1I5HW

Solution structure of the rnedd4 wwiii domain-renal bp2 peptide complex
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
50
structure length
50
Chain Sequence
GSPVDSNDLGPLPPGWEERTHTDGRVFFINHNIKKTQWEDPRMQNVAITG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UBIQUITIN LIGASE NEDD4
publication title Solution structure of a Nedd4 WW domain-ENaC peptide complex.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Ligase
total genus 3
structure length 50
sequence length 50
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2001-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00397 WW WW domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 1i5hW00
2YSBA 1K9QA 3L4HA 5AHTA 2ZQUA 2M3OW 2F21A 2ZQVA 5CQ2A 2MDIA 2ZR6A 3ODKA 2JV4A 3OOBA 3TDBA 4U85A 1EG3A 1TK7A 2BA1A 2ZR5A 2XP8A 2YSIA 2E45A 2YSHA 3KADA 3KAGA 2DMVA 2ZQTA 2M8IA 3KAFA 4REXA 1EG4A 3KAIA 2XPAA 2YSGA 4QIBA 2DK1A 2XP7A 2DWVA 1F8AB 4U84A 2KXQA 3LE4A 2RE3A 3CNGA 2XP6A 2ZR4A 4E5RA 1K9RA 1O6WA 3KAHA 2XPBA 2ZAJA 2DK7A 2DJYA 3M7NA 2Q5AA 2JX8A 2YSFA 2JXWA 2L4JA 2XP5A 1WR7A 2XP9A 3WH0A 1ZCNA 2LAJA 1JMQA 2ZQSA 3TC5A 4U86A 3KABA 1PINA 3TCZA 3M85A 2JMFA 3NTPA 2XP4A 1WMVA 1I5HW 2XP3A 1YW5A 3KCEA 2EZ5W 2M8JA 1NMVA 2ITKA
chains in the Genus database with same CATH superfamily
2YSBA 1K9QA 3L4HA 5AHTA 2ZQUA 3LKXA 2M3OW 2F21A 2ZQVA 1RP5A 5CQ2A 3MQHA 2YAJB 2MDIA 2QRVA 2ZR6A 3ODKA 2JV4A 3OOBA 3TDBA 4U85A 3MCBB 1EG3A 1TK7A 2BA1A 2ZR5A 2XP8A 2YSIA 2E45A 2YSHA 3KADA 3KAGA 2DMVA 2ZQTA 2M8IA 3KAFA 2Y8NB 3FSBA 4REXA 1EG4A 1FLCA 3KAIA 2XPAA 2YSGA 4QIBA 2DK1A 2XP7A 2DWVA 1F8AB 4GLXA 4U84A 2KXQA 3LE4A 2RE3A 3CNGA 2XP6A 2ZR4A 5U47A 1TR8A 4E5RA 1K9RA 5E64A 3PQHA 1O6WA 3KAHA 2XPBA 2ZAJA 2DK7A 2DJYA 3M7NA 5E5WA 2Q5AA 2JX8A 2YSFA 2JXWA 2L4JA 2XP5A 1WR7A 2XP9A 2WAEA 5E65A 3WH0A 3MCBA 1ZCNA 2LAJA 5E66A 3FSCA 3LKXB 2OWOA 1JMQA 2ZQSA 3TC5A 3FS8A 4U86A 3KABA 1PINA 3TCZA 3M85A 2WADA 2JMFA 5E62A 3NTPA 2XP4A 4A0UA 1WMVA 1I5HW 2XP3A 3MQGA 1YW5A 3KCEA 2EZ5W 2M8JA 1NMVA 4A0TA 2ITKA
chains in the Genus database with same CATH topology
2YSBA 1K9QA 3L4HA 5AHTA 2ZQUA 3LKXA 2M3OW 2F21A 2ZQVA 1RP5A 5CQ2A 3MQHA 2YAJB 2MDIA 2QRVA 2ZR6A 3ODKA 2JV4A 3OOBA 3TDBA 4U85A 3MCBB 1EG3A 1TK7A 2BA1A 2ZR5A 2XP8A 2YSIA 2E45A 2YSHA 3KADA 3KAGA 2DMVA 2ZQTA 2M8IA 3KAFA 2Y8NB 3FSBA 4REXA 1EG4A 1FLCA 3KAIA 2XPAA 2YSGA 4QIBA 2DK1A 2XP7A 2DWVA 1F8AB 4GLXA 4U84A 2KXQA 3LE4A 2RE3A 3CNGA 2XP6A 2ZR4A 5U47A 1TR8A 4E5RA 1K9RA 5E64A 3PQHA 1O6WA 3KAHA 2XPBA 2ZAJA 2DK7A 2DJYA 3M7NA 5E5WA 2Q5AA 2JX8A 2YSFA 2JXWA 2L4JA 2XP5A 1WR7A 2XP9A 2WAEA 5E65A 3WH0A 3MCBA 1ZCNA 2LAJA 5E66A 3FSCA 3LKXB 2OWOA 1JMQA 2ZQSA 3TC5A 3FS8A 4U86A 3KABA 1PINA 3TCZA 3M85A 2WADA 2JMFA 5E62A 3NTPA 2XP4A 4A0UA 1WMVA 1I5HW 2XP3A 3MQGA 1YW5A 3KCEA 2EZ5W 2M8JA 1NMVA 4A0TA 2ITKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YSB A;  1K9Q A;  3L4H A;  5AHT A;  2ZQU A;  2M3O W;  2F21 A;  2ZQV A;  5CQ2 A;  2MDI A;  2ZR6 A;  3ODK A;  2JV4 A;  3OOB A;  3TDB A;  4U85 A;  1EG3 A;  1TK7 A;  2BA1 A;  2ZR5 A;  2XP8 A;  2YSI A;  2E45 A;  2YSH A;  3KAD A;  3KAG A;  2DMV A;  2ZQT A;  2M8I A;  3KAF A;  4REX A;  1EG4 A;  3KAI A;  2XPA A;  2YSG A;  4QIB A;  2DK1 A;  2XP7 A;  2DWV A;  1F8A B;  4U84 A;  2KXQ A;  3LE4 A;  2RE3 A;  3CNG A;  2XP6 A;  2ZR4 A;  4E5R A;  1K9R A;  1O6W A;  3KAH A;  2XPB A;  2ZAJ A;  2DK7 A;  2DJY A;  3M7N A;  2Q5A A;  2JX8 A;  2YSF A;  2JXW A;  2L4J A;  2XP5 A;  1WR7 A;  2XP9 A;  3WH0 A;  1ZCN A;  2LAJ A;  1JMQ A;  2ZQS A;  3TC5 A;  4U86 A;  3KAB A;  1PIN A;  3TCZ A;  3M85 A;  2JMF A;  3NTP A;  2XP4 A;  1WMV A;  1I5H W;  2XP3 A;  1YW5 A;  3KCE A;  2EZ5 W;  2M8J A;  1NMV A;  2ITK A; 
#chains in the Genus database with same CATH topology
 2YSB A;  1K9Q A;  3L4H A;  5AHT A;  2ZQU A;  3LKX A;  2M3O W;  2F21 A;  2ZQV A;  1RP5 A;  5CQ2 A;  3MQH A;  2YAJ B;  2MDI A;  2QRV A;  2ZR6 A;  3ODK A;  2JV4 A;  3OOB A;  3TDB A;  4U85 A;  3MCB B;  1EG3 A;  1TK7 A;  2BA1 A;  2ZR5 A;  2XP8 A;  2YSI A;  2E45 A;  2YSH A;  3KAD A;  3KAG A;  2DMV A;  2ZQT A;  2M8I A;  3KAF A;  2Y8N B;  3FSB A;  4REX A;  1EG4 A;  1FLC A;  3KAI A;  2XPA A;  2YSG A;  4QIB A;  2DK1 A;  2XP7 A;  2DWV A;  1F8A B;  4GLX A;  4U84 A;  2KXQ A;  3LE4 A;  2RE3 A;  3CNG A;  2XP6 A;  2ZR4 A;  5U47 A;  1TR8 A;  4E5R A;  1K9R A;  5E64 A;  3PQH A;  1O6W A;  3KAH A;  2XPB A;  2ZAJ A;  2DK7 A;  2DJY A;  3M7N A;  5E5W A;  2Q5A A;  2JX8 A;  2YSF A;  2JXW A;  2L4J A;  2XP5 A;  1WR7 A;  2XP9 A;  2WAE A;  5E65 A;  3WH0 A;  3MCB A;  1ZCN A;  2LAJ A;  5E66 A;  3FSC A;  3LKX B;  2OWO A;  1JMQ A;  2ZQS A;  3TC5 A;  3FS8 A;  4U86 A;  3KAB A;  1PIN A;  3TCZ A;  3M85 A;  2WAD A;  2JMF A;  5E62 A;  3NTP A;  2XP4 A;  4A0U A;  1WMV A;  1I5H W;  2XP3 A;  3MQG A;  1YW5 A;  3KCE A;  2EZ5 W;  2M8J A;  1NMV A;  4A0T A;  2ITK A; 
#chains in the Genus database with same CATH homology
 2YSB A;  1K9Q A;  3L4H A;  5AHT A;  2ZQU A;  3LKX A;  2M3O W;  2F21 A;  2ZQV A;  1RP5 A;  5CQ2 A;  3MQH A;  2YAJ B;  2MDI A;  2QRV A;  2ZR6 A;  3ODK A;  2JV4 A;  3OOB A;  3TDB A;  4U85 A;  3MCB B;  1EG3 A;  1TK7 A;  2BA1 A;  2ZR5 A;  2XP8 A;  2YSI A;  2E45 A;  2YSH A;  3KAD A;  3KAG A;  2DMV A;  2ZQT A;  2M8I A;  3KAF A;  2Y8N B;  3FSB A;  4REX A;  1EG4 A;  1FLC A;  3KAI A;  2XPA A;  2YSG A;  4QIB A;  2DK1 A;  2XP7 A;  2DWV A;  1F8A B;  4GLX A;  4U84 A;  2KXQ A;  3LE4 A;  2RE3 A;  3CNG A;  2XP6 A;  2ZR4 A;  5U47 A;  1TR8 A;  4E5R A;  1K9R A;  5E64 A;  3PQH A;  1O6W A;  3KAH A;  2XPB A;  2ZAJ A;  2DK7 A;  2DJY A;  3M7N A;  5E5W A;  2Q5A A;  2JX8 A;  2YSF A;  2JXW A;  2L4J A;  2XP5 A;  1WR7 A;  2XP9 A;  2WAE A;  5E65 A;  3WH0 A;  3MCB A;  1ZCN A;  2LAJ A;  5E66 A;  3FSC A;  3LKX B;  2OWO A;  1JMQ A;  2ZQS A;  3TC5 A;  3FS8 A;  4U86 A;  3KAB A;  1PIN A;  3TCZ A;  3M85 A;  2WAD A;  2JMF A;  5E62 A;  3NTP A;  2XP4 A;  4A0U A;  1WMV A;  1I5H W;  2XP3 A;  3MQG A;  1YW5 A;  3KCE A;  2EZ5 W;  2M8J A;  1NMV A;  4A0T A;  2ITK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...