3FKEA

Structure of the ebola vp35 interferon inhibitory domain
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
123
structure length
123
Chain Sequence
b'DISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polymerase cofactor VP35
molecule tags Rna binding protein
source organism Zaire ebolavirus - mayinga (zaire, 1976)
publication title Structure of the Ebola VP35 interferon inhibitory domain.
pubmed doi rcsb
total genus 40
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3fkeA01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 3fkeA02
3L26A 4GHLA 4IBFA 3L28A 3L2AA 3L25A 3FKEA 4IBIA 4IBEA 4IBJA 4IJFA 3KS8A 4IBGA 3L29A 4IBDA 4LG2A 3L27A 4IBBA 4IBCA 3KS4A 5BPVA 4GH9A 4IBKA 4GHAA 4IJEA
chains in the Genus database with same CATH superfamily
4LF9M 2VF8A 2JXNA 1E8BA 2XSZD 1I4WA 1QUTA 1UM8A 2CHQA 2L09A 4DR4M 1DV0A 1QVRA 1W1VA 4DV2M 4IBFA 2FOIC 1VEGA 2DXIA 1NV9A 2DWLA 3HZJA 2LXEA 2YQZA 3U6LA 4JYAM 2UUAM 4OJ5A 1IFYA 2CEAA 2O5RA 3T6PA 4S12A 1Q39A 4JI7M 4LG2A 2LHCA 3TPZA 4W5WA 1G8PA 1L2DA 4MGIE 1GO5A 2CHGA 3AFHA 4Z8XA 4NXNM 1NNJA 2R4EA 4DV7M 2Z3XA 1YU1A 2LHGA 4DUYM 1IXZA 4FWDA 1QO6A 1W5SA 3UJNA 2V1CA 4LY6A 4LFBM 1XWIA 2CV2A 4FD2A 4DR6M 3GRRA 4ZPXA 1I94M 3K8ZA 4JN6A 3CGWA 3HJQA 1OAIA 4FWGA 5JI2E 3FKEA 1VQ1A 3MJ5A 5FLXS 2QBYA 3L25A 1GJSA 1H6UA 4GC9A 5ITXA 4BLCA 3MMPA 3GQ5A 2KZSA 4DV5M 3AKZA 3SBJA 1ZMUA 3GRUA 4X64M 1QQWA 4L78A 3PNYA 5ITUA 1AIPC 1NY6A 3B89A 4JI1M 2Y21A 2I7NA 2KNVA 3HHYA 4DV6M 1NJGA 3KW6A 4LJ6A 5BPVA 2FFJA 3HY5A 1EAKA 3D8BA 4GIPA 1PRBA 4AZFA 4LGYA 4D80A 4MB4A 3FRIA 4AW4A 5FSWA 4R7GA 4CGYB 1SG9A 3ILKA 3I4VA 1VEKA 3SAVA 4OVZB 1H8PA 1OGGA 1W1PA 5F3WA 2XSZA 2ZAMA 4LJ9A 4A3VB 3FUWA 1XMQM 1QANA 2DAIA 2DKLA 3GP1A 3EIHA 4GEWA 1QAOA 1SXJD 3DOAA 5BR8M 3U6QA 4OX9M 1D0LA 4IBIA 1DGBA 2JE5A 3PXGA 4LJ5A 1A5TA 1ORYB 1XNRM 2OOBA 3HHXA 1IN6A 4WURA 4R3DA 1WR1B 4DV0M 1TDZA 1SXJE 4GKKM 4M9ZA 3TE6A 1HR0M 3GLGA 4NYYA 1L1TA 2JUJA 2FFFB 2F5NA 1HQYE 2Y2QA 4JI2M 4G4NA 2RRUA 4L8RC 1NO1A 3BBZA 4XGIA 5GKNA 1E32A 1NVMA 1XXHE 2ERCA 2CUZA 4NC6A 2CFOA 2H1RA 4B7HA 3CTWB 3FE3A 2QQ8A 1N32M 1ED7A 3HJSA 5ITTA 2VDBB 3TL4X 4AI6A 1D0MA 2UU9M 1E6PA 4HMCA 4NRVA 3WD1A 4LJ8A 1DO2A 2DNAA 3H4JA 2D7HA 4Y28F 3SHGB 2G5GX 2OOAA 3E21A 4AQYM 2WSFF 3FYCA 2Y2HA 4I81A 2ZTCA 1GKIA 3KP0E 2Z4RA 4PD2A 5ITYA 3HWSA 1YU0A 2FH0A 4Z2HA 3N3FA 4LFCM 2D7GA 2DAEA 2Y2LA 4I5SA 5IWAM 5ITXE 4HMEA 3I01M 4NY2A 3AOEC 2WSEF 1C7YA 3JR5A 2VQEM 3SYLA 3AOGA 2HAKA 4IBKA 1PJQA 2EA0A 2EUCA 4MB5A 1ZMVA 1TTEA 1TH4A 4DV4M 1EIJA 4Z2JA 4HL4A 5EP1A 4DBGB 2CV0A 4MGHA 3FTCA 2ZANA 4GRIA 2JY6B 4KLNA 2UXCM 2QHOB 2QCUA 1G59A 1OGBA 1O6IA 1V92A 1IN4A 4KODA 3A42A 3LQRA 4YHHM 1ZQ9A 2UUBM 1OJLA 5DYIA 4NXMM 3U61A 1IXSB 4OU7A 4FCTA 1G4AE 3U6DA 4R71A 1GOIA 3PFIA 2G3QA 4M9SA 3HHZA 1N75A 2DZLA 3BOSA 1S3SA 3VK7A 3VKGA 3K2LA 4OJOA 4Q7JA 1TGUA 4Z2GA 1FNNA 4TUWA 3D8LA 4JI6M 1Y8GA 2JA2A 3GLFA 2K9DA 3SAWA 2HHHM 2LVAA 4L16A 3MHVC 5C18A 2XFSA 4LFAM 3ZQJA 3T1HM 4LJ4A 2EKFA 3F92A 1G3IA 3HKPA 3J80S 4AG6A 1HNZM 1YSYA 3H4MA 3UK6A 3J7AS 1E6RA 4HMDA 4B08A 5FTJA 3FRHA 2DWNA 4FCVA 3L2AA 1E9RA 1NSFA 1OFIA 2Y0TA 2QZ4A 3U5ZB 1VDDA 1T3TA 1J7KA 3GQ3A 1E88A 1LTMA 1J5EM 2APLA 2ZTDA 2P5TA 3L29A 5EQTA 4DR3M 2B3TA 1MU5A 1IY1A 1ZAEA 3GLFB 3KOZE 2RTSA 2DHRA 1QAQA 1OIPA 2DZOB 3E46A 2Y2PA 3SAUA 1TH2A 1OIZA 2DAMA 2MJ5B 1YU3A 2V5OA 3GQ4A 2R62A 2Z8YM 2O25A 3E4RA 1IXRC 2HKJA 3GLHE 5IZ7D 3I04M 4OJ6A 2UUCM 2D49A 1IBLM 1NHGC 3VDUA 2Q2EB 4JXJA 1TR8A 2DHYA 3LCUA 5KQDA 2LVNC 2DZNB 3OTOM 1DGGA 3HONA 1BVSA 4Z2KA 3TWLA 2OPFA 3U5ZA 1HNWM 3WD0A 3C3EA 2MGWA 2JY8A 3IG8A 5EP3A 3U6OA 1EE8A 4LJ7A 4IBJA 3KS8A 4P17A 2M60A 4KHPM 3W68A 3GPXA 3GRVA 5EXXA 1PDCA 5EP2A 4JI4M 3GLHB 3UZUA 4CIZA 5KQ8A 2DENA 2XF3A 1DGHB 2OO9A 2R6FA 1G71A 3NWLA 3GPUA 1K82A 2WSCF 3GLFE 1YUBA 4QNMA 2DVWB 2UXDM 4D81A 2KEBA 3RGSA 1IBMM 3FUUA 3LW5F 1UFZA 4CISA 3VLFB 1WJ7A 4II7A 4M9XA 3VDPA 5EXTA 5ITRA 2EKKA 1P3QQ 2LWXA 2VIIA 4RKUF 4NSOB 1PJJA 1D0KA 3GLHA 3KXEC 2G8LA 2L4FA 1GJTA 1N34M 1ZMWA 1L1ZA 2JP7A 2VF7A 4NL4H 3QAUA 1NNUC 4AKGA 1XC8A 4IBGA 2L7HA 2RGHA 3T1YM 2Y20A 4M0WA 3WHLA 1IY0A 1YE9A 4FCWA 1CUKA 2IOUA 4IBCA 1DO0A 2R18A 2Y2KA 4XK8F 3GLIB 3FYDA 1JR3D 5JI3E 1XNQM 1W1TA 2L7IA 4WP2A 3KP1E 5KO3A 3FTDA 3HHWA 2VQFM 2K0BX 4TX8A 2L2DA 2LH0A 4F1IA 1N77A 4GKJM 2KDLA 3M0EA 2KHHA 2O01F 1AUAA 4DV1M 3VK8A 3DA1A 1AIWA 3T15A 4AG5A 1MN3A 4B7GA 2JY5A 2Z7JA 3FUVA 2M5ZA 3LVWA 4MGZE 4JI3M 2QP9X 4X65M 4NZ3A 4GHLA 2UXBM 3WX7A 2FS1A 2R46A 4EIWA 1W1YA 2XLJA 1PJSA 2JNHA 3SATA 1UR8A 1JR3A 4PCZA 3SMSA 1R5LA 4IBEA 3V76A 5KPZA 4X66M 1FJGM 3KSXA 2XZUA 2XD1A 3WD4A 2C9CA 1Z5CA 2YR0A 4PDIA 4LZZA 3QYBA 3GLIA 4Z2IA 4I4LA 1VG5A 1YU2A 4DR7M 2E5LM 3GLGE 3K92A 2QBYB 5ITQA 3HU2A 1TF0B 1H0GA 2HWJA 4QOSA 5FTNA 3JR4A 4GH9A 1Z59A 3U6MA 4P16A 4AKHA 4DR5M 1Q02A 1T43A 3U6EA 4GHAA 4MB7A 2KRKA 3SFZA 3GPYA 3TWMA 3GRYA 1OFHA 4QHTA 3VFDA 5A2QS 1XHBA 3AOEA 5FTKA 4OVZA 1KSFX 1OTRA 3ZH9B 2Y2NA 2QNJA 4UN2B 2BJVA 3LVVA 3K9PA 1GL6A 1N36M 1K3XA 3MQLA 2X8AA 4DR2M 4OJLA 4MGKE 3I4YA 1SXJC 5DYGA 3VKHA 5DFLA 2XD5A 3IG5A 1IBKM 1J09A 3GPPA 3KDSE 4MH0E 3IECA 2XZFA 4G4QA 2JZ0A 2C5RA 1D2NA 3CF2A 3GLGB 1R2YA 4NZ4A 2GQFA 4LZJA 1GL7A 5IREB 1NV8A 5LMNM 3MK6A 4I8OA 3U6PA 2FNAA 2KXEA 1HQCA 4L15A 2F5SA 2OQ4A 2I7PA 1SXJA 2KA6B 4PT5A 4ITQA 1IN7A 5EXSA 4NRWA 1N33M 4LF4M 1YU4A 1KS0A 1KYIA 3B7NA 4HEOA 4MM3B 4XBOA 2KW0A 2XEPA 1HT2E 1QZEA 4KT0F 3HU1A 2V1UA 2C96A 3Q8XA 1RU3A 2H5XA 3FUXA 1XMOM 1IM2A 1HT1E 2MH8A 5L8RF 2R45A 1CK7A 3J7BA 2C98A 4RNAA 3GO8A 2CV1A 1DGHA 4LF6M 4OJPA 3R8FA 4KO8A 3M6AA 1HJPA 1R6BX 4DUZM 1IN8A 1DGFA 1TDHA 2KNAA 3HX3A 3A98B 3SC3A 3U60B 4NOOB 1L6JA 1YUEA 2R44A 4NSRA 3ZC7B 2YNMD 1Q3BA 4B3RM 1UR9A 4QOZC 4FWHA 3TWKA 3QYEA 3BXWA 3A46A 4DR1M 5E26A 3SARA 2JZ1A 2R4JA 4G6ZA 4G4RA 3M7GA 1V33A 1WGLA 3K9OA 1PJTA 2DAKA 3B7QA 2EJSA 1GVNA 2DWZB 3LMMA 4K0KM 3EIEA 2QPAA 4BBAA 1W5TA 2QSFX 4CHTB 1L8QA 4NYUA 1IXSA 2BWBA 1OAOC 4L6V6 3KS4A 4FW9A 1QDRA 3CF0A 3KOYE 3LCVB 1MJGM 1Z5BA 1GPFA 3W67A 3KVWA 3AJIB 3AV0A 3TQSA 1N78A 2J7OA 1R4GA 2XFTA 1YLAA 2XH9A 4LRTA 2K6BA 3WHKA 1C1KA 1R2ZA 2CE7A 4ANRA 4OUIA 1L2CA 2N35A 3L26A 2J5YA 5EP4A 3SASA 4LJAA 2MROB 4B3SM 4Z6YA 3FTFA 4WW0A 2CRUA 4QNLA 7CATA 3T38A 1GXDA 4F2LA 4RF1A 3WD3A 2X4AA 3FD9A 5KPRA 2LTUA 1L2BA 3E9SA 1GABA 2LVQD 3SYKA 3ZCBB 4REZA 3KFUG 3R9XB 2LBCA 2KZUA 1GLNA 4MGYE 3RE8A 3L27A 1T6OA 5H37D 2LVOC 3B74A 4G3OA 4IBBA 4LRSA 2UWXA 4MB3A 4AKIA 3I51A 3J2PB 1HNXM 1QUSA 2Y2MA 2A5YB 3M7PA 2DWMA 2QENA 1QYRA 5IT9S 1J7MA 3B7ZA 3WD2A 4JV5M 3KSJA 2R65A 2Z4SA 3IHPA 4LGMA 5KPTA 3SHFA 1PGYA 3KOXE 3U61B 1JR3E 4QHSA 4CJ6A 1KFVA 2HL7A 3U6CA 3NBIA 1IN5A 2L4EA 3DZDA 1MX0A 4IJFA 2YFQA 4GC5A 3AL0C 4B3MM 2BJWA 1PJIA 2C9OA 5FTMA 3THGA 2CWBA 2X49A 1JB0F 4HLQA 2L6OA 4QNRA 2JWSA 2RKOA 2GNOA 1E94E 1XB2B 1XXHA 4G4OA 3QWLA 3W0LB 1OQYA 1VEJA 2WZJA 3HU3A 1E6NA 1K3WA 4NZ1A 2JY7A 3GLIE 4D82A 4M0DA 4L4UA 3J27B 1V34A 1Z6TA 2W82A 1NHWC 2F5OA 3W0FA 1LV7A 2BNKA 1QZMA 3SMPA 3HGIA 2ZM6M 2BWEA 2CP8A 2RGOA 4X62M 3U6SA 1H0IA 4OW0A 1Q3CA 8CATA 2Y2IA 3DFZA 2XGNA 2J7NA 4LF5M 1NJFA 2D7EA 5EXPA 1R7RA 4B3TM 1X37A 2JCHA 4LF7M 2F5PA 2ZBKB 3C58A 3FTEA 3LQQA 3RGPA 3NBXX 1WHCA 2F5QA 2KRUA 1NY5A 1G41A 2NQ8C 3C3DA 5E6JA 4JI8M 2KNZA 3JAMS 5DNYA 2DI0A 2K47A 1WXQA 2FE8A 1PM5A 2LNHC 3HSHA 3PNVA 1ZV1A 3J81S 2R0IA 1E6ZA 2Y2JA 2DAGA 1QDTA 4IJEA 4JI0M 3Q8GA 4PDGA 1IY2A 1OKSA 3U60A 2F4VM 2Y2GA 4JI5M 3A45A 3PVSA 3L28A 2V6ZM 2CHVA 2ZAOA 3KOWE 4NZ5A 2LVPC 3UMMA 1EFUB 1JQJC 3HJ8A 4DV3M 2Y2OA 1CXWA 2Y0QA 3C9PA 5FTLA 3B9PA 1IQPA 4LCBA 4B7FA 4FVMA 4GMQA 4IBDA 5LMUM 1F4IA 1E15A 4GITA 1WIVA 4YY3M 1E9SA 3FUTA 3UGJA 5EJCA 1WGNA 1QAMA 2C99A 3RFWA 1TH3A 1VDLA 5C1BA 2BG1A 2FN2A 4LF8M 4Z2LA 2EO2A 1Z5AA 2MR9A 3CF6E 1SXJB 2AHMA 1XXHB 4IIWA 4RF0A 2HCBA 3K1JA 4BB9A
chains in the Genus database with same CATH topology
4LF9M 2XSZD 1I4WA 1UM8A 2CHQA 2L09A 4DR4M 1QVRA 4DV2M 4IBFA 2FOIC 2DXIA 2DWLA 2LXEA 2YQZA 3U6LA 4JYAM 2UUAM 4OJ5A 2CEAA 2O5RA 4S12A 1Q39A 4JI7M 4LG2A 3TPZA 4W5WA 1G8PA 1L2DA 4MGIE 2CHGA 3AFHA 4Z8XA 4NXNM 1NNJA 2R4EA 4DV7M 2Z3XA 1YU1A 4DUYM 1IXZA 4FWDA 1W5SA 3UJNA 2V1CA 4LY6A 4LFBM 1XWIA 2CV2A 4FD2A 4DR6M 3GRRA 4ZPXA 1I94M 3K8ZA 4JN6A 3HJQA 4FWGA 5JI2E 5FLXS 3FKEA 3MJ5A 2QBYA 3L25A 1H6UA 4GC9A 5ITXA 4BLCA 3GQ5A 2KZSA 4DV5M 3AKZA 3SBJA 3GRUA 4X64M 1QQWA 4L78A 3PNYA 5ITUA 1NY6A 4JI1M 2Y21A 2I7NA 3HHYA 4DV6M 1NJGA 3KW6A 4LJ6A 5BPVA 2FFJA 3D8BA 4GIPA 4AZFA 4LGYA 4D80A 4AW4A 5FSWA 4R7GA 4CGYB 3ILKA 3I4VA 3SAVA 4OVZB 5F3WA 2XSZA 2ZAMA 4LJ9A 4A3VB 3FUWA 1XMQM 1QANA 3GP1A 3EIHA 1QAOA 1SXJD 3DOAA 5BR8M 3U6QA 4OX9M 4IBIA 1DGBA 2JE5A 3PXGA 4LJ5A 1ORYB 1XNRM 3HHXA 1IN6A 4WURA 4R3DA 4DV0M 1TDZA 1SXJE 4GKKM 4M9ZA 3TE6A 1HR0M 3GLGA 4NYYA 1L1TA 2FFFB 2F5NA 1HQYE 2Y2QA 4JI2M 4G4NA 4L8RC 4XGIA 5GKNA 1E32A 1NVMA 2ERCA 2CUZA 2CFOA 2H1RA 4B7HA 3CTWB 1N32M 3HJSA 5ITTA 3TL4X 4AI6A 2UU9M 4NRVA 4LJ8A 1DO2A 2D7HA 3SHGB 2G5GX 4AQYM 3FYCA 2Y2HA 4I81A 1GKIA 3KP0E 2Z4RA 4PD2A 5ITYA 3HWSA 1YU0A 3N3FA 4LFCM 2D7GA 2Y2LA 4I5SA 5IWAM 5ITXE 4NY2A 3AOEC 3JR5A 2VQEM 3SYLA 3AOGA 4IBKA 2EA0A 2EUCA 1TH4A 4DV4M 4HL4A 5EP1A 2CV0A 4MGHA 3FTCA 2ZANA 4GRIA 4KLNA 2UXCM 2QCUA 1G59A 1IN4A 4KODA 3A42A 3LQRA 4YHHM 1ZQ9A 2UUBM 1OJLA 5DYIA 4NXMM 3U61A 1IXSB 4OU7A 4FCTA 1G4AE 3U6DA 3PFIA 4M9SA 3HHZA 1N75A 3BOSA 1S3SA 3VK7A 3VKGA 3K2LA 4OJOA 1TGUA 1FNNA 4TUWA 3D8LA 4JI6M 2JA2A 3GLFA 3SAWA 2HHHM 4L16A 3MHVC 5C18A 2XFSA 4LFAM 3T1HM 4LJ4A 1G3IA 3HKPA 3J80S 4AG6A 1HNZM 1YSYA 3H4MA 3UK6A 3J7AS 4B08A 5FTJA 2DWNA 4FCVA 3L2AA 1E9RA 1NSFA 1OFIA 2Y0TA 2QZ4A 3U5ZB 1VDDA 1T3TA 1J7KA 3GQ3A 1J5EM 3L29A 5EQTA 2P5TA 4DR3M 1MU5A 1IY1A 1ZAEA 3GLFB 3KOZE 2DHRA 1QAQA 2DZOB 2Y2PA 3SAUA 1TH2A 1YU3A 3GQ4A 2R62A 3E4RA 1IXRC 2HKJA 5IZ7D 4OJ6A 2UUCM 1IBLM 1NHGC 3VDUA 2Q2EB 4JXJA 5KQDA 3HONA 2DZNB 3OTOM 1DGGA 3TWLA 2OPFA 3U5ZA 1HNWM 5EP3A 3IG8A 3U6OA 1EE8A 4LJ7A 4IBJA 3KS8A 2M60A 4KHPM 3GPXA 3GRVA 5EXXA 5EP2A 4JI4M 3GLHB 3UZUA 5KQ8A 2XF3A 1DGHB 3NWLA 3GPUA 1K82A 1YUBA 4QNMA 2DVWB 2UXDM 4D81A 2KEBA 3RGSA 1IBMM 3FUUA 4CISA 3VLFB 4II7A 4M9XA 3VDPA 5EXTA 5ITRA 2LWXA 2VIIA 4NSOB 1PJJA 3GLHA 3KXEC 2G8LA 1N34M 1L1ZA 4NL4H 3QAUA 1NNUC 4AKGA 1XC8A 4IBGA 2L7HA 2RGHA 3T1YM 2Y20A 4M0WA 3WHLA 1IY0A 1YE9A 4FCWA 2IOUA 4IBCA 1DO0A 2R18A 2Y2KA 3GLIB 3FYDA 1JR3D 5JI3E 1XNQM 2L7IA 3KP1E 5KO3A 3FTDA 3HHWA 2VQFM 4GKJM 2LH0A 1N77A 3M0EA 4DV1M 3VK8A 3DA1A 3T15A 4AG5A 4B7GA 4JI3M 2Z7JA 3FUVA 2M5ZA 3LVWA 4MGZE 2QP9X 4X65M 4NZ3A 4GHLA 2UXBM 3WX7A 2R46A 4EIWA 2XLJA 3SATA 1JR3A 4PCZA 3SMSA 4IBEA 5KPZA 4X66M 1FJGM 3KSXA 2XZUA 2XD1A 2C9CA 1Z5CA 2YR0A 4PDIA 4LZZA 3GLIA 4I4LA 1YU2A 4DR7M 2E5LM 3K92A 2QBYB 5ITQA 3HU2A 4QOSA 5FTNA 3JR4A 4GH9A 1Z59A 3U6MA 4P16A 4AKHA 4DR5M 3U6EA 4GHAA 4MB7A 2KRKA 3SFZA 3GPYA 3TWMA 3GRYA 1OFHA 4QHTA 3VFDA 5A2QS 1XHBA 3AOEA 5FTKA 4OVZA 1KSFX 3ZH9B 2Y2NA 2BJVA 3LVVA 1K3XA 1GL6A 1N36M 2X8AA 4DR2M 4OJLA 4MGKE 3I4YA 1SXJC 5DYGA 3VKHA 2XD5A 3IG5A 1IBKM 1J09A 3GPPA 3KDSE 4MH0E 2XZFA 4G4QA 2C5RA 1D2NA 3CF2A 3GLGB 1R2YA 4NZ4A 4LZJA 1GL7A 5IREB 5LMNM 3MK6A 4I8OA 3U6PA 2FNAA 2KXEA 1HQCA 4L15A 2F5SA 2OQ4A 2I7PA 1SXJA 2KA6B 4PT5A 4ITQA 1IN7A 5EXSA 4NRWA 1N33M 4LF4M 1YU4A 1KYIA 4MM3B 4XBOA 2KW0A 2XEPA 1HT2E 3HU1A 2V1UA 2C96A 3Q8XA 3FUXA 1XMOM 1IM2A 1HT1E 2R45A 3J7BA 2C98A 4RNAA 3GO8A 2CV1A 1DGHA 4LF6M 4OJPA 3R8FA 4KO8A 3M6AA 1R6BX 4DUZM 1IN8A 1DGFA 1TDHA 3U60B 3A98B 3SC3A 1YUEA 4NOOB 4NSRA 3ZC7B 2YNMD 1Q3BA 4B3RM 4QOZC 4FWHA 3TWKA 3A46A 4DR1M 5E26A 3SARA 2R4JA 4G6ZA 4G4RA 3M7GA 1GVNA 2DWZB 3LMMA 4K0KM 3EIEA 2QPAA 4BBAA 1W5TA 4CHTB 1L8QA 4NYUA 3KS4A 4FW9A 3CF0A 3KOYE 1Z5BA 3KVWA 3AJIB 3AV0A 3TQSA 1N78A 2J7OA 4LRTA 2XFTA 2XH9A 3WHKA 1C1KA 1R2ZA 2CE7A 4OUIA 1L2CA 3L26A 5EP4A 3SASA 4LJAA 4B3SM 4Z6YA 3FTFA 4WW0A 4QNLA 7CATA 3T38A 4RF1A 2X4AA 3FD9A 5KPRA 1L2BA 3E9SA 3SYKA 3ZCBB 3KFUG 4REZA 3R9XB 2KZUA 1GLNA 4MGYE 3RE8A 3L27A 5H37D 5KPTA 4IBBA 4LRSA 2UWXA 4AKIA 3I51A 3J2PB 1HNXM 2Y2MA 2A5YB 2DWMA 2QENA 1QYRA 5IT9S 4JV5M 3KSJA 2R65A 2Z4SA 4LGMA 3SHFA 3KOXE 3U61B 4QHSA 1KFVA 2HL7A 3U6CA 3NBIA 1IN5A 3DZDA 1MX0A 4IJFA 2YFQA 4GC5A 3AL0C 4B3MM 2BJWA 1PJIA 2C9OA 5FTMA 3THGA 2X49A 4HLQA 2L6OA 4QNRA 2RKOA 1E94E 1XXHA 4G4OA 3QWLA 3W0LB 3HU3A 4NZ1A 1K3WA 4D82A 4M0DA 4L4UA 3J27B 2F5OA 1Z6TA 2W82A 1NHWC 3W0FA 1LV7A 2BNKA 1QZMA 3SMPA 3HGIA 2ZM6M 2RGOA 4X62M 3U6SA 4OW0A 1Q3CA 8CATA 2Y2IA 3DFZA 2XGNA 2J7NA 4LF5M 1NJFA 2D7EA 5EXPA 1R7RA 4B3TM 1X37A 2JCHA 4LF7M 2F5PA 2ZBKB 3C58A 3FTEA 3LQQA 3RGPA 2F5QA 2KRUA 1NY5A 1G41A 2NQ8C 5E6JA 4JI8M 3JAMS 5DNYA 2K47A 1WXQA 2FE8A 1PM5A 2LNHC 3HSHA 3PNVA 3J81S 2Y2JA 4JI0M 4IJEA 4PDGA 1IY2A 3U60A 2F4VM 2Y2GA 4JI5M 3A45A 3PVSA 3L28A 2V6ZM 2CHVA 2ZAOA 3KOWE 4NZ5A 3UMMA 4DV3M 1JQJC 3HJ8A 2Y2OA 2Y0QA 5FTLA 3B9PA 1IQPA 4LCBA 4B7FA 4FVMA 4GMQA 4IBDA 5LMUM 4GITA 4YY3M 1E9SA 3FUTA 3UGJA 5EJCA 1QAMA 2C99A 3RFWA 1TH3A 5C1BA 2BG1A 4LF8M 2EO2A 1Z5AA 3CF6E 1SXJB 2AHMA 1XXHB 4IIWA 4RF0A 2HCBA 3K1JA 4BB9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L26 A;  4GHL A;  4IBF A;  3L28 A;  3L2A A;  3L25 A;  3FKE A;  4IBI A;  4IBE A;  4IBJ A;  4IJF A;  3KS8 A;  4IBG A;  3L29 A;  4IBD A;  4LG2 A;  3L27 A;  4IBB A;  4IBC A;  3KS4 A;  5BPV A;  4GH9 A;  4IBK A;  4GHA A;  4IJE A; 
#chains in the Genus database with same CATH topology
 4LF9 M;  2VF8 A;  2JXN A;  1E8B A;  2XSZ D;  1I4W A;  1QUT A;  1UM8 A;  2CHQ A;  2L09 A;  4DR4 M;  1DV0 A;  1QVR A;  1W1V A;  4DV2 M;  4IBF A;  2FOI C;  1VEG A;  2DXI A;  1NV9 A;  2DWL A;  3HZJ A;  2LXE A;  2YQZ A;  3U6L A;  4JYA M;  2UUA M;  4OJ5 A;  1IFY A;  2CEA A;  2O5R A;  3T6P A;  4S12 A;  1Q39 A;  4JI7 M;  4LG2 A;  2LHC A;  3TPZ A;  4W5W A;  1G8P A;  1L2D A;  4MGI E;  1GO5 A;  2CHG A;  3AFH A;  4Z8X A;  4NXN M;  1NNJ A;  2R4E A;  4DV7 M;  2Z3X A;  1YU1 A;  2LHG A;  4DUY M;  1IXZ A;  4FWD A;  1QO6 A;  1W5S A;  3UJN A;  2V1C A;  4LY6 A;  4LFB M;  1XWI A;  2CV2 A;  4FD2 A;  4DR6 M;  3GRR A;  4ZPX A;  1I94 M;  3K8Z A;  4JN6 A;  3CGW A;  3HJQ A;  1OAI A;  4FWG A;  5JI2 E;  3FKE A;  1VQ1 A;  3MJ5 A;  5FLX S;  2QBY A;  3L25 A;  1GJS A;  1H6U A;  4GC9 A;  5ITX A;  4BLC A;  3MMP A;  3GQ5 A;  2KZS A;  4DV5 M;  3AKZ A;  3SBJ A;  1ZMU A;  3GRU A;  4X64 M;  1QQW A;  4L78 A;  3PNY A;  5ITU A;  1AIP C;  1NY6 A;  3B89 A;  4JI1 M;  2Y21 A;  2I7N A;  2KNV A;  3HHY A;  4DV6 M;  1NJG A;  3KW6 A;  4LJ6 A;  5BPV A;  2FFJ A;  3HY5 A;  1EAK A;  3D8B A;  4GIP A;  1PRB A;  4AZF A;  4LGY A;  4D80 A;  4MB4 A;  3FRI A;  4AW4 A;  5FSW A;  4R7G A;  4CGY B;  1SG9 A;  3ILK A;  3I4V A;  1VEK A;  3SAV A;  4OVZ B;  1H8P A;  1OGG A;  1W1P A;  5F3W A;  2XSZ A;  2ZAM A;  4LJ9 A;  4A3V B;  3FUW A;  1XMQ M;  1QAN A;  2DAI A;  2DKL A;  3GP1 A;  3EIH A;  4GEW A;  1QAO A;  1SXJ D;  3DOA A;  5BR8 M;  3U6Q A;  4OX9 M;  1D0L A;  4IBI A;  1DGB A;  2JE5 A;  3PXG A;  4LJ5 A;  1A5T A;  1ORY B;  1XNR M;  2OOB A;  3HHX A;  1IN6 A;  4WUR A;  4R3D A;  1WR1 B;  4DV0 M;  1TDZ A;  1SXJ E;  4GKK M;  4M9Z A;  3TE6 A;  1HR0 M;  3GLG A;  4NYY A;  1L1T A;  2JUJ A;  2FFF B;  2F5N A;  1HQY E;  2Y2Q A;  4JI2 M;  4G4N A;  2RRU A;  4L8R C;  1NO1 A;  3BBZ A;  4XGI A;  5GKN A;  1E32 A;  1NVM A;  1XXH E;  2ERC A;  2CUZ A;  4NC6 A;  2CFO A;  2H1R A;  4B7H A;  3CTW B;  3FE3 A;  2QQ8 A;  1N32 M;  1ED7 A;  3HJS A;  5ITT A;  2VDB B;  3TL4 X;  4AI6 A;  1D0M A;  2UU9 M;  1E6P A;  4HMC A;  4NRV A;  3WD1 A;  4LJ8 A;  1DO2 A;  2DNA A;  3H4J A;  2D7H A;  4Y28 F;  3SHG B;  2G5G X;  2OOA A;  3E21 A;  4AQY M;  2WSF F;  3FYC A;  2Y2H A;  4I81 A;  2ZTC A;  1GKI A;  3KP0 E;  2Z4R A;  4PD2 A;  5ITY A;  3HWS A;  1YU0 A;  2FH0 A;  4Z2H A;  3N3F A;  4LFC M;  2D7G A;  2DAE A;  2Y2L A;  4I5S A;  5IWA M;  5ITX E;  4HME A;  3I01 M;  4NY2 A;  3AOE C;  2WSE F;  1C7Y A;  3JR5 A;  2VQE M;  3SYL A;  3AOG A;  2HAK A;  4IBK A;  1PJQ A;  2EA0 A;  2EUC A;  4MB5 A;  1ZMV A;  1TTE A;  1TH4 A;  4DV4 M;  1EIJ A;  4Z2J A;  4HL4 A;  5EP1 A;  4DBG B;  2CV0 A;  4MGH A;  3FTC A;  2ZAN A;  4GRI A;  2JY6 B;  4KLN A;  2UXC M;  2QHO B;  2QCU A;  1G59 A;  1OGB A;  1O6I A;  1V92 A;  1IN4 A;  4KOD A;  3A42 A;  3LQR A;  4YHH M;  1ZQ9 A;  2UUB M;  1OJL A;  5DYI A;  4NXM M;  3U61 A;  1IXS B;  4OU7 A;  4FCT A;  1G4A E;  3U6D A;  4R71 A;  1GOI A;  3PFI A;  2G3Q A;  4M9S A;  3HHZ A;  1N75 A;  2DZL A;  3BOS A;  1S3S A;  3VK7 A;  3VKG A;  3K2L A;  4OJO A;  4Q7J A;  1TGU A;  4Z2G A;  1FNN A;  4TUW A;  3D8L A;  4JI6 M;  1Y8G A;  2JA2 A;  3GLF A;  2K9D A;  3SAW A;  2HHH M;  2LVA A;  4L16 A;  3MHV C;  5C18 A;  2XFS A;  4LFA M;  3ZQJ A;  3T1H M;  4LJ4 A;  2EKF A;  3F92 A;  1G3I A;  3HKP A;  3J80 S;  4AG6 A;  1HNZ M;  1YSY A;  3H4M A;  3UK6 A;  3J7A S;  1E6R A;  4HMD A;  4B08 A;  5FTJ A;  3FRH A;  2DWN A;  4FCV A;  3L2A A;  1E9R A;  1NSF A;  1OFI A;  2Y0T A;  2QZ4 A;  3U5Z B;  1VDD A;  1T3T A;  1J7K A;  3GQ3 A;  1E88 A;  1LTM A;  1J5E M;  2APL A;  2ZTD A;  2P5T A;  3L29 A;  5EQT A;  4DR3 M;  2B3T A;  1MU5 A;  1IY1 A;  1ZAE A;  3GLF B;  3KOZ E;  2RTS A;  2DHR A;  1QAQ A;  1OIP A;  2DZO B;  3E46 A;  2Y2P A;  3SAU A;  1TH2 A;  1OIZ A;  2DAM A;  2MJ5 B;  1YU3 A;  2V5O A;  3GQ4 A;  2R62 A;  2Z8Y M;  2O25 A;  3E4R A;  1IXR C;  2HKJ A;  3GLH E;  5IZ7 D;  3I04 M;  4OJ6 A;  2UUC M;  2D49 A;  1IBL M;  1NHG C;  3VDU A;  2Q2E B;  4JXJ A;  1TR8 A;  2DHY A;  3LCU A;  5KQD A;  2LVN C;  2DZN B;  3OTO M;  1DGG A;  3HON A;  1BVS A;  4Z2K A;  3TWL A;  2OPF A;  3U5Z A;  1HNW M;  3WD0 A;  3C3E A;  2MGW A;  2JY8 A;  3IG8 A;  5EP3 A;  3U6O A;  1EE8 A;  4LJ7 A;  4IBJ A;  3KS8 A;  4P17 A;  2M60 A;  4KHP M;  3W68 A;  3GPX A;  3GRV A;  5EXX A;  1PDC A;  5EP2 A;  4JI4 M;  3GLH B;  3UZU A;  4CIZ A;  5KQ8 A;  2DEN A;  2XF3 A;  1DGH B;  2OO9 A;  2R6F A;  1G71 A;  3NWL A;  3GPU A;  1K82 A;  2WSC F;  3GLF E;  1YUB A;  4QNM A;  2DVW B;  2UXD M;  4D81 A;  2KEB A;  3RGS A;  1IBM M;  3FUU A;  3LW5 F;  1UFZ A;  4CIS A;  3VLF B;  1WJ7 A;  4II7 A;  4M9X A;  3VDP A;  5EXT A;  5ITR A;  2EKK A;  1P3Q Q;  2LWX A;  2VII A;  4RKU F;  4NSO B;  1PJJ A;  1D0K A;  3GLH A;  3KXE C;  2G8L A;  2L4F A;  1GJT A;  1N34 M;  1ZMW A;  1L1Z A;  2JP7 A;  2VF7 A;  4NL4 H;  3QAU A;  1NNU C;  4AKG A;  1XC8 A;  4IBG A;  2L7H A;  2RGH A;  3T1Y M;  2Y20 A;  4M0W A;  3WHL A;  1IY0 A;  1YE9 A;  4FCW A;  1CUK A;  2IOU A;  4IBC A;  1DO0 A;  2R18 A;  2Y2K A;  4XK8 F;  3GLI B;  3FYD A;  1JR3 D;  5JI3 E;  1XNQ M;  1W1T A;  2L7I A;  4WP2 A;  3KP1 E;  5KO3 A;  3FTD A;  3HHW A;  2VQF M;  2K0B X;  4TX8 A;  2L2D A;  2LH0 A;  4F1I A;  1N77 A;  4GKJ M;  2KDL A;  3M0E A;  2KHH A;  2O01 F;  1AUA A;  4DV1 M;  3VK8 A;  3DA1 A;  1AIW A;  3T15 A;  4AG5 A;  1MN3 A;  4B7G A;  2JY5 A;  2Z7J A;  3FUV A;  2M5Z A;  3LVW A;  4MGZ E;  4JI3 M;  2QP9 X;  4X65 M;  4NZ3 A;  4GHL A;  2UXB M;  3WX7 A;  2FS1 A;  2R46 A;  4EIW A;  1W1Y A;  2XLJ A;  1PJS A;  2JNH A;  3SAT A;  1UR8 A;  1JR3 A;  4PCZ A;  3SMS A;  1R5L A;  4IBE A;  3V76 A;  5KPZ A;  4X66 M;  1FJG M;  3KSX A;  2XZU A;  2XD1 A;  3WD4 A;  2C9C A;  1Z5C A;  2YR0 A;  4PDI A;  4LZZ A;  3QYB A;  3GLI A;  4Z2I A;  4I4L A;  1VG5 A;  1YU2 A;  4DR7 M;  2E5L M;  3GLG E;  3K92 A;  2QBY B;  5ITQ A;  3HU2 A;  1TF0 B;  1H0G A;  2HWJ A;  4QOS A;  5FTN A;  3JR4 A;  4GH9 A;  1Z59 A;  3U6M A;  4P16 A;  4AKH A;  4DR5 M;  1Q02 A;  1T43 A;  3U6E A;  4GHA A;  4MB7 A;  2KRK A;  3SFZ A;  3GPY A;  3TWM A;  3GRY A;  1OFH A;  4QHT A;  3VFD A;  5A2Q S;  1XHB A;  3AOE A;  5FTK A;  4OVZ A;  1KSF X;  1OTR A;  3ZH9 B;  2Y2N A;  2QNJ A;  4UN2 B;  2BJV A;  3LVV A;  3K9P A;  1GL6 A;  1N36 M;  1K3X A;  3MQL A;  2X8A A;  4DR2 M;  4OJL A;  4MGK E;  3I4Y A;  1SXJ C;  5DYG A;  3VKH A;  5DFL A;  2XD5 A;  3IG5 A;  1IBK M;  1J09 A;  3GPP A;  3KDS E;  4MH0 E;  3IEC A;  2XZF A;  4G4Q A;  2JZ0 A;  2C5R A;  1D2N A;  3CF2 A;  3GLG B;  1R2Y A;  4NZ4 A;  2GQF A;  4LZJ A;  1GL7 A;  5IRE B;  1NV8 A;  5LMN M;  3MK6 A;  4I8O A;  3U6P A;  2FNA A;  2KXE A;  1HQC A;  4L15 A;  2F5S A;  2OQ4 A;  2I7P A;  1SXJ A;  2KA6 B;  4PT5 A;  4ITQ A;  1IN7 A;  5EXS A;  4NRW A;  1N33 M;  4LF4 M;  1YU4 A;  1KS0 A;  1KYI A;  3B7N A;  4HEO A;  4MM3 B;  4XBO A;  2KW0 A;  2XEP A;  1HT2 E;  1QZE A;  4KT0 F;  3HU1 A;  2V1U A;  2C96 A;  3Q8X A;  1RU3 A;  2H5X A;  3FUX A;  1XMO M;  1IM2 A;  1HT1 E;  2MH8 A;  5L8R F;  2R45 A;  1CK7 A;  3J7B A;  2C98 A;  4RNA A;  3GO8 A;  2CV1 A;  1DGH A;  4LF6 M;  4OJP A;  3R8F A;  4KO8 A;  3M6A A;  1HJP A;  1R6B X;  4DUZ M;  1IN8 A;  1DGF A;  1TDH A;  2KNA A;  3HX3 A;  3A98 B;  3SC3 A;  3U60 B;  4NOO B;  1L6J A;  1YUE A;  2R44 A;  4NSR A;  3ZC7 B;  2YNM D;  1Q3B A;  4B3R M;  1UR9 A;  4QOZ C;  4FWH A;  3TWK A;  3QYE A;  3BXW A;  3A46 A;  4DR1 M;  5E26 A;  3SAR A;  2JZ1 A;  2R4J A;  4G6Z A;  4G4R A;  3M7G A;  1V33 A;  1WGL A;  3K9O A;  1PJT A;  2DAK A;  3B7Q A;  2EJS A;  1GVN A;  2DWZ B;  3LMM A;  4K0K M;  3EIE A;  2QPA A;  4BBA A;  1W5T A;  2QSF X;  4CHT B;  1L8Q A;  4NYU A;  1IXS A;  2BWB A;  1OAO C;  4L6V 6;  3KS4 A;  4FW9 A;  1QDR A;  3CF0 A;  3KOY E;  3LCV B;  1MJG M;  1Z5B A;  1GPF A;  3W67 A;  3KVW A;  3AJI B;  3AV0 A;  3TQS A;  1N78 A;  2J7O A;  1R4G A;  2XFT A;  1YLA A;  2XH9 A;  4LRT A;  2K6B A;  3WHK A;  1C1K A;  1R2Z A;  2CE7 A;  4ANR A;  4OUI A;  1L2C A;  2N35 A;  3L26 A;  2J5Y A;  5EP4 A;  3SAS A;  4LJA A;  2MRO B;  4B3S M;  4Z6Y A;  3FTF A;  4WW0 A;  2CRU A;  4QNL A;  7CAT A;  3T38 A;  1GXD A;  4F2L A;  4RF1 A;  3WD3 A;  2X4A A;  3FD9 A;  5KPR A;  2LTU A;  1L2B A;  3E9S A;  1GAB A;  2LVQ D;  3SYK A;  3ZCB B;  4REZ A;  3KFU G;  3R9X B;  2LBC A;  2KZU A;  1GLN A;  4MGY E;  3RE8 A;  3L27 A;  1T6O A;  5H37 D;  2LVO C;  3B74 A;  4G3O A;  4IBB A;  4LRS A;  2UWX A;  4MB3 A;  4AKI A;  3I51 A;  3J2P B;  1HNX M;  1QUS A;  2Y2M A;  2A5Y B;  3M7P A;  2DWM A;  2QEN A;  1QYR A;  5IT9 S;  1J7M A;  3B7Z A;  3WD2 A;  4JV5 M;  3KSJ A;  2R65 A;  2Z4S A;  3IHP A;  4LGM A;  5KPT A;  3SHF A;  1PGY A;  3KOX E;  3U61 B;  1JR3 E;  4QHS A;  4CJ6 A;  1KFV A;  2HL7 A;  3U6C A;  3NBI A;  1IN5 A;  2L4E A;  3DZD A;  1MX0 A;  4IJF A;  2YFQ A;  4GC5 A;  3AL0 C;  4B3M M;  2BJW A;  1PJI A;  2C9O A;  5FTM A;  3THG A;  2CWB A;  2X49 A;  1JB0 F;  4HLQ A;  2L6O A;  4QNR A;  2JWS A;  2RKO A;  2GNO A;  1E94 E;  1XB2 B;  1XXH A;  4G4O A;  3QWL A;  3W0L B;  1OQY A;  1VEJ A;  2WZJ A;  3HU3 A;  1E6N A;  1K3W A;  4NZ1 A;  2JY7 A;  3GLI E;  4D82 A;  4M0D A;  4L4U A;  3J27 B;  1V34 A;  1Z6T A;  2W82 A;  1NHW C;  2F5O A;  3W0F A;  1LV7 A;  2BNK A;  1QZM A;  3SMP A;  3HGI A;  2ZM6 M;  2BWE A;  2CP8 A;  2RGO A;  4X62 M;  3U6S A;  1H0I A;  4OW0 A;  1Q3C A;  8CAT A;  2Y2I A;  3DFZ A;  2XGN A;  2J7N A;  4LF5 M;  1NJF A;  2D7E A;  5EXP A;  1R7R A;  4B3T M;  1X37 A;  2JCH A;  4LF7 M;  2F5P A;  2ZBK B;  3C58 A;  3FTE A;  3LQQ A;  3RGP A;  3NBX X;  1WHC A;  2F5Q A;  2KRU A;  1NY5 A;  1G41 A;  2NQ8 C;  3C3D A;  5E6J A;  4JI8 M;  2KNZ A;  3JAM S;  5DNY A;  2DI0 A;  2K47 A;  1WXQ A;  2FE8 A;  1PM5 A;  2LNH C;  3HSH A;  3PNV A;  1ZV1 A;  3J81 S;  2R0I A;  1E6Z A;  2Y2J A;  2DAG A;  1QDT A;  4IJE A;  4JI0 M;  3Q8G A;  4PDG A;  1IY2 A;  1OKS A;  3U60 A;  2F4V M;  2Y2G A;  4JI5 M;  3A45 A;  3PVS A;  3L28 A;  2V6Z M;  2CHV A;  2ZAO A;  3KOW E;  4NZ5 A;  2LVP C;  3UMM A;  1EFU B;  1JQJ C;  3HJ8 A;  4DV3 M;  2Y2O A;  1CXW A;  2Y0Q A;  3C9P A;  5FTL A;  3B9P A;  1IQP A;  4LCB A;  4B7F A;  4FVM A;  4GMQ A;  4IBD A;  5LMU M;  1F4I A;  1E15 A;  4GIT A;  1WIV A;  4YY3 M;  1E9S A;  3FUT A;  3UGJ A;  5EJC A;  1WGN A;  1QAM A;  2C99 A;  3RFW A;  1TH3 A;  1VDL A;  5C1B A;  2BG1 A;  2FN2 A;  4LF8 M;  4Z2L A;  2EO2 A;  1Z5A A;  2MR9 A;  3CF6 E;  1SXJ B;  2AHM A;  1XXH B;  4IIW A;  4RF0 A;  2HCB A;  3K1J A;  4BB9 A; 
#chains in the Genus database with same CATH homology
 4LF9 M;  2XSZ D;  1I4W A;  1UM8 A;  2CHQ A;  2L09 A;  4DR4 M;  1QVR A;  4DV2 M;  4IBF A;  2FOI C;  2DXI A;  2DWL A;  2LXE A;  2YQZ A;  3U6L A;  4JYA M;  2UUA M;  4OJ5 A;  2CEA A;  2O5R A;  4S12 A;  1Q39 A;  4JI7 M;  4LG2 A;  3TPZ A;  4W5W A;  1G8P A;  1L2D A;  4MGI E;  2CHG A;  3AFH A;  4Z8X A;  4NXN M;  1NNJ A;  2R4E A;  4DV7 M;  2Z3X A;  1YU1 A;  4DUY M;  1IXZ A;  4FWD A;  1W5S A;  3UJN A;  2V1C A;  4LY6 A;  4LFB M;  1XWI A;  2CV2 A;  4FD2 A;  4DR6 M;  3GRR A;  4ZPX A;  1I94 M;  3K8Z A;  4JN6 A;  3HJQ A;  4FWG A;  5JI2 E;  5FLX S;  3FKE A;  3MJ5 A;  2QBY A;  3L25 A;  1H6U A;  4GC9 A;  5ITX A;  4BLC A;  3GQ5 A;  2KZS A;  4DV5 M;  3AKZ A;  3SBJ A;  3GRU A;  4X64 M;  1QQW A;  4L78 A;  3PNY A;  5ITU A;  1NY6 A;  4JI1 M;  2Y21 A;  2I7N A;  3HHY A;  4DV6 M;  1NJG A;  3KW6 A;  4LJ6 A;  5BPV A;  2FFJ A;  3D8B A;  4GIP A;  4AZF A;  4LGY A;  4D80 A;  4AW4 A;  5FSW A;  4R7G A;  4CGY B;  3ILK A;  3I4V A;  3SAV A;  4OVZ B;  5F3W A;  2XSZ A;  2ZAM A;  4LJ9 A;  4A3V B;  3FUW A;  1XMQ M;  1QAN A;  3GP1 A;  3EIH A;  1QAO A;  1SXJ D;  3DOA A;  5BR8 M;  3U6Q A;  4OX9 M;  4IBI A;  1DGB A;  2JE5 A;  3PXG A;  4LJ5 A;  1ORY B;  1XNR M;  3HHX A;  1IN6 A;  4WUR A;  4R3D A;  4DV0 M;  1TDZ A;  1SXJ E;  4GKK M;  4M9Z A;  3TE6 A;  1HR0 M;  3GLG A;  4NYY A;  1L1T A;  2FFF B;  2F5N A;  1HQY E;  2Y2Q A;  4JI2 M;  4G4N A;  4L8R C;  4XGI A;  5GKN A;  1E32 A;  1NVM A;  2ERC A;  2CUZ A;  2CFO A;  2H1R A;  4B7H A;  3CTW B;  1N32 M;  3HJS A;  5ITT A;  3TL4 X;  4AI6 A;  2UU9 M;  4NRV A;  4LJ8 A;  1DO2 A;  2D7H A;  3SHG B;  2G5G X;  4AQY M;  3FYC A;  2Y2H A;  4I81 A;  1GKI A;  3KP0 E;  2Z4R A;  4PD2 A;  5ITY A;  3HWS A;  1YU0 A;  3N3F A;  4LFC M;  2D7G A;  2Y2L A;  4I5S A;  5IWA M;  5ITX E;  4NY2 A;  3AOE C;  3JR5 A;  2VQE M;  3SYL A;  3AOG A;  4IBK A;  2EA0 A;  2EUC A;  1TH4 A;  4DV4 M;  4HL4 A;  5EP1 A;  2CV0 A;  4MGH A;  3FTC A;  2ZAN A;  4GRI A;  4KLN A;  2UXC M;  2QCU A;  1G59 A;  1IN4 A;  4KOD A;  3A42 A;  3LQR A;  4YHH M;  1ZQ9 A;  2UUB M;  1OJL A;  5DYI A;  4NXM M;  3U61 A;  1IXS B;  4OU7 A;  4FCT A;  1G4A E;  3U6D A;  3PFI A;  4M9S A;  3HHZ A;  1N75 A;  3BOS A;  1S3S A;  3VK7 A;  3VKG A;  3K2L A;  4OJO A;  1TGU A;  1FNN A;  4TUW A;  3D8L A;  4JI6 M;  2JA2 A;  3GLF A;  3SAW A;  2HHH M;  4L16 A;  3MHV C;  5C18 A;  2XFS A;  4LFA M;  3T1H M;  4LJ4 A;  1G3I A;  3HKP A;  3J80 S;  4AG6 A;  1HNZ M;  1YSY A;  3H4M A;  3UK6 A;  3J7A S;  4B08 A;  5FTJ A;  2DWN A;  4FCV A;  3L2A A;  1E9R A;  1NSF A;  1OFI A;  2Y0T A;  2QZ4 A;  3U5Z B;  1VDD A;  1T3T A;  1J7K A;  3GQ3 A;  1J5E M;  3L29 A;  5EQT A;  2P5T A;  4DR3 M;  1MU5 A;  1IY1 A;  1ZAE A;  3GLF B;  3KOZ E;  2DHR A;  1QAQ A;  2DZO B;  2Y2P A;  3SAU A;  1TH2 A;  1YU3 A;  3GQ4 A;  2R62 A;  3E4R A;  1IXR C;  2HKJ A;  5IZ7 D;  4OJ6 A;  2UUC M;  1IBL M;  1NHG C;  3VDU A;  2Q2E B;  4JXJ A;  5KQD A;  3HON A;  2DZN B;  3OTO M;  1DGG A;  3TWL A;  2OPF A;  3U5Z A;  1HNW M;  5EP3 A;  3IG8 A;  3U6O A;  1EE8 A;  4LJ7 A;  4IBJ A;  3KS8 A;  2M60 A;  4KHP M;  3GPX A;  3GRV A;  5EXX A;  5EP2 A;  4JI4 M;  3GLH B;  3UZU A;  5KQ8 A;  2XF3 A;  1DGH B;  3NWL A;  3GPU A;  1K82 A;  1YUB A;  4QNM A;  2DVW B;  2UXD M;  4D81 A;  2KEB A;  3RGS A;  1IBM M;  3FUU A;  4CIS A;  3VLF B;  4II7 A;  4M9X A;  3VDP A;  5EXT A;  5ITR A;  2LWX A;  2VII A;  4NSO B;  1PJJ A;  3GLH A;  3KXE C;  2G8L A;  1N34 M;  1L1Z A;  4NL4 H;  3QAU A;  1NNU C;  4AKG A;  1XC8 A;  4IBG A;  2L7H A;  2RGH A;  3T1Y M;  2Y20 A;  4M0W A;  3WHL A;  1IY0 A;  1YE9 A;  4FCW A;  2IOU A;  4IBC A;  1DO0 A;  2R18 A;  2Y2K A;  3GLI B;  3FYD A;  1JR3 D;  5JI3 E;  1XNQ M;  2L7I A;  3KP1 E;  5KO3 A;  3FTD A;  3HHW A;  2VQF M;  4GKJ M;  2LH0 A;  1N77 A;  3M0E A;  4DV1 M;  3VK8 A;  3DA1 A;  3T15 A;  4AG5 A;  4B7G A;  4JI3 M;  2Z7J A;  3FUV A;  2M5Z A;  3LVW A;  4MGZ E;  2QP9 X;  4X65 M;  4NZ3 A;  4GHL A;  2UXB M;  3WX7 A;  2R46 A;  4EIW A;  2XLJ A;  3SAT A;  1JR3 A;  4PCZ A;  3SMS A;  4IBE A;  5KPZ A;  4X66 M;  1FJG M;  3KSX A;  2XZU A;  2XD1 A;  2C9C A;  1Z5C A;  2YR0 A;  4PDI A;  4LZZ A;  3GLI A;  4I4L A;  1YU2 A;  4DR7 M;  2E5L M;  3K92 A;  2QBY B;  5ITQ A;  3HU2 A;  4QOS A;  5FTN A;  3JR4 A;  4GH9 A;  1Z59 A;  3U6M A;  4P16 A;  4AKH A;  4DR5 M;  3U6E A;  4GHA A;  4MB7 A;  2KRK A;  3SFZ A;  3GPY A;  3TWM A;  3GRY A;  1OFH A;  4QHT A;  3VFD A;  5A2Q S;  1XHB A;  3AOE A;  5FTK A;  4OVZ A;  1KSF X;  3ZH9 B;  2Y2N A;  2BJV A;  3LVV A;  1K3X A;  1GL6 A;  1N36 M;  2X8A A;  4DR2 M;  4OJL A;  4MGK E;  3I4Y A;  1SXJ C;  5DYG A;  3VKH A;  2XD5 A;  3IG5 A;  1IBK M;  1J09 A;  3GPP A;  3KDS E;  4MH0 E;  2XZF A;  4G4Q A;  2C5R A;  1D2N A;  3CF2 A;  3GLG B;  1R2Y A;  4NZ4 A;  4LZJ A;  1GL7 A;  5IRE B;  5LMN M;  3MK6 A;  4I8O A;  3U6P A;  2FNA A;  2KXE A;  1HQC A;  4L15 A;  2F5S A;  2OQ4 A;  2I7P A;  1SXJ A;  2KA6 B;  4PT5 A;  4ITQ A;  1IN7 A;  5EXS A;  4NRW A;  1N33 M;  4LF4 M;  1YU4 A;  1KYI A;  4MM3 B;  4XBO A;  2KW0 A;  2XEP A;  1HT2 E;  3HU1 A;  2V1U A;  2C96 A;  3Q8X A;  3FUX A;  1XMO M;  1IM2 A;  1HT1 E;  2R45 A;  3J7B A;  2C98 A;  4RNA A;  3GO8 A;  2CV1 A;  1DGH A;  4LF6 M;  4OJP A;  3R8F A;  4KO8 A;  3M6A A;  1R6B X;  4DUZ M;  1IN8 A;  1DGF A;  1TDH A;  3U60 B;  3A98 B;  3SC3 A;  1YUE A;  4NOO B;  4NSR A;  3ZC7 B;  2YNM D;  1Q3B A;  4B3R M;  4QOZ C;  4FWH A;  3TWK A;  3A46 A;  4DR1 M;  5E26 A;  3SAR A;  2R4J A;  4G6Z A;  4G4R A;  3M7G A;  1GVN A;  2DWZ B;  3LMM A;  4K0K M;  3EIE A;  2QPA A;  4BBA A;  1W5T A;  4CHT B;  1L8Q A;  4NYU A;  3KS4 A;  4FW9 A;  3CF0 A;  3KOY E;  1Z5B A;  3KVW A;  3AJI B;  3AV0 A;  3TQS A;  1N78 A;  2J7O A;  4LRT A;  2XFT A;  2XH9 A;  3WHK A;  1C1K A;  1R2Z A;  2CE7 A;  4OUI A;  1L2C A;  3L26 A;  5EP4 A;  3SAS A;  4LJA A;  4B3S M;  4Z6Y A;  3FTF A;  4WW0 A;  4QNL A;  7CAT A;  3T38 A;  4RF1 A;  2X4A A;  3FD9 A;  5KPR A;  1L2B A;  3E9S A;  3SYK A;  3ZCB B;  3KFU G;  4REZ A;  3R9X B;  2KZU A;  1GLN A;  4MGY E;  3RE8 A;  3L27 A;  5H37 D;  5KPT A;  4IBB A;  4LRS A;  2UWX A;  4AKI A;  3I51 A;  3J2P B;  1HNX M;  2Y2M A;  2A5Y B;  2DWM A;  2QEN A;  1QYR A;  5IT9 S;  4JV5 M;  3KSJ A;  2R65 A;  2Z4S A;  4LGM A;  3SHF A;  3KOX E;  3U61 B;  4QHS A;  1KFV A;  2HL7 A;  3U6C A;  3NBI A;  1IN5 A;  3DZD A;  1MX0 A;  4IJF A;  2YFQ A;  4GC5 A;  3AL0 C;  4B3M M;  2BJW A;  1PJI A;  2C9O A;  5FTM A;  3THG A;  2X49 A;  4HLQ A;  2L6O A;  4QNR A;  2RKO A;  1E94 E;  1XXH A;  4G4O A;  3QWL A;  3W0L B;  3HU3 A;  4NZ1 A;  1K3W A;  4D82 A;  4M0D A;  4L4U A;  3J27 B;  2F5O A;  1Z6T A;  2W82 A;  1NHW C;  3W0F A;  1LV7 A;  2BNK A;  1QZM A;  3SMP A;  3HGI A;  2ZM6 M;  2RGO A;  4X62 M;  3U6S A;  4OW0 A;  1Q3C A;  8CAT A;  2Y2I A;  3DFZ A;  2XGN A;  2J7N A;  4LF5 M;  1NJF A;  2D7E A;  5EXP A;  1R7R A;  4B3T M;  1X37 A;  2JCH A;  4LF7 M;  2F5P A;  2ZBK B;  3C58 A;  3FTE A;  3LQQ A;  3RGP A;  2F5Q A;  2KRU A;  1NY5 A;  1G41 A;  2NQ8 C;  5E6J A;  4JI8 M;  3JAM S;  5DNY A;  2K47 A;  1WXQ A;  2FE8 A;  1PM5 A;  2LNH C;  3HSH A;  3PNV A;  3J81 S;  2Y2J A;  4JI0 M;  4IJE A;  4PDG A;  1IY2 A;  3U60 A;  2F4V M;  2Y2G A;  4JI5 M;  3A45 A;  3PVS A;  3L28 A;  2V6Z M;  2CHV A;  2ZAO A;  3KOW E;  4NZ5 A;  3UMM A;  4DV3 M;  1JQJ C;  3HJ8 A;  2Y2O A;  2Y0Q A;  5FTL A;  3B9P A;  1IQP A;  4LCB A;  4B7F A;  4FVM A;  4GMQ A;  4IBD A;  5LMU M;  4GIT A;  4YY3 M;  1E9S A;  3FUT A;  3UGJ A;  5EJC A;  1QAM A;  2C99 A;  3RFW A;  1TH3 A;  5C1B A;  2BG1 A;  4LF8 M;  2EO2 A;  1Z5A A;  3CF6 E;  1SXJ B;  2AHM A;  1XXH B;  4IIW A;  4RF0 A;  2HCB A;  3K1J A;  4BB9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...