1I5HW

Solution structure of the rnedd4 wwiii domain-renal bp2 peptide complex
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
50
structure length
50
Chain Sequence
GSPVDSNDLGPLPPGWEERTHTDGRVFFINHNIKKTQWEDPRMQNVAITG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords UBIQUITIN LIGASE NEDD4
publication title Solution structure of a Nedd4 WW domain-ENaC peptide complex.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 3
structure length 50
sequence length 50
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2001-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00397 WW WW domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 1i5hW00
3CNGA 1WMVA 2XP4A 2JMFA 1WR7A 1NMVA 3L4HA 4E5RA 2YSGA 3ODKA 2XP9A 2M8IA 2M3OW 2YSBA 4U86A 2DMVA 2JV4A 2F21A 5AHTA 2XPBA 1JMQA 3M85A 1EG3A 1O6WA 3KAHA 2M8JA 2XP3A 5CQ2A 2E45A 4QIBA 2L4JA 2ZQVA 2DJYA 2XP8A 1ZCNA 2JXWA 2XP6A 2LAJA 2ZQTA 2ITKA 2DK1A 1TK7A 2ZR6A 3KAGA 1YW5A 2XP5A 3KAIA 2ZR5A 2RE3A 4U84A 2YSIA 2YSHA 2ZR4A 2XP7A 3LE4A 3TDBA 1EG4A 2ZAJA 2MDIA 3KAFA 3TCZA 2JX8A 2KXQA 3KCEA 2EZ5W 2BA1A 2XPAA 3NTPA 3WH0A 1K9QA 4U85A 3TC5A 2YSFA 2ZQUA 3KADA 2ZQSA 3KABA 3M7NA 1F8AB 1PINA 2Q5AA 1K9RA 1I5HW 3OOBA 2DWVA 4REXA 2DK7A
chains in the Genus database with same CATH superfamily
3CNGA 1WMVA 2XP4A 5E64A 2JMFA 1WR7A 1NMVA 3L4HA 4A0TA 4E5RA 3MCBA 1FLCA 2YSGA 3ODKA 2XP9A 2M8IA 2M3OW 2WAEA 2OWOA 2YSBA 4U86A 2DMVA 2JV4A 2F21A 5AHTA 4A0UA 2XPBA 1JMQA 3M85A 2QRVA 1EG3A 1O6WA 3KAHA 2YAJB 2M8JA 2XP3A 5CQ2A 2E45A 5E5WA 4QIBA 2L4JA 2ZQVA 2DJYA 2XP8A 5E65A 1ZCNA 2JXWA 2XP6A 3MCBB 2LAJA 2ZQTA 1TR8A 2ITKA 2DK1A 3MQGA 1TK7A 2ZR6A 3KAGA 1YW5A 2XP5A 3KAIA 3LKXA 4GLXA 2WADA 2ZR5A 1RP5A 2RE3A 2YSIA 4U84A 2YSHA 2ZR4A 5U47A 2XP7A 3LE4A 3TDBA 1EG4A 2ZAJA 2MDIA 3KAFA 3MQHA 5E66A 3TCZA 2JX8A 2KXQA 3KCEA 2EZ5W 2BA1A 2XPAA 3NTPA 3WH0A 1K9QA 3PQHA 4U85A 3TC5A 2YSFA 2ZQUA 3KADA 2ZQSA 3KABA 3M7NA 1F8AB 3FSBA 1PINA 3LKXB 2Y8NB 3FS8A 5E62A 2Q5AA 1K9RA 1I5HW 3FSCA 3OOBA 2DWVA 4REXA 2DK7A
chains in the Genus database with same CATH topology
3CNGA 1WMVA 2XP4A 5E64A 2JMFA 1WR7A 1NMVA 3L4HA 4A0TA 4E5RA 3MCBA 1FLCA 2YSGA 3ODKA 2XP9A 2M8IA 2M3OW 2WAEA 2OWOA 2YSBA 4U86A 2DMVA 2JV4A 2F21A 5AHTA 4A0UA 2XPBA 1JMQA 3M85A 2QRVA 1EG3A 1O6WA 3KAHA 2YAJB 2M8JA 2XP3A 5CQ2A 2E45A 5E5WA 4QIBA 2L4JA 2ZQVA 2DJYA 2XP8A 5E65A 1ZCNA 2JXWA 2XP6A 3MCBB 2LAJA 2ZQTA 1TR8A 2ITKA 2DK1A 3MQGA 1TK7A 2ZR6A 3KAGA 1YW5A 2XP5A 3KAIA 3LKXA 4GLXA 2WADA 2ZR5A 1RP5A 2RE3A 2YSIA 4U84A 2YSHA 2ZR4A 5U47A 2XP7A 3LE4A 3TDBA 1EG4A 2ZAJA 2MDIA 3KAFA 3MQHA 5E66A 3TCZA 2JX8A 2KXQA 3KCEA 2EZ5W 2BA1A 2XPAA 3NTPA 3WH0A 1K9QA 3PQHA 4U85A 3TC5A 2YSFA 2ZQUA 3KADA 2ZQSA 3KABA 3M7NA 1F8AB 3FSBA 1PINA 3LKXB 2Y8NB 3FS8A 5E62A 2Q5AA 1K9RA 1I5HW 3FSCA 3OOBA 2DWVA 4REXA 2DK7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CNG A;  1WMV A;  2XP4 A;  2JMF A;  1WR7 A;  1NMV A;  3L4H A;  4E5R A;  2YSG A;  3ODK A;  2XP9 A;  2M8I A;  2M3O W;  2YSB A;  4U86 A;  2DMV A;  2JV4 A;  2F21 A;  5AHT A;  2XPB A;  1JMQ A;  3M85 A;  1EG3 A;  1O6W A;  3KAH A;  2M8J A;  2XP3 A;  5CQ2 A;  2E45 A;  4QIB A;  2L4J A;  2ZQV A;  2DJY A;  2XP8 A;  1ZCN A;  2JXW A;  2XP6 A;  2LAJ A;  2ZQT A;  2ITK A;  2DK1 A;  1TK7 A;  2ZR6 A;  3KAG A;  1YW5 A;  2XP5 A;  3KAI A;  2ZR5 A;  2RE3 A;  4U84 A;  2YSI A;  2YSH A;  2ZR4 A;  2XP7 A;  3LE4 A;  3TDB A;  1EG4 A;  2ZAJ A;  2MDI A;  3KAF A;  3TCZ A;  2JX8 A;  2KXQ A;  3KCE A;  2EZ5 W;  2BA1 A;  2XPA A;  3NTP A;  3WH0 A;  1K9Q A;  4U85 A;  3TC5 A;  2YSF A;  2ZQU A;  3KAD A;  2ZQS A;  3KAB A;  3M7N A;  1F8A B;  1PIN A;  2Q5A A;  1K9R A;  1I5H W;  3OOB A;  2DWV A;  4REX A;  2DK7 A; 
#chains in the Genus database with same CATH topology
 3CNG A;  1WMV A;  2XP4 A;  5E64 A;  2JMF A;  1WR7 A;  1NMV A;  3L4H A;  4A0T A;  4E5R A;  3MCB A;  1FLC A;  2YSG A;  3ODK A;  2XP9 A;  2M8I A;  2M3O W;  2WAE A;  2OWO A;  2YSB A;  4U86 A;  2DMV A;  2JV4 A;  2F21 A;  5AHT A;  4A0U A;  2XPB A;  1JMQ A;  3M85 A;  2QRV A;  1EG3 A;  1O6W A;  3KAH A;  2YAJ B;  2M8J A;  2XP3 A;  5CQ2 A;  2E45 A;  5E5W A;  4QIB A;  2L4J A;  2ZQV A;  2DJY A;  2XP8 A;  5E65 A;  1ZCN A;  2JXW A;  2XP6 A;  3MCB B;  2LAJ A;  2ZQT A;  1TR8 A;  2ITK A;  2DK1 A;  3MQG A;  1TK7 A;  2ZR6 A;  3KAG A;  1YW5 A;  2XP5 A;  3KAI A;  3LKX A;  4GLX A;  2WAD A;  2ZR5 A;  1RP5 A;  2RE3 A;  2YSI A;  4U84 A;  2YSH A;  2ZR4 A;  5U47 A;  2XP7 A;  3LE4 A;  3TDB A;  1EG4 A;  2ZAJ A;  2MDI A;  3KAF A;  3MQH A;  5E66 A;  3TCZ A;  2JX8 A;  2KXQ A;  3KCE A;  2EZ5 W;  2BA1 A;  2XPA A;  3NTP A;  3WH0 A;  1K9Q A;  3PQH A;  4U85 A;  3TC5 A;  2YSF A;  2ZQU A;  3KAD A;  2ZQS A;  3KAB A;  3M7N A;  1F8A B;  3FSB A;  1PIN A;  3LKX B;  2Y8N B;  3FS8 A;  5E62 A;  2Q5A A;  1K9R A;  1I5H W;  3FSC A;  3OOB A;  2DWV A;  4REX A;  2DK7 A; 
#chains in the Genus database with same CATH homology
 3CNG A;  1WMV A;  2XP4 A;  5E64 A;  2JMF A;  1WR7 A;  1NMV A;  3L4H A;  4A0T A;  4E5R A;  3MCB A;  1FLC A;  2YSG A;  3ODK A;  2XP9 A;  2M8I A;  2M3O W;  2WAE A;  2OWO A;  2YSB A;  4U86 A;  2DMV A;  2JV4 A;  2F21 A;  5AHT A;  4A0U A;  2XPB A;  1JMQ A;  3M85 A;  2QRV A;  1EG3 A;  1O6W A;  3KAH A;  2YAJ B;  2M8J A;  2XP3 A;  5CQ2 A;  2E45 A;  5E5W A;  4QIB A;  2L4J A;  2ZQV A;  2DJY A;  2XP8 A;  5E65 A;  1ZCN A;  2JXW A;  2XP6 A;  3MCB B;  2LAJ A;  2ZQT A;  1TR8 A;  2ITK A;  2DK1 A;  3MQG A;  1TK7 A;  2ZR6 A;  3KAG A;  1YW5 A;  2XP5 A;  3KAI A;  3LKX A;  4GLX A;  2WAD A;  2ZR5 A;  1RP5 A;  2RE3 A;  2YSI A;  4U84 A;  2YSH A;  2ZR4 A;  5U47 A;  2XP7 A;  3LE4 A;  3TDB A;  1EG4 A;  2ZAJ A;  2MDI A;  3KAF A;  3MQH A;  5E66 A;  3TCZ A;  2JX8 A;  2KXQ A;  3KCE A;  2EZ5 W;  2BA1 A;  2XPA A;  3NTP A;  3WH0 A;  1K9Q A;  3PQH A;  4U85 A;  3TC5 A;  2YSF A;  2ZQU A;  3KAD A;  2ZQS A;  3KAB A;  3M7N A;  1F8A B;  3FSB A;  1PIN A;  3LKX B;  2Y8N B;  3FS8 A;  5E62 A;  2Q5A A;  1K9R A;  1I5H W;  3FSC A;  3OOB A;  2DWV A;  4REX A;  2DK7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...