4IJEA

Crystal structure of the zaire ebolavirus vp35 interferon inhibitory domain r312a/k319a/r322a mutant
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
124
structure length
124
Chain Sequence
PDISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLAPVPPSPAIDAGWVCVFQLQDGKTLGLKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polymerase cofactor VP35
publication title Development of RNA Aptamers Targeting Ebola Virus VP35.
pubmed doi rcsb
source organism Zaire ebolavirus
molecule tags Viral protein
total genus 42
structure length 124
sequence length 124
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ijeA01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4ijeA02
4GHLA 3L27A 4IBGA 3FKEA 4IBIA 3L29A 3L2AA 3KS8A 4LG2A 4IBCA 3L28A 4GH9A 4IBFA 3L26A 4IBDA 4IBBA 4GHAA 5BPVA 4IJFA 3KS4A 4IBKA 4IBEA 4IBJA 3L25A 4IJEA
chains in the Genus database with same CATH superfamily
3GO8A 2JCHA 4ITQA 3FYDA 4AQYM 1SXJB 2XD5A 3AV0A 3IHPA 1R4GA 3GQ3A 3WHLA 4XK8F 1JR3E 3LVWA 4G4OA 4NXMM 3FTDA 1WR1B 3UMMA 1Q3BA 3NBXX 4CJ6A 4MGIE 1N33M 2EO2A 1KYIA 1E6PA 1WJ7A 3WD1A 3C9PA 3WD3A 3K8ZA 4GH9A 1MX0A 1UM8A 3CGWA 4Z2LA 5KQDA 1SXJA 2FFJA 5L8RF 4AG6A 4JXJA 4GKKM 3NWLA 4KODA 4PDGA 2R4EA 2MR9A 1IN8A 2WZJA 4OJ5A 4DR3M 2YR0A 1P3QQ 4X65M 4TX8A 1YUBA 4LRTA 4OJLA 2C96A 3L25A 2Y2PA 4BBAA 1HNZM 3PFIA 2V5OA 4DR6M 3E4RA 3DFZA 2C5RA 3GRRA 2QNJA 3L29A 4P17A 4CHTB 4LFCM 2MGWA 1QQWA 3AL0C 4NRWA 3K1JA 4MGZE 3B74A 3E21A 3AOEA 3GLFB 2CRUA 4NYUA 5F3WA 2XF3A 2VF7A 5ITTA 1I94M 2VQEM 1QDRA 2LVAA 5EXSA 3TE6A 1EFUB 1OIPA 4OVZB 4Z6YA 4I8OA 2CV0A 4WURA 4L6V6 3WD4A 2M5ZA 2Y2NA 4G3OA 3GP1A 2F5QA 5EP1A 4JI8M 2RKOA 2DWZB 4DR4M 1OAIA 1XMQM 4IBKA 3SAWA 3GLFA 2D49A 1LTMA 3HONA 2XH9A 1ZAEA 4GRIA 4LGYA 1R6BX 1Z5AA 4GHLA 2L4FA 1K3WA 1YU3A 1KFVA 4LY6A 2DWNA 2BG1A 4Z8XA 4PT5A 3GLGE 4AKHA 2JZ1A 1QAMA 3C3DA 3FUUA 3HWSA 3VFDA 4K0KM 3AOEC 4MB3A 1Z59A 3IG8A 4L4UA 1GL7A 4LFAM 2R46A 4D80A 2ZANA 4B3SM 4NZ3A 2Y2GA 2HL7A 1W1PA 1D0LA 1TDHA 2QSFX 1PJQA 4M9XA 2VDBB 2DAKA 3UK6A 1VQ1A 4B7FA 2QBYB 1TTEA 3QWLA 3FTFA 2EA0A 1S3SA 3K9OA 3KOWE 3GLIE 5GKNA 1YUEA 1SXJE 4OW0A 4OJOA 1R5LA 3CF2A 3NBIA 3KOXE 3KW6A 4KT0F 2RGOA 4X66M 2FH0A 4LF5M 1GO5A 2DAMA 3HJSA 2QBYA 1JB0F 5DYGA 4B3RM 1QVRA 1QDTA 3KOYE 3GPPA 1SG9A 4B3MM 1F4IA 1XNQM 1YU1A 3U6CA 1H0GA 5JI2E 2UUAM 4Z2HA 2C98A 1WHCA 3L28A 4X64M 1H8PA 1J7KA 3DOAA 3WD0A 2P5TA 4MH0E 5FTLA 5FSWA 3TWMA 2XD1A 1WGNA 3EIEA 3KXEC 3MHVC 2OQ4A 1C7YA 3HJ8A 1MU5A 3TWKA 2DAGA 4QNRA 4DR5M 3ZQJA 4EIWA 4MB7A 2LVOC 2C99A 3PNVA 3SATA 1TH3A 2VQFM 1AUAA 1G71A 2HCBA 2DWMA 2DKLA 2GNOA 2JXNA 5EJCA 1J7MA 2L7IA 1LV7A 2Y2JA 4Z2KA 3IECA 4MB5A 4M0DA 1HQYE 2L6OA 4JI7M 5EXTA 1HR0M 2UXDM 1ZQ9A 2AHMA 3LVVA 3LW5F 3HX3A 4L15A 1Z6TA 4D82A 1E32A 1YU4A 4NZ1A 1T6OA 1ORYB 2B3TA 3KDSE 4CISA 1GL6A 1QANA 2XEPA 2EKFA 4TUWA 4IBBA 2R18A 2MROB 4HMDA 1JQJC 3A98B 1N34M 3U6PA 2CV2A 3E9SA 2Y2HA 3C3EA 4DR1M 3CF6E 1G41A 1IFYA 4IBEA 1UR8A 4OJPA 1GJSA 5H37D 1PDCA 2KHHA 4GEWA 2RRUA 1RU3A 4LGMA 5ITUA 4QOZC 3VDUA 1L6JA 4LJ7A 1R7RA 1IN7A 1HNWM 1PGYA 1G3IA 4LZJA 4QOSA 4KHPM 2CWBA 4LFBM 4MM3B 3J27B 4DR2M 4HMCA 1NV9A 1N75A 2E5LM 2F5PA 1E15A 2Y2OA 2OOAA 3GLHE 3KSJA 4WP2A 3HHXA 4IBCA 5FTNA 5JI3E 3R9XB 2Y21A 4NSOB 1N78A 2EJSA 2LXEA 3L26A 2JY7A 2WSFF 4B7GA 3R8FA 2G8LA 5KO3A 1E8BA 1X37A 2DWLA 1VEGA 4Z2IA 2DZNB 5KPRA 1NJGA 2BJWA 1FNNA 1N77A 2ZTDA 3MQLA 4NY2A 4I81A 2QHOB 2EKKA 4JI5M 2O01F 1UR9A 1VEKA 1WIVA 3HHWA 1NV8A 1QUTA 1K82A 1NY5A 2JY6B 3GQ5A 2KRUA 4JI4M 1YU0A 4HMEA 3KVWA 2C9OA 1KS0A 2KW0A 3A45A 1DO0A 2JP7A 4JI2M 2Y2IA 3RGSA 2FFFB 2KA6B 3U5ZB 2DZLA 2D7GA 2K0BX 1Q39A 2BWBA 4NL4H 2O5RA 1TR8A 2ZTCA 4PDIA 2KXEA 3U6EA 2UUCM 2LWXA 3SBJA 2DNAA 4HL4A 4IIWA 2JWSA 1DV0A 3M6AA 4BLCA 5ITRA 1Z5BA 4JYAM 5EP4A 4NZ4A 1NNUC 1N32M 2ZM6M 2K47A 3AOGA 3U5ZA 3SMSA 4DV2M 1EIJA 4W5WA 4FW9A 4LCBA 1QZMA 3GRUA 5EP3A 1V33A 1L2BA 1C1KA 1XB2B 3L27A 1DGFA 3FKEA 3I04M 3HKPA 4LJAA 1L8QA 4LJ5A 5E6JA 2MJ5B 2Y0QA 4OVZA 3IG5A 3UGJA 3ZH9B 3WD2A 1W1VA 3HSHA 4LF8M 1IXSB 4UN2B 1QO6A 1D0KA 2DHRA 7CATA 2UUBM 1Q02A 3UZUA 1HT2E 1IN4A 2LVNC 4ZPXA 2L09A 4NXNM 2BWEA 2XSZD 5ITYA 1OTRA 3VKGA 1GJTA 1IXRC 2XFSA 2X49A 3Q8XA 4AKGA 3T6PA 2CE7A 3GRVA 2OO9A 3PVSA 1W1YA 2DAIA 3UJNA 2Y2KA 1W5TA 1XHBA 3SAVA 3VKHA 1ED7A 2DI0A 2Z7JA 1IXSA 2OPFA 1JR3D 1T3TA 4L78A 3B7ZA 3M7PA 4MGYE 1OIZA 2CFOA 4IJEA 3U6LA 3KP0E 4QHSA 3U6OA 2XZFA 2FN2A 4GC9A 1UFZA 1NO1A 2XGNA 3B89A 2QP9X 4JV5M 4DV7M 1IN5A 1E6ZA 4PCZA 3V76A 2D7EA 2ZBKB 2LHCA 1WGLA 1IY2A 2Z3XA 1IXZA 5LMUM 1ZMVA 3VDPA 3AKZA 3W68A 3T1YM 1PJIA 1GOIA 3EIHA 2JY5A 4RF0A 1CK7A 4GIPA 2XSZA 4LJ8A 4D81A 4DR7M 2JNHA 2Z4RA 4IBDA 1GLNA 3FTCA 3FUXA 1YLAA 3BBZA 3FTEA 3RE8A 4CIZA 4GITA 2KNZA 3DZDA 4B3TM 2QZ4A 3HGIA 1AIPC 3D8BA 4L8RC 1WXQA 4LF6M 1T43A 2C9CA 2J7OA 3FUVA 3WHKA 3KOZE 4IBIA 3SARA 2UWXA 2Y0TA 5BR8M 3Q8GA 3GLFE 2LVPC 2YFQA 2L2DA 2RTSA 4KLNA 4HEOA 3SYKA 3HY5A 5EXXA 1KSFX 2N35A 2J7NA 1G4AE 2WSCF 2I7PA 4P16A 3KS8A 1VEJA 2DVWB 5IWAM 1NVMA 2F5SA 5DFLA 3U6QA 3MJ5A 1QYRA 3U61B 4LF4M 1TF0B 3GPXA 3U60B 1IY0A 1PJSA 2KDLA 1ZMUA 3K2LA 5FTKA 2KZUA 1OFHA 5IT9S 2Y2LA 5ITQA 2CP8A 3ZC7B 4QNLA 1TH2A 4YY3M 4WW0A 4X62M 1HNXM 2Y2MA 1NHWC 4CGYB 2UU9M 3ZCBB 1QUSA 1YSYA 1XC8A 1IBKM 4IBJA 1TGUA 3MMPA 5E26A 4JI6M 5A2QS 3U61A 4GHAA 3GPUA 3U60A 1EE8A 3GQ4A 1E88A 2V1CA 2VF8A 4DV6M 1GKIA 3KSXA 1A5TA 2BJVA 4LF7M 1GPFA 2QPAA 1NHGC 3C58A 2R6FA 2KNVA 3RGPA 3GLGB 3VK8A 4I4LA 4Z2JA 2R65A 3HU1A 3HJQA 5DYIA 4G4NA 4GKJM 4OJ6A 2WSEF 1N36M 8CATA 3KFUG 1YU2A 1E9RA 5ITXA 3GRYA 1XXHB 3KS4A 1Q3CA 1VG5A 3M0EA 2V1UA 2X8AA 4MB4A 3BOSA 3J7BA 2H5XA 2LTUA 1NNJA 5KQ8A 3SMPA 3LQQA 4FWGA 1OAOC 2BNKA 3GLIB 2IOUA 1VDLA 2A5YB 3AJIB 2HHHM 1O6IA 3WX7A 1IQPA 3D8LA 3QYEA 4OX9M 2ERCA 1FJGM 3H4MA 4LJ9A 1XXHA 4LJ4A 2F5NA 1ZMWA 3J80S 1MJGM 4FCTA 1V34A 4G4QA 2VIIA 3W67A 2DENA 4I5SA 3GLIA 1E6RA 2L7HA 1W1TA 3THGA 2F4VM 3B7QA 4Q7JA 3I01M 2HAKA 1NY6A 2LBCA 5IZ7D 2V6ZM 1AIWA 1PJTA 4JN6A 1TDZA 4R7GA 3VK7A 1HJPA 3FD9A 4HLQA 2K6BA 5BPVA 4OUIA 2L4EA 4M9ZA 5DNYA 2JA2A 5EP2A 4DV5M 1HT1E 4AKIA 5C18A 2R62A 1L1ZA 2QENA 2G5GX 2G3QA 3QYBA 2FOIC 4RNAA 4FCVA 1IN6A 2HKJA 2JUJA 1OGGA 1XNRM 2CV1A 3B7NA 1OFIA 2GQFA 5LMNM 1L2CA 1OGBA 4R3DA 2LH0A 2KZSA 5FLXS 3JR5A 3N3FA 1QZEA 1V92A 2CUZA 2QCUA 1L1TA 2DHYA 4LG2A 1SXJC 4DBGB 4REZA 1J5EM 5FTJA 2JZ0A 1E9SA 2K9DA 2ZAOA 1G8PA 2LNHC 4QNMA 3T1HM 3E46A 1QAOA 4GMQA 4LRSA 2CHVA 2R0IA 1D2NA 2Z8YM 3JAMS 2Y2QA 4OU7A 2CHQA 2XZUA 1NSFA 4DV3M 2Q2EB 4JI1M 1H6UA 4JI0M 2OOBA 3DA1A 4M9SA 3K9PA 2XFTA 1GVNA 3QAUA 5KPZA 5ITXE 4XGIA 2ZAMA 3U6DA 2FS1A 1BVSA 4LZZA 4QHTA 1GABA 4DV1M 2JY8A 4NC6A 1G59A 4DUZM 2HWJA 4S12A 2FNAA 2H1RA 2I7NA 4B7HA 1I4WA 2MH8A 3L2AA 4GC5A 1IBLM 4NSRA 2LHGA 3SAUA 4AW4A 4F2LA 4NOOB 4RKUF 2KEBA 5EXPA 3SYLA 3I51A 1XWIA 2KNAA 4Y28F 1IY1A 4A3VB 1E6NA 3FUTA 3W0LB 3LMMA 1XXHE 3HU2A 3LCVB 3RFWA 1R2ZA 1H0IA 1D0MA 2FE8A 3FUWA 1OJLA 5IREB 3GLHB 3JR4A 3J81S 4II7A 2QQ8A 1CUKA 2KRKA 1W5SA 4DV4M 4PD2A 1YE9A 3PXGA 4MGKE 2XLJA 3J7AS 1JR3A 4DV0M 1PRBA 4M0WA 3I4VA 1EAKA 3ILKA 2YQZA 3AFHA 1ZV1A 3B9PA 4FWDA 4KO8A 3H4JA 3CF0A 3GLHA 2APLA 4NRVA 3HHYA 4R71A 2LVQD 5KPTA 1DGBA 1OKSA 2R4JA 4LF9M 1DGGA 3K92A 4G6ZA 3W0FA 2DXIA 1DO2A 3CTWB 1IM2A 4XBOA 3TWLA 2UXBM 3HU3A 2UXCM 3FYCA 2EUCA 3BXWA 4FCWA 3HZJA 3TQSA 4FD2A 3FRIA 4RF1A 3SHGB 2NQ8C 1XMOM 2O25A 2JE5A 4AZFA 4FVMA 4B08A 2Y20A 2J5YA 3T38A 4NYYA 2RGHA 4NZ5A 4Z2GA 5EQTA 3A46A 1Z5CA 4IJFA 3KP1E 2YNMD 4F1IA 3U6SA 2CEAA 2DZOB 4MGHA 4AG5A 3MK6A 1IBMM 3FRHA 2CHGA 2X4AA 4ANRA 3SASA 4IBGA 1Y8GA 3PNYA 2Z4SA 3SHFA 1PJJA 4AI6A 1CXWA 1HQCA 2W82A 4JI3M 1PM5A 3I4YA 1VDDA 3F92A 4G4RA 1NJFA 1DGHB 4BB9A 1MN3A 3J2PB 1L2DA 1SXJD 3VLFB 1J09A 4FWHA 3SFZA 1GXDA 2M60A 4IBFA 3T15A 1E94E 1K3XA 2DAEA 3A42A 5C1BA 3FE3A 4YHHM 3OTOM 2F5OA 4LJ6A 3LCUA 3TPZA 2R45A 3TL4X 1QAQA 1DGHA 2R44A 3U6MA 4DUYM 1OQYA 3GPYA 1R2YA 3LQRA 5FTMA 4L16A 3GLGA 2D7HA 3HHZA 3M7GA 1TH4A 3SC3A
chains in the Genus database with same CATH topology
3GO8A 2JCHA 4ITQA 3FYDA 4AQYM 1SXJB 2XD5A 3AV0A 3GQ3A 3WHLA 3LVWA 4G4OA 4NXMM 3FTDA 3UMMA 1Q3BA 4MGIE 1N33M 2EO2A 1KYIA 3K8ZA 4GH9A 1MX0A 1UM8A 5KQDA 1SXJA 2FFJA 4AG6A 4JXJA 4GKKM 3NWLA 4KODA 4PDGA 2R4EA 1IN8A 4OJ5A 4DR3M 2YR0A 4X65M 1YUBA 4LRTA 4OJLA 2C96A 3L25A 2Y2PA 4BBAA 1HNZM 3PFIA 4DR6M 3E4RA 3DFZA 2C5RA 3GRRA 3L29A 4CHTB 4LFCM 1QQWA 3AL0C 4NRWA 3K1JA 4MGZE 3AOEA 3GLFB 4NYUA 5F3WA 2XF3A 5ITTA 1I94M 2VQEM 5EXSA 3TE6A 4OVZB 4Z6YA 2CV0A 4I8OA 4WURA 2M5ZA 2Y2NA 3GP1A 2F5QA 5EP1A 4JI8M 2RKOA 2DWZB 4DR4M 1XMQM 4IBKA 3SAWA 3GLFA 3HONA 2XH9A 1ZAEA 4GRIA 4LGYA 1R6BX 1Z5AA 4GHLA 1K3WA 1YU3A 1KFVA 4LY6A 2DWNA 2BG1A 4Z8XA 4PT5A 4AKHA 3FUUA 1QAMA 3VFDA 3HWSA 4K0KM 3AOEC 1Z59A 3IG8A 4L4UA 1GL7A 4LFAM 2R46A 4D80A 2ZANA 4B3SM 4NZ3A 2Y2GA 2HL7A 1TDHA 4M9XA 3UK6A 4B7FA 2QBYB 3QWLA 3FTFA 2EA0A 1S3SA 3KOWE 5GKNA 1YUEA 1SXJE 4OW0A 4OJOA 3CF2A 3NBIA 3KOXE 3KW6A 4X66M 2RGOA 4LF5M 3HJSA 2QBYA 5DYGA 4B3RM 1QVRA 3KOYE 3GPPA 4B3MM 1XNQM 1YU1A 3U6CA 5JI2E 2UUAM 2C98A 3L28A 4X64M 1J7KA 3DOAA 2P5TA 4MH0E 5FTLA 5FSWA 3TWMA 2XD1A 3EIEA 3KXEC 3MHVC 2OQ4A 3HJ8A 1MU5A 3TWKA 4QNRA 4DR5M 4EIWA 4MB7A 3PNVA 2C99A 3SATA 1TH3A 2VQFM 2HCBA 2DWMA 5EJCA 2L7IA 1LV7A 2Y2JA 4M0DA 1HQYE 2L6OA 4JI7M 5EXTA 1HR0M 2UXDM 1ZQ9A 2AHMA 3LVVA 4L15A 1YU4A 1Z6TA 4D82A 1E32A 4NZ1A 1ORYB 3KDSE 4CISA 1GL6A 1QANA 2XEPA 4TUWA 4IBBA 2R18A 1JQJC 3A98B 1N34M 3U6PA 2CV2A 3E9SA 2Y2HA 4DR1M 3CF6E 1G41A 4IBEA 4OJPA 5H37D 4LGMA 5ITUA 4QOZC 3VDUA 4LJ7A 1R7RA 1IN7A 1HNWM 1G3IA 4LZJA 4QOSA 4KHPM 4LFBM 4MM3B 3J27B 4DR2M 1N75A 2E5LM 2F5PA 2Y2OA 3KSJA 3HHXA 4IBCA 5FTNA 5JI3E 3R9XB 2Y21A 4NSOB 1N78A 2LXEA 3L26A 3R8FA 4B7GA 2G8LA 5KO3A 1X37A 2DWLA 2DZNB 5KPRA 1NJGA 2BJWA 1FNNA 1N77A 4I81A 4JI5M 3HHWA 1K82A 1NY5A 3GQ5A 4JI4M 2KRUA 1YU0A 3KVWA 2C9OA 2KW0A 3A45A 1DO0A 4JI2M 2Y2IA 3RGSA 2FFFB 2KA6B 3U5ZB 2D7GA 1Q39A 4NL4H 2O5RA 4PDIA 2KXEA 3U6EA 2UUCM 2LWXA 3SBJA 4HL4A 4IIWA 3M6AA 4BLCA 5ITRA 1Z5BA 4JYAM 5EP4A 1NNUC 1N32M 2ZM6M 2K47A 3AOGA 3U5ZA 3SMSA 4DV2M 4W5WA 4FW9A 4LCBA 1QZMA 3GRUA 5EP3A 1L2BA 1C1KA 3L27A 1DGFA 3FKEA 5E6JA 3HKPA 4LJAA 1L8QA 4LJ5A 3TWLA 2Y0QA 4OVZA 3UGJA 3IG5A 3ZH9B 3HSHA 4LF8M 1IXSB 2DHRA 2UUBM 3UZUA 1HT2E 1IN4A 4ZPXA 2L09A 4NXNM 2XSZD 5ITYA 3VKGA 4AKGA 1IXRC 2XFSA 2X49A 3Q8XA 4NZ4A 2CE7A 3GRVA 3PVSA 3UJNA 2Y2KA 1W5TA 1XHBA 3SAVA 3VKHA 2Z7JA 2OPFA 1JR3D 1T3TA 4L78A 4MGYE 2CFOA 4IJEA 3U6LA 3KP0E 4QHSA 3U6OA 2XZFA 4GC9A 2XGNA 2QP9X 4JV5M 4DV7M 1IN5A 4PCZA 2D7EA 2ZBKB 1IY2A 2Z3XA 1IXZA 5LMUM 3VDPA 3AKZA 1PJIA 3T1YM 3EIHA 4RF0A 4GIPA 2XSZA 4LJ8A 4D81A 4DR7M 2Z4RA 4IBDA 1GLNA 3FTCA 3FUXA 3FTEA 3RE8A 4GITA 3DZDA 4B3TM 2QZ4A 3HGIA 3D8BA 4L8RC 1WXQA 4LF6M 2C9CA 3FUVA 2J7OA 2UWXA 3WHKA 3KOZE 4IBIA 3SARA 2Y0TA 5BR8M 2YFQA 4KLNA 3SYKA 5EXXA 1KSFX 2J7NA 4P16A 1G4AE 3KS8A 2I7PA 2DVWB 5IWAM 1NVMA 2F5SA 3U6QA 3MJ5A 1QYRA 3U61B 4LF4M 3GPXA 3U60B 1IY0A 3K2LA 5FTKA 2KZUA 1OFHA 5IT9S 2Y2LA 5ITQA 3ZC7B 4QNLA 1TH2A 4YY3M 4WW0A 4X62M 1HNXM 2Y2MA 1NHWC 4CGYB 2UU9M 3ZCBB 1YSYA 1XC8A 1IBKM 4IBJA 1TGUA 4JI6M 5E26A 5A2QS 3U61A 4GHAA 3GPUA 3U60A 1EE8A 3GQ4A 2V1CA 4DV6M 1GKIA 3KSXA 2BJVA 4LF7M 2QPAA 1NHGC 3C58A 3RGPA 3GLGB 3VK8A 4I4LA 2R65A 3HU1A 3HJQA 5DYIA 4G4NA 4GKJM 4OJ6A 1N36M 8CATA 3KFUG 1YU2A 1E9RA 5ITXA 3GRYA 1XXHB 3KS4A 1Q3CA 2V1UA 3M0EA 2X8AA 3BOSA 3J7BA 1NNJA 5KQ8A 3SMPA 3LQQA 4FWGA 2BNKA 3GLIB 2IOUA 2A5YB 3AJIB 2HHHM 3WX7A 1IQPA 3D8LA 4OX9M 2ERCA 1FJGM 3H4MA 4LJ9A 1XXHA 4LJ4A 2F5NA 3J80S 4FCTA 4G4QA 2VIIA 4I5SA 3GLIA 2L7HA 3THGA 2F4VM 1NY6A 5IZ7D 2V6ZM 4JN6A 1TDZA 4R7GA 3VK7A 4HLQA 3FD9A 4OUIA 5BPVA 4M9ZA 5DNYA 2JA2A 5EP2A 4DV5M 1HT1E 4AKIA 5C18A 2R62A 1L1ZA 2QENA 2G5GX 2FOIC 4RNAA 4FCVA 1IN6A 2HKJA 1XNRM 2CV1A 1OFIA 5LMNM 1L2CA 4R3DA 2LH0A 2KZSA 5FLXS 3JR5A 3N3FA 1L1TA 2CUZA 2QCUA 4LG2A 1SXJC 4REZA 1J5EM 5FTJA 1E9SA 2ZAOA 1G8PA 2LNHC 4QNMA 3T1HM 1QAOA 4GMQA 4LRSA 2CHVA 1D2NA 3JAMS 2Y2QA 4OU7A 2CHQA 2XZUA 1NSFA 4DV3M 2Q2EB 4JI1M 1H6UA 4JI0M 3DA1A 4M9SA 2XFTA 1GVNA 3QAUA 5KPZA 5ITXE 4XGIA 2ZAMA 3U6DA 4LZZA 4QHTA 4DV1M 1G59A 4DUZM 4S12A 2FNAA 2H1RA 2I7NA 4B7HA 1I4WA 3L2AA 4GC5A 1IBLM 4NSRA 3SAUA 4AW4A 7CATA 4NOOB 2KEBA 5EXPA 3SYLA 3I51A 1XWIA 1IY1A 4A3VB 3FUTA 3W0LB 3LMMA 3HU2A 3RFWA 1R2ZA 2FE8A 3FUWA 1OJLA 5IREB 3GLHB 3JR4A 3J81S 4II7A 2KRKA 1W5SA 4DV4M 4PD2A 1YE9A 3PXGA 4MGKE 2XLJA 3J7AS 1JR3A 4DV0M 4M0WA 3I4VA 3ILKA 2YQZA 3AFHA 4FWDA 3B9PA 4KO8A 3CF0A 3GLHA 3HHYA 4NRVA 5KPTA 1DGBA 2R4JA 4LF9M 1DGGA 3K92A 4G6ZA 3W0FA 2DXIA 1DO2A 3CTWB 1IM2A 4XBOA 2UXBM 4NY2A 3HU3A 2UXCM 3FYCA 2EUCA 4FCWA 3TQSA 4FD2A 4RF1A 3SHGB 1XMOM 2NQ8C 2JE5A 4AZFA 4FVMA 4B08A 2Y20A 3T38A 4NYYA 2RGHA 4NZ5A 5EQTA 3A46A 1Z5CA 4IJFA 3KP1E 2YNMD 3U6SA 2CEAA 2DZOB 4MGHA 4AG5A 3MK6A 1IBMM 2CHGA 2X4AA 3SASA 4IBGA 3PNYA 2Z4SA 3SHFA 1PJJA 4AI6A 1HQCA 2W82A 4JI3M 1PM5A 3I4YA 1VDDA 4G4RA 1NJFA 1DGHB 4BB9A 3J2PB 1L2DA 1SXJD 3VLFB 1J09A 4FWHA 3SFZA 2M60A 4IBFA 3T15A 1E94E 1K3XA 3A42A 4YHHM 5C1BA 2F5OA 3OTOM 4LJ6A 3TPZA 2R45A 3TL4X 1QAQA 1DGHA 3U6MA 4DUYM 3GPYA 1R2YA 3LQRA 5FTMA 4L16A 3GLGA 2D7HA 3HHZA 3M7GA 1TH4A 3SC3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GHL A;  3L27 A;  4IBG A;  3FKE A;  4IBI A;  3L29 A;  3L2A A;  3KS8 A;  4LG2 A;  4IBC A;  3L28 A;  4GH9 A;  4IBF A;  3L26 A;  4IBD A;  4IBB A;  4GHA A;  5BPV A;  4IJF A;  3KS4 A;  4IBK A;  4IBE A;  4IBJ A;  3L25 A;  4IJE A; 
#chains in the Genus database with same CATH topology
 3GO8 A;  2JCH A;  4ITQ A;  3FYD A;  4AQY M;  1SXJ B;  2XD5 A;  3AV0 A;  3IHP A;  1R4G A;  3GQ3 A;  3WHL A;  4XK8 F;  1JR3 E;  3LVW A;  4G4O A;  4NXM M;  3FTD A;  1WR1 B;  3UMM A;  1Q3B A;  3NBX X;  4CJ6 A;  4MGI E;  1N33 M;  2EO2 A;  1KYI A;  1E6P A;  1WJ7 A;  3WD1 A;  3C9P A;  3WD3 A;  3K8Z A;  4GH9 A;  1MX0 A;  1UM8 A;  3CGW A;  4Z2L A;  5KQD A;  1SXJ A;  2FFJ A;  5L8R F;  4AG6 A;  4JXJ A;  4GKK M;  3NWL A;  4KOD A;  4PDG A;  2R4E A;  2MR9 A;  1IN8 A;  2WZJ A;  4OJ5 A;  4DR3 M;  2YR0 A;  1P3Q Q;  4X65 M;  4TX8 A;  1YUB A;  4LRT A;  4OJL A;  2C96 A;  3L25 A;  2Y2P A;  4BBA A;  1HNZ M;  3PFI A;  2V5O A;  4DR6 M;  3E4R A;  3DFZ A;  2C5R A;  3GRR A;  2QNJ A;  3L29 A;  4P17 A;  4CHT B;  4LFC M;  2MGW A;  1QQW A;  3AL0 C;  4NRW A;  3K1J A;  4MGZ E;  3B74 A;  3E21 A;  3AOE A;  3GLF B;  2CRU A;  4NYU A;  5F3W A;  2XF3 A;  2VF7 A;  5ITT A;  1I94 M;  2VQE M;  1QDR A;  2LVA A;  5EXS A;  3TE6 A;  1EFU B;  1OIP A;  4OVZ B;  4Z6Y A;  4I8O A;  2CV0 A;  4WUR A;  4L6V 6;  3WD4 A;  2M5Z A;  2Y2N A;  4G3O A;  3GP1 A;  2F5Q A;  5EP1 A;  4JI8 M;  2RKO A;  2DWZ B;  4DR4 M;  1OAI A;  1XMQ M;  4IBK A;  3SAW A;  3GLF A;  2D49 A;  1LTM A;  3HON A;  2XH9 A;  1ZAE A;  4GRI A;  4LGY A;  1R6B X;  1Z5A A;  4GHL A;  2L4F A;  1K3W A;  1YU3 A;  1KFV A;  4LY6 A;  2DWN A;  2BG1 A;  4Z8X A;  4PT5 A;  3GLG E;  4AKH A;  2JZ1 A;  1QAM A;  3C3D A;  3FUU A;  3HWS A;  3VFD A;  4K0K M;  3AOE C;  4MB3 A;  1Z59 A;  3IG8 A;  4L4U A;  1GL7 A;  4LFA M;  2R46 A;  4D80 A;  2ZAN A;  4B3S M;  4NZ3 A;  2Y2G A;  2HL7 A;  1W1P A;  1D0L A;  1TDH A;  2QSF X;  1PJQ A;  4M9X A;  2VDB B;  2DAK A;  3UK6 A;  1VQ1 A;  4B7F A;  2QBY B;  1TTE A;  3QWL A;  3FTF A;  2EA0 A;  1S3S A;  3K9O A;  3KOW E;  3GLI E;  5GKN A;  1YUE A;  1SXJ E;  4OW0 A;  4OJO A;  1R5L A;  3CF2 A;  3NBI A;  3KOX E;  3KW6 A;  4KT0 F;  2RGO A;  4X66 M;  2FH0 A;  4LF5 M;  1GO5 A;  2DAM A;  3HJS A;  2QBY A;  1JB0 F;  5DYG A;  4B3R M;  1QVR A;  1QDT A;  3KOY E;  3GPP A;  1SG9 A;  4B3M M;  1F4I A;  1XNQ M;  1YU1 A;  3U6C A;  1H0G A;  5JI2 E;  2UUA M;  4Z2H A;  2C98 A;  1WHC A;  3L28 A;  4X64 M;  1H8P A;  1J7K A;  3DOA A;  3WD0 A;  2P5T A;  4MH0 E;  5FTL A;  5FSW A;  3TWM A;  2XD1 A;  1WGN A;  3EIE A;  3KXE C;  3MHV C;  2OQ4 A;  1C7Y A;  3HJ8 A;  1MU5 A;  3TWK A;  2DAG A;  4QNR A;  4DR5 M;  3ZQJ A;  4EIW A;  4MB7 A;  2LVO C;  2C99 A;  3PNV A;  3SAT A;  1TH3 A;  2VQF M;  1AUA A;  1G71 A;  2HCB A;  2DWM A;  2DKL A;  2GNO A;  2JXN A;  5EJC A;  1J7M A;  2L7I A;  1LV7 A;  2Y2J A;  4Z2K A;  3IEC A;  4MB5 A;  4M0D A;  1HQY E;  2L6O A;  4JI7 M;  5EXT A;  1HR0 M;  2UXD M;  1ZQ9 A;  2AHM A;  3LVV A;  3LW5 F;  3HX3 A;  4L15 A;  1Z6T A;  4D82 A;  1E32 A;  1YU4 A;  4NZ1 A;  1T6O A;  1ORY B;  2B3T A;  3KDS E;  4CIS A;  1GL6 A;  1QAN A;  2XEP A;  2EKF A;  4TUW A;  4IBB A;  2R18 A;  2MRO B;  4HMD A;  1JQJ C;  3A98 B;  1N34 M;  3U6P A;  2CV2 A;  3E9S A;  2Y2H A;  3C3E A;  4DR1 M;  3CF6 E;  1G41 A;  1IFY A;  4IBE A;  1UR8 A;  4OJP A;  1GJS A;  5H37 D;  1PDC A;  2KHH A;  4GEW A;  2RRU A;  1RU3 A;  4LGM A;  5ITU A;  4QOZ C;  3VDU A;  1L6J A;  4LJ7 A;  1R7R A;  1IN7 A;  1HNW M;  1PGY A;  1G3I A;  4LZJ A;  4QOS A;  4KHP M;  2CWB A;  4LFB M;  4MM3 B;  3J27 B;  4DR2 M;  4HMC A;  1NV9 A;  1N75 A;  2E5L M;  2F5P A;  1E15 A;  2Y2O A;  2OOA A;  3GLH E;  3KSJ A;  4WP2 A;  3HHX A;  4IBC A;  5FTN A;  5JI3 E;  3R9X B;  2Y21 A;  4NSO B;  1N78 A;  2EJS A;  2LXE A;  3L26 A;  2JY7 A;  2WSF F;  4B7G A;  3R8F A;  2G8L A;  5KO3 A;  1E8B A;  1X37 A;  2DWL A;  1VEG A;  4Z2I A;  2DZN B;  5KPR A;  1NJG A;  2BJW A;  1FNN A;  1N77 A;  2ZTD A;  3MQL A;  4NY2 A;  4I81 A;  2QHO B;  2EKK A;  4JI5 M;  2O01 F;  1UR9 A;  1VEK A;  1WIV A;  3HHW A;  1NV8 A;  1QUT A;  1K82 A;  1NY5 A;  2JY6 B;  3GQ5 A;  2KRU A;  4JI4 M;  1YU0 A;  4HME A;  3KVW A;  2C9O A;  1KS0 A;  2KW0 A;  3A45 A;  1DO0 A;  2JP7 A;  4JI2 M;  2Y2I A;  3RGS A;  2FFF B;  2KA6 B;  3U5Z B;  2DZL A;  2D7G A;  2K0B X;  1Q39 A;  2BWB A;  4NL4 H;  2O5R A;  1TR8 A;  2ZTC A;  4PDI A;  2KXE A;  3U6E A;  2UUC M;  2LWX A;  3SBJ A;  2DNA A;  4HL4 A;  4IIW A;  2JWS A;  1DV0 A;  3M6A A;  4BLC A;  5ITR A;  1Z5B A;  4JYA M;  5EP4 A;  4NZ4 A;  1NNU C;  1N32 M;  2ZM6 M;  2K47 A;  3AOG A;  3U5Z A;  3SMS A;  4DV2 M;  1EIJ A;  4W5W A;  4FW9 A;  4LCB A;  1QZM A;  3GRU A;  5EP3 A;  1V33 A;  1L2B A;  1C1K A;  1XB2 B;  3L27 A;  1DGF A;  3FKE A;  3I04 M;  3HKP A;  4LJA A;  1L8Q A;  4LJ5 A;  5E6J A;  2MJ5 B;  2Y0Q A;  4OVZ A;  3IG5 A;  3UGJ A;  3ZH9 B;  3WD2 A;  1W1V A;  3HSH A;  4LF8 M;  1IXS B;  4UN2 B;  1QO6 A;  1D0K A;  2DHR A;  7CAT A;  2UUB M;  1Q02 A;  3UZU A;  1HT2 E;  1IN4 A;  2LVN C;  4ZPX A;  2L09 A;  4NXN M;  2BWE A;  2XSZ D;  5ITY A;  1OTR A;  3VKG A;  1GJT A;  1IXR C;  2XFS A;  2X49 A;  3Q8X A;  4AKG A;  3T6P A;  2CE7 A;  3GRV A;  2OO9 A;  3PVS A;  1W1Y A;  2DAI A;  3UJN A;  2Y2K A;  1W5T A;  1XHB A;  3SAV A;  3VKH A;  1ED7 A;  2DI0 A;  2Z7J A;  1IXS A;  2OPF A;  1JR3 D;  1T3T A;  4L78 A;  3B7Z A;  3M7P A;  4MGY E;  1OIZ A;  2CFO A;  4IJE A;  3U6L A;  3KP0 E;  4QHS A;  3U6O A;  2XZF A;  2FN2 A;  4GC9 A;  1UFZ A;  1NO1 A;  2XGN A;  3B89 A;  2QP9 X;  4JV5 M;  4DV7 M;  1IN5 A;  1E6Z A;  4PCZ A;  3V76 A;  2D7E A;  2ZBK B;  2LHC A;  1WGL A;  1IY2 A;  2Z3X A;  1IXZ A;  5LMU M;  1ZMV A;  3VDP A;  3AKZ A;  3W68 A;  3T1Y M;  1PJI A;  1GOI A;  3EIH A;  2JY5 A;  4RF0 A;  1CK7 A;  4GIP A;  2XSZ A;  4LJ8 A;  4D81 A;  4DR7 M;  2JNH A;  2Z4R A;  4IBD A;  1GLN A;  3FTC A;  3FUX A;  1YLA A;  3BBZ A;  3FTE A;  3RE8 A;  4CIZ A;  4GIT A;  2KNZ A;  3DZD A;  4B3T M;  2QZ4 A;  3HGI A;  1AIP C;  3D8B A;  4L8R C;  1WXQ A;  4LF6 M;  1T43 A;  2C9C A;  2J7O A;  3FUV A;  3WHK A;  3KOZ E;  4IBI A;  3SAR A;  2UWX A;  2Y0T A;  5BR8 M;  3Q8G A;  3GLF E;  2LVP C;  2YFQ A;  2L2D A;  2RTS A;  4KLN A;  4HEO A;  3SYK A;  3HY5 A;  5EXX A;  1KSF X;  2N35 A;  2J7N A;  1G4A E;  2WSC F;  2I7P A;  4P16 A;  3KS8 A;  1VEJ A;  2DVW B;  5IWA M;  1NVM A;  2F5S A;  5DFL A;  3U6Q A;  3MJ5 A;  1QYR A;  3U61 B;  4LF4 M;  1TF0 B;  3GPX A;  3U60 B;  1IY0 A;  1PJS A;  2KDL A;  1ZMU A;  3K2L A;  5FTK A;  2KZU A;  1OFH A;  5IT9 S;  2Y2L A;  5ITQ A;  2CP8 A;  3ZC7 B;  4QNL A;  1TH2 A;  4YY3 M;  4WW0 A;  4X62 M;  1HNX M;  2Y2M A;  1NHW C;  4CGY B;  2UU9 M;  3ZCB B;  1QUS A;  1YSY A;  1XC8 A;  1IBK M;  4IBJ A;  1TGU A;  3MMP A;  5E26 A;  4JI6 M;  5A2Q S;  3U61 A;  4GHA A;  3GPU A;  3U60 A;  1EE8 A;  3GQ4 A;  1E88 A;  2V1C A;  2VF8 A;  4DV6 M;  1GKI A;  3KSX A;  1A5T A;  2BJV A;  4LF7 M;  1GPF A;  2QPA A;  1NHG C;  3C58 A;  2R6F A;  2KNV A;  3RGP A;  3GLG B;  3VK8 A;  4I4L A;  4Z2J A;  2R65 A;  3HU1 A;  3HJQ A;  5DYI A;  4G4N A;  4GKJ M;  4OJ6 A;  2WSE F;  1N36 M;  8CAT A;  3KFU G;  1YU2 A;  1E9R A;  5ITX A;  3GRY A;  1XXH B;  3KS4 A;  1Q3C A;  1VG5 A;  3M0E A;  2V1U A;  2X8A A;  4MB4 A;  3BOS A;  3J7B A;  2H5X A;  2LTU A;  1NNJ A;  5KQ8 A;  3SMP A;  3LQQ A;  4FWG A;  1OAO C;  2BNK A;  3GLI B;  2IOU A;  1VDL A;  2A5Y B;  3AJI B;  2HHH M;  1O6I A;  3WX7 A;  1IQP A;  3D8L A;  3QYE A;  4OX9 M;  2ERC A;  1FJG M;  3H4M A;  4LJ9 A;  1XXH A;  4LJ4 A;  2F5N A;  1ZMW A;  3J80 S;  1MJG M;  4FCT A;  1V34 A;  4G4Q A;  2VII A;  3W67 A;  2DEN A;  4I5S A;  3GLI A;  1E6R A;  2L7H A;  1W1T A;  3THG A;  2F4V M;  3B7Q A;  4Q7J A;  3I01 M;  2HAK A;  1NY6 A;  2LBC A;  5IZ7 D;  2V6Z M;  1AIW A;  1PJT A;  4JN6 A;  1TDZ A;  4R7G A;  3VK7 A;  1HJP A;  3FD9 A;  4HLQ A;  2K6B A;  5BPV A;  4OUI A;  2L4E A;  4M9Z A;  5DNY A;  2JA2 A;  5EP2 A;  4DV5 M;  1HT1 E;  4AKI A;  5C18 A;  2R62 A;  1L1Z A;  2QEN A;  2G5G X;  2G3Q A;  3QYB A;  2FOI C;  4RNA A;  4FCV A;  1IN6 A;  2HKJ A;  2JUJ A;  1OGG A;  1XNR M;  2CV1 A;  3B7N A;  1OFI A;  2GQF A;  5LMN M;  1L2C A;  1OGB A;  4R3D A;  2LH0 A;  2KZS A;  5FLX S;  3JR5 A;  3N3F A;  1QZE A;  1V92 A;  2CUZ A;  2QCU A;  1L1T A;  2DHY A;  4LG2 A;  1SXJ C;  4DBG B;  4REZ A;  1J5E M;  5FTJ A;  2JZ0 A;  1E9S A;  2K9D A;  2ZAO A;  1G8P A;  2LNH C;  4QNM A;  3T1H M;  3E46 A;  1QAO A;  4GMQ A;  4LRS A;  2CHV A;  2R0I A;  1D2N A;  2Z8Y M;  3JAM S;  2Y2Q A;  4OU7 A;  2CHQ A;  2XZU A;  1NSF A;  4DV3 M;  2Q2E B;  4JI1 M;  1H6U A;  4JI0 M;  2OOB A;  3DA1 A;  4M9S A;  3K9P A;  2XFT A;  1GVN A;  3QAU A;  5KPZ A;  5ITX E;  4XGI A;  2ZAM A;  3U6D A;  2FS1 A;  1BVS A;  4LZZ A;  4QHT A;  1GAB A;  4DV1 M;  2JY8 A;  4NC6 A;  1G59 A;  4DUZ M;  2HWJ A;  4S12 A;  2FNA A;  2H1R A;  2I7N A;  4B7H A;  1I4W A;  2MH8 A;  3L2A A;  4GC5 A;  1IBL M;  4NSR A;  2LHG A;  3SAU A;  4AW4 A;  4F2L A;  4NOO B;  4RKU F;  2KEB A;  5EXP A;  3SYL A;  3I51 A;  1XWI A;  2KNA A;  4Y28 F;  1IY1 A;  4A3V B;  1E6N A;  3FUT A;  3W0L B;  3LMM A;  1XXH E;  3HU2 A;  3LCV B;  3RFW A;  1R2Z A;  1H0I A;  1D0M A;  2FE8 A;  3FUW A;  1OJL A;  5IRE B;  3GLH B;  3JR4 A;  3J81 S;  4II7 A;  2QQ8 A;  1CUK A;  2KRK A;  1W5S A;  4DV4 M;  4PD2 A;  1YE9 A;  3PXG A;  4MGK E;  2XLJ A;  3J7A S;  1JR3 A;  4DV0 M;  1PRB A;  4M0W A;  3I4V A;  1EAK A;  3ILK A;  2YQZ A;  3AFH A;  1ZV1 A;  3B9P A;  4FWD A;  4KO8 A;  3H4J A;  3CF0 A;  3GLH A;  2APL A;  4NRV A;  3HHY A;  4R71 A;  2LVQ D;  5KPT A;  1DGB A;  1OKS A;  2R4J A;  4LF9 M;  1DGG A;  3K92 A;  4G6Z A;  3W0F A;  2DXI A;  1DO2 A;  3CTW B;  1IM2 A;  4XBO A;  3TWL A;  2UXB M;  3HU3 A;  2UXC M;  3FYC A;  2EUC A;  3BXW A;  4FCW A;  3HZJ A;  3TQS A;  4FD2 A;  3FRI A;  4RF1 A;  3SHG B;  2NQ8 C;  1XMO M;  2O25 A;  2JE5 A;  4AZF A;  4FVM A;  4B08 A;  2Y20 A;  2J5Y A;  3T38 A;  4NYY A;  2RGH A;  4NZ5 A;  4Z2G A;  5EQT A;  3A46 A;  1Z5C A;  4IJF A;  3KP1 E;  2YNM D;  4F1I A;  3U6S A;  2CEA A;  2DZO B;  4MGH A;  4AG5 A;  3MK6 A;  1IBM M;  3FRH A;  2CHG A;  2X4A A;  4ANR A;  3SAS A;  4IBG A;  1Y8G A;  3PNY A;  2Z4S A;  3SHF A;  1PJJ A;  4AI6 A;  1CXW A;  1HQC A;  2W82 A;  4JI3 M;  1PM5 A;  3I4Y A;  1VDD A;  3F92 A;  4G4R A;  1NJF A;  1DGH B;  4BB9 A;  1MN3 A;  3J2P B;  1L2D A;  1SXJ D;  3VLF B;  1J09 A;  4FWH A;  3SFZ A;  1GXD A;  2M60 A;  4IBF A;  3T15 A;  1E94 E;  1K3X A;  2DAE A;  3A42 A;  5C1B A;  3FE3 A;  4YHH M;  3OTO M;  2F5O A;  4LJ6 A;  3LCU A;  3TPZ A;  2R45 A;  3TL4 X;  1QAQ A;  1DGH A;  2R44 A;  3U6M A;  4DUY M;  1OQY A;  3GPY A;  1R2Y A;  3LQR A;  5FTM A;  4L16 A;  3GLG A;  2D7H A;  3HHZ A;  3M7G A;  1TH4 A;  3SC3 A; 
#chains in the Genus database with same CATH homology
 3GO8 A;  2JCH A;  4ITQ A;  3FYD A;  4AQY M;  1SXJ B;  2XD5 A;  3AV0 A;  3GQ3 A;  3WHL A;  3LVW A;  4G4O A;  4NXM M;  3FTD A;  3UMM A;  1Q3B A;  4MGI E;  1N33 M;  2EO2 A;  1KYI A;  3K8Z A;  4GH9 A;  1MX0 A;  1UM8 A;  5KQD A;  1SXJ A;  2FFJ A;  4AG6 A;  4JXJ A;  4GKK M;  3NWL A;  4KOD A;  4PDG A;  2R4E A;  1IN8 A;  4OJ5 A;  4DR3 M;  2YR0 A;  4X65 M;  1YUB A;  4LRT A;  4OJL A;  2C96 A;  3L25 A;  2Y2P A;  4BBA A;  1HNZ M;  3PFI A;  4DR6 M;  3E4R A;  3DFZ A;  2C5R A;  3GRR A;  3L29 A;  4CHT B;  4LFC M;  1QQW A;  3AL0 C;  4NRW A;  3K1J A;  4MGZ E;  3AOE A;  3GLF B;  4NYU A;  5F3W A;  2XF3 A;  5ITT A;  1I94 M;  2VQE M;  5EXS A;  3TE6 A;  4OVZ B;  4Z6Y A;  2CV0 A;  4I8O A;  4WUR A;  2M5Z A;  2Y2N A;  3GP1 A;  2F5Q A;  5EP1 A;  4JI8 M;  2RKO A;  2DWZ B;  4DR4 M;  1XMQ M;  4IBK A;  3SAW A;  3GLF A;  3HON A;  2XH9 A;  1ZAE A;  4GRI A;  4LGY A;  1R6B X;  1Z5A A;  4GHL A;  1K3W A;  1YU3 A;  1KFV A;  4LY6 A;  2DWN A;  2BG1 A;  4Z8X A;  4PT5 A;  4AKH A;  3FUU A;  1QAM A;  3VFD A;  3HWS A;  4K0K M;  3AOE C;  1Z59 A;  3IG8 A;  4L4U A;  1GL7 A;  4LFA M;  2R46 A;  4D80 A;  2ZAN A;  4B3S M;  4NZ3 A;  2Y2G A;  2HL7 A;  1TDH A;  4M9X A;  3UK6 A;  4B7F A;  2QBY B;  3QWL A;  3FTF A;  2EA0 A;  1S3S A;  3KOW E;  5GKN A;  1YUE A;  1SXJ E;  4OW0 A;  4OJO A;  3CF2 A;  3NBI A;  3KOX E;  3KW6 A;  4X66 M;  2RGO A;  4LF5 M;  3HJS A;  2QBY A;  5DYG A;  4B3R M;  1QVR A;  3KOY E;  3GPP A;  4B3M M;  1XNQ M;  1YU1 A;  3U6C A;  5JI2 E;  2UUA M;  2C98 A;  3L28 A;  4X64 M;  1J7K A;  3DOA A;  2P5T A;  4MH0 E;  5FTL A;  5FSW A;  3TWM A;  2XD1 A;  3EIE A;  3KXE C;  3MHV C;  2OQ4 A;  3HJ8 A;  1MU5 A;  3TWK A;  4QNR A;  4DR5 M;  4EIW A;  4MB7 A;  3PNV A;  2C99 A;  3SAT A;  1TH3 A;  2VQF M;  2HCB A;  2DWM A;  5EJC A;  2L7I A;  1LV7 A;  2Y2J A;  4M0D A;  1HQY E;  2L6O A;  4JI7 M;  5EXT A;  1HR0 M;  2UXD M;  1ZQ9 A;  2AHM A;  3LVV A;  4L15 A;  1YU4 A;  1Z6T A;  4D82 A;  1E32 A;  4NZ1 A;  1ORY B;  3KDS E;  4CIS A;  1GL6 A;  1QAN A;  2XEP A;  4TUW A;  4IBB A;  2R18 A;  1JQJ C;  3A98 B;  1N34 M;  3U6P A;  2CV2 A;  3E9S A;  2Y2H A;  4DR1 M;  3CF6 E;  1G41 A;  4IBE A;  4OJP A;  5H37 D;  4LGM A;  5ITU A;  4QOZ C;  3VDU A;  4LJ7 A;  1R7R A;  1IN7 A;  1HNW M;  1G3I A;  4LZJ A;  4QOS A;  4KHP M;  4LFB M;  4MM3 B;  3J27 B;  4DR2 M;  1N75 A;  2E5L M;  2F5P A;  2Y2O A;  3KSJ A;  3HHX A;  4IBC A;  5FTN A;  5JI3 E;  3R9X B;  2Y21 A;  4NSO B;  1N78 A;  2LXE A;  3L26 A;  3R8F A;  4B7G A;  2G8L A;  5KO3 A;  1X37 A;  2DWL A;  2DZN B;  5KPR A;  1NJG A;  2BJW A;  1FNN A;  1N77 A;  4I81 A;  4JI5 M;  3HHW A;  1K82 A;  1NY5 A;  3GQ5 A;  4JI4 M;  2KRU A;  1YU0 A;  3KVW A;  2C9O A;  2KW0 A;  3A45 A;  1DO0 A;  4JI2 M;  2Y2I A;  3RGS A;  2FFF B;  2KA6 B;  3U5Z B;  2D7G A;  1Q39 A;  4NL4 H;  2O5R A;  4PDI A;  2KXE A;  3U6E A;  2UUC M;  2LWX A;  3SBJ A;  4HL4 A;  4IIW A;  3M6A A;  4BLC A;  5ITR A;  1Z5B A;  4JYA M;  5EP4 A;  1NNU C;  1N32 M;  2ZM6 M;  2K47 A;  3AOG A;  3U5Z A;  3SMS A;  4DV2 M;  4W5W A;  4FW9 A;  4LCB A;  1QZM A;  3GRU A;  5EP3 A;  1L2B A;  1C1K A;  3L27 A;  1DGF A;  3FKE A;  5E6J A;  3HKP A;  4LJA A;  1L8Q A;  4LJ5 A;  3TWL A;  2Y0Q A;  4OVZ A;  3UGJ A;  3IG5 A;  3ZH9 B;  3HSH A;  4LF8 M;  1IXS B;  2DHR A;  2UUB M;  3UZU A;  1HT2 E;  1IN4 A;  4ZPX A;  2L09 A;  4NXN M;  2XSZ D;  5ITY A;  3VKG A;  4AKG A;  1IXR C;  2XFS A;  2X49 A;  3Q8X A;  4NZ4 A;  2CE7 A;  3GRV A;  3PVS A;  3UJN A;  2Y2K A;  1W5T A;  1XHB A;  3SAV A;  3VKH A;  2Z7J A;  2OPF A;  1JR3 D;  1T3T A;  4L78 A;  4MGY E;  2CFO A;  4IJE A;  3U6L A;  3KP0 E;  4QHS A;  3U6O A;  2XZF A;  4GC9 A;  2XGN A;  2QP9 X;  4JV5 M;  4DV7 M;  1IN5 A;  4PCZ A;  2D7E A;  2ZBK B;  1IY2 A;  2Z3X A;  1IXZ A;  5LMU M;  3VDP A;  3AKZ A;  1PJI A;  3T1Y M;  3EIH A;  4RF0 A;  4GIP A;  2XSZ A;  4LJ8 A;  4D81 A;  4DR7 M;  2Z4R A;  4IBD A;  1GLN A;  3FTC A;  3FUX A;  3FTE A;  3RE8 A;  4GIT A;  3DZD A;  4B3T M;  2QZ4 A;  3HGI A;  3D8B A;  4L8R C;  1WXQ A;  4LF6 M;  2C9C A;  3FUV A;  2J7O A;  2UWX A;  3WHK A;  3KOZ E;  4IBI A;  3SAR A;  2Y0T A;  5BR8 M;  2YFQ A;  4KLN A;  3SYK A;  5EXX A;  1KSF X;  2J7N A;  4P16 A;  1G4A E;  3KS8 A;  2I7P A;  2DVW B;  5IWA M;  1NVM A;  2F5S A;  3U6Q A;  3MJ5 A;  1QYR A;  3U61 B;  4LF4 M;  3GPX A;  3U60 B;  1IY0 A;  3K2L A;  5FTK A;  2KZU A;  1OFH A;  5IT9 S;  2Y2L A;  5ITQ A;  3ZC7 B;  4QNL A;  1TH2 A;  4YY3 M;  4WW0 A;  4X62 M;  1HNX M;  2Y2M A;  1NHW C;  4CGY B;  2UU9 M;  3ZCB B;  1YSY A;  1XC8 A;  1IBK M;  4IBJ A;  1TGU A;  4JI6 M;  5E26 A;  5A2Q S;  3U61 A;  4GHA A;  3GPU A;  3U60 A;  1EE8 A;  3GQ4 A;  2V1C A;  4DV6 M;  1GKI A;  3KSX A;  2BJV A;  4LF7 M;  2QPA A;  1NHG C;  3C58 A;  3RGP A;  3GLG B;  3VK8 A;  4I4L A;  2R65 A;  3HU1 A;  3HJQ A;  5DYI A;  4G4N A;  4GKJ M;  4OJ6 A;  1N36 M;  8CAT A;  3KFU G;  1YU2 A;  1E9R A;  5ITX A;  3GRY A;  1XXH B;  3KS4 A;  1Q3C A;  2V1U A;  3M0E A;  2X8A A;  3BOS A;  3J7B A;  1NNJ A;  5KQ8 A;  3SMP A;  3LQQ A;  4FWG A;  2BNK A;  3GLI B;  2IOU A;  2A5Y B;  3AJI B;  2HHH M;  3WX7 A;  1IQP A;  3D8L A;  4OX9 M;  2ERC A;  1FJG M;  3H4M A;  4LJ9 A;  1XXH A;  4LJ4 A;  2F5N A;  3J80 S;  4FCT A;  4G4Q A;  2VII A;  4I5S A;  3GLI A;  2L7H A;  3THG A;  2F4V M;  1NY6 A;  5IZ7 D;  2V6Z M;  4JN6 A;  1TDZ A;  4R7G A;  3VK7 A;  4HLQ A;  3FD9 A;  4OUI A;  5BPV A;  4M9Z A;  5DNY A;  2JA2 A;  5EP2 A;  4DV5 M;  1HT1 E;  4AKI A;  5C18 A;  2R62 A;  1L1Z A;  2QEN A;  2G5G X;  2FOI C;  4RNA A;  4FCV A;  1IN6 A;  2HKJ A;  1XNR M;  2CV1 A;  1OFI A;  5LMN M;  1L2C A;  4R3D A;  2LH0 A;  2KZS A;  5FLX S;  3JR5 A;  3N3F A;  1L1T A;  2CUZ A;  2QCU A;  4LG2 A;  1SXJ C;  4REZ A;  1J5E M;  5FTJ A;  1E9S A;  2ZAO A;  1G8P A;  2LNH C;  4QNM A;  3T1H M;  1QAO A;  4GMQ A;  4LRS A;  2CHV A;  1D2N A;  3JAM S;  2Y2Q A;  4OU7 A;  2CHQ A;  2XZU A;  1NSF A;  4DV3 M;  2Q2E B;  4JI1 M;  1H6U A;  4JI0 M;  3DA1 A;  4M9S A;  2XFT A;  1GVN A;  3QAU A;  5KPZ A;  5ITX E;  4XGI A;  2ZAM A;  3U6D A;  4LZZ A;  4QHT A;  4DV1 M;  1G59 A;  4DUZ M;  4S12 A;  2FNA A;  2H1R A;  2I7N A;  4B7H A;  1I4W A;  3L2A A;  4GC5 A;  1IBL M;  4NSR A;  3SAU A;  4AW4 A;  7CAT A;  4NOO B;  2KEB A;  5EXP A;  3SYL A;  3I51 A;  1XWI A;  1IY1 A;  4A3V B;  3FUT A;  3W0L B;  3LMM A;  3HU2 A;  3RFW A;  1R2Z A;  2FE8 A;  3FUW A;  1OJL A;  5IRE B;  3GLH B;  3JR4 A;  3J81 S;  4II7 A;  2KRK A;  1W5S A;  4DV4 M;  4PD2 A;  1YE9 A;  3PXG A;  4MGK E;  2XLJ A;  3J7A S;  1JR3 A;  4DV0 M;  4M0W A;  3I4V A;  3ILK A;  2YQZ A;  3AFH A;  4FWD A;  3B9P A;  4KO8 A;  3CF0 A;  3GLH A;  3HHY A;  4NRV A;  5KPT A;  1DGB A;  2R4J A;  4LF9 M;  1DGG A;  3K92 A;  4G6Z A;  3W0F A;  2DXI A;  1DO2 A;  3CTW B;  1IM2 A;  4XBO A;  2UXB M;  4NY2 A;  3HU3 A;  2UXC M;  3FYC A;  2EUC A;  4FCW A;  3TQS A;  4FD2 A;  4RF1 A;  3SHG B;  1XMO M;  2NQ8 C;  2JE5 A;  4AZF A;  4FVM A;  4B08 A;  2Y20 A;  3T38 A;  4NYY A;  2RGH A;  4NZ5 A;  5EQT A;  3A46 A;  1Z5C A;  4IJF A;  3KP1 E;  2YNM D;  3U6S A;  2CEA A;  2DZO B;  4MGH A;  4AG5 A;  3MK6 A;  1IBM M;  2CHG A;  2X4A A;  3SAS A;  4IBG A;  3PNY A;  2Z4S A;  3SHF A;  1PJJ A;  4AI6 A;  1HQC A;  2W82 A;  4JI3 M;  1PM5 A;  3I4Y A;  1VDD A;  4G4R A;  1NJF A;  1DGH B;  4BB9 A;  3J2P B;  1L2D A;  1SXJ D;  3VLF B;  1J09 A;  4FWH A;  3SFZ A;  2M60 A;  4IBF A;  3T15 A;  1E94 E;  1K3X A;  3A42 A;  4YHH M;  5C1B A;  2F5O A;  3OTO M;  4LJ6 A;  3TPZ A;  2R45 A;  3TL4 X;  1QAQ A;  1DGH A;  3U6M A;  4DUY M;  3GPY A;  1R2Y A;  3LQR A;  5FTM A;  4L16 A;  3GLG A;  2D7H A;  3HHZ A;  3M7G A;  1TH4 A;  3SC3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...