2XPAA

Discovery of cell-active phenyl-imidazole pin1 inhibitors by structure-guided fragment evolution
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
157
structure length
146
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of Cell-Active Phenyl-Imidazole Pin1 Inhibitors by Structure-Guided Fragment Evolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords PEPTIDYL-PROLYL CIS-TRANS ISOMERASE NIMA-INTERACTING 1
total genus 47
structure length 146
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2xpaA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2xpaA02
4W9QA 3RFWA 1FKSA 4O2TA 3LUOA 4DIPA 5DITA 5HW6A 2MLZA 4IQCA 3M7NA 2XP9A 2RUCA 3WH0A 3O5GA 3UI4A 5HUAA 4NNRA 2PBCA 4ODNA 4LAXA 2LPVA 4ODOA 5B8IC 1PBKA 1FKGA 5DIUA 2D9FA 3CGMA 4DRMA 4DZ2A 1FKKA 5J6EA 3IKGA 3O5MA 1WMVA 2F2DA 2F21A 3TCZA 1TCOC 2ZR4A 1I5HW 1FKTA 1JNSA 2OFNA 2XP8A 2YSGA 1J4IA 1ZK6A 2M08A 3IKDA 1M5YA 2KGJA 4ODMA 5HKGA 2KE0A 4TW6A 4W9PA 3KADA 1HXVA 2XP3A 2ZAJA 2MPHA 2XP4A 2DMVA 2ZR5A 3LE4A 1KT0A 2M2AA 1T11A 2LJ4A 4U86A 2FKEA 4GGQA 2ZQUA 3KACA 4MGVA 1FKFA 4R0XA 3O5PA 4IQ2A 3KAIA 1NSGA 1QPLA 1QPFA 2Q5AA 4QT2A 4BF8A 2DG4A 2KFWA 1TK7A 2K8IA 2DJYA 4DH0A 5HW8A 1F8AB 2L4JA 2N87A 3TDBA 2PPNA 2PV1A 2RQSA 4FN2A 4ODQA 4DRIA 2KO7A 1Y0OA 1EG4A 1KT1A 3KAHA 4LAVA 2XPBA 2VCDA 4J4NA 3M85A 2JMFA 2RUQA 3O5OA 4JFJA 5HWCA 2UZ5A 4ITZA 4ODRA 4JFIA 3UQAA 3NTPA 1W26A 2MNTA 4TNSA 2MDIA 1B6CA 2XP5A 2JZVA 4MSPA 4ODLA 2M8IA 2DK7A 3PA7A 5DIVA 5D75A 5HW7A 1J6YA 4DT4A 2LAJA 2XPAA 4C02B 1F40A 2BA1A 2XP6A 5HT1A 3RGCA 1J4RA 4U84A 4TW8A 1EQ3A 3O5KA 4E5RA 2M3OW 4JFKA 1K9RA 3L4HA 1J4HA 5I98A 2XP7A 3KCEA 4G50A 3CNGA 2JXWA 1D7JA 3O5LA 3O5IA 2MF9A 2DG9A 3FAPA 4DRQA 2YSFA 1NMWA 2RURA 3PRDA 4DRKA 2ZQVA 1FKIA 1JVWA 4FAPA 1D6OA 2ZQSA 2PV3A 2YSIA 3O5RA 1FJDA 3ODKA 4U85A 1FD9A 3UF8A 3EY6A 1EYMA 1N1AA 3IK8A 3VAWA 3CGNA 4DROA 2YSHA 4DZ3A 3NRKA 4QIBA 1WR7A 2AWGA 2L2SA 3O5JA 1FKRA 1O6WA 2F4EA 4REXA 3KAFA 4TX0A 1D7IA 1R9HA 1YW5A 3JYMA 2DWVA 1JMQA 3UQBA 1Q6HA 3TC5A 2DG3A 4GIVA 2MLYA 2YSBA 1QZ2A 4JYSA 1A7XA 2ZR6A 1ROUA 2E45A 5CQ2A 1FKHA 4JFMA 1L1PA 2LKNA 2RE3A 2M1IA 3UQIA 4N19A 5AHTA 3KABA 3KAGA 4QT3A 1C9HA 3I6CA 4TW7A 1P5QA 3OOBA 4JFLA 2KI3A 2DK1A 4ODPA 2VN1A 4ODKA 3O5EA 2M8JA 2MLXA 4TYOA 3UI6A 1PINA 2JX8A 4LAWA 2EZ5W 1BKFA 2RUDA 2FAPA 3NI6A 1Q6IA 5BXJA 3JYJA 4IPXA 3GPKA 3O5FA 1NMVA 2ZQTA 2PPOA 3MDYB 1K9QA 4J4OA 3H9RB 1FKJA 5GPGA 4DRJA 5HTGA 1ZCNA 1Q1CA 2PV2A 3PRBA 4LAYA 1FKLA 1D7HA 4DRPA 3O5DA 1FKDA 2LGOA 1Q6UA 3JXVA 3UI5A 4DRNA 2KXQA 4W9OA 1FAPA 1U79A 5HWBA 2IF4A 3IHZA 2ITKA 2JV4A 1BL4A 3O5QA 2PPPA 4G2PA 1JNTA 2Y78A 1ROTA 1FKBA 3B7XA 2RSEA 3KZ7A 1YATA 4DRHA 1EG3A 2KR7A
chains in the Genus database with same CATH superfamily
3RFWA 5HW6A 1WAWA 4IQCA 3G6MA 3O5GA 4NNRA 5HBFA 3ARRA 1ZBVA 1PBKA 5E65A 1FFQA 1ZBWA 1FKGA 1WNOA 3CGMA 1NWUA 3IKGA 1WMVA 4P8VA 1FKTA 1JNSA 3IKDA 4ODMA 4ZS6A 2ZAJA 2XP4A 2DMVA 1KT0A 1T11A 3CHEA 3ALGA 3FSBA 3O5PA 3PRAA 1W1PA 4ZPVR 3KAIA 4MTVA 2KFWA 4DH0A 2DJYA 5HW8A 3TDBA 3CHDA 1JNEA 4JFIA 2MDIA 2DT0A 2XP5A 2JZVA 4MSPA 2DK7A 5D75A 4DT4A 2LAJA 2XPAA 2BA1A 2A3CA 2XP6A 3RGCA 3WD0A 4TW8A 1OGGA 1HKIA 4G50A 2Y8NB 3O5IA 2MF9A 2DG9A 4A0TA 4LGXA 4W5UA 2RURA 4DRKA 1D6OA 2ZQSA 3O5RA 1JCHB 4U85A 4WK9A 1FD9A 1WB0A 3EY6A 1EYMA 3VAWA 2WAEA 3NRKA 1WR7A 3ARZA 2DSWA 1HJWA 1SR0A 3AQUA 2QRVA 1R9HA 1X6NA 2DG3A 4GIVA 1E6PA 2MLYA 4JYSA 1A7XA 2ZR6A 3MQGA 1ROUA 4WKAA 2LKNA 4Z2JA 3OOBA 2B31A 4ODKA 2VN1A 2YBUA 1LL7A 4MNMA 3UI6A 4HBOA 3JYJA 1E6ZA 4IPXA 4P8UA 3O5FA 4DWSA 2ZQTA 3WL1A 4KR0B 4MPKA 1FKDA 3B8SA 4DRNA 1FAPA 5HWBA 3O5QA 2JV4A 3LKXB 1NWTA 2PPPA 2AOSA 2Y78A 3ARVA 3B7XA 2KR7A 2DSVA 2MLZA 1OWQA 2RUCA 2WLZA 1GPFA 3WD3A 4LAXA 3AS0A 4KQZA 4DRMA 5J6EA 5DO2A 1ZBCA 2O9OA 2YSGA 1J4IA 2DSZA 3CHFA 2KGJA 1K9TA 2G41A 4W9PA 4R5EA 4Z2IA 1HXVA 2XP3A 2DT2A 1HJVA 1LL6A 2M2AA 2LJ4A 2ZQUA 1O6IA 1QPFA 2Q5AA 5U47A 2DG4A 1F40A 2K8IA 2L4JA 2PPNA 2RQSA 4ODQA 1EG4A 3FS8A 4LAVA 3AS3A 2JMFA 1HKJA 5HWCA 1W9UA 2OWOA 2MNTA 2M8IA 3PA7A 3BXWA 3ARUA 2ETNA 2YAJB 5HT1A 3AROA 3O5KA 4E5RA 3B9AA 1K9RA 1J4HA 3G6LA 3CNGA 3AS1A 3FY1A 4DRQA 2B5UB 3UF8A 2A3BA 3IK8A 3RMEA 4DROA 2YSHA 4QIBA 1GUVA 3RM9A 2L2SA 4P8WA 4REXA 3KAFA 4TX0A 3JYMA 4S3JA 1JMQA 3ARYA 3TC5A 1UR9A 1EIBA 1HKMA 2E45A 2DSUA 2DT3A 3KAGA 4QT3A 4Z2GA 1C9HA 1P5QA 2KI3A 2WK2A 4ODPA 3O5EA 1PINA 1E9LA 3WD4A 4UDMA 1X6LA 5BXJA 1NMVA 1LJYA 1FKJA 1LG2A 2LGOA 3JXVA 4Z2KA 5GQBA 1W9VA 4W9OA 1U79A 2ITKA 1BL4A 1NWRA 4G2PA 1JNTA 3ARPA 1HKKA 1EG3A 4O2TA 1W1VA 3LUOA 4DIPA 5HUAA 3M7NA 2XP9A 3ARSA 2PBCA 4ODNA 2LPVA 5B8IC 4DWSB 1UR8A 4PTMA 4WKFA 4QZVB 3O5MA 2F2DA 2F21A 3TCZA 1TCOC 2ZR4A 1I5HW 1NWSA 2OFNA 1EDQA 1GRJA 2A3AA 2XP8A 2M08A 3ARXA 2MPHA 3LE4A 4GGQA 2FKEA 4MGVA 3KACA 3CH9A 4WIWA 4IQ2A 4NZCA 4BF8A 3BMBA 1H0GA 1LG1A 1F8AB 4FN2A 4L3NA 5E5WA 2KO7A 1KT1A 1ZL1A 4Q7NA 2XPBA 4J4NA 3O5OA 4ITZA 1FLCA 3UQAA 3NTPA 2YBTA 1W26A 4TNSA 3EIPA 2WADA 5HW7A 2QF8A 1EQ3A 1J4RA 1JNDA 1ZU8A 2M3OW 3LKXA 4JFKA 3L4HA 5I98A 3RM4A 3KCEA 2JXWA 1D7JA 3O5LA 3ARQA 4P8XA 4S3KA 2YSFA 1NMWA 3PRDA 2ZQVA 2PI6A 2PV3A 1FJDA 3PR9A 2EULA 1W9PA 3CGNA 4DZ3A 5JH8A 2OLHA 2AWGA 1FKRA 2F4EA 3W4RA 4ML4A 3WD1A 3WD2A 4MNKA 2DWVA 2YSBA 1QZ2A 3FSCA 5DF0A 4JFMA 2RE3A 3UQIA 4N19A 5AHTA 3WIJA 3I6CA 4Q22A 4ZPTR 1D2KA 2M8JA 2MLXA 2JX8A 4LAWA 1W1YA 3NI6A 2RUDA 2FAPA 1Q6IA 3GPKA 5GPGA 3ALFA 4J4OA 1K9QA 4NSBA 1Q1CA 2G8ZA 2PV2A 3PRBA 4LAYA 1EHNA 1FKLA 1D7HA 2PN0A 3UI5A 2KXQA 1ZB5A 3IHZA 5E64A 3WQWA 1LL4A 4URIA 4DWSD 2RSEA 1YATA 2P4VA 4DRHA 1GOIA 3WQVA 4W9QA 3RM8A 1FKSA 1RP5A 4HBEA 5DITA 1OGBA 1W1TA 3WH0A 3UI4A 1IX5A 1HJXA 4ODOA 1XRVA 5DIUA 2D9FA 5E62A 3MQHA 4DZ2A 1FKKA 1E6RA 1TFVA 3WKZA 3GU0A 1ZBKA 2A3EA 1ZK6A 1M5YA 5HKGA 2KE0A 4TW6A 3KADA 2ZR5A 1VF8A 4A0UA 4U86A 3GTYX 1FKFA 4R0XA 1NH6A 4HARA 5GPRA 1NSGA 1QPLA 4MAVA 4QT2A 3AS2A 3PQHA 1TK7A 2PV1A 2N87A 4DRIA 1Y0OA 3CZ8A 4DWSC 3KAHA 1E6NA 2VCDA 3M85A 2RUQA 4GLXA 4JFJA 1LQ0A 2UZ5A 4ODRA 1H0IA 4Z2HA 1B6CA 4ODLA 5DIVA 2F23A 2ESCA 1J6YA 4C02B 4U84A 4MNLA 4MNJA 2XP7A 4IT4A 3OA5A 3CHCA 1SYTA 3FAPA 3MCBB 3MCBA 5E66A 3FXYA 4IT6A 4ZPWR 4FAPA 2DT1A 3B9EA 3QOKA 1FKIA 1JVWA 1RD6A 2YSIA 1FFRA 3ODKA 1TR8A 1N1AA 4AY1A 2WM0A 3O5JA 1O6WA 3ARTA 3WL0A 1D7IA 1YW5A 3UQBA 1Q6HA 1E15A 5CQ2A 1FKHA 2IUZA 4WJXA 4XAKA 2M1IA 3KABA 4TW7A 4JFLA 2DK1A 2DPEA 1E44A 4TYOA 1ITXA 3B9DA 1KFWA 2EZ5W 1BKFA 1XHGA 4Z2LA 2PPOA 3MDYB 4DRJA 3H9RB 5HTGA 1ZCNA 2FDMA 4L72B 4DRPA 3O5DA 1Q6UA 5DEZA 2WLYA 2IF4A 4WKHA 1CTNA 3ARWA 1ROTA 1FKBA 2O92A 3KZ7A 1L1PA
chains in the Genus database with same CATH topology
3RFWA 5HW6A 1WAWA 4IQCA 3G6MA 3O5GA 4NNRA 5HBFA 3ARRA 1ZBVA 1PBKA 5E65A 1FFQA 1ZBWA 1FKGA 1WNOA 3CGMA 1NWUA 3IKGA 1WMVA 4P8VA 1FKTA 1JNSA 3IKDA 4ODMA 4ZS6A 2ZAJA 2XP4A 2DMVA 1KT0A 1T11A 3CHEA 3ALGA 3FSBA 3O5PA 3PRAA 1W1PA 4ZPVR 3KAIA 4MTVA 2KFWA 4DH0A 2DJYA 5HW8A 3TDBA 3CHDA 1JNEA 4JFIA 2MDIA 2DT0A 2XP5A 2JZVA 4MSPA 2DK7A 5D75A 4DT4A 2LAJA 2XPAA 2BA1A 2A3CA 2XP6A 3RGCA 3WD0A 4TW8A 1OGGA 1HKIA 4G50A 2Y8NB 3O5IA 2MF9A 2DG9A 4A0TA 4LGXA 4W5UA 2RURA 4DRKA 1D6OA 2ZQSA 3O5RA 4U85A 4WK9A 1FD9A 1WB0A 3EY6A 1EYMA 3VAWA 2WAEA 3NRKA 1WR7A 3ARZA 2DSWA 1HJWA 1SR0A 3AQUA 2QRVA 1R9HA 1X6NA 2DG3A 4GIVA 1E6PA 2MLYA 4JYSA 1A7XA 2ZR6A 3MQGA 1ROUA 4WKAA 2LKNA 4Z2JA 3OOBA 2B31A 4ODKA 2VN1A 2YBUA 1LL7A 4MNMA 3UI6A 4HBOA 3JYJA 1E6ZA 4IPXA 4P8UA 3O5FA 4DWSA 2ZQTA 3WL1A 4KR0B 4MPKA 1FKDA 3B8SA 4DRNA 1FAPA 5HWBA 3O5QA 2JV4A 3LKXB 1NWTA 2PPPA 2AOSA 2Y78A 3ARVA 3B7XA 2KR7A 2DSVA 2MLZA 1OWQA 2RUCA 2WLZA 1GPFA 3WD3A 4LAXA 3AS0A 4KQZA 4DRMA 5J6EA 5DO2A 1ZBCA 2O9OA 2YSGA 1J4IA 2DSZA 3CHFA 2KGJA 1K9TA 2G41A 4W9PA 4R5EA 4Z2IA 1HXVA 2XP3A 2DT2A 1HJVA 1LL6A 2M2AA 2LJ4A 2ZQUA 1O6IA 1QPFA 2Q5AA 5U47A 2DG4A 1F40A 2K8IA 2L4JA 2PPNA 2RQSA 4ODQA 1EG4A 3FS8A 4LAVA 3AS3A 2JMFA 1HKJA 5HWCA 1W9UA 2OWOA 2MNTA 2M8IA 3PA7A 3BXWA 3ARUA 5HT1A 2YAJB 3AROA 3O5KA 4E5RA 3B9AA 1K9RA 1J4HA 3G6LA 3CNGA 3AS1A 3FY1A 4DRQA 3UF8A 2A3BA 3IK8A 3RMEA 4DROA 2YSHA 4QIBA 1GUVA 3RM9A 2L2SA 4P8WA 4REXA 3KAFA 4TX0A 3JYMA 4S3JA 1JMQA 3ARYA 3TC5A 1UR9A 1EIBA 1HKMA 2E45A 2DSUA 2DT3A 3KAGA 4QT3A 4Z2GA 1C9HA 1P5QA 2KI3A 2WK2A 4ODPA 3O5EA 1PINA 1E9LA 3WD4A 1X6LA 5BXJA 1NMVA 1LJYA 1FKJA 1LG2A 2LGOA 3JXVA 4Z2KA 5GQBA 1W9VA 4W9OA 1U79A 2ITKA 1BL4A 1NWRA 4G2PA 1JNTA 3ARPA 1HKKA 1EG3A 4O2TA 1W1VA 3LUOA 4DIPA 5HUAA 3M7NA 2XP9A 3ARSA 2PBCA 4ODNA 2LPVA 5B8IC 4DWSB 1UR8A 4PTMA 4WKFA 4QZVB 3O5MA 2F2DA 2F21A 3TCZA 1TCOC 2ZR4A 1I5HW 1NWSA 2OFNA 1EDQA 2A3AA 2XP8A 2M08A 3ARXA 2MPHA 3LE4A 4GGQA 2FKEA 4MGVA 3KACA 3CH9A 4WIWA 4IQ2A 4NZCA 4BF8A 1H0GA 1LG1A 1F8AB 4FN2A 4L3NA 5E5WA 2KO7A 1KT1A 1ZL1A 4Q7NA 2XPBA 4J4NA 3O5OA 4ITZA 1FLCA 3UQAA 3NTPA 2YBTA 1W26A 4TNSA 2WADA 5HW7A 2QF8A 1EQ3A 1J4RA 1JNDA 1ZU8A 2M3OW 3LKXA 4JFKA 3L4HA 5I98A 3RM4A 3KCEA 2JXWA 1D7JA 3O5LA 3ARQA 4P8XA 4S3KA 2YSFA 1NMWA 3PRDA 2ZQVA 2PI6A 2PV3A 1FJDA 3PR9A 1W9PA 3CGNA 4DZ3A 5JH8A 2OLHA 2AWGA 1FKRA 2F4EA 3W4RA 4ML4A 3WD1A 3WD2A 4MNKA 2DWVA 2YSBA 1QZ2A 3FSCA 5DF0A 4JFMA 2RE3A 3UQIA 4N19A 5AHTA 3WIJA 3I6CA 4Q22A 4ZPTR 1D2KA 2M8JA 2MLXA 2JX8A 4LAWA 1W1YA 3NI6A 2RUDA 2FAPA 1Q6IA 3GPKA 5GPGA 3ALFA 4J4OA 1K9QA 4NSBA 1Q1CA 2G8ZA 2PV2A 3PRBA 4LAYA 1EHNA 1FKLA 1D7HA 3UI5A 2KXQA 1ZB5A 3IHZA 5E64A 3WQWA 1LL4A 4URIA 4DWSD 2RSEA 1YATA 4DRHA 1GOIA 3WQVA 4W9QA 3RM8A 1FKSA 1RP5A 4HBEA 5DITA 1OGBA 1W1TA 3WH0A 3UI4A 1IX5A 1HJXA 4ODOA 1XRVA 5DIUA 2D9FA 5E62A 3MQHA 4DZ2A 1FKKA 1E6RA 1TFVA 3WKZA 1ZBKA 2A3EA 1ZK6A 1M5YA 5HKGA 2KE0A 4TW6A 3KADA 2ZR5A 1VF8A 4A0UA 4U86A 1FKFA 4R0XA 1NH6A 4HARA 5GPRA 1NSGA 1QPLA 4MAVA 4QT2A 3AS2A 3PQHA 1TK7A 2PV1A 2N87A 4DRIA 1Y0OA 3CZ8A 4DWSC 3KAHA 1E6NA 2VCDA 3M85A 2RUQA 4GLXA 4JFJA 1LQ0A 2UZ5A 4ODRA 1H0IA 4Z2HA 1B6CA 4ODLA 5DIVA 2ESCA 1J6YA 4C02B 4U84A 4MNLA 4MNJA 2XP7A 4IT4A 3OA5A 3CHCA 1SYTA 3FAPA 3MCBB 3MCBA 5E66A 3FXYA 4IT6A 4ZPWR 4FAPA 2DT1A 3B9EA 3QOKA 1FKIA 1JVWA 1RD6A 2YSIA 1FFRA 3ODKA 1TR8A 1N1AA 4AY1A 2WM0A 3O5JA 1O6WA 3ARTA 3WL0A 1D7IA 1YW5A 3UQBA 1Q6HA 1E15A 5CQ2A 1FKHA 2IUZA 4WJXA 4XAKA 2M1IA 3KABA 4TW7A 4JFLA 2DK1A 2DPEA 4TYOA 1ITXA 3B9DA 1KFWA 2EZ5W 1BKFA 1XHGA 4Z2LA 2PPOA 3MDYB 4DRJA 3H9RB 5HTGA 1ZCNA 2FDMA 4L72B 4DRPA 3O5DA 1Q6UA 5DEZA 2WLYA 2IF4A 4WKHA 1CTNA 3ARWA 1ROTA 1FKBA 2O92A 3KZ7A 1L1PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W9Q A;  3RFW A;  1FKS A;  4O2T A;  3LUO A;  4DIP A;  5DIT A;  5HW6 A;  2MLZ A;  4IQC A;  3M7N A;  2XP9 A;  2RUC A;  3WH0 A;  3O5G A;  3UI4 A;  5HUA A;  4NNR A;  2PBC A;  4ODN A;  4LAX A;  2LPV A;  4ODO A;  5B8I C;  1PBK A;  1FKG A;  5DIU A;  2D9F A;  3CGM A;  4DRM A;  4DZ2 A;  1FKK A;  5J6E A;  3IKG A;  3O5M A;  1WMV A;  2F2D A;  2F21 A;  3TCZ A;  1TCO C;  2ZR4 A;  1I5H W;  1FKT A;  1JNS A;  2OFN A;  2XP8 A;  2YSG A;  1J4I A;  1ZK6 A;  2M08 A;  3IKD A;  1M5Y A;  2KGJ A;  4ODM A;  5HKG A;  2KE0 A;  4TW6 A;  4W9P A;  3KAD A;  1HXV A;  2XP3 A;  2ZAJ A;  2MPH A;  2XP4 A;  2DMV A;  2ZR5 A;  3LE4 A;  1KT0 A;  2M2A A;  1T11 A;  2LJ4 A;  4U86 A;  2FKE A;  4GGQ A;  2ZQU A;  3KAC A;  4MGV A;  1FKF A;  4R0X A;  3O5P A;  4IQ2 A;  3KAI A;  1NSG A;  1QPL A;  1QPF A;  2Q5A A;  4QT2 A;  4BF8 A;  2DG4 A;  2KFW A;  1TK7 A;  2K8I A;  2DJY A;  4DH0 A;  5HW8 A;  1F8A B;  2L4J A;  2N87 A;  3TDB A;  2PPN A;  2PV1 A;  2RQS A;  4FN2 A;  4ODQ A;  4DRI A;  2KO7 A;  1Y0O A;  1EG4 A;  1KT1 A;  3KAH A;  4LAV A;  2XPB A;  2VCD A;  4J4N A;  3M85 A;  2JMF A;  2RUQ A;  3O5O A;  4JFJ A;  5HWC A;  2UZ5 A;  4ITZ A;  4ODR A;  4JFI A;  3UQA A;  3NTP A;  1W26 A;  2MNT A;  4TNS A;  2MDI A;  1B6C A;  2XP5 A;  2JZV A;  4MSP A;  4ODL A;  2M8I A;  2DK7 A;  3PA7 A;  5DIV A;  5D75 A;  5HW7 A;  1J6Y A;  4DT4 A;  2LAJ A;  2XPA A;  4C02 B;  1F40 A;  2BA1 A;  2XP6 A;  5HT1 A;  3RGC A;  1J4R A;  4U84 A;  4TW8 A;  1EQ3 A;  3O5K A;  4E5R A;  2M3O W;  4JFK A;  1K9R A;  3L4H A;  1J4H A;  5I98 A;  2XP7 A;  3KCE A;  4G50 A;  3CNG A;  2JXW A;  1D7J A;  3O5L A;  3O5I A;  2MF9 A;  2DG9 A;  3FAP A;  4DRQ A;  2YSF A;  1NMW A;  2RUR A;  3PRD A;  4DRK A;  2ZQV A;  1FKI A;  1JVW A;  4FAP A;  1D6O A;  2ZQS A;  2PV3 A;  2YSI A;  3O5R A;  1FJD A;  3ODK A;  4U85 A;  1FD9 A;  3UF8 A;  3EY6 A;  1EYM A;  1N1A A;  3IK8 A;  3VAW A;  3CGN A;  4DRO A;  2YSH A;  4DZ3 A;  3NRK A;  4QIB A;  1WR7 A;  2AWG A;  2L2S A;  3O5J A;  1FKR A;  1O6W A;  2F4E A;  4REX A;  3KAF A;  4TX0 A;  1D7I A;  1R9H A;  1YW5 A;  3JYM A;  2DWV A;  1JMQ A;  3UQB A;  1Q6H A;  3TC5 A;  2DG3 A;  4GIV A;  2MLY A;  2YSB A;  1QZ2 A;  4JYS A;  1A7X A;  2ZR6 A;  1ROU A;  2E45 A;  5CQ2 A;  1FKH A;  4JFM A;  1L1P A;  2LKN A;  2RE3 A;  2M1I A;  3UQI A;  4N19 A;  5AHT A;  3KAB A;  3KAG A;  4QT3 A;  1C9H A;  3I6C A;  4TW7 A;  1P5Q A;  3OOB A;  4JFL A;  2KI3 A;  2DK1 A;  4ODP A;  2VN1 A;  4ODK A;  3O5E A;  2M8J A;  2MLX A;  4TYO A;  3UI6 A;  1PIN A;  2JX8 A;  4LAW A;  2EZ5 W;  1BKF A;  2RUD A;  2FAP A;  3NI6 A;  1Q6I A;  5BXJ A;  3JYJ A;  4IPX A;  3GPK A;  3O5F A;  1NMV A;  2ZQT A;  2PPO A;  3MDY B;  1K9Q A;  4J4O A;  3H9R B;  1FKJ A;  5GPG A;  4DRJ A;  5HTG A;  1ZCN A;  1Q1C A;  2PV2 A;  3PRB A;  4LAY A;  1FKL A;  1D7H A;  4DRP A;  3O5D A;  1FKD A;  2LGO A;  1Q6U A;  3JXV A;  3UI5 A;  4DRN A;  2KXQ A;  4W9O A;  1FAP A;  1U79 A;  5HWB A;  2IF4 A;  3IHZ A;  2ITK A;  2JV4 A;  1BL4 A;  3O5Q A;  2PPP A;  4G2P A;  1JNT A;  2Y78 A;  1ROT A;  1FKB A;  3B7X A;  2RSE A;  3KZ7 A;  1YAT A;  4DRH A;  1EG3 A;  2KR7 A; 
#chains in the Genus database with same CATH topology
 3RFW A;  5HW6 A;  1WAW A;  4IQC A;  3G6M A;  3O5G A;  4NNR A;  5HBF A;  3ARR A;  1ZBV A;  1PBK A;  5E65 A;  1FFQ A;  1ZBW A;  1FKG A;  1WNO A;  3CGM A;  1NWU A;  3IKG A;  1WMV A;  4P8V A;  1FKT A;  1JNS A;  3IKD A;  4ODM A;  4ZS6 A;  2ZAJ A;  2XP4 A;  2DMV A;  1KT0 A;  1T11 A;  3CHE A;  3ALG A;  3FSB A;  3O5P A;  3PRA A;  1W1P A;  4ZPV R;  3KAI A;  4MTV A;  2KFW A;  4DH0 A;  2DJY A;  5HW8 A;  3TDB A;  3CHD A;  1JNE A;  4JFI A;  2MDI A;  2DT0 A;  2XP5 A;  2JZV A;  4MSP A;  2DK7 A;  5D75 A;  4DT4 A;  2LAJ A;  2XPA A;  2BA1 A;  2A3C A;  2XP6 A;  3RGC A;  3WD0 A;  4TW8 A;  1OGG A;  1HKI A;  4G50 A;  2Y8N B;  3O5I A;  2MF9 A;  2DG9 A;  4A0T A;  4LGX A;  4W5U A;  2RUR A;  4DRK A;  1D6O A;  2ZQS A;  3O5R A;  1JCH B;  4U85 A;  4WK9 A;  1FD9 A;  1WB0 A;  3EY6 A;  1EYM A;  3VAW A;  2WAE A;  3NRK A;  1WR7 A;  3ARZ A;  2DSW A;  1HJW A;  1SR0 A;  3AQU A;  2QRV A;  1R9H A;  1X6N A;  2DG3 A;  4GIV A;  1E6P A;  2MLY A;  4JYS A;  1A7X A;  2ZR6 A;  3MQG A;  1ROU A;  4WKA A;  2LKN A;  4Z2J A;  3OOB A;  2B31 A;  4ODK A;  2VN1 A;  2YBU A;  1LL7 A;  4MNM A;  3UI6 A;  4HBO A;  3JYJ A;  1E6Z A;  4IPX A;  4P8U A;  3O5F A;  4DWS A;  2ZQT A;  3WL1 A;  4KR0 B;  4MPK A;  1FKD A;  3B8S A;  4DRN A;  1FAP A;  5HWB A;  3O5Q A;  2JV4 A;  3LKX B;  1NWT A;  2PPP A;  2AOS A;  2Y78 A;  3ARV A;  3B7X A;  2KR7 A;  2DSV A;  2MLZ A;  1OWQ A;  2RUC A;  2WLZ A;  1GPF A;  3WD3 A;  4LAX A;  3AS0 A;  4KQZ A;  4DRM A;  5J6E A;  5DO2 A;  1ZBC A;  2O9O A;  2YSG A;  1J4I A;  2DSZ A;  3CHF A;  2KGJ A;  1K9T A;  2G41 A;  4W9P A;  4R5E A;  4Z2I A;  1HXV A;  2XP3 A;  2DT2 A;  1HJV A;  1LL6 A;  2M2A A;  2LJ4 A;  2ZQU A;  1O6I A;  1QPF A;  2Q5A A;  5U47 A;  2DG4 A;  1F40 A;  2K8I A;  2L4J A;  2PPN A;  2RQS A;  4ODQ A;  1EG4 A;  3FS8 A;  4LAV A;  3AS3 A;  2JMF A;  1HKJ A;  5HWC A;  1W9U A;  2OWO A;  2MNT A;  2M8I A;  3PA7 A;  3BXW A;  3ARU A;  2ETN A;  2YAJ B;  5HT1 A;  3ARO A;  3O5K A;  4E5R A;  3B9A A;  1K9R A;  1J4H A;  3G6L A;  3CNG A;  3AS1 A;  3FY1 A;  4DRQ A;  2B5U B;  3UF8 A;  2A3B A;  3IK8 A;  3RME A;  4DRO A;  2YSH A;  4QIB A;  1GUV A;  3RM9 A;  2L2S A;  4P8W A;  4REX A;  3KAF A;  4TX0 A;  3JYM A;  4S3J A;  1JMQ A;  3ARY A;  3TC5 A;  1UR9 A;  1EIB A;  1HKM A;  2E45 A;  2DSU A;  2DT3 A;  3KAG A;  4QT3 A;  4Z2G A;  1C9H A;  1P5Q A;  2KI3 A;  2WK2 A;  4ODP A;  3O5E A;  1PIN A;  1E9L A;  3WD4 A;  4UDM A;  1X6L A;  5BXJ A;  1NMV A;  1LJY A;  1FKJ A;  1LG2 A;  2LGO A;  3JXV A;  4Z2K A;  5GQB A;  1W9V A;  4W9O A;  1U79 A;  2ITK A;  1BL4 A;  1NWR A;  4G2P A;  1JNT A;  3ARP A;  1HKK A;  1EG3 A;  4O2T A;  1W1V A;  3LUO A;  4DIP A;  5HUA A;  3M7N A;  2XP9 A;  3ARS A;  2PBC A;  4ODN A;  2LPV A;  5B8I C;  4DWS B;  1UR8 A;  4PTM A;  4WKF A;  4QZV B;  3O5M A;  2F2D A;  2F21 A;  3TCZ A;  1TCO C;  2ZR4 A;  1I5H W;  1NWS A;  2OFN A;  1EDQ A;  1GRJ A;  2A3A A;  2XP8 A;  2M08 A;  3ARX A;  2MPH A;  3LE4 A;  4GGQ A;  2FKE A;  4MGV A;  3KAC A;  3CH9 A;  4WIW A;  4IQ2 A;  4NZC A;  4BF8 A;  3BMB A;  1H0G A;  1LG1 A;  1F8A B;  4FN2 A;  4L3N A;  5E5W A;  2KO7 A;  1KT1 A;  1ZL1 A;  4Q7N A;  2XPB A;  4J4N A;  3O5O A;  4ITZ A;  1FLC A;  3UQA A;  3NTP A;  2YBT A;  1W26 A;  4TNS A;  3EIP A;  2WAD A;  5HW7 A;  2QF8 A;  1EQ3 A;  1J4R A;  1JND A;  1ZU8 A;  2M3O W;  3LKX A;  4JFK A;  3L4H A;  5I98 A;  3RM4 A;  3KCE A;  2JXW A;  1D7J A;  3O5L A;  3ARQ A;  4P8X A;  4S3K A;  2YSF A;  1NMW A;  3PRD A;  2ZQV A;  2PI6 A;  2PV3 A;  1FJD A;  3PR9 A;  2EUL A;  1W9P A;  3CGN A;  4DZ3 A;  5JH8 A;  2OLH A;  2AWG A;  1FKR A;  2F4E A;  3W4R A;  4ML4 A;  3WD1 A;  3WD2 A;  4MNK A;  2DWV A;  2YSB A;  1QZ2 A;  3FSC A;  5DF0 A;  4JFM A;  2RE3 A;  3UQI A;  4N19 A;  5AHT A;  3WIJ A;  3I6C A;  4Q22 A;  4ZPT R;  1D2K A;  2M8J A;  2MLX A;  2JX8 A;  4LAW A;  1W1Y A;  3NI6 A;  2RUD A;  2FAP A;  1Q6I A;  3GPK A;  5GPG A;  3ALF A;  4J4O A;  1K9Q A;  4NSB A;  1Q1C A;  2G8Z A;  2PV2 A;  3PRB A;  4LAY A;  1EHN A;  1FKL A;  1D7H A;  2PN0 A;  3UI5 A;  2KXQ A;  1ZB5 A;  3IHZ A;  5E64 A;  3WQW A;  1LL4 A;  4URI A;  4DWS D;  2RSE A;  1YAT A;  2P4V A;  4DRH A;  1GOI A;  3WQV A;  4W9Q A;  3RM8 A;  1FKS A;  1RP5 A;  4HBE A;  5DIT A;  1OGB A;  1W1T A;  3WH0 A;  3UI4 A;  1IX5 A;  1HJX A;  4ODO A;  1XRV A;  5DIU A;  2D9F A;  5E62 A;  3MQH A;  4DZ2 A;  1FKK A;  1E6R A;  1TFV A;  3WKZ A;  3GU0 A;  1ZBK A;  2A3E A;  1ZK6 A;  1M5Y A;  5HKG A;  2KE0 A;  4TW6 A;  3KAD A;  2ZR5 A;  1VF8 A;  4A0U A;  4U86 A;  3GTY X;  1FKF A;  4R0X A;  1NH6 A;  4HAR A;  5GPR A;  1NSG A;  1QPL A;  4MAV A;  4QT2 A;  3AS2 A;  3PQH A;  1TK7 A;  2PV1 A;  2N87 A;  4DRI A;  1Y0O A;  3CZ8 A;  4DWS C;  3KAH A;  1E6N A;  2VCD A;  3M85 A;  2RUQ A;  4GLX A;  4JFJ A;  1LQ0 A;  2UZ5 A;  4ODR A;  1H0I A;  4Z2H A;  1B6C A;  4ODL A;  5DIV A;  2F23 A;  2ESC A;  1J6Y A;  4C02 B;  4U84 A;  4MNL A;  4MNJ A;  2XP7 A;  4IT4 A;  3OA5 A;  3CHC A;  1SYT A;  3FAP A;  3MCB B;  3MCB A;  5E66 A;  3FXY A;  4IT6 A;  4ZPW R;  4FAP A;  2DT1 A;  3B9E A;  3QOK A;  1FKI A;  1JVW A;  1RD6 A;  2YSI A;  1FFR A;  3ODK A;  1TR8 A;  1N1A A;  4AY1 A;  2WM0 A;  3O5J A;  1O6W A;  3ART A;  3WL0 A;  1D7I A;  1YW5 A;  3UQB A;  1Q6H A;  1E15 A;  5CQ2 A;  1FKH A;  2IUZ A;  4WJX A;  4XAK A;  2M1I A;  3KAB A;  4TW7 A;  4JFL A;  2DK1 A;  2DPE A;  1E44 A;  4TYO A;  1ITX A;  3B9D A;  1KFW A;  2EZ5 W;  1BKF A;  1XHG A;  4Z2L A;  2PPO A;  3MDY B;  4DRJ A;  3H9R B;  5HTG A;  1ZCN A;  2FDM A;  4L72 B;  4DRP A;  3O5D A;  1Q6U A;  5DEZ A;  2WLY A;  2IF4 A;  4WKH A;  1CTN A;  3ARW A;  1ROT A;  1FKB A;  2O92 A;  3KZ7 A;  1L1P A; 
#chains in the Genus database with same CATH homology
 3RFW A;  5HW6 A;  1WAW A;  4IQC A;  3G6M A;  3O5G A;  4NNR A;  5HBF A;  3ARR A;  1ZBV A;  1PBK A;  5E65 A;  1FFQ A;  1ZBW A;  1FKG A;  1WNO A;  3CGM A;  1NWU A;  3IKG A;  1WMV A;  4P8V A;  1FKT A;  1JNS A;  3IKD A;  4ODM A;  4ZS6 A;  2ZAJ A;  2XP4 A;  2DMV A;  1KT0 A;  1T11 A;  3CHE A;  3ALG A;  3FSB A;  3O5P A;  3PRA A;  1W1P A;  4ZPV R;  3KAI A;  4MTV A;  2KFW A;  4DH0 A;  2DJY A;  5HW8 A;  3TDB A;  3CHD A;  1JNE A;  4JFI A;  2MDI A;  2DT0 A;  2XP5 A;  2JZV A;  4MSP A;  2DK7 A;  5D75 A;  4DT4 A;  2LAJ A;  2XPA A;  2BA1 A;  2A3C A;  2XP6 A;  3RGC A;  3WD0 A;  4TW8 A;  1OGG A;  1HKI A;  4G50 A;  2Y8N B;  3O5I A;  2MF9 A;  2DG9 A;  4A0T A;  4LGX A;  4W5U A;  2RUR A;  4DRK A;  1D6O A;  2ZQS A;  3O5R A;  4U85 A;  4WK9 A;  1FD9 A;  1WB0 A;  3EY6 A;  1EYM A;  3VAW A;  2WAE A;  3NRK A;  1WR7 A;  3ARZ A;  2DSW A;  1HJW A;  1SR0 A;  3AQU A;  2QRV A;  1R9H A;  1X6N A;  2DG3 A;  4GIV A;  1E6P A;  2MLY A;  4JYS A;  1A7X A;  2ZR6 A;  3MQG A;  1ROU A;  4WKA A;  2LKN A;  4Z2J A;  3OOB A;  2B31 A;  4ODK A;  2VN1 A;  2YBU A;  1LL7 A;  4MNM A;  3UI6 A;  4HBO A;  3JYJ A;  1E6Z A;  4IPX A;  4P8U A;  3O5F A;  4DWS A;  2ZQT A;  3WL1 A;  4KR0 B;  4MPK A;  1FKD A;  3B8S A;  4DRN A;  1FAP A;  5HWB A;  3O5Q A;  2JV4 A;  3LKX B;  1NWT A;  2PPP A;  2AOS A;  2Y78 A;  3ARV A;  3B7X A;  2KR7 A;  2DSV A;  2MLZ A;  1OWQ A;  2RUC A;  2WLZ A;  1GPF A;  3WD3 A;  4LAX A;  3AS0 A;  4KQZ A;  4DRM A;  5J6E A;  5DO2 A;  1ZBC A;  2O9O A;  2YSG A;  1J4I A;  2DSZ A;  3CHF A;  2KGJ A;  1K9T A;  2G41 A;  4W9P A;  4R5E A;  4Z2I A;  1HXV A;  2XP3 A;  2DT2 A;  1HJV A;  1LL6 A;  2M2A A;  2LJ4 A;  2ZQU A;  1O6I A;  1QPF A;  2Q5A A;  5U47 A;  2DG4 A;  1F40 A;  2K8I A;  2L4J A;  2PPN A;  2RQS A;  4ODQ A;  1EG4 A;  3FS8 A;  4LAV A;  3AS3 A;  2JMF A;  1HKJ A;  5HWC A;  1W9U A;  2OWO A;  2MNT A;  2M8I A;  3PA7 A;  3BXW A;  3ARU A;  5HT1 A;  2YAJ B;  3ARO A;  3O5K A;  4E5R A;  3B9A A;  1K9R A;  1J4H A;  3G6L A;  3CNG A;  3AS1 A;  3FY1 A;  4DRQ A;  3UF8 A;  2A3B A;  3IK8 A;  3RME A;  4DRO A;  2YSH A;  4QIB A;  1GUV A;  3RM9 A;  2L2S A;  4P8W A;  4REX A;  3KAF A;  4TX0 A;  3JYM A;  4S3J A;  1JMQ A;  3ARY A;  3TC5 A;  1UR9 A;  1EIB A;  1HKM A;  2E45 A;  2DSU A;  2DT3 A;  3KAG A;  4QT3 A;  4Z2G A;  1C9H A;  1P5Q A;  2KI3 A;  2WK2 A;  4ODP A;  3O5E A;  1PIN A;  1E9L A;  3WD4 A;  1X6L A;  5BXJ A;  1NMV A;  1LJY A;  1FKJ A;  1LG2 A;  2LGO A;  3JXV A;  4Z2K A;  5GQB A;  1W9V A;  4W9O A;  1U79 A;  2ITK A;  1BL4 A;  1NWR A;  4G2P A;  1JNT A;  3ARP A;  1HKK A;  1EG3 A;  4O2T A;  1W1V A;  3LUO A;  4DIP A;  5HUA A;  3M7N A;  2XP9 A;  3ARS A;  2PBC A;  4ODN A;  2LPV A;  5B8I C;  4DWS B;  1UR8 A;  4PTM A;  4WKF A;  4QZV B;  3O5M A;  2F2D A;  2F21 A;  3TCZ A;  1TCO C;  2ZR4 A;  1I5H W;  1NWS A;  2OFN A;  1EDQ A;  2A3A A;  2XP8 A;  2M08 A;  3ARX A;  2MPH A;  3LE4 A;  4GGQ A;  2FKE A;  4MGV A;  3KAC A;  3CH9 A;  4WIW A;  4IQ2 A;  4NZC A;  4BF8 A;  1H0G A;  1LG1 A;  1F8A B;  4FN2 A;  4L3N A;  5E5W A;  2KO7 A;  1KT1 A;  1ZL1 A;  4Q7N A;  2XPB A;  4J4N A;  3O5O A;  4ITZ A;  1FLC A;  3UQA A;  3NTP A;  2YBT A;  1W26 A;  4TNS A;  2WAD A;  5HW7 A;  2QF8 A;  1EQ3 A;  1J4R A;  1JND A;  1ZU8 A;  2M3O W;  3LKX A;  4JFK A;  3L4H A;  5I98 A;  3RM4 A;  3KCE A;  2JXW A;  1D7J A;  3O5L A;  3ARQ A;  4P8X A;  4S3K A;  2YSF A;  1NMW A;  3PRD A;  2ZQV A;  2PI6 A;  2PV3 A;  1FJD A;  3PR9 A;  1W9P A;  3CGN A;  4DZ3 A;  5JH8 A;  2OLH A;  2AWG A;  1FKR A;  2F4E A;  3W4R A;  4ML4 A;  3WD1 A;  3WD2 A;  4MNK A;  2DWV A;  2YSB A;  1QZ2 A;  3FSC A;  5DF0 A;  4JFM A;  2RE3 A;  3UQI A;  4N19 A;  5AHT A;  3WIJ A;  3I6C A;  4Q22 A;  4ZPT R;  1D2K A;  2M8J A;  2MLX A;  2JX8 A;  4LAW A;  1W1Y A;  3NI6 A;  2RUD A;  2FAP A;  1Q6I A;  3GPK A;  5GPG A;  3ALF A;  4J4O A;  1K9Q A;  4NSB A;  1Q1C A;  2G8Z A;  2PV2 A;  3PRB A;  4LAY A;  1EHN A;  1FKL A;  1D7H A;  3UI5 A;  2KXQ A;  1ZB5 A;  3IHZ A;  5E64 A;  3WQW A;  1LL4 A;  4URI A;  4DWS D;  2RSE A;  1YAT A;  4DRH A;  1GOI A;  3WQV A;  4W9Q A;  3RM8 A;  1FKS A;  1RP5 A;  4HBE A;  5DIT A;  1OGB A;  1W1T A;  3WH0 A;  3UI4 A;  1IX5 A;  1HJX A;  4ODO A;  1XRV A;  5DIU A;  2D9F A;  5E62 A;  3MQH A;  4DZ2 A;  1FKK A;  1E6R A;  1TFV A;  3WKZ A;  1ZBK A;  2A3E A;  1ZK6 A;  1M5Y A;  5HKG A;  2KE0 A;  4TW6 A;  3KAD A;  2ZR5 A;  1VF8 A;  4A0U A;  4U86 A;  1FKF A;  4R0X A;  1NH6 A;  4HAR A;  5GPR A;  1NSG A;  1QPL A;  4MAV A;  4QT2 A;  3AS2 A;  3PQH A;  1TK7 A;  2PV1 A;  2N87 A;  4DRI A;  1Y0O A;  3CZ8 A;  4DWS C;  3KAH A;  1E6N A;  2VCD A;  3M85 A;  2RUQ A;  4GLX A;  4JFJ A;  1LQ0 A;  2UZ5 A;  4ODR A;  1H0I A;  4Z2H A;  1B6C A;  4ODL A;  5DIV A;  2ESC A;  1J6Y A;  4C02 B;  4U84 A;  4MNL A;  4MNJ A;  2XP7 A;  4IT4 A;  3OA5 A;  3CHC A;  1SYT A;  3FAP A;  3MCB B;  3MCB A;  5E66 A;  3FXY A;  4IT6 A;  4ZPW R;  4FAP A;  2DT1 A;  3B9E A;  3QOK A;  1FKI A;  1JVW A;  1RD6 A;  2YSI A;  1FFR A;  3ODK A;  1TR8 A;  1N1A A;  4AY1 A;  2WM0 A;  3O5J A;  1O6W A;  3ART A;  3WL0 A;  1D7I A;  1YW5 A;  3UQB A;  1Q6H A;  1E15 A;  5CQ2 A;  1FKH A;  2IUZ A;  4WJX A;  4XAK A;  2M1I A;  3KAB A;  4TW7 A;  4JFL A;  2DK1 A;  2DPE A;  4TYO A;  1ITX A;  3B9D A;  1KFW A;  2EZ5 W;  1BKF A;  1XHG A;  4Z2L A;  2PPO A;  3MDY B;  4DRJ A;  3H9R B;  5HTG A;  1ZCN A;  2FDM A;  4L72 B;  4DRP A;  3O5D A;  1Q6U A;  5DEZ A;  2WLY A;  2IF4 A;  4WKH A;  1CTN A;  3ARW A;  1ROT A;  1FKB A;  2O92 A;  3KZ7 A;  1L1P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...