4IJEA

Crystal structure of the zaire ebolavirus vp35 interferon inhibitory domain r312a/k319a/r322a mutant
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
124
structure length
124
Chain Sequence
PDISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLAPVPPSPAIDAGWVCVFQLQDGKTLGLKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords Polymerase cofactor VP35
publication title Development of RNA Aptamers Targeting Ebola Virus VP35.
pubmed doi rcsb
source organism Zaire ebolavirus
total genus 42
structure length 124
sequence length 124
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ijeA01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4ijeA02
4IBFA 3KS8A 4GH9A 4IBEA 4IBJA 3L2AA 3KS4A 4IJEA 3L28A 3L29A 4GHAA 3L25A 4IJFA 5BPVA 3L27A 4IBIA 4IBGA 4IBBA 3FKEA 4GHLA 4IBKA 3L26A 4IBCA 4IBDA 4LG2A
chains in the Genus database with same CATH superfamily
4IBFA 1C7YA 3C3DA 4DR4M 2OOAA 4B3RM 1CXWA 3E46A 3VDPA 2DZOB 3M7GA 1Q02A 3C58A 1E9RA 3J7BA 2Q2EB 4LF7M 4MGZE 3SBJA 1QZEA 4QOSA 4Z6YA 1QUSA 4M9SA 5FTNA 2HHHM 4NXNM 2R0IA 3HHXA 2LXEA 1OAIA 2ERCA 3U60A 4OUIA 4LJ7A 4CIZA 4X65M 1C1KA 2G8LA 5GKNA 3GLFA 1R2ZA 1H8PA 3HU2A 2R62A 4QHSA 3SC3A 4G6ZA 3IG8A 3RE8A 1G3IA 4WURA 4GIPA 5ITUA 5IT9S 2Y2QA 3SHFA 1QDRA 2K9DA 4IBCA 4MM3B 4FCTA 1SXJE 1QO6A 1QAOA 5EXTA 3U6OA 2L4EA 2I7PA 2KZSA 4CHTB 3GLIB 3SMSA 5BR8M 3GP1A 1EIJA 1D0LA 4M0WA 5EXSA 1IBKM 2Y20A 3TE6A 3SARA 1SXJD 3KFUG 4IBJA 4DUYM 1J09A 2YQZA 1W5SA 1WIVA 1Z5BA 2FH0A 2J7OA 3B89A 2JXNA 2LVQD 1XXHA 3WHKA 4MH0E 3KP1E 1NSFA 5C1BA 3CGWA 4NOOB 3TWLA 4IBIA 3CTWB 1TDZA 4LF5M 3K2LA 3KW6A 2CHVA 1P3QQ 3FKEA 2JZ1A 3M6AA 1YE9A 3FYCA 1UFZA 4MB3A 1OKSA 2DI0A 5EP2A 1E8BA 4NZ4A 2D7HA 2ZM6M 4R3DA 1OQYA 4AW4A 1Q3CA 2VQEM 2EA0A 1YU3A 2C98A 2R65A 4M0DA 5H37D 3W0FA 5A2QS 3GPYA 1TTEA 2EO2A 3B74A 4FWHA 1AUAA 2L7HA 3JR4A 1N36M 4GKKM 2Y2NA 4KT0F 1DGHA 3I4YA 4Z8XA 4ITQA 2BWBA 4LFCM 3IG5A 2F5OA 4WW0A 3GRRA 4KHPM 3TWKA 2QQ8A 1ZQ9A 3LQQA 3AOGA 2XD1A 2DWLA 5EJCA 1L2DA 1YSYA 2DZLA 3SFZA 2CP8A 3FYDA 5DYIA 1XB2B 4LF4M 2L2DA 2A5YB 4LRTA 1F4IA 4FWGA 4RF0A 2JNHA 1S3SA 1R7RA 4GITA 2JY7A 1I4WA 2Y0QA 2LBCA 1QUTA 4JI1M 5FTJA 1KSFX 2Z4RA 3PFIA 3ZCBB 1VEJA 3B9PA 4DV3M 2V6ZM 3GLHA 1HT2E 4NL4H 2Y2LA 2FE8A 1NNJA 2R45A 2L09A 2R46A 1HQYE 2APLA 2DNAA 2HCBA 3UK6A 1E6NA 3L2AA 4DR5M 2CFOA 2XH9A 1DGBA 3AOEA 5ITYA 3AKZA 3FTFA 3FUVA 7CATA 2MROB 4TX8A 1H0GA 5KPRA 3VDUA 1GXDA 4NYYA 2LTUA 4AKGA 5EP1A 2XD5A 5EXPA 4G4RA 2XSZA 1VG5A 3AFHA 3U5ZA 2QBYB 1SXJC 5EP4A 1PJJA 5DYGA 2Z4SA 2V5OA 4JI6M 2DAGA 4HEOA 1R2YA 4NRVA 2HKJA 4QNRA 4AI6A 1YU4A 3IHPA 2JCHA 1L6JA 4MB4A 1QANA 1QQWA 2EJSA 2UXDM 1BVSA 2LHCA 4CGYB 2Z3XA 3FRIA 3QYEA 3TQSA 3A98B 2LHGA 2YNMD 2QNJA 4M9XA 5IZ7D 4CJ6A 3OTOM 1V92A 2CUZA 5KO3A 3GLGE 2KRUA 4LF6M 1CUKA 1VDDA 3I04M 4NXMM 4K0KM 2CWBA 4DR6M 4NSRA 5BPVA 3TWMA 4YHHM 4HMDA 2N35A 1HJPA 1NNUC 1L2CA 1IN7A 3GLFE 1QDTA 1G41A 3U60B 1H6UA 4IBKA 2WZJA 2RRUA 4G4QA 2UXBM 1XNRM 4MB7A 3KOWE 3T1YM 2CHGA 4OU7A 2Y0TA 4RF1A 2FN2A 2KNAA 4REZA 3WD2A 1JR3E 2L7IA 1PDCA 3T6PA 3JR5A 2YR0A 4DV6M 4DR2M 2OOBA 3FTDA 3GLGA 2LWXA 1IM2A 2F5QA 2Y2OA 1OIPA 3A42A 2Y2KA 1OTRA 2XFSA 3HONA 3LVVA 3U6EA 2DZNB 2KNVA 2XFTA 1RU3A 3E4RA 5FTMA 4Z2HA 2VQFM 2CE7A 3VK7A 2BJVA 4IJFA 1W1PA 2J5YA 5IREB 3U6QA 1XXHE 4A3VB 5ITTA 2R6FA 3KOYE 4QNMA 1T3TA 2DHRA 2ZBKB 1QZMA 2ZTCA 3GO8A 2JA2A 4R7GA 1IY2A 1QAQA 1VQ1A 3L26A 2XZFA 1ZMVA 4IIWA 4F2LA 4NZ5A 1W1VA 1GJSA 3U6DA 3HHWA 1OFHA 1TH2A 1JR3A 4I5SA 3QAUA 2UWXA 4FCVA 2LVNC 2XEPA 3I51A 3B7QA 4MGKE 1SXJB 4JI7M 3QWLA 1TR8A 3AV0A 2O25A 3U6MA 4QOZC 1IQPA 2KA6B 1JQJC 1WJ7A 3HY5A 4Z2LA 3EIEA 2JY5A 1ORYB 3K92A 1PJSA 2LVPC 2R4EA 3KDSE 5JI2E 3WX7A 3I4VA 3A45A 1DGHB 5IWAM 1VEGA 2DHYA 3L25A 3GRYA 2F5SA 2H5XA 3T38A 3U6PA 4NZ1A 1Y8GA 1TDHA 1ZV1A 4IBBA 2K6BA 5L8RF 3ZC7B 3VKGA 2FOIC 2GQFA 1E6RA 3AJIB 3KSJA 4JI3M 2UXCM 1GL7A 1KS0A 3IECA 4YY3M 2K0BX 1CK7A 1HNWM 1N77A 1W1YA 1QVRA 2JZ0A 3HU1A 2Y2GA 3SASA 2JWSA 2CV0A 2UU9M 1HNZM 1OGGA 4OJ6A 5EP3A 2WSFF 1O6IA 1NVMA 1IFYA 3GLHE 1L2BA 2WSCF 2AHMA 4IBEA 1E32A 2XLJA 4PT5A 4TUWA 1GPFA 1W1TA 4MB5A 2DWNA 3C9PA 1MU5A 3D8LA 2JY6B 4FWDA 1UR8A 3PNVA 4XK8F 5C18A 2G5GX 1PM5A 1DO2A 2UUCM 1G59A 3FUTA 3MQLA 5KQDA 3H4JA 4AG5A 4QHTA 2QENA 2KRKA 3C3EA 3GLIA 4L4UA 2JE5A 4DR7M 4B3SM 2MJ5B 1PGYA 2EKFA 2F5NA 1H0IA 4B3TM 4PDGA 4OX9M 1NJGA 3WD0A 1OGBA 4M9ZA 3E21A 3LCUA 3U5ZB 2Y2IA 3HHYA 4Z2KA 3KXEC 3CF0A 4X62M 4OJPA 4L78A 3SYKA 3W0LB 3MHVC 2XSZD 1GOIA 5DNYA 5LMUM 2Y2MA 1OJLA 3J7AS 3WD3A 2QSFX 4AG6A 5FLXS 2QP9X 2QZ4A 2D49A 2HL7A 4I81A 3K9PA 1PJTA 2WSEF 1E6ZA 2EKKA 1VDLA 3KSXA 3HJQA 2F4VM 2KEBA 3M0EA 2DENA 3NWLA 3KP0E 2DVWB 3HGIA 3WHLA 2CRUA 4DV2M 2Y21A 2KZUA 4DV1M 3HHZA 1IXRC 1T43A 5FTLA 2VF8A 4XBOA 2CEAA 2Y2PA 2FFJA 4R71A 3KOXE 4NSOB 2RGOA 8CATA 1IBMM 1KFVA 4Y28F 3U6LA 1IN5A 2G3QA 1L1TA 3WD1A 2Z8YM 2P5TA 1DO0A 3JAMS 1HR0M 4F1IA 4LCBA 2ZAMA 1WGLA 3H4MA 3HZJA 1E88A 3FD9A 3Q8GA 1N32M 3QYBA 5EQTA 1PJQA 2DKLA 2EUCA 2LH0A 4JI5M 1LV7A 3HU3A 1N78A 2Y2HA 3SYLA 4OJLA 1R6BX 1VEKA 4CISA 4II7A 4FW9A 3KS4A 1UM8A 1IXZA 2CHQA 1I94M 4HMCA 3GLGB 3B7ZA 3LQRA 3FUXA 4NZ3A 1L1ZA 2M60A 2L6OA 3J2PB 3KVWA 4LFAM 1DGGA 1L8QA 4AKIA 1IXSA 1JB0F 3VK8A 1QYRA 3NBXX 2RTSA 2QPAA 1EFUB 3MMPA 3GLFB 4LF9M 1Z6TA 1GKIA 3KS8A 3HKPA 4DBGB 4DR1M 4AZFA 1N34M 1Z5AA 1ZMWA 2MGWA 4OJ5A 4MGHA 1A5TA 1NJFA 1D2NA 4OW0A 2BJWA 1E15A 2VDBB 3R9XB 3HJ8A 1N33M 1KYIA 1Q3BA 3FUWA 3AOEC 2FFFB 2KNZA 4B7GA 4DUZM 3U61A 4NRWA 1Q39A 4RKUF 2IOUA 2UUBM 1JR3D 5KPZA 3W67A 2DAIA 1IY0A 4GMQA 1PRBA 4DV5M 1G4AE 2OO9A 5E26A 1OAOC 1NV9A 4XGIA 1X37A 1ZMUA 4X66M 3M7PA 3MK6A 1NHGC 1YUEA 4L16A 1XXHB 1YUBA 4LGMA 3DFZA 1D0KA 3KOZE 4GEWA 3SHGB 1NO1A 3GRVA 1WR1B 3SMPA 3UJNA 1XC8A 1WHCA 1ZAEA 2CV2A 1E9SA 3FTEA 4LJAA 4BB9A 3GPUA 4LJ8A 3GQ4A 2BG1A 2KDLA 4S12A 2V1UA 1IY1A 1QAMA 3CF6E 3J81S 4JYAM 1HQCA 4KODA 2O5RA 1XHBA 3CF2A 3U6CA 5JI3E 4G4OA 2HWJA 4ZPXA 3L28A 5ITRA 1NY5A 4OJOA 4GC9A 1EE8A 3K8ZA 3J27B 2R44A 2LVOC 1ED7A 4I8OA 4JI2M 4OVZA 3RFWA 5ITXA 4IBGA 3U6SA 4G3OA 1J5EM 2ZAOA 2BNKA 1J7MA 4AKHA 1Z5CA 2LVAA 3GLIE 3J80S 2ZTDA 1MJGM 3F92A 3I01M 3K1JA 1R5LA 1E6PA 2HAKA 3BXWA 3HSHA 4LGYA 2VF7A 1J7KA 4BBAA 1LTMA 4WP2A 4DR3M 1MX0A 4I4LA 3W68A 3GPXA 1YU2A 3SATA 4LZZA 3LCVB 2J7NA 3GQ5A 3SAUA 1SG9A 4GC5A 3NBIA 5LMNM 4B3MM 1K3WA 2CV1A 3HX3A 3RGPA 4NC6A 3GLHB 2MR9A 2D7EA 2I7NA 3VLFB 1TGUA 4L8RC 1OIZA 4LZJA 5FTKA 4D81A 4D80A 4DV0M 3L27A 3FTCA 2M5ZA 4Z2JA 3ILKA 2DWZB 4LJ5A 2JP7A 3SAVA 2C9CA 1PJIA 1SXJA 4JN6A 3UMMA 1GL6A 2RGHA 4NY2A 4IBDA 4JI4M 4ANRA 5DFLA 2F5PA 3BOSA 4DV7M 3B7NA 3AL0C 4LRSA 3FUUA 3GRUA 4JI0M 2QCUA 4FCWA 2BWEA 3PXGA 3E9SA 4KO8A 1TH3A 3TPZA 1EAKA 1TH4A 2L4FA 3BBZA 4P17A 2C9OA 4B7HA 1WXQA 3K9OA 5FSWA 3MJ5A 1IN4A 2GNOA 4Z2IA 4B7FA 3PNYA 2Z7JA 3SAWA 4JV5M 4AQYM 4NYUA 1TF0B 3LMMA 2Y2JA 1XMQM 1IBLM 3FE3A 3L29A 4GRIA 4PCZA 1IN6A 4RNAA 2QHOB 1D0MA 3EIHA 4LY6A 1G8PA 2DAEA 1GVNA 4HL4A 4X64M 4QNLA 4GHLA 1HNXM 2C96A 2K47A 2O01F 4FVMA 2VIIA 3TL4X 3VFDA 4EIWA 4P16A 3D8BA 2RKOA 4LG2A 2X4AA 3DZDA 4PDIA 4GH9A 1AIPC 5KQ8A 1IXSB 3LVWA 1OFIA 4L6V6 3ZH9B 4DV4M 1R4GA 4Q7JA 4JXJA 1NHWC 1XNQM 2JY8A 2DWMA 2W82A 1Z59A 5E6JA 3GPPA 4G4NA 2OPFA 4LJ9A 1K82A 2MH8A 2H1RA 4LFBM 2C5RA 3ZQJA 2R4JA 2UUAM 2ZANA 3N3FA 1IN8A 3HWSA 3LW5F 4D82A 4GHAA 1E94E 2DAMA 2XF3A 4LF8M 3GQ3A 3U61B 3VKHA 1GABA 1UR9A 3UGJA 4GKJM 5KPTA 1WGNA 4UN2B 1HT1E 2B3TA 3PVSA 4W5WA 5F3WA 2C99A 2E5LM 1GO5A 2NQ8C 2JUJA 3T1HM 1YLAA 3HJSA 2KHHA 4BLCA 4KLNA 3WD4A 4HLQA 3RGSA 2DAKA 3DA1A 1FJGM 2FNAA 2D7GA 3UZUA 2KW0A 5ITQA 2XGNA 2FS1A 1XWIA 1V33A 3T15A 2OQ4A 4L15A 2DXIA 1DGFA 2R18A 1DV0A 1NY6A 2X49A 2KXEA 3V76A 3THGA 1MN3A 4IJEA 1XMOM 1N75A 2XZUA 4JI8M 2QBYA 1YU1A 4FD2A 4LJ4A 1K3XA 2YFQA 4B08A 5EXXA 2LNHC 3Q8XA 4LJ6A 3A46A 1GJTA 2V1CA 4MGYE 4PD2A 4MGIE 5ITXE 1NV8A 1G71A 1W5TA 4HMEA 1YU0A 4Z2GA 1AIWA 1T6OA 1FNNA 3R8FA 4OVZB 1GLNA 1V34A 3FRHA 2X8AA 3DOAA
chains in the Genus database with same CATH topology
4IBFA 4DR4M 4B3RM 3VDPA 2DZOB 3M7GA 3C58A 1E9RA 3J7BA 2Q2EB 4LF7M 4MGZE 3SBJA 4QOSA 4Z6YA 5FTNA 4M9SA 2HHHM 4NXNM 3HHXA 2LXEA 2ERCA 3U60A 4OUIA 4LJ7A 4X65M 1C1KA 2G8LA 5GKNA 3GLFA 1R2ZA 3HU2A 2R62A 4QHSA 3SC3A 4G6ZA 3IG8A 3RE8A 1G3IA 4WURA 4GIPA 5ITUA 5IT9S 2Y2QA 3SHFA 4MM3B 4IBCA 4FCTA 1SXJE 1QAOA 5EXTA 3U6OA 4CHTB 2I7PA 2KZSA 3GLIB 3SMSA 5BR8M 3GP1A 4M0WA 5EXSA 1IBKM 2Y20A 3TE6A 3SARA 1SXJD 3KFUG 4IBJA 4DUYM 1J09A 2YQZA 1W5SA 1Z5BA 2J7OA 3WHKA 1XXHA 4MH0E 3KP1E 1NSFA 5C1BA 4NOOB 3TWLA 4IBIA 3CTWB 1TDZA 4LF5M 3K2LA 3KW6A 2CHVA 3FKEA 3M6AA 1YE9A 3FYCA 5EP2A 4NZ4A 2D7HA 2ZM6M 4R3DA 4AW4A 2EA0A 1Q3CA 2VQEM 1YU3A 2C98A 2R65A 4M0DA 5H37D 3W0FA 5A2QS 3GPYA 2EO2A 4FWHA 4GKKM 1N36M 2Y2NA 2L7HA 3JR4A 1DGHA 3I4YA 4Z8XA 4ITQA 4LFCM 3IG5A 2F5OA 4WW0A 3GRRA 4KHPM 3TWKA 1ZQ9A 3LQQA 3AOGA 2XD1A 2DWLA 5EJCA 1L2DA 1YSYA 3SFZA 3FYDA 5DYIA 4LF4M 2A5YB 4LRTA 4FWGA 4RF0A 1S3SA 1R7RA 4GITA 2Y0QA 1I4WA 4JI1M 5FTJA 1KSFX 2Z4RA 3PFIA 3ZCBB 3B9PA 4DV3M 2V6ZM 3GLHA 1HT2E 4NL4H 2Y2LA 2FE8A 1NNJA 2R45A 2L09A 2R46A 1HQYE 2HCBA 3UK6A 3L2AA 4DR5M 2CFOA 2XH9A 1DGBA 3AOEA 5ITYA 3AKZA 3FTFA 3FUVA 7CATA 5KPRA 3VDUA 4NYYA 4AKGA 2XD5A 5EP1A 5EXPA 4G4RA 2XSZA 3AFHA 3U5ZA 2QBYB 1SXJC 5EP4A 1PJJA 5DYGA 2Z4SA 4JI6M 1R2YA 4NRVA 2HKJA 4QNRA 4AI6A 1YU4A 2JCHA 1QANA 1QQWA 2UXDM 4CGYB 2Z3XA 3TQSA 3A98B 2YNMD 4M9XA 5IZ7D 3OTOM 2CUZA 5KO3A 2KRUA 4LF6M 1VDDA 4NXMM 4K0KM 4DR6M 4NSRA 5BPVA 3TWMA 4YHHM 1NNUC 1L2CA 1IN7A 1G41A 3U60B 1H6UA 4IBKA 4G4QA 2UXBM 1XNRM 4MB7A 3KOWE 3T1YM 2CHGA 4OU7A 2Y0TA 4RF1A 4REZA 2L7IA 3JR5A 2YR0A 4DV6M 4DR2M 3FTDA 3GLGA 2F5QA 2LWXA 1IM2A 2Y2OA 3A42A 2Y2KA 2XFSA 3HONA 3LVVA 3U6EA 2DZNB 2XFTA 3E4RA 5FTMA 2VQFM 2CE7A 3VK7A 2BJVA 4IJFA 5IREB 3U6QA 4A3VB 5ITTA 3KOYE 4QNMA 1T3TA 2DHRA 2ZBKB 1QZMA 3GO8A 2JA2A 4R7GA 1IY2A 1QAQA 3L26A 2XZFA 4IIWA 4NZ5A 3U6DA 3HHWA 1OFHA 1TH2A 1JR3A 4I5SA 3QAUA 2UWXA 4FCVA 2XEPA 3I51A 4MGKE 1SXJB 4JI7M 3QWLA 3AV0A 4NZ3A 3U6MA 4QOZC 1IQPA 2KA6B 1JQJC 3EIEA 1ORYB 3K92A 5JI2E 3KDSE 2R4EA 3WX7A 3I4VA 3A45A 1DGHB 5IWAM 3L25A 3GRYA 2F5SA 3T38A 3U6PA 4NZ1A 3VKGA 1TDHA 4IBBA 3ZC7B 2FOIC 3AJIB 3KSJA 4JI3M 2UXCM 1GL7A 4YY3M 1HNWM 1N77A 1QVRA 3HU1A 2Y2GA 3SASA 2CV0A 2UU9M 1HNZM 4OJ6A 5EP3A 1NVMA 1L2BA 2Y2PA 2XLJA 2AHMA 4IBEA 1E32A 4PT5A 4TUWA 2DWNA 1MU5A 3D8LA 4FWDA 3PNVA 5C18A 2G5GX 1PM5A 1DO2A 2UUCM 1G59A 3FUTA 5KQDA 4AG5A 4QHTA 2QENA 2KRKA 3GLIA 2JE5A 4L4UA 4DR7M 4B3SM 2F5NA 4B3TM 4PDGA 4OX9M 1NJGA 4M9ZA 3U5ZB 2Y2IA 3HHYA 3KXEC 3CF0A 4X62M 4OJPA 4L78A 3SYKA 3W0LB 3MHVC 2XSZD 5DNYA 5LMUM 2Y2MA 1OJLA 3J7AS 4AG6A 5FLXS 2QP9X 2QZ4A 2HL7A 4I81A 3KSXA 3HJQA 2F4VM 2KEBA 3M0EA 3NWLA 3KP0E 2DVWB 3HGIA 3WHLA 4DV2M 2Y21A 2KZUA 4DV1M 3HHZA 1IXRC 5FTLA 4XBOA 2CEAA 2FFJA 3KOXE 4NSOB 2RGOA 8CATA 1IBMM 1KFVA 3U6LA 1IN5A 1L1TA 2P5TA 1DO0A 3JAMS 1HR0M 4LCBA 2ZAMA 3H4MA 3FD9A 1N32M 5EQTA 2EUCA 2LH0A 4JI5M 1LV7A 3HU3A 1N78A 2Y2HA 3SYLA 4OJLA 1R6BX 4CISA 4II7A 4FW9A 3KS4A 1UM8A 1IXZA 2CHQA 1I94M 3GLGB 3LQRA 3FUXA 1L1ZA 2M60A 2L6OA 3J2PB 3KVWA 4LFAM 1DGGA 1L8QA 4AKIA 3VK8A 1QYRA 2QPAA 3GLFB 4LF9M 1Z6TA 1GKIA 3KS8A 3HKPA 4DR1M 4AZFA 1N34M 1Z5AA 4OJ5A 4MGHA 1NJFA 1D2NA 4OW0A 2BJWA 3R9XB 3HJ8A 1N33M 1KYIA 1Q3BA 3FUWA 3AOEC 2FFFB 4B7GA 4DUZM 3U61A 4NRWA 1Q39A 2IOUA 2UUBM 1JR3D 5KPZA 1IY0A 4GMQA 4DV5M 1G4AE 5E26A 4XGIA 1X37A 4X66M 3MK6A 1NHGC 1YUEA 4L16A 1XXHB 1YUBA 4LGMA 3DFZA 3KOZE 3SHGB 3GRVA 3SMPA 3UJNA 2CV2A 1XC8A 1ZAEA 1E9SA 3FTEA 4LJAA 4BB9A 3GPUA 4LJ8A 3GQ4A 2BG1A 4S12A 2V1UA 1IY1A 1QAMA 3CF6E 3J81S 4JYAM 1HQCA 4KODA 2O5RA 1XHBA 3CF2A 3U6CA 5JI3E 4G4OA 4ZPXA 4OJOA 3L28A 5ITRA 1NY5A 4GC9A 1EE8A 3K8ZA 3J27B 4I8OA 4JI2M 4OVZA 3RFWA 5ITXA 4IBGA 3U6SA 1J5EM 2ZAOA 2BNKA 4AKHA 1Z5CA 3J80S 3K1JA 3HSHA 4LGYA 1J7KA 4BBAA 4DR3M 1MX0A 4I4LA 3GPXA 1YU2A 3SATA 4LZZA 2J7NA 3GQ5A 3SAUA 4GC5A 3NBIA 5LMNM 4B3MM 1K3WA 2CV1A 3RGPA 3GLHB 2D7EA 2I7NA 3VLFB 1TGUA 4L8RC 4LZJA 5FTKA 4D81A 4D80A 4DV0M 3L27A 3FTCA 2M5ZA 3ILKA 2DWZB 4LJ5A 3SAVA 2C9CA 1PJIA 1SXJA 4JN6A 3UMMA 1GL6A 2RGHA 4NY2A 4IBDA 4JI4M 2F5PA 3BOSA 4DV7M 3AL0C 4LRSA 3FUUA 3GRUA 4JI0M 2QCUA 4FCWA 3PXGA 3E9SA 4KO8A 1TH3A 3TPZA 1TH4A 2C9OA 4B7HA 1WXQA 5FSWA 3MJ5A 1IN4A 4B7FA 3PNYA 2Z7JA 3SAWA 4JV5M 4AQYM 4NYUA 3LMMA 2Y2JA 1XMQM 1IBLM 3L29A 4GRIA 4PCZA 1IN6A 4RNAA 4LY6A 3EIHA 1G8PA 4QNLA 1GVNA 4HL4A 4X64M 4GHLA 1HNXM 2C96A 2K47A 4FVMA 3TL4X 2VIIA 3VFDA 4EIWA 4P16A 3D8BA 2RKOA 4LG2A 2X4AA 3DZDA 4PDIA 4GH9A 5KQ8A 1IXSB 3LVWA 1OFIA 3ZH9B 4DV4M 4JXJA 1NHWC 1XNQM 2DWMA 2W82A 1Z59A 5E6JA 3GPPA 4G4NA 2OPFA 4LJ9A 1K82A 2H1RA 4LFBM 2C5RA 2R4JA 2UUAM 2ZANA 3N3FA 1IN8A 3HWSA 4D82A 4GHAA 1E94E 2XF3A 4LF8M 3GQ3A 3U61B 3VKHA 3UGJA 4GKJM 5KPTA 1HT1E 3PVSA 4W5WA 5F3WA 2C99A 2E5LM 2NQ8C 3T1HM 3HJSA 4BLCA 4KLNA 4HLQA 3RGSA 3DA1A 1FJGM 2FNAA 2D7GA 3UZUA 2KW0A 5ITQA 2XGNA 1XWIA 3T15A 2OQ4A 4L15A 2DXIA 1DGFA 2R18A 1NY6A 2X49A 2KXEA 3THGA 4IJEA 1XMOM 1N75A 2XZUA 4JI8M 2QBYA 1YU1A 4FD2A 4LJ4A 1K3XA 2YFQA 4B08A 5EXXA 2LNHC 3Q8XA 4LJ6A 3A46A 2V1CA 4MGYE 4PD2A 4MGIE 5ITXE 1W5TA 1YU0A 1FNNA 3R8FA 4OVZB 1GLNA 2X8AA 3DOAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IBF A;  3KS8 A;  4GH9 A;  4IBE A;  4IBJ A;  3L2A A;  3KS4 A;  4IJE A;  3L28 A;  3L29 A;  4GHA A;  3L25 A;  4IJF A;  5BPV A;  3L27 A;  4IBI A;  4IBG A;  4IBB A;  3FKE A;  4GHL A;  4IBK A;  3L26 A;  4IBC A;  4IBD A;  4LG2 A; 
#chains in the Genus database with same CATH topology
 4IBF A;  1C7Y A;  3C3D A;  4DR4 M;  2OOA A;  4B3R M;  1CXW A;  3E46 A;  3VDP A;  2DZO B;  3M7G A;  1Q02 A;  3C58 A;  1E9R A;  3J7B A;  2Q2E B;  4LF7 M;  4MGZ E;  3SBJ A;  1QZE A;  4QOS A;  4Z6Y A;  1QUS A;  4M9S A;  5FTN A;  2HHH M;  4NXN M;  2R0I A;  3HHX A;  2LXE A;  1OAI A;  2ERC A;  3U60 A;  4OUI A;  4LJ7 A;  4CIZ A;  4X65 M;  1C1K A;  2G8L A;  5GKN A;  3GLF A;  1R2Z A;  1H8P A;  3HU2 A;  2R62 A;  4QHS A;  3SC3 A;  4G6Z A;  3IG8 A;  3RE8 A;  1G3I A;  4WUR A;  4GIP A;  5ITU A;  5IT9 S;  2Y2Q A;  3SHF A;  1QDR A;  2K9D A;  4IBC A;  4MM3 B;  4FCT A;  1SXJ E;  1QO6 A;  1QAO A;  5EXT A;  3U6O A;  2L4E A;  2I7P A;  2KZS A;  4CHT B;  3GLI B;  3SMS A;  5BR8 M;  3GP1 A;  1EIJ A;  1D0L A;  4M0W A;  5EXS A;  1IBK M;  2Y20 A;  3TE6 A;  3SAR A;  1SXJ D;  3KFU G;  4IBJ A;  4DUY M;  1J09 A;  2YQZ A;  1W5S A;  1WIV A;  1Z5B A;  2FH0 A;  2J7O A;  3B89 A;  2JXN A;  2LVQ D;  1XXH A;  3WHK A;  4MH0 E;  3KP1 E;  1NSF A;  5C1B A;  3CGW A;  4NOO B;  3TWL A;  4IBI A;  3CTW B;  1TDZ A;  4LF5 M;  3K2L A;  3KW6 A;  2CHV A;  1P3Q Q;  3FKE A;  2JZ1 A;  3M6A A;  1YE9 A;  3FYC A;  1UFZ A;  4MB3 A;  1OKS A;  2DI0 A;  5EP2 A;  1E8B A;  4NZ4 A;  2D7H A;  2ZM6 M;  4R3D A;  1OQY A;  4AW4 A;  1Q3C A;  2VQE M;  2EA0 A;  1YU3 A;  2C98 A;  2R65 A;  4M0D A;  5H37 D;  3W0F A;  5A2Q S;  3GPY A;  1TTE A;  2EO2 A;  3B74 A;  4FWH A;  1AUA A;  2L7H A;  3JR4 A;  1N36 M;  4GKK M;  2Y2N A;  4KT0 F;  1DGH A;  3I4Y A;  4Z8X A;  4ITQ A;  2BWB A;  4LFC M;  3IG5 A;  2F5O A;  4WW0 A;  3GRR A;  4KHP M;  3TWK A;  2QQ8 A;  1ZQ9 A;  3LQQ A;  3AOG A;  2XD1 A;  2DWL A;  5EJC A;  1L2D A;  1YSY A;  2DZL A;  3SFZ A;  2CP8 A;  3FYD A;  5DYI A;  1XB2 B;  4LF4 M;  2L2D A;  2A5Y B;  4LRT A;  1F4I A;  4FWG A;  4RF0 A;  2JNH A;  1S3S A;  1R7R A;  4GIT A;  2JY7 A;  1I4W A;  2Y0Q A;  2LBC A;  1QUT A;  4JI1 M;  5FTJ A;  1KSF X;  2Z4R A;  3PFI A;  3ZCB B;  1VEJ A;  3B9P A;  4DV3 M;  2V6Z M;  3GLH A;  1HT2 E;  4NL4 H;  2Y2L A;  2FE8 A;  1NNJ A;  2R45 A;  2L09 A;  2R46 A;  1HQY E;  2APL A;  2DNA A;  2HCB A;  3UK6 A;  1E6N A;  3L2A A;  4DR5 M;  2CFO A;  2XH9 A;  1DGB A;  3AOE A;  5ITY A;  3AKZ A;  3FTF A;  3FUV A;  7CAT A;  2MRO B;  4TX8 A;  1H0G A;  5KPR A;  3VDU A;  1GXD A;  4NYY A;  2LTU A;  4AKG A;  5EP1 A;  2XD5 A;  5EXP A;  4G4R A;  2XSZ A;  1VG5 A;  3AFH A;  3U5Z A;  2QBY B;  1SXJ C;  5EP4 A;  1PJJ A;  5DYG A;  2Z4S A;  2V5O A;  4JI6 M;  2DAG A;  4HEO A;  1R2Y A;  4NRV A;  2HKJ A;  4QNR A;  4AI6 A;  1YU4 A;  3IHP A;  2JCH A;  1L6J A;  4MB4 A;  1QAN A;  1QQW A;  2EJS A;  2UXD M;  1BVS A;  2LHC A;  4CGY B;  2Z3X A;  3FRI A;  3QYE A;  3TQS A;  3A98 B;  2LHG A;  2YNM D;  2QNJ A;  4M9X A;  5IZ7 D;  4CJ6 A;  3OTO M;  1V92 A;  2CUZ A;  5KO3 A;  3GLG E;  2KRU A;  4LF6 M;  1CUK A;  1VDD A;  3I04 M;  4NXM M;  4K0K M;  2CWB A;  4DR6 M;  4NSR A;  5BPV A;  3TWM A;  4YHH M;  4HMD A;  2N35 A;  1HJP A;  1NNU C;  1L2C A;  1IN7 A;  3GLF E;  1QDT A;  1G41 A;  3U60 B;  1H6U A;  4IBK A;  2WZJ A;  2RRU A;  4G4Q A;  2UXB M;  1XNR M;  4MB7 A;  3KOW E;  3T1Y M;  2CHG A;  4OU7 A;  2Y0T A;  4RF1 A;  2FN2 A;  2KNA A;  4REZ A;  3WD2 A;  1JR3 E;  2L7I A;  1PDC A;  3T6P A;  3JR5 A;  2YR0 A;  4DV6 M;  4DR2 M;  2OOB A;  3FTD A;  3GLG A;  2LWX A;  1IM2 A;  2F5Q A;  2Y2O A;  1OIP A;  3A42 A;  2Y2K A;  1OTR A;  2XFS A;  3HON A;  3LVV A;  3U6E A;  2DZN B;  2KNV A;  2XFT A;  1RU3 A;  3E4R A;  5FTM A;  4Z2H A;  2VQF M;  2CE7 A;  3VK7 A;  2BJV A;  4IJF A;  1W1P A;  2J5Y A;  5IRE B;  3U6Q A;  1XXH E;  4A3V B;  5ITT A;  2R6F A;  3KOY E;  4QNM A;  1T3T A;  2DHR A;  2ZBK B;  1QZM A;  2ZTC A;  3GO8 A;  2JA2 A;  4R7G A;  1IY2 A;  1QAQ A;  1VQ1 A;  3L26 A;  2XZF A;  1ZMV A;  4IIW A;  4F2L A;  4NZ5 A;  1W1V A;  1GJS A;  3U6D A;  3HHW A;  1OFH A;  1TH2 A;  1JR3 A;  4I5S A;  3QAU A;  2UWX A;  4FCV A;  2LVN C;  2XEP A;  3I51 A;  3B7Q A;  4MGK E;  1SXJ B;  4JI7 M;  3QWL A;  1TR8 A;  3AV0 A;  2O25 A;  3U6M A;  4QOZ C;  1IQP A;  2KA6 B;  1JQJ C;  1WJ7 A;  3HY5 A;  4Z2L A;  3EIE A;  2JY5 A;  1ORY B;  3K92 A;  1PJS A;  2LVP C;  2R4E A;  3KDS E;  5JI2 E;  3WX7 A;  3I4V A;  3A45 A;  1DGH B;  5IWA M;  1VEG A;  2DHY A;  3L25 A;  3GRY A;  2F5S A;  2H5X A;  3T38 A;  3U6P A;  4NZ1 A;  1Y8G A;  1TDH A;  1ZV1 A;  4IBB A;  2K6B A;  5L8R F;  3ZC7 B;  3VKG A;  2FOI C;  2GQF A;  1E6R A;  3AJI B;  3KSJ A;  4JI3 M;  2UXC M;  1GL7 A;  1KS0 A;  3IEC A;  4YY3 M;  2K0B X;  1CK7 A;  1HNW M;  1N77 A;  1W1Y A;  1QVR A;  2JZ0 A;  3HU1 A;  2Y2G A;  3SAS A;  2JWS A;  2CV0 A;  2UU9 M;  1HNZ M;  1OGG A;  4OJ6 A;  5EP3 A;  2WSF F;  1O6I A;  1NVM A;  1IFY A;  3GLH E;  1L2B A;  2WSC F;  2AHM A;  4IBE A;  1E32 A;  2XLJ A;  4PT5 A;  4TUW A;  1GPF A;  1W1T A;  4MB5 A;  2DWN A;  3C9P A;  1MU5 A;  3D8L A;  2JY6 B;  4FWD A;  1UR8 A;  3PNV A;  4XK8 F;  5C18 A;  2G5G X;  1PM5 A;  1DO2 A;  2UUC M;  1G59 A;  3FUT A;  3MQL A;  5KQD A;  3H4J A;  4AG5 A;  4QHT A;  2QEN A;  2KRK A;  3C3E A;  3GLI A;  4L4U A;  2JE5 A;  4DR7 M;  4B3S M;  2MJ5 B;  1PGY A;  2EKF A;  2F5N A;  1H0I A;  4B3T M;  4PDG A;  4OX9 M;  1NJG A;  3WD0 A;  1OGB A;  4M9Z A;  3E21 A;  3LCU A;  3U5Z B;  2Y2I A;  3HHY A;  4Z2K A;  3KXE C;  3CF0 A;  4X62 M;  4OJP A;  4L78 A;  3SYK A;  3W0L B;  3MHV C;  2XSZ D;  1GOI A;  5DNY A;  5LMU M;  2Y2M A;  1OJL A;  3J7A S;  3WD3 A;  2QSF X;  4AG6 A;  5FLX S;  2QP9 X;  2QZ4 A;  2D49 A;  2HL7 A;  4I81 A;  3K9P A;  1PJT A;  2WSE F;  1E6Z A;  2EKK A;  1VDL A;  3KSX A;  3HJQ A;  2F4V M;  2KEB A;  3M0E A;  2DEN A;  3NWL A;  3KP0 E;  2DVW B;  3HGI A;  3WHL A;  2CRU A;  4DV2 M;  2Y21 A;  2KZU A;  4DV1 M;  3HHZ A;  1IXR C;  1T43 A;  5FTL A;  2VF8 A;  4XBO A;  2CEA A;  2Y2P A;  2FFJ A;  4R71 A;  3KOX E;  4NSO B;  2RGO A;  8CAT A;  1IBM M;  1KFV A;  4Y28 F;  3U6L A;  1IN5 A;  2G3Q A;  1L1T A;  3WD1 A;  2Z8Y M;  2P5T A;  1DO0 A;  3JAM S;  1HR0 M;  4F1I A;  4LCB A;  2ZAM A;  1WGL A;  3H4M A;  3HZJ A;  1E88 A;  3FD9 A;  3Q8G A;  1N32 M;  3QYB A;  5EQT A;  1PJQ A;  2DKL A;  2EUC A;  2LH0 A;  4JI5 M;  1LV7 A;  3HU3 A;  1N78 A;  2Y2H A;  3SYL A;  4OJL A;  1R6B X;  1VEK A;  4CIS A;  4II7 A;  4FW9 A;  3KS4 A;  1UM8 A;  1IXZ A;  2CHQ A;  1I94 M;  4HMC A;  3GLG B;  3B7Z A;  3LQR A;  3FUX A;  4NZ3 A;  1L1Z A;  2M60 A;  2L6O A;  3J2P B;  3KVW A;  4LFA M;  1DGG A;  1L8Q A;  4AKI A;  1IXS A;  1JB0 F;  3VK8 A;  1QYR A;  3NBX X;  2RTS A;  2QPA A;  1EFU B;  3MMP A;  3GLF B;  4LF9 M;  1Z6T A;  1GKI A;  3KS8 A;  3HKP A;  4DBG B;  4DR1 M;  4AZF A;  1N34 M;  1Z5A A;  1ZMW A;  2MGW A;  4OJ5 A;  4MGH A;  1A5T A;  1NJF A;  1D2N A;  4OW0 A;  2BJW A;  1E15 A;  2VDB B;  3R9X B;  3HJ8 A;  1N33 M;  1KYI A;  1Q3B A;  3FUW A;  3AOE C;  2FFF B;  2KNZ A;  4B7G A;  4DUZ M;  3U61 A;  4NRW A;  1Q39 A;  4RKU F;  2IOU A;  2UUB M;  1JR3 D;  5KPZ A;  3W67 A;  2DAI A;  1IY0 A;  4GMQ A;  1PRB A;  4DV5 M;  1G4A E;  2OO9 A;  5E26 A;  1OAO C;  1NV9 A;  4XGI A;  1X37 A;  1ZMU A;  4X66 M;  3M7P A;  3MK6 A;  1NHG C;  1YUE A;  4L16 A;  1XXH B;  1YUB A;  4LGM A;  3DFZ A;  1D0K A;  3KOZ E;  4GEW A;  3SHG B;  1NO1 A;  3GRV A;  1WR1 B;  3SMP A;  3UJN A;  1XC8 A;  1WHC A;  1ZAE A;  2CV2 A;  1E9S A;  3FTE A;  4LJA A;  4BB9 A;  3GPU A;  4LJ8 A;  3GQ4 A;  2BG1 A;  2KDL A;  4S12 A;  2V1U A;  1IY1 A;  1QAM A;  3CF6 E;  3J81 S;  4JYA M;  1HQC A;  4KOD A;  2O5R A;  1XHB A;  3CF2 A;  3U6C A;  5JI3 E;  4G4O A;  2HWJ A;  4ZPX A;  3L28 A;  5ITR A;  1NY5 A;  4OJO A;  4GC9 A;  1EE8 A;  3K8Z A;  3J27 B;  2R44 A;  2LVO C;  1ED7 A;  4I8O A;  4JI2 M;  4OVZ A;  3RFW A;  5ITX A;  4IBG A;  3U6S A;  4G3O A;  1J5E M;  2ZAO A;  2BNK A;  1J7M A;  4AKH A;  1Z5C A;  2LVA A;  3GLI E;  3J80 S;  2ZTD A;  1MJG M;  3F92 A;  3I01 M;  3K1J A;  1R5L A;  1E6P A;  2HAK A;  3BXW A;  3HSH A;  4LGY A;  2VF7 A;  1J7K A;  4BBA A;  1LTM A;  4WP2 A;  4DR3 M;  1MX0 A;  4I4L A;  3W68 A;  3GPX A;  1YU2 A;  3SAT A;  4LZZ A;  3LCV B;  2J7N A;  3GQ5 A;  3SAU A;  1SG9 A;  4GC5 A;  3NBI A;  5LMN M;  4B3M M;  1K3W A;  2CV1 A;  3HX3 A;  3RGP A;  4NC6 A;  3GLH B;  2MR9 A;  2D7E A;  2I7N A;  3VLF B;  1TGU A;  4L8R C;  1OIZ A;  4LZJ A;  5FTK A;  4D81 A;  4D80 A;  4DV0 M;  3L27 A;  3FTC A;  2M5Z A;  4Z2J A;  3ILK A;  2DWZ B;  4LJ5 A;  2JP7 A;  3SAV A;  2C9C A;  1PJI A;  1SXJ A;  4JN6 A;  3UMM A;  1GL6 A;  2RGH A;  4NY2 A;  4IBD A;  4JI4 M;  4ANR A;  5DFL A;  2F5P A;  3BOS A;  4DV7 M;  3B7N A;  3AL0 C;  4LRS A;  3FUU A;  3GRU A;  4JI0 M;  2QCU A;  4FCW A;  2BWE A;  3PXG A;  3E9S A;  4KO8 A;  1TH3 A;  3TPZ A;  1EAK A;  1TH4 A;  2L4F A;  3BBZ A;  4P17 A;  2C9O A;  4B7H A;  1WXQ A;  3K9O A;  5FSW A;  3MJ5 A;  1IN4 A;  2GNO A;  4Z2I A;  4B7F A;  3PNY A;  2Z7J A;  3SAW A;  4JV5 M;  4AQY M;  4NYU A;  1TF0 B;  3LMM A;  2Y2J A;  1XMQ M;  1IBL M;  3FE3 A;  3L29 A;  4GRI A;  4PCZ A;  1IN6 A;  4RNA A;  2QHO B;  1D0M A;  3EIH A;  4LY6 A;  1G8P A;  2DAE A;  1GVN A;  4HL4 A;  4X64 M;  4QNL A;  4GHL A;  1HNX M;  2C96 A;  2K47 A;  2O01 F;  4FVM A;  2VII A;  3TL4 X;  3VFD A;  4EIW A;  4P16 A;  3D8B A;  2RKO A;  4LG2 A;  2X4A A;  3DZD A;  4PDI A;  4GH9 A;  1AIP C;  5KQ8 A;  1IXS B;  3LVW A;  1OFI A;  4L6V 6;  3ZH9 B;  4DV4 M;  1R4G A;  4Q7J A;  4JXJ A;  1NHW C;  1XNQ M;  2JY8 A;  2DWM A;  2W82 A;  1Z59 A;  5E6J A;  3GPP A;  4G4N A;  2OPF A;  4LJ9 A;  1K82 A;  2MH8 A;  2H1R A;  4LFB M;  2C5R A;  3ZQJ A;  2R4J A;  2UUA M;  2ZAN A;  3N3F A;  1IN8 A;  3HWS A;  3LW5 F;  4D82 A;  4GHA A;  1E94 E;  2DAM A;  2XF3 A;  4LF8 M;  3GQ3 A;  3U61 B;  3VKH A;  1GAB A;  1UR9 A;  3UGJ A;  4GKJ M;  5KPT A;  1WGN A;  4UN2 B;  1HT1 E;  2B3T A;  3PVS A;  4W5W A;  5F3W A;  2C99 A;  2E5L M;  1GO5 A;  2NQ8 C;  2JUJ A;  3T1H M;  1YLA A;  3HJS A;  2KHH A;  4BLC A;  4KLN A;  3WD4 A;  4HLQ A;  3RGS A;  2DAK A;  3DA1 A;  1FJG M;  2FNA A;  2D7G A;  3UZU A;  2KW0 A;  5ITQ A;  2XGN A;  2FS1 A;  1XWI A;  1V33 A;  3T15 A;  2OQ4 A;  4L15 A;  2DXI A;  1DGF A;  2R18 A;  1DV0 A;  1NY6 A;  2X49 A;  2KXE A;  3V76 A;  3THG A;  1MN3 A;  4IJE A;  1XMO M;  1N75 A;  2XZU A;  4JI8 M;  2QBY A;  1YU1 A;  4FD2 A;  4LJ4 A;  1K3X A;  2YFQ A;  4B08 A;  5EXX A;  2LNH C;  3Q8X A;  4LJ6 A;  3A46 A;  1GJT A;  2V1C A;  4MGY E;  4PD2 A;  4MGI E;  5ITX E;  1NV8 A;  1G71 A;  1W5T A;  4HME A;  1YU0 A;  4Z2G A;  1AIW A;  1T6O A;  1FNN A;  3R8F A;  4OVZ B;  1GLN A;  1V34 A;  3FRH A;  2X8A A;  3DOA A; 
#chains in the Genus database with same CATH homology
 4IBF A;  4DR4 M;  4B3R M;  3VDP A;  2DZO B;  3M7G A;  3C58 A;  1E9R A;  3J7B A;  2Q2E B;  4LF7 M;  4MGZ E;  3SBJ A;  4QOS A;  4Z6Y A;  5FTN A;  4M9S A;  2HHH M;  4NXN M;  3HHX A;  2LXE A;  2ERC A;  3U60 A;  4OUI A;  4LJ7 A;  4X65 M;  1C1K A;  2G8L A;  5GKN A;  3GLF A;  1R2Z A;  3HU2 A;  2R62 A;  4QHS A;  3SC3 A;  4G6Z A;  3IG8 A;  3RE8 A;  1G3I A;  4WUR A;  4GIP A;  5ITU A;  5IT9 S;  2Y2Q A;  3SHF A;  4MM3 B;  4IBC A;  4FCT A;  1SXJ E;  1QAO A;  5EXT A;  3U6O A;  4CHT B;  2I7P A;  2KZS A;  3GLI B;  3SMS A;  5BR8 M;  3GP1 A;  4M0W A;  5EXS A;  1IBK M;  2Y20 A;  3TE6 A;  3SAR A;  1SXJ D;  3KFU G;  4IBJ A;  4DUY M;  1J09 A;  2YQZ A;  1W5S A;  1Z5B A;  2J7O A;  3WHK A;  1XXH A;  4MH0 E;  3KP1 E;  1NSF A;  5C1B A;  4NOO B;  3TWL A;  4IBI A;  3CTW B;  1TDZ A;  4LF5 M;  3K2L A;  3KW6 A;  2CHV A;  3FKE A;  3M6A A;  1YE9 A;  3FYC A;  5EP2 A;  4NZ4 A;  2D7H A;  2ZM6 M;  4R3D A;  4AW4 A;  2EA0 A;  1Q3C A;  2VQE M;  1YU3 A;  2C98 A;  2R65 A;  4M0D A;  5H37 D;  3W0F A;  5A2Q S;  3GPY A;  2EO2 A;  4FWH A;  4GKK M;  1N36 M;  2Y2N A;  2L7H A;  3JR4 A;  1DGH A;  3I4Y A;  4Z8X A;  4ITQ A;  4LFC M;  3IG5 A;  2F5O A;  4WW0 A;  3GRR A;  4KHP M;  3TWK A;  1ZQ9 A;  3LQQ A;  3AOG A;  2XD1 A;  2DWL A;  5EJC A;  1L2D A;  1YSY A;  3SFZ A;  3FYD A;  5DYI A;  4LF4 M;  2A5Y B;  4LRT A;  4FWG A;  4RF0 A;  1S3S A;  1R7R A;  4GIT A;  2Y0Q A;  1I4W A;  4JI1 M;  5FTJ A;  1KSF X;  2Z4R A;  3PFI A;  3ZCB B;  3B9P A;  4DV3 M;  2V6Z M;  3GLH A;  1HT2 E;  4NL4 H;  2Y2L A;  2FE8 A;  1NNJ A;  2R45 A;  2L09 A;  2R46 A;  1HQY E;  2HCB A;  3UK6 A;  3L2A A;  4DR5 M;  2CFO A;  2XH9 A;  1DGB A;  3AOE A;  5ITY A;  3AKZ A;  3FTF A;  3FUV A;  7CAT A;  5KPR A;  3VDU A;  4NYY A;  4AKG A;  2XD5 A;  5EP1 A;  5EXP A;  4G4R A;  2XSZ A;  3AFH A;  3U5Z A;  2QBY B;  1SXJ C;  5EP4 A;  1PJJ A;  5DYG A;  2Z4S A;  4JI6 M;  1R2Y A;  4NRV A;  2HKJ A;  4QNR A;  4AI6 A;  1YU4 A;  2JCH A;  1QAN A;  1QQW A;  2UXD M;  4CGY B;  2Z3X A;  3TQS A;  3A98 B;  2YNM D;  4M9X A;  5IZ7 D;  3OTO M;  2CUZ A;  5KO3 A;  2KRU A;  4LF6 M;  1VDD A;  4NXM M;  4K0K M;  4DR6 M;  4NSR A;  5BPV A;  3TWM A;  4YHH M;  1NNU C;  1L2C A;  1IN7 A;  1G41 A;  3U60 B;  1H6U A;  4IBK A;  4G4Q A;  2UXB M;  1XNR M;  4MB7 A;  3KOW E;  3T1Y M;  2CHG A;  4OU7 A;  2Y0T A;  4RF1 A;  4REZ A;  2L7I A;  3JR5 A;  2YR0 A;  4DV6 M;  4DR2 M;  3FTD A;  3GLG A;  2F5Q A;  2LWX A;  1IM2 A;  2Y2O A;  3A42 A;  2Y2K A;  2XFS A;  3HON A;  3LVV A;  3U6E A;  2DZN B;  2XFT A;  3E4R A;  5FTM A;  2VQF M;  2CE7 A;  3VK7 A;  2BJV A;  4IJF A;  5IRE B;  3U6Q A;  4A3V B;  5ITT A;  3KOY E;  4QNM A;  1T3T A;  2DHR A;  2ZBK B;  1QZM A;  3GO8 A;  2JA2 A;  4R7G A;  1IY2 A;  1QAQ A;  3L26 A;  2XZF A;  4IIW A;  4NZ5 A;  3U6D A;  3HHW A;  1OFH A;  1TH2 A;  1JR3 A;  4I5S A;  3QAU A;  2UWX A;  4FCV A;  2XEP A;  3I51 A;  4MGK E;  1SXJ B;  4JI7 M;  3QWL A;  3AV0 A;  4NZ3 A;  3U6M A;  4QOZ C;  1IQP A;  2KA6 B;  1JQJ C;  3EIE A;  1ORY B;  3K92 A;  5JI2 E;  3KDS E;  2R4E A;  3WX7 A;  3I4V A;  3A45 A;  1DGH B;  5IWA M;  3L25 A;  3GRY A;  2F5S A;  3T38 A;  3U6P A;  4NZ1 A;  3VKG A;  1TDH A;  4IBB A;  3ZC7 B;  2FOI C;  3AJI B;  3KSJ A;  4JI3 M;  2UXC M;  1GL7 A;  4YY3 M;  1HNW M;  1N77 A;  1QVR A;  3HU1 A;  2Y2G A;  3SAS A;  2CV0 A;  2UU9 M;  1HNZ M;  4OJ6 A;  5EP3 A;  1NVM A;  1L2B A;  2Y2P A;  2XLJ A;  2AHM A;  4IBE A;  1E32 A;  4PT5 A;  4TUW A;  2DWN A;  1MU5 A;  3D8L A;  4FWD A;  3PNV A;  5C18 A;  2G5G X;  1PM5 A;  1DO2 A;  2UUC M;  1G59 A;  3FUT A;  5KQD A;  4AG5 A;  4QHT A;  2QEN A;  2KRK A;  3GLI A;  2JE5 A;  4L4U A;  4DR7 M;  4B3S M;  2F5N A;  4B3T M;  4PDG A;  4OX9 M;  1NJG A;  4M9Z A;  3U5Z B;  2Y2I A;  3HHY A;  3KXE C;  3CF0 A;  4X62 M;  4OJP A;  4L78 A;  3SYK A;  3W0L B;  3MHV C;  2XSZ D;  5DNY A;  5LMU M;  2Y2M A;  1OJL A;  3J7A S;  4AG6 A;  5FLX S;  2QP9 X;  2QZ4 A;  2HL7 A;  4I81 A;  3KSX A;  3HJQ A;  2F4V M;  2KEB A;  3M0E A;  3NWL A;  3KP0 E;  2DVW B;  3HGI A;  3WHL A;  4DV2 M;  2Y21 A;  2KZU A;  4DV1 M;  3HHZ A;  1IXR C;  5FTL A;  4XBO A;  2CEA A;  2FFJ A;  3KOX E;  4NSO B;  2RGO A;  8CAT A;  1IBM M;  1KFV A;  3U6L A;  1IN5 A;  1L1T A;  2P5T A;  1DO0 A;  3JAM S;  1HR0 M;  4LCB A;  2ZAM A;  3H4M A;  3FD9 A;  1N32 M;  5EQT A;  2EUC A;  2LH0 A;  4JI5 M;  1LV7 A;  3HU3 A;  1N78 A;  2Y2H A;  3SYL A;  4OJL A;  1R6B X;  4CIS A;  4II7 A;  4FW9 A;  3KS4 A;  1UM8 A;  1IXZ A;  2CHQ A;  1I94 M;  3GLG B;  3LQR A;  3FUX A;  1L1Z A;  2M60 A;  2L6O A;  3J2P B;  3KVW A;  4LFA M;  1DGG A;  1L8Q A;  4AKI A;  3VK8 A;  1QYR A;  2QPA A;  3GLF B;  4LF9 M;  1Z6T A;  1GKI A;  3KS8 A;  3HKP A;  4DR1 M;  4AZF A;  1N34 M;  1Z5A A;  4OJ5 A;  4MGH A;  1NJF A;  1D2N A;  4OW0 A;  2BJW A;  3R9X B;  3HJ8 A;  1N33 M;  1KYI A;  1Q3B A;  3FUW A;  3AOE C;  2FFF B;  4B7G A;  4DUZ M;  3U61 A;  4NRW A;  1Q39 A;  2IOU A;  2UUB M;  1JR3 D;  5KPZ A;  1IY0 A;  4GMQ A;  4DV5 M;  1G4A E;  5E26 A;  4XGI A;  1X37 A;  4X66 M;  3MK6 A;  1NHG C;  1YUE A;  4L16 A;  1XXH B;  1YUB A;  4LGM A;  3DFZ A;  3KOZ E;  3SHG B;  3GRV A;  3SMP A;  3UJN A;  2CV2 A;  1XC8 A;  1ZAE A;  1E9S A;  3FTE A;  4LJA A;  4BB9 A;  3GPU A;  4LJ8 A;  3GQ4 A;  2BG1 A;  4S12 A;  2V1U A;  1IY1 A;  1QAM A;  3CF6 E;  3J81 S;  4JYA M;  1HQC A;  4KOD A;  2O5R A;  1XHB A;  3CF2 A;  3U6C A;  5JI3 E;  4G4O A;  4ZPX A;  4OJO A;  3L28 A;  5ITR A;  1NY5 A;  4GC9 A;  1EE8 A;  3K8Z A;  3J27 B;  4I8O A;  4JI2 M;  4OVZ A;  3RFW A;  5ITX A;  4IBG A;  3U6S A;  1J5E M;  2ZAO A;  2BNK A;  4AKH A;  1Z5C A;  3J80 S;  3K1J A;  3HSH A;  4LGY A;  1J7K A;  4BBA A;  4DR3 M;  1MX0 A;  4I4L A;  3GPX A;  1YU2 A;  3SAT A;  4LZZ A;  2J7N A;  3GQ5 A;  3SAU A;  4GC5 A;  3NBI A;  5LMN M;  4B3M M;  1K3W A;  2CV1 A;  3RGP A;  3GLH B;  2D7E A;  2I7N A;  3VLF B;  1TGU A;  4L8R C;  4LZJ A;  5FTK A;  4D81 A;  4D80 A;  4DV0 M;  3L27 A;  3FTC A;  2M5Z A;  3ILK A;  2DWZ B;  4LJ5 A;  3SAV A;  2C9C A;  1PJI A;  1SXJ A;  4JN6 A;  3UMM A;  1GL6 A;  2RGH A;  4NY2 A;  4IBD A;  4JI4 M;  2F5P A;  3BOS A;  4DV7 M;  3AL0 C;  4LRS A;  3FUU A;  3GRU A;  4JI0 M;  2QCU A;  4FCW A;  3PXG A;  3E9S A;  4KO8 A;  1TH3 A;  3TPZ A;  1TH4 A;  2C9O A;  4B7H A;  1WXQ A;  5FSW A;  3MJ5 A;  1IN4 A;  4B7F A;  3PNY A;  2Z7J A;  3SAW A;  4JV5 M;  4AQY M;  4NYU A;  3LMM A;  2Y2J A;  1XMQ M;  1IBL M;  3L29 A;  4GRI A;  4PCZ A;  1IN6 A;  4RNA A;  4LY6 A;  3EIH A;  1G8P A;  4QNL A;  1GVN A;  4HL4 A;  4X64 M;  4GHL A;  1HNX M;  2C96 A;  2K47 A;  4FVM A;  3TL4 X;  2VII A;  3VFD A;  4EIW A;  4P16 A;  3D8B A;  2RKO A;  4LG2 A;  2X4A A;  3DZD A;  4PDI A;  4GH9 A;  5KQ8 A;  1IXS B;  3LVW A;  1OFI A;  3ZH9 B;  4DV4 M;  4JXJ A;  1NHW C;  1XNQ M;  2DWM A;  2W82 A;  1Z59 A;  5E6J A;  3GPP A;  4G4N A;  2OPF A;  4LJ9 A;  1K82 A;  2H1R A;  4LFB M;  2C5R A;  2R4J A;  2UUA M;  2ZAN A;  3N3F A;  1IN8 A;  3HWS A;  4D82 A;  4GHA A;  1E94 E;  2XF3 A;  4LF8 M;  3GQ3 A;  3U61 B;  3VKH A;  3UGJ A;  4GKJ M;  5KPT A;  1HT1 E;  3PVS A;  4W5W A;  5F3W A;  2C99 A;  2E5L M;  2NQ8 C;  3T1H M;  3HJS A;  4BLC A;  4KLN A;  4HLQ A;  3RGS A;  3DA1 A;  1FJG M;  2FNA A;  2D7G A;  3UZU A;  2KW0 A;  5ITQ A;  2XGN A;  1XWI A;  3T15 A;  2OQ4 A;  4L15 A;  2DXI A;  1DGF A;  2R18 A;  1NY6 A;  2X49 A;  2KXE A;  3THG A;  4IJE A;  1XMO M;  1N75 A;  2XZU A;  4JI8 M;  2QBY A;  1YU1 A;  4FD2 A;  4LJ4 A;  1K3X A;  2YFQ A;  4B08 A;  5EXX A;  2LNH C;  3Q8X A;  4LJ6 A;  3A46 A;  2V1C A;  4MGY E;  4PD2 A;  4MGI E;  5ITX E;  1W5T A;  1YU0 A;  1FNN A;  3R8F A;  4OVZ B;  1GLN A;  2X8A A;  3DOA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...