4IJFA

Crystal structure of the zaire ebolavirus vp35 interferon inhibitory domain k222a/r225a/k248a/k251a mutant
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
123
structure length
123
Chain Sequence
DISAADLANIMYDHLPGFGTAFHQLVQVICALGADSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Development of RNA Aptamers Targeting Ebola Virus VP35.
pubmed doi rcsb
source organism Zaire ebolavirus
molecule tags Viral protein
molecule keywords Polymerase cofactor VP35
total genus 36
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2012-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ijfA01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4ijfA02
5BPVA 4GHLA 4IBIA 4IJFA 4IBJA 3L28A 4IBKA 3L2AA 3KS8A 4IBFA 3L29A 4IJEA 4IBBA 4IBCA 4GHAA 4IBGA 4IBDA 4GH9A 3L25A 4IBEA 3FKEA 3L27A 3L26A 3KS4A 4LG2A
chains in the Genus database with same CATH superfamily
4Z6YA 5EXXA 2CP8A 2F5OA 2VQEM 1L1TA 2Y2IA 2DHRA 2QCUA 2WSEF 4YHHM 3U5ZB 2L09A 2BJWA 2R46A 2W82A 2QZ4A 3HKPA 3Q8XA 4LJ9A 2XEPA 4X62M 1HT1E 3A42A 1KS0A 2X8AA 1QANA 1H0IA 2Y2GA 1NVMA 1R5LA 2CHQA 3GLGB 4OX9M 3K2LA 2O5RA 1GLNA 1N33M 1DGBA 2YR0A 2QSFX 3J81S 2L4EA 4LF5M 3FUTA 4NZ3A 3GLHA 3GO8A 3CF2A 1D2NA 1IXRC 1PRBA 1MN3A 2UUAM 1E6PA 1YU3A 4L78A 2E5LM 2J7OA 3L26A 3GPPA 1KSFX 1J7MA 3SYLA 2DAKA 2VF7A 2WZJA 4BLCA 4X65M 1GJSA 2FS1A 3I4VA 2MR9A 4RF1A 4B08A 1DGFA 2JA2A 4HMDA 1R7RA 5EP4A 4JI8M 2VQFM 1JR3D 1VEGA 1ZAEA 4HLQA 5JI2E 5FLXS 4WP2A 4FWDA 4DV3M 4I8OA 1UR8A 3HGIA 3GQ4A 3FUWA 3SAVA 2OOAA 2R44A 4NZ1A 3VDUA 3WHKA 4TX8A 2YNMD 2RGHA 1D0KA 1MX0A 2J5YA 2M60A 3E4RA 1EIJA 1NNUC 3U6SA 4D80A 3HWSA 3D8BA 3ZQJA 2Q2EB 4NYYA 2XD5A 4KODA 1E88A 1IM2A 2O01F 1YSYA 2DAMA 4JI6M 4MM3B 5FTMA 2JY5A 2FNAA 5FTNA 3GPUA 2QENA 3V76A 4YY3M 1AIWA 1PJQA 1R2ZA 1GVNA 3T38A 1GO5A 1NY5A 4MGKE 3U6DA 4Z2HA 4K0KM 4JI1M 1XMOM 3B74A 2DAEA 3LVWA 4AW4A 1T3TA 4GRIA 5ITTA 2OO9A 1G59A 2UUBM 1D0LA 4Z2LA 3SYKA 1JR3E 2NQ8C 4LJ4A 3LCUA 1S3SA 2KRKA 3CF6E 4IJEA 4G4NA 4AQYM 4KHPM 4IBCA 2F5PA 1OFHA 2GNOA 4JI3M 2ZBKB 3AOEC 4LF4M 1V92A 1ZMUA 2JUJA 2KDLA 3JAMS 5ITUA 5ITRA 5EJCA 1IBLM 3KFUG 2XFTA 4LCBA 3PNVA 2KEBA 2JXNA 3R9XB 3A46A 3KS4A 3U6OA 1HJPA 2D7GA 4GHLA 2Y2QA 3LQQA 1V33A 2LTUA 1K3XA 2GQFA 2FN2A 3THGA 1XMQM 3LW5F 3AL0C 1DO0A 2L7IA 2KNZA 2MROB 4DV2M 3AOEA 4MGYE 4QHTA 3VLFB 1XXHB 2EJSA 4B3MM 4NYUA 1JB0F 1E9SA 2DZOB 4FCWA 3GLFA 2MH8A 2HL7A 1X37A 1N32M 1E9RA 4NZ4A 2Y2KA 2DAGA 3MK6A 1XNQM 1HQYE 1UR9A 1WJ7A 4DR4M 2XD1A 1E6NA 1ZMVA 5JI3E 4MB7A 1JQJC 1JR3A 1XWIA 2QQ8A 2R65A 4X66M 3WD0A 4LF6M 3FRHA 2RKOA 1QAMA 1E6RA 2JP7A 2R4JA 2FFJA 2R4EA 1D0MA 4G4OA 2F5QA 4AG5A 3FUVA 1C1KA 4BB9A 4OVZA 4B3RM 3RFWA 3GLGE 4LF8M 3TPZA 3KOYE 1QO6A 1ZV1A 2A5YB 4QNLA 1L6JA 2L6OA 2CV1A 4CJ6A 2VIIA 1E15A 1UM8A 4I4LA 1GKIA 1I4WA 3L29A 3KVWA 5DNYA 4LF9M 1WXQA 2VF8A 3E46A 1IN6A 4RKUF 3H4JA 1YUEA 4L15A 4JV5M 2DHYA 2V6ZM 2HCBA 2JY8A 2LVOC 4IBDA 2XZUA 3WD4A 1L8QA 4JN6A 2F4VM 2R6FA 4LGYA 2FFFB 2M5ZA 4R7GA 2F5SA 1QZMA 2LVQD 2DKLA 2XFSA 3MMPA 3IECA 5FTLA 1OGGA 3SAUA 2L2DA 4LFCM 2CFOA 2D7HA 5EP2A 3TWLA 3K9OA 3FRIA 4IIWA 4CIZA 3AFHA 3WD1A 4WW0A 1QAQA 1GL7A 5FTJA 1W1YA 5BPVA 2QBYA 3K9PA 2CRUA 2LHCA 4IBIA 4P16A 1HNZM 1K82A 4B7GA 4LGMA 2ZTDA 2Y2NA 1Z5AA 1IN7A 4OUIA 1EE8A 1Q3CA 5DFLA 3TE6A 3H4MA 1AUAA 2Z4RA 4PCZA 2LHGA 2D49A 1IY0A 3EIHA 3SMPA 3GLFE 2ZANA 4KO8A 4B7HA 5BR8M 2XZFA 5IREB 3KOWE 4GC5A 3DFZA 1AIPC 1NV9A 1XXHE 3DA1A 3J27B 1GABA 5C1BA 4L16A 3KOXE 1IN8A 5DYIA 2HWJA 4F2LA 2JZ0A 1OIPA 1GJTA 3HU2A 5LMUM 1HNWM 4M0DA 5EXPA 1TDZA 4LJ5A 2DZNB 1MJGM 3BXWA 4GC9A 3CGWA 4WURA 4JYAM 3RGSA 1E6ZA 2EO2A 2V1CA 4B7FA 2C5RA 1SXJB 4NXMM 4NSRA 3U61A 2G3QA 3MJ5A 4PDGA 1DGHB 2V1UA 2LWXA 1IY2A 4L4UA 4XGIA 3GQ5A 4DV5M 2ZTCA 3WHLA 3RE8A 3SHFA 4L6V6 2JY6B 4FWGA 1YUBA 2DNAA 5EQTA 4OW0A 4PT5A 4DUZM 4GHAA 2UU9M 2IOUA 2Z8YM 2UXBM 2N35A 3LQRA 4EIWA 3FUUA 5EP3A 3RGPA 2DXIA 1E94E 1LTMA 3M0EA 4PD2A 1NHWC 4DUYM 1EFUB 2OOBA 1HT2E 4B3TM 3B89A 2OQ4A 4M9SA 3IG5A 1DGHA 3BBZA 3R8FA 1H0GA 1L2BA 1Z59A 2BWBA 3HX3A 3W0LB 3B7QA 1TF0B 3FTFA 4LFBM 4HMEA 1SXJD 5EP1A 1HR0M 2R0IA 3IG8A 5E26A 4AKHA 4RF0A 1QZEA 2KXEA 3U5ZA 1OTRA 3VKGA 3FYDA 3U6LA 2AHMA 3I01M 2C9CA 4CISA 3UK6A 2K6BA 2VDBB 4QHSA 2QHOB 2Z7JA 1Z5CA 4R71A 4GH9A 1I94M 4NRVA 1QYRA 1V34A 1XHBA 4LRSA 3UGJA 3W0FA 1Z6TA 3T1HM 1Q02A 5DYGA 1CUKA 3J7BA 1W1TA 1QAOA 3AOGA 4MGZE 4MH0E 1W5SA 1FNNA 3GLFB 4DV7M 3AV0A 1Q39A 3SFZA 2DVWB 1PJIA 4XK8F 1XXHA 1G4AE 3IHPA 5LMNM 4OJOA 2C96A 4KT0F 4CHTB 3JR4A 4DR2M 4QNRA 5F3WA 2DWMA 1E8BA 1PJTA 1R6BX 3GRVA 1DO2A 4ITQA 1NSFA 1OAOC 2DWLA 2L7HA 3DOAA 1N36M 2Y20A 2QBYB 1L2CA 3GLHE 1XC8A 2HHHM 2G5GX 3A45A 2WSFF 4MB5A 1PJJA 3I51A 3M7PA 3UZUA 4GITA 5KPZA 2ERCA 2DWNA 3C3EA 4JI7M 3U61B 3HJQA 3MQLA 1SXJA 1WR1B 2QPAA 3HU1A 4LRTA 4ZPXA 2K47A 1NJFA 2KNAA 4Q7JA 4NRWA 2KRUA 1NY6A 1WIVA 2QNJA 4GMQA 2LVNC 1R4GA 1J09A 2LH0A 2BNKA 1OQYA 5C18A 5FSWA 1TGUA 1NO1A 4DV4M 1IBMM 5GKNA 2C98A 3GLIA 2BWEA 1GOIA 4I81A 3WD2A 1OGBA 2Z4SA 1VEJA 3E9SA 2L4FA 3U6PA 4HEOA 8CATA 2UXDM 4NC6A 2MGWA 3GRYA 1KFVA 3VDPA 3OTOM 1OKSA 1N75A 2CV2A 3LVVA 1TH3A 2Y0QA 3K1JA 4REZA 1DGGA 2XSZA 1G8PA 2XSZD 3B7ZA 4HL4A 4LY6A 3KP0E 4D81A 3UJNA 3CF0A 4JI4M 3HZJA 4GKKM 2R18A 4LFAM 4IBEA 1PGYA 3FKEA 2Y2JA 3HONA 3TQSA 4M9ZA 1T6OA 1IY1A 2I7PA 1A5TA 4B3SM 2RTSA 3C3DA 1IXZA 4LJAA 4DR1M 5EXSA 1Q3BA 2FOIC 3KSJA 1SXJC 2X4AA 3J2PB 4JI5M 3L28A 1HNXM 4NZ5A 4FW9A 4GKJM 3AKZA 4LJ6A 3E21A 2CV0A 1CXWA 2WSCF 1HQCA 2DAIA 4XBOA 2P5TA 1K3WA 2Y2PA 3C9PA 3WX7A 1H6UA 1WGLA 1LV7A 2YFQA 1OJLA 2EUCA 4DV0M 2DI0A 4KLNA 1N34M 2JZ1A 3SHGB 1ORYB 3W68A 5KPRA 1W1PA 2KHHA 1IXSA 1G71A 4FCVA 3TWKA 4FCTA 5H37D 1IBKM 1TH2A 3L25A 3SC3A 1ED7A 3PVSA 4LZZA 4AKIA 3QAUA 2B3TA 1QUSA 1N77A 1MU5A 1NV8A 2JNHA 1YE9A 3FUXA 5IZ7D 3ZC7B 3GLIE 3J7AS 2UXCM 2DZLA 2X49A 5A2QS 1KYIA 3F92A 5IWAM 2Y0TA 4PDIA 4DR5M 3T1YM 3FE3A 1L2DA 1Z5BA 4AZFA 4RNAA 3LCVB 1RU3A 3JR5A 2D7EA 4G3OA 3TL4X 3SATA 2JY7A 2ZAOA 3HY5A 3HHYA 1YLAA 4Z2JA 3A98B 4IBFA 4R3DA 3DZDA 4X64M 3SARA 4DR7M 1QQWA 3Q8GA 4Z8XA 3B7NA 3KSXA 3QWLA 3N3FA 4AG6A 2LNHC 2RRUA 2V5OA 1OIZA 2UWXA 4JI0M 3KP1E 4JXJA 2Z3XA 1GPFA 2EKKA 4DV1M 3VK7A 3SASA 4TUWA 2C9OA 4P17A 2K9DA 3FTDA 3K92A 3BOSA 1VDLA 4DBGB 2XLJA 4LZJA 2KA6B 1VQ1A 3GP1A 4FD2A 1IN5A 4G6ZA 2RGOA 1QDRA 4NXNM 1PM5A 2KW0A 1T43A 2YQZA 5KQ8A 1IFYA 2LVAA 2JWSA 3KXEC 2DENA 3LMMA 3VK8A 3HHWA 2CUZA 3AJIB 3QYBA 4OU7A 4G4QA 2HKJA 3U60B 4JI2M 2Y2MA 1TR8A 1J7KA 7CATA 4Z2KA 4IBJA 1DV0A 3KS8A 1PJSA 3T15A 4D82A 1NNJA 1F4IA 4DR3M 3ZH9B 3KDSE 2C99A 3HJSA 4HMCA 3CTWB 3HHZA 4IBBA 2Y21A 1GL6A 1TH4A 4F1IA 1Y8GA 1QDTA 3MHVC 3VFDA 1W1VA 3GRRA 1CK7A 1IN4A 4M0WA 1XNRM 2FH0A 5FTKA 2XF3A 3PFIA 2O25A 4AKGA 4Z2GA 4AI6A 5ITYA 1UFZA 3VKHA 1SG9A 2CHGA 3M6AA 4I5SA 3HJ8A 5KQDA 2UUCM 4IJFA 1FJGM 3ZCBB 4FVMA 3GPXA 4MB4A 3C58A 1VEKA 1C7YA 1TTEA 3PXGA 4CGYB 3GLHB 2Y2LA 2CHVA 4QNMA 3GPYA 1YU4A 3HHXA 2MJ5B 2J7NA 4NOOB 4NL4H 5IT9S 4OVZB 1OAIA 1H8PA 2ZAMA 4DV6M 1QUTA 1NJGA 2XH9A 1L1ZA 3GRUA 3U6CA 2F5NA 3QYEA 2JCHA 4LJ7A 1TDHA 1XB2B 4FWHA 3NBIA 2QP9X 3GQ3A 2LVPC 2BG1A 3NBXX 3ILKA 3I4YA 3K8ZA 2EKFA 2KNVA 5EXTA 1ZMWA 2EA0A 3L27A 4OJPA 4DR6M 1NHGC 2G8LA 2LXEA 5ITXE 3SMSA 4L8RC 1QVRA 3TWMA 3HU3A 3U6EA 4M9XA 1EAKA 2R45A 4S12A 3M7GA 3HSHA 4MB3A 3PNYA 3FTEA 4Z2IA 1R2YA 2H5XA 2Y2HA 1P3QQ 2CWBA 1IQPA 3FD9A 1G41A 2KZSA 1YU1A 3SBJA 4OJ6A 2CEAA 1E32A 3EIEA 5ITQA 4IBGA 3W67A 3U6MA 2Y2OA 5ITXA 4LF7M 3GLGA 1VG5A 3GLIB 2R62A 3T6PA 2OPFA 2CE7A 1OFIA 4G4RA 2JE5A 3UMMA 1G3IA 2BJVA 2KZUA 1J5EM 1SXJE 3J80S 1VDDA 2APLA 3FYCA 2ZM6M 4LG2A 1N78A 4NY2A 4ANRA 3KW6A 1O6IA 4UN2B 4MGHA 2XGNA 5KO3A 2FE8A 1W5TA 3KOZE 4IBKA 4W5WA 3I04M 3L2AA 3U6QA 3SAWA 2K0BX 4GIPA 1WHCA 3D8LA 1IXSB 4GEWA 4Y28F 4NSOB 3U60A 4LJ8A 3WD3A 5KPTA 4OJ5A 3NWLA 1WGNA 1YU2A 5L8RF 2I7NA 2LBCA 4MGIE 4QOZC 2H1RA 4BBAA 4OJLA 3FTCA 5E6JA 1GXDA 4QOSA 1PDCA 1BVSA 3B9PA 4II7A 4A3VB 1YU0A 2HAKA 2DWZB 1ZQ9A
chains in the Genus database with same CATH topology
4Z6YA 5EXXA 2F5OA 2VQEM 1L1TA 2Y2IA 2DHRA 2QCUA 4YHHM 3U5ZB 2L09A 2BJWA 2R46A 2W82A 2QZ4A 3HKPA 3Q8XA 4LJ9A 2XEPA 4X62M 1HT1E 3A42A 2X8AA 1QANA 2Y2GA 1NVMA 2CHQA 3GLGB 4OX9M 3K2LA 2O5RA 1GLNA 1N33M 1DGBA 2YR0A 3J81S 4LF5M 3FUTA 4NZ3A 3GLHA 3GO8A 3CF2A 1D2NA 1IXRC 2UUAM 1YU3A 4L78A 2E5LM 2J7OA 3L26A 3GPPA 1KSFX 3SYLA 4X65M 4BLCA 3I4VA 4RF1A 4B08A 1DGFA 2JA2A 1R7RA 5EP4A 4JI8M 2VQFM 1JR3D 1ZAEA 4HLQA 5JI2E 5FLXS 4FWDA 4DV3M 4I8OA 3HGIA 3GQ4A 3FUWA 3SAVA 4NZ1A 3VDUA 3WHKA 2YNMD 2RGHA 1MX0A 2M60A 3E4RA 1NNUC 3U6SA 4D80A 3HWSA 3D8BA 2Q2EB 4NYYA 2XD5A 4KODA 1IM2A 4JI6M 1YSYA 4MM3B 5FTMA 2FNAA 5FTNA 3GPUA 2QENA 4YY3M 1R2ZA 1GVNA 3T38A 1NY5A 4MGKE 3U6DA 4K0KM 4JI1M 1XMOM 3LVWA 4AW4A 1T3TA 4GRIA 5ITTA 1G59A 2UUBM 3SYKA 4G4NA 2NQ8C 4LJ4A 4AQYM 1S3SA 2KRKA 3CF6E 4IJEA 4KHPM 4IBCA 2F5PA 1OFHA 4JI3M 2ZBKB 3AOEC 4LF4M 5ITRA 1IBLM 3JAMS 5ITUA 5EJCA 3KFUG 2XFTA 4LCBA 3PNVA 2KEBA 3R9XB 3A46A 3KS4A 3U6OA 2D7GA 4GHLA 2Y2QA 3LQQA 1K3XA 3THGA 1XMQM 3AL0C 1DO0A 2L7IA 4DV2M 3AOEA 4MGYE 4QHTA 3VLFB 1XXHB 4B3MM 1E9SA 2DZOB 4FCWA 3GLFA 2HL7A 1X37A 1N32M 1E9RA 4NZ4A 2Y2KA 3MK6A 1XNQM 1HQYE 4DR4M 2XD1A 5JI3E 4MB7A 1JQJC 1JR3A 1XWIA 4X66M 2R65A 4LF6M 2RKOA 1QAMA 2R4JA 2FFJA 2R4EA 4G4OA 2F5QA 4AG5A 3FUVA 1C1KA 4BB9A 4OVZA 4B3RM 3RFWA 4LF8M 3TPZA 3KOYE 2A5YB 4QNLA 2L6OA 2CV1A 2VIIA 1UM8A 4I4LA 1GKIA 1I4WA 3L29A 3KVWA 5DNYA 4LF9M 1WXQA 1IN6A 1YUEA 4L15A 4JV5M 2V6ZM 2HCBA 4IBDA 2XZUA 1L8QA 4JN6A 2F4VM 4LGYA 2FFFB 2M5ZA 4R7GA 2F5SA 1QZMA 2XFSA 5FTLA 3SAUA 4LFCM 2CFOA 2D7HA 5EP2A 3TWLA 4IIWA 3AFHA 4WW0A 1QAQA 1GL7A 5FTJA 5BPVA 2QBYA 4IBIA 4P16A 1HNZM 1K82A 4B7GA 4LGMA 2Y2NA 1Z5AA 1IN7A 4OUIA 1EE8A 1Q3CA 3TE6A 3H4MA 2Z4RA 4PCZA 1IY0A 3EIHA 3SMPA 2ZANA 4KO8A 4B7HA 5BR8M 2XZFA 5IREB 3KOWE 4GC5A 3DFZA 3DA1A 3J27B 5C1BA 4L16A 3KOXE 1IN8A 5DYIA 1HNWM 3HU2A 5LMUM 4M0DA 5EXPA 1TDZA 4LJ5A 2DZNB 4GC9A 4WURA 4JYAM 3RGSA 2EO2A 2V1CA 4B7FA 2C5RA 1SXJB 4NXMM 4NSRA 3U61A 3MJ5A 4PDGA 1DGHB 2V1UA 2LWXA 1IY2A 4L4UA 4XGIA 3GQ5A 4DV5M 3WHLA 3RE8A 3SHFA 4FWGA 4LFBM 1YUBA 5EQTA 4OW0A 4PT5A 4DUZM 4GHAA 2UU9M 2IOUA 2UXBM 3LQRA 4EIWA 3FUUA 5EP3A 3RGPA 2DXIA 1E94E 3M0EA 4PD2A 1NHWC 4DUYM 1HT2E 4B3TM 2OQ4A 4M9SA 3IG5A 1DGHA 3R8FA 1L2BA 1Z59A 3W0LB 3FTFA 1SXJD 5EP1A 1HR0M 5E26A 3IG8A 4AKHA 4RF0A 3U5ZA 2KXEA 3VKGA 3FYDA 3U6LA 2AHMA 4CISA 2C9CA 3UK6A 4QHSA 2Z7JA 1Z5CA 4GH9A 1I94M 4NRVA 1QYRA 1XHBA 4LRSA 3UGJA 3W0FA 1Z6TA 3T1HM 5DYGA 3J7BA 1QAOA 3AOGA 4MGZE 4MH0E 1W5SA 1FNNA 3GLFB 4DV7M 3AV0A 1Q39A 3SFZA 2DVWB 1PJIA 1XXHA 1G4AE 5LMNM 4OJOA 2C96A 4CHTB 3JR4A 4DR2M 4QNRA 5F3WA 2DWMA 1R6BX 3GRVA 1DO2A 4ITQA 1NSFA 2DWLA 2L7HA 3DOAA 2Y20A 2QBYB 1L2CA 1XC8A 2HHHM 2G5GX 3A45A 1PJJA 3I51A 3UZUA 4GITA 5KPZA 2ERCA 4JI7M 3U61B 3HJQA 1SXJA 4LRTA 2QPAA 3HU1A 4ZPXA 2K47A 1NJFA 4NRWA 2KRUA 1NY6A 4GMQA 1J09A 2LH0A 2BNKA 5C18A 1IBMM 5FSWA 1TGUA 4DV4M 5GKNA 2C98A 3GLIA 4I81A 2Z4SA 3E9SA 3U6PA 8CATA 2UXDM 3GRYA 1KFVA 3VDPA 3OTOM 1N75A 2CV2A 3LVVA 1TH3A 3K1JA 2Y0QA 4REZA 1DGGA 2XSZA 1G8PA 2XSZD 4HL4A 4LY6A 4D81A 3KP0E 3UJNA 3CF0A 4JI4M 4GKKM 2R18A 4LFAM 4IBEA 3FKEA 2Y2JA 3HONA 3TQSA 4M9ZA 1IY1A 2I7PA 4B3SM 4DR1M 1IXZA 4LJAA 5EXSA 1Q3BA 2FOIC 3KSJA 1SXJC 2X4AA 3J2PB 4JI5M 3L28A 1HNXM 4NZ5A 4FW9A 4GKJM 3AKZA 4LJ6A 2CV0A 1HQCA 4XBOA 2P5TA 1K3WA 2Y2PA 3WX7A 1H6UA 1LV7A 2YFQA 1OJLA 2EUCA 4DV0M 4KLNA 1N34M 3SHGB 1ORYB 5KPRA 4FCVA 3TWKA 4FCTA 5H37D 1IBKM 1TH2A 3L25A 3SC3A 3PVSA 4LZZA 4AKIA 3QAUA 1N77A 1MU5A 3FUXA 1YE9A 5IZ7D 3ZC7B 3J7AS 2UXCM 2X49A 5A2QS 1KYIA 5IWAM 2Y0TA 4PDIA 4DR5M 3T1YM 1L2DA 2DWNA 1Z5BA 4AZFA 4RNAA 3JR5A 3SATA 2D7EA 3TL4X 2ZAOA 3HHYA 3A98B 4IBFA 4R3DA 3DZDA 4X64M 3SARA 4DR7M 1QQWA 4Z8XA 3KSXA 3QWLA 3N3FA 4AG6A 2LNHC 2UWXA 4JI0M 3KP1E 4JXJA 2Z3XA 4DV1M 3VK7A 3SASA 4TUWA 2C9OA 3FTDA 3K92A 3BOSA 2XLJA 4LZJA 2KA6B 3GP1A 4FD2A 1IN5A 4G6ZA 2RGOA 1PM5A 4NXNM 2KW0A 2YQZA 5KQ8A 3KXEC 3LMMA 3VK8A 1N36M 4NYUA 3HHWA 2CUZA 3AJIB 4OU7A 4G4QA 3U60B 2HKJA 4JI2M 2Y2MA 1J7KA 7CATA 4IBJA 3KS8A 3T15A 4D82A 1NNJA 4DR3M 3ZH9B 3KDSE 2C99A 3HJSA 3CTWB 3HHZA 4IBBA 2Y21A 1GL6A 1TH4A 3MHVC 3VFDA 3GRRA 1IN4A 4M0WA 1XNRM 5FTKA 2XF3A 3PFIA 4AKGA 4AI6A 5ITYA 3VKHA 2CHGA 4I5SA 3M6AA 3HJ8A 5KQDA 2UUCM 4IJFA 1FJGM 3ZCBB 4FVMA 3GPXA 3C58A 3PXGA 4CGYB 3GLHB 2Y2LA 2CHVA 4QNMA 3GPYA 1YU4A 3HHXA 2J7NA 4NOOB 4NL4H 5IT9S 4OVZB 2ZAMA 4DV6M 1NJGA 2XH9A 1L1ZA 3GRUA 3U6CA 2F5NA 2JCHA 4LJ7A 1TDHA 4FWHA 3NBIA 2QP9X 3GQ3A 2BG1A 3ILKA 3I4YA 3K8ZA 4OJPA 5EXTA 2EA0A 3L27A 4DR6M 1NHGC 2G8LA 2LXEA 5ITXE 3SMSA 4L8RC 1QVRA 3TWMA 3HU3A 3U6EA 4M9XA 2R45A 4S12A 3M7GA 3HSHA 3PNYA 3FTEA 1R2YA 2Y2HA 1IQPA 3FD9A 1G41A 2KZSA 1YU1A 3SBJA 4OJ6A 2CEAA 1E32A 3EIEA 5ITQA 4IBGA 3U6MA 2Y2OA 5ITXA 4LF7M 3GLGA 3GLIB 2R62A 2OPFA 4G4RA 2CE7A 1OFIA 2JE5A 3UMMA 1G3IA 2BJVA 2KZUA 1J5EM 1SXJE 3J80S 1VDDA 3FYCA 2ZM6M 4LG2A 1N78A 4NY2A 3KW6A 4MGHA 2XGNA 5KO3A 2FE8A 1W5TA 3KOZE 4IBKA 4W5WA 3L2AA 3U6QA 3SAWA 1YU2A 4GIPA 3D8LA 1IXSB 3U60A 4NSOB 4LJ8A 5KPTA 4OJ5A 3NWLA 2I7NA 4MGIE 4QOZC 2H1RA 4BBAA 4OJLA 3FTCA 5E6JA 4QOSA 3B9PA 4II7A 4A3VB 1YU0A 2DWZB 1ZQ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BPV A;  4GHL A;  4IBI A;  4IJF A;  4IBJ A;  3L28 A;  4IBK A;  3L2A A;  3KS8 A;  4IBF A;  3L29 A;  4IJE A;  4IBB A;  4IBC A;  4GHA A;  4IBG A;  4IBD A;  4GH9 A;  3L25 A;  4IBE A;  3FKE A;  3L27 A;  3L26 A;  3KS4 A;  4LG2 A; 
#chains in the Genus database with same CATH topology
 4Z6Y A;  5EXX A;  2CP8 A;  2F5O A;  2VQE M;  1L1T A;  2Y2I A;  2DHR A;  2QCU A;  2WSE F;  4YHH M;  3U5Z B;  2L09 A;  2BJW A;  2R46 A;  2W82 A;  2QZ4 A;  3HKP A;  3Q8X A;  4LJ9 A;  2XEP A;  4X62 M;  1HT1 E;  3A42 A;  1KS0 A;  2X8A A;  1QAN A;  1H0I A;  2Y2G A;  1NVM A;  1R5L A;  2CHQ A;  3GLG B;  4OX9 M;  3K2L A;  2O5R A;  1GLN A;  1N33 M;  1DGB A;  2YR0 A;  2QSF X;  3J81 S;  2L4E A;  4LF5 M;  3FUT A;  4NZ3 A;  3GLH A;  3GO8 A;  3CF2 A;  1D2N A;  1IXR C;  1PRB A;  1MN3 A;  2UUA M;  1E6P A;  1YU3 A;  4L78 A;  2E5L M;  2J7O A;  3L26 A;  3GPP A;  1KSF X;  1J7M A;  3SYL A;  2DAK A;  2VF7 A;  2WZJ A;  4BLC A;  4X65 M;  1GJS A;  2FS1 A;  3I4V A;  2MR9 A;  4RF1 A;  4B08 A;  1DGF A;  2JA2 A;  4HMD A;  1R7R A;  5EP4 A;  4JI8 M;  2VQF M;  1JR3 D;  1VEG A;  1ZAE A;  4HLQ A;  5JI2 E;  5FLX S;  4WP2 A;  4FWD A;  4DV3 M;  4I8O A;  1UR8 A;  3HGI A;  3GQ4 A;  3FUW A;  3SAV A;  2OOA A;  2R44 A;  4NZ1 A;  3VDU A;  3WHK A;  4TX8 A;  2YNM D;  2RGH A;  1D0K A;  1MX0 A;  2J5Y A;  2M60 A;  3E4R A;  1EIJ A;  1NNU C;  3U6S A;  4D80 A;  3HWS A;  3D8B A;  3ZQJ A;  2Q2E B;  4NYY A;  2XD5 A;  4KOD A;  1E88 A;  1IM2 A;  2O01 F;  1YSY A;  2DAM A;  4JI6 M;  4MM3 B;  5FTM A;  2JY5 A;  2FNA A;  5FTN A;  3GPU A;  2QEN A;  3V76 A;  4YY3 M;  1AIW A;  1PJQ A;  1R2Z A;  1GVN A;  3T38 A;  1GO5 A;  1NY5 A;  4MGK E;  3U6D A;  4Z2H A;  4K0K M;  4JI1 M;  1XMO M;  3B74 A;  2DAE A;  3LVW A;  4AW4 A;  1T3T A;  4GRI A;  5ITT A;  2OO9 A;  1G59 A;  2UUB M;  1D0L A;  4Z2L A;  3SYK A;  1JR3 E;  2NQ8 C;  4LJ4 A;  3LCU A;  1S3S A;  2KRK A;  3CF6 E;  4IJE A;  4G4N A;  4AQY M;  4KHP M;  4IBC A;  2F5P A;  1OFH A;  2GNO A;  4JI3 M;  2ZBK B;  3AOE C;  4LF4 M;  1V92 A;  1ZMU A;  2JUJ A;  2KDL A;  3JAM S;  5ITU A;  5ITR A;  5EJC A;  1IBL M;  3KFU G;  2XFT A;  4LCB A;  3PNV A;  2KEB A;  2JXN A;  3R9X B;  3A46 A;  3KS4 A;  3U6O A;  1HJP A;  2D7G A;  4GHL A;  2Y2Q A;  3LQQ A;  1V33 A;  2LTU A;  1K3X A;  2GQF A;  2FN2 A;  3THG A;  1XMQ M;  3LW5 F;  3AL0 C;  1DO0 A;  2L7I A;  2KNZ A;  2MRO B;  4DV2 M;  3AOE A;  4MGY E;  4QHT A;  3VLF B;  1XXH B;  2EJS A;  4B3M M;  4NYU A;  1JB0 F;  1E9S A;  2DZO B;  4FCW A;  3GLF A;  2MH8 A;  2HL7 A;  1X37 A;  1N32 M;  1E9R A;  4NZ4 A;  2Y2K A;  2DAG A;  3MK6 A;  1XNQ M;  1HQY E;  1UR9 A;  1WJ7 A;  4DR4 M;  2XD1 A;  1E6N A;  1ZMV A;  5JI3 E;  4MB7 A;  1JQJ C;  1JR3 A;  1XWI A;  2QQ8 A;  2R65 A;  4X66 M;  3WD0 A;  4LF6 M;  3FRH A;  2RKO A;  1QAM A;  1E6R A;  2JP7 A;  2R4J A;  2FFJ A;  2R4E A;  1D0M A;  4G4O A;  2F5Q A;  4AG5 A;  3FUV A;  1C1K A;  4BB9 A;  4OVZ A;  4B3R M;  3RFW A;  3GLG E;  4LF8 M;  3TPZ A;  3KOY E;  1QO6 A;  1ZV1 A;  2A5Y B;  4QNL A;  1L6J A;  2L6O A;  2CV1 A;  4CJ6 A;  2VII A;  1E15 A;  1UM8 A;  4I4L A;  1GKI A;  1I4W A;  3L29 A;  3KVW A;  5DNY A;  4LF9 M;  1WXQ A;  2VF8 A;  3E46 A;  1IN6 A;  4RKU F;  3H4J A;  1YUE A;  4L15 A;  4JV5 M;  2DHY A;  2V6Z M;  2HCB A;  2JY8 A;  2LVO C;  4IBD A;  2XZU A;  3WD4 A;  1L8Q A;  4JN6 A;  2F4V M;  2R6F A;  4LGY A;  2FFF B;  2M5Z A;  4R7G A;  2F5S A;  1QZM A;  2LVQ D;  2DKL A;  2XFS A;  3MMP A;  3IEC A;  5FTL A;  1OGG A;  3SAU A;  2L2D A;  4LFC M;  2CFO A;  2D7H A;  5EP2 A;  3TWL A;  3K9O A;  3FRI A;  4IIW A;  4CIZ A;  3AFH A;  3WD1 A;  4WW0 A;  1QAQ A;  1GL7 A;  5FTJ A;  1W1Y A;  5BPV A;  2QBY A;  3K9P A;  2CRU A;  2LHC A;  4IBI A;  4P16 A;  1HNZ M;  1K82 A;  4B7G A;  4LGM A;  2ZTD A;  2Y2N A;  1Z5A A;  1IN7 A;  4OUI A;  1EE8 A;  1Q3C A;  5DFL A;  3TE6 A;  3H4M A;  1AUA A;  2Z4R A;  4PCZ A;  2LHG A;  2D49 A;  1IY0 A;  3EIH A;  3SMP A;  3GLF E;  2ZAN A;  4KO8 A;  4B7H A;  5BR8 M;  2XZF A;  5IRE B;  3KOW E;  4GC5 A;  3DFZ A;  1AIP C;  1NV9 A;  1XXH E;  3DA1 A;  3J27 B;  1GAB A;  5C1B A;  4L16 A;  3KOX E;  1IN8 A;  5DYI A;  2HWJ A;  4F2L A;  2JZ0 A;  1OIP A;  1GJT A;  3HU2 A;  5LMU M;  1HNW M;  4M0D A;  5EXP A;  1TDZ A;  4LJ5 A;  2DZN B;  1MJG M;  3BXW A;  4GC9 A;  3CGW A;  4WUR A;  4JYA M;  3RGS A;  1E6Z A;  2EO2 A;  2V1C A;  4B7F A;  2C5R A;  1SXJ B;  4NXM M;  4NSR A;  3U61 A;  2G3Q A;  3MJ5 A;  4PDG A;  1DGH B;  2V1U A;  2LWX A;  1IY2 A;  4L4U A;  4XGI A;  3GQ5 A;  4DV5 M;  2ZTC A;  3WHL A;  3RE8 A;  3SHF A;  4L6V 6;  2JY6 B;  4FWG A;  1YUB A;  2DNA A;  5EQT A;  4OW0 A;  4PT5 A;  4DUZ M;  4GHA A;  2UU9 M;  2IOU A;  2Z8Y M;  2UXB M;  2N35 A;  3LQR A;  4EIW A;  3FUU A;  5EP3 A;  3RGP A;  2DXI A;  1E94 E;  1LTM A;  3M0E A;  4PD2 A;  1NHW C;  4DUY M;  1EFU B;  2OOB A;  1HT2 E;  4B3T M;  3B89 A;  2OQ4 A;  4M9S A;  3IG5 A;  1DGH A;  3BBZ A;  3R8F A;  1H0G A;  1L2B A;  1Z59 A;  2BWB A;  3HX3 A;  3W0L B;  3B7Q A;  1TF0 B;  3FTF A;  4LFB M;  4HME A;  1SXJ D;  5EP1 A;  1HR0 M;  2R0I A;  3IG8 A;  5E26 A;  4AKH A;  4RF0 A;  1QZE A;  2KXE A;  3U5Z A;  1OTR A;  3VKG A;  3FYD A;  3U6L A;  2AHM A;  3I01 M;  2C9C A;  4CIS A;  3UK6 A;  2K6B A;  2VDB B;  4QHS A;  2QHO B;  2Z7J A;  1Z5C A;  4R71 A;  4GH9 A;  1I94 M;  4NRV A;  1QYR A;  1V34 A;  1XHB A;  4LRS A;  3UGJ A;  3W0F A;  1Z6T A;  3T1H M;  1Q02 A;  5DYG A;  1CUK A;  3J7B A;  1W1T A;  1QAO A;  3AOG A;  4MGZ E;  4MH0 E;  1W5S A;  1FNN A;  3GLF B;  4DV7 M;  3AV0 A;  1Q39 A;  3SFZ A;  2DVW B;  1PJI A;  4XK8 F;  1XXH A;  1G4A E;  3IHP A;  5LMN M;  4OJO A;  2C96 A;  4KT0 F;  4CHT B;  3JR4 A;  4DR2 M;  4QNR A;  5F3W A;  2DWM A;  1E8B A;  1PJT A;  1R6B X;  3GRV A;  1DO2 A;  4ITQ A;  1NSF A;  1OAO C;  2DWL A;  2L7H A;  3DOA A;  1N36 M;  2Y20 A;  2QBY B;  1L2C A;  3GLH E;  1XC8 A;  2HHH M;  2G5G X;  3A45 A;  2WSF F;  4MB5 A;  1PJJ A;  3I51 A;  3M7P A;  3UZU A;  4GIT A;  5KPZ A;  2ERC A;  2DWN A;  3C3E A;  4JI7 M;  3U61 B;  3HJQ A;  3MQL A;  1SXJ A;  1WR1 B;  2QPA A;  3HU1 A;  4LRT A;  4ZPX A;  2K47 A;  1NJF A;  2KNA A;  4Q7J A;  4NRW A;  2KRU A;  1NY6 A;  1WIV A;  2QNJ A;  4GMQ A;  2LVN C;  1R4G A;  1J09 A;  2LH0 A;  2BNK A;  1OQY A;  5C18 A;  5FSW A;  1TGU A;  1NO1 A;  4DV4 M;  1IBM M;  5GKN A;  2C98 A;  3GLI A;  2BWE A;  1GOI A;  4I81 A;  3WD2 A;  1OGB A;  2Z4S A;  1VEJ A;  3E9S A;  2L4F A;  3U6P A;  4HEO A;  8CAT A;  2UXD M;  4NC6 A;  2MGW A;  3GRY A;  1KFV A;  3VDP A;  3OTO M;  1OKS A;  1N75 A;  2CV2 A;  3LVV A;  1TH3 A;  2Y0Q A;  3K1J A;  4REZ A;  1DGG A;  2XSZ A;  1G8P A;  2XSZ D;  3B7Z A;  4HL4 A;  4LY6 A;  3KP0 E;  4D81 A;  3UJN A;  3CF0 A;  4JI4 M;  3HZJ A;  4GKK M;  2R18 A;  4LFA M;  4IBE A;  1PGY A;  3FKE A;  2Y2J A;  3HON A;  3TQS A;  4M9Z A;  1T6O A;  1IY1 A;  2I7P A;  1A5T A;  4B3S M;  2RTS A;  3C3D A;  1IXZ A;  4LJA A;  4DR1 M;  5EXS A;  1Q3B A;  2FOI C;  3KSJ A;  1SXJ C;  2X4A A;  3J2P B;  4JI5 M;  3L28 A;  1HNX M;  4NZ5 A;  4FW9 A;  4GKJ M;  3AKZ A;  4LJ6 A;  3E21 A;  2CV0 A;  1CXW A;  2WSC F;  1HQC A;  2DAI A;  4XBO A;  2P5T A;  1K3W A;  2Y2P A;  3C9P A;  3WX7 A;  1H6U A;  1WGL A;  1LV7 A;  2YFQ A;  1OJL A;  2EUC A;  4DV0 M;  2DI0 A;  4KLN A;  1N34 M;  2JZ1 A;  3SHG B;  1ORY B;  3W68 A;  5KPR A;  1W1P A;  2KHH A;  1IXS A;  1G71 A;  4FCV A;  3TWK A;  4FCT A;  5H37 D;  1IBK M;  1TH2 A;  3L25 A;  3SC3 A;  1ED7 A;  3PVS A;  4LZZ A;  4AKI A;  3QAU A;  2B3T A;  1QUS A;  1N77 A;  1MU5 A;  1NV8 A;  2JNH A;  1YE9 A;  3FUX A;  5IZ7 D;  3ZC7 B;  3GLI E;  3J7A S;  2UXC M;  2DZL A;  2X49 A;  5A2Q S;  1KYI A;  3F92 A;  5IWA M;  2Y0T A;  4PDI A;  4DR5 M;  3T1Y M;  3FE3 A;  1L2D A;  1Z5B A;  4AZF A;  4RNA A;  3LCV B;  1RU3 A;  3JR5 A;  2D7E A;  4G3O A;  3TL4 X;  3SAT A;  2JY7 A;  2ZAO A;  3HY5 A;  3HHY A;  1YLA A;  4Z2J A;  3A98 B;  4IBF A;  4R3D A;  3DZD A;  4X64 M;  3SAR A;  4DR7 M;  1QQW A;  3Q8G A;  4Z8X A;  3B7N A;  3KSX A;  3QWL A;  3N3F A;  4AG6 A;  2LNH C;  2RRU A;  2V5O A;  1OIZ A;  2UWX A;  4JI0 M;  3KP1 E;  4JXJ A;  2Z3X A;  1GPF A;  2EKK A;  4DV1 M;  3VK7 A;  3SAS A;  4TUW A;  2C9O A;  4P17 A;  2K9D A;  3FTD A;  3K92 A;  3BOS A;  1VDL A;  4DBG B;  2XLJ A;  4LZJ A;  2KA6 B;  1VQ1 A;  3GP1 A;  4FD2 A;  1IN5 A;  4G6Z A;  2RGO A;  1QDR A;  4NXN M;  1PM5 A;  2KW0 A;  1T43 A;  2YQZ A;  5KQ8 A;  1IFY A;  2LVA A;  2JWS A;  3KXE C;  2DEN A;  3LMM A;  3VK8 A;  3HHW A;  2CUZ A;  3AJI B;  3QYB A;  4OU7 A;  4G4Q A;  2HKJ A;  3U60 B;  4JI2 M;  2Y2M A;  1TR8 A;  1J7K A;  7CAT A;  4Z2K A;  4IBJ A;  1DV0 A;  3KS8 A;  1PJS A;  3T15 A;  4D82 A;  1NNJ A;  1F4I A;  4DR3 M;  3ZH9 B;  3KDS E;  2C99 A;  3HJS A;  4HMC A;  3CTW B;  3HHZ A;  4IBB A;  2Y21 A;  1GL6 A;  1TH4 A;  4F1I A;  1Y8G A;  1QDT A;  3MHV C;  3VFD A;  1W1V A;  3GRR A;  1CK7 A;  1IN4 A;  4M0W A;  1XNR M;  2FH0 A;  5FTK A;  2XF3 A;  3PFI A;  2O25 A;  4AKG A;  4Z2G A;  4AI6 A;  5ITY A;  1UFZ A;  3VKH A;  1SG9 A;  2CHG A;  3M6A A;  4I5S A;  3HJ8 A;  5KQD A;  2UUC M;  4IJF A;  1FJG M;  3ZCB B;  4FVM A;  3GPX A;  4MB4 A;  3C58 A;  1VEK A;  1C7Y A;  1TTE A;  3PXG A;  4CGY B;  3GLH B;  2Y2L A;  2CHV A;  4QNM A;  3GPY A;  1YU4 A;  3HHX A;  2MJ5 B;  2J7N A;  4NOO B;  4NL4 H;  5IT9 S;  4OVZ B;  1OAI A;  1H8P A;  2ZAM A;  4DV6 M;  1QUT A;  1NJG A;  2XH9 A;  1L1Z A;  3GRU A;  3U6C A;  2F5N A;  3QYE A;  2JCH A;  4LJ7 A;  1TDH A;  1XB2 B;  4FWH A;  3NBI A;  2QP9 X;  3GQ3 A;  2LVP C;  2BG1 A;  3NBX X;  3ILK A;  3I4Y A;  3K8Z A;  2EKF A;  2KNV A;  5EXT A;  1ZMW A;  2EA0 A;  3L27 A;  4OJP A;  4DR6 M;  1NHG C;  2G8L A;  2LXE A;  5ITX E;  3SMS A;  4L8R C;  1QVR A;  3TWM A;  3HU3 A;  3U6E A;  4M9X A;  1EAK A;  2R45 A;  4S12 A;  3M7G A;  3HSH A;  4MB3 A;  3PNY A;  3FTE A;  4Z2I A;  1R2Y A;  2H5X A;  2Y2H A;  1P3Q Q;  2CWB A;  1IQP A;  3FD9 A;  1G41 A;  2KZS A;  1YU1 A;  3SBJ A;  4OJ6 A;  2CEA A;  1E32 A;  3EIE A;  5ITQ A;  4IBG A;  3W67 A;  3U6M A;  2Y2O A;  5ITX A;  4LF7 M;  3GLG A;  1VG5 A;  3GLI B;  2R62 A;  3T6P A;  2OPF A;  2CE7 A;  1OFI A;  4G4R A;  2JE5 A;  3UMM A;  1G3I A;  2BJV A;  2KZU A;  1J5E M;  1SXJ E;  3J80 S;  1VDD A;  2APL A;  3FYC A;  2ZM6 M;  4LG2 A;  1N78 A;  4NY2 A;  4ANR A;  3KW6 A;  1O6I A;  4UN2 B;  4MGH A;  2XGN A;  5KO3 A;  2FE8 A;  1W5T A;  3KOZ E;  4IBK A;  4W5W A;  3I04 M;  3L2A A;  3U6Q A;  3SAW A;  2K0B X;  4GIP A;  1WHC A;  3D8L A;  1IXS B;  4GEW A;  4Y28 F;  4NSO B;  3U60 A;  4LJ8 A;  3WD3 A;  5KPT A;  4OJ5 A;  3NWL A;  1WGN A;  1YU2 A;  5L8R F;  2I7N A;  2LBC A;  4MGI E;  4QOZ C;  2H1R A;  4BBA A;  4OJL A;  3FTC A;  5E6J A;  1GXD A;  4QOS A;  1PDC A;  1BVS A;  3B9P A;  4II7 A;  4A3V B;  1YU0 A;  2HAK A;  2DWZ B;  1ZQ9 A; 
#chains in the Genus database with same CATH homology
 4Z6Y A;  5EXX A;  2F5O A;  2VQE M;  1L1T A;  2Y2I A;  2DHR A;  2QCU A;  4YHH M;  3U5Z B;  2L09 A;  2BJW A;  2R46 A;  2W82 A;  2QZ4 A;  3HKP A;  3Q8X A;  4LJ9 A;  2XEP A;  4X62 M;  1HT1 E;  3A42 A;  2X8A A;  1QAN A;  2Y2G A;  1NVM A;  2CHQ A;  3GLG B;  4OX9 M;  3K2L A;  2O5R A;  1GLN A;  1N33 M;  1DGB A;  2YR0 A;  3J81 S;  4LF5 M;  3FUT A;  4NZ3 A;  3GLH A;  3GO8 A;  3CF2 A;  1D2N A;  1IXR C;  2UUA M;  1YU3 A;  4L78 A;  2E5L M;  2J7O A;  3L26 A;  3GPP A;  1KSF X;  3SYL A;  4X65 M;  4BLC A;  3I4V A;  4RF1 A;  4B08 A;  1DGF A;  2JA2 A;  1R7R A;  5EP4 A;  4JI8 M;  2VQF M;  1JR3 D;  1ZAE A;  4HLQ A;  5JI2 E;  5FLX S;  4FWD A;  4DV3 M;  4I8O A;  3HGI A;  3GQ4 A;  3FUW A;  3SAV A;  4NZ1 A;  3VDU A;  3WHK A;  2YNM D;  2RGH A;  1MX0 A;  2M60 A;  3E4R A;  1NNU C;  3U6S A;  4D80 A;  3HWS A;  3D8B A;  2Q2E B;  4NYY A;  2XD5 A;  4KOD A;  1IM2 A;  4JI6 M;  1YSY A;  4MM3 B;  5FTM A;  2FNA A;  5FTN A;  3GPU A;  2QEN A;  4YY3 M;  1R2Z A;  1GVN A;  3T38 A;  1NY5 A;  4MGK E;  3U6D A;  4K0K M;  4JI1 M;  1XMO M;  3LVW A;  4AW4 A;  1T3T A;  4GRI A;  5ITT A;  1G59 A;  2UUB M;  3SYK A;  4G4N A;  2NQ8 C;  4LJ4 A;  4AQY M;  1S3S A;  2KRK A;  3CF6 E;  4IJE A;  4KHP M;  4IBC A;  2F5P A;  1OFH A;  4JI3 M;  2ZBK B;  3AOE C;  4LF4 M;  5ITR A;  1IBL M;  3JAM S;  5ITU A;  5EJC A;  3KFU G;  2XFT A;  4LCB A;  3PNV A;  2KEB A;  3R9X B;  3A46 A;  3KS4 A;  3U6O A;  2D7G A;  4GHL A;  2Y2Q A;  3LQQ A;  1K3X A;  3THG A;  1XMQ M;  3AL0 C;  1DO0 A;  2L7I A;  4DV2 M;  3AOE A;  4MGY E;  4QHT A;  3VLF B;  1XXH B;  4B3M M;  1E9S A;  2DZO B;  4FCW A;  3GLF A;  2HL7 A;  1X37 A;  1N32 M;  1E9R A;  4NZ4 A;  2Y2K A;  3MK6 A;  1XNQ M;  1HQY E;  4DR4 M;  2XD1 A;  5JI3 E;  4MB7 A;  1JQJ C;  1JR3 A;  1XWI A;  4X66 M;  2R65 A;  4LF6 M;  2RKO A;  1QAM A;  2R4J A;  2FFJ A;  2R4E A;  4G4O A;  2F5Q A;  4AG5 A;  3FUV A;  1C1K A;  4BB9 A;  4OVZ A;  4B3R M;  3RFW A;  4LF8 M;  3TPZ A;  3KOY E;  2A5Y B;  4QNL A;  2L6O A;  2CV1 A;  2VII A;  1UM8 A;  4I4L A;  1GKI A;  1I4W A;  3L29 A;  3KVW A;  5DNY A;  4LF9 M;  1WXQ A;  1IN6 A;  1YUE A;  4L15 A;  4JV5 M;  2V6Z M;  2HCB A;  4IBD A;  2XZU A;  1L8Q A;  4JN6 A;  2F4V M;  4LGY A;  2FFF B;  2M5Z A;  4R7G A;  2F5S A;  1QZM A;  2XFS A;  5FTL A;  3SAU A;  4LFC M;  2CFO A;  2D7H A;  5EP2 A;  3TWL A;  4IIW A;  3AFH A;  4WW0 A;  1QAQ A;  1GL7 A;  5FTJ A;  5BPV A;  2QBY A;  4IBI A;  4P16 A;  1HNZ M;  1K82 A;  4B7G A;  4LGM A;  2Y2N A;  1Z5A A;  1IN7 A;  4OUI A;  1EE8 A;  1Q3C A;  3TE6 A;  3H4M A;  2Z4R A;  4PCZ A;  1IY0 A;  3EIH A;  3SMP A;  2ZAN A;  4KO8 A;  4B7H A;  5BR8 M;  2XZF A;  5IRE B;  3KOW E;  4GC5 A;  3DFZ A;  3DA1 A;  3J27 B;  5C1B A;  4L16 A;  3KOX E;  1IN8 A;  5DYI A;  1HNW M;  3HU2 A;  5LMU M;  4M0D A;  5EXP A;  1TDZ A;  4LJ5 A;  2DZN B;  4GC9 A;  4WUR A;  4JYA M;  3RGS A;  2EO2 A;  2V1C A;  4B7F A;  2C5R A;  1SXJ B;  4NXM M;  4NSR A;  3U61 A;  3MJ5 A;  4PDG A;  1DGH B;  2V1U A;  2LWX A;  1IY2 A;  4L4U A;  4XGI A;  3GQ5 A;  4DV5 M;  3WHL A;  3RE8 A;  3SHF A;  4FWG A;  4LFB M;  1YUB A;  5EQT A;  4OW0 A;  4PT5 A;  4DUZ M;  4GHA A;  2UU9 M;  2IOU A;  2UXB M;  3LQR A;  4EIW A;  3FUU A;  5EP3 A;  3RGP A;  2DXI A;  1E94 E;  3M0E A;  4PD2 A;  1NHW C;  4DUY M;  1HT2 E;  4B3T M;  2OQ4 A;  4M9S A;  3IG5 A;  1DGH A;  3R8F A;  1L2B A;  1Z59 A;  3W0L B;  3FTF A;  1SXJ D;  5EP1 A;  1HR0 M;  5E26 A;  3IG8 A;  4AKH A;  4RF0 A;  3U5Z A;  2KXE A;  3VKG A;  3FYD A;  3U6L A;  2AHM A;  4CIS A;  2C9C A;  3UK6 A;  4QHS A;  2Z7J A;  1Z5C A;  4GH9 A;  1I94 M;  4NRV A;  1QYR A;  1XHB A;  4LRS A;  3UGJ A;  3W0F A;  1Z6T A;  3T1H M;  5DYG A;  3J7B A;  1QAO A;  3AOG A;  4MGZ E;  4MH0 E;  1W5S A;  1FNN A;  3GLF B;  4DV7 M;  3AV0 A;  1Q39 A;  3SFZ A;  2DVW B;  1PJI A;  1XXH A;  1G4A E;  5LMN M;  4OJO A;  2C96 A;  4CHT B;  3JR4 A;  4DR2 M;  4QNR A;  5F3W A;  2DWM A;  1R6B X;  3GRV A;  1DO2 A;  4ITQ A;  1NSF A;  2DWL A;  2L7H A;  3DOA A;  2Y20 A;  2QBY B;  1L2C A;  1XC8 A;  2HHH M;  2G5G X;  3A45 A;  1PJJ A;  3I51 A;  3UZU A;  4GIT A;  5KPZ A;  2ERC A;  4JI7 M;  3U61 B;  3HJQ A;  1SXJ A;  4LRT A;  2QPA A;  3HU1 A;  4ZPX A;  2K47 A;  1NJF A;  4NRW A;  2KRU A;  1NY6 A;  4GMQ A;  1J09 A;  2LH0 A;  2BNK A;  5C18 A;  1IBM M;  5FSW A;  1TGU A;  4DV4 M;  5GKN A;  2C98 A;  3GLI A;  4I81 A;  2Z4S A;  3E9S A;  3U6P A;  8CAT A;  2UXD M;  3GRY A;  1KFV A;  3VDP A;  3OTO M;  1N75 A;  2CV2 A;  3LVV A;  1TH3 A;  3K1J A;  2Y0Q A;  4REZ A;  1DGG A;  2XSZ A;  1G8P A;  2XSZ D;  4HL4 A;  4LY6 A;  4D81 A;  3KP0 E;  3UJN A;  3CF0 A;  4JI4 M;  4GKK M;  2R18 A;  4LFA M;  4IBE A;  3FKE A;  2Y2J A;  3HON A;  3TQS A;  4M9Z A;  1IY1 A;  2I7P A;  4B3S M;  4DR1 M;  1IXZ A;  4LJA A;  5EXS A;  1Q3B A;  2FOI C;  3KSJ A;  1SXJ C;  2X4A A;  3J2P B;  4JI5 M;  3L28 A;  1HNX M;  4NZ5 A;  4FW9 A;  4GKJ M;  3AKZ A;  4LJ6 A;  2CV0 A;  1HQC A;  4XBO A;  2P5T A;  1K3W A;  2Y2P A;  3WX7 A;  1H6U A;  1LV7 A;  2YFQ A;  1OJL A;  2EUC A;  4DV0 M;  4KLN A;  1N34 M;  3SHG B;  1ORY B;  5KPR A;  4FCV A;  3TWK A;  4FCT A;  5H37 D;  1IBK M;  1TH2 A;  3L25 A;  3SC3 A;  3PVS A;  4LZZ A;  4AKI A;  3QAU A;  1N77 A;  1MU5 A;  3FUX A;  1YE9 A;  5IZ7 D;  3ZC7 B;  3J7A S;  2UXC M;  2X49 A;  5A2Q S;  1KYI A;  5IWA M;  2Y0T A;  4PDI A;  4DR5 M;  3T1Y M;  1L2D A;  2DWN A;  1Z5B A;  4AZF A;  4RNA A;  3JR5 A;  3SAT A;  2D7E A;  3TL4 X;  2ZAO A;  3HHY A;  3A98 B;  4IBF A;  4R3D A;  3DZD A;  4X64 M;  3SAR A;  4DR7 M;  1QQW A;  4Z8X A;  3KSX A;  3QWL A;  3N3F A;  4AG6 A;  2LNH C;  2UWX A;  4JI0 M;  3KP1 E;  4JXJ A;  2Z3X A;  4DV1 M;  3VK7 A;  3SAS A;  4TUW A;  2C9O A;  3FTD A;  3K92 A;  3BOS A;  2XLJ A;  4LZJ A;  2KA6 B;  3GP1 A;  4FD2 A;  1IN5 A;  4G6Z A;  2RGO A;  1PM5 A;  4NXN M;  2KW0 A;  2YQZ A;  5KQ8 A;  3KXE C;  3LMM A;  3VK8 A;  1N36 M;  4NYU A;  3HHW A;  2CUZ A;  3AJI B;  4OU7 A;  4G4Q A;  3U60 B;  2HKJ A;  4JI2 M;  2Y2M A;  1J7K A;  7CAT A;  4IBJ A;  3KS8 A;  3T15 A;  4D82 A;  1NNJ A;  4DR3 M;  3ZH9 B;  3KDS E;  2C99 A;  3HJS A;  3CTW B;  3HHZ A;  4IBB A;  2Y21 A;  1GL6 A;  1TH4 A;  3MHV C;  3VFD A;  3GRR A;  1IN4 A;  4M0W A;  1XNR M;  5FTK A;  2XF3 A;  3PFI A;  4AKG A;  4AI6 A;  5ITY A;  3VKH A;  2CHG A;  4I5S A;  3M6A A;  3HJ8 A;  5KQD A;  2UUC M;  4IJF A;  1FJG M;  3ZCB B;  4FVM A;  3GPX A;  3C58 A;  3PXG A;  4CGY B;  3GLH B;  2Y2L A;  2CHV A;  4QNM A;  3GPY A;  1YU4 A;  3HHX A;  2J7N A;  4NOO B;  4NL4 H;  5IT9 S;  4OVZ B;  2ZAM A;  4DV6 M;  1NJG A;  2XH9 A;  1L1Z A;  3GRU A;  3U6C A;  2F5N A;  2JCH A;  4LJ7 A;  1TDH A;  4FWH A;  3NBI A;  2QP9 X;  3GQ3 A;  2BG1 A;  3ILK A;  3I4Y A;  3K8Z A;  4OJP A;  5EXT A;  2EA0 A;  3L27 A;  4DR6 M;  1NHG C;  2G8L A;  2LXE A;  5ITX E;  3SMS A;  4L8R C;  1QVR A;  3TWM A;  3HU3 A;  3U6E A;  4M9X A;  2R45 A;  4S12 A;  3M7G A;  3HSH A;  3PNY A;  3FTE A;  1R2Y A;  2Y2H A;  1IQP A;  3FD9 A;  1G41 A;  2KZS A;  1YU1 A;  3SBJ A;  4OJ6 A;  2CEA A;  1E32 A;  3EIE A;  5ITQ A;  4IBG A;  3U6M A;  2Y2O A;  5ITX A;  4LF7 M;  3GLG A;  3GLI B;  2R62 A;  2OPF A;  4G4R A;  2CE7 A;  1OFI A;  2JE5 A;  3UMM A;  1G3I A;  2BJV A;  2KZU A;  1J5E M;  1SXJ E;  3J80 S;  1VDD A;  3FYC A;  2ZM6 M;  4LG2 A;  1N78 A;  4NY2 A;  3KW6 A;  4MGH A;  2XGN A;  5KO3 A;  2FE8 A;  1W5T A;  3KOZ E;  4IBK A;  4W5W A;  3L2A A;  3U6Q A;  3SAW A;  1YU2 A;  4GIP A;  3D8L A;  1IXS B;  3U60 A;  4NSO B;  4LJ8 A;  5KPT A;  4OJ5 A;  3NWL A;  2I7N A;  4MGI E;  4QOZ C;  2H1R A;  4BBA A;  4OJL A;  3FTC A;  5E6J A;  4QOS A;  3B9P A;  4II7 A;  4A3V B;  1YU0 A;  2DWZ B;  1ZQ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...