3FKEA

Structure of the ebola vp35 interferon inhibitory domain
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
123
structure length
123
Chain Sequence
DISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords Polymerase cofactor VP35
publication title Structure of the Ebola VP35 interferon inhibitory domain.
pubmed doi rcsb
source organism Zaire ebolavirus - mayinga (zaire, 1976)
total genus 40
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3fkeA01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 3fkeA02
4IBEA 5BPVA 4IBCA 4IBBA 4LG2A 3L27A 3L29A 4IJEA 3FKEA 4GHLA 4GH9A 4IBFA 4IBJA 3L26A 3L25A 4IBDA 4IJFA 4GHAA 4IBIA 4IBKA 4IBGA 3L28A 3L2AA 3KS4A 3KS8A
chains in the Genus database with same CATH superfamily
4Z2JA 2EKKA 3ZCBB 3SAUA 1YLAA 1T43A 3HWSA 3MHVC 4JI3M 1J09A 2QNJA 1IN5A 3FRIA 2JZ0A 2K6BA 2X49A 3KXEC 3E46A 4L16A 2XZUA 4JI6M 3PFIA 1JR3E 2C96A 2F5PA 4LJ7A 4XBOA 2JY6B 3U6EA 3W0LB 2JWSA 4NL4H 2R0IA 2CP8A 1IXZA 2BWBA 4Z2KA 5FSWA 5KPTA 2GQFA 1ORYB 4K0KM 1XMQM 4GMQA 1D2NA 1E88A 4NRWA 3I4VA 2DZLA 1TDHA 5ITQA 4AI6A 3M0EA 1GO5A 5ITUA 3KS4A 4LGYA 2ZAOA 3B74A 2H1RA 2R46A 4GKJM 3KSXA 2L7HA 2DZOB 2CHVA 4L78A 3R9XB 1GJSA 2XD5A 1E6NA 1I4WA 2JY7A 1J5EM 1ZV1A 3HHXA 4MH0E 5E6JA 3THGA 2KNAA 4G3OA 3WD4A 2RTSA 3DA1A 3AOGA 4JI0M 3SFZA 3GPPA 2ZANA 3AJIB 2B3TA 3BXWA 1DGHA 4FWDA 4I81A 4IBJA 4RF0A 1S3SA 3GPUA 4HMEA 3KOWE 3W67A 3HU3A 4QNRA 4PD2A 1V34A 1PJJA 1XXHA 4Q7JA 1T6OA 1EFUB 2EKFA 5IT9S 3MMPA 2CHQA 5ITXA 1T3TA 4HMDA 4LZJA 4MGHA 1PM5A 4R71A 4TUWA 1JQJC 1IFYA 4NZ3A 4LJ5A 4G4QA 1G41A 3VKGA 4LY6A 2DWZB 4OVZB 2KRUA 4WURA 1N32M 5ITTA 2DENA 3SAVA 1TDZA 4KHPM 3GPYA 3KP0E 4B3MM 2VQFM 2L09A 3GLGA 4EIWA 1QUTA 3H4MA 3ILKA 2VDBB 2LXEA 4P16A 4BB9A 2BJWA 1EAKA 3N3FA 4FVMA 2Z7JA 2DZNB 1Z5AA 1MN3A 2H5XA 3FRHA 3I51A 2L4EA 3LVWA 4IBDA 4LGMA 2LVOC 3C9PA 3GLHA 4D82A 4B3SM 1SG9A 2Y2OA 2APLA 1ZMVA 4LRTA 3RGPA 3HJ8A 4DV1M 3FTFA 2KRKA 2FS1A 2F5SA 2XD1A 4LF4M 2UXDM 5ITYA 2D49A 2M5ZA 5DYIA 1TTEA 1V92A 1GXDA 3HJSA 1QYRA 3HHZA 2JP7A 4HL4A 3VLFB 2RGOA 1NNUC 2CV0A 4B08A 4OJLA 3BOSA 3FUWA 3U6DA 2BNKA 4LG2A 1TGUA 1VEKA 3U6LA 4AG6A 4X62M 2QBYB 2W82A 1ZMWA 2M60A 2FFFB 3K1JA 5A2QS 2CV1A 4L8RC 2KZUA 4WW0A 4HMCA 5IZ7D 4LF8M 1Z5BA 2DHYA 1VDLA 4LJ4A 2KNZA 3U5ZA 4DR4M 3KW6A 4B3TM 4DR2M 3GLFA 1R2YA 4MB4A 1GKIA 3FYDA 3LVVA 2JUJA 4LZZA 5JI3E 1IN4A 2ZM6M 1H6UA 3FTDA 2X8AA 2Z8YM 4QNMA 3SMPA 2LVQD 1CUKA 3A46A 3GLIE 2KW0A 2Y2QA 1W1VA 4OUIA 2X4AA 4JI8M 5FTNA 3T1HM 1L6JA 1R5LA 1OQYA 4A3VB 2HHHM 1SXJA 1DGGA 1XMOM 2R4EA 1RU3A 3NWLA 2XGNA 4GC9A 1NHGC 3MK6A 1E8BA 1KSFX 3HHYA 4I4LA 4GKKM 3L27A 3TWKA 2J7NA 1G59A 3A98B 1HNZM 3Q8XA 4L4UA 5EP4A 4L6V6 1V33A 1MU5A 2Y0TA 2J7OA 5EXTA 4IJFA 3JR5A 1JR3D 2LNHC 1DO2A 1N33M 1YU1A 1R4GA 4HEOA 1JB0F 4IBKA 3WHKA 2UU9M 2FOIC 4AKHA 2Y2LA 3CGWA 3VK8A 2O5RA 1NVMA 4DV7M 1K82A 2C98A 3PVSA 4HLQA 4MGZE 3U60A 1NV9A 2BG1A 4M0DA 4NYUA 3DFZA 3FUVA 4AW4A 4OJ5A 4JI7M 3GLFB 3SYKA 4KO8A 1OJLA 2OQ4A 1E9SA 3GRRA 2JE5A 4DV5M 1QO6A 1OKSA 4FCVA 1FJGM 2DAKA 2L2DA 3J81S 4LF9M 3FD9A 4X66M 1DGFA 4D80A 3FTEA 3U61A 3HSHA 4OU7A 4W5WA 2R62A 2R44A 2EUCA 2CUZA 3KOXE 3LQRA 1R2ZA 5IWAM 1W1PA 2F5QA 2QHOB 3J7AS 3W0FA 1G8PA 3DZDA 2CV2A 4LF5M 1IXSB 3GRVA 4RNAA 1A5TA 5FLXS 2VF7A 3C58A 1W1TA 5KQ8A 2Y20A 1HJPA 1C7YA 1TR8A 4LFBM 1Q39A 1QAQA 3SHGB 3J2PB 5BPVA 3F92A 3UJNA 1P3QQ 1QZMA 4JXJA 3SMSA 2V5OA 1ED7A 1D0KA 1EIJA 2E5LM 4Z2LA 1QDRA 2XH9A 1AIWA 3L29A 2CEAA 2LVPC 2WZJA 3R8FA 3IHPA 3J27B 3ZH9B 1KS0A 1WXQA 1YUEA 3MJ5A 1E6RA 3AOEC 4IBFA 3TWLA 5ITRA 2CFOA 1Z5CA 1SXJC 1UFZA 2DAIA 4X65M 3SAWA 1PJIA 2DAGA 2CRUA 2FH0A 4NOOB 1TH3A 3K92A 3I01M 1EE8A 1OIPA 1GL7A 2Q2EB 2K0BX 3W68A 1IQPA 1GOIA 1PJTA 1N77A 1WJ7A 2LVNC 5EQTA 1R7RA 5FTLA 3SASA 4IBCA 4NY2A 2ZBKB 2R45A 3ZC7B 4IBBA 4CIZA 1ZMUA 2KEBA 3AL0C 2ZAMA 3AFHA 3K8ZA 1XNQM 4S12A 5LMUM 3J80S 2EA0A 1UR8A 2D7GA 2XFTA 2MH8A 1PDCA 1NY6A 2WSEF 1L2BA 3MQLA 1UM8A 3U6SA 4FWGA 2N35A 4B3RM 2HAKA 2L7IA 3U6CA 2Y21A 3HU1A 1OAIA 3WHLA 3HONA 4MB7A 5DFLA 2UUAM 2JY8A 4CJ6A 4RF1A 1DGHB 2DAEA 3T38A 3E4RA 4DV2M 3SBJA 3UZUA 3WD0A 3K9OA 4AG5A 5EXPA 4IBEA 1XXHB 4NXNM 2VQEM 2Z3XA 1AUAA 1H8PA 1IBKM 1OIZA 3JAMS 4II7A 1G71A 2DVWB 2D7EA 4IJEA 4NZ4A 3QWLA 4DUYM 4BBAA 4RKUF 2QENA 1N34M 4DR7M 3QYBA 3T1YM 3HKPA 1XC8A 2YFQA 1G4AE 4B7HA 2DWMA 2UXBM 3B7NA 5EP2A 1YU4A 4TX8A 4DV4M 4ZPXA 1QAOA 1XB2B 1GPFA 4D81A 2JNHA 2DNAA 3GLIA 1MX0A 4IBIA 3NBIA 1SXJD 3U6MA 2QP9X 2YR0A 4QHSA 3GLGB 2HCBA 1PRBA 5EXSA 1OGBA 2R4JA 1PJSA 3PNVA 1J7KA 3TL4X 1KFVA 4AKIA 1E9RA 4CHTB 4KODA 3LW5F 5GKNA 1K3XA 3U6PA 3AOEA 1HR0M 1VEGA 3GLHB 3GP1A 3SYLA 1FNNA 4CGYB 3U6OA 4MB5A 4Z6YA 1LV7A 2G8LA 1Z6TA 2OO9A 3HU2A 1XHBA 2XSZD 3WX7A 4XK8F 2MGWA 2L6OA 4LFCM 4DR6M 4Z2GA 1BVSA 2L4FA 3WD2A 1L8QA 1QAMA 4I5SA 3IECA 4KLNA 4I8OA 4QOSA 3OTOM 5EXXA 2G5GX 4MM3B 5BR8M 1LTMA 4F1IA 3AKZA 2KXEA 3EIHA 4DR5M 1E6PA 4JI5M 3L28A 1IBMM 3GRYA 3VFDA 2XSZA 1PJQA 3B7ZA 1G3IA 1WHCA 4XGIA 4G4NA 2Y2PA 2RKOA 3KSJA 3KS8A 3RGSA 1OGGA 5LMNM 2QZ4A 3U5ZB 1WIVA 1IM2A 3LQQA 2C99A 3B7QA 2HL7A 5KO3A 1QVRA 4QOZC 1L1ZA 3CF0A 1AIPC 1DV0A 2YQZA 1YSYA 3M7GA 3D8BA 4GC5A 4Z8XA 5KPZA 3SHFA 3SARA 2UWXA 1OTRA 3LMMA 2GNOA 4PDGA 4ANRA 3IG8A 2XEPA 3GQ3A 2IOUA 2XFSA 4DR3M 3KVWA 2I7PA 1SXJB 4OJ6A 2FE8A 4MGKE 1OFIA 4NYYA 1Y8GA 4G6ZA 4FCWA 3T15A 2Y2IA 3FUUA 1N36M 1WR1B 3D8LA 3FTCA 1L2CA 4GEWA 2DXIA 1GLNA 3M6AA 2UUCM 1Q02A 2BJVA 1W5SA 1YUBA 3GPXA 3HHWA 4MGYE 1E15A 2DAMA 4PT5A 1QUSA 5L8RF 3U6QA 1QZEA 3K2LA 3LCVB 2XZFA 3ZQJA 3K9PA 2LTUA 4IIWA 4PDIA 1E6ZA 2J5YA 4NC6A 1GL6A 4Z2IA 2FFJA 3U60B 2LHCA 4JYAM 4LJAA 5C18A 2D7HA 4FW9A 3TPZA 3VK7A 1NO1A 2F4VM 1HT1E 3QYEA 3FE3A 1NJGA 3L26A 1H0GA 2JA2A 1HNWM 1IY2A 4FWHA 3L25A 3A42A 1YE9A 5EJCA 1K3WA 4OJPA 1DO0A 1HQCA 3KOZE 1GABA 4NZ1A 3L2AA 3T6PA 4L15A 5DNYA 4OVZA 2JXNA 7CATA 4B7FA 1UR9A 2ZTDA 4QHTA 2K9DA 2Y2GA 2VIIA 2R65A 4JN6A 2C9CA 3KFUG 3U61B 2WSFF 1C1KA 4LCBA 4FD2A 1W5TA 4R7GA 5E26A 5F3WA 4AQYM 3GQ4A 1NNJA 1IXRC 3C3EA 2C5RA 1Z59A 4AZFA 2MR9A 2LWXA 4LF7M 2FN2A 3RE8A 2FNAA 1L1TA 1N75A 1NSFA 1VDDA 4M0WA 2HKJA 1D0LA 2DHRA 3V76A 2HWJA 2KDLA 2LBCA 4GH9A 3Q8GA 2A5YB 2UUBM 3B89A 4M9XA 4REZA 3SC3A 2JCHA 1TH4A 2CE7A 1DGBA 2JZ1A 4LJ6A 1IN6A 3E9SA 2CHGA 2LVAA 2WSCF 4NRVA 4CISA 2Y2JA 4LJ9A 2KA6B 3VDPA 1TH2A 3NBXX 4YY3M 2DWLA 1WGLA 2QPAA 4R3DA 1Q3CA 3UGJA 4QNLA 3GQ5A 4OW0A 2QBYA 3VKHA 4DV6M 1XXHE 1GVNA 3HJQA 4G4RA 2DI0A 1HQYE 3TWMA 2XF3A 4DBGB 3M7PA 5ITXE 2QQ8A 2Z4SA 4Y28F 1YU2A 1E32A 1PGYA 1R6BX 4OJOA 1VQ1A 3IG5A 4GIPA 1YU3A 5EP1A 5IREB 4KT0F 3HX3A 3LCUA 1IY1A 3PNYA 2Z4RA 3EIEA 3I04M 4B7GA 1QDTA 1D0MA 3CF2A 3PXGA 3VDUA 4JI1M 2DWNA 3A45A 4PCZA 1HNXM 1Q3BA 2Y2NA 1QQWA 1ZAEA 1GJTA 4MGIE 1IN8A 4F2LA 4GHAA 1OFHA 3GLGE 4IBGA 1MJGM 5FTMA 2P5TA 1VEJA 2MROB 4BLCA 4LF6M 3AV0A 1L2DA 2EJSA 1TF0B 3QAUA 1W1YA 2OOBA 1E94E 3KDSE 3GLHE 1KYIA 2OPFA 4JI4M 3FYCA 1J7MA 2Y2KA 2V1UA 3C3DA 1N78A 3BBZA 4UN2B 4MB3A 1IN7A 3JR4A 2Y2MA 4DV3M 3HZJA 4NZ5A 4DV0M 3GRUA 2VF8A 4G4OA 4NXMM 2QSFX 3UMMA 4NSOB 4P17A 5DYGA 3FKEA 3RFWA 1H0IA 1QANA 3KP1E 2LH0A 2O01F 5H37D 2F5OA 1XWIA 2O25A 4JV5M 4DR1M 1IY0A 2K47A 2I7NA 2R18A 3WD3A 3HGIA 3E21A 3H4JA 4LRSA 2OOAA 3CF6E 3FUTA 4GRIA 1NJFA 2KHHA 4WP2A 1O6IA 4OX9M 2R6FA 1NV8A 3FUXA 4FCTA 2C9OA 2RRUA 4AKGA 1CK7A 3DOAA 4GITA 3GLFE 3GLIB 4X64M 1I94M 2G3QA 1OAOC 2Y0QA 5JI2E 3KOYE 2XLJA 1VG5A 1IBLM 2ERCA 1YU0A 2CWBA 2Y2HA 4LFAM 2DKLA 2ZTCA 2F5NA 3TQSA 1SXJE 3GO8A 3SATA 4GHLA 2EO2A 1IXSA 2JY5A 2LHGA 2KNVA 2MJ5B 3I4YA 3J7BA 2RGHA 4NSRA 5EP3A 5KPRA 1XNRM 1NHWC 3UK6A 1F4IA 5FTKA 3HY5A 4ITQA 4M9SA 2YNMD 5C1BA 2QCUA 3CTWB 2UXCM 1ZQ9A 3WD1A 2V1CA 1X37A 1CXWA 8CATA 1HT2E 2V6ZM 4M9ZA 3TE6A 4JI2M 4Z2HA 4YHHM 2KZSA 5KQDA 2NQ8C 3B9PA 4LJ8A 2BWEA 4DUZM 1WGNA 1NY5A 5FTJA 2AHMA 1JR3A
chains in the Genus database with same CATH topology
3ZCBB 3SAUA 3HWSA 3MHVC 4JI3M 1J09A 3KXEC 1IN5A 2X49A 4L16A 2XZUA 4JI6M 3PFIA 2C96A 2F5PA 4LJ7A 4XBOA 3U6EA 3W0LB 4NL4H 1IXZA 5FSWA 5KPTA 1ORYB 4K0KM 1XMQM 4GMQA 1D2NA 4NRWA 3I4VA 5ITQA 1TDHA 4AI6A 3M0EA 5ITUA 3KS4A 4LGYA 2ZAOA 2H1RA 2R46A 4GKJM 3KSXA 2L7HA 2DZOB 2CHVA 4L78A 3R9XB 2XD5A 1I4WA 1J5EM 3HHXA 5E6JA 4MH0E 3THGA 3DA1A 3AOGA 4JI0M 3SFZA 3GPPA 2ZANA 3AJIB 4RF0A 1DGHA 4FWDA 4I81A 4IBJA 3GPUA 1S3SA 3KOWE 3HU3A 4QNRA 4PD2A 1PJJA 1XXHA 5IT9S 2CHQA 5ITXA 1T3TA 4LZJA 4MGHA 1PM5A 4TUWA 1JQJC 4NZ3A 4LJ5A 4G4QA 1G41A 3VKGA 4LY6A 2DWZB 4OVZB 2KRUA 4WURA 1N32M 5ITTA 3SAVA 1TDZA 4KHPM 3GPYA 3KP0E 4B3MM 2VQFM 2L09A 3GLGA 4EIWA 3H4MA 3ILKA 1YU2A 2LXEA 4P16A 4BB9A 2BJWA 3N3FA 4FVMA 2Z7JA 2DZNB 1Z5AA 3I51A 4IBDA 3LVWA 4LGMA 3GLHA 4D82A 4B3SM 2Y2OA 4LRTA 3RGPA 3HJ8A 4DV1M 3FTFA 2KRKA 2F5SA 2XD1A 4LF4M 2UXDM 5ITYA 2M5ZA 5DYIA 3HJSA 1QYRA 3HHZA 4HL4A 3VLFB 2RGOA 1NNUC 2CV0A 4B08A 3BOSA 3FUWA 2BNKA 4LG2A 1TGUA 3U6LA 4AG6A 4X62M 2QBYB 2W82A 2M60A 2FFFB 3K1JA 5A2QS 2CV1A 4L8RC 2KZUA 4WW0A 5IZ7D 4LF8M 1Z5BA 4LJ4A 3U5ZA 4DR4M 3KW6A 4B3TM 4DR2M 3GLFA 1R2YA 1GKIA 3FYDA 3LVVA 4LZZA 5JI3E 1IN4A 2ZM6M 1H6UA 3FTDA 2X8AA 4QNMA 3SMPA 2Y2QA 3A46A 2KW0A 4OUIA 2X4AA 4JI8M 5FTNA 3T1HM 4A3VB 2HHHM 1SXJA 1DGGA 1XMOM 2R4EA 3NWLA 2XGNA 4GC9A 1NHGC 3MK6A 1KSFX 3HHYA 4I4LA 4GKKM 3L27A 3TWKA 2J7NA 1G59A 3A98B 1HNZM 3Q8XA 4L4UA 5EP4A 1MU5A 2Y0TA 2J7OA 5EXTA 4IJFA 3JR5A 1JR3D 2LNHC 1DO2A 1N33M 1YU1A 4IBKA 2UU9M 3WHKA 2FOIC 4AKHA 2Y2LA 3VK8A 2O5RA 1NVMA 4DV7M 1K82A 2C98A 3PVSA 4HLQA 4MGZE 3U60A 2BG1A 4NYUA 4M0DA 3DFZA 3FUVA 4AW4A 4OJ5A 4JI7M 3GLFB 3SYKA 4KO8A 1OJLA 2OQ4A 1E9SA 3GRRA 2JE5A 4DV5M 4FCVA 1FJGM 3J81S 4LF9M 3FD9A 4X66M 1DGFA 4D80A 3FTEA 3U61A 3HSHA 4OU7A 4W5WA 2R62A 2EUCA 2CUZA 3KOXE 3LQRA 1R2ZA 5IWAM 2F5QA 3J7AS 3W0FA 1G8PA 3DZDA 2CV2A 4LF5M 1IXSB 3GRVA 4RNAA 3C58A 5FLXS 5KQ8A 2Y20A 4LFBM 1Q39A 1QAQA 3SHGB 3J2PB 5BPVA 3UJNA 4JXJA 1QZMA 3SMSA 2E5LM 2XH9A 3L29A 2CEAA 3R8FA 3J27B 3ZH9B 1WXQA 1YUEA 3MJ5A 3AOEC 4IBFA 3TWLA 5ITRA 2CFOA 1Z5CA 1SXJC 3SAWA 4X65M 1PJIA 4NOOB 1TH3A 3K92A 1EE8A 1GL7A 2Q2EB 1IQPA 1N77A 5EQTA 1R7RA 5FTLA 3SASA 4IBCA 4NY2A 2ZBKB 2R45A 3ZC7B 4IBBA 2KEBA 3AL0C 2ZAMA 3AFHA 3K8ZA 1XNQM 4S12A 5LMUM 3J80S 2EA0A 2D7GA 2XFTA 1NY6A 1L2BA 1UM8A 3U6SA 4FWGA 4B3RM 2L7IA 3U6CA 2Y21A 3HU1A 3WHLA 3HONA 4MB7A 2UUAM 4RF1A 1DGHB 3T38A 4DV2M 3E4RA 3SBJA 3UZUA 4AG5A 5EXPA 4IBEA 1XXHB 4NXNM 2VQEM 2Z3XA 1IBKM 3JAMS 4II7A 2DVWB 2D7EA 4IJEA 4NZ4A 3QWLA 4DUYM 4BBAA 1N34M 2QENA 4DR7M 3T1YM 3HKPA 1XC8A 2YFQA 1G4AE 4B7HA 2DWMA 2UXBM 5EP2A 1YU4A 4DV4M 4ZPXA 1QAOA 4D81A 3GLIA 1MX0A 4IBIA 3NBIA 1SXJD 3U6MA 2QP9X 2YR0A 4QHSA 3GLGB 2HCBA 5EXSA 2R4JA 3PNVA 1J7KA 3TL4X 1KFVA 4AKIA 1E9RA 4CHTB 4KODA 5GKNA 1K3XA 3U6PA 3AOEA 1HR0M 3GLHB 3GP1A 3SYLA 1FNNA 4CGYB 3U6OA 4Z6YA 1LV7A 2G8LA 1Z6TA 3HU2A 1XHBA 2XSZD 3WX7A 4LFCM 2L6OA 4DR6M 1L8QA 1QAMA 4I5SA 3OTOM 4KLNA 4I8OA 4QOSA 5EXXA 2G5GX 4MM3B 5BR8M 3AKZA 2KXEA 3EIHA 4DR5M 4JI5M 3L28A 1IBMM 3GRYA 3VFDA 2XSZA 1G3IA 4XGIA 4G4NA 2Y2PA 2RKOA 3KSJA 3KS8A 3RGSA 5LMNM 2QZ4A 3U5ZB 1IM2A 3LQQA 2C99A 2HL7A 5KO3A 1QVRA 4QOZC 1L1ZA 3CF0A 2YQZA 1YSYA 3M7GA 3D8BA 4GC5A 4Z8XA 5KPZA 3SHFA 3SARA 2UWXA 3LMMA 4PDGA 3GQ3A 2IOUA 3IG8A 2XEPA 2XFSA 4DR3M 3KVWA 2I7PA 1SXJB 4OJ6A 2FE8A 4MGKE 1OFIA 4NYYA 4G6ZA 4FCWA 3T15A 3FUUA 1N36M 3D8LA 3FTCA 1L2CA 2DXIA 1GLNA 3M6AA 2UUCM 2BJVA 1W5SA 1YUBA 3GPXA 3HHWA 4MGYE 4PT5A 3U6QA 3K2LA 2XZFA 4IIWA 4PDIA 1GL6A 2FFJA 3U60B 4JYAM 4LJAA 5C18A 2D7HA 4FW9A 3TPZA 3VK7A 2F4VM 1HT1E 3L26A 1NJGA 2JA2A 1HNWM 1IY2A 4FWHA 3L25A 3A42A 1YE9A 5EJCA 1K3WA 4OJPA 1DO0A 1HQCA 3KOZE 4NZ1A 3L2AA 5DNYA 4L15A 2Y2IA 4OVZA 2Y2GA 7CATA 4B7FA 4QHTA 2VIIA 2R65A 4JN6A 2C9CA 3KFUG 3U61B 1C1KA 4LCBA 4FD2A 1W5TA 4R7GA 5E26A 5F3WA 4AQYM 3GQ4A 1NNJA 1IXRC 2C5RA 1Z59A 4AZFA 4LF7M 2LWXA 3RE8A 2FNAA 1L1TA 1N75A 1NSFA 1VDDA 4M0WA 2HKJA 2DHRA 4GH9A 2A5YB 2UUBM 3SC3A 4M9XA 4REZA 2JCHA 1TH4A 2CE7A 1DGBA 4LJ6A 1IN6A 3E9SA 2CHGA 4NRVA 4CISA 2Y2JA 4OJLA 4OJOA 4LJ9A 2KA6B 3VDPA 1TH2A 4YY3M 2DWLA 2QPAA 4R3DA 1Q3CA 3UGJA 4QNLA 3GQ5A 4OW0A 2QBYA 3VKHA 4DV6M 3HJQA 1GVNA 4G4RA 1HQYE 3TWMA 2XF3A 5ITXE 2Z4SA 1E32A 1R6BX 3IG5A 4GIPA 1YU3A 5EP1A 5IREB 1IY1A 3PNYA 2Z4RA 3EIEA 4B7GA 3PXGA 3CF2A 4JI1M 3VDUA 2DWNA 3A45A 4PCZA 1HNXM 1Q3BA 2Y2NA 1QQWA 1ZAEA 4MGIE 1IN8A 4GHAA 1OFHA 4IBGA 5FTMA 2P5TA 4BLCA 4LF6M 3AV0A 1L2DA 3QAUA 1E94E 3KDSE 2OPFA 1KYIA 4JI4M 3FYCA 2Y2KA 2V1UA 1N78A 1IN7A 3JR4A 2Y2MA 4DV3M 4NZ5A 4DV0M 3GRUA 4G4OA 4NXMM 3UMMA 4NSOB 5DYGA 3FKEA 3RFWA 1QANA 3KP1E 2LH0A 5H37D 2F5OA 1XWIA 4JV5M 4DR1M 1IY0A 2K47A 2I7NA 2R18A 3HGIA 4LRSA 3CF6E 3FUTA 4GRIA 1NJFA 4OX9M 4FCTA 3FUXA 2C9OA 4AKGA 3DOAA 4GITA 3GLIB 4X64M 1I94M 2Y0QA 5JI2E 3KOYE 2XLJA 1IBLM 2ERCA 1YU0A 2Y2HA 4LFAM 2F5NA 3TQSA 1SXJE 3GO8A 3SATA 4GHLA 2EO2A 3J7BA 4NSRA 3U6DA 5EP3A 5KPRA 3I4YA 2RGHA 1XNRM 1NHWC 3UK6A 5FTKA 4ITQA 4M9SA 2YNMD 5C1BA 2QCUA 3CTWB 2UXCM 1ZQ9A 2V1CA 1X37A 8CATA 1HT2E 2V6ZM 4M9ZA 3TE6A 4JI2M 4YHHM 2KZSA 5KQDA 2NQ8C 3B9PA 4LJ8A 4DUZM 1NY5A 5FTJA 2AHMA 1JR3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IBE A;  5BPV A;  4IBC A;  4IBB A;  4LG2 A;  3L27 A;  3L29 A;  4IJE A;  3FKE A;  4GHL A;  4GH9 A;  4IBF A;  4IBJ A;  3L26 A;  3L25 A;  4IBD A;  4IJF A;  4GHA A;  4IBI A;  4IBK A;  4IBG A;  3L28 A;  3L2A A;  3KS4 A;  3KS8 A; 
#chains in the Genus database with same CATH topology
 4Z2J A;  2EKK A;  3ZCB B;  3SAU A;  1YLA A;  1T43 A;  3HWS A;  3MHV C;  4JI3 M;  1J09 A;  2QNJ A;  1IN5 A;  3FRI A;  2JZ0 A;  2K6B A;  2X49 A;  3KXE C;  3E46 A;  4L16 A;  2XZU A;  4JI6 M;  3PFI A;  1JR3 E;  2C96 A;  2F5P A;  4LJ7 A;  4XBO A;  2JY6 B;  3U6E A;  3W0L B;  2JWS A;  4NL4 H;  2R0I A;  2CP8 A;  1IXZ A;  2BWB A;  4Z2K A;  5FSW A;  5KPT A;  2GQF A;  1ORY B;  4K0K M;  1XMQ M;  4GMQ A;  1D2N A;  1E88 A;  4NRW A;  3I4V A;  2DZL A;  1TDH A;  5ITQ A;  4AI6 A;  3M0E A;  1GO5 A;  5ITU A;  3KS4 A;  4LGY A;  2ZAO A;  3B74 A;  2H1R A;  2R46 A;  4GKJ M;  3KSX A;  2L7H A;  2DZO B;  2CHV A;  4L78 A;  3R9X B;  1GJS A;  2XD5 A;  1E6N A;  1I4W A;  2JY7 A;  1J5E M;  1ZV1 A;  3HHX A;  4MH0 E;  5E6J A;  3THG A;  2KNA A;  4G3O A;  3WD4 A;  2RTS A;  3DA1 A;  3AOG A;  4JI0 M;  3SFZ A;  3GPP A;  2ZAN A;  3AJI B;  2B3T A;  3BXW A;  1DGH A;  4FWD A;  4I81 A;  4IBJ A;  4RF0 A;  1S3S A;  3GPU A;  4HME A;  3KOW E;  3W67 A;  3HU3 A;  4QNR A;  4PD2 A;  1V34 A;  1PJJ A;  1XXH A;  4Q7J A;  1T6O A;  1EFU B;  2EKF A;  5IT9 S;  3MMP A;  2CHQ A;  5ITX A;  1T3T A;  4HMD A;  4LZJ A;  4MGH A;  1PM5 A;  4R71 A;  4TUW A;  1JQJ C;  1IFY A;  4NZ3 A;  4LJ5 A;  4G4Q A;  1G41 A;  3VKG A;  4LY6 A;  2DWZ B;  4OVZ B;  2KRU A;  4WUR A;  1N32 M;  5ITT A;  2DEN A;  3SAV A;  1TDZ A;  4KHP M;  3GPY A;  3KP0 E;  4B3M M;  2VQF M;  2L09 A;  3GLG A;  4EIW A;  1QUT A;  3H4M A;  3ILK A;  2VDB B;  2LXE A;  4P16 A;  4BB9 A;  2BJW A;  1EAK A;  3N3F A;  4FVM A;  2Z7J A;  2DZN B;  1Z5A A;  1MN3 A;  2H5X A;  3FRH A;  3I51 A;  2L4E A;  3LVW A;  4IBD A;  4LGM A;  2LVO C;  3C9P A;  3GLH A;  4D82 A;  4B3S M;  1SG9 A;  2Y2O A;  2APL A;  1ZMV A;  4LRT A;  3RGP A;  3HJ8 A;  4DV1 M;  3FTF A;  2KRK A;  2FS1 A;  2F5S A;  2XD1 A;  4LF4 M;  2UXD M;  5ITY A;  2D49 A;  2M5Z A;  5DYI A;  1TTE A;  1V92 A;  1GXD A;  3HJS A;  1QYR A;  3HHZ A;  2JP7 A;  4HL4 A;  3VLF B;  2RGO A;  1NNU C;  2CV0 A;  4B08 A;  4OJL A;  3BOS A;  3FUW A;  3U6D A;  2BNK A;  4LG2 A;  1TGU A;  1VEK A;  3U6L A;  4AG6 A;  4X62 M;  2QBY B;  2W82 A;  1ZMW A;  2M60 A;  2FFF B;  3K1J A;  5A2Q S;  2CV1 A;  4L8R C;  2KZU A;  4WW0 A;  4HMC A;  5IZ7 D;  4LF8 M;  1Z5B A;  2DHY A;  1VDL A;  4LJ4 A;  2KNZ A;  3U5Z A;  4DR4 M;  3KW6 A;  4B3T M;  4DR2 M;  3GLF A;  1R2Y A;  4MB4 A;  1GKI A;  3FYD A;  3LVV A;  2JUJ A;  4LZZ A;  5JI3 E;  1IN4 A;  2ZM6 M;  1H6U A;  3FTD A;  2X8A A;  2Z8Y M;  4QNM A;  3SMP A;  2LVQ D;  1CUK A;  3A46 A;  3GLI E;  2KW0 A;  2Y2Q A;  1W1V A;  4OUI A;  2X4A A;  4JI8 M;  5FTN A;  3T1H M;  1L6J A;  1R5L A;  1OQY A;  4A3V B;  2HHH M;  1SXJ A;  1DGG A;  1XMO M;  2R4E A;  1RU3 A;  3NWL A;  2XGN A;  4GC9 A;  1NHG C;  3MK6 A;  1E8B A;  1KSF X;  3HHY A;  4I4L A;  4GKK M;  3L27 A;  3TWK A;  2J7N A;  1G59 A;  3A98 B;  1HNZ M;  3Q8X A;  4L4U A;  5EP4 A;  4L6V 6;  1V33 A;  1MU5 A;  2Y0T A;  2J7O A;  5EXT A;  4IJF A;  3JR5 A;  1JR3 D;  2LNH C;  1DO2 A;  1N33 M;  1YU1 A;  1R4G A;  4HEO A;  1JB0 F;  4IBK A;  3WHK A;  2UU9 M;  2FOI C;  4AKH A;  2Y2L A;  3CGW A;  3VK8 A;  2O5R A;  1NVM A;  4DV7 M;  1K82 A;  2C98 A;  3PVS A;  4HLQ A;  4MGZ E;  3U60 A;  1NV9 A;  2BG1 A;  4M0D A;  4NYU A;  3DFZ A;  3FUV A;  4AW4 A;  4OJ5 A;  4JI7 M;  3GLF B;  3SYK A;  4KO8 A;  1OJL A;  2OQ4 A;  1E9S A;  3GRR A;  2JE5 A;  4DV5 M;  1QO6 A;  1OKS A;  4FCV A;  1FJG M;  2DAK A;  2L2D A;  3J81 S;  4LF9 M;  3FD9 A;  4X66 M;  1DGF A;  4D80 A;  3FTE A;  3U61 A;  3HSH A;  4OU7 A;  4W5W A;  2R62 A;  2R44 A;  2EUC A;  2CUZ A;  3KOX E;  3LQR A;  1R2Z A;  5IWA M;  1W1P A;  2F5Q A;  2QHO B;  3J7A S;  3W0F A;  1G8P A;  3DZD A;  2CV2 A;  4LF5 M;  1IXS B;  3GRV A;  4RNA A;  1A5T A;  5FLX S;  2VF7 A;  3C58 A;  1W1T A;  5KQ8 A;  2Y20 A;  1HJP A;  1C7Y A;  1TR8 A;  4LFB M;  1Q39 A;  1QAQ A;  3SHG B;  3J2P B;  5BPV A;  3F92 A;  3UJN A;  1P3Q Q;  1QZM A;  4JXJ A;  3SMS A;  2V5O A;  1ED7 A;  1D0K A;  1EIJ A;  2E5L M;  4Z2L A;  1QDR A;  2XH9 A;  1AIW A;  3L29 A;  2CEA A;  2LVP C;  2WZJ A;  3R8F A;  3IHP A;  3J27 B;  3ZH9 B;  1KS0 A;  1WXQ A;  1YUE A;  3MJ5 A;  1E6R A;  3AOE C;  4IBF A;  3TWL A;  5ITR A;  2CFO A;  1Z5C A;  1SXJ C;  1UFZ A;  2DAI A;  4X65 M;  3SAW A;  1PJI A;  2DAG A;  2CRU A;  2FH0 A;  4NOO B;  1TH3 A;  3K92 A;  3I01 M;  1EE8 A;  1OIP A;  1GL7 A;  2Q2E B;  2K0B X;  3W68 A;  1IQP A;  1GOI A;  1PJT A;  1N77 A;  1WJ7 A;  2LVN C;  5EQT A;  1R7R A;  5FTL A;  3SAS A;  4IBC A;  4NY2 A;  2ZBK B;  2R45 A;  3ZC7 B;  4IBB A;  4CIZ A;  1ZMU A;  2KEB A;  3AL0 C;  2ZAM A;  3AFH A;  3K8Z A;  1XNQ M;  4S12 A;  5LMU M;  3J80 S;  2EA0 A;  1UR8 A;  2D7G A;  2XFT A;  2MH8 A;  1PDC A;  1NY6 A;  2WSE F;  1L2B A;  3MQL A;  1UM8 A;  3U6S A;  4FWG A;  2N35 A;  4B3R M;  2HAK A;  2L7I A;  3U6C A;  2Y21 A;  3HU1 A;  1OAI A;  3WHL A;  3HON A;  4MB7 A;  5DFL A;  2UUA M;  2JY8 A;  4CJ6 A;  4RF1 A;  1DGH B;  2DAE A;  3T38 A;  3E4R A;  4DV2 M;  3SBJ A;  3UZU A;  3WD0 A;  3K9O A;  4AG5 A;  5EXP A;  4IBE A;  1XXH B;  4NXN M;  2VQE M;  2Z3X A;  1AUA A;  1H8P A;  1IBK M;  1OIZ A;  3JAM S;  4II7 A;  1G71 A;  2DVW B;  2D7E A;  4IJE A;  4NZ4 A;  3QWL A;  4DUY M;  4BBA A;  4RKU F;  2QEN A;  1N34 M;  4DR7 M;  3QYB A;  3T1Y M;  3HKP A;  1XC8 A;  2YFQ A;  1G4A E;  4B7H A;  2DWM A;  2UXB M;  3B7N A;  5EP2 A;  1YU4 A;  4TX8 A;  4DV4 M;  4ZPX A;  1QAO A;  1XB2 B;  1GPF A;  4D81 A;  2JNH A;  2DNA A;  3GLI A;  1MX0 A;  4IBI A;  3NBI A;  1SXJ D;  3U6M A;  2QP9 X;  2YR0 A;  4QHS A;  3GLG B;  2HCB A;  1PRB A;  5EXS A;  1OGB A;  2R4J A;  1PJS A;  3PNV A;  1J7K A;  3TL4 X;  1KFV A;  4AKI A;  1E9R A;  4CHT B;  4KOD A;  3LW5 F;  5GKN A;  1K3X A;  3U6P A;  3AOE A;  1HR0 M;  1VEG A;  3GLH B;  3GP1 A;  3SYL A;  1FNN A;  4CGY B;  3U6O A;  4MB5 A;  4Z6Y A;  1LV7 A;  2G8L A;  1Z6T A;  2OO9 A;  3HU2 A;  1XHB A;  2XSZ D;  3WX7 A;  4XK8 F;  2MGW A;  2L6O A;  4LFC M;  4DR6 M;  4Z2G A;  1BVS A;  2L4F A;  3WD2 A;  1L8Q A;  1QAM A;  4I5S A;  3IEC A;  4KLN A;  4I8O A;  4QOS A;  3OTO M;  5EXX A;  2G5G X;  4MM3 B;  5BR8 M;  1LTM A;  4F1I A;  3AKZ A;  2KXE A;  3EIH A;  4DR5 M;  1E6P A;  4JI5 M;  3L28 A;  1IBM M;  3GRY A;  3VFD A;  2XSZ A;  1PJQ A;  3B7Z A;  1G3I A;  1WHC A;  4XGI A;  4G4N A;  2Y2P A;  2RKO A;  3KSJ A;  3KS8 A;  3RGS A;  1OGG A;  5LMN M;  2QZ4 A;  3U5Z B;  1WIV A;  1IM2 A;  3LQQ A;  2C99 A;  3B7Q A;  2HL7 A;  5KO3 A;  1QVR A;  4QOZ C;  1L1Z A;  3CF0 A;  1AIP C;  1DV0 A;  2YQZ A;  1YSY A;  3M7G A;  3D8B A;  4GC5 A;  4Z8X A;  5KPZ A;  3SHF A;  3SAR A;  2UWX A;  1OTR A;  3LMM A;  2GNO A;  4PDG A;  4ANR A;  3IG8 A;  2XEP A;  3GQ3 A;  2IOU A;  2XFS A;  4DR3 M;  3KVW A;  2I7P A;  1SXJ B;  4OJ6 A;  2FE8 A;  4MGK E;  1OFI A;  4NYY A;  1Y8G A;  4G6Z A;  4FCW A;  3T15 A;  2Y2I A;  3FUU A;  1N36 M;  1WR1 B;  3D8L A;  3FTC A;  1L2C A;  4GEW A;  2DXI A;  1GLN A;  3M6A A;  2UUC M;  1Q02 A;  2BJV A;  1W5S A;  1YUB A;  3GPX A;  3HHW A;  4MGY E;  1E15 A;  2DAM A;  4PT5 A;  1QUS A;  5L8R F;  3U6Q A;  1QZE A;  3K2L A;  3LCV B;  2XZF A;  3ZQJ A;  3K9P A;  2LTU A;  4IIW A;  4PDI A;  1E6Z A;  2J5Y A;  4NC6 A;  1GL6 A;  4Z2I A;  2FFJ A;  3U60 B;  2LHC A;  4JYA M;  4LJA A;  5C18 A;  2D7H A;  4FW9 A;  3TPZ A;  3VK7 A;  1NO1 A;  2F4V M;  1HT1 E;  3QYE A;  3FE3 A;  1NJG A;  3L26 A;  1H0G A;  2JA2 A;  1HNW M;  1IY2 A;  4FWH A;  3L25 A;  3A42 A;  1YE9 A;  5EJC A;  1K3W A;  4OJP A;  1DO0 A;  1HQC A;  3KOZ E;  1GAB A;  4NZ1 A;  3L2A A;  3T6P A;  4L15 A;  5DNY A;  4OVZ A;  2JXN A;  7CAT A;  4B7F A;  1UR9 A;  2ZTD A;  4QHT A;  2K9D A;  2Y2G A;  2VII A;  2R65 A;  4JN6 A;  2C9C A;  3KFU G;  3U61 B;  2WSF F;  1C1K A;  4LCB A;  4FD2 A;  1W5T A;  4R7G A;  5E26 A;  5F3W A;  4AQY M;  3GQ4 A;  1NNJ A;  1IXR C;  3C3E A;  2C5R A;  1Z59 A;  4AZF A;  2MR9 A;  2LWX A;  4LF7 M;  2FN2 A;  3RE8 A;  2FNA A;  1L1T A;  1N75 A;  1NSF A;  1VDD A;  4M0W A;  2HKJ A;  1D0L A;  2DHR A;  3V76 A;  2HWJ A;  2KDL A;  2LBC A;  4GH9 A;  3Q8G A;  2A5Y B;  2UUB M;  3B89 A;  4M9X A;  4REZ A;  3SC3 A;  2JCH A;  1TH4 A;  2CE7 A;  1DGB A;  2JZ1 A;  4LJ6 A;  1IN6 A;  3E9S A;  2CHG A;  2LVA A;  2WSC F;  4NRV A;  4CIS A;  2Y2J A;  4LJ9 A;  2KA6 B;  3VDP A;  1TH2 A;  3NBX X;  4YY3 M;  2DWL A;  1WGL A;  2QPA A;  4R3D A;  1Q3C A;  3UGJ A;  4QNL A;  3GQ5 A;  4OW0 A;  2QBY A;  3VKH A;  4DV6 M;  1XXH E;  1GVN A;  3HJQ A;  4G4R A;  2DI0 A;  1HQY E;  3TWM A;  2XF3 A;  4DBG B;  3M7P A;  5ITX E;  2QQ8 A;  2Z4S A;  4Y28 F;  1YU2 A;  1E32 A;  1PGY A;  1R6B X;  4OJO A;  1VQ1 A;  3IG5 A;  4GIP A;  1YU3 A;  5EP1 A;  5IRE B;  4KT0 F;  3HX3 A;  3LCU A;  1IY1 A;  3PNY A;  2Z4R A;  3EIE A;  3I04 M;  4B7G A;  1QDT A;  1D0M A;  3CF2 A;  3PXG A;  3VDU A;  4JI1 M;  2DWN A;  3A45 A;  4PCZ A;  1HNX M;  1Q3B A;  2Y2N A;  1QQW A;  1ZAE A;  1GJT A;  4MGI E;  1IN8 A;  4F2L A;  4GHA A;  1OFH A;  3GLG E;  4IBG A;  1MJG M;  5FTM A;  2P5T A;  1VEJ A;  2MRO B;  4BLC A;  4LF6 M;  3AV0 A;  1L2D A;  2EJS A;  1TF0 B;  3QAU A;  1W1Y A;  2OOB A;  1E94 E;  3KDS E;  3GLH E;  1KYI A;  2OPF A;  4JI4 M;  3FYC A;  1J7M A;  2Y2K A;  2V1U A;  3C3D A;  1N78 A;  3BBZ A;  4UN2 B;  4MB3 A;  1IN7 A;  3JR4 A;  2Y2M A;  4DV3 M;  3HZJ A;  4NZ5 A;  4DV0 M;  3GRU A;  2VF8 A;  4G4O A;  4NXM M;  2QSF X;  3UMM A;  4NSO B;  4P17 A;  5DYG A;  3FKE A;  3RFW A;  1H0I A;  1QAN A;  3KP1 E;  2LH0 A;  2O01 F;  5H37 D;  2F5O A;  1XWI A;  2O25 A;  4JV5 M;  4DR1 M;  1IY0 A;  2K47 A;  2I7N A;  2R18 A;  3WD3 A;  3HGI A;  3E21 A;  3H4J A;  4LRS A;  2OOA A;  3CF6 E;  3FUT A;  4GRI A;  1NJF A;  2KHH A;  4WP2 A;  1O6I A;  4OX9 M;  2R6F A;  1NV8 A;  3FUX A;  4FCT A;  2C9O A;  2RRU A;  4AKG A;  1CK7 A;  3DOA A;  4GIT A;  3GLF E;  3GLI B;  4X64 M;  1I94 M;  2G3Q A;  1OAO C;  2Y0Q A;  5JI2 E;  3KOY E;  2XLJ A;  1VG5 A;  1IBL M;  2ERC A;  1YU0 A;  2CWB A;  2Y2H A;  4LFA M;  2DKL A;  2ZTC A;  2F5N A;  3TQS A;  1SXJ E;  3GO8 A;  3SAT A;  4GHL A;  2EO2 A;  1IXS A;  2JY5 A;  2LHG A;  2KNV A;  2MJ5 B;  3I4Y A;  3J7B A;  2RGH A;  4NSR A;  5EP3 A;  5KPR A;  1XNR M;  1NHW C;  3UK6 A;  1F4I A;  5FTK A;  3HY5 A;  4ITQ A;  4M9S A;  2YNM D;  5C1B A;  2QCU A;  3CTW B;  2UXC M;  1ZQ9 A;  3WD1 A;  2V1C A;  1X37 A;  1CXW A;  8CAT A;  1HT2 E;  2V6Z M;  4M9Z A;  3TE6 A;  4JI2 M;  4Z2H A;  4YHH M;  2KZS A;  5KQD A;  2NQ8 C;  3B9P A;  4LJ8 A;  2BWE A;  4DUZ M;  1WGN A;  1NY5 A;  5FTJ A;  2AHM A;  1JR3 A; 
#chains in the Genus database with same CATH homology
 3ZCB B;  3SAU A;  3HWS A;  3MHV C;  4JI3 M;  1J09 A;  3KXE C;  1IN5 A;  2X49 A;  4L16 A;  2XZU A;  4JI6 M;  3PFI A;  2C96 A;  2F5P A;  4LJ7 A;  4XBO A;  3U6E A;  3W0L B;  4NL4 H;  1IXZ A;  5FSW A;  5KPT A;  1ORY B;  4K0K M;  1XMQ M;  4GMQ A;  1D2N A;  4NRW A;  3I4V A;  5ITQ A;  1TDH A;  4AI6 A;  3M0E A;  5ITU A;  3KS4 A;  4LGY A;  2ZAO A;  2H1R A;  2R46 A;  4GKJ M;  3KSX A;  2L7H A;  2DZO B;  2CHV A;  4L78 A;  3R9X B;  2XD5 A;  1I4W A;  1J5E M;  3HHX A;  5E6J A;  4MH0 E;  3THG A;  3DA1 A;  3AOG A;  4JI0 M;  3SFZ A;  3GPP A;  2ZAN A;  3AJI B;  4RF0 A;  1DGH A;  4FWD A;  4I81 A;  4IBJ A;  3GPU A;  1S3S A;  3KOW E;  3HU3 A;  4QNR A;  4PD2 A;  1PJJ A;  1XXH A;  5IT9 S;  2CHQ A;  5ITX A;  1T3T A;  4LZJ A;  4MGH A;  1PM5 A;  4TUW A;  1JQJ C;  4NZ3 A;  4LJ5 A;  4G4Q A;  1G41 A;  3VKG A;  4LY6 A;  2DWZ B;  4OVZ B;  2KRU A;  4WUR A;  1N32 M;  5ITT A;  3SAV A;  1TDZ A;  4KHP M;  3GPY A;  3KP0 E;  4B3M M;  2VQF M;  2L09 A;  3GLG A;  4EIW A;  3H4M A;  3ILK A;  1YU2 A;  2LXE A;  4P16 A;  4BB9 A;  2BJW A;  3N3F A;  4FVM A;  2Z7J A;  2DZN B;  1Z5A A;  3I51 A;  4IBD A;  3LVW A;  4LGM A;  3GLH A;  4D82 A;  4B3S M;  2Y2O A;  4LRT A;  3RGP A;  3HJ8 A;  4DV1 M;  3FTF A;  2KRK A;  2F5S A;  2XD1 A;  4LF4 M;  2UXD M;  5ITY A;  2M5Z A;  5DYI A;  3HJS A;  1QYR A;  3HHZ A;  4HL4 A;  3VLF B;  2RGO A;  1NNU C;  2CV0 A;  4B08 A;  3BOS A;  3FUW A;  2BNK A;  4LG2 A;  1TGU A;  3U6L A;  4AG6 A;  4X62 M;  2QBY B;  2W82 A;  2M60 A;  2FFF B;  3K1J A;  5A2Q S;  2CV1 A;  4L8R C;  2KZU A;  4WW0 A;  5IZ7 D;  4LF8 M;  1Z5B A;  4LJ4 A;  3U5Z A;  4DR4 M;  3KW6 A;  4B3T M;  4DR2 M;  3GLF A;  1R2Y A;  1GKI A;  3FYD A;  3LVV A;  4LZZ A;  5JI3 E;  1IN4 A;  2ZM6 M;  1H6U A;  3FTD A;  2X8A A;  4QNM A;  3SMP A;  2Y2Q A;  3A46 A;  2KW0 A;  4OUI A;  2X4A A;  4JI8 M;  5FTN A;  3T1H M;  4A3V B;  2HHH M;  1SXJ A;  1DGG A;  1XMO M;  2R4E A;  3NWL A;  2XGN A;  4GC9 A;  1NHG C;  3MK6 A;  1KSF X;  3HHY A;  4I4L A;  4GKK M;  3L27 A;  3TWK A;  2J7N A;  1G59 A;  3A98 B;  1HNZ M;  3Q8X A;  4L4U A;  5EP4 A;  1MU5 A;  2Y0T A;  2J7O A;  5EXT A;  4IJF A;  3JR5 A;  1JR3 D;  2LNH C;  1DO2 A;  1N33 M;  1YU1 A;  4IBK A;  2UU9 M;  3WHK A;  2FOI C;  4AKH A;  2Y2L A;  3VK8 A;  2O5R A;  1NVM A;  4DV7 M;  1K82 A;  2C98 A;  3PVS A;  4HLQ A;  4MGZ E;  3U60 A;  2BG1 A;  4NYU A;  4M0D A;  3DFZ A;  3FUV A;  4AW4 A;  4OJ5 A;  4JI7 M;  3GLF B;  3SYK A;  4KO8 A;  1OJL A;  2OQ4 A;  1E9S A;  3GRR A;  2JE5 A;  4DV5 M;  4FCV A;  1FJG M;  3J81 S;  4LF9 M;  3FD9 A;  4X66 M;  1DGF A;  4D80 A;  3FTE A;  3U61 A;  3HSH A;  4OU7 A;  4W5W A;  2R62 A;  2EUC A;  2CUZ A;  3KOX E;  3LQR A;  1R2Z A;  5IWA M;  2F5Q A;  3J7A S;  3W0F A;  1G8P A;  3DZD A;  2CV2 A;  4LF5 M;  1IXS B;  3GRV A;  4RNA A;  3C58 A;  5FLX S;  5KQ8 A;  2Y20 A;  4LFB M;  1Q39 A;  1QAQ A;  3SHG B;  3J2P B;  5BPV A;  3UJN A;  4JXJ A;  1QZM A;  3SMS A;  2E5L M;  2XH9 A;  3L29 A;  2CEA A;  3R8F A;  3J27 B;  3ZH9 B;  1WXQ A;  1YUE A;  3MJ5 A;  3AOE C;  4IBF A;  3TWL A;  5ITR A;  2CFO A;  1Z5C A;  1SXJ C;  3SAW A;  4X65 M;  1PJI A;  4NOO B;  1TH3 A;  3K92 A;  1EE8 A;  1GL7 A;  2Q2E B;  1IQP A;  1N77 A;  5EQT A;  1R7R A;  5FTL A;  3SAS A;  4IBC A;  4NY2 A;  2ZBK B;  2R45 A;  3ZC7 B;  4IBB A;  2KEB A;  3AL0 C;  2ZAM A;  3AFH A;  3K8Z A;  1XNQ M;  4S12 A;  5LMU M;  3J80 S;  2EA0 A;  2D7G A;  2XFT A;  1NY6 A;  1L2B A;  1UM8 A;  3U6S A;  4FWG A;  4B3R M;  2L7I A;  3U6C A;  2Y21 A;  3HU1 A;  3WHL A;  3HON A;  4MB7 A;  2UUA M;  4RF1 A;  1DGH B;  3T38 A;  4DV2 M;  3E4R A;  3SBJ A;  3UZU A;  4AG5 A;  5EXP A;  4IBE A;  1XXH B;  4NXN M;  2VQE M;  2Z3X A;  1IBK M;  3JAM S;  4II7 A;  2DVW B;  2D7E A;  4IJE A;  4NZ4 A;  3QWL A;  4DUY M;  4BBA A;  1N34 M;  2QEN A;  4DR7 M;  3T1Y M;  3HKP A;  1XC8 A;  2YFQ A;  1G4A E;  4B7H A;  2DWM A;  2UXB M;  5EP2 A;  1YU4 A;  4DV4 M;  4ZPX A;  1QAO A;  4D81 A;  3GLI A;  1MX0 A;  4IBI A;  3NBI A;  1SXJ D;  3U6M A;  2QP9 X;  2YR0 A;  4QHS A;  3GLG B;  2HCB A;  5EXS A;  2R4J A;  3PNV A;  1J7K A;  3TL4 X;  1KFV A;  4AKI A;  1E9R A;  4CHT B;  4KOD A;  5GKN A;  1K3X A;  3U6P A;  3AOE A;  1HR0 M;  3GLH B;  3GP1 A;  3SYL A;  1FNN A;  4CGY B;  3U6O A;  4Z6Y A;  1LV7 A;  2G8L A;  1Z6T A;  3HU2 A;  1XHB A;  2XSZ D;  3WX7 A;  4LFC M;  2L6O A;  4DR6 M;  1L8Q A;  1QAM A;  4I5S A;  3OTO M;  4KLN A;  4I8O A;  4QOS A;  5EXX A;  2G5G X;  4MM3 B;  5BR8 M;  3AKZ A;  2KXE A;  3EIH A;  4DR5 M;  4JI5 M;  3L28 A;  1IBM M;  3GRY A;  3VFD A;  2XSZ A;  1G3I A;  4XGI A;  4G4N A;  2Y2P A;  2RKO A;  3KSJ A;  3KS8 A;  3RGS A;  5LMN M;  2QZ4 A;  3U5Z B;  1IM2 A;  3LQQ A;  2C99 A;  2HL7 A;  5KO3 A;  1QVR A;  4QOZ C;  1L1Z A;  3CF0 A;  2YQZ A;  1YSY A;  3M7G A;  3D8B A;  4GC5 A;  4Z8X A;  5KPZ A;  3SHF A;  3SAR A;  2UWX A;  3LMM A;  4PDG A;  3GQ3 A;  2IOU A;  3IG8 A;  2XEP A;  2XFS A;  4DR3 M;  3KVW A;  2I7P A;  1SXJ B;  4OJ6 A;  2FE8 A;  4MGK E;  1OFI A;  4NYY A;  4G6Z A;  4FCW A;  3T15 A;  3FUU A;  1N36 M;  3D8L A;  3FTC A;  1L2C A;  2DXI A;  1GLN A;  3M6A A;  2UUC M;  2BJV A;  1W5S A;  1YUB A;  3GPX A;  3HHW A;  4MGY E;  4PT5 A;  3U6Q A;  3K2L A;  2XZF A;  4IIW A;  4PDI A;  1GL6 A;  2FFJ A;  3U60 B;  4JYA M;  4LJA A;  5C18 A;  2D7H A;  4FW9 A;  3TPZ A;  3VK7 A;  2F4V M;  1HT1 E;  3L26 A;  1NJG A;  2JA2 A;  1HNW M;  1IY2 A;  4FWH A;  3L25 A;  3A42 A;  1YE9 A;  5EJC A;  1K3W A;  4OJP A;  1DO0 A;  1HQC A;  3KOZ E;  4NZ1 A;  3L2A A;  5DNY A;  4L15 A;  2Y2I A;  4OVZ A;  2Y2G A;  7CAT A;  4B7F A;  4QHT A;  2VII A;  2R65 A;  4JN6 A;  2C9C A;  3KFU G;  3U61 B;  1C1K A;  4LCB A;  4FD2 A;  1W5T A;  4R7G A;  5E26 A;  5F3W A;  4AQY M;  3GQ4 A;  1NNJ A;  1IXR C;  2C5R A;  1Z59 A;  4AZF A;  4LF7 M;  2LWX A;  3RE8 A;  2FNA A;  1L1T A;  1N75 A;  1NSF A;  1VDD A;  4M0W A;  2HKJ A;  2DHR A;  4GH9 A;  2A5Y B;  2UUB M;  3SC3 A;  4M9X A;  4REZ A;  2JCH A;  1TH4 A;  2CE7 A;  1DGB A;  4LJ6 A;  1IN6 A;  3E9S A;  2CHG A;  4NRV A;  4CIS A;  2Y2J A;  4OJL A;  4OJO A;  4LJ9 A;  2KA6 B;  3VDP A;  1TH2 A;  4YY3 M;  2DWL A;  2QPA A;  4R3D A;  1Q3C A;  3UGJ A;  4QNL A;  3GQ5 A;  4OW0 A;  2QBY A;  3VKH A;  4DV6 M;  3HJQ A;  1GVN A;  4G4R A;  1HQY E;  3TWM A;  2XF3 A;  5ITX E;  2Z4S A;  1E32 A;  1R6B X;  3IG5 A;  4GIP A;  1YU3 A;  5EP1 A;  5IRE B;  1IY1 A;  3PNY A;  2Z4R A;  3EIE A;  4B7G A;  3PXG A;  3CF2 A;  4JI1 M;  3VDU A;  2DWN A;  3A45 A;  4PCZ A;  1HNX M;  1Q3B A;  2Y2N A;  1QQW A;  1ZAE A;  4MGI E;  1IN8 A;  4GHA A;  1OFH A;  4IBG A;  5FTM A;  2P5T A;  4BLC A;  4LF6 M;  3AV0 A;  1L2D A;  3QAU A;  1E94 E;  3KDS E;  2OPF A;  1KYI A;  4JI4 M;  3FYC A;  2Y2K A;  2V1U A;  1N78 A;  1IN7 A;  3JR4 A;  2Y2M A;  4DV3 M;  4NZ5 A;  4DV0 M;  3GRU A;  4G4O A;  4NXM M;  3UMM A;  4NSO B;  5DYG A;  3FKE A;  3RFW A;  1QAN A;  3KP1 E;  2LH0 A;  5H37 D;  2F5O A;  1XWI A;  4JV5 M;  4DR1 M;  1IY0 A;  2K47 A;  2I7N A;  2R18 A;  3HGI A;  4LRS A;  3CF6 E;  3FUT A;  4GRI A;  1NJF A;  4OX9 M;  4FCT A;  3FUX A;  2C9O A;  4AKG A;  3DOA A;  4GIT A;  3GLI B;  4X64 M;  1I94 M;  2Y0Q A;  5JI2 E;  3KOY E;  2XLJ A;  1IBL M;  2ERC A;  1YU0 A;  2Y2H A;  4LFA M;  2F5N A;  3TQS A;  1SXJ E;  3GO8 A;  3SAT A;  4GHL A;  2EO2 A;  3J7B A;  4NSR A;  3U6D A;  5EP3 A;  5KPR A;  3I4Y A;  2RGH A;  1XNR M;  1NHW C;  3UK6 A;  5FTK A;  4ITQ A;  4M9S A;  2YNM D;  5C1B A;  2QCU A;  3CTW B;  2UXC M;  1ZQ9 A;  2V1C A;  1X37 A;  8CAT A;  1HT2 E;  2V6Z M;  4M9Z A;  3TE6 A;  4JI2 M;  4YHH M;  2KZS A;  5KQD A;  2NQ8 C;  3B9P A;  4LJ8 A;  4DUZ M;  1NY5 A;  5FTJ A;  2AHM A;  1JR3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...