4IJFA

Crystal structure of the zaire ebolavirus vp35 interferon inhibitory domain k222a/r225a/k248a/k251a mutant
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
123
structure length
123
Chain Sequence
DISAADLANIMYDHLPGFGTAFHQLVQVICALGADSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polymerase cofactor VP35
publication title Development of RNA Aptamers Targeting Ebola Virus VP35.
pubmed doi rcsb
source organism Zaire ebolavirus
molecule tags Viral protein
total genus 36
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2012-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ijfA01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4ijfA02
3L28A 4IJFA 4IBEA 4GH9A 4IJEA 5BPVA 4IBIA 3FKEA 3L27A 4IBDA 4IBCA 4GHLA 3L29A 4IBGA 3KS4A 3L2AA 4GHAA 3L26A 4IBFA 4LG2A 4IBKA 3L25A 4IBBA 4IBJA 3KS8A
chains in the Genus database with same CATH superfamily
4JI5M 3L28A 4L4UA 4QOZC 3K9OA 2DAIA 3TPZA 2BJVA 4G6ZA 4LJ4A 5FTKA 5KQ8A 3MMPA 2APLA 4IBIA 2CHVA 3KW6A 5L8RF 3E9SA 2O5RA 2KRUA 4PCZA 4G4RA 4IBCA 3SATA 2KXEA 1LTMA 3I51A 4LJ8A 1VDDA 2XZUA 4AI6A 1V34A 3C9PA 1Q39A 5EXPA 3FUUA 5C1BA 3GLFB 4Z8XA 3VK7A 1W5TA 3F92A 2XSZA 1TH2A 1C1KA 2HCBA 3J2PB 4F1IA 4Z6YA 2CFOA 4DV6M 1HJPA 1HR0M 2Y0QA 4B3TM 2B3TA 2L7HA 2FE8A 3FD9A 1WGLA 1DO2A 1Q02A 2W82A 2DKLA 2KEBA 2XH9A 3BXWA 1GXDA 4FCWA 4HMEA 4XK8F 4OJ5A 1KSFX 5EXSA 4LFAM 4EIWA 1L1TA 2DAGA 2UU9M 2Y2HA 4TX8A 3AOEA 2J5YA 2L2DA 4YY3M 2KNZA 4DR3M 2JZ1A 4AKHA 4LZJA 4W5WA 1YUEA 4OUIA 1OTRA 3GLHE 1IN7A 1G3IA 2QZ4A 1OJLA 2XD5A 3KP0E 4PDGA 1PDCA 2RGOA 3UGJA 5ITUA 4B3MM 3PNYA 1W1TA 3U60B 2DWMA 2XSZD 3GQ4A 2L09A 1G59A 1FNNA 1YU4A 4LF4M 2HKJA 4UN2B 3HY5A 2V1UA 5ITXA 3ZCBB 5BR8M 1ZAEA 2Y2QA 2Y2MA 2K9DA 3J80S 2DNAA 3SARA 1D0LA 2O01F 4HMDA 4RNAA 1N36M 1JR3E 2QNJA 2Y2LA 4Z2LA 3H4JA 1LV7A 4LF7M 4M9SA 3SHFA 3KOWE 3QWLA 2M60A 2KNAA 1QANA 4CGYB 4GKKM 1QAOA 4NRWA 1UR8A 1RU3A 1YU1A 1J09A 3FKEA 3VDUA 1T6OA 1ZV1A 3CF0A 3E21A 4ANRA 5KO3A 1L2CA 4Z2JA 1CXWA 1TH3A 2JY6B 2QHOB 4NC6A 2Y2OA 3VFDA 1DGGA 2AHMA 1G71A 4REZA 1UM8A 2LTUA 4FVMA 5EP1A 3FUWA 4OU7A 1T43A 1TF0B 3A98B 1P3QQ 3U60A 1IBKM 1XNRM 1H0IA 4NL4H 3I4YA 5GKNA 2OOBA 3E46A 8CATA 5E6JA 2V5OA 4L6V6 2G3QA 2VQFM 2DZOB 1WGNA 4JI8M 4NRVA 3L25A 4LGMA 3U61B 2R0IA 1SG9A 2L4EA 5ITYA 2FFFB 2UXDM 1TDHA 3A42A 4NXNM 3IECA 4LJ9A 5KPRA 1J7MA 3GO8A 1I94M 2F5PA 2C9OA 3GPXA 3E4RA 3GLHB 2F5OA 4JI1M 3B7NA 1OQYA 3NWLA 3RE8A 5H37D 4NXMM 2Y2JA 1NV9A 3HZJA 3SAVA 1NVMA 1MJGM 3WD1A 3K2LA 1MX0A 4NYYA 1HT1E 3GLGE 2J7NA 2YR0A 2YQZA 4PD2A 2CV2A 3CGWA 3GLFE 1QZMA 3HJSA 4B7FA 3DFZA 4D80A 1E6ZA 3T6PA 1D0MA 2IOUA 2F5SA 1XMOM 4CIZA 2JXNA 1OFHA 2Z4RA 3D8LA 2VF8A 4OW0A 1R7RA 4DR7M 4S12A 2RKOA 5FLXS 5LMUM 3R9XB 1V92A 3LQQA 5IREB 2YFQA 3OTOM 1KFVA 3PVSA 2BWBA 4MB4A 1GVNA 1ZMVA 3SHGB 3R8FA 4IBDA 3FE3A 3GLHA 2Y2PA 4IIWA 5JI2E 3U6CA 1GKIA 1NNUC 4IBGA 7CATA 2C98A 5FSWA 1QO6A 2Y2KA 2DWZB 2Z7JA 1XWIA 2CRUA 2K6BA 2R6FA 3IHPA 2JA2A 4GHAA 2Z4SA 1L6JA 2EKFA 1PRBA 4HLQA 1XNQM 1GJTA 3U6SA 2CEAA 4KO8A 2QSFX 4IBFA 1E94E 4QNMA 5E26A 2RTSA 4IBKA 3N3FA 1IN4A 2YNMD 3K92A 4IBBA 1KYIA 2FNAA 1R5LA 4NZ4A 2MGWA 2D49A 1HQCA 4DR6M 1JR3A 4GC9A 3T38A 3TWKA 2XLJA 2JCHA 1QVRA 3ZC7B 4RKUF 4LF6M 4L78A 1TR8A 4OJPA 4DBGB 4LF9M 2V1CA 2J7OA 3MK6A 5FTJA 4M9ZA 2XZFA 1GLNA 2JWSA 1QAMA 2KW0A 2P5TA 4M0DA 1PJTA 4MGHA 3RGPA 3HU2A 1NV8A 2DZLA 1W1PA 2JZ0A 3KS4A 2DZNB 4X62M 3ZQJA 2R44A 2EJSA 1JQJC 3GLGB 1W5SA 1UFZA 3LMMA 3AV0A 3GRVA 3A46A 1GL6A 1V33A 4DV2M 5EP3A 1IXRC 4OVZB 2JY7A 3KSXA 2F5QA 1IM2A 4B3RM 1EAKA 2UUAM 4LFCM 1R6BX 1VEKA 2QQ8A 3THGA 1AUAA 3VDPA 1JR3D 1DGBA 3M6AA 5ITRA 4JV5M 2M5ZA 5FTMA 3UZUA 1XXHB 4GH9A 3AL0C 1EIJA 1O6IA 3M0EA 2HL7A 5DFLA 3FYCA 3RFWA 4AW4A 2OQ4A 3B7QA 2MROB 5KPZA 2CV1A 4QOSA 2C96A 2I7NA 1VEJA 4NZ5A 4NOOB 3TQSA 3PFIA 2HWJA 3GLGA 2JNHA 4DV0M 1C7YA 1CK7A 3GLFA 4DV1M 1IQPA 1L8QA 3C58A 2LNHC 4GKJM 1UR9A 2L6OA 4L15A 3NBIA 3J7AS 3KS8A 2FFJA 3ILKA 4P17A 2DHYA 1WIVA 2R45A 4KHPM 2L4FA 2UXBM 3VKGA 2DENA 3GP1A 1R4GA 4IBEA 4Y28F 3JR4A 2ZM6M 4MB3A 1XXHA 3LCVB 3SBJA 1QDRA 3HWSA 1ZMWA 4I4LA 4IJEA 2UUBM 5FTLA 3BOSA 3L27A 4YHHM 2LXEA 1PGYA 3HX3A 3FRIA 4LJ7A 1ZQ9A 2K47A 2LVQD 3SFZA 4A3VB 1S3SA 5DNYA 3T1HM 3DA1A 5DYIA 1TTEA 4Z2IA 2JY8A 4CISA 1N33M 3EIEA 2EUCA 1SXJE 3SYKA 3W0FA 2VF7A 5EP2A 4QHTA 4MGKE 1QZEA 4NSRA 1Z5CA 1ED7A 3AJIB 4L16A 5KPTA 4XBOA 4GMQA 3GLIE 1I4WA 2H1RA 2GNOA 5IT9S 5IZ7D 1GO5A 4B08A 1OIZA 3SMPA 2DXIA 2UUCM 1N34M 4OJLA 3KOXE 4NZ1A 3T15A 2DAEA 4DV7M 1E8BA 3KOYE 4MH0E 1W1VA 3MQLA 2R18A 1VEGA 3AOGA 2D7GA 4Z2GA 3KSJA 4FD2A 1J7KA 4AZFA 2DWLA 3AKZA 2XFTA 3LQRA 1AIPC 2XEPA 4WURA 3GPPA 4GHLA 3B7ZA 1HNXM 1X37A 2KHHA 3SASA 1YU3A 4BLCA 2Y2GA 1PJQA 4R71A 3CTWB 5A2QS 2LVNC 4NYUA 2DHRA 2CWBA 2X49A 3LW5F 4I5SA 4X65M 4OJOA 2VDBB 3I04M 3FTDA 3U6OA 3FTCA 2KA6B 3RGSA 1QDTA 2OPFA 2QBYB 3U61A 1D2NA 2RRUA 4TUWA 2ZBKB 4LRTA 3MHVC 1A5TA 2LBCA 2NQ8C 3V76A 1XXHE 4M0WA 3SAUA 1W1YA 2JE5A 1NSFA 2LVAA 4NY2A 4OJ6A 3U6DA 1ZMUA 2MH8A 3UK6A 1N75A 1YSYA 4F2LA 3TE6A 5LMNM 2Y20A 1K3WA 1DGHB 2OO9A 2Q2EB 1HNWM 1IFYA 3WD0A 1K82A 1HQYE 4G4NA 1SXJB 4G4QA 4FCVA 1IY2A 4ZPXA 1NHWC 2G5GX 5EJCA 3SMSA 1J5EM 3GRRA 4AG5A 3U6LA 4GRIA 3GLIB 4GEWA 3B89A 3B9PA 2XF3A 1IBMM 3WD3A 1CUKA 1E32A 1QQWA 4LGYA 4MGIE 2QCUA 2R4JA 4WP2A 4JI7M 4JN6A 4JI3M 3TWMA 1GPFA 4B7GA 3UJNA 1GL7A 3NBXX 2Y2NA 4OX9M 2QENA 1YUBA 2MR9A 2Y0TA 3B74A 4RF0A 4I8OA 1GJSA 4BBAA 4LF8M 5EP4A 3L29A 3AOEC 4R3DA 4D82A 2DI0A 1PM5A 1DGHA 2BJWA 3LVWA 4P16A 4QHSA 2ZANA 3W0LB 1XC8A 3JAMS 3U6EA 1Z5AA 3CF6E 4JI2M 2Z8YM 1SXJA 4KODA 4DUZM 1QUSA 5C18A 1Q3CA 1PJSA 1XMQM 3U5ZB 4QNLA 3WD4A 1AIWA 1VQ1A 2ZTCA 3GLIA 1T3TA 1Z5BA 3FTEA 1H0GA 1EE8A 1NHGC 2VIIA 4LJ5A 3CF2A 3J81S 3H4MA 2OOAA 3AFHA 3IG5A 4IJFA 3Q8XA 4LJAA 3KDSE 3GRUA 1NY5A 1OFIA 3HGIA 2X8AA 1DV0A 1E88A 5F3WA 1DO0A 2LWXA 1QUTA 1OAIA 2V6ZM 4DV4M 4Q7JA 2LHGA 3VKHA 5ITQA 1VDLA 1QAQA 3WHKA 1N77A 2RGHA 3I4VA 2GQFA 1SXJD 2R65A 1WJ7A 3HONA 2F4VM 4RF1A 4KLNA 4LF5M 2Z3XA 1BVSA 4B3SM 1OGGA 2K0BX 1IN6A 4LG2A 5KQDA 1VG5A 2LVOC 4OVZA 4NSOB 2CP8A 3U5ZA 2E5LM 1K3XA 1OIPA 1IXZA 4LRSA 2BNKA 2WZJA 3KVWA 1E6RA 2F5NA 3D8BA 1ORYB 1OAOC 3U6PA 1H8PA 4AQYM 1G4AE 3J7BA 2WSCF 1IN5A 1E9SA 3EIHA 3QAUA 5JI3E 3BBZA 1WR1B 2BG1A 1Z6TA 3UMMA 4X66M 1EFUB 2WSEF 2JUJA 3HHZA 1DGFA 5ITTA 4DR5M 1IBLM 3QYBA 5EXTA 2Y2IA 3U6MA 3FUVA 3SC3A 5IWAM 2VQEM 2CV0A 3HJQA 4G4OA 2KZUA 4MB5A 3C3EA 2KNVA 2N35A 3LCUA 2KRKA 4GITA 4DV5M 3I01M 3JR5A 4FCTA 4HMCA 2EO2A 2XFSA 3DOAA 1E6NA 1TGUA 3DZDA 3FRHA 4K0KM 2H5XA 3GPYA 3HKPA 3TL4X 2EKKA 3FUTA 3HHWA 2LVPC 2D7EA 4MGYE 3KOZE 2DWNA 2HHHM 3KFUG 3GQ3A 2FS1A 4DR2M 1PJJA 1PJIA 1HNZM 2CE7A 4PT5A 4ITQA 3K8ZA 3C3DA 1YU2A 4Z2HA 3LVVA 3HHXA 5BPVA 4WW0A 3TWLA 1NJFA 4JI6M 1NO1A 3IG8A 3M7PA 3ZH9B 2EA0A 1YLAA 4BB9A 1Q3BA 4M9XA 2DVWB 3W68A 2C9CA 1L1ZA 3K1JA 2ZAMA 1G41A 4MGZE 4HL4A 3K9PA 1KS0A 2A5YB 4DR1M 1E15A 1Z59A 1R2ZA 2HAKA 4FWGA 5EQTA 4GIPA 4AKIA 1FJGM 4B7HA 2FOIC 4IBJA 2Y21A 2DAMA 1OGBA 1WHCA 3HJ8A 3KXEC 2JY5A 2ZAOA 2LHCA 1TDZA 1IY0A 3M7GA 3GQ5A 3U6QA 2UWXA 2FN2A 2LH0A 1HT2E 4DR4M 2CUZA 2G8LA 3A45A 4DV3M 3Q8GA 2I7PA 1TH4A 4G3OA 2FH0A 3SAWA 4JI4M 1IXSB 2C99A 4Z2KA 3WD2A 4FW9A 4LZZA 1JB0F 1WXQA 2L7IA 2QP9X 2UXCM 1XHBA 2ERCA 1E9RA 3L2AA 4AG6A 3GPUA 1IY1A 2DAKA 4KT0F 4II7A 4JI0M 1Y8GA 3PNVA 2C5RA 3FTFA 1GOIA 4QNRA 2X4AA 2R46A 4MB7A 3HU3A 4FWHA 4LJ6A 5ITXE 2WSFF 3HU1A 3VLFB 3W67A 1N78A 1NNJA 3WHLA 1L2BA 2QPAA 3FUXA 5DYGA 3VK8A 2D7HA 1SXJC 2ZTDA 1NY6A 4X64M 1G8PA 4I81A 3GRYA 1N32M 4GC5A 3HSHA 2QBYA 4JXJA 4LCBA 1OKSA 2O25A 1F4IA 3KP1E 3SYLA 1NJGA 1R2YA 2BWEA 3MJ5A 1D0KA 1XB2B 2R62A 2R4EA 2CHQA 1IXSA 2CHGA 2XGNA 4CJ6A 2XD1A 1YE9A 1MN3A 1GABA 2KZSA 4D81A 4LFBM 3J27B 4CHTB 1QYRA 4AKGA 5FTNA 1L2DA 1E6PA 4PDIA 3PXGA 5EXXA 3L26A 1MU5A 3HHYA 1YU0A 4L8RC 3T1YM 3FYDA 2KDLA 3QYEA 4HEOA 4XGIA 2MJ5B 4MM3B 4LY6A 2JP7A 4NZ3A 4FWDA 4R7GA 4DUYM 4JYAM 1H6UA 1IN8A 3WX7A
chains in the Genus database with same CATH topology
4JI5M 3L28A 4L4UA 4QOZC 3TPZA 2BJVA 4G6ZA 4LJ4A 5FTKA 5KQ8A 4IBIA 2CHVA 3KW6A 3E9SA 2O5RA 2KRUA 4PCZA 4G4RA 4IBCA 3SATA 2KXEA 2XZUA 3I51A 4LJ8A 1VDDA 4AI6A 1Q39A 5EXPA 3FUUA 5C1BA 3GLFB 4Z8XA 3VK7A 1W5TA 2XSZA 1TH2A 1C1KA 2HCBA 3J2PB 4Z6YA 2CFOA 4DV6M 1HR0M 2Y0QA 4B3TM 2L7HA 2FE8A 3FD9A 1DO2A 2W82A 2KEBA 2XH9A 4FCWA 4OJ5A 1KSFX 5EXSA 4LFAM 4EIWA 1L1TA 2UU9M 2Y2HA 3AOEA 4YY3M 4DR3M 4AKHA 1YUEA 4LZJA 4W5WA 4OUIA 1IN7A 1G3IA 2QZ4A 1OJLA 2XD5A 3KP0E 4PDGA 2RGOA 3UGJA 5ITUA 4B3MM 3PNYA 3U60B 2DWMA 2XSZD 3GQ4A 2L09A 1G59A 1FNNA 1YU4A 4LF4M 2HKJA 2V1UA 5ITXA 3ZCBB 5BR8M 1ZAEA 2Y2QA 2Y2MA 3J80S 3SARA 4RNAA 1N36M 2Y2LA 1LV7A 4LF7M 4M9SA 3SHFA 3KOWE 3QWLA 2M60A 1QANA 4CGYB 4GKKM 1QAOA 4NRWA 1YU1A 1J09A 3FKEA 3VDUA 1L2CA 3CF0A 5KO3A 1TH3A 2Y2OA 3VFDA 1DGGA 2AHMA 4REZA 1UM8A 4FVMA 5EP1A 4OU7A 3FUWA 3U60A 3A98B 1IBKM 1XNRM 4NL4H 3I4YA 5GKNA 8CATA 5E6JA 2VQFM 2DZOB 4JI8M 3L25A 4NRVA 4LGMA 3U61B 5ITYA 2FFFB 2UXDM 1TDHA 3A42A 4NXNM 4LJ9A 5KPRA 3GO8A 1I94M 2F5PA 2C9OA 3GPXA 3E4RA 3GLHB 2F5OA 4JI1M 3NWLA 3RE8A 4NXMM 5H37D 2Y2JA 3SAVA 1NVMA 3K2LA 1MX0A 4NYYA 1HT1E 2J7NA 2YR0A 2YQZA 4PD2A 1QZMA 3HJSA 4B7FA 3DFZA 4D80A 2IOUA 2F5SA 1XMOM 2Z4RA 1OFHA 3D8LA 4OW0A 1R7RA 4DR7M 4S12A 2RKOA 5FLXS 5LMUM 3R9XB 3LQQA 5IREB 2YFQA 3OTOM 1KFVA 3PVSA 1GVNA 3R8FA 3SHGB 4IBDA 3GLHA 2Y2PA 4IIWA 5JI2E 3U6CA 1GKIA 1NNUC 4IBGA 7CATA 2C98A 5FSWA 2Y2KA 2DWZB 2Z7JA 1XWIA 2JA2A 4GHAA 2Z4SA 4HLQA 1XNQM 3U6SA 2CEAA 4KO8A 4IBFA 3N3FA 1E94E 4QNMA 5E26A 4IBKA 1IN4A 2YNMD 3K92A 4IBBA 1KYIA 2FNAA 4NZ4A 1HQCA 4DR6M 1JR3A 4GC9A 3T38A 3TWKA 2XLJA 2JCHA 1QVRA 3ZC7B 4LF6M 4L78A 4OJPA 4LF9M 2V1CA 2J7OA 3MK6A 5FTJA 4M9ZA 2XZFA 1GLNA 2P5TA 1QAMA 2KW0A 4M0DA 4MGHA 3RGPA 3HU2A 3KS4A 2DZNB 4X62M 1JQJC 3GLGB 1W5SA 3LMMA 3AV0A 3GRVA 3A46A 1GL6A 4DV2M 5EP3A 1IXRC 4OVZB 3KSXA 2F5QA 1IM2A 4B3RM 2UUAM 4LFCM 1R6BX 3VDPA 3THGA 1JR3D 1DGBA 3M6AA 5ITRA 4JV5M 2M5ZA 5FTMA 3UZUA 1XXHB 4GH9A 3AL0C 3M0EA 2HL7A 3FYCA 3RFWA 4AW4A 2OQ4A 5KPZA 2CV1A 4QOSA 2C96A 2I7NA 4NZ5A 4NOOB 3TQSA 3PFIA 3GLGA 4DV0M 3GLFA 4DV1M 1IQPA 1L8QA 3C58A 2LNHC 4GKJM 2L6OA 4L15A 3NBIA 3J7AS 3KS8A 2FFJA 3ILKA 2R45A 4KHPM 2UXBM 3VKGA 3GP1A 4IBEA 3JR4A 2ZM6M 1XXHA 3SBJA 3HWSA 4IJEA 4I4LA 2UUBM 5FTLA 3BOSA 3L27A 4YHHM 2LXEA 4LJ7A 3SFZA 1ZQ9A 2K47A 4A3VB 1S3SA 5DNYA 3T1HM 3DA1A 5DYIA 4CISA 1N33M 3EIEA 2EUCA 1SXJE 3SYKA 3W0FA 5EP2A 4QHTA 4MGKE 4NSRA 1Z5CA 3AJIB 4L16A 5KPTA 4XBOA 4GMQA 1I4WA 2H1RA 5IT9S 4OJLA 5IZ7D 4B08A 2DXIA 3SMPA 2UUCM 1N34M 3KOXE 4NZ1A 3T15A 4DV7M 3KOYE 4MH0E 2R18A 3AOGA 2D7GA 3KSJA 4FD2A 1J7KA 4AZFA 2DWLA 3AKZA 2XFTA 3LQRA 4WURA 2XEPA 3GPPA 4GHLA 1HNXM 1X37A 3SASA 1YU3A 4BLCA 2Y2GA 3CTWB 5A2QS 4NYUA 2DHRA 4I5SA 2X49A 4OJOA 4X65M 3U6OA 3FTDA 3FTCA 2KA6B 3RGSA 2OPFA 2QBYB 3U61A 1D2NA 4TUWA 2ZBKB 4LRTA 3MHVC 2NQ8C 2JE5A 4M0WA 3SAUA 1NSFA 4NY2A 4OJ6A 3U6DA 3UK6A 1N75A 1YSYA 3TE6A 5LMNM 2Y20A 1K3WA 1DGHB 2Q2EB 1HNWM 1K82A 1HQYE 4G4NA 1SXJB 4G4QA 4FCVA 1IY2A 4ZPXA 1NHWC 2G5GX 5EJCA 3SMSA 1J5EM 3GRRA 4AG5A 3U6LA 4GRIA 3GLIB 3B9PA 2XF3A 1IBMM 1E32A 1QQWA 4LGYA 4MGIE 2QCUA 2R4JA 4JI7M 4JN6A 4JI3M 3TWMA 4B7GA 3UJNA 1GL7A 2Y2NA 4OX9M 2QENA 1YUBA 2Y0TA 4RF0A 4I8OA 4BBAA 4LF8M 5EP4A 3L29A 3AOEC 4R3DA 4D82A 1PM5A 1DGHA 2BJWA 3LVWA 4P16A 4QHSA 2ZANA 3W0LB 1XC8A 3JAMS 3U6EA 1Z5AA 3CF6E 4JI2M 1SXJA 4KODA 4DUZM 5C18A 1Q3CA 1XMQM 3U5ZB 4QNLA 3GLIA 3FTEA 1T3TA 1Z5BA 1EE8A 1NHGC 2VIIA 4LJ5A 3CF2A 3J81S 3H4MA 3AFHA 3IG5A 4IJFA 3Q8XA 4LJAA 3KDSE 3GRUA 1NY5A 1OFIA 3HGIA 2X8AA 5F3WA 1DO0A 2LWXA 2V6ZM 4DV4M 3VKHA 5ITQA 1QAQA 3WHKA 1N77A 2RGHA 3I4VA 2R65A 1SXJD 3HONA 2F4VM 4RF1A 4KLNA 4LF5M 2Z3XA 4B3SM 1IN6A 4LG2A 5KQDA 4OVZA 4NSOB 3U5ZA 2E5LM 1K3XA 1IXZA 4LRSA 2BNKA 3KVWA 2F5NA 3D8BA 1ORYB 3U6PA 4AQYM 1G4AE 3J7BA 3QAUA 1IN5A 1E9SA 3EIHA 5JI3E 2BG1A 1Z6TA 3UMMA 4X66M 3HHZA 4DR5M 1DGFA 5ITTA 1IBLM 5EXTA 2Y2IA 3U6MA 3FUVA 3SC3A 5IWAM 2VQEM 2CV0A 3HJQA 4G4OA 2KZUA 2KRKA 4GITA 4DV5M 3JR5A 4FCTA 2EO2A 2XFSA 3DOAA 1TGUA 3DZDA 4K0KM 3GPYA 3HKPA 3TL4X 3FUTA 3HHWA 2D7EA 4MGYE 3KOZE 2DWNA 2HHHM 3KFUG 3GQ3A 4DR2M 1PJJA 1PJIA 1HNZM 2CE7A 4PT5A 4ITQA 3K8ZA 1YU2A 3LVVA 3HHXA 5BPVA 4WW0A 3TWLA 1NJFA 4JI6M 3IG8A 3ZH9B 2EA0A 4BB9A 1Q3BA 4M9XA 2DVWB 2C9CA 1L1ZA 3K1JA 2ZAMA 1G41A 4MGZE 4HL4A 2A5YB 4DR1M 1Z59A 1R2ZA 4FWGA 5EQTA 4AKIA 4GIPA 1FJGM 4B7HA 2FOIC 4IBJA 2Y21A 3HJ8A 3KXEC 2ZAOA 1TDZA 1IY0A 3M7GA 3GQ5A 3U6QA 2UWXA 2LH0A 1HT2E 4DR4M 2CUZA 2G8LA 3A45A 4DV3M 2I7PA 1TH4A 4JI4M 3SAWA 1IXSB 2C99A 4FW9A 4LZZA 1WXQA 2L7IA 2QP9X 2UXCM 1XHBA 2ERCA 1E9RA 3L2AA 4AG6A 3GPUA 1IY1A 2C5RA 4JI0M 4II7A 2CV2A 3FTFA 3PNVA 4QNRA 2X4AA 2R46A 4MB7A 3HU3A 4FWHA 4LJ6A 5ITXE 3HU1A 3VLFB 1N78A 1NNJA 3WHLA 1L2BA 2QPAA 3FUXA 5DYGA 3VK8A 2D7HA 1SXJC 4X64M 1NY6A 1N32M 1G8PA 4I81A 3GRYA 3HSHA 4GC5A 2QBYA 4JXJA 4LCBA 3KP1E 3SYLA 1NJGA 1R2YA 3MJ5A 2R62A 2R4EA 2CHQA 2CHGA 2XGNA 2XD1A 1YE9A 2KZSA 4D81A 4LFBM 3J27B 4CHTB 1QYRA 4AKGA 5FTNA 1L2DA 4PDIA 3PXGA 5EXXA 3L26A 1MU5A 3HHYA 1YU0A 4L8RC 3T1YM 3FYDA 4XGIA 4MM3B 4LY6A 4NZ3A 4FWDA 4R7GA 4DUYM 4JYAM 1H6UA 1IN8A 3WX7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L28 A;  4IJF A;  4IBE A;  4GH9 A;  4IJE A;  5BPV A;  4IBI A;  3FKE A;  3L27 A;  4IBD A;  4IBC A;  4GHL A;  3L29 A;  4IBG A;  3KS4 A;  3L2A A;  4GHA A;  3L26 A;  4IBF A;  4LG2 A;  4IBK A;  3L25 A;  4IBB A;  4IBJ A;  3KS8 A; 
#chains in the Genus database with same CATH topology
 4JI5 M;  3L28 A;  4L4U A;  4QOZ C;  3K9O A;  2DAI A;  3TPZ A;  2BJV A;  4G6Z A;  4LJ4 A;  5FTK A;  5KQ8 A;  3MMP A;  2APL A;  4IBI A;  2CHV A;  3KW6 A;  5L8R F;  3E9S A;  2O5R A;  2KRU A;  4PCZ A;  4G4R A;  4IBC A;  3SAT A;  2KXE A;  1LTM A;  3I51 A;  4LJ8 A;  1VDD A;  2XZU A;  4AI6 A;  1V34 A;  3C9P A;  1Q39 A;  5EXP A;  3FUU A;  5C1B A;  3GLF B;  4Z8X A;  3VK7 A;  1W5T A;  3F92 A;  2XSZ A;  1TH2 A;  1C1K A;  2HCB A;  3J2P B;  4F1I A;  4Z6Y A;  2CFO A;  4DV6 M;  1HJP A;  1HR0 M;  2Y0Q A;  4B3T M;  2B3T A;  2L7H A;  2FE8 A;  3FD9 A;  1WGL A;  1DO2 A;  1Q02 A;  2W82 A;  2DKL A;  2KEB A;  2XH9 A;  3BXW A;  1GXD A;  4FCW A;  4HME A;  4XK8 F;  4OJ5 A;  1KSF X;  5EXS A;  4LFA M;  4EIW A;  1L1T A;  2DAG A;  2UU9 M;  2Y2H A;  4TX8 A;  3AOE A;  2J5Y A;  2L2D A;  4YY3 M;  2KNZ A;  4DR3 M;  2JZ1 A;  4AKH A;  4LZJ A;  4W5W A;  1YUE A;  4OUI A;  1OTR A;  3GLH E;  1IN7 A;  1G3I A;  2QZ4 A;  1OJL A;  2XD5 A;  3KP0 E;  4PDG A;  1PDC A;  2RGO A;  3UGJ A;  5ITU A;  4B3M M;  3PNY A;  1W1T A;  3U60 B;  2DWM A;  2XSZ D;  3GQ4 A;  2L09 A;  1G59 A;  1FNN A;  1YU4 A;  4LF4 M;  2HKJ A;  4UN2 B;  3HY5 A;  2V1U A;  5ITX A;  3ZCB B;  5BR8 M;  1ZAE A;  2Y2Q A;  2Y2M A;  2K9D A;  3J80 S;  2DNA A;  3SAR A;  1D0L A;  2O01 F;  4HMD A;  4RNA A;  1N36 M;  1JR3 E;  2QNJ A;  2Y2L A;  4Z2L A;  3H4J A;  1LV7 A;  4LF7 M;  4M9S A;  3SHF A;  3KOW E;  3QWL A;  2M60 A;  2KNA A;  1QAN A;  4CGY B;  4GKK M;  1QAO A;  4NRW A;  1UR8 A;  1RU3 A;  1YU1 A;  1J09 A;  3FKE A;  3VDU A;  1T6O A;  1ZV1 A;  3CF0 A;  3E21 A;  4ANR A;  5KO3 A;  1L2C A;  4Z2J A;  1CXW A;  1TH3 A;  2JY6 B;  2QHO B;  4NC6 A;  2Y2O A;  3VFD A;  1DGG A;  2AHM A;  1G71 A;  4REZ A;  1UM8 A;  2LTU A;  4FVM A;  5EP1 A;  3FUW A;  4OU7 A;  1T43 A;  1TF0 B;  3A98 B;  1P3Q Q;  3U60 A;  1IBK M;  1XNR M;  1H0I A;  4NL4 H;  3I4Y A;  5GKN A;  2OOB A;  3E46 A;  8CAT A;  5E6J A;  2V5O A;  4L6V 6;  2G3Q A;  2VQF M;  2DZO B;  1WGN A;  4JI8 M;  4NRV A;  3L25 A;  4LGM A;  3U61 B;  2R0I A;  1SG9 A;  2L4E A;  5ITY A;  2FFF B;  2UXD M;  1TDH A;  3A42 A;  4NXN M;  3IEC A;  4LJ9 A;  5KPR A;  1J7M A;  3GO8 A;  1I94 M;  2F5P A;  2C9O A;  3GPX A;  3E4R A;  3GLH B;  2F5O A;  4JI1 M;  3B7N A;  1OQY A;  3NWL A;  3RE8 A;  5H37 D;  4NXM M;  2Y2J A;  1NV9 A;  3HZJ A;  3SAV A;  1NVM A;  1MJG M;  3WD1 A;  3K2L A;  1MX0 A;  4NYY A;  1HT1 E;  3GLG E;  2J7N A;  2YR0 A;  2YQZ A;  4PD2 A;  2CV2 A;  3CGW A;  3GLF E;  1QZM A;  3HJS A;  4B7F A;  3DFZ A;  4D80 A;  1E6Z A;  3T6P A;  1D0M A;  2IOU A;  2F5S A;  1XMO M;  4CIZ A;  2JXN A;  1OFH A;  2Z4R A;  3D8L A;  2VF8 A;  4OW0 A;  1R7R A;  4DR7 M;  4S12 A;  2RKO A;  5FLX S;  5LMU M;  3R9X B;  1V92 A;  3LQQ A;  5IRE B;  2YFQ A;  3OTO M;  1KFV A;  3PVS A;  2BWB A;  4MB4 A;  1GVN A;  1ZMV A;  3SHG B;  3R8F A;  4IBD A;  3FE3 A;  3GLH A;  2Y2P A;  4IIW A;  5JI2 E;  3U6C A;  1GKI A;  1NNU C;  4IBG A;  7CAT A;  2C98 A;  5FSW A;  1QO6 A;  2Y2K A;  2DWZ B;  2Z7J A;  1XWI A;  2CRU A;  2K6B A;  2R6F A;  3IHP A;  2JA2 A;  4GHA A;  2Z4S A;  1L6J A;  2EKF A;  1PRB A;  4HLQ A;  1XNQ M;  1GJT A;  3U6S A;  2CEA A;  4KO8 A;  2QSF X;  4IBF A;  1E94 E;  4QNM A;  5E26 A;  2RTS A;  4IBK A;  3N3F A;  1IN4 A;  2YNM D;  3K92 A;  4IBB A;  1KYI A;  2FNA A;  1R5L A;  4NZ4 A;  2MGW A;  2D49 A;  1HQC A;  4DR6 M;  1JR3 A;  4GC9 A;  3T38 A;  3TWK A;  2XLJ A;  2JCH A;  1QVR A;  3ZC7 B;  4RKU F;  4LF6 M;  4L78 A;  1TR8 A;  4OJP A;  4DBG B;  4LF9 M;  2V1C A;  2J7O A;  3MK6 A;  5FTJ A;  4M9Z A;  2XZF A;  1GLN A;  2JWS A;  1QAM A;  2KW0 A;  2P5T A;  4M0D A;  1PJT A;  4MGH A;  3RGP A;  3HU2 A;  1NV8 A;  2DZL A;  1W1P A;  2JZ0 A;  3KS4 A;  2DZN B;  4X62 M;  3ZQJ A;  2R44 A;  2EJS A;  1JQJ C;  3GLG B;  1W5S A;  1UFZ A;  3LMM A;  3AV0 A;  3GRV A;  3A46 A;  1GL6 A;  1V33 A;  4DV2 M;  5EP3 A;  1IXR C;  4OVZ B;  2JY7 A;  3KSX A;  2F5Q A;  1IM2 A;  4B3R M;  1EAK A;  2UUA M;  4LFC M;  1R6B X;  1VEK A;  2QQ8 A;  3THG A;  1AUA A;  3VDP A;  1JR3 D;  1DGB A;  3M6A A;  5ITR A;  4JV5 M;  2M5Z A;  5FTM A;  3UZU A;  1XXH B;  4GH9 A;  3AL0 C;  1EIJ A;  1O6I A;  3M0E A;  2HL7 A;  5DFL A;  3FYC A;  3RFW A;  4AW4 A;  2OQ4 A;  3B7Q A;  2MRO B;  5KPZ A;  2CV1 A;  4QOS A;  2C96 A;  2I7N A;  1VEJ A;  4NZ5 A;  4NOO B;  3TQS A;  3PFI A;  2HWJ A;  3GLG A;  2JNH A;  4DV0 M;  1C7Y A;  1CK7 A;  3GLF A;  4DV1 M;  1IQP A;  1L8Q A;  3C58 A;  2LNH C;  4GKJ M;  1UR9 A;  2L6O A;  4L15 A;  3NBI A;  3J7A S;  3KS8 A;  2FFJ A;  3ILK A;  4P17 A;  2DHY A;  1WIV A;  2R45 A;  4KHP M;  2L4F A;  2UXB M;  3VKG A;  2DEN A;  3GP1 A;  1R4G A;  4IBE A;  4Y28 F;  3JR4 A;  2ZM6 M;  4MB3 A;  1XXH A;  3LCV B;  3SBJ A;  1QDR A;  3HWS A;  1ZMW A;  4I4L A;  4IJE A;  2UUB M;  5FTL A;  3BOS A;  3L27 A;  4YHH M;  2LXE A;  1PGY A;  3HX3 A;  3FRI A;  4LJ7 A;  1ZQ9 A;  2K47 A;  2LVQ D;  3SFZ A;  4A3V B;  1S3S A;  5DNY A;  3T1H M;  3DA1 A;  5DYI A;  1TTE A;  4Z2I A;  2JY8 A;  4CIS A;  1N33 M;  3EIE A;  2EUC A;  1SXJ E;  3SYK A;  3W0F A;  2VF7 A;  5EP2 A;  4QHT A;  4MGK E;  1QZE A;  4NSR A;  1Z5C A;  1ED7 A;  3AJI B;  4L16 A;  5KPT A;  4XBO A;  4GMQ A;  3GLI E;  1I4W A;  2H1R A;  2GNO A;  5IT9 S;  5IZ7 D;  1GO5 A;  4B08 A;  1OIZ A;  3SMP A;  2DXI A;  2UUC M;  1N34 M;  4OJL A;  3KOX E;  4NZ1 A;  3T15 A;  2DAE A;  4DV7 M;  1E8B A;  3KOY E;  4MH0 E;  1W1V A;  3MQL A;  2R18 A;  1VEG A;  3AOG A;  2D7G A;  4Z2G A;  3KSJ A;  4FD2 A;  1J7K A;  4AZF A;  2DWL A;  3AKZ A;  2XFT A;  3LQR A;  1AIP C;  2XEP A;  4WUR A;  3GPP A;  4GHL A;  3B7Z A;  1HNX M;  1X37 A;  2KHH A;  3SAS A;  1YU3 A;  4BLC A;  2Y2G A;  1PJQ A;  4R71 A;  3CTW B;  5A2Q S;  2LVN C;  4NYU A;  2DHR A;  2CWB A;  2X49 A;  3LW5 F;  4I5S A;  4X65 M;  4OJO A;  2VDB B;  3I04 M;  3FTD A;  3U6O A;  3FTC A;  2KA6 B;  3RGS A;  1QDT A;  2OPF A;  2QBY B;  3U61 A;  1D2N A;  2RRU A;  4TUW A;  2ZBK B;  4LRT A;  3MHV C;  1A5T A;  2LBC A;  2NQ8 C;  3V76 A;  1XXH E;  4M0W A;  3SAU A;  1W1Y A;  2JE5 A;  1NSF A;  2LVA A;  4NY2 A;  4OJ6 A;  3U6D A;  1ZMU A;  2MH8 A;  3UK6 A;  1N75 A;  1YSY A;  4F2L A;  3TE6 A;  5LMN M;  2Y20 A;  1K3W A;  1DGH B;  2OO9 A;  2Q2E B;  1HNW M;  1IFY A;  3WD0 A;  1K82 A;  1HQY E;  4G4N A;  1SXJ B;  4G4Q A;  4FCV A;  1IY2 A;  4ZPX A;  1NHW C;  2G5G X;  5EJC A;  3SMS A;  1J5E M;  3GRR A;  4AG5 A;  3U6L A;  4GRI A;  3GLI B;  4GEW A;  3B89 A;  3B9P A;  2XF3 A;  1IBM M;  3WD3 A;  1CUK A;  1E32 A;  1QQW A;  4LGY A;  4MGI E;  2QCU A;  2R4J A;  4WP2 A;  4JI7 M;  4JN6 A;  4JI3 M;  3TWM A;  1GPF A;  4B7G A;  3UJN A;  1GL7 A;  3NBX X;  2Y2N A;  4OX9 M;  2QEN A;  1YUB A;  2MR9 A;  2Y0T A;  3B74 A;  4RF0 A;  4I8O A;  1GJS A;  4BBA A;  4LF8 M;  5EP4 A;  3L29 A;  3AOE C;  4R3D A;  4D82 A;  2DI0 A;  1PM5 A;  1DGH A;  2BJW A;  3LVW A;  4P16 A;  4QHS A;  2ZAN A;  3W0L B;  1XC8 A;  3JAM S;  3U6E A;  1Z5A A;  3CF6 E;  4JI2 M;  2Z8Y M;  1SXJ A;  4KOD A;  4DUZ M;  1QUS A;  5C18 A;  1Q3C A;  1PJS A;  1XMQ M;  3U5Z B;  4QNL A;  3WD4 A;  1AIW A;  1VQ1 A;  2ZTC A;  3GLI A;  1T3T A;  1Z5B A;  3FTE A;  1H0G A;  1EE8 A;  1NHG C;  2VII A;  4LJ5 A;  3CF2 A;  3J81 S;  3H4M A;  2OOA A;  3AFH A;  3IG5 A;  4IJF A;  3Q8X A;  4LJA A;  3KDS E;  3GRU A;  1NY5 A;  1OFI A;  3HGI A;  2X8A A;  1DV0 A;  1E88 A;  5F3W A;  1DO0 A;  2LWX A;  1QUT A;  1OAI A;  2V6Z M;  4DV4 M;  4Q7J A;  2LHG A;  3VKH A;  5ITQ A;  1VDL A;  1QAQ A;  3WHK A;  1N77 A;  2RGH A;  3I4V A;  2GQF A;  1SXJ D;  2R65 A;  1WJ7 A;  3HON A;  2F4V M;  4RF1 A;  4KLN A;  4LF5 M;  2Z3X A;  1BVS A;  4B3S M;  1OGG A;  2K0B X;  1IN6 A;  4LG2 A;  5KQD A;  1VG5 A;  2LVO C;  4OVZ A;  4NSO B;  2CP8 A;  3U5Z A;  2E5L M;  1K3X A;  1OIP A;  1IXZ A;  4LRS A;  2BNK A;  2WZJ A;  3KVW A;  1E6R A;  2F5N A;  3D8B A;  1ORY B;  1OAO C;  3U6P A;  1H8P A;  4AQY M;  1G4A E;  3J7B A;  2WSC F;  1IN5 A;  1E9S A;  3EIH A;  3QAU A;  5JI3 E;  3BBZ A;  1WR1 B;  2BG1 A;  1Z6T A;  3UMM A;  4X66 M;  1EFU B;  2WSE F;  2JUJ A;  3HHZ A;  1DGF A;  5ITT A;  4DR5 M;  1IBL M;  3QYB A;  5EXT A;  2Y2I A;  3U6M A;  3FUV A;  3SC3 A;  5IWA M;  2VQE M;  2CV0 A;  3HJQ A;  4G4O A;  2KZU A;  4MB5 A;  3C3E A;  2KNV A;  2N35 A;  3LCU A;  2KRK A;  4GIT A;  4DV5 M;  3I01 M;  3JR5 A;  4FCT A;  4HMC A;  2EO2 A;  2XFS A;  3DOA A;  1E6N A;  1TGU A;  3DZD A;  3FRH A;  4K0K M;  2H5X A;  3GPY A;  3HKP A;  3TL4 X;  2EKK A;  3FUT A;  3HHW A;  2LVP C;  2D7E A;  4MGY E;  3KOZ E;  2DWN A;  2HHH M;  3KFU G;  3GQ3 A;  2FS1 A;  4DR2 M;  1PJJ A;  1PJI A;  1HNZ M;  2CE7 A;  4PT5 A;  4ITQ A;  3K8Z A;  3C3D A;  1YU2 A;  4Z2H A;  3LVV A;  3HHX A;  5BPV A;  4WW0 A;  3TWL A;  1NJF A;  4JI6 M;  1NO1 A;  3IG8 A;  3M7P A;  3ZH9 B;  2EA0 A;  1YLA A;  4BB9 A;  1Q3B A;  4M9X A;  2DVW B;  3W68 A;  2C9C A;  1L1Z A;  3K1J A;  2ZAM A;  1G41 A;  4MGZ E;  4HL4 A;  3K9P A;  1KS0 A;  2A5Y B;  4DR1 M;  1E15 A;  1Z59 A;  1R2Z A;  2HAK A;  4FWG A;  5EQT A;  4GIP A;  4AKI A;  1FJG M;  4B7H A;  2FOI C;  4IBJ A;  2Y21 A;  2DAM A;  1OGB A;  1WHC A;  3HJ8 A;  3KXE C;  2JY5 A;  2ZAO A;  2LHC A;  1TDZ A;  1IY0 A;  3M7G A;  3GQ5 A;  3U6Q A;  2UWX A;  2FN2 A;  2LH0 A;  1HT2 E;  4DR4 M;  2CUZ A;  2G8L A;  3A45 A;  4DV3 M;  3Q8G A;  2I7P A;  1TH4 A;  4G3O A;  2FH0 A;  3SAW A;  4JI4 M;  1IXS B;  2C99 A;  4Z2K A;  3WD2 A;  4FW9 A;  4LZZ A;  1JB0 F;  1WXQ A;  2L7I A;  2QP9 X;  2UXC M;  1XHB A;  2ERC A;  1E9R A;  3L2A A;  4AG6 A;  3GPU A;  1IY1 A;  2DAK A;  4KT0 F;  4II7 A;  4JI0 M;  1Y8G A;  3PNV A;  2C5R A;  3FTF A;  1GOI A;  4QNR A;  2X4A A;  2R46 A;  4MB7 A;  3HU3 A;  4FWH A;  4LJ6 A;  5ITX E;  2WSF F;  3HU1 A;  3VLF B;  3W67 A;  1N78 A;  1NNJ A;  3WHL A;  1L2B A;  2QPA A;  3FUX A;  5DYG A;  3VK8 A;  2D7H A;  1SXJ C;  2ZTD A;  1NY6 A;  4X64 M;  1G8P A;  4I81 A;  3GRY A;  1N32 M;  4GC5 A;  3HSH A;  2QBY A;  4JXJ A;  4LCB A;  1OKS A;  2O25 A;  1F4I A;  3KP1 E;  3SYL A;  1NJG A;  1R2Y A;  2BWE A;  3MJ5 A;  1D0K A;  1XB2 B;  2R62 A;  2R4E A;  2CHQ A;  1IXS A;  2CHG A;  2XGN A;  4CJ6 A;  2XD1 A;  1YE9 A;  1MN3 A;  1GAB A;  2KZS A;  4D81 A;  4LFB M;  3J27 B;  4CHT B;  1QYR A;  4AKG A;  5FTN A;  1L2D A;  1E6P A;  4PDI A;  3PXG A;  5EXX A;  3L26 A;  1MU5 A;  3HHY A;  1YU0 A;  4L8R C;  3T1Y M;  3FYD A;  2KDL A;  3QYE A;  4HEO A;  4XGI A;  2MJ5 B;  4MM3 B;  4LY6 A;  2JP7 A;  4NZ3 A;  4FWD A;  4R7G A;  4DUY M;  4JYA M;  1H6U A;  1IN8 A;  3WX7 A; 
#chains in the Genus database with same CATH homology
 4JI5 M;  3L28 A;  4L4U A;  4QOZ C;  3TPZ A;  2BJV A;  4G6Z A;  4LJ4 A;  5FTK A;  5KQ8 A;  4IBI A;  2CHV A;  3KW6 A;  3E9S A;  2O5R A;  2KRU A;  4PCZ A;  4G4R A;  4IBC A;  3SAT A;  2KXE A;  2XZU A;  3I51 A;  4LJ8 A;  1VDD A;  4AI6 A;  1Q39 A;  5EXP A;  3FUU A;  5C1B A;  3GLF B;  4Z8X A;  3VK7 A;  1W5T A;  2XSZ A;  1TH2 A;  1C1K A;  2HCB A;  3J2P B;  4Z6Y A;  2CFO A;  4DV6 M;  1HR0 M;  2Y0Q A;  4B3T M;  2L7H A;  2FE8 A;  3FD9 A;  1DO2 A;  2W82 A;  2KEB A;  2XH9 A;  4FCW A;  4OJ5 A;  1KSF X;  5EXS A;  4LFA M;  4EIW A;  1L1T A;  2UU9 M;  2Y2H A;  3AOE A;  4YY3 M;  4DR3 M;  4AKH A;  1YUE A;  4LZJ A;  4W5W A;  4OUI A;  1IN7 A;  1G3I A;  2QZ4 A;  1OJL A;  2XD5 A;  3KP0 E;  4PDG A;  2RGO A;  3UGJ A;  5ITU A;  4B3M M;  3PNY A;  3U60 B;  2DWM A;  2XSZ D;  3GQ4 A;  2L09 A;  1G59 A;  1FNN A;  1YU4 A;  4LF4 M;  2HKJ A;  2V1U A;  5ITX A;  3ZCB B;  5BR8 M;  1ZAE A;  2Y2Q A;  2Y2M A;  3J80 S;  3SAR A;  4RNA A;  1N36 M;  2Y2L A;  1LV7 A;  4LF7 M;  4M9S A;  3SHF A;  3KOW E;  3QWL A;  2M60 A;  1QAN A;  4CGY B;  4GKK M;  1QAO A;  4NRW A;  1YU1 A;  1J09 A;  3FKE A;  3VDU A;  1L2C A;  3CF0 A;  5KO3 A;  1TH3 A;  2Y2O A;  3VFD A;  1DGG A;  2AHM A;  4REZ A;  1UM8 A;  4FVM A;  5EP1 A;  4OU7 A;  3FUW A;  3U60 A;  3A98 B;  1IBK M;  1XNR M;  4NL4 H;  3I4Y A;  5GKN A;  8CAT A;  5E6J A;  2VQF M;  2DZO B;  4JI8 M;  3L25 A;  4NRV A;  4LGM A;  3U61 B;  5ITY A;  2FFF B;  2UXD M;  1TDH A;  3A42 A;  4NXN M;  4LJ9 A;  5KPR A;  3GO8 A;  1I94 M;  2F5P A;  2C9O A;  3GPX A;  3E4R A;  3GLH B;  2F5O A;  4JI1 M;  3NWL A;  3RE8 A;  4NXM M;  5H37 D;  2Y2J A;  3SAV A;  1NVM A;  3K2L A;  1MX0 A;  4NYY A;  1HT1 E;  2J7N A;  2YR0 A;  2YQZ A;  4PD2 A;  1QZM A;  3HJS A;  4B7F A;  3DFZ A;  4D80 A;  2IOU A;  2F5S A;  1XMO M;  2Z4R A;  1OFH A;  3D8L A;  4OW0 A;  1R7R A;  4DR7 M;  4S12 A;  2RKO A;  5FLX S;  5LMU M;  3R9X B;  3LQQ A;  5IRE B;  2YFQ A;  3OTO M;  1KFV A;  3PVS A;  1GVN A;  3R8F A;  3SHG B;  4IBD A;  3GLH A;  2Y2P A;  4IIW A;  5JI2 E;  3U6C A;  1GKI A;  1NNU C;  4IBG A;  7CAT A;  2C98 A;  5FSW A;  2Y2K A;  2DWZ B;  2Z7J A;  1XWI A;  2JA2 A;  4GHA A;  2Z4S A;  4HLQ A;  1XNQ M;  3U6S A;  2CEA A;  4KO8 A;  4IBF A;  3N3F A;  1E94 E;  4QNM A;  5E26 A;  4IBK A;  1IN4 A;  2YNM D;  3K92 A;  4IBB A;  1KYI A;  2FNA A;  4NZ4 A;  1HQC A;  4DR6 M;  1JR3 A;  4GC9 A;  3T38 A;  3TWK A;  2XLJ A;  2JCH A;  1QVR A;  3ZC7 B;  4LF6 M;  4L78 A;  4OJP A;  4LF9 M;  2V1C A;  2J7O A;  3MK6 A;  5FTJ A;  4M9Z A;  2XZF A;  1GLN A;  2P5T A;  1QAM A;  2KW0 A;  4M0D A;  4MGH A;  3RGP A;  3HU2 A;  3KS4 A;  2DZN B;  4X62 M;  1JQJ C;  3GLG B;  1W5S A;  3LMM A;  3AV0 A;  3GRV A;  3A46 A;  1GL6 A;  4DV2 M;  5EP3 A;  1IXR C;  4OVZ B;  3KSX A;  2F5Q A;  1IM2 A;  4B3R M;  2UUA M;  4LFC M;  1R6B X;  3VDP A;  3THG A;  1JR3 D;  1DGB A;  3M6A A;  5ITR A;  4JV5 M;  2M5Z A;  5FTM A;  3UZU A;  1XXH B;  4GH9 A;  3AL0 C;  3M0E A;  2HL7 A;  3FYC A;  3RFW A;  4AW4 A;  2OQ4 A;  5KPZ A;  2CV1 A;  4QOS A;  2C96 A;  2I7N A;  4NZ5 A;  4NOO B;  3TQS A;  3PFI A;  3GLG A;  4DV0 M;  3GLF A;  4DV1 M;  1IQP A;  1L8Q A;  3C58 A;  2LNH C;  4GKJ M;  2L6O A;  4L15 A;  3NBI A;  3J7A S;  3KS8 A;  2FFJ A;  3ILK A;  2R45 A;  4KHP M;  2UXB M;  3VKG A;  3GP1 A;  4IBE A;  3JR4 A;  2ZM6 M;  1XXH A;  3SBJ A;  3HWS A;  4IJE A;  4I4L A;  2UUB M;  5FTL A;  3BOS A;  3L27 A;  4YHH M;  2LXE A;  4LJ7 A;  3SFZ A;  1ZQ9 A;  2K47 A;  4A3V B;  1S3S A;  5DNY A;  3T1H M;  3DA1 A;  5DYI A;  4CIS A;  1N33 M;  3EIE A;  2EUC A;  1SXJ E;  3SYK A;  3W0F A;  5EP2 A;  4QHT A;  4MGK E;  4NSR A;  1Z5C A;  3AJI B;  4L16 A;  5KPT A;  4XBO A;  4GMQ A;  1I4W A;  2H1R A;  5IT9 S;  4OJL A;  5IZ7 D;  4B08 A;  2DXI A;  3SMP A;  2UUC M;  1N34 M;  3KOX E;  4NZ1 A;  3T15 A;  4DV7 M;  3KOY E;  4MH0 E;  2R18 A;  3AOG A;  2D7G A;  3KSJ A;  4FD2 A;  1J7K A;  4AZF A;  2DWL A;  3AKZ A;  2XFT A;  3LQR A;  4WUR A;  2XEP A;  3GPP A;  4GHL A;  1HNX M;  1X37 A;  3SAS A;  1YU3 A;  4BLC A;  2Y2G A;  3CTW B;  5A2Q S;  4NYU A;  2DHR A;  4I5S A;  2X49 A;  4OJO A;  4X65 M;  3U6O A;  3FTD A;  3FTC A;  2KA6 B;  3RGS A;  2OPF A;  2QBY B;  3U61 A;  1D2N A;  4TUW A;  2ZBK B;  4LRT A;  3MHV C;  2NQ8 C;  2JE5 A;  4M0W A;  3SAU A;  1NSF A;  4NY2 A;  4OJ6 A;  3U6D A;  3UK6 A;  1N75 A;  1YSY A;  3TE6 A;  5LMN M;  2Y20 A;  1K3W A;  1DGH B;  2Q2E B;  1HNW M;  1K82 A;  1HQY E;  4G4N A;  1SXJ B;  4G4Q A;  4FCV A;  1IY2 A;  4ZPX A;  1NHW C;  2G5G X;  5EJC A;  3SMS A;  1J5E M;  3GRR A;  4AG5 A;  3U6L A;  4GRI A;  3GLI B;  3B9P A;  2XF3 A;  1IBM M;  1E32 A;  1QQW A;  4LGY A;  4MGI E;  2QCU A;  2R4J A;  4JI7 M;  4JN6 A;  4JI3 M;  3TWM A;  4B7G A;  3UJN A;  1GL7 A;  2Y2N A;  4OX9 M;  2QEN A;  1YUB A;  2Y0T A;  4RF0 A;  4I8O A;  4BBA A;  4LF8 M;  5EP4 A;  3L29 A;  3AOE C;  4R3D A;  4D82 A;  1PM5 A;  1DGH A;  2BJW A;  3LVW A;  4P16 A;  4QHS A;  2ZAN A;  3W0L B;  1XC8 A;  3JAM S;  3U6E A;  1Z5A A;  3CF6 E;  4JI2 M;  1SXJ A;  4KOD A;  4DUZ M;  5C18 A;  1Q3C A;  1XMQ M;  3U5Z B;  4QNL A;  3GLI A;  3FTE A;  1T3T A;  1Z5B A;  1EE8 A;  1NHG C;  2VII A;  4LJ5 A;  3CF2 A;  3J81 S;  3H4M A;  3AFH A;  3IG5 A;  4IJF A;  3Q8X A;  4LJA A;  3KDS E;  3GRU A;  1NY5 A;  1OFI A;  3HGI A;  2X8A A;  5F3W A;  1DO0 A;  2LWX A;  2V6Z M;  4DV4 M;  3VKH A;  5ITQ A;  1QAQ A;  3WHK A;  1N77 A;  2RGH A;  3I4V A;  2R65 A;  1SXJ D;  3HON A;  2F4V M;  4RF1 A;  4KLN A;  4LF5 M;  2Z3X A;  4B3S M;  1IN6 A;  4LG2 A;  5KQD A;  4OVZ A;  4NSO B;  3U5Z A;  2E5L M;  1K3X A;  1IXZ A;  4LRS A;  2BNK A;  3KVW A;  2F5N A;  3D8B A;  1ORY B;  3U6P A;  4AQY M;  1G4A E;  3J7B A;  3QAU A;  1IN5 A;  1E9S A;  3EIH A;  5JI3 E;  2BG1 A;  1Z6T A;  3UMM A;  4X66 M;  3HHZ A;  4DR5 M;  1DGF A;  5ITT A;  1IBL M;  5EXT A;  2Y2I A;  3U6M A;  3FUV A;  3SC3 A;  5IWA M;  2VQE M;  2CV0 A;  3HJQ A;  4G4O A;  2KZU A;  2KRK A;  4GIT A;  4DV5 M;  3JR5 A;  4FCT A;  2EO2 A;  2XFS A;  3DOA A;  1TGU A;  3DZD A;  4K0K M;  3GPY A;  3HKP A;  3TL4 X;  3FUT A;  3HHW A;  2D7E A;  4MGY E;  3KOZ E;  2DWN A;  2HHH M;  3KFU G;  3GQ3 A;  4DR2 M;  1PJJ A;  1PJI A;  1HNZ M;  2CE7 A;  4PT5 A;  4ITQ A;  3K8Z A;  1YU2 A;  3LVV A;  3HHX A;  5BPV A;  4WW0 A;  3TWL A;  1NJF A;  4JI6 M;  3IG8 A;  3ZH9 B;  2EA0 A;  4BB9 A;  1Q3B A;  4M9X A;  2DVW B;  2C9C A;  1L1Z A;  3K1J A;  2ZAM A;  1G41 A;  4MGZ E;  4HL4 A;  2A5Y B;  4DR1 M;  1Z59 A;  1R2Z A;  4FWG A;  5EQT A;  4AKI A;  4GIP A;  1FJG M;  4B7H A;  2FOI C;  4IBJ A;  2Y21 A;  3HJ8 A;  3KXE C;  2ZAO A;  1TDZ A;  1IY0 A;  3M7G A;  3GQ5 A;  3U6Q A;  2UWX A;  2LH0 A;  1HT2 E;  4DR4 M;  2CUZ A;  2G8L A;  3A45 A;  4DV3 M;  2I7P A;  1TH4 A;  4JI4 M;  3SAW A;  1IXS B;  2C99 A;  4FW9 A;  4LZZ A;  1WXQ A;  2L7I A;  2QP9 X;  2UXC M;  1XHB A;  2ERC A;  1E9R A;  3L2A A;  4AG6 A;  3GPU A;  1IY1 A;  2C5R A;  4JI0 M;  4II7 A;  2CV2 A;  3FTF A;  3PNV A;  4QNR A;  2X4A A;  2R46 A;  4MB7 A;  3HU3 A;  4FWH A;  4LJ6 A;  5ITX E;  3HU1 A;  3VLF B;  1N78 A;  1NNJ A;  3WHL A;  1L2B A;  2QPA A;  3FUX A;  5DYG A;  3VK8 A;  2D7H A;  1SXJ C;  4X64 M;  1NY6 A;  1N32 M;  1G8P A;  4I81 A;  3GRY A;  3HSH A;  4GC5 A;  2QBY A;  4JXJ A;  4LCB A;  3KP1 E;  3SYL A;  1NJG A;  1R2Y A;  3MJ5 A;  2R62 A;  2R4E A;  2CHQ A;  2CHG A;  2XGN A;  2XD1 A;  1YE9 A;  2KZS A;  4D81 A;  4LFB M;  3J27 B;  4CHT B;  1QYR A;  4AKG A;  5FTN A;  1L2D A;  4PDI A;  3PXG A;  5EXX A;  3L26 A;  1MU5 A;  3HHY A;  1YU0 A;  4L8R C;  3T1Y M;  3FYD A;  4XGI A;  4MM3 B;  4LY6 A;  4NZ3 A;  4FWD A;  4R7G A;  4DUY M;  4JYA M;  1H6U A;  1IN8 A;  3WX7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...