4IJEA

Crystal structure of the zaire ebolavirus vp35 interferon inhibitory domain r312a/k319a/r322a mutant
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
124
structure length
124
Chain Sequence
b'PDISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLAPVPPSPAIDAGWVCVFQLQDGKTLGLKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polymerase cofactor VP35
publication title Development of RNA Aptamers Targeting Ebola Virus VP35.
pubmed doi rcsb
source organism Zaire ebolavirus
molecule tags Viral protein
total genus 42
structure length 124
sequence length 124
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ijeA01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4ijeA02
4GH9A 4IBJA 4LG2A 3L2AA 4GHLA 3KS4A 4IJFA 4IBCA 4IBGA 4IBIA 5BPVA 4GHAA 4IBEA 3FKEA 4IJEA 3L25A 3L28A 3KS8A 3L27A 3L26A 4IBDA 4IBFA 3L29A 4IBBA 4IBKA
chains in the Genus database with same CATH superfamily
4GC5A 2JY5A 1J09A 1T6OA 2ZTDA 3J2PB 3PVSA 1XNQM 4LF9M 3PNYA 5LMUM 2CHGA 1QAOA 2Z7JA 3RGSA 1PM5A 1MU5A 4B3RM 1HR0M 1XMOM 4MGIE 4Z2GA 1Z6TA 2IOUA 1TH2A 2X8AA 2NQ8C 1XXHE 5BPVA 5DFLA 4YY3M 3U6MA 2DWMA 4NYUA 1IY0A 1TH4A 3FRIA 1R5LA 1E32A 3I51A 1QQWA 3GLGB 1E9RA 3K92A 4KODA 1H6UA 2Y2HA 3GPUA 3U6CA 2L7HA 4WP2A 1GVNA 1Z5AA 4M0WA 3CTWB 2FFJA 2JXNA 4XK8F 3U6PA 2ERCA 3LVVA 2DHYA 1GXDA 1HQCA 1G41A 2R45A 3U6LA 1R7RA 4QOSA 1E8BA 4OUIA 2EJSA 1R2YA 1W1PA 2HHHM 5EXPA 5EXXA 1IN7A 4FD2A 3GLFA 2DXIA 1F4IA 1JB0F 1FNNA 2D49A 3FUWA 4G4RA 1ED7A 1G71A 2DZLA 2O25A 4GRIA 4ANRA 3GRVA 4W5WA 4OX9M 2JY6B 3QYEA 2R4JA 1WHCA 2DAKA 3ZH9B 4LF5M 4DV2M 2CE7A 3DOAA 1TF0B 2EUCA 2QBYB 4MH0E 4MGZE 2Q2EB 5ITTA 3U60A 1YUBA 4FCTA 3ZC7B 3VKGA 1D0MA 2QSFX 3T38A 2KNZA 4Y28F 3IHPA 5ITXA 4DBGB 2D7HA 1NY6A 4GIPA 4HLQA 2XFSA 3VK8A 1YU0A 1IXRC 4GC9A 2FN2A 3V76A 4DUYM 4LG2A 1QDRA 3SBJA 3J27B 2OOAA 3I4VA 3SAUA 3KSXA 2UXCM 3KVWA 4IBCA 2UUCM 1D2NA 4IBGA 2CRUA 3KW6A 4R3DA 5KQ8A 1IY2A 4LRSA 3U6OA 2Y2PA 1GO5A 1J5EM 1MJGM 4L8RC 2DWZB 4Q7JA 1IN8A 2J7NA 1AIWA 4JI3M 1J7KA 4D81A 1E6PA 3FUVA 3M7GA 5EJCA 2XD5A 4M9SA 3LMMA 2JY8A 1IBLM 4IJEA 2R6FA 3L25A 3A98B 5EXTA 2J5YA 4G4OA 1JR3A 5FTKA 2R4EA 3U5ZA 4LGMA 4MGYE 1G59A 2DAIA 4MM3B 4NC6A 1EFUB 1OFHA 4IBKA 1QO6A 2A5YB 2CEAA 1W5SA 3WD1A 2XGNA 2Z4SA 4NOOB 4D82A 1WGLA 2P5TA 3LCUA 2C98A 2CHQA 4DV7M 3VK7A 3LQRA 5ITYA 1T3TA 4II7A 3U6DA 2CFOA 4NRVA 2KXEA 4DV4M 3J7AS 1YLAA 2K9DA 2MROB 4IIWA 5FTLA 1QUTA 3SAWA 2X4AA 3FTFA 2V1CA 1YUEA 2FFFB 4DV5M 3HONA 1E15A 2O01F 4NZ5A 1IM2A 1Z5CA 4JI2M 2JE5A 3CF6E 1P3QQ 2KRKA 2LHCA 1WR1B 1S3SA 5BR8M 3L28A 1IXSA 3K8ZA 3DA1A 3GLIA 2LVPC 1E88A 4IBFA 4D80A 2MH8A 2JNHA 2VF8A 3SYKA 3PNVA 3KP1E 3U60B 1OGBA 3HZJA 3TE6A 3KP0E 3T1HM 1HNZM 4LF8M 2DENA 1W1VA 2BWEA 2I7NA 4MGKE 1HJPA 1G8PA 1SXJE 5FTNA 4AQYM 1OFIA 1IFYA 4LY6A 4TX8A 1VEGA 2ZANA 3M6AA 3SMPA 3ZQJA 1GPFA 3F92A 1H0IA 4DUZM 4I81A 2ZTCA 4KHPM 2DNAA 4G3OA 3AOEA 2UU9M 4OJ5A 1YSYA 1XWIA 4DR5M 4Z2HA 1E6RA 1QZEA 2Y0QA 1QAMA 2R18A 2HKJA 3CF2A 3GLFE 3DZDA 2GQFA 3B74A 3NBXX 4DV0M 1TR8A 4B3SM 1GOIA 3UZUA 3BXWA 2VF7A 1QZMA 1GL7A 4FCWA 3K9PA 1IY1A 4M9XA 1D0LA 2UXBM 4DV3M 4NY2A 4JI0M 2OQ4A 1Q3CA 1L1TA 1PJJA 1NJGA 3HHWA 1H8PA 3LQQA 1ZAEA 2CUZA 2LVAA 4WURA 3J80S 3U5ZB 1XMQM 1TDHA 4NZ3A 3K1JA 4JI8M 1WGNA 4B7GA 4OJOA 4HL4A 4YHHM 1NJFA 4JI1M 2Y0TA 3KS4A 3GP1A 2FE8A 2Y2NA 2XZFA 2CHVA 4FVMA 1K82A 1G4AE 2L4EA 4M0DA 1N33M 4AW4A 2RGOA 2MGWA 2D7GA 3I4YA 5EQTA 3HX3A 4L4UA 2F4VM 4HEOA 2V1UA 5E6JA 1NVMA 1Q39A 3FKEA 4LJ7A 1I94M 4B3TM 1QDTA 4G4QA 4FWGA 2M5ZA 3WD2A 4NXMM 2KZUA 1OAOC 2FH0A 4OJLA 4JXJA 4S12A 2L6OA 4L15A 1N75A 3R9XB 3B7ZA 4KLNA 3GQ3A 3U61A 2DAGA 1L1ZA 4JI6M 4GEWA 2RRUA 4LCBA 3BOSA 3K2LA 1Q3BA 2CV2A 2JP7A 4I4LA 5JI3E 2EKKA 3EIHA 5IWAM 1C7YA 2JZ0A 4GKJM 3AOGA 2Y20A 1W1YA 2G5GX 3R8FA 4MB4A 1ORYB 1N36M 1KFVA 3SFZA 1DGHA 1SG9A 4DR7M 1PRBA 2Y2IA 2RGHA 3UJNA 3FUXA 2XD1A 3H4JA 1GLNA 2FNAA 3WX7A 4LJ4A 4OJ6A 3UK6A 5FTMA 5KQDA 2E5LM 4G6ZA 2HCBA 4CIZA 5ITXE 3U6QA 2R65A 2Y2MA 2KZSA 3A45A 3VDUA 1SXJB 3JR4A 1KS0A 1HQYE 2DZNB 1IN5A 2JWSA 1NNUC 5E26A 2Y2GA 1GABA 4B3MM 1GJTA 4LFBM 3LCVB 2B3TA 3HWSA 3FTDA 3KSJA 2LWXA 4LJ5A 3M7PA 3WD0A 3LW5F 1NY5A 3FUUA 1NHGC 4I5SA 3GLFB 2Z3XA 2DZOB 1ZMUA 3IG5A 3D8LA 1NHWC 3GLHA 2XLJA 4K0KM 4Z2JA 4AKIA 2LHGA 3TWLA 1JR3E 1LV7A 2KNVA 2LXEA 1I4WA 3FTCA 3HU3A 3KOYE 3T6PA 5KO3A 3Q8GA 4QNLA 5GKNA 3FTEA 4P17A 4RKUF 2QP9X 1HT2E 3SARA 5DYGA 2QENA 4JYAM 1IBKM 4FCVA 1UFZA 1YE9A 2DKLA 5DYIA 1IN6A 5IREB 2VQEM 3Q8XA 4OU7A 2Z8YM 5H37D 4B7FA 4IBBA 3GPXA 5ITRA 1WIVA 3HHYA 3H4MA 3SHGB 3U61B 2JY7A 3FE3A 4GH9A 2WSEF 3MJ5A 4HMCA 1SXJC 2JCHA 2HL7A 2VDBB 1TGUA 1NSFA 3NWLA 2XZUA 1XNRM 2V6ZM 3FRHA 5A2QS 2LVNC 3RFWA 4DR6M 2LVOC 3SC3A 1JQJC 4R71A 3MHVC 1QAQA 3C3EA 3GLIE 3PFIA 2F5NA 3KOWE 4JI4M 2Y2KA 2QHOB 2YQZA 3BBZA 1YU2A 1PJSA 3C58A 1OIZA 1OKSA 4LFAM 3VKHA 1E94E 2R46A 2Y2JA 1Q02A 2LTUA 2XEPA 3RGPA 2UUAM 4X65M 2K47A 1QUSA 2C5RA 1LTMA 2KW0A 1V33A 2L4FA 3THGA 1PDCA 3A42A 1X37A 2OPFA 3FYDA 5FTJA 1NO1A 2XSZD 4X62M 2K6BA 3HU2A 4NZ4A 4MB5A 4DR1M 4LGYA 5KPTA 2F5OA 4LFCM 1L8QA 3B89A 1DGGA 3GLGA 3SAVA 1W5TA 4OVZA 3W68A 2EO2A 2YFQA 1R4GA 2G3QA 2APLA 4LZZA 4EIWA 2RTSA 2BWBA 2ZAOA 2WSFF 4GHAA 1J7MA 4JN6A 3D8BA 3GLHB 4OJPA 1O6IA 2YNMD 4FW9A 2R0IA 2EA0A 1Y8GA 3FD9A 3FYCA 3TQSA 4X66M 3KS8A 2CV1A 2BNKA 4LF7M 2VIIA 2Z4RA 4QOZC 3GRRA 1HNXM 3ZCBB 5LMNM 4NYYA 2XF3A 1D0KA 2XFTA 1DV0A 1E9SA 4L78A 3LVWA 4NSRA 2OO9A 3KXEC 3E9SA 3TPZA 3W0LB 4QHTA 4PD2A 1WJ7A 3T1YM 3VDPA 1RU3A 3KOZE 4MB7A 1YU3A 4BBAA 2HAKA 5EP4A 3TWKA 3FUTA 3IG8A 3HU1A 2O5RA 2Y2QA 2KHHA 2WZJA 4DR2M 1UR8A 2CWBA 3ILKA 3KOXE 4B08A 2CP8A 4XGIA 5KPRA 2Y2LA 1G3IA 3VLFB 2W82A 5EP2A 1UM8A 4CJ6A 2Y2OA 3B7NA 4KT0F 4MB3A 3HHZA 1TTEA 3L29A 5IT9S 1SXJD 4PT5A 1K3XA 4NRWA 1FJGM 4NL4H 1OQYA 5C18A 3E4RA 1E6NA 1IXSB 2H5XA 1OTRA 1H0GA 3GLIB 2KRUA 3GRUA 4FWHA 5EP3A 1VG5A 5IZ7D 2QNJA 1E6ZA 5F3WA 2ZBKB 3L2AA 4MGHA 3JR5A 4Z2LA 3JAMS 1DO2A 2UUBM 4TUWA 2QQ8A 1L2DA 1ZMVA 4IJFA 1W1TA 1EAKA 1V34A 2ZAMA 2LVQD 3I01M 4GITA 3A46A 4LZJA 4DV1M 4LJ6A 2XH9A 4F2LA 4Z6YA 4HMDA 4M9ZA 4OVZB 3TL4X 3SMSA 4R7GA 1HNWM 1N77A 5EXSA 1KYIA 2K0BX 2R44A 1UR9A 1Z5BA 3VFDA 3OTOM 1XXHA 3HKPA 2C9CA 1L2BA 1OAIA 1CXWA 4X64M 2BJVA 1L2CA 1VDDA 3IECA 1YU1A 2D7EA 4JI7M 4HMEA 2RKOA 4LJAA 3AFHA 1GKIA 2KEBA 2DVWB 3GLHE 3E46A 4NXNM 3KFUG 4REZA 1Z59A 4LJ9A 1CUKA 3B7QA 4CHTB 3QYBA 1IBMM 4GHLA 3GQ5A 1DGBA 3DFZA 2L2DA 4LRTA 2X49A 1TDZA 2BJWA 4GMQA 2DWLA 1QVRA 2HWJA 4DR4M 3J7BA 1BVSA 3GQ4A 2H1RA 4Z2IA 1VEKA 1EE8A 1V92A 4FWDA 2V5OA 2C96A 4I8OA 3PXGA 4PDIA 4KO8A 3L27A 3M0EA 1KSFX 1TH3A 2FOIC 5EP1A 3U6EA 4RF0A 5DNYA 2L7IA 4RNAA 1NV8A 2KDLA 2DAMA 4QHSA 4CISA 4B7HA 5FSWA 1A5TA 1QANA 3AOEC 4IBJA 4DV6M 3GO8A 3AKZA 4G4NA 2QCUA 5JI2E 2L09A 2KA6B 2LH0A 1ZMWA 2F5SA 1QYRA 1OIPA 4LF6M 1N78A 1IN4A 4GKKM 3HHXA 2QZ4A 1GL6A 3UGJA 2FS1A 1XC8A 1NV9A 3QAUA 5ITUA 3QWLA 3TWMA 4ITQA 1R6BX 1DGHB 4AZFA 4XBOA 2JA2A 4NSOB 2XSZA 2I7PA 4LF4M 3C9PA 3AV0A 4IBDA 1N32M 2OOBA 4PDGA 3HSHA 8CATA 1XXHB 3GLGE 3SASA 5KPZA 4AG5A 1HT1E 3J81S 5L8RF 1NNJA 1PJQA 3SHFA 1JR3D 2AHMA 3MK6A 1N34M 2KNAA 3B9PA 2R62A 3CF0A 4L16A 2M60A 4AI6A 1DO0A 1EIJA 3EIEA 4F1IA 4QNRA 2JZ1A 1GJSA 3WHKA 5C1BA 3GPPA 3W0FA 4L6V6 2VQFM 1L6JA 5FLXS 2MR9A 2F5PA 4BB9A 4Z2KA 1CK7A 2EKFA 1MN3A 2WSCF 2J7OA 1XB2B 4OW0A 4UN2B 4WW0A 2N35A 3SYLA 2MJ5B 4BLCA 3WHLA 1R2ZA 4NZ1A 1OJLA 3AJIB 2DWNA 4P16A 1T43A 1DGFA 2JUJA 2Y21A 1OGGA 1AUAA 2CV0A 2UXDM 2QPAA 2DAEA 3CGWA 3I04M 2C99A 2UWXA 2C9OA 3HJSA 1ZV1A 3K9OA 4RF1A 1YU4A 3WD3A 1IQPA 1VQ1A 1C1KA 1VEJA 2LNHC 3HJQA 2G8LA 4AG6A 2ZM6M 4AKHA 3HGIA 4A3VB 1AIPC 2F5QA 3HY5A 3GRYA 3MQLA 3KDSE 3U6SA 3W67A 4Z8XA 2GNOA 3HJ8A 1XHBA 4IBIA 3SATA 4ZPXA 2DI0A 7CATA 2DHRA 4LJ8A 1WXQA 3C3DA 2QBYA 1SXJA 4IBEA 1ZQ9A 3UMMA 3T15A 4AKGA 4JI5M 4QNMA 3RE8A 1PJIA 3AL0C 1PJTA 2YR0A 3WD4A 1IXZA 4CGYB 3N3FA 3L26A 4JV5M 1VDLA 2LBCA 5ITQA 3GPYA 3NBIA 3MMPA 4DR3M 3E21A 1K3WA 4PCZA 1PGYA 2BG1A 1MX0A
chains in the Genus database with same CATH topology
4GC5A 1J09A 3J2PB 3PVSA 1XNQM 4LF9M 3PNYA 5LMUM 2CHGA 1QAOA 2Z7JA 3RGSA 1PM5A 1MU5A 4B3RM 1HR0M 1XMOM 4MGIE 1Z6TA 2IOUA 1TH2A 2X8AA 2NQ8C 5BPVA 4YY3M 3U6MA 2DWMA 4NYUA 1IY0A 1TH4A 1E32A 3I51A 1QQWA 3GLGB 1E9RA 3K92A 4KODA 1H6UA 2Y2HA 3GPUA 3U6CA 2L7HA 1GVNA 1Z5AA 4M0WA 3CTWB 2FFJA 3U6PA 2ERCA 3LVVA 1HQCA 1G41A 2R45A 3U6LA 1R7RA 4QOSA 4OUIA 1R2YA 2HHHM 5EXPA 5EXXA 1IN7A 4FD2A 3GLFA 2DXIA 1FNNA 3FUWA 4G4RA 4GRIA 3GRVA 4W5WA 4OX9M 2R4JA 3ZH9B 4LF5M 4DV2M 2CE7A 3DOAA 2EUCA 2QBYB 4MH0E 4MGZE 2Q2EB 5ITTA 3U60A 1YUBA 4FCTA 3ZC7B 3VKGA 3T38A 5ITXA 2D7HA 1NY6A 4GIPA 4HLQA 2XFSA 3VK8A 1YU0A 1IXRC 4GC9A 4DUYM 4LG2A 3SBJA 3J27B 3I4VA 3SAUA 3KSXA 2UXCM 3KVWA 4IBCA 2UUCM 1D2NA 4IBGA 3KW6A 4R3DA 5KQ8A 1IY2A 4LRSA 3U6OA 2Y2PA 1J5EM 4L8RC 2DWZB 1IN8A 2J7NA 4JI3M 1J7KA 4D81A 3FUVA 3M7GA 5EJCA 2XD5A 4M9SA 3LMMA 1IBLM 4IJEA 3L25A 3A98B 5EXTA 4G4OA 1JR3A 5FTKA 2R4EA 3U5ZA 4LGMA 4MGYE 1G59A 4MM3B 4IBKA 1OFHA 2A5YB 2CEAA 1W5SA 2XGNA 2Z4SA 4NOOB 4D82A 2P5TA 2C98A 2CHQA 4DV7M 3VK7A 3LQRA 5ITYA 1T3TA 4II7A 3U6DA 2CFOA 4NRVA 4DV4M 3J7AS 4IIWA 5FTLA 3SAWA 2FFFB 2X4AA 3FTFA 2V1CA 1YUEA 3HONA 4DV5M 4NZ5A 1IM2A 1Z5CA 4JI2M 2JE5A 3CF6E 2KRKA 1S3SA 5BR8M 3L28A 3K8ZA 3DA1A 3GLIA 4IBFA 4D80A 3SYKA 3PNVA 3KP1E 3U60B 3TE6A 3KP0E 3T1HM 1HNZM 4LF8M 2I7NA 4MGKE 5FTNA 1G8PA 1SXJE 4AQYM 1OFIA 4LY6A 2ZANA 3M6AA 3SMPA 4DUZM 4I81A 4KHPM 2UU9M 3AOEA 4OJ5A 1YSYA 1XWIA 4DR5M 2Y0QA 1QAMA 2R18A 2HKJA 3CF2A 3DZDA 4DV0M 4B3SM 3UZUA 4FCWA 1QZMA 1GL7A 4OJ6A 1IY1A 4M9XA 2UXBM 4DV3M 4NY2A 4JI0M 2OQ4A 1Q3CA 1L1TA 1PJJA 1NJGA 3HHWA 3LQQA 1ZAEA 2CUZA 4WURA 3J80S 3U5ZB 1XMQM 1TDHA 4NZ3A 3K1JA 4JI8M 4B7GA 4OJOA 4HL4A 4YHHM 1NJFA 4JI1M 2Y0TA 3KS4A 3GP1A 2FE8A 2Y2NA 2XZFA 2CHVA 4FVMA 1K82A 1G4AE 4M0DA 1N33M 4AW4A 2RGOA 2D7GA 3I4YA 5EQTA 4L4UA 2F4VM 2V1UA 5E6JA 1NVMA 1Q39A 3FKEA 4LJ7A 1I94M 4B3TM 4G4QA 4FWGA 2M5ZA 4NXMM 2KZUA 4OJLA 4JXJA 4S12A 2L6OA 4L15A 1N75A 3R9XB 3GQ3A 4KLNA 3U61A 1L1ZA 4JI6M 4LCBA 3BOSA 3K2LA 1Q3BA 2CV2A 4I4LA 5JI3E 3EIHA 5IWAM 4GKJM 3AOGA 2Y20A 2G5GX 3R8FA 1ORYB 1N36M 1KFVA 3SFZA 1DGHA 4DR7M 2Y2IA 2RGHA 3UJNA 3FUXA 2XD1A 1GLNA 2FNAA 3WX7A 4LJ4A 3UK6A 5FTMA 5KQDA 2E5LM 4G6ZA 2HCBA 5ITXE 3U6QA 2Y2MA 2R65A 2KZSA 3A45A 3VDUA 1SXJB 3JR4A 1HQYE 2DZNB 1IN5A 5E26A 1NNUC 2Y2GA 4B3MM 4LFBM 3HWSA 3KSJA 3FTDA 4LJ5A 2LWXA 1NY5A 3FUUA 1NHGC 4I5SA 3GLFB 2Z3XA 2DZOB 3IG5A 3D8LA 1NHWC 3GLHA 2XLJA 4K0KM 4AKIA 3TWLA 1LV7A 2LXEA 3FTCA 1I4WA 3KOYE 3HU3A 5KO3A 4QNLA 5GKNA 3FTEA 2QP9X 1HT2E 3SARA 5DYGA 2QENA 4JYAM 1IBKM 4FCVA 1YE9A 5DYIA 1IN6A 5IREB 2VQEM 3Q8XA 4OU7A 5H37D 4B7FA 4IBBA 3GPXA 5ITRA 3HHYA 3H4MA 3SHGB 3U61B 4GH9A 3MJ5A 1SXJC 2JCHA 2HL7A 1TGUA 1NSFA 3NWLA 2XZUA 1XNRM 2V6ZM 5A2QS 3RFWA 4DR6M 3SC3A 1JQJC 3MHVC 1QAQA 2F5NA 3PFIA 4JI4M 3KOWE 2Y2KA 2YQZA 1YU2A 3C58A 4LFAM 3VKHA 1E94E 2R46A 2Y2JA 2XEPA 3RGPA 2UUAM 4X65M 2K47A 2C5RA 2KW0A 3THGA 3A42A 1X37A 2OPFA 3FYDA 5FTJA 2XSZD 4X62M 3HU2A 4NZ4A 4DR1M 4LGYA 5KPTA 2F5OA 4LFCM 1L8QA 3GLGA 1DGGA 3SAVA 1W5TA 4OVZA 2EO2A 2YFQA 4LZZA 4EIWA 2ZAOA 4GHAA 4JN6A 3D8BA 3GLHB 4OJPA 2YNMD 4FW9A 2EA0A 3FD9A 3FYCA 3TQSA 4X66M 3KS8A 2CV1A 2BNKA 4LF7M 2VIIA 2Z4RA 4QOZC 3GRRA 1HNXM 3ZCBB 5LMNM 4NYYA 2XF3A 2XFTA 1E9SA 4L78A 3LVWA 4NSRA 3KXEC 3E9SA 3TPZA 3W0LB 4QHTA 4PD2A 3T1YM 3VDPA 3KOZE 4MB7A 1YU3A 4BBAA 5EP4A 3TWKA 3FUTA 3IG8A 3HU1A 2O5RA 2Y2QA 4DR2M 3ILKA 3KOXE 4B08A 4XGIA 5KPRA 2Y2LA 1G3IA 3VLFB 2W82A 5EP2A 1UM8A 2Y2OA 3HHZA 3L29A 5IT9S 1SXJD 4PT5A 1K3XA 4NRWA 1FJGM 4NL4H 5C18A 3E4RA 1IXSB 3GLIB 2KRUA 3GRUA 4FWHA 5EP3A 5IZ7D 5F3WA 2ZBKB 3L2AA 4MGHA 3JR5A 3JAMS 1DO2A 2UUBM 4TUWA 1L2DA 4IJFA 2ZAMA 4GITA 3A46A 4LZJA 4DV1M 4LJ6A 2XH9A 4Z6YA 4M9ZA 4OVZB 3TL4X 3SMSA 4R7GA 1HNWM 1N77A 5EXSA 1KYIA 1Z5BA 3VFDA 3OTOM 1XXHA 3HKPA 2C9CA 1L2BA 4X64M 2BJVA 1L2CA 1VDDA 1YU1A 2D7EA 4JI7M 2RKOA 4LJAA 3AFHA 1GKIA 2KEBA 2DVWB 4NXNM 3KFUG 4REZA 1Z59A 4LJ9A 4CHTB 1IBMM 4GHLA 3GQ5A 1DGBA 3DFZA 4LRTA 1TDZA 2X49A 2BJWA 4GMQA 2DWLA 1QVRA 4DR4M 3J7BA 3GQ4A 2H1RA 1EE8A 4FWDA 2C96A 4I8OA 3PXGA 4PDIA 4KO8A 3L27A 3M0EA 1KSFX 1TH3A 2FOIC 5EP1A 3U6EA 4RF0A 5DNYA 2L7IA 4RNAA 4QHSA 4CISA 4B7HA 5FSWA 4IBJA 1QANA 3AOEC 4DV6M 3GO8A 3AKZA 4G4NA 2QCUA 5JI2E 2L09A 2KA6B 2LH0A 2F5SA 1QYRA 4LF6M 1N78A 1IN4A 4GKKM 3HHXA 2QZ4A 1GL6A 3UGJA 1XC8A 3QAUA 5ITUA 3QWLA 3TWMA 4ITQA 1R6BX 1DGHB 4AZFA 4XBOA 2JA2A 4NSOB 2XSZA 2I7PA 4LF4M 3AV0A 4IBDA 1N32M 4PDGA 3HSHA 8CATA 1XXHB 3SASA 5KPZA 4AG5A 1HT1E 3J81S 1NNJA 3SHFA 1JR3D 2AHMA 3MK6A 1N34M 3B9PA 2R62A 3CF0A 4L16A 2M60A 4AI6A 1DO0A 3EIEA 4QNRA 3WHKA 5C1BA 3GPPA 3W0FA 2VQFM 5FLXS 2F5PA 4BB9A 2J7OA 4WW0A 4OW0A 3SYLA 4BLCA 3WHLA 1R2ZA 4NZ1A 1OJLA 3AJIB 2DWNA 4P16A 1DGFA 2Y21A 2CV0A 2UXDM 2QPAA 2C99A 2UWXA 2C9OA 3HJSA 4RF1A 1YU4A 1IQPA 2LNHC 1C1KA 3HJQA 2ZM6M 4AKHA 2G8LA 4AG6A 3HGIA 4A3VB 2F5QA 3GRYA 3KDSE 3U6SA 4Z8XA 3HJ8A 1XHBA 4IBIA 3SATA 4ZPXA 7CATA 2DHRA 4LJ8A 1WXQA 2QBYA 1SXJA 4IBEA 1ZQ9A 3UMMA 3T15A 4AKGA 4JI5M 4QNMA 3RE8A 1PJIA 3AL0C 2YR0A 1IXZA 4CGYB 3N3FA 3L26A 4JV5M 3GPYA 5ITQA 3NBIA 4DR3M 1K3WA 4PCZA 2KXEA 2BG1A 1MX0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GH9 A;  4IBJ A;  4LG2 A;  3L2A A;  4GHL A;  3KS4 A;  4IJF A;  4IBC A;  4IBG A;  4IBI A;  5BPV A;  4GHA A;  4IBE A;  3FKE A;  4IJE A;  3L25 A;  3L28 A;  3KS8 A;  3L27 A;  3L26 A;  4IBD A;  4IBF A;  3L29 A;  4IBB A;  4IBK A; 
#chains in the Genus database with same CATH topology
 4GC5 A;  2JY5 A;  1J09 A;  1T6O A;  2ZTD A;  3J2P B;  3PVS A;  1XNQ M;  4LF9 M;  3PNY A;  5LMU M;  2CHG A;  1QAO A;  2Z7J A;  3RGS A;  1PM5 A;  1MU5 A;  4B3R M;  1HR0 M;  1XMO M;  4MGI E;  4Z2G A;  1Z6T A;  2IOU A;  1TH2 A;  2X8A A;  2NQ8 C;  1XXH E;  5BPV A;  5DFL A;  4YY3 M;  3U6M A;  2DWM A;  4NYU A;  1IY0 A;  1TH4 A;  3FRI A;  1R5L A;  1E32 A;  3I51 A;  1QQW A;  3GLG B;  1E9R A;  3K92 A;  4KOD A;  1H6U A;  2Y2H A;  3GPU A;  3U6C A;  2L7H A;  4WP2 A;  1GVN A;  1Z5A A;  4M0W A;  3CTW B;  2FFJ A;  2JXN A;  4XK8 F;  3U6P A;  2ERC A;  3LVV A;  2DHY A;  1GXD A;  1HQC A;  1G41 A;  2R45 A;  3U6L A;  1R7R A;  4QOS A;  1E8B A;  4OUI A;  2EJS A;  1R2Y A;  1W1P A;  2HHH M;  5EXP A;  5EXX A;  1IN7 A;  4FD2 A;  3GLF A;  2DXI A;  1F4I A;  1JB0 F;  1FNN A;  2D49 A;  3FUW A;  4G4R A;  1ED7 A;  1G71 A;  2DZL A;  2O25 A;  4GRI A;  4ANR A;  3GRV A;  4W5W A;  4OX9 M;  2JY6 B;  3QYE A;  2R4J A;  1WHC A;  2DAK A;  3ZH9 B;  4LF5 M;  4DV2 M;  2CE7 A;  3DOA A;  1TF0 B;  2EUC A;  2QBY B;  4MH0 E;  4MGZ E;  2Q2E B;  5ITT A;  3U60 A;  1YUB A;  4FCT A;  3ZC7 B;  3VKG A;  1D0M A;  2QSF X;  3T38 A;  2KNZ A;  4Y28 F;  3IHP A;  5ITX A;  4DBG B;  2D7H A;  1NY6 A;  4GIP A;  4HLQ A;  2XFS A;  3VK8 A;  1YU0 A;  1IXR C;  4GC9 A;  2FN2 A;  3V76 A;  4DUY M;  4LG2 A;  1QDR A;  3SBJ A;  3J27 B;  2OOA A;  3I4V A;  3SAU A;  3KSX A;  2UXC M;  3KVW A;  4IBC A;  2UUC M;  1D2N A;  4IBG A;  2CRU A;  3KW6 A;  4R3D A;  5KQ8 A;  1IY2 A;  4LRS A;  3U6O A;  2Y2P A;  1GO5 A;  1J5E M;  1MJG M;  4L8R C;  2DWZ B;  4Q7J A;  1IN8 A;  2J7N A;  1AIW A;  4JI3 M;  1J7K A;  4D81 A;  1E6P A;  3FUV A;  3M7G A;  5EJC A;  2XD5 A;  4M9S A;  3LMM A;  2JY8 A;  1IBL M;  4IJE A;  2R6F A;  3L25 A;  3A98 B;  5EXT A;  2J5Y A;  4G4O A;  1JR3 A;  5FTK A;  2R4E A;  3U5Z A;  4LGM A;  4MGY E;  1G59 A;  2DAI A;  4MM3 B;  4NC6 A;  1EFU B;  1OFH A;  4IBK A;  1QO6 A;  2A5Y B;  2CEA A;  1W5S A;  3WD1 A;  2XGN A;  2Z4S A;  4NOO B;  4D82 A;  1WGL A;  2P5T A;  3LCU A;  2C98 A;  2CHQ A;  4DV7 M;  3VK7 A;  3LQR A;  5ITY A;  1T3T A;  4II7 A;  3U6D A;  2CFO A;  4NRV A;  2KXE A;  4DV4 M;  3J7A S;  1YLA A;  2K9D A;  2MRO B;  4IIW A;  5FTL A;  1QUT A;  3SAW A;  2X4A A;  3FTF A;  2V1C A;  1YUE A;  2FFF B;  4DV5 M;  3HON A;  1E15 A;  2O01 F;  4NZ5 A;  1IM2 A;  1Z5C A;  4JI2 M;  2JE5 A;  3CF6 E;  1P3Q Q;  2KRK A;  2LHC A;  1WR1 B;  1S3S A;  5BR8 M;  3L28 A;  1IXS A;  3K8Z A;  3DA1 A;  3GLI A;  2LVP C;  1E88 A;  4IBF A;  4D80 A;  2MH8 A;  2JNH A;  2VF8 A;  3SYK A;  3PNV A;  3KP1 E;  3U60 B;  1OGB A;  3HZJ A;  3TE6 A;  3KP0 E;  3T1H M;  1HNZ M;  4LF8 M;  2DEN A;  1W1V A;  2BWE A;  2I7N A;  4MGK E;  1HJP A;  1G8P A;  1SXJ E;  5FTN A;  4AQY M;  1OFI A;  1IFY A;  4LY6 A;  4TX8 A;  1VEG A;  2ZAN A;  3M6A A;  3SMP A;  3ZQJ A;  1GPF A;  3F92 A;  1H0I A;  4DUZ M;  4I81 A;  2ZTC A;  4KHP M;  2DNA A;  4G3O A;  3AOE A;  2UU9 M;  4OJ5 A;  1YSY A;  1XWI A;  4DR5 M;  4Z2H A;  1E6R A;  1QZE A;  2Y0Q A;  1QAM A;  2R18 A;  2HKJ A;  3CF2 A;  3GLF E;  3DZD A;  2GQF A;  3B74 A;  3NBX X;  4DV0 M;  1TR8 A;  4B3S M;  1GOI A;  3UZU A;  3BXW A;  2VF7 A;  1QZM A;  1GL7 A;  4FCW A;  3K9P A;  1IY1 A;  4M9X A;  1D0L A;  2UXB M;  4DV3 M;  4NY2 A;  4JI0 M;  2OQ4 A;  1Q3C A;  1L1T A;  1PJJ A;  1NJG A;  3HHW A;  1H8P A;  3LQQ A;  1ZAE A;  2CUZ A;  2LVA A;  4WUR A;  3J80 S;  3U5Z B;  1XMQ M;  1TDH A;  4NZ3 A;  3K1J A;  4JI8 M;  1WGN A;  4B7G A;  4OJO A;  4HL4 A;  4YHH M;  1NJF A;  4JI1 M;  2Y0T A;  3KS4 A;  3GP1 A;  2FE8 A;  2Y2N A;  2XZF A;  2CHV A;  4FVM A;  1K82 A;  1G4A E;  2L4E A;  4M0D A;  1N33 M;  4AW4 A;  2RGO A;  2MGW A;  2D7G A;  3I4Y A;  5EQT A;  3HX3 A;  4L4U A;  2F4V M;  4HEO A;  2V1U A;  5E6J A;  1NVM A;  1Q39 A;  3FKE A;  4LJ7 A;  1I94 M;  4B3T M;  1QDT A;  4G4Q A;  4FWG A;  2M5Z A;  3WD2 A;  4NXM M;  2KZU A;  1OAO C;  2FH0 A;  4OJL A;  4JXJ A;  4S12 A;  2L6O A;  4L15 A;  1N75 A;  3R9X B;  3B7Z A;  4KLN A;  3GQ3 A;  3U61 A;  2DAG A;  1L1Z A;  4JI6 M;  4GEW A;  2RRU A;  4LCB A;  3BOS A;  3K2L A;  1Q3B A;  2CV2 A;  2JP7 A;  4I4L A;  5JI3 E;  2EKK A;  3EIH A;  5IWA M;  1C7Y A;  2JZ0 A;  4GKJ M;  3AOG A;  2Y20 A;  1W1Y A;  2G5G X;  3R8F A;  4MB4 A;  1ORY B;  1N36 M;  1KFV A;  3SFZ A;  1DGH A;  1SG9 A;  4DR7 M;  1PRB A;  2Y2I A;  2RGH A;  3UJN A;  3FUX A;  2XD1 A;  3H4J A;  1GLN A;  2FNA A;  3WX7 A;  4LJ4 A;  4OJ6 A;  3UK6 A;  5FTM A;  5KQD A;  2E5L M;  4G6Z A;  2HCB A;  4CIZ A;  5ITX E;  3U6Q A;  2R65 A;  2Y2M A;  2KZS A;  3A45 A;  3VDU A;  1SXJ B;  3JR4 A;  1KS0 A;  1HQY E;  2DZN B;  1IN5 A;  2JWS A;  1NNU C;  5E26 A;  2Y2G A;  1GAB A;  4B3M M;  1GJT A;  4LFB M;  3LCV B;  2B3T A;  3HWS A;  3FTD A;  3KSJ A;  2LWX A;  4LJ5 A;  3M7P A;  3WD0 A;  3LW5 F;  1NY5 A;  3FUU A;  1NHG C;  4I5S A;  3GLF B;  2Z3X A;  2DZO B;  1ZMU A;  3IG5 A;  3D8L A;  1NHW C;  3GLH A;  2XLJ A;  4K0K M;  4Z2J A;  4AKI A;  2LHG A;  3TWL A;  1JR3 E;  1LV7 A;  2KNV A;  2LXE A;  1I4W A;  3FTC A;  3HU3 A;  3KOY E;  3T6P A;  5KO3 A;  3Q8G A;  4QNL A;  5GKN A;  3FTE A;  4P17 A;  4RKU F;  2QP9 X;  1HT2 E;  3SAR A;  5DYG A;  2QEN A;  4JYA M;  1IBK M;  4FCV A;  1UFZ A;  1YE9 A;  2DKL A;  5DYI A;  1IN6 A;  5IRE B;  2VQE M;  3Q8X A;  4OU7 A;  2Z8Y M;  5H37 D;  4B7F A;  4IBB A;  3GPX A;  5ITR A;  1WIV A;  3HHY A;  3H4M A;  3SHG B;  3U61 B;  2JY7 A;  3FE3 A;  4GH9 A;  2WSE F;  3MJ5 A;  4HMC A;  1SXJ C;  2JCH A;  2HL7 A;  2VDB B;  1TGU A;  1NSF A;  3NWL A;  2XZU A;  1XNR M;  2V6Z M;  3FRH A;  5A2Q S;  2LVN C;  3RFW A;  4DR6 M;  2LVO C;  3SC3 A;  1JQJ C;  4R71 A;  3MHV C;  1QAQ A;  3C3E A;  3GLI E;  3PFI A;  2F5N A;  3KOW E;  4JI4 M;  2Y2K A;  2QHO B;  2YQZ A;  3BBZ A;  1YU2 A;  1PJS A;  3C58 A;  1OIZ A;  1OKS A;  4LFA M;  3VKH A;  1E94 E;  2R46 A;  2Y2J A;  1Q02 A;  2LTU A;  2XEP A;  3RGP A;  2UUA M;  4X65 M;  2K47 A;  1QUS A;  2C5R A;  1LTM A;  2KW0 A;  1V33 A;  2L4F A;  3THG A;  1PDC A;  3A42 A;  1X37 A;  2OPF A;  3FYD A;  5FTJ A;  1NO1 A;  2XSZ D;  4X62 M;  2K6B A;  3HU2 A;  4NZ4 A;  4MB5 A;  4DR1 M;  4LGY A;  5KPT A;  2F5O A;  4LFC M;  1L8Q A;  3B89 A;  1DGG A;  3GLG A;  3SAV A;  1W5T A;  4OVZ A;  3W68 A;  2EO2 A;  2YFQ A;  1R4G A;  2G3Q A;  2APL A;  4LZZ A;  4EIW A;  2RTS A;  2BWB A;  2ZAO A;  2WSF F;  4GHA A;  1J7M A;  4JN6 A;  3D8B A;  3GLH B;  4OJP A;  1O6I A;  2YNM D;  4FW9 A;  2R0I A;  2EA0 A;  1Y8G A;  3FD9 A;  3FYC A;  3TQS A;  4X66 M;  3KS8 A;  2CV1 A;  2BNK A;  4LF7 M;  2VII A;  2Z4R A;  4QOZ C;  3GRR A;  1HNX M;  3ZCB B;  5LMN M;  4NYY A;  2XF3 A;  1D0K A;  2XFT A;  1DV0 A;  1E9S A;  4L78 A;  3LVW A;  4NSR A;  2OO9 A;  3KXE C;  3E9S A;  3TPZ A;  3W0L B;  4QHT A;  4PD2 A;  1WJ7 A;  3T1Y M;  3VDP A;  1RU3 A;  3KOZ E;  4MB7 A;  1YU3 A;  4BBA A;  2HAK A;  5EP4 A;  3TWK A;  3FUT A;  3IG8 A;  3HU1 A;  2O5R A;  2Y2Q A;  2KHH A;  2WZJ A;  4DR2 M;  1UR8 A;  2CWB A;  3ILK A;  3KOX E;  4B08 A;  2CP8 A;  4XGI A;  5KPR A;  2Y2L A;  1G3I A;  3VLF B;  2W82 A;  5EP2 A;  1UM8 A;  4CJ6 A;  2Y2O A;  3B7N A;  4KT0 F;  4MB3 A;  3HHZ A;  1TTE A;  3L29 A;  5IT9 S;  1SXJ D;  4PT5 A;  1K3X A;  4NRW A;  1FJG M;  4NL4 H;  1OQY A;  5C18 A;  3E4R A;  1E6N A;  1IXS B;  2H5X A;  1OTR A;  1H0G A;  3GLI B;  2KRU A;  3GRU A;  4FWH A;  5EP3 A;  1VG5 A;  5IZ7 D;  2QNJ A;  1E6Z A;  5F3W A;  2ZBK B;  3L2A A;  4MGH A;  3JR5 A;  4Z2L A;  3JAM S;  1DO2 A;  2UUB M;  4TUW A;  2QQ8 A;  1L2D A;  1ZMV A;  4IJF A;  1W1T A;  1EAK A;  1V34 A;  2ZAM A;  2LVQ D;  3I01 M;  4GIT A;  3A46 A;  4LZJ A;  4DV1 M;  4LJ6 A;  2XH9 A;  4F2L A;  4Z6Y A;  4HMD A;  4M9Z A;  4OVZ B;  3TL4 X;  3SMS A;  4R7G A;  1HNW M;  1N77 A;  5EXS A;  1KYI A;  2K0B X;  2R44 A;  1UR9 A;  1Z5B A;  3VFD A;  3OTO M;  1XXH A;  3HKP A;  2C9C A;  1L2B A;  1OAI A;  1CXW A;  4X64 M;  2BJV A;  1L2C A;  1VDD A;  3IEC A;  1YU1 A;  2D7E A;  4JI7 M;  4HME A;  2RKO A;  4LJA A;  3AFH A;  1GKI A;  2KEB A;  2DVW B;  3GLH E;  3E46 A;  4NXN M;  3KFU G;  4REZ A;  1Z59 A;  4LJ9 A;  1CUK A;  3B7Q A;  4CHT B;  3QYB A;  1IBM M;  4GHL A;  3GQ5 A;  1DGB A;  3DFZ A;  2L2D A;  4LRT A;  2X49 A;  1TDZ A;  2BJW A;  4GMQ A;  2DWL A;  1QVR A;  2HWJ A;  4DR4 M;  3J7B A;  1BVS A;  3GQ4 A;  2H1R A;  4Z2I A;  1VEK A;  1EE8 A;  1V92 A;  4FWD A;  2V5O A;  2C96 A;  4I8O A;  3PXG A;  4PDI A;  4KO8 A;  3L27 A;  3M0E A;  1KSF X;  1TH3 A;  2FOI C;  5EP1 A;  3U6E A;  4RF0 A;  5DNY A;  2L7I A;  4RNA A;  1NV8 A;  2KDL A;  2DAM A;  4QHS A;  4CIS A;  4B7H A;  5FSW A;  1A5T A;  1QAN A;  3AOE C;  4IBJ A;  4DV6 M;  3GO8 A;  3AKZ A;  4G4N A;  2QCU A;  5JI2 E;  2L09 A;  2KA6 B;  2LH0 A;  1ZMW A;  2F5S A;  1QYR A;  1OIP A;  4LF6 M;  1N78 A;  1IN4 A;  4GKK M;  3HHX A;  2QZ4 A;  1GL6 A;  3UGJ A;  2FS1 A;  1XC8 A;  1NV9 A;  3QAU A;  5ITU A;  3QWL A;  3TWM A;  4ITQ A;  1R6B X;  1DGH B;  4AZF A;  4XBO A;  2JA2 A;  4NSO B;  2XSZ A;  2I7P A;  4LF4 M;  3C9P A;  3AV0 A;  4IBD A;  1N32 M;  2OOB A;  4PDG A;  3HSH A;  8CAT A;  1XXH B;  3GLG E;  3SAS A;  5KPZ A;  4AG5 A;  1HT1 E;  3J81 S;  5L8R F;  1NNJ A;  1PJQ A;  3SHF A;  1JR3 D;  2AHM A;  3MK6 A;  1N34 M;  2KNA A;  3B9P A;  2R62 A;  3CF0 A;  4L16 A;  2M60 A;  4AI6 A;  1DO0 A;  1EIJ A;  3EIE A;  4F1I A;  4QNR A;  2JZ1 A;  1GJS A;  3WHK A;  5C1B A;  3GPP A;  3W0F A;  4L6V 6;  2VQF M;  1L6J A;  5FLX S;  2MR9 A;  2F5P A;  4BB9 A;  4Z2K A;  1CK7 A;  2EKF A;  1MN3 A;  2WSC F;  2J7O A;  1XB2 B;  4OW0 A;  4UN2 B;  4WW0 A;  2N35 A;  3SYL A;  2MJ5 B;  4BLC A;  3WHL A;  1R2Z A;  4NZ1 A;  1OJL A;  3AJI B;  2DWN A;  4P16 A;  1T43 A;  1DGF A;  2JUJ A;  2Y21 A;  1OGG A;  1AUA A;  2CV0 A;  2UXD M;  2QPA A;  2DAE A;  3CGW A;  3I04 M;  2C99 A;  2UWX A;  2C9O A;  3HJS A;  1ZV1 A;  3K9O A;  4RF1 A;  1YU4 A;  3WD3 A;  1IQP A;  1VQ1 A;  1C1K A;  1VEJ A;  2LNH C;  3HJQ A;  2G8L A;  4AG6 A;  2ZM6 M;  4AKH A;  3HGI A;  4A3V B;  1AIP C;  2F5Q A;  3HY5 A;  3GRY A;  3MQL A;  3KDS E;  3U6S A;  3W67 A;  4Z8X A;  2GNO A;  3HJ8 A;  1XHB A;  4IBI A;  3SAT A;  4ZPX A;  2DI0 A;  7CAT A;  2DHR A;  4LJ8 A;  1WXQ A;  3C3D A;  2QBY A;  1SXJ A;  4IBE A;  1ZQ9 A;  3UMM A;  3T15 A;  4AKG A;  4JI5 M;  4QNM A;  3RE8 A;  1PJI A;  3AL0 C;  1PJT A;  2YR0 A;  3WD4 A;  1IXZ A;  4CGY B;  3N3F A;  3L26 A;  4JV5 M;  1VDL A;  2LBC A;  5ITQ A;  3GPY A;  3NBI A;  3MMP A;  4DR3 M;  3E21 A;  1K3W A;  4PCZ A;  1PGY A;  2BG1 A;  1MX0 A; 
#chains in the Genus database with same CATH homology
 4GC5 A;  1J09 A;  3J2P B;  3PVS A;  1XNQ M;  4LF9 M;  3PNY A;  5LMU M;  2CHG A;  1QAO A;  2Z7J A;  3RGS A;  1PM5 A;  1MU5 A;  4B3R M;  1HR0 M;  1XMO M;  4MGI E;  1Z6T A;  2IOU A;  1TH2 A;  2X8A A;  2NQ8 C;  5BPV A;  4YY3 M;  3U6M A;  2DWM A;  4NYU A;  1IY0 A;  1TH4 A;  1E32 A;  3I51 A;  1QQW A;  3GLG B;  1E9R A;  3K92 A;  4KOD A;  1H6U A;  2Y2H A;  3GPU A;  3U6C A;  2L7H A;  1GVN A;  1Z5A A;  4M0W A;  3CTW B;  2FFJ A;  3U6P A;  2ERC A;  3LVV A;  1HQC A;  1G41 A;  2R45 A;  3U6L A;  1R7R A;  4QOS A;  4OUI A;  1R2Y A;  2HHH M;  5EXP A;  5EXX A;  1IN7 A;  4FD2 A;  3GLF A;  2DXI A;  1FNN A;  3FUW A;  4G4R A;  4GRI A;  3GRV A;  4W5W A;  4OX9 M;  2R4J A;  3ZH9 B;  4LF5 M;  4DV2 M;  2CE7 A;  3DOA A;  2EUC A;  2QBY B;  4MH0 E;  4MGZ E;  2Q2E B;  5ITT A;  3U60 A;  1YUB A;  4FCT A;  3ZC7 B;  3VKG A;  3T38 A;  5ITX A;  2D7H A;  1NY6 A;  4GIP A;  4HLQ A;  2XFS A;  3VK8 A;  1YU0 A;  1IXR C;  4GC9 A;  4DUY M;  4LG2 A;  3SBJ A;  3J27 B;  3I4V A;  3SAU A;  3KSX A;  2UXC M;  3KVW A;  4IBC A;  2UUC M;  1D2N A;  4IBG A;  3KW6 A;  4R3D A;  5KQ8 A;  1IY2 A;  4LRS A;  3U6O A;  2Y2P A;  1J5E M;  4L8R C;  2DWZ B;  1IN8 A;  2J7N A;  4JI3 M;  1J7K A;  4D81 A;  3FUV A;  3M7G A;  5EJC A;  2XD5 A;  4M9S A;  3LMM A;  1IBL M;  4IJE A;  3L25 A;  3A98 B;  5EXT A;  4G4O A;  1JR3 A;  5FTK A;  2R4E A;  3U5Z A;  4LGM A;  4MGY E;  1G59 A;  4MM3 B;  4IBK A;  1OFH A;  2A5Y B;  2CEA A;  1W5S A;  2XGN A;  2Z4S A;  4NOO B;  4D82 A;  2P5T A;  2C98 A;  2CHQ A;  4DV7 M;  3VK7 A;  3LQR A;  5ITY A;  1T3T A;  4II7 A;  3U6D A;  2CFO A;  4NRV A;  4DV4 M;  3J7A S;  4IIW A;  5FTL A;  3SAW A;  2FFF B;  2X4A A;  3FTF A;  2V1C A;  1YUE A;  3HON A;  4DV5 M;  4NZ5 A;  1IM2 A;  1Z5C A;  4JI2 M;  2JE5 A;  3CF6 E;  2KRK A;  1S3S A;  5BR8 M;  3L28 A;  3K8Z A;  3DA1 A;  3GLI A;  4IBF A;  4D80 A;  3SYK A;  3PNV A;  3KP1 E;  3U60 B;  3TE6 A;  3KP0 E;  3T1H M;  1HNZ M;  4LF8 M;  2I7N A;  4MGK E;  5FTN A;  1G8P A;  1SXJ E;  4AQY M;  1OFI A;  4LY6 A;  2ZAN A;  3M6A A;  3SMP A;  4DUZ M;  4I81 A;  4KHP M;  2UU9 M;  3AOE A;  4OJ5 A;  1YSY A;  1XWI A;  4DR5 M;  2Y0Q A;  1QAM A;  2R18 A;  2HKJ A;  3CF2 A;  3DZD A;  4DV0 M;  4B3S M;  3UZU A;  4FCW A;  1QZM A;  1GL7 A;  4OJ6 A;  1IY1 A;  4M9X A;  2UXB M;  4DV3 M;  4NY2 A;  4JI0 M;  2OQ4 A;  1Q3C A;  1L1T A;  1PJJ A;  1NJG A;  3HHW A;  3LQQ A;  1ZAE A;  2CUZ A;  4WUR A;  3J80 S;  3U5Z B;  1XMQ M;  1TDH A;  4NZ3 A;  3K1J A;  4JI8 M;  4B7G A;  4OJO A;  4HL4 A;  4YHH M;  1NJF A;  4JI1 M;  2Y0T A;  3KS4 A;  3GP1 A;  2FE8 A;  2Y2N A;  2XZF A;  2CHV A;  4FVM A;  1K82 A;  1G4A E;  4M0D A;  1N33 M;  4AW4 A;  2RGO A;  2D7G A;  3I4Y A;  5EQT A;  4L4U A;  2F4V M;  2V1U A;  5E6J A;  1NVM A;  1Q39 A;  3FKE A;  4LJ7 A;  1I94 M;  4B3T M;  4G4Q A;  4FWG A;  2M5Z A;  4NXM M;  2KZU A;  4OJL A;  4JXJ A;  4S12 A;  2L6O A;  4L15 A;  1N75 A;  3R9X B;  3GQ3 A;  4KLN A;  3U61 A;  1L1Z A;  4JI6 M;  4LCB A;  3BOS A;  3K2L A;  1Q3B A;  2CV2 A;  4I4L A;  5JI3 E;  3EIH A;  5IWA M;  4GKJ M;  3AOG A;  2Y20 A;  2G5G X;  3R8F A;  1ORY B;  1N36 M;  1KFV A;  3SFZ A;  1DGH A;  4DR7 M;  2Y2I A;  2RGH A;  3UJN A;  3FUX A;  2XD1 A;  1GLN A;  2FNA A;  3WX7 A;  4LJ4 A;  3UK6 A;  5FTM A;  5KQD A;  2E5L M;  4G6Z A;  2HCB A;  5ITX E;  3U6Q A;  2Y2M A;  2R65 A;  2KZS A;  3A45 A;  3VDU A;  1SXJ B;  3JR4 A;  1HQY E;  2DZN B;  1IN5 A;  5E26 A;  1NNU C;  2Y2G A;  4B3M M;  4LFB M;  3HWS A;  3KSJ A;  3FTD A;  4LJ5 A;  2LWX A;  1NY5 A;  3FUU A;  1NHG C;  4I5S A;  3GLF B;  2Z3X A;  2DZO B;  3IG5 A;  3D8L A;  1NHW C;  3GLH A;  2XLJ A;  4K0K M;  4AKI A;  3TWL A;  1LV7 A;  2LXE A;  3FTC A;  1I4W A;  3KOY E;  3HU3 A;  5KO3 A;  4QNL A;  5GKN A;  3FTE A;  2QP9 X;  1HT2 E;  3SAR A;  5DYG A;  2QEN A;  4JYA M;  1IBK M;  4FCV A;  1YE9 A;  5DYI A;  1IN6 A;  5IRE B;  2VQE M;  3Q8X A;  4OU7 A;  5H37 D;  4B7F A;  4IBB A;  3GPX A;  5ITR A;  3HHY A;  3H4M A;  3SHG B;  3U61 B;  4GH9 A;  3MJ5 A;  1SXJ C;  2JCH A;  2HL7 A;  1TGU A;  1NSF A;  3NWL A;  2XZU A;  1XNR M;  2V6Z M;  5A2Q S;  3RFW A;  4DR6 M;  3SC3 A;  1JQJ C;  3MHV C;  1QAQ A;  2F5N A;  3PFI A;  4JI4 M;  3KOW E;  2Y2K A;  2YQZ A;  1YU2 A;  3C58 A;  4LFA M;  3VKH A;  1E94 E;  2R46 A;  2Y2J A;  2XEP A;  3RGP A;  2UUA M;  4X65 M;  2K47 A;  2C5R A;  2KW0 A;  3THG A;  3A42 A;  1X37 A;  2OPF A;  3FYD A;  5FTJ A;  2XSZ D;  4X62 M;  3HU2 A;  4NZ4 A;  4DR1 M;  4LGY A;  5KPT A;  2F5O A;  4LFC M;  1L8Q A;  3GLG A;  1DGG A;  3SAV A;  1W5T A;  4OVZ A;  2EO2 A;  2YFQ A;  4LZZ A;  4EIW A;  2ZAO A;  4GHA A;  4JN6 A;  3D8B A;  3GLH B;  4OJP A;  2YNM D;  4FW9 A;  2EA0 A;  3FD9 A;  3FYC A;  3TQS A;  4X66 M;  3KS8 A;  2CV1 A;  2BNK A;  4LF7 M;  2VII A;  2Z4R A;  4QOZ C;  3GRR A;  1HNX M;  3ZCB B;  5LMN M;  4NYY A;  2XF3 A;  2XFT A;  1E9S A;  4L78 A;  3LVW A;  4NSR A;  3KXE C;  3E9S A;  3TPZ A;  3W0L B;  4QHT A;  4PD2 A;  3T1Y M;  3VDP A;  3KOZ E;  4MB7 A;  1YU3 A;  4BBA A;  5EP4 A;  3TWK A;  3FUT A;  3IG8 A;  3HU1 A;  2O5R A;  2Y2Q A;  4DR2 M;  3ILK A;  3KOX E;  4B08 A;  4XGI A;  5KPR A;  2Y2L A;  1G3I A;  3VLF B;  2W82 A;  5EP2 A;  1UM8 A;  2Y2O A;  3HHZ A;  3L29 A;  5IT9 S;  1SXJ D;  4PT5 A;  1K3X A;  4NRW A;  1FJG M;  4NL4 H;  5C18 A;  3E4R A;  1IXS B;  3GLI B;  2KRU A;  3GRU A;  4FWH A;  5EP3 A;  5IZ7 D;  5F3W A;  2ZBK B;  3L2A A;  4MGH A;  3JR5 A;  3JAM S;  1DO2 A;  2UUB M;  4TUW A;  1L2D A;  4IJF A;  2ZAM A;  4GIT A;  3A46 A;  4LZJ A;  4DV1 M;  4LJ6 A;  2XH9 A;  4Z6Y A;  4M9Z A;  4OVZ B;  3TL4 X;  3SMS A;  4R7G A;  1HNW M;  1N77 A;  5EXS A;  1KYI A;  1Z5B A;  3VFD A;  3OTO M;  1XXH A;  3HKP A;  2C9C A;  1L2B A;  4X64 M;  2BJV A;  1L2C A;  1VDD A;  1YU1 A;  2D7E A;  4JI7 M;  2RKO A;  4LJA A;  3AFH A;  1GKI A;  2KEB A;  2DVW B;  4NXN M;  3KFU G;  4REZ A;  1Z59 A;  4LJ9 A;  4CHT B;  1IBM M;  4GHL A;  3GQ5 A;  1DGB A;  3DFZ A;  4LRT A;  1TDZ A;  2X49 A;  2BJW A;  4GMQ A;  2DWL A;  1QVR A;  4DR4 M;  3J7B A;  3GQ4 A;  2H1R A;  1EE8 A;  4FWD A;  2C96 A;  4I8O A;  3PXG A;  4PDI A;  4KO8 A;  3L27 A;  3M0E A;  1KSF X;  1TH3 A;  2FOI C;  5EP1 A;  3U6E A;  4RF0 A;  5DNY A;  2L7I A;  4RNA A;  4QHS A;  4CIS A;  4B7H A;  5FSW A;  4IBJ A;  1QAN A;  3AOE C;  4DV6 M;  3GO8 A;  3AKZ A;  4G4N A;  2QCU A;  5JI2 E;  2L09 A;  2KA6 B;  2LH0 A;  2F5S A;  1QYR A;  4LF6 M;  1N78 A;  1IN4 A;  4GKK M;  3HHX A;  2QZ4 A;  1GL6 A;  3UGJ A;  1XC8 A;  3QAU A;  5ITU A;  3QWL A;  3TWM A;  4ITQ A;  1R6B X;  1DGH B;  4AZF A;  4XBO A;  2JA2 A;  4NSO B;  2XSZ A;  2I7P A;  4LF4 M;  3AV0 A;  4IBD A;  1N32 M;  4PDG A;  3HSH A;  8CAT A;  1XXH B;  3SAS A;  5KPZ A;  4AG5 A;  1HT1 E;  3J81 S;  1NNJ A;  3SHF A;  1JR3 D;  2AHM A;  3MK6 A;  1N34 M;  3B9P A;  2R62 A;  3CF0 A;  4L16 A;  2M60 A;  4AI6 A;  1DO0 A;  3EIE A;  4QNR A;  3WHK A;  5C1B A;  3GPP A;  3W0F A;  2VQF M;  5FLX S;  2F5P A;  4BB9 A;  2J7O A;  4WW0 A;  4OW0 A;  3SYL A;  4BLC A;  3WHL A;  1R2Z A;  4NZ1 A;  1OJL A;  3AJI B;  2DWN A;  4P16 A;  1DGF A;  2Y21 A;  2CV0 A;  2UXD M;  2QPA A;  2C99 A;  2UWX A;  2C9O A;  3HJS A;  4RF1 A;  1YU4 A;  1IQP A;  2LNH C;  1C1K A;  3HJQ A;  2ZM6 M;  4AKH A;  2G8L A;  4AG6 A;  3HGI A;  4A3V B;  2F5Q A;  3GRY A;  3KDS E;  3U6S A;  4Z8X A;  3HJ8 A;  1XHB A;  4IBI A;  3SAT A;  4ZPX A;  7CAT A;  2DHR A;  4LJ8 A;  1WXQ A;  2QBY A;  1SXJ A;  4IBE A;  1ZQ9 A;  3UMM A;  3T15 A;  4AKG A;  4JI5 M;  4QNM A;  3RE8 A;  1PJI A;  3AL0 C;  2YR0 A;  1IXZ A;  4CGY B;  3N3F A;  3L26 A;  4JV5 M;  3GPY A;  5ITQ A;  3NBI A;  4DR3 M;  1K3W A;  4PCZ A;  2KXE A;  2BG1 A;  1MX0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...