2JE5A

Structural and mechanistic basis of penicillin binding protein inhibition by lactivicins
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
683
structure length
461
Chain Sequence
SEITYSDGTDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTNQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Drug-binding protein
molecule keywords PENICILLIN-BINDING PROTEIN 1B
publication title Structural and Mechanistic Basis of Penicillin-Binding Protein Inhibition by Lactivicins
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 147
structure length 461
sequence length 683
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
A PF00912 Transgly Transglycosylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2je5A01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2je5A03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2je5A02
4KZ3A 1E3UA 1HD8A 1K55C 2WADA 4QY6A 3UE0A 3ZVWA 1MBLA 3A3EA 1CK3A 2VGJA 2Z2LB 4JF4A 4RYEA 3S22A 1H5XA 4CJNA 3IF6C 2EX6A 1NXYA 1NZOA 4M3KA 1WYCA 1W5DA 2ZM0A 5E43A 3WRZA 4XXRA 4PM9A 4S2NA 4GD6A 3LO7A 3FKWA 2ZM2A 3M6BA 4OKPA 3G35A 3N4IA 1KDSA 3G34A 5CERA 3ZG9B 3BFEA 3A3IA 2XQZA 1VM1A 3BM6A 3NIAA 3W4OA 1BLPA 2Y55A 5CGWA 3UPNA 3HLEA 5E2EA 3EQVA 1SKFA 2ZQ8A 3M6HA 3MBZA 4A5RA 1IKGA 4OLDA 1PIOA 1DY6A 3IHBA 2JC7A 1Z6FA 3UPOA 2ZQ9A 5TFQA 3ZNYA 3E2LA 3LY3A 2DNSA 2HPBA 4NK3A 2CC1A 2WGWA 3Q1FA 2QZ6A 3B3XA 4OPYA 1ZG4A 2DRWA 1XX2A 3NDEA 4ZJ2A 1CEFA 1S0WA 4DKIA 4RX3A 1FSYA 4ZDXA 1ZC2A 5I94A 4P6BA 4BL3A 2R9WA 1MWSA 1XPBA 4OP5A 3ZCZA 1U60A 3BYDA 5GLBA 4EWFA 4F94A 1YT4A 2HP9A 3C4OA 1KVLA 3BFDA 1YLJA 3UPPA 4QJGA 1L0GA 4E3OA 4Y0UA 2V1ZA 2EXAA 3RXXA 3GRJA 4IBRA 3RJUA 4S2NC 1IYQA 1FOFA 1QMEA 4S2JA 4U0TA 4WBGA 4O7DA 4X69A 2XK1A 1FQGA 3WS1A 2H10A 1L0EA 4N9KA 4ZTKA 4OOYA 2Y91A 5EVIA 1ES3A 2WGWB 3OPHA 4E3LA 2HP5A 2WKIA 3V39A 2GDNA 1IYPA 3ZG7B 4ID4A 3WS4A 1YLYA 3AGFA 3GV9A 2XD5A 4S2MA 5TGFA 4MEZA 3FV7A 1JTGA 3HLDA 4K0WA 5FAQA 5EOOA 1K55A 4R0QA 2J9PA 1MWUA 4GZBA 1LL9A 1I2WA 2V20A 3G32A 2EXBA 5DF7A 5EECA 1KGFA 3OPRA 4X6TA 4ZAMA 1XKZA 1KDWA 4K91A 5HFOA 2J9OA 5FATA 2Y4AA 3C4PA 4JXGA 3SH8A 1Q2QA 2PBYA 2ZC5B 3VFFA 1K4EA 1K4FA 1PW1A 4JPMA 4WM9A 5EVIB 3CMZA 3NC8A 4HBTA 3V3RA 4D2OA 3HLGA 1ALQA 5FI6A 4HBUA 4PM6A 4GN2A 3W4PA 3HLCA 2A49A 2WGIA 4S2KA 5FQ9A 3UO9A 4UAAA 2HP6A 1J9MA 3N7WA 2ZD8A 3PBSA 5E2FA 3GQZA 1YLTA 3Q07A 3G31A 4R23A 1JWZA 3SS5A 3CZDA 5GL9A 4OOMA 2P9VA 4KZAA 3W8KA 5FA7A 3ZG5A 4BLMA 1TDLA 3OC2A 5FQJA 4OH0A 3OPLA 2ZC4B 3ZFZA 3WS5A 3TOIA 5DF9A 1VQQA 2XEPA 5KSCA 4E3IA 1JVJA 3G2ZA 1TEMA 4GDBA 4E3KA 5CHMA 4Y0TA 3VFHA 4UA9A 1EI5A 4MBHA 3AGEA 4JF5A 2ZC3B 3VP3A 3UE1A 3BFCA 4KZ4A 1BSGA 5HW3A 4PPRA 4WZ4A 4FH2A 3PBTA 1JWVA 2Y59A 5M1AA 2Y2NA 1K54A 5AQ9A 1BULA 4IVKA 1BUEA 4WEKA 5A92A 1NYYA 1IEMA 4X68A 3W4QA 5FQIA 4ZBEA 4DE1A 2DCFA 4EV4A 5HX9A 4C3QA 3DW0A 4OPRA 5GLAA 2EX9A 4R1GA 3V50A 3ZNTA 4E6XA 3LEZA 3UDXA 1FR1A 4JXWA 2P9VB 1KE3A 5JYPA 1PWCA 1FCNA 1BLHA 3LCEA 5GHYA 5FAOA 2V2FF 1L2SA 3TSGA 1JWPA 2XF3A 3ZVTA 4R3BA 1DJAA 1YMSA 4EUZA 2WK0A 5HL1A 3UE3A 3QNCA 4QHCA 1L0FA 2HDQA 1DJBA 4S2IA 1WYBA 2WGVA 3GR2A 3V3SA 4BL2A 2XR0A 4FD8A 4S2OA 4X53A 2BLSA 4WEJA 5DTKA 2XD1A 3MZDA 2Q9MA 4KQRA 1SDEA 1WE4A 4YINA 3P09A 3CG5A 3IWOA 5IHVA 3WS0A 5BOHA 2E8IA 3BFGA 1NZUA 4UA7A 5GHXA 5TR7A 3HLWA 4S2PA 4K0XA 4E3JA 2WAEA 1XA7A 1LL5A 3A3FA 1MKIA 1MPLA 3MXRA 3IXGA 5GHZA 3O3VA 5DTTA 2XFTA 2FFFB 1OMEA 1HVBA 1JTDA 1K54C 2HDUA 3S4XA 4KQQA 1RCJA 3Q7ZA 1BZAA 1YM1A 1W79A 1W8YA 4N92A 4KZBA 3MKEA 2Y2PA 3PBQA 4HESA 3HL9A 4XUXA 3VOYA 4EBLA 1XXMA 3FZCA 4OP8A 2ZQAA 2Y2KA 2WKEA 3GMWA 4P85A 2ZQDA 5HAQA 1XP4A 3NCKA 2XLNA 3BRMA 1MXOA 3NI9A 4EBNA 3DWZA 3HLBA 3OCNA 4DE2A 4DDYA 4KQOA 2Y2GA 1PWDA 2X71A 3VSLA 3HREA 1YLPA 4CPKA 5CEBA 4RVAA 1K57A 3VMAA 5CGXA 5AQ7A 3G30A 2Z2MB 1TDGA 2EFUA 1H8ZA 4OQ0A 5CGSA 5AQBA 1BT5A 4Q8IA 2UWXA 1GHMA 4LV3A 4R4RA 1LLBA 5EPHA 4PM8A 3WWXA 3O88A 3MXSA 1LI9A 5FDHA 4P87A 1BTLA 1IYSA 3QHYA 5M18A 1IELA 4UA6A 1PYYA 1IKIA 2Y2HA 4BD1A 3UNWA 3G2YA 1GA0A 4KZ9A 1XGIA 4OONA 2Y2QA 3IXBA 1C3BA 2XH9A 5M19A 4OQIA 3BLSA 1YLWA 2OLVA 5FQQA 2BG1A 1ES4A 2WUQA 4BJPA 5DF8A 1PWGA 3PTEA 3RXWA 3IH8A 1G68A 3PAEA 5CHJA 1PZPA 2ZQCA 3C7VA 4KG6A 1NJ4A 1YQSA 4XUZA 5FI2A 1K38A 1PI5A 5FQMA 5FAPA 3V5MA 3ZG8B 4DRTA 4N1XA 2HDSA 3OCLA 4L0LA 1KGGA 1FSWA 1HZOA 4E3NA 3G4PA 1CI8A 4GB7A 3ITBA 1AXBA 1KGEA 4N9LA 4OPZA 4WELA 2WZZA 1YMXA 3OZHA 4LCMA 5CRFA 4Z9QA 5D3OA 5F1FA 1IYOA 5GLCA 3VP1A 4WMCD 4Y7PA 1PI4A 1TVFA 2R9XA 5CEDA 4WMCA 1K57C 3FWLA 1HTZA 2IWCA 5EE8A 1ES2A 3N8LA 1CEGA 1LI0A 3GVBA 3M2JA 3OPPA 5F82A 4UHUA 1BLSA 4Y0OA 3N6IA 3SS4A 1N4OA 1NYMA 2H5SA 3IT9A 2WZXA 3Q82A 5KMWA 1W7FA 1GCEA 4B88A 1RGZA 3PAGA 1I5QA 4PM5A 4GDNA 4DE3A 1G6AA 4JLFA 4JXSA 3NDGA 5DTSA 1EWZA 4GD8A 4BQMA 2Y2MA 1ESUA 1PZOA 2EX8A 2JBFA 3IH9A 1XGJA 1KE0A 1MWRA 3ISGA 5FI7A 1CI9A 3UN7A 4DXBA 5F1GA 5E2GA 3IXHA 5F83A 1E3UD 2Y2LA 3HUMA 1ONGA 2Y2IA 3ZDJA 3IWQA 3M2KA 1EROA 1LHYA 1DJCA 2P74A 1FR6A 5KZHA 4PMAA 2Y2OA 2PU2A 5EUAA 2EX2A 3MKFA 3BFFA 3LY4A 4RA7A 3DWKA 4BENA 4YFMA 3A3DA 4LENA 5CTMA 4B4ZA 4KENB 3P98A 4S2LA 1KVMA 1N9BA 1FCMA 2VGKA 3ZG0A 5E2HA 3C7UA 3HBRA 4WYYA 2ZJ9A 3O87A 3QNBA 4LV0A 2G2WA 5HARA 3SH7A 3SH9A 2Y2JA 3ZGAB 1RGYA 3MZFA 5JYOA 3SS3A 2QMIA 2IWDA 3A3JA 4KZ6A 5U47A 3GSGA 1M6KA 4IBXA 3MFDA 5GLDA 3VP0A 1ONHA 3C5AA 1GHIA 4JF6A 3SOIA 2XGNA 1Q2PA 1E25A 1NY0A 5CXWA 4KG2A 4U3TA 1ERQA 4QD4A 4MNRA 4KZ5A 4HEFA 3VSKA 3N8SA 2C6WB 3AGDA 3DTMA 3E2KA 3HVFA 3NY4A 4OPQA 4QB8A 4DDSA 2A3UA 2QPNA 4JKTA 2RCXA 4WZ5A 3MZEA 1PW8A 1Y54A 3GTCA 4P0MA 3FYZA 4GNUA 3I7JA 3PBRA 4LV2A 1QMFA 1GA9A 1K56D 1ES5A 2ZC7A 1YLZA 2JCHA 2J7VA 1K56A 3Q7VA 1K6SA 4C75A 2WKHA 5A93A 5EOEA 3BEBA 4N1HA 4LV1A 2XFSA 1H8YA 3IWIA 3IQAA 1E4DA 4OQGA 3HUOA 5FSRA 3N8RA 3UDIA 1K25A 2G2UA 4GKUA 2PU4A 2RL3A 2ZQ7A 4IEDA 5EVLA 2H0TA 4QY5A 5EVID 3HUNA 1S6RA 3PBNA 2EFXA 4R4SA 3D4FA 3ITAA 4KZ7A 5L2FA 1I2SA 4KG5A 4QU3A 3UY6A 5AQAA 5FASA 5A90A 3FKVA 2FFYA 1K6RA 4B4XA 1XA1A 4PM7A 2WYXA 1GHPA 2X02A 3ZHHA 1ERMA 3CJMA 4LCLA 2JE5A 3JYIA 2IWBA 3Q7VB 2C5WB 4MLLA 4X55A 1FCOA 3VP4A 3IF6A 3WRTA 3EQUA 1MWTA 4WZ5C 2Q9NA 5A91A 5HAPA 4EBPA 2B5RA 3S1YA 1SDNA 5CHUA 3UDFA 2WAFA 1O07A 1L0DA 3HLFA 4JXVA 4KZ8A 3BECA 3TG9A 4MBFA 3IHAA 4MBKA 5DVAA 4FSFA 2OV5A 4X56A 1O7EA 2H0YA 4DE0A 3WS2A 4EQIA 4ZJ3A 1ESIA 1RP5A 4E3MA 4U0XA 4BD0A 1ZG6A 4ZJ1A 1BLCA 3IF5A 5CECA 2OLUA 2ZC6B 5CTNA 4DF6A 4FCFA 3NBLA 3PBOA 1SCWA 2I72A 4OOLA 5EVIC 2X01A 4C6YA 4NETA 3VOZA 4DXCA 5KSHA 5J8XA 4JBFA 5HAIA 4OLGA 1MY8A 3IXDA 4IVIA 2ZLYA 2XDMA 2ZM8A 3O86A 4H8RA 3Q81A 4OQHA 4E6WA 3BLMA 3IF6B 4OVDA 1SHVA 2J8YA 4RX2A 1NRFA 1M40A 2HDRA 2ZMAA 4R3JA 1KE4A 1W8QA 2OSUA 4GOGA 5G18A 1ZKJA 5FQKA 3VP2A 4FH4A
chains in the Genus database with same CATH superfamily
2A2LA 1HD8A 4QY6A 1V9YA 3ZVWA 1YSPA 2F2AC 3CPTB 4RYEA 3S22A 2IO5B 3IF6C 4XT2B 2EX6A 4M3KA 2D49A 5E43A 4H9SA 1TZYD 1TZYA 3EG5B 5K5BA 3FKWA 4IBBA 4OKPA 2INWA 3TE8A 3AZMD 3OBFA 3ZG9B 3BFEA 3S7QA 4UUZA 3A3IA 4LG2A 1VM1A 1BFMA 3BM6A 5DJTA 1KU5A 1LSVA 3X1TC 2NQBB 2AROA 3M6HA 3RELB 4CAYB 4OLDA 1PIOA 1Z6FA 1HQ3A 1LSWA 2DNSA 4NK3A 2CC1A 2VEAA 5JRGD 2OWJA 4HJ6A 2HGVA 3RFBA 2DRWA 2HJ9C 3AZGA 1V9ZA 1OT9A 3B6FD 4XUJB 1KX4A 3MSHA 3FC7A 2R9WA 1MWSA 1W1TA 3HJIA 3EPKA 1YSQA 1S4RA 5GLBA 1YT4A 1VEUA 1KVLA 4F3LA 3NQUB 4E3OA 4Y0UA 2F8NB 4IBRA 1TZYC 5HWTA 1P3KA 5DJUA 3AZMC 1ES3A 3MGPB 1P3PD 1VHMA 2W3FA 5BT1D 5DFYA 5TJJA 1XJ3A 2PD7A 3WS4A 1SZVA 3W98A 4Z2MG 3UTBD 5FAQA 5AV6D 3LICA 2D02A 1I2WA 1P3BA 5JRGC 3NJAA 3AV1D 3B6FC 1OGBA 2PDRA 4JXGA 4WU8D 2PBYA 2ZC5B 4R3AA 4DMZA 1ID3A 3T1XA 2DMWA 3W99A 1K4EA 4WM9A 1OTAA 3AZJD 2I9VA 3REJD 1XFNA 4G91B 3REJA 4HBUA 1X0OA 5HPFA 3W4PA 1P3KC 3HLCA 3LYXA 4S2KA 5FQ9A 4UAAA 3AZNB 1J9MA 2ZD8A 3UT9D 5B2JD 2L4RA 3MQOA 3SS5A 1PRQA 3IX4A 1H0GA 2FJ7B 3W8KA 4BLMA 3C30A 3KSYA 1YPRA 1P3PC 5BT1C 3ZFZA 3ICYA 3LI8A 1TEMA 4Y17A 4GDBA 1ZLAD 1STZA 4Z2GA 5BNXA 4IBFA 3UTBC 4UA9A 1EI5A 4MBHA 3MQLA 5CP6B 3V9RB 5HW3A 1P3BC 5M1AA 2Y2NA 1K54A 4IVKA 4GJ4A 4GH9A 3C8CA 3EGDC 3HONA 4EESA 3AV1C 3X1TB 5DNNA 4NG2A 1ID3C 4E6XA 3W99C 4BMWA 2P9VB 5JYPA 1PWCA 3AZED 3REJC 1UR8A 5FAOA 2V2FF 4WU9D 3TSGA 3MQQA 3ZVTA 4FH4A 1DJAA 1YMSA 5HL1A 5C3IB 1DJBA 2QKPA 3GR2A 4Z2IA 5J4EA 3AZLD 2XR0A 3N3FA 2BASA 4DQYB 3AZLA 4IBJA 2Q9MA 4WV4B 4HGAC 1P3ID 3WKJD 1P3IA 3BY9A 3IWOA 3L7HA 2JKTI 4WF0A 1ULYA 3AN2A 5B2IA 3AV2D 5TR7A 3HLWA 3K2NA 3AV2A 4HJ4A 1ZLAC 4K0XA 4E3JA 1P3LB 1TS8A 2CV5D 2CV5A 3O3VA 4H9NB 3CITA 3AZMB 1K54C 4GHIB 4KQQA 1RCJA 2M1CA 5AVBD 1OJGA 3NHQA 1U35A 3VOYA 4KZBA 2Y2PA 2JKGA 4J8XB 2P08A 5DNNC 3FZCA 2M7VA 2ZOIA 1J7MA 2ZQAA 2JSSA 3NI9A 1MXOA 1OGGA 4DE2A 2HF6A 2Y2GA 2X71A 3IBRA 1S32D 5JRGB 4KGCB 2XSSA 4H9PB 3AZLC 3DTEA 4GCZA 4R6LA 3B6FB 5AQ7A 3G30A 1P3IC 3H0MC 1TDGA 3AN2C 4OQ0A 5B2IC 3H7WB 2UWXA 3REHD 5GT0D 3REKA 3AV2C 1Z09A 4CQHA 1HTAA 5GT0A 3REHA 4K08A 5EPHA 4PM8A 3WWXA 5HDSA 2LY8A 5L8MA 5FDHA 3LIFA 2CV5C 2O0YA 4BD1A 1GA0A 3T4SA 3IXBA 5M19A 5F99B 5AVBC 1YLWA 2BG1A 2WUQA 4BJPA 4WNNB 1P3PB 5DF8A 3PTEA 2ZMVA 1G68A 3PAEA 2G5IC 1OTBA 4KG6A 5B1LD 5CPJA 1Q9CA 3MQ0A 5FQMA 5FAPA 2DQNC 4R38A 4N1XA 3UTBB 1GSXA 4Z66D 3G4PA 4E3NA 1CI8A 5AV6B 1AXBA 3OOVA 4KUDA 2WZZA 5CRFA 5F1FA 1IYOA 3C1CD 2KDKA 3FWLA 5TBMA 2LB5A 5AY8D 3AV1B 3M2JA 4HNBA 4Y0OA 4WU8B 1N4OA 3A6NA 1NYMA 2H5SA 3AZJB 1W7FA 3HJKA 3REHC 5GT0C 3C1BD 4DE3A 3C1BA 2PR5A 3BWLA 1G6AA 5DTSA 4GD8A 1XJ4A 1KE0A 1PFLA 3UT9B 5B2JB 5FI7A 5HPIA 2W3GA 4EQ1A 5FUGB 1KX3A 5F83A 3AZHD 4J8VA 3HUMA 1ONGA 2PD8A 1EROA 1LHYA 1DJCA 1PZRA 1F66A 3MGRA 3BY8A 2Y2OA 5EUAA 1P0ZA 3MKFA 4RA7A 1G28A 4J8UA 1ZLAB 4YFMA 5AVCA 3P98A 5EV0A 1N9BA 4Z66C 4ZUXA 3UTAA 5E2HA 1PNEA 1D7EA 3C1CC 4R8PB 5B32D 3L25A 3B42A 3O62D 1ONHA 3A6NC 2PYOA 4PKYA 3H0RC 2XGNA 3VH5T 3AZEB 5B0ZD 4WU9B 3C1BC 5B0ZA 5CXWA 4U3TA 4BWIA 2W1RA 4KZ5A 2ZM5A 5GXQB 1P3FD 3DTMA 3NY4A 4OPQA 1H3OA 5B32G 2QPNA 2V0WA 3JPUA 3MZEA 3WKJB 1PW8A 1YU1A 1S4SA 3UB8A 3WTPE 1Y54A 3MGRC 4NE3A 4P0MA 3FYZA 3WTPD 3WTPA 4HOIA 4H9QB 5B31D 4E44A 3IWIA 3UTAC 1P3MD 3RH8B 2L0WA 3HUOA 3N8RA 4M6BA 4NEED 1K25A 4EO5C 2BYMB 3MNNB 2QHKA 2PU4A 2ZQ7A 2H0TA 2W27A 3LELD 4QY5A 5EVID 3T4JA 5AVBB 3LELA 5B32C 3WD1A 3JVVA 4I38A 4CLCE 4KZ7A 5L2FA 4KG5A 4CLCA 3UY6A 2PYOC 5AQAA 3R45A 2MJ6A 1ACFA 5B0ZC 4P6ZM 3ZHHA 4L9GA 2IWBA 1S32B 4H9RB 3W96A 2C5WB 1P3FC 4MLLA 3MGQD 5A91A 2ZY5A 2VKSA 4IUKA 3REID 4ARZA 1T3UA 3UDFA 1O07A 1IFQA 4KZ8A 3WTPC 3BECA 1T18A 4FSFA 2OV5A 3CPTA 5AV5D 4XT2A 4EQIA 4ZJ3A 4E3MA 3T1QB 5AV5A 4U0XA 1P3MC 1ZG6A 1MC0A 4MB4A 3QP6A 1W63Q 4UPKA 3NBLA 2J3WA 4X1LA 5FEGA 2I72A 5EVIC 3LELC 2X01A 4NETA 4DXCA 1CJFA 1YKDA 2QYBA 3Q81A 1IOUA 5B1LB 3RELD 2NQBA 3D72A 5B24D 3RELA 4CAYA 1ZKJA 5FQKA 4Z66B 3L26A 1E3UA 3C2WA 1K55C 5F6AA 3A3EA 4IBDA 1CK3A 2O9AA 3C1CB 2VGJA 1H8MA 2Z2LB 1NXYA 4YOFA 1W5DA 5AY8B 3MGQC 3EEHA 5G4YA 2VJWA 3REIC 2JKRM 4XUJA 2ZM2A 3EPJA 3T4TA 1D06A 2QJ5A 1F2KA 4HJ3A 3T1SA 3N4IA 1KDSA 1P3AD 4HY8A 4O01A 2IO5C 2L1MA 3NQUA 5AV5C 5FEFA 3W4OA 1BLPA 2Y55A 2F8NA 3HLEA 3H9WA 3A0SA 1IKGA 3DAVA 3AZHB 3ZNYA 3E2LA 1BH9B 3MGSD 1Y28A 3MGPA 5AV8D 4I39A 4H6JB 2NQBC 2D01A 3RELC 4I3AA 3TU4D 5B24C 3VH6W 1FSYA 3AFAD 3PR6A 4BL3A 4EO5B 3VH6A 1U60A 3KYQA 4OJLA 3BFDA 1E6PA 1YLJA 5CPKD 5B32B 4QJGA 3LJAD 2EXAA 3O62B 2J3TC 3UMEA 4XUJC 1EQZD 3WS1A 2H10A 2HUEC 3FDDA 3B6GD 4LRYC 1P3AC 4ZTKA 1UR9A 3B0BA 2OAP1 1NRJA 2WGWB 2HJEA 3KSFA 4L9FA 2Z6CA 1S1ZA 5HL6A 3V39A 1ODVA 1IYPA 3ZG7B 1P3FB 1GSWA 4ID4A 4IJEA 2JKRI 2PYPA 1YLYA 3AZNA 2XD5A 4D60A 4S2MA 3LZ0D 1F5MA 3H82B 2RVQD 3FV7A 3HLDA 4K0WA 3LZ1B 2FJ7D 3MGPC 4R0QA 4BBTA 2FJ7A 1FIKA 2J9PA 1LL9A 5AV8C 5EFWA 2EXBA 4G3VA 3OPRA 4X6TA 3TU4C 5B31B 4NXEA 5AJGA 1P3MB 4MN5A 5HFOA 3AFAC 3EPHA 3SH8A 2DF4C 5CP6A 1K4FA 3V9RA 4HI4A 5EVIB 5CHLB 4HBTA 4D2OA 1H8PA 2W3HA 3HLGA 5CPKC 1ALQA 1H3QA 2WGIA 3X1TA 2HP6A 3F1PB 5E2FA 3Q07A 3G31A 5IT5A 2P9VA 4G91C 2CWEA 5FA7A 4YNRA 3OC2A 3T4KA 3OPLA 4YM6D 1E6RA 3TOIA 4YM6A 1VQQA 4E3IA 3G2ZA 4E3KA 3MGQB 4BBUA 3VFHA 2WKQA 3REIB 3MF0A 3AGEA 4JF5A 2ZC3B 2FJ7C 3VP3A 3BFCA 4WZ4A 2XRNA 3IBJA 1NYYA 5AV5B 1J3WA 3W4QA 2FH5A 1P3LD 4ZBEA 4EV4A 5HX9A 3S7OA 1P3LA 3ZNTA 3FPWA 5CP6C 1FCNA 1BLHA 4H9NA 1TS0A 3LCEA 2Z6DA 3AZMA 1JWPA 4GHIA 2VV6A 4EUZA 2J80A 4J8XD 3UE3A 4QHCA 4Y5FA 4J8XA 5KDMB 1WYBA 2W3EA 1TD5A 5BO0B 3C38A 4BL2A 2ACGA 5B24B 4S2OA 2BLSA 4WEJA 1CF0A 2XD1A 4LRZE 5HWWA 3IX8A 5IHVA 5C3IC 5EM1A 5BOHA 4YM6C 1NZUA 4KGCD 2VA0A 5JRGA 4KGCA 4H9PA 3E4QA 1MKIA 3B6FA 1OT6A 3IXGA 2HUEB 1NLYA 2EWWA 3X1UD 2FFFB 1OMEA 1P3AB 1HVBA 3H7WA 3L29A 1YM1A 4N92A 4EBLA 4JGPA 1XXMA 1P3LC 3T12B 4YWZA 4KUOA 5HAQA 3KXBB 3DWZA 3MGSB 5F99D 4PHTA 5F99A 3WA9D 2VGLM 4KQOA 4J8XC 5AV8B 3WA9A 4WNNA 1P3PA 3TU4B 3S7PA 4AWLC 3KFUG 1NWZA 3MJQA 3NQJB 3AFAB 4Y15A 3UTBA 5AV6A 1GXDA 1P3OB 1BT5A 4KGCC 1CK7A 5CPKB 4LV3A 3LJAB 3O88A 2VV8A 1A7WA 5G49A 5F69A 4Y13A 1LI9A 3QP1A 1BTLA 1EQZB 4HP4A 3AV1A 4E45A 4OJPA 4UA6A 3B6GB 1PYYA 4WU8A 1M19D 4KZ9A 1XGIA 3AZJA 5FQQA 2RIQA 2JKTM 1M18D 5DKKA 2XA7S 3LI9A 1M18A 1PWGA 2PT7A 5CHJA 3U4LP 4NYYA 1PZPA 4XUZA 1PI5A 3V5MA 3UT9A 5B2JA 3LZ0B 4DRTA 2ZY4A 5B33D 1FSWA 3BJNA 5FUGA 4GB7A 3ITBA 5F99C 5HDCA 3PYPA 3WA9C 4IHQA 1YMXA 3OZHA 5D3OA 4Q0IA 3WD3A 1EAKA 2A24B 2R9XA 4MN6A 2IWCA 4O8GA 1ES2A 1ZLAA 3D9YA 3OPPA 5F82A 5GSUD 5AV6C 4UHUA 4ZBJB 3Q82A 5L07A 1RGZA 3PAGA 4R8PD 4R8PA 1KS0A 3NDGA 1H0IA 1XGJA 4WU8C 3DTKA 3ISGA 2HV1A 3FPVA 4JGOA 4QNLA 3UN7A 1M19C 3CUEA 3AZJC 3AZEA 2P74A 3KSGA 1M18C 4WU9A 1FR6A 5AV9D 4YM6B 2EX2A 3LY4A 1B6WA 5GXQD 4BENA 3UT9C 5B2JC 5GXQA 4MMNA 5B33C 1KVMA 3ZG0A 3WKJA 1SKOB 4WYYA 3T4LA 3O87A 3QNBA 3VE3A 1GSVA 2G2WA 3MZFA 5JYOA 3AZFD 3SS3A 2QMIA 1KX5D 4Q0JA 4XZQD 4H9QA 1M6KA 4IBXA 2WKPA 5GLDA 5GSUC 1DP6A 3EOIA 3MNND 1OPXA 3MNNA 2BYMA 2K31A 3W97D 4L9EA 4NKPA 4R8PC 3B0DC 5J7EA 5AVBA 4MNRA 4HEFA 3VSKA 3N8SA 2C6WB 3HVFA 3WX7A 4QB8A 4AWLB 3CUEC 3KX0X 2RCXA 4JKTA 3AZEC 1MZUA 4WU9C 4UEYA 5B1MB 4GNUA 5AV9C 1Z2CB 2VZWA 1K56D 4IBGA 2ZC7A 2JCHA 1K56A 5HWVA 1S32A 1AOID 5GXQC 4H9RA 3R7WB 4C75A 3NOTC 4IBCA 5EOEA 4LV1A 3IQAA 3WKJC 3AZKB 2G5HC 3F1NB 3X1UB 2NZDD 4GKUA 4IEDA 2IA2A 1S6RA 1N9LA 3AZFC 3PBNA 4DJ3A 3KWQD 4EETB 3F1OB 1YU4A 1EW0A 4Z2LA 3MNNC 2B02A 3T50A 4H9OB 2JHEA 3W97C 1XA1A 3WA9B 1GHPA 4NYUA 3CJMA 3JYIA 3PXPA 3L28A 3VP4A 5B1LA 1G6OA 1MWTA 2Q9NA 3LIEA 4ZRRA 5CHUA 4Z66A 3VH6T 2L5AA 3W2ZA 3TG9A 4MBFA 3IHAA 1S32C 3C1CA 4X56A 1O7EA 5G49B 2FN2A 1ED7A 5L10A 3L27A 1RP5A 4GS9B 5AY8A 4G92B 3IF5A 5CTNA 3L2AA 4FCFA 1M19B 2ZL1B 3PBOA 3VOZA 1M18B 3KWQC 4IVIA 3M7PA 4H8RA 4O0PA 4OQHA 3WD2A 3BLMA 2VX8A 2J8YA 3D3OA 3AYWD 4R3JA 1W8QA 5B33B 3L9KA 4X23D 3AZHA 1BH9A 4ETZA 1H5XA 4QWOA 4H6JA 5B1LC 1NZOA 2ZM0A 3WRZA 2GNXA 4S2NA 5GSUB 1T1BA 1OTDA 3G35A 3A1KA 3KSHA 5CERA 3B0DB 2XQZA 5A8BA 4HH2A 4HMEA 1W2EA 3NIAA 5B32A 5AY8C 3CHWP 5CGWA 3U2AA 5E2EA 3BW6A 3O62A 3EQVA 4AFIA 3MBZA 1LSXA 2ZMFA 3CAXA 1DY6A 2JC7A 5TFQA 2YKFA 2HPBA 5AV9B 3IS2B 2WGWA 2PHYA 4DRBA 3KUYB 3B3XA 1XX2A 3NDEA 1P3FA 4ZJ2A 3AYWC 1CXWA 2XA7M 3QP2A 4WL9A 3AZHC 4RX3A 4DKIA 4ZDXA 2J8PA 1ZC2A 4X23C 3LZ1D 3H82A 3LIBA 3LZ1A 1XPBA 4OP5A 5LBRA 3BYDA 4EWFA 4F94A 2HP9A 3C4OA 3AZFB 1L0GA 1KX5B 2ZY2A 4XZQB 3RJUA 4X1MA 4S2NC 5B31A 4O7DA 4X69A 3MFXA 1P3MA 2G7UA 2CMNA 3GECA 1L0EA 2KLIA 4N9KA 3QP8A 3W97B 5EVIA 3OPHA 1MKMA 3MR0A 3O62C 3WD4A 2HP5A 2WKIA 2EWVA 3KS8A 4NY2A 2E8JA 3F1PA 5B31G 5TGFA 4MEZA 2HIOD 4NZ5A 2HIOA 2Y8HA 5EOOA 1K55A 4DJ2A 1MWUA 2V20A 2V8FA 3G32A 3MS6A 2BTFP 1AOIB 5DF7A 4DRAA 1P3GD 4JGRA 1KGFA 3MVDD 1XKZA 4OJOA 1T19A 3MGQA 5FATA 3REIA 3LZ1C 5HSQA 3VFFA 2NZDB 1PW1A 1BYWA 3CMZA 3NC8A 3V3RA 3X1VD 4PM6A 4HQAA 3KWQB 4Y2FA 5B31C 3NECA 4NXFA 2W0NA 5B40B 3N7WA 3PBSA 3AZID 4R23A 3CZDA 4OOMA 4IJGA 1TDLA 5FQJA 5HD5A 1TS7A 4EU0A 4JJNB 5KDMA 5GT3D 2ZY3A 5CHMA 5BO0A 4WJ3C 2W1TB 4Y0TA 5B24A 3LIAA 2HIOC 1BSGA 1UWNX 4FH2A 4LGWA 2V8CA 2Y59A 5AQ9A 1BULA 1AIWA 1BUEA 4WEKA 5A92A 1IEMA 4X68A 5FQIA 4DE1A 2NUTC 3DW0A 5GLAA 4R1GA 3WAAD 3LEZA 3UDXA 2VQRA 1P3AA 3X1SD 4QLCD 3X1VC 2XF3A 2WK0A 4MCWA 2WGVA 3AZIC 4FD8A 3AYWB 5DTKA 2YFVB 3KXBD 4X23B 3KXBA 1WE4A 2F8NH 4YINA 3MGSA 3CG5A 3P09A 1S66L 2E8IA 3BFGA 5AV8A 1YU3A 4UA7A 3ZQ5A 3KSIA 5GT3C 1JFIB 1L6JA 4B9OA 2WAEA 4YS3D 3TU4A 1XA7A 3OLOA 1MPLA 3NQJA 4IBEA 3AFAA 2VLGA 2XFTA 3T4QA 1P3OD 1ZHHB 3Q7ZA 1P3OA 5CPKA 3MKEA 2V0UA 3PBQA 4LRXC 4XUXA 5E5AB 3LJAA 3EGXC 5DKLA 4NXBA 2Y79A 4OP8A 1EQZA 5HD3A 2H28A 4B93A 1B67A 1VB6A 3GMWA 4IJFA 4P85A 2O9BA 3B6GA 3NCKA 2XLNA 3BRMA 3UE6A 3HLBA 4QLCC 4DDYA 3CLOA 1PWDA 1YU2A 5I5LA 3BQAA 4EEPA 1S67L 4LD9B 4Z1WA 4CPKA 3IP4C 4BBVA 1K57A 4I3IA 1XFQA 3KXBC 3LZ0A 3E0YA 2O9CA 2Z2MB 3MGSC 2EFUA 1WWIA 2YKHA 1H8ZA 4WN5A 4R4RA 2A24A 1W1YA 1Y4OA 1IYSA 2PR6A 3G2YA 1E88A 1P3OC 5DNMD 2K2NA 3UMDA 4OQIA 3BLSA 2OLVA 5B0YD 3LJAC 3FKEA 1EQZC 2ZQCA 3C7VA 1NJ4A 1YQSA 4Z2HA 1M1AD 3B6GC 1P97A 3H0LC 5CPIB 4L0LA 3OCLA 1KGGA 3B47A 2HIOB 1KGEA 4WELA 4HHDA 4LCMA 4WMCD 4Y7PA 5CEDA 1P3GB 4WMCA 1K57C 2ZOHA 1HTZA 5EE8A 3MVDB 3N8LA 3LZ0C 1LI0A 3GVBA 2RVQC 3LR4A 1BLSA 3N6IA 3IT9A 1SKOA 2WZXA 1WA9A 5KMWA 4B88A 1W1VA 1I5QA 3VH5A 3X1VB 3TRCA 1ZTUA 1YAXA 1EWZA 4BQMA 1ESUA 1PZOA 2JBFA 3IH9A 4EERA 3AZIB 2IOUA 1MWRA 4ZBJC 1CI9A 4DXBA 3IXHA 3A0VA 4FOFA 2Y2IA 5B0YC 5KZHA 3E4PA 1BH8B 1AWIA 5GT3B 4NFTA 5CTMA 1M1AC 5HZHA 1FCMA 4UQIS 2OOLA 3AL0C 4ETXA 5B1MD 5B1MA 2EA9A 3SH9A 1VETB 1RGYA 1P34B 3A3JA 3KYEA 3R7WA 4KZ6A 5U47A 3GSGA 2AROD 4OJ5A 4TX8A 3SW1A 3A0RA 1E8BA 3AZKD 3WAAB 3C5AA 4JF6A 3AZKA 1Q2PA 3F1NA 1HQ3D 3X1UA 3X1SB 4QLCB 1F9IA 4KG2A 3F1OA 4IBKA 4DDSA 3E2KA 2AVXA 1OJ5A 3AZGD 3B0CW 5BNVB 3SZTA 4CSRB 1DP9A 1KX4D 3MXQA 4LFUA 4H9OA 4KHAB 4Z2MH 4J8WB 3GTCA 4HMDA 3VOLA 3I7JA 4LV2A 1QMFA 1GA9A 4RQ9A 3LIDA 2J7VA 2JN7A 1K6SA 2WKHA 5A93A 1LL8A 4H9SC 3BEBA 4YS3B 1O6IA 2XFSA 1P3KD 1E4DA 1P9WA 5B1MC 4I5SA 2KX6A 3LGOA 2P04A 4GW9A 2YFWB 2EFXA 4FTXA 3D4FA 1DP8A 2AROC 1I2SA 3KYZA 4GS9A 3AZKC 5BPVA 3W98D 5A90A 3X1UC 4B4XA 1HQ3C 1M19A 2ZL1A 1XJ6A 4IUHA 2WYXA 3B33A 1ERMA 1P3BD 4LCLA 2V1BA 3Q7VB 3E98A 3F6TA 5IS1A 3AZGC 1FCOA 3DBAA 4X55A 5HAPA 1KX4C 5B33A 1ID3D 4QPRA 3W99D 2BYKB 3HLFA 4JXVA 1TAFB 3GDIA 1CQAA 3VV4A 4Y3IA 1T1CA 5DVAA 4ME4A 4Z2JA 2H0YA 4Z5TB 4G3KA 3UB6A 4ZJ1A 3EPLA 2OLUA 5GSUA 3LFVA 4NE6A 5DNMB 5B0YB 4JBFA 3IXDA 4ESPA 2ZLYA 2XDMA 2XROA 4G92C 3HSHA 3IF6B 4OVDA 1M1AB 3W98C 1M40A 2HDRA 2ZMAA 5G18A 2OSUA 4KZ3A 1A0KA 2WADA 1N1JB 3UE0A 2PAVP 1MBLA 5AV9A 3IS2A 4JF4A 4CJNA 3EEAA 3KUYD 1L3LA 4NZ1A 4GHLA 3KUYA 4II7A 1WYCA 4WZSB 3ULFA 5DNND 1UGUA 4XXRA 4PM9A 4P6ZS 4GD6A 3LO7A 5JA4B 3M6BA 3R4KA 4FUWA 3LR3A 3G34A 5EM0A 1TS6A 2HZ5A 3AZFA 1KX5A 4XZQA 3UPNA 1SKFA 2ZQ8A 4WUJA 4A5RA 1S1YA 3IHBA 3UPOA 2UV0E 2ZQ9A 4I3JA 3LY3A 3W97A 3EWKA 3Q1FA 3AN2D 2OWHA 5B2ID 2QZ6A 4OPYA 1ZG4A 1CEFA 1S0WA 1TZYB 3P01A 2W3DA 5I94A 4P6BA 1NLZA 3P7NA 3ZCZA 4UUZB 3KUYC 1U35D 2PBDP 3UPPA 1AOIA 2V1ZA 3RXXA 3GRJA 4Q0HA 4G3WA 2AROB 1IYQA 1FOFA 1QMEA 4S2JA 4U0TA 4WBGA 2XK1A 1FQGA 3KO6A 5G4ZA 4OJ6A 1HQ3B 2NZDA 4OOYA 2Y91A 5C5KA 2K7SA 2V1AA 4E3LA 4NE5A 1KX5C 2KOIA 4XZQC 3KWQA 3A1IA 2GDNA 5B40D 3AZGB 2FZ0A 5B40A 3AGFA 3GV9A 4HMCA 1KX4B 3LR5A 1JTGA 3K3DA 4NZ3A 1VEUB 4MB5A 4GZBA 3REKD 4F3LB 4JJND 1W63M 5EECA 3P5JB 4JJNA 4ZAMA 4LLOB 1P3KB 1KDWA 4K91A 2J9OA 2W1TA 2Y4AA 3C4PA 1Q2QA 4JPMA 4E04A 1U35C 1AOIC 5FI6A 4UQIM 5AVFA 4GN2A 4HH3A 1YU0A 2A49A 5CPJD 3UO9A 1YUEA 3W98B 3GQZA 1YLTA 2NZDC 2PRFA 1P9RA 2V5OA 4OUIA 1JWZA 3QP4A 5GL9A 4KZAA 3V67A 4KUDD 3ZG5A 4OH0A 1P3BB 2ZC4B 5FL3A 3WS5A 5DF9A 5KSCA 2XEPA 4R70A 1JVJA 5B40C 3KS4A 3K3CA 1K0KA 5IU1A 3AYWA 3O5YA 5BS7A 2YFVA 1ID3B 3A6ND 3W99B 4X23A 3UE1A 2PYRA 4KZ4A 1E15A 4PPRA 3PBTA 3REKC 3REJB 1JWVA 3S7NA 2GZAA 2RTSA 4JJNC 3TJZC 1JFIA 2DCFA 4LPZA 4C3QA 4OPRA 2EX9A 5L09A 3V50A 2QWSA 1FR1A 4JXWA 1KX3D 1KE3A 4J8VD 4HGAB 5GHYA 1L2SA 1F66D 4HIAA 3MGRD 4R3BA 3JVUA 5E5AD 3QNCA 5KIZA 1L0FA 5E5AA 2HDQA 4S2IA 3V3SA 5CPJC 4J8UD 2LB9A 4EW7A 4X53A 5BNXB 5AVCD 2ZBBA 3MZDA 4KQRA 4WLAA 4ZUXD 3UTAD 1SDEA 3HCYA 3LUQA 4KUDC 2GX5A 3WS0A 1F98A 4LD9D 5GHXA 2GJ3A 4S2PA 4LD9A 4DN0A 1LL5A 5DNNB 3A3FA 5BS7C 3MXRA 2B95A 2PYOD 5GHZA 5DTTA 1JTDA 2HDUA 3S4XA 1BZAA 1W79A 1W8YA 2O99A 4HESA 3HL9A 1DRMA 3IX3A 1XJ2A 3AZLB 4PAUA 2Y2KA 1KX3C 2WKEA 3LEQA 2ZQDA 4J8VC 1XP4A 1P3IB 4EBNA 4Z2KA 3QP5A 2OAQ1 3OCNA 1F66C 4PKYG 3AN2B 5E5AC 4EEUA 5B2IB 4X25A 3AV2B 3VSLA 3HREA 1YLPA 4J8UC 5CEBA 4RVAA 3VMAA 3G6OA 1WWSA 5AVCC 5CPID 5CGXA 4ZUXC 5CPIA 2CV5B 2M7UA 2B18A 3LR0A 5CGSA 5AQBA 2QJ7A 4Q8IA 1GHMA 4LD9C 1U35B 5AVEA 1LLBA 3PHYA 1P3GA 3MXSA 3MVDA 4P87A 4CLCD 3QHYA 5M18A 1IELA 1IKIA 2Y2HA 5EVEA 3UNWA 4OONA 2Y2QA 1C3BA 2XH9A 1ES4A 3ZYTA 3X1VA 4M4XA 3UB7A 3RXWA 3IH8A 3W96D 5FI2A 4MDZA 1H0MA 1K38A 3NULA 3AZIA 3ZG8B 2HDSA 3B0CT 1HZOA 4N9LA 1LT0A 4OPZA 5DFXA 4Z9QA 3REKB 3T1RA 3VP1A 4KQDA 1BH8A 3REHB 5GT0B 5GLCA 1PI4A 1TVFA 3NOPC 5GT3A 5FDSA 5CPIC 1CEGA 1G5UA 2VGLS 3SS4A 1GCEA 3RTYA 1R4VA 4GDNA 1P34D 1VETA 1P3GC 4PM5A 1P34A 3MVDC 4JLFA 4JXSA 2Y2MA 5CPJB 4CLCC 3E4OA 2NQBD 2EX8A 3WAAA 3WD0A 1JNUA 5F68A 5F1GA 5E2GA 1F1EA 1E3UD 2Y2LA 3ZDJA 4JGQA 3IWQA 3M2KA 3VE4A 4KUDB 3X1SA 2JKFA 4PMAA 4QLCA 2PU2A 1GOIA 3W96C 3BFFA 5TBMB 3DWKA 2Q0OA 3BQ8A 3A3DA 1E6ZA 4LENA 4B4ZA 5BNVA 4CSRA 2VK3A 2J3TD 4KENB 4S2LA 4XUJD 2VGKA 3C7UA 3A6NB 4IBIA 2WKRA 3HBRA 4J8WD 2ZJ9A 5F5YA 4KHAA 2V9AA 4J8WA 4LV0A 5HARA 3SH7A 2Y2JA 3C1BB 4GHAA 2IWDA 2F8ND 1QO6A 5CX7A 4YS3A 3MFDA 3VP0A 1KX3B 1GHIA 3SOIA 4J8VB 4NZ4A 1E25A 1NY0A 1P34C 1F66B 3MGRB 1HLUP 3MGPD 2YFWA 1ERQA 4QD4A 1OTEA 4J8UB 3AGDA 3WAAC 2A3UA 5HDDA 5AVCB 1GPFA 4ZUXB 3UTAB 2F8NG 4WZ5A 4NXGA 3UB9A 1KOUA 3X1SC 3T4OA 3PBRA 1T1AA 1ES5A 1YLZA 3Q7VA 3CWFA 4N1HA 4KUKA 1H8YA 4OQGA 4GLQA 5FSRA 2PYOB 3UDIA 4J8WC 2G2UA 4MB3A 1FILA 2P7JA 2RL3A 2BYKA 5EVLA 3UB5P 1TAFA 2R78A 5B0ZB 3HUNA 4R4SA 4Z5TD 4YS3C 4Z5TA 3ITAA 5MC7A 1PDCA 1H3OB 4QU3A 3AZND 1TF1A 4EXOA 5FASA 3FKVA 1UWPX 1K6RA 2FFYA 4PM7A 5DNMA 2X02A 5B0YA 3WTPB 3TW8A 1N9OA 2JE5A 3WRTA 3IF6A 4EUVA 3EQUA 1M1AA 4WZ5C 2VV7A 4EBPA 2B5RA 3S1YA 1SDNA 4MN7A 2WAFA 2NUPC 1L0DA 5CP6D 1N1JA 4HP9A 4MBKA 3LELB 1E6NA 4DE0A 3WS2A 1ESIA 5J3WA 3X1TD 4CLCB 3DTIA 4BD0A 3CI6A 1BLCA 1N9NA 3R45B 5CECA 3VH5W 2ZC6B 4DF6A 2W8SA 5JA4A 1SCWA 2F8NK 1W1PA 1D1JA 4OOLA 3MMHA 4C6YA 5KSHA 5J8XA 5HAIA 4OLGA 1MY8A 4Z5TC 3FG8A 2ZM8A 3O86A 3W96B 1OTIA 4E6WA 1SHVA 3AZNC 4RX2A 1NRFA 1KE4A 4GOGA 4ARZB 3ZGAB 3VP2A 5DNMC 3NOUC
chains in the Genus database with same CATH topology
1HD8A 4QY6A 3ZVWA 2F2AC 4RYEA 3S22A 2IO5B 3IF6C 2EX6A 4M3KA 5E43A 4H9SA 1TZYD 1TZYA 3EG5B 3FKWA 4IBBA 4OKPA 3AZMD 3ZG9B 3BFEA 4UUZA 3A3IA 4LG2A 1VM1A 1BFMA 3BM6A 1KU5A 3X1TC 2NQBB 2AROA 3M6HA 3RELB 4CAYB 4OLDA 1PIOA 1Z6FA 1HQ3A 2DNSA 4NK3A 2CC1A 5JRGD 2DRWA 3AZGA 3B6FD 4XUJB 1KX4A 2R9WA 1MWSA 3EPKA 5GLBA 1YT4A 1KVLA 3NQUB 4E3OA 4Y0UA 2F8NB 4IBRA 1TZYC 1P3KA 3AZMC 1ES3A 3MGPB 1P3PD 5BT1D 3WS4A 3W98A 4Z2MG 3UTBD 5FAQA 5AV6D 1I2WA 1P3BA 5JRGC 3AV1D 3B6FC 4JXGA 4WU8D 2PBYA 2ZC5B 1ID3A 3W99A 1K4EA 4WM9A 3AZJD 3REJD 4G91B 3REJA 4HBUA 3W4PA 1P3KC 3HLCA 4S2KA 5FQ9A 4UAAA 3AZNB 1J9MA 2ZD8A 3UT9D 5B2JD 3SS5A 2FJ7B 3W8KA 4BLMA 3KSYA 1P3PC 5BT1C 3ZFZA 1TEMA 4GDBA 1ZLAD 5BNXA 4IBFA 3UTBC 4UA9A 1EI5A 4MBHA 5CP6B 3V9RB 5HW3A 1P3BC 5M1AA 2Y2NA 1K54A 4IVKA 4GH9A 3HONA 3AV1C 3X1TB 5DNNA 4E6XA 1ID3C 3W99C 2P9VB 5JYPA 1PWCA 3AZED 3REJC 5FAOA 2V2FF 4WU9D 3TSGA 3ZVTA 1DJAA 1YMSA 5HL1A 5C3IB 1DJBA 3GR2A 3AZLD 2XR0A 3N3FA 4DQYB 3AZLA 4IBJA 2Q9MA 4WV4B 4HGAC 1P3ID 3WKJD 1P3IA 3IWOA 1ULYA 3AN2A 5B2IA 3AV2D 5TR7A 3HLWA 3AV2A 1ZLAC 4K0XA 4E3JA 1P3LB 2CV5D 2CV5A 3O3VA 4H9NB 3AZMB 1K54C 4KQQA 1RCJA 5AVBD 1U35A 3VOYA 4KZBA 2Y2PA 4J8XB 5DNNC 3FZCA 2ZQAA 2JSSA 3NI9A 1MXOA 4DE2A 2Y2GA 2X71A 1S32D 5JRGB 4KGCB 4H9PB 3AZLC 3B6FB 5AQ7A 3G30A 1P3IC 3H0MC 1TDGA 3AN2C 4OQ0A 5B2IC 2UWXA 3REHD 5GT0D 3REKA 3AV2C 1HTAA 5GT0A 3REHA 5EPHA 4PM8A 3WWXA 2LY8A 5FDHA 2CV5C 4BD1A 1GA0A 3IXBA 5M19A 5F99B 5AVBC 1YLWA 2BG1A 2WUQA 4BJPA 4WNNB 1P3PB 5DF8A 3PTEA 1G68A 3PAEA 2G5IC 4KG6A 5B1LD 5CPJA 1Q9CA 5FQMA 5FAPA 2DQNC 4N1XA 3UTBB 4Z66D 3G4PA 4E3NA 1CI8A 5AV6B 1AXBA 4KUDA 2WZZA 5CRFA 5F1FA 1IYOA 3C1CD 3FWLA 5AY8D 3AV1B 3M2JA 4Y0OA 4WU8B 1N4OA 3A6NA 1NYMA 2H5SA 3AZJB 1W7FA 3REHC 5GT0C 3C1BD 4DE3A 3C1BA 1G6AA 5DTSA 4GD8A 1KE0A 3UT9B 5B2JB 5FI7A 5FUGB 1KX3A 5F83A 3AZHD 4J8VA 3HUMA 1ONGA 1EROA 1LHYA 1DJCA 1PZRA 1F66A 3MGRA 2Y2OA 5EUAA 3MKFA 4RA7A 4J8UA 1ZLAB 4YFMA 5AVCA 3P98A 1N9BA 4Z66C 4ZUXA 3UTAA 5E2HA 3C1CC 4R8PB 5B32D 3L25A 3O62D 1ONHA 3A6NC 2PYOA 2XGNA 3H0RC 3VH5T 3AZEB 5B0ZD 4WU9B 3C1BC 5B0ZA 5CXWA 4U3TA 4KZ5A 2ZM5A 5GXQB 1P3FD 3DTMA 3NY4A 4OPQA 1H3OA 5B32G 2QPNA 3MZEA 3WKJB 1PW8A 1YU1A 3WTPE 1Y54A 3MGRC 4NE3A 4P0MA 3FYZA 3WTPD 3WTPA 4H9QB 5B31D 4E44A 3IWIA 3UTAC 1P3MD 3HUOA 3N8RA 4M6BA 1K25A 4EO5C 2BYMB 3MNNB 2PU4A 2ZQ7A 2H0TA 4QY5A 3LELD 5EVID 5AVBB 3LELA 5B32C 4KZ7A 5L2FA 4KG5A 3UY6A 2PYOC 5AQAA 3R45A 5B0ZC 3ZHHA 2IWBA 1S32B 4H9RB 3W96A 2C5WB 1P3FC 4MLLA 3MGQD 5A91A 2ZY5A 3REID 1T3UA 3UDFA 1O07A 4KZ8A 3WTPC 3BECA 4FSFA 2OV5A 5AV5D 4EQIA 4ZJ3A 4E3MA 5AV5A 4U0XA 1P3MC 1ZG6A 4UPKA 3NBLA 2I72A 5EVIC 3LELC 2X01A 4NETA 4DXCA 3Q81A 5B1LB 3RELD 2NQBA 5B24D 3RELA 4CAYA 1ZKJA 5FQKA 4Z66B 3L26A 1E3UA 1K55C 3A3EA 4IBDA 1CK3A 2VGJA 3C1CB 2Z2LB 1NXYA 1W5DA 5AY8B 3MGQC 3REIC 4XUJA 2ZM2A 3EPJA 3N4IA 1KDSA 1P3AD 2IO5C 3NQUA 5AV5C 3W4OA 1BLPA 2Y55A 2F8NA 3HLEA 1IKGA 3AZHB 3ZNYA 3E2LA 1BH9B 3MGSD 3MGPA 5AV8D 2NQBC 3RELC 3TU4D 5B24C 3VH6W 1FSYA 3AFAD 4BL3A 4EO5B 3VH6A 1U60A 4OJLA 3BFDA 1YLJA 5CPKD 5B32B 4QJGA 3LJAD 2EXAA 3O62B 4XUJC 1EQZD 3WS1A 2H10A 2HUEC 3FDDA 3B6GD 1P3AC 4ZTKA 3B0BA 2WGWB 3V39A 1IYPA 3ZG7B 1P3FB 4ID4A 4IJEA 1YLYA 3AZNA 2XD5A 4S2MA 3LZ0D 2RVQD 3FV7A 3HLDA 4K0WA 3LZ1B 2FJ7D 3MGPC 4R0QA 2FJ7A 2J9PA 1LL9A 5AV8C 2EXBA 3OPRA 4X6TA 3TU4C 5B31B 1P3MB 5HFOA 3AFAC 3EPHA 3SH8A 2DF4C 5CP6A 1K4FA 3V9RA 5EVIB 5CHLB 4HBTA 4D2OA 3HLGA 5CPKC 1ALQA 2WGIA 3X1TA 2HP6A 5E2FA 3Q07A 3G31A 2P9VA 4G91C 2CWEA 5FA7A 3OC2A 3OPLA 4YM6D 3TOIA 4YM6A 1VQQA 4E3IA 3G2ZA 4E3KA 3MGQB 3VFHA 3REIB 3AGEA 4JF5A 2ZC3B 2FJ7C 3VP3A 3BFCA 4WZ4A 1NYYA 5AV5B 3W4QA 4ZBEA 1P3LD 4EV4A 5HX9A 1P3LA 3ZNTA 5CP6C 1FCNA 1BLHA 4H9NA 3LCEA 3AZMA 1JWPA 4EUZA 4J8XD 3UE3A 4QHCA 4J8XA 5KDMB 1WYBA 4BL2A 5BO0B 4S2OA 5B24B 2BLSA 4WEJA 2XD1A 5IHVA 5C3IC 5BOHA 4YM6C 1NZUA 4KGCD 5JRGA 4KGCA 4H9PA 1MKIA 3B6FA 3IXGA 2HUEB 3X1UD 2FFFB 1OMEA 1P3AB 1HVBA 3L29A 1YM1A 4N92A 4EBLA 1XXMA 1P3LC 5HAQA 3KXBB 3DWZA 3MGSB 5F99D 5F99A 3WA9D 4KQOA 4J8XC 5AV8B 3WA9A 4WNNA 1P3PA 3TU4B 4AWLC 3KFUG 3NQJB 3AFAB 3UTBA 5AV6A 1P3OB 1BT5A 4KGCC 5CPKB 4LV3A 3LJAB 3O88A 1A7WA 5G49A 1LI9A 1BTLA 1EQZB 3AV1A 4E45A 4OJPA 4UA6A 3B6GB 1PYYA 4WU8A 1M19D 4KZ9A 1XGIA 3AZJA 5FQQA 2RIQA 1M18D 1M18A 1PWGA 5CHJA 4NYYA 1PZPA 4XUZA 1PI5A 3V5MA 3UT9A 5B2JA 3LZ0B 4DRTA 2ZY4A 5B33D 1FSWA 5FUGA 4GB7A 3ITBA 5F99C 3WA9C 1YMXA 3OZHA 5D3OA 2R9XA 2IWCA 1ES2A 1ZLAA 3OPPA 5F82A 5GSUD 5AV6C 4UHUA 4ZBJB 3Q82A 1RGZA 3PAGA 4R8PD 4R8PA 3NDGA 1XGJA 4WU8C 3ISGA 4QNLA 3UN7A 1M19C 3AZJC 3AZEA 2P74A 1M18C 4WU9A 1FR6A 5AV9D 4YM6B 2EX2A 3LY4A 1B6WA 5GXQD 4BENA 3UT9C 5B2JC 5GXQA 5B33C 1KVMA 3ZG0A 3WKJA 4WYYA 3O87A 3QNBA 2G2WA 3MZFA 5JYOA 3AZFD 3SS3A 2QMIA 1KX5D 4XZQD 4H9QA 1M6KA 4IBXA 5GLDA 5GSUC 3MNND 3MNNA 2BYMA 3W97D 4R8PC 3B0DC 5AVBA 4MNRA 4HEFA 3VSKA 3N8SA 2C6WB 3HVFA 3WX7A 4QB8A 4AWLB 4JKTA 2RCXA 3AZEC 4WU9C 5B1MB 4GNUA 5AV9C 1Z2CB 1K56D 4IBGA 2ZC7A 2JCHA 1K56A 1S32A 1AOID 5GXQC 4H9RA 4C75A 5EOEA 4IBCA 4LV1A 3IQAA 3WKJC 3AZKB 2G5HC 4GKUA 3X1UB 2NZDD 4IEDA 1S6RA 3PBNA 3AZFC 3KWQD 1YU4A 3MNNC 4H9OB 3W97C 1XA1A 3WA9B 1GHPA 4NYUA 3CJMA 3JYIA 3L28A 3VP4A 5B1LA 1MWTA 2Q9NA 5CHUA 4Z66A 3VH6T 2L5AA 3TG9A 4MBFA 3IHAA 1S32C 3C1CA 4X56A 1O7EA 5G49B 3L27A 1RP5A 5AY8A 4G92B 3IF5A 5CTNA 3L2AA 4FCFA 1M19B 3PBOA 3VOZA 1M18B 3KWQC 4IVIA 4H8RA 4OQHA 3BLMA 2J8YA 3AYWD 4R3JA 1W8QA 5B33B 4X23D 3AZHA 1BH9A 1H5XA 5B1LC 1NZOA 2ZM0A 3WRZA 4S2NA 5GSUB 3G35A 3A1KA 5CERA 3B0DB 2XQZA 1W2EA 3NIAA 5B32A 5AY8C 5CGWA 5E2EA 3O62A 3EQVA 3MBZA 1DY6A 2JC7A 5TFQA 2HPBA 5AV9B 2WGWA 4DRBA 3KUYB 3B3XA 1XX2A 3NDEA 1P3FA 4ZJ2A 3AYWC 4DKIA 3AZHC 4RX3A 4ZDXA 2J8PA 1ZC2A 4X23C 3LZ1D 3LZ1A 1XPBA 4OP5A 3BYDA 4EWFA 4F94A 2HP9A 3C4OA 3AZFB 1L0GA 1KX5B 2ZY2A 4XZQB 3RJUA 4S2NC 5B31A 4O7DA 4X69A 1P3MA 1L0EA 4N9KA 3W97B 5EVIA 3OPHA 3O62C 2HP5A 2WKIA 3KS8A 4NY2A 5B31G 5TGFA 4MEZA 2HIOD 4NZ5A 2HIOA 5EOOA 1K55A 1MWUA 2V20A 3G32A 1AOIB 5DF7A 4DRAA 1P3GD 1KGFA 3MVDD 1XKZA 4OJOA 3MGQA 5FATA 3REIA 3LZ1C 3VFFA 2NZDB 1PW1A 3CMZA 3NC8A 3V3RA 3X1VD 4PM6A 3KWQB 5B31C 5B40B 3N7WA 3PBSA 3AZID 4R23A 3CZDA 4OOMA 1TDLA 5FQJA 4JJNB 5KDMA 5GT3D 2ZY3A 5CHMA 5BO0A 4WJ3C 4Y0TA 5B24A 2HIOC 1BSGA 4FH2A 2Y59A 5AQ9A 1BULA 1BUEA 4WEKA 5A92A 1IEMA 4X68A 5FQIA 4DE1A 3DW0A 5GLAA 4R1GA 3WAAD 3LEZA 3UDXA 2VQRA 1P3AA 3X1SD 4QLCD 3X1VC 2XF3A 2WK0A 2WGVA 3AZIC 4FD8A 3AYWB 5DTKA 2YFVB 3KXBD 4X23B 3KXBA 1WE4A 2F8NH 4YINA 3MGSA 3CG5A 3P09A 2E8IA 3BFGA 5AV8A 1YU3A 4UA7A 5GT3C 1JFIB 2WAEA 4YS3D 3TU4A 1XA7A 1MPLA 3NQJA 4IBEA 3AFAA 2XFTA 1P3OD 3Q7ZA 1P3OA 5CPKA 3MKEA 3PBQA 4XUXA 5E5AB 3LJAA 4OP8A 1EQZA 1B67A 3GMWA 4IJFA 4P85A 3B6GA 3NCKA 2XLNA 3BRMA 3HLBA 4QLCC 4DDYA 1PWDA 1YU2A 4LD9B 4CPKA 3IP4C 1K57A 3KXBC 3LZ0A 2Z2MB 3MGSC 2EFUA 1WWIA 1H8ZA 4R4RA 1IYSA 3G2YA 1P3OC 5DNMD 4OQIA 3BLSA 2OLVA 5B0YD 3LJAC 3FKEA 1EQZC 2ZQCA 3C7VA 1NJ4A 1YQSA 1M1AD 3B6GC 3H0LC 5CPIB 4L0LA 3OCLA 1KGGA 2HIOB 1KGEA 4WELA 4LCMA 4WMCD 4Y7PA 5CEDA 1P3GB 4WMCA 1K57C 1HTZA 5EE8A 3MVDB 3N8LA 3LZ0C 1LI0A 3GVBA 2RVQC 1BLSA 3N6IA 3IT9A 2WZXA 5KMWA 4B88A 1I5QA 3VH5A 3X1VB 1EWZA 4BQMA 1ESUA 1PZOA 2JBFA 3IH9A 3AZIB 2IOUA 1MWRA 4ZBJC 1CI9A 4DXBA 3IXHA 2Y2IA 5B0YC 5KZHA 1BH8B 5GT3B 4NFTA 5CTMA 1M1AC 1FCMA 3AL0C 5B1MD 5B1MA 3SH9A 1RGYA 1P34B 3A3JA 4KZ6A 5U47A 3GSGA 2AROD 4OJ5A 3AZKD 3WAAB 3C5AA 4JF6A 3AZKA 1Q2PA 1HQ3D 3X1UA 3X1SB 4QLCB 4KG2A 4IBKA 4DDSA 3E2KA 3AZGD 3B0CW 5BNVB 4CSRB 1KX4D 4H9OA 4KHAB 4Z2MH 4J8WB 3GTCA 3I7JA 4LV2A 1QMFA 1GA9A 2J7VA 1K6SA 2WKHA 5A93A 4H9SC 3BEBA 4YS3B 2XFSA 1P3KD 1E4DA 5B1MC 2YFWB 2EFXA 3D4FA 2AROC 1I2SA 3AZKC 5BPVA 3W98D 5A90A 3X1UC 4B4XA 1HQ3C 1M19A 2WYXA 1ERMA 1P3BD 4LCLA 3Q7VB 3F6TA 3AZGC 1FCOA 4X55A 5HAPA 1KX4C 5B33A 1ID3D 3W99D 2BYKB 3HLFA 4JXVA 1TAFB 5DVAA 2H0YA 4Z5TB 4ZJ1A 3EPLA 2OLUA 5GSUA 4NE6A 5DNMB 5B0YB 4JBFA 3IXDA 2ZLYA 2XDMA 4G92C 3HSHA 3IF6B 4OVDA 1M1AB 3W98C 1M40A 2HDRA 2ZMAA 5G18A 2OSUA 4KZ3A 2WADA 1N1JB 3UE0A 1MBLA 5AV9A 4JF4A 4CJNA 3KUYD 4NZ1A 4GHLA 3KUYA 1WYCA 4WZSB 5DNND 4XXRA 4PM9A 4GD6A 3LO7A 5JA4B 3M6BA 3G34A 3AZFA 1KX5A 4XZQA 3UPNA 1SKFA 2ZQ8A 4A5RA 3IHBA 3UPOA 2ZQ9A 3LY3A 3W97A 3Q1FA 3AN2D 5B2ID 2QZ6A 4OPYA 1ZG4A 1CEFA 1S0WA 1TZYB 5I94A 4P6BA 3ZCZA 4UUZB 3KUYC 1U35D 3UPPA 1AOIA 2V1ZA 3RXXA 3GRJA 2AROB 1IYQA 1FOFA 1QMEA 4S2JA 4U0TA 4WBGA 2XK1A 1FQGA 4OJ6A 1HQ3B 2NZDA 4OOYA 2Y91A 4E3LA 4NE5A 1KX5C 4XZQC 3KWQA 3A1IA 2GDNA 5B40D 3AZGB 5B40A 3AGFA 3GV9A 1KX4B 1JTGA 4NZ3A 4GZBA 3REKD 4JJND 5EECA 3P5JB 4JJNA 4ZAMA 1P3KB 1KDWA 4K91A 2J9OA 2Y4AA 3C4PA 1Q2QA 4JPMA 1U35C 1AOIC 5FI6A 4GN2A 1YU0A 2A49A 5CPJD 3UO9A 1YUEA 3W98B 3GQZA 1YLTA 2NZDC 4OUIA 1JWZA 5GL9A 4KZAA 4KUDD 3ZG5A 4OH0A 1P3BB 2ZC4B 3WS5A 5DF9A 5KSCA 2XEPA 1JVJA 5B40C 3KS4A 3AYWA 5BS7A 2YFVA 1ID3B 3A6ND 3W99B 4X23A 3UE1A 4KZ4A 4PPRA 3PBTA 3REKC 3REJB 1JWVA 4JJNC 1JFIA 2DCFA 4C3QA 4OPRA 2EX9A 3V50A 1FR1A 4JXWA 1KX3D 1KE3A 4J8VD 4HGAB 5GHYA 1L2SA 1F66D 3MGRD 4R3BA 5E5AD 3QNCA 1L0FA 5E5AA 2HDQA 4S2IA 3V3SA 5CPJC 4J8UD 4X53A 5BNXB 5AVCD 3MZDA 4KQRA 4ZUXD 3UTAD 1SDEA 4KUDC 3WS0A 4LD9D 5GHXA 4S2PA 4LD9A 1LL5A 5DNNB 3A3FA 5BS7C 3MXRA 2PYOD 5GHZA 5DTTA 1JTDA 2HDUA 3S4XA 1BZAA 1W79A 1W8YA 4HESA 3HL9A 3AZLB 2Y2KA 1KX3C 2WKEA 2ZQDA 4J8VC 1XP4A 1P3IB 4EBNA 3OCNA 1F66C 3AN2B 5E5AC 5B2IB 3AV2B 3VSLA 3HREA 1YLPA 4J8UC 5CEBA 4RVAA 3VMAA 1WWSA 5AVCC 5CPID 5CGXA 4ZUXC 5CPIA 2CV5B 5CGSA 5AQBA 4Q8IA 1GHMA 4LD9C 1U35B 1LLBA 1P3GA 3MXSA 3MVDA 4P87A 3QHYA 5M18A 1IELA 1IKIA 2Y2HA 3UNWA 4OONA 2Y2QA 1C3BA 2XH9A 1ES4A 3X1VA 3RXWA 3IH8A 3W96D 5FI2A 1K38A 3AZIA 3ZG8B 2HDSA 3B0CT 1HZOA 4N9LA 4OPZA 4Z9QA 3REKB 3VP1A 5GLCA 1BH8A 3REHB 5GT0B 1PI4A 1TVFA 5GT3A 5CPIC 1CEGA 3SS4A 1GCEA 1R4VA 4GDNA 1P34D 4PM5A 1P3GC 1P34A 3MVDC 4JLFA 4JXSA 2Y2MA 5CPJB 2NQBD 2EX8A 3WAAA 5F1GA 5E2GA 1F1EA 1E3UD 2Y2LA 3ZDJA 3IWQA 3M2KA 4KUDB 3X1SA 4PMAA 4QLCA 2PU2A 3W96C 3BFFA 3DWKA 3A3DA 4LENA 4B4ZA 5BNVA 4CSRA 4KENB 4S2LA 4XUJD 2VGKA 3C7UA 3A6NB 4IBIA 3HBRA 4J8WD 2ZJ9A 4KHAA 4J8WA 4LV0A 5HARA 3SH7A 2Y2JA 3C1BB 4GHAA 2IWDA 2F8ND 4YS3A 3MFDA 3VP0A 1KX3B 1GHIA 3SOIA 4J8VB 4NZ4A 1E25A 1NY0A 1P34C 1F66B 3MGRB 3MGPD 2YFWA 1ERQA 4QD4A 4J8UB 3AGDA 3WAAC 2A3UA 5AVCB 4ZUXB 3UTAB 2F8NG 4WZ5A 3X1SC 3PBRA 1ES5A 1YLZA 3Q7VA 4N1HA 1H8YA 4OQGA 5FSRA 2PYOB 3UDIA 4J8WC 2G2UA 2RL3A 5EVLA 2BYKA 1TAFA 5B0ZB 3HUNA 4R4SA 4Z5TD 4YS3C 4Z5TA 3ITAA 1H3OB 4QU3A 3AZND 5FASA 3FKVA 2FFYA 1K6RA 4PM7A 5DNMA 2X02A 5B0YA 3WTPB 2JE5A 3WRTA 3IF6A 3EQUA 1M1AA 4WZ5C 4EBPA 2B5RA 3S1YA 1SDNA 2WAFA 1L0DA 5CP6D 1N1JA 4MBKA 3LELB 4DE0A 3WS2A 1ESIA 3X1TD 4BD0A 1BLCA 3R45B 5CECA 3VH5W 2ZC6B 4DF6A 2W8SA 5JA4A 1SCWA 2F8NK 4OOLA 4C6YA 5KSHA 5J8XA 5HAIA 4OLGA 1MY8A 4Z5TC 2ZM8A 3O86A 3W96B 4E6WA 1SHVA 3AZNC 4RX2A 1NRFA 1KE4A 4GOGA 3ZGAB 3VP2A 5DNMC 4FH4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KZ3 A;  1E3U A;  1HD8 A;  1K55 C;  2WAD A;  4QY6 A;  3UE0 A;  3ZVW A;  1MBL A;  3A3E A;  1CK3 A;  2VGJ A;  2Z2L B;  4JF4 A;  4RYE A;  3S22 A;  1H5X A;  4CJN A;  3IF6 C;  2EX6 A;  1NXY A;  1NZO A;  4M3K A;  1WYC A;  1W5D A;  2ZM0 A;  5E43 A;  3WRZ A;  4XXR A;  4PM9 A;  4S2N A;  4GD6 A;  3LO7 A;  3FKW A;  2ZM2 A;  3M6B A;  4OKP A;  3G35 A;  3N4I A;  1KDS A;  3G34 A;  5CER A;  3ZG9 B;  3BFE A;  3A3I A;  2XQZ A;  1VM1 A;  3BM6 A;  3NIA A;  3W4O A;  1BLP A;  2Y55 A;  5CGW A;  3UPN A;  3HLE A;  5E2E A;  3EQV A;  1SKF A;  2ZQ8 A;  3M6H A;  3MBZ A;  4A5R A;  1IKG A;  4OLD A;  1PIO A;  1DY6 A;  3IHB A;  2JC7 A;  1Z6F A;  3UPO A;  2ZQ9 A;  5TFQ A;  3ZNY A;  3E2L A;  3LY3 A;  2DNS A;  2HPB A;  4NK3 A;  2CC1 A;  2WGW A;  3Q1F A;  2QZ6 A;  3B3X A;  4OPY A;  1ZG4 A;  2DRW A;  1XX2 A;  3NDE A;  4ZJ2 A;  1CEF A;  1S0W A;  4DKI A;  4RX3 A;  1FSY A;  4ZDX A;  1ZC2 A;  5I94 A;  4P6B A;  4BL3 A;  2R9W A;  1MWS A;  1XPB A;  4OP5 A;  3ZCZ A;  1U60 A;  3BYD A;  5GLB A;  4EWF A;  4F94 A;  1YT4 A;  2HP9 A;  3C4O A;  1KVL A;  3BFD A;  1YLJ A;  3UPP A;  4QJG A;  1L0G A;  4E3O A;  4Y0U A;  2V1Z A;  2EXA A;  3RXX A;  3GRJ A;  4IBR A;  3RJU A;  4S2N C;  1IYQ A;  1FOF A;  1QME A;  4S2J A;  4U0T A;  4WBG A;  4O7D A;  4X69 A;  2XK1 A;  1FQG A;  3WS1 A;  2H10 A;  1L0E A;  4N9K A;  4ZTK A;  4OOY A;  2Y91 A;  5EVI A;  1ES3 A;  2WGW B;  3OPH A;  4E3L A;  2HP5 A;  2WKI A;  3V39 A;  2GDN A;  1IYP A;  3ZG7 B;  4ID4 A;  3WS4 A;  1YLY A;  3AGF A;  3GV9 A;  2XD5 A;  4S2M A;  5TGF A;  4MEZ A;  3FV7 A;  1JTG A;  3HLD A;  4K0W A;  5FAQ A;  5EOO A;  1K55 A;  4R0Q A;  2J9P A;  1MWU A;  4GZB A;  1LL9 A;  1I2W A;  2V20 A;  3G32 A;  2EXB A;  5DF7 A;  5EEC A;  1KGF A;  3OPR A;  4X6T A;  4ZAM A;  1XKZ A;  1KDW A;  4K91 A;  5HFO A;  2J9O A;  5FAT A;  2Y4A A;  3C4P A;  4JXG A;  3SH8 A;  1Q2Q A;  2PBY A;  2ZC5 B;  3VFF A;  1K4E A;  1K4F A;  1PW1 A;  4JPM A;  4WM9 A;  5EVI B;  3CMZ A;  3NC8 A;  4HBT A;  3V3R A;  4D2O A;  3HLG A;  1ALQ A;  5FI6 A;  4HBU A;  4PM6 A;  4GN2 A;  3W4P A;  3HLC A;  2A49 A;  2WGI A;  4S2K A;  5FQ9 A;  3UO9 A;  4UAA A;  2HP6 A;  1J9M A;  3N7W A;  2ZD8 A;  3PBS A;  5E2F A;  3GQZ A;  1YLT A;  3Q07 A;  3G31 A;  4R23 A;  1JWZ A;  3SS5 A;  3CZD A;  5GL9 A;  4OOM A;  2P9V A;  4KZA A;  3W8K A;  5FA7 A;  3ZG5 A;  4BLM A;  1TDL A;  3OC2 A;  5FQJ A;  4OH0 A;  3OPL A;  2ZC4 B;  3ZFZ A;  3WS5 A;  3TOI A;  5DF9 A;  1VQQ A;  2XEP A;  5KSC A;  4E3I A;  1JVJ A;  3G2Z A;  1TEM A;  4GDB A;  4E3K A;  5CHM A;  4Y0T A;  3VFH A;  4UA9 A;  1EI5 A;  4MBH A;  3AGE A;  4JF5 A;  2ZC3 B;  3VP3 A;  3UE1 A;  3BFC A;  4KZ4 A;  1BSG A;  5HW3 A;  4PPR A;  4WZ4 A;  4FH2 A;  3PBT A;  1JWV A;  2Y59 A;  5M1A A;  2Y2N A;  1K54 A;  5AQ9 A;  1BUL A;  4IVK A;  1BUE A;  4WEK A;  5A92 A;  1NYY A;  1IEM A;  4X68 A;  3W4Q A;  5FQI A;  4ZBE A;  4DE1 A;  2DCF A;  4EV4 A;  5HX9 A;  4C3Q A;  3DW0 A;  4OPR A;  5GLA A;  2EX9 A;  4R1G A;  3V50 A;  3ZNT A;  4E6X A;  3LEZ A;  3UDX A;  1FR1 A;  4JXW A;  2P9V B;  1KE3 A;  5JYP A;  1PWC A;  1FCN A;  1BLH A;  3LCE A;  5GHY A;  5FAO A;  2V2F F;  1L2S A;  3TSG A;  1JWP A;  2XF3 A;  3ZVT A;  4R3B A;  1DJA A;  1YMS A;  4EUZ A;  2WK0 A;  5HL1 A;  3UE3 A;  3QNC A;  4QHC A;  1L0F A;  2HDQ A;  1DJB A;  4S2I A;  1WYB A;  2WGV A;  3GR2 A;  3V3S A;  4BL2 A;  2XR0 A;  4FD8 A;  4S2O A;  4X53 A;  2BLS A;  4WEJ A;  5DTK A;  2XD1 A;  3MZD A;  2Q9M A;  4KQR A;  1SDE A;  1WE4 A;  4YIN A;  3P09 A;  3CG5 A;  3IWO A;  5IHV A;  3WS0 A;  5BOH A;  2E8I A;  3BFG A;  1NZU A;  4UA7 A;  5GHX A;  5TR7 A;  3HLW A;  4S2P A;  4K0X A;  4E3J A;  2WAE A;  1XA7 A;  1LL5 A;  3A3F A;  1MKI A;  1MPL A;  3MXR A;  3IXG A;  5GHZ A;  3O3V A;  5DTT A;  2XFT A;  2FFF B;  1OME A;  1HVB A;  1JTD A;  1K54 C;  2HDU A;  3S4X A;  4KQQ A;  1RCJ A;  3Q7Z A;  1BZA A;  1YM1 A;  1W79 A;  1W8Y A;  4N92 A;  4KZB A;  3MKE A;  2Y2P A;  3PBQ A;  4HES A;  3HL9 A;  4XUX A;  3VOY A;  4EBL A;  1XXM A;  3FZC A;  4OP8 A;  2ZQA A;  2Y2K A;  2WKE A;  3GMW A;  4P85 A;  2ZQD A;  5HAQ A;  1XP4 A;  3NCK A;  2XLN A;  3BRM A;  1MXO A;  3NI9 A;  4EBN A;  3DWZ A;  3HLB A;  3OCN A;  4DE2 A;  4DDY A;  4KQO A;  2Y2G A;  1PWD A;  2X71 A;  3VSL A;  3HRE A;  1YLP A;  4CPK A;  5CEB A;  4RVA A;  1K57 A;  3VMA A;  5CGX A;  5AQ7 A;  3G30 A;  2Z2M B;  1TDG A;  2EFU A;  1H8Z A;  4OQ0 A;  5CGS A;  5AQB A;  1BT5 A;  4Q8I A;  2UWX A;  1GHM A;  4LV3 A;  4R4R A;  1LLB A;  5EPH A;  4PM8 A;  3WWX A;  3O88 A;  3MXS A;  1LI9 A;  5FDH A;  4P87 A;  1BTL A;  1IYS A;  3QHY A;  5M18 A;  1IEL A;  4UA6 A;  1PYY A;  1IKI A;  2Y2H A;  4BD1 A;  3UNW A;  3G2Y A;  1GA0 A;  4KZ9 A;  1XGI A;  4OON A;  2Y2Q A;  3IXB A;  1C3B A;  2XH9 A;  5M19 A;  4OQI A;  3BLS A;  1YLW A;  2OLV A;  5FQQ A;  2BG1 A;  1ES4 A;  2WUQ A;  4BJP A;  5DF8 A;  1PWG A;  3PTE A;  3RXW A;  3IH8 A;  1G68 A;  3PAE A;  5CHJ A;  1PZP A;  2ZQC A;  3C7V A;  4KG6 A;  1NJ4 A;  1YQS A;  4XUZ A;  5FI2 A;  1K38 A;  1PI5 A;  5FQM A;  5FAP A;  3V5M A;  3ZG8 B;  4DRT A;  4N1X A;  2HDS A;  3OCL A;  4L0L A;  1KGG A;  1FSW A;  1HZO A;  4E3N A;  3G4P A;  1CI8 A;  4GB7 A;  3ITB A;  1AXB A;  1KGE A;  4N9L A;  4OPZ A;  4WEL A;  2WZZ A;  1YMX A;  3OZH A;  4LCM A;  5CRF A;  4Z9Q A;  5D3O A;  5F1F A;  1IYO A;  5GLC A;  3VP1 A;  4WMC D;  4Y7P A;  1PI4 A;  1TVF A;  2R9X A;  5CED A;  4WMC A;  1K57 C;  3FWL A;  1HTZ A;  2IWC A;  5EE8 A;  1ES2 A;  3N8L A;  1CEG A;  1LI0 A;  3GVB A;  3M2J A;  3OPP A;  5F82 A;  4UHU A;  1BLS A;  4Y0O A;  3N6I A;  3SS4 A;  1N4O A;  1NYM A;  2H5S A;  3IT9 A;  2WZX A;  3Q82 A;  5KMW A;  1W7F A;  1GCE A;  4B88 A;  1RGZ A;  3PAG A;  1I5Q A;  4PM5 A;  4GDN A;  4DE3 A;  1G6A A;  4JLF A;  4JXS A;  3NDG A;  5DTS A;  1EWZ A;  4GD8 A;  4BQM A;  2Y2M A;  1ESU A;  1PZO A;  2EX8 A;  2JBF A;  3IH9 A;  1XGJ A;  1KE0 A;  1MWR A;  3ISG A;  5FI7 A;  1CI9 A;  3UN7 A;  4DXB A;  5F1G A;  5E2G A;  3IXH A;  5F83 A;  1E3U D;  2Y2L A;  3HUM A;  1ONG A;  2Y2I A;  3ZDJ A;  3IWQ A;  3M2K A;  1ERO A;  1LHY A;  1DJC A;  2P74 A;  1FR6 A;  5KZH A;  4PMA A;  2Y2O A;  2PU2 A;  5EUA A;  2EX2 A;  3MKF A;  3BFF A;  3LY4 A;  4RA7 A;  3DWK A;  4BEN A;  4YFM A;  3A3D A;  4LEN A;  5CTM A;  4B4Z A;  4KEN B;  3P98 A;  4S2L A;  1KVM A;  1N9B A;  1FCM A;  2VGK A;  3ZG0 A;  5E2H A;  3C7U A;  3HBR A;  4WYY A;  2ZJ9 A;  3O87 A;  3QNB A;  4LV0 A;  2G2W A;  5HAR A;  3SH7 A;  3SH9 A;  2Y2J A;  3ZGA B;  1RGY A;  3MZF A;  5JYO A;  3SS3 A;  2QMI A;  2IWD A;  3A3J A;  4KZ6 A;  5U47 A;  3GSG A;  1M6K A;  4IBX A;  3MFD A;  5GLD A;  3VP0 A;  1ONH A;  3C5A A;  1GHI A;  4JF6 A;  3SOI A;  2XGN A;  1Q2P A;  1E25 A;  1NY0 A;  5CXW A;  4KG2 A;  4U3T A;  1ERQ A;  4QD4 A;  4MNR A;  4KZ5 A;  4HEF A;  3VSK A;  3N8S A;  2C6W B;  3AGD A;  3DTM A;  3E2K A;  3HVF A;  3NY4 A;  4OPQ A;  4QB8 A;  4DDS A;  2A3U A;  2QPN A;  4JKT A;  2RCX A;  4WZ5 A;  3MZE A;  1PW8 A;  1Y54 A;  3GTC A;  4P0M A;  3FYZ A;  4GNU A;  3I7J A;  3PBR A;  4LV2 A;  1QMF A;  1GA9 A;  1K56 D;  1ES5 A;  2ZC7 A;  1YLZ A;  2JCH A;  2J7V A;  1K56 A;  3Q7V A;  1K6S A;  4C75 A;  2WKH A;  5A93 A;  5EOE A;  3BEB A;  4N1H A;  4LV1 A;  2XFS A;  1H8Y A;  3IWI A;  3IQA A;  1E4D A;  4OQG A;  3HUO A;  5FSR A;  3N8R A;  3UDI A;  1K25 A;  2G2U A;  4GKU A;  2PU4 A;  2RL3 A;  2ZQ7 A;  4IED A;  5EVL A;  2H0T A;  4QY5 A;  5EVI D;  3HUN A;  1S6R A;  3PBN A;  2EFX A;  4R4S A;  3D4F A;  3ITA A;  4KZ7 A;  5L2F A;  1I2S A;  4KG5 A;  4QU3 A;  3UY6 A;  5AQA A;  5FAS A;  5A90 A;  3FKV A;  2FFY A;  1K6R A;  4B4X A;  1XA1 A;  4PM7 A;  2WYX A;  1GHP A;  2X02 A;  3ZHH A;  1ERM A;  3CJM A;  4LCL A;  2JE5 A;  3JYI A;  2IWB A;  3Q7V B;  2C5W B;  4MLL A;  4X55 A;  1FCO A;  3VP4 A;  3IF6 A;  3WRT A;  3EQU A;  1MWT A;  4WZ5 C;  2Q9N A;  5A91 A;  5HAP A;  4EBP A;  2B5R A;  3S1Y A;  1SDN A;  5CHU A;  3UDF A;  2WAF A;  1O07 A;  1L0D A;  3HLF A;  4JXV A;  4KZ8 A;  3BEC A;  3TG9 A;  4MBF A;  3IHA A;  4MBK A;  5DVA A;  4FSF A;  2OV5 A;  4X56 A;  1O7E A;  2H0Y A;  4DE0 A;  3WS2 A;  4EQI A;  4ZJ3 A;  1ESI A;  1RP5 A;  4E3M A;  4U0X A;  4BD0 A;  1ZG6 A;  4ZJ1 A;  1BLC A;  3IF5 A;  5CEC A;  2OLU A;  2ZC6 B;  5CTN A;  4DF6 A;  4FCF A;  3NBL A;  3PBO A;  1SCW A;  2I72 A;  4OOL A;  5EVI C;  2X01 A;  4C6Y A;  4NET A;  3VOZ A;  4DXC A;  5KSH A;  5J8X A;  4JBF A;  5HAI A;  4OLG A;  1MY8 A;  3IXD A;  4IVI A;  2ZLY A;  2XDM A;  2ZM8 A;  3O86 A;  4H8R A;  3Q81 A;  4OQH A;  4E6W A;  3BLM A;  3IF6 B;  4OVD A;  1SHV A;  2J8Y A;  4RX2 A;  1NRF A;  1M40 A;  2HDR A;  2ZMA A;  4R3J A;  1KE4 A;  1W8Q A;  2OSU A;  4GOG A;  5G18 A;  1ZKJ A;  5FQK A;  3VP2 A;  4FH4 A; 
#chains in the Genus database with same CATH topology
 2A2L A;  1HD8 A;  4QY6 A;  1V9Y A;  3ZVW A;  1YSP A;  2F2A C;  3CPT B;  4RYE A;  3S22 A;  2IO5 B;  3IF6 C;  4XT2 B;  2EX6 A;  4M3K A;  2D49 A;  5E43 A;  4H9S A;  1TZY D;  1TZY A;  3EG5 B;  5K5B A;  3FKW A;  4IBB A;  4OKP A;  2INW A;  3TE8 A;  3AZM D;  3OBF A;  3ZG9 B;  3BFE A;  3S7Q A;  4UUZ A;  3A3I A;  4LG2 A;  1VM1 A;  1BFM A;  3BM6 A;  5DJT A;  1KU5 A;  1LSV A;  3X1T C;  2NQB B;  2ARO A;  3M6H A;  3REL B;  4CAY B;  4OLD A;  1PIO A;  1Z6F A;  1HQ3 A;  1LSW A;  2DNS A;  4NK3 A;  2CC1 A;  2VEA A;  5JRG D;  2OWJ A;  4HJ6 A;  2HGV A;  3RFB A;  2DRW A;  2HJ9 C;  3AZG A;  1V9Z A;  1OT9 A;  3B6F D;  4XUJ B;  1KX4 A;  3MSH A;  3FC7 A;  2R9W A;  1MWS A;  1W1T A;  3HJI A;  3EPK A;  1YSQ A;  1S4R A;  5GLB A;  1YT4 A;  1VEU A;  1KVL A;  4F3L A;  3NQU B;  4E3O A;  4Y0U A;  2F8N B;  4IBR A;  1TZY C;  5HWT A;  1P3K A;  5DJU A;  3AZM C;  1ES3 A;  3MGP B;  1P3P D;  1VHM A;  2W3F A;  5BT1 D;  5DFY A;  5TJJ A;  1XJ3 A;  2PD7 A;  3WS4 A;  1SZV A;  3W98 A;  4Z2M G;  3UTB D;  5FAQ A;  5AV6 D;  3LIC A;  2D02 A;  1I2W A;  1P3B A;  5JRG C;  3NJA A;  3AV1 D;  3B6F C;  1OGB A;  2PDR A;  4JXG A;  4WU8 D;  2PBY A;  2ZC5 B;  4R3A A;  4DMZ A;  1ID3 A;  3T1X A;  2DMW A;  3W99 A;  1K4E A;  4WM9 A;  1OTA A;  3AZJ D;  2I9V A;  3REJ D;  1XFN A;  4G91 B;  3REJ A;  4HBU A;  1X0O A;  5HPF A;  3W4P A;  1P3K C;  3HLC A;  3LYX A;  4S2K A;  5FQ9 A;  4UAA A;  3AZN B;  1J9M A;  2ZD8 A;  3UT9 D;  5B2J D;  2L4R A;  3MQO A;  3SS5 A;  1PRQ A;  3IX4 A;  1H0G A;  2FJ7 B;  3W8K A;  4BLM A;  3C30 A;  3KSY A;  1YPR A;  1P3P C;  5BT1 C;  3ZFZ A;  3ICY A;  3LI8 A;  1TEM A;  4Y17 A;  4GDB A;  1ZLA D;  1STZ A;  4Z2G A;  5BNX A;  4IBF A;  3UTB C;  4UA9 A;  1EI5 A;  4MBH A;  3MQL A;  5CP6 B;  3V9R B;  5HW3 A;  1P3B C;  5M1A A;  2Y2N A;  1K54 A;  4IVK A;  4GJ4 A;  4GH9 A;  3C8C A;  3EGD C;  3HON A;  4EES A;  3AV1 C;  3X1T B;  5DNN A;  4NG2 A;  1ID3 C;  4E6X A;  3W99 C;  4BMW A;  2P9V B;  5JYP A;  1PWC A;  3AZE D;  3REJ C;  1UR8 A;  5FAO A;  2V2F F;  4WU9 D;  3TSG A;  3MQQ A;  3ZVT A;  4FH4 A;  1DJA A;  1YMS A;  5HL1 A;  5C3I B;  1DJB A;  2QKP A;  3GR2 A;  4Z2I A;  5J4E A;  3AZL D;  2XR0 A;  3N3F A;  2BAS A;  4DQY B;  3AZL A;  4IBJ A;  2Q9M A;  4WV4 B;  4HGA C;  1P3I D;  3WKJ D;  1P3I A;  3BY9 A;  3IWO A;  3L7H A;  2JKT I;  4WF0 A;  1ULY A;  3AN2 A;  5B2I A;  3AV2 D;  5TR7 A;  3HLW A;  3K2N A;  3AV2 A;  4HJ4 A;  1ZLA C;  4K0X A;  4E3J A;  1P3L B;  1TS8 A;  2CV5 D;  2CV5 A;  3O3V A;  4H9N B;  3CIT A;  3AZM B;  1K54 C;  4GHI B;  4KQQ A;  1RCJ A;  2M1C A;  5AVB D;  1OJG A;  3NHQ A;  1U35 A;  3VOY A;  4KZB A;  2Y2P A;  2JKG A;  4J8X B;  2P08 A;  5DNN C;  3FZC A;  2M7V A;  2ZOI A;  1J7M A;  2ZQA A;  2JSS A;  3NI9 A;  1MXO A;  1OGG A;  4DE2 A;  2HF6 A;  2Y2G A;  2X71 A;  3IBR A;  1S32 D;  5JRG B;  4KGC B;  2XSS A;  4H9P B;  3AZL C;  3DTE A;  4GCZ A;  4R6L A;  3B6F B;  5AQ7 A;  3G30 A;  1P3I C;  3H0M C;  1TDG A;  3AN2 C;  4OQ0 A;  5B2I C;  3H7W B;  2UWX A;  3REH D;  5GT0 D;  3REK A;  3AV2 C;  1Z09 A;  4CQH A;  1HTA A;  5GT0 A;  3REH A;  4K08 A;  5EPH A;  4PM8 A;  3WWX A;  5HDS A;  2LY8 A;  5L8M A;  5FDH A;  3LIF A;  2CV5 C;  2O0Y A;  4BD1 A;  1GA0 A;  3T4S A;  3IXB A;  5M19 A;  5F99 B;  5AVB C;  1YLW A;  2BG1 A;  2WUQ A;  4BJP A;  4WNN B;  1P3P B;  5DF8 A;  3PTE A;  2ZMV A;  1G68 A;  3PAE A;  2G5I C;  1OTB A;  4KG6 A;  5B1L D;  5CPJ A;  1Q9C A;  3MQ0 A;  5FQM A;  5FAP A;  2DQN C;  4R38 A;  4N1X A;  3UTB B;  1GSX A;  4Z66 D;  3G4P A;  4E3N A;  1CI8 A;  5AV6 B;  1AXB A;  3OOV A;  4KUD A;  2WZZ A;  5CRF A;  5F1F A;  1IYO A;  3C1C D;  2KDK A;  3FWL A;  5TBM A;  2LB5 A;  5AY8 D;  3AV1 B;  3M2J A;  4HNB A;  4Y0O A;  4WU8 B;  1N4O A;  3A6N A;  1NYM A;  2H5S A;  3AZJ B;  1W7F A;  3HJK A;  3REH C;  5GT0 C;  3C1B D;  4DE3 A;  3C1B A;  2PR5 A;  3BWL A;  1G6A A;  5DTS A;  4GD8 A;  1XJ4 A;  1KE0 A;  1PFL A;  3UT9 B;  5B2J B;  5FI7 A;  5HPI A;  2W3G A;  4EQ1 A;  5FUG B;  1KX3 A;  5F83 A;  3AZH D;  4J8V A;  3HUM A;  1ONG A;  2PD8 A;  1ERO A;  1LHY A;  1DJC A;  1PZR A;  1F66 A;  3MGR A;  3BY8 A;  2Y2O A;  5EUA A;  1P0Z A;  3MKF A;  4RA7 A;  1G28 A;  4J8U A;  1ZLA B;  4YFM A;  5AVC A;  3P98 A;  5EV0 A;  1N9B A;  4Z66 C;  4ZUX A;  3UTA A;  5E2H A;  1PNE A;  1D7E A;  3C1C C;  4R8P B;  5B32 D;  3L25 A;  3B42 A;  3O62 D;  1ONH A;  3A6N C;  2PYO A;  4PKY A;  3H0R C;  2XGN A;  3VH5 T;  3AZE B;  5B0Z D;  4WU9 B;  3C1B C;  5B0Z A;  5CXW A;  4U3T A;  4BWI A;  2W1R A;  4KZ5 A;  2ZM5 A;  5GXQ B;  1P3F D;  3DTM A;  3NY4 A;  4OPQ A;  1H3O A;  5B32 G;  2QPN A;  2V0W A;  3JPU A;  3MZE A;  3WKJ B;  1PW8 A;  1YU1 A;  1S4S A;  3UB8 A;  3WTP E;  1Y54 A;  3MGR C;  4NE3 A;  4P0M A;  3FYZ A;  3WTP D;  3WTP A;  4HOI A;  4H9Q B;  5B31 D;  4E44 A;  3IWI A;  3UTA C;  1P3M D;  3RH8 B;  2L0W A;  3HUO A;  3N8R A;  4M6B A;  4NEE D;  1K25 A;  4EO5 C;  2BYM B;  3MNN B;  2QHK A;  2PU4 A;  2ZQ7 A;  2H0T A;  2W27 A;  3LEL D;  4QY5 A;  5EVI D;  3T4J A;  5AVB B;  3LEL A;  5B32 C;  3WD1 A;  3JVV A;  4I38 A;  4CLC E;  4KZ7 A;  5L2F A;  4KG5 A;  4CLC A;  3UY6 A;  2PYO C;  5AQA A;  3R45 A;  2MJ6 A;  1ACF A;  5B0Z C;  4P6Z M;  3ZHH A;  4L9G A;  2IWB A;  1S32 B;  4H9R B;  3W96 A;  2C5W B;  1P3F C;  4MLL A;  3MGQ D;  5A91 A;  2ZY5 A;  2VKS A;  4IUK A;  3REI D;  4ARZ A;  1T3U A;  3UDF A;  1O07 A;  1IFQ A;  4KZ8 A;  3WTP C;  3BEC A;  1T18 A;  4FSF A;  2OV5 A;  3CPT A;  5AV5 D;  4XT2 A;  4EQI A;  4ZJ3 A;  4E3M A;  3T1Q B;  5AV5 A;  4U0X A;  1P3M C;  1ZG6 A;  1MC0 A;  4MB4 A;  3QP6 A;  1W63 Q;  4UPK A;  3NBL A;  2J3W A;  4X1L A;  5FEG A;  2I72 A;  5EVI C;  3LEL C;  2X01 A;  4NET A;  4DXC A;  1CJF A;  1YKD A;  2QYB A;  3Q81 A;  1IOU A;  5B1L B;  3REL D;  2NQB A;  3D72 A;  5B24 D;  3REL A;  4CAY A;  1ZKJ A;  5FQK A;  4Z66 B;  3L26 A;  1E3U A;  3C2W A;  1K55 C;  5F6A A;  3A3E A;  4IBD A;  1CK3 A;  2O9A A;  3C1C B;  2VGJ A;  1H8M A;  2Z2L B;  1NXY A;  4YOF A;  1W5D A;  5AY8 B;  3MGQ C;  3EEH A;  5G4Y A;  2VJW A;  3REI C;  2JKR M;  4XUJ A;  2ZM2 A;  3EPJ A;  3T4T A;  1D06 A;  2QJ5 A;  1F2K A;  4HJ3 A;  3T1S A;  3N4I A;  1KDS A;  1P3A D;  4HY8 A;  4O01 A;  2IO5 C;  2L1M A;  3NQU A;  5AV5 C;  5FEF A;  3W4O A;  1BLP A;  2Y55 A;  2F8N A;  3HLE A;  3H9W A;  3A0S A;  1IKG A;  3DAV A;  3AZH B;  3ZNY A;  3E2L A;  1BH9 B;  3MGS D;  1Y28 A;  3MGP A;  5AV8 D;  4I39 A;  4H6J B;  2NQB C;  2D01 A;  3REL C;  4I3A A;  3TU4 D;  5B24 C;  3VH6 W;  1FSY A;  3AFA D;  3PR6 A;  4BL3 A;  4EO5 B;  3VH6 A;  1U60 A;  3KYQ A;  4OJL A;  3BFD A;  1E6P A;  1YLJ A;  5CPK D;  5B32 B;  4QJG A;  3LJA D;  2EXA A;  3O62 B;  2J3T C;  3UME A;  4XUJ C;  1EQZ D;  3WS1 A;  2H10 A;  2HUE C;  3FDD A;  3B6G D;  4LRY C;  1P3A C;  4ZTK A;  1UR9 A;  3B0B A;  2OAP 1;  1NRJ A;  2WGW B;  2HJE A;  3KSF A;  4L9F A;  2Z6C A;  1S1Z A;  5HL6 A;  3V39 A;  1ODV A;  1IYP A;  3ZG7 B;  1P3F B;  1GSW A;  4ID4 A;  4IJE A;  2JKR I;  2PYP A;  1YLY A;  3AZN A;  2XD5 A;  4D60 A;  4S2M A;  3LZ0 D;  1F5M A;  3H82 B;  2RVQ D;  3FV7 A;  3HLD A;  4K0W A;  3LZ1 B;  2FJ7 D;  3MGP C;  4R0Q A;  4BBT A;  2FJ7 A;  1FIK A;  2J9P A;  1LL9 A;  5AV8 C;  5EFW A;  2EXB A;  4G3V A;  3OPR A;  4X6T A;  3TU4 C;  5B31 B;  4NXE A;  5AJG A;  1P3M B;  4MN5 A;  5HFO A;  3AFA C;  3EPH A;  3SH8 A;  2DF4 C;  5CP6 A;  1K4F A;  3V9R A;  4HI4 A;  5EVI B;  5CHL B;  4HBT A;  4D2O A;  1H8P A;  2W3H A;  3HLG A;  5CPK C;  1ALQ A;  1H3Q A;  2WGI A;  3X1T A;  2HP6 A;  3F1P B;  5E2F A;  3Q07 A;  3G31 A;  5IT5 A;  2P9V A;  4G91 C;  2CWE A;  5FA7 A;  4YNR A;  3OC2 A;  3T4K A;  3OPL A;  4YM6 D;  1E6R A;  3TOI A;  4YM6 A;  1VQQ A;  4E3I A;  3G2Z A;  4E3K A;  3MGQ B;  4BBU A;  3VFH A;  2WKQ A;  3REI B;  3MF0 A;  3AGE A;  4JF5 A;  2ZC3 B;  2FJ7 C;  3VP3 A;  3BFC A;  4WZ4 A;  2XRN A;  3IBJ A;  1NYY A;  5AV5 B;  1J3W A;  3W4Q A;  2FH5 A;  1P3L D;  4ZBE A;  4EV4 A;  5HX9 A;  3S7O A;  1P3L A;  3ZNT A;  3FPW A;  5CP6 C;  1FCN A;  1BLH A;  4H9N A;  1TS0 A;  3LCE A;  2Z6D A;  3AZM A;  1JWP A;  4GHI A;  2VV6 A;  4EUZ A;  2J80 A;  4J8X D;  3UE3 A;  4QHC A;  4Y5F A;  4J8X A;  5KDM B;  1WYB A;  2W3E A;  1TD5 A;  5BO0 B;  3C38 A;  4BL2 A;  2ACG A;  5B24 B;  4S2O A;  2BLS A;  4WEJ A;  1CF0 A;  2XD1 A;  4LRZ E;  5HWW A;  3IX8 A;  5IHV A;  5C3I C;  5EM1 A;  5BOH A;  4YM6 C;  1NZU A;  4KGC D;  2VA0 A;  5JRG A;  4KGC A;  4H9P A;  3E4Q A;  1MKI A;  3B6F A;  1OT6 A;  3IXG A;  2HUE B;  1NLY A;  2EWW A;  3X1U D;  2FFF B;  1OME A;  1P3A B;  1HVB A;  3H7W A;  3L29 A;  1YM1 A;  4N92 A;  4EBL A;  4JGP A;  1XXM A;  1P3L C;  3T12 B;  4YWZ A;  4KUO A;  5HAQ A;  3KXB B;  3DWZ A;  3MGS B;  5F99 D;  4PHT A;  5F99 A;  3WA9 D;  2VGL M;  4KQO A;  4J8X C;  5AV8 B;  3WA9 A;  4WNN A;  1P3P A;  3TU4 B;  3S7P A;  4AWL C;  3KFU G;  1NWZ A;  3MJQ A;  3NQJ B;  3AFA B;  4Y15 A;  3UTB A;  5AV6 A;  1GXD A;  1P3O B;  1BT5 A;  4KGC C;  1CK7 A;  5CPK B;  4LV3 A;  3LJA B;  3O88 A;  2VV8 A;  1A7W A;  5G49 A;  5F69 A;  4Y13 A;  1LI9 A;  3QP1 A;  1BTL A;  1EQZ B;  4HP4 A;  3AV1 A;  4E45 A;  4OJP A;  4UA6 A;  3B6G B;  1PYY A;  4WU8 A;  1M19 D;  4KZ9 A;  1XGI A;  3AZJ A;  5FQQ A;  2RIQ A;  2JKT M;  1M18 D;  5DKK A;  2XA7 S;  3LI9 A;  1M18 A;  1PWG A;  2PT7 A;  5CHJ A;  3U4L P;  4NYY A;  1PZP A;  4XUZ A;  1PI5 A;  3V5M A;  3UT9 A;  5B2J A;  3LZ0 B;  4DRT A;  2ZY4 A;  5B33 D;  1FSW A;  3BJN A;  5FUG A;  4GB7 A;  3ITB A;  5F99 C;  5HDC A;  3PYP A;  3WA9 C;  4IHQ A;  1YMX A;  3OZH A;  5D3O A;  4Q0I A;  3WD3 A;  1EAK A;  2A24 B;  2R9X A;  4MN6 A;  2IWC A;  4O8G A;  1ES2 A;  1ZLA A;  3D9Y A;  3OPP A;  5F82 A;  5GSU D;  5AV6 C;  4UHU A;  4ZBJ B;  3Q82 A;  5L07 A;  1RGZ A;  3PAG A;  4R8P D;  4R8P A;  1KS0 A;  3NDG A;  1H0I A;  1XGJ A;  4WU8 C;  3DTK A;  3ISG A;  2HV1 A;  3FPV A;  4JGO A;  4QNL A;  3UN7 A;  1M19 C;  3CUE A;  3AZJ C;  3AZE A;  2P74 A;  3KSG A;  1M18 C;  4WU9 A;  1FR6 A;  5AV9 D;  4YM6 B;  2EX2 A;  3LY4 A;  1B6W A;  5GXQ D;  4BEN A;  3UT9 C;  5B2J C;  5GXQ A;  4MMN A;  5B33 C;  1KVM A;  3ZG0 A;  3WKJ A;  1SKO B;  4WYY A;  3T4L A;  3O87 A;  3QNB A;  3VE3 A;  1GSV A;  2G2W A;  3MZF A;  5JYO A;  3AZF D;  3SS3 A;  2QMI A;  1KX5 D;  4Q0J A;  4XZQ D;  4H9Q A;  1M6K A;  4IBX A;  2WKP A;  5GLD A;  5GSU C;  1DP6 A;  3EOI A;  3MNN D;  1OPX A;  3MNN A;  2BYM A;  2K31 A;  3W97 D;  4L9E A;  4NKP A;  4R8P C;  3B0D C;  5J7E A;  5AVB A;  4MNR A;  4HEF A;  3VSK A;  3N8S A;  2C6W B;  3HVF A;  3WX7 A;  4QB8 A;  4AWL B;  3CUE C;  3KX0 X;  2RCX A;  4JKT A;  3AZE C;  1MZU A;  4WU9 C;  4UEY A;  5B1M B;  4GNU A;  5AV9 C;  1Z2C B;  2VZW A;  1K56 D;  4IBG A;  2ZC7 A;  2JCH A;  1K56 A;  5HWV A;  1S32 A;  1AOI D;  5GXQ C;  4H9R A;  3R7W B;  4C75 A;  3NOT C;  4IBC A;  5EOE A;  4LV1 A;  3IQA A;  3WKJ C;  3AZK B;  2G5H C;  3F1N B;  3X1U B;  2NZD D;  4GKU A;  4IED A;  2IA2 A;  1S6R A;  1N9L A;  3AZF C;  3PBN A;  4DJ3 A;  3KWQ D;  4EET B;  3F1O B;  1YU4 A;  1EW0 A;  4Z2L A;  3MNN C;  2B02 A;  3T50 A;  4H9O B;  2JHE A;  3W97 C;  1XA1 A;  3WA9 B;  1GHP A;  4NYU A;  3CJM A;  3JYI A;  3PXP A;  3L28 A;  3VP4 A;  5B1L A;  1G6O A;  1MWT A;  2Q9N A;  3LIE A;  4ZRR A;  5CHU A;  4Z66 A;  3VH6 T;  2L5A A;  3W2Z A;  3TG9 A;  4MBF A;  3IHA A;  1S32 C;  3C1C A;  4X56 A;  1O7E A;  5G49 B;  2FN2 A;  1ED7 A;  5L10 A;  3L27 A;  1RP5 A;  4GS9 B;  5AY8 A;  4G92 B;  3IF5 A;  5CTN A;  3L2A A;  4FCF A;  1M19 B;  2ZL1 B;  3PBO A;  3VOZ A;  1M18 B;  3KWQ C;  4IVI A;  3M7P A;  4H8R A;  4O0P A;  4OQH A;  3WD2 A;  3BLM A;  2VX8 A;  2J8Y A;  3D3O A;  3AYW D;  4R3J A;  1W8Q A;  5B33 B;  3L9K A;  4X23 D;  3AZH A;  1BH9 A;  4ETZ A;  1H5X A;  4QWO A;  4H6J A;  5B1L C;  1NZO A;  2ZM0 A;  3WRZ A;  2GNX A;  4S2N A;  5GSU B;  1T1B A;  1OTD A;  3G35 A;  3A1K A;  3KSH A;  5CER A;  3B0D B;  2XQZ A;  5A8B A;  4HH2 A;  4HME A;  1W2E A;  3NIA A;  5B32 A;  5AY8 C;  3CHW P;  5CGW A;  3U2A A;  5E2E A;  3BW6 A;  3O62 A;  3EQV A;  4AFI A;  3MBZ A;  1LSX A;  2ZMF A;  3CAX A;  1DY6 A;  2JC7 A;  5TFQ A;  2YKF A;  2HPB A;  5AV9 B;  3IS2 B;  2WGW A;  2PHY A;  4DRB A;  3KUY B;  3B3X A;  1XX2 A;  3NDE A;  1P3F A;  4ZJ2 A;  3AYW C;  1CXW A;  2XA7 M;  3QP2 A;  4WL9 A;  3AZH C;  4RX3 A;  4DKI A;  4ZDX A;  2J8P A;  1ZC2 A;  4X23 C;  3LZ1 D;  3H82 A;  3LIB A;  3LZ1 A;  1XPB A;  4OP5 A;  5LBR A;  3BYD A;  4EWF A;  4F94 A;  2HP9 A;  3C4O A;  3AZF B;  1L0G A;  1KX5 B;  2ZY2 A;  4XZQ B;  3RJU A;  4X1M A;  4S2N C;  5B31 A;  4O7D A;  4X69 A;  3MFX A;  1P3M A;  2G7U A;  2CMN A;  3GEC A;  1L0E A;  2KLI A;  4N9K A;  3QP8 A;  3W97 B;  5EVI A;  3OPH A;  1MKM A;  3MR0 A;  3O62 C;  3WD4 A;  2HP5 A;  2WKI A;  2EWV A;  3KS8 A;  4NY2 A;  2E8J A;  3F1P A;  5B31 G;  5TGF A;  4MEZ A;  2HIO D;  4NZ5 A;  2HIO A;  2Y8H A;  5EOO A;  1K55 A;  4DJ2 A;  1MWU A;  2V20 A;  2V8F A;  3G32 A;  3MS6 A;  2BTF P;  1AOI B;  5DF7 A;  4DRA A;  1P3G D;  4JGR A;  1KGF A;  3MVD D;  1XKZ A;  4OJO A;  1T19 A;  3MGQ A;  5FAT A;  3REI A;  3LZ1 C;  5HSQ A;  3VFF A;  2NZD B;  1PW1 A;  1BYW A;  3CMZ A;  3NC8 A;  3V3R A;  3X1V D;  4PM6 A;  4HQA A;  3KWQ B;  4Y2F A;  5B31 C;  3NEC A;  4NXF A;  2W0N A;  5B40 B;  3N7W A;  3PBS A;  3AZI D;  4R23 A;  3CZD A;  4OOM A;  4IJG A;  1TDL A;  5FQJ A;  5HD5 A;  1TS7 A;  4EU0 A;  4JJN B;  5KDM A;  5GT3 D;  2ZY3 A;  5CHM A;  5BO0 A;  4WJ3 C;  2W1T B;  4Y0T A;  5B24 A;  3LIA A;  2HIO C;  1BSG A;  1UWN X;  4FH2 A;  4LGW A;  2V8C A;  2Y59 A;  5AQ9 A;  1BUL A;  1AIW A;  1BUE A;  4WEK A;  5A92 A;  1IEM A;  4X68 A;  5FQI A;  4DE1 A;  2NUT C;  3DW0 A;  5GLA A;  4R1G A;  3WAA D;  3LEZ A;  3UDX A;  2VQR A;  1P3A A;  3X1S D;  4QLC D;  3X1V C;  2XF3 A;  2WK0 A;  4MCW A;  2WGV A;  3AZI C;  4FD8 A;  3AYW B;  5DTK A;  2YFV B;  3KXB D;  4X23 B;  3KXB A;  1WE4 A;  2F8N H;  4YIN A;  3MGS A;  3CG5 A;  3P09 A;  1S66 L;  2E8I A;  3BFG A;  5AV8 A;  1YU3 A;  4UA7 A;  3ZQ5 A;  3KSI A;  5GT3 C;  1JFI B;  1L6J A;  4B9O A;  2WAE A;  4YS3 D;  3TU4 A;  1XA7 A;  3OLO A;  1MPL A;  3NQJ A;  4IBE A;  3AFA A;  2VLG A;  2XFT A;  3T4Q A;  1P3O D;  1ZHH B;  3Q7Z A;  1P3O A;  5CPK A;  3MKE A;  2V0U A;  3PBQ A;  4LRX C;  4XUX A;  5E5A B;  3LJA A;  3EGX C;  5DKL A;  4NXB A;  2Y79 A;  4OP8 A;  1EQZ A;  5HD3 A;  2H28 A;  4B93 A;  1B67 A;  1VB6 A;  3GMW A;  4IJF A;  4P85 A;  2O9B A;  3B6G A;  3NCK A;  2XLN A;  3BRM A;  3UE6 A;  3HLB A;  4QLC C;  4DDY A;  3CLO A;  1PWD A;  1YU2 A;  5I5L A;  3BQA A;  4EEP A;  1S67 L;  4LD9 B;  4Z1W A;  4CPK A;  3IP4 C;  4BBV A;  1K57 A;  4I3I A;  1XFQ A;  3KXB C;  3LZ0 A;  3E0Y A;  2O9C A;  2Z2M B;  3MGS C;  2EFU A;  1WWI A;  2YKH A;  1H8Z A;  4WN5 A;  4R4R A;  2A24 A;  1W1Y A;  1Y4O A;  1IYS A;  2PR6 A;  3G2Y A;  1E88 A;  1P3O C;  5DNM D;  2K2N A;  3UMD A;  4OQI A;  3BLS A;  2OLV A;  5B0Y D;  3LJA C;  3FKE A;  1EQZ C;  2ZQC A;  3C7V A;  1NJ4 A;  1YQS A;  4Z2H A;  1M1A D;  3B6G C;  1P97 A;  3H0L C;  5CPI B;  4L0L A;  3OCL A;  1KGG A;  3B47 A;  2HIO B;  1KGE A;  4WEL A;  4HHD A;  4LCM A;  4WMC D;  4Y7P A;  5CED A;  1P3G B;  4WMC A;  1K57 C;  2ZOH A;  1HTZ A;  5EE8 A;  3MVD B;  3N8L A;  3LZ0 C;  1LI0 A;  3GVB A;  2RVQ C;  3LR4 A;  1BLS A;  3N6I A;  3IT9 A;  1SKO A;  2WZX A;  1WA9 A;  5KMW A;  4B88 A;  1W1V A;  1I5Q A;  3VH5 A;  3X1V B;  3TRC A;  1ZTU A;  1YAX A;  1EWZ A;  4BQM A;  1ESU A;  1PZO A;  2JBF A;  3IH9 A;  4EER A;  3AZI B;  2IOU A;  1MWR A;  4ZBJ C;  1CI9 A;  4DXB A;  3IXH A;  3A0V A;  4FOF A;  2Y2I A;  5B0Y C;  5KZH A;  3E4P A;  1BH8 B;  1AWI A;  5GT3 B;  4NFT A;  5CTM A;  1M1A C;  5HZH A;  1FCM A;  4UQI S;  2OOL A;  3AL0 C;  4ETX A;  5B1M D;  5B1M A;  2EA9 A;  3SH9 A;  1VET B;  1RGY A;  1P34 B;  3A3J A;  3KYE A;  3R7W A;  4KZ6 A;  5U47 A;  3GSG A;  2ARO D;  4OJ5 A;  4TX8 A;  3SW1 A;  3A0R A;  1E8B A;  3AZK D;  3WAA B;  3C5A A;  4JF6 A;  3AZK A;  1Q2P A;  3F1N A;  1HQ3 D;  3X1U A;  3X1S B;  4QLC B;  1F9I A;  4KG2 A;  3F1O A;  4IBK A;  4DDS A;  3E2K A;  2AVX A;  1OJ5 A;  3AZG D;  3B0C W;  5BNV B;  3SZT A;  4CSR B;  1DP9 A;  1KX4 D;  3MXQ A;  4LFU A;  4H9O A;  4KHA B;  4Z2M H;  4J8W B;  3GTC A;  4HMD A;  3VOL A;  3I7J A;  4LV2 A;  1QMF A;  1GA9 A;  4RQ9 A;  3LID A;  2J7V A;  2JN7 A;  1K6S A;  2WKH A;  5A93 A;  1LL8 A;  4H9S C;  3BEB A;  4YS3 B;  1O6I A;  2XFS A;  1P3K D;  1E4D A;  1P9W A;  5B1M C;  4I5S A;  2KX6 A;  3LGO A;  2P04 A;  4GW9 A;  2YFW B;  2EFX A;  4FTX A;  3D4F A;  1DP8 A;  2ARO C;  1I2S A;  3KYZ A;  4GS9 A;  3AZK C;  5BPV A;  3W98 D;  5A90 A;  3X1U C;  4B4X A;  1HQ3 C;  1M19 A;  2ZL1 A;  1XJ6 A;  4IUH A;  2WYX A;  3B33 A;  1ERM A;  1P3B D;  4LCL A;  2V1B A;  3Q7V B;  3E98 A;  3F6T A;  5IS1 A;  3AZG C;  1FCO A;  3DBA A;  4X55 A;  5HAP A;  1KX4 C;  5B33 A;  1ID3 D;  4QPR A;  3W99 D;  2BYK B;  3HLF A;  4JXV A;  1TAF B;  3GDI A;  1CQA A;  3VV4 A;  4Y3I A;  1T1C A;  5DVA A;  4ME4 A;  4Z2J A;  2H0Y A;  4Z5T B;  4G3K A;  3UB6 A;  4ZJ1 A;  3EPL A;  2OLU A;  5GSU A;  3LFV A;  4NE6 A;  5DNM B;  5B0Y B;  4JBF A;  3IXD A;  4ESP A;  2ZLY A;  2XDM A;  2XRO A;  4G92 C;  3HSH A;  3IF6 B;  4OVD A;  1M1A B;  3W98 C;  1M40 A;  2HDR A;  2ZMA A;  5G18 A;  2OSU A;  4KZ3 A;  1A0K A;  2WAD A;  1N1J B;  3UE0 A;  2PAV P;  1MBL A;  5AV9 A;  3IS2 A;  4JF4 A;  4CJN A;  3EEA A;  3KUY D;  1L3L A;  4NZ1 A;  4GHL A;  3KUY A;  4II7 A;  1WYC A;  4WZS B;  3ULF A;  5DNN D;  1UGU A;  4XXR A;  4PM9 A;  4P6Z S;  4GD6 A;  3LO7 A;  5JA4 B;  3M6B A;  3R4K A;  4FUW A;  3LR3 A;  3G34 A;  5EM0 A;  1TS6 A;  2HZ5 A;  3AZF A;  1KX5 A;  4XZQ A;  3UPN A;  1SKF A;  2ZQ8 A;  4WUJ A;  4A5R A;  1S1Y A;  3IHB A;  3UPO A;  2UV0 E;  2ZQ9 A;  4I3J A;  3LY3 A;  3W97 A;  3EWK A;  3Q1F A;  3AN2 D;  2OWH A;  5B2I D;  2QZ6 A;  4OPY A;  1ZG4 A;  1CEF A;  1S0W A;  1TZY B;  3P01 A;  2W3D A;  5I94 A;  4P6B A;  1NLZ A;  3P7N A;  3ZCZ A;  4UUZ B;  3KUY C;  1U35 D;  2PBD P;  3UPP A;  1AOI A;  2V1Z A;  3RXX A;  3GRJ A;  4Q0H A;  4G3W A;  2ARO B;  1IYQ A;  1FOF A;  1QME A;  4S2J A;  4U0T A;  4WBG A;  2XK1 A;  1FQG A;  3KO6 A;  5G4Z A;  4OJ6 A;  1HQ3 B;  2NZD A;  4OOY A;  2Y91 A;  5C5K A;  2K7S A;  2V1A A;  4E3L A;  4NE5 A;  1KX5 C;  2KOI A;  4XZQ C;  3KWQ A;  3A1I A;  2GDN A;  5B40 D;  3AZG B;  2FZ0 A;  5B40 A;  3AGF A;  3GV9 A;  4HMC A;  1KX4 B;  3LR5 A;  1JTG A;  3K3D A;  4NZ3 A;  1VEU B;  4MB5 A;  4GZB A;  3REK D;  4F3L B;  4JJN D;  1W63 M;  5EEC A;  3P5J B;  4JJN A;  4ZAM A;  4LLO B;  1P3K B;  1KDW A;  4K91 A;  2J9O A;  2W1T A;  2Y4A A;  3C4P A;  1Q2Q A;  4JPM A;  4E04 A;  1U35 C;  1AOI C;  5FI6 A;  4UQI M;  5AVF A;  4GN2 A;  4HH3 A;  1YU0 A;  2A49 A;  5CPJ D;  3UO9 A;  1YUE A;  3W98 B;  3GQZ A;  1YLT A;  2NZD C;  2PRF A;  1P9R A;  2V5O A;  4OUI A;  1JWZ A;  3QP4 A;  5GL9 A;  4KZA A;  3V67 A;  4KUD D;  3ZG5 A;  4OH0 A;  1P3B B;  2ZC4 B;  5FL3 A;  3WS5 A;  5DF9 A;  5KSC A;  2XEP A;  4R70 A;  1JVJ A;  5B40 C;  3KS4 A;  3K3C A;  1K0K A;  5IU1 A;  3AYW A;  3O5Y A;  5BS7 A;  2YFV A;  1ID3 B;  3A6N D;  3W99 B;  4X23 A;  3UE1 A;  2PYR A;  4KZ4 A;  1E15 A;  4PPR A;  3PBT A;  3REK C;  3REJ B;  1JWV A;  3S7N A;  2GZA A;  2RTS A;  4JJN C;  3TJZ C;  1JFI A;  2DCF A;  4LPZ A;  4C3Q A;  4OPR A;  2EX9 A;  5L09 A;  3V50 A;  2QWS A;  1FR1 A;  4JXW A;  1KX3 D;  1KE3 A;  4J8V D;  4HGA B;  5GHY A;  1L2S A;  1F66 D;  4HIA A;  3MGR D;  4R3B A;  3JVU A;  5E5A D;  3QNC A;  5KIZ A;  1L0F A;  5E5A A;  2HDQ A;  4S2I A;  3V3S A;  5CPJ C;  4J8U D;  2LB9 A;  4EW7 A;  4X53 A;  5BNX B;  5AVC D;  2ZBB A;  3MZD A;  4KQR A;  4WLA A;  4ZUX D;  3UTA D;  1SDE A;  3HCY A;  3LUQ A;  4KUD C;  2GX5 A;  3WS0 A;  1F98 A;  4LD9 D;  5GHX A;  2GJ3 A;  4S2P A;  4LD9 A;  4DN0 A;  1LL5 A;  5DNN B;  3A3F A;  5BS7 C;  3MXR A;  2B95 A;  2PYO D;  5GHZ A;  5DTT A;  1JTD A;  2HDU A;  3S4X A;  1BZA A;  1W79 A;  1W8Y A;  2O99 A;  4HES A;  3HL9 A;  1DRM A;  3IX3 A;  1XJ2 A;  3AZL B;  4PAU A;  2Y2K A;  1KX3 C;  2WKE A;  3LEQ A;  2ZQD A;  4J8V C;  1XP4 A;  1P3I B;  4EBN A;  4Z2K A;  3QP5 A;  2OAQ 1;  3OCN A;  1F66 C;  4PKY G;  3AN2 B;  5E5A C;  4EEU A;  5B2I B;  4X25 A;  3AV2 B;  3VSL A;  3HRE A;  1YLP A;  4J8U C;  5CEB A;  4RVA A;  3VMA A;  3G6O A;  1WWS A;  5AVC C;  5CPI D;  5CGX A;  4ZUX C;  5CPI A;  2CV5 B;  2M7U A;  2B18 A;  3LR0 A;  5CGS A;  5AQB A;  2QJ7 A;  4Q8I A;  1GHM A;  4LD9 C;  1U35 B;  5AVE A;  1LLB A;  3PHY A;  1P3G A;  3MXS A;  3MVD A;  4P87 A;  4CLC D;  3QHY A;  5M18 A;  1IEL A;  1IKI A;  2Y2H A;  5EVE A;  3UNW A;  4OON A;  2Y2Q A;  1C3B A;  2XH9 A;  1ES4 A;  3ZYT A;  3X1V A;  4M4X A;  3UB7 A;  3RXW A;  3IH8 A;  3W96 D;  5FI2 A;  4MDZ A;  1H0M A;  1K38 A;  3NUL A;  3AZI A;  3ZG8 B;  2HDS A;  3B0C T;  1HZO A;  4N9L A;  1LT0 A;  4OPZ A;  5DFX A;  4Z9Q A;  3REK B;  3T1R A;  3VP1 A;  4KQD A;  1BH8 A;  3REH B;  5GT0 B;  5GLC A;  1PI4 A;  1TVF A;  3NOP C;  5GT3 A;  5FDS A;  5CPI C;  1CEG A;  1G5U A;  2VGL S;  3SS4 A;  1GCE A;  3RTY A;  1R4V A;  4GDN A;  1P34 D;  1VET A;  1P3G C;  4PM5 A;  1P34 A;  3MVD C;  4JLF A;  4JXS A;  2Y2M A;  5CPJ B;  4CLC C;  3E4O A;  2NQB D;  2EX8 A;  3WAA A;  3WD0 A;  1JNU A;  5F68 A;  5F1G A;  5E2G A;  1F1E A;  1E3U D;  2Y2L A;  3ZDJ A;  4JGQ A;  3IWQ A;  3M2K A;  3VE4 A;  4KUD B;  3X1S A;  2JKF A;  4PMA A;  4QLC A;  2PU2 A;  1GOI A;  3W96 C;  3BFF A;  5TBM B;  3DWK A;  2Q0O A;  3BQ8 A;  3A3D A;  1E6Z A;  4LEN A;  4B4Z A;  5BNV A;  4CSR A;  2VK3 A;  2J3T D;  4KEN B;  4S2L A;  4XUJ D;  2VGK A;  3C7U A;  3A6N B;  4IBI A;  2WKR A;  3HBR A;  4J8W D;  2ZJ9 A;  5F5Y A;  4KHA A;  2V9A A;  4J8W A;  4LV0 A;  5HAR A;  3SH7 A;  2Y2J A;  3C1B B;  4GHA A;  2IWD A;  2F8N D;  1QO6 A;  5CX7 A;  4YS3 A;  3MFD A;  3VP0 A;  1KX3 B;  1GHI A;  3SOI A;  4J8V B;  4NZ4 A;  1E25 A;  1NY0 A;  1P34 C;  1F66 B;  3MGR B;  1HLU P;  3MGP D;  2YFW A;  1ERQ A;  4QD4 A;  1OTE A;  4J8U B;  3AGD A;  3WAA C;  2A3U A;  5HDD A;  5AVC B;  1GPF A;  4ZUX B;  3UTA B;  2F8N G;  4WZ5 A;  4NXG A;  3UB9 A;  1KOU A;  3X1S C;  3T4O A;  3PBR A;  1T1A A;  1ES5 A;  1YLZ A;  3Q7V A;  3CWF A;  4N1H A;  4KUK A;  1H8Y A;  4OQG A;  4GLQ A;  5FSR A;  2PYO B;  3UDI A;  4J8W C;  2G2U A;  4MB3 A;  1FIL A;  2P7J A;  2RL3 A;  2BYK A;  5EVL A;  3UB5 P;  1TAF A;  2R78 A;  5B0Z B;  3HUN A;  4R4S A;  4Z5T D;  4YS3 C;  4Z5T A;  3ITA A;  5MC7 A;  1PDC A;  1H3O B;  4QU3 A;  3AZN D;  1TF1 A;  4EXO A;  5FAS A;  3FKV A;  1UWP X;  1K6R A;  2FFY A;  4PM7 A;  5DNM A;  2X02 A;  5B0Y A;  3WTP B;  3TW8 A;  1N9O A;  2JE5 A;  3WRT A;  3IF6 A;  4EUV A;  3EQU A;  1M1A A;  4WZ5 C;  2VV7 A;  4EBP A;  2B5R A;  3S1Y A;  1SDN A;  4MN7 A;  2WAF A;  2NUP C;  1L0D A;  5CP6 D;  1N1J A;  4HP9 A;  4MBK A;  3LEL B;  1E6N A;  4DE0 A;  3WS2 A;  1ESI A;  5J3W A;  3X1T D;  4CLC B;  3DTI A;  4BD0 A;  3CI6 A;  1BLC A;  1N9N A;  3R45 B;  5CEC A;  3VH5 W;  2ZC6 B;  4DF6 A;  2W8S A;  5JA4 A;  1SCW A;  2F8N K;  1W1P A;  1D1J A;  4OOL A;  3MMH A;  4C6Y A;  5KSH A;  5J8X A;  5HAI A;  4OLG A;  1MY8 A;  4Z5T C;  3FG8 A;  2ZM8 A;  3O86 A;  3W96 B;  1OTI A;  4E6W A;  1SHV A;  3AZN C;  4RX2 A;  1NRF A;  1KE4 A;  4GOG A;  4ARZ B;  3ZGA B;  3VP2 A;  5DNM C;  3NOU C; 
#chains in the Genus database with same CATH homology
 1HD8 A;  4QY6 A;  3ZVW A;  2F2A C;  4RYE A;  3S22 A;  2IO5 B;  3IF6 C;  2EX6 A;  4M3K A;  5E43 A;  4H9S A;  1TZY D;  1TZY A;  3EG5 B;  3FKW A;  4IBB A;  4OKP A;  3AZM D;  3ZG9 B;  3BFE A;  4UUZ A;  3A3I A;  4LG2 A;  1VM1 A;  1BFM A;  3BM6 A;  1KU5 A;  3X1T C;  2NQB B;  2ARO A;  3M6H A;  3REL B;  4CAY B;  4OLD A;  1PIO A;  1Z6F A;  1HQ3 A;  2DNS A;  4NK3 A;  2CC1 A;  5JRG D;  2DRW A;  3AZG A;  3B6F D;  4XUJ B;  1KX4 A;  2R9W A;  1MWS A;  3EPK A;  5GLB A;  1YT4 A;  1KVL A;  3NQU B;  4E3O A;  4Y0U A;  2F8N B;  4IBR A;  1TZY C;  1P3K A;  3AZM C;  1ES3 A;  3MGP B;  1P3P D;  5BT1 D;  3WS4 A;  3W98 A;  4Z2M G;  3UTB D;  5FAQ A;  5AV6 D;  1I2W A;  1P3B A;  5JRG C;  3AV1 D;  3B6F C;  4JXG A;  4WU8 D;  2PBY A;  2ZC5 B;  1ID3 A;  3W99 A;  1K4E A;  4WM9 A;  3AZJ D;  3REJ D;  4G91 B;  3REJ A;  4HBU A;  3W4P A;  1P3K C;  3HLC A;  4S2K A;  5FQ9 A;  4UAA A;  3AZN B;  1J9M A;  2ZD8 A;  3UT9 D;  5B2J D;  3SS5 A;  2FJ7 B;  3W8K A;  4BLM A;  3KSY A;  1P3P C;  5BT1 C;  3ZFZ A;  1TEM A;  4GDB A;  1ZLA D;  5BNX A;  4IBF A;  3UTB C;  4UA9 A;  1EI5 A;  4MBH A;  5CP6 B;  3V9R B;  5HW3 A;  1P3B C;  5M1A A;  2Y2N A;  1K54 A;  4IVK A;  4GH9 A;  3HON A;  3AV1 C;  3X1T B;  5DNN A;  4E6X A;  1ID3 C;  3W99 C;  2P9V B;  5JYP A;  1PWC A;  3AZE D;  3REJ C;  5FAO A;  2V2F F;  4WU9 D;  3TSG A;  3ZVT A;  1DJA A;  1YMS A;  5HL1 A;  5C3I B;  1DJB A;  3GR2 A;  3AZL D;  2XR0 A;  3N3F A;  4DQY B;  3AZL A;  4IBJ A;  2Q9M A;  4WV4 B;  4HGA C;  1P3I D;  3WKJ D;  1P3I A;  3IWO A;  1ULY A;  3AN2 A;  5B2I A;  3AV2 D;  5TR7 A;  3HLW A;  3AV2 A;  1ZLA C;  4K0X A;  4E3J A;  1P3L B;  2CV5 D;  2CV5 A;  3O3V A;  4H9N B;  3AZM B;  1K54 C;  4KQQ A;  1RCJ A;  5AVB D;  1U35 A;  3VOY A;  4KZB A;  2Y2P A;  4J8X B;  5DNN C;  3FZC A;  2ZQA A;  2JSS A;  3NI9 A;  1MXO A;  4DE2 A;  2Y2G A;  2X71 A;  1S32 D;  5JRG B;  4KGC B;  4H9P B;  3AZL C;  3B6F B;  5AQ7 A;  3G30 A;  1P3I C;  3H0M C;  1TDG A;  3AN2 C;  4OQ0 A;  5B2I C;  2UWX A;  3REH D;  5GT0 D;  3REK A;  3AV2 C;  1HTA A;  5GT0 A;  3REH A;  5EPH A;  4PM8 A;  3WWX A;  2LY8 A;  5FDH A;  2CV5 C;  4BD1 A;  1GA0 A;  3IXB A;  5M19 A;  5F99 B;  5AVB C;  1YLW A;  2BG1 A;  2WUQ A;  4BJP A;  4WNN B;  1P3P B;  5DF8 A;  3PTE A;  1G68 A;  3PAE A;  2G5I C;  4KG6 A;  5B1L D;  5CPJ A;  1Q9C A;  5FQM A;  5FAP A;  2DQN C;  4N1X A;  3UTB B;  4Z66 D;  3G4P A;  4E3N A;  1CI8 A;  5AV6 B;  1AXB A;  4KUD A;  2WZZ A;  5CRF A;  5F1F A;  1IYO A;  3C1C D;  3FWL A;  5AY8 D;  3AV1 B;  3M2J A;  4Y0O A;  4WU8 B;  1N4O A;  3A6N A;  1NYM A;  2H5S A;  3AZJ B;  1W7F A;  3REH C;  5GT0 C;  3C1B D;  4DE3 A;  3C1B A;  1G6A A;  5DTS A;  4GD8 A;  1KE0 A;  3UT9 B;  5B2J B;  5FI7 A;  5FUG B;  1KX3 A;  5F83 A;  3AZH D;  4J8V A;  3HUM A;  1ONG A;  1ERO A;  1LHY A;  1DJC A;  1PZR A;  1F66 A;  3MGR A;  2Y2O A;  5EUA A;  3MKF A;  4RA7 A;  4J8U A;  1ZLA B;  4YFM A;  5AVC A;  3P98 A;  1N9B A;  4Z66 C;  4ZUX A;  3UTA A;  5E2H A;  3C1C C;  4R8P B;  5B32 D;  3L25 A;  3O62 D;  1ONH A;  3A6N C;  2PYO A;  2XGN A;  3H0R C;  3VH5 T;  3AZE B;  5B0Z D;  4WU9 B;  3C1B C;  5B0Z A;  5CXW A;  4U3T A;  4KZ5 A;  2ZM5 A;  5GXQ B;  1P3F D;  3DTM A;  3NY4 A;  4OPQ A;  1H3O A;  5B32 G;  2QPN A;  3MZE A;  3WKJ B;  1PW8 A;  1YU1 A;  3WTP E;  1Y54 A;  3MGR C;  4NE3 A;  4P0M A;  3FYZ A;  3WTP D;  3WTP A;  4H9Q B;  5B31 D;  4E44 A;  3IWI A;  3UTA C;  1P3M D;  3HUO A;  3N8R A;  4M6B A;  1K25 A;  4EO5 C;  2BYM B;  3MNN B;  2PU4 A;  2ZQ7 A;  2H0T A;  4QY5 A;  3LEL D;  5EVI D;  5AVB B;  3LEL A;  5B32 C;  4KZ7 A;  5L2F A;  4KG5 A;  3UY6 A;  2PYO C;  5AQA A;  3R45 A;  5B0Z C;  3ZHH A;  2IWB A;  1S32 B;  4H9R B;  3W96 A;  2C5W B;  1P3F C;  4MLL A;  3MGQ D;  5A91 A;  2ZY5 A;  3REI D;  1T3U A;  3UDF A;  1O07 A;  4KZ8 A;  3WTP C;  3BEC A;  4FSF A;  2OV5 A;  5AV5 D;  4EQI A;  4ZJ3 A;  4E3M A;  5AV5 A;  4U0X A;  1P3M C;  1ZG6 A;  4UPK A;  3NBL A;  2I72 A;  5EVI C;  3LEL C;  2X01 A;  4NET A;  4DXC A;  3Q81 A;  5B1L B;  3REL D;  2NQB A;  5B24 D;  3REL A;  4CAY A;  1ZKJ A;  5FQK A;  4Z66 B;  3L26 A;  1E3U A;  1K55 C;  3A3E A;  4IBD A;  1CK3 A;  2VGJ A;  3C1C B;  2Z2L B;  1NXY A;  1W5D A;  5AY8 B;  3MGQ C;  3REI C;  4XUJ A;  2ZM2 A;  3EPJ A;  3N4I A;  1KDS A;  1P3A D;  2IO5 C;  3NQU A;  5AV5 C;  3W4O A;  1BLP A;  2Y55 A;  2F8N A;  3HLE A;  1IKG A;  3AZH B;  3ZNY A;  3E2L A;  1BH9 B;  3MGS D;  3MGP A;  5AV8 D;  2NQB C;  3REL C;  3TU4 D;  5B24 C;  3VH6 W;  1FSY A;  3AFA D;  4BL3 A;  4EO5 B;  3VH6 A;  1U60 A;  4OJL A;  3BFD A;  1YLJ A;  5CPK D;  5B32 B;  4QJG A;  3LJA D;  2EXA A;  3O62 B;  4XUJ C;  1EQZ D;  3WS1 A;  2H10 A;  2HUE C;  3FDD A;  3B6G D;  1P3A C;  4ZTK A;  3B0B A;  2WGW B;  3V39 A;  1IYP A;  3ZG7 B;  1P3F B;  4ID4 A;  4IJE A;  1YLY A;  3AZN A;  2XD5 A;  4S2M A;  3LZ0 D;  2RVQ D;  3FV7 A;  3HLD A;  4K0W A;  3LZ1 B;  2FJ7 D;  3MGP C;  4R0Q A;  2FJ7 A;  2J9P A;  1LL9 A;  5AV8 C;  2EXB A;  3OPR A;  4X6T A;  3TU4 C;  5B31 B;  1P3M B;  5HFO A;  3AFA C;  3EPH A;  3SH8 A;  2DF4 C;  5CP6 A;  1K4F A;  3V9R A;  5EVI B;  5CHL B;  4HBT A;  4D2O A;  3HLG A;  5CPK C;  1ALQ A;  2WGI A;  3X1T A;  2HP6 A;  5E2F A;  3Q07 A;  3G31 A;  2P9V A;  4G91 C;  2CWE A;  5FA7 A;  3OC2 A;  3OPL A;  4YM6 D;  3TOI A;  4YM6 A;  1VQQ A;  4E3I A;  3G2Z A;  4E3K A;  3MGQ B;  3VFH A;  3REI B;  3AGE A;  4JF5 A;  2ZC3 B;  2FJ7 C;  3VP3 A;  3BFC A;  4WZ4 A;  1NYY A;  5AV5 B;  3W4Q A;  4ZBE A;  1P3L D;  4EV4 A;  5HX9 A;  1P3L A;  3ZNT A;  5CP6 C;  1FCN A;  1BLH A;  4H9N A;  3LCE A;  3AZM A;  1JWP A;  4EUZ A;  4J8X D;  3UE3 A;  4QHC A;  4J8X A;  5KDM B;  1WYB A;  4BL2 A;  5BO0 B;  4S2O A;  5B24 B;  2BLS A;  4WEJ A;  2XD1 A;  5IHV A;  5C3I C;  5BOH A;  4YM6 C;  1NZU A;  4KGC D;  5JRG A;  4KGC A;  4H9P A;  1MKI A;  3B6F A;  3IXG A;  2HUE B;  3X1U D;  2FFF B;  1OME A;  1P3A B;  1HVB A;  3L29 A;  1YM1 A;  4N92 A;  4EBL A;  1XXM A;  1P3L C;  5HAQ A;  3KXB B;  3DWZ A;  3MGS B;  5F99 D;  5F99 A;  3WA9 D;  4KQO A;  4J8X C;  5AV8 B;  3WA9 A;  4WNN A;  1P3P A;  3TU4 B;  4AWL C;  3KFU G;  3NQJ B;  3AFA B;  3UTB A;  5AV6 A;  1P3O B;  1BT5 A;  4KGC C;  5CPK B;  4LV3 A;  3LJA B;  3O88 A;  1A7W A;  5G49 A;  1LI9 A;  1BTL A;  1EQZ B;  3AV1 A;  4E45 A;  4OJP A;  4UA6 A;  3B6G B;  1PYY A;  4WU8 A;  1M19 D;  4KZ9 A;  1XGI A;  3AZJ A;  5FQQ A;  2RIQ A;  1M18 D;  1M18 A;  1PWG A;  5CHJ A;  4NYY A;  1PZP A;  4XUZ A;  1PI5 A;  3V5M A;  3UT9 A;  5B2J A;  3LZ0 B;  4DRT A;  2ZY4 A;  5B33 D;  1FSW A;  5FUG A;  4GB7 A;  3ITB A;  5F99 C;  3WA9 C;  1YMX A;  3OZH A;  5D3O A;  2R9X A;  2IWC A;  1ES2 A;  1ZLA A;  3OPP A;  5F82 A;  5GSU D;  5AV6 C;  4UHU A;  4ZBJ B;  3Q82 A;  1RGZ A;  3PAG A;  4R8P D;  4R8P A;  3NDG A;  1XGJ A;  4WU8 C;  3ISG A;  4QNL A;  3UN7 A;  1M19 C;  3AZJ C;  3AZE A;  2P74 A;  1M18 C;  4WU9 A;  1FR6 A;  5AV9 D;  4YM6 B;  2EX2 A;  3LY4 A;  1B6W A;  5GXQ D;  4BEN A;  3UT9 C;  5B2J C;  5GXQ A;  5B33 C;  1KVM A;  3ZG0 A;  3WKJ A;  4WYY A;  3O87 A;  3QNB A;  2G2W A;  3MZF A;  5JYO A;  3AZF D;  3SS3 A;  2QMI A;  1KX5 D;  4XZQ D;  4H9Q A;  1M6K A;  4IBX A;  5GLD A;  5GSU C;  3MNN D;  3MNN A;  2BYM A;  3W97 D;  4R8P C;  3B0D C;  5AVB A;  4MNR A;  4HEF A;  3VSK A;  3N8S A;  2C6W B;  3HVF A;  3WX7 A;  4QB8 A;  4AWL B;  4JKT A;  2RCX A;  3AZE C;  4WU9 C;  5B1M B;  4GNU A;  5AV9 C;  1Z2C B;  1K56 D;  4IBG A;  2ZC7 A;  2JCH A;  1K56 A;  1S32 A;  1AOI D;  5GXQ C;  4H9R A;  4C75 A;  5EOE A;  4IBC A;  4LV1 A;  3IQA A;  3WKJ C;  3AZK B;  2G5H C;  4GKU A;  3X1U B;  2NZD D;  4IED A;  1S6R A;  3PBN A;  3AZF C;  3KWQ D;  1YU4 A;  3MNN C;  4H9O B;  3W97 C;  1XA1 A;  3WA9 B;  1GHP A;  4NYU A;  3CJM A;  3JYI A;  3L28 A;  3VP4 A;  5B1L A;  1MWT A;  2Q9N A;  5CHU A;  4Z66 A;  3VH6 T;  2L5A A;  3TG9 A;  4MBF A;  3IHA A;  1S32 C;  3C1C A;  4X56 A;  1O7E A;  5G49 B;  3L27 A;  1RP5 A;  5AY8 A;  4G92 B;  3IF5 A;  5CTN A;  3L2A A;  4FCF A;  1M19 B;  3PBO A;  3VOZ A;  1M18 B;  3KWQ C;  4IVI A;  4H8R A;  4OQH A;  3BLM A;  2J8Y A;  3AYW D;  4R3J A;  1W8Q A;  5B33 B;  4X23 D;  3AZH A;  1BH9 A;  1H5X A;  5B1L C;  1NZO A;  2ZM0 A;  3WRZ A;  4S2N A;  5GSU B;  3G35 A;  3A1K A;  5CER A;  3B0D B;  2XQZ A;  1W2E A;  3NIA A;  5B32 A;  5AY8 C;  5CGW A;  5E2E A;  3O62 A;  3EQV A;  3MBZ A;  1DY6 A;  2JC7 A;  5TFQ A;  2HPB A;  5AV9 B;  2WGW A;  4DRB A;  3KUY B;  3B3X A;  1XX2 A;  3NDE A;  1P3F A;  4ZJ2 A;  3AYW C;  4DKI A;  3AZH C;  4RX3 A;  4ZDX A;  2J8P A;  1ZC2 A;  4X23 C;  3LZ1 D;  3LZ1 A;  1XPB A;  4OP5 A;  3BYD A;  4EWF A;  4F94 A;  2HP9 A;  3C4O A;  3AZF B;  1L0G A;  1KX5 B;  2ZY2 A;  4XZQ B;  3RJU A;  4S2N C;  5B31 A;  4O7D A;  4X69 A;  1P3M A;  1L0E A;  4N9K A;  3W97 B;  5EVI A;  3OPH A;  3O62 C;  2HP5 A;  2WKI A;  3KS8 A;  4NY2 A;  5B31 G;  5TGF A;  4MEZ A;  2HIO D;  4NZ5 A;  2HIO A;  5EOO A;  1K55 A;  1MWU A;  2V20 A;  3G32 A;  1AOI B;  5DF7 A;  4DRA A;  1P3G D;  1KGF A;  3MVD D;  1XKZ A;  4OJO A;  3MGQ A;  5FAT A;  3REI A;  3LZ1 C;  3VFF A;  2NZD B;  1PW1 A;  3CMZ A;  3NC8 A;  3V3R A;  3X1V D;  4PM6 A;  3KWQ B;  5B31 C;  5B40 B;  3N7W A;  3PBS A;  3AZI D;  4R23 A;  3CZD A;  4OOM A;  1TDL A;  5FQJ A;  4JJN B;  5KDM A;  5GT3 D;  2ZY3 A;  5CHM A;  5BO0 A;  4WJ3 C;  4Y0T A;  5B24 A;  2HIO C;  1BSG A;  4FH2 A;  2Y59 A;  5AQ9 A;  1BUL A;  1BUE A;  4WEK A;  5A92 A;  1IEM A;  4X68 A;  5FQI A;  4DE1 A;  3DW0 A;  5GLA A;  4R1G A;  3WAA D;  3LEZ A;  3UDX A;  2VQR A;  1P3A A;  3X1S D;  4QLC D;  3X1V C;  2XF3 A;  2WK0 A;  2WGV A;  3AZI C;  4FD8 A;  3AYW B;  5DTK A;  2YFV B;  3KXB D;  4X23 B;  3KXB A;  1WE4 A;  2F8N H;  4YIN A;  3MGS A;  3CG5 A;  3P09 A;  2E8I A;  3BFG A;  5AV8 A;  1YU3 A;  4UA7 A;  5GT3 C;  1JFI B;  2WAE A;  4YS3 D;  3TU4 A;  1XA7 A;  1MPL A;  3NQJ A;  4IBE A;  3AFA A;  2XFT A;  1P3O D;  3Q7Z A;  1P3O A;  5CPK A;  3MKE A;  3PBQ A;  4XUX A;  5E5A B;  3LJA A;  4OP8 A;  1EQZ A;  1B67 A;  3GMW A;  4IJF A;  4P85 A;  3B6G A;  3NCK A;  2XLN A;  3BRM A;  3HLB A;  4QLC C;  4DDY A;  1PWD A;  1YU2 A;  4LD9 B;  4CPK A;  3IP4 C;  1K57 A;  3KXB C;  3LZ0 A;  2Z2M B;  3MGS C;  2EFU A;  1WWI A;  1H8Z A;  4R4R A;  1IYS A;  3G2Y A;  1P3O C;  5DNM D;  4OQI A;  3BLS A;  2OLV A;  5B0Y D;  3LJA C;  3FKE A;  1EQZ C;  2ZQC A;  3C7V A;  1NJ4 A;  1YQS A;  1M1A D;  3B6G C;  3H0L C;  5CPI B;  4L0L A;  3OCL A;  1KGG A;  2HIO B;  1KGE A;  4WEL A;  4LCM A;  4WMC D;  4Y7P A;  5CED A;  1P3G B;  4WMC A;  1K57 C;  1HTZ A;  5EE8 A;  3MVD B;  3N8L A;  3LZ0 C;  1LI0 A;  3GVB A;  2RVQ C;  1BLS A;  3N6I A;  3IT9 A;  2WZX A;  5KMW A;  4B88 A;  1I5Q A;  3VH5 A;  3X1V B;  1EWZ A;  4BQM A;  1ESU A;  1PZO A;  2JBF A;  3IH9 A;  3AZI B;  2IOU A;  1MWR A;  4ZBJ C;  1CI9 A;  4DXB A;  3IXH A;  2Y2I A;  5B0Y C;  5KZH A;  1BH8 B;  5GT3 B;  4NFT A;  5CTM A;  1M1A C;  1FCM A;  3AL0 C;  5B1M D;  5B1M A;  3SH9 A;  1RGY A;  1P34 B;  3A3J A;  4KZ6 A;  5U47 A;  3GSG A;  2ARO D;  4OJ5 A;  3AZK D;  3WAA B;  3C5A A;  4JF6 A;  3AZK A;  1Q2P A;  1HQ3 D;  3X1U A;  3X1S B;  4QLC B;  4KG2 A;  4IBK A;  4DDS A;  3E2K A;  3AZG D;  3B0C W;  5BNV B;  4CSR B;  1KX4 D;  4H9O A;  4KHA B;  4Z2M H;  4J8W B;  3GTC A;  3I7J A;  4LV2 A;  1QMF A;  1GA9 A;  2J7V A;  1K6S A;  2WKH A;  5A93 A;  4H9S C;  3BEB A;  4YS3 B;  2XFS A;  1P3K D;  1E4D A;  5B1M C;  2YFW B;  2EFX A;  3D4F A;  2ARO C;  1I2S A;  3AZK C;  5BPV A;  3W98 D;  5A90 A;  3X1U C;  4B4X A;  1HQ3 C;  1M19 A;  2WYX A;  1ERM A;  1P3B D;  4LCL A;  3Q7V B;  3F6T A;  3AZG C;  1FCO A;  4X55 A;  5HAP A;  1KX4 C;  5B33 A;  1ID3 D;  3W99 D;  2BYK B;  3HLF A;  4JXV A;  1TAF B;  5DVA A;  2H0Y A;  4Z5T B;  4ZJ1 A;  3EPL A;  2OLU A;  5GSU A;  4NE6 A;  5DNM B;  5B0Y B;  4JBF A;  3IXD A;  2ZLY A;  2XDM A;  4G92 C;  3HSH A;  3IF6 B;  4OVD A;  1M1A B;  3W98 C;  1M40 A;  2HDR A;  2ZMA A;  5G18 A;  2OSU A;  4KZ3 A;  2WAD A;  1N1J B;  3UE0 A;  1MBL A;  5AV9 A;  4JF4 A;  4CJN A;  3KUY D;  4NZ1 A;  4GHL A;  3KUY A;  1WYC A;  4WZS B;  5DNN D;  4XXR A;  4PM9 A;  4GD6 A;  3LO7 A;  5JA4 B;  3M6B A;  3G34 A;  3AZF A;  1KX5 A;  4XZQ A;  3UPN A;  1SKF A;  2ZQ8 A;  4A5R A;  3IHB A;  3UPO A;  2ZQ9 A;  3LY3 A;  3W97 A;  3Q1F A;  3AN2 D;  5B2I D;  2QZ6 A;  4OPY A;  1ZG4 A;  1CEF A;  1S0W A;  1TZY B;  5I94 A;  4P6B A;  3ZCZ A;  4UUZ B;  3KUY C;  1U35 D;  3UPP A;  1AOI A;  2V1Z A;  3RXX A;  3GRJ A;  2ARO B;  1IYQ A;  1FOF A;  1QME A;  4S2J A;  4U0T A;  4WBG A;  2XK1 A;  1FQG A;  4OJ6 A;  1HQ3 B;  2NZD A;  4OOY A;  2Y91 A;  4E3L A;  4NE5 A;  1KX5 C;  4XZQ C;  3KWQ A;  3A1I A;  2GDN A;  5B40 D;  3AZG B;  5B40 A;  3AGF A;  3GV9 A;  1KX4 B;  1JTG A;  4NZ3 A;  4GZB A;  3REK D;  4JJN D;  5EEC A;  3P5J B;  4JJN A;  4ZAM A;  1P3K B;  1KDW A;  4K91 A;  2J9O A;  2Y4A A;  3C4P A;  1Q2Q A;  4JPM A;  1U35 C;  1AOI C;  5FI6 A;  4GN2 A;  1YU0 A;  2A49 A;  5CPJ D;  3UO9 A;  1YUE A;  3W98 B;  3GQZ A;  1YLT A;  2NZD C;  4OUI A;  1JWZ A;  5GL9 A;  4KZA A;  4KUD D;  3ZG5 A;  4OH0 A;  1P3B B;  2ZC4 B;  3WS5 A;  5DF9 A;  5KSC A;  2XEP A;  1JVJ A;  5B40 C;  3KS4 A;  3AYW A;  5BS7 A;  2YFV A;  1ID3 B;  3A6N D;  3W99 B;  4X23 A;  3UE1 A;  4KZ4 A;  4PPR A;  3PBT A;  3REK C;  3REJ B;  1JWV A;  4JJN C;  1JFI A;  2DCF A;  4C3Q A;  4OPR A;  2EX9 A;  3V50 A;  1FR1 A;  4JXW A;  1KX3 D;  1KE3 A;  4J8V D;  4HGA B;  5GHY A;  1L2S A;  1F66 D;  3MGR D;  4R3B A;  5E5A D;  3QNC A;  1L0F A;  5E5A A;  2HDQ A;  4S2I A;  3V3S A;  5CPJ C;  4J8U D;  4X53 A;  5BNX B;  5AVC D;  3MZD A;  4KQR A;  4ZUX D;  3UTA D;  1SDE A;  4KUD C;  3WS0 A;  4LD9 D;  5GHX A;  4S2P A;  4LD9 A;  1LL5 A;  5DNN B;  3A3F A;  5BS7 C;  3MXR A;  2PYO D;  5GHZ A;  5DTT A;  1JTD A;  2HDU A;  3S4X A;  1BZA A;  1W79 A;  1W8Y A;  4HES A;  3HL9 A;  3AZL B;  2Y2K A;  1KX3 C;  2WKE A;  2ZQD A;  4J8V C;  1XP4 A;  1P3I B;  4EBN A;  3OCN A;  1F66 C;  3AN2 B;  5E5A C;  5B2I B;  3AV2 B;  3VSL A;  3HRE A;  1YLP A;  4J8U C;  5CEB A;  4RVA A;  3VMA A;  1WWS A;  5AVC C;  5CPI D;  5CGX A;  4ZUX C;  5CPI A;  2CV5 B;  5CGS A;  5AQB A;  4Q8I A;  1GHM A;  4LD9 C;  1U35 B;  1LLB A;  1P3G A;  3MXS A;  3MVD A;  4P87 A;  3QHY A;  5M18 A;  1IEL A;  1IKI A;  2Y2H A;  3UNW A;  4OON A;  2Y2Q A;  1C3B A;  2XH9 A;  1ES4 A;  3X1V A;  3RXW A;  3IH8 A;  3W96 D;  5FI2 A;  1K38 A;  3AZI A;  3ZG8 B;  2HDS A;  3B0C T;  1HZO A;  4N9L A;  4OPZ A;  4Z9Q A;  3REK B;  3VP1 A;  5GLC A;  1BH8 A;  3REH B;  5GT0 B;  1PI4 A;  1TVF A;  5GT3 A;  5CPI C;  1CEG A;  3SS4 A;  1GCE A;  1R4V A;  4GDN A;  1P34 D;  4PM5 A;  1P3G C;  1P34 A;  3MVD C;  4JLF A;  4JXS A;  2Y2M A;  5CPJ B;  2NQB D;  2EX8 A;  3WAA A;  5F1G A;  5E2G A;  1F1E A;  1E3U D;  2Y2L A;  3ZDJ A;  3IWQ A;  3M2K A;  4KUD B;  3X1S A;  4PMA A;  4QLC A;  2PU2 A;  3W96 C;  3BFF A;  3DWK A;  3A3D A;  4LEN A;  4B4Z A;  5BNV A;  4CSR A;  4KEN B;  4S2L A;  4XUJ D;  2VGK A;  3C7U A;  3A6N B;  4IBI A;  3HBR A;  4J8W D;  2ZJ9 A;  4KHA A;  4J8W A;  4LV0 A;  5HAR A;  3SH7 A;  2Y2J A;  3C1B B;  4GHA A;  2IWD A;  2F8N D;  4YS3 A;  3MFD A;  3VP0 A;  1KX3 B;  1GHI A;  3SOI A;  4J8V B;  4NZ4 A;  1E25 A;  1NY0 A;  1P34 C;  1F66 B;  3MGR B;  3MGP D;  2YFW A;  1ERQ A;  4QD4 A;  4J8U B;  3AGD A;  3WAA C;  2A3U A;  5AVC B;  4ZUX B;  3UTA B;  2F8N G;  4WZ5 A;  3X1S C;  3PBR A;  1ES5 A;  1YLZ A;  3Q7V A;  4N1H A;  1H8Y A;  4OQG A;  5FSR A;  2PYO B;  3UDI A;  4J8W C;  2G2U A;  2RL3 A;  5EVL A;  2BYK A;  1TAF A;  5B0Z B;  3HUN A;  4R4S A;  4Z5T D;  4YS3 C;  4Z5T A;  3ITA A;  1H3O B;  4QU3 A;  3AZN D;  5FAS A;  3FKV A;  2FFY A;  1K6R A;  4PM7 A;  5DNM A;  2X02 A;  5B0Y A;  3WTP B;  2JE5 A;  3WRT A;  3IF6 A;  3EQU A;  1M1A A;  4WZ5 C;  4EBP A;  2B5R A;  3S1Y A;  1SDN A;  2WAF A;  1L0D A;  5CP6 D;  1N1J A;  4MBK A;  3LEL B;  4DE0 A;  3WS2 A;  1ESI A;  3X1T D;  4BD0 A;  1BLC A;  3R45 B;  5CEC A;  3VH5 W;  2ZC6 B;  4DF6 A;  2W8S A;  5JA4 A;  1SCW A;  2F8N K;  4OOL A;  4C6Y A;  5KSH A;  5J8X A;  5HAI A;  4OLG A;  1MY8 A;  4Z5T C;  2ZM8 A;  3O86 A;  3W96 B;  4E6W A;  1SHV A;  3AZN C;  4RX2 A;  1NRF A;  1KE4 A;  4GOG A;  3ZGA B;  3VP2 A;  5DNM C;  4FH4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...