2UWXA

Active site restructuring regulates ligand recognition in class a penicillin-binding proteins
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
489
structure length
468
Chain Sequence
ISEITYSDGTVIASIDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPATTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTNQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PENICILLIN-BINDING PROTEIN 1B
publication title Active Site Restructuring Regulates Ligand Recognition in Class a Penicillin-Binding Proteins
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 149
structure length 468
sequence length 489
ec nomenclature ec 2.3.2.-:
pdb deposition date 2007-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2uwxA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2uwxA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2uwxA02
5I94A 3PBQA 4GDNA 4KQOA 2XD1A 4PM6A 5EVID 5CEBA 3W4QA 4KG2A 1KDWA 3FV7A 5E2EA 3IXHA 2WKHA 3HLWA 2UWXA 4OQIA 4WEJA 2G2WA 1S0WA 1YLJA 3UPNA 3OCLA 4DE3A 4E6XA 3ZG5A 4OP5A 1MBLA 2XEPA 1RGZA 4Q8IA 3HLDA 3S1YA 1WYCA 3VP1A 3M6HA 1K6RA 2GDNA 2X01A 1BLSA 3GVBA 4OKPA 2FFFB 4ZJ1A 1MPLA 1KE3A 1WYBA 3LY4A 3N8SA 2XD5A 2XLNA 3HVFA 4S2NC 4KQRA 2Q9MA 2IWDA 4OPYA 4WELA 3HL9A 3ZG9B 4N9KA 3MXSA 4BJPA 5E2FA 1BLPA 2ZC5B 2QZ6A 3PBRA 4DRTA 2HDSA 2RL3A 5BOHA 4DDYA 3VP4A 3C7UA 4UA7A 4OQHA 3ITAA 4RVAA 1L0DA 5FSRA 1QMEA 2Y2LA 5GLDA 4KZ4A 1MWRA 2QMIA 3M2JA 1ES5A 3WS1A 1ES2A 2C5WB 3IT9A 3LCEA 4M3KA 1SDNA 2V1ZA 4S2IA 3RXWA 4LV1A 1JVJA 3M6BA 3SS5A 3FKVA 4GZBA 3NI9A 1ESIA 2HDQA 4YFMA 1BSGA 1LI9A 3W4PA 1MKIA 2OSUA 1BULA 5DTSA 5EVIA 3V39A 4K0XA 5DF7A 1FR6A 5AQ7A 3HLGA 2OV5A 3SH8A 4D2OA 1E3UD 1GA9A 4OPQA 4DXBA 1RCJA 5JYPA 3DWKA 1JTGA 3IH9A 1E4DA 4K91A 5KSCA 2EX9A 4ZDXA 3MZFA 1O7EA 3O3VA 1NY0A 1GHPA 1FCNA 3C4OA 4KZ9A 3JYIA 5FQQA 4OOLA 3RJUA 5CGWA 3FYZA 2WKIA 4N1XA 4ZJ2A 1VQQA 4QD4A 5DF8A 1ZG6A 1NXYA 2Y2GA 3WS0A 2P74A 4MNRA 1KVLA 5FQIA 2XH9A 5FQKA 1KGEA 2J8YA 2WGIA 2Z2MB 5TFQA 3UDFA 1KE4A 2R9WA 2ZM8A 2Y2NA 3IHBA 3IXGA 4KZ5A 5CGSA 5TR7A 3VMAA 1EWZA 4KZ6A 5D3OA 1GA0A 1BLHA 3BYDA 3Q7ZA 2ZQDA 3SH7A 3O86A 5DTKA 4KG5A 1YLYA 2JC7A 1NZUA 2WK0A 3D4FA 5CEDA 1BTLA 4WMCD 3FKWA 1EI5A 1MWSA 1K38A 1PIOA 4JF4A 4R3BA 4OQGA 3OCNA 2WGWB 4KENB 5E2HA 1I5QA 4E3JA 4PMAA 3NDGA 4P85A 5GL9A 2HP6A 5F82A 3VP0A 4WZ5A 4N92A 1K25A 3QHYA 1BZAA 2EX6A 3NDEA 5HL1A 1HTZA 5CXWA 5F83A 5GHYA 5HX9A 4EBLA 3EQVA 4OQ0A 1E25A 3PBTA 5M18A 1ALQA 2Y91A 1FSYA 3BFEA 3BM6A 4S2PA 4U3TA 1S6RA 1E3UA 4MLLA 1K54C 2H10A 4P0MA 5EPHA 5F1GA 4JXSA 2Y55A 4WYYA 3LEZA 1MWTA 4ZAMA 4EBPA 3IF6C 1LLBA 3N7WA 3UE3A 4OLDA 3P09A 2J9OA 4XXRA 3TOIA 1PI5A 5CGXA 4R1GA 3N6IA 2Y4AA 1N4OA 1W5DA 3A3EA 1W79A 4LV3A 1PWCA 2ZC4B 1FCOA 1KGGA 5EOEA 3WS4A 3HUMA 3OC2A 1W8YA 4R3JA 3A3FA 3MXRA 1ERQA 4E3IA 5FAQA 1MY8A 1WE4A 5KMWA 4EUZA 3WRTA 5FAOA 3UPOA 4GKUA 4NETA 3S22A 1K55A 4OH0A 1H5XA 4ZBEA 3ZG7B 4E3MA 3AGDA 4GOGA 3HUOA 5CHJA 5E43A 3ZNTA 3BFGA 2A3UA 4BLMA 2EXBA 1MWUA 2FFYA 1DJCA 4OLGA 5EOOA 3UN7A 2JCHA 4IBXA 4WMCA 1JWZA 4JKTA 3UE1A 3ISGA 2Y2IA 3DW0A 1ZKJA 3BFDA 4FD8A 3G30A 5DTTA 4MBKA 4L0LA 1K6SA 4B88A 4BQMA 2PBYA 4Y0TA 4FH2A 4PM5A 2XK1A 3ZFZA 1M6KA 5GLCA 2XFTA 3VOZA 2WYXA 1YLPA 5KSHA 3C7VA 5J8XA 3QNBA 3SH9A 3C5AA 5CERA 3IXBA 2WZXA 3Q07A 2Y2HA 1Y54A 5M1AA 4EBNA 2E8IA 2PU2A 1DY6A 1SCWA 4BD0A 4C3QA 4P6BA 3PBNA 1IYOA 1YLZA 1LHYA 3GV9A 2B5RA 2EX2A 2WUQA 3IF5A 2DRWA 3OZHA 5U47A 2Y2JA 3AGEA 4GNUA 3IWQA 2EX8A 4GN2A 3VOYA 1K56D 4OP8A 1JTDA 2G2UA 1PYYA 4DXCA 1GHMA 3Q82A 2XGNA 3A3IA 4PM7A 5FATA 4IVKA 3G2YA 4DKIA 2H0TA 2H5SA 3DWZA 3S4XA 5FI2A 4N1HA 2V2FF 2Y2KA 1IKIA 4Y7PA 3TG9A 5HAQA 5GHXA 5E2GA 4C6YA 2OLUA 1KVMA 1OMEA 3LY3A 1K57C 3DTMA 3IF6B 5CRFA 3WWXA 4IVIA 4KG6A 3ITBA 3HREA 4JF5A 1LL9A 4OVDA 3UDXA 2WGVA 4DE0A 3N8LA 4FSFA 3W4OA 5F1FA 1L0EA 4EWFA 2Q9NA 2ZC3B 3AGFA 4KZ7A 4LV0A 4PM8A 1FCMA 1YT4A 4S2LA 3WS2A 2ZM0A 2JBFA 4KZBA 3GSGA 5CECA 1LI0A 4PPRA 4RX3A 4DE2A 1MXOA 1PZOA 1L0FA 2HDUA 1QMFA 4JF6A 4GD8A 1RP5A 3OPLA 4RA7A 5TGFA 4Y0UA 3V3SA 5EVIC 3PTEA 3UE0A 1K4EA 3M2KA 1TDLA 4QU3A 4BL2A 3VFHA 4EQIA 1PW8A 4LV2A 4CJNA 1GHIA 5EE8A 5FQ9A 1GCEA 3HLCA 2JE5A 2BLSA 4X69A 3PBSA 3BLMA 3SS4A 3IHAA 2ZM2A 4UA6A 4X68A 3VP3A 2EXAA 5AQBA 5AQ9A 3BRMA 2V20A 5CHMA 1IYQA 2H0YA 1IYPA 1XA7A 3UDIA 1EROA 1K54A 3MKFA 3OPRA 2Y2OA 1K56A 5FDHA 1SKFA 2ZQAA 2XQZA 2XR0A 1XP4A 2XFSA 3MZDA 1HVBA 1FSWA 4Z9QA 4FCFA 1ES3A 1G68A 1CK3A 2EFXA 4MEZA 2WZZA 1IYSA 2R9XA 1TEMA 4O7DA 3QNCA 4U0XA 3IQAA 4WZ4A 2ZQ7A 3EQUA 3Q1FA 1KDSA 2J9PA 1Q2QA 3RXXA 4X56A 5JYOA 4QY5A 4HEFA 2C6WB 5DVAA 3NY4A 4RYEA 2ZQ8A 5IHVA 4DDSA 3MFDA 2WAFA 4JLFA 1L2SA 4UA9A 2Y2QA 5GHZA 5EVLA 3A3JA 3G4PA 4X53A 3FZCA 2ZD8A 3ZVTA 4BL3A 1DJAA 3G32A 3VP2A 1Q2PA 4LCMA 4WZ5C 3V3RA 5FASA 4E3OA 4GB7A 4S2NA 2WGWA 4UAAA 5DF9A 1ZC2A 1HD8A 3CZDA 4XUZA 1XPBA 4S2OA 3VSLA 4JXVA 2CC1A 4RX2A 4KZ8A 3P98A 5KZHA 1NYYA 1O07A 1H8YA 2HP5A 5G18A 3UNWA 1YMXA 3N8RA 3ZG0A 3IWIA 4ZTKA 3BLSA 1XKZA 3ZNYA 2Y59A 1BUEA 4DE1A 4C75A 5M19A 4ID4A 5GLAA 1AXBA 3HLFA 2QPNA 5CHUA 4OOMA 1YMSA 3W8KA 1K4FA 3ZDJA 2ZLYA 4WM9A 4BD1A 4LENA 1L0GA 4E6WA 5FQJA 1FR1A 5AQAA 3WRZA 1CI8A 3B3XA 5EVIB 5A92A 4GD6A 2ZJ9A 4EV4A 3E2KA 4P87A 4JBFA 1BT5A 2VGKA 3IH8A 5L2FA 3VFFA 5CTNA 1HZOA 1PZPA 3Q81A 4MBHA 1PW1A 4KZAA 2IWBA 2Z2LB 4HBUA 2P9VB 3BEBA 4BENA 3GTCA 1M40A 1K55C 1YQSA 2I72A 1YM1A 4S2JA 5CTMA 5GLBA 3Q7VB 3SS3A 3GMWA 5HAPA 3CJMA 4NK3A 1K57A 3NBLA 1J9MA 2Y2PA 1XGIA 3HUNA 3PBOA 4QHCA 1JWVA 5A90A 5A93A 3N4IA 1IELA 4H8RA 2ZMAA 1W7FA 1ERMA 1KGFA 4QB8A 5FQMA 4DF6A 3G2ZA 3G34A 3IXDA 4B4ZA 3OPPA 5HW3A 4ZJ3A 3LO7A 3I7JA 3NIAA 1ONGA 1ESUA 1U60A 1IKGA 1N9BA 2DNSA 1PI4A 2EFUA 3ZG8B 2HPBA 1VM1A 1G6AA 3TSGA 2WKEA 4OONA 4JPMA 5HFOA 1CI9A 1IEMA 5EECA 4QJGA 2RCXA 3A3DA 3O87A 1TDGA 2BG1A 1CEFA 1Z6FA 4WBGA 3V50A 2X02A 3IWOA 2ZC6B 3MBZA 4R4SA 2P9VA 1RGYA 1NZOA 3CG5A 3G31A 4N9LA 4R4RA 5FA7A 1YLWA 2ZQ9A 3ZCZA 1PWDA 1FOFA 1BLCA 3Q7VA 1CEGA 4X6TA 4XUXA 3NC8A 4S2KA 5EUAA 3PAGA 1ONHA 4LCLA 2Y2MA 3NCKA 3O88A 4PM9A 2HDRA 3BFCA 4JXWA 1NYMA 1H8ZA 1XX2A 2PU4A 1W8QA 4MBFA 1KE0A 4OOYA 4F94A 3GQZA 1ES4A 2WAEA 3MZEA 3ZVWA 3FWLA 5HARA 4E3LA 3SOIA 3HLEA 2DCFA 2J7VA 3IF6A 3BECA 1NJ4A 1YLTA 4S2MA 4WEKA 1NRFA 2WADA 3OPHA 4HESA 4KZ3A 4E3NA 4HBTA 4R23A 5HAIA 4CPKA 4OPRA 3GRJA 4QY6A 1DJBA 4B4XA 4U0TA 1FQGA 3HLBA 2XDMA 2OLVA 4K0WA 4FH4A 3BFFA 3ZHHA 1XXMA 2A49A 2ZC7A 4R0QA 1I2WA 3UPPA 1JWPA 1C3BA 1SDEA 1SHVA 4GDBA 4Y0OA 3GR2A 4JXGA 3CMZA 4OPZA 3C4PA 3V5MA 4A5RA 1I2SA 1XA1A 5A91A 3ZGAB 2VGJA 4X55A 2HP9A 4KQQA 2XF3A 2ZQCA 3HBRA 4YINA 2IWCA 3E2LA 5FI7A 3WS5A 1PWGA 3UO9A 5FAPA 3UY6A 3MKEA 1ZG4A 1TVFA 4IEDA 3VSKA 3G35A 5FI6A 1LL5A 4UHUA 2X71A 1XGJA 3PAEA 4IBRA 4E3KA
chains in the Genus database with same CATH superfamily
3CUEC 3PBQA 4GDNA 5EVID 3F1OB 1XFQA 4KG2A 1KDWA 5E2EA 5IS1A 1N9NA 3HLWA 3UT9C 4JJND 1VEUA 4OQIA 4IJFA 2QJ7A 2A24A 4WEJA 5AV6C 5EFWA 3W2ZA 1S0WA 3WD3A 1P3GB 1M1AB 4J8UD 1KX5A 1S66L 1P3KB 1WYCA 3KYQA 3REHB 3M6HA 1BLSA 4EEUA 2NZDA 1MPLA 5AV9B 1OTIA 1HTAA 1LSWA 4IJGA 4OPYA 5B0ZA 3O62B 4N9KA 2K7SA 3B6GA 2QZ6A 2HDSA 4WNNA 3LELC 5BOHA 3VP4A 3C7UA 3ITAA 1EQZA 5FSRA 2W1TB 2VA0A 5GLDA 4YS3B 3W97D 2VKSA 5MC7A 2BYMA 5F99D 5CPJB 5CPIA 1T1CA 1KX3B 2V1ZA 4MB4A 5AY8B 2HDQA 3SZTA 1P3GA 5DTSA 4WLAA 2NQBD 5EVIA 3WTPC 4K0XA 3AFAC 4IBFA 4QNLA 3MQQA 4Q0JA 2ZY2A 4JJNA 2ZY4A 4OPQA 3REHA 1M18B 1G28A 3IH9A 5KSCA 3MZFA 1P3FD 3O3VA 1PFLA 1W1VA 4H9NA 1H0GA 4OOLA 3RJUA 2JKTM 4O8GA 3O62A 1VQQA 4QD4A 5DF8A 3KSYA 3TU4D 1TS7A 1KVLA 1KX4D 4BWIA 4WU8C 1KGEA 5AV9C 3HCYA 2HV1A 3H82A 1DP8A 2R9WA 3IHBA 5AV5B 5CPJA 3MGPD 3NQUB 1BLHA 2ZQDA 2IO5B 4YWZA 4R38A 4E44A 2WK0A 3W97A 4YS3C 2JHEA 1BFMA 1EI5A 1Z09A 4KENB 1I5QA 3D3OA 3A6NC 1HQ3B 1WWIA 4PMAA 2V0UA 5GL9A 4WZ5A 1U35D 4GH9A 1OT9A 5F83A 4XZQD 3NOUC 1P3LD 5GHYA 2NQBA 1P3MD 3PBTA 3F6TA 4G91B 2F8NB 1ALQA 4MLLA 2W8SA 5AVBD 4P0MA 1D1JA 3AZKB 4Z2LA 1P3FA 3H9WA 4ZAMA 3IF6C 5B2IC 1LLBA 3N7WA 3UE3A 5K5BA 3P09A 1PI5A 3P5JB 4IBJA 3A0RA 1WA9A 4LV3A 2XSSA 3TU4A 1FCOA 1KX4A 3LZ0C 3WAAB 1NLYA 3ZYTA 3U2AA 3MXRA 4JGOA 5FAQA 3MVDB 1M19B 1P3PC 3P7NA 4GKUA 3S22A 4ZBEA 3MGPA 3ICYA 3HUOA 3BFGA 4GLQA 2EA9A 4KUDC 4BLMA 1MWUA 1L6JA 1MKMA 1JFIA 3M7PA 3ISGA 2Y2IA 2LB5A 5DTTA 3WKJB 2F8NA 2V8CA 2YFVB 4B88A 4ESPA 4PM5A 1M6KA 3VH5A 2WYXA 4DMZA 5KSHA 4CLCB 3AZKA 3SH9A 1OJGA 3V67A 1XJ6A 1P3LA 4J8VD 1P3MA 1AOID 3CPTB 4EBNA 1DY6A 4OJPA 4LFUA 5AVBA 4DRAA 1YLZA 3OZHA 5U47A 4J8WB 1KS0A 3IWQA 2F8NH 3CHWP 4GN2A 1PNEA 4OP8A 1JTDA 1GHMA 4WV4B 5L8MA 5HDSA 5B24C 2M7UA 1P3AD 5CPKD 3C8CA 2ACGA 5FI2A 3AZMC 3BQ8A 3X1TD 1JNUA 1M19C 5F69A 3UTBB 3T4TA 4IVIA 3ITBA 1Z2CB 3T4LA 1MZUA 5F1FA 3MGRD 3W4OA 3UE6A 1L0EA 2Q9NA 3LZ1D 2ZC3B 3AGFA 4YM6D 4HGAB 3WS2A 2ZM0A 2JBFA 4Z1WA 3CPTA 3AZID 4RX3A 4DE2A 1YKDA 3LR3A 1ZLAC 3KXBD 2W3DA 3AYWB 2HDUA 1QMFA 4JF6A 1H8PA 3V3SA 3AZFB 2PD8A 3M2KA 5CX7A 1STZA 1TDLA 3T50A 3VFHA 1AOIA 5F5YA 4R8PB 4NE5A 4PKYG 5A8BA 5EE8A 5FQ9A 3S7NA 2JE5A 3SS4A 5DNND 2ZM2A 3NQJA 1S32D 5B0YD 1P9WA 3C1BC 5C3IC 3N3FA 3BRMA 3P01A 4OJLA 5E5AB 5DKLA 1EROA 3DAVA 1K54A 4J8WC 3MKFA 2Y2OA 4J8XD 5FDHA 4WU9B 2J3TD 2ZQAA 2GZAA 4NXFA 4ETZA 4Z9QA 3T4KA 1P3AA 5CPKA 4MEZA 3X1TA 1BYWA 2ZY3A 3QNCA 4U0XA 1OGBA 2FZ0A 3IQAA 3Q1FA 3L25A 3T1RA 3EGXC 3AZJC 3MGRA 1ID3D 3LZ1A 5B40B 4DDSA 3MFDA 2WAFA 3AZFA 3A3JA 4X53A 3NECA 2ZD8A 4BL3A 3G32A 2M7VA 3EG5B 1XFNA 4LCMA 3KXBA 3V3RA 5GXQC 2WGWA 1S1ZA 2L1MA 3X1UB 1HD8A 3U4LP 1N9LA 3VSLA 4BBUA 4RX2A 3W98D 1VETA 3P98A 5BT1D 2HP5A 1H8YA 3N8RA 5DJTA 5DNNA 4ZTKA 4Z66D 3ZNYA 5B0YA 2Z6DA 3HLFA 1P9RA 5CHUA 5KDMA 1YMSA 1K4FA 4HY8A 4OJ5A 2GJ3A 5E5AC 3LEQA 2ZLYA 1ACFA 1UWPX 4J8XA 4AWLC 4NE6A 3LJAD 4ETXA 1IOUA 1YSPA 2ZJ9A 5HPIA 4P87A 2QHKA 4UHUA 4E45A 5IU1A 1HZOA 1TZYD 2IWBA 3AN2C 4HBUA 1M40A 5CTMA 4IBCA 2NUTC 5B31C 3MGQC 2DQNC 2Y2PA 3KUYA 1ID3A 1S4SA 3KWQC 1JWVA 2O0YA 5J3WA 2AROD 3N4IA 5A93A 3E98A 3X1UA 1K0KA 1DRMA 1KGFA 4QB8A 4DJ2A 4I39A 5HW3A 4ZJ3A 3I7JA 5FDSA 1ESUA 1U60A 2EFUA 2E8JA 3ZG8B 1G6AA 3B0DB 2WKEA 2VV6A 4JPMA 4UQIS 4Z66A 3WA9D 2RCXA 1H0IA 3H0LC 5B1MC 4WBGA 4NEED 3K3CA 3LIBA 4R4SA 5B32B 4R4RA 3LJAA 3AV1C 2FJ7D 5B2JB 3NULA 4EQ1A 4ZUXB 4BMWA 1CEGA 4X6TA 3UB8A 3LFVA 4EETB 5EUAA 1TZYA 4HJ6A 1P34C 2VLGA 3NCKA 3O88A 4PM9A 3BFCA 1H8ZA 2PU4A 2Z6CA 1KE0A 4NFTA 3GQZA 3PXPA 3AZLC 3HONA 4Z5TC 3SOIA 1F5MA 3HLEA 1YLTA 1DP6A 1NJ4A 5GT3D 3X1SB 1YU3A 2AROA 4H9RB 4S2MA 4HESA 4WEKA 1QO6A 4E3NA 3REJD 3EPLA 2BYKA 2J8PA 5B33B 2CMNA 1DJBA 4NXGA 2AVXA 3BFFA 1GSWA 2PR6A 2JKRI 3UPPA 3W96D 3V5MA 4A5RA 1I2SA 1UR9A 5DJUA 3AL0C 4KQQA 2PDRA 4H9SC 3MNNB 2PYOC 3HJIA 3IX4A 3EPJA 3AZHA 1UGUA 3UO9A 4LD9B 3KO6A 1ZG4A 2CV5B 4IEDA 3X1VC 1LL5A 1P3BB 5G49B 4WF0A 3V39A 2RVQD 5I94A 4PM6A 5CEBA 1N1JB 3W4QA 2F8NG 1T1AA 3FV7A 3CAXA 4FTXA 2KOIA 3AZND 2UWXA 3VH6T 4DE3A 3ZG5A 5AJGA 2XEPA 5GT0A 5GT3A 3HLDA 3NOTC 5AVCC 3B0CT 3REJA 1P3IB 3ULFA 1K6RA 3T4JA 3WD0A 3LY4A 4EERA 4S2NC 3AZEC 4KQRA 4CLCE 1BLPA 4XUJC 3RELC 1L0DA 4NYYA 2CV5A 2Y2LA 5G49A 1P3BA 2QMIA 3WD1A 3REID 3IT9A 4M3KA 1SDNA 5GSUC 4S2IA 4EO5B 1V9ZA 3M6BA 3MGSB 5CP6C 2PRFA 3B6FD 2L5AA 3PR6A 4QLCD 3AZGD 1LI9A 4GS9B 1YU1A 3EPKA 1OTBA 4EEPA 3SH8A 3AZNA 4GHIB 4D2OA 5HD3A 5FEGA 4B9OA 5AV8B 3DWKA 4EESA 5JRGD 4Z2MH 1F66B 1O7EA 4Y5FA 1P3OD 1GHPA 3C4OA 4N1XA 3R7WA 4ZJ2A 2ZBBA 3AV2C 4H9OB 3WS0A 2XH9A 3UT9B 2WGIA 5AV6B 2Z2MB 3REKD 2JSSA 4I3IA 3IXGA 1KX5D 1GA0A 3BYDA 3Q7ZA 3NJAA 3SH7A 4X23C 1YLYA 2W3GA 5CEDA 4DN0A 1BTLA 3LIFA 3REIA 2HIOA 2NZDD 1MWSA 3FKWA 4HH2A 5I5LA 1PIOA 2W3HA 4OQGA 3VOLA 2B18A 5E2HA 4F3LA 3MGSC 1J7MA 4H9PA 3B6GD 3B6FA 3FPWA 3GECA 3LELB 1AIWA 5F82A 5AV8A 1F66A 4IHQA 2W1RA 4MMNA 2QJ5A 4EBLA 5M18A 1OGGA 4OQ0A 5EM1A 3H7WB 3VE3A 4NZ5A 2Y91A 3BFEA 3BM6A 4U3TA 3CUEA 4KGCC 5EPHA 4H9OA 5F1GA 5JRGA 4JXSA 2Y55A 1MWTA 1CF0A 3W99C 2ZMVA 3CITA 2HGVA 4IBBA 2D02A 4R1GA 1LL8A 3WX7A 2B95A 1P3GD 2Y4AA 1M1AD 4WL9A 3FG8A 4UPKA 3DTKA 3WTPB 1KGGA 3HUMA 3AFAB 1P3KD 4E3IA 3REHD 1D7EA 5BS7A 3REKA 5KMWA 3WRTA 5FAOA 4ARZB 4G3KA 4NETA 2KDKA 4GOGA 5CHJA 5E43A 3O62D 4EUVA 4IBGA 2EXBA 3LELA 1DJCA 2P08A 5EOOA 4O01A 3CI6A 4WU8B 1CJFA 2ZOHA 3V9RA 1K6SA 4BQMA 1D06A 5CPJD 2XFTA 3KFUG 1KX3D 3VV4A 5J8XA 3QNBA 5CERA 5AY8D 3IXBA 2Y2HA 1Y54A 1E6PA 3L27A 4P6BA 4C3QA 3PBNA 1IYOA 3WTPA 2F2AC 1LHYA 2WUQA 3F1OA 3GV9A 3IF5A 2FN2A 3QP8A 3QP4A 5TBMB 3A6NB 4GNUA 3KX0X 1M18D 1K56D 2G2UA 1OJ5A 2BTFP 1M1AA 4DXCA 2YKHA 3A3IA 3T4QA 5FATA 3G2YA 4DKIA 2H0TA 3DWZA 4NZ4A 2HJEA 3S4XA 3S7OA 1P3KA 3TG9A 5B0ZC 4C6YA 1BH9B 3LY3A 1K57C 2IA2A 5DNMC 3NOPC 3IF6B 5B2IB 1UR8A 2YFWB 2W3FA 5B1LC 5AV9A 1T1BA 1EQZC 4HP4A 3N8LA 3SW1A 5AV5D 4EWFA 1TS8A 3UTAB 3KSIA 5CPIC 4NKPA 3LZ0B 4PM8A 1YT4A 2W1TA 4KZBA 3GSGA 5CECA 4YS3A 2B02A 4PPRA 3C1CC 1SKOB 2R78A 1P3PB 1KX3A 1RP5A 4RA7A 5TGFA 1Q9CA 5AY8A 3B42A 5EVIC 1K4EA 4KUDB 1HQ3D 4QU3A 5EV0A 4LV2A 5LBRA 1GHIA 4JJNC 4WN5A 2G7UA 2IOUA 1UWNX 4UA6A 4YOFA 4J8UC 3VP3A 2F8ND 1IYQA 3UDIA 2OAP1 3OPRA 4IUKA 1BH9A 1M18A 1K56A 3AZKD 2QYBA 2V1BA 2XQZA 2XFSA 3C2WA 1YPRA 1FSWA 4KQDA 1OTAA 2WZZA 1TEMA 5KIZA 3WAAD 1ZHHB 4WZ4A 1OPXA 2ZQ7A 3RXXA 3MVDD 1SKOA 1P3PA 5AV5A 3NY4A 2ZQ8A 4H9QB 5F99C 3UTAC 5B24B 3NQUA 4JLFA 4UA9A 3AZMB 3L2AA 4X25A 4KUDA 2VK3A 3RFBA 1DJAA 4WZ5C 3S7PA 4E3OA 4GB7A 4XZQB 4UAAA 4EXOA 5DF9A 5HD5A 3WKJD 2XRNA 2NQBC 4XUZA 5CHLB 1HQ3A 2CC1A 3LICA 3MJQA 1NYYA 4JGPA 3UNWA 4CLCD 4MDZA 1XKZA 2Y59A 3A1KA 4DE1A 1EAKA 3UB9A 5GLAA 2L4RA 1P3FC 2QPNA 3W8KA 4KUKA 3ZDJA 1ZLAB 4LENA 3QP2A 4E6WA 2YKFA 5AQAA 3WRZA 1CI8A 1ED7A 3TU4C 4EV4A 1KX4C 4J8WD 3EPHA 4JBFA 4QPRA 4Z2MG 3IH8A 4CQHA 1PZPA 1LSVA 3UB5P 3MR0A 2LY8A 3L7HA 3KSHA 3C1BB 3OOVA 5C3IB 3BEBA 4BENA 5B24A 5J7EA 3GTCA 3WAAA 1YQSA 3MGPC 3AZMA 3SS3A 5HAPA 4Z2HA 1OT6A 3MVDA 3NBLA 1J9MA 1M19A 3HUNA 3S7QA 5FEFA 3UTBD 2WKPA 5L07A 1KU5A 1TD5A 4HJ4A 3H0RC 4AFIA 1ERMA 5FQMA 4HOIA 4DF6A 3G2ZA 2ZOIA 3HJKA 3IXDA 4B4ZA 4DQYB 3KS8A 1H3OB 1U35C 4XZQC 3FKEA 1P3LC 3WKJA 2YFVA 4K08A 3AZJB 1PI4A 1P3MC 3AYWD 3TSGA 1E15A 4CLCA 5AVBC 1AWIA 5EECA 3AZFD 3O87A 1TDGA 1CEFA 4R8PD 2L0WA 4YNRA 5GXQB 3MBZA 1NZOA 1PWDA 2PT7A 3EOIA 5E5AD 4J8WA 1BH8B 5HWTA 4WU9D 2Y2MA 5F68A 1NYMA 1W8QA 4F94A 1CQAA 2WAEA 4AWLB 3MZEA 1H3OA 4YM6B 2J7VA 3UTBA 3BECA 1X0OA 1NRFA 2EWVA 4KZ3A 4R23A 4CPKA 3AN2B 3WD4A 4OPRA 5B40D 4B4XA 5BNVB 1FQGA 4OJOA 4FH4A 5B31B 3MGQB 2ZC7A 4J8VC 1AOIC 3KUYD 1C3BA 3KWQB 3JVVA 4GDBA 4Y0OA 3GR2A 3AYWA 4JXGA 3CMZA 3C4PA 1XA1A 3ZGAB 4X55A 3X1UD 4YINA 4R8PA 1PWGA 3UMDA 5FAPA 2CWEA 2O99A 3KS4A 5E5AA 5FI6A 3WTPE 1P3AC 5CPKC 1XGJA 4WYYA 1F9IA 3PAEA 4E3KA 3UB6A 4WU9A 3X1TC 4KQOA 4LRZE 5B1MB 4HI4A 2ZL1B 2O9BA 3MXQA 1W1PA 2G2WA 2UV0E 1YLJA 3AN2A 3OCLA 3MGRC 3AV1B 4E6XA 4Y2FA 1MBLA 4H6JB 4YM6C 1RGZA 3VH5W 5B31A 3UMEA 3VP1A 2X01A 3AZIC 2GDNA 1P34B 2FFFB 5B40A 4LPZA 4UQIM 4ZJ1A 3KXBC 1KE3A 4HNBA 2XD5A 3HVFA 4Z2IA 2Q9MA 1NLZA 3HL9A 3MXSA 4DRTA 5E2FA 3AZLB 2ZC5B 4Z5TB 1GOIA 2RL3A 4UA7A 4D60A 5DNNC 4OQHA 4RVAA 1S32C 3EEAA 5B0YC 3BY9A 1MWRA 4M4XA 1ES5A 3WS1A 1TS6A 2C5WB 4J8XC 3FPVA 2J3TC 4LV1A 4GHLA 1W1YA 4QWOA 3R45B 3FKVA 5B1MA 4DRBA 4YFMA 1BSGA 4MN5A 5B32D 2HZ5A 3T1SA 1BULA 5B2JD 2V8FA 3FC7A 1O6IA 4ZUXD 2PYOB 4Y3IA 3E4PA 3HLGA 4CSRB 1E3UD 4DXBA 1RCJA 3AZHD 1N9OA 4K91A 2EX9A 1ID3C 1H0MA 3T12B 1NY0A 3X1VB 5FQQA 3FYZA 3IBRA 1ZG6A 1NXYA 2P74A 4MNRA 2HJ9C 3MS6A 3X1SD 2J8YA 1P97A 5B33D 3UDFA 1KE4A 4UEYA 5TR7A 2Y2NA 3W98C 3VMAA 1EWZA 5BT1C 5D3OA 4UUZB 5GT0D 5IT5A 4Z66C 3O86A 4PHTA 5DTKA 5AVCB 4P6ZS 1YUEA 2JC7A 1NZUA 2QWSA 2M1CA 1K38A 4R3BA 3OCNA 3AZEB 3LJAC 5HDDA 2PYOA 3MNND 4E3JA 3NDGA 4CSRA 3LR0A 2HP6A 1EW0A 4LD9D 4XUJB 3QHYA 3RELB 5HL1A 5B32A 5CXWA 4EU0A 5B2JA 2CV5D 3EQVA 1E25A 4ZUXA 4XT2B 4R70A 3VH6A 1FSYA 1P3BD 1VB6A 3JVUA 1S6RA 1E3UA 5GSUB 5CP6B 3BY8A 4FUWA 4XXRA 2J9OA 1R4VA 2AROC 3TOIA 5CGXA 3N6IA 1TAFB 4L9GA 1W79A 2H28A 1PWCA 2ZC4B 1Y28A 3WS4A 3OC2A 4UUZA 2EWWA 4Q0IA 3X1SA 4H9RA 3IX3A 4R3JA 3A3FA 4Y13A 1ERQA 1P3ID 1MY8A 5B33A 3LIEA 3A0SA 4NXBA 1K55A 4OH0A 1H5XA 3ZG7B 4E3MA 1E6NA 3ZNTA 3T1XA 3WA9C 3AV2B 3OBFA 2FFYA 4OLGA 3UN7A 4JKTA 3UE1A 3RELA 3DW0A 1GPFA 2HUEC 4L0LA 2FJ7C 2JKTI 4XT2A 1A7WA 2PBYA 3MNNA 4FH2A 2XK1A 3ZFZA 5GSUA 3C7VA 4LD9A 3MMHA 5CP6A 1XJ3A 3Q07A 4X23B 2E8IA 1ULYA 1SCWA 2HIOD 4BD0A 2B5RA 1N1JA 2DRWA 3DBAA 4MCWA 2V5OA 4IBDA 3AGEA 4TX8A 5GT3C 2MJ6A 5AV8D 2LB9A 3MFXA 4GCZA 4GJ4A 3VOYA 3REJC 1PYYA 1F66D 3F1NB 3ZQ5A 5F6AA 4IVKA 1F1EA 4HMCA 4N1HA 2GX5A 5HAQA 5GHXA 4KGCB 1P3IA 1KVMA 5EVEA 5FUGB 1L3LA 3W96C 3UT9D 3W99B 5CRFA 2O9CA 4LRYC 3HREA 5AV6D 1LL9A 4OVDA 4ZRRA 2WGVA 3UDXA 4DE0A 1SZVA 5HDCA 4FOFA 5HPFA 4KZ7A 1ODVA 3BJNA 1FCMA 4S2LA 4NZ1A 2PBDP 3MQ0A 3AZGB 1PZOA 2WKRA 2RVQC 5HZHA 4LRXC 4ZBJC 1LSXA 5J4EA 3GDIA 2W0NA 3MGSA 3UE0A 4BL2A 3B33A 3LELD 1PW8A 5L10A 4CJNA 3AZNC 5G4ZA 4GS9A 2BLSA 3PBSA 3BLMA 3IHAA 3IX8A 2J80A 3F1PB 2EXAA 1P3OB 1PRQA 2H0YA 4HIAA 1IYPA 4GHIA 4KGCA 2ZM5A 2XR0A 1XP4A 2PYPA 1HVBA 1E6ZA 1ES3A 1G68A 1VEUB 3WTPD 3AFAD 1KX5B 1KOUA 3UT9A 3EQUA 2J9PA 5AV6A 3UB7A 1IFQA 2VQRA 4RYEA 2NZDB 3REIC 1L2SA 2DMWA 5B0ZB 3T1QB 2D49A 3ZVTA 2G5HC 3VP2A 4QLCC 5DNMB 4WU8D 3AZGC 4Z2JA 1Q2PA 5FASA 5B1LB 1MC0A 5B31G 5AV9D 1EQZB 3F1PA 1A0KA 3KYZA 1ZC2A 1XPBA 4S2OA 4KHAB 1O07A 5G18A 5CPIB 4LLOB 1YMXA 3ZG0A 5JRGC 5M19A 4ID4A 4YS3D 3C1CB 3H7WA 1P3OC 4WM9A 1FILA 1GSVA 1L0GA 5FQJA 3B3XA 5EVIB 3A6ND 1S4RA 1BT5A 2VGKA 4JJNB 5L2FA 3VFFA 5CTNA 2JKRM 1PW1A 4KZAA 5BS7C 3REKC 4J8UB 2P9VB 2GNXA 3AFAA 1KX5C 2I72A 4H9NB 4HH3A 3IS2B 3Q7VB 3GMWA 1K57A 1XGIA 5DNMA 5B2ID 4ARZA 2NZDC 5B1LA 2OWHA 3E4OA 2ZMAA 3H82B 1W7FA 2PD7A 1G5UA 4KHAA 2HF6A 4GW9A 3UTAD 3B6GC 3LZ0D 4WU8A 3E4QA 1H3QA 3NIAA 3C1CA 2DNSA 1N9BA 4Y15A 1DP9A 2HPBA 3W97B 2VJWA 1P3PD 3PYPA 5F99B 4PAUA 3R4KA 1CI9A 1IEMA 3A3DA 2OWJA 4KUDD 1TS0A 4G92B 2BASA 3IP4C 4MB5A 1P3GC 4J8UA 1M1AC 2P9VA 3G31A 4HJ3A 4N9LA 5FA7A 1YLWA 2ZQ9A 2NQBB 4NYUA 4LG2A 3ZCZA 5TBMA 4NY2A 3A6NA 1BLCA 3IS2A 3Q7VA 4XUXA 1P3KC 4S2KA 3MQLA 3REHC 3RH8B 1Y4OA 1P3FB 4JXWA 1F2KA 1VHMA 4MN6A 3DTIA 3L9KA 4MBFA 4OOYA 3TRCA 3O62C 3ZVWA 5B32G 1HLUP 3FWLA 3QP5A 5HARA 3TU4B 1KX4B 5B2IA 2I9VA 3IF6A 2YFWA 3OPHA 2WADA 4HBTA 5HAIA 4QY6A 5F99A 3UTAA 4HMEA 4X1LA 5B24D 5CPJC 3LZ0A 3HLBA 3MGPB 1KX3C 3AZMD 3L29A 1XJ2A 3ZHHA 5AY8C 1GXDA 4R0QA 1I2WA 1NRJA 1M19D 1JWPA 1SDEA 3TW8A 3W97C 2PYRA 1JFIB 4OPZA 3B47A 5A91A 2HP9A 2P04A 5DKKA 5HWWA 2IWCA 2Y79A 3E2LA 4G92C 1M18C 1U35B 3UY6A 3H0MC 1G6OA 3D72A 2XROA 1P3LB 3MKEA 3WD2A 1P3MB 4KUOA 3VSKA 3G35A 1ZLAD 2F8NK 4IBRA 5AVBB 3B0BA 2XD1A 4HQAA 5HL6A 2VEAA 3IXHA 2WKHA 5BPVA 3QP6A 2WKQA 1OTEA 2DF4C 4BBVA 3UPNA 3MF0A 3C1BD 4IBKA 5AV5C 2JN7A 4L9FA 4OP5A 2OOLA 3NHQA 4Q8IA 2D01A 3T4SA 3MQOA 2IO5C 3S1YA 3K3DA 3GVBA 4OKPA 4H9QA 1WYBA 3N8SA 2J3WA 2XLNA 1W2EA 2IWDA 4WELA 3ZG9B 2RTSA 4BJPA 1HQ3C 2G5IC 3PBRA 2QKPA 4DDYA 4B93A 3E0YA 1U35A 4XZQA 3LI8A 1QMEA 3AZJD 4KZ4A 4G91C 4IBEA 3M2JA 1ES2A 1FIKA 3LCEA 3AZKC 3RXWA 1JVJA 3SS5A 4ME4A 4J8VB 4GZBA 3NI9A 1AOIB 1ESIA 1ZLAA 3W4PA 5GXQD 1MKIA 2OSUA 3NQJB 3VH5T 1PZRA 5C5KA 5DF7A 4HMDA 1FR6A 5AQ7A 3WAAC 4Q0HA 2OV5A 1GA9A 5JYPA 1JTGA 1E4DA 3MVDC 4ZDXA 3C1BA 3L26A 3LI9A 2JKFA 4LGWA 3KSGA 1FCNA 4KZ9A 3JYIA 1P3AB 3K2NA 5CPKB 4G3VA 5CGWA 2WKIA 1ZTUA 2Y2GA 3X1TB 2W27A 5FQIA 5FQKA 4CAYB 1T19A 2VGLM 3WKJC 5TFQA 3AN2D 3MGRB 5EM0A 5CGSA 2ZM8A 4KZ5A 3LZ1B 4KZ6A 4CLCC 1W1TA 5B31D 3MGQD 4J8VA 4KG5A 2VZWA 3AZJA 4IJEA 3D4FA 3AZIB 3KWQD 4WMCD 4O0PA 4X1MA 3KXBB 4JF4A 1E88A 2V1AA 3G6OA 2WGWB 3EWKA 3FDDA 3QP1A 3LYXA 4P85A 1VETB 3VP0A 4N92A 1K25A 4HHDA 1BZAA 2EX6A 5GXQA 5DNNB 1HTZA 3NDEA 2V0WA 1S32B 2PHYA 2VGLS 5B0YB 5HX9A 3HSHA 3JPUA 5KDMB 4S2PA 4I3AA 5HWVA 1BH8A 3DTEA 1K54C 2H10A 4J8XB 2O9AA 3O5YA 5BNXB 3LEZA 2P7JA 4CAYA 4EBPA 5B1MD 3UTBC 2V9AA 3LGOA 4HP9A 4OLDA 3KSFA 1WWSA 1N4OA 1W5DA 3A3EA 3AV1D 2KLIA 3C38A 5EOEA 4YM6A 1CK7A 4JGRA 4HGAC 1W8YA 4NE3A 3AZIA 1WE4A 3KUYB 1P34D 1ID3B 4EUZA 3UPOA 2K2NA 3AYWC 5BNVA 3LZ1C 2JKGA 3AGDA 1W63M 3T4OA 3AZFC 3MGQA 2A3UA 3AZLD 1T18A 4Z5TD 4R8PC 3KWQA 2JCHA 4IBXA 4WMCA 1JWZA 1ZKJA 3BFDA 1S32A 3G30A 4FD8A 1YU4A 4MBKA 1YSQA 4Y0TA 5L09A 3W98B 5GLCA 2XA7M 3VOZA 1YLPA 4WU9C 5BNXA 3C5AA 4Z66B 3IBJA 2WZXA 2Q0OA 5M1AA 2W3EA 4I3JA 3VE4A 2PU2A 4NG2A 3LJAB 2EX2A 2PYOD 2Y2JA 4NZ3A 1LT0A 2EX8A 2ZL1A 4GHAA 1TZYB 4Z2GA 3AV1A 3Q82A 5AVFA 1B6WA 2XGNA 5B40C 4PM7A 3X1VD 4H6JA 2H5SA 4Y7PA 2V2FF 2Y2KA 1IKIA 4P6ZM 5E2GA 3KYEA 2OLUA 2XA7S 4L9EA 1OMEA 1P34A 4MN7A 3KUYC 3DTMA 2INWA 3WWXA 4KG6A 2AROB 4JF5A 3LIAA 3X1UC 2BYKB 1YAXA 1E8BA 4FSFA 5JA4B 3AZLA 3W98A 4Z5TA 4E04A 3OLOA 4LV0A 2RIQA 1YU2A 5AVCD 4R6LA 1LI0A 5AVEA 3EGDC 1MXOA 5TJJA 1L0FA 3AZED 2FH5A 3OPLA 4GD8A 4Y0UA 3WA9B 3PTEA 1E6RA 3R45A 4EQIA 1GCEA 3HLCA 4XUJD 3RELD 3AZHB 4X69A 2HUEB 1GSXA 4X68A 3CLOA 3A1IA 2FJ7B 4H9SA 4R3AA 2VX8A 5AQ9A 5AQBA 2V20A 5CHMA 1XA7A 1TF1A 3BQAA 5GSUD 1SKFA 2NUPC 1TZYC 5CP6D 3MZDA 4OUIA 4FCFA 3X1VA 3TE8A 1CK3A 4JGQA 2EFXA 2K31A 1V9YA 1IYSA 5JA4A 2R9XA 3BWLA 4O7DA 4IBIA 5GT0B 5GT3B 1KDSA 1Q2QA 4X56A 3REJB 5JYOA 4QY5A 4HEFA 2C6WB 5DVAA 4OJ6A 5IHVA 3B0DC 2Y8HA 5GHZA 2Y2QA 5EVLA 3WA9A 3G4PA 5AVCA 3AV2D 3FZCA 3W96B 4S2NA 2FJ7A 5B32C 3AZEA 4WJ3C 5B2JC 1S1YA 1H8MA 3CZDA 4ZUXC 4Z2KA 4JXVA 4KZ8A 5KZHA 1T3UA 4Y17A 4XUJA 3IWIA 3AZHC 3BLSA 1BUEA 4X23D 4C75A 1AXBA 3BW6A 4OOMA 2KX6A 2VV8A 4BD1A 3LR4A 4M6BA 5G4YA 4ZBJB 5BO0B 1FR1A 3D9YA 5A92A 1F98A 4GD6A 3MGSD 4WZSB 3E2KA 3X1SC 3AZNB 3EEHA 1XJ4A 3Q81A 1TAFA 4MBHA 5B33C 2Z2LB 4EW7A 3MSHA 1B67A 1K55C 3CWFA 1YM1A 4S2JA 5GLBA 5GT0C 3R7WB 3CJMA 4KGCD 4NK3A 3W96A 3LUQA 3PBOA 4QHCA 3TJZC 3W99D 5A90A 4WUJA 1IELA 4NXEA 4H8RA 1CXWA 3LR5A 3MNNC 3AV2A 3G34A 3OPPA 4I38A 4LD9C 3LO7A 1ONGA 1IKGA 2CV5C 1VM1A 1P3BC 3REIB 2HIOB 4OONA 5BO0A 1NWZA 5HFOA 4QJGA 1W63Q 4X23A 4BBTA 1S67L 4F3LB 2BG1A 4H9PB 3B6FB 1Z6FA 4QLCB 2X02A 3V50A 3IWOA 2ZC6B 5FL3A 1P0ZA 3CG5A 1RGYA 4I5SA 3RTYA 1FOFA 1YU0A 5DFXA 3NC8A 4DJ3A 3PAGA 1P3IC 1ONHA 5JRGB 4LCLA 3F1NA 2HDRA 4G3WA 1XX2A 2OAQ1 1ES4A 3C30A 5FUGA 4E3LA 2DCFA 5HSQA 3W99A 3LIDA 2A24B 1OTDA 3REKB 4PKYA 3GRJA 3VH6W 4U0TA 2XDMA 1J3WA 2OLVA 2PR5A 4EO5C 4K0WA 3L28A 5B0ZD 1XXMA 2A49A 2PAVP 4IUHA 4MB3A 4RQ9A 3A0VA 1SHVA 4QLCA 3AZGA 5DNMD 2A2LA 2ZMFA 2HIOC 5B1LD 3B0CW 1EQZD 2VGJA 3V9RB 2XF3A 2ZQCA 3HBRA 5FI7A 3PHYA 3B6GB 1PDCA 5CPID 3B6FC 3WS5A 4WNNB 5AV8C 1F66C 5DFYA 3C1CD 1P3OA 1TVFA 2BYMB 2ZY5A 2X71A 4II7A 2VV7A
chains in the Genus database with same CATH topology
3PBQA 4GDNA 5EVID 4KG2A 1KDWA 5E2EA 3HLWA 3UT9C 4JJND 4OQIA 4IJFA 4WEJA 5AV6C 1S0WA 1P3GB 1M1AB 4J8UD 1KX5A 1P3KB 1WYCA 3REHB 3M6HA 1BLSA 2NZDA 1MPLA 5AV9B 1HTAA 4OPYA 5B0ZA 3O62B 4N9KA 3B6GA 2QZ6A 2HDSA 4WNNA 3LELC 5BOHA 3VP4A 3C7UA 3ITAA 1EQZA 5FSRA 5GLDA 4YS3B 3W97D 2BYMA 5F99D 5CPJB 5CPIA 1KX3B 2V1ZA 5AY8B 2HDQA 1P3GA 5DTSA 2NQBD 5EVIA 3WTPC 4K0XA 3AFAC 4IBFA 4QNLA 2ZY2A 4JJNA 2ZY4A 4OPQA 3REHA 1M18B 3IH9A 5KSCA 3MZFA 1P3FD 3O3VA 4H9NA 4OOLA 3RJUA 3O62A 1VQQA 4QD4A 5DF8A 3KSYA 3TU4D 1KVLA 1KX4D 4WU8C 1KGEA 5AV9C 2R9WA 3IHBA 5AV5B 5CPJA 3MGPD 3NQUB 1BLHA 2ZQDA 2IO5B 4E44A 2WK0A 3W97A 4YS3C 1BFMA 1EI5A 4KENB 1I5QA 3A6NC 1HQ3B 1WWIA 4PMAA 5GL9A 4WZ5A 1U35D 4GH9A 5F83A 4XZQD 1P3LD 5GHYA 2NQBA 1P3MD 3PBTA 3F6TA 4G91B 2F8NB 1ALQA 4MLLA 2W8SA 5AVBD 4P0MA 3AZKB 1P3FA 4ZAMA 3IF6C 5B2IC 1LLBA 3N7WA 3UE3A 3P09A 1PI5A 3P5JB 4IBJA 4LV3A 3TU4A 1FCOA 1KX4A 3LZ0C 3WAAB 3MXRA 5FAQA 3MVDB 1M19B 1P3PC 4GKUA 3S22A 4ZBEA 3MGPA 3HUOA 3BFGA 4KUDC 4BLMA 1MWUA 1JFIA 3ISGA 2Y2IA 5DTTA 3WKJB 2F8NA 4B88A 2YFVB 4PM5A 1M6KA 3VH5A 2WYXA 5KSHA 3AZKA 3SH9A 1P3LA 4J8VD 1P3MA 1AOID 4EBNA 1DY6A 4OJPA 5AVBA 4DRAA 1YLZA 3OZHA 5U47A 4J8WB 3IWQA 2F8NH 4GN2A 4OP8A 1JTDA 1GHMA 4WV4B 5B24C 1P3AD 5CPKD 5FI2A 3AZMC 3X1TD 1M19C 3UTBB 4IVIA 3ITBA 1Z2CB 5F1FA 3MGRD 3W4OA 1L0EA 2Q9NA 3LZ1D 2ZC3B 3AGFA 4YM6D 4HGAB 3WS2A 2ZM0A 2JBFA 3AZID 4RX3A 4DE2A 1ZLAC 3KXBD 3AYWB 2HDUA 1QMFA 4JF6A 3V3SA 3AZFB 3M2KA 1TDLA 3VFHA 1AOIA 4R8PB 4NE5A 5EE8A 5FQ9A 2JE5A 3SS4A 5DNND 2ZM2A 3NQJA 1S32D 5B0YD 3C1BC 5C3IC 3N3FA 3BRMA 4OJLA 5E5AB 1EROA 1K54A 4J8WC 3MKFA 2Y2OA 4J8XD 5FDHA 4WU9B 2ZQAA 4Z9QA 1P3AA 5CPKA 4MEZA 3X1TA 2ZY3A 3QNCA 4U0XA 3IQAA 3Q1FA 3L25A 3AZJC 3MGRA 1ID3D 3LZ1A 5B40B 4DDSA 3MFDA 2WAFA 3AZFA 3A3JA 4X53A 2ZD8A 4BL3A 3G32A 3EG5B 4LCMA 3KXBA 3V3RA 5GXQC 2WGWA 3X1UB 1HD8A 3VSLA 4RX2A 3W98D 3P98A 5BT1D 2HP5A 1H8YA 3N8RA 5DNNA 4ZTKA 4Z66D 3ZNYA 5B0YA 3HLFA 5CHUA 5KDMA 1YMSA 1K4FA 4OJ5A 5E5AC 2ZLYA 4J8XA 4AWLC 4NE6A 3LJAD 2ZJ9A 4P87A 4UHUA 4E45A 1HZOA 1TZYD 2IWBA 3AN2C 4HBUA 1M40A 5CTMA 4IBCA 5B31C 3MGQC 2DQNC 2Y2PA 3KUYA 1ID3A 3KWQC 1JWVA 2AROD 3N4IA 5A93A 3X1UA 1KGFA 4QB8A 5HW3A 4ZJ3A 3I7JA 1ESUA 1U60A 2EFUA 3ZG8B 1G6AA 3B0DB 2WKEA 4JPMA 4Z66A 3WA9D 2RCXA 3H0LC 5B1MC 4WBGA 4R4SA 5B32B 4R4RA 3LJAA 3AV1C 2FJ7D 5B2JB 4ZUXB 1CEGA 4X6TA 5EUAA 1TZYA 1P34C 3NCKA 3O88A 4PM9A 3BFCA 1H8ZA 2PU4A 1KE0A 4NFTA 3GQZA 3AZLC 3HONA 4Z5TC 3SOIA 3HLEA 1YLTA 1NJ4A 5GT3D 3X1SB 1YU3A 2AROA 4H9RB 4S2MA 4HESA 4WEKA 4E3NA 3REJD 3EPLA 2BYKA 2J8PA 5B33B 1DJBA 3BFFA 3UPPA 3W96D 3V5MA 4A5RA 1I2SA 3AL0C 4KQQA 4H9SC 3MNNB 2PYOC 3EPJA 3AZHA 3UO9A 4LD9B 1ZG4A 2CV5B 4IEDA 3X1VC 1LL5A 1P3BB 5G49B 3V39A 2RVQD 5I94A 4PM6A 5CEBA 1N1JB 3W4QA 2F8NG 3FV7A 3AZND 2UWXA 3VH6T 4DE3A 3ZG5A 2XEPA 5GT0A 5GT3A 3HLDA 5AVCC 3B0CT 3REJA 1P3IB 1K6RA 3LY4A 4S2NC 3AZEC 4KQRA 1BLPA 4XUJC 3RELC 1L0DA 4NYYA 2CV5A 2Y2LA 5G49A 1P3BA 2QMIA 3REID 3IT9A 4M3KA 1SDNA 5GSUC 4S2IA 4EO5B 3M6BA 3MGSB 5CP6C 3B6FD 2L5AA 4QLCD 3AZGD 1LI9A 1YU1A 3EPKA 3SH8A 3AZNA 4D2OA 5AV8B 3DWKA 5JRGD 4Z2MH 1F66B 1O7EA 1P3OD 1GHPA 3C4OA 4N1XA 4ZJ2A 3AV2C 4H9OB 3WS0A 2XH9A 3UT9B 2WGIA 5AV6B 2Z2MB 3REKD 2JSSA 3IXGA 1KX5D 1GA0A 3BYDA 3Q7ZA 3SH7A 4X23C 1YLYA 5CEDA 1BTLA 3REIA 2HIOA 2NZDD 1MWSA 3FKWA 1PIOA 4OQGA 5E2HA 3MGSC 4H9PA 3B6GD 3B6FA 5F82A 3LELB 5AV8A 1F66A 4EBLA 5M18A 4OQ0A 4NZ5A 2Y91A 3BFEA 3BM6A 4U3TA 4KGCC 5EPHA 4H9OA 5F1GA 5JRGA 4JXSA 2Y55A 1MWTA 3W99C 4IBBA 4R1GA 3WX7A 1P3GD 2Y4AA 1M1AD 4UPKA 3WTPB 1KGGA 3HUMA 3AFAB 1P3KD 4E3IA 3REHD 5BS7A 3REKA 5KMWA 3WRTA 5FAOA 4NETA 4GOGA 5CHJA 5E43A 3O62D 4IBGA 2EXBA 3LELA 1DJCA 5EOOA 4WU8B 3V9RA 1K6SA 4BQMA 5CPJD 2XFTA 3KFUG 1KX3D 5J8XA 3QNBA 5CERA 5AY8D 3IXBA 2Y2HA 1Y54A 3L27A 4P6BA 4C3QA 3PBNA 1IYOA 3WTPA 3IF5A 2F2AC 1LHYA 2WUQA 3GV9A 3A6NB 4GNUA 1M18D 1K56D 2G2UA 1M1AA 4DXCA 3A3IA 5FATA 3G2YA 4DKIA 2H0TA 3DWZA 4NZ4A 3S4XA 1P3KA 3TG9A 5B0ZC 4C6YA 1BH9B 3LY3A 1K57C 5DNMC 3IF6B 5B2IB 2YFWB 5B1LC 5AV9A 1EQZC 3N8LA 5AV5D 4EWFA 3UTAB 5CPIC 3LZ0B 4PM8A 1YT4A 4KZBA 3GSGA 5CECA 4YS3A 4PPRA 3C1CC 1P3PB 1KX3A 1RP5A 4RA7A 5TGFA 1Q9CA 5AY8A 5EVIC 1K4EA 4KUDB 1HQ3D 4QU3A 4LV2A 1GHIA 4JJNC 2IOUA 4UA6A 4J8UC 3VP3A 2F8ND 1IYQA 3UDIA 3OPRA 1BH9A 1M18A 1K56A 3AZKD 2XQZA 2XFSA 1FSWA 2WZZA 1TEMA 3WAAD 4WZ4A 2ZQ7A 3RXXA 3MVDD 1P3PA 5AV5A 3NY4A 2ZQ8A 4H9QB 5F99C 3UTAC 5B24B 3NQUA 4JLFA 4UA9A 3AZMB 3L2AA 4KUDA 1DJAA 4WZ5C 4E3OA 4GB7A 4XZQB 4UAAA 5DF9A 3WKJD 2NQBC 4XUZA 5CHLB 1HQ3A 2CC1A 1NYYA 3UNWA 1XKZA 2Y59A 3A1KA 4DE1A 5GLAA 1P3FC 2QPNA 3W8KA 3ZDJA 1ZLAB 4LENA 4E6WA 5AQAA 3WRZA 1CI8A 3TU4C 4EV4A 1KX4C 4J8WD 3EPHA 4JBFA 4Z2MG 3IH8A 1PZPA 2LY8A 3C1BB 5C3IB 3BEBA 4BENA 5B24A 3GTCA 3WAAA 1YQSA 3MGPC 3AZMA 3SS3A 5HAPA 3MVDA 3NBLA 1J9MA 1M19A 3HUNA 3UTBD 1KU5A 3H0RC 1ERMA 5FQMA 4DF6A 3G2ZA 3IXDA 4B4ZA 4DQYB 3KS8A 1H3OB 1U35C 4XZQC 3FKEA 1P3LC 3WKJA 2YFVA 3AZJB 1PI4A 1P3MC 3AYWD 3TSGA 5AVBC 5EECA 3AZFD 3O87A 1TDGA 1CEFA 4R8PD 5GXQB 3MBZA 1NZOA 1PWDA 5E5AD 4J8WA 1BH8B 4WU9D 2Y2MA 1NYMA 1W8QA 4F94A 2WAEA 3MZEA 4AWLB 1H3OA 4YM6B 2J7VA 3UTBA 3BECA 1NRFA 4KZ3A 4R23A 4CPKA 3AN2B 4OPRA 5B40D 4B4XA 5BNVB 1FQGA 4OJOA 4FH4A 5B31B 3MGQB 2ZC7A 4J8VC 1AOIC 3KUYD 1C3BA 3KWQB 4GDBA 4Y0OA 3GR2A 3AYWA 4JXGA 3CMZA 3C4PA 1XA1A 3ZGAB 4X55A 3X1UD 4YINA 4R8PA 1PWGA 5FAPA 2CWEA 3KS4A 5E5AA 5FI6A 3WTPE 1P3AC 5CPKC 1XGJA 4WYYA 3PAEA 4E3KA 4WU9A 3X1TC 4KQOA 5B1MB 2G2WA 1YLJA 3AN2A 3OCLA 3MGRC 3AV1B 4E6XA 1MBLA 4YM6C 1RGZA 3VH5W 5B31A 3VP1A 2X01A 3AZIC 2GDNA 1P34B 2FFFB 5B40A 4ZJ1A 3KXBC 1KE3A 2XD5A 3HVFA 2Q9MA 3HL9A 3MXSA 4DRTA 5E2FA 3AZLB 2ZC5B 4Z5TB 2RL3A 4UA7A 5DNNC 4OQHA 4RVAA 1S32C 5B0YC 1MWRA 1ES5A 3WS1A 2C5WB 4J8XC 4LV1A 4GHLA 3R45B 3FKVA 5B1MA 4DRBA 4YFMA 1BSGA 5B32D 1BULA 5B2JD 4ZUXD 2PYOB 3HLGA 4CSRB 1E3UD 4DXBA 1RCJA 3AZHD 4K91A 2EX9A 1ID3C 1NY0A 3X1VB 5FQQA 3FYZA 1ZG6A 1NXYA 2P74A 4MNRA 3X1SD 2J8YA 5B33D 3UDFA 1KE4A 5TR7A 2Y2NA 3W98C 3VMAA 1EWZA 5BT1C 5D3OA 4UUZB 5GT0D 4Z66C 3O86A 5DTKA 5AVCB 1YUEA 2JC7A 1NZUA 1K38A 4R3BA 3OCNA 3AZEB 3LJAC 2PYOA 3MNND 4E3JA 3NDGA 4CSRA 2HP6A 4LD9D 4XUJB 3QHYA 3RELB 5HL1A 5B32A 5CXWA 5B2JA 2CV5D 3EQVA 1E25A 4ZUXA 3VH6A 1FSYA 1P3BD 1S6RA 1E3UA 5GSUB 5CP6B 4XXRA 2J9OA 1R4VA 2AROC 3TOIA 5CGXA 3N6IA 1TAFB 1W79A 1PWCA 2ZC4B 3WS4A 3OC2A 4UUZA 3X1SA 4H9RA 4R3JA 3A3FA 1ERQA 1P3ID 1MY8A 5B33A 1K55A 4OH0A 1H5XA 3ZG7B 4E3MA 3ZNTA 3WA9C 3AV2B 2FFYA 4OLGA 3UN7A 4JKTA 3UE1A 3RELA 3DW0A 2HUEC 4L0LA 2FJ7C 1A7WA 2PBYA 3MNNA 4FH2A 2XK1A 3ZFZA 5GSUA 3C7VA 4LD9A 5CP6A 3Q07A 4X23B 2E8IA 1ULYA 1SCWA 2HIOD 4BD0A 2B5RA 1N1JA 2DRWA 4IBDA 3AGEA 5GT3C 5AV8D 3VOYA 3REJC 1PYYA 1F66D 4IVKA 1F1EA 4N1HA 5HAQA 5GHXA 4KGCB 1P3IA 1KVMA 5FUGB 3W96C 3UT9D 3W99B 5CRFA 3HREA 5AV6D 1LL9A 4OVDA 3UDXA 2WGVA 4DE0A 4KZ7A 1FCMA 4S2LA 4NZ1A 3AZGB 1PZOA 2RVQC 4ZBJC 3MGSA 3UE0A 4BL2A 3LELD 1PW8A 4CJNA 3AZNC 2BLSA 3PBSA 3BLMA 3IHAA 2EXAA 1P3OB 2H0YA 1IYPA 4KGCA 2ZM5A 2XR0A 1XP4A 1HVBA 1ES3A 1G68A 3WTPD 3AFAD 1KX5B 3UT9A 3EQUA 2J9PA 5AV6A 2VQRA 4RYEA 2NZDB 3REIC 1L2SA 5B0ZB 3ZVTA 2G5HC 3VP2A 4QLCC 5DNMB 4WU8D 3AZGC 1Q2PA 5FASA 5B1LB 5B31G 5AV9D 1EQZB 1ZC2A 1XPBA 4S2OA 4KHAB 1O07A 5G18A 5CPIB 1YMXA 3ZG0A 5JRGC 5M19A 4ID4A 4YS3D 3C1CB 1P3OC 4WM9A 1L0GA 5FQJA 3B3XA 5EVIB 3A6ND 1BT5A 2VGKA 4JJNB 5L2FA 3VFFA 5CTNA 1PW1A 4KZAA 5BS7C 3REKC 4J8UB 2P9VB 3AFAA 1KX5C 2I72A 4H9NB 3Q7VB 3GMWA 1K57A 1XGIA 5DNMA 5B2ID 2NZDC 5B1LA 2ZMAA 1W7FA 4KHAA 3UTAD 3B6GC 3LZ0D 4WU8A 3NIAA 3C1CA 2DNSA 1N9BA 2HPBA 3W97B 1P3PD 5F99B 1CI9A 1IEMA 3A3DA 4KUDD 4G92B 3IP4C 1P3GC 4J8UA 1M1AC 3G31A 2P9VA 5FA7A 4N9LA 1YLWA 2ZQ9A 2NQBB 4NYUA 4LG2A 3ZCZA 4NY2A 3A6NA 1BLCA 3Q7VA 4XUXA 1P3KC 4S2KA 3REHC 1P3FB 4JXWA 4MBFA 4OOYA 3O62C 3ZVWA 5B32G 3FWLA 5HARA 3TU4B 3IF6A 5B2IA 1KX4B 2YFWA 3OPHA 2WADA 4HBTA 5HAIA 4QY6A 5F99A 3UTAA 5B24D 5CPJC 3LZ0A 3HLBA 3MGPB 1KX3C 3AZMD 3L29A 3ZHHA 5AY8C 4R0QA 1I2WA 1M19D 1JWPA 1SDEA 3W97C 1JFIB 4OPZA 5A91A 2HP9A 2IWCA 3E2LA 4G92C 1M18C 1U35B 3UY6A 3H0MC 1P3LB 3MKEA 1P3MB 3VSKA 3G35A 1ZLAD 2F8NK 4IBRA 5AVBB 3B0BA 2XD1A 3IXHA 2WKHA 5BPVA 2DF4C 3UPNA 3C1BD 4IBKA 5AV5C 4OP5A 4Q8IA 2IO5C 3S1YA 3GVBA 4OKPA 4H9QA 1WYBA 3N8SA 2XLNA 1W2EA 2IWDA 4WELA 3ZG9B 4BJPA 1HQ3C 2G5IC 3PBRA 4DDYA 1U35A 4XZQA 1QMEA 3AZJD 4KZ4A 4G91C 4IBEA 3M2JA 1ES2A 3LCEA 3AZKC 3RXWA 1JVJA 3SS5A 4J8VB 4GZBA 3NI9A 1AOIB 1ESIA 1ZLAA 3W4PA 5GXQD 1MKIA 2OSUA 3NQJB 3VH5T 1PZRA 5DF7A 1FR6A 5AQ7A 3WAAC 2OV5A 1GA9A 5JYPA 1JTGA 1E4DA 3MVDC 4ZDXA 3C1BA 3L26A 1FCNA 4KZ9A 3JYIA 1P3AB 5CPKB 5CGWA 2WKIA 2Y2GA 3X1TB 5FQIA 5FQKA 4CAYB 3WKJC 5TFQA 3AN2D 3MGRB 5CGSA 2ZM8A 4KZ5A 3LZ1B 4KZ6A 5B31D 3MGQD 4J8VA 4KG5A 3AZJA 4IJEA 3D4FA 3AZIB 3KWQD 4WMCD 3KXBB 4JF4A 2WGWB 3FDDA 4P85A 3VP0A 4N92A 1K25A 1BZAA 2EX6A 5GXQA 5DNNB 1HTZA 3NDEA 1S32B 5HX9A 5B0YB 3HSHA 5KDMB 4S2PA 1BH8A 1K54C 2H10A 4J8XB 5BNXB 3LEZA 4EBPA 4CAYA 5B1MD 3UTBC 4OLDA 1WWSA 1N4OA 1W5DA 3A3EA 3AV1D 5EOEA 4YM6A 4HGAC 1W8YA 4NE3A 3AZIA 1WE4A 3KUYB 1P34D 1ID3B 4EUZA 3UPOA 3AYWC 5BNVA 3LZ1C 3AGDA 3AZFC 3MGQA 2A3UA 3AZLD 4Z5TD 4R8PC 3KWQA 2JCHA 4IBXA 4WMCA 1JWZA 1ZKJA 3BFDA 1S32A 3G30A 4FD8A 1YU4A 4MBKA 4Y0TA 3W98B 5GLCA 3VOZA 1YLPA 4WU9C 5BNXA 3C5AA 4Z66B 2WZXA 5M1AA 2PU2A 3LJAB 2EX2A 2PYOD 2Y2JA 4NZ3A 2EX8A 4GHAA 1TZYB 3AV1A 3Q82A 1B6WA 2XGNA 5B40C 4PM7A 3X1VD 2H5SA 4Y7PA 2V2FF 2Y2KA 1IKIA 5E2GA 2OLUA 1OMEA 1P34A 3KUYC 3DTMA 3WWXA 4KG6A 2AROB 4JF5A 3X1UC 2BYKB 4FSFA 5JA4B 3AZLA 3W98A 4Z5TA 4LV0A 2RIQA 1YU2A 5AVCD 1LI0A 1MXOA 1L0FA 3AZED 3OPLA 4GD8A 4Y0UA 3WA9B 3PTEA 3R45A 4EQIA 1GCEA 3HLCA 4XUJD 3RELD 3AZHB 4X69A 2HUEB 4X68A 3A1IA 2FJ7B 4H9SA 5AQBA 5AQ9A 2V20A 5CHMA 1XA7A 5GSUD 1SKFA 1TZYC 5CP6D 3MZDA 4OUIA 4FCFA 3X1VA 1CK3A 2EFXA 1IYSA 5JA4A 2R9XA 4O7DA 4IBIA 5GT0B 5GT3B 1KDSA 1Q2QA 4X56A 3REJB 5JYOA 4QY5A 4HEFA 2C6WB 5DVAA 4OJ6A 5IHVA 3B0DC 5GHZA 2Y2QA 5EVLA 3WA9A 3G4PA 5AVCA 3AV2D 3FZCA 3W96B 4S2NA 2FJ7A 5B32C 3AZEA 4WJ3C 5B2JC 3CZDA 4ZUXC 4JXVA 4KZ8A 5KZHA 1T3UA 4XUJA 3IWIA 3AZHC 3BLSA 1BUEA 4X23D 4C75A 1AXBA 4OOMA 4BD1A 4M6BA 4ZBJB 5BO0B 1FR1A 5A92A 4GD6A 3MGSD 4WZSB 3E2KA 3X1SC 3AZNB 3Q81A 1TAFA 4MBHA 5B33C 2Z2LB 1B67A 1K55C 1YM1A 4S2JA 5GLBA 5GT0C 3CJMA 4KGCD 4NK3A 3W96A 3PBOA 4QHCA 3W99D 5A90A 1IELA 4H8RA 3MNNC 3AV2A 3G34A 3OPPA 4LD9C 3LO7A 1ONGA 1IKGA 2CV5C 1VM1A 1P3BC 3REIB 2HIOB 4OONA 5BO0A 5HFOA 4QJGA 4X23A 2BG1A 4H9PB 3B6FB 1Z6FA 4QLCB 2X02A 3V50A 3IWOA 2ZC6B 3CG5A 1RGYA 1FOFA 1YU0A 3NC8A 3PAGA 1P3IC 1ONHA 5JRGB 4LCLA 2HDRA 1XX2A 1ES4A 5FUGA 4E3LA 2DCFA 3W99A 3REKB 3GRJA 3VH6W 4U0TA 2XDMA 2OLVA 4EO5C 4K0WA 3L28A 5B0ZD 1XXMA 2A49A 1SHVA 4QLCA 3AZGA 5DNMD 2HIOC 5B1LD 3B0CW 1EQZD 2VGJA 3V9RB 2XF3A 2ZQCA 3HBRA 5FI7A 3WS5A 3B6GB 5CPID 3B6FC 4WNNB 5AV8C 1F66C 3C1CD 1P3OA 1TVFA 2BYMB 2ZY5A 2X71A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I94 A;  3PBQ A;  4GDN A;  4KQO A;  2XD1 A;  4PM6 A;  5EVI D;  5CEB A;  3W4Q A;  4KG2 A;  1KDW A;  3FV7 A;  5E2E A;  3IXH A;  2WKH A;  3HLW A;  2UWX A;  4OQI A;  4WEJ A;  2G2W A;  1S0W A;  1YLJ A;  3UPN A;  3OCL A;  4DE3 A;  4E6X A;  3ZG5 A;  4OP5 A;  1MBL A;  2XEP A;  1RGZ A;  4Q8I A;  3HLD A;  3S1Y A;  1WYC A;  3VP1 A;  3M6H A;  1K6R A;  2GDN A;  2X01 A;  1BLS A;  3GVB A;  4OKP A;  2FFF B;  4ZJ1 A;  1MPL A;  1KE3 A;  1WYB A;  3LY4 A;  3N8S A;  2XD5 A;  2XLN A;  3HVF A;  4S2N C;  4KQR A;  2Q9M A;  2IWD A;  4OPY A;  4WEL A;  3HL9 A;  3ZG9 B;  4N9K A;  3MXS A;  4BJP A;  5E2F A;  1BLP A;  2ZC5 B;  2QZ6 A;  3PBR A;  4DRT A;  2HDS A;  2RL3 A;  5BOH A;  4DDY A;  3VP4 A;  3C7U A;  4UA7 A;  4OQH A;  3ITA A;  4RVA A;  1L0D A;  5FSR A;  1QME A;  2Y2L A;  5GLD A;  4KZ4 A;  1MWR A;  2QMI A;  3M2J A;  1ES5 A;  3WS1 A;  1ES2 A;  2C5W B;  3IT9 A;  3LCE A;  4M3K A;  1SDN A;  2V1Z A;  4S2I A;  3RXW A;  4LV1 A;  1JVJ A;  3M6B A;  3SS5 A;  3FKV A;  4GZB A;  3NI9 A;  1ESI A;  2HDQ A;  4YFM A;  1BSG A;  1LI9 A;  3W4P A;  1MKI A;  2OSU A;  1BUL A;  5DTS A;  5EVI A;  3V39 A;  4K0X A;  5DF7 A;  1FR6 A;  5AQ7 A;  3HLG A;  2OV5 A;  3SH8 A;  4D2O A;  1E3U D;  1GA9 A;  4OPQ A;  4DXB A;  1RCJ A;  5JYP A;  3DWK A;  1JTG A;  3IH9 A;  1E4D A;  4K91 A;  5KSC A;  2EX9 A;  4ZDX A;  3MZF A;  1O7E A;  3O3V A;  1NY0 A;  1GHP A;  1FCN A;  3C4O A;  4KZ9 A;  3JYI A;  5FQQ A;  4OOL A;  3RJU A;  5CGW A;  3FYZ A;  2WKI A;  4N1X A;  4ZJ2 A;  1VQQ A;  4QD4 A;  5DF8 A;  1ZG6 A;  1NXY A;  2Y2G A;  3WS0 A;  2P74 A;  4MNR A;  1KVL A;  5FQI A;  2XH9 A;  5FQK A;  1KGE A;  2J8Y A;  2WGI A;  2Z2M B;  5TFQ A;  3UDF A;  1KE4 A;  2R9W A;  2ZM8 A;  2Y2N A;  3IHB A;  3IXG A;  4KZ5 A;  5CGS A;  5TR7 A;  3VMA A;  1EWZ A;  4KZ6 A;  5D3O A;  1GA0 A;  1BLH A;  3BYD A;  3Q7Z A;  2ZQD A;  3SH7 A;  3O86 A;  5DTK A;  4KG5 A;  1YLY A;  2JC7 A;  1NZU A;  2WK0 A;  3D4F A;  5CED A;  1BTL A;  4WMC D;  3FKW A;  1EI5 A;  1MWS A;  1K38 A;  1PIO A;  4JF4 A;  4R3B A;  4OQG A;  3OCN A;  2WGW B;  4KEN B;  5E2H A;  1I5Q A;  4E3J A;  4PMA A;  3NDG A;  4P85 A;  5GL9 A;  2HP6 A;  5F82 A;  3VP0 A;  4WZ5 A;  4N92 A;  1K25 A;  3QHY A;  1BZA A;  2EX6 A;  3NDE A;  5HL1 A;  1HTZ A;  5CXW A;  5F83 A;  5GHY A;  5HX9 A;  4EBL A;  3EQV A;  4OQ0 A;  1E25 A;  3PBT A;  5M18 A;  1ALQ A;  2Y91 A;  1FSY A;  3BFE A;  3BM6 A;  4S2P A;  4U3T A;  1S6R A;  1E3U A;  4MLL A;  1K54 C;  2H10 A;  4P0M A;  5EPH A;  5F1G A;  4JXS A;  2Y55 A;  4WYY A;  3LEZ A;  1MWT A;  4ZAM A;  4EBP A;  3IF6 C;  1LLB A;  3N7W A;  3UE3 A;  4OLD A;  3P09 A;  2J9O A;  4XXR A;  3TOI A;  1PI5 A;  5CGX A;  4R1G A;  3N6I A;  2Y4A A;  1N4O A;  1W5D A;  3A3E A;  1W79 A;  4LV3 A;  1PWC A;  2ZC4 B;  1FCO A;  1KGG A;  5EOE A;  3WS4 A;  3HUM A;  3OC2 A;  1W8Y A;  4R3J A;  3A3F A;  3MXR A;  1ERQ A;  4E3I A;  5FAQ A;  1MY8 A;  1WE4 A;  5KMW A;  4EUZ A;  3WRT A;  5FAO A;  3UPO A;  4GKU A;  4NET A;  3S22 A;  1K55 A;  4OH0 A;  1H5X A;  4ZBE A;  3ZG7 B;  4E3M A;  3AGD A;  4GOG A;  3HUO A;  5CHJ A;  5E43 A;  3ZNT A;  3BFG A;  2A3U A;  4BLM A;  2EXB A;  1MWU A;  2FFY A;  1DJC A;  4OLG A;  5EOO A;  3UN7 A;  2JCH A;  4IBX A;  4WMC A;  1JWZ A;  4JKT A;  3UE1 A;  3ISG A;  2Y2I A;  3DW0 A;  1ZKJ A;  3BFD A;  4FD8 A;  3G30 A;  5DTT A;  4MBK A;  4L0L A;  1K6S A;  4B88 A;  4BQM A;  2PBY A;  4Y0T A;  4FH2 A;  4PM5 A;  2XK1 A;  3ZFZ A;  1M6K A;  5GLC A;  2XFT A;  3VOZ A;  2WYX A;  1YLP A;  5KSH A;  3C7V A;  5J8X A;  3QNB A;  3SH9 A;  3C5A A;  5CER A;  3IXB A;  2WZX A;  3Q07 A;  2Y2H A;  1Y54 A;  5M1A A;  4EBN A;  2E8I A;  2PU2 A;  1DY6 A;  1SCW A;  4BD0 A;  4C3Q A;  4P6B A;  3PBN A;  1IYO A;  1YLZ A;  1LHY A;  3GV9 A;  2B5R A;  2EX2 A;  2WUQ A;  3IF5 A;  2DRW A;  3OZH A;  5U47 A;  2Y2J A;  3AGE A;  4GNU A;  3IWQ A;  2EX8 A;  4GN2 A;  3VOY A;  1K56 D;  4OP8 A;  1JTD A;  2G2U A;  1PYY A;  4DXC A;  1GHM A;  3Q82 A;  2XGN A;  3A3I A;  4PM7 A;  5FAT A;  4IVK A;  3G2Y A;  4DKI A;  2H0T A;  2H5S A;  3DWZ A;  3S4X A;  5FI2 A;  4N1H A;  2V2F F;  2Y2K A;  1IKI A;  4Y7P A;  3TG9 A;  5HAQ A;  5GHX A;  5E2G A;  4C6Y A;  2OLU A;  1KVM A;  1OME A;  3LY3 A;  1K57 C;  3DTM A;  3IF6 B;  5CRF A;  3WWX A;  4IVI A;  4KG6 A;  3ITB A;  3HRE A;  4JF5 A;  1LL9 A;  4OVD A;  3UDX A;  2WGV A;  4DE0 A;  3N8L A;  4FSF A;  3W4O A;  5F1F A;  1L0E A;  4EWF A;  2Q9N A;  2ZC3 B;  3AGF A;  4KZ7 A;  4LV0 A;  4PM8 A;  1FCM A;  1YT4 A;  4S2L A;  3WS2 A;  2ZM0 A;  2JBF A;  4KZB A;  3GSG A;  5CEC A;  1LI0 A;  4PPR A;  4RX3 A;  4DE2 A;  1MXO A;  1PZO A;  1L0F A;  2HDU A;  1QMF A;  4JF6 A;  4GD8 A;  1RP5 A;  3OPL A;  4RA7 A;  5TGF A;  4Y0U A;  3V3S A;  5EVI C;  3PTE A;  3UE0 A;  1K4E A;  3M2K A;  1TDL A;  4QU3 A;  4BL2 A;  3VFH A;  4EQI A;  1PW8 A;  4LV2 A;  4CJN A;  1GHI A;  5EE8 A;  5FQ9 A;  1GCE A;  3HLC A;  2JE5 A;  2BLS A;  4X69 A;  3PBS A;  3BLM A;  3SS4 A;  3IHA A;  2ZM2 A;  4UA6 A;  4X68 A;  3VP3 A;  2EXA A;  5AQB A;  5AQ9 A;  3BRM A;  2V20 A;  5CHM A;  1IYQ A;  2H0Y A;  1IYP A;  1XA7 A;  3UDI A;  1ERO A;  1K54 A;  3MKF A;  3OPR A;  2Y2O A;  1K56 A;  5FDH A;  1SKF A;  2ZQA A;  2XQZ A;  2XR0 A;  1XP4 A;  2XFS A;  3MZD A;  1HVB A;  1FSW A;  4Z9Q A;  4FCF A;  1ES3 A;  1G68 A;  1CK3 A;  2EFX A;  4MEZ A;  2WZZ A;  1IYS A;  2R9X A;  1TEM A;  4O7D A;  3QNC A;  4U0X A;  3IQA A;  4WZ4 A;  2ZQ7 A;  3EQU A;  3Q1F A;  1KDS A;  2J9P A;  1Q2Q A;  3RXX A;  4X56 A;  5JYO A;  4QY5 A;  4HEF A;  2C6W B;  5DVA A;  3NY4 A;  4RYE A;  2ZQ8 A;  5IHV A;  4DDS A;  3MFD A;  2WAF A;  4JLF A;  1L2S A;  4UA9 A;  2Y2Q A;  5GHZ A;  5EVL A;  3A3J A;  3G4P A;  4X53 A;  3FZC A;  2ZD8 A;  3ZVT A;  4BL3 A;  1DJA A;  3G32 A;  3VP2 A;  1Q2P A;  4LCM A;  4WZ5 C;  3V3R A;  5FAS A;  4E3O A;  4GB7 A;  4S2N A;  2WGW A;  4UAA A;  5DF9 A;  1ZC2 A;  1HD8 A;  3CZD A;  4XUZ A;  1XPB A;  4S2O A;  3VSL A;  4JXV A;  2CC1 A;  4RX2 A;  4KZ8 A;  3P98 A;  5KZH A;  1NYY A;  1O07 A;  1H8Y A;  2HP5 A;  5G18 A;  3UNW A;  1YMX A;  3N8R A;  3ZG0 A;  3IWI A;  4ZTK A;  3BLS A;  1XKZ A;  3ZNY A;  2Y59 A;  1BUE A;  4DE1 A;  4C75 A;  5M19 A;  4ID4 A;  5GLA A;  1AXB A;  3HLF A;  2QPN A;  5CHU A;  4OOM A;  1YMS A;  3W8K A;  1K4F A;  3ZDJ A;  2ZLY A;  4WM9 A;  4BD1 A;  4LEN A;  1L0G A;  4E6W A;  5FQJ A;  1FR1 A;  5AQA A;  3WRZ A;  1CI8 A;  3B3X A;  5EVI B;  5A92 A;  4GD6 A;  2ZJ9 A;  4EV4 A;  3E2K A;  4P87 A;  4JBF A;  1BT5 A;  2VGK A;  3IH8 A;  5L2F A;  3VFF A;  5CTN A;  1HZO A;  1PZP A;  3Q81 A;  4MBH A;  1PW1 A;  4KZA A;  2IWB A;  2Z2L B;  4HBU A;  2P9V B;  3BEB A;  4BEN A;  3GTC A;  1M40 A;  1K55 C;  1YQS A;  2I72 A;  1YM1 A;  4S2J A;  5CTM A;  5GLB A;  3Q7V B;  3SS3 A;  3GMW A;  5HAP A;  3CJM A;  4NK3 A;  1K57 A;  3NBL A;  1J9M A;  2Y2P A;  1XGI A;  3HUN A;  3PBO A;  4QHC A;  1JWV A;  5A90 A;  5A93 A;  3N4I A;  1IEL A;  4H8R A;  2ZMA A;  1W7F A;  1ERM A;  1KGF A;  4QB8 A;  5FQM A;  4DF6 A;  3G2Z A;  3G34 A;  3IXD A;  4B4Z A;  3OPP A;  5HW3 A;  4ZJ3 A;  3LO7 A;  3I7J A;  3NIA A;  1ONG A;  1ESU A;  1U60 A;  1IKG A;  1N9B A;  2DNS A;  1PI4 A;  2EFU A;  3ZG8 B;  2HPB A;  1VM1 A;  1G6A A;  3TSG A;  2WKE A;  4OON A;  4JPM A;  5HFO A;  1CI9 A;  1IEM A;  5EEC A;  4QJG A;  2RCX A;  3A3D A;  3O87 A;  1TDG A;  2BG1 A;  1CEF A;  1Z6F A;  4WBG A;  3V50 A;  2X02 A;  3IWO A;  2ZC6 B;  3MBZ A;  4R4S A;  2P9V A;  1RGY A;  1NZO A;  3CG5 A;  3G31 A;  4N9L A;  4R4R A;  5FA7 A;  1YLW A;  2ZQ9 A;  3ZCZ A;  1PWD A;  1FOF A;  1BLC A;  3Q7V A;  1CEG A;  4X6T A;  4XUX A;  3NC8 A;  4S2K A;  5EUA A;  3PAG A;  1ONH A;  4LCL A;  2Y2M A;  3NCK A;  3O88 A;  4PM9 A;  2HDR A;  3BFC A;  4JXW A;  1NYM A;  1H8Z A;  1XX2 A;  2PU4 A;  1W8Q A;  4MBF A;  1KE0 A;  4OOY A;  4F94 A;  3GQZ A;  1ES4 A;  2WAE A;  3MZE A;  3ZVW A;  3FWL A;  5HAR A;  4E3L A;  3SOI A;  3HLE A;  2DCF A;  2J7V A;  3IF6 A;  3BEC A;  1NJ4 A;  1YLT A;  4S2M A;  4WEK A;  1NRF A;  2WAD A;  3OPH A;  4HES A;  4KZ3 A;  4E3N A;  4HBT A;  4R23 A;  5HAI A;  4CPK A;  4OPR A;  3GRJ A;  4QY6 A;  1DJB A;  4B4X A;  4U0T A;  1FQG A;  3HLB A;  2XDM A;  2OLV A;  4K0W A;  4FH4 A;  3BFF A;  3ZHH A;  1XXM A;  2A49 A;  2ZC7 A;  4R0Q A;  1I2W A;  3UPP A;  1JWP A;  1C3B A;  1SDE A;  1SHV A;  4GDB A;  4Y0O A;  3GR2 A;  4JXG A;  3CMZ A;  4OPZ A;  3C4P A;  3V5M A;  4A5R A;  1I2S A;  1XA1 A;  5A91 A;  3ZGA B;  2VGJ A;  4X55 A;  2HP9 A;  4KQQ A;  2XF3 A;  2ZQC A;  3HBR A;  4YIN A;  2IWC A;  3E2L A;  5FI7 A;  3WS5 A;  1PWG A;  3UO9 A;  5FAP A;  3UY6 A;  3MKE A;  1ZG4 A;  1TVF A;  4IED A;  3VSK A;  3G35 A;  5FI6 A;  1LL5 A;  4UHU A;  2X71 A;  1XGJ A;  3PAE A;  4IBR A;  4E3K A; 
#chains in the Genus database with same CATH topology
 3CUE C;  3PBQ A;  4GDN A;  5EVI D;  3F1O B;  1XFQ A;  4KG2 A;  1KDW A;  5E2E A;  5IS1 A;  1N9N A;  3HLW A;  3UT9 C;  4JJN D;  1VEU A;  4OQI A;  4IJF A;  2QJ7 A;  2A24 A;  4WEJ A;  5AV6 C;  5EFW A;  3W2Z A;  1S0W A;  3WD3 A;  1P3G B;  1M1A B;  4J8U D;  1KX5 A;  1S66 L;  1P3K B;  1WYC A;  3KYQ A;  3REH B;  3M6H A;  1BLS A;  4EEU A;  2NZD A;  1MPL A;  5AV9 B;  1OTI A;  1HTA A;  1LSW A;  4IJG A;  4OPY A;  5B0Z A;  3O62 B;  4N9K A;  2K7S A;  3B6G A;  2QZ6 A;  2HDS A;  4WNN A;  3LEL C;  5BOH A;  3VP4 A;  3C7U A;  3ITA A;  1EQZ A;  5FSR A;  2W1T B;  2VA0 A;  5GLD A;  4YS3 B;  3W97 D;  2VKS A;  5MC7 A;  2BYM A;  5F99 D;  5CPJ B;  5CPI A;  1T1C A;  1KX3 B;  2V1Z A;  4MB4 A;  5AY8 B;  2HDQ A;  3SZT A;  1P3G A;  5DTS A;  4WLA A;  2NQB D;  5EVI A;  3WTP C;  4K0X A;  3AFA C;  4IBF A;  4QNL A;  3MQQ A;  4Q0J A;  2ZY2 A;  4JJN A;  2ZY4 A;  4OPQ A;  3REH A;  1M18 B;  1G28 A;  3IH9 A;  5KSC A;  3MZF A;  1P3F D;  3O3V A;  1PFL A;  1W1V A;  4H9N A;  1H0G A;  4OOL A;  3RJU A;  2JKT M;  4O8G A;  3O62 A;  1VQQ A;  4QD4 A;  5DF8 A;  3KSY A;  3TU4 D;  1TS7 A;  1KVL A;  1KX4 D;  4BWI A;  4WU8 C;  1KGE A;  5AV9 C;  3HCY A;  2HV1 A;  3H82 A;  1DP8 A;  2R9W A;  3IHB A;  5AV5 B;  5CPJ A;  3MGP D;  3NQU B;  1BLH A;  2ZQD A;  2IO5 B;  4YWZ A;  4R38 A;  4E44 A;  2WK0 A;  3W97 A;  4YS3 C;  2JHE A;  1BFM A;  1EI5 A;  1Z09 A;  4KEN B;  1I5Q A;  3D3O A;  3A6N C;  1HQ3 B;  1WWI A;  4PMA A;  2V0U A;  5GL9 A;  4WZ5 A;  1U35 D;  4GH9 A;  1OT9 A;  5F83 A;  4XZQ D;  3NOU C;  1P3L D;  5GHY A;  2NQB A;  1P3M D;  3PBT A;  3F6T A;  4G91 B;  2F8N B;  1ALQ A;  4MLL A;  2W8S A;  5AVB D;  4P0M A;  1D1J A;  3AZK B;  4Z2L A;  1P3F A;  3H9W A;  4ZAM A;  3IF6 C;  5B2I C;  1LLB A;  3N7W A;  3UE3 A;  5K5B A;  3P09 A;  1PI5 A;  3P5J B;  4IBJ A;  3A0R A;  1WA9 A;  4LV3 A;  2XSS A;  3TU4 A;  1FCO A;  1KX4 A;  3LZ0 C;  3WAA B;  1NLY A;  3ZYT A;  3U2A A;  3MXR A;  4JGO A;  5FAQ A;  3MVD B;  1M19 B;  1P3P C;  3P7N A;  4GKU A;  3S22 A;  4ZBE A;  3MGP A;  3ICY A;  3HUO A;  3BFG A;  4GLQ A;  2EA9 A;  4KUD C;  4BLM A;  1MWU A;  1L6J A;  1MKM A;  1JFI A;  3M7P A;  3ISG A;  2Y2I A;  2LB5 A;  5DTT A;  3WKJ B;  2F8N A;  2V8C A;  2YFV B;  4B88 A;  4ESP A;  4PM5 A;  1M6K A;  3VH5 A;  2WYX A;  4DMZ A;  5KSH A;  4CLC B;  3AZK A;  3SH9 A;  1OJG A;  3V67 A;  1XJ6 A;  1P3L A;  4J8V D;  1P3M A;  1AOI D;  3CPT B;  4EBN A;  1DY6 A;  4OJP A;  4LFU A;  5AVB A;  4DRA A;  1YLZ A;  3OZH A;  5U47 A;  4J8W B;  1KS0 A;  3IWQ A;  2F8N H;  3CHW P;  4GN2 A;  1PNE A;  4OP8 A;  1JTD A;  1GHM A;  4WV4 B;  5L8M A;  5HDS A;  5B24 C;  2M7U A;  1P3A D;  5CPK D;  3C8C A;  2ACG A;  5FI2 A;  3AZM C;  3BQ8 A;  3X1T D;  1JNU A;  1M19 C;  5F69 A;  3UTB B;  3T4T A;  4IVI A;  3ITB A;  1Z2C B;  3T4L A;  1MZU A;  5F1F A;  3MGR D;  3W4O A;  3UE6 A;  1L0E A;  2Q9N A;  3LZ1 D;  2ZC3 B;  3AGF A;  4YM6 D;  4HGA B;  3WS2 A;  2ZM0 A;  2JBF A;  4Z1W A;  3CPT A;  3AZI D;  4RX3 A;  4DE2 A;  1YKD A;  3LR3 A;  1ZLA C;  3KXB D;  2W3D A;  3AYW B;  2HDU A;  1QMF A;  4JF6 A;  1H8P A;  3V3S A;  3AZF B;  2PD8 A;  3M2K A;  5CX7 A;  1STZ A;  1TDL A;  3T50 A;  3VFH A;  1AOI A;  5F5Y A;  4R8P B;  4NE5 A;  4PKY G;  5A8B A;  5EE8 A;  5FQ9 A;  3S7N A;  2JE5 A;  3SS4 A;  5DNN D;  2ZM2 A;  3NQJ A;  1S32 D;  5B0Y D;  1P9W A;  3C1B C;  5C3I C;  3N3F A;  3BRM A;  3P01 A;  4OJL A;  5E5A B;  5DKL A;  1ERO A;  3DAV A;  1K54 A;  4J8W C;  3MKF A;  2Y2O A;  4J8X D;  5FDH A;  4WU9 B;  2J3T D;  2ZQA A;  2GZA A;  4NXF A;  4ETZ A;  4Z9Q A;  3T4K A;  1P3A A;  5CPK A;  4MEZ A;  3X1T A;  1BYW A;  2ZY3 A;  3QNC A;  4U0X A;  1OGB A;  2FZ0 A;  3IQA A;  3Q1F A;  3L25 A;  3T1R A;  3EGX C;  3AZJ C;  3MGR A;  1ID3 D;  3LZ1 A;  5B40 B;  4DDS A;  3MFD A;  2WAF A;  3AZF A;  3A3J A;  4X53 A;  3NEC A;  2ZD8 A;  4BL3 A;  3G32 A;  2M7V A;  3EG5 B;  1XFN A;  4LCM A;  3KXB A;  3V3R A;  5GXQ C;  2WGW A;  1S1Z A;  2L1M A;  3X1U B;  1HD8 A;  3U4L P;  1N9L A;  3VSL A;  4BBU A;  4RX2 A;  3W98 D;  1VET A;  3P98 A;  5BT1 D;  2HP5 A;  1H8Y A;  3N8R A;  5DJT A;  5DNN A;  4ZTK A;  4Z66 D;  3ZNY A;  5B0Y A;  2Z6D A;  3HLF A;  1P9R A;  5CHU A;  5KDM A;  1YMS A;  1K4F A;  4HY8 A;  4OJ5 A;  2GJ3 A;  5E5A C;  3LEQ A;  2ZLY A;  1ACF A;  1UWP X;  4J8X A;  4AWL C;  4NE6 A;  3LJA D;  4ETX A;  1IOU A;  1YSP A;  2ZJ9 A;  5HPI A;  4P87 A;  2QHK A;  4UHU A;  4E45 A;  5IU1 A;  1HZO A;  1TZY D;  2IWB A;  3AN2 C;  4HBU A;  1M40 A;  5CTM A;  4IBC A;  2NUT C;  5B31 C;  3MGQ C;  2DQN C;  2Y2P A;  3KUY A;  1ID3 A;  1S4S A;  3KWQ C;  1JWV A;  2O0Y A;  5J3W A;  2ARO D;  3N4I A;  5A93 A;  3E98 A;  3X1U A;  1K0K A;  1DRM A;  1KGF A;  4QB8 A;  4DJ2 A;  4I39 A;  5HW3 A;  4ZJ3 A;  3I7J A;  5FDS A;  1ESU A;  1U60 A;  2EFU A;  2E8J A;  3ZG8 B;  1G6A A;  3B0D B;  2WKE A;  2VV6 A;  4JPM A;  4UQI S;  4Z66 A;  3WA9 D;  2RCX A;  1H0I A;  3H0L C;  5B1M C;  4WBG A;  4NEE D;  3K3C A;  3LIB A;  4R4S A;  5B32 B;  4R4R A;  3LJA A;  3AV1 C;  2FJ7 D;  5B2J B;  3NUL A;  4EQ1 A;  4ZUX B;  4BMW A;  1CEG A;  4X6T A;  3UB8 A;  3LFV A;  4EET B;  5EUA A;  1TZY A;  4HJ6 A;  1P34 C;  2VLG A;  3NCK A;  3O88 A;  4PM9 A;  3BFC A;  1H8Z A;  2PU4 A;  2Z6C A;  1KE0 A;  4NFT A;  3GQZ A;  3PXP A;  3AZL C;  3HON A;  4Z5T C;  3SOI A;  1F5M A;  3HLE A;  1YLT A;  1DP6 A;  1NJ4 A;  5GT3 D;  3X1S B;  1YU3 A;  2ARO A;  4H9R B;  4S2M A;  4HES A;  4WEK A;  1QO6 A;  4E3N A;  3REJ D;  3EPL A;  2BYK A;  2J8P A;  5B33 B;  2CMN A;  1DJB A;  4NXG A;  2AVX A;  3BFF A;  1GSW A;  2PR6 A;  2JKR I;  3UPP A;  3W96 D;  3V5M A;  4A5R A;  1I2S A;  1UR9 A;  5DJU A;  3AL0 C;  4KQQ A;  2PDR A;  4H9S C;  3MNN B;  2PYO C;  3HJI A;  3IX4 A;  3EPJ A;  3AZH A;  1UGU A;  3UO9 A;  4LD9 B;  3KO6 A;  1ZG4 A;  2CV5 B;  4IED A;  3X1V C;  1LL5 A;  1P3B B;  5G49 B;  4WF0 A;  3V39 A;  2RVQ D;  5I94 A;  4PM6 A;  5CEB A;  1N1J B;  3W4Q A;  2F8N G;  1T1A A;  3FV7 A;  3CAX A;  4FTX A;  2KOI A;  3AZN D;  2UWX A;  3VH6 T;  4DE3 A;  3ZG5 A;  5AJG A;  2XEP A;  5GT0 A;  5GT3 A;  3HLD A;  3NOT C;  5AVC C;  3B0C T;  3REJ A;  1P3I B;  3ULF A;  1K6R A;  3T4J A;  3WD0 A;  3LY4 A;  4EER A;  4S2N C;  3AZE C;  4KQR A;  4CLC E;  1BLP A;  4XUJ C;  3REL C;  1L0D A;  4NYY A;  2CV5 A;  2Y2L A;  5G49 A;  1P3B A;  2QMI A;  3WD1 A;  3REI D;  3IT9 A;  4M3K A;  1SDN A;  5GSU C;  4S2I A;  4EO5 B;  1V9Z A;  3M6B A;  3MGS B;  5CP6 C;  2PRF A;  3B6F D;  2L5A A;  3PR6 A;  4QLC D;  3AZG D;  1LI9 A;  4GS9 B;  1YU1 A;  3EPK A;  1OTB A;  4EEP A;  3SH8 A;  3AZN A;  4GHI B;  4D2O A;  5HD3 A;  5FEG A;  4B9O A;  5AV8 B;  3DWK A;  4EES A;  5JRG D;  4Z2M H;  1F66 B;  1O7E A;  4Y5F A;  1P3O D;  1GHP A;  3C4O A;  4N1X A;  3R7W A;  4ZJ2 A;  2ZBB A;  3AV2 C;  4H9O B;  3WS0 A;  2XH9 A;  3UT9 B;  2WGI A;  5AV6 B;  2Z2M B;  3REK D;  2JSS A;  4I3I A;  3IXG A;  1KX5 D;  1GA0 A;  3BYD A;  3Q7Z A;  3NJA A;  3SH7 A;  4X23 C;  1YLY A;  2W3G A;  5CED A;  4DN0 A;  1BTL A;  3LIF A;  3REI A;  2HIO A;  2NZD D;  1MWS A;  3FKW A;  4HH2 A;  5I5L A;  1PIO A;  2W3H A;  4OQG A;  3VOL A;  2B18 A;  5E2H A;  4F3L A;  3MGS C;  1J7M A;  4H9P A;  3B6G D;  3B6F A;  3FPW A;  3GEC A;  3LEL B;  1AIW A;  5F82 A;  5AV8 A;  1F66 A;  4IHQ A;  2W1R A;  4MMN A;  2QJ5 A;  4EBL A;  5M18 A;  1OGG A;  4OQ0 A;  5EM1 A;  3H7W B;  3VE3 A;  4NZ5 A;  2Y91 A;  3BFE A;  3BM6 A;  4U3T A;  3CUE A;  4KGC C;  5EPH A;  4H9O A;  5F1G A;  5JRG A;  4JXS A;  2Y55 A;  1MWT A;  1CF0 A;  3W99 C;  2ZMV A;  3CIT A;  2HGV A;  4IBB A;  2D02 A;  4R1G A;  1LL8 A;  3WX7 A;  2B95 A;  1P3G D;  2Y4A A;  1M1A D;  4WL9 A;  3FG8 A;  4UPK A;  3DTK A;  3WTP B;  1KGG A;  3HUM A;  3AFA B;  1P3K D;  4E3I A;  3REH D;  1D7E A;  5BS7 A;  3REK A;  5KMW A;  3WRT A;  5FAO A;  4ARZ B;  4G3K A;  4NET A;  2KDK A;  4GOG A;  5CHJ A;  5E43 A;  3O62 D;  4EUV A;  4IBG A;  2EXB A;  3LEL A;  1DJC A;  2P08 A;  5EOO A;  4O01 A;  3CI6 A;  4WU8 B;  1CJF A;  2ZOH A;  3V9R A;  1K6S A;  4BQM A;  1D06 A;  5CPJ D;  2XFT A;  3KFU G;  1KX3 D;  3VV4 A;  5J8X A;  3QNB A;  5CER A;  5AY8 D;  3IXB A;  2Y2H A;  1Y54 A;  1E6P A;  3L27 A;  4P6B A;  4C3Q A;  3PBN A;  1IYO A;  3WTP A;  2F2A C;  1LHY A;  2WUQ A;  3F1O A;  3GV9 A;  3IF5 A;  2FN2 A;  3QP8 A;  3QP4 A;  5TBM B;  3A6N B;  4GNU A;  3KX0 X;  1M18 D;  1K56 D;  2G2U A;  1OJ5 A;  2BTF P;  1M1A A;  4DXC A;  2YKH A;  3A3I A;  3T4Q A;  5FAT A;  3G2Y A;  4DKI A;  2H0T A;  3DWZ A;  4NZ4 A;  2HJE A;  3S4X A;  3S7O A;  1P3K A;  3TG9 A;  5B0Z C;  4C6Y A;  1BH9 B;  3LY3 A;  1K57 C;  2IA2 A;  5DNM C;  3NOP C;  3IF6 B;  5B2I B;  1UR8 A;  2YFW B;  2W3F A;  5B1L C;  5AV9 A;  1T1B A;  1EQZ C;  4HP4 A;  3N8L A;  3SW1 A;  5AV5 D;  4EWF A;  1TS8 A;  3UTA B;  3KSI A;  5CPI C;  4NKP A;  3LZ0 B;  4PM8 A;  1YT4 A;  2W1T A;  4KZB A;  3GSG A;  5CEC A;  4YS3 A;  2B02 A;  4PPR A;  3C1C C;  1SKO B;  2R78 A;  1P3P B;  1KX3 A;  1RP5 A;  4RA7 A;  5TGF A;  1Q9C A;  5AY8 A;  3B42 A;  5EVI C;  1K4E A;  4KUD B;  1HQ3 D;  4QU3 A;  5EV0 A;  4LV2 A;  5LBR A;  1GHI A;  4JJN C;  4WN5 A;  2G7U A;  2IOU A;  1UWN X;  4UA6 A;  4YOF A;  4J8U C;  3VP3 A;  2F8N D;  1IYQ A;  3UDI A;  2OAP 1;  3OPR A;  4IUK A;  1BH9 A;  1M18 A;  1K56 A;  3AZK D;  2QYB A;  2V1B A;  2XQZ A;  2XFS A;  3C2W A;  1YPR A;  1FSW A;  4KQD A;  1OTA A;  2WZZ A;  1TEM A;  5KIZ A;  3WAA D;  1ZHH B;  4WZ4 A;  1OPX A;  2ZQ7 A;  3RXX A;  3MVD D;  1SKO A;  1P3P A;  5AV5 A;  3NY4 A;  2ZQ8 A;  4H9Q B;  5F99 C;  3UTA C;  5B24 B;  3NQU A;  4JLF A;  4UA9 A;  3AZM B;  3L2A A;  4X25 A;  4KUD A;  2VK3 A;  3RFB A;  1DJA A;  4WZ5 C;  3S7P A;  4E3O A;  4GB7 A;  4XZQ B;  4UAA A;  4EXO A;  5DF9 A;  5HD5 A;  3WKJ D;  2XRN A;  2NQB C;  4XUZ A;  5CHL B;  1HQ3 A;  2CC1 A;  3LIC A;  3MJQ A;  1NYY A;  4JGP A;  3UNW A;  4CLC D;  4MDZ A;  1XKZ A;  2Y59 A;  3A1K A;  4DE1 A;  1EAK A;  3UB9 A;  5GLA A;  2L4R A;  1P3F C;  2QPN A;  3W8K A;  4KUK A;  3ZDJ A;  1ZLA B;  4LEN A;  3QP2 A;  4E6W A;  2YKF A;  5AQA A;  3WRZ A;  1CI8 A;  1ED7 A;  3TU4 C;  4EV4 A;  1KX4 C;  4J8W D;  3EPH A;  4JBF A;  4QPR A;  4Z2M G;  3IH8 A;  4CQH A;  1PZP A;  1LSV A;  3UB5 P;  3MR0 A;  2LY8 A;  3L7H A;  3KSH A;  3C1B B;  3OOV A;  5C3I B;  3BEB A;  4BEN A;  5B24 A;  5J7E A;  3GTC A;  3WAA A;  1YQS A;  3MGP C;  3AZM A;  3SS3 A;  5HAP A;  4Z2H A;  1OT6 A;  3MVD A;  3NBL A;  1J9M A;  1M19 A;  3HUN A;  3S7Q A;  5FEF A;  3UTB D;  2WKP A;  5L07 A;  1KU5 A;  1TD5 A;  4HJ4 A;  3H0R C;  4AFI A;  1ERM A;  5FQM A;  4HOI A;  4DF6 A;  3G2Z A;  2ZOI A;  3HJK A;  3IXD A;  4B4Z A;  4DQY B;  3KS8 A;  1H3O B;  1U35 C;  4XZQ C;  3FKE A;  1P3L C;  3WKJ A;  2YFV A;  4K08 A;  3AZJ B;  1PI4 A;  1P3M C;  3AYW D;  3TSG A;  1E15 A;  4CLC A;  5AVB C;  1AWI A;  5EEC A;  3AZF D;  3O87 A;  1TDG A;  1CEF A;  4R8P D;  2L0W A;  4YNR A;  5GXQ B;  3MBZ A;  1NZO A;  1PWD A;  2PT7 A;  3EOI A;  5E5A D;  4J8W A;  1BH8 B;  5HWT A;  4WU9 D;  2Y2M A;  5F68 A;  1NYM A;  1W8Q A;  4F94 A;  1CQA A;  2WAE A;  4AWL B;  3MZE A;  1H3O A;  4YM6 B;  2J7V A;  3UTB A;  3BEC A;  1X0O A;  1NRF A;  2EWV A;  4KZ3 A;  4R23 A;  4CPK A;  3AN2 B;  3WD4 A;  4OPR A;  5B40 D;  4B4X A;  5BNV B;  1FQG A;  4OJO A;  4FH4 A;  5B31 B;  3MGQ B;  2ZC7 A;  4J8V C;  1AOI C;  3KUY D;  1C3B A;  3KWQ B;  3JVV A;  4GDB A;  4Y0O A;  3GR2 A;  3AYW A;  4JXG A;  3CMZ A;  3C4P A;  1XA1 A;  3ZGA B;  4X55 A;  3X1U D;  4YIN A;  4R8P A;  1PWG A;  3UMD A;  5FAP A;  2CWE A;  2O99 A;  3KS4 A;  5E5A A;  5FI6 A;  3WTP E;  1P3A C;  5CPK C;  1XGJ A;  4WYY A;  1F9I A;  3PAE A;  4E3K A;  3UB6 A;  4WU9 A;  3X1T C;  4KQO A;  4LRZ E;  5B1M B;  4HI4 A;  2ZL1 B;  2O9B A;  3MXQ A;  1W1P A;  2G2W A;  2UV0 E;  1YLJ A;  3AN2 A;  3OCL A;  3MGR C;  3AV1 B;  4E6X A;  4Y2F A;  1MBL A;  4H6J B;  4YM6 C;  1RGZ A;  3VH5 W;  5B31 A;  3UME A;  3VP1 A;  2X01 A;  3AZI C;  2GDN A;  1P34 B;  2FFF B;  5B40 A;  4LPZ A;  4UQI M;  4ZJ1 A;  3KXB C;  1KE3 A;  4HNB A;  2XD5 A;  3HVF A;  4Z2I A;  2Q9M A;  1NLZ A;  3HL9 A;  3MXS A;  4DRT A;  5E2F A;  3AZL B;  2ZC5 B;  4Z5T B;  1GOI A;  2RL3 A;  4UA7 A;  4D60 A;  5DNN C;  4OQH A;  4RVA A;  1S32 C;  3EEA A;  5B0Y C;  3BY9 A;  1MWR A;  4M4X A;  1ES5 A;  3WS1 A;  1TS6 A;  2C5W B;  4J8X C;  3FPV A;  2J3T C;  4LV1 A;  4GHL A;  1W1Y A;  4QWO A;  3R45 B;  3FKV A;  5B1M A;  4DRB A;  4YFM A;  1BSG A;  4MN5 A;  5B32 D;  2HZ5 A;  3T1S A;  1BUL A;  5B2J D;  2V8F A;  3FC7 A;  1O6I A;  4ZUX D;  2PYO B;  4Y3I A;  3E4P A;  3HLG A;  4CSR B;  1E3U D;  4DXB A;  1RCJ A;  3AZH D;  1N9O A;  4K91 A;  2EX9 A;  1ID3 C;  1H0M A;  3T12 B;  1NY0 A;  3X1V B;  5FQQ A;  3FYZ A;  3IBR A;  1ZG6 A;  1NXY A;  2P74 A;  4MNR A;  2HJ9 C;  3MS6 A;  3X1S D;  2J8Y A;  1P97 A;  5B33 D;  3UDF A;  1KE4 A;  4UEY A;  5TR7 A;  2Y2N A;  3W98 C;  3VMA A;  1EWZ A;  5BT1 C;  5D3O A;  4UUZ B;  5GT0 D;  5IT5 A;  4Z66 C;  3O86 A;  4PHT A;  5DTK A;  5AVC B;  4P6Z S;  1YUE A;  2JC7 A;  1NZU A;  2QWS A;  2M1C A;  1K38 A;  4R3B A;  3OCN A;  3AZE B;  3LJA C;  5HDD A;  2PYO A;  3MNN D;  4E3J A;  3NDG A;  4CSR A;  3LR0 A;  2HP6 A;  1EW0 A;  4LD9 D;  4XUJ B;  3QHY A;  3REL B;  5HL1 A;  5B32 A;  5CXW A;  4EU0 A;  5B2J A;  2CV5 D;  3EQV A;  1E25 A;  4ZUX A;  4XT2 B;  4R70 A;  3VH6 A;  1FSY A;  1P3B D;  1VB6 A;  3JVU A;  1S6R A;  1E3U A;  5GSU B;  5CP6 B;  3BY8 A;  4FUW A;  4XXR A;  2J9O A;  1R4V A;  2ARO C;  3TOI A;  5CGX A;  3N6I A;  1TAF B;  4L9G A;  1W79 A;  2H28 A;  1PWC A;  2ZC4 B;  1Y28 A;  3WS4 A;  3OC2 A;  4UUZ A;  2EWW A;  4Q0I A;  3X1S A;  4H9R A;  3IX3 A;  4R3J A;  3A3F A;  4Y13 A;  1ERQ A;  1P3I D;  1MY8 A;  5B33 A;  3LIE A;  3A0S A;  4NXB A;  1K55 A;  4OH0 A;  1H5X A;  3ZG7 B;  4E3M A;  1E6N A;  3ZNT A;  3T1X A;  3WA9 C;  3AV2 B;  3OBF A;  2FFY A;  4OLG A;  3UN7 A;  4JKT A;  3UE1 A;  3REL A;  3DW0 A;  1GPF A;  2HUE C;  4L0L A;  2FJ7 C;  2JKT I;  4XT2 A;  1A7W A;  2PBY A;  3MNN A;  4FH2 A;  2XK1 A;  3ZFZ A;  5GSU A;  3C7V A;  4LD9 A;  3MMH A;  5CP6 A;  1XJ3 A;  3Q07 A;  4X23 B;  2E8I A;  1ULY A;  1SCW A;  2HIO D;  4BD0 A;  2B5R A;  1N1J A;  2DRW A;  3DBA A;  4MCW A;  2V5O A;  4IBD A;  3AGE A;  4TX8 A;  5GT3 C;  2MJ6 A;  5AV8 D;  2LB9 A;  3MFX A;  4GCZ A;  4GJ4 A;  3VOY A;  3REJ C;  1PYY A;  1F66 D;  3F1N B;  3ZQ5 A;  5F6A A;  4IVK A;  1F1E A;  4HMC A;  4N1H A;  2GX5 A;  5HAQ A;  5GHX A;  4KGC B;  1P3I A;  1KVM A;  5EVE A;  5FUG B;  1L3L A;  3W96 C;  3UT9 D;  3W99 B;  5CRF A;  2O9C A;  4LRY C;  3HRE A;  5AV6 D;  1LL9 A;  4OVD A;  4ZRR A;  2WGV A;  3UDX A;  4DE0 A;  1SZV A;  5HDC A;  4FOF A;  5HPF A;  4KZ7 A;  1ODV A;  3BJN A;  1FCM A;  4S2L A;  4NZ1 A;  2PBD P;  3MQ0 A;  3AZG B;  1PZO A;  2WKR A;  2RVQ C;  5HZH A;  4LRX C;  4ZBJ C;  1LSX A;  5J4E A;  3GDI A;  2W0N A;  3MGS A;  3UE0 A;  4BL2 A;  3B33 A;  3LEL D;  1PW8 A;  5L10 A;  4CJN A;  3AZN C;  5G4Z A;  4GS9 A;  2BLS A;  3PBS A;  3BLM A;  3IHA A;  3IX8 A;  2J80 A;  3F1P B;  2EXA A;  1P3O B;  1PRQ A;  2H0Y A;  4HIA A;  1IYP A;  4GHI A;  4KGC A;  2ZM5 A;  2XR0 A;  1XP4 A;  2PYP A;  1HVB A;  1E6Z A;  1ES3 A;  1G68 A;  1VEU B;  3WTP D;  3AFA D;  1KX5 B;  1KOU A;  3UT9 A;  3EQU A;  2J9P A;  5AV6 A;  3UB7 A;  1IFQ A;  2VQR A;  4RYE A;  2NZD B;  3REI C;  1L2S A;  2DMW A;  5B0Z B;  3T1Q B;  2D49 A;  3ZVT A;  2G5H C;  3VP2 A;  4QLC C;  5DNM B;  4WU8 D;  3AZG C;  4Z2J A;  1Q2P A;  5FAS A;  5B1L B;  1MC0 A;  5B31 G;  5AV9 D;  1EQZ B;  3F1P A;  1A0K A;  3KYZ A;  1ZC2 A;  1XPB A;  4S2O A;  4KHA B;  1O07 A;  5G18 A;  5CPI B;  4LLO B;  1YMX A;  3ZG0 A;  5JRG C;  5M19 A;  4ID4 A;  4YS3 D;  3C1C B;  3H7W A;  1P3O C;  4WM9 A;  1FIL A;  1GSV A;  1L0G A;  5FQJ A;  3B3X A;  5EVI B;  3A6N D;  1S4R A;  1BT5 A;  2VGK A;  4JJN B;  5L2F A;  3VFF A;  5CTN A;  2JKR M;  1PW1 A;  4KZA A;  5BS7 C;  3REK C;  4J8U B;  2P9V B;  2GNX A;  3AFA A;  1KX5 C;  2I72 A;  4H9N B;  4HH3 A;  3IS2 B;  3Q7V B;  3GMW A;  1K57 A;  1XGI A;  5DNM A;  5B2I D;  4ARZ A;  2NZD C;  5B1L A;  2OWH A;  3E4O A;  2ZMA A;  3H82 B;  1W7F A;  2PD7 A;  1G5U A;  4KHA A;  2HF6 A;  4GW9 A;  3UTA D;  3B6G C;  3LZ0 D;  4WU8 A;  3E4Q A;  1H3Q A;  3NIA A;  3C1C A;  2DNS A;  1N9B A;  4Y15 A;  1DP9 A;  2HPB A;  3W97 B;  2VJW A;  1P3P D;  3PYP A;  5F99 B;  4PAU A;  3R4K A;  1CI9 A;  1IEM A;  3A3D A;  2OWJ A;  4KUD D;  1TS0 A;  4G92 B;  2BAS A;  3IP4 C;  4MB5 A;  1P3G C;  4J8U A;  1M1A C;  2P9V A;  3G31 A;  4HJ3 A;  4N9L A;  5FA7 A;  1YLW A;  2ZQ9 A;  2NQB B;  4NYU A;  4LG2 A;  3ZCZ A;  5TBM A;  4NY2 A;  3A6N A;  1BLC A;  3IS2 A;  3Q7V A;  4XUX A;  1P3K C;  4S2K A;  3MQL A;  3REH C;  3RH8 B;  1Y4O A;  1P3F B;  4JXW A;  1F2K A;  1VHM A;  4MN6 A;  3DTI A;  3L9K A;  4MBF A;  4OOY A;  3TRC A;  3O62 C;  3ZVW A;  5B32 G;  1HLU P;  3FWL A;  3QP5 A;  5HAR A;  3TU4 B;  1KX4 B;  5B2I A;  2I9V A;  3IF6 A;  2YFW A;  3OPH A;  2WAD A;  4HBT A;  5HAI A;  4QY6 A;  5F99 A;  3UTA A;  4HME A;  4X1L A;  5B24 D;  5CPJ C;  3LZ0 A;  3HLB A;  3MGP B;  1KX3 C;  3AZM D;  3L29 A;  1XJ2 A;  3ZHH A;  5AY8 C;  1GXD A;  4R0Q A;  1I2W A;  1NRJ A;  1M19 D;  1JWP A;  1SDE A;  3TW8 A;  3W97 C;  2PYR A;  1JFI B;  4OPZ A;  3B47 A;  5A91 A;  2HP9 A;  2P04 A;  5DKK A;  5HWW A;  2IWC A;  2Y79 A;  3E2L A;  4G92 C;  1M18 C;  1U35 B;  3UY6 A;  3H0M C;  1G6O A;  3D72 A;  2XRO A;  1P3L B;  3MKE A;  3WD2 A;  1P3M B;  4KUO A;  3VSK A;  3G35 A;  1ZLA D;  2F8N K;  4IBR A;  5AVB B;  3B0B A;  2XD1 A;  4HQA A;  5HL6 A;  2VEA A;  3IXH A;  2WKH A;  5BPV A;  3QP6 A;  2WKQ A;  1OTE A;  2DF4 C;  4BBV A;  3UPN A;  3MF0 A;  3C1B D;  4IBK A;  5AV5 C;  2JN7 A;  4L9F A;  4OP5 A;  2OOL A;  3NHQ A;  4Q8I A;  2D01 A;  3T4S A;  3MQO A;  2IO5 C;  3S1Y A;  3K3D A;  3GVB A;  4OKP A;  4H9Q A;  1WYB A;  3N8S A;  2J3W A;  2XLN A;  1W2E A;  2IWD A;  4WEL A;  3ZG9 B;  2RTS A;  4BJP A;  1HQ3 C;  2G5I C;  3PBR A;  2QKP A;  4DDY A;  4B93 A;  3E0Y A;  1U35 A;  4XZQ A;  3LI8 A;  1QME A;  3AZJ D;  4KZ4 A;  4G91 C;  4IBE A;  3M2J A;  1ES2 A;  1FIK A;  3LCE A;  3AZK C;  3RXW A;  1JVJ A;  3SS5 A;  4ME4 A;  4J8V B;  4GZB A;  3NI9 A;  1AOI B;  1ESI A;  1ZLA A;  3W4P A;  5GXQ D;  1MKI A;  2OSU A;  3NQJ B;  3VH5 T;  1PZR A;  5C5K A;  5DF7 A;  4HMD A;  1FR6 A;  5AQ7 A;  3WAA C;  4Q0H A;  2OV5 A;  1GA9 A;  5JYP A;  1JTG A;  1E4D A;  3MVD C;  4ZDX A;  3C1B A;  3L26 A;  3LI9 A;  2JKF A;  4LGW A;  3KSG A;  1FCN A;  4KZ9 A;  3JYI A;  1P3A B;  3K2N A;  5CPK B;  4G3V A;  5CGW A;  2WKI A;  1ZTU A;  2Y2G A;  3X1T B;  2W27 A;  5FQI A;  5FQK A;  4CAY B;  1T19 A;  2VGL M;  3WKJ C;  5TFQ A;  3AN2 D;  3MGR B;  5EM0 A;  5CGS A;  2ZM8 A;  4KZ5 A;  3LZ1 B;  4KZ6 A;  4CLC C;  1W1T A;  5B31 D;  3MGQ D;  4J8V A;  4KG5 A;  2VZW A;  3AZJ A;  4IJE A;  3D4F A;  3AZI B;  3KWQ D;  4WMC D;  4O0P A;  4X1M A;  3KXB B;  4JF4 A;  1E88 A;  2V1A A;  3G6O A;  2WGW B;  3EWK A;  3FDD A;  3QP1 A;  3LYX A;  4P85 A;  1VET B;  3VP0 A;  4N92 A;  1K25 A;  4HHD A;  1BZA A;  2EX6 A;  5GXQ A;  5DNN B;  1HTZ A;  3NDE A;  2V0W A;  1S32 B;  2PHY A;  2VGL S;  5B0Y B;  5HX9 A;  3HSH A;  3JPU A;  5KDM B;  4S2P A;  4I3A A;  5HWV A;  1BH8 A;  3DTE A;  1K54 C;  2H10 A;  4J8X B;  2O9A A;  3O5Y A;  5BNX B;  3LEZ A;  2P7J A;  4CAY A;  4EBP A;  5B1M D;  3UTB C;  2V9A A;  3LGO A;  4HP9 A;  4OLD A;  3KSF A;  1WWS A;  1N4O A;  1W5D A;  3A3E A;  3AV1 D;  2KLI A;  3C38 A;  5EOE A;  4YM6 A;  1CK7 A;  4JGR A;  4HGA C;  1W8Y A;  4NE3 A;  3AZI A;  1WE4 A;  3KUY B;  1P34 D;  1ID3 B;  4EUZ A;  3UPO A;  2K2N A;  3AYW C;  5BNV A;  3LZ1 C;  2JKG A;  3AGD A;  1W63 M;  3T4O A;  3AZF C;  3MGQ A;  2A3U A;  3AZL D;  1T18 A;  4Z5T D;  4R8P C;  3KWQ A;  2JCH A;  4IBX A;  4WMC A;  1JWZ A;  1ZKJ A;  3BFD A;  1S32 A;  3G30 A;  4FD8 A;  1YU4 A;  4MBK A;  1YSQ A;  4Y0T A;  5L09 A;  3W98 B;  5GLC A;  2XA7 M;  3VOZ A;  1YLP A;  4WU9 C;  5BNX A;  3C5A A;  4Z66 B;  3IBJ A;  2WZX A;  2Q0O A;  5M1A A;  2W3E A;  4I3J A;  3VE4 A;  2PU2 A;  4NG2 A;  3LJA B;  2EX2 A;  2PYO D;  2Y2J A;  4NZ3 A;  1LT0 A;  2EX8 A;  2ZL1 A;  4GHA A;  1TZY B;  4Z2G A;  3AV1 A;  3Q82 A;  5AVF A;  1B6W A;  2XGN A;  5B40 C;  4PM7 A;  3X1V D;  4H6J A;  2H5S A;  4Y7P A;  2V2F F;  2Y2K A;  1IKI A;  4P6Z M;  5E2G A;  3KYE A;  2OLU A;  2XA7 S;  4L9E A;  1OME A;  1P34 A;  4MN7 A;  3KUY C;  3DTM A;  2INW A;  3WWX A;  4KG6 A;  2ARO B;  4JF5 A;  3LIA A;  3X1U C;  2BYK B;  1YAX A;  1E8B A;  4FSF A;  5JA4 B;  3AZL A;  3W98 A;  4Z5T A;  4E04 A;  3OLO A;  4LV0 A;  2RIQ A;  1YU2 A;  5AVC D;  4R6L A;  1LI0 A;  5AVE A;  3EGD C;  1MXO A;  5TJJ A;  1L0F A;  3AZE D;  2FH5 A;  3OPL A;  4GD8 A;  4Y0U A;  3WA9 B;  3PTE A;  1E6R A;  3R45 A;  4EQI A;  1GCE A;  3HLC A;  4XUJ D;  3REL D;  3AZH B;  4X69 A;  2HUE B;  1GSX A;  4X68 A;  3CLO A;  3A1I A;  2FJ7 B;  4H9S A;  4R3A A;  2VX8 A;  5AQ9 A;  5AQB A;  2V20 A;  5CHM A;  1XA7 A;  1TF1 A;  3BQA A;  5GSU D;  1SKF A;  2NUP C;  1TZY C;  5CP6 D;  3MZD A;  4OUI A;  4FCF A;  3X1V A;  3TE8 A;  1CK3 A;  4JGQ A;  2EFX A;  2K31 A;  1V9Y A;  1IYS A;  5JA4 A;  2R9X A;  3BWL A;  4O7D A;  4IBI A;  5GT0 B;  5GT3 B;  1KDS A;  1Q2Q A;  4X56 A;  3REJ B;  5JYO A;  4QY5 A;  4HEF A;  2C6W B;  5DVA A;  4OJ6 A;  5IHV A;  3B0D C;  2Y8H A;  5GHZ A;  2Y2Q A;  5EVL A;  3WA9 A;  3G4P A;  5AVC A;  3AV2 D;  3FZC A;  3W96 B;  4S2N A;  2FJ7 A;  5B32 C;  3AZE A;  4WJ3 C;  5B2J C;  1S1Y A;  1H8M A;  3CZD A;  4ZUX C;  4Z2K A;  4JXV A;  4KZ8 A;  5KZH A;  1T3U A;  4Y17 A;  4XUJ A;  3IWI A;  3AZH C;  3BLS A;  1BUE A;  4X23 D;  4C75 A;  1AXB A;  3BW6 A;  4OOM A;  2KX6 A;  2VV8 A;  4BD1 A;  3LR4 A;  4M6B A;  5G4Y A;  4ZBJ B;  5BO0 B;  1FR1 A;  3D9Y A;  5A92 A;  1F98 A;  4GD6 A;  3MGS D;  4WZS B;  3E2K A;  3X1S C;  3AZN B;  3EEH A;  1XJ4 A;  3Q81 A;  1TAF A;  4MBH A;  5B33 C;  2Z2L B;  4EW7 A;  3MSH A;  1B67 A;  1K55 C;  3CWF A;  1YM1 A;  4S2J A;  5GLB A;  5GT0 C;  3R7W B;  3CJM A;  4KGC D;  4NK3 A;  3W96 A;  3LUQ A;  3PBO A;  4QHC A;  3TJZ C;  3W99 D;  5A90 A;  4WUJ A;  1IEL A;  4NXE A;  4H8R A;  1CXW A;  3LR5 A;  3MNN C;  3AV2 A;  3G34 A;  3OPP A;  4I38 A;  4LD9 C;  3LO7 A;  1ONG A;  1IKG A;  2CV5 C;  1VM1 A;  1P3B C;  3REI B;  2HIO B;  4OON A;  5BO0 A;  1NWZ A;  5HFO A;  4QJG A;  1W63 Q;  4X23 A;  4BBT A;  1S67 L;  4F3L B;  2BG1 A;  4H9P B;  3B6F B;  1Z6F A;  4QLC B;  2X02 A;  3V50 A;  3IWO A;  2ZC6 B;  5FL3 A;  1P0Z A;  3CG5 A;  1RGY A;  4I5S A;  3RTY A;  1FOF A;  1YU0 A;  5DFX A;  3NC8 A;  4DJ3 A;  3PAG A;  1P3I C;  1ONH A;  5JRG B;  4LCL A;  3F1N A;  2HDR A;  4G3W A;  1XX2 A;  2OAQ 1;  1ES4 A;  3C30 A;  5FUG A;  4E3L A;  2DCF A;  5HSQ A;  3W99 A;  3LID A;  2A24 B;  1OTD A;  3REK B;  4PKY A;  3GRJ A;  3VH6 W;  4U0T A;  2XDM A;  1J3W A;  2OLV A;  2PR5 A;  4EO5 C;  4K0W A;  3L28 A;  5B0Z D;  1XXM A;  2A49 A;  2PAV P;  4IUH A;  4MB3 A;  4RQ9 A;  3A0V A;  1SHV A;  4QLC A;  3AZG A;  5DNM D;  2A2L A;  2ZMF A;  2HIO C;  5B1L D;  3B0C W;  1EQZ D;  2VGJ A;  3V9R B;  2XF3 A;  2ZQC A;  3HBR A;  5FI7 A;  3PHY A;  3B6G B;  1PDC A;  5CPI D;  3B6F C;  3WS5 A;  4WNN B;  5AV8 C;  1F66 C;  5DFY A;  3C1C D;  1P3O A;  1TVF A;  2BYM B;  2ZY5 A;  2X71 A;  4II7 A;  2VV7 A; 
#chains in the Genus database with same CATH homology
 3PBQ A;  4GDN A;  5EVI D;  4KG2 A;  1KDW A;  5E2E A;  3HLW A;  3UT9 C;  4JJN D;  4OQI A;  4IJF A;  4WEJ A;  5AV6 C;  1S0W A;  1P3G B;  1M1A B;  4J8U D;  1KX5 A;  1P3K B;  1WYC A;  3REH B;  3M6H A;  1BLS A;  2NZD A;  1MPL A;  5AV9 B;  1HTA A;  4OPY A;  5B0Z A;  3O62 B;  4N9K A;  3B6G A;  2QZ6 A;  2HDS A;  4WNN A;  3LEL C;  5BOH A;  3VP4 A;  3C7U A;  3ITA A;  1EQZ A;  5FSR A;  5GLD A;  4YS3 B;  3W97 D;  2BYM A;  5F99 D;  5CPJ B;  5CPI A;  1KX3 B;  2V1Z A;  5AY8 B;  2HDQ A;  1P3G A;  5DTS A;  2NQB D;  5EVI A;  3WTP C;  4K0X A;  3AFA C;  4IBF A;  4QNL A;  2ZY2 A;  4JJN A;  2ZY4 A;  4OPQ A;  3REH A;  1M18 B;  3IH9 A;  5KSC A;  3MZF A;  1P3F D;  3O3V A;  4H9N A;  4OOL A;  3RJU A;  3O62 A;  1VQQ A;  4QD4 A;  5DF8 A;  3KSY A;  3TU4 D;  1KVL A;  1KX4 D;  4WU8 C;  1KGE A;  5AV9 C;  2R9W A;  3IHB A;  5AV5 B;  5CPJ A;  3MGP D;  3NQU B;  1BLH A;  2ZQD A;  2IO5 B;  4E44 A;  2WK0 A;  3W97 A;  4YS3 C;  1BFM A;  1EI5 A;  4KEN B;  1I5Q A;  3A6N C;  1HQ3 B;  1WWI A;  4PMA A;  5GL9 A;  4WZ5 A;  1U35 D;  4GH9 A;  5F83 A;  4XZQ D;  1P3L D;  5GHY A;  2NQB A;  1P3M D;  3PBT A;  3F6T A;  4G91 B;  2F8N B;  1ALQ A;  4MLL A;  2W8S A;  5AVB D;  4P0M A;  3AZK B;  1P3F A;  4ZAM A;  3IF6 C;  5B2I C;  1LLB A;  3N7W A;  3UE3 A;  3P09 A;  1PI5 A;  3P5J B;  4IBJ A;  4LV3 A;  3TU4 A;  1FCO A;  1KX4 A;  3LZ0 C;  3WAA B;  3MXR A;  5FAQ A;  3MVD B;  1M19 B;  1P3P C;  4GKU A;  3S22 A;  4ZBE A;  3MGP A;  3HUO A;  3BFG A;  4KUD C;  4BLM A;  1MWU A;  1JFI A;  3ISG A;  2Y2I A;  5DTT A;  3WKJ B;  2F8N A;  4B88 A;  2YFV B;  4PM5 A;  1M6K A;  3VH5 A;  2WYX A;  5KSH A;  3AZK A;  3SH9 A;  1P3L A;  4J8V D;  1P3M A;  1AOI D;  4EBN A;  1DY6 A;  4OJP A;  5AVB A;  4DRA A;  1YLZ A;  3OZH A;  5U47 A;  4J8W B;  3IWQ A;  2F8N H;  4GN2 A;  4OP8 A;  1JTD A;  1GHM A;  4WV4 B;  5B24 C;  1P3A D;  5CPK D;  5FI2 A;  3AZM C;  3X1T D;  1M19 C;  3UTB B;  4IVI A;  3ITB A;  1Z2C B;  5F1F A;  3MGR D;  3W4O A;  1L0E A;  2Q9N A;  3LZ1 D;  2ZC3 B;  3AGF A;  4YM6 D;  4HGA B;  3WS2 A;  2ZM0 A;  2JBF A;  3AZI D;  4RX3 A;  4DE2 A;  1ZLA C;  3KXB D;  3AYW B;  2HDU A;  1QMF A;  4JF6 A;  3V3S A;  3AZF B;  3M2K A;  1TDL A;  3VFH A;  1AOI A;  4R8P B;  4NE5 A;  5EE8 A;  5FQ9 A;  2JE5 A;  3SS4 A;  5DNN D;  2ZM2 A;  3NQJ A;  1S32 D;  5B0Y D;  3C1B C;  5C3I C;  3N3F A;  3BRM A;  4OJL A;  5E5A B;  1ERO A;  1K54 A;  4J8W C;  3MKF A;  2Y2O A;  4J8X D;  5FDH A;  4WU9 B;  2ZQA A;  4Z9Q A;  1P3A A;  5CPK A;  4MEZ A;  3X1T A;  2ZY3 A;  3QNC A;  4U0X A;  3IQA A;  3Q1F A;  3L25 A;  3AZJ C;  3MGR A;  1ID3 D;  3LZ1 A;  5B40 B;  4DDS A;  3MFD A;  2WAF A;  3AZF A;  3A3J A;  4X53 A;  2ZD8 A;  4BL3 A;  3G32 A;  3EG5 B;  4LCM A;  3KXB A;  3V3R A;  5GXQ C;  2WGW A;  3X1U B;  1HD8 A;  3VSL A;  4RX2 A;  3W98 D;  3P98 A;  5BT1 D;  2HP5 A;  1H8Y A;  3N8R A;  5DNN A;  4ZTK A;  4Z66 D;  3ZNY A;  5B0Y A;  3HLF A;  5CHU A;  5KDM A;  1YMS A;  1K4F A;  4OJ5 A;  5E5A C;  2ZLY A;  4J8X A;  4AWL C;  4NE6 A;  3LJA D;  2ZJ9 A;  4P87 A;  4UHU A;  4E45 A;  1HZO A;  1TZY D;  2IWB A;  3AN2 C;  4HBU A;  1M40 A;  5CTM A;  4IBC A;  5B31 C;  3MGQ C;  2DQN C;  2Y2P A;  3KUY A;  1ID3 A;  3KWQ C;  1JWV A;  2ARO D;  3N4I A;  5A93 A;  3X1U A;  1KGF A;  4QB8 A;  5HW3 A;  4ZJ3 A;  3I7J A;  1ESU A;  1U60 A;  2EFU A;  3ZG8 B;  1G6A A;  3B0D B;  2WKE A;  4JPM A;  4Z66 A;  3WA9 D;  2RCX A;  3H0L C;  5B1M C;  4WBG A;  4R4S A;  5B32 B;  4R4R A;  3LJA A;  3AV1 C;  2FJ7 D;  5B2J B;  4ZUX B;  1CEG A;  4X6T A;  5EUA A;  1TZY A;  1P34 C;  3NCK A;  3O88 A;  4PM9 A;  3BFC A;  1H8Z A;  2PU4 A;  1KE0 A;  4NFT A;  3GQZ A;  3AZL C;  3HON A;  4Z5T C;  3SOI A;  3HLE A;  1YLT A;  1NJ4 A;  5GT3 D;  3X1S B;  1YU3 A;  2ARO A;  4H9R B;  4S2M A;  4HES A;  4WEK A;  4E3N A;  3REJ D;  3EPL A;  2BYK A;  2J8P A;  5B33 B;  1DJB A;  3BFF A;  3UPP A;  3W96 D;  3V5M A;  4A5R A;  1I2S A;  3AL0 C;  4KQQ A;  4H9S C;  3MNN B;  2PYO C;  3EPJ A;  3AZH A;  3UO9 A;  4LD9 B;  1ZG4 A;  2CV5 B;  4IED A;  3X1V C;  1LL5 A;  1P3B B;  5G49 B;  3V39 A;  2RVQ D;  5I94 A;  4PM6 A;  5CEB A;  1N1J B;  3W4Q A;  2F8N G;  3FV7 A;  3AZN D;  2UWX A;  3VH6 T;  4DE3 A;  3ZG5 A;  2XEP A;  5GT0 A;  5GT3 A;  3HLD A;  5AVC C;  3B0C T;  3REJ A;  1P3I B;  1K6R A;  3LY4 A;  4S2N C;  3AZE C;  4KQR A;  1BLP A;  4XUJ C;  3REL C;  1L0D A;  4NYY A;  2CV5 A;  2Y2L A;  5G49 A;  1P3B A;  2QMI A;  3REI D;  3IT9 A;  4M3K A;  1SDN A;  5GSU C;  4S2I A;  4EO5 B;  3M6B A;  3MGS B;  5CP6 C;  3B6F D;  2L5A A;  4QLC D;  3AZG D;  1LI9 A;  1YU1 A;  3EPK A;  3SH8 A;  3AZN A;  4D2O A;  5AV8 B;  3DWK A;  5JRG D;  4Z2M H;  1F66 B;  1O7E A;  1P3O D;  1GHP A;  3C4O A;  4N1X A;  4ZJ2 A;  3AV2 C;  4H9O B;  3WS0 A;  2XH9 A;  3UT9 B;  2WGI A;  5AV6 B;  2Z2M B;  3REK D;  2JSS A;  3IXG A;  1KX5 D;  1GA0 A;  3BYD A;  3Q7Z A;  3SH7 A;  4X23 C;  1YLY A;  5CED A;  1BTL A;  3REI A;  2HIO A;  2NZD D;  1MWS A;  3FKW A;  1PIO A;  4OQG A;  5E2H A;  3MGS C;  4H9P A;  3B6G D;  3B6F A;  5F82 A;  3LEL B;  5AV8 A;  1F66 A;  4EBL A;  5M18 A;  4OQ0 A;  4NZ5 A;  2Y91 A;  3BFE A;  3BM6 A;  4U3T A;  4KGC C;  5EPH A;  4H9O A;  5F1G A;  5JRG A;  4JXS A;  2Y55 A;  1MWT A;  3W99 C;  4IBB A;  4R1G A;  3WX7 A;  1P3G D;  2Y4A A;  1M1A D;  4UPK A;  3WTP B;  1KGG A;  3HUM A;  3AFA B;  1P3K D;  4E3I A;  3REH D;  5BS7 A;  3REK A;  5KMW A;  3WRT A;  5FAO A;  4NET A;  4GOG A;  5CHJ A;  5E43 A;  3O62 D;  4IBG A;  2EXB A;  3LEL A;  1DJC A;  5EOO A;  4WU8 B;  3V9R A;  1K6S A;  4BQM A;  5CPJ D;  2XFT A;  3KFU G;  1KX3 D;  5J8X A;  3QNB A;  5CER A;  5AY8 D;  3IXB A;  2Y2H A;  1Y54 A;  3L27 A;  4P6B A;  4C3Q A;  3PBN A;  1IYO A;  3WTP A;  3IF5 A;  2F2A C;  1LHY A;  2WUQ A;  3GV9 A;  3A6N B;  4GNU A;  1M18 D;  1K56 D;  2G2U A;  1M1A A;  4DXC A;  3A3I A;  5FAT A;  3G2Y A;  4DKI A;  2H0T A;  3DWZ A;  4NZ4 A;  3S4X A;  1P3K A;  3TG9 A;  5B0Z C;  4C6Y A;  1BH9 B;  3LY3 A;  1K57 C;  5DNM C;  3IF6 B;  5B2I B;  2YFW B;  5B1L C;  5AV9 A;  1EQZ C;  3N8L A;  5AV5 D;  4EWF A;  3UTA B;  5CPI C;  3LZ0 B;  4PM8 A;  1YT4 A;  4KZB A;  3GSG A;  5CEC A;  4YS3 A;  4PPR A;  3C1C C;  1P3P B;  1KX3 A;  1RP5 A;  4RA7 A;  5TGF A;  1Q9C A;  5AY8 A;  5EVI C;  1K4E A;  4KUD B;  1HQ3 D;  4QU3 A;  4LV2 A;  1GHI A;  4JJN C;  2IOU A;  4UA6 A;  4J8U C;  3VP3 A;  2F8N D;  1IYQ A;  3UDI A;  3OPR A;  1BH9 A;  1M18 A;  1K56 A;  3AZK D;  2XQZ A;  2XFS A;  1FSW A;  2WZZ A;  1TEM A;  3WAA D;  4WZ4 A;  2ZQ7 A;  3RXX A;  3MVD D;  1P3P A;  5AV5 A;  3NY4 A;  2ZQ8 A;  4H9Q B;  5F99 C;  3UTA C;  5B24 B;  3NQU A;  4JLF A;  4UA9 A;  3AZM B;  3L2A A;  4KUD A;  1DJA A;  4WZ5 C;  4E3O A;  4GB7 A;  4XZQ B;  4UAA A;  5DF9 A;  3WKJ D;  2NQB C;  4XUZ A;  5CHL B;  1HQ3 A;  2CC1 A;  1NYY A;  3UNW A;  1XKZ A;  2Y59 A;  3A1K A;  4DE1 A;  5GLA A;  1P3F C;  2QPN A;  3W8K A;  3ZDJ A;  1ZLA B;  4LEN A;  4E6W A;  5AQA A;  3WRZ A;  1CI8 A;  3TU4 C;  4EV4 A;  1KX4 C;  4J8W D;  3EPH A;  4JBF A;  4Z2M G;  3IH8 A;  1PZP A;  2LY8 A;  3C1B B;  5C3I B;  3BEB A;  4BEN A;  5B24 A;  3GTC A;  3WAA A;  1YQS A;  3MGP C;  3AZM A;  3SS3 A;  5HAP A;  3MVD A;  3NBL A;  1J9M A;  1M19 A;  3HUN A;  3UTB D;  1KU5 A;  3H0R C;  1ERM A;  5FQM A;  4DF6 A;  3G2Z A;  3IXD A;  4B4Z A;  4DQY B;  3KS8 A;  1H3O B;  1U35 C;  4XZQ C;  3FKE A;  1P3L C;  3WKJ A;  2YFV A;  3AZJ B;  1PI4 A;  1P3M C;  3AYW D;  3TSG A;  5AVB C;  5EEC A;  3AZF D;  3O87 A;  1TDG A;  1CEF A;  4R8P D;  5GXQ B;  3MBZ A;  1NZO A;  1PWD A;  5E5A D;  4J8W A;  1BH8 B;  4WU9 D;  2Y2M A;  1NYM A;  1W8Q A;  4F94 A;  2WAE A;  3MZE A;  4AWL B;  1H3O A;  4YM6 B;  2J7V A;  3UTB A;  3BEC A;  1NRF A;  4KZ3 A;  4R23 A;  4CPK A;  3AN2 B;  4OPR A;  5B40 D;  4B4X A;  5BNV B;  1FQG A;  4OJO A;  4FH4 A;  5B31 B;  3MGQ B;  2ZC7 A;  4J8V C;  1AOI C;  3KUY D;  1C3B A;  3KWQ B;  4GDB A;  4Y0O A;  3GR2 A;  3AYW A;  4JXG A;  3CMZ A;  3C4P A;  1XA1 A;  3ZGA B;  4X55 A;  3X1U D;  4YIN A;  4R8P A;  1PWG A;  5FAP A;  2CWE A;  3KS4 A;  5E5A A;  5FI6 A;  3WTP E;  1P3A C;  5CPK C;  1XGJ A;  4WYY A;  3PAE A;  4E3K A;  4WU9 A;  3X1T C;  4KQO A;  5B1M B;  2G2W A;  1YLJ A;  3AN2 A;  3OCL A;  3MGR C;  3AV1 B;  4E6X A;  1MBL A;  4YM6 C;  1RGZ A;  3VH5 W;  5B31 A;  3VP1 A;  2X01 A;  3AZI C;  2GDN A;  1P34 B;  2FFF B;  5B40 A;  4ZJ1 A;  3KXB C;  1KE3 A;  2XD5 A;  3HVF A;  2Q9M A;  3HL9 A;  3MXS A;  4DRT A;  5E2F A;  3AZL B;  2ZC5 B;  4Z5T B;  2RL3 A;  4UA7 A;  5DNN C;  4OQH A;  4RVA A;  1S32 C;  5B0Y C;  1MWR A;  1ES5 A;  3WS1 A;  2C5W B;  4J8X C;  4LV1 A;  4GHL A;  3R45 B;  3FKV A;  5B1M A;  4DRB A;  4YFM A;  1BSG A;  5B32 D;  1BUL A;  5B2J D;  4ZUX D;  2PYO B;  3HLG A;  4CSR B;  1E3U D;  4DXB A;  1RCJ A;  3AZH D;  4K91 A;  2EX9 A;  1ID3 C;  1NY0 A;  3X1V B;  5FQQ A;  3FYZ A;  1ZG6 A;  1NXY A;  2P74 A;  4MNR A;  3X1S D;  2J8Y A;  5B33 D;  3UDF A;  1KE4 A;  5TR7 A;  2Y2N A;  3W98 C;  3VMA A;  1EWZ A;  5BT1 C;  5D3O A;  4UUZ B;  5GT0 D;  4Z66 C;  3O86 A;  5DTK A;  5AVC B;  1YUE A;  2JC7 A;  1NZU A;  1K38 A;  4R3B A;  3OCN A;  3AZE B;  3LJA C;  2PYO A;  3MNN D;  4E3J A;  3NDG A;  4CSR A;  2HP6 A;  4LD9 D;  4XUJ B;  3QHY A;  3REL B;  5HL1 A;  5B32 A;  5CXW A;  5B2J A;  2CV5 D;  3EQV A;  1E25 A;  4ZUX A;  3VH6 A;  1FSY A;  1P3B D;  1S6R A;  1E3U A;  5GSU B;  5CP6 B;  4XXR A;  2J9O A;  1R4V A;  2ARO C;  3TOI A;  5CGX A;  3N6I A;  1TAF B;  1W79 A;  1PWC A;  2ZC4 B;  3WS4 A;  3OC2 A;  4UUZ A;  3X1S A;  4H9R A;  4R3J A;  3A3F A;  1ERQ A;  1P3I D;  1MY8 A;  5B33 A;  1K55 A;  4OH0 A;  1H5X A;  3ZG7 B;  4E3M A;  3ZNT A;  3WA9 C;  3AV2 B;  2FFY A;  4OLG A;  3UN7 A;  4JKT A;  3UE1 A;  3REL A;  3DW0 A;  2HUE C;  4L0L A;  2FJ7 C;  1A7W A;  2PBY A;  3MNN A;  4FH2 A;  2XK1 A;  3ZFZ A;  5GSU A;  3C7V A;  4LD9 A;  5CP6 A;  3Q07 A;  4X23 B;  2E8I A;  1ULY A;  1SCW A;  2HIO D;  4BD0 A;  2B5R A;  1N1J A;  2DRW A;  4IBD A;  3AGE A;  5GT3 C;  5AV8 D;  3VOY A;  3REJ C;  1PYY A;  1F66 D;  4IVK A;  1F1E A;  4N1H A;  5HAQ A;  5GHX A;  4KGC B;  1P3I A;  1KVM A;  5FUG B;  3W96 C;  3UT9 D;  3W99 B;  5CRF A;  3HRE A;  5AV6 D;  1LL9 A;  4OVD A;  3UDX A;  2WGV A;  4DE0 A;  4KZ7 A;  1FCM A;  4S2L A;  4NZ1 A;  3AZG B;  1PZO A;  2RVQ C;  4ZBJ C;  3MGS A;  3UE0 A;  4BL2 A;  3LEL D;  1PW8 A;  4CJN A;  3AZN C;  2BLS A;  3PBS A;  3BLM A;  3IHA A;  2EXA A;  1P3O B;  2H0Y A;  1IYP A;  4KGC A;  2ZM5 A;  2XR0 A;  1XP4 A;  1HVB A;  1ES3 A;  1G68 A;  3WTP D;  3AFA D;  1KX5 B;  3UT9 A;  3EQU A;  2J9P A;  5AV6 A;  2VQR A;  4RYE A;  2NZD B;  3REI C;  1L2S A;  5B0Z B;  3ZVT A;  2G5H C;  3VP2 A;  4QLC C;  5DNM B;  4WU8 D;  3AZG C;  1Q2P A;  5FAS A;  5B1L B;  5B31 G;  5AV9 D;  1EQZ B;  1ZC2 A;  1XPB A;  4S2O A;  4KHA B;  1O07 A;  5G18 A;  5CPI B;  1YMX A;  3ZG0 A;  5JRG C;  5M19 A;  4ID4 A;  4YS3 D;  3C1C B;  1P3O C;  4WM9 A;  1L0G A;  5FQJ A;  3B3X A;  5EVI B;  3A6N D;  1BT5 A;  2VGK A;  4JJN B;  5L2F A;  3VFF A;  5CTN A;  1PW1 A;  4KZA A;  5BS7 C;  3REK C;  4J8U B;  2P9V B;  3AFA A;  1KX5 C;  2I72 A;  4H9N B;  3Q7V B;  3GMW A;  1K57 A;  1XGI A;  5DNM A;  5B2I D;  2NZD C;  5B1L A;  2ZMA A;  1W7F A;  4KHA A;  3UTA D;  3B6G C;  3LZ0 D;  4WU8 A;  3NIA A;  3C1C A;  2DNS A;  1N9B A;  2HPB A;  3W97 B;  1P3P D;  5F99 B;  1CI9 A;  1IEM A;  3A3D A;  4KUD D;  4G92 B;  3IP4 C;  1P3G C;  4J8U A;  1M1A C;  3G31 A;  2P9V A;  5FA7 A;  4N9L A;  1YLW A;  2ZQ9 A;  2NQB B;  4NYU A;  4LG2 A;  3ZCZ A;  4NY2 A;  3A6N A;  1BLC A;  3Q7V A;  4XUX A;  1P3K C;  4S2K A;  3REH C;  1P3F B;  4JXW A;  4MBF A;  4OOY A;  3O62 C;  3ZVW A;  5B32 G;  3FWL A;  5HAR A;  3TU4 B;  3IF6 A;  5B2I A;  1KX4 B;  2YFW A;  3OPH A;  2WAD A;  4HBT A;  5HAI A;  4QY6 A;  5F99 A;  3UTA A;  5B24 D;  5CPJ C;  3LZ0 A;  3HLB A;  3MGP B;  1KX3 C;  3AZM D;  3L29 A;  3ZHH A;  5AY8 C;  4R0Q A;  1I2W A;  1M19 D;  1JWP A;  1SDE A;  3W97 C;  1JFI B;  4OPZ A;  5A91 A;  2HP9 A;  2IWC A;  3E2L A;  4G92 C;  1M18 C;  1U35 B;  3UY6 A;  3H0M C;  1P3L B;  3MKE A;  1P3M B;  3VSK A;  3G35 A;  1ZLA D;  2F8N K;  4IBR A;  5AVB B;  3B0B A;  2XD1 A;  3IXH A;  2WKH A;  5BPV A;  2DF4 C;  3UPN A;  3C1B D;  4IBK A;  5AV5 C;  4OP5 A;  4Q8I A;  2IO5 C;  3S1Y A;  3GVB A;  4OKP A;  4H9Q A;  1WYB A;  3N8S A;  2XLN A;  1W2E A;  2IWD A;  4WEL A;  3ZG9 B;  4BJP A;  1HQ3 C;  2G5I C;  3PBR A;  4DDY A;  1U35 A;  4XZQ A;  1QME A;  3AZJ D;  4KZ4 A;  4G91 C;  4IBE A;  3M2J A;  1ES2 A;  3LCE A;  3AZK C;  3RXW A;  1JVJ A;  3SS5 A;  4J8V B;  4GZB A;  3NI9 A;  1AOI B;  1ESI A;  1ZLA A;  3W4P A;  5GXQ D;  1MKI A;  2OSU A;  3NQJ B;  3VH5 T;  1PZR A;  5DF7 A;  1FR6 A;  5AQ7 A;  3WAA C;  2OV5 A;  1GA9 A;  5JYP A;  1JTG A;  1E4D A;  3MVD C;  4ZDX A;  3C1B A;  3L26 A;  1FCN A;  4KZ9 A;  3JYI A;  1P3A B;  5CPK B;  5CGW A;  2WKI A;  2Y2G A;  3X1T B;  5FQI A;  5FQK A;  4CAY B;  3WKJ C;  5TFQ A;  3AN2 D;  3MGR B;  5CGS A;  2ZM8 A;  4KZ5 A;  3LZ1 B;  4KZ6 A;  5B31 D;  3MGQ D;  4J8V A;  4KG5 A;  3AZJ A;  4IJE A;  3D4F A;  3AZI B;  3KWQ D;  4WMC D;  3KXB B;  4JF4 A;  2WGW B;  3FDD A;  4P85 A;  3VP0 A;  4N92 A;  1K25 A;  1BZA A;  2EX6 A;  5GXQ A;  5DNN B;  1HTZ A;  3NDE A;  1S32 B;  5HX9 A;  5B0Y B;  3HSH A;  5KDM B;  4S2P A;  1BH8 A;  1K54 C;  2H10 A;  4J8X B;  5BNX B;  3LEZ A;  4EBP A;  4CAY A;  5B1M D;  3UTB C;  4OLD A;  1WWS A;  1N4O A;  1W5D A;  3A3E A;  3AV1 D;  5EOE A;  4YM6 A;  4HGA C;  1W8Y A;  4NE3 A;  3AZI A;  1WE4 A;  3KUY B;  1P34 D;  1ID3 B;  4EUZ A;  3UPO A;  3AYW C;  5BNV A;  3LZ1 C;  3AGD A;  3AZF C;  3MGQ A;  2A3U A;  3AZL D;  4Z5T D;  4R8P C;  3KWQ A;  2JCH A;  4IBX A;  4WMC A;  1JWZ A;  1ZKJ A;  3BFD A;  1S32 A;  3G30 A;  4FD8 A;  1YU4 A;  4MBK A;  4Y0T A;  3W98 B;  5GLC A;  3VOZ A;  1YLP A;  4WU9 C;  5BNX A;  3C5A A;  4Z66 B;  2WZX A;  5M1A A;  2PU2 A;  3LJA B;  2EX2 A;  2PYO D;  2Y2J A;  4NZ3 A;  2EX8 A;  4GHA A;  1TZY B;  3AV1 A;  3Q82 A;  1B6W A;  2XGN A;  5B40 C;  4PM7 A;  3X1V D;  2H5S A;  4Y7P A;  2V2F F;  2Y2K A;  1IKI A;  5E2G A;  2OLU A;  1OME A;  1P34 A;  3KUY C;  3DTM A;  3WWX A;  4KG6 A;  2ARO B;  4JF5 A;  3X1U C;  2BYK B;  4FSF A;  5JA4 B;  3AZL A;  3W98 A;  4Z5T A;  4LV0 A;  2RIQ A;  1YU2 A;  5AVC D;  1LI0 A;  1MXO A;  1L0F A;  3AZE D;  3OPL A;  4GD8 A;  4Y0U A;  3WA9 B;  3PTE A;  3R45 A;  4EQI A;  1GCE A;  3HLC A;  4XUJ D;  3REL D;  3AZH B;  4X69 A;  2HUE B;  4X68 A;  3A1I A;  2FJ7 B;  4H9S A;  5AQB A;  5AQ9 A;  2V20 A;  5CHM A;  1XA7 A;  5GSU D;  1SKF A;  1TZY C;  5CP6 D;  3MZD A;  4OUI A;  4FCF A;  3X1V A;  1CK3 A;  2EFX A;  1IYS A;  5JA4 A;  2R9X A;  4O7D A;  4IBI A;  5GT0 B;  5GT3 B;  1KDS A;  1Q2Q A;  4X56 A;  3REJ B;  5JYO A;  4QY5 A;  4HEF A;  2C6W B;  5DVA A;  4OJ6 A;  5IHV A;  3B0D C;  5GHZ A;  2Y2Q A;  5EVL A;  3WA9 A;  3G4P A;  5AVC A;  3AV2 D;  3FZC A;  3W96 B;  4S2N A;  2FJ7 A;  5B32 C;  3AZE A;  4WJ3 C;  5B2J C;  3CZD A;  4ZUX C;  4JXV A;  4KZ8 A;  5KZH A;  1T3U A;  4XUJ A;  3IWI A;  3AZH C;  3BLS A;  1BUE A;  4X23 D;  4C75 A;  1AXB A;  4OOM A;  4BD1 A;  4M6B A;  4ZBJ B;  5BO0 B;  1FR1 A;  5A92 A;  4GD6 A;  3MGS D;  4WZS B;  3E2K A;  3X1S C;  3AZN B;  3Q81 A;  1TAF A;  4MBH A;  5B33 C;  2Z2L B;  1B67 A;  1K55 C;  1YM1 A;  4S2J A;  5GLB A;  5GT0 C;  3CJM A;  4KGC D;  4NK3 A;  3W96 A;  3PBO A;  4QHC A;  3W99 D;  5A90 A;  1IEL A;  4H8R A;  3MNN C;  3AV2 A;  3G34 A;  3OPP A;  4LD9 C;  3LO7 A;  1ONG A;  1IKG A;  2CV5 C;  1VM1 A;  1P3B C;  3REI B;  2HIO B;  4OON A;  5BO0 A;  5HFO A;  4QJG A;  4X23 A;  2BG1 A;  4H9P B;  3B6F B;  1Z6F A;  4QLC B;  2X02 A;  3V50 A;  3IWO A;  2ZC6 B;  3CG5 A;  1RGY A;  1FOF A;  1YU0 A;  3NC8 A;  3PAG A;  1P3I C;  1ONH A;  5JRG B;  4LCL A;  2HDR A;  1XX2 A;  1ES4 A;  5FUG A;  4E3L A;  2DCF A;  3W99 A;  3REK B;  3GRJ A;  3VH6 W;  4U0T A;  2XDM A;  2OLV A;  4EO5 C;  4K0W A;  3L28 A;  5B0Z D;  1XXM A;  2A49 A;  1SHV A;  4QLC A;  3AZG A;  5DNM D;  2HIO C;  5B1L D;  3B0C W;  1EQZ D;  2VGJ A;  3V9R B;  2XF3 A;  2ZQC A;  3HBR A;  5FI7 A;  3WS5 A;  3B6G B;  5CPI D;  3B6F C;  4WNN B;  5AV8 C;  1F66 C;  3C1C D;  1P3O A;  1TVF A;  2BYM B;  2ZY5 A;  2X71 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...