3FKEA

Structure of the ebola vp35 interferon inhibitory domain
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
123
structure length
123
Chain Sequence
DISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Ebola VP35 interferon inhibitory domain.
pubmed doi rcsb
source organism Zaire ebolavirus - mayinga (zaire, 1976)
molecule tags Rna binding protein
molecule keywords Polymerase cofactor VP35
total genus 40
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3fkeA01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 3fkeA02
5BPVA 3L27A 4GH9A 3L28A 4IBCA 3KS4A 4GHAA 4IBIA 3L25A 4IBFA 4IJFA 3L2AA 3L29A 4IBKA 3FKEA 4IBGA 4LG2A 4IBBA 4IBEA 4GHLA 4IJEA 3L26A 4IBDA 3KS8A 4IBJA
chains in the Genus database with same CATH superfamily
3HWSA 3TWKA 2WZJA 2D49A 2O5RA 2ZM6M 3U6LA 1E6PA 1KSFX 3TWLA 2FN2A 4FCVA 3VDUA 4NZ3A 3SC3A 4PD2A 4PCZA 2Z7JA 1R2ZA 1Q39A 2FFFB 3FRHA 2DAKA 3MJ5A 4IBFA 4R7GA 3PXGA 4LZJA 2YFQA 5FTMA 2DVWB 2CFOA 2F4VM 4I8OA 4TUWA 2KEBA 2Y2QA 1QUSA 1IN5A 5L8RF 2CHGA 2Y0TA 3GRVA 2BJVA 3HKPA 2Y21A 3FRIA 4F1IA 2DZNB 4OVZA 4HMEA 4YHHM 1GOIA 4D81A 4LF7M 2L7IA 4XBOA 1QVRA 4X65M 2KXEA 4DUZM 2JCHA 2UXCM 2CHQA 1WIVA 1QDTA 2K9DA 3M7PA 1KFVA 3L27A 1N77A 5BR8M 4CJ6A 3HONA 4AW4A 2L4EA 1OKSA 2CUZA 3LCUA 1VDLA 3FYDA 4CGYB 4EIWA 4PDGA 5ITUA 1XNQM 3BXWA 3DOAA 4BLCA 2JP7A 2CV1A 2H5XA 2HWJA 2QP9X 4NYYA 1QZEA 3Q8GA 2HHHM 4LFAM 4WP2A 1QZMA 3CTWB 2D7EA 2DAIA 3THGA 4LF5M 1W1YA 2JNHA 5ITYA 3GRYA 1N36M 1C7YA 4IIWA 1XB2B 4IBEA 1IBKM 4OJ5A 4AG5A 2UUAM 2UU9M 3FTDA 1KS0A 4II7A 3SFZA 2OPFA 4JN6A 3RGSA 2Y2OA 4GC9A 3MHVC 2DXIA 3R8FA 3TL4X 1J7KA 1LTMA 4PT5A 1H0IA 3RFWA 4LF9M 3ZCBB 3SYKA 1YU0A 4Z2GA 3HHZA 4GHAA 1V92A 2OOBA 2ZANA 1Z6TA 3KOXE 3NBXX 2CV2A 2KW0A 1G4AE 4B7GA 3GQ4A 2XLJA 1XNRM 4IJFA 4NXMM 4Z2HA 4HL4A 3U6OA 3K9OA 4LFBM 2XZUA 4WURA 4F2LA 3WD4A 1DGGA 1NV8A 2V1CA 2V6ZM 4NSOB 4NY2A 1QANA 2QCUA 3HHWA 3M7GA 4LCBA 3MMPA 3KFUG 4DR6M 4KHPM 5EP1A 4L6V6 4GEWA 1HNWM 1NV9A 1NHGC 1W1PA 3AL0C 1IXRC 3B74A 3AOGA 3JR4A 3GLIB 4AKGA 1J09A 2DHRA 3AJIB 3C9PA 5EP4A 5FTLA 4XGIA 1XXHE 2KNVA 4QOSA 1L8QA 2X4AA 1D2NA 4FVMA 4KODA 2JE5A 3LVWA 5KPTA 4OVZB 3B7ZA 3K92A 4D80A 3SAVA 1E15A 4TX8A 2J7NA 2K6BA 4I4LA 3HJQA 2MROB 4IBIA 5KO3A 1YUBA 2KDLA 2KHHA 5ITRA 2EKFA 5DYIA 3L25A 2G5GX 2ZTDA 1E9SA 1TDHA 2XEPA 1EIJA 3RGPA 1Y8GA 1OJLA 3HJSA 2VDBB 4CHTB 4JI8M 2Y2NA 2R46A 2RGOA 4DV4M 2RKOA 1WGLA 2YR0A 2OOAA 3C3EA 3I4YA 5DNYA 3L26A 1C1KA 2JZ1A 4LGYA 3WHKA 2RGHA 1H8PA 2V1UA 4Z8XA 5BPVA 3M0EA 1SXJD 2LXEA 3J7BA 1KYIA 4LJ7A 3QAUA 5EXSA 2K0BX 4X64M 1ORYB 4NRVA 1GXDA 2VQEM 4G3OA 5C18A 3J7AS 2DZLA 1IY2A 2LH0A 3GLFA 1JR3E 2WSCF 2CP8A 1XWIA 4QHTA 3AOEA 2Z4SA 2UUBM 2CRUA 3KOWE 2FH0A 2FS1A 2O01F 2XSZA 4GRIA 3Q8XA 1GVNA 3GPXA 1YUEA 1OIZA 4IBBA 2G3QA 2RRUA 4JV5M 3E4RA 1GKIA 3I51A 3KDSE 4NYUA 5F3WA 2DWNA 4Y28F 2R0IA 2LWXA 2M5ZA 3A98B 4KT0F 4HMCA 2UWXA 1ZQ9A 1L2CA 4XK8F 1OTRA 2X49A 3SAWA 3TWMA 3LQQA 4IBCA 2YQZA 4NZ4A 3BBZA 2VF8A 3KP1E 4K0KM 3MQLA 1D0KA 1Z5BA 1E94E 2DHYA 1EE8A 3KVWA 3GLHA 4B3MM 4DV1M 3HHXA 2FFJA 4FWHA 4B08A 1NJGA 2OQ4A 4P16A 2MH8A 2MJ5B 2ZBKB 1E6NA 1G3IA 1T3TA 4GC5A 3E9SA 2Y0QA 1WXQA 4JXJA 3T1HM 3OTOM 2ZAMA 2DKLA 4DR3M 4B7FA 1IY0A 1GL6A 1ZMVA 3VDPA 3UK6A 4L8RC 4JI0M 1H0GA 4JI7M 4M0DA 4LZZA 1IN7A 1TH2A 2JY8A 2L09A 3B89A 3F92A 3FUTA 3QYBA 3LMMA 3AV0A 2Y2KA 4A3VB 2QBYB 3SAUA 1JR3A 3T15A 2CWBA 2EJSA 1HT2E 2XH9A 3U60A 3KW6A 3U61A 1TF0B 4WW0A 2CEAA 2HL7A 2R18A 2ZTCA 3L2AA 1Q3BA 1TH4A 1E6RA 1O6IA 3IECA 2KNAA 2NQ8C 3B7NA 3K1JA 5KPZA 3HJ8A 1G8PA 4NC6A 5ITTA 1QO6A 3SMPA 3N3FA 4YY3M 3GLGB 1K3WA 3FYCA 4QNLA 2QQ8A 1VQ1A 2CE7A 3JAMS 2AHMA 1IN8A 1R4GA 2Z3XA 1W5TA 3B9PA 1JB0F 3W0FA 3ILKA 3U6DA 3VK8A 1XMOM 5KQDA 2GNOA 1HQYE 4L78A 4DV2M 4G4RA 1N32M 4LF6M 1L6JA 1TTEA 3T38A 5GKNA 1SXJC 3AKZA 4Z2LA 1QAOA 1SG9A 5LMNM 2Y2LA 3J27B 2I7NA 4LJ9A 4B3TM 1XHBA 2XSZD 5KPRA 2UXDM 5C1BA 1VG5A 3FTEA 1WR1B 2C98A 2LTUA 4KO8A 4MB4A 1N75A 3FTCA 2VQFM 4JI2M 4AI6A 1YU4A 3K2LA 1IFYA 2I7PA 1HR0M 2Z4RA 3AFHA 3WD2A 2DZOB 3FUUA 3LQRA 1XC8A 3SHFA 4DV7M 1XXHA 4FD2A 5JI3E 2WSFF 4LJ5A 3GQ3A 3HU1A 1Q02A 2LVQD 3GRUA 1J5EM 1NNUC 1R7RA 5E6JA 2CHVA 1G71A 2QSFX 3CF0A 2E5LM 3CGWA 3W68A 2R6FA 4DR1M 3DA1A 1HNXM 1GJSA 3IHPA 4CIZA 3T1YM 1OFIA 1IBMM 3KXEC 2FOIC 1IBLM 5EP2A 2XGNA 4LFCM 4REZA 2LNHC 2EKKA 2P5TA 2G8LA 4NXNM 1VEKA 5FTKA 3U5ZA 1MJGM 3PFIA 2BNKA 2BJWA 3BOSA 1I4WA 4L4UA 4LJ8A 2R4JA 4IBGA 2Q2EB 4GKJM 1GO5A 3SMSA 2L6OA 3GLFE 1DGBA 2BWEA 2XD5A 4GHLA 1NHWC 1PJSA 4M9SA 2JA2A 3U61B 1TR8A 4G6ZA 4LRTA 4DV0M 1W1VA 1OGGA 1IM2A 1GLNA 1T6OA 1PJTA 4DR7M 1D0MA 1NSFA 2Y2JA 4I81A 4I5SA 1OAOC 3U6CA 3U6PA 2MR9A 1CUKA 5E26A 4PDIA 1QDRA 1Z5CA 3D8BA 2EUCA 4OJPA 3EIHA 2JY7A 1ZMUA 2YNMD 3FUWA 3GRRA 3K8ZA 3UGJA 1R2YA 3HHYA 4IBKA 5DYGA 1DO0A 1P3QQ 1VEJA 1Z59A 3FUXA 3KSXA 3LCVB 4HLQA 4GIPA 4MGHA 2L2DA 3E46A 3U6MA 4FCWA 3LVVA 3H4JA 2LVNC 3PNVA 3QWLA 1CXWA 3ZH9B 4CISA 1T43A 4Z2JA 1A5TA 3VLFB 4OUIA 1MN3A 2HKJA 1OIPA 1PGYA 3HY5A 4RF1A 4RKUF 4DBGB 4HEOA 4W5WA 4OJLA 1DV0A 3WX7A 4IBJA 2O25A 3U6QA 2VF7A 2WSEF 3DZDA 4FW9A 5A2QS 1RU3A 4GH9A 1XMQM 3NBIA 2GQFA 2JWSA 1QAMA 2UXBM 2R45A 2BG1A 5IWAM 3CF2A 3PVSA 1NY6A 2LHGA 2DAGA 3VKHA 4OJOA 1DGHA 5DFLA 3VK7A 1L2DA 1QAQA 1PJIA 2DWZB 2Y2MA 3GLIE 2L4FA 4P17A 3HU2A 2RTSA 4GMQA 2D7HA 2J7OA 5EP3A 2M60A 5EJCA 3I01M 1R5LA 2R65A 3A42A 3J80S 1R6BX 1QQWA 3U5ZB 2DENA 4IBDA 3GPYA 2F5SA 1HNZM 2HCBA 4DV3M 4OU7A 4KLNA 1X37A 3J2PB 4DR2M 1IN6A 1BVSA 4DR5M 1WGNA 5KQ8A 1HT1E 1YU2A 3SASA 3JR5A 3T6PA 4DV5M 1QYRA 4JI3M 3ZC7B 2XF3A 2C5RA 1IN4A 1E8BA 2Y2IA 4QNRA 1IXSA 2W82A 1PDCA 1VEGA 4ANRA 1EAKA 1XXHB 2F5NA 2QZ4A 2Y2HA 3UZUA 2L7HA 2KRUA 3NWLA 2B3TA 4HMDA 4JI4M 1E88A 2R44A 1DGHB 2HAKA 3A46A 5IZ7D 3QYEA 4IJEA 3TQSA 3HGIA 1GJTA 3SARA 3KS8A 3WD1A 3HSHA 4D82A 3D8LA 5JI2E 2XD1A 2LHCA 3M6AA 1AUAA 4NZ1A 2Y20A 1NJFA 1SXJE 3V76A 4AKIA 3SYLA 2VIIA 4OX9M 1E32A 2H1RA 1UR9A 2LBCA 4DV6M 4B7HA 1DGFA 2DNAA 2A5YB 4JI6M 2C99A 4JYAM 2Z8YM 3C3DA 1Z5AA 2D7GA 3J81S 1OGBA 5IT9S 1VDDA 4MGKE 4NOOB 2C96A 2FNAA 1H6UA 2XFTA 2XFSA 1OFHA 3PNYA 5FTJA 1GABA 1ED7A 2JUJA 1N33M 2F5QA 1YU3A 1IXSB 4MB7A 3FUVA 1FJGM 1IY1A 4MM3B 4OJ6A 4OW0A 1V33A 3SHGB 2X8AA 3HU3A 3AOEC 4Q7JA 1NO1A 3H4MA 3WD3A 4QHSA 1ZV1A 1IQPA 5H37D 4G4NA 3UJNA 1HQCA 1OQYA 1L1ZA 4NZ5A 4MGYE 4BB9A 2KRKA 5FSWA 3HZJA 3GLFB 2K47A 1HJPA 5EXPA 4M9XA 3WHLA 3SATA 4DR4M 3KOZE 3TPZA 1NVMA 2DAMA 1JR3D 4DUYM 1N34M 3U6EA 3WD0A 2JY5A 1YLAA 4R71A 4FWDA 1L2BA 3I4VA 5IREB 7CATA 1E9RA 1SXJB 2QNJA 2JXNA 2QBYA 4M9ZA 3UMMA 4ITQA 1NNJA 3DFZA 2EO2A 4MB5A 2APLA 3U60B 2KA6B 2MGWA 2QPAA 1AIPC 3FTFA 1UR8A 4GITA 4BBAA 2CV0A 1K3XA 3FD9A 4Z2KA 4JI1M 1MX0A 1TH3A 4M0WA 3W67A 1TGUA 4UN2B 1FNNA 2R4EA 2QENA 3HX3A 4L16A 3GPPA 1L1TA 8CATA 3GLGA 2DWMA 2XZFA 1DO2A 3FE3A 4LJAA 4FCTA 5EQTA 5ITXE 1ZMWA 4G4QA 3CF6E 4QOZC 1CK7A 1YU1A 1JQJC 2V5OA 2KNZA 2C9OA 3GLHB 5EXXA 2QHOB 4B3RM 3L28A 4LJ4A 3A45A 3LW5F 3KS4A 3SBJA 1Q3CA 3B7QA 2F5PA 2LVAA 5EXTA 1E6ZA 3EIEA 3GPUA 4Z2IA 1G41A 2Y2PA 3KSJA 2FE8A 2JY6B 1V34A 4ZPXA 5ITQA 1S3SA 3L29A 2OO9A 2R62A 4QNMA 4L15A 4NRWA 4LG2A 1J7MA 3K9PA 3GP1A 3KP0E 1SXJA 1D0LA 4MGZE 4Z6YA 1F4IA 4AKHA 2BWBA 2KZUA 3TE6A 4B3SM 1PRBA 1GL7A 1YSYA 3IG8A 4NL4H 2N35A 1LV7A 3MK6A 4X66M 2C9CA 4JI5M 2F5OA 2LVPC 5ITXA 3W0LB 4LJ6A 4RNAA 1UFZA 1ZAEA 1QUTA 1WHCA 3VFDA 4MGIE 3GLGE 2ERCA 2J5YA 1TDZA 1K82A 2DWLA 2Y2GA 1GPFA 3GQ5A 2DAEA 1PM5A 3ZQJA 4LF4M 4AZFA 4AQYM 1OAIA 4AG6A 5LMUM 1EFUB 2UUCM 4MH0E 3GLIA 4GKKM 2KZSA 1W1TA 4RF0A 1YE9A 1G59A 2ZAOA 4LGMA 1MU5A 2JZ0A 3IG5A 5FLXS 3RE8A 3R9XB 1I94M 1W5SA 3FKEA 4S12A 3GO8A 4G4OA 1IXZA 2EA0A 3GLHE 2IOUA 4X62M 1WJ7A 4LY6A 4LF8M 4FWGA 3KOYE 3C58A 5FTNA 3U6SA 3VKGA 1NY5A 3I04M 1AIWA 2DI0A 1PJJA 1N78A 4MB3A 4LRSA 3E21A 1UM8A 4R3DA 1PJQA 2LVOC 4NSRA
chains in the Genus database with same CATH topology
3HWSA 3TWKA 2O5RA 2ZM6M 3U6LA 1KSFX 3TWLA 4NZ3A 4FCVA 3VDUA 3SC3A 4PD2A 4PCZA 2Z7JA 1R2ZA 1Q39A 2FFFB 3MJ5A 4IBFA 4R7GA 3PXGA 4LZJA 2YFQA 5FTMA 2DVWB 2CFOA 2F4VM 4I8OA 4TUWA 2KEBA 2Y2QA 1IN5A 2CHGA 2Y0TA 3GRVA 2BJVA 3HKPA 2Y21A 2DZNB 4OVZA 4YHHM 4D81A 4LF7M 2L7IA 4XBOA 1QVRA 4X65M 2KXEA 4DUZM 2JCHA 2UXCM 2CHQA 1KFVA 3L27A 1N77A 5BR8M 3HONA 4AW4A 2CUZA 3FYDA 4CGYB 4EIWA 4PDGA 5ITUA 1XNQM 4AI6A 4BLCA 3DOAA 2CV1A 4NYYA 2QP9X 2HHHM 4LFAM 1QZMA 3CTWB 2D7EA 3THGA 4LF5M 5ITYA 3GRYA 1N36M 4IIWA 4IBEA 1IBKM 4OJ5A 4AG5A 2UUAM 2UU9M 3FTDA 4II7A 3SFZA 2OPFA 4JN6A 3RGSA 2Y2OA 4GC9A 3MHVC 2DXIA 3R8FA 3TL4X 1J7KA 4PT5A 3RFWA 4LF9M 3ZCBB 3SYKA 1YU0A 3HHZA 4GHAA 2ZANA 3KOXE 1Z6TA 2CV2A 2KW0A 1G4AE 4B7GA 3GQ4A 2XLJA 1XNRM 4IJFA 4NXMM 4HL4A 3U6OA 4LFBM 2XZUA 4WURA 1DGGA 2V1CA 2V6ZM 4NSOB 4NY2A 1QANA 2QCUA 3HHWA 3M7GA 4LCBA 3KFUG 4DR6M 4KHPM 5EP1A 1HNWM 1NHGC 3AL0C 1IXRC 3JR4A 3AOGA 4AKGA 3GLIB 1J09A 2DHRA 3AJIB 5FTLA 5EP4A 5H37D 4XGIA 4QOSA 1L8QA 2X4AA 1D2NA 4FVMA 4KODA 2JE5A 3LVWA 5KPTA 4OVZB 3K92A 4D80A 3SAVA 2J7NA 4I4LA 3HJQA 4IBIA 5KO3A 1YUBA 5ITRA 5DYIA 3L25A 2G5GX 1E9SA 1TDHA 2XEPA 3RGPA 4CHTB 1OJLA 3HJSA 2Y2NA 4JI8M 2R46A 2RGOA 4DV4M 2RKOA 1UM8A 2YR0A 3I4YA 5DNYA 3L26A 1C1KA 4LGYA 3WHKA 2RGHA 2V1UA 4Z8XA 5BPVA 3M0EA 1SXJD 2LXEA 3J7BA 1KYIA 4LJ7A 3QAUA 5EXSA 4X64M 1ORYB 4NRVA 2VQEM 5C18A 3J7AS 2LH0A 1IY2A 3GLFA 1XWIA 4QHTA 3AOEA 2Z4SA 2UUBM 3KOWE 2XSZA 4GRIA 3Q8XA 1GVNA 3GPXA 1YUEA 4IBBA 4JV5M 3E4RA 1GKIA 3I51A 3KDSE 5F3WA 2DWNA 2LWXA 2M5ZA 3A98B 2UWXA 1ZQ9A 1L2CA 2X49A 3SAWA 3TWMA 3LQQA 4IBCA 2YQZA 4NZ4A 3KP1E 4K0KM 1Z5BA 1E94E 1EE8A 3KVWA 3GLHA 4B3MM 4DV1M 3HHXA 2FFJA 4FWHA 4B08A 1NJGA 2OQ4A 4P16A 2ZBKB 1G3IA 1T3TA 4GC5A 3E9SA 2Y0QA 1WXQA 4JXJA 3T1HM 3OTOM 2ZAMA 4DR3M 4B7FA 1IY0A 1GL6A 3VDPA 3UK6A 4L8RC 4JI0M 4JI7M 4M0DA 4LZZA 1IN7A 1TH2A 2L09A 3FUTA 5EP2A 2Y2KA 3LMMA 3AV0A 4A3VB 2QBYB 3SAUA 1JR3A 3T15A 1HT2E 2XH9A 3U60A 3KW6A 3U61A 4WW0A 2CEAA 2HL7A 2R18A 3L2AA 1Q3BA 1TH4A 3K1JA 2NQ8C 5KPZA 5ITTA 3HJ8A 1G8PA 3SMPA 3N3FA 4YY3M 3GLGB 1K3WA 3FYCA 4QNLA 2CE7A 3JAMS 1IN8A 2AHMA 2Z3XA 3U6DA 1W5TA 3B9PA 3W0FA 3VK8A 3ILKA 1XMOM 5KQDA 4L78A 1HQYE 4DV2M 4G4RA 1N32M 4LF6M 3T38A 3AKZA 5GKNA 1SXJC 1QAOA 5LMNM 2Y2LA 3J27B 2I7NA 4LJ9A 4B3TM 1XHBA 2XSZD 5KPRA 2UXDM 5C1BA 3FTEA 2C98A 4KO8A 1N75A 3FTCA 2VQFM 4JI2M 1YU4A 3K2LA 2I7PA 1HR0M 2Z4RA 3AFHA 2DZOB 3FUUA 1XC8A 3SHFA 4DV7M 1XXHA 4FD2A 5JI3E 4LJ5A 3GQ3A 3HU1A 3GRUA 1J5EM 1NNUC 1R7RA 5E6JA 2CHVA 2E5LM 3CF0A 4DR1M 3DA1A 1HNXM 3T1YM 1OFIA 1IBMM 3KXEC 2FOIC 1IBLM 2XGNA 4LFCM 4REZA 2LNHC 2P5TA 2G8LA 4NXNM 5FTKA 3U5ZA 3PFIA 2BNKA 2BJWA 3BOSA 1I4WA 4L4UA 4LJ8A 2R4JA 4IBGA 2Q2EB 4GKJM 3SMSA 2L6OA 1DGBA 2XD5A 4GHLA 1NHWC 4M9SA 3U61B 2JA2A 4G6ZA 4LRTA 4DV0M 1IM2A 1GLNA 4DR7M 1NSFA 2Y2JA 4I81A 4I5SA 3U6CA 3U6PA 5E26A 4PDIA 1Z5CA 3D8BA 2EUCA 4OJPA 3EIHA 2YNMD 3FUWA 3GRRA 3K8ZA 3UGJA 1R2YA 3HHYA 4IBKA 5DYGA 1DO0A 1Z59A 3FUXA 3KSXA 4HLQA 4GIPA 4MGHA 3U6MA 4FCWA 3LVVA 3PNVA 3QWLA 3ZH9B 4CISA 3VLFB 4OUIA 2HKJA 4RF1A 4OJLA 4W5WA 3WX7A 4IBJA 3U6QA 4FW9A 3DZDA 5A2QS 4GH9A 1XMQM 3NBIA 1QAMA 2UXBM 2R45A 2BG1A 5IWAM 3CF2A 3PVSA 1NY6A 3VKHA 4OJOA 1DGHA 3VK7A 1L2DA 1QAQA 1PJIA 2DWZB 2Y2MA 3HU2A 4GMQA 2D7HA 2J7OA 5EP3A 2M60A 5EJCA 3A42A 2R65A 3J80S 1R6BX 1QQWA 3U5ZB 4IBDA 3GPYA 2F5SA 1HNZM 2HCBA 4DV3M 4OU7A 4KLNA 1X37A 3J2PB 4DR2M 1IN6A 4DR5M 5KQ8A 1HT1E 1YU2A 3SASA 3JR5A 4DV5M 1QYRA 4JI3M 3ZC7B 2XF3A 2C5RA 1IN4A 2Y2IA 4QNRA 2W82A 1XXHB 2F5NA 2QZ4A 2Y2HA 3UZUA 2L7HA 2KRUA 3NWLA 4JI4M 1DGHB 3A46A 5IZ7D 4IJEA 3TQSA 3HGIA 3SARA 3KS8A 3HSHA 4D82A 3D8LA 5JI2E 2XD1A 3M6AA 4NZ1A 2Y20A 1NJFA 1SXJE 4AKIA 3SYLA 2VIIA 4OX9M 1E32A 2H1RA 4DV6M 4B7HA 1DGFA 4JI6M 2A5YB 2C99A 4JYAM 1Z5AA 2D7GA 3J81S 5IT9S 1VDDA 4MGKE 4NOOB 2C96A 2FNAA 1H6UA 2XFTA 2XFSA 1OFHA 3PNYA 5FTJA 1N33M 1YU3A 2F5QA 1IXSB 4MB7A 3FUVA 1FJGM 1IY1A 4MM3B 4OJ6A 4OW0A 3SHGB 2X8AA 3HU3A 3AOEC 3H4MA 4QHSA 1IQPA 4G4NA 3UJNA 1HQCA 1L1ZA 4NZ5A 4MGYE 4BB9A 2KRKA 5FSWA 3GLFB 2K47A 3WHLA 5EXPA 4M9XA 3SATA 4DR4M 3KOZE 3TPZA 1NVMA 1JR3D 4DUYM 1N34M 3U6EA 4FWDA 1L2BA 3I4VA 5IREB 7CATA 1E9RA 1SXJB 2QBYA 4M9ZA 3UMMA 4ITQA 1NNJA 3DFZA 2EO2A 3U60B 2KA6B 2QPAA 3FTFA 4GITA 4BBAA 2CV0A 1K3XA 3FD9A 4JI1M 1MX0A 1TH3A 4M0WA 3GPPA 1TGUA 1FNNA 2R4EA 2QENA 4L16A 1L1TA 8CATA 3GLGA 2DWMA 2XZFA 1DO2A 5EQTA 4LJAA 4FCTA 5ITXE 1YU1A 4G4QA 4QOZC 3CF6E 1JQJC 2C9OA 3GLHB 5EXXA 4B3RM 3L28A 4LJ4A 3A45A 3SBJA 3KS4A 2F5PA 1Q3CA 4NYUA 5EXTA 3EIEA 3GPUA 1G41A 2Y2PA 3KSJA 2FE8A 4ZPXA 5ITQA 1S3SA 3L29A 2R62A 4QNMA 4L15A 4NRWA 4LG2A 3GP1A 3KP0E 1SXJA 4MGZE 4Z6YA 4AKHA 2KZUA 3TE6A 4B3SM 3IG8A 1GL7A 1YSYA 4NL4H 4X66M 3MK6A 1LV7A 4JI5M 2C9CA 2F5OA 5ITXA 3W0LB 4LJ6A 4RNAA 3VFDA 1ZAEA 2DWLA 1K82A 4MGIE 1TDZA 2ERCA 2Y2GA 3GQ5A 1PM5A 4LF4M 4AZFA 4AQYM 4AG6A 5LMUM 2UUCM 4MH0E 3GLIA 4GKKM 2KZSA 4RF0A 1YE9A 1G59A 2ZAOA 4LGMA 1MU5A 3IG5A 5FLXS 3RE8A 3R9XB 1I94M 1W5SA 3FKEA 4S12A 3GO8A 4G4OA 1IXZA 2EA0A 2IOUA 4X62M 4LY6A 4LF8M 4FWGA 3KOYE 3C58A 5FTNA 3U6SA 3VKGA 1NY5A 1PJJA 1N78A 4LRSA 3LQRA 4R3DA 4NSRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BPV A;  3L27 A;  4GH9 A;  3L28 A;  4IBC A;  3KS4 A;  4GHA A;  4IBI A;  3L25 A;  4IBF A;  4IJF A;  3L2A A;  3L29 A;  4IBK A;  3FKE A;  4IBG A;  4LG2 A;  4IBB A;  4IBE A;  4GHL A;  4IJE A;  3L26 A;  4IBD A;  3KS8 A;  4IBJ A; 
#chains in the Genus database with same CATH topology
 3HWS A;  3TWK A;  2WZJ A;  2D49 A;  2O5R A;  2ZM6 M;  3U6L A;  1E6P A;  1KSF X;  3TWL A;  2FN2 A;  4FCV A;  3VDU A;  4NZ3 A;  3SC3 A;  4PD2 A;  4PCZ A;  2Z7J A;  1R2Z A;  1Q39 A;  2FFF B;  3FRH A;  2DAK A;  3MJ5 A;  4IBF A;  4R7G A;  3PXG A;  4LZJ A;  2YFQ A;  5FTM A;  2DVW B;  2CFO A;  2F4V M;  4I8O A;  4TUW A;  2KEB A;  2Y2Q A;  1QUS A;  1IN5 A;  5L8R F;  2CHG A;  2Y0T A;  3GRV A;  2BJV A;  3HKP A;  2Y21 A;  3FRI A;  4F1I A;  2DZN B;  4OVZ A;  4HME A;  4YHH M;  1GOI A;  4D81 A;  4LF7 M;  2L7I A;  4XBO A;  1QVR A;  4X65 M;  2KXE A;  4DUZ M;  2JCH A;  2UXC M;  2CHQ A;  1WIV A;  1QDT A;  2K9D A;  3M7P A;  1KFV A;  3L27 A;  1N77 A;  5BR8 M;  4CJ6 A;  3HON A;  4AW4 A;  2L4E A;  1OKS A;  2CUZ A;  3LCU A;  1VDL A;  3FYD A;  4CGY B;  4EIW A;  4PDG A;  5ITU A;  1XNQ M;  3BXW A;  3DOA A;  4BLC A;  2JP7 A;  2CV1 A;  2H5X A;  2HWJ A;  2QP9 X;  4NYY A;  1QZE A;  3Q8G A;  2HHH M;  4LFA M;  4WP2 A;  1QZM A;  3CTW B;  2D7E A;  2DAI A;  3THG A;  4LF5 M;  1W1Y A;  2JNH A;  5ITY A;  3GRY A;  1N36 M;  1C7Y A;  4IIW A;  1XB2 B;  4IBE A;  1IBK M;  4OJ5 A;  4AG5 A;  2UUA M;  2UU9 M;  3FTD A;  1KS0 A;  4II7 A;  3SFZ A;  2OPF A;  4JN6 A;  3RGS A;  2Y2O A;  4GC9 A;  3MHV C;  2DXI A;  3R8F A;  3TL4 X;  1J7K A;  1LTM A;  4PT5 A;  1H0I A;  3RFW A;  4LF9 M;  3ZCB B;  3SYK A;  1YU0 A;  4Z2G A;  3HHZ A;  4GHA A;  1V92 A;  2OOB A;  2ZAN A;  1Z6T A;  3KOX E;  3NBX X;  2CV2 A;  2KW0 A;  1G4A E;  4B7G A;  3GQ4 A;  2XLJ A;  1XNR M;  4IJF A;  4NXM M;  4Z2H A;  4HL4 A;  3U6O A;  3K9O A;  4LFB M;  2XZU A;  4WUR A;  4F2L A;  3WD4 A;  1DGG A;  1NV8 A;  2V1C A;  2V6Z M;  4NSO B;  4NY2 A;  1QAN A;  2QCU A;  3HHW A;  3M7G A;  4LCB A;  3MMP A;  3KFU G;  4DR6 M;  4KHP M;  5EP1 A;  4L6V 6;  4GEW A;  1HNW M;  1NV9 A;  1NHG C;  1W1P A;  3AL0 C;  1IXR C;  3B74 A;  3AOG A;  3JR4 A;  3GLI B;  4AKG A;  1J09 A;  2DHR A;  3AJI B;  3C9P A;  5EP4 A;  5FTL A;  4XGI A;  1XXH E;  2KNV A;  4QOS A;  1L8Q A;  2X4A A;  1D2N A;  4FVM A;  4KOD A;  2JE5 A;  3LVW A;  5KPT A;  4OVZ B;  3B7Z A;  3K92 A;  4D80 A;  3SAV A;  1E15 A;  4TX8 A;  2J7N A;  2K6B A;  4I4L A;  3HJQ A;  2MRO B;  4IBI A;  5KO3 A;  1YUB A;  2KDL A;  2KHH A;  5ITR A;  2EKF A;  5DYI A;  3L25 A;  2G5G X;  2ZTD A;  1E9S A;  1TDH A;  2XEP A;  1EIJ A;  3RGP A;  1Y8G A;  1OJL A;  3HJS A;  2VDB B;  4CHT B;  4JI8 M;  2Y2N A;  2R46 A;  2RGO A;  4DV4 M;  2RKO A;  1WGL A;  2YR0 A;  2OOA A;  3C3E A;  3I4Y A;  5DNY A;  3L26 A;  1C1K A;  2JZ1 A;  4LGY A;  3WHK A;  2RGH A;  1H8P A;  2V1U A;  4Z8X A;  5BPV A;  3M0E A;  1SXJ D;  2LXE A;  3J7B A;  1KYI A;  4LJ7 A;  3QAU A;  5EXS A;  2K0B X;  4X64 M;  1ORY B;  4NRV A;  1GXD A;  2VQE M;  4G3O A;  5C18 A;  3J7A S;  2DZL A;  1IY2 A;  2LH0 A;  3GLF A;  1JR3 E;  2WSC F;  2CP8 A;  1XWI A;  4QHT A;  3AOE A;  2Z4S A;  2UUB M;  2CRU A;  3KOW E;  2FH0 A;  2FS1 A;  2O01 F;  2XSZ A;  4GRI A;  3Q8X A;  1GVN A;  3GPX A;  1YUE A;  1OIZ A;  4IBB A;  2G3Q A;  2RRU A;  4JV5 M;  3E4R A;  1GKI A;  3I51 A;  3KDS E;  4NYU A;  5F3W A;  2DWN A;  4Y28 F;  2R0I A;  2LWX A;  2M5Z A;  3A98 B;  4KT0 F;  4HMC A;  2UWX A;  1ZQ9 A;  1L2C A;  4XK8 F;  1OTR A;  2X49 A;  3SAW A;  3TWM A;  3LQQ A;  4IBC A;  2YQZ A;  4NZ4 A;  3BBZ A;  2VF8 A;  3KP1 E;  4K0K M;  3MQL A;  1D0K A;  1Z5B A;  1E94 E;  2DHY A;  1EE8 A;  3KVW A;  3GLH A;  4B3M M;  4DV1 M;  3HHX A;  2FFJ A;  4FWH A;  4B08 A;  1NJG A;  2OQ4 A;  4P16 A;  2MH8 A;  2MJ5 B;  2ZBK B;  1E6N A;  1G3I A;  1T3T A;  4GC5 A;  3E9S A;  2Y0Q A;  1WXQ A;  4JXJ A;  3T1H M;  3OTO M;  2ZAM A;  2DKL A;  4DR3 M;  4B7F A;  1IY0 A;  1GL6 A;  1ZMV A;  3VDP A;  3UK6 A;  4L8R C;  4JI0 M;  1H0G A;  4JI7 M;  4M0D A;  4LZZ A;  1IN7 A;  1TH2 A;  2JY8 A;  2L09 A;  3B89 A;  3F92 A;  3FUT A;  3QYB A;  3LMM A;  3AV0 A;  2Y2K A;  4A3V B;  2QBY B;  3SAU A;  1JR3 A;  3T15 A;  2CWB A;  2EJS A;  1HT2 E;  2XH9 A;  3U60 A;  3KW6 A;  3U61 A;  1TF0 B;  4WW0 A;  2CEA A;  2HL7 A;  2R18 A;  2ZTC A;  3L2A A;  1Q3B A;  1TH4 A;  1E6R A;  1O6I A;  3IEC A;  2KNA A;  2NQ8 C;  3B7N A;  3K1J A;  5KPZ A;  3HJ8 A;  1G8P A;  4NC6 A;  5ITT A;  1QO6 A;  3SMP A;  3N3F A;  4YY3 M;  3GLG B;  1K3W A;  3FYC A;  4QNL A;  2QQ8 A;  1VQ1 A;  2CE7 A;  3JAM S;  2AHM A;  1IN8 A;  1R4G A;  2Z3X A;  1W5T A;  3B9P A;  1JB0 F;  3W0F A;  3ILK A;  3U6D A;  3VK8 A;  1XMO M;  5KQD A;  2GNO A;  1HQY E;  4L78 A;  4DV2 M;  4G4R A;  1N32 M;  4LF6 M;  1L6J A;  1TTE A;  3T38 A;  5GKN A;  1SXJ C;  3AKZ A;  4Z2L A;  1QAO A;  1SG9 A;  5LMN M;  2Y2L A;  3J27 B;  2I7N A;  4LJ9 A;  4B3T M;  1XHB A;  2XSZ D;  5KPR A;  2UXD M;  5C1B A;  1VG5 A;  3FTE A;  1WR1 B;  2C98 A;  2LTU A;  4KO8 A;  4MB4 A;  1N75 A;  3FTC A;  2VQF M;  4JI2 M;  4AI6 A;  1YU4 A;  3K2L A;  1IFY A;  2I7P A;  1HR0 M;  2Z4R A;  3AFH A;  3WD2 A;  2DZO B;  3FUU A;  3LQR A;  1XC8 A;  3SHF A;  4DV7 M;  1XXH A;  4FD2 A;  5JI3 E;  2WSF F;  4LJ5 A;  3GQ3 A;  3HU1 A;  1Q02 A;  2LVQ D;  3GRU A;  1J5E M;  1NNU C;  1R7R A;  5E6J A;  2CHV A;  1G71 A;  2QSF X;  3CF0 A;  2E5L M;  3CGW A;  3W68 A;  2R6F A;  4DR1 M;  3DA1 A;  1HNX M;  1GJS A;  3IHP A;  4CIZ A;  3T1Y M;  1OFI A;  1IBM M;  3KXE C;  2FOI C;  1IBL M;  5EP2 A;  2XGN A;  4LFC M;  4REZ A;  2LNH C;  2EKK A;  2P5T A;  2G8L A;  4NXN M;  1VEK A;  5FTK A;  3U5Z A;  1MJG M;  3PFI A;  2BNK A;  2BJW A;  3BOS A;  1I4W A;  4L4U A;  4LJ8 A;  2R4J A;  4IBG A;  2Q2E B;  4GKJ M;  1GO5 A;  3SMS A;  2L6O A;  3GLF E;  1DGB A;  2BWE A;  2XD5 A;  4GHL A;  1NHW C;  1PJS A;  4M9S A;  2JA2 A;  3U61 B;  1TR8 A;  4G6Z A;  4LRT A;  4DV0 M;  1W1V A;  1OGG A;  1IM2 A;  1GLN A;  1T6O A;  1PJT A;  4DR7 M;  1D0M A;  1NSF A;  2Y2J A;  4I81 A;  4I5S A;  1OAO C;  3U6C A;  3U6P A;  2MR9 A;  1CUK A;  5E26 A;  4PDI A;  1QDR A;  1Z5C A;  3D8B A;  2EUC A;  4OJP A;  3EIH A;  2JY7 A;  1ZMU A;  2YNM D;  3FUW A;  3GRR A;  3K8Z A;  3UGJ A;  1R2Y A;  3HHY A;  4IBK A;  5DYG A;  1DO0 A;  1P3Q Q;  1VEJ A;  1Z59 A;  3FUX A;  3KSX A;  3LCV B;  4HLQ A;  4GIP A;  4MGH A;  2L2D A;  3E46 A;  3U6M A;  4FCW A;  3LVV A;  3H4J A;  2LVN C;  3PNV A;  3QWL A;  1CXW A;  3ZH9 B;  4CIS A;  1T43 A;  4Z2J A;  1A5T A;  3VLF B;  4OUI A;  1MN3 A;  2HKJ A;  1OIP A;  1PGY A;  3HY5 A;  4RF1 A;  4RKU F;  4DBG B;  4HEO A;  4W5W A;  4OJL A;  1DV0 A;  3WX7 A;  4IBJ A;  2O25 A;  3U6Q A;  2VF7 A;  2WSE F;  3DZD A;  4FW9 A;  5A2Q S;  1RU3 A;  4GH9 A;  1XMQ M;  3NBI A;  2GQF A;  2JWS A;  1QAM A;  2UXB M;  2R45 A;  2BG1 A;  5IWA M;  3CF2 A;  3PVS A;  1NY6 A;  2LHG A;  2DAG A;  3VKH A;  4OJO A;  1DGH A;  5DFL A;  3VK7 A;  1L2D A;  1QAQ A;  1PJI A;  2DWZ B;  2Y2M A;  3GLI E;  2L4F A;  4P17 A;  3HU2 A;  2RTS A;  4GMQ A;  2D7H A;  2J7O A;  5EP3 A;  2M60 A;  5EJC A;  3I01 M;  1R5L A;  2R65 A;  3A42 A;  3J80 S;  1R6B X;  1QQW A;  3U5Z B;  2DEN A;  4IBD A;  3GPY A;  2F5S A;  1HNZ M;  2HCB A;  4DV3 M;  4OU7 A;  4KLN A;  1X37 A;  3J2P B;  4DR2 M;  1IN6 A;  1BVS A;  4DR5 M;  1WGN A;  5KQ8 A;  1HT1 E;  1YU2 A;  3SAS A;  3JR5 A;  3T6P A;  4DV5 M;  1QYR A;  4JI3 M;  3ZC7 B;  2XF3 A;  2C5R A;  1IN4 A;  1E8B A;  2Y2I A;  4QNR A;  1IXS A;  2W82 A;  1PDC A;  1VEG A;  4ANR A;  1EAK A;  1XXH B;  2F5N A;  2QZ4 A;  2Y2H A;  3UZU A;  2L7H A;  2KRU A;  3NWL A;  2B3T A;  4HMD A;  4JI4 M;  1E88 A;  2R44 A;  1DGH B;  2HAK A;  3A46 A;  5IZ7 D;  3QYE A;  4IJE A;  3TQS A;  3HGI A;  1GJT A;  3SAR A;  3KS8 A;  3WD1 A;  3HSH A;  4D82 A;  3D8L A;  5JI2 E;  2XD1 A;  2LHC A;  3M6A A;  1AUA A;  4NZ1 A;  2Y20 A;  1NJF A;  1SXJ E;  3V76 A;  4AKI A;  3SYL A;  2VII A;  4OX9 M;  1E32 A;  2H1R A;  1UR9 A;  2LBC A;  4DV6 M;  4B7H A;  1DGF A;  2DNA A;  2A5Y B;  4JI6 M;  2C99 A;  4JYA M;  2Z8Y M;  3C3D A;  1Z5A A;  2D7G A;  3J81 S;  1OGB A;  5IT9 S;  1VDD A;  4MGK E;  4NOO B;  2C96 A;  2FNA A;  1H6U A;  2XFT A;  2XFS A;  1OFH A;  3PNY A;  5FTJ A;  1GAB A;  1ED7 A;  2JUJ A;  1N33 M;  2F5Q A;  1YU3 A;  1IXS B;  4MB7 A;  3FUV A;  1FJG M;  1IY1 A;  4MM3 B;  4OJ6 A;  4OW0 A;  1V33 A;  3SHG B;  2X8A A;  3HU3 A;  3AOE C;  4Q7J A;  1NO1 A;  3H4M A;  3WD3 A;  4QHS A;  1ZV1 A;  1IQP A;  5H37 D;  4G4N A;  3UJN A;  1HQC A;  1OQY A;  1L1Z A;  4NZ5 A;  4MGY E;  4BB9 A;  2KRK A;  5FSW A;  3HZJ A;  3GLF B;  2K47 A;  1HJP A;  5EXP A;  4M9X A;  3WHL A;  3SAT A;  4DR4 M;  3KOZ E;  3TPZ A;  1NVM A;  2DAM A;  1JR3 D;  4DUY M;  1N34 M;  3U6E A;  3WD0 A;  2JY5 A;  1YLA A;  4R71 A;  4FWD A;  1L2B A;  3I4V A;  5IRE B;  7CAT A;  1E9R A;  1SXJ B;  2QNJ A;  2JXN A;  2QBY A;  4M9Z A;  3UMM A;  4ITQ A;  1NNJ A;  3DFZ A;  2EO2 A;  4MB5 A;  2APL A;  3U60 B;  2KA6 B;  2MGW A;  2QPA A;  1AIP C;  3FTF A;  1UR8 A;  4GIT A;  4BBA A;  2CV0 A;  1K3X A;  3FD9 A;  4Z2K A;  4JI1 M;  1MX0 A;  1TH3 A;  4M0W A;  3W67 A;  1TGU A;  4UN2 B;  1FNN A;  2R4E A;  2QEN A;  3HX3 A;  4L16 A;  3GPP A;  1L1T A;  8CAT A;  3GLG A;  2DWM A;  2XZF A;  1DO2 A;  3FE3 A;  4LJA A;  4FCT A;  5EQT A;  5ITX E;  1ZMW A;  4G4Q A;  3CF6 E;  4QOZ C;  1CK7 A;  1YU1 A;  1JQJ C;  2V5O A;  2KNZ A;  2C9O A;  3GLH B;  5EXX A;  2QHO B;  4B3R M;  3L28 A;  4LJ4 A;  3A45 A;  3LW5 F;  3KS4 A;  3SBJ A;  1Q3C A;  3B7Q A;  2F5P A;  2LVA A;  5EXT A;  1E6Z A;  3EIE A;  3GPU A;  4Z2I A;  1G41 A;  2Y2P A;  3KSJ A;  2FE8 A;  2JY6 B;  1V34 A;  4ZPX A;  5ITQ A;  1S3S A;  3L29 A;  2OO9 A;  2R62 A;  4QNM A;  4L15 A;  4NRW A;  4LG2 A;  1J7M A;  3K9P A;  3GP1 A;  3KP0 E;  1SXJ A;  1D0L A;  4MGZ E;  4Z6Y A;  1F4I A;  4AKH A;  2BWB A;  2KZU A;  3TE6 A;  4B3S M;  1PRB A;  1GL7 A;  1YSY A;  3IG8 A;  4NL4 H;  2N35 A;  1LV7 A;  3MK6 A;  4X66 M;  2C9C A;  4JI5 M;  2F5O A;  2LVP C;  5ITX A;  3W0L B;  4LJ6 A;  4RNA A;  1UFZ A;  1ZAE A;  1QUT A;  1WHC A;  3VFD A;  4MGI E;  3GLG E;  2ERC A;  2J5Y A;  1TDZ A;  1K82 A;  2DWL A;  2Y2G A;  1GPF A;  3GQ5 A;  2DAE A;  1PM5 A;  3ZQJ A;  4LF4 M;  4AZF A;  4AQY M;  1OAI A;  4AG6 A;  5LMU M;  1EFU B;  2UUC M;  4MH0 E;  3GLI A;  4GKK M;  2KZS A;  1W1T A;  4RF0 A;  1YE9 A;  1G59 A;  2ZAO A;  4LGM A;  1MU5 A;  2JZ0 A;  3IG5 A;  5FLX S;  3RE8 A;  3R9X B;  1I94 M;  1W5S A;  3FKE A;  4S12 A;  3GO8 A;  4G4O A;  1IXZ A;  2EA0 A;  3GLH E;  2IOU A;  4X62 M;  1WJ7 A;  4LY6 A;  4LF8 M;  4FWG A;  3KOY E;  3C58 A;  5FTN A;  3U6S A;  3VKG A;  1NY5 A;  3I04 M;  1AIW A;  2DI0 A;  1PJJ A;  1N78 A;  4MB3 A;  4LRS A;  3E21 A;  1UM8 A;  4R3D A;  1PJQ A;  2LVO C;  4NSR A; 
#chains in the Genus database with same CATH homology
 3HWS A;  3TWK A;  2O5R A;  2ZM6 M;  3U6L A;  1KSF X;  3TWL A;  4NZ3 A;  4FCV A;  3VDU A;  3SC3 A;  4PD2 A;  4PCZ A;  2Z7J A;  1R2Z A;  1Q39 A;  2FFF B;  3MJ5 A;  4IBF A;  4R7G A;  3PXG A;  4LZJ A;  2YFQ A;  5FTM A;  2DVW B;  2CFO A;  2F4V M;  4I8O A;  4TUW A;  2KEB A;  2Y2Q A;  1IN5 A;  2CHG A;  2Y0T A;  3GRV A;  2BJV A;  3HKP A;  2Y21 A;  2DZN B;  4OVZ A;  4YHH M;  4D81 A;  4LF7 M;  2L7I A;  4XBO A;  1QVR A;  4X65 M;  2KXE A;  4DUZ M;  2JCH A;  2UXC M;  2CHQ A;  1KFV A;  3L27 A;  1N77 A;  5BR8 M;  3HON A;  4AW4 A;  2CUZ A;  3FYD A;  4CGY B;  4EIW A;  4PDG A;  5ITU A;  1XNQ M;  4AI6 A;  4BLC A;  3DOA A;  2CV1 A;  4NYY A;  2QP9 X;  2HHH M;  4LFA M;  1QZM A;  3CTW B;  2D7E A;  3THG A;  4LF5 M;  5ITY A;  3GRY A;  1N36 M;  4IIW A;  4IBE A;  1IBK M;  4OJ5 A;  4AG5 A;  2UUA M;  2UU9 M;  3FTD A;  4II7 A;  3SFZ A;  2OPF A;  4JN6 A;  3RGS A;  2Y2O A;  4GC9 A;  3MHV C;  2DXI A;  3R8F A;  3TL4 X;  1J7K A;  4PT5 A;  3RFW A;  4LF9 M;  3ZCB B;  3SYK A;  1YU0 A;  3HHZ A;  4GHA A;  2ZAN A;  3KOX E;  1Z6T A;  2CV2 A;  2KW0 A;  1G4A E;  4B7G A;  3GQ4 A;  2XLJ A;  1XNR M;  4IJF A;  4NXM M;  4HL4 A;  3U6O A;  4LFB M;  2XZU A;  4WUR A;  1DGG A;  2V1C A;  2V6Z M;  4NSO B;  4NY2 A;  1QAN A;  2QCU A;  3HHW A;  3M7G A;  4LCB A;  3KFU G;  4DR6 M;  4KHP M;  5EP1 A;  1HNW M;  1NHG C;  3AL0 C;  1IXR C;  3JR4 A;  3AOG A;  4AKG A;  3GLI B;  1J09 A;  2DHR A;  3AJI B;  5FTL A;  5EP4 A;  5H37 D;  4XGI A;  4QOS A;  1L8Q A;  2X4A A;  1D2N A;  4FVM A;  4KOD A;  2JE5 A;  3LVW A;  5KPT A;  4OVZ B;  3K92 A;  4D80 A;  3SAV A;  2J7N A;  4I4L A;  3HJQ A;  4IBI A;  5KO3 A;  1YUB A;  5ITR A;  5DYI A;  3L25 A;  2G5G X;  1E9S A;  1TDH A;  2XEP A;  3RGP A;  4CHT B;  1OJL A;  3HJS A;  2Y2N A;  4JI8 M;  2R46 A;  2RGO A;  4DV4 M;  2RKO A;  1UM8 A;  2YR0 A;  3I4Y A;  5DNY A;  3L26 A;  1C1K A;  4LGY A;  3WHK A;  2RGH A;  2V1U A;  4Z8X A;  5BPV A;  3M0E A;  1SXJ D;  2LXE A;  3J7B A;  1KYI A;  4LJ7 A;  3QAU A;  5EXS A;  4X64 M;  1ORY B;  4NRV A;  2VQE M;  5C18 A;  3J7A S;  2LH0 A;  1IY2 A;  3GLF A;  1XWI A;  4QHT A;  3AOE A;  2Z4S A;  2UUB M;  3KOW E;  2XSZ A;  4GRI A;  3Q8X A;  1GVN A;  3GPX A;  1YUE A;  4IBB A;  4JV5 M;  3E4R A;  1GKI A;  3I51 A;  3KDS E;  5F3W A;  2DWN A;  2LWX A;  2M5Z A;  3A98 B;  2UWX A;  1ZQ9 A;  1L2C A;  2X49 A;  3SAW A;  3TWM A;  3LQQ A;  4IBC A;  2YQZ A;  4NZ4 A;  3KP1 E;  4K0K M;  1Z5B A;  1E94 E;  1EE8 A;  3KVW A;  3GLH A;  4B3M M;  4DV1 M;  3HHX A;  2FFJ A;  4FWH A;  4B08 A;  1NJG A;  2OQ4 A;  4P16 A;  2ZBK B;  1G3I A;  1T3T A;  4GC5 A;  3E9S A;  2Y0Q A;  1WXQ A;  4JXJ A;  3T1H M;  3OTO M;  2ZAM A;  4DR3 M;  4B7F A;  1IY0 A;  1GL6 A;  3VDP A;  3UK6 A;  4L8R C;  4JI0 M;  4JI7 M;  4M0D A;  4LZZ A;  1IN7 A;  1TH2 A;  2L09 A;  3FUT A;  5EP2 A;  2Y2K A;  3LMM A;  3AV0 A;  4A3V B;  2QBY B;  3SAU A;  1JR3 A;  3T15 A;  1HT2 E;  2XH9 A;  3U60 A;  3KW6 A;  3U61 A;  4WW0 A;  2CEA A;  2HL7 A;  2R18 A;  3L2A A;  1Q3B A;  1TH4 A;  3K1J A;  2NQ8 C;  5KPZ A;  5ITT A;  3HJ8 A;  1G8P A;  3SMP A;  3N3F A;  4YY3 M;  3GLG B;  1K3W A;  3FYC A;  4QNL A;  2CE7 A;  3JAM S;  1IN8 A;  2AHM A;  2Z3X A;  3U6D A;  1W5T A;  3B9P A;  3W0F A;  3VK8 A;  3ILK A;  1XMO M;  5KQD A;  4L78 A;  1HQY E;  4DV2 M;  4G4R A;  1N32 M;  4LF6 M;  3T38 A;  3AKZ A;  5GKN A;  1SXJ C;  1QAO A;  5LMN M;  2Y2L A;  3J27 B;  2I7N A;  4LJ9 A;  4B3T M;  1XHB A;  2XSZ D;  5KPR A;  2UXD M;  5C1B A;  3FTE A;  2C98 A;  4KO8 A;  1N75 A;  3FTC A;  2VQF M;  4JI2 M;  1YU4 A;  3K2L A;  2I7P A;  1HR0 M;  2Z4R A;  3AFH A;  2DZO B;  3FUU A;  1XC8 A;  3SHF A;  4DV7 M;  1XXH A;  4FD2 A;  5JI3 E;  4LJ5 A;  3GQ3 A;  3HU1 A;  3GRU A;  1J5E M;  1NNU C;  1R7R A;  5E6J A;  2CHV A;  2E5L M;  3CF0 A;  4DR1 M;  3DA1 A;  1HNX M;  3T1Y M;  1OFI A;  1IBM M;  3KXE C;  2FOI C;  1IBL M;  2XGN A;  4LFC M;  4REZ A;  2LNH C;  2P5T A;  2G8L A;  4NXN M;  5FTK A;  3U5Z A;  3PFI A;  2BNK A;  2BJW A;  3BOS A;  1I4W A;  4L4U A;  4LJ8 A;  2R4J A;  4IBG A;  2Q2E B;  4GKJ M;  3SMS A;  2L6O A;  1DGB A;  2XD5 A;  4GHL A;  1NHW C;  4M9S A;  3U61 B;  2JA2 A;  4G6Z A;  4LRT A;  4DV0 M;  1IM2 A;  1GLN A;  4DR7 M;  1NSF A;  2Y2J A;  4I81 A;  4I5S A;  3U6C A;  3U6P A;  5E26 A;  4PDI A;  1Z5C A;  3D8B A;  2EUC A;  4OJP A;  3EIH A;  2YNM D;  3FUW A;  3GRR A;  3K8Z A;  3UGJ A;  1R2Y A;  3HHY A;  4IBK A;  5DYG A;  1DO0 A;  1Z59 A;  3FUX A;  3KSX A;  4HLQ A;  4GIP A;  4MGH A;  3U6M A;  4FCW A;  3LVV A;  3PNV A;  3QWL A;  3ZH9 B;  4CIS A;  3VLF B;  4OUI A;  2HKJ A;  4RF1 A;  4OJL A;  4W5W A;  3WX7 A;  4IBJ A;  3U6Q A;  4FW9 A;  3DZD A;  5A2Q S;  4GH9 A;  1XMQ M;  3NBI A;  1QAM A;  2UXB M;  2R45 A;  2BG1 A;  5IWA M;  3CF2 A;  3PVS A;  1NY6 A;  3VKH A;  4OJO A;  1DGH A;  3VK7 A;  1L2D A;  1QAQ A;  1PJI A;  2DWZ B;  2Y2M A;  3HU2 A;  4GMQ A;  2D7H A;  2J7O A;  5EP3 A;  2M60 A;  5EJC A;  3A42 A;  2R65 A;  3J80 S;  1R6B X;  1QQW A;  3U5Z B;  4IBD A;  3GPY A;  2F5S A;  1HNZ M;  2HCB A;  4DV3 M;  4OU7 A;  4KLN A;  1X37 A;  3J2P B;  4DR2 M;  1IN6 A;  4DR5 M;  5KQ8 A;  1HT1 E;  1YU2 A;  3SAS A;  3JR5 A;  4DV5 M;  1QYR A;  4JI3 M;  3ZC7 B;  2XF3 A;  2C5R A;  1IN4 A;  2Y2I A;  4QNR A;  2W82 A;  1XXH B;  2F5N A;  2QZ4 A;  2Y2H A;  3UZU A;  2L7H A;  2KRU A;  3NWL A;  4JI4 M;  1DGH B;  3A46 A;  5IZ7 D;  4IJE A;  3TQS A;  3HGI A;  3SAR A;  3KS8 A;  3HSH A;  4D82 A;  3D8L A;  5JI2 E;  2XD1 A;  3M6A A;  4NZ1 A;  2Y20 A;  1NJF A;  1SXJ E;  4AKI A;  3SYL A;  2VII A;  4OX9 M;  1E32 A;  2H1R A;  4DV6 M;  4B7H A;  1DGF A;  4JI6 M;  2A5Y B;  2C99 A;  4JYA M;  1Z5A A;  2D7G A;  3J81 S;  5IT9 S;  1VDD A;  4MGK E;  4NOO B;  2C96 A;  2FNA A;  1H6U A;  2XFT A;  2XFS A;  1OFH A;  3PNY A;  5FTJ A;  1N33 M;  1YU3 A;  2F5Q A;  1IXS B;  4MB7 A;  3FUV A;  1FJG M;  1IY1 A;  4MM3 B;  4OJ6 A;  4OW0 A;  3SHG B;  2X8A A;  3HU3 A;  3AOE C;  3H4M A;  4QHS A;  1IQP A;  4G4N A;  3UJN A;  1HQC A;  1L1Z A;  4NZ5 A;  4MGY E;  4BB9 A;  2KRK A;  5FSW A;  3GLF B;  2K47 A;  3WHL A;  5EXP A;  4M9X A;  3SAT A;  4DR4 M;  3KOZ E;  3TPZ A;  1NVM A;  1JR3 D;  4DUY M;  1N34 M;  3U6E A;  4FWD A;  1L2B A;  3I4V A;  5IRE B;  7CAT A;  1E9R A;  1SXJ B;  2QBY A;  4M9Z A;  3UMM A;  4ITQ A;  1NNJ A;  3DFZ A;  2EO2 A;  3U60 B;  2KA6 B;  2QPA A;  3FTF A;  4GIT A;  4BBA A;  2CV0 A;  1K3X A;  3FD9 A;  4JI1 M;  1MX0 A;  1TH3 A;  4M0W A;  3GPP A;  1TGU A;  1FNN A;  2R4E A;  2QEN A;  4L16 A;  1L1T A;  8CAT A;  3GLG A;  2DWM A;  2XZF A;  1DO2 A;  5EQT A;  4LJA A;  4FCT A;  5ITX E;  1YU1 A;  4G4Q A;  4QOZ C;  3CF6 E;  1JQJ C;  2C9O A;  3GLH B;  5EXX A;  4B3R M;  3L28 A;  4LJ4 A;  3A45 A;  3SBJ A;  3KS4 A;  2F5P A;  1Q3C A;  4NYU A;  5EXT A;  3EIE A;  3GPU A;  1G41 A;  2Y2P A;  3KSJ A;  2FE8 A;  4ZPX A;  5ITQ A;  1S3S A;  3L29 A;  2R62 A;  4QNM A;  4L15 A;  4NRW A;  4LG2 A;  3GP1 A;  3KP0 E;  1SXJ A;  4MGZ E;  4Z6Y A;  4AKH A;  2KZU A;  3TE6 A;  4B3S M;  3IG8 A;  1GL7 A;  1YSY A;  4NL4 H;  4X66 M;  3MK6 A;  1LV7 A;  4JI5 M;  2C9C A;  2F5O A;  5ITX A;  3W0L B;  4LJ6 A;  4RNA A;  3VFD A;  1ZAE A;  2DWL A;  1K82 A;  4MGI E;  1TDZ A;  2ERC A;  2Y2G A;  3GQ5 A;  1PM5 A;  4LF4 M;  4AZF A;  4AQY M;  4AG6 A;  5LMU M;  2UUC M;  4MH0 E;  3GLI A;  4GKK M;  2KZS A;  4RF0 A;  1YE9 A;  1G59 A;  2ZAO A;  4LGM A;  1MU5 A;  3IG5 A;  5FLX S;  3RE8 A;  3R9X B;  1I94 M;  1W5S A;  3FKE A;  4S12 A;  3GO8 A;  4G4O A;  1IXZ A;  2EA0 A;  2IOU A;  4X62 M;  4LY6 A;  4LF8 M;  4FWG A;  3KOY E;  3C58 A;  5FTN A;  3U6S A;  3VKG A;  1NY5 A;  1PJJ A;  1N78 A;  4LRS A;  3LQR A;  4R3D A;  4NSR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...