2JE5A

Structural and mechanistic basis of penicillin binding protein inhibition by lactivicins
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
683
structure length
461
Chain Sequence
b'SEITYSDGTDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTNQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PENICILLIN-BINDING PROTEIN 1B
publication title Structural and Mechanistic Basis of Penicillin-Binding Protein Inhibition by Lactivicins
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Drug-binding protein
total genus 147
structure length 461
sequence length 683
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
A PF00912 Transgly Transglycosylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2je5A01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2je5A03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2je5A02
1DJAA 5D3OA 4FH4A 4RX3A 2G2UA 1NXYA 3ZG9B 3EQUA 4DE2A 5FQIA 3ZG5A 2WKIA 4O7DA 4UA9A 1W5DA 1YMSA 2Y2PA 2WZZA 1G6AA 2C5WB 3P09A 4IBRA 2H0TA 3HLDA 1RCJA 3ZG8B 1AXBA 2JBFA 1FCOA 3CJMA 5CXWA 3WRZA 1IYOA 2X01A 3ISGA 4QY6A 1BUEA 1XKZA 2Y2IA 1S0WA 4PM9A 5FQJA 2ZJ9A 3GVBA 4OPRA 3ZDJA 1FCMA 3NDEA 4E3IA 4E6XA 3V39A 2WAEA 3DWZA 4E3JA 4R23A 4M3KA 4QB8A 4KZ6A 1EROA 1FR6A 5EVIA 5E2HA 2VGJA 5CECA 2A3UA 1E3UD 1CK3A 5FA7A 2FFYA 3PBNA 1YLPA 4MBHA 3ZCZA 5J8XA 3IHBA 4U3TA 5DVAA 1IEMA 4OVDA 1WE4A 5F1GA 1XPBA 3Q82A 4WEKA 5IHVA 3IH8A 2JC7A 2ZQAA 4GDBA 5EVIB 1ESIA 4CJNA 2Z2LB 1K56D 1L0DA 4PMAA 5HL1A 3ZG7B 1HD8A 2EFUA 4BLMA 3UE0A 3N4IA 3N8LA 4OLGA 4HBUA 2Y91A 1TEMA 4S2NC 1TDLA 1IYQA 1K4FA 5CGWA 1ES3A 4C3QA 1SCWA 1O7EA 3WS0A 3M2JA 5EECA 4DE3A 1FSWA 5DTSA 2Z2MB 4Q8IA 4JPMA 4MBKA 5AQAA 2EX9A 4DRTA 3G2ZA 3I7JA 1PIOA 1XP4A 1XA1A 5EOOA 1Y54A 1E25A 3OCLA 4GZBA 4ZAMA 3BEBA 4N1XA 5AQBA 1YLZA 1XX2A 4KZAA 4GD6A 4KZ7A 3ZFZA 1VQQA 3FKVA 1CEGA 2J8YA 4F94A 1KDSA 1L0EA 2Y2NA 4KG6A 3ZNTA 1SDEA 3MZFA 3E2LA 1SDNA 3E2KA 4IEDA 2OLUA 2ZLYA 3GR2A 5FSRA 4QD4A 5EE8A 2XK1A 3HUOA 2ZQ8A 3V5MA 2HDUA 3PTEA 1XGIA 3UY6A 3MZDA 3BRMA 4OKPA 4BJPA 5EVIC 1K57A 3QNCA 4RVAA 4OQHA 5HAIA 3IHAA 3NCKA 5GLAA 2OV5A 4NK3A 1N9BA 5FASA 3BYDA 4GD8A 1DJBA 2XR0A 1PWGA 2ZD8A 3RJUA 3UE1A 2XD1A 3G31A 3PBQA 3SS5A 2WKEA 3LEZA 3MXSA 3DWKA 3M6BA 4X6TA 3IQAA 3FZCA 5A92A 3MZEA 3VP4A 4P87A 3VP2A 1ZG6A 1LHYA 4ZJ3A 1MWTA 5GLDA 4KZ8A 4XUZA 3Q81A 2Y2MA 1ALQA 1PWCA 3GMWA 5DF8A 2ZC3B 4DKIA 4Y0OA 1Q2QA 5M1AA 3UDIA 4ZDXA 1H8ZA 4LV1A 2H5SA 5GLCA 5HAQA 3N8SA 5E2FA 2H0YA 5FAPA 3A3IA 4E3NA 3CZDA 1H8YA 5HW3A 1ONGA 5FI7A 3HVFA 2HP6A 4JF5A 3GTCA 3MKFA 3N6IA 4OQ0A 4LENA 3AGEA 4NETA 5TGFA 4N92A 5CEBA 1DJCA 1PZPA 1PW1A 3NY4A 3PAEA 4S2IA 3LY4A 1M40A 2Y2JA 2EXAA 4LV0A 1MWSA 3A3JA 2UWXA 2Y2KA 2HDQA 1IYPA 1GCEA 5M18A 3HLWA 1E3UA 2Y2OA 2Y2LA 1HZOA 2JCHA 1W8YA 4YINA 1ERMA 2X02A 3PAGA 3V3RA 1IELA 3CMZA 3OPRA 4EV4A 5KSCA 4RX2A 5A90A 1LL9A 4BL2A 5GHYA 4B4XA 3IWIA 5EPHA 1K56A 3WS1A 5G18A 2ZC7A 2OLVA 4JXWA 1KE0A 5FI6A 3WS4A 3C4PA 3C7UA 1CI8A 1JTDA 1K57C 3OPLA 3UPPA 3UPOA 3BFFA 4GOGA 4FSFA 1I2SA 1KGGA 1BSGA 1XGJA 2Y2HA 3BLMA 2WYXA 3G35A 4MNRA 2J9PA 4MBFA 1ESUA 3C7VA 3GV9A 1K38A 5AQ9A 4K0XA 1NRFA 4MEZA 4QHCA 3B3XA 1EI5A 1ZKJA 4GB7A 5FQMA 4DF6A 5CERA 5A91A 2IWBA 4QU3A 1G68A 2EXBA 1PYYA 5CHUA 1PZOA 3P98A 3VP0A 5A93A 4OOMA 1NZOA 4N9KA 4ZTKA 2HDSA 4UHUA 4N1HA 2Q9NA 4WM9A 3UDXA 2RCXA 3ZVTA 3BLSA 3NC8A 3SS4A 3ITAA 1JVJA 3NI9A 4S2OA 4IVKA 3HBRA 4R0QA 3HLFA 1NZUA 1FQGA 3GQZA 5I94A 4WMCD 3W4QA 4S2KA 1PWDA 1MWRA 2EX6A 4KG2A 1JWPA 4OH0A 1KGFA 3WWXA 4EBLA 4OPQA 4YFMA 4N9LA 4GKUA 1GA9A 5F83A 1W79A 3QHYA 1FOFA 1N4OA 4U0XA 5E2EA 1W7FA 2P9VA 5HFOA 3HL9A 1SHVA 3FKWA 3IT9A 5U47A 5JYOA 4S2MA 2EFXA 1QMEA 2WK0A 3BM6A 2ZQ7A 3A3DA 3Q07A 4P6BA 1RGZA 2FFFB 2XF3A 4RYEA 3A3EA 3G2YA 2VGKA 5CRFA 4WZ5A 3W4PA 1BTLA 4X69A 5KZHA 1ONHA 4B4ZA 3O88A 3ITBA 2WADA 2OSUA 3G32A 4KZ4A 5E43A 2QMIA 5CHJA 5TFQA 1BLCA 3ZHHA 1JWVA 4L0LA 5E2GA 3BECA 2H10A 2V20A 1VM1A 2WKHA 4LV3A 5GLBA 3OPHA 3NBLA 2ZM8A 3S1YA 2E8IA 4DDSA 1E4DA 1YLTA 5HARA 2V1ZA 1HTZA 5JYPA 5M19A 4PPRA 1QMFA 2DRWA 1ES5A 2WGVA 4JBFA 1NY0A 1KVLA 1K6RA 1K54A 1DY6A 2ZQ9A 2R9XA 4JKTA 5F1FA 5BOHA 1K55A 2Q9MA 3IXGA 1KGEA 2BG1A 2Y4AA 5DF9A 5CGXA 1K6SA 1PI5A 2Y59A 3FYZA 4R3JA 4BENA 4GN2A 3TOIA 5EOEA 3ZVWA 3DTMA 3OC2A 3UO9A 3IXBA 3A3FA 4JF6A 2R9WA 5DTTA 3O86A 5TR7A 4EBNA 3VOZA 1Q2PA 3V3SA 2XDMA 4KG5A 5GHZA 3ZG0A 2PU4A 2DCFA 1RP5A 2PBYA 1BT5A 3FWLA 4ZJ2A 2RL3A 2CC1A 4OQIA 3M2KA 3MXRA 1ZC2A 3N8RA 2IWDA 4KENB 1LLBA 4PM7A 4JXGA 2V2FF 3NIAA 4UA6A 5HX9A 1NYMA 3IF6A 3DW0A 4OQGA 4RA7A 4QY5A 3SH8A 4XUXA 1YLWA 3S22A 3GRJA 5FQKA 3VFHA 2QPNA 3PBOA 4EWFA 1NJ4A 5DTKA 5FATA 4CPKA 1NYYA 1U60A 1O07A 2XFSA 4UA7A 5FQ9A 5AQ7A 5FAQA 5GL9A 4KQQA 4WZ5C 4X53A 3IF6B 1MWUA 4E3OA 3HUNA 4WEJA 2ZQCA 3BFEA 4ZJ1A 1LI0A 4P0MA 5CEDA 3LCEA 2C6WB 1XXMA 1LL5A 4E3KA 4PM5A 3TG9A 3W8KA 2XEPA 5FDHA 3CG5A 4FH2A 3AGDA 1L0GA 3IWQA 3OCNA 1GHPA 3GSGA 4PM6A 1MXOA 5KSHA 3M6HA 3Q7ZA 1GHIA 5FQQA 5KMWA 3D4FA 4BD0A 4OP5A 1C3BA 4WZ4A 3SH9A 2DNSA 3BFGA 4WMCA 4E3LA 2ZM2A 4OLDA 4EUZA 1K54C 3Q7VA 5L2FA 1S6RA 2A49A 1K55C 3HLEA 2WGWA 1JWZA 1XA7A 5F82A 4LCLA 2HDRA 3VFFA 4DDYA 2XH9A 3O87A 3VOYA 3NDGA 4FD8A 4PM8A 4KZBA 5FI2A 3N7WA 4R3BA 4Y0UA 3HLBA 2BLSA 2ZC4B 4HBTA 3Q7VB 4DXCA 1GA0A 3HLGA 1ES4A 1TVFA 4JLFA 2G2WA 2WGWB 4LV2A 3VP1A 2P74A 4E3MA 4S2PA 1K25A 3VMAA 1RGYA 3HLCA 1IKIA 1WYCA 3JYIA 3PBSA 5CTNA 3HREA 4UAAA 2EX2A 1W8QA 3PBRA 4QJGA 1SKFA 2WUQA 1OMEA 1ERQA 3IF6C 3VSLA 4DE1A 3ZGAB 2XQZA 2ZC6B 4MLLA 3WS5A 4C75A 1YMXA 4K91A 5EUAA 3UNWA 4S2JA 3W4OA 1FSYA 4C6YA 1EWZA 2J9OA 2EX8A 2X71A 4BD1A 4D2OA 3OPPA 1Z6FA 1I2WA 4OOLA 5EVID 4Y0TA 1YM1A 2ZQDA 5FAOA 3IF5A 4ID4A 3UE3A 2P9VB 3AGFA 5GHXA 4R4RA 4WBGA 3V50A 1FCNA 1BLSA 3RXXA 4K0WA 4OPZA 1LI9A 1TDGA 5CHMA 3SOIA 1KE4A 4R4SA 4B88A 1K4EA 1YQSA 3HUMA 4OOYA 4EQIA 3O3VA 3MBZA 4GNUA 4IVIA 2ZM0A 4GDNA 3WRTA 3LY3A 1PW8A 4Z9QA 1H5XA 4WYYA 4WELA 1BULA 2XGNA 5CGSA 1JTGA 3RXWA 1IKGA 2Y2GA 1PI4A 1WYBA 1IYSA 2JE5A 3QNBA 4ZBEA 2I72A 5EVLA 3UPNA 1MY8A 3TSGA 3BFCA 3Q1FA 3G4PA 3S4XA 3UDFA 3IXDA 2QZ6A 1BLPA 1KVMA 2GDNA 4JF4A 2WGIA 2WZXA 4FCFA 3IH9A 4DXBA 1HVBA 4OP8A 2HP5A 1MKIA 1L2SA 2PU2A 5DF7A 1CI9A 4DE0A 2B5RA 1ES2A 2ZC5B 4Y7PA 4HEFA 3PBTA 2J7VA 4OONA 4P85A 4BL3A 2IWCA 4X55A 3LO7A 1YT4A 3EQVA 4S2LA 3MFDA 4U0TA 1BZAA 3VSKA 1KE3A 4JXVA 4KQRA 3G34A 1BLHA 3IXHA 2Y2QA 1FR1A 1I5QA 4JXSA 2XFTA 4KZ5A 4KQOA 4XXRA 3OZHA 3FV7A 3C4OA 1GHMA 2ZMAA 4KZ9A 4X68A 1CEFA 1YLYA 1MPLA 2WAFA 1J9MA 3IWOA 2Y55A 4KZ3A 1ZG4A 4OPYA 3BFDA 3SH7A 1L0FA 1M6KA 2HP9A 3G30A 4IBXA 4S2NA 3VP3A 5HAPA 3UN7A 3ZNYA 4EBPA 3SS3A 4A5RA 1YLJA 1KDWA 4H8RA 4HESA 5CTMA 2XD5A 3C5AA 2HPBA 4BQMA 4E6WA 4R1GA 3MKEA 4LCMA 1MBLA 4X56A 3WS2A 2XLNA
chains in the Genus database with same CATH superfamily
5CP6C 2G2UA 4H9OA 2PYRA 3AV1A 5FQIA 2VEAA 3E4PA 1W5DA 5AV8B 3R4KA 3L27A 2H0TA 3HLDA 1RCJA 2O9AA 3L2AA 1FCOA 3CJMA 2PDRA 3KUYC 1IYOA 3WA9C 3AZHB 3ISGA 4QY6A 5GT0D 1S0WA 1YAXA 2ZJ9A 1G28A 3AZIB 4E3JA 3H82A 3MR0A 4QLCD 3T1SA 1FR6A 2V1AA 5E2HA 2VGJA 4KUDA 1YUEA 2DMWA 1E3UD 3PBNA 3MS6A 3ZCZA 4ETXA 3IHBA 5CPJB 3AZMC 4XZQA 2PD8A 3CPTB 3NQJA 2M1CA 1W63Q 3MGPC 3W96D 3B6GB 3W99D 3IH8A 4GDBA 3WD2A 4WL9A 3ZYTA 1B67A 2GJ3A 1L0DA 2P7JA 1HD8A 4XUJD 4F3LB 5DNNA 1PDCA 4HI4A 5GT0C 2W1TA 1KX3B 3NQUA 1FSWA 5DTSA 2Z2MB 3PHYA 4JPMA 4QLCC 4MBKA 1P3PB 2F8NG 3G2ZA 3RELA 2R78A 4YM6A 2NZDD 5B32A 3A0SA 3RFBA 2ZY5A 5EOOA 5B0ZC 4JJND 3F1NA 4ZAMA 3BEBA 3D3OA 5CP6A 3AZKC 5DNMA 5FDSA 3W99C 4EESA 5AVCD 3PXPA 4EU0A 4WU9B 1AOIA 3MZFA 4XUJC 3E2KA 4IEDA 3REKC 3HUOA 5AVBD 2HDUA 3EG5B 4J8WD 1XGIA 3BRMA 1VB6A 2QHKA 4BJPA 4O01A 1OJ5A 3DTKA 4QWOA 2XR0A 2ZD8A 3UE1A 1IOUA 2XD1A 1KOUA 2WKEA 3DWKA 3M6BA 4X6TA 5B24B 3LZ1D 2NZDC 3CAXA 2AROB 2JHEA 3VP4A 4JJNC 3VP2A 3W98D 1LHYA 4UUZB 2HGVA 5AVCC 2J3TD 3WAAB 3AZGD 1H8MA 4NZ5A 3LIEA 3Q81A 5DF8A 3VV4A 3REHB 1E88A 4DKIA 4Y15A 4UQIS 1H8ZA 1F5MA 1P3KB 5E2FA 5AVBC 2H0YA 3A3IA 3CZDA 4J8WC 4HQAA 4UQIM 3HVFA 5C5KA 1OTBA 3MGRC 4LENA 3AGEA 3LZ0C 5I5LA 3NY4A 4OUIA 3T4TA 1M1AC 4S2IA 3LY4A 1M40A 3X1UC 4QLCA 4J8VB 1MWSA 4NXBA 2Y2OA 3LZ1C 1E3UA 1XFNA 4GCZA 4EW7A 3W98C 1P3LC 3PAGA 4Z5TB 1IELA 3FPVA 5KSCA 5A90A 3MGQB 3W96A 3K3CA 2J3TC 4H9OB 3AZGC 5EPHA 3WS1A 2B18A 5MC7A 4JXWA 4XUJA 1KE0A 3C7UA 3OPLA 1K57C 3KSYA 5B33B 1KX5D 3KWQD 2WYXA 3JVVA 3KSGA 4MNRA 4MBFA 1P3FC 4K0XA 1NRFA 2GNXA 4EQ1A 4Y13A 1SKOA 4H9QA 2NZDA 5BNXA 2IWBA 4JJNA 3UTAC 1G68A 2EXBA 1PZOA 2Z6CA 2PR5A 4H6JA 4ZTKA 4UHUA 2O9BA 3ZQ5A 3UDXA 3ZVTA 1B6WA 5DKLA 5B2IB 5K5BA 3NC8A 1KX4D 3ITAA 1JVJA 4EUVA 3AFAD 4IVKA 4R0QA 4IJFA 2W8SA 4J8WA 1MWRA 4KG2A 2CMNA 2F2AC 4OPQA 2YFWA 1GA9A 1W79A 2PYPA 4HGAB 3ICYA 3LICA 3QP2A 3IT9A 4GHAA 4S2MA 3R7WA 3LEQA 3LZ1A 4DMZA 2RTSA 4YM6B 3BM6A 2ZQ7A 1F66B 2FFFB 4IBDA 2XF3A 3F1NB 1ED7A 3EGDC 1P34A 4WZ5A 3AZGA 3DBAA 4X69A 3H0RC 2FJ7C 3K2NA 4B4ZA 1KX4C 3V67A 2OSUA 3G32A 4KZ4A 5HDDA 3AFAC 5CHJA 1JWVA 4MB3A 4WLAA 3KS4A 5GLBA 3OPHA 4JGOA 2RVQD 4PKYG 2V9AA 4PPRA 1O6IA 3KS8A 4H9SA 1M18A 2F8NK 2VKSA 1KVLA 4WJ3C 5B1MB 3VH6W 1G6OA 2ZL1B 1A0KA 2Y4AA 3QP5A 3ZVWA 3DTMA 3OC2A 5HD5A 3X1TC 4JF6A 2R9WA 3VOZA 3ZG0A 3AZJB 2PU4A 1RP5A 1KX5A 2DF4C 5AV6C 3KWQA 3M2KA 3MXRA 3N8RA 4KENB 3AZEC 1LLBA 2RVQC 4PM7A 4X1MA 3LIAA 3IF6A 3DW0A 4XUXA 3S22A 3WKJB 4DN0A 3GRJA 5FQKA 3VFHA 4NYUA 4EWFA 5FQ9A 3HSHA 4LD9D 4X23D 2ZQCA 4ZJ1A 3UTBC 4IUHA 3LCEA 2QJ5A 3AYWD 1XXMA 1LL5A 3TG9A 4I39A 3W8KA 3CG5A 4FH2A 1GHPA 2RIQA 3GSGA 3W96B 1KX4A 5KSHA 1GHIA 5FQQA 1FILA 3AFAA 3D4FA 4II7A 4O8GA 4OP5A 3SH9A 1MC0A 3E98A 2ZM2A 5JRGD 4OLDA 5GT3D 1K54C 1S6RA 3LYXA 1JWZA 2ZY3A 1XA7A 5HWTA 4LCLA 3VFFA 1D06A 3LELC 5AV8D 4KZBA 3N7WA 4EO5C 2ZC4B 3Q7VB 1CXWA 4LD9C 2G2WA 4H9QB 3AZHD 2LY8A 4MDZA 4E3MA 1F98A 4HJ6A 3AYWC 3VMAA 3JYIA 3PBSA 4H6JB 4PHTA 2XA7S 5CTNA 2BYMA 4B9OA 3AZNB 4MB5A 3EPKA 2XA7M 2F8NB 2XQZA 4H9PB 3WS5A 1STZA 5CPJD 5GT3C 3O62D 4S2JA 1FSYA 1EWZA 1GSXA 5DKKA 4BD1A 1ULYA 3B6GD 1Z6FA 1YM1A 5AV8C 2ZQDA 3IF5A 4ID4A 4WF0A 4IHQA 2HIOB 1T19A 2AVXA 4B93A 4WBGA 3AZHC 3R7WB 3RXXA 1LI9A 3SZTA 4R8PB 3SOIA 3MVDC 2W3FA 1GPFA 4OOYA 5B2JB 1P34B 3AZIC 3LY3A 3KYQA 4L9GA 4WYYA 4ARZA 2YFVA 1P3PD 1JTGA 3B0BA 2Y2GA 1IKGA 1PI4A 1WYBA 2OOLA 2NUTC 5E5AA 5EVLA 5KDMA 1UGUA 5CPJC 2HUEB 3Q1FA 1VETA 3S4XA 3UDFA 2B95A 3TRCA 2QZ6A 1S32D 4JF4A 3IH9A 3QP8A 4DXBA 1HVBA 3MQQA 4WU9D 1MKIA 1M18B 2JKFA 2PU2A 4ETZA 4HH2A 4R3AA 4O0PA 2ZC5B 4Y7PA 3JPUA 4X23A 4OONA 1KX3C 3EQVA 3MFDA 1E6NA 1BZAA 3VSKA 1BFMA 4I3JA 3QP4A 2CWEA 1I5QA 4KZ5A 2G5IC 1P3PC 4E45A 2OWJA 2ZMAA 3R45A 5B24D 3PYPA 1KX5B 2AROD 1J9MA 5JRGA 3IWOA 5GT3A 4S2NA 1P3BC 3ZNYA 1CK7A 4E6WA 3KSHA 3WAAD 3C5AA 4DJ3A 4R1GA 4LFUA 3T4LA 4R70A 1YPRA 3REHD 3WS2A 4NY2A 1PZRA 1P3KD 4FH4A 1NXYA 3AZHA 5FUGA 4DE2A 3BY8A 4O7DA 1E6ZA 2K31A 4J8XB 2Y2PA 1G6AA 2C5WB 2Y79A 3ZG8B 1AXBA 4QNLA 5CXWA 1WWSA 2HJEA 2Y2IA 4J8VD 4OPRA 2AROC 1U35B 3O62A 1P3AB 2WAEA 3CPTA 3DWZA 2PR6A 4M3KA 4QB8A 3MGQD 5GXQB 3B6GA 3WAAC 2A3UA 5FA7A 2FFYA 2L0WA 4ZRRA 1YLPA 3REHC 5J8XA 3L28A 4F3LA 1N9OA 3CLOA 1W1VA 5B33D 1P3KC 2D01A 1EAKA 3Q82A 4KUOA 5IHVA 4IBBA 4CJNA 5EVIB 1ESIA 1XJ3A 5B40B 1K56D 4BLMA 3TJZC 3N8LA 4DRAA 1IFQA 1TDLA 1IYQA 3KX0X 1P3PA 4C3QA 1SCWA 1O7EA 1P3GB 2CV5C 3M2JA 5EECA 4DE3A 3H9WA 4Z5TC 1ID3A 1S32A 5AJGA 3EEAA 3MGQC 5AQAA 1S4RA 3AV1C 4WU9A 5HD3A 3E4OA 5B2ID 3FPWA 1E25A 4NKPA 5IT5A 1XJ4A 5AQBA 1YLZA 5B33C 1J7MA 4Z2HA 4KZAA 1W2EA 1VQQA 3BJNA 3MJQA 5J3WA 3ZNTA 3E2LA 1JFIB 2ZLYA 5FSRA 2W3GA 3JVUA 2G7UA 4NEED 4X25A 2G5HC 1P3OB 1OT9A 3EOIA 5B24A 1KU5A 3IX8A 4KUDC 2OV5A 5E5AB 3EGXC 1F66D 4WV4B 4XZQC 4UUZA 4NZ1A 1LSVA 3SS5A 3LEZA 3MXSA 3FC7A 4AWLB 5B2IC 5A92A 4P87A 1CF0A 1P3KA 1GSVA 5DNNC 1MWTA 2D02A 4X23B 4KZ8A 4XUZA 2GX5A 1T3UA 2HZ5A 5M1AA 3UDIA 2W3HA 5GLCA 5TBMA 1H8YA 5B1MD 4J8VA 5FI7A 2HP6A 4NYYA 3KO6A 3RTYA 4LRYC 3N6IA 4YM6C 4OQ0A 3T4KA 3R45B 5CEBA 3HJIA 1F66C 3PAEA 4D60A 3H0LC 1P0ZA 3MGQA 3LI8A 4HY8A 2UWXA 5CPIA 5DNMC 2YKFA 2JCHA 1W8YA 1X0OA 4YINA 1VHMA 1AOIC 3AZJD 1ERMA 1K0KA 2X02A 4GJ4A 5B33A 4RX2A 1LL9A 3T4SA 5FUGB 2D49A 3VH5W 5B31G 3LJAB 1K56A 5FI6A 1WWIA 3WS4A 3C4PA 4Q0JA 3AN2B 1YU0A 3WKJD 4GOGA 5BT1D 1KGGA 5F68A 2Y2HA 4IBCA 3BLMA 5B1MC 2VZWA 3VOLA 1ESUA 2ZM5A 5F5YA 4HMCA 3VH5A 4IJEA 4RQ9A 4MEZA 3O62B 5DJUA 1E8BA 3B3XA 1NLYA 3NULA 1ZKJA 3AL0C 4G91B 5FQMA 5B2IA 5CHUA 1ZLAB 3P98A 4OOMA 1NZOA 5F6AA 3U4LP 2W3EA 2Q9NA 1G5UA 3LIDA 1UWPX 5JA4A 4S2OA 3WKJC 5BT1C 1M19B 1NZUA 1ODVA 3GQZA 3BQ8A 4S2KA 1PWDA 2EX6A 5F99B 3B0CT 4YFMA 4N9LA 4CAYA 1OGGA 4GKUA 1FOFA 1N4OA 4I3AA 2P9VA 1F66A 5HFOA 4J8UD 1ID3B 1S32B 5JYOA 3W96C 2WK0A 3AZND 3G6OA 1H0MA 3A3DA 1H0GA 2F8ND 4RYEA 4NZ3A 2NUPC 3UMEA 1BTLA 1EQZD 3O88A 3ITBA 5E43A 3FKEA 5TFQA 3IP4C 4GH9A 3ZHHA 5E2GA 3LR3A 2H10A 5B1MA 1VM1A 2V20A 2ZOIA 2HIOD 2ZM8A 4DDSA 2E8IA 2ZL1A 4EERA 4IBEA 5HARA 5JYPA 5M19A 3X1SB 2DRWA 1ES5A 1TS0A 2W27A 4R8PD 4LRZE 1BH8B 5B2JD 5F1FA 5L07A 1P34D 2BG1A 3AZNC 3FYZA 3AZJA 4R3JA 2MJ6A 2LB5A 4GN2A 3TOIA 4Q0IA 5AV5B 1F1EA 5EOEA 3UO9A 3A3FA 2PYOD 3O86A 3V3SA 1MKMA 5GHZA 3W97A 2E8JA 4HH3A 5F69A 2DCFA 3CHWP 3WKJA 1OTEA 3FWLA 1UR9A 1M18D 5TBMB 1ZC2A 5DJTA 3T4QA 2HIOC 4R38A 2V2FF 3NIAA 1D7EA 1OTIA 3SH8A 3T1RA 2EWWA 5B31A 3REIB 4GHIB 1NJ4A 5DTKA 3AV2B 1NYYA 5B2JC 1S4SA 3V9RA 1P34C 4WZ5C 4G92B 3T1XA 1MWUA 5CPIB 4HOIA 2J80A 5DFXA 4E3KA 2XEPA 1TD5A 3AGDA 5BS7A 5BO0B 1TS7A 3D9YA 3WTPA 2DNSA 4H9SC 1M18C 4FUWA 3W2ZA 3Q7VA 3HLEA 4DDYA 2HDRA 4PM8A 4J8XD 4J8UA 3HLBA 3MQ0A 4HBTA 4DXCA 1YU1A 3HLGA 2WGWB 4LV2A 3VP1A 3AZNA 1P3MB 2F8NA 3T12B 3HLCA 1KX5C 4H9PA 1U35D 4MB4A 1EQZA 3KWQC 2VV6A 1W8QA 1P3AD 1SKFA 3UB6A 5J7EA 1UR8A 2A24B 3IF6C 3VSLA 5GXQD 4DE1A 5JA4B 2V0UA 2HIOA 3W4OA 1R4VA 2Q0OA 1F2KA 1H3QA 2X71A 3SW1A 3OPPA 4CAYB 5EVID 1I2WA 4OOLA 4Y0TA 5B40D 4R8PA 3UE3A 3WD1A 2L1MA 2P9VB 5B2JA 1GOIA 4R4RA 3L29A 1DP9A 4K0WA 5C3IC 3CI6A 1KE4A 4B88A 4DQYB 3KXBB 1P3GD 1U35C 3HUMA 4YWZA 3MBZA 4GDNA 2PYOA 1P3AC 3WRTA 1H5XA 1BULA 3P7NA 2GZAA 1IYSA 4NXEA 5AY8B 3TSGA 3BFCA 2KX6A 1BLPA 2WGIA 3TU4A 2WZXA 4FCFA 5B40C 2EA9A 2HP5A 1P9RA 3KUYB 2PT7A 2B5RA 4L9FA 4YNRA 1YSQA 3F1OA 2J7VA 4P85A 3N3FA 4X55A 3IBRA 1P3OD 3FG8A 4U0TA 1P3GC 5E5AD 3WX7A 3IXHA 3ULFA 4CQHA 4YOFA 4XXRA 3LUQA 3W97B 1GHMA 3AZMB 3VE4A 1MPLA 2WAFA 4KZ3A 1YU3A 4OPYA 3SH7A 1L0FA 1M6KA 2HP9A 3MGPB 4EBPA 3SS3A 4GHLA 4HIAA 1YLJA 4HESA 2XD5A 4BQMA 2HPBA 3MKEA 4J8XA 4LCMA 5B31B 4HJ4A 3P5JB 1DJAA 5D3OA 3V9RB 4RX3A 2WKIA 3K3DA 4OJ5A 2NQBD 3P01A 4UA9A 2V8CA 3MMHA 1P3OC 3L7HA 3QP1A 5GSUB 1U35A 2QYBA 3GDIA 4MN7A 5E5AC 2JBFA 1P3AA 3T50A 1OJGA 2X01A 4ZUXB 2JKRM 5GXQA 4PM9A 5FQJA 3GVBA 3HONA 5FL3A 2JKGA 5B0ZB 4AWLC 3ZDJA 1FCMA 2EWVA 3NDEA 5CPKB 4E3IA 3WTPB 3AZKB 4R6LA 2VLGA 4KZ6A 3C1BB 1EROA 4X23C 5EVIA 5B40A 5CECA 3LJAD 2JN7A 3H7WB 3REKB 1A7WA 4U3TA 1E6RA 5DVAA 4Z2IA 4J8UB 5J4EA 4OVDA 5F1GA 4M6BA 3AN2D 4OJ6A 1XPBA 4WEKA 4NE5A 2JC7A 1TZYB 4E04A 4PMAA 3TE8A 1P3GA 2EFUA 3ZG7B 3UE0A 3F6TA 5JRGC 4OLGA 1EQZB 4HBUA 4EETB 1TEMA 4S2NC 1K4FA 3D72A 5CGWA 2M7VA 1LSWA 1P9WA 3WS0A 3MF0A 3A1KA 1ZLAD 3AZLB 1E6PA 4DRTA 2EX9A 1PIOA 3LJAC 4NXFA 5EM0A 1JFIA 1YU2A 1Y54A 3OCLA 4PKYA 4GZBA 3AN2C 1JNUA 3BW6A 1F9IA 4N1XA 4CLCE 1XX2A 1M19D 1OPXA 4F94A 2J8YA 5F99D 1KDSA 1L0EA 5L8MA 2Y2NA 4KG6A 1P3OA 3LZ0B 3B6FB 3VH6T 1SDNA 3AZFB 3GR2A 1M1AB 4QD4A 3O62C 1Z2CB 2PYOB 3WD0A 2FZ0A 3NJAA 1NRJA 1ID3D 3MZDA 4K08A 4H9RA 3B6GC 4I5SA 2B02A 3IHAA 3NCKA 1TF1A 4NK3A 5G4ZA 4E44A 1ZLAC 5HAIA 5FASA 2XRNA 1W63M 1PWGA 1H3OA 4OJLA 1V9YA 3TU4B 3NOPC 3UB5P 3MZEA 3KFUG 1ZG6A 4GS9B 4BBTA 3DTEA 3HJKA 5GLDA 2NQBA 3F1OB 3RH8B 4DJ2A 4KUKA 2ZC3B 4Y0OA 3X1SD 1Q2QA 5HAQA 1N9LA 5B1LB 2W1RA 2K2NA 2VJWA 5HW3A 1LT0A 1ID3C 1S32C 4WU9C 4N92A 4M4XA 5AV5D 4LV0A 2ZY4A 4ZBJB 1GCEA 2HDQA 3HLWA 3LJAA 4XT2B 1HZOA 2VX8A 5AV9D 3AN2A 3OOVA 3OPRA 3E4QA 4BL2A 4TX8A 2ZBBA 2ZC7A 2OLVA 3X1SC 5B24C 3TW8A 5B0YB 1JTDA 2P08A 3UPPA 5HDSA 3BFFA 3REID 5L10A 1I2SA 1S66L 1XGJA 3AV2D 2BTFP 5BNVB 3UB7A 3G35A 2J9PA 4Z1WA 3KSFA 2ZMVA 3C7VA 3GV9A 5CPID 1S67L 1ZLAA 3L26A 4QHCA 5AV5C 1EI5A 3IBJA 2KDKA 2FJ7B 4KGCB 4GB7A 5FEFA 5A91A 1PYYA 3VE3A 3VP0A 5A93A 1M19A 4N9KA 4N1HA 3QP6A 5F99A 4WM9A 1P3IB 4OJPA 4J8VC 1S1YA 3BLSA 5HWWA 3SS4A 1T1AA 3IX3A 3UE6A 3HBRA 3REIC 3HLFA 1FQGA 3W4QA 1ACFA 1DRMA 4WNNA 3WWXA 1Q9CA 4LGWA 1PNEA 5CPIC 3UT9B 1P3MD 4U0XA 1E15A 5E2EA 5HL6A 3X1VA 4IBFA 2VGLS 3FKWA 5U47A 1OT6A 1LSXA 2EFXA 1QMEA 5HPIA 2VGLM 3Q07A 1BH9B 3BWLA 1RGZA 3A3EA 5KZHA 1ONHA 3X1SA 3LR4A 2O99A 1H8PA 1BH8A 1WA9A 3S1YA 5B32G 4WUJA 3UTBB 2V1ZA 1HTZA 2QJ7A 4H9RB 3EPHA 5HPFA 1DP8A 5AV5A 3E0YA 1K6RA 3C30A 2ZQ9A 4NG2A 2R9XA 3KXBD 3MQOA 4JKTA 1K55A 1H3OB 5CX7A 2Q9MA 5CGXA 1PI5A 2Y59A 4I38A 1HTAA 5AV9A 2V8FA 4BENA 4HP4A 4HGAC 5AY8D 4BWIA 2NQBB 5DTTA 2XDMA 5G49B 3LELB 4CSRB 2PBYA 1BT5A 2M7UA 3REIA 2RL3A 3B33A 4GHIA 2DQNC 3AV2A 3KUYD 1VEUB 3WA9D 3MXQA 4UA6A 5A8BA 2BYKB 5HDCA 5HX9A 1NYMA 4RA7A 4OQGA 2WKQA 1YLWA 5EV0A 4CPKA 5BO0A 2XFSA 1U60A 1O07A 4UA7A 5EVEA 5AQ7A 5GL9A 3L25A 4X53A 4E3OA 1HQ3A 2JKRI 1LI0A 4P0MA 5CEDA 2C6WB 3W97D 3C1CA 3LR0A 4PM5A 3AZMD 5FDHA 1L0GA 3IWQA 5AY8C 1MXOA 3MGPD 4H9NB 3L9KA 4WZ4A 1C3BA 2XSSA 4Z66B 5B31D 3GECA 4EUZA 5L2FA 1YU4A 2WGWA 3MNNA 3MVDB 1P3MA 2XH9A 3O87A 3AZJC 3NDGA 4R3BA 3LFVA 5GSUD 1KS0A 2VA0A 3LI9A 1TAFB 1ES4A 1TVFA 4WU8A 4ZUXD 2A24A 3UB8A 3W97C 1AIWA 5B0ZD 1K25A 1IKIA 5CPKD 3WTPD 3HREA 4LLOB 2EX2A 1D1JA 3PBRA 3AZKD 4QJGA 4YS3A 1OMEA 3C1BD 4NE6A 3WD4A 4BBUA 5B31C 3REKD 4MLLA 3B0DB 2Z6DA 4K91A 4AFIA 3UNWA 3MQLA 4Z2MH 2O0YA 4WNNB 2J9OA 4D2OA 4P6ZS 1TZYD 5FAOA 3REJB 3KXBA 5GSUC 3X1VB 4P6ZM 5BS7C 2PD7A 4CLCA 3A6NB 4ZUXC 3V50A 1T18A 4HMDA 1TDGA 5CHMA 3CUEA 5FEGA 1K4EA 1YQSA 5CPKC 3WTPC 3O3VA 5AY8A 1P3BB 2HF6A 4IVIA 3AZLD 2KOIA 1PW8A 4Z9QA 3MGSB 3C1BC 2XGNA 1SZVA 3RXWA 2JE5A 4ZBEA 1V9ZA 3UPNA 4KHAB 3KUYA 1MY8A 3WA9A 4J8UC 4JGRA 1XJ2A 3G4PA 3IXDA 1KVMA 2GDNA 3MGRD 1TZYC 4OP8A 3LZ0D 3B6FD 1L2SA 3AZFD 4HNBA 1CI9A 1M1AD 1ES2A 4NE3A 3X1UD 1EQZC 1W1YA 3C8CA 4BL3A 3DAVA 2IWCA 4WN5A 5AV9B 1YT4A 3AZMA 4S2LA 1P3LD 4JXVA 4KQRA 1BLHA 3AZLC 1T1BA 1FR1A 3MGPA 4JXSA 2XFTA 4KQOA 3OZHA 3FV7A 4Z2JA 1YLYA 3TU4D 1CEFA 2JSSA 1H0IA 4R8PC 5BPVA 3EWKA 1EW0A 2FH5A 3BFDA 4MCWA 4QPRA 3VH5T 3G30A 5GT0A 1KDWA 4H8RA 5CTMA 1P3FD 3B6FC 1MBLA 4X56A 5GSUA 3AZFC 2V0WA 3WD3A 5B1LD 2HUEC 3ZG9B 4ZUXA 2PYOC 3EQUA 3ZG5A 5AVFA 1HQ3B 2CV5B 1YMSA 2IO5B 5B0ZA 3NECA 3UTAD 2WZZA 3P09A 3C1CB 5CPKA 4IBRA 3S7PA 4EEUA 4G3WA 3AZKA 3WRZA 3W99A 5HZHA 3AV1B 1L6JA 1BUEA 1XKZA 3C1BA 3IS2A 1GSWA 2INWA 3F1PA 3TU4C 5L09A 3H7WA 1XJ6A 3REKA 4E6XA 3V39A 1DP6A 1S1ZA 3C38A 1GXDA 4DRBA 4R23A 4GW9A 2VQRA 1TZYA 3MNNB 1CK3A 4MBHA 4L9EA 1IEMA 4X1LA 5B0YD 1WE4A 3A0VA 1MZUA 2V5OA 5B1LC 3CITA 3H82B 4I3IA 4WU8B 2ZQAA 4KUDB 3MSHA 2Z2LB 5HL1A 4XZQB 3N4IA 3AZLA 3NQJB 5AVCA 2Y91A 1N1JA 2FJ7D 4YS3B 4KGCD 4ZBJC 1ES3A 2HJ9C 4BBVA 1J3WA 3A1IA 1YSPA 4Y5FA 4J8XC 1XFQA 5DNNB 5AVBA 4Q8IA 2W1TB 3MGRA 4Z2LA 3B42A 3I7JA 1P3ID 1XP4A 3NQUB 3LZ0A 3B6FA 4HMEA 1XA1A 3EPJA 3AZFA 1YKDA 1M1AA 2J3WA 5B0YC 2W0NA 3X1UA 4GD6A 4KZ7A 3ZFZA 4CLCB 3FKVA 2P04A 1CEGA 3RELB 5GXQC 5B32B 3W98A 1SDEA 1P3LA 3CWFA 2VK3A 3UT9D 2OLUA 2JKTM 5EE8A 2XK1A 5CP6B 2IOUA 2ZQ8A 3V5MA 5DNMB 3X1TD 2OAQ1 3PTEA 4KGCC 3UY6A 1T1CA 4OKPA 3OBFA 1AOIB 2VV7A 5EVIC 1K57A 3QNCA 1W1PA 4OQHA 4RVAA 5AV6D 5GLAA 2ZY2A 3MFXA 4GS9A 1N9BA 3BYDA 4GD8A 3WA9B 1DJBA 5HWVA 3AZED 3KYZA 3RJUA 3G31A 5CHLB 4Z2GA 1ZHHB 3PBQA 1P3FA 1BYWA 1P3IC 3IQAA 3FZCA 2L4RA 1NWZA 4IBGA 5B1LA 4ZJ3A 3IX4A 2BASA 1HLUP 4G3KA 2Y2MA 3UTAA 1ALQA 3UTBD 1PWCA 3GMWA 4IJGA 3H0MC 3UT9C 4ZDXA 4LV1A 2H5SA 3N8SA 5FAPA 4E3NA 1ONGA 3VH6A 5AVEA 4JF5A 3GTCA 3MKFA 4XT2A 3KYEA 4NETA 3FDDA 5TGFA 2FN2A 1DJCA 1PZPA 1PW1A 1W1TA 4PAUA 2Y2JA 5GT0B 2EXAA 3LR5A 2L5AA 3A3JA 5LBRA 2Y2KA 5M18A 1IYPA 4NZ4A 1PFLA 2Y2LA 4UPKA 3LELD 2QKPA 5EM1A 5B0YA 4IUKA 3V3RA 3CMZA 4GLQA 4EV4A 4QLCB 3UMDA 5GHYA 4B4XA 5BNVA 3IWIA 3A0RA 3T4JA 2O9CA 5G18A 2K7SA 1CI8A 3S7NA 3UPOA 4FSFA 1BSGA 4MN5A 3W99B 3UB9A 2FJ7A 4KGCA 3IS2B 2ZMFA 4XUJB 3F1PB 4Q0HA 1K38A 5AQ9A 1P97A 3LGOA 5HSQA 2J8PA 1P3IA 2NQBC 1AWIA 5CERA 4Z2MG 4DF6A 4QU3A 2YKHA 4HHDA 3LIFA 4Z66D 2HDSA 2UV0E 1SKOB 1CJFA 2RCXA 2NZDB 5BNXB 4LPZA 4JJNB 3UT9A 3NI9A 3MVDD 4MMNA 5I94A 4WMCD 3X1TA 5AVCB 3AZID 1N1JB 4LG2A 5EFWA 3NHQA 1JWPA 4OH0A 1KGFA 4EBLA 3BY9A 2A2LA 3HCYA 3PR6A 5F83A 5AV6A 3QHYA 1BH9A 2PAVP 1TS8A 1W7FA 2PRFA 5AVBB 3AZEA 3HL9A 4J8WB 1SHVA 1ZTUA 3MGRB 2YFWB 4JGPA 4P6BA 1FIKA 3T4OA 4Z66C 1UWNX 3X1UB 3G2YA 2VGKA 5CRFA 3W4PA 5IU1A 3LZ1B 3UTBA 4G91C 2WADA 3W98B 1P3LB 1KX3D 2QMIA 3EPLA 1BLCA 4L0LA 1L3LA 3REJD 3BECA 2WKHA 2F8NH 4LV3A 3AZGB 3X1VD 3NBLA 1E4DA 1YLTA 5TJJA 3A6ND 1QMFA 4NXGA 3T1QB 4JBFA 2WGVA 1NY0A 1K54A 1DY6A 2OAP1 1M19C 5BOHA 1OTAA 1P3BD 3IXGA 1KGEA 5F99C 1P3FB 5DF9A 1K6SA 5G49A 3MGSD 3LELA 4CSRA 2HV1A 4EEPA 3B0DC 3B47A 4LD9A 1VEUA 3IXBA 2BYKA 5TR7A 4EBNA 1Q2PA 4KG5A 4Y3IA 2I9VA 3AYWA 3UTAB 1TS6A 4ZJ2A 3REJC 1Y28A 1QO6A 2CC1A 4OQIA 2OWHA 2IWDA 3X1VC 4JXGA 4OJOA 3A6NC 4QY5A 2XROA 2PBDP 2QPNA 3PBOA 3KWQB 5FATA 3C2WA 3S7OA 5FAQA 4KQQA 3BQAA 1N9NA 3IF6B 3HUNA 4WEJA 3MGSC 3BFEA 5AV8A 4H9NA 3NOUC 2LB9A 4Z66A 4Z2KA 3OCNA 2WKPA 4IBIA 4PM6A 3M6HA 4KQDA 3Q7ZA 2W3DA 5KMWA 3MVDA 4BD0A 4LRXC 3BFGA 4WMCA 4E3LA 3AZIA 1TAFA 2A49A 1K55C 1KX4B 5F82A 5C3IB 3WTPE 3AFAB 3M7PA 1HQ3D 3VOYA 2CV5D 4FD8A 5FI2A 3S7QA 5AV9C 5CPJA 4Y0UA 4Z5TD 3C1CD 2BLSA 1GA0A 4JLFA 2P74A 3AV1D 4HJ3A 4S2PA 1RGYA 1WYCA 3KSIA 4Y17A 4UAAA 4FTXA 3AV2C 2WUQA 1ERQA 4G92C 1KX3A 3MNND 3REJA 1OTDA 3ZGAB 2ZC6B 4C75A 1YMXA 5EUAA 3DTIA 2BYMB 3X1TB 4C6YA 4NFTA 3A6NA 4EXOA 2EX8A 4UEYA 1HQ3C 4WU8D 3LIBA 5IS1A 5AV6B 4KUDD 4WZSB 2IO5C 2H28A 3C1CC 4BMWA 2JKTI 3AZEB 3AGFA 5GHXA 4XZQD 1P3BA 2VV8A 2ZOHA 2QWSA 3MGSA 1FCNA 1BLSA 4OPZA 3B0CW 4YS3D 4ME4A 2KLIA 4R4SA 5DFYA 4EQIA 4GNUA 4KHAA 5DNND 2ZM0A 5G4YA 4WELA 5CGSA 3MNNC 1P3MC 3QNBA 2I72A 4ESPA 4Y2FA 4ARZB 4CLCD 3OLOA 2YFVB 4WU8C 1LL8A 3U2AA 3RELD 2AROA 4YM6D 4MN6A 5B32D 3O5YA 5KDMB 5DF7A 3NOTC 4DE0A 1VETB 2WKRA 5CP6D 4HEFA 3PBTA 3WAAA 5DNMD 4G3VA 4YS3C 3REHA 4IBJA 3LO7A 1AOID 2ACGA 2PHYA 4EO5B 1KE3A 1NLZA 3G34A 2IA2A 2Y2QA 4LD9B 2Y8HA 3C4OA 3AYWB 4KZ9A 4X68A 2Y55A 1CQAA 5KIZA 1ZG4A 3KXBC 4IBXA 3VP3A 5HAPA 2V1BA 4FOFA 3UN7A 4IBKA 4CLCC 4A5RA 1Z09A 1OGBA 3RELC 2CV5A 4HP9A 3EEHA 5B32C 5JRGB 4Z5TA 3CUEC 1Y4OA 5GT3B 2XLNA 1PRQA 4JGQA
chains in the Genus database with same CATH topology
5CP6C 2G2UA 4H9OA 3AV1A 5FQIA 1W5DA 5AV8B 3L27A 2H0TA 3HLDA 1RCJA 3L2AA 1FCOA 3CJMA 3KUYC 1IYOA 3WA9C 3AZHB 3ISGA 4QY6A 5GT0D 1S0WA 2ZJ9A 3AZIB 4E3JA 4QLCD 1FR6A 5E2HA 2VGJA 4KUDA 1YUEA 1E3UD 3PBNA 3ZCZA 3IHBA 5CPJB 3AZMC 4XZQA 3NQJA 3MGPC 3W96D 3B6GB 3W99D 3IH8A 4GDBA 1B67A 1L0DA 1HD8A 4XUJD 5DNNA 5GT0C 1KX3B 3NQUA 1FSWA 5DTSA 2Z2MB 4JPMA 4QLCC 4MBKA 1P3PB 2F8NG 3G2ZA 3RELA 4YM6A 2NZDD 5B32A 2ZY5A 5EOOA 5B0ZC 4JJND 4ZAMA 3BEBA 5CP6A 3AZKC 5DNMA 3W99C 5AVCD 4WU9B 1AOIA 3MZFA 4XUJC 3E2KA 4IEDA 3REKC 3HUOA 5AVBD 2HDUA 3EG5B 4J8WD 1XGIA 3BRMA 4BJPA 2XR0A 2ZD8A 3UE1A 2XD1A 2WKEA 3DWKA 3M6BA 4X6TA 5B24B 3LZ1D 2NZDC 2AROB 3VP4A 4JJNC 3VP2A 3W98D 1LHYA 4UUZB 5AVCC 3WAAB 3AZGD 4NZ5A 3Q81A 5DF8A 3REHB 4DKIA 1H8ZA 1P3KB 5E2FA 5AVBC 2H0YA 3A3IA 3CZDA 4J8WC 3HVFA 3MGRC 4LENA 3AGEA 3LZ0C 3NY4A 4OUIA 1M1AC 4S2IA 3LY4A 1M40A 3X1UC 4QLCA 4J8VB 1MWSA 2Y2OA 3LZ1C 1E3UA 3W98C 1P3LC 3PAGA 4Z5TB 1IELA 5KSCA 5A90A 3MGQB 3W96A 4H9OB 3AZGC 5EPHA 3WS1A 4JXWA 4XUJA 1KE0A 3C7UA 3OPLA 1K57C 3KSYA 5B33B 1KX5D 3KWQD 2WYXA 4MNRA 4MBFA 1P3FC 4K0XA 1NRFA 4H9QA 2NZDA 5BNXA 2IWBA 4JJNA 3UTAC 1G68A 2EXBA 1PZOA 4ZTKA 4UHUA 3UDXA 3ZVTA 1B6WA 5B2IB 3NC8A 1KX4D 3ITAA 1JVJA 3AFAD 4IVKA 4R0QA 4IJFA 2W8SA 4J8WA 1MWRA 4KG2A 2F2AC 4OPQA 2YFWA 1GA9A 1W79A 4HGAB 3IT9A 4GHAA 4S2MA 3LZ1A 4YM6B 3BM6A 2ZQ7A 1F66B 2FFFB 4IBDA 2XF3A 1P34A 4WZ5A 3AZGA 4X69A 3H0RC 2FJ7C 4B4ZA 1KX4C 2OSUA 3G32A 4KZ4A 3AFAC 5CHJA 1JWVA 3KS4A 5GLBA 3OPHA 2RVQD 4PPRA 3KS8A 4H9SA 1M18A 2F8NK 1KVLA 4WJ3C 5B1MB 3VH6W 2Y4AA 3ZVWA 3DTMA 3OC2A 3X1TC 4JF6A 2R9WA 3VOZA 3ZG0A 3AZJB 2PU4A 1RP5A 1KX5A 2DF4C 5AV6C 3KWQA 3M2KA 3MXRA 3N8RA 4KENB 3AZEC 1LLBA 2RVQC 4PM7A 3IF6A 3DW0A 4XUXA 3S22A 3WKJB 3GRJA 5FQKA 3VFHA 4NYUA 4EWFA 5FQ9A 3HSHA 4LD9D 4X23D 2ZQCA 4ZJ1A 3UTBC 3LCEA 3AYWD 1XXMA 1LL5A 3TG9A 3W8KA 3CG5A 4FH2A 1GHPA 2RIQA 3GSGA 3W96B 1KX4A 5KSHA 1GHIA 5FQQA 3AFAA 3D4FA 4OP5A 3SH9A 2ZM2A 5JRGD 4OLDA 5GT3D 1K54C 1S6RA 1JWZA 2ZY3A 1XA7A 4LCLA 3VFFA 3LELC 5AV8D 4KZBA 3N7WA 4EO5C 2ZC4B 3Q7VB 4LD9C 2G2WA 4H9QB 3AZHD 2LY8A 4E3MA 3AYWC 3VMAA 3JYIA 3PBSA 5CTNA 2BYMA 3AZNB 3EPKA 2F8NB 2XQZA 4H9PB 3WS5A 5CPJD 5GT3C 3O62D 4S2JA 1FSYA 1EWZA 4BD1A 1ULYA 3B6GD 1Z6FA 2ZQDA 5AV8C 1YM1A 3IF5A 4ID4A 2HIOB 4WBGA 3AZHC 3RXXA 1LI9A 4R8PB 3SOIA 3MVDC 4OOYA 5B2JB 1P34B 3AZIC 3LY3A 4WYYA 2YFVA 1P3PD 1JTGA 3B0BA 2Y2GA 1IKGA 1PI4A 1WYBA 5E5AA 5EVLA 5KDMA 5CPJC 2HUEB 3Q1FA 3S4XA 3UDFA 2QZ6A 1S32D 4JF4A 3IH9A 4DXBA 1HVBA 4WU9D 1MKIA 1M18B 2PU2A 2ZC5B 4Y7PA 4X23A 4OONA 1KX3C 3EQVA 3MFDA 1BZAA 3VSKA 1BFMA 2CWEA 1I5QA 4KZ5A 2G5IC 1P3PC 4E45A 2ZMAA 3R45A 5B24D 1KX5B 2AROD 1J9MA 5JRGA 3IWOA 5GT3A 4S2NA 1P3BC 3ZNYA 4E6WA 3WAAD 3C5AA 4R1GA 3REHD 3WS2A 4NY2A 1PZRA 1P3KD 4FH4A 1NXYA 3AZHA 5FUGA 4DE2A 4O7DA 4J8XB 2Y2PA 1G6AA 2C5WB 3ZG8B 1AXBA 4QNLA 5CXWA 1WWSA 2Y2IA 4J8VD 4OPRA 2AROC 1U35B 3O62A 1P3AB 2WAEA 3DWZA 4M3KA 4QB8A 3MGQD 5GXQB 3B6GA 3WAAC 2A3UA 5FA7A 2FFYA 1YLPA 3REHC 5J8XA 3L28A 5B33D 1P3KC 3Q82A 5IHVA 4IBBA 4CJNA 5EVIB 1ESIA 5B40B 1K56D 4BLMA 3N8LA 4DRAA 1TDLA 1IYQA 1P3PA 4C3QA 1SCWA 1O7EA 1P3GB 2CV5C 3M2JA 5EECA 4DE3A 4Z5TC 1ID3A 1S32A 3MGQC 5AQAA 3AV1C 4WU9A 5B2ID 1E25A 5AQBA 1YLZA 5B33C 4KZAA 1W2EA 1VQQA 3ZNTA 3E2LA 1JFIB 2ZLYA 5FSRA 2G5HC 1P3OB 5B24A 1KU5A 4KUDC 2OV5A 5E5AB 1F66D 4WV4B 4XZQC 4UUZA 4NZ1A 3SS5A 3LEZA 3MXSA 4AWLB 5B2IC 5A92A 4P87A 1P3KA 5DNNC 1MWTA 4X23B 4KZ8A 4XUZA 1T3UA 5M1AA 3UDIA 5GLCA 1H8YA 5B1MD 4J8VA 5FI7A 2HP6A 4NYYA 3N6IA 4YM6C 4OQ0A 3R45B 5CEBA 1F66C 3PAEA 3H0LC 3MGQA 2UWXA 5CPIA 5DNMC 2JCHA 1W8YA 4YINA 1AOIC 3AZJD 1ERMA 2X02A 5B33A 4RX2A 1LL9A 5FUGB 3VH5W 5B31G 3LJAB 1K56A 5FI6A 1WWIA 3WS4A 3C4PA 3AN2B 1YU0A 3WKJD 4GOGA 5BT1D 1KGGA 2Y2HA 4IBCA 3BLMA 5B1MC 1ESUA 2ZM5A 3VH5A 4IJEA 4MEZA 3O62B 3B3XA 1ZKJA 3AL0C 4G91B 5FQMA 5B2IA 5CHUA 1ZLAB 3P98A 4OOMA 1NZOA 2Q9NA 5JA4A 4S2OA 3WKJC 5BT1C 1M19B 1NZUA 3GQZA 4S2KA 1PWDA 2EX6A 5F99B 3B0CT 4YFMA 4N9LA 4CAYA 4GKUA 1FOFA 1N4OA 2P9VA 1F66A 5HFOA 4J8UD 1ID3B 1S32B 5JYOA 3W96C 2WK0A 3AZND 3A3DA 2F8ND 4RYEA 4NZ3A 1BTLA 1EQZD 3O88A 3ITBA 5E43A 3FKEA 5TFQA 3IP4C 4GH9A 3ZHHA 5E2GA 2H10A 5B1MA 1VM1A 2V20A 2HIOD 2ZM8A 4DDSA 2E8IA 4IBEA 5HARA 5JYPA 5M19A 3X1SB 2DRWA 1ES5A 4R8PD 1BH8B 5B2JD 5F1FA 1P34D 2BG1A 3AZNC 3FYZA 3AZJA 4R3JA 4GN2A 3TOIA 5AV5B 1F1EA 5EOEA 3UO9A 3A3FA 2PYOD 3O86A 3V3SA 5GHZA 3W97A 2DCFA 3WKJA 3FWLA 1M18D 1ZC2A 2HIOC 2V2FF 3NIAA 3SH8A 5B31A 3REIB 1NJ4A 5DTKA 3AV2B 1NYYA 5B2JC 3V9RA 1P34C 4WZ5C 4G92B 1MWUA 5CPIB 4E3KA 2XEPA 3AGDA 5BS7A 5BO0B 3WTPA 2DNSA 4H9SC 1M18C 3Q7VA 3HLEA 4DDYA 2HDRA 4PM8A 4J8XD 4J8UA 3HLBA 4HBTA 4DXCA 1YU1A 3HLGA 2WGWB 4LV2A 3VP1A 3AZNA 1P3MB 2F8NA 3HLCA 1KX5C 4H9PA 1U35D 1EQZA 3KWQC 1W8QA 1P3AD 1SKFA 3IF6C 3VSLA 5GXQD 4DE1A 5JA4B 2HIOA 3W4OA 1R4VA 2X71A 3OPPA 4CAYB 5EVID 1I2WA 4OOLA 4Y0TA 5B40D 4R8PA 3UE3A 2P9VB 5B2JA 4R4RA 3L29A 4K0WA 5C3IC 1KE4A 4B88A 4DQYB 3HUMA 3KXBB 1U35C 1P3GD 3MBZA 4GDNA 2PYOA 1P3AC 3WRTA 1H5XA 1BULA 1IYSA 5AY8B 3TSGA 3BFCA 1BLPA 2WGIA 3TU4A 2WZXA 4FCFA 5B40C 2HP5A 3KUYB 2B5RA 2J7VA 4P85A 3N3FA 4X55A 1P3OD 4U0TA 1P3GC 5E5AD 3WX7A 3IXHA 4XXRA 3W97B 1GHMA 3AZMB 1MPLA 2WAFA 4KZ3A 1YU3A 4OPYA 3SH7A 1L0FA 1M6KA 2HP9A 3MGPB 4EBPA 3SS3A 4GHLA 1YLJA 4HESA 2XD5A 4BQMA 2HPBA 3MKEA 4J8XA 4LCMA 5B31B 3P5JB 1DJAA 5D3OA 3V9RB 4RX3A 2WKIA 4OJ5A 2NQBD 4UA9A 1P3OC 5GSUB 1U35A 5E5AC 2JBFA 1P3AA 2X01A 4ZUXB 5GXQA 4PM9A 5FQJA 3GVBA 3HONA 3ZDJA 5B0ZB 4AWLC 1FCMA 3NDEA 5CPKB 4E3IA 3WTPB 3AZKB 4KZ6A 3C1BB 1EROA 4X23C 5EVIA 5B40A 5CECA 3LJAD 3REKB 1A7WA 4U3TA 5DVAA 4J8UB 4OVDA 5F1GA 4M6BA 3AN2D 4OJ6A 1XPBA 4WEKA 4NE5A 2JC7A 1TZYB 4PMAA 1P3GA 2EFUA 3ZG7B 3UE0A 3F6TA 5JRGC 4OLGA 1EQZB 4HBUA 1TEMA 4S2NC 1K4FA 5CGWA 3WS0A 3A1KA 1ZLAD 3AZLB 4DRTA 2EX9A 1PIOA 3LJAC 1JFIA 1YU2A 1Y54A 3OCLA 4GZBA 3AN2C 4N1XA 1XX2A 1M19D 4F94A 2J8YA 5F99D 1KDSA 1L0EA 2Y2NA 4KG6A 1P3OA 3LZ0B 3B6FB 3VH6T 1SDNA 3AZFB 3GR2A 1M1AB 4QD4A 3O62C 1Z2CB 2PYOB 1ID3D 3MZDA 4H9RA 3B6GC 5HAIA 3IHAA 3NCKA 4NK3A 4E44A 1ZLAC 5FASA 1PWGA 1H3OA 4OJLA 3TU4B 3MZEA 3KFUG 1ZG6A 5GLDA 2NQBA 2ZC3B 4Y0OA 3X1SD 1Q2QA 5HAQA 5B1LB 5HW3A 1ID3C 1S32C 4WU9C 4N92A 5AV5D 4LV0A 2ZY4A 4ZBJB 1GCEA 2HDQA 3HLWA 3LJAA 1HZOA 5AV9D 3AN2A 3OPRA 4BL2A 2ZC7A 2OLVA 3X1SC 5B24C 5B0YB 1JTDA 3UPPA 3BFFA 3REID 1I2SA 1XGJA 3AV2D 5BNVB 3G35A 2J9PA 3C7VA 3GV9A 5CPID 1ZLAA 3L26A 4QHCA 5AV5C 1EI5A 2FJ7B 4KGCB 4GB7A 5A91A 1PYYA 3VP0A 5A93A 1M19A 4N9KA 4N1HA 5F99A 4WM9A 1P3IB 4OJPA 4J8VC 3BLSA 3SS4A 3HBRA 3REIC 3HLFA 1FQGA 3W4QA 4WNNA 3WWXA 1Q9CA 5CPIC 3UT9B 1P3MD 4U0XA 5E2EA 3X1VA 4IBFA 3FKWA 5U47A 2EFXA 1QMEA 3Q07A 1BH9B 1RGZA 3A3EA 5KZHA 1ONHA 3X1SA 1BH8A 3S1YA 5B32G 3UTBB 2V1ZA 1HTZA 4H9RB 3EPHA 5AV5A 1K6RA 2ZQ9A 2R9XA 3KXBD 4JKTA 1K55A 1H3OB 2Q9MA 5CGXA 1PI5A 2Y59A 1HTAA 5AV9A 4BENA 4HGAC 5AY8D 2NQBB 5DTTA 2XDMA 5G49B 3LELB 4CSRB 2PBYA 1BT5A 3REIA 2RL3A 2DQNC 3AV2A 3KUYD 3WA9D 4UA6A 2BYKB 5HX9A 1NYMA 4RA7A 4OQGA 1YLWA 4CPKA 5BO0A 2XFSA 1U60A 1O07A 4UA7A 5AQ7A 5GL9A 3L25A 4X53A 4E3OA 1HQ3A 1LI0A 4P0MA 5CEDA 2C6WB 3W97D 3C1CA 4PM5A 3AZMD 5FDHA 1L0GA 3IWQA 5AY8C 1MXOA 3MGPD 4H9NB 4WZ4A 1C3BA 4Z66B 5B31D 4EUZA 5L2FA 1YU4A 2WGWA 3MNNA 3MVDB 1P3MA 2XH9A 3O87A 3AZJC 3NDGA 4R3BA 5GSUD 1TAFB 1ES4A 1TVFA 4WU8A 4ZUXD 3W97C 5B0ZD 1K25A 1IKIA 5CPKD 3WTPD 3HREA 2EX2A 3PBRA 3AZKD 4QJGA 4YS3A 1OMEA 3C1BD 4NE6A 5B31C 3REKD 4MLLA 3B0DB 4K91A 3UNWA 4Z2MH 4WNNB 2J9OA 4D2OA 1TZYD 5FAOA 3REJB 3KXBA 5GSUC 3X1VB 5BS7C 3A6NB 4ZUXC 3V50A 1TDGA 5CHMA 1K4EA 1YQSA 5CPKC 3WTPC 3O3VA 5AY8A 1P3BB 4IVIA 3AZLD 1PW8A 4Z9QA 3MGSB 3C1BC 2XGNA 3RXWA 2JE5A 4ZBEA 3UPNA 4KHAB 3KUYA 1MY8A 3WA9A 4J8UC 3G4PA 3IXDA 1KVMA 2GDNA 3MGRD 1TZYC 4OP8A 3LZ0D 3B6FD 1L2SA 3AZFD 1CI9A 1M1AD 1ES2A 4NE3A 3X1UD 1EQZC 4BL3A 2IWCA 5AV9B 1YT4A 3AZMA 4S2LA 1P3LD 4JXVA 4KQRA 1BLHA 3AZLC 1FR1A 3MGPA 4JXSA 2XFTA 4KQOA 3OZHA 3FV7A 1YLYA 3TU4D 1CEFA 2JSSA 5BPVA 4R8PC 3BFDA 3VH5T 3G30A 5GT0A 1KDWA 4H8RA 5CTMA 1P3FD 3B6FC 1MBLA 4X56A 5GSUA 3AZFC 5B1LD 2HUEC 3ZG9B 4ZUXA 2PYOC 3EQUA 3ZG5A 1HQ3B 2CV5B 1YMSA 2IO5B 5B0ZA 3UTAD 2WZZA 3P09A 3C1CB 5CPKA 4IBRA 3AZKA 3WRZA 3W99A 3AV1B 1BUEA 1XKZA 3C1BA 3TU4C 3REKA 4E6XA 3V39A 4DRBA 4R23A 2VQRA 1TZYA 3MNNB 1CK3A 4MBHA 1IEMA 5B0YD 1WE4A 5B1LC 2ZQAA 4WU8B 4KUDB 2Z2LB 5HL1A 4XZQB 3N4IA 3AZLA 3NQJB 5AVCA 2Y91A 1N1JA 2FJ7D 4YS3B 4KGCD 4ZBJC 1ES3A 3A1IA 4J8XC 5DNNB 5AVBA 4Q8IA 3MGRA 3I7JA 1P3ID 1XP4A 3NQUB 3LZ0A 3B6FA 1XA1A 3EPJA 3AZFA 1M1AA 5B0YC 3X1UA 4GD6A 4KZ7A 3ZFZA 3FKVA 1CEGA 3RELB 5GXQC 5B32B 3W98A 1SDEA 1P3LA 3UT9D 2OLUA 5EE8A 2XK1A 5CP6B 2IOUA 2ZQ8A 3V5MA 5DNMB 3X1TD 3PTEA 4KGCC 3UY6A 4OKPA 1AOIB 5EVIC 1K57A 3QNCA 4RVAA 4OQHA 5AV6D 5GLAA 2ZY2A 1N9BA 3BYDA 4GD8A 3WA9B 1DJBA 3AZED 3RJUA 3G31A 5CHLB 3PBQA 1P3FA 1P3IC 3IQAA 3FZCA 4IBGA 5B1LA 4ZJ3A 2Y2MA 3UTAA 1ALQA 3UTBD 1PWCA 3GMWA 3H0MC 3UT9C 4ZDXA 4LV1A 2H5SA 3N8SA 5FAPA 4E3NA 1ONGA 3VH6A 4JF5A 3GTCA 3MKFA 4NETA 3FDDA 5TGFA 1DJCA 1PZPA 1PW1A 2Y2JA 5GT0B 2EXAA 2L5AA 3A3JA 2Y2KA 5M18A 1IYPA 4NZ4A 2Y2LA 4UPKA 3LELD 5B0YA 3V3RA 3CMZA 4EV4A 4QLCB 5GHYA 4B4XA 5BNVA 3IWIA 5G18A 1CI8A 3UPOA 4FSFA 1BSGA 3W99B 2FJ7A 4KGCA 4XUJB 1K38A 5AQ9A 2J8PA 1P3IA 2NQBC 4DF6A 5CERA 4Z2MG 4QU3A 4Z66D 2HDSA 2RCXA 2NZDB 5BNXB 4JJNB 3UT9A 3NI9A 3MVDD 5I94A 4WMCD 3X1TA 5AVCB 3AZID 1N1JB 4LG2A 1JWPA 4OH0A 1KGFA 4EBLA 5F83A 5AV6A 3QHYA 1BH9A 1W7FA 5AVBB 3AZEA 3HL9A 4J8WB 1SHVA 3MGRB 2YFWB 4P6BA 4Z66C 3X1UB 3G2YA 2VGKA 5CRFA 3W4PA 3LZ1B 3UTBA 4G91C 2WADA 3W98B 1P3LB 1KX3D 2QMIA 3EPLA 1BLCA 4L0LA 3REJD 3BECA 2WKHA 2F8NH 4LV3A 3AZGB 3X1VD 3NBLA 1E4DA 1YLTA 3A6ND 1QMFA 4JBFA 2WGVA 1NY0A 1K54A 1DY6A 1M19C 5BOHA 1P3BD 3IXGA 1KGEA 5F99C 1P3FB 5DF9A 1K6SA 5G49A 3MGSD 3LELA 4CSRA 3B0DC 4LD9A 3IXBA 2BYKA 5TR7A 4EBNA 1Q2PA 4KG5A 3AYWA 3UTAB 4ZJ2A 3REJC 2CC1A 4OQIA 2IWDA 3X1VC 4JXGA 4OJOA 3A6NC 4QY5A 2QPNA 3PBOA 3KWQB 5FATA 5FAQA 4KQQA 3IF6B 3HUNA 4WEJA 3MGSC 3BFEA 5AV8A 4H9NA 4Z66A 3OCNA 4IBIA 4PM6A 3M6HA 3Q7ZA 5KMWA 3MVDA 4BD0A 3BFGA 4WMCA 4E3LA 3AZIA 1TAFA 2A49A 1K55C 1KX4B 5F82A 5C3IB 3WTPE 3AFAB 1HQ3D 3VOYA 2CV5D 4FD8A 5FI2A 5AV9C 5CPJA 4Y0UA 4Z5TD 3C1CD 2BLSA 1GA0A 4JLFA 2P74A 3AV1D 4S2PA 1RGYA 1WYCA 4UAAA 3AV2C 2WUQA 1ERQA 4G92C 1KX3A 3MNND 3REJA 3ZGAB 2ZC6B 4C75A 1YMXA 5EUAA 2BYMB 3X1TB 4C6YA 4NFTA 3A6NA 2EX8A 1HQ3C 4WU8D 5AV6B 4KUDD 4WZSB 2IO5C 3C1CC 3AZEB 3AGFA 5GHXA 4XZQD 1P3BA 3MGSA 1FCNA 1BLSA 4OPZA 3B0CW 4YS3D 4R4SA 4EQIA 4GNUA 4KHAA 5DNND 2ZM0A 4WELA 5CGSA 3MNNC 1P3MC 3QNBA 2I72A 2YFVB 4WU8C 3RELD 2AROA 4YM6D 5B32D 5KDMB 5DF7A 4DE0A 5CP6D 4HEFA 3PBTA 3WAAA 5DNMD 4YS3C 3REHA 4IBJA 3LO7A 1AOID 4EO5B 1KE3A 3G34A 2Y2QA 4LD9B 3C4OA 3AYWB 4KZ9A 4X68A 2Y55A 1ZG4A 3KXBC 4IBXA 3VP3A 5HAPA 3UN7A 4IBKA 4A5RA 3RELC 2CV5A 5B32C 5JRGB 4Z5TA 5GT3B 2XLNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DJA A;  5D3O A;  4FH4 A;  4RX3 A;  2G2U A;  1NXY A;  3ZG9 B;  3EQU A;  4DE2 A;  5FQI A;  3ZG5 A;  2WKI A;  4O7D A;  4UA9 A;  1W5D A;  1YMS A;  2Y2P A;  2WZZ A;  1G6A A;  2C5W B;  3P09 A;  4IBR A;  2H0T A;  3HLD A;  1RCJ A;  3ZG8 B;  1AXB A;  2JBF A;  1FCO A;  3CJM A;  5CXW A;  3WRZ A;  1IYO A;  2X01 A;  3ISG A;  4QY6 A;  1BUE A;  1XKZ A;  2Y2I A;  1S0W A;  4PM9 A;  5FQJ A;  2ZJ9 A;  3GVB A;  4OPR A;  3ZDJ A;  1FCM A;  3NDE A;  4E3I A;  4E6X A;  3V39 A;  2WAE A;  3DWZ A;  4E3J A;  4R23 A;  4M3K A;  4QB8 A;  4KZ6 A;  1ERO A;  1FR6 A;  5EVI A;  5E2H A;  2VGJ A;  5CEC A;  2A3U A;  1E3U D;  1CK3 A;  5FA7 A;  2FFY A;  3PBN A;  1YLP A;  4MBH A;  3ZCZ A;  5J8X A;  3IHB A;  4U3T A;  5DVA A;  1IEM A;  4OVD A;  1WE4 A;  5F1G A;  1XPB A;  3Q82 A;  4WEK A;  5IHV A;  3IH8 A;  2JC7 A;  2ZQA A;  4GDB A;  5EVI B;  1ESI A;  4CJN A;  2Z2L B;  1K56 D;  1L0D A;  4PMA A;  5HL1 A;  3ZG7 B;  1HD8 A;  2EFU A;  4BLM A;  3UE0 A;  3N4I A;  3N8L A;  4OLG A;  4HBU A;  2Y91 A;  1TEM A;  4S2N C;  1TDL A;  1IYQ A;  1K4F A;  5CGW A;  1ES3 A;  4C3Q A;  1SCW A;  1O7E A;  3WS0 A;  3M2J A;  5EEC A;  4DE3 A;  1FSW A;  5DTS A;  2Z2M B;  4Q8I A;  4JPM A;  4MBK A;  5AQA A;  2EX9 A;  4DRT A;  3G2Z A;  3I7J A;  1PIO A;  1XP4 A;  1XA1 A;  5EOO A;  1Y54 A;  1E25 A;  3OCL A;  4GZB A;  4ZAM A;  3BEB A;  4N1X A;  5AQB A;  1YLZ A;  1XX2 A;  4KZA A;  4GD6 A;  4KZ7 A;  3ZFZ A;  1VQQ A;  3FKV A;  1CEG A;  2J8Y A;  4F94 A;  1KDS A;  1L0E A;  2Y2N A;  4KG6 A;  3ZNT A;  1SDE A;  3MZF A;  3E2L A;  1SDN A;  3E2K A;  4IED A;  2OLU A;  2ZLY A;  3GR2 A;  5FSR A;  4QD4 A;  5EE8 A;  2XK1 A;  3HUO A;  2ZQ8 A;  3V5M A;  2HDU A;  3PTE A;  1XGI A;  3UY6 A;  3MZD A;  3BRM A;  4OKP A;  4BJP A;  5EVI C;  1K57 A;  3QNC A;  4RVA A;  4OQH A;  5HAI A;  3IHA A;  3NCK A;  5GLA A;  2OV5 A;  4NK3 A;  1N9B A;  5FAS A;  3BYD A;  4GD8 A;  1DJB A;  2XR0 A;  1PWG A;  2ZD8 A;  3RJU A;  3UE1 A;  2XD1 A;  3G31 A;  3PBQ A;  3SS5 A;  2WKE A;  3LEZ A;  3MXS A;  3DWK A;  3M6B A;  4X6T A;  3IQA A;  3FZC A;  5A92 A;  3MZE A;  3VP4 A;  4P87 A;  3VP2 A;  1ZG6 A;  1LHY A;  4ZJ3 A;  1MWT A;  5GLD A;  4KZ8 A;  4XUZ A;  3Q81 A;  2Y2M A;  1ALQ A;  1PWC A;  3GMW A;  5DF8 A;  2ZC3 B;  4DKI A;  4Y0O A;  1Q2Q A;  5M1A A;  3UDI A;  4ZDX A;  1H8Z A;  4LV1 A;  2H5S A;  5GLC A;  5HAQ A;  3N8S A;  5E2F A;  2H0Y A;  5FAP A;  3A3I A;  4E3N A;  3CZD A;  1H8Y A;  5HW3 A;  1ONG A;  5FI7 A;  3HVF A;  2HP6 A;  4JF5 A;  3GTC A;  3MKF A;  3N6I A;  4OQ0 A;  4LEN A;  3AGE A;  4NET A;  5TGF A;  4N92 A;  5CEB A;  1DJC A;  1PZP A;  1PW1 A;  3NY4 A;  3PAE A;  4S2I A;  3LY4 A;  1M40 A;  2Y2J A;  2EXA A;  4LV0 A;  1MWS A;  3A3J A;  2UWX A;  2Y2K A;  2HDQ A;  1IYP A;  1GCE A;  5M18 A;  3HLW A;  1E3U A;  2Y2O A;  2Y2L A;  1HZO A;  2JCH A;  1W8Y A;  4YIN A;  1ERM A;  2X02 A;  3PAG A;  3V3R A;  1IEL A;  3CMZ A;  3OPR A;  4EV4 A;  5KSC A;  4RX2 A;  5A90 A;  1LL9 A;  4BL2 A;  5GHY A;  4B4X A;  3IWI A;  5EPH A;  1K56 A;  3WS1 A;  5G18 A;  2ZC7 A;  2OLV A;  4JXW A;  1KE0 A;  5FI6 A;  3WS4 A;  3C4P A;  3C7U A;  1CI8 A;  1JTD A;  1K57 C;  3OPL A;  3UPP A;  3UPO A;  3BFF A;  4GOG A;  4FSF A;  1I2S A;  1KGG A;  1BSG A;  1XGJ A;  2Y2H A;  3BLM A;  2WYX A;  3G35 A;  4MNR A;  2J9P A;  4MBF A;  1ESU A;  3C7V A;  3GV9 A;  1K38 A;  5AQ9 A;  4K0X A;  1NRF A;  4MEZ A;  4QHC A;  3B3X A;  1EI5 A;  1ZKJ A;  4GB7 A;  5FQM A;  4DF6 A;  5CER A;  5A91 A;  2IWB A;  4QU3 A;  1G68 A;  2EXB A;  1PYY A;  5CHU A;  1PZO A;  3P98 A;  3VP0 A;  5A93 A;  4OOM A;  1NZO A;  4N9K A;  4ZTK A;  2HDS A;  4UHU A;  4N1H A;  2Q9N A;  4WM9 A;  3UDX A;  2RCX A;  3ZVT A;  3BLS A;  3NC8 A;  3SS4 A;  3ITA A;  1JVJ A;  3NI9 A;  4S2O A;  4IVK A;  3HBR A;  4R0Q A;  3HLF A;  1NZU A;  1FQG A;  3GQZ A;  5I94 A;  4WMC D;  3W4Q A;  4S2K A;  1PWD A;  1MWR A;  2EX6 A;  4KG2 A;  1JWP A;  4OH0 A;  1KGF A;  3WWX A;  4EBL A;  4OPQ A;  4YFM A;  4N9L A;  4GKU A;  1GA9 A;  5F83 A;  1W79 A;  3QHY A;  1FOF A;  1N4O A;  4U0X A;  5E2E A;  1W7F A;  2P9V A;  5HFO A;  3HL9 A;  1SHV A;  3FKW A;  3IT9 A;  5U47 A;  5JYO A;  4S2M A;  2EFX A;  1QME A;  2WK0 A;  3BM6 A;  2ZQ7 A;  3A3D A;  3Q07 A;  4P6B A;  1RGZ A;  2FFF B;  2XF3 A;  4RYE A;  3A3E A;  3G2Y A;  2VGK A;  5CRF A;  4WZ5 A;  3W4P A;  1BTL A;  4X69 A;  5KZH A;  1ONH A;  4B4Z A;  3O88 A;  3ITB A;  2WAD A;  2OSU A;  3G32 A;  4KZ4 A;  5E43 A;  2QMI A;  5CHJ A;  5TFQ A;  1BLC A;  3ZHH A;  1JWV A;  4L0L A;  5E2G A;  3BEC A;  2H10 A;  2V20 A;  1VM1 A;  2WKH A;  4LV3 A;  5GLB A;  3OPH A;  3NBL A;  2ZM8 A;  3S1Y A;  2E8I A;  4DDS A;  1E4D A;  1YLT A;  5HAR A;  2V1Z A;  1HTZ A;  5JYP A;  5M19 A;  4PPR A;  1QMF A;  2DRW A;  1ES5 A;  2WGV A;  4JBF A;  1NY0 A;  1KVL A;  1K6R A;  1K54 A;  1DY6 A;  2ZQ9 A;  2R9X A;  4JKT A;  5F1F A;  5BOH A;  1K55 A;  2Q9M A;  3IXG A;  1KGE A;  2BG1 A;  2Y4A A;  5DF9 A;  5CGX A;  1K6S A;  1PI5 A;  2Y59 A;  3FYZ A;  4R3J A;  4BEN A;  4GN2 A;  3TOI A;  5EOE A;  3ZVW A;  3DTM A;  3OC2 A;  3UO9 A;  3IXB A;  3A3F A;  4JF6 A;  2R9W A;  5DTT A;  3O86 A;  5TR7 A;  4EBN A;  3VOZ A;  1Q2P A;  3V3S A;  2XDM A;  4KG5 A;  5GHZ A;  3ZG0 A;  2PU4 A;  2DCF A;  1RP5 A;  2PBY A;  1BT5 A;  3FWL A;  4ZJ2 A;  2RL3 A;  2CC1 A;  4OQI A;  3M2K A;  3MXR A;  1ZC2 A;  3N8R A;  2IWD A;  4KEN B;  1LLB A;  4PM7 A;  4JXG A;  2V2F F;  3NIA A;  4UA6 A;  5HX9 A;  1NYM A;  3IF6 A;  3DW0 A;  4OQG A;  4RA7 A;  4QY5 A;  3SH8 A;  4XUX A;  1YLW A;  3S22 A;  3GRJ A;  5FQK A;  3VFH A;  2QPN A;  3PBO A;  4EWF A;  1NJ4 A;  5DTK A;  5FAT A;  4CPK A;  1NYY A;  1U60 A;  1O07 A;  2XFS A;  4UA7 A;  5FQ9 A;  5AQ7 A;  5FAQ A;  5GL9 A;  4KQQ A;  4WZ5 C;  4X53 A;  3IF6 B;  1MWU A;  4E3O A;  3HUN A;  4WEJ A;  2ZQC A;  3BFE A;  4ZJ1 A;  1LI0 A;  4P0M A;  5CED A;  3LCE A;  2C6W B;  1XXM A;  1LL5 A;  4E3K A;  4PM5 A;  3TG9 A;  3W8K A;  2XEP A;  5FDH A;  3CG5 A;  4FH2 A;  3AGD A;  1L0G A;  3IWQ A;  3OCN A;  1GHP A;  3GSG A;  4PM6 A;  1MXO A;  5KSH A;  3M6H A;  3Q7Z A;  1GHI A;  5FQQ A;  5KMW A;  3D4F A;  4BD0 A;  4OP5 A;  1C3B A;  4WZ4 A;  3SH9 A;  2DNS A;  3BFG A;  4WMC A;  4E3L A;  2ZM2 A;  4OLD A;  4EUZ A;  1K54 C;  3Q7V A;  5L2F A;  1S6R A;  2A49 A;  1K55 C;  3HLE A;  2WGW A;  1JWZ A;  1XA7 A;  5F82 A;  4LCL A;  2HDR A;  3VFF A;  4DDY A;  2XH9 A;  3O87 A;  3VOY A;  3NDG A;  4FD8 A;  4PM8 A;  4KZB A;  5FI2 A;  3N7W A;  4R3B A;  4Y0U A;  3HLB A;  2BLS A;  2ZC4 B;  4HBT A;  3Q7V B;  4DXC A;  1GA0 A;  3HLG A;  1ES4 A;  1TVF A;  4JLF A;  2G2W A;  2WGW B;  4LV2 A;  3VP1 A;  2P74 A;  4E3M A;  4S2P A;  1K25 A;  3VMA A;  1RGY A;  3HLC A;  1IKI A;  1WYC A;  3JYI A;  3PBS A;  5CTN A;  3HRE A;  4UAA A;  2EX2 A;  1W8Q A;  3PBR A;  4QJG A;  1SKF A;  2WUQ A;  1OME A;  1ERQ A;  3IF6 C;  3VSL A;  4DE1 A;  3ZGA B;  2XQZ A;  2ZC6 B;  4MLL A;  3WS5 A;  4C75 A;  1YMX A;  4K91 A;  5EUA A;  3UNW A;  4S2J A;  3W4O A;  1FSY A;  4C6Y A;  1EWZ A;  2J9O A;  2EX8 A;  2X71 A;  4BD1 A;  4D2O A;  3OPP A;  1Z6F A;  1I2W A;  4OOL A;  5EVI D;  4Y0T A;  1YM1 A;  2ZQD A;  5FAO A;  3IF5 A;  4ID4 A;  3UE3 A;  2P9V B;  3AGF A;  5GHX A;  4R4R A;  4WBG A;  3V50 A;  1FCN A;  1BLS A;  3RXX A;  4K0W A;  4OPZ A;  1LI9 A;  1TDG A;  5CHM A;  3SOI A;  1KE4 A;  4R4S A;  4B88 A;  1K4E A;  1YQS A;  3HUM A;  4OOY A;  4EQI A;  3O3V A;  3MBZ A;  4GNU A;  4IVI A;  2ZM0 A;  4GDN A;  3WRT A;  3LY3 A;  1PW8 A;  4Z9Q A;  1H5X A;  4WYY A;  4WEL A;  1BUL A;  2XGN A;  5CGS A;  1JTG A;  3RXW A;  1IKG A;  2Y2G A;  1PI4 A;  1WYB A;  1IYS A;  2JE5 A;  3QNB A;  4ZBE A;  2I72 A;  5EVL A;  3UPN A;  1MY8 A;  3TSG A;  3BFC A;  3Q1F A;  3G4P A;  3S4X A;  3UDF A;  3IXD A;  2QZ6 A;  1BLP A;  1KVM A;  2GDN A;  4JF4 A;  2WGI A;  2WZX A;  4FCF A;  3IH9 A;  4DXB A;  1HVB A;  4OP8 A;  2HP5 A;  1MKI A;  1L2S A;  2PU2 A;  5DF7 A;  1CI9 A;  4DE0 A;  2B5R A;  1ES2 A;  2ZC5 B;  4Y7P A;  4HEF A;  3PBT A;  2J7V A;  4OON A;  4P85 A;  4BL3 A;  2IWC A;  4X55 A;  3LO7 A;  1YT4 A;  3EQV A;  4S2L A;  3MFD A;  4U0T A;  1BZA A;  3VSK A;  1KE3 A;  4JXV A;  4KQR A;  3G34 A;  1BLH A;  3IXH A;  2Y2Q A;  1FR1 A;  1I5Q A;  4JXS A;  2XFT A;  4KZ5 A;  4KQO A;  4XXR A;  3OZH A;  3FV7 A;  3C4O A;  1GHM A;  2ZMA A;  4KZ9 A;  4X68 A;  1CEF A;  1YLY A;  1MPL A;  2WAF A;  1J9M A;  3IWO A;  2Y55 A;  4KZ3 A;  1ZG4 A;  4OPY A;  3BFD A;  3SH7 A;  1L0F A;  1M6K A;  2HP9 A;  3G30 A;  4IBX A;  4S2N A;  3VP3 A;  5HAP A;  3UN7 A;  3ZNY A;  4EBP A;  3SS3 A;  4A5R A;  1YLJ A;  1KDW A;  4H8R A;  4HES A;  5CTM A;  2XD5 A;  3C5A A;  2HPB A;  4BQM A;  4E6W A;  4R1G A;  3MKE A;  4LCM A;  1MBL A;  4X56 A;  3WS2 A;  2XLN A; 
#chains in the Genus database with same CATH topology
 5CP6 C;  2G2U A;  4H9O A;  2PYR A;  3AV1 A;  5FQI A;  2VEA A;  3E4P A;  1W5D A;  5AV8 B;  3R4K A;  3L27 A;  2H0T A;  3HLD A;  1RCJ A;  2O9A A;  3L2A A;  1FCO A;  3CJM A;  2PDR A;  3KUY C;  1IYO A;  3WA9 C;  3AZH B;  3ISG A;  4QY6 A;  5GT0 D;  1S0W A;  1YAX A;  2ZJ9 A;  1G28 A;  3AZI B;  4E3J A;  3H82 A;  3MR0 A;  4QLC D;  3T1S A;  1FR6 A;  2V1A A;  5E2H A;  2VGJ A;  4KUD A;  1YUE A;  2DMW A;  1E3U D;  3PBN A;  3MS6 A;  3ZCZ A;  4ETX A;  3IHB A;  5CPJ B;  3AZM C;  4XZQ A;  2PD8 A;  3CPT B;  3NQJ A;  2M1C A;  1W63 Q;  3MGP C;  3W96 D;  3B6G B;  3W99 D;  3IH8 A;  4GDB A;  3WD2 A;  4WL9 A;  3ZYT A;  1B67 A;  2GJ3 A;  1L0D A;  2P7J A;  1HD8 A;  4XUJ D;  4F3L B;  5DNN A;  1PDC A;  4HI4 A;  5GT0 C;  2W1T A;  1KX3 B;  3NQU A;  1FSW A;  5DTS A;  2Z2M B;  3PHY A;  4JPM A;  4QLC C;  4MBK A;  1P3P B;  2F8N G;  3G2Z A;  3REL A;  2R78 A;  4YM6 A;  2NZD D;  5B32 A;  3A0S A;  3RFB A;  2ZY5 A;  5EOO A;  5B0Z C;  4JJN D;  3F1N A;  4ZAM A;  3BEB A;  3D3O A;  5CP6 A;  3AZK C;  5DNM A;  5FDS A;  3W99 C;  4EES A;  5AVC D;  3PXP A;  4EU0 A;  4WU9 B;  1AOI A;  3MZF A;  4XUJ C;  3E2K A;  4IED A;  3REK C;  3HUO A;  5AVB D;  2HDU A;  3EG5 B;  4J8W D;  1XGI A;  3BRM A;  1VB6 A;  2QHK A;  4BJP A;  4O01 A;  1OJ5 A;  3DTK A;  4QWO A;  2XR0 A;  2ZD8 A;  3UE1 A;  1IOU A;  2XD1 A;  1KOU A;  2WKE A;  3DWK A;  3M6B A;  4X6T A;  5B24 B;  3LZ1 D;  2NZD C;  3CAX A;  2ARO B;  2JHE A;  3VP4 A;  4JJN C;  3VP2 A;  3W98 D;  1LHY A;  4UUZ B;  2HGV A;  5AVC C;  2J3T D;  3WAA B;  3AZG D;  1H8M A;  4NZ5 A;  3LIE A;  3Q81 A;  5DF8 A;  3VV4 A;  3REH B;  1E88 A;  4DKI A;  4Y15 A;  4UQI S;  1H8Z A;  1F5M A;  1P3K B;  5E2F A;  5AVB C;  2H0Y A;  3A3I A;  3CZD A;  4J8W C;  4HQA A;  4UQI M;  3HVF A;  5C5K A;  1OTB A;  3MGR C;  4LEN A;  3AGE A;  3LZ0 C;  5I5L A;  3NY4 A;  4OUI A;  3T4T A;  1M1A C;  4S2I A;  3LY4 A;  1M40 A;  3X1U C;  4QLC A;  4J8V B;  1MWS A;  4NXB A;  2Y2O A;  3LZ1 C;  1E3U A;  1XFN A;  4GCZ A;  4EW7 A;  3W98 C;  1P3L C;  3PAG A;  4Z5T B;  1IEL A;  3FPV A;  5KSC A;  5A90 A;  3MGQ B;  3W96 A;  3K3C A;  2J3T C;  4H9O B;  3AZG C;  5EPH A;  3WS1 A;  2B18 A;  5MC7 A;  4JXW A;  4XUJ A;  1KE0 A;  3C7U A;  3OPL A;  1K57 C;  3KSY A;  5B33 B;  1KX5 D;  3KWQ D;  2WYX A;  3JVV A;  3KSG A;  4MNR A;  4MBF A;  1P3F C;  4K0X A;  1NRF A;  2GNX A;  4EQ1 A;  4Y13 A;  1SKO A;  4H9Q A;  2NZD A;  5BNX A;  2IWB A;  4JJN A;  3UTA C;  1G68 A;  2EXB A;  1PZO A;  2Z6C A;  2PR5 A;  4H6J A;  4ZTK A;  4UHU A;  2O9B A;  3ZQ5 A;  3UDX A;  3ZVT A;  1B6W A;  5DKL A;  5B2I B;  5K5B A;  3NC8 A;  1KX4 D;  3ITA A;  1JVJ A;  4EUV A;  3AFA D;  4IVK A;  4R0Q A;  4IJF A;  2W8S A;  4J8W A;  1MWR A;  4KG2 A;  2CMN A;  2F2A C;  4OPQ A;  2YFW A;  1GA9 A;  1W79 A;  2PYP A;  4HGA B;  3ICY A;  3LIC A;  3QP2 A;  3IT9 A;  4GHA A;  4S2M A;  3R7W A;  3LEQ A;  3LZ1 A;  4DMZ A;  2RTS A;  4YM6 B;  3BM6 A;  2ZQ7 A;  1F66 B;  2FFF B;  4IBD A;  2XF3 A;  3F1N B;  1ED7 A;  3EGD C;  1P34 A;  4WZ5 A;  3AZG A;  3DBA A;  4X69 A;  3H0R C;  2FJ7 C;  3K2N A;  4B4Z A;  1KX4 C;  3V67 A;  2OSU A;  3G32 A;  4KZ4 A;  5HDD A;  3AFA C;  5CHJ A;  1JWV A;  4MB3 A;  4WLA A;  3KS4 A;  5GLB A;  3OPH A;  4JGO A;  2RVQ D;  4PKY G;  2V9A A;  4PPR A;  1O6I A;  3KS8 A;  4H9S A;  1M18 A;  2F8N K;  2VKS A;  1KVL A;  4WJ3 C;  5B1M B;  3VH6 W;  1G6O A;  2ZL1 B;  1A0K A;  2Y4A A;  3QP5 A;  3ZVW A;  3DTM A;  3OC2 A;  5HD5 A;  3X1T C;  4JF6 A;  2R9W A;  3VOZ A;  3ZG0 A;  3AZJ B;  2PU4 A;  1RP5 A;  1KX5 A;  2DF4 C;  5AV6 C;  3KWQ A;  3M2K A;  3MXR A;  3N8R A;  4KEN B;  3AZE C;  1LLB A;  2RVQ C;  4PM7 A;  4X1M A;  3LIA A;  3IF6 A;  3DW0 A;  4XUX A;  3S22 A;  3WKJ B;  4DN0 A;  3GRJ A;  5FQK A;  3VFH A;  4NYU A;  4EWF A;  5FQ9 A;  3HSH A;  4LD9 D;  4X23 D;  2ZQC A;  4ZJ1 A;  3UTB C;  4IUH A;  3LCE A;  2QJ5 A;  3AYW D;  1XXM A;  1LL5 A;  3TG9 A;  4I39 A;  3W8K A;  3CG5 A;  4FH2 A;  1GHP A;  2RIQ A;  3GSG A;  3W96 B;  1KX4 A;  5KSH A;  1GHI A;  5FQQ A;  1FIL A;  3AFA A;  3D4F A;  4II7 A;  4O8G A;  4OP5 A;  3SH9 A;  1MC0 A;  3E98 A;  2ZM2 A;  5JRG D;  4OLD A;  5GT3 D;  1K54 C;  1S6R A;  3LYX A;  1JWZ A;  2ZY3 A;  1XA7 A;  5HWT A;  4LCL A;  3VFF A;  1D06 A;  3LEL C;  5AV8 D;  4KZB A;  3N7W A;  4EO5 C;  2ZC4 B;  3Q7V B;  1CXW A;  4LD9 C;  2G2W A;  4H9Q B;  3AZH D;  2LY8 A;  4MDZ A;  4E3M A;  1F98 A;  4HJ6 A;  3AYW C;  3VMA A;  3JYI A;  3PBS A;  4H6J B;  4PHT A;  2XA7 S;  5CTN A;  2BYM A;  4B9O A;  3AZN B;  4MB5 A;  3EPK A;  2XA7 M;  2F8N B;  2XQZ A;  4H9P B;  3WS5 A;  1STZ A;  5CPJ D;  5GT3 C;  3O62 D;  4S2J A;  1FSY A;  1EWZ A;  1GSX A;  5DKK A;  4BD1 A;  1ULY A;  3B6G D;  1Z6F A;  1YM1 A;  5AV8 C;  2ZQD A;  3IF5 A;  4ID4 A;  4WF0 A;  4IHQ A;  2HIO B;  1T19 A;  2AVX A;  4B93 A;  4WBG A;  3AZH C;  3R7W B;  3RXX A;  1LI9 A;  3SZT A;  4R8P B;  3SOI A;  3MVD C;  2W3F A;  1GPF A;  4OOY A;  5B2J B;  1P34 B;  3AZI C;  3LY3 A;  3KYQ A;  4L9G A;  4WYY A;  4ARZ A;  2YFV A;  1P3P D;  1JTG A;  3B0B A;  2Y2G A;  1IKG A;  1PI4 A;  1WYB A;  2OOL A;  2NUT C;  5E5A A;  5EVL A;  5KDM A;  1UGU A;  5CPJ C;  2HUE B;  3Q1F A;  1VET A;  3S4X A;  3UDF A;  2B95 A;  3TRC A;  2QZ6 A;  1S32 D;  4JF4 A;  3IH9 A;  3QP8 A;  4DXB A;  1HVB A;  3MQQ A;  4WU9 D;  1MKI A;  1M18 B;  2JKF A;  2PU2 A;  4ETZ A;  4HH2 A;  4R3A A;  4O0P A;  2ZC5 B;  4Y7P A;  3JPU A;  4X23 A;  4OON A;  1KX3 C;  3EQV A;  3MFD A;  1E6N A;  1BZA A;  3VSK A;  1BFM A;  4I3J A;  3QP4 A;  2CWE A;  1I5Q A;  4KZ5 A;  2G5I C;  1P3P C;  4E45 A;  2OWJ A;  2ZMA A;  3R45 A;  5B24 D;  3PYP A;  1KX5 B;  2ARO D;  1J9M A;  5JRG A;  3IWO A;  5GT3 A;  4S2N A;  1P3B C;  3ZNY A;  1CK7 A;  4E6W A;  3KSH A;  3WAA D;  3C5A A;  4DJ3 A;  4R1G A;  4LFU A;  3T4L A;  4R70 A;  1YPR A;  3REH D;  3WS2 A;  4NY2 A;  1PZR A;  1P3K D;  4FH4 A;  1NXY A;  3AZH A;  5FUG A;  4DE2 A;  3BY8 A;  4O7D A;  1E6Z A;  2K31 A;  4J8X B;  2Y2P A;  1G6A A;  2C5W B;  2Y79 A;  3ZG8 B;  1AXB A;  4QNL A;  5CXW A;  1WWS A;  2HJE A;  2Y2I A;  4J8V D;  4OPR A;  2ARO C;  1U35 B;  3O62 A;  1P3A B;  2WAE A;  3CPT A;  3DWZ A;  2PR6 A;  4M3K A;  4QB8 A;  3MGQ D;  5GXQ B;  3B6G A;  3WAA C;  2A3U A;  5FA7 A;  2FFY A;  2L0W A;  4ZRR A;  1YLP A;  3REH C;  5J8X A;  3L28 A;  4F3L A;  1N9O A;  3CLO A;  1W1V A;  5B33 D;  1P3K C;  2D01 A;  1EAK A;  3Q82 A;  4KUO A;  5IHV A;  4IBB A;  4CJN A;  5EVI B;  1ESI A;  1XJ3 A;  5B40 B;  1K56 D;  4BLM A;  3TJZ C;  3N8L A;  4DRA A;  1IFQ A;  1TDL A;  1IYQ A;  3KX0 X;  1P3P A;  4C3Q A;  1SCW A;  1O7E A;  1P3G B;  2CV5 C;  3M2J A;  5EEC A;  4DE3 A;  3H9W A;  4Z5T C;  1ID3 A;  1S32 A;  5AJG A;  3EEA A;  3MGQ C;  5AQA A;  1S4R A;  3AV1 C;  4WU9 A;  5HD3 A;  3E4O A;  5B2I D;  3FPW A;  1E25 A;  4NKP A;  5IT5 A;  1XJ4 A;  5AQB A;  1YLZ A;  5B33 C;  1J7M A;  4Z2H A;  4KZA A;  1W2E A;  1VQQ A;  3BJN A;  3MJQ A;  5J3W A;  3ZNT A;  3E2L A;  1JFI B;  2ZLY A;  5FSR A;  2W3G A;  3JVU A;  2G7U A;  4NEE D;  4X25 A;  2G5H C;  1P3O B;  1OT9 A;  3EOI A;  5B24 A;  1KU5 A;  3IX8 A;  4KUD C;  2OV5 A;  5E5A B;  3EGX C;  1F66 D;  4WV4 B;  4XZQ C;  4UUZ A;  4NZ1 A;  1LSV A;  3SS5 A;  3LEZ A;  3MXS A;  3FC7 A;  4AWL B;  5B2I C;  5A92 A;  4P87 A;  1CF0 A;  1P3K A;  1GSV A;  5DNN C;  1MWT A;  2D02 A;  4X23 B;  4KZ8 A;  4XUZ A;  2GX5 A;  1T3U A;  2HZ5 A;  5M1A A;  3UDI A;  2W3H A;  5GLC A;  5TBM A;  1H8Y A;  5B1M D;  4J8V A;  5FI7 A;  2HP6 A;  4NYY A;  3KO6 A;  3RTY A;  4LRY C;  3N6I A;  4YM6 C;  4OQ0 A;  3T4K A;  3R45 B;  5CEB A;  3HJI A;  1F66 C;  3PAE A;  4D60 A;  3H0L C;  1P0Z A;  3MGQ A;  3LI8 A;  4HY8 A;  2UWX A;  5CPI A;  5DNM C;  2YKF A;  2JCH A;  1W8Y A;  1X0O A;  4YIN A;  1VHM A;  1AOI C;  3AZJ D;  1ERM A;  1K0K A;  2X02 A;  4GJ4 A;  5B33 A;  4RX2 A;  1LL9 A;  3T4S A;  5FUG B;  2D49 A;  3VH5 W;  5B31 G;  3LJA B;  1K56 A;  5FI6 A;  1WWI A;  3WS4 A;  3C4P A;  4Q0J A;  3AN2 B;  1YU0 A;  3WKJ D;  4GOG A;  5BT1 D;  1KGG A;  5F68 A;  2Y2H A;  4IBC A;  3BLM A;  5B1M C;  2VZW A;  3VOL A;  1ESU A;  2ZM5 A;  5F5Y A;  4HMC A;  3VH5 A;  4IJE A;  4RQ9 A;  4MEZ A;  3O62 B;  5DJU A;  1E8B A;  3B3X A;  1NLY A;  3NUL A;  1ZKJ A;  3AL0 C;  4G91 B;  5FQM A;  5B2I A;  5CHU A;  1ZLA B;  3P98 A;  4OOM A;  1NZO A;  5F6A A;  3U4L P;  2W3E A;  2Q9N A;  1G5U A;  3LID A;  1UWP X;  5JA4 A;  4S2O A;  3WKJ C;  5BT1 C;  1M19 B;  1NZU A;  1ODV A;  3GQZ A;  3BQ8 A;  4S2K A;  1PWD A;  2EX6 A;  5F99 B;  3B0C T;  4YFM A;  4N9L A;  4CAY A;  1OGG A;  4GKU A;  1FOF A;  1N4O A;  4I3A A;  2P9V A;  1F66 A;  5HFO A;  4J8U D;  1ID3 B;  1S32 B;  5JYO A;  3W96 C;  2WK0 A;  3AZN D;  3G6O A;  1H0M A;  3A3D A;  1H0G A;  2F8N D;  4RYE A;  4NZ3 A;  2NUP C;  3UME A;  1BTL A;  1EQZ D;  3O88 A;  3ITB A;  5E43 A;  3FKE A;  5TFQ A;  3IP4 C;  4GH9 A;  3ZHH A;  5E2G A;  3LR3 A;  2H10 A;  5B1M A;  1VM1 A;  2V20 A;  2ZOI A;  2HIO D;  2ZM8 A;  4DDS A;  2E8I A;  2ZL1 A;  4EER A;  4IBE A;  5HAR A;  5JYP A;  5M19 A;  3X1S B;  2DRW A;  1ES5 A;  1TS0 A;  2W27 A;  4R8P D;  4LRZ E;  1BH8 B;  5B2J D;  5F1F A;  5L07 A;  1P34 D;  2BG1 A;  3AZN C;  3FYZ A;  3AZJ A;  4R3J A;  2MJ6 A;  2LB5 A;  4GN2 A;  3TOI A;  4Q0I A;  5AV5 B;  1F1E A;  5EOE A;  3UO9 A;  3A3F A;  2PYO D;  3O86 A;  3V3S A;  1MKM A;  5GHZ A;  3W97 A;  2E8J A;  4HH3 A;  5F69 A;  2DCF A;  3CHW P;  3WKJ A;  1OTE A;  3FWL A;  1UR9 A;  1M18 D;  5TBM B;  1ZC2 A;  5DJT A;  3T4Q A;  2HIO C;  4R38 A;  2V2F F;  3NIA A;  1D7E A;  1OTI A;  3SH8 A;  3T1R A;  2EWW A;  5B31 A;  3REI B;  4GHI B;  1NJ4 A;  5DTK A;  3AV2 B;  1NYY A;  5B2J C;  1S4S A;  3V9R A;  1P34 C;  4WZ5 C;  4G92 B;  3T1X A;  1MWU A;  5CPI B;  4HOI A;  2J80 A;  5DFX A;  4E3K A;  2XEP A;  1TD5 A;  3AGD A;  5BS7 A;  5BO0 B;  1TS7 A;  3D9Y A;  3WTP A;  2DNS A;  4H9S C;  1M18 C;  4FUW A;  3W2Z A;  3Q7V A;  3HLE A;  4DDY A;  2HDR A;  4PM8 A;  4J8X D;  4J8U A;  3HLB A;  3MQ0 A;  4HBT A;  4DXC A;  1YU1 A;  3HLG A;  2WGW B;  4LV2 A;  3VP1 A;  3AZN A;  1P3M B;  2F8N A;  3T12 B;  3HLC A;  1KX5 C;  4H9P A;  1U35 D;  4MB4 A;  1EQZ A;  3KWQ C;  2VV6 A;  1W8Q A;  1P3A D;  1SKF A;  3UB6 A;  5J7E A;  1UR8 A;  2A24 B;  3IF6 C;  3VSL A;  5GXQ D;  4DE1 A;  5JA4 B;  2V0U A;  2HIO A;  3W4O A;  1R4V A;  2Q0O A;  1F2K A;  1H3Q A;  2X71 A;  3SW1 A;  3OPP A;  4CAY B;  5EVI D;  1I2W A;  4OOL A;  4Y0T A;  5B40 D;  4R8P A;  3UE3 A;  3WD1 A;  2L1M A;  2P9V B;  5B2J A;  1GOI A;  4R4R A;  3L29 A;  1DP9 A;  4K0W A;  5C3I C;  3CI6 A;  1KE4 A;  4B88 A;  4DQY B;  3KXB B;  1P3G D;  1U35 C;  3HUM A;  4YWZ A;  3MBZ A;  4GDN A;  2PYO A;  1P3A C;  3WRT A;  1H5X A;  1BUL A;  3P7N A;  2GZA A;  1IYS A;  4NXE A;  5AY8 B;  3TSG A;  3BFC A;  2KX6 A;  1BLP A;  2WGI A;  3TU4 A;  2WZX A;  4FCF A;  5B40 C;  2EA9 A;  2HP5 A;  1P9R A;  3KUY B;  2PT7 A;  2B5R A;  4L9F A;  4YNR A;  1YSQ A;  3F1O A;  2J7V A;  4P85 A;  3N3F A;  4X55 A;  3IBR A;  1P3O D;  3FG8 A;  4U0T A;  1P3G C;  5E5A D;  3WX7 A;  3IXH A;  3ULF A;  4CQH A;  4YOF A;  4XXR A;  3LUQ A;  3W97 B;  1GHM A;  3AZM B;  3VE4 A;  1MPL A;  2WAF A;  4KZ3 A;  1YU3 A;  4OPY A;  3SH7 A;  1L0F A;  1M6K A;  2HP9 A;  3MGP B;  4EBP A;  3SS3 A;  4GHL A;  4HIA A;  1YLJ A;  4HES A;  2XD5 A;  4BQM A;  2HPB A;  3MKE A;  4J8X A;  4LCM A;  5B31 B;  4HJ4 A;  3P5J B;  1DJA A;  5D3O A;  3V9R B;  4RX3 A;  2WKI A;  3K3D A;  4OJ5 A;  2NQB D;  3P01 A;  4UA9 A;  2V8C A;  3MMH A;  1P3O C;  3L7H A;  3QP1 A;  5GSU B;  1U35 A;  2QYB A;  3GDI A;  4MN7 A;  5E5A C;  2JBF A;  1P3A A;  3T50 A;  1OJG A;  2X01 A;  4ZUX B;  2JKR M;  5GXQ A;  4PM9 A;  5FQJ A;  3GVB A;  3HON A;  5FL3 A;  2JKG A;  5B0Z B;  4AWL C;  3ZDJ A;  1FCM A;  2EWV A;  3NDE A;  5CPK B;  4E3I A;  3WTP B;  3AZK B;  4R6L A;  2VLG A;  4KZ6 A;  3C1B B;  1ERO A;  4X23 C;  5EVI A;  5B40 A;  5CEC A;  3LJA D;  2JN7 A;  3H7W B;  3REK B;  1A7W A;  4U3T A;  1E6R A;  5DVA A;  4Z2I A;  4J8U B;  5J4E A;  4OVD A;  5F1G A;  4M6B A;  3AN2 D;  4OJ6 A;  1XPB A;  4WEK A;  4NE5 A;  2JC7 A;  1TZY B;  4E04 A;  4PMA A;  3TE8 A;  1P3G A;  2EFU A;  3ZG7 B;  3UE0 A;  3F6T A;  5JRG C;  4OLG A;  1EQZ B;  4HBU A;  4EET B;  1TEM A;  4S2N C;  1K4F A;  3D72 A;  5CGW A;  2M7V A;  1LSW A;  1P9W A;  3WS0 A;  3MF0 A;  3A1K A;  1ZLA D;  3AZL B;  1E6P A;  4DRT A;  2EX9 A;  1PIO A;  3LJA C;  4NXF A;  5EM0 A;  1JFI A;  1YU2 A;  1Y54 A;  3OCL A;  4PKY A;  4GZB A;  3AN2 C;  1JNU A;  3BW6 A;  1F9I A;  4N1X A;  4CLC E;  1XX2 A;  1M19 D;  1OPX A;  4F94 A;  2J8Y A;  5F99 D;  1KDS A;  1L0E A;  5L8M A;  2Y2N A;  4KG6 A;  1P3O A;  3LZ0 B;  3B6F B;  3VH6 T;  1SDN A;  3AZF B;  3GR2 A;  1M1A B;  4QD4 A;  3O62 C;  1Z2C B;  2PYO B;  3WD0 A;  2FZ0 A;  3NJA A;  1NRJ A;  1ID3 D;  3MZD A;  4K08 A;  4H9R A;  3B6G C;  4I5S A;  2B02 A;  3IHA A;  3NCK A;  1TF1 A;  4NK3 A;  5G4Z A;  4E44 A;  1ZLA C;  5HAI A;  5FAS A;  2XRN A;  1W63 M;  1PWG A;  1H3O A;  4OJL A;  1V9Y A;  3TU4 B;  3NOP C;  3UB5 P;  3MZE A;  3KFU G;  1ZG6 A;  4GS9 B;  4BBT A;  3DTE A;  3HJK A;  5GLD A;  2NQB A;  3F1O B;  3RH8 B;  4DJ2 A;  4KUK A;  2ZC3 B;  4Y0O A;  3X1S D;  1Q2Q A;  5HAQ A;  1N9L A;  5B1L B;  2W1R A;  2K2N A;  2VJW A;  5HW3 A;  1LT0 A;  1ID3 C;  1S32 C;  4WU9 C;  4N92 A;  4M4X A;  5AV5 D;  4LV0 A;  2ZY4 A;  4ZBJ B;  1GCE A;  2HDQ A;  3HLW A;  3LJA A;  4XT2 B;  1HZO A;  2VX8 A;  5AV9 D;  3AN2 A;  3OOV A;  3OPR A;  3E4Q A;  4BL2 A;  4TX8 A;  2ZBB A;  2ZC7 A;  2OLV A;  3X1S C;  5B24 C;  3TW8 A;  5B0Y B;  1JTD A;  2P08 A;  3UPP A;  5HDS A;  3BFF A;  3REI D;  5L10 A;  1I2S A;  1S66 L;  1XGJ A;  3AV2 D;  2BTF P;  5BNV B;  3UB7 A;  3G35 A;  2J9P A;  4Z1W A;  3KSF A;  2ZMV A;  3C7V A;  3GV9 A;  5CPI D;  1S67 L;  1ZLA A;  3L26 A;  4QHC A;  5AV5 C;  1EI5 A;  3IBJ A;  2KDK A;  2FJ7 B;  4KGC B;  4GB7 A;  5FEF A;  5A91 A;  1PYY A;  3VE3 A;  3VP0 A;  5A93 A;  1M19 A;  4N9K A;  4N1H A;  3QP6 A;  5F99 A;  4WM9 A;  1P3I B;  4OJP A;  4J8V C;  1S1Y A;  3BLS A;  5HWW A;  3SS4 A;  1T1A A;  3IX3 A;  3UE6 A;  3HBR A;  3REI C;  3HLF A;  1FQG A;  3W4Q A;  1ACF A;  1DRM A;  4WNN A;  3WWX A;  1Q9C A;  4LGW A;  1PNE A;  5CPI C;  3UT9 B;  1P3M D;  4U0X A;  1E15 A;  5E2E A;  5HL6 A;  3X1V A;  4IBF A;  2VGL S;  3FKW A;  5U47 A;  1OT6 A;  1LSX A;  2EFX A;  1QME A;  5HPI A;  2VGL M;  3Q07 A;  1BH9 B;  3BWL A;  1RGZ A;  3A3E A;  5KZH A;  1ONH A;  3X1S A;  3LR4 A;  2O99 A;  1H8P A;  1BH8 A;  1WA9 A;  3S1Y A;  5B32 G;  4WUJ A;  3UTB B;  2V1Z A;  1HTZ A;  2QJ7 A;  4H9R B;  3EPH A;  5HPF A;  1DP8 A;  5AV5 A;  3E0Y A;  1K6R A;  3C30 A;  2ZQ9 A;  4NG2 A;  2R9X A;  3KXB D;  3MQO A;  4JKT A;  1K55 A;  1H3O B;  5CX7 A;  2Q9M A;  5CGX A;  1PI5 A;  2Y59 A;  4I38 A;  1HTA A;  5AV9 A;  2V8F A;  4BEN A;  4HP4 A;  4HGA C;  5AY8 D;  4BWI A;  2NQB B;  5DTT A;  2XDM A;  5G49 B;  3LEL B;  4CSR B;  2PBY A;  1BT5 A;  2M7U A;  3REI A;  2RL3 A;  3B33 A;  4GHI A;  2DQN C;  3AV2 A;  3KUY D;  1VEU B;  3WA9 D;  3MXQ A;  4UA6 A;  5A8B A;  2BYK B;  5HDC A;  5HX9 A;  1NYM A;  4RA7 A;  4OQG A;  2WKQ A;  1YLW A;  5EV0 A;  4CPK A;  5BO0 A;  2XFS A;  1U60 A;  1O07 A;  4UA7 A;  5EVE A;  5AQ7 A;  5GL9 A;  3L25 A;  4X53 A;  4E3O A;  1HQ3 A;  2JKR I;  1LI0 A;  4P0M A;  5CED A;  2C6W B;  3W97 D;  3C1C A;  3LR0 A;  4PM5 A;  3AZM D;  5FDH A;  1L0G A;  3IWQ A;  5AY8 C;  1MXO A;  3MGP D;  4H9N B;  3L9K A;  4WZ4 A;  1C3B A;  2XSS A;  4Z66 B;  5B31 D;  3GEC A;  4EUZ A;  5L2F A;  1YU4 A;  2WGW A;  3MNN A;  3MVD B;  1P3M A;  2XH9 A;  3O87 A;  3AZJ C;  3NDG A;  4R3B A;  3LFV A;  5GSU D;  1KS0 A;  2VA0 A;  3LI9 A;  1TAF B;  1ES4 A;  1TVF A;  4WU8 A;  4ZUX D;  2A24 A;  3UB8 A;  3W97 C;  1AIW A;  5B0Z D;  1K25 A;  1IKI A;  5CPK D;  3WTP D;  3HRE A;  4LLO B;  2EX2 A;  1D1J A;  3PBR A;  3AZK D;  4QJG A;  4YS3 A;  1OME A;  3C1B D;  4NE6 A;  3WD4 A;  4BBU A;  5B31 C;  3REK D;  4MLL A;  3B0D B;  2Z6D A;  4K91 A;  4AFI A;  3UNW A;  3MQL A;  4Z2M H;  2O0Y A;  4WNN B;  2J9O A;  4D2O A;  4P6Z S;  1TZY D;  5FAO A;  3REJ B;  3KXB A;  5GSU C;  3X1V B;  4P6Z M;  5BS7 C;  2PD7 A;  4CLC A;  3A6N B;  4ZUX C;  3V50 A;  1T18 A;  4HMD A;  1TDG A;  5CHM A;  3CUE A;  5FEG A;  1K4E A;  1YQS A;  5CPK C;  3WTP C;  3O3V A;  5AY8 A;  1P3B B;  2HF6 A;  4IVI A;  3AZL D;  2KOI A;  1PW8 A;  4Z9Q A;  3MGS B;  3C1B C;  2XGN A;  1SZV A;  3RXW A;  2JE5 A;  4ZBE A;  1V9Z A;  3UPN A;  4KHA B;  3KUY A;  1MY8 A;  3WA9 A;  4J8U C;  4JGR A;  1XJ2 A;  3G4P A;  3IXD A;  1KVM A;  2GDN A;  3MGR D;  1TZY C;  4OP8 A;  3LZ0 D;  3B6F D;  1L2S A;  3AZF D;  4HNB A;  1CI9 A;  1M1A D;  1ES2 A;  4NE3 A;  3X1U D;  1EQZ C;  1W1Y A;  3C8C A;  4BL3 A;  3DAV A;  2IWC A;  4WN5 A;  5AV9 B;  1YT4 A;  3AZM A;  4S2L A;  1P3L D;  4JXV A;  4KQR A;  1BLH A;  3AZL C;  1T1B A;  1FR1 A;  3MGP A;  4JXS A;  2XFT A;  4KQO A;  3OZH A;  3FV7 A;  4Z2J A;  1YLY A;  3TU4 D;  1CEF A;  2JSS A;  1H0I A;  4R8P C;  5BPV A;  3EWK A;  1EW0 A;  2FH5 A;  3BFD A;  4MCW A;  4QPR A;  3VH5 T;  3G30 A;  5GT0 A;  1KDW A;  4H8R A;  5CTM A;  1P3F D;  3B6F C;  1MBL A;  4X56 A;  5GSU A;  3AZF C;  2V0W A;  3WD3 A;  5B1L D;  2HUE C;  3ZG9 B;  4ZUX A;  2PYO C;  3EQU A;  3ZG5 A;  5AVF A;  1HQ3 B;  2CV5 B;  1YMS A;  2IO5 B;  5B0Z A;  3NEC A;  3UTA D;  2WZZ A;  3P09 A;  3C1C B;  5CPK A;  4IBR A;  3S7P A;  4EEU A;  4G3W A;  3AZK A;  3WRZ A;  3W99 A;  5HZH A;  3AV1 B;  1L6J A;  1BUE A;  1XKZ A;  3C1B A;  3IS2 A;  1GSW A;  2INW A;  3F1P A;  3TU4 C;  5L09 A;  3H7W A;  1XJ6 A;  3REK A;  4E6X A;  3V39 A;  1DP6 A;  1S1Z A;  3C38 A;  1GXD A;  4DRB A;  4R23 A;  4GW9 A;  2VQR A;  1TZY A;  3MNN B;  1CK3 A;  4MBH A;  4L9E A;  1IEM A;  4X1L A;  5B0Y D;  1WE4 A;  3A0V A;  1MZU A;  2V5O A;  5B1L C;  3CIT A;  3H82 B;  4I3I A;  4WU8 B;  2ZQA A;  4KUD B;  3MSH A;  2Z2L B;  5HL1 A;  4XZQ B;  3N4I A;  3AZL A;  3NQJ B;  5AVC A;  2Y91 A;  1N1J A;  2FJ7 D;  4YS3 B;  4KGC D;  4ZBJ C;  1ES3 A;  2HJ9 C;  4BBV A;  1J3W A;  3A1I A;  1YSP A;  4Y5F A;  4J8X C;  1XFQ A;  5DNN B;  5AVB A;  4Q8I A;  2W1T B;  3MGR A;  4Z2L A;  3B42 A;  3I7J A;  1P3I D;  1XP4 A;  3NQU B;  3LZ0 A;  3B6F A;  4HME A;  1XA1 A;  3EPJ A;  3AZF A;  1YKD A;  1M1A A;  2J3W A;  5B0Y C;  2W0N A;  3X1U A;  4GD6 A;  4KZ7 A;  3ZFZ A;  4CLC B;  3FKV A;  2P04 A;  1CEG A;  3REL B;  5GXQ C;  5B32 B;  3W98 A;  1SDE A;  1P3L A;  3CWF A;  2VK3 A;  3UT9 D;  2OLU A;  2JKT M;  5EE8 A;  2XK1 A;  5CP6 B;  2IOU A;  2ZQ8 A;  3V5M A;  5DNM B;  3X1T D;  2OAQ 1;  3PTE A;  4KGC C;  3UY6 A;  1T1C A;  4OKP A;  3OBF A;  1AOI B;  2VV7 A;  5EVI C;  1K57 A;  3QNC A;  1W1P A;  4OQH A;  4RVA A;  5AV6 D;  5GLA A;  2ZY2 A;  3MFX A;  4GS9 A;  1N9B A;  3BYD A;  4GD8 A;  3WA9 B;  1DJB A;  5HWV A;  3AZE D;  3KYZ A;  3RJU A;  3G31 A;  5CHL B;  4Z2G A;  1ZHH B;  3PBQ A;  1P3F A;  1BYW A;  1P3I C;  3IQA A;  3FZC A;  2L4R A;  1NWZ A;  4IBG A;  5B1L A;  4ZJ3 A;  3IX4 A;  2BAS A;  1HLU P;  4G3K A;  2Y2M A;  3UTA A;  1ALQ A;  3UTB D;  1PWC A;  3GMW A;  4IJG A;  3H0M C;  3UT9 C;  4ZDX A;  4LV1 A;  2H5S A;  3N8S A;  5FAP A;  4E3N A;  1ONG A;  3VH6 A;  5AVE A;  4JF5 A;  3GTC A;  3MKF A;  4XT2 A;  3KYE A;  4NET A;  3FDD A;  5TGF A;  2FN2 A;  1DJC A;  1PZP A;  1PW1 A;  1W1T A;  4PAU A;  2Y2J A;  5GT0 B;  2EXA A;  3LR5 A;  2L5A A;  3A3J A;  5LBR A;  2Y2K A;  5M18 A;  1IYP A;  4NZ4 A;  1PFL A;  2Y2L A;  4UPK A;  3LEL D;  2QKP A;  5EM1 A;  5B0Y A;  4IUK A;  3V3R A;  3CMZ A;  4GLQ A;  4EV4 A;  4QLC B;  3UMD A;  5GHY A;  4B4X A;  5BNV A;  3IWI A;  3A0R A;  3T4J A;  2O9C A;  5G18 A;  2K7S A;  1CI8 A;  3S7N A;  3UPO A;  4FSF A;  1BSG A;  4MN5 A;  3W99 B;  3UB9 A;  2FJ7 A;  4KGC A;  3IS2 B;  2ZMF A;  4XUJ B;  3F1P B;  4Q0H A;  1K38 A;  5AQ9 A;  1P97 A;  3LGO A;  5HSQ A;  2J8P A;  1P3I A;  2NQB C;  1AWI A;  5CER A;  4Z2M G;  4DF6 A;  4QU3 A;  2YKH A;  4HHD A;  3LIF A;  4Z66 D;  2HDS A;  2UV0 E;  1SKO B;  1CJF A;  2RCX A;  2NZD B;  5BNX B;  4LPZ A;  4JJN B;  3UT9 A;  3NI9 A;  3MVD D;  4MMN A;  5I94 A;  4WMC D;  3X1T A;  5AVC B;  3AZI D;  1N1J B;  4LG2 A;  5EFW A;  3NHQ A;  1JWP A;  4OH0 A;  1KGF A;  4EBL A;  3BY9 A;  2A2L A;  3HCY A;  3PR6 A;  5F83 A;  5AV6 A;  3QHY A;  1BH9 A;  2PAV P;  1TS8 A;  1W7F A;  2PRF A;  5AVB B;  3AZE A;  3HL9 A;  4J8W B;  1SHV A;  1ZTU A;  3MGR B;  2YFW B;  4JGP A;  4P6B A;  1FIK A;  3T4O A;  4Z66 C;  1UWN X;  3X1U B;  3G2Y A;  2VGK A;  5CRF A;  3W4P A;  5IU1 A;  3LZ1 B;  3UTB A;  4G91 C;  2WAD A;  3W98 B;  1P3L B;  1KX3 D;  2QMI A;  3EPL A;  1BLC A;  4L0L A;  1L3L A;  3REJ D;  3BEC A;  2WKH A;  2F8N H;  4LV3 A;  3AZG B;  3X1V D;  3NBL A;  1E4D A;  1YLT A;  5TJJ A;  3A6N D;  1QMF A;  4NXG A;  3T1Q B;  4JBF A;  2WGV A;  1NY0 A;  1K54 A;  1DY6 A;  2OAP 1;  1M19 C;  5BOH A;  1OTA A;  1P3B D;  3IXG A;  1KGE A;  5F99 C;  1P3F B;  5DF9 A;  1K6S A;  5G49 A;  3MGS D;  3LEL A;  4CSR A;  2HV1 A;  4EEP A;  3B0D C;  3B47 A;  4LD9 A;  1VEU A;  3IXB A;  2BYK A;  5TR7 A;  4EBN A;  1Q2P A;  4KG5 A;  4Y3I A;  2I9V A;  3AYW A;  3UTA B;  1TS6 A;  4ZJ2 A;  3REJ C;  1Y28 A;  1QO6 A;  2CC1 A;  4OQI A;  2OWH A;  2IWD A;  3X1V C;  4JXG A;  4OJO A;  3A6N C;  4QY5 A;  2XRO A;  2PBD P;  2QPN A;  3PBO A;  3KWQ B;  5FAT A;  3C2W A;  3S7O A;  5FAQ A;  4KQQ A;  3BQA A;  1N9N A;  3IF6 B;  3HUN A;  4WEJ A;  3MGS C;  3BFE A;  5AV8 A;  4H9N A;  3NOU C;  2LB9 A;  4Z66 A;  4Z2K A;  3OCN A;  2WKP A;  4IBI A;  4PM6 A;  3M6H A;  4KQD A;  3Q7Z A;  2W3D A;  5KMW A;  3MVD A;  4BD0 A;  4LRX C;  3BFG A;  4WMC A;  4E3L A;  3AZI A;  1TAF A;  2A49 A;  1K55 C;  1KX4 B;  5F82 A;  5C3I B;  3WTP E;  3AFA B;  3M7P A;  1HQ3 D;  3VOY A;  2CV5 D;  4FD8 A;  5FI2 A;  3S7Q A;  5AV9 C;  5CPJ A;  4Y0U A;  4Z5T D;  3C1C D;  2BLS A;  1GA0 A;  4JLF A;  2P74 A;  3AV1 D;  4HJ3 A;  4S2P A;  1RGY A;  1WYC A;  3KSI A;  4Y17 A;  4UAA A;  4FTX A;  3AV2 C;  2WUQ A;  1ERQ A;  4G92 C;  1KX3 A;  3MNN D;  3REJ A;  1OTD A;  3ZGA B;  2ZC6 B;  4C75 A;  1YMX A;  5EUA A;  3DTI A;  2BYM B;  3X1T B;  4C6Y A;  4NFT A;  3A6N A;  4EXO A;  2EX8 A;  4UEY A;  1HQ3 C;  4WU8 D;  3LIB A;  5IS1 A;  5AV6 B;  4KUD D;  4WZS B;  2IO5 C;  2H28 A;  3C1C C;  4BMW A;  2JKT I;  3AZE B;  3AGF A;  5GHX A;  4XZQ D;  1P3B A;  2VV8 A;  2ZOH A;  2QWS A;  3MGS A;  1FCN A;  1BLS A;  4OPZ A;  3B0C W;  4YS3 D;  4ME4 A;  2KLI A;  4R4S A;  5DFY A;  4EQI A;  4GNU A;  4KHA A;  5DNN D;  2ZM0 A;  5G4Y A;  4WEL A;  5CGS A;  3MNN C;  1P3M C;  3QNB A;  2I72 A;  4ESP A;  4Y2F A;  4ARZ B;  4CLC D;  3OLO A;  2YFV B;  4WU8 C;  1LL8 A;  3U2A A;  3REL D;  2ARO A;  4YM6 D;  4MN6 A;  5B32 D;  3O5Y A;  5KDM B;  5DF7 A;  3NOT C;  4DE0 A;  1VET B;  2WKR A;  5CP6 D;  4HEF A;  3PBT A;  3WAA A;  5DNM D;  4G3V A;  4YS3 C;  3REH A;  4IBJ A;  3LO7 A;  1AOI D;  2ACG A;  2PHY A;  4EO5 B;  1KE3 A;  1NLZ A;  3G34 A;  2IA2 A;  2Y2Q A;  4LD9 B;  2Y8H A;  3C4O A;  3AYW B;  4KZ9 A;  4X68 A;  2Y55 A;  1CQA A;  5KIZ A;  1ZG4 A;  3KXB C;  4IBX A;  3VP3 A;  5HAP A;  2V1B A;  4FOF A;  3UN7 A;  4IBK A;  4CLC C;  4A5R A;  1Z09 A;  1OGB A;  3REL C;  2CV5 A;  4HP9 A;  3EEH A;  5B32 C;  5JRG B;  4Z5T A;  3CUE C;  1Y4O A;  5GT3 B;  2XLN A;  1PRQ A;  4JGQ A; 
#chains in the Genus database with same CATH homology
 5CP6 C;  2G2U A;  4H9O A;  3AV1 A;  5FQI A;  1W5D A;  5AV8 B;  3L27 A;  2H0T A;  3HLD A;  1RCJ A;  3L2A A;  1FCO A;  3CJM A;  3KUY C;  1IYO A;  3WA9 C;  3AZH B;  3ISG A;  4QY6 A;  5GT0 D;  1S0W A;  2ZJ9 A;  3AZI B;  4E3J A;  4QLC D;  1FR6 A;  5E2H A;  2VGJ A;  4KUD A;  1YUE A;  1E3U D;  3PBN A;  3ZCZ A;  3IHB A;  5CPJ B;  3AZM C;  4XZQ A;  3NQJ A;  3MGP C;  3W96 D;  3B6G B;  3W99 D;  3IH8 A;  4GDB A;  1B67 A;  1L0D A;  1HD8 A;  4XUJ D;  5DNN A;  5GT0 C;  1KX3 B;  3NQU A;  1FSW A;  5DTS A;  2Z2M B;  4JPM A;  4QLC C;  4MBK A;  1P3P B;  2F8N G;  3G2Z A;  3REL A;  4YM6 A;  2NZD D;  5B32 A;  2ZY5 A;  5EOO A;  5B0Z C;  4JJN D;  4ZAM A;  3BEB A;  5CP6 A;  3AZK C;  5DNM A;  3W99 C;  5AVC D;  4WU9 B;  1AOI A;  3MZF A;  4XUJ C;  3E2K A;  4IED A;  3REK C;  3HUO A;  5AVB D;  2HDU A;  3EG5 B;  4J8W D;  1XGI A;  3BRM A;  4BJP A;  2XR0 A;  2ZD8 A;  3UE1 A;  2XD1 A;  2WKE A;  3DWK A;  3M6B A;  4X6T A;  5B24 B;  3LZ1 D;  2NZD C;  2ARO B;  3VP4 A;  4JJN C;  3VP2 A;  3W98 D;  1LHY A;  4UUZ B;  5AVC C;  3WAA B;  3AZG D;  4NZ5 A;  3Q81 A;  5DF8 A;  3REH B;  4DKI A;  1H8Z A;  1P3K B;  5E2F A;  5AVB C;  2H0Y A;  3A3I A;  3CZD A;  4J8W C;  3HVF A;  3MGR C;  4LEN A;  3AGE A;  3LZ0 C;  3NY4 A;  4OUI A;  1M1A C;  4S2I A;  3LY4 A;  1M40 A;  3X1U C;  4QLC A;  4J8V B;  1MWS A;  2Y2O A;  3LZ1 C;  1E3U A;  3W98 C;  1P3L C;  3PAG A;  4Z5T B;  1IEL A;  5KSC A;  5A90 A;  3MGQ B;  3W96 A;  4H9O B;  3AZG C;  5EPH A;  3WS1 A;  4JXW A;  4XUJ A;  1KE0 A;  3C7U A;  3OPL A;  1K57 C;  3KSY A;  5B33 B;  1KX5 D;  3KWQ D;  2WYX A;  4MNR A;  4MBF A;  1P3F C;  4K0X A;  1NRF A;  4H9Q A;  2NZD A;  5BNX A;  2IWB A;  4JJN A;  3UTA C;  1G68 A;  2EXB A;  1PZO A;  4ZTK A;  4UHU A;  3UDX A;  3ZVT A;  1B6W A;  5B2I B;  3NC8 A;  1KX4 D;  3ITA A;  1JVJ A;  3AFA D;  4IVK A;  4R0Q A;  4IJF A;  2W8S A;  4J8W A;  1MWR A;  4KG2 A;  2F2A C;  4OPQ A;  2YFW A;  1GA9 A;  1W79 A;  4HGA B;  3IT9 A;  4GHA A;  4S2M A;  3LZ1 A;  4YM6 B;  3BM6 A;  2ZQ7 A;  1F66 B;  2FFF B;  4IBD A;  2XF3 A;  1P34 A;  4WZ5 A;  3AZG A;  4X69 A;  3H0R C;  2FJ7 C;  4B4Z A;  1KX4 C;  2OSU A;  3G32 A;  4KZ4 A;  3AFA C;  5CHJ A;  1JWV A;  3KS4 A;  5GLB A;  3OPH A;  2RVQ D;  4PPR A;  3KS8 A;  4H9S A;  1M18 A;  2F8N K;  1KVL A;  4WJ3 C;  5B1M B;  3VH6 W;  2Y4A A;  3ZVW A;  3DTM A;  3OC2 A;  3X1T C;  4JF6 A;  2R9W A;  3VOZ A;  3ZG0 A;  3AZJ B;  2PU4 A;  1RP5 A;  1KX5 A;  2DF4 C;  5AV6 C;  3KWQ A;  3M2K A;  3MXR A;  3N8R A;  4KEN B;  3AZE C;  1LLB A;  2RVQ C;  4PM7 A;  3IF6 A;  3DW0 A;  4XUX A;  3S22 A;  3WKJ B;  3GRJ A;  5FQK A;  3VFH A;  4NYU A;  4EWF A;  5FQ9 A;  3HSH A;  4LD9 D;  4X23 D;  2ZQC A;  4ZJ1 A;  3UTB C;  3LCE A;  3AYW D;  1XXM A;  1LL5 A;  3TG9 A;  3W8K A;  3CG5 A;  4FH2 A;  1GHP A;  2RIQ A;  3GSG A;  3W96 B;  1KX4 A;  5KSH A;  1GHI A;  5FQQ A;  3AFA A;  3D4F A;  4OP5 A;  3SH9 A;  2ZM2 A;  5JRG D;  4OLD A;  5GT3 D;  1K54 C;  1S6R A;  1JWZ A;  2ZY3 A;  1XA7 A;  4LCL A;  3VFF A;  3LEL C;  5AV8 D;  4KZB A;  3N7W A;  4EO5 C;  2ZC4 B;  3Q7V B;  4LD9 C;  2G2W A;  4H9Q B;  3AZH D;  2LY8 A;  4E3M A;  3AYW C;  3VMA A;  3JYI A;  3PBS A;  5CTN A;  2BYM A;  3AZN B;  3EPK A;  2F8N B;  2XQZ A;  4H9P B;  3WS5 A;  5CPJ D;  5GT3 C;  3O62 D;  4S2J A;  1FSY A;  1EWZ A;  4BD1 A;  1ULY A;  3B6G D;  1Z6F A;  2ZQD A;  5AV8 C;  1YM1 A;  3IF5 A;  4ID4 A;  2HIO B;  4WBG A;  3AZH C;  3RXX A;  1LI9 A;  4R8P B;  3SOI A;  3MVD C;  4OOY A;  5B2J B;  1P34 B;  3AZI C;  3LY3 A;  4WYY A;  2YFV A;  1P3P D;  1JTG A;  3B0B A;  2Y2G A;  1IKG A;  1PI4 A;  1WYB A;  5E5A A;  5EVL A;  5KDM A;  5CPJ C;  2HUE B;  3Q1F A;  3S4X A;  3UDF A;  2QZ6 A;  1S32 D;  4JF4 A;  3IH9 A;  4DXB A;  1HVB A;  4WU9 D;  1MKI A;  1M18 B;  2PU2 A;  2ZC5 B;  4Y7P A;  4X23 A;  4OON A;  1KX3 C;  3EQV A;  3MFD A;  1BZA A;  3VSK A;  1BFM A;  2CWE A;  1I5Q A;  4KZ5 A;  2G5I C;  1P3P C;  4E45 A;  2ZMA A;  3R45 A;  5B24 D;  1KX5 B;  2ARO D;  1J9M A;  5JRG A;  3IWO A;  5GT3 A;  4S2N A;  1P3B C;  3ZNY A;  4E6W A;  3WAA D;  3C5A A;  4R1G A;  3REH D;  3WS2 A;  4NY2 A;  1PZR A;  1P3K D;  4FH4 A;  1NXY A;  3AZH A;  5FUG A;  4DE2 A;  4O7D A;  4J8X B;  2Y2P A;  1G6A A;  2C5W B;  3ZG8 B;  1AXB A;  4QNL A;  5CXW A;  1WWS A;  2Y2I A;  4J8V D;  4OPR A;  2ARO C;  1U35 B;  3O62 A;  1P3A B;  2WAE A;  3DWZ A;  4M3K A;  4QB8 A;  3MGQ D;  5GXQ B;  3B6G A;  3WAA C;  2A3U A;  5FA7 A;  2FFY A;  1YLP A;  3REH C;  5J8X A;  3L28 A;  5B33 D;  1P3K C;  3Q82 A;  5IHV A;  4IBB A;  4CJN A;  5EVI B;  1ESI A;  5B40 B;  1K56 D;  4BLM A;  3N8L A;  4DRA A;  1TDL A;  1IYQ A;  1P3P A;  4C3Q A;  1SCW A;  1O7E A;  1P3G B;  2CV5 C;  3M2J A;  5EEC A;  4DE3 A;  4Z5T C;  1ID3 A;  1S32 A;  3MGQ C;  5AQA A;  3AV1 C;  4WU9 A;  5B2I D;  1E25 A;  5AQB A;  1YLZ A;  5B33 C;  4KZA A;  1W2E A;  1VQQ A;  3ZNT A;  3E2L A;  1JFI B;  2ZLY A;  5FSR A;  2G5H C;  1P3O B;  5B24 A;  1KU5 A;  4KUD C;  2OV5 A;  5E5A B;  1F66 D;  4WV4 B;  4XZQ C;  4UUZ A;  4NZ1 A;  3SS5 A;  3LEZ A;  3MXS A;  4AWL B;  5B2I C;  5A92 A;  4P87 A;  1P3K A;  5DNN C;  1MWT A;  4X23 B;  4KZ8 A;  4XUZ A;  1T3U A;  5M1A A;  3UDI A;  5GLC A;  1H8Y A;  5B1M D;  4J8V A;  5FI7 A;  2HP6 A;  4NYY A;  3N6I A;  4YM6 C;  4OQ0 A;  3R45 B;  5CEB A;  1F66 C;  3PAE A;  3H0L C;  3MGQ A;  2UWX A;  5CPI A;  5DNM C;  2JCH A;  1W8Y A;  4YIN A;  1AOI C;  3AZJ D;  1ERM A;  2X02 A;  5B33 A;  4RX2 A;  1LL9 A;  5FUG B;  3VH5 W;  5B31 G;  3LJA B;  1K56 A;  5FI6 A;  1WWI A;  3WS4 A;  3C4P A;  3AN2 B;  1YU0 A;  3WKJ D;  4GOG A;  5BT1 D;  1KGG A;  2Y2H A;  4IBC A;  3BLM A;  5B1M C;  1ESU A;  2ZM5 A;  3VH5 A;  4IJE A;  4MEZ A;  3O62 B;  3B3X A;  1ZKJ A;  3AL0 C;  4G91 B;  5FQM A;  5B2I A;  5CHU A;  1ZLA B;  3P98 A;  4OOM A;  1NZO A;  2Q9N A;  5JA4 A;  4S2O A;  3WKJ C;  5BT1 C;  1M19 B;  1NZU A;  3GQZ A;  4S2K A;  1PWD A;  2EX6 A;  5F99 B;  3B0C T;  4YFM A;  4N9L A;  4CAY A;  4GKU A;  1FOF A;  1N4O A;  2P9V A;  1F66 A;  5HFO A;  4J8U D;  1ID3 B;  1S32 B;  5JYO A;  3W96 C;  2WK0 A;  3AZN D;  3A3D A;  2F8N D;  4RYE A;  4NZ3 A;  1BTL A;  1EQZ D;  3O88 A;  3ITB A;  5E43 A;  3FKE A;  5TFQ A;  3IP4 C;  4GH9 A;  3ZHH A;  5E2G A;  2H10 A;  5B1M A;  1VM1 A;  2V20 A;  2HIO D;  2ZM8 A;  4DDS A;  2E8I A;  4IBE A;  5HAR A;  5JYP A;  5M19 A;  3X1S B;  2DRW A;  1ES5 A;  4R8P D;  1BH8 B;  5B2J D;  5F1F A;  1P34 D;  2BG1 A;  3AZN C;  3FYZ A;  3AZJ A;  4R3J A;  4GN2 A;  3TOI A;  5AV5 B;  1F1E A;  5EOE A;  3UO9 A;  3A3F A;  2PYO D;  3O86 A;  3V3S A;  5GHZ A;  3W97 A;  2DCF A;  3WKJ A;  3FWL A;  1M18 D;  1ZC2 A;  2HIO C;  2V2F F;  3NIA A;  3SH8 A;  5B31 A;  3REI B;  1NJ4 A;  5DTK A;  3AV2 B;  1NYY A;  5B2J C;  3V9R A;  1P34 C;  4WZ5 C;  4G92 B;  1MWU A;  5CPI B;  4E3K A;  2XEP A;  3AGD A;  5BS7 A;  5BO0 B;  3WTP A;  2DNS A;  4H9S C;  1M18 C;  3Q7V A;  3HLE A;  4DDY A;  2HDR A;  4PM8 A;  4J8X D;  4J8U A;  3HLB A;  4HBT A;  4DXC A;  1YU1 A;  3HLG A;  2WGW B;  4LV2 A;  3VP1 A;  3AZN A;  1P3M B;  2F8N A;  3HLC A;  1KX5 C;  4H9P A;  1U35 D;  1EQZ A;  3KWQ C;  1W8Q A;  1P3A D;  1SKF A;  3IF6 C;  3VSL A;  5GXQ D;  4DE1 A;  5JA4 B;  2HIO A;  3W4O A;  1R4V A;  2X71 A;  3OPP A;  4CAY B;  5EVI D;  1I2W A;  4OOL A;  4Y0T A;  5B40 D;  4R8P A;  3UE3 A;  2P9V B;  5B2J A;  4R4R A;  3L29 A;  4K0W A;  5C3I C;  1KE4 A;  4B88 A;  4DQY B;  3HUM A;  3KXB B;  1U35 C;  1P3G D;  3MBZ A;  4GDN A;  2PYO A;  1P3A C;  3WRT A;  1H5X A;  1BUL A;  1IYS A;  5AY8 B;  3TSG A;  3BFC A;  1BLP A;  2WGI A;  3TU4 A;  2WZX A;  4FCF A;  5B40 C;  2HP5 A;  3KUY B;  2B5R A;  2J7V A;  4P85 A;  3N3F A;  4X55 A;  1P3O D;  4U0T A;  1P3G C;  5E5A D;  3WX7 A;  3IXH A;  4XXR A;  3W97 B;  1GHM A;  3AZM B;  1MPL A;  2WAF A;  4KZ3 A;  1YU3 A;  4OPY A;  3SH7 A;  1L0F A;  1M6K A;  2HP9 A;  3MGP B;  4EBP A;  3SS3 A;  4GHL A;  1YLJ A;  4HES A;  2XD5 A;  4BQM A;  2HPB A;  3MKE A;  4J8X A;  4LCM A;  5B31 B;  3P5J B;  1DJA A;  5D3O A;  3V9R B;  4RX3 A;  2WKI A;  4OJ5 A;  2NQB D;  4UA9 A;  1P3O C;  5GSU B;  1U35 A;  5E5A C;  2JBF A;  1P3A A;  2X01 A;  4ZUX B;  5GXQ A;  4PM9 A;  5FQJ A;  3GVB A;  3HON A;  3ZDJ A;  5B0Z B;  4AWL C;  1FCM A;  3NDE A;  5CPK B;  4E3I A;  3WTP B;  3AZK B;  4KZ6 A;  3C1B B;  1ERO A;  4X23 C;  5EVI A;  5B40 A;  5CEC A;  3LJA D;  3REK B;  1A7W A;  4U3T A;  5DVA A;  4J8U B;  4OVD A;  5F1G A;  4M6B A;  3AN2 D;  4OJ6 A;  1XPB A;  4WEK A;  4NE5 A;  2JC7 A;  1TZY B;  4PMA A;  1P3G A;  2EFU A;  3ZG7 B;  3UE0 A;  3F6T A;  5JRG C;  4OLG A;  1EQZ B;  4HBU A;  1TEM A;  4S2N C;  1K4F A;  5CGW A;  3WS0 A;  3A1K A;  1ZLA D;  3AZL B;  4DRT A;  2EX9 A;  1PIO A;  3LJA C;  1JFI A;  1YU2 A;  1Y54 A;  3OCL A;  4GZB A;  3AN2 C;  4N1X A;  1XX2 A;  1M19 D;  4F94 A;  2J8Y A;  5F99 D;  1KDS A;  1L0E A;  2Y2N A;  4KG6 A;  1P3O A;  3LZ0 B;  3B6F B;  3VH6 T;  1SDN A;  3AZF B;  3GR2 A;  1M1A B;  4QD4 A;  3O62 C;  1Z2C B;  2PYO B;  1ID3 D;  3MZD A;  4H9R A;  3B6G C;  5HAI A;  3IHA A;  3NCK A;  4NK3 A;  4E44 A;  1ZLA C;  5FAS A;  1PWG A;  1H3O A;  4OJL A;  3TU4 B;  3MZE A;  3KFU G;  1ZG6 A;  5GLD A;  2NQB A;  2ZC3 B;  4Y0O A;  3X1S D;  1Q2Q A;  5HAQ A;  5B1L B;  5HW3 A;  1ID3 C;  1S32 C;  4WU9 C;  4N92 A;  5AV5 D;  4LV0 A;  2ZY4 A;  4ZBJ B;  1GCE A;  2HDQ A;  3HLW A;  3LJA A;  1HZO A;  5AV9 D;  3AN2 A;  3OPR A;  4BL2 A;  2ZC7 A;  2OLV A;  3X1S C;  5B24 C;  5B0Y B;  1JTD A;  3UPP A;  3BFF A;  3REI D;  1I2S A;  1XGJ A;  3AV2 D;  5BNV B;  3G35 A;  2J9P A;  3C7V A;  3GV9 A;  5CPI D;  1ZLA A;  3L26 A;  4QHC A;  5AV5 C;  1EI5 A;  2FJ7 B;  4KGC B;  4GB7 A;  5A91 A;  1PYY A;  3VP0 A;  5A93 A;  1M19 A;  4N9K A;  4N1H A;  5F99 A;  4WM9 A;  1P3I B;  4OJP A;  4J8V C;  3BLS A;  3SS4 A;  3HBR A;  3REI C;  3HLF A;  1FQG A;  3W4Q A;  4WNN A;  3WWX A;  1Q9C A;  5CPI C;  3UT9 B;  1P3M D;  4U0X A;  5E2E A;  3X1V A;  4IBF A;  3FKW A;  5U47 A;  2EFX A;  1QME A;  3Q07 A;  1BH9 B;  1RGZ A;  3A3E A;  5KZH A;  1ONH A;  3X1S A;  1BH8 A;  3S1Y A;  5B32 G;  3UTB B;  2V1Z A;  1HTZ A;  4H9R B;  3EPH A;  5AV5 A;  1K6R A;  2ZQ9 A;  2R9X A;  3KXB D;  4JKT A;  1K55 A;  1H3O B;  2Q9M A;  5CGX A;  1PI5 A;  2Y59 A;  1HTA A;  5AV9 A;  4BEN A;  4HGA C;  5AY8 D;  2NQB B;  5DTT A;  2XDM A;  5G49 B;  3LEL B;  4CSR B;  2PBY A;  1BT5 A;  3REI A;  2RL3 A;  2DQN C;  3AV2 A;  3KUY D;  3WA9 D;  4UA6 A;  2BYK B;  5HX9 A;  1NYM A;  4RA7 A;  4OQG A;  1YLW A;  4CPK A;  5BO0 A;  2XFS A;  1U60 A;  1O07 A;  4UA7 A;  5AQ7 A;  5GL9 A;  3L25 A;  4X53 A;  4E3O A;  1HQ3 A;  1LI0 A;  4P0M A;  5CED A;  2C6W B;  3W97 D;  3C1C A;  4PM5 A;  3AZM D;  5FDH A;  1L0G A;  3IWQ A;  5AY8 C;  1MXO A;  3MGP D;  4H9N B;  4WZ4 A;  1C3B A;  4Z66 B;  5B31 D;  4EUZ A;  5L2F A;  1YU4 A;  2WGW A;  3MNN A;  3MVD B;  1P3M A;  2XH9 A;  3O87 A;  3AZJ C;  3NDG A;  4R3B A;  5GSU D;  1TAF B;  1ES4 A;  1TVF A;  4WU8 A;  4ZUX D;  3W97 C;  5B0Z D;  1K25 A;  1IKI A;  5CPK D;  3WTP D;  3HRE A;  2EX2 A;  3PBR A;  3AZK D;  4QJG A;  4YS3 A;  1OME A;  3C1B D;  4NE6 A;  5B31 C;  3REK D;  4MLL A;  3B0D B;  4K91 A;  3UNW A;  4Z2M H;  4WNN B;  2J9O A;  4D2O A;  1TZY D;  5FAO A;  3REJ B;  3KXB A;  5GSU C;  3X1V B;  5BS7 C;  3A6N B;  4ZUX C;  3V50 A;  1TDG A;  5CHM A;  1K4E A;  1YQS A;  5CPK C;  3WTP C;  3O3V A;  5AY8 A;  1P3B B;  4IVI A;  3AZL D;  1PW8 A;  4Z9Q A;  3MGS B;  3C1B C;  2XGN A;  3RXW A;  2JE5 A;  4ZBE A;  3UPN A;  4KHA B;  3KUY A;  1MY8 A;  3WA9 A;  4J8U C;  3G4P A;  3IXD A;  1KVM A;  2GDN A;  3MGR D;  1TZY C;  4OP8 A;  3LZ0 D;  3B6F D;  1L2S A;  3AZF D;  1CI9 A;  1M1A D;  1ES2 A;  4NE3 A;  3X1U D;  1EQZ C;  4BL3 A;  2IWC A;  5AV9 B;  1YT4 A;  3AZM A;  4S2L A;  1P3L D;  4JXV A;  4KQR A;  1BLH A;  3AZL C;  1FR1 A;  3MGP A;  4JXS A;  2XFT A;  4KQO A;  3OZH A;  3FV7 A;  1YLY A;  3TU4 D;  1CEF A;  2JSS A;  5BPV A;  4R8P C;  3BFD A;  3VH5 T;  3G30 A;  5GT0 A;  1KDW A;  4H8R A;  5CTM A;  1P3F D;  3B6F C;  1MBL A;  4X56 A;  5GSU A;  3AZF C;  5B1L D;  2HUE C;  3ZG9 B;  4ZUX A;  2PYO C;  3EQU A;  3ZG5 A;  1HQ3 B;  2CV5 B;  1YMS A;  2IO5 B;  5B0Z A;  3UTA D;  2WZZ A;  3P09 A;  3C1C B;  5CPK A;  4IBR A;  3AZK A;  3WRZ A;  3W99 A;  3AV1 B;  1BUE A;  1XKZ A;  3C1B A;  3TU4 C;  3REK A;  4E6X A;  3V39 A;  4DRB A;  4R23 A;  2VQR A;  1TZY A;  3MNN B;  1CK3 A;  4MBH A;  1IEM A;  5B0Y D;  1WE4 A;  5B1L C;  2ZQA A;  4WU8 B;  4KUD B;  2Z2L B;  5HL1 A;  4XZQ B;  3N4I A;  3AZL A;  3NQJ B;  5AVC A;  2Y91 A;  1N1J A;  2FJ7 D;  4YS3 B;  4KGC D;  4ZBJ C;  1ES3 A;  3A1I A;  4J8X C;  5DNN B;  5AVB A;  4Q8I A;  3MGR A;  3I7J A;  1P3I D;  1XP4 A;  3NQU B;  3LZ0 A;  3B6F A;  1XA1 A;  3EPJ A;  3AZF A;  1M1A A;  5B0Y C;  3X1U A;  4GD6 A;  4KZ7 A;  3ZFZ A;  3FKV A;  1CEG A;  3REL B;  5GXQ C;  5B32 B;  3W98 A;  1SDE A;  1P3L A;  3UT9 D;  2OLU A;  5EE8 A;  2XK1 A;  5CP6 B;  2IOU A;  2ZQ8 A;  3V5M A;  5DNM B;  3X1T D;  3PTE A;  4KGC C;  3UY6 A;  4OKP A;  1AOI B;  5EVI C;  1K57 A;  3QNC A;  4RVA A;  4OQH A;  5AV6 D;  5GLA A;  2ZY2 A;  1N9B A;  3BYD A;  4GD8 A;  3WA9 B;  1DJB A;  3AZE D;  3RJU A;  3G31 A;  5CHL B;  3PBQ A;  1P3F A;  1P3I C;  3IQA A;  3FZC A;  4IBG A;  5B1L A;  4ZJ3 A;  2Y2M A;  3UTA A;  1ALQ A;  3UTB D;  1PWC A;  3GMW A;  3H0M C;  3UT9 C;  4ZDX A;  4LV1 A;  2H5S A;  3N8S A;  5FAP A;  4E3N A;  1ONG A;  3VH6 A;  4JF5 A;  3GTC A;  3MKF A;  4NET A;  3FDD A;  5TGF A;  1DJC A;  1PZP A;  1PW1 A;  2Y2J A;  5GT0 B;  2EXA A;  2L5A A;  3A3J A;  2Y2K A;  5M18 A;  1IYP A;  4NZ4 A;  2Y2L A;  4UPK A;  3LEL D;  5B0Y A;  3V3R A;  3CMZ A;  4EV4 A;  4QLC B;  5GHY A;  4B4X A;  5BNV A;  3IWI A;  5G18 A;  1CI8 A;  3UPO A;  4FSF A;  1BSG A;  3W99 B;  2FJ7 A;  4KGC A;  4XUJ B;  1K38 A;  5AQ9 A;  2J8P A;  1P3I A;  2NQB C;  4DF6 A;  5CER A;  4Z2M G;  4QU3 A;  4Z66 D;  2HDS A;  2RCX A;  2NZD B;  5BNX B;  4JJN B;  3UT9 A;  3NI9 A;  3MVD D;  5I94 A;  4WMC D;  3X1T A;  5AVC B;  3AZI D;  1N1J B;  4LG2 A;  1JWP A;  4OH0 A;  1KGF A;  4EBL A;  5F83 A;  5AV6 A;  3QHY A;  1BH9 A;  1W7F A;  5AVB B;  3AZE A;  3HL9 A;  4J8W B;  1SHV A;  3MGR B;  2YFW B;  4P6B A;  4Z66 C;  3X1U B;  3G2Y A;  2VGK A;  5CRF A;  3W4P A;  3LZ1 B;  3UTB A;  4G91 C;  2WAD A;  3W98 B;  1P3L B;  1KX3 D;  2QMI A;  3EPL A;  1BLC A;  4L0L A;  3REJ D;  3BEC A;  2WKH A;  2F8N H;  4LV3 A;  3AZG B;  3X1V D;  3NBL A;  1E4D A;  1YLT A;  3A6N D;  1QMF A;  4JBF A;  2WGV A;  1NY0 A;  1K54 A;  1DY6 A;  1M19 C;  5BOH A;  1P3B D;  3IXG A;  1KGE A;  5F99 C;  1P3F B;  5DF9 A;  1K6S A;  5G49 A;  3MGS D;  3LEL A;  4CSR A;  3B0D C;  4LD9 A;  3IXB A;  2BYK A;  5TR7 A;  4EBN A;  1Q2P A;  4KG5 A;  3AYW A;  3UTA B;  4ZJ2 A;  3REJ C;  2CC1 A;  4OQI A;  2IWD A;  3X1V C;  4JXG A;  4OJO A;  3A6N C;  4QY5 A;  2QPN A;  3PBO A;  3KWQ B;  5FAT A;  5FAQ A;  4KQQ A;  3IF6 B;  3HUN A;  4WEJ A;  3MGS C;  3BFE A;  5AV8 A;  4H9N A;  4Z66 A;  3OCN A;  4IBI A;  4PM6 A;  3M6H A;  3Q7Z A;  5KMW A;  3MVD A;  4BD0 A;  3BFG A;  4WMC A;  4E3L A;  3AZI A;  1TAF A;  2A49 A;  1K55 C;  1KX4 B;  5F82 A;  5C3I B;  3WTP E;  3AFA B;  1HQ3 D;  3VOY A;  2CV5 D;  4FD8 A;  5FI2 A;  5AV9 C;  5CPJ A;  4Y0U A;  4Z5T D;  3C1C D;  2BLS A;  1GA0 A;  4JLF A;  2P74 A;  3AV1 D;  4S2P A;  1RGY A;  1WYC A;  4UAA A;  3AV2 C;  2WUQ A;  1ERQ A;  4G92 C;  1KX3 A;  3MNN D;  3REJ A;  3ZGA B;  2ZC6 B;  4C75 A;  1YMX A;  5EUA A;  2BYM B;  3X1T B;  4C6Y A;  4NFT A;  3A6N A;  2EX8 A;  1HQ3 C;  4WU8 D;  5AV6 B;  4KUD D;  4WZS B;  2IO5 C;  3C1C C;  3AZE B;  3AGF A;  5GHX A;  4XZQ D;  1P3B A;  3MGS A;  1FCN A;  1BLS A;  4OPZ A;  3B0C W;  4YS3 D;  4R4S A;  4EQI A;  4GNU A;  4KHA A;  5DNN D;  2ZM0 A;  4WEL A;  5CGS A;  3MNN C;  1P3M C;  3QNB A;  2I72 A;  2YFV B;  4WU8 C;  3REL D;  2ARO A;  4YM6 D;  5B32 D;  5KDM B;  5DF7 A;  4DE0 A;  5CP6 D;  4HEF A;  3PBT A;  3WAA A;  5DNM D;  4YS3 C;  3REH A;  4IBJ A;  3LO7 A;  1AOI D;  4EO5 B;  1KE3 A;  3G34 A;  2Y2Q A;  4LD9 B;  3C4O A;  3AYW B;  4KZ9 A;  4X68 A;  2Y55 A;  1ZG4 A;  3KXB C;  4IBX A;  3VP3 A;  5HAP A;  3UN7 A;  4IBK A;  4A5R A;  3REL C;  2CV5 A;  5B32 C;  5JRG B;  4Z5T A;  5GT3 B;  2XLN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...