4IJFA

Crystal structure of the zaire ebolavirus vp35 interferon inhibitory domain k222a/r225a/k248a/k251a mutant
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
123
structure length
123
Chain Sequence
DISAADLANIMYDHLPGFGTAFHQLVQVICALGADSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polymerase cofactor VP35
publication title Development of RNA Aptamers Targeting Ebola Virus VP35.
pubmed doi rcsb
source organism Zaire ebolavirus
molecule tags Viral protein
total genus 36
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2012-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ijfA01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4ijfA02
3L29A 4GHLA 4IBBA 5BPVA 3L27A 4GHAA 4IBIA 3L26A 4GH9A 4LG2A 3L28A 4IBFA 3KS4A 3L25A 4IBKA 4IJFA 4IJEA 4IBGA 3KS8A 3FKEA 3L2AA 4IBJA 4IBCA 4IBDA 4IBEA
chains in the Genus database with same CATH superfamily
4NOOB 1LTMA 2KNVA 4B7GA 1L1ZA 5KO3A 5LMNM 3I04M 4L78A 1T3TA 3NWLA 1YSYA 2OOBA 2ZANA 3FUUA 3WHLA 1TF0B 4L16A 3HU2A 4OU7A 3THGA 1IN7A 3TQSA 4JI4M 2BWBA 3GLHA 1NV9A 3GLFB 2CHQA 3DA1A 5IREB 4DR3M 1W5TA 4S12A 4L8RC 4TX8A 4Z2IA 4Z2LA 4KO8A 4L6V6 3KP1E 3GLGB 2LNHC 4AKHA 3KOZE 4G3OA 1OJLA 4RKUF 2Y0QA 3B74A 2V5OA 1HQYE 1A5TA 2XSZD 2KXEA 5BR8M 3FUVA 1TR8A 2QCUA 4GMQA 4TUWA 1YU0A 2Y2HA 2J5YA 4Z6YA 4QNRA 3PXGA 2RTSA 1PDCA 2HCBA 1J5EM 2R44A 4DUYM 4LF7M 4NRWA 2F4VM 4IBBA 1W1VA 2FN2A 4LZZA 1ZAEA 2RGOA 1J7KA 3AFHA 1XNRM 4QNMA 3GLIB 1SXJE 5ITTA 2OPFA 2DHRA 3FRHA 1GABA 4CGYB 1JR3D 2A5YB 3H4MA 1GO5A 3N3FA 5KPZA 2BJVA 2O25A 2Z4RA 3K2LA 4G4RA 3VKGA 3VLFB 4JI8M 1V33A 2MR9A 3FRIA 3CF0A 3U5ZA 4JI1M 2R65A 3E21A 1WGLA 2FOIC 4CIZA 5KPRA 2OQ4A 2FFFB 1SXJA 2DI0A 1DGHB 1VQ1A 3NBIA 1XNQM 3WX7A 5EQTA 1L2BA 4XGIA 4LY6A 4X64M 1CK7A 2EKKA 3FUTA 2R62A 3FYCA 3GQ4A 3TL4X 4IBDA 4DR4M 3ZH9B 1X37A 3D8LA 1G59A 3SAVA 4D81A 2UU9M 5ITXE 2LH0A 1XXHB 3T1HM 2I7PA 1PM5A 1VEGA 1NO1A 3GLHB 3LVVA 2MROB 4FWGA 3LQRA 2UWXA 3W67A 1QANA 4OUIA 3QYBA 4Z2JA 4IJEA 3HWSA 4PCZA 5IZ7D 3FUXA 3FKEA 1WGNA 2N35A 1TTEA 3CTWB 3KP0E 4NZ5A 4MB4A 3GO8A 2Y2KA 4HMCA 1RU3A 3LQQA 1PJSA 3FTDA 3SAUA 1W1YA 1VDLA 2D7GA 4R3DA 2Y2GA 2K9DA 3VDPA 2QSFX 4Z2GA 2CUZA 4FD2A 2L7IA 4MGKE 3E46A 1TH3A 4RF1A 5IT9S 4AZFA 3ZQJA 3E4RA 2E5LM 1Z59A 4FW9A 1HQCA 4HL4A 4LJAA 3J7AS 1PJTA 4X62M 4Z8XA 4LRTA 4NY2A 2XSZA 4G4OA 3A42A 1KYIA 1UR9A 4NSOB 1H8PA 3I01M 1XMQM 1K3WA 2GQFA 5ITRA 2QBYA 1NSFA 3K9PA 3CF6E 4OX9M 1EAKA 1D0LA 3HU3A 2R0IA 4P17A 2R45A 1SXJB 1R4GA 3J81S 2Y2LA 1Z5AA 3I4YA 4DR2M 1OTRA 1QAMA 1QYRA 2XD5A 2KRUA 4DV2M 3GQ3A 1NNJA 1YUEA 4DV7M 3FE3A 2JZ0A 3UZUA 3VK7A 1GXDA 2VQFM 4KLNA 1JR3A 1I94M 3SFZA 4F1IA 2LHGA 5IWAM 2LBCA 1VDDA 3T6PA 4CISA 3HX3A 4PD2A 2JCHA 5DFLA 2CHVA 1O6IA 3OTOM 4CJ6A 4MGIE 3KDSE 4MGYE 4LF4M 2Y21A 1R7RA 2EUCA 2R46A 2BNKA 3C3EA 2DKLA 4MB5A 1XC8A 1QQWA 1Y8GA 3NBXX 5C18A 1MU5A 1KSFX 4OVZA 1N33M 4REZA 4XK8F 5FTNA 4IBJA 3T1YM 3HHWA 1FNNA 1QVRA 4K0KM 3QWLA 1ED7A 1QUSA 2R4EA 4AKIA 4IBCA 3J27B 4NRVA 4EIWA 3AOGA 3GRVA 4M0DA 2AHMA 4DR1M 3SHFA 3TWLA 3U61A 3SATA 3K8ZA 2HAKA 4GC5A 4QHSA 1E6PA 4IIWA 3GRYA 4LF9M 1T6OA 3MQLA 4D82A 2B3TA 2VQEM 2DWMA 3J80S 2UXCM 2CP8A 3A98B 2Z4SA 5ITYA 4LJ8A 3SMSA 4QOSA 4PT5A 3EIHA 2HL7A 1D2NA 1JB0F 1R6BX 3GRRA 3KSJA 1G41A 3WD3A 2DWLA 1E6ZA 2Y0TA 5DNYA 3ZCBB 4AG5A 3AKZA 2NQ8C 1MX0A 5EXSA 5F3WA 4OJOA 4FCTA 5KPTA 2F5NA 1Q3BA 1Z6TA 2ZM6M 1DGFA 1GKIA 2VIIA 1XMOM 2QBYB 4LF8M 3WD1A 1E88A 5EXXA 3KOXE 1SXJC 2BJWA 4R71A 2CRUA 1SG9A 3W68A 2KZSA 3TPZA 2M60A 2MH8A 4JI2M 3AJIB 2C5RA 2JY6B 3C3DA 3PNYA 3KXEC 2CV0A 2G5GX 4L15A 3B7QA 5EJCA 2R6FA 2H1RA 1E94E 3BXWA 1E32A 4M0WA 1Q39A 2P5TA 1QUTA 3UK6A 2L7HA 1Z5CA 4DV0M 3M7GA 4Y28F 3VDUA 3GP1A 4LFCM 3T15A 2EJSA 4GITA 2MGWA 2WSCF 1HNZM 2F5SA 2C99A 2EO2A 3QAUA 2QP9X 1YU1A 4NL4H 3FTEA 3MMPA 3IECA 3L25A 4LJ7A 1VG5A 2DAMA 2XFTA 5KQDA 1IFYA 3U6QA 3DOAA 3HU1A 2QPAA 3I4VA 1L8QA 4DR6M 2DAKA 2FNAA 5JI3E 3C9PA 4MB3A 5FTJA 4OVZB 3IG5A 1HJPA 2Y2PA 1TDZA 2F5QA 1S3SA 1IXSB 1GL6A 2J7NA 2XEPA 4HEOA 5GKNA 3EIEA 1Z5BA 4LGMA 1DO2A 2OOAA 2DAGA 4MB7A 3VKHA 1GOIA 4FWHA 1R2YA 1UM8A 1PJIA 3GQ5A 8CATA 2L2DA 4JI5M 2HKJA 2JUJA 4FCVA 5EXTA 3GPYA 3U6MA 2L4FA 1Q02A 1IY0A 4G4NA 4HLQA 3PVSA 2YQZA 2JWSA 2Z7JA 1N36M 1PRBA 4B7HA 2ZBKB 4YHHM 2XLJA 4OJ6A 3LCVB 1E6RA 4P16A 1QO6A 1W1PA 2APLA 4ITQA 1R5LA 2LHCA 3HHXA 5ITXA 3U6EA 3SASA 4I81A 4L4UA 1XWIA 3DZDA 5L8RF 2JZ1A 4NZ4A 1K3XA 2VDBB 1IN8A 4R7GA 4CHTB 1IBLM 3JAMS 2DWZB 1AIWA 4GC9A 4DBGB 2LVAA 1OIZA 1IBMM 4MGHA 3L2AA 4IBEA 2KW0A 2KZUA 5E6JA 4DUZM 3HKPA 2WZJA 1IN4A 3KVWA 2G3QA 1TH2A 1YU3A 2DXIA 1N75A 2LVOC 1L2CA 4GH9A 1NV8A 4M9ZA 4LG2A 4FCWA 3KS4A 2GNOA 3QYEA 2X4AA 2DAIA 3WD4A 2C9OA 3K9OA 4DV4M 4GKKM 3Q8XA 4GEWA 1GL7A 3CF2A 4AW4A 4II7A 3TWKA 3GLFE 1PJQA 3A45A 3B7ZA 4D80A 3SBJA 3KSXA 3U5ZB 4NYUA 4PDIA 3W0FA 1LV7A 3ILKA 3GLGE 2KEBA 1EFUB 1NJGA 1G3IA 4KT0F 4B7FA 5FTKA 2FH0A 4WP2A 1FJGM 2WSEF 2DAEA 4UN2B 3SMPA 3M0EA 4MH0E 1I4WA 2QZ4A 3CGWA 3FD9A 3VK8A 1PJJA 5BPVA 1NNUC 1TDHA 3M6AA 3U6PA 3AOEA 4GRIA 1H6UA 2CFOA 4LCBA 4LJ4A 3GLFA 2D49A 3L26A 2LVPC 5C1BA 3GLGA 3MJ5A 4DR7M 3L28A 3LMMA 4HMEA 1GJTA 5E26A 3SC3A 4JYAM 3I51A 3J2PB 2IOUA 1ZQ9A 4G4QA 1JQJC 3GPUA 1H0GA 4I8OA 1G8PA 2L09A 4QHTA 3GLIE 2XD1A 1KS0A 1HT1E 3HSHA 3U60A 3B7NA 3FUWA 1WIVA 2ZTCA 3UJNA 3JR4A 3RGPA 4AKGA 3HONA 2YFQA 2X8AA 4HMDA 2UXDM 1MJGM 1W5SA 2FFJA 2G8LA 1HR0M 4LJ5A 3U6SA 2CHGA 2V1UA 4RF0A 3HJSA 3IG8A 3GLIA 4RNAA 5EP3A 3K92A 4DV6M 3TWMA 1J7MA 2L6OA 5DYIA 3KFUG 1E8BA 4NZ1A 2QQ8A 1D0MA 5KQ8A 3KOYE 3RGSA 4Q7JA 1VEKA 1G4AE 4NXNM 2R18A 1DV0A 1MN3A 4OJ5A 1BVSA 2C98A 3C58A 1YU4A 5FTLA 1NY6A 4ZPXA 1GLNA 1E9RA 1V34A 3SAWA 2C96A 1OFIA 2CV2A 4MM3B 4ANRA 1XB2B 1G71A 1GPFA 3DFZA 1IY1A 1XXHE 3HHYA 4QOZC 3U6OA 2UUAM 4M9XA 1WR1B 1KFVA 2JE5A 3TE6A 1HT2E 4B3RM 3AL0C 2KRKA 1F4IA 3GPPA 1QDRA 4B3MM 1UFZA 1C7YA 2M5ZA 2JY5A 2OO9A 3D8BA 2UUBM 1IY2A 2Z3XA 2QNJA 3E9SA 4KODA 2JY8A 1AIPC 2Y2JA 1IXRC 5JI2E 1XXHA 1OQYA 3LVWA 1R2ZA 2D7EA 1CUKA 2JXNA 1E15A 1WHCA 1DO0A 1UR8A 3UMMA 3PFIA 1K82A 2FE8A 2HHHM 1WJ7A 1OIPA 4IBKA 3MHVC 1NHWC 4FWDA 4JI3M 3W0LB 3A46A 1IQPA 2QENA 3ZC7B 1OKSA 3RFWA 1QDTA 1NHGC 2UXBM 1GVNA 3U60B 1J09A 4MGZE 1IXZA 5EXPA 3GRUA 4OW0A 3H4JA 1YUBA 1H0IA 2LTUA 2L4EA 4GKJM 1L6JA 2RGHA 5FTMA 1NJFA 1OAIA 5EP4A 3WD0A 4QNLA 2BWEA 2W82A 2LVNC 2O5RA 3U61B 5FSWA 3WD2A 1ZMUA 5EP2A 3KW6A 1EE8A 3U6LA 4A3VB 5FLXS 1N34M 2F5PA 4B3SM 1YU2A 2X49A 3SYKA 3HHZA 2KNZA 5EP1A 2V1CA 4G6ZA 1ORYB 2K0BX 4BLCA 2JNHA 3B89A 4IJFA 3V76A 4BB9A 4JV5M 4M9SA 1N78A 1E9SA 1TH4A 2H5XA 4IBGA 4I5SA 1DGGA 2XZUA 2KHHA 1V92A 3PNVA 4DV3M 2XZFA 4WW0A 4LF6M 1L2DA 4F2LA 4B3TM 4X66M 2DZLA 4AG6A 4JI6M 1ZV1A 2Z8YM 2K47A 1OGGA 1HNXM 1QZEA 2RRUA 3HGIA 4NZ3A 2UUCM 2R4JA 4GHLA 2C9CA 2KNAA 1TGUA 2D7HA 3AOEC 4I4LA 2DNAA 3FYDA 3VFDA 1QAOA 2JY7A 4AQYM 2Y2OA 1GJSA 3FTCA 1ZMVA 1IM2A 3SARA 3RE8A 4LF5M 4KHPM 4NXMM 4LZJA 4BBAA 3F92A 2XFSA 4LJ9A 1L1TA 1OFHA 3KS8A 2Y2NA 4LRSA 4XBOA 1W1TA 1YE9A 2JP7A 4FVMA 2YNMD 4JN6A 3WHKA 3UGJA 2LXEA 3BOSA 2ZTDA 1OAOC 3GPXA 1N77A 2EKFA 1EIJA 3IHPA 4LFBM 4NYYA 2DZOB 1ZMWA 3BBZA 1QZMA 3Q8GA 2CWBA 2F5OA 2YR0A 3KOWE 3L29A 2DHYA 2CV1A 3MK6A 3L27A 1VEJA 1IBKM 2Q2EB 2VF8A 1NVMA 4OJLA 4X65M 2I7NA 3R8FA 4DV5M 3AV0A 2XGNA 2RKOA 1IN6A 2ZAOA 2XF3A 2LVQD 2BG1A 3M7PA 4B08A 1PGYA 1JR3E 3FTFA 2KA6B 2VF7A 2DVWB 4JXJA 4NC6A 2Y2IA 1C1KA 5H37D 7CATA 1WXQA 1Q3CA 4Z2KA 1CXWA 4PDGA 3JR5A 4NSRA 5ITUA 2KDLA 2EA0A 4OJPA 1D0KA 2HWJA 1SXJD 3HZJA 4AI6A 2O01F 2WSFF 1XHBA 1E6NA 1OGBA 3R9XB 4Z2HA 1N32M 3B9PA 4LJ6A 4GHAA 2MJ5B 4JI7M 1YLAA 4JI0M 1QAQA 2V6ZM 3J7BA 4IBIA 5A2QS 4YY3M 4LFAM 5DYGA 4IBFA 3U6DA 2DWNA 2XH9A 4W5WA 1NY5A 5ITQA 2Y2QA 4LGYA 4DR5M 2DZNB 2QHOB 1P3QQ 2ERCA 2J7OA 2Y2MA 2CEAA 4WURA 1DGHA 3T38A 2JA2A 3K1JA 3LW5F 4DV1M 1HNWM 3LCUA 1IXSA 3GLHE 1AUAA 1DGBA 3HJQA 3HJ8A 2Y20A 5LMUM 4GIPA 2CE7A 2DENA 3SHGB 3U6CA 3HY5A 2FS1A 3SYLA 2K6BA 2ZAMA 1T43A 2LWXA 1IN5A
chains in the Genus database with same CATH topology
4NOOB 4B7GA 1L1ZA 5KO3A 5LMNM 4L78A 1T3TA 3NWLA 1YSYA 2ZANA 3FUUA 3WHLA 4L16A 4OU7A 3HU2A 2Y2GA 3THGA 1IN7A 3TQSA 4JI4M 3GLHA 3GLFB 4DR3M 2CHQA 3DA1A 5IREB 4L8RC 1W5TA 4S12A 4KO8A 3GLGB 3KP1E 2LNHC 4AKHA 3KOZE 1OJLA 2Y0QA 1HQYE 2XSZD 2KXEA 5BR8M 3FUVA 2QCUA 4GMQA 4TUWA 1YU0A 2Y2HA 4Z6YA 4QNRA 3PXGA 2HCBA 1J5EM 4LF7M 4DUYM 4NRWA 2F4VM 4IBBA 4LZZA 1ZAEA 2RGOA 1J7KA 3AFHA 1XNRM 4QNMA 3GLIB 1SXJE 5ITTA 2OPFA 2DHRA 4CGYB 1JR3D 2A5YB 3H4MA 3N3FA 5KPZA 2BJVA 2Z4RA 3K2LA 4G4RA 3VKGA 3VLFB 4JI8M 4NYYA 3CF0A 3U5ZA 4JI1M 2R65A 2FFFB 2FOIC 5KPRA 2OQ4A 1SXJA 1DGHB 3NBIA 1XNQM 3WX7A 5EQTA 1L2BA 4XGIA 4LY6A 4X64M 3FUTA 2R62A 3FYCA 3GQ4A 3TL4X 4IBDA 4DR4M 3ZH9B 1X37A 3D8LA 1G59A 3SAVA 4D81A 2UU9M 5ITXE 2LH0A 1XXHB 3T1HM 2I7PA 1PM5A 3GLHB 3LVVA 4FWGA 3LQRA 2UWXA 1QANA 4OUIA 4IJEA 3HWSA 4PCZA 3FUXA 3FKEA 3CTWB 3KP0E 4NZ5A 3GO8A 2Y2KA 3LQQA 3FTDA 3SAUA 2D7GA 4R3DA 3VDPA 2CUZA 4FD2A 2L7IA 4MGKE 4RF1A 1TH3A 5IT9S 4AZFA 3E4RA 2E5LM 1Z59A 4FW9A 1HQCA 4HL4A 4LJAA 3J7AS 4X62M 4Z8XA 4LRTA 4NY2A 2XSZA 4G4OA 3A42A 1KYIA 4NSOB 1XMQM 1K3WA 5ITRA 2QBYA 1NSFA 3CF6E 4OX9M 3HU3A 2R45A 1SXJB 3J81S 2Y2LA 1Z5AA 3I4YA 4DR2M 1QAMA 1QYRA 2XD5A 2KRUA 4DV2M 3GQ3A 1NNJA 1YUEA 4DV7M 3UZUA 3VK7A 2VQFM 4KLNA 1JR3A 1I94M 3SFZA 5IWAM 1VDDA 4CISA 4PD2A 2JCHA 2CHVA 3OTOM 4MGIE 3KDSE 4MGYE 4LF4M 2Y21A 1R7RA 2EUCA 2R46A 2BNKA 1XC8A 1QQWA 5C18A 1MU5A 1KSFX 4OVZA 1N33M 4REZA 5FTNA 4IBJA 3T1YM 3HHWA 1FNNA 1QVRA 4K0KM 3QWLA 2R4EA 4AKIA 4IBCA 3J27B 4NRVA 4EIWA 3AOGA 3GRVA 4M0DA 2AHMA 4DR1M 3SHFA 3TWLA 3U61A 3SATA 3K8ZA 4QHSA 4GC5A 4IIWA 3GRYA 4LF9M 4D82A 2VQEM 2DWMA 2UXCM 3J80S 3A98B 2Z4SA 5ITYA 4LJ8A 3SMSA 4QOSA 4PT5A 3EIHA 2HL7A 1D2NA 1R6BX 3GRRA 3KSJA 1G41A 2DWLA 2Y0TA 5DNYA 3ZCBB 4AG5A 3AKZA 2NQ8C 1MX0A 5EXSA 5F3WA 4OJOA 4FCTA 5KPTA 2F5NA 1Q3BA 1Z6TA 2ZM6M 1DGFA 1GKIA 2VIIA 1XMOM 2QBYB 4LF8M 5EXXA 3KOXE 1SXJC 2BJWA 2KZSA 3TPZA 2M60A 4JI2M 3AJIB 2C5RA 3PNYA 3KXEC 2CV0A 2G5GX 4L15A 5IZ7D 5EJCA 2H1RA 1E94E 4M0WA 1E32A 3UK6A 1Q39A 2P5TA 2L7HA 1Z5CA 4DV0M 3M7GA 3VDUA 3GP1A 4LFCM 3T15A 4GITA 1HNZM 2F5SA 2C99A 2EO2A 3QAUA 2QP9X 1YU1A 4NL4H 3FTEA 3L25A 4LJ7A 2XFTA 5KQDA 3U6QA 3DOAA 3HU1A 2QPAA 3I4VA 1L8QA 4DR6M 2FNAA 5JI3E 5FTJA 4OVZB 3IG5A 1TDZA 2F5QA 1S3SA 1IXSB 1GL6A 2J7NA 2XEPA 5GKNA 3EIEA 1Z5BA 4LGMA 1DO2A 3VKHA 4MB7A 4FWHA 1R2YA 1UM8A 1PJIA 3GQ5A 8CATA 4JI5M 2HKJA 5EXTA 4FCVA 3GPYA 3U6MA 4G4NA 1IY0A 1N36M 4HLQA 3PVSA 2YQZA 2Z7JA 4B7HA 4YHHM 2ZBKB 2XLJA 4OJ6A 4P16A 4ITQA 3HHXA 5ITXA 3U6EA 3SASA 4I81A 4L4UA 1XWIA 3DZDA 4NZ4A 1K3XA 1IBLM 1IN8A 4R7GA 4CHTB 3JAMS 2DWZB 4GC9A 1IBMM 4MGHA 3L2AA 4IBEA 2KZUA 2KW0A 5E6JA 4DUZM 3HKPA 1IN4A 3KVWA 1TH2A 1YU3A 2DXIA 1N75A 1L2CA 4GH9A 4M9ZA 4LG2A 4FCWA 3KS4A 2X4AA 2C9OA 4GKKM 4DV4M 3Q8XA 4AW4A 1GL7A 3CF2A 4II7A 3TWKA 3A45A 4D80A 3SBJA 3KSXA 3U5ZB 4NYUA 4PDIA 3W0FA 1LV7A 3ILKA 2KEBA 4B7FA 1NJGA 1G3IA 5FTKA 1FJGM 3SMPA 3M0EA 4MH0E 1I4WA 2QZ4A 3FD9A 3VK8A 1PJJA 5BPVA 1NNUC 1TDHA 3M6AA 3U6PA 3AOEA 4GRIA 1H6UA 2CFOA 4LCBA 4LJ4A 3GLFA 3L26A 5C1BA 3GLGA 3MJ5A 4DR7M 3L28A 3LMMA 5E26A 3SC3A 4JYAM 3I51A 3J2PB 2IOUA 1ZQ9A 4G4QA 1JQJC 3GPUA 4I8OA 1G8PA 2L09A 4QHTA 2XD1A 1HT1E 3HSHA 3U60A 3FUWA 3UJNA 3JR4A 3RGPA 4AKGA 3HONA 2YFQA 2X8AA 2UXDM 1W5SA 2FFJA 2G8LA 1HR0M 4LJ5A 3U6SA 2CHGA 2V1UA 4RF0A 3HJSA 3IG8A 3GLIA 4RNAA 5EP3A 3K92A 4DV6M 3TWMA 2L6OA 5DYIA 3KFUG 4NZ1A 5KQ8A 3KOYE 3RGSA 1G4AE 4NXNM 2R18A 4OJ5A 2C98A 3C58A 1YU4A 5FTLA 1NY6A 4ZPXA 1GLNA 1E9RA 3SAWA 2CV2A 2C96A 1OFIA 4MM3B 3DFZA 1IY1A 3HHYA 4QOZC 3U6OA 2UUAM 4M9XA 2JE5A 1KFVA 3TE6A 1HT2E 4B3RM 3AL0C 2KRKA 3GPPA 4B3MM 2M5ZA 3D8BA 2UUBM 1IY2A 2Z3XA 3E9SA 4KODA 2Y2JA 1IXRC 5JI2E 1XXHA 3LVWA 1R2ZA 2D7EA 1DO0A 3UMMA 3PFIA 1K82A 2FE8A 2HHHM 4IBKA 3MHVC 1NHWC 4FWDA 4JI3M 3W0LB 3A46A 1IQPA 2QENA 3ZC7B 3RFWA 1NHGC 2UXBM 1GVNA 3U60B 1J09A 4MGZE 1IXZA 5EXPA 3GRUA 4OW0A 1YUBA 4GKJM 2RGHA 5FTMA 1NJFA 5EP4A 4QNLA 2W82A 2O5RA 3U61B 5FSWA 5EP2A 3KW6A 1EE8A 3U6LA 4A3VB 5FLXS 1N34M 2F5PA 4B3SM 1YU2A 2X49A 3SYKA 3HHZA 5EP1A 2V1CA 4G6ZA 1ORYB 4BLCA 4JV5M 4IJFA 4BB9A 4M9SA 1N78A 1E9SA 1TH4A 4I5SA 4IBGA 2XZUA 1DGGA 3PNVA 4DV3M 2XZFA 4WW0A 4LF6M 1L2DA 4B3TM 4X66M 4AG6A 4JI6M 2K47A 1HNXM 3HGIA 4NZ3A 2UUCM 2R4JA 4GHLA 2C9CA 1TGUA 2D7HA 3AOEC 4I4LA 3FYDA 3VFDA 1QAOA 4AQYM 2Y2OA 3FTCA 1IM2A 3SARA 3RE8A 4LF5M 4KHPM 4NXMM 4LZJA 4BBAA 2XFSA 4LJ9A 1L1TA 1OFHA 3KS8A 2Y2NA 4LRSA 4XBOA 1YE9A 4FVMA 3WHKA 2YNMD 4JN6A 3UGJA 2LXEA 3BOSA 3GPXA 1N77A 4LFBM 2DZOB 1QZMA 2F5OA 2YR0A 3KOWE 3L29A 2CV1A 3MK6A 3L27A 1IBKM 2Q2EB 4OJLA 1NVMA 4X65M 2I7NA 3R8FA 4DV5M 3AV0A 2XGNA 2RKOA 1IN6A 2ZAOA 2XF3A 2BG1A 4B08A 3FTFA 2KA6B 2DVWB 4JXJA 2Y2IA 1C1KA 5H37D 7CATA 1WXQA 1Q3CA 4PDGA 3JR5A 4NSRA 5ITUA 2EA0A 4OJPA 1SXJD 4AI6A 1XHBA 3R9XB 1N32M 3B9PA 4LJ6A 4GHAA 4JI7M 4JI0M 1QAQA 2V6ZM 3J7BA 4IBIA 5A2QS 4YY3M 4LFAM 5DYGA 4IBFA 3U6DA 2DWNA 2XH9A 4W5WA 1NY5A 5ITQA 2Y2QA 4LGYA 4DR5M 2DZNB 2ERCA 2J7OA 2Y2MA 2CEAA 4WURA 1DGHA 3T38A 2JA2A 3K1JA 4DV1M 1HNWM 1DGBA 3HJQA 5LMUM 3HJ8A 2Y20A 4GIPA 2CE7A 3U6CA 3SHGB 3SYLA 2Y2PA 2ZAMA 2LWXA 1IN5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L29 A;  4GHL A;  4IBB A;  5BPV A;  3L27 A;  4GHA A;  4IBI A;  3L26 A;  4GH9 A;  4LG2 A;  3L28 A;  4IBF A;  3KS4 A;  3L25 A;  4IBK A;  4IJF A;  4IJE A;  4IBG A;  3KS8 A;  3FKE A;  3L2A A;  4IBJ A;  4IBC A;  4IBD A;  4IBE A; 
#chains in the Genus database with same CATH topology
 4NOO B;  1LTM A;  2KNV A;  4B7G A;  1L1Z A;  5KO3 A;  5LMN M;  3I04 M;  4L78 A;  1T3T A;  3NWL A;  1YSY A;  2OOB A;  2ZAN A;  3FUU A;  3WHL A;  1TF0 B;  4L16 A;  3HU2 A;  4OU7 A;  3THG A;  1IN7 A;  3TQS A;  4JI4 M;  2BWB A;  3GLH A;  1NV9 A;  3GLF B;  2CHQ A;  3DA1 A;  5IRE B;  4DR3 M;  1W5T A;  4S12 A;  4L8R C;  4TX8 A;  4Z2I A;  4Z2L A;  4KO8 A;  4L6V 6;  3KP1 E;  3GLG B;  2LNH C;  4AKH A;  3KOZ E;  4G3O A;  1OJL A;  4RKU F;  2Y0Q A;  3B74 A;  2V5O A;  1HQY E;  1A5T A;  2XSZ D;  2KXE A;  5BR8 M;  3FUV A;  1TR8 A;  2QCU A;  4GMQ A;  4TUW A;  1YU0 A;  2Y2H A;  2J5Y A;  4Z6Y A;  4QNR A;  3PXG A;  2RTS A;  1PDC A;  2HCB A;  1J5E M;  2R44 A;  4DUY M;  4LF7 M;  4NRW A;  2F4V M;  4IBB A;  1W1V A;  2FN2 A;  4LZZ A;  1ZAE A;  2RGO A;  1J7K A;  3AFH A;  1XNR M;  4QNM A;  3GLI B;  1SXJ E;  5ITT A;  2OPF A;  2DHR A;  3FRH A;  1GAB A;  4CGY B;  1JR3 D;  2A5Y B;  3H4M A;  1GO5 A;  3N3F A;  5KPZ A;  2BJV A;  2O25 A;  2Z4R A;  3K2L A;  4G4R A;  3VKG A;  3VLF B;  4JI8 M;  1V33 A;  2MR9 A;  3FRI A;  3CF0 A;  3U5Z A;  4JI1 M;  2R65 A;  3E21 A;  1WGL A;  2FOI C;  4CIZ A;  5KPR A;  2OQ4 A;  2FFF B;  1SXJ A;  2DI0 A;  1DGH B;  1VQ1 A;  3NBI A;  1XNQ M;  3WX7 A;  5EQT A;  1L2B A;  4XGI A;  4LY6 A;  4X64 M;  1CK7 A;  2EKK A;  3FUT A;  2R62 A;  3FYC A;  3GQ4 A;  3TL4 X;  4IBD A;  4DR4 M;  3ZH9 B;  1X37 A;  3D8L A;  1G59 A;  3SAV A;  4D81 A;  2UU9 M;  5ITX E;  2LH0 A;  1XXH B;  3T1H M;  2I7P A;  1PM5 A;  1VEG A;  1NO1 A;  3GLH B;  3LVV A;  2MRO B;  4FWG A;  3LQR A;  2UWX A;  3W67 A;  1QAN A;  4OUI A;  3QYB A;  4Z2J A;  4IJE A;  3HWS A;  4PCZ A;  5IZ7 D;  3FUX A;  3FKE A;  1WGN A;  2N35 A;  1TTE A;  3CTW B;  3KP0 E;  4NZ5 A;  4MB4 A;  3GO8 A;  2Y2K A;  4HMC A;  1RU3 A;  3LQQ A;  1PJS A;  3FTD A;  3SAU A;  1W1Y A;  1VDL A;  2D7G A;  4R3D A;  2Y2G A;  2K9D A;  3VDP A;  2QSF X;  4Z2G A;  2CUZ A;  4FD2 A;  2L7I A;  4MGK E;  3E46 A;  1TH3 A;  4RF1 A;  5IT9 S;  4AZF A;  3ZQJ A;  3E4R A;  2E5L M;  1Z59 A;  4FW9 A;  1HQC A;  4HL4 A;  4LJA A;  3J7A S;  1PJT A;  4X62 M;  4Z8X A;  4LRT A;  4NY2 A;  2XSZ A;  4G4O A;  3A42 A;  1KYI A;  1UR9 A;  4NSO B;  1H8P A;  3I01 M;  1XMQ M;  1K3W A;  2GQF A;  5ITR A;  2QBY A;  1NSF A;  3K9P A;  3CF6 E;  4OX9 M;  1EAK A;  1D0L A;  3HU3 A;  2R0I A;  4P17 A;  2R45 A;  1SXJ B;  1R4G A;  3J81 S;  2Y2L A;  1Z5A A;  3I4Y A;  4DR2 M;  1OTR A;  1QAM A;  1QYR A;  2XD5 A;  2KRU A;  4DV2 M;  3GQ3 A;  1NNJ A;  1YUE A;  4DV7 M;  3FE3 A;  2JZ0 A;  3UZU A;  3VK7 A;  1GXD A;  2VQF M;  4KLN A;  1JR3 A;  1I94 M;  3SFZ A;  4F1I A;  2LHG A;  5IWA M;  2LBC A;  1VDD A;  3T6P A;  4CIS A;  3HX3 A;  4PD2 A;  2JCH A;  5DFL A;  2CHV A;  1O6I A;  3OTO M;  4CJ6 A;  4MGI E;  3KDS E;  4MGY E;  4LF4 M;  2Y21 A;  1R7R A;  2EUC A;  2R46 A;  2BNK A;  3C3E A;  2DKL A;  4MB5 A;  1XC8 A;  1QQW A;  1Y8G A;  3NBX X;  5C18 A;  1MU5 A;  1KSF X;  4OVZ A;  1N33 M;  4REZ A;  4XK8 F;  5FTN A;  4IBJ A;  3T1Y M;  3HHW A;  1FNN A;  1QVR A;  4K0K M;  3QWL A;  1ED7 A;  1QUS A;  2R4E A;  4AKI A;  4IBC A;  3J27 B;  4NRV A;  4EIW A;  3AOG A;  3GRV A;  4M0D A;  2AHM A;  4DR1 M;  3SHF A;  3TWL A;  3U61 A;  3SAT A;  3K8Z A;  2HAK A;  4GC5 A;  4QHS A;  1E6P A;  4IIW A;  3GRY A;  4LF9 M;  1T6O A;  3MQL A;  4D82 A;  2B3T A;  2VQE M;  2DWM A;  3J80 S;  2UXC M;  2CP8 A;  3A98 B;  2Z4S A;  5ITY A;  4LJ8 A;  3SMS A;  4QOS A;  4PT5 A;  3EIH A;  2HL7 A;  1D2N A;  1JB0 F;  1R6B X;  3GRR A;  3KSJ A;  1G41 A;  3WD3 A;  2DWL A;  1E6Z A;  2Y0T A;  5DNY A;  3ZCB B;  4AG5 A;  3AKZ A;  2NQ8 C;  1MX0 A;  5EXS A;  5F3W A;  4OJO A;  4FCT A;  5KPT A;  2F5N A;  1Q3B A;  1Z6T A;  2ZM6 M;  1DGF A;  1GKI A;  2VII A;  1XMO M;  2QBY B;  4LF8 M;  3WD1 A;  1E88 A;  5EXX A;  3KOX E;  1SXJ C;  2BJW A;  4R71 A;  2CRU A;  1SG9 A;  3W68 A;  2KZS A;  3TPZ A;  2M60 A;  2MH8 A;  4JI2 M;  3AJI B;  2C5R A;  2JY6 B;  3C3D A;  3PNY A;  3KXE C;  2CV0 A;  2G5G X;  4L15 A;  3B7Q A;  5EJC A;  2R6F A;  2H1R A;  1E94 E;  3BXW A;  1E32 A;  4M0W A;  1Q39 A;  2P5T A;  1QUT A;  3UK6 A;  2L7H A;  1Z5C A;  4DV0 M;  3M7G A;  4Y28 F;  3VDU A;  3GP1 A;  4LFC M;  3T15 A;  2EJS A;  4GIT A;  2MGW A;  2WSC F;  1HNZ M;  2F5S A;  2C99 A;  2EO2 A;  3QAU A;  2QP9 X;  1YU1 A;  4NL4 H;  3FTE A;  3MMP A;  3IEC A;  3L25 A;  4LJ7 A;  1VG5 A;  2DAM A;  2XFT A;  5KQD A;  1IFY A;  3U6Q A;  3DOA A;  3HU1 A;  2QPA A;  3I4V A;  1L8Q A;  4DR6 M;  2DAK A;  2FNA A;  5JI3 E;  3C9P A;  4MB3 A;  5FTJ A;  4OVZ B;  3IG5 A;  1HJP A;  2Y2P A;  1TDZ A;  2F5Q A;  1S3S A;  1IXS B;  1GL6 A;  2J7N A;  2XEP A;  4HEO A;  5GKN A;  3EIE A;  1Z5B A;  4LGM A;  1DO2 A;  2OOA A;  2DAG A;  4MB7 A;  3VKH A;  1GOI A;  4FWH A;  1R2Y A;  1UM8 A;  1PJI A;  3GQ5 A;  8CAT A;  2L2D A;  4JI5 M;  2HKJ A;  2JUJ A;  4FCV A;  5EXT A;  3GPY A;  3U6M A;  2L4F A;  1Q02 A;  1IY0 A;  4G4N A;  4HLQ A;  3PVS A;  2YQZ A;  2JWS A;  2Z7J A;  1N36 M;  1PRB A;  4B7H A;  2ZBK B;  4YHH M;  2XLJ A;  4OJ6 A;  3LCV B;  1E6R A;  4P16 A;  1QO6 A;  1W1P A;  2APL A;  4ITQ A;  1R5L A;  2LHC A;  3HHX A;  5ITX A;  3U6E A;  3SAS A;  4I81 A;  4L4U A;  1XWI A;  3DZD A;  5L8R F;  2JZ1 A;  4NZ4 A;  1K3X A;  2VDB B;  1IN8 A;  4R7G A;  4CHT B;  1IBL M;  3JAM S;  2DWZ B;  1AIW A;  4GC9 A;  4DBG B;  2LVA A;  1OIZ A;  1IBM M;  4MGH A;  3L2A A;  4IBE A;  2KW0 A;  2KZU A;  5E6J A;  4DUZ M;  3HKP A;  2WZJ A;  1IN4 A;  3KVW A;  2G3Q A;  1TH2 A;  1YU3 A;  2DXI A;  1N75 A;  2LVO C;  1L2C A;  4GH9 A;  1NV8 A;  4M9Z A;  4LG2 A;  4FCW A;  3KS4 A;  2GNO A;  3QYE A;  2X4A A;  2DAI A;  3WD4 A;  2C9O A;  3K9O A;  4DV4 M;  4GKK M;  3Q8X A;  4GEW A;  1GL7 A;  3CF2 A;  4AW4 A;  4II7 A;  3TWK A;  3GLF E;  1PJQ A;  3A45 A;  3B7Z A;  4D80 A;  3SBJ A;  3KSX A;  3U5Z B;  4NYU A;  4PDI A;  3W0F A;  1LV7 A;  3ILK A;  3GLG E;  2KEB A;  1EFU B;  1NJG A;  1G3I A;  4KT0 F;  4B7F A;  5FTK A;  2FH0 A;  4WP2 A;  1FJG M;  2WSE F;  2DAE A;  4UN2 B;  3SMP A;  3M0E A;  4MH0 E;  1I4W A;  2QZ4 A;  3CGW A;  3FD9 A;  3VK8 A;  1PJJ A;  5BPV A;  1NNU C;  1TDH A;  3M6A A;  3U6P A;  3AOE A;  4GRI A;  1H6U A;  2CFO A;  4LCB A;  4LJ4 A;  3GLF A;  2D49 A;  3L26 A;  2LVP C;  5C1B A;  3GLG A;  3MJ5 A;  4DR7 M;  3L28 A;  3LMM A;  4HME A;  1GJT A;  5E26 A;  3SC3 A;  4JYA M;  3I51 A;  3J2P B;  2IOU A;  1ZQ9 A;  4G4Q A;  1JQJ C;  3GPU A;  1H0G A;  4I8O A;  1G8P A;  2L09 A;  4QHT A;  3GLI E;  2XD1 A;  1KS0 A;  1HT1 E;  3HSH A;  3U60 A;  3B7N A;  3FUW A;  1WIV A;  2ZTC A;  3UJN A;  3JR4 A;  3RGP A;  4AKG A;  3HON A;  2YFQ A;  2X8A A;  4HMD A;  2UXD M;  1MJG M;  1W5S A;  2FFJ A;  2G8L A;  1HR0 M;  4LJ5 A;  3U6S A;  2CHG A;  2V1U A;  4RF0 A;  3HJS A;  3IG8 A;  3GLI A;  4RNA A;  5EP3 A;  3K92 A;  4DV6 M;  3TWM A;  1J7M A;  2L6O A;  5DYI A;  3KFU G;  1E8B A;  4NZ1 A;  2QQ8 A;  1D0M A;  5KQ8 A;  3KOY E;  3RGS A;  4Q7J A;  1VEK A;  1G4A E;  4NXN M;  2R18 A;  1DV0 A;  1MN3 A;  4OJ5 A;  1BVS A;  2C98 A;  3C58 A;  1YU4 A;  5FTL A;  1NY6 A;  4ZPX A;  1GLN A;  1E9R A;  1V34 A;  3SAW A;  2C96 A;  1OFI A;  2CV2 A;  4MM3 B;  4ANR A;  1XB2 B;  1G71 A;  1GPF A;  3DFZ A;  1IY1 A;  1XXH E;  3HHY A;  4QOZ C;  3U6O A;  2UUA M;  4M9X A;  1WR1 B;  1KFV A;  2JE5 A;  3TE6 A;  1HT2 E;  4B3R M;  3AL0 C;  2KRK A;  1F4I A;  3GPP A;  1QDR A;  4B3M M;  1UFZ A;  1C7Y A;  2M5Z A;  2JY5 A;  2OO9 A;  3D8B A;  2UUB M;  1IY2 A;  2Z3X A;  2QNJ A;  3E9S A;  4KOD A;  2JY8 A;  1AIP C;  2Y2J A;  1IXR C;  5JI2 E;  1XXH A;  1OQY A;  3LVW A;  1R2Z A;  2D7E A;  1CUK A;  2JXN A;  1E15 A;  1WHC A;  1DO0 A;  1UR8 A;  3UMM A;  3PFI A;  1K82 A;  2FE8 A;  2HHH M;  1WJ7 A;  1OIP A;  4IBK A;  3MHV C;  1NHW C;  4FWD A;  4JI3 M;  3W0L B;  3A46 A;  1IQP A;  2QEN A;  3ZC7 B;  1OKS A;  3RFW A;  1QDT A;  1NHG C;  2UXB M;  1GVN A;  3U60 B;  1J09 A;  4MGZ E;  1IXZ A;  5EXP A;  3GRU A;  4OW0 A;  3H4J A;  1YUB A;  1H0I A;  2LTU A;  2L4E A;  4GKJ M;  1L6J A;  2RGH A;  5FTM A;  1NJF A;  1OAI A;  5EP4 A;  3WD0 A;  4QNL A;  2BWE A;  2W82 A;  2LVN C;  2O5R A;  3U61 B;  5FSW A;  3WD2 A;  1ZMU A;  5EP2 A;  3KW6 A;  1EE8 A;  3U6L A;  4A3V B;  5FLX S;  1N34 M;  2F5P A;  4B3S M;  1YU2 A;  2X49 A;  3SYK A;  3HHZ A;  2KNZ A;  5EP1 A;  2V1C A;  4G6Z A;  1ORY B;  2K0B X;  4BLC A;  2JNH A;  3B89 A;  4IJF A;  3V76 A;  4BB9 A;  4JV5 M;  4M9S A;  1N78 A;  1E9S A;  1TH4 A;  2H5X A;  4IBG A;  4I5S A;  1DGG A;  2XZU A;  2KHH A;  1V92 A;  3PNV A;  4DV3 M;  2XZF A;  4WW0 A;  4LF6 M;  1L2D A;  4F2L A;  4B3T M;  4X66 M;  2DZL A;  4AG6 A;  4JI6 M;  1ZV1 A;  2Z8Y M;  2K47 A;  1OGG A;  1HNX M;  1QZE A;  2RRU A;  3HGI A;  4NZ3 A;  2UUC M;  2R4J A;  4GHL A;  2C9C A;  2KNA A;  1TGU A;  2D7H A;  3AOE C;  4I4L A;  2DNA A;  3FYD A;  3VFD A;  1QAO A;  2JY7 A;  4AQY M;  2Y2O A;  1GJS A;  3FTC A;  1ZMV A;  1IM2 A;  3SAR A;  3RE8 A;  4LF5 M;  4KHP M;  4NXM M;  4LZJ A;  4BBA A;  3F92 A;  2XFS A;  4LJ9 A;  1L1T A;  1OFH A;  3KS8 A;  2Y2N A;  4LRS A;  4XBO A;  1W1T A;  1YE9 A;  2JP7 A;  4FVM A;  2YNM D;  4JN6 A;  3WHK A;  3UGJ A;  2LXE A;  3BOS A;  2ZTD A;  1OAO C;  3GPX A;  1N77 A;  2EKF A;  1EIJ A;  3IHP A;  4LFB M;  4NYY A;  2DZO B;  1ZMW A;  3BBZ A;  1QZM A;  3Q8G A;  2CWB A;  2F5O A;  2YR0 A;  3KOW E;  3L29 A;  2DHY A;  2CV1 A;  3MK6 A;  3L27 A;  1VEJ A;  1IBK M;  2Q2E B;  2VF8 A;  1NVM A;  4OJL A;  4X65 M;  2I7N A;  3R8F A;  4DV5 M;  3AV0 A;  2XGN A;  2RKO A;  1IN6 A;  2ZAO A;  2XF3 A;  2LVQ D;  2BG1 A;  3M7P A;  4B08 A;  1PGY A;  1JR3 E;  3FTF A;  2KA6 B;  2VF7 A;  2DVW B;  4JXJ A;  4NC6 A;  2Y2I A;  1C1K A;  5H37 D;  7CAT A;  1WXQ A;  1Q3C A;  4Z2K A;  1CXW A;  4PDG A;  3JR5 A;  4NSR A;  5ITU A;  2KDL A;  2EA0 A;  4OJP A;  1D0K A;  2HWJ A;  1SXJ D;  3HZJ A;  4AI6 A;  2O01 F;  2WSF F;  1XHB A;  1E6N A;  1OGB A;  3R9X B;  4Z2H A;  1N32 M;  3B9P A;  4LJ6 A;  4GHA A;  2MJ5 B;  4JI7 M;  1YLA A;  4JI0 M;  1QAQ A;  2V6Z M;  3J7B A;  4IBI A;  5A2Q S;  4YY3 M;  4LFA M;  5DYG A;  4IBF A;  3U6D A;  2DWN A;  2XH9 A;  4W5W A;  1NY5 A;  5ITQ A;  2Y2Q A;  4LGY A;  4DR5 M;  2DZN B;  2QHO B;  1P3Q Q;  2ERC A;  2J7O A;  2Y2M A;  2CEA A;  4WUR A;  1DGH A;  3T38 A;  2JA2 A;  3K1J A;  3LW5 F;  4DV1 M;  1HNW M;  3LCU A;  1IXS A;  3GLH E;  1AUA A;  1DGB A;  3HJQ A;  3HJ8 A;  2Y20 A;  5LMU M;  4GIP A;  2CE7 A;  2DEN A;  3SHG B;  3U6C A;  3HY5 A;  2FS1 A;  3SYL A;  2K6B A;  2ZAM A;  1T43 A;  2LWX A;  1IN5 A; 
#chains in the Genus database with same CATH homology
 4NOO B;  4B7G A;  1L1Z A;  5KO3 A;  5LMN M;  4L78 A;  1T3T A;  3NWL A;  1YSY A;  2ZAN A;  3FUU A;  3WHL A;  4L16 A;  4OU7 A;  3HU2 A;  2Y2G A;  3THG A;  1IN7 A;  3TQS A;  4JI4 M;  3GLH A;  3GLF B;  4DR3 M;  2CHQ A;  3DA1 A;  5IRE B;  4L8R C;  1W5T A;  4S12 A;  4KO8 A;  3GLG B;  3KP1 E;  2LNH C;  4AKH A;  3KOZ E;  1OJL A;  2Y0Q A;  1HQY E;  2XSZ D;  2KXE A;  5BR8 M;  3FUV A;  2QCU A;  4GMQ A;  4TUW A;  1YU0 A;  2Y2H A;  4Z6Y A;  4QNR A;  3PXG A;  2HCB A;  1J5E M;  4LF7 M;  4DUY M;  4NRW A;  2F4V M;  4IBB A;  4LZZ A;  1ZAE A;  2RGO A;  1J7K A;  3AFH A;  1XNR M;  4QNM A;  3GLI B;  1SXJ E;  5ITT A;  2OPF A;  2DHR A;  4CGY B;  1JR3 D;  2A5Y B;  3H4M A;  3N3F A;  5KPZ A;  2BJV A;  2Z4R A;  3K2L A;  4G4R A;  3VKG A;  3VLF B;  4JI8 M;  4NYY A;  3CF0 A;  3U5Z A;  4JI1 M;  2R65 A;  2FFF B;  2FOI C;  5KPR A;  2OQ4 A;  1SXJ A;  1DGH B;  3NBI A;  1XNQ M;  3WX7 A;  5EQT A;  1L2B A;  4XGI A;  4LY6 A;  4X64 M;  3FUT A;  2R62 A;  3FYC A;  3GQ4 A;  3TL4 X;  4IBD A;  4DR4 M;  3ZH9 B;  1X37 A;  3D8L A;  1G59 A;  3SAV A;  4D81 A;  2UU9 M;  5ITX E;  2LH0 A;  1XXH B;  3T1H M;  2I7P A;  1PM5 A;  3GLH B;  3LVV A;  4FWG A;  3LQR A;  2UWX A;  1QAN A;  4OUI A;  4IJE A;  3HWS A;  4PCZ A;  3FUX A;  3FKE A;  3CTW B;  3KP0 E;  4NZ5 A;  3GO8 A;  2Y2K A;  3LQQ A;  3FTD A;  3SAU A;  2D7G A;  4R3D A;  3VDP A;  2CUZ A;  4FD2 A;  2L7I A;  4MGK E;  4RF1 A;  1TH3 A;  5IT9 S;  4AZF A;  3E4R A;  2E5L M;  1Z59 A;  4FW9 A;  1HQC A;  4HL4 A;  4LJA A;  3J7A S;  4X62 M;  4Z8X A;  4LRT A;  4NY2 A;  2XSZ A;  4G4O A;  3A42 A;  1KYI A;  4NSO B;  1XMQ M;  1K3W A;  5ITR A;  2QBY A;  1NSF A;  3CF6 E;  4OX9 M;  3HU3 A;  2R45 A;  1SXJ B;  3J81 S;  2Y2L A;  1Z5A A;  3I4Y A;  4DR2 M;  1QAM A;  1QYR A;  2XD5 A;  2KRU A;  4DV2 M;  3GQ3 A;  1NNJ A;  1YUE A;  4DV7 M;  3UZU A;  3VK7 A;  2VQF M;  4KLN A;  1JR3 A;  1I94 M;  3SFZ A;  5IWA M;  1VDD A;  4CIS A;  4PD2 A;  2JCH A;  2CHV A;  3OTO M;  4MGI E;  3KDS E;  4MGY E;  4LF4 M;  2Y21 A;  1R7R A;  2EUC A;  2R46 A;  2BNK A;  1XC8 A;  1QQW A;  5C18 A;  1MU5 A;  1KSF X;  4OVZ A;  1N33 M;  4REZ A;  5FTN A;  4IBJ A;  3T1Y M;  3HHW A;  1FNN A;  1QVR A;  4K0K M;  3QWL A;  2R4E A;  4AKI A;  4IBC A;  3J27 B;  4NRV A;  4EIW A;  3AOG A;  3GRV A;  4M0D A;  2AHM A;  4DR1 M;  3SHF A;  3TWL A;  3U61 A;  3SAT A;  3K8Z A;  4QHS A;  4GC5 A;  4IIW A;  3GRY A;  4LF9 M;  4D82 A;  2VQE M;  2DWM A;  2UXC M;  3J80 S;  3A98 B;  2Z4S A;  5ITY A;  4LJ8 A;  3SMS A;  4QOS A;  4PT5 A;  3EIH A;  2HL7 A;  1D2N A;  1R6B X;  3GRR A;  3KSJ A;  1G41 A;  2DWL A;  2Y0T A;  5DNY A;  3ZCB B;  4AG5 A;  3AKZ A;  2NQ8 C;  1MX0 A;  5EXS A;  5F3W A;  4OJO A;  4FCT A;  5KPT A;  2F5N A;  1Q3B A;  1Z6T A;  2ZM6 M;  1DGF A;  1GKI A;  2VII A;  1XMO M;  2QBY B;  4LF8 M;  5EXX A;  3KOX E;  1SXJ C;  2BJW A;  2KZS A;  3TPZ A;  2M60 A;  4JI2 M;  3AJI B;  2C5R A;  3PNY A;  3KXE C;  2CV0 A;  2G5G X;  4L15 A;  5IZ7 D;  5EJC A;  2H1R A;  1E94 E;  4M0W A;  1E32 A;  3UK6 A;  1Q39 A;  2P5T A;  2L7H A;  1Z5C A;  4DV0 M;  3M7G A;  3VDU A;  3GP1 A;  4LFC M;  3T15 A;  4GIT A;  1HNZ M;  2F5S A;  2C99 A;  2EO2 A;  3QAU A;  2QP9 X;  1YU1 A;  4NL4 H;  3FTE A;  3L25 A;  4LJ7 A;  2XFT A;  5KQD A;  3U6Q A;  3DOA A;  3HU1 A;  2QPA A;  3I4V A;  1L8Q A;  4DR6 M;  2FNA A;  5JI3 E;  5FTJ A;  4OVZ B;  3IG5 A;  1TDZ A;  2F5Q A;  1S3S A;  1IXS B;  1GL6 A;  2J7N A;  2XEP A;  5GKN A;  3EIE A;  1Z5B A;  4LGM A;  1DO2 A;  3VKH A;  4MB7 A;  4FWH A;  1R2Y A;  1UM8 A;  1PJI A;  3GQ5 A;  8CAT A;  4JI5 M;  2HKJ A;  5EXT A;  4FCV A;  3GPY A;  3U6M A;  4G4N A;  1IY0 A;  1N36 M;  4HLQ A;  3PVS A;  2YQZ A;  2Z7J A;  4B7H A;  4YHH M;  2ZBK B;  2XLJ A;  4OJ6 A;  4P16 A;  4ITQ A;  3HHX A;  5ITX A;  3U6E A;  3SAS A;  4I81 A;  4L4U A;  1XWI A;  3DZD A;  4NZ4 A;  1K3X A;  1IBL M;  1IN8 A;  4R7G A;  4CHT B;  3JAM S;  2DWZ B;  4GC9 A;  1IBM M;  4MGH A;  3L2A A;  4IBE A;  2KZU A;  2KW0 A;  5E6J A;  4DUZ M;  3HKP A;  1IN4 A;  3KVW A;  1TH2 A;  1YU3 A;  2DXI A;  1N75 A;  1L2C A;  4GH9 A;  4M9Z A;  4LG2 A;  4FCW A;  3KS4 A;  2X4A A;  2C9O A;  4GKK M;  4DV4 M;  3Q8X A;  4AW4 A;  1GL7 A;  3CF2 A;  4II7 A;  3TWK A;  3A45 A;  4D80 A;  3SBJ A;  3KSX A;  3U5Z B;  4NYU A;  4PDI A;  3W0F A;  1LV7 A;  3ILK A;  2KEB A;  4B7F A;  1NJG A;  1G3I A;  5FTK A;  1FJG M;  3SMP A;  3M0E A;  4MH0 E;  1I4W A;  2QZ4 A;  3FD9 A;  3VK8 A;  1PJJ A;  5BPV A;  1NNU C;  1TDH A;  3M6A A;  3U6P A;  3AOE A;  4GRI A;  1H6U A;  2CFO A;  4LCB A;  4LJ4 A;  3GLF A;  3L26 A;  5C1B A;  3GLG A;  3MJ5 A;  4DR7 M;  3L28 A;  3LMM A;  5E26 A;  3SC3 A;  4JYA M;  3I51 A;  3J2P B;  2IOU A;  1ZQ9 A;  4G4Q A;  1JQJ C;  3GPU A;  4I8O A;  1G8P A;  2L09 A;  4QHT A;  2XD1 A;  1HT1 E;  3HSH A;  3U60 A;  3FUW A;  3UJN A;  3JR4 A;  3RGP A;  4AKG A;  3HON A;  2YFQ A;  2X8A A;  2UXD M;  1W5S A;  2FFJ A;  2G8L A;  1HR0 M;  4LJ5 A;  3U6S A;  2CHG A;  2V1U A;  4RF0 A;  3HJS A;  3IG8 A;  3GLI A;  4RNA A;  5EP3 A;  3K92 A;  4DV6 M;  3TWM A;  2L6O A;  5DYI A;  3KFU G;  4NZ1 A;  5KQ8 A;  3KOY E;  3RGS A;  1G4A E;  4NXN M;  2R18 A;  4OJ5 A;  2C98 A;  3C58 A;  1YU4 A;  5FTL A;  1NY6 A;  4ZPX A;  1GLN A;  1E9R A;  3SAW A;  2CV2 A;  2C96 A;  1OFI A;  4MM3 B;  3DFZ A;  1IY1 A;  3HHY A;  4QOZ C;  3U6O A;  2UUA M;  4M9X A;  2JE5 A;  1KFV A;  3TE6 A;  1HT2 E;  4B3R M;  3AL0 C;  2KRK A;  3GPP A;  4B3M M;  2M5Z A;  3D8B A;  2UUB M;  1IY2 A;  2Z3X A;  3E9S A;  4KOD A;  2Y2J A;  1IXR C;  5JI2 E;  1XXH A;  3LVW A;  1R2Z A;  2D7E A;  1DO0 A;  3UMM A;  3PFI A;  1K82 A;  2FE8 A;  2HHH M;  4IBK A;  3MHV C;  1NHW C;  4FWD A;  4JI3 M;  3W0L B;  3A46 A;  1IQP A;  2QEN A;  3ZC7 B;  3RFW A;  1NHG C;  2UXB M;  1GVN A;  3U60 B;  1J09 A;  4MGZ E;  1IXZ A;  5EXP A;  3GRU A;  4OW0 A;  1YUB A;  4GKJ M;  2RGH A;  5FTM A;  1NJF A;  5EP4 A;  4QNL A;  2W82 A;  2O5R A;  3U61 B;  5FSW A;  5EP2 A;  3KW6 A;  1EE8 A;  3U6L A;  4A3V B;  5FLX S;  1N34 M;  2F5P A;  4B3S M;  1YU2 A;  2X49 A;  3SYK A;  3HHZ A;  5EP1 A;  2V1C A;  4G6Z A;  1ORY B;  4BLC A;  4JV5 M;  4IJF A;  4BB9 A;  4M9S A;  1N78 A;  1E9S A;  1TH4 A;  4I5S A;  4IBG A;  2XZU A;  1DGG A;  3PNV A;  4DV3 M;  2XZF A;  4WW0 A;  4LF6 M;  1L2D A;  4B3T M;  4X66 M;  4AG6 A;  4JI6 M;  2K47 A;  1HNX M;  3HGI A;  4NZ3 A;  2UUC M;  2R4J A;  4GHL A;  2C9C A;  1TGU A;  2D7H A;  3AOE C;  4I4L A;  3FYD A;  3VFD A;  1QAO A;  4AQY M;  2Y2O A;  3FTC A;  1IM2 A;  3SAR A;  3RE8 A;  4LF5 M;  4KHP M;  4NXM M;  4LZJ A;  4BBA A;  2XFS A;  4LJ9 A;  1L1T A;  1OFH A;  3KS8 A;  2Y2N A;  4LRS A;  4XBO A;  1YE9 A;  4FVM A;  3WHK A;  2YNM D;  4JN6 A;  3UGJ A;  2LXE A;  3BOS A;  3GPX A;  1N77 A;  4LFB M;  2DZO B;  1QZM A;  2F5O A;  2YR0 A;  3KOW E;  3L29 A;  2CV1 A;  3MK6 A;  3L27 A;  1IBK M;  2Q2E B;  4OJL A;  1NVM A;  4X65 M;  2I7N A;  3R8F A;  4DV5 M;  3AV0 A;  2XGN A;  2RKO A;  1IN6 A;  2ZAO A;  2XF3 A;  2BG1 A;  4B08 A;  3FTF A;  2KA6 B;  2DVW B;  4JXJ A;  2Y2I A;  1C1K A;  5H37 D;  7CAT A;  1WXQ A;  1Q3C A;  4PDG A;  3JR5 A;  4NSR A;  5ITU A;  2EA0 A;  4OJP A;  1SXJ D;  4AI6 A;  1XHB A;  3R9X B;  1N32 M;  3B9P A;  4LJ6 A;  4GHA A;  4JI7 M;  4JI0 M;  1QAQ A;  2V6Z M;  3J7B A;  4IBI A;  5A2Q S;  4YY3 M;  4LFA M;  5DYG A;  4IBF A;  3U6D A;  2DWN A;  2XH9 A;  4W5W A;  1NY5 A;  5ITQ A;  2Y2Q A;  4LGY A;  4DR5 M;  2DZN B;  2ERC A;  2J7O A;  2Y2M A;  2CEA A;  4WUR A;  1DGH A;  3T38 A;  2JA2 A;  3K1J A;  4DV1 M;  1HNW M;  1DGB A;  3HJQ A;  5LMU M;  3HJ8 A;  2Y20 A;  4GIP A;  2CE7 A;  3U6C A;  3SHG B;  3SYL A;  2Y2P A;  2ZAM A;  2LWX A;  1IN5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...