2XPAA

Discovery of cell-active phenyl-imidazole pin1 inhibitors by structure-guided fragment evolution
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
157
structure length
146
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of Cell-Active Phenyl-Imidazole Pin1 Inhibitors by Structure-Guided Fragment Evolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords PEPTIDYL-PROLYL CIS-TRANS ISOMERASE NIMA-INTERACTING 1
total genus 47
structure length 146
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2xpaA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2xpaA02
4FN2A 1FAPA 4ODOA 1PBKA 2M2AA 1WR7A 4W9PA 2LGOA 2ZQSA 4U86A 2DG4A 4DRPA 1JNTA 1KT1A 2XP8A 4J4OA 2JX8A 4LAVA 1W26A 1FKTA 3GPKA 4IPXA 5DIUA 4DRJA 4DRKA 1K9RA 2KR7A 3CNGA 1NMWA 2KI3A 3IK8A 2FAPA 1BKFA 3JYMA 2PV3A 4TNSA 5HWBA 1N1AA 5I98A 1FKGA 4JFKA 2M8JA 3KABA 2K8IA 4TW6A 2M1IA 2MLZA 5HW7A 2RUQA 3UQBA 2MPHA 1FKSA 4G50A 1A7XA 2ZQTA 3M85A 4DRQA 1R9HA 3ODKA 3O5GA 1WMVA 1ZK6A 4ODKA 2DWVA 1O6WA 3NI6A 1I5HW 2VCDA 3O5LA 3WH0A 4R0XA 2ZAJA 2IF4A 3KACA 4LAXA 4ODRA 4DRNA 1NSGA 2LAJA 2VN1A 2D9FA 1JNSA 5D75A 4ODQA 1QZ2A 4QIBA 3UQAA 2ZR6A 2KXQA 2F4EA 4W9QA 2Q5AA 4TW7A 5HUAA 1J4IA 1F8AB 2E45A 3PA7A 3TDBA 1FKKA 2MF9A 3TCZA 2N87A 4JFLA 1FKJA 4U84A 4N19A 4ODLA 3UF8A 2JV4A 4ODNA 3OOBA 1FKLA 3LE4A 5HTGA 1J4HA 1PINA 2M3OW 1FD9A 1BL4A 1J4RA 1TCOC 3I6CA 2ZR5A 4JFMA 4W9OA 4DRHA 1L1PA 3NTPA 4U85A 1YW5A 1HXVA 1QPLA 2ZQUA 2BA1A 1Q1CA 3RFWA 2ZR4A 2DG9A 3O5PA 5DITA 4DROA 2YSBA 1ZCNA 2JXWA 1ROTA 3MDYB 4GIVA 5HWCA 2PBCA 3IHZA 2MDIA 3O5MA 3H9RB 5HW6A 4G2PA 4NNRA 2YSHA 2DK7A 2JZVA 1D7IA 1FKIA 2KGJA 3O5QA 3IKDA 2KE0A 4ITZA 5DIVA 2RURA 3KCEA 2YSIA 2OFNA 2Y78A 4DT4A 4DZ2A 3RGCA 3PRDA 1FKRA 5CQ2A 1ROUA 3O5IA 4QT2A 4MGVA 1M5YA 2XP7A 5HT1A 3NRKA 4FAPA 4ODPA 1FKDA 4C02B 1FJDA 4DRMA 1EYMA 4DRIA 5B8IC 2LJ4A 2M08A 4MSPA 1EQ3A 2AWGA 1D7HA 1EG3A 1C9HA 4JFIA 4LAYA 3JXVA 1F40A 2XPBA 4GGQA 2LPVA 3O5DA 4DH0A 3VAWA 3UI6A 4O2TA 3O5JA 5AHTA 4TW8A 2PV1A 2PPPA 4JYSA 1TK7A 2YSFA 2XP9A 2ZQVA 2L2SA 2MNTA 2RUDA 3FAPA 4JFJA 1NMVA 2YSGA 3PRBA 2M8IA 4ODMA 4DIPA 2DJYA 5HW8A 2PV2A 1EG4A 2DMVA 2XP6A 1K9QA 1YATA 2KO7A 4REXA 2LKNA 4TYOA 2DK1A 3O5OA 2F21A 2KFWA 4DZ3A 3KAIA 3O5FA 4LAWA 3KAGA 3O5EA 3O5KA 5J6EA 2RSEA 3B7XA 2XPAA 1Q6IA 4TX0A 1Q6UA 1FKFA 2XP4A 3KAFA 2RE3A 3KZ7A 1Y0OA 5GPGA 4IQCA 1J6YA 1P5QA 1T11A 2L4JA 1FKBA 1JVWA 1Q6HA 2F2DA 1JMQA 3KADA 1FKHA 5BXJA 2ITKA 3JYJA 1KT0A 2FKEA 4BF8A 1D7JA 2XP5A 2PPOA 3O5RA 3M7NA 2PPNA 4E5RA 2EZ5W 1U79A 2MLYA 2UZ5A 3L4HA 3TC5A 3KAHA 2MLXA 2RUCA 3IKGA 4IQ2A 4QT3A 1D6OA 3EY6A 2RQSA 1QPFA 3UI5A 3UQIA 5HKGA 2JMFA 3LUOA 3CGNA 1B6CA 2DG3A 3CGMA 4J4NA 3UI4A 2XP3A
chains in the Genus database with same CATH superfamily
1FAPA 2LGOA 4U86A 4DWSA 4Z2KA 2F23A 4J4OA 4DRKA 2JX8A 5E5WA 1FKTA 4PTMA 1BKFA 5U47A 5HWBA 5I98A 2M8JA 3KABA 3M85A 2QF8A 1HJXA 4AY1A 1ZBCA 2P4VA 2DWVA 1UR8A 4R0XA 1EIBA 2IF4A 3KACA 4MAVA 4DRNA 3ALFA 2D9FA 1LL4A 4W9QA 4TW7A 1J4IA 3PA7A 2E45A 3AQUA 3TDBA 2MF9A 4ODLA 3RM8A 3WQVA 3QOKA 1FKLA 3LE4A 1FD9A 5DO2A 2ZR5A 4A0TA 1QPLA 2ZQUA 2ZR4A 3AS0A 4L3NA 1JNSA 4GIVA 2ETNA 5HW6A 4ITZA 1ITXA 2A3CA 2OFNA 2Y78A 4DT4A 1ROUA 1OGBA 4MGVA 4DWSC 1W1TA 3NRKA 4MNLA 1H0GA 3CH9A 1GPFA 1RP5A 4P8VA 2A3AA 4Z2LA 4DH0A 3ARXA 3O5DA 3VAWA 4URIA 4ZS6A 2IUZA 1NMVA 3PRBA 3ARWA 4MNMA 1EG4A 2DMVA 2XP6A 2KO7A 5DEZA 3KAIA 1W1YA 4LAWA 3KAGA 2WAEA 3O5KA 5J6EA 2YAJB 1Q6IA 2YBUA 1RD6A 1FKFA 3KAFA 1NWRA 3KZ7A 3ARVA 1J6YA 1P5QA 1OGGA 1T11A 1FLCA 3KADA 2G41A 4Z2HA 5BXJA 2ITKA 3JYJA 3RM4A 1KT0A 1EDQA 2DT0A 2XP5A 2PPNA 1ZBVA 2MLYA 4IQ2A 4NNRA 3G6LA 4QT3A 1E6ZA 3GTYX 1TFVA 3CGMA 2YBTA 3RMEA 1TR8A 3RM9A 4ZPTR 1PBKA 2M2AA 1WR7A 2DG4A 2XP8A 1K9RA 3JYMA 2KI3A 2FAPA 4TNSA 1W1PA 3BMBA 4JFKA 2M1IA 2RUQA 1FKSA 4WKAA 4WKHA 1NH6A 3ARZA 1K9TA 1WMVA 3ARPA 1GRJA 2DSVA 1O6WA 1I5HW 2WLZA 2EULA 3O5LA 5HBFA 2O9OA 4KR0B 2LAJA 1E6PA 4QIBA 3B9EA 1ZU8A 3UQAA 1F8AB 2WADA 4A0UA 1FKKA 2N87A 4Z2JA 3LKXB 1HKKA 1E9LA 1W9VA 5HTGA 1PINA 2A3BA 4DRHA 4JFMA 1L1PA 4U85A 1HKIA 3B9AA 5DITA 2YSBA 1ROTA 3MDYB 3ARTA 3CHFA 3O5QA 1D7IA 1FKIA 1JNDA 4W5UA 3IKDA 2KE0A 5DIVA 3W4RA 1SYTA 1LL6A 1KFWA 3PRDA 5CQ2A 1LG1A 1M5YA 2ESCA 4ODPA 1FKDA 1FJDA 2B5UB 4DRIA 1EQ3A 1F40A 1EG3A 4LAYA 1LL7A 3JXVA 3MQGA 3FSCA 3UI6A 3BXWA 2PPPA 3PR9A 4S3KA 3WD2A 2MNTA 4JFJA 3FAPA 4DRJA 4DIPA 2A3EA 1O6IA 1YATA 5JH8A 1ZL1A 4TYOA 5E66A 1UR9A 4MNKA 3B9DA 3O5FA 3O5EA 2Y8NB 4NZCA 4S3JA 2RE3A 2DPEA 1E6RA 5GPGA 4IQCA 4DWSD 1FKBA 2F2DA 4BF8A 4E5RA 2PN0A 2EZ5W 1U79A 4IT4A 3KAHA 3MCBA 3CHCA 1QPFA 3WIJA 3LUOA 4P8XA 4WIWA 1NWSA 3CGNA 2DG3A 3OA5A 4W9OA 2XP3A 1XRVA 4ZPWR 3AS2A 4ODOA 4W9PA 1JCHB 3LKXA 4KQZA 1JNTA 4IT6A 4LGXA 1KT1A 1W26A 3GPKA 4IPXA 3WL1A 2WK2A 2PV3A 3CHEA 3B8SA 3AROA 2K8IA 5HW7A 3UQBA 2MLZA 2MPHA 1VF8A 4G50A 3WL0A 2ZQTA 3ARUA 3GU0A 4DRQA 3O5GA 3ODKA 1ZK6A 4Z2IA 3AS1A 4LAXA 1NSGA 2VN1A 1QZ2A 5HUAA 2Q5AA 1OWQA 2OLHA 3TCZA 4JFLA 3UF8A 2JV4A 4ODNA 3OOBA 1J4HA 1BL4A 3I6CA 3NTPA 3ARSA 2BA1A 3MCBB 5HWCA 2PBCA 4GLXA 2MDIA 3IHZA 1X6NA 1W1VA 3ALGA 3CZ8A 3KCEA 2OWOA 4DZ2A 3RGCA 1FKRA 3O5IA 2DT3A 4NSBA 4C02B 4DRMA 1H0IA 5B8IC 2LJ4A 4MSPA 1ZBKA 2AWGA 1D7HA 2FDMA 3AS3A 4QZVB 4GGQA 2LPVA 1SR0A 4HBEA 1W9UA 5AHTA 4TW8A 1ZB5A 4JYSA 1TK7A 4HARA 2ZQVA 2L2SA 2YSGA 5HW8A 3WKZA 2DK1A 3O5OA 2O92A 1XHGA 4DZ3A 1WAWA 2B31A 4R5EA 1GOIA 2XPAA 4MPKA 1Q6UA 1WB0A 2WLYA 5E65A 3PRAA 4MNJA 4P8WA 1LJYA 1Q6HA 1JMQA 1FKHA 5GPRA 2FKEA 1D7JA 2PPOA 1JNEA 3M7NA 1FFRA 3WQWA 1E44A 2UZ5A 3TC5A 1D2KA 2MLXA 3IKGA 1D6OA 3EY6A 3UI5A 1E15A 5HKGA 1NWUA 4WKFA 1B6CA 5DF0A 1WNOA 4FN2A 4ZPVR 2ZQSA 2DT2A 4DRPA 1IX5A 1HKMA 5DIUA 4LAVA 2KR7A 3CNGA 1NMWA 1ZBWA 3IK8A 5E62A 2DSUA 1N1AA 1FKGA 4TW6A 5E64A 1NWTA 3FY1A 1A7XA 1R9HA 1FFQA 4ODKA 3NI6A 2VCDA 3WH0A 4Q7NA 2ZAJA 4ODRA 3WD0A 4MTVA 3ARYA 5D75A 4ODQA 2ZR6A 2KXQA 2F4EA 5GQBA 4N19A 1FKJA 3MQHA 4U84A 2DT1A 1LQ0A 3G6MA 2M3OW 1J4RA 1TCOC 2DSZA 1YW5A 1HXVA 1HJWA 1LG2A 1Q1CA 3RFWA 2DG9A 3O5PA 2PI6A 4DROA 1ZCNA 2JXWA 1E6NA 1X6LA 3O5MA 3EIPA 3H9RB 2QRVA 4G2PA 2KGJA 2YSHA 2DK7A 2AOSA 2JZVA 4Z2GA 2RURA 2YSIA 3WD4A 4QT2A 5HT1A 2XP7A 4FAPA 4DWSB 1EYMA 4P8UA 2M08A 1C9HA 4JFIA 2XPBA 4HBOA 4O2TA 3O5JA 3FS8A 2PV1A 2YSFA 2XP9A 4ODMA 2RUDA 2M8IA 2DJYA 1W9PA 3FSBA 2PV2A 3ARRA 1CTNA 1K9QA 2LKNA 2WM0A 4REXA 3WD1A 2F21A 1HJVA 1GUVA 2KFWA 4Q22A 2RSEA 3B7XA 2G8ZA 2XP4A 4XAKA 1Y0OA 2DSWA 1EHNA 2L4JA 1JVWA 4UDMA 3O5RA 3CHDA 3L4HA 2RUCA 3ARQA 4WK9A 1HKJA 2RQSA 3FXYA 4ML4A 3UQIA 2JMFA 3WD3A 4WJXA 4L72B 3PQHA 4TX0A 4J4NA 3UI4A
chains in the Genus database with same CATH topology
1FAPA 2LGOA 4U86A 4DWSA 4Z2KA 4J4OA 4DRKA 2JX8A 5E5WA 1FKTA 4PTMA 1BKFA 5U47A 5HWBA 5I98A 2M8JA 3KABA 3M85A 2QF8A 1HJXA 4AY1A 1ZBCA 2DWVA 1UR8A 4R0XA 1EIBA 2IF4A 3KACA 4MAVA 4DRNA 3ALFA 2D9FA 1LL4A 4W9QA 4TW7A 1J4IA 3PA7A 2E45A 3AQUA 3TDBA 2MF9A 4ODLA 3RM8A 3WQVA 3QOKA 1FKLA 3LE4A 1FD9A 5DO2A 2ZR5A 4A0TA 1QPLA 2ZQUA 2ZR4A 3AS0A 4L3NA 1JNSA 4GIVA 5HW6A 4ITZA 1ITXA 2A3CA 2OFNA 2Y78A 4DT4A 1ROUA 1OGBA 4MGVA 4DWSC 1W1TA 3NRKA 4MNLA 1H0GA 3CH9A 1GPFA 1RP5A 4P8VA 2A3AA 4Z2LA 4DH0A 3ARXA 3O5DA 3VAWA 4URIA 4ZS6A 2IUZA 1NMVA 3PRBA 3ARWA 4MNMA 1EG4A 2DMVA 2XP6A 2KO7A 5DEZA 3KAIA 1W1YA 4LAWA 3KAGA 2WAEA 3O5KA 5J6EA 2YAJB 1Q6IA 2YBUA 1RD6A 1FKFA 3KAFA 1NWRA 3KZ7A 3ARVA 1J6YA 1P5QA 1OGGA 1T11A 1FLCA 3KADA 2G41A 4Z2HA 5BXJA 2ITKA 3JYJA 3RM4A 1KT0A 1EDQA 2DT0A 2XP5A 2PPNA 1ZBVA 2MLYA 4IQ2A 4NNRA 3G6LA 4QT3A 1E6ZA 1TFVA 3CGMA 2YBTA 3RMEA 1TR8A 3RM9A 4ZPTR 1PBKA 2M2AA 1WR7A 2DG4A 2XP8A 1K9RA 3JYMA 2KI3A 2FAPA 4TNSA 1W1PA 4JFKA 2M1IA 2RUQA 1FKSA 4WKAA 4WKHA 1NH6A 3ARZA 1K9TA 1WMVA 3ARPA 2DSVA 1O6WA 1I5HW 2WLZA 3O5LA 5HBFA 2O9OA 4KR0B 2LAJA 1E6PA 4QIBA 3B9EA 1ZU8A 3UQAA 1F8AB 2WADA 4A0UA 1FKKA 2N87A 4Z2JA 3LKXB 1HKKA 1E9LA 1W9VA 5HTGA 1PINA 2A3BA 4DRHA 4JFMA 1L1PA 4U85A 1HKIA 3B9AA 5DITA 2YSBA 1ROTA 3MDYB 3ARTA 3CHFA 3O5QA 1D7IA 1FKIA 1JNDA 4W5UA 3IKDA 2KE0A 5DIVA 3W4RA 1SYTA 1LL6A 1KFWA 3PRDA 5CQ2A 1LG1A 1M5YA 2ESCA 4ODPA 1FKDA 1FJDA 4DRIA 1EQ3A 1F40A 1EG3A 4LAYA 1LL7A 3JXVA 3MQGA 3FSCA 3UI6A 3BXWA 2PPPA 3PR9A 4S3KA 3WD2A 2MNTA 4JFJA 3FAPA 4DRJA 4DIPA 2A3EA 1O6IA 1YATA 5JH8A 1ZL1A 4TYOA 5E66A 1UR9A 4MNKA 3B9DA 3O5FA 3O5EA 2Y8NB 4NZCA 4S3JA 2RE3A 2DPEA 1E6RA 5GPGA 4IQCA 4DWSD 1FKBA 2F2DA 4BF8A 4E5RA 2EZ5W 1U79A 4IT4A 3KAHA 3MCBA 3CHCA 1QPFA 3WIJA 3LUOA 4P8XA 4WIWA 1NWSA 3CGNA 2DG3A 3OA5A 4W9OA 2XP3A 1XRVA 4ZPWR 3AS2A 4ODOA 4W9PA 3LKXA 4KQZA 1JNTA 4IT6A 4LGXA 1KT1A 1W26A 3GPKA 4IPXA 3WL1A 2WK2A 2PV3A 3CHEA 3B8SA 3AROA 2K8IA 5HW7A 3UQBA 2MLZA 2MPHA 1VF8A 4G50A 3WL0A 2ZQTA 3ARUA 4DRQA 3O5GA 3ODKA 1ZK6A 4Z2IA 3AS1A 4LAXA 1NSGA 2VN1A 1QZ2A 5HUAA 2Q5AA 1OWQA 2OLHA 3TCZA 4JFLA 3UF8A 2JV4A 4ODNA 3OOBA 1J4HA 1BL4A 3I6CA 3NTPA 3ARSA 2BA1A 3MCBB 5HWCA 2PBCA 4GLXA 2MDIA 3IHZA 1X6NA 1W1VA 3ALGA 3CZ8A 3KCEA 2OWOA 4DZ2A 3RGCA 1FKRA 3O5IA 2DT3A 4NSBA 4C02B 4DRMA 1H0IA 5B8IC 2LJ4A 4MSPA 1ZBKA 2AWGA 1D7HA 2FDMA 3AS3A 4QZVB 4GGQA 2LPVA 1SR0A 4HBEA 1W9UA 5AHTA 4TW8A 1ZB5A 4JYSA 1TK7A 4HARA 2ZQVA 2L2SA 2YSGA 5HW8A 3WKZA 2DK1A 3O5OA 2O92A 1XHGA 4DZ3A 1WAWA 2B31A 4R5EA 1GOIA 2XPAA 4MPKA 1Q6UA 1WB0A 2WLYA 5E65A 3PRAA 4MNJA 4P8WA 1LJYA 1Q6HA 1JMQA 1FKHA 5GPRA 2FKEA 1D7JA 2PPOA 1JNEA 3M7NA 1FFRA 3WQWA 2UZ5A 3TC5A 1D2KA 2MLXA 3IKGA 1D6OA 3EY6A 3UI5A 1E15A 5HKGA 1NWUA 4WKFA 1B6CA 5DF0A 1WNOA 4FN2A 4ZPVR 2ZQSA 2DT2A 4DRPA 1IX5A 1HKMA 5DIUA 4LAVA 2KR7A 3CNGA 1NMWA 1ZBWA 3IK8A 5E62A 2DSUA 1N1AA 1FKGA 4TW6A 5E64A 1NWTA 3FY1A 1A7XA 1R9HA 1FFQA 4ODKA 3NI6A 2VCDA 3WH0A 4Q7NA 2ZAJA 4ODRA 3WD0A 4MTVA 3ARYA 5D75A 4ODQA 2ZR6A 2KXQA 2F4EA 5GQBA 4N19A 1FKJA 3MQHA 4U84A 2DT1A 1LQ0A 3G6MA 2M3OW 1J4RA 1TCOC 2DSZA 1YW5A 1HXVA 1HJWA 1LG2A 1Q1CA 3RFWA 2DG9A 3O5PA 2PI6A 4DROA 1ZCNA 2JXWA 1E6NA 1X6LA 3O5MA 3H9RB 2QRVA 4G2PA 2KGJA 2YSHA 2DK7A 2AOSA 2JZVA 4Z2GA 2RURA 2YSIA 3WD4A 4QT2A 5HT1A 2XP7A 4FAPA 4DWSB 1EYMA 4P8UA 2M08A 1C9HA 4JFIA 2XPBA 4HBOA 4O2TA 3O5JA 3FS8A 2PV1A 2YSFA 2XP9A 4ODMA 2RUDA 2M8IA 2DJYA 1W9PA 3FSBA 2PV2A 3ARRA 1CTNA 1K9QA 2LKNA 2WM0A 4REXA 3WD1A 2F21A 1HJVA 1GUVA 2KFWA 4Q22A 2RSEA 3B7XA 2G8ZA 2XP4A 4XAKA 1Y0OA 2DSWA 1EHNA 2L4JA 1JVWA 3O5RA 3CHDA 3L4HA 2RUCA 3ARQA 4WK9A 1HKJA 2RQSA 3FXYA 4ML4A 3UQIA 2JMFA 3WD3A 4WJXA 4L72B 3PQHA 4TX0A 4J4NA 3UI4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FN2 A;  1FAP A;  4ODO A;  1PBK A;  2M2A A;  1WR7 A;  4W9P A;  2LGO A;  2ZQS A;  4U86 A;  2DG4 A;  4DRP A;  1JNT A;  1KT1 A;  2XP8 A;  4J4O A;  2JX8 A;  4LAV A;  1W26 A;  1FKT A;  3GPK A;  4IPX A;  5DIU A;  4DRJ A;  4DRK A;  1K9R A;  2KR7 A;  3CNG A;  1NMW A;  2KI3 A;  3IK8 A;  2FAP A;  1BKF A;  3JYM A;  2PV3 A;  4TNS A;  5HWB A;  1N1A A;  5I98 A;  1FKG A;  4JFK A;  2M8J A;  3KAB A;  2K8I A;  4TW6 A;  2M1I A;  2MLZ A;  5HW7 A;  2RUQ A;  3UQB A;  2MPH A;  1FKS A;  4G50 A;  1A7X A;  2ZQT A;  3M85 A;  4DRQ A;  1R9H A;  3ODK A;  3O5G A;  1WMV A;  1ZK6 A;  4ODK A;  2DWV A;  1O6W A;  3NI6 A;  1I5H W;  2VCD A;  3O5L A;  3WH0 A;  4R0X A;  2ZAJ A;  2IF4 A;  3KAC A;  4LAX A;  4ODR A;  4DRN A;  1NSG A;  2LAJ A;  2VN1 A;  2D9F A;  1JNS A;  5D75 A;  4ODQ A;  1QZ2 A;  4QIB A;  3UQA A;  2ZR6 A;  2KXQ A;  2F4E A;  4W9Q A;  2Q5A A;  4TW7 A;  5HUA A;  1J4I A;  1F8A B;  2E45 A;  3PA7 A;  3TDB A;  1FKK A;  2MF9 A;  3TCZ A;  2N87 A;  4JFL A;  1FKJ A;  4U84 A;  4N19 A;  4ODL A;  3UF8 A;  2JV4 A;  4ODN A;  3OOB A;  1FKL A;  3LE4 A;  5HTG A;  1J4H A;  1PIN A;  2M3O W;  1FD9 A;  1BL4 A;  1J4R A;  1TCO C;  3I6C A;  2ZR5 A;  4JFM A;  4W9O A;  4DRH A;  1L1P A;  3NTP A;  4U85 A;  1YW5 A;  1HXV A;  1QPL A;  2ZQU A;  2BA1 A;  1Q1C A;  3RFW A;  2ZR4 A;  2DG9 A;  3O5P A;  5DIT A;  4DRO A;  2YSB A;  1ZCN A;  2JXW A;  1ROT A;  3MDY B;  4GIV A;  5HWC A;  2PBC A;  3IHZ A;  2MDI A;  3O5M A;  3H9R B;  5HW6 A;  4G2P A;  4NNR A;  2YSH A;  2DK7 A;  2JZV A;  1D7I A;  1FKI A;  2KGJ A;  3O5Q A;  3IKD A;  2KE0 A;  4ITZ A;  5DIV A;  2RUR A;  3KCE A;  2YSI A;  2OFN A;  2Y78 A;  4DT4 A;  4DZ2 A;  3RGC A;  3PRD A;  1FKR A;  5CQ2 A;  1ROU A;  3O5I A;  4QT2 A;  4MGV A;  1M5Y A;  2XP7 A;  5HT1 A;  3NRK A;  4FAP A;  4ODP A;  1FKD A;  4C02 B;  1FJD A;  4DRM A;  1EYM A;  4DRI A;  5B8I C;  2LJ4 A;  2M08 A;  4MSP A;  1EQ3 A;  2AWG A;  1D7H A;  1EG3 A;  1C9H A;  4JFI A;  4LAY A;  3JXV A;  1F40 A;  2XPB A;  4GGQ A;  2LPV A;  3O5D A;  4DH0 A;  3VAW A;  3UI6 A;  4O2T A;  3O5J A;  5AHT A;  4TW8 A;  2PV1 A;  2PPP A;  4JYS A;  1TK7 A;  2YSF A;  2XP9 A;  2ZQV A;  2L2S A;  2MNT A;  2RUD A;  3FAP A;  4JFJ A;  1NMV A;  2YSG A;  3PRB A;  2M8I A;  4ODM A;  4DIP A;  2DJY A;  5HW8 A;  2PV2 A;  1EG4 A;  2DMV A;  2XP6 A;  1K9Q A;  1YAT A;  2KO7 A;  4REX A;  2LKN A;  4TYO A;  2DK1 A;  3O5O A;  2F21 A;  2KFW A;  4DZ3 A;  3KAI A;  3O5F A;  4LAW A;  3KAG A;  3O5E A;  3O5K A;  5J6E A;  2RSE A;  3B7X A;  2XPA A;  1Q6I A;  4TX0 A;  1Q6U A;  1FKF A;  2XP4 A;  3KAF A;  2RE3 A;  3KZ7 A;  1Y0O A;  5GPG A;  4IQC A;  1J6Y A;  1P5Q A;  1T11 A;  2L4J A;  1FKB A;  1JVW A;  1Q6H A;  2F2D A;  1JMQ A;  3KAD A;  1FKH A;  5BXJ A;  2ITK A;  3JYJ A;  1KT0 A;  2FKE A;  4BF8 A;  1D7J A;  2XP5 A;  2PPO A;  3O5R A;  3M7N A;  2PPN A;  4E5R A;  2EZ5 W;  1U79 A;  2MLY A;  2UZ5 A;  3L4H A;  3TC5 A;  3KAH A;  2MLX A;  2RUC A;  3IKG A;  4IQ2 A;  4QT3 A;  1D6O A;  3EY6 A;  2RQS A;  1QPF A;  3UI5 A;  3UQI A;  5HKG A;  2JMF A;  3LUO A;  3CGN A;  1B6C A;  2DG3 A;  3CGM A;  4J4N A;  3UI4 A;  2XP3 A; 
#chains in the Genus database with same CATH topology
 1FAP A;  2LGO A;  4U86 A;  4DWS A;  4Z2K A;  2F23 A;  4J4O A;  4DRK A;  2JX8 A;  5E5W A;  1FKT A;  4PTM A;  1BKF A;  5U47 A;  5HWB A;  5I98 A;  2M8J A;  3KAB A;  3M85 A;  2QF8 A;  1HJX A;  4AY1 A;  1ZBC A;  2P4V A;  2DWV A;  1UR8 A;  4R0X A;  1EIB A;  2IF4 A;  3KAC A;  4MAV A;  4DRN A;  3ALF A;  2D9F A;  1LL4 A;  4W9Q A;  4TW7 A;  1J4I A;  3PA7 A;  2E45 A;  3AQU A;  3TDB A;  2MF9 A;  4ODL A;  3RM8 A;  3WQV A;  3QOK A;  1FKL A;  3LE4 A;  1FD9 A;  5DO2 A;  2ZR5 A;  4A0T A;  1QPL A;  2ZQU A;  2ZR4 A;  3AS0 A;  4L3N A;  1JNS A;  4GIV A;  2ETN A;  5HW6 A;  4ITZ A;  1ITX A;  2A3C A;  2OFN A;  2Y78 A;  4DT4 A;  1ROU A;  1OGB A;  4MGV A;  4DWS C;  1W1T A;  3NRK A;  4MNL A;  1H0G A;  3CH9 A;  1GPF A;  1RP5 A;  4P8V A;  2A3A A;  4Z2L A;  4DH0 A;  3ARX A;  3O5D A;  3VAW A;  4URI A;  4ZS6 A;  2IUZ A;  1NMV A;  3PRB A;  3ARW A;  4MNM A;  1EG4 A;  2DMV A;  2XP6 A;  2KO7 A;  5DEZ A;  3KAI A;  1W1Y A;  4LAW A;  3KAG A;  2WAE A;  3O5K A;  5J6E A;  2YAJ B;  1Q6I A;  2YBU A;  1RD6 A;  1FKF A;  3KAF A;  1NWR A;  3KZ7 A;  3ARV A;  1J6Y A;  1P5Q A;  1OGG A;  1T11 A;  1FLC A;  3KAD A;  2G41 A;  4Z2H A;  5BXJ A;  2ITK A;  3JYJ A;  3RM4 A;  1KT0 A;  1EDQ A;  2DT0 A;  2XP5 A;  2PPN A;  1ZBV A;  2MLY A;  4IQ2 A;  4NNR A;  3G6L A;  4QT3 A;  1E6Z A;  3GTY X;  1TFV A;  3CGM A;  2YBT A;  3RME A;  1TR8 A;  3RM9 A;  4ZPT R;  1PBK A;  2M2A A;  1WR7 A;  2DG4 A;  2XP8 A;  1K9R A;  3JYM A;  2KI3 A;  2FAP A;  4TNS A;  1W1P A;  3BMB A;  4JFK A;  2M1I A;  2RUQ A;  1FKS A;  4WKA A;  4WKH A;  1NH6 A;  3ARZ A;  1K9T A;  1WMV A;  3ARP A;  1GRJ A;  2DSV A;  1O6W A;  1I5H W;  2WLZ A;  2EUL A;  3O5L A;  5HBF A;  2O9O A;  4KR0 B;  2LAJ A;  1E6P A;  4QIB A;  3B9E A;  1ZU8 A;  3UQA A;  1F8A B;  2WAD A;  4A0U A;  1FKK A;  2N87 A;  4Z2J A;  3LKX B;  1HKK A;  1E9L A;  1W9V A;  5HTG A;  1PIN A;  2A3B A;  4DRH A;  4JFM A;  1L1P A;  4U85 A;  1HKI A;  3B9A A;  5DIT A;  2YSB A;  1ROT A;  3MDY B;  3ART A;  3CHF A;  3O5Q A;  1D7I A;  1FKI A;  1JND A;  4W5U A;  3IKD A;  2KE0 A;  5DIV A;  3W4R A;  1SYT A;  1LL6 A;  1KFW A;  3PRD A;  5CQ2 A;  1LG1 A;  1M5Y A;  2ESC A;  4ODP A;  1FKD A;  1FJD A;  2B5U B;  4DRI A;  1EQ3 A;  1F40 A;  1EG3 A;  4LAY A;  1LL7 A;  3JXV A;  3MQG A;  3FSC A;  3UI6 A;  3BXW A;  2PPP A;  3PR9 A;  4S3K A;  3WD2 A;  2MNT A;  4JFJ A;  3FAP A;  4DRJ A;  4DIP A;  2A3E A;  1O6I A;  1YAT A;  5JH8 A;  1ZL1 A;  4TYO A;  5E66 A;  1UR9 A;  4MNK A;  3B9D A;  3O5F A;  3O5E A;  2Y8N B;  4NZC A;  4S3J A;  2RE3 A;  2DPE A;  1E6R A;  5GPG A;  4IQC A;  4DWS D;  1FKB A;  2F2D A;  4BF8 A;  4E5R A;  2PN0 A;  2EZ5 W;  1U79 A;  4IT4 A;  3KAH A;  3MCB A;  3CHC A;  1QPF A;  3WIJ A;  3LUO A;  4P8X A;  4WIW A;  1NWS A;  3CGN A;  2DG3 A;  3OA5 A;  4W9O A;  2XP3 A;  1XRV A;  4ZPW R;  3AS2 A;  4ODO A;  4W9P A;  1JCH B;  3LKX A;  4KQZ A;  1JNT A;  4IT6 A;  4LGX A;  1KT1 A;  1W26 A;  3GPK A;  4IPX A;  3WL1 A;  2WK2 A;  2PV3 A;  3CHE A;  3B8S A;  3ARO A;  2K8I A;  5HW7 A;  3UQB A;  2MLZ A;  2MPH A;  1VF8 A;  4G50 A;  3WL0 A;  2ZQT A;  3ARU A;  3GU0 A;  4DRQ A;  3O5G A;  3ODK A;  1ZK6 A;  4Z2I A;  3AS1 A;  4LAX A;  1NSG A;  2VN1 A;  1QZ2 A;  5HUA A;  2Q5A A;  1OWQ A;  2OLH A;  3TCZ A;  4JFL A;  3UF8 A;  2JV4 A;  4ODN A;  3OOB A;  1J4H A;  1BL4 A;  3I6C A;  3NTP A;  3ARS A;  2BA1 A;  3MCB B;  5HWC A;  2PBC A;  4GLX A;  2MDI A;  3IHZ A;  1X6N A;  1W1V A;  3ALG A;  3CZ8 A;  3KCE A;  2OWO A;  4DZ2 A;  3RGC A;  1FKR A;  3O5I A;  2DT3 A;  4NSB A;  4C02 B;  4DRM A;  1H0I A;  5B8I C;  2LJ4 A;  4MSP A;  1ZBK A;  2AWG A;  1D7H A;  2FDM A;  3AS3 A;  4QZV B;  4GGQ A;  2LPV A;  1SR0 A;  4HBE A;  1W9U A;  5AHT A;  4TW8 A;  1ZB5 A;  4JYS A;  1TK7 A;  4HAR A;  2ZQV A;  2L2S A;  2YSG A;  5HW8 A;  3WKZ A;  2DK1 A;  3O5O A;  2O92 A;  1XHG A;  4DZ3 A;  1WAW A;  2B31 A;  4R5E A;  1GOI A;  2XPA A;  4MPK A;  1Q6U A;  1WB0 A;  2WLY A;  5E65 A;  3PRA A;  4MNJ A;  4P8W A;  1LJY A;  1Q6H A;  1JMQ A;  1FKH A;  5GPR A;  2FKE A;  1D7J A;  2PPO A;  1JNE A;  3M7N A;  1FFR A;  3WQW A;  1E44 A;  2UZ5 A;  3TC5 A;  1D2K A;  2MLX A;  3IKG A;  1D6O A;  3EY6 A;  3UI5 A;  1E15 A;  5HKG A;  1NWU A;  4WKF A;  1B6C A;  5DF0 A;  1WNO A;  4FN2 A;  4ZPV R;  2ZQS A;  2DT2 A;  4DRP A;  1IX5 A;  1HKM A;  5DIU A;  4LAV A;  2KR7 A;  3CNG A;  1NMW A;  1ZBW A;  3IK8 A;  5E62 A;  2DSU A;  1N1A A;  1FKG A;  4TW6 A;  5E64 A;  1NWT A;  3FY1 A;  1A7X A;  1R9H A;  1FFQ A;  4ODK A;  3NI6 A;  2VCD A;  3WH0 A;  4Q7N A;  2ZAJ A;  4ODR A;  3WD0 A;  4MTV A;  3ARY A;  5D75 A;  4ODQ A;  2ZR6 A;  2KXQ A;  2F4E A;  5GQB A;  4N19 A;  1FKJ A;  3MQH A;  4U84 A;  2DT1 A;  1LQ0 A;  3G6M A;  2M3O W;  1J4R A;  1TCO C;  2DSZ A;  1YW5 A;  1HXV A;  1HJW A;  1LG2 A;  1Q1C A;  3RFW A;  2DG9 A;  3O5P A;  2PI6 A;  4DRO A;  1ZCN A;  2JXW A;  1E6N A;  1X6L A;  3O5M A;  3EIP A;  3H9R B;  2QRV A;  4G2P A;  2KGJ A;  2YSH A;  2DK7 A;  2AOS A;  2JZV A;  4Z2G A;  2RUR A;  2YSI A;  3WD4 A;  4QT2 A;  5HT1 A;  2XP7 A;  4FAP A;  4DWS B;  1EYM A;  4P8U A;  2M08 A;  1C9H A;  4JFI A;  2XPB A;  4HBO A;  4O2T A;  3O5J A;  3FS8 A;  2PV1 A;  2YSF A;  2XP9 A;  4ODM A;  2RUD A;  2M8I A;  2DJY A;  1W9P A;  3FSB A;  2PV2 A;  3ARR A;  1CTN A;  1K9Q A;  2LKN A;  2WM0 A;  4REX A;  3WD1 A;  2F21 A;  1HJV A;  1GUV A;  2KFW A;  4Q22 A;  2RSE A;  3B7X A;  2G8Z A;  2XP4 A;  4XAK A;  1Y0O A;  2DSW A;  1EHN A;  2L4J A;  1JVW A;  4UDM A;  3O5R A;  3CHD A;  3L4H A;  2RUC A;  3ARQ A;  4WK9 A;  1HKJ A;  2RQS A;  3FXY A;  4ML4 A;  3UQI A;  2JMF A;  3WD3 A;  4WJX A;  4L72 B;  3PQH A;  4TX0 A;  4J4N A;  3UI4 A; 
#chains in the Genus database with same CATH homology
 1FAP A;  2LGO A;  4U86 A;  4DWS A;  4Z2K A;  4J4O A;  4DRK A;  2JX8 A;  5E5W A;  1FKT A;  4PTM A;  1BKF A;  5U47 A;  5HWB A;  5I98 A;  2M8J A;  3KAB A;  3M85 A;  2QF8 A;  1HJX A;  4AY1 A;  1ZBC A;  2DWV A;  1UR8 A;  4R0X A;  1EIB A;  2IF4 A;  3KAC A;  4MAV A;  4DRN A;  3ALF A;  2D9F A;  1LL4 A;  4W9Q A;  4TW7 A;  1J4I A;  3PA7 A;  2E45 A;  3AQU A;  3TDB A;  2MF9 A;  4ODL A;  3RM8 A;  3WQV A;  3QOK A;  1FKL A;  3LE4 A;  1FD9 A;  5DO2 A;  2ZR5 A;  4A0T A;  1QPL A;  2ZQU A;  2ZR4 A;  3AS0 A;  4L3N A;  1JNS A;  4GIV A;  5HW6 A;  4ITZ A;  1ITX A;  2A3C A;  2OFN A;  2Y78 A;  4DT4 A;  1ROU A;  1OGB A;  4MGV A;  4DWS C;  1W1T A;  3NRK A;  4MNL A;  1H0G A;  3CH9 A;  1GPF A;  1RP5 A;  4P8V A;  2A3A A;  4Z2L A;  4DH0 A;  3ARX A;  3O5D A;  3VAW A;  4URI A;  4ZS6 A;  2IUZ A;  1NMV A;  3PRB A;  3ARW A;  4MNM A;  1EG4 A;  2DMV A;  2XP6 A;  2KO7 A;  5DEZ A;  3KAI A;  1W1Y A;  4LAW A;  3KAG A;  2WAE A;  3O5K A;  5J6E A;  2YAJ B;  1Q6I A;  2YBU A;  1RD6 A;  1FKF A;  3KAF A;  1NWR A;  3KZ7 A;  3ARV A;  1J6Y A;  1P5Q A;  1OGG A;  1T11 A;  1FLC A;  3KAD A;  2G41 A;  4Z2H A;  5BXJ A;  2ITK A;  3JYJ A;  3RM4 A;  1KT0 A;  1EDQ A;  2DT0 A;  2XP5 A;  2PPN A;  1ZBV A;  2MLY A;  4IQ2 A;  4NNR A;  3G6L A;  4QT3 A;  1E6Z A;  1TFV A;  3CGM A;  2YBT A;  3RME A;  1TR8 A;  3RM9 A;  4ZPT R;  1PBK A;  2M2A A;  1WR7 A;  2DG4 A;  2XP8 A;  1K9R A;  3JYM A;  2KI3 A;  2FAP A;  4TNS A;  1W1P A;  4JFK A;  2M1I A;  2RUQ A;  1FKS A;  4WKA A;  4WKH A;  1NH6 A;  3ARZ A;  1K9T A;  1WMV A;  3ARP A;  2DSV A;  1O6W A;  1I5H W;  2WLZ A;  3O5L A;  5HBF A;  2O9O A;  4KR0 B;  2LAJ A;  1E6P A;  4QIB A;  3B9E A;  1ZU8 A;  3UQA A;  1F8A B;  2WAD A;  4A0U A;  1FKK A;  2N87 A;  4Z2J A;  3LKX B;  1HKK A;  1E9L A;  1W9V A;  5HTG A;  1PIN A;  2A3B A;  4DRH A;  4JFM A;  1L1P A;  4U85 A;  1HKI A;  3B9A A;  5DIT A;  2YSB A;  1ROT A;  3MDY B;  3ART A;  3CHF A;  3O5Q A;  1D7I A;  1FKI A;  1JND A;  4W5U A;  3IKD A;  2KE0 A;  5DIV A;  3W4R A;  1SYT A;  1LL6 A;  1KFW A;  3PRD A;  5CQ2 A;  1LG1 A;  1M5Y A;  2ESC A;  4ODP A;  1FKD A;  1FJD A;  4DRI A;  1EQ3 A;  1F40 A;  1EG3 A;  4LAY A;  1LL7 A;  3JXV A;  3MQG A;  3FSC A;  3UI6 A;  3BXW A;  2PPP A;  3PR9 A;  4S3K A;  3WD2 A;  2MNT A;  4JFJ A;  3FAP A;  4DRJ A;  4DIP A;  2A3E A;  1O6I A;  1YAT A;  5JH8 A;  1ZL1 A;  4TYO A;  5E66 A;  1UR9 A;  4MNK A;  3B9D A;  3O5F A;  3O5E A;  2Y8N B;  4NZC A;  4S3J A;  2RE3 A;  2DPE A;  1E6R A;  5GPG A;  4IQC A;  4DWS D;  1FKB A;  2F2D A;  4BF8 A;  4E5R A;  2EZ5 W;  1U79 A;  4IT4 A;  3KAH A;  3MCB A;  3CHC A;  1QPF A;  3WIJ A;  3LUO A;  4P8X A;  4WIW A;  1NWS A;  3CGN A;  2DG3 A;  3OA5 A;  4W9O A;  2XP3 A;  1XRV A;  4ZPW R;  3AS2 A;  4ODO A;  4W9P A;  3LKX A;  4KQZ A;  1JNT A;  4IT6 A;  4LGX A;  1KT1 A;  1W26 A;  3GPK A;  4IPX A;  3WL1 A;  2WK2 A;  2PV3 A;  3CHE A;  3B8S A;  3ARO A;  2K8I A;  5HW7 A;  3UQB A;  2MLZ A;  2MPH A;  1VF8 A;  4G50 A;  3WL0 A;  2ZQT A;  3ARU A;  4DRQ A;  3O5G A;  3ODK A;  1ZK6 A;  4Z2I A;  3AS1 A;  4LAX A;  1NSG A;  2VN1 A;  1QZ2 A;  5HUA A;  2Q5A A;  1OWQ A;  2OLH A;  3TCZ A;  4JFL A;  3UF8 A;  2JV4 A;  4ODN A;  3OOB A;  1J4H A;  1BL4 A;  3I6C A;  3NTP A;  3ARS A;  2BA1 A;  3MCB B;  5HWC A;  2PBC A;  4GLX A;  2MDI A;  3IHZ A;  1X6N A;  1W1V A;  3ALG A;  3CZ8 A;  3KCE A;  2OWO A;  4DZ2 A;  3RGC A;  1FKR A;  3O5I A;  2DT3 A;  4NSB A;  4C02 B;  4DRM A;  1H0I A;  5B8I C;  2LJ4 A;  4MSP A;  1ZBK A;  2AWG A;  1D7H A;  2FDM A;  3AS3 A;  4QZV B;  4GGQ A;  2LPV A;  1SR0 A;  4HBE A;  1W9U A;  5AHT A;  4TW8 A;  1ZB5 A;  4JYS A;  1TK7 A;  4HAR A;  2ZQV A;  2L2S A;  2YSG A;  5HW8 A;  3WKZ A;  2DK1 A;  3O5O A;  2O92 A;  1XHG A;  4DZ3 A;  1WAW A;  2B31 A;  4R5E A;  1GOI A;  2XPA A;  4MPK A;  1Q6U A;  1WB0 A;  2WLY A;  5E65 A;  3PRA A;  4MNJ A;  4P8W A;  1LJY A;  1Q6H A;  1JMQ A;  1FKH A;  5GPR A;  2FKE A;  1D7J A;  2PPO A;  1JNE A;  3M7N A;  1FFR A;  3WQW A;  2UZ5 A;  3TC5 A;  1D2K A;  2MLX A;  3IKG A;  1D6O A;  3EY6 A;  3UI5 A;  1E15 A;  5HKG A;  1NWU A;  4WKF A;  1B6C A;  5DF0 A;  1WNO A;  4FN2 A;  4ZPV R;  2ZQS A;  2DT2 A;  4DRP A;  1IX5 A;  1HKM A;  5DIU A;  4LAV A;  2KR7 A;  3CNG A;  1NMW A;  1ZBW A;  3IK8 A;  5E62 A;  2DSU A;  1N1A A;  1FKG A;  4TW6 A;  5E64 A;  1NWT A;  3FY1 A;  1A7X A;  1R9H A;  1FFQ A;  4ODK A;  3NI6 A;  2VCD A;  3WH0 A;  4Q7N A;  2ZAJ A;  4ODR A;  3WD0 A;  4MTV A;  3ARY A;  5D75 A;  4ODQ A;  2ZR6 A;  2KXQ A;  2F4E A;  5GQB A;  4N19 A;  1FKJ A;  3MQH A;  4U84 A;  2DT1 A;  1LQ0 A;  3G6M A;  2M3O W;  1J4R A;  1TCO C;  2DSZ A;  1YW5 A;  1HXV A;  1HJW A;  1LG2 A;  1Q1C A;  3RFW A;  2DG9 A;  3O5P A;  2PI6 A;  4DRO A;  1ZCN A;  2JXW A;  1E6N A;  1X6L A;  3O5M A;  3H9R B;  2QRV A;  4G2P A;  2KGJ A;  2YSH A;  2DK7 A;  2AOS A;  2JZV A;  4Z2G A;  2RUR A;  2YSI A;  3WD4 A;  4QT2 A;  5HT1 A;  2XP7 A;  4FAP A;  4DWS B;  1EYM A;  4P8U A;  2M08 A;  1C9H A;  4JFI A;  2XPB A;  4HBO A;  4O2T A;  3O5J A;  3FS8 A;  2PV1 A;  2YSF A;  2XP9 A;  4ODM A;  2RUD A;  2M8I A;  2DJY A;  1W9P A;  3FSB A;  2PV2 A;  3ARR A;  1CTN A;  1K9Q A;  2LKN A;  2WM0 A;  4REX A;  3WD1 A;  2F21 A;  1HJV A;  1GUV A;  2KFW A;  4Q22 A;  2RSE A;  3B7X A;  2G8Z A;  2XP4 A;  4XAK A;  1Y0O A;  2DSW A;  1EHN A;  2L4J A;  1JVW A;  3O5R A;  3CHD A;  3L4H A;  2RUC A;  3ARQ A;  4WK9 A;  1HKJ A;  2RQS A;  3FXY A;  4ML4 A;  3UQI A;  2JMF A;  3WD3 A;  4WJX A;  4L72 B;  3PQH A;  4TX0 A;  4J4N A;  3UI4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...