2JE5A

Structural and mechanistic basis of penicillin binding protein inhibition by lactivicins
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
683
structure length
461
Chain Sequence
SEITYSDGTDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTNQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Mechanistic Basis of Penicillin-Binding Protein Inhibition by Lactivicins
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Drug-binding protein
molecule keywords PENICILLIN-BINDING PROTEIN 1B
total genus 147
structure length 461
sequence length 683
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
A PF00912 Transgly Transglycosylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2je5A01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2je5A03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2je5A02
2XD5A 5FDHA 4GZBA 1MWUA 1FSYA 5EVIC 5L2FA 1K56D 5J8XA 3VP2A 4K0XA 1OMEA 5DF9A 3HLGA 4QB8A 5GL9A 4QJGA 3GSGA 3PBQA 2J9OA 3V50A 4WZ4A 2UWXA 4RYEA 3ZNTA 5E2GA 2Y2KA 1K56A 1TEMA 1XXMA 2EXBA 4N1XA 1ALQA 1ZC2A 3C7VA 4UA9A 5CTNA 1RGYA 1XGIA 5FQQA 4WEKA 1ONGA 2EX2A 2Y59A 2EX6A 2J8YA 3UPNA 4PM9A 3ZVWA 1KE4A 2PBYA 2HDUA 3W8KA 1W79A 3MZEA 1H8ZA 3S22A 1PYYA 2PU4A 3QHYA 3HREA 2Y2NA 3HLEA 3M2JA 3FZCA 5A91A 5GLDA 3BEBA 3C7UA 4IBXA 1EWZA 2H0YA 3G35A 3A3IA 3NCKA 3Q81A 4NK3A 4R3BA 5AQBA 2OV5A 4N9KA 2XK1A 3FYZA 4XXRA 3SS3A 1NRFA 1RCJA 1L0FA 3IT9A 1QMFA 4KG6A 4OOMA 3MKEA 1LI9A 2ZQ7A 5EVID 4OPQA 4XUXA 5E2FA 3GMWA 1L2SA 4GB7A 5FI2A 4UA7A 2VGJA 4E3OA 4U3TA 1GA0A 1HVBA 1RP5A 4OQIA 1NZOA 3RJUA 1K6SA 4E3NA 1M40A 4GDNA 5U47A 3IH9A 1HTZA 3RXXA 3VFHA 1KGGA 2JE5A 3G4PA 3V5MA 5CECA 1K54C 1ES3A 1BLHA 1K4FA 2XF3A 3MXSA 5EVIA 3I7JA 5FA7A 3VFFA 1PZOA 1MXOA 4KZ9A 4JLFA 5CGWA 3M6HA 3ZG5A 1BLCA 4E3JA 3OPHA 4Y0OA 2DRWA 3OZHA 5M1AA 4JF4A 5FATA 4RVAA 4DXBA 3LO7A 3RXWA 5F1FA 4WEJA 1W5DA 3G30A 4R23A 2XDMA 3NDGA 3VSKA 3CG5A 1SDEA 2ZJ9A 4E3LA 4OH0A 3W4OA 5EOOA 1YMSA 2XFTA 1K57A 4GN2A 5CRFA 3IXGA 3O86A 4UHUA 1JWVA 1SHVA 4X53A 2ZQDA 3PTEA 3PBSA 2Y2PA 4ID4A 3WRZA 1I2SA 4DXCA 4UAAA 3SH8A 4PM5A 3VP1A 1IYQA 4QY6A 3VP0A 1MWSA 4LV0A 3O3VA 5EVLA 5JYPA 3CMZA 3IXHA 3SS4A 2H5SA 2WGVA 3IXBA 5GHYA 3PBTA 4ZJ3A 4FSFA 2Y2LA 4MBFA 3ZVTA 1Z6FA 1DY6A 2R9WA 3BM6A 3M6BA 1KVMA 2HDRA 2WADA 2Y2IA 3ISGA 3OPPA 3Q82A 4PPRA 1MBLA 3UPOA 4S2IA 4KQRA 3WRTA 3ZDJA 5AQAA 2C5WB 3A3DA 4OONA 4UA6A 1NXYA 4BL2A 2Y2OA 4S2MA 1BUEA 4KZ5A 1K55A 1XGJA 3TSGA 2WK0A 4X69A 1HZOA 2OSUA 3DTMA 3IWQA 4FH4A 4X6TA 3AGDA 3EQUA 2FFYA 5TR7A 5IHVA 5GHXA 3UN7A 5E2EA 1IYPA 3BFCA 1C3BA 4FD8A 4S2NC 5CEBA 2P9VA 4D2OA 3FKVA 3C5AA 4BD1A 3QNBA 5FQKA 3SS5A 3HLFA 1BZAA 1AXBA 3P09A 4WYYA 3ZG7B 4E3KA 4EBNA 4R0QA 4K0WA 1W8YA 4JXGA 2WAFA 3UDXA 4GD6A 1NY0A 3IHBA 5F1GA 4B4XA 4S2JA 2V20A 3S4XA 3ITAA 1K6RA 1PWDA 2J7VA 4OQ0A 4BENA 5EPHA 1CK3A 4GOGA 1YLPA 5FI7A 1ES5A 3PBOA 3HUOA 3NIAA 3ZNYA 4DE2A 4IVKA 2HP5A 4OOLA 3ZFZA 4CPKA 4MBHA 2HDSA 5E2HA 5FQ9A 4R1GA 4P87A 5EUAA 3UO9A 4Y7PA 4H8RA 4RX2A 4LV1A 5KSHA 2G2WA 1FOFA 1ES2A 3Q7VA 4HBTA 3A3FA 4B4ZA 2BLSA 2Z2MB 4KZ4A 2Y2HA 3BYDA 1K54A 1E3UA 1NJ4A 3BECA 5TGFA 4QU3A 2WGIA 2ZQCA 2RCXA 4KENB 3OCNA 1JWZA 4EQIA 1FCOA 1JVJA 4B88A 2I72A 3N4IA 4MBKA 3NDEA 4DE3A 3SH9A 3W4QA 1JWPA 4DF6A 5HAQA 5BOHA 2Y2QA 1EI5A 3DWKA 4BL3A 4X55A 1LL9A 5A93A 2C6WB 3SOIA 4HBUA 4LV3A 1KGFA 3N8SA 4QY5A 4EWFA 1KE3A 1NYYA 1FSWA 1S0WA 1RGZA 3MKFA 5AQ7A 4ZTKA 4JXVA 4PM8A 1Q2PA 2V2FF 2WKHA 1Q2QA 4C3QA 2WZXA 1H8YA 3OPLA 5DTTA 1BLPA 3UDIA 2XEPA 2JC7A 3JYIA 3WS4A 5CHMA 4JXWA 1IELA 1BULA 1CEGA 2WKIA 3Q7ZA 3IWIA 1WYCA 2Y2GA 5CERA 1IYSA 1IYOA 4S2KA 4IBRA 4EV4A 4IEDA 2RL3A 3N6IA 1XA1A 3WS1A 2Y2JA 4NETA 4Y0UA 5TFQA 1K57C 2X01A 4FCFA 5DTSA 5FI6A 1TDGA 1KVLA 3LCEA 4S2LA 1YLJA 1JTGA 3BRMA 5FQMA 4EUZA 2V1ZA 2ZC7A 5HFOA 2PU2A 5G18A 4X56A 2WGWB 3IF6C 3UDFA 4OPZA 1WE4A 4Z9QA 2G2UA 4OQGA 1EROA 3ZGAB 3V3SA 3LY4A 2XD1A 1GCEA 4K91A 2WYXA 3G34A 1TDLA 5CHJA 5FQIA 4E6WA 4LENA 5M18A 2WAEA 3PAGA 1G6AA 4PM7A 4QD4A 4JXSA 5CHUA 2ZQ9A 2A49A 2XR0A 3WWXA 3E2KA 1IKIA 3HBRA 4KZ7A 5FAOA 1CI8A 1NZUA 4KZ3A 2IWBA 3UE1A 1I5QA 4OP8A 2WKEA 5HARA 4BLMA 5HW3A 1MY8A 1K55C 2GDNA 2WZZA 3HLBA 3DWZA 3Q7VB 4Y0TA 3N7WA 5F83A 5KMWA 4EBLA 4BQMA 1SCWA 2QMIA 4KZAA 1L0DA 3QNCA 1GHMA 3NI9A 1MKIA 3Q07A 4KG2A 4X68A 1M6KA 3GVBA 5JYOA 4S2NA 1NYMA 2Z2LB 1KGEA 2VGKA 2Y4AA 3V3RA 1HD8A 3ZCZA 1LLBA 4E3MA 2WUQA 4GDBA 3PBRA 1BT5A 3NC8A 1CI9A 2ZM0A 2Q9MA 4JF6A 5CGXA 4C6YA 3D4FA 1FCMA 3ZHHA 2EFXA 1J9MA 4E3IA 1BLSA 1LI0A 3MZFA 5FAPA 3BLMA 4L0LA 4WZ5C 4LCMA 5FASA 4DE1A 2R9XA 3GTCA 5DTKA 4IVIA 4BD0A 4DRTA 3OCLA 4M3KA 4R4RA 4GNUA 3FKWA 4WM9A 5D3OA 1E3UD 1YLZA 3VP3A 4OPYA 3B3XA 2Q9NA 3GRJA 4HEFA 4OQHA 5FAQA 3W4PA 1PWGA 3ITBA 1MWTA 1XP4A 1O7EA 2EX8A 1FR1A 2OLVA 4MLLA 5HL1A 1ZG4A 1G68A 1W7FA 1LL5A 3IF6A 4ZJ2A 4KZ8A 4DDYA 3HLCA 4ZAMA 1K38A 3HLDA 3OPRA 3NY4A 2HDQA 4BJPA 3G2YA 3C4OA 3UPPA 4ZBEA 4ZJ1A 3O88A 4JF5A 1IKGA 5CTMA 3SH7A 3VSLA 1PWCA 5KSCA 1GHPA 2J9PA 4YFMA 3FWLA 4KZ6A 5KZHA 2JBFA 5I94A 3IQAA 4JBFA 2WGWA 1XX2A 1YLYA 1MWRA 2QZ6A 2ZC6B 2ZQ8A 4PM6A 5GLBA 3ZG9B 3MFDA 3A3JA 3UNWA 3IXDA 2XH9A 1ZG6A 1PIOA 3BFFA 4R4SA 2H0TA 3HUMA 3UY6A 3VP4A 2IWCA 5EE8A 4ZDXA 5FSRA 1FQGA 4Q8IA 2Y2MA 1MPLA 3MXRA 1GHIA 3PAEA 1W8QA 1YLTA 3HUNA 5M19A 3AGEA 4OPRA 4KQOA 2HP6A 3VOZA 4QHCA 4WBGA 1O07A 4HESA 1TVFA 4R3JA 3LY3A 3IHAA 2EFUA 4P85A 3ZG8B 4XUZA 4RA7A 5CGSA 3TOIA 3GR2A 1Y54A 3LEZA 2ZLYA 4A5RA 3A3EA 1PZPA 1FR6A 2HPBA 4N1HA 4OVDA 4RX3A 1K25A 2EX9A 4MEZA 4O7DA 1PI4A 2DNSA 3O87A 5GLAA 4N92A 3DW0A 4WMCA 3WS5A 2BG1A 1N4OA 3IWOA 3VOYA 3N8LA 3PBNA 1ESIA 3P98A 1DJBA 3S1YA 2Y55A 1U60A 3OC2A 5HAIA 2A3UA 1VM1A 2X71A 4OKPA 4EBPA 3IF5A 2XQZA 1L0EA 1K4EA 4DE0A 4KG5A 5E43A 3UE0A 1BTLA 3C4PA 1KDWA 4MNRA 4YINA 5F82A 2XLNA 2ZQAA 1N9BA 1XA7A 3E2LA 3MZDA 4GD8A 1ESUA 1ERQA 1E4DA 3G2ZA 4U0TA 5GLCA 2OLUA 3CZDA 5CXWA 1ES4A 3NBLA 4LCLA 2P74A 4GKUA 2HP9A 1LHYA 3IH8A 3GQZA 3Q1FA 2Y91A 2DCFA 1VQQA 2P9VB 3IF6B 4WZ5A 2ZC5B 2IWDA 2ZM8A 3N8RA 2QPNA 4E6XA 4N9LA 4WELA 3BLSA 2CC1A 2EXAA 4OLDA 1E25A 2B5RA 5A90A 5CEDA 1KE0A 1YM1A 2ZMAA 3WS2A 5DF7A 3MBZA 5EECA 1CEFA 1JTDA 1L0GA 1ERMA 2XGNA 3V39A 3ZG0A 4C75A 1PI5A 1XPBA 1SKFA 4PMAA 3CJMA 3M2KA 4OLGA 3WS0A 2ZD8A 4U0XA 4KQQA 1WYBA 3HL9A 4CJNA 4S2OA 2ZM2A 1DJAA 2JCHA 1SDNA 4LV2A 3UE3A 1H5XA 5HAPA 4DKIA 1PW1A 3G32A 5EVIB 1BSGA 1QMEA 5FQJA 1FCNA 1S6RA 3AGFA 1DJCA 2FFFB 1KDSA 1IEMA 1YLWA 1YQSA 2X02A 3FV7A 4JKTA 4KZBA 4P6BA 3TG9A 3BFGA 3EQVA 2H10A 3VMAA 1YMXA 2ZC4B 4P0MA 3HLWA 1I2WA 1PW8A 5EOEA 5A92A 2XFSA 1GA9A 3HVFA 5DVAA 4F94A 3BFDA 4JPMA 5GHZA 4OP5A 1ONHA 1ZKJA 3GV9A 4WMCD 4S2PA 3BFEA 4FH2A 4OOYA 5HX9A 2ZC3B 1XKZA 3G31A 1YT4A 4DDSA 5AQ9A 5DF8A 2E8IA
chains in the Genus database with same CATH superfamily
5FDHA 4GZBA 1MWUA 1FSYA 5EVIC 2XROA 5BS7A 5L2FA 4NKPA 3VP2A 4K0XA 4KGCC 4K08A 3UB9A 1TAFA 3HLGA 4MB5A 4QJGA 5AVBA 1S1ZA 4QPRA 5J7EA 3E98A 4B93A 2Y2KA 1K56A 4Z5TA 4N1XA 1H0GA 5B1LD 3TU4A 1ALQA 3C7VA 1V9ZA 1XGIA 2QHKA 2EX2A 5AV6B 3OLOA 5AV8C 4O0PA 2A24B 3AZKC 5B1LC 3S22A 1PYYA 4ARZB 5A91A 5GLDA 2FN2A 3C7UA 1EWZA 4HH2A 3G35A 5B1MA 4XXRA 1RCJA 1L0FA 5FEGA 3MKEA 1BH8B 4EW7A 3GMWA 4GB7A 3LR5A 1HVBA 1NZOA 5GXQA 4F3LB 5B32G 1KX5A 4QLCA 1K4FA 1P3IC 3AZID 4CSRA 3N3FA 1HQ3B 3C1BA 3M6HA 3ZG5A 1AOIA 5EM0A 5IS1A 3LO7A 3RXWA 3AZLB 3KUYB 4WEJA 3NOPC 3AFAB 1W5DA 2FZ0A 5B2IB 2XDMA 2D01A 3G30A 3NDGA 1SDEA 3UMDA 3VH6T 5L8MA 2ZOHA 4YWZA 4ESPA 1CXWA 2XFTA 2W1TA 1JWVA 4ID4A 2Y2PA 4QLCC 1I2SA 3SH8A 1IYQA 3FKEA 3O3VA 2BYMB 3C38A 1WA9A 5GHYA 3PBTA 3B0CW 3X1UD 3BM6A 2HDRA 4MCWA 4HJ4A 5KIZA 4HMCA 3OPPA 4NE5A 3WRTA 2WKRA 4J8WB 3NQJB 3A3DA 4UA6A 4NFTA 5IT5A 4LRXC 2Y2OA 3O62D 4Q0JA 3MNNB 4HJ6A 1XGJA 4L9GA 4WU8B 1HZOA 3IWQA 4FH4A 5B0YB 4X6TA 4DRAA 3EQUA 5AV5B 2FFYA 4GS9B 3T4QA 5GHXA 1P3KD 1JNUA 4JJNB 5E2EA 1IYPA 1P0ZA 3OOVA 2G5HC 5CEBA 1W63Q 5F69A 3B0DC 3SS5A 3HLFA 1T19A 2W0NA 4R0QA 3MS6A 4JXGA 1M19B 2WAFA 3CWFA 3U2AA 3UDXA 4B4XA 4H9QB 5EPHA 5B24C 3EG5B 3X1VA 3HUOA 3NIAA 5HD3A 2FJ7A 1XFNA 1P3BC 4OOLA 4CPKA 4MBHA 2HDSA 5KSHA 3AZGB 4Y7PA 4RX2A 4J8VA 5L09A 4G92C 3AV2B 1ES2A 4KGCB 3Q7VA 3AZFB 2Z2MB 4CLCB 3AZNC 4KZ4A 1G5UA 2AROC 3S7NA 5BT1C 3AN2D 1E3UA 3BECA 3H0LC 3MQOA 2ZQCA 4QU3A 2CMNA 4EQIA 4OUIA 4B88A 2ZL1A 5B40A 4DF6A 1S4RA 3B6FC 2Y2QA 3AZIA 1CF0A 4G3VA 4E44A 4M6BA 4AFIA 1OJ5A 4HBUA 4WU8D 2HJEA 3N8SA 4ZBJC 3EGXC 3WAAC 2YFVB 4ZTKA 5AQ7A 5B0YD 4JXVA 1Q2PA 2IA2A 4HI4A 4WZSB 5AVBB 3OPLA 3T1QB 2JC7A 1H0IA 5CHMA 4XUJA 4D60A 3Q7ZA 3JVVA 3TU4B 2IO5C 1IYSA 4B9OA 1UR8A 4EV4A 5IU1A 5DNND 2CV5B 1XA1A 5BT1D 3AN2C 5DTSA 3ZQ5A 1P9WA 3LCEA 1ULYA 2IOUA 4HNBA 4S2LA 5AJGA 2P08A 5EVEA 1N9LA 2HGVA 5F99C 1VEUB 4HGAB 2G2UA 4J8UD 1GCEA 1M18B 2Y8HA 5AY8D 1BH8A 4R8PD 1G6AA 1P3BD 3S7PA 3WTPD 3WA9B 2ZQ9A 1M1AD 4H9SA 1QO6A 4HP9A 4YOFA 4KHAA 4J8VD 1NZUA 3REJC 3REKC 1YU4A 3CHWP 5CX7A 4BLMA 2F8NB 4EBLA 3UTBB 3WKJC 3QNCA 3WA9C 3F1NA 1P34B 4DN0A 4KG2A 5B2IA 1F66C 3KXBA 1PNEA 4GJ4A 2Y4AA 4E3MA 3PBRA 2V1AA 2Q9MA 3UB7A 3ZHHA 1J9MA 3KWQB 3BLMA 5E5AA 4L0LA 4LCMA 3MMHA 3GTCA 1LT0A 5DTKA 4Y13A 1XFQA 3OCLA 5EV0A 1E15A 4M3KA 4GNUA 1E3UD 2Y79A 4WN5A 2Z6CA 4OPYA 4IBEA 2Q9NA 4HEFA 5JYPA 5HL1A 1MWTA 5L07A 1F66A 1W7FA 5TJJA 3L2AA 1TS0A 5HSQA 4ZAMA 3KYQA 3OPRA 1ZHHB 3NY4A 3KYZA 2HDQA 3REHC 4BJPA 3MNNA 3RELB 3G2YA 3C4OA 1M18D 5EFWA 4ZJ1A 4JF5A 1W1PA 4EEUA 1PWCA 3AYWD 5BS7C 4KZ6A 3WA9D 3UMEA 3R7WB 2RVQC 4JJNA 1U35D 2ZC6B 4PM6A 3X1SA 2O99A 3JVUA 3B42A 2H0TA 3UY6A 5B33D 4L9EA 4DQYB 3T1XA 5EE8A 5AY8C 4XZQC 4Q8IA 4M4XA 2E8JA 2V9AA 2W3GA 4MN7A 4HMEA 3HUNA 3WAAA 5DNNA 3EPKA 1MC0A 3C8CA 1EW0A 4HESA 4WF0A 3X1UB 5GT0C 1P3OD 3W97D 5CGSA 1Y54A 3A3EA 4N1HA 4OVDA 4RX3A 2F8NK 3A1KA 3KUYD 3TJZC 5GLAA 3DW0A 5B1MC 5B31A 4R8PA 3EOIA 5B2JA 3P5JB 3BQ8A 3S1YA 4IBGA 1D7EA 1U60A 1T3UA 1F5MA 3OC2A 5HAIA 4EESA 3AV1D 2HV1A 1TAFB 3KWQC 1P3AA 4DE0A 4WV4B 5B40B 4Y3IA 5E43A 3UE0A 1BTLA 4MNRA 2D49A 3AZJC 3T4JA 4NYUA 1YKDA 2ZOIA 4KUDC 1ESUA 1ERQA 4Z5TB 5B24D 3L7HA 3JPUA 5GLCA 2O9CA 1M19D 5TBMA 5DFXA 1MKMA 3M7PA 2BASA 3AZJB 3NQUB 3IH8A 3GQZA 3LIDA 5GT3A 3A6ND 2P9VB 1YU2A 4WZ5A 2HIOC 2ZM8A 3MVDD 2L1MA 2Z6DA 4N9LA 3LJAB 4QWOA 5AV6C 2CC1A 1KE0A 1YM1A 3TE8A 5DF7A 5B1MB 2R78A 3FDDA 1CEFA 2K31A 1ERMA 4CQHA 2KLIA 4E45A 3EPLA 3CJMA 2CV5A 1E8BA 1E6ZA 2ZD8A 3A0RA 3HL9A 4BWIA 5GSUA 5G49B 4QLCB 4Z66D 4DKIA 4OJOA 3G32A 1YSPA 3WTPE 1BSGA 3A0VA 4CSRB 4I3AA 1IEMA 3T4LA 1M18A 3BFGA 2QJ5A 4ZUXC 3EQVA 3VMAA 3AFAC 5AVCB 3HLWA 1P3FD 1VB6A 3AZLA 5CP6C 3LICA 4KHAB 4WU9C 1ONHA 3BFEA 3AZHD 2ZMFA 3G31A 2VKSA 5CPJD 4Z2MG 5AQ9A 1KOUA 3LJAC 5GT0A 1P3MB 3UTBA 4HH3A 4Q0HA 1P3PB 1R4VA 5DF9A 4QB8A 4PKYG 3X1SC 3GSGA 1F98A 3LIAA 1OT6A 2UWXA 4RYEA 1S32A 5E2GA 3MR0A 1XXMA 4J8WA 3NQJA 2HUEB 3X1TD 4NG2A 1CK7A 5G4ZA 5B1LB 3WD1A 2J80A 4PM9A 1KE4A 3LEQA 3A6NC 3NOUC 2HDUA 3F1OB 1O6IA 5BPVA 2MJ6A 2Y2NA 3FZCA 1CJFA 1F66B 2H0YA 3LR4A 3Q81A 4NK3A 3NCKA 5AQBA 1H0MA 4MB4A 1QMFA 1S32C 4J8UA 4OOMA 2F2AC 3LZ1D 4OPQA 5E2FA 4E3OA 5FI2A 4UA7A 2VGJA 4U3TA 1GA0A 1S67L 1P3ID 4OQIA 3HJIA 3T4KA 5AVCD 4Z66A 1ZLAA 3WTPC 1U35C 1M40A 1K6SA 4GDNA 1M19C 1HTZA 2LB5A 3RXXA 3VFHA 3V5MA 3R7WA 1K54C 3BWLA 3MXSA 2DMWA 3I7JA 3REID 3VFFA 5AY8B 4E3JA 3OPHA 4Y0OA 2DRWA 5M1AA 4JF4A 3AZGA 2ZMVA 4RVAA 1XJ6A 4G91C 3B6GD 4Q0IA 4NZ5A 4CLCA 4J8XC 2ZJ9A 5F99B 1W1VA 2VLGA 5B2ID 5EOOA 1KS0A 1YMSA 5HZHA 1K57A 5CRFA 5DNMA 3IXGA 3O86A 4X53A 3WRZA 4NXBA 4DXCA 3EPJA 4PM5A 2F8NH 4OJ6A 3AZMA 3CMZA 4G91B 3IXHA 1ZTUA 3IXBA 4FSFA 2Y2LA 3ZVTA 1Z6FA 3RELD 5B2JB 1DY6A 5CPKA 2WADA 2Y2IA 5AVCC 4ZUXB 2YFVA 1MBLA 1VETB 3ZDJA 5AQAA 2C5WB 2W8SA 3ICYA 3AZEA 4OONA 4BL2A 1U35B 4S2MA 2AVXA 1BUEA 3AZFC 4GCZA 3HONA 4XUJB 4QNLA 4UEYA 4PHTA 3HJKA 4NE3A 4X69A 1CQAA 2OSUA 3AGDA 3AZJA 3NQUA 2KOIA 3GDIA 5CPKC 3BFCA 2PR6A 2P9VA 3FKVA 4BD1A 2EWVA 5C3IB 3L25A 3QNBA 3WKJB 3UTAD 1BZAA 3X1SD 4LG2A 3LJAA 1GPFA 3MGPA 5B33C 1NY0A 5F1GA 1VEUA 4WUJA 1BH9B 1MZUA 3B33A 2VGLS 4GLQA 3S4XA 3AV2C 1P3KA 1GOIA 3ITAA 2L5AA 1PWDA 3NOTC 1GSWA 2J7VA 3MGQC 4GOGA 5FI7A 2CWEA 1ES5A 4IJGA 2GX5A 3E4PA 2JKRM 5GSUB 2JKGA 2QKPA 5HWTA 4YS3B 1KX3B 5G49A 4H6JB 4R1GA 4XT2B 4LV1A 3AZFD 3QP6A 4Z2HA 3VH6W 2F8NA 4IBBA 3KS4A 2BLSA 1UR9A 5DJTA 2Y2HA 1NJ4A 5AVCA 2RCXA 4KENB 1YUEA 1JWZA 3AN2B 1FCOA 1P34A 5BO0A 2I72A 3R45B 1WWSA 3REJA 4MBKA 3NDEA 3KXBB 1DRMA 3W4QA 5BOHA 2V0WA 1EI5A 4J8UC 4BL3A 5A93A 2JSSA 1PDCA 3SOIA 4P6ZS 4LV3A 3W98D 5GT0B 5B24A 1P3MA 1KE3A 2LB9A 1P3PA 4H9OA 1S0WA 1RGZA 3FPVA 2WKHA 2ZY5A 2J3WA 1H8YA 5DTTA 4DJ3A 2G7UA 3WS4A 3MFXA 3WKJD 2PRFA 1BULA 4HY8A 4Y15A 1WYCA 2Y2GA 2P04A 3C2WA 3AZKD 4Y0UA 3T4OA 3RELA 1K57C 2X01A 4FCFA 5FI6A 4MN5A 4H9RB 1JTGA 3BRMA 5FQMA 4EUZA 2V1ZA 2ZC7A 5HFOA 3H7WA 5MC7A 2PU2A 2HIOB 3UDFA 3T1RA 4NE6A 5B1MD 4OPZA 1WE4A 4OQGA 3ZGAB 4YS3D 2XD1A 2WYXA 3G34A 4UQIM 4E6WA 4Z2LA 4JGQA 1BFMA 1P3BB 4J8UB 5M18A 2WAEA 4YM6A 1T18A 3PAGA 4R6LA 4QD4A 3LYXA 5CHUA 3VE3A 2XR0A 3WWXA 3E2KA 1IKIA 4KZ7A 3AZLD 4Z66B 1ZLAB 4I5SA 3UE1A 3KYEA 4Z2GA 3D72A 4DRBA 4OP8A 2WKEA 2B95A 1MY8A 1S66L 3BY8A 5KDMA 5I5LA 3NJAA 5KMWA 3WTPA 3MGPD 4BQMA 2PYOC 3B0BA 1L0DA 1B67A 3UTBD 1GHMA 3NI9A 1MKIA 4IJEA 2PBDP 1M6KA 3AZHB 2Z2LB 5F99A 3PR6A 3ZCZA 2WUQA 3KSYA 1TZYD 3W96C 4WU8C 1AWIA 5CGXA 3D4FA 1P3MD 4UUZA 1KX4D 1P3AB 4DE1A 4J8WD 2R9XA 3AZMB 1SZVA 2W27A 5TBMB 5CPKB 4OQHA 5LBRA 2ZY2A 1PWGA 4ZUXA 1XP4A 3REJD 1FR1A 1ZG4A 5GT3B 4EUVA 3X1TB 5AV5D 1G68A 1HLUP 3MF0A 4ZJ2A 4KZ8A 2F8NG 5B32C 1U35A 4XUJC 2W3HA 1P97A 3L28A 3O88A 3UB6A 3VH6A 3UT9A 5CTMA 1PZRA 3LIFA 2PYOD 3FWLA 3IQAA 3B6GB 2WGWA 5CPJC 1W1TA 2M1CA 3MSHA 3T4SA 3WKJA 1ZG6A 1PIOA 1HQ3C 2IWCA 1TZYC 5J3WA 5FSRA 4EXOA 1P3IB 1MPLA 3MXRA 4NXGA 1KX5C 1XJ3A 3RH8B 3AZGD 1W8QA 5M19A 4JGRA 3AGEA 4OPRA 3VOZA 4QHCA 4WBGA 4J8VC 5BNXA 3W97B 3UT9C 3UB8A 3LY3A 1EQZD 5B33A 3MGPC 2EFUA 3BQAA 3ZG8B 4XUZA 3GR2A 1AOIC 4A5RA 3REKA 1FR6A 4YNRA 2VJWA 1Y28A 4KQDA 4YS3A 1KX3A 4XT2A 3NHQA 3O87A 4N92A 3WD4A 3WS5A 2BG1A 4YM6D 5F99D 1F2KA 3PBNA 3P98A 1DJBA 1SKOA 4H9NB 2A3UA 2X71A 4OKPA 3IF5A 2NUPC 2XQZA 3LI8A 1L0EA 5B40D 1P3AC 4WJ3C 3K2NA 3R45A 3REJB 5F82A 1N9BA 3CITA 1S32B 4BBVA 3G2ZA 4U0TA 1ES4A 3NBLA 2P74A 4Z5TD 5B24B 2HP9A 1AIWA 5B1LA 3TU4D 5B31G 3Q1FA 4H9OB 2Y91A 4NXFA 2DCFA 3IF6B 5E5AC 3AZND 3F1OA 3W97C 2ZC5B 3BY9A 3A6NB 2JN7A 2QPNA 4WELA 3BLSA 4IBCA 3DBAA 3MVDB 5B31C 3SZTA 5GSUD 5DNMC 5A90A 5CEDA 1UWNX 2ZMAA 3WS2A 4ZRRA 3MBZA 1JTDA 1L0GA 3V39A 1PI5A 2IO5B 3V67A 3LZ1C 1SKFA 3KO6A 4PMAA 3M2KA 1PFLA 4OLGA 4NYYA 5JRGB 4KQQA 1H3OA 3WD0A 2ZM2A 1DP9A 1SDNA 4LV2A 3UE3A 3H7WB 1H5XA 2HIOA 2O0YA 5HAPA 2VK3A 2PYRA 1TS7A 4HQAA 5FQJA 5AY8A 1YQSA 1YLWA 1DJCA 2FFFB 4P6BA 1P3BA 1W63M 3TG9A 4YM6B 2FJ7C 3UT9D 1YMXA 4Z2MH 1XJ2A 2WKPA 4P0MA 1OJGA 3MQ0A 5EOEA 3S7OA 5GT0D 1P3FB 3FPWA 4F94A 2K7SA 2NZDD 4OP5A 5CPJB 4IBIA 5DNMB 5DF8A 2XD5A 5KDMB 2K2NA 3WTPB 5J8XA 3MGRB 3W98A 2NQBC 1OMEA 1P3PD 4FTXA 4J8XA 5F5YA 4WZ4A 4I38A 1KX4C 4EO5B 3ZNTA 2XRNA 1TEMA 1VETA 2EXBA 4UA9A 3AZEB 5CTNA 5FQQA 3LELB 2J8YA 4HMDA 3UPNA 3ZVWA 5AV9B 2PBYA 3AZKA 2BYKA 3W8KA 1TD5A 1ACFA 3MZEA 1H8ZA 3QHYA 3HLEA 2NZDC 3KFUG 4WL9A 3B0DB 3BEBA 2YFWB 1ZLAD 4IBXA 3AZHC 3AV1C 3A3IA 4O8GA 2OV5A 2XK1A 3FYZA 3NULA 4KG6A 3B0CT 3IT9A 3SS3A 3RFBA 1LI9A 1L2SA 3MGPB 5GXQC 1BH9A 2RTSA 3UT9B 2VV6A 1P3KB 3LIBA 1P3MC 2NQBD 1KGGA 2JE5A 3B6GA 3CPTA 4J8WC 1BLHA 2XF3A 5FUGB 4LRZE 5EVIA 2VX8A 5FA7A 1PZOA 1MXOA 1TZYB 4JLFA 4WU9B 4II7A 3OZHA 4H9SC 1KX4B 5FATA 4H6JA 3LFVA 2G5IC 1P3GD 3AL0C 3MGSD 1G28A 5EM1A 3MGRD 3VSKA 1E6RA 4TX8A 3CG5A 3UTAC 3KSIA 5BNXB 4OH0A 1A0KA 4X1LA 3W97A 3W4OA 4G3WA 4GN2A 3AN2A 4MN6A 3PTEA 3PBSA 5BO0B 4KUKA 1B6WA 4UAAA 3VP1A 4IBJA 4QY6A 3VP0A 1MWSA 3AYWC 4LV0A 3TW8A 5B2IC 5EVLA 4KGCD 1OT9A 2H5SA 4ZJ3A 3M6BA 4Y17A 1KVMA 5AVFA 1SKOB 3D9YA 3ISGA 2B18A 5J4EA 2V0UA 3MQLA 4S2IA 4KQRA 4Z2JA 1NXYA 1J7MA 2A2LA 2AROD 4KZ5A 4JGOA 5B0ZB 2PD8A 3AZIC 1P3GC 1ID3D 3DTMA 4Z2KA 1OTAA 1P3LB 3CAXA 1M1AA 3QP4A 3UN7A 3B6FD 4S2NC 4D2OA 3C5AA 5FQKA 4H9RA 1D06A 1S4SA 5C5KA 2HZ5A 4GD6A 5AV9C 1UGUA 3LR0A 4O01A 2NQBA 3W98C 4S2JA 2V20A 1K6RA 3MGSB 4OQ0A 4IBDA 4BENA 4MB3A 1CK3A 1YLPA 5C3IC 4YS3C 3H9WA 3UTAA 3P7NA 3X1VC 1EQZA 4IVKA 3ZFZA 4P87A 5EUAA 3UO9A 5E5AD 3MGQB 3SW1A 2G2WA 1FOFA 3U4LP 2J3TD 3VH5A 3MGRC 4HBTA 3BYDA 5TGFA 2WGIA 2HUEC 1JFIA 1P9RA 1LSWA 4QLCD 2YKHA 3AZHA 2F8ND 2O9BA 3SH9A 5CPJA 4KUOA 5HAQA 3DWKA 2C6WB 4UUZB 2JKRI 3C1CD 4L9FA 4QY5A 3MXQA 1P3PC 4EWFA 1NYYA 3MGRA 3MKFA 4PM8A 2V2FF 1Q2QA 2WZXA 3O5YA 1BLPA 5CPID 4J8XB 1NLZA 5JRGD 3B47A 3JYIA 4JXWA 4MDZA 3X1TA 2WKQA 1CEGA 5CP6B 2PDRA 3IWIA 1S1YA 5DKKA 4S2KA 3LELA 4PAUA 2Y2JA 1T1BA 5B32D 1KVLA 2BYKB 2XSSA 1P3OA 4X25A 3ULFA 5G18A 2WGWB 2W1RA 3IF6C 5K5BA 1FILA 1E88A 1EROA 5A8BA 3V3SA 5CHJA 5FQIA 2EA9A 4LENA 2J8PA 4LPZA 1P3IA 3CLOA 4PM7A 3E0YA 1HTAA 3AV1A 5FAOA 3EPHA 2OWJA 5HDCA 3CPTB 3LI9A 5B33B 2GDNA 2WZZA 3HLBA 3DWZA 4CLCC 1ED7A 4RQ9A 5F83A 5FDSA 4Y0TA 3REKB 1OTDA 1TZYA 4G92B 3W96B 4WU9A 1SCWA 2VEAA 4LLOB 2QMIA 4KZAA 1KX4A 5HD5A 1Q9CA 1OTIA 3PHYA 3Q07A 2VZWA 4X68A 5AV6D 4S2NA 1NYMA 2DF4C 4H9NA 5DNMD 1X0OA 4GDBA 1BT5A 3IP4C 5B40C 5F68A 4E3IA 1LI0A 2PR5A 3IX8A 2V5OA 3F1PA 3R4KA 1P3AD 3LZ0B 4BD0A 4PKYA 4DRTA 4R4RA 3FKWA 1YLZA 1H3QA 3CI6A 5FAQA 3B3XA 5B2JC 3TU4C 3W4PA 3REHD 1O7EA 4MLLA 3IF6A 2VV7A 4DDYA 3HLCA 2VQRA 3A6NA 3HLDA 3MNNC 3EEAA 3MVDA 1VHMA 3UPPA 4WNNB 5B0ZA 3FG8A 4ZBEA 1IKGA 3SH7A 5KSCA 3VSLA 2J9PA 4YFMA 4X23C 5KZHA 2PHYA 5I94A 5GXQD 1P3LA 4IBKA 4JBFA 1M1AB 3KX0X 2V8CA 1KX5D 5GT3C 2ZQ8A 5GLBA 5JRGA 3ZG9B 3LUQA 3UNWA 3IXDA 1L6JA 4NY2A 1H3OB 3HUMA 3VP4A 4GHIB 3EWKA 5CPIC 4ZDXA 1M1AC 3C1BD 3PAEA 2XA7S 3OBFA 1AOID 4EQ1A 1YLTA 1TS6A 1O07A 2BTFP 4R3JA 3RTYA 4ETXA 3UTAB 3IHAA 1PRQA 3W99B 4RA7A 3AZGC 5FL3A 2ZLYA 1P3FA 1PZPA 2HF6A 2HPBA 5HWWA 4MEZA 4O7DA 1A7WA 1PI4A 1XJ4A 2DNSA 3MGQA 3L27A 4WMCA 1N4OA 3VOYA 3IBJA 4R3AA 4Y2FA 3W98B 4EBPA 2ZBBA 4KUDD 1KX3D 1OGGA 5AV8A 4LD9B 4KG5A 5HPIA 4Z66C 1KDWA 4YINA 4LRYC 2XLNA 2ZQAA 2KX6A 1KU5A 1XA7A 3MZDA 4GD8A 3C1BC 1E4DA 3E4QA 4DJ2A 3CZDA 5CXWA 1IFQA 2JKTM 4LCLA 3BJNA 3W99C 3H0MC 5AV9A 3W2ZA 3AZKB 2VGLM 2IWDA 1STZA 2D02A 3N8RA 4E6XA 3PXPA 4HP4A 3DTEA 2EXAA 5G4YA 3REIA 1E25A 1ID3B 2YFWA 1EAKA 2B5RA 4HJ3A 5EECA 3ZG0A 4C75A 1XPBA 4IJFA 3WS0A 4U0XA 5CHLB 4XZQD 1WYBA 4CJNA 1H8MA 3X1VD 1P3OB 4LGWA 2FJ7D 2V8FA 3QP5A 3NECA 3L26A 1PW1A 5FUGA 4CAYA 5EVIB 3RELC 1QMEA 3VOLA 4R8PC 1S6RA 3DAVA 2V1BA 3AGFA 4JKTA 1KDSA 1P3OC 4C6YA 4KZBA 2H10A 2PD7A 3AZLC 3C30A 1GA9A 3HVFA 5DVAA 4BBTA 5GHZA 1ZKJA 4WMCD 3GV9A 4FOFA 4FH2A 2ZC3B 4J8XD 4X23B 1ID3C 3S7QA 1YU0A 2UV0E 3DTKA 2E8IA 3W96A 1K56D 4ZBJB 4X1MA 1BYWA 3IBRA 5GL9A 3AZMD 3AZJD 1KX3C 2GNXA 2PAVP 3PBQA 2J9OA 3WD3A 3V50A 1YSQA 1F9IA 5CPIA 4FUWA 3C1CB 1EQZC 1ZC2A 1RGYA 4WEKA 1ONGA 2Y59A 3F1PB 3AZED 2EX6A 3IX4A 1E6NA 3LELD 1OTEA 1W79A 3IS2A 1T1AA 2JKTI 2PU4A 3HREA 3M2JA 3V9RB 1Z2CB 3FC7A 1N9OA 4NXEA 4R3BA 4N9KA 1P34C 1NRFA 2OOLA 2CV5D 1M18C 3T4TA 3E4OA 5EVID 2ZQ7A 4I39A 4XUXA 2M7VA 3X1UC 1RP5A 2B02A 2OAQ1 2NQBB 2OAP1 3RJUA 4E3NA 5GT3D 3MGSA 5U47A 3IH9A 3G4PA 5CECA 3F6TA 1GSXA 1ES3A 1HQ3D 2QWSA 4IUKA 1D1JA 3C1CC 1EQZB 4KZ9A 5CGWA 1BLCA 4GHIA 5AV5C 3AFAD 1T1CA 2GZAA 4WU9D 4DXBA 5F1FA 3T12B 1N1JB 4R23A 1P3GB 4E3LA 3VV4A 3IX3A 2JHEA 1NLYA 4Y5FA 4EU0A 4UHUA 1SHVA 2ZQDA 1JFIB 3REHB 4UPKA 4UQIS 4WLAA 2CV5C 3KSGA 3T1SA 2O9AA 2PT7A 4DMZA 3SS4A 2WGVA 4MBFA 2R9WA 3O62C 2L4RA 1NWZA 1E6PA 3Q82A 3AYWB 2INWA 4PPRA 1GSVA 3UPOA 2AROB 4LD9A 3AZNB 1K55A 2L0WA 3TSGA 3MNND 5CP6A 2A24A 2WK0A 3BW6A 4ARZA 3KUYC 3B6FB 5TR7A 1Y4OA 5IHVA 3O62A 4GHLA 1P3LD 1C3BA 4FD8A 2XA7M 1N9NA 4ME4A 5HL6A 1OTBA 3LZ1A 4JJND 5F6AA 2GJ3A 1AXBA 3P09A 1S32D 4WYYA 1YPRA 3ZG7B 4E3KA 2OWHA 4EBNA 4K0WA 1W8YA 3IHBA 3MQQA 5GXQB 3WAAD 3GECA 3PBOA 3ZNYA 2W3DA 4DE2A 4Z5TC 5DJUA 3AV1B 3C1BB 4KUDB 2HP5A 5E2HA 5FQ9A 1AOIB 2NZDB 4H8RA 3MGSC 3KUYA 4CLCD 3H82A 1Z09A 3A3FA 4B4ZA 1L3LA 4H9PA 4NZ3A 5B31D 1K54A 5JA4B 3OCNA 3EGDC 2W1TB 1JVJA 3N4IA 1H8PA 4OJPA 2P7JA 4DE3A 4EERA 4JJNC 2DQNC 3T50A 2HJ9C 1JWPA 5L10A 3MJQA 4AWLB 3KSFA 1P3LC 5B0YC 4X55A 1LL9A 4Z2IA 2I9VA 1KGFA 2KDKA 3WD2A 1FSWA 3LZ0A 2PYOA 5AVBD 4C3QA 3L9KA 4I3IA 3UDIA 2XEPA 4R70A 4XZQB 5CPIB 3EEHA 1IELA 3X1TC 4WU8A 3LIEA 3H0RC 2WKIA 1P3FC 4Z1WA 1V9YA 5CERA 5B0YA 1IYOA 4IBRA 3A1IA 4IEDA 5BNVA 2RL3A 3N6IA 4GS9A 3WS1A 4NETA 5TFQA 5CPKD 4WNNA 3LJAD 1TDGA 1YLJA 2VA0A 4CLCE 3PYPA 2YKFA 4X56A 3V9RA 4Z9QA 4I3JA 3LY4A 4K91A 1G6OA 1TDLA 5B32A 4AWLC 5DFYA 4HIAA 3KXBC 4MMNA 3X1VB 4JXSA 2A49A 3LGOA 3D3OA 3HBRA 3KSHA 4P6ZM 1CI8A 4NZ1A 4LD9C 4KZ3A 2IWBA 1I5QA 5HARA 5HW3A 3KXBD 1K55C 3W99A 3AV2A 1P3KC 1YU3A 3Q7VB 3N7WA 3LELC 5FEFA 4BMWA 4EETB 3REKD 3W96D 3UB5P 1YU1A 3GVBA 5JYOA 2VGKA 4GH9A 1KGEA 3V3RA 1HD8A 2QJ7A 1LLBA 3AZIB 3NC8A 4JF6A 1CI9A 2ZM0A 3UTBC 1FCMA 2EFXA 3REHA 1BLSA 3MZFA 5FAPA 5AV8B 3LZ0D 4WZ5C 5FASA 1F66D 2ZY3A 3KWQD 1YAXA 4IVIA 4R38A 3QP8A 1IOUA 5AV6A 2H28A 4IHQA 3AZEC 4WM9A 5D3OA 5HDDA 4NEED 4GW9A 3VP3A 3L29A 5HWVA 3GRJA 3G6OA 3ITBA 2EX8A 3AYWA 2OLVA 1LL5A 2HIOD 4YM6C 4OJ5A 5HDSA 2AROA 4JGPA 3AZNA 1K38A 1LSVA 3K3CA 3DTIA 5DNNC 3REIB 1ID3A 1WWIA 1FIKA 1GHPA 4F3LA 1KX5B 2JBFA 3B6FA 1XX2A 1YLYA 2FH5A 1MWRA 2QZ6A 3O62B 4BBUA 3MFDA 3A3JA 3LZ1B 3LR3A 2XH9A 3BFFA 1HQ3A 4R4SA 5B0ZD 1LSXA 1FQGA 2Y2MA 4GHAA 3QP1A 1GHIA 2ZY4A 3WA9A 4CAYB 2JKFA 3AFAA 3LZ0C 2W3EA 3UE6A 4KQOA 1DP8A 2HP6A 3VE4A 2ZM5A 2VV8A 3W99D 1TVFA 1NRJA 5B2JD 4P85A 3TOIA 4ETZA 3LEZA 4IBFA 2LY8A 2QYBA 2EWWA 4KUDA 1K25A 4G3KA 5GSUC 2EX9A 4HOIA 2BYMA 3K3DA 2NZDA 5AV8D 4E04A 1GXDA 3F1NB 4X23A 3IWOA 3H82B 1K0KA 3N8LA 1ESIA 4H9PB 1OPXA 2Y55A 1VM1A 5JA4A 1K4EA 3ZYTA 3KWQA 1UWPX 5E5AB 3MGQD 1ODVA 3C4PA 3AV2D 2RVQD 4LD9D 3E2LA 3CUEC 4EO5C 3C1CA 3WX7A 4IUHA 2OLUA 4ZUXD 5CP6D 4GKUA 3QP2A 5AV5A 1LHYA 5AVEA 4HGAC 2PYOB 5DKLA 1VQQA 3IS2B 2J3TC 3VH5W 4XUJD 4OLDA 4XZQA 4EEPA 1M19A 1F1EA 3VH5T 1ZLAC 4H9QA 2XGNA 5AV9D 2PYPA 4OJLA 2Q0OA 1W2EA 5BNVB 3HCYA 5HPFA 3X1SB 2FJ7B 4S2OA 5B0ZC 1J3WA 1DJAA 2JCHA 3CUEA 2M7UA 5AVBC 1TF1A 4J8VB 3HSHA 4HHDA 1OGBA 3WAAB 4KGCA 5DNNB 3REIC 3AZFA 1FCNA 3TRCA 2ACGA 3FV7A 2W3FA 5B32B 2X02A 1DP6A 3A0SA 2ZC4B 3X1UA 1W1YA 5JRGC 1I2WA 1LL8A 1PW8A 5A92A 2XFSA 4LFUA 1N1JA 4NZ4A 3BFDA 1P3GA 2ZL1B 3P01A 4JPMA 1P34D 4S2PA 4X23D 4OOYA 2RIQA 1TS8A 3B6GC 5HX9A 1XKZA 2NUTC 1YT4A 4DDSA 3KS8A 3AZMC 5B31B 3MVDC 4R8PB
chains in the Genus database with same CATH topology
5FDHA 4GZBA 1MWUA 1FSYA 5EVIC 5BS7A 5L2FA 3VP2A 4K0XA 4KGCC 1TAFA 3HLGA 4QJGA 5AVBA 2Y2KA 1K56A 4Z5TA 4N1XA 5B1LD 3TU4A 1ALQA 3C7VA 1XGIA 2EX2A 5AV6B 5AV8C 3AZKC 5B1LC 3S22A 1PYYA 5A91A 5GLDA 3C7UA 1EWZA 3G35A 5B1MA 4XXRA 1RCJA 1L0FA 3MKEA 1BH8B 3GMWA 4GB7A 1HVBA 1NZOA 5GXQA 5B32G 1KX5A 4QLCA 1K4FA 1P3IC 3AZID 4CSRA 3N3FA 1HQ3B 3C1BA 3M6HA 3ZG5A 1AOIA 3LO7A 3RXWA 3AZLB 3KUYB 4WEJA 3AFAB 1W5DA 3G30A 5B2IB 2XDMA 3NDGA 1SDEA 3VH6T 2XFTA 1JWVA 4ID4A 2Y2PA 4QLCC 1I2SA 3SH8A 1IYQA 3FKEA 3O3VA 2BYMB 5GHYA 3PBTA 3B0CW 3X1UD 3BM6A 2HDRA 3OPPA 4NE5A 3WRTA 4J8WB 3NQJB 3A3DA 4UA6A 4NFTA 2Y2OA 3O62D 3MNNB 1XGJA 4WU8B 1HZOA 3IWQA 4FH4A 5B0YB 4X6TA 4DRAA 3EQUA 5AV5B 2FFYA 5GHXA 1P3KD 4JJNB 5E2EA 1IYPA 5CEBA 2G5HC 3B0DC 3SS5A 3HLFA 4R0QA 4JXGA 1M19B 2WAFA 3UDXA 4B4XA 4H9QB 5EPHA 5B24C 3EG5B 3X1VA 3HUOA 3NIAA 2FJ7A 1P3BC 4OOLA 4CPKA 4MBHA 2HDSA 5KSHA 3AZGB 4Y7PA 4RX2A 4J8VA 4G92C 3AV2B 1ES2A 4KGCB 3Q7VA 3AZFB 2Z2MB 3AZNC 4KZ4A 2AROC 5BT1C 3AN2D 1E3UA 3BECA 3H0LC 4QU3A 2ZQCA 4EQIA 4OUIA 4B88A 5B40A 4DF6A 3B6FC 2Y2QA 3AZIA 4E44A 4M6BA 4HBUA 4WU8D 3N8SA 4ZBJC 3WAAC 2YFVB 4ZTKA 5AQ7A 5B0YD 4JXVA 1Q2PA 4WZSB 5AVBB 3OPLA 2JC7A 5CHMA 4XUJA 3Q7ZA 3TU4B 2IO5C 1IYSA 4EV4A 5DNND 2CV5B 1XA1A 5BT1D 3AN2C 5DTSA 3LCEA 4S2LA 1ULYA 2IOUA 5F99C 4HGAB 2G2UA 4J8UD 1GCEA 1M18B 5AY8D 1BH8A 4R8PD 1G6AA 1P3BD 3WTPD 3WA9B 2ZQ9A 1M1AD 4H9SA 4KHAA 4J8VD 1NZUA 3REJC 3REKC 1YU4A 4BLMA 2F8NB 4EBLA 3UTBB 3WKJC 3QNCA 3WA9C 1P34B 4KG2A 5B2IA 1F66C 3KXBA 2Y4AA 4E3MA 3PBRA 2Q9MA 3ZHHA 1J9MA 3KWQB 3BLMA 5E5AA 4L0LA 4LCMA 3GTCA 5DTKA 3OCLA 4M3KA 4GNUA 1E3UD 4OPYA 4IBEA 2Q9NA 4HEFA 5JYPA 5HL1A 1MWTA 1F66A 1W7FA 3L2AA 4ZAMA 3OPRA 3NY4A 2HDQA 3REHC 4BJPA 3MNNA 3RELB 3G2YA 3C4OA 1M18D 4ZJ1A 4JF5A 1PWCA 3AYWD 5BS7C 4KZ6A 3WA9D 2RVQC 4JJNA 1U35D 2ZC6B 4PM6A 3X1SA 2H0TA 3UY6A 5B33D 4DQYB 5EE8A 5AY8C 4XZQC 4Q8IA 3HUNA 3WAAA 5DNNA 3EPKA 4HESA 3X1UB 5GT0C 1P3OD 3W97D 5CGSA 1Y54A 3A3EA 4N1HA 4OVDA 4RX3A 2F8NK 3A1KA 3KUYD 5GLAA 3DW0A 5B1MC 5B31A 4R8PA 5B2JA 3P5JB 3S1YA 4IBGA 1U60A 1T3UA 3OC2A 5HAIA 3AV1D 1TAFB 3KWQC 1P3AA 4DE0A 4WV4B 5B40B 5E43A 3UE0A 1BTLA 4MNRA 3AZJC 4NYUA 4KUDC 1ESUA 1ERQA 4Z5TB 5B24D 5GLCA 1M19D 3AZJB 3NQUB 3IH8A 3GQZA 5GT3A 3A6ND 2P9VB 1YU2A 4WZ5A 2HIOC 2ZM8A 3MVDD 4N9LA 3LJAB 5AV6C 2CC1A 1KE0A 1YM1A 5DF7A 5B1MB 3FDDA 1CEFA 1ERMA 4E45A 3EPLA 3CJMA 2CV5A 2ZD8A 3HL9A 5GSUA 5G49B 4QLCB 4Z66D 4DKIA 4OJOA 3G32A 3WTPE 1BSGA 4CSRB 1IEMA 1M18A 3BFGA 4ZUXC 3EQVA 3VMAA 3AFAC 5AVCB 3HLWA 1P3FD 3AZLA 5CP6C 4KHAB 4WU9C 1ONHA 3BFEA 3AZHD 3G31A 5CPJD 4Z2MG 5AQ9A 3LJAC 5GT0A 1P3MB 3UTBA 1P3PB 1R4VA 5DF9A 4QB8A 3X1SC 3GSGA 2UWXA 4RYEA 1S32A 5E2GA 1XXMA 4J8WA 3NQJA 2HUEB 3X1TD 5B1LB 4PM9A 1KE4A 3A6NC 2HDUA 5BPVA 2Y2NA 3FZCA 1F66B 2H0YA 3Q81A 4NK3A 5AQBA 3NCKA 1QMFA 1S32C 4J8UA 4OOMA 2F2AC 3LZ1D 4OPQA 5E2FA 4E3OA 5FI2A 4UA7A 2VGJA 4U3TA 1GA0A 1P3ID 4OQIA 5AVCD 4Z66A 1ZLAA 3WTPC 1U35C 1M40A 4GDNA 1K6SA 1M19C 1HTZA 3RXXA 3VFHA 3V5MA 1K54C 3MXSA 3I7JA 3REID 3VFFA 5AY8B 4E3JA 3OPHA 4Y0OA 2DRWA 5M1AA 4JF4A 3AZGA 4RVAA 4G91C 3B6GD 4NZ5A 4J8XC 2ZJ9A 5F99B 5B2ID 5EOOA 1YMSA 1K57A 5CRFA 5DNMA 3IXGA 3O86A 4X53A 3WRZA 4DXCA 3EPJA 4PM5A 2F8NH 4OJ6A 3AZMA 3CMZA 4G91B 3IXHA 3IXBA 4FSFA 2Y2LA 3ZVTA 1Z6FA 3RELD 5B2JB 1DY6A 5CPKA 2WADA 2Y2IA 5AVCC 4ZUXB 2YFVA 1MBLA 3ZDJA 5AQAA 2C5WB 2W8SA 4OONA 3AZEA 4BL2A 1U35B 4S2MA 1BUEA 3AZFC 3HONA 4XUJB 4QNLA 4NE3A 4X69A 2OSUA 3AGDA 3AZJA 3NQUA 5CPKC 3BFCA 2P9VA 3FKVA 4BD1A 5C3IB 3L25A 3QNBA 3WKJB 3UTAD 1BZAA 3X1SD 4LG2A 3LJAA 3MGPA 5B33C 1NY0A 5F1GA 1BH9B 3S4XA 3AV2C 1P3KA 3ITAA 2L5AA 1PWDA 2J7VA 3MGQC 4GOGA 5FI7A 2CWEA 1ES5A 5GSUB 4YS3B 1KX3B 5G49A 4R1GA 4LV1A 3AZFD 3VH6W 2F8NA 4IBBA 3KS4A 2BLSA 2Y2HA 1NJ4A 5AVCA 2RCXA 4KENB 1YUEA 1JWZA 3AN2B 1FCOA 1P34A 5BO0A 2I72A 3R45B 1WWSA 3REJA 4MBKA 3NDEA 3KXBB 3W4QA 5BOHA 1EI5A 4J8UC 4BL3A 5A93A 2JSSA 3SOIA 4LV3A 3W98D 5GT0B 5B24A 1P3MA 1KE3A 1P3PA 4H9OA 1S0WA 1RGZA 2WKHA 2ZY5A 1H8YA 5DTTA 3WS4A 3WKJD 1BULA 1WYCA 2Y2GA 3AZKD 4Y0UA 3RELA 1K57C 2X01A 4FCFA 5FI6A 4H9RB 1JTGA 3BRMA 5FQMA 4EUZA 2V1ZA 2ZC7A 5HFOA 2PU2A 2HIOB 3UDFA 4NE6A 5B1MD 4OPZA 1WE4A 4OQGA 3ZGAB 4YS3D 2XD1A 2WYXA 3G34A 4E6WA 1BFMA 1P3BB 4J8UB 5M18A 2WAEA 4YM6A 3PAGA 4QD4A 5CHUA 2XR0A 3WWXA 3E2KA 1IKIA 4KZ7A 3AZLD 4Z66B 1ZLAB 3UE1A 4DRBA 4OP8A 2WKEA 1MY8A 5KDMA 5KMWA 3WTPA 3MGPD 4BQMA 2PYOC 3B0BA 1L0DA 1B67A 3UTBD 1GHMA 3NI9A 1MKIA 4IJEA 1M6KA 3AZHB 2Z2LB 5F99A 3ZCZA 2WUQA 3KSYA 1TZYD 3W96C 4WU8C 5CGXA 3D4FA 1P3MD 4UUZA 1KX4D 1P3AB 4DE1A 4J8WD 2R9XA 3AZMB 5CPKB 4OQHA 2ZY2A 1PWGA 4ZUXA 1XP4A 3REJD 1FR1A 1ZG4A 5GT3B 3X1TB 5AV5D 1G68A 4ZJ2A 4KZ8A 2F8NG 5B32C 1U35A 4XUJC 3L28A 3O88A 3VH6A 3UT9A 5CTMA 1PZRA 2PYOD 3FWLA 3IQAA 3B6GB 2WGWA 5CPJC 3WKJA 1ZG6A 1PIOA 1HQ3C 2IWCA 1TZYC 5FSRA 1P3IB 1MPLA 3MXRA 1KX5C 3AZGD 1W8QA 5M19A 3AGEA 4OPRA 3VOZA 4QHCA 4WBGA 4J8VC 5BNXA 3W97B 3UT9C 3LY3A 1EQZD 5B33A 3MGPC 2EFUA 3ZG8B 4XUZA 3GR2A 1AOIC 4A5RA 3REKA 1FR6A 4YS3A 1KX3A 3O87A 4N92A 3WS5A 2BG1A 4YM6D 5F99D 3PBNA 3P98A 1DJBA 4H9NB 2A3UA 2X71A 4OKPA 3IF5A 2XQZA 1L0EA 5B40D 1P3AC 4WJ3C 3R45A 3REJB 5F82A 1N9BA 1S32B 3G2ZA 4U0TA 1ES4A 3NBLA 2P74A 4Z5TD 5B24B 2HP9A 5B1LA 3TU4D 5B31G 3Q1FA 4H9OB 2Y91A 2DCFA 3IF6B 5E5AC 3AZND 3W97C 2ZC5B 3A6NB 2QPNA 4WELA 3BLSA 4IBCA 3MVDB 5B31C 5GSUD 5DNMC 5A90A 5CEDA 3WS2A 2ZMAA 3MBZA 1JTDA 1L0GA 3V39A 1PI5A 2IO5B 3LZ1C 1SKFA 4PMAA 3M2KA 4OLGA 4NYYA 5JRGB 4KQQA 1H3OA 2ZM2A 1SDNA 4LV2A 3UE3A 1H5XA 2HIOA 5HAPA 5FQJA 5AY8A 1YQSA 1DJCA 2FFFB 1YLWA 4P6BA 1P3BA 3TG9A 4YM6B 2FJ7C 3UT9D 1YMXA 4Z2MH 4P0MA 5EOEA 5GT0D 1P3FB 4F94A 2NZDD 4OP5A 5CPJB 4IBIA 5DNMB 5DF8A 2XD5A 5KDMB 3WTPB 5J8XA 3MGRB 3W98A 2NQBC 1OMEA 1P3PD 4J8XA 4WZ4A 1KX4C 4EO5B 3ZNTA 1TEMA 2EXBA 4UA9A 3AZEB 5CTNA 5FQQA 3LELB 2J8YA 3UPNA 3ZVWA 5AV9B 2PBYA 3AZKA 2BYKA 3W8KA 3MZEA 1H8ZA 3QHYA 3HLEA 2NZDC 3KFUG 3B0DB 3BEBA 2YFWB 1ZLAD 4IBXA 3AZHC 3AV1C 3A3IA 2OV5A 2XK1A 3FYZA 3SS3A 4KG6A 3B0CT 3IT9A 1LI9A 1L2SA 3MGPB 5GXQC 1BH9A 3UT9B 1P3KB 1P3MC 2NQBD 1KGGA 2JE5A 3B6GA 4J8WC 1BLHA 2XF3A 5FUGB 5EVIA 5FA7A 1PZOA 1MXOA 1TZYB 4JLFA 4WU9B 3OZHA 4H9SC 1KX4B 5FATA 2G5IC 1P3GD 3AL0C 3MGSD 3MGRD 3VSKA 3CG5A 3UTAC 4OH0A 5BNXB 3W4OA 3W97A 4GN2A 3AN2A 3PTEA 3PBSA 5BO0B 1B6WA 4UAAA 3VP1A 4IBJA 4QY6A 3VP0A 1MWSA 3AYWC 4LV0A 5B2IC 5EVLA 4KGCD 2H5SA 4ZJ3A 3M6BA 1KVMA 3ISGA 4S2IA 4KQRA 1NXYA 2AROD 4KZ5A 5B0ZB 3AZIC 1P3GC 1ID3D 3DTMA 1P3LB 1M1AA 3UN7A 3B6FD 4S2NC 4D2OA 3C5AA 5FQKA 4H9RA 4GD6A 5AV9C 2NQBA 3W98C 4S2JA 2V20A 1K6RA 3MGSB 4OQ0A 4IBDA 4BENA 1CK3A 1YLPA 5C3IC 4YS3C 3UTAA 3X1VC 1EQZA 4IVKA 3ZFZA 4P87A 5EUAA 3UO9A 5E5AD 3MGQB 2G2WA 1FOFA 3VH5A 3MGRC 4HBTA 3BYDA 5TGFA 2WGIA 2HUEC 1JFIA 4QLCD 3AZHA 2F8ND 3SH9A 5CPJA 5HAQA 3DWKA 2C6WB 4UUZB 3C1CD 4QY5A 4EWFA 1P3PC 3MGRA 1NYYA 3MKFA 4PM8A 2V2FF 1Q2QA 2WZXA 1BLPA 5CPID 4J8XB 5JRGD 3JYIA 4JXWA 3X1TA 1CEGA 5CP6B 3IWIA 4S2KA 3LELA 2Y2JA 5B32D 1KVLA 2BYKB 1P3OA 5G18A 2WGWB 3IF6C 1EROA 3V3SA 5CHJA 5FQIA 4LENA 2J8PA 1P3IA 4PM7A 1HTAA 3AV1A 5FAOA 3EPHA 5B33B 2GDNA 2WZZA 3HLBA 3DWZA 4Y0TA 5F83A 3REKB 1TZYA 4G92B 3W96B 4WU9A 1SCWA 2QMIA 4KZAA 1KX4A 1Q9CA 3Q07A 4X68A 5AV6D 4S2NA 1NYMA 2DF4C 4H9NA 5DNMD 4GDBA 1BT5A 3IP4C 5B40C 4E3IA 1LI0A 1P3AD 3LZ0B 4BD0A 4DRTA 4R4RA 3FKWA 1YLZA 5FAQA 3B3XA 5B2JC 3TU4C 3W4PA 3REHD 1O7EA 4MLLA 3IF6A 4DDYA 3HLCA 2VQRA 3A6NA 3HLDA 3MNNC 3MVDA 3UPPA 4WNNB 5B0ZA 4ZBEA 1IKGA 3SH7A 5KSCA 3VSLA 2J9PA 4YFMA 4X23C 5KZHA 5I94A 5GXQD 1P3LA 4IBKA 4JBFA 1M1AB 1KX5D 5GT3C 2ZQ8A 5GLBA 5JRGA 3ZG9B 3UNWA 3IXDA 4NY2A 1H3OB 3HUMA 3VP4A 5CPIC 4ZDXA 1M1AC 3C1BD 3PAEA 1AOID 1YLTA 1O07A 4R3JA 3UTAB 3IHAA 3W99B 4RA7A 3AZGC 2ZLYA 1P3FA 1PZPA 2HPBA 4MEZA 4O7DA 1A7WA 1PI4A 2DNSA 3MGQA 3L27A 4WMCA 1N4OA 3VOYA 3W98B 4EBPA 4KUDD 1KX3D 5AV8A 4LD9B 4KG5A 4Z66C 1KDWA 4YINA 2XLNA 2ZQAA 1KU5A 1XA7A 3MZDA 4GD8A 3C1BC 1E4DA 3CZDA 5CXWA 4LCLA 3W99C 3H0MC 5AV9A 3AZKB 2IWDA 3N8RA 4E6XA 2EXAA 3REIA 1E25A 1ID3B 2YFWA 2B5RA 5EECA 3ZG0A 4C75A 1XPBA 4IJFA 3WS0A 4U0XA 5CHLB 4XZQD 1WYBA 4CJNA 3X1VD 1P3OB 2FJ7D 3L26A 1PW1A 5FUGA 4CAYA 5EVIB 3RELC 1QMEA 4R8PC 1S6RA 3AGFA 4JKTA 1KDSA 1P3OC 4C6YA 4KZBA 2H10A 3AZLC 1GA9A 3HVFA 5DVAA 5GHZA 1ZKJA 4WMCD 3GV9A 4FH2A 2ZC3B 4J8XD 4X23B 1ID3C 1YU0A 2E8IA 3W96A 1K56D 4ZBJB 5GL9A 3AZMD 3AZJD 1KX3C 3PBQA 2J9OA 3V50A 5CPIA 3C1CB 1EQZC 1ZC2A 1RGYA 4WEKA 1ONGA 2Y59A 3AZED 2EX6A 3LELD 1W79A 2PU4A 3HREA 3M2JA 3V9RB 1Z2CB 4R3BA 4N9KA 1P34C 1NRFA 2CV5D 1M18C 5EVID 2ZQ7A 4XUXA 3X1UC 1RP5A 2NQBB 3RJUA 4E3NA 5GT3D 3MGSA 5U47A 3IH9A 3G4PA 5CECA 3F6TA 1ES3A 1HQ3D 3C1CC 1EQZB 4KZ9A 5CGWA 1BLCA 5AV5C 3AFAD 4WU9D 4DXBA 5F1FA 1N1JB 4R23A 1P3GB 4E3LA 4UHUA 1SHVA 2ZQDA 1JFIB 3REHB 4UPKA 2CV5C 3SS4A 2WGVA 4MBFA 2R9WA 3O62C 3Q82A 3AYWB 4PPRA 3UPOA 2AROB 4LD9A 3AZNB 1K55A 3TSGA 3MNND 5CP6A 2WK0A 3KUYC 3B6FB 5TR7A 5IHVA 3O62A 4GHLA 4FD8A 1P3LD 1C3BA 3LZ1A 4JJND 1AXBA 3P09A 1S32D 4WYYA 3ZG7B 4E3KA 4EBNA 4K0WA 1W8YA 3IHBA 5GXQB 3WAAD 3PBOA 3ZNYA 4DE2A 4Z5TC 3AV1B 3C1BB 4KUDB 2HP5A 5E2HA 5FQ9A 1AOIB 2NZDB 4H8RA 3MGSC 3KUYA 3A3FA 4B4ZA 4H9PA 4NZ3A 5B31D 1K54A 5JA4B 3OCNA 1JVJA 3N4IA 4OJPA 4DE3A 4JJNC 2DQNC 1JWPA 4AWLB 1P3LC 5B0YC 4X55A 1LL9A 1KGFA 1FSWA 3LZ0A 2PYOA 5AVBD 4C3QA 3UDIA 2XEPA 4XZQB 5CPIB 1IELA 3X1TC 4WU8A 3H0RC 2WKIA 1P3FC 5CERA 5B0YA 1IYOA 4IBRA 3A1IA 4IEDA 5BNVA 2RL3A 3N6IA 3WS1A 4NETA 5TFQA 5CPKD 4WNNA 3LJAD 1TDGA 1YLJA 4X56A 3V9RA 4Z9QA 3LY4A 4K91A 1TDLA 5B32A 4AWLC 3KXBC 3X1VB 4JXSA 2A49A 3HBRA 1CI8A 4NZ1A 4LD9C 4KZ3A 2IWBA 1I5QA 5HARA 5HW3A 3KXBD 1K55C 3W99A 3AV2A 1P3KC 1YU3A 3Q7VB 3N7WA 3LELC 3REKD 3W96D 1YU1A 3GVBA 5JYOA 2VGKA 4GH9A 1KGEA 3V3RA 1HD8A 1LLBA 3AZIB 3NC8A 4JF6A 1CI9A 2ZM0A 3UTBC 1FCMA 2EFXA 3REHA 1BLSA 3MZFA 5FAPA 5AV8B 3LZ0D 4WZ5C 5FASA 1F66D 2ZY3A 3KWQD 4IVIA 5AV6A 3AZEC 4WM9A 5D3OA 3VP3A 3L29A 3GRJA 3ITBA 2EX8A 3AYWA 2OLVA 1LL5A 2HIOD 4YM6C 4OJ5A 2AROA 3AZNA 1K38A 5DNNC 3REIB 1ID3A 1WWIA 1GHPA 1KX5B 2JBFA 3B6FA 1XX2A 1YLYA 1MWRA 2QZ6A 3O62B 3MFDA 3A3JA 3LZ1B 3BFFA 2XH9A 1HQ3A 4R4SA 5B0ZD 1FQGA 2Y2MA 4GHAA 1GHIA 2ZY4A 3WA9A 4CAYB 3AFAA 3LZ0C 4KQOA 2HP6A 2ZM5A 3W99D 1TVFA 5B2JD 4P85A 3TOIA 3LEZA 4IBFA 2LY8A 4KUDA 1K25A 5GSUC 2EX9A 2BYMA 2NZDA 5AV8D 3IWOA 4X23A 3N8LA 1ESIA 4H9PB 2Y55A 1VM1A 5JA4A 1K4EA 3KWQA 5E5AB 3MGQD 3C4PA 3AV2D 2RVQD 4LD9D 3E2LA 4EO5C 3C1CA 3WX7A 2OLUA 4ZUXD 5CP6D 4GKUA 5AV5A 1LHYA 4HGAC 2PYOB 1VQQA 3VH5W 4XUJD 4OLDA 4XZQA 1M19A 1F1EA 3VH5T 1ZLAC 4H9QA 2XGNA 5AV9D 4OJLA 1W2EA 5BNVB 3X1SB 2FJ7B 4S2OA 5B0ZC 1DJAA 2JCHA 5AVBC 4J8VB 3HSHA 3WAAB 4KGCA 5DNNB 3REIC 3AZFA 1FCNA 3FV7A 5B32B 2X02A 2ZC4B 3X1UA 5JRGC 1I2WA 1PW8A 5A92A 2XFSA 1N1JA 4NZ4A 3BFDA 1P3GA 4JPMA 1P34D 4S2PA 4X23D 4OOYA 2RIQA 5HX9A 3B6GC 1XKZA 1YT4A 4DDSA 3KS8A 3AZMC 5B31B 3MVDC 4R8PB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XD5 A;  5FDH A;  4GZB A;  1MWU A;  1FSY A;  5EVI C;  5L2F A;  1K56 D;  5J8X A;  3VP2 A;  4K0X A;  1OME A;  5DF9 A;  3HLG A;  4QB8 A;  5GL9 A;  4QJG A;  3GSG A;  3PBQ A;  2J9O A;  3V50 A;  4WZ4 A;  2UWX A;  4RYE A;  3ZNT A;  5E2G A;  2Y2K A;  1K56 A;  1TEM A;  1XXM A;  2EXB A;  4N1X A;  1ALQ A;  1ZC2 A;  3C7V A;  4UA9 A;  5CTN A;  1RGY A;  1XGI A;  5FQQ A;  4WEK A;  1ONG A;  2EX2 A;  2Y59 A;  2EX6 A;  2J8Y A;  3UPN A;  4PM9 A;  3ZVW A;  1KE4 A;  2PBY A;  2HDU A;  3W8K A;  1W79 A;  3MZE A;  1H8Z A;  3S22 A;  1PYY A;  2PU4 A;  3QHY A;  3HRE A;  2Y2N A;  3HLE A;  3M2J A;  3FZC A;  5A91 A;  5GLD A;  3BEB A;  3C7U A;  4IBX A;  1EWZ A;  2H0Y A;  3G35 A;  3A3I A;  3NCK A;  3Q81 A;  4NK3 A;  4R3B A;  5AQB A;  2OV5 A;  4N9K A;  2XK1 A;  3FYZ A;  4XXR A;  3SS3 A;  1NRF A;  1RCJ A;  1L0F A;  3IT9 A;  1QMF A;  4KG6 A;  4OOM A;  3MKE A;  1LI9 A;  2ZQ7 A;  5EVI D;  4OPQ A;  4XUX A;  5E2F A;  3GMW A;  1L2S A;  4GB7 A;  5FI2 A;  4UA7 A;  2VGJ A;  4E3O A;  4U3T A;  1GA0 A;  1HVB A;  1RP5 A;  4OQI A;  1NZO A;  3RJU A;  1K6S A;  4E3N A;  1M40 A;  4GDN A;  5U47 A;  3IH9 A;  1HTZ A;  3RXX A;  3VFH A;  1KGG A;  2JE5 A;  3G4P A;  3V5M A;  5CEC A;  1K54 C;  1ES3 A;  1BLH A;  1K4F A;  2XF3 A;  3MXS A;  5EVI A;  3I7J A;  5FA7 A;  3VFF A;  1PZO A;  1MXO A;  4KZ9 A;  4JLF A;  5CGW A;  3M6H A;  3ZG5 A;  1BLC A;  4E3J A;  3OPH A;  4Y0O A;  2DRW A;  3OZH A;  5M1A A;  4JF4 A;  5FAT A;  4RVA A;  4DXB A;  3LO7 A;  3RXW A;  5F1F A;  4WEJ A;  1W5D A;  3G30 A;  4R23 A;  2XDM A;  3NDG A;  3VSK A;  3CG5 A;  1SDE A;  2ZJ9 A;  4E3L A;  4OH0 A;  3W4O A;  5EOO A;  1YMS A;  2XFT A;  1K57 A;  4GN2 A;  5CRF A;  3IXG A;  3O86 A;  4UHU A;  1JWV A;  1SHV A;  4X53 A;  2ZQD A;  3PTE A;  3PBS A;  2Y2P A;  4ID4 A;  3WRZ A;  1I2S A;  4DXC A;  4UAA A;  3SH8 A;  4PM5 A;  3VP1 A;  1IYQ A;  4QY6 A;  3VP0 A;  1MWS A;  4LV0 A;  3O3V A;  5EVL A;  5JYP A;  3CMZ A;  3IXH A;  3SS4 A;  2H5S A;  2WGV A;  3IXB A;  5GHY A;  3PBT A;  4ZJ3 A;  4FSF A;  2Y2L A;  4MBF A;  3ZVT A;  1Z6F A;  1DY6 A;  2R9W A;  3BM6 A;  3M6B A;  1KVM A;  2HDR A;  2WAD A;  2Y2I A;  3ISG A;  3OPP A;  3Q82 A;  4PPR A;  1MBL A;  3UPO A;  4S2I A;  4KQR A;  3WRT A;  3ZDJ A;  5AQA A;  2C5W B;  3A3D A;  4OON A;  4UA6 A;  1NXY A;  4BL2 A;  2Y2O A;  4S2M A;  1BUE A;  4KZ5 A;  1K55 A;  1XGJ A;  3TSG A;  2WK0 A;  4X69 A;  1HZO A;  2OSU A;  3DTM A;  3IWQ A;  4FH4 A;  4X6T A;  3AGD A;  3EQU A;  2FFY A;  5TR7 A;  5IHV A;  5GHX A;  3UN7 A;  5E2E A;  1IYP A;  3BFC A;  1C3B A;  4FD8 A;  4S2N C;  5CEB A;  2P9V A;  4D2O A;  3FKV A;  3C5A A;  4BD1 A;  3QNB A;  5FQK A;  3SS5 A;  3HLF A;  1BZA A;  1AXB A;  3P09 A;  4WYY A;  3ZG7 B;  4E3K A;  4EBN A;  4R0Q A;  4K0W A;  1W8Y A;  4JXG A;  2WAF A;  3UDX A;  4GD6 A;  1NY0 A;  3IHB A;  5F1G A;  4B4X A;  4S2J A;  2V20 A;  3S4X A;  3ITA A;  1K6R A;  1PWD A;  2J7V A;  4OQ0 A;  4BEN A;  5EPH A;  1CK3 A;  4GOG A;  1YLP A;  5FI7 A;  1ES5 A;  3PBO A;  3HUO A;  3NIA A;  3ZNY A;  4DE2 A;  4IVK A;  2HP5 A;  4OOL A;  3ZFZ A;  4CPK A;  4MBH A;  2HDS A;  5E2H A;  5FQ9 A;  4R1G A;  4P87 A;  5EUA A;  3UO9 A;  4Y7P A;  4H8R A;  4RX2 A;  4LV1 A;  5KSH A;  2G2W A;  1FOF A;  1ES2 A;  3Q7V A;  4HBT A;  3A3F A;  4B4Z A;  2BLS A;  2Z2M B;  4KZ4 A;  2Y2H A;  3BYD A;  1K54 A;  1E3U A;  1NJ4 A;  3BEC A;  5TGF A;  4QU3 A;  2WGI A;  2ZQC A;  2RCX A;  4KEN B;  3OCN A;  1JWZ A;  4EQI A;  1FCO A;  1JVJ A;  4B88 A;  2I72 A;  3N4I A;  4MBK A;  3NDE A;  4DE3 A;  3SH9 A;  3W4Q A;  1JWP A;  4DF6 A;  5HAQ A;  5BOH A;  2Y2Q A;  1EI5 A;  3DWK A;  4BL3 A;  4X55 A;  1LL9 A;  5A93 A;  2C6W B;  3SOI A;  4HBU A;  4LV3 A;  1KGF A;  3N8S A;  4QY5 A;  4EWF A;  1KE3 A;  1NYY A;  1FSW A;  1S0W A;  1RGZ A;  3MKF A;  5AQ7 A;  4ZTK A;  4JXV A;  4PM8 A;  1Q2P A;  2V2F F;  2WKH A;  1Q2Q A;  4C3Q A;  2WZX A;  1H8Y A;  3OPL A;  5DTT A;  1BLP A;  3UDI A;  2XEP A;  2JC7 A;  3JYI A;  3WS4 A;  5CHM A;  4JXW A;  1IEL A;  1BUL A;  1CEG A;  2WKI A;  3Q7Z A;  3IWI A;  1WYC A;  2Y2G A;  5CER A;  1IYS A;  1IYO A;  4S2K A;  4IBR A;  4EV4 A;  4IED A;  2RL3 A;  3N6I A;  1XA1 A;  3WS1 A;  2Y2J A;  4NET A;  4Y0U A;  5TFQ A;  1K57 C;  2X01 A;  4FCF A;  5DTS A;  5FI6 A;  1TDG A;  1KVL A;  3LCE A;  4S2L A;  1YLJ A;  1JTG A;  3BRM A;  5FQM A;  4EUZ A;  2V1Z A;  2ZC7 A;  5HFO A;  2PU2 A;  5G18 A;  4X56 A;  2WGW B;  3IF6 C;  3UDF A;  4OPZ A;  1WE4 A;  4Z9Q A;  2G2U A;  4OQG A;  1ERO A;  3ZGA B;  3V3S A;  3LY4 A;  2XD1 A;  1GCE A;  4K91 A;  2WYX A;  3G34 A;  1TDL A;  5CHJ A;  5FQI A;  4E6W A;  4LEN A;  5M18 A;  2WAE A;  3PAG A;  1G6A A;  4PM7 A;  4QD4 A;  4JXS A;  5CHU A;  2ZQ9 A;  2A49 A;  2XR0 A;  3WWX A;  3E2K A;  1IKI A;  3HBR A;  4KZ7 A;  5FAO A;  1CI8 A;  1NZU A;  4KZ3 A;  2IWB A;  3UE1 A;  1I5Q A;  4OP8 A;  2WKE A;  5HAR A;  4BLM A;  5HW3 A;  1MY8 A;  1K55 C;  2GDN A;  2WZZ A;  3HLB A;  3DWZ A;  3Q7V B;  4Y0T A;  3N7W A;  5F83 A;  5KMW A;  4EBL A;  4BQM A;  1SCW A;  2QMI A;  4KZA A;  1L0D A;  3QNC A;  1GHM A;  3NI9 A;  1MKI A;  3Q07 A;  4KG2 A;  4X68 A;  1M6K A;  3GVB A;  5JYO A;  4S2N A;  1NYM A;  2Z2L B;  1KGE A;  2VGK A;  2Y4A A;  3V3R A;  1HD8 A;  3ZCZ A;  1LLB A;  4E3M A;  2WUQ A;  4GDB A;  3PBR A;  1BT5 A;  3NC8 A;  1CI9 A;  2ZM0 A;  2Q9M A;  4JF6 A;  5CGX A;  4C6Y A;  3D4F A;  1FCM A;  3ZHH A;  2EFX A;  1J9M A;  4E3I A;  1BLS A;  1LI0 A;  3MZF A;  5FAP A;  3BLM A;  4L0L A;  4WZ5 C;  4LCM A;  5FAS A;  4DE1 A;  2R9X A;  3GTC A;  5DTK A;  4IVI A;  4BD0 A;  4DRT A;  3OCL A;  4M3K A;  4R4R A;  4GNU A;  3FKW A;  4WM9 A;  5D3O A;  1E3U D;  1YLZ A;  3VP3 A;  4OPY A;  3B3X A;  2Q9N A;  3GRJ A;  4HEF A;  4OQH A;  5FAQ A;  3W4P A;  1PWG A;  3ITB A;  1MWT A;  1XP4 A;  1O7E A;  2EX8 A;  1FR1 A;  2OLV A;  4MLL A;  5HL1 A;  1ZG4 A;  1G68 A;  1W7F A;  1LL5 A;  3IF6 A;  4ZJ2 A;  4KZ8 A;  4DDY A;  3HLC A;  4ZAM A;  1K38 A;  3HLD A;  3OPR A;  3NY4 A;  2HDQ A;  4BJP A;  3G2Y A;  3C4O A;  3UPP A;  4ZBE A;  4ZJ1 A;  3O88 A;  4JF5 A;  1IKG A;  5CTM A;  3SH7 A;  3VSL A;  1PWC A;  5KSC A;  1GHP A;  2J9P A;  4YFM A;  3FWL A;  4KZ6 A;  5KZH A;  2JBF A;  5I94 A;  3IQA A;  4JBF A;  2WGW A;  1XX2 A;  1YLY A;  1MWR A;  2QZ6 A;  2ZC6 B;  2ZQ8 A;  4PM6 A;  5GLB A;  3ZG9 B;  3MFD A;  3A3J A;  3UNW A;  3IXD A;  2XH9 A;  1ZG6 A;  1PIO A;  3BFF A;  4R4S A;  2H0T A;  3HUM A;  3UY6 A;  3VP4 A;  2IWC A;  5EE8 A;  4ZDX A;  5FSR A;  1FQG A;  4Q8I A;  2Y2M A;  1MPL A;  3MXR A;  1GHI A;  3PAE A;  1W8Q A;  1YLT A;  3HUN A;  5M19 A;  3AGE A;  4OPR A;  4KQO A;  2HP6 A;  3VOZ A;  4QHC A;  4WBG A;  1O07 A;  4HES A;  1TVF A;  4R3J A;  3LY3 A;  3IHA A;  2EFU A;  4P85 A;  3ZG8 B;  4XUZ A;  4RA7 A;  5CGS A;  3TOI A;  3GR2 A;  1Y54 A;  3LEZ A;  2ZLY A;  4A5R A;  3A3E A;  1PZP A;  1FR6 A;  2HPB A;  4N1H A;  4OVD A;  4RX3 A;  1K25 A;  2EX9 A;  4MEZ A;  4O7D A;  1PI4 A;  2DNS A;  3O87 A;  5GLA A;  4N92 A;  3DW0 A;  4WMC A;  3WS5 A;  2BG1 A;  1N4O A;  3IWO A;  3VOY A;  3N8L A;  3PBN A;  1ESI A;  3P98 A;  1DJB A;  3S1Y A;  2Y55 A;  1U60 A;  3OC2 A;  5HAI A;  2A3U A;  1VM1 A;  2X71 A;  4OKP A;  4EBP A;  3IF5 A;  2XQZ A;  1L0E A;  1K4E A;  4DE0 A;  4KG5 A;  5E43 A;  3UE0 A;  1BTL A;  3C4P A;  1KDW A;  4MNR A;  4YIN A;  5F82 A;  2XLN A;  2ZQA A;  1N9B A;  1XA7 A;  3E2L A;  3MZD A;  4GD8 A;  1ESU A;  1ERQ A;  1E4D A;  3G2Z A;  4U0T A;  5GLC A;  2OLU A;  3CZD A;  5CXW A;  1ES4 A;  3NBL A;  4LCL A;  2P74 A;  4GKU A;  2HP9 A;  1LHY A;  3IH8 A;  3GQZ A;  3Q1F A;  2Y91 A;  2DCF A;  1VQQ A;  2P9V B;  3IF6 B;  4WZ5 A;  2ZC5 B;  2IWD A;  2ZM8 A;  3N8R A;  2QPN A;  4E6X A;  4N9L A;  4WEL A;  3BLS A;  2CC1 A;  2EXA A;  4OLD A;  1E25 A;  2B5R A;  5A90 A;  5CED A;  1KE0 A;  1YM1 A;  2ZMA A;  3WS2 A;  5DF7 A;  3MBZ A;  5EEC A;  1CEF A;  1JTD A;  1L0G A;  1ERM A;  2XGN A;  3V39 A;  3ZG0 A;  4C75 A;  1PI5 A;  1XPB A;  1SKF A;  4PMA A;  3CJM A;  3M2K A;  4OLG A;  3WS0 A;  2ZD8 A;  4U0X A;  4KQQ A;  1WYB A;  3HL9 A;  4CJN A;  4S2O A;  2ZM2 A;  1DJA A;  2JCH A;  1SDN A;  4LV2 A;  3UE3 A;  1H5X A;  5HAP A;  4DKI A;  1PW1 A;  3G32 A;  5EVI B;  1BSG A;  1QME A;  5FQJ A;  1FCN A;  1S6R A;  3AGF A;  1DJC A;  2FFF B;  1KDS A;  1IEM A;  1YLW A;  1YQS A;  2X02 A;  3FV7 A;  4JKT A;  4KZB A;  4P6B A;  3TG9 A;  3BFG A;  3EQV A;  2H10 A;  3VMA A;  1YMX A;  2ZC4 B;  4P0M A;  3HLW A;  1I2W A;  1PW8 A;  5EOE A;  5A92 A;  2XFS A;  1GA9 A;  3HVF A;  5DVA A;  4F94 A;  3BFD A;  4JPM A;  5GHZ A;  4OP5 A;  1ONH A;  1ZKJ A;  3GV9 A;  4WMC D;  4S2P A;  3BFE A;  4FH2 A;  4OOY A;  5HX9 A;  2ZC3 B;  1XKZ A;  3G31 A;  1YT4 A;  4DDS A;  5AQ9 A;  5DF8 A;  2E8I A; 
#chains in the Genus database with same CATH topology
 5FDH A;  4GZB A;  1MWU A;  1FSY A;  5EVI C;  2XRO A;  5BS7 A;  5L2F A;  4NKP A;  3VP2 A;  4K0X A;  4KGC C;  4K08 A;  3UB9 A;  1TAF A;  3HLG A;  4MB5 A;  4QJG A;  5AVB A;  1S1Z A;  4QPR A;  5J7E A;  3E98 A;  4B93 A;  2Y2K A;  1K56 A;  4Z5T A;  4N1X A;  1H0G A;  5B1L D;  3TU4 A;  1ALQ A;  3C7V A;  1V9Z A;  1XGI A;  2QHK A;  2EX2 A;  5AV6 B;  3OLO A;  5AV8 C;  4O0P A;  2A24 B;  3AZK C;  5B1L C;  3S22 A;  1PYY A;  4ARZ B;  5A91 A;  5GLD A;  2FN2 A;  3C7U A;  1EWZ A;  4HH2 A;  3G35 A;  5B1M A;  4XXR A;  1RCJ A;  1L0F A;  5FEG A;  3MKE A;  1BH8 B;  4EW7 A;  3GMW A;  4GB7 A;  3LR5 A;  1HVB A;  1NZO A;  5GXQ A;  4F3L B;  5B32 G;  1KX5 A;  4QLC A;  1K4F A;  1P3I C;  3AZI D;  4CSR A;  3N3F A;  1HQ3 B;  3C1B A;  3M6H A;  3ZG5 A;  1AOI A;  5EM0 A;  5IS1 A;  3LO7 A;  3RXW A;  3AZL B;  3KUY B;  4WEJ A;  3NOP C;  3AFA B;  1W5D A;  2FZ0 A;  5B2I B;  2XDM A;  2D01 A;  3G30 A;  3NDG A;  1SDE A;  3UMD A;  3VH6 T;  5L8M A;  2ZOH A;  4YWZ A;  4ESP A;  1CXW A;  2XFT A;  2W1T A;  1JWV A;  4ID4 A;  2Y2P A;  4QLC C;  1I2S A;  3SH8 A;  1IYQ A;  3FKE A;  3O3V A;  2BYM B;  3C38 A;  1WA9 A;  5GHY A;  3PBT A;  3B0C W;  3X1U D;  3BM6 A;  2HDR A;  4MCW A;  4HJ4 A;  5KIZ A;  4HMC A;  3OPP A;  4NE5 A;  3WRT A;  2WKR A;  4J8W B;  3NQJ B;  3A3D A;  4UA6 A;  4NFT A;  5IT5 A;  4LRX C;  2Y2O A;  3O62 D;  4Q0J A;  3MNN B;  4HJ6 A;  1XGJ A;  4L9G A;  4WU8 B;  1HZO A;  3IWQ A;  4FH4 A;  5B0Y B;  4X6T A;  4DRA A;  3EQU A;  5AV5 B;  2FFY A;  4GS9 B;  3T4Q A;  5GHX A;  1P3K D;  1JNU A;  4JJN B;  5E2E A;  1IYP A;  1P0Z A;  3OOV A;  2G5H C;  5CEB A;  1W63 Q;  5F69 A;  3B0D C;  3SS5 A;  3HLF A;  1T19 A;  2W0N A;  4R0Q A;  3MS6 A;  4JXG A;  1M19 B;  2WAF A;  3CWF A;  3U2A A;  3UDX A;  4B4X A;  4H9Q B;  5EPH A;  5B24 C;  3EG5 B;  3X1V A;  3HUO A;  3NIA A;  5HD3 A;  2FJ7 A;  1XFN A;  1P3B C;  4OOL A;  4CPK A;  4MBH A;  2HDS A;  5KSH A;  3AZG B;  4Y7P A;  4RX2 A;  4J8V A;  5L09 A;  4G92 C;  3AV2 B;  1ES2 A;  4KGC B;  3Q7V A;  3AZF B;  2Z2M B;  4CLC B;  3AZN C;  4KZ4 A;  1G5U A;  2ARO C;  3S7N A;  5BT1 C;  3AN2 D;  1E3U A;  3BEC A;  3H0L C;  3MQO A;  2ZQC A;  4QU3 A;  2CMN A;  4EQI A;  4OUI A;  4B88 A;  2ZL1 A;  5B40 A;  4DF6 A;  1S4R A;  3B6F C;  2Y2Q A;  3AZI A;  1CF0 A;  4G3V A;  4E44 A;  4M6B A;  4AFI A;  1OJ5 A;  4HBU A;  4WU8 D;  2HJE A;  3N8S A;  4ZBJ C;  3EGX C;  3WAA C;  2YFV B;  4ZTK A;  5AQ7 A;  5B0Y D;  4JXV A;  1Q2P A;  2IA2 A;  4HI4 A;  4WZS B;  5AVB B;  3OPL A;  3T1Q B;  2JC7 A;  1H0I A;  5CHM A;  4XUJ A;  4D60 A;  3Q7Z A;  3JVV A;  3TU4 B;  2IO5 C;  1IYS A;  4B9O A;  1UR8 A;  4EV4 A;  5IU1 A;  5DNN D;  2CV5 B;  1XA1 A;  5BT1 D;  3AN2 C;  5DTS A;  3ZQ5 A;  1P9W A;  3LCE A;  1ULY A;  2IOU A;  4HNB A;  4S2L A;  5AJG A;  2P08 A;  5EVE A;  1N9L A;  2HGV A;  5F99 C;  1VEU B;  4HGA B;  2G2U A;  4J8U D;  1GCE A;  1M18 B;  2Y8H A;  5AY8 D;  1BH8 A;  4R8P D;  1G6A A;  1P3B D;  3S7P A;  3WTP D;  3WA9 B;  2ZQ9 A;  1M1A D;  4H9S A;  1QO6 A;  4HP9 A;  4YOF A;  4KHA A;  4J8V D;  1NZU A;  3REJ C;  3REK C;  1YU4 A;  3CHW P;  5CX7 A;  4BLM A;  2F8N B;  4EBL A;  3UTB B;  3WKJ C;  3QNC A;  3WA9 C;  3F1N A;  1P34 B;  4DN0 A;  4KG2 A;  5B2I A;  1F66 C;  3KXB A;  1PNE A;  4GJ4 A;  2Y4A A;  4E3M A;  3PBR A;  2V1A A;  2Q9M A;  3UB7 A;  3ZHH A;  1J9M A;  3KWQ B;  3BLM A;  5E5A A;  4L0L A;  4LCM A;  3MMH A;  3GTC A;  1LT0 A;  5DTK A;  4Y13 A;  1XFQ A;  3OCL A;  5EV0 A;  1E15 A;  4M3K A;  4GNU A;  1E3U D;  2Y79 A;  4WN5 A;  2Z6C A;  4OPY A;  4IBE A;  2Q9N A;  4HEF A;  5JYP A;  5HL1 A;  1MWT A;  5L07 A;  1F66 A;  1W7F A;  5TJJ A;  3L2A A;  1TS0 A;  5HSQ A;  4ZAM A;  3KYQ A;  3OPR A;  1ZHH B;  3NY4 A;  3KYZ A;  2HDQ A;  3REH C;  4BJP A;  3MNN A;  3REL B;  3G2Y A;  3C4O A;  1M18 D;  5EFW A;  4ZJ1 A;  4JF5 A;  1W1P A;  4EEU A;  1PWC A;  3AYW D;  5BS7 C;  4KZ6 A;  3WA9 D;  3UME A;  3R7W B;  2RVQ C;  4JJN A;  1U35 D;  2ZC6 B;  4PM6 A;  3X1S A;  2O99 A;  3JVU A;  3B42 A;  2H0T A;  3UY6 A;  5B33 D;  4L9E A;  4DQY B;  3T1X A;  5EE8 A;  5AY8 C;  4XZQ C;  4Q8I A;  4M4X A;  2E8J A;  2V9A A;  2W3G A;  4MN7 A;  4HME A;  3HUN A;  3WAA A;  5DNN A;  3EPK A;  1MC0 A;  3C8C A;  1EW0 A;  4HES A;  4WF0 A;  3X1U B;  5GT0 C;  1P3O D;  3W97 D;  5CGS A;  1Y54 A;  3A3E A;  4N1H A;  4OVD A;  4RX3 A;  2F8N K;  3A1K A;  3KUY D;  3TJZ C;  5GLA A;  3DW0 A;  5B1M C;  5B31 A;  4R8P A;  3EOI A;  5B2J A;  3P5J B;  3BQ8 A;  3S1Y A;  4IBG A;  1D7E A;  1U60 A;  1T3U A;  1F5M A;  3OC2 A;  5HAI A;  4EES A;  3AV1 D;  2HV1 A;  1TAF B;  3KWQ C;  1P3A A;  4DE0 A;  4WV4 B;  5B40 B;  4Y3I A;  5E43 A;  3UE0 A;  1BTL A;  4MNR A;  2D49 A;  3AZJ C;  3T4J A;  4NYU A;  1YKD A;  2ZOI A;  4KUD C;  1ESU A;  1ERQ A;  4Z5T B;  5B24 D;  3L7H A;  3JPU A;  5GLC A;  2O9C A;  1M19 D;  5TBM A;  5DFX A;  1MKM A;  3M7P A;  2BAS A;  3AZJ B;  3NQU B;  3IH8 A;  3GQZ A;  3LID A;  5GT3 A;  3A6N D;  2P9V B;  1YU2 A;  4WZ5 A;  2HIO C;  2ZM8 A;  3MVD D;  2L1M A;  2Z6D A;  4N9L A;  3LJA B;  4QWO A;  5AV6 C;  2CC1 A;  1KE0 A;  1YM1 A;  3TE8 A;  5DF7 A;  5B1M B;  2R78 A;  3FDD A;  1CEF A;  2K31 A;  1ERM A;  4CQH A;  2KLI A;  4E45 A;  3EPL A;  3CJM A;  2CV5 A;  1E8B A;  1E6Z A;  2ZD8 A;  3A0R A;  3HL9 A;  4BWI A;  5GSU A;  5G49 B;  4QLC B;  4Z66 D;  4DKI A;  4OJO A;  3G32 A;  1YSP A;  3WTP E;  1BSG A;  3A0V A;  4CSR B;  4I3A A;  1IEM A;  3T4L A;  1M18 A;  3BFG A;  2QJ5 A;  4ZUX C;  3EQV A;  3VMA A;  3AFA C;  5AVC B;  3HLW A;  1P3F D;  1VB6 A;  3AZL A;  5CP6 C;  3LIC A;  4KHA B;  4WU9 C;  1ONH A;  3BFE A;  3AZH D;  2ZMF A;  3G31 A;  2VKS A;  5CPJ D;  4Z2M G;  5AQ9 A;  1KOU A;  3LJA C;  5GT0 A;  1P3M B;  3UTB A;  4HH3 A;  4Q0H A;  1P3P B;  1R4V A;  5DF9 A;  4QB8 A;  4PKY G;  3X1S C;  3GSG A;  1F98 A;  3LIA A;  1OT6 A;  2UWX A;  4RYE A;  1S32 A;  5E2G A;  3MR0 A;  1XXM A;  4J8W A;  3NQJ A;  2HUE B;  3X1T D;  4NG2 A;  1CK7 A;  5G4Z A;  5B1L B;  3WD1 A;  2J80 A;  4PM9 A;  1KE4 A;  3LEQ A;  3A6N C;  3NOU C;  2HDU A;  3F1O B;  1O6I A;  5BPV A;  2MJ6 A;  2Y2N A;  3FZC A;  1CJF A;  1F66 B;  2H0Y A;  3LR4 A;  3Q81 A;  4NK3 A;  3NCK A;  5AQB A;  1H0M A;  4MB4 A;  1QMF A;  1S32 C;  4J8U A;  4OOM A;  2F2A C;  3LZ1 D;  4OPQ A;  5E2F A;  4E3O A;  5FI2 A;  4UA7 A;  2VGJ A;  4U3T A;  1GA0 A;  1S67 L;  1P3I D;  4OQI A;  3HJI A;  3T4K A;  5AVC D;  4Z66 A;  1ZLA A;  3WTP C;  1U35 C;  1M40 A;  1K6S A;  4GDN A;  1M19 C;  1HTZ A;  2LB5 A;  3RXX A;  3VFH A;  3V5M A;  3R7W A;  1K54 C;  3BWL A;  3MXS A;  2DMW A;  3I7J A;  3REI D;  3VFF A;  5AY8 B;  4E3J A;  3OPH A;  4Y0O A;  2DRW A;  5M1A A;  4JF4 A;  3AZG A;  2ZMV A;  4RVA A;  1XJ6 A;  4G91 C;  3B6G D;  4Q0I A;  4NZ5 A;  4CLC A;  4J8X C;  2ZJ9 A;  5F99 B;  1W1V A;  2VLG A;  5B2I D;  5EOO A;  1KS0 A;  1YMS A;  5HZH A;  1K57 A;  5CRF A;  5DNM A;  3IXG A;  3O86 A;  4X53 A;  3WRZ A;  4NXB A;  4DXC A;  3EPJ A;  4PM5 A;  2F8N H;  4OJ6 A;  3AZM A;  3CMZ A;  4G91 B;  3IXH A;  1ZTU A;  3IXB A;  4FSF A;  2Y2L A;  3ZVT A;  1Z6F A;  3REL D;  5B2J B;  1DY6 A;  5CPK A;  2WAD A;  2Y2I A;  5AVC C;  4ZUX B;  2YFV A;  1MBL A;  1VET B;  3ZDJ A;  5AQA A;  2C5W B;  2W8S A;  3ICY A;  3AZE A;  4OON A;  4BL2 A;  1U35 B;  4S2M A;  2AVX A;  1BUE A;  3AZF C;  4GCZ A;  3HON A;  4XUJ B;  4QNL A;  4UEY A;  4PHT A;  3HJK A;  4NE3 A;  4X69 A;  1CQA A;  2OSU A;  3AGD A;  3AZJ A;  3NQU A;  2KOI A;  3GDI A;  5CPK C;  3BFC A;  2PR6 A;  2P9V A;  3FKV A;  4BD1 A;  2EWV A;  5C3I B;  3L25 A;  3QNB A;  3WKJ B;  3UTA D;  1BZA A;  3X1S D;  4LG2 A;  3LJA A;  1GPF A;  3MGP A;  5B33 C;  1NY0 A;  5F1G A;  1VEU A;  4WUJ A;  1BH9 B;  1MZU A;  3B33 A;  2VGL S;  4GLQ A;  3S4X A;  3AV2 C;  1P3K A;  1GOI A;  3ITA A;  2L5A A;  1PWD A;  3NOT C;  1GSW A;  2J7V A;  3MGQ C;  4GOG A;  5FI7 A;  2CWE A;  1ES5 A;  4IJG A;  2GX5 A;  3E4P A;  2JKR M;  5GSU B;  2JKG A;  2QKP A;  5HWT A;  4YS3 B;  1KX3 B;  5G49 A;  4H6J B;  4R1G A;  4XT2 B;  4LV1 A;  3AZF D;  3QP6 A;  4Z2H A;  3VH6 W;  2F8N A;  4IBB A;  3KS4 A;  2BLS A;  1UR9 A;  5DJT A;  2Y2H A;  1NJ4 A;  5AVC A;  2RCX A;  4KEN B;  1YUE A;  1JWZ A;  3AN2 B;  1FCO A;  1P34 A;  5BO0 A;  2I72 A;  3R45 B;  1WWS A;  3REJ A;  4MBK A;  3NDE A;  3KXB B;  1DRM A;  3W4Q A;  5BOH A;  2V0W A;  1EI5 A;  4J8U C;  4BL3 A;  5A93 A;  2JSS A;  1PDC A;  3SOI A;  4P6Z S;  4LV3 A;  3W98 D;  5GT0 B;  5B24 A;  1P3M A;  1KE3 A;  2LB9 A;  1P3P A;  4H9O A;  1S0W A;  1RGZ A;  3FPV A;  2WKH A;  2ZY5 A;  2J3W A;  1H8Y A;  5DTT A;  4DJ3 A;  2G7U A;  3WS4 A;  3MFX A;  3WKJ D;  2PRF A;  1BUL A;  4HY8 A;  4Y15 A;  1WYC A;  2Y2G A;  2P04 A;  3C2W A;  3AZK D;  4Y0U A;  3T4O A;  3REL A;  1K57 C;  2X01 A;  4FCF A;  5FI6 A;  4MN5 A;  4H9R B;  1JTG A;  3BRM A;  5FQM A;  4EUZ A;  2V1Z A;  2ZC7 A;  5HFO A;  3H7W A;  5MC7 A;  2PU2 A;  2HIO B;  3UDF A;  3T1R A;  4NE6 A;  5B1M D;  4OPZ A;  1WE4 A;  4OQG A;  3ZGA B;  4YS3 D;  2XD1 A;  2WYX A;  3G34 A;  4UQI M;  4E6W A;  4Z2L A;  4JGQ A;  1BFM A;  1P3B B;  4J8U B;  5M18 A;  2WAE A;  4YM6 A;  1T18 A;  3PAG A;  4R6L A;  4QD4 A;  3LYX A;  5CHU A;  3VE3 A;  2XR0 A;  3WWX A;  3E2K A;  1IKI A;  4KZ7 A;  3AZL D;  4Z66 B;  1ZLA B;  4I5S A;  3UE1 A;  3KYE A;  4Z2G A;  3D72 A;  4DRB A;  4OP8 A;  2WKE A;  2B95 A;  1MY8 A;  1S66 L;  3BY8 A;  5KDM A;  5I5L A;  3NJA A;  5KMW A;  3WTP A;  3MGP D;  4BQM A;  2PYO C;  3B0B A;  1L0D A;  1B67 A;  3UTB D;  1GHM A;  3NI9 A;  1MKI A;  4IJE A;  2PBD P;  1M6K A;  3AZH B;  2Z2L B;  5F99 A;  3PR6 A;  3ZCZ A;  2WUQ A;  3KSY A;  1TZY D;  3W96 C;  4WU8 C;  1AWI A;  5CGX A;  3D4F A;  1P3M D;  4UUZ A;  1KX4 D;  1P3A B;  4DE1 A;  4J8W D;  2R9X A;  3AZM B;  1SZV A;  2W27 A;  5TBM B;  5CPK B;  4OQH A;  5LBR A;  2ZY2 A;  1PWG A;  4ZUX A;  1XP4 A;  3REJ D;  1FR1 A;  1ZG4 A;  5GT3 B;  4EUV A;  3X1T B;  5AV5 D;  1G68 A;  1HLU P;  3MF0 A;  4ZJ2 A;  4KZ8 A;  2F8N G;  5B32 C;  1U35 A;  4XUJ C;  2W3H A;  1P97 A;  3L28 A;  3O88 A;  3UB6 A;  3VH6 A;  3UT9 A;  5CTM A;  1PZR A;  3LIF A;  2PYO D;  3FWL A;  3IQA A;  3B6G B;  2WGW A;  5CPJ C;  1W1T A;  2M1C A;  3MSH A;  3T4S A;  3WKJ A;  1ZG6 A;  1PIO A;  1HQ3 C;  2IWC A;  1TZY C;  5J3W A;  5FSR A;  4EXO A;  1P3I B;  1MPL A;  3MXR A;  4NXG A;  1KX5 C;  1XJ3 A;  3RH8 B;  3AZG D;  1W8Q A;  5M19 A;  4JGR A;  3AGE A;  4OPR A;  3VOZ A;  4QHC A;  4WBG A;  4J8V C;  5BNX A;  3W97 B;  3UT9 C;  3UB8 A;  3LY3 A;  1EQZ D;  5B33 A;  3MGP C;  2EFU A;  3BQA A;  3ZG8 B;  4XUZ A;  3GR2 A;  1AOI C;  4A5R A;  3REK A;  1FR6 A;  4YNR A;  2VJW A;  1Y28 A;  4KQD A;  4YS3 A;  1KX3 A;  4XT2 A;  3NHQ A;  3O87 A;  4N92 A;  3WD4 A;  3WS5 A;  2BG1 A;  4YM6 D;  5F99 D;  1F2K A;  3PBN A;  3P98 A;  1DJB A;  1SKO A;  4H9N B;  2A3U A;  2X71 A;  4OKP A;  3IF5 A;  2NUP C;  2XQZ A;  3LI8 A;  1L0E A;  5B40 D;  1P3A C;  4WJ3 C;  3K2N A;  3R45 A;  3REJ B;  5F82 A;  1N9B A;  3CIT A;  1S32 B;  4BBV A;  3G2Z A;  4U0T A;  1ES4 A;  3NBL A;  2P74 A;  4Z5T D;  5B24 B;  2HP9 A;  1AIW A;  5B1L A;  3TU4 D;  5B31 G;  3Q1F A;  4H9O B;  2Y91 A;  4NXF A;  2DCF A;  3IF6 B;  5E5A C;  3AZN D;  3F1O A;  3W97 C;  2ZC5 B;  3BY9 A;  3A6N B;  2JN7 A;  2QPN A;  4WEL A;  3BLS A;  4IBC A;  3DBA A;  3MVD B;  5B31 C;  3SZT A;  5GSU D;  5DNM C;  5A90 A;  5CED A;  1UWN X;  2ZMA A;  3WS2 A;  4ZRR A;  3MBZ A;  1JTD A;  1L0G A;  3V39 A;  1PI5 A;  2IO5 B;  3V67 A;  3LZ1 C;  1SKF A;  3KO6 A;  4PMA A;  3M2K A;  1PFL A;  4OLG A;  4NYY A;  5JRG B;  4KQQ A;  1H3O A;  3WD0 A;  2ZM2 A;  1DP9 A;  1SDN A;  4LV2 A;  3UE3 A;  3H7W B;  1H5X A;  2HIO A;  2O0Y A;  5HAP A;  2VK3 A;  2PYR A;  1TS7 A;  4HQA A;  5FQJ A;  5AY8 A;  1YQS A;  1YLW A;  1DJC A;  2FFF B;  4P6B A;  1P3B A;  1W63 M;  3TG9 A;  4YM6 B;  2FJ7 C;  3UT9 D;  1YMX A;  4Z2M H;  1XJ2 A;  2WKP A;  4P0M A;  1OJG A;  3MQ0 A;  5EOE A;  3S7O A;  5GT0 D;  1P3F B;  3FPW A;  4F94 A;  2K7S A;  2NZD D;  4OP5 A;  5CPJ B;  4IBI A;  5DNM B;  5DF8 A;  2XD5 A;  5KDM B;  2K2N A;  3WTP B;  5J8X A;  3MGR B;  3W98 A;  2NQB C;  1OME A;  1P3P D;  4FTX A;  4J8X A;  5F5Y A;  4WZ4 A;  4I38 A;  1KX4 C;  4EO5 B;  3ZNT A;  2XRN A;  1TEM A;  1VET A;  2EXB A;  4UA9 A;  3AZE B;  5CTN A;  5FQQ A;  3LEL B;  2J8Y A;  4HMD A;  3UPN A;  3ZVW A;  5AV9 B;  2PBY A;  3AZK A;  2BYK A;  3W8K A;  1TD5 A;  1ACF A;  3MZE A;  1H8Z A;  3QHY A;  3HLE A;  2NZD C;  3KFU G;  4WL9 A;  3B0D B;  3BEB A;  2YFW B;  1ZLA D;  4IBX A;  3AZH C;  3AV1 C;  3A3I A;  4O8G A;  2OV5 A;  2XK1 A;  3FYZ A;  3NUL A;  4KG6 A;  3B0C T;  3IT9 A;  3SS3 A;  3RFB A;  1LI9 A;  1L2S A;  3MGP B;  5GXQ C;  1BH9 A;  2RTS A;  3UT9 B;  2VV6 A;  1P3K B;  3LIB A;  1P3M C;  2NQB D;  1KGG A;  2JE5 A;  3B6G A;  3CPT A;  4J8W C;  1BLH A;  2XF3 A;  5FUG B;  4LRZ E;  5EVI A;  2VX8 A;  5FA7 A;  1PZO A;  1MXO A;  1TZY B;  4JLF A;  4WU9 B;  4II7 A;  3OZH A;  4H9S C;  1KX4 B;  5FAT A;  4H6J A;  3LFV A;  2G5I C;  1P3G D;  3AL0 C;  3MGS D;  1G28 A;  5EM1 A;  3MGR D;  3VSK A;  1E6R A;  4TX8 A;  3CG5 A;  3UTA C;  3KSI A;  5BNX B;  4OH0 A;  1A0K A;  4X1L A;  3W97 A;  3W4O A;  4G3W A;  4GN2 A;  3AN2 A;  4MN6 A;  3PTE A;  3PBS A;  5BO0 B;  4KUK A;  1B6W A;  4UAA A;  3VP1 A;  4IBJ A;  4QY6 A;  3VP0 A;  1MWS A;  3AYW C;  4LV0 A;  3TW8 A;  5B2I C;  5EVL A;  4KGC D;  1OT9 A;  2H5S A;  4ZJ3 A;  3M6B A;  4Y17 A;  1KVM A;  5AVF A;  1SKO B;  3D9Y A;  3ISG A;  2B18 A;  5J4E A;  2V0U A;  3MQL A;  4S2I A;  4KQR A;  4Z2J A;  1NXY A;  1J7M A;  2A2L A;  2ARO D;  4KZ5 A;  4JGO A;  5B0Z B;  2PD8 A;  3AZI C;  1P3G C;  1ID3 D;  3DTM A;  4Z2K A;  1OTA A;  1P3L B;  3CAX A;  1M1A A;  3QP4 A;  3UN7 A;  3B6F D;  4S2N C;  4D2O A;  3C5A A;  5FQK A;  4H9R A;  1D06 A;  1S4S A;  5C5K A;  2HZ5 A;  4GD6 A;  5AV9 C;  1UGU A;  3LR0 A;  4O01 A;  2NQB A;  3W98 C;  4S2J A;  2V20 A;  1K6R A;  3MGS B;  4OQ0 A;  4IBD A;  4BEN A;  4MB3 A;  1CK3 A;  1YLP A;  5C3I C;  4YS3 C;  3H9W A;  3UTA A;  3P7N A;  3X1V C;  1EQZ A;  4IVK A;  3ZFZ A;  4P87 A;  5EUA A;  3UO9 A;  5E5A D;  3MGQ B;  3SW1 A;  2G2W A;  1FOF A;  3U4L P;  2J3T D;  3VH5 A;  3MGR C;  4HBT A;  3BYD A;  5TGF A;  2WGI A;  2HUE C;  1JFI A;  1P9R A;  1LSW A;  4QLC D;  2YKH A;  3AZH A;  2F8N D;  2O9B A;  3SH9 A;  5CPJ A;  4KUO A;  5HAQ A;  3DWK A;  2C6W B;  4UUZ B;  2JKR I;  3C1C D;  4L9F A;  4QY5 A;  3MXQ A;  1P3P C;  4EWF A;  1NYY A;  3MGR A;  3MKF A;  4PM8 A;  2V2F F;  1Q2Q A;  2WZX A;  3O5Y A;  1BLP A;  5CPI D;  4J8X B;  1NLZ A;  5JRG D;  3B47 A;  3JYI A;  4JXW A;  4MDZ A;  3X1T A;  2WKQ A;  1CEG A;  5CP6 B;  2PDR A;  3IWI A;  1S1Y A;  5DKK A;  4S2K A;  3LEL A;  4PAU A;  2Y2J A;  1T1B A;  5B32 D;  1KVL A;  2BYK B;  2XSS A;  1P3O A;  4X25 A;  3ULF A;  5G18 A;  2WGW B;  2W1R A;  3IF6 C;  5K5B A;  1FIL A;  1E88 A;  1ERO A;  5A8B A;  3V3S A;  5CHJ A;  5FQI A;  2EA9 A;  4LEN A;  2J8P A;  4LPZ A;  1P3I A;  3CLO A;  4PM7 A;  3E0Y A;  1HTA A;  3AV1 A;  5FAO A;  3EPH A;  2OWJ A;  5HDC A;  3CPT B;  3LI9 A;  5B33 B;  2GDN A;  2WZZ A;  3HLB A;  3DWZ A;  4CLC C;  1ED7 A;  4RQ9 A;  5F83 A;  5FDS A;  4Y0T A;  3REK B;  1OTD A;  1TZY A;  4G92 B;  3W96 B;  4WU9 A;  1SCW A;  2VEA A;  4LLO B;  2QMI A;  4KZA A;  1KX4 A;  5HD5 A;  1Q9C A;  1OTI A;  3PHY A;  3Q07 A;  2VZW A;  4X68 A;  5AV6 D;  4S2N A;  1NYM A;  2DF4 C;  4H9N A;  5DNM D;  1X0O A;  4GDB A;  1BT5 A;  3IP4 C;  5B40 C;  5F68 A;  4E3I A;  1LI0 A;  2PR5 A;  3IX8 A;  2V5O A;  3F1P A;  3R4K A;  1P3A D;  3LZ0 B;  4BD0 A;  4PKY A;  4DRT A;  4R4R A;  3FKW A;  1YLZ A;  1H3Q A;  3CI6 A;  5FAQ A;  3B3X A;  5B2J C;  3TU4 C;  3W4P A;  3REH D;  1O7E A;  4MLL A;  3IF6 A;  2VV7 A;  4DDY A;  3HLC A;  2VQR A;  3A6N A;  3HLD A;  3MNN C;  3EEA A;  3MVD A;  1VHM A;  3UPP A;  4WNN B;  5B0Z A;  3FG8 A;  4ZBE A;  1IKG A;  3SH7 A;  5KSC A;  3VSL A;  2J9P A;  4YFM A;  4X23 C;  5KZH A;  2PHY A;  5I94 A;  5GXQ D;  1P3L A;  4IBK A;  4JBF A;  1M1A B;  3KX0 X;  2V8C A;  1KX5 D;  5GT3 C;  2ZQ8 A;  5GLB A;  5JRG A;  3ZG9 B;  3LUQ A;  3UNW A;  3IXD A;  1L6J A;  4NY2 A;  1H3O B;  3HUM A;  3VP4 A;  4GHI B;  3EWK A;  5CPI C;  4ZDX A;  1M1A C;  3C1B D;  3PAE A;  2XA7 S;  3OBF A;  1AOI D;  4EQ1 A;  1YLT A;  1TS6 A;  1O07 A;  2BTF P;  4R3J A;  3RTY A;  4ETX A;  3UTA B;  3IHA A;  1PRQ A;  3W99 B;  4RA7 A;  3AZG C;  5FL3 A;  2ZLY A;  1P3F A;  1PZP A;  2HF6 A;  2HPB A;  5HWW A;  4MEZ A;  4O7D A;  1A7W A;  1PI4 A;  1XJ4 A;  2DNS A;  3MGQ A;  3L27 A;  4WMC A;  1N4O A;  3VOY A;  3IBJ A;  4R3A A;  4Y2F A;  3W98 B;  4EBP A;  2ZBB A;  4KUD D;  1KX3 D;  1OGG A;  5AV8 A;  4LD9 B;  4KG5 A;  5HPI A;  4Z66 C;  1KDW A;  4YIN A;  4LRY C;  2XLN A;  2ZQA A;  2KX6 A;  1KU5 A;  1XA7 A;  3MZD A;  4GD8 A;  3C1B C;  1E4D A;  3E4Q A;  4DJ2 A;  3CZD A;  5CXW A;  1IFQ A;  2JKT M;  4LCL A;  3BJN A;  3W99 C;  3H0M C;  5AV9 A;  3W2Z A;  3AZK B;  2VGL M;  2IWD A;  1STZ A;  2D02 A;  3N8R A;  4E6X A;  3PXP A;  4HP4 A;  3DTE A;  2EXA A;  5G4Y A;  3REI A;  1E25 A;  1ID3 B;  2YFW A;  1EAK A;  2B5R A;  4HJ3 A;  5EEC A;  3ZG0 A;  4C75 A;  1XPB A;  4IJF A;  3WS0 A;  4U0X A;  5CHL B;  4XZQ D;  1WYB A;  4CJN A;  1H8M A;  3X1V D;  1P3O B;  4LGW A;  2FJ7 D;  2V8F A;  3QP5 A;  3NEC A;  3L26 A;  1PW1 A;  5FUG A;  4CAY A;  5EVI B;  3REL C;  1QME A;  3VOL A;  4R8P C;  1S6R A;  3DAV A;  2V1B A;  3AGF A;  4JKT A;  1KDS A;  1P3O C;  4C6Y A;  4KZB A;  2H10 A;  2PD7 A;  3AZL C;  3C30 A;  1GA9 A;  3HVF A;  5DVA A;  4BBT A;  5GHZ A;  1ZKJ A;  4WMC D;  3GV9 A;  4FOF A;  4FH2 A;  2ZC3 B;  4J8X D;  4X23 B;  1ID3 C;  3S7Q A;  1YU0 A;  2UV0 E;  3DTK A;  2E8I A;  3W96 A;  1K56 D;  4ZBJ B;  4X1M A;  1BYW A;  3IBR A;  5GL9 A;  3AZM D;  3AZJ D;  1KX3 C;  2GNX A;  2PAV P;  3PBQ A;  2J9O A;  3WD3 A;  3V50 A;  1YSQ A;  1F9I A;  5CPI A;  4FUW A;  3C1C B;  1EQZ C;  1ZC2 A;  1RGY A;  4WEK A;  1ONG A;  2Y59 A;  3F1P B;  3AZE D;  2EX6 A;  3IX4 A;  1E6N A;  3LEL D;  1OTE A;  1W79 A;  3IS2 A;  1T1A A;  2JKT I;  2PU4 A;  3HRE A;  3M2J A;  3V9R B;  1Z2C B;  3FC7 A;  1N9O A;  4NXE A;  4R3B A;  4N9K A;  1P34 C;  1NRF A;  2OOL A;  2CV5 D;  1M18 C;  3T4T A;  3E4O A;  5EVI D;  2ZQ7 A;  4I39 A;  4XUX A;  2M7V A;  3X1U C;  1RP5 A;  2B02 A;  2OAQ 1;  2NQB B;  2OAP 1;  3RJU A;  4E3N A;  5GT3 D;  3MGS A;  5U47 A;  3IH9 A;  3G4P A;  5CEC A;  3F6T A;  1GSX A;  1ES3 A;  1HQ3 D;  2QWS A;  4IUK A;  1D1J A;  3C1C C;  1EQZ B;  4KZ9 A;  5CGW A;  1BLC A;  4GHI A;  5AV5 C;  3AFA D;  1T1C A;  2GZA A;  4WU9 D;  4DXB A;  5F1F A;  3T12 B;  1N1J B;  4R23 A;  1P3G B;  4E3L A;  3VV4 A;  3IX3 A;  2JHE A;  1NLY A;  4Y5F A;  4EU0 A;  4UHU A;  1SHV A;  2ZQD A;  1JFI B;  3REH B;  4UPK A;  4UQI S;  4WLA A;  2CV5 C;  3KSG A;  3T1S A;  2O9A A;  2PT7 A;  4DMZ A;  3SS4 A;  2WGV A;  4MBF A;  2R9W A;  3O62 C;  2L4R A;  1NWZ A;  1E6P A;  3Q82 A;  3AYW B;  2INW A;  4PPR A;  1GSV A;  3UPO A;  2ARO B;  4LD9 A;  3AZN B;  1K55 A;  2L0W A;  3TSG A;  3MNN D;  5CP6 A;  2A24 A;  2WK0 A;  3BW6 A;  4ARZ A;  3KUY C;  3B6F B;  5TR7 A;  1Y4O A;  5IHV A;  3O62 A;  4GHL A;  1P3L D;  1C3B A;  4FD8 A;  2XA7 M;  1N9N A;  4ME4 A;  5HL6 A;  1OTB A;  3LZ1 A;  4JJN D;  5F6A A;  2GJ3 A;  1AXB A;  3P09 A;  1S32 D;  4WYY A;  1YPR A;  3ZG7 B;  4E3K A;  2OWH A;  4EBN A;  4K0W A;  1W8Y A;  3IHB A;  3MQQ A;  5GXQ B;  3WAA D;  3GEC A;  3PBO A;  3ZNY A;  2W3D A;  4DE2 A;  4Z5T C;  5DJU A;  3AV1 B;  3C1B B;  4KUD B;  2HP5 A;  5E2H A;  5FQ9 A;  1AOI B;  2NZD B;  4H8R A;  3MGS C;  3KUY A;  4CLC D;  3H82 A;  1Z09 A;  3A3F A;  4B4Z A;  1L3L A;  4H9P A;  4NZ3 A;  5B31 D;  1K54 A;  5JA4 B;  3OCN A;  3EGD C;  2W1T B;  1JVJ A;  3N4I A;  1H8P A;  4OJP A;  2P7J A;  4DE3 A;  4EER A;  4JJN C;  2DQN C;  3T50 A;  2HJ9 C;  1JWP A;  5L10 A;  3MJQ A;  4AWL B;  3KSF A;  1P3L C;  5B0Y C;  4X55 A;  1LL9 A;  4Z2I A;  2I9V A;  1KGF A;  2KDK A;  3WD2 A;  1FSW A;  3LZ0 A;  2PYO A;  5AVB D;  4C3Q A;  3L9K A;  4I3I A;  3UDI A;  2XEP A;  4R70 A;  4XZQ B;  5CPI B;  3EEH A;  1IEL A;  3X1T C;  4WU8 A;  3LIE A;  3H0R C;  2WKI A;  1P3F C;  4Z1W A;  1V9Y A;  5CER A;  5B0Y A;  1IYO A;  4IBR A;  3A1I A;  4IED A;  5BNV A;  2RL3 A;  3N6I A;  4GS9 A;  3WS1 A;  4NET A;  5TFQ A;  5CPK D;  4WNN A;  3LJA D;  1TDG A;  1YLJ A;  2VA0 A;  4CLC E;  3PYP A;  2YKF A;  4X56 A;  3V9R A;  4Z9Q A;  4I3J A;  3LY4 A;  4K91 A;  1G6O A;  1TDL A;  5B32 A;  4AWL C;  5DFY A;  4HIA A;  3KXB C;  4MMN A;  3X1V B;  4JXS A;  2A49 A;  3LGO A;  3D3O A;  3HBR A;  3KSH A;  4P6Z M;  1CI8 A;  4NZ1 A;  4LD9 C;  4KZ3 A;  2IWB A;  1I5Q A;  5HAR A;  5HW3 A;  3KXB D;  1K55 C;  3W99 A;  3AV2 A;  1P3K C;  1YU3 A;  3Q7V B;  3N7W A;  3LEL C;  5FEF A;  4BMW A;  4EET B;  3REK D;  3W96 D;  3UB5 P;  1YU1 A;  3GVB A;  5JYO A;  2VGK A;  4GH9 A;  1KGE A;  3V3R A;  1HD8 A;  2QJ7 A;  1LLB A;  3AZI B;  3NC8 A;  4JF6 A;  1CI9 A;  2ZM0 A;  3UTB C;  1FCM A;  2EFX A;  3REH A;  1BLS A;  3MZF A;  5FAP A;  5AV8 B;  3LZ0 D;  4WZ5 C;  5FAS A;  1F66 D;  2ZY3 A;  3KWQ D;  1YAX A;  4IVI A;  4R38 A;  3QP8 A;  1IOU A;  5AV6 A;  2H28 A;  4IHQ A;  3AZE C;  4WM9 A;  5D3O A;  5HDD A;  4NEE D;  4GW9 A;  3VP3 A;  3L29 A;  5HWV A;  3GRJ A;  3G6O A;  3ITB A;  2EX8 A;  3AYW A;  2OLV A;  1LL5 A;  2HIO D;  4YM6 C;  4OJ5 A;  5HDS A;  2ARO A;  4JGP A;  3AZN A;  1K38 A;  1LSV A;  3K3C A;  3DTI A;  5DNN C;  3REI B;  1ID3 A;  1WWI A;  1FIK A;  1GHP A;  4F3L A;  1KX5 B;  2JBF A;  3B6F A;  1XX2 A;  1YLY A;  2FH5 A;  1MWR A;  2QZ6 A;  3O62 B;  4BBU A;  3MFD A;  3A3J A;  3LZ1 B;  3LR3 A;  2XH9 A;  3BFF A;  1HQ3 A;  4R4S A;  5B0Z D;  1LSX A;  1FQG A;  2Y2M A;  4GHA A;  3QP1 A;  1GHI A;  2ZY4 A;  3WA9 A;  4CAY B;  2JKF A;  3AFA A;  3LZ0 C;  2W3E A;  3UE6 A;  4KQO A;  1DP8 A;  2HP6 A;  3VE4 A;  2ZM5 A;  2VV8 A;  3W99 D;  1TVF A;  1NRJ A;  5B2J D;  4P85 A;  3TOI A;  4ETZ A;  3LEZ A;  4IBF A;  2LY8 A;  2QYB A;  2EWW A;  4KUD A;  1K25 A;  4G3K A;  5GSU C;  2EX9 A;  4HOI A;  2BYM A;  3K3D A;  2NZD A;  5AV8 D;  4E04 A;  1GXD A;  3F1N B;  4X23 A;  3IWO A;  3H82 B;  1K0K A;  3N8L A;  1ESI A;  4H9P B;  1OPX A;  2Y55 A;  1VM1 A;  5JA4 A;  1K4E A;  3ZYT A;  3KWQ A;  1UWP X;  5E5A B;  3MGQ D;  1ODV A;  3C4P A;  3AV2 D;  2RVQ D;  4LD9 D;  3E2L A;  3CUE C;  4EO5 C;  3C1C A;  3WX7 A;  4IUH A;  2OLU A;  4ZUX D;  5CP6 D;  4GKU A;  3QP2 A;  5AV5 A;  1LHY A;  5AVE A;  4HGA C;  2PYO B;  5DKL A;  1VQQ A;  3IS2 B;  2J3T C;  3VH5 W;  4XUJ D;  4OLD A;  4XZQ A;  4EEP A;  1M19 A;  1F1E A;  3VH5 T;  1ZLA C;  4H9Q A;  2XGN A;  5AV9 D;  2PYP A;  4OJL A;  2Q0O A;  1W2E A;  5BNV B;  3HCY A;  5HPF A;  3X1S B;  2FJ7 B;  4S2O A;  5B0Z C;  1J3W A;  1DJA A;  2JCH A;  3CUE A;  2M7U A;  5AVB C;  1TF1 A;  4J8V B;  3HSH A;  4HHD A;  1OGB A;  3WAA B;  4KGC A;  5DNN B;  3REI C;  3AZF A;  1FCN A;  3TRC A;  2ACG A;  3FV7 A;  2W3F A;  5B32 B;  2X02 A;  1DP6 A;  3A0S A;  2ZC4 B;  3X1U A;  1W1Y A;  5JRG C;  1I2W A;  1LL8 A;  1PW8 A;  5A92 A;  2XFS A;  4LFU A;  1N1J A;  4NZ4 A;  3BFD A;  1P3G A;  2ZL1 B;  3P01 A;  4JPM A;  1P34 D;  4S2P A;  4X23 D;  4OOY A;  2RIQ A;  1TS8 A;  3B6G C;  5HX9 A;  1XKZ A;  2NUT C;  1YT4 A;  4DDS A;  3KS8 A;  3AZM C;  5B31 B;  3MVD C;  4R8P B; 
#chains in the Genus database with same CATH homology
 5FDH A;  4GZB A;  1MWU A;  1FSY A;  5EVI C;  5BS7 A;  5L2F A;  3VP2 A;  4K0X A;  4KGC C;  1TAF A;  3HLG A;  4QJG A;  5AVB A;  2Y2K A;  1K56 A;  4Z5T A;  4N1X A;  5B1L D;  3TU4 A;  1ALQ A;  3C7V A;  1XGI A;  2EX2 A;  5AV6 B;  5AV8 C;  3AZK C;  5B1L C;  3S22 A;  1PYY A;  5A91 A;  5GLD A;  3C7U A;  1EWZ A;  3G35 A;  5B1M A;  4XXR A;  1RCJ A;  1L0F A;  3MKE A;  1BH8 B;  3GMW A;  4GB7 A;  1HVB A;  1NZO A;  5GXQ A;  5B32 G;  1KX5 A;  4QLC A;  1K4F A;  1P3I C;  3AZI D;  4CSR A;  3N3F A;  1HQ3 B;  3C1B A;  3M6H A;  3ZG5 A;  1AOI A;  3LO7 A;  3RXW A;  3AZL B;  3KUY B;  4WEJ A;  3AFA B;  1W5D A;  3G30 A;  5B2I B;  2XDM A;  3NDG A;  1SDE A;  3VH6 T;  2XFT A;  1JWV A;  4ID4 A;  2Y2P A;  4QLC C;  1I2S A;  3SH8 A;  1IYQ A;  3FKE A;  3O3V A;  2BYM B;  5GHY A;  3PBT A;  3B0C W;  3X1U D;  3BM6 A;  2HDR A;  3OPP A;  4NE5 A;  3WRT A;  4J8W B;  3NQJ B;  3A3D A;  4UA6 A;  4NFT A;  2Y2O A;  3O62 D;  3MNN B;  1XGJ A;  4WU8 B;  1HZO A;  3IWQ A;  4FH4 A;  5B0Y B;  4X6T A;  4DRA A;  3EQU A;  5AV5 B;  2FFY A;  5GHX A;  1P3K D;  4JJN B;  5E2E A;  1IYP A;  5CEB A;  2G5H C;  3B0D C;  3SS5 A;  3HLF A;  4R0Q A;  4JXG A;  1M19 B;  2WAF A;  3UDX A;  4B4X A;  4H9Q B;  5EPH A;  5B24 C;  3EG5 B;  3X1V A;  3HUO A;  3NIA A;  2FJ7 A;  1P3B C;  4OOL A;  4CPK A;  4MBH A;  2HDS A;  5KSH A;  3AZG B;  4Y7P A;  4RX2 A;  4J8V A;  4G92 C;  3AV2 B;  1ES2 A;  4KGC B;  3Q7V A;  3AZF B;  2Z2M B;  3AZN C;  4KZ4 A;  2ARO C;  5BT1 C;  3AN2 D;  1E3U A;  3BEC A;  3H0L C;  4QU3 A;  2ZQC A;  4EQI A;  4OUI A;  4B88 A;  5B40 A;  4DF6 A;  3B6F C;  2Y2Q A;  3AZI A;  4E44 A;  4M6B A;  4HBU A;  4WU8 D;  3N8S A;  4ZBJ C;  3WAA C;  2YFV B;  4ZTK A;  5AQ7 A;  5B0Y D;  4JXV A;  1Q2P A;  4WZS B;  5AVB B;  3OPL A;  2JC7 A;  5CHM A;  4XUJ A;  3Q7Z A;  3TU4 B;  2IO5 C;  1IYS A;  4EV4 A;  5DNN D;  2CV5 B;  1XA1 A;  5BT1 D;  3AN2 C;  5DTS A;  3LCE A;  4S2L A;  1ULY A;  2IOU A;  5F99 C;  4HGA B;  2G2U A;  4J8U D;  1GCE A;  1M18 B;  5AY8 D;  1BH8 A;  4R8P D;  1G6A A;  1P3B D;  3WTP D;  3WA9 B;  2ZQ9 A;  1M1A D;  4H9S A;  4KHA A;  4J8V D;  1NZU A;  3REJ C;  3REK C;  1YU4 A;  4BLM A;  2F8N B;  4EBL A;  3UTB B;  3WKJ C;  3QNC A;  3WA9 C;  1P34 B;  4KG2 A;  5B2I A;  1F66 C;  3KXB A;  2Y4A A;  4E3M A;  3PBR A;  2Q9M A;  3ZHH A;  1J9M A;  3KWQ B;  3BLM A;  5E5A A;  4L0L A;  4LCM A;  3GTC A;  5DTK A;  3OCL A;  4M3K A;  4GNU A;  1E3U D;  4OPY A;  4IBE A;  2Q9N A;  4HEF A;  5JYP A;  5HL1 A;  1MWT A;  1F66 A;  1W7F A;  3L2A A;  4ZAM A;  3OPR A;  3NY4 A;  2HDQ A;  3REH C;  4BJP A;  3MNN A;  3REL B;  3G2Y A;  3C4O A;  1M18 D;  4ZJ1 A;  4JF5 A;  1PWC A;  3AYW D;  5BS7 C;  4KZ6 A;  3WA9 D;  2RVQ C;  4JJN A;  1U35 D;  2ZC6 B;  4PM6 A;  3X1S A;  2H0T A;  3UY6 A;  5B33 D;  4DQY B;  5EE8 A;  5AY8 C;  4XZQ C;  4Q8I A;  3HUN A;  3WAA A;  5DNN A;  3EPK A;  4HES A;  3X1U B;  5GT0 C;  1P3O D;  3W97 D;  5CGS A;  1Y54 A;  3A3E A;  4N1H A;  4OVD A;  4RX3 A;  2F8N K;  3A1K A;  3KUY D;  5GLA A;  3DW0 A;  5B1M C;  5B31 A;  4R8P A;  5B2J A;  3P5J B;  3S1Y A;  4IBG A;  1U60 A;  1T3U A;  3OC2 A;  5HAI A;  3AV1 D;  1TAF B;  3KWQ C;  1P3A A;  4DE0 A;  4WV4 B;  5B40 B;  5E43 A;  3UE0 A;  1BTL A;  4MNR A;  3AZJ C;  4NYU A;  4KUD C;  1ESU A;  1ERQ A;  4Z5T B;  5B24 D;  5GLC A;  1M19 D;  3AZJ B;  3NQU B;  3IH8 A;  3GQZ A;  5GT3 A;  3A6N D;  2P9V B;  1YU2 A;  4WZ5 A;  2HIO C;  2ZM8 A;  3MVD D;  4N9L A;  3LJA B;  5AV6 C;  2CC1 A;  1KE0 A;  1YM1 A;  5DF7 A;  5B1M B;  3FDD A;  1CEF A;  1ERM A;  4E45 A;  3EPL A;  3CJM A;  2CV5 A;  2ZD8 A;  3HL9 A;  5GSU A;  5G49 B;  4QLC B;  4Z66 D;  4DKI A;  4OJO A;  3G32 A;  3WTP E;  1BSG A;  4CSR B;  1IEM A;  1M18 A;  3BFG A;  4ZUX C;  3EQV A;  3VMA A;  3AFA C;  5AVC B;  3HLW A;  1P3F D;  3AZL A;  5CP6 C;  4KHA B;  4WU9 C;  1ONH A;  3BFE A;  3AZH D;  3G31 A;  5CPJ D;  4Z2M G;  5AQ9 A;  3LJA C;  5GT0 A;  1P3M B;  3UTB A;  1P3P B;  1R4V A;  5DF9 A;  4QB8 A;  3X1S C;  3GSG A;  2UWX A;  4RYE A;  1S32 A;  5E2G A;  1XXM A;  4J8W A;  3NQJ A;  2HUE B;  3X1T D;  5B1L B;  4PM9 A;  1KE4 A;  3A6N C;  2HDU A;  5BPV A;  2Y2N A;  3FZC A;  1F66 B;  2H0Y A;  3Q81 A;  4NK3 A;  5AQB A;  3NCK A;  1QMF A;  1S32 C;  4J8U A;  4OOM A;  2F2A C;  3LZ1 D;  4OPQ A;  5E2F A;  4E3O A;  5FI2 A;  4UA7 A;  2VGJ A;  4U3T A;  1GA0 A;  1P3I D;  4OQI A;  5AVC D;  4Z66 A;  1ZLA A;  3WTP C;  1U35 C;  1M40 A;  4GDN A;  1K6S A;  1M19 C;  1HTZ A;  3RXX A;  3VFH A;  3V5M A;  1K54 C;  3MXS A;  3I7J A;  3REI D;  3VFF A;  5AY8 B;  4E3J A;  3OPH A;  4Y0O A;  2DRW A;  5M1A A;  4JF4 A;  3AZG A;  4RVA A;  4G91 C;  3B6G D;  4NZ5 A;  4J8X C;  2ZJ9 A;  5F99 B;  5B2I D;  5EOO A;  1YMS A;  1K57 A;  5CRF A;  5DNM A;  3IXG A;  3O86 A;  4X53 A;  3WRZ A;  4DXC A;  3EPJ A;  4PM5 A;  2F8N H;  4OJ6 A;  3AZM A;  3CMZ A;  4G91 B;  3IXH A;  3IXB A;  4FSF A;  2Y2L A;  3ZVT A;  1Z6F A;  3REL D;  5B2J B;  1DY6 A;  5CPK A;  2WAD A;  2Y2I A;  5AVC C;  4ZUX B;  2YFV A;  1MBL A;  3ZDJ A;  5AQA A;  2C5W B;  2W8S A;  4OON A;  3AZE A;  4BL2 A;  1U35 B;  4S2M A;  1BUE A;  3AZF C;  3HON A;  4XUJ B;  4QNL A;  4NE3 A;  4X69 A;  2OSU A;  3AGD A;  3AZJ A;  3NQU A;  5CPK C;  3BFC A;  2P9V A;  3FKV A;  4BD1 A;  5C3I B;  3L25 A;  3QNB A;  3WKJ B;  3UTA D;  1BZA A;  3X1S D;  4LG2 A;  3LJA A;  3MGP A;  5B33 C;  1NY0 A;  5F1G A;  1BH9 B;  3S4X A;  3AV2 C;  1P3K A;  3ITA A;  2L5A A;  1PWD A;  2J7V A;  3MGQ C;  4GOG A;  5FI7 A;  2CWE A;  1ES5 A;  5GSU B;  4YS3 B;  1KX3 B;  5G49 A;  4R1G A;  4LV1 A;  3AZF D;  3VH6 W;  2F8N A;  4IBB A;  3KS4 A;  2BLS A;  2Y2H A;  1NJ4 A;  5AVC A;  2RCX A;  4KEN B;  1YUE A;  1JWZ A;  3AN2 B;  1FCO A;  1P34 A;  5BO0 A;  2I72 A;  3R45 B;  1WWS A;  3REJ A;  4MBK A;  3NDE A;  3KXB B;  3W4Q A;  5BOH A;  1EI5 A;  4J8U C;  4BL3 A;  5A93 A;  2JSS A;  3SOI A;  4LV3 A;  3W98 D;  5GT0 B;  5B24 A;  1P3M A;  1KE3 A;  1P3P A;  4H9O A;  1S0W A;  1RGZ A;  2WKH A;  2ZY5 A;  1H8Y A;  5DTT A;  3WS4 A;  3WKJ D;  1BUL A;  1WYC A;  2Y2G A;  3AZK D;  4Y0U A;  3REL A;  1K57 C;  2X01 A;  4FCF A;  5FI6 A;  4H9R B;  1JTG A;  3BRM A;  5FQM A;  4EUZ A;  2V1Z A;  2ZC7 A;  5HFO A;  2PU2 A;  2HIO B;  3UDF A;  4NE6 A;  5B1M D;  4OPZ A;  1WE4 A;  4OQG A;  3ZGA B;  4YS3 D;  2XD1 A;  2WYX A;  3G34 A;  4E6W A;  1BFM A;  1P3B B;  4J8U B;  5M18 A;  2WAE A;  4YM6 A;  3PAG A;  4QD4 A;  5CHU A;  2XR0 A;  3WWX A;  3E2K A;  1IKI A;  4KZ7 A;  3AZL D;  4Z66 B;  1ZLA B;  3UE1 A;  4DRB A;  4OP8 A;  2WKE A;  1MY8 A;  5KDM A;  5KMW A;  3WTP A;  3MGP D;  4BQM A;  2PYO C;  3B0B A;  1L0D A;  1B67 A;  3UTB D;  1GHM A;  3NI9 A;  1MKI A;  4IJE A;  1M6K A;  3AZH B;  2Z2L B;  5F99 A;  3ZCZ A;  2WUQ A;  3KSY A;  1TZY D;  3W96 C;  4WU8 C;  5CGX A;  3D4F A;  1P3M D;  4UUZ A;  1KX4 D;  1P3A B;  4DE1 A;  4J8W D;  2R9X A;  3AZM B;  5CPK B;  4OQH A;  2ZY2 A;  1PWG A;  4ZUX A;  1XP4 A;  3REJ D;  1FR1 A;  1ZG4 A;  5GT3 B;  3X1T B;  5AV5 D;  1G68 A;  4ZJ2 A;  4KZ8 A;  2F8N G;  5B32 C;  1U35 A;  4XUJ C;  3L28 A;  3O88 A;  3VH6 A;  3UT9 A;  5CTM A;  1PZR A;  2PYO D;  3FWL A;  3IQA A;  3B6G B;  2WGW A;  5CPJ C;  3WKJ A;  1ZG6 A;  1PIO A;  1HQ3 C;  2IWC A;  1TZY C;  5FSR A;  1P3I B;  1MPL A;  3MXR A;  1KX5 C;  3AZG D;  1W8Q A;  5M19 A;  3AGE A;  4OPR A;  3VOZ A;  4QHC A;  4WBG A;  4J8V C;  5BNX A;  3W97 B;  3UT9 C;  3LY3 A;  1EQZ D;  5B33 A;  3MGP C;  2EFU A;  3ZG8 B;  4XUZ A;  3GR2 A;  1AOI C;  4A5R A;  3REK A;  1FR6 A;  4YS3 A;  1KX3 A;  3O87 A;  4N92 A;  3WS5 A;  2BG1 A;  4YM6 D;  5F99 D;  3PBN A;  3P98 A;  1DJB A;  4H9N B;  2A3U A;  2X71 A;  4OKP A;  3IF5 A;  2XQZ A;  1L0E A;  5B40 D;  1P3A C;  4WJ3 C;  3R45 A;  3REJ B;  5F82 A;  1N9B A;  1S32 B;  3G2Z A;  4U0T A;  1ES4 A;  3NBL A;  2P74 A;  4Z5T D;  5B24 B;  2HP9 A;  5B1L A;  3TU4 D;  5B31 G;  3Q1F A;  4H9O B;  2Y91 A;  2DCF A;  3IF6 B;  5E5A C;  3AZN D;  3W97 C;  2ZC5 B;  3A6N B;  2QPN A;  4WEL A;  3BLS A;  4IBC A;  3MVD B;  5B31 C;  5GSU D;  5DNM C;  5A90 A;  5CED A;  3WS2 A;  2ZMA A;  3MBZ A;  1JTD A;  1L0G A;  3V39 A;  1PI5 A;  2IO5 B;  3LZ1 C;  1SKF A;  4PMA A;  3M2K A;  4OLG A;  4NYY A;  5JRG B;  4KQQ A;  1H3O A;  2ZM2 A;  1SDN A;  4LV2 A;  3UE3 A;  1H5X A;  2HIO A;  5HAP A;  5FQJ A;  5AY8 A;  1YQS A;  1DJC A;  2FFF B;  1YLW A;  4P6B A;  1P3B A;  3TG9 A;  4YM6 B;  2FJ7 C;  3UT9 D;  1YMX A;  4Z2M H;  4P0M A;  5EOE A;  5GT0 D;  1P3F B;  4F94 A;  2NZD D;  4OP5 A;  5CPJ B;  4IBI A;  5DNM B;  5DF8 A;  2XD5 A;  5KDM B;  3WTP B;  5J8X A;  3MGR B;  3W98 A;  2NQB C;  1OME A;  1P3P D;  4J8X A;  4WZ4 A;  1KX4 C;  4EO5 B;  3ZNT A;  1TEM A;  2EXB A;  4UA9 A;  3AZE B;  5CTN A;  5FQQ A;  3LEL B;  2J8Y A;  3UPN A;  3ZVW A;  5AV9 B;  2PBY A;  3AZK A;  2BYK A;  3W8K A;  3MZE A;  1H8Z A;  3QHY A;  3HLE A;  2NZD C;  3KFU G;  3B0D B;  3BEB A;  2YFW B;  1ZLA D;  4IBX A;  3AZH C;  3AV1 C;  3A3I A;  2OV5 A;  2XK1 A;  3FYZ A;  3SS3 A;  4KG6 A;  3B0C T;  3IT9 A;  1LI9 A;  1L2S A;  3MGP B;  5GXQ C;  1BH9 A;  3UT9 B;  1P3K B;  1P3M C;  2NQB D;  1KGG A;  2JE5 A;  3B6G A;  4J8W C;  1BLH A;  2XF3 A;  5FUG B;  5EVI A;  5FA7 A;  1PZO A;  1MXO A;  1TZY B;  4JLF A;  4WU9 B;  3OZH A;  4H9S C;  1KX4 B;  5FAT A;  2G5I C;  1P3G D;  3AL0 C;  3MGS D;  3MGR D;  3VSK A;  3CG5 A;  3UTA C;  4OH0 A;  5BNX B;  3W4O A;  3W97 A;  4GN2 A;  3AN2 A;  3PTE A;  3PBS A;  5BO0 B;  1B6W A;  4UAA A;  3VP1 A;  4IBJ A;  4QY6 A;  3VP0 A;  1MWS A;  3AYW C;  4LV0 A;  5B2I C;  5EVL A;  4KGC D;  2H5S A;  4ZJ3 A;  3M6B A;  1KVM A;  3ISG A;  4S2I A;  4KQR A;  1NXY A;  2ARO D;  4KZ5 A;  5B0Z B;  3AZI C;  1P3G C;  1ID3 D;  3DTM A;  1P3L B;  1M1A A;  3UN7 A;  3B6F D;  4S2N C;  4D2O A;  3C5A A;  5FQK A;  4H9R A;  4GD6 A;  5AV9 C;  2NQB A;  3W98 C;  4S2J A;  2V20 A;  1K6R A;  3MGS B;  4OQ0 A;  4IBD A;  4BEN A;  1CK3 A;  1YLP A;  5C3I C;  4YS3 C;  3UTA A;  3X1V C;  1EQZ A;  4IVK A;  3ZFZ A;  4P87 A;  5EUA A;  3UO9 A;  5E5A D;  3MGQ B;  2G2W A;  1FOF A;  3VH5 A;  3MGR C;  4HBT A;  3BYD A;  5TGF A;  2WGI A;  2HUE C;  1JFI A;  4QLC D;  3AZH A;  2F8N D;  3SH9 A;  5CPJ A;  5HAQ A;  3DWK A;  2C6W B;  4UUZ B;  3C1C D;  4QY5 A;  4EWF A;  1P3P C;  3MGR A;  1NYY A;  3MKF A;  4PM8 A;  2V2F F;  1Q2Q A;  2WZX A;  1BLP A;  5CPI D;  4J8X B;  5JRG D;  3JYI A;  4JXW A;  3X1T A;  1CEG A;  5CP6 B;  3IWI A;  4S2K A;  3LEL A;  2Y2J A;  5B32 D;  1KVL A;  2BYK B;  1P3O A;  5G18 A;  2WGW B;  3IF6 C;  1ERO A;  3V3S A;  5CHJ A;  5FQI A;  4LEN A;  2J8P A;  1P3I A;  4PM7 A;  1HTA A;  3AV1 A;  5FAO A;  3EPH A;  5B33 B;  2GDN A;  2WZZ A;  3HLB A;  3DWZ A;  4Y0T A;  5F83 A;  3REK B;  1TZY A;  4G92 B;  3W96 B;  4WU9 A;  1SCW A;  2QMI A;  4KZA A;  1KX4 A;  1Q9C A;  3Q07 A;  4X68 A;  5AV6 D;  4S2N A;  1NYM A;  2DF4 C;  4H9N A;  5DNM D;  4GDB A;  1BT5 A;  3IP4 C;  5B40 C;  4E3I A;  1LI0 A;  1P3A D;  3LZ0 B;  4BD0 A;  4DRT A;  4R4R A;  3FKW A;  1YLZ A;  5FAQ A;  3B3X A;  5B2J C;  3TU4 C;  3W4P A;  3REH D;  1O7E A;  4MLL A;  3IF6 A;  4DDY A;  3HLC A;  2VQR A;  3A6N A;  3HLD A;  3MNN C;  3MVD A;  3UPP A;  4WNN B;  5B0Z A;  4ZBE A;  1IKG A;  3SH7 A;  5KSC A;  3VSL A;  2J9P A;  4YFM A;  4X23 C;  5KZH A;  5I94 A;  5GXQ D;  1P3L A;  4IBK A;  4JBF A;  1M1A B;  1KX5 D;  5GT3 C;  2ZQ8 A;  5GLB A;  5JRG A;  3ZG9 B;  3UNW A;  3IXD A;  4NY2 A;  1H3O B;  3HUM A;  3VP4 A;  5CPI C;  4ZDX A;  1M1A C;  3C1B D;  3PAE A;  1AOI D;  1YLT A;  1O07 A;  4R3J A;  3UTA B;  3IHA A;  3W99 B;  4RA7 A;  3AZG C;  2ZLY A;  1P3F A;  1PZP A;  2HPB A;  4MEZ A;  4O7D A;  1A7W A;  1PI4 A;  2DNS A;  3MGQ A;  3L27 A;  4WMC A;  1N4O A;  3VOY A;  3W98 B;  4EBP A;  4KUD D;  1KX3 D;  5AV8 A;  4LD9 B;  4KG5 A;  4Z66 C;  1KDW A;  4YIN A;  2XLN A;  2ZQA A;  1KU5 A;  1XA7 A;  3MZD A;  4GD8 A;  3C1B C;  1E4D A;  3CZD A;  5CXW A;  4LCL A;  3W99 C;  3H0M C;  5AV9 A;  3AZK B;  2IWD A;  3N8R A;  4E6X A;  2EXA A;  3REI A;  1E25 A;  1ID3 B;  2YFW A;  2B5R A;  5EEC A;  3ZG0 A;  4C75 A;  1XPB A;  4IJF A;  3WS0 A;  4U0X A;  5CHL B;  4XZQ D;  1WYB A;  4CJN A;  3X1V D;  1P3O B;  2FJ7 D;  3L26 A;  1PW1 A;  5FUG A;  4CAY A;  5EVI B;  3REL C;  1QME A;  4R8P C;  1S6R A;  3AGF A;  4JKT A;  1KDS A;  1P3O C;  4C6Y A;  4KZB A;  2H10 A;  3AZL C;  1GA9 A;  3HVF A;  5DVA A;  5GHZ A;  1ZKJ A;  4WMC D;  3GV9 A;  4FH2 A;  2ZC3 B;  4J8X D;  4X23 B;  1ID3 C;  1YU0 A;  2E8I A;  3W96 A;  1K56 D;  4ZBJ B;  5GL9 A;  3AZM D;  3AZJ D;  1KX3 C;  3PBQ A;  2J9O A;  3V50 A;  5CPI A;  3C1C B;  1EQZ C;  1ZC2 A;  1RGY A;  4WEK A;  1ONG A;  2Y59 A;  3AZE D;  2EX6 A;  3LEL D;  1W79 A;  2PU4 A;  3HRE A;  3M2J A;  3V9R B;  1Z2C B;  4R3B A;  4N9K A;  1P34 C;  1NRF A;  2CV5 D;  1M18 C;  5EVI D;  2ZQ7 A;  4XUX A;  3X1U C;  1RP5 A;  2NQB B;  3RJU A;  4E3N A;  5GT3 D;  3MGS A;  5U47 A;  3IH9 A;  3G4P A;  5CEC A;  3F6T A;  1ES3 A;  1HQ3 D;  3C1C C;  1EQZ B;  4KZ9 A;  5CGW A;  1BLC A;  5AV5 C;  3AFA D;  4WU9 D;  4DXB A;  5F1F A;  1N1J B;  4R23 A;  1P3G B;  4E3L A;  4UHU A;  1SHV A;  2ZQD A;  1JFI B;  3REH B;  4UPK A;  2CV5 C;  3SS4 A;  2WGV A;  4MBF A;  2R9W A;  3O62 C;  3Q82 A;  3AYW B;  4PPR A;  3UPO A;  2ARO B;  4LD9 A;  3AZN B;  1K55 A;  3TSG A;  3MNN D;  5CP6 A;  2WK0 A;  3KUY C;  3B6F B;  5TR7 A;  5IHV A;  3O62 A;  4GHL A;  4FD8 A;  1P3L D;  1C3B A;  3LZ1 A;  4JJN D;  1AXB A;  3P09 A;  1S32 D;  4WYY A;  3ZG7 B;  4E3K A;  4EBN A;  4K0W A;  1W8Y A;  3IHB A;  5GXQ B;  3WAA D;  3PBO A;  3ZNY A;  4DE2 A;  4Z5T C;  3AV1 B;  3C1B B;  4KUD B;  2HP5 A;  5E2H A;  5FQ9 A;  1AOI B;  2NZD B;  4H8R A;  3MGS C;  3KUY A;  3A3F A;  4B4Z A;  4H9P A;  4NZ3 A;  5B31 D;  1K54 A;  5JA4 B;  3OCN A;  1JVJ A;  3N4I A;  4OJP A;  4DE3 A;  4JJN C;  2DQN C;  1JWP A;  4AWL B;  1P3L C;  5B0Y C;  4X55 A;  1LL9 A;  1KGF A;  1FSW A;  3LZ0 A;  2PYO A;  5AVB D;  4C3Q A;  3UDI A;  2XEP A;  4XZQ B;  5CPI B;  1IEL A;  3X1T C;  4WU8 A;  3H0R C;  2WKI A;  1P3F C;  5CER A;  5B0Y A;  1IYO A;  4IBR A;  3A1I A;  4IED A;  5BNV A;  2RL3 A;  3N6I A;  3WS1 A;  4NET A;  5TFQ A;  5CPK D;  4WNN A;  3LJA D;  1TDG A;  1YLJ A;  4X56 A;  3V9R A;  4Z9Q A;  3LY4 A;  4K91 A;  1TDL A;  5B32 A;  4AWL C;  3KXB C;  3X1V B;  4JXS A;  2A49 A;  3HBR A;  1CI8 A;  4NZ1 A;  4LD9 C;  4KZ3 A;  2IWB A;  1I5Q A;  5HAR A;  5HW3 A;  3KXB D;  1K55 C;  3W99 A;  3AV2 A;  1P3K C;  1YU3 A;  3Q7V B;  3N7W A;  3LEL C;  3REK D;  3W96 D;  1YU1 A;  3GVB A;  5JYO A;  2VGK A;  4GH9 A;  1KGE A;  3V3R A;  1HD8 A;  1LLB A;  3AZI B;  3NC8 A;  4JF6 A;  1CI9 A;  2ZM0 A;  3UTB C;  1FCM A;  2EFX A;  3REH A;  1BLS A;  3MZF A;  5FAP A;  5AV8 B;  3LZ0 D;  4WZ5 C;  5FAS A;  1F66 D;  2ZY3 A;  3KWQ D;  4IVI A;  5AV6 A;  3AZE C;  4WM9 A;  5D3O A;  3VP3 A;  3L29 A;  3GRJ A;  3ITB A;  2EX8 A;  3AYW A;  2OLV A;  1LL5 A;  2HIO D;  4YM6 C;  4OJ5 A;  2ARO A;  3AZN A;  1K38 A;  5DNN C;  3REI B;  1ID3 A;  1WWI A;  1GHP A;  1KX5 B;  2JBF A;  3B6F A;  1XX2 A;  1YLY A;  1MWR A;  2QZ6 A;  3O62 B;  3MFD A;  3A3J A;  3LZ1 B;  3BFF A;  2XH9 A;  1HQ3 A;  4R4S A;  5B0Z D;  1FQG A;  2Y2M A;  4GHA A;  1GHI A;  2ZY4 A;  3WA9 A;  4CAY B;  3AFA A;  3LZ0 C;  4KQO A;  2HP6 A;  2ZM5 A;  3W99 D;  1TVF A;  5B2J D;  4P85 A;  3TOI A;  3LEZ A;  4IBF A;  2LY8 A;  4KUD A;  1K25 A;  5GSU C;  2EX9 A;  2BYM A;  2NZD A;  5AV8 D;  3IWO A;  4X23 A;  3N8L A;  1ESI A;  4H9P B;  2Y55 A;  1VM1 A;  5JA4 A;  1K4E A;  3KWQ A;  5E5A B;  3MGQ D;  3C4P A;  3AV2 D;  2RVQ D;  4LD9 D;  3E2L A;  4EO5 C;  3C1C A;  3WX7 A;  2OLU A;  4ZUX D;  5CP6 D;  4GKU A;  5AV5 A;  1LHY A;  4HGA C;  2PYO B;  1VQQ A;  3VH5 W;  4XUJ D;  4OLD A;  4XZQ A;  1M19 A;  1F1E A;  3VH5 T;  1ZLA C;  4H9Q A;  2XGN A;  5AV9 D;  4OJL A;  1W2E A;  5BNV B;  3X1S B;  2FJ7 B;  4S2O A;  5B0Z C;  1DJA A;  2JCH A;  5AVB C;  4J8V B;  3HSH A;  3WAA B;  4KGC A;  5DNN B;  3REI C;  3AZF A;  1FCN A;  3FV7 A;  5B32 B;  2X02 A;  2ZC4 B;  3X1U A;  5JRG C;  1I2W A;  1PW8 A;  5A92 A;  2XFS A;  1N1J A;  4NZ4 A;  3BFD A;  1P3G A;  4JPM A;  1P34 D;  4S2P A;  4X23 D;  4OOY A;  2RIQ A;  5HX9 A;  3B6G C;  1XKZ A;  1YT4 A;  4DDS A;  3KS8 A;  3AZM C;  5B31 B;  3MVD C;  4R8P B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...