  4QOZ C;  1QVR A;  4NRW A;  5H37 D;  4DR3 M;  1JQJ C;  3NBI A;  2UUB M;  4IBK A;  3CF2 A;  2UXB M;  1OFH A;  3A46 A;  1HQC A;  4PT5 A;  3RGS A;  3SYL A;  4FWG A;  5IWA M;  3D8L A;  8CAT A;  3KXE C;  4DUY M;  4JI8 M;  2XLJ A;  4OX9 M;  2Y2L A;  1DGF A;  2QEN A;  4NYY A;  3WX7 A;  4DR7 M;  4ZPX A;  2C98 A;  7CAT A;  1Z6T A;  4B3R M;  3KFU G;  4OU7 A;  4LJ9 A;  2HL7 A;  5BPV A;  4LG2 A;  4QHS A;  3SYK A;  3KOX E;  1T3T A;  5E26 A;  1XWI A;  3D8B A;  1YU0 A;  5EJC A;  4FD2 A;  3GLG B;  1XC8 A;  3FKE A;  4B3M M;  4G6Z A;  4LJ5 A;  2OQ4 A;  4L16 A;  1E9S A;  4OJL A;  4LGY A;  2JE5 A;  3GQ4 A;  2UUC M;  2VQF M;  2G5G X;  4B7F A;  3MK6 A;  2V1C A;  2D7H A;  4X65 M;  1Z5C A;  3K2L A;  3W0F A;  1J7K A;  3SHF A;  1JR3 D;  1TGU A;  1N32 M;  2DWZ B;  1G8P A;  3AOE A;  1VDD A;  4JXJ A;  3I51 A;  5KQD A;  2XZF A;  5LMU M;  4LF4 M;  3GRY A;  2I7N A;  2F5N A;  1Q39 A;  4EIW A;  3VK7 A;  3HHW A;  3KSX A;  4OJP A;  2C9C A;  1Z59 A;  2CV2 A;  4NOO B;  4B3S M;  4M0D A;  4R7G A;  3TWK A;  2DWM A;  1L2C A;  3L29 A;  3U6E A;  2I7P A;  4HL4 A;  4IJE A;  4DV2 M;  4B7G A;  3FTD A;  3T1Y M;  2DWN A;  2BG1 A;  1E32 A;  2H1R A;  2F5S A;  1XMQ M;  2Y2K A;  2Z7J A;  3FYC A;  2BJV A;  5ITQ A;  4IBF A;  3KS8 A;  3U6D A;  2JA2 A;  3WHK A;  2ERC A;  3FTE A;  3SMS A;  5ITT A;  2E5L M;  3SC3 A;  2R18 A;  2R46 A;  3AOG A;  5FSW A;  1KFV A;  4W5W A;  2DZN B;  4M0W A;  4DR2 M;  4LF9 M;  3GLF A;  3L2A A;  1QAO A;  4D82 A;  1NVM A;  5IRE B;  1L1Z A;  4JI3 M;  4DV3 M;  3UJN A;  2FFF B;  4MB7 A;  2M60 A;  2R4E A;  4KOD A;  3ZH9 B;  4L8R C;  1IY2 A;  5FTL A;  2YNM D;  1EE8 A;  2ZAN A;  2KRU A;  4S12 A;  5JI2 E;  2EUC A;  2DWL A;  4BBA A;  5EP3 A;  3U60 A;  4JI1 M;  3L27 A;  3TWL A;  2XSZ A;  1PJJ A;  3KP1 E;  1NJF A;  2A5Y B;  4LF5 M;  4MGY E;  1ZQ9 A;  2FFJ A;  1X37 A;  4GMQ A;  5FTM A;  3U60 B;  1G41 A;  3U6C A;  2XH9 A;  2RGH A;  3SBJ A;  1NNJ A;  4B08 A;  1HT1 E;  1ORY B;  1FNN A;  4FWH A;  4NXN M;  4IBB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...