1I5HW

Solution structure of the rnedd4 wwiii domain-renal bp2 peptide complex
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
50
structure length
50
Chain Sequence
GSPVDSNDLGPLPPGWEERTHTDGRVFFINHNIKKTQWEDPRMQNVAITG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UBIQUITIN LIGASE NEDD4
publication title Solution structure of a Nedd4 WW domain-ENaC peptide complex.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Ligase
total genus 3
structure length 50
sequence length 50
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2001-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00397 WW WW domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 1i5hW00
2ZQSA 1EG3A 1ZCNA 2YSGA 3NTPA 3WH0A 4U85A 2M8JA 2LAJA 2YSIA 2E45A 1PINA 1I5HW 2M8IA 2XPAA 3KABA 2Q5AA 3TCZA 2ZQVA 2XP8A 2JX8A 1YW5A 2XPBA 1EG4A 1K9QA 4U84A 4U86A 2XP7A 2XP4A 3KAHA 2M3OW 2ZR5A 1K9RA 2YSHA 4E5RA 2DK1A 2DWVA 2KXQA 3KAGA 1JMQA 2JMFA 2ZQTA 2ITKA 3L4HA 3OOBA 5AHTA 2YSBA 3TC5A 2DJYA 3KCEA 2XP5A 2XP3A 1WMVA 2EZ5W 2ZAJA 2DMVA 1F8AB 3TDBA 5CQ2A 2DK7A 2F21A 3KAIA 3M7NA 3KAFA 2XP9A 2RE3A 4REXA 3CNGA 1NMVA 3KADA 1WR7A 2L4JA 2XP6A 2MDIA 2ZR4A 2ZQUA 2JV4A 1O6WA 2JXWA 4QIBA 2ZR6A 3LE4A 3ODKA 3M85A 2BA1A 2YSFA 1TK7A
chains in the Genus database with same CATH superfamily
2ZQSA 1EG3A 1ZCNA 2YSGA 3NTPA 3WH0A 4U85A 2M8JA 5E62A 2LAJA 5E5WA 2YSIA 4A0UA 3FSBA 2E45A 1PINA 5E66A 1I5HW 2M8IA 2XPAA 3KABA 2Q5AA 3TCZA 2ZQVA 2XP8A 2JX8A 1YW5A 2XPBA 1EG4A 4GLXA 1K9QA 5U47A 3FSCA 5E64A 4U84A 4U86A 2XP7A 3MCBA 2XP4A 3KAHA 2M3OW 2ZR5A 1K9RA 2YSHA 4E5RA 2DK1A 2DWVA 2KXQA 3KAGA 1TR8A 3LKXA 1JMQA 2JMFA 2ZQTA 2ITKA 3L4HA 3OOBA 5AHTA 2YAJB 2Y8NB 5E65A 2YSBA 3TC5A 2DJYA 3KCEA 2XP5A 1FLCA 1RP5A 2XP3A 1WMVA 2EZ5W 4A0TA 2ZAJA 2DMVA 1F8AB 3TDBA 5CQ2A 3MQHA 2DK7A 2F21A 3MCBB 3KAIA 3M7NA 3KAFA 2WAEA 2XP9A 2RE3A 4REXA 3CNGA 1NMVA 3KADA 3LKXB 3PQHA 1WR7A 2L4JA 2XP6A 2OWOA 2MDIA 2ZR4A 2ZQUA 2JV4A 2QRVA 1O6WA 3MQGA 2JXWA 4QIBA 2ZR6A 2WADA 3LE4A 3ODKA 3M85A 2BA1A 2YSFA 1TK7A 3FS8A
chains in the Genus database with same CATH topology
2ZQSA 1EG3A 1ZCNA 2YSGA 3NTPA 3WH0A 4U85A 2M8JA 5E62A 2LAJA 5E5WA 2YSIA 4A0UA 3FSBA 2E45A 1PINA 5E66A 1I5HW 2M8IA 2XPAA 3KABA 2Q5AA 3TCZA 2ZQVA 2XP8A 2JX8A 1YW5A 2XPBA 1EG4A 4GLXA 1K9QA 5U47A 3FSCA 5E64A 4U84A 4U86A 2XP7A 3MCBA 2XP4A 3KAHA 2M3OW 2ZR5A 1K9RA 2YSHA 4E5RA 2DK1A 2DWVA 2KXQA 3KAGA 1TR8A 3LKXA 1JMQA 2JMFA 2ZQTA 2ITKA 3L4HA 3OOBA 5AHTA 2YAJB 2Y8NB 5E65A 2YSBA 3TC5A 2DJYA 3KCEA 2XP5A 1FLCA 1RP5A 2XP3A 1WMVA 2EZ5W 4A0TA 2ZAJA 2DMVA 1F8AB 3TDBA 5CQ2A 3MQHA 2DK7A 2F21A 3MCBB 3KAIA 3M7NA 3KAFA 2WAEA 2XP9A 2RE3A 4REXA 3CNGA 1NMVA 3KADA 3LKXB 3PQHA 1WR7A 2L4JA 2XP6A 2OWOA 2MDIA 2ZR4A 2ZQUA 2JV4A 2QRVA 1O6WA 3MQGA 2JXWA 4QIBA 2ZR6A 2WADA 3LE4A 3ODKA 3M85A 2BA1A 2YSFA 1TK7A 3FS8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZQS A;  1EG3 A;  1ZCN A;  2YSG A;  3NTP A;  3WH0 A;  4U85 A;  2M8J A;  2LAJ A;  2YSI A;  2E45 A;  1PIN A;  1I5H W;  2M8I A;  2XPA A;  3KAB A;  2Q5A A;  3TCZ A;  2ZQV A;  2XP8 A;  2JX8 A;  1YW5 A;  2XPB A;  1EG4 A;  1K9Q A;  4U84 A;  4U86 A;  2XP7 A;  2XP4 A;  3KAH A;  2M3O W;  2ZR5 A;  1K9R A;  2YSH A;  4E5R A;  2DK1 A;  2DWV A;  2KXQ A;  3KAG A;  1JMQ A;  2JMF A;  2ZQT A;  2ITK A;  3L4H A;  3OOB A;  5AHT A;  2YSB A;  3TC5 A;  2DJY A;  3KCE A;  2XP5 A;  2XP3 A;  1WMV A;  2EZ5 W;  2ZAJ A;  2DMV A;  1F8A B;  3TDB A;  5CQ2 A;  2DK7 A;  2F21 A;  3KAI A;  3M7N A;  3KAF A;  2XP9 A;  2RE3 A;  4REX A;  3CNG A;  1NMV A;  3KAD A;  1WR7 A;  2L4J A;  2XP6 A;  2MDI A;  2ZR4 A;  2ZQU A;  2JV4 A;  1O6W A;  2JXW A;  4QIB A;  2ZR6 A;  3LE4 A;  3ODK A;  3M85 A;  2BA1 A;  2YSF A;  1TK7 A; 
#chains in the Genus database with same CATH topology
 2ZQS A;  1EG3 A;  1ZCN A;  2YSG A;  3NTP A;  3WH0 A;  4U85 A;  2M8J A;  5E62 A;  2LAJ A;  5E5W A;  2YSI A;  4A0U A;  3FSB A;  2E45 A;  1PIN A;  5E66 A;  1I5H W;  2M8I A;  2XPA A;  3KAB A;  2Q5A A;  3TCZ A;  2ZQV A;  2XP8 A;  2JX8 A;  1YW5 A;  2XPB A;  1EG4 A;  4GLX A;  1K9Q A;  5U47 A;  3FSC A;  5E64 A;  4U84 A;  4U86 A;  2XP7 A;  3MCB A;  2XP4 A;  3KAH A;  2M3O W;  2ZR5 A;  1K9R A;  2YSH A;  4E5R A;  2DK1 A;  2DWV A;  2KXQ A;  3KAG A;  1TR8 A;  3LKX A;  1JMQ A;  2JMF A;  2ZQT A;  2ITK A;  3L4H A;  3OOB A;  5AHT A;  2YAJ B;  2Y8N B;  5E65 A;  2YSB A;  3TC5 A;  2DJY A;  3KCE A;  2XP5 A;  1FLC A;  1RP5 A;  2XP3 A;  1WMV A;  2EZ5 W;  4A0T A;  2ZAJ A;  2DMV A;  1F8A B;  3TDB A;  5CQ2 A;  3MQH A;  2DK7 A;  2F21 A;  3MCB B;  3KAI A;  3M7N A;  3KAF A;  2WAE A;  2XP9 A;  2RE3 A;  4REX A;  3CNG A;  1NMV A;  3KAD A;  3LKX B;  3PQH A;  1WR7 A;  2L4J A;  2XP6 A;  2OWO A;  2MDI A;  2ZR4 A;  2ZQU A;  2JV4 A;  2QRV A;  1O6W A;  3MQG A;  2JXW A;  4QIB A;  2ZR6 A;  2WAD A;  3LE4 A;  3ODK A;  3M85 A;  2BA1 A;  2YSF A;  1TK7 A;  3FS8 A; 
#chains in the Genus database with same CATH homology
 2ZQS A;  1EG3 A;  1ZCN A;  2YSG A;  3NTP A;  3WH0 A;  4U85 A;  2M8J A;  5E62 A;  2LAJ A;  5E5W A;  2YSI A;  4A0U A;  3FSB A;  2E45 A;  1PIN A;  5E66 A;  1I5H W;  2M8I A;  2XPA A;  3KAB A;  2Q5A A;  3TCZ A;  2ZQV A;  2XP8 A;  2JX8 A;  1YW5 A;  2XPB A;  1EG4 A;  4GLX A;  1K9Q A;  5U47 A;  3FSC A;  5E64 A;  4U84 A;  4U86 A;  2XP7 A;  3MCB A;  2XP4 A;  3KAH A;  2M3O W;  2ZR5 A;  1K9R A;  2YSH A;  4E5R A;  2DK1 A;  2DWV A;  2KXQ A;  3KAG A;  1TR8 A;  3LKX A;  1JMQ A;  2JMF A;  2ZQT A;  2ITK A;  3L4H A;  3OOB A;  5AHT A;  2YAJ B;  2Y8N B;  5E65 A;  2YSB A;  3TC5 A;  2DJY A;  3KCE A;  2XP5 A;  1FLC A;  1RP5 A;  2XP3 A;  1WMV A;  2EZ5 W;  4A0T A;  2ZAJ A;  2DMV A;  1F8A B;  3TDB A;  5CQ2 A;  3MQH A;  2DK7 A;  2F21 A;  3MCB B;  3KAI A;  3M7N A;  3KAF A;  2WAE A;  2XP9 A;  2RE3 A;  4REX A;  3CNG A;  1NMV A;  3KAD A;  3LKX B;  3PQH A;  1WR7 A;  2L4J A;  2XP6 A;  2OWO A;  2MDI A;  2ZR4 A;  2ZQU A;  2JV4 A;  2QRV A;  1O6W A;  3MQG A;  2JXW A;  4QIB A;  2ZR6 A;  2WAD A;  3LE4 A;  3ODK A;  3M85 A;  2BA1 A;  2YSF A;  1TK7 A;  3FS8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...