4IJEA

Crystal structure of the zaire ebolavirus vp35 interferon inhibitory domain r312a/k319a/r322a mutant
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
124
structure length
124
Chain Sequence
PDISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLAPVPPSPAIDAGWVCVFQLQDGKTLGLKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polymerase cofactor VP35
publication title Development of RNA Aptamers Targeting Ebola Virus VP35.
pubmed doi rcsb
source organism Zaire ebolavirus
molecule tags Viral protein
total genus 42
structure length 124
sequence length 124
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ijeA01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4ijeA02
4IBGA 3L28A 4GHLA 4IBKA 4GH9A 4IBCA 3KS8A 4IBJA 4IBFA 3KS4A 4IBBA 4IJFA 4LG2A 4IBDA 4IBIA 4IBEA 3L2AA 3L27A 4IJEA 3L26A 3L29A 5BPVA 3L25A 4GHAA 3FKEA
chains in the Genus database with same CATH superfamily
3GLFE 2LVOC 3GLFB 5ITQA 2F4VM 4GKJM 4QNRA 2Z4RA 5ITYA 2Y2KA 2EA0A 2G3QA 3FRHA 1QZMA 4IBKA 3K9PA 3JR4A 2OQ4A 3WX7A 3J27B 2QBYA 4P17A 2YR0A 3OTOM 1IXSA 3U5ZB 3SAUA 2L7HA 2XH9A 4Z8XA 4G4RA 2D7GA 2L4FA 1EE8A 4IIWA 4XK8F 5FSWA 3UZUA 1XNQM 2WSCF 4M9ZA 3K8ZA 3KP0E 8CATA 5LMNM 4LZJA 2F5PA 4BLCA 1LV7A 2Y2OA 4X64M 2KA6B 4UN2B 2XD1A 3GLHE 2R65A 1CK7A 4PCZA 3GLHB 4LGMA 4D80A 4IJEA 3SHGB 1XMOM 3I4YA 2KZSA 2QP9X 4JN6A 1UM8A 2X49A 2BWBA 3KOYE 3QAUA 2EJSA 2C98A 3HJ8A 4GEWA 4L8RC 3B74A 1ZQ9A 1L1ZA 3FTEA 2LVAA 2CV2A 1A5TA 1Z59A 1QDTA 1ZAEA 3C3EA 2DWNA 1TH4A 3HJQA 4NC6A 1Z6TA 1Y8GA 2LNHC 1WGNA 3J81S 4DV4M 2F5NA 3KOWE 1WGLA 3RGSA 4DV1M 3AOEA 1W1PA 2DZNB 3HKPA 3JR5A 1Q3BA 5IREB 3GQ3A 4LG2A 1DO2A 3MQLA 1DO0A 5KO3A 3WD4A 2Y2HA 4IBIA 2K6BA 4QNMA 4GKKM 2V6ZM 4PD2A 1G41A 1UFZA 2L2DA 2FOIC 3AFHA 5ITTA 1ZMVA 2GQFA 3HSHA 2JP7A 1WJ7A 5E6JA 2ZTDA 3LQRA 4NL4H 3SASA 2C96A 3QYEA 2FN2A 5ITUA 4DUYM 1IY1A 1R4GA 1QUSA 1T3TA 2LWXA 1J5EM 7CATA 2DAIA 1VDLA 5EXTA 5A2QS 3GPUA 1JR3A 2XFTA 3LCVB 1E6RA 2KDLA 4LFAM 1MN3A 4MB7A 3AOEC 2Z3XA 2BJWA 5FTMA 3NWLA 1FJGM 1NV8A 4MB5A 1SXJD 1OFIA 4ZPXA 2YFQA 4X65M 2FS1A 4L15A 3I4VA 5KPRA 1K3XA 2FFFB 1GL6A 2Y2MA 4TUWA 4QNLA 2DHRA 2KZUA 2EO2A 4P16A 1XMQM 2LVQD 3Q8GA 3PVSA 3HONA 4LF7M 4LF6M 5BPVA 1TF0B 4LFBM 2UXCM 2HCBA 3SC3A 1ED7A 2KNVA 1VG5A 2JY5A 3PNYA 3PNVA 3LVVA 4G3OA 2FE8A 1S3SA 2Y2JA 4DR5M 4EIWA 5EP3A 3SYLA 2MR9A 2YQZA 2XFSA 1OAOC 2WZJA 5ITXA 2QENA 3T38A 3SHFA 4B08A 4MB3A 4AKHA 1L1TA 4GC5A 1J7KA 2K9DA 4X62M 4DV2M 2CWBA 1XXHA 1L2DA 2V1UA 3GPXA 2DAKA 3Q8XA 5EP4A 5FTLA 2R46A 2UUAM 2FFJA 2Z4SA 2L7IA 4DV0M 4LRTA 2CE7A 2Q2EB 4Z2KA 1NSFA 5F3WA 4LF5M 3KVWA 1H8PA 2Z7JA 2RTSA 1I94M 1ZMWA 4KHPM 3ZQJA 1C7YA 4Z2IA 1WIVA 1IY0A 2EKKA 1DGHA 1IN6A 1DGGA 3ILKA 3GLIA 3W68A 3TE6A 4IBGA 1SXJB 5ITXE 2DKLA 4G4QA 3U6LA 2LH0A 1UR8A 2V5OA 2DAEA 5IZ7D 1X37A 5FLXS 5KPTA 3DFZA 4S12A 3RFWA 3ZCBB 3RGPA 3K1JA 2JWSA 3GLGA 4DR1M 4DV3M 2GNOA 2QQ8A 4AZFA 1HQYE 4F1IA 2H1RA 3A98B 3KSXA 2HHHM 1JQJC 3FUUA 3FUWA 4MGYE 3U61A 1HT1E 2P5TA 2XGNA 4D82A 1GJSA 4Z2GA 4NXMM 3FUXA 4D81A 3L25A 1YU1A 2G5GX 1O6IA 3GLIE 2FNAA 3AL0C 4GHAA 2VIIA 2JY8A 3AJIB 3VLFB 2DVWB 3FTFA 2L09A 1XC8A 1W5TA 5EP2A 4DR3M 4II7A 4MGKE 4MGIE 4R7GA 1YE9A 1MJGM 1NNUC 1C1KA 2R18A 3LQQA 1IN4A 3A45A 3WHKA 1IBMM 3A46A 2DXIA 3GLGE 4HMDA 2X4AA 4CIZA 1PJSA 2XF3A 1NY5A 4AW4A 1TDHA 3T1HM 1G59A 3BBZA 1F4IA 1NO1A 2Y2PA 2D7EA 1PM5A 2ZBKB 1HNZM 4IBFA 2Y2NA 2A5YB 1QUTA 3KSJA 4IJFA 2QPAA 3EIEA 4HL4A 1R5LA 1QAQA 2LHCA 3HHYA 3SYKA 4G4OA 1PJJA 1L2BA 3EIHA 3F92A 3HU1A 1PJQA 2KEBA 3NBIA 4F2LA 1E6ZA 3L26A 3VK7A 1YU4A 2KRKA 1IN5A 1QVRA 3U60B 4FWDA 3J80S 1WHCA 1Q02A 3T15A 3D8BA 2CHGA 2DAMA 4W5WA 4DV6M 1WR1B 4FCVA 2HWJA 2HAKA 2JZ0A 4I81A 3MHVC 3IG5A 1GLNA 2QBYB 4LJ4A 1GJTA 4OJOA 3IHPA 2R0IA 3FUTA 2RGOA 4RNAA 2XSZA 4PDGA 3WD2A 1OIZA 1E15A 2XLJA 2DWLA 2CV0A 4CJ6A 1SG9A 3U6MA 1QO6A 1HQCA 1OJLA 4RF0A 2OO9A 1G8PA 1AIWA 1GABA 1PRBA 3SMPA 1OIPA 2O5RA 2I7PA 3FRIA 4L78A 4DV7M 2JCHA 4R3DA 2KNZA 3FYDA 2LHGA 4LJ6A 4NSRA 2BWEA 2YNMD 1NHGC 3GRRA 4REZA 3RE8A 3LCUA 4HLQA 2LVPC 3C58A 3WHLA 2M5ZA 2JUJA 4TX8A 1PDCA 3M6AA 2X8AA 2RRUA 1UR9A 3E9SA 4K0KM 1YUBA 4HMCA 3FTCA 2E5LM 4ITQA 3A42A 3UK6A 3HJSA 3JAMS 2CUZA 2J7OA 1ORYB 3I04M 2WSFF 4RF1A 3I51A 2KW0A 1KYIA 5IT9S 2LXEA 2VQFM 1NHWC 1Q39A 5EXXA 3GO8A 4M0WA 2K47A 1IBLM 2Y2LA 2WSEF 2JY7A 1XHBA 3DOAA 3H4JA 3K2LA 2MH8A 1Q3CA 1VQ1A 3KOZE 1IY2A 3MJ5A 1R6BX 1NVMA 1HT2E 2OOAA 2JY6B 1IBKM 1JR3E 2R6FA 5KPZA 3U6QA 2QNJA 2KRUA 4MH0E 3PFIA 3R9XB 3VKHA 2Y20A 1YSYA 3UJNA 2DNAA 1OGBA 2XZUA 4KT0F 3SARA 5C1BA 1IXZA 1TH3A 5EJCA 1IXRC 4DR4M 3T6PA 1V92A 4R71A 2O25A 2UXBM 4CHTB 1E94E 4B7FA 4QOZC 3AV0A 2CHQA 4BBAA 4LF4M 1EIJA 1IM2A 3TWKA 2CFOA 3L29A 1GKIA 4Z2JA 4OVZB 4LF9M 4DBGB 1D0MA 1MU5A 2O01F 1QDRA 3LMMA 4WURA 4OJ6A 2JXNA 1SXJA 4JI2M 2MGWA 2ERCA 2BNKA 1HR0M 2B3TA 4RKUF 2KNAA 4JI5M 5LMUM 4AG6A 5C18A 1T43A 4OU7A 1K82A 2QZ4A 1XXHE 1NV9A 1N78A 1IFYA 1NJGA 1XXHB 1VDDA 2NQ8C 1KSFX 3ZH9B 5ITRA 3AKZA 2UXDM 2R4EA 4CGYB 3SFZA 2OPFA 3KOXE 3H4MA 2DWMA 4A3VB 2J7NA 2RGHA 5DNYA 4JYAM 3MMPA 4KODA 4YY3M 3VK8A 3L2AA 4JI4M 2AHMA 3QWLA 1J7MA 1N75A 1XWIA 2DI0A 3HHWA 3TWLA 2K0BX 1G71A 4CISA 3WD3A 2L6OA 2QCUA 4NXNM 1DGHB 1ZV1A 3GLIB 3GQ5A 3B7QA 2UUCM 5EXPA 2VDBB 1KFVA 4FCTA 3QYBA 4XGIA 1FNNA 3SATA 2C9OA 3GLFA 4JI8M 3VDPA 4JI0M 1V33A 5H37D 4YHHM 4GH9A 3LVWA 4JI6M 3GLGB 2JZ1A 4Y28F 3U5ZA 1YUEA 2F5QA 4FD2A 1GO5A 2R62A 3AOGA 4IBJA 4B7HA 4QHSA 4LJAA 1E6NA 3C9PA 1H0IA 3CTWB 3M7GA 4GRIA 3U61B 2BJVA 2ZAOA 4L6V6 4PT5A 2UU9M 1DGBA 2DZOB 4IBEA 4GIPA 3GPYA 4AKIA 2RKOA 3GLHA 4WP2A 4OJPA 3U60A 2HL7A 1H6UA 2Y0QA 4L4UA 2DAGA 4XBOA 1L8QA 4JI7M 2DENA 1IN8A 3E46A 5FTNA 1PJIA 1N36M 4MB4A 3B9PA 4LJ8A 1E8BA 2M60A 5EP1A 1K3WA 4KO8A 2CP8A 2VF8A 3HZJA 4MM3B 4LZZA 2CHVA 2C9CA 1D2NA 1QZEA 3GRYA 3J7AS 1EAKA 3U6OA 3CF6E 3SAWA 3VFDA 1QAMA 1IXSB 1W1VA 3IG8A 3MK6A 2Y2QA 4B3SM 3KS8A 1CXWA 1VEGA 4JI3M 1I4WA 1MX0A 1IQPA 1NY6A 3FE3A 2XD5A 3PXGA 3V76A 2MJ5B 2ZANA 1JR3D 5KQ8A 1KS0A 1GVNA 3GRVA 2Y0TA 4MGHA 5KQDA 1E6PA 4GMQA 2CEAA 2EKFA 3W0LB 2VF7A 3FD9A 3HX3A 2N35A 1TTEA 4NZ3A 2QHOB 5JI2E 3J7BA 4LJ7A 2UWXA 4NOOB 1E32A 4LY6A 3VDUA 1H0GA 1L2CA 2QSFX 5GKNA 1DGFA 4NRVA 3M7PA 4M9SA 3J2PB 4NY2A 4KLNA 4X66M 5BR8M 4Z2HA 2XZFA 4AI6A 4I4LA 1DV0A 2DHYA 4QHTA 1GPFA 1R2ZA 1NJFA 4LFCM 1YU3A 1TGUA 3FTDA 3U6DA 3I01M 1OKSA 1AIPC 1R7RA 3U6PA 3TPZA 1E9SA 4OJLA 1HNWM 2EUCA 1TDZA 1Z5AA 3UGJA 4JI1M 4FVMA 1XB2B 2L4EA 3L27A 4LF8M 4DUZM 4FWGA 1AUAA 1VEJA 1QAOA 2F5SA 4NZ5A 3SBJA 2KHHA 3FKEA 2F5OA 1V34A 5FTJA 2I7NA 3NBXX 1PGYA 3CF0A 3D8LA 3SMSA 2CV1A 4NZ4A 1WXQA 3B7NA 2R44A 4M0DA 4Z2LA 1OGGA 4Q7JA 3B89A 4GC9A 1OQYA 3THGA 2H5XA 3CGWA 4QOSA 4I8OA 3TWMA 4G4NA 2Y2GA 5E26A 1ZMUA 3SAVA 3VKGA 1P3QQ 3HU2A 3HWSA 3R8FA 4FW9A 2Y2IA 3W67A 4IBBA 5IWAM 1EFUB 4DV5M 1NNJA 4HEOA 5EXSA 4DR7M 1T6OA 1E88A 3K9OA 4PDIA 3GQ4A 2MROB 2R4JA 1L6JA 1W5SA 3CF2A 3U6CA 4B3TM 4OVZA 1VEKA 2JNHA 1W1YA 3TQSA 3C3DA 3N3FA 2OOBA 3M0EA 2XEPA 1JB0F 3K92A 1OTRA 2FH0A 2G8LA 1PJTA 3KW6A 4AG5A 2D7HA 1OAIA 2ZTCA 3FYCA 3HHXA 3W0FA 3U6SA 1R2YA 1E9RA 2CRUA 3LW5F 3KFUG 2D49A 1HJPA 4LJ5A 1GL7A 4I5SA 1Z5BA 3KP1E 5DYGA 1G4AE 1QYRA 2LVNC 3HU3A 5FTKA 4Z6YA 4OX9M 4DR6M 4OUIA 3GRUA 3HGIA 4GITA 5L8RF 1D0KA 3GP1A 1N77A 4NRWA 1N32M 1GOIA 2JE5A 1BVSA 2W82A 1QQWA 4B7GA 3UMMA 1YU2A 1G3IA 1TH2A 1CUKA 2BG1A 4NZ1A 2UUBM 1SXJC 4MGZE 5DYIA 3IECA 4AKGA 1SXJE 3ZC7B 4HMEA 1N33M 3U6EA 1HNXM 1XNRM 3L28A 2HKJA 2JA2A 1TR8A 3WD1A 4G6ZA 3DZDA 2IOUA 3BXWA 4L16A 1OFHA 1Z5CA 2LBCA 1D0LA 2V1CA 4JXJA 4B3RM 4GHLA 3BOSA 2DWZB 3DA1A 1J09A 4IBCA 2DZLA 4OJ5A 4NSOB 3HY5A 2J5YA 1N34M 3FUVA 2LTUA 4BB9A 3KXEC 4LCBA 2KXEA 2Y21A 2C99A 2ZAMA 5DFLA 3GPPA 4LJ9A 1YLAA 3KS4A 4DR2M 1IN7A 4FCWA 3E4RA 3KDSE 4ANRA 4FWHA 1YU0A 1RU3A 4LGYA 2Z8YM 1W1TA 3WD0A 4JV5M 2APLA 4IBDA 1QANA 3E21A 3B7ZA 3HHZA 4OW0A 4LRSA 2ZM6M 4AQYM 2C5RA 2R45A 4WW0A 2XSZD 3TL4X 3T1YM 2VQEM 1GXDA 4NYYA 4B3MM 4NYUA 1LTMA 5EQTA 5JI3E 4M9XA
chains in the Genus database with same CATH topology
3GLFB 5ITQA 2F4VM 4GKJM 4QNRA 2Z4RA 5ITYA 2Y2KA 2EA0A 2OQ4A 3JR4A 1QZMA 4IBKA 3WX7A 3J27B 2QBYA 2YR0A 3OTOM 3U5ZB 3SAUA 2L7HA 2XH9A 4Z8XA 4G4RA 2D7GA 1XNQM 1EE8A 4IIWA 5FSWA 4NZ1A 3UZUA 4M9ZA 3K8ZA 3KP0E 8CATA 5LMNM 4LZJA 2F5PA 4BLCA 1LV7A 2Y2OA 4X64M 2KA6B 2XD1A 2R65A 4PCZA 3GLHB 4LGMA 4D80A 4IJEA 3SHGB 1XMOM 3I4YA 2KZSA 2QP9X 4JN6A 1UM8A 2X49A 3KOYE 3QAUA 3HJ8A 2C98A 4L8RC 1ZQ9A 1L1ZA 3FTEA 2CV2A 1Z59A 1ZAEA 2DWNA 1TH4A 3HJQA 1Z6TA 2LNHC 3J81S 4DV4M 2F5NA 3KOWE 3RGSA 4DV1M 3AOEA 2DZNB 3HKPA 3JR5A 1Q3BA 5IREB 3GQ3A 4LG2A 1DO2A 1DO0A 5KO3A 2Y2HA 4IBIA 4QNMA 4GKKM 2V6ZM 4PD2A 1G41A 5ITTA 2FOIC 3AFHA 3HSHA 5E6JA 3LQRA 4NL4H 3SASA 2C96A 5ITUA 4DUYM 1IY1A 1T3TA 2LWXA 1J5EM 7CATA 5EXTA 5A2QS 3GPUA 1JR3A 2XFTA 4LFAM 4MB7A 3AOEC 2Z3XA 2BJWA 5FTMA 3NWLA 1FJGM 1SXJD 1OFIA 4ZPXA 2YFQA 4X65M 4L15A 3I4VA 5KPRA 1K3XA 2FFFB 1GL6A 2Y2MA 4TUWA 4QNLA 2DHRA 2KZUA 2EO2A 4P16A 1XMQM 3PVSA 3HONA 4LF7M 4LF6M 5BPVA 4LFBM 2UXCM 2HCBA 3SC3A 3PNYA 3PNVA 3LVVA 2FE8A 1S3SA 2Y2JA 4DR5M 4EIWA 5EP3A 3SYLA 2YQZA 2XFSA 5ITXA 2QENA 3T38A 3SHFA 4B08A 4AKHA 1L1TA 4GC5A 1J7KA 4X62M 4DV2M 1XXHA 1L2DA 2V1UA 3GPXA 3Q8XA 5EP4A 5FTLA 2R46A 2UUAM 2FFJA 2Z4SA 2L7IA 4DV0M 4LRTA 2CE7A 2Q2EB 1NSFA 5F3WA 4LF5M 3KVWA 2Z7JA 1I94M 4KHPM 1IY0A 1DGHA 1IN6A 1DGGA 3ILKA 3GLIA 3TE6A 4IBGA 1SXJB 5ITXE 4G4QA 3U6LA 2LH0A 5IZ7D 1X37A 5FLXS 5KPTA 3DFZA 4S12A 3RFWA 3ZCBB 3RGPA 3K1JA 3GLGA 4DR1M 4DV3M 4AZFA 1HQYE 2H1RA 3A98B 3KSXA 2HHHM 1JQJC 3FUUA 3FUWA 4MGYE 3U61A 1HT1E 2P5TA 2XGNA 4D82A 4NXMM 3FUXA 4D81A 3L25A 1YU1A 2G5GX 2FNAA 3AL0C 4GHAA 2VIIA 3AJIB 3VLFB 2DVWB 3FTFA 2L09A 1XC8A 1W5TA 5EP2A 4DR3M 4II7A 4MGKE 4MGIE 4R7GA 1YE9A 2R18A 1NNUC 1C1KA 1IBMM 3LQQA 1IN4A 3A45A 3WHKA 2DXIA 3A46A 2Y2GA 2X4AA 2XF3A 1NY5A 4AW4A 1TDHA 3T1HM 1G59A 2Y2PA 2D7EA 1PM5A 2ZBKB 1HNZM 4IBFA 2Y2NA 2A5YB 3KSJA 4IJFA 2QPAA 3EIEA 4HL4A 1L2BA 1QAQA 3HHYA 3SYKA 4G4OA 1PJJA 3EIHA 3HU1A 2KEBA 3NBIA 1YU4A 3L26A 3VK7A 2KRKA 1IN5A 1QVRA 3U60B 4FWDA 3J80S 3T15A 3D8BA 2CHGA 4W5WA 4DV6M 4FCVA 3MHVC 3IG5A 1GLNA 2QBYB 4LJ4A 4OJOA 3FUTA 2RGOA 4RNAA 2XSZA 4PDGA 2XLJA 2DWLA 2CV0A 3U6MA 1HQCA 1OJLA 4RF0A 1G8PA 3SMPA 2O5RA 2I7PA 4L78A 4DV7M 2JCHA 4R3DA 3FYDA 4NSRA 4LJ6A 2YNMD 1NHGC 3GRRA 4REZA 3RE8A 4HLQA 3C58A 3WHLA 2M5ZA 3M6AA 2X8AA 3E9SA 4K0KM 1YUBA 3FTCA 2E5LM 4ITQA 3A42A 3UK6A 3HJSA 3JAMS 2CUZA 2J7OA 1ORYB 4RF1A 3I51A 2KW0A 1KYIA 5IT9S 2LXEA 2VQFM 1NHWC 1Q39A 5EXXA 3GO8A 4M0WA 2K47A 1IBLM 2Y2LA 3DOAA 1XHBA 3MJ5A 3K2LA 4I81A 1Q3CA 3KOZE 1IY2A 1IBKM 1R6BX 1NVMA 1HT2E 5KPZA 3U6QA 4MH0E 2KRUA 3PFIA 3R9XB 3VKHA 2Y20A 1YSYA 3UJNA 2XZUA 3SARA 5C1BA 1IXZA 1TH3A 5EJCA 1IXRC 4DR4M 2UXBM 4CHTB 1E94E 4B7FA 4QOZC 3AV0A 2CHQA 4BBAA 4LF4M 1IM2A 3TWKA 2CFOA 3L29A 1GKIA 4OVZB 4LF9M 1MU5A 3LMMA 4WURA 4OJ6A 4JI2M 1SXJA 2ERCA 2BNKA 1HR0M 4JI5M 5LMUM 4AG6A 5C18A 4OU7A 1K82A 2QZ4A 1NJGA 1XXHB 1VDDA 2NQ8C 1KSFX 3ZH9B 5ITRA 3AKZA 2UXDM 2R4EA 4CGYB 3SFZA 2OPFA 3KOXE 3H4MA 2DWMA 4A3VB 2J7NA 2RGHA 5DNYA 4JYAM 4KODA 3VK8A 4YY3M 4JI4M 3L2AA 2AHMA 3QWLA 1N75A 1XWIA 3HHWA 3TWLA 4CISA 2L6OA 2QCUA 4NXNM 1DGHB 3GLIB 3GQ5A 2UUCM 5EXPA 1KFVA 4FCTA 4XGIA 3SATA 1FNNA 2C9OA 3GLFA 4JI8M 3VDPA 4JI0M 5H37D 4YHHM 4JI6M 4GH9A 3LVWA 3GLGB 3U5ZA 1YUEA 2F5QA 4FD2A 2R62A 3AOGA 4IBJA 4B7HA 4QHSA 4LJAA 3CTWB 3M7GA 4GRIA 3U61B 2BJVA 2ZAOA 4PT5A 2UU9M 1DGBA 2DZOB 4IBEA 4GIPA 3GPYA 4AKIA 2RKOA 3GLHA 4OJPA 3U60A 2HL7A 1H6UA 2Y0QA 4L4UA 4XBOA 1L8QA 4JI7M 1IN8A 1PJIA 5FTNA 1N36M 3B9PA 4LJ8A 2M60A 5EP1A 1K3WA 4KO8A 4MM3B 4LZZA 2CHVA 2C9CA 1D2NA 3GRYA 3J7AS 3U6OA 3CF6E 3SAWA 3VFDA 1QAMA 1IXSB 3IG8A 3MK6A 2Y2QA 4B3SM 3KS8A 4JI3M 1I4WA 1MX0A 1IQPA 1NY6A 2XD5A 3PXGA 2ZANA 1JR3D 5KQ8A 1GVNA 3GRVA 2Y0TA 4MGHA 5KQDA 4GMQA 2CEAA 3W0LB 3FD9A 4NZ3A 2UWXA 5JI2E 3J7BA 4LJ7A 4NOOB 1E32A 4LY6A 3VDUA 1L2CA 5GKNA 1DGFA 4NRVA 4M9SA 3J2PB 4NY2A 4KLNA 4X66M 5BR8M 2XZFA 4AI6A 4I4LA 4QHTA 1R2ZA 1NJFA 4LFCM 1YU3A 1TGUA 3FTDA 3U6DA 1R7RA 3U6PA 3TPZA 1E9SA 4OJLA 1HNWM 2EUCA 1TDZA 1Z5AA 3UGJA 4JI1M 4FVMA 3L27A 4LF8M 4DUZM 4FWGA 1QAOA 2F5SA 4NZ5A 3SBJA 3FKEA 2F5OA 5FTJA 2I7NA 3CF0A 3D8LA 3SMSA 2CV1A 4NZ4A 1WXQA 4M0DA 3THGA 4GC9A 4QOSA 4I8OA 3TWMA 4G4NA 5E26A 3SAVA 3VKGA 3HU2A 3HWSA 3R8FA 4FW9A 2Y2IA 4IBBA 5IWAM 4DV5M 1NNJA 5EXSA 4DR7M 4PDIA 3GQ4A 2R4JA 1W5SA 3CF2A 3U6CA 4B3TM 4OVZA 3TQSA 3N3FA 3M0EA 2XEPA 3K92A 2G8LA 3KW6A 4AG5A 2D7HA 3FYCA 3HHXA 3W0FA 3U6SA 1R2YA 1E9RA 3KFUG 4LJ5A 1GL7A 4I5SA 1Z5BA 3KP1E 5DYGA 1G4AE 1QYRA 3HU3A 5FTKA 4Z6YA 4OX9M 4DR6M 4OUIA 3GRUA 3HGIA 4GITA 4NRWA 3GP1A 1N77A 1N32M 2JE5A 2W82A 1QQWA 4B7GA 3UMMA 1YU2A 1G3IA 1TH2A 2BG1A 2UUBM 1SXJC 4MGZE 5DYIA 4AKGA 1SXJE 3ZC7B 1N33M 3U6EA 1HNXM 1XNRM 3L28A 2HKJA 2JA2A 4G6ZA 3DZDA 2IOUA 4L16A 1OFHA 1Z5CA 4GHLA 2V1CA 4JXJA 4B3RM 3BOSA 2DWZB 3DA1A 1J09A 4IBCA 4OJ5A 4NSOB 1N34M 3FUVA 3GPPA 4BB9A 3KXEC 4LCBA 2KXEA 2Y21A 2C99A 2ZAMA 4LJ9A 3KS4A 4DR2M 1IN7A 4FCWA 3E4RA 3KDSE 4FWHA 1YU0A 4LGYA 4JV5M 4IBDA 1QANA 3HHZA 4OW0A 4LRSA 2ZM6M 4AQYM 2C5RA 2R45A 4WW0A 2XSZD 3TL4X 3T1YM 2VQEM 4NYYA 4B3MM 4NYUA 1N78A 5EQTA 5JI3E 4M9XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IBG A;  3L28 A;  4GHL A;  4IBK A;  4GH9 A;  4IBC A;  3KS8 A;  4IBJ A;  4IBF A;  3KS4 A;  4IBB A;  4IJF A;  4LG2 A;  4IBD A;  4IBI A;  4IBE A;  3L2A A;  3L27 A;  4IJE A;  3L26 A;  3L29 A;  5BPV A;  3L25 A;  4GHA A;  3FKE A; 
#chains in the Genus database with same CATH topology
 3GLF E;  2LVO C;  3GLF B;  5ITQ A;  2F4V M;  4GKJ M;  4QNR A;  2Z4R A;  5ITY A;  2Y2K A;  2EA0 A;  2G3Q A;  3FRH A;  1QZM A;  4IBK A;  3K9P A;  3JR4 A;  2OQ4 A;  3WX7 A;  3J27 B;  2QBY A;  4P17 A;  2YR0 A;  3OTO M;  1IXS A;  3U5Z B;  3SAU A;  2L7H A;  2XH9 A;  4Z8X A;  4G4R A;  2D7G A;  2L4F A;  1EE8 A;  4IIW A;  4XK8 F;  5FSW A;  3UZU A;  1XNQ M;  2WSC F;  4M9Z A;  3K8Z A;  3KP0 E;  8CAT A;  5LMN M;  4LZJ A;  2F5P A;  4BLC A;  1LV7 A;  2Y2O A;  4X64 M;  2KA6 B;  4UN2 B;  2XD1 A;  3GLH E;  2R65 A;  1CK7 A;  4PCZ A;  3GLH B;  4LGM A;  4D80 A;  4IJE A;  3SHG B;  1XMO M;  3I4Y A;  2KZS A;  2QP9 X;  4JN6 A;  1UM8 A;  2X49 A;  2BWB A;  3KOY E;  3QAU A;  2EJS A;  2C98 A;  3HJ8 A;  4GEW A;  4L8R C;  3B74 A;  1ZQ9 A;  1L1Z A;  3FTE A;  2LVA A;  2CV2 A;  1A5T A;  1Z59 A;  1QDT A;  1ZAE A;  3C3E A;  2DWN A;  1TH4 A;  3HJQ A;  4NC6 A;  1Z6T A;  1Y8G A;  2LNH C;  1WGN A;  3J81 S;  4DV4 M;  2F5N A;  3KOW E;  1WGL A;  3RGS A;  4DV1 M;  3AOE A;  1W1P A;  2DZN B;  3HKP A;  3JR5 A;  1Q3B A;  5IRE B;  3GQ3 A;  4LG2 A;  1DO2 A;  3MQL A;  1DO0 A;  5KO3 A;  3WD4 A;  2Y2H A;  4IBI A;  2K6B A;  4QNM A;  4GKK M;  2V6Z M;  4PD2 A;  1G41 A;  1UFZ A;  2L2D A;  2FOI C;  3AFH A;  5ITT A;  1ZMV A;  2GQF A;  3HSH A;  2JP7 A;  1WJ7 A;  5E6J A;  2ZTD A;  3LQR A;  4NL4 H;  3SAS A;  2C96 A;  3QYE A;  2FN2 A;  5ITU A;  4DUY M;  1IY1 A;  1R4G A;  1QUS A;  1T3T A;  2LWX A;  1J5E M;  7CAT A;  2DAI A;  1VDL A;  5EXT A;  5A2Q S;  3GPU A;  1JR3 A;  2XFT A;  3LCV B;  1E6R A;  2KDL A;  4LFA M;  1MN3 A;  4MB7 A;  3AOE C;  2Z3X A;  2BJW A;  5FTM A;  3NWL A;  1FJG M;  1NV8 A;  4MB5 A;  1SXJ D;  1OFI A;  4ZPX A;  2YFQ A;  4X65 M;  2FS1 A;  4L15 A;  3I4V A;  5KPR A;  1K3X A;  2FFF B;  1GL6 A;  2Y2M A;  4TUW A;  4QNL A;  2DHR A;  2KZU A;  2EO2 A;  4P16 A;  1XMQ M;  2LVQ D;  3Q8G A;  3PVS A;  3HON A;  4LF7 M;  4LF6 M;  5BPV A;  1TF0 B;  4LFB M;  2UXC M;  2HCB A;  3SC3 A;  1ED7 A;  2KNV A;  1VG5 A;  2JY5 A;  3PNY A;  3PNV A;  3LVV A;  4G3O A;  2FE8 A;  1S3S A;  2Y2J A;  4DR5 M;  4EIW A;  5EP3 A;  3SYL A;  2MR9 A;  2YQZ A;  2XFS A;  1OAO C;  2WZJ A;  5ITX A;  2QEN A;  3T38 A;  3SHF A;  4B08 A;  4MB3 A;  4AKH A;  1L1T A;  4GC5 A;  1J7K A;  2K9D A;  4X62 M;  4DV2 M;  2CWB A;  1XXH A;  1L2D A;  2V1U A;  3GPX A;  2DAK A;  3Q8X A;  5EP4 A;  5FTL A;  2R46 A;  2UUA M;  2FFJ A;  2Z4S A;  2L7I A;  4DV0 M;  4LRT A;  2CE7 A;  2Q2E B;  4Z2K A;  1NSF A;  5F3W A;  4LF5 M;  3KVW A;  1H8P A;  2Z7J A;  2RTS A;  1I94 M;  1ZMW A;  4KHP M;  3ZQJ A;  1C7Y A;  4Z2I A;  1WIV A;  1IY0 A;  2EKK A;  1DGH A;  1IN6 A;  1DGG A;  3ILK A;  3GLI A;  3W68 A;  3TE6 A;  4IBG A;  1SXJ B;  5ITX E;  2DKL A;  4G4Q A;  3U6L A;  2LH0 A;  1UR8 A;  2V5O A;  2DAE A;  5IZ7 D;  1X37 A;  5FLX S;  5KPT A;  3DFZ A;  4S12 A;  3RFW A;  3ZCB B;  3RGP A;  3K1J A;  2JWS A;  3GLG A;  4DR1 M;  4DV3 M;  2GNO A;  2QQ8 A;  4AZF A;  1HQY E;  4F1I A;  2H1R A;  3A98 B;  3KSX A;  2HHH M;  1JQJ C;  3FUU A;  3FUW A;  4MGY E;  3U61 A;  1HT1 E;  2P5T A;  2XGN A;  4D82 A;  1GJS A;  4Z2G A;  4NXM M;  3FUX A;  4D81 A;  3L25 A;  1YU1 A;  2G5G X;  1O6I A;  3GLI E;  2FNA A;  3AL0 C;  4GHA A;  2VII A;  2JY8 A;  3AJI B;  3VLF B;  2DVW B;  3FTF A;  2L09 A;  1XC8 A;  1W5T A;  5EP2 A;  4DR3 M;  4II7 A;  4MGK E;  4MGI E;  4R7G A;  1YE9 A;  1MJG M;  1NNU C;  1C1K A;  2R18 A;  3LQQ A;  1IN4 A;  3A45 A;  3WHK A;  1IBM M;  3A46 A;  2DXI A;  3GLG E;  4HMD A;  2X4A A;  4CIZ A;  1PJS A;  2XF3 A;  1NY5 A;  4AW4 A;  1TDH A;  3T1H M;  1G59 A;  3BBZ A;  1F4I A;  1NO1 A;  2Y2P A;  2D7E A;  1PM5 A;  2ZBK B;  1HNZ M;  4IBF A;  2Y2N A;  2A5Y B;  1QUT A;  3KSJ A;  4IJF A;  2QPA A;  3EIE A;  4HL4 A;  1R5L A;  1QAQ A;  2LHC A;  3HHY A;  3SYK A;  4G4O A;  1PJJ A;  1L2B A;  3EIH A;  3F92 A;  3HU1 A;  1PJQ A;  2KEB A;  3NBI A;  4F2L A;  1E6Z A;  3L26 A;  3VK7 A;  1YU4 A;  2KRK A;  1IN5 A;  1QVR A;  3U60 B;  4FWD A;  3J80 S;  1WHC A;  1Q02 A;  3T15 A;  3D8B A;  2CHG A;  2DAM A;  4W5W A;  4DV6 M;  1WR1 B;  4FCV A;  2HWJ A;  2HAK A;  2JZ0 A;  4I81 A;  3MHV C;  3IG5 A;  1GLN A;  2QBY B;  4LJ4 A;  1GJT A;  4OJO A;  3IHP A;  2R0I A;  3FUT A;  2RGO A;  4RNA A;  2XSZ A;  4PDG A;  3WD2 A;  1OIZ A;  1E15 A;  2XLJ A;  2DWL A;  2CV0 A;  4CJ6 A;  1SG9 A;  3U6M A;  1QO6 A;  1HQC A;  1OJL A;  4RF0 A;  2OO9 A;  1G8P A;  1AIW A;  1GAB A;  1PRB A;  3SMP A;  1OIP A;  2O5R A;  2I7P A;  3FRI A;  4L78 A;  4DV7 M;  2JCH A;  4R3D A;  2KNZ A;  3FYD A;  2LHG A;  4LJ6 A;  4NSR A;  2BWE A;  2YNM D;  1NHG C;  3GRR A;  4REZ A;  3RE8 A;  3LCU A;  4HLQ A;  2LVP C;  3C58 A;  3WHL A;  2M5Z A;  2JUJ A;  4TX8 A;  1PDC A;  3M6A A;  2X8A A;  2RRU A;  1UR9 A;  3E9S A;  4K0K M;  1YUB A;  4HMC A;  3FTC A;  2E5L M;  4ITQ A;  3A42 A;  3UK6 A;  3HJS A;  3JAM S;  2CUZ A;  2J7O A;  1ORY B;  3I04 M;  2WSF F;  4RF1 A;  3I51 A;  2KW0 A;  1KYI A;  5IT9 S;  2LXE A;  2VQF M;  1NHW C;  1Q39 A;  5EXX A;  3GO8 A;  4M0W A;  2K47 A;  1IBL M;  2Y2L A;  2WSE F;  2JY7 A;  1XHB A;  3DOA A;  3H4J A;  3K2L A;  2MH8 A;  1Q3C A;  1VQ1 A;  3KOZ E;  1IY2 A;  3MJ5 A;  1R6B X;  1NVM A;  1HT2 E;  2OOA A;  2JY6 B;  1IBK M;  1JR3 E;  2R6F A;  5KPZ A;  3U6Q A;  2QNJ A;  2KRU A;  4MH0 E;  3PFI A;  3R9X B;  3VKH A;  2Y20 A;  1YSY A;  3UJN A;  2DNA A;  1OGB A;  2XZU A;  4KT0 F;  3SAR A;  5C1B A;  1IXZ A;  1TH3 A;  5EJC A;  1IXR C;  4DR4 M;  3T6P A;  1V92 A;  4R71 A;  2O25 A;  2UXB M;  4CHT B;  1E94 E;  4B7F A;  4QOZ C;  3AV0 A;  2CHQ A;  4BBA A;  4LF4 M;  1EIJ A;  1IM2 A;  3TWK A;  2CFO A;  3L29 A;  1GKI A;  4Z2J A;  4OVZ B;  4LF9 M;  4DBG B;  1D0M A;  1MU5 A;  2O01 F;  1QDR A;  3LMM A;  4WUR A;  4OJ6 A;  2JXN A;  1SXJ A;  4JI2 M;  2MGW A;  2ERC A;  2BNK A;  1HR0 M;  2B3T A;  4RKU F;  2KNA A;  4JI5 M;  5LMU M;  4AG6 A;  5C18 A;  1T43 A;  4OU7 A;  1K82 A;  2QZ4 A;  1XXH E;  1NV9 A;  1N78 A;  1IFY A;  1NJG A;  1XXH B;  1VDD A;  2NQ8 C;  1KSF X;  3ZH9 B;  5ITR A;  3AKZ A;  2UXD M;  2R4E A;  4CGY B;  3SFZ A;  2OPF A;  3KOX E;  3H4M A;  2DWM A;  4A3V B;  2J7N A;  2RGH A;  5DNY A;  4JYA M;  3MMP A;  4KOD A;  4YY3 M;  3VK8 A;  3L2A A;  4JI4 M;  2AHM A;  3QWL A;  1J7M A;  1N75 A;  1XWI A;  2DI0 A;  3HHW A;  3TWL A;  2K0B X;  1G71 A;  4CIS A;  3WD3 A;  2L6O A;  2QCU A;  4NXN M;  1DGH B;  1ZV1 A;  3GLI B;  3GQ5 A;  3B7Q A;  2UUC M;  5EXP A;  2VDB B;  1KFV A;  4FCT A;  3QYB A;  4XGI A;  1FNN A;  3SAT A;  2C9O A;  3GLF A;  4JI8 M;  3VDP A;  4JI0 M;  1V33 A;  5H37 D;  4YHH M;  4GH9 A;  3LVW A;  4JI6 M;  3GLG B;  2JZ1 A;  4Y28 F;  3U5Z A;  1YUE A;  2F5Q A;  4FD2 A;  1GO5 A;  2R62 A;  3AOG A;  4IBJ A;  4B7H A;  4QHS A;  4LJA A;  1E6N A;  3C9P A;  1H0I A;  3CTW B;  3M7G A;  4GRI A;  3U61 B;  2BJV A;  2ZAO A;  4L6V 6;  4PT5 A;  2UU9 M;  1DGB A;  2DZO B;  4IBE A;  4GIP A;  3GPY A;  4AKI A;  2RKO A;  3GLH A;  4WP2 A;  4OJP A;  3U60 A;  2HL7 A;  1H6U A;  2Y0Q A;  4L4U A;  2DAG A;  4XBO A;  1L8Q A;  4JI7 M;  2DEN A;  1IN8 A;  3E46 A;  5FTN A;  1PJI A;  1N36 M;  4MB4 A;  3B9P A;  4LJ8 A;  1E8B A;  2M60 A;  5EP1 A;  1K3W A;  4KO8 A;  2CP8 A;  2VF8 A;  3HZJ A;  4MM3 B;  4LZZ A;  2CHV A;  2C9C A;  1D2N A;  1QZE A;  3GRY A;  3J7A S;  1EAK A;  3U6O A;  3CF6 E;  3SAW A;  3VFD A;  1QAM A;  1IXS B;  1W1V A;  3IG8 A;  3MK6 A;  2Y2Q A;  4B3S M;  3KS8 A;  1CXW A;  1VEG A;  4JI3 M;  1I4W A;  1MX0 A;  1IQP A;  1NY6 A;  3FE3 A;  2XD5 A;  3PXG A;  3V76 A;  2MJ5 B;  2ZAN A;  1JR3 D;  5KQ8 A;  1KS0 A;  1GVN A;  3GRV A;  2Y0T A;  4MGH A;  5KQD A;  1E6P A;  4GMQ A;  2CEA A;  2EKF A;  3W0L B;  2VF7 A;  3FD9 A;  3HX3 A;  2N35 A;  1TTE A;  4NZ3 A;  2QHO B;  5JI2 E;  3J7B A;  4LJ7 A;  2UWX A;  4NOO B;  1E32 A;  4LY6 A;  3VDU A;  1H0G A;  1L2C A;  2QSF X;  5GKN A;  1DGF A;  4NRV A;  3M7P A;  4M9S A;  3J2P B;  4NY2 A;  4KLN A;  4X66 M;  5BR8 M;  4Z2H A;  2XZF A;  4AI6 A;  4I4L A;  1DV0 A;  2DHY A;  4QHT A;  1GPF A;  1R2Z A;  1NJF A;  4LFC M;  1YU3 A;  1TGU A;  3FTD A;  3U6D A;  3I01 M;  1OKS A;  1AIP C;  1R7R A;  3U6P A;  3TPZ A;  1E9S A;  4OJL A;  1HNW M;  2EUC A;  1TDZ A;  1Z5A A;  3UGJ A;  4JI1 M;  4FVM A;  1XB2 B;  2L4E A;  3L27 A;  4LF8 M;  4DUZ M;  4FWG A;  1AUA A;  1VEJ A;  1QAO A;  2F5S A;  4NZ5 A;  3SBJ A;  2KHH A;  3FKE A;  2F5O A;  1V34 A;  5FTJ A;  2I7N A;  3NBX X;  1PGY A;  3CF0 A;  3D8L A;  3SMS A;  2CV1 A;  4NZ4 A;  1WXQ A;  3B7N A;  2R44 A;  4M0D A;  4Z2L A;  1OGG A;  4Q7J A;  3B89 A;  4GC9 A;  1OQY A;  3THG A;  2H5X A;  3CGW A;  4QOS A;  4I8O A;  3TWM A;  4G4N A;  2Y2G A;  5E26 A;  1ZMU A;  3SAV A;  3VKG A;  1P3Q Q;  3HU2 A;  3HWS A;  3R8F A;  4FW9 A;  2Y2I A;  3W67 A;  4IBB A;  5IWA M;  1EFU B;  4DV5 M;  1NNJ A;  4HEO A;  5EXS A;  4DR7 M;  1T6O A;  1E88 A;  3K9O A;  4PDI A;  3GQ4 A;  2MRO B;  2R4J A;  1L6J A;  1W5S A;  3CF2 A;  3U6C A;  4B3T M;  4OVZ A;  1VEK A;  2JNH A;  1W1Y A;  3TQS A;  3C3D A;  3N3F A;  2OOB A;  3M0E A;  2XEP A;  1JB0 F;  3K92 A;  1OTR A;  2FH0 A;  2G8L A;  1PJT A;  3KW6 A;  4AG5 A;  2D7H A;  1OAI A;  2ZTC A;  3FYC A;  3HHX A;  3W0F A;  3U6S A;  1R2Y A;  1E9R A;  2CRU A;  3LW5 F;  3KFU G;  2D49 A;  1HJP A;  4LJ5 A;  1GL7 A;  4I5S A;  1Z5B A;  3KP1 E;  5DYG A;  1G4A E;  1QYR A;  2LVN C;  3HU3 A;  5FTK A;  4Z6Y A;  4OX9 M;  4DR6 M;  4OUI A;  3GRU A;  3HGI A;  4GIT A;  5L8R F;  1D0K A;  3GP1 A;  1N77 A;  4NRW A;  1N32 M;  1GOI A;  2JE5 A;  1BVS A;  2W82 A;  1QQW A;  4B7G A;  3UMM A;  1YU2 A;  1G3I A;  1TH2 A;  1CUK A;  2BG1 A;  4NZ1 A;  2UUB M;  1SXJ C;  4MGZ E;  5DYI A;  3IEC A;  4AKG A;  1SXJ E;  3ZC7 B;  4HME A;  1N33 M;  3U6E A;  1HNX M;  1XNR M;  3L28 A;  2HKJ A;  2JA2 A;  1TR8 A;  3WD1 A;  4G6Z A;  3DZD A;  2IOU A;  3BXW A;  4L16 A;  1OFH A;  1Z5C A;  2LBC A;  1D0L A;  2V1C A;  4JXJ A;  4B3R M;  4GHL A;  3BOS A;  2DWZ B;  3DA1 A;  1J09 A;  4IBC A;  2DZL A;  4OJ5 A;  4NSO B;  3HY5 A;  2J5Y A;  1N34 M;  3FUV A;  2LTU A;  4BB9 A;  3KXE C;  4LCB A;  2KXE A;  2Y21 A;  2C99 A;  2ZAM A;  5DFL A;  3GPP A;  4LJ9 A;  1YLA A;  3KS4 A;  4DR2 M;  1IN7 A;  4FCW A;  3E4R A;  3KDS E;  4ANR A;  4FWH A;  1YU0 A;  1RU3 A;  4LGY A;  2Z8Y M;  1W1T A;  3WD0 A;  4JV5 M;  2APL A;  4IBD A;  1QAN A;  3E21 A;  3B7Z A;  3HHZ A;  4OW0 A;  4LRS A;  2ZM6 M;  4AQY M;  2C5R A;  2R45 A;  4WW0 A;  2XSZ D;  3TL4 X;  3T1Y M;  2VQE M;  1GXD A;  4NYY A;  4B3M M;  4NYU A;  1LTM A;  5EQT A;  5JI3 E;  4M9X A; 
#chains in the Genus database with same CATH homology
 3GLF B;  5ITQ A;  2F4V M;  4GKJ M;  4QNR A;  2Z4R A;  5ITY A;  2Y2K A;  2EA0 A;  2OQ4 A;  3JR4 A;  1QZM A;  4IBK A;  3WX7 A;  3J27 B;  2QBY A;  2YR0 A;  3OTO M;  3U5Z B;  3SAU A;  2L7H A;  2XH9 A;  4Z8X A;  4G4R A;  2D7G A;  1XNQ M;  1EE8 A;  4IIW A;  5FSW A;  4NZ1 A;  3UZU A;  4M9Z A;  3K8Z A;  3KP0 E;  8CAT A;  5LMN M;  4LZJ A;  2F5P A;  4BLC A;  1LV7 A;  2Y2O A;  4X64 M;  2KA6 B;  2XD1 A;  2R65 A;  4PCZ A;  3GLH B;  4LGM A;  4D80 A;  4IJE A;  3SHG B;  1XMO M;  3I4Y A;  2KZS A;  2QP9 X;  4JN6 A;  1UM8 A;  2X49 A;  3KOY E;  3QAU A;  3HJ8 A;  2C98 A;  4L8R C;  1ZQ9 A;  1L1Z A;  3FTE A;  2CV2 A;  1Z59 A;  1ZAE A;  2DWN A;  1TH4 A;  3HJQ A;  1Z6T A;  2LNH C;  3J81 S;  4DV4 M;  2F5N A;  3KOW E;  3RGS A;  4DV1 M;  3AOE A;  2DZN B;  3HKP A;  3JR5 A;  1Q3B A;  5IRE B;  3GQ3 A;  4LG2 A;  1DO2 A;  1DO0 A;  5KO3 A;  2Y2H A;  4IBI A;  4QNM A;  4GKK M;  2V6Z M;  4PD2 A;  1G41 A;  5ITT A;  2FOI C;  3AFH A;  3HSH A;  5E6J A;  3LQR A;  4NL4 H;  3SAS A;  2C96 A;  5ITU A;  4DUY M;  1IY1 A;  1T3T A;  2LWX A;  1J5E M;  7CAT A;  5EXT A;  5A2Q S;  3GPU A;  1JR3 A;  2XFT A;  4LFA M;  4MB7 A;  3AOE C;  2Z3X A;  2BJW A;  5FTM A;  3NWL A;  1FJG M;  1SXJ D;  1OFI A;  4ZPX A;  2YFQ A;  4X65 M;  4L15 A;  3I4V A;  5KPR A;  1K3X A;  2FFF B;  1GL6 A;  2Y2M A;  4TUW A;  4QNL A;  2DHR A;  2KZU A;  2EO2 A;  4P16 A;  1XMQ M;  3PVS A;  3HON A;  4LF7 M;  4LF6 M;  5BPV A;  4LFB M;  2UXC M;  2HCB A;  3SC3 A;  3PNY A;  3PNV A;  3LVV A;  2FE8 A;  1S3S A;  2Y2J A;  4DR5 M;  4EIW A;  5EP3 A;  3SYL A;  2YQZ A;  2XFS A;  5ITX A;  2QEN A;  3T38 A;  3SHF A;  4B08 A;  4AKH A;  1L1T A;  4GC5 A;  1J7K A;  4X62 M;  4DV2 M;  1XXH A;  1L2D A;  2V1U A;  3GPX A;  3Q8X A;  5EP4 A;  5FTL A;  2R46 A;  2UUA M;  2FFJ A;  2Z4S A;  2L7I A;  4DV0 M;  4LRT A;  2CE7 A;  2Q2E B;  1NSF A;  5F3W A;  4LF5 M;  3KVW A;  2Z7J A;  1I94 M;  4KHP M;  1IY0 A;  1DGH A;  1IN6 A;  1DGG A;  3ILK A;  3GLI A;  3TE6 A;  4IBG A;  1SXJ B;  5ITX E;  4G4Q A;  3U6L A;  2LH0 A;  5IZ7 D;  1X37 A;  5FLX S;  5KPT A;  3DFZ A;  4S12 A;  3RFW A;  3ZCB B;  3RGP A;  3K1J A;  3GLG A;  4DR1 M;  4DV3 M;  4AZF A;  1HQY E;  2H1R A;  3A98 B;  3KSX A;  2HHH M;  1JQJ C;  3FUU A;  3FUW A;  4MGY E;  3U61 A;  1HT1 E;  2P5T A;  2XGN A;  4D82 A;  4NXM M;  3FUX A;  4D81 A;  3L25 A;  1YU1 A;  2G5G X;  2FNA A;  3AL0 C;  4GHA A;  2VII A;  3AJI B;  3VLF B;  2DVW B;  3FTF A;  2L09 A;  1XC8 A;  1W5T A;  5EP2 A;  4DR3 M;  4II7 A;  4MGK E;  4MGI E;  4R7G A;  1YE9 A;  2R18 A;  1NNU C;  1C1K A;  1IBM M;  3LQQ A;  1IN4 A;  3A45 A;  3WHK A;  2DXI A;  3A46 A;  2Y2G A;  2X4A A;  2XF3 A;  1NY5 A;  4AW4 A;  1TDH A;  3T1H M;  1G59 A;  2Y2P A;  2D7E A;  1PM5 A;  2ZBK B;  1HNZ M;  4IBF A;  2Y2N A;  2A5Y B;  3KSJ A;  4IJF A;  2QPA A;  3EIE A;  4HL4 A;  1L2B A;  1QAQ A;  3HHY A;  3SYK A;  4G4O A;  1PJJ A;  3EIH A;  3HU1 A;  2KEB A;  3NBI A;  1YU4 A;  3L26 A;  3VK7 A;  2KRK A;  1IN5 A;  1QVR A;  3U60 B;  4FWD A;  3J80 S;  3T15 A;  3D8B A;  2CHG A;  4W5W A;  4DV6 M;  4FCV A;  3MHV C;  3IG5 A;  1GLN A;  2QBY B;  4LJ4 A;  4OJO A;  3FUT A;  2RGO A;  4RNA A;  2XSZ A;  4PDG A;  2XLJ A;  2DWL A;  2CV0 A;  3U6M A;  1HQC A;  1OJL A;  4RF0 A;  1G8P A;  3SMP A;  2O5R A;  2I7P A;  4L78 A;  4DV7 M;  2JCH A;  4R3D A;  3FYD A;  4NSR A;  4LJ6 A;  2YNM D;  1NHG C;  3GRR A;  4REZ A;  3RE8 A;  4HLQ A;  3C58 A;  3WHL A;  2M5Z A;  3M6A A;  2X8A A;  3E9S A;  4K0K M;  1YUB A;  3FTC A;  2E5L M;  4ITQ A;  3A42 A;  3UK6 A;  3HJS A;  3JAM S;  2CUZ A;  2J7O A;  1ORY B;  4RF1 A;  3I51 A;  2KW0 A;  1KYI A;  5IT9 S;  2LXE A;  2VQF M;  1NHW C;  1Q39 A;  5EXX A;  3GO8 A;  4M0W A;  2K47 A;  1IBL M;  2Y2L A;  3DOA A;  1XHB A;  3MJ5 A;  3K2L A;  4I81 A;  1Q3C A;  3KOZ E;  1IY2 A;  1IBK M;  1R6B X;  1NVM A;  1HT2 E;  5KPZ A;  3U6Q A;  4MH0 E;  2KRU A;  3PFI A;  3R9X B;  3VKH A;  2Y20 A;  1YSY A;  3UJN A;  2XZU A;  3SAR A;  5C1B A;  1IXZ A;  1TH3 A;  5EJC A;  1IXR C;  4DR4 M;  2UXB M;  4CHT B;  1E94 E;  4B7F A;  4QOZ C;  3AV0 A;  2CHQ A;  4BBA A;  4LF4 M;  1IM2 A;  3TWK A;  2CFO A;  3L29 A;  1GKI A;  4OVZ B;  4LF9 M;  1MU5 A;  3LMM A;  4WUR A;  4OJ6 A;  4JI2 M;  1SXJ A;  2ERC A;  2BNK A;  1HR0 M;  4JI5 M;  5LMU M;  4AG6 A;  5C18 A;  4OU7 A;  1K82 A;  2QZ4 A;  1NJG A;  1XXH B;  1VDD A;  2NQ8 C;  1KSF X;  3ZH9 B;  5ITR A;  3AKZ A;  2UXD M;  2R4E A;  4CGY B;  3SFZ A;  2OPF A;  3KOX E;  3H4M A;  2DWM A;  4A3V B;  2J7N A;  2RGH A;  5DNY A;  4JYA M;  4KOD A;  3VK8 A;  4YY3 M;  4JI4 M;  3L2A A;  2AHM A;  3QWL A;  1N75 A;  1XWI A;  3HHW A;  3TWL A;  4CIS A;  2L6O A;  2QCU A;  4NXN M;  1DGH B;  3GLI B;  3GQ5 A;  2UUC M;  5EXP A;  1KFV A;  4FCT A;  4XGI A;  3SAT A;  1FNN A;  2C9O A;  3GLF A;  4JI8 M;  3VDP A;  4JI0 M;  5H37 D;  4YHH M;  4JI6 M;  4GH9 A;  3LVW A;  3GLG B;  3U5Z A;  1YUE A;  2F5Q A;  4FD2 A;  2R62 A;  3AOG A;  4IBJ A;  4B7H A;  4QHS A;  4LJA A;  3CTW B;  3M7G A;  4GRI A;  3U61 B;  2BJV A;  2ZAO A;  4PT5 A;  2UU9 M;  1DGB A;  2DZO B;  4IBE A;  4GIP A;  3GPY A;  4AKI A;  2RKO A;  3GLH A;  4OJP A;  3U60 A;  2HL7 A;  1H6U A;  2Y0Q A;  4L4U A;  4XBO A;  1L8Q A;  4JI7 M;  1IN8 A;  1PJI A;  5FTN A;  1N36 M;  3B9P A;  4LJ8 A;  2M60 A;  5EP1 A;  1K3W A;  4KO8 A;  4MM3 B;  4LZZ A;  2CHV A;  2C9C A;  1D2N A;  3GRY A;  3J7A S;  3U6O A;  3CF6 E;  3SAW A;  3VFD A;  1QAM A;  1IXS B;  3IG8 A;  3MK6 A;  2Y2Q A;  4B3S M;  3KS8 A;  4JI3 M;  1I4W A;  1MX0 A;  1IQP A;  1NY6 A;  2XD5 A;  3PXG A;  2ZAN A;  1JR3 D;  5KQ8 A;  1GVN A;  3GRV A;  2Y0T A;  4MGH A;  5KQD A;  4GMQ A;  2CEA A;  3W0L B;  3FD9 A;  4NZ3 A;  2UWX A;  5JI2 E;  3J7B A;  4LJ7 A;  4NOO B;  1E32 A;  4LY6 A;  3VDU A;  1L2C A;  5GKN A;  1DGF A;  4NRV A;  4M9S A;  3J2P B;  4NY2 A;  4KLN A;  4X66 M;  5BR8 M;  2XZF A;  4AI6 A;  4I4L A;  4QHT A;  1R2Z A;  1NJF A;  4LFC M;  1YU3 A;  1TGU A;  3FTD A;  3U6D A;  1R7R A;  3U6P A;  3TPZ A;  1E9S A;  4OJL A;  1HNW M;  2EUC A;  1TDZ A;  1Z5A A;  3UGJ A;  4JI1 M;  4FVM A;  3L27 A;  4LF8 M;  4DUZ M;  4FWG A;  1QAO A;  2F5S A;  4NZ5 A;  3SBJ A;  3FKE A;  2F5O A;  5FTJ A;  2I7N A;  3CF0 A;  3D8L A;  3SMS A;  2CV1 A;  4NZ4 A;  1WXQ A;  4M0D A;  3THG A;  4GC9 A;  4QOS A;  4I8O A;  3TWM A;  4G4N A;  5E26 A;  3SAV A;  3VKG A;  3HU2 A;  3HWS A;  3R8F A;  4FW9 A;  2Y2I A;  4IBB A;  5IWA M;  4DV5 M;  1NNJ A;  5EXS A;  4DR7 M;  4PDI A;  3GQ4 A;  2R4J A;  1W5S A;  3CF2 A;  3U6C A;  4B3T M;  4OVZ A;  3TQS A;  3N3F A;  3M0E A;  2XEP A;  3K92 A;  2G8L A;  3KW6 A;  4AG5 A;  2D7H A;  3FYC A;  3HHX A;  3W0F A;  3U6S A;  1R2Y A;  1E9R A;  3KFU G;  4LJ5 A;  1GL7 A;  4I5S A;  1Z5B A;  3KP1 E;  5DYG A;  1G4A E;  1QYR A;  3HU3 A;  5FTK A;  4Z6Y A;  4OX9 M;  4DR6 M;  4OUI A;  3GRU A;  3HGI A;  4GIT A;  4NRW A;  3GP1 A;  1N77 A;  1N32 M;  2JE5 A;  2W82 A;  1QQW A;  4B7G A;  3UMM A;  1YU2 A;  1G3I A;  1TH2 A;  2BG1 A;  2UUB M;  1SXJ C;  4MGZ E;  5DYI A;  4AKG A;  1SXJ E;  3ZC7 B;  1N33 M;  3U6E A;  1HNX M;  1XNR M;  3L28 A;  2HKJ A;  2JA2 A;  4G6Z A;  3DZD A;  2IOU A;  4L16 A;  1OFH A;  1Z5C A;  4GHL A;  2V1C A;  4JXJ A;  4B3R M;  3BOS A;  2DWZ B;  3DA1 A;  1J09 A;  4IBC A;  4OJ5 A;  4NSO B;  1N34 M;  3FUV A;  3GPP A;  4BB9 A;  3KXE C;  4LCB A;  2KXE A;  2Y21 A;  2C99 A;  2ZAM A;  4LJ9 A;  3KS4 A;  4DR2 M;  1IN7 A;  4FCW A;  3E4R A;  3KDS E;  4FWH A;  1YU0 A;  4LGY A;  4JV5 M;  4IBD A;  1QAN A;  3HHZ A;  4OW0 A;  4LRS A;  2ZM6 M;  4AQY M;  2C5R A;  2R45 A;  4WW0 A;  2XSZ D;  3TL4 X;  3T1Y M;  2VQE M;  4NYY A;  4B3M M;  4NYU A;  1N78 A;  5EQT A;  5JI3 E;  4M9X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...