1AIWA

Nmr structures of the cellulose-binding domain of the endoglucanase z from erwinia chrysanthemi, 23 structures
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
62
structure length
62
Chain Sequence
b'MGDCANANVYPNWVSKDWAGGQPTHNEAGQSIVYKGNLYTANWYTASVPGSDSSWTQVGSCN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOGLUCANASE Z
publication title Solution structure of the cellulose-binding domain of the endoglucanase Z secreted by Erwinia chrysanthemi.
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Cellulose degradation
total genus 18
structure length 62
sequence length 62
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 1997-04-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.20 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Carbohydrate-binding module superfamily 5/12 1aiwA00
1E6PA 3WD3A 2RTSA 1OGGA 4Z2IA 1UR8A 1GOIA 1GPFA 1UR9A 4MB5A 1O6IA 4Z2KA 1E15A 4Z2LA 4Z2GA 1ED7A 1W1VA 3WD4A 3WD2A 1AIWA 4HMDA 4Z2HA 4Z2JA 4MB4A 4TX8A 1E6ZA 1H0IA 1OGBA 1E6RA 1H0GA 3WD0A 2D49A 4HMCA 1W1YA 4HMEA 1E6NA 1W1TA 4MB3A 3WD1A 1W1PA
chains in the Genus database with same CATH superfamily
1E6PA 4NZ4A 4GH9A 2RTSA 2Y2HA 1GOIA 2XD5A 4IBKA 4IBGA 1UR9A 4IBEA 3L28A 2JCHA 1ED7A 3WX7A 2BG1A 3MQLA 3KS4A 3L25A 2Y2GA 4TX8A 2IOUA 3L29A 1H0IA 4OJOA 3WD0A 4HMCA 4IBIA 1W1YA 4HMEA 2Y2OA 1W1TA 3L27A 1PDCA 4IJFA 4IBDA 4Z2JA 4NYYA 2Y2LA 1YU4A 2V5OA 1H8PA 4Z2KA 3N3FA 1E8BA 4GHLA 1AIWA 3WD2A 4NZ5A 3L26A 1CK7A 1E88A 3HSHA 5BPVA 1OGBA 2Y2JA 1GXDA 1H0GA 2D49A 2Y2KA 2JE5A 1E6NA 4OUIA 4OJLA 4IBFA 3L2AA 4MB3A 1QO6A 1OGGA 4NY2A 4GHAA 1YU1A 4MB5A 3FKEA 4IBBA 4Z2GA 3WD4A 1YU0A 1CXWA 4QNLA 2XD1A 2Y2PA 2Y2NA 2FN2A 1KS0A 1L6JA 2Y2MA 4NZ3A 1EAKA 1YUEA 3WD3A 4Z2IA 1UR8A 1GPFA 3KS8A 2Y2IA 1YU2A 1O6IA 3HONA 4OJ6A 1E15A 4NZ1A 4Z2LA 1W1VA 3M7PA 1J7MA 4HMDA 4LG2A 4Z2HA 4OJ5A 4IBCA 4MB4A 4IBJA 1E6ZA 3WD1A 2Y2QA 1YU3A 1E6RA 2FFFB 4IJEA 4NYUA 2UWXA 1W1PA 4OJPA
chains in the Genus database with same CATH topology
1E6PA 3WD3A 2RTSA 1OGGA 4Z2IA 1UR8A 1GOIA 1GPFA 1UR9A 4MB5A 1O6IA 4Z2KA 1E15A 4Z2LA 4Z2GA 1ED7A 1W1VA 3WD4A 3WD2A 1AIWA 4HMDA 4Z2HA 4Z2JA 4MB4A 4TX8A 1E6ZA 1H0IA 1OGBA 1E6RA 1H0GA 3WD0A 2D49A 4HMCA 1W1YA 4HMEA 1E6NA 1W1TA 4MB3A 3WD1A 1W1PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E6P A;  3WD3 A;  2RTS A;  1OGG A;  4Z2I A;  1UR8 A;  1GOI A;  1GPF A;  1UR9 A;  4MB5 A;  1O6I A;  4Z2K A;  1E15 A;  4Z2L A;  4Z2G A;  1ED7 A;  1W1V A;  3WD4 A;  3WD2 A;  1AIW A;  4HMD A;  4Z2H A;  4Z2J A;  4MB4 A;  4TX8 A;  1E6Z A;  1H0I A;  1OGB A;  1E6R A;  1H0G A;  3WD0 A;  2D49 A;  4HMC A;  1W1Y A;  4HME A;  1E6N A;  1W1T A;  4MB3 A;  3WD1 A;  1W1P A; 
#chains in the Genus database with same CATH topology
 1E6P A;  4NZ4 A;  4GH9 A;  2RTS A;  2Y2H A;  1GOI A;  2XD5 A;  4IBK A;  4IBG A;  1UR9 A;  4IBE A;  3L28 A;  2JCH A;  1ED7 A;  3WX7 A;  2BG1 A;  3MQL A;  3KS4 A;  3L25 A;  2Y2G A;  4TX8 A;  2IOU A;  3L29 A;  1H0I A;  4OJO A;  3WD0 A;  4HMC A;  4IBI A;  1W1Y A;  4HME A;  2Y2O A;  1W1T A;  3L27 A;  1PDC A;  4IJF A;  4IBD A;  4Z2J A;  4NYY A;  2Y2L A;  1YU4 A;  2V5O A;  1H8P A;  4Z2K A;  3N3F A;  1E8B A;  4GHL A;  1AIW A;  3WD2 A;  4NZ5 A;  3L26 A;  1CK7 A;  1E88 A;  3HSH A;  5BPV A;  1OGB A;  2Y2J A;  1GXD A;  1H0G A;  2D49 A;  2Y2K A;  2JE5 A;  1E6N A;  4OUI A;  4OJL A;  4IBF A;  3L2A A;  4MB3 A;  1QO6 A;  1OGG A;  4NY2 A;  4GHA A;  1YU1 A;  4MB5 A;  3FKE A;  4IBB A;  4Z2G A;  3WD4 A;  1YU0 A;  1CXW A;  4QNL A;  2XD1 A;  2Y2P A;  2Y2N A;  2FN2 A;  1KS0 A;  1L6J A;  2Y2M A;  4NZ3 A;  1EAK A;  1YUE A;  3WD3 A;  4Z2I A;  1UR8 A;  1GPF A;  3KS8 A;  2Y2I A;  1YU2 A;  1O6I A;  3HON A;  4OJ6 A;  1E15 A;  4NZ1 A;  4Z2L A;  1W1V A;  3M7P A;  1J7M A;  4HMD A;  4LG2 A;  4Z2H A;  4OJ5 A;  4IBC A;  4MB4 A;  4IBJ A;  1E6Z A;  3WD1 A;  2Y2Q A;  1YU3 A;  1E6R A;  2FFF B;  4IJE A;  4NYU A;  2UWX A;  1W1P A;  4OJP A; 
#chains in the Genus database with same CATH homology
 1E6P A;  3WD3 A;  2RTS A;  1OGG A;  4Z2I A;  1UR8 A;  1GOI A;  1GPF A;  1UR9 A;  4MB5 A;  1O6I A;  4Z2K A;  1E15 A;  4Z2L A;  4Z2G A;  1ED7 A;  1W1V A;  3WD4 A;  3WD2 A;  1AIW A;  4HMD A;  4Z2H A;  4Z2J A;  4MB4 A;  4TX8 A;  1E6Z A;  1H0I A;  1OGB A;  1E6R A;  1H0G A;  3WD0 A;  2D49 A;  4HMC A;  1W1Y A;  4HME A;  1E6N A;  1W1T A;  4MB3 A;  3WD1 A;  1W1P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...