2UWXA

Active site restructuring regulates ligand recognition in class a penicillin-binding proteins
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
489
structure length
468
Chain Sequence
ISEITYSDGTVIASIDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPATTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTNQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PENICILLIN-BINDING PROTEIN 1B
publication title Active Site Restructuring Regulates Ligand Recognition in Class a Penicillin-Binding Proteins
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
total genus 149
structure length 468
sequence length 489
ec nomenclature ec 2.3.2.-:
pdb deposition date 2007-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2uwxA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2uwxA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2uwxA02
4MBHA 4LENA 1XGJA 4KZ6A 3PBOA 2ZLYA 4KG2A 2ZC6B 1HD8A 3HUNA 3W4OA 5DF8A 2X02A 1DJBA 3IF5A 5EOOA 2XK1A 3LO7A 1Z6FA 4X56A 5FQJA 4JXWA 5DF7A 4KZ5A 5EVIB 1G68A 3ITAA 4KZ7A 3G32A 4X68A 2Y2JA 2WGWB 3SH8A 3N8RA 5TR7A 2Z2LB 4E6WA 4IBXA 4R3BA 3Q07A 4WZ5C 3G35A 5GLDA 2EX6A 4QU3A 4HESA 1NXYA 2ZQAA 3MZDA 4S2PA 4S2OA 1ALQA 5CGXA 1LI0A 2X71A 1GHPA 3NIAA 3PAEA 4Y0OA 5DTTA 3SOIA 4EBPA 4EUZA 4YINA 4BL2A 1XP4A 3C7UA 3ZG7B 3B3XA 1KE3A 1Y54A 1L0EA 1W7FA 4A5RA 1IELA 4GB7A 4S2NA 1IYOA 3HREA 5GHZA 4PM5A 2WAFA 3FV7A 3WS2A 5CGSA 3M2KA 1NJ4A 1TVFA 4X6TA 4ZBEA 4UAAA 4DRTA 1FCNA 2P9VB 3DW0A 4WYYA 4JPMA 5HAIA 3VSLA 3BEBA 1IEMA 1JTDA 5A90A 3BYDA 3WS1A 4B4ZA 4QB8A 2G2WA 1ZG6A 1ERQA 1I2WA 1TDLA 3HBRA 3P09A 4OQHA 4GD8A 1BUEA 3IWIA 3RJUA 3PBRA 4PM9A 1MWRA 4JBFA 4KG6A 2R9XA 3IHBA 2XQZA 5E2FA 4PMAA 2Y91A 4MEZA 4ZAMA 1CK3A 1K38A 5FAQA 1K57C 1K56A 2PBYA 4K0XA 3VSKA 3ZGAB 5HAPA 4QJGA 1WE4A 5CXWA 3TOIA 1I2SA 3BFEA 3UDFA 5CTNA 4Z9QA 5FI6A 1XXMA 2H0YA 3WS5A 1J9MA 3M6HA 4KZ3A 1E3UA 1IYPA 4OQ0A 5FI7A 2IWCA 3MZEA 4GDBA 3VP3A 2HDUA 3JYIA 4IVIA 2ZC4B 1IYSA 3G4PA 5EVLA 3UO9A 5FI2A 4KZ4A 4GZBA 4U0XA 2HDRA 1PW1A 4B88A 2Y2GA 5A93A 2DNSA 2HPBA 3HLFA 4B4XA 3FWLA 4ZJ2A 1BLHA 3ZG8B 1YLYA 3IH8A 1KDWA 5GL9A 1XPBA 3Q7ZA 1NRFA 3A3IA 3BECA 3NI9A 3O3VA 5M19A 1YMSA 2RL3A 4E3JA 2OLVA 1K4EA 4X53A 4OQGA 5F83A 1FSYA 4U0TA 1YLJA 4CJNA 2IWDA 3ZVTA 2GDNA 4OONA 2I72A 2EFXA 4FSFA 5HARA 1FCOA 3A3EA 5EVIC 3W4QA 2EX9A 1KGFA 3BLSA 4X55A 4WMCA 1BULA 4E3KA 2Z2MB 2FFFB 4FH4A 1H8ZA 1LL5A 2WGIA 1L0FA 3V50A 5JYOA 4E3IA 1PWDA 2EXAA 4QHCA 4BL3A 1LL9A 5TFQA 4IBRA 3MZFA 3BFGA 5CERA 3NCKA 1FCMA 2ZMAA 3OPPA 3P98A 3C4PA 4OH0A 1ONHA 3Q7VA 2J9PA 4OP5A 1GA0A 1U60A 4P87A 3OPLA 4S2MA 3LY4A 1ONGA 2Y2KA 4C3QA 1ES3A 3OPHA 3G2YA 4ID4A 2EXBA 1BSGA 3V39A 1W5DA 5GLBA 5FASA 2WZXA 2V20A 5CHMA 3DWKA 2OV5A 3UE3A 3VP2A 4PM7A 5EVIA 3GV9A 4U3TA 1PZPA 1JWVA 3MXRA 4OLDA 3OCLA 4HBUA 5FQ9A 3IXHA 3FYZA 1EROA 1MWTA 1PWCA 3LY3A 5F1GA 3UPNA 1HVBA 1NZOA 3I7JA 3ZG9B 1WYCA 4P0MA 3ZG0A 5HL1A 5FSRA 5EPHA 4MNRA 3V3RA 1K55C 5M1AA 1ZKJA 5J8XA 4EBNA 3VOZA 3IXDA 2FFYA 1SDEA 4KENB 3W4PA 5KSCA 3IF6A 4BQMA 1PYYA 3NDEA 4MBFA 5EE8A 1SKFA 1MWUA 1KE4A 1WYBA 4R23A 4EBLA 4OOLA 3IQAA 1W79A 5FQIA 2PU4A 3MFDA 3UNWA 1NZUA 1RP5A 3HLBA 2XFSA 4GOGA 2WADA 1CEFA 1DJCA 2XD1A 3ITBA 3NBLA 3ZHHA 1N9BA 5DVAA 5FA7A 1FR1A 3GRJA 4QY5A 5FDHA 3UN7A 4S2IA 4E3MA 5I94A 5EUAA 1IKIA 3LCEA 3ZNYA 2ZQCA 2PU2A 4DXCA 3HLCA 4XUXA 3BFDA 3SH9A 1KGGA 3HLEA 3HLDA 4WM9A 2ZC3B 4RX3A 2IWBA 2Y2IA 1LLBA 4KZAA 1XGIA 3A3FA 4LV2A 4WZ5A 4Y7PA 2EX8A 2Y2HA 1O07A 3WS4A 1FR6A 1M6KA 4DE0A 3GMWA 3HLWA 2E8IA 1MXOA 5KZHA 1BLSA 4RA7A 1H5XA 2WGVA 4KG5A 4UA9A 1K56D 5A91A 2P74A 2JCHA 3GVBA 4WEJA 4BD0A 3MKEA 4Q8IA 3LEZA 2G2UA 4RX2A 3PBQA 4DE1A 3QNCA 3VFHA 3Q82A 4KQRA 2HP6A 5KMWA 3UPOA 5M18A 3ZFZA 5KSHA 3VMAA 3O86A 1E3UD 4OLGA 1K25A 4PPRA 2V1ZA 2DCFA 1S0WA 3Q1FA 2Y2NA 4JF4A 4JXVA 1ES2A 2J7VA 2Y59A 5CHJA 5HX9A 3M6BA 1PZOA 4JXGA 1K54C 3OC2A 4F94A 1N4OA 1FQGA 2XR0A 1YQSA 3D4FA 1FSWA 3UDIA 3IH9A 1K57A 4GDNA 3UE0A 5FAOA 3RXWA 1MWSA 2ZQ8A 2HDSA 1CI9A 1SHVA 2R9WA 4WZ4A 5D3OA 3S4XA 4L0LA 4R4SA 3WS0A 2ZD8A 4Y0UA 3ZVWA 3ZDJA 2JBFA 4KZ9A 2XH9A 3DWZA 3UPPA 1SCWA 2C6WB 1GCEA 1EI5A 5HFOA 1XA7A 4KQQA 1MBLA 1NY0A 2WZZA 4R4RA 4WMCD 4XXRA 4KZ8A 3W8KA 1BZAA 4FD8A 2VGJA 3VOYA 3ISGA 2ZJ9A 3NDGA 1JVJA 1Q2PA 2CC1A 3C4OA 4CPKA 3HUMA 5E2HA 4E3LA 4BLMA 3HL9A 4LV1A 4MBKA 1L0GA 1QMFA 4ZDXA 1GHMA 3S1YA 4ZJ1A 1O7EA 1TDGA 3WRTA 4DE3A 5HW3A 2ZM0A 5E2GA 2EX2A 2DRWA 5EOEA 5CGWA 2C5WB 4E6XA 3A3JA 4JXSA 2Y2PA 1YLTA 1SDNA 3HUOA 3OZHA 2XF3A 4NETA 3IWQA 1KVMA 3TG9A 5JYPA 1L0DA 1IKGA 1G6AA 3MBZA 5EVID 1MY8A 2QMIA 4DDSA 3PBSA 4UA7A 2WKIA 4QY6A 2WGWA 5HAQA 4ZJ3A 1BLPA 4GN2A 1MPLA 4E3NA 1KVLA 5EECA 3BFFA 3O87A 3V5MA 5L2FA 3A3DA 2Q9NA 3E2KA 2HP9A 5F1FA 3BRMA 2WK0A 5DTSA 5FQKA 4X69A 2H10A 4LCLA 1JWPA 3BLMA 3IXGA 4JLFA 4DDYA 3Q7VB 4OKPA 2H5SA 1PIOA 3E2LA 4N9KA 3ZG5A 3FKVA 3PAGA 2Y2LA 1DY6A 1GHIA 4NK3A 3HVFA 5FAPA 1ERMA 4DE2A 4S2NC 3WWXA 3PBTA 4IEDA 3AGDA 4C6YA 4EV4A 3AGFA 2P9VA 2Y55A 1HTZA 3CJMA 3FKWA 3S22A 1K6SA 1ES4A 4LCMA 2Y2MA 5AQAA 3M2JA 4C75A 4WEKA 3ZNTA 5GLAA 3NC8A 2HP5A 3UY6A 4RYEA 4UA6A 1PW8A 2ZQ7A 4UHUA 5F82A 5FATA 3TSGA 3RXXA 3NY4A 3OPRA 3VFFA 1K55A 5FQQA 1E25A 1GA9A 1YLWA 1YT4A 2WKEA 2XGNA 1XA1A 4JKTA 3QHYA 4P6BA 1NYMA 2XLNA 5TGFA 1CI8A 3UE1A 1M40A 3IF6B 1YLPA 4BENA 2V2FF 1XKZA 2XFTA 3CZDA 2WYXA 1E4DA 5GLCA 3G30A 1YLZA 3MKFA 4OPRA 3SH7A 2WUQA 4O7DA 5CEBA 3ZCZA 4LV0A 4OVDA 3VP1A 3IT9A 4PM8A 4OPZA 3V3SA 1PI4A 2QZ6A 3IWOA 1ZC2A 3IHAA 5AQ9A 3WRZA 2JC7A 1ESUA 4IVKA 1HZOA 4N1XA 1LI9A 5CRFA 4R3JA 4MLLA 5FQMA 1YM1A 2B5RA 3HLGA 4FH2A 2EFUA 4GKUA 4ZTKA 4OPQA 3OCNA 5U47A 5CECA 4LV3A 3VP0A 4BJPA 3EQUA 1S6RA 1VQQA 4N1HA 4Y0TA 1W8YA 3FZCA 4GD6A 5CTMA 1DJAA 3C7VA 2X01A 4OP8A 2QPNA 4JF6A 4P85A 4KQOA 1JTGA 4WELA 4EWFA 2XEPA 1EWZA 1RGZA 1L2SA 2XDMA 2ZM2A 3BM6A 3UDXA 4HBTA 2Q9MA 1AXBA 4XUZA 5BOHA 4QD4A 2WKHA 3GSGA 3N4IA 4N9LA 3MXSA 2XD5A 5IHVA 2BG1A 4R0QA 4S2KA 3PTEA 1TEMA 2Y4AA 1JWZA 5E2EA 1PI5A 2ZC7A 1KDSA 3BFCA 4FCFA 4BD1A 3N8SA 1OMEA 3SS4A 3SS5A 4R1GA 1I5QA 2A49A 4OPYA 1VM1A 1W8QA 3C5AA 4EQIA 2JE5A 3CG5A 1XX2A 5E43A 3N7WA 1NYYA 5AQBA 4YFMA 1ES5A 4RVAA 1RCJA 3CMZA 2J9OA 1YMXA 1ZG4A 4KZBA 4OOMA 4OQIA 1K54A 3GTCA 4WBGA 1IYQA 3QNBA 4JF5A 5DF9A 1K4FA 1K6RA 4DKIA 5A92A 1KE0A 1BTLA 1CEGA 3EQVA 3SS3A 4DXBA 2A3UA 1ESIA 2OSUA 4K0WA 5GHXA 3GQZA 5CEDA 1RGYA 2ZC5B 5CHUA 2ZQ9A 3G34A 3Q81A 1LHYA 4GNUA 5DTKA 5G18A 2Y2QA 4PM6A 2WAEA 2VGKA 1QMEA 3GR2A 4D2OA 3VP4A 3AGEA 1PWGA 5AQ7A 3IXBA 2RCXA 2ZQDA 4N92A 1H8YA 3N6IA 3G2ZA 1MKIA 2HDQA 4DF6A 3PBNA 3DTMA 1BT5A 2BLSA 1KGEA 2H0TA 2J8YA 3G31A 4OOYA 4S2LA 2ZM8A 4S2JA 4HEFA 2OLUA 1C3BA 1FOFA 3O88A 2Y2OA 3IF6C 4K91A 4E3OA 3N8LA 1BLCA 5GHYA 2UWXA 4M3KA 4H8RA 1Q2QA
chains in the Genus database with same CATH superfamily
4MBHA 1XGJA 4KZ6A 4UQIS 3A0VA 3HUNA 3KYZA 2HUEB 5DF8A 1JFIA 1P3AC 3LO7A 3L2AA 1P34D 1P3GC 4JXWA 3W98D 2FN2A 3S7QA 3C1BA 4KZ7A 5F69A 3G32A 3C1BD 3WA9B 2OOLA 2HF6A 4IBXA 3KS4A 2V0UA 1AWIA 4ZBJC 4S2OA 5CGXA 2QYBA 1GHPA 3NIAA 3SOIA 4R8PB 4EUZA 3C7UA 1KX4D 3AFAB 2JN7A 1Y54A 3O62B 4A5RA 4GB7A 3UE6A 4YM6A 4IBJA 4OJPA 5F99D 4F3LB 4PM5A 1NJ4A 1TVFA 2D02A 4UAAA 4DRTA 1FCNA 2P9VB 5JRGA 1ED7A 3BEBA 1IEMA 3BYDA 1F1EA 2G2WA 1ZG6A 1I2WA 1TDLA 3P09A 3RELC 4OQHA 4GD8A 2NQBD 1BUEA 3RJUA 1HLUP 4PM9A 4MN5A 4KG6A 3H0MC 5IU1A 4J8WD 4PMAA 4MEZA 5CPJD 2VZWA 3CPTB 2PBYA 3VSKA 2V9AA 2OWHA 5HAPA 3EOIA 4J8UC 1P3OC 5CTNA 5B32D 3LIDA 1OTAA 3MGSD 4JJNC 1E3UA 4OQ0A 2HDUA 2VV7A 4IVIA 2ZC4B 2M7UA 2B18A 3WTPE 2HDRA 2Y8HA 1ID3A 4Z66A 1ID3D 4B88A 2P7JA 5A93A 3X1VA 3AZLA 3LZ0C 4J8VB 2I9VA 1UGUA 1YLYA 2XSSA 3IH8A 4D60A 1XPBA 1GSXA 5B24A 3AZJC 3VH6T 1X0OA 2OLVA 4J8XD 2AROB 5C3IC 1W1PA 1FSYA 4H9OA 4NFTA 4H9RB 2IWDA 1B6WA 4OONA 2A2LA 3C8CA 3T4LA 5HARA 1M1AA 5EVIC 4X55A 5AVBA 3HONA 2CV5B 1BULA 2J80A 2FFFB 1M19C 5B0YA 5C5KA 3AZMA 4HMCA 3AZMD 4XZQA 3BFGA 3IS2A 4XZQD 3NCKA 2ZMAA 3QP1A 3UB6A 5L09A 2NZDA 1G6OA 1YU0A 1GA0A 5B1LA 4S2MA 3OPLA 4C3QA 3LY4A 1ES3A 3OPHA 2J8PA 3FG8A 2V20A 2OV5A 3WTPB 1P3LD 4M6BA 1JWVA 3DTEA 4HBUA 3LIFA 2A24A 1AOIB 3F1PB 1NZOA 3LICA 3I7JA 5GXQB 5FSRA 2V1BA 3EPHA 5MC7A 2FFYA 1NWZA 3IF6A 4BQMA 4MBFA 3MNNA 1MWUA 4R23A 2J3TC 3S7NA 5FQIA 3C2WA 2PU4A 3MFDA 5HZHA 3WAAB 3BY9A 2CMNA 3NBLA 3DAVA 3ZHHA 1XJ2A 3DTKA 1FR1A 4MB3A 3KXBB 3GRJA 1ZLAD 4H6JB 4EO5B 3UN7A 4CLCE 2BYKB 1IKIA 2ZQCA 3HLCA 4XUXA 3X1SA 2ZC3B 3F1OB 3X1SD 4GJ4A 2IWBA 4YS3C 2Y2IA 3REJB 3KUYD 3A3FA 1T1BA 4LV2A 4WZ5A 2EX8A 3W99B 4QLCD 3WS4A 3MGRC 2E8IA 3V9RB 1MXOA 5BS7A 2WGVA 1K56D 4BD0A 1Y4OA 3B6GC 4RX2A 2YKFA 4DE1A 3VFHA 4WU9C 1U35A 4X23D 5B31G 3UB9A 5AVCD 1K25A 1UWPX 4BBTA 5FUGA 3REKB 3AZHA 3Q1FA 5B2JC 2Y2NA 4NE5A 4JF4A 1F66C 2Y59A 4Y17A 2VJWA 2PRFA 4P6ZM 2BYMA 5L07A 3TJZC 3UTBD 1ULYA 3OC2A 1N4OA 3UDIA 4WU8A 1F2KA 2W1TB 4GDNA 1S32A 3WKJA 3P7NA 1S32D 4MB5A 2V8CA 1OTEA 3RXWA 1CI9A 3S4XA 4L0LA 4G92C 4CLCB 4GS9A 4ZUXB 1KX5A 3WS0A 1KX5D 4GW9A 5B2IB 3UPPA 1SCWA 3SZTA 1EI5A 4KUKA 5HFOA 4Z5TD 4UPKA 4I3AA 1NY0A 4WMCD 3W8KA 3HSHA 1BZAA 2VGJA 3G6OA 2ZJ9A 3VH5T 3KX0X 5AV5C 4NG2A 1JVJA 3MQQA 1YU2A 2IO5B 5AJGA 4CAYB 5TBMB 4MBKA 5BT1D 4ZDXA 1GHMA 1KX3D 3S1YA 4ZJ1A 1O7EA 3WRTA 4ZRRA 2ZY2A 2DRWA 4E6XA 1YLTA 1KVMA 5JYPA 3MBZA 4MN7A 3PBSA 3C1BC 4UA7A 3WA9A 5HAQA 3WA9D 2QJ7A 4H9QB 5L2FA 4L9EA 5F1FA 3BRMA 5FQKA 2RIQA 2O0YA 4LCLA 4R8PA 4JLFA 4XT2B 4UEYA 1EW0A 2H5SA 3AFAA 3MQOA 3AZFB 3ZG5A 2Y2LA 5B0ZB 3O62A 1ERMA 5B32G 3NULA 4DE2A 1M18B 3AN2B 5DKKA 4F3LA 4WL9A 2YFWB 3W2ZA 4YM6C 4IEDA 3N3FA 4EV4A 2P9VA 1HTZA 3CHWP 5IS1A 4HP4A 1HQ3B 1ES4A 5JRGC 5AQAA 4WEKA 3CLOA 3NQJB 4Q0HA 1E6RA 1P3GD 2JKTI 5F82A 4HNBA 2IA2A 3RXXA 3NY4A 3LELB 2HV1A 5FQQA 1GA9A 1YLWA 3CPTA 2WKEA 2XGNA 4JKTA 2XLNA 3E98A 5AV8B 1YLPA 4BENA 3CZDA 4NE3A 5CEBA 2GX5A 3G30A 3MKFA 2P04A 4O7DA 1P3BB 2QZ6A 3T1QB 4IBCA 3IHAA 5G4ZA 1ID3C 4Z66C 2B95A 1TD5A 3X1VC 3B0CT 4J8VA 3AZLC 5CECA 4LV3A 4IJEA 4BJPA 4Y0TA 5B24C 1VQQA 4X25A 3FZCA 4GD6A 2AROA 1DJAA 3C7VA 4OP8A 2QPNA 2ZOHA 3RELD 4EWFA 3D3OA 4H9RA 2XDMA 2ZM2A 4HBTA 5AV6B 2Q9MA 1GPFA 4FOFA 2WKHA 3GSGA 1P3KB 4J8UD 1P3OD 3MXSA 5IHVA 2CV5A 3PTEA 2Y4AA 3UT9B 3BFCA 4FCFA 3N8SA 5B0YC 3SS4A 5GT0B 3AZMC 4XZQC 2HJEA 1TZYB 4OPYA 4EQIA 3LGOA 2NZDC 1T1AA 5AQBA 1E6PA 5DJTA 2F8NG 5B1LC 1T18A 4ARZB 4MB4A 1K54A 3UB5P 1IYQA 3QNBA 4WJ3C 4JF5A 3RH8B 4DKIA 5A92A 1KE0A 3WTPA 4DXBA 4K0WA 3WTPD 1ESIA 4CSRB 2F8NH 5CHUA 2ZQ9A 4GNUA 5KDMB 4PM6A 2VGKA 1AOIA 3F1PA 3OBFA 3IXBA 1YU1A 3MQLA 2DMWA 1P3PB 5GXQA 2K31A 3DTMA 1BT5A 2H0TA 1KGEA 4HEFA 1OPXA 1M19D 3OOVA 2V1AA 5HDDA 4YOFA 3IF6C 1P3MB 4NY2A 3WAAA 3LZ1B 4NXGA 1LSXA 2ZC6B 4JGPA 1HD8A 3EPLA 3W4OA 3KXBA 4H6JA 3HCYA 2XK1A 3AL0C 1OTBA 4X56A 4FUWA 2BYKA 4G3WA 4LD9B 1G68A 1N1JB 3F1OA 3ITAA 1W1VA 3X1SC 3REJA 2ZMFA 4AFIA 3N8RA 3REJD 4E6WA 4LRZE 2A24B 3AYWB 4WZ5C 4HJ3A 3R7WB 3W99A 3KWQB 2OWJA 3E4PA 3L28A 4S2PA 3V9RA 1ALQA 2X71A 1Q9CA 3PAEA 5BS7C 4Q0JA 5DTTA 1CJFA 1WWSA 4OJLA 1A0KA 4AWLB 3B3XA 1KE3A 3MNNB 2NUPC 1U35C 1B67A 5GHZA 3FV7A 3WS2A 3M2KA 4H9NA 4X6TA 4ZBEA 1V9ZA 3AV2A 3REHB 2ZMVA 4JPMA 3REKA 4KUDB 3AZHC 1JTDA 5GT3B 3WS1A 5CP6B 1P3IB 3HBRA 3VE4A 2L5AA 4JGOA 2V8FA 1E8BA 1MWRA 3ULFA 3JPUA 3V67A 3EPJA 2W1TA 4WU8C 3VH5W 1CK3A 1K38A 5GSUB 4PKYA 4Q0IA 1S32C 3WKJC 3A6NA 1I2SA 3BFEA 3UDFA 5J4EA 4CLCA 4I3IA 4CLCD 4ZUXD 1KX5C 3MMHA 4NEED 5B2IA 3M7PA 4G91C 3WS5A 3M6HA 5HWWA 4EQ1A 5CPKB 2HZ5A 3KSIA 4HMEA 4NXBA 1IYSA 5EVLA 3KSHA 5FI2A 4U0XA 4GZBA 4WU9D 3W96B 3NOUC 3HLFA 4HJ4A 3PYPA 4ZJ2A 1BLHA 1T3UA 4CAYA 5TBMA 3LJAB 5B2JD 5BT1C 3A3IA 3LUQA 1YMSA 2RL3A 5AV9D 3MVDB 5F83A 2HUEC 2QWSA 4Z2JA 1DP8A 2EFXA 4P6ZS 4XUJB 3W4QA 1SKOB 3WA9C 4Y3IA 4NYYA 2Z2MB 3A1IA 5DNMB 1H8ZA 1LL5A 1L0FA 3V50A 4H9QA 4E3IA 1PWDA 4BL3A 1LL9A 4IJFA 5CERA 1FCMA 3T12B 4XT2A 4R8PC 2J9PA 4OP5A 1ZTUA 3AZFA 1ONGA 3AFAC 5AV5D 5G4YA 5B0ZA 4ID4A 4B9OA 1BSGA 3NOTC 3O62C 1M18A 3AN2A 4PAUA 2YFWA 3AN2D 1W5DA 2W0NA 5FASA 4NZ5A 2WZXA 3DWKA 3VP2A 1PRQA 1HQ3A 3GDIA 3K3DA 1PZPA 3FC7A 5B1MB 4L9GA 3QP4A 4OLDA 3NQJA 3A0RA 5B33B 3KSFA 3T4JA 3UPNA 3IX3A 4II7A 3LELA 1Z09A 1ZKJA 4LLOB 4EBNA 5KSCA 3JVUA 5AV8A 3NDEA 5EE8A 5AV8D 1KE4A 1H8PA 2YFVB 3IQAA 1W79A 1NZUA 2W27A 2WADA 2XD1A 1P3BA 3T4OA 1N9BA 1P3BD 4WNNB 2JKTM 2PYOB 1AIWA 4LGWA 4YM6D 1CF0A 4TX8A 3ZNYA 3NQUB 4J8VC 3BFDA 3B0BA 5JRGD 1KGGA 3HLEA 2GJ3A 3AZNB 4EW7A 1LLBA 3IX4A 4KZAA 1TS0A 1CQAA 2AROC 4Y7PA 2Y2HA 1O07A 2YKHA 4Z2MG 4DE0A 1PZRA 4EU0A 5KZHA 5AV6A 1TS7A 1H5XA 4KG5A 4DRAA 5A91A 3GVBA 2JCHA 3EGXC 4WEJA 1P3KA 4Q8IA 1P3KD 1GSVA 1BH8B 3PBQA 2CV5C 3UT9A 4HI4A 2V0WA 3UPOA 5M18A 3MS6A 5GT0A 5GT0D 3O86A 1E3UD 1TZYA 4PPRA 1TZYD 4E04A 2PAVP 4Z66D 4JXVA 3LIAA 2J7VA 4X1LA 5HX9A 4DJ3A 1PZOA 4ARZA 3X1VD 3AZLD 1KS0A 1K54C 3D4FA 1FSWA 3R4KA 5B24D 2W1RA 3IH9A 1K57A 1BYWA 3WTPC 3AZEB 4CSRA 2ZQ8A 2HDSA 2R9WA 5KDMA 1STZA 2ZD8A 4Y0UA 1AOIC 3ZVWA 5F5YA 3UB8A 2JBFA 4KZ9A 2XH9A 4KQDA 1M1AD 1P3PA 1P3PD 5GXQC 5AVBD 4R4RA 2WZZA 4XXRA 3KS8A 5DFYA 4KZ8A 3D72A 4FD8A 5EM0A 3RFBA 3ISGA 3AZIB 2E8JA 5B0YD 2CC1A 5AY8B 4CPKA 2Z6DA 1P3MA 3HUMA 2NZDD 3HL9A 4LV1A 1QMFA 3LZ1A 3WAAC 4ME4A 3LZ1D 1Y28A 2V5OA 5B1LD 5E2GA 3C1CB 2HGVA 4BMWA 3R45B 3X1UB 5HL6A 2CWEA 1SDNA 4EO5C 3HUOA 2XF3A 3IWQA 1L0DA 4LD9A 1G6AA 3TE8A 1N1JA 2QMIA 5B40B 4EETB 3REJC 4WLAA 3MGQB 3AYWA 1KVLA 1IFQA 2GZAA 3R7WA 3KWQA 1LSWA 2W3HA 3A3DA 3W99C 3E2KA 2H28A 4H9PB 2ZBBA 1W1TA 3LR4A 3Q7VB 4N9KA 3UTAB 1F5MA 1GHIA 3MNND 5FAPA 3BQAA 4ETZA 3PBTA 2W3GA 3AGFA 3REHA 4KUDA 3REKC 3ZNTA 5GLAA 5GT3A 4WN5A 3UY6A 4RYEA 5CP6A 1P3IA 2VK3A 2M7VA 3REIB 4R3AA 4EUVA 2G5IC 4JGQA 3VFFA 1E25A 5GSUA 3X1TB 1CI8A 3UE1A 1M40A 4Z2KA 4CLCC 4ZUXC 1XKZA 1J3WA 3SH7A 5B2IC 5F6AA 1F98A 5CPKA 4LV0A 3W97B 3IT9A 3V3SA 4OJ6A 4Z2GA 2PR6A 3W96A 3IWOA 3WRZA 5AQ9A 1U35D 2JC7A 3AV1B 1HZOA 1LI9A 5CRFA 4R3JA 1PDCA 4H9NB 5IT5A 3HLGA 3AV2B 4FH2A 4GKUA 3LJAA 2IO5C 5U47A 3LJAD 3AZHD 4HJ6A 4O01A 3EWKA 4N1HA 3MVDA 5AV9C 3MVDD 2X01A 2W3FA 4P85A 1D1JA 4KQOA 2XEPA 2NUTC 4I38A 3BM6A 4WU8D 4XUJA 4L9FA 4GH9A 3MJQA 1SKOA 3WKJD 3A6NB 3O5YA 4JGRA 3VH6A 3N4IA 4N9LA 4QWOA 2BG1A 4R0QA 1TEMA 3EEHA 3T4SA 5DNMA 5EV0A 1PI5A 2ZC7A 1KDSA 4WV4B 3B0DB 3SS5A 3T50A 1I5QA 1R4VA 1YU4A 3LYXA 4NXFA 5FL3A 3CG5A 5EM1A 4YS3B 2EWWA 4BBUA 2FJ7B 1RCJA 3CWFA 5LBRA 3AZFC 5B0ZC 1M18C 3AN2C 4WZSB 1K6RA 3SS3A 3EQVA 1HQ3C 5CPIB 5B1MA 1LSVA 3VE3A 3B6GB 1S4RA 2ACGA 5DTKA 5B33A 1QMEA 3AGEA 2RCXA 2ZQDA 1H0MA 3G2ZA 1MKIA 4DF6A 3PBNA 3LELC 4B93A 4ETXA 2OLUA 1FOFA 3UMDA 4K91A 5AV8C 2YFVA 4Y2FA 3T4QA 4H8RA 3BLMA 4HOIA 1UR8A 4LENA 4R8PD 4NZ3A 2XRNA 3AZKB 3AFAD 1P3BC 2IOUA 3B6FB 4WNNA 1H3OB 5HPFA 5J7EA 2X02A 5L10A 3O62D 3EPKA 2PYOA 3IF5A 5B31B 5E5AB 5DF7A 3NQUA 4KZ5A 2GNXA 3QP6A 4HH2A 4X68A 3AZNA 2WGWB 2VX8A 5HDSA 3CUEA 5TR7A 3SH8A 3VOLA 2Z2LB 3Q07A 1NRJA 5DNNB 2EX6A 4QU3A 1NXYA 3MZDA 1BFMA 1N9NA 1LI0A 2ZY4A 5AV6C 2VV8A 4Y0OA 4BL2A 1CXWA 1P3KC 1BH8A 4R70A 3ZG7B 3UT9C 3VH6W 3L26A 1W7FA 1IYOA 3HREA 5HD3A 1P34B 2WAFA 5GT0C 1D7EA 5CGSA 3RTYA 3W98B 3E4OA 1TZYC 3P5JB 3DW0A 4WYYA 5HAIA 1E6NA 3VSLA 1CK7A 4IBBA 5A90A 4MDZA 3B33A 4B4ZA 5BPVA 4J8VD 2FZ0A 4DN0A 3PBRA 2R9XA 5G49B 5E2FA 5FEFA 3IX8A 4ZAMA 3QP8A 3AZEA 1K57C 3BY8A 4K0XA 2AROD 3MR0A 4QJGA 1WE4A 1KX4B 3TOIA 4EESA 5FI6A 2H0YA 5F99B 1J9MA 1M1AC 5FI7A 4CQHA 3MZEA 4GDBA 3JYIA 1P3PC 3G4PA 3P01A 5AVBC 4KZ4A 2CV5D 1PW1A 2Y2GA 3AZIA 2LB5A 3LIEA 4HQAA 4B4XA 5AY8A 2NQBB 1P3FB 1KDWA 1P3MC 3Q7ZA 4Z2LA 1NRFA 4J8WB 3O3VA 5M19A 3LZ1C 4E3JA 5CPJB 1K4EA 4EERA 4X53A 4OQGA 3C1CA 2QKPA 3R45A 4U0TA 3L29A 1YLJA 3X1UA 3VH5A 2GDNA 5B32B 1H8MA 2MJ6A 4FSFA 3MGSB 4JJNA 1FCOA 4LD9C 5B40A 2EX9A 3SW1A 1KGFA 1YAXA 3KYEA 1H0GA 3A1KA 3MGQA 3C38A 4FH4A 3AYWC 3GECA 5CHLB 1AOID 1XFNA 3KWQC 3L27A 4IBRA 5GXQD 4H9PA 2PYRA 1ONHA 2KOIA 3Q7VA 3WD2A 1FIKA 4J8XB 3UTAA 2Y2KA 3LI9A 5EFWA 1YUEA 4AWLC 3G2YA 3MNNC 2KDKA 4E45A 2HIOB 5CHMA 3WAAD 2W3EA 5EVIA 3GV9A 3REHC 4U3TA 2VGLM 3MXRA 5L8MA 3KXBD 3OCLA 5FQ9A 4KHAB 2EA9A 3IXHA 5GT3C 3FYZA 2RVQC 1EROA 3REIA 5CP6C 1MWTA 1P3IC 1PWCA 3LY3A 3REID 1P97A 2OAP1 5F1GA 2XROA 4G3KA 3ZG9B 4KUOA 3T1SA 5K5BA 4P0MA 2EWVA 3ZG0A 1YU3A 3F1NB 3X1TA 5J8XA 4IBIA 3VOZA 4Y15A 3IXDA 4KENB 1SDEA 2ZL1B 3W99D 1PYYA 4EBLA 3CI6A 4OOLA 3FDDA 3H0RC 1RP5A 3HLBA 3W97A 3B42A 1CEFA 3W97D 2L0WA 2ZM5A 1P3LB 1P9RA 5FA7A 3W96C 5DKLA 3AV1A 3MGPB 3L7HA 4S2IA 4E3MA 5EUAA 2PU2A 3SH9A 3AV2D 3REKD 4WM9A 3LJAC 4H9SA 3MVDC 1F9IA 4HH3A 1N9LA 2F8NB 2F2AC 1VB6A 1FR6A 5DFXA 2M1CA 4RA7A 4XUJC 2P74A 3A6ND 2G2UA 3QNCA 3Q82A 5HSQA 4KQRA 5DNMC 1OTIA 1ZLAB 2HP6A 5KMWA 4Z2HA 5B2ID 5KSHA 3VMAA 4OLGA 1OJ5A 2V1ZA 2DCFA 1S0WA 2QHKA 4YS3A 1YKDA 3KUYB 2FJ7A 1ES2A 4HMDA 4JXGA 4QLCB 4F94A 1FQGA 3BJNA 4Y5FA 2INWA 5CPIA 3UE0A 3TU4B 5FAOA 3B6GA 5B1MC 1MWSA 3AZGB 4DMZA 1SHVA 4WZ4A 5D3OA 4X23B 5B33C 2VA0A 3DWZA 5AVCB 3FKEA 1XA7A 4KQQA 3B47A 5JA4B 1LT0A 2O9AA 3NDGA 1Q2PA 3C4OA 3UTBB 4OJ5A 4BLMA 1W2EA 4O0PA 3AZKA 3IBJA 5HW3A 3AZFD 3B6FA 1H3OA 5B0ZD 2PYOC 2Y2PA 1M18D 2RTSA 5B31A 3U2AA 5E5AA 3TG9A 3S7OA 1HQ3D 2PHYA 5BO0B 3AZNC 2WKIA 4Z5TB 2WGWA 4ZJ3A 1BLPA 3CUEC 4E3NA 3CITA 4IBFA 2PT7A 3BFFA 3O87A 3V5MA 1S66L 5DNNA 2HP9A 4X69A 3LELD 1YSPA 3EG5B 1JWPA 3IXGA 3B0CW 4NE6A 1KX3B 4OKPA 4KGCB 2OAQ1 3FKVA 3PAGA 1PFLA 4NK3A 1XJ4A 4HHDA 4X1MA 3WWXA 1P34A 3AGDA 3W98A 2Y55A 3CJMA 3FKWA 1NLZA 3S22A 1P9WA 1K6SA 1V9YA 4LCMA 2Y2MA 4GHAA 3M2JA 1EQZB 3HJIA 3NC8A 1ODVA 2HP5A 3LEQA 3LFVA 4DJ2A 4GLQA 3MXQA 4HGAB 3TSGA 5G49A 3OPRA 1GXDA 1K55A 1L6JA 3AZEC 3T4TA 1XA1A 4P6BA 1KX4A 5TGFA 2D01A 3KFUG 4IBEA 1W63Q 5F99A 2WYXA 5AV6D 1E4DA 3H82A 1YLZA 4OPRA 1TS8A 3JVVA 4IUHA 3ZCZA 5FEGA 3WD1A 4OVDA 2L4RA 4PM8A 4OPZA 4M4XA 1PI4A 3UT9D 1ESUA 1P0ZA 4IVKA 4Z2MH 1P3AB 4N1XA 3AZIC 1FILA 1P3GB 2G5HC 1YM1A 2B5RA 2NQBA 5AY8C 1P3FA 2EFUA 4ZTKA 3NHQA 1P3FD 3OCNA 4J8WA 1N9OA 1UWNX 3VP0A 3EQUA 5CPJA 3EGDC 4BWIA 1PNEA 3C1CC 3X1UC 1EWZA 1RGZA 4ZBJB 5B32A 3UDXA 3MGSA 4GHLA 4XUZA 4GCZA 4MCWA 5B40C 4QD4A 4RQ9A 3DTIA 1K0KA 1JWZA 3MGQC 5E2EA 4BD1A 4NYUA 1OMEA 1W8QA 3S7PA 2JE5A 3MQ0A 3WD3A 1XJ6A 3H9WA 2XA7M 1ES5A 4RVAA 4J8XA 4UUZB 4R38A 2J9OA 3UTAC 1ZG4A 3NECA 4KZBA 3RELB 4OQIA 2HIOA 1P3MD 2HIOD 2JKRI 1K4FA 2B02A 3F6TA 1KU5A 1BTLA 1CEGA 1YSQA 3MF0A 5GHXA 4J8UB 1P3OB 1RGYA 2O9CA 3KXBC 4KHAA 3G34A 3EEAA 1LHYA 1IOUA 5G18A 3LR3A 3REIC 2WAEA 3GR2A 4LG2A 3VP4A 1PWGA 3HJKA 4JJNB 4LD9D 5AQ7A 1H8YA 3N6IA 2HDQA 1VHMA 2J8YA 3F1NA 4OOYA 4OUIA 2Z6CA 4Z2IA 4S2JA 3X1TC 3AYWD 1C3BA 2ZL1A 2Y2OA 3KWQD 3LZ0B 4E3OA 5GHYA 4M3KA 4PKYG 3AZJB 3PBOA 2ZLYA 3W97C 1P3LA 4KG2A 5C3IB 4MMNA 2UV0E 1DJBA 2ZY5A 3MGPA 5EOOA 1VEUB 3AV1C 3MGPD 4PHTA 1Z6FA 4LPZA 5FQJA 5EVIB 3REHD 3AV2C 3TRCA 4KUDD 1LL8A 2Y2JA 4LFUA 4H9SC 5GT3D 2RVQD 1WWIA 5CP6D 1EAKA 1P3ID 1M19B 3KSGA 4R3BA 3UMEA 2F8NA 1GOIA 3G35A 2F8ND 2VGLS 5GLDA 4HESA 2ZQAA 2R78A 4EBPA 5GSUD 4YINA 3L25A 2VEAA 1XP4A 3A6NC 2WKRA 3PHYA 1L0EA 1A7WA 1ZLAA 1IELA 4S2NA 3B0DC 4HP9A 3KO6A 5CPKD 3BWLA 3BQ8A 4QNLA 1D06A 3W96D 1S1YA 1VETB 5EVEA 3KUYA 3H0LC 2FJ7C 4O8GA 4QB8A 1ERQA 2BASA 1BH9B 3IWIA 4QLCA 4JBFA 3IHBA 2XQZA 2Y91A 1TF1A 5BNVB 5FAQA 1K56A 3ZGAB 3H7WB 3TU4A 5CPIC 3TU4D 5CXWA 5KIZA 5HPIA 3AZGA 4X23A 3AZGD 4Z9QA 1XXMA 2VV6A 4KZ3A 5AVCA 4XUJD 1IYPA 2IWCA 3VP3A 2AVXA 5BNXB 3UO9A 5JA4A 2PD7A 4GHIB 5DNMD 1DP9A 2DNSA 2HPBA 3MSHA 3FWLA 3LI8A 3ZG8B 3UTBA 2WKPA 5GL9A 3LR5A 3BECA 3L9KA 3NI9A 1G28A 3AZKC 3FPWA 3B6FC 1H0IA 2D49A 1J7MA 3MFXA 1OJGA 1S67L 4CJNA 3ZVTA 3MGRB 5B31C 5E5AC 2W3DA 1TS6A 2I72A 3KSYA 3A3EA 5BO0A 3BLSA 5B1MD 4Z5TA 1H3QA 3K2NA 3NOPC 4WMCA 4E3KA 4WU9B 5B33D 5JYOA 2WGIA 4LRYC 2EXAA 2Y79A 4QHCA 4UQIM 5TFQA 5DNNC 3MZFA 2PDRA 4MN6A 4ESPA 2K7SA 3OPPA 3P98A 5B2JB 3C4PA 4I3JA 4OH0A 4IBDA 1KX3A 1F66B 4P87A 1W1YA 1U60A 5AV9B 2J3WA 4KGCA 4Y13A 4KGCD 4IBGA 2EXBA 2VKSA 3V39A 3ICYA 2VLGA 1P34C 5GLBA 1G5UA 4EEUA 3UE3A 3W98C 4PM7A 2ZOIA 2G7UA 4YWZA 4NKPA 1EQZA 1EQZD 4I5SA 2PYOD 4WUJA 2ZY3A 4G92B 3QP2A 5J3WA 1HVBA 2PBDP 4NZ4A 3AZND 1KOUA 1WYCA 5HL1A 3A0SA 5EPHA 3K3CA 4MNRA 3V3RA 1K55C 5M1AA 2JKGA 2PR5A 3VV4A 1KX4C 3W4PA 5AV5B 1SKFA 2KLIA 1WYBA 3WD4A 1TAFB 5F99C 3U4LP 3UNWA 2XFSA 4GOGA 1DJCA 3ITBA 3FPVA 5DVAA 1JFIB 1P3AA 4QY5A 5FDHA 1P3AD 1XFQA 1P3GA 5I94A 3T4KA 2O99A 3LCEA 4DXCA 2NQBC 1P3FC 3HLDA 3C1BB 4RX3A 5F68A 4HIAA 3E0YA 4J8WC 1JNUA 5CPJC 1XGIA 2K2NA 4HY8A 1M6KA 3GMWA 3HLWA 4EEPA 5B32C 1BLSA 3ZQ5A 3MGSC 3AZED 4UA9A 3BW6A 3WD0A 3MKEA 3LEZA 2O9BA 4DQYB 3C30A 2L1MA 2LB9A 4YM6B 3WX7A 3H82B 3ZFZA 4IBKA 4R6LA 5JRGB 1UR9A 1Z2CB 4UUZA 3AZID 4J8XC 5CHJA 3M6BA 3RELA 1ACFA 5AY8D 2HIOC 4EXOA 2XR0A 1XJ3A 1YQSA 3T1RA 3C1CD 4J8UA 1P3OA 3X1UD 2Q0OA 4R4SA 3ZDJA 3ZYTA 4JJND 5B40D 2C6WB 1GCEA 1O6IA 4WF0A 5HDCA 1MBLA 1ID3B 3MGQD 4Z66B 2JKRM 4NZ1A 3VOYA 3LZ0A 3X1VB 1OGBA 3AZLB 1OT9A 3LZ0D 5E2HA 4E3LA 2BTFP 1L0GA 3AZJA 5B24B 3AZJD 1TDGA 4DE3A 1P3LC 3UTAD 2ZM0A 1YPRA 2EX2A 5EOEA 5CGWA 4H9OB 2C5WB 1VEUA 3A3JA 3MGPC 4JXSA 2XA7S 3OZHA 1WA9A 1OT6A 4NETA 1IKGA 5DJUA 3LR0A 1M1AB 1MY8A 5EVID 4DDSA 4KUDC 3NJAA 4QY6A 5AVBB 1NLYA 4GN2A 1MPLA 5HD5A 1M19A 5HWTA 5EECA 1S4SA 5B0YB 2QJ5A 3AZMB 2Q9NA 4XZQB 1L3LA 3IS2B 2WK0A 5DTSA 2NZDB 2H10A 5GSUC 4DDYA 2KX6A 2HJ9C 3X1TD 4IHQA 5B1LB 1E6ZA 1PIOA 3E2LA 5AVFA 1DY6A 3HVFA 1ZLAC 4IJGA 4S2NC 4C6YA 1T19A 1E88A 5CPKC 1OTDA 1S1ZA 1VETA 4C75A 3KUYC 1W63M 3AV1D 4UA6A 5TJJA 1GSWA 1PW8A 2LY8A 2ZQ7A 1TAFA 1BH9A 3PR6A 5CX7A 3DBAA 4UHUA 5FATA 4QLCC 4DRBA 1MC0A 5BNVA 1YT4A 3H7WA 2FH5A 3LIBA 3TU4C 3QHYA 1NYMA 2JHEA 4OJOA 1MKMA 3AZGC 3IF6B 4X23C 2V2FF 3OLOA 2XFTA 2J3TD 5GLCA 1HTAA 2WUQA 5AVCC 3VP1A 5BNXA 2JKFA 1ZC2A 4GHIA 4K08A 3E4QA 4IUKA 2P08A 4MLLA 5FQMA 2DQNC 1DP6A 3UTBC 4OPQA 3X1SB 4YS3D 1S6RA 1W8YA 2FJ7D 5CTMA 1ZHHB 1T1CA 4JF6A 3PXPA 1JTGA 4WELA 2PYPA 4G3VA 3MGRA 3MGRD 1L2SA 2DF4C 4ZUXA 4LRXC 1AXBA 3IBRA 5CPID 5BOHA 4FTXA 3B6GD 2WKQA 2XD5A 4Z5TC 1DRMA 4WU9A 4S2KA 1U35B 5FDSA 3TW8A 4R1GA 2A49A 1VM1A 5AVEA 3C5AA 5B2JA 2W8SA 5FUGB 3KYQA 3AZHB 3T1XA 1XX2A 5E43A 3N7WA 1NYYA 1F66A 1KX3C 1F66D 5AV9A 4I39A 4YFMA 3CMZA 1YMXA 4KGCC 1SZVA 4OOMA 1MZUA 2BYMB 1E15A 5HWVA 3GTCA 4WBGA 5DF9A 2PD8A 4WU8B 3AZKD 2A3UA 2OSUA 1S32B 3B6FD 3WKJB 3GQZA 5CEDA 1EQZC 2ZC5B 1OGGA 3Q81A 4NXEA 4E44A 2Y2QA 5B31D 1QO6A 5E5AD 4GS9B 1KX5B 4D2OA 2F8NK 2VQRA 4G91B 4HGAC 4N92A 5I5LA 4Z1WA 3IP4C 2BLSA 3G31A 3CAXA 4S2LA 2ZM8A 3D9YA 3QP5A 5AV5A 3O88A 4BBVA 5DNND 3N8LA 1BLCA 3UB7A 5A8BA 2UWXA 4YNRA 2JSSA 4QPRA 1Q2QA
chains in the Genus database with same CATH topology
4MBHA 1XGJA 4KZ6A 3HUNA 2HUEB 5DF8A 1JFIA 1P3AC 3LO7A 3L2AA 1P34D 1P3GC 4JXWA 3W98D 3C1BA 4KZ7A 3G32A 3C1BD 3WA9B 4IBXA 3KS4A 4ZBJC 4S2OA 5CGXA 1GHPA 3NIAA 3SOIA 4R8PB 4EUZA 3C7UA 1KX4D 3AFAB 1Y54A 3O62B 4A5RA 4GB7A 4YM6A 4IBJA 4OJPA 5F99D 4PM5A 1NJ4A 1TVFA 4DRTA 4UAAA 1FCNA 2P9VB 5JRGA 3BEBA 1IEMA 3BYDA 1F1EA 2G2WA 1ZG6A 1I2WA 1TDLA 3P09A 3RELC 4OQHA 4GD8A 2NQBD 1BUEA 3RJUA 4PM9A 4KG6A 3H0MC 4J8WD 4PMAA 4MEZA 5CPJD 2PBYA 3VSKA 5HAPA 4J8UC 1P3OC 5CTNA 5B32D 3MGSD 4JJNC 1E3UA 4OQ0A 2HDUA 4IVIA 2ZC4B 3WTPE 2HDRA 1ID3A 4Z66A 1ID3D 4B88A 5A93A 3X1VA 3AZLA 3LZ0C 4J8VB 1YLYA 3IH8A 1XPBA 5B24A 3AZJC 3VH6T 2OLVA 4J8XD 2AROB 5C3IC 1FSYA 4H9OA 4NFTA 4H9RB 2IWDA 1B6WA 4OONA 5HARA 1M1AA 5EVIC 4X55A 5AVBA 3HONA 2CV5B 1BULA 2FFFB 1M19C 5B0YA 3AZMA 3AZMD 4XZQA 3BFGA 4XZQD 3NCKA 2ZMAA 2NZDA 1YU0A 1GA0A 5B1LA 4S2MA 3OPLA 4C3QA 3LY4A 1ES3A 3OPHA 2J8PA 2V20A 2OV5A 3WTPB 1P3LD 4M6BA 1JWVA 4HBUA 1AOIB 1NZOA 3I7JA 5GXQB 5FSRA 3EPHA 2FFYA 3IF6A 4BQMA 4MBFA 3MNNA 1MWUA 4R23A 5FQIA 2PU4A 3MFDA 3WAAB 3NBLA 3ZHHA 1FR1A 3KXBB 3GRJA 1ZLAD 4EO5B 3UN7A 2BYKB 1IKIA 2ZQCA 3HLCA 4XUXA 3X1SA 2ZC3B 3X1SD 2IWBA 4YS3C 2Y2IA 3REJB 3KUYD 3A3FA 4LV2A 4WZ5A 2EX8A 3W99B 4QLCD 3WS4A 3MGRC 2E8IA 3V9RB 1MXOA 5BS7A 2WGVA 1K56D 4BD0A 3B6GC 4RX2A 4DE1A 3VFHA 4WU9C 1U35A 4X23D 5B31G 5AVCD 1K25A 5FUGA 3REKB 3AZHA 3Q1FA 5B2JC 2Y2NA 4NE5A 4JF4A 1F66C 2Y59A 2BYMA 3UTBD 1ULYA 3OC2A 1N4OA 3UDIA 4WU8A 4GDNA 1S32A 3WKJA 1S32D 3RXWA 1CI9A 3S4XA 4L0LA 4G92C 4ZUXB 1KX5A 3WS0A 1KX5D 5B2IB 3UPPA 1SCWA 1EI5A 5HFOA 4Z5TD 4UPKA 1NY0A 4WMCD 3W8KA 3HSHA 1BZAA 2VGJA 2ZJ9A 3VH5T 5AV5C 1JVJA 1YU2A 2IO5B 4CAYB 4MBKA 5BT1D 4ZDXA 1GHMA 1KX3D 3S1YA 4ZJ1A 1O7EA 3WRTA 2ZY2A 2DRWA 4E6XA 1YLTA 1KVMA 5JYPA 3MBZA 3PBSA 3C1BC 4UA7A 3WA9A 5HAQA 3WA9D 4H9QB 5L2FA 5F1FA 3BRMA 5FQKA 2RIQA 4LCLA 4R8PA 4JLFA 2H5SA 3AFAA 3AZFB 3ZG5A 2Y2LA 5B0ZB 3O62A 1ERMA 5B32G 4DE2A 1M18B 3AN2B 2YFWB 4YM6C 4IEDA 3N3FA 4EV4A 2P9VA 1HTZA 1HQ3B 1ES4A 5JRGC 5AQAA 4WEKA 3NQJB 1P3GD 5F82A 3RXXA 3NY4A 3LELB 5FQQA 1GA9A 1YLWA 2WKEA 2XGNA 4JKTA 2XLNA 5AV8B 1YLPA 4BENA 3CZDA 4NE3A 5CEBA 3G30A 3MKFA 4O7DA 1P3BB 2QZ6A 4IBCA 3IHAA 1ID3C 4Z66C 3X1VC 3B0CT 4J8VA 3AZLC 5CECA 4LV3A 4IJEA 4BJPA 4Y0TA 5B24C 1VQQA 3FZCA 4GD6A 2AROA 1DJAA 3C7VA 4OP8A 2QPNA 3RELD 4EWFA 4H9RA 2XDMA 2ZM2A 4HBTA 5AV6B 2Q9MA 2WKHA 3GSGA 1P3KB 4J8UD 1P3OD 3MXSA 5IHVA 2CV5A 3PTEA 2Y4AA 3UT9B 3BFCA 4FCFA 3N8SA 5B0YC 3SS4A 5GT0B 3AZMC 4XZQC 1TZYB 4OPYA 4EQIA 2NZDC 5AQBA 2F8NG 5B1LC 1K54A 1IYQA 3QNBA 4WJ3C 4JF5A 4DKIA 5A92A 1KE0A 3WTPA 4DXBA 4K0WA 3WTPD 1ESIA 4CSRB 2F8NH 5CHUA 2ZQ9A 4GNUA 5KDMB 4PM6A 2VGKA 1AOIA 3IXBA 1YU1A 1P3PB 5GXQA 3DTMA 1BT5A 2H0TA 1KGEA 4HEFA 1M19D 3IF6C 1P3MB 4NY2A 3WAAA 3LZ1B 2ZC6B 1HD8A 3EPLA 3W4OA 3KXBA 2XK1A 3AL0C 4X56A 2BYKA 4LD9B 1G68A 1N1JB 3ITAA 3X1SC 3REJA 3N8RA 3REJD 4E6WA 3AYWB 4WZ5C 3W99A 3KWQB 3L28A 4S2PA 3V9RA 1ALQA 2X71A 1Q9CA 3PAEA 5BS7C 5DTTA 1WWSA 4OJLA 4AWLB 3B3XA 1KE3A 3MNNB 1U35C 1B67A 5GHZA 3FV7A 3WS2A 3M2KA 4H9NA 4X6TA 4ZBEA 3AV2A 3REHB 4JPMA 3REKA 4KUDB 3AZHC 1JTDA 5GT3B 3WS1A 5CP6B 1P3IB 3HBRA 2L5AA 1MWRA 3EPJA 4WU8C 3VH5W 1CK3A 1K38A 5GSUB 1S32C 3WKJC 3A6NA 1I2SA 3BFEA 3UDFA 4ZUXD 1KX5C 5B2IA 4G91C 3WS5A 3M6HA 5CPKB 1IYSA 5EVLA 5FI2A 4U0XA 4GZBA 4WU9D 3W96B 3HLFA 4ZJ2A 1BLHA 1T3UA 4CAYA 3LJAB 5B2JD 5BT1C 3A3IA 1YMSA 2RL3A 5AV9D 3MVDB 5F83A 2HUEC 2EFXA 4XUJB 3W4QA 3WA9C 4NYYA 2Z2MB 3A1IA 5DNMB 1H8ZA 1LL5A 1L0FA 3V50A 4H9QA 4E3IA 1PWDA 4BL3A 1LL9A 4IJFA 5CERA 1FCMA 4R8PC 2J9PA 4OP5A 3AZFA 1ONGA 3AFAC 5AV5D 5B0ZA 4ID4A 1BSGA 3O62C 1M18A 3AN2A 2YFWA 3AN2D 1W5DA 5FASA 4NZ5A 2WZXA 3DWKA 3VP2A 1HQ3A 1PZPA 5B1MB 4OLDA 3NQJA 5B33B 3UPNA 3LELA 1ZKJA 4EBNA 5KSCA 5AV8A 3NDEA 5EE8A 5AV8D 1KE4A 2YFVB 3IQAA 1W79A 1NZUA 2WADA 2XD1A 1P3BA 1N9BA 1P3BD 4WNNB 2PYOB 4YM6D 3ZNYA 3NQUB 4J8VC 3BFDA 3B0BA 3HLEA 5JRGD 1KGGA 3AZNB 1LLBA 4KZAA 2AROC 4Y7PA 2Y2HA 1O07A 4Z2MG 4DE0A 1PZRA 5KZHA 5AV6A 1H5XA 4KG5A 4DRAA 5A91A 3GVBA 2JCHA 4WEJA 1P3KA 4Q8IA 1P3KD 1BH8B 3PBQA 2CV5C 3UT9A 3UPOA 5M18A 5GT0A 5GT0D 3O86A 1E3UD 1TZYA 4PPRA 1TZYD 4Z66D 4JXVA 2J7VA 5HX9A 1PZOA 3X1VD 3AZLD 1K54C 3D4FA 1FSWA 5B24D 3IH9A 1K57A 3WTPC 3AZEB 4CSRA 2ZQ8A 2HDSA 2R9WA 5KDMA 2ZD8A 4Y0UA 1AOIC 3ZVWA 2JBFA 4KZ9A 2XH9A 1M1AD 1P3PA 1P3PD 5GXQC 5AVBD 4R4RA 2WZZA 4XXRA 3KS8A 4KZ8A 4FD8A 3ISGA 3AZIB 5B0YD 2CC1A 5AY8B 4CPKA 1P3MA 3HUMA 2NZDD 3HL9A 4LV1A 1QMFA 3LZ1A 3WAAC 3LZ1D 5B1LD 5E2GA 3C1CB 3R45B 3X1UB 2CWEA 1SDNA 4EO5C 3HUOA 2XF3A 3IWQA 1L0DA 4LD9A 1G6AA 1N1JA 2QMIA 5B40B 3REJC 3MGQB 3AYWA 1KVLA 3KWQA 3A3DA 3W99C 3E2KA 4H9PB 3Q7VB 4N9KA 3UTAB 1GHIA 3MNND 5FAPA 3PBTA 3AGFA 3REHA 4KUDA 3REKC 3ZNTA 5GLAA 5GT3A 3UY6A 4RYEA 5CP6A 1P3IA 3REIB 2G5IC 3VFFA 1E25A 5GSUA 3X1TB 1CI8A 3UE1A 1M40A 4ZUXC 1XKZA 3SH7A 5B2IC 5CPKA 4LV0A 3W97B 3IT9A 3V3SA 4OJ6A 3W96A 3IWOA 3WRZA 5AQ9A 1U35D 2JC7A 3AV1B 1HZOA 1LI9A 5CRFA 4R3JA 4H9NB 3HLGA 3AV2B 4FH2A 4GKUA 3LJAA 2IO5C 5U47A 3LJAD 3AZHD 4N1HA 3MVDA 5AV9C 3MVDD 2X01A 4P85A 4KQOA 2XEPA 3BM6A 4WU8D 4XUJA 4GH9A 3WKJD 3A6NB 3VH6A 3N4IA 4N9LA 2BG1A 4R0QA 1TEMA 5DNMA 1PI5A 2ZC7A 1KDSA 4WV4B 3B0DB 3SS5A 1I5QA 1R4VA 1YU4A 3CG5A 4YS3B 2FJ7B 1RCJA 3AZFC 5B0ZC 1M18C 3AN2C 4WZSB 1K6RA 3SS3A 3EQVA 1HQ3C 5CPIB 5B1MA 3B6GB 5DTKA 5B33A 1QMEA 3AGEA 2RCXA 2ZQDA 3G2ZA 1MKIA 4DF6A 3PBNA 3LELC 2OLUA 1FOFA 4K91A 5AV8C 2YFVA 4H8RA 3BLMA 4LENA 4R8PD 4NZ3A 3AZKB 3AFAD 1P3BC 2IOUA 3B6FB 4WNNA 1H3OB 2X02A 3O62D 3EPKA 2PYOA 3IF5A 5B31B 5E5AB 5DF7A 3NQUA 4KZ5A 4X68A 3AZNA 2WGWB 3SH8A 5TR7A 2Z2LB 3Q07A 5DNNB 2EX6A 4QU3A 1NXYA 3MZDA 1BFMA 1LI0A 2ZY4A 5AV6C 4Y0OA 4BL2A 1P3KC 1BH8A 3ZG7B 3UT9C 3VH6W 3L26A 1W7FA 1IYOA 3HREA 1P34B 2WAFA 5GT0C 5CGSA 3W98B 1TZYC 3P5JB 3DW0A 4WYYA 5HAIA 3VSLA 4IBBA 5A90A 4B4ZA 5BPVA 4J8VD 3PBRA 2R9XA 5G49B 5E2FA 4ZAMA 3AZEA 1K57C 4K0XA 2AROD 4QJGA 1WE4A 1KX4B 3TOIA 5FI6A 2H0YA 5F99B 1J9MA 1M1AC 5FI7A 3MZEA 4GDBA 3JYIA 1P3PC 3G4PA 5AVBC 4KZ4A 2CV5D 1PW1A 2Y2GA 3AZIA 4B4XA 5AY8A 2NQBB 1P3FB 1KDWA 1P3MC 3Q7ZA 1NRFA 4J8WB 3O3VA 5M19A 3LZ1C 4E3JA 5CPJB 1K4EA 4X53A 4OQGA 3C1CA 3R45A 4U0TA 3L29A 1YLJA 3X1UA 3VH5A 2GDNA 5B32B 4FSFA 3MGSB 4JJNA 1FCOA 4LD9C 5B40A 2EX9A 1KGFA 3A1KA 3MGQA 4FH4A 3AYWC 5CHLB 1AOID 3KWQC 3L27A 4IBRA 5GXQD 4H9PA 1ONHA 3Q7VA 4J8XB 3UTAA 2Y2KA 1YUEA 4AWLC 3G2YA 3MNNC 4E45A 2HIOB 5CHMA 3WAAD 5EVIA 3GV9A 3REHC 4U3TA 3MXRA 3KXBD 3OCLA 5FQ9A 4KHAB 3IXHA 5GT3C 3FYZA 2RVQC 1EROA 3REIA 5CP6C 1MWTA 1P3IC 1PWCA 3LY3A 3REID 5F1GA 3ZG9B 4P0MA 3ZG0A 1YU3A 3X1TA 5J8XA 4IBIA 3VOZA 3IXDA 4KENB 1SDEA 3W99D 1PYYA 4EBLA 4OOLA 3FDDA 3H0RC 1RP5A 3HLBA 3W97A 1CEFA 3W97D 2ZM5A 1P3LB 5FA7A 3W96C 3AV1A 3MGPB 4S2IA 4E3MA 5EUAA 2PU2A 3SH9A 3AV2D 3REKD 4WM9A 3LJAC 4H9SA 3MVDC 2F8NB 2F2AC 1FR6A 4RA7A 4XUJC 2P74A 3A6ND 2G2UA 3QNCA 3Q82A 4KQRA 5DNMC 2HP6A 1ZLAB 5KMWA 5B2ID 5KSHA 3VMAA 4OLGA 2V1ZA 2DCFA 1S0WA 4YS3A 3KUYB 2FJ7A 1ES2A 4JXGA 4QLCB 4F94A 1FQGA 5CPIA 3UE0A 3TU4B 5FAOA 3B6GA 5B1MC 1MWSA 3AZGB 1SHVA 4WZ4A 5D3OA 4X23B 5B33C 3DWZA 5AVCB 3FKEA 1XA7A 4KQQA 5JA4B 3NDGA 1Q2PA 3C4OA 3UTBB 4OJ5A 4BLMA 1W2EA 3AZKA 5HW3A 3AZFD 3B6FA 1H3OA 5B0ZD 2PYOC 2Y2PA 1M18D 5B31A 5E5AA 3TG9A 1HQ3D 5BO0B 3AZNC 2WKIA 4Z5TB 2WGWA 4ZJ3A 1BLPA 4E3NA 4IBFA 3BFFA 3O87A 3V5MA 5DNNA 2HP9A 4X69A 3LELD 3EG5B 1JWPA 3IXGA 3B0CW 4NE6A 1KX3B 4OKPA 4KGCB 3FKVA 3PAGA 4NK3A 3WWXA 1P34A 3AGDA 3W98A 2Y55A 3CJMA 3FKWA 3S22A 1K6SA 4LCMA 2Y2MA 4GHAA 3M2JA 1EQZB 3NC8A 2HP5A 4HGAB 3TSGA 5G49A 3OPRA 1K55A 3AZEC 1XA1A 4P6BA 1KX4A 5TGFA 3KFUG 4IBEA 5F99A 2WYXA 5AV6D 1E4DA 1YLZA 4OPRA 3ZCZA 4OVDA 4PM8A 4OPZA 1PI4A 3UT9D 1ESUA 4IVKA 4Z2MH 1P3AB 4N1XA 3AZIC 1P3GB 2G5HC 1YM1A 2B5RA 2NQBA 5AY8C 1P3FA 2EFUA 4ZTKA 1P3FD 3OCNA 4J8WA 3VP0A 3EQUA 5CPJA 3C1CC 3X1UC 1EWZA 1RGZA 4ZBJB 5B32A 3UDXA 3MGSA 4GHLA 4XUZA 5B40C 4QD4A 1JWZA 3MGQC 5E2EA 4BD1A 4NYUA 1OMEA 1W8QA 2JE5A 1ES5A 4RVAA 4J8XA 4UUZB 2J9OA 3UTAC 1ZG4A 4KZBA 3RELB 4OQIA 2HIOA 1P3MD 2HIOD 1K4FA 3F6TA 1KU5A 1BTLA 1CEGA 5GHXA 4J8UB 1P3OB 1RGYA 3KXBC 4KHAA 3G34A 1LHYA 5G18A 3REIC 2WAEA 3GR2A 4LG2A 3VP4A 1PWGA 4JJNB 4LD9D 5AQ7A 1H8YA 3N6IA 2HDQA 2J8YA 4OOYA 4OUIA 4S2JA 3X1TC 3AYWD 1C3BA 2Y2OA 3KWQD 3LZ0B 4E3OA 5GHYA 4M3KA 3AZJB 3PBOA 2ZLYA 3W97C 1P3LA 4KG2A 5C3IB 1DJBA 2ZY5A 3MGPA 5EOOA 3AV1C 3MGPD 1Z6FA 5FQJA 5EVIB 3REHD 3AV2C 4KUDD 2Y2JA 4H9SC 5GT3D 2RVQD 1WWIA 5CP6D 4R3BA 1P3ID 1M19B 2F8NA 3G35A 2F8ND 5GLDA 4HESA 2ZQAA 4EBPA 5GSUD 4YINA 3L25A 1XP4A 3A6NC 1L0EA 1A7WA 1ZLAA 1IELA 4S2NA 3B0DC 5CPKD 4QNLA 3W96D 3KUYA 3H0LC 2FJ7C 4QB8A 1ERQA 1BH9B 3IWIA 4QLCA 4JBFA 3IHBA 2XQZA 2Y91A 5BNVB 5FAQA 1K56A 3ZGAB 3TU4A 5CPIC 3TU4D 5CXWA 3AZGA 4X23A 3AZGD 4Z9QA 1XXMA 4KZ3A 5AVCA 4XUJD 1IYPA 2IWCA 3VP3A 5BNXB 3UO9A 5JA4A 5DNMD 2DNSA 2HPBA 3FWLA 3ZG8B 3UTBA 5GL9A 3BECA 3NI9A 3AZKC 3B6FC 4CJNA 3ZVTA 3MGRB 5B31C 5E5AC 2I72A 3KSYA 3A3EA 5BO0A 3BLSA 5B1MD 4Z5TA 4WMCA 4E3KA 4WU9B 5B33D 5JYOA 2WGIA 2EXAA 4QHCA 5TFQA 5DNNC 3MZFA 3OPPA 3P98A 5B2JB 3C4PA 4OH0A 4IBDA 1KX3A 1F66B 4P87A 1U60A 5AV9B 4KGCA 4KGCD 4IBGA 2EXBA 3V39A 1P34C 5GLBA 3UE3A 3W98C 4PM7A 1EQZA 1EQZD 2PYOD 2ZY3A 4G92B 1HVBA 4NZ4A 3AZND 1WYCA 5HL1A 5EPHA 4MNRA 3V3RA 1K55C 5M1AA 1KX4C 3W4PA 5AV5B 1SKFA 1WYBA 1TAFB 5F99C 3UNWA 2XFSA 4GOGA 1DJCA 3ITBA 5DVAA 1JFIB 1P3AA 4QY5A 5FDHA 1P3AD 1P3GA 5I94A 3LCEA 4DXCA 2NQBC 1P3FC 3HLDA 3C1BB 4RX3A 4J8WC 5CPJC 1XGIA 1M6KA 3GMWA 3HLWA 5B32C 1BLSA 3MGSC 3AZED 4UA9A 3MKEA 3LEZA 4DQYB 4YM6B 3WX7A 3ZFZA 4IBKA 5JRGB 1Z2CB 4UUZA 3AZID 4J8XC 5CHJA 3M6BA 3RELA 5AY8D 2HIOC 2XR0A 1YQSA 3C1CD 4J8UA 1P3OA 3X1UD 4R4SA 3ZDJA 4JJND 5B40D 2C6WB 1GCEA 1MBLA 1ID3B 3MGQD 4Z66B 3VOYA 4NZ1A 3LZ0A 3X1VB 3AZLB 3LZ0D 5E2HA 4E3LA 1L0GA 3AZJA 5B24B 3AZJD 1TDGA 4DE3A 1P3LC 3UTAD 2ZM0A 2EX2A 5EOEA 5CGWA 4H9OB 2C5WB 3A3JA 3MGPC 4JXSA 3OZHA 4NETA 1IKGA 5EVID 1M1AB 1MY8A 4DDSA 4KUDC 4QY6A 5AVBB 4GN2A 1MPLA 1M19A 5EECA 5B0YB 3AZMB 2Q9NA 4XZQB 2WK0A 5DTSA 2NZDB 2H10A 5GSUC 4DDYA 3X1TD 5B1LB 1PIOA 3E2LA 1DY6A 3HVFA 1ZLAC 4S2NC 4C6YA 5CPKC 4C75A 3KUYC 3AV1D 4UA6A 1PW8A 2LY8A 2ZQ7A 1TAFA 1BH9A 4UHUA 5FATA 4QLCC 4DRBA 5BNVA 1YT4A 3TU4C 3QHYA 1NYMA 4OJOA 3AZGC 3IF6B 4X23C 2V2FF 2XFTA 5GLCA 1HTAA 2WUQA 5AVCC 3VP1A 5BNXA 1ZC2A 4MLLA 5FQMA 2DQNC 3UTBC 4OPQA 3X1SB 4YS3D 1S6RA 1W8YA 2FJ7D 5CTMA 4JF6A 1JTGA 4WELA 3MGRA 3MGRD 1L2SA 2DF4C 4ZUXA 1AXBA 5CPID 5BOHA 3B6GD 2XD5A 4Z5TC 4WU9A 4S2KA 1U35B 4R1GA 2A49A 1VM1A 3C5AA 5B2JA 2W8SA 5FUGB 3AZHB 1XX2A 5E43A 3N7WA 1NYYA 1F66A 1KX3C 1F66D 5AV9A 4YFMA 3CMZA 1YMXA 4KGCC 4OOMA 2BYMB 3GTCA 4WBGA 5DF9A 4WU8B 3AZKD 2A3UA 2OSUA 1S32B 3B6FD 3WKJB 3GQZA 5CEDA 1EQZC 2ZC5B 3Q81A 4E44A 2Y2QA 5B31D 5E5AD 1KX5B 4D2OA 2F8NK 2VQRA 4G91B 4HGAC 4N92A 3IP4C 2BLSA 3G31A 4S2LA 2ZM8A 5AV5A 3O88A 5DNND 3N8LA 1BLCA 2UWXA 2JSSA 1Q2QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MBH A;  4LEN A;  1XGJ A;  4KZ6 A;  3PBO A;  2ZLY A;  4KG2 A;  2ZC6 B;  1HD8 A;  3HUN A;  3W4O A;  5DF8 A;  2X02 A;  1DJB A;  3IF5 A;  5EOO A;  2XK1 A;  3LO7 A;  1Z6F A;  4X56 A;  5FQJ A;  4JXW A;  5DF7 A;  4KZ5 A;  5EVI B;  1G68 A;  3ITA A;  4KZ7 A;  3G32 A;  4X68 A;  2Y2J A;  2WGW B;  3SH8 A;  3N8R A;  5TR7 A;  2Z2L B;  4E6W A;  4IBX A;  4R3B A;  3Q07 A;  4WZ5 C;  3G35 A;  5GLD A;  2EX6 A;  4QU3 A;  4HES A;  1NXY A;  2ZQA A;  3MZD A;  4S2P A;  4S2O A;  1ALQ A;  5CGX A;  1LI0 A;  2X71 A;  1GHP A;  3NIA A;  3PAE A;  4Y0O A;  5DTT A;  3SOI A;  4EBP A;  4EUZ A;  4YIN A;  4BL2 A;  1XP4 A;  3C7U A;  3ZG7 B;  3B3X A;  1KE3 A;  1Y54 A;  1L0E A;  1W7F A;  4A5R A;  1IEL A;  4GB7 A;  4S2N A;  1IYO A;  3HRE A;  5GHZ A;  4PM5 A;  2WAF A;  3FV7 A;  3WS2 A;  5CGS A;  3M2K A;  1NJ4 A;  1TVF A;  4X6T A;  4ZBE A;  4UAA A;  4DRT A;  1FCN A;  2P9V B;  3DW0 A;  4WYY A;  4JPM A;  5HAI A;  3VSL A;  3BEB A;  1IEM A;  1JTD A;  5A90 A;  3BYD A;  3WS1 A;  4B4Z A;  4QB8 A;  2G2W A;  1ZG6 A;  1ERQ A;  1I2W A;  1TDL A;  3HBR A;  3P09 A;  4OQH A;  4GD8 A;  1BUE A;  3IWI A;  3RJU A;  3PBR A;  4PM9 A;  1MWR A;  4JBF A;  4KG6 A;  2R9X A;  3IHB A;  2XQZ A;  5E2F A;  4PMA A;  2Y91 A;  4MEZ A;  4ZAM A;  1CK3 A;  1K38 A;  5FAQ A;  1K57 C;  1K56 A;  2PBY A;  4K0X A;  3VSK A;  3ZGA B;  5HAP A;  4QJG A;  1WE4 A;  5CXW A;  3TOI A;  1I2S A;  3BFE A;  3UDF A;  5CTN A;  4Z9Q A;  5FI6 A;  1XXM A;  2H0Y A;  3WS5 A;  1J9M A;  3M6H A;  4KZ3 A;  1E3U A;  1IYP A;  4OQ0 A;  5FI7 A;  2IWC A;  3MZE A;  4GDB A;  3VP3 A;  2HDU A;  3JYI A;  4IVI A;  2ZC4 B;  1IYS A;  3G4P A;  5EVL A;  3UO9 A;  5FI2 A;  4KZ4 A;  4GZB A;  4U0X A;  2HDR A;  1PW1 A;  4B88 A;  2Y2G A;  5A93 A;  2DNS A;  2HPB A;  3HLF A;  4B4X A;  3FWL A;  4ZJ2 A;  1BLH A;  3ZG8 B;  1YLY A;  3IH8 A;  1KDW A;  5GL9 A;  1XPB A;  3Q7Z A;  1NRF A;  3A3I A;  3BEC A;  3NI9 A;  3O3V A;  5M19 A;  1YMS A;  2RL3 A;  4E3J A;  2OLV A;  1K4E A;  4X53 A;  4OQG A;  5F83 A;  1FSY A;  4U0T A;  1YLJ A;  4CJN A;  2IWD A;  3ZVT A;  2GDN A;  4OON A;  2I72 A;  2EFX A;  4FSF A;  5HAR A;  1FCO A;  3A3E A;  5EVI C;  3W4Q A;  2EX9 A;  1KGF A;  3BLS A;  4X55 A;  4WMC A;  1BUL A;  4E3K A;  2Z2M B;  2FFF B;  4FH4 A;  1H8Z A;  1LL5 A;  2WGI A;  1L0F A;  3V50 A;  5JYO A;  4E3I A;  1PWD A;  2EXA A;  4QHC A;  4BL3 A;  1LL9 A;  5TFQ A;  4IBR A;  3MZF A;  3BFG A;  5CER A;  3NCK A;  1FCM A;  2ZMA A;  3OPP A;  3P98 A;  3C4P A;  4OH0 A;  1ONH A;  3Q7V A;  2J9P A;  4OP5 A;  1GA0 A;  1U60 A;  4P87 A;  3OPL A;  4S2M A;  3LY4 A;  1ONG A;  2Y2K A;  4C3Q A;  1ES3 A;  3OPH A;  3G2Y A;  4ID4 A;  2EXB A;  1BSG A;  3V39 A;  1W5D A;  5GLB A;  5FAS A;  2WZX A;  2V20 A;  5CHM A;  3DWK A;  2OV5 A;  3UE3 A;  3VP2 A;  4PM7 A;  5EVI A;  3GV9 A;  4U3T A;  1PZP A;  1JWV A;  3MXR A;  4OLD A;  3OCL A;  4HBU A;  5FQ9 A;  3IXH A;  3FYZ A;  1ERO A;  1MWT A;  1PWC A;  3LY3 A;  5F1G A;  3UPN A;  1HVB A;  1NZO A;  3I7J A;  3ZG9 B;  1WYC A;  4P0M A;  3ZG0 A;  5HL1 A;  5FSR A;  5EPH A;  4MNR A;  3V3R A;  1K55 C;  5M1A A;  1ZKJ A;  5J8X A;  4EBN A;  3VOZ A;  3IXD A;  2FFY A;  1SDE A;  4KEN B;  3W4P A;  5KSC A;  3IF6 A;  4BQM A;  1PYY A;  3NDE A;  4MBF A;  5EE8 A;  1SKF A;  1MWU A;  1KE4 A;  1WYB A;  4R23 A;  4EBL A;  4OOL A;  3IQA A;  1W79 A;  5FQI A;  2PU4 A;  3MFD A;  3UNW A;  1NZU A;  1RP5 A;  3HLB A;  2XFS A;  4GOG A;  2WAD A;  1CEF A;  1DJC A;  2XD1 A;  3ITB A;  3NBL A;  3ZHH A;  1N9B A;  5DVA A;  5FA7 A;  1FR1 A;  3GRJ A;  4QY5 A;  5FDH A;  3UN7 A;  4S2I A;  4E3M A;  5I94 A;  5EUA A;  1IKI A;  3LCE A;  3ZNY A;  2ZQC A;  2PU2 A;  4DXC A;  3HLC A;  4XUX A;  3BFD A;  3SH9 A;  1KGG A;  3HLE A;  3HLD A;  4WM9 A;  2ZC3 B;  4RX3 A;  2IWB A;  2Y2I A;  1LLB A;  4KZA A;  1XGI A;  3A3F A;  4LV2 A;  4WZ5 A;  4Y7P A;  2EX8 A;  2Y2H A;  1O07 A;  3WS4 A;  1FR6 A;  1M6K A;  4DE0 A;  3GMW A;  3HLW A;  2E8I A;  1MXO A;  5KZH A;  1BLS A;  4RA7 A;  1H5X A;  2WGV A;  4KG5 A;  4UA9 A;  1K56 D;  5A91 A;  2P74 A;  2JCH A;  3GVB A;  4WEJ A;  4BD0 A;  3MKE A;  4Q8I A;  3LEZ A;  2G2U A;  4RX2 A;  3PBQ A;  4DE1 A;  3QNC A;  3VFH A;  3Q82 A;  4KQR A;  2HP6 A;  5KMW A;  3UPO A;  5M18 A;  3ZFZ A;  5KSH A;  3VMA A;  3O86 A;  1E3U D;  4OLG A;  1K25 A;  4PPR A;  2V1Z A;  2DCF A;  1S0W A;  3Q1F A;  2Y2N A;  4JF4 A;  4JXV A;  1ES2 A;  2J7V A;  2Y59 A;  5CHJ A;  5HX9 A;  3M6B A;  1PZO A;  4JXG A;  1K54 C;  3OC2 A;  4F94 A;  1N4O A;  1FQG A;  2XR0 A;  1YQS A;  3D4F A;  1FSW A;  3UDI A;  3IH9 A;  1K57 A;  4GDN A;  3UE0 A;  5FAO A;  3RXW A;  1MWS A;  2ZQ8 A;  2HDS A;  1CI9 A;  1SHV A;  2R9W A;  4WZ4 A;  5D3O A;  3S4X A;  4L0L A;  4R4S A;  3WS0 A;  2ZD8 A;  4Y0U A;  3ZVW A;  3ZDJ A;  2JBF A;  4KZ9 A;  2XH9 A;  3DWZ A;  3UPP A;  1SCW A;  2C6W B;  1GCE A;  1EI5 A;  5HFO A;  1XA7 A;  4KQQ A;  1MBL A;  1NY0 A;  2WZZ A;  4R4R A;  4WMC D;  4XXR A;  4KZ8 A;  3W8K A;  1BZA A;  4FD8 A;  2VGJ A;  3VOY A;  3ISG A;  2ZJ9 A;  3NDG A;  1JVJ A;  1Q2P A;  2CC1 A;  3C4O A;  4CPK A;  3HUM A;  5E2H A;  4E3L A;  4BLM A;  3HL9 A;  4LV1 A;  4MBK A;  1L0G A;  1QMF A;  4ZDX A;  1GHM A;  3S1Y A;  4ZJ1 A;  1O7E A;  1TDG A;  3WRT A;  4DE3 A;  5HW3 A;  2ZM0 A;  5E2G A;  2EX2 A;  2DRW A;  5EOE A;  5CGW A;  2C5W B;  4E6X A;  3A3J A;  4JXS A;  2Y2P A;  1YLT A;  1SDN A;  3HUO A;  3OZH A;  2XF3 A;  4NET A;  3IWQ A;  1KVM A;  3TG9 A;  5JYP A;  1L0D A;  1IKG A;  1G6A A;  3MBZ A;  5EVI D;  1MY8 A;  2QMI A;  4DDS A;  3PBS A;  4UA7 A;  2WKI A;  4QY6 A;  2WGW A;  5HAQ A;  4ZJ3 A;  1BLP A;  4GN2 A;  1MPL A;  4E3N A;  1KVL A;  5EEC A;  3BFF A;  3O87 A;  3V5M A;  5L2F A;  3A3D A;  2Q9N A;  3E2K A;  2HP9 A;  5F1F A;  3BRM A;  2WK0 A;  5DTS A;  5FQK A;  4X69 A;  2H10 A;  4LCL A;  1JWP A;  3BLM A;  3IXG A;  4JLF A;  4DDY A;  3Q7V B;  4OKP A;  2H5S A;  1PIO A;  3E2L A;  4N9K A;  3ZG5 A;  3FKV A;  3PAG A;  2Y2L A;  1DY6 A;  1GHI A;  4NK3 A;  3HVF A;  5FAP A;  1ERM A;  4DE2 A;  4S2N C;  3WWX A;  3PBT A;  4IED A;  3AGD A;  4C6Y A;  4EV4 A;  3AGF A;  2P9V A;  2Y55 A;  1HTZ A;  3CJM A;  3FKW A;  3S22 A;  1K6S A;  1ES4 A;  4LCM A;  2Y2M A;  5AQA A;  3M2J A;  4C75 A;  4WEK A;  3ZNT A;  5GLA A;  3NC8 A;  2HP5 A;  3UY6 A;  4RYE A;  4UA6 A;  1PW8 A;  2ZQ7 A;  4UHU A;  5F82 A;  5FAT A;  3TSG A;  3RXX A;  3NY4 A;  3OPR A;  3VFF A;  1K55 A;  5FQQ A;  1E25 A;  1GA9 A;  1YLW A;  1YT4 A;  2WKE A;  2XGN A;  1XA1 A;  4JKT A;  3QHY A;  4P6B A;  1NYM A;  2XLN A;  5TGF A;  1CI8 A;  3UE1 A;  1M40 A;  3IF6 B;  1YLP A;  4BEN A;  2V2F F;  1XKZ A;  2XFT A;  3CZD A;  2WYX A;  1E4D A;  5GLC A;  3G30 A;  1YLZ A;  3MKF A;  4OPR A;  3SH7 A;  2WUQ A;  4O7D A;  5CEB A;  3ZCZ A;  4LV0 A;  4OVD A;  3VP1 A;  3IT9 A;  4PM8 A;  4OPZ A;  3V3S A;  1PI4 A;  2QZ6 A;  3IWO A;  1ZC2 A;  3IHA A;  5AQ9 A;  3WRZ A;  2JC7 A;  1ESU A;  4IVK A;  1HZO A;  4N1X A;  1LI9 A;  5CRF A;  4R3J A;  4MLL A;  5FQM A;  1YM1 A;  2B5R A;  3HLG A;  4FH2 A;  2EFU A;  4GKU A;  4ZTK A;  4OPQ A;  3OCN A;  5U47 A;  5CEC A;  4LV3 A;  3VP0 A;  4BJP A;  3EQU A;  1S6R A;  1VQQ A;  4N1H A;  4Y0T A;  1W8Y A;  3FZC A;  4GD6 A;  5CTM A;  1DJA A;  3C7V A;  2X01 A;  4OP8 A;  2QPN A;  4JF6 A;  4P85 A;  4KQO A;  1JTG A;  4WEL A;  4EWF A;  2XEP A;  1EWZ A;  1RGZ A;  1L2S A;  2XDM A;  2ZM2 A;  3BM6 A;  3UDX A;  4HBT A;  2Q9M A;  1AXB A;  4XUZ A;  5BOH A;  4QD4 A;  2WKH A;  3GSG A;  3N4I A;  4N9L A;  3MXS A;  2XD5 A;  5IHV A;  2BG1 A;  4R0Q A;  4S2K A;  3PTE A;  1TEM A;  2Y4A A;  1JWZ A;  5E2E A;  1PI5 A;  2ZC7 A;  1KDS A;  3BFC A;  4FCF A;  4BD1 A;  3N8S A;  1OME A;  3SS4 A;  3SS5 A;  4R1G A;  1I5Q A;  2A49 A;  4OPY A;  1VM1 A;  1W8Q A;  3C5A A;  4EQI A;  2JE5 A;  3CG5 A;  1XX2 A;  5E43 A;  3N7W A;  1NYY A;  5AQB A;  4YFM A;  1ES5 A;  4RVA A;  1RCJ A;  3CMZ A;  2J9O A;  1YMX A;  1ZG4 A;  4KZB A;  4OOM A;  4OQI A;  1K54 A;  3GTC A;  4WBG A;  1IYQ A;  3QNB A;  4JF5 A;  5DF9 A;  1K4F A;  1K6R A;  4DKI A;  5A92 A;  1KE0 A;  1BTL A;  1CEG A;  3EQV A;  3SS3 A;  4DXB A;  2A3U A;  1ESI A;  2OSU A;  4K0W A;  5GHX A;  3GQZ A;  5CED A;  1RGY A;  2ZC5 B;  5CHU A;  2ZQ9 A;  3G34 A;  3Q81 A;  1LHY A;  4GNU A;  5DTK A;  5G18 A;  2Y2Q A;  4PM6 A;  2WAE A;  2VGK A;  1QME A;  3GR2 A;  4D2O A;  3VP4 A;  3AGE A;  1PWG A;  5AQ7 A;  3IXB A;  2RCX A;  2ZQD A;  4N92 A;  1H8Y A;  3N6I A;  3G2Z A;  1MKI A;  2HDQ A;  4DF6 A;  3PBN A;  3DTM A;  1BT5 A;  2BLS A;  1KGE A;  2H0T A;  2J8Y A;  3G31 A;  4OOY A;  4S2L A;  2ZM8 A;  4S2J A;  4HEF A;  2OLU A;  1C3B A;  1FOF A;  3O88 A;  2Y2O A;  3IF6 C;  4K91 A;  4E3O A;  3N8L A;  1BLC A;  5GHY A;  2UWX A;  4M3K A;  4H8R A;  1Q2Q A; 
#chains in the Genus database with same CATH topology
 4MBH A;  1XGJ A;  4KZ6 A;  4UQI S;  3A0V A;  3HUN A;  3KYZ A;  2HUE B;  5DF8 A;  1JFI A;  1P3A C;  3LO7 A;  3L2A A;  1P34 D;  1P3G C;  4JXW A;  3W98 D;  2FN2 A;  3S7Q A;  3C1B A;  4KZ7 A;  5F69 A;  3G32 A;  3C1B D;  3WA9 B;  2OOL A;  2HF6 A;  4IBX A;  3KS4 A;  2V0U A;  1AWI A;  4ZBJ C;  4S2O A;  5CGX A;  2QYB A;  1GHP A;  3NIA A;  3SOI A;  4R8P B;  4EUZ A;  3C7U A;  1KX4 D;  3AFA B;  2JN7 A;  1Y54 A;  3O62 B;  4A5R A;  4GB7 A;  3UE6 A;  4YM6 A;  4IBJ A;  4OJP A;  5F99 D;  4F3L B;  4PM5 A;  1NJ4 A;  1TVF A;  2D02 A;  4UAA A;  4DRT A;  1FCN A;  2P9V B;  5JRG A;  1ED7 A;  3BEB A;  1IEM A;  3BYD A;  1F1E A;  2G2W A;  1ZG6 A;  1I2W A;  1TDL A;  3P09 A;  3REL C;  4OQH A;  4GD8 A;  2NQB D;  1BUE A;  3RJU A;  1HLU P;  4PM9 A;  4MN5 A;  4KG6 A;  3H0M C;  5IU1 A;  4J8W D;  4PMA A;  4MEZ A;  5CPJ D;  2VZW A;  3CPT B;  2PBY A;  3VSK A;  2V9A A;  2OWH A;  5HAP A;  3EOI A;  4J8U C;  1P3O C;  5CTN A;  5B32 D;  3LID A;  1OTA A;  3MGS D;  4JJN C;  1E3U A;  4OQ0 A;  2HDU A;  2VV7 A;  4IVI A;  2ZC4 B;  2M7U A;  2B18 A;  3WTP E;  2HDR A;  2Y8H A;  1ID3 A;  4Z66 A;  1ID3 D;  4B88 A;  2P7J A;  5A93 A;  3X1V A;  3AZL A;  3LZ0 C;  4J8V B;  2I9V A;  1UGU A;  1YLY A;  2XSS A;  3IH8 A;  4D60 A;  1XPB A;  1GSX A;  5B24 A;  3AZJ C;  3VH6 T;  1X0O A;  2OLV A;  4J8X D;  2ARO B;  5C3I C;  1W1P A;  1FSY A;  4H9O A;  4NFT A;  4H9R B;  2IWD A;  1B6W A;  4OON A;  2A2L A;  3C8C A;  3T4L A;  5HAR A;  1M1A A;  5EVI C;  4X55 A;  5AVB A;  3HON A;  2CV5 B;  1BUL A;  2J80 A;  2FFF B;  1M19 C;  5B0Y A;  5C5K A;  3AZM A;  4HMC A;  3AZM D;  4XZQ A;  3BFG A;  3IS2 A;  4XZQ D;  3NCK A;  2ZMA A;  3QP1 A;  3UB6 A;  5L09 A;  2NZD A;  1G6O A;  1YU0 A;  1GA0 A;  5B1L A;  4S2M A;  3OPL A;  4C3Q A;  3LY4 A;  1ES3 A;  3OPH A;  2J8P A;  3FG8 A;  2V20 A;  2OV5 A;  3WTP B;  1P3L D;  4M6B A;  1JWV A;  3DTE A;  4HBU A;  3LIF A;  2A24 A;  1AOI B;  3F1P B;  1NZO A;  3LIC A;  3I7J A;  5GXQ B;  5FSR A;  2V1B A;  3EPH A;  5MC7 A;  2FFY A;  1NWZ A;  3IF6 A;  4BQM A;  4MBF A;  3MNN A;  1MWU A;  4R23 A;  2J3T C;  3S7N A;  5FQI A;  3C2W A;  2PU4 A;  3MFD A;  5HZH A;  3WAA B;  3BY9 A;  2CMN A;  3NBL A;  3DAV A;  3ZHH A;  1XJ2 A;  3DTK A;  1FR1 A;  4MB3 A;  3KXB B;  3GRJ A;  1ZLA D;  4H6J B;  4EO5 B;  3UN7 A;  4CLC E;  2BYK B;  1IKI A;  2ZQC A;  3HLC A;  4XUX A;  3X1S A;  2ZC3 B;  3F1O B;  3X1S D;  4GJ4 A;  2IWB A;  4YS3 C;  2Y2I A;  3REJ B;  3KUY D;  3A3F A;  1T1B A;  4LV2 A;  4WZ5 A;  2EX8 A;  3W99 B;  4QLC D;  3WS4 A;  3MGR C;  2E8I A;  3V9R B;  1MXO A;  5BS7 A;  2WGV A;  1K56 D;  4BD0 A;  1Y4O A;  3B6G C;  4RX2 A;  2YKF A;  4DE1 A;  3VFH A;  4WU9 C;  1U35 A;  4X23 D;  5B31 G;  3UB9 A;  5AVC D;  1K25 A;  1UWP X;  4BBT A;  5FUG A;  3REK B;  3AZH A;  3Q1F A;  5B2J C;  2Y2N A;  4NE5 A;  4JF4 A;  1F66 C;  2Y59 A;  4Y17 A;  2VJW A;  2PRF A;  4P6Z M;  2BYM A;  5L07 A;  3TJZ C;  3UTB D;  1ULY A;  3OC2 A;  1N4O A;  3UDI A;  4WU8 A;  1F2K A;  2W1T B;  4GDN A;  1S32 A;  3WKJ A;  3P7N A;  1S32 D;  4MB5 A;  2V8C A;  1OTE A;  3RXW A;  1CI9 A;  3S4X A;  4L0L A;  4G92 C;  4CLC B;  4GS9 A;  4ZUX B;  1KX5 A;  3WS0 A;  1KX5 D;  4GW9 A;  5B2I B;  3UPP A;  1SCW A;  3SZT A;  1EI5 A;  4KUK A;  5HFO A;  4Z5T D;  4UPK A;  4I3A A;  1NY0 A;  4WMC D;  3W8K A;  3HSH A;  1BZA A;  2VGJ A;  3G6O A;  2ZJ9 A;  3VH5 T;  3KX0 X;  5AV5 C;  4NG2 A;  1JVJ A;  3MQQ A;  1YU2 A;  2IO5 B;  5AJG A;  4CAY B;  5TBM B;  4MBK A;  5BT1 D;  4ZDX A;  1GHM A;  1KX3 D;  3S1Y A;  4ZJ1 A;  1O7E A;  3WRT A;  4ZRR A;  2ZY2 A;  2DRW A;  4E6X A;  1YLT A;  1KVM A;  5JYP A;  3MBZ A;  4MN7 A;  3PBS A;  3C1B C;  4UA7 A;  3WA9 A;  5HAQ A;  3WA9 D;  2QJ7 A;  4H9Q B;  5L2F A;  4L9E A;  5F1F A;  3BRM A;  5FQK A;  2RIQ A;  2O0Y A;  4LCL A;  4R8P A;  4JLF A;  4XT2 B;  4UEY A;  1EW0 A;  2H5S A;  3AFA A;  3MQO A;  3AZF B;  3ZG5 A;  2Y2L A;  5B0Z B;  3O62 A;  1ERM A;  5B32 G;  3NUL A;  4DE2 A;  1M18 B;  3AN2 B;  5DKK A;  4F3L A;  4WL9 A;  2YFW B;  3W2Z A;  4YM6 C;  4IED A;  3N3F A;  4EV4 A;  2P9V A;  1HTZ A;  3CHW P;  5IS1 A;  4HP4 A;  1HQ3 B;  1ES4 A;  5JRG C;  5AQA A;  4WEK A;  3CLO A;  3NQJ B;  4Q0H A;  1E6R A;  1P3G D;  2JKT I;  5F82 A;  4HNB A;  2IA2 A;  3RXX A;  3NY4 A;  3LEL B;  2HV1 A;  5FQQ A;  1GA9 A;  1YLW A;  3CPT A;  2WKE A;  2XGN A;  4JKT A;  2XLN A;  3E98 A;  5AV8 B;  1YLP A;  4BEN A;  3CZD A;  4NE3 A;  5CEB A;  2GX5 A;  3G30 A;  3MKF A;  2P04 A;  4O7D A;  1P3B B;  2QZ6 A;  3T1Q B;  4IBC A;  3IHA A;  5G4Z A;  1ID3 C;  4Z66 C;  2B95 A;  1TD5 A;  3X1V C;  3B0C T;  4J8V A;  3AZL C;  5CEC A;  4LV3 A;  4IJE A;  4BJP A;  4Y0T A;  5B24 C;  1VQQ A;  4X25 A;  3FZC A;  4GD6 A;  2ARO A;  1DJA A;  3C7V A;  4OP8 A;  2QPN A;  2ZOH A;  3REL D;  4EWF A;  3D3O A;  4H9R A;  2XDM A;  2ZM2 A;  4HBT A;  5AV6 B;  2Q9M A;  1GPF A;  4FOF A;  2WKH A;  3GSG A;  1P3K B;  4J8U D;  1P3O D;  3MXS A;  5IHV A;  2CV5 A;  3PTE A;  2Y4A A;  3UT9 B;  3BFC A;  4FCF A;  3N8S A;  5B0Y C;  3SS4 A;  5GT0 B;  3AZM C;  4XZQ C;  2HJE A;  1TZY B;  4OPY A;  4EQI A;  3LGO A;  2NZD C;  1T1A A;  5AQB A;  1E6P A;  5DJT A;  2F8N G;  5B1L C;  1T18 A;  4ARZ B;  4MB4 A;  1K54 A;  3UB5 P;  1IYQ A;  3QNB A;  4WJ3 C;  4JF5 A;  3RH8 B;  4DKI A;  5A92 A;  1KE0 A;  3WTP A;  4DXB A;  4K0W A;  3WTP D;  1ESI A;  4CSR B;  2F8N H;  5CHU A;  2ZQ9 A;  4GNU A;  5KDM B;  4PM6 A;  2VGK A;  1AOI A;  3F1P A;  3OBF A;  3IXB A;  1YU1 A;  3MQL A;  2DMW A;  1P3P B;  5GXQ A;  2K31 A;  3DTM A;  1BT5 A;  2H0T A;  1KGE A;  4HEF A;  1OPX A;  1M19 D;  3OOV A;  2V1A A;  5HDD A;  4YOF A;  3IF6 C;  1P3M B;  4NY2 A;  3WAA A;  3LZ1 B;  4NXG A;  1LSX A;  2ZC6 B;  4JGP A;  1HD8 A;  3EPL A;  3W4O A;  3KXB A;  4H6J A;  3HCY A;  2XK1 A;  3AL0 C;  1OTB A;  4X56 A;  4FUW A;  2BYK A;  4G3W A;  4LD9 B;  1G68 A;  1N1J B;  3F1O A;  3ITA A;  1W1V A;  3X1S C;  3REJ A;  2ZMF A;  4AFI A;  3N8R A;  3REJ D;  4E6W A;  4LRZ E;  2A24 B;  3AYW B;  4WZ5 C;  4HJ3 A;  3R7W B;  3W99 A;  3KWQ B;  2OWJ A;  3E4P A;  3L28 A;  4S2P A;  3V9R A;  1ALQ A;  2X71 A;  1Q9C A;  3PAE A;  5BS7 C;  4Q0J A;  5DTT A;  1CJF A;  1WWS A;  4OJL A;  1A0K A;  4AWL B;  3B3X A;  1KE3 A;  3MNN B;  2NUP C;  1U35 C;  1B67 A;  5GHZ A;  3FV7 A;  3WS2 A;  3M2K A;  4H9N A;  4X6T A;  4ZBE A;  1V9Z A;  3AV2 A;  3REH B;  2ZMV A;  4JPM A;  3REK A;  4KUD B;  3AZH C;  1JTD A;  5GT3 B;  3WS1 A;  5CP6 B;  1P3I B;  3HBR A;  3VE4 A;  2L5A A;  4JGO A;  2V8F A;  1E8B A;  1MWR A;  3ULF A;  3JPU A;  3V67 A;  3EPJ A;  2W1T A;  4WU8 C;  3VH5 W;  1CK3 A;  1K38 A;  5GSU B;  4PKY A;  4Q0I A;  1S32 C;  3WKJ C;  3A6N A;  1I2S A;  3BFE A;  3UDF A;  5J4E A;  4CLC A;  4I3I A;  4CLC D;  4ZUX D;  1KX5 C;  3MMH A;  4NEE D;  5B2I A;  3M7P A;  4G91 C;  3WS5 A;  3M6H A;  5HWW A;  4EQ1 A;  5CPK B;  2HZ5 A;  3KSI A;  4HME A;  4NXB A;  1IYS A;  5EVL A;  3KSH A;  5FI2 A;  4U0X A;  4GZB A;  4WU9 D;  3W96 B;  3NOU C;  3HLF A;  4HJ4 A;  3PYP A;  4ZJ2 A;  1BLH A;  1T3U A;  4CAY A;  5TBM A;  3LJA B;  5B2J D;  5BT1 C;  3A3I A;  3LUQ A;  1YMS A;  2RL3 A;  5AV9 D;  3MVD B;  5F83 A;  2HUE C;  2QWS A;  4Z2J A;  1DP8 A;  2EFX A;  4P6Z S;  4XUJ B;  3W4Q A;  1SKO B;  3WA9 C;  4Y3I A;  4NYY A;  2Z2M B;  3A1I A;  5DNM B;  1H8Z A;  1LL5 A;  1L0F A;  3V50 A;  4H9Q A;  4E3I A;  1PWD A;  4BL3 A;  1LL9 A;  4IJF A;  5CER A;  1FCM A;  3T12 B;  4XT2 A;  4R8P C;  2J9P A;  4OP5 A;  1ZTU A;  3AZF A;  1ONG A;  3AFA C;  5AV5 D;  5G4Y A;  5B0Z A;  4ID4 A;  4B9O A;  1BSG A;  3NOT C;  3O62 C;  1M18 A;  3AN2 A;  4PAU A;  2YFW A;  3AN2 D;  1W5D A;  2W0N A;  5FAS A;  4NZ5 A;  2WZX A;  3DWK A;  3VP2 A;  1PRQ A;  1HQ3 A;  3GDI A;  3K3D A;  1PZP A;  3FC7 A;  5B1M B;  4L9G A;  3QP4 A;  4OLD A;  3NQJ A;  3A0R A;  5B33 B;  3KSF A;  3T4J A;  3UPN A;  3IX3 A;  4II7 A;  3LEL A;  1Z09 A;  1ZKJ A;  4LLO B;  4EBN A;  5KSC A;  3JVU A;  5AV8 A;  3NDE A;  5EE8 A;  5AV8 D;  1KE4 A;  1H8P A;  2YFV B;  3IQA A;  1W79 A;  1NZU A;  2W27 A;  2WAD A;  2XD1 A;  1P3B A;  3T4O A;  1N9B A;  1P3B D;  4WNN B;  2JKT M;  2PYO B;  1AIW A;  4LGW A;  4YM6 D;  1CF0 A;  4TX8 A;  3ZNY A;  3NQU B;  4J8V C;  3BFD A;  3B0B A;  5JRG D;  1KGG A;  3HLE A;  2GJ3 A;  3AZN B;  4EW7 A;  1LLB A;  3IX4 A;  4KZA A;  1TS0 A;  1CQA A;  2ARO C;  4Y7P A;  2Y2H A;  1O07 A;  2YKH A;  4Z2M G;  4DE0 A;  1PZR A;  4EU0 A;  5KZH A;  5AV6 A;  1TS7 A;  1H5X A;  4KG5 A;  4DRA A;  5A91 A;  3GVB A;  2JCH A;  3EGX C;  4WEJ A;  1P3K A;  4Q8I A;  1P3K D;  1GSV A;  1BH8 B;  3PBQ A;  2CV5 C;  3UT9 A;  4HI4 A;  2V0W A;  3UPO A;  5M18 A;  3MS6 A;  5GT0 A;  5GT0 D;  3O86 A;  1E3U D;  1TZY A;  4PPR A;  1TZY D;  4E04 A;  2PAV P;  4Z66 D;  4JXV A;  3LIA A;  2J7V A;  4X1L A;  5HX9 A;  4DJ3 A;  1PZO A;  4ARZ A;  3X1V D;  3AZL D;  1KS0 A;  1K54 C;  3D4F A;  1FSW A;  3R4K A;  5B24 D;  2W1R A;  3IH9 A;  1K57 A;  1BYW A;  3WTP C;  3AZE B;  4CSR A;  2ZQ8 A;  2HDS A;  2R9W A;  5KDM A;  1STZ A;  2ZD8 A;  4Y0U A;  1AOI C;  3ZVW A;  5F5Y A;  3UB8 A;  2JBF A;  4KZ9 A;  2XH9 A;  4KQD A;  1M1A D;  1P3P A;  1P3P D;  5GXQ C;  5AVB D;  4R4R A;  2WZZ A;  4XXR A;  3KS8 A;  5DFY A;  4KZ8 A;  3D72 A;  4FD8 A;  5EM0 A;  3RFB A;  3ISG A;  3AZI B;  2E8J A;  5B0Y D;  2CC1 A;  5AY8 B;  4CPK A;  2Z6D A;  1P3M A;  3HUM A;  2NZD D;  3HL9 A;  4LV1 A;  1QMF A;  3LZ1 A;  3WAA C;  4ME4 A;  3LZ1 D;  1Y28 A;  2V5O A;  5B1L D;  5E2G A;  3C1C B;  2HGV A;  4BMW A;  3R45 B;  3X1U B;  5HL6 A;  2CWE A;  1SDN A;  4EO5 C;  3HUO A;  2XF3 A;  3IWQ A;  1L0D A;  4LD9 A;  1G6A A;  3TE8 A;  1N1J A;  2QMI A;  5B40 B;  4EET B;  3REJ C;  4WLA A;  3MGQ B;  3AYW A;  1KVL A;  1IFQ A;  2GZA A;  3R7W A;  3KWQ A;  1LSW A;  2W3H A;  3A3D A;  3W99 C;  3E2K A;  2H28 A;  4H9P B;  2ZBB A;  1W1T A;  3LR4 A;  3Q7V B;  4N9K A;  3UTA B;  1F5M A;  1GHI A;  3MNN D;  5FAP A;  3BQA A;  4ETZ A;  3PBT A;  2W3G A;  3AGF A;  3REH A;  4KUD A;  3REK C;  3ZNT A;  5GLA A;  5GT3 A;  4WN5 A;  3UY6 A;  4RYE A;  5CP6 A;  1P3I A;  2VK3 A;  2M7V A;  3REI B;  4R3A A;  4EUV A;  2G5I C;  4JGQ A;  3VFF A;  1E25 A;  5GSU A;  3X1T B;  1CI8 A;  3UE1 A;  1M40 A;  4Z2K A;  4CLC C;  4ZUX C;  1XKZ A;  1J3W A;  3SH7 A;  5B2I C;  5F6A A;  1F98 A;  5CPK A;  4LV0 A;  3W97 B;  3IT9 A;  3V3S A;  4OJ6 A;  4Z2G A;  2PR6 A;  3W96 A;  3IWO A;  3WRZ A;  5AQ9 A;  1U35 D;  2JC7 A;  3AV1 B;  1HZO A;  1LI9 A;  5CRF A;  4R3J A;  1PDC A;  4H9N B;  5IT5 A;  3HLG A;  3AV2 B;  4FH2 A;  4GKU A;  3LJA A;  2IO5 C;  5U47 A;  3LJA D;  3AZH D;  4HJ6 A;  4O01 A;  3EWK A;  4N1H A;  3MVD A;  5AV9 C;  3MVD D;  2X01 A;  2W3F A;  4P85 A;  1D1J A;  4KQO A;  2XEP A;  2NUT C;  4I38 A;  3BM6 A;  4WU8 D;  4XUJ A;  4L9F A;  4GH9 A;  3MJQ A;  1SKO A;  3WKJ D;  3A6N B;  3O5Y A;  4JGR A;  3VH6 A;  3N4I A;  4N9L A;  4QWO A;  2BG1 A;  4R0Q A;  1TEM A;  3EEH A;  3T4S A;  5DNM A;  5EV0 A;  1PI5 A;  2ZC7 A;  1KDS A;  4WV4 B;  3B0D B;  3SS5 A;  3T50 A;  1I5Q A;  1R4V A;  1YU4 A;  3LYX A;  4NXF A;  5FL3 A;  3CG5 A;  5EM1 A;  4YS3 B;  2EWW A;  4BBU A;  2FJ7 B;  1RCJ A;  3CWF A;  5LBR A;  3AZF C;  5B0Z C;  1M18 C;  3AN2 C;  4WZS B;  1K6R A;  3SS3 A;  3EQV A;  1HQ3 C;  5CPI B;  5B1M A;  1LSV A;  3VE3 A;  3B6G B;  1S4R A;  2ACG A;  5DTK A;  5B33 A;  1QME A;  3AGE A;  2RCX A;  2ZQD A;  1H0M A;  3G2Z A;  1MKI A;  4DF6 A;  3PBN A;  3LEL C;  4B93 A;  4ETX A;  2OLU A;  1FOF A;  3UMD A;  4K91 A;  5AV8 C;  2YFV A;  4Y2F A;  3T4Q A;  4H8R A;  3BLM A;  4HOI A;  1UR8 A;  4LEN A;  4R8P D;  4NZ3 A;  2XRN A;  3AZK B;  3AFA D;  1P3B C;  2IOU A;  3B6F B;  4WNN A;  1H3O B;  5HPF A;  5J7E A;  2X02 A;  5L10 A;  3O62 D;  3EPK A;  2PYO A;  3IF5 A;  5B31 B;  5E5A B;  5DF7 A;  3NQU A;  4KZ5 A;  2GNX A;  3QP6 A;  4HH2 A;  4X68 A;  3AZN A;  2WGW B;  2VX8 A;  5HDS A;  3CUE A;  5TR7 A;  3SH8 A;  3VOL A;  2Z2L B;  3Q07 A;  1NRJ A;  5DNN B;  2EX6 A;  4QU3 A;  1NXY A;  3MZD A;  1BFM A;  1N9N A;  1LI0 A;  2ZY4 A;  5AV6 C;  2VV8 A;  4Y0O A;  4BL2 A;  1CXW A;  1P3K C;  1BH8 A;  4R70 A;  3ZG7 B;  3UT9 C;  3VH6 W;  3L26 A;  1W7F A;  1IYO A;  3HRE A;  5HD3 A;  1P34 B;  2WAF A;  5GT0 C;  1D7E A;  5CGS A;  3RTY A;  3W98 B;  3E4O A;  1TZY C;  3P5J B;  3DW0 A;  4WYY A;  5HAI A;  1E6N A;  3VSL A;  1CK7 A;  4IBB A;  5A90 A;  4MDZ A;  3B33 A;  4B4Z A;  5BPV A;  4J8V D;  2FZ0 A;  4DN0 A;  3PBR A;  2R9X A;  5G49 B;  5E2F A;  5FEF A;  3IX8 A;  4ZAM A;  3QP8 A;  3AZE A;  1K57 C;  3BY8 A;  4K0X A;  2ARO D;  3MR0 A;  4QJG A;  1WE4 A;  1KX4 B;  3TOI A;  4EES A;  5FI6 A;  2H0Y A;  5F99 B;  1J9M A;  1M1A C;  5FI7 A;  4CQH A;  3MZE A;  4GDB A;  3JYI A;  1P3P C;  3G4P A;  3P01 A;  5AVB C;  4KZ4 A;  2CV5 D;  1PW1 A;  2Y2G A;  3AZI A;  2LB5 A;  3LIE A;  4HQA A;  4B4X A;  5AY8 A;  2NQB B;  1P3F B;  1KDW A;  1P3M C;  3Q7Z A;  4Z2L A;  1NRF A;  4J8W B;  3O3V A;  5M19 A;  3LZ1 C;  4E3J A;  5CPJ B;  1K4E A;  4EER A;  4X53 A;  4OQG A;  3C1C A;  2QKP A;  3R45 A;  4U0T A;  3L29 A;  1YLJ A;  3X1U A;  3VH5 A;  2GDN A;  5B32 B;  1H8M A;  2MJ6 A;  4FSF A;  3MGS B;  4JJN A;  1FCO A;  4LD9 C;  5B40 A;  2EX9 A;  3SW1 A;  1KGF A;  1YAX A;  3KYE A;  1H0G A;  3A1K A;  3MGQ A;  3C38 A;  4FH4 A;  3AYW C;  3GEC A;  5CHL B;  1AOI D;  1XFN A;  3KWQ C;  3L27 A;  4IBR A;  5GXQ D;  4H9P A;  2PYR A;  1ONH A;  2KOI A;  3Q7V A;  3WD2 A;  1FIK A;  4J8X B;  3UTA A;  2Y2K A;  3LI9 A;  5EFW A;  1YUE A;  4AWL C;  3G2Y A;  3MNN C;  2KDK A;  4E45 A;  2HIO B;  5CHM A;  3WAA D;  2W3E A;  5EVI A;  3GV9 A;  3REH C;  4U3T A;  2VGL M;  3MXR A;  5L8M A;  3KXB D;  3OCL A;  5FQ9 A;  4KHA B;  2EA9 A;  3IXH A;  5GT3 C;  3FYZ A;  2RVQ C;  1ERO A;  3REI A;  5CP6 C;  1MWT A;  1P3I C;  1PWC A;  3LY3 A;  3REI D;  1P97 A;  2OAP 1;  5F1G A;  2XRO A;  4G3K A;  3ZG9 B;  4KUO A;  3T1S A;  5K5B A;  4P0M A;  2EWV A;  3ZG0 A;  1YU3 A;  3F1N B;  3X1T A;  5J8X A;  4IBI A;  3VOZ A;  4Y15 A;  3IXD A;  4KEN B;  1SDE A;  2ZL1 B;  3W99 D;  1PYY A;  4EBL A;  3CI6 A;  4OOL A;  3FDD A;  3H0R C;  1RP5 A;  3HLB A;  3W97 A;  3B42 A;  1CEF A;  3W97 D;  2L0W A;  2ZM5 A;  1P3L B;  1P9R A;  5FA7 A;  3W96 C;  5DKL A;  3AV1 A;  3MGP B;  3L7H A;  4S2I A;  4E3M A;  5EUA A;  2PU2 A;  3SH9 A;  3AV2 D;  3REK D;  4WM9 A;  3LJA C;  4H9S A;  3MVD C;  1F9I A;  4HH3 A;  1N9L A;  2F8N B;  2F2A C;  1VB6 A;  1FR6 A;  5DFX A;  2M1C A;  4RA7 A;  4XUJ C;  2P74 A;  3A6N D;  2G2U A;  3QNC A;  3Q82 A;  5HSQ A;  4KQR A;  5DNM C;  1OTI A;  1ZLA B;  2HP6 A;  5KMW A;  4Z2H A;  5B2I D;  5KSH A;  3VMA A;  4OLG A;  1OJ5 A;  2V1Z A;  2DCF A;  1S0W A;  2QHK A;  4YS3 A;  1YKD A;  3KUY B;  2FJ7 A;  1ES2 A;  4HMD A;  4JXG A;  4QLC B;  4F94 A;  1FQG A;  3BJN A;  4Y5F A;  2INW A;  5CPI A;  3UE0 A;  3TU4 B;  5FAO A;  3B6G A;  5B1M C;  1MWS A;  3AZG B;  4DMZ A;  1SHV A;  4WZ4 A;  5D3O A;  4X23 B;  5B33 C;  2VA0 A;  3DWZ A;  5AVC B;  3FKE A;  1XA7 A;  4KQQ A;  3B47 A;  5JA4 B;  1LT0 A;  2O9A A;  3NDG A;  1Q2P A;  3C4O A;  3UTB B;  4OJ5 A;  4BLM A;  1W2E A;  4O0P A;  3AZK A;  3IBJ A;  5HW3 A;  3AZF D;  3B6F A;  1H3O A;  5B0Z D;  2PYO C;  2Y2P A;  1M18 D;  2RTS A;  5B31 A;  3U2A A;  5E5A A;  3TG9 A;  3S7O A;  1HQ3 D;  2PHY A;  5BO0 B;  3AZN C;  2WKI A;  4Z5T B;  2WGW A;  4ZJ3 A;  1BLP A;  3CUE C;  4E3N A;  3CIT A;  4IBF A;  2PT7 A;  3BFF A;  3O87 A;  3V5M A;  1S66 L;  5DNN A;  2HP9 A;  4X69 A;  3LEL D;  1YSP A;  3EG5 B;  1JWP A;  3IXG A;  3B0C W;  4NE6 A;  1KX3 B;  4OKP A;  4KGC B;  2OAQ 1;  3FKV A;  3PAG A;  1PFL A;  4NK3 A;  1XJ4 A;  4HHD A;  4X1M A;  3WWX A;  1P34 A;  3AGD A;  3W98 A;  2Y55 A;  3CJM A;  3FKW A;  1NLZ A;  3S22 A;  1P9W A;  1K6S A;  1V9Y A;  4LCM A;  2Y2M A;  4GHA A;  3M2J A;  1EQZ B;  3HJI A;  3NC8 A;  1ODV A;  2HP5 A;  3LEQ A;  3LFV A;  4DJ2 A;  4GLQ A;  3MXQ A;  4HGA B;  3TSG A;  5G49 A;  3OPR A;  1GXD A;  1K55 A;  1L6J A;  3AZE C;  3T4T A;  1XA1 A;  4P6B A;  1KX4 A;  5TGF A;  2D01 A;  3KFU G;  4IBE A;  1W63 Q;  5F99 A;  2WYX A;  5AV6 D;  1E4D A;  3H82 A;  1YLZ A;  4OPR A;  1TS8 A;  3JVV A;  4IUH A;  3ZCZ A;  5FEG A;  3WD1 A;  4OVD A;  2L4R A;  4PM8 A;  4OPZ A;  4M4X A;  1PI4 A;  3UT9 D;  1ESU A;  1P0Z A;  4IVK A;  4Z2M H;  1P3A B;  4N1X A;  3AZI C;  1FIL A;  1P3G B;  2G5H C;  1YM1 A;  2B5R A;  2NQB A;  5AY8 C;  1P3F A;  2EFU A;  4ZTK A;  3NHQ A;  1P3F D;  3OCN A;  4J8W A;  1N9O A;  1UWN X;  3VP0 A;  3EQU A;  5CPJ A;  3EGD C;  4BWI A;  1PNE A;  3C1C C;  3X1U C;  1EWZ A;  1RGZ A;  4ZBJ B;  5B32 A;  3UDX A;  3MGS A;  4GHL A;  4XUZ A;  4GCZ A;  4MCW A;  5B40 C;  4QD4 A;  4RQ9 A;  3DTI A;  1K0K A;  1JWZ A;  3MGQ C;  5E2E A;  4BD1 A;  4NYU A;  1OME A;  1W8Q A;  3S7P A;  2JE5 A;  3MQ0 A;  3WD3 A;  1XJ6 A;  3H9W A;  2XA7 M;  1ES5 A;  4RVA A;  4J8X A;  4UUZ B;  4R38 A;  2J9O A;  3UTA C;  1ZG4 A;  3NEC A;  4KZB A;  3REL B;  4OQI A;  2HIO A;  1P3M D;  2HIO D;  2JKR I;  1K4F A;  2B02 A;  3F6T A;  1KU5 A;  1BTL A;  1CEG A;  1YSQ A;  3MF0 A;  5GHX A;  4J8U B;  1P3O B;  1RGY A;  2O9C A;  3KXB C;  4KHA A;  3G34 A;  3EEA A;  1LHY A;  1IOU A;  5G18 A;  3LR3 A;  3REI C;  2WAE A;  3GR2 A;  4LG2 A;  3VP4 A;  1PWG A;  3HJK A;  4JJN B;  4LD9 D;  5AQ7 A;  1H8Y A;  3N6I A;  2HDQ A;  1VHM A;  2J8Y A;  3F1N A;  4OOY A;  4OUI A;  2Z6C A;  4Z2I A;  4S2J A;  3X1T C;  3AYW D;  1C3B A;  2ZL1 A;  2Y2O A;  3KWQ D;  3LZ0 B;  4E3O A;  5GHY A;  4M3K A;  4PKY G;  3AZJ B;  3PBO A;  2ZLY A;  3W97 C;  1P3L A;  4KG2 A;  5C3I B;  4MMN A;  2UV0 E;  1DJB A;  2ZY5 A;  3MGP A;  5EOO A;  1VEU B;  3AV1 C;  3MGP D;  4PHT A;  1Z6F A;  4LPZ A;  5FQJ A;  5EVI B;  3REH D;  3AV2 C;  3TRC A;  4KUD D;  1LL8 A;  2Y2J A;  4LFU A;  4H9S C;  5GT3 D;  2RVQ D;  1WWI A;  5CP6 D;  1EAK A;  1P3I D;  1M19 B;  3KSG A;  4R3B A;  3UME A;  2F8N A;  1GOI A;  3G35 A;  2F8N D;  2VGL S;  5GLD A;  4HES A;  2ZQA A;  2R78 A;  4EBP A;  5GSU D;  4YIN A;  3L25 A;  2VEA A;  1XP4 A;  3A6N C;  2WKR A;  3PHY A;  1L0E A;  1A7W A;  1ZLA A;  1IEL A;  4S2N A;  3B0D C;  4HP9 A;  3KO6 A;  5CPK D;  3BWL A;  3BQ8 A;  4QNL A;  1D06 A;  3W96 D;  1S1Y A;  1VET B;  5EVE A;  3KUY A;  3H0L C;  2FJ7 C;  4O8G A;  4QB8 A;  1ERQ A;  2BAS A;  1BH9 B;  3IWI A;  4QLC A;  4JBF A;  3IHB A;  2XQZ A;  2Y91 A;  1TF1 A;  5BNV B;  5FAQ A;  1K56 A;  3ZGA B;  3H7W B;  3TU4 A;  5CPI C;  3TU4 D;  5CXW A;  5KIZ A;  5HPI A;  3AZG A;  4X23 A;  3AZG D;  4Z9Q A;  1XXM A;  2VV6 A;  4KZ3 A;  5AVC A;  4XUJ D;  1IYP A;  2IWC A;  3VP3 A;  2AVX A;  5BNX B;  3UO9 A;  5JA4 A;  2PD7 A;  4GHI B;  5DNM D;  1DP9 A;  2DNS A;  2HPB A;  3MSH A;  3FWL A;  3LI8 A;  3ZG8 B;  3UTB A;  2WKP A;  5GL9 A;  3LR5 A;  3BEC A;  3L9K A;  3NI9 A;  1G28 A;  3AZK C;  3FPW A;  3B6F C;  1H0I A;  2D49 A;  1J7M A;  3MFX A;  1OJG A;  1S67 L;  4CJN A;  3ZVT A;  3MGR B;  5B31 C;  5E5A C;  2W3D A;  1TS6 A;  2I72 A;  3KSY A;  3A3E A;  5BO0 A;  3BLS A;  5B1M D;  4Z5T A;  1H3Q A;  3K2N A;  3NOP C;  4WMC A;  4E3K A;  4WU9 B;  5B33 D;  5JYO A;  2WGI A;  4LRY C;  2EXA A;  2Y79 A;  4QHC A;  4UQI M;  5TFQ A;  5DNN C;  3MZF A;  2PDR A;  4MN6 A;  4ESP A;  2K7S A;  3OPP A;  3P98 A;  5B2J B;  3C4P A;  4I3J A;  4OH0 A;  4IBD A;  1KX3 A;  1F66 B;  4P87 A;  1W1Y A;  1U60 A;  5AV9 B;  2J3W A;  4KGC A;  4Y13 A;  4KGC D;  4IBG A;  2EXB A;  2VKS A;  3V39 A;  3ICY A;  2VLG A;  1P34 C;  5GLB A;  1G5U A;  4EEU A;  3UE3 A;  3W98 C;  4PM7 A;  2ZOI A;  2G7U A;  4YWZ A;  4NKP A;  1EQZ A;  1EQZ D;  4I5S A;  2PYO D;  4WUJ A;  2ZY3 A;  4G92 B;  3QP2 A;  5J3W A;  1HVB A;  2PBD P;  4NZ4 A;  3AZN D;  1KOU A;  1WYC A;  5HL1 A;  3A0S A;  5EPH A;  3K3C A;  4MNR A;  3V3R A;  1K55 C;  5M1A A;  2JKG A;  2PR5 A;  3VV4 A;  1KX4 C;  3W4P A;  5AV5 B;  1SKF A;  2KLI A;  1WYB A;  3WD4 A;  1TAF B;  5F99 C;  3U4L P;  3UNW A;  2XFS A;  4GOG A;  1DJC A;  3ITB A;  3FPV A;  5DVA A;  1JFI B;  1P3A A;  4QY5 A;  5FDH A;  1P3A D;  1XFQ A;  1P3G A;  5I94 A;  3T4K A;  2O99 A;  3LCE A;  4DXC A;  2NQB C;  1P3F C;  3HLD A;  3C1B B;  4RX3 A;  5F68 A;  4HIA A;  3E0Y A;  4J8W C;  1JNU A;  5CPJ C;  1XGI A;  2K2N A;  4HY8 A;  1M6K A;  3GMW A;  3HLW A;  4EEP A;  5B32 C;  1BLS A;  3ZQ5 A;  3MGS C;  3AZE D;  4UA9 A;  3BW6 A;  3WD0 A;  3MKE A;  3LEZ A;  2O9B A;  4DQY B;  3C30 A;  2L1M A;  2LB9 A;  4YM6 B;  3WX7 A;  3H82 B;  3ZFZ A;  4IBK A;  4R6L A;  5JRG B;  1UR9 A;  1Z2C B;  4UUZ A;  3AZI D;  4J8X C;  5CHJ A;  3M6B A;  3REL A;  1ACF A;  5AY8 D;  2HIO C;  4EXO A;  2XR0 A;  1XJ3 A;  1YQS A;  3T1R A;  3C1C D;  4J8U A;  1P3O A;  3X1U D;  2Q0O A;  4R4S A;  3ZDJ A;  3ZYT A;  4JJN D;  5B40 D;  2C6W B;  1GCE A;  1O6I A;  4WF0 A;  5HDC A;  1MBL A;  1ID3 B;  3MGQ D;  4Z66 B;  2JKR M;  4NZ1 A;  3VOY A;  3LZ0 A;  3X1V B;  1OGB A;  3AZL B;  1OT9 A;  3LZ0 D;  5E2H A;  4E3L A;  2BTF P;  1L0G A;  3AZJ A;  5B24 B;  3AZJ D;  1TDG A;  4DE3 A;  1P3L C;  3UTA D;  2ZM0 A;  1YPR A;  2EX2 A;  5EOE A;  5CGW A;  4H9O B;  2C5W B;  1VEU A;  3A3J A;  3MGP C;  4JXS A;  2XA7 S;  3OZH A;  1WA9 A;  1OT6 A;  4NET A;  1IKG A;  5DJU A;  3LR0 A;  1M1A B;  1MY8 A;  5EVI D;  4DDS A;  4KUD C;  3NJA A;  4QY6 A;  5AVB B;  1NLY A;  4GN2 A;  1MPL A;  5HD5 A;  1M19 A;  5HWT A;  5EEC A;  1S4S A;  5B0Y B;  2QJ5 A;  3AZM B;  2Q9N A;  4XZQ B;  1L3L A;  3IS2 B;  2WK0 A;  5DTS A;  2NZD B;  2H10 A;  5GSU C;  4DDY A;  2KX6 A;  2HJ9 C;  3X1T D;  4IHQ A;  5B1L B;  1E6Z A;  1PIO A;  3E2L A;  5AVF A;  1DY6 A;  3HVF A;  1ZLA C;  4IJG A;  4S2N C;  4C6Y A;  1T19 A;  1E88 A;  5CPK C;  1OTD A;  1S1Z A;  1VET A;  4C75 A;  3KUY C;  1W63 M;  3AV1 D;  4UA6 A;  5TJJ A;  1GSW A;  1PW8 A;  2LY8 A;  2ZQ7 A;  1TAF A;  1BH9 A;  3PR6 A;  5CX7 A;  3DBA A;  4UHU A;  5FAT A;  4QLC C;  4DRB A;  1MC0 A;  5BNV A;  1YT4 A;  3H7W A;  2FH5 A;  3LIB A;  3TU4 C;  3QHY A;  1NYM A;  2JHE A;  4OJO A;  1MKM A;  3AZG C;  3IF6 B;  4X23 C;  2V2F F;  3OLO A;  2XFT A;  2J3T D;  5GLC A;  1HTA A;  2WUQ A;  5AVC C;  3VP1 A;  5BNX A;  2JKF A;  1ZC2 A;  4GHI A;  4K08 A;  3E4Q A;  4IUK A;  2P08 A;  4MLL A;  5FQM A;  2DQN C;  1DP6 A;  3UTB C;  4OPQ A;  3X1S B;  4YS3 D;  1S6R A;  1W8Y A;  2FJ7 D;  5CTM A;  1ZHH B;  1T1C A;  4JF6 A;  3PXP A;  1JTG A;  4WEL A;  2PYP A;  4G3V A;  3MGR A;  3MGR D;  1L2S A;  2DF4 C;  4ZUX A;  4LRX C;  1AXB A;  3IBR A;  5CPI D;  5BOH A;  4FTX A;  3B6G D;  2WKQ A;  2XD5 A;  4Z5T C;  1DRM A;  4WU9 A;  4S2K A;  1U35 B;  5FDS A;  3TW8 A;  4R1G A;  2A49 A;  1VM1 A;  5AVE A;  3C5A A;  5B2J A;  2W8S A;  5FUG B;  3KYQ A;  3AZH B;  3T1X A;  1XX2 A;  5E43 A;  3N7W A;  1NYY A;  1F66 A;  1KX3 C;  1F66 D;  5AV9 A;  4I39 A;  4YFM A;  3CMZ A;  1YMX A;  4KGC C;  1SZV A;  4OOM A;  1MZU A;  2BYM B;  1E15 A;  5HWV A;  3GTC A;  4WBG A;  5DF9 A;  2PD8 A;  4WU8 B;  3AZK D;  2A3U A;  2OSU A;  1S32 B;  3B6F D;  3WKJ B;  3GQZ A;  5CED A;  1EQZ C;  2ZC5 B;  1OGG A;  3Q81 A;  4NXE A;  4E44 A;  2Y2Q A;  5B31 D;  1QO6 A;  5E5A D;  4GS9 B;  1KX5 B;  4D2O A;  2F8N K;  2VQR A;  4G91 B;  4HGA C;  4N92 A;  5I5L A;  4Z1W A;  3IP4 C;  2BLS A;  3G31 A;  3CAX A;  4S2L A;  2ZM8 A;  3D9Y A;  3QP5 A;  5AV5 A;  3O88 A;  4BBV A;  5DNN D;  3N8L A;  1BLC A;  3UB7 A;  5A8B A;  2UWX A;  4YNR A;  2JSS A;  4QPR A;  1Q2Q A; 
#chains in the Genus database with same CATH homology
 4MBH A;  1XGJ A;  4KZ6 A;  3HUN A;  2HUE B;  5DF8 A;  1JFI A;  1P3A C;  3LO7 A;  3L2A A;  1P34 D;  1P3G C;  4JXW A;  3W98 D;  3C1B A;  4KZ7 A;  3G32 A;  3C1B D;  3WA9 B;  4IBX A;  3KS4 A;  4ZBJ C;  4S2O A;  5CGX A;  1GHP A;  3NIA A;  3SOI A;  4R8P B;  4EUZ A;  3C7U A;  1KX4 D;  3AFA B;  1Y54 A;  3O62 B;  4A5R A;  4GB7 A;  4YM6 A;  4IBJ A;  4OJP A;  5F99 D;  4PM5 A;  1NJ4 A;  1TVF A;  4DRT A;  4UAA A;  1FCN A;  2P9V B;  5JRG A;  3BEB A;  1IEM A;  3BYD A;  1F1E A;  2G2W A;  1ZG6 A;  1I2W A;  1TDL A;  3P09 A;  3REL C;  4OQH A;  4GD8 A;  2NQB D;  1BUE A;  3RJU A;  4PM9 A;  4KG6 A;  3H0M C;  4J8W D;  4PMA A;  4MEZ A;  5CPJ D;  2PBY A;  3VSK A;  5HAP A;  4J8U C;  1P3O C;  5CTN A;  5B32 D;  3MGS D;  4JJN C;  1E3U A;  4OQ0 A;  2HDU A;  4IVI A;  2ZC4 B;  3WTP E;  2HDR A;  1ID3 A;  4Z66 A;  1ID3 D;  4B88 A;  5A93 A;  3X1V A;  3AZL A;  3LZ0 C;  4J8V B;  1YLY A;  3IH8 A;  1XPB A;  5B24 A;  3AZJ C;  3VH6 T;  2OLV A;  4J8X D;  2ARO B;  5C3I C;  1FSY A;  4H9O A;  4NFT A;  4H9R B;  2IWD A;  1B6W A;  4OON A;  5HAR A;  1M1A A;  5EVI C;  4X55 A;  5AVB A;  3HON A;  2CV5 B;  1BUL A;  2FFF B;  1M19 C;  5B0Y A;  3AZM A;  3AZM D;  4XZQ A;  3BFG A;  4XZQ D;  3NCK A;  2ZMA A;  2NZD A;  1YU0 A;  1GA0 A;  5B1L A;  4S2M A;  3OPL A;  4C3Q A;  3LY4 A;  1ES3 A;  3OPH A;  2J8P A;  2V20 A;  2OV5 A;  3WTP B;  1P3L D;  4M6B A;  1JWV A;  4HBU A;  1AOI B;  1NZO A;  3I7J A;  5GXQ B;  5FSR A;  3EPH A;  2FFY A;  3IF6 A;  4BQM A;  4MBF A;  3MNN A;  1MWU A;  4R23 A;  5FQI A;  2PU4 A;  3MFD A;  3WAA B;  3NBL A;  3ZHH A;  1FR1 A;  3KXB B;  3GRJ A;  1ZLA D;  4EO5 B;  3UN7 A;  2BYK B;  1IKI A;  2ZQC A;  3HLC A;  4XUX A;  3X1S A;  2ZC3 B;  3X1S D;  2IWB A;  4YS3 C;  2Y2I A;  3REJ B;  3KUY D;  3A3F A;  4LV2 A;  4WZ5 A;  2EX8 A;  3W99 B;  4QLC D;  3WS4 A;  3MGR C;  2E8I A;  3V9R B;  1MXO A;  5BS7 A;  2WGV A;  1K56 D;  4BD0 A;  3B6G C;  4RX2 A;  4DE1 A;  3VFH A;  4WU9 C;  1U35 A;  4X23 D;  5B31 G;  5AVC D;  1K25 A;  5FUG A;  3REK B;  3AZH A;  3Q1F A;  5B2J C;  2Y2N A;  4NE5 A;  4JF4 A;  1F66 C;  2Y59 A;  2BYM A;  3UTB D;  1ULY A;  3OC2 A;  1N4O A;  3UDI A;  4WU8 A;  4GDN A;  1S32 A;  3WKJ A;  1S32 D;  3RXW A;  1CI9 A;  3S4X A;  4L0L A;  4G92 C;  4ZUX B;  1KX5 A;  3WS0 A;  1KX5 D;  5B2I B;  3UPP A;  1SCW A;  1EI5 A;  5HFO A;  4Z5T D;  4UPK A;  1NY0 A;  4WMC D;  3W8K A;  3HSH A;  1BZA A;  2VGJ A;  2ZJ9 A;  3VH5 T;  5AV5 C;  1JVJ A;  1YU2 A;  2IO5 B;  4CAY B;  4MBK A;  5BT1 D;  4ZDX A;  1GHM A;  1KX3 D;  3S1Y A;  4ZJ1 A;  1O7E A;  3WRT A;  2ZY2 A;  2DRW A;  4E6X A;  1YLT A;  1KVM A;  5JYP A;  3MBZ A;  3PBS A;  3C1B C;  4UA7 A;  3WA9 A;  5HAQ A;  3WA9 D;  4H9Q B;  5L2F A;  5F1F A;  3BRM A;  5FQK A;  2RIQ A;  4LCL A;  4R8P A;  4JLF A;  2H5S A;  3AFA A;  3AZF B;  3ZG5 A;  2Y2L A;  5B0Z B;  3O62 A;  1ERM A;  5B32 G;  4DE2 A;  1M18 B;  3AN2 B;  2YFW B;  4YM6 C;  4IED A;  3N3F A;  4EV4 A;  2P9V A;  1HTZ A;  1HQ3 B;  1ES4 A;  5JRG C;  5AQA A;  4WEK A;  3NQJ B;  1P3G D;  5F82 A;  3RXX A;  3NY4 A;  3LEL B;  5FQQ A;  1GA9 A;  1YLW A;  2WKE A;  2XGN A;  4JKT A;  2XLN A;  5AV8 B;  1YLP A;  4BEN A;  3CZD A;  4NE3 A;  5CEB A;  3G30 A;  3MKF A;  4O7D A;  1P3B B;  2QZ6 A;  4IBC A;  3IHA A;  1ID3 C;  4Z66 C;  3X1V C;  3B0C T;  4J8V A;  3AZL C;  5CEC A;  4LV3 A;  4IJE A;  4BJP A;  4Y0T A;  5B24 C;  1VQQ A;  3FZC A;  4GD6 A;  2ARO A;  1DJA A;  3C7V A;  4OP8 A;  2QPN A;  3REL D;  4EWF A;  4H9R A;  2XDM A;  2ZM2 A;  4HBT A;  5AV6 B;  2Q9M A;  2WKH A;  3GSG A;  1P3K B;  4J8U D;  1P3O D;  3MXS A;  5IHV A;  2CV5 A;  3PTE A;  2Y4A A;  3UT9 B;  3BFC A;  4FCF A;  3N8S A;  5B0Y C;  3SS4 A;  5GT0 B;  3AZM C;  4XZQ C;  1TZY B;  4OPY A;  4EQI A;  2NZD C;  5AQB A;  2F8N G;  5B1L C;  1K54 A;  1IYQ A;  3QNB A;  4WJ3 C;  4JF5 A;  4DKI A;  5A92 A;  1KE0 A;  3WTP A;  4DXB A;  4K0W A;  3WTP D;  1ESI A;  4CSR B;  2F8N H;  5CHU A;  2ZQ9 A;  4GNU A;  5KDM B;  4PM6 A;  2VGK A;  1AOI A;  3IXB A;  1YU1 A;  1P3P B;  5GXQ A;  3DTM A;  1BT5 A;  2H0T A;  1KGE A;  4HEF A;  1M19 D;  3IF6 C;  1P3M B;  4NY2 A;  3WAA A;  3LZ1 B;  2ZC6 B;  1HD8 A;  3EPL A;  3W4O A;  3KXB A;  2XK1 A;  3AL0 C;  4X56 A;  2BYK A;  4LD9 B;  1G68 A;  1N1J B;  3ITA A;  3X1S C;  3REJ A;  3N8R A;  3REJ D;  4E6W A;  3AYW B;  4WZ5 C;  3W99 A;  3KWQ B;  3L28 A;  4S2P A;  3V9R A;  1ALQ A;  2X71 A;  1Q9C A;  3PAE A;  5BS7 C;  5DTT A;  1WWS A;  4OJL A;  4AWL B;  3B3X A;  1KE3 A;  3MNN B;  1U35 C;  1B67 A;  5GHZ A;  3FV7 A;  3WS2 A;  3M2K A;  4H9N A;  4X6T A;  4ZBE A;  3AV2 A;  3REH B;  4JPM A;  3REK A;  4KUD B;  3AZH C;  1JTD A;  5GT3 B;  3WS1 A;  5CP6 B;  1P3I B;  3HBR A;  2L5A A;  1MWR A;  3EPJ A;  4WU8 C;  3VH5 W;  1CK3 A;  1K38 A;  5GSU B;  1S32 C;  3WKJ C;  3A6N A;  1I2S A;  3BFE A;  3UDF A;  4ZUX D;  1KX5 C;  5B2I A;  4G91 C;  3WS5 A;  3M6H A;  5CPK B;  1IYS A;  5EVL A;  5FI2 A;  4U0X A;  4GZB A;  4WU9 D;  3W96 B;  3HLF A;  4ZJ2 A;  1BLH A;  1T3U A;  4CAY A;  3LJA B;  5B2J D;  5BT1 C;  3A3I A;  1YMS A;  2RL3 A;  5AV9 D;  3MVD B;  5F83 A;  2HUE C;  2EFX A;  4XUJ B;  3W4Q A;  3WA9 C;  4NYY A;  2Z2M B;  3A1I A;  5DNM B;  1H8Z A;  1LL5 A;  1L0F A;  3V50 A;  4H9Q A;  4E3I A;  1PWD A;  4BL3 A;  1LL9 A;  4IJF A;  5CER A;  1FCM A;  4R8P C;  2J9P A;  4OP5 A;  3AZF A;  1ONG A;  3AFA C;  5AV5 D;  5B0Z A;  4ID4 A;  1BSG A;  3O62 C;  1M18 A;  3AN2 A;  2YFW A;  3AN2 D;  1W5D A;  5FAS A;  4NZ5 A;  2WZX A;  3DWK A;  3VP2 A;  1HQ3 A;  1PZP A;  5B1M B;  4OLD A;  3NQJ A;  5B33 B;  3UPN A;  3LEL A;  1ZKJ A;  4EBN A;  5KSC A;  5AV8 A;  3NDE A;  5EE8 A;  5AV8 D;  1KE4 A;  2YFV B;  3IQA A;  1W79 A;  1NZU A;  2WAD A;  2XD1 A;  1P3B A;  1N9B A;  1P3B D;  4WNN B;  2PYO B;  4YM6 D;  3ZNY A;  3NQU B;  4J8V C;  3BFD A;  3B0B A;  3HLE A;  5JRG D;  1KGG A;  3AZN B;  1LLB A;  4KZA A;  2ARO C;  4Y7P A;  2Y2H A;  1O07 A;  4Z2M G;  4DE0 A;  1PZR A;  5KZH A;  5AV6 A;  1H5X A;  4KG5 A;  4DRA A;  5A91 A;  3GVB A;  2JCH A;  4WEJ A;  1P3K A;  4Q8I A;  1P3K D;  1BH8 B;  3PBQ A;  2CV5 C;  3UT9 A;  3UPO A;  5M18 A;  5GT0 A;  5GT0 D;  3O86 A;  1E3U D;  1TZY A;  4PPR A;  1TZY D;  4Z66 D;  4JXV A;  2J7V A;  5HX9 A;  1PZO A;  3X1V D;  3AZL D;  1K54 C;  3D4F A;  1FSW A;  5B24 D;  3IH9 A;  1K57 A;  3WTP C;  3AZE B;  4CSR A;  2ZQ8 A;  2HDS A;  2R9W A;  5KDM A;  2ZD8 A;  4Y0U A;  1AOI C;  3ZVW A;  2JBF A;  4KZ9 A;  2XH9 A;  1M1A D;  1P3P A;  1P3P D;  5GXQ C;  5AVB D;  4R4R A;  2WZZ A;  4XXR A;  3KS8 A;  4KZ8 A;  4FD8 A;  3ISG A;  3AZI B;  5B0Y D;  2CC1 A;  5AY8 B;  4CPK A;  1P3M A;  3HUM A;  2NZD D;  3HL9 A;  4LV1 A;  1QMF A;  3LZ1 A;  3WAA C;  3LZ1 D;  5B1L D;  5E2G A;  3C1C B;  3R45 B;  3X1U B;  2CWE A;  1SDN A;  4EO5 C;  3HUO A;  2XF3 A;  3IWQ A;  1L0D A;  4LD9 A;  1G6A A;  1N1J A;  2QMI A;  5B40 B;  3REJ C;  3MGQ B;  3AYW A;  1KVL A;  3KWQ A;  3A3D A;  3W99 C;  3E2K A;  4H9P B;  3Q7V B;  4N9K A;  3UTA B;  1GHI A;  3MNN D;  5FAP A;  3PBT A;  3AGF A;  3REH A;  4KUD A;  3REK C;  3ZNT A;  5GLA A;  5GT3 A;  3UY6 A;  4RYE A;  5CP6 A;  1P3I A;  3REI B;  2G5I C;  3VFF A;  1E25 A;  5GSU A;  3X1T B;  1CI8 A;  3UE1 A;  1M40 A;  4ZUX C;  1XKZ A;  3SH7 A;  5B2I C;  5CPK A;  4LV0 A;  3W97 B;  3IT9 A;  3V3S A;  4OJ6 A;  3W96 A;  3IWO A;  3WRZ A;  5AQ9 A;  1U35 D;  2JC7 A;  3AV1 B;  1HZO A;  1LI9 A;  5CRF A;  4R3J A;  4H9N B;  3HLG A;  3AV2 B;  4FH2 A;  4GKU A;  3LJA A;  2IO5 C;  5U47 A;  3LJA D;  3AZH D;  4N1H A;  3MVD A;  5AV9 C;  3MVD D;  2X01 A;  4P85 A;  4KQO A;  2XEP A;  3BM6 A;  4WU8 D;  4XUJ A;  4GH9 A;  3WKJ D;  3A6N B;  3VH6 A;  3N4I A;  4N9L A;  2BG1 A;  4R0Q A;  1TEM A;  5DNM A;  1PI5 A;  2ZC7 A;  1KDS A;  4WV4 B;  3B0D B;  3SS5 A;  1I5Q A;  1R4V A;  1YU4 A;  3CG5 A;  4YS3 B;  2FJ7 B;  1RCJ A;  3AZF C;  5B0Z C;  1M18 C;  3AN2 C;  4WZS B;  1K6R A;  3SS3 A;  3EQV A;  1HQ3 C;  5CPI B;  5B1M A;  3B6G B;  5DTK A;  5B33 A;  1QME A;  3AGE A;  2RCX A;  2ZQD A;  3G2Z A;  1MKI A;  4DF6 A;  3PBN A;  3LEL C;  2OLU A;  1FOF A;  4K91 A;  5AV8 C;  2YFV A;  4H8R A;  3BLM A;  4LEN A;  4R8P D;  4NZ3 A;  3AZK B;  3AFA D;  1P3B C;  2IOU A;  3B6F B;  4WNN A;  1H3O B;  2X02 A;  3O62 D;  3EPK A;  2PYO A;  3IF5 A;  5B31 B;  5E5A B;  5DF7 A;  3NQU A;  4KZ5 A;  4X68 A;  3AZN A;  2WGW B;  3SH8 A;  5TR7 A;  2Z2L B;  3Q07 A;  5DNN B;  2EX6 A;  4QU3 A;  1NXY A;  3MZD A;  1BFM A;  1LI0 A;  2ZY4 A;  5AV6 C;  4Y0O A;  4BL2 A;  1P3K C;  1BH8 A;  3ZG7 B;  3UT9 C;  3VH6 W;  3L26 A;  1W7F A;  1IYO A;  3HRE A;  1P34 B;  2WAF A;  5GT0 C;  5CGS A;  3W98 B;  1TZY C;  3P5J B;  3DW0 A;  4WYY A;  5HAI A;  3VSL A;  4IBB A;  5A90 A;  4B4Z A;  5BPV A;  4J8V D;  3PBR A;  2R9X A;  5G49 B;  5E2F A;  4ZAM A;  3AZE A;  1K57 C;  4K0X A;  2ARO D;  4QJG A;  1WE4 A;  1KX4 B;  3TOI A;  5FI6 A;  2H0Y A;  5F99 B;  1J9M A;  1M1A C;  5FI7 A;  3MZE A;  4GDB A;  3JYI A;  1P3P C;  3G4P A;  5AVB C;  4KZ4 A;  2CV5 D;  1PW1 A;  2Y2G A;  3AZI A;  4B4X A;  5AY8 A;  2NQB B;  1P3F B;  1KDW A;  1P3M C;  3Q7Z A;  1NRF A;  4J8W B;  3O3V A;  5M19 A;  3LZ1 C;  4E3J A;  5CPJ B;  1K4E A;  4X53 A;  4OQG A;  3C1C A;  3R45 A;  4U0T A;  3L29 A;  1YLJ A;  3X1U A;  3VH5 A;  2GDN A;  5B32 B;  4FSF A;  3MGS B;  4JJN A;  1FCO A;  4LD9 C;  5B40 A;  2EX9 A;  1KGF A;  3A1K A;  3MGQ A;  4FH4 A;  3AYW C;  5CHL B;  1AOI D;  3KWQ C;  3L27 A;  4IBR A;  5GXQ D;  4H9P A;  1ONH A;  3Q7V A;  4J8X B;  3UTA A;  2Y2K A;  1YUE A;  4AWL C;  3G2Y A;  3MNN C;  4E45 A;  2HIO B;  5CHM A;  3WAA D;  5EVI A;  3GV9 A;  3REH C;  4U3T A;  3MXR A;  3KXB D;  3OCL A;  5FQ9 A;  4KHA B;  3IXH A;  5GT3 C;  3FYZ A;  2RVQ C;  1ERO A;  3REI A;  5CP6 C;  1MWT A;  1P3I C;  1PWC A;  3LY3 A;  3REI D;  5F1G A;  3ZG9 B;  4P0M A;  3ZG0 A;  1YU3 A;  3X1T A;  5J8X A;  4IBI A;  3VOZ A;  3IXD A;  4KEN B;  1SDE A;  3W99 D;  1PYY A;  4EBL A;  4OOL A;  3FDD A;  3H0R C;  1RP5 A;  3HLB A;  3W97 A;  1CEF A;  3W97 D;  2ZM5 A;  1P3L B;  5FA7 A;  3W96 C;  3AV1 A;  3MGP B;  4S2I A;  4E3M A;  5EUA A;  2PU2 A;  3SH9 A;  3AV2 D;  3REK D;  4WM9 A;  3LJA C;  4H9S A;  3MVD C;  2F8N B;  2F2A C;  1FR6 A;  4RA7 A;  4XUJ C;  2P74 A;  3A6N D;  2G2U A;  3QNC A;  3Q82 A;  4KQR A;  5DNM C;  2HP6 A;  1ZLA B;  5KMW A;  5B2I D;  5KSH A;  3VMA A;  4OLG A;  2V1Z A;  2DCF A;  1S0W A;  4YS3 A;  3KUY B;  2FJ7 A;  1ES2 A;  4JXG A;  4QLC B;  4F94 A;  1FQG A;  5CPI A;  3UE0 A;  3TU4 B;  5FAO A;  3B6G A;  5B1M C;  1MWS A;  3AZG B;  1SHV A;  4WZ4 A;  5D3O A;  4X23 B;  5B33 C;  3DWZ A;  5AVC B;  3FKE A;  1XA7 A;  4KQQ A;  5JA4 B;  3NDG A;  1Q2P A;  3C4O A;  3UTB B;  4OJ5 A;  4BLM A;  1W2E A;  3AZK A;  5HW3 A;  3AZF D;  3B6F A;  1H3O A;  5B0Z D;  2PYO C;  2Y2P A;  1M18 D;  5B31 A;  5E5A A;  3TG9 A;  1HQ3 D;  5BO0 B;  3AZN C;  2WKI A;  4Z5T B;  2WGW A;  4ZJ3 A;  1BLP A;  4E3N A;  4IBF A;  3BFF A;  3O87 A;  3V5M A;  5DNN A;  2HP9 A;  4X69 A;  3LEL D;  3EG5 B;  1JWP A;  3IXG A;  3B0C W;  4NE6 A;  1KX3 B;  4OKP A;  4KGC B;  3FKV A;  3PAG A;  4NK3 A;  3WWX A;  1P34 A;  3AGD A;  3W98 A;  2Y55 A;  3CJM A;  3FKW A;  3S22 A;  1K6S A;  4LCM A;  2Y2M A;  4GHA A;  3M2J A;  1EQZ B;  3NC8 A;  2HP5 A;  4HGA B;  3TSG A;  5G49 A;  3OPR A;  1K55 A;  3AZE C;  1XA1 A;  4P6B A;  1KX4 A;  5TGF A;  3KFU G;  4IBE A;  5F99 A;  2WYX A;  5AV6 D;  1E4D A;  1YLZ A;  4OPR A;  3ZCZ A;  4OVD A;  4PM8 A;  4OPZ A;  1PI4 A;  3UT9 D;  1ESU A;  4IVK A;  4Z2M H;  1P3A B;  4N1X A;  3AZI C;  1P3G B;  2G5H C;  1YM1 A;  2B5R A;  2NQB A;  5AY8 C;  1P3F A;  2EFU A;  4ZTK A;  1P3F D;  3OCN A;  4J8W A;  3VP0 A;  3EQU A;  5CPJ A;  3C1C C;  3X1U C;  1EWZ A;  1RGZ A;  4ZBJ B;  5B32 A;  3UDX A;  3MGS A;  4GHL A;  4XUZ A;  5B40 C;  4QD4 A;  1JWZ A;  3MGQ C;  5E2E A;  4BD1 A;  4NYU A;  1OME A;  1W8Q A;  2JE5 A;  1ES5 A;  4RVA A;  4J8X A;  4UUZ B;  2J9O A;  3UTA C;  1ZG4 A;  4KZB A;  3REL B;  4OQI A;  2HIO A;  1P3M D;  2HIO D;  1K4F A;  3F6T A;  1KU5 A;  1BTL A;  1CEG A;  5GHX A;  4J8U B;  1P3O B;  1RGY A;  3KXB C;  4KHA A;  3G34 A;  1LHY A;  5G18 A;  3REI C;  2WAE A;  3GR2 A;  4LG2 A;  3VP4 A;  1PWG A;  4JJN B;  4LD9 D;  5AQ7 A;  1H8Y A;  3N6I A;  2HDQ A;  2J8Y A;  4OOY A;  4OUI A;  4S2J A;  3X1T C;  3AYW D;  1C3B A;  2Y2O A;  3KWQ D;  3LZ0 B;  4E3O A;  5GHY A;  4M3K A;  3AZJ B;  3PBO A;  2ZLY A;  3W97 C;  1P3L A;  4KG2 A;  5C3I B;  1DJB A;  2ZY5 A;  3MGP A;  5EOO A;  3AV1 C;  3MGP D;  1Z6F A;  5FQJ A;  5EVI B;  3REH D;  3AV2 C;  4KUD D;  2Y2J A;  4H9S C;  5GT3 D;  2RVQ D;  1WWI A;  5CP6 D;  4R3B A;  1P3I D;  1M19 B;  2F8N A;  3G35 A;  2F8N D;  5GLD A;  4HES A;  2ZQA A;  4EBP A;  5GSU D;  4YIN A;  3L25 A;  1XP4 A;  3A6N C;  1L0E A;  1A7W A;  1ZLA A;  1IEL A;  4S2N A;  3B0D C;  5CPK D;  4QNL A;  3W96 D;  3KUY A;  3H0L C;  2FJ7 C;  4QB8 A;  1ERQ A;  1BH9 B;  3IWI A;  4QLC A;  4JBF A;  3IHB A;  2XQZ A;  2Y91 A;  5BNV B;  5FAQ A;  1K56 A;  3ZGA B;  3TU4 A;  5CPI C;  3TU4 D;  5CXW A;  3AZG A;  4X23 A;  3AZG D;  4Z9Q A;  1XXM A;  4KZ3 A;  5AVC A;  4XUJ D;  1IYP A;  2IWC A;  3VP3 A;  5BNX B;  3UO9 A;  5JA4 A;  5DNM D;  2DNS A;  2HPB A;  3FWL A;  3ZG8 B;  3UTB A;  5GL9 A;  3BEC A;  3NI9 A;  3AZK C;  3B6F C;  4CJN A;  3ZVT A;  3MGR B;  5B31 C;  5E5A C;  2I72 A;  3KSY A;  3A3E A;  5BO0 A;  3BLS A;  5B1M D;  4Z5T A;  4WMC A;  4E3K A;  4WU9 B;  5B33 D;  5JYO A;  2WGI A;  2EXA A;  4QHC A;  5TFQ A;  5DNN C;  3MZF A;  3OPP A;  3P98 A;  5B2J B;  3C4P A;  4OH0 A;  4IBD A;  1KX3 A;  1F66 B;  4P87 A;  1U60 A;  5AV9 B;  4KGC A;  4KGC D;  4IBG A;  2EXB A;  3V39 A;  1P34 C;  5GLB A;  3UE3 A;  3W98 C;  4PM7 A;  1EQZ A;  1EQZ D;  2PYO D;  2ZY3 A;  4G92 B;  1HVB A;  4NZ4 A;  3AZN D;  1WYC A;  5HL1 A;  5EPH A;  4MNR A;  3V3R A;  1K55 C;  5M1A A;  1KX4 C;  3W4P A;  5AV5 B;  1SKF A;  1WYB A;  1TAF B;  5F99 C;  3UNW A;  2XFS A;  4GOG A;  1DJC A;  3ITB A;  5DVA A;  1JFI B;  1P3A A;  4QY5 A;  5FDH A;  1P3A D;  1P3G A;  5I94 A;  3LCE A;  4DXC A;  2NQB C;  1P3F C;  3HLD A;  3C1B B;  4RX3 A;  4J8W C;  5CPJ C;  1XGI A;  1M6K A;  3GMW A;  3HLW A;  5B32 C;  1BLS A;  3MGS C;  3AZE D;  4UA9 A;  3MKE A;  3LEZ A;  4DQY B;  4YM6 B;  3WX7 A;  3ZFZ A;  4IBK A;  5JRG B;  1Z2C B;  4UUZ A;  3AZI D;  4J8X C;  5CHJ A;  3M6B A;  3REL A;  5AY8 D;  2HIO C;  2XR0 A;  1YQS A;  3C1C D;  4J8U A;  1P3O A;  3X1U D;  4R4S A;  3ZDJ A;  4JJN D;  5B40 D;  2C6W B;  1GCE A;  1MBL A;  1ID3 B;  3MGQ D;  4Z66 B;  3VOY A;  4NZ1 A;  3LZ0 A;  3X1V B;  3AZL B;  3LZ0 D;  5E2H A;  4E3L A;  1L0G A;  3AZJ A;  5B24 B;  3AZJ D;  1TDG A;  4DE3 A;  1P3L C;  3UTA D;  2ZM0 A;  2EX2 A;  5EOE A;  5CGW A;  4H9O B;  2C5W B;  3A3J A;  3MGP C;  4JXS A;  3OZH A;  4NET A;  1IKG A;  5EVI D;  1M1A B;  1MY8 A;  4DDS A;  4KUD C;  4QY6 A;  5AVB B;  4GN2 A;  1MPL A;  1M19 A;  5EEC A;  5B0Y B;  3AZM B;  2Q9N A;  4XZQ B;  2WK0 A;  5DTS A;  2NZD B;  2H10 A;  5GSU C;  4DDY A;  3X1T D;  5B1L B;  1PIO A;  3E2L A;  1DY6 A;  3HVF A;  1ZLA C;  4S2N C;  4C6Y A;  5CPK C;  4C75 A;  3KUY C;  3AV1 D;  4UA6 A;  1PW8 A;  2LY8 A;  2ZQ7 A;  1TAF A;  1BH9 A;  4UHU A;  5FAT A;  4QLC C;  4DRB A;  5BNV A;  1YT4 A;  3TU4 C;  3QHY A;  1NYM A;  4OJO A;  3AZG C;  3IF6 B;  4X23 C;  2V2F F;  2XFT A;  5GLC A;  1HTA A;  2WUQ A;  5AVC C;  3VP1 A;  5BNX A;  1ZC2 A;  4MLL A;  5FQM A;  2DQN C;  3UTB C;  4OPQ A;  3X1S B;  4YS3 D;  1S6R A;  1W8Y A;  2FJ7 D;  5CTM A;  4JF6 A;  1JTG A;  4WEL A;  3MGR A;  3MGR D;  1L2S A;  2DF4 C;  4ZUX A;  1AXB A;  5CPI D;  5BOH A;  3B6G D;  2XD5 A;  4Z5T C;  4WU9 A;  4S2K A;  1U35 B;  4R1G A;  2A49 A;  1VM1 A;  3C5A A;  5B2J A;  2W8S A;  5FUG B;  3AZH B;  1XX2 A;  5E43 A;  3N7W A;  1NYY A;  1F66 A;  1KX3 C;  1F66 D;  5AV9 A;  4YFM A;  3CMZ A;  1YMX A;  4KGC C;  4OOM A;  2BYM B;  3GTC A;  4WBG A;  5DF9 A;  4WU8 B;  3AZK D;  2A3U A;  2OSU A;  1S32 B;  3B6F D;  3WKJ B;  3GQZ A;  5CED A;  1EQZ C;  2ZC5 B;  3Q81 A;  4E44 A;  2Y2Q A;  5B31 D;  5E5A D;  1KX5 B;  4D2O A;  2F8N K;  2VQR A;  4G91 B;  4HGA C;  4N92 A;  3IP4 C;  2BLS A;  3G31 A;  4S2L A;  2ZM8 A;  5AV5 A;  3O88 A;  5DNN D;  3N8L A;  1BLC A;  2UWX A;  2JSS A;  1Q2Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...