2UWXA

Active site restructuring regulates ligand recognition in class a penicillin-binding proteins
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
489
structure length
468
Chain Sequence
ISEITYSDGTVIASIDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPATTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTNQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Active Site Restructuring Regulates Ligand Recognition in Class a Penicillin-Binding Proteins
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
molecule keywords PENICILLIN-BINDING PROTEIN 1B
total genus 149
structure length 468
sequence length 489
ec nomenclature ec 2.3.2.-:
pdb deposition date 2007-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2uwxA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2uwxA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2uwxA02
4KENB 4GZBA 4EV4A 2XLNA 4JXGA 4S2LA 3HUNA 3GRJA 1XX2A 3ITBA 4DE2A 4EUZA 4H8RA 2HDSA 3LY3A 1MPLA 3ZVWA 4X56A 1NRFA 1NY0A 4KZ5A 3S1YA 4QY5A 4MEZA 2OLUA 3TG9A 3ZCZA 3UO9A 4GDNA 5A92A 3CJMA 1K54A 2HDQA 4OLDA 5EVID 3RJUA 3M2KA 5KZHA 3B3XA 3GMWA 4OQIA 5GL9A 3VP0A 5CHJA 3IXGA 5EUAA 3G2ZA 5G18A 1RGZA 1MBLA 5F82A 2VGJA 4UAAA 2EX9A 3HBRA 5F1GA 4P87A 1S6RA 1YMXA 3ZNTA 5HL1A 3N4IA 4Y7PA 4P0MA 5DVAA 3ISGA 4KQOA 5E43A 3BM6A 4XUXA 1K6RA 1XA1A 4N9LA 5AQ7A 2E8IA 3UDXA 5CTMA 1MWSA 5EOEA 1CI8A 3IHBA 3OCLA 2XK1A 3Q81A 3C5AA 4LV0A 3C4PA 1XKZA 1L2SA 3IF6A 1MWUA 3G35A 5CECA 1E25A 4M3KA 4MBHA 4LV2A 2Y2QA 1K4EA 1U60A 4PM5A 4ID4A 5EVLA 1K57A 3PAGA 5DF9A 2V20A 2QMIA 2V1ZA 4R23A 3UE1A 3MFDA 5FI6A 4ZJ2A 5I94A 3M6HA 1KDWA 4N92A 1E4DA 2Q9MA 5EVIB 2RL3A 2XF3A 1PWDA 1YT4A 2R9XA 3BYDA 3FZCA 3BEBA 4DE1A 1IYOA 3PTEA 1N9BA 1RP5A 2ZC3B 3E2LA 4ZJ1A 3VFFA 3WRZA 4FD8A 4KZ3A 5DTSA 2WK0A 1KE0A 2IWBA 3N8RA 5E2HA 1DJBA 2ZC7A 3ZDJA 2JC7A 4WYYA 2H10A 3A3EA 3N8SA 5CXWA 3IXDA 5HAQA 5CTNA 5FQMA 2XD5A 2EXAA 2OSUA 2P74A 4D2OA 3MZFA 4UA9A 4ZDXA 1PW8A 3O88A 4KQQA 3I7JA 3RXXA 1H5XA 1PW1A 2ZQCA 5DTKA 2ZC6B 3VMAA 1W8YA 5GLAA 1ERMA 2Y2JA 3FKVA 5DF7A 2Y2IA 4KZ9A 4WM9A 3DTMA 3ITAA 2C5WB 1HTZA 3G34A 5DF8A 5TR7A 5KSHA 3PBRA 3SOIA 1LL9A 1Y54A 5GLDA 1C3BA 3IF5A 2HP5A 3S4XA 3G4PA 4C75A 5HX9A 2WYXA 2B5RA 1BLCA 3DWKA 3IXHA 1YLZA 2J9PA 4QB8A 2ZQ8A 2Y2PA 1CEFA 3PBOA 2A3UA 4S2IA 4WMCA 1NYYA 4FH4A 5CHUA 1HVBA 3O3VA 4BQMA 2QZ6A 4S2MA 1ZG6A 1PI4A 3IHAA 3P98A 3Q1FA 4R0QA 3NDGA 5CGSA 2IWDA 2J9OA 1WYBA 3IH9A 3IXBA 3M2JA 3QNBA 1NZUA 4WMCD 3QNCA 4IVKA 4X53A 1IKGA 5FDHA 3NIAA 5EPHA 1LL5A 1KVMA 3OCNA 4P6BA 4QY6A 3SS5A 4E3KA 4JXSA 3UPNA 4R4RA 1EWZA 2JBFA 4P85A 4OVDA 1BT5A 3HLWA 4HESA 2I72A 3SS4A 4EQIA 2FFFB 5HAIA 4E3OA 3HL9A 4OOMA 3NBLA 4Z9QA 3NCKA 4B4ZA 2Y2OA 1QMFA 3OPRA 4IVIA 1M40A 4MBFA 3FWLA 4DDSA 1ES3A 3C7UA 4N9KA 1Q2PA 2VGKA 2BG1A 2G2WA 1Z6FA 4JLFA 4S2NA 2DNSA 4OKPA 1W8QA 3WRTA 3A3JA 4JBFA 1CK3A 3LCEA 4UHUA 5FAPA 2PU4A 2P9VA 4RX2A 1IYQA 2IWCA 2WGWB 4QU3A 4E6WA 2HPBA 2ZM8A 3DWZA 3WS5A 5CHMA 3PBQA 3QHYA 5M18A 1FSWA 1ZC2A 4S2NC 3IH8A 5EOOA 3HLDA 2EFXA 4B4XA 4DE0A 5TGFA 1K4FA 2J8YA 1PZPA 2Z2MB 3NC8A 3C4OA 1K54C 5CEBA 2WKHA 4OPZA 5EVIC 3ZG8B 2ZQDA 4KZ4A 3BRMA 5FAQA 5J8XA 3GR2A 5CERA 1VM1A 3EQUA 4R3BA 3ZHHA 1LI0A 4UA6A 4BD0A 1JTDA 4KQRA 1OMEA 1MWTA 1GHMA 4QD4A 3ZG9B 3OPHA 4S2PA 1AXBA 1ESUA 1XGJA 2Q9NA 3A3DA 2FFYA 1IELA 4XUZA 5GHXA 2ZC5B 1K38A 1MY8A 2CC1A 4RYEA 2J7VA 4R3JA 4FSFA 1K56A 2X71A 3BFDA 2PU2A 3Q7VA 1PWCA 4UA7A 5AQBA 5F1FA 4XXRA 1ALQA 5D3OA 4HBUA 5CGWA 3A3FA 5FSRA 1JTGA 2H0TA 3V3SA 4WEJA 4BD1A 1IYSA 2HDUA 1ES2A 5HARA 1W5DA 3G31A 1GHIA 3HLCA 4E3IA 4O7DA 3ZG7B 1K6SA 3SH9A 1XP4A 1JWVA 1KGGA 4OQ0A 4S2JA 5FI7A 2XD1A 4WZ5A 1TDLA 4OOYA 1BSGA 2X02A 4PPRA 4Y0TA 4GKUA 3M6BA 1MXOA 4U0XA 1TEMA 2RCXA 4CJNA 5HW3A 1K56D 3HLGA 3PAEA 4A5RA 4EBLA 4FCFA 1KGEA 2XR0A 2P9VB 3WWXA 2Y55A 1H8YA 3G30A 1YM1A 3P09A 1DJCA 1M6KA 1E3UD 3SH7A 4X69A 3IF6B 5M1AA 3WS0A 4MLLA 5GLCA 4S2OA 3IF6C 5GHZA 4DXCA 3JYIA 3OPPA 3MKFA 3BFEA 3HVFA 5JYOA 1I5QA 4WZ5C 4YINA 4DXBA 1ESIA 3AGDA 3CMZA 4JF6A 3UPPA 3ZVTA 5EE8A 4OONA 1WYCA 2JE5A 4BLMA 4E3NA 2V2FF 4OPYA 1EI5A 1ZKJA 3N7WA 3WS2A 2ZQAA 1KE4A 1NYMA 4IEDA 1H8ZA 1SKFA 3GVBA 1MWRA 4OLGA 1FQGA 1ES4A 1K57C 4PM6A 3RXWA 1JWPA 3NI9A 5TFQA 4EBNA 1TVFA 3C7VA 4X6TA 2H5SA 1YLYA 3PBSA 3FYZA 1L0DA 4GN2A 1DJAA 4GNUA 4LV3A 4DF6A 4Q8IA 4NK3A 5KSCA 3DW0A 4LV1A 4E3MA 4K91A 3HUOA 2EX2A 2G2UA 5M19A 3PBNA 1ONHA 1YLPA 4Y0UA 4ZBEA 1O7EA 1YLWA 5FQQA 2DCFA 1BULA 5EECA 2EX6A 1LLBA 1FCNA 3AGFA 4LENA 2Z2LB 1FSYA 4KZ8A 4MNRA 1GA0A 4U3TA 5FQIA 1BZAA 2Y2KA 2HDRA 2EXBA 4KG5A 4EWFA 3FKWA 2Y2LA 1FOFA 3MZDA 1K55A 4WEKA 4R1GA 5DTTA 3Q7VB 2BLSA 3UE0A 3IT9A 3GSGA 3MZEA 3TSGA 3HREA 1IEMA 3AGEA 4OP8A 4ZAMA 3N6IA 1HZOA 3G2YA 4PM9A 2X01A 3GQZA 4C3QA 1IYPA 1RGYA 4IBRA 2Y4AA 5FI2A 2Y59A 3MKEA 1IKIA 1W7FA 5FQ9A 1L0EA 3GTCA 1FCMA 1FR6A 3S22A 1CI9A 2JCHA 1SCWA 2XDMA 2WUQA 2OLVA 3NY4A 4JPMA 1G6AA 1SDNA 4B88A 1YQSA 4CPKA 1TDGA 4OPQA 5CRFA 2Y2GA 3WS1A 2C6WB 1YLTA 1FCOA 2ZQ7A 4WBGA 5JYPA 1W79A 4KZBA 5HAPA 5E2GA 2XEPA 5AQ9A 3IWIA 4KG2A 3SS3A 4OPRA 3CG5A 4JF5A 2XH9A 1KGFA 3V50A 1EROA 4DRTA 3HLFA 4PMAA 1J9MA 2GDNA 5FATA 3LO7A 5HFOA 3BLMA 2R9WA 4NETA 1HD8A 5F83A 3VP4A 4OQHA 2ZLYA 2XQZA 1BUEA 2A49A 4LCMA 4K0WA 4N1XA 4DKIA 4HEFA 3BFFA 5FASA 3CZDA 1O07A 1ONGA 4PM7A 1KE3A 1L0GA 3D4FA 4QHCA 3HLBA 4OQGA 3VSKA 3ZG5A 4BJPA 4E6XA 5GHYA 3VOZA 3VSLA 4GDBA 3V5MA 3VP1A 2WZXA 3W8KA 3N8LA 2ZMAA 1G68A 3VP2A 3IQAA 5KMWA 3ZFZA 1XXMA 3OZHA 1I2SA 4S2KA 1NXYA 3BECA 4DE3A 5GLBA 4BL3A 2ZM0A 2XGNA 4GB7A 5CGXA 1K55C 4EBPA 3OPLA 4F94A 4JXVA 3Q82A 1BLSA 4R4SA 5E2FA 5E2EA 3W4QA 3W4OA 3SH8A 1GHPA 1PYYA 1KVLA 3ZG0A 1GCEA 4HBTA 1FR1A 1NJ4A 5EVIA 3UE3A 1BLPA 1L0FA 1LI9A 4BL2A 3O87A 3PBTA 3V3RA 1SDEA 1YLJA 4ZTKA 5A91A 4E3LA 1YMSA 3UPOA 5U47A 1KDSA 3BFCA 2WAFA 3A3IA 3MXRA 4DDYA 5A93A 5IHVA 4C6YA 1PWGA 3BFGA 1PI5A 1XGIA 1GA9A 2WKIA 2EX8A 2WZZA 5L2FA 1DY6A 2PBYA 2Y2NA 2EFUA 1SHVA 4LCLA 4X68A 3FV7A 4RA7A 5FQJA 4QJGA 4JKTA 4RVAA 3MBZA 4OOLA 3WS4A 3UN7A 2WGVA 4WELA 5FQKA 4KZ6A 3NDEA 4ZJ3A 3MXSA 1K25A 3HLEA 1XPBA 1E3UA 3BLSA 3HUMA 3LY4A 1WE4A 5CEDA 2Y91A 3OC2A 2HP9A 1N4OA 3EQVA 4WZ4A 5FAOA 4KZAA 4FH2A 4E3JA 1Q2QA 2ZD8A 1XA7A 1PZOA 1LHYA 3GV9A 5AQAA 4KG6A 3G32A 2Y2HA 4GD8A 3VOYA 2ZQ9A 3TOIA 3LEZA 3Q7ZA 3O86A 1ZG4A 2XFTA 4OH0A 4U0TA 2OV5A 5BOHA 1JVJA 2HP6A 2WADA 4PM8A 4BENA 1VQQA 2WGWA 2XFSA 4YFMA 2ZM2A 2ZC4B 3E2KA 2H0YA 3ZNYA 2WAEA 3IWQA 3VFHA 1I2WA 1MKIA 2UWXA 3Q07A 1QMEA 1ERQA 4OP5A 3ZGAB 1ES5A 4IBXA 3VP3A 4KZ7A 3UDIA 4JF4A 2QPNA 3UNWA 1CEGA 5A90A 3UY6A 2DRWA 3W4PA 3IWOA 1RCJA 4GOGA 4MBKA 5FA7A 1PIOA 3UDFA 2Y2MA 1JWZA 1NZOA 4K0XA 2ZJ9A 2WGIA 4X55A 4Y0OA 1BLHA 4JXWA 3V39A 4L0LA 2WKEA 1S0WA 4GD6A 1BTLA 4RX3A 4N1HA
chains in the Genus database with same CATH superfamily
4ARZB 1JFIB 3DAVA 4O8GA 4HOIA 4NYUA 1XX2A 3DTEA 3REID 2HDSA 4J8VA 4GS9B 4B9OA 3WD4A 1P3OB 1NRFA 1NY0A 1UWPX 2PYRA 3NOUC 3CJMA 3RJUA 1F2KA 3AFAD 5CHJA 3KSFA 2AROB 2UV0E 3AZNB 4UAAA 5IU1A 1F66B 3N4IA 4P0MA 5DVAA 3BM6A 4MDZA 1K6RA 3TE8A 3UDXA 2G5IC 5AV8A 1OTDA 2K31A 1CI8A 1P3KA 3Q81A 3C5AA 1XKZA 1KX3D 1E25A 4M3KA 1K4EA 4ID4A 3VH5A 4J8WD 5DF9A 3UTAC 2QMIA 5FI6A 4ZJ2A 3O62D 3KX0X 3M6HA 5AY8A 4N92A 1E4DA 2Q9MA 3WTPE 1PWDA 1P34D 3MGQC 1RP5A 3E2LA 2ZC3B 3O5YA 2RIQA 3LIBA 4XUJC 3REIB 5DTSA 3N8RA 4H9OB 5B1MB 3L9KA 3AZFD 1U35A 4HMDA 4X23B 5GT0A 3NQJA 2XD5A 4HHDA 1PW8A 1M18A 3TW8A 1H5XA 2HUEC 2ZQCA 2ZC6B 3VMAA 4R8PD 3FKVA 3REKA 4H9SA 1W63M 3DTMA 2C5WB 3G34A 5DF8A 5KSHA 1NLYA 3PBRA 4X23A 1H3QA 4IBCA 3QP6A 1Y54A 5GLDA 4H9OA 1MZUA 5EFWA 4LRZE 3T12B 2QYBA 2WYXA 3LZ0A 1BLCA 3C1BC 2Y2PA 1CEFA 4S2IA 2BYMB 3O3VA 3LFVA 1PI4A 4DMZA 4LLOB 4J8VB 3NULA 4GS9A 5CGSA 4H9RB 3IH9A 3MQ0A 3X1VA 4X53A 3E4QA 5FDHA 1N9LA 2LB5A 3NIAA 5EPHA 1LL5A 3A6NC 1E88A 2D49A 5AY8D 2B02A 2YFVB 3O62A 4JXSA 1EWZA 3AZGA 5GT3B 3BWLA 2JBFA 4NE6A 2HF6A 2ZY3A 3GDIA 4Z2JA 3B6GD 3TU4B 5HAIA 4H9QA 3HL9A 4NYYA 3QP1A 5DJTA 5B40C 2Q0OA 3EEHA 4DDSA 2L0WA 2VV6A 3E98A 2BG1A 3W97C 2G2WA 4OKPA 1A0KA 2CV5C 3NQUB 3UTBD 3AFAA 2ZL1A 5B32B 1CK3A 4R38A 2PU4A 2WGWB 3CLOA 1YSPA 3WS5A 5CHMA 3QHYA 5M18A 1W2EA 1ZC2A 4S2NC 1TS0A 5EOOA 5TGFA 2Z2MB 3AN2B 3NC8A 2Z6DA 4HMCA 3LIEA 5CEBA 4OPZA 3IS2B 1UR9A 1D7EA 1M19D 3GR2A 5CERA 1VM1A 4CLCA 3EQUA 3ZHHA 2F8NH 1Y28A 4WNNA 2JKGA 2FN2A 1YU3A 5CPJA 4QD4A 1AXBA 3KS4A 2Q9NA 2JKRM 2W1TA 1IELA 5GHXA 3QP2A 3KS8A 1P3KC 2CC1A 4DN0A 4R3JA 2ZY2A 2Z6CA 3LI8A 3AZHD 4XZQA 3KXBA 5AQBA 5F1FA 4YS3C 5CGWA 1JTGA 4BD1A 5JRGC 1IYSA 1EQZC 1W5DA 3G31A 3HLCA 2VGLM 4CAYA 4O7DA 4J8XB 1K6SA 1JWVA 3WD1A 1OGGA 4Y0TA 3EWKA 4B93A 3ZYTA 4CJNA 1K56D 3LI9A 3X1SD 4QLCD 2CMNA 5DNMA 3G30A 1DJCA 1M6KA 3TU4D 5JA4A 5GT3D 1I5QA 3AGDA 4JF6A 3T1XA 1EAKA 3B33A 5B1MC 4HIAA 3IBRA 3LELD 3GVBA 1P3AA 1HQ3C 1ES4A 5AV5B 1K57C 4GHIB 3S7NA 3MQQA 3MGRD 4EBNA 3C7VA 2B18A 1KX5D 5GSUC 4Z66C 3WTPA 1YLYA 1N1JA 3AZHA 1L0DA 1DJAA 4GNUA 5KSCA 4NK3A 4OJLA 4WL9A 3P7NA 1H0IA 3HUOA 3REJB 3S7QA 5M19A 2WKRA 4H6JA 2J80A 1P3AB 1YLPA 4MN6A 4Y0UA 3A1KA 5BO0A 5CPJD 5HL6A 3QP8A 5EECA 1LLBA 1FCNA 4KUDA 4LENA 4P6ZM 1W1YA 4MNRA 4U3TA 2Y2KA 2HDRA 5C3IB 4KG5A 5LBRA 1HLUP 3U2AA 3FG8A 3MZDA 1K55A 4O01A 3H7WB 1KX5B 1CK7A 3X1TA 1KX4C 3TSGA 1AWIA 1IEMA 2ZOHA 4ZAMA 3N6IA 2PD7A 2X01A 3UTBA 1LSWA 4IBRA 4Z5TA 2YKHA 1P3MC 2W3GA 2F2AC 3MGPC 4ZUXA 2J3TD 3UB6A 1L0EA 1NLZA 2YFVA 3O62B 1FCMA 1FR6A 3S22A 2JCHA 2XDMA 3NY4A 1G6AA 4B88A 1TDGA 3WS1A 2ZOIA 3B6GA 2C6WB 1KX3C 3X1TC 2HZ5A 4F3LB 5HAPA 5AQ9A 3IWIA 4UPKA 3V9RB 4KG2A 1E6PA 3L29A 1VB6A 1KGFA 3V50A 1EROA 1L6JA 1UR8A 3UB5P 2GDNA 2AVXA 5AV6A 3LO7A 2R9WA 4XZQC 4NETA 1HD8A 5CPJB 3H0MC 2XQZA 1BUEA 3AYWC 1UGUA 4LCMA 5HD5A 1V9YA 4K0WA 4N1XA 2AROA 5B31B 4XUJB 3V67A 1ONGA 4BJPA 1KE3A 4IUHA 3D4FA 3HLBA 3ZG5A 5BT1C 5GHYA 3V5MA 3AV2A 2ZY4A 3ZFZA 3DTKA 3OZHA 4HJ4A 2W1TB 3MS6A 4BL3A 4KUKA 5BPVA 4Y15A 5GXQD 5B0YB 5CPKB 1KOUA 4GB7A 5CGXA 3AZGB 1K55C 5B1LD 1S32D 4J8XC 2AROC 5E2FA 5E2EA 4Y2FA 3SH8A 3AZFA 5AVBA 5HWWA 1GCEA 5AVCA 2DQNC 1LI9A 4J8WC 1F5MA 3EOIA 4CSRA 4ZTKA 1YMSA 3UPOA 1GSVA 3LZ1C 4DDYA 3W96A 1J3WA 1PWGA 5C5KA 2WZZA 4HGAB 1DY6A 2XSSA 1HQ3D 3R4KA 4LCLA 3MQLA 4RA7A 5FQJA 4QJGA 4KGCD 4OOLA 3LJAB 1VETB 1YPRA 1KX3A 4WELA 4KZ6A 3UN7A 3BLSA 4QNLA 2EWWA 3EQVA 4WZ4A 5FEFA 4OJ6A 1M1AB 5G4YA 3B6GB 4WU8A 4G92C 3W97A 4E45A 3MGPD 1LHYA 3KUYD 2Y2HA 3R45B 2ZQ9A 2P08A 5B2IA 3F1NA 3AZIA 4WU9B 3KFUG 1YU1A 2JKTM 4I39A 1KX4D 4QLCC 3C2WA 3DBAA 3X1SC 2H0YA 1ED7A 4H9RA 4J8VD 1I2WA 3VFHA 5B0ZA 3W97B 1KX4A 1QMEA 4OP5A 1M19B 1M18B 3AZID 4EO5B 4YM6A 4KZ7A 3UDIA 2OAQ1 1WA9A 3MVDB 3AN2D 1S67L 1AOIC 3UY6A 4XZQB 3W4PA 3C1CD 1RCJA 4GOGA 4EERA 3M7PA 5GXQC 1JWZA 5BNVA 5G4ZA 2LY8A 4Y0OA 1IFQA 3V39A 4JJNA 5AV8C 4L0LA 1SZVA 3UTBB 3LR5A 5B31C 1OJ5A 1P3FC 1KX4B 4GZBA 5F5YA 3TJZC 1KX5C 2MJ6A 1T1CA 2XLNA 1T19A 4S2LA 4Z2IA 3MGPB 4H8RA 5CP6C 3LY3A 1MPLA 3AZFB 1P3KB 4X56A 3S1YA 2DF4C 5B1MD 2V8CA 4MEZA 1TZYB 4NY2A 1K54A 3FDDA 1LSXA 4UEYA 4IHQA 1ID3C 5AVCD 2W1RA 3L2AA 5KZHA 4Z2MG 3B3XA 3B0DB 3GMWA 5GL9A 2A24B 5BS7A 3G2ZA 4GLQA 5G18A 2VGJA 5F1GA 3WAAC 2F8ND 2HIOD 2ZMFA 5HL1A 1P0ZA 3ISGA 4UQIM 5AQ7A 2E8IA 1TAFB 5CTMA 2YFWB 2XK1A 4BBUA 3A0VA 4KGCA 5CECA 3UT9B 4MBHA 4AFIA 4NE3A 2KLIA 1Z2CB 4MN5A 4Q0HA 2V20A 4R23A 4HGAC 3T4KA 3UE1A 3HONA 3AYWB 4WV4B 3LZ0C 2XA7S 5EVIB 2RL3A 4ETXA 1YT4A 4QWOA 2R9XA 2AROD 3BEBA 4DE1A 1IYOA 3PTEA 3MJQA 4ZJ1A 3AFAB 3T1QB 5B0ZC 2M1CA 5B0ZB 1KE0A 5E2HA 2JC7A 3MQOA 3A3EA 5CXWA 3IXDA 3L28A 4JGQA 4LD9A 4X23C 2OSUA 5J4EA 3W96C 3O88A 2HJ9C 2KOIA 3I7JA 1PW1A 2NQBD 5DTKA 1ERMA 3ITAA 5TR7A 3LR4A 4ZUXB 1M19C 5F6AA 4H9PA 1H3OB 4MB4A 3L26A 3JPUA 3IF5A 3S4XA 3G4PA 4C75A 5HX9A 2B5RA 3DWKA 4J8WB 2J9PA 2ZQ8A 3PBOA 4WMCA 1NYYA 4FH4A 1ZG6A 1H8PA 3BY8A 3Q1FA 3NDGA 4EEPA 4YNRA 3LELC 3X1UC 1NWZA 1IKGA 1KVMA 3V9RA 4P6BA 4QY6A 3UPNA 4HI4A 3RFBA 3L7HA 3VE4A 4HESA 3D9YA 4E3OA 1OGBA 5DNMB 1F98A 3NBLA 3NCKA 4IVIA 1H8MA 1PNEA 3AYWA 4R6LA 2GNXA 2QJ7A 4N9KA 4LD9D 3MGSD 3WTPD 3WRTA 1KX5A 4KHAA 4WNNB 4UHUA 1Z09A 5FAPA 4YS3A 1IYQA 3G6OA 3DWZA 2V5OA 5F68A 3UT9C 3AZKC 4F3LA 4DQYB 4HJ6A 2J8YA 1PZPA 3UTAB 5JRGD 2PD8A 3C4OA 5AVCC 1WWIA 4NZ1A 4MN7A 1K54C 4GJ4A 4II7A 2F8NG 3ZG8B 2ZQDA 4KZ4A 5FAQA 5J8XA 5GT3A 2I9VA 3NJAA 4R3BA 1LI0A 4KQRA 1OMEA 3MGRB 1XJ2A 4NZ5A 2WKQA 5AV5D 4Q0IA 2FFYA 4IBDA 4XUZA 1P3OC 4RYEA 2J7VA 4LGWA 4FSFA 4J8XA 3EPKA 1CF0A 3EG5B 2BYMA 2VJWA 4WZSB 5D3OA 3T4SA 4L9FA 3UB9A 5FSRA 3W2ZA 2H0TA 3V3SA 4WEJA 3B6FC 2HDUA 1P3PB 5HARA 3LELA 1NRJA 1GHIA 4E3IA 2NUTC 1XP4A 5HWVA 1KGGA 4OQ0A 4S2JA 4GKUA 4U0XA 4X25A 3H9WA 3PAEA 3REHD 4NKPA 4LD9C 4FCFA 5B24C 1TS8A 3TU4A 3WA9B 2P9VB 3WWXA 1YM1A 4RQ9A 1P9RA 4X69A 3KWQB 3X1SA 3LZ0B 4MLLA 3F1PB 3IF6C 1ACFA 4GHLA 4XT2A 3MGQB 3OPPA 3MKFA 4YM6D 3AZLB 4WZ5C 4DXBA 1G6OA 1F66A 1ESIA 3CMZA 5DNNA 1N1JB 5AY8C 3AZHB 5JRGA 1OPXA 3BQ8A 3N7WA 4Y17A 5E5AD 1NYMA 4IEDA 1H8ZA 1SKFA 2PYOA 1FQGA 1ZTUA 3RXWA 5AV5C 1TVFA 1U35B 3PBSA 1E8BA 3W99B 3FYZA 3LYXA 4GN2A 4Q8IA 4ZUXC 1JFIA 4LV1A 3AZLA 4K91A 2EX2A 3HCYA 3PBNA 2OWJA 2PR6A 1MKMA 2NZDA 1ONHA 4ZBEA 1O7EA 1YLWA 5FQQA 4ETZA 3VOLA 2DCFA 2PDRA 3AN2C 3LGOA 1GA0A 1CXWA 5FQIA 4CLCD 4M6BA 1BZAA 3S7PA 3B47A 3UMEA 1W1TA 2EXBA 4EWFA 2Y2LA 3W96D 3C1BA 5AV8B 4WEKA 5I5LA 3UE0A 4NXGA 4PHTA 3GSGA 3EGXC 3HREA 4CAYB 3AGEA 3A6NB 5F99D 2OAP1 4P6ZS 1ZLAA 1RGYA 2BYKA 5BS7C 3BJNA 1P3BC 2W27A 3QP4A 4J8UA 3O62C 1G5UA 2RVQC 1ID3B 4CPKA 4OPQA 4I3IA 3X1UD 5JYPA 3F1PA 1SKOA 3AV2D 1W79A 4KZBA 5B32C 5E2GA 4J8UD 4OPRA 3CG5A 3PXPA 3WAAD 4DRTA 3X1VC 4Q0JA 4GW9A 2CV5A 1WWSA 4OQHA 4H9PB 1P3IC 2ZLYA 3PYPA 2A49A 3JVVA 1S32C 2FJ7B 2A24A 3BFFA 5FASA 1O07A 3H82B 4PM7A 4LPZA 4FTXA 2VGLS 4ZBJB 1IOUA 2XROA 1G68A 4X23D 4KUOA 3SW1A 3NHQA 3W98D 3REKD 4NXBA 5B2JC 4R8PA 5AV8D 5GLBA 2ZM0A 4JGRA 4DRBA 5CPKC 4EU0A 3KSYA 3OPLA 4KQDA 5GT0D 4EBPA 4R4SA 3W4QA 2ZMVA 1BYWA 3ZG0A 1ZLAD 1E6ZA 5F69A 4HBTA 1BH9B 3LICA 1L0FA 3C1BB 4BL2A 3O87A 5HDSA 3OLOA 4H9NA 1SDEA 5A91A 5AV9D 1KDSA 1ULYA 2WAFA 3MXRA 4J8UC 4WJ3C 2FH5A 5DNND 3ULFA 1F66D 3BFGA 4J8WA 2PBYA 2EFUA 1P3LD 1SHVA 3CHWP 3AV2C 3FV7A 3WS4A 4KUDD 1D1JA 2WGVA 3AZLC 1K25A 2QWSA 3IX8A 3RELB 5CEDA 3MXQA 4IBBA 3T4TA 2HP9A 2GJ3A 5FAOA 3MMHA 1VEUA 1G28A 3C1CA 5GT3C 3UT9A 3AZLD 5KDMA 2ZD8A 1XA7A 3REHA 1PZOA 2PAVP 4KG6A 3R7WA 5FUGA 3IBJA 2ZM5A 3Q7ZA 1ZG4A 5B40B 4HP4A 2HUEB 2PYOD 2PYPA 4PM8A 4BENA 1VQQA 1OTAA 3A0SA 3VH5T 5B24D 2ZC4B 4Z66B 5GSUB 5E5AA 3REIA 3REHB 2UWXA 1T1AA 3AV1C 5KIZA 3F1OA 1ES5A 4IBXA 2M7VA 3VP3A 5CPIC 1OTEA 1AOIB 2EWVA 1DP8A 3IX3A 5A90A 1EQZD 2DRWA 5CPID 5B2JA 4H9QB 2Y2MA 3CI6A 3AV1D 2ZJ9A 2WGIA 1YAXA 4G3WA 2WKEA 2VX8A 4UUZB 1B67A 4RX3A 3W98C 3KYQA 4KENB 1P3FB 4EV4A 4NE5A 1HQ3A 3VH6W 3NECA 3HUNA 1BH9A 5CP6B 4EUZA 4OJOA 4R3AA 4UQIS 4NXEA 2YFWA 1PRQA 1P3MB 4KZ5A 4GH9A 4Z2HA 4Z2MH 3TG9A 4GDNA 4OLDA 1LT0A 2HDQA 3UTAA 3EPJA 1MC0A 1D06A 1EQZB 4IUKA 3IXGA 5TBMA 5JRGB 3AZKD 1MBLA 3MGQA 5F82A 3HBRA 1OTBA 1T18A 4P87A 4Y7PA 1F66C 4KQOA 2FZ0A 2G7UA 4XUXA 2O9CA 4N9LA 2D01A 5AV5A 4GHIA 1ODVA 3FPVA 1MWSA 3MFXA 5EOEA 3IHBA 3FC7A 4JJNB 3MGSC 2EA9A 5B24B 3L25A 3IF6A 4WU8B 3X1VB 5TBMB 2Y2QA 2PYOB 1TD5A 4PM5A 3AZKB 4O0PA 1P3IB 5EVLA 2VKSA 3K3DA 2B95A 4NG2A 5J3WA 5I94A 1E6NA 2NUPC 2O0YA 2VA0A 1YU4A 2XF3A 4H9SC 3LUQA 3KYEA 4WF0A 3FZCA 5FUGB 3VFFA 5EVEA 3WRZA 4FD8A 4PKYG 4KZ3A 3T50A 3RELD 4YS3D 2WK0A 3K3CA 2ZC7A 4EETB 3KWQA 1YUEA 3MGSA 1X0OA 4ARZA 5HAQA 5FQMA 2P74A 4D2OA 3HJIA 4GCZA 4KQQA 2VV7A 5BT1D 5B33B 4EQ1A 3WX7A 4DRAA 5GLAA 2Y2JA 5DF7A 5FL3A 2Y2IA 4WM9A 4CLCC 4HMEA 2ZBBA 3SZTA 2HP5A 4HQAA 1ZLAB 4QPRA 2QJ5A 4G91B 3VE3A 4QB8A 4ZUXD 1HVBA 4BQMA 5GSUD 4Z66D 4S2MA 5J7EA 5A8BA 3WA9C 4CSRB 3UE6A 3X1TD 4OJPA 2J9OA 2IO5B 2XRNA 3M2JA 3NOPC 4WMCD 3QNCA 3NQJB 3OCNA 2IOUA 3IS2A 4KHAB 3RH8B 2L5AA 5G49B 3CAXA 4R4RA 3RELC 1P3GD 1R4VA 4OVDA 1BFMA 5AV6B 3HLWA 2I72A 1P3BD 1J7MA 2FFFB 1P34C 1P3GB 4Z9QA 4B4ZA 2Y2OA 2JSSA 3EPHA 3U4LP 2HIOA 4MBFA 2F8NA 1ES3A 5JA4B 3KYZA 3AZKA 4K08A 3B0BA 1Z6FA 1W8QA 4HH2A 4JBFA 5AV9B 3MGRA 3LCEA 4M4XA 2IWCA 2HPBA 3PHYA 3IH8A 4B4XA 4DE0A 1P34A 2EFXA 5AJGA 2GX5A 4IJGA 2JKFA 5AVCB 4LRYC 3S7OA 4BD0A 1JTDA 1S4SA 1MWTA 1P3KD 2NZDB 3MGRC 2NQBC 3OPHA 1H3OA 4ZBJC 1LSVA 4QLCA 3EEAA 1MY8A 1K56A 1P3FA 2X71A 3BFDA 2PU2A 4ZRRA 3AZJD 4ME4A 5B32G 4H6JB 3A3FA 2R78A 4YS3B 3LJAA 1VETA 4EUVA 1ES2A 5B24A 5KDMB 4G3VA 3ZG7B 3SH9A 5FI7A 3WAAB 4OOYA 1BSGA 2X02A 4JJNC 4PPRA 2RCXA 3MGPA 5B2IB 3W97D 3HLGA 4WU8D 4EBLA 3D3OA 1KGEA 3FKEA 4JJND 3P09A 5M1AA 3KUYC 4DXCA 3JYIA 1P3LA 3AFAC 5JYOA 4YINA 2LB9A 3UPPA 2HJEA 3CWFA 5EE8A 2D02A 1WYCA 2JE5A 4BLMA 4E3NA 3A6ND 4OPYA 1EI5A 1ZKJA 2ZQAA 4WN5A 4KUDC 4KGCC 3LJAD 3W96B 3WA9D 3LIAA 3AZJA 2H5SA 3C8CA 4LV3A 1P3FD 4DF6A 4CLCB 4I38A 4E3MA 2Y79A 5AV9C 1S4RA 3KSHA 1O6IA 5HZHA 3MNND 3LIFA 1BULA 5HPFA 1P3MA 5CPIB 1P3PD 3W98A 2Z2LB 4KZ8A 3LZ1B 4IBEA 5B1LB 3AZGD 3AZIC 2ZY5A 4WUJA 1KS0A 2RTSA 3VH6T 5B40A 2BYKB 3FKWA 3VV4A 2WKPA 4J8VC 1FOFA 1TAFA 5DTTA 3Q7VB 2BLSA 2IO5C 4OP8A 3B0CT 4YWZA 4EEUA 2QHKA 4PM9A 2VK3A 4C3QA 5AVBD 5B0YA 5FI2A 2Y59A 1OT6A 1S32A 1GSWA 3MKEA 5B1LA 4G92B 1W7FA 1AIWA 5FQ9A 5GXQA 3LZ0D 1GXDA 5DNMC 4HH3A 5AVBB 1TZYC 1P3ID 1SCWA 4D60A 2OLVA 4JPMA 5EM1A 2L1MA 5DJUA 1YQSA 5CRFA 2Y2GA 1P3BA 2VLGA 2CV5B 1GOIA 1FCOA 3X1UA 1YLTA 2ZQ7A 4BBVA 3ZQ5A 1HTAA 1P3LC 1V9ZA 3BW6A 4XUJA 3EGDC 4HY8A 5HDDA 5BNXA 2ACGA 1VHMA 3SS3A 3WTPB 5DNNB 3R7WB 3LZ1D 3D72A 4PMAA 5FATA 5EV0A 1PDCA 3BLMA 3VP4A 1TZYA 3KWQC 3MNNB 2KDKA 2A2LA 3NOTC 4MCWA 4OJ5A 4DKIA 2W3DA 1DRMA 2IA2A 4E6XA 4QHCA 3CPTB 2V0UA 1YSQA 4GDBA 3VP1A 1I2SA 4S2KA 2NZDD 3B6FB 4IBIA 3C1CC 3A0RA 1AOID 4JXVA 2FJ7D 1BLSA 3W4OA 3AL0C 5HD3A 4Z5TD 3DTIA 1KVLA 3BQAA 1NJ4A 5EVIA 3UE3A 3RELA 3HJKA 1P3AD 3PBTA 3E0YA 1YLJA 3B6FA 4E3LA 4BMWA 5U47A 3BFCA 3MGSB 3A3IA 5B31G 3LIDA 1XJ6A 2INWA 3WKJC 4IBGA 5A93A 3F1NB 1PI5A 4J8UB 2EX8A 2PRFA 4JKTA 4RVAA 4NFTA 4ZJ3A 1UWNX 2V1BA 3X1UB 4I3JA 3GECA 1ID3D 3LY4A 2L4RA 3OC2A 3T1SA 4YM6C 1P3BB 4KZAA 4FH2A 3AZJB 4KUDB 5CPKA 4E3JA 1Q2QA 2VV8A 3GV9A 5AV6C 5FEGA 4GD8A 1FILA 3TOIA 3TU4C 3LEZA 3O86A 2XFTA 4Z2GA 4OH0A 1BH8A 3VH6A 2OV5A 2PT7A 2HP6A 3EPLA 2WGWA 2XFSA 4YFMA 2ZM2A 4NZ4A 3KSIA 3Q07A 2CWEA 2E8JA 2F8NB 1YU0A 3KXBD 3OOVA 5GT0B 3IX4A 4J8XD 3KXBB 1CJFA 3JVUA 5B1LC 4MBKA 3KXBC 3F6TA 2HV1A 3UDFA 3AV1A 3C38A 3FPWA 4X55A 1BLHA 4JXWA 5CPIA 3W98B 1M1AA 4N1HA 4EESA 5B33D 1M19A 4JXGA 3CUEA 3GRJA 3ITBA 4DE2A 5DKKA 2O99A 4G3KA 3ZVWA 1H0GA 4QY5A 3KO6A 2OLUA 3ZCZA 2W3HA 3UO9A 5EVID 3M2KA 4OQIA 4XZQD 3VP0A 5EUAA 2FJ7A 1RGZA 5K5BA 3UT9D 2EX9A 1S6RA 1YMXA 2W3EA 3X1TB 2HGVA 3ZNTA 4X1LA 5E43A 1XA1A 4PKYA 2PBDP 1P3OA 3OCLA 5B32D 4WU8C 4LV0A 3C4PA 1L2SA 2HIOB 1MWUA 3G35A 4LV2A 1U60A 4PAUA 1K0KA 1K57A 3PAGA 3LEQA 2V1ZA 3MFDA 4Z5TB 2JN7A 4DJ3A 1KDWA 4Z2LA 1BH8B 2FJ7C 3BYDA 3A1IA 1N9BA 1B6WA 5AV9A 3B6FD 3CITA 5L10A 4LG2A 1XFQA 2IWBA 1DJBA 2QKPA 3PR6A 3ZDJA 3AZJC 3REKC 4WYYA 2H10A 3AZHC 5AY8B 3N8SA 2O9BA 1AOIA 4R70A 5CTNA 2EXAA 3LZ1A 4MB3A 3MZFA 1YU2A 4UA9A 4ZDXA 3RXXA 3AZGC 1W8YA 5BO0B 4KZ9A 1TS6A 5B0YC 2BTFP 1HTZA 1P3PC 3SOIA 4Y13A 1LL9A 1C3BA 1XJ4A 1P3IA 3LR3A 1M18D 3IXHA 1YLZA 5HSQA 4IBJA 2A3UA 3X1VD 5CHUA 1U35D 5B0YD 5GXQB 5G49A 2QZ6A 5DFXA 2GZAA 4R8PC 3KSGA 2VEAA 3B0CW 3IHAA 3H0RC 3UTBC 3P98A 4WLAA 4H9NB 4R0QA 4DJ2A 3P01A 2CV5D 2IWDA 1WYBA 3IXBA 5E5AB 3QNBA 1NZUA 4IVKA 4Z1WA 3W99A 3KUYB 3WAAA 2RVQD 5BNXB 3P5JB 5B40D 3ICYA 3SS5A 4E3KA 1YKDA 4YM6B 3T4QA 3MR0A 4XUJD 3T4JA 4P85A 2W3FA 1BT5A 3SS4A 4EQIA 2W8SA 2KX6A 1P3MD 2XA7M 4OOMA 1P34B 1QMFA 4I3AA 1HQ3B 3MNNA 3OPRA 1M40A 4Y5FA 3FWLA 4XT2B 1PFLA 3C7UA 2VGKA 1Q2PA 4S2NA 3REHC 3W99C 4JLFA 2DNSA 3H82A 3A3JA 5F99A 4RX2A 2P9VA 1JNUA 4E6WA 4QU3A 3H7WA 2ZM8A 3MSHA 3PBQA 4E04A 1FSWA 3HLDA 3C1BD 5AVFA 1K4FA 5CPJC 4NZ3A 3WD2A 3MNNC 2WKHA 5EVIC 3BRMA 4EXOA 5HPIA 4HNBA 4UA6A 3IP4C 1P3PA 3REJA 5B32A 3REIC 2ZL1B 1P3OD 1GHMA 3ZG9B 4S2PA 1ESUA 1XGJA 3REKB 3UB8A 2NQBB 2OOLA 3A3DA 4NEED 2ZC5B 1K38A 2V8FA 1N9OA 2K7SA 3AN2A 5B31D 2JHEA 4UA7A 3Q7VA 1PWCA 2PHYA 5HWTA 4XXRA 5B2JB 1ALQA 4HBUA 3B0DC 4IBKA 2H28A 5B0ZD 2K2NA 4TX8A 1F1EA 3T4OA 3WKJA 3UMDA 1P3LB 2XD1A 4WZ5A 1TDLA 3UB7A 1T1BA 1OTIA 4YOFA 3M6BA 5B2ID 1MXOA 1TEMA 4HJ3A 5FDSA 3WTPC 3QP5A 3KUYA 4LD9B 3VH5W 3AZMD 1ZHHB 5HW3A 1TF1A 4A5RA 1W63Q 5B2IC 2PYOC 2XR0A 3WKJB 2Y55A 1H8YA 1L3LA 3AV2B 1CQAA 1E3UD 3SH7A 3IF6B 3LELB 1SKOB 3WS0A 5GLCA 4S2OA 5GHZA 3AZNA 3BFEA 3HVFA 5AVEA 3ZVTA 4IBFA 4OONA 4L9EA 1P97A 2V2FF 5L8MA 3WS2A 3H0LC 1KE4A 4FUWA 1Y4OA 2JKRI 4IJEA 1MWRA 4OLGA 5L09A 4PM6A 3B42A 1JWPA 2G5HC 4Z2KA 3K2NA 3NI9A 4QLCB 1GSXA 5TFQA 4WU9C 4MB5A 4X6TA 3AZED 1H0MA 1U35C 2YKFA 5CP6A 3REJC 3DW0A 1W1VA 2G2UA 1M18C 1OJGA 1ID3A 1P9WA 2EX6A 3AGFA 3T4LA 1VEUB 1FSYA 2F8NK 5CHLB 4BBTA 1P3GA 5IS1A 2V9AA 2J3WA 2OWHA 1E6RA 4MMNA 3AZIB 4WU9A 3R45A 3W99D 4R1GA 3NQUA 3IT9A 2J8PA 3MZEA 5MC7A 1HZOA 3G2YA 3GQZA 1IYPA 4Y3IA 4L9GA 5GSUA 4Z66A 1S1YA 2Y4AA 4CLCE 4BWIA 5AV6D 3B6GC 4FOFA 1S66L 3MVDA 1IKIA 1P3GC 4X1MA 3AYWD 3GTCA 1CI9A 5F99B 2WUQA 1SDNA 3MF0A 4EW7A 4LFUA 3RTYA 2P04A 1LL8A 4WBGA 3X1SB 4ESPA 2JKTI 2XEPA 4E44A 5DNNC 1XJ3A 4JF5A 4UUZA 2XH9A 5CX7A 2HIOC 3LR0A 4EO5C 3HLFA 1GPFA 1J9MA 5TJJA 5HFOA 5F83A 1OT9A 1TZYD 3T1RA 4Z5TC 1S1ZA 2J3TC 1TS7A 4HEFA 1S32B 3CZDA 4JGPA 3VSKA 4GHAA 1L0GA 5A92A 4OQGA 2NZDC 3VOZA 3VSLA 4HP9A 3E4OA 2WZXA 3W8KA 1F9IA 3N8LA 1EW0A 2ZMAA 3VP2A 1E15A 3IQAA 5KMWA 1XXMA 3AZFC 4IJFA 3BY9A 2NQBA 1NXYA 3BECA 4DE3A 1PZRA 2XGNA 3C1CB 3F1OB 3E4PA 2O9AA 1FIKA 3MGQD 3MVDD 4F94A 3Q82A 4AWLB 1GHPA 1PYYA 3AZNC 5DKLA 4AWLC 3KWQD 1FR1A 3N3FA 2P7JA 3UTAD 5BNVB 1BLPA 4G91C 1N9NA 3V3RA 1W1PA 1DP9A 3OBFA 2V0WA 4JGOA 4R8PB 3AZEC 5IHVA 4WU9D 4C6YA 3AZEB 5EM0A 1XGIA 1GA9A 2WKIA 5L2FA 2Y2NA 5B33A 3LJAC 4X68A 4CQHA 3MBZA 3C30A 5FQKA 5E5AC 3NDEA 3MXSA 1M1AD 4I5SA 3HLEA 1XPBA 1E3UA 3HUMA 1WE4A 2Y91A 5HDCA 5DNMD 1XFNA 1N4OA 5L07A 3HSHA 4NXFA 1M1AC 4KGCB 1EQZA 1A7WA 5CP6D 5AQAA 2M7UA 3G32A 3VOYA 1Q9CA 3AZEA 2V1AA 5AVBC 3WD3A 2Y8HA 5F99C 3WA9A 3WD0A 5DFYA 2W0NA 3CUEC 4U0TA 5BOHA 3L27A 5B33C 1JVJA 2WADA 3WKJD 4OUIA 5B1MA 1KX3B 4LRXC 3E2KA 2VQRA 3ZNYA 2WAEA 3AZMC 3IWQA 1MKIA 2BASA 3A6NA 3AZMB 3AV1B 2PR5A 1P3AC 1ERQA 3ZGAB 3CPTA 3TRCA 1ZLAC 3AZND 1STZA 4JF4A 1QO6A 5B31A 2VZWA 2QPNA 1T3UA 3UNWA 1CEGA 5GT0C 3MVDC 3IWOA 5CPKD 1KU5A 5FA7A 1PIOA 1NZOA 5IT5A 4K0XA 5C3IC 1S0WA 5B2JD 2DMWA 4GD6A 1BTLA 3REJD 1DP6A 3AZMA
chains in the Genus database with same CATH topology
1JFIB 4NYUA 1XX2A 3REID 2HDSA 4J8VA 1P3OB 1NRFA 1NY0A 3CJMA 3RJUA 3AFAD 5CHJA 2AROB 3AZNB 4UAAA 1F66B 3N4IA 4P0MA 5DVAA 3BM6A 1K6RA 3UDXA 2G5IC 5AV8A 1CI8A 1P3KA 3Q81A 3C5AA 1XKZA 1KX3D 1E25A 4M3KA 1K4EA 4ID4A 3VH5A 4J8WD 5DF9A 3UTAC 2QMIA 5FI6A 4ZJ2A 3O62D 3M6HA 5AY8A 4N92A 1E4DA 2Q9MA 3WTPE 1PWDA 1P34D 3MGQC 1RP5A 3E2LA 2ZC3B 2RIQA 4XUJC 3REIB 5DTSA 3N8RA 4H9OB 5B1MB 3AZFD 1U35A 4X23B 5GT0A 3NQJA 2XD5A 1PW8A 1M18A 1H5XA 2HUEC 2ZQCA 2ZC6B 3VMAA 4R8PD 3FKVA 3REKA 4H9SA 3DTMA 2C5WB 3G34A 5DF8A 5KSHA 3PBRA 4X23A 4IBCA 1Y54A 5GLDA 4H9OA 2WYXA 3LZ0A 1BLCA 3C1BC 2Y2PA 1CEFA 4S2IA 2BYMB 3O3VA 1PI4A 4J8VB 5CGSA 4H9RB 3IH9A 3X1VA 4X53A 5FDHA 3NIAA 5EPHA 1LL5A 3A6NC 5AY8D 2YFVB 3O62A 4JXSA 1EWZA 3AZGA 5GT3B 2JBFA 4NE6A 2ZY3A 3B6GD 3TU4B 5HAIA 4H9QA 3HL9A 4NYYA 5B40C 4DDSA 2BG1A 3W97C 2G2WA 4OKPA 2CV5C 3NQUB 3UTBD 3AFAA 5B32B 1CK3A 2PU4A 2WGWB 3WS5A 5CHMA 3QHYA 5M18A 1W2EA 1ZC2A 4S2NC 5EOOA 5TGFA 2Z2MB 3AN2B 3NC8A 5CEBA 4OPZA 1M19D 3GR2A 5CERA 1VM1A 3EQUA 3ZHHA 2F8NH 4WNNA 1YU3A 5CPJA 4QD4A 1AXBA 3KS4A 2Q9NA 1IELA 5GHXA 3KS8A 1P3KC 2CC1A 4R3JA 2ZY2A 3AZHD 4XZQA 3KXBA 5AQBA 5F1FA 4YS3C 5CGWA 1JTGA 4BD1A 5JRGC 1IYSA 1EQZC 1W5DA 3G31A 3HLCA 4CAYA 4O7DA 4J8XB 1K6SA 1JWVA 4Y0TA 4CJNA 1K56D 3X1SD 4QLCD 5DNMA 3G30A 1DJCA 1M6KA 3TU4D 5JA4A 5GT3D 1I5QA 3AGDA 4JF6A 5B1MC 3LELD 3GVBA 1P3AA 1HQ3C 1ES4A 5AV5B 1K57C 3MGRD 4EBNA 3C7VA 1KX5D 5GSUC 4Z66C 3WTPA 1YLYA 1N1JA 3AZHA 1L0DA 1DJAA 4GNUA 5KSCA 4NK3A 4OJLA 3HUOA 3REJB 5M19A 1P3AB 1YLPA 4Y0UA 3A1KA 5BO0A 5CPJD 5EECA 1LLBA 1FCNA 4KUDA 4LENA 4MNRA 4U3TA 2Y2KA 2HDRA 5C3IB 4KG5A 3MZDA 1K55A 1KX5B 3X1TA 1KX4C 3TSGA 1IEMA 4ZAMA 3N6IA 2X01A 3UTBA 4IBRA 4Z5TA 1P3MC 2F2AC 3MGPC 4ZUXA 1L0EA 2YFVA 3O62B 1FCMA 1FR6A 3S22A 2JCHA 2XDMA 3NY4A 1G6AA 4B88A 1TDGA 3WS1A 3B6GA 2C6WB 1KX3C 3X1TC 5HAPA 5AQ9A 3IWIA 4UPKA 3V9RB 4KG2A 3L29A 1KGFA 3V50A 1EROA 2GDNA 5AV6A 3LO7A 2R9WA 4XZQC 4NETA 1HD8A 5CPJB 3H0MC 2XQZA 1BUEA 3AYWC 4LCMA 4K0WA 4N1XA 2AROA 5B31B 4XUJB 1ONGA 4BJPA 1KE3A 3D4FA 3HLBA 3ZG5A 5BT1C 5GHYA 3V5MA 3AV2A 2ZY4A 3ZFZA 3OZHA 4BL3A 5BPVA 5GXQD 5B0YB 5CPKB 4GB7A 5CGXA 3AZGB 1K55C 5B1LD 1S32D 4J8XC 2AROC 5E2FA 5E2EA 3SH8A 3AZFA 5AVBA 1GCEA 5AVCA 2DQNC 1LI9A 4J8WC 4CSRA 4ZTKA 1YMSA 3UPOA 3LZ1C 4DDYA 3W96A 1PWGA 2WZZA 4HGAB 1DY6A 1HQ3D 4LCLA 4RA7A 5FQJA 4QJGA 4KGCD 4OOLA 3LJAB 3UN7A 4WELA 1KX3A 4KZ6A 3BLSA 4QNLA 3EQVA 4WZ4A 4OJ6A 1M1AB 3B6GB 4WU8A 4G92C 3W97A 4E45A 3MGPD 1LHYA 3KUYD 2Y2HA 3R45B 2ZQ9A 5B2IA 3AZIA 4WU9B 3KFUG 1YU1A 1KX4D 4QLCC 3X1SC 2H0YA 4H9RA 4J8VD 1I2WA 3VFHA 5B0ZA 3W97B 1KX4A 1QMEA 4OP5A 1M19B 1M18B 3AZID 4EO5B 4YM6A 4KZ7A 3UDIA 3MVDB 3AN2D 1AOIC 3UY6A 4XZQB 3W4PA 3C1CD 1RCJA 4GOGA 5GXQC 1JWZA 5BNVA 2LY8A 4Y0OA 3V39A 4JJNA 5AV8C 4L0LA 3UTBB 5B31C 1P3FC 1KX4B 4GZBA 1KX5C 2XLNA 4S2LA 3MGPB 4H8RA 5CP6C 3LY3A 1MPLA 3AZFB 1P3KB 4X56A 3S1YA 2DF4C 5B1MD 4MEZA 1TZYB 4NY2A 1K54A 3FDDA 1ID3C 5AVCD 3L2AA 5KZHA 4Z2MG 3B3XA 3B0DB 3GMWA 5GL9A 5BS7A 3G2ZA 5G18A 2VGJA 5F1GA 3WAAC 2F8ND 2HIOD 5HL1A 3ISGA 5AQ7A 2E8IA 1TAFB 5CTMA 2YFWB 2XK1A 4KGCA 5CECA 3UT9B 4MBHA 4NE3A 1Z2CB 2V20A 4R23A 4HGAC 3UE1A 3HONA 3AYWB 4WV4B 3LZ0C 5EVIB 2RL3A 1YT4A 2R9XA 2AROD 3BEBA 4DE1A 1IYOA 3PTEA 4ZJ1A 3AFAB 5B0ZC 5B0ZB 1KE0A 5E2HA 2JC7A 3A3EA 5CXWA 3IXDA 3L28A 4LD9A 4X23C 2OSUA 3W96C 3O88A 3I7JA 1PW1A 2NQBD 5DTKA 1ERMA 3ITAA 5TR7A 4ZUXB 1M19C 4H9PA 1H3OB 3L26A 3IF5A 3S4XA 3G4PA 4C75A 5HX9A 2B5RA 3DWKA 4J8WB 2J9PA 2ZQ8A 3PBOA 4WMCA 1NYYA 4FH4A 1ZG6A 3Q1FA 3NDGA 3LELC 3X1UC 1IKGA 1KVMA 3V9RA 4P6BA 4QY6A 3UPNA 4HESA 4E3OA 5DNMB 3NBLA 3NCKA 4IVIA 3AYWA 4N9KA 4LD9D 3MGSD 3WTPD 3WRTA 1KX5A 4KHAA 4WNNB 4UHUA 5FAPA 4YS3A 1IYQA 3DWZA 3UT9C 3AZKC 4DQYB 2J8YA 1PZPA 3UTAB 5JRGD 3C4OA 5AVCC 1WWIA 4NZ1A 1K54C 2F8NG 3ZG8B 2ZQDA 4KZ4A 5FAQA 5J8XA 5GT3A 4R3BA 1LI0A 4KQRA 1OMEA 3MGRB 4NZ5A 5AV5D 2FFYA 4IBDA 4XUZA 1P3OC 4RYEA 2J7VA 4FSFA 4J8XA 3EPKA 3EG5B 2BYMA 4WZSB 5D3OA 5FSRA 2H0TA 3V3SA 4WEJA 3B6FC 2HDUA 1P3PB 5HARA 3LELA 1GHIA 4E3IA 1XP4A 1KGGA 4OQ0A 4S2JA 4GKUA 4U0XA 3PAEA 3REHD 4LD9C 4FCFA 5B24C 3TU4A 3WA9B 2P9VB 3WWXA 1YM1A 4X69A 3KWQB 3X1SA 3LZ0B 4MLLA 3IF6C 4GHLA 3MGQB 3OPPA 3MKFA 4YM6D 3AZLB 4WZ5C 4DXBA 1F66A 1ESIA 3CMZA 5DNNA 1N1JB 5AY8C 3AZHB 5JRGA 3N7WA 5E5AD 1NYMA 4IEDA 1H8ZA 1SKFA 2PYOA 1FQGA 3RXWA 5AV5C 1TVFA 1U35B 3PBSA 3W99B 3FYZA 4GN2A 4Q8IA 4ZUXC 1JFIA 4LV1A 3AZLA 4K91A 2EX2A 3PBNA 2NZDA 1ONHA 4ZBEA 1O7EA 1YLWA 5FQQA 2DCFA 3AN2C 1GA0A 5FQIA 4M6BA 1BZAA 2EXBA 4EWFA 2Y2LA 3W96D 3C1BA 5AV8B 4WEKA 3UE0A 3GSGA 3HREA 4CAYB 3AGEA 3A6NB 5F99D 1ZLAA 1RGYA 2BYKA 5BS7C 1P3BC 4J8UA 3O62C 2RVQC 1ID3B 4CPKA 4OPQA 3X1UD 5JYPA 3AV2D 1W79A 4KZBA 5B32C 5E2GA 4J8UD 4OPRA 3CG5A 3WAAD 4DRTA 3X1VC 2CV5A 1WWSA 4OQHA 4H9PB 1P3IC 2ZLYA 2A49A 1S32C 2FJ7B 3BFFA 5FASA 1O07A 4PM7A 4ZBJB 1G68A 4X23D 3W98D 3REKD 5B2JC 4R8PA 5AV8D 5GLBA 2ZM0A 4DRBA 5CPKC 3KSYA 3OPLA 4EBPA 5GT0D 4R4SA 3W4QA 3ZG0A 1ZLAD 4HBTA 1BH9B 1L0FA 3C1BB 4BL2A 3O87A 4H9NA 1SDEA 5A91A 5AV9D 1KDSA 1ULYA 2WAFA 3MXRA 4J8UC 4WJ3C 5DNND 3BFGA 1F66D 4J8WA 2PBYA 2EFUA 1P3LD 1SHVA 3AV2C 3FV7A 3WS4A 4KUDD 2WGVA 3AZLC 1K25A 3RELB 5CEDA 4IBBA 2HP9A 5FAOA 3C1CA 5GT3C 3UT9A 3AZLD 5KDMA 2ZD8A 1XA7A 3REHA 1PZOA 4KG6A 5FUGA 3Q7ZA 2ZM5A 1ZG4A 5B40B 2HUEB 2PYOD 4PM8A 4BENA 1VQQA 3VH5T 5B24D 2ZC4B 4Z66B 5GSUB 5E5AA 3REIA 3REHB 2UWXA 3AV1C 1ES5A 4IBXA 3VP3A 5CPIC 1AOIB 5A90A 1EQZD 2DRWA 5CPID 5B2JA 4H9QB 2Y2MA 3AV1D 2ZJ9A 2WGIA 2WKEA 4UUZB 1B67A 4RX3A 3W98C 4KENB 1P3FB 4EV4A 4NE5A 1HQ3A 3VH6W 3HUNA 1BH9A 5CP6B 4EUZA 4OJOA 2YFWA 1P3MB 4KZ5A 4GH9A 4Z2MH 3TG9A 4GDNA 4OLDA 2HDQA 3UTAA 3EPJA 1EQZB 3IXGA 5JRGB 3AZKD 1MBLA 3MGQA 5F82A 3HBRA 4P87A 4Y7PA 1F66C 4KQOA 4XUXA 4N9LA 5AV5A 5EOEA 1MWSA 3IHBA 4JJNB 3MGSC 3IF6A 5B24B 3L25A 4WU8B 3X1VB 2Y2QA 2PYOB 4PM5A 3AZKB 1P3IB 5EVLA 5I94A 1YU4A 2XF3A 4H9SC 3FZCA 5FUGB 3VFFA 3WRZA 4FD8A 4KZ3A 3RELD 4YS3D 2WK0A 2ZC7A 3KWQA 1YUEA 3MGSA 5HAQA 5FQMA 2P74A 4D2OA 4KQQA 5BT1D 5B33B 3WX7A 4DRAA 5GLAA 2Y2JA 5DF7A 2Y2IA 4WM9A 2HP5A 1ZLAB 4G91B 4QB8A 4ZUXD 1HVBA 4BQMA 5GSUD 4Z66D 4S2MA 3WA9C 4CSRB 3X1TD 4OJPA 2J9OA 2IO5B 3M2JA 4WMCD 3QNCA 3NQJB 3OCNA 2IOUA 4KHAB 2L5AA 5G49B 4R4RA 3RELC 1P3GD 1R4VA 4OVDA 1BFMA 5AV6B 3HLWA 2I72A 1P3BD 2FFFB 1P34C 1P3GB 4Z9QA 4B4ZA 2Y2OA 2JSSA 3EPHA 2HIOA 4MBFA 2F8NA 1ES3A 5JA4B 3AZKA 3B0BA 1Z6FA 1W8QA 4JBFA 5AV9B 3MGRA 3LCEA 2IWCA 2HPBA 3IH8A 4B4XA 4DE0A 1P34A 2EFXA 5AVCB 4BD0A 1JTDA 1MWTA 1P3KD 2NZDB 3MGRC 2NQBC 3OPHA 1H3OA 4ZBJC 4QLCA 1MY8A 1K56A 1P3FA 2X71A 3BFDA 2PU2A 3AZJD 5B32G 3A3FA 4YS3B 3LJAA 1ES2A 5B24A 5KDMB 3ZG7B 3SH9A 5FI7A 3WAAB 4OOYA 1BSGA 2X02A 4JJNC 4PPRA 2RCXA 3MGPA 5B2IB 3W97D 3HLGA 4WU8D 4EBLA 1KGEA 3FKEA 4JJND 3P09A 5M1AA 3KUYC 4DXCA 3JYIA 1P3LA 3AFAC 5JYOA 4YINA 3UPPA 5EE8A 4BLMA 1WYCA 2JE5A 4E3NA 3A6ND 4OPYA 1EI5A 1ZKJA 2ZQAA 4KUDC 4KGCC 3LJAD 3W96B 3WA9D 3AZJA 2H5SA 4LV3A 1P3FD 4DF6A 4E3MA 5AV9C 3MNND 1BULA 1P3MA 5CPIB 1P3PD 3W98A 2Z2LB 4KZ8A 3LZ1B 4IBEA 5B1LB 3AZGD 3AZIC 2ZY5A 3VH6T 5B40A 2BYKB 3FKWA 4J8VC 1FOFA 1TAFA 5DTTA 3Q7VB 2BLSA 2IO5C 4OP8A 3B0CT 4PM9A 4C3QA 5AVBD 5B0YA 5FI2A 2Y59A 1S32A 3MKEA 5B1LA 4G92B 1W7FA 5FQ9A 5GXQA 3LZ0D 5DNMC 5AVBB 1TZYC 1P3ID 1SCWA 2OLVA 4JPMA 1YQSA 5CRFA 2Y2GA 1P3BA 2CV5B 1YLTA 1FCOA 3X1UA 2ZQ7A 1HTAA 1P3LC 4XUJA 5BNXA 3SS3A 3WTPB 5DNNB 3LZ1D 4PMAA 5FATA 3BLMA 3VP4A 1TZYA 3KWQC 3MNNB 4OJ5A 4DKIA 4E6XA 4QHCA 4GDBA 3VP1A 1I2SA 4S2KA 2NZDD 3B6FB 4IBIA 3C1CC 1AOID 4JXVA 2FJ7D 1BLSA 3W4OA 3AL0C 4Z5TD 1KVLA 1NJ4A 5EVIA 3UE3A 3RELA 1P3AD 3PBTA 1YLJA 3B6FA 4E3LA 5U47A 3BFCA 3MGSB 3A3IA 5B31G 3WKJC 4IBGA 5A93A 1PI5A 4J8UB 2EX8A 4JKTA 4RVAA 4NFTA 4ZJ3A 3X1UB 1ID3D 3LY4A 3OC2A 4YM6C 1P3BB 4KZAA 4FH2A 3AZJB 4KUDB 5CPKA 4E3JA 1Q2QA 3GV9A 5AV6C 4GD8A 3TOIA 3TU4C 3LEZA 3O86A 2XFTA 4OH0A 1BH8A 3VH6A 2OV5A 2HP6A 3EPLA 2WGWA 2XFSA 4YFMA 2ZM2A 4NZ4A 3Q07A 2CWEA 2F8NB 1YU0A 3KXBD 5GT0B 4J8XD 3KXBB 5B1LC 4MBKA 3KXBC 3F6TA 3UDFA 3AV1A 4X55A 1BLHA 4JXWA 5CPIA 3W98B 1M1AA 4N1HA 5B33D 1M19A 4JXGA 3GRJA 3ITBA 4DE2A 3ZVWA 4QY5A 2OLUA 3ZCZA 3UO9A 5EVID 3M2KA 4OQIA 4XZQD 3VP0A 5EUAA 2FJ7A 1RGZA 3UT9D 2EX9A 1S6RA 1YMXA 3ZNTA 3X1TB 5E43A 1XA1A 1P3OA 3OCLA 5B32D 4WU8C 4LV0A 3C4PA 1L2SA 2HIOB 1MWUA 3G35A 4LV2A 1U60A 1K57A 3PAGA 2V1ZA 3MFDA 4Z5TB 1KDWA 1BH8B 2FJ7C 3BYDA 3A1IA 1N9BA 1B6WA 5AV9A 3B6FD 4LG2A 2IWBA 1DJBA 3ZDJA 3AZJC 3REKC 4WYYA 2H10A 3AZHC 5AY8B 3N8SA 1AOIA 5CTNA 2EXAA 3LZ1A 3MZFA 1YU2A 4UA9A 4ZDXA 3RXXA 3AZGC 1W8YA 5BO0B 4KZ9A 5B0YC 1HTZA 1P3PC 3SOIA 1LL9A 1C3BA 1P3IA 1M18D 3IXHA 1YLZA 4IBJA 2A3UA 3X1VD 5CHUA 1U35D 5B0YD 5GXQB 5G49A 2QZ6A 4R8PC 3B0CW 3IHAA 3H0RC 3UTBC 3P98A 4H9NB 4R0QA 2CV5D 2IWDA 1WYBA 3IXBA 5E5AB 3QNBA 1NZUA 4IVKA 3W99A 3KUYB 3WAAA 2RVQD 5BNXB 3P5JB 5B40D 3SS5A 4E3KA 4YM6B 4XUJD 4P85A 1BT5A 3SS4A 4EQIA 2W8SA 1P3MD 4OOMA 1P34B 1QMFA 1HQ3B 3MNNA 3OPRA 1M40A 3FWLA 3C7UA 2VGKA 1Q2PA 4S2NA 3REHC 3W99C 4JLFA 2DNSA 3A3JA 5F99A 4RX2A 2P9VA 4E6WA 4QU3A 2ZM8A 3PBQA 1FSWA 3HLDA 3C1BD 1K4FA 5CPJC 4NZ3A 3MNNC 2WKHA 5EVIC 3BRMA 4UA6A 3IP4C 1P3PA 3REJA 5B32A 3REIC 1P3OD 1GHMA 3ZG9B 4S2PA 1ESUA 1XGJA 3REKB 2NQBB 3A3DA 2ZC5B 1K38A 3AN2A 5B31D 4UA7A 3Q7VA 1PWCA 4XXRA 5B2JB 1ALQA 4HBUA 3B0DC 4IBKA 5B0ZD 1F1EA 3WKJA 1P3LB 2XD1A 4WZ5A 1TDLA 3M6BA 5B2ID 1MXOA 1TEMA 3WTPC 3KUYA 4LD9B 3VH5W 3AZMD 5HW3A 4A5RA 5B2IC 2PYOC 2XR0A 3WKJB 2Y55A 1H8YA 3AV2B 1E3UD 3SH7A 3IF6B 3LELB 3WS0A 5GLCA 4S2OA 5GHZA 3AZNA 3BFEA 3HVFA 3ZVTA 4IBFA 4OONA 2V2FF 3WS2A 3H0LC 1KE4A 4IJEA 1MWRA 4OLGA 4PM6A 1JWPA 2G5HC 3NI9A 4QLCB 5TFQA 4WU9C 4X6TA 3AZED 1U35C 5CP6A 3REJC 3DW0A 2G2UA 1M18C 1ID3A 2EX6A 3AGFA 1FSYA 2F8NK 5CHLB 1P3GA 3AZIB 4WU9A 3R45A 3W99D 4R1GA 3NQUA 3IT9A 2J8PA 3MZEA 1HZOA 3G2YA 3GQZA 1IYPA 5GSUA 4Z66A 2Y4AA 5AV6D 3B6GC 3MVDA 1IKIA 1P3GC 3AYWD 3GTCA 1CI9A 5F99B 2WUQA 1SDNA 4WBGA 3X1SB 2XEPA 4E44A 5DNNC 4JF5A 4UUZA 2XH9A 2HIOC 4EO5C 3HLFA 1J9MA 5HFOA 5F83A 1TZYD 4Z5TC 4HEFA 1S32B 3CZDA 3VSKA 4GHAA 1L0GA 5A92A 4OQGA 2NZDC 3VOZA 3VSLA 2WZXA 3W8KA 3N8LA 2ZMAA 3VP2A 3IQAA 5KMWA 1XXMA 3AZFC 4IJFA 2NQBA 1NXYA 3BECA 4DE3A 1PZRA 2XGNA 3C1CB 3MGQD 3MVDD 4F94A 3Q82A 4AWLB 1GHPA 1PYYA 3AZNC 4AWLC 3KWQD 1FR1A 3N3FA 3UTAD 5BNVB 1BLPA 4G91C 3V3RA 4R8PB 3AZEC 5IHVA 4WU9D 4C6YA 3AZEB 1XGIA 1GA9A 2WKIA 5L2FA 2Y2NA 5B33A 3LJAC 4X68A 3MBZA 5FQKA 5E5AC 3NDEA 3MXSA 1M1AD 3HLEA 1XPBA 1E3UA 3HUMA 1WE4A 2Y91A 5DNMD 1N4OA 3HSHA 1M1AC 4KGCB 1EQZA 1A7WA 5CP6D 5AQAA 3G32A 3VOYA 1Q9CA 3AZEA 5AVBC 5F99C 3WA9A 4U0TA 5BOHA 3L27A 5B33C 1JVJA 2WADA 3WKJD 4OUIA 5B1MA 1KX3B 3E2KA 2VQRA 3ZNYA 2WAEA 3AZMC 3IWQA 1MKIA 3A6NA 3AZMB 3AV1B 1P3AC 1ERQA 3ZGAB 1ZLAC 3AZND 4JF4A 5B31A 1T3UA 2QPNA 3UNWA 1CEGA 5GT0C 3MVDC 3IWOA 5CPKD 1KU5A 5FA7A 1PIOA 1NZOA 4K0XA 5C3IC 1S0WA 5B2JD 4GD6A 1BTLA 3REJD 3AZMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KEN B;  4GZB A;  4EV4 A;  2XLN A;  4JXG A;  4S2L A;  3HUN A;  3GRJ A;  1XX2 A;  3ITB A;  4DE2 A;  4EUZ A;  4H8R A;  2HDS A;  3LY3 A;  1MPL A;  3ZVW A;  4X56 A;  1NRF A;  1NY0 A;  4KZ5 A;  3S1Y A;  4QY5 A;  4MEZ A;  2OLU A;  3TG9 A;  3ZCZ A;  3UO9 A;  4GDN A;  5A92 A;  3CJM A;  1K54 A;  2HDQ A;  4OLD A;  5EVI D;  3RJU A;  3M2K A;  5KZH A;  3B3X A;  3GMW A;  4OQI A;  5GL9 A;  3VP0 A;  5CHJ A;  3IXG A;  5EUA A;  3G2Z A;  5G18 A;  1RGZ A;  1MBL A;  5F82 A;  2VGJ A;  4UAA A;  2EX9 A;  3HBR A;  5F1G A;  4P87 A;  1S6R A;  1YMX A;  3ZNT A;  5HL1 A;  3N4I A;  4Y7P A;  4P0M A;  5DVA A;  3ISG A;  4KQO A;  5E43 A;  3BM6 A;  4XUX A;  1K6R A;  1XA1 A;  4N9L A;  5AQ7 A;  2E8I A;  3UDX A;  5CTM A;  1MWS A;  5EOE A;  1CI8 A;  3IHB A;  3OCL A;  2XK1 A;  3Q81 A;  3C5A A;  4LV0 A;  3C4P A;  1XKZ A;  1L2S A;  3IF6 A;  1MWU A;  3G35 A;  5CEC A;  1E25 A;  4M3K A;  4MBH A;  4LV2 A;  2Y2Q A;  1K4E A;  1U60 A;  4PM5 A;  4ID4 A;  5EVL A;  1K57 A;  3PAG A;  5DF9 A;  2V20 A;  2QMI A;  2V1Z A;  4R23 A;  3UE1 A;  3MFD A;  5FI6 A;  4ZJ2 A;  5I94 A;  3M6H A;  1KDW A;  4N92 A;  1E4D A;  2Q9M A;  5EVI B;  2RL3 A;  2XF3 A;  1PWD A;  1YT4 A;  2R9X A;  3BYD A;  3FZC A;  3BEB A;  4DE1 A;  1IYO A;  3PTE A;  1N9B A;  1RP5 A;  2ZC3 B;  3E2L A;  4ZJ1 A;  3VFF A;  3WRZ A;  4FD8 A;  4KZ3 A;  5DTS A;  2WK0 A;  1KE0 A;  2IWB A;  3N8R A;  5E2H A;  1DJB A;  2ZC7 A;  3ZDJ A;  2JC7 A;  4WYY A;  2H10 A;  3A3E A;  3N8S A;  5CXW A;  3IXD A;  5HAQ A;  5CTN A;  5FQM A;  2XD5 A;  2EXA A;  2OSU A;  2P74 A;  4D2O A;  3MZF A;  4UA9 A;  4ZDX A;  1PW8 A;  3O88 A;  4KQQ A;  3I7J A;  3RXX A;  1H5X A;  1PW1 A;  2ZQC A;  5DTK A;  2ZC6 B;  3VMA A;  1W8Y A;  5GLA A;  1ERM A;  2Y2J A;  3FKV A;  5DF7 A;  2Y2I A;  4KZ9 A;  4WM9 A;  3DTM A;  3ITA A;  2C5W B;  1HTZ A;  3G34 A;  5DF8 A;  5TR7 A;  5KSH A;  3PBR A;  3SOI A;  1LL9 A;  1Y54 A;  5GLD A;  1C3B A;  3IF5 A;  2HP5 A;  3S4X A;  3G4P A;  4C75 A;  5HX9 A;  2WYX A;  2B5R A;  1BLC A;  3DWK A;  3IXH A;  1YLZ A;  2J9P A;  4QB8 A;  2ZQ8 A;  2Y2P A;  1CEF A;  3PBO A;  2A3U A;  4S2I A;  4WMC A;  1NYY A;  4FH4 A;  5CHU A;  1HVB A;  3O3V A;  4BQM A;  2QZ6 A;  4S2M A;  1ZG6 A;  1PI4 A;  3IHA A;  3P98 A;  3Q1F A;  4R0Q A;  3NDG A;  5CGS A;  2IWD A;  2J9O A;  1WYB A;  3IH9 A;  3IXB A;  3M2J A;  3QNB A;  1NZU A;  4WMC D;  3QNC A;  4IVK A;  4X53 A;  1IKG A;  5FDH A;  3NIA A;  5EPH A;  1LL5 A;  1KVM A;  3OCN A;  4P6B A;  4QY6 A;  3SS5 A;  4E3K A;  4JXS A;  3UPN A;  4R4R A;  1EWZ A;  2JBF A;  4P85 A;  4OVD A;  1BT5 A;  3HLW A;  4HES A;  2I72 A;  3SS4 A;  4EQI A;  2FFF B;  5HAI A;  4E3O A;  3HL9 A;  4OOM A;  3NBL A;  4Z9Q A;  3NCK A;  4B4Z A;  2Y2O A;  1QMF A;  3OPR A;  4IVI A;  1M40 A;  4MBF A;  3FWL A;  4DDS A;  1ES3 A;  3C7U A;  4N9K A;  1Q2P A;  2VGK A;  2BG1 A;  2G2W A;  1Z6F A;  4JLF A;  4S2N A;  2DNS A;  4OKP A;  1W8Q A;  3WRT A;  3A3J A;  4JBF A;  1CK3 A;  3LCE A;  4UHU A;  5FAP A;  2PU4 A;  2P9V A;  4RX2 A;  1IYQ A;  2IWC A;  2WGW B;  4QU3 A;  4E6W A;  2HPB A;  2ZM8 A;  3DWZ A;  3WS5 A;  5CHM A;  3PBQ A;  3QHY A;  5M18 A;  1FSW A;  1ZC2 A;  4S2N C;  3IH8 A;  5EOO A;  3HLD A;  2EFX A;  4B4X A;  4DE0 A;  5TGF A;  1K4F A;  2J8Y A;  1PZP A;  2Z2M B;  3NC8 A;  3C4O A;  1K54 C;  5CEB A;  2WKH A;  4OPZ A;  5EVI C;  3ZG8 B;  2ZQD A;  4KZ4 A;  3BRM A;  5FAQ A;  5J8X A;  3GR2 A;  5CER A;  1VM1 A;  3EQU A;  4R3B A;  3ZHH A;  1LI0 A;  4UA6 A;  4BD0 A;  1JTD A;  4KQR A;  1OME A;  1MWT A;  1GHM A;  4QD4 A;  3ZG9 B;  3OPH A;  4S2P A;  1AXB A;  1ESU A;  1XGJ A;  2Q9N A;  3A3D A;  2FFY A;  1IEL A;  4XUZ A;  5GHX A;  2ZC5 B;  1K38 A;  1MY8 A;  2CC1 A;  4RYE A;  2J7V A;  4R3J A;  4FSF A;  1K56 A;  2X71 A;  3BFD A;  2PU2 A;  3Q7V A;  1PWC A;  4UA7 A;  5AQB A;  5F1F A;  4XXR A;  1ALQ A;  5D3O A;  4HBU A;  5CGW A;  3A3F A;  5FSR A;  1JTG A;  2H0T A;  3V3S A;  4WEJ A;  4BD1 A;  1IYS A;  2HDU A;  1ES2 A;  5HAR A;  1W5D A;  3G31 A;  1GHI A;  3HLC A;  4E3I A;  4O7D A;  3ZG7 B;  1K6S A;  3SH9 A;  1XP4 A;  1JWV A;  1KGG A;  4OQ0 A;  4S2J A;  5FI7 A;  2XD1 A;  4WZ5 A;  1TDL A;  4OOY A;  1BSG A;  2X02 A;  4PPR A;  4Y0T A;  4GKU A;  3M6B A;  1MXO A;  4U0X A;  1TEM A;  2RCX A;  4CJN A;  5HW3 A;  1K56 D;  3HLG A;  3PAE A;  4A5R A;  4EBL A;  4FCF A;  1KGE A;  2XR0 A;  2P9V B;  3WWX A;  2Y55 A;  1H8Y A;  3G30 A;  1YM1 A;  3P09 A;  1DJC A;  1M6K A;  1E3U D;  3SH7 A;  4X69 A;  3IF6 B;  5M1A A;  3WS0 A;  4MLL A;  5GLC A;  4S2O A;  3IF6 C;  5GHZ A;  4DXC A;  3JYI A;  3OPP A;  3MKF A;  3BFE A;  3HVF A;  5JYO A;  1I5Q A;  4WZ5 C;  4YIN A;  4DXB A;  1ESI A;  3AGD A;  3CMZ A;  4JF6 A;  3UPP A;  3ZVT A;  5EE8 A;  4OON A;  1WYC A;  2JE5 A;  4BLM A;  4E3N A;  2V2F F;  4OPY A;  1EI5 A;  1ZKJ A;  3N7W A;  3WS2 A;  2ZQA A;  1KE4 A;  1NYM A;  4IED A;  1H8Z A;  1SKF A;  3GVB A;  1MWR A;  4OLG A;  1FQG A;  1ES4 A;  1K57 C;  4PM6 A;  3RXW A;  1JWP A;  3NI9 A;  5TFQ A;  4EBN A;  1TVF A;  3C7V A;  4X6T A;  2H5S A;  1YLY A;  3PBS A;  3FYZ A;  1L0D A;  4GN2 A;  1DJA A;  4GNU A;  4LV3 A;  4DF6 A;  4Q8I A;  4NK3 A;  5KSC A;  3DW0 A;  4LV1 A;  4E3M A;  4K91 A;  3HUO A;  2EX2 A;  2G2U A;  5M19 A;  3PBN A;  1ONH A;  1YLP A;  4Y0U A;  4ZBE A;  1O7E A;  1YLW A;  5FQQ A;  2DCF A;  1BUL A;  5EEC A;  2EX6 A;  1LLB A;  1FCN A;  3AGF A;  4LEN A;  2Z2L B;  1FSY A;  4KZ8 A;  4MNR A;  1GA0 A;  4U3T A;  5FQI A;  1BZA A;  2Y2K A;  2HDR A;  2EXB A;  4KG5 A;  4EWF A;  3FKW A;  2Y2L A;  1FOF A;  3MZD A;  1K55 A;  4WEK A;  4R1G A;  5DTT A;  3Q7V B;  2BLS A;  3UE0 A;  3IT9 A;  3GSG A;  3MZE A;  3TSG A;  3HRE A;  1IEM A;  3AGE A;  4OP8 A;  4ZAM A;  3N6I A;  1HZO A;  3G2Y A;  4PM9 A;  2X01 A;  3GQZ A;  4C3Q A;  1IYP A;  1RGY A;  4IBR A;  2Y4A A;  5FI2 A;  2Y59 A;  3MKE A;  1IKI A;  1W7F A;  5FQ9 A;  1L0E A;  3GTC A;  1FCM A;  1FR6 A;  3S22 A;  1CI9 A;  2JCH A;  1SCW A;  2XDM A;  2WUQ A;  2OLV A;  3NY4 A;  4JPM A;  1G6A A;  1SDN A;  4B88 A;  1YQS A;  4CPK A;  1TDG A;  4OPQ A;  5CRF A;  2Y2G A;  3WS1 A;  2C6W B;  1YLT A;  1FCO A;  2ZQ7 A;  4WBG A;  5JYP A;  1W79 A;  4KZB A;  5HAP A;  5E2G A;  2XEP A;  5AQ9 A;  3IWI A;  4KG2 A;  3SS3 A;  4OPR A;  3CG5 A;  4JF5 A;  2XH9 A;  1KGF A;  3V50 A;  1ERO A;  4DRT A;  3HLF A;  4PMA A;  1J9M A;  2GDN A;  5FAT A;  3LO7 A;  5HFO A;  3BLM A;  2R9W A;  4NET A;  1HD8 A;  5F83 A;  3VP4 A;  4OQH A;  2ZLY A;  2XQZ A;  1BUE A;  2A49 A;  4LCM A;  4K0W A;  4N1X A;  4DKI A;  4HEF A;  3BFF A;  5FAS A;  3CZD A;  1O07 A;  1ONG A;  4PM7 A;  1KE3 A;  1L0G A;  3D4F A;  4QHC A;  3HLB A;  4OQG A;  3VSK A;  3ZG5 A;  4BJP A;  4E6X A;  5GHY A;  3VOZ A;  3VSL A;  4GDB A;  3V5M A;  3VP1 A;  2WZX A;  3W8K A;  3N8L A;  2ZMA A;  1G68 A;  3VP2 A;  3IQA A;  5KMW A;  3ZFZ A;  1XXM A;  3OZH A;  1I2S A;  4S2K A;  1NXY A;  3BEC A;  4DE3 A;  5GLB A;  4BL3 A;  2ZM0 A;  2XGN A;  4GB7 A;  5CGX A;  1K55 C;  4EBP A;  3OPL A;  4F94 A;  4JXV A;  3Q82 A;  1BLS A;  4R4S A;  5E2F A;  5E2E A;  3W4Q A;  3W4O A;  3SH8 A;  1GHP A;  1PYY A;  1KVL A;  3ZG0 A;  1GCE A;  4HBT A;  1FR1 A;  1NJ4 A;  5EVI A;  3UE3 A;  1BLP A;  1L0F A;  1LI9 A;  4BL2 A;  3O87 A;  3PBT A;  3V3R A;  1SDE A;  1YLJ A;  4ZTK A;  5A91 A;  4E3L A;  1YMS A;  3UPO A;  5U47 A;  1KDS A;  3BFC A;  2WAF A;  3A3I A;  3MXR A;  4DDY A;  5A93 A;  5IHV A;  4C6Y A;  1PWG A;  3BFG A;  1PI5 A;  1XGI A;  1GA9 A;  2WKI A;  2EX8 A;  2WZZ A;  5L2F A;  1DY6 A;  2PBY A;  2Y2N A;  2EFU A;  1SHV A;  4LCL A;  4X68 A;  3FV7 A;  4RA7 A;  5FQJ A;  4QJG A;  4JKT A;  4RVA A;  3MBZ A;  4OOL A;  3WS4 A;  3UN7 A;  2WGV A;  4WEL A;  5FQK A;  4KZ6 A;  3NDE A;  4ZJ3 A;  3MXS A;  1K25 A;  3HLE A;  1XPB A;  1E3U A;  3BLS A;  3HUM A;  3LY4 A;  1WE4 A;  5CED A;  2Y91 A;  3OC2 A;  2HP9 A;  1N4O A;  3EQV A;  4WZ4 A;  5FAO A;  4KZA A;  4FH2 A;  4E3J A;  1Q2Q A;  2ZD8 A;  1XA7 A;  1PZO A;  1LHY A;  3GV9 A;  5AQA A;  4KG6 A;  3G32 A;  2Y2H A;  4GD8 A;  3VOY A;  2ZQ9 A;  3TOI A;  3LEZ A;  3Q7Z A;  3O86 A;  1ZG4 A;  2XFT A;  4OH0 A;  4U0T A;  2OV5 A;  5BOH A;  1JVJ A;  2HP6 A;  2WAD A;  4PM8 A;  4BEN A;  1VQQ A;  2WGW A;  2XFS A;  4YFM A;  2ZM2 A;  2ZC4 B;  3E2K A;  2H0Y A;  3ZNY A;  2WAE A;  3IWQ A;  3VFH A;  1I2W A;  1MKI A;  2UWX A;  3Q07 A;  1QME A;  1ERQ A;  4OP5 A;  3ZGA B;  1ES5 A;  4IBX A;  3VP3 A;  4KZ7 A;  3UDI A;  4JF4 A;  2QPN A;  3UNW A;  1CEG A;  5A90 A;  3UY6 A;  2DRW A;  3W4P A;  3IWO A;  1RCJ A;  4GOG A;  4MBK A;  5FA7 A;  1PIO A;  3UDF A;  2Y2M A;  1JWZ A;  1NZO A;  4K0X A;  2ZJ9 A;  2WGI A;  4X55 A;  4Y0O A;  1BLH A;  4JXW A;  3V39 A;  4L0L A;  2WKE A;  1S0W A;  4GD6 A;  1BTL A;  4RX3 A;  4N1H A; 
#chains in the Genus database with same CATH topology
 4ARZ B;  1JFI B;  3DAV A;  4O8G A;  4HOI A;  4NYU A;  1XX2 A;  3DTE A;  3REI D;  2HDS A;  4J8V A;  4GS9 B;  4B9O A;  3WD4 A;  1P3O B;  1NRF A;  1NY0 A;  1UWP X;  2PYR A;  3NOU C;  3CJM A;  3RJU A;  1F2K A;  3AFA D;  5CHJ A;  3KSF A;  2ARO B;  2UV0 E;  3AZN B;  4UAA A;  5IU1 A;  1F66 B;  3N4I A;  4P0M A;  5DVA A;  3BM6 A;  4MDZ A;  1K6R A;  3TE8 A;  3UDX A;  2G5I C;  5AV8 A;  1OTD A;  2K31 A;  1CI8 A;  1P3K A;  3Q81 A;  3C5A A;  1XKZ A;  1KX3 D;  1E25 A;  4M3K A;  1K4E A;  4ID4 A;  3VH5 A;  4J8W D;  5DF9 A;  3UTA C;  2QMI A;  5FI6 A;  4ZJ2 A;  3O62 D;  3KX0 X;  3M6H A;  5AY8 A;  4N92 A;  1E4D A;  2Q9M A;  3WTP E;  1PWD A;  1P34 D;  3MGQ C;  1RP5 A;  3E2L A;  2ZC3 B;  3O5Y A;  2RIQ A;  3LIB A;  4XUJ C;  3REI B;  5DTS A;  3N8R A;  4H9O B;  5B1M B;  3L9K A;  3AZF D;  1U35 A;  4HMD A;  4X23 B;  5GT0 A;  3NQJ A;  2XD5 A;  4HHD A;  1PW8 A;  1M18 A;  3TW8 A;  1H5X A;  2HUE C;  2ZQC A;  2ZC6 B;  3VMA A;  4R8P D;  3FKV A;  3REK A;  4H9S A;  1W63 M;  3DTM A;  2C5W B;  3G34 A;  5DF8 A;  5KSH A;  1NLY A;  3PBR A;  4X23 A;  1H3Q A;  4IBC A;  3QP6 A;  1Y54 A;  5GLD A;  4H9O A;  1MZU A;  5EFW A;  4LRZ E;  3T12 B;  2QYB A;  2WYX A;  3LZ0 A;  1BLC A;  3C1B C;  2Y2P A;  1CEF A;  4S2I A;  2BYM B;  3O3V A;  3LFV A;  1PI4 A;  4DMZ A;  4LLO B;  4J8V B;  3NUL A;  4GS9 A;  5CGS A;  4H9R B;  3IH9 A;  3MQ0 A;  3X1V A;  4X53 A;  3E4Q A;  5FDH A;  1N9L A;  2LB5 A;  3NIA A;  5EPH A;  1LL5 A;  3A6N C;  1E88 A;  2D49 A;  5AY8 D;  2B02 A;  2YFV B;  3O62 A;  4JXS A;  1EWZ A;  3AZG A;  5GT3 B;  3BWL A;  2JBF A;  4NE6 A;  2HF6 A;  2ZY3 A;  3GDI A;  4Z2J A;  3B6G D;  3TU4 B;  5HAI A;  4H9Q A;  3HL9 A;  4NYY A;  3QP1 A;  5DJT A;  5B40 C;  2Q0O A;  3EEH A;  4DDS A;  2L0W A;  2VV6 A;  3E98 A;  2BG1 A;  3W97 C;  2G2W A;  4OKP A;  1A0K A;  2CV5 C;  3NQU B;  3UTB D;  3AFA A;  2ZL1 A;  5B32 B;  1CK3 A;  4R38 A;  2PU4 A;  2WGW B;  3CLO A;  1YSP A;  3WS5 A;  5CHM A;  3QHY A;  5M18 A;  1W2E A;  1ZC2 A;  4S2N C;  1TS0 A;  5EOO A;  5TGF A;  2Z2M B;  3AN2 B;  3NC8 A;  2Z6D A;  4HMC A;  3LIE A;  5CEB A;  4OPZ A;  3IS2 B;  1UR9 A;  1D7E A;  1M19 D;  3GR2 A;  5CER A;  1VM1 A;  4CLC A;  3EQU A;  3ZHH A;  2F8N H;  1Y28 A;  4WNN A;  2JKG A;  2FN2 A;  1YU3 A;  5CPJ A;  4QD4 A;  1AXB A;  3KS4 A;  2Q9N A;  2JKR M;  2W1T A;  1IEL A;  5GHX A;  3QP2 A;  3KS8 A;  1P3K C;  2CC1 A;  4DN0 A;  4R3J A;  2ZY2 A;  2Z6C A;  3LI8 A;  3AZH D;  4XZQ A;  3KXB A;  5AQB A;  5F1F A;  4YS3 C;  5CGW A;  1JTG A;  4BD1 A;  5JRG C;  1IYS A;  1EQZ C;  1W5D A;  3G31 A;  3HLC A;  2VGL M;  4CAY A;  4O7D A;  4J8X B;  1K6S A;  1JWV A;  3WD1 A;  1OGG A;  4Y0T A;  3EWK A;  4B93 A;  3ZYT A;  4CJN A;  1K56 D;  3LI9 A;  3X1S D;  4QLC D;  2CMN A;  5DNM A;  3G30 A;  1DJC A;  1M6K A;  3TU4 D;  5JA4 A;  5GT3 D;  1I5Q A;  3AGD A;  4JF6 A;  3T1X A;  1EAK A;  3B33 A;  5B1M C;  4HIA A;  3IBR A;  3LEL D;  3GVB A;  1P3A A;  1HQ3 C;  1ES4 A;  5AV5 B;  1K57 C;  4GHI B;  3S7N A;  3MQQ A;  3MGR D;  4EBN A;  3C7V A;  2B18 A;  1KX5 D;  5GSU C;  4Z66 C;  3WTP A;  1YLY A;  1N1J A;  3AZH A;  1L0D A;  1DJA A;  4GNU A;  5KSC A;  4NK3 A;  4OJL A;  4WL9 A;  3P7N A;  1H0I A;  3HUO A;  3REJ B;  3S7Q A;  5M19 A;  2WKR A;  4H6J A;  2J80 A;  1P3A B;  1YLP A;  4MN6 A;  4Y0U A;  3A1K A;  5BO0 A;  5CPJ D;  5HL6 A;  3QP8 A;  5EEC A;  1LLB A;  1FCN A;  4KUD A;  4LEN A;  4P6Z M;  1W1Y A;  4MNR A;  4U3T A;  2Y2K A;  2HDR A;  5C3I B;  4KG5 A;  5LBR A;  1HLU P;  3U2A A;  3FG8 A;  3MZD A;  1K55 A;  4O01 A;  3H7W B;  1KX5 B;  1CK7 A;  3X1T A;  1KX4 C;  3TSG A;  1AWI A;  1IEM A;  2ZOH A;  4ZAM A;  3N6I A;  2PD7 A;  2X01 A;  3UTB A;  1LSW A;  4IBR A;  4Z5T A;  2YKH A;  1P3M C;  2W3G A;  2F2A C;  3MGP C;  4ZUX A;  2J3T D;  3UB6 A;  1L0E A;  1NLZ A;  2YFV A;  3O62 B;  1FCM A;  1FR6 A;  3S22 A;  2JCH A;  2XDM A;  3NY4 A;  1G6A A;  4B88 A;  1TDG A;  3WS1 A;  2ZOI A;  3B6G A;  2C6W B;  1KX3 C;  3X1T C;  2HZ5 A;  4F3L B;  5HAP A;  5AQ9 A;  3IWI A;  4UPK A;  3V9R B;  4KG2 A;  1E6P A;  3L29 A;  1VB6 A;  1KGF A;  3V50 A;  1ERO A;  1L6J A;  1UR8 A;  3UB5 P;  2GDN A;  2AVX A;  5AV6 A;  3LO7 A;  2R9W A;  4XZQ C;  4NET A;  1HD8 A;  5CPJ B;  3H0M C;  2XQZ A;  1BUE A;  3AYW C;  1UGU A;  4LCM A;  5HD5 A;  1V9Y A;  4K0W A;  4N1X A;  2ARO A;  5B31 B;  4XUJ B;  3V67 A;  1ONG A;  4BJP A;  1KE3 A;  4IUH A;  3D4F A;  3HLB A;  3ZG5 A;  5BT1 C;  5GHY A;  3V5M A;  3AV2 A;  2ZY4 A;  3ZFZ A;  3DTK A;  3OZH A;  4HJ4 A;  2W1T B;  3MS6 A;  4BL3 A;  4KUK A;  5BPV A;  4Y15 A;  5GXQ D;  5B0Y B;  5CPK B;  1KOU A;  4GB7 A;  5CGX A;  3AZG B;  1K55 C;  5B1L D;  1S32 D;  4J8X C;  2ARO C;  5E2F A;  5E2E A;  4Y2F A;  3SH8 A;  3AZF A;  5AVB A;  5HWW A;  1GCE A;  5AVC A;  2DQN C;  1LI9 A;  4J8W C;  1F5M A;  3EOI A;  4CSR A;  4ZTK A;  1YMS A;  3UPO A;  1GSV A;  3LZ1 C;  4DDY A;  3W96 A;  1J3W A;  1PWG A;  5C5K A;  2WZZ A;  4HGA B;  1DY6 A;  2XSS A;  1HQ3 D;  3R4K A;  4LCL A;  3MQL A;  4RA7 A;  5FQJ A;  4QJG A;  4KGC D;  4OOL A;  3LJA B;  1VET B;  1YPR A;  1KX3 A;  4WEL A;  4KZ6 A;  3UN7 A;  3BLS A;  4QNL A;  2EWW A;  3EQV A;  4WZ4 A;  5FEF A;  4OJ6 A;  1M1A B;  5G4Y A;  3B6G B;  4WU8 A;  4G92 C;  3W97 A;  4E45 A;  3MGP D;  1LHY A;  3KUY D;  2Y2H A;  3R45 B;  2ZQ9 A;  2P08 A;  5B2I A;  3F1N A;  3AZI A;  4WU9 B;  3KFU G;  1YU1 A;  2JKT M;  4I39 A;  1KX4 D;  4QLC C;  3C2W A;  3DBA A;  3X1S C;  2H0Y A;  1ED7 A;  4H9R A;  4J8V D;  1I2W A;  3VFH A;  5B0Z A;  3W97 B;  1KX4 A;  1QME A;  4OP5 A;  1M19 B;  1M18 B;  3AZI D;  4EO5 B;  4YM6 A;  4KZ7 A;  3UDI A;  2OAQ 1;  1WA9 A;  3MVD B;  3AN2 D;  1S67 L;  1AOI C;  3UY6 A;  4XZQ B;  3W4P A;  3C1C D;  1RCJ A;  4GOG A;  4EER A;  3M7P A;  5GXQ C;  1JWZ A;  5BNV A;  5G4Z A;  2LY8 A;  4Y0O A;  1IFQ A;  3V39 A;  4JJN A;  5AV8 C;  4L0L A;  1SZV A;  3UTB B;  3LR5 A;  5B31 C;  1OJ5 A;  1P3F C;  1KX4 B;  4GZB A;  5F5Y A;  3TJZ C;  1KX5 C;  2MJ6 A;  1T1C A;  2XLN A;  1T19 A;  4S2L A;  4Z2I A;  3MGP B;  4H8R A;  5CP6 C;  3LY3 A;  1MPL A;  3AZF B;  1P3K B;  4X56 A;  3S1Y A;  2DF4 C;  5B1M D;  2V8C A;  4MEZ A;  1TZY B;  4NY2 A;  1K54 A;  3FDD A;  1LSX A;  4UEY A;  4IHQ A;  1ID3 C;  5AVC D;  2W1R A;  3L2A A;  5KZH A;  4Z2M G;  3B3X A;  3B0D B;  3GMW A;  5GL9 A;  2A24 B;  5BS7 A;  3G2Z A;  4GLQ A;  5G18 A;  2VGJ A;  5F1G A;  3WAA C;  2F8N D;  2HIO D;  2ZMF A;  5HL1 A;  1P0Z A;  3ISG A;  4UQI M;  5AQ7 A;  2E8I A;  1TAF B;  5CTM A;  2YFW B;  2XK1 A;  4BBU A;  3A0V A;  4KGC A;  5CEC A;  3UT9 B;  4MBH A;  4AFI A;  4NE3 A;  2KLI A;  1Z2C B;  4MN5 A;  4Q0H A;  2V20 A;  4R23 A;  4HGA C;  3T4K A;  3UE1 A;  3HON A;  3AYW B;  4WV4 B;  3LZ0 C;  2XA7 S;  5EVI B;  2RL3 A;  4ETX A;  1YT4 A;  4QWO A;  2R9X A;  2ARO D;  3BEB A;  4DE1 A;  1IYO A;  3PTE A;  3MJQ A;  4ZJ1 A;  3AFA B;  3T1Q B;  5B0Z C;  2M1C A;  5B0Z B;  1KE0 A;  5E2H A;  2JC7 A;  3MQO A;  3A3E A;  5CXW A;  3IXD A;  3L28 A;  4JGQ A;  4LD9 A;  4X23 C;  2OSU A;  5J4E A;  3W96 C;  3O88 A;  2HJ9 C;  2KOI A;  3I7J A;  1PW1 A;  2NQB D;  5DTK A;  1ERM A;  3ITA A;  5TR7 A;  3LR4 A;  4ZUX B;  1M19 C;  5F6A A;  4H9P A;  1H3O B;  4MB4 A;  3L26 A;  3JPU A;  3IF5 A;  3S4X A;  3G4P A;  4C75 A;  5HX9 A;  2B5R A;  3DWK A;  4J8W B;  2J9P A;  2ZQ8 A;  3PBO A;  4WMC A;  1NYY A;  4FH4 A;  1ZG6 A;  1H8P A;  3BY8 A;  3Q1F A;  3NDG A;  4EEP A;  4YNR A;  3LEL C;  3X1U C;  1NWZ A;  1IKG A;  1KVM A;  3V9R A;  4P6B A;  4QY6 A;  3UPN A;  4HI4 A;  3RFB A;  3L7H A;  3VE4 A;  4HES A;  3D9Y A;  4E3O A;  1OGB A;  5DNM B;  1F98 A;  3NBL A;  3NCK A;  4IVI A;  1H8M A;  1PNE A;  3AYW A;  4R6L A;  2GNX A;  2QJ7 A;  4N9K A;  4LD9 D;  3MGS D;  3WTP D;  3WRT A;  1KX5 A;  4KHA A;  4WNN B;  4UHU A;  1Z09 A;  5FAP A;  4YS3 A;  1IYQ A;  3G6O A;  3DWZ A;  2V5O A;  5F68 A;  3UT9 C;  3AZK C;  4F3L A;  4DQY B;  4HJ6 A;  2J8Y A;  1PZP A;  3UTA B;  5JRG D;  2PD8 A;  3C4O A;  5AVC C;  1WWI A;  4NZ1 A;  4MN7 A;  1K54 C;  4GJ4 A;  4II7 A;  2F8N G;  3ZG8 B;  2ZQD A;  4KZ4 A;  5FAQ A;  5J8X A;  5GT3 A;  2I9V A;  3NJA A;  4R3B A;  1LI0 A;  4KQR A;  1OME A;  3MGR B;  1XJ2 A;  4NZ5 A;  2WKQ A;  5AV5 D;  4Q0I A;  2FFY A;  4IBD A;  4XUZ A;  1P3O C;  4RYE A;  2J7V A;  4LGW A;  4FSF A;  4J8X A;  3EPK A;  1CF0 A;  3EG5 B;  2BYM A;  2VJW A;  4WZS B;  5D3O A;  3T4S A;  4L9F A;  3UB9 A;  5FSR A;  3W2Z A;  2H0T A;  3V3S A;  4WEJ A;  3B6F C;  2HDU A;  1P3P B;  5HAR A;  3LEL A;  1NRJ A;  1GHI A;  4E3I A;  2NUT C;  1XP4 A;  5HWV A;  1KGG A;  4OQ0 A;  4S2J A;  4GKU A;  4U0X A;  4X25 A;  3H9W A;  3PAE A;  3REH D;  4NKP A;  4LD9 C;  4FCF A;  5B24 C;  1TS8 A;  3TU4 A;  3WA9 B;  2P9V B;  3WWX A;  1YM1 A;  4RQ9 A;  1P9R A;  4X69 A;  3KWQ B;  3X1S A;  3LZ0 B;  4MLL A;  3F1P B;  3IF6 C;  1ACF A;  4GHL A;  4XT2 A;  3MGQ B;  3OPP A;  3MKF A;  4YM6 D;  3AZL B;  4WZ5 C;  4DXB A;  1G6O A;  1F66 A;  1ESI A;  3CMZ A;  5DNN A;  1N1J B;  5AY8 C;  3AZH B;  5JRG A;  1OPX A;  3BQ8 A;  3N7W A;  4Y17 A;  5E5A D;  1NYM A;  4IED A;  1H8Z A;  1SKF A;  2PYO A;  1FQG A;  1ZTU A;  3RXW A;  5AV5 C;  1TVF A;  1U35 B;  3PBS A;  1E8B A;  3W99 B;  3FYZ A;  3LYX A;  4GN2 A;  4Q8I A;  4ZUX C;  1JFI A;  4LV1 A;  3AZL A;  4K91 A;  2EX2 A;  3HCY A;  3PBN A;  2OWJ A;  2PR6 A;  1MKM A;  2NZD A;  1ONH A;  4ZBE A;  1O7E A;  1YLW A;  5FQQ A;  4ETZ A;  3VOL A;  2DCF A;  2PDR A;  3AN2 C;  3LGO A;  1GA0 A;  1CXW A;  5FQI A;  4CLC D;  4M6B A;  1BZA A;  3S7P A;  3B47 A;  3UME A;  1W1T A;  2EXB A;  4EWF A;  2Y2L A;  3W96 D;  3C1B A;  5AV8 B;  4WEK A;  5I5L A;  3UE0 A;  4NXG A;  4PHT A;  3GSG A;  3EGX C;  3HRE A;  4CAY B;  3AGE A;  3A6N B;  5F99 D;  2OAP 1;  4P6Z S;  1ZLA A;  1RGY A;  2BYK A;  5BS7 C;  3BJN A;  1P3B C;  2W27 A;  3QP4 A;  4J8U A;  3O62 C;  1G5U A;  2RVQ C;  1ID3 B;  4CPK A;  4OPQ A;  4I3I A;  3X1U D;  5JYP A;  3F1P A;  1SKO A;  3AV2 D;  1W79 A;  4KZB A;  5B32 C;  5E2G A;  4J8U D;  4OPR A;  3CG5 A;  3PXP A;  3WAA D;  4DRT A;  3X1V C;  4Q0J A;  4GW9 A;  2CV5 A;  1WWS A;  4OQH A;  4H9P B;  1P3I C;  2ZLY A;  3PYP A;  2A49 A;  3JVV A;  1S32 C;  2FJ7 B;  2A24 A;  3BFF A;  5FAS A;  1O07 A;  3H82 B;  4PM7 A;  4LPZ A;  4FTX A;  2VGL S;  4ZBJ B;  1IOU A;  2XRO A;  1G68 A;  4X23 D;  4KUO A;  3SW1 A;  3NHQ A;  3W98 D;  3REK D;  4NXB A;  5B2J C;  4R8P A;  5AV8 D;  5GLB A;  2ZM0 A;  4JGR A;  4DRB A;  5CPK C;  4EU0 A;  3KSY A;  3OPL A;  4KQD A;  5GT0 D;  4EBP A;  4R4S A;  3W4Q A;  2ZMV A;  1BYW A;  3ZG0 A;  1ZLA D;  1E6Z A;  5F69 A;  4HBT A;  1BH9 B;  3LIC A;  1L0F A;  3C1B B;  4BL2 A;  3O87 A;  5HDS A;  3OLO A;  4H9N A;  1SDE A;  5A91 A;  5AV9 D;  1KDS A;  1ULY A;  2WAF A;  3MXR A;  4J8U C;  4WJ3 C;  2FH5 A;  5DNN D;  3ULF A;  1F66 D;  3BFG A;  4J8W A;  2PBY A;  2EFU A;  1P3L D;  1SHV A;  3CHW P;  3AV2 C;  3FV7 A;  3WS4 A;  4KUD D;  1D1J A;  2WGV A;  3AZL C;  1K25 A;  2QWS A;  3IX8 A;  3REL B;  5CED A;  3MXQ A;  4IBB A;  3T4T A;  2HP9 A;  2GJ3 A;  5FAO A;  3MMH A;  1VEU A;  1G28 A;  3C1C A;  5GT3 C;  3UT9 A;  3AZL D;  5KDM A;  2ZD8 A;  1XA7 A;  3REH A;  1PZO A;  2PAV P;  4KG6 A;  3R7W A;  5FUG A;  3IBJ A;  2ZM5 A;  3Q7Z A;  1ZG4 A;  5B40 B;  4HP4 A;  2HUE B;  2PYO D;  2PYP A;  4PM8 A;  4BEN A;  1VQQ A;  1OTA A;  3A0S A;  3VH5 T;  5B24 D;  2ZC4 B;  4Z66 B;  5GSU B;  5E5A A;  3REI A;  3REH B;  2UWX A;  1T1A A;  3AV1 C;  5KIZ A;  3F1O A;  1ES5 A;  4IBX A;  2M7V A;  3VP3 A;  5CPI C;  1OTE A;  1AOI B;  2EWV A;  1DP8 A;  3IX3 A;  5A90 A;  1EQZ D;  2DRW A;  5CPI D;  5B2J A;  4H9Q B;  2Y2M A;  3CI6 A;  3AV1 D;  2ZJ9 A;  2WGI A;  1YAX A;  4G3W A;  2WKE A;  2VX8 A;  4UUZ B;  1B67 A;  4RX3 A;  3W98 C;  3KYQ A;  4KEN B;  1P3F B;  4EV4 A;  4NE5 A;  1HQ3 A;  3VH6 W;  3NEC A;  3HUN A;  1BH9 A;  5CP6 B;  4EUZ A;  4OJO A;  4R3A A;  4UQI S;  4NXE A;  2YFW A;  1PRQ A;  1P3M B;  4KZ5 A;  4GH9 A;  4Z2H A;  4Z2M H;  3TG9 A;  4GDN A;  4OLD A;  1LT0 A;  2HDQ A;  3UTA A;  3EPJ A;  1MC0 A;  1D06 A;  1EQZ B;  4IUK A;  3IXG A;  5TBM A;  5JRG B;  3AZK D;  1MBL A;  3MGQ A;  5F82 A;  3HBR A;  1OTB A;  1T18 A;  4P87 A;  4Y7P A;  1F66 C;  4KQO A;  2FZ0 A;  2G7U A;  4XUX A;  2O9C A;  4N9L A;  2D01 A;  5AV5 A;  4GHI A;  1ODV A;  3FPV A;  1MWS A;  3MFX A;  5EOE A;  3IHB A;  3FC7 A;  4JJN B;  3MGS C;  2EA9 A;  5B24 B;  3L25 A;  3IF6 A;  4WU8 B;  3X1V B;  5TBM B;  2Y2Q A;  2PYO B;  1TD5 A;  4PM5 A;  3AZK B;  4O0P A;  1P3I B;  5EVL A;  2VKS A;  3K3D A;  2B95 A;  4NG2 A;  5J3W A;  5I94 A;  1E6N A;  2NUP C;  2O0Y A;  2VA0 A;  1YU4 A;  2XF3 A;  4H9S C;  3LUQ A;  3KYE A;  4WF0 A;  3FZC A;  5FUG B;  3VFF A;  5EVE A;  3WRZ A;  4FD8 A;  4PKY G;  4KZ3 A;  3T50 A;  3REL D;  4YS3 D;  2WK0 A;  3K3C A;  2ZC7 A;  4EET B;  3KWQ A;  1YUE A;  3MGS A;  1X0O A;  4ARZ A;  5HAQ A;  5FQM A;  2P74 A;  4D2O A;  3HJI A;  4GCZ A;  4KQQ A;  2VV7 A;  5BT1 D;  5B33 B;  4EQ1 A;  3WX7 A;  4DRA A;  5GLA A;  2Y2J A;  5DF7 A;  5FL3 A;  2Y2I A;  4WM9 A;  4CLC C;  4HME A;  2ZBB A;  3SZT A;  2HP5 A;  4HQA A;  1ZLA B;  4QPR A;  2QJ5 A;  4G91 B;  3VE3 A;  4QB8 A;  4ZUX D;  1HVB A;  4BQM A;  5GSU D;  4Z66 D;  4S2M A;  5J7E A;  5A8B A;  3WA9 C;  4CSR B;  3UE6 A;  3X1T D;  4OJP A;  2J9O A;  2IO5 B;  2XRN A;  3M2J A;  3NOP C;  4WMC D;  3QNC A;  3NQJ B;  3OCN A;  2IOU A;  3IS2 A;  4KHA B;  3RH8 B;  2L5A A;  5G49 B;  3CAX A;  4R4R A;  3REL C;  1P3G D;  1R4V A;  4OVD A;  1BFM A;  5AV6 B;  3HLW A;  2I72 A;  1P3B D;  1J7M A;  2FFF B;  1P34 C;  1P3G B;  4Z9Q A;  4B4Z A;  2Y2O A;  2JSS A;  3EPH A;  3U4L P;  2HIO A;  4MBF A;  2F8N A;  1ES3 A;  5JA4 B;  3KYZ A;  3AZK A;  4K08 A;  3B0B A;  1Z6F A;  1W8Q A;  4HH2 A;  4JBF A;  5AV9 B;  3MGR A;  3LCE A;  4M4X A;  2IWC A;  2HPB A;  3PHY A;  3IH8 A;  4B4X A;  4DE0 A;  1P34 A;  2EFX A;  5AJG A;  2GX5 A;  4IJG A;  2JKF A;  5AVC B;  4LRY C;  3S7O A;  4BD0 A;  1JTD A;  1S4S A;  1MWT A;  1P3K D;  2NZD B;  3MGR C;  2NQB C;  3OPH A;  1H3O A;  4ZBJ C;  1LSV A;  4QLC A;  3EEA A;  1MY8 A;  1K56 A;  1P3F A;  2X71 A;  3BFD A;  2PU2 A;  4ZRR A;  3AZJ D;  4ME4 A;  5B32 G;  4H6J B;  3A3F A;  2R78 A;  4YS3 B;  3LJA A;  1VET A;  4EUV A;  1ES2 A;  5B24 A;  5KDM B;  4G3V A;  3ZG7 B;  3SH9 A;  5FI7 A;  3WAA B;  4OOY A;  1BSG A;  2X02 A;  4JJN C;  4PPR A;  2RCX A;  3MGP A;  5B2I B;  3W97 D;  3HLG A;  4WU8 D;  4EBL A;  3D3O A;  1KGE A;  3FKE A;  4JJN D;  3P09 A;  5M1A A;  3KUY C;  4DXC A;  3JYI A;  1P3L A;  3AFA C;  5JYO A;  4YIN A;  2LB9 A;  3UPP A;  2HJE A;  3CWF A;  5EE8 A;  2D02 A;  1WYC A;  2JE5 A;  4BLM A;  4E3N A;  3A6N D;  4OPY A;  1EI5 A;  1ZKJ A;  2ZQA A;  4WN5 A;  4KUD C;  4KGC C;  3LJA D;  3W96 B;  3WA9 D;  3LIA A;  3AZJ A;  2H5S A;  3C8C A;  4LV3 A;  1P3F D;  4DF6 A;  4CLC B;  4I38 A;  4E3M A;  2Y79 A;  5AV9 C;  1S4R A;  3KSH A;  1O6I A;  5HZH A;  3MNN D;  3LIF A;  1BUL A;  5HPF A;  1P3M A;  5CPI B;  1P3P D;  3W98 A;  2Z2L B;  4KZ8 A;  3LZ1 B;  4IBE A;  5B1L B;  3AZG D;  3AZI C;  2ZY5 A;  4WUJ A;  1KS0 A;  2RTS A;  3VH6 T;  5B40 A;  2BYK B;  3FKW A;  3VV4 A;  2WKP A;  4J8V C;  1FOF A;  1TAF A;  5DTT A;  3Q7V B;  2BLS A;  2IO5 C;  4OP8 A;  3B0C T;  4YWZ A;  4EEU A;  2QHK A;  4PM9 A;  2VK3 A;  4C3Q A;  5AVB D;  5B0Y A;  5FI2 A;  2Y59 A;  1OT6 A;  1S32 A;  1GSW A;  3MKE A;  5B1L A;  4G92 B;  1W7F A;  1AIW A;  5FQ9 A;  5GXQ A;  3LZ0 D;  1GXD A;  5DNM C;  4HH3 A;  5AVB B;  1TZY C;  1P3I D;  1SCW A;  4D60 A;  2OLV A;  4JPM A;  5EM1 A;  2L1M A;  5DJU A;  1YQS A;  5CRF A;  2Y2G A;  1P3B A;  2VLG A;  2CV5 B;  1GOI A;  1FCO A;  3X1U A;  1YLT A;  2ZQ7 A;  4BBV A;  3ZQ5 A;  1HTA A;  1P3L C;  1V9Z A;  3BW6 A;  4XUJ A;  3EGD C;  4HY8 A;  5HDD A;  5BNX A;  2ACG A;  1VHM A;  3SS3 A;  3WTP B;  5DNN B;  3R7W B;  3LZ1 D;  3D72 A;  4PMA A;  5FAT A;  5EV0 A;  1PDC A;  3BLM A;  3VP4 A;  1TZY A;  3KWQ C;  3MNN B;  2KDK A;  2A2L A;  3NOT C;  4MCW A;  4OJ5 A;  4DKI A;  2W3D A;  1DRM A;  2IA2 A;  4E6X A;  4QHC A;  3CPT B;  2V0U A;  1YSQ A;  4GDB A;  3VP1 A;  1I2S A;  4S2K A;  2NZD D;  3B6F B;  4IBI A;  3C1C C;  3A0R A;  1AOI D;  4JXV A;  2FJ7 D;  1BLS A;  3W4O A;  3AL0 C;  5HD3 A;  4Z5T D;  3DTI A;  1KVL A;  3BQA A;  1NJ4 A;  5EVI A;  3UE3 A;  3REL A;  3HJK A;  1P3A D;  3PBT A;  3E0Y A;  1YLJ A;  3B6F A;  4E3L A;  4BMW A;  5U47 A;  3BFC A;  3MGS B;  3A3I A;  5B31 G;  3LID A;  1XJ6 A;  2INW A;  3WKJ C;  4IBG A;  5A93 A;  3F1N B;  1PI5 A;  4J8U B;  2EX8 A;  2PRF A;  4JKT A;  4RVA A;  4NFT A;  4ZJ3 A;  1UWN X;  2V1B A;  3X1U B;  4I3J A;  3GEC A;  1ID3 D;  3LY4 A;  2L4R A;  3OC2 A;  3T1S A;  4YM6 C;  1P3B B;  4KZA A;  4FH2 A;  3AZJ B;  4KUD B;  5CPK A;  4E3J A;  1Q2Q A;  2VV8 A;  3GV9 A;  5AV6 C;  5FEG A;  4GD8 A;  1FIL A;  3TOI A;  3TU4 C;  3LEZ A;  3O86 A;  2XFT A;  4Z2G A;  4OH0 A;  1BH8 A;  3VH6 A;  2OV5 A;  2PT7 A;  2HP6 A;  3EPL A;  2WGW A;  2XFS A;  4YFM A;  2ZM2 A;  4NZ4 A;  3KSI A;  3Q07 A;  2CWE A;  2E8J A;  2F8N B;  1YU0 A;  3KXB D;  3OOV A;  5GT0 B;  3IX4 A;  4J8X D;  3KXB B;  1CJF A;  3JVU A;  5B1L C;  4MBK A;  3KXB C;  3F6T A;  2HV1 A;  3UDF A;  3AV1 A;  3C38 A;  3FPW A;  4X55 A;  1BLH A;  4JXW A;  5CPI A;  3W98 B;  1M1A A;  4N1H A;  4EES A;  5B33 D;  1M19 A;  4JXG A;  3CUE A;  3GRJ A;  3ITB A;  4DE2 A;  5DKK A;  2O99 A;  4G3K A;  3ZVW A;  1H0G A;  4QY5 A;  3KO6 A;  2OLU A;  3ZCZ A;  2W3H A;  3UO9 A;  5EVI D;  3M2K A;  4OQI A;  4XZQ D;  3VP0 A;  5EUA A;  2FJ7 A;  1RGZ A;  5K5B A;  3UT9 D;  2EX9 A;  1S6R A;  1YMX A;  2W3E A;  3X1T B;  2HGV A;  3ZNT A;  4X1L A;  5E43 A;  1XA1 A;  4PKY A;  2PBD P;  1P3O A;  3OCL A;  5B32 D;  4WU8 C;  4LV0 A;  3C4P A;  1L2S A;  2HIO B;  1MWU A;  3G35 A;  4LV2 A;  1U60 A;  4PAU A;  1K0K A;  1K57 A;  3PAG A;  3LEQ A;  2V1Z A;  3MFD A;  4Z5T B;  2JN7 A;  4DJ3 A;  1KDW A;  4Z2L A;  1BH8 B;  2FJ7 C;  3BYD A;  3A1I A;  1N9B A;  1B6W A;  5AV9 A;  3B6F D;  3CIT A;  5L10 A;  4LG2 A;  1XFQ A;  2IWB A;  1DJB A;  2QKP A;  3PR6 A;  3ZDJ A;  3AZJ C;  3REK C;  4WYY A;  2H10 A;  3AZH C;  5AY8 B;  3N8S A;  2O9B A;  1AOI A;  4R70 A;  5CTN A;  2EXA A;  3LZ1 A;  4MB3 A;  3MZF A;  1YU2 A;  4UA9 A;  4ZDX A;  3RXX A;  3AZG C;  1W8Y A;  5BO0 B;  4KZ9 A;  1TS6 A;  5B0Y C;  2BTF P;  1HTZ A;  1P3P C;  3SOI A;  4Y13 A;  1LL9 A;  1C3B A;  1XJ4 A;  1P3I A;  3LR3 A;  1M18 D;  3IXH A;  1YLZ A;  5HSQ A;  4IBJ A;  2A3U A;  3X1V D;  5CHU A;  1U35 D;  5B0Y D;  5GXQ B;  5G49 A;  2QZ6 A;  5DFX A;  2GZA A;  4R8P C;  3KSG A;  2VEA A;  3B0C W;  3IHA A;  3H0R C;  3UTB C;  3P98 A;  4WLA A;  4H9N B;  4R0Q A;  4DJ2 A;  3P01 A;  2CV5 D;  2IWD A;  1WYB A;  3IXB A;  5E5A B;  3QNB A;  1NZU A;  4IVK A;  4Z1W A;  3W99 A;  3KUY B;  3WAA A;  2RVQ D;  5BNX B;  3P5J B;  5B40 D;  3ICY A;  3SS5 A;  4E3K A;  1YKD A;  4YM6 B;  3T4Q A;  3MR0 A;  4XUJ D;  3T4J A;  4P85 A;  2W3F A;  1BT5 A;  3SS4 A;  4EQI A;  2W8S A;  2KX6 A;  1P3M D;  2XA7 M;  4OOM A;  1P34 B;  1QMF A;  4I3A A;  1HQ3 B;  3MNN A;  3OPR A;  1M40 A;  4Y5F A;  3FWL A;  4XT2 B;  1PFL A;  3C7U A;  2VGK A;  1Q2P A;  4S2N A;  3REH C;  3W99 C;  4JLF A;  2DNS A;  3H82 A;  3A3J A;  5F99 A;  4RX2 A;  2P9V A;  1JNU A;  4E6W A;  4QU3 A;  3H7W A;  2ZM8 A;  3MSH A;  3PBQ A;  4E04 A;  1FSW A;  3HLD A;  3C1B D;  5AVF A;  1K4F A;  5CPJ C;  4NZ3 A;  3WD2 A;  3MNN C;  2WKH A;  5EVI C;  3BRM A;  4EXO A;  5HPI A;  4HNB A;  4UA6 A;  3IP4 C;  1P3P A;  3REJ A;  5B32 A;  3REI C;  2ZL1 B;  1P3O D;  1GHM A;  3ZG9 B;  4S2P A;  1ESU A;  1XGJ A;  3REK B;  3UB8 A;  2NQB B;  2OOL A;  3A3D A;  4NEE D;  2ZC5 B;  1K38 A;  2V8F A;  1N9O A;  2K7S A;  3AN2 A;  5B31 D;  2JHE A;  4UA7 A;  3Q7V A;  1PWC A;  2PHY A;  5HWT A;  4XXR A;  5B2J B;  1ALQ A;  4HBU A;  3B0D C;  4IBK A;  2H28 A;  5B0Z D;  2K2N A;  4TX8 A;  1F1E A;  3T4O A;  3WKJ A;  3UMD A;  1P3L B;  2XD1 A;  4WZ5 A;  1TDL A;  3UB7 A;  1T1B A;  1OTI A;  4YOF A;  3M6B A;  5B2I D;  1MXO A;  1TEM A;  4HJ3 A;  5FDS A;  3WTP C;  3QP5 A;  3KUY A;  4LD9 B;  3VH5 W;  3AZM D;  1ZHH B;  5HW3 A;  1TF1 A;  4A5R A;  1W63 Q;  5B2I C;  2PYO C;  2XR0 A;  3WKJ B;  2Y55 A;  1H8Y A;  1L3L A;  3AV2 B;  1CQA A;  1E3U D;  3SH7 A;  3IF6 B;  3LEL B;  1SKO B;  3WS0 A;  5GLC A;  4S2O A;  5GHZ A;  3AZN A;  3BFE A;  3HVF A;  5AVE A;  3ZVT A;  4IBF A;  4OON A;  4L9E A;  1P97 A;  2V2F F;  5L8M A;  3WS2 A;  3H0L C;  1KE4 A;  4FUW A;  1Y4O A;  2JKR I;  4IJE A;  1MWR A;  4OLG A;  5L09 A;  4PM6 A;  3B42 A;  1JWP A;  2G5H C;  4Z2K A;  3K2N A;  3NI9 A;  4QLC B;  1GSX A;  5TFQ A;  4WU9 C;  4MB5 A;  4X6T A;  3AZE D;  1H0M A;  1U35 C;  2YKF A;  5CP6 A;  3REJ C;  3DW0 A;  1W1V A;  2G2U A;  1M18 C;  1OJG A;  1ID3 A;  1P9W A;  2EX6 A;  3AGF A;  3T4L A;  1VEU B;  1FSY A;  2F8N K;  5CHL B;  4BBT A;  1P3G A;  5IS1 A;  2V9A A;  2J3W A;  2OWH A;  1E6R A;  4MMN A;  3AZI B;  4WU9 A;  3R45 A;  3W99 D;  4R1G A;  3NQU A;  3IT9 A;  2J8P A;  3MZE A;  5MC7 A;  1HZO A;  3G2Y A;  3GQZ A;  1IYP A;  4Y3I A;  4L9G A;  5GSU A;  4Z66 A;  1S1Y A;  2Y4A A;  4CLC E;  4BWI A;  5AV6 D;  3B6G C;  4FOF A;  1S66 L;  3MVD A;  1IKI A;  1P3G C;  4X1M A;  3AYW D;  3GTC A;  1CI9 A;  5F99 B;  2WUQ A;  1SDN A;  3MF0 A;  4EW7 A;  4LFU A;  3RTY A;  2P04 A;  1LL8 A;  4WBG A;  3X1S B;  4ESP A;  2JKT I;  2XEP A;  4E44 A;  5DNN C;  1XJ3 A;  4JF5 A;  4UUZ A;  2XH9 A;  5CX7 A;  2HIO C;  3LR0 A;  4EO5 C;  3HLF A;  1GPF A;  1J9M A;  5TJJ A;  5HFO A;  5F83 A;  1OT9 A;  1TZY D;  3T1R A;  4Z5T C;  1S1Z A;  2J3T C;  1TS7 A;  4HEF A;  1S32 B;  3CZD A;  4JGP A;  3VSK A;  4GHA A;  1L0G A;  5A92 A;  4OQG A;  2NZD C;  3VOZ A;  3VSL A;  4HP9 A;  3E4O A;  2WZX A;  3W8K A;  1F9I A;  3N8L A;  1EW0 A;  2ZMA A;  3VP2 A;  1E15 A;  3IQA A;  5KMW A;  1XXM A;  3AZF C;  4IJF A;  3BY9 A;  2NQB A;  1NXY A;  3BEC A;  4DE3 A;  1PZR A;  2XGN A;  3C1C B;  3F1O B;  3E4P A;  2O9A A;  1FIK A;  3MGQ D;  3MVD D;  4F94 A;  3Q82 A;  4AWL B;  1GHP A;  1PYY A;  3AZN C;  5DKL A;  4AWL C;  3KWQ D;  1FR1 A;  3N3F A;  2P7J A;  3UTA D;  5BNV B;  1BLP A;  4G91 C;  1N9N A;  3V3R A;  1W1P A;  1DP9 A;  3OBF A;  2V0W A;  4JGO A;  4R8P B;  3AZE C;  5IHV A;  4WU9 D;  4C6Y A;  3AZE B;  5EM0 A;  1XGI A;  1GA9 A;  2WKI A;  5L2F A;  2Y2N A;  5B33 A;  3LJA C;  4X68 A;  4CQH A;  3MBZ A;  3C30 A;  5FQK A;  5E5A C;  3NDE A;  3MXS A;  1M1A D;  4I5S A;  3HLE A;  1XPB A;  1E3U A;  3HUM A;  1WE4 A;  2Y91 A;  5HDC A;  5DNM D;  1XFN A;  1N4O A;  5L07 A;  3HSH A;  4NXF A;  1M1A C;  4KGC B;  1EQZ A;  1A7W A;  5CP6 D;  5AQA A;  2M7U A;  3G32 A;  3VOY A;  1Q9C A;  3AZE A;  2V1A A;  5AVB C;  3WD3 A;  2Y8H A;  5F99 C;  3WA9 A;  3WD0 A;  5DFY A;  2W0N A;  3CUE C;  4U0T A;  5BOH A;  3L27 A;  5B33 C;  1JVJ A;  2WAD A;  3WKJ D;  4OUI A;  5B1M A;  1KX3 B;  4LRX C;  3E2K A;  2VQR A;  3ZNY A;  2WAE A;  3AZM C;  3IWQ A;  1MKI A;  2BAS A;  3A6N A;  3AZM B;  3AV1 B;  2PR5 A;  1P3A C;  1ERQ A;  3ZGA B;  3CPT A;  3TRC A;  1ZLA C;  3AZN D;  1STZ A;  4JF4 A;  1QO6 A;  5B31 A;  2VZW A;  2QPN A;  1T3U A;  3UNW A;  1CEG A;  5GT0 C;  3MVD C;  3IWO A;  5CPK D;  1KU5 A;  5FA7 A;  1PIO A;  1NZO A;  5IT5 A;  4K0X A;  5C3I C;  1S0W A;  5B2J D;  2DMW A;  4GD6 A;  1BTL A;  3REJ D;  1DP6 A;  3AZM A; 
#chains in the Genus database with same CATH homology
 1JFI B;  4NYU A;  1XX2 A;  3REI D;  2HDS A;  4J8V A;  1P3O B;  1NRF A;  1NY0 A;  3CJM A;  3RJU A;  3AFA D;  5CHJ A;  2ARO B;  3AZN B;  4UAA A;  1F66 B;  3N4I A;  4P0M A;  5DVA A;  3BM6 A;  1K6R A;  3UDX A;  2G5I C;  5AV8 A;  1CI8 A;  1P3K A;  3Q81 A;  3C5A A;  1XKZ A;  1KX3 D;  1E25 A;  4M3K A;  1K4E A;  4ID4 A;  3VH5 A;  4J8W D;  5DF9 A;  3UTA C;  2QMI A;  5FI6 A;  4ZJ2 A;  3O62 D;  3M6H A;  5AY8 A;  4N92 A;  1E4D A;  2Q9M A;  3WTP E;  1PWD A;  1P34 D;  3MGQ C;  1RP5 A;  3E2L A;  2ZC3 B;  2RIQ A;  4XUJ C;  3REI B;  5DTS A;  3N8R A;  4H9O B;  5B1M B;  3AZF D;  1U35 A;  4X23 B;  5GT0 A;  3NQJ A;  2XD5 A;  1PW8 A;  1M18 A;  1H5X A;  2HUE C;  2ZQC A;  2ZC6 B;  3VMA A;  4R8P D;  3FKV A;  3REK A;  4H9S A;  3DTM A;  2C5W B;  3G34 A;  5DF8 A;  5KSH A;  3PBR A;  4X23 A;  4IBC A;  1Y54 A;  5GLD A;  4H9O A;  2WYX A;  3LZ0 A;  1BLC A;  3C1B C;  2Y2P A;  1CEF A;  4S2I A;  2BYM B;  3O3V A;  1PI4 A;  4J8V B;  5CGS A;  4H9R B;  3IH9 A;  3X1V A;  4X53 A;  5FDH A;  3NIA A;  5EPH A;  1LL5 A;  3A6N C;  5AY8 D;  2YFV B;  3O62 A;  4JXS A;  1EWZ A;  3AZG A;  5GT3 B;  2JBF A;  4NE6 A;  2ZY3 A;  3B6G D;  3TU4 B;  5HAI A;  4H9Q A;  3HL9 A;  4NYY A;  5B40 C;  4DDS A;  2BG1 A;  3W97 C;  2G2W A;  4OKP A;  2CV5 C;  3NQU B;  3UTB D;  3AFA A;  5B32 B;  1CK3 A;  2PU4 A;  2WGW B;  3WS5 A;  5CHM A;  3QHY A;  5M18 A;  1W2E A;  1ZC2 A;  4S2N C;  5EOO A;  5TGF A;  2Z2M B;  3AN2 B;  3NC8 A;  5CEB A;  4OPZ A;  1M19 D;  3GR2 A;  5CER A;  1VM1 A;  3EQU A;  3ZHH A;  2F8N H;  4WNN A;  1YU3 A;  5CPJ A;  4QD4 A;  1AXB A;  3KS4 A;  2Q9N A;  1IEL A;  5GHX A;  3KS8 A;  1P3K C;  2CC1 A;  4R3J A;  2ZY2 A;  3AZH D;  4XZQ A;  3KXB A;  5AQB A;  5F1F A;  4YS3 C;  5CGW A;  1JTG A;  4BD1 A;  5JRG C;  1IYS A;  1EQZ C;  1W5D A;  3G31 A;  3HLC A;  4CAY A;  4O7D A;  4J8X B;  1K6S A;  1JWV A;  4Y0T A;  4CJN A;  1K56 D;  3X1S D;  4QLC D;  5DNM A;  3G30 A;  1DJC A;  1M6K A;  3TU4 D;  5JA4 A;  5GT3 D;  1I5Q A;  3AGD A;  4JF6 A;  5B1M C;  3LEL D;  3GVB A;  1P3A A;  1HQ3 C;  1ES4 A;  5AV5 B;  1K57 C;  3MGR D;  4EBN A;  3C7V A;  1KX5 D;  5GSU C;  4Z66 C;  3WTP A;  1YLY A;  1N1J A;  3AZH A;  1L0D A;  1DJA A;  4GNU A;  5KSC A;  4NK3 A;  4OJL A;  3HUO A;  3REJ B;  5M19 A;  1P3A B;  1YLP A;  4Y0U A;  3A1K A;  5BO0 A;  5CPJ D;  5EEC A;  1LLB A;  1FCN A;  4KUD A;  4LEN A;  4MNR A;  4U3T A;  2Y2K A;  2HDR A;  5C3I B;  4KG5 A;  3MZD A;  1K55 A;  1KX5 B;  3X1T A;  1KX4 C;  3TSG A;  1IEM A;  4ZAM A;  3N6I A;  2X01 A;  3UTB A;  4IBR A;  4Z5T A;  1P3M C;  2F2A C;  3MGP C;  4ZUX A;  1L0E A;  2YFV A;  3O62 B;  1FCM A;  1FR6 A;  3S22 A;  2JCH A;  2XDM A;  3NY4 A;  1G6A A;  4B88 A;  1TDG A;  3WS1 A;  3B6G A;  2C6W B;  1KX3 C;  3X1T C;  5HAP A;  5AQ9 A;  3IWI A;  4UPK A;  3V9R B;  4KG2 A;  3L29 A;  1KGF A;  3V50 A;  1ERO A;  2GDN A;  5AV6 A;  3LO7 A;  2R9W A;  4XZQ C;  4NET A;  1HD8 A;  5CPJ B;  3H0M C;  2XQZ A;  1BUE A;  3AYW C;  4LCM A;  4K0W A;  4N1X A;  2ARO A;  5B31 B;  4XUJ B;  1ONG A;  4BJP A;  1KE3 A;  3D4F A;  3HLB A;  3ZG5 A;  5BT1 C;  5GHY A;  3V5M A;  3AV2 A;  2ZY4 A;  3ZFZ A;  3OZH A;  4BL3 A;  5BPV A;  5GXQ D;  5B0Y B;  5CPK B;  4GB7 A;  5CGX A;  3AZG B;  1K55 C;  5B1L D;  1S32 D;  4J8X C;  2ARO C;  5E2F A;  5E2E A;  3SH8 A;  3AZF A;  5AVB A;  1GCE A;  5AVC A;  2DQN C;  1LI9 A;  4J8W C;  4CSR A;  4ZTK A;  1YMS A;  3UPO A;  3LZ1 C;  4DDY A;  3W96 A;  1PWG A;  2WZZ A;  4HGA B;  1DY6 A;  1HQ3 D;  4LCL A;  4RA7 A;  5FQJ A;  4QJG A;  4KGC D;  4OOL A;  3LJA B;  3UN7 A;  4WEL A;  1KX3 A;  4KZ6 A;  3BLS A;  4QNL A;  3EQV A;  4WZ4 A;  4OJ6 A;  1M1A B;  3B6G B;  4WU8 A;  4G92 C;  3W97 A;  4E45 A;  3MGP D;  1LHY A;  3KUY D;  2Y2H A;  3R45 B;  2ZQ9 A;  5B2I A;  3AZI A;  4WU9 B;  3KFU G;  1YU1 A;  1KX4 D;  4QLC C;  3X1S C;  2H0Y A;  4H9R A;  4J8V D;  1I2W A;  3VFH A;  5B0Z A;  3W97 B;  1KX4 A;  1QME A;  4OP5 A;  1M19 B;  1M18 B;  3AZI D;  4EO5 B;  4YM6 A;  4KZ7 A;  3UDI A;  3MVD B;  3AN2 D;  1AOI C;  3UY6 A;  4XZQ B;  3W4P A;  3C1C D;  1RCJ A;  4GOG A;  5GXQ C;  1JWZ A;  5BNV A;  2LY8 A;  4Y0O A;  3V39 A;  4JJN A;  5AV8 C;  4L0L A;  3UTB B;  5B31 C;  1P3F C;  1KX4 B;  4GZB A;  1KX5 C;  2XLN A;  4S2L A;  3MGP B;  4H8R A;  5CP6 C;  3LY3 A;  1MPL A;  3AZF B;  1P3K B;  4X56 A;  3S1Y A;  2DF4 C;  5B1M D;  4MEZ A;  1TZY B;  4NY2 A;  1K54 A;  3FDD A;  1ID3 C;  5AVC D;  3L2A A;  5KZH A;  4Z2M G;  3B3X A;  3B0D B;  3GMW A;  5GL9 A;  5BS7 A;  3G2Z A;  5G18 A;  2VGJ A;  5F1G A;  3WAA C;  2F8N D;  2HIO D;  5HL1 A;  3ISG A;  5AQ7 A;  2E8I A;  1TAF B;  5CTM A;  2YFW B;  2XK1 A;  4KGC A;  5CEC A;  3UT9 B;  4MBH A;  4NE3 A;  1Z2C B;  2V20 A;  4R23 A;  4HGA C;  3UE1 A;  3HON A;  3AYW B;  4WV4 B;  3LZ0 C;  5EVI B;  2RL3 A;  1YT4 A;  2R9X A;  2ARO D;  3BEB A;  4DE1 A;  1IYO A;  3PTE A;  4ZJ1 A;  3AFA B;  5B0Z C;  5B0Z B;  1KE0 A;  5E2H A;  2JC7 A;  3A3E A;  5CXW A;  3IXD A;  3L28 A;  4LD9 A;  4X23 C;  2OSU A;  3W96 C;  3O88 A;  3I7J A;  1PW1 A;  2NQB D;  5DTK A;  1ERM A;  3ITA A;  5TR7 A;  4ZUX B;  1M19 C;  4H9P A;  1H3O B;  3L26 A;  3IF5 A;  3S4X A;  3G4P A;  4C75 A;  5HX9 A;  2B5R A;  3DWK A;  4J8W B;  2J9P A;  2ZQ8 A;  3PBO A;  4WMC A;  1NYY A;  4FH4 A;  1ZG6 A;  3Q1F A;  3NDG A;  3LEL C;  3X1U C;  1IKG A;  1KVM A;  3V9R A;  4P6B A;  4QY6 A;  3UPN A;  4HES A;  4E3O A;  5DNM B;  3NBL A;  3NCK A;  4IVI A;  3AYW A;  4N9K A;  4LD9 D;  3MGS D;  3WTP D;  3WRT A;  1KX5 A;  4KHA A;  4WNN B;  4UHU A;  5FAP A;  4YS3 A;  1IYQ A;  3DWZ A;  3UT9 C;  3AZK C;  4DQY B;  2J8Y A;  1PZP A;  3UTA B;  5JRG D;  3C4O A;  5AVC C;  1WWI A;  4NZ1 A;  1K54 C;  2F8N G;  3ZG8 B;  2ZQD A;  4KZ4 A;  5FAQ A;  5J8X A;  5GT3 A;  4R3B A;  1LI0 A;  4KQR A;  1OME A;  3MGR B;  4NZ5 A;  5AV5 D;  2FFY A;  4IBD A;  4XUZ A;  1P3O C;  4RYE A;  2J7V A;  4FSF A;  4J8X A;  3EPK A;  3EG5 B;  2BYM A;  4WZS B;  5D3O A;  5FSR A;  2H0T A;  3V3S A;  4WEJ A;  3B6F C;  2HDU A;  1P3P B;  5HAR A;  3LEL A;  1GHI A;  4E3I A;  1XP4 A;  1KGG A;  4OQ0 A;  4S2J A;  4GKU A;  4U0X A;  3PAE A;  3REH D;  4LD9 C;  4FCF A;  5B24 C;  3TU4 A;  3WA9 B;  2P9V B;  3WWX A;  1YM1 A;  4X69 A;  3KWQ B;  3X1S A;  3LZ0 B;  4MLL A;  3IF6 C;  4GHL A;  3MGQ B;  3OPP A;  3MKF A;  4YM6 D;  3AZL B;  4WZ5 C;  4DXB A;  1F66 A;  1ESI A;  3CMZ A;  5DNN A;  1N1J B;  5AY8 C;  3AZH B;  5JRG A;  3N7W A;  5E5A D;  1NYM A;  4IED A;  1H8Z A;  1SKF A;  2PYO A;  1FQG A;  3RXW A;  5AV5 C;  1TVF A;  1U35 B;  3PBS A;  3W99 B;  3FYZ A;  4GN2 A;  4Q8I A;  4ZUX C;  1JFI A;  4LV1 A;  3AZL A;  4K91 A;  2EX2 A;  3PBN A;  2NZD A;  1ONH A;  4ZBE A;  1O7E A;  1YLW A;  5FQQ A;  2DCF A;  3AN2 C;  1GA0 A;  5FQI A;  4M6B A;  1BZA A;  2EXB A;  4EWF A;  2Y2L A;  3W96 D;  3C1B A;  5AV8 B;  4WEK A;  3UE0 A;  3GSG A;  3HRE A;  4CAY B;  3AGE A;  3A6N B;  5F99 D;  1ZLA A;  1RGY A;  2BYK A;  5BS7 C;  1P3B C;  4J8U A;  3O62 C;  2RVQ C;  1ID3 B;  4CPK A;  4OPQ A;  3X1U D;  5JYP A;  3AV2 D;  1W79 A;  4KZB A;  5B32 C;  5E2G A;  4J8U D;  4OPR A;  3CG5 A;  3WAA D;  4DRT A;  3X1V C;  2CV5 A;  1WWS A;  4OQH A;  4H9P B;  1P3I C;  2ZLY A;  2A49 A;  1S32 C;  2FJ7 B;  3BFF A;  5FAS A;  1O07 A;  4PM7 A;  4ZBJ B;  1G68 A;  4X23 D;  3W98 D;  3REK D;  5B2J C;  4R8P A;  5AV8 D;  5GLB A;  2ZM0 A;  4DRB A;  5CPK C;  3KSY A;  3OPL A;  4EBP A;  5GT0 D;  4R4S A;  3W4Q A;  3ZG0 A;  1ZLA D;  4HBT A;  1BH9 B;  1L0F A;  3C1B B;  4BL2 A;  3O87 A;  4H9N A;  1SDE A;  5A91 A;  5AV9 D;  1KDS A;  1ULY A;  2WAF A;  3MXR A;  4J8U C;  4WJ3 C;  5DNN D;  3BFG A;  1F66 D;  4J8W A;  2PBY A;  2EFU A;  1P3L D;  1SHV A;  3AV2 C;  3FV7 A;  3WS4 A;  4KUD D;  2WGV A;  3AZL C;  1K25 A;  3REL B;  5CED A;  4IBB A;  2HP9 A;  5FAO A;  3C1C A;  5GT3 C;  3UT9 A;  3AZL D;  5KDM A;  2ZD8 A;  1XA7 A;  3REH A;  1PZO A;  4KG6 A;  5FUG A;  3Q7Z A;  2ZM5 A;  1ZG4 A;  5B40 B;  2HUE B;  2PYO D;  4PM8 A;  4BEN A;  1VQQ A;  3VH5 T;  5B24 D;  2ZC4 B;  4Z66 B;  5GSU B;  5E5A A;  3REI A;  3REH B;  2UWX A;  3AV1 C;  1ES5 A;  4IBX A;  3VP3 A;  5CPI C;  1AOI B;  5A90 A;  1EQZ D;  2DRW A;  5CPI D;  5B2J A;  4H9Q B;  2Y2M A;  3AV1 D;  2ZJ9 A;  2WGI A;  2WKE A;  4UUZ B;  1B67 A;  4RX3 A;  3W98 C;  4KEN B;  1P3F B;  4EV4 A;  4NE5 A;  1HQ3 A;  3VH6 W;  3HUN A;  1BH9 A;  5CP6 B;  4EUZ A;  4OJO A;  2YFW A;  1P3M B;  4KZ5 A;  4GH9 A;  4Z2M H;  3TG9 A;  4GDN A;  4OLD A;  2HDQ A;  3UTA A;  3EPJ A;  1EQZ B;  3IXG A;  5JRG B;  3AZK D;  1MBL A;  3MGQ A;  5F82 A;  3HBR A;  4P87 A;  4Y7P A;  1F66 C;  4KQO A;  4XUX A;  4N9L A;  5AV5 A;  5EOE A;  1MWS A;  3IHB A;  4JJN B;  3MGS C;  3IF6 A;  5B24 B;  3L25 A;  4WU8 B;  3X1V B;  2Y2Q A;  2PYO B;  4PM5 A;  3AZK B;  1P3I B;  5EVL A;  5I94 A;  1YU4 A;  2XF3 A;  4H9S C;  3FZC A;  5FUG B;  3VFF A;  3WRZ A;  4FD8 A;  4KZ3 A;  3REL D;  4YS3 D;  2WK0 A;  2ZC7 A;  3KWQ A;  1YUE A;  3MGS A;  5HAQ A;  5FQM A;  2P74 A;  4D2O A;  4KQQ A;  5BT1 D;  5B33 B;  3WX7 A;  4DRA A;  5GLA A;  2Y2J A;  5DF7 A;  2Y2I A;  4WM9 A;  2HP5 A;  1ZLA B;  4G91 B;  4QB8 A;  4ZUX D;  1HVB A;  4BQM A;  5GSU D;  4Z66 D;  4S2M A;  3WA9 C;  4CSR B;  3X1T D;  4OJP A;  2J9O A;  2IO5 B;  3M2J A;  4WMC D;  3QNC A;  3NQJ B;  3OCN A;  2IOU A;  4KHA B;  2L5A A;  5G49 B;  4R4R A;  3REL C;  1P3G D;  1R4V A;  4OVD A;  1BFM A;  5AV6 B;  3HLW A;  2I72 A;  1P3B D;  2FFF B;  1P34 C;  1P3G B;  4Z9Q A;  4B4Z A;  2Y2O A;  2JSS A;  3EPH A;  2HIO A;  4MBF A;  2F8N A;  1ES3 A;  5JA4 B;  3AZK A;  3B0B A;  1Z6F A;  1W8Q A;  4JBF A;  5AV9 B;  3MGR A;  3LCE A;  2IWC A;  2HPB A;  3IH8 A;  4B4X A;  4DE0 A;  1P34 A;  2EFX A;  5AVC B;  4BD0 A;  1JTD A;  1MWT A;  1P3K D;  2NZD B;  3MGR C;  2NQB C;  3OPH A;  1H3O A;  4ZBJ C;  4QLC A;  1MY8 A;  1K56 A;  1P3F A;  2X71 A;  3BFD A;  2PU2 A;  3AZJ D;  5B32 G;  3A3F A;  4YS3 B;  3LJA A;  1ES2 A;  5B24 A;  5KDM B;  3ZG7 B;  3SH9 A;  5FI7 A;  3WAA B;  4OOY A;  1BSG A;  2X02 A;  4JJN C;  4PPR A;  2RCX A;  3MGP A;  5B2I B;  3W97 D;  3HLG A;  4WU8 D;  4EBL A;  1KGE A;  3FKE A;  4JJN D;  3P09 A;  5M1A A;  3KUY C;  4DXC A;  3JYI A;  1P3L A;  3AFA C;  5JYO A;  4YIN A;  3UPP A;  5EE8 A;  4BLM A;  1WYC A;  2JE5 A;  4E3N A;  3A6N D;  4OPY A;  1EI5 A;  1ZKJ A;  2ZQA A;  4KUD C;  4KGC C;  3LJA D;  3W96 B;  3WA9 D;  3AZJ A;  2H5S A;  4LV3 A;  1P3F D;  4DF6 A;  4E3M A;  5AV9 C;  3MNN D;  1BUL A;  1P3M A;  5CPI B;  1P3P D;  3W98 A;  2Z2L B;  4KZ8 A;  3LZ1 B;  4IBE A;  5B1L B;  3AZG D;  3AZI C;  2ZY5 A;  3VH6 T;  5B40 A;  2BYK B;  3FKW A;  4J8V C;  1FOF A;  1TAF A;  5DTT A;  3Q7V B;  2BLS A;  2IO5 C;  4OP8 A;  3B0C T;  4PM9 A;  4C3Q A;  5AVB D;  5B0Y A;  5FI2 A;  2Y59 A;  1S32 A;  3MKE A;  5B1L A;  4G92 B;  1W7F A;  5FQ9 A;  5GXQ A;  3LZ0 D;  5DNM C;  5AVB B;  1TZY C;  1P3I D;  1SCW A;  2OLV A;  4JPM A;  1YQS A;  5CRF A;  2Y2G A;  1P3B A;  2CV5 B;  1YLT A;  1FCO A;  3X1U A;  2ZQ7 A;  1HTA A;  1P3L C;  4XUJ A;  5BNX A;  3SS3 A;  3WTP B;  5DNN B;  3LZ1 D;  4PMA A;  5FAT A;  3BLM A;  3VP4 A;  1TZY A;  3KWQ C;  3MNN B;  4OJ5 A;  4DKI A;  4E6X A;  4QHC A;  4GDB A;  3VP1 A;  1I2S A;  4S2K A;  2NZD D;  3B6F B;  4IBI A;  3C1C C;  1AOI D;  4JXV A;  2FJ7 D;  1BLS A;  3W4O A;  3AL0 C;  4Z5T D;  1KVL A;  1NJ4 A;  5EVI A;  3UE3 A;  3REL A;  1P3A D;  3PBT A;  1YLJ A;  3B6F A;  4E3L A;  5U47 A;  3BFC A;  3MGS B;  3A3I A;  5B31 G;  3WKJ C;  4IBG A;  5A93 A;  1PI5 A;  4J8U B;  2EX8 A;  4JKT A;  4RVA A;  4NFT A;  4ZJ3 A;  3X1U B;  1ID3 D;  3LY4 A;  3OC2 A;  4YM6 C;  1P3B B;  4KZA A;  4FH2 A;  3AZJ B;  4KUD B;  5CPK A;  4E3J A;  1Q2Q A;  3GV9 A;  5AV6 C;  4GD8 A;  3TOI A;  3TU4 C;  3LEZ A;  3O86 A;  2XFT A;  4OH0 A;  1BH8 A;  3VH6 A;  2OV5 A;  2HP6 A;  3EPL A;  2WGW A;  2XFS A;  4YFM A;  2ZM2 A;  4NZ4 A;  3Q07 A;  2CWE A;  2F8N B;  1YU0 A;  3KXB D;  5GT0 B;  4J8X D;  3KXB B;  5B1L C;  4MBK A;  3KXB C;  3F6T A;  3UDF A;  3AV1 A;  4X55 A;  1BLH A;  4JXW A;  5CPI A;  3W98 B;  1M1A A;  4N1H A;  5B33 D;  1M19 A;  4JXG A;  3GRJ A;  3ITB A;  4DE2 A;  3ZVW A;  4QY5 A;  2OLU A;  3ZCZ A;  3UO9 A;  5EVI D;  3M2K A;  4OQI A;  4XZQ D;  3VP0 A;  5EUA A;  2FJ7 A;  1RGZ A;  3UT9 D;  2EX9 A;  1S6R A;  1YMX A;  3ZNT A;  3X1T B;  5E43 A;  1XA1 A;  1P3O A;  3OCL A;  5B32 D;  4WU8 C;  4LV0 A;  3C4P A;  1L2S A;  2HIO B;  1MWU A;  3G35 A;  4LV2 A;  1U60 A;  1K57 A;  3PAG A;  2V1Z A;  3MFD A;  4Z5T B;  1KDW A;  1BH8 B;  2FJ7 C;  3BYD A;  3A1I A;  1N9B A;  1B6W A;  5AV9 A;  3B6F D;  4LG2 A;  2IWB A;  1DJB A;  3ZDJ A;  3AZJ C;  3REK C;  4WYY A;  2H10 A;  3AZH C;  5AY8 B;  3N8S A;  1AOI A;  5CTN A;  2EXA A;  3LZ1 A;  3MZF A;  1YU2 A;  4UA9 A;  4ZDX A;  3RXX A;  3AZG C;  1W8Y A;  5BO0 B;  4KZ9 A;  5B0Y C;  1HTZ A;  1P3P C;  3SOI A;  1LL9 A;  1C3B A;  1P3I A;  1M18 D;  3IXH A;  1YLZ A;  4IBJ A;  2A3U A;  3X1V D;  5CHU A;  1U35 D;  5B0Y D;  5GXQ B;  5G49 A;  2QZ6 A;  4R8P C;  3B0C W;  3IHA A;  3H0R C;  3UTB C;  3P98 A;  4H9N B;  4R0Q A;  2CV5 D;  2IWD A;  1WYB A;  3IXB A;  5E5A B;  3QNB A;  1NZU A;  4IVK A;  3W99 A;  3KUY B;  3WAA A;  2RVQ D;  5BNX B;  3P5J B;  5B40 D;  3SS5 A;  4E3K A;  4YM6 B;  4XUJ D;  4P85 A;  1BT5 A;  3SS4 A;  4EQI A;  2W8S A;  1P3M D;  4OOM A;  1P34 B;  1QMF A;  1HQ3 B;  3MNN A;  3OPR A;  1M40 A;  3FWL A;  3C7U A;  2VGK A;  1Q2P A;  4S2N A;  3REH C;  3W99 C;  4JLF A;  2DNS A;  3A3J A;  5F99 A;  4RX2 A;  2P9V A;  4E6W A;  4QU3 A;  2ZM8 A;  3PBQ A;  1FSW A;  3HLD A;  3C1B D;  1K4F A;  5CPJ C;  4NZ3 A;  3MNN C;  2WKH A;  5EVI C;  3BRM A;  4UA6 A;  3IP4 C;  1P3P A;  3REJ A;  5B32 A;  3REI C;  1P3O D;  1GHM A;  3ZG9 B;  4S2P A;  1ESU A;  1XGJ A;  3REK B;  2NQB B;  3A3D A;  2ZC5 B;  1K38 A;  3AN2 A;  5B31 D;  4UA7 A;  3Q7V A;  1PWC A;  4XXR A;  5B2J B;  1ALQ A;  4HBU A;  3B0D C;  4IBK A;  5B0Z D;  1F1E A;  3WKJ A;  1P3L B;  2XD1 A;  4WZ5 A;  1TDL A;  3M6B A;  5B2I D;  1MXO A;  1TEM A;  3WTP C;  3KUY A;  4LD9 B;  3VH5 W;  3AZM D;  5HW3 A;  4A5R A;  5B2I C;  2PYO C;  2XR0 A;  3WKJ B;  2Y55 A;  1H8Y A;  3AV2 B;  1E3U D;  3SH7 A;  3IF6 B;  3LEL B;  3WS0 A;  5GLC A;  4S2O A;  5GHZ A;  3AZN A;  3BFE A;  3HVF A;  3ZVT A;  4IBF A;  4OON A;  2V2F F;  3WS2 A;  3H0L C;  1KE4 A;  4IJE A;  1MWR A;  4OLG A;  4PM6 A;  1JWP A;  2G5H C;  3NI9 A;  4QLC B;  5TFQ A;  4WU9 C;  4X6T A;  3AZE D;  1U35 C;  5CP6 A;  3REJ C;  3DW0 A;  2G2U A;  1M18 C;  1ID3 A;  2EX6 A;  3AGF A;  1FSY A;  2F8N K;  5CHL B;  1P3G A;  3AZI B;  4WU9 A;  3R45 A;  3W99 D;  4R1G A;  3NQU A;  3IT9 A;  2J8P A;  3MZE A;  1HZO A;  3G2Y A;  3GQZ A;  1IYP A;  5GSU A;  4Z66 A;  2Y4A A;  5AV6 D;  3B6G C;  3MVD A;  1IKI A;  1P3G C;  3AYW D;  3GTC A;  1CI9 A;  5F99 B;  2WUQ A;  1SDN A;  4WBG A;  3X1S B;  2XEP A;  4E44 A;  5DNN C;  4JF5 A;  4UUZ A;  2XH9 A;  2HIO C;  4EO5 C;  3HLF A;  1J9M A;  5HFO A;  5F83 A;  1TZY D;  4Z5T C;  4HEF A;  1S32 B;  3CZD A;  3VSK A;  4GHA A;  1L0G A;  5A92 A;  4OQG A;  2NZD C;  3VOZ A;  3VSL A;  2WZX A;  3W8K A;  3N8L A;  2ZMA A;  3VP2 A;  3IQA A;  5KMW A;  1XXM A;  3AZF C;  4IJF A;  2NQB A;  1NXY A;  3BEC A;  4DE3 A;  1PZR A;  2XGN A;  3C1C B;  3MGQ D;  3MVD D;  4F94 A;  3Q82 A;  4AWL B;  1GHP A;  1PYY A;  3AZN C;  4AWL C;  3KWQ D;  1FR1 A;  3N3F A;  3UTA D;  5BNV B;  1BLP A;  4G91 C;  3V3R A;  4R8P B;  3AZE C;  5IHV A;  4WU9 D;  4C6Y A;  3AZE B;  1XGI A;  1GA9 A;  2WKI A;  5L2F A;  2Y2N A;  5B33 A;  3LJA C;  4X68 A;  3MBZ A;  5FQK A;  5E5A C;  3NDE A;  3MXS A;  1M1A D;  3HLE A;  1XPB A;  1E3U A;  3HUM A;  1WE4 A;  2Y91 A;  5DNM D;  1N4O A;  3HSH A;  1M1A C;  4KGC B;  1EQZ A;  1A7W A;  5CP6 D;  5AQA A;  3G32 A;  3VOY A;  1Q9C A;  3AZE A;  5AVB C;  5F99 C;  3WA9 A;  4U0T A;  5BOH A;  3L27 A;  5B33 C;  1JVJ A;  2WAD A;  3WKJ D;  4OUI A;  5B1M A;  1KX3 B;  3E2K A;  2VQR A;  3ZNY A;  2WAE A;  3AZM C;  3IWQ A;  1MKI A;  3A6N A;  3AZM B;  3AV1 B;  1P3A C;  1ERQ A;  3ZGA B;  1ZLA C;  3AZN D;  4JF4 A;  5B31 A;  1T3U A;  2QPN A;  3UNW A;  1CEG A;  5GT0 C;  3MVD C;  3IWO A;  5CPK D;  1KU5 A;  5FA7 A;  1PIO A;  1NZO A;  4K0X A;  5C3I C;  1S0W A;  5B2J D;  4GD6 A;  1BTL A;  3REJ D;  3AZM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...