2UWXA

Active site restructuring regulates ligand recognition in class a penicillin-binding proteins
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
489
structure length
468
Chain Sequence
b'ISEITYSDGTVIASIDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPATTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTNQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PENICILLIN-BINDING PROTEIN 1B
molecule tags Transferase
source organism Streptococcus pneumoniae
publication title Active Site Restructuring Regulates Ligand Recognition in Class a Penicillin-Binding Proteins
pubmed doi rcsb
total genus 149
structure length 468
sequence length 489
ec nomenclature ec 2.3.2.-:
pdb deposition date 2007-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2uwxA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2uwxA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2uwxA02
4OPZA 3CZDA 5HL1A 2HDUA 4DE3A 4R3JA 3DW0A 2WADA 1L0GA 2XDMA 5GHXA 1ERMA 3IF6B 3MXRA 5IHVA 1PYYA 3HUOA 3N6IA 1Q2QA 3DTMA 4OOYA 4ZTKA 3ZFZA 3ZCZA 4FSFA 1PW1A 2Y2KA 2XGNA 2Z2LB 1MPLA 4S2PA 5JYPA 4GB7A 5DF7A 4E3IA 2PU4A 3C4PA 3G2YA 1ES4A 3GSGA 3VOZA 1LI0A 4KENB 3RXXA 4QB8A 2Y2MA 2H0YA 4IBRA 2J7VA 1C3BA 2ZLYA 4EBLA 1K57A 5I94A 5CXWA 1O07A 4UA7A 1K57C 3C4OA 3MKFA 2EX8A 3M6HA 2HDRA 3N4IA 5F1FA 1IKIA 3IHBA 3FV7A 1DJAA 4M3KA 3ZG0A 5EVIA 1BSGA 1XKZA 5FI6A 1SDNA 4P6BA 4A5RA 4QY5A 4BQMA 1OMEA 1RP5A 1W79A 4OQIA 1DJBA 2ZQ7A 1YQSA 3WRZA 3PBOA 1ALQA 1K54A 2B5RA 2P9VA 2ZMAA 5TR7A 4P85A 4RYEA 3MZDA 3GTCA 3NI9A 4B88A 2HDSA 4R1GA 4LENA 3BM6A 1WE4A 1KDSA 3B3XA 2Y4AA 3VFFA 5TGFA 4B4XA 5CEBA 4ZJ3A 3ZG8B 4N1XA 3CJMA 4F94A 3A3EA 2ZQCA 5GLBA 5EVLA 4GDBA 1W5DA 2WKHA 3UDXA 1Y54A 3SS3A 1K6RA 1CI9A 3V3RA 3G34A 1KGEA 3ZNTA 1U60A 1HD8A 4JPMA 1K56A 4FH4A 3FZCA 3OCNA 2Y2PA 2XQZA 3UE3A 4Q8IA 1WYCA 4GN2A 4X6TA 4EBNA 1JTGA 5FAPA 3HLGA 1LL9A 5DVAA 2JC7A 5FASA 1K55C 2V2FF 1PI5A 4N9KA 4DXCA 1GCEA 1K4FA 1N4OA 5EUAA 2H5SA 5M19A 1MWRA 1W8QA 3IWIA 1IYSA 3BFFA 3ZNYA 4GD8A 4OPRA 1CI8A 2XEPA 2OLUA 4DRTA 4H8RA 1YLPA 3IWOA 1K38A 2WKIA 1E3UD 2EXAA 3RJUA 2DNSA 4BL3A 2R9WA 3A3IA 4MLLA 4KG2A 2X71A 3Q1FA 3ZVWA 1H8ZA 1ONGA 5CGSA 5KMWA 3OC2A 1XP4A 4JF5A 4Y0UA 5FQ9A 2RCXA 1GHPA 2Q9MA 3OPPA 3VP1A 2WGWA 1BLPA 2A3UA 2Y2HA 2JE5A 3Q7ZA 2RL3A 3LY3A 5DTTA 4EWFA 1EWZA 1BUEA 4UA6A 2IWBA 1JWPA 4U3TA 3VFHA 1BLCA 4ZDXA 3HL9A 1SKFA 2DRWA 4R4RA 5GLCA 1DJCA 3IF6A 4GOGA 1BT5A 3IXDA 3W4PA 4QJGA 3IWQA 3W4QA 3UE0A 1JWZA 4OQGA 3PBSA 4U0TA 3UNWA 3MXSA 5FI7A 4E3JA 3VP3A 4WEKA 4E6XA 1FR6A 1H5XA 2UWXA 5FATA 1YMSA 3MZFA 1MWSA 1YLJA 2WAEA 5CGWA 1PWGA 2EX6A 1S0WA 3BFEA 4YINA 2X02A 5FI2A 1W8YA 3HUMA 5HAQA 4QY6A 3MKEA 1IELA 1ES3A 3GV9A 3I7JA 1WYBA 3VMAA 5EVIB 3AGFA 1G6AA 3FWLA 3LY4A 4OOMA 2ZC4B 3BFGA 3FKWA 4MNRA 3IXBA 2XK1A 4XXRA 4C75A 5CTMA 2R9XA 2P9VB 3C7UA 3HLBA 4DDYA 3IH9A 1TVFA 4P87A 2VGJA 3S22A 3N7WA 2XLNA 4PM7A 2HDQA 1RCJA 5BOHA 4DKIA 4S2OA 3IT9A 3EQUA 5HAIA 1G68A 3NBLA 4WMCA 5AQ9A 3HBRA 1SHVA 1Q2PA 1XGJA 3S4XA 1HZOA 4QD4A 4EBPA 3A3DA 3AGEA 4BLMA 4BENA 3V3SA 2WKEA 3BLMA 4PM8A 5E43A 4C3QA 1M40A 1KVMA 1O7EA 2E8IA 1MWTA 3O87A 4UAAA 3M2JA 4HBTA 4KQQA 2ZC3B 1KVLA 3AGDA 2J9PA 3V5MA 1PIOA 4IVIA 1YT4A 4KZAA 4JXVA 2Q9NA 1TEMA 3A3FA 2QMIA 2ZQ9A 1NYMA 4PM9A 5AQAA 4X53A 5HW3A 2Y2LA 1BZAA 4PMAA 3HREA 1ESUA 2HP6A 3G31A 1FSYA 4E3KA 3W8KA 5GL9A 3LEZA 5KZHA 2H0TA 3ZG9B 2Y59A 2H10A 4EQIA 4OLDA 3NDEA 2Y2GA 2ZQAA 4O7DA 3MBZA 3VSKA 5CECA 4X68A 2Z2MB 1I2WA 3HLDA 3W4OA 3ISGA 5J8XA 1BULA 3WRTA 3PAEA 3G35A 3C5AA 2FFFB 5FQIA 3QHYA 3IXHA 1MWUA 1ONHA 2WGWB 1RGZA 4X69A 3TOIA 1KE0A 2Y2IA 1NZUA 2EFUA 5EVID 2ZC7A 4RA7A 4JXSA 1GHMA 3M2KA 2IWCA 3SH8A 1ZKJA 5EOEA 4OPYA 3G32A 5GLDA 4GNUA 3CG5A 3IF6C 3ITAA 4RX2A 4BL2A 1MY8A 3FYZA 4MEZA 4WBGA 1K54C 2EXBA 4OQ0A 1M6KA 2ZQ8A 4OKPA 1BLHA 3MZEA 4BD1A 4KZ8A 5CRFA 5GLAA 4JXGA 1JWVA 1YMXA 5CHUA 5HFOA 1BTLA 3EQVA 3PBQA 2Y2QA 4KZ9A 3S1YA 1YLTA 2ZM2A 3DWZA 4E3LA 2WGIA 4ZJ2A 5EPHA 5EOOA 1ES2A 2WUQA 3DWKA 1IEMA 3P98A 2WAFA 1NYYA 2XF3A 5CHMA 4E3OA 5E2GA 2DCFA 1CK3A 3UO9A 3HLFA 4OONA 1E4DA 5DTKA 4OLGA 1TDGA 3WS5A 2ZM0A 5DF9A 5FAOA 1K6SA 4JF4A 4JKTA 3UN7A 4S2JA 2QZ6A 5CTNA 1ESIA 2BLSA 2VGKA 2CC1A 3O86A 3E2KA 3NC8A 4KQOA 4LCLA 1RGYA 4LCMA 4LV2A 4R0QA 5TFQA 1FSWA 1NY0A 4FCFA 1K55A 3WS2A 4E3NA 4U0XA 4E6WA 3IXGA 1VQQA 1FCMA 1XA1A 1YM1A 3O3VA 4QU3A 4WMCD 4JF6A 1K25A 5AQ7A 1NRFA 1NZOA 4S2MA 5GHZA 1E3UA 3UDIA 4OP5A 4KG6A 4KZ5A 4BJPA 4X55A 2ZD8A 4MBHA 3O88A 2QPNA 4S2IA 3E2LA 3GQZA 1IYQA 4N9LA 3OCLA 3OPHA 2HPBA 2J9OA 2WZXA 4KG5A 3BRMA 3ZG5A 5M18A 3SH9A 3UPOA 3Q82A 1EROA 2PU2A 5A93A 3P09A 1PWCA 3PBNA 1JVJA 4KZ6A 4OQHA 3SS5A 1YLWA 1KGGA 2ZC5B 3BFCA 2ZM8A 3NCKA 2EX9A 5FQKA 2ZC6B 1VM1A 3UPPA 4QHCA 1ZC2A 4S2KA 5E2HA 5FQJA 4S2NC 3CMZA 1MKIA 4EUZA 3HLEA 4DDSA 4S2NA 4X56A 4GKUA 1K4EA 3M6BA 3SOIA 3VSLA 4MBFA 1J9MA 4HESA 1W7FA 2WZZA 3BEBA 4RX3A 5KSHA 3PBTA 4WYYA 1PW8A 3OZHA 3PAGA 4N92A 3OPRA 3ZG7B 5F82A 4RVAA 4DE2A 4L0LA 5FQMA 1CEGA 3IH8A 4K0XA 3GRJA 1HVBA 1LI9A 4OOLA 5L2FA 4JLFA 2JBFA 4NK3A 2ZQDA 1LL5A 3HVFA 1MBLA 3Q7VA 4OVDA 3UE1A 3WWXA 3G30A 1KE4A 3GVBA 1L0DA 2C5WB 3VOYA 3WS1A 3NIAA 4PM6A 2OV5A 4HEFA 1I5QA 1XX2A 1GHIA 3BLSA 3PBRA 4K91A 5FSRA 5A92A 4IEDA 5A91A 2XD1A 5FA7A 5AQBA 2GDNA 3PTEA 1QMFA 4ZJ1A 4DXBA 3V39A 4R23A 4WM9A 1LHYA 4KQRA 5A90A 3TSGA 3RXWA 5F1GA 3WS0A 1XA7A 2JCHA 1IYPA 5DTSA 3UPNA 1NXYA 2HP5A 4DF6A 3MFDA 3A3JA 3ZHHA 2PBYA 4GD6A 4KZ7A 1IYOA 1MXOA 4PPRA 3FKVA 5CEDA 1K56D 1GA9A 3NY4A 1PZPA 2IWDA 2Y2OA 4LV0A 1SDEA 4P0MA 4K0WA 2FFYA 4UA9A 1PI4A 2EFXA 3NDGA 5CHJA 1FCNA 4ZAMA 1H8YA 1ES5A 1KDWA 4CPKA 3VP0A 3OPLA 3BECA 1IKGA 3G2ZA 4XUZA 4Z9QA 2OLVA 4OPQA 3HUNA 4BD0A 3N8LA 1S6RA 5FAQA 3G4PA 3GR2A 4IVKA 5F83A 2G2UA 3ZVTA 1N9BA 2XFTA 3Q7VB 3N8RA 4YFMA 4WELA 5FDHA 5EVIC 1AXBA 2XD5A 1L0FA 1YLZA 1XXMA 4DE0A 5U47A 3D4FA 1I2SA 3Q07A 3IHAA 1Z6FA 2V1ZA 5JYOA 1E25A 1HTZA 2P74A 1JTDA 4LV1A 1NJ4A 4KZBA 4CJNA 4WZ4A 5DF8A 4C6YA 1ZG6A 2WGVA 2XFSA 3QNCA 3HLCA 4GZBA 3HLWA 3SH7A 3ZGAB 3SS4A 2BG1A 4Y0OA 2A49A 4DE1A 4ZBEA 3BFDA 4WEJA 5GHYA 4FD8A 4UHUA 1TDLA 1XPBA 1EI5A 3LO7A 3Q81A 5EE8A 3UY6A 3V50A 4EV4A 5KSCA 3N8SA 4R4SA 4N1HA 3IQAA 2Y55A 4OP8A 3VP2A 4PM5A 2WK0A 5HARA 2OSUA 4GDNA 4NETA 3QNBA 1YLYA 5D3OA 4ID4A 3VP4A 2EX2A 2XH9A 4R3BA 3LCEA 4KZ3A 1ERQA 4D2OA 2XR0A 4E3MA 1FQGA 5E2FA 2Y2JA 1PZOA 1CEFA 2G2WA 1LLBA 4S2LA 5G18A 2HP9A 3C7VA 4LV3A 4XUXA 2Y91A 2X01A 1KE3A 2WYXA 3WS4A 2Y2NA 1FOFA 2ZJ9A 3IF5A 4Y7PA 1GA0A 1QMEA 4IBXA 4HBUA 5E2EA 1ZG4A 1BLSA 5HX9A 1FCOA 1KGFA 4JXWA 4OH0A 1L2SA 4JBFA 5CGXA 4KZ4A 4MBKA 1XGIA 2C6WB 1DY6A 3GMWA 3ITBA 5FQQA 3TG9A 1FR1A 1PWDA 2I72A 3ZDJA 4Y0TA 5M1AA 4B4ZA 1L0EA 1SCWA 4WZ5C 3JYIA 2V20A 2J8YA 4FH2A 5HAPA 3BYDA 4WZ5A 3UDFA 5EECA 5CERA
chains in the Genus database with same CATH superfamily
2WKPA 1L3LA 2ZY3A 2V0UA 1KX4C 3MF0A 1L0GA 2FJ7A 4CSRB 3N6IA 3DTMA 3ZCZA 3EGXC 2XSSA 2Y2KA 3H7WB 2Z2LB 3JPUA 1MPLA 3T50A 5JYPA 5DF7A 4GLQA 2PU4A 2ZBBA 1LI0A 3WD4A 5AV5D 5I94A 3IS2A 3R45B 5CXWA 3REHC 3IBJA 1O07A 3REKC 1K57C 4HOIA 3N4IA 4YM6C 5GT3A 5B0ZB 3FV7A 5A8BA 1P34A 1BSGA 1SDNA 4GHLA 2Z6CA 3WRZA 4MB5A 2ZQ7A 3PBOA 3B0CW 4MN5A 3ZQ5A 5TR7A 4P85A 4X23C 4B93A 3V9RA 3GTCA 5C3IC 3AZJB 3BM6A 5KDMB 3B3XA 5TGFA 2M7VA 5AJGA 3CJMA 3AZFC 1B6WA 3KXBC 4Z66A 4GDBA 1W5DA 2WKHA 3AZID 2HF6A 1KGEA 1BH8A 4JPMA 1P3OC 3MMHA 2K2NA 3OCNA 2PYRA 3NQUB 2BASA 3UE3A 2QHKA 4GW9A 5DVAA 2JC7A 3K2NA 5GXQB 1M19A 4N9KA 3HSHA 3B6FB 1GCEA 4DXCA 1N4OA 3KUYC 5EUAA 1O6IA 2H5SA 3AZHA 2NQBB 1GXDA 3BFFA 4GD8A 3LIDA 2UV0E 1CI8A 2XEPA 4DRTA 4H8RA 1K38A 1UGUA 1S4SA 2B95A 2WKIA 2DNSA 4MDZA 3BY8A 4BL3A 2R9WA 2VLGA 4MLLA 4KG2A 5JRGD 3B47A 3ZVWA 1H8ZA 1ONGA 5KMWA 1DP8A 2RCXA 1OPXA 2GJ3A 1X0OA 2WGWA 4GH9A 1BLPA 2Y2HA 3MGQC 3PHYA 5BS7A 1H8MA 3LY3A 4EWFA 3AZEC 2IWBA 1BUEA 4XZQD 4AFIA 4YM6D 3HL9A 2DRWA 3W97B 1DJCA 3IF6A 1ID3A 3IXDA 3REHD 3W4PA 3IWQA 3W4QA 2ZOIA 3E4PA 3MXSA 1QO6A 3VP3A 1FR6A 5CP6D 1H5XA 5FATA 5CPKB 1YMSA 2ZOHA 1MWSA 2NZDB 1YSQA 1E6RA 4MN6A 5FI2A 3HUMA 3H0RC 5HAQA 1N9LA 3MKEA 4NEED 4KUOA 4EO5B 3GV9A 5GT0B 3REID 3MVDA 4UQIM 3RELA 2PT7A 4XUJA 3RELC 1P3BA 3FKWA 1P3KC 1P3FC 5CPJC 4X23A 3HLBA 3WAAC 1TF1A 2YKFA 2CMNA 1T1BA 1P3PC 3EQUA 4HP9A 5HAIA 5JA4A 3WTPA 2W27A 4WMCA 1XGJA 4DJ3A 3AZKD 4QD4A 1P0ZA 4BENA 3V3SA 2WKEA 4PM8A 5B2IA 4C3QA 1O7EA 2E8IA 4IBKA 3LEQA 3B6GA 1ED7A 4I3JA 5B0ZD 1KX3A 1LL8A 2ZL1A 2Q9NA 4PM9A 3A3FA 5AQAA 5BT1C 3UTBC 1LT0A 2W1TB 3AZIA 2PYPA 4HGAC 3HREA 5BNVB 4X25A 5AV9D 4J8UA 4EESA 4PKYA 1PDCA 4XT2A 4WF0A 2Y2GA 4O7DA 3E4QA 3MBZA 5DKKA 3REKB 3ZYTA 2Z2MB 3P01A 1I2WA 2HZ5A 4QWOA 5J8XA 1BULA 3WRTA 3AV2C 1ZLAC 4CLCA 4XUJD 1P3BD 3IXHA 3EG5B 3TOIA 1KE0A 3MQ0A 3LELD 1P34D 3AZMD 1GHMA 4GNUA 3CG5A 3IF6C 5DNNA 4RX2A 4BL2A 3FYZA 4MEZA 5AY8B 1N9OA 4KZ8A 4JXGA 1YMXA 4YS3D 4H6JB 1BTLA 1OGGA 3EQVA 3S1YA 3DWZA 4E3LA 3B33A 2WUQA 2VZWA 3DWKA 3P98A 1CK3A 1ZHHB 3HLFA 4Z2MG 4OLGA 2FJ7D 3F1PB 3QP2A 5DF9A 4DN0A 3LELC 2WKQA 2VGKA 2CC1A 3E2KA 3NC8A 3LR4A 5B2JD 1RGYA 4UUZB 4LCLA 4XUJC 1P3BC 1NY0A 3AV2D 4Z2LA 3WS2A 4U0XA 4E6WA 4KQDA 1FCMA 5CPJB 5B31A 1NRFA 4S2MA 4IBCA 4NXFA 4BJPA 3X1UD 5AV8C 4AWLB 4IBGA 3C1BD 3ZG5A 4Q0IA 1AOID 4YM6B 5M18A 3SH9A 1N9NA 4IJGA 2PU2A 2VV6A 2A2LA 5A93A 3LZ0B 1TZYB 2QWSA 2L1MA 3KWQA 2V1BA 1YLWA 1KGGA 2LB9A 3NQJB 2F2AC 2H28A 1VM1A 5B0YC 1VB6A 4S2NC 3B0DB 3CMZA 3DBAA 2O9AA 2NZDC 1H3OA 4JGPA 1KU5A 3REJB 1P3PD 4MBFA 1W7FA 1PW8A 2AROB 1JFIA 3REHA 5HDDA 3ZG7B 5F82A 5AV6B 4MN7A 5FQMA 4K0XA 3X1VB 2F8NA 1ZLAA 4CLCC 4QNLA 3CUEA 1FILA 4JLFA 2JBFA 2BYKA 4MB3A 3REIC 2HUEB 4Z2KA 4YOFA 5J4EA 5DNMB 1P3KB 3CWFA 3UE1A 2JKGA 3WWXA 2W3HA 1KE4A 1KOUA 1L0DA 2C5WB 1DRMA 3VOYA 3MGSA 5HWWA 1BFMA 2RVQD 4X1LA 3BLSA 5FSRA 2G5IC 5I5LA 1XFNA 1OGBA 5CP6A 1TD5A 4DXBA 4ZJ1A 2J3TD 3V39A 3TU4D 3KSGA 4H9SC 4KQRA 5A90A 5B2IC 1XA7A 2JCHA 5DTSA 2VQRA 5F69A 4DF6A 3S7QA 3A3JA 1DP9A 4NE3A 1MXOA 5HPIA 4WU9C 4JGRA 3FKVA 1GA9A 4J8VB 3D72A 3UTBA 1PZPA 3MNNA 2Y2OA 2VV7A 5F6AA 5GSUB 4K0WA 1HLUP 4WZSB 1FCNA 4WV4B 3EPJA 3HJKA 3UB8A 2RIQA 2OLVA 1XJ4A 4OPQA 1S1YA 3EPLA 3PYPA 5EFWA 3AV2A 5FAQA 4H9OA 4R38A 1N9BA 4IHQA 3S7PA 4EETB 3AZMC 5FDHA 5BS7C 2PD8A 1P34C 1YLZA 3AZEA 1V9YA 1XXMA 5U47A 3L26A 1TZYC 3AZGD 3L2AA 4HJ3A 1KX5B 3IHAA 2V1ZA 1E25A 2HIOD 4LV1A 4CJNA 1UR9A 4WZ4A 5DF8A 4CQHA 2PHYA 2XFSA 3R4KA 3SH7A 4YS3A 5HD3A 1S4RA 1VEUA 4ZBEA 2L0WA 5B32C 3KSIA 4UHUA 1XPBA 1TDLA 1BH9B 2JKFA 3LO7A 4LD9D 5TBMB 4E45A 2AROC 3IQAA 3VP2A 1NWZA 2WK0A 4PM5A 5EM1A 3W96C 4NETA 3QNBA 4DJ2A 3VP4A 4ID4A 3R7WB 3IS2B 3R45A 4IBEA 1ERQA 3W99B 4G3VA 3LELA 5E2FA 4Q0JA 1LLBA 3A6NC 2HP9A 4I39A 4XUXA 4LV3A 2X01A 5DJUA 3REKD 1FOFA 1GA0A 4IBXA 3T1SA 1S66L 4HBUA 5B1LC 3UTAA 5JRGB 5AV6D 1FCOA 3CPTB 4JBFA 2C6WB 1TAFA 4GHIB 4OJPA 3GMWA 3WAAD 4H9SA 1YU2A 4WZ5C 4FH2A 1T18A 2VKSA 2B02A 2PAVP 1P3LD 2HV1A 1BH8B 2XDMA 5GHXA 3T4OA 3LZ0D 1YPRA 1M1AA 3LFVA 5GXQC 4OOYA 1Q2QA 4ZTKA 1OT6A 4FSFA 3BWLA 4E04A 4H9NB 3C1CB 3MGRA 1CXWA 5AV6C 1S32A 1ES4A 5B31D 2Y2MA 5B40D 2H0YA 4QB8A 4UPKA 4EBLA 1K57A 1XJ6A 1NLZA 2KLIA 3W98D 1W1VA 2EX8A 3REIB 4GS9B 4K08A 5B2JA 3IHBA 1A0KA 3LIFA 4M3KA 1OJ5A 3ZG0A 4OJ6A 1XKZA 4DQYB 4A5RA 4BQMA 5B1MA 1OMEA 2V5OA 3LJAA 1YQSA 3W96D 4EXOA 4RYEA 1KX5C 2CV5D 5IU1A 3AZNA 2Y4AA 3B42A 3S7OA 3KSHA 3AZFA 1BYWA 4B4XA 3ZG8B 5CEBA 4AWLC 5GLBA 3B0BA 2JKTI 1CK7A 5EVLA 3PR6A 3KUYD 2O99A 1K6RA 2F8NK 1CI9A 3ZNTA 1P3AC 3E0YA 2AVXA 3G34A 4Z2IA 3RTYA 1K56A 1Y28A 4XZQA 2Y2PA 3W96B 4ETXA 4Q8IA 1WYCA 4GN2A 4EO5C 4JGQA 4X6TA 2YFVB 3HLGA 1P3OD 1LL9A 5DFXA 1K55C 2V2FF 2B18A 1P3AD 2QJ5A 3B0DC 5M19A 3ZNYA 4Y17A 1YLPA 2ACGA 3RJUA 3O62D 4KHAA 2PD7A 3A3IA 2W3GA 2X71A 3Q1FA 5CGSA 1GSWA 3OC2A 4OJOA 4Y0UA 1M18C 3DTEA 3W97D 3VP1A 2FH5A 3WTPE 2JE5A 2GZAA 2RL3A 1YU3A 3UE6A 5GLCA 5TJJA 5E5AC 3M7PA 1T1CA 3B6GB 5LBRA 4QJGA 2K31A 4H9PA 1JWZA 3PBSA 2EWWA 4E3JA 4E6XA 4ZBJB 4HH2A 5HZHA 2F8NH 3UTAD 1S0WA 4YINA 3EGDC 1P3GB 1W1YA 1H0GA 3AN2B 3CUEC 5FEFA 1P3OB 5EV0A 1ES3A 3AYWB 1P3LC 3NOPC 1WYBA 1YKDA 3AGFA 1G6AA 3FWLA 4LLOB 3MGSC 2ZC4B 3BFGA 3UT9D 3AFAC 3P5JB 3C7UA 4DDYA 4WL9A 3S22A 3B0CT 4KUDA 2XLNA 1CF0A 4PM7A 2HDQA 4HQAA 4QLCB 4DKIA 3IT9A 3S4XA 3NBLA 5AQ9A 3ULFA 3HBRA 1SHVA 4ESPA 4Z66B 1JNUA 4BLMA 1P3MA 5E43A 4ZUXA 4NE5A 1M40A 1KVMA 3O87A 3A6ND 2ZC3B 1N1JB 1KX4A 3AV1C 4IVIA 2YFWA 1YT4A 4KZAA 3AV1A 1EW0A 4R8PD 1TEMA 5GXQA 1NYMA 5HW3A 2Y2LA 2AROD 1BZAA 2DQNC 5G4ZA 4PMAA 4ARZA 3AZHB 4E3KA 3G31A 4L9EA 3W8KA 3C1CD 3WD2A 2P7JA 3CLOA 5B32B 3ZG9B 2Y59A 4OLDA 3NDEA 1SKOB 1ULYA 3MXQA 5CECA 5J3WA 3T4SA 3PAEA 3G35A 3C5AA 3VH5W 3QHYA 4IJFA 1TZYD 2ZY4A 3AZGC 1MWUA 4WLAA 2WGWB 1RGZA 3T12B 2Y2IA 2INWA 2ZC7A 4RA7A 3M2KA 2IWCA 4UQIS 3EOIA 1P3FB 4UEYA 5B33A 3WAAB 1MY8A 3LJAC 4WBGA 3AN2D 1K54C 2ZQ8A 4OKPA 1BLHA 3CI6A 4BD1A 4Z66D 3S7NA 5AVCA 1JWVA 2Z6DA 4HIAA 5HFOA 5CPKA 4KZ9A 3L29A 3A0VA 3FPWA 3MS6A 5EOOA 5DNND 3LJAD 2XF3A 3LUQA 5E2GA 3UO9A 3LI9A 4OONA 1E4DA 3LZ1B 2PYOC 1P3AA 4TX8A 3DTIA 4S2JA 1ESIA 2PRFA 4KQOA 4LV2A 3MGPB 1J7MA 1OTIA 4KGCC 1CJFA 1H0MA 4EERA 4I5SA 5F99D 2F8ND 3CHWP 3LR5A 2O9CA 4E3NA 3QP5A 3KUYA 1FIKA 3W98B 3IXGA 2L4RA 1VQQA 3LR0A 1K25A 5CPKD 3UDIA 2CV5B 4KZ5A 1P3PA 3SW1A 4S2IA 1IYQA 2JHEA 3FDDA 3MGQA 1M18A 2GNXA 3Q82A 4WJ3C 3B6GD 5B1MD 5E5AB 3P7NA 3LZ1D 3WKJD 1PWCA 3WKJB 2ZC5B 4FUWA 3FG8A 1AOIA 2ZC6B 3UPPA 4QHCA 1A7WA 1ZC2A 4S2KA 5E2HA 5FQJA 1MKIA 3HLEA 3MNNB 4GKUA 3M6BA 3SOIA 1S32C 3X1UA 3BJNA 4Y5FA 4HESA 4RX3A 1S32D 4XT2B 3OZHA 1W2EA 1OTEA 5G49B 4KUKA 3REKA 1NLYA 4L0LA 1CEGA 3UT9C 3GRJA 2YKHA 1LI9A 4HP4A 4WNNB 3RELD 3BQAA 4LG2A 5B1MC 3X1TD 3AZMB 3A6NA 4H9RA 1T3UA 4J8XD 1P3MD 3TU4B 3W99D 3AFAA 3WS1A 3NIAA 3IX3A 2JKRI 5AY8A 1KX5A 3UB9A 4WN5A 5BO0A 1U35B 1I5QA 5B24A 4IEDA 5AV8B 4LD9B 1F98A 5AQBA 3WTPC 4EU0A 4YS3B 2GDNA 1QMFA 3PTEA 5AV9B 3UB5P 3WS0A 3QP1A 3EEAA 5IS1A 3ZHHA 1PFLA 4Z2HA 1WWSA 4KZ7A 3AZLD 4NKPA 1W1TA 4PPRA 1P9RA 5B0YB 4KGCA 2V8CA 1SDEA 4EUVA 3NJAA 2EFXA 5CHJA 3GDIA 1H8YA 5B31B 1P3IC 3O62C 2V8FA 3BECA 4Z9QA 5AVCD 1P3GC 2A24A 3AN2C 1S6RA 1NRJA 2ZMFA 3NHQA 5F83A 2XFTA 4BBTA 2HUEC 4YFMA 4MB4A 4LRXC 3VOLA 5EVIC 1L0FA 1MKMA 1I2SA 2M1CA 1B67A 2V1AA 3V9RB 1HTZA 2P74A 1JTDA 1NJ4A 2G7UA 4NYUA 2BYMB 2W8SA 2L5AA 5KDMA 4C6YA 3VH6A 3HLCA 4GZBA 3HLWA 4ETZA 1H3OB 3ZGAB 3KSFA 2A49A 3H7WA 5CHLB 1H0IA 2VGLS 3V50A 2PR6A 3C1CA 1SZVA 3B6FD 4X23D 3WD1A 4R6LA 5HARA 5D3OA 2XH9A 1HQ3D 4EW7A 3LCEA 3AV1D 1FQGA 3WA9A 5IT5A 4Z1WA 2Y2JA 3REIA 1PZOA 3U4LP 4NZ3A 5GT3B 2PDRA 2Y91A 1KE3A 2WYXA 5AV5A 2Y2NA 3W98C 2ZJ9A 4Y7PA 2NQBA 1QMEA 4NG2A 1ZTUA 5E2EA 4OH0A 3L7HA 1L2SA 2W0NA 5CGXA 4KZ4A 1P97A 1Z2CB 1V9ZA 5CP6B 1FR1A 1PWDA 5B32G 5M1AA 4B4ZA 3F6TA 1SCWA 5HAPA 3MGSD 3BYDA 3LIEA 5EECA 4OPZA 1E6ZA 5HL1A 2HDUA 3KWQC 1F9IA 3C30A 2P08A 3NQUA 3LYXA 5IHVA 5KIZA 2LY8A 1G6OA 5B40A 2XGNA 3B6FA 1WWIA 4S2PA 3LIBA 4GB7A 5J7EA 3VH6W 2NZDA 5CPIA 1P3IA 2Y79A 3O5YA 3C4PA 3G2YA 1J3WA 3GSGA 5CPIC 5B1LD 3O62B 2ZLYA 1C3BA 3FC7A 4JJND 3AZHD 4LFUA 4UA7A 3MKFA 3M6HA 2PYOB 2HDRA 3KX0X 5F1FA 1P3LA 4LGWA 1DJAA 2K7SA 3RELB 5EVIA 3MGQD 3C38A 5FI6A 1RP5A 1W79A 1DJBA 3AZKB 1ALQA 1K54A 2P9VA 3W97A 4LRZE 5B33C 4B88A 5B1LB 2HDSA 3AZNC 4LD9C 4PKYG 5JRGC 1T1AA 4LENA 4R1GA 5L07A 5B24C 1KDSA 1WE4A 3VFFA 3C1BA 1UR8A 4H9PB 4N1XA 1VEUB 4F94A 3A3EA 2ZQCA 3MQLA 5TBMA 5F99A 3MGPD 3UDXA 4HMDA 3SS3A 1XFQA 3TRCA 4FH4A 2JSSA 1D06A 4CAYA 2XQZA 3LICA 3JVUA 3C8CA 4EBNA 4WU9A 2JKRM 3AYWC 1JTGA 3AYWA 3H9WA 3VE4A 1PI5A 3F1OB 2PBDP 3MVDB 1K4FA 1MWRA 4XUJB 1P3BB 1IYSA 4HMCA 4OPRA 4QLCD 4MCWA 3IWOA 1E3UD 2EXAA 2EWVA 4G3WA 2HIOB 3UT9B 5B33D 4QLCA 5FQ9A 5B0ZA 1GHPA 5HDCA 1R4VA 3OPPA 1OJGA 2A3UA 5G4YA 2BTFP 3Q7ZA 3AZLC 5DTTA 1D1JA 1EWZA 3VFHA 4ZDXA 1JWPA 4U3TA 1BLCA 1OTDA 1SKFA 2D02A 3KYQA 1ID3C 2FJ7B 3AZJA 4H9QB 1KX4B 4GOGA 1BT5A 3UMEA 3UE0A 5B40C 4U0TA 4II7A 4MMNA 4WEKA 4EQ1A 5CPID 1EQZC 4Z2MH 1TS0A 1YLJA 3E98A 2WAEA 5CGWA 1UWNX 2EX6A 3BFEA 4J8UD 2X02A 1LSXA 3W2ZA 4Q0HA 4QY6A 1G5UA 4GS9A 1IELA 1KX4D 3RFBA 5GT3C 3VMAA 2IOUA 3LY4A 2GX5A 2ZMVA 4IBFA 3V67A 2NUTC 4IJEA 5EM0A 4MNRA 2VEAA 1T19A 3IXBA 1F66B 2R9XA 3IH9A 5B33B 3WAAA 3MQOA 3T4JA 5C3IB 3D9YA 3N7WA 1RCJA 3T1QB 5BOHA 4S2OA 2NZDD 1G68A 1Q2PA 3KO6A 2KX6A 5B0YD 5FDSA 3KSYA 3BLMA 3NOUC 4UAAA 3M2JA 4HBTA 4KQQA 3LZ1C 3MJQA 2J9PA 3V5MA 1KX3C 3B6GC 1PIOA 1HQ3C 2ZQ9A 3MGPA 1M1AC 4D60A 3B6FC 1CQAA 3IBRA 1FSYA 4Z5TC 3KS4A 4HJ6A 4EQIA 4YWZA 2ZQAA 3REHB 1F66D 3QP6A 2E8JA 4X68A 3HLDA 4P6ZM 2HIOC 3ISGA 3W4OA 4IUKA 4RQ9A 2J3WA 2FFFB 5B2JC 3X1TB 3E4OA 4GJ4A 4X69A 5F68A 4F3LA 1OTBA 2EFUA 5EVID 1E88A 4YM6A 3MGQB 4JXSA 4J8WC 4G91C 4WU8A 4X23B 5EOEA 4OPYA 3G32A 5GLDA 4OJLA 1TZYA 3KYZA 1ID3B 2EXBA 5CRFA 5GLAA 3KXBB 5CHUA 1OT9A 1P3ID 3PBQA 2Y2QA 1YLTA 4Z66C 1G28A 5EPHA 2IO5C 5B2IB 5B31G 1IEMA 2WAFA 1NYYA 5CHMA 4E3OA 2AROA 2DCFA 2W3DA 1P3OA 5DTKA 5DFYA 3WS5A 1M19D 4WU8D 2ZM0A 2ZY5A 1K6SA 4JKTA 3UN7A 2QZ6A 5CTNA 3O86A 5L8MA 4FTXA 5BNVA 5FUGB 4ZUXD 4HMEA 4B9OA 4FCFA 1P3KA 5GSUA 3TU4C 3TU4A 3L27A 1XA1A 1F66C 5AQ7A 3RH8B 1S67L 5GHZA 1E3UA 1U35C 4E44A 1TS7A 4OP5A 4KG6A 4X55A 2ZY2A 2ZD8A 5AY8D 3O88A 2RVQC 3WTPB 5JA4B 2QPNA 2IA2A 3GQZA 4O0PA 4IUHA 2J9OA 2WZXA 5BPVA 1P3MC 3BRMA 3WD0A 5B0ZC 2HJEA 3VV4A 3QP8A 3LR3A 3P09A 4LPZA 3WX7A 3PBNA 2F8NG 5K5BA 3SS5A 3BFCA 4FOFA 2ZM8A 2EX9A 4CLCD 1KX3B 2W1RA 3F1NA 3AZJC 2W1TA 3AZIB 5B0YA 1GSXA 4EUZA 4J8VA 4ARZB 1LSWA 4Y2FA 3VSLA 4J8UB 4NYYA 1PZRA 3EPHA 3BEBA 3T1RA 3JVVA 3PBTA 4WYYA 1HTAA 3PAGA 4RVAA 2HJ9C 4DE2A 3AZJD 5CPJD 5HWTA 3F1PA 4ZRRA 3W99A 2W3EA 5DJTA 3AV2B 1Y4OA 5HDSA 2DMWA 1H8PA 1MBLA 3WD3A 5L09A 4JJNB 1AWIA 3GECA 3GVBA 1S1ZA 4G92C 5CPJA 4NZ1A 2LB5A 3VH5A 1W63M 5AY8C 3UTAC 1XX2A 3MFXA 1GHIA 4K91A 5A92A 5FA7A 2Y8HA 4HNBA 4WM9A 5F99C 4OJ5A 4R8PB 1LHYA 3TSGA 5AVBA 3RXWA 1BH9A 5F1GA 3AL0C 4KGCD 1IYPA 4IBDA 5E5AD 5AVEA 1K0KA 3MFDA 3NOTC 4XZQC 2PBYA 2J80A 3A1IA 1IYOA 1M19C 3HJIA 1YU0A 2FJ7C 5CEDA 1K56D 3EPKA 1M1AB 4IBIA 3NY4A 3VH6T 1M18D 4LV0A 3REJA 4P0MA 3MNNC 2FFYA 5BNXA 1PI4A 5AV5B 3NDGA 3MGRB 1ES5A 3VP0A 1KS0A 1IKGA 4XUZA 2QJ7A 3X1VA 2F8NB 3KYEA 4QLCC 3K3CA 1ZLAB 2VA0A 3N8LA 1TAFB 3GR2A 1ACFA 3AZGA 2W3FA 3ZVTA 4NXEA 3Q7VB 5DNMA 2OWHA 5GT0C 3AYWD 1AXBA 2XD5A 4M6BA 3EEHA 3D4FA 1Z6FA 2VGLM 4GCZA 5JYOA 3NECA 5AVBD 1H3QA 1EQZA 2V0WA 2MJ6A 1ZG6A 3QNCA 3KXBD 4G3KA 1WA9A 5DKLA 2J8PA 2WKRA 1TS6A 2XA7M 3SS4A 4EEPA 3BFDA 3IX8A 4WEJA 4Z5TD 5AV9C 5EE8A 3UY6A 3Q81A 1JFIB 4BBUA 2FN2A 4R4SA 5G49A 4N1HA 3UTBD 4OP8A 5BT1D 2OSUA 5F5YA 1IFQA 1P9WA 2EX2A 4D2OA 4E3MA 2XR0A 1KX3D 2EA9A 5FL3A 1EAKA 5CX7A 3WS4A 3X1SA 3IF5A 1E6NA 3EWKA 4JJNC 3AZKC 3X1SC 3L9KA 3MGSB 4Z5TB 1Z09A 3LJAB 5B31C 1ZG4A 5HX9A 4JXWA 5B1LA 5B24B 4MBKA 3L25A 1DY6A 1PNEA 4HH3A 3BY9A 5FQQA 3TG9A 1LSVA 4J8VD 2I72A 4Y0TA 3CAXA 1L0EA 1VETB 4Y3IA 3LZ0C 5F99B 4WZ5A 3UDFA 3WA9D 1L6JA 5MC7A 3AZLA 3CZDA 1HQ3A 4DE3A 5GT3D 4O01A 3DW0A 4R3JA 1YUEA 2WADA 5AVFA 4CAYB 1ERMA 3IF6B 5L10A 3MXRA 3LGOA 1PYYA 3HUOA 2XROA 4NXBA 4J8VC 3T1XA 4J8UC 3ZFZA 4ZBJC 3F1OA 1PW1A 2I9VA 3SZTA 4DRAA 4E3IA 3VOZA 3MGRC 2IO5B 4KENB 3RXXA 5HL6A 1P3GA 4IBRA 2J7VA 4KHAB 3X1SD 3AN2A 2A24B 4J8XB 2NQBD 3C4OA 4R70A 4H9OB 3IP4C 2P04A 1ID3D 1IKIA 4J8WA 5HD5A 2NUPC 3AZED 1MZUA 2KOIA 3AZEB 4GHAA 4P6BA 4QY5A 4OQIA 4YNRA 3W97C 2B5RA 3NULA 3UTAB 2ZMAA 3MZDA 3H82B 1MC0A 3CPTA 3NI9A 3UB7A 4OUIA 3BQ8A 3OLOA 1XJ3A 4ZJ3A 4HY8A 5AVBC 2XRNA 3OBFA 1P3MB 1Y54A 2JN7A 3DTKA 3V3RA 1U60A 1HD8A 4NZ5A 3FZCA 3R7WA 4CSRA 5DNMD 5HWVA 5GT0D 5FAPA 5FASA 2ZL1B 3AZIC 3D3OA 3MGPC 3TJZC 1W8QA 3X1VD 3IWIA 1E8BA 1P3GD 4BBVA 3REJC 2KDKA 2JKTM 2OLUA 3AZFD 4KUDB 4GHIA 2CV5C 1XP4A 3FPVA 4JF5A 4CLCB 1OTAA 2Q9MA 1P34B 4I3IA 4P6ZS 3MSHA 4WU9D 4UA6A 4IBBA 4R4RA 5DNNB 3AZNB 3PXPA 3K3DA 4OQGA 3UNWA 5FI7A 3MGRD 4H6JA 2UWXA 4H9NA 3MQQA 3MZFA 1P3IB 3C2WA 4ME4A 1S32B 2VK3A 1PWGA 1STZA 5B32A 1W8YA 3W99C 4J8XC 2D01A 2PYOA 4EEUA 2G5HC 4NXGA 4Z2GA 3KWQD 3I7JA 5B2JB 3X1TC 1M19B 4LRYC 5EVEA 3X1TA 3TW8A 5EVIB 3WA9C 3H0LC 4G91B 3LI8A 3L28A 1F5MA 4OOMA 5B1MB 1UWPX 2QYBA 3A0SA 3AZKA 2XK1A 5GSUC 4M4XA 4XXRA 5CTMA 4C75A 1GOIA 2P9VB 3W98A 2HGVA 2D49A 1TVFA 2VGJA 4P87A 3C1BB 3T4KA 3TE8A 3KXBA 4WUJA 1HZOA 5C5KA 4EBPA 3A3DA 3AGEA 1DP6A 4HHDA 3HONA 1MWTA 3MVDD 3LZ0A 3WKJC 1KVLA 3AGDA 2FZ0A 3WKJA 2YFVA 3LZ1A 4DMZA 2V9AA 4PHTA 1AOIC 4JXVA 2ZM5A 2QMIA 4X53A 1E6PA 5FUGA 1ESUA 2HP6A 5B32D 5GL9A 3LEZA 3X1UC 4NY2A 5KZHA 2H0TA 5FEGA 3CITA 2H10A 3BW6A 3VSKA 5AV6A 2HIOA 1F1EA 1YU1A 3UT9A 3KFUG 2PR5A 4L9FA 5GT0A 5FQIA 2BYKB 1F2KA 1ONHA 1E15A 1NZUA 3A6NB 4WU8C 3SH8A 1ZKJA 5E5AA 3ITAA 3HCYA 4H9QA 3FKEA 3DAVA 5DNNC 4OQ0A 1M6KA 5AVCC 3MZEA 4NE6A 3T4LA 4YS3C 3N3FA 2ZM2A 2WGIA 4ZJ2A 4ZUXB 1ES2A 3MNND 2VX8A 4Z2JA 2YFWB 1TDGA 5HSQA 4J8WD 1YSPA 5FAOA 4JF4A 4WNNA 3MR0A 4BMWA 3UB6A 2BLSA 4LCMA 4BWIA 2OAP1 5TFQA 3UTBB 4R0QA 5HPFA 3OOVA 5B2ID 1FSWA 1K55A 1F66A 2J3TC 1YM1A 1TS8A 3AFAB 3WTPD 3O3VA 4QU3A 4WMCD 4KUDD 4JF6A 4I3AA 1NZOA 3ICYA 2VJWA 4MBHA 3VE3A 5AV8A 3E2LA 3KS8A 2VV8A 4N9LA 3OCLA 3OPHA 4NFTA 2HPBA 1D7EA 4KG5A 4R8PC 3UPOA 4R8PA 1EROA 4IBJA 1N1JA 1JVJA 4KZ6A 4OQHA 3NCKA 2OAQ1 3AV1B 5FQKA 2BYMA 1ODVA 4DDSA 4S2NA 4X56A 4Y13A 1K4EA 2O0YA 1J9MA 5BNXB 2WZZA 4PAUA 5KSHA 4N92A 1SKOA 3OPRA 3AFAD 1IOUA 1P3AB 3IH8A 1Q9CA 5GSUD 4X1MA 1P3KD 1HVBA 4OOLA 2XA7S 5L2FA 3WA9B 3LELB 4NK3A 4UUZA 2ZQDA 3AZGB 1LL5A 4F3LB 1YU4A 3HVFA 3Q7VA 4OVDA 2CWEA 2OWJA 3G30A 4WU8B 3G6OA 1P3FA 4PM6A 3C1BC 2OV5A 4HEFA 5AV8D 5JRGA 3PBRA 4O8GA 1U35D 1EQZB 5AVCB 5A91A 2XD1A 5CPKC 3T4TA 5CP6C 4KUDC 1EQZD 2DF4C 4L9GA 3LIAA 3QP4A 1M18B 4R23A 4ZUXC 3UPNA 1NXYA 2HP5A 3KWQB 4GD6A 1AOIB 3NQJA 3UMDA 2PYOD 2M7UA 1XJ2A 3H0MC 2IWDA 4R3AA 3X1UB 2R78A 4UA9A 3X1SB 3KUYB 2RTSA 4ZAMA 5CPIB 1KDWA 3IX4A 4CPKA 4Z5TA 3OPLA 3O62A 2CV5A 3G2ZA 4DRBA 3REJD 1P3PB 4QPRA 3X1VC 3HUNA 4Y15A 4BD0A 3U2AA 3G4PA 4IVKA 2G2UA 4I38A 3AZMA 1P3LB 4H9RB 3N8RA 1GSVA 4WELA 5DNMC 1VETA 4DE0A 1VHMA 1W63Q 4G92B 3AZLB 1HQ3B 3Q07A 1ZLAD 4NZ4A 3F1NB 4KZBA 4LD9A 4HI4A 4HGAB 2WGVA 3AZFB 1AIWA 5B40B 2OOLA 2BG1A 4Y0OA 4DE1A 5AV9A 3C1CC 5B24D 4FD8A 5GHYA 1EI5A 3AZND 4EV4A 1M1AD 5KSCA 1KX5D 3N8SA 2Y55A 4HJ4A 4GDNA 1YLYA 2QKPA 3W96A 4XZQB 4R3BA 4J8XA 4KZ3A 4WU9B 4KGCB 1W1PA 1CEFA 2G2WA 3MVDC 4S2LA 5G18A 4J8WB 3C7VA 4JJNA 2O9BA 2NQBC 3AZHC 5AV5C 5BO0B 1BLSA 1U35A 3H82A 1KGFA 3T4QA 1XGIA 1YAXA 3VH5T 4JGOA 3ITBA 1GPFA 4CLCE 3ZDJA 1P3FD 5GXQD 3JYIA 2V20A 5AVBB 2J8YA 3A0RA 1PRQA 3A1KA 2Q0OA 5CERA
chains in the Genus database with same CATH topology
2ZY3A 1KX4C 1L0GA 2FJ7A 4CSRB 3N6IA 3DTMA 3ZCZA 2Y2KA 2Z2LB 1MPLA 5JYPA 5DF7A 2PU4A 1LI0A 5AV5D 5I94A 3R45B 5CXWA 3REHC 1O07A 3REKC 1K57C 3N4IA 4YM6C 5GT3A 5B0ZB 3FV7A 1P34A 1BSGA 1SDNA 4GHLA 3WRZA 2ZQ7A 3PBOA 3B0CW 5TR7A 4P85A 4X23C 3V9RA 3GTCA 5C3IC 3AZJB 3BM6A 5KDMB 3B3XA 5TGFA 3CJMA 3AZFC 1B6WA 3KXBC 4Z66A 4GDBA 1W5DA 2WKHA 3AZID 1KGEA 1BH8A 4JPMA 1P3OC 3OCNA 3NQUB 3UE3A 5DVAA 2JC7A 5GXQB 1M19A 4N9KA 3HSHA 3B6FB 1GCEA 4DXCA 1N4OA 3KUYC 5EUAA 2H5SA 3AZHA 2NQBB 3BFFA 4GD8A 1CI8A 2XEPA 4DRTA 4H8RA 1K38A 2WKIA 2DNSA 4BL3A 2R9WA 4MLLA 4KG2A 5JRGD 3ZVWA 1H8ZA 1ONGA 5KMWA 2RCXA 2WGWA 4GH9A 1BLPA 2Y2HA 3MGQC 5BS7A 3LY3A 4EWFA 3AZEC 2IWBA 1BUEA 4XZQD 4YM6D 3HL9A 2DRWA 3W97B 1DJCA 3IF6A 1ID3A 3IXDA 3REHD 3W4PA 3IWQA 3W4QA 3MXSA 3VP3A 1FR6A 5CP6D 1H5XA 5FATA 5CPKB 1YMSA 1MWSA 2NZDB 5FI2A 3HUMA 3H0RC 5HAQA 3MKEA 4EO5B 3GV9A 5GT0B 3REID 3MVDA 3RELA 4XUJA 3RELC 1P3BA 3FKWA 1P3KC 1P3FC 5CPJC 4X23A 3HLBA 3WAAC 1P3PC 3EQUA 5HAIA 5JA4A 3WTPA 4WMCA 1XGJA 3AZKD 4QD4A 4BENA 3V3SA 2WKEA 4PM8A 5B2IA 4C3QA 1O7EA 2E8IA 4IBKA 3B6GA 5B0ZD 1KX3A 2Q9NA 4PM9A 3A3FA 5AQAA 5BT1C 3UTBC 3AZIA 4HGAC 3HREA 5BNVB 5AV9D 4J8UA 2Y2GA 4O7DA 3MBZA 3REKB 2Z2MB 1I2WA 5J8XA 1BULA 3WRTA 3AV2C 1ZLAC 4XUJD 1P3BD 3IXHA 3EG5B 3TOIA 1KE0A 3LELD 1P34D 3AZMD 1GHMA 4GNUA 3CG5A 3IF6C 5DNNA 4RX2A 4BL2A 3FYZA 4MEZA 5AY8B 4KZ8A 4JXGA 1YMXA 4YS3D 1BTLA 3EQVA 3S1YA 3DWZA 4E3LA 2WUQA 3DWKA 3P98A 1CK3A 3HLFA 4Z2MG 4OLGA 2FJ7D 5DF9A 3LELC 2VGKA 2CC1A 4LCLA 3E2KA 3NC8A 5B2JD 4UUZB 1RGYA 4XUJC 1P3BC 1NY0A 3AV2D 3WS2A 4U0XA 4E6WA 1FCMA 5CPJB 5B31A 1NRFA 4S2MA 4IBCA 4BJPA 3X1UD 5AV8C 4AWLB 4IBGA 3C1BD 3ZG5A 1AOID 4YM6B 5M18A 3SH9A 2PU2A 5A93A 3LZ0B 1TZYB 3KWQA 1YLWA 1KGGA 3NQJB 2F2AC 1VM1A 5B0YC 4S2NC 3B0DB 3CMZA 2NZDC 1H3OA 1KU5A 3REJB 4MBFA 1P3PD 1W7FA 1PW8A 2AROB 1JFIA 3REHA 3ZG7B 5F82A 5AV6B 5FQMA 4K0XA 3X1VB 2F8NA 1ZLAA 4QNLA 4JLFA 2JBFA 2BYKA 3REIC 2HUEB 5DNMB 1P3KB 3UE1A 3WWXA 1KE4A 1L0DA 2C5WB 3VOYA 3MGSA 1BFMA 2RVQD 3BLSA 5FSRA 2G5IC 5CP6A 4DXBA 4ZJ1A 3V39A 3TU4D 4H9SC 4KQRA 5A90A 5B2IC 1XA7A 2JCHA 5DTSA 2VQRA 4DF6A 3A3JA 4NE3A 1MXOA 4WU9C 3FKVA 1GA9A 4J8VB 3UTBA 1PZPA 3MNNA 2Y2OA 5GSUB 4K0WA 4WZSB 1FCNA 4WV4B 3EPJA 2RIQA 2OLVA 4OPQA 3EPLA 3AV2A 5FAQA 4H9OA 1N9BA 3AZMC 5FDHA 5BS7C 1P34C 1YLZA 3AZEA 1XXMA 5U47A 3L26A 1TZYC 3AZGD 3L2AA 1KX5B 3IHAA 2V1ZA 1E25A 2HIOD 4LV1A 4CJNA 4WZ4A 5DF8A 2XFSA 3SH7A 4YS3A 4ZBEA 5B32C 4UHUA 1TDLA 1XPBA 1BH9B 3LO7A 4LD9D 4E45A 2AROC 3IQAA 3VP2A 4PM5A 2WK0A 3W96C 4NETA 3QNBA 3VP4A 4ID4A 3R45A 4IBEA 1ERQA 3W99B 3LELA 5E2FA 1LLBA 3A6NC 2HP9A 4XUXA 4LV3A 2X01A 3REKD 1FOFA 1GA0A 4IBXA 4HBUA 5B1LC 3UTAA 5JRGB 5AV6D 1FCOA 4JBFA 2C6WB 1TAFA 4OJPA 3GMWA 3WAAD 4H9SA 1YU2A 4WZ5C 4FH2A 1P3LD 1BH8B 2XDMA 5GHXA 3LZ0D 1M1AA 5GXQC 4OOYA 1Q2QA 4ZTKA 4FSFA 4H9NB 3C1CB 3MGRA 5AV6C 1S32A 1ES4A 5B31D 2Y2MA 5B40D 2H0YA 4QB8A 4UPKA 4EBLA 1K57A 3W98D 2EX8A 3REIB 5B2JA 3IHBA 4M3KA 3ZG0A 4OJ6A 1XKZA 4DQYB 4A5RA 4BQMA 5B1MA 1OMEA 3LJAA 1YQSA 3W96D 4RYEA 1KX5C 2CV5D 3AZNA 2Y4AA 3AZFA 4B4XA 5CEBA 3ZG8B 4AWLC 5GLBA 3B0BA 5EVLA 3KUYD 1K6RA 2F8NK 1CI9A 3ZNTA 1P3AC 3G34A 1K56A 4XZQA 2Y2PA 3W96B 4Q8IA 1WYCA 4GN2A 4EO5C 4X6TA 2YFVB 3HLGA 1P3OD 1LL9A 1K55C 2V2FF 1P3AD 3B0DC 5M19A 3ZNYA 1YLPA 3RJUA 3O62D 4KHAA 3A3IA 2X71A 3Q1FA 5CGSA 3OC2A 4OJOA 4Y0UA 1M18C 3W97D 3VP1A 3WTPE 2JE5A 2RL3A 1YU3A 5GLCA 5E5AC 3B6GB 4QJGA 4H9PA 1JWZA 3PBSA 4E3JA 4E6XA 4ZBJB 2F8NH 3UTAD 1S0WA 4YINA 1P3GB 3AN2B 1P3OB 1ES3A 3AYWB 1P3LC 1WYBA 3AGFA 1G6AA 3FWLA 3MGSC 2ZC4B 3BFGA 3UT9D 3AFAC 3P5JB 3C7UA 4DDYA 3S22A 3B0CT 4KUDA 2XLNA 4PM7A 2HDQA 4QLCB 4DKIA 3IT9A 3S4XA 3NBLA 5AQ9A 3HBRA 1SHVA 4Z66B 4BLMA 1P3MA 5E43A 4ZUXA 4NE5A 1M40A 1KVMA 3O87A 3A6ND 2ZC3B 1N1JB 1KX4A 3AV1C 4IVIA 2YFWA 1YT4A 4KZAA 3AV1A 4R8PD 1TEMA 5GXQA 1NYMA 5HW3A 2Y2LA 2AROD 1BZAA 2DQNC 4PMAA 3AZHB 4E3KA 3G31A 3W8KA 3C1CD 5B32B 3ZG9B 2Y59A 4OLDA 3NDEA 1ULYA 5CECA 3PAEA 3G35A 3C5AA 3VH5W 3QHYA 4IJFA 1TZYD 2ZY4A 3AZGC 1MWUA 2WGWB 1RGZA 2Y2IA 2ZC7A 4RA7A 3M2KA 2IWCA 1P3FB 5B33A 3WAAB 1MY8A 3LJAC 4WBGA 3AN2D 1K54C 2ZQ8A 4OKPA 1BLHA 4BD1A 4Z66D 5AVCA 1JWVA 5HFOA 5CPKA 4KZ9A 3L29A 5EOOA 5DNND 3LJAD 2XF3A 5E2GA 3UO9A 4OONA 1E4DA 3LZ1B 2PYOC 1P3AA 4S2JA 4KQOA 1ESIA 4LV2A 3MGPB 4KGCC 5F99D 2F8ND 4E3NA 3KUYA 3W98B 3IXGA 1VQQA 1K25A 5CPKD 3UDIA 2CV5B 4KZ5A 1P3PA 4S2IA 1IYQA 3FDDA 3MGQA 1M18A 3Q82A 4WJ3C 3B6GD 5B1MD 5E5AB 3LZ1D 3WKJD 1PWCA 3WKJB 2ZC5B 1AOIA 2ZC6B 3UPPA 4QHCA 1A7WA 1ZC2A 4S2KA 5E2HA 5FQJA 1MKIA 3HLEA 3MNNB 4GKUA 3M6BA 3SOIA 1S32C 3X1UA 4HESA 4RX3A 1S32D 3OZHA 1W2EA 5G49B 3REKA 4L0LA 1CEGA 3UT9C 3GRJA 1LI9A 4WNNB 3RELD 3AZMB 5B1MC 3X1TD 4LG2A 3A6NA 4H9RA 1T3UA 4J8XD 1P3MD 3TU4B 3W99D 3AFAA 3WS1A 3NIAA 5AY8A 1KX5A 5BO0A 1U35B 1I5QA 5B24A 4IEDA 5AV8B 4LD9B 5AQBA 3WTPC 4YS3B 2GDNA 1QMFA 3PTEA 5AV9B 3WS0A 3ZHHA 1WWSA 4KZ7A 3AZLD 4PPRA 5B0YB 4KGCA 1SDEA 2EFXA 5CHJA 1H8YA 5B31B 1P3IC 3O62C 3BECA 4Z9QA 5AVCD 1P3GC 3AN2C 1S6RA 5F83A 2XFTA 2HUEC 4YFMA 5EVIC 1L0FA 1I2SA 1B67A 3V9RB 1HTZA 2P74A 1JTDA 1NJ4A 4NYUA 2BYMB 2W8SA 2L5AA 5KDMA 4C6YA 3VH6A 3HLCA 4GZBA 3HLWA 1H3OB 3ZGAB 2A49A 5CHLB 3V50A 3C1CA 3B6FD 4X23D 5HARA 5D3OA 2XH9A 1HQ3D 3LCEA 3AV1D 1FQGA 3WA9A 2Y2JA 3REIA 1PZOA 4NZ3A 5GT3B 2Y91A 1KE3A 2WYXA 5AV5A 2Y2NA 3W98C 2ZJ9A 4Y7PA 2NQBA 1QMEA 5E2EA 4OH0A 1L2SA 5CGXA 4KZ4A 1Z2CB 5CP6B 1FR1A 1PWDA 5B32G 5M1AA 4B4ZA 3F6TA 1SCWA 5HAPA 3MGSD 3BYDA 5EECA 4OPZA 5HL1A 2HDUA 3KWQC 3NQUA 5IHVA 2LY8A 5B40A 2XGNA 3B6FA 1WWIA 4S2PA 4GB7A 3VH6W 2NZDA 5CPIA 1P3IA 3C4PA 3G2YA 3GSGA 5CPIC 5B1LD 3O62B 2ZLYA 1C3BA 4JJND 3AZHD 4UA7A 3MKFA 3M6HA 2PYOB 2HDRA 5F1FA 1P3LA 1DJAA 3RELB 5EVIA 3MGQD 5FI6A 1RP5A 1W79A 1DJBA 3AZKB 1ALQA 1K54A 2P9VA 3W97A 5B33C 4B88A 5B1LB 2HDSA 3AZNC 4LD9C 5JRGC 4LENA 4R1GA 5B24C 1KDSA 1WE4A 3VFFA 3C1BA 4H9PB 4N1XA 4F94A 3A3EA 2ZQCA 5F99A 3MGPD 3UDXA 3SS3A 4FH4A 2JSSA 4CAYA 2XQZA 4EBNA 4WU9A 3AYWC 1JTGA 3AYWA 1PI5A 3MVDB 1K4FA 1MWRA 4XUJB 1P3BB 1IYSA 4OPRA 4QLCD 3IWOA 1E3UD 2EXAA 2HIOB 3UT9B 5B33D 4QLCA 5FQ9A 5B0ZA 1GHPA 1R4VA 3OPPA 2A3UA 3Q7ZA 3AZLC 5DTTA 1EWZA 3VFHA 4ZDXA 1JWPA 4U3TA 1BLCA 1SKFA 1ID3C 2FJ7B 3AZJA 4H9QB 1KX4B 4GOGA 1BT5A 3UE0A 5B40C 4U0TA 4WEKA 5CPID 1EQZC 4Z2MH 1YLJA 2WAEA 5CGWA 2EX6A 3BFEA 4J8UD 2X02A 4QY6A 1IELA 1KX4D 5GT3C 3VMAA 2IOUA 3LY4A 4IBFA 4IJEA 4MNRA 3IXBA 1F66B 2R9XA 3IH9A 5B33B 3WAAA 5C3IB 3N7WA 1RCJA 5BOHA 4S2OA 2NZDD 1G68A 1Q2PA 5B0YD 3KSYA 3BLMA 4UAAA 3M2JA 4HBTA 4KQQA 3LZ1C 2J9PA 3V5MA 1KX3C 3B6GC 1PIOA 1HQ3C 2ZQ9A 3MGPA 1M1AC 3B6FC 1FSYA 4Z5TC 3KS4A 4EQIA 2ZQAA 3REHB 1F66D 4X68A 3HLDA 2HIOC 3ISGA 3W4OA 2FFFB 5B2JC 3X1TB 4X69A 2EFUA 5EVID 4YM6A 3MGQB 4JXSA 4J8WC 4G91C 4WU8A 4X23B 5EOEA 4OPYA 3G32A 5GLDA 4OJLA 1TZYA 1ID3B 2EXBA 5CRFA 5GLAA 3KXBB 5CHUA 1P3ID 3PBQA 2Y2QA 1YLTA 4Z66C 5EPHA 2IO5C 5B2IB 5B31G 1IEMA 2WAFA 1NYYA 5CHMA 4E3OA 2AROA 2DCFA 1P3OA 5DTKA 3WS5A 1M19D 4WU8D 2ZM0A 2ZY5A 1K6SA 4JKTA 3UN7A 2QZ6A 5CTNA 3O86A 5BNVA 5FUGB 4ZUXD 4FCFA 1P3KA 5GSUA 3TU4C 3TU4A 3L27A 1XA1A 1F66C 5AQ7A 5GHZA 1E3UA 1U35C 4E44A 4OP5A 4KG6A 4X55A 2ZY2A 2ZD8A 5AY8D 3O88A 2RVQC 3WTPB 5JA4B 2QPNA 3GQZA 2J9OA 2WZXA 5BPVA 1P3MC 3BRMA 5B0ZC 3P09A 3WX7A 3PBNA 2F8NG 3SS5A 3BFCA 2ZM8A 2EX9A 1KX3B 3AZJC 3AZIB 5B0YA 4EUZA 4J8VA 3VSLA 4J8UB 4NYYA 1PZRA 3EPHA 3BEBA 3PBTA 4WYYA 1HTAA 3PAGA 4RVAA 4DE2A 3AZJD 5CPJD 3W99A 3AV2B 1MBLA 4JJNB 3GVBA 4G92C 5CPJA 4NZ1A 3VH5A 5AY8C 3UTAC 1XX2A 1GHIA 4K91A 5A92A 5FA7A 4WM9A 5F99C 4OJ5A 4R8PB 1LHYA 3TSGA 5AVBA 3RXWA 1BH9A 5F1GA 3AL0C 4KGCD 1IYPA 4IBDA 5E5AD 3MFDA 4XZQC 2PBYA 3A1IA 1IYOA 1M19C 1YU0A 2FJ7C 5CEDA 1K56D 3EPKA 1M1AB 4IBIA 3NY4A 3VH6T 1M18D 4LV0A 3REJA 4P0MA 3MNNC 2FFYA 5BNXA 1PI4A 5AV5B 3NDGA 3MGRB 1ES5A 3VP0A 1IKGA 4XUZA 3X1VA 2F8NB 4QLCC 1ZLAB 3N8LA 1TAFB 3GR2A 3AZGA 3ZVTA 3Q7VB 5DNMA 5GT0C 3AYWD 1AXBA 2XD5A 4M6BA 3D4FA 1Z6FA 5JYOA 5AVBD 1EQZA 1ZG6A 3QNCA 3KXBD 2J8PA 3SS4A 3BFDA 4WEJA 4Z5TD 5AV9C 5EE8A 3UY6A 3Q81A 1JFIB 4R4SA 5G49A 4N1HA 3UTBD 4OP8A 5BT1D 2OSUA 2EX2A 4D2OA 4E3MA 2XR0A 1KX3D 3WS4A 3X1SA 3IF5A 4JJNC 3AZKC 3X1SC 3MGSB 4Z5TB 3LJAB 5B31C 1ZG4A 5HX9A 4JXWA 5B1LA 5B24B 4MBKA 3L25A 1DY6A 5FQQA 3TG9A 4J8VD 2I72A 4Y0TA 1L0EA 3LZ0C 5F99B 4WZ5A 3UDFA 3WA9D 3AZLA 3CZDA 1HQ3A 4DE3A 5GT3D 4R3JA 3DW0A 1YUEA 2WADA 4CAYB 1ERMA 3IF6B 3MXRA 1PYYA 3HUOA 4J8VC 4J8UC 3ZFZA 4ZBJC 1PW1A 4DRAA 4E3IA 3VOZA 3MGRC 2IO5B 4KENB 3RXXA 1P3GA 4IBRA 2J7VA 4KHAB 3X1SD 3AN2A 4J8XB 2NQBD 3C4OA 4H9OB 3IP4C 1ID3D 1IKIA 4J8WA 3AZED 3AZEB 4GHAA 4P6BA 4QY5A 4OQIA 3W97C 2B5RA 3UTAB 2ZMAA 3MZDA 3NI9A 4OUIA 4ZJ3A 5AVBC 1P3MB 1Y54A 3V3RA 1U60A 1HD8A 4NZ5A 3FZCA 4CSRA 5DNMD 5GT0D 5FAPA 5FASA 3AZIC 3MGPC 1W8QA 3X1VD 3IWIA 1P3GD 3REJC 2OLUA 3AZFD 4KUDB 2CV5C 1XP4A 4JF5A 2Q9MA 1P34B 4WU9D 4UA6A 4IBBA 4R4RA 5DNNB 3AZNB 4OQGA 3UNWA 5FI7A 3MGRD 2UWXA 4H9NA 3MZFA 1P3IB 1S32B 1PWGA 5B32A 1W8YA 3W99C 4J8XC 2PYOA 2G5HC 3KWQD 3I7JA 5B2JB 3X1TC 1M19B 3X1TA 5EVIB 3WA9C 3H0LC 4G91B 3L28A 4OOMA 5B1MB 4XXRA 3AZKA 2XK1A 5GSUC 4C75A 5CTMA 2P9VB 3W98A 1TVFA 4P87A 2VGJA 3C1BB 3KXBA 1HZOA 4EBPA 3A3DA 3AGEA 3HONA 1MWTA 3MVDD 3LZ0A 3WKJC 1KVLA 3AGDA 3WKJA 2YFVA 3LZ1A 1AOIC 4JXVA 2ZM5A 2QMIA 4X53A 5FUGA 1ESUA 2HP6A 5B32D 5GL9A 3LEZA 3X1UC 4NY2A 5KZHA 2H0TA 2H10A 3VSKA 5AV6A 2HIOA 1F1EA 1YU1A 3UT9A 3KFUG 5GT0A 5FQIA 2BYKB 1ONHA 1NZUA 3A6NB 4WU8C 3SH8A 1ZKJA 5E5AA 3ITAA 4H9QA 3FKEA 5DNNC 4OQ0A 1M6KA 5AVCC 3MZEA 4NE6A 4YS3C 3N3FA 2ZM2A 2WGIA 4ZJ2A 4ZUXB 1ES2A 3MNND 2YFWB 1TDGA 4J8WD 5FAOA 4JF4A 4WNNA 2BLSA 4LCMA 5TFQA 3UTBB 4R0QA 5B2ID 1FSWA 1K55A 1F66A 1YM1A 3AFAB 3WTPD 3O3VA 4QU3A 4WMCD 4KUDD 4JF6A 1NZOA 4MBHA 5AV8A 3E2LA 3KS8A 4N9LA 3OCLA 3OPHA 4NFTA 4KG5A 2HPBA 4R8PC 3UPOA 4R8PA 1EROA 4IBJA 1N1JA 1JVJA 4KZ6A 4OQHA 3NCKA 3AV1B 5FQKA 2BYMA 4DDSA 4S2NA 4X56A 1K4EA 1J9MA 5BNXB 2WZZA 5KSHA 4N92A 3OPRA 3AFAD 1P3AB 3IH8A 1Q9CA 5GSUD 1P3KD 1HVBA 4OOLA 5L2FA 3WA9B 3LELB 4NK3A 4UUZA 2ZQDA 3AZGB 1LL5A 1YU4A 3Q7VA 3HVFA 4OVDA 2CWEA 3G30A 4WU8B 1P3FA 4PM6A 3C1BC 2OV5A 4HEFA 5AV8D 5JRGA 3PBRA 1U35D 1EQZB 5AVCB 5A91A 2XD1A 5CPKC 5CP6C 4KUDC 1EQZD 2DF4C 1M18B 4R23A 4ZUXC 3UPNA 1NXYA 2HP5A 3KWQB 4GD6A 1AOIB 3NQJA 2PYOD 3H0MC 2IWDA 3X1UB 4UA9A 3X1SB 3KUYB 4ZAMA 5CPIB 1KDWA 4CPKA 4Z5TA 3OPLA 3O62A 2CV5A 3G2ZA 4DRBA 3REJD 1P3PB 3X1VC 3HUNA 4BD0A 3G4PA 4IVKA 2G2UA 3AZMA 1P3LB 4H9RB 3N8RA 4WELA 5DNMC 4DE0A 4G92B 3AZLB 1HQ3B 3Q07A 1ZLAD 4NZ4A 4KZBA 4LD9A 4HGAB 2WGVA 3AZFB 5B40B 2BG1A 4Y0OA 4DE1A 5AV9A 3C1CC 5B24D 4FD8A 5GHYA 1EI5A 3AZND 4EV4A 1M1AD 5KSCA 1KX5D 3N8SA 2Y55A 4GDNA 1YLYA 3W96A 4XZQB 4R3BA 4J8XA 4KZ3A 4WU9B 4KGCB 1CEFA 2G2WA 3MVDC 4S2LA 5G18A 4J8WB 3C7VA 4JJNA 2NQBC 3AZHC 5AV5C 5BO0B 1BLSA 1U35A 1KGFA 1XGIA 3VH5T 3ITBA 3ZDJA 1P3FD 5GXQD 3JYIA 2V20A 5AVBB 2J8YA 3A1KA 5CERA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OPZ A;  3CZD A;  5HL1 A;  2HDU A;  4DE3 A;  4R3J A;  3DW0 A;  2WAD A;  1L0G A;  2XDM A;  5GHX A;  1ERM A;  3IF6 B;  3MXR A;  5IHV A;  1PYY A;  3HUO A;  3N6I A;  1Q2Q A;  3DTM A;  4OOY A;  4ZTK A;  3ZFZ A;  3ZCZ A;  4FSF A;  1PW1 A;  2Y2K A;  2XGN A;  2Z2L B;  1MPL A;  4S2P A;  5JYP A;  4GB7 A;  5DF7 A;  4E3I A;  2PU4 A;  3C4P A;  3G2Y A;  1ES4 A;  3GSG A;  3VOZ A;  1LI0 A;  4KEN B;  3RXX A;  4QB8 A;  2Y2M A;  2H0Y A;  4IBR A;  2J7V A;  1C3B A;  2ZLY A;  4EBL A;  1K57 A;  5I94 A;  5CXW A;  1O07 A;  4UA7 A;  1K57 C;  3C4O A;  3MKF A;  2EX8 A;  3M6H A;  2HDR A;  3N4I A;  5F1F A;  1IKI A;  3IHB A;  3FV7 A;  1DJA A;  4M3K A;  3ZG0 A;  5EVI A;  1BSG A;  1XKZ A;  5FI6 A;  1SDN A;  4P6B A;  4A5R A;  4QY5 A;  4BQM A;  1OME A;  1RP5 A;  1W79 A;  4OQI A;  1DJB A;  2ZQ7 A;  1YQS A;  3WRZ A;  3PBO A;  1ALQ A;  1K54 A;  2B5R A;  2P9V A;  2ZMA A;  5TR7 A;  4P85 A;  4RYE A;  3MZD A;  3GTC A;  3NI9 A;  4B88 A;  2HDS A;  4R1G A;  4LEN A;  3BM6 A;  1WE4 A;  1KDS A;  3B3X A;  2Y4A A;  3VFF A;  5TGF A;  4B4X A;  5CEB A;  4ZJ3 A;  3ZG8 B;  4N1X A;  3CJM A;  4F94 A;  3A3E A;  2ZQC A;  5GLB A;  5EVL A;  4GDB A;  1W5D A;  2WKH A;  3UDX A;  1Y54 A;  3SS3 A;  1K6R A;  1CI9 A;  3V3R A;  3G34 A;  1KGE A;  3ZNT A;  1U60 A;  1HD8 A;  4JPM A;  1K56 A;  4FH4 A;  3FZC A;  3OCN A;  2Y2P A;  2XQZ A;  3UE3 A;  4Q8I A;  1WYC A;  4GN2 A;  4X6T A;  4EBN A;  1JTG A;  5FAP A;  3HLG A;  1LL9 A;  5DVA A;  2JC7 A;  5FAS A;  1K55 C;  2V2F F;  1PI5 A;  4N9K A;  4DXC A;  1GCE A;  1K4F A;  1N4O A;  5EUA A;  2H5S A;  5M19 A;  1MWR A;  1W8Q A;  3IWI A;  1IYS A;  3BFF A;  3ZNY A;  4GD8 A;  4OPR A;  1CI8 A;  2XEP A;  2OLU A;  4DRT A;  4H8R A;  1YLP A;  3IWO A;  1K38 A;  2WKI A;  1E3U D;  2EXA A;  3RJU A;  2DNS A;  4BL3 A;  2R9W A;  3A3I A;  4MLL A;  4KG2 A;  2X71 A;  3Q1F A;  3ZVW A;  1H8Z A;  1ONG A;  5CGS A;  5KMW A;  3OC2 A;  1XP4 A;  4JF5 A;  4Y0U A;  5FQ9 A;  2RCX A;  1GHP A;  2Q9M A;  3OPP A;  3VP1 A;  2WGW A;  1BLP A;  2A3U A;  2Y2H A;  2JE5 A;  3Q7Z A;  2RL3 A;  3LY3 A;  5DTT A;  4EWF A;  1EWZ A;  1BUE A;  4UA6 A;  2IWB A;  1JWP A;  4U3T A;  3VFH A;  1BLC A;  4ZDX A;  3HL9 A;  1SKF A;  2DRW A;  4R4R A;  5GLC A;  1DJC A;  3IF6 A;  4GOG A;  1BT5 A;  3IXD A;  3W4P A;  4QJG A;  3IWQ A;  3W4Q A;  3UE0 A;  1JWZ A;  4OQG A;  3PBS A;  4U0T A;  3UNW A;  3MXS A;  5FI7 A;  4E3J A;  3VP3 A;  4WEK A;  4E6X A;  1FR6 A;  1H5X A;  2UWX A;  5FAT A;  1YMS A;  3MZF A;  1MWS A;  1YLJ A;  2WAE A;  5CGW A;  1PWG A;  2EX6 A;  1S0W A;  3BFE A;  4YIN A;  2X02 A;  5FI2 A;  1W8Y A;  3HUM A;  5HAQ A;  4QY6 A;  3MKE A;  1IEL A;  1ES3 A;  3GV9 A;  3I7J A;  1WYB A;  3VMA A;  5EVI B;  3AGF A;  1G6A A;  3FWL A;  3LY4 A;  4OOM A;  2ZC4 B;  3BFG A;  3FKW A;  4MNR A;  3IXB A;  2XK1 A;  4XXR A;  4C75 A;  5CTM A;  2R9X A;  2P9V B;  3C7U A;  3HLB A;  4DDY A;  3IH9 A;  1TVF A;  4P87 A;  2VGJ A;  3S22 A;  3N7W A;  2XLN A;  4PM7 A;  2HDQ A;  1RCJ A;  5BOH A;  4DKI A;  4S2O A;  3IT9 A;  3EQU A;  5HAI A;  1G68 A;  3NBL A;  4WMC A;  5AQ9 A;  3HBR A;  1SHV A;  1Q2P A;  1XGJ A;  3S4X A;  1HZO A;  4QD4 A;  4EBP A;  3A3D A;  3AGE A;  4BLM A;  4BEN A;  3V3S A;  2WKE A;  3BLM A;  4PM8 A;  5E43 A;  4C3Q A;  1M40 A;  1KVM A;  1O7E A;  2E8I A;  1MWT A;  3O87 A;  4UAA A;  3M2J A;  4HBT A;  4KQQ A;  2ZC3 B;  1KVL A;  3AGD A;  2J9P A;  3V5M A;  1PIO A;  4IVI A;  1YT4 A;  4KZA A;  4JXV A;  2Q9N A;  1TEM A;  3A3F A;  2QMI A;  2ZQ9 A;  1NYM A;  4PM9 A;  5AQA A;  4X53 A;  5HW3 A;  2Y2L A;  1BZA A;  4PMA A;  3HRE A;  1ESU A;  2HP6 A;  3G31 A;  1FSY A;  4E3K A;  3W8K A;  5GL9 A;  3LEZ A;  5KZH A;  2H0T A;  3ZG9 B;  2Y59 A;  2H10 A;  4EQI A;  4OLD A;  3NDE A;  2Y2G A;  2ZQA A;  4O7D A;  3MBZ A;  3VSK A;  5CEC A;  4X68 A;  2Z2M B;  1I2W A;  3HLD A;  3W4O A;  3ISG A;  5J8X A;  1BUL A;  3WRT A;  3PAE A;  3G35 A;  3C5A A;  2FFF B;  5FQI A;  3QHY A;  3IXH A;  1MWU A;  1ONH A;  2WGW B;  1RGZ A;  4X69 A;  3TOI A;  1KE0 A;  2Y2I A;  1NZU A;  2EFU A;  5EVI D;  2ZC7 A;  4RA7 A;  4JXS A;  1GHM A;  3M2K A;  2IWC A;  3SH8 A;  1ZKJ A;  5EOE A;  4OPY A;  3G32 A;  5GLD A;  4GNU A;  3CG5 A;  3IF6 C;  3ITA A;  4RX2 A;  4BL2 A;  1MY8 A;  3FYZ A;  4MEZ A;  4WBG A;  1K54 C;  2EXB A;  4OQ0 A;  1M6K A;  2ZQ8 A;  4OKP A;  1BLH A;  3MZE A;  4BD1 A;  4KZ8 A;  5CRF A;  5GLA A;  4JXG A;  1JWV A;  1YMX A;  5CHU A;  5HFO A;  1BTL A;  3EQV A;  3PBQ A;  2Y2Q A;  4KZ9 A;  3S1Y A;  1YLT A;  2ZM2 A;  3DWZ A;  4E3L A;  2WGI A;  4ZJ2 A;  5EPH A;  5EOO A;  1ES2 A;  2WUQ A;  3DWK A;  1IEM A;  3P98 A;  2WAF A;  1NYY A;  2XF3 A;  5CHM A;  4E3O A;  5E2G A;  2DCF A;  1CK3 A;  3UO9 A;  3HLF A;  4OON A;  1E4D A;  5DTK A;  4OLG A;  1TDG A;  3WS5 A;  2ZM0 A;  5DF9 A;  5FAO A;  1K6S A;  4JF4 A;  4JKT A;  3UN7 A;  4S2J A;  2QZ6 A;  5CTN A;  1ESI A;  2BLS A;  2VGK A;  2CC1 A;  3O86 A;  3E2K A;  3NC8 A;  4KQO A;  4LCL A;  1RGY A;  4LCM A;  4LV2 A;  4R0Q A;  5TFQ A;  1FSW A;  1NY0 A;  4FCF A;  1K55 A;  3WS2 A;  4E3N A;  4U0X A;  4E6W A;  3IXG A;  1VQQ A;  1FCM A;  1XA1 A;  1YM1 A;  3O3V A;  4QU3 A;  4WMC D;  4JF6 A;  1K25 A;  5AQ7 A;  1NRF A;  1NZO A;  4S2M A;  5GHZ A;  1E3U A;  3UDI A;  4OP5 A;  4KG6 A;  4KZ5 A;  4BJP A;  4X55 A;  2ZD8 A;  4MBH A;  3O88 A;  2QPN A;  4S2I A;  3E2L A;  3GQZ A;  1IYQ A;  4N9L A;  3OCL A;  3OPH A;  2HPB A;  2J9O A;  2WZX A;  4KG5 A;  3BRM A;  3ZG5 A;  5M18 A;  3SH9 A;  3UPO A;  3Q82 A;  1ERO A;  2PU2 A;  5A93 A;  3P09 A;  1PWC A;  3PBN A;  1JVJ A;  4KZ6 A;  4OQH A;  3SS5 A;  1YLW A;  1KGG A;  2ZC5 B;  3BFC A;  2ZM8 A;  3NCK A;  2EX9 A;  5FQK A;  2ZC6 B;  1VM1 A;  3UPP A;  4QHC A;  1ZC2 A;  4S2K A;  5E2H A;  5FQJ A;  4S2N C;  3CMZ A;  1MKI A;  4EUZ A;  3HLE A;  4DDS A;  4S2N A;  4X56 A;  4GKU A;  1K4E A;  3M6B A;  3SOI A;  3VSL A;  4MBF A;  1J9M A;  4HES A;  1W7F A;  2WZZ A;  3BEB A;  4RX3 A;  5KSH A;  3PBT A;  4WYY A;  1PW8 A;  3OZH A;  3PAG A;  4N92 A;  3OPR A;  3ZG7 B;  5F82 A;  4RVA A;  4DE2 A;  4L0L A;  5FQM A;  1CEG A;  3IH8 A;  4K0X A;  3GRJ A;  1HVB A;  1LI9 A;  4OOL A;  5L2F A;  4JLF A;  2JBF A;  4NK3 A;  2ZQD A;  1LL5 A;  3HVF A;  1MBL A;  3Q7V A;  4OVD A;  3UE1 A;  3WWX A;  3G30 A;  1KE4 A;  3GVB A;  1L0D A;  2C5W B;  3VOY A;  3WS1 A;  3NIA A;  4PM6 A;  2OV5 A;  4HEF A;  1I5Q A;  1XX2 A;  1GHI A;  3BLS A;  3PBR A;  4K91 A;  5FSR A;  5A92 A;  4IED A;  5A91 A;  2XD1 A;  5FA7 A;  5AQB A;  2GDN A;  3PTE A;  1QMF A;  4ZJ1 A;  4DXB A;  3V39 A;  4R23 A;  4WM9 A;  1LHY A;  4KQR A;  5A90 A;  3TSG A;  3RXW A;  5F1G A;  3WS0 A;  1XA7 A;  2JCH A;  1IYP A;  5DTS A;  3UPN A;  1NXY A;  2HP5 A;  4DF6 A;  3MFD A;  3A3J A;  3ZHH A;  2PBY A;  4GD6 A;  4KZ7 A;  1IYO A;  1MXO A;  4PPR A;  3FKV A;  5CED A;  1K56 D;  1GA9 A;  3NY4 A;  1PZP A;  2IWD A;  2Y2O A;  4LV0 A;  1SDE A;  4P0M A;  4K0W A;  2FFY A;  4UA9 A;  1PI4 A;  2EFX A;  3NDG A;  5CHJ A;  1FCN A;  4ZAM A;  1H8Y A;  1ES5 A;  1KDW A;  4CPK A;  3VP0 A;  3OPL A;  3BEC A;  1IKG A;  3G2Z A;  4XUZ A;  4Z9Q A;  2OLV A;  4OPQ A;  3HUN A;  4BD0 A;  3N8L A;  1S6R A;  5FAQ A;  3G4P A;  3GR2 A;  4IVK A;  5F83 A;  2G2U A;  3ZVT A;  1N9B A;  2XFT A;  3Q7V B;  3N8R A;  4YFM A;  4WEL A;  5FDH A;  5EVI C;  1AXB A;  2XD5 A;  1L0F A;  1YLZ A;  1XXM A;  4DE0 A;  5U47 A;  3D4F A;  1I2S A;  3Q07 A;  3IHA A;  1Z6F A;  2V1Z A;  5JYO A;  1E25 A;  1HTZ A;  2P74 A;  1JTD A;  4LV1 A;  1NJ4 A;  4KZB A;  4CJN A;  4WZ4 A;  5DF8 A;  4C6Y A;  1ZG6 A;  2WGV A;  2XFS A;  3QNC A;  3HLC A;  4GZB A;  3HLW A;  3SH7 A;  3ZGA B;  3SS4 A;  2BG1 A;  4Y0O A;  2A49 A;  4DE1 A;  4ZBE A;  3BFD A;  4WEJ A;  5GHY A;  4FD8 A;  4UHU A;  1TDL A;  1XPB A;  1EI5 A;  3LO7 A;  3Q81 A;  5EE8 A;  3UY6 A;  3V50 A;  4EV4 A;  5KSC A;  3N8S A;  4R4S A;  4N1H A;  3IQA A;  2Y55 A;  4OP8 A;  3VP2 A;  4PM5 A;  2WK0 A;  5HAR A;  2OSU A;  4GDN A;  4NET A;  3QNB A;  1YLY A;  5D3O A;  4ID4 A;  3VP4 A;  2EX2 A;  2XH9 A;  4R3B A;  3LCE A;  4KZ3 A;  1ERQ A;  4D2O A;  2XR0 A;  4E3M A;  1FQG A;  5E2F A;  2Y2J A;  1PZO A;  1CEF A;  2G2W A;  1LLB A;  4S2L A;  5G18 A;  2HP9 A;  3C7V A;  4LV3 A;  4XUX A;  2Y91 A;  2X01 A;  1KE3 A;  2WYX A;  3WS4 A;  2Y2N A;  1FOF A;  2ZJ9 A;  3IF5 A;  4Y7P A;  1GA0 A;  1QME A;  4IBX A;  4HBU A;  5E2E A;  1ZG4 A;  1BLS A;  5HX9 A;  1FCO A;  1KGF A;  4JXW A;  4OH0 A;  1L2S A;  4JBF A;  5CGX A;  4KZ4 A;  4MBK A;  1XGI A;  2C6W B;  1DY6 A;  3GMW A;  3ITB A;  5FQQ A;  3TG9 A;  1FR1 A;  1PWD A;  2I72 A;  3ZDJ A;  4Y0T A;  5M1A A;  4B4Z A;  1L0E A;  1SCW A;  4WZ5 C;  3JYI A;  2V20 A;  2J8Y A;  4FH2 A;  5HAP A;  3BYD A;  4WZ5 A;  3UDF A;  5EEC A;  5CER A; 
#chains in the Genus database with same CATH topology
 2WKP A;  1L3L A;  2ZY3 A;  2V0U A;  1KX4 C;  3MF0 A;  1L0G A;  2FJ7 A;  4CSR B;  3N6I A;  3DTM A;  3ZCZ A;  3EGX C;  2XSS A;  2Y2K A;  3H7W B;  2Z2L B;  3JPU A;  1MPL A;  3T50 A;  5JYP A;  5DF7 A;  4GLQ A;  2PU4 A;  2ZBB A;  1LI0 A;  3WD4 A;  5AV5 D;  5I94 A;  3IS2 A;  3R45 B;  5CXW A;  3REH C;  3IBJ A;  1O07 A;  3REK C;  1K57 C;  4HOI A;  3N4I A;  4YM6 C;  5GT3 A;  5B0Z B;  3FV7 A;  5A8B A;  1P34 A;  1BSG A;  1SDN A;  4GHL A;  2Z6C A;  3WRZ A;  4MB5 A;  2ZQ7 A;  3PBO A;  3B0C W;  4MN5 A;  3ZQ5 A;  5TR7 A;  4P85 A;  4X23 C;  4B93 A;  3V9R A;  3GTC A;  5C3I C;  3AZJ B;  3BM6 A;  5KDM B;  3B3X A;  5TGF A;  2M7V A;  5AJG A;  3CJM A;  3AZF C;  1B6W A;  3KXB C;  4Z66 A;  4GDB A;  1W5D A;  2WKH A;  3AZI D;  2HF6 A;  1KGE A;  1BH8 A;  4JPM A;  1P3O C;  3MMH A;  2K2N A;  3OCN A;  2PYR A;  3NQU B;  2BAS A;  3UE3 A;  2QHK A;  4GW9 A;  5DVA A;  2JC7 A;  3K2N A;  5GXQ B;  1M19 A;  4N9K A;  3HSH A;  3B6F B;  1GCE A;  4DXC A;  1N4O A;  3KUY C;  5EUA A;  1O6I A;  2H5S A;  3AZH A;  2NQB B;  1GXD A;  3BFF A;  4GD8 A;  3LID A;  2UV0 E;  1CI8 A;  2XEP A;  4DRT A;  4H8R A;  1K38 A;  1UGU A;  1S4S A;  2B95 A;  2WKI A;  2DNS A;  4MDZ A;  3BY8 A;  4BL3 A;  2R9W A;  2VLG A;  4MLL A;  4KG2 A;  5JRG D;  3B47 A;  3ZVW A;  1H8Z A;  1ONG A;  5KMW A;  1DP8 A;  2RCX A;  1OPX A;  2GJ3 A;  1X0O A;  2WGW A;  4GH9 A;  1BLP A;  2Y2H A;  3MGQ C;  3PHY A;  5BS7 A;  1H8M A;  3LY3 A;  4EWF A;  3AZE C;  2IWB A;  1BUE A;  4XZQ D;  4AFI A;  4YM6 D;  3HL9 A;  2DRW A;  3W97 B;  1DJC A;  3IF6 A;  1ID3 A;  3IXD A;  3REH D;  3W4P A;  3IWQ A;  3W4Q A;  2ZOI A;  3E4P A;  3MXS A;  1QO6 A;  3VP3 A;  1FR6 A;  5CP6 D;  1H5X A;  5FAT A;  5CPK B;  1YMS A;  2ZOH A;  1MWS A;  2NZD B;  1YSQ A;  1E6R A;  4MN6 A;  5FI2 A;  3HUM A;  3H0R C;  5HAQ A;  1N9L A;  3MKE A;  4NEE D;  4KUO A;  4EO5 B;  3GV9 A;  5GT0 B;  3REI D;  3MVD A;  4UQI M;  3REL A;  2PT7 A;  4XUJ A;  3REL C;  1P3B A;  3FKW A;  1P3K C;  1P3F C;  5CPJ C;  4X23 A;  3HLB A;  3WAA C;  1TF1 A;  2YKF A;  2CMN A;  1T1B A;  1P3P C;  3EQU A;  4HP9 A;  5HAI A;  5JA4 A;  3WTP A;  2W27 A;  4WMC A;  1XGJ A;  4DJ3 A;  3AZK D;  4QD4 A;  1P0Z A;  4BEN A;  3V3S A;  2WKE A;  4PM8 A;  5B2I A;  4C3Q A;  1O7E A;  2E8I A;  4IBK A;  3LEQ A;  3B6G A;  1ED7 A;  4I3J A;  5B0Z D;  1KX3 A;  1LL8 A;  2ZL1 A;  2Q9N A;  4PM9 A;  3A3F A;  5AQA A;  5BT1 C;  3UTB C;  1LT0 A;  2W1T B;  3AZI A;  2PYP A;  4HGA C;  3HRE A;  5BNV B;  4X25 A;  5AV9 D;  4J8U A;  4EES A;  4PKY A;  1PDC A;  4XT2 A;  4WF0 A;  2Y2G A;  4O7D A;  3E4Q A;  3MBZ A;  5DKK A;  3REK B;  3ZYT A;  2Z2M B;  3P01 A;  1I2W A;  2HZ5 A;  4QWO A;  5J8X A;  1BUL A;  3WRT A;  3AV2 C;  1ZLA C;  4CLC A;  4XUJ D;  1P3B D;  3IXH A;  3EG5 B;  3TOI A;  1KE0 A;  3MQ0 A;  3LEL D;  1P34 D;  3AZM D;  1GHM A;  4GNU A;  3CG5 A;  3IF6 C;  5DNN A;  4RX2 A;  4BL2 A;  3FYZ A;  4MEZ A;  5AY8 B;  1N9O A;  4KZ8 A;  4JXG A;  1YMX A;  4YS3 D;  4H6J B;  1BTL A;  1OGG A;  3EQV A;  3S1Y A;  3DWZ A;  4E3L A;  3B33 A;  2WUQ A;  2VZW A;  3DWK A;  3P98 A;  1CK3 A;  1ZHH B;  3HLF A;  4Z2M G;  4OLG A;  2FJ7 D;  3F1P B;  3QP2 A;  5DF9 A;  4DN0 A;  3LEL C;  2WKQ A;  2VGK A;  2CC1 A;  3E2K A;  3NC8 A;  3LR4 A;  5B2J D;  1RGY A;  4UUZ B;  4LCL A;  4XUJ C;  1P3B C;  1NY0 A;  3AV2 D;  4Z2L A;  3WS2 A;  4U0X A;  4E6W A;  4KQD A;  1FCM A;  5CPJ B;  5B31 A;  1NRF A;  4S2M A;  4IBC A;  4NXF A;  4BJP A;  3X1U D;  5AV8 C;  4AWL B;  4IBG A;  3C1B D;  3ZG5 A;  4Q0I A;  1AOI D;  4YM6 B;  5M18 A;  3SH9 A;  1N9N A;  4IJG A;  2PU2 A;  2VV6 A;  2A2L A;  5A93 A;  3LZ0 B;  1TZY B;  2QWS A;  2L1M A;  3KWQ A;  2V1B A;  1YLW A;  1KGG A;  2LB9 A;  3NQJ B;  2F2A C;  2H28 A;  1VM1 A;  5B0Y C;  1VB6 A;  4S2N C;  3B0D B;  3CMZ A;  3DBA A;  2O9A A;  2NZD C;  1H3O A;  4JGP A;  1KU5 A;  3REJ B;  1P3P D;  4MBF A;  1W7F A;  1PW8 A;  2ARO B;  1JFI A;  3REH A;  5HDD A;  3ZG7 B;  5F82 A;  5AV6 B;  4MN7 A;  5FQM A;  4K0X A;  3X1V B;  2F8N A;  1ZLA A;  4CLC C;  4QNL A;  3CUE A;  1FIL A;  4JLF A;  2JBF A;  2BYK A;  4MB3 A;  3REI C;  2HUE B;  4Z2K A;  4YOF A;  5J4E A;  5DNM B;  1P3K B;  3CWF A;  3UE1 A;  2JKG A;  3WWX A;  2W3H A;  1KE4 A;  1KOU A;  1L0D A;  2C5W B;  1DRM A;  3VOY A;  3MGS A;  5HWW A;  1BFM A;  2RVQ D;  4X1L A;  3BLS A;  5FSR A;  2G5I C;  5I5L A;  1XFN A;  1OGB A;  5CP6 A;  1TD5 A;  4DXB A;  4ZJ1 A;  2J3T D;  3V39 A;  3TU4 D;  3KSG A;  4H9S C;  4KQR A;  5A90 A;  5B2I C;  1XA7 A;  2JCH A;  5DTS A;  2VQR A;  5F69 A;  4DF6 A;  3S7Q A;  3A3J A;  1DP9 A;  4NE3 A;  1MXO A;  5HPI A;  4WU9 C;  4JGR A;  3FKV A;  1GA9 A;  4J8V B;  3D72 A;  3UTB A;  1PZP A;  3MNN A;  2Y2O A;  2VV7 A;  5F6A A;  5GSU B;  4K0W A;  1HLU P;  4WZS B;  1FCN A;  4WV4 B;  3EPJ A;  3HJK A;  3UB8 A;  2RIQ A;  2OLV A;  1XJ4 A;  4OPQ A;  1S1Y A;  3EPL A;  3PYP A;  5EFW A;  3AV2 A;  5FAQ A;  4H9O A;  4R38 A;  1N9B A;  4IHQ A;  3S7P A;  4EET B;  3AZM C;  5FDH A;  5BS7 C;  2PD8 A;  1P34 C;  1YLZ A;  3AZE A;  1V9Y A;  1XXM A;  5U47 A;  3L26 A;  1TZY C;  3AZG D;  3L2A A;  4HJ3 A;  1KX5 B;  3IHA A;  2V1Z A;  1E25 A;  2HIO D;  4LV1 A;  4CJN A;  1UR9 A;  4WZ4 A;  5DF8 A;  4CQH A;  2PHY A;  2XFS A;  3R4K A;  3SH7 A;  4YS3 A;  5HD3 A;  1S4R A;  1VEU A;  4ZBE A;  2L0W A;  5B32 C;  3KSI A;  4UHU A;  1XPB A;  1TDL A;  1BH9 B;  2JKF A;  3LO7 A;  4LD9 D;  5TBM B;  4E45 A;  2ARO C;  3IQA A;  3VP2 A;  1NWZ A;  2WK0 A;  4PM5 A;  5EM1 A;  3W96 C;  4NET A;  3QNB A;  4DJ2 A;  3VP4 A;  4ID4 A;  3R7W B;  3IS2 B;  3R45 A;  4IBE A;  1ERQ A;  3W99 B;  4G3V A;  3LEL A;  5E2F A;  4Q0J A;  1LLB A;  3A6N C;  2HP9 A;  4I39 A;  4XUX A;  4LV3 A;  2X01 A;  5DJU A;  3REK D;  1FOF A;  1GA0 A;  4IBX A;  3T1S A;  1S66 L;  4HBU A;  5B1L C;  3UTA A;  5JRG B;  5AV6 D;  1FCO A;  3CPT B;  4JBF A;  2C6W B;  1TAF A;  4GHI B;  4OJP A;  3GMW A;  3WAA D;  4H9S A;  1YU2 A;  4WZ5 C;  4FH2 A;  1T18 A;  2VKS A;  2B02 A;  2PAV P;  1P3L D;  2HV1 A;  1BH8 B;  2XDM A;  5GHX A;  3T4O A;  3LZ0 D;  1YPR A;  1M1A A;  3LFV A;  5GXQ C;  4OOY A;  1Q2Q A;  4ZTK A;  1OT6 A;  4FSF A;  3BWL A;  4E04 A;  4H9N B;  3C1C B;  3MGR A;  1CXW A;  5AV6 C;  1S32 A;  1ES4 A;  5B31 D;  2Y2M A;  5B40 D;  2H0Y A;  4QB8 A;  4UPK A;  4EBL A;  1K57 A;  1XJ6 A;  1NLZ A;  2KLI A;  3W98 D;  1W1V A;  2EX8 A;  3REI B;  4GS9 B;  4K08 A;  5B2J A;  3IHB A;  1A0K A;  3LIF A;  4M3K A;  1OJ5 A;  3ZG0 A;  4OJ6 A;  1XKZ A;  4DQY B;  4A5R A;  4BQM A;  5B1M A;  1OME A;  2V5O A;  3LJA A;  1YQS A;  3W96 D;  4EXO A;  4RYE A;  1KX5 C;  2CV5 D;  5IU1 A;  3AZN A;  2Y4A A;  3B42 A;  3S7O A;  3KSH A;  3AZF A;  1BYW A;  4B4X A;  3ZG8 B;  5CEB A;  4AWL C;  5GLB A;  3B0B A;  2JKT I;  1CK7 A;  5EVL A;  3PR6 A;  3KUY D;  2O99 A;  1K6R A;  2F8N K;  1CI9 A;  3ZNT A;  1P3A C;  3E0Y A;  2AVX A;  3G34 A;  4Z2I A;  3RTY A;  1K56 A;  1Y28 A;  4XZQ A;  2Y2P A;  3W96 B;  4ETX A;  4Q8I A;  1WYC A;  4GN2 A;  4EO5 C;  4JGQ A;  4X6T A;  2YFV B;  3HLG A;  1P3O D;  1LL9 A;  5DFX A;  1K55 C;  2V2F F;  2B18 A;  1P3A D;  2QJ5 A;  3B0D C;  5M19 A;  3ZNY A;  4Y17 A;  1YLP A;  2ACG A;  3RJU A;  3O62 D;  4KHA A;  2PD7 A;  3A3I A;  2W3G A;  2X71 A;  3Q1F A;  5CGS A;  1GSW A;  3OC2 A;  4OJO A;  4Y0U A;  1M18 C;  3DTE A;  3W97 D;  3VP1 A;  2FH5 A;  3WTP E;  2JE5 A;  2GZA A;  2RL3 A;  1YU3 A;  3UE6 A;  5GLC A;  5TJJ A;  5E5A C;  3M7P A;  1T1C A;  3B6G B;  5LBR A;  4QJG A;  2K31 A;  4H9P A;  1JWZ A;  3PBS A;  2EWW A;  4E3J A;  4E6X A;  4ZBJ B;  4HH2 A;  5HZH A;  2F8N H;  3UTA D;  1S0W A;  4YIN A;  3EGD C;  1P3G B;  1W1Y A;  1H0G A;  3AN2 B;  3CUE C;  5FEF A;  1P3O B;  5EV0 A;  1ES3 A;  3AYW B;  1P3L C;  3NOP C;  1WYB A;  1YKD A;  3AGF A;  1G6A A;  3FWL A;  4LLO B;  3MGS C;  2ZC4 B;  3BFG A;  3UT9 D;  3AFA C;  3P5J B;  3C7U A;  4DDY A;  4WL9 A;  3S22 A;  3B0C T;  4KUD A;  2XLN A;  1CF0 A;  4PM7 A;  2HDQ A;  4HQA A;  4QLC B;  4DKI A;  3IT9 A;  3S4X A;  3NBL A;  5AQ9 A;  3ULF A;  3HBR A;  1SHV A;  4ESP A;  4Z66 B;  1JNU A;  4BLM A;  1P3M A;  5E43 A;  4ZUX A;  4NE5 A;  1M40 A;  1KVM A;  3O87 A;  3A6N D;  2ZC3 B;  1N1J B;  1KX4 A;  3AV1 C;  4IVI A;  2YFW A;  1YT4 A;  4KZA A;  3AV1 A;  1EW0 A;  4R8P D;  1TEM A;  5GXQ A;  1NYM A;  5HW3 A;  2Y2L A;  2ARO D;  1BZA A;  2DQN C;  5G4Z A;  4PMA A;  4ARZ A;  3AZH B;  4E3K A;  3G31 A;  4L9E A;  3W8K A;  3C1C D;  3WD2 A;  2P7J A;  3CLO A;  5B32 B;  3ZG9 B;  2Y59 A;  4OLD A;  3NDE A;  1SKO B;  1ULY A;  3MXQ A;  5CEC A;  5J3W A;  3T4S A;  3PAE A;  3G35 A;  3C5A A;  3VH5 W;  3QHY A;  4IJF A;  1TZY D;  2ZY4 A;  3AZG C;  1MWU A;  4WLA A;  2WGW B;  1RGZ A;  3T12 B;  2Y2I A;  2INW A;  2ZC7 A;  4RA7 A;  3M2K A;  2IWC A;  4UQI S;  3EOI A;  1P3F B;  4UEY A;  5B33 A;  3WAA B;  1MY8 A;  3LJA C;  4WBG A;  3AN2 D;  1K54 C;  2ZQ8 A;  4OKP A;  1BLH A;  3CI6 A;  4BD1 A;  4Z66 D;  3S7N A;  5AVC A;  1JWV A;  2Z6D A;  4HIA A;  5HFO A;  5CPK A;  4KZ9 A;  3L29 A;  3A0V A;  3FPW A;  3MS6 A;  5EOO A;  5DNN D;  3LJA D;  2XF3 A;  3LUQ A;  5E2G A;  3UO9 A;  3LI9 A;  4OON A;  1E4D A;  3LZ1 B;  2PYO C;  1P3A A;  4TX8 A;  3DTI A;  4S2J A;  1ESI A;  2PRF A;  4KQO A;  4LV2 A;  3MGP B;  1J7M A;  1OTI A;  4KGC C;  1CJF A;  1H0M A;  4EER A;  4I5S A;  5F99 D;  2F8N D;  3CHW P;  3LR5 A;  2O9C A;  4E3N A;  3QP5 A;  3KUY A;  1FIK A;  3W98 B;  3IXG A;  2L4R A;  1VQQ A;  3LR0 A;  1K25 A;  5CPK D;  3UDI A;  2CV5 B;  4KZ5 A;  1P3P A;  3SW1 A;  4S2I A;  1IYQ A;  2JHE A;  3FDD A;  3MGQ A;  1M18 A;  2GNX A;  3Q82 A;  4WJ3 C;  3B6G D;  5B1M D;  5E5A B;  3P7N A;  3LZ1 D;  3WKJ D;  1PWC A;  3WKJ B;  2ZC5 B;  4FUW A;  3FG8 A;  1AOI A;  2ZC6 B;  3UPP A;  4QHC A;  1A7W A;  1ZC2 A;  4S2K A;  5E2H A;  5FQJ A;  1MKI A;  3HLE A;  3MNN B;  4GKU A;  3M6B A;  3SOI A;  1S32 C;  3X1U A;  3BJN A;  4Y5F A;  4HES A;  4RX3 A;  1S32 D;  4XT2 B;  3OZH A;  1W2E A;  1OTE A;  5G49 B;  4KUK A;  3REK A;  1NLY A;  4L0L A;  1CEG A;  3UT9 C;  3GRJ A;  2YKH A;  1LI9 A;  4HP4 A;  4WNN B;  3REL D;  3BQA A;  4LG2 A;  5B1M C;  3X1T D;  3AZM B;  3A6N A;  4H9R A;  1T3U A;  4J8X D;  1P3M D;  3TU4 B;  3W99 D;  3AFA A;  3WS1 A;  3NIA A;  3IX3 A;  2JKR I;  5AY8 A;  1KX5 A;  3UB9 A;  4WN5 A;  5BO0 A;  1U35 B;  1I5Q A;  5B24 A;  4IED A;  5AV8 B;  4LD9 B;  1F98 A;  5AQB A;  3WTP C;  4EU0 A;  4YS3 B;  2GDN A;  1QMF A;  3PTE A;  5AV9 B;  3UB5 P;  3WS0 A;  3QP1 A;  3EEA A;  5IS1 A;  3ZHH A;  1PFL A;  4Z2H A;  1WWS A;  4KZ7 A;  3AZL D;  4NKP A;  1W1T A;  4PPR A;  1P9R A;  5B0Y B;  4KGC A;  2V8C A;  1SDE A;  4EUV A;  3NJA A;  2EFX A;  5CHJ A;  3GDI A;  1H8Y A;  5B31 B;  1P3I C;  3O62 C;  2V8F A;  3BEC A;  4Z9Q A;  5AVC D;  1P3G C;  2A24 A;  3AN2 C;  1S6R A;  1NRJ A;  2ZMF A;  3NHQ A;  5F83 A;  2XFT A;  4BBT A;  2HUE C;  4YFM A;  4MB4 A;  4LRX C;  3VOL A;  5EVI C;  1L0F A;  1MKM A;  1I2S A;  2M1C A;  1B67 A;  2V1A A;  3V9R B;  1HTZ A;  2P74 A;  1JTD A;  1NJ4 A;  2G7U A;  4NYU A;  2BYM B;  2W8S A;  2L5A A;  5KDM A;  4C6Y A;  3VH6 A;  3HLC A;  4GZB A;  3HLW A;  4ETZ A;  1H3O B;  3ZGA B;  3KSF A;  2A49 A;  3H7W A;  5CHL B;  1H0I A;  2VGL S;  3V50 A;  2PR6 A;  3C1C A;  1SZV A;  3B6F D;  4X23 D;  3WD1 A;  4R6L A;  5HAR A;  5D3O A;  2XH9 A;  1HQ3 D;  4EW7 A;  3LCE A;  3AV1 D;  1FQG A;  3WA9 A;  5IT5 A;  4Z1W A;  2Y2J A;  3REI A;  1PZO A;  3U4L P;  4NZ3 A;  5GT3 B;  2PDR A;  2Y91 A;  1KE3 A;  2WYX A;  5AV5 A;  2Y2N A;  3W98 C;  2ZJ9 A;  4Y7P A;  2NQB A;  1QME A;  4NG2 A;  1ZTU A;  5E2E A;  4OH0 A;  3L7H A;  1L2S A;  2W0N A;  5CGX A;  4KZ4 A;  1P97 A;  1Z2C B;  1V9Z A;  5CP6 B;  1FR1 A;  1PWD A;  5B32 G;  5M1A A;  4B4Z A;  3F6T A;  1SCW A;  5HAP A;  3MGS D;  3BYD A;  3LIE A;  5EEC A;  4OPZ A;  1E6Z A;  5HL1 A;  2HDU A;  3KWQ C;  1F9I A;  3C30 A;  2P08 A;  3NQU A;  3LYX A;  5IHV A;  5KIZ A;  2LY8 A;  1G6O A;  5B40 A;  2XGN A;  3B6F A;  1WWI A;  4S2P A;  3LIB A;  4GB7 A;  5J7E A;  3VH6 W;  2NZD A;  5CPI A;  1P3I A;  2Y79 A;  3O5Y A;  3C4P A;  3G2Y A;  1J3W A;  3GSG A;  5CPI C;  5B1L D;  3O62 B;  2ZLY A;  1C3B A;  3FC7 A;  4JJN D;  3AZH D;  4LFU A;  4UA7 A;  3MKF A;  3M6H A;  2PYO B;  2HDR A;  3KX0 X;  5F1F A;  1P3L A;  4LGW A;  1DJA A;  2K7S A;  3REL B;  5EVI A;  3MGQ D;  3C38 A;  5FI6 A;  1RP5 A;  1W79 A;  1DJB A;  3AZK B;  1ALQ A;  1K54 A;  2P9V A;  3W97 A;  4LRZ E;  5B33 C;  4B88 A;  5B1L B;  2HDS A;  3AZN C;  4LD9 C;  4PKY G;  5JRG C;  1T1A A;  4LEN A;  4R1G A;  5L07 A;  5B24 C;  1KDS A;  1WE4 A;  3VFF A;  3C1B A;  1UR8 A;  4H9P B;  4N1X A;  1VEU B;  4F94 A;  3A3E A;  2ZQC A;  3MQL A;  5TBM A;  5F99 A;  3MGP D;  3UDX A;  4HMD A;  3SS3 A;  1XFQ A;  3TRC A;  4FH4 A;  2JSS A;  1D06 A;  4CAY A;  2XQZ A;  3LIC A;  3JVU A;  3C8C A;  4EBN A;  4WU9 A;  2JKR M;  3AYW C;  1JTG A;  3AYW A;  3H9W A;  3VE4 A;  1PI5 A;  3F1O B;  2PBD P;  3MVD B;  1K4F A;  1MWR A;  4XUJ B;  1P3B B;  1IYS A;  4HMC A;  4OPR A;  4QLC D;  4MCW A;  3IWO A;  1E3U D;  2EXA A;  2EWV A;  4G3W A;  2HIO B;  3UT9 B;  5B33 D;  4QLC A;  5FQ9 A;  5B0Z A;  1GHP A;  5HDC A;  1R4V A;  3OPP A;  1OJG A;  2A3U A;  5G4Y A;  2BTF P;  3Q7Z A;  3AZL C;  5DTT A;  1D1J A;  1EWZ A;  3VFH A;  4ZDX A;  1JWP A;  4U3T A;  1BLC A;  1OTD A;  1SKF A;  2D02 A;  3KYQ A;  1ID3 C;  2FJ7 B;  3AZJ A;  4H9Q B;  1KX4 B;  4GOG A;  1BT5 A;  3UME A;  3UE0 A;  5B40 C;  4U0T A;  4II7 A;  4MMN A;  4WEK A;  4EQ1 A;  5CPI D;  1EQZ C;  4Z2M H;  1TS0 A;  1YLJ A;  3E98 A;  2WAE A;  5CGW A;  1UWN X;  2EX6 A;  3BFE A;  4J8U D;  2X02 A;  1LSX A;  3W2Z A;  4Q0H A;  4QY6 A;  1G5U A;  4GS9 A;  1IEL A;  1KX4 D;  3RFB A;  5GT3 C;  3VMA A;  2IOU A;  3LY4 A;  2GX5 A;  2ZMV A;  4IBF A;  3V67 A;  2NUT C;  4IJE A;  5EM0 A;  4MNR A;  2VEA A;  1T19 A;  3IXB A;  1F66 B;  2R9X A;  3IH9 A;  5B33 B;  3WAA A;  3MQO A;  3T4J A;  5C3I B;  3D9Y A;  3N7W A;  1RCJ A;  3T1Q B;  5BOH A;  4S2O A;  2NZD D;  1G68 A;  1Q2P A;  3KO6 A;  2KX6 A;  5B0Y D;  5FDS A;  3KSY A;  3BLM A;  3NOU C;  4UAA A;  3M2J A;  4HBT A;  4KQQ A;  3LZ1 C;  3MJQ A;  2J9P A;  3V5M A;  1KX3 C;  3B6G C;  1PIO A;  1HQ3 C;  2ZQ9 A;  3MGP A;  1M1A C;  4D60 A;  3B6F C;  1CQA A;  3IBR A;  1FSY A;  4Z5T C;  3KS4 A;  4HJ6 A;  4EQI A;  4YWZ A;  2ZQA A;  3REH B;  1F66 D;  3QP6 A;  2E8J A;  4X68 A;  3HLD A;  4P6Z M;  2HIO C;  3ISG A;  3W4O A;  4IUK A;  4RQ9 A;  2J3W A;  2FFF B;  5B2J C;  3X1T B;  3E4O A;  4GJ4 A;  4X69 A;  5F68 A;  4F3L A;  1OTB A;  2EFU A;  5EVI D;  1E88 A;  4YM6 A;  3MGQ B;  4JXS A;  4J8W C;  4G91 C;  4WU8 A;  4X23 B;  5EOE A;  4OPY A;  3G32 A;  5GLD A;  4OJL A;  1TZY A;  3KYZ A;  1ID3 B;  2EXB A;  5CRF A;  5GLA A;  3KXB B;  5CHU A;  1OT9 A;  1P3I D;  3PBQ A;  2Y2Q A;  1YLT A;  4Z66 C;  1G28 A;  5EPH A;  2IO5 C;  5B2I B;  5B31 G;  1IEM A;  2WAF A;  1NYY A;  5CHM A;  4E3O A;  2ARO A;  2DCF A;  2W3D A;  1P3O A;  5DTK A;  5DFY A;  3WS5 A;  1M19 D;  4WU8 D;  2ZM0 A;  2ZY5 A;  1K6S A;  4JKT A;  3UN7 A;  2QZ6 A;  5CTN A;  3O86 A;  5L8M A;  4FTX A;  5BNV A;  5FUG B;  4ZUX D;  4HME A;  4B9O A;  4FCF A;  1P3K A;  5GSU A;  3TU4 C;  3TU4 A;  3L27 A;  1XA1 A;  1F66 C;  5AQ7 A;  3RH8 B;  1S67 L;  5GHZ A;  1E3U A;  1U35 C;  4E44 A;  1TS7 A;  4OP5 A;  4KG6 A;  4X55 A;  2ZY2 A;  2ZD8 A;  5AY8 D;  3O88 A;  2RVQ C;  3WTP B;  5JA4 B;  2QPN A;  2IA2 A;  3GQZ A;  4O0P A;  4IUH A;  2J9O A;  2WZX A;  5BPV A;  1P3M C;  3BRM A;  3WD0 A;  5B0Z C;  2HJE A;  3VV4 A;  3QP8 A;  3LR3 A;  3P09 A;  4LPZ A;  3WX7 A;  3PBN A;  2F8N G;  5K5B A;  3SS5 A;  3BFC A;  4FOF A;  2ZM8 A;  2EX9 A;  4CLC D;  1KX3 B;  2W1R A;  3F1N A;  3AZJ C;  2W1T A;  3AZI B;  5B0Y A;  1GSX A;  4EUZ A;  4J8V A;  4ARZ B;  1LSW A;  4Y2F A;  3VSL A;  4J8U B;  4NYY A;  1PZR A;  3EPH A;  3BEB A;  3T1R A;  3JVV A;  3PBT A;  4WYY A;  1HTA A;  3PAG A;  4RVA A;  2HJ9 C;  4DE2 A;  3AZJ D;  5CPJ D;  5HWT A;  3F1P A;  4ZRR A;  3W99 A;  2W3E A;  5DJT A;  3AV2 B;  1Y4O A;  5HDS A;  2DMW A;  1H8P A;  1MBL A;  3WD3 A;  5L09 A;  4JJN B;  1AWI A;  3GEC A;  3GVB A;  1S1Z A;  4G92 C;  5CPJ A;  4NZ1 A;  2LB5 A;  3VH5 A;  1W63 M;  5AY8 C;  3UTA C;  1XX2 A;  3MFX A;  1GHI A;  4K91 A;  5A92 A;  5FA7 A;  2Y8H A;  4HNB A;  4WM9 A;  5F99 C;  4OJ5 A;  4R8P B;  1LHY A;  3TSG A;  5AVB A;  3RXW A;  1BH9 A;  5F1G A;  3AL0 C;  4KGC D;  1IYP A;  4IBD A;  5E5A D;  5AVE A;  1K0K A;  3MFD A;  3NOT C;  4XZQ C;  2PBY A;  2J80 A;  3A1I A;  1IYO A;  1M19 C;  3HJI A;  1YU0 A;  2FJ7 C;  5CED A;  1K56 D;  3EPK A;  1M1A B;  4IBI A;  3NY4 A;  3VH6 T;  1M18 D;  4LV0 A;  3REJ A;  4P0M A;  3MNN C;  2FFY A;  5BNX A;  1PI4 A;  5AV5 B;  3NDG A;  3MGR B;  1ES5 A;  3VP0 A;  1KS0 A;  1IKG A;  4XUZ A;  2QJ7 A;  3X1V A;  2F8N B;  3KYE A;  4QLC C;  3K3C A;  1ZLA B;  2VA0 A;  3N8L A;  1TAF B;  3GR2 A;  1ACF A;  3AZG A;  2W3F A;  3ZVT A;  4NXE A;  3Q7V B;  5DNM A;  2OWH A;  5GT0 C;  3AYW D;  1AXB A;  2XD5 A;  4M6B A;  3EEH A;  3D4F A;  1Z6F A;  2VGL M;  4GCZ A;  5JYO A;  3NEC A;  5AVB D;  1H3Q A;  1EQZ A;  2V0W A;  2MJ6 A;  1ZG6 A;  3QNC A;  3KXB D;  4G3K A;  1WA9 A;  5DKL A;  2J8P A;  2WKR A;  1TS6 A;  2XA7 M;  3SS4 A;  4EEP A;  3BFD A;  3IX8 A;  4WEJ A;  4Z5T D;  5AV9 C;  5EE8 A;  3UY6 A;  3Q81 A;  1JFI B;  4BBU A;  2FN2 A;  4R4S A;  5G49 A;  4N1H A;  3UTB D;  4OP8 A;  5BT1 D;  2OSU A;  5F5Y A;  1IFQ A;  1P9W A;  2EX2 A;  4D2O A;  4E3M A;  2XR0 A;  1KX3 D;  2EA9 A;  5FL3 A;  1EAK A;  5CX7 A;  3WS4 A;  3X1S A;  3IF5 A;  1E6N A;  3EWK A;  4JJN C;  3AZK C;  3X1S C;  3L9K A;  3MGS B;  4Z5T B;  1Z09 A;  3LJA B;  5B31 C;  1ZG4 A;  5HX9 A;  4JXW A;  5B1L A;  5B24 B;  4MBK A;  3L25 A;  1DY6 A;  1PNE A;  4HH3 A;  3BY9 A;  5FQQ A;  3TG9 A;  1LSV A;  4J8V D;  2I72 A;  4Y0T A;  3CAX A;  1L0E A;  1VET B;  4Y3I A;  3LZ0 C;  5F99 B;  4WZ5 A;  3UDF A;  3WA9 D;  1L6J A;  5MC7 A;  3AZL A;  3CZD A;  1HQ3 A;  4DE3 A;  5GT3 D;  4O01 A;  3DW0 A;  4R3J A;  1YUE A;  2WAD A;  5AVF A;  4CAY B;  1ERM A;  3IF6 B;  5L10 A;  3MXR A;  3LGO A;  1PYY A;  3HUO A;  2XRO A;  4NXB A;  4J8V C;  3T1X A;  4J8U C;  3ZFZ A;  4ZBJ C;  3F1O A;  1PW1 A;  2I9V A;  3SZT A;  4DRA A;  4E3I A;  3VOZ A;  3MGR C;  2IO5 B;  4KEN B;  3RXX A;  5HL6 A;  1P3G A;  4IBR A;  2J7V A;  4KHA B;  3X1S D;  3AN2 A;  2A24 B;  4J8X B;  2NQB D;  3C4O A;  4R70 A;  4H9O B;  3IP4 C;  2P04 A;  1ID3 D;  1IKI A;  4J8W A;  5HD5 A;  2NUP C;  3AZE D;  1MZU A;  2KOI A;  3AZE B;  4GHA A;  4P6B A;  4QY5 A;  4OQI A;  4YNR A;  3W97 C;  2B5R A;  3NUL A;  3UTA B;  2ZMA A;  3MZD A;  3H82 B;  1MC0 A;  3CPT A;  3NI9 A;  3UB7 A;  4OUI A;  3BQ8 A;  3OLO A;  1XJ3 A;  4ZJ3 A;  4HY8 A;  5AVB C;  2XRN A;  3OBF A;  1P3M B;  1Y54 A;  2JN7 A;  3DTK A;  3V3R A;  1U60 A;  1HD8 A;  4NZ5 A;  3FZC A;  3R7W A;  4CSR A;  5DNM D;  5HWV A;  5GT0 D;  5FAP A;  5FAS A;  2ZL1 B;  3AZI C;  3D3O A;  3MGP C;  3TJZ C;  1W8Q A;  3X1V D;  3IWI A;  1E8B A;  1P3G D;  4BBV A;  3REJ C;  2KDK A;  2JKT M;  2OLU A;  3AZF D;  4KUD B;  4GHI A;  2CV5 C;  1XP4 A;  3FPV A;  4JF5 A;  4CLC B;  1OTA A;  2Q9M A;  1P34 B;  4I3I A;  4P6Z S;  3MSH A;  4WU9 D;  4UA6 A;  4IBB A;  4R4R A;  5DNN B;  3AZN B;  3PXP A;  3K3D A;  4OQG A;  3UNW A;  5FI7 A;  3MGR D;  4H6J A;  2UWX A;  4H9N A;  3MQQ A;  3MZF A;  1P3I B;  3C2W A;  4ME4 A;  1S32 B;  2VK3 A;  1PWG A;  1STZ A;  5B32 A;  1W8Y A;  3W99 C;  4J8X C;  2D01 A;  2PYO A;  4EEU A;  2G5H C;  4NXG A;  4Z2G A;  3KWQ D;  3I7J A;  5B2J B;  3X1T C;  1M19 B;  4LRY C;  5EVE A;  3X1T A;  3TW8 A;  5EVI B;  3WA9 C;  3H0L C;  4G91 B;  3LI8 A;  3L28 A;  1F5M A;  4OOM A;  5B1M B;  1UWP X;  2QYB A;  3A0S A;  3AZK A;  2XK1 A;  5GSU C;  4M4X A;  4XXR A;  5CTM A;  4C75 A;  1GOI A;  2P9V B;  3W98 A;  2HGV A;  2D49 A;  1TVF A;  2VGJ A;  4P87 A;  3C1B B;  3T4K A;  3TE8 A;  3KXB A;  4WUJ A;  1HZO A;  5C5K A;  4EBP A;  3A3D A;  3AGE A;  1DP6 A;  4HHD A;  3HON A;  1MWT A;  3MVD D;  3LZ0 A;  3WKJ C;  1KVL A;  3AGD A;  2FZ0 A;  3WKJ A;  2YFV A;  3LZ1 A;  4DMZ A;  2V9A A;  4PHT A;  1AOI C;  4JXV A;  2ZM5 A;  2QMI A;  4X53 A;  1E6P A;  5FUG A;  1ESU A;  2HP6 A;  5B32 D;  5GL9 A;  3LEZ A;  3X1U C;  4NY2 A;  5KZH A;  2H0T A;  5FEG A;  3CIT A;  2H10 A;  3BW6 A;  3VSK A;  5AV6 A;  2HIO A;  1F1E A;  1YU1 A;  3UT9 A;  3KFU G;  2PR5 A;  4L9F A;  5GT0 A;  5FQI A;  2BYK B;  1F2K A;  1ONH A;  1E15 A;  1NZU A;  3A6N B;  4WU8 C;  3SH8 A;  1ZKJ A;  5E5A A;  3ITA A;  3HCY A;  4H9Q A;  3FKE A;  3DAV A;  5DNN C;  4OQ0 A;  1M6K A;  5AVC C;  3MZE A;  4NE6 A;  3T4L A;  4YS3 C;  3N3F A;  2ZM2 A;  2WGI A;  4ZJ2 A;  4ZUX B;  1ES2 A;  3MNN D;  2VX8 A;  4Z2J A;  2YFW B;  1TDG A;  5HSQ A;  4J8W D;  1YSP A;  5FAO A;  4JF4 A;  4WNN A;  3MR0 A;  4BMW A;  3UB6 A;  2BLS A;  4LCM A;  4BWI A;  2OAP 1;  5TFQ A;  3UTB B;  4R0Q A;  5HPF A;  3OOV A;  5B2I D;  1FSW A;  1K55 A;  1F66 A;  2J3T C;  1YM1 A;  1TS8 A;  3AFA B;  3WTP D;  3O3V A;  4QU3 A;  4WMC D;  4KUD D;  4JF6 A;  4I3A A;  1NZO A;  3ICY A;  2VJW A;  4MBH A;  3VE3 A;  5AV8 A;  3E2L A;  3KS8 A;  2VV8 A;  4N9L A;  3OCL A;  3OPH A;  4NFT A;  2HPB A;  1D7E A;  4KG5 A;  4R8P C;  3UPO A;  4R8P A;  1ERO A;  4IBJ A;  1N1J A;  1JVJ A;  4KZ6 A;  4OQH A;  3NCK A;  2OAQ 1;  3AV1 B;  5FQK A;  2BYM A;  1ODV A;  4DDS A;  4S2N A;  4X56 A;  4Y13 A;  1K4E A;  2O0Y A;  1J9M A;  5BNX B;  2WZZ A;  4PAU A;  5KSH A;  4N92 A;  1SKO A;  3OPR A;  3AFA D;  1IOU A;  1P3A B;  3IH8 A;  1Q9C A;  5GSU D;  4X1M A;  1P3K D;  1HVB A;  4OOL A;  2XA7 S;  5L2F A;  3WA9 B;  3LEL B;  4NK3 A;  4UUZ A;  2ZQD A;  3AZG B;  1LL5 A;  4F3L B;  1YU4 A;  3HVF A;  3Q7V A;  4OVD A;  2CWE A;  2OWJ A;  3G30 A;  4WU8 B;  3G6O A;  1P3F A;  4PM6 A;  3C1B C;  2OV5 A;  4HEF A;  5AV8 D;  5JRG A;  3PBR A;  4O8G A;  1U35 D;  1EQZ B;  5AVC B;  5A91 A;  2XD1 A;  5CPK C;  3T4T A;  5CP6 C;  4KUD C;  1EQZ D;  2DF4 C;  4L9G A;  3LIA A;  3QP4 A;  1M18 B;  4R23 A;  4ZUX C;  3UPN A;  1NXY A;  2HP5 A;  3KWQ B;  4GD6 A;  1AOI B;  3NQJ A;  3UMD A;  2PYO D;  2M7U A;  1XJ2 A;  3H0M C;  2IWD A;  4R3A A;  3X1U B;  2R78 A;  4UA9 A;  3X1S B;  3KUY B;  2RTS A;  4ZAM A;  5CPI B;  1KDW A;  3IX4 A;  4CPK A;  4Z5T A;  3OPL A;  3O62 A;  2CV5 A;  3G2Z A;  4DRB A;  3REJ D;  1P3P B;  4QPR A;  3X1V C;  3HUN A;  4Y15 A;  4BD0 A;  3U2A A;  3G4P A;  4IVK A;  2G2U A;  4I38 A;  3AZM A;  1P3L B;  4H9R B;  3N8R A;  1GSV A;  4WEL A;  5DNM C;  1VET A;  4DE0 A;  1VHM A;  1W63 Q;  4G92 B;  3AZL B;  1HQ3 B;  3Q07 A;  1ZLA D;  4NZ4 A;  3F1N B;  4KZB A;  4LD9 A;  4HI4 A;  4HGA B;  2WGV A;  3AZF B;  1AIW A;  5B40 B;  2OOL A;  2BG1 A;  4Y0O A;  4DE1 A;  5AV9 A;  3C1C C;  5B24 D;  4FD8 A;  5GHY A;  1EI5 A;  3AZN D;  4EV4 A;  1M1A D;  5KSC A;  1KX5 D;  3N8S A;  2Y55 A;  4HJ4 A;  4GDN A;  1YLY A;  2QKP A;  3W96 A;  4XZQ B;  4R3B A;  4J8X A;  4KZ3 A;  4WU9 B;  4KGC B;  1W1P A;  1CEF A;  2G2W A;  3MVD C;  4S2L A;  5G18 A;  4J8W B;  3C7V A;  4JJN A;  2O9B A;  2NQB C;  3AZH C;  5AV5 C;  5BO0 B;  1BLS A;  1U35 A;  3H82 A;  1KGF A;  3T4Q A;  1XGI A;  1YAX A;  3VH5 T;  4JGO A;  3ITB A;  1GPF A;  4CLC E;  3ZDJ A;  1P3F D;  5GXQ D;  3JYI A;  2V20 A;  5AVB B;  2J8Y A;  3A0R A;  1PRQ A;  3A1K A;  2Q0O A;  5CER A; 
#chains in the Genus database with same CATH homology
 2ZY3 A;  1KX4 C;  1L0G A;  2FJ7 A;  4CSR B;  3N6I A;  3DTM A;  3ZCZ A;  2Y2K A;  2Z2L B;  1MPL A;  5JYP A;  5DF7 A;  2PU4 A;  1LI0 A;  5AV5 D;  5I94 A;  3R45 B;  5CXW A;  3REH C;  1O07 A;  3REK C;  1K57 C;  3N4I A;  4YM6 C;  5GT3 A;  5B0Z B;  3FV7 A;  1P34 A;  1BSG A;  1SDN A;  4GHL A;  3WRZ A;  2ZQ7 A;  3PBO A;  3B0C W;  5TR7 A;  4P85 A;  4X23 C;  3V9R A;  3GTC A;  5C3I C;  3AZJ B;  3BM6 A;  5KDM B;  3B3X A;  5TGF A;  3CJM A;  3AZF C;  1B6W A;  3KXB C;  4Z66 A;  4GDB A;  1W5D A;  2WKH A;  3AZI D;  1KGE A;  1BH8 A;  4JPM A;  1P3O C;  3OCN A;  3NQU B;  3UE3 A;  5DVA A;  2JC7 A;  5GXQ B;  1M19 A;  4N9K A;  3HSH A;  3B6F B;  1GCE A;  4DXC A;  1N4O A;  3KUY C;  5EUA A;  2H5S A;  3AZH A;  2NQB B;  3BFF A;  4GD8 A;  1CI8 A;  2XEP A;  4DRT A;  4H8R A;  1K38 A;  2WKI A;  2DNS A;  4BL3 A;  2R9W A;  4MLL A;  4KG2 A;  5JRG D;  3ZVW A;  1H8Z A;  1ONG A;  5KMW A;  2RCX A;  2WGW A;  4GH9 A;  1BLP A;  2Y2H A;  3MGQ C;  5BS7 A;  3LY3 A;  4EWF A;  3AZE C;  2IWB A;  1BUE A;  4XZQ D;  4YM6 D;  3HL9 A;  2DRW A;  3W97 B;  1DJC A;  3IF6 A;  1ID3 A;  3IXD A;  3REH D;  3W4P A;  3IWQ A;  3W4Q A;  3MXS A;  3VP3 A;  1FR6 A;  5CP6 D;  1H5X A;  5FAT A;  5CPK B;  1YMS A;  1MWS A;  2NZD B;  5FI2 A;  3HUM A;  3H0R C;  5HAQ A;  3MKE A;  4EO5 B;  3GV9 A;  5GT0 B;  3REI D;  3MVD A;  3REL A;  4XUJ A;  3REL C;  1P3B A;  3FKW A;  1P3K C;  1P3F C;  5CPJ C;  4X23 A;  3HLB A;  3WAA C;  1P3P C;  3EQU A;  5HAI A;  5JA4 A;  3WTP A;  4WMC A;  1XGJ A;  3AZK D;  4QD4 A;  4BEN A;  3V3S A;  2WKE A;  4PM8 A;  5B2I A;  4C3Q A;  1O7E A;  2E8I A;  4IBK A;  3B6G A;  5B0Z D;  1KX3 A;  2Q9N A;  4PM9 A;  3A3F A;  5AQA A;  5BT1 C;  3UTB C;  3AZI A;  4HGA C;  3HRE A;  5BNV B;  5AV9 D;  4J8U A;  2Y2G A;  4O7D A;  3MBZ A;  3REK B;  2Z2M B;  1I2W A;  5J8X A;  1BUL A;  3WRT A;  3AV2 C;  1ZLA C;  4XUJ D;  1P3B D;  3IXH A;  3EG5 B;  3TOI A;  1KE0 A;  3LEL D;  1P34 D;  3AZM D;  1GHM A;  4GNU A;  3CG5 A;  3IF6 C;  5DNN A;  4RX2 A;  4BL2 A;  3FYZ A;  4MEZ A;  5AY8 B;  4KZ8 A;  4JXG A;  1YMX A;  4YS3 D;  1BTL A;  3EQV A;  3S1Y A;  3DWZ A;  4E3L A;  2WUQ A;  3DWK A;  3P98 A;  1CK3 A;  3HLF A;  4Z2M G;  4OLG A;  2FJ7 D;  5DF9 A;  3LEL C;  2VGK A;  2CC1 A;  4LCL A;  3E2K A;  3NC8 A;  5B2J D;  4UUZ B;  1RGY A;  4XUJ C;  1P3B C;  1NY0 A;  3AV2 D;  3WS2 A;  4U0X A;  4E6W A;  1FCM A;  5CPJ B;  5B31 A;  1NRF A;  4S2M A;  4IBC A;  4BJP A;  3X1U D;  5AV8 C;  4AWL B;  4IBG A;  3C1B D;  3ZG5 A;  1AOI D;  4YM6 B;  5M18 A;  3SH9 A;  2PU2 A;  5A93 A;  3LZ0 B;  1TZY B;  3KWQ A;  1YLW A;  1KGG A;  3NQJ B;  2F2A C;  1VM1 A;  5B0Y C;  4S2N C;  3B0D B;  3CMZ A;  2NZD C;  1H3O A;  1KU5 A;  3REJ B;  4MBF A;  1P3P D;  1W7F A;  1PW8 A;  2ARO B;  1JFI A;  3REH A;  3ZG7 B;  5F82 A;  5AV6 B;  5FQM A;  4K0X A;  3X1V B;  2F8N A;  1ZLA A;  4QNL A;  4JLF A;  2JBF A;  2BYK A;  3REI C;  2HUE B;  5DNM B;  1P3K B;  3UE1 A;  3WWX A;  1KE4 A;  1L0D A;  2C5W B;  3VOY A;  3MGS A;  1BFM A;  2RVQ D;  3BLS A;  5FSR A;  2G5I C;  5CP6 A;  4DXB A;  4ZJ1 A;  3V39 A;  3TU4 D;  4H9S C;  4KQR A;  5A90 A;  5B2I C;  1XA7 A;  2JCH A;  5DTS A;  2VQR A;  4DF6 A;  3A3J A;  4NE3 A;  1MXO A;  4WU9 C;  3FKV A;  1GA9 A;  4J8V B;  3UTB A;  1PZP A;  3MNN A;  2Y2O A;  5GSU B;  4K0W A;  4WZS B;  1FCN A;  4WV4 B;  3EPJ A;  2RIQ A;  2OLV A;  4OPQ A;  3EPL A;  3AV2 A;  5FAQ A;  4H9O A;  1N9B A;  3AZM C;  5FDH A;  5BS7 C;  1P34 C;  1YLZ A;  3AZE A;  1XXM A;  5U47 A;  3L26 A;  1TZY C;  3AZG D;  3L2A A;  1KX5 B;  3IHA A;  2V1Z A;  1E25 A;  2HIO D;  4LV1 A;  4CJN A;  4WZ4 A;  5DF8 A;  2XFS A;  3SH7 A;  4YS3 A;  4ZBE A;  5B32 C;  4UHU A;  1TDL A;  1XPB A;  1BH9 B;  3LO7 A;  4LD9 D;  4E45 A;  2ARO C;  3IQA A;  3VP2 A;  4PM5 A;  2WK0 A;  3W96 C;  4NET A;  3QNB A;  3VP4 A;  4ID4 A;  3R45 A;  4IBE A;  1ERQ A;  3W99 B;  3LEL A;  5E2F A;  1LLB A;  3A6N C;  2HP9 A;  4XUX A;  4LV3 A;  2X01 A;  3REK D;  1FOF A;  1GA0 A;  4IBX A;  4HBU A;  5B1L C;  3UTA A;  5JRG B;  5AV6 D;  1FCO A;  4JBF A;  2C6W B;  1TAF A;  4OJP A;  3GMW A;  3WAA D;  4H9S A;  1YU2 A;  4WZ5 C;  4FH2 A;  1P3L D;  1BH8 B;  2XDM A;  5GHX A;  3LZ0 D;  1M1A A;  5GXQ C;  4OOY A;  1Q2Q A;  4ZTK A;  4FSF A;  4H9N B;  3C1C B;  3MGR A;  5AV6 C;  1S32 A;  1ES4 A;  5B31 D;  2Y2M A;  5B40 D;  2H0Y A;  4QB8 A;  4UPK A;  4EBL A;  1K57 A;  3W98 D;  2EX8 A;  3REI B;  5B2J A;  3IHB A;  4M3K A;  3ZG0 A;  4OJ6 A;  1XKZ A;  4DQY B;  4A5R A;  4BQM A;  5B1M A;  1OME A;  3LJA A;  1YQS A;  3W96 D;  4RYE A;  1KX5 C;  2CV5 D;  3AZN A;  2Y4A A;  3AZF A;  4B4X A;  5CEB A;  3ZG8 B;  4AWL C;  5GLB A;  3B0B A;  5EVL A;  3KUY D;  1K6R A;  2F8N K;  1CI9 A;  3ZNT A;  1P3A C;  3G34 A;  1K56 A;  4XZQ A;  2Y2P A;  3W96 B;  4Q8I A;  1WYC A;  4GN2 A;  4EO5 C;  4X6T A;  2YFV B;  3HLG A;  1P3O D;  1LL9 A;  1K55 C;  2V2F F;  1P3A D;  3B0D C;  5M19 A;  3ZNY A;  1YLP A;  3RJU A;  3O62 D;  4KHA A;  3A3I A;  2X71 A;  3Q1F A;  5CGS A;  3OC2 A;  4OJO A;  4Y0U A;  1M18 C;  3W97 D;  3VP1 A;  3WTP E;  2JE5 A;  2RL3 A;  1YU3 A;  5GLC A;  5E5A C;  3B6G B;  4QJG A;  4H9P A;  1JWZ A;  3PBS A;  4E3J A;  4E6X A;  4ZBJ B;  2F8N H;  3UTA D;  1S0W A;  4YIN A;  1P3G B;  3AN2 B;  1P3O B;  1ES3 A;  3AYW B;  1P3L C;  1WYB A;  3AGF A;  1G6A A;  3FWL A;  3MGS C;  2ZC4 B;  3BFG A;  3UT9 D;  3AFA C;  3P5J B;  3C7U A;  4DDY A;  3S22 A;  3B0C T;  4KUD A;  2XLN A;  4PM7 A;  2HDQ A;  4QLC B;  4DKI A;  3IT9 A;  3S4X A;  3NBL A;  5AQ9 A;  3HBR A;  1SHV A;  4Z66 B;  4BLM A;  1P3M A;  5E43 A;  4ZUX A;  4NE5 A;  1M40 A;  1KVM A;  3O87 A;  3A6N D;  2ZC3 B;  1N1J B;  1KX4 A;  3AV1 C;  4IVI A;  2YFW A;  1YT4 A;  4KZA A;  3AV1 A;  4R8P D;  1TEM A;  5GXQ A;  1NYM A;  5HW3 A;  2Y2L A;  2ARO D;  1BZA A;  2DQN C;  4PMA A;  3AZH B;  4E3K A;  3G31 A;  3W8K A;  3C1C D;  5B32 B;  3ZG9 B;  2Y59 A;  4OLD A;  3NDE A;  1ULY A;  5CEC A;  3PAE A;  3G35 A;  3C5A A;  3VH5 W;  3QHY A;  4IJF A;  1TZY D;  2ZY4 A;  3AZG C;  1MWU A;  2WGW B;  1RGZ A;  2Y2I A;  2ZC7 A;  4RA7 A;  3M2K A;  2IWC A;  1P3F B;  5B33 A;  3WAA B;  1MY8 A;  3LJA C;  4WBG A;  3AN2 D;  1K54 C;  2ZQ8 A;  4OKP A;  1BLH A;  4BD1 A;  4Z66 D;  5AVC A;  1JWV A;  5HFO A;  5CPK A;  4KZ9 A;  3L29 A;  5EOO A;  5DNN D;  3LJA D;  2XF3 A;  5E2G A;  3UO9 A;  4OON A;  1E4D A;  3LZ1 B;  2PYO C;  1P3A A;  4S2J A;  4KQO A;  1ESI A;  4LV2 A;  3MGP B;  4KGC C;  5F99 D;  2F8N D;  4E3N A;  3KUY A;  3W98 B;  3IXG A;  1VQQ A;  1K25 A;  5CPK D;  3UDI A;  2CV5 B;  4KZ5 A;  1P3P A;  4S2I A;  1IYQ A;  3FDD A;  3MGQ A;  1M18 A;  3Q82 A;  4WJ3 C;  3B6G D;  5B1M D;  5E5A B;  3LZ1 D;  3WKJ D;  1PWC A;  3WKJ B;  2ZC5 B;  1AOI A;  2ZC6 B;  3UPP A;  4QHC A;  1A7W A;  1ZC2 A;  4S2K A;  5E2H A;  5FQJ A;  1MKI A;  3HLE A;  3MNN B;  4GKU A;  3M6B A;  3SOI A;  1S32 C;  3X1U A;  4HES A;  4RX3 A;  1S32 D;  3OZH A;  1W2E A;  5G49 B;  3REK A;  4L0L A;  1CEG A;  3UT9 C;  3GRJ A;  1LI9 A;  4WNN B;  3REL D;  3AZM B;  5B1M C;  3X1T D;  4LG2 A;  3A6N A;  4H9R A;  1T3U A;  4J8X D;  1P3M D;  3TU4 B;  3W99 D;  3AFA A;  3WS1 A;  3NIA A;  5AY8 A;  1KX5 A;  5BO0 A;  1U35 B;  1I5Q A;  5B24 A;  4IED A;  5AV8 B;  4LD9 B;  5AQB A;  3WTP C;  4YS3 B;  2GDN A;  1QMF A;  3PTE A;  5AV9 B;  3WS0 A;  3ZHH A;  1WWS A;  4KZ7 A;  3AZL D;  4PPR A;  5B0Y B;  4KGC A;  1SDE A;  2EFX A;  5CHJ A;  1H8Y A;  5B31 B;  1P3I C;  3O62 C;  3BEC A;  4Z9Q A;  5AVC D;  1P3G C;  3AN2 C;  1S6R A;  5F83 A;  2XFT A;  2HUE C;  4YFM A;  5EVI C;  1L0F A;  1I2S A;  1B67 A;  3V9R B;  1HTZ A;  2P74 A;  1JTD A;  1NJ4 A;  4NYU A;  2BYM B;  2W8S A;  2L5A A;  5KDM A;  4C6Y A;  3VH6 A;  3HLC A;  4GZB A;  3HLW A;  1H3O B;  3ZGA B;  2A49 A;  5CHL B;  3V50 A;  3C1C A;  3B6F D;  4X23 D;  5HAR A;  5D3O A;  2XH9 A;  1HQ3 D;  3LCE A;  3AV1 D;  1FQG A;  3WA9 A;  2Y2J A;  3REI A;  1PZO A;  4NZ3 A;  5GT3 B;  2Y91 A;  1KE3 A;  2WYX A;  5AV5 A;  2Y2N A;  3W98 C;  2ZJ9 A;  4Y7P A;  2NQB A;  1QME A;  5E2E A;  4OH0 A;  1L2S A;  5CGX A;  4KZ4 A;  1Z2C B;  5CP6 B;  1FR1 A;  1PWD A;  5B32 G;  5M1A A;  4B4Z A;  3F6T A;  1SCW A;  5HAP A;  3MGS D;  3BYD A;  5EEC A;  4OPZ A;  5HL1 A;  2HDU A;  3KWQ C;  3NQU A;  5IHV A;  2LY8 A;  5B40 A;  2XGN A;  3B6F A;  1WWI A;  4S2P A;  4GB7 A;  3VH6 W;  2NZD A;  5CPI A;  1P3I A;  3C4P A;  3G2Y A;  3GSG A;  5CPI C;  5B1L D;  3O62 B;  2ZLY A;  1C3B A;  4JJN D;  3AZH D;  4UA7 A;  3MKF A;  3M6H A;  2PYO B;  2HDR A;  5F1F A;  1P3L A;  1DJA A;  3REL B;  5EVI A;  3MGQ D;  5FI6 A;  1RP5 A;  1W79 A;  1DJB A;  3AZK B;  1ALQ A;  1K54 A;  2P9V A;  3W97 A;  5B33 C;  4B88 A;  5B1L B;  2HDS A;  3AZN C;  4LD9 C;  5JRG C;  4LEN A;  4R1G A;  5B24 C;  1KDS A;  1WE4 A;  3VFF A;  3C1B A;  4H9P B;  4N1X A;  4F94 A;  3A3E A;  2ZQC A;  5F99 A;  3MGP D;  3UDX A;  3SS3 A;  4FH4 A;  2JSS A;  4CAY A;  2XQZ A;  4EBN A;  4WU9 A;  3AYW C;  1JTG A;  3AYW A;  1PI5 A;  3MVD B;  1K4F A;  1MWR A;  4XUJ B;  1P3B B;  1IYS A;  4OPR A;  4QLC D;  3IWO A;  1E3U D;  2EXA A;  2HIO B;  3UT9 B;  5B33 D;  4QLC A;  5FQ9 A;  5B0Z A;  1GHP A;  1R4V A;  3OPP A;  2A3U A;  3Q7Z A;  3AZL C;  5DTT A;  1EWZ A;  3VFH A;  4ZDX A;  1JWP A;  4U3T A;  1BLC A;  1SKF A;  1ID3 C;  2FJ7 B;  3AZJ A;  4H9Q B;  1KX4 B;  4GOG A;  1BT5 A;  3UE0 A;  5B40 C;  4U0T A;  4WEK A;  5CPI D;  1EQZ C;  4Z2M H;  1YLJ A;  2WAE A;  5CGW A;  2EX6 A;  3BFE A;  4J8U D;  2X02 A;  4QY6 A;  1IEL A;  1KX4 D;  5GT3 C;  3VMA A;  2IOU A;  3LY4 A;  4IBF A;  4IJE A;  4MNR A;  3IXB A;  1F66 B;  2R9X A;  3IH9 A;  5B33 B;  3WAA A;  5C3I B;  3N7W A;  1RCJ A;  5BOH A;  4S2O A;  2NZD D;  1G68 A;  1Q2P A;  5B0Y D;  3KSY A;  3BLM A;  4UAA A;  3M2J A;  4HBT A;  4KQQ A;  3LZ1 C;  2J9P A;  3V5M A;  1KX3 C;  3B6G C;  1PIO A;  1HQ3 C;  2ZQ9 A;  3MGP A;  1M1A C;  3B6F C;  1FSY A;  4Z5T C;  3KS4 A;  4EQI A;  2ZQA A;  3REH B;  1F66 D;  4X68 A;  3HLD A;  2HIO C;  3ISG A;  3W4O A;  2FFF B;  5B2J C;  3X1T B;  4X69 A;  2EFU A;  5EVI D;  4YM6 A;  3MGQ B;  4JXS A;  4J8W C;  4G91 C;  4WU8 A;  4X23 B;  5EOE A;  4OPY A;  3G32 A;  5GLD A;  4OJL A;  1TZY A;  1ID3 B;  2EXB A;  5CRF A;  5GLA A;  3KXB B;  5CHU A;  1P3I D;  3PBQ A;  2Y2Q A;  1YLT A;  4Z66 C;  5EPH A;  2IO5 C;  5B2I B;  5B31 G;  1IEM A;  2WAF A;  1NYY A;  5CHM A;  4E3O A;  2ARO A;  2DCF A;  1P3O A;  5DTK A;  3WS5 A;  1M19 D;  4WU8 D;  2ZM0 A;  2ZY5 A;  1K6S A;  4JKT A;  3UN7 A;  2QZ6 A;  5CTN A;  3O86 A;  5BNV A;  5FUG B;  4ZUX D;  4FCF A;  1P3K A;  5GSU A;  3TU4 C;  3TU4 A;  3L27 A;  1XA1 A;  1F66 C;  5AQ7 A;  5GHZ A;  1E3U A;  1U35 C;  4E44 A;  4OP5 A;  4KG6 A;  4X55 A;  2ZY2 A;  2ZD8 A;  5AY8 D;  3O88 A;  2RVQ C;  3WTP B;  5JA4 B;  2QPN A;  3GQZ A;  2J9O A;  2WZX A;  5BPV A;  1P3M C;  3BRM A;  5B0Z C;  3P09 A;  3WX7 A;  3PBN A;  2F8N G;  3SS5 A;  3BFC A;  2ZM8 A;  2EX9 A;  1KX3 B;  3AZJ C;  3AZI B;  5B0Y A;  4EUZ A;  4J8V A;  3VSL A;  4J8U B;  4NYY A;  1PZR A;  3EPH A;  3BEB A;  3PBT A;  4WYY A;  1HTA A;  3PAG A;  4RVA A;  4DE2 A;  3AZJ D;  5CPJ D;  3W99 A;  3AV2 B;  1MBL A;  4JJN B;  3GVB A;  4G92 C;  5CPJ A;  4NZ1 A;  3VH5 A;  5AY8 C;  3UTA C;  1XX2 A;  1GHI A;  4K91 A;  5A92 A;  5FA7 A;  4WM9 A;  5F99 C;  4OJ5 A;  4R8P B;  1LHY A;  3TSG A;  5AVB A;  3RXW A;  1BH9 A;  5F1G A;  3AL0 C;  4KGC D;  1IYP A;  4IBD A;  5E5A D;  3MFD A;  4XZQ C;  2PBY A;  3A1I A;  1IYO A;  1M19 C;  1YU0 A;  2FJ7 C;  5CED A;  1K56 D;  3EPK A;  1M1A B;  4IBI A;  3NY4 A;  3VH6 T;  1M18 D;  4LV0 A;  3REJ A;  4P0M A;  3MNN C;  2FFY A;  5BNX A;  1PI4 A;  5AV5 B;  3NDG A;  3MGR B;  1ES5 A;  3VP0 A;  1IKG A;  4XUZ A;  3X1V A;  2F8N B;  4QLC C;  1ZLA B;  3N8L A;  1TAF B;  3GR2 A;  3AZG A;  3ZVT A;  3Q7V B;  5DNM A;  5GT0 C;  3AYW D;  1AXB A;  2XD5 A;  4M6B A;  3D4F A;  1Z6F A;  5JYO A;  5AVB D;  1EQZ A;  1ZG6 A;  3QNC A;  3KXB D;  2J8P A;  3SS4 A;  3BFD A;  4WEJ A;  4Z5T D;  5AV9 C;  5EE8 A;  3UY6 A;  3Q81 A;  1JFI B;  4R4S A;  5G49 A;  4N1H A;  3UTB D;  4OP8 A;  5BT1 D;  2OSU A;  2EX2 A;  4D2O A;  4E3M A;  2XR0 A;  1KX3 D;  3WS4 A;  3X1S A;  3IF5 A;  4JJN C;  3AZK C;  3X1S C;  3MGS B;  4Z5T B;  3LJA B;  5B31 C;  1ZG4 A;  5HX9 A;  4JXW A;  5B1L A;  5B24 B;  4MBK A;  3L25 A;  1DY6 A;  5FQQ A;  3TG9 A;  4J8V D;  2I72 A;  4Y0T A;  1L0E A;  3LZ0 C;  5F99 B;  4WZ5 A;  3UDF A;  3WA9 D;  3AZL A;  3CZD A;  1HQ3 A;  4DE3 A;  5GT3 D;  4R3J A;  3DW0 A;  1YUE A;  2WAD A;  4CAY B;  1ERM A;  3IF6 B;  3MXR A;  1PYY A;  3HUO A;  4J8V C;  4J8U C;  3ZFZ A;  4ZBJ C;  1PW1 A;  4DRA A;  4E3I A;  3VOZ A;  3MGR C;  2IO5 B;  4KEN B;  3RXX A;  1P3G A;  4IBR A;  2J7V A;  4KHA B;  3X1S D;  3AN2 A;  4J8X B;  2NQB D;  3C4O A;  4H9O B;  3IP4 C;  1ID3 D;  1IKI A;  4J8W A;  3AZE D;  3AZE B;  4GHA A;  4P6B A;  4QY5 A;  4OQI A;  3W97 C;  2B5R A;  3UTA B;  2ZMA A;  3MZD A;  3NI9 A;  4OUI A;  4ZJ3 A;  5AVB C;  1P3M B;  1Y54 A;  3V3R A;  1U60 A;  1HD8 A;  4NZ5 A;  3FZC A;  4CSR A;  5DNM D;  5GT0 D;  5FAP A;  5FAS A;  3AZI C;  3MGP C;  1W8Q A;  3X1V D;  3IWI A;  1P3G D;  3REJ C;  2OLU A;  3AZF D;  4KUD B;  2CV5 C;  1XP4 A;  4JF5 A;  2Q9M A;  1P34 B;  4WU9 D;  4UA6 A;  4IBB A;  4R4R A;  5DNN B;  3AZN B;  4OQG A;  3UNW A;  5FI7 A;  3MGR D;  2UWX A;  4H9N A;  3MZF A;  1P3I B;  1S32 B;  1PWG A;  5B32 A;  1W8Y A;  3W99 C;  4J8X C;  2PYO A;  2G5H C;  3KWQ D;  3I7J A;  5B2J B;  3X1T C;  1M19 B;  3X1T A;  5EVI B;  3WA9 C;  3H0L C;  4G91 B;  3L28 A;  4OOM A;  5B1M B;  4XXR A;  3AZK A;  2XK1 A;  5GSU C;  4C75 A;  5CTM A;  2P9V B;  3W98 A;  1TVF A;  4P87 A;  2VGJ A;  3C1B B;  3KXB A;  1HZO A;  4EBP A;  3A3D A;  3AGE A;  3HON A;  1MWT A;  3MVD D;  3LZ0 A;  3WKJ C;  1KVL A;  3AGD A;  3WKJ A;  2YFV A;  3LZ1 A;  1AOI C;  4JXV A;  2ZM5 A;  2QMI A;  4X53 A;  5FUG A;  1ESU A;  2HP6 A;  5B32 D;  5GL9 A;  3LEZ A;  3X1U C;  4NY2 A;  5KZH A;  2H0T A;  2H10 A;  3VSK A;  5AV6 A;  2HIO A;  1F1E A;  1YU1 A;  3UT9 A;  3KFU G;  5GT0 A;  5FQI A;  2BYK B;  1ONH A;  1NZU A;  3A6N B;  4WU8 C;  3SH8 A;  1ZKJ A;  5E5A A;  3ITA A;  4H9Q A;  3FKE A;  5DNN C;  4OQ0 A;  1M6K A;  5AVC C;  3MZE A;  4NE6 A;  4YS3 C;  3N3F A;  2ZM2 A;  2WGI A;  4ZJ2 A;  4ZUX B;  1ES2 A;  3MNN D;  2YFW B;  1TDG A;  4J8W D;  5FAO A;  4JF4 A;  4WNN A;  2BLS A;  4LCM A;  5TFQ A;  3UTB B;  4R0Q A;  5B2I D;  1FSW A;  1K55 A;  1F66 A;  1YM1 A;  3AFA B;  3WTP D;  3O3V A;  4QU3 A;  4WMC D;  4KUD D;  4JF6 A;  1NZO A;  4MBH A;  5AV8 A;  3E2L A;  3KS8 A;  4N9L A;  3OCL A;  3OPH A;  4NFT A;  4KG5 A;  2HPB A;  4R8P C;  3UPO A;  4R8P A;  1ERO A;  4IBJ A;  1N1J A;  1JVJ A;  4KZ6 A;  4OQH A;  3NCK A;  3AV1 B;  5FQK A;  2BYM A;  4DDS A;  4S2N A;  4X56 A;  1K4E A;  1J9M A;  5BNX B;  2WZZ A;  5KSH A;  4N92 A;  3OPR A;  3AFA D;  1P3A B;  3IH8 A;  1Q9C A;  5GSU D;  1P3K D;  1HVB A;  4OOL A;  5L2F A;  3WA9 B;  3LEL B;  4NK3 A;  4UUZ A;  2ZQD A;  3AZG B;  1LL5 A;  1YU4 A;  3Q7V A;  3HVF A;  4OVD A;  2CWE A;  3G30 A;  4WU8 B;  1P3F A;  4PM6 A;  3C1B C;  2OV5 A;  4HEF A;  5AV8 D;  5JRG A;  3PBR A;  1U35 D;  1EQZ B;  5AVC B;  5A91 A;  2XD1 A;  5CPK C;  5CP6 C;  4KUD C;  1EQZ D;  2DF4 C;  1M18 B;  4R23 A;  4ZUX C;  3UPN A;  1NXY A;  2HP5 A;  3KWQ B;  4GD6 A;  1AOI B;  3NQJ A;  2PYO D;  3H0M C;  2IWD A;  3X1U B;  4UA9 A;  3X1S B;  3KUY B;  4ZAM A;  5CPI B;  1KDW A;  4CPK A;  4Z5T A;  3OPL A;  3O62 A;  2CV5 A;  3G2Z A;  4DRB A;  3REJ D;  1P3P B;  3X1V C;  3HUN A;  4BD0 A;  3G4P A;  4IVK A;  2G2U A;  3AZM A;  1P3L B;  4H9R B;  3N8R A;  4WEL A;  5DNM C;  4DE0 A;  4G92 B;  3AZL B;  1HQ3 B;  3Q07 A;  1ZLA D;  4NZ4 A;  4KZB A;  4LD9 A;  4HGA B;  2WGV A;  3AZF B;  5B40 B;  2BG1 A;  4Y0O A;  4DE1 A;  5AV9 A;  3C1C C;  5B24 D;  4FD8 A;  5GHY A;  1EI5 A;  3AZN D;  4EV4 A;  1M1A D;  5KSC A;  1KX5 D;  3N8S A;  2Y55 A;  4GDN A;  1YLY A;  3W96 A;  4XZQ B;  4R3B A;  4J8X A;  4KZ3 A;  4WU9 B;  4KGC B;  1CEF A;  2G2W A;  3MVD C;  4S2L A;  5G18 A;  4J8W B;  3C7V A;  4JJN A;  2NQB C;  3AZH C;  5AV5 C;  5BO0 B;  1BLS A;  1U35 A;  1KGF A;  1XGI A;  3VH5 T;  3ITB A;  3ZDJ A;  1P3F D;  5GXQ D;  3JYI A;  2V20 A;  5AVB B;  2J8Y A;  3A1K A;  5CER A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...