4IJFA

Crystal structure of the zaire ebolavirus vp35 interferon inhibitory domain k222a/r225a/k248a/k251a mutant
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
123
structure length
123
Chain Sequence
DISAADLANIMYDHLPGFGTAFHQLVQVICALGADSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Development of RNA Aptamers Targeting Ebola Virus VP35.
pubmed doi rcsb
source organism Zaire ebolavirus
molecule tags Viral protein
molecule keywords Polymerase cofactor VP35
total genus 36
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2012-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ijfA01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4ijfA02
3L28A 3L29A 3FKEA 4IJEA 3L25A 3KS4A 4IBCA 4IBGA 5BPVA 4IBFA 4IBJA 4IBBA 4GHLA 3L26A 4IBEA 4IBDA 3L2AA 3L27A 4IBIA 4IJFA 4IBKA 3KS8A 4GH9A 4GHAA 4LG2A
chains in the Genus database with same CATH superfamily
3TL4X 4DV1M 1Y8GA 4IJEA 1AIPC 2DZLA 1T3TA 3B7ZA 4L6V6 1YUBA 1ZMUA 4LRSA 5IREB 3GQ5A 2H1RA 3WHLA 3T15A 4TUWA 1H6UA 4IBJA 3THGA 1JR3E 1NJGA 2HCBA 4DBGB 1E15A 4MB7A 1H0GA 4MB5A 3ZC7B 2L09A 2R44A 3KDSE 3CTWB 2DXIA 3FTFA 2O5RA 3MMPA 5EP1A 4GHLA 1OTRA 1VEJA 3JR4A 1PRBA 4XBOA 3ZCBB 1E94E 3A45A 3JAMS 2XLJA 1OKSA 3VDUA 3GLIA 1NHGC 1TDHA 1NY6A 4LJ4A 5E26A 2HAKA 2Y2NA 2F5NA 2LHCA 2DKLA 5GKNA 3W0FA 4QNLA 1L2BA 4X65M 3HU1A 2Y2LA 3HJQA 3IG5A 2JWSA 2MH8A 3U5ZB 2X8AA 4FCWA 4LF5M 3GLGE 3L28A 2XFTA 4FCTA 1JB0F 3RGSA 4NSRA 2BG1A 3K1JA 3M0EA 1IY2A 1K3XA 3H4JA 3UK6A 4LJ5A 3CGWA 3LVVA 3C3EA 3GLFA 4BBAA 1Q3CA 2KZSA 2Y2QA 1NSFA 4QNRA 2IOUA 1Q39A 1S3SA 3KFUG 5FTKA 2C98A 2ERCA 2LBCA 4NC6A 4B7HA 1OIZA 2BWEA 4RF0A 4JI7M 4QOZC 4B08A 4HL4A 5EXXA 2FNAA 1GKIA 2ZAMA 4PCZA 5KO3A 3HGIA 5EXTA 2CHGA 3U6MA 2L7IA 2CV1A 3PNVA 3B74A 4LGMA 3WD0A 2BJVA 2BNKA 2XFSA 4OJOA 4HMEA 2M60A 4IIWA 5KQDA 2LTUA 1DGFA 3Q8GA 3GLGB 4G4NA 1R6BX 4JN6A 5EP2A 3E9SA 1OFIA 3D8LA 2LH0A 4B7GA 3UJNA 5DYGA 4X66M 4DR2M 3ZQJA 2LVAA 3M7PA 2XZFA 4NYYA 1N77A 2WZJA 2JA2A 1XMQM 1ED7A 2UUAM 3FYDA 2MJ5B 2KEBA 1XXHE 2EUCA 2HKJA 4UN2B 5LMUM 2OPFA 1E8BA 4R71A 1IFYA 2W82A 3GPYA 3HJSA 1YU1A 3HWSA 1MX0A 2KDLA 4NXMM 3KS8A 4GHAA 3T38A 1WR1B 4AKIA 3HX3A 3FRHA 1L1ZA 2Y2OA 3TWMA 2ZTDA 3FKEA 1EE8A 1WXQA 2J7OA 2N35A 3SASA 1K3WA 3L25A 1DO0A 2DAKA 3BBZA 4K0KM 4OJ6A 2Y2JA 2AHMA 2EKKA 4KO8A 3N3FA 1UFZA 4I5SA 4CJ6A 4LCBA 1DGHA 2WSEF 2EKFA 3K8ZA 3AOGA 1H8PA 3VKHA 2Y0TA 3R8FA 4NZ4A 1FNNA 2ZBKB 3VLFB 1W5TA 3U5ZA 4GIPA 1CUKA 1OQYA 5FSWA 4P16A 2V1UA 2MR9A 4JI1M 3AFHA 1TF0B 1GOIA 3WHKA 2FS1A 5ITXE 2CV2A 2RTSA 1WGLA 4OUIA 2RKOA 1R4GA 1DO2A 2DWZB 2R6FA 3I4VA 3U6PA 4WW0A 1GJSA 3CF2A 3GQ4A 4DV4M 2I7NA 1FJGM 1OAIA 4B3RM 4GKJM 3HSHA 4NRWA 1JR3A 3SYLA 1R5LA 2LVPC 1E6PA 3RGPA 2E5LM 4CIZA 1W1YA 5FTJA 4B7FA 2XGNA 3M7GA 1R7RA 1XNQM 1IY1A 3I4YA 5EQTA 3DFZA 3KP0E 4FD2A 4G4OA 1GABA 2BWBA 2QNJA 2C9OA 2KRKA 2Z4SA 3DOAA 2D49A 3BOSA 4MB3A 4Z2JA 1QO6A 2HL7A 2QQ8A 1D0LA 5DNYA 2JZ0A 2CFOA 1PJJA 2Z7JA 1BVSA 1NNJA 4LF4M 3GLFB 3U6OA 1P3QQ 2Z8YM 4IBKA 4GC5A 5IZ7D 4X64M 2DWLA 3LCVB 2F5QA 2FN2A 4QNMA 4II7A 2XD5A 3OTOM 1HNWM 4DR5M 1OGBA 3J7AS 3KP1E 4S12A 1QANA 4W5WA 4JYAM 2H5XA 1AIWA 4Z8XA 2L6OA 1XNRM 5A2QS 2F5SA 3UZUA 4AKGA 4FCVA 1WGNA 2R65A 2Y21A 1OAOC 2G8LA 3GLHE 4GRIA 4G4QA 4WURA 4HMCA 3U6SA 2R62A 2OOAA 3K2LA 3KOYE 1O6IA 2JCHA 2Y2IA 3K92A 1IM2A 4RF1A 4WP2A 1D0KA 3WD2A 3J81S 1OIPA 5KPRA 3HHXA 1N78A 3WD3A 3LW5F 5LMNM 2F5OA 2GNOA 2KRUA 4L16A 2XSZD 3J80S 1IY0A 1L2DA 1OGGA 1TH3A 4GC9A 2RRUA 1JR3D 1X37A 4MGIE 2DVWB 2RGOA 4AI6A 3WD4A 5F3WA 1E9RA 3FD9A 4OU7A 4DV3M 3RE8A 4LRTA 3VDPA 2C99A 4MGKE 4ZPXA 3U6QA 2G5GX 1NHWC 4LJ6A 2CRUA 4DV5M 5H37D 2VQFM 4LF7M 2CV0A 1I4WA 4OVZA 1EIJA 2QENA 3VK7A 1LTMA 3KOWE 3Q8XA 4B3SM 2R4JA 4MGZE 1VG5A 2ZANA 3DZDA 3C9PA 2K9DA 3DA1A 5E6JA 5ITUA 3SMPA 2UU9M 4IBEA 4PD2A 2DAEA 3F92A 1GL6A 4IBDA 5KQ8A 2XEPA 2XSZA 1K82A 1GO5A 3U60A 1D0MA 1QAMA 1NVMA 3LCUA 4IJFA 5DYIA 1IBLM 1HT2E 1W5SA 1XHBA 1L2CA 2D7EA 2LWXA 1IXSB 5ITQA 3HU2A 1CK7A 3CF0A 1ZQ9A 4AKHA 2M5ZA 3WX7A 2D7HA 1QUSA 1L6JA 2O01F 4CHTB 4DR6M 2Z3XA 2Y2PA 2CP8A 2L2DA 3GPPA 1GLNA 4MH0E 1TR8A 3NBIA 1QYRA 3J7BA 1IBKM 1GJTA 2QP9X 3ILKA 2I7PA 2KNZA 2B3TA 4LF6M 3RFWA 2ZTCA 1HNXM 4JI5M 2KA6B 3AJIB 1QAOA 4FWDA 3SAWA 1UR8A 1SXJE 3HHZA 4OVZB 3QAUA 4M9SA 1Z59A 3HU3A 3ZH9B 1N75A 3VFDA 2R18A 2R4EA 3GQ3A 2X49A 4NZ1A 4TX8A 4OJLA 4Z2IA 4D82A 4L15A 4NOOB 3QYBA 4NSOB 5L8RF 3MK6A 4JXJA 2CWBA 4QHTA 2HWJA 5BR8M 4LZZA 1QDRA 2JXNA 1ZMVA 2MROB 2LVNC 2DENA 2GQFA 4IBFA 1QQWA 1KS0A 1G8PA 1VDLA 2DHRA 2JUJA 1N34M 4MGYE 4DV7M 2DWMA 3E4RA 3FE3A 1GPFA 2QCUA 2JP7A 3GRRA 1SXJD 2XH9A 2DHYA 3SYKA 1PJSA 1A5TA 2C9CA 2KHHA 2KXEA 4REZA 1QZMA 2JZ1A 4Z2GA 3TWLA 4AG5A 1SXJA 4GEWA 4IBIA 3HJ8A 1XB2B 4PDGA 2YR0A 2DAMA 1E9SA 1Q02A 1OJLA 1TH2A 3BXWA 1SXJC 5ITRA 1KFVA 1G59A 4OX9M 3R9XB 4AQYM 2DAGA 3HHYA 1F4IA 5IWAM 4CGYB 3TE6A 2C5RA 4M9ZA 3AL0C 2R45A 2YFQA 1L8QA 4HEOA 4JI8M 1T6OA 3TWKA 5EXPA 3TQSA 1XXHB 3GLHA 3IHPA 2WSFF 3W67A 1IXRC 3A46A 3CF6E 2CUZA 7CATA 2EJSA 3W0LB 2QBYB 1IXSA 1C1KA 4YHHM 1H0IA 3LVWA 3C3DA 2WSCF 3EIEA 5ITYA 2QSFX 1YSYA 2OO9A 4B3TM 1WHCA 1YLAA 1XC8A 2UUBM 1G3IA 1AUAA 1G41A 4DUZM 1T43A 4AZFA 4NY2A 4F2LA 3GRUA 5FLXS 1QUTA 4KLNA 1J5EM 4Q7JA 2XZUA 4IBCA 4IBGA 5BPVA 4I81A 1G4AE 2QHOB 1GL7A 1N36M 1NV8A 1GVNA 2K6BA 3E46A 3GRYA 5KPZA 4MM3B 4EIWA 4L8RC 4IBBA 3SMSA 3LMMA 3SFZA 2F5PA 1W1VA 3I51A 4KHPM 2A5YB 5FTLA 5JI2E 5EP4A 5ITXA 3IECA 3MQLA 5JI3E 1G71A 3L26A 1IBMM 4LFCM 1J7MA 2J5YA 1IN6A 1XMOM 4Z2LA 4G3OA 2D7GA 3L2AA 4LF9M 1E6RA 3HHWA 4FW9A 4AG6A 1VDDA 4JI2M 3SATA 2KNVA 3HZJA 1L1TA 3WD1A 2VIIA 3GO8A 1E88A 2UWXA 3GLFE 3T1HM 1TTEA 2K0BX 3K9PA 1Z5AA 3HY5A 2R46A 2VF7A 2CE7A 2KNAA 2JY8A 1LV7A 2LHGA 2RGHA 2ZAOA 3FUUA 2CHVA 4LGYA 1EAKA 3GPUA 4M0DA 1V34A 1WJ7A 4GITA 5FTMA 2Y20A 2MGWA 4JI0M 1TDZA 1N33M 3U6EA 1E6NA 4NZ5A 4NL4H 4I4LA 2CHQA 2G3QA 3B7QA 1SXJB 3AOEC 1NNUC 2OOBA 1JQJC 1IN8A 1QDTA 3FYCA 4JI3M 3W68A 3GPXA 2EA0A 1PM5A 1R2YA 2DNAA 3PNYA 1XWIA 4KODA 1W1TA 1MU5A 4XGIA 5C1BA 4LZJA 2FE8A 3PVSA 1EFUB 1MN3A 3FRIA 4LF8M 3LQQA 1D2NA 4LY6A 1R2ZA 4P17A 3U60B 2Y2MA 1Z6TA 3FTCA 1YU2A 2NQ8C 4JI4M 2DZNB 2F4VM 3KXEC 1E6ZA 4YY3M 1PGYA 4Z6YA 2K47A 3JR5A 3GLGA 3U61B 1HJPA 1NV9A 4I8OA 2L4EA 2V6ZM 4L4UA 3VK8A 1KSFX 4GMQA 5EJCA 1PDCA 4DV6M 1HNZM 4Z2KA 2QBYA 3D8BA 3PFIA 1Z5BA 2LVQD 1YU4A 4CISA 3U6DA 2Y2KA 2DZOB 2UXBM 4M0WA 4NXNM 4JI6M 3AV0A 1VEGA 1N32M 2O25A 3TPZA 2V1CA 4FVMA 4MGHA 3E21A 2JE5A 4NYUA 4LFBM 4B3MM 3T6PA 3SHFA 1IN5A 3I01M 4GH9A 3KSXA 4F1IA 3T1YM 1HT1E 1ZV1A 1V33A 2DAIA 2JY6B 3L29A 4LJ9A 4QOSA 2L4FA 4RKUF 3SARA 1W1PA 5KPTA 2FOIC 3C58A 8CATA 2ZM6M 1OFHA 3KS4A 1ZAEA 1UM8A 2JNHA 3K9OA 4KT0F 5DFLA 3UGJA 2VQEM 4GKKM 1Z5CA 3I04M 4PT5A 2FFJA 3H4MA 3QYEA 4L78A 4LFAM 3GP1A 2YQZA 1QZEA 3SBJA 1IXZA 2BJWA 4LJ7A 2KZUA 1PJIA 3J2PB 4XK8F 4DR1M 2OQ4A 2UXDM 3KSJA 1YU0A 3MJ5A 1NY5A 3GLIE 1IN4A 1HR0M 1TH4A 4DUYM 2JY5A 1VQ1A 1I94M 2LVOC 3B7NA 3M6AA 4NRVA 3SAUA 2XF3A 4DV2M 3FUWA 1NJFA 1Q3BA 1YUEA 3FTDA 2Z4RA 3FUVA 4Y28F 2FFFB 1IQPA 2C96A 1ORYB 1ZMWA 4HLQA 3J27B 4JV5M 3A98B 4LG2A 4G6ZA 4A3VB 2LNHC 2P5TA 2QPAA 4DR7M 1V92A 3KW6A 3MHVC 3FUXA 1C7YA 2CEAA 4MB4A 2JY7A 3V76A 1HQCA 2QZ4A 2Y0QA 1DGBA 1DGHB 1J09A 3AKZA 2V5OA 3IG8A 4R7GA 3B89A 5EP3A 4D80A 2DI0A 1J7KA 2Y2GA 4ANRA 4R3DA 2XD1A 3GRVA 1DGGA 4G4RA 4LJAA 3U6CA 1PJTA 1TGUA 1YE9A 3SC3A 2L7HA 4M9XA 1HQYE 2X4AA 2KW0A 4QHSA 3HKPA 3UMMA 2APLA 4OW0A 3HONA 3L27A 4AW4A 3LQRA 3B9PA 1QVRA 2FH0A 5C18A 1YU3A 4PDIA 2UXCM 1MJGM 4ITQA 2Y2HA 4OJPA 3U6LA 2VDBB 3NBXX 1KYIA 5FTNA 3AOEA 4HMDA 3A42A 2LXEA 4NZ3A 4Z2HA 1CXWA 4OJ5A 4RNAA 4DR3M 1XXHA 3GLHB 4D81A 2DWNA 3GLIB 2UUCM 5IT9S 5EXSA 1GXDA 1PJQA 3KOZE 1E32A 4BB9A 3SHGB 4DR4M 2EO2A 3VKGA 4FWGA 1QAQA 4LJ8A 2VF8A 1NO1A 2HHHM 4DV0M 2Q2EB 3KOXE 1VEKA 3PXGA 3QWLA 3EIHA 1IN7A 3KVWA 5ITTA 3U61A 3NWLA 1WIVA 4X62M 4BLCA 3SAVA 3FTEA 1RU3A 2J7NA 1UR9A 2YNMD 4FWHA 1DV0A 1SG9A 2R0IA 3FUTA
chains in the Genus database with same CATH topology
3TL4X 4DV1M 4IJEA 1T3TA 1YUBA 4LRSA 5IREB 3GQ5A 2H1RA 3WHLA 3T15A 4TUWA 1H6UA 4IBJA 3THGA 1NJGA 2HCBA 4MB7A 3ZC7B 2L09A 2DXIA 3KDSE 3CTWB 3FTFA 2O5RA 5EP1A 4GHLA 3JR4A 4XBOA 3ZCBB 1E94E 3A45A 3JAMS 2XLJA 3VDUA 3GLIA 1NHGC 1TDHA 1NY6A 4LJ4A 5E26A 2Y2NA 2F5NA 5GKNA 3W0FA 4QNLA 1L2BA 4X65M 3HU1A 2Y2LA 3HJQA 3IG5A 4LF5M 3U5ZB 2X8AA 4FCWA 3L28A 2XFTA 4FCTA 3RGSA 4NSRA 2BG1A 3K1JA 3M0EA 1IY2A 1K3XA 3UK6A 4LJ5A 3LVVA 3GLFA 4BBAA 1Q3CA 2KZSA 2Y2QA 1NSFA 4QNRA 2IOUA 1Q39A 1S3SA 3KFUG 5FTKA 2C98A 2ERCA 4JI7M 4QOZC 4B7HA 4RF0A 4B08A 4HL4A 5EXXA 2FNAA 1GKIA 2ZAMA 4PCZA 5KO3A 3HGIA 5EXTA 2CHGA 3U6MA 2L7IA 2CV1A 3PNVA 4LGMA 2BJVA 2BNKA 2XFSA 4OJOA 2M60A 4IIWA 5KQDA 1DGFA 3GLGB 4G4NA 1R6BX 4JN6A 5EP2A 3E9SA 1OFIA 3D8LA 2LH0A 4B7GA 3UJNA 5DYGA 4X66M 4DR2M 4NYYA 2XZFA 1N77A 2JA2A 1XMQM 2UUAM 3FYDA 2KEBA 2EUCA 2HKJA 5LMUM 2OPFA 2W82A 3GPYA 3HJSA 1YU1A 3HWSA 1MX0A 4NXMM 3KS8A 4GHAA 3T38A 4AKIA 1L1ZA 2Y2OA 3TWMA 3FKEA 1EE8A 1WXQA 2J7OA 3SASA 1K3WA 3L25A 1DO0A 4K0KM 4OJ6A 2Y2JA 2AHMA 4KO8A 3N3FA 4I5SA 4LCBA 1DGHA 3K8ZA 3AOGA 3VKHA 2Y0TA 3R8FA 4NZ4A 1FNNA 2ZBKB 3VLFB 1W5TA 3U5ZA 4GIPA 5FSWA 2V1UA 4JI1M 4P16A 3AFHA 3WHKA 5ITXE 2CV2A 4OUIA 2RKOA 1DO2A 2DWZB 3I4VA 3U6PA 4WW0A 3CF2A 3GQ4A 4DV4M 2I7NA 1FJGM 4B3RM 4GKJM 3HSHA 4NRWA 1JR3A 3SYLA 3RGPA 2E5LM 5FTJA 4B7FA 2XGNA 3M7GA 1R7RA 1XNQM 1IY1A 3I4YA 5EQTA 3DFZA 3KP0E 4FD2A 4G4OA 2C9OA 2KRKA 2Z4SA 3DOAA 3BOSA 2HL7A 5DNYA 2CFOA 1PJJA 2Z7JA 4LF4M 1NNJA 3GLFB 3U6OA 4IBKA 5IZ7D 4GC5A 4X64M 2DWLA 2F5QA 4QNMA 4II7A 2XD5A 1HNWM 4DR5M 3J7AS 3KP1E 4S12A 1QANA 4W5WA 4JYAM 4Z8XA 2L6OA 1XNRM 5A2QS 2F5SA 3UZUA 4AKGA 4FCVA 2R65A 2Y21A 2G8LA 4G4QA 4GRIA 4WURA 3U6SA 2R62A 3K2LA 3KOYE 2JCHA 2Y2IA 3K92A 1IM2A 4RF1A 3J81S 5KPRA 3HHXA 1N78A 5LMNM 2F5OA 2KRUA 3J80S 4L16A 2XSZD 1L2DA 1IY0A 1TH3A 4GC9A 1JR3D 1X37A 4MGIE 2DVWB 2RGOA 4AI6A 5F3WA 1E9RA 3FD9A 4OU7A 4DV3M 3RE8A 4LRTA 3VDPA 2C99A 4MGKE 4ZPXA 3U6QA 2G5GX 1NHWC 4LJ6A 4DV5M 5H37D 2VQFM 4LF7M 2CV0A 1I4WA 4OVZA 2QENA 3VK7A 3KOWE 3Q8XA 4B3SM 2R4JA 4MGZE 5ITUA 2ZANA 3DZDA 5E6JA 3DA1A 3SMPA 2UU9M 4IBEA 4PD2A 4IBDA 1GL6A 5KQ8A 2XEPA 2XSZA 1K82A 3U60A 1QAMA 1NVMA 4IJFA 5DYIA 1IBLM 1HT2E 1W5SA 1XHBA 1L2CA 2D7EA 2LWXA 1IXSB 5ITQA 3HU2A 3CF0A 1ZQ9A 4AKHA 2M5ZA 3WX7A 2D7HA 4CHTB 4DR6M 2Z3XA 2Y2PA 3GPPA 1GLNA 4MH0E 3NBIA 1QYRA 3J7BA 1IBKM 3ILKA 2QP9X 2I7PA 4LF6M 3RFWA 1HNXM 4JI5M 2KA6B 3AJIB 1QAOA 4FWDA 3SAWA 1SXJE 3HHZA 4OVZB 3QAUA 4M9SA 1Z59A 3HU3A 3ZH9B 1N75A 3VFDA 2R18A 2R4EA 3GQ3A 2X49A 4NZ1A 4OJLA 4D82A 4L15A 4NOOB 4NSOB 3MK6A 4JXJA 4QHTA 5BR8M 4LZZA 4IBFA 1QQWA 1G8PA 2DHRA 1N34M 4MGYE 4DV7M 2DWMA 3E4RA 2QCUA 3GRRA 1SXJD 2XH9A 3SYKA 2KXEA 2C9CA 4REZA 1QZMA 3TWLA 4AG5A 1SXJA 4IBIA 3HJ8A 4PDGA 2YR0A 1E9SA 1OJLA 1TH2A 1SXJC 5ITRA 1KFVA 1G59A 4OX9M 3R9XB 4AQYM 3HHYA 5IWAM 4CGYB 3TE6A 2C5RA 4M9ZA 3AL0C 2R45A 2YFQA 1L8QA 4JI8M 3TWKA 5EXPA 3TQSA 1XXHB 3GLHA 1IXRC 3A46A 3CF6E 2CUZA 7CATA 3W0LB 2QBYB 1C1KA 4YHHM 3LVWA 3EIEA 5ITYA 1YSYA 4B3TM 1XC8A 2UUBM 1G3IA 1G41A 4DUZM 4AZFA 4NY2A 3GRUA 5FLXS 4KLNA 1J5EM 2XZUA 4IBCA 4IBGA 5BPVA 4I81A 1G4AE 1GL7A 1N36M 3GRYA 1GVNA 4MM3B 4EIWA 4L8RC 4IBBA 3SMSA 3LMMA 3SFZA 2F5PA 3I51A 4KHPM 2A5YB 5FTLA 5JI2E 5EP4A 5ITXA 5JI3E 3L26A 1IBMM 4LFCM 1IN6A 1XMOM 2D7GA 3L2AA 4LF9M 3HHWA 4FW9A 4AG6A 1VDDA 4JI2M 3SATA 1L1TA 2VIIA 3GO8A 2UWXA 3T1HM 1Z5AA 2R46A 2CE7A 2RGHA 1LV7A 2ZAOA 3FUUA 2CHVA 4LGYA 3GPUA 4M0DA 4GITA 5FTMA 2Y20A 4JI0M 1N33M 1TDZA 4NZ5A 3U6EA 4NL4H 4I4LA 2CHQA 1SXJB 3AOEC 1NNUC 3FYCA 1JQJC 1IN8A 4JI3M 3OTOM 3GPXA 2EA0A 1PM5A 1R2YA 3PNYA 1XWIA 4KODA 1MU5A 4XGIA 5C1BA 4LZJA 2FE8A 3PVSA 4LF8M 3LQQA 1D2NA 4LY6A 1R2ZA 3U60B 2Y2MA 3FTCA 1Z6TA 1YU2A 2NQ8C 4JI4M 2DZNB 2F4VM 3KXEC 4YY3M 3JR5A 4Z6YA 2K47A 3GLGA 3VK8A 3U61B 4I8OA 4L4UA 2V6ZM 1KSFX 4GMQA 5EJCA 4DV6M 1HNZM 2QBYA 3D8BA 3PFIA 1Z5BA 1YU4A 4CISA 3U6DA 2Y2KA 2DZOB 2UXBM 4M0WA 4NXNM 4JI6M 3AV0A 1N32M 3TPZA 2V1CA 4FVMA 4MGHA 2JE5A 4NYUA 4LFBM 4B3MM 3SHFA 1IN5A 4GH9A 3KSXA 3T1YM 1HT1E 3L29A 4LJ9A 4QOSA 3SARA 5KPTA 2FOIC 3C58A 8CATA 2ZM6M 1OFHA 3KS4A 1ZAEA 1UM8A 2VQEM 3UGJA 4GKKM 1Z5CA 4PT5A 2FFJA 3H4MA 4L78A 4LFAM 3GP1A 2YQZA 3SBJA 1PJIA 1IXZA 2BJWA 4LJ7A 2KZUA 1YU0A 3J2PB 4DR1M 2FFFB 2OQ4A 2UXDM 3KSJA 3MJ5A 1NY5A 1IN4A 1HR0M 1TH4A 4DUYM 1I94M 3M6AA 4NRVA 3SAUA 2XF3A 4DV2M 3FUWA 1NJFA 1Q3BA 1YUEA 3FTDA 2Z4RA 3FUVA 1IQPA 2C96A 1ORYB 4HLQA 4JV5M 3J27B 3A98B 4LG2A 4G6ZA 4A3VB 2LNHC 2P5TA 2QPAA 4DR7M 3KW6A 3MHVC 3FUXA 2CEAA 1HQCA 2QZ4A 2Y0QA 1DGBA 1DGHB 1J09A 3AKZA 3IG8A 4R7GA 5EP3A 4D80A 1J7KA 2Y2GA 4R3DA 2XD1A 3GRVA 1DGGA 4G4RA 4LJAA 3U6CA 1TGUA 1YE9A 3SC3A 2L7HA 4M9XA 1HQYE 2X4AA 2KW0A 4QHSA 3HKPA 3UMMA 4OW0A 3HONA 3L27A 4AW4A 3LQRA 3B9PA 1QVRA 5C18A 1YU3A 4PDIA 2UXCM 4ITQA 2Y2HA 4OJPA 3U6LA 5FTNA 1KYIA 4NZ3A 3AOEA 3A42A 2LXEA 4OJ5A 4RNAA 4DR3M 1XXHA 3GLHB 4D81A 2DWNA 3GLIB 2UUCM 5IT9S 5EXSA 4BB9A 3KOZE 1E32A 3SHGB 4DR4M 2EO2A 3VKGA 4FWGA 1QAQA 4LJ8A 2HHHM 4DV0M 2Q2EB 3KOXE 3PXGA 3QWLA 3EIHA 1IN7A 3KVWA 5ITTA 3U61A 3NWLA 4X62M 4BLCA 3SAVA 3FTEA 2J7NA 2YNMD 4FWHA 5KPZA 3FUTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L28 A;  3L29 A;  3FKE A;  4IJE A;  3L25 A;  3KS4 A;  4IBC A;  4IBG A;  5BPV A;  4IBF A;  4IBJ A;  4IBB A;  4GHL A;  3L26 A;  4IBE A;  4IBD A;  3L2A A;  3L27 A;  4IBI A;  4IJF A;  4IBK A;  3KS8 A;  4GH9 A;  4GHA A;  4LG2 A; 
#chains in the Genus database with same CATH topology
 3TL4 X;  4DV1 M;  1Y8G A;  4IJE A;  1AIP C;  2DZL A;  1T3T A;  3B7Z A;  4L6V 6;  1YUB A;  1ZMU A;  4LRS A;  5IRE B;  3GQ5 A;  2H1R A;  3WHL A;  3T15 A;  4TUW A;  1H6U A;  4IBJ A;  3THG A;  1JR3 E;  1NJG A;  2HCB A;  4DBG B;  1E15 A;  4MB7 A;  1H0G A;  4MB5 A;  3ZC7 B;  2L09 A;  2R44 A;  3KDS E;  3CTW B;  2DXI A;  3FTF A;  2O5R A;  3MMP A;  5EP1 A;  4GHL A;  1OTR A;  1VEJ A;  3JR4 A;  1PRB A;  4XBO A;  3ZCB B;  1E94 E;  3A45 A;  3JAM S;  2XLJ A;  1OKS A;  3VDU A;  3GLI A;  1NHG C;  1TDH A;  1NY6 A;  4LJ4 A;  5E26 A;  2HAK A;  2Y2N A;  2F5N A;  2LHC A;  2DKL A;  5GKN A;  3W0F A;  4QNL A;  1L2B A;  4X65 M;  3HU1 A;  2Y2L A;  3HJQ A;  3IG5 A;  2JWS A;  2MH8 A;  3U5Z B;  2X8A A;  4FCW A;  4LF5 M;  3GLG E;  3L28 A;  2XFT A;  4FCT A;  1JB0 F;  3RGS A;  4NSR A;  2BG1 A;  3K1J A;  3M0E A;  1IY2 A;  1K3X A;  3H4J A;  3UK6 A;  4LJ5 A;  3CGW A;  3LVV A;  3C3E A;  3GLF A;  4BBA A;  1Q3C A;  2KZS A;  2Y2Q A;  1NSF A;  4QNR A;  2IOU A;  1Q39 A;  1S3S A;  3KFU G;  5FTK A;  2C98 A;  2ERC A;  2LBC A;  4NC6 A;  4B7H A;  1OIZ A;  2BWE A;  4RF0 A;  4JI7 M;  4QOZ C;  4B08 A;  4HL4 A;  5EXX A;  2FNA A;  1GKI A;  2ZAM A;  4PCZ A;  5KO3 A;  3HGI A;  5EXT A;  2CHG A;  3U6M A;  2L7I A;  2CV1 A;  3PNV A;  3B74 A;  4LGM A;  3WD0 A;  2BJV A;  2BNK A;  2XFS A;  4OJO A;  4HME A;  2M60 A;  4IIW A;  5KQD A;  2LTU A;  1DGF A;  3Q8G A;  3GLG B;  4G4N A;  1R6B X;  4JN6 A;  5EP2 A;  3E9S A;  1OFI A;  3D8L A;  2LH0 A;  4B7G A;  3UJN A;  5DYG A;  4X66 M;  4DR2 M;  3ZQJ A;  2LVA A;  3M7P A;  2XZF A;  4NYY A;  1N77 A;  2WZJ A;  2JA2 A;  1XMQ M;  1ED7 A;  2UUA M;  3FYD A;  2MJ5 B;  2KEB A;  1XXH E;  2EUC A;  2HKJ A;  4UN2 B;  5LMU M;  2OPF A;  1E8B A;  4R71 A;  1IFY A;  2W82 A;  3GPY A;  3HJS A;  1YU1 A;  3HWS A;  1MX0 A;  2KDL A;  4NXM M;  3KS8 A;  4GHA A;  3T38 A;  1WR1 B;  4AKI A;  3HX3 A;  3FRH A;  1L1Z A;  2Y2O A;  3TWM A;  2ZTD A;  3FKE A;  1EE8 A;  1WXQ A;  2J7O A;  2N35 A;  3SAS A;  1K3W A;  3L25 A;  1DO0 A;  2DAK A;  3BBZ A;  4K0K M;  4OJ6 A;  2Y2J A;  2AHM A;  2EKK A;  4KO8 A;  3N3F A;  1UFZ A;  4I5S A;  4CJ6 A;  4LCB A;  1DGH A;  2WSE F;  2EKF A;  3K8Z A;  3AOG A;  1H8P A;  3VKH A;  2Y0T A;  3R8F A;  4NZ4 A;  1FNN A;  2ZBK B;  3VLF B;  1W5T A;  3U5Z A;  4GIP A;  1CUK A;  1OQY A;  5FSW A;  4P16 A;  2V1U A;  2MR9 A;  4JI1 M;  3AFH A;  1TF0 B;  1GOI A;  3WHK A;  2FS1 A;  5ITX E;  2CV2 A;  2RTS A;  1WGL A;  4OUI A;  2RKO A;  1R4G A;  1DO2 A;  2DWZ B;  2R6F A;  3I4V A;  3U6P A;  4WW0 A;  1GJS A;  3CF2 A;  3GQ4 A;  4DV4 M;  2I7N A;  1FJG M;  1OAI A;  4B3R M;  4GKJ M;  3HSH A;  4NRW A;  1JR3 A;  3SYL A;  1R5L A;  2LVP C;  1E6P A;  3RGP A;  2E5L M;  4CIZ A;  1W1Y A;  5FTJ A;  4B7F A;  2XGN A;  3M7G A;  1R7R A;  1XNQ M;  1IY1 A;  3I4Y A;  5EQT A;  3DFZ A;  3KP0 E;  4FD2 A;  4G4O A;  1GAB A;  2BWB A;  2QNJ A;  2C9O A;  2KRK A;  2Z4S A;  3DOA A;  2D49 A;  3BOS A;  4MB3 A;  4Z2J A;  1QO6 A;  2HL7 A;  2QQ8 A;  1D0L A;  5DNY A;  2JZ0 A;  2CFO A;  1PJJ A;  2Z7J A;  1BVS A;  1NNJ A;  4LF4 M;  3GLF B;  3U6O A;  1P3Q Q;  2Z8Y M;  4IBK A;  4GC5 A;  5IZ7 D;  4X64 M;  2DWL A;  3LCV B;  2F5Q A;  2FN2 A;  4QNM A;  4II7 A;  2XD5 A;  3OTO M;  1HNW M;  4DR5 M;  1OGB A;  3J7A S;  3KP1 E;  4S12 A;  1QAN A;  4W5W A;  4JYA M;  2H5X A;  1AIW A;  4Z8X A;  2L6O A;  1XNR M;  5A2Q S;  2F5S A;  3UZU A;  4AKG A;  4FCV A;  1WGN A;  2R65 A;  2Y21 A;  1OAO C;  2G8L A;  3GLH E;  4GRI A;  4G4Q A;  4WUR A;  4HMC A;  3U6S A;  2R62 A;  2OOA A;  3K2L A;  3KOY E;  1O6I A;  2JCH A;  2Y2I A;  3K92 A;  1IM2 A;  4RF1 A;  4WP2 A;  1D0K A;  3WD2 A;  3J81 S;  1OIP A;  5KPR A;  3HHX A;  1N78 A;  3WD3 A;  3LW5 F;  5LMN M;  2F5O A;  2GNO A;  2KRU A;  4L16 A;  2XSZ D;  3J80 S;  1IY0 A;  1L2D A;  1OGG A;  1TH3 A;  4GC9 A;  2RRU A;  1JR3 D;  1X37 A;  4MGI E;  2DVW B;  2RGO A;  4AI6 A;  3WD4 A;  5F3W A;  1E9R A;  3FD9 A;  4OU7 A;  4DV3 M;  3RE8 A;  4LRT A;  3VDP A;  2C99 A;  4MGK E;  4ZPX A;  3U6Q A;  2G5G X;  1NHW C;  4LJ6 A;  2CRU A;  4DV5 M;  5H37 D;  2VQF M;  4LF7 M;  2CV0 A;  1I4W A;  4OVZ A;  1EIJ A;  2QEN A;  3VK7 A;  1LTM A;  3KOW E;  3Q8X A;  4B3S M;  2R4J A;  4MGZ E;  1VG5 A;  2ZAN A;  3DZD A;  3C9P A;  2K9D A;  3DA1 A;  5E6J A;  5ITU A;  3SMP A;  2UU9 M;  4IBE A;  4PD2 A;  2DAE A;  3F92 A;  1GL6 A;  4IBD A;  5KQ8 A;  2XEP A;  2XSZ A;  1K82 A;  1GO5 A;  3U60 A;  1D0M A;  1QAM A;  1NVM A;  3LCU A;  4IJF A;  5DYI A;  1IBL M;  1HT2 E;  1W5S A;  1XHB A;  1L2C A;  2D7E A;  2LWX A;  1IXS B;  5ITQ A;  3HU2 A;  1CK7 A;  3CF0 A;  1ZQ9 A;  4AKH A;  2M5Z A;  3WX7 A;  2D7H A;  1QUS A;  1L6J A;  2O01 F;  4CHT B;  4DR6 M;  2Z3X A;  2Y2P A;  2CP8 A;  2L2D A;  3GPP A;  1GLN A;  4MH0 E;  1TR8 A;  3NBI A;  1QYR A;  3J7B A;  1IBK M;  1GJT A;  2QP9 X;  3ILK A;  2I7P A;  2KNZ A;  2B3T A;  4LF6 M;  3RFW A;  2ZTC A;  1HNX M;  4JI5 M;  2KA6 B;  3AJI B;  1QAO A;  4FWD A;  3SAW A;  1UR8 A;  1SXJ E;  3HHZ A;  4OVZ B;  3QAU A;  4M9S A;  1Z59 A;  3HU3 A;  3ZH9 B;  1N75 A;  3VFD A;  2R18 A;  2R4E A;  3GQ3 A;  2X49 A;  4NZ1 A;  4TX8 A;  4OJL A;  4Z2I A;  4D82 A;  4L15 A;  4NOO B;  3QYB A;  4NSO B;  5L8R F;  3MK6 A;  4JXJ A;  2CWB A;  4QHT A;  2HWJ A;  5BR8 M;  4LZZ A;  1QDR A;  2JXN A;  1ZMV A;  2MRO B;  2LVN C;  2DEN A;  2GQF A;  4IBF A;  1QQW A;  1KS0 A;  1G8P A;  1VDL A;  2DHR A;  2JUJ A;  1N34 M;  4MGY E;  4DV7 M;  2DWM A;  3E4R A;  3FE3 A;  1GPF A;  2QCU A;  2JP7 A;  3GRR A;  1SXJ D;  2XH9 A;  2DHY A;  3SYK A;  1PJS A;  1A5T A;  2C9C A;  2KHH A;  2KXE A;  4REZ A;  1QZM A;  2JZ1 A;  4Z2G A;  3TWL A;  4AG5 A;  1SXJ A;  4GEW A;  4IBI A;  3HJ8 A;  1XB2 B;  4PDG A;  2YR0 A;  2DAM A;  1E9S A;  1Q02 A;  1OJL A;  1TH2 A;  3BXW A;  1SXJ C;  5ITR A;  1KFV A;  1G59 A;  4OX9 M;  3R9X B;  4AQY M;  2DAG A;  3HHY A;  1F4I A;  5IWA M;  4CGY B;  3TE6 A;  2C5R A;  4M9Z A;  3AL0 C;  2R45 A;  2YFQ A;  1L8Q A;  4HEO A;  4JI8 M;  1T6O A;  3TWK A;  5EXP A;  3TQS A;  1XXH B;  3GLH A;  3IHP A;  2WSF F;  3W67 A;  1IXR C;  3A46 A;  3CF6 E;  2CUZ A;  7CAT A;  2EJS A;  3W0L B;  2QBY B;  1IXS A;  1C1K A;  4YHH M;  1H0I A;  3LVW A;  3C3D A;  2WSC F;  3EIE A;  5ITY A;  2QSF X;  1YSY A;  2OO9 A;  4B3T M;  1WHC A;  1YLA A;  1XC8 A;  2UUB M;  1G3I A;  1AUA A;  1G41 A;  4DUZ M;  1T43 A;  4AZF A;  4NY2 A;  4F2L A;  3GRU A;  5FLX S;  1QUT A;  4KLN A;  1J5E M;  4Q7J A;  2XZU A;  4IBC A;  4IBG A;  5BPV A;  4I81 A;  1G4A E;  2QHO B;  1GL7 A;  1N36 M;  1NV8 A;  1GVN A;  2K6B A;  3E46 A;  3GRY A;  5KPZ A;  4MM3 B;  4EIW A;  4L8R C;  4IBB A;  3SMS A;  3LMM A;  3SFZ A;  2F5P A;  1W1V A;  3I51 A;  4KHP M;  2A5Y B;  5FTL A;  5JI2 E;  5EP4 A;  5ITX A;  3IEC A;  3MQL A;  5JI3 E;  1G71 A;  3L26 A;  1IBM M;  4LFC M;  1J7M A;  2J5Y A;  1IN6 A;  1XMO M;  4Z2L A;  4G3O A;  2D7G A;  3L2A A;  4LF9 M;  1E6R A;  3HHW A;  4FW9 A;  4AG6 A;  1VDD A;  4JI2 M;  3SAT A;  2KNV A;  3HZJ A;  1L1T A;  3WD1 A;  2VII A;  3GO8 A;  1E88 A;  2UWX A;  3GLF E;  3T1H M;  1TTE A;  2K0B X;  3K9P A;  1Z5A A;  3HY5 A;  2R46 A;  2VF7 A;  2CE7 A;  2KNA A;  2JY8 A;  1LV7 A;  2LHG A;  2RGH A;  2ZAO A;  3FUU A;  2CHV A;  4LGY A;  1EAK A;  3GPU A;  4M0D A;  1V34 A;  1WJ7 A;  4GIT A;  5FTM A;  2Y20 A;  2MGW A;  4JI0 M;  1TDZ A;  1N33 M;  3U6E A;  1E6N A;  4NZ5 A;  4NL4 H;  4I4L A;  2CHQ A;  2G3Q A;  3B7Q A;  1SXJ B;  3AOE C;  1NNU C;  2OOB A;  1JQJ C;  1IN8 A;  1QDT A;  3FYC A;  4JI3 M;  3W68 A;  3GPX A;  2EA0 A;  1PM5 A;  1R2Y A;  2DNA A;  3PNY A;  1XWI A;  4KOD A;  1W1T A;  1MU5 A;  4XGI A;  5C1B A;  4LZJ A;  2FE8 A;  3PVS A;  1EFU B;  1MN3 A;  3FRI A;  4LF8 M;  3LQQ A;  1D2N A;  4LY6 A;  1R2Z A;  4P17 A;  3U60 B;  2Y2M A;  1Z6T A;  3FTC A;  1YU2 A;  2NQ8 C;  4JI4 M;  2DZN B;  2F4V M;  3KXE C;  1E6Z A;  4YY3 M;  1PGY A;  4Z6Y A;  2K47 A;  3JR5 A;  3GLG A;  3U61 B;  1HJP A;  1NV9 A;  4I8O A;  2L4E A;  2V6Z M;  4L4U A;  3VK8 A;  1KSF X;  4GMQ A;  5EJC A;  1PDC A;  4DV6 M;  1HNZ M;  4Z2K A;  2QBY A;  3D8B A;  3PFI A;  1Z5B A;  2LVQ D;  1YU4 A;  4CIS A;  3U6D A;  2Y2K A;  2DZO B;  2UXB M;  4M0W A;  4NXN M;  4JI6 M;  3AV0 A;  1VEG A;  1N32 M;  2O25 A;  3TPZ A;  2V1C A;  4FVM A;  4MGH A;  3E21 A;  2JE5 A;  4NYU A;  4LFB M;  4B3M M;  3T6P A;  3SHF A;  1IN5 A;  3I01 M;  4GH9 A;  3KSX A;  4F1I A;  3T1Y M;  1HT1 E;  1ZV1 A;  1V33 A;  2DAI A;  2JY6 B;  3L29 A;  4LJ9 A;  4QOS A;  2L4F A;  4RKU F;  3SAR A;  1W1P A;  5KPT A;  2FOI C;  3C58 A;  8CAT A;  2ZM6 M;  1OFH A;  3KS4 A;  1ZAE A;  1UM8 A;  2JNH A;  3K9O A;  4KT0 F;  5DFL A;  3UGJ A;  2VQE M;  4GKK M;  1Z5C A;  3I04 M;  4PT5 A;  2FFJ A;  3H4M A;  3QYE A;  4L78 A;  4LFA M;  3GP1 A;  2YQZ A;  1QZE A;  3SBJ A;  1IXZ A;  2BJW A;  4LJ7 A;  2KZU A;  1PJI A;  3J2P B;  4XK8 F;  4DR1 M;  2OQ4 A;  2UXD M;  3KSJ A;  1YU0 A;  3MJ5 A;  1NY5 A;  3GLI E;  1IN4 A;  1HR0 M;  1TH4 A;  4DUY M;  2JY5 A;  1VQ1 A;  1I94 M;  2LVO C;  3B7N A;  3M6A A;  4NRV A;  3SAU A;  2XF3 A;  4DV2 M;  3FUW A;  1NJF A;  1Q3B A;  1YUE A;  3FTD A;  2Z4R A;  3FUV A;  4Y28 F;  2FFF B;  1IQP A;  2C96 A;  1ORY B;  1ZMW A;  4HLQ A;  3J27 B;  4JV5 M;  3A98 B;  4LG2 A;  4G6Z A;  4A3V B;  2LNH C;  2P5T A;  2QPA A;  4DR7 M;  1V92 A;  3KW6 A;  3MHV C;  3FUX A;  1C7Y A;  2CEA A;  4MB4 A;  2JY7 A;  3V76 A;  1HQC A;  2QZ4 A;  2Y0Q A;  1DGB A;  1DGH B;  1J09 A;  3AKZ A;  2V5O A;  3IG8 A;  4R7G A;  3B89 A;  5EP3 A;  4D80 A;  2DI0 A;  1J7K A;  2Y2G A;  4ANR A;  4R3D A;  2XD1 A;  3GRV A;  1DGG A;  4G4R A;  4LJA A;  3U6C A;  1PJT A;  1TGU A;  1YE9 A;  3SC3 A;  2L7H A;  4M9X A;  1HQY E;  2X4A A;  2KW0 A;  4QHS A;  3HKP A;  3UMM A;  2APL A;  4OW0 A;  3HON A;  3L27 A;  4AW4 A;  3LQR A;  3B9P A;  1QVR A;  2FH0 A;  5C18 A;  1YU3 A;  4PDI A;  2UXC M;  1MJG M;  4ITQ A;  2Y2H A;  4OJP A;  3U6L A;  2VDB B;  3NBX X;  1KYI A;  5FTN A;  3AOE A;  4HMD A;  3A42 A;  2LXE A;  4NZ3 A;  4Z2H A;  1CXW A;  4OJ5 A;  4RNA A;  4DR3 M;  1XXH A;  3GLH B;  4D81 A;  2DWN A;  3GLI B;  2UUC M;  5IT9 S;  5EXS A;  1GXD A;  1PJQ A;  3KOZ E;  1E32 A;  4BB9 A;  3SHG B;  4DR4 M;  2EO2 A;  3VKG A;  4FWG A;  1QAQ A;  4LJ8 A;  2VF8 A;  1NO1 A;  2HHH M;  4DV0 M;  2Q2E B;  3KOX E;  1VEK A;  3PXG A;  3QWL A;  3EIH A;  1IN7 A;  3KVW A;  5ITT A;  3U61 A;  3NWL A;  1WIV A;  4X62 M;  4BLC A;  3SAV A;  3FTE A;  1RU3 A;  2J7N A;  1UR9 A;  2YNM D;  4FWH A;  1DV0 A;  1SG9 A;  2R0I A;  3FUT A; 
#chains in the Genus database with same CATH homology
 3TL4 X;  4DV1 M;  4IJE A;  1T3T A;  1YUB A;  4LRS A;  5IRE B;  3GQ5 A;  2H1R A;  3WHL A;  3T15 A;  4TUW A;  1H6U A;  4IBJ A;  3THG A;  1NJG A;  2HCB A;  4MB7 A;  3ZC7 B;  2L09 A;  2DXI A;  3KDS E;  3CTW B;  3FTF A;  2O5R A;  5EP1 A;  4GHL A;  3JR4 A;  4XBO A;  3ZCB B;  1E94 E;  3A45 A;  3JAM S;  2XLJ A;  3VDU A;  3GLI A;  1NHG C;  1TDH A;  1NY6 A;  4LJ4 A;  5E26 A;  2Y2N A;  2F5N A;  5GKN A;  3W0F A;  4QNL A;  1L2B A;  4X65 M;  3HU1 A;  2Y2L A;  3HJQ A;  3IG5 A;  4LF5 M;  3U5Z B;  2X8A A;  4FCW A;  3L28 A;  2XFT A;  4FCT A;  3RGS A;  4NSR A;  2BG1 A;  3K1J A;  3M0E A;  1IY2 A;  1K3X A;  3UK6 A;  4LJ5 A;  3LVV A;  3GLF A;  4BBA A;  1Q3C A;  2KZS A;  2Y2Q A;  1NSF A;  4QNR A;  2IOU A;  1Q39 A;  1S3S A;  3KFU G;  5FTK A;  2C98 A;  2ERC A;  4JI7 M;  4QOZ C;  4B7H A;  4RF0 A;  4B08 A;  4HL4 A;  5EXX A;  2FNA A;  1GKI A;  2ZAM A;  4PCZ A;  5KO3 A;  3HGI A;  5EXT A;  2CHG A;  3U6M A;  2L7I A;  2CV1 A;  3PNV A;  4LGM A;  2BJV A;  2BNK A;  2XFS A;  4OJO A;  2M60 A;  4IIW A;  5KQD A;  1DGF A;  3GLG B;  4G4N A;  1R6B X;  4JN6 A;  5EP2 A;  3E9S A;  1OFI A;  3D8L A;  2LH0 A;  4B7G A;  3UJN A;  5DYG A;  4X66 M;  4DR2 M;  4NYY A;  2XZF A;  1N77 A;  2JA2 A;  1XMQ M;  2UUA M;  3FYD A;  2KEB A;  2EUC A;  2HKJ A;  5LMU M;  2OPF A;  2W82 A;  3GPY A;  3HJS A;  1YU1 A;  3HWS A;  1MX0 A;  4NXM M;  3KS8 A;  4GHA A;  3T38 A;  4AKI A;  1L1Z A;  2Y2O A;  3TWM A;  3FKE A;  1EE8 A;  1WXQ A;  2J7O A;  3SAS A;  1K3W A;  3L25 A;  1DO0 A;  4K0K M;  4OJ6 A;  2Y2J A;  2AHM A;  4KO8 A;  3N3F A;  4I5S A;  4LCB A;  1DGH A;  3K8Z A;  3AOG A;  3VKH A;  2Y0T A;  3R8F A;  4NZ4 A;  1FNN A;  2ZBK B;  3VLF B;  1W5T A;  3U5Z A;  4GIP A;  5FSW A;  2V1U A;  4JI1 M;  4P16 A;  3AFH A;  3WHK A;  5ITX E;  2CV2 A;  4OUI A;  2RKO A;  1DO2 A;  2DWZ B;  3I4V A;  3U6P A;  4WW0 A;  3CF2 A;  3GQ4 A;  4DV4 M;  2I7N A;  1FJG M;  4B3R M;  4GKJ M;  3HSH A;  4NRW A;  1JR3 A;  3SYL A;  3RGP A;  2E5L M;  5FTJ A;  4B7F A;  2XGN A;  3M7G A;  1R7R A;  1XNQ M;  1IY1 A;  3I4Y A;  5EQT A;  3DFZ A;  3KP0 E;  4FD2 A;  4G4O A;  2C9O A;  2KRK A;  2Z4S A;  3DOA A;  3BOS A;  2HL7 A;  5DNY A;  2CFO A;  1PJJ A;  2Z7J A;  4LF4 M;  1NNJ A;  3GLF B;  3U6O A;  4IBK A;  5IZ7 D;  4GC5 A;  4X64 M;  2DWL A;  2F5Q A;  4QNM A;  4II7 A;  2XD5 A;  1HNW M;  4DR5 M;  3J7A S;  3KP1 E;  4S12 A;  1QAN A;  4W5W A;  4JYA M;  4Z8X A;  2L6O A;  1XNR M;  5A2Q S;  2F5S A;  3UZU A;  4AKG A;  4FCV A;  2R65 A;  2Y21 A;  2G8L A;  4G4Q A;  4GRI A;  4WUR A;  3U6S A;  2R62 A;  3K2L A;  3KOY E;  2JCH A;  2Y2I A;  3K92 A;  1IM2 A;  4RF1 A;  3J81 S;  5KPR A;  3HHX A;  1N78 A;  5LMN M;  2F5O A;  2KRU A;  3J80 S;  4L16 A;  2XSZ D;  1L2D A;  1IY0 A;  1TH3 A;  4GC9 A;  1JR3 D;  1X37 A;  4MGI E;  2DVW B;  2RGO A;  4AI6 A;  5F3W A;  1E9R A;  3FD9 A;  4OU7 A;  4DV3 M;  3RE8 A;  4LRT A;  3VDP A;  2C99 A;  4MGK E;  4ZPX A;  3U6Q A;  2G5G X;  1NHW C;  4LJ6 A;  4DV5 M;  5H37 D;  2VQF M;  4LF7 M;  2CV0 A;  1I4W A;  4OVZ A;  2QEN A;  3VK7 A;  3KOW E;  3Q8X A;  4B3S M;  2R4J A;  4MGZ E;  5ITU A;  2ZAN A;  3DZD A;  5E6J A;  3DA1 A;  3SMP A;  2UU9 M;  4IBE A;  4PD2 A;  4IBD A;  1GL6 A;  5KQ8 A;  2XEP A;  2XSZ A;  1K82 A;  3U60 A;  1QAM A;  1NVM A;  4IJF A;  5DYI A;  1IBL M;  1HT2 E;  1W5S A;  1XHB A;  1L2C A;  2D7E A;  2LWX A;  1IXS B;  5ITQ A;  3HU2 A;  3CF0 A;  1ZQ9 A;  4AKH A;  2M5Z A;  3WX7 A;  2D7H A;  4CHT B;  4DR6 M;  2Z3X A;  2Y2P A;  3GPP A;  1GLN A;  4MH0 E;  3NBI A;  1QYR A;  3J7B A;  1IBK M;  3ILK A;  2QP9 X;  2I7P A;  4LF6 M;  3RFW A;  1HNX M;  4JI5 M;  2KA6 B;  3AJI B;  1QAO A;  4FWD A;  3SAW A;  1SXJ E;  3HHZ A;  4OVZ B;  3QAU A;  4M9S A;  1Z59 A;  3HU3 A;  3ZH9 B;  1N75 A;  3VFD A;  2R18 A;  2R4E A;  3GQ3 A;  2X49 A;  4NZ1 A;  4OJL A;  4D82 A;  4L15 A;  4NOO B;  4NSO B;  3MK6 A;  4JXJ A;  4QHT A;  5BR8 M;  4LZZ A;  4IBF A;  1QQW A;  1G8P A;  2DHR A;  1N34 M;  4MGY E;  4DV7 M;  2DWM A;  3E4R A;  2QCU A;  3GRR A;  1SXJ D;  2XH9 A;  3SYK A;  2KXE A;  2C9C A;  4REZ A;  1QZM A;  3TWL A;  4AG5 A;  1SXJ A;  4IBI A;  3HJ8 A;  4PDG A;  2YR0 A;  1E9S A;  1OJL A;  1TH2 A;  1SXJ C;  5ITR A;  1KFV A;  1G59 A;  4OX9 M;  3R9X B;  4AQY M;  3HHY A;  5IWA M;  4CGY B;  3TE6 A;  2C5R A;  4M9Z A;  3AL0 C;  2R45 A;  2YFQ A;  1L8Q A;  4JI8 M;  3TWK A;  5EXP A;  3TQS A;  1XXH B;  3GLH A;  1IXR C;  3A46 A;  3CF6 E;  2CUZ A;  7CAT A;  3W0L B;  2QBY B;  1C1K A;  4YHH M;  3LVW A;  3EIE A;  5ITY A;  1YSY A;  4B3T M;  1XC8 A;  2UUB M;  1G3I A;  1G41 A;  4DUZ M;  4AZF A;  4NY2 A;  3GRU A;  5FLX S;  4KLN A;  1J5E M;  2XZU A;  4IBC A;  4IBG A;  5BPV A;  4I81 A;  1G4A E;  1GL7 A;  1N36 M;  3GRY A;  1GVN A;  4MM3 B;  4EIW A;  4L8R C;  4IBB A;  3SMS A;  3LMM A;  3SFZ A;  2F5P A;  3I51 A;  4KHP M;  2A5Y B;  5FTL A;  5JI2 E;  5EP4 A;  5ITX A;  5JI3 E;  3L26 A;  1IBM M;  4LFC M;  1IN6 A;  1XMO M;  2D7G A;  3L2A A;  4LF9 M;  3HHW A;  4FW9 A;  4AG6 A;  1VDD A;  4JI2 M;  3SAT A;  1L1T A;  2VII A;  3GO8 A;  2UWX A;  3T1H M;  1Z5A A;  2R46 A;  2CE7 A;  2RGH A;  1LV7 A;  2ZAO A;  3FUU A;  2CHV A;  4LGY A;  3GPU A;  4M0D A;  4GIT A;  5FTM A;  2Y20 A;  4JI0 M;  1N33 M;  1TDZ A;  4NZ5 A;  3U6E A;  4NL4 H;  4I4L A;  2CHQ A;  1SXJ B;  3AOE C;  1NNU C;  3FYC A;  1JQJ C;  1IN8 A;  4JI3 M;  3OTO M;  3GPX A;  2EA0 A;  1PM5 A;  1R2Y A;  3PNY A;  1XWI A;  4KOD A;  1MU5 A;  4XGI A;  5C1B A;  4LZJ A;  2FE8 A;  3PVS A;  4LF8 M;  3LQQ A;  1D2N A;  4LY6 A;  1R2Z A;  3U60 B;  2Y2M A;  3FTC A;  1Z6T A;  1YU2 A;  2NQ8 C;  4JI4 M;  2DZN B;  2F4V M;  3KXE C;  4YY3 M;  3JR5 A;  4Z6Y A;  2K47 A;  3GLG A;  3VK8 A;  3U61 B;  4I8O A;  4L4U A;  2V6Z M;  1KSF X;  4GMQ A;  5EJC A;  4DV6 M;  1HNZ M;  2QBY A;  3D8B A;  3PFI A;  1Z5B A;  1YU4 A;  4CIS A;  3U6D A;  2Y2K A;  2DZO B;  2UXB M;  4M0W A;  4NXN M;  4JI6 M;  3AV0 A;  1N32 M;  3TPZ A;  2V1C A;  4FVM A;  4MGH A;  2JE5 A;  4NYU A;  4LFB M;  4B3M M;  3SHF A;  1IN5 A;  4GH9 A;  3KSX A;  3T1Y M;  1HT1 E;  3L29 A;  4LJ9 A;  4QOS A;  3SAR A;  5KPT A;  2FOI C;  3C58 A;  8CAT A;  2ZM6 M;  1OFH A;  3KS4 A;  1ZAE A;  1UM8 A;  2VQE M;  3UGJ A;  4GKK M;  1Z5C A;  4PT5 A;  2FFJ A;  3H4M A;  4L78 A;  4LFA M;  3GP1 A;  2YQZ A;  3SBJ A;  1PJI A;  1IXZ A;  2BJW A;  4LJ7 A;  2KZU A;  1YU0 A;  3J2P B;  4DR1 M;  2FFF B;  2OQ4 A;  2UXD M;  3KSJ A;  3MJ5 A;  1NY5 A;  1IN4 A;  1HR0 M;  1TH4 A;  4DUY M;  1I94 M;  3M6A A;  4NRV A;  3SAU A;  2XF3 A;  4DV2 M;  3FUW A;  1NJF A;  1Q3B A;  1YUE A;  3FTD A;  2Z4R A;  3FUV A;  1IQP A;  2C96 A;  1ORY B;  4HLQ A;  4JV5 M;  3J27 B;  3A98 B;  4LG2 A;  4G6Z A;  4A3V B;  2LNH C;  2P5T A;  2QPA A;  4DR7 M;  3KW6 A;  3MHV C;  3FUX A;  2CEA A;  1HQC A;  2QZ4 A;  2Y0Q A;  1DGB A;  1DGH B;  1J09 A;  3AKZ A;  3IG8 A;  4R7G A;  5EP3 A;  4D80 A;  1J7K A;  2Y2G A;  4R3D A;  2XD1 A;  3GRV A;  1DGG A;  4G4R A;  4LJA A;  3U6C A;  1TGU A;  1YE9 A;  3SC3 A;  2L7H A;  4M9X A;  1HQY E;  2X4A A;  2KW0 A;  4QHS A;  3HKP A;  3UMM A;  4OW0 A;  3HON A;  3L27 A;  4AW4 A;  3LQR A;  3B9P A;  1QVR A;  5C18 A;  1YU3 A;  4PDI A;  2UXC M;  4ITQ A;  2Y2H A;  4OJP A;  3U6L A;  5FTN A;  1KYI A;  4NZ3 A;  3AOE A;  3A42 A;  2LXE A;  4OJ5 A;  4RNA A;  4DR3 M;  1XXH A;  3GLH B;  4D81 A;  2DWN A;  3GLI B;  2UUC M;  5IT9 S;  5EXS A;  4BB9 A;  3KOZ E;  1E32 A;  3SHG B;  4DR4 M;  2EO2 A;  3VKG A;  4FWG A;  1QAQ A;  4LJ8 A;  2HHH M;  4DV0 M;  2Q2E B;  3KOX E;  3PXG A;  3QWL A;  3EIH A;  1IN7 A;  3KVW A;  5ITT A;  3U61 A;  3NWL A;  4X62 M;  4BLC A;  3SAV A;  3FTE A;  2J7N A;  2YNM D;  4FWH A;  5KPZ A;  3FUT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...