2JE5A

Structural and mechanistic basis of penicillin binding protein inhibition by lactivicins
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
683
structure length
461
Chain Sequence
SEITYSDGTDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTNQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PENICILLIN-BINDING PROTEIN 1B
publication title Structural and Mechanistic Basis of Penicillin-Binding Protein Inhibition by Lactivicins
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Drug-binding protein
total genus 147
structure length 461
sequence length 683
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
A PF00912 Transgly Transglycosylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2je5A01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2je5A03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2je5A02
1O7EA 1XX2A 1PI5A 5GHZA 3G34A 3V5MA 1U60A 4MBFA 1TEMA 3WS0A 4LENA 1TDLA 5BOHA 2EX2A 4OONA 1K6RA 4LCMA 4PPRA 1NYYA 5KSCA 5FAOA 1W7FA 4OP8A 4ZBEA 4E3KA 2V1ZA 1S0WA 1XGIA 2Y55A 4WZ5A 1MY8A 3WRZA 1BT5A 4A5RA 1L0FA 4IBRA 4MBKA 1MWUA 4E6XA 3NI9A 4UA9A 4UHUA 3G4PA 4FD8A 5F82A 3OPLA 2Q9NA 2J8YA 3LEZA 1KVLA 2Y2PA 4KZ7A 2C5WB 5EECA 2FFFB 4N1XA 3ZDJA 4QHCA 5HAQA 4QJGA 4KQOA 4RVAA 3C4OA 2ZQ7A 2Y2HA 3BFCA 4LV1A 3G31A 4DF6A 2WKHA 3UE0A 4R3BA 2UWXA 5FAQA 2ZQDA 4HESA 3O87A 3PBRA 4GB7A 3UDIA 2HDQA 2IWDA 3V39A 3IT9A 1JVJA 3HUMA 4Z9QA 1H8YA 3UE3A 4QU3A 5DTTA 2XFSA 1W8YA 3G2YA 1ZKJA 2ZC3B 3NBLA 5EVIC 1W79A 4EBLA 5CTMA 2BG1A 3OPRA 1ESUA 5GLAA 3W8KA 2PBYA 3QNBA 4FSFA 5A91A 3VP2A 2P74A 2BLSA 5EOOA 4E3JA 3UN7A 4EQIA 3C7UA 3IF6C 1MWTA 1KGGA 4KZBA 5FI7A 3S4XA 2VGKA 1MKIA 2QMIA 1O07A 4KZ3A 1J9MA 1ES5A 1XP4A 2EFUA 4DE1A 4IEDA 3PAEA 3IH9A 3M2JA 4DXBA 1XA1A 5AQBA 2E8IA 1KDSA 2WADA 2Y2LA 3AGDA 3IXDA 2ZC7A 3Q7VA 1LI9A 5HFOA 5FASA 1XGJA 4OOYA 3V3RA 2C6WB 5I94A 5FA7A 1K55C 4JBFA 4OH0A 4XUZA 3W4PA 3HLBA 1BTLA 4HBUA 2IWBA 3SH7A 4CPKA 5EVIB 1WYBA 3N6IA 1XPBA 4IVKA 4BL3A 1VM1A 1SDNA 2XQZA 3TG9A 1IYQA 1EWZA 5FQJA 4OPZA 3O86A 1JTDA 3EQUA 3O3VA 1FR6A 4JPMA 4GN2A 1K56A 2V2FF 5DF7A 4QD4A 5CGWA 2XGNA 4N9LA 4CJNA 3IF6B 3OPPA 1PWCA 5CHMA 5G18A 4ZDXA 2HP9A 2ZM8A 4UAAA 4GOGA 4YFMA 1DJAA 1EROA 4OPQA 3HBRA 4DE2A 3A3IA 2WAEA 1ES2A 4S2KA 5A93A 3GMWA 3VOZA 3HL9A 1QMFA 1BLPA 4R0QA 4S2MA 4E3OA 3HLGA 2PU2A 5KZHA 3PBSA 4KQQA 1GHIA 1PWDA 3WRTA 1SDEA 2XH9A 2H0TA 5TR7A 1KE0A 2B5RA 1RGYA 3RJUA 4BQMA 1RGZA 1H8ZA 1NYMA 3G30A 2H10A 2JBFA 4K91A 4WM9A 1M6KA 3ZG7B 4WEJA 4BD0A 1MBLA 2QZ6A 1IYSA 1RP5A 3ITAA 4Y0TA 3ZFZA 1E3UD 4PMAA 2H0YA 3NCKA 1LHYA 3IQAA 4PM8A 3CMZA 2G2UA 1I2SA 3A3JA 1FSWA 2Y2MA 4B4ZA 4WYYA 4RA7A 4X53A 2FFYA 2WGWB 1IYOA 1CI8A 2XD5A 3OZHA 2XEPA 5L2FA 2Y2JA 1FOFA 4XXRA 1K54A 5F1FA 4HEFA 3NIAA 4KZAA 2Y4AA 2R9WA 3IXGA 3ZNTA 4PM5A 3FZCA 3IWIA 2J9OA 3A3DA 4JKTA 3N8LA 3MFDA 3N7WA 3A3FA 2WK0A 1KE3A 2P9VB 4QY5A 4BJPA 3ZCZA 1ONHA 2HDSA 5JYOA 4MBHA 2Q9MA 3DTMA 4Q8IA 4OQIA 3VP0A 3PTEA 2ZJ9A 3IHAA 3OC2A 5M1AA 3P09A 4N9KA 1TVFA 5F83A 3O88A 3WS5A 3BEBA 2EXAA 3DWZA 4GDNA 1DJBA 4X56A 3VOYA 5J8XA 3LO7A 3PBOA 1GA9A 1SKFA 1PWGA 3D4FA 5A90A 5FSRA 4C75A 1NZOA 4LV3A 1TDGA 3UDFA 1N9BA 3VMAA 1ES3A 4S2NC 2ZQAA 2XK1A 1L0DA 2J9PA 3HUNA 4WMCA 4ZJ2A 3BFEA 3ISGA 2ZQCA 5JYPA 3CZDA 5DTKA 1H5XA 2ZC4B 4S2OA 5EUAA 4JF4A 3TSGA 5CXWA 3BLSA 2JC7A 5FI2A 3FYZA 4UA6A 5AQ7A 3ZNYA 5M19A 2EFXA 3S22A 1MXOA 1YLPA 3AGEA 3LY4A 2ZLYA 4C6YA 2Y59A 5HAIA 1IEMA 1RCJA 1ZC2A 1LL5A 1KVMA 3MZEA 4JLFA 1XKZA 3ZVWA 5CHUA 3MKEA 3IXHA 1PYYA 4EBPA 4S2PA 3Q82A 2JE5A 1YLTA 3FV7A 2V20A 3GQZA 1Y54A 3WS1A 5HL1A 3Q07A 3Q7ZA 4DDYA 3E2KA 3GRJA 3HLFA 4BENA 4DE0A 1NRFA 5EOEA 5AQAA 1MPLA 1PZPA 4OP5A 1NJ4A 3LCEA 5DF9A 1K57C 4ID4A 5DVAA 4UA7A 2WYXA 2WKEA 2X02A 3MBZA 3SH9A 3HVFA 5AQ9A 3VP3A 5A92A 1JWVA 5CGXA 3WWXA 1L2SA 1BLSA 1DJCA 3BRMA 5EVIA 1NY0A 3M2KA 5E2EA 1YT4A 3HLEA 3HLWA 2VGJA 4C3QA 3IHBA 2ZD8A 5FI6A 2WZXA 2Y2IA 2XLNA 3PBNA 3QNCA 4FH4A 2RL3A 4DXCA 4LV2A 1GHPA 2OLUA 1KDWA 3IF6A 3BM6A 4QY6A 1QMEA 1BSGA 4WELA 1CI9A 1KGEA 1IKIA 1YLYA 3GSGA 4ZAMA 1L0GA 3PAGA 3RXXA 1KE4A 2Y2NA 5EVID 1AXBA 4B4XA 1PI4A 4EUZA 1K57A 1IELA 2XD1A 4MLLA 1W5DA 4OOMA 4X69A 1CEGA 4OOLA 3QHYA 3DWKA 3IWQA 5KSHA 2HPBA 2Y2OA 1K55A 3ZG0A 2HDRA 4KZ8A 4K0WA 5E2HA 4PM6A 4BL2A 5GHXA 3UNWA 1K56D 3CJMA 1FSYA 4E3MA 3OCLA 2IWCA 3VP4A 3V50A 4IBXA 4WZ4A 3BFDA 5IHVA 3FKWA 1YLZA 1N4OA 4OVDA 4KZ6A 1EI5A 3RXWA 2WGWA 3ZG5A 1FQGA 5TFQA 1S6RA 2DRWA 3IF5A 3P98A 4L0LA 4GD6A 5U47A 1SHVA 4QB8A 2PU4A 5FQ9A 4BD1A 4JXWA 1ESIA 3BYDA 1IYPA 3BFGA 4RYEA 5CHJA 2R9XA 3E2LA 3UPOA 1GA0A 3NY4A 1ALQA 1HZOA 2DCFA 4N92A 2P9VA 3C7VA 1G68A 2A3UA 4WZ5C 5CRFA 5CEDA 5FQQA 3JYIA 1GCEA 4P85A 3VFFA 1K4EA 1CEFA 3VSKA 2Y2KA 1E4DA 3GR2A 3N8SA 4N1HA 4R1GA 3ITBA 1K25A 3IH8A 3ZG9B 1LL9A 3HUOA 4K0XA 5EE8A 4MNRA 2XDMA 4KZ5A 5FQIA 2Z2LB 4KG2A 1ERMA 2OV5A 4M3KA 3BFFA 3FKVA 1M40A 4X68A 3EQVA 3SS3A 5HARA 3WS2A 5EVLA 4U0TA 1XA7A 1JWZA 2OSUA 3V3SA 4XUXA 1I2WA 2WKIA 2XF3A 3HLDA 2EX8A 5E2GA 4JXVA 3N8RA 1BLHA 2A49A 4P6BA 5E2FA 2ZM2A 3PBQA 1HVBA 3FWLA 2ZM0A 1K4FA 4GD8A 1YM1A 3M6BA 5DF8A 4WBGA 5HW3A 3GTCA 3MXSA 1HD8A 2GDNA 4IVIA 4Y0OA 1SCWA 1YLWA 5CTNA 4EV4A 1LI0A 4E3LA 1MWSA 2WUQA 4KZ9A 4MEZA 3BECA 4LV0A 5GLCA 5KMWA 4GZBA 3A3EA 3LY3A 4EBNA 5E43A 3VP1A 2WGIA 1BZAA 4WMCD 3HLCA 1FR1A 2CC1A 4R23A 5CECA 3IWOA 1FCOA 3UY6A 2I72A 4F94A 3UPPA 1L0EA 1PZOA 4OPRA 4OQHA 2H5SA 1NZUA 3MZDA 4B88A 1JWPA 4S2NA 1BLCA 4PM9A 5FQMA 4JF6A 3C5AA 1YMSA 2WZZA 4Y0UA 1FCMA 3GV9A 4OPYA 4RX2A 5CERA 3BLMA 2J7VA 3AGFA 4KENB 3C4PA 4E6WA 3MZFA 1I5QA 2OLVA 5M18A 2ZQ9A 2EX6A 2Y91A 2Z2MB 3CG5A 3NDGA 4OKPA 4FH2A 3Q81A 3W4OA 3Q1FA 2HDUA 4KG6A 3UPNA 4ZJ3A 3NDEA 4H8RA 1HTZA 1IKGA 2DNSA 4KG5A 1ZG6A 2ZMAA 1K6SA 4R3JA 4S2JA 4JXSA 3W4QA 1WYCA 2HP6A 1FCNA 1OMEA 1ZG4A 4JF5A 4X55A 2RCXA 4GNUA 2XR0A 4E3NA 4ZTKA 2QPNA 2Y2GA 3Q7VB 1C3BA 5CEBA 5HAPA 2WAFA 1YMXA 1LLBA 3GVBA 3SH8A 3SOIA 3I7JA 1VQQA 4P0MA 5GL9A 2WGVA 5GLBA 3UDXA 4YINA 1GHMA 2Y2QA 1NXYA 1Z6FA 2ZC6B 3IXBA 5TGFA 4DRTA 1DY6A 4KZ4A 3G32A 5FQKA 1ERQA 4P87A 1G6AA 1K38A 1BUEA 3UE1A 3ZVTA 4OQGA 5GLDA 3OPHA 3N4IA 1W8QA 3PBTA 5HX9A 1ES4A 2HP5A 5D3OA 1WE4A 1Q2PA 1XXMA 3B3XA 4PM7A 4DDSA 1YQSA 2X01A 1PW1A 4RX3A 2JCHA 5FAPA 4OLDA 4S2LA 4JXGA 5EPHA 1K54C 4ZJ1A 1YLJA 3DW0A 3ZG8B 1E3UA 4Y7PA 2XFTA 2EX9A 4OQ0A 4DKIA 4LCLA 5FATA 1Q2QA 2X71A 4EWFA 3G35A 3TOIA 2ZQ8A 3WS4A 4DE3A 4R4SA 3NC8A 3VFHA 3MXRA 1JTGA 5F1GA 3G2ZA 3SS4A 4KQRA 3MKFA 1PIOA 3HREA 4E3IA 4D2OA 1CK3A 4X6TA 1KGFA 1BULA 4NETA 4NK3A 3SS5A 5CGSA 5GHYA 4O7DA 1MWRA 1PW8A 2ZC5B 3ZGAB 3M6HA 3S1YA 5DTSA 4GDBA 4BLMA 1E25A 4S2IA 3UO9A 3ZHHA 4GKUA 3VSLA 1ONGA 4OLGA 4U3TA 4HBTA 4R4RA 5FDHA 4WEKA 2EXBA 2G2WA 4FCFA 3OCNA 4U0XA
chains in the Genus database with same CATH superfamily
1XX2A 1PI5A 1U35D 2NZDC 3KYQA 5G49B 4MCWA 5BOHA 2PDRA 3W96B 3MGQB 4OONA 2D01A 4J8VB 4LGWA 1M19D 3U2AA 5B33A 4OP8A 1XGIA 2Y55A 2GNXA 3REKC 2VV7A 1MY8A 1P3OD 4YM6D 3LJAB 3AZEB 3KSYA 1MWUA 4E6XA 3OPLA 3HONA 3KXBD 2Y2PA 1KX5D 4L9GA 3ZDJA 5HDDA 1OPXA 4ZUXB 2JKTM 4EERA 2Y2HA 2EWVA 4LV1A 2YKFA 3UE0A 1P34A 3VH6A 4R3BA 5FAQA 5CPIC 4IJFA 1Y28A 3UDIA 4Z9QA 1P3PC 3WKJB 1H8YA 1G6OA 4OJ5A 3B0DC 4I39A 5CTMA 3OPRA 4HGAB 1TS0A 2PBYA 2P74A 3FDDA 2BLSA 3O5YA 4EEPA 3C7UA 3S4XA 1PZRA 3AV1D 2QMIA 4KZ3A 3WTPA 1ES5A 1GSWA 3PAEA 1XA1A 4NEED 5AQBA 5B1LB 4XZQB 1W63Q 3IXDA 2ZC7A 3Q7VA 1P3AB 4KQDA 5I94A 4WU8B 1WA9A 1K55C 1YSQA 2JKGA 4OH0A 4XUZA 3VE3A 1MZUA 2IWBA 1M18B 4CPKA 5EVIB 3N6IA 4IVKA 3NQUA 1VM1A 2XQZA 2M7UA 5FQJA 4OPZA 1JTDA 5FEGA 1FR6A 5EVEA 4GN2A 1K56A 3VH5T 3IF6B 4ZBJB 4QWOA 2G7UA 4ZDXA 2ZM8A 4UAAA 4YFMA 3LI9A 1DP9A 2V8FA 3REJC 1P3LB 1ES2A 5B32A 3A6ND 4S2KA 4QLCB 5LBRA 2QHKA 3UB9A 1BLPA 1TF1A 5KDMB 2H0TA 3P7NA 4KGCC 2D02A 4F3LB 3MVDA 3LELC 4BQMA 1MBLA 1E3UD 3AV2A 1E6ZA 3NCKA 5F99D 5AY8B 4GJ4A 3AZMD 3AZLA 3AZFA 1CI8A 1FOFA 1OT9A 2VJWA 3NIAA 2HIOB 3ZNTA 2J3TC 4HI4A 4BBTA 5CPJD 4JKTA 2F8NK 2WK0A 2P9VB 4BJPA 2Z6CA 1ONHA 3TRCA 2KX6A 4MBHA 4OQIA 3W98B 4XUJA 2ZJ9A 4H9PA 4DRBA 3KWQC 5CHLB 2YFWB 4X1MA 4GDNA 5AVBA 4LD9B 3MXQA 4HHDA 4X56A 3VOYA 5J8XA 1PWGA 5A90A 5B33D 4C75A 4YS3C 1NZOA 4LV3A 4UPKA 3KXBB 1F98A 1KX5B 1ES3A 1TZYA 1L0DA 1D06A 5TBMB 5JYPA 2YKHA 3ISGA 2ZQCA 1H5XA 4WL9A 2IOUA 5JRGA 2ZC4B 2JC7A 2F2AC 4UA6A 2EFXA 1PFLA 2ZLYA 4IBIA 1LL5A 1KVMA 3AZIC 5CHUA 1P34D 3CHWP 3AZGA 1OTAA 5AV5C 5BS7C 5FUGB 4S2PA 4DJ3A 2V20A 5HL1A 3Q7ZA 4DDYA 3E2KA 4DE0A 4BENA 3AV1B 4JJNA 1NJ4A 3F1PA 3LCEA 5DF9A 4ID4A 2WKEA 3VP3A 3SH9A 4CSRB 2Q0OA 1L3LA 3D72A 1NY0A 5DKKA 3NQJA 1XJ2A 1YT4A 2W3GA 3IHBA 2ZD8A 4R3AA 5FI6A 3P5JB 3REID 1E15A 2Y8HA 2RL3A 4DXCA 4LV2A 3AZHD 4HJ3A 2XRNA 1M1AC 5DFYA 2KOIA 4WELA 1CI9A 1AOIC 3GSGA 4ZAMA 5CPKC 1L0GA 1T1BA 3UB8A 1AXBA 2JKRM 4B4XA 3B6GB 1O6IA 3WD0A 4EUZA 5DNNC 2XD1A 2W3DA 1W5DA 3D9YA 3TU4B 5AVEA 3UB5P 3T1XA 4IBCA 1KOUA 4NE5A 4K0WA 3X1VC 2V9AA 4IJGA 5BT1D 1K56D 1S4SA 1G5UA 4UUZA 2V5OA 3WD2A 5FEFA 3B47A 3KUYA 2JKFA 3UE6A 5IHVA 4WU9C 1XFQA 1F66A 1F9IA 3IF5A 2DRWA 3MQLA 5FQ9A 3C1CA 1IYPA 5CHJA 3WAAC 3UPOA 3X1UC 3LR3A 2ACGA 5BNVA 5B1MA 1ALQA 1KX3A 3C8CA 3MVDD 3EPKA 3C7VA 3AFAC 1LSVA 1IOUA 1G68A 5CPJB 3HSHA 1GCEA 3AZJC 3AV2D 2FJ7B 2FZ0A 1B67A 3ITBA 1ID3A 3AZLD 3AZFD 4WZSB 4Y2FA 3ZG9B 1H8PA 5EE8A 4R8PC 5FQIA 5CP6C 2H28A 2Z2LB 5B2IA 4KG2A 1ERMA 3FKVA 1EQZA 4IUHA 3VE4A 2ZL1A 3B0CT 1H3QA 4U0TA 4EQ1A 4XUXA 4EUVA 2WKIA 3MR0A 2EX8A 3G6OA 4JXVA 1P3BA 2PYOA 4J8UD 1SKOA 5B33B 5E2FA 3KYEA 4XUJD 4UEYA 4GD8A 3LZ0C 3KS8A 3U4LP 3GTCA 3IX8A 1HD8A 5AVBD 1YLWA 5B40D 1W1YA 2WUQA 4ARZA 4EXOA 5GLCA 5AV9D 5GT3C 3KFUG 5HWTA 3LY3A 3OBFA 4EBNA 3W97C 1TZYD 1BZAA 4R23A 2VK3A 4IBKA 1P34B 3UY6A 2IO5B 1L0EA 4OPRA 4OQHA 3AYWD 1XJ3A 1P3GA 5IT5A 4JF6A 2WZZA 5HPFA 3CLOA 3B6FC 3BLMA 1T18A 1I5QA 3E4OA 3AZGD 4WN5A 2Y91A 3QP5A 5IU1A 3MGRA 2Z2MB 3CG5A 4MDZA 2JHEA 3Q81A 3W4OA 3Q1FA 5GSUC 3W99A 1LT0A 3NDEA 1HQ3A 1UWNX 1HTZA 4Z2MH 1YAXA 3V67A 3H82A 2OOLA 4KG5A 4CLCE 3WTPB 4JJND 2HUEC 3AN2A 3A0VA 4JXSA 3ULFA 5AVCB 1FCNA 1P3KA 2RCXA 4KUDD 1S67L 3T4LA 2Y2GA 1UR8A 3Q7VB 4K08A 2WAFA 5B2JA 1BH8A 3EGXC 4IBBA 1Z6FA 5TGFA 4DRTA 5FQKA 1W2EA 3NQUB 1A0KA 3T4QA 3C1BA 4WLAA 3UE1A 4OQGA 3PBTA 4O8GA 4J8WD 5D3OA 1WE4A 1LSXA 3BJNA 5E5AA 3NOTC 5EPHA 4EETB 3W96C 1VB6A 3MGQC 1X0OA 2EWWA 2XFTA 3T4KA 4J8VC 5B0ZA 4OQ0A 5EFWA 4DKIA 4LCLA 2X71A 3RTYA 5B32B 4BWIA 2ZQ8A 4OUIA 3MKFA 3UTAB 3B33A 1PIOA 3LJAC 3AZEC 4D2OA 4LFUA 3KUYD 1YU3A 4NETA 3GDIA 5CGSA 1M19A 4O7DA 3UT9A 3MVDB 3MGSB 2ZC5B 1P3MA 1F66D 4LRXC 2J8PA 1GOIA 4BLMA 1E25A 4OLGA 4U3TA 3AV2B 4ZUXC 3VH5W 3C1CD 2BYMA 4H9QA 3AZLB 3AZFB 5GHZA 3V5MA 4CLCA 4LRZE 5B1MD 4MBFA 1JFIA 4X23A 4JGRA 2VLGA 1BYWA 3REHB 3WKJC 1NYYA 1OTBA 1S0WA 1ID3D 3FC7A 4HGAC 3C38A 3WRZA 3S7NA 4A5RA 4IBRA 5B2ID 4TX8A 2F8NG 3NI9A 3G4PA 4FD8A 4O01A 3F1OA 2XA7S 4HIAA 3LEZA 4H9PB 1KVLA 4KZ7A 2C5WB 5EECA 4N1XA 2O0YA 1P97A 4QJGA 4RVAA 2NZDA 2HJEA 5AVBB 3C4OA 1CXWA 1D1JA 2PYOD 5B1LC 4XZQC 3KO6A 1P3AC 2ZQDA 4HESA 3PBRA 4GB7A 5B31B 2IWDA 4WU8C 1JVJA 3GECA 1TZYB 1F1EA 5AJGA 5DTTA 3O62D 4IUKA 5F5YA 5JRGB 1M18C 3G2YA 5EVIC 4NYYA 1ESUA 3QNBA 2ZOHA 4FSFA 5A91A 4E3JA 3LI8A 2XA7M 3NULA 4EQIA 3IF6C 4ZBJC 1O07A 2NUTC 2EFUA 1P3GD 3IH9A 1P3LC 3FKEA 4NXBA 4QLCC 1P3PA 5HFOA 1XGJA 3V3RA 4JJNB 3F1PB 2A2LA 4EU0A 2UV0E 2VGLS 4Y13A 2XSSA 3W4PA 1DP6A 2QJ7A 1WYBA 1XPBA 4BL3A 3W99D 3NQJB 1HQ3D 3C30A 1S32A 4PHTA 3AN2D 5AY8C 4NZ5A 1DRMA 4HH2A 2VZWA 4Q0IA 2HIOC 2O99A 3EGDC 5F68A 1EROA 3A3IA 5F99A 4NXFA 1UGUA 3IS2A 1VETA 3VH6W 3HL9A 4S2MA 4E3OA 5KZHA 3C1BD 2VGLM 3WA9B 3PBSA 5HL6A 1SDEA 2XH9A 3LIBA 3W98C 1KE0A 2B5RA 3RJUA 1Z2CB 1YU2A 4UUZB 5E5AD 2JBFA 4K91A 4Y0TA 3ITAA 1RP5A 1LHYA 4LD9C 3IQAA 3KUYB 3EEAA 1CJFA 1I2SA 3A3JA 4HJ4A 5B0ZD 4B4ZA 4WYYA 4X53A 2O9BA 1F66B 2XD5A 3OZHA 5L2FA 2Y2JA 5F1FA 2CWEA 3KXBC 4II7A 3MGPD 1KX5C 4BBVA 2Y4AA 3IXGA 1E6RA 3DTIA 3C1CB 4G91B 3MS6A 1W1VA 3L27A 5BNVB 5B1MB 4H9OA 3UT9D 1TAFA 1KX3B 2PYPA 1P3MD 1P0ZA 4GHAA 4QNLA 3LIEA 3KYZA 4WEKA 3LZ1D 2W3EA 1KX4A 3L28A 2CV5D 1ID3B 4OJPA 3IHAA 5GT0A 4CLCD 4N9KA 4J8XA 4NZ3A 3WS5A 4X23D 3BEBA 1H0MA 4CQHA 1GA9A 1EQZB 2W0NA 2ZL1B 1WWIA 1IFQA 1TDGA 2AROA 3AV1C 4S2NC 4MN7A 5EM0A 2J9PA 3HUNA 1P3BB 4BBUA 1SKOB 5DTKA 3T1RA 1J7MA 4HNBA 1TS7A 5AV6A 4JF4A 4AFIA 5FI2A 3FYZA 1YLPA 4P6ZS 3AGEA 3F6TA 1BFMA 2O9AA 1S1ZA 4WNNA 2Y59A 1IEMA 2NZDD 1RCJA 5HAIA 4Z2JA 3KWQA 4HOIA 3IXHA 3RELA 3LEQA 2JE5A 3FV7A 2ZM5A 4MMNA 4YS3A 3B0CW 3GQZA 3W2ZA 3Q07A 3B6GC 3REIA 2P7JA 3QP1A 3GRJA 5L09A 4Q0JA 3TU4C 5AQAA 3AZHA 1P3GB 1K57C 4UA7A 1VEUA 2X02A 5CX7A 3EPLA 5AQ9A 3HJIA 2NUPC 1BLSA 4NY2A 3M2KA 3HLEA 4P6ZM 5DKLA 2WZXA 3X1SA 3MGRB 4GS9A 3PBNA 4FH4A 5CPID 2HGVA 4EW7A 3W99B 4QY6A 4LPZA 2L1MA 1P3PD 1BSGA 3CPTA 3CUEC 1KGEA 3H82B 5B0YA 2PT7A 3PAGA 3LFVA 3BY9A 2Y2NA 1P3KB 5L8MA 1PI4A 1IELA 4OOMA 4KUOA 5AVFA 1CEGA 4OOLA 3QHYA 3IWQA 5CPJC 5B2JB 2HPBA 3MSHA 2FJ7C 2HDRA 2BASA 1S32D 2ZMVA 5E2HA 1BH8B 2PD8A 4PM6A 4DJ2A 4Z5TA 2PYRA 1Q9CA 3VP4A 3C1BB 5BO0A 2YFVA 2G5HC 4Z66A 4OVDA 1N4OA 3ZG5A 5TFQA 1S6RA 5U47A 1SHVA 3PXPA 4GCZA 4HQAA 3BFGA 4RYEA 5B33C 4Y15A 1HZOA 3X1TA 2ZMFA 1U35B 4NZ1A 3X1VA 5CEDA 1CEFA 4Z2LA 2Y2KA 1E4DA 3GR2A 3IBRA 4ZRRA 1PRQA 1M19B 4J8UA 1P3MB 2WKRA 3HUOA 1P9RA 2XDMA 2R78A 3KSIA 1P3OB 2OV5A 2BYMB 4YM6B 1P3FA 3UB6A 1L6JA 1P34C 3EQVA 2IO5C 3LR4A 5B40A 4HY8A 5HARA 4CLCB 2OSUA 1ZLAA 1JFIB 3WAAA 5E2GA 4KGCD 5AV9A 3N8RA 3AFAA 1HVBA 1KX4D 2ZM0A 3MNNA 5HD5A 4M4XA 1YM1A 5GT0D 3M6BA 2B95A 1GPFA 4J8XD 2ZY2A 3AYWA 4Y0OA 1MC0A 1SCWA 4IBFA 2MJ6A 4LRYC 3NHQA 2BTFP 3F1OB 3OLOA 4KZ9A 2AROD 5KMWA 3WTPC 5AV8A 5AVCC 1FR1A 4Z2GA 4UQIS 5AV6D 1PZOA 1KS0A 2H5SA 3MZDA 4B88A 1JWPA 3LGOA 4PM9A 5FQMA 4DN0A 3C5AA 4Y0UA 3GV9A 4OPYA 3VH6T 2J7VA 1P9WA 3KWQD 1N1JA 4E6WA 4KUDA 2OLVA 2ZQ9A 3RELD 4YS3D 3NDGA 5BT1C 3CI6A 2HDUA 3BY8A 3UPNA 4ZJ3A 2DNSA 2ZMAA 2PR5A 4FOFA 5HD3A 4IBJA 1OMEA 4X55A 5B32C 4E3NA 4J8WA 4UQIM 1W1PA 1J3WA 4ZTKA 4DQYB 3L25A 1C3BA 5CEBA 3UTAC 5HAPA 3M7PA 3SW1A 3LIFA 5DNMA 4YWZA 4IBGA 3CWFA 4I3AA 4NFTA 3X1SD 1BH9A 3MVDC 3MGSC 1NXYA 3CITA 1DY6A 3A6NB 1ERQA 4P87A 1OGBA 5KIZA 1CF0A 3AV2C 1S32B 1W8QA 5GSUA 5HX9A 5B0YD 4XT2B 4GHIA 1Q2PA 4X1LA 3AZLC 3AZFC 4DDSA 1PW1A 3RFBA 1LL8A 2GZAA 4GLQA 3D3OA 3REHC 4LG2A 5FATA 5F99B 4EWFA 2O9CA 3TOIA 3WS4A 5B24A 3IS2B 3NC8A 3AZMB 4Z5TD 3G2ZA 3SS4A 4H9RB 1F2KA 4I5SA 4X6TA 1KGFA 4Z66D 5GHYA 4H9SA 5HSQA 4IHQA 5DJUA 1MKMA 3ZGAB 1F5MA 3M6HA 2M1CA 3KSGA 4S2IA 3UO9A 3VSLA 4HBTA 5AVBC 3E98A 4R4RA 1BLCA 2G2WA 4FCFA 5DNND 3S7PA 1O7EA 1H0IA 3X1TD 2P04A 3WS0A 4LENA 1TDLA 3QP6A 3H0MC 2EX2A 2JKTI 5B31C 3X1VD 3HCYA 1TZYC 1P3IA 4PPRA 2V1ZA 5JRGC 4H9OB 1TAFB 5IS1A 3AZEA 2V1AA 2HV1A 4WZ5A 3IBJA 2DF4C 3IX4A 5EV0A 1BT5A 2OAQ1 4MBKA 2L5AA 4UHUA 1KX4B 1R4VA 4PKYG 1P3FD 2J8YA 5GT0B 3O62A 3AZNA 2W8SA 2FFFB 4J8XB 1ZLAD 3AZKA 3WAAD 3L7HA 4G92C 2BYKA 3BFCA 3AFAD 2UWXA 1PDCA 4WUJA 1AIWA 3MNND 2AROB 3MJQA 5A8BA 3AZJD 4JJNC 2HDQA 5DJTA 3H0RC 2W3HA 4QU3A 1TS8A 1W8YA 5AV6B 1ZKJA 1T3UA 3NBLA 2NQBA 4R8PD 2BG1A 3H7WA 3W8KA 1H0GA 3VP2A 1XJ4A 4WNNB 5AV8D 4R70A 2QKPA 4MB3A 3KWQB 1MWTA 1KGGA 1MKIA 3RELB 1J9MA 1YPRA 2ZY5A 2GX5A 4NKPA 3M2JA 2QJ5A 3VV4A 2E8IA 3REIB 1YU0A 4WU8A 3T4SA 3AZHB 5FASA 2C6WB 5FA7A 3WA9C 1VEUB 3LR5A 4JBFA 1S66L 1BTLA 3E4PA 5C5KA 3SH7A 5GT3D 2GJ3A 1SDNA 3TG9A 1EWZA 3O86A 4JGOA 4NE3A 3KSFA 4DRAA 3KUYC 2PAVP 3O3VA 3X1SB 4JPMA 4GS9B 2V2FF 4QD4A 1F66C 5CGWA 4H9NA 2XGNA 4CJNA 3OPPA 1PWCA 2HP9A 4E04A 4GOGA 3CPTB 3B6FD 3C1CC 5B0YB 4OJLA 4G91C 4QLCA 5DNMD 4OPQA 4HMEA 5B1MC 2ZY4A 1KX3C 3VOZA 5FDSA 4CAYA 2J80A 3QP2A 3MGPA 3HLGA 2PU2A 4KQQA 1PWDA 3WRTA 5GSUD 1ID3C 4ETZA 1E8BA 1H8ZA 1QO6A 4Z5TB 2H10A 3ZG7B 1M6KA 4WEJA 2QZ6A 3ZFZA 4PMAA 2H0YA 4PM8A 5BO0B 2G2UA 3CMZA 2YFVB 3A1IA 4Z66B 5EM1A 1FSWA 2Y2MA 1EQZC 2JSSA 3EOIA 2FFYA 3LZ1A 5GXQA 2XEPA 1K54A 3K3CA 2CV5A 4Z2HA 5B24D 4HEFA 3IX3A 4KZAA 4PM5A 3FZCA 3IWIA 2J9OA 4HP4A 1P3BC 3N8LA 3MFDA 2VA0A 3A3FA 3X1TB 2HDSA 1V9YA 5JYOA 2VX8A 2HJ9C 3PTEA 2K31A 4J8UB 3OC2A 3VOLA 3MGQD 4XUJB 3UTBA 1DJBA 5HDCA 1OTDA 1P3ID 3LO7A 3PBOA 2RVQC 1T19A 1P3FB 3DTKA 1AWIA 5B40B 4NYUA 3UDFA 3VMAA 1ZLAB 3AZED 1P3GC 4WMCA 4ZJ2A 5AV9B 3BFEA 3CZDA 5EUAA 4S2OA 3MNNB 4AWLB 1UWPX 3REKA 5CXWA 3L26A 3UMEA 3BLSA 3R45A 3AZND 3B42A 5M19A 3S22A 1MXOA 3AZKD 3LY4A 3AYWB 3MGRC 1H8MA 3MZEA 4JLFA 1XKZA 2FN2A 3W99C 3Q82A 1YLTA 2A24A 3AZGB 5AV8B 3WS1A 4YNRA 3LUQA 4Z2KA 1P3KC 3HLFA 5CPIA 3AL0C 2NQBD 1PZPA 5DVAA 5B2JC 2WYXA 3MBZA 1JWVA 5L10A 1L2SA 3BRMA 3UMDA 5E2EA 4KUDB 5I5LA 4C3QA 3C1BC 3T4OA 5C3IB 2XLNA 3ZYTA 5TJJA 1KDWA 2OLUA 4WU8D 1CK7A 4YOFA 2L0WA 5B32G 5G4YA 3RXXA 1M18D 5EVID 4J8WB 1K57A 5J4EA 1H3OA 1U35C 5JA4A 3DWKA 5F6AA 3MFXA 4OJ6A 2Y2OA 5DNMB 1K55A 4KZ8A 1BH9B 1M19C 1P3MC 3CJMA 1FSYA 1N9LA 1K0KA 3V50A 1P3LD 1P3OC 4QPRA 1EAKA 3T4TA 3NJAA 4QLCD 1EI5A 4YM6C 2WGWA 4GHIB 3RXWA 4ESPA 1FQGA 1W63M 2ZOIA 3P98A 4L0LA 4CLCC 3KS4A 1A7WA 2OAP1 4QB8A 3R7WA 1ESIA 3BYDA 2R9XA 3REJA 1GA0A 2VKSA 3PR6A 2DCFA 4Y5FA 5B24B 4L9FA 2FJ7A 3BQAA 5CRFA 3EEHA 2OWJA 5FQQA 3JYIA 1OJGA 3VSKA 3N8SA 4EO5B 4KGCA 3OOVA 2HZ5A 1ED7A 3LELA 3IH8A 1LL9A 4EEUA 5GXQD 4MNRA 5J7EA 4Y3IA 3IP4C 3L29A 1YKDA 3BFFA 4X68A 5K5BA 3SS3A 3SZTA 5B2IB 5B31G 3BW6A 1XA7A 3V3SA 1I2WA 3HLDA 3W98D 3RH8B 1P3IB 4P6BA 4HJ6A 2QWSA 2ZM2A 3PBQA 3FWLA 4IJEA 4KHAA 3BQ8A 2V0UA 2PYOB 1TS6A 2V8CA 3KX0X 4LD9D 4WBGA 3MQ0A 2W1TA 3MXSA 3UTBD 2GDNA 4HH3A 5CTNA 2L4RA 4EV4A 4IBDA 1LI0A 4E3LA 5HWVA 3O62B 2CMNA 2F8NA 4LV0A 3AZNB 1XFNA 3JPUA 4I38A 3LIAA 3AZKB 4ARZB 2WGIA 4WMCD 3HLCA 2BYKB 5CECA 2LB5A 1FCOA 2I72A 3UPPA 3REKD 1NZUA 1YMSA 1FCMA 4RX2A 3HJKA 4KENB 4G3VA 3A6NC 1E6NA 2NQBB 1ACFA 3EPJA 5M18A 3H7WB 3T50A 1S32C 1LSWA 5HDSA 4G3WA 2INWA 3AZIA 1DP8A 2LY8A 5L07A 5AVCA 5AV5A 5BS7A 4X25A 1ZG6A 3T1QB 1K6SA 4R3JA 4S2JA 1HQ3B 1WYCA 2HP6A 4D60A 4JF5A 5F99C 2XROA 3AN2B 2XR0A 3AZMC 3R4KA 1PNEA 2W27A 5DFXA 4P0MA 1VQQA 5GL9A 2WGVA 3T4JA 3UDXA 4YINA 4NXGA 2WKPA 2Y2QA 2ZC6B 3IXBA 3F1NA 4KZ4A 5HPIA 3G32A 1NWZA 1K38A 1V9ZA 3N4IA 3B6GD 2HP5A 4LLOB 1XXMA 2WKQA 3B3XA 3TU4D 1YQSA 4PM7A 2X01A 2JCHA 5FAPA 4H9NB 1M1AA 4ZJ1A 3DW0A 3EWKA 5E5AB 1AOIA 1OJ5A 5CPKA 4WV4B 3UTAA 3G35A 3V9RA 5DNNA 5B0ZB 4DE3A 4R4SA 3VFHA 1JTGA 2RIQA 1S4RA 4KQRA 4CAYB 4Z1WA 3MGPB 3HREA 4E3IA 3MGSA 3SS5A 1KX4C 1MWRA 1PW8A 5GT0C 4GDBA 4HMDA 4Y17A 3ZHHA 4J8XC 3UT9B 3A1KA 4Z2IA 3OCNA 5FDHA 2EXBA 4WU9A 2B18A 1T1CA 4U0XA 3REJD 3G34A 3JVUA 3LZ1B 4E44A 5GXQB 3REHA 1U60A 2AROC 2CV5B 1TEMA 4H9QB 4JGQA 2FJ7D 1K6RA 4NZ4A 4LCMA 5KSCA 3X1UA 4X23B 5FAOA 1W7FA 4ZBEA 4E3KA 4NE6A 5AV6C 3LELD 2HF6A 1YU1A 2JN7A 3FPWA 3AZJA 3EG5B 1L0FA 4E45A 3WX7A 4UA9A 5F82A 2Q9NA 4R8PA 3RELC 3UTBB 5CP6A 4QHCA 2J3TD 5HAQA 4KQOA 2ZQ7A 1GSVA 3G31A 4DF6A 2WKHA 3REIC 3NOPC 2NZDB 5B31A 1JNUA 4Q0HA 1SZVA 3AZHC 3O87A 2QYBA 3V39A 3IT9A 4M6BA 1HLUP 3HUMA 3B0BA 3UE3A 3MF0A 2XFSA 3ZQ5A 2ZC3B 3LZ0A 1W79A 2M7VA 4EBLA 3REKB 5GLAA 2F8ND 3R45B 3S7OA 3X1SC 5EOOA 1B6WA 3UN7A 3MQOA 4KZBA 5FI7A 2VGKA 4H6JA 5GT3A 1XP4A 4DE1A 1GXDA 5B0YC 3W97A 2A24B 4IEDA 2LB9A 1S1YA 4DXBA 3CAXA 2Y79A 1KDSA 2WADA 2Y2LA 1FIKA 3AGDA 4MN5A 2VV6A 5CPIB 1LI9A 1STZA 2PBDP 4OOYA 1P3PB 3B6FA 1YUEA 3HLBA 3MQQA 3KSHA 3DBAA 4HBUA 4Z5TC 3B0DB 3AZID 4ME4A 3WTPD 5HWWA 1IYQA 5AVCD 5AV5D 3DTEA 3EQUA 4Z66C 5DF7A 5G4ZA 4N9LA 3C2WA 5CHMA 5G18A 1DJAA 1NRJA 4GH9A 2J3WA 2V0WA 3HBRA 4DE2A 2WAEA 4EESA 5A93A 3GMWA 3X1TC 3WA9A 1H3OB 1QMFA 5JA4B 4R0QA 2F8NH 1NLZA 2OWHA 1VETB 4L9EA 1GHIA 5TR7A 1RGYA 2DMWA 4J8UC 1RGZA 1NYMA 3G30A 5BNXA 4WM9A 4BD0A 4XUJC 1M1AD 1IYSA 1AOID 5B32D 5CPKD 3BWLA 2PRFA 4RA7A 1P3FC 2RTSA 2WGWB 1IYOA 3UTAD 5B40C 4XXRA 2IA2A 5G49A 3QP4A 4HP9A 1ZLAC 3ICYA 3W96A 3MGQA 2R9WA 4R38A 3R7WB 4J8VA 5AV9C 3A3DA 3MGSD 3REJB 3LR0A 3N7WA 1GSXA 3MNNC 4AWLC 1KE3A 4QY5A 3WD3A 3ZCZA 3LJAA 3AYWC 2Q9MA 1XJ6A 3DTMA 4Q8IA 4KGCB 3T1SA 3VP0A 4WU9D 1Z09A 3LELB 4B9OA 5M1AA 4I3JA 3UB7A 3WD1A 3P09A 1KU5A 3REHD 1TVFA 5F83A 3O88A 2EXAA 3DWZA 1YU4A 4ZUXA 2Z6DA 3AZGC 5AV8C 2K7SA 3X1UD 1SKFA 3D4FA 2I9VA 5FSRA 1N9BA 1N9NA 2ZQAA 2XK1A 3WKJA 3P01A 1EW0A 3E0YA 4KHAB 3TSGA 1HTAA 3H0LC 4KUDC 5AQ7A 3ZNYA 4KUKA 2W1TB 4C6YA 5C3IC 5CP6D 1ZC2A 4FUWA 3ZVWA 3MKEA 5B31D 2B02A 1PYYA 2F8NB 4EBPA 2E8JA 3NOUC 1Y54A 5JRGD 3A0SA 5HZHA 5B1LA 4XZQA 3K2NA 4J8WC 1ZTUA 4YS3B 1CQAA 1P3AA 1NRFA 5EOEA 4G3KA 3LZ0D 1MPLA 5BPVA 4OP5A 1N9OA 5DNMC 3HVFA 5A92A 5CGXA 3WWXA 1TD5A 1DJCA 4NXEA 1M18A 5EVIA 3FG8A 3HLWA 2VGJA 1ULYA 2PHYA 3TE8A 3TW8A 2Y2IA 3W97D 3QNCA 2AVXA 3AZIB 1GHPA 3IF6A 3BM6A 1G28A 5AV5B 1QMEA 4WF0A 1IKIA 1YLYA 1D7EA 5FL3A 2EA9A 4OJOA 3T12B 1P3LA 1KE4A 4MLLA 5B24C 4X69A 1W1TA 5KSHA 3ZG0A 5KDMA 4EO5C 3H9WA 3QP8A 4BL2A 4F3LA 4H9SC 4NG2A 5GHXA 3UNWA 3LYXA 1ODVA 3F1NB 2KLIA 4E3MA 3OCLA 2IWCA 4IBXA 4WZ4A 3BFDA 4O0PA 3FKWA 5AY8A 1YLZA 4KZ6A 5B2IC 3S7QA 4GD6A 1M1AB 3WA9D 2VQRA 2HIOA 3LICA 2PU4A 4BD1A 2G5IC 4JXWA 1OTIA 1AOIB 5CPKB 1P3IC 3E2LA 1U35A 3NY4A 2W1RA 4HMCA 2DQNC 3LIDA 4N92A 3V9RB 5DNNB 2PYOC 2ZY3A 2P9VA 2A3UA 4WZ5C 4IBEA 4P85A 3VFFA 1K4EA 1WWSA 3X1VB 3W98A 4N1HA 4R1GA 1K25A 3TJZC 1YSPA 3O62C 2PD7A 1P3OA 3AZNC 4K0XA 1OT6A 2YFWA 4YM6A 3AZKC 3W96D 4KZ5A 4LD9A 3PYPA 4WJ3C 4J8VD 4M3KA 1KX3D 1M40A 4WU9B 3PHYA 2PR6A 3WS2A 5EVLA 3KXBA 2VV8A 1JWZA 1KX5A 4JGPA 1UR9A 2P08A 2XF3A 5TBMA 1BLHA 3WAAB 3LJAD 2A49A 3X1UB 1K4FA 2NQBC 5DF8A 3AFAB 5HW3A 3FPVA 1EQZD 3AZJB 1T1AA 4ZUXD 4IVIA 3L9KA 1MWSA 4MEZA 3NECA 3BECA 4PKYA 5FUGA 1P3BD 4GZBA 4R8PB 3A3EA 5CP6B 1HQ3C 4R6LA 5E43A 3A0RA 3VP1A 3WKJD 2CC1A 3IWOA 3AN2C 5MC7A 4F94A 3AV1A 4S2NA 4GHLA 4CSRA 5CERA 3AGFA 4BMWA 4I3IA 3C4PA 2JKRI 1ZHHB 3LZ0B 3MZFA 3VH5A 2EX6A 2RVQD 1N1JB 4GW9A 1Y4OA 2KDKA 1OGGA 3EPHA 4FH2A 4OKPA 3WD4A 5B1LD 4XZQD 4KG6A 4H8RA 1P3AD 1IKGA 4G92B 2W3FA 4FTXA 4H6JB 5E5AC 5GT3B 4MN6A 3JVVA 3W4QA 3W97B 1NLYA 2FH5A 1ZG4A 3B6GA 4GNUA 5B0ZC 3TU4A 2QPNA 3MGRD 4MB4A 3MGPC 1YMXA 1LLBA 3GVBA 3SH8A 3SOIA 3I7JA 3MMHA 1OTEA 3A6NA 3B6FB 5GLBA 1GHMA 3E4QA 1G6AA 4XT2A 3UT9C 4ETXA 1BUEA 3ZVTA 3N3FA 5GLDA 3OPHA 4RQ9A 3L2AA 1P3KD 1ES4A 3LZ1C 4RX3A 4OLDA 5GSUB 5GXQC 4S2LA 4JXGA 1K54C 4PAUA 2CV5C 5B2JD 1YLJA 3ZG8B 1E3UA 4Y7PA 3CUEA 2HUEB 2EX9A 2ZBBA 4X23C 3AZMA 1E6PA 4B93A 1Q2QA 3K3DA 4Z2MG 1E88A 4H9RA 3MXRA 5F1GA 1FILA 5CPJA 5J3WA 1CK3A 3DAVA 4DMZA 1VHMA 5AY8D 1BULA 2K2NA 4NK3A 3S1YA 5BNXB 4MB5A 5DTSA 4GKUA 2D49A 3UTBC 1ONGA 2HIOD 2V1BA 5F69A 2VEAA 3WTPE
chains in the Genus database with same CATH topology
1XX2A 1PI5A 1U35D 2NZDC 5G49B 5BOHA 3W96B 3MGQB 4OONA 4J8VB 1M19D 5B33A 4OP8A 1XGIA 2Y55A 3REKC 1MY8A 1P3OD 4YM6D 3LJAB 3AZEB 3KSYA 1MWUA 4E6XA 3OPLA 3HONA 3KXBD 2Y2PA 1KX5D 3ZDJA 4ZUXB 2Y2HA 4LV1A 3UE0A 1P34A 3VH6A 4R3BA 5FAQA 5CPIC 4IJFA 3UDIA 4Z9QA 1P3PC 3WKJB 1H8YA 4OJ5A 3B0DC 5CTMA 3OPRA 4HGAB 2PBYA 2P74A 3FDDA 2BLSA 3C7UA 3S4XA 1PZRA 3AV1D 2QMIA 4KZ3A 3WTPA 1ES5A 3PAEA 1XA1A 5AQBA 5B1LB 4XZQB 3IXDA 2ZC7A 3Q7VA 1P3AB 5I94A 4WU8B 1K55C 4OH0A 4XUZA 2IWBA 1M18B 4CPKA 5EVIB 3N6IA 4IVKA 3NQUA 1VM1A 2XQZA 5FQJA 4OPZA 1JTDA 1FR6A 4GN2A 1K56A 3VH5T 3IF6B 4ZBJB 4ZDXA 2ZM8A 4UAAA 4YFMA 3REJC 1P3LB 1ES2A 5B32A 3A6ND 4S2KA 4QLCB 1BLPA 5KDMB 2H0TA 4KGCC 3MVDA 3LELC 4BQMA 1MBLA 1E3UD 3AV2A 3NCKA 5F99D 5AY8B 3AZMD 3AZLA 3AZFA 1CI8A 1FOFA 3NIAA 2HIOB 3ZNTA 5CPJD 4JKTA 2F8NK 2WK0A 2P9VB 4BJPA 1ONHA 4MBHA 4OQIA 3W98B 4XUJA 2ZJ9A 4H9PA 4DRBA 3KWQC 5CHLB 2YFWB 4GDNA 5AVBA 4LD9B 4X56A 3VOYA 5J8XA 1PWGA 5A90A 5B33D 4C75A 4YS3C 1NZOA 4LV3A 4UPKA 3KXBB 1KX5B 1ES3A 1TZYA 1L0DA 5JYPA 3ISGA 2ZQCA 1H5XA 2IOUA 5JRGA 2ZC4B 2JC7A 2F2AC 4UA6A 2EFXA 2ZLYA 4IBIA 1LL5A 1KVMA 3AZIC 5CHUA 1P34D 3AZGA 5AV5C 5BS7C 5FUGB 4S2PA 2V20A 5HL1A 3Q7ZA 4DDYA 3E2KA 4DE0A 4BENA 3AV1B 4JJNA 1NJ4A 3LCEA 5DF9A 4ID4A 2WKEA 3VP3A 3SH9A 4CSRB 1NY0A 3NQJA 1YT4A 3IHBA 2ZD8A 5FI6A 3P5JB 3REID 2RL3A 4DXCA 4LV2A 3AZHD 1M1AC 4WELA 1CI9A 1AOIC 3GSGA 4ZAMA 5CPKC 1L0GA 1AXBA 4B4XA 3B6GB 4EUZA 5DNNC 2XD1A 1W5DA 3TU4B 4IBCA 4NE5A 4K0WA 3X1VC 5BT1D 1K56D 4UUZA 3KUYA 5IHVA 4WU9C 1F66A 3IF5A 2DRWA 5FQ9A 3C1CA 1IYPA 5CHJA 3WAAC 3UPOA 3X1UC 5BNVA 5B1MA 1ALQA 1KX3A 3MVDD 3EPKA 3C7VA 3AFAC 1G68A 5CPJB 3HSHA 1GCEA 3AZJC 3AV2D 2FJ7B 1B67A 3ITBA 1ID3A 3AZLD 3AZFD 4WZSB 3ZG9B 5EE8A 4R8PC 5FQIA 5CP6C 2Z2LB 5B2IA 4KG2A 1ERMA 3FKVA 1EQZA 3B0CT 4U0TA 4XUXA 2WKIA 2EX8A 4JXVA 1P3BA 2PYOA 4J8UD 5B33B 5E2FA 4XUJD 4GD8A 3LZ0C 3KS8A 3GTCA 1HD8A 5AVBD 1YLWA 5B40D 2WUQA 5GLCA 5AV9D 5GT3C 3KFUG 3LY3A 4EBNA 3W97C 1TZYD 1BZAA 4R23A 4IBKA 1P34B 3UY6A 2IO5B 1L0EA 4OPRA 4OQHA 3AYWD 1P3GA 4JF6A 2WZZA 3B6FC 3BLMA 1I5QA 3AZGD 2Y91A 3MGRA 2Z2MB 3CG5A 3Q81A 3W4OA 3Q1FA 5GSUC 3W99A 3NDEA 1HQ3A 1HTZA 4Z2MH 4KG5A 3WTPB 4JJND 2HUEC 3AN2A 4JXSA 5AVCB 1FCNA 1P3KA 2RCXA 4KUDD 2Y2GA 3Q7VB 2WAFA 5B2JA 1BH8A 4IBBA 1Z6FA 5TGFA 4DRTA 5FQKA 1W2EA 3NQUB 3C1BA 3UE1A 4OQGA 3PBTA 4J8WD 5D3OA 1WE4A 5E5AA 5EPHA 3W96C 3MGQC 2XFTA 4J8VC 5B0ZA 4OQ0A 4DKIA 4LCLA 2X71A 5B32B 2ZQ8A 4OUIA 3MKFA 3UTAB 1PIOA 3LJAC 3AZEC 4D2OA 3KUYD 1YU3A 4NETA 5CGSA 1M19A 4O7DA 3UT9A 3MVDB 3MGSB 2ZC5B 1P3MA 1F66D 2J8PA 4BLMA 1E25A 4OLGA 4U3TA 3AV2B 4ZUXC 3VH5W 3C1CD 2BYMA 4H9QA 3AZLB 3AZFB 5GHZA 3V5MA 5B1MD 4MBFA 1JFIA 4X23A 3REHB 3WKJC 1NYYA 1S0WA 1ID3D 4HGAC 3WRZA 4A5RA 4IBRA 5B2ID 2F8NG 3NI9A 3G4PA 4FD8A 3LEZA 4H9PB 1KVLA 4KZ7A 2C5WB 5EECA 4N1XA 4QJGA 4RVAA 2NZDA 5AVBB 3C4OA 2PYOD 5B1LC 4XZQC 1P3AC 2ZQDA 4HESA 3PBRA 4GB7A 5B31B 2IWDA 4WU8C 1JVJA 1TZYB 1F1EA 5DTTA 3O62D 5JRGB 1M18C 3G2YA 5EVIC 4NYYA 1ESUA 3QNBA 4FSFA 5A91A 4E3JA 4EQIA 3IF6C 4ZBJC 1O07A 2EFUA 1P3GD 3IH9A 1P3LC 3FKEA 4QLCC 1P3PA 5HFOA 1XGJA 3V3RA 4JJNB 3W4PA 1WYBA 1XPBA 4BL3A 3W99D 3NQJB 1HQ3D 1S32A 3AN2D 5AY8C 4NZ5A 2HIOC 1EROA 3A3IA 5F99A 3VH6W 3HL9A 4S2MA 4E3OA 5KZHA 3C1BD 3PBSA 3WA9B 1SDEA 2XH9A 3W98C 1KE0A 2B5RA 3RJUA 1Z2CB 1YU2A 4UUZB 5E5AD 2JBFA 4K91A 4Y0TA 3ITAA 1RP5A 1LHYA 4LD9C 3IQAA 3KUYB 1I2SA 3A3JA 5B0ZD 4B4ZA 4WYYA 4X53A 1F66B 2XD5A 3OZHA 5L2FA 2Y2JA 5F1FA 2CWEA 3KXBC 3MGPD 1KX5C 2Y4AA 3IXGA 3C1CB 4G91B 3L27A 5BNVB 5B1MB 4H9OA 3UT9D 1TAFA 1KX3B 1P3MD 4GHAA 4QNLA 3LZ1D 1KX4A 3L28A 2CV5D 1ID3B 4OJPA 3IHAA 5GT0A 4N9KA 4J8XA 4NZ3A 3WS5A 4X23D 3BEBA 1GA9A 1EQZB 1WWIA 1TDGA 2AROA 3AV1C 4S2NC 2J9PA 3HUNA 1P3BB 5DTKA 5AV6A 4JF4A 5FI2A 3FYZA 1YLPA 3AGEA 3F6TA 1BFMA 4WNNA 2Y59A 1IEMA 2NZDD 1RCJA 5HAIA 3KWQA 3IXHA 3RELA 2JE5A 3FV7A 2ZM5A 4YS3A 3B0CW 3GQZA 3Q07A 3B6GC 3REIA 3GRJA 3TU4C 5AQAA 3AZHA 1P3GB 1K57C 4UA7A 2X02A 3EPLA 5AQ9A 1BLSA 4NY2A 3M2KA 3HLEA 2WZXA 3X1SA 3MGRB 3PBNA 4FH4A 5CPID 3W99B 4QY6A 1P3PD 1BSGA 1KGEA 5B0YA 3PAGA 2Y2NA 1P3KB 1PI4A 1IELA 4OOMA 1CEGA 4OOLA 3QHYA 3IWQA 5CPJC 5B2JB 2HPBA 2FJ7C 2HDRA 1S32D 5E2HA 1BH8B 4PM6A 4Z5TA 1Q9CA 3VP4A 3C1BB 5BO0A 2YFVA 2G5HC 4Z66A 4OVDA 1N4OA 3ZG5A 5TFQA 1S6RA 5U47A 1SHVA 3BFGA 4RYEA 5B33C 1HZOA 3X1TA 1U35B 4NZ1A 3X1VA 5CEDA 1CEFA 2Y2KA 1E4DA 3GR2A 1M19B 4J8UA 1P3MB 3HUOA 2XDMA 1P3OB 2OV5A 2BYMB 4YM6B 1P3FA 1P34C 3EQVA 2IO5C 5HARA 5B40A 2OSUA 1ZLAA 1JFIB 3WAAA 5E2GA 4KGCD 5AV9A 3N8RA 3AFAA 1HVBA 1KX4D 2ZM0A 3MNNA 1YM1A 5GT0D 3M6BA 4J8XD 2ZY2A 3AYWA 4Y0OA 1SCWA 4IBFA 4KZ9A 2AROD 5KMWA 3WTPC 5AV8A 5AVCC 1FR1A 5AV6D 1PZOA 2H5SA 3MZDA 4B88A 1JWPA 4PM9A 5FQMA 3C5AA 4Y0UA 3GV9A 4OPYA 3VH6T 2J7VA 3KWQD 1N1JA 4E6WA 4KUDA 2OLVA 2ZQ9A 3RELD 4YS3D 3NDGA 5BT1C 2HDUA 3UPNA 4ZJ3A 2DNSA 2ZMAA 4IBJA 1OMEA 4X55A 5B32C 4E3NA 4J8WA 4ZTKA 4DQYB 3L25A 1C3BA 5CEBA 3UTAC 5HAPA 5DNMA 4IBGA 4NFTA 3X1SD 1BH9A 3MVDC 3MGSC 1NXYA 1DY6A 3A6NB 1ERQA 4P87A 3AV2C 1S32B 1W8QA 5GSUA 5HX9A 5B0YD 1Q2PA 4DDSA 3AZLC 3AZFC 1PW1A 3REHC 4LG2A 5FATA 5F99B 4EWFA 3TOIA 3WS4A 5B24A 3NC8A 3AZMB 4Z5TD 3G2ZA 3SS4A 4H9RB 4X6TA 1KGFA 4Z66D 5GHYA 4H9SA 3ZGAB 3M6HA 4S2IA 3UO9A 3VSLA 4HBTA 5AVBC 4R4RA 1BLCA 2G2WA 4FCFA 5DNND 1O7EA 3X1TD 3WS0A 4LENA 1TDLA 3H0MC 2EX2A 5B31C 3X1VD 1TZYC 1P3IA 4PPRA 2V1ZA 5JRGC 4H9OB 1TAFB 3AZEA 4WZ5A 2DF4C 1BT5A 4MBKA 2L5AA 4UHUA 1KX4B 1R4VA 1P3FD 2J8YA 5GT0B 3O62A 3AZNA 2W8SA 2FFFB 4J8XB 1ZLAD 3AZKA 3WAAD 4G92C 2BYKA 3BFCA 3AFAD 2UWXA 3MNND 2AROB 3AZJD 4JJNC 2HDQA 3H0RC 4QU3A 1W8YA 5AV6B 1ZKJA 1T3UA 3NBLA 2NQBA 4R8PD 2BG1A 3W8KA 3VP2A 4WNNB 5AV8D 3KWQB 1MWTA 1KGGA 1MKIA 3RELB 1J9MA 2ZY5A 3M2JA 2E8IA 3REIB 1YU0A 4WU8A 3AZHB 5FASA 2C6WB 5FA7A 3WA9C 4JBFA 1BTLA 3SH7A 5GT3D 1SDNA 3TG9A 1EWZA 3O86A 4NE3A 4DRAA 3KUYC 3O3VA 3X1SB 4JPMA 2V2FF 4QD4A 1F66C 5CGWA 4H9NA 2XGNA 4CJNA 3OPPA 1PWCA 2HP9A 4GOGA 3B6FD 3C1CC 5B0YB 4OJLA 4G91C 4QLCA 5DNMD 4OPQA 5B1MC 2ZY4A 1KX3C 3VOZA 4CAYA 3MGPA 3HLGA 2PU2A 4KQQA 1PWDA 3WRTA 5GSUD 1ID3C 1H8ZA 4Z5TB 2H10A 3ZG7B 1M6KA 4WEJA 2QZ6A 3ZFZA 4PMAA 2H0YA 4PM8A 5BO0B 2G2UA 3CMZA 2YFVB 3A1IA 4Z66B 1FSWA 2Y2MA 1EQZC 2JSSA 2FFYA 3LZ1A 5GXQA 2XEPA 1K54A 2CV5A 5B24D 4HEFA 4KZAA 4PM5A 3FZCA 3IWIA 2J9OA 1P3BC 3N8LA 3MFDA 3A3FA 3X1TB 2HDSA 5JYOA 3PTEA 4J8UB 3OC2A 3MGQD 4XUJB 3UTBA 1DJBA 1P3ID 3LO7A 3PBOA 2RVQC 1P3FB 5B40B 4NYUA 3UDFA 3VMAA 1ZLAB 3AZED 1P3GC 4WMCA 4ZJ2A 5AV9B 3BFEA 3CZDA 5EUAA 4S2OA 3MNNB 4AWLB 3REKA 5CXWA 3L26A 3BLSA 3R45A 3AZND 5M19A 3S22A 1MXOA 3AZKD 3LY4A 3AYWB 3MGRC 3MZEA 4JLFA 1XKZA 3W99C 3Q82A 1YLTA 3AZGB 5AV8B 3WS1A 1P3KC 3HLFA 5CPIA 3AL0C 2NQBD 1PZPA 5DVAA 5B2JC 2WYXA 3MBZA 1JWVA 1L2SA 3BRMA 5E2EA 4KUDB 4C3QA 3C1BC 5C3IB 2XLNA 1KDWA 2OLUA 4WU8D 5B32G 3RXXA 1M18D 5EVID 4J8WB 1K57A 1H3OA 1U35C 5JA4A 3DWKA 4OJ6A 2Y2OA 5DNMB 1K55A 4KZ8A 1BH9B 1M19C 1P3MC 3CJMA 1FSYA 3V50A 1P3LD 1P3OC 4QLCD 1EI5A 4YM6C 2WGWA 3RXWA 1FQGA 3P98A 4L0LA 3KS4A 1A7WA 4QB8A 1ESIA 3BYDA 2R9XA 3REJA 1GA0A 2DCFA 5B24B 2FJ7A 5CRFA 5FQQA 3JYIA 3VSKA 3N8SA 4EO5B 4KGCA 3LELA 3IH8A 1LL9A 5GXQD 4MNRA 3IP4C 3L29A 3BFFA 4X68A 3SS3A 5B2IB 5B31G 1XA7A 3V3SA 1I2WA 3HLDA 3W98D 1P3IB 4P6BA 2ZM2A 3PBQA 3FWLA 4IJEA 4KHAA 2PYOB 4LD9D 4WBGA 3MXSA 3UTBD 2GDNA 5CTNA 4EV4A 4IBDA 1LI0A 4E3LA 3O62B 2F8NA 4LV0A 3AZNB 3AZKB 2WGIA 4WMCD 3HLCA 2BYKB 5CECA 1FCOA 2I72A 3UPPA 3REKD 1NZUA 1YMSA 1FCMA 4RX2A 4KENB 3A6NC 2NQBB 3EPJA 5M18A 1S32C 3AZIA 2LY8A 5AVCA 5AV5A 5BS7A 1ZG6A 1K6SA 4R3JA 4S2JA 1HQ3B 1WYCA 2HP6A 4JF5A 5F99C 3AN2B 2XR0A 3AZMC 4P0MA 1VQQA 5GL9A 2WGVA 3UDXA 4YINA 2Y2QA 2ZC6B 3IXBA 4KZ4A 3G32A 1K38A 3N4IA 3B6GD 2HP5A 1XXMA 3B3XA 4PM7A 3TU4D 1YQSA 2X01A 2JCHA 5FAPA 4H9NB 1M1AA 4ZJ1A 3DW0A 5E5AB 1AOIA 5CPKA 4WV4B 3UTAA 3G35A 3V9RA 5DNNA 5B0ZB 4DE3A 4R4SA 3VFHA 1JTGA 2RIQA 4KQRA 4CAYB 3MGPB 3HREA 4E3IA 3MGSA 3SS5A 1KX4C 1MWRA 1PW8A 5GT0C 4GDBA 3ZHHA 4J8XC 3UT9B 3A1KA 3OCNA 5FDHA 2EXBA 4WU9A 4U0XA 3REJD 3G34A 3LZ1B 4E44A 5GXQB 3REHA 1U60A 2AROC 2CV5B 1TEMA 4H9QB 2FJ7D 1K6RA 4NZ4A 4LCMA 5KSCA 3X1UA 4X23B 5FAOA 1W7FA 4ZBEA 4E3KA 4NE6A 5AV6C 3LELD 1YU1A 3AZJA 3EG5B 1L0FA 4E45A 3WX7A 4UA9A 5F82A 2Q9NA 4R8PA 3RELC 3UTBB 5CP6A 4QHCA 5HAQA 4KQOA 2ZQ7A 3G31A 4DF6A 2WKHA 3REIC 2NZDB 5B31A 3AZHC 3O87A 3V39A 3IT9A 4M6BA 3HUMA 3B0BA 3UE3A 2XFSA 2ZC3B 3LZ0A 1W79A 4EBLA 3REKB 5GLAA 2F8ND 3R45B 3X1SC 5EOOA 1B6WA 3UN7A 4KZBA 5FI7A 2VGKA 5GT3A 1XP4A 4DE1A 5B0YC 3W97A 4IEDA 4DXBA 1KDSA 2WADA 2Y2LA 3AGDA 5CPIB 1LI9A 4OOYA 1P3PB 3B6FA 1YUEA 3HLBA 4HBUA 4Z5TC 3B0DB 3AZID 3WTPD 1IYQA 5AVCD 5AV5D 3EQUA 4Z66C 5DF7A 4N9LA 5CHMA 5G18A 1DJAA 4GH9A 3HBRA 4DE2A 2WAEA 5A93A 3GMWA 3X1TC 3WA9A 1H3OB 1QMFA 5JA4B 4R0QA 2F8NH 1GHIA 5TR7A 1RGYA 4J8UC 1RGZA 1NYMA 3G30A 5BNXA 4WM9A 4BD0A 4XUJC 1M1AD 1IYSA 1AOID 5B32D 5CPKD 4RA7A 1P3FC 2WGWB 1IYOA 3UTAD 5B40C 4XXRA 5G49A 1ZLAC 3W96A 3MGQA 2R9WA 4J8VA 5AV9C 3A3DA 3MGSD 3REJB 3N7WA 3MNNC 4AWLC 1KE3A 4QY5A 3ZCZA 3LJAA 3AYWC 2Q9MA 3DTMA 4Q8IA 4KGCB 3VP0A 4WU9D 3LELB 5M1AA 3P09A 1KU5A 3REHD 1TVFA 5F83A 3O88A 2EXAA 3DWZA 1YU4A 4ZUXA 3AZGC 5AV8C 3X1UD 1SKFA 3D4FA 5FSRA 1N9BA 2ZQAA 2XK1A 3WKJA 4KHAB 3TSGA 1HTAA 3H0LC 4KUDC 5AQ7A 3ZNYA 4C6YA 5C3IC 5CP6D 1ZC2A 3ZVWA 3MKEA 5B31D 1PYYA 2F8NB 4EBPA 1Y54A 5JRGD 5B1LA 4XZQA 4J8WC 4YS3B 1P3AA 1NRFA 5EOEA 3LZ0D 1MPLA 5BPVA 4OP5A 5DNMC 3HVFA 5A92A 5CGXA 3WWXA 1DJCA 1M18A 5EVIA 3HLWA 2VGJA 1ULYA 2Y2IA 3W97D 3QNCA 3AZIB 1GHPA 3IF6A 3BM6A 5AV5B 1QMEA 1IKIA 1YLYA 4OJOA 1P3LA 1KE4A 4MLLA 5B24C 4X69A 5KSHA 3ZG0A 5KDMA 4EO5C 4BL2A 4H9SC 5GHXA 3UNWA 4E3MA 3OCLA 2IWCA 4IBXA 4WZ4A 3BFDA 3FKWA 5AY8A 1YLZA 4KZ6A 5B2IC 4GD6A 1M1AB 3WA9D 2VQRA 2HIOA 2PU4A 4BD1A 2G5IC 4JXWA 1AOIB 5CPKB 1P3IC 3E2LA 1U35A 3NY4A 2DQNC 4N92A 3V9RB 5DNNB 2PYOC 2ZY3A 2P9VA 2A3UA 4WZ5C 4IBEA 4P85A 3VFFA 1K4EA 1WWSA 3X1VB 3W98A 4N1HA 4R1GA 1K25A 3O62C 1P3OA 3AZNC 4K0XA 2YFWA 4YM6A 3AZKC 3W96D 4KZ5A 4LD9A 4WJ3C 4J8VD 4M3KA 1KX3D 1M40A 4WU9B 3WS2A 5EVLA 3KXBA 1JWZA 1KX5A 2XF3A 1BLHA 3WAAB 3LJAD 2A49A 3X1UB 1K4FA 2NQBC 5DF8A 3AFAB 5HW3A 1EQZD 3AZJB 4ZUXD 4IVIA 1MWSA 4MEZA 3BECA 5FUGA 1P3BD 4GZBA 4R8PB 3A3EA 5CP6B 1HQ3C 5E43A 3VP1A 3WKJD 2CC1A 3IWOA 3AN2C 4F94A 3AV1A 4S2NA 4GHLA 4CSRA 5CERA 3AGFA 3C4PA 3LZ0B 3MZFA 3VH5A 2EX6A 2RVQD 1N1JB 4OKPA 3EPHA 4FH2A 5B1LD 4XZQD 4KG6A 4H8RA 1P3AD 1IKGA 4G92B 5E5AC 5GT3B 3W4QA 3W97B 1ZG4A 3B6GA 4GNUA 5B0ZC 3TU4A 2QPNA 3MGRD 3MGPC 1YMXA 1LLBA 3GVBA 3SH8A 3SOIA 3I7JA 3A6NA 3B6FB 5GLBA 1GHMA 1G6AA 3UT9C 1BUEA 3ZVTA 3N3FA 5GLDA 3OPHA 3L2AA 1P3KD 1ES4A 3LZ1C 4RX3A 4OLDA 5GSUB 5GXQC 4S2LA 4JXGA 1K54C 2CV5C 5B2JD 1YLJA 3ZG8B 1E3UA 4Y7PA 2HUEB 2EX9A 4X23C 3AZMA 1Q2QA 4Z2MG 4H9RA 3MXRA 5F1GA 5CPJA 1CK3A 5AY8D 1BULA 4NK3A 3S1YA 5BNXB 5DTSA 4GKUA 3UTBC 1ONGA 2HIOD 4WEKA 3WTPE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O7E A;  1XX2 A;  1PI5 A;  5GHZ A;  3G34 A;  3V5M A;  1U60 A;  4MBF A;  1TEM A;  3WS0 A;  4LEN A;  1TDL A;  5BOH A;  2EX2 A;  4OON A;  1K6R A;  4LCM A;  4PPR A;  1NYY A;  5KSC A;  5FAO A;  1W7F A;  4OP8 A;  4ZBE A;  4E3K A;  2V1Z A;  1S0W A;  1XGI A;  2Y55 A;  4WZ5 A;  1MY8 A;  3WRZ A;  1BT5 A;  4A5R A;  1L0F A;  4IBR A;  4MBK A;  1MWU A;  4E6X A;  3NI9 A;  4UA9 A;  4UHU A;  3G4P A;  4FD8 A;  5F82 A;  3OPL A;  2Q9N A;  2J8Y A;  3LEZ A;  1KVL A;  2Y2P A;  4KZ7 A;  2C5W B;  5EEC A;  2FFF B;  4N1X A;  3ZDJ A;  4QHC A;  5HAQ A;  4QJG A;  4KQO A;  4RVA A;  3C4O A;  2ZQ7 A;  2Y2H A;  3BFC A;  4LV1 A;  3G31 A;  4DF6 A;  2WKH A;  3UE0 A;  4R3B A;  2UWX A;  5FAQ A;  2ZQD A;  4HES A;  3O87 A;  3PBR A;  4GB7 A;  3UDI A;  2HDQ A;  2IWD A;  3V39 A;  3IT9 A;  1JVJ A;  3HUM A;  4Z9Q A;  1H8Y A;  3UE3 A;  4QU3 A;  5DTT A;  2XFS A;  1W8Y A;  3G2Y A;  1ZKJ A;  2ZC3 B;  3NBL A;  5EVI C;  1W79 A;  4EBL A;  5CTM A;  2BG1 A;  3OPR A;  1ESU A;  5GLA A;  3W8K A;  2PBY A;  3QNB A;  4FSF A;  5A91 A;  3VP2 A;  2P74 A;  2BLS A;  5EOO A;  4E3J A;  3UN7 A;  4EQI A;  3C7U A;  3IF6 C;  1MWT A;  1KGG A;  4KZB A;  5FI7 A;  3S4X A;  2VGK A;  1MKI A;  2QMI A;  1O07 A;  4KZ3 A;  1J9M A;  1ES5 A;  1XP4 A;  2EFU A;  4DE1 A;  4IED A;  3PAE A;  3IH9 A;  3M2J A;  4DXB A;  1XA1 A;  5AQB A;  2E8I A;  1KDS A;  2WAD A;  2Y2L A;  3AGD A;  3IXD A;  2ZC7 A;  3Q7V A;  1LI9 A;  5HFO A;  5FAS A;  1XGJ A;  4OOY A;  3V3R A;  2C6W B;  5I94 A;  5FA7 A;  1K55 C;  4JBF A;  4OH0 A;  4XUZ A;  3W4P A;  3HLB A;  1BTL A;  4HBU A;  2IWB A;  3SH7 A;  4CPK A;  5EVI B;  1WYB A;  3N6I A;  1XPB A;  4IVK A;  4BL3 A;  1VM1 A;  1SDN A;  2XQZ A;  3TG9 A;  1IYQ A;  1EWZ A;  5FQJ A;  4OPZ A;  3O86 A;  1JTD A;  3EQU A;  3O3V A;  1FR6 A;  4JPM A;  4GN2 A;  1K56 A;  2V2F F;  5DF7 A;  4QD4 A;  5CGW A;  2XGN A;  4N9L A;  4CJN A;  3IF6 B;  3OPP A;  1PWC A;  5CHM A;  5G18 A;  4ZDX A;  2HP9 A;  2ZM8 A;  4UAA A;  4GOG A;  4YFM A;  1DJA A;  1ERO A;  4OPQ A;  3HBR A;  4DE2 A;  3A3I A;  2WAE A;  1ES2 A;  4S2K A;  5A93 A;  3GMW A;  3VOZ A;  3HL9 A;  1QMF A;  1BLP A;  4R0Q A;  4S2M A;  4E3O A;  3HLG A;  2PU2 A;  5KZH A;  3PBS A;  4KQQ A;  1GHI A;  1PWD A;  3WRT A;  1SDE A;  2XH9 A;  2H0T A;  5TR7 A;  1KE0 A;  2B5R A;  1RGY A;  3RJU A;  4BQM A;  1RGZ A;  1H8Z A;  1NYM A;  3G30 A;  2H10 A;  2JBF A;  4K91 A;  4WM9 A;  1M6K A;  3ZG7 B;  4WEJ A;  4BD0 A;  1MBL A;  2QZ6 A;  1IYS A;  1RP5 A;  3ITA A;  4Y0T A;  3ZFZ A;  1E3U D;  4PMA A;  2H0Y A;  3NCK A;  1LHY A;  3IQA A;  4PM8 A;  3CMZ A;  2G2U A;  1I2S A;  3A3J A;  1FSW A;  2Y2M A;  4B4Z A;  4WYY A;  4RA7 A;  4X53 A;  2FFY A;  2WGW B;  1IYO A;  1CI8 A;  2XD5 A;  3OZH A;  2XEP A;  5L2F A;  2Y2J A;  1FOF A;  4XXR A;  1K54 A;  5F1F A;  4HEF A;  3NIA A;  4KZA A;  2Y4A A;  2R9W A;  3IXG A;  3ZNT A;  4PM5 A;  3FZC A;  3IWI A;  2J9O A;  3A3D A;  4JKT A;  3N8L A;  3MFD A;  3N7W A;  3A3F A;  2WK0 A;  1KE3 A;  2P9V B;  4QY5 A;  4BJP A;  3ZCZ A;  1ONH A;  2HDS A;  5JYO A;  4MBH A;  2Q9M A;  3DTM A;  4Q8I A;  4OQI A;  3VP0 A;  3PTE A;  2ZJ9 A;  3IHA A;  3OC2 A;  5M1A A;  3P09 A;  4N9K A;  1TVF A;  5F83 A;  3O88 A;  3WS5 A;  3BEB A;  2EXA A;  3DWZ A;  4GDN A;  1DJB A;  4X56 A;  3VOY A;  5J8X A;  3LO7 A;  3PBO A;  1GA9 A;  1SKF A;  1PWG A;  3D4F A;  5A90 A;  5FSR A;  4C75 A;  1NZO A;  4LV3 A;  1TDG A;  3UDF A;  1N9B A;  3VMA A;  1ES3 A;  4S2N C;  2ZQA A;  2XK1 A;  1L0D A;  2J9P A;  3HUN A;  4WMC A;  4ZJ2 A;  3BFE A;  3ISG A;  2ZQC A;  5JYP A;  3CZD A;  5DTK A;  1H5X A;  2ZC4 B;  4S2O A;  5EUA A;  4JF4 A;  3TSG A;  5CXW A;  3BLS A;  2JC7 A;  5FI2 A;  3FYZ A;  4UA6 A;  5AQ7 A;  3ZNY A;  5M19 A;  2EFX A;  3S22 A;  1MXO A;  1YLP A;  3AGE A;  3LY4 A;  2ZLY A;  4C6Y A;  2Y59 A;  5HAI A;  1IEM A;  1RCJ A;  1ZC2 A;  1LL5 A;  1KVM A;  3MZE A;  4JLF A;  1XKZ A;  3ZVW A;  5CHU A;  3MKE A;  3IXH A;  1PYY A;  4EBP A;  4S2P A;  3Q82 A;  2JE5 A;  1YLT A;  3FV7 A;  2V20 A;  3GQZ A;  1Y54 A;  3WS1 A;  5HL1 A;  3Q07 A;  3Q7Z A;  4DDY A;  3E2K A;  3GRJ A;  3HLF A;  4BEN A;  4DE0 A;  1NRF A;  5EOE A;  5AQA A;  1MPL A;  1PZP A;  4OP5 A;  1NJ4 A;  3LCE A;  5DF9 A;  1K57 C;  4ID4 A;  5DVA A;  4UA7 A;  2WYX A;  2WKE A;  2X02 A;  3MBZ A;  3SH9 A;  3HVF A;  5AQ9 A;  3VP3 A;  5A92 A;  1JWV A;  5CGX A;  3WWX A;  1L2S A;  1BLS A;  1DJC A;  3BRM A;  5EVI A;  1NY0 A;  3M2K A;  5E2E A;  1YT4 A;  3HLE A;  3HLW A;  2VGJ A;  4C3Q A;  3IHB A;  2ZD8 A;  5FI6 A;  2WZX A;  2Y2I A;  2XLN A;  3PBN A;  3QNC A;  4FH4 A;  2RL3 A;  4DXC A;  4LV2 A;  1GHP A;  2OLU A;  1KDW A;  3IF6 A;  3BM6 A;  4QY6 A;  1QME A;  1BSG A;  4WEL A;  1CI9 A;  1KGE A;  1IKI A;  1YLY A;  3GSG A;  4ZAM A;  1L0G A;  3PAG A;  3RXX A;  1KE4 A;  2Y2N A;  5EVI D;  1AXB A;  4B4X A;  1PI4 A;  4EUZ A;  1K57 A;  1IEL A;  2XD1 A;  4MLL A;  1W5D A;  4OOM A;  4X69 A;  1CEG A;  4OOL A;  3QHY A;  3DWK A;  3IWQ A;  5KSH A;  2HPB A;  2Y2O A;  1K55 A;  3ZG0 A;  2HDR A;  4KZ8 A;  4K0W A;  5E2H A;  4PM6 A;  4BL2 A;  5GHX A;  3UNW A;  1K56 D;  3CJM A;  1FSY A;  4E3M A;  3OCL A;  2IWC A;  3VP4 A;  3V50 A;  4IBX A;  4WZ4 A;  3BFD A;  5IHV A;  3FKW A;  1YLZ A;  1N4O A;  4OVD A;  4KZ6 A;  1EI5 A;  3RXW A;  2WGW A;  3ZG5 A;  1FQG A;  5TFQ A;  1S6R A;  2DRW A;  3IF5 A;  3P98 A;  4L0L A;  4GD6 A;  5U47 A;  1SHV A;  4QB8 A;  2PU4 A;  5FQ9 A;  4BD1 A;  4JXW A;  1ESI A;  3BYD A;  1IYP A;  3BFG A;  4RYE A;  5CHJ A;  2R9X A;  3E2L A;  3UPO A;  1GA0 A;  3NY4 A;  1ALQ A;  1HZO A;  2DCF A;  4N92 A;  2P9V A;  3C7V A;  1G68 A;  2A3U A;  4WZ5 C;  5CRF A;  5CED A;  5FQQ A;  3JYI A;  1GCE A;  4P85 A;  3VFF A;  1K4E A;  1CEF A;  3VSK A;  2Y2K A;  1E4D A;  3GR2 A;  3N8S A;  4N1H A;  4R1G A;  3ITB A;  1K25 A;  3IH8 A;  3ZG9 B;  1LL9 A;  3HUO A;  4K0X A;  5EE8 A;  4MNR A;  2XDM A;  4KZ5 A;  5FQI A;  2Z2L B;  4KG2 A;  1ERM A;  2OV5 A;  4M3K A;  3BFF A;  3FKV A;  1M40 A;  4X68 A;  3EQV A;  3SS3 A;  5HAR A;  3WS2 A;  5EVL A;  4U0T A;  1XA7 A;  1JWZ A;  2OSU A;  3V3S A;  4XUX A;  1I2W A;  2WKI A;  2XF3 A;  3HLD A;  2EX8 A;  5E2G A;  4JXV A;  3N8R A;  1BLH A;  2A49 A;  4P6B A;  5E2F A;  2ZM2 A;  3PBQ A;  1HVB A;  3FWL A;  2ZM0 A;  1K4F A;  4GD8 A;  1YM1 A;  3M6B A;  5DF8 A;  4WBG A;  5HW3 A;  3GTC A;  3MXS A;  1HD8 A;  2GDN A;  4IVI A;  4Y0O A;  1SCW A;  1YLW A;  5CTN A;  4EV4 A;  1LI0 A;  4E3L A;  1MWS A;  2WUQ A;  4KZ9 A;  4MEZ A;  3BEC A;  4LV0 A;  5GLC A;  5KMW A;  4GZB A;  3A3E A;  3LY3 A;  4EBN A;  5E43 A;  3VP1 A;  2WGI A;  1BZA A;  4WMC D;  3HLC A;  1FR1 A;  2CC1 A;  4R23 A;  5CEC A;  3IWO A;  1FCO A;  3UY6 A;  2I72 A;  4F94 A;  3UPP A;  1L0E A;  1PZO A;  4OPR A;  4OQH A;  2H5S A;  1NZU A;  3MZD A;  4B88 A;  1JWP A;  4S2N A;  1BLC A;  4PM9 A;  5FQM A;  4JF6 A;  3C5A A;  1YMS A;  2WZZ A;  4Y0U A;  1FCM A;  3GV9 A;  4OPY A;  4RX2 A;  5CER A;  3BLM A;  2J7V A;  3AGF A;  4KEN B;  3C4P A;  4E6W A;  3MZF A;  1I5Q A;  2OLV A;  5M18 A;  2ZQ9 A;  2EX6 A;  2Y91 A;  2Z2M B;  3CG5 A;  3NDG A;  4OKP A;  4FH2 A;  3Q81 A;  3W4O A;  3Q1F A;  2HDU A;  4KG6 A;  3UPN A;  4ZJ3 A;  3NDE A;  4H8R A;  1HTZ A;  1IKG A;  2DNS A;  4KG5 A;  1ZG6 A;  2ZMA A;  1K6S A;  4R3J A;  4S2J A;  4JXS A;  3W4Q A;  1WYC A;  2HP6 A;  1FCN A;  1OME A;  1ZG4 A;  4JF5 A;  4X55 A;  2RCX A;  4GNU A;  2XR0 A;  4E3N A;  4ZTK A;  2QPN A;  2Y2G A;  3Q7V B;  1C3B A;  5CEB A;  5HAP A;  2WAF A;  1YMX A;  1LLB A;  3GVB A;  3SH8 A;  3SOI A;  3I7J A;  1VQQ A;  4P0M A;  5GL9 A;  2WGV A;  5GLB A;  3UDX A;  4YIN A;  1GHM A;  2Y2Q A;  1NXY A;  1Z6F A;  2ZC6 B;  3IXB A;  5TGF A;  4DRT A;  1DY6 A;  4KZ4 A;  3G32 A;  5FQK A;  1ERQ A;  4P87 A;  1G6A A;  1K38 A;  1BUE A;  3UE1 A;  3ZVT A;  4OQG A;  5GLD A;  3OPH A;  3N4I A;  1W8Q A;  3PBT A;  5HX9 A;  1ES4 A;  2HP5 A;  5D3O A;  1WE4 A;  1Q2P A;  1XXM A;  3B3X A;  4PM7 A;  4DDS A;  1YQS A;  2X01 A;  1PW1 A;  4RX3 A;  2JCH A;  5FAP A;  4OLD A;  4S2L A;  4JXG A;  5EPH A;  1K54 C;  4ZJ1 A;  1YLJ A;  3DW0 A;  3ZG8 B;  1E3U A;  4Y7P A;  2XFT A;  2EX9 A;  4OQ0 A;  4DKI A;  4LCL A;  5FAT A;  1Q2Q A;  2X71 A;  4EWF A;  3G35 A;  3TOI A;  2ZQ8 A;  3WS4 A;  4DE3 A;  4R4S A;  3NC8 A;  3VFH A;  3MXR A;  1JTG A;  5F1G A;  3G2Z A;  3SS4 A;  4KQR A;  3MKF A;  1PIO A;  3HRE A;  4E3I A;  4D2O A;  1CK3 A;  4X6T A;  1KGF A;  1BUL A;  4NET A;  4NK3 A;  3SS5 A;  5CGS A;  5GHY A;  4O7D A;  1MWR A;  1PW8 A;  2ZC5 B;  3ZGA B;  3M6H A;  3S1Y A;  5DTS A;  4GDB A;  4BLM A;  1E25 A;  4S2I A;  3UO9 A;  3ZHH A;  4GKU A;  3VSL A;  1ONG A;  4OLG A;  4U3T A;  4HBT A;  4R4R A;  5FDH A;  4WEK A;  2EXB A;  2G2W A;  4FCF A;  3OCN A;  4U0X A; 
#chains in the Genus database with same CATH topology
 1XX2 A;  1PI5 A;  1U35 D;  2NZD C;  3KYQ A;  5G49 B;  4MCW A;  5BOH A;  2PDR A;  3W96 B;  3MGQ B;  4OON A;  2D01 A;  4J8V B;  4LGW A;  1M19 D;  3U2A A;  5B33 A;  4OP8 A;  1XGI A;  2Y55 A;  2GNX A;  3REK C;  2VV7 A;  1MY8 A;  1P3O D;  4YM6 D;  3LJA B;  3AZE B;  3KSY A;  1MWU A;  4E6X A;  3OPL A;  3HON A;  3KXB D;  2Y2P A;  1KX5 D;  4L9G A;  3ZDJ A;  5HDD A;  1OPX A;  4ZUX B;  2JKT M;  4EER A;  2Y2H A;  2EWV A;  4LV1 A;  2YKF A;  3UE0 A;  1P34 A;  3VH6 A;  4R3B A;  5FAQ A;  5CPI C;  4IJF A;  1Y28 A;  3UDI A;  4Z9Q A;  1P3P C;  3WKJ B;  1H8Y A;  1G6O A;  4OJ5 A;  3B0D C;  4I39 A;  5CTM A;  3OPR A;  4HGA B;  1TS0 A;  2PBY A;  2P74 A;  3FDD A;  2BLS A;  3O5Y A;  4EEP A;  3C7U A;  3S4X A;  1PZR A;  3AV1 D;  2QMI A;  4KZ3 A;  3WTP A;  1ES5 A;  1GSW A;  3PAE A;  1XA1 A;  4NEE D;  5AQB A;  5B1L B;  4XZQ B;  1W63 Q;  3IXD A;  2ZC7 A;  3Q7V A;  1P3A B;  4KQD A;  5I94 A;  4WU8 B;  1WA9 A;  1K55 C;  1YSQ A;  2JKG A;  4OH0 A;  4XUZ A;  3VE3 A;  1MZU A;  2IWB A;  1M18 B;  4CPK A;  5EVI B;  3N6I A;  4IVK A;  3NQU A;  1VM1 A;  2XQZ A;  2M7U A;  5FQJ A;  4OPZ A;  1JTD A;  5FEG A;  1FR6 A;  5EVE A;  4GN2 A;  1K56 A;  3VH5 T;  3IF6 B;  4ZBJ B;  4QWO A;  2G7U A;  4ZDX A;  2ZM8 A;  4UAA A;  4YFM A;  3LI9 A;  1DP9 A;  2V8F A;  3REJ C;  1P3L B;  1ES2 A;  5B32 A;  3A6N D;  4S2K A;  4QLC B;  5LBR A;  2QHK A;  3UB9 A;  1BLP A;  1TF1 A;  5KDM B;  2H0T A;  3P7N A;  4KGC C;  2D02 A;  4F3L B;  3MVD A;  3LEL C;  4BQM A;  1MBL A;  1E3U D;  3AV2 A;  1E6Z A;  3NCK A;  5F99 D;  5AY8 B;  4GJ4 A;  3AZM D;  3AZL A;  3AZF A;  1CI8 A;  1FOF A;  1OT9 A;  2VJW A;  3NIA A;  2HIO B;  3ZNT A;  2J3T C;  4HI4 A;  4BBT A;  5CPJ D;  4JKT A;  2F8N K;  2WK0 A;  2P9V B;  4BJP A;  2Z6C A;  1ONH A;  3TRC A;  2KX6 A;  4MBH A;  4OQI A;  3W98 B;  4XUJ A;  2ZJ9 A;  4H9P A;  4DRB A;  3KWQ C;  5CHL B;  2YFW B;  4X1M A;  4GDN A;  5AVB A;  4LD9 B;  3MXQ A;  4HHD A;  4X56 A;  3VOY A;  5J8X A;  1PWG A;  5A90 A;  5B33 D;  4C75 A;  4YS3 C;  1NZO A;  4LV3 A;  4UPK A;  3KXB B;  1F98 A;  1KX5 B;  1ES3 A;  1TZY A;  1L0D A;  1D06 A;  5TBM B;  5JYP A;  2YKH A;  3ISG A;  2ZQC A;  1H5X A;  4WL9 A;  2IOU A;  5JRG A;  2ZC4 B;  2JC7 A;  2F2A C;  4UA6 A;  2EFX A;  1PFL A;  2ZLY A;  4IBI A;  1LL5 A;  1KVM A;  3AZI C;  5CHU A;  1P34 D;  3CHW P;  3AZG A;  1OTA A;  5AV5 C;  5BS7 C;  5FUG B;  4S2P A;  4DJ3 A;  2V20 A;  5HL1 A;  3Q7Z A;  4DDY A;  3E2K A;  4DE0 A;  4BEN A;  3AV1 B;  4JJN A;  1NJ4 A;  3F1P A;  3LCE A;  5DF9 A;  4ID4 A;  2WKE A;  3VP3 A;  3SH9 A;  4CSR B;  2Q0O A;  1L3L A;  3D72 A;  1NY0 A;  5DKK A;  3NQJ A;  1XJ2 A;  1YT4 A;  2W3G A;  3IHB A;  2ZD8 A;  4R3A A;  5FI6 A;  3P5J B;  3REI D;  1E15 A;  2Y8H A;  2RL3 A;  4DXC A;  4LV2 A;  3AZH D;  4HJ3 A;  2XRN A;  1M1A C;  5DFY A;  2KOI A;  4WEL A;  1CI9 A;  1AOI C;  3GSG A;  4ZAM A;  5CPK C;  1L0G A;  1T1B A;  3UB8 A;  1AXB A;  2JKR M;  4B4X A;  3B6G B;  1O6I A;  3WD0 A;  4EUZ A;  5DNN C;  2XD1 A;  2W3D A;  1W5D A;  3D9Y A;  3TU4 B;  5AVE A;  3UB5 P;  3T1X A;  4IBC A;  1KOU A;  4NE5 A;  4K0W A;  3X1V C;  2V9A A;  4IJG A;  5BT1 D;  1K56 D;  1S4S A;  1G5U A;  4UUZ A;  2V5O A;  3WD2 A;  5FEF A;  3B47 A;  3KUY A;  2JKF A;  3UE6 A;  5IHV A;  4WU9 C;  1XFQ A;  1F66 A;  1F9I A;  3IF5 A;  2DRW A;  3MQL A;  5FQ9 A;  3C1C A;  1IYP A;  5CHJ A;  3WAA C;  3UPO A;  3X1U C;  3LR3 A;  2ACG A;  5BNV A;  5B1M A;  1ALQ A;  1KX3 A;  3C8C A;  3MVD D;  3EPK A;  3C7V A;  3AFA C;  1LSV A;  1IOU A;  1G68 A;  5CPJ B;  3HSH A;  1GCE A;  3AZJ C;  3AV2 D;  2FJ7 B;  2FZ0 A;  1B67 A;  3ITB A;  1ID3 A;  3AZL D;  3AZF D;  4WZS B;  4Y2F A;  3ZG9 B;  1H8P A;  5EE8 A;  4R8P C;  5FQI A;  5CP6 C;  2H28 A;  2Z2L B;  5B2I A;  4KG2 A;  1ERM A;  3FKV A;  1EQZ A;  4IUH A;  3VE4 A;  2ZL1 A;  3B0C T;  1H3Q A;  4U0T A;  4EQ1 A;  4XUX A;  4EUV A;  2WKI A;  3MR0 A;  2EX8 A;  3G6O A;  4JXV A;  1P3B A;  2PYO A;  4J8U D;  1SKO A;  5B33 B;  5E2F A;  3KYE A;  4XUJ D;  4UEY A;  4GD8 A;  3LZ0 C;  3KS8 A;  3U4L P;  3GTC A;  3IX8 A;  1HD8 A;  5AVB D;  1YLW A;  5B40 D;  1W1Y A;  2WUQ A;  4ARZ A;  4EXO A;  5GLC A;  5AV9 D;  5GT3 C;  3KFU G;  5HWT A;  3LY3 A;  3OBF A;  4EBN A;  3W97 C;  1TZY D;  1BZA A;  4R23 A;  2VK3 A;  4IBK A;  1P34 B;  3UY6 A;  2IO5 B;  1L0E A;  4OPR A;  4OQH A;  3AYW D;  1XJ3 A;  1P3G A;  5IT5 A;  4JF6 A;  2WZZ A;  5HPF A;  3CLO A;  3B6F C;  3BLM A;  1T18 A;  1I5Q A;  3E4O A;  3AZG D;  4WN5 A;  2Y91 A;  3QP5 A;  5IU1 A;  3MGR A;  2Z2M B;  3CG5 A;  4MDZ A;  2JHE A;  3Q81 A;  3W4O A;  3Q1F A;  5GSU C;  3W99 A;  1LT0 A;  3NDE A;  1HQ3 A;  1UWN X;  1HTZ A;  4Z2M H;  1YAX A;  3V67 A;  3H82 A;  2OOL A;  4KG5 A;  4CLC E;  3WTP B;  4JJN D;  2HUE C;  3AN2 A;  3A0V A;  4JXS A;  3ULF A;  5AVC B;  1FCN A;  1P3K A;  2RCX A;  4KUD D;  1S67 L;  3T4L A;  2Y2G A;  1UR8 A;  3Q7V B;  4K08 A;  2WAF A;  5B2J A;  1BH8 A;  3EGX C;  4IBB A;  1Z6F A;  5TGF A;  4DRT A;  5FQK A;  1W2E A;  3NQU B;  1A0K A;  3T4Q A;  3C1B A;  4WLA A;  3UE1 A;  4OQG A;  3PBT A;  4O8G A;  4J8W D;  5D3O A;  1WE4 A;  1LSX A;  3BJN A;  5E5A A;  3NOT C;  5EPH A;  4EET B;  3W96 C;  1VB6 A;  3MGQ C;  1X0O A;  2EWW A;  2XFT A;  3T4K A;  4J8V C;  5B0Z A;  4OQ0 A;  5EFW A;  4DKI A;  4LCL A;  2X71 A;  3RTY A;  5B32 B;  4BWI A;  2ZQ8 A;  4OUI A;  3MKF A;  3UTA B;  3B33 A;  1PIO A;  3LJA C;  3AZE C;  4D2O A;  4LFU A;  3KUY D;  1YU3 A;  4NET A;  3GDI A;  5CGS A;  1M19 A;  4O7D A;  3UT9 A;  3MVD B;  3MGS B;  2ZC5 B;  1P3M A;  1F66 D;  4LRX C;  2J8P A;  1GOI A;  4BLM A;  1E25 A;  4OLG A;  4U3T A;  3AV2 B;  4ZUX C;  3VH5 W;  3C1C D;  2BYM A;  4H9Q A;  3AZL B;  3AZF B;  5GHZ A;  3V5M A;  4CLC A;  4LRZ E;  5B1M D;  4MBF A;  1JFI A;  4X23 A;  4JGR A;  2VLG A;  1BYW A;  3REH B;  3WKJ C;  1NYY A;  1OTB A;  1S0W A;  1ID3 D;  3FC7 A;  4HGA C;  3C38 A;  3WRZ A;  3S7N A;  4A5R A;  4IBR A;  5B2I D;  4TX8 A;  2F8N G;  3NI9 A;  3G4P A;  4FD8 A;  4O01 A;  3F1O A;  2XA7 S;  4HIA A;  3LEZ A;  4H9P B;  1KVL A;  4KZ7 A;  2C5W B;  5EEC A;  4N1X A;  2O0Y A;  1P97 A;  4QJG A;  4RVA A;  2NZD A;  2HJE A;  5AVB B;  3C4O A;  1CXW A;  1D1J A;  2PYO D;  5B1L C;  4XZQ C;  3KO6 A;  1P3A C;  2ZQD A;  4HES A;  3PBR A;  4GB7 A;  5B31 B;  2IWD A;  4WU8 C;  1JVJ A;  3GEC A;  1TZY B;  1F1E A;  5AJG A;  5DTT A;  3O62 D;  4IUK A;  5F5Y A;  5JRG B;  1M18 C;  3G2Y A;  5EVI C;  4NYY A;  1ESU A;  3QNB A;  2ZOH A;  4FSF A;  5A91 A;  4E3J A;  3LI8 A;  2XA7 M;  3NUL A;  4EQI A;  3IF6 C;  4ZBJ C;  1O07 A;  2NUT C;  2EFU A;  1P3G D;  3IH9 A;  1P3L C;  3FKE A;  4NXB A;  4QLC C;  1P3P A;  5HFO A;  1XGJ A;  3V3R A;  4JJN B;  3F1P B;  2A2L A;  4EU0 A;  2UV0 E;  2VGL S;  4Y13 A;  2XSS A;  3W4P A;  1DP6 A;  2QJ7 A;  1WYB A;  1XPB A;  4BL3 A;  3W99 D;  3NQJ B;  1HQ3 D;  3C30 A;  1S32 A;  4PHT A;  3AN2 D;  5AY8 C;  4NZ5 A;  1DRM A;  4HH2 A;  2VZW A;  4Q0I A;  2HIO C;  2O99 A;  3EGD C;  5F68 A;  1ERO A;  3A3I A;  5F99 A;  4NXF A;  1UGU A;  3IS2 A;  1VET A;  3VH6 W;  3HL9 A;  4S2M A;  4E3O A;  5KZH A;  3C1B D;  2VGL M;  3WA9 B;  3PBS A;  5HL6 A;  1SDE A;  2XH9 A;  3LIB A;  3W98 C;  1KE0 A;  2B5R A;  3RJU A;  1Z2C B;  1YU2 A;  4UUZ B;  5E5A D;  2JBF A;  4K91 A;  4Y0T A;  3ITA A;  1RP5 A;  1LHY A;  4LD9 C;  3IQA A;  3KUY B;  3EEA A;  1CJF A;  1I2S A;  3A3J A;  4HJ4 A;  5B0Z D;  4B4Z A;  4WYY A;  4X53 A;  2O9B A;  1F66 B;  2XD5 A;  3OZH A;  5L2F A;  2Y2J A;  5F1F A;  2CWE A;  3KXB C;  4II7 A;  3MGP D;  1KX5 C;  4BBV A;  2Y4A A;  3IXG A;  1E6R A;  3DTI A;  3C1C B;  4G91 B;  3MS6 A;  1W1V A;  3L27 A;  5BNV B;  5B1M B;  4H9O A;  3UT9 D;  1TAF A;  1KX3 B;  2PYP A;  1P3M D;  1P0Z A;  4GHA A;  4QNL A;  3LIE A;  3KYZ A;  4WEK A;  3LZ1 D;  2W3E A;  1KX4 A;  3L28 A;  2CV5 D;  1ID3 B;  4OJP A;  3IHA A;  5GT0 A;  4CLC D;  4N9K A;  4J8X A;  4NZ3 A;  3WS5 A;  4X23 D;  3BEB A;  1H0M A;  4CQH A;  1GA9 A;  1EQZ B;  2W0N A;  2ZL1 B;  1WWI A;  1IFQ A;  1TDG A;  2ARO A;  3AV1 C;  4S2N C;  4MN7 A;  5EM0 A;  2J9P A;  3HUN A;  1P3B B;  4BBU A;  1SKO B;  5DTK A;  3T1R A;  1J7M A;  4HNB A;  1TS7 A;  5AV6 A;  4JF4 A;  4AFI A;  5FI2 A;  3FYZ A;  1YLP A;  4P6Z S;  3AGE A;  3F6T A;  1BFM A;  2O9A A;  1S1Z A;  4WNN A;  2Y59 A;  1IEM A;  2NZD D;  1RCJ A;  5HAI A;  4Z2J A;  3KWQ A;  4HOI A;  3IXH A;  3REL A;  3LEQ A;  2JE5 A;  3FV7 A;  2ZM5 A;  4MMN A;  4YS3 A;  3B0C W;  3GQZ A;  3W2Z A;  3Q07 A;  3B6G C;  3REI A;  2P7J A;  3QP1 A;  3GRJ A;  5L09 A;  4Q0J A;  3TU4 C;  5AQA A;  3AZH A;  1P3G B;  1K57 C;  4UA7 A;  1VEU A;  2X02 A;  5CX7 A;  3EPL A;  5AQ9 A;  3HJI A;  2NUP C;  1BLS A;  4NY2 A;  3M2K A;  3HLE A;  4P6Z M;  5DKL A;  2WZX A;  3X1S A;  3MGR B;  4GS9 A;  3PBN A;  4FH4 A;  5CPI D;  2HGV A;  4EW7 A;  3W99 B;  4QY6 A;  4LPZ A;  2L1M A;  1P3P D;  1BSG A;  3CPT A;  3CUE C;  1KGE A;  3H82 B;  5B0Y A;  2PT7 A;  3PAG A;  3LFV A;  3BY9 A;  2Y2N A;  1P3K B;  5L8M A;  1PI4 A;  1IEL A;  4OOM A;  4KUO A;  5AVF A;  1CEG A;  4OOL A;  3QHY A;  3IWQ A;  5CPJ C;  5B2J B;  2HPB A;  3MSH A;  2FJ7 C;  2HDR A;  2BAS A;  1S32 D;  2ZMV A;  5E2H A;  1BH8 B;  2PD8 A;  4PM6 A;  4DJ2 A;  4Z5T A;  2PYR A;  1Q9C A;  3VP4 A;  3C1B B;  5BO0 A;  2YFV A;  2G5H C;  4Z66 A;  4OVD A;  1N4O A;  3ZG5 A;  5TFQ A;  1S6R A;  5U47 A;  1SHV A;  3PXP A;  4GCZ A;  4HQA A;  3BFG A;  4RYE A;  5B33 C;  4Y15 A;  1HZO A;  3X1T A;  2ZMF A;  1U35 B;  4NZ1 A;  3X1V A;  5CED A;  1CEF A;  4Z2L A;  2Y2K A;  1E4D A;  3GR2 A;  3IBR A;  4ZRR A;  1PRQ A;  1M19 B;  4J8U A;  1P3M B;  2WKR A;  3HUO A;  1P9R A;  2XDM A;  2R78 A;  3KSI A;  1P3O B;  2OV5 A;  2BYM B;  4YM6 B;  1P3F A;  3UB6 A;  1L6J A;  1P34 C;  3EQV A;  2IO5 C;  3LR4 A;  5B40 A;  4HY8 A;  5HAR A;  4CLC B;  2OSU A;  1ZLA A;  1JFI B;  3WAA A;  5E2G A;  4KGC D;  5AV9 A;  3N8R A;  3AFA A;  1HVB A;  1KX4 D;  2ZM0 A;  3MNN A;  5HD5 A;  4M4X A;  1YM1 A;  5GT0 D;  3M6B A;  2B95 A;  1GPF A;  4J8X D;  2ZY2 A;  3AYW A;  4Y0O A;  1MC0 A;  1SCW A;  4IBF A;  2MJ6 A;  4LRY C;  3NHQ A;  2BTF P;  3F1O B;  3OLO A;  4KZ9 A;  2ARO D;  5KMW A;  3WTP C;  5AV8 A;  5AVC C;  1FR1 A;  4Z2G A;  4UQI S;  5AV6 D;  1PZO A;  1KS0 A;  2H5S A;  3MZD A;  4B88 A;  1JWP A;  3LGO A;  4PM9 A;  5FQM A;  4DN0 A;  3C5A A;  4Y0U A;  3GV9 A;  4OPY A;  3VH6 T;  2J7V A;  1P9W A;  3KWQ D;  1N1J A;  4E6W A;  4KUD A;  2OLV A;  2ZQ9 A;  3REL D;  4YS3 D;  3NDG A;  5BT1 C;  3CI6 A;  2HDU A;  3BY8 A;  3UPN A;  4ZJ3 A;  2DNS A;  2ZMA A;  2PR5 A;  4FOF A;  5HD3 A;  4IBJ A;  1OME A;  4X55 A;  5B32 C;  4E3N A;  4J8W A;  4UQI M;  1W1P A;  1J3W A;  4ZTK A;  4DQY B;  3L25 A;  1C3B A;  5CEB A;  3UTA C;  5HAP A;  3M7P A;  3SW1 A;  3LIF A;  5DNM A;  4YWZ A;  4IBG A;  3CWF A;  4I3A A;  4NFT A;  3X1S D;  1BH9 A;  3MVD C;  3MGS C;  1NXY A;  3CIT A;  1DY6 A;  3A6N B;  1ERQ A;  4P87 A;  1OGB A;  5KIZ A;  1CF0 A;  3AV2 C;  1S32 B;  1W8Q A;  5GSU A;  5HX9 A;  5B0Y D;  4XT2 B;  4GHI A;  1Q2P A;  4X1L A;  3AZL C;  3AZF C;  4DDS A;  1PW1 A;  3RFB A;  1LL8 A;  2GZA A;  4GLQ A;  3D3O A;  3REH C;  4LG2 A;  5FAT A;  5F99 B;  4EWF A;  2O9C A;  3TOI A;  3WS4 A;  5B24 A;  3IS2 B;  3NC8 A;  3AZM B;  4Z5T D;  3G2Z A;  3SS4 A;  4H9R B;  1F2K A;  4I5S A;  4X6T A;  1KGF A;  4Z66 D;  5GHY A;  4H9S A;  5HSQ A;  4IHQ A;  5DJU A;  1MKM A;  3ZGA B;  1F5M A;  3M6H A;  2M1C A;  3KSG A;  4S2I A;  3UO9 A;  3VSL A;  4HBT A;  5AVB C;  3E98 A;  4R4R A;  1BLC A;  2G2W A;  4FCF A;  5DNN D;  3S7P A;  1O7E A;  1H0I A;  3X1T D;  2P04 A;  3WS0 A;  4LEN A;  1TDL A;  3QP6 A;  3H0M C;  2EX2 A;  2JKT I;  5B31 C;  3X1V D;  3HCY A;  1TZY C;  1P3I A;  4PPR A;  2V1Z A;  5JRG C;  4H9O B;  1TAF B;  5IS1 A;  3AZE A;  2V1A A;  2HV1 A;  4WZ5 A;  3IBJ A;  2DF4 C;  3IX4 A;  5EV0 A;  1BT5 A;  2OAQ 1;  4MBK A;  2L5A A;  4UHU A;  1KX4 B;  1R4V A;  4PKY G;  1P3F D;  2J8Y A;  5GT0 B;  3O62 A;  3AZN A;  2W8S A;  2FFF B;  4J8X B;  1ZLA D;  3AZK A;  3WAA D;  3L7H A;  4G92 C;  2BYK A;  3BFC A;  3AFA D;  2UWX A;  1PDC A;  4WUJ A;  1AIW A;  3MNN D;  2ARO B;  3MJQ A;  5A8B A;  3AZJ D;  4JJN C;  2HDQ A;  5DJT A;  3H0R C;  2W3H A;  4QU3 A;  1TS8 A;  1W8Y A;  5AV6 B;  1ZKJ A;  1T3U A;  3NBL A;  2NQB A;  4R8P D;  2BG1 A;  3H7W A;  3W8K A;  1H0G A;  3VP2 A;  1XJ4 A;  4WNN B;  5AV8 D;  4R70 A;  2QKP A;  4MB3 A;  3KWQ B;  1MWT A;  1KGG A;  1MKI A;  3REL B;  1J9M A;  1YPR A;  2ZY5 A;  2GX5 A;  4NKP A;  3M2J A;  2QJ5 A;  3VV4 A;  2E8I A;  3REI B;  1YU0 A;  4WU8 A;  3T4S A;  3AZH B;  5FAS A;  2C6W B;  5FA7 A;  3WA9 C;  1VEU B;  3LR5 A;  4JBF A;  1S66 L;  1BTL A;  3E4P A;  5C5K A;  3SH7 A;  5GT3 D;  2GJ3 A;  1SDN A;  3TG9 A;  1EWZ A;  3O86 A;  4JGO A;  4NE3 A;  3KSF A;  4DRA A;  3KUY C;  2PAV P;  3O3V A;  3X1S B;  4JPM A;  4GS9 B;  2V2F F;  4QD4 A;  1F66 C;  5CGW A;  4H9N A;  2XGN A;  4CJN A;  3OPP A;  1PWC A;  2HP9 A;  4E04 A;  4GOG A;  3CPT B;  3B6F D;  3C1C C;  5B0Y B;  4OJL A;  4G91 C;  4QLC A;  5DNM D;  4OPQ A;  4HME A;  5B1M C;  2ZY4 A;  1KX3 C;  3VOZ A;  5FDS A;  4CAY A;  2J80 A;  3QP2 A;  3MGP A;  3HLG A;  2PU2 A;  4KQQ A;  1PWD A;  3WRT A;  5GSU D;  1ID3 C;  4ETZ A;  1E8B A;  1H8Z A;  1QO6 A;  4Z5T B;  2H10 A;  3ZG7 B;  1M6K A;  4WEJ A;  2QZ6 A;  3ZFZ A;  4PMA A;  2H0Y A;  4PM8 A;  5BO0 B;  2G2U A;  3CMZ A;  2YFV B;  3A1I A;  4Z66 B;  5EM1 A;  1FSW A;  2Y2M A;  1EQZ C;  2JSS A;  3EOI A;  2FFY A;  3LZ1 A;  5GXQ A;  2XEP A;  1K54 A;  3K3C A;  2CV5 A;  4Z2H A;  5B24 D;  4HEF A;  3IX3 A;  4KZA A;  4PM5 A;  3FZC A;  3IWI A;  2J9O A;  4HP4 A;  1P3B C;  3N8L A;  3MFD A;  2VA0 A;  3A3F A;  3X1T B;  2HDS A;  1V9Y A;  5JYO A;  2VX8 A;  2HJ9 C;  3PTE A;  2K31 A;  4J8U B;  3OC2 A;  3VOL A;  3MGQ D;  4XUJ B;  3UTB A;  1DJB A;  5HDC A;  1OTD A;  1P3I D;  3LO7 A;  3PBO A;  2RVQ C;  1T19 A;  1P3F B;  3DTK A;  1AWI A;  5B40 B;  4NYU A;  3UDF A;  3VMA A;  1ZLA B;  3AZE D;  1P3G C;  4WMC A;  4ZJ2 A;  5AV9 B;  3BFE A;  3CZD A;  5EUA A;  4S2O A;  3MNN B;  4AWL B;  1UWP X;  3REK A;  5CXW A;  3L26 A;  3UME A;  3BLS A;  3R45 A;  3AZN D;  3B42 A;  5M19 A;  3S22 A;  1MXO A;  3AZK D;  3LY4 A;  3AYW B;  3MGR C;  1H8M A;  3MZE A;  4JLF A;  1XKZ A;  2FN2 A;  3W99 C;  3Q82 A;  1YLT A;  2A24 A;  3AZG B;  5AV8 B;  3WS1 A;  4YNR A;  3LUQ A;  4Z2K A;  1P3K C;  3HLF A;  5CPI A;  3AL0 C;  2NQB D;  1PZP A;  5DVA A;  5B2J C;  2WYX A;  3MBZ A;  1JWV A;  5L10 A;  1L2S A;  3BRM A;  3UMD A;  5E2E A;  4KUD B;  5I5L A;  4C3Q A;  3C1B C;  3T4O A;  5C3I B;  2XLN A;  3ZYT A;  5TJJ A;  1KDW A;  2OLU A;  4WU8 D;  1CK7 A;  4YOF A;  2L0W A;  5B32 G;  5G4Y A;  3RXX A;  1M18 D;  5EVI D;  4J8W B;  1K57 A;  5J4E A;  1H3O A;  1U35 C;  5JA4 A;  3DWK A;  5F6A A;  3MFX A;  4OJ6 A;  2Y2O A;  5DNM B;  1K55 A;  4KZ8 A;  1BH9 B;  1M19 C;  1P3M C;  3CJM A;  1FSY A;  1N9L A;  1K0K A;  3V50 A;  1P3L D;  1P3O C;  4QPR A;  1EAK A;  3T4T A;  3NJA A;  4QLC D;  1EI5 A;  4YM6 C;  2WGW A;  4GHI B;  3RXW A;  4ESP A;  1FQG A;  1W63 M;  2ZOI A;  3P98 A;  4L0L A;  4CLC C;  3KS4 A;  1A7W A;  2OAP 1;  4QB8 A;  3R7W A;  1ESI A;  3BYD A;  2R9X A;  3REJ A;  1GA0 A;  2VKS A;  3PR6 A;  2DCF A;  4Y5F A;  5B24 B;  4L9F A;  2FJ7 A;  3BQA A;  5CRF A;  3EEH A;  2OWJ A;  5FQQ A;  3JYI A;  1OJG A;  3VSK A;  3N8S A;  4EO5 B;  4KGC A;  3OOV A;  2HZ5 A;  1ED7 A;  3LEL A;  3IH8 A;  1LL9 A;  4EEU A;  5GXQ D;  4MNR A;  5J7E A;  4Y3I A;  3IP4 C;  3L29 A;  1YKD A;  3BFF A;  4X68 A;  5K5B A;  3SS3 A;  3SZT A;  5B2I B;  5B31 G;  3BW6 A;  1XA7 A;  3V3S A;  1I2W A;  3HLD A;  3W98 D;  3RH8 B;  1P3I B;  4P6B A;  4HJ6 A;  2QWS A;  2ZM2 A;  3PBQ A;  3FWL A;  4IJE A;  4KHA A;  3BQ8 A;  2V0U A;  2PYO B;  1TS6 A;  2V8C A;  3KX0 X;  4LD9 D;  4WBG A;  3MQ0 A;  2W1T A;  3MXS A;  3UTB D;  2GDN A;  4HH3 A;  5CTN A;  2L4R A;  4EV4 A;  4IBD A;  1LI0 A;  4E3L A;  5HWV A;  3O62 B;  2CMN A;  2F8N A;  4LV0 A;  3AZN B;  1XFN A;  3JPU A;  4I38 A;  3LIA A;  3AZK B;  4ARZ B;  2WGI A;  4WMC D;  3HLC A;  2BYK B;  5CEC A;  2LB5 A;  1FCO A;  2I72 A;  3UPP A;  3REK D;  1NZU A;  1YMS A;  1FCM A;  4RX2 A;  3HJK A;  4KEN B;  4G3V A;  3A6N C;  1E6N A;  2NQB B;  1ACF A;  3EPJ A;  5M18 A;  3H7W B;  3T50 A;  1S32 C;  1LSW A;  5HDS A;  4G3W A;  2INW A;  3AZI A;  1DP8 A;  2LY8 A;  5L07 A;  5AVC A;  5AV5 A;  5BS7 A;  4X25 A;  1ZG6 A;  3T1Q B;  1K6S A;  4R3J A;  4S2J A;  1HQ3 B;  1WYC A;  2HP6 A;  4D60 A;  4JF5 A;  5F99 C;  2XRO A;  3AN2 B;  2XR0 A;  3AZM C;  3R4K A;  1PNE A;  2W27 A;  5DFX A;  4P0M A;  1VQQ A;  5GL9 A;  2WGV A;  3T4J A;  3UDX A;  4YIN A;  4NXG A;  2WKP A;  2Y2Q A;  2ZC6 B;  3IXB A;  3F1N A;  4KZ4 A;  5HPI A;  3G32 A;  1NWZ A;  1K38 A;  1V9Z A;  3N4I A;  3B6G D;  2HP5 A;  4LLO B;  1XXM A;  2WKQ A;  3B3X A;  3TU4 D;  1YQS A;  4PM7 A;  2X01 A;  2JCH A;  5FAP A;  4H9N B;  1M1A A;  4ZJ1 A;  3DW0 A;  3EWK A;  5E5A B;  1AOI A;  1OJ5 A;  5CPK A;  4WV4 B;  3UTA A;  3G35 A;  3V9R A;  5DNN A;  5B0Z B;  4DE3 A;  4R4S A;  3VFH A;  1JTG A;  2RIQ A;  1S4R A;  4KQR A;  4CAY B;  4Z1W A;  3MGP B;  3HRE A;  4E3I A;  3MGS A;  3SS5 A;  1KX4 C;  1MWR A;  1PW8 A;  5GT0 C;  4GDB A;  4HMD A;  4Y17 A;  3ZHH A;  4J8X C;  3UT9 B;  3A1K A;  4Z2I A;  3OCN A;  5FDH A;  2EXB A;  4WU9 A;  2B18 A;  1T1C A;  4U0X A;  3REJ D;  3G34 A;  3JVU A;  3LZ1 B;  4E44 A;  5GXQ B;  3REH A;  1U60 A;  2ARO C;  2CV5 B;  1TEM A;  4H9Q B;  4JGQ A;  2FJ7 D;  1K6R A;  4NZ4 A;  4LCM A;  5KSC A;  3X1U A;  4X23 B;  5FAO A;  1W7F A;  4ZBE A;  4E3K A;  4NE6 A;  5AV6 C;  3LEL D;  2HF6 A;  1YU1 A;  2JN7 A;  3FPW A;  3AZJ A;  3EG5 B;  1L0F A;  4E45 A;  3WX7 A;  4UA9 A;  5F82 A;  2Q9N A;  4R8P A;  3REL C;  3UTB B;  5CP6 A;  4QHC A;  2J3T D;  5HAQ A;  4KQO A;  2ZQ7 A;  1GSV A;  3G31 A;  4DF6 A;  2WKH A;  3REI C;  3NOP C;  2NZD B;  5B31 A;  1JNU A;  4Q0H A;  1SZV A;  3AZH C;  3O87 A;  2QYB A;  3V39 A;  3IT9 A;  4M6B A;  1HLU P;  3HUM A;  3B0B A;  3UE3 A;  3MF0 A;  2XFS A;  3ZQ5 A;  2ZC3 B;  3LZ0 A;  1W79 A;  2M7V A;  4EBL A;  3REK B;  5GLA A;  2F8N D;  3R45 B;  3S7O A;  3X1S C;  5EOO A;  1B6W A;  3UN7 A;  3MQO A;  4KZB A;  5FI7 A;  2VGK A;  4H6J A;  5GT3 A;  1XP4 A;  4DE1 A;  1GXD A;  5B0Y C;  3W97 A;  2A24 B;  4IED A;  2LB9 A;  1S1Y A;  4DXB A;  3CAX A;  2Y79 A;  1KDS A;  2WAD A;  2Y2L A;  1FIK A;  3AGD A;  4MN5 A;  2VV6 A;  5CPI B;  1LI9 A;  1STZ A;  2PBD P;  4OOY A;  1P3P B;  3B6F A;  1YUE A;  3HLB A;  3MQQ A;  3KSH A;  3DBA A;  4HBU A;  4Z5T C;  3B0D B;  3AZI D;  4ME4 A;  3WTP D;  5HWW A;  1IYQ A;  5AVC D;  5AV5 D;  3DTE A;  3EQU A;  4Z66 C;  5DF7 A;  5G4Z A;  4N9L A;  3C2W A;  5CHM A;  5G18 A;  1DJA A;  1NRJ A;  4GH9 A;  2J3W A;  2V0W A;  3HBR A;  4DE2 A;  2WAE A;  4EES A;  5A93 A;  3GMW A;  3X1T C;  3WA9 A;  1H3O B;  1QMF A;  5JA4 B;  4R0Q A;  2F8N H;  1NLZ A;  2OWH A;  1VET B;  4L9E A;  1GHI A;  5TR7 A;  1RGY A;  2DMW A;  4J8U C;  1RGZ A;  1NYM A;  3G30 A;  5BNX A;  4WM9 A;  4BD0 A;  4XUJ C;  1M1A D;  1IYS A;  1AOI D;  5B32 D;  5CPK D;  3BWL A;  2PRF A;  4RA7 A;  1P3F C;  2RTS A;  2WGW B;  1IYO A;  3UTA D;  5B40 C;  4XXR A;  2IA2 A;  5G49 A;  3QP4 A;  4HP9 A;  1ZLA C;  3ICY A;  3W96 A;  3MGQ A;  2R9W A;  4R38 A;  3R7W B;  4J8V A;  5AV9 C;  3A3D A;  3MGS D;  3REJ B;  3LR0 A;  3N7W A;  1GSX A;  3MNN C;  4AWL C;  1KE3 A;  4QY5 A;  3WD3 A;  3ZCZ A;  3LJA A;  3AYW C;  2Q9M A;  1XJ6 A;  3DTM A;  4Q8I A;  4KGC B;  3T1S A;  3VP0 A;  4WU9 D;  1Z09 A;  3LEL B;  4B9O A;  5M1A A;  4I3J A;  3UB7 A;  3WD1 A;  3P09 A;  1KU5 A;  3REH D;  1TVF A;  5F83 A;  3O88 A;  2EXA A;  3DWZ A;  1YU4 A;  4ZUX A;  2Z6D A;  3AZG C;  5AV8 C;  2K7S A;  3X1U D;  1SKF A;  3D4F A;  2I9V A;  5FSR A;  1N9B A;  1N9N A;  2ZQA A;  2XK1 A;  3WKJ A;  3P01 A;  1EW0 A;  3E0Y A;  4KHA B;  3TSG A;  1HTA A;  3H0L C;  4KUD C;  5AQ7 A;  3ZNY A;  4KUK A;  2W1T B;  4C6Y A;  5C3I C;  5CP6 D;  1ZC2 A;  4FUW A;  3ZVW A;  3MKE A;  5B31 D;  2B02 A;  1PYY A;  2F8N B;  4EBP A;  2E8J A;  3NOU C;  1Y54 A;  5JRG D;  3A0S A;  5HZH A;  5B1L A;  4XZQ A;  3K2N A;  4J8W C;  1ZTU A;  4YS3 B;  1CQA A;  1P3A A;  1NRF A;  5EOE A;  4G3K A;  3LZ0 D;  1MPL A;  5BPV A;  4OP5 A;  1N9O A;  5DNM C;  3HVF A;  5A92 A;  5CGX A;  3WWX A;  1TD5 A;  1DJC A;  4NXE A;  1M18 A;  5EVI A;  3FG8 A;  3HLW A;  2VGJ A;  1ULY A;  2PHY A;  3TE8 A;  3TW8 A;  2Y2I A;  3W97 D;  3QNC A;  2AVX A;  3AZI B;  1GHP A;  3IF6 A;  3BM6 A;  1G28 A;  5AV5 B;  1QME A;  4WF0 A;  1IKI A;  1YLY A;  1D7E A;  5FL3 A;  2EA9 A;  4OJO A;  3T12 B;  1P3L A;  1KE4 A;  4MLL A;  5B24 C;  4X69 A;  1W1T A;  5KSH A;  3ZG0 A;  5KDM A;  4EO5 C;  3H9W A;  3QP8 A;  4BL2 A;  4F3L A;  4H9S C;  4NG2 A;  5GHX A;  3UNW A;  3LYX A;  1ODV A;  3F1N B;  2KLI A;  4E3M A;  3OCL A;  2IWC A;  4IBX A;  4WZ4 A;  3BFD A;  4O0P A;  3FKW A;  5AY8 A;  1YLZ A;  4KZ6 A;  5B2I C;  3S7Q A;  4GD6 A;  1M1A B;  3WA9 D;  2VQR A;  2HIO A;  3LIC A;  2PU4 A;  4BD1 A;  2G5I C;  4JXW A;  1OTI A;  1AOI B;  5CPK B;  1P3I C;  3E2L A;  1U35 A;  3NY4 A;  2W1R A;  4HMC A;  2DQN C;  3LID A;  4N92 A;  3V9R B;  5DNN B;  2PYO C;  2ZY3 A;  2P9V A;  2A3U A;  4WZ5 C;  4IBE A;  4P85 A;  3VFF A;  1K4E A;  1WWS A;  3X1V B;  3W98 A;  4N1H A;  4R1G A;  1K25 A;  3TJZ C;  1YSP A;  3O62 C;  2PD7 A;  1P3O A;  3AZN C;  4K0X A;  1OT6 A;  2YFW A;  4YM6 A;  3AZK C;  3W96 D;  4KZ5 A;  4LD9 A;  3PYP A;  4WJ3 C;  4J8V D;  4M3K A;  1KX3 D;  1M40 A;  4WU9 B;  3PHY A;  2PR6 A;  3WS2 A;  5EVL A;  3KXB A;  2VV8 A;  1JWZ A;  1KX5 A;  4JGP A;  1UR9 A;  2P08 A;  2XF3 A;  5TBM A;  1BLH A;  3WAA B;  3LJA D;  2A49 A;  3X1U B;  1K4F A;  2NQB C;  5DF8 A;  3AFA B;  5HW3 A;  3FPV A;  1EQZ D;  3AZJ B;  1T1A A;  4ZUX D;  4IVI A;  3L9K A;  1MWS A;  4MEZ A;  3NEC A;  3BEC A;  4PKY A;  5FUG A;  1P3B D;  4GZB A;  4R8P B;  3A3E A;  5CP6 B;  1HQ3 C;  4R6L A;  5E43 A;  3A0R A;  3VP1 A;  3WKJ D;  2CC1 A;  3IWO A;  3AN2 C;  5MC7 A;  4F94 A;  3AV1 A;  4S2N A;  4GHL A;  4CSR A;  5CER A;  3AGF A;  4BMW A;  4I3I A;  3C4P A;  2JKR I;  1ZHH B;  3LZ0 B;  3MZF A;  3VH5 A;  2EX6 A;  2RVQ D;  1N1J B;  4GW9 A;  1Y4O A;  2KDK A;  1OGG A;  3EPH A;  4FH2 A;  4OKP A;  3WD4 A;  5B1L D;  4XZQ D;  4KG6 A;  4H8R A;  1P3A D;  1IKG A;  4G92 B;  2W3F A;  4FTX A;  4H6J B;  5E5A C;  5GT3 B;  4MN6 A;  3JVV A;  3W4Q A;  3W97 B;  1NLY A;  2FH5 A;  1ZG4 A;  3B6G A;  4GNU A;  5B0Z C;  3TU4 A;  2QPN A;  3MGR D;  4MB4 A;  3MGP C;  1YMX A;  1LLB A;  3GVB A;  3SH8 A;  3SOI A;  3I7J A;  3MMH A;  1OTE A;  3A6N A;  3B6F B;  5GLB A;  1GHM A;  3E4Q A;  1G6A A;  4XT2 A;  3UT9 C;  4ETX A;  1BUE A;  3ZVT A;  3N3F A;  5GLD A;  3OPH A;  4RQ9 A;  3L2A A;  1P3K D;  1ES4 A;  3LZ1 C;  4RX3 A;  4OLD A;  5GSU B;  5GXQ C;  4S2L A;  4JXG A;  1K54 C;  4PAU A;  2CV5 C;  5B2J D;  1YLJ A;  3ZG8 B;  1E3U A;  4Y7P A;  3CUE A;  2HUE B;  2EX9 A;  2ZBB A;  4X23 C;  3AZM A;  1E6P A;  4B93 A;  1Q2Q A;  3K3D A;  4Z2M G;  1E88 A;  4H9R A;  3MXR A;  5F1G A;  1FIL A;  5CPJ A;  5J3W A;  1CK3 A;  3DAV A;  4DMZ A;  1VHM A;  5AY8 D;  1BUL A;  2K2N A;  4NK3 A;  3S1Y A;  5BNX B;  4MB5 A;  5DTS A;  4GKU A;  2D49 A;  3UTB C;  1ONG A;  2HIO D;  2V1B A;  5F69 A;  2VEA A;  3WTP E; 
#chains in the Genus database with same CATH homology
 1XX2 A;  1PI5 A;  1U35 D;  2NZD C;  5G49 B;  5BOH A;  3W96 B;  3MGQ B;  4OON A;  4J8V B;  1M19 D;  5B33 A;  4OP8 A;  1XGI A;  2Y55 A;  3REK C;  1MY8 A;  1P3O D;  4YM6 D;  3LJA B;  3AZE B;  3KSY A;  1MWU A;  4E6X A;  3OPL A;  3HON A;  3KXB D;  2Y2P A;  1KX5 D;  3ZDJ A;  4ZUX B;  2Y2H A;  4LV1 A;  3UE0 A;  1P34 A;  3VH6 A;  4R3B A;  5FAQ A;  5CPI C;  4IJF A;  3UDI A;  4Z9Q A;  1P3P C;  3WKJ B;  1H8Y A;  4OJ5 A;  3B0D C;  5CTM A;  3OPR A;  4HGA B;  2PBY A;  2P74 A;  3FDD A;  2BLS A;  3C7U A;  3S4X A;  1PZR A;  3AV1 D;  2QMI A;  4KZ3 A;  3WTP A;  1ES5 A;  3PAE A;  1XA1 A;  5AQB A;  5B1L B;  4XZQ B;  3IXD A;  2ZC7 A;  3Q7V A;  1P3A B;  5I94 A;  4WU8 B;  1K55 C;  4OH0 A;  4XUZ A;  2IWB A;  1M18 B;  4CPK A;  5EVI B;  3N6I A;  4IVK A;  3NQU A;  1VM1 A;  2XQZ A;  5FQJ A;  4OPZ A;  1JTD A;  1FR6 A;  4GN2 A;  1K56 A;  3VH5 T;  3IF6 B;  4ZBJ B;  4ZDX A;  2ZM8 A;  4UAA A;  4YFM A;  3REJ C;  1P3L B;  1ES2 A;  5B32 A;  3A6N D;  4S2K A;  4QLC B;  1BLP A;  5KDM B;  2H0T A;  4KGC C;  3MVD A;  3LEL C;  4BQM A;  1MBL A;  1E3U D;  3AV2 A;  3NCK A;  5F99 D;  5AY8 B;  3AZM D;  3AZL A;  3AZF A;  1CI8 A;  1FOF A;  3NIA A;  2HIO B;  3ZNT A;  5CPJ D;  4JKT A;  2F8N K;  2WK0 A;  2P9V B;  4BJP A;  1ONH A;  4MBH A;  4OQI A;  3W98 B;  4XUJ A;  2ZJ9 A;  4H9P A;  4DRB A;  3KWQ C;  5CHL B;  2YFW B;  4GDN A;  5AVB A;  4LD9 B;  4X56 A;  3VOY A;  5J8X A;  1PWG A;  5A90 A;  5B33 D;  4C75 A;  4YS3 C;  1NZO A;  4LV3 A;  4UPK A;  3KXB B;  1KX5 B;  1ES3 A;  1TZY A;  1L0D A;  5JYP A;  3ISG A;  2ZQC A;  1H5X A;  2IOU A;  5JRG A;  2ZC4 B;  2JC7 A;  2F2A C;  4UA6 A;  2EFX A;  2ZLY A;  4IBI A;  1LL5 A;  1KVM A;  3AZI C;  5CHU A;  1P34 D;  3AZG A;  5AV5 C;  5BS7 C;  5FUG B;  4S2P A;  2V20 A;  5HL1 A;  3Q7Z A;  4DDY A;  3E2K A;  4DE0 A;  4BEN A;  3AV1 B;  4JJN A;  1NJ4 A;  3LCE A;  5DF9 A;  4ID4 A;  2WKE A;  3VP3 A;  3SH9 A;  4CSR B;  1NY0 A;  3NQJ A;  1YT4 A;  3IHB A;  2ZD8 A;  5FI6 A;  3P5J B;  3REI D;  2RL3 A;  4DXC A;  4LV2 A;  3AZH D;  1M1A C;  4WEL A;  1CI9 A;  1AOI C;  3GSG A;  4ZAM A;  5CPK C;  1L0G A;  1AXB A;  4B4X A;  3B6G B;  4EUZ A;  5DNN C;  2XD1 A;  1W5D A;  3TU4 B;  4IBC A;  4NE5 A;  4K0W A;  3X1V C;  5BT1 D;  1K56 D;  4UUZ A;  3KUY A;  5IHV A;  4WU9 C;  1F66 A;  3IF5 A;  2DRW A;  5FQ9 A;  3C1C A;  1IYP A;  5CHJ A;  3WAA C;  3UPO A;  3X1U C;  5BNV A;  5B1M A;  1ALQ A;  1KX3 A;  3MVD D;  3EPK A;  3C7V A;  3AFA C;  1G68 A;  5CPJ B;  3HSH A;  1GCE A;  3AZJ C;  3AV2 D;  2FJ7 B;  1B67 A;  3ITB A;  1ID3 A;  3AZL D;  3AZF D;  4WZS B;  3ZG9 B;  5EE8 A;  4R8P C;  5FQI A;  5CP6 C;  2Z2L B;  5B2I A;  4KG2 A;  1ERM A;  3FKV A;  1EQZ A;  3B0C T;  4U0T A;  4XUX A;  2WKI A;  2EX8 A;  4JXV A;  1P3B A;  2PYO A;  4J8U D;  5B33 B;  5E2F A;  4XUJ D;  4GD8 A;  3LZ0 C;  3KS8 A;  3GTC A;  1HD8 A;  5AVB D;  1YLW A;  5B40 D;  2WUQ A;  5GLC A;  5AV9 D;  5GT3 C;  3KFU G;  3LY3 A;  4EBN A;  3W97 C;  1TZY D;  1BZA A;  4R23 A;  4IBK A;  1P34 B;  3UY6 A;  2IO5 B;  1L0E A;  4OPR A;  4OQH A;  3AYW D;  1P3G A;  4JF6 A;  2WZZ A;  3B6F C;  3BLM A;  1I5Q A;  3AZG D;  2Y91 A;  3MGR A;  2Z2M B;  3CG5 A;  3Q81 A;  3W4O A;  3Q1F A;  5GSU C;  3W99 A;  3NDE A;  1HQ3 A;  1HTZ A;  4Z2M H;  4KG5 A;  3WTP B;  4JJN D;  2HUE C;  3AN2 A;  4JXS A;  5AVC B;  1FCN A;  1P3K A;  2RCX A;  4KUD D;  2Y2G A;  3Q7V B;  2WAF A;  5B2J A;  1BH8 A;  4IBB A;  1Z6F A;  5TGF A;  4DRT A;  5FQK A;  1W2E A;  3NQU B;  3C1B A;  3UE1 A;  4OQG A;  3PBT A;  4J8W D;  5D3O A;  1WE4 A;  5E5A A;  5EPH A;  3W96 C;  3MGQ C;  2XFT A;  4J8V C;  5B0Z A;  4OQ0 A;  4DKI A;  4LCL A;  2X71 A;  5B32 B;  2ZQ8 A;  4OUI A;  3MKF A;  3UTA B;  1PIO A;  3LJA C;  3AZE C;  4D2O A;  3KUY D;  1YU3 A;  4NET A;  5CGS A;  1M19 A;  4O7D A;  3UT9 A;  3MVD B;  3MGS B;  2ZC5 B;  1P3M A;  1F66 D;  2J8P A;  4BLM A;  1E25 A;  4OLG A;  4U3T A;  3AV2 B;  4ZUX C;  3VH5 W;  3C1C D;  2BYM A;  4H9Q A;  3AZL B;  3AZF B;  5GHZ A;  3V5M A;  5B1M D;  4MBF A;  1JFI A;  4X23 A;  3REH B;  3WKJ C;  1NYY A;  1S0W A;  1ID3 D;  4HGA C;  3WRZ A;  4A5R A;  4IBR A;  5B2I D;  2F8N G;  3NI9 A;  3G4P A;  4FD8 A;  3LEZ A;  4H9P B;  1KVL A;  4KZ7 A;  2C5W B;  5EEC A;  4N1X A;  4QJG A;  4RVA A;  2NZD A;  5AVB B;  3C4O A;  2PYO D;  5B1L C;  4XZQ C;  1P3A C;  2ZQD A;  4HES A;  3PBR A;  4GB7 A;  5B31 B;  2IWD A;  4WU8 C;  1JVJ A;  1TZY B;  1F1E A;  5DTT A;  3O62 D;  5JRG B;  1M18 C;  3G2Y A;  5EVI C;  4NYY A;  1ESU A;  3QNB A;  4FSF A;  5A91 A;  4E3J A;  4EQI A;  3IF6 C;  4ZBJ C;  1O07 A;  2EFU A;  1P3G D;  3IH9 A;  1P3L C;  3FKE A;  4QLC C;  1P3P A;  5HFO A;  1XGJ A;  3V3R A;  4JJN B;  3W4P A;  1WYB A;  1XPB A;  4BL3 A;  3W99 D;  3NQJ B;  1HQ3 D;  1S32 A;  3AN2 D;  5AY8 C;  4NZ5 A;  2HIO C;  1ERO A;  3A3I A;  5F99 A;  3VH6 W;  3HL9 A;  4S2M A;  4E3O A;  5KZH A;  3C1B D;  3PBS A;  3WA9 B;  1SDE A;  2XH9 A;  3W98 C;  1KE0 A;  2B5R A;  3RJU A;  1Z2C B;  1YU2 A;  4UUZ B;  5E5A D;  2JBF A;  4K91 A;  4Y0T A;  3ITA A;  1RP5 A;  1LHY A;  4LD9 C;  3IQA A;  3KUY B;  1I2S A;  3A3J A;  5B0Z D;  4B4Z A;  4WYY A;  4X53 A;  1F66 B;  2XD5 A;  3OZH A;  5L2F A;  2Y2J A;  5F1F A;  2CWE A;  3KXB C;  3MGP D;  1KX5 C;  2Y4A A;  3IXG A;  3C1C B;  4G91 B;  3L27 A;  5BNV B;  5B1M B;  4H9O A;  3UT9 D;  1TAF A;  1KX3 B;  1P3M D;  4GHA A;  4QNL A;  3LZ1 D;  1KX4 A;  3L28 A;  2CV5 D;  1ID3 B;  4OJP A;  3IHA A;  5GT0 A;  4N9K A;  4J8X A;  4NZ3 A;  3WS5 A;  4X23 D;  3BEB A;  1GA9 A;  1EQZ B;  1WWI A;  1TDG A;  2ARO A;  3AV1 C;  4S2N C;  2J9P A;  3HUN A;  1P3B B;  5DTK A;  5AV6 A;  4JF4 A;  5FI2 A;  3FYZ A;  1YLP A;  3AGE A;  3F6T A;  1BFM A;  4WNN A;  2Y59 A;  1IEM A;  2NZD D;  1RCJ A;  5HAI A;  3KWQ A;  3IXH A;  3REL A;  2JE5 A;  3FV7 A;  2ZM5 A;  4YS3 A;  3B0C W;  3GQZ A;  3Q07 A;  3B6G C;  3REI A;  3GRJ A;  3TU4 C;  5AQA A;  3AZH A;  1P3G B;  1K57 C;  4UA7 A;  2X02 A;  3EPL A;  5AQ9 A;  1BLS A;  4NY2 A;  3M2K A;  3HLE A;  2WZX A;  3X1S A;  3MGR B;  3PBN A;  4FH4 A;  5CPI D;  3W99 B;  4QY6 A;  1P3P D;  1BSG A;  1KGE A;  5B0Y A;  3PAG A;  2Y2N A;  1P3K B;  1PI4 A;  1IEL A;  4OOM A;  1CEG A;  4OOL A;  3QHY A;  3IWQ A;  5CPJ C;  5B2J B;  2HPB A;  2FJ7 C;  2HDR A;  1S32 D;  5E2H A;  1BH8 B;  4PM6 A;  4Z5T A;  1Q9C A;  3VP4 A;  3C1B B;  5BO0 A;  2YFV A;  2G5H C;  4Z66 A;  4OVD A;  1N4O A;  3ZG5 A;  5TFQ A;  1S6R A;  5U47 A;  1SHV A;  3BFG A;  4RYE A;  5B33 C;  1HZO A;  3X1T A;  1U35 B;  4NZ1 A;  3X1V A;  5CED A;  1CEF A;  2Y2K A;  1E4D A;  3GR2 A;  1M19 B;  4J8U A;  1P3M B;  3HUO A;  2XDM A;  1P3O B;  2OV5 A;  2BYM B;  4YM6 B;  1P3F A;  1P34 C;  3EQV A;  2IO5 C;  5HAR A;  5B40 A;  2OSU A;  1ZLA A;  1JFI B;  3WAA A;  5E2G A;  4KGC D;  5AV9 A;  3N8R A;  3AFA A;  1HVB A;  1KX4 D;  2ZM0 A;  3MNN A;  1YM1 A;  5GT0 D;  3M6B A;  4J8X D;  2ZY2 A;  3AYW A;  4Y0O A;  1SCW A;  4IBF A;  4KZ9 A;  2ARO D;  5KMW A;  3WTP C;  5AV8 A;  5AVC C;  1FR1 A;  5AV6 D;  1PZO A;  2H5S A;  3MZD A;  4B88 A;  1JWP A;  4PM9 A;  5FQM A;  3C5A A;  4Y0U A;  3GV9 A;  4OPY A;  3VH6 T;  2J7V A;  3KWQ D;  1N1J A;  4E6W A;  4KUD A;  2OLV A;  2ZQ9 A;  3REL D;  4YS3 D;  3NDG A;  5BT1 C;  2HDU A;  3UPN A;  4ZJ3 A;  2DNS A;  2ZMA A;  4IBJ A;  1OME A;  4X55 A;  5B32 C;  4E3N A;  4J8W A;  4ZTK A;  4DQY B;  3L25 A;  1C3B A;  5CEB A;  3UTA C;  5HAP A;  5DNM A;  4IBG A;  4NFT A;  3X1S D;  1BH9 A;  3MVD C;  3MGS C;  1NXY A;  1DY6 A;  3A6N B;  1ERQ A;  4P87 A;  3AV2 C;  1S32 B;  1W8Q A;  5GSU A;  5HX9 A;  5B0Y D;  1Q2P A;  4DDS A;  3AZL C;  3AZF C;  1PW1 A;  3REH C;  4LG2 A;  5FAT A;  5F99 B;  4EWF A;  3TOI A;  3WS4 A;  5B24 A;  3NC8 A;  3AZM B;  4Z5T D;  3G2Z A;  3SS4 A;  4H9R B;  4X6T A;  1KGF A;  4Z66 D;  5GHY A;  4H9S A;  3ZGA B;  3M6H A;  4S2I A;  3UO9 A;  3VSL A;  4HBT A;  5AVB C;  4R4R A;  1BLC A;  2G2W A;  4FCF A;  5DNN D;  1O7E A;  3X1T D;  3WS0 A;  4LEN A;  1TDL A;  3H0M C;  2EX2 A;  5B31 C;  3X1V D;  1TZY C;  1P3I A;  4PPR A;  2V1Z A;  5JRG C;  4H9O B;  1TAF B;  3AZE A;  4WZ5 A;  2DF4 C;  1BT5 A;  4MBK A;  2L5A A;  4UHU A;  1KX4 B;  1R4V A;  1P3F D;  2J8Y A;  5GT0 B;  3O62 A;  3AZN A;  2W8S A;  2FFF B;  4J8X B;  1ZLA D;  3AZK A;  3WAA D;  4G92 C;  2BYK A;  3BFC A;  3AFA D;  2UWX A;  3MNN D;  2ARO B;  3AZJ D;  4JJN C;  2HDQ A;  3H0R C;  4QU3 A;  1W8Y A;  5AV6 B;  1ZKJ A;  1T3U A;  3NBL A;  2NQB A;  4R8P D;  2BG1 A;  3W8K A;  3VP2 A;  4WNN B;  5AV8 D;  3KWQ B;  1MWT A;  1KGG A;  1MKI A;  3REL B;  1J9M A;  2ZY5 A;  3M2J A;  2E8I A;  3REI B;  1YU0 A;  4WU8 A;  3AZH B;  5FAS A;  2C6W B;  5FA7 A;  3WA9 C;  4JBF A;  1BTL A;  3SH7 A;  5GT3 D;  1SDN A;  3TG9 A;  1EWZ A;  3O86 A;  4NE3 A;  4DRA A;  3KUY C;  3O3V A;  3X1S B;  4JPM A;  2V2F F;  4QD4 A;  1F66 C;  5CGW A;  4H9N A;  2XGN A;  4CJN A;  3OPP A;  1PWC A;  2HP9 A;  4GOG A;  3B6F D;  3C1C C;  5B0Y B;  4OJL A;  4G91 C;  4QLC A;  5DNM D;  4OPQ A;  5B1M C;  2ZY4 A;  1KX3 C;  3VOZ A;  4CAY A;  3MGP A;  3HLG A;  2PU2 A;  4KQQ A;  1PWD A;  3WRT A;  5GSU D;  1ID3 C;  1H8Z A;  4Z5T B;  2H10 A;  3ZG7 B;  1M6K A;  4WEJ A;  2QZ6 A;  3ZFZ A;  4PMA A;  2H0Y A;  4PM8 A;  5BO0 B;  2G2U A;  3CMZ A;  2YFV B;  3A1I A;  4Z66 B;  1FSW A;  2Y2M A;  1EQZ C;  2JSS A;  2FFY A;  3LZ1 A;  5GXQ A;  2XEP A;  1K54 A;  2CV5 A;  5B24 D;  4HEF A;  4KZA A;  4PM5 A;  3FZC A;  3IWI A;  2J9O A;  1P3B C;  3N8L A;  3MFD A;  3A3F A;  3X1T B;  2HDS A;  5JYO A;  3PTE A;  4J8U B;  3OC2 A;  3MGQ D;  4XUJ B;  3UTB A;  1DJB A;  1P3I D;  3LO7 A;  3PBO A;  2RVQ C;  1P3F B;  5B40 B;  4NYU A;  3UDF A;  3VMA A;  1ZLA B;  3AZE D;  1P3G C;  4WMC A;  4ZJ2 A;  5AV9 B;  3BFE A;  3CZD A;  5EUA A;  4S2O A;  3MNN B;  4AWL B;  3REK A;  5CXW A;  3L26 A;  3BLS A;  3R45 A;  3AZN D;  5M19 A;  3S22 A;  1MXO A;  3AZK D;  3LY4 A;  3AYW B;  3MGR C;  3MZE A;  4JLF A;  1XKZ A;  3W99 C;  3Q82 A;  1YLT A;  3AZG B;  5AV8 B;  3WS1 A;  1P3K C;  3HLF A;  5CPI A;  3AL0 C;  2NQB D;  1PZP A;  5DVA A;  5B2J C;  2WYX A;  3MBZ A;  1JWV A;  1L2S A;  3BRM A;  5E2E A;  4KUD B;  4C3Q A;  3C1B C;  5C3I B;  2XLN A;  1KDW A;  2OLU A;  4WU8 D;  5B32 G;  3RXX A;  1M18 D;  5EVI D;  4J8W B;  1K57 A;  1H3O A;  1U35 C;  5JA4 A;  3DWK A;  4OJ6 A;  2Y2O A;  5DNM B;  1K55 A;  4KZ8 A;  1BH9 B;  1M19 C;  1P3M C;  3CJM A;  1FSY A;  3V50 A;  1P3L D;  1P3O C;  4QLC D;  1EI5 A;  4YM6 C;  2WGW A;  3RXW A;  1FQG A;  3P98 A;  4L0L A;  3KS4 A;  1A7W A;  4QB8 A;  1ESI A;  3BYD A;  2R9X A;  3REJ A;  1GA0 A;  2DCF A;  5B24 B;  2FJ7 A;  5CRF A;  5FQQ A;  3JYI A;  3VSK A;  3N8S A;  4EO5 B;  4KGC A;  3LEL A;  3IH8 A;  1LL9 A;  5GXQ D;  4MNR A;  3IP4 C;  3L29 A;  3BFF A;  4X68 A;  3SS3 A;  5B2I B;  5B31 G;  1XA7 A;  3V3S A;  1I2W A;  3HLD A;  3W98 D;  1P3I B;  4P6B A;  2ZM2 A;  3PBQ A;  3FWL A;  4IJE A;  4KHA A;  2PYO B;  4LD9 D;  4WBG A;  3MXS A;  3UTB D;  2GDN A;  5CTN A;  4EV4 A;  4IBD A;  1LI0 A;  4E3L A;  3O62 B;  2F8N A;  4LV0 A;  3AZN B;  3AZK B;  2WGI A;  4WMC D;  3HLC A;  2BYK B;  5CEC A;  1FCO A;  2I72 A;  3UPP A;  3REK D;  1NZU A;  1YMS A;  1FCM A;  4RX2 A;  4KEN B;  3A6N C;  2NQB B;  3EPJ A;  5M18 A;  1S32 C;  3AZI A;  2LY8 A;  5AVC A;  5AV5 A;  5BS7 A;  1ZG6 A;  1K6S A;  4R3J A;  4S2J A;  1HQ3 B;  1WYC A;  2HP6 A;  4JF5 A;  5F99 C;  3AN2 B;  2XR0 A;  3AZM C;  4P0M A;  1VQQ A;  5GL9 A;  2WGV A;  3UDX A;  4YIN A;  2Y2Q A;  2ZC6 B;  3IXB A;  4KZ4 A;  3G32 A;  1K38 A;  3N4I A;  3B6G D;  2HP5 A;  1XXM A;  3B3X A;  4PM7 A;  3TU4 D;  1YQS A;  2X01 A;  2JCH A;  5FAP A;  4H9N B;  1M1A A;  4ZJ1 A;  3DW0 A;  5E5A B;  1AOI A;  5CPK A;  4WV4 B;  3UTA A;  3G35 A;  3V9R A;  5DNN A;  5B0Z B;  4DE3 A;  4R4S A;  3VFH A;  1JTG A;  2RIQ A;  4KQR A;  4CAY B;  3MGP B;  3HRE A;  4E3I A;  3MGS A;  3SS5 A;  1KX4 C;  1MWR A;  1PW8 A;  5GT0 C;  4GDB A;  3ZHH A;  4J8X C;  3UT9 B;  3A1K A;  3OCN A;  5FDH A;  2EXB A;  4WU9 A;  4U0X A;  3REJ D;  3G34 A;  3LZ1 B;  4E44 A;  5GXQ B;  3REH A;  1U60 A;  2ARO C;  2CV5 B;  1TEM A;  4H9Q B;  2FJ7 D;  1K6R A;  4NZ4 A;  4LCM A;  5KSC A;  3X1U A;  4X23 B;  5FAO A;  1W7F A;  4ZBE A;  4E3K A;  4NE6 A;  5AV6 C;  3LEL D;  1YU1 A;  3AZJ A;  3EG5 B;  1L0F A;  4E45 A;  3WX7 A;  4UA9 A;  5F82 A;  2Q9N A;  4R8P A;  3REL C;  3UTB B;  5CP6 A;  4QHC A;  5HAQ A;  4KQO A;  2ZQ7 A;  3G31 A;  4DF6 A;  2WKH A;  3REI C;  2NZD B;  5B31 A;  3AZH C;  3O87 A;  3V39 A;  3IT9 A;  4M6B A;  3HUM A;  3B0B A;  3UE3 A;  2XFS A;  2ZC3 B;  3LZ0 A;  1W79 A;  4EBL A;  3REK B;  5GLA A;  2F8N D;  3R45 B;  3X1S C;  5EOO A;  1B6W A;  3UN7 A;  4KZB A;  5FI7 A;  2VGK A;  5GT3 A;  1XP4 A;  4DE1 A;  5B0Y C;  3W97 A;  4IED A;  4DXB A;  1KDS A;  2WAD A;  2Y2L A;  3AGD A;  5CPI B;  1LI9 A;  4OOY A;  1P3P B;  3B6F A;  1YUE A;  3HLB A;  4HBU A;  4Z5T C;  3B0D B;  3AZI D;  3WTP D;  1IYQ A;  5AVC D;  5AV5 D;  3EQU A;  4Z66 C;  5DF7 A;  4N9L A;  5CHM A;  5G18 A;  1DJA A;  4GH9 A;  3HBR A;  4DE2 A;  2WAE A;  5A93 A;  3GMW A;  3X1T C;  3WA9 A;  1H3O B;  1QMF A;  5JA4 B;  4R0Q A;  2F8N H;  1GHI A;  5TR7 A;  1RGY A;  4J8U C;  1RGZ A;  1NYM A;  3G30 A;  5BNX A;  4WM9 A;  4BD0 A;  4XUJ C;  1M1A D;  1IYS A;  1AOI D;  5B32 D;  5CPK D;  4RA7 A;  1P3F C;  2WGW B;  1IYO A;  3UTA D;  5B40 C;  4XXR A;  5G49 A;  1ZLA C;  3W96 A;  3MGQ A;  2R9W A;  4J8V A;  5AV9 C;  3A3D A;  3MGS D;  3REJ B;  3N7W A;  3MNN C;  4AWL C;  1KE3 A;  4QY5 A;  3ZCZ A;  3LJA A;  3AYW C;  2Q9M A;  3DTM A;  4Q8I A;  4KGC B;  3VP0 A;  4WU9 D;  3LEL B;  5M1A A;  3P09 A;  1KU5 A;  3REH D;  1TVF A;  5F83 A;  3O88 A;  2EXA A;  3DWZ A;  1YU4 A;  4ZUX A;  3AZG C;  5AV8 C;  3X1U D;  1SKF A;  3D4F A;  5FSR A;  1N9B A;  2ZQA A;  2XK1 A;  3WKJ A;  4KHA B;  3TSG A;  1HTA A;  3H0L C;  4KUD C;  5AQ7 A;  3ZNY A;  4C6Y A;  5C3I C;  5CP6 D;  1ZC2 A;  3ZVW A;  3MKE A;  5B31 D;  1PYY A;  2F8N B;  4EBP A;  1Y54 A;  5JRG D;  5B1L A;  4XZQ A;  4J8W C;  4YS3 B;  1P3A A;  1NRF A;  5EOE A;  3LZ0 D;  1MPL A;  5BPV A;  4OP5 A;  5DNM C;  3HVF A;  5A92 A;  5CGX A;  3WWX A;  1DJC A;  1M18 A;  5EVI A;  3HLW A;  2VGJ A;  1ULY A;  2Y2I A;  3W97 D;  3QNC A;  3AZI B;  1GHP A;  3IF6 A;  3BM6 A;  5AV5 B;  1QME A;  1IKI A;  1YLY A;  4OJO A;  1P3L A;  1KE4 A;  4MLL A;  5B24 C;  4X69 A;  5KSH A;  3ZG0 A;  5KDM A;  4EO5 C;  4BL2 A;  4H9S C;  5GHX A;  3UNW A;  4E3M A;  3OCL A;  2IWC A;  4IBX A;  4WZ4 A;  3BFD A;  3FKW A;  5AY8 A;  1YLZ A;  4KZ6 A;  5B2I C;  4GD6 A;  1M1A B;  3WA9 D;  2VQR A;  2HIO A;  2PU4 A;  4BD1 A;  2G5I C;  4JXW A;  1AOI B;  5CPK B;  1P3I C;  3E2L A;  1U35 A;  3NY4 A;  2DQN C;  4N92 A;  3V9R B;  5DNN B;  2PYO C;  2ZY3 A;  2P9V A;  2A3U A;  4WZ5 C;  4IBE A;  4P85 A;  3VFF A;  1K4E A;  1WWS A;  3X1V B;  3W98 A;  4N1H A;  4R1G A;  1K25 A;  3O62 C;  1P3O A;  3AZN C;  4K0X A;  2YFW A;  4YM6 A;  3AZK C;  3W96 D;  4KZ5 A;  4LD9 A;  4WJ3 C;  4J8V D;  4M3K A;  1KX3 D;  1M40 A;  4WU9 B;  3WS2 A;  5EVL A;  3KXB A;  1JWZ A;  1KX5 A;  2XF3 A;  1BLH A;  3WAA B;  3LJA D;  2A49 A;  3X1U B;  1K4F A;  2NQB C;  5DF8 A;  3AFA B;  5HW3 A;  1EQZ D;  3AZJ B;  4ZUX D;  4IVI A;  1MWS A;  4MEZ A;  3BEC A;  5FUG A;  1P3B D;  4GZB A;  4R8P B;  3A3E A;  5CP6 B;  1HQ3 C;  5E43 A;  3VP1 A;  3WKJ D;  2CC1 A;  3IWO A;  3AN2 C;  4F94 A;  3AV1 A;  4S2N A;  4GHL A;  4CSR A;  5CER A;  3AGF A;  3C4P A;  3LZ0 B;  3MZF A;  3VH5 A;  2EX6 A;  2RVQ D;  1N1J B;  4OKP A;  3EPH A;  4FH2 A;  5B1L D;  4XZQ D;  4KG6 A;  4H8R A;  1P3A D;  1IKG A;  4G92 B;  5E5A C;  5GT3 B;  3W4Q A;  3W97 B;  1ZG4 A;  3B6G A;  4GNU A;  5B0Z C;  3TU4 A;  2QPN A;  3MGR D;  3MGP C;  1YMX A;  1LLB A;  3GVB A;  3SH8 A;  3SOI A;  3I7J A;  3A6N A;  3B6F B;  5GLB A;  1GHM A;  1G6A A;  3UT9 C;  1BUE A;  3ZVT A;  3N3F A;  5GLD A;  3OPH A;  3L2A A;  1P3K D;  1ES4 A;  3LZ1 C;  4RX3 A;  4OLD A;  5GSU B;  5GXQ C;  4S2L A;  4JXG A;  1K54 C;  2CV5 C;  5B2J D;  1YLJ A;  3ZG8 B;  1E3U A;  4Y7P A;  2HUE B;  2EX9 A;  4X23 C;  3AZM A;  1Q2Q A;  4Z2M G;  4H9R A;  3MXR A;  5F1G A;  5CPJ A;  1CK3 A;  5AY8 D;  1BUL A;  4NK3 A;  3S1Y A;  5BNX B;  5DTS A;  4GKU A;  3UTB C;  1ONG A;  2HIO D;  4WEK A;  3WTP E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...