3FKEA

Structure of the ebola vp35 interferon inhibitory domain
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
123
structure length
123
Chain Sequence
DISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Ebola VP35 interferon inhibitory domain.
pubmed doi rcsb
source organism Zaire ebolavirus - mayinga (zaire, 1976)
molecule tags Rna binding protein
molecule keywords Polymerase cofactor VP35
total genus 40
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3fkeA01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 3fkeA02
4IBDA 4IBCA 3L27A 4IBBA 3L26A 4IJFA 4GHLA 3L29A 3L2AA 3L25A 4IBGA 3KS4A 3FKEA 3KS8A 3L28A 4IBKA 5BPVA 4GHAA 4GH9A 4IBFA 4IBJA 4IBEA 4LG2A 4IJEA 4IBIA
chains in the Genus database with same CATH superfamily
3JR5A 1Z5CA 1T3TA 1XNRM 3SAWA 1ORYB 3SMPA 1TGUA 2R6FA 4LJAA 1IM2A 4S12A 1TTEA 4I8OA 2Y0TA 5JI2E 1IFYA 5KO3A 4I4LA 3J81S 2C9CA 2FOIC 3AJIB 4MGHA 5F3WA 3RE8A 5E26A 1XNQM 5BR8M 4HLQA 2CWBA 1CUKA 3ZC7B 4R7GA 3E9SA 1R2YA 4LFBM 4NZ3A 2JY5A 1VEGA 4IBKA 1IXZA 1HQYE 1NO1A 2XF3A 2Y2KA 2LVOC 3GLFE 1DGFA 3FUWA 1YUEA 2OQ4A 4P16A 4UN2B 1YU2A 3KOYE 1VQ1A 3BXWA 4FD2A 4IBFA 2G5GX 3FTDA 4M9SA 3SMSA 3A45A 3WX7A 1YU3A 3QAUA 3IG8A 4LJ9A 1DGBA 4I81A 3K8ZA 1IBKM 2UUAM 2MR9A 3HJ8A 2EA0A 1OGBA 4Z2KA 3FD9A 3UGJA 1QDRA 4HMDA 4G4QA 3GRVA 3HU1A 3N3FA 2F5QA 4HEOA 4ANRA 5EP3A 4F2LA 2D7GA 1QO6A 3RGSA 1I94M 2RGOA 5KQDA 1BVSA 1L8QA 1MN3A 2FH0A 2JA2A 4DV6M 2UWXA 2KZSA 1NHGC 2I7PA 4LZJA 5DNYA 4CJ6A 1YU4A 1IN8A 1D0LA 2DENA 1TF0B 3GLGB 2UXCM 4L78A 3KSXA 1IBLM 1GJSA 4NYYA 1NSFA 3KDSE 5GKNA 3VDPA 2Y2OA 1QUTA 4G4NA 2WZJA 4JI5M 2XLJA 4Z2LA 1OAIA 2FFJA 4IBDA 1Z6TA 2ERCA 4X62M 1IN4A 1VEKA 3GO8A 3L27A 5FTKA 3D8BA 1J5EM 1WHCA 1DO2A 1V33A 3SFZA 5KQ8A 2UXDM 3TQSA 3E46A 2KEBA 3AOGA 3THGA 2L4FA 1E6RA 3LCUA 1QAQA 4EIWA 5ITRA 1AIPC 3K2LA 4MB7A 4BLCA 4NY2A 2R45A 3DOAA 5EXSA 4DUYM 1C7YA 2XSZA 1Z5BA 2EJSA 4DUZM 1Z59A 4LF7M 3AV0A 4L6V6 2K47A 4WW0A 3VFDA 3ZCBB 4DR5M 2LBCA 2Y21A 5BPVA 2W82A 3E4RA 1SG9A 5EQTA 4LJ5A 3BOSA 2C96A 4B3MM 3M7GA 1MX0A 1UR8A 3I01M 4AG6A 3I4VA 1DV0A 1L2CA 1R4GA 2HHHM 4QNLA 5IREB 2JY6B 1N75A 1NNJA 2LHCA 1DGHB 2KHHA 5EXPA 1W5SA 4JN6A 3GRYA 4AW4A 4DR2M 3K1JA 2KNVA 1HQCA 1E9SA 1G59A 4DR3M 2Y2HA 2J7NA 1ZMVA 4FWHA 5KPZA 3GLIE 3U6LA 2Y20A 1G71A 1VG5A 2CFOA 2Y2PA 3LQRA 2XSZD 3FRHA 3IHPA 1R7RA 1DGGA 2DAMA 3MJ5A 2LVNC 3V76A 4B3RM 3VK8A 3UZUA 1IN6A 2BG1A 1GVNA 1NV8A 2EKKA 3TE6A 3D8LA 3GQ5A 1V92A 2LVQD 4FWGA 1NY5A 4OVZB 2QP9X 5IZ7D 4JXJA 2YQZA 3FYCA 4W5WA 4LF9M 4TUWA 4OUIA 3VKGA 4R3DA 2ZAMA 3SASA 2DWZB 3Q8GA 2DHYA 2EUCA 3B7QA 3KSJA 3B74A 4NSOB 1QQWA 1PDCA 3U60A 1OFHA 2DKLA 2V1CA 3SBJA 3FYDA 1H8PA 3EIHA 3HX3A 3DZDA 4D80A 1K3XA 1N33M 1QANA 3L26A 2RTSA 4LF4M 4GHLA 2LVAA 3L29A 4PDIA 3A98B 2KRUA 1I4WA 3GLHE 3HJSA 2RRUA 2LH0A 4KO8A 1XXHA 4B7FA 2VQFM 2F4VM 3BBZA 4YY3M 1QUSA 1GLNA 2UXBM 2XGNA 4JI4M 3KP1E 3GP1A 4QHSA 2QBYB 4Z6YA 2CV1A 3UMMA 3OTOM 1KS0A 2MJ5B 2CRUA 4NXNM 1IXRC 3CF6E 4GRIA 4LY6A 4Z2IA 1VEJA 2RGHA 2JZ1A 1NJFA 3K9PA 3GQ3A 3B7ZA 2P5TA 1IBMM 1D2NA 4JV5M 1E6PA 4OVZA 1TDZA 3FTCA 4IJFA 4QHTA 1OKSA 5FTMA 3DA1A 3L25A 1YU1A 4Z8XA 5ITYA 4Z2GA 5LMUM 2R65A 3U6DA 4NOOB 5FLXS 1RU3A 2L7HA 1GO5A 1VDDA 1Q39A 1XHBA 4WP2A 1W1VA 1H6UA 2JP7A 4NZ4A 1NY6A 3FTEA 2R44A 4LGMA 3UJNA 2O25A 3GLGA 3LW5F 4NZ5A 2R62A 3TWKA 3M6AA 2DI0A 2FE8A 3FUXA 2CE7A 2V6ZM 5A2QS 2VF7A 2HAKA 2OPFA 2KNAA 4RKUF 5H37D 2YNMD 4DV1M 3K92A 3KVWA 3J7AS 2FN2A 1KFVA 2FS1A 1AIWA 2BWBA 4AKIA 4LJ6A 5DFLA 1R5LA 4TX8A 2MH8A 2QENA 1IQPA 1UM8A 2BJVA 3A42A 4GITA 3GPXA 4L4UA 1PJTA 3AKZA 1G8PA 3SHGB 4B7HA 1G41A 4RF0A 4CISA 1YSYA 2Y2MA 3IG5A 4PCZA 3LVVA 2KZUA 2HL7A 2LHGA 2ZAOA 3F92A 2QSFX 3B9PA 3HJQA 4GEWA 1QAMA 2RKOA 3WD4A 3C58A 5C1BA 2X8AA 3FTFA 1W1PA 3ZH9B 3C9PA 1XXHE 4LZZA 2XD1A 3GPPA 3I4YA 3HU3A 5DYIA 3GPYA 2Z4SA 2QPAA 4MB4A 4M9ZA 3HHYA 1ZMUA 4QNRA 1IY1A 3HHZA 2XZUA 4OX9M 3T1HM 3QYBA 4YHHM 2XZFA 2K6BA 3WD0A 2M5ZA 2MROB 3MHVC 3L2AA 2FNAA 1TR8A 2F5NA 2DVWB 3CF0A 5E6JA 3U5ZB 1DO0A 1Q3BA 1J09A 3PNYA 4NRVA 4NL4H 4FCTA 5EXXA 4NRWA 4K0KM 4GKJM 1OQYA 3M7PA 1NJGA 2K9DA 2XFSA 4NYUA 4WURA 4B3TM 4R71A 2KNZA 2HCBA 2EKFA 3SATA 2O5RA 4OW0A 1L6JA 1YUBA 4L15A 4X66M 1WJ7A 2ZM6M 4IBJA 4LF5M 1Q3CA 4LFCM 1WIVA 3FRIA 3HKPA 2CEAA 3U5ZA 3RGPA 2CHGA 3SHFA 2DAEA 4XGIA 5EP2A 3T38A 4MGIE 2WSEF 4AZFA 2IOUA 4OU7A 5EP4A 3GLIA 3KOZE 1L1ZA 4Z2JA 3GPUA 4FVMA 1OIZA 1GJTA 1W5TA 4ZPXA 4JI1M 3T15A 1IN7A 3C3EA 4GMQA 3PXGA 2VDBB 2C99A 1D0MA 2Z7JA 3LVWA 3L28A 3W68A 4DV7M 1E88A 1OAOC 3FUTA 2L7IA 4ITQA 3I51A 3EIEA 2BNKA 3GRUA 4XK8F 3RFWA 2GNOA 4PDGA 4GH9A 1YU0A 4LF8M 1IN5A 1PJSA 4AI6A 1PJJA 4OJ6A 1TH3A 2H5XA 3QWLA 4REZA 4LFAM 2D49A 1N77A 2UUCM 1T43A 4MB5A 4IBCA 4OJPA 3GLFA 3GRRA 1N34M 4OJLA 2B3TA 5EP1A 3KXEC 2CUZA 3M0EA 1JR3E 1XXHB 1XMOM 1LTMA 3SYLA 1XMQM 3GLHB 4DR7M 1KYIA 2F5SA 1GOIA 2D7HA 2Y0QA 5L8RF 2CP8A 3U6CA 2KDLA 3WD2A 3TWLA 3R8FA 3J2PB 1CXWA 1PGYA 2LWXA 2BWEA 2JWSA 3U61B 4LCBA 2CHQA 1V34A 2VQEM 1X37A 4GHAA 1SXJE 1HJPA 1S3SA 1A5TA 4LJ7A 2G3QA 4JYAM 4MGZE 5ITQA 1E15A 1FJGM 1N78A 2N35A 3HU2A 1NNUC 1Z5AA 4LG2A 4IJEA 2LNHC 3B89A 5JI3E 3GLHA 2Z8YM 2UUBM 2XFTA 2DZLA 3J27B 2E5LM 2L6OA 4QOZC 3MK6A 1W1TA 3HGIA 4LRSA 2Y2NA 1H0GA 5EXTA 3TL4X 4OJOA 1XWIA 3ZQJA 5FSWA 3GLFB 1MJGM 2Y2JA 2X49A 3KOXE 4JI8M 3KFUG 1GXDA 4MGYE 2DAKA 4LF6M 2R18A 2NQ8C 4DV0M 3WHKA 1GABA 1YLAA 1G3IA 3JR4A 2JY8A 1PJQA 4PT5A 5DYGA 1TH4A 4DBGB 2CV2A 3AFHA 4JI7M 3R9XB 1EFUB 3FE3A 1K82A 3NWLA 2X4AA 4LGYA 4M9XA 5FTNA 2YFQA 4MGKE 4D82A 3HHWA 3GQ4A 1PJIA 2OOAA 4DR6M 2R46A 4NZ1A 3WD1A 4BB9A 2KRKA 1EIJA 4FCVA 1IY0A 4AQYM 1PM5A 3C3DA 2HKJA 2ZBKB 5ITXE 1CK7A 1W1YA 3U6EA 4XBOA 3NBIA 1NV9A 1H0IA 1Q02A 4DV5M 2VF8A 4L8RC 2OO9A 1J7KA 3CGWA 2Y2IA 4RF1A 2GQFA 1XC8A 3HZJA 1E94E 3PVSA 2DAGA 5C18A 2ZANA 4DV3M 3U6QA 4X64M 1HR0M 1HT2E 2XH9A 3J80S 2Z3XA 2DAIA 2JUJA 3HWSA 3SAUA 2DWMA 2KXEA 5IWAM 2Y2LA 3MQLA 2K0BX 3ILKA 4IBEA 2R4EA 4CHTB 4G6ZA 4X65M 4M0DA 4Q7JA 2R0IA 2YR0A 4A3VB 3H4JA 1HNXM 1C1KA 3B7NA 1JB0F 1N36M 4OJ5A 3WD3A 1J7MA 4F1IA 3J7BA 4CGYB 4DV4M 1ZAEA 4QNMA 1R6BX 4FCWA 3FUUA 1ZV1A 3HHXA 3PFIA 1MU5A 4HMEA 3W67A 4AG5A 3SC3A 1VDLA 3HONA 5LMNM 4IBGA 1DGHA 4B08A 3AOEA 1UFZA 8CATA 4LRTA 1SXJB 1HT1E 1Y8GA 3SYKA 3JAMS 2JCHA 4G4RA 2Y2QA 5EJCA 1OTRA 2H1RA 2LTUA 5ITTA 1K3WA 5IT9S 1E6NA 4JI6M 2D7EA 2Q2EB 2O01F 4MB3A 4AKGA 3AL0C 3GLIB 1WGNA 3VDUA 4FW9A 7CATA 2QHOB 2KW0A 1HNWM 2LVPC 4MH0E 2CV0A 2QBYA 4NXMM 1GL6A 4GIPA 2L2DA 2C5RA 1SXJA 1OJLA 4AKHA 4I5SA 5KPTA 1GL7A 4G3OA 3LQQA 4FWDA 3VKHA 2JE5A 1PRBA 4PD2A 2A5YB 4GC9A 2MGWA 4Z2HA 2ZTDA 1YE9A 2EO2A 1E9RA 1LV7A 1QYRA 1TDHA 1OIPA 1ZMWA 1E32A 2DZOB 3QYEA 3MMPA 4MM3B 1HNZM 3U6SA 2XD5A 3CF2A 2V5OA 4JI0M 4D81A 2L4EA 2VIIA 1JR3A 3W0LB 2J7OA 2QCUA 4IIWA 4LJ4A 1OFIA 1QZMA 3PNVA 2XEPA 2DHRA 2WSCF 2KA6B 1EE8A 3NBXX 4GC5A 1L2BA 3W0FA 1IXSA 1NHWC 3IECA 4GKKM 4HL4A 4DR4M 2JXNA 1ED7A 2Y2GA 4LJ8A 3KP0E 3FUVA 3TPZA 4P17A 4II7A 3U61A 2JZ0A 3HSHA 1UR9A 1GPFA 3SARA 1ZQ9A 3H4MA 1T6OA 1E6ZA 2JNHA 1SXJD 2DZNB 1F4IA 4HMCA 1D0KA 2APLA 3HY5A 1IXSB 2V1UA 2R4JA 3AOEC 5ITXA 3CTWB 1KSFX 4KLNA 4NC6A 3GLGE 5ITUA 2DWLA 2AHMA 4G4OA 4B3SM 3KS8A 2DNAA 4Y28F 2CHVA 2WSFF 1AUAA 1O6IA 3T6PA 4JI3M 1E8BA 1JR3D 3WHLA 3K9OA 4DR1M 3U6PA 1TH2A 1NVMA 1FNNA 4QOSA 2G8LA 3I04M 1XB2B 2DXIA 3KW6A 1JQJC 2J5YA 3DFZA 2F5PA 1P3QQ 3LMMA 3SAVA 1QZEA 2C98A 4IBBA 4M0WA 2JY7A 4L16A 2QQ8A 2I7NA 2QZ4A 2LXEA 3Q8XA 4KT0F 3U6OA 1G4AE 1N32M 3KOWE 4DV2M 5KPRA 5FTJA 1GKIA 2OOBA 3UK6A 1QDTA 2M60A 4RNAA 3VK7A 4CIZA 4B7GA 5FTLA 3U6MA 3TWMA 2DWNA 3A46A 4BBAA 1L1TA 2QNJA 3U60B 2FFFB 2BJWA 3KS4A 3FKEA 1WXQA 1OGGA 1EAKA 3T1YM 1IY2A 3E21A 2L09A 4JI2M 4KODA 1WR1B 4NSRA 2UU9M 1SXJC 2ZTCA 2HWJA 1WGLA 2F5OA 1R2ZA 2Z4RA 1QVRA 1L2DA 3VLFB 4KHPM 1QAOA 2C9OA 3LCVB 4IBIA
chains in the Genus database with same CATH topology
3JR5A 1Z5CA 1T3TA 1XNRM 3SAWA 1ORYB 3SMPA 1TGUA 4LJAA 1IM2A 4S12A 4I8OA 2Y0TA 5JI2E 5KO3A 4I4LA 3J81S 2C9CA 2FOIC 3AJIB 4MGHA 5F3WA 3RE8A 5E26A 1XNQM 5BR8M 4HLQA 4LFBM 4NZ3A 3ZC7B 4R7GA 3E9SA 1R2YA 4IBKA 1IXZA 1HQYE 2XF3A 2Y2KA 1DGFA 3FUWA 1YUEA 2OQ4A 4P16A 1YU2A 3KOYE 4IBFA 4FD2A 4M9SA 2G5GX 3FTDA 3SMSA 3WX7A 3A45A 1YU3A 3QAUA 3IG8A 4LJ9A 1DGBA 4I81A 3K8ZA 1IBKM 2UUAM 3HJ8A 2EA0A 3FD9A 3UGJA 4G4QA 3GRVA 3HU1A 2F5QA 5EP3A 2D7GA 3RGSA 1I94M 2RGOA 5KQDA 1L8QA 2JA2A 4DV6M 2UWXA 2KZSA 1NHGC 2I7PA 4LZJA 5DNYA 1YU4A 1IN8A 3GLGB 2UXCM 4L78A 3KSXA 1IBLM 4NYYA 1NSFA 3KDSE 5GKNA 3VDPA 2Y2OA 4G4NA 4JI5M 2XLJA 4IBDA 2FFJA 1Z6TA 2ERCA 4X62M 1IN4A 3GO8A 3L27A 5FTKA 3D8BA 1J5EM 1DO2A 3SFZA 5KQ8A 2UXDM 3TQSA 2KEBA 3AOGA 3THGA 1QAQA 4EIWA 5ITRA 3K2LA 4MB7A 4BLCA 4NY2A 2R45A 3DOAA 5EXSA 4DUYM 4LF7M 2XSZA 1Z5BA 4DUZM 1Z59A 3AV0A 3ZCBB 2K47A 4WW0A 3VFDA 4DR5M 5BPVA 2Y21A 2W82A 3E4RA 5EQTA 4LJ5A 3BOSA 2C96A 4B3MM 3M7GA 1MX0A 4AG6A 3I4VA 1L2CA 2HHHM 4QNLA 5IREB 1N75A 1NNJA 1DGHB 5EXPA 1W5SA 4JN6A 3GRYA 4AW4A 4DR2M 3K1JA 1HQCA 1E9SA 1G59A 4DR3M 2J7NA 4FWHA 5KPZA 3U6LA 2Y20A 2CFOA 2Y2PA 3LQRA 2XSZD 1R7RA 1DGGA 3MJ5A 4B3RM 3VK8A 3UZUA 1IN6A 2BG1A 1GVNA 3TE6A 3D8LA 3GQ5A 5IZ7D 4FWGA 1NY5A 4OVZB 2QP9X 4JXJA 2YQZA 3FYCA 4W5WA 4LF9M 4TUWA 4OUIA 4R3DA 2ZAMA 3SASA 2DWZB 2EUCA 3KSJA 4NSOB 1QQWA 3U60A 1OFHA 2V1CA 3SBJA 3FYDA 3EIHA 3DZDA 4D80A 1K3XA 1N33M 1QANA 3L26A 4LF4M 4GHLA 3L29A 4PDIA 3A98B 2KRUA 1I4WA 4KO8A 3HJSA 2VQFM 2LH0A 4B7FA 1XXHA 2F4VM 4DR4M 4YY3M 1GLNA 2UXBM 2XGNA 4JI4M 3KP1E 3GP1A 4QHSA 2QBYB 4Z6YA 2CV1A 3UMMA 3OTOM 4NXNM 1IXRC 3CF6E 4GRIA 4LY6A 2RGHA 1NJFA 3GQ3A 2P5TA 1IBMM 1D2NA 4JV5M 4OVZA 1TDZA 3FTCA 4IJFA 4QHTA 5FTMA 3DA1A 3L25A 1YU1A 4Z8XA 5ITYA 5LMUM 2R65A 3U6DA 4NOOB 5FLXS 2L7HA 1VDDA 1Q39A 1XHBA 1H6UA 4NZ4A 1NY6A 3FTEA 4LGMA 3UJNA 3GLGA 2R62A 3TWKA 3M6AA 2FE8A 3FUXA 2CE7A 2V6ZM 5A2QS 2OPFA 5H37D 2YNMD 4DV1M 3K92A 3KVWA 3J7AS 1KFVA 4AKIA 4LJ6A 2QENA 4GITA 1IQPA 1UM8A 2BJVA 3A42A 3GPXA 4L4UA 3AKZA 1G8PA 3SHGB 4B7HA 1G41A 4RF0A 4CISA 1YSYA 2Y2MA 3IG5A 4PCZA 3LVVA 2KZUA 2HL7A 2ZAOA 3B9PA 3HJQA 1QAMA 2RKOA 3C58A 5C1BA 2X8AA 3FTFA 3ZH9B 4LZZA 2XD1A 3GPPA 3I4YA 3HU3A 5DYIA 3GPYA 2Z4SA 2QPAA 4M9ZA 3HHYA 4QNRA 1IY1A 3HHZA 2XZUA 4OX9M 3T1HM 4YHHM 2XZFA 2M5ZA 3MHVC 2F5NA 3L2AA 2FNAA 2DVWB 3CF0A 5E6JA 3U5ZB 1DO0A 1Q3BA 1J09A 3PNYA 4NRVA 4NL4H 4FCTA 5EXXA 4NRWA 4K0KM 4GKJM 1NJGA 4NYUA 2XFSA 4WURA 4B3TM 2HCBA 3SATA 2O5RA 4OW0A 1YUBA 4L15A 4X66M 2ZM6M 4LF5M 4IBJA 1Q3CA 4LFCM 3HKPA 2CEAA 3U5ZA 3RGPA 2CHGA 3SHFA 4XGIA 5EP2A 3T38A 4MGIE 4AZFA 2IOUA 4OU7A 5EP4A 3GLIA 3KOZE 1L1ZA 3GPUA 4FVMA 1W5TA 4ZPXA 4JI1M 3T15A 1IN7A 4GMQA 3PXGA 2Y2HA 2C99A 2Z7JA 3LVWA 3L28A 4DV7M 3FUTA 2L7IA 4ITQA 3I51A 3EIEA 2BNKA 3GRUA 3RFWA 4PDGA 4GH9A 1YU0A 1IN5A 4AI6A 1PJJA 4OJ6A 1TH3A 3QWLA 4REZA 4LFAM 1N77A 2UUCM 4OJLA 4IBCA 4OJPA 3GLFA 3GRRA 1N34M 5EP1A 3KXEC 2CUZA 3M0EA 1XMOM 1XXHB 3SYLA 1XMQM 3GLHB 4DR7M 1KYIA 2F5SA 2D7HA 2Y0QA 3U6CA 3TWLA 3R8FA 3J2PB 2LWXA 3U61B 4LCBA 2CHQA 2VQEM 1X37A 4GHAA 1SXJE 1S3SA 4LJ7A 4JYAM 4MGZE 5ITQA 1FJGM 1N78A 3HU2A 1NNUC 1Z5AA 4LG2A 4IJEA 2LNHC 5JI3E 3GLHA 2UUBM 2XFTA 3J27B 2E5LM 2L6OA 4QOZC 3MK6A 3HGIA 4LRSA 2Y2NA 5EXTA 3TL4X 4OJOA 1XWIA 5FSWA 3GLFB 2Y2JA 2X49A 3KOXE 4JI8M 3KFUG 4MGYE 4LF6M 2R18A 2NQ8C 4DV0M 3WHKA 3JR4A 1G3IA 4PT5A 5DYGA 1TH4A 2CV2A 3AFHA 4JI7M 3R9XB 1K82A 3NWLA 2X4AA 4LGYA 4M9XA 5FTNA 2YFQA 4MGKE 4D82A 3HHWA 3GQ4A 1PJIA 4NZ1A 4DR6M 2R46A 4BB9A 2KRKA 4FCVA 1IY0A 4AQYM 1PM5A 2HKJA 2ZBKB 5ITXE 3U6EA 4XBOA 3NBIA 4DV5M 4L8RC 1J7KA 2Y2IA 4RF1A 1XC8A 1E94E 3PVSA 5C18A 2ZANA 4DV3M 3U6QA 4X64M 1HR0M 1HT2E 2XH9A 3J80S 2Z3XA 3SAUA 3HWSA 2DWMA 4LF8M 2Y2LA 2KXEA 5IWAM 3ILKA 4IBEA 2R4EA 4CHTB 4G6ZA 4X65M 4M0DA 2YR0A 4A3VB 1HNXM 4OJ5A 1C1KA 1N36M 3J7BA 4CGYB 4DV4M 1ZAEA 4QNMA 1R6BX 4FCWA 3FUUA 3HHXA 3PFIA 1MU5A 4AG5A 3SC3A 3HONA 5LMNM 4IBGA 1DGHA 4B08A 3AOEA 8CATA 4LRTA 1SXJB 1HT1E 3SYKA 3JAMS 2JCHA 2Y2QA 4G4RA 5EJCA 5ITTA 2H1RA 1K3WA 5IT9S 4JI6M 2D7EA 2Q2EB 4AKGA 3AL0C 3GLIB 7CATA 3VDUA 4FW9A 1HNWM 2KW0A 4MH0E 2CV0A 2QBYA 4NXMM 1GL6A 4GIPA 2C5RA 1SXJA 1OJLA 4AKHA 4I5SA 5KPTA 1GL7A 2JE5A 3LQQA 4FWDA 3VKHA 4PD2A 2A5YB 4GC9A 1YE9A 2EO2A 1E9RA 1LV7A 1QYRA 1TDHA 1E32A 2DZOB 4MM3B 1HNZM 3U6SA 2XD5A 3CF2A 4JI0M 4D81A 2VIIA 1JR3A 3W0LB 2J7OA 2QCUA 4IIWA 4LJ4A 1QZMA 1OFIA 3PNVA 2XEPA 2DHRA 2KA6B 1EE8A 4GC5A 1L2BA 3W0FA 1NHWC 4GKKM 4HL4A 2Y2GA 4LJ8A 3KP0E 3FUVA 3TPZA 4II7A 3U61A 3HSHA 3SARA 1ZQ9A 3H4MA 1SXJD 2DZNB 2V1UA 1IXSB 2R4JA 3AOEC 5ITXA 3CTWB 1KSFX 4KLNA 5ITUA 2AHMA 4G4OA 4B3SM 3KS8A 2CHVA 4JI3M 1JR3D 3WHLA 4DR1M 3U6PA 1TH2A 1NVMA 1FNNA 4QOSA 2G8LA 2DXIA 3KW6A 1JQJC 3DFZA 2F5PA 3SAVA 3LMMA 2C98A 4IBBA 4M0WA 4L16A 3U6OA 2I7NA 2QZ4A 2LXEA 3Q8XA 1N32M 3N3FA 1G4AE 3KOWE 4DV2M 5KPRA 5FTJA 1GKIA 3VKGA 3UK6A 2M60A 4RNAA 2DWLA 3VK7A 5FTLA 4B7GA 3U6MA 2DWNA 3TWMA 3A46A 4BBAA 1L1TA 3U60B 2FFFB 2BJWA 3KS4A 3FKEA 1WXQA 3T1YM 1IY2A 2L09A 4JI2M 4KODA 4NSRA 2UU9M 1SXJC 2F5OA 1R2ZA 2Z4RA 1QVRA 1L2DA 3VLFB 4KHPM 1QAOA 2C9OA 4NZ5A 4IBIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IBD A;  4IBC A;  3L27 A;  4IBB A;  3L26 A;  4IJF A;  4GHL A;  3L29 A;  3L2A A;  3L25 A;  4IBG A;  3KS4 A;  3FKE A;  3KS8 A;  3L28 A;  4IBK A;  5BPV A;  4GHA A;  4GH9 A;  4IBF A;  4IBJ A;  4IBE A;  4LG2 A;  4IJE A;  4IBI A; 
#chains in the Genus database with same CATH topology
 3JR5 A;  1Z5C A;  1T3T A;  1XNR M;  3SAW A;  1ORY B;  3SMP A;  1TGU A;  2R6F A;  4LJA A;  1IM2 A;  4S12 A;  1TTE A;  4I8O A;  2Y0T A;  5JI2 E;  1IFY A;  5KO3 A;  4I4L A;  3J81 S;  2C9C A;  2FOI C;  3AJI B;  4MGH A;  5F3W A;  3RE8 A;  5E26 A;  1XNQ M;  5BR8 M;  4HLQ A;  2CWB A;  1CUK A;  3ZC7 B;  4R7G A;  3E9S A;  1R2Y A;  4LFB M;  4NZ3 A;  2JY5 A;  1VEG A;  4IBK A;  1IXZ A;  1HQY E;  1NO1 A;  2XF3 A;  2Y2K A;  2LVO C;  3GLF E;  1DGF A;  3FUW A;  1YUE A;  2OQ4 A;  4P16 A;  4UN2 B;  1YU2 A;  3KOY E;  1VQ1 A;  3BXW A;  4FD2 A;  4IBF A;  2G5G X;  3FTD A;  4M9S A;  3SMS A;  3A45 A;  3WX7 A;  1YU3 A;  3QAU A;  3IG8 A;  4LJ9 A;  1DGB A;  4I81 A;  3K8Z A;  1IBK M;  2UUA M;  2MR9 A;  3HJ8 A;  2EA0 A;  1OGB A;  4Z2K A;  3FD9 A;  3UGJ A;  1QDR A;  4HMD A;  4G4Q A;  3GRV A;  3HU1 A;  3N3F A;  2F5Q A;  4HEO A;  4ANR A;  5EP3 A;  4F2L A;  2D7G A;  1QO6 A;  3RGS A;  1I94 M;  2RGO A;  5KQD A;  1BVS A;  1L8Q A;  1MN3 A;  2FH0 A;  2JA2 A;  4DV6 M;  2UWX A;  2KZS A;  1NHG C;  2I7P A;  4LZJ A;  5DNY A;  4CJ6 A;  1YU4 A;  1IN8 A;  1D0L A;  2DEN A;  1TF0 B;  3GLG B;  2UXC M;  4L78 A;  3KSX A;  1IBL M;  1GJS A;  4NYY A;  1NSF A;  3KDS E;  5GKN A;  3VDP A;  2Y2O A;  1QUT A;  4G4N A;  2WZJ A;  4JI5 M;  2XLJ A;  4Z2L A;  1OAI A;  2FFJ A;  4IBD A;  1Z6T A;  2ERC A;  4X62 M;  1IN4 A;  1VEK A;  3GO8 A;  3L27 A;  5FTK A;  3D8B A;  1J5E M;  1WHC A;  1DO2 A;  1V33 A;  3SFZ A;  5KQ8 A;  2UXD M;  3TQS A;  3E46 A;  2KEB A;  3AOG A;  3THG A;  2L4F A;  1E6R A;  3LCU A;  1QAQ A;  4EIW A;  5ITR A;  1AIP C;  3K2L A;  4MB7 A;  4BLC A;  4NY2 A;  2R45 A;  3DOA A;  5EXS A;  4DUY M;  1C7Y A;  2XSZ A;  1Z5B A;  2EJS A;  4DUZ M;  1Z59 A;  4LF7 M;  3AV0 A;  4L6V 6;  2K47 A;  4WW0 A;  3VFD A;  3ZCB B;  4DR5 M;  2LBC A;  2Y21 A;  5BPV A;  2W82 A;  3E4R A;  1SG9 A;  5EQT A;  4LJ5 A;  3BOS A;  2C96 A;  4B3M M;  3M7G A;  1MX0 A;  1UR8 A;  3I01 M;  4AG6 A;  3I4V A;  1DV0 A;  1L2C A;  1R4G A;  2HHH M;  4QNL A;  5IRE B;  2JY6 B;  1N75 A;  1NNJ A;  2LHC A;  1DGH B;  2KHH A;  5EXP A;  1W5S A;  4JN6 A;  3GRY A;  4AW4 A;  4DR2 M;  3K1J A;  2KNV A;  1HQC A;  1E9S A;  1G59 A;  4DR3 M;  2Y2H A;  2J7N A;  1ZMV A;  4FWH A;  5KPZ A;  3GLI E;  3U6L A;  2Y20 A;  1G71 A;  1VG5 A;  2CFO A;  2Y2P A;  3LQR A;  2XSZ D;  3FRH A;  3IHP A;  1R7R A;  1DGG A;  2DAM A;  3MJ5 A;  2LVN C;  3V76 A;  4B3R M;  3VK8 A;  3UZU A;  1IN6 A;  2BG1 A;  1GVN A;  1NV8 A;  2EKK A;  3TE6 A;  3D8L A;  3GQ5 A;  1V92 A;  2LVQ D;  4FWG A;  1NY5 A;  4OVZ B;  2QP9 X;  5IZ7 D;  4JXJ A;  2YQZ A;  3FYC A;  4W5W A;  4LF9 M;  4TUW A;  4OUI A;  3VKG A;  4R3D A;  2ZAM A;  3SAS A;  2DWZ B;  3Q8G A;  2DHY A;  2EUC A;  3B7Q A;  3KSJ A;  3B74 A;  4NSO B;  1QQW A;  1PDC A;  3U60 A;  1OFH A;  2DKL A;  2V1C A;  3SBJ A;  3FYD A;  1H8P A;  3EIH A;  3HX3 A;  3DZD A;  4D80 A;  1K3X A;  1N33 M;  1QAN A;  3L26 A;  2RTS A;  4LF4 M;  4GHL A;  2LVA A;  3L29 A;  4PDI A;  3A98 B;  2KRU A;  1I4W A;  3GLH E;  3HJS A;  2RRU A;  2LH0 A;  4KO8 A;  1XXH A;  4B7F A;  2VQF M;  2F4V M;  3BBZ A;  4YY3 M;  1QUS A;  1GLN A;  2UXB M;  2XGN A;  4JI4 M;  3KP1 E;  3GP1 A;  4QHS A;  2QBY B;  4Z6Y A;  2CV1 A;  3UMM A;  3OTO M;  1KS0 A;  2MJ5 B;  2CRU A;  4NXN M;  1IXR C;  3CF6 E;  4GRI A;  4LY6 A;  4Z2I A;  1VEJ A;  2RGH A;  2JZ1 A;  1NJF A;  3K9P A;  3GQ3 A;  3B7Z A;  2P5T A;  1IBM M;  1D2N A;  4JV5 M;  1E6P A;  4OVZ A;  1TDZ A;  3FTC A;  4IJF A;  4QHT A;  1OKS A;  5FTM A;  3DA1 A;  3L25 A;  1YU1 A;  4Z8X A;  5ITY A;  4Z2G A;  5LMU M;  2R65 A;  3U6D A;  4NOO B;  5FLX S;  1RU3 A;  2L7H A;  1GO5 A;  1VDD A;  1Q39 A;  1XHB A;  4WP2 A;  1W1V A;  1H6U A;  2JP7 A;  4NZ4 A;  1NY6 A;  3FTE A;  2R44 A;  4LGM A;  3UJN A;  2O25 A;  3GLG A;  3LW5 F;  4NZ5 A;  2R62 A;  3TWK A;  3M6A A;  2DI0 A;  2FE8 A;  3FUX A;  2CE7 A;  2V6Z M;  5A2Q S;  2VF7 A;  2HAK A;  2OPF A;  2KNA A;  4RKU F;  5H37 D;  2YNM D;  4DV1 M;  3K92 A;  3KVW A;  3J7A S;  2FN2 A;  1KFV A;  2FS1 A;  1AIW A;  2BWB A;  4AKI A;  4LJ6 A;  5DFL A;  1R5L A;  4TX8 A;  2MH8 A;  2QEN A;  1IQP A;  1UM8 A;  2BJV A;  3A42 A;  4GIT A;  3GPX A;  4L4U A;  1PJT A;  3AKZ A;  1G8P A;  3SHG B;  4B7H A;  1G41 A;  4RF0 A;  4CIS A;  1YSY A;  2Y2M A;  3IG5 A;  4PCZ A;  3LVV A;  2KZU A;  2HL7 A;  2LHG A;  2ZAO A;  3F92 A;  2QSF X;  3B9P A;  3HJQ A;  4GEW A;  1QAM A;  2RKO A;  3WD4 A;  3C58 A;  5C1B A;  2X8A A;  3FTF A;  1W1P A;  3ZH9 B;  3C9P A;  1XXH E;  4LZZ A;  2XD1 A;  3GPP A;  3I4Y A;  3HU3 A;  5DYI A;  3GPY A;  2Z4S A;  2QPA A;  4MB4 A;  4M9Z A;  3HHY A;  1ZMU A;  4QNR A;  1IY1 A;  3HHZ A;  2XZU A;  4OX9 M;  3T1H M;  3QYB A;  4YHH M;  2XZF A;  2K6B A;  3WD0 A;  2M5Z A;  2MRO B;  3MHV C;  3L2A A;  2FNA A;  1TR8 A;  2F5N A;  2DVW B;  3CF0 A;  5E6J A;  3U5Z B;  1DO0 A;  1Q3B A;  1J09 A;  3PNY A;  4NRV A;  4NL4 H;  4FCT A;  5EXX A;  4NRW A;  4K0K M;  4GKJ M;  1OQY A;  3M7P A;  1NJG A;  2K9D A;  2XFS A;  4NYU A;  4WUR A;  4B3T M;  4R71 A;  2KNZ A;  2HCB A;  2EKF A;  3SAT A;  2O5R A;  4OW0 A;  1L6J A;  1YUB A;  4L15 A;  4X66 M;  1WJ7 A;  2ZM6 M;  4IBJ A;  4LF5 M;  1Q3C A;  4LFC M;  1WIV A;  3FRI A;  3HKP A;  2CEA A;  3U5Z A;  3RGP A;  2CHG A;  3SHF A;  2DAE A;  4XGI A;  5EP2 A;  3T38 A;  4MGI E;  2WSE F;  4AZF A;  2IOU A;  4OU7 A;  5EP4 A;  3GLI A;  3KOZ E;  1L1Z A;  4Z2J A;  3GPU A;  4FVM A;  1OIZ A;  1GJT A;  1W5T A;  4ZPX A;  4JI1 M;  3T15 A;  1IN7 A;  3C3E A;  4GMQ A;  3PXG A;  2VDB B;  2C99 A;  1D0M A;  2Z7J A;  3LVW A;  3L28 A;  3W68 A;  4DV7 M;  1E88 A;  1OAO C;  3FUT A;  2L7I A;  4ITQ A;  3I51 A;  3EIE A;  2BNK A;  3GRU A;  4XK8 F;  3RFW A;  2GNO A;  4PDG A;  4GH9 A;  1YU0 A;  4LF8 M;  1IN5 A;  1PJS A;  4AI6 A;  1PJJ A;  4OJ6 A;  1TH3 A;  2H5X A;  3QWL A;  4REZ A;  4LFA M;  2D49 A;  1N77 A;  2UUC M;  1T43 A;  4MB5 A;  4IBC A;  4OJP A;  3GLF A;  3GRR A;  1N34 M;  4OJL A;  2B3T A;  5EP1 A;  3KXE C;  2CUZ A;  3M0E A;  1JR3 E;  1XXH B;  1XMO M;  1LTM A;  3SYL A;  1XMQ M;  3GLH B;  4DR7 M;  1KYI A;  2F5S A;  1GOI A;  2D7H A;  2Y0Q A;  5L8R F;  2CP8 A;  3U6C A;  2KDL A;  3WD2 A;  3TWL A;  3R8F A;  3J2P B;  1CXW A;  1PGY A;  2LWX A;  2BWE A;  2JWS A;  3U61 B;  4LCB A;  2CHQ A;  1V34 A;  2VQE M;  1X37 A;  4GHA A;  1SXJ E;  1HJP A;  1S3S A;  1A5T A;  4LJ7 A;  2G3Q A;  4JYA M;  4MGZ E;  5ITQ A;  1E15 A;  1FJG M;  1N78 A;  2N35 A;  3HU2 A;  1NNU C;  1Z5A A;  4LG2 A;  4IJE A;  2LNH C;  3B89 A;  5JI3 E;  3GLH A;  2Z8Y M;  2UUB M;  2XFT A;  2DZL A;  3J27 B;  2E5L M;  2L6O A;  4QOZ C;  3MK6 A;  1W1T A;  3HGI A;  4LRS A;  2Y2N A;  1H0G A;  5EXT A;  3TL4 X;  4OJO A;  1XWI A;  3ZQJ A;  5FSW A;  3GLF B;  1MJG M;  2Y2J A;  2X49 A;  3KOX E;  4JI8 M;  3KFU G;  1GXD A;  4MGY E;  2DAK A;  4LF6 M;  2R18 A;  2NQ8 C;  4DV0 M;  3WHK A;  1GAB A;  1YLA A;  1G3I A;  3JR4 A;  2JY8 A;  1PJQ A;  4PT5 A;  5DYG A;  1TH4 A;  4DBG B;  2CV2 A;  3AFH A;  4JI7 M;  3R9X B;  1EFU B;  3FE3 A;  1K82 A;  3NWL A;  2X4A A;  4LGY A;  4M9X A;  5FTN A;  2YFQ A;  4MGK E;  4D82 A;  3HHW A;  3GQ4 A;  1PJI A;  2OOA A;  4DR6 M;  2R46 A;  4NZ1 A;  3WD1 A;  4BB9 A;  2KRK A;  1EIJ A;  4FCV A;  1IY0 A;  4AQY M;  1PM5 A;  3C3D A;  2HKJ A;  2ZBK B;  5ITX E;  1CK7 A;  1W1Y A;  3U6E A;  4XBO A;  3NBI A;  1NV9 A;  1H0I A;  1Q02 A;  4DV5 M;  2VF8 A;  4L8R C;  2OO9 A;  1J7K A;  3CGW A;  2Y2I A;  4RF1 A;  2GQF A;  1XC8 A;  3HZJ A;  1E94 E;  3PVS A;  2DAG A;  5C18 A;  2ZAN A;  4DV3 M;  3U6Q A;  4X64 M;  1HR0 M;  1HT2 E;  2XH9 A;  3J80 S;  2Z3X A;  2DAI A;  2JUJ A;  3HWS A;  3SAU A;  2DWM A;  2KXE A;  5IWA M;  2Y2L A;  3MQL A;  2K0B X;  3ILK A;  4IBE A;  2R4E A;  4CHT B;  4G6Z A;  4X65 M;  4M0D A;  4Q7J A;  2R0I A;  2YR0 A;  4A3V B;  3H4J A;  1HNX M;  1C1K A;  3B7N A;  1JB0 F;  1N36 M;  4OJ5 A;  3WD3 A;  1J7M A;  4F1I A;  3J7B A;  4CGY B;  4DV4 M;  1ZAE A;  4QNM A;  1R6B X;  4FCW A;  3FUU A;  1ZV1 A;  3HHX A;  3PFI A;  1MU5 A;  4HME A;  3W67 A;  4AG5 A;  3SC3 A;  1VDL A;  3HON A;  5LMN M;  4IBG A;  1DGH A;  4B08 A;  3AOE A;  1UFZ A;  8CAT A;  4LRT A;  1SXJ B;  1HT1 E;  1Y8G A;  3SYK A;  3JAM S;  2JCH A;  4G4R A;  2Y2Q A;  5EJC A;  1OTR A;  2H1R A;  2LTU A;  5ITT A;  1K3W A;  5IT9 S;  1E6N A;  4JI6 M;  2D7E A;  2Q2E B;  2O01 F;  4MB3 A;  4AKG A;  3AL0 C;  3GLI B;  1WGN A;  3VDU A;  4FW9 A;  7CAT A;  2QHO B;  2KW0 A;  1HNW M;  2LVP C;  4MH0 E;  2CV0 A;  2QBY A;  4NXM M;  1GL6 A;  4GIP A;  2L2D A;  2C5R A;  1SXJ A;  1OJL A;  4AKH A;  4I5S A;  5KPT A;  1GL7 A;  4G3O A;  3LQQ A;  4FWD A;  3VKH A;  2JE5 A;  1PRB A;  4PD2 A;  2A5Y B;  4GC9 A;  2MGW A;  4Z2H A;  2ZTD A;  1YE9 A;  2EO2 A;  1E9R A;  1LV7 A;  1QYR A;  1TDH A;  1OIP A;  1ZMW A;  1E32 A;  2DZO B;  3QYE A;  3MMP A;  4MM3 B;  1HNZ M;  3U6S A;  2XD5 A;  3CF2 A;  2V5O A;  4JI0 M;  4D81 A;  2L4E A;  2VII A;  1JR3 A;  3W0L B;  2J7O A;  2QCU A;  4IIW A;  4LJ4 A;  1OFI A;  1QZM A;  3PNV A;  2XEP A;  2DHR A;  2WSC F;  2KA6 B;  1EE8 A;  3NBX X;  4GC5 A;  1L2B A;  3W0F A;  1IXS A;  1NHW C;  3IEC A;  4GKK M;  4HL4 A;  4DR4 M;  2JXN A;  1ED7 A;  2Y2G A;  4LJ8 A;  3KP0 E;  3FUV A;  3TPZ A;  4P17 A;  4II7 A;  3U61 A;  2JZ0 A;  3HSH A;  1UR9 A;  1GPF A;  3SAR A;  1ZQ9 A;  3H4M A;  1T6O A;  1E6Z A;  2JNH A;  1SXJ D;  2DZN B;  1F4I A;  4HMC A;  1D0K A;  2APL A;  3HY5 A;  1IXS B;  2V1U A;  2R4J A;  3AOE C;  5ITX A;  3CTW B;  1KSF X;  4KLN A;  4NC6 A;  3GLG E;  5ITU A;  2DWL A;  2AHM A;  4G4O A;  4B3S M;  3KS8 A;  2DNA A;  4Y28 F;  2CHV A;  2WSF F;  1AUA A;  1O6I A;  3T6P A;  4JI3 M;  1E8B A;  1JR3 D;  3WHL A;  3K9O A;  4DR1 M;  3U6P A;  1TH2 A;  1NVM A;  1FNN A;  4QOS A;  2G8L A;  3I04 M;  1XB2 B;  2DXI A;  3KW6 A;  1JQJ C;  2J5Y A;  3DFZ A;  2F5P A;  1P3Q Q;  3LMM A;  3SAV A;  1QZE A;  2C98 A;  4IBB A;  4M0W A;  2JY7 A;  4L16 A;  2QQ8 A;  2I7N A;  2QZ4 A;  2LXE A;  3Q8X A;  4KT0 F;  3U6O A;  1G4A E;  1N32 M;  3KOW E;  4DV2 M;  5KPR A;  5FTJ A;  1GKI A;  2OOB A;  3UK6 A;  1QDT A;  2M60 A;  4RNA A;  3VK7 A;  4CIZ A;  4B7G A;  5FTL A;  3U6M A;  3TWM A;  2DWN A;  3A46 A;  4BBA A;  1L1T A;  2QNJ A;  3U60 B;  2FFF B;  2BJW A;  3KS4 A;  3FKE A;  1WXQ A;  1OGG A;  1EAK A;  3T1Y M;  1IY2 A;  3E21 A;  2L09 A;  4JI2 M;  4KOD A;  1WR1 B;  4NSR A;  2UU9 M;  1SXJ C;  2ZTC A;  2HWJ A;  1WGL A;  2F5O A;  1R2Z A;  2Z4R A;  1QVR A;  1L2D A;  3VLF B;  4KHP M;  1QAO A;  2C9O A;  3LCV B;  4IBI A; 
#chains in the Genus database with same CATH homology
 3JR5 A;  1Z5C A;  1T3T A;  1XNR M;  3SAW A;  1ORY B;  3SMP A;  1TGU A;  4LJA A;  1IM2 A;  4S12 A;  4I8O A;  2Y0T A;  5JI2 E;  5KO3 A;  4I4L A;  3J81 S;  2C9C A;  2FOI C;  3AJI B;  4MGH A;  5F3W A;  3RE8 A;  5E26 A;  1XNQ M;  5BR8 M;  4HLQ A;  4LFB M;  4NZ3 A;  3ZC7 B;  4R7G A;  3E9S A;  1R2Y A;  4IBK A;  1IXZ A;  1HQY E;  2XF3 A;  2Y2K A;  1DGF A;  3FUW A;  1YUE A;  2OQ4 A;  4P16 A;  1YU2 A;  3KOY E;  4IBF A;  4FD2 A;  4M9S A;  2G5G X;  3FTD A;  3SMS A;  3WX7 A;  3A45 A;  1YU3 A;  3QAU A;  3IG8 A;  4LJ9 A;  1DGB A;  4I81 A;  3K8Z A;  1IBK M;  2UUA M;  3HJ8 A;  2EA0 A;  3FD9 A;  3UGJ A;  4G4Q A;  3GRV A;  3HU1 A;  2F5Q A;  5EP3 A;  2D7G A;  3RGS A;  1I94 M;  2RGO A;  5KQD A;  1L8Q A;  2JA2 A;  4DV6 M;  2UWX A;  2KZS A;  1NHG C;  2I7P A;  4LZJ A;  5DNY A;  1YU4 A;  1IN8 A;  3GLG B;  2UXC M;  4L78 A;  3KSX A;  1IBL M;  4NYY A;  1NSF A;  3KDS E;  5GKN A;  3VDP A;  2Y2O A;  4G4N A;  4JI5 M;  2XLJ A;  4IBD A;  2FFJ A;  1Z6T A;  2ERC A;  4X62 M;  1IN4 A;  3GO8 A;  3L27 A;  5FTK A;  3D8B A;  1J5E M;  1DO2 A;  3SFZ A;  5KQ8 A;  2UXD M;  3TQS A;  2KEB A;  3AOG A;  3THG A;  1QAQ A;  4EIW A;  5ITR A;  3K2L A;  4MB7 A;  4BLC A;  4NY2 A;  2R45 A;  3DOA A;  5EXS A;  4DUY M;  4LF7 M;  2XSZ A;  1Z5B A;  4DUZ M;  1Z59 A;  3AV0 A;  3ZCB B;  2K47 A;  4WW0 A;  3VFD A;  4DR5 M;  5BPV A;  2Y21 A;  2W82 A;  3E4R A;  5EQT A;  4LJ5 A;  3BOS A;  2C96 A;  4B3M M;  3M7G A;  1MX0 A;  4AG6 A;  3I4V A;  1L2C A;  2HHH M;  4QNL A;  5IRE B;  1N75 A;  1NNJ A;  1DGH B;  5EXP A;  1W5S A;  4JN6 A;  3GRY A;  4AW4 A;  4DR2 M;  3K1J A;  1HQC A;  1E9S A;  1G59 A;  4DR3 M;  2J7N A;  4FWH A;  5KPZ A;  3U6L A;  2Y20 A;  2CFO A;  2Y2P A;  3LQR A;  2XSZ D;  1R7R A;  1DGG A;  3MJ5 A;  4B3R M;  3VK8 A;  3UZU A;  1IN6 A;  2BG1 A;  1GVN A;  3TE6 A;  3D8L A;  3GQ5 A;  5IZ7 D;  4FWG A;  1NY5 A;  4OVZ B;  2QP9 X;  4JXJ A;  2YQZ A;  3FYC A;  4W5W A;  4LF9 M;  4TUW A;  4OUI A;  4R3D A;  2ZAM A;  3SAS A;  2DWZ B;  2EUC A;  3KSJ A;  4NSO B;  1QQW A;  3U60 A;  1OFH A;  2V1C A;  3SBJ A;  3FYD A;  3EIH A;  3DZD A;  4D80 A;  1K3X A;  1N33 M;  1QAN A;  3L26 A;  4LF4 M;  4GHL A;  3L29 A;  4PDI A;  3A98 B;  2KRU A;  1I4W A;  4KO8 A;  3HJS A;  2VQF M;  2LH0 A;  4B7F A;  1XXH A;  2F4V M;  4DR4 M;  4YY3 M;  1GLN A;  2UXB M;  2XGN A;  4JI4 M;  3KP1 E;  3GP1 A;  4QHS A;  2QBY B;  4Z6Y A;  2CV1 A;  3UMM A;  3OTO M;  4NXN M;  1IXR C;  3CF6 E;  4GRI A;  4LY6 A;  2RGH A;  1NJF A;  3GQ3 A;  2P5T A;  1IBM M;  1D2N A;  4JV5 M;  4OVZ A;  1TDZ A;  3FTC A;  4IJF A;  4QHT A;  5FTM A;  3DA1 A;  3L25 A;  1YU1 A;  4Z8X A;  5ITY A;  5LMU M;  2R65 A;  3U6D A;  4NOO B;  5FLX S;  2L7H A;  1VDD A;  1Q39 A;  1XHB A;  1H6U A;  4NZ4 A;  1NY6 A;  3FTE A;  4LGM A;  3UJN A;  3GLG A;  2R62 A;  3TWK A;  3M6A A;  2FE8 A;  3FUX A;  2CE7 A;  2V6Z M;  5A2Q S;  2OPF A;  5H37 D;  2YNM D;  4DV1 M;  3K92 A;  3KVW A;  3J7A S;  1KFV A;  4AKI A;  4LJ6 A;  2QEN A;  4GIT A;  1IQP A;  1UM8 A;  2BJV A;  3A42 A;  3GPX A;  4L4U A;  3AKZ A;  1G8P A;  3SHG B;  4B7H A;  1G41 A;  4RF0 A;  4CIS A;  1YSY A;  2Y2M A;  3IG5 A;  4PCZ A;  3LVV A;  2KZU A;  2HL7 A;  2ZAO A;  3B9P A;  3HJQ A;  1QAM A;  2RKO A;  3C58 A;  5C1B A;  2X8A A;  3FTF A;  3ZH9 B;  4LZZ A;  2XD1 A;  3GPP A;  3I4Y A;  3HU3 A;  5DYI A;  3GPY A;  2Z4S A;  2QPA A;  4M9Z A;  3HHY A;  4QNR A;  1IY1 A;  3HHZ A;  2XZU A;  4OX9 M;  3T1H M;  4YHH M;  2XZF A;  2M5Z A;  3MHV C;  2F5N A;  3L2A A;  2FNA A;  2DVW B;  3CF0 A;  5E6J A;  3U5Z B;  1DO0 A;  1Q3B A;  1J09 A;  3PNY A;  4NRV A;  4NL4 H;  4FCT A;  5EXX A;  4NRW A;  4K0K M;  4GKJ M;  1NJG A;  4NYU A;  2XFS A;  4WUR A;  4B3T M;  2HCB A;  3SAT A;  2O5R A;  4OW0 A;  1YUB A;  4L15 A;  4X66 M;  2ZM6 M;  4LF5 M;  4IBJ A;  1Q3C A;  4LFC M;  3HKP A;  2CEA A;  3U5Z A;  3RGP A;  2CHG A;  3SHF A;  4XGI A;  5EP2 A;  3T38 A;  4MGI E;  4AZF A;  2IOU A;  4OU7 A;  5EP4 A;  3GLI A;  3KOZ E;  1L1Z A;  3GPU A;  4FVM A;  1W5T A;  4ZPX A;  4JI1 M;  3T15 A;  1IN7 A;  4GMQ A;  3PXG A;  2Y2H A;  2C99 A;  2Z7J A;  3LVW A;  3L28 A;  4DV7 M;  3FUT A;  2L7I A;  4ITQ A;  3I51 A;  3EIE A;  2BNK A;  3GRU A;  3RFW A;  4PDG A;  4GH9 A;  1YU0 A;  1IN5 A;  4AI6 A;  1PJJ A;  4OJ6 A;  1TH3 A;  3QWL A;  4REZ A;  4LFA M;  1N77 A;  2UUC M;  4OJL A;  4IBC A;  4OJP A;  3GLF A;  3GRR A;  1N34 M;  5EP1 A;  3KXE C;  2CUZ A;  3M0E A;  1XMO M;  1XXH B;  3SYL A;  1XMQ M;  3GLH B;  4DR7 M;  1KYI A;  2F5S A;  2D7H A;  2Y0Q A;  3U6C A;  3TWL A;  3R8F A;  3J2P B;  2LWX A;  3U61 B;  4LCB A;  2CHQ A;  2VQE M;  1X37 A;  4GHA A;  1SXJ E;  1S3S A;  4LJ7 A;  4JYA M;  4MGZ E;  5ITQ A;  1FJG M;  1N78 A;  3HU2 A;  1NNU C;  1Z5A A;  4LG2 A;  4IJE A;  2LNH C;  5JI3 E;  3GLH A;  2UUB M;  2XFT A;  3J27 B;  2E5L M;  2L6O A;  4QOZ C;  3MK6 A;  3HGI A;  4LRS A;  2Y2N A;  5EXT A;  3TL4 X;  4OJO A;  1XWI A;  5FSW A;  3GLF B;  2Y2J A;  2X49 A;  3KOX E;  4JI8 M;  3KFU G;  4MGY E;  4LF6 M;  2R18 A;  2NQ8 C;  4DV0 M;  3WHK A;  3JR4 A;  1G3I A;  4PT5 A;  5DYG A;  1TH4 A;  2CV2 A;  3AFH A;  4JI7 M;  3R9X B;  1K82 A;  3NWL A;  2X4A A;  4LGY A;  4M9X A;  5FTN A;  2YFQ A;  4MGK E;  4D82 A;  3HHW A;  3GQ4 A;  1PJI A;  4NZ1 A;  4DR6 M;  2R46 A;  4BB9 A;  2KRK A;  4FCV A;  1IY0 A;  4AQY M;  1PM5 A;  2HKJ A;  2ZBK B;  5ITX E;  3U6E A;  4XBO A;  3NBI A;  4DV5 M;  4L8R C;  1J7K A;  2Y2I A;  4RF1 A;  1XC8 A;  1E94 E;  3PVS A;  5C18 A;  2ZAN A;  4DV3 M;  3U6Q A;  4X64 M;  1HR0 M;  1HT2 E;  2XH9 A;  3J80 S;  2Z3X A;  3SAU A;  3HWS A;  2DWM A;  4LF8 M;  2Y2L A;  2KXE A;  5IWA M;  3ILK A;  4IBE A;  2R4E A;  4CHT B;  4G6Z A;  4X65 M;  4M0D A;  2YR0 A;  4A3V B;  1HNX M;  4OJ5 A;  1C1K A;  1N36 M;  3J7B A;  4CGY B;  4DV4 M;  1ZAE A;  4QNM A;  1R6B X;  4FCW A;  3FUU A;  3HHX A;  3PFI A;  1MU5 A;  4AG5 A;  3SC3 A;  3HON A;  5LMN M;  4IBG A;  1DGH A;  4B08 A;  3AOE A;  8CAT A;  4LRT A;  1SXJ B;  1HT1 E;  3SYK A;  3JAM S;  2JCH A;  2Y2Q A;  4G4R A;  5EJC A;  5ITT A;  2H1R A;  1K3W A;  5IT9 S;  4JI6 M;  2D7E A;  2Q2E B;  4AKG A;  3AL0 C;  3GLI B;  7CAT A;  3VDU A;  4FW9 A;  1HNW M;  2KW0 A;  4MH0 E;  2CV0 A;  2QBY A;  4NXM M;  1GL6 A;  4GIP A;  2C5R A;  1SXJ A;  1OJL A;  4AKH A;  4I5S A;  5KPT A;  1GL7 A;  2JE5 A;  3LQQ A;  4FWD A;  3VKH A;  4PD2 A;  2A5Y B;  4GC9 A;  1YE9 A;  2EO2 A;  1E9R A;  1LV7 A;  1QYR A;  1TDH A;  1E32 A;  2DZO B;  4MM3 B;  1HNZ M;  3U6S A;  2XD5 A;  3CF2 A;  4JI0 M;  4D81 A;  2VII A;  1JR3 A;  3W0L B;  2J7O A;  2QCU A;  4IIW A;  4LJ4 A;  1QZM A;  1OFI A;  3PNV A;  2XEP A;  2DHR A;  2KA6 B;  1EE8 A;  4GC5 A;  1L2B A;  3W0F A;  1NHW C;  4GKK M;  4HL4 A;  2Y2G A;  4LJ8 A;  3KP0 E;  3FUV A;  3TPZ A;  4II7 A;  3U61 A;  3HSH A;  3SAR A;  1ZQ9 A;  3H4M A;  1SXJ D;  2DZN B;  2V1U A;  1IXS B;  2R4J A;  3AOE C;  5ITX A;  3CTW B;  1KSF X;  4KLN A;  5ITU A;  2AHM A;  4G4O A;  4B3S M;  3KS8 A;  2CHV A;  4JI3 M;  1JR3 D;  3WHL A;  4DR1 M;  3U6P A;  1TH2 A;  1NVM A;  1FNN A;  4QOS A;  2G8L A;  2DXI A;  3KW6 A;  1JQJ C;  3DFZ A;  2F5P A;  3SAV A;  3LMM A;  2C98 A;  4IBB A;  4M0W A;  4L16 A;  3U6O A;  2I7N A;  2QZ4 A;  2LXE A;  3Q8X A;  1N32 M;  3N3F A;  1G4A E;  3KOW E;  4DV2 M;  5KPR A;  5FTJ A;  1GKI A;  3VKG A;  3UK6 A;  2M60 A;  4RNA A;  2DWL A;  3VK7 A;  5FTL A;  4B7G A;  3U6M A;  2DWN A;  3TWM A;  3A46 A;  4BBA A;  1L1T A;  3U60 B;  2FFF B;  2BJW A;  3KS4 A;  3FKE A;  1WXQ A;  3T1Y M;  1IY2 A;  2L09 A;  4JI2 M;  4KOD A;  4NSR A;  2UU9 M;  1SXJ C;  2F5O A;  1R2Z A;  2Z4R A;  1QVR A;  1L2D A;  3VLF B;  4KHP M;  1QAO A;  2C9O A;  4NZ5 A;  4IBI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...