4IJFA

Crystal structure of the zaire ebolavirus vp35 interferon inhibitory domain k222a/r225a/k248a/k251a mutant
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
123
structure length
123
Chain Sequence
b'DISAADLANIMYDHLPGFGTAFHQLVQVICALGADSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polymerase cofactor VP35
publication title Development of RNA Aptamers Targeting Ebola Virus VP35.
pubmed doi rcsb
source organism Zaire ebolavirus
molecule tags Viral protein
total genus 36
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2012-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ijfA01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4ijfA02
4IBJA 3L2AA 4IBBA 3KS8A 4IBFA 3FKEA 4IJEA 4IJFA 3L29A 4LG2A 4IBKA 3L25A 4GHLA 4IBEA 4IBCA 4IBIA 4IBDA 3L26A 3KS4A 4GHAA 5BPVA 4IBGA 3L28A 3L27A 4GH9A
chains in the Genus database with same CATH superfamily
1VDLA 1N34M 1SXJE 3GQ3A 2R45A 1VQ1A 2DZOB 4GMQA 1ED7A 2AHMA 2FS1A 4FCVA 1GVNA 3FUTA 2F5SA 3A98B 3U5ZA 4LF9M 3TWLA 3GLHE 3HJ8A 4LZJA 3K2LA 2JZ1A 3WD1A 3UMMA 4MGHA 1TH4A 3FTDA 4QOSA 3TQSA 4LG2A 3SARA 2Y2KA 1Q3BA 1XB2B 2EA0A 2HKJA 2MR9A 3GQ4A 3A46A 4K0KM 2JA2A 4OVZA 1E6ZA 2D49A 4R71A 3J2PB 3JAMS 3HWSA 1ZMWA 3HHXA 4D80A 4FCWA 2QHOB 4NXNM 3L28A 3HJQA 2Y2IA 2JUJA 3PFIA 4OJ6A 1OFHA 1ZV1A 1A5TA 1G8PA 3RFWA 2Y20A 3FUWA 4JN6A 4X66M 4OJOA 1IN4A 3MMPA 2VF8A 2FFFB 2Y2NA 2RKOA 3CF6E 4M9SA 5KPZA 2HWJA 2EKKA 3FUVA 4MB4A 3HHZA 4M9XA 3GLHB 4GEWA 1QZMA 3SBJA 3CTWB 2ZM6M 5EXXA 2OOAA 1L8QA 3DOAA 3FTEA 1LTMA 3KSXA 1GL7A 1E6PA 1XXHA 5ITQA 1GO5A 1JR3D 3T1HM 4IBEA 3T15A 3C58A 4RKUF 1E88A 1QAOA 4JXJA 1P3QQ 2YNMD 4QNRA 2XSZD 3L26A 1FJGM 1KS0A 3NWLA 2KA6B 3F92A 3AOGA 4PT5A 3GPXA 2Y2MA 4OJ5A 1DGBA 2FH0A 3GLGA 2KNVA 2EJSA 4Z6YA 3H4JA 3DA1A 3QYEA 3FTCA 2YR0A 2NQ8C 4LJ7A 2R6FA 4KT0F 4IIWA 2UXDM 1Y8GA 4CIZA 1AUAA 3PNYA 4G4OA 3C9PA 3Q8GA 4KHPM 4Z2JA 1UFZA 1HQCA 2DNAA 3IECA 3ZCBB 2F5PA 1D0MA 3M6AA 1S3SA 2BJVA 4A3VB 3B7ZA 3L25A 3R9XB 1T43A 4JI5M 1Z5CA 4IBDA 3WD4A 1TH3A 2LVQD 2Y2QA 1IBMM 3KFUG 2J7NA 2VQFM 5JI2E 4JV5M 1DGHA 1NNUC 2QCUA 7CATA 1LV7A 3T6PA 2Y2GA 3KDSE 2DWZB 3SMSA 1YU4A 3N3FA 1OAOC 1I94M 2XH9A 4HMDA 3PNVA 3L2AA 1PJTA 2CV0A 3KVWA 1PJIA 4IBBA 4R3DA 1HJPA 2CE7A 3E21A 3VDUA 1EFUB 4LF4M 1VEKA 1HT1E 4LFCM 1QUSA 4AG5A 2GNOA 1DV0A 1DO0A 3JR5A 2JZ0A 1OFIA 4LF7M 3U6QA 2F5NA 2W82A 3CGWA 3GRYA 1NVMA 1YUBA 4FW9A 2QBYB 2DAIA 2JY6B 3GLFA 4GIPA 2OPFA 3KP0E 4B3SM 3U6LA 1N33M 4Z2HA 1WGLA 3HZJA 1FNNA 1IN6A 2JY5A 4XK8F 3SMPA 1J5EM 2V5OA 2HAKA 4M9ZA 1OIZA 1NY6A 2CUZA 4RNAA 4QOZC 4PDIA 1L6JA 1JR3A 5EP1A 1D2NA 2DAMA 2IOUA 4KO8A 3SAUA 5ITTA 1IXSB 2XSZA 3EIHA 2F5OA 2GQFA 2I7PA 5C18A 5ITXE 1AIWA 4LJ4A 4MB3A 5L8RF 2OQ4A 2B3TA 2L7IA 2C98A 2QP9X 1QAMA 2YQZA 4RF1A 3SYLA 1H8PA 5EQTA 2XD5A 3LMMA 3FRHA 3RE8A 4PCZA 2OO9A 4DV7M 4LCBA 2KDLA 1G3IA 4REZA 2D7EA 4PDGA 3L27A 4JI6M 4LF8M 4GKKM 1OGBA 2CFOA 4OJLA 4DV3M 4DV0M 3UJNA 1N36M 2H5XA 3GRRA 2KZUA 3E9SA 4DV2M 3GRUA 1E6NA 4NRVA 1IXZA 2DAKA 2V1CA 3I4YA 3M7GA 4G4QA 2KHHA 4UN2B 1W5TA 2DAEA 1HNXM 3SHFA 3KS8A 3VK7A 2DXIA 2FOIC 1HT2E 3LW5F 2K47A 2E5LM 3GP1A 4X65M 3HONA 2BWEA 2Y21A 1N75A 2CRUA 2J5YA 2XZUA 4OJPA 3WHKA 5KPTA 1W5SA 1QQWA 1GLNA 2DZNB 3TPZA 1XNRM 4LJAA 5ITYA 2JE5A 4MB7A 1KFVA 1HNZM 1GABA 2HL7A 4GITA 4NXMM 3HSHA 4MB5A 1VDDA 2DWMA 2ZTDA 4LZZA 3U6EA 4JYAM 2LVOC 3U6CA 1JB0F 4ITQA 2CWBA 1YSYA 4DUYM 3E46A 5ITRA 1TF0B 4IBJA 3LQQA 2FFJA 4G4RA 1SXJB 1TR8A 2MROB 1BVSA 2OOBA 3ILKA 1GXDA 2CP8A 1IN5A 2L09A 1IQPA 2APLA 2LHCA 4GC9A 5IWAM 1CXWA 4MGZE 2BNKA 4NOOB 3M7PA 3VKHA 1HQYE 2L7HA 1C7YA 3J7AS 4FVMA 3QYBA 1K3WA 1OKSA 2K0BX 2JY7A 2WSFF 4P16A 3U61B 3RGPA 4QHSA 3LCUA 2KRUA 3UK6A 1KYIA 1YU2A 2DWNA 3EIEA 4B3MM 2LXEA 3AFHA 3U60B 4DV1M 2LHGA 5FSWA 3WD3A 2I7NA 3C3DA 1XMQM 4DUZM 1G71A 3HKPA 4NSRA 1GJTA 2EKFA 2F5QA 5IREB 3U5ZB 2UU9M 4GRIA 8CATA 1SG9A 4I5SA 2QSFX 2RRUA 5F3WA 2XGNA 1X37A 4NC6A 1WGNA 2WZJA 3CF2A 3CF0A 4IBFA 1H0GA 2Y2JA 3WD0A 3GLIA 2DKLA 1XXHE 5LMUM 1OQYA 1SXJD 4B7FA 1YU1A 1W1VA 4MH0E 3HHYA 4OVZB 1D0LA 4JI0M 3ZC7B 1R7RA 1UR8A 1J09A 1YLAA 4B3RM 5IT9S 5ITUA 2LVPC 1PDCA 3K9OA 2DAGA 2R65A 3QWLA 1DGFA 2L4FA 1OAIA 3I4VA 3HJSA 2R46A 5EXTA 5KPRA 3GLGE 4G4NA 1K3XA 1GJSA 4X62M 1CK7A 2LBCA 3HU2A 4MGYE 2MJ5B 2C99A 4NYYA 4QNLA 2BWBA 3FUUA 1H0IA 3FUXA 2KNAA 2A5YB 4KLNA 1UM8A 1J7KA 4P17A 4B7HA 4NY2A 4AKHA 2QZ4A 2VF7A 1WHCA 4BB9A 3U6SA 4JI7M 4I8OA 1L2BA 4OW0A 2UUBM 3W0LB 4B3TM 4FCTA 1NV9A 4IJFA 4QHTA 3L29A 3H4MA 1ZMUA 3LVVA 4HMEA 5KQ8A 3SHGB 3T38A 1Z59A 3FTFA 2KNZA 4DV6M 2UXBM 2Y2PA 4XGIA 3Q8XA 2UWXA 5GKNA 3IG8A 2UUAM 3J27B 5LMNM 4FWDA 3B9PA 3V76A 4LJ9A 4XBOA 3A42A 3RGSA 3GQ5A 2XF3A 1W1YA 1O6IA 1L1ZA 3K1JA 3GLGB 4AW4A 1XNQM 2KXEA 1R2YA 4NL4H 1V34A 2XFSA 1D0KA 5EJCA 1AIPC 1WXQA 2DENA 3I51A 3WHLA 2D7GA 2FE8A 4AQYM 3KXEC 4LJ5A 1EIJA 2G5GX 3KP1E 4YHHM 2Y2OA 4Z2GA 2CHVA 4HEOA 4LRTA 4OUIA 1K82A 2HCBA 2RGHA 3GO8A 5E26A 4CISA 1QZEA 4TX8A 2G3QA 3MQLA 2CV1A 3MHVC 1J7MA 2X8AA 2DZLA 2K9DA 4BLCA 3UGJA 4LFBM 5EXSA 5FTNA 3W0FA 2JXNA 3E4RA 3GLFE 5DFLA 2DHRA 4DR5M 3SFZA 5KQDA 1IBKM 4OU7A 1GL6A 1DGHB 2X49A 3TWMA 2XZFA 1TGUA 1YU3A 2RGOA 4GH9A 1UR9A 5C1BA 3KOXE 2LVNC 1RU3A 2D7HA 2EO2A 3MK6A 2FN2A 1G41A 2JCHA 1SXJA 1E6RA 5FTKA 4OX9M 1MX0A 3HX3A 4M0DA 3SATA 1F4IA 3KOZE 4AKGA 4NZ5A 1PGYA 1IY0A 1DGGA 3AV0A 1R4GA 4L15A 3GLHA 4S12A 1V92A 2CHGA 2QNJA 4PD2A 1N78A 2H1RA 3U6PA 4DR1M 3J7BA 4IJEA 1XHBA 2J7OA 2YFQA 2Z4RA 4WP2A 1IN7A 1R2ZA 3AL0C 4GHLA 4L78A 1KSFX 1T3TA 2LTUA 4CJ6A 2LVAA 1ZQ9A 1TDHA 2XFTA 3KSJA 1MJGM 5FTLA 3GPYA 4B08A 3GLFB 3D8BA 5EXPA 4NYUA 2VIIA 2LWXA 3AJIB 4JI2M 1IY2A 4R7GA 3LQRA 3U60A 5EP3A 5E6JA 1EAKA 2C9OA 1WIVA 3B89A 1IXRC 5FTMA 2MGWA 4Q7JA 4DR2M 3LCVB 2M5ZA 4LGMA 3A45A 1NO1A 2VQEM 1EE8A 3PXGA 1TH2A 2KEBA 1VG5A 1R6BX 4DV5M 1IN8A 3AOEA 3HU3A 1VEGA 3MJ5A 1ZAEA 1OIPA 1QVRA 1XWIA 4BBAA 1HR0M 2JP7A 1NJGA 1QANA 2XEPA 3BXWA 3HGIA 3GPPA 2DVWB 3KOWE 3LVWA 4IBKA 5FTJA 2WSEF 3UZUA 4FWGA 1N32M 3FYDA 4LJ8A 3VFDA 2UXCM 4Z8XA 3DFZA 1I4WA 1E15A 1GPFA 2RTSA 1YU0A 4ANRA 2BG1A 1IY1A 1E32A 2C96A 2JWSA 2R18A 3I01M 1WR1B 3KOYE 4FD2A 4G3OA 4LRSA 4D81A 2L4EA 3R8FA 4Z2IA 3FE3A 4ZPXA 4D82A 1Z6TA 3AKZA 1PJJA 2CV2A 4LFAM 4DR6M 3VKGA 4JI1M 3BOSA 1Z5AA 2DWLA 1OGGA 2FNAA 5JI3E 4WURA 1WJ7A 1Z5BA 4M0WA 4MM3B 3TE6A 5KO3A 3HU1A 4DR3M 1N77A 2F4VM 2Y2LA 1PJSA 4HL4A 4HMCA 2O25A 5A2QS 3FKEA 4I4LA 3D8LA 3ZH9B 1CUKA 1NHGC 1QYRA 2JY8A 2ZAMA 2Y2HA 4NRWA 2Z8YM 5FLXS 1E9SA 2C9CA 4HLQA 4F2LA 4FWHA 1XMOM 2CHQA 4DBGB 1QAQA 3JR4A 5BR8M 3U6MA 4Z2LA 4LF6M 3SC3A 3IG5A 3KS4A 2QBYA 2O01F 2QENA 4IBGA 3TWKA 4MGIE 5BPVA 4L8RC 3WX7A 2DHYA 1QDRA 3FRIA 4W5WA 3TL4X 2Q2EB 2K6BA 2R62A 3NBIA 3QAUA 2LH0A 3T1YM 4JI3M 3FYCA 2ERCA 2Z4SA 2KW0A 5DYGA 1R5LA 2QPAA 4LJ6A 3GLIE 3B7QA 2Z3XA 1W1PA 2V6ZM 2VDBB 2ZAOA 5H37D 4L16A 2XLJA 1MU5A 1PRBA 1PM5A 2N35A 2R4EA 1Q3CA 1IM2A 1IXSA 2G8LA 3B7NA 4JI4M 3U6OA 1XXHB 3FD9A 3K9PA 3SAWA 4DR4M 4NZ3A 2QQ8A 4AZFA 4IBIA 3B74A 4LGYA 1MN3A 2L2DA 1H6UA 3SASA 1SXJC 4GHAA 1PJQA 1YUEA 4NZ1A 1GKIA 1NV8A 4II7A 2MH8A 1L1TA 1IFYA 1E94E 1OJLA 1Q39A 1HNWM 4TUWA 1E8BA 4B7GA 4CHTB 2ZANA 4DV4M 3GRVA 3IHPA 1JQJC 4L6V6 4NSOB 4WW0A 1T6OA 3J80S 2L6OA 2Z7JA 3K8ZA 1GOIA 3GLIB 3WD2A 1G4AE 3THGA 2X4AA 1V33A 4GC5A 3VK8A 2O5RA 4Z2KA 1NJFA 4Y28F 3VLFB 3W68A 2LNHC 1YE9A 3SYKA 4AI6A 3HHWA 3J81S 1ZMVA 5DYIA 5ITXA 4YY3M 1ORYB 3K92A 4MGKE 3GPUA 3OTOM 1TDZA 4X64M 4CGYB 5DNYA 5EP2A 1QUTA 2R44A 3AOEC 4QNMA 1VEJA 2V1UA 3ZQJA 3U6DA 2KRKA 3M0EA 1IBLM 2BJWA 1L2CA 4GKJM 3KW6A 1NNJA 5EP4A 2HHHM 2Y0QA 2UUCM 1JR3E 4JI8M 4EIWA 4AKIA 4AG6A 2ZTCA 2JNHA 3I04M 4L4UA 2CEAA 1OTRA 1DO2A 2WSCF 4RF0A 3VDPA 4NZ4A 2P5TA 1QO6A 3PVSA 2EUCA 4G6ZA 3BBZA 2DI0A 4LY6A 5IZ7D 3W67A 1E9RA 1NY5A 2KZSA 4KODA 2R0IA 1TTEA 1C1KA 4LF5M 4F1IA 2XD1A 2R4JA 4IBCA 1Q02A 3SAVA 2Y0TA 3U61A 1QDTA 1G59A 1W1TA 1NSFA 3DZDA 1NHWC 2C5RA 4DR7M 4I81A 1L2DA 1XC8A 2ZBKB 3C3EA 3HY5A 3NBXX 2M60A
chains in the Genus database with same CATH topology
1N34M 1SXJE 3GQ3A 2R45A 2DZOB 4GMQA 2AHMA 4FCVA 2F5SA 1GVNA 3FUTA 3A98B 3U5ZA 4LF9M 3TWLA 3HJ8A 4LZJA 3K2LA 3UMMA 4MGHA 1TH4A 3FTDA 4QOSA 3TQSA 4LG2A 3SARA 2Y2KA 1Q3BA 2EA0A 2HKJA 3GQ4A 3A46A 4K0KM 2JA2A 4OVZA 3J2PB 3JAMS 3HWSA 3HHXA 4D80A 4FCWA 4NXNM 3L28A 3HJQA 2Y2IA 4OJ6A 3PFIA 1OFHA 1G8PA 3RFWA 2Y20A 3FUWA 4JN6A 4X66M 4OJOA 1IN4A 2FFFB 2Y2NA 2RKOA 3CF6E 4M9SA 5KPZA 3FUVA 3HHZA 4M9XA 3GLHB 1QZMA 3SBJA 3CTWB 2ZM6M 5EXXA 1L8QA 3DOAA 3FTEA 3KSXA 1GL7A 1XXHA 5ITQA 1JR3D 3T1HM 4IBEA 3T15A 3C58A 1QAOA 4JXJA 2YNMD 4QNRA 2XSZD 3L26A 1FJGM 3NWLA 2KA6B 3GPXA 3AOGA 4PT5A 2Y2MA 4OJ5A 1DGBA 3GLGA 4Z6YA 3DA1A 3FTCA 2YR0A 2NQ8C 4LJ7A 4IIWA 2UXDM 3PNYA 4G4OA 4KHPM 1HQCA 3ZCBB 2F5PA 3M6AA 1S3SA 2BJVA 4A3VB 3L25A 3R9XB 4JI5M 1Z5CA 4IBDA 1TH3A 2Y2QA 1IBMM 3KFUG 2J7NA 2VQFM 5JI2E 4JV5M 1DGHA 1NNUC 2QCUA 7CATA 1LV7A 2Y2GA 3KDSE 2DWZB 3SMSA 1YU4A 3N3FA 1I94M 2XH9A 3PNVA 3L2AA 2CV0A 3KVWA 1PJIA 4IBBA 4R3DA 2CE7A 3VDUA 4LF4M 1HT1E 4LFCM 4AG5A 1DO0A 3JR5A 1OFIA 4LF7M 3U6QA 2F5NA 2W82A 3GRYA 1NVMA 1YUBA 4FW9A 2QBYB 3GLFA 4GIPA 2OPFA 3KP0E 4B3SM 3U6LA 1N33M 1FNNA 1IN6A 3SMPA 1J5EM 4M9ZA 1NY6A 2CUZA 4RNAA 4QOZC 4PDIA 1JR3A 5EP1A 1D2NA 2IOUA 4KO8A 3SAUA 5ITTA 1IXSB 2XSZA 3EIHA 2F5OA 2I7PA 5C18A 5ITXE 4LJ4A 2OQ4A 2L7IA 2C98A 2QP9X 1QAMA 2YQZA 4RF1A 3SYLA 5EQTA 2XD5A 3LMMA 4PCZA 3RE8A 4DV7M 4LCBA 4REZA 1G3IA 4PDGA 2D7EA 4JI6M 3L27A 4LF8M 4GKKM 2CFOA 4OJLA 4DV3M 4DV0M 3UJNA 1N36M 3GRRA 4DV2M 2KZUA 3E9SA 3GRUA 4NRVA 1IXZA 2V1CA 3I4YA 3M7GA 4G4QA 1HNXM 1W5TA 3SHFA 3KS8A 3VK7A 2DXIA 2FOIC 1HT2E 2E5LM 2K47A 3GP1A 4X65M 3HONA 2Y21A 1N75A 2XZUA 4OJPA 3WHKA 5KPTA 1W5SA 1QQWA 1GLNA 2DZNB 3TPZA 1XNRM 4LJAA 5ITYA 2JE5A 4MB7A 1KFVA 2HL7A 4GITA 4NXMM 3HSHA 1VDDA 2DWMA 4LZZA 4JYAM 3U6EA 3U6CA 4ITQA 1YSYA 4DUYM 5ITRA 4IBJA 3LQQA 2FFJA 4G4RA 1SXJB 3ILKA 2L09A 1IN5A 1IQPA 5IWAM 4GC9A 4MGZE 2BNKA 4NOOB 3VKHA 1HQYE 2L7HA 3J7AS 4FVMA 1K3WA 4P16A 3U61B 3RGPA 4QHSA 1YU2A 2KRUA 3UK6A 1KYIA 2DWNA 3EIEA 4B3MM 2LXEA 3AFHA 3U60B 4DV1M 5FSWA 2I7NA 1XMQM 4DUZM 3HKPA 4NSRA 2F5QA 5IREB 3U5ZB 2UU9M 4GRIA 8CATA 4I5SA 5F3WA 2XGNA 1X37A 3CF2A 3CF0A 4IBFA 2Y2JA 3GLIA 5LMUM 1YU1A 1SXJD 4B7FA 4MH0E 3HHYA 4OVZB 4JI0M 3ZC7B 1R7RA 1J09A 4B3RM 5IT9S 5ITUA 2R65A 3QWLA 1DGFA 3I4VA 3HJSA 2R46A 5EXTA 5KPRA 4G4NA 1K3XA 4X62M 3HU2A 4MGYE 2C99A 4NYYA 4QNLA 3FUUA 3FUXA 2A5YB 4KLNA 1UM8A 1J7KA 4B7HA 4NY2A 4AKHA 2QZ4A 4BB9A 3U6SA 4JI7M 4I8OA 1L2BA 4OW0A 2UUBM 3W0LB 4B3TM 4FCTA 4IJFA 4QHTA 3L29A 3H4MA 3LVVA 5KQ8A 3SHGB 3T38A 1Z59A 3FTFA 4DV6M 2UXBM 2Y2PA 4XGIA 3Q8XA 2UWXA 5GKNA 3IG8A 2UUAM 3J27B 5LMNM 4FWDA 3B9PA 3GQ5A 4LJ9A 4XBOA 3A42A 3RGSA 2XF3A 1L1ZA 3K1JA 3GLGB 4AW4A 1XNQM 2KXEA 1R2YA 4NL4H 2XFSA 5EJCA 1WXQA 3I51A 3WHLA 4AQYM 4DR7M 2D7GA 2FE8A 4NZ1A 3KXEC 4LJ5A 2G5GX 3KP1E 4YHHM 2CHVA 4LRTA 4OUIA 1K82A 2HCBA 2RGHA 3GO8A 5E26A 4CISA 2CV1A 3MHVC 2X8AA 4BLCA 3UGJA 4LFBM 5EXSA 5FTNA 3W0FA 3E4RA 2DHRA 4DR5M 3SFZA 5KQDA 1IBKM 4OU7A 1GL6A 1DGHB 2X49A 3TWMA 2XZFA 1TGUA 1YU3A 2RGOA 4GH9A 5C1BA 3KOXE 3MK6A 2D7HA 2EO2A 2JCHA 1G41A 1SXJA 5FTKA 4OX9M 1MX0A 4M0DA 3SATA 4AKGA 3KOZE 4NZ5A 1IY0A 1DGGA 3AV0A 4L15A 3GLHA 4S12A 2CHGA 4PD2A 1N78A 2H1RA 3U6PA 4DR1M 3J7BA 4IJEA 1XHBA 2J7OA 2YFQA 2Z4RA 1IN7A 1R2ZA 3AL0C 4GHLA 4L78A 1KSFX 1T3TA 1ZQ9A 1TDHA 2XFTA 3KSJA 5FTLA 3GPYA 3GLFB 4B08A 3D8BA 5EXPA 4NYUA 2VIIA 2LWXA 3AJIB 4JI2M 1IY2A 4R7GA 3LQRA 3U60A 5EP3A 5E6JA 2C9OA 5FTMA 1IXRC 4DR2M 2M5ZA 4LGMA 3A45A 2VQEM 1EE8A 3PXGA 1TH2A 2KEBA 4DV5M 1R6BX 1IN8A 3AOEA 3HU3A 3MJ5A 1ZAEA 1QVRA 1XWIA 4BBAA 1HR0M 1NJGA 2XEPA 1QANA 3HGIA 3GPPA 2DVWB 3KOWE 3LVWA 4IBKA 5FTJA 3UZUA 4FWGA 1N32M 3FYDA 4LJ8A 3VFDA 2UXCM 4Z8XA 3DFZA 1I4WA 1YU0A 2BG1A 1IY1A 1E32A 2C96A 2R18A 3KOYE 4FD2A 4LRSA 4D81A 3R8FA 1HNZM 2Y2OA 4ZPXA 4D82A 1Z6TA 3AKZA 1PJJA 2CV2A 4LFAM 4DR6M 3VKGA 4JI1M 3BOSA 1Z5AA 2DWLA 2FNAA 5JI3E 4WURA 1Z5BA 5KO3A 4M0WA 4MM3B 3TE6A 4DR3M 3HU1A 1N77A 2F4VM 2Y2LA 4HL4A 5A2QS 3FKEA 4I4LA 3D8LA 3ZH9B 1NHGC 1QYRA 2ZAMA 2Y2HA 4NRWA 5FLXS 1E9SA 2C9CA 4HLQA 4FWHA 1XMOM 2CHQA 1QAQA 3JR4A 5BR8M 3U6MA 4LF6M 3SC3A 3IG5A 3KS4A 2QBYA 5BPVA 2QENA 4IBGA 3TWKA 4MGIE 4L8RC 3WX7A 4W5WA 3TL4X 2Q2EB 2R62A 3NBIA 3QAUA 2LH0A 3T1YM 4JI3M 3FYCA 2ERCA 2Z4SA 2KW0A 5DYGA 2QPAA 4LJ6A 2Z3XA 2V6ZM 2ZAOA 5H37D 2XLJA 4L16A 1PM5A 1MU5A 2R4EA 1Q3CA 1IM2A 2G8LA 4JI4M 3U6OA 1XXHB 3FD9A 3SAWA 4DR4M 4NZ3A 4AZFA 4IBIA 4LGYA 1H6UA 3SASA 1SXJC 4GHAA 1YUEA 1GKIA 4II7A 1L1TA 1E94E 1OJLA 1Q39A 1HNWM 4TUWA 4B7GA 4CHTB 2ZANA 4DV4M 3GRVA 1JQJC 4NSOB 4WW0A 3J80S 2L6OA 2Z7JA 3K8ZA 3GLIB 1G4AE 3THGA 2X4AA 4GC5A 3VK8A 2O5RA 1NJFA 3VLFB 2LNHC 1YE9A 3SYKA 4AI6A 3HHWA 3J81S 5DYIA 5ITXA 4YY3M 1ORYB 3K92A 4MGKE 3GPUA 3OTOM 1TDZA 4X64M 4CGYB 5DNYA 5EP2A 3AOEC 4QNMA 2V1UA 3U6DA 2KRKA 3M0EA 1IBLM 2BJWA 1L2CA 4GKJM 3KW6A 1NNJA 5EP4A 2HHHM 2Y0QA 2UUCM 4JI8M 4EIWA 4AKIA 4AG6A 4L4UA 2CEAA 4RF0A 1DO2A 4NZ4A 3VDPA 2P5TA 3PVSA 2EUCA 4G6ZA 4LY6A 5IZ7D 1E9RA 1NY5A 2KZSA 4KODA 1C1KA 4LF5M 2XD1A 2R4JA 4IBCA 3SAVA 2Y0TA 3U61A 1G59A 1NSFA 3DZDA 1NHWC 2C5RA 4I81A 1L2DA 1XC8A 2ZBKB 2M60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IBJ A;  3L2A A;  4IBB A;  3KS8 A;  4IBF A;  3FKE A;  4IJE A;  4IJF A;  3L29 A;  4LG2 A;  4IBK A;  3L25 A;  4GHL A;  4IBE A;  4IBC A;  4IBI A;  4IBD A;  3L26 A;  3KS4 A;  4GHA A;  5BPV A;  4IBG A;  3L28 A;  3L27 A;  4GH9 A; 
#chains in the Genus database with same CATH topology
 1VDL A;  1N34 M;  1SXJ E;  3GQ3 A;  2R45 A;  1VQ1 A;  2DZO B;  4GMQ A;  1ED7 A;  2AHM A;  2FS1 A;  4FCV A;  1GVN A;  3FUT A;  2F5S A;  3A98 B;  3U5Z A;  4LF9 M;  3TWL A;  3GLH E;  3HJ8 A;  4LZJ A;  3K2L A;  2JZ1 A;  3WD1 A;  3UMM A;  4MGH A;  1TH4 A;  3FTD A;  4QOS A;  3TQS A;  4LG2 A;  3SAR A;  2Y2K A;  1Q3B A;  1XB2 B;  2EA0 A;  2HKJ A;  2MR9 A;  3GQ4 A;  3A46 A;  4K0K M;  2JA2 A;  4OVZ A;  1E6Z A;  2D49 A;  4R71 A;  3J2P B;  3JAM S;  3HWS A;  1ZMW A;  3HHX A;  4D80 A;  4FCW A;  2QHO B;  4NXN M;  3L28 A;  3HJQ A;  2Y2I A;  2JUJ A;  3PFI A;  4OJ6 A;  1OFH A;  1ZV1 A;  1A5T A;  1G8P A;  3RFW A;  2Y20 A;  3FUW A;  4JN6 A;  4X66 M;  4OJO A;  1IN4 A;  3MMP A;  2VF8 A;  2FFF B;  2Y2N A;  2RKO A;  3CF6 E;  4M9S A;  5KPZ A;  2HWJ A;  2EKK A;  3FUV A;  4MB4 A;  3HHZ A;  4M9X A;  3GLH B;  4GEW A;  1QZM A;  3SBJ A;  3CTW B;  2ZM6 M;  5EXX A;  2OOA A;  1L8Q A;  3DOA A;  3FTE A;  1LTM A;  3KSX A;  1GL7 A;  1E6P A;  1XXH A;  5ITQ A;  1GO5 A;  1JR3 D;  3T1H M;  4IBE A;  3T15 A;  3C58 A;  4RKU F;  1E88 A;  1QAO A;  4JXJ A;  1P3Q Q;  2YNM D;  4QNR A;  2XSZ D;  3L26 A;  1FJG M;  1KS0 A;  3NWL A;  2KA6 B;  3F92 A;  3AOG A;  4PT5 A;  3GPX A;  2Y2M A;  4OJ5 A;  1DGB A;  2FH0 A;  3GLG A;  2KNV A;  2EJS A;  4Z6Y A;  3H4J A;  3DA1 A;  3QYE A;  3FTC A;  2YR0 A;  2NQ8 C;  4LJ7 A;  2R6F A;  4KT0 F;  4IIW A;  2UXD M;  1Y8G A;  4CIZ A;  1AUA A;  3PNY A;  4G4O A;  3C9P A;  3Q8G A;  4KHP M;  4Z2J A;  1UFZ A;  1HQC A;  2DNA A;  3IEC A;  3ZCB B;  2F5P A;  1D0M A;  3M6A A;  1S3S A;  2BJV A;  4A3V B;  3B7Z A;  3L25 A;  3R9X B;  1T43 A;  4JI5 M;  1Z5C A;  4IBD A;  3WD4 A;  1TH3 A;  2LVQ D;  2Y2Q A;  1IBM M;  3KFU G;  2J7N A;  2VQF M;  5JI2 E;  4JV5 M;  1DGH A;  1NNU C;  2QCU A;  7CAT A;  1LV7 A;  3T6P A;  2Y2G A;  3KDS E;  2DWZ B;  3SMS A;  1YU4 A;  3N3F A;  1OAO C;  1I94 M;  2XH9 A;  4HMD A;  3PNV A;  3L2A A;  1PJT A;  2CV0 A;  3KVW A;  1PJI A;  4IBB A;  4R3D A;  1HJP A;  2CE7 A;  3E21 A;  3VDU A;  1EFU B;  4LF4 M;  1VEK A;  1HT1 E;  4LFC M;  1QUS A;  4AG5 A;  2GNO A;  1DV0 A;  1DO0 A;  3JR5 A;  2JZ0 A;  1OFI A;  4LF7 M;  3U6Q A;  2F5N A;  2W82 A;  3CGW A;  3GRY A;  1NVM A;  1YUB A;  4FW9 A;  2QBY B;  2DAI A;  2JY6 B;  3GLF A;  4GIP A;  2OPF A;  3KP0 E;  4B3S M;  3U6L A;  1N33 M;  4Z2H A;  1WGL A;  3HZJ A;  1FNN A;  1IN6 A;  2JY5 A;  4XK8 F;  3SMP A;  1J5E M;  2V5O A;  2HAK A;  4M9Z A;  1OIZ A;  1NY6 A;  2CUZ A;  4RNA A;  4QOZ C;  4PDI A;  1L6J A;  1JR3 A;  5EP1 A;  1D2N A;  2DAM A;  2IOU A;  4KO8 A;  3SAU A;  5ITT A;  1IXS B;  2XSZ A;  3EIH A;  2F5O A;  2GQF A;  2I7P A;  5C18 A;  5ITX E;  1AIW A;  4LJ4 A;  4MB3 A;  5L8R F;  2OQ4 A;  2B3T A;  2L7I A;  2C98 A;  2QP9 X;  1QAM A;  2YQZ A;  4RF1 A;  3SYL A;  1H8P A;  5EQT A;  2XD5 A;  3LMM A;  3FRH A;  3RE8 A;  4PCZ A;  2OO9 A;  4DV7 M;  4LCB A;  2KDL A;  1G3I A;  4REZ A;  2D7E A;  4PDG A;  3L27 A;  4JI6 M;  4LF8 M;  4GKK M;  1OGB A;  2CFO A;  4OJL A;  4DV3 M;  4DV0 M;  3UJN A;  1N36 M;  2H5X A;  3GRR A;  2KZU A;  3E9S A;  4DV2 M;  3GRU A;  1E6N A;  4NRV A;  1IXZ A;  2DAK A;  2V1C A;  3I4Y A;  3M7G A;  4G4Q A;  2KHH A;  4UN2 B;  1W5T A;  2DAE A;  1HNX M;  3SHF A;  3KS8 A;  3VK7 A;  2DXI A;  2FOI C;  1HT2 E;  3LW5 F;  2K47 A;  2E5L M;  3GP1 A;  4X65 M;  3HON A;  2BWE A;  2Y21 A;  1N75 A;  2CRU A;  2J5Y A;  2XZU A;  4OJP A;  3WHK A;  5KPT A;  1W5S A;  1QQW A;  1GLN A;  2DZN B;  3TPZ A;  1XNR M;  4LJA A;  5ITY A;  2JE5 A;  4MB7 A;  1KFV A;  1HNZ M;  1GAB A;  2HL7 A;  4GIT A;  4NXM M;  3HSH A;  4MB5 A;  1VDD A;  2DWM A;  2ZTD A;  4LZZ A;  3U6E A;  4JYA M;  2LVO C;  3U6C A;  1JB0 F;  4ITQ A;  2CWB A;  1YSY A;  4DUY M;  3E46 A;  5ITR A;  1TF0 B;  4IBJ A;  3LQQ A;  2FFJ A;  4G4R A;  1SXJ B;  1TR8 A;  2MRO B;  1BVS A;  2OOB A;  3ILK A;  1GXD A;  2CP8 A;  1IN5 A;  2L09 A;  1IQP A;  2APL A;  2LHC A;  4GC9 A;  5IWA M;  1CXW A;  4MGZ E;  2BNK A;  4NOO B;  3M7P A;  3VKH A;  1HQY E;  2L7H A;  1C7Y A;  3J7A S;  4FVM A;  3QYB A;  1K3W A;  1OKS A;  2K0B X;  2JY7 A;  2WSF F;  4P16 A;  3U61 B;  3RGP A;  4QHS A;  3LCU A;  2KRU A;  3UK6 A;  1KYI A;  1YU2 A;  2DWN A;  3EIE A;  4B3M M;  2LXE A;  3AFH A;  3U60 B;  4DV1 M;  2LHG A;  5FSW A;  3WD3 A;  2I7N A;  3C3D A;  1XMQ M;  4DUZ M;  1G71 A;  3HKP A;  4NSR A;  1GJT A;  2EKF A;  2F5Q A;  5IRE B;  3U5Z B;  2UU9 M;  4GRI A;  8CAT A;  1SG9 A;  4I5S A;  2QSF X;  2RRU A;  5F3W A;  2XGN A;  1X37 A;  4NC6 A;  1WGN A;  2WZJ A;  3CF2 A;  3CF0 A;  4IBF A;  1H0G A;  2Y2J A;  3WD0 A;  3GLI A;  2DKL A;  1XXH E;  5LMU M;  1OQY A;  1SXJ D;  4B7F A;  1YU1 A;  1W1V A;  4MH0 E;  3HHY A;  4OVZ B;  1D0L A;  4JI0 M;  3ZC7 B;  1R7R A;  1UR8 A;  1J09 A;  1YLA A;  4B3R M;  5IT9 S;  5ITU A;  2LVP C;  1PDC A;  3K9O A;  2DAG A;  2R65 A;  3QWL A;  1DGF A;  2L4F A;  1OAI A;  3I4V A;  3HJS A;  2R46 A;  5EXT A;  5KPR A;  3GLG E;  4G4N A;  1K3X A;  1GJS A;  4X62 M;  1CK7 A;  2LBC A;  3HU2 A;  4MGY E;  2MJ5 B;  2C99 A;  4NYY A;  4QNL A;  2BWB A;  3FUU A;  1H0I A;  3FUX A;  2KNA A;  2A5Y B;  4KLN A;  1UM8 A;  1J7K A;  4P17 A;  4B7H A;  4NY2 A;  4AKH A;  2QZ4 A;  2VF7 A;  1WHC A;  4BB9 A;  3U6S A;  4JI7 M;  4I8O A;  1L2B A;  4OW0 A;  2UUB M;  3W0L B;  4B3T M;  4FCT A;  1NV9 A;  4IJF A;  4QHT A;  3L29 A;  3H4M A;  1ZMU A;  3LVV A;  4HME A;  5KQ8 A;  3SHG B;  3T38 A;  1Z59 A;  3FTF A;  2KNZ A;  4DV6 M;  2UXB M;  2Y2P A;  4XGI A;  3Q8X A;  2UWX A;  5GKN A;  3IG8 A;  2UUA M;  3J27 B;  5LMN M;  4FWD A;  3B9P A;  3V76 A;  4LJ9 A;  4XBO A;  3A42 A;  3RGS A;  3GQ5 A;  2XF3 A;  1W1Y A;  1O6I A;  1L1Z A;  3K1J A;  3GLG B;  4AW4 A;  1XNQ M;  2KXE A;  1R2Y A;  4NL4 H;  1V34 A;  2XFS A;  1D0K A;  5EJC A;  1AIP C;  1WXQ A;  2DEN A;  3I51 A;  3WHL A;  2D7G A;  2FE8 A;  4AQY M;  3KXE C;  4LJ5 A;  1EIJ A;  2G5G X;  3KP1 E;  4YHH M;  2Y2O A;  4Z2G A;  2CHV A;  4HEO A;  4LRT A;  4OUI A;  1K82 A;  2HCB A;  2RGH A;  3GO8 A;  5E26 A;  4CIS A;  1QZE A;  4TX8 A;  2G3Q A;  3MQL A;  2CV1 A;  3MHV C;  1J7M A;  2X8A A;  2DZL A;  2K9D A;  4BLC A;  3UGJ A;  4LFB M;  5EXS A;  5FTN A;  3W0F A;  2JXN A;  3E4R A;  3GLF E;  5DFL A;  2DHR A;  4DR5 M;  3SFZ A;  5KQD A;  1IBK M;  4OU7 A;  1GL6 A;  1DGH B;  2X49 A;  3TWM A;  2XZF A;  1TGU A;  1YU3 A;  2RGO A;  4GH9 A;  1UR9 A;  5C1B A;  3KOX E;  2LVN C;  1RU3 A;  2D7H A;  2EO2 A;  3MK6 A;  2FN2 A;  1G41 A;  2JCH A;  1SXJ A;  1E6R A;  5FTK A;  4OX9 M;  1MX0 A;  3HX3 A;  4M0D A;  3SAT A;  1F4I A;  3KOZ E;  4AKG A;  4NZ5 A;  1PGY A;  1IY0 A;  1DGG A;  3AV0 A;  1R4G A;  4L15 A;  3GLH A;  4S12 A;  1V92 A;  2CHG A;  2QNJ A;  4PD2 A;  1N78 A;  2H1R A;  3U6P A;  4DR1 M;  3J7B A;  4IJE A;  1XHB A;  2J7O A;  2YFQ A;  2Z4R A;  4WP2 A;  1IN7 A;  1R2Z A;  3AL0 C;  4GHL A;  4L78 A;  1KSF X;  1T3T A;  2LTU A;  4CJ6 A;  2LVA A;  1ZQ9 A;  1TDH A;  2XFT A;  3KSJ A;  1MJG M;  5FTL A;  3GPY A;  4B08 A;  3GLF B;  3D8B A;  5EXP A;  4NYU A;  2VII A;  2LWX A;  3AJI B;  4JI2 M;  1IY2 A;  4R7G A;  3LQR A;  3U60 A;  5EP3 A;  5E6J A;  1EAK A;  2C9O A;  1WIV A;  3B89 A;  1IXR C;  5FTM A;  2MGW A;  4Q7J A;  4DR2 M;  3LCV B;  2M5Z A;  4LGM A;  3A45 A;  1NO1 A;  2VQE M;  1EE8 A;  3PXG A;  1TH2 A;  2KEB A;  1VG5 A;  1R6B X;  4DV5 M;  1IN8 A;  3AOE A;  3HU3 A;  1VEG A;  3MJ5 A;  1ZAE A;  1OIP A;  1QVR A;  1XWI A;  4BBA A;  1HR0 M;  2JP7 A;  1NJG A;  1QAN A;  2XEP A;  3BXW A;  3HGI A;  3GPP A;  2DVW B;  3KOW E;  3LVW A;  4IBK A;  5FTJ A;  2WSE F;  3UZU A;  4FWG A;  1N32 M;  3FYD A;  4LJ8 A;  3VFD A;  2UXC M;  4Z8X A;  3DFZ A;  1I4W A;  1E15 A;  1GPF A;  2RTS A;  1YU0 A;  4ANR A;  2BG1 A;  1IY1 A;  1E32 A;  2C96 A;  2JWS A;  2R18 A;  3I01 M;  1WR1 B;  3KOY E;  4FD2 A;  4G3O A;  4LRS A;  4D81 A;  2L4E A;  3R8F A;  4Z2I A;  3FE3 A;  4ZPX A;  4D82 A;  1Z6T A;  3AKZ A;  1PJJ A;  2CV2 A;  4LFA M;  4DR6 M;  3VKG A;  4JI1 M;  3BOS A;  1Z5A A;  2DWL A;  1OGG A;  2FNA A;  5JI3 E;  4WUR A;  1WJ7 A;  1Z5B A;  4M0W A;  4MM3 B;  3TE6 A;  5KO3 A;  3HU1 A;  4DR3 M;  1N77 A;  2F4V M;  2Y2L A;  1PJS A;  4HL4 A;  4HMC A;  2O25 A;  5A2Q S;  3FKE A;  4I4L A;  3D8L A;  3ZH9 B;  1CUK A;  1NHG C;  1QYR A;  2JY8 A;  2ZAM A;  2Y2H A;  4NRW A;  2Z8Y M;  5FLX S;  1E9S A;  2C9C A;  4HLQ A;  4F2L A;  4FWH A;  1XMO M;  2CHQ A;  4DBG B;  1QAQ A;  3JR4 A;  5BR8 M;  3U6M A;  4Z2L A;  4LF6 M;  3SC3 A;  3IG5 A;  3KS4 A;  2QBY A;  2O01 F;  2QEN A;  4IBG A;  3TWK A;  4MGI E;  5BPV A;  4L8R C;  3WX7 A;  2DHY A;  1QDR A;  3FRI A;  4W5W A;  3TL4 X;  2Q2E B;  2K6B A;  2R62 A;  3NBI A;  3QAU A;  2LH0 A;  3T1Y M;  4JI3 M;  3FYC A;  2ERC A;  2Z4S A;  2KW0 A;  5DYG A;  1R5L A;  2QPA A;  4LJ6 A;  3GLI E;  3B7Q A;  2Z3X A;  1W1P A;  2V6Z M;  2VDB B;  2ZAO A;  5H37 D;  4L16 A;  2XLJ A;  1MU5 A;  1PRB A;  1PM5 A;  2N35 A;  2R4E A;  1Q3C A;  1IM2 A;  1IXS A;  2G8L A;  3B7N A;  4JI4 M;  3U6O A;  1XXH B;  3FD9 A;  3K9P A;  3SAW A;  4DR4 M;  4NZ3 A;  2QQ8 A;  4AZF A;  4IBI A;  3B74 A;  4LGY A;  1MN3 A;  2L2D A;  1H6U A;  3SAS A;  1SXJ C;  4GHA A;  1PJQ A;  1YUE A;  4NZ1 A;  1GKI A;  1NV8 A;  4II7 A;  2MH8 A;  1L1T A;  1IFY A;  1E94 E;  1OJL A;  1Q39 A;  1HNW M;  4TUW A;  1E8B A;  4B7G A;  4CHT B;  2ZAN A;  4DV4 M;  3GRV A;  3IHP A;  1JQJ C;  4L6V 6;  4NSO B;  4WW0 A;  1T6O A;  3J80 S;  2L6O A;  2Z7J A;  3K8Z A;  1GOI A;  3GLI B;  3WD2 A;  1G4A E;  3THG A;  2X4A A;  1V33 A;  4GC5 A;  3VK8 A;  2O5R A;  4Z2K A;  1NJF A;  4Y28 F;  3VLF B;  3W68 A;  2LNH C;  1YE9 A;  3SYK A;  4AI6 A;  3HHW A;  3J81 S;  1ZMV A;  5DYI A;  5ITX A;  4YY3 M;  1ORY B;  3K92 A;  4MGK E;  3GPU A;  3OTO M;  1TDZ A;  4X64 M;  4CGY B;  5DNY A;  5EP2 A;  1QUT A;  2R44 A;  3AOE C;  4QNM A;  1VEJ A;  2V1U A;  3ZQJ A;  3U6D A;  2KRK A;  3M0E A;  1IBL M;  2BJW A;  1L2C A;  4GKJ M;  3KW6 A;  1NNJ A;  5EP4 A;  2HHH M;  2Y0Q A;  2UUC M;  1JR3 E;  4JI8 M;  4EIW A;  4AKI A;  4AG6 A;  2ZTC A;  2JNH A;  3I04 M;  4L4U A;  2CEA A;  1OTR A;  1DO2 A;  2WSC F;  4RF0 A;  3VDP A;  4NZ4 A;  2P5T A;  1QO6 A;  3PVS A;  2EUC A;  4G6Z A;  3BBZ A;  2DI0 A;  4LY6 A;  5IZ7 D;  3W67 A;  1E9R A;  1NY5 A;  2KZS A;  4KOD A;  2R0I A;  1TTE A;  1C1K A;  4LF5 M;  4F1I A;  2XD1 A;  2R4J A;  4IBC A;  1Q02 A;  3SAV A;  2Y0T A;  3U61 A;  1QDT A;  1G59 A;  1W1T A;  1NSF A;  3DZD A;  1NHW C;  2C5R A;  4DR7 M;  4I81 A;  1L2D A;  1XC8 A;  2ZBK B;  3C3E A;  3HY5 A;  3NBX X;  2M60 A; 
#chains in the Genus database with same CATH homology
 1N34 M;  1SXJ E;  3GQ3 A;  2R45 A;  2DZO B;  4GMQ A;  2AHM A;  4FCV A;  2F5S A;  1GVN A;  3FUT A;  3A98 B;  3U5Z A;  4LF9 M;  3TWL A;  3HJ8 A;  4LZJ A;  3K2L A;  3UMM A;  4MGH A;  1TH4 A;  3FTD A;  4QOS A;  3TQS A;  4LG2 A;  3SAR A;  2Y2K A;  1Q3B A;  2EA0 A;  2HKJ A;  3GQ4 A;  3A46 A;  4K0K M;  2JA2 A;  4OVZ A;  3J2P B;  3JAM S;  3HWS A;  3HHX A;  4D80 A;  4FCW A;  4NXN M;  3L28 A;  3HJQ A;  2Y2I A;  4OJ6 A;  3PFI A;  1OFH A;  1G8P A;  3RFW A;  2Y20 A;  3FUW A;  4JN6 A;  4X66 M;  4OJO A;  1IN4 A;  2FFF B;  2Y2N A;  2RKO A;  3CF6 E;  4M9S A;  5KPZ A;  3FUV A;  3HHZ A;  4M9X A;  3GLH B;  1QZM A;  3SBJ A;  3CTW B;  2ZM6 M;  5EXX A;  1L8Q A;  3DOA A;  3FTE A;  3KSX A;  1GL7 A;  1XXH A;  5ITQ A;  1JR3 D;  3T1H M;  4IBE A;  3T15 A;  3C58 A;  1QAO A;  4JXJ A;  2YNM D;  4QNR A;  2XSZ D;  3L26 A;  1FJG M;  3NWL A;  2KA6 B;  3GPX A;  3AOG A;  4PT5 A;  2Y2M A;  4OJ5 A;  1DGB A;  3GLG A;  4Z6Y A;  3DA1 A;  3FTC A;  2YR0 A;  2NQ8 C;  4LJ7 A;  4IIW A;  2UXD M;  3PNY A;  4G4O A;  4KHP M;  1HQC A;  3ZCB B;  2F5P A;  3M6A A;  1S3S A;  2BJV A;  4A3V B;  3L25 A;  3R9X B;  4JI5 M;  1Z5C A;  4IBD A;  1TH3 A;  2Y2Q A;  1IBM M;  3KFU G;  2J7N A;  2VQF M;  5JI2 E;  4JV5 M;  1DGH A;  1NNU C;  2QCU A;  7CAT A;  1LV7 A;  2Y2G A;  3KDS E;  2DWZ B;  3SMS A;  1YU4 A;  3N3F A;  1I94 M;  2XH9 A;  3PNV A;  3L2A A;  2CV0 A;  3KVW A;  1PJI A;  4IBB A;  4R3D A;  2CE7 A;  3VDU A;  4LF4 M;  1HT1 E;  4LFC M;  4AG5 A;  1DO0 A;  3JR5 A;  1OFI A;  4LF7 M;  3U6Q A;  2F5N A;  2W82 A;  3GRY A;  1NVM A;  1YUB A;  4FW9 A;  2QBY B;  3GLF A;  4GIP A;  2OPF A;  3KP0 E;  4B3S M;  3U6L A;  1N33 M;  1FNN A;  1IN6 A;  3SMP A;  1J5E M;  4M9Z A;  1NY6 A;  2CUZ A;  4RNA A;  4QOZ C;  4PDI A;  1JR3 A;  5EP1 A;  1D2N A;  2IOU A;  4KO8 A;  3SAU A;  5ITT A;  1IXS B;  2XSZ A;  3EIH A;  2F5O A;  2I7P A;  5C18 A;  5ITX E;  4LJ4 A;  2OQ4 A;  2L7I A;  2C98 A;  2QP9 X;  1QAM A;  2YQZ A;  4RF1 A;  3SYL A;  5EQT A;  2XD5 A;  3LMM A;  4PCZ A;  3RE8 A;  4DV7 M;  4LCB A;  4REZ A;  1G3I A;  4PDG A;  2D7E A;  4JI6 M;  3L27 A;  4LF8 M;  4GKK M;  2CFO A;  4OJL A;  4DV3 M;  4DV0 M;  3UJN A;  1N36 M;  3GRR A;  4DV2 M;  2KZU A;  3E9S A;  3GRU A;  4NRV A;  1IXZ A;  2V1C A;  3I4Y A;  3M7G A;  4G4Q A;  1HNX M;  1W5T A;  3SHF A;  3KS8 A;  3VK7 A;  2DXI A;  2FOI C;  1HT2 E;  2E5L M;  2K47 A;  3GP1 A;  4X65 M;  3HON A;  2Y21 A;  1N75 A;  2XZU A;  4OJP A;  3WHK A;  5KPT A;  1W5S A;  1QQW A;  1GLN A;  2DZN B;  3TPZ A;  1XNR M;  4LJA A;  5ITY A;  2JE5 A;  4MB7 A;  1KFV A;  2HL7 A;  4GIT A;  4NXM M;  3HSH A;  1VDD A;  2DWM A;  4LZZ A;  4JYA M;  3U6E A;  3U6C A;  4ITQ A;  1YSY A;  4DUY M;  5ITR A;  4IBJ A;  3LQQ A;  2FFJ A;  4G4R A;  1SXJ B;  3ILK A;  2L09 A;  1IN5 A;  1IQP A;  5IWA M;  4GC9 A;  4MGZ E;  2BNK A;  4NOO B;  3VKH A;  1HQY E;  2L7H A;  3J7A S;  4FVM A;  1K3W A;  4P16 A;  3U61 B;  3RGP A;  4QHS A;  1YU2 A;  2KRU A;  3UK6 A;  1KYI A;  2DWN A;  3EIE A;  4B3M M;  2LXE A;  3AFH A;  3U60 B;  4DV1 M;  5FSW A;  2I7N A;  1XMQ M;  4DUZ M;  3HKP A;  4NSR A;  2F5Q A;  5IRE B;  3U5Z B;  2UU9 M;  4GRI A;  8CAT A;  4I5S A;  5F3W A;  2XGN A;  1X37 A;  3CF2 A;  3CF0 A;  4IBF A;  2Y2J A;  3GLI A;  5LMU M;  1YU1 A;  1SXJ D;  4B7F A;  4MH0 E;  3HHY A;  4OVZ B;  4JI0 M;  3ZC7 B;  1R7R A;  1J09 A;  4B3R M;  5IT9 S;  5ITU A;  2R65 A;  3QWL A;  1DGF A;  3I4V A;  3HJS A;  2R46 A;  5EXT A;  5KPR A;  4G4N A;  1K3X A;  4X62 M;  3HU2 A;  4MGY E;  2C99 A;  4NYY A;  4QNL A;  3FUU A;  3FUX A;  2A5Y B;  4KLN A;  1UM8 A;  1J7K A;  4B7H A;  4NY2 A;  4AKH A;  2QZ4 A;  4BB9 A;  3U6S A;  4JI7 M;  4I8O A;  1L2B A;  4OW0 A;  2UUB M;  3W0L B;  4B3T M;  4FCT A;  4IJF A;  4QHT A;  3L29 A;  3H4M A;  3LVV A;  5KQ8 A;  3SHG B;  3T38 A;  1Z59 A;  3FTF A;  4DV6 M;  2UXB M;  2Y2P A;  4XGI A;  3Q8X A;  2UWX A;  5GKN A;  3IG8 A;  2UUA M;  3J27 B;  5LMN M;  4FWD A;  3B9P A;  3GQ5 A;  4LJ9 A;  4XBO A;  3A42 A;  3RGS A;  2XF3 A;  1L1Z A;  3K1J A;  3GLG B;  4AW4 A;  1XNQ M;  2KXE A;  1R2Y A;  4NL4 H;  2XFS A;  5EJC A;  1WXQ A;  3I51 A;  3WHL A;  4AQY M;  4DR7 M;  2D7G A;  2FE8 A;  4NZ1 A;  3KXE C;  4LJ5 A;  2G5G X;  3KP1 E;  4YHH M;  2CHV A;  4LRT A;  4OUI A;  1K82 A;  2HCB A;  2RGH A;  3GO8 A;  5E26 A;  4CIS A;  2CV1 A;  3MHV C;  2X8A A;  4BLC A;  3UGJ A;  4LFB M;  5EXS A;  5FTN A;  3W0F A;  3E4R A;  2DHR A;  4DR5 M;  3SFZ A;  5KQD A;  1IBK M;  4OU7 A;  1GL6 A;  1DGH B;  2X49 A;  3TWM A;  2XZF A;  1TGU A;  1YU3 A;  2RGO A;  4GH9 A;  5C1B A;  3KOX E;  3MK6 A;  2D7H A;  2EO2 A;  2JCH A;  1G41 A;  1SXJ A;  5FTK A;  4OX9 M;  1MX0 A;  4M0D A;  3SAT A;  4AKG A;  3KOZ E;  4NZ5 A;  1IY0 A;  1DGG A;  3AV0 A;  4L15 A;  3GLH A;  4S12 A;  2CHG A;  4PD2 A;  1N78 A;  2H1R A;  3U6P A;  4DR1 M;  3J7B A;  4IJE A;  1XHB A;  2J7O A;  2YFQ A;  2Z4R A;  1IN7 A;  1R2Z A;  3AL0 C;  4GHL A;  4L78 A;  1KSF X;  1T3T A;  1ZQ9 A;  1TDH A;  2XFT A;  3KSJ A;  5FTL A;  3GPY A;  3GLF B;  4B08 A;  3D8B A;  5EXP A;  4NYU A;  2VII A;  2LWX A;  3AJI B;  4JI2 M;  1IY2 A;  4R7G A;  3LQR A;  3U60 A;  5EP3 A;  5E6J A;  2C9O A;  5FTM A;  1IXR C;  4DR2 M;  2M5Z A;  4LGM A;  3A45 A;  2VQE M;  1EE8 A;  3PXG A;  1TH2 A;  2KEB A;  4DV5 M;  1R6B X;  1IN8 A;  3AOE A;  3HU3 A;  3MJ5 A;  1ZAE A;  1QVR A;  1XWI A;  4BBA A;  1HR0 M;  1NJG A;  2XEP A;  1QAN A;  3HGI A;  3GPP A;  2DVW B;  3KOW E;  3LVW A;  4IBK A;  5FTJ A;  3UZU A;  4FWG A;  1N32 M;  3FYD A;  4LJ8 A;  3VFD A;  2UXC M;  4Z8X A;  3DFZ A;  1I4W A;  1YU0 A;  2BG1 A;  1IY1 A;  1E32 A;  2C96 A;  2R18 A;  3KOY E;  4FD2 A;  4LRS A;  4D81 A;  3R8F A;  1HNZ M;  2Y2O A;  4ZPX A;  4D82 A;  1Z6T A;  3AKZ A;  1PJJ A;  2CV2 A;  4LFA M;  4DR6 M;  3VKG A;  4JI1 M;  3BOS A;  1Z5A A;  2DWL A;  2FNA A;  5JI3 E;  4WUR A;  1Z5B A;  5KO3 A;  4M0W A;  4MM3 B;  3TE6 A;  4DR3 M;  3HU1 A;  1N77 A;  2F4V M;  2Y2L A;  4HL4 A;  5A2Q S;  3FKE A;  4I4L A;  3D8L A;  3ZH9 B;  1NHG C;  1QYR A;  2ZAM A;  2Y2H A;  4NRW A;  5FLX S;  1E9S A;  2C9C A;  4HLQ A;  4FWH A;  1XMO M;  2CHQ A;  1QAQ A;  3JR4 A;  5BR8 M;  3U6M A;  4LF6 M;  3SC3 A;  3IG5 A;  3KS4 A;  2QBY A;  5BPV A;  2QEN A;  4IBG A;  3TWK A;  4MGI E;  4L8R C;  3WX7 A;  4W5W A;  3TL4 X;  2Q2E B;  2R62 A;  3NBI A;  3QAU A;  2LH0 A;  3T1Y M;  4JI3 M;  3FYC A;  2ERC A;  2Z4S A;  2KW0 A;  5DYG A;  2QPA A;  4LJ6 A;  2Z3X A;  2V6Z M;  2ZAO A;  5H37 D;  2XLJ A;  4L16 A;  1PM5 A;  1MU5 A;  2R4E A;  1Q3C A;  1IM2 A;  2G8L A;  4JI4 M;  3U6O A;  1XXH B;  3FD9 A;  3SAW A;  4DR4 M;  4NZ3 A;  4AZF A;  4IBI A;  4LGY A;  1H6U A;  3SAS A;  1SXJ C;  4GHA A;  1YUE A;  1GKI A;  4II7 A;  1L1T A;  1E94 E;  1OJL A;  1Q39 A;  1HNW M;  4TUW A;  4B7G A;  4CHT B;  2ZAN A;  4DV4 M;  3GRV A;  1JQJ C;  4NSO B;  4WW0 A;  3J80 S;  2L6O A;  2Z7J A;  3K8Z A;  3GLI B;  1G4A E;  3THG A;  2X4A A;  4GC5 A;  3VK8 A;  2O5R A;  1NJF A;  3VLF B;  2LNH C;  1YE9 A;  3SYK A;  4AI6 A;  3HHW A;  3J81 S;  5DYI A;  5ITX A;  4YY3 M;  1ORY B;  3K92 A;  4MGK E;  3GPU A;  3OTO M;  1TDZ A;  4X64 M;  4CGY B;  5DNY A;  5EP2 A;  3AOE C;  4QNM A;  2V1U A;  3U6D A;  2KRK A;  3M0E A;  1IBL M;  2BJW A;  1L2C A;  4GKJ M;  3KW6 A;  1NNJ A;  5EP4 A;  2HHH M;  2Y0Q A;  2UUC M;  4JI8 M;  4EIW A;  4AKI A;  4AG6 A;  4L4U A;  2CEA A;  4RF0 A;  1DO2 A;  4NZ4 A;  3VDP A;  2P5T A;  3PVS A;  2EUC A;  4G6Z A;  4LY6 A;  5IZ7 D;  1E9R A;  1NY5 A;  2KZS A;  4KOD A;  1C1K A;  4LF5 M;  2XD1 A;  2R4J A;  4IBC A;  3SAV A;  2Y0T A;  3U61 A;  1G59 A;  1NSF A;  3DZD A;  1NHW C;  2C5R A;  4I81 A;  1L2D A;  1XC8 A;  2ZBK B;  2M60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...