4IJFA

Crystal structure of the zaire ebolavirus vp35 interferon inhibitory domain k222a/r225a/k248a/k251a mutant
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
123
structure length
123
Chain Sequence
DISAADLANIMYDHLPGFGTAFHQLVQVICALGADSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords Polymerase cofactor VP35
publication title Development of RNA Aptamers Targeting Ebola Virus VP35.
pubmed doi rcsb
source organism Zaire ebolavirus
total genus 36
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2012-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ijfA01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4ijfA02
4IBBA 4IJEA 3L27A 4IBCA 4IBDA 3FKEA 3L29A 4IBFA 4GHAA 3KS4A 4IBEA 4IBGA 4IJFA 4IBJA 4GH9A 3L2AA 4IBKA 4IBIA 4LG2A 3L28A 3L25A 4GHLA 5BPVA 3KS8A 3L26A
chains in the Genus database with same CATH superfamily
1DGBA 1TGUA 4AQYM 1XC8A 2RGOA 3VKHA 1BVSA 4OJ5A 2LVAA 4KODA 3I01M 5L8RF 1W1VA 4IIWA 1W1PA 4OUIA 1K3WA 4LGMA 3GLGE 4OJ6A 3K9OA 4M9SA 4IBFA 1DV0A 3SHGB 5ITRA 1QQWA 3RGPA 5FTJA 1JB0F 3DFZA 4IJFA 2Y21A 2C98A 3LCVB 3KVWA 3CTWB 2UUAM 4GEWA 4AKIA 3QWLA 5IT9S 2C96A 2HWJA 3QYEA 2D7GA 4KO8A 2L6OA 4R71A 2BNKA 1XXHB 3TWKA 1V34A 4D81A 1TF0B 1TTEA 2Z7JA 4MH0E 2DNAA 5H37D 4CGYB 1EIJA 3HZJA 3UMMA 2QNJA 2R44A 4L15A 5KQDA 3HHZA 2DXIA 1N75A 2FOIC 4LFBM 3NWLA 4JV5M 3AOGA 1QAOA 1G8PA 1FNNA 3J2PB 3KOWE 1E9SA 1NSFA 1OIPA 2M5ZA 3L29A 3W68A 5ITQA 1JQJC 4LJAA 2KRUA 1K3XA 3U5ZA 4IBEA 5KPTA 2O01F 5FTKA 2Z4RA 4G4OA 4TUWA 3GQ3A 4XGIA 1A5TA 2DKLA 1W1TA 4BLCA 3WD4A 2QHOB 4NYUA 1OJLA 3IG8A 3D8LA 3KP0E 1XMQM 2RTSA 3FUVA 4DR3M 4DV7M 2Y2HA 3KSJA 1R2ZA 1GVNA 5ITYA 3U61B 2DAMA 2Y0TA 2VF7A 4IBIA 4LG2A 1XNQM 2F5QA 2JE5A 3HJQA 2VQEM 4NZ1A 2KHHA 4OJOA 3VFDA 5KPRA 3EIHA 2VQFM 1GJTA 1CUKA 3ZC7B 4OVZA 3IHPA 3HHXA 4IJEA 3W67A 2JZ0A 3RGSA 4MB7A 1O6IA 1VDLA 1VEGA 2CV0A 3E9SA 2L2DA 1EAKA 4MM3B 4NZ5A 4NXMM 3HY5A 2BWBA 2UXBM 1VQ1A 5EP4A 3H4JA 1YE9A 4R3DA 3U6MA 1SXJB 1QANA 3AJIB 1PM5A 3U6LA 4IBJA 4JI0M 1G59A 2KDLA 1G3IA 5EXXA 1T43A 2LH0A 4NRVA 2HHHM 4M9XA 4FWHA 2RRUA 4NY2A 4NRWA 4LCBA 3GPXA 1L2DA 3CF6E 1TH2A 1PDCA 3LW5F 4AI6A 3L28A 1PRBA 3FUTA 2EUCA 4MGKE 4Z2KA 5BPVA 4CIZA 2C5RA 2F4VM 1YU1A 3GPYA 3GLGB 1PJIA 4Z8XA 5BR8M 4MB3A 1AUAA 1MJGM 1V33A 1L1TA 3AL0C 2Y2QA 1NVMA 3Q8XA 1SG9A 3GQ5A 4NYYA 3AOEC 3FKEA 3K92A 1IXSA 2KNZA 2DAEA 4LRSA 3GLIB 1N77A 4LF9M 3TWLA 4GC9A 2APLA 2JY5A 4L6V6 1OIZA 1NV8A 2WSEF 2ZTCA 3R8FA 4DV5M 2CV1A 2H1RA 2CP8A 4IBGA 2QBYA 4QOSA 2ZTDA 4LGYA 1R2YA 4GKKM 3HU1A 4WURA 3U6PA 3VLFB 2AHMA 4IBKA 1OFIA 1ZMUA 2XSZD 3M0EA 2BJVA 1EE8A 2R6FA 2XD1A 2I7NA 1PJJA 3K2LA 1WGNA 3C58A 3SFZA 4L78A 4RKUF 3V76A 2HAKA 1R6BX 2JY7A 2FFFB 5LMNM 2ZAOA 2FN2A 3WD3A 3T1HM 2KNAA 3BBZA 4LJ4A 2DWLA 3C3EA 3QAUA 1IBKM 3H4MA 1HJPA 1Z59A 3HGIA 1V92A 3WHLA 3LQQA 3KS4A 4CISA 1X37A 2LTUA 4GITA 1CXWA 4RF1A 4GH9A 4MB4A 2DAKA 3MMPA 4OU7A 1E15A 1Z5AA 3J7BA 5DFLA 1IBMM 2KZUA 3LVVA 3I4VA 4FW9A 3KSXA 4NSOB 5IZ7D 2RKOA 1I4WA 2EJSA 4LJ5A 1OGBA 2ZANA 5EXSA 4LZZA 4B3MM 2JNHA 3SBJA 3L25A 4X64M 1ZMWA 4HEOA 2X4AA 4DV4M 2MH8A 2R18A 2VIIA 4LJ7A 3FTFA 4X65M 2QQ8A 1D0KA 1IXZA 2UUBM 3I4YA 3QYBA 3FTDA 4DR5M 1ZAEA 1QAMA 7CATA 2YNMD 4TX8A 2K9DA 4B7GA 4NZ3A 4GC5A 4JI7M 3U6QA 2CHGA 4QNLA 2C99A 2L09A 3U6EA 1N33M 1OAOC 4OW0A 1Q02A 1QO6A 4AG5A 4JI2M 4K0KM 2K0BX 1UR8A 3U60B 2D7HA 3GLIE 1OAIA 3GPUA 1NJFA 3DOAA 3T6PA 3W0FA 2L7IA 3D8BA 2HKJA 3GRUA 1TDZA 3B9PA 2G8LA 4Z2GA 2F5NA 1NHGC 5DYIA 4X62M 3A45A 2KNVA 4I4LA 1S3SA 4X66M 1Y8GA 2DHYA 1J09A 1GO5A 2L7HA 3LVWA 4B3RM 4L4UA 4Q7JA 4BBAA 4F1IA 3L27A 5FSWA 3GQ4A 1WGLA 4WW0A 2OQ4A 2O25A 3HSHA 8CATA 4Z2JA 5ITXA 3A98B 1OGGA 1AIWA 1GKIA 1W5SA 1E6NA 2W82A 2N35A 4HMEA 1L6JA 4RNAA 3GRRA 1JR3E 5E26A 4LF7M 3HHWA 1SXJC 2G5GX 2EKKA 4ANRA 2XZUA 2DWNA 3PNYA 3PVSA 1Z5BA 3OTOM 4JI6M 1WXQA 2DVWB 2OO9A 2R62A 2UUCM 2YQZA 3JR4A 3SAWA 1OKSA 1N32M 4LJ6A 4L16A 5FTLA 2J7NA 3KFUG 1D0MA 2NQ8C 1DGHA 2WZJA 3KDSE 1ZQ9A 1E94E 3FD9A 3MJ5A 1HR0M 2OPFA 4AZFA 2JWSA 1IN4A 2DWMA 2Y2NA 2JY8A 1IM2A 2MJ5B 1XWIA 4PCZA 4NOOB 3U5ZB 4QNMA 1PGYA 3TE6A 2XZFA 5JI3E 3FUWA 1UR9A 1C7YA 2R65A 2CWBA 1YUBA 1R4GA 2DHRA 1D0LA 4FCWA 4I81A 2BJWA 1F4IA 2JA2A 4L8RC 4REZA 3SYKA 3U6SA 3T38A 2KW0A 1HT2E 1OTRA 1WJ7A 2QP9X 5KPZA 2DI0A 3GLHA 4FCTA 3SC3A 1NNJA 3A46A 1Z5CA 4BB9A 4DR1M 3C3DA 3HU2A 1HQCA 1GJSA 4OVZB 1QUSA 1W5TA 1E6ZA 3LMMA 1EFUB 4JYAM 1GPFA 4ITQA 2Z8YM 3M7GA 4B7HA 3Q8GA 2LVQD 2R4EA 3GRVA 4A3VB 1P3QQ 4IBCA 4B7FA 4AKGA 3VDPA 2QCUA 4DV0M 3TL4X 4GIPA 3SAUA 1NHWC 1UM8A 2P5TA 1TR8A 4HLQA 4M0WA 3SHFA 4JI5M 4M9ZA 1YU2A 4AG6A 3J27B 5EP2A 5LMUM 1J7MA 3FUUA 4DV1M 4PT5A 2WSFF 5ITUA 1TH3A 3JR5A 2Z3XA 3BXWA 3KXEC 3NBXX 4B3TM 3K1JA 2DZOB 4OX9M 4G6ZA 4Z6YA 2B3TA 4NL4H 4NZ4A 2Z4SA 1PJQA 5IREB 1HT1E 4IBBA 3EIEA 3U6CA 1TDHA 1IXSB 1H0IA 2Y2JA 3FYCA 1PJSA 3M7PA 3VKGA 2RGHA 3FRHA 3GLFA 4DR4M 1NJGA 2CE7A 3FUXA 2QBYB 3HHYA 4FVMA 3BOSA 1E88A 3AOEA 1IY1A 3GPPA 2D7EA 4D80A 4PDGA 3HJSA 2D49A 3K9PA 1LV7A 1SXJD 3WHKA 3F92A 4MB5A 3UJNA 2DZNB 5IWAM 1GABA 3B89A 1Q39A 3HJ8A 1WR1B 1E6RA 3WD1A 3FRIA 2K6BA 5KQ8A 2HCBA 2FFJA 3C9PA 4GHLA 2CFOA 3B7NA 1I94M 2JXNA 2ERCA 4AW4A 3SATA 2DZLA 3WD2A 3AV0A 1IN7A 4FWDA 3T15A 3LCUA 3THGA 5C18A 5EXTA 3WD0A 4GMQA 1KYIA 4Z2LA 4DUZM 4JN6A 4DR7M 1YU4A 2Y2MA 4Z2HA 2JP7A 3PXGA 2QZ4A 2L4FA 1IY0A 2CHVA 2OOBA 1FJGM 4GKJM 3N3FA 1DGFA 4QHSA 4Y28F 2LVPC 4LRTA 3KP1E 1E32A 4FD2A 3JAMS 1GL6A 2R45A 2V1CA 1L1ZA 2V1UA 5A2QS 1IXRC 2GNOA 3SMPA 2JUJA 2E5LM 2Y2PA 3HU3A 1OQYA 2I7PA 1IFYA 1OFHA 3VK8A 3GLHE 2XH9A 2C9CA 3CGWA 4LY6A 1NV9A 4D82A 1D2NA 2FS1A 2JY6B 1XXHA 1K82A 2LHCA 3TWMA 1HNXM 2CV2A 2UWXA 4DUYM 3GRYA 4F2LA 1IBLM 2LBCA 2MGWA 1IN5A 1JR3D 2Y2IA 2V6ZM 3DA1A 4QHTA 1Z6TA 4IBDA 5JI2E 2F5SA 2XF3A 1E9RA 2Y2KA 4FCVA 3HWSA 2GQFA 4B08A 4II7A 1LTMA 3WX7A 1MX0A 2Q2EB 2KA6B 3B74A 2YFQA 1QZMA 1VEKA 1XB2B 3E21A 3IECA 5DNYA 4G4RA 1IN6A 4KT0F 2G3QA 4GRIA 2Y2GA 4DV2M 4LF4M 2BWEA 4CHTB 1PJTA 2WSCF 1XNRM 3ZH9B 4LF6M 1L2BA 2XSZA 3B7ZA 1QUTA 3SYLA 1N34M 4NSRA 4MGZE 3U61A 1IQPA 2XGNA 1NNUC 2Y20A 1R7RA 4P17A 5DYGA 1C1KA 2V5OA 4DR2M 3W0LB 5EP1A 2XD5A 1N78A 1E6PA 1DO0A 1KS0A 1CK7A 1QZEA 3VDUA 1YLAA 4AKHA 2DAGA 2MR9A 4I5SA 1HQYE 4DV6M 4P16A 2XLJA 2X49A 3GLFE 1HNWM 3HX3A 2CUZA 1MN3A 2ZBKB 4DBGB 3ILKA 4MGHA 1VEJA 3J81S 3FTEA 4XK8F 3IG5A 4JI3M 2ZM6M 1GOIA 3L2AA 3MHVC 1SXJA 1QYRA 2F5PA 3TPZA 5EXPA 2LVOC 3RE8A 3KOXE 5F3WA 1DGHB 1IN8A 4JXJA 2KRKA 2KZSA 4HL4A 2HL7A 4HMCA 4KLNA 5KO3A 4LFCM 1YU3A 2J5YA 1DGGA 2C9OA 2VDBB 3J7AS 2K47A 1E8BA 3L26A 1QDTA 4OJLA 1WHCA 2XFSA 2XFTA 1NY5A 3I51A 3SASA 3GLGA 3GO8A 4KHPM 5EJCA 4JI8M 2X8AA 3VK7A 3J80S 3TQSA 1YUEA 3MQLA 2QPAA 4MGIE 1DO2A 4NC6A 1W1YA 1XHBA 3GLIA 2EO2A 5E6JA 1G41A 3GLHB 4QOZC 2R46A 5FLXS 1HNZM 3UZUA 2UU9M 3CF0A 4R7GA 3B7QA 2L4EA 4JI4M 4MGYE 4JI1M 5GKNA 4XBOA 2MROB 2JZ1A 1GXDA 3U6DA 1IY2A 3HONA 4ZPXA 2UXCM 2XEPA 3PNVA 4LFAM 4HMDA 4YHHM 3UGJA 4RF0A 4FWGA 2BG1A 4CJ6A 2LNHC 1XXHE 4LZJA 1VDDA 1YSYA 1NO1A 1NY6A 1G71A 1ORYB 2LWXA 3CF2A 4YY3M 3GP1A 1TH4A 3K8ZA 3SAVA 1ZMVA 1N36M 1JR3A 4LJ9A 2J7OA 3UK6A 2M60A 1R5LA 1MU5A 2VF8A 3KOYE 2F5OA 4W5WA 5EQTA 5FTNA 3SMSA 5ITXE 3KOZE 1GLNA 4S12A 1J5EM 1AIPC 3R9XB 5EP3A 4B3SM 2FH0A 1G4AE 4QNRA 2Y2LA 4UN2B 5FTMA 4WP2A 3AKZA 4DV3M 1QAQA 5ITTA 1UFZA 3FE3A 4EIWA 2EA0A 2EKFA 1XMOM 5C1BA 1H0GA 1WIVA 2DENA 3FTCA 3SARA 2A5YB 1QDRA 3AFHA 1VG5A 2CEAA 3T1YM 4M0DA 4LJ8A 2JCHA 1QVRA 1J7KA 2H5XA 3KS8A 1RU3A 1H8PA 2O5RA 2CHQA 1GL7A 2QSFX 1KSFX 3ZQJA 1H6UA 3GLFB 1T3TA 2R0IA 3FYDA 3I04M 2LHGA 3NBIA 3RFWA 2Y2OA 2R4JA 1ZV1A 3E46A 2LVNC 1KFVA 3MK6A 1T6OA 4PD2A 3KW6A 2ZAMA 1Q3BA 2OOAA 2QENA 3A42A 3PFIA 2KEBA 3HKPA 1Q3CA 3M6AA 3ZCBB 4NXNM 3U6OA 2YR0A 1YU0A 2FNAA 2UXDM 1L2CA 2KXEA 2Y0QA 2IOUA 4G4QA 4OJPA 4LF5M 4Z2IA 1SXJE 4DR6M 4PDIA 3U60A 4LF8M 2FE8A 2CRUA 2LXEA 4I8OA 4G3OA 1L8QA 3LQRA 1ED7A 2DWZB 3DZDA 4G4NA 4GHAA 2DAIA 3E4RA
chains in the Genus database with same CATH topology
1DGBA 1TGUA 4AQYM 1XC8A 2RGOA 3VKHA 4OJ5A 4KODA 4IIWA 4OUIA 1K3WA 4LGMA 4OJ6A 4M9SA 4IBFA 3SHGB 5ITRA 1QQWA 3RGPA 5FTJA 3DFZA 4IJFA 2Y21A 2C98A 3KVWA 3CTWB 2UUAM 4AKIA 3QWLA 5IT9S 2C96A 2D7GA 4KO8A 2L6OA 2BNKA 1XXHB 3TWKA 4D81A 2Z7JA 4MH0E 5H37D 4CGYB 3UMMA 3HHZA 4L15A 5KQDA 2DXIA 4LFBM 1N75A 2FOIC 3NWLA 4JV5M 3AOGA 1QAOA 1G8PA 1FNNA 3J2PB 3KOWE 1E9SA 1NSFA 2M5ZA 3L29A 5ITQA 1JQJC 2KRUA 1K3XA 3U5ZA 4IBEA 5KPTA 5FTKA 2Z4RA 4G4OA 4TUWA 3GQ3A 4XGIA 4BLCA 4NYUA 1OJLA 3IG8A 3D8LA 3KP0E 1XMQM 3FUVA 4DR3M 4DV7M 2Y2HA 3KSJA 1R2ZA 1GVNA 5ITYA 3U61B 1XNQM 2Y0TA 4IBIA 4LG2A 2F5QA 2JE5A 3HJQA 2VQEM 4NZ1A 4OJOA 3VFDA 5KPRA 3EIHA 2VQFM 3ZC7B 4OVZA 3HHXA 4IJEA 3RGSA 4MB7A 2CV0A 3E9SA 4NZ5A 4MM3B 4NXMM 2UXBM 5EP4A 1YE9A 4R3DA 3U6MA 1SXJB 1QANA 3AJIB 1PM5A 3U6LA 4IBJA 4JI0M 1G59A 1G3IA 5EXXA 2LH0A 4NRVA 2HHHM 4M9XA 4FWHA 4NY2A 4NRWA 4LCBA 3GPXA 1L2DA 3CF6E 1TH2A 4AI6A 3L28A 3FUTA 2EUCA 4MGKE 5BPVA 2C5RA 2F4VM 1YU1A 3GPYA 3GLGB 1PJIA 4Z8XA 5BR8M 1L1TA 3AL0C 2Y2QA 1NVMA 3Q8XA 3GQ5A 4NYYA 3AOEC 3FKEA 3K92A 4LRSA 3GLIB 1N77A 4LF9M 3TWLA 4GC9A 3R8FA 2CV1A 4DV5M 2H1RA 4IBGA 2QBYA 4QOSA 4LGYA 1R2YA 4GKKM 3HU1A 4WURA 3U6PA 3VLFB 2AHMA 4IBKA 1OFIA 2XSZD 3M0EA 2BJVA 1EE8A 2XD1A 2I7NA 1PJJA 3K2LA 3C58A 3SFZA 4L78A 1R6BX 5LMNM 2ZAOA 3T1HM 4LJ4A 2DWLA 3QAUA 1IBKM 3H4MA 1Z59A 3HGIA 4CISA 3WHLA 3LQQA 3KS4A 1X37A 4GITA 4RF1A 4GH9A 4OU7A 1Z5AA 3J7BA 1IBMM 2KZUA 3LVVA 3I4VA 4FW9A 3KSXA 4NSOB 5IZ7D 2RKOA 1I4WA 4LJ5A 2ZANA 5EXSA 4LZZA 4B3MM 3SBJA 3L25A 4X64M 2X4AA 4DV4M 2R18A 2VIIA 4LJ7A 3FTFA 4X65M 2UUBM 1IXZA 3I4YA 3FTDA 4DR5M 1ZAEA 1QAMA 7CATA 2YNMD 4B7GA 4NZ3A 4GC5A 4JI7M 3U6QA 2CHGA 4QNLA 2C99A 2L09A 3U6EA 1N33M 4OW0A 4AG5A 4JI2M 4K0KM 3U60B 2D7HA 3GPUA 1NJFA 3DOAA 3W0FA 2L7IA 3D8BA 2HKJA 3GRUA 1TDZA 3B9PA 2G8LA 2F5NA 1NHGC 5DYIA 4X62M 3A45A 4I4LA 1S3SA 4X66M 1J09A 2L7HA 3LVWA 4B3RM 4L4UA 4BBAA 3L27A 5FSWA 3GQ4A 4WW0A 2OQ4A 3HSHA 8CATA 5ITXA 3A98B 1GKIA 1W5SA 2W82A 4RNAA 3GRRA 5E26A 4LF7M 3HHWA 1SXJC 2G5GX 2XZUA 2DWNA 3PNYA 3PVSA 1Z5BA 3OTOM 4JI6M 1WXQA 2DVWB 2R62A 2UUCM 2YQZA 3JR4A 3SAWA 1N32M 4LJ6A 4L16A 5FTLA 2J7NA 3KFUG 2NQ8C 1DGHA 3KDSE 3MJ5A 1ZQ9A 1E94E 3FD9A 1HR0M 2OPFA 4AZFA 2DWMA 1IN4A 2Y2NA 1IM2A 1XWIA 4PCZA 4NOOB 3U5ZB 4QNMA 3TE6A 2XZFA 5JI3E 3FUWA 2R65A 1YUBA 2DHRA 4FCWA 4I81A 2BJWA 2JA2A 4L8RC 4REZA 3SYKA 3U6SA 3T38A 2KW0A 1HT2E 5KPZA 2QP9X 3GLHA 4FCTA 3SC3A 1NNJA 3A46A 1Z5CA 4BB9A 4DR1M 3HU2A 1HQCA 4OVZB 1W5TA 3LMMA 4JYAM 4ITQA 3M7GA 4B7HA 2R4EA 3GRVA 4A3VB 4IBCA 4B7FA 4AKGA 3VDPA 2QCUA 4DV0M 3TL4X 4GIPA 3SAUA 1NHWC 1UM8A 2P5TA 4HLQA 4M0WA 3SHFA 4JI5M 4M9ZA 1YU2A 4AG6A 3J27B 5EP2A 5LMUM 3FUUA 4DV1M 4PT5A 3JR5A 5ITUA 1TH3A 2Z3XA 3KXEC 4B3TM 3K1JA 2DZOB 4OX9M 4G6ZA 4Z6YA 4NL4H 4NZ4A 2Z4SA 5IREB 1HT1E 4IBBA 3EIEA 3U6CA 1TDHA 1IXSB 2Y2JA 3FYCA 3VKGA 2RGHA 3GLFA 4DR4M 1NJGA 2CE7A 3FUXA 2QBYB 3HHYA 4FVMA 3BOSA 3AOEA 1IY1A 3GPPA 2D7EA 4D80A 4PDGA 3HJSA 1LV7A 1SXJD 3WHKA 3UJNA 2DZNB 5IWAM 1Q39A 3HJ8A 5KQ8A 2HCBA 2FFJA 4GHLA 2CFOA 1I94M 2ERCA 4AW4A 3SATA 3AV0A 1IN7A 4FWDA 3T15A 3THGA 5C18A 5EXTA 4GMQA 1KYIA 4DUZM 4JN6A 4DR7M 1YU4A 2Y2MA 3PXGA 2QZ4A 1IY0A 2CHVA 1FJGM 3N3FA 4GKJM 1DGFA 4QHSA 4LRTA 3KP1E 1E32A 4FD2A 3JAMS 1GL6A 2R45A 2V1CA 1L1ZA 2V1UA 5A2QS 1IXRC 3SMPA 2E5LM 2Y2PA 3HU3A 2I7PA 1OFHA 3VK8A 2XH9A 2C9CA 4LY6A 1K82A 4D82A 1D2NA 1HNXM 1XXHA 3TWMA 2UWXA 2CV2A 4DUYM 3GRYA 1IBLM 1IN5A 1JR3D 2Y2IA 2V6ZM 3DA1A 4QHTA 1Z6TA 4IBDA 5JI2E 2F5SA 2XF3A 1E9RA 2Y2KA 4FCVA 3HWSA 4B08A 4II7A 3WX7A 1MX0A 2Q2EB 2KA6B 4LJAA 2YFQA 1QZMA 5DNYA 4G4RA 1IN6A 2Y2GA 4GRIA 4DV2M 4LF4M 4CHTB 1XNRM 3ZH9B 4LF6M 1L2BA 2XSZA 3SYLA 1N34M 4NSRA 4MGZE 3U61A 1IQPA 2XGNA 1NNUC 2Y20A 1R7RA 5DYGA 1C1KA 4DR2M 3W0LB 5EP1A 2XD5A 1N78A 1DO0A 3VDUA 4AKHA 4I5SA 4DV6M 1HQYE 4P16A 2XLJA 2X49A 1HNWM 2CUZA 2ZBKB 3J81S 3ILKA 4MGHA 3FTEA 4JI3M 3IG5A 2ZM6M 3L2AA 3MHVC 1SXJA 1QYRA 2F5PA 3TPZA 5EXPA 3RE8A 3KOXE 5F3WA 1DGHB 1IN8A 4JXJA 2KRKA 2KZSA 4HL4A 2HL7A 4KLNA 5KO3A 4LFCM 1YU3A 1DGGA 2C9OA 3J7AS 2K47A 4OJLA 3L26A 2XFSA 2XFTA 1NY5A 3I51A 3SASA 3GLGA 3GO8A 4KHPM 5EJCA 4JI8M 2X8AA 3VK7A 3J80S 3TQSA 1YUEA 2QPAA 4MGIE 1DO2A 1XHBA 3GLIA 2EO2A 5E6JA 1G41A 3GLHB 4QOZC 2R46A 5FLXS 1HNZM 3UZUA 2UU9M 3CF0A 4R7GA 4JI4M 4MGYE 4JI1M 5GKNA 4XBOA 3U6DA 1IY2A 3HONA 4ZPXA 2UXCM 2XEPA 3PNVA 4LFAM 4YHHM 3UGJA 4RF0A 4FWGA 2BG1A 2LNHC 4LZJA 1VDDA 1YSYA 1ORYB 1NY6A 2LWXA 3CF2A 4YY3M 3GP1A 3SAVA 2FFFB 1TH4A 3K8ZA 1N36M 1JR3A 4LJ9A 2J7OA 3UK6A 2M60A 1MU5A 3KOYE 2F5OA 5EQTA 5FTNA 3SMSA 5ITXE 3KOZE 1GLNA 4S12A 1J5EM 5EP3A 4B3SM 1G4AE 4QNRA 2Y2LA 5FTMA 4DV3M 3AKZA 1QAQA 5ITTA 4EIWA 2EA0A 1XMOM 5C1BA 3FTCA 3SARA 2A5YB 3AFHA 2CEAA 3T1YM 4M0DA 4LJ8A 2JCHA 1QVRA 1J7KA 3KS8A 2O5RA 2CHQA 1GL7A 1KSFX 3GLFB 1H6UA 1T3TA 3FYDA 3NBIA 3RFWA 2Y2OA 2R4JA 1KFVA 3MK6A 4PD2A 3KW6A 2ZAMA 2QENA 3A42A 1Q3BA 3PFIA 3R9XB 2KEBA 3HKPA 1Q3CA 3M6AA 3ZCBB 4NXNM 3U6OA 2YR0A 1YU0A 2FNAA 2UXDM 1L2CA 2KXEA 2Y0QA 2IOUA 4G4QA 4OJPA 4LF5M 1SXJE 4DR6M 4PDIA 3U60A 4LF8M 2FE8A 2LXEA 4I8OA 1L8QA 3LQRA 2DWZB 3DZDA 4G4NA 4GHAA 4W5WA 3E4RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IBB A;  4IJE A;  3L27 A;  4IBC A;  4IBD A;  3FKE A;  3L29 A;  4IBF A;  4GHA A;  3KS4 A;  4IBE A;  4IBG A;  4IJF A;  4IBJ A;  4GH9 A;  3L2A A;  4IBK A;  4IBI A;  4LG2 A;  3L28 A;  3L25 A;  4GHL A;  5BPV A;  3KS8 A;  3L26 A; 
#chains in the Genus database with same CATH topology
 1DGB A;  1TGU A;  4AQY M;  1XC8 A;  2RGO A;  3VKH A;  1BVS A;  4OJ5 A;  2LVA A;  4KOD A;  3I01 M;  5L8R F;  1W1V A;  4IIW A;  1W1P A;  4OUI A;  1K3W A;  4LGM A;  3GLG E;  4OJ6 A;  3K9O A;  4M9S A;  4IBF A;  1DV0 A;  3SHG B;  5ITR A;  1QQW A;  3RGP A;  5FTJ A;  1JB0 F;  3DFZ A;  4IJF A;  2Y21 A;  2C98 A;  3LCV B;  3KVW A;  3CTW B;  2UUA M;  4GEW A;  4AKI A;  3QWL A;  5IT9 S;  2C96 A;  2HWJ A;  3QYE A;  2D7G A;  4KO8 A;  2L6O A;  4R71 A;  2BNK A;  1XXH B;  3TWK A;  1V34 A;  4D81 A;  1TF0 B;  1TTE A;  2Z7J A;  4MH0 E;  2DNA A;  5H37 D;  4CGY B;  1EIJ A;  3HZJ A;  3UMM A;  2QNJ A;  2R44 A;  4L15 A;  5KQD A;  3HHZ A;  2DXI A;  1N75 A;  2FOI C;  4LFB M;  3NWL A;  4JV5 M;  3AOG A;  1QAO A;  1G8P A;  1FNN A;  3J2P B;  3KOW E;  1E9S A;  1NSF A;  1OIP A;  2M5Z A;  3L29 A;  3W68 A;  5ITQ A;  1JQJ C;  4LJA A;  2KRU A;  1K3X A;  3U5Z A;  4IBE A;  5KPT A;  2O01 F;  5FTK A;  2Z4R A;  4G4O A;  4TUW A;  3GQ3 A;  4XGI A;  1A5T A;  2DKL A;  1W1T A;  4BLC A;  3WD4 A;  2QHO B;  4NYU A;  1OJL A;  3IG8 A;  3D8L A;  3KP0 E;  1XMQ M;  2RTS A;  3FUV A;  4DR3 M;  4DV7 M;  2Y2H A;  3KSJ A;  1R2Z A;  1GVN A;  5ITY A;  3U61 B;  2DAM A;  2Y0T A;  2VF7 A;  4IBI A;  4LG2 A;  1XNQ M;  2F5Q A;  2JE5 A;  3HJQ A;  2VQE M;  4NZ1 A;  2KHH A;  4OJO A;  3VFD A;  5KPR A;  3EIH A;  2VQF M;  1GJT A;  1CUK A;  3ZC7 B;  4OVZ A;  3IHP A;  3HHX A;  4IJE A;  3W67 A;  2JZ0 A;  3RGS A;  4MB7 A;  1O6I A;  1VDL A;  1VEG A;  2CV0 A;  3E9S A;  2L2D A;  1EAK A;  4MM3 B;  4NZ5 A;  4NXM M;  3HY5 A;  2BWB A;  2UXB M;  1VQ1 A;  5EP4 A;  3H4J A;  1YE9 A;  4R3D A;  3U6M A;  1SXJ B;  1QAN A;  3AJI B;  1PM5 A;  3U6L A;  4IBJ A;  4JI0 M;  1G59 A;  2KDL A;  1G3I A;  5EXX A;  1T43 A;  2LH0 A;  4NRV A;  2HHH M;  4M9X A;  4FWH A;  2RRU A;  4NY2 A;  4NRW A;  4LCB A;  3GPX A;  1L2D A;  3CF6 E;  1TH2 A;  1PDC A;  3LW5 F;  4AI6 A;  3L28 A;  1PRB A;  3FUT A;  2EUC A;  4MGK E;  4Z2K A;  5BPV A;  4CIZ A;  2C5R A;  2F4V M;  1YU1 A;  3GPY A;  3GLG B;  1PJI A;  4Z8X A;  5BR8 M;  4MB3 A;  1AUA A;  1MJG M;  1V33 A;  1L1T A;  3AL0 C;  2Y2Q A;  1NVM A;  3Q8X A;  1SG9 A;  3GQ5 A;  4NYY A;  3AOE C;  3FKE A;  3K92 A;  1IXS A;  2KNZ A;  2DAE A;  4LRS A;  3GLI B;  1N77 A;  4LF9 M;  3TWL A;  4GC9 A;  2APL A;  2JY5 A;  4L6V 6;  1OIZ A;  1NV8 A;  2WSE F;  2ZTC A;  3R8F A;  4DV5 M;  2CV1 A;  2H1R A;  2CP8 A;  4IBG A;  2QBY A;  4QOS A;  2ZTD A;  4LGY A;  1R2Y A;  4GKK M;  3HU1 A;  4WUR A;  3U6P A;  3VLF B;  2AHM A;  4IBK A;  1OFI A;  1ZMU A;  2XSZ D;  3M0E A;  2BJV A;  1EE8 A;  2R6F A;  2XD1 A;  2I7N A;  1PJJ A;  3K2L A;  1WGN A;  3C58 A;  3SFZ A;  4L78 A;  4RKU F;  3V76 A;  2HAK A;  1R6B X;  2JY7 A;  2FFF B;  5LMN M;  2ZAO A;  2FN2 A;  3WD3 A;  3T1H M;  2KNA A;  3BBZ A;  4LJ4 A;  2DWL A;  3C3E A;  3QAU A;  1IBK M;  3H4M A;  1HJP A;  1Z59 A;  3HGI A;  1V92 A;  3WHL A;  3LQQ A;  3KS4 A;  4CIS A;  1X37 A;  2LTU A;  4GIT A;  1CXW A;  4RF1 A;  4GH9 A;  4MB4 A;  2DAK A;  3MMP A;  4OU7 A;  1E15 A;  1Z5A A;  3J7B A;  5DFL A;  1IBM M;  2KZU A;  3LVV A;  3I4V A;  4FW9 A;  3KSX A;  4NSO B;  5IZ7 D;  2RKO A;  1I4W A;  2EJS A;  4LJ5 A;  1OGB A;  2ZAN A;  5EXS A;  4LZZ A;  4B3M M;  2JNH A;  3SBJ A;  3L25 A;  4X64 M;  1ZMW A;  4HEO A;  2X4A A;  4DV4 M;  2MH8 A;  2R18 A;  2VII A;  4LJ7 A;  3FTF A;  4X65 M;  2QQ8 A;  1D0K A;  1IXZ A;  2UUB M;  3I4Y A;  3QYB A;  3FTD A;  4DR5 M;  1ZAE A;  1QAM A;  7CAT A;  2YNM D;  4TX8 A;  2K9D A;  4B7G A;  4NZ3 A;  4GC5 A;  4JI7 M;  3U6Q A;  2CHG A;  4QNL A;  2C99 A;  2L09 A;  3U6E A;  1N33 M;  1OAO C;  4OW0 A;  1Q02 A;  1QO6 A;  4AG5 A;  4JI2 M;  4K0K M;  2K0B X;  1UR8 A;  3U60 B;  2D7H A;  3GLI E;  1OAI A;  3GPU A;  1NJF A;  3DOA A;  3T6P A;  3W0F A;  2L7I A;  3D8B A;  2HKJ A;  3GRU A;  1TDZ A;  3B9P A;  2G8L A;  4Z2G A;  2F5N A;  1NHG C;  5DYI A;  4X62 M;  3A45 A;  2KNV A;  4I4L A;  1S3S A;  4X66 M;  1Y8G A;  2DHY A;  1J09 A;  1GO5 A;  2L7H A;  3LVW A;  4B3R M;  4L4U A;  4Q7J A;  4BBA A;  4F1I A;  3L27 A;  5FSW A;  3GQ4 A;  1WGL A;  4WW0 A;  2OQ4 A;  2O25 A;  3HSH A;  8CAT A;  4Z2J A;  5ITX A;  3A98 B;  1OGG A;  1AIW A;  1GKI A;  1W5S A;  1E6N A;  2W82 A;  2N35 A;  4HME A;  1L6J A;  4RNA A;  3GRR A;  1JR3 E;  5E26 A;  4LF7 M;  3HHW A;  1SXJ C;  2G5G X;  2EKK A;  4ANR A;  2XZU A;  2DWN A;  3PNY A;  3PVS A;  1Z5B A;  3OTO M;  4JI6 M;  1WXQ A;  2DVW B;  2OO9 A;  2R62 A;  2UUC M;  2YQZ A;  3JR4 A;  3SAW A;  1OKS A;  1N32 M;  4LJ6 A;  4L16 A;  5FTL A;  2J7N A;  3KFU G;  1D0M A;  2NQ8 C;  1DGH A;  2WZJ A;  3KDS E;  1ZQ9 A;  1E94 E;  3FD9 A;  3MJ5 A;  1HR0 M;  2OPF A;  4AZF A;  2JWS A;  1IN4 A;  2DWM A;  2Y2N A;  2JY8 A;  1IM2 A;  2MJ5 B;  1XWI A;  4PCZ A;  4NOO B;  3U5Z B;  4QNM A;  1PGY A;  3TE6 A;  2XZF A;  5JI3 E;  3FUW A;  1UR9 A;  1C7Y A;  2R65 A;  2CWB A;  1YUB A;  1R4G A;  2DHR A;  1D0L A;  4FCW A;  4I81 A;  2BJW A;  1F4I A;  2JA2 A;  4L8R C;  4REZ A;  3SYK A;  3U6S A;  3T38 A;  2KW0 A;  1HT2 E;  1OTR A;  1WJ7 A;  2QP9 X;  5KPZ A;  2DI0 A;  3GLH A;  4FCT A;  3SC3 A;  1NNJ A;  3A46 A;  1Z5C A;  4BB9 A;  4DR1 M;  3C3D A;  3HU2 A;  1HQC A;  1GJS A;  4OVZ B;  1QUS A;  1W5T A;  1E6Z A;  3LMM A;  1EFU B;  4JYA M;  1GPF A;  4ITQ A;  2Z8Y M;  3M7G A;  4B7H A;  3Q8G A;  2LVQ D;  2R4E A;  3GRV A;  4A3V B;  1P3Q Q;  4IBC A;  4B7F A;  4AKG A;  3VDP A;  2QCU A;  4DV0 M;  3TL4 X;  4GIP A;  3SAU A;  1NHW C;  1UM8 A;  2P5T A;  1TR8 A;  4HLQ A;  4M0W A;  3SHF A;  4JI5 M;  4M9Z A;  1YU2 A;  4AG6 A;  3J27 B;  5EP2 A;  5LMU M;  1J7M A;  3FUU A;  4DV1 M;  4PT5 A;  2WSF F;  5ITU A;  1TH3 A;  3JR5 A;  2Z3X A;  3BXW A;  3KXE C;  3NBX X;  4B3T M;  3K1J A;  2DZO B;  4OX9 M;  4G6Z A;  4Z6Y A;  2B3T A;  4NL4 H;  4NZ4 A;  2Z4S A;  1PJQ A;  5IRE B;  1HT1 E;  4IBB A;  3EIE A;  3U6C A;  1TDH A;  1IXS B;  1H0I A;  2Y2J A;  3FYC A;  1PJS A;  3M7P A;  3VKG A;  2RGH A;  3FRH A;  3GLF A;  4DR4 M;  1NJG A;  2CE7 A;  3FUX A;  2QBY B;  3HHY A;  4FVM A;  3BOS A;  1E88 A;  3AOE A;  1IY1 A;  3GPP A;  2D7E A;  4D80 A;  4PDG A;  3HJS A;  2D49 A;  3K9P A;  1LV7 A;  1SXJ D;  3WHK A;  3F92 A;  4MB5 A;  3UJN A;  2DZN B;  5IWA M;  1GAB A;  3B89 A;  1Q39 A;  3HJ8 A;  1WR1 B;  1E6R A;  3WD1 A;  3FRI A;  2K6B A;  5KQ8 A;  2HCB A;  2FFJ A;  3C9P A;  4GHL A;  2CFO A;  3B7N A;  1I94 M;  2JXN A;  2ERC A;  4AW4 A;  3SAT A;  2DZL A;  3WD2 A;  3AV0 A;  1IN7 A;  4FWD A;  3T15 A;  3LCU A;  3THG A;  5C18 A;  5EXT A;  3WD0 A;  4GMQ A;  1KYI A;  4Z2L A;  4DUZ M;  4JN6 A;  4DR7 M;  1YU4 A;  2Y2M A;  4Z2H A;  2JP7 A;  3PXG A;  2QZ4 A;  2L4F A;  1IY0 A;  2CHV A;  2OOB A;  1FJG M;  4GKJ M;  3N3F A;  1DGF A;  4QHS A;  4Y28 F;  2LVP C;  4LRT A;  3KP1 E;  1E32 A;  4FD2 A;  3JAM S;  1GL6 A;  2R45 A;  2V1C A;  1L1Z A;  2V1U A;  5A2Q S;  1IXR C;  2GNO A;  3SMP A;  2JUJ A;  2E5L M;  2Y2P A;  3HU3 A;  1OQY A;  2I7P A;  1IFY A;  1OFH A;  3VK8 A;  3GLH E;  2XH9 A;  2C9C A;  3CGW A;  4LY6 A;  1NV9 A;  4D82 A;  1D2N A;  2FS1 A;  2JY6 B;  1XXH A;  1K82 A;  2LHC A;  3TWM A;  1HNX M;  2CV2 A;  2UWX A;  4DUY M;  3GRY A;  4F2L A;  1IBL M;  2LBC A;  2MGW A;  1IN5 A;  1JR3 D;  2Y2I A;  2V6Z M;  3DA1 A;  4QHT A;  1Z6T A;  4IBD A;  5JI2 E;  2F5S A;  2XF3 A;  1E9R A;  2Y2K A;  4FCV A;  3HWS A;  2GQF A;  4B08 A;  4II7 A;  1LTM A;  3WX7 A;  1MX0 A;  2Q2E B;  2KA6 B;  3B74 A;  2YFQ A;  1QZM A;  1VEK A;  1XB2 B;  3E21 A;  3IEC A;  5DNY A;  4G4R A;  1IN6 A;  4KT0 F;  2G3Q A;  4GRI A;  2Y2G A;  4DV2 M;  4LF4 M;  2BWE A;  4CHT B;  1PJT A;  2WSC F;  1XNR M;  3ZH9 B;  4LF6 M;  1L2B A;  2XSZ A;  3B7Z A;  1QUT A;  3SYL A;  1N34 M;  4NSR A;  4MGZ E;  3U61 A;  1IQP A;  2XGN A;  1NNU C;  2Y20 A;  1R7R A;  4P17 A;  5DYG A;  1C1K A;  2V5O A;  4DR2 M;  3W0L B;  5EP1 A;  2XD5 A;  1N78 A;  1E6P A;  1DO0 A;  1KS0 A;  1CK7 A;  1QZE A;  3VDU A;  1YLA A;  4AKH A;  2DAG A;  2MR9 A;  4I5S A;  1HQY E;  4DV6 M;  4P16 A;  2XLJ A;  2X49 A;  3GLF E;  1HNW M;  3HX3 A;  2CUZ A;  1MN3 A;  2ZBK B;  4DBG B;  3ILK A;  4MGH A;  1VEJ A;  3J81 S;  3FTE A;  4XK8 F;  3IG5 A;  4JI3 M;  2ZM6 M;  1GOI A;  3L2A A;  3MHV C;  1SXJ A;  1QYR A;  2F5P A;  3TPZ A;  5EXP A;  2LVO C;  3RE8 A;  3KOX E;  5F3W A;  1DGH B;  1IN8 A;  4JXJ A;  2KRK A;  2KZS A;  4HL4 A;  2HL7 A;  4HMC A;  4KLN A;  5KO3 A;  4LFC M;  1YU3 A;  2J5Y A;  1DGG A;  2C9O A;  2VDB B;  3J7A S;  2K47 A;  1E8B A;  3L26 A;  1QDT A;  4OJL A;  1WHC A;  2XFS A;  2XFT A;  1NY5 A;  3I51 A;  3SAS A;  3GLG A;  3GO8 A;  4KHP M;  5EJC A;  4JI8 M;  2X8A A;  3VK7 A;  3J80 S;  3TQS A;  1YUE A;  3MQL A;  2QPA A;  4MGI E;  1DO2 A;  4NC6 A;  1W1Y A;  1XHB A;  3GLI A;  2EO2 A;  5E6J A;  1G41 A;  3GLH B;  4QOZ C;  2R46 A;  5FLX S;  1HNZ M;  3UZU A;  2UU9 M;  3CF0 A;  4R7G A;  3B7Q A;  2L4E A;  4JI4 M;  4MGY E;  4JI1 M;  5GKN A;  4XBO A;  2MRO B;  2JZ1 A;  1GXD A;  3U6D A;  1IY2 A;  3HON A;  4ZPX A;  2UXC M;  2XEP A;  3PNV A;  4LFA M;  4HMD A;  4YHH M;  3UGJ A;  4RF0 A;  4FWG A;  2BG1 A;  4CJ6 A;  2LNH C;  1XXH E;  4LZJ A;  1VDD A;  1YSY A;  1NO1 A;  1NY6 A;  1G71 A;  1ORY B;  2LWX A;  3CF2 A;  4YY3 M;  3GP1 A;  1TH4 A;  3K8Z A;  3SAV A;  1ZMV A;  1N36 M;  1JR3 A;  4LJ9 A;  2J7O A;  3UK6 A;  2M60 A;  1R5L A;  1MU5 A;  2VF8 A;  3KOY E;  2F5O A;  4W5W A;  5EQT A;  5FTN A;  3SMS A;  5ITX E;  3KOZ E;  1GLN A;  4S12 A;  1J5E M;  1AIP C;  3R9X B;  5EP3 A;  4B3S M;  2FH0 A;  1G4A E;  4QNR A;  2Y2L A;  4UN2 B;  5FTM A;  4WP2 A;  3AKZ A;  4DV3 M;  1QAQ A;  5ITT A;  1UFZ A;  3FE3 A;  4EIW A;  2EA0 A;  2EKF A;  1XMO M;  5C1B A;  1H0G A;  1WIV A;  2DEN A;  3FTC A;  3SAR A;  2A5Y B;  1QDR A;  3AFH A;  1VG5 A;  2CEA A;  3T1Y M;  4M0D A;  4LJ8 A;  2JCH A;  1QVR A;  1J7K A;  2H5X A;  3KS8 A;  1RU3 A;  1H8P A;  2O5R A;  2CHQ A;  1GL7 A;  2QSF X;  1KSF X;  3ZQJ A;  1H6U A;  3GLF B;  1T3T A;  2R0I A;  3FYD A;  3I04 M;  2LHG A;  3NBI A;  3RFW A;  2Y2O A;  2R4J A;  1ZV1 A;  3E46 A;  2LVN C;  1KFV A;  3MK6 A;  1T6O A;  4PD2 A;  3KW6 A;  2ZAM A;  1Q3B A;  2OOA A;  2QEN A;  3A42 A;  3PFI A;  2KEB A;  3HKP A;  1Q3C A;  3M6A A;  3ZCB B;  4NXN M;  3U6O A;  2YR0 A;  1YU0 A;  2FNA A;  2UXD M;  1L2C A;  2KXE A;  2Y0Q A;  2IOU A;  4G4Q A;  4OJP A;  4LF5 M;  4Z2I A;  1SXJ E;  4DR6 M;  4PDI A;  3U60 A;  4LF8 M;  2FE8 A;  2CRU A;  2LXE A;  4I8O A;  4G3O A;  1L8Q A;  3LQR A;  1ED7 A;  2DWZ B;  3DZD A;  4G4N A;  4GHA A;  2DAI A;  3E4R A; 
#chains in the Genus database with same CATH homology
 1DGB A;  1TGU A;  4AQY M;  1XC8 A;  2RGO A;  3VKH A;  4OJ5 A;  4KOD A;  4IIW A;  4OUI A;  1K3W A;  4LGM A;  4OJ6 A;  4M9S A;  4IBF A;  3SHG B;  5ITR A;  1QQW A;  3RGP A;  5FTJ A;  3DFZ A;  4IJF A;  2Y21 A;  2C98 A;  3KVW A;  3CTW B;  2UUA M;  4AKI A;  3QWL A;  5IT9 S;  2C96 A;  2D7G A;  4KO8 A;  2L6O A;  2BNK A;  1XXH B;  3TWK A;  4D81 A;  2Z7J A;  4MH0 E;  5H37 D;  4CGY B;  3UMM A;  3HHZ A;  4L15 A;  5KQD A;  2DXI A;  4LFB M;  1N75 A;  2FOI C;  3NWL A;  4JV5 M;  3AOG A;  1QAO A;  1G8P A;  1FNN A;  3J2P B;  3KOW E;  1E9S A;  1NSF A;  2M5Z A;  3L29 A;  5ITQ A;  1JQJ C;  2KRU A;  1K3X A;  3U5Z A;  4IBE A;  5KPT A;  5FTK A;  2Z4R A;  4G4O A;  4TUW A;  3GQ3 A;  4XGI A;  4BLC A;  4NYU A;  1OJL A;  3IG8 A;  3D8L A;  3KP0 E;  1XMQ M;  3FUV A;  4DR3 M;  4DV7 M;  2Y2H A;  3KSJ A;  1R2Z A;  1GVN A;  5ITY A;  3U61 B;  1XNQ M;  2Y0T A;  4IBI A;  4LG2 A;  2F5Q A;  2JE5 A;  3HJQ A;  2VQE M;  4NZ1 A;  4OJO A;  3VFD A;  5KPR A;  3EIH A;  2VQF M;  3ZC7 B;  4OVZ A;  3HHX A;  4IJE A;  3RGS A;  4MB7 A;  2CV0 A;  3E9S A;  4NZ5 A;  4MM3 B;  4NXM M;  2UXB M;  5EP4 A;  1YE9 A;  4R3D A;  3U6M A;  1SXJ B;  1QAN A;  3AJI B;  1PM5 A;  3U6L A;  4IBJ A;  4JI0 M;  1G59 A;  1G3I A;  5EXX A;  2LH0 A;  4NRV A;  2HHH M;  4M9X A;  4FWH A;  4NY2 A;  4NRW A;  4LCB A;  3GPX A;  1L2D A;  3CF6 E;  1TH2 A;  4AI6 A;  3L28 A;  3FUT A;  2EUC A;  4MGK E;  5BPV A;  2C5R A;  2F4V M;  1YU1 A;  3GPY A;  3GLG B;  1PJI A;  4Z8X A;  5BR8 M;  1L1T A;  3AL0 C;  2Y2Q A;  1NVM A;  3Q8X A;  3GQ5 A;  4NYY A;  3AOE C;  3FKE A;  3K92 A;  4LRS A;  3GLI B;  1N77 A;  4LF9 M;  3TWL A;  4GC9 A;  3R8F A;  2CV1 A;  4DV5 M;  2H1R A;  4IBG A;  2QBY A;  4QOS A;  4LGY A;  1R2Y A;  4GKK M;  3HU1 A;  4WUR A;  3U6P A;  3VLF B;  2AHM A;  4IBK A;  1OFI A;  2XSZ D;  3M0E A;  2BJV A;  1EE8 A;  2XD1 A;  2I7N A;  1PJJ A;  3K2L A;  3C58 A;  3SFZ A;  4L78 A;  1R6B X;  5LMN M;  2ZAO A;  3T1H M;  4LJ4 A;  2DWL A;  3QAU A;  1IBK M;  3H4M A;  1Z59 A;  3HGI A;  4CIS A;  3WHL A;  3LQQ A;  3KS4 A;  1X37 A;  4GIT A;  4RF1 A;  4GH9 A;  4OU7 A;  1Z5A A;  3J7B A;  1IBM M;  2KZU A;  3LVV A;  3I4V A;  4FW9 A;  3KSX A;  4NSO B;  5IZ7 D;  2RKO A;  1I4W A;  4LJ5 A;  2ZAN A;  5EXS A;  4LZZ A;  4B3M M;  3SBJ A;  3L25 A;  4X64 M;  2X4A A;  4DV4 M;  2R18 A;  2VII A;  4LJ7 A;  3FTF A;  4X65 M;  2UUB M;  1IXZ A;  3I4Y A;  3FTD A;  4DR5 M;  1ZAE A;  1QAM A;  7CAT A;  2YNM D;  4B7G A;  4NZ3 A;  4GC5 A;  4JI7 M;  3U6Q A;  2CHG A;  4QNL A;  2C99 A;  2L09 A;  3U6E A;  1N33 M;  4OW0 A;  4AG5 A;  4JI2 M;  4K0K M;  3U60 B;  2D7H A;  3GPU A;  1NJF A;  3DOA A;  3W0F A;  2L7I A;  3D8B A;  2HKJ A;  3GRU A;  1TDZ A;  3B9P A;  2G8L A;  2F5N A;  1NHG C;  5DYI A;  4X62 M;  3A45 A;  4I4L A;  1S3S A;  4X66 M;  1J09 A;  2L7H A;  3LVW A;  4B3R M;  4L4U A;  4BBA A;  3L27 A;  5FSW A;  3GQ4 A;  4WW0 A;  2OQ4 A;  3HSH A;  8CAT A;  5ITX A;  3A98 B;  1GKI A;  1W5S A;  2W82 A;  4RNA A;  3GRR A;  5E26 A;  4LF7 M;  3HHW A;  1SXJ C;  2G5G X;  2XZU A;  2DWN A;  3PNY A;  3PVS A;  1Z5B A;  3OTO M;  4JI6 M;  1WXQ A;  2DVW B;  2R62 A;  2UUC M;  2YQZ A;  3JR4 A;  3SAW A;  1N32 M;  4LJ6 A;  4L16 A;  5FTL A;  2J7N A;  3KFU G;  2NQ8 C;  1DGH A;  3KDS E;  3MJ5 A;  1ZQ9 A;  1E94 E;  3FD9 A;  1HR0 M;  2OPF A;  4AZF A;  2DWM A;  1IN4 A;  2Y2N A;  1IM2 A;  1XWI A;  4PCZ A;  4NOO B;  3U5Z B;  4QNM A;  3TE6 A;  2XZF A;  5JI3 E;  3FUW A;  2R65 A;  1YUB A;  2DHR A;  4FCW A;  4I81 A;  2BJW A;  2JA2 A;  4L8R C;  4REZ A;  3SYK A;  3U6S A;  3T38 A;  2KW0 A;  1HT2 E;  5KPZ A;  2QP9 X;  3GLH A;  4FCT A;  3SC3 A;  1NNJ A;  3A46 A;  1Z5C A;  4BB9 A;  4DR1 M;  3HU2 A;  1HQC A;  4OVZ B;  1W5T A;  3LMM A;  4JYA M;  4ITQ A;  3M7G A;  4B7H A;  2R4E A;  3GRV A;  4A3V B;  4IBC A;  4B7F A;  4AKG A;  3VDP A;  2QCU A;  4DV0 M;  3TL4 X;  4GIP A;  3SAU A;  1NHW C;  1UM8 A;  2P5T A;  4HLQ A;  4M0W A;  3SHF A;  4JI5 M;  4M9Z A;  1YU2 A;  4AG6 A;  3J27 B;  5EP2 A;  5LMU M;  3FUU A;  4DV1 M;  4PT5 A;  3JR5 A;  5ITU A;  1TH3 A;  2Z3X A;  3KXE C;  4B3T M;  3K1J A;  2DZO B;  4OX9 M;  4G6Z A;  4Z6Y A;  4NL4 H;  4NZ4 A;  2Z4S A;  5IRE B;  1HT1 E;  4IBB A;  3EIE A;  3U6C A;  1TDH A;  1IXS B;  2Y2J A;  3FYC A;  3VKG A;  2RGH A;  3GLF A;  4DR4 M;  1NJG A;  2CE7 A;  3FUX A;  2QBY B;  3HHY A;  4FVM A;  3BOS A;  3AOE A;  1IY1 A;  3GPP A;  2D7E A;  4D80 A;  4PDG A;  3HJS A;  1LV7 A;  1SXJ D;  3WHK A;  3UJN A;  2DZN B;  5IWA M;  1Q39 A;  3HJ8 A;  5KQ8 A;  2HCB A;  2FFJ A;  4GHL A;  2CFO A;  1I94 M;  2ERC A;  4AW4 A;  3SAT A;  3AV0 A;  1IN7 A;  4FWD A;  3T15 A;  3THG A;  5C18 A;  5EXT A;  4GMQ A;  1KYI A;  4DUZ M;  4JN6 A;  4DR7 M;  1YU4 A;  2Y2M A;  3PXG A;  2QZ4 A;  1IY0 A;  2CHV A;  1FJG M;  3N3F A;  4GKJ M;  1DGF A;  4QHS A;  4LRT A;  3KP1 E;  1E32 A;  4FD2 A;  3JAM S;  1GL6 A;  2R45 A;  2V1C A;  1L1Z A;  2V1U A;  5A2Q S;  1IXR C;  3SMP A;  2E5L M;  2Y2P A;  3HU3 A;  2I7P A;  1OFH A;  3VK8 A;  2XH9 A;  2C9C A;  4LY6 A;  1K82 A;  4D82 A;  1D2N A;  1HNX M;  1XXH A;  3TWM A;  2UWX A;  2CV2 A;  4DUY M;  3GRY A;  1IBL M;  1IN5 A;  1JR3 D;  2Y2I A;  2V6Z M;  3DA1 A;  4QHT A;  1Z6T A;  4IBD A;  5JI2 E;  2F5S A;  2XF3 A;  1E9R A;  2Y2K A;  4FCV A;  3HWS A;  4B08 A;  4II7 A;  3WX7 A;  1MX0 A;  2Q2E B;  2KA6 B;  4LJA A;  2YFQ A;  1QZM A;  5DNY A;  4G4R A;  1IN6 A;  2Y2G A;  4GRI A;  4DV2 M;  4LF4 M;  4CHT B;  1XNR M;  3ZH9 B;  4LF6 M;  1L2B A;  2XSZ A;  3SYL A;  1N34 M;  4NSR A;  4MGZ E;  3U61 A;  1IQP A;  2XGN A;  1NNU C;  2Y20 A;  1R7R A;  5DYG A;  1C1K A;  4DR2 M;  3W0L B;  5EP1 A;  2XD5 A;  1N78 A;  1DO0 A;  3VDU A;  4AKH A;  4I5S A;  4DV6 M;  1HQY E;  4P16 A;  2XLJ A;  2X49 A;  1HNW M;  2CUZ A;  2ZBK B;  3J81 S;  3ILK A;  4MGH A;  3FTE A;  4JI3 M;  3IG5 A;  2ZM6 M;  3L2A A;  3MHV C;  1SXJ A;  1QYR A;  2F5P A;  3TPZ A;  5EXP A;  3RE8 A;  3KOX E;  5F3W A;  1DGH B;  1IN8 A;  4JXJ A;  2KRK A;  2KZS A;  4HL4 A;  2HL7 A;  4KLN A;  5KO3 A;  4LFC M;  1YU3 A;  1DGG A;  2C9O A;  3J7A S;  2K47 A;  4OJL A;  3L26 A;  2XFS A;  2XFT A;  1NY5 A;  3I51 A;  3SAS A;  3GLG A;  3GO8 A;  4KHP M;  5EJC A;  4JI8 M;  2X8A A;  3VK7 A;  3J80 S;  3TQS A;  1YUE A;  2QPA A;  4MGI E;  1DO2 A;  1XHB A;  3GLI A;  2EO2 A;  5E6J A;  1G41 A;  3GLH B;  4QOZ C;  2R46 A;  5FLX S;  1HNZ M;  3UZU A;  2UU9 M;  3CF0 A;  4R7G A;  4JI4 M;  4MGY E;  4JI1 M;  5GKN A;  4XBO A;  3U6D A;  1IY2 A;  3HON A;  4ZPX A;  2UXC M;  2XEP A;  3PNV A;  4LFA M;  4YHH M;  3UGJ A;  4RF0 A;  4FWG A;  2BG1 A;  2LNH C;  4LZJ A;  1VDD A;  1YSY A;  1ORY B;  1NY6 A;  2LWX A;  3CF2 A;  4YY3 M;  3GP1 A;  3SAV A;  2FFF B;  1TH4 A;  3K8Z A;  1N36 M;  1JR3 A;  4LJ9 A;  2J7O A;  3UK6 A;  2M60 A;  1MU5 A;  3KOY E;  2F5O A;  5EQT A;  5FTN A;  3SMS A;  5ITX E;  3KOZ E;  1GLN A;  4S12 A;  1J5E M;  5EP3 A;  4B3S M;  1G4A E;  4QNR A;  2Y2L A;  5FTM A;  4DV3 M;  3AKZ A;  1QAQ A;  5ITT A;  4EIW A;  2EA0 A;  1XMO M;  5C1B A;  3FTC A;  3SAR A;  2A5Y B;  3AFH A;  2CEA A;  3T1Y M;  4M0D A;  4LJ8 A;  2JCH A;  1QVR A;  1J7K A;  3KS8 A;  2O5R A;  2CHQ A;  1GL7 A;  1KSF X;  3GLF B;  1H6U A;  1T3T A;  3FYD A;  3NBI A;  3RFW A;  2Y2O A;  2R4J A;  1KFV A;  3MK6 A;  4PD2 A;  3KW6 A;  2ZAM A;  2QEN A;  3A42 A;  1Q3B A;  3PFI A;  3R9X B;  2KEB A;  3HKP A;  1Q3C A;  3M6A A;  3ZCB B;  4NXN M;  3U6O A;  2YR0 A;  1YU0 A;  2FNA A;  2UXD M;  1L2C A;  2KXE A;  2Y0Q A;  2IOU A;  4G4Q A;  4OJP A;  4LF5 M;  1SXJ E;  4DR6 M;  4PDI A;  3U60 A;  4LF8 M;  2FE8 A;  2LXE A;  4I8O A;  1L8Q A;  3LQR A;  2DWZ B;  3DZD A;  4G4N A;  4GHA A;  4W5W A;  3E4R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...