2JE5A

Structural and mechanistic basis of penicillin binding protein inhibition by lactivicins
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
683
structure length
461
Chain Sequence
SEITYSDGTDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTNQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PENICILLIN-BINDING PROTEIN 1B
publication title Structural and Mechanistic Basis of Penicillin-Binding Protein Inhibition by Lactivicins
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Drug-binding protein
total genus 147
structure length 461
sequence length 683
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
A PF00912 Transgly Transglycosylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2je5A01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2je5A03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2je5A02
4S2JA 4H8RA 3M2KA 5CRFA 5CEDA 1WYBA 4HESA 1MXOA 2R9XA 2XD5A 3ITAA 1SHVA 1SKFA 3N8LA 4K91A 4Y0TA 2HDRA 4OP5A 2PU4A 1BZAA 1K56A 3BYDA 3G2ZA 3Q07A 4Z9QA 2FFFB 1LI9A 3LEZA 4DDYA 2WYXA 4WBGA 5HAQA 2WGWB 1XX2A 2Y55A 2OLVA 3BFDA 4LV0A 4DRTA 3M6HA 4MEZA 5BOHA 1YLWA 3M2JA 4U3TA 2WAEA 3FZCA 1FR6A 4OQ0A 5GHZA 3BFEA 1PZOA 3PTEA 4OPYA 5E2GA 1NJ4A 3VFFA 2XGNA 1FCMA 3IHBA 3WRZA 3HUMA 2Z2MB 5JYPA 5A91A 2BG1A 2Y91A 4Y7PA 2Y2KA 1SCWA 5EVLA 3MKFA 3HREA 1H8YA 1WE4A 1L0GA 2QMIA 2P9VB 3GRJA 4IEDA 2WK0A 4KZ7A 4LV1A 4MLLA 5FQMA 1ZC2A 2DCFA 4DXCA 4OPRA 4DKIA 4E3JA 3IXGA 1ALQA 1PZPA 4DE0A 3Q7ZA 4KZBA 4CJNA 4E6WA 1PWGA 3C7UA 1H5XA 1LLBA 3SS4A 4OPZA 4WZ5A 4EQIA 5DF9A 3MXRA 4N1XA 5E2EA 2XLNA 4XUZA 2J9PA 3ZGAB 3IQAA 4B88A 3DWKA 5HAPA 2HDSA 1Q2PA 4B4XA 1W8QA 2Q9NA 3GQZA 3Q81A 5EVID 2Y2JA 3GSGA 1HZOA 3UPNA 1K6SA 2WAFA 4ZJ1A 1BLSA 2ZC4B 4RX3A 4JXWA 2R9WA 4KZ5A 4U0TA 5FQKA 3Q82A 4P6BA 4E3KA 4FCFA 1IKGA 2H0TA 1VM1A 2WZXA 4HBTA 4KQRA 3PBOA 3HL9A 1YLZA 2XD1A 5J8XA 4FSFA 3BLMA 4PM6A 3IWIA 2XR0A 2HP5A 3IH8A 4KZ6A 4X55A 4C3QA 5CECA 1BLPA 5FA7A 3OZHA 1YLTA 2H10A 4GD8A 5G18A 3SH8A 4QJGA 3ZG5A 4QY6A 3G31A 5FQIA 1CI9A 3CMZA 3UY6A 1IEMA 2Z2LB 4WM9A 4UAAA 2XDMA 3WS5A 5AQBA 3IH9A 3OC2A 1BLHA 4ZTKA 3ZHHA 4JPMA 5FSRA 1QMEA 1FCOA 1E3UA 1GCEA 5FI7A 1C3BA 3BFFA 3VP0A 3WS0A 1EI5A 4GN2A 4S2IA 1IYOA 3PBSA 2C5WB 5TGFA 2X01A 4PMAA 3HLWA 4N1HA 1TEMA 1W7FA 1LL5A 3GR2A 3IXDA 3S22A 3SS5A 1XGIA 3C5AA 3NCKA 3OCLA 3G32A 4EBNA 4Y0UA 1GHPA 1BULA 3CZDA 1K4FA 4ZJ2A 2V2FF 3V3SA 4F94A 5M19A 4S2MA 3VOZA 2HP9A 3WS1A 3A3IA 3I7JA 1XXMA 3VMAA 2ZQ8A 1MWUA 3HLBA 2H0YA 1JWPA 3OPRA 3Q1FA 2WZZA 1SDNA 3HLGA 1JWVA 4Q8IA 4P87A 4IBXA 2P74A 3W4QA 4BD1A 2EXAA 3C4OA 3ZVWA 1ZKJA 1FQGA 1K57C 4QU3A 3UE0A 2DRWA 3GMWA 4GDBA 3VSLA 5GLAA 1MKIA 4OKPA 5FQJA 3NDEA 1O07A 1TDLA 3HUOA 4OPQA 1K55A 5CGSA 4R23A 3V50A 3WRTA 4GDNA 3B3XA 4OONA 4PM7A 4DE1A 4P0MA 4S2OA 2J7VA 1DJBA 3JYIA 4FH2A 1BTLA 5EE8A 3N8SA 5EVIB 5HW3A 2Y2LA 1ES3A 2WADA 1I2WA 2RL3A 5GL9A 5CGXA 5FAPA 2ZM8A 3V3RA 4KZAA 5GLDA 1CI8A 2PBYA 3UNWA 1I2SA 1MWSA 2WGWA 4OOYA 3ZG8B 4PPRA 1K55C 3G30A 1KVLA 1MWTA 3VP2A 2IWDA 5EPHA 4M3KA 3A3FA 1YT4A 3HLCA 4ZAMA 1HVBA 4BL2A 1MY8A 3ZNYA 1YLPA 1WYCA 3EQVA 3PBTA 1K38A 2C6WB 1YMSA 5M18A 3MXSA 4RX2A 3V5MA 3G4PA 2CC1A 5IHVA 2XK1A 4UA7A 5CTMA 4WYYA 3IHAA 3PBRA 3G2YA 3IT9A 2P9VA 4WMCA 2H5SA 1ONHA 5FI6A 3G35A 1JTGA 2ZM0A 4WEKA 3VSKA 3AGDA 3HUNA 4KZ9A 2I72A 4YINA 4WZ4A 3O87A 2ZLYA 1L0DA 5A90A 1TDGA 5FAQA 3ZDJA 2HPBA 3NDGA 4QY5A 5TFQA 1ZG4A 1O7EA 4UA9A 3C7VA 2XFSA 2ZMAA 3LO7A 1XA1A 3FKWA 3QNCA 5CXWA 4ZJ3A 3VP3A 3BEBA 3VOYA 1FR1A 1GHIA 3UDFA 1L0EA 3A3JA 1H8ZA 2J9OA 3BLSA 5D3OA 1S0WA 5EOEA 4OP8A 3ZG7B 2OV5A 1PIOA 1NRFA 3D4FA 4WZ5C 5EUAA 4DE3A 4K0WA 4EBLA 4S2LA 2WKIA 4KG5A 3MZDA 3FYZA 5A92A 4IVIA 5HARA 3V39A 1J9MA 4OLGA 2J8YA 4OH0A 4KENB 1KVMA 4IBRA 2HDQA 4E3IA 2WGIA 3TOIA 5EOOA 2Y2MA 4FH4A 4JBFA 1YQSA 2XF3A 2XFTA 4NETA 1KGFA 3IF6A 1K56D 2QPNA 1I5QA 2B5RA 1BSGA 4C75A 4HBUA 2Y2QA 3QHYA 4JF6A 4KZ8A 3P98A 1K54A 1M40A 1TVFA 1FSWA 2G2WA 5GHYA 2WKEA 3Q7VB 4YFMA 2EX6A 1FOFA 5FATA 2GDNA 2HP6A 4PM8A 4EWFA 2Y2PA 1NZOA 1PI4A 4R0QA 3SH7A 3ZG9B 4A5RA 4OOLA 4JF5A 5GHXA 1E4DA 1ES5A 4O7DA 4WEJA 3IF6C 2IWBA 4C6YA 3ISGA 1M6KA 2Y2NA 3O3VA 1KE4A 3BECA 1PWCA 3OPLA 2OLUA 4R1GA 5E2HA 4BQMA 3ITBA 1MBLA 3DWZA 3VP4A 5HX9A 3MKEA 1ESUA 3G34A 2EFUA 5U47A 4GZBA 3BRMA 3FV7A 2FFYA 1EROA 1XPBA 4GD6A 4LCLA 1AXBA 2WUQA 4JXVA 3W8KA 4OQHA 4QB8A 3QNBA 4MBKA 3NI9A 3UDIA 4BLMA 2EX9A 5KMWA 4E6XA 1IYPA 4EUZA 4QD4A 2XH9A 3LCEA 1W79A 1NY0A 1NZUA 1RCJA 1G68A 2IWCA 3NIAA 5DTTA 1GA0A 1SDEA 1N9BA 2ZC7A 5JYOA 5AQAA 2HDUA 4MBHA 1GHMA 5FQQA 3MBZA 3P09A 3IWQA 2UWXA 3ZCZA 3UPOA 3HVFA 3SOIA 2EFXA 2A3UA 5KSCA 3RXWA 5F82A 1PYYA 3BFGA 3NC8A 5DTKA 5EVIA 2V1ZA 1L0FA 3PAGA 4JXSA 2JC7A 3ZVTA 1CK3A 4RYEA 4OOMA 5DF8A 5CHUA 1IELA 3N8RA 2VGJA 1PWDA 3N4IA 1RGZA 2ZC3B 3IWOA 5FASA 3W4PA 1LI0A 3S1YA 1JWZA 1XKZA 5CEBA 1NYYA 1Q2QA 3EQUA 4XUXA 3SH9A 5AQ9A 1KGGA 3UE1A 3RJUA 1NXYA 1E3UD 4LCMA 4GB7A 3DTMA 3TSGA 4U0XA 4Y0OA 3VFHA 4R3JA 4MBFA 4R4RA 4XXRA 4X56A 1XP4A 5FDHA 5GLBA 5CTNA 2ZC6B 3A3EA 3M6BA 3OPPA 4UA6A 4KQOA 4E3LA 4KZ3A 1BUEA 1JTDA 1DJCA 3E2KA 3HLDA 3UE3A 2XQZA 4S2NA 1YM1A 4ZDXA 5KZHA 4DE2A 1VQQA 3SS3A 1L2SA 1ES4A 5AQ7A 4GKUA 2ZQAA 2V20A 1KDSA 2QZ6A 1RGYA 1XGJA 3WS4A 5E2FA 2DNSA 1KGEA 5EECA 1GA9A 4ZBEA 1PW8A 1KDWA 3HLFA 3PAEA 3UPPA 5HL1A 2VGKA 1RP5A 2ZM2A 3E2LA 5KSHA 3BFCA 1LHYA 2ZQDA 1FCNA 1IKIA 1U60A 4X53A 1BT5A 3CJMA 3NY4A 1HTZA 4S2NC 1ESIA 1W5DA 2JBFA 1ONGA 3MZFA 4L0LA 1ES2A 4PM9A 2ZC5B 1CEGA 4JKTA 4DXBA 4OLDA 3HLEA 4N9LA 1E25A 4N92A 4KZ4A 1MPLA 4EV4A 1DY6A 2E8IA 5DTSA 1KE3A 5FI2A 4NK3A 3FWLA 2EX8A 4D2OA 4IVKA 3FKVA 4DDSA 4ID4A 2ZQ9A 5I94A 4GOGA 1NYMA 1S6RA 1ERMA 1LL9A 2ZD8A 3MZEA 3N7WA 5M1AA 2OSUA 3TG9A 4S2PA 4BENA 2Q9MA 5E43A 3GV9A 1IYQA 1QMFA 4JLFA 4K0XA 4OQIA 4P85A 4BL3A 2G2UA 3AGEA 3Q7VA 3WWXA 4WELA 5FQ9A 2BLSA 3AGFA 4LV3A 4N9KA 5GLCA 4DF6A 2X71A 2Y4AA 2ZQCA 3UDXA 1CEFA 4KG6A 1G6AA 2ZQ7A 5CERA 3ZG0A 2JE5A 3IF5A 5HAIA 2JCHA 1Y54A 1ZG6A 3OCNA 4E3NA 3MFDA 1BLCA 2Y2HA 3ZFZA 4KG2A 1K4EA 4E3OA 3GTCA 4OQGA 1PI5A 2WKHA 4CPKA 4MNRA 2XEPA 4WMCD 1K25A 1K6RA 1K54C 3IF6B 3O86A 4JF4A 5HFOA 4X69A 4LV2A 2RCXA 3N6IA 4X6TA 1ERQA 3UO9A 1YLJA 3UN7A 5F1GA 2EXBA 4RVAA 2Y2IA 1OMEA 2Y2OA 5CHMA 3LY3A 4PM5A 1YMXA 5DVAA 4HEFA 3WS2A 3CG5A 2ZJ9A 4FD8A 2Y59A 4KQQA 2WGVA 5L2FA 1K57A 4EBPA 3PBQA 1MWRA 1HD8A 2X02A 4RA7A 1KE0A 4X68A 3S4XA 3LY4A 4QHCA 5F1FA 5TR7A 1Z6FA 1W8YA 4UHUA 1FSYA 1N4OA 3IXHA 5DF7A 4B4ZA 4E3MA 3NBLA 3ZNTA 4GNUA 5CGWA 3O88A 4JXGA 1YLYA 4BJPA 1XA7A 2A49A 3RXXA 3IXBA 3HBRA 2EX2A 4R3BA 3GVBA 3VP1A 1IYSA 3PBNA 4BD0A 3A3DA 1DJAA 5A93A 3BM6A 3C4PA 1EWZA 1PW1A 4OVDA 4S2KA 3OPHA 4R4SA 3DW0A 1JVJA 5EVIC 2Y2GA 4LENA 5F83A 5FAOA 3W4OA 2PU2A 5CHJA
chains in the Genus database with same CATH superfamily
4S2JA 5CPJB 1WYBA 3MS6A 1HQ3A 1MXOA 4O01A 3H7WA 1SHVA 4FOFA 1M19C 2HDRA 3MF0A 2PU4A 2LY8A 3G2ZA 1UGUA 2V8CA 5AV8C 4Z9QA 2FFFB 3UTBB 3IX3A 2WYXA 3REKD 3CAXA 1TS6A 1KOUA 5KDMA 3MNNA 2OLVA 1YAXA 3FZCA 4H6JB 4OQ0A 4CLCB 1PZOA 4MCWA 1M1AC 2HIOC 3IHBA 3HUMA 2Z2MB 3WD4A 5JYPA 4Y7PA 2Y2KA 1G28A 5AV6C 4HNBA 5B2IC 2IOUA 1L0GA 3KSFA 4IEDA 4YNRA 3AZFA 5B2JD 2JKTI 3AZLC 2O9CA 3Q7ZA 1KX5D 5DNMB 1YPRA 4KZBA 1MC0A 3O62C 1ULYA 3SS4A 4JJNA 3WAAA 3IQAA 1KX3B 4B4XA 3C1BD 4R70A 3GQZA 2Q9NA 5B1MA 3W98D 1HZOA 5B32D 4KZ5A 4E3KA 4HBTA 5J8XA 1YLZA 2XD1A 3T50A 3BLMA 3G6OA 2PT7A 5CECA 1EQZA 5K5BA 3OZHA 4GD8A 3VH6W 3SH8A 3LYXA 4QJGA 3ZG5A 4H9PB 4R8PA 1CI9A 5JA4B 3AZHB 1P3BC 3WS5A 1PZRA 1S1ZA 3F1NB 4NKPA 4WV4B 4ZTKA 3CUEA 3MGQD 3MGRD 3VP0A 3IBRA 3WS0A 5F6AA 4GN2A 1IYOA 4HP9A 2X01A 5IT5A 4PMAA 5LBRA 4N1HA 4X23A 1LL5A 3CZDA 2V2FF 5M19A 1MKMA 2VEAA 3VOZA 4KUOA 3KSIA 4F3LB 3X1TB 3A3IA 5AY8B 5B0ZB 3AZEB 4H9OB 3MQQA 1OTDA 3OPRA 3B6GB 3Q1FA 4XUJC 3REJD 3W4QA 2EXAA 3UTAB 4QU3A 2DRWA 4I3IA 4NE6A 3VSLA 4Y13A 3AZIB 3A6NC 5F99D 2PYOB 1O07A 3AN2C 4OPQA 3T4QA 4R23A 5HDDA 3WTPA 3LJAC 2NQBC 2YFWB 3REHD 3WRTA 4P0MA 2J7VA 1F66D 3B42A 2Y2LA 3UT9D 1I2WA 1BH9A 1XFQA 3LZ1D 4IJGA 5GLDA 3UNWA 1I2SA 1M19B 4OOYA 4PPRA 1K55C 3G30A 2G7UA 1KVLA 3JPUA 2IWDA 3MXQA 5AV8B 4M3KA 4H6JA 1HTAA 1N1JB 1LSWA 5EFWA 1H3OB 1NRJA 2FN2A 2CV5D 1WYCA 3PBTA 1YMSA 2M7VA 3V5MA 3A1KA 5IHVA 3EPKA 4UA7A 5DNND 4WYYA 2VV8A 1M1AB 2HIOB 5G4YA 5FI6A 3AFAC 5AV6B 4L9EA 4WEKA 4YINA 2I72A 3MFXA 3MGSD 1YU2A 1FILA 2PR5A 5A90A 5FAQA 4IBCA 3AZLB 1P3OA 4QY5A 1O7EA 1KX3A 3O62B 3LELA 3VP3A 2B02A 3UDFA 3LIEA 4Z66C 4UPKA 2HGVA 2VA0A 4DRAA 4WZ5C 2F8NH 3T1SA 4S2LA 5CPKC 3VV4A 4KG5A 3MZDA 4OH0A 5JA4A 3AZHA 4IBKA 2PR6A 1KVMA 4IBRA 5AVCC 3F1NA 2WGIA 3RELD 5FDSA 1W1YA 4JBFA 3T4JA 2XF3A 2XFTA 3U4LP 3IF6A 4GCZA 1P3BB 1P3PD 5B0YD 4WU9C 2YKFA 4KZ8A 5CPID 3CI6A 3WD2A 5AVBD 1WWSA 1N9NA 3MGPC 3LI9A 5GSUD 4UUZA 1NZOA 2W3FA 1H8PA 3B47A 3BWLA 5AV5D 4H9NB 3SH7A 4QWOA 3T4SA 1E4DA 4WEJA 3SZTA 4C6YA 3BY9A 1PWCA 3X1TA 2F8NK 2OLUA 4R1GA 4BQMA 1MBLA 3DWZA 5AY8A 3VP4A 5HX9A 3VOLA 2EFUA 4H9OA 3BRMA 3FV7A 3B6GA 1EROA 4GD6A 3QNBA 3UDIA 4BLMA 3UTAA 3C1CC 1IYPA 3VH5W 4XUJB 4QD4A 3AZIA 4EEPA 1NZUA 1RCJA 1EAKA 4GH9A 2PYOA 2IWCA 3F6TA 3PYPA 5DTTA 5FQQA 3B0CT 3ZCZA 4EETB 5C5KA 2A3UA 2JKFA 3RXWA 5F82A 3A6NB 1P3AD 3AN2B 1BH8A 3NC8A 4CAYB 3LJAB 5B24D 2NQBB 4RYEA 3P01A 3W97A 5DF8A 4NZ4A 4KUKA 1M19A 2E8JA 1PWDA 3KXBC 4GHIB 5AV8A 4GLQA 1H3OA 4HGAC 1N9OA 1XKZA 5CEBA 4J8XA 1Q2QA 4XUXA 3C1BC 5AQ9A 5BT1D 3RJUA 4LFUA 4BMWA 4E04A 1E3UD 4LCMA 4GB7A 3BJNA 1M1AA 2HIOA 4R3JA 4MBFA 4R4RA 4X56A 3DTEA 5GLBA 4IBIA 4KHAB 5CTNA 1T19A 2ZC6B 4UA6A 5AV6A 1BUEA 3EG5B 3E2KA 3HLDA 1YM1A 5KZHA 3AFAB 1BFMA 1L2SA 1O6IA 4GKUA 1XGJA 5E2FA 4Y3IA 3X1SA 4ZBEA 1PW8A 2GX5A 1XJ6A 2ZM2A 1ZLAD 1LHYA 3WA9C 4X53A 4J8UD 4KGCD 1W5DA 1ONGA 5MC7A 4PM9A 1CEGA 4DXBA 4OLDA 4NYUA 4Z66B 2V8FA 3IP4C 1YU1A 4ZUXD 1KE3A 1T18A 2OOLA 3UMEA 3F1PB 1DP6A 4GS9A 4IVKA 5DFXA 5CPKB 1S6RA 4HIAA 2W1RA 1P3BA 3TG9A 4BENA 5AVCB 4XZQD 3AZND 4JLFA 5B1LD 2G2UA 4Z2GA 3ZYTA 4CSRA 3AGFA 1TAFA 5B40A 4DF6A 2VK3A 4WU9B 1CEFA 1LSXA 2ZQ7A 3ZG0A 2JE5A 1CJFA 5HAIA 3MGPB 1ID3D 3OCNA 2PDRA 2Y2HA 4B9OA 4KG2A 3LFVA 4KUDC 4WMCD 1K6RA 4JF4A 3S7QA 3LZ1C 4X6TA 3H82A 3UO9A 4RVAA 4XUJA 4PM5A 3LY3A 2K7SA 5DVAA 4DMZA 1XJ3A 2CV5C 3OOVA 4LLOB 4KQQA 3LIAA 5L2FA 3B0CW 3REID 3C1CB 4B93A 1J3WA 1HD8A 2X02A 4RA7A 3S4XA 3LY4A 3A6NA 2RVQD 5TR7A 4CAYA 1W8YA 5DJTA 3AYWC 1E15A 3LJAA 2NQBA 1NLZA 4B4ZA 3D72A 1S32D 3CWFA 2HV1A 5CGWA 2D02A 4JXGA 2A49A 4GHIA 5GT0C 5BPVA 4R3BA 3GVBA 1IYSA 3A3DA 3EEAA 4RQ9A 3DW0A 3KXBB 3L7HA 5EVIC 2PU2A 5AVFA 5CHJA 4HGAB 5CRFA 3M2KA 2FJ7D 5HDCA 3AZJC 3MVDD 3C1BB 2XD5A 3N8LA 4YM6D 4OP5A 5CX7A 1K56A 3Q07A 3KWQC 4Z1WA 3N3FA 2L1MA 1LI9A 3LEZA 5IU1A 3AV2D 4MB3A 4JGPA 3M6HA 1H8MA 2RIQA 2ZL1B 4U3TA 1FR6A 3BFEA 3KSYA 3PTEA 5E2GA 5G49B 2XGNA 3L29A 2QKPA 1S4RA 1P3PC 1M18C 4MB4A 2V0UA 4J8WC 4QNLA 1WE4A 1E6NA 2QMIA 3GRJA 4MLLA 4KZ7A 5GSUC 2RTSA 1ZC2A 4OPRA 3WA9B 4Z66A 2OAP1 4Y17A 3B6FA 4E6WA 2O9BA 1OT6A 3C7UA 1P34D 4OPZA 2PRFA 4WZ5A 5DF9A 2DF4C 3P5JB 2M7UA 3AZGD 1Q2PA 4HP4A 4D60A 4J8VC 1W8QA 2Y2JA 4IJEA 1CXWA 1K6SA 5E5AD 5AVCA 4O0PA 2WKRA 2R9WA 4U0TA 5FQKA 3Q82A 4P6BA 1STZA 2WZXA 2NZDD 4KQRA 3HL9A 1UWPX 4FSFA 1G6OA 2HP5A 4WU9A 1BLPA 4EEUA 5GT3A 1YLTA 2H10A 2V5OA 3VH6T 3MGPA 1PRQA 3UY6A 1IEMA 1AWIA 4WM9A 1U35C 2OWHA 3L27A 2XDMA 4UAAA 2FZ0A 4YOFA 4Z5TA 2ZY5A 3ZHHA 3WKJD 1QMEA 1P3LD 5FI7A 3BFFA 5GXQA 5BS7C 1S4SA 4ARZB 1EI5A 2G5HC 4KUDB 3CHWP 3KSHA 4LD9C 1LL8A 1P3IC 3HLWA 3LZ1B 3TU4D 3IXDA 3SS5A 1XGIA 3G32A 3AV1D 1BULA 3UB8A 1K4FA 3WD3A 3C1CA 2CV5B 3FG8A 1OPXA 5JRGD 1XXMA 1AOID 1MWUA 5B33D 1P3MD 1JWPA 2BYKB 2WZZA 4Q8IA 3LR0A 5L07A 3AYWB 2HUEC 3X1VC 1K57C 3UE0A 4GDBA 3W96C 5FQJA 2WKPA 3V67A 2BTFP 2PAVP 1TDLA 3KXBA 5GT0B 3V50A 4OJPA 4H9RA 1V9YA 1YU0A 4WLAA 1B67A 4PM7A 5EE8A 4FH2A 1DJBA 5EVIB 1F5MA 2UV0E 3T1XA 1P3KD 3N8SA 2W3HA 3IS2B 2WADA 5FAPA 3AZJB 4KZAA 2PBYA 4HJ6A 3ZG8B 5IS1A 2ZL1A 3LZ0D 3KWQB 2XSSA 5EPHA 4BL2A 4Z5TD 1HVBA 5HWTA 2AROA 1F2KA 2DMWA 4YS3D 3LIBA 1QO6A 2CC1A 3E0YA 2W1TA 2MJ6A 3IHAA 1W63M 1ONHA 3FPWA 2ZM0A 1D7EA 3WA9A 1M18B 4J8WB 2VKSA 1HLUP 2W3GA 3VSKA 4KZ9A 3KYZA 1A7WA 4EXOA 3M7PA 3B33A 2ZLYA 3O87A 5TBMB 5GSUB 4IBFA 2OAQ1 5FL3A 4QLCB 3C7VA 2ZMAA 3LO7A 3QNCA 3BEBA 3A3JA 2J9OA 1T1CA 1F98A 3AZMD 3KO6A 5D3OA 1S0WA 4J8VB 3X1UD 1VB6A 1PIOA 3D4FA 5HWWA 3ZQ5A 1P3GC 5EUAA 4DE3A 3LI8A 2J8PA 4K0WA 1H0IA 1OTIA 1PNEA 3FYZA 5A92A 1J9MA 4OLGA 2J8YA 4NE3A 1NWZA 3LR4A 1HQ3D 5EOOA 3NHQA 4FH4A 4NETA 4H9SC 2HJ9C 1KGFA 1P0ZA 1U35B 2QPNA 4ARZA 2Q0OA 1EW0A 1T1AA 2B5RA 1FIKA 4KUDA 3W2ZA 3P98A 3MNND 1FSWA 2D01A 2WKEA 3Q7VB 1FOFA 5FATA 2GDNA 2PBDP 5I5LA 4EWFA 1OGGA 1PI4A 1CF0A 4HMDA 4I39A 4LD9B 3RH8B 2V1AA 4Q0JA 5GHXA 1P3IB 3R7WA 4NZ1A 3BECA 2FJ7C 5AV9C 5HWVA 1ESUA 5U47A 2P08A 2BYKA 4LCLA 3AZFD 1AXBA 2WUQA 1KX4C 4JXVA 1LSVA 4QB8A 3AV2C 5CP6C 3AYWA 3LUQA 2EX9A 4JJND 3WAAD 3VH5T 3W99A 1G68A 3AZKC 1GA0A 1SDEA 2HUEB 5GT0A 3X1VB 2PD8A 3MBZA 4NXBA 2UWXA 5B1MD 3W96B 5KSCA 1TS0A 1PYYA 5CPJA 1E88A 5EVIA 2V1ZA 4Z2KA 3IS2A 3AZJA 5G4ZA 4L9GA 1UWNX 3UTBA 1EQZD 4NXFA 5CHUA 1P34C 3N4IA 3IWOA 5DKKA 4R8PD 3T4KA 3KWQA 5HZHA 1LI0A 2P04A 4CLCA 3EQUA 3K2NA 1KGGA 4ME4A 4WU8C 1WA9A 4DJ2A 4ZBJC 4IBBA 3KUYC 3LR3A 3OPPA 4EQ1A 4E3LA 1M18A 4J8WA 4X23D 1JTDA 5J4EA 5B2IB 5TBMA 2XQZA 5DNMA 3UE3A 1VQQA 4HJ3A 2V20A 4NEED 4QLCA 4L9FA 2DNSA 1GA9A 4GJ4A 5EVEA 4MB5A 1KDWA 3PAEA 3UPPA 5HL1A 1P3LC 2VGKA 1T3UA 5KSHA 2XRNA 3BFCA 1IKIA 2CWEA 4J8VA 4S2NC 4L0LA 3MZFA 3NJAA 4HI4A 4KZ4A 4PHTA 4AWLC 2E8IA 3WTPE 4PKYG 1P3FC 3IX4A 4H9PA 4TX8A 1P3GB 3WTPD 2Z6CA 4DDSA 4ID4A 3L2AA 5I94A 5JRGC 4GOGA 1NYMA 2Y8HA 3T12B 3MZEA 3N7WA 1U35A 4S2PA 5E43A 3GV9A 4K0XA 4OQIA 3Q7VA 4EERA 5BS7A 2J3TD 4N9KA 5GLCA 4LRYC 2Y4AA 1TZYC 3UDXA 4KG6A 1G6AA 5B31C 4LD9A 3IF5A 1P3IA 1ZG6A 4E3NA 2BYMB 3DBAA 1K4EA 4OQGA 1PI5A 4F3LA 4CPKA 5B0ZA 3AZEA 1K54C 3SW1A 2JN7A 5HFOA 4DJ3A 2FJ7B 4X69A 3NOUC 2ZBBA 5AV9B 2RCXA 3N6IA 3REKC 1ERQA 1YLJA 3UN7A 5F1GA 2EXBA 2Y2IA 1KX4B 1P3OD 2Y2OA 4LGWA 2O9AA 3AV2B 4HEFA 1KX3D 3CG5A 4UEYA 3NULA 3WS2A 5CP6B 4FD8A 3LELD 1R4VA 4R3AA 3X1VA 1K57A 1MWRA 2W0NA 3W96A 1KE0A 5F69A 1K0KA 3AZKB 4NZ3A 5L10A 4KQDA 3UB9A 2YFWA 3KS8A 4JGOA 3UB6A 1OT9A 5AJGA 1FSYA 1N4OA 3NQUB 4E3MA 5B2JC 4GNUA 1KX5C 3O88A 4MN6A 2L5AA 1XJ4A 2EX2A 3HBRA 3AZHD 3PBNA 4BD0A 1N1JA 3BM6A 4PKYA 1EWZA 1P34B 3W98C 3W4OA 1L6JA 5F83A 3T1QB 3JVUA 1TD5A 5B32C 4HESA 5DFYA 3ITAA 4K91A 4WU8B 1BZAA 5F68A 4NXGA 4ZBJB 2O99A 4Z2HA 4DDYA 5B2IA 4WBGA 2WGWB 3KUYB 4LV0A 4GW9A 4DRTA 5BOHA 4O8GA 3AZLA 3X1TD 5GHZA 2LB5A 4JGRA 1NJ4A 3ULFA 5AY8D 3O62A 3MR0A 1FCMA 2W3DA 1E6RA 2BG1A 3MGQC 2JKGA 2Y91A 3MGRC 2VJWA 3B6GD 5EVLA 3MKFA 3HREA 1Z09A 1DRMA 5BNXB 1P3LB 2HJEA 2P9VB 3UTAD 4HJ4A 2NUPC 4DXCA 2W3EA 4E3JA 3EGXC 3IXGA 3AZID 1ALQA 4DE0A 3R4KA 2PYOD 1PWGA 2YFVB 4Q0HA 1H5XA 1LLBA 1P3GA 4EQIA 3MXRA 4N1XA 5E2EA 2XLNA 4XUZA 2J9PA 3ZGAB 2A24B 4AWLB 3UB7A 3DWKA 5HAPA 1P3FB 3Q81A 3UPNA 1OJGA 4LPZA 2WAFA 1BLSA 4UQIM 2ZC4B 4RX3A 3W97D 5JRGB 4JXWA 3REJC 3VH6A 1YKDA 1M19D 1W1VA 3L9KA 4JJNC 3R45B 4HMEA 1AIWA 3WAAC 5AV8D 3IH8A 4C3QA 5EV0A 5FA7A 2ZY4A 5G18A 4H9NA 4J8XD 5F99C 4QY6A 3G31A 3EPHA 3CMZA 2BYMA 4G92C 2Z2LB 1TZYB 4NFTA 5B31B 2F8NB 1M1AD 5AQBA 2HIOD 3REHC 3OC2A 1BLHA 4JPMA 5FSRA 1F66C 3QP2A 1GCEA 1C3BA 5AV6D 4IBEA 3UT9C 5AV9A 4DN0A 2XA7M 4R8PC 2C5WB 3WD1A 2J80A 1KX4A 3GR2A 3S22A 2EWVA 3NCKA 3OCLA 3REKB 4ESPA 5CP6A 4EBNA 3X1SD 3CUEC 4F94A 2ZM5A 1W1PA 3AZKA 5DNNC 3I7JA 2PYRA 1VETB 3AN2A 2ZQ8A 4BBVA 1JNUA 3HLBA 2H0YA 2LB9A 5HSQA 3HLGA 4P87A 4IBXA 3MGSC 1W2EA 2GNXA 3ZVWA 1ZKJA 2QWSA 1S67L 5B2JB 5GLAA 2YKHA 3S7PA 1KX5B 3NDEA 1A0KA 3HUOA 4EUVA 1K55A 5CGSA 4X25A 1P3BD 4GDNA 3B3XA 4WU8A 4S2OA 3JYIA 5HW3A 3C8CA 4KHAA 3W98B 5CHLB 5B40D 5B32B 2ZM8A 4Z2IA 3GDIA 2WGWA 3KUYA 2VX8A 4WNNB 4NZ5A 4LG2A 2W27A 1MWTA 3AFAA 3VP2A 3WTPC 3A3FA 1YT4A 3HLCA 3OBFA 3RELC 4IUKA 1K38A 2C6WB 5M18A 3MXSA 3G4PA 1H0GA 1IOUA 5B0YC 5BNXA 3K3DA 5CPIC 3IT9A 2P9VA 2KLIA 5DJUA 3MGQB 5AVBC 2J3TC 3MGRB 1D1JA 3G35A 5AVEA 1YSQA 3CITA 4XUJD 3B0BA 3EEHA 5AV5C 4WZ4A 3H0MC 1W1TA 1L0DA 3BY8A 3KYEA 1TDGA 1Q9CA 2KDKA 3ZDJA 3RFBA 4IJFA 3NDGA 3F1PA 3HONA 2A24A 3NQJB 1ZG4A 5TFQA 2XFSA 3A6ND 5CPKA 1P3FA 1OGBA 1XA1A 3FKWA 4ZJ3A 1P97A 1FR1A 3LJAD 2NQBD 3BW6A 1CQAA 4JGQA 2INWA 4OP8A 3ZG7B 4HY8A 3R45A 4YWZA 1S1YA 1NRFA 2V9AA 1P3OC 3H9WA 3REJB 2VGLM 3LELC 4OJLA 2QJ7A 1GPFA 5FUGB 3WAAB 2ZMFA 4IVIA 4Q0IA 5HARA 3V39A 4BWIA 1TZYA 4DRBA 5B31A 2F8NA 4I3JA 3IX8A 5F99B 1P3AC 1YUEA 5F5YA 4G92B 3AL0C 1J7MA 1K56D 4XT2B 5B24C 1I5QA 1BSGA 3REHB 2Y2QA 3QHYA 4HBUA 4JF6A 1K54A 1M40A 1TVFA 5HPFA 1F66B 2EX6A 3UT9B 2HP6A 3C30A 4E44A 2R78A 1T1BA 3REKA 4R0QA 3WX7A 1ED7A 3ZG9B 1IFQA 4NE5A 4OOLA 4R8PB 4JF5A 2B95A 5BT1C 4WN5A 1ES5A 4O7DA 3C38A 3IF6C 3ISGA 3O3VA 2Y2NA 1KE4A 3OPLA 2KOIA 5HD3A 1OTAA 2VQRA 5TJJA 4GZBA 2FFYA 3VH5A 3W8KA 5DNNB 3MJQA 4Z66D 1GXDA 4Z2LA 3NI9A 3B6FD 5KMWA 5B2JA 1W79A 1KX5A 3MGSB 1JFIB 5AQAA 1GHMA 3UPOA 1KU5A 3SOIA 5BO0B 1ZLAC 3TW8A 5AVCD 3H0LC 3FC7A 3DAVA 3VE3A 2JKRI 4J8UC 3C1BA 4KGCC 1W63Q 3W98A 1G5UA 2VV6A 3PAGA 4JXSA 2JC7A 3ZVTA 5B32A 1CK3A 4M6BA 4OOMA 4WU9D 3K3CA 4NY2A 1SKOB 1VEUB 5GT3D 4ZUXC 4WNNA 3C2WA 3MGPD 1N9LA 1RGZA 2ZC3B 5FASA 3S1YA 4LRXC 4IUHA 3GECA 5G49A 3WTPB 1Z2CB 5GXQD 3W97C 3DTMA 3TSGA 1GOIA 3WD0A 3RELB 4XZQC 1XP4A 3AZNC 5FDHA 3MGQA 4WJ3C 3A3EA 3MGRA 5B1LC 2V1BA 1BH9B 1P3PB 5B0YB 3D9YA 1DJCA 4J8XC 5CPIB 1NLYA 4ZDXA 3PR6A 5AVBB 4P6ZM 3SS3A 5AQ7A 1ID3C 3C1CD 2QZ6A 3DTKA 1KS0A 3NQJA 1KGEA 5AV5B 4EO5C 3TE8A 3HLFA 3E2LA 4Z2JA 4GHAA 5A8BA 1ODVA 3CPTB 1FCNA 2GZAA 3EGDC 4WZSB 3NY4A 2NUTC 4H9QB 2ZC5B 4N9LA 3MQLA 4N92A 3REJA 4NXEA 3X1SC 5DTSA 5FUGA 3KXBD 5FI2A 4NK3A 2EX8A 3REIC 1P3OB 4D2OA 1DP9A 3UB5P 4ETXA 3FKVA 1XJ2A 3LELB 5F99A 1LL9A 2RVQC 4DQYB 5M1AA 2OSUA 4XT2A 3LICA 3REHA 1OJ5A 3LGOA 1S32C 1P3AB 3BQAA 1IYQA 1QMFA 4P85A 1F66A 3AGEA 2PD7A 3UT9A 4LV3A 3VE4A 5B24B 3LEQA 3KYQA 3LZ1A 2DQNC 2AROD 5CERA 2JCHA 3MFDA 1L3LA 3GTCA 4EESA 2CV5A 2WKHA 3MVDC 4MNRA 1K25A 4YM6C 3IF6B 3O86A 5B40C 2G5IC 3WA9D 5DNNA 4I38A 4LV2A 1GSWA 3KSGA 4UUZB 4I3AA 1OMEA 5CHMA 1Y28A 1YMXA 3MGSA 4GHLA 3EPJA 1JFIA 2ZJ9A 4EBPA 1PDCA 2WKQA 3UMDA 5BO0A 4BBUA 4Y5FA 4QHCA 1TS7A 1P9RA 5F1FA 5FEGA 3NOPC 2QJ5A 1UR8A 4UHUA 3T4LA 4K08A 1XFNA 1ZLAB 3QP1A 1OTBA 1SKOA 1VEUA 4J8UB 4KGCB 3LIFA 1XA7A 3FDDA 3VP1A 1YSPA 4ZUXB 1DJAA 3C4PA 3AZGC 1ZTUA 4S2KA 4EW7A 4LENA 4HH2A 4OQHA 5E5AC 2O0YA 5CEDA 4H8RA 3RELA 2R9XA 4KUDD 1BH8B 4Y0TA 3EPLA 1SKFA 2NZDC 3QP8A 5L8MA 3BYDA 3W97B 1P3PA 5B0YA 5CPIA 4XZQB 3AZNB 5HAQA 5AVBA 1XX2A 2Y55A 5B1LB 2ZMVA 3BFDA 3U2AA 5GSUA 4MEZA 1YLWA 3M2JA 2WAEA 4MDZA 1SZVA 5AV5A 4J8XB 4OPYA 3VFFA 4Z2MH 3WRZA 1ID3B 3WKJC 5A91A 3CPTA 1SCWA 1YU3A 1H8YA 4EO5B 2K2NA 2HZ5A 4H9QA 1F1EA 5FQMA 2WK0A 3AYWD 4LV1A 3E4OA 2DCFA 4DKIA 1ZHHB 4LRZE 3TU4C 1PZPA 3W99D 4X1LA 4CJNA 1WWIA 3AV1C 3QP5A 5HD5A 5GT0D 1F9IA 4ETZA 4G91C 3H0RC 3X1SB 4B88A 2HDSA 5CPJD 1P9WA 5EVID 3GSGA 3REIB 1AOIC 5B33C 1P3MC 3KFUG 4ZJ1A 4I5SA 3AZJD 2I9VA 3LR5A 1P3AA 3UTBD 3B6FC 4FCFA 1IKGA 2H0TA 1VM1A 3PBOA 4NG2A 5B24A 4CLCE 3KWQD 4PM6A 3IWIA 2XR0A 4KZ6A 4X55A 2FH5A 1S32B 1E6PA 4CLCD 1D06A 5FQIA 3T4TA 4GS9B 4R38A 3A1IA 3P7NA 2D49A 3IH9A 3O5YA 4HHDA 3QP6A 3B0DC 4G3KA 4WL9A 4G3VA 4EU0A 3TRCA 1FCOA 1E3UA 1P3KC 1M18D 2Y79A 4J8WD 2VZWA 2JHEA 5GT3C 4S2IA 3MVDB 3MQ0A 4IBDA 2A2LA 4UQIS 4YM6B 5DNMD 4CSRB 5C3IC 3PBSA 5TGFA 1TAFB 5B40B 3LZ0C 1TEMA 1W7FA 4QLCD 4Z5TC 3C5AA 4Y0UA 1GHPA 4YS3C 4ZJ2A 3V3SA 5GXQC 3KS4A 3L26A 3L28A 2HP9A 4S2MA 3WS1A 4BBTA 4J8VD 3VMAA 1ZLAA 1SDNA 1JWVA 3BQ8A 4J8UA 3H82B 4KGCA 5BNVB 2IO5C 2P74A 4BD1A 1E6ZA 3C4OA 5DKLA 4E45A 1FQGA 4FUWA 2XA7S 3GMWA 1TS8A 4HQAA 3V9RB 5J7EA 1MKIA 4ZUXA 4OKPA 4Y2FA 2VV7A 3EWKA 3S7OA 1U35D 1GSXA 4WF0A 4NYYA 3PHYA 3AZGB 3AZMC 4OONA 4DE1A 3X1UC 1BTLA 1H0MA 1ES3A 5E5AB 2RL3A 5GL9A 4MN7A 5CGXA 4HMCA 3V3RA 1X0OA 1CI8A 4XZQA 3AZNA 1MWSA 4LD9D 5B1LA 2NZDB 1P3ID 3IBJA 3QP4A 4ZAMA 3OLOA 5L09A 1MY8A 2P7JA 3ZNYA 1ACFA 1YLPA 1HQ3C 3EQVA 1ID3A 5B0ZD 3AZED 4OJ6A 3T4OA 3ICYA 4RX2A 2ZOHA 2XK1A 5CTMA 1YU4A 3PBRA 3G2YA 4WMCA 2H5SA 3WKJB 3MNNC 1JTGA 2AROC 3AGDA 3HUNA 4OJOA 2K31A 3X1VD 3HCYA 5FEFA 2HPBA 3TU4B 3W96D 4UA9A 3E4PA 3E98A 3F1OB 3HJKA 3AV1B 3PXPA 5CXWA 3REIA 2AVXA 3VOYA 3KX0X 1GHIA 4G91B 1L0EA 3AZFC 1H8ZA 2B18A 3BLSA 5EOEA 1AOIB 2OV5A 4H9SA 1OTEA 5B33B 1P3MB 2JKRM 4QPRA 4EBLA 1S32A 2WKIA 3B6FB 4IHQA 3NECA 5HL6A 5HPIA 4OUIA 5B1MC 4KENB 3UE6A 4M4XA 2V0WA 2HDQA 4E3IA 3TOIA 2Y2MA 3MQOA 1YQSA 1UR9A 4Z2MG 2FJ7A 4C75A 3MVDA 5B2ID 3B0DB 1EQZC 4YM6A 2G2WA 5GHYA 3MMHA 1P3KB 4YFMA 2W8SA 4PM8A 2Y2PA 4X1MA 5GT3B 4A5RA 3AZLD 4IBJA 3AV2A 3O62D 5C3IB 2ZY2A 2VGLS 2IWBA 3LZ0B 1M6KA 2ZY3A 4Z5TB 5E2HA 3ITBA 4YS3B 3S7NA 3MKEA 3G34A 5GXQB 2IA2A 1XPBA 4ZRRA 4X23C 3NQUA 5BNVA 4MBKA 1PFLA 1LT0A 4E6XA 1P3GD 3V9RA 4EUZA 2XH9A 3LCEA 1NY0A 2IO5B 1CK7A 2JKTM 2PYPA 3NIAA 2ZC7A 5J3WA 5B31G 2F8NG 1N9BA 5JYOA 2HDUA 4MBHA 1P34A 3P09A 3RTYA 3IWQA 2F2AC 3HVFA 2EFXA 3AZGA 3BFGA 5DTKA 1L0FA 5E5AA 4IBGA 3W99C 4II7A 3FKEA 3AZMB 1IELA 3N8RA 2GJ3A 2NZDA 3X1UB 2VGJA 1E8BA 4AFIA 3W4PA 4HH3A 1JWZA 3JVVA 5CPJC 1NYYA 3SH9A 1MZUA 3UE1A 1NXYA 4H9RB 2ACGA 5AV9D 3UTBC 4U0XA 4Y0OA 3VFHA 4Y15A 1HQ3B 4XXRA 3H7WB 3WKJA 1P3LA 3M6BA 4KQOA 3TJZC 2EA9A 4KZ3A 1KX4D 1VHMA 3T1RA 3CLOA 4CLCC 5CP6D 4PAUA 4S2NA 5KDMB 3MNNB 2YFVA 3MSHA 4DE2A 1ES4A 2ZQAA 1KDSA 3TU4A 1RGYA 3WS4A 2AROB 3FPVA 3F1OA 3L25A 3AZKD 5EECA 3AV1A 3AN2D 1RP5A 2ZQDA 2W1TB 1U60A 5B32G 1BT5A 2J3WA 5JRGA 3CJMA 5DNMC 1HTZA 1ESIA 1AOIA 2JBFA 5B33A 1P3MA 1ES2A 4JKTA 4QLCC 3AZFB 3HLEA 1E25A 1MPLA 4EV4A 1DY6A 3HJIA 1KX3C 1H3QA 3FWLA 4JJNB 2L4RA 4OJ5A 4P6ZS 2ZQ9A 1ERMA 4WU8D 2ZD8A 2QHKA 5B1MB 2Q9MA 4G3WA 1TF1A 2H28A 4BL3A 3A0VA 3KUYD 3WWXA 1P3KA 4WELA 5FQ9A 5EM0A 2BLSA 3AFAD 3EOIA 2X71A 3AZHC 2ZQCA 3D3OA 1EQZB 2VLGA 2CMNA 2HF6A 1Y54A 2PHYA 4HOIA 3LZ0A 1BLCA 1Y4OA 2QYBA 3ZFZA 4E3OA 4YS3A 2XEPA 1VETA 3E4QA 4R6LA 2BASA 2L0WA 2JSSA 2M1CA 2EWWA 3HSHA 1BYWA 2Z6DA 4X23B 4FTXA 3X1TC 5CPKD 1P3FD 2Y59A 5AY8C 5B0ZC 3AZEC 2WGVA 3R7WB 3PBQA 5KIZA 4X68A 3DTIA 3B6GC 1S66L 1DP8A 1GSVA 1Z6FA 3UTAC 2OWJA 3A0RA 3IXHA 4MN5A 5DF7A 2XROA 3A0SA 3NBLA 3ZNTA 4CQHA 4WUJA 3AZIC 3AZMA 2ZOIA 2PYOC 3X1UA 1YLYA 4BJPA 1V9ZA 3NOTC 3RXXA 5EM1A 3IXBA 3LIDA 3W99B 1TZYD 5B31D 2F8ND 1B6WA 5A93A 4MMNA 1PW1A 2KX6A 4OVDA 3OPHA 4R4SA 1JVJA 2Y2GA 5HDSA 5FAOA
chains in the Genus database with same CATH topology
4S2JA 5CPJB 1WYBA 1HQ3A 1MXOA 1SHVA 1M19C 2HDRA 2PU4A 2LY8A 3G2ZA 4Z9QA 5AV8C 2FFFB 3UTBB 2WYXA 3REKD 5KDMA 3MNNA 2OLVA 3FZCA 4OQ0A 1PZOA 1M1AC 2HIOC 3IHBA 3HUMA 2Z2MB 5JYPA 4Y7PA 2Y2KA 5AV6C 5B2IC 2IOUA 1L0GA 4IEDA 3AZFA 5B2JD 3AZLC 3Q7ZA 1KX5D 5DNMB 4KZBA 3O62C 1ULYA 3SS4A 4JJNA 3WAAA 3IQAA 1KX3B 4B4XA 3C1BD 3GQZA 2Q9NA 5B1MA 3W98D 1HZOA 5B32D 4KZ5A 4E3KA 4HBTA 5J8XA 1YLZA 2XD1A 3BLMA 5CECA 1EQZA 3OZHA 4GD8A 3VH6W 3SH8A 4QJGA 3ZG5A 4H9PB 4R8PA 1CI9A 5JA4B 3AZHB 1P3BC 3WS5A 1PZRA 4WV4B 4ZTKA 3MGQD 3MGRD 3VP0A 3WS0A 4GN2A 1IYOA 2X01A 4PMAA 4N1HA 4X23A 1LL5A 3CZDA 2V2FF 5M19A 3VOZA 3X1TB 3A3IA 5AY8B 5B0ZB 3AZEB 4H9OB 3OPRA 3B6GB 3Q1FA 4XUJC 3REJD 3W4QA 2EXAA 3UTAB 4QU3A 2DRWA 4NE6A 3VSLA 3AZIB 3A6NC 5F99D 2PYOB 1O07A 3AN2C 4OPQA 4R23A 3WTPA 3LJAC 2NQBC 2YFWB 3REHD 3WRTA 4P0MA 2J7VA 1F66D 2Y2LA 3UT9D 1I2WA 1BH9A 3LZ1D 5GLDA 3UNWA 1I2SA 1M19B 4OOYA 4PPRA 1K55C 3G30A 1KVLA 2IWDA 5AV8B 4M3KA 1HTAA 1N1JB 1H3OB 2CV5D 1WYCA 3PBTA 1YMSA 3V5MA 3A1KA 5IHVA 3EPKA 4UA7A 5DNND 4WYYA 1M1AB 2HIOB 5FI6A 3AFAC 5AV6B 4WEKA 4YINA 2I72A 3MGSD 1YU2A 5A90A 5FAQA 4IBCA 3AZLB 1P3OA 4QY5A 1O7EA 1KX3A 3O62B 3LELA 3VP3A 3UDFA 4Z66C 4UPKA 4DRAA 4WZ5C 2F8NH 4S2LA 5CPKC 4KG5A 3MZDA 4OH0A 5JA4A 3AZHA 4IBKA 1KVMA 4IBRA 5AVCC 2WGIA 3RELD 4JBFA 2XF3A 2XFTA 3IF6A 1P3BB 1P3PD 5B0YD 4WU9C 4KZ8A 5CPID 5AVBD 1WWSA 3MGPC 5GSUD 4UUZA 1NZOA 5AV5D 4H9NB 3SH7A 1E4DA 4WEJA 4C6YA 1PWCA 3X1TA 2F8NK 2OLUA 4R1GA 4BQMA 1MBLA 3DWZA 5AY8A 3VP4A 5HX9A 2EFUA 4H9OA 3BRMA 3FV7A 3B6GA 1EROA 4GD6A 3QNBA 3UDIA 4BLMA 3UTAA 3C1CC 1IYPA 3VH5W 4XUJB 4QD4A 3AZIA 1NZUA 1RCJA 4GH9A 2IWCA 2PYOA 3F6TA 5DTTA 5FQQA 3B0CT 3ZCZA 2A3UA 3RXWA 5F82A 3A6NB 1P3AD 3AN2B 1BH8A 3NC8A 4CAYB 3LJAB 5B24D 2NQBB 4RYEA 3W97A 5DF8A 4NZ4A 1M19A 1PWDA 3KXBC 5AV8A 1H3OA 4HGAC 5CEBA 1XKZA 4J8XA 1Q2QA 4XUXA 3C1BC 5AQ9A 5BT1D 3RJUA 1E3UD 4LCMA 4GB7A 1M1AA 2HIOA 4R3JA 4MBFA 4R4RA 4X56A 5GLBA 4IBIA 4KHAB 5CTNA 2ZC6B 4UA6A 5AV6A 1BUEA 3EG5B 3E2KA 3HLDA 1YM1A 5KZHA 3AFAB 1BFMA 1L2SA 4GKUA 1XGJA 5E2FA 3X1SA 4ZBEA 1PW8A 2ZM2A 1ZLAD 1LHYA 3WA9C 4X53A 4J8UD 4KGCD 1W5DA 1ONGA 4PM9A 1CEGA 4DXBA 4OLDA 4NYUA 4Z66B 3IP4C 1YU1A 4ZUXD 1KE3A 4IVKA 5CPKB 1S6RA 1P3BA 3TG9A 4BENA 5AVCB 4XZQD 3AZND 4JLFA 5B1LD 2G2UA 4CSRA 3AGFA 1TAFA 5B40A 4DF6A 4WU9B 1CEFA 2ZQ7A 3ZG0A 2JE5A 5HAIA 3MGPB 1ID3D 3OCNA 2Y2HA 4KG2A 4KUDC 4WMCD 1K6RA 4JF4A 3LZ1C 4X6TA 3UO9A 4RVAA 4XUJA 4PM5A 3LY3A 5DVAA 2CV5C 4KQQA 5L2FA 3B0CW 3REID 3C1CB 1HD8A 2X02A 4RA7A 3S4XA 3LY4A 3A6NA 2RVQD 5TR7A 4CAYA 1W8YA 3AYWC 3LJAA 2NQBA 4B4ZA 1S32D 5CGWA 4JXGA 2A49A 5GT0C 5BPVA 4R3BA 3GVBA 1IYSA 3A3DA 3DW0A 3KXBB 5EVIC 2PU2A 5CHJA 4HGAB 5CRFA 3M2KA 2FJ7D 3AZJC 3MVDD 3C1BB 2XD5A 3N8LA 4YM6D 4OP5A 1K56A 3Q07A 3KWQC 3N3FA 1LI9A 3LEZA 3AV2D 3M6HA 2RIQA 4U3TA 1FR6A 3BFEA 3KSYA 3PTEA 5E2GA 5G49B 2XGNA 3L29A 1P3PC 1M18C 4J8WC 4QNLA 1WE4A 2QMIA 3GRJA 4MLLA 4KZ7A 5GSUC 1ZC2A 4OPRA 3WA9B 4Z66A 3B6FA 4E6WA 3C7UA 1P34D 4OPZA 4WZ5A 5DF9A 2DF4C 3P5JB 3AZGD 1Q2PA 4J8VC 1W8QA 2Y2JA 4IJEA 1K6SA 5E5AD 5AVCA 2R9WA 4U0TA 5FQKA 3Q82A 4P6BA 2WZXA 2NZDD 4KQRA 3HL9A 4FSFA 2HP5A 4WU9A 1BLPA 5GT3A 1YLTA 2H10A 3VH6T 3MGPA 3UY6A 1IEMA 4WM9A 1U35C 4UAAA 3L27A 2XDMA 4Z5TA 2ZY5A 3ZHHA 3WKJD 1QMEA 1P3LD 5FI7A 3BFFA 5GXQA 5BS7C 1EI5A 2G5HC 4KUDB 4LD9C 1P3IC 3HLWA 3LZ1B 3TU4D 3IXDA 3SS5A 1XGIA 3G32A 3AV1D 1BULA 1K4FA 3C1CA 2CV5B 5JRGD 1XXMA 1AOID 1MWUA 5B33D 1P3MD 1JWPA 2BYKB 2WZZA 4Q8IA 3AYWB 2HUEC 3X1VC 1K57C 3UE0A 4GDBA 3W96C 5FQJA 1TDLA 3KXBA 5GT0B 3V50A 4OJPA 4H9RA 1YU0A 1B67A 4PM7A 5EE8A 4FH2A 1DJBA 5EVIB 1P3KD 3N8SA 2WADA 5FAPA 3AZJB 4KZAA 2PBYA 3ZG8B 3LZ0D 3KWQB 5EPHA 4BL2A 4Z5TD 1HVBA 2AROA 4YS3D 2CC1A 3IHAA 1ONHA 2ZM0A 3WA9A 1M18B 4J8WB 3VSKA 4KZ9A 1A7WA 3O87A 2ZLYA 5GSUB 4IBFA 4QLCB 3C7VA 2ZMAA 3LO7A 3QNCA 3BEBA 3A3JA 2J9OA 3AZMD 5D3OA 1S0WA 4J8VB 3X1UD 1PIOA 3D4FA 1P3GC 5EUAA 4DE3A 4K0WA 2J8PA 3FYZA 5A92A 1J9MA 4OLGA 2J8YA 4NE3A 1HQ3D 5EOOA 4FH4A 4NETA 4H9SC 1KGFA 1U35B 2QPNA 2B5RA 4KUDA 3P98A 3MNND 1FSWA 2WKEA 3Q7VB 1FOFA 5FATA 2GDNA 4EWFA 1PI4A 4LD9B 5GHXA 1P3IB 4NZ1A 3BECA 2FJ7C 5AV9C 1ESUA 5U47A 2BYKA 4LCLA 3AZFD 1AXBA 2WUQA 1KX4C 4JXVA 4QB8A 3AV2C 5CP6C 3AYWA 2EX9A 4JJND 3WAAD 3VH5T 3W99A 1G68A 3AZKC 1GA0A 1SDEA 2HUEB 5GT0A 3X1VB 3MBZA 2UWXA 5B1MD 3W96B 5KSCA 1PYYA 5CPJA 5EVIA 2V1ZA 3AZJA 3UTBA 1EQZD 5CHUA 1P34C 3N4IA 3IWOA 4R8PD 3KWQA 1LI0A 3EQUA 1KGGA 4WU8C 4ZBJC 4IBBA 3KUYC 3OPPA 4E3LA 1M18A 4J8WA 4X23D 1JTDA 5B2IB 3UE3A 2XQZA 5DNMA 1VQQA 2V20A 4QLCA 2DNSA 1GA9A 1KDWA 3PAEA 3UPPA 5HL1A 1P3LC 2VGKA 1T3UA 5KSHA 3BFCA 1IKIA 2CWEA 4J8VA 4S2NC 4L0LA 3MZFA 4KZ4A 4AWLC 2E8IA 3WTPE 1P3FC 4H9PA 1P3GB 3WTPD 4DDSA 4ID4A 3L2AA 5I94A 5JRGC 4GOGA 1NYMA 3MZEA 3N7WA 1U35A 4S2PA 5E43A 3GV9A 4K0XA 4OQIA 3Q7VA 5BS7A 4N9KA 5GLCA 2Y4AA 1TZYC 3UDXA 4KG6A 1G6AA 5B31C 4LD9A 3IF5A 1P3IA 1ZG6A 4E3NA 2BYMB 1K4EA 4OQGA 1PI5A 4CPKA 5B0ZA 3AZEA 1K54C 5HFOA 2FJ7B 4X69A 5AV9B 2RCXA 3N6IA 3REKC 1ERQA 1YLJA 3UN7A 5F1GA 2EXBA 2Y2IA 1KX4B 1P3OD 2Y2OA 3AV2B 4HEFA 1KX3D 3CG5A 3WS2A 5CP6B 4FD8A 3LELD 1R4VA 3X1VA 1K57A 1MWRA 3W96A 1KE0A 3AZKB 4NZ3A 2YFWA 3KS8A 1FSYA 1N4OA 3NQUB 4E3MA 5B2JC 4GNUA 1KX5C 3O88A 2L5AA 3HBRA 2EX2A 3AZHD 3PBNA 4BD0A 1N1JA 3BM6A 1EWZA 1P34B 3W98C 3W4OA 5F83A 5B32C 4HESA 3ITAA 4K91A 4WU8B 1BZAA 4ZBJB 4DDYA 5B2IA 4WBGA 2WGWB 3KUYB 4LV0A 4DRTA 5BOHA 3AZLA 3X1TD 5GHZA 1NJ4A 5AY8D 3O62A 1FCMA 2BG1A 3MGQC 2Y91A 3MGRC 3B6GD 5EVLA 3MKFA 3HREA 5BNXB 1P3LB 2P9VB 3UTAD 4DXCA 4E3JA 3IXGA 3AZID 1ALQA 4DE0A 2PYOD 1PWGA 2YFVB 1H5XA 1LLBA 1P3GA 4EQIA 3MXRA 4N1XA 5E2EA 2XLNA 4XUZA 2J9PA 3ZGAB 4AWLB 3DWKA 5HAPA 1P3FB 3Q81A 3UPNA 2WAFA 1BLSA 2ZC4B 4RX3A 3W97D 5JRGB 4JXWA 3REJC 3VH6A 1M19D 4JJNC 3R45B 3WAAC 5AV8D 3IH8A 4C3QA 5FA7A 2ZY4A 5G18A 4H9NA 4J8XD 5F99C 4QY6A 3G31A 3EPHA 3CMZA 2BYMA 4G92C 2Z2LB 1TZYB 4NFTA 5B31B 2F8NB 1M1AD 5AQBA 2HIOD 3REHC 3OC2A 1BLHA 4JPMA 5FSRA 1F66C 1GCEA 1C3BA 5AV6D 4IBEA 3UT9C 5AV9A 4R8PC 2C5WB 1KX4A 3GR2A 3S22A 3NCKA 3OCLA 3REKB 5CP6A 4EBNA 3X1SD 4F94A 2ZM5A 3AZKA 5DNNC 3I7JA 3AN2A 2ZQ8A 3HLBA 2H0YA 3HLGA 4P87A 4IBXA 3MGSC 1W2EA 3ZVWA 1ZKJA 5B2JB 5GLAA 1KX5B 3NDEA 3HUOA 1K55A 5CGSA 1P3BD 4GDNA 3B3XA 4WU8A 4S2OA 3JYIA 5HW3A 4KHAA 3W98B 5CHLB 5B40D 5B32B 2ZM8A 2WGWA 3KUYA 4WNNB 4NZ5A 4LG2A 1MWTA 3AFAA 3VP2A 3WTPC 3A3FA 1YT4A 3HLCA 3RELC 1K38A 2C6WB 5M18A 3MXSA 3G4PA 5B0YC 5BNXA 5CPIC 3IT9A 2P9VA 3MGQB 5AVBC 3G35A 3MGRB 4XUJD 3B0BA 5AV5C 4WZ4A 3H0MC 1L0DA 1TDGA 1Q9CA 3ZDJA 4IJFA 3NDGA 3HONA 5TFQA 3NQJB 1ZG4A 2XFSA 3A6ND 5CPKA 1P3FA 1XA1A 3FKWA 4ZJ3A 1FR1A 3LJAD 2NQBD 4OP8A 3ZG7B 3R45A 1NRFA 1P3OC 3REJB 3LELC 4OJLA 4IVIA 5FUGB 3WAAB 5HARA 3V39A 1TZYA 4DRBA 5B31A 2F8NA 5F99B 1P3AC 1YUEA 4G92B 3AL0C 1K56D 5B24C 1I5QA 1BSGA 3REHB 2Y2QA 3QHYA 4HBUA 4JF6A 1K54A 1M40A 1TVFA 1F66B 2EX6A 3UT9B 2HP6A 4E44A 3REKA 4R0QA 3WX7A 3ZG9B 4NE5A 4OOLA 4R8PB 4JF5A 5BT1C 1ES5A 4O7DA 3IF6C 3ISGA 3O3VA 2Y2NA 1KE4A 3OPLA 2VQRA 4GZBA 2FFYA 3VH5A 3W8KA 5DNNB 4Z66D 3NI9A 3B6FD 5KMWA 5B2JA 1W79A 1KX5A 3MGSB 1JFIB 5AQAA 1GHMA 3UPOA 1KU5A 3SOIA 5BO0B 1ZLAC 5AVCD 3H0LC 4J8UC 3C1BA 4KGCC 3W98A 3PAGA 4JXSA 2JC7A 3ZVTA 5B32A 1CK3A 4M6BA 4OOMA 4WU9D 4NY2A 5GT3D 4ZUXC 4WNNA 3MGPD 1RGZA 2ZC3B 5FASA 3S1YA 5G49A 3WTPB 1Z2CB 5GXQD 3W97C 3DTMA 3TSGA 3RELB 4XZQC 1XP4A 3AZNC 5FDHA 3MGQA 4WJ3C 3A3EA 3MGRA 5B1LC 1BH9B 1P3PB 5B0YB 1DJCA 4J8XC 5CPIB 4ZDXA 5AVBB 3SS3A 5AQ7A 1ID3C 3C1CD 2QZ6A 3NQJA 1KGEA 5AV5B 4EO5C 3HLFA 3E2LA 4GHAA 1FCNA 4WZSB 3NY4A 4H9QB 2ZC5B 4N9LA 4N92A 3REJA 3X1SC 5DTSA 5FUGA 3KXBD 5FI2A 4NK3A 2EX8A 3REIC 1P3OB 4D2OA 3FKVA 3LELB 5F99A 1LL9A 2RVQC 4DQYB 5M1AA 2OSUA 3REHA 1S32C 1P3AB 1IYQA 1QMFA 4P85A 1F66A 3AGEA 4LV3A 3UT9A 5B24B 3LZ1A 2DQNC 2AROD 5CERA 2JCHA 3MFDA 3GTCA 2CV5A 2WKHA 3MVDC 4MNRA 1K25A 4YM6C 3IF6B 3O86A 5B40C 2G5IC 3WA9D 5DNNA 4LV2A 4UUZB 1OMEA 5CHMA 1YMXA 3MGSA 4GHLA 3EPJA 1JFIA 2ZJ9A 4EBPA 5BO0A 4QHCA 5F1FA 4UHUA 1ZLAB 4J8UB 4KGCB 1XA7A 3FDDA 3VP1A 4ZUXB 1DJAA 3C4PA 3AZGC 4S2KA 4LENA 4OQHA 5E5AC 5CEDA 4H8RA 3RELA 2R9XA 4KUDD 1BH8B 4Y0TA 3EPLA 1SKFA 2NZDC 3BYDA 3W97B 1P3PA 5B0YA 5CPIA 4XZQB 3AZNB 5HAQA 5AVBA 1XX2A 2Y55A 5B1LB 3BFDA 5GSUA 4MEZA 1YLWA 3M2JA 2WAEA 5AV5A 4J8XB 4OPYA 3VFFA 4Z2MH 3WRZA 1ID3B 3WKJC 5A91A 1SCWA 1YU3A 1H8YA 4EO5B 4H9QA 1F1EA 5FQMA 2WK0A 3AYWD 4LV1A 2DCFA 4DKIA 3TU4C 1PZPA 3W99D 4CJNA 1WWIA 3AV1C 5GT0D 4G91C 3H0RC 3X1SB 4B88A 2HDSA 5CPJD 5EVID 3GSGA 3REIB 1AOIC 5B33C 1P3MC 3KFUG 4ZJ1A 3AZJD 1P3AA 3UTBD 3B6FC 4FCFA 1IKGA 2H0TA 1VM1A 3PBOA 5B24A 3KWQD 4PM6A 3IWIA 2XR0A 4KZ6A 4X55A 1S32B 5FQIA 3A1IA 3IH9A 3B0DC 1FCOA 1E3UA 1P3KC 1M18D 4J8WD 5GT3C 4S2IA 3MVDB 4IBDA 4YM6B 5DNMD 4CSRB 5C3IC 3PBSA 5TGFA 1TAFB 5B40B 3LZ0C 1TEMA 1W7FA 4QLCD 4Z5TC 3C5AA 4Y0UA 1GHPA 4YS3C 4ZJ2A 3V3SA 5GXQC 3KS4A 3L26A 3L28A 2HP9A 4S2MA 3WS1A 4J8VD 3VMAA 1ZLAA 1SDNA 1JWVA 4J8UA 4KGCA 5BNVB 2IO5C 2P74A 4BD1A 3C4OA 4E45A 1FQGA 3GMWA 3V9RB 1MKIA 4ZUXA 4OKPA 1U35D 4NYYA 3AZGB 3AZMC 4OONA 4DE1A 3X1UC 1BTLA 1ES3A 5E5AB 2RL3A 5GL9A 5CGXA 3V3RA 1CI8A 4XZQA 3AZNA 1MWSA 4LD9D 5B1LA 2NZDB 1P3ID 4ZAMA 1MY8A 3ZNYA 1YLPA 1HQ3C 3EQVA 1ID3A 5B0ZD 3AZED 4OJ6A 4RX2A 2XK1A 5CTMA 1YU4A 3PBRA 3G2YA 4WMCA 2H5SA 3WKJB 3MNNC 1JTGA 2AROC 3AGDA 3HUNA 4OJOA 3X1VD 2HPBA 3TU4B 3W96D 4UA9A 3AV1B 5CXWA 3REIA 3VOYA 1GHIA 4G91B 1L0EA 3AZFC 1H8ZA 3BLSA 5EOEA 1AOIB 2OV5A 4H9SA 5B33B 1P3MB 4EBLA 1S32A 2WKIA 3B6FB 4OUIA 5B1MC 4KENB 2HDQA 4E3IA 3TOIA 2Y2MA 1YQSA 4Z2MG 2FJ7A 4C75A 3MVDA 5B2ID 3B0DB 1EQZC 4YM6A 2G2WA 5GHYA 1P3KB 4YFMA 2W8SA 4PM8A 2Y2PA 5GT3B 4A5RA 3AZLD 4IBJA 3AV2A 3O62D 5C3IB 2ZY2A 2IWBA 3LZ0B 1M6KA 2ZY3A 4Z5TB 5E2HA 3ITBA 4YS3B 3MKEA 3G34A 5GXQB 1XPBA 4X23C 3NQUA 5BNVA 4MBKA 4E6XA 1P3GD 3V9RA 4EUZA 2XH9A 3LCEA 1NY0A 2IO5B 3NIAA 2ZC7A 5B31G 2F8NG 1N9BA 5JYOA 2HDUA 4MBHA 1P34A 3P09A 3IWQA 2F2AC 3HVFA 2EFXA 3AZGA 3BFGA 5DTKA 1L0FA 5E5AA 4IBGA 3W99C 3FKEA 3AZMB 1IELA 3N8RA 2NZDA 3X1UB 2VGJA 3W4PA 1JWZA 5CPJC 1NYYA 3SH9A 3UE1A 1NXYA 4H9RB 5AV9D 3UTBC 4U0XA 4Y0OA 3VFHA 1HQ3B 4XXRA 3WKJA 1P3LA 3M6BA 4KQOA 4KZ3A 1KX4D 5CP6D 4S2NA 5KDMB 3MNNB 2YFVA 4DE2A 1ES4A 2ZQAA 1KDSA 3TU4A 1RGYA 3WS4A 2AROB 3L25A 3AZKD 5EECA 3AV1A 3AN2D 1RP5A 2ZQDA 1U60A 5B32G 1BT5A 3CJMA 5JRGA 5DNMC 1HTZA 1ESIA 1AOIA 2JBFA 5B33A 1P3MA 1ES2A 4JKTA 4QLCC 3AZFB 3HLEA 1E25A 1MPLA 4EV4A 1DY6A 1KX3C 3FWLA 4JJNB 4OJ5A 2ZQ9A 1ERMA 4WU8D 2ZD8A 5B1MB 2Q9MA 4BL3A 3KUYD 3WWXA 1P3KA 4WELA 5FQ9A 2BLSA 3AFAD 2X71A 3AZHC 2ZQCA 1EQZB 1Y54A 3LZ0A 1BLCA 3ZFZA 4E3OA 4YS3A 2XEPA 2JSSA 3HSHA 4X23B 3X1TC 5CPKD 1P3FD 2Y59A 5AY8C 5B0ZC 3AZEC 2WGVA 3PBQA 4X68A 3B6GC 1Z6FA 3UTAC 3IXHA 5DF7A 3NBLA 3ZNTA 3AZIC 3AZMA 2PYOC 3X1UA 1YLYA 4BJPA 3RXXA 3IXBA 3W99B 1TZYD 5B31D 2F8ND 1B6WA 5A93A 1PW1A 4OVDA 3OPHA 4R4SA 1JVJA 2Y2GA 5FAOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4S2J A;  4H8R A;  3M2K A;  5CRF A;  5CED A;  1WYB A;  4HES A;  1MXO A;  2R9X A;  2XD5 A;  3ITA A;  1SHV A;  1SKF A;  3N8L A;  4K91 A;  4Y0T A;  2HDR A;  4OP5 A;  2PU4 A;  1BZA A;  1K56 A;  3BYD A;  3G2Z A;  3Q07 A;  4Z9Q A;  2FFF B;  1LI9 A;  3LEZ A;  4DDY A;  2WYX A;  4WBG A;  5HAQ A;  2WGW B;  1XX2 A;  2Y55 A;  2OLV A;  3BFD A;  4LV0 A;  4DRT A;  3M6H A;  4MEZ A;  5BOH A;  1YLW A;  3M2J A;  4U3T A;  2WAE A;  3FZC A;  1FR6 A;  4OQ0 A;  5GHZ A;  3BFE A;  1PZO A;  3PTE A;  4OPY A;  5E2G A;  1NJ4 A;  3VFF A;  2XGN A;  1FCM A;  3IHB A;  3WRZ A;  3HUM A;  2Z2M B;  5JYP A;  5A91 A;  2BG1 A;  2Y91 A;  4Y7P A;  2Y2K A;  1SCW A;  5EVL A;  3MKF A;  3HRE A;  1H8Y A;  1WE4 A;  1L0G A;  2QMI A;  2P9V B;  3GRJ A;  4IED A;  2WK0 A;  4KZ7 A;  4LV1 A;  4MLL A;  5FQM A;  1ZC2 A;  2DCF A;  4DXC A;  4OPR A;  4DKI A;  4E3J A;  3IXG A;  1ALQ A;  1PZP A;  4DE0 A;  3Q7Z A;  4KZB A;  4CJN A;  4E6W A;  1PWG A;  3C7U A;  1H5X A;  1LLB A;  3SS4 A;  4OPZ A;  4WZ5 A;  4EQI A;  5DF9 A;  3MXR A;  4N1X A;  5E2E A;  2XLN A;  4XUZ A;  2J9P A;  3ZGA B;  3IQA A;  4B88 A;  3DWK A;  5HAP A;  2HDS A;  1Q2P A;  4B4X A;  1W8Q A;  2Q9N A;  3GQZ A;  3Q81 A;  5EVI D;  2Y2J A;  3GSG A;  1HZO A;  3UPN A;  1K6S A;  2WAF A;  4ZJ1 A;  1BLS A;  2ZC4 B;  4RX3 A;  4JXW A;  2R9W A;  4KZ5 A;  4U0T A;  5FQK A;  3Q82 A;  4P6B A;  4E3K A;  4FCF A;  1IKG A;  2H0T A;  1VM1 A;  2WZX A;  4HBT A;  4KQR A;  3PBO A;  3HL9 A;  1YLZ A;  2XD1 A;  5J8X A;  4FSF A;  3BLM A;  4PM6 A;  3IWI A;  2XR0 A;  2HP5 A;  3IH8 A;  4KZ6 A;  4X55 A;  4C3Q A;  5CEC A;  1BLP A;  5FA7 A;  3OZH A;  1YLT A;  2H10 A;  4GD8 A;  5G18 A;  3SH8 A;  4QJG A;  3ZG5 A;  4QY6 A;  3G31 A;  5FQI A;  1CI9 A;  3CMZ A;  3UY6 A;  1IEM A;  2Z2L B;  4WM9 A;  4UAA A;  2XDM A;  3WS5 A;  5AQB A;  3IH9 A;  3OC2 A;  1BLH A;  4ZTK A;  3ZHH A;  4JPM A;  5FSR A;  1QME A;  1FCO A;  1E3U A;  1GCE A;  5FI7 A;  1C3B A;  3BFF A;  3VP0 A;  3WS0 A;  1EI5 A;  4GN2 A;  4S2I A;  1IYO A;  3PBS A;  2C5W B;  5TGF A;  2X01 A;  4PMA A;  3HLW A;  4N1H A;  1TEM A;  1W7F A;  1LL5 A;  3GR2 A;  3IXD A;  3S22 A;  3SS5 A;  1XGI A;  3C5A A;  3NCK A;  3OCL A;  3G32 A;  4EBN A;  4Y0U A;  1GHP A;  1BUL A;  3CZD A;  1K4F A;  4ZJ2 A;  2V2F F;  3V3S A;  4F94 A;  5M19 A;  4S2M A;  3VOZ A;  2HP9 A;  3WS1 A;  3A3I A;  3I7J A;  1XXM A;  3VMA A;  2ZQ8 A;  1MWU A;  3HLB A;  2H0Y A;  1JWP A;  3OPR A;  3Q1F A;  2WZZ A;  1SDN A;  3HLG A;  1JWV A;  4Q8I A;  4P87 A;  4IBX A;  2P74 A;  3W4Q A;  4BD1 A;  2EXA A;  3C4O A;  3ZVW A;  1ZKJ A;  1FQG A;  1K57 C;  4QU3 A;  3UE0 A;  2DRW A;  3GMW A;  4GDB A;  3VSL A;  5GLA A;  1MKI A;  4OKP A;  5FQJ A;  3NDE A;  1O07 A;  1TDL A;  3HUO A;  4OPQ A;  1K55 A;  5CGS A;  4R23 A;  3V50 A;  3WRT A;  4GDN A;  3B3X A;  4OON A;  4PM7 A;  4DE1 A;  4P0M A;  4S2O A;  2J7V A;  1DJB A;  3JYI A;  4FH2 A;  1BTL A;  5EE8 A;  3N8S A;  5EVI B;  5HW3 A;  2Y2L A;  1ES3 A;  2WAD A;  1I2W A;  2RL3 A;  5GL9 A;  5CGX A;  5FAP A;  2ZM8 A;  3V3R A;  4KZA A;  5GLD A;  1CI8 A;  2PBY A;  3UNW A;  1I2S A;  1MWS A;  2WGW A;  4OOY A;  3ZG8 B;  4PPR A;  1K55 C;  3G30 A;  1KVL A;  1MWT A;  3VP2 A;  2IWD A;  5EPH A;  4M3K A;  3A3F A;  1YT4 A;  3HLC A;  4ZAM A;  1HVB A;  4BL2 A;  1MY8 A;  3ZNY A;  1YLP A;  1WYC A;  3EQV A;  3PBT A;  1K38 A;  2C6W B;  1YMS A;  5M18 A;  3MXS A;  4RX2 A;  3V5M A;  3G4P A;  2CC1 A;  5IHV A;  2XK1 A;  4UA7 A;  5CTM A;  4WYY A;  3IHA A;  3PBR A;  3G2Y A;  3IT9 A;  2P9V A;  4WMC A;  2H5S A;  1ONH A;  5FI6 A;  3G35 A;  1JTG A;  2ZM0 A;  4WEK A;  3VSK A;  3AGD A;  3HUN A;  4KZ9 A;  2I72 A;  4YIN A;  4WZ4 A;  3O87 A;  2ZLY A;  1L0D A;  5A90 A;  1TDG A;  5FAQ A;  3ZDJ A;  2HPB A;  3NDG A;  4QY5 A;  5TFQ A;  1ZG4 A;  1O7E A;  4UA9 A;  3C7V A;  2XFS A;  2ZMA A;  3LO7 A;  1XA1 A;  3FKW A;  3QNC A;  5CXW A;  4ZJ3 A;  3VP3 A;  3BEB A;  3VOY A;  1FR1 A;  1GHI A;  3UDF A;  1L0E A;  3A3J A;  1H8Z A;  2J9O A;  3BLS A;  5D3O A;  1S0W A;  5EOE A;  4OP8 A;  3ZG7 B;  2OV5 A;  1PIO A;  1NRF A;  3D4F A;  4WZ5 C;  5EUA A;  4DE3 A;  4K0W A;  4EBL A;  4S2L A;  2WKI A;  4KG5 A;  3MZD A;  3FYZ A;  5A92 A;  4IVI A;  5HAR A;  3V39 A;  1J9M A;  4OLG A;  2J8Y A;  4OH0 A;  4KEN B;  1KVM A;  4IBR A;  2HDQ A;  4E3I A;  2WGI A;  3TOI A;  5EOO A;  2Y2M A;  4FH4 A;  4JBF A;  1YQS A;  2XF3 A;  2XFT A;  4NET A;  1KGF A;  3IF6 A;  1K56 D;  2QPN A;  1I5Q A;  2B5R A;  1BSG A;  4C75 A;  4HBU A;  2Y2Q A;  3QHY A;  4JF6 A;  4KZ8 A;  3P98 A;  1K54 A;  1M40 A;  1TVF A;  1FSW A;  2G2W A;  5GHY A;  2WKE A;  3Q7V B;  4YFM A;  2EX6 A;  1FOF A;  5FAT A;  2GDN A;  2HP6 A;  4PM8 A;  4EWF A;  2Y2P A;  1NZO A;  1PI4 A;  4R0Q A;  3SH7 A;  3ZG9 B;  4A5R A;  4OOL A;  4JF5 A;  5GHX A;  1E4D A;  1ES5 A;  4O7D A;  4WEJ A;  3IF6 C;  2IWB A;  4C6Y A;  3ISG A;  1M6K A;  2Y2N A;  3O3V A;  1KE4 A;  3BEC A;  1PWC A;  3OPL A;  2OLU A;  4R1G A;  5E2H A;  4BQM A;  3ITB A;  1MBL A;  3DWZ A;  3VP4 A;  5HX9 A;  3MKE A;  1ESU A;  3G34 A;  2EFU A;  5U47 A;  4GZB A;  3BRM A;  3FV7 A;  2FFY A;  1ERO A;  1XPB A;  4GD6 A;  4LCL A;  1AXB A;  2WUQ A;  4JXV A;  3W8K A;  4OQH A;  4QB8 A;  3QNB A;  4MBK A;  3NI9 A;  3UDI A;  4BLM A;  2EX9 A;  5KMW A;  4E6X A;  1IYP A;  4EUZ A;  4QD4 A;  2XH9 A;  3LCE A;  1W79 A;  1NY0 A;  1NZU A;  1RCJ A;  1G68 A;  2IWC A;  3NIA A;  5DTT A;  1GA0 A;  1SDE A;  1N9B A;  2ZC7 A;  5JYO A;  5AQA A;  2HDU A;  4MBH A;  1GHM A;  5FQQ A;  3MBZ A;  3P09 A;  3IWQ A;  2UWX A;  3ZCZ A;  3UPO A;  3HVF A;  3SOI A;  2EFX A;  2A3U A;  5KSC A;  3RXW A;  5F82 A;  1PYY A;  3BFG A;  3NC8 A;  5DTK A;  5EVI A;  2V1Z A;  1L0F A;  3PAG A;  4JXS A;  2JC7 A;  3ZVT A;  1CK3 A;  4RYE A;  4OOM A;  5DF8 A;  5CHU A;  1IEL A;  3N8R A;  2VGJ A;  1PWD A;  3N4I A;  1RGZ A;  2ZC3 B;  3IWO A;  5FAS A;  3W4P A;  1LI0 A;  3S1Y A;  1JWZ A;  1XKZ A;  5CEB A;  1NYY A;  1Q2Q A;  3EQU A;  4XUX A;  3SH9 A;  5AQ9 A;  1KGG A;  3UE1 A;  3RJU A;  1NXY A;  1E3U D;  4LCM A;  4GB7 A;  3DTM A;  3TSG A;  4U0X A;  4Y0O A;  3VFH A;  4R3J A;  4MBF A;  4R4R A;  4XXR A;  4X56 A;  1XP4 A;  5FDH A;  5GLB A;  5CTN A;  2ZC6 B;  3A3E A;  3M6B A;  3OPP A;  4UA6 A;  4KQO A;  4E3L A;  4KZ3 A;  1BUE A;  1JTD A;  1DJC A;  3E2K A;  3HLD A;  3UE3 A;  2XQZ A;  4S2N A;  1YM1 A;  4ZDX A;  5KZH A;  4DE2 A;  1VQQ A;  3SS3 A;  1L2S A;  1ES4 A;  5AQ7 A;  4GKU A;  2ZQA A;  2V20 A;  1KDS A;  2QZ6 A;  1RGY A;  1XGJ A;  3WS4 A;  5E2F A;  2DNS A;  1KGE A;  5EEC A;  1GA9 A;  4ZBE A;  1PW8 A;  1KDW A;  3HLF A;  3PAE A;  3UPP A;  5HL1 A;  2VGK A;  1RP5 A;  2ZM2 A;  3E2L A;  5KSH A;  3BFC A;  1LHY A;  2ZQD A;  1FCN A;  1IKI A;  1U60 A;  4X53 A;  1BT5 A;  3CJM A;  3NY4 A;  1HTZ A;  4S2N C;  1ESI A;  1W5D A;  2JBF A;  1ONG A;  3MZF A;  4L0L A;  1ES2 A;  4PM9 A;  2ZC5 B;  1CEG A;  4JKT A;  4DXB A;  4OLD A;  3HLE A;  4N9L A;  1E25 A;  4N92 A;  4KZ4 A;  1MPL A;  4EV4 A;  1DY6 A;  2E8I A;  5DTS A;  1KE3 A;  5FI2 A;  4NK3 A;  3FWL A;  2EX8 A;  4D2O A;  4IVK A;  3FKV A;  4DDS A;  4ID4 A;  2ZQ9 A;  5I94 A;  4GOG A;  1NYM A;  1S6R A;  1ERM A;  1LL9 A;  2ZD8 A;  3MZE A;  3N7W A;  5M1A A;  2OSU A;  3TG9 A;  4S2P A;  4BEN A;  2Q9M A;  5E43 A;  3GV9 A;  1IYQ A;  1QMF A;  4JLF A;  4K0X A;  4OQI A;  4P85 A;  4BL3 A;  2G2U A;  3AGE A;  3Q7V A;  3WWX A;  4WEL A;  5FQ9 A;  2BLS A;  3AGF A;  4LV3 A;  4N9K A;  5GLC A;  4DF6 A;  2X71 A;  2Y4A A;  2ZQC A;  3UDX A;  1CEF A;  4KG6 A;  1G6A A;  2ZQ7 A;  5CER A;  3ZG0 A;  2JE5 A;  3IF5 A;  5HAI A;  2JCH A;  1Y54 A;  1ZG6 A;  3OCN A;  4E3N A;  3MFD A;  1BLC A;  2Y2H A;  3ZFZ A;  4KG2 A;  1K4E A;  4E3O A;  3GTC A;  4OQG A;  1PI5 A;  2WKH A;  4CPK A;  4MNR A;  2XEP A;  4WMC D;  1K25 A;  1K6R A;  1K54 C;  3IF6 B;  3O86 A;  4JF4 A;  5HFO A;  4X69 A;  4LV2 A;  2RCX A;  3N6I A;  4X6T A;  1ERQ A;  3UO9 A;  1YLJ A;  3UN7 A;  5F1G A;  2EXB A;  4RVA A;  2Y2I A;  1OME A;  2Y2O A;  5CHM A;  3LY3 A;  4PM5 A;  1YMX A;  5DVA A;  4HEF A;  3WS2 A;  3CG5 A;  2ZJ9 A;  4FD8 A;  2Y59 A;  4KQQ A;  2WGV A;  5L2F A;  1K57 A;  4EBP A;  3PBQ A;  1MWR A;  1HD8 A;  2X02 A;  4RA7 A;  1KE0 A;  4X68 A;  3S4X A;  3LY4 A;  4QHC A;  5F1F A;  5TR7 A;  1Z6F A;  1W8Y A;  4UHU A;  1FSY A;  1N4O A;  3IXH A;  5DF7 A;  4B4Z A;  4E3M A;  3NBL A;  3ZNT A;  4GNU A;  5CGW A;  3O88 A;  4JXG A;  1YLY A;  4BJP A;  1XA7 A;  2A49 A;  3RXX A;  3IXB A;  3HBR A;  2EX2 A;  4R3B A;  3GVB A;  3VP1 A;  1IYS A;  3PBN A;  4BD0 A;  3A3D A;  1DJA A;  5A93 A;  3BM6 A;  3C4P A;  1EWZ A;  1PW1 A;  4OVD A;  4S2K A;  3OPH A;  4R4S A;  3DW0 A;  1JVJ A;  5EVI C;  2Y2G A;  4LEN A;  5F83 A;  5FAO A;  3W4O A;  2PU2 A;  5CHJ A; 
#chains in the Genus database with same CATH topology
 4S2J A;  5CPJ B;  1WYB A;  3MS6 A;  1HQ3 A;  1MXO A;  4O01 A;  3H7W A;  1SHV A;  4FOF A;  1M19 C;  2HDR A;  3MF0 A;  2PU4 A;  2LY8 A;  3G2Z A;  1UGU A;  2V8C A;  5AV8 C;  4Z9Q A;  2FFF B;  3UTB B;  3IX3 A;  2WYX A;  3REK D;  3CAX A;  1TS6 A;  1KOU A;  5KDM A;  3MNN A;  2OLV A;  1YAX A;  3FZC A;  4H6J B;  4OQ0 A;  4CLC B;  1PZO A;  4MCW A;  1M1A C;  2HIO C;  3IHB A;  3HUM A;  2Z2M B;  3WD4 A;  5JYP A;  4Y7P A;  2Y2K A;  1G28 A;  5AV6 C;  4HNB A;  5B2I C;  2IOU A;  1L0G A;  3KSF A;  4IED A;  4YNR A;  3AZF A;  5B2J D;  2JKT I;  3AZL C;  2O9C A;  3Q7Z A;  1KX5 D;  5DNM B;  1YPR A;  4KZB A;  1MC0 A;  3O62 C;  1ULY A;  3SS4 A;  4JJN A;  3WAA A;  3IQA A;  1KX3 B;  4B4X A;  3C1B D;  4R70 A;  3GQZ A;  2Q9N A;  5B1M A;  3W98 D;  1HZO A;  5B32 D;  4KZ5 A;  4E3K A;  4HBT A;  5J8X A;  1YLZ A;  2XD1 A;  3T50 A;  3BLM A;  3G6O A;  2PT7 A;  5CEC A;  1EQZ A;  5K5B A;  3OZH A;  4GD8 A;  3VH6 W;  3SH8 A;  3LYX A;  4QJG A;  3ZG5 A;  4H9P B;  4R8P A;  1CI9 A;  5JA4 B;  3AZH B;  1P3B C;  3WS5 A;  1PZR A;  1S1Z A;  3F1N B;  4NKP A;  4WV4 B;  4ZTK A;  3CUE A;  3MGQ D;  3MGR D;  3VP0 A;  3IBR A;  3WS0 A;  5F6A A;  4GN2 A;  1IYO A;  4HP9 A;  2X01 A;  5IT5 A;  4PMA A;  5LBR A;  4N1H A;  4X23 A;  1LL5 A;  3CZD A;  2V2F F;  5M19 A;  1MKM A;  2VEA A;  3VOZ A;  4KUO A;  3KSI A;  4F3L B;  3X1T B;  3A3I A;  5AY8 B;  5B0Z B;  3AZE B;  4H9O B;  3MQQ A;  1OTD A;  3OPR A;  3B6G B;  3Q1F A;  4XUJ C;  3REJ D;  3W4Q A;  2EXA A;  3UTA B;  4QU3 A;  2DRW A;  4I3I A;  4NE6 A;  3VSL A;  4Y13 A;  3AZI B;  3A6N C;  5F99 D;  2PYO B;  1O07 A;  3AN2 C;  4OPQ A;  3T4Q A;  4R23 A;  5HDD A;  3WTP A;  3LJA C;  2NQB C;  2YFW B;  3REH D;  3WRT A;  4P0M A;  2J7V A;  1F66 D;  3B42 A;  2Y2L A;  3UT9 D;  1I2W A;  1BH9 A;  1XFQ A;  3LZ1 D;  4IJG A;  5GLD A;  3UNW A;  1I2S A;  1M19 B;  4OOY A;  4PPR A;  1K55 C;  3G30 A;  2G7U A;  1KVL A;  3JPU A;  2IWD A;  3MXQ A;  5AV8 B;  4M3K A;  4H6J A;  1HTA A;  1N1J B;  1LSW A;  5EFW A;  1H3O B;  1NRJ A;  2FN2 A;  2CV5 D;  1WYC A;  3PBT A;  1YMS A;  2M7V A;  3V5M A;  3A1K A;  5IHV A;  3EPK A;  4UA7 A;  5DNN D;  4WYY A;  2VV8 A;  1M1A B;  2HIO B;  5G4Y A;  5FI6 A;  3AFA C;  5AV6 B;  4L9E A;  4WEK A;  4YIN A;  2I72 A;  3MFX A;  3MGS D;  1YU2 A;  1FIL A;  2PR5 A;  5A90 A;  5FAQ A;  4IBC A;  3AZL B;  1P3O A;  4QY5 A;  1O7E A;  1KX3 A;  3O62 B;  3LEL A;  3VP3 A;  2B02 A;  3UDF A;  3LIE A;  4Z66 C;  4UPK A;  2HGV A;  2VA0 A;  4DRA A;  4WZ5 C;  2F8N H;  3T1S A;  4S2L A;  5CPK C;  3VV4 A;  4KG5 A;  3MZD A;  4OH0 A;  5JA4 A;  3AZH A;  4IBK A;  2PR6 A;  1KVM A;  4IBR A;  5AVC C;  3F1N A;  2WGI A;  3REL D;  5FDS A;  1W1Y A;  4JBF A;  3T4J A;  2XF3 A;  2XFT A;  3U4L P;  3IF6 A;  4GCZ A;  1P3B B;  1P3P D;  5B0Y D;  4WU9 C;  2YKF A;  4KZ8 A;  5CPI D;  3CI6 A;  3WD2 A;  5AVB D;  1WWS A;  1N9N A;  3MGP C;  3LI9 A;  5GSU D;  4UUZ A;  1NZO A;  2W3F A;  1H8P A;  3B47 A;  3BWL A;  5AV5 D;  4H9N B;  3SH7 A;  4QWO A;  3T4S A;  1E4D A;  4WEJ A;  3SZT A;  4C6Y A;  3BY9 A;  1PWC A;  3X1T A;  2F8N K;  2OLU A;  4R1G A;  4BQM A;  1MBL A;  3DWZ A;  5AY8 A;  3VP4 A;  5HX9 A;  3VOL A;  2EFU A;  4H9O A;  3BRM A;  3FV7 A;  3B6G A;  1ERO A;  4GD6 A;  3QNB A;  3UDI A;  4BLM A;  3UTA A;  3C1C C;  1IYP A;  3VH5 W;  4XUJ B;  4QD4 A;  3AZI A;  4EEP A;  1NZU A;  1RCJ A;  1EAK A;  4GH9 A;  2PYO A;  2IWC A;  3F6T A;  3PYP A;  5DTT A;  5FQQ A;  3B0C T;  3ZCZ A;  4EET B;  5C5K A;  2A3U A;  2JKF A;  3RXW A;  5F82 A;  3A6N B;  1P3A D;  3AN2 B;  1BH8 A;  3NC8 A;  4CAY B;  3LJA B;  5B24 D;  2NQB B;  4RYE A;  3P01 A;  3W97 A;  5DF8 A;  4NZ4 A;  4KUK A;  1M19 A;  2E8J A;  1PWD A;  3KXB C;  4GHI B;  5AV8 A;  4GLQ A;  1H3O A;  4HGA C;  1N9O A;  1XKZ A;  5CEB A;  4J8X A;  1Q2Q A;  4XUX A;  3C1B C;  5AQ9 A;  5BT1 D;  3RJU A;  4LFU A;  4BMW A;  4E04 A;  1E3U D;  4LCM A;  4GB7 A;  3BJN A;  1M1A A;  2HIO A;  4R3J A;  4MBF A;  4R4R A;  4X56 A;  3DTE A;  5GLB A;  4IBI A;  4KHA B;  5CTN A;  1T19 A;  2ZC6 B;  4UA6 A;  5AV6 A;  1BUE A;  3EG5 B;  3E2K A;  3HLD A;  1YM1 A;  5KZH A;  3AFA B;  1BFM A;  1L2S A;  1O6I A;  4GKU A;  1XGJ A;  5E2F A;  4Y3I A;  3X1S A;  4ZBE A;  1PW8 A;  2GX5 A;  1XJ6 A;  2ZM2 A;  1ZLA D;  1LHY A;  3WA9 C;  4X53 A;  4J8U D;  4KGC D;  1W5D A;  1ONG A;  5MC7 A;  4PM9 A;  1CEG A;  4DXB A;  4OLD A;  4NYU A;  4Z66 B;  2V8F A;  3IP4 C;  1YU1 A;  4ZUX D;  1KE3 A;  1T18 A;  2OOL A;  3UME A;  3F1P B;  1DP6 A;  4GS9 A;  4IVK A;  5DFX A;  5CPK B;  1S6R A;  4HIA A;  2W1R A;  1P3B A;  3TG9 A;  4BEN A;  5AVC B;  4XZQ D;  3AZN D;  4JLF A;  5B1L D;  2G2U A;  4Z2G A;  3ZYT A;  4CSR A;  3AGF A;  1TAF A;  5B40 A;  4DF6 A;  2VK3 A;  4WU9 B;  1CEF A;  1LSX A;  2ZQ7 A;  3ZG0 A;  2JE5 A;  1CJF A;  5HAI A;  3MGP B;  1ID3 D;  3OCN A;  2PDR A;  2Y2H A;  4B9O A;  4KG2 A;  3LFV A;  4KUD C;  4WMC D;  1K6R A;  4JF4 A;  3S7Q A;  3LZ1 C;  4X6T A;  3H82 A;  3UO9 A;  4RVA A;  4XUJ A;  4PM5 A;  3LY3 A;  2K7S A;  5DVA A;  4DMZ A;  1XJ3 A;  2CV5 C;  3OOV A;  4LLO B;  4KQQ A;  3LIA A;  5L2F A;  3B0C W;  3REI D;  3C1C B;  4B93 A;  1J3W A;  1HD8 A;  2X02 A;  4RA7 A;  3S4X A;  3LY4 A;  3A6N A;  2RVQ D;  5TR7 A;  4CAY A;  1W8Y A;  5DJT A;  3AYW C;  1E15 A;  3LJA A;  2NQB A;  1NLZ A;  4B4Z A;  3D72 A;  1S32 D;  3CWF A;  2HV1 A;  5CGW A;  2D02 A;  4JXG A;  2A49 A;  4GHI A;  5GT0 C;  5BPV A;  4R3B A;  3GVB A;  1IYS A;  3A3D A;  3EEA A;  4RQ9 A;  3DW0 A;  3KXB B;  3L7H A;  5EVI C;  2PU2 A;  5AVF A;  5CHJ A;  4HGA B;  5CRF A;  3M2K A;  2FJ7 D;  5HDC A;  3AZJ C;  3MVD D;  3C1B B;  2XD5 A;  3N8L A;  4YM6 D;  4OP5 A;  5CX7 A;  1K56 A;  3Q07 A;  3KWQ C;  4Z1W A;  3N3F A;  2L1M A;  1LI9 A;  3LEZ A;  5IU1 A;  3AV2 D;  4MB3 A;  4JGP A;  3M6H A;  1H8M A;  2RIQ A;  2ZL1 B;  4U3T A;  1FR6 A;  3BFE A;  3KSY A;  3PTE A;  5E2G A;  5G49 B;  2XGN A;  3L29 A;  2QKP A;  1S4R A;  1P3P C;  1M18 C;  4MB4 A;  2V0U A;  4J8W C;  4QNL A;  1WE4 A;  1E6N A;  2QMI A;  3GRJ A;  4MLL A;  4KZ7 A;  5GSU C;  2RTS A;  1ZC2 A;  4OPR A;  3WA9 B;  4Z66 A;  2OAP 1;  4Y17 A;  3B6F A;  4E6W A;  2O9B A;  1OT6 A;  3C7U A;  1P34 D;  4OPZ A;  2PRF A;  4WZ5 A;  5DF9 A;  2DF4 C;  3P5J B;  2M7U A;  3AZG D;  1Q2P A;  4HP4 A;  4D60 A;  4J8V C;  1W8Q A;  2Y2J A;  4IJE A;  1CXW A;  1K6S A;  5E5A D;  5AVC A;  4O0P A;  2WKR A;  2R9W A;  4U0T A;  5FQK A;  3Q82 A;  4P6B A;  1STZ A;  2WZX A;  2NZD D;  4KQR A;  3HL9 A;  1UWP X;  4FSF A;  1G6O A;  2HP5 A;  4WU9 A;  1BLP A;  4EEU A;  5GT3 A;  1YLT A;  2H10 A;  2V5O A;  3VH6 T;  3MGP A;  1PRQ A;  3UY6 A;  1IEM A;  1AWI A;  4WM9 A;  1U35 C;  2OWH A;  3L27 A;  2XDM A;  4UAA A;  2FZ0 A;  4YOF A;  4Z5T A;  2ZY5 A;  3ZHH A;  3WKJ D;  1QME A;  1P3L D;  5FI7 A;  3BFF A;  5GXQ A;  5BS7 C;  1S4S A;  4ARZ B;  1EI5 A;  2G5H C;  4KUD B;  3CHW P;  3KSH A;  4LD9 C;  1LL8 A;  1P3I C;  3HLW A;  3LZ1 B;  3TU4 D;  3IXD A;  3SS5 A;  1XGI A;  3G32 A;  3AV1 D;  1BUL A;  3UB8 A;  1K4F A;  3WD3 A;  3C1C A;  2CV5 B;  3FG8 A;  1OPX A;  5JRG D;  1XXM A;  1AOI D;  1MWU A;  5B33 D;  1P3M D;  1JWP A;  2BYK B;  2WZZ A;  4Q8I A;  3LR0 A;  5L07 A;  3AYW B;  2HUE C;  3X1V C;  1K57 C;  3UE0 A;  4GDB A;  3W96 C;  5FQJ A;  2WKP A;  3V67 A;  2BTF P;  2PAV P;  1TDL A;  3KXB A;  5GT0 B;  3V50 A;  4OJP A;  4H9R A;  1V9Y A;  1YU0 A;  4WLA A;  1B67 A;  4PM7 A;  5EE8 A;  4FH2 A;  1DJB A;  5EVI B;  1F5M A;  2UV0 E;  3T1X A;  1P3K D;  3N8S A;  2W3H A;  3IS2 B;  2WAD A;  5FAP A;  3AZJ B;  4KZA A;  2PBY A;  4HJ6 A;  3ZG8 B;  5IS1 A;  2ZL1 A;  3LZ0 D;  3KWQ B;  2XSS A;  5EPH A;  4BL2 A;  4Z5T D;  1HVB A;  5HWT A;  2ARO A;  1F2K A;  2DMW A;  4YS3 D;  3LIB A;  1QO6 A;  2CC1 A;  3E0Y A;  2W1T A;  2MJ6 A;  3IHA A;  1W63 M;  1ONH A;  3FPW A;  2ZM0 A;  1D7E A;  3WA9 A;  1M18 B;  4J8W B;  2VKS A;  1HLU P;  2W3G A;  3VSK A;  4KZ9 A;  3KYZ A;  1A7W A;  4EXO A;  3M7P A;  3B33 A;  2ZLY A;  3O87 A;  5TBM B;  5GSU B;  4IBF A;  2OAQ 1;  5FL3 A;  4QLC B;  3C7V A;  2ZMA A;  3LO7 A;  3QNC A;  3BEB A;  3A3J A;  2J9O A;  1T1C A;  1F98 A;  3AZM D;  3KO6 A;  5D3O A;  1S0W A;  4J8V B;  3X1U D;  1VB6 A;  1PIO A;  3D4F A;  5HWW A;  3ZQ5 A;  1P3G C;  5EUA A;  4DE3 A;  3LI8 A;  2J8P A;  4K0W A;  1H0I A;  1OTI A;  1PNE A;  3FYZ A;  5A92 A;  1J9M A;  4OLG A;  2J8Y A;  4NE3 A;  1NWZ A;  3LR4 A;  1HQ3 D;  5EOO A;  3NHQ A;  4FH4 A;  4NET A;  4H9S C;  2HJ9 C;  1KGF A;  1P0Z A;  1U35 B;  2QPN A;  4ARZ A;  2Q0O A;  1EW0 A;  1T1A A;  2B5R A;  1FIK A;  4KUD A;  3W2Z A;  3P98 A;  3MNN D;  1FSW A;  2D01 A;  2WKE A;  3Q7V B;  1FOF A;  5FAT A;  2GDN A;  2PBD P;  5I5L A;  4EWF A;  1OGG A;  1PI4 A;  1CF0 A;  4HMD A;  4I39 A;  4LD9 B;  3RH8 B;  2V1A A;  4Q0J A;  5GHX A;  1P3I B;  3R7W A;  4NZ1 A;  3BEC A;  2FJ7 C;  5AV9 C;  5HWV A;  1ESU A;  5U47 A;  2P08 A;  2BYK A;  4LCL A;  3AZF D;  1AXB A;  2WUQ A;  1KX4 C;  4JXV A;  1LSV A;  4QB8 A;  3AV2 C;  5CP6 C;  3AYW A;  3LUQ A;  2EX9 A;  4JJN D;  3WAA D;  3VH5 T;  3W99 A;  1G68 A;  3AZK C;  1GA0 A;  1SDE A;  2HUE B;  5GT0 A;  3X1V B;  2PD8 A;  3MBZ A;  4NXB A;  2UWX A;  5B1M D;  3W96 B;  5KSC A;  1TS0 A;  1PYY A;  5CPJ A;  1E88 A;  5EVI A;  2V1Z A;  4Z2K A;  3IS2 A;  3AZJ A;  5G4Z A;  4L9G A;  1UWN X;  3UTB A;  1EQZ D;  4NXF A;  5CHU A;  1P34 C;  3N4I A;  3IWO A;  5DKK A;  4R8P D;  3T4K A;  3KWQ A;  5HZH A;  1LI0 A;  2P04 A;  4CLC A;  3EQU A;  3K2N A;  1KGG A;  4ME4 A;  4WU8 C;  1WA9 A;  4DJ2 A;  4ZBJ C;  4IBB A;  3KUY C;  3LR3 A;  3OPP A;  4EQ1 A;  4E3L A;  1M18 A;  4J8W A;  4X23 D;  1JTD A;  5J4E A;  5B2I B;  5TBM A;  2XQZ A;  5DNM A;  3UE3 A;  1VQQ A;  4HJ3 A;  2V20 A;  4NEE D;  4QLC A;  4L9F A;  2DNS A;  1GA9 A;  4GJ4 A;  5EVE A;  4MB5 A;  1KDW A;  3PAE A;  3UPP A;  5HL1 A;  1P3L C;  2VGK A;  1T3U A;  5KSH A;  2XRN A;  3BFC A;  1IKI A;  2CWE A;  4J8V A;  4S2N C;  4L0L A;  3MZF A;  3NJA A;  4HI4 A;  4KZ4 A;  4PHT A;  4AWL C;  2E8I A;  3WTP E;  4PKY G;  1P3F C;  3IX4 A;  4H9P A;  4TX8 A;  1P3G B;  3WTP D;  2Z6C A;  4DDS A;  4ID4 A;  3L2A A;  5I94 A;  5JRG C;  4GOG A;  1NYM A;  2Y8H A;  3T12 B;  3MZE A;  3N7W A;  1U35 A;  4S2P A;  5E43 A;  3GV9 A;  4K0X A;  4OQI A;  3Q7V A;  4EER A;  5BS7 A;  2J3T D;  4N9K A;  5GLC A;  4LRY C;  2Y4A A;  1TZY C;  3UDX A;  4KG6 A;  1G6A A;  5B31 C;  4LD9 A;  3IF5 A;  1P3I A;  1ZG6 A;  4E3N A;  2BYM B;  3DBA A;  1K4E A;  4OQG A;  1PI5 A;  4F3L A;  4CPK A;  5B0Z A;  3AZE A;  1K54 C;  3SW1 A;  2JN7 A;  5HFO A;  4DJ3 A;  2FJ7 B;  4X69 A;  3NOU C;  2ZBB A;  5AV9 B;  2RCX A;  3N6I A;  3REK C;  1ERQ A;  1YLJ A;  3UN7 A;  5F1G A;  2EXB A;  2Y2I A;  1KX4 B;  1P3O D;  2Y2O A;  4LGW A;  2O9A A;  3AV2 B;  4HEF A;  1KX3 D;  3CG5 A;  4UEY A;  3NUL A;  3WS2 A;  5CP6 B;  4FD8 A;  3LEL D;  1R4V A;  4R3A A;  3X1V A;  1K57 A;  1MWR A;  2W0N A;  3W96 A;  1KE0 A;  5F69 A;  1K0K A;  3AZK B;  4NZ3 A;  5L10 A;  4KQD A;  3UB9 A;  2YFW A;  3KS8 A;  4JGO A;  3UB6 A;  1OT9 A;  5AJG A;  1FSY A;  1N4O A;  3NQU B;  4E3M A;  5B2J C;  4GNU A;  1KX5 C;  3O88 A;  4MN6 A;  2L5A A;  1XJ4 A;  2EX2 A;  3HBR A;  3AZH D;  3PBN A;  4BD0 A;  1N1J A;  3BM6 A;  4PKY A;  1EWZ A;  1P34 B;  3W98 C;  3W4O A;  1L6J A;  5F83 A;  3T1Q B;  3JVU A;  1TD5 A;  5B32 C;  4HES A;  5DFY A;  3ITA A;  4K91 A;  4WU8 B;  1BZA A;  5F68 A;  4NXG A;  4ZBJ B;  2O99 A;  4Z2H A;  4DDY A;  5B2I A;  4WBG A;  2WGW B;  3KUY B;  4LV0 A;  4GW9 A;  4DRT A;  5BOH A;  4O8G A;  3AZL A;  3X1T D;  5GHZ A;  2LB5 A;  4JGR A;  1NJ4 A;  3ULF A;  5AY8 D;  3O62 A;  3MR0 A;  1FCM A;  2W3D A;  1E6R A;  2BG1 A;  3MGQ C;  2JKG A;  2Y91 A;  3MGR C;  2VJW A;  3B6G D;  5EVL A;  3MKF A;  3HRE A;  1Z09 A;  1DRM A;  5BNX B;  1P3L B;  2HJE A;  2P9V B;  3UTA D;  4HJ4 A;  2NUP C;  4DXC A;  2W3E A;  4E3J A;  3EGX C;  3IXG A;  3AZI D;  1ALQ A;  4DE0 A;  3R4K A;  2PYO D;  1PWG A;  2YFV B;  4Q0H A;  1H5X A;  1LLB A;  1P3G A;  4EQI A;  3MXR A;  4N1X A;  5E2E A;  2XLN A;  4XUZ A;  2J9P A;  3ZGA B;  2A24 B;  4AWL B;  3UB7 A;  3DWK A;  5HAP A;  1P3F B;  3Q81 A;  3UPN A;  1OJG A;  4LPZ A;  2WAF A;  1BLS A;  4UQI M;  2ZC4 B;  4RX3 A;  3W97 D;  5JRG B;  4JXW A;  3REJ C;  3VH6 A;  1YKD A;  1M19 D;  1W1V A;  3L9K A;  4JJN C;  3R45 B;  4HME A;  1AIW A;  3WAA C;  5AV8 D;  3IH8 A;  4C3Q A;  5EV0 A;  5FA7 A;  2ZY4 A;  5G18 A;  4H9N A;  4J8X D;  5F99 C;  4QY6 A;  3G31 A;  3EPH A;  3CMZ A;  2BYM A;  4G92 C;  2Z2L B;  1TZY B;  4NFT A;  5B31 B;  2F8N B;  1M1A D;  5AQB A;  2HIO D;  3REH C;  3OC2 A;  1BLH A;  4JPM A;  5FSR A;  1F66 C;  3QP2 A;  1GCE A;  1C3B A;  5AV6 D;  4IBE A;  3UT9 C;  5AV9 A;  4DN0 A;  2XA7 M;  4R8P C;  2C5W B;  3WD1 A;  2J80 A;  1KX4 A;  3GR2 A;  3S22 A;  2EWV A;  3NCK A;  3OCL A;  3REK B;  4ESP A;  5CP6 A;  4EBN A;  3X1S D;  3CUE C;  4F94 A;  2ZM5 A;  1W1P A;  3AZK A;  5DNN C;  3I7J A;  2PYR A;  1VET B;  3AN2 A;  2ZQ8 A;  4BBV A;  1JNU A;  3HLB A;  2H0Y A;  2LB9 A;  5HSQ A;  3HLG A;  4P87 A;  4IBX A;  3MGS C;  1W2E A;  2GNX A;  3ZVW A;  1ZKJ A;  2QWS A;  1S67 L;  5B2J B;  5GLA A;  2YKH A;  3S7P A;  1KX5 B;  3NDE A;  1A0K A;  3HUO A;  4EUV A;  1K55 A;  5CGS A;  4X25 A;  1P3B D;  4GDN A;  3B3X A;  4WU8 A;  4S2O A;  3JYI A;  5HW3 A;  3C8C A;  4KHA A;  3W98 B;  5CHL B;  5B40 D;  5B32 B;  2ZM8 A;  4Z2I A;  3GDI A;  2WGW A;  3KUY A;  2VX8 A;  4WNN B;  4NZ5 A;  4LG2 A;  2W27 A;  1MWT A;  3AFA A;  3VP2 A;  3WTP C;  3A3F A;  1YT4 A;  3HLC A;  3OBF A;  3REL C;  4IUK A;  1K38 A;  2C6W B;  5M18 A;  3MXS A;  3G4P A;  1H0G A;  1IOU A;  5B0Y C;  5BNX A;  3K3D A;  5CPI C;  3IT9 A;  2P9V A;  2KLI A;  5DJU A;  3MGQ B;  5AVB C;  2J3T C;  3MGR B;  1D1J A;  3G35 A;  5AVE A;  1YSQ A;  3CIT A;  4XUJ D;  3B0B A;  3EEH A;  5AV5 C;  4WZ4 A;  3H0M C;  1W1T A;  1L0D A;  3BY8 A;  3KYE A;  1TDG A;  1Q9C A;  2KDK A;  3ZDJ A;  3RFB A;  4IJF A;  3NDG A;  3F1P A;  3HON A;  2A24 A;  3NQJ B;  1ZG4 A;  5TFQ A;  2XFS A;  3A6N D;  5CPK A;  1P3F A;  1OGB A;  1XA1 A;  3FKW A;  4ZJ3 A;  1P97 A;  1FR1 A;  3LJA D;  2NQB D;  3BW6 A;  1CQA A;  4JGQ A;  2INW A;  4OP8 A;  3ZG7 B;  4HY8 A;  3R45 A;  4YWZ A;  1S1Y A;  1NRF A;  2V9A A;  1P3O C;  3H9W A;  3REJ B;  2VGL M;  3LEL C;  4OJL A;  2QJ7 A;  1GPF A;  5FUG B;  3WAA B;  2ZMF A;  4IVI A;  4Q0I A;  5HAR A;  3V39 A;  4BWI A;  1TZY A;  4DRB A;  5B31 A;  2F8N A;  4I3J A;  3IX8 A;  5F99 B;  1P3A C;  1YUE A;  5F5Y A;  4G92 B;  3AL0 C;  1J7M A;  1K56 D;  4XT2 B;  5B24 C;  1I5Q A;  1BSG A;  3REH B;  2Y2Q A;  3QHY A;  4HBU A;  4JF6 A;  1K54 A;  1M40 A;  1TVF A;  5HPF A;  1F66 B;  2EX6 A;  3UT9 B;  2HP6 A;  3C30 A;  4E44 A;  2R78 A;  1T1B A;  3REK A;  4R0Q A;  3WX7 A;  1ED7 A;  3ZG9 B;  1IFQ A;  4NE5 A;  4OOL A;  4R8P B;  4JF5 A;  2B95 A;  5BT1 C;  4WN5 A;  1ES5 A;  4O7D A;  3C38 A;  3IF6 C;  3ISG A;  3O3V A;  2Y2N A;  1KE4 A;  3OPL A;  2KOI A;  5HD3 A;  1OTA A;  2VQR A;  5TJJ A;  4GZB A;  2FFY A;  3VH5 A;  3W8K A;  5DNN B;  3MJQ A;  4Z66 D;  1GXD A;  4Z2L A;  3NI9 A;  3B6F D;  5KMW A;  5B2J A;  1W79 A;  1KX5 A;  3MGS B;  1JFI B;  5AQA A;  1GHM A;  3UPO A;  1KU5 A;  3SOI A;  5BO0 B;  1ZLA C;  3TW8 A;  5AVC D;  3H0L C;  3FC7 A;  3DAV A;  3VE3 A;  2JKR I;  4J8U C;  3C1B A;  4KGC C;  1W63 Q;  3W98 A;  1G5U A;  2VV6 A;  3PAG A;  4JXS A;  2JC7 A;  3ZVT A;  5B32 A;  1CK3 A;  4M6B A;  4OOM A;  4WU9 D;  3K3C A;  4NY2 A;  1SKO B;  1VEU B;  5GT3 D;  4ZUX C;  4WNN A;  3C2W A;  3MGP D;  1N9L A;  1RGZ A;  2ZC3 B;  5FAS A;  3S1Y A;  4LRX C;  4IUH A;  3GEC A;  5G49 A;  3WTP B;  1Z2C B;  5GXQ D;  3W97 C;  3DTM A;  3TSG A;  1GOI A;  3WD0 A;  3REL B;  4XZQ C;  1XP4 A;  3AZN C;  5FDH A;  3MGQ A;  4WJ3 C;  3A3E A;  3MGR A;  5B1L C;  2V1B A;  1BH9 B;  1P3P B;  5B0Y B;  3D9Y A;  1DJC A;  4J8X C;  5CPI B;  1NLY A;  4ZDX A;  3PR6 A;  5AVB B;  4P6Z M;  3SS3 A;  5AQ7 A;  1ID3 C;  3C1C D;  2QZ6 A;  3DTK A;  1KS0 A;  3NQJ A;  1KGE A;  5AV5 B;  4EO5 C;  3TE8 A;  3HLF A;  3E2L A;  4Z2J A;  4GHA A;  5A8B A;  1ODV A;  3CPT B;  1FCN A;  2GZA A;  3EGD C;  4WZS B;  3NY4 A;  2NUT C;  4H9Q B;  2ZC5 B;  4N9L A;  3MQL A;  4N92 A;  3REJ A;  4NXE A;  3X1S C;  5DTS A;  5FUG A;  3KXB D;  5FI2 A;  4NK3 A;  2EX8 A;  3REI C;  1P3O B;  4D2O A;  1DP9 A;  3UB5 P;  4ETX A;  3FKV A;  1XJ2 A;  3LEL B;  5F99 A;  1LL9 A;  2RVQ C;  4DQY B;  5M1A A;  2OSU A;  4XT2 A;  3LIC A;  3REH A;  1OJ5 A;  3LGO A;  1S32 C;  1P3A B;  3BQA A;  1IYQ A;  1QMF A;  4P85 A;  1F66 A;  3AGE A;  2PD7 A;  3UT9 A;  4LV3 A;  3VE4 A;  5B24 B;  3LEQ A;  3KYQ A;  3LZ1 A;  2DQN C;  2ARO D;  5CER A;  2JCH A;  3MFD A;  1L3L A;  3GTC A;  4EES A;  2CV5 A;  2WKH A;  3MVD C;  4MNR A;  1K25 A;  4YM6 C;  3IF6 B;  3O86 A;  5B40 C;  2G5I C;  3WA9 D;  5DNN A;  4I38 A;  4LV2 A;  1GSW A;  3KSG A;  4UUZ B;  4I3A A;  1OME A;  5CHM A;  1Y28 A;  1YMX A;  3MGS A;  4GHL A;  3EPJ A;  1JFI A;  2ZJ9 A;  4EBP A;  1PDC A;  2WKQ A;  3UMD A;  5BO0 A;  4BBU A;  4Y5F A;  4QHC A;  1TS7 A;  1P9R A;  5F1F A;  5FEG A;  3NOP C;  2QJ5 A;  1UR8 A;  4UHU A;  3T4L A;  4K08 A;  1XFN A;  1ZLA B;  3QP1 A;  1OTB A;  1SKO A;  1VEU A;  4J8U B;  4KGC B;  3LIF A;  1XA7 A;  3FDD A;  3VP1 A;  1YSP A;  4ZUX B;  1DJA A;  3C4P A;  3AZG C;  1ZTU A;  4S2K A;  4EW7 A;  4LEN A;  4HH2 A;  4OQH A;  5E5A C;  2O0Y A;  5CED A;  4H8R A;  3REL A;  2R9X A;  4KUD D;  1BH8 B;  4Y0T A;  3EPL A;  1SKF A;  2NZD C;  3QP8 A;  5L8M A;  3BYD A;  3W97 B;  1P3P A;  5B0Y A;  5CPI A;  4XZQ B;  3AZN B;  5HAQ A;  5AVB A;  1XX2 A;  2Y55 A;  5B1L B;  2ZMV A;  3BFD A;  3U2A A;  5GSU A;  4MEZ A;  1YLW A;  3M2J A;  2WAE A;  4MDZ A;  1SZV A;  5AV5 A;  4J8X B;  4OPY A;  3VFF A;  4Z2M H;  3WRZ A;  1ID3 B;  3WKJ C;  5A91 A;  3CPT A;  1SCW A;  1YU3 A;  1H8Y A;  4EO5 B;  2K2N A;  2HZ5 A;  4H9Q A;  1F1E A;  5FQM A;  2WK0 A;  3AYW D;  4LV1 A;  3E4O A;  2DCF A;  4DKI A;  1ZHH B;  4LRZ E;  3TU4 C;  1PZP A;  3W99 D;  4X1L A;  4CJN A;  1WWI A;  3AV1 C;  3QP5 A;  5HD5 A;  5GT0 D;  1F9I A;  4ETZ A;  4G91 C;  3H0R C;  3X1S B;  4B88 A;  2HDS A;  5CPJ D;  1P9W A;  5EVI D;  3GSG A;  3REI B;  1AOI C;  5B33 C;  1P3M C;  3KFU G;  4ZJ1 A;  4I5S A;  3AZJ D;  2I9V A;  3LR5 A;  1P3A A;  3UTB D;  3B6F C;  4FCF A;  1IKG A;  2H0T A;  1VM1 A;  3PBO A;  4NG2 A;  5B24 A;  4CLC E;  3KWQ D;  4PM6 A;  3IWI A;  2XR0 A;  4KZ6 A;  4X55 A;  2FH5 A;  1S32 B;  1E6P A;  4CLC D;  1D06 A;  5FQI A;  3T4T A;  4GS9 B;  4R38 A;  3A1I A;  3P7N A;  2D49 A;  3IH9 A;  3O5Y A;  4HHD A;  3QP6 A;  3B0D C;  4G3K A;  4WL9 A;  4G3V A;  4EU0 A;  3TRC A;  1FCO A;  1E3U A;  1P3K C;  1M18 D;  2Y79 A;  4J8W D;  2VZW A;  2JHE A;  5GT3 C;  4S2I A;  3MVD B;  3MQ0 A;  4IBD A;  2A2L A;  4UQI S;  4YM6 B;  5DNM D;  4CSR B;  5C3I C;  3PBS A;  5TGF A;  1TAF B;  5B40 B;  3LZ0 C;  1TEM A;  1W7F A;  4QLC D;  4Z5T C;  3C5A A;  4Y0U A;  1GHP A;  4YS3 C;  4ZJ2 A;  3V3S A;  5GXQ C;  3KS4 A;  3L26 A;  3L28 A;  2HP9 A;  4S2M A;  3WS1 A;  4BBT A;  4J8V D;  3VMA A;  1ZLA A;  1SDN A;  1JWV A;  3BQ8 A;  4J8U A;  3H82 B;  4KGC A;  5BNV B;  2IO5 C;  2P74 A;  4BD1 A;  1E6Z A;  3C4O A;  5DKL A;  4E45 A;  1FQG A;  4FUW A;  2XA7 S;  3GMW A;  1TS8 A;  4HQA A;  3V9R B;  5J7E A;  1MKI A;  4ZUX A;  4OKP A;  4Y2F A;  2VV7 A;  3EWK A;  3S7O A;  1U35 D;  1GSX A;  4WF0 A;  4NYY A;  3PHY A;  3AZG B;  3AZM C;  4OON A;  4DE1 A;  3X1U C;  1BTL A;  1H0M A;  1ES3 A;  5E5A B;  2RL3 A;  5GL9 A;  4MN7 A;  5CGX A;  4HMC A;  3V3R A;  1X0O A;  1CI8 A;  4XZQ A;  3AZN A;  1MWS A;  4LD9 D;  5B1L A;  2NZD B;  1P3I D;  3IBJ A;  3QP4 A;  4ZAM A;  3OLO A;  5L09 A;  1MY8 A;  2P7J A;  3ZNY A;  1ACF A;  1YLP A;  1HQ3 C;  3EQV A;  1ID3 A;  5B0Z D;  3AZE D;  4OJ6 A;  3T4O A;  3ICY A;  4RX2 A;  2ZOH A;  2XK1 A;  5CTM A;  1YU4 A;  3PBR A;  3G2Y A;  4WMC A;  2H5S A;  3WKJ B;  3MNN C;  1JTG A;  2ARO C;  3AGD A;  3HUN A;  4OJO A;  2K31 A;  3X1V D;  3HCY A;  5FEF A;  2HPB A;  3TU4 B;  3W96 D;  4UA9 A;  3E4P A;  3E98 A;  3F1O B;  3HJK A;  3AV1 B;  3PXP A;  5CXW A;  3REI A;  2AVX A;  3VOY A;  3KX0 X;  1GHI A;  4G91 B;  1L0E A;  3AZF C;  1H8Z A;  2B18 A;  3BLS A;  5EOE A;  1AOI B;  2OV5 A;  4H9S A;  1OTE A;  5B33 B;  1P3M B;  2JKR M;  4QPR A;  4EBL A;  1S32 A;  2WKI A;  3B6F B;  4IHQ A;  3NEC A;  5HL6 A;  5HPI A;  4OUI A;  5B1M C;  4KEN B;  3UE6 A;  4M4X A;  2V0W A;  2HDQ A;  4E3I A;  3TOI A;  2Y2M A;  3MQO A;  1YQS A;  1UR9 A;  4Z2M G;  2FJ7 A;  4C75 A;  3MVD A;  5B2I D;  3B0D B;  1EQZ C;  4YM6 A;  2G2W A;  5GHY A;  3MMH A;  1P3K B;  4YFM A;  2W8S A;  4PM8 A;  2Y2P A;  4X1M A;  5GT3 B;  4A5R A;  3AZL D;  4IBJ A;  3AV2 A;  3O62 D;  5C3I B;  2ZY2 A;  2VGL S;  2IWB A;  3LZ0 B;  1M6K A;  2ZY3 A;  4Z5T B;  5E2H A;  3ITB A;  4YS3 B;  3S7N A;  3MKE A;  3G34 A;  5GXQ B;  2IA2 A;  1XPB A;  4ZRR A;  4X23 C;  3NQU A;  5BNV A;  4MBK A;  1PFL A;  1LT0 A;  4E6X A;  1P3G D;  3V9R A;  4EUZ A;  2XH9 A;  3LCE A;  1NY0 A;  2IO5 B;  1CK7 A;  2JKT M;  2PYP A;  3NIA A;  2ZC7 A;  5J3W A;  5B31 G;  2F8N G;  1N9B A;  5JYO A;  2HDU A;  4MBH A;  1P34 A;  3P09 A;  3RTY A;  3IWQ A;  2F2A C;  3HVF A;  2EFX A;  3AZG A;  3BFG A;  5DTK A;  1L0F A;  5E5A A;  4IBG A;  3W99 C;  4II7 A;  3FKE A;  3AZM B;  1IEL A;  3N8R A;  2GJ3 A;  2NZD A;  3X1U B;  2VGJ A;  1E8B A;  4AFI A;  3W4P A;  4HH3 A;  1JWZ A;  3JVV A;  5CPJ C;  1NYY A;  3SH9 A;  1MZU A;  3UE1 A;  1NXY A;  4H9R B;  2ACG A;  5AV9 D;  3UTB C;  4U0X A;  4Y0O A;  3VFH A;  4Y15 A;  1HQ3 B;  4XXR A;  3H7W B;  3WKJ A;  1P3L A;  3M6B A;  4KQO A;  3TJZ C;  2EA9 A;  4KZ3 A;  1KX4 D;  1VHM A;  3T1R A;  3CLO A;  4CLC C;  5CP6 D;  4PAU A;  4S2N A;  5KDM B;  3MNN B;  2YFV A;  3MSH A;  4DE2 A;  1ES4 A;  2ZQA A;  1KDS A;  3TU4 A;  1RGY A;  3WS4 A;  2ARO B;  3FPV A;  3F1O A;  3L25 A;  3AZK D;  5EEC A;  3AV1 A;  3AN2 D;  1RP5 A;  2ZQD A;  2W1T B;  1U60 A;  5B32 G;  1BT5 A;  2J3W A;  5JRG A;  3CJM A;  5DNM C;  1HTZ A;  1ESI A;  1AOI A;  2JBF A;  5B33 A;  1P3M A;  1ES2 A;  4JKT A;  4QLC C;  3AZF B;  3HLE A;  1E25 A;  1MPL A;  4EV4 A;  1DY6 A;  3HJI A;  1KX3 C;  1H3Q A;  3FWL A;  4JJN B;  2L4R A;  4OJ5 A;  4P6Z S;  2ZQ9 A;  1ERM A;  4WU8 D;  2ZD8 A;  2QHK A;  5B1M B;  2Q9M A;  4G3W A;  1TF1 A;  2H28 A;  4BL3 A;  3A0V A;  3KUY D;  3WWX A;  1P3K A;  4WEL A;  5FQ9 A;  5EM0 A;  2BLS A;  3AFA D;  3EOI A;  2X71 A;  3AZH C;  2ZQC A;  3D3O A;  1EQZ B;  2VLG A;  2CMN A;  2HF6 A;  1Y54 A;  2PHY A;  4HOI A;  3LZ0 A;  1BLC A;  1Y4O A;  2QYB A;  3ZFZ A;  4E3O A;  4YS3 A;  2XEP A;  1VET A;  3E4Q A;  4R6L A;  2BAS A;  2L0W A;  2JSS A;  2M1C A;  2EWW A;  3HSH A;  1BYW A;  2Z6D A;  4X23 B;  4FTX A;  3X1T C;  5CPK D;  1P3F D;  2Y59 A;  5AY8 C;  5B0Z C;  3AZE C;  2WGV A;  3R7W B;  3PBQ A;  5KIZ A;  4X68 A;  3DTI A;  3B6G C;  1S66 L;  1DP8 A;  1GSV A;  1Z6F A;  3UTA C;  2OWJ A;  3A0R A;  3IXH A;  4MN5 A;  5DF7 A;  2XRO A;  3A0S A;  3NBL A;  3ZNT A;  4CQH A;  4WUJ A;  3AZI C;  3AZM A;  2ZOI A;  2PYO C;  3X1U A;  1YLY A;  4BJP A;  1V9Z A;  3NOT C;  3RXX A;  5EM1 A;  3IXB A;  3LID A;  3W99 B;  1TZY D;  5B31 D;  2F8N D;  1B6W A;  5A93 A;  4MMN A;  1PW1 A;  2KX6 A;  4OVD A;  3OPH A;  4R4S A;  1JVJ A;  2Y2G A;  5HDS A;  5FAO A; 
#chains in the Genus database with same CATH homology
 4S2J A;  5CPJ B;  1WYB A;  1HQ3 A;  1MXO A;  1SHV A;  1M19 C;  2HDR A;  2PU4 A;  2LY8 A;  3G2Z A;  4Z9Q A;  5AV8 C;  2FFF B;  3UTB B;  2WYX A;  3REK D;  5KDM A;  3MNN A;  2OLV A;  3FZC A;  4OQ0 A;  1PZO A;  1M1A C;  2HIO C;  3IHB A;  3HUM A;  2Z2M B;  5JYP A;  4Y7P A;  2Y2K A;  5AV6 C;  5B2I C;  2IOU A;  1L0G A;  4IED A;  3AZF A;  5B2J D;  3AZL C;  3Q7Z A;  1KX5 D;  5DNM B;  4KZB A;  3O62 C;  1ULY A;  3SS4 A;  4JJN A;  3WAA A;  3IQA A;  1KX3 B;  4B4X A;  3C1B D;  3GQZ A;  2Q9N A;  5B1M A;  3W98 D;  1HZO A;  5B32 D;  4KZ5 A;  4E3K A;  4HBT A;  5J8X A;  1YLZ A;  2XD1 A;  3BLM A;  5CEC A;  1EQZ A;  3OZH A;  4GD8 A;  3VH6 W;  3SH8 A;  4QJG A;  3ZG5 A;  4H9P B;  4R8P A;  1CI9 A;  5JA4 B;  3AZH B;  1P3B C;  3WS5 A;  1PZR A;  4WV4 B;  4ZTK A;  3MGQ D;  3MGR D;  3VP0 A;  3WS0 A;  4GN2 A;  1IYO A;  2X01 A;  4PMA A;  4N1H A;  4X23 A;  1LL5 A;  3CZD A;  2V2F F;  5M19 A;  3VOZ A;  3X1T B;  3A3I A;  5AY8 B;  5B0Z B;  3AZE B;  4H9O B;  3OPR A;  3B6G B;  3Q1F A;  4XUJ C;  3REJ D;  3W4Q A;  2EXA A;  3UTA B;  4QU3 A;  2DRW A;  4NE6 A;  3VSL A;  3AZI B;  3A6N C;  5F99 D;  2PYO B;  1O07 A;  3AN2 C;  4OPQ A;  4R23 A;  3WTP A;  3LJA C;  2NQB C;  2YFW B;  3REH D;  3WRT A;  4P0M A;  2J7V A;  1F66 D;  2Y2L A;  3UT9 D;  1I2W A;  1BH9 A;  3LZ1 D;  5GLD A;  3UNW A;  1I2S A;  1M19 B;  4OOY A;  4PPR A;  1K55 C;  3G30 A;  1KVL A;  2IWD A;  5AV8 B;  4M3K A;  1HTA A;  1N1J B;  1H3O B;  2CV5 D;  1WYC A;  3PBT A;  1YMS A;  3V5M A;  3A1K A;  5IHV A;  3EPK A;  4UA7 A;  5DNN D;  4WYY A;  1M1A B;  2HIO B;  5FI6 A;  3AFA C;  5AV6 B;  4WEK A;  4YIN A;  2I72 A;  3MGS D;  1YU2 A;  5A90 A;  5FAQ A;  4IBC A;  3AZL B;  1P3O A;  4QY5 A;  1O7E A;  1KX3 A;  3O62 B;  3LEL A;  3VP3 A;  3UDF A;  4Z66 C;  4UPK A;  4DRA A;  4WZ5 C;  2F8N H;  4S2L A;  5CPK C;  4KG5 A;  3MZD A;  4OH0 A;  5JA4 A;  3AZH A;  4IBK A;  1KVM A;  4IBR A;  5AVC C;  2WGI A;  3REL D;  4JBF A;  2XF3 A;  2XFT A;  3IF6 A;  1P3B B;  1P3P D;  5B0Y D;  4WU9 C;  4KZ8 A;  5CPI D;  5AVB D;  1WWS A;  3MGP C;  5GSU D;  4UUZ A;  1NZO A;  5AV5 D;  4H9N B;  3SH7 A;  1E4D A;  4WEJ A;  4C6Y A;  1PWC A;  3X1T A;  2F8N K;  2OLU A;  4R1G A;  4BQM A;  1MBL A;  3DWZ A;  5AY8 A;  3VP4 A;  5HX9 A;  2EFU A;  4H9O A;  3BRM A;  3FV7 A;  3B6G A;  1ERO A;  4GD6 A;  3QNB A;  3UDI A;  4BLM A;  3UTA A;  3C1C C;  1IYP A;  3VH5 W;  4XUJ B;  4QD4 A;  3AZI A;  1NZU A;  1RCJ A;  4GH9 A;  2IWC A;  2PYO A;  3F6T A;  5DTT A;  5FQQ A;  3B0C T;  3ZCZ A;  2A3U A;  3RXW A;  5F82 A;  3A6N B;  1P3A D;  3AN2 B;  1BH8 A;  3NC8 A;  4CAY B;  3LJA B;  5B24 D;  2NQB B;  4RYE A;  3W97 A;  5DF8 A;  4NZ4 A;  1M19 A;  1PWD A;  3KXB C;  5AV8 A;  1H3O A;  4HGA C;  5CEB A;  1XKZ A;  4J8X A;  1Q2Q A;  4XUX A;  3C1B C;  5AQ9 A;  5BT1 D;  3RJU A;  1E3U D;  4LCM A;  4GB7 A;  1M1A A;  2HIO A;  4R3J A;  4MBF A;  4R4R A;  4X56 A;  5GLB A;  4IBI A;  4KHA B;  5CTN A;  2ZC6 B;  4UA6 A;  5AV6 A;  1BUE A;  3EG5 B;  3E2K A;  3HLD A;  1YM1 A;  5KZH A;  3AFA B;  1BFM A;  1L2S A;  4GKU A;  1XGJ A;  5E2F A;  3X1S A;  4ZBE A;  1PW8 A;  2ZM2 A;  1ZLA D;  1LHY A;  3WA9 C;  4X53 A;  4J8U D;  4KGC D;  1W5D A;  1ONG A;  4PM9 A;  1CEG A;  4DXB A;  4OLD A;  4NYU A;  4Z66 B;  3IP4 C;  1YU1 A;  4ZUX D;  1KE3 A;  4IVK A;  5CPK B;  1S6R A;  1P3B A;  3TG9 A;  4BEN A;  5AVC B;  4XZQ D;  3AZN D;  4JLF A;  5B1L D;  2G2U A;  4CSR A;  3AGF A;  1TAF A;  5B40 A;  4DF6 A;  4WU9 B;  1CEF A;  2ZQ7 A;  3ZG0 A;  2JE5 A;  5HAI A;  3MGP B;  1ID3 D;  3OCN A;  2Y2H A;  4KG2 A;  4KUD C;  4WMC D;  1K6R A;  4JF4 A;  3LZ1 C;  4X6T A;  3UO9 A;  4RVA A;  4XUJ A;  4PM5 A;  3LY3 A;  5DVA A;  2CV5 C;  4KQQ A;  5L2F A;  3B0C W;  3REI D;  3C1C B;  1HD8 A;  2X02 A;  4RA7 A;  3S4X A;  3LY4 A;  3A6N A;  2RVQ D;  5TR7 A;  4CAY A;  1W8Y A;  3AYW C;  3LJA A;  2NQB A;  4B4Z A;  1S32 D;  5CGW A;  4JXG A;  2A49 A;  5GT0 C;  5BPV A;  4R3B A;  3GVB A;  1IYS A;  3A3D A;  3DW0 A;  3KXB B;  5EVI C;  2PU2 A;  5CHJ A;  4HGA B;  5CRF A;  3M2K A;  2FJ7 D;  3AZJ C;  3MVD D;  3C1B B;  2XD5 A;  3N8L A;  4YM6 D;  4OP5 A;  1K56 A;  3Q07 A;  3KWQ C;  3N3F A;  1LI9 A;  3LEZ A;  3AV2 D;  3M6H A;  2RIQ A;  4U3T A;  1FR6 A;  3BFE A;  3KSY A;  3PTE A;  5E2G A;  5G49 B;  2XGN A;  3L29 A;  1P3P C;  1M18 C;  4J8W C;  4QNL A;  1WE4 A;  2QMI A;  3GRJ A;  4MLL A;  4KZ7 A;  5GSU C;  1ZC2 A;  4OPR A;  3WA9 B;  4Z66 A;  3B6F A;  4E6W A;  3C7U A;  1P34 D;  4OPZ A;  4WZ5 A;  5DF9 A;  2DF4 C;  3P5J B;  3AZG D;  1Q2P A;  4J8V C;  1W8Q A;  2Y2J A;  4IJE A;  1K6S A;  5E5A D;  5AVC A;  2R9W A;  4U0T A;  5FQK A;  3Q82 A;  4P6B A;  2WZX A;  2NZD D;  4KQR A;  3HL9 A;  4FSF A;  2HP5 A;  4WU9 A;  1BLP A;  5GT3 A;  1YLT A;  2H10 A;  3VH6 T;  3MGP A;  3UY6 A;  1IEM A;  4WM9 A;  1U35 C;  4UAA A;  3L27 A;  2XDM A;  4Z5T A;  2ZY5 A;  3ZHH A;  3WKJ D;  1QME A;  1P3L D;  5FI7 A;  3BFF A;  5GXQ A;  5BS7 C;  1EI5 A;  2G5H C;  4KUD B;  4LD9 C;  1P3I C;  3HLW A;  3LZ1 B;  3TU4 D;  3IXD A;  3SS5 A;  1XGI A;  3G32 A;  3AV1 D;  1BUL A;  1K4F A;  3C1C A;  2CV5 B;  5JRG D;  1XXM A;  1AOI D;  1MWU A;  5B33 D;  1P3M D;  1JWP A;  2BYK B;  2WZZ A;  4Q8I A;  3AYW B;  2HUE C;  3X1V C;  1K57 C;  3UE0 A;  4GDB A;  3W96 C;  5FQJ A;  1TDL A;  3KXB A;  5GT0 B;  3V50 A;  4OJP A;  4H9R A;  1YU0 A;  1B67 A;  4PM7 A;  5EE8 A;  4FH2 A;  1DJB A;  5EVI B;  1P3K D;  3N8S A;  2WAD A;  5FAP A;  3AZJ B;  4KZA A;  2PBY A;  3ZG8 B;  3LZ0 D;  3KWQ B;  5EPH A;  4BL2 A;  4Z5T D;  1HVB A;  2ARO A;  4YS3 D;  2CC1 A;  3IHA A;  1ONH A;  2ZM0 A;  3WA9 A;  1M18 B;  4J8W B;  3VSK A;  4KZ9 A;  1A7W A;  3O87 A;  2ZLY A;  5GSU B;  4IBF A;  4QLC B;  3C7V A;  2ZMA A;  3LO7 A;  3QNC A;  3BEB A;  3A3J A;  2J9O A;  3AZM D;  5D3O A;  1S0W A;  4J8V B;  3X1U D;  1PIO A;  3D4F A;  1P3G C;  5EUA A;  4DE3 A;  4K0W A;  2J8P A;  3FYZ A;  5A92 A;  1J9M A;  4OLG A;  2J8Y A;  4NE3 A;  1HQ3 D;  5EOO A;  4FH4 A;  4NET A;  4H9S C;  1KGF A;  1U35 B;  2QPN A;  2B5R A;  4KUD A;  3P98 A;  3MNN D;  1FSW A;  2WKE A;  3Q7V B;  1FOF A;  5FAT A;  2GDN A;  4EWF A;  1PI4 A;  4LD9 B;  5GHX A;  1P3I B;  4NZ1 A;  3BEC A;  2FJ7 C;  5AV9 C;  1ESU A;  5U47 A;  2BYK A;  4LCL A;  3AZF D;  1AXB A;  2WUQ A;  1KX4 C;  4JXV A;  4QB8 A;  3AV2 C;  5CP6 C;  3AYW A;  2EX9 A;  4JJN D;  3WAA D;  3VH5 T;  3W99 A;  1G68 A;  3AZK C;  1GA0 A;  1SDE A;  2HUE B;  5GT0 A;  3X1V B;  3MBZ A;  2UWX A;  5B1M D;  3W96 B;  5KSC A;  1PYY A;  5CPJ A;  5EVI A;  2V1Z A;  3AZJ A;  3UTB A;  1EQZ D;  5CHU A;  1P34 C;  3N4I A;  3IWO A;  4R8P D;  3KWQ A;  1LI0 A;  3EQU A;  1KGG A;  4WU8 C;  4ZBJ C;  4IBB A;  3KUY C;  3OPP A;  4E3L A;  1M18 A;  4J8W A;  4X23 D;  1JTD A;  5B2I B;  3UE3 A;  2XQZ A;  5DNM A;  1VQQ A;  2V20 A;  4QLC A;  2DNS A;  1GA9 A;  1KDW A;  3PAE A;  3UPP A;  5HL1 A;  1P3L C;  2VGK A;  1T3U A;  5KSH A;  3BFC A;  1IKI A;  2CWE A;  4J8V A;  4S2N C;  4L0L A;  3MZF A;  4KZ4 A;  4AWL C;  2E8I A;  3WTP E;  1P3F C;  4H9P A;  1P3G B;  3WTP D;  4DDS A;  4ID4 A;  3L2A A;  5I94 A;  5JRG C;  4GOG A;  1NYM A;  3MZE A;  3N7W A;  1U35 A;  4S2P A;  5E43 A;  3GV9 A;  4K0X A;  4OQI A;  3Q7V A;  5BS7 A;  4N9K A;  5GLC A;  2Y4A A;  1TZY C;  3UDX A;  4KG6 A;  1G6A A;  5B31 C;  4LD9 A;  3IF5 A;  1P3I A;  1ZG6 A;  4E3N A;  2BYM B;  1K4E A;  4OQG A;  1PI5 A;  4CPK A;  5B0Z A;  3AZE A;  1K54 C;  5HFO A;  2FJ7 B;  4X69 A;  5AV9 B;  2RCX A;  3N6I A;  3REK C;  1ERQ A;  1YLJ A;  3UN7 A;  5F1G A;  2EXB A;  2Y2I A;  1KX4 B;  1P3O D;  2Y2O A;  3AV2 B;  4HEF A;  1KX3 D;  3CG5 A;  3WS2 A;  5CP6 B;  4FD8 A;  3LEL D;  1R4V A;  3X1V A;  1K57 A;  1MWR A;  3W96 A;  1KE0 A;  3AZK B;  4NZ3 A;  2YFW A;  3KS8 A;  1FSY A;  1N4O A;  3NQU B;  4E3M A;  5B2J C;  4GNU A;  1KX5 C;  3O88 A;  2L5A A;  3HBR A;  2EX2 A;  3AZH D;  3PBN A;  4BD0 A;  1N1J A;  3BM6 A;  1EWZ A;  1P34 B;  3W98 C;  3W4O A;  5F83 A;  5B32 C;  4HES A;  3ITA A;  4K91 A;  4WU8 B;  1BZA A;  4ZBJ B;  4DDY A;  5B2I A;  4WBG A;  2WGW B;  3KUY B;  4LV0 A;  4DRT A;  5BOH A;  3AZL A;  3X1T D;  5GHZ A;  1NJ4 A;  5AY8 D;  3O62 A;  1FCM A;  2BG1 A;  3MGQ C;  2Y91 A;  3MGR C;  3B6G D;  5EVL A;  3MKF A;  3HRE A;  5BNX B;  1P3L B;  2P9V B;  3UTA D;  4DXC A;  4E3J A;  3IXG A;  3AZI D;  1ALQ A;  4DE0 A;  2PYO D;  1PWG A;  2YFV B;  1H5X A;  1LLB A;  1P3G A;  4EQI A;  3MXR A;  4N1X A;  5E2E A;  2XLN A;  4XUZ A;  2J9P A;  3ZGA B;  4AWL B;  3DWK A;  5HAP A;  1P3F B;  3Q81 A;  3UPN A;  2WAF A;  1BLS A;  2ZC4 B;  4RX3 A;  3W97 D;  5JRG B;  4JXW A;  3REJ C;  3VH6 A;  1M19 D;  4JJN C;  3R45 B;  3WAA C;  5AV8 D;  3IH8 A;  4C3Q A;  5FA7 A;  2ZY4 A;  5G18 A;  4H9N A;  4J8X D;  5F99 C;  4QY6 A;  3G31 A;  3EPH A;  3CMZ A;  2BYM A;  4G92 C;  2Z2L B;  1TZY B;  4NFT A;  5B31 B;  2F8N B;  1M1A D;  5AQB A;  2HIO D;  3REH C;  3OC2 A;  1BLH A;  4JPM A;  5FSR A;  1F66 C;  1GCE A;  1C3B A;  5AV6 D;  4IBE A;  3UT9 C;  5AV9 A;  4R8P C;  2C5W B;  1KX4 A;  3GR2 A;  3S22 A;  3NCK A;  3OCL A;  3REK B;  5CP6 A;  4EBN A;  3X1S D;  4F94 A;  2ZM5 A;  3AZK A;  5DNN C;  3I7J A;  3AN2 A;  2ZQ8 A;  3HLB A;  2H0Y A;  3HLG A;  4P87 A;  4IBX A;  3MGS C;  1W2E A;  3ZVW A;  1ZKJ A;  5B2J B;  5GLA A;  1KX5 B;  3NDE A;  3HUO A;  1K55 A;  5CGS A;  1P3B D;  4GDN A;  3B3X A;  4WU8 A;  4S2O A;  3JYI A;  5HW3 A;  4KHA A;  3W98 B;  5CHL B;  5B40 D;  5B32 B;  2ZM8 A;  2WGW A;  3KUY A;  4WNN B;  4NZ5 A;  4LG2 A;  1MWT A;  3AFA A;  3VP2 A;  3WTP C;  3A3F A;  1YT4 A;  3HLC A;  3REL C;  1K38 A;  2C6W B;  5M18 A;  3MXS A;  3G4P A;  5B0Y C;  5BNX A;  5CPI C;  3IT9 A;  2P9V A;  3MGQ B;  5AVB C;  3G35 A;  3MGR B;  4XUJ D;  3B0B A;  5AV5 C;  4WZ4 A;  3H0M C;  1L0D A;  1TDG A;  1Q9C A;  3ZDJ A;  4IJF A;  3NDG A;  3HON A;  5TFQ A;  3NQJ B;  1ZG4 A;  2XFS A;  3A6N D;  5CPK A;  1P3F A;  1XA1 A;  3FKW A;  4ZJ3 A;  1FR1 A;  3LJA D;  2NQB D;  4OP8 A;  3ZG7 B;  3R45 A;  1NRF A;  1P3O C;  3REJ B;  3LEL C;  4OJL A;  4IVI A;  5FUG B;  3WAA B;  5HAR A;  3V39 A;  1TZY A;  4DRB A;  5B31 A;  2F8N A;  5F99 B;  1P3A C;  1YUE A;  4G92 B;  3AL0 C;  1K56 D;  5B24 C;  1I5Q A;  1BSG A;  3REH B;  2Y2Q A;  3QHY A;  4HBU A;  4JF6 A;  1K54 A;  1M40 A;  1TVF A;  1F66 B;  2EX6 A;  3UT9 B;  2HP6 A;  4E44 A;  3REK A;  4R0Q A;  3WX7 A;  3ZG9 B;  4NE5 A;  4OOL A;  4R8P B;  4JF5 A;  5BT1 C;  1ES5 A;  4O7D A;  3IF6 C;  3ISG A;  3O3V A;  2Y2N A;  1KE4 A;  3OPL A;  2VQR A;  4GZB A;  2FFY A;  3VH5 A;  3W8K A;  5DNN B;  4Z66 D;  3NI9 A;  3B6F D;  5KMW A;  5B2J A;  1W79 A;  1KX5 A;  3MGS B;  1JFI B;  5AQA A;  1GHM A;  3UPO A;  1KU5 A;  3SOI A;  5BO0 B;  1ZLA C;  5AVC D;  3H0L C;  4J8U C;  3C1B A;  4KGC C;  3W98 A;  3PAG A;  4JXS A;  2JC7 A;  3ZVT A;  5B32 A;  1CK3 A;  4M6B A;  4OOM A;  4WU9 D;  4NY2 A;  5GT3 D;  4ZUX C;  4WNN A;  3MGP D;  1RGZ A;  2ZC3 B;  5FAS A;  3S1Y A;  5G49 A;  3WTP B;  1Z2C B;  5GXQ D;  3W97 C;  3DTM A;  3TSG A;  3REL B;  4XZQ C;  1XP4 A;  3AZN C;  5FDH A;  3MGQ A;  4WJ3 C;  3A3E A;  3MGR A;  5B1L C;  1BH9 B;  1P3P B;  5B0Y B;  1DJC A;  4J8X C;  5CPI B;  4ZDX A;  5AVB B;  3SS3 A;  5AQ7 A;  1ID3 C;  3C1C D;  2QZ6 A;  3NQJ A;  1KGE A;  5AV5 B;  4EO5 C;  3HLF A;  3E2L A;  4GHA A;  1FCN A;  4WZS B;  3NY4 A;  4H9Q B;  2ZC5 B;  4N9L A;  4N92 A;  3REJ A;  3X1S C;  5DTS A;  5FUG A;  3KXB D;  5FI2 A;  4NK3 A;  2EX8 A;  3REI C;  1P3O B;  4D2O A;  3FKV A;  3LEL B;  5F99 A;  1LL9 A;  2RVQ C;  4DQY B;  5M1A A;  2OSU A;  3REH A;  1S32 C;  1P3A B;  1IYQ A;  1QMF A;  4P85 A;  1F66 A;  3AGE A;  4LV3 A;  3UT9 A;  5B24 B;  3LZ1 A;  2DQN C;  2ARO D;  5CER A;  2JCH A;  3MFD A;  3GTC A;  2CV5 A;  2WKH A;  3MVD C;  4MNR A;  1K25 A;  4YM6 C;  3IF6 B;  3O86 A;  5B40 C;  2G5I C;  3WA9 D;  5DNN A;  4LV2 A;  4UUZ B;  1OME A;  5CHM A;  1YMX A;  3MGS A;  4GHL A;  3EPJ A;  1JFI A;  2ZJ9 A;  4EBP A;  5BO0 A;  4QHC A;  5F1F A;  4UHU A;  1ZLA B;  4J8U B;  4KGC B;  1XA7 A;  3FDD A;  3VP1 A;  4ZUX B;  1DJA A;  3C4P A;  3AZG C;  4S2K A;  4LEN A;  4OQH A;  5E5A C;  5CED A;  4H8R A;  3REL A;  2R9X A;  4KUD D;  1BH8 B;  4Y0T A;  3EPL A;  1SKF A;  2NZD C;  3BYD A;  3W97 B;  1P3P A;  5B0Y A;  5CPI A;  4XZQ B;  3AZN B;  5HAQ A;  5AVB A;  1XX2 A;  2Y55 A;  5B1L B;  3BFD A;  5GSU A;  4MEZ A;  1YLW A;  3M2J A;  2WAE A;  5AV5 A;  4J8X B;  4OPY A;  3VFF A;  4Z2M H;  3WRZ A;  1ID3 B;  3WKJ C;  5A91 A;  1SCW A;  1YU3 A;  1H8Y A;  4EO5 B;  4H9Q A;  1F1E A;  5FQM A;  2WK0 A;  3AYW D;  4LV1 A;  2DCF A;  4DKI A;  3TU4 C;  1PZP A;  3W99 D;  4CJN A;  1WWI A;  3AV1 C;  5GT0 D;  4G91 C;  3H0R C;  3X1S B;  4B88 A;  2HDS A;  5CPJ D;  5EVI D;  3GSG A;  3REI B;  1AOI C;  5B33 C;  1P3M C;  3KFU G;  4ZJ1 A;  3AZJ D;  1P3A A;  3UTB D;  3B6F C;  4FCF A;  1IKG A;  2H0T A;  1VM1 A;  3PBO A;  5B24 A;  3KWQ D;  4PM6 A;  3IWI A;  2XR0 A;  4KZ6 A;  4X55 A;  1S32 B;  5FQI A;  3A1I A;  3IH9 A;  3B0D C;  1FCO A;  1E3U A;  1P3K C;  1M18 D;  4J8W D;  5GT3 C;  4S2I A;  3MVD B;  4IBD A;  4YM6 B;  5DNM D;  4CSR B;  5C3I C;  3PBS A;  5TGF A;  1TAF B;  5B40 B;  3LZ0 C;  1TEM A;  1W7F A;  4QLC D;  4Z5T C;  3C5A A;  4Y0U A;  1GHP A;  4YS3 C;  4ZJ2 A;  3V3S A;  5GXQ C;  3KS4 A;  3L26 A;  3L28 A;  2HP9 A;  4S2M A;  3WS1 A;  4J8V D;  3VMA A;  1ZLA A;  1SDN A;  1JWV A;  4J8U A;  4KGC A;  5BNV B;  2IO5 C;  2P74 A;  4BD1 A;  3C4O A;  4E45 A;  1FQG A;  3GMW A;  3V9R B;  1MKI A;  4ZUX A;  4OKP A;  1U35 D;  4NYY A;  3AZG B;  3AZM C;  4OON A;  4DE1 A;  3X1U C;  1BTL A;  1ES3 A;  5E5A B;  2RL3 A;  5GL9 A;  5CGX A;  3V3R A;  1CI8 A;  4XZQ A;  3AZN A;  1MWS A;  4LD9 D;  5B1L A;  2NZD B;  1P3I D;  4ZAM A;  1MY8 A;  3ZNY A;  1YLP A;  1HQ3 C;  3EQV A;  1ID3 A;  5B0Z D;  3AZE D;  4OJ6 A;  4RX2 A;  2XK1 A;  5CTM A;  1YU4 A;  3PBR A;  3G2Y A;  4WMC A;  2H5S A;  3WKJ B;  3MNN C;  1JTG A;  2ARO C;  3AGD A;  3HUN A;  4OJO A;  3X1V D;  2HPB A;  3TU4 B;  3W96 D;  4UA9 A;  3AV1 B;  5CXW A;  3REI A;  3VOY A;  1GHI A;  4G91 B;  1L0E A;  3AZF C;  1H8Z A;  3BLS A;  5EOE A;  1AOI B;  2OV5 A;  4H9S A;  5B33 B;  1P3M B;  4EBL A;  1S32 A;  2WKI A;  3B6F B;  4OUI A;  5B1M C;  4KEN B;  2HDQ A;  4E3I A;  3TOI A;  2Y2M A;  1YQS A;  4Z2M G;  2FJ7 A;  4C75 A;  3MVD A;  5B2I D;  3B0D B;  1EQZ C;  4YM6 A;  2G2W A;  5GHY A;  1P3K B;  4YFM A;  2W8S A;  4PM8 A;  2Y2P A;  5GT3 B;  4A5R A;  3AZL D;  4IBJ A;  3AV2 A;  3O62 D;  5C3I B;  2ZY2 A;  2IWB A;  3LZ0 B;  1M6K A;  2ZY3 A;  4Z5T B;  5E2H A;  3ITB A;  4YS3 B;  3MKE A;  3G34 A;  5GXQ B;  1XPB A;  4X23 C;  3NQU A;  5BNV A;  4MBK A;  4E6X A;  1P3G D;  3V9R A;  4EUZ A;  2XH9 A;  3LCE A;  1NY0 A;  2IO5 B;  3NIA A;  2ZC7 A;  5B31 G;  2F8N G;  1N9B A;  5JYO A;  2HDU A;  4MBH A;  1P34 A;  3P09 A;  3IWQ A;  2F2A C;  3HVF A;  2EFX A;  3AZG A;  3BFG A;  5DTK A;  1L0F A;  5E5A A;  4IBG A;  3W99 C;  3FKE A;  3AZM B;  1IEL A;  3N8R A;  2NZD A;  3X1U B;  2VGJ A;  3W4P A;  1JWZ A;  5CPJ C;  1NYY A;  3SH9 A;  3UE1 A;  1NXY A;  4H9R B;  5AV9 D;  3UTB C;  4U0X A;  4Y0O A;  3VFH A;  1HQ3 B;  4XXR A;  3WKJ A;  1P3L A;  3M6B A;  4KQO A;  4KZ3 A;  1KX4 D;  5CP6 D;  4S2N A;  5KDM B;  3MNN B;  2YFV A;  4DE2 A;  1ES4 A;  2ZQA A;  1KDS A;  3TU4 A;  1RGY A;  3WS4 A;  2ARO B;  3L25 A;  3AZK D;  5EEC A;  3AV1 A;  3AN2 D;  1RP5 A;  2ZQD A;  1U60 A;  5B32 G;  1BT5 A;  3CJM A;  5JRG A;  5DNM C;  1HTZ A;  1ESI A;  1AOI A;  2JBF A;  5B33 A;  1P3M A;  1ES2 A;  4JKT A;  4QLC C;  3AZF B;  3HLE A;  1E25 A;  1MPL A;  4EV4 A;  1DY6 A;  1KX3 C;  3FWL A;  4JJN B;  4OJ5 A;  2ZQ9 A;  1ERM A;  4WU8 D;  2ZD8 A;  5B1M B;  2Q9M A;  4BL3 A;  3KUY D;  3WWX A;  1P3K A;  4WEL A;  5FQ9 A;  2BLS A;  3AFA D;  2X71 A;  3AZH C;  2ZQC A;  1EQZ B;  1Y54 A;  3LZ0 A;  1BLC A;  3ZFZ A;  4E3O A;  4YS3 A;  2XEP A;  2JSS A;  3HSH A;  4X23 B;  3X1T C;  5CPK D;  1P3F D;  2Y59 A;  5AY8 C;  5B0Z C;  3AZE C;  2WGV A;  3PBQ A;  4X68 A;  3B6G C;  1Z6F A;  3UTA C;  3IXH A;  5DF7 A;  3NBL A;  3ZNT A;  3AZI C;  3AZM A;  2PYO C;  3X1U A;  1YLY A;  4BJP A;  3RXX A;  3IXB A;  3W99 B;  1TZY D;  5B31 D;  2F8N D;  1B6W A;  5A93 A;  1PW1 A;  4OVD A;  3OPH A;  4R4S A;  1JVJ A;  2Y2G A;  5FAO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...