2XPAA

Discovery of cell-active phenyl-imidazole pin1 inhibitors by structure-guided fragment evolution
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
157
structure length
146
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEPTIDYL-PROLYL CIS-TRANS ISOMERASE NIMA-INTERACTING 1
publication title Discovery of Cell-Active Phenyl-Imidazole Pin1 Inhibitors by Structure-Guided Fragment Evolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 47
structure length 146
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2xpaA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2xpaA02
2JMFA 3KCEA 4ITZA 2MLZA 2KXQA 2LAJA 1J4HA 3UI5A 4W9PA 2M8JA 3KAHA 1Q6IA 2ZQUA 3I6CA 3NRKA 3O5RA 3TC5A 3IHZA 4ODQA 2VCDA 4U86A 4DRNA 3MDYB 3KZ7A 2Y78A 2KGJA 4JFIA 4E5RA 5HWBA 2XP8A 4DRKA 2F21A 3UI4A 1ZK6A 1K9RA 1D6OA 1FKFA 1ROUA 4MSPA 2PV2A 1FKDA 4DIPA 1W26A 4GGQA 1QZ2A 5J6EA 1PINA 4QT2A 2ZR4A 3KAGA 4ODPA 4TX0A 1JVWA 2DWVA 4FAPA 2XP3A 5I98A 2RQSA 1FJDA 1FKLA 3ODKA 2PPNA 4DRPA 3NI6A 1HXVA 4JYSA 2PV1A 5B8IC 2M2AA 1EQ3A 4IQCA 5HWCA 1D7IA 2FKEA 3KACA 1N1AA 1KT1A 4GIVA 1I5HW 1D7JA 3O5MA 5HKGA 4R0XA 5BXJA 5HW7A 2RURA 2PPPA 1D7HA 1FKBA 4U85A 4C02B 3B7XA 3PRBA 3H9RB 2YSBA 4NNRA 2XPBA 2M8IA 3L4HA 3VAWA 3NTPA 3IK8A 4DRIA 2BA1A 3PA7A 1FAPA 1B6CA 2KE0A 4TNSA 4QIBA 2M3OW 3O5GA 2Q5AA 2DK1A 4LAXA 2JX8A 2L4JA 2RUCA 1BL4A 2K8IA 1TK7A 4TW6A 1J4RA 3TCZA 3O5QA 3O5FA 1ROTA 4DRJA 5DIUA 4ODNA 3UQBA 2ITKA 3LE4A 4JFJA 2ZR5A 2RSEA 3PRDA 2E45A 3KAIA 1YATA 4TW7A 1KT0A 2L2SA 4ODOA 3M7NA 1L1PA 1QPLA 4LAWA 1JMQA 4J4NA 2F4EA 1WR7A 1J4IA 4ODLA 2MPHA 2DK7A 2UZ5A 3IKDA 1JNTA 3UF8A 1FKHA 2OFNA 2RE3A 1FD9A 1F40A 3JYMA 2LPVA 1R9HA 1ZCNA 1Q1CA 2PPOA 4LAYA 1WMVA 3UQAA 2EZ5W 2XP4A 1Y0OA 1U79A 2VN1A 3FAPA 4N19A 2N87A 4DZ2A 4G50A 1JNSA 2XP6A 1Q6UA 3CNGA 2MDIA 2KI3A 2DG3A 2KR7A 4BF8A 4G2PA 3WH0A 3EY6A 1J6YA 1P5QA 1O6WA 1NSGA 4TW8A 4DRHA 4DRQA 4O2TA 2MNTA 3RFWA 5AHTA 4DZ3A 2KO7A 1F8AB 1TCOC 3O5KA 2FAPA 2IF4A 3UQIA 2F2DA 1Q6HA 4J4OA 3OOBA 3M85A 1EG4A 2DG4A 2MLXA 4ODKA 1A7XA 5HT1A 1M5YA 4U84A 4REXA 3KADA 2YSFA 5GPGA 4JFMA 3KAFA 3CGNA 4IPXA 3O5JA 1FKTA 4W9OA 2ZR6A 3KABA 2LJ4A 1FKRA 4LAVA 1BKFA 2PV3A 3LUOA 4DROA 5HW6A 1FKSA 1EYMA 2LGOA 2M08A 2M1IA 1K9QA 1FKKA 1FKJA 4IQ2A 3O5DA 4W9QA 2YSIA 3O5IA 4QT3A 4MGVA 2YSGA 2XP7A 2XPAA 2PBCA 3O5LA 4DT4A 2XP5A 3JXVA 2RUQA 2DJYA 4FN2A 5D75A 4JFKA 2ZAJA 1NMWA 2DMVA 2JXWA 3UI6A 3IKGA 1FKGA 2AWGA 2XP9A 5DIVA 2ZQVA 2LKNA 5CQ2A 2JV4A 5HTGA 2DG9A 1NMVA 3CGMA 4DH0A 2YSHA 4ODRA 2MF9A 2ZQSA 5DITA 5HUAA 2RUDA 1FKIA 4JFLA 2KFWA 4TYOA 3RGCA 2ZQTA 3O5EA 3O5OA 1PBKA 1C9HA 3TDBA 1EG3A 2JZVA 2MLYA 5HW8A 1T11A 3JYJA 1YW5A 1QPFA 2D9FA 4ODMA 4DRMA 3O5PA 3GPKA
chains in the Genus database with same CATH superfamily
2JMFA 3KCEA 4ITZA 2MLZA 4LGXA 2KXQA 3LKXB 2LAJA 2ESCA 2DSWA 1NWTA 5GPRA 1GUVA 1J4HA 2A3EA 3UI5A 1GOIA 4W9PA 2M8JA 3KAHA 1Q6IA 1RD6A 2ZQUA 3I6CA 1LG2A 3AS1A 3NRKA 4DWSD 3O5RA 3TC5A 4WJXA 3IHZA 4ODQA 1W1YA 2VCDA 4U86A 3WL0A 4Z2LA 3CH9A 4DRNA 3MDYB 3KZ7A 2Y78A 1GPFA 2KGJA 4JFIA 4E5RA 4Z2IA 4WIWA 5HWBA 1D2KA 2XP8A 1EHNA 3PRAA 2YAJB 2F21A 4DRKA 1ZBKA 3UI4A 3ALGA 2IUZA 1ZK6A 1LG1A 1K9RA 1UR9A 4P8WA 3MQHA 5E65A 1GRJA 1HKJA 1EIBA 5JH8A 1FFQA 1D6OA 1FKFA 3LKXA 1ROUA 4WK9A 1IX5A 2WADA 4MSPA 2PV2A 1FKDA 4DIPA 1W26A 4GGQA 2DT2A 1QZ2A 5J6EA 1PINA 3ARRA 1CTNA 4QT2A 2ZR4A 3WD1A 3KAGA 2DPEA 4ML4A 4MPKA 4ODPA 4DWSC 5E64A 3FY1A 1OGGA 4TX0A 3ARUA 1JVWA 2DWVA 3ARWA 4FAPA 2XP3A 1NWUA 5I98A 2RQSA 1FJDA 3PQHA 4P8UA 1FKLA 3ODKA 1NWRA 4Z2GA 2PPNA 4WKAA 4ZPVR 2Y8NB 1WAWA 4DRPA 3NI6A 1OWQA 1HXVA 3ARVA 4Q7NA 3W4RA 4WKHA 1RP5A 5DEZA 4JYSA 1WB0A 2PV1A 5B8IC 2M2AA 1EQ3A 4UDMA 4IQCA 5HWCA 4XAKA 2PN0A 2F23A 3ARYA 2P4VA 3CHEA 1D7IA 2FKEA 1E6PA 1W1VA 3KACA 4MNLA 1N1AA 1KT1A 4GIVA 1I5HW 1D7JA 3AS2A 3O5MA 5HKGA 3GTYX 3G6LA 5HBFA 5DF0A 4R0XA 5BXJA 4L3NA 4KR0B 5HW7A 2RURA 2PPPA 1D7HA 1FKBA 4MAVA 4U85A 4C02B 3GU0A 1ITXA 3B7XA 3B9DA 3PRBA 2YBUA 3H9RB 2YSBA 4NNRA 4Z2KA 2XPBA 2AOSA 3B9EA 3RM4A 2M8IA 3L4HA 3VAWA 1E44A 3NTPA 1JNDA 1LQ0A 3IK8A 4DRIA 3OA5A 2BA1A 3PA7A 1FAPA 1B6CA 2KE0A 3FSCA 1XRVA 4TNSA 4QIBA 2M3OW 3O5GA 2Q5AA 2DK1A 4KQZA 1ZU8A 4MNMA 4LAXA 2JX8A 2L4JA 3WQWA 2RUCA 3CHDA 1BL4A 1FFRA 2K8IA 1ZBCA 1TK7A 4TW6A 3WD4A 1J4RA 1H0GA 3TCZA 3O5QA 3O5FA 1ROTA 4DRJA 1ZL1A 2DT1A 5DIUA 4ODNA 3UQBA 2ITKA 3LE4A 4JFJA 4NSBA 2ZR5A 2RSEA 3PRDA 3MCBB 1OGBA 2E45A 3MQGA 3KAIA 4URIA 1YATA 4TW7A 1KT0A 2L2SA 1W9UA 4ODOA 3M7NA 1LL6A 1L1PA 1LL7A 1QPLA 2G8ZA 4LAWA 1JMQA 4J4NA 1ZBVA 2F4EA 1WR7A 1J4IA 4ODLA 4AY1A 3G6MA 2MPHA 2DK7A 1W1TA 4ZPWR 2UZ5A 3IKDA 1JNTA 3AROA 3UF8A 1ZB5A 1FKHA 2OFNA 2RE3A 1FD9A 1F40A 1K9TA 2YBTA 3JYMA 4Z2JA 4GLXA 3ARQA 1LJYA 2LPVA 1O6IA 1R9HA 3MCBA 1ZCNA 2G41A 3EIPA 1Q1CA 2PPOA 4LAYA 4Q22A 2DSZA 2B31A 1WMVA 3UQAA 2EZ5W 2XP4A 1HJXA 1Y0OA 1U79A 3RMEA 2VN1A 3FAPA 4N19A 2N87A 4DZ2A 4G50A 1JNSA 1E6RA 2O92A 2XP6A 2EULA 1HKMA 1Q6UA 3CNGA 2MDIA 2KI3A 2DG3A 2KR7A 2QF8A 4BF8A 3ARPA 4G2PA 4A0TA 3WH0A 1X6LA 3WQVA 3EY6A 1J6YA 1P5QA 3WL1A 1O6WA 3QOKA 1NSGA 4TW8A 2DT0A 4DRHA 2FDMA 4DRQA 2DSVA 1KFWA 3B9AA 4O2TA 2MNTA 1EDQA 3RFWA 1HKIA 5AHTA 4DZ3A 2KO7A 3RM9A 2WK2A 1F8AB 5U47A 1TCOC 2IF4A 2FAPA 3O5KA 2QRVA 3RM8A 4ZPTR 4W5UA 1TR8A 1W9VA 1E6ZA 2F2DA 3UQIA 1Q6HA 1NH6A 2O9OA 4J4OA 2ETNA 3OOBA 3CZ8A 2DT3A 3M85A 3ARTA 1WNOA 1EG4A 3FS8A 4NZCA 4S3JA 2DG4A 1SR0A 2MLXA 4MNJA 4ODKA 1A7XA 5HT1A 1M5YA 4U84A 2OWOA 3WIJA 4REXA 3KADA 2YSFA 5GPGA 4JFMA 4MTVA 3KAFA 2WM0A 3CHCA 3CGNA 4QZVB 4HBEA 4IPXA 2WLZA 5DO2A 3O5JA 1NWSA 2A3BA 1FKTA 4W9OA 2WLYA 2ZR6A 3KABA 2LJ4A 1FKRA 1TFVA 1HKKA 4LAVA 2DSUA 1BKFA 2PV3A 3LUOA 4IT6A 4DROA 5HW6A 5E62A 1FKSA 1EYMA 3WD0A 3FXYA 2LGOA 2M08A 2M1IA 1K9QA 1FKKA 4P8XA 1FKJA 4IQ2A 3O5DA 4W9QA 4ZS6A 1FLCA 1H0IA 3ARZA 2YSIA 3WD2A 4IT4A 2A3AA 1E15A 3O5IA 1HJVA 4QT3A 3AS3A 4MGVA 2YSGA 3AS0A 2XP7A 2XPAA 2PBCA 3BMBA 3FSBA 2XP5A 3O5LA 3JXVA 2RUQA 4HBOA 4DT4A 2WAEA 2DJYA 1SYTA 4FN2A 5D75A 4JFKA 2ZAJA 1NMWA 2DMVA 3ARSA 2JXWA 4L72B 3UI6A 1JNEA 1X6NA 3IKGA 4DWSB 4HARA 4WKFA 1FKGA 2AWGA 2XP9A 5DIVA 1ZBWA 1LL4A 2ZQVA 3ARXA 2LKNA 2PI6A 2OLHA 5CQ2A 2JV4A 5HTGA 3WD3A 3BXWA 2DG9A 1NMVA 4P8VA 3CGMA 1UR8A 4DH0A 2YSHA 4ODRA 2MF9A 2ZQSA 1VF8A 5DITA 5HUAA 4MNKA 5E5WA 1E9LA 2RUDA 1XHGA 3WKZA 4A0UA 1FKIA 1W1PA 3AQUA 4JFLA 2KFWA 4TYOA 3RGCA 2ZQTA 2B5UB 5E66A 3O5EA 3O5OA 4R5EA 4S3KA 1JCHB 1PBKA 5GQBA 1E6NA 1C9HA 3TDBA 1EG3A 4DWSA 4Z2HA 2JZVA 2A3CA 1W9PA 2MLYA 5HW8A 1T11A 3JYJA 1YW5A 3CHFA 1QPFA 2D9FA 3PR9A 4ODMA 4PTMA 4DRMA 1HJWA 3ALFA 3O5PA 3B8SA 3GPKA
chains in the Genus database with same CATH topology
2JMFA 3KCEA 4ITZA 2MLZA 4LGXA 2KXQA 3LKXB 2LAJA 2ESCA 2DSWA 1NWTA 5GPRA 1GUVA 1J4HA 2A3EA 3UI5A 1GOIA 4W9PA 2M8JA 3KAHA 1Q6IA 1RD6A 2ZQUA 3I6CA 1LG2A 3AS1A 3NRKA 4DWSD 3O5RA 3TC5A 4WJXA 3IHZA 4ODQA 1W1YA 2VCDA 4U86A 3WL0A 4Z2LA 3CH9A 4DRNA 3MDYB 3KZ7A 2Y78A 1GPFA 2KGJA 4JFIA 4E5RA 4Z2IA 4WIWA 5HWBA 1D2KA 2XP8A 1EHNA 3PRAA 2YAJB 2F21A 4DRKA 1ZBKA 3UI4A 3ALGA 2IUZA 1ZK6A 1LG1A 1K9RA 1UR9A 4P8WA 3MQHA 5E65A 1HKJA 1EIBA 5JH8A 1FFQA 1D6OA 1FKFA 3LKXA 1ROUA 4WK9A 1IX5A 2WADA 4MSPA 2PV2A 1FKDA 4DIPA 1W26A 4GGQA 2DT2A 1QZ2A 5J6EA 1PINA 3ARRA 1CTNA 4QT2A 2ZR4A 3WD1A 3KAGA 2DPEA 4ML4A 4MPKA 4ODPA 4DWSC 5E64A 3FY1A 1OGGA 4TX0A 3ARUA 1JVWA 2DWVA 3ARWA 4FAPA 2XP3A 1NWUA 5I98A 2RQSA 1FJDA 3PQHA 4P8UA 1FKLA 3ODKA 1NWRA 4Z2GA 2PPNA 4WKAA 4ZPVR 2Y8NB 1WAWA 4DRPA 3NI6A 1OWQA 1HXVA 3ARVA 4Q7NA 3W4RA 4WKHA 1RP5A 5DEZA 4JYSA 1WB0A 2PV1A 5B8IC 2M2AA 1EQ3A 4IQCA 5HWCA 4XAKA 3ARYA 3CHEA 1D7IA 2FKEA 1E6PA 1W1VA 3KACA 4MNLA 1N1AA 1KT1A 4GIVA 1I5HW 1D7JA 3AS2A 3O5MA 5HKGA 3G6LA 5HBFA 5DF0A 4R0XA 5BXJA 4L3NA 4KR0B 5HW7A 2RURA 2PPPA 1D7HA 1FKBA 4MAVA 4U85A 4C02B 1ITXA 3B7XA 3B9DA 3PRBA 2YBUA 3H9RB 2YSBA 4NNRA 4Z2KA 2XPBA 2AOSA 3B9EA 3RM4A 2M8IA 3L4HA 3VAWA 3NTPA 1JNDA 1LQ0A 3IK8A 4DRIA 3OA5A 2BA1A 3PA7A 1FAPA 1B6CA 2KE0A 3FSCA 1XRVA 4TNSA 4QIBA 2M3OW 3O5GA 2Q5AA 2DK1A 4KQZA 1ZU8A 4MNMA 4LAXA 2JX8A 2L4JA 3WQWA 2RUCA 3CHDA 1BL4A 1FFRA 2K8IA 1ZBCA 1TK7A 4TW6A 3WD4A 1J4RA 1H0GA 3TCZA 3O5QA 3O5FA 1ROTA 4DRJA 1ZL1A 2DT1A 5DIUA 4ODNA 3UQBA 2ITKA 3LE4A 4JFJA 4NSBA 2ZR5A 2RSEA 3PRDA 3MCBB 1OGBA 2E45A 3MQGA 3KAIA 4URIA 1YATA 4TW7A 1KT0A 2L2SA 1W9UA 4ODOA 3M7NA 1LL6A 1L1PA 1LL7A 1QPLA 2G8ZA 4LAWA 1JMQA 4J4NA 1ZBVA 2F4EA 1WR7A 1J4IA 4ODLA 4AY1A 3G6MA 2MPHA 2DK7A 1W1TA 4ZPWR 2UZ5A 3IKDA 1JNTA 3AROA 3UF8A 1ZB5A 1FKHA 2OFNA 2RE3A 1FD9A 1F40A 1K9TA 2YBTA 3JYMA 4Z2JA 4GLXA 3ARQA 1LJYA 2LPVA 1O6IA 1R9HA 3MCBA 1ZCNA 2G41A 1Q1CA 2PPOA 4LAYA 4Q22A 2DSZA 2B31A 1WMVA 3UQAA 2EZ5W 2XP4A 1HJXA 1Y0OA 1U79A 3RMEA 2VN1A 3FAPA 4N19A 2N87A 4DZ2A 4G50A 1JNSA 1E6RA 2O92A 2XP6A 1HKMA 1Q6UA 3CNGA 2MDIA 2KI3A 2DG3A 2KR7A 2QF8A 4BF8A 3ARPA 4G2PA 4A0TA 3WH0A 1X6LA 3WQVA 3EY6A 1J6YA 1P5QA 3WL1A 1O6WA 3QOKA 1NSGA 4TW8A 2DT0A 4DRHA 2FDMA 4DRQA 2DSVA 1KFWA 3B9AA 4O2TA 2MNTA 1EDQA 3RFWA 1HKIA 5AHTA 4DZ3A 2KO7A 3RM9A 2WK2A 1F8AB 5U47A 1TCOC 2IF4A 2FAPA 3O5KA 2QRVA 3RM8A 4ZPTR 4W5UA 1TR8A 1W9VA 1E6ZA 2F2DA 3UQIA 1Q6HA 1NH6A 2O9OA 4J4OA 3OOBA 3CZ8A 2DT3A 3M85A 3ARTA 1WNOA 1EG4A 3FS8A 4NZCA 4S3JA 2DG4A 1SR0A 2MLXA 4MNJA 4ODKA 1A7XA 5HT1A 1M5YA 4U84A 2OWOA 3WIJA 4REXA 3KADA 2YSFA 5GPGA 4JFMA 4MTVA 3KAFA 2WM0A 3CHCA 3CGNA 4QZVB 4HBEA 4IPXA 2WLZA 5DO2A 3O5JA 1NWSA 2A3BA 1FKTA 4W9OA 2WLYA 2ZR6A 3KABA 2LJ4A 1FKRA 1TFVA 1HKKA 4LAVA 2DSUA 1BKFA 2PV3A 3LUOA 4IT6A 4DROA 5HW6A 5E62A 1FKSA 1EYMA 3WD0A 3FXYA 2LGOA 2M08A 2M1IA 1K9QA 1FKKA 4P8XA 1FKJA 4IQ2A 3O5DA 4W9QA 4ZS6A 1FLCA 1H0IA 3ARZA 2YSIA 3WD2A 4IT4A 2A3AA 1E15A 3O5IA 1HJVA 4QT3A 3AS3A 4MGVA 2YSGA 3AS0A 2XP7A 2XPAA 2PBCA 3O5LA 3FSBA 2XP5A 4HBOA 3JXVA 2RUQA 4DT4A 2WAEA 2DJYA 1SYTA 4FN2A 5D75A 4JFKA 2ZAJA 1NMWA 2DMVA 3ARSA 2JXWA 4L72B 3UI6A 1JNEA 1X6NA 3IKGA 4DWSB 4HARA 4WKFA 1FKGA 2AWGA 2XP9A 5DIVA 1ZBWA 1LL4A 2ZQVA 3ARXA 2LKNA 2PI6A 2OLHA 5CQ2A 2JV4A 5HTGA 3WD3A 3BXWA 2DG9A 1NMVA 4P8VA 3CGMA 1UR8A 4DH0A 2YSHA 4ODRA 2MF9A 2ZQSA 1VF8A 5DITA 5HUAA 4MNKA 5E5WA 1E9LA 2RUDA 1XHGA 3WKZA 4A0UA 1FKIA 1W1PA 3AQUA 4JFLA 2KFWA 4TYOA 3RGCA 2ZQTA 5E66A 3O5EA 3O5OA 4R5EA 4S3KA 1PBKA 5GQBA 1E6NA 1C9HA 3TDBA 1EG3A 4DWSA 4Z2HA 2JZVA 2A3CA 1W9PA 2MLYA 5HW8A 1T11A 3JYJA 1YW5A 3CHFA 1QPFA 2D9FA 3PR9A 4ODMA 4PTMA 4DRMA 1HJWA 3ALFA 3O5PA 3B8SA 3GPKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JMF A;  3KCE A;  4ITZ A;  2MLZ A;  2KXQ A;  2LAJ A;  1J4H A;  3UI5 A;  4W9P A;  2M8J A;  3KAH A;  1Q6I A;  2ZQU A;  3I6C A;  3NRK A;  3O5R A;  3TC5 A;  3IHZ A;  4ODQ A;  2VCD A;  4U86 A;  4DRN A;  3MDY B;  3KZ7 A;  2Y78 A;  2KGJ A;  4JFI A;  4E5R A;  5HWB A;  2XP8 A;  4DRK A;  2F21 A;  3UI4 A;  1ZK6 A;  1K9R A;  1D6O A;  1FKF A;  1ROU A;  4MSP A;  2PV2 A;  1FKD A;  4DIP A;  1W26 A;  4GGQ A;  1QZ2 A;  5J6E A;  1PIN A;  4QT2 A;  2ZR4 A;  3KAG A;  4ODP A;  4TX0 A;  1JVW A;  2DWV A;  4FAP A;  2XP3 A;  5I98 A;  2RQS A;  1FJD A;  1FKL A;  3ODK A;  2PPN A;  4DRP A;  3NI6 A;  1HXV A;  4JYS A;  2PV1 A;  5B8I C;  2M2A A;  1EQ3 A;  4IQC A;  5HWC A;  1D7I A;  2FKE A;  3KAC A;  1N1A A;  1KT1 A;  4GIV A;  1I5H W;  1D7J A;  3O5M A;  5HKG A;  4R0X A;  5BXJ A;  5HW7 A;  2RUR A;  2PPP A;  1D7H A;  1FKB A;  4U85 A;  4C02 B;  3B7X A;  3PRB A;  3H9R B;  2YSB A;  4NNR A;  2XPB A;  2M8I A;  3L4H A;  3VAW A;  3NTP A;  3IK8 A;  4DRI A;  2BA1 A;  3PA7 A;  1FAP A;  1B6C A;  2KE0 A;  4TNS A;  4QIB A;  2M3O W;  3O5G A;  2Q5A A;  2DK1 A;  4LAX A;  2JX8 A;  2L4J A;  2RUC A;  1BL4 A;  2K8I A;  1TK7 A;  4TW6 A;  1J4R A;  3TCZ A;  3O5Q A;  3O5F A;  1ROT A;  4DRJ A;  5DIU A;  4ODN A;  3UQB A;  2ITK A;  3LE4 A;  4JFJ A;  2ZR5 A;  2RSE A;  3PRD A;  2E45 A;  3KAI A;  1YAT A;  4TW7 A;  1KT0 A;  2L2S A;  4ODO A;  3M7N A;  1L1P A;  1QPL A;  4LAW A;  1JMQ A;  4J4N A;  2F4E A;  1WR7 A;  1J4I A;  4ODL A;  2MPH A;  2DK7 A;  2UZ5 A;  3IKD A;  1JNT A;  3UF8 A;  1FKH A;  2OFN A;  2RE3 A;  1FD9 A;  1F40 A;  3JYM A;  2LPV A;  1R9H A;  1ZCN A;  1Q1C A;  2PPO A;  4LAY A;  1WMV A;  3UQA A;  2EZ5 W;  2XP4 A;  1Y0O A;  1U79 A;  2VN1 A;  3FAP A;  4N19 A;  2N87 A;  4DZ2 A;  4G50 A;  1JNS A;  2XP6 A;  1Q6U A;  3CNG A;  2MDI A;  2KI3 A;  2DG3 A;  2KR7 A;  4BF8 A;  4G2P A;  3WH0 A;  3EY6 A;  1J6Y A;  1P5Q A;  1O6W A;  1NSG A;  4TW8 A;  4DRH A;  4DRQ A;  4O2T A;  2MNT A;  3RFW A;  5AHT A;  4DZ3 A;  2KO7 A;  1F8A B;  1TCO C;  3O5K A;  2FAP A;  2IF4 A;  3UQI A;  2F2D A;  1Q6H A;  4J4O A;  3OOB A;  3M85 A;  1EG4 A;  2DG4 A;  2MLX A;  4ODK A;  1A7X A;  5HT1 A;  1M5Y A;  4U84 A;  4REX A;  3KAD A;  2YSF A;  5GPG A;  4JFM A;  3KAF A;  3CGN A;  4IPX A;  3O5J A;  1FKT A;  4W9O A;  2ZR6 A;  3KAB A;  2LJ4 A;  1FKR A;  4LAV A;  1BKF A;  2PV3 A;  3LUO A;  4DRO A;  5HW6 A;  1FKS A;  1EYM A;  2LGO A;  2M08 A;  2M1I A;  1K9Q A;  1FKK A;  1FKJ A;  4IQ2 A;  3O5D A;  4W9Q A;  2YSI A;  3O5I A;  4QT3 A;  4MGV A;  2YSG A;  2XP7 A;  2XPA A;  2PBC A;  3O5L A;  4DT4 A;  2XP5 A;  3JXV A;  2RUQ A;  2DJY A;  4FN2 A;  5D75 A;  4JFK A;  2ZAJ A;  1NMW A;  2DMV A;  2JXW A;  3UI6 A;  3IKG A;  1FKG A;  2AWG A;  2XP9 A;  5DIV A;  2ZQV A;  2LKN A;  5CQ2 A;  2JV4 A;  5HTG A;  2DG9 A;  1NMV A;  3CGM A;  4DH0 A;  2YSH A;  4ODR A;  2MF9 A;  2ZQS A;  5DIT A;  5HUA A;  2RUD A;  1FKI A;  4JFL A;  2KFW A;  4TYO A;  3RGC A;  2ZQT A;  3O5E A;  3O5O A;  1PBK A;  1C9H A;  3TDB A;  1EG3 A;  2JZV A;  2MLY A;  5HW8 A;  1T11 A;  3JYJ A;  1YW5 A;  1QPF A;  2D9F A;  4ODM A;  4DRM A;  3O5P A;  3GPK A; 
#chains in the Genus database with same CATH topology
 2JMF A;  3KCE A;  4ITZ A;  2MLZ A;  4LGX A;  2KXQ A;  3LKX B;  2LAJ A;  2ESC A;  2DSW A;  1NWT A;  5GPR A;  1GUV A;  1J4H A;  2A3E A;  3UI5 A;  1GOI A;  4W9P A;  2M8J A;  3KAH A;  1Q6I A;  1RD6 A;  2ZQU A;  3I6C A;  1LG2 A;  3AS1 A;  3NRK A;  4DWS D;  3O5R A;  3TC5 A;  4WJX A;  3IHZ A;  4ODQ A;  1W1Y A;  2VCD A;  4U86 A;  3WL0 A;  4Z2L A;  3CH9 A;  4DRN A;  3MDY B;  3KZ7 A;  2Y78 A;  1GPF A;  2KGJ A;  4JFI A;  4E5R A;  4Z2I A;  4WIW A;  5HWB A;  1D2K A;  2XP8 A;  1EHN A;  3PRA A;  2YAJ B;  2F21 A;  4DRK A;  1ZBK A;  3UI4 A;  3ALG A;  2IUZ A;  1ZK6 A;  1LG1 A;  1K9R A;  1UR9 A;  4P8W A;  3MQH A;  5E65 A;  1GRJ A;  1HKJ A;  1EIB A;  5JH8 A;  1FFQ A;  1D6O A;  1FKF A;  3LKX A;  1ROU A;  4WK9 A;  1IX5 A;  2WAD A;  4MSP A;  2PV2 A;  1FKD A;  4DIP A;  1W26 A;  4GGQ A;  2DT2 A;  1QZ2 A;  5J6E A;  1PIN A;  3ARR A;  1CTN A;  4QT2 A;  2ZR4 A;  3WD1 A;  3KAG A;  2DPE A;  4ML4 A;  4MPK A;  4ODP A;  4DWS C;  5E64 A;  3FY1 A;  1OGG A;  4TX0 A;  3ARU A;  1JVW A;  2DWV A;  3ARW A;  4FAP A;  2XP3 A;  1NWU A;  5I98 A;  2RQS A;  1FJD A;  3PQH A;  4P8U A;  1FKL A;  3ODK A;  1NWR A;  4Z2G A;  2PPN A;  4WKA A;  4ZPV R;  2Y8N B;  1WAW A;  4DRP A;  3NI6 A;  1OWQ A;  1HXV A;  3ARV A;  4Q7N A;  3W4R A;  4WKH A;  1RP5 A;  5DEZ A;  4JYS A;  1WB0 A;  2PV1 A;  5B8I C;  2M2A A;  1EQ3 A;  4UDM A;  4IQC A;  5HWC A;  4XAK A;  2PN0 A;  2F23 A;  3ARY A;  2P4V A;  3CHE A;  1D7I A;  2FKE A;  1E6P A;  1W1V A;  3KAC A;  4MNL A;  1N1A A;  1KT1 A;  4GIV A;  1I5H W;  1D7J A;  3AS2 A;  3O5M A;  5HKG A;  3GTY X;  3G6L A;  5HBF A;  5DF0 A;  4R0X A;  5BXJ A;  4L3N A;  4KR0 B;  5HW7 A;  2RUR A;  2PPP A;  1D7H A;  1FKB A;  4MAV A;  4U85 A;  4C02 B;  3GU0 A;  1ITX A;  3B7X A;  3B9D A;  3PRB A;  2YBU A;  3H9R B;  2YSB A;  4NNR A;  4Z2K A;  2XPB A;  2AOS A;  3B9E A;  3RM4 A;  2M8I A;  3L4H A;  3VAW A;  1E44 A;  3NTP A;  1JND A;  1LQ0 A;  3IK8 A;  4DRI A;  3OA5 A;  2BA1 A;  3PA7 A;  1FAP A;  1B6C A;  2KE0 A;  3FSC A;  1XRV A;  4TNS A;  4QIB A;  2M3O W;  3O5G A;  2Q5A A;  2DK1 A;  4KQZ A;  1ZU8 A;  4MNM A;  4LAX A;  2JX8 A;  2L4J A;  3WQW A;  2RUC A;  3CHD A;  1BL4 A;  1FFR A;  2K8I A;  1ZBC A;  1TK7 A;  4TW6 A;  3WD4 A;  1J4R A;  1H0G A;  3TCZ A;  3O5Q A;  3O5F A;  1ROT A;  4DRJ A;  1ZL1 A;  2DT1 A;  5DIU A;  4ODN A;  3UQB A;  2ITK A;  3LE4 A;  4JFJ A;  4NSB A;  2ZR5 A;  2RSE A;  3PRD A;  3MCB B;  1OGB A;  2E45 A;  3MQG A;  3KAI A;  4URI A;  1YAT A;  4TW7 A;  1KT0 A;  2L2S A;  1W9U A;  4ODO A;  3M7N A;  1LL6 A;  1L1P A;  1LL7 A;  1QPL A;  2G8Z A;  4LAW A;  1JMQ A;  4J4N A;  1ZBV A;  2F4E A;  1WR7 A;  1J4I A;  4ODL A;  4AY1 A;  3G6M A;  2MPH A;  2DK7 A;  1W1T A;  4ZPW R;  2UZ5 A;  3IKD A;  1JNT A;  3ARO A;  3UF8 A;  1ZB5 A;  1FKH A;  2OFN A;  2RE3 A;  1FD9 A;  1F40 A;  1K9T A;  2YBT A;  3JYM A;  4Z2J A;  4GLX A;  3ARQ A;  1LJY A;  2LPV A;  1O6I A;  1R9H A;  3MCB A;  1ZCN A;  2G41 A;  3EIP A;  1Q1C A;  2PPO A;  4LAY A;  4Q22 A;  2DSZ A;  2B31 A;  1WMV A;  3UQA A;  2EZ5 W;  2XP4 A;  1HJX A;  1Y0O A;  1U79 A;  3RME A;  2VN1 A;  3FAP A;  4N19 A;  2N87 A;  4DZ2 A;  4G50 A;  1JNS A;  1E6R A;  2O92 A;  2XP6 A;  2EUL A;  1HKM A;  1Q6U A;  3CNG A;  2MDI A;  2KI3 A;  2DG3 A;  2KR7 A;  2QF8 A;  4BF8 A;  3ARP A;  4G2P A;  4A0T A;  3WH0 A;  1X6L A;  3WQV A;  3EY6 A;  1J6Y A;  1P5Q A;  3WL1 A;  1O6W A;  3QOK A;  1NSG A;  4TW8 A;  2DT0 A;  4DRH A;  2FDM A;  4DRQ A;  2DSV A;  1KFW A;  3B9A A;  4O2T A;  2MNT A;  1EDQ A;  3RFW A;  1HKI A;  5AHT A;  4DZ3 A;  2KO7 A;  3RM9 A;  2WK2 A;  1F8A B;  5U47 A;  1TCO C;  2IF4 A;  2FAP A;  3O5K A;  2QRV A;  3RM8 A;  4ZPT R;  4W5U A;  1TR8 A;  1W9V A;  1E6Z A;  2F2D A;  3UQI A;  1Q6H A;  1NH6 A;  2O9O A;  4J4O A;  2ETN A;  3OOB A;  3CZ8 A;  2DT3 A;  3M85 A;  3ART A;  1WNO A;  1EG4 A;  3FS8 A;  4NZC A;  4S3J A;  2DG4 A;  1SR0 A;  2MLX A;  4MNJ A;  4ODK A;  1A7X A;  5HT1 A;  1M5Y A;  4U84 A;  2OWO A;  3WIJ A;  4REX A;  3KAD A;  2YSF A;  5GPG A;  4JFM A;  4MTV A;  3KAF A;  2WM0 A;  3CHC A;  3CGN A;  4QZV B;  4HBE A;  4IPX A;  2WLZ A;  5DO2 A;  3O5J A;  1NWS A;  2A3B A;  1FKT A;  4W9O A;  2WLY A;  2ZR6 A;  3KAB A;  2LJ4 A;  1FKR A;  1TFV A;  1HKK A;  4LAV A;  2DSU A;  1BKF A;  2PV3 A;  3LUO A;  4IT6 A;  4DRO A;  5HW6 A;  5E62 A;  1FKS A;  1EYM A;  3WD0 A;  3FXY A;  2LGO A;  2M08 A;  2M1I A;  1K9Q A;  1FKK A;  4P8X A;  1FKJ A;  4IQ2 A;  3O5D A;  4W9Q A;  4ZS6 A;  1FLC A;  1H0I A;  3ARZ A;  2YSI A;  3WD2 A;  4IT4 A;  2A3A A;  1E15 A;  3O5I A;  1HJV A;  4QT3 A;  3AS3 A;  4MGV A;  2YSG A;  3AS0 A;  2XP7 A;  2XPA A;  2PBC A;  3BMB A;  3FSB A;  2XP5 A;  3O5L A;  3JXV A;  2RUQ A;  4HBO A;  4DT4 A;  2WAE A;  2DJY A;  1SYT A;  4FN2 A;  5D75 A;  4JFK A;  2ZAJ A;  1NMW A;  2DMV A;  3ARS A;  2JXW A;  4L72 B;  3UI6 A;  1JNE A;  1X6N A;  3IKG A;  4DWS B;  4HAR A;  4WKF A;  1FKG A;  2AWG A;  2XP9 A;  5DIV A;  1ZBW A;  1LL4 A;  2ZQV A;  3ARX A;  2LKN A;  2PI6 A;  2OLH A;  5CQ2 A;  2JV4 A;  5HTG A;  3WD3 A;  3BXW A;  2DG9 A;  1NMV A;  4P8V A;  3CGM A;  1UR8 A;  4DH0 A;  2YSH A;  4ODR A;  2MF9 A;  2ZQS A;  1VF8 A;  5DIT A;  5HUA A;  4MNK A;  5E5W A;  1E9L A;  2RUD A;  1XHG A;  3WKZ A;  4A0U A;  1FKI A;  1W1P A;  3AQU A;  4JFL A;  2KFW A;  4TYO A;  3RGC A;  2ZQT A;  2B5U B;  5E66 A;  3O5E A;  3O5O A;  4R5E A;  4S3K A;  1JCH B;  1PBK A;  5GQB A;  1E6N A;  1C9H A;  3TDB A;  1EG3 A;  4DWS A;  4Z2H A;  2JZV A;  2A3C A;  1W9P A;  2MLY A;  5HW8 A;  1T11 A;  3JYJ A;  1YW5 A;  3CHF A;  1QPF A;  2D9F A;  3PR9 A;  4ODM A;  4PTM A;  4DRM A;  1HJW A;  3ALF A;  3O5P A;  3B8S A;  3GPK A; 
#chains in the Genus database with same CATH homology
 2JMF A;  3KCE A;  4ITZ A;  2MLZ A;  4LGX A;  2KXQ A;  3LKX B;  2LAJ A;  2ESC A;  2DSW A;  1NWT A;  5GPR A;  1GUV A;  1J4H A;  2A3E A;  3UI5 A;  1GOI A;  4W9P A;  2M8J A;  3KAH A;  1Q6I A;  1RD6 A;  2ZQU A;  3I6C A;  1LG2 A;  3AS1 A;  3NRK A;  4DWS D;  3O5R A;  3TC5 A;  4WJX A;  3IHZ A;  4ODQ A;  1W1Y A;  2VCD A;  4U86 A;  3WL0 A;  4Z2L A;  3CH9 A;  4DRN A;  3MDY B;  3KZ7 A;  2Y78 A;  1GPF A;  2KGJ A;  4JFI A;  4E5R A;  4Z2I A;  4WIW A;  5HWB A;  1D2K A;  2XP8 A;  1EHN A;  3PRA A;  2YAJ B;  2F21 A;  4DRK A;  1ZBK A;  3UI4 A;  3ALG A;  2IUZ A;  1ZK6 A;  1LG1 A;  1K9R A;  1UR9 A;  4P8W A;  3MQH A;  5E65 A;  1HKJ A;  1EIB A;  5JH8 A;  1FFQ A;  1D6O A;  1FKF A;  3LKX A;  1ROU A;  4WK9 A;  1IX5 A;  2WAD A;  4MSP A;  2PV2 A;  1FKD A;  4DIP A;  1W26 A;  4GGQ A;  2DT2 A;  1QZ2 A;  5J6E A;  1PIN A;  3ARR A;  1CTN A;  4QT2 A;  2ZR4 A;  3WD1 A;  3KAG A;  2DPE A;  4ML4 A;  4MPK A;  4ODP A;  4DWS C;  5E64 A;  3FY1 A;  1OGG A;  4TX0 A;  3ARU A;  1JVW A;  2DWV A;  3ARW A;  4FAP A;  2XP3 A;  1NWU A;  5I98 A;  2RQS A;  1FJD A;  3PQH A;  4P8U A;  1FKL A;  3ODK A;  1NWR A;  4Z2G A;  2PPN A;  4WKA A;  4ZPV R;  2Y8N B;  1WAW A;  4DRP A;  3NI6 A;  1OWQ A;  1HXV A;  3ARV A;  4Q7N A;  3W4R A;  4WKH A;  1RP5 A;  5DEZ A;  4JYS A;  1WB0 A;  2PV1 A;  5B8I C;  2M2A A;  1EQ3 A;  4IQC A;  5HWC A;  4XAK A;  3ARY A;  3CHE A;  1D7I A;  2FKE A;  1E6P A;  1W1V A;  3KAC A;  4MNL A;  1N1A A;  1KT1 A;  4GIV A;  1I5H W;  1D7J A;  3AS2 A;  3O5M A;  5HKG A;  3G6L A;  5HBF A;  5DF0 A;  4R0X A;  5BXJ A;  4L3N A;  4KR0 B;  5HW7 A;  2RUR A;  2PPP A;  1D7H A;  1FKB A;  4MAV A;  4U85 A;  4C02 B;  1ITX A;  3B7X A;  3B9D A;  3PRB A;  2YBU A;  3H9R B;  2YSB A;  4NNR A;  4Z2K A;  2XPB A;  2AOS A;  3B9E A;  3RM4 A;  2M8I A;  3L4H A;  3VAW A;  3NTP A;  1JND A;  1LQ0 A;  3IK8 A;  4DRI A;  3OA5 A;  2BA1 A;  3PA7 A;  1FAP A;  1B6C A;  2KE0 A;  3FSC A;  1XRV A;  4TNS A;  4QIB A;  2M3O W;  3O5G A;  2Q5A A;  2DK1 A;  4KQZ A;  1ZU8 A;  4MNM A;  4LAX A;  2JX8 A;  2L4J A;  3WQW A;  2RUC A;  3CHD A;  1BL4 A;  1FFR A;  2K8I A;  1ZBC A;  1TK7 A;  4TW6 A;  3WD4 A;  1J4R A;  1H0G A;  3TCZ A;  3O5Q A;  3O5F A;  1ROT A;  4DRJ A;  1ZL1 A;  2DT1 A;  5DIU A;  4ODN A;  3UQB A;  2ITK A;  3LE4 A;  4JFJ A;  4NSB A;  2ZR5 A;  2RSE A;  3PRD A;  3MCB B;  1OGB A;  2E45 A;  3MQG A;  3KAI A;  4URI A;  1YAT A;  4TW7 A;  1KT0 A;  2L2S A;  1W9U A;  4ODO A;  3M7N A;  1LL6 A;  1L1P A;  1LL7 A;  1QPL A;  2G8Z A;  4LAW A;  1JMQ A;  4J4N A;  1ZBV A;  2F4E A;  1WR7 A;  1J4I A;  4ODL A;  4AY1 A;  3G6M A;  2MPH A;  2DK7 A;  1W1T A;  4ZPW R;  2UZ5 A;  3IKD A;  1JNT A;  3ARO A;  3UF8 A;  1ZB5 A;  1FKH A;  2OFN A;  2RE3 A;  1FD9 A;  1F40 A;  1K9T A;  2YBT A;  3JYM A;  4Z2J A;  4GLX A;  3ARQ A;  1LJY A;  2LPV A;  1O6I A;  1R9H A;  3MCB A;  1ZCN A;  2G41 A;  1Q1C A;  2PPO A;  4LAY A;  4Q22 A;  2DSZ A;  2B31 A;  1WMV A;  3UQA A;  2EZ5 W;  2XP4 A;  1HJX A;  1Y0O A;  1U79 A;  3RME A;  2VN1 A;  3FAP A;  4N19 A;  2N87 A;  4DZ2 A;  4G50 A;  1JNS A;  1E6R A;  2O92 A;  2XP6 A;  1HKM A;  1Q6U A;  3CNG A;  2MDI A;  2KI3 A;  2DG3 A;  2KR7 A;  2QF8 A;  4BF8 A;  3ARP A;  4G2P A;  4A0T A;  3WH0 A;  1X6L A;  3WQV A;  3EY6 A;  1J6Y A;  1P5Q A;  3WL1 A;  1O6W A;  3QOK A;  1NSG A;  4TW8 A;  2DT0 A;  4DRH A;  2FDM A;  4DRQ A;  2DSV A;  1KFW A;  3B9A A;  4O2T A;  2MNT A;  1EDQ A;  3RFW A;  1HKI A;  5AHT A;  4DZ3 A;  2KO7 A;  3RM9 A;  2WK2 A;  1F8A B;  5U47 A;  1TCO C;  2IF4 A;  2FAP A;  3O5K A;  2QRV A;  3RM8 A;  4ZPT R;  4W5U A;  1TR8 A;  1W9V A;  1E6Z A;  2F2D A;  3UQI A;  1Q6H A;  1NH6 A;  2O9O A;  4J4O A;  3OOB A;  3CZ8 A;  2DT3 A;  3M85 A;  3ART A;  1WNO A;  1EG4 A;  3FS8 A;  4NZC A;  4S3J A;  2DG4 A;  1SR0 A;  2MLX A;  4MNJ A;  4ODK A;  1A7X A;  5HT1 A;  1M5Y A;  4U84 A;  2OWO A;  3WIJ A;  4REX A;  3KAD A;  2YSF A;  5GPG A;  4JFM A;  4MTV A;  3KAF A;  2WM0 A;  3CHC A;  3CGN A;  4QZV B;  4HBE A;  4IPX A;  2WLZ A;  5DO2 A;  3O5J A;  1NWS A;  2A3B A;  1FKT A;  4W9O A;  2WLY A;  2ZR6 A;  3KAB A;  2LJ4 A;  1FKR A;  1TFV A;  1HKK A;  4LAV A;  2DSU A;  1BKF A;  2PV3 A;  3LUO A;  4IT6 A;  4DRO A;  5HW6 A;  5E62 A;  1FKS A;  1EYM A;  3WD0 A;  3FXY A;  2LGO A;  2M08 A;  2M1I A;  1K9Q A;  1FKK A;  4P8X A;  1FKJ A;  4IQ2 A;  3O5D A;  4W9Q A;  4ZS6 A;  1FLC A;  1H0I A;  3ARZ A;  2YSI A;  3WD2 A;  4IT4 A;  2A3A A;  1E15 A;  3O5I A;  1HJV A;  4QT3 A;  3AS3 A;  4MGV A;  2YSG A;  3AS0 A;  2XP7 A;  2XPA A;  2PBC A;  3O5L A;  3FSB A;  2XP5 A;  4HBO A;  3JXV A;  2RUQ A;  4DT4 A;  2WAE A;  2DJY A;  1SYT A;  4FN2 A;  5D75 A;  4JFK A;  2ZAJ A;  1NMW A;  2DMV A;  3ARS A;  2JXW A;  4L72 B;  3UI6 A;  1JNE A;  1X6N A;  3IKG A;  4DWS B;  4HAR A;  4WKF A;  1FKG A;  2AWG A;  2XP9 A;  5DIV A;  1ZBW A;  1LL4 A;  2ZQV A;  3ARX A;  2LKN A;  2PI6 A;  2OLH A;  5CQ2 A;  2JV4 A;  5HTG A;  3WD3 A;  3BXW A;  2DG9 A;  1NMV A;  4P8V A;  3CGM A;  1UR8 A;  4DH0 A;  2YSH A;  4ODR A;  2MF9 A;  2ZQS A;  1VF8 A;  5DIT A;  5HUA A;  4MNK A;  5E5W A;  1E9L A;  2RUD A;  1XHG A;  3WKZ A;  4A0U A;  1FKI A;  1W1P A;  3AQU A;  4JFL A;  2KFW A;  4TYO A;  3RGC A;  2ZQT A;  5E66 A;  3O5E A;  3O5O A;  4R5E A;  4S3K A;  1PBK A;  5GQB A;  1E6N A;  1C9H A;  3TDB A;  1EG3 A;  4DWS A;  4Z2H A;  2JZV A;  2A3C A;  1W9P A;  2MLY A;  5HW8 A;  1T11 A;  3JYJ A;  1YW5 A;  3CHF A;  1QPF A;  2D9F A;  3PR9 A;  4ODM A;  4PTM A;  4DRM A;  1HJW A;  3ALF A;  3O5P A;  3B8S A;  3GPK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...