2XPAA

Discovery of cell-active phenyl-imidazole pin1 inhibitors by structure-guided fragment evolution
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
157
structure length
146
Chain Sequence
b'LPPGWEKAMSRSSGRVYYFNHITNASQWERPSGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEPTIDYL-PROLYL CIS-TRANS ISOMERASE NIMA-INTERACTING 1
publication title Discovery of Cell-Active Phenyl-Imidazole Pin1 Inhibitors by Structure-Guided Fragment Evolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 47
structure length 146
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2xpaA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2xpaA02
3LUOA 4LAYA 2DK7A 2PV1A 4J4NA 1W26A 4ITZA 3O5PA 4IPXA 3UF8A 4DIPA 1EG3A 3B7XA 1FKDA 1FKJA 5B8IC 4ODRA 2ZQSA 3UI6A 1EQ3A 2FAPA 4FAPA 1Q6IA 2AWGA 2D9FA 4DRQA 1QZ2A 4N19A 1YATA 3IHZA 1EG4A 4ODMA 4JFLA 3NI6A 4DT4A 4G2PA 2F2DA 1J4IA 2FKEA 2KGJA 1K9QA 3PRBA 3FAPA 4R0XA 1FKGA 3MDYB 2M3OW 3CGNA 4QIBA 3O5OA 2ZAJA 2RURA 3O5EA 3KAIA 4J4OA 3O5FA 4GIVA 1Q6HA 4ODKA 1Q6UA 2ZR5A 3O5DA 3KAGA 1JNSA 2ZR4A 2L4JA 2LGOA 4ODLA 4LAWA 4DRIA 2MF9A 4MGVA 3O5LA 1Q1CA 3M7NA 1FKSA 4DRPA 1FKFA 1BL4A 2Y78A 1JMQA 1D7HA 4U85A 2KO7A 2M8IA 2RUQA 4G50A 5HW8A 2N87A 3PA7A 3TDBA 3L4HA 2XP5A 2YSBA 5HWBA 3CGMA 2DG4A 1F8AB 2MLXA 3UI4A 3JYJA 2XP6A 3KACA 4TW7A 1TCOC 2Q5AA 4U86A 1P5QA 2LAJA 4QT2A 1FKHA 3RFWA 1FKLA 1J4RA 1O6WA 2JMFA 4DRHA 1FKKA 4MSPA 1QPLA 2RSEA 5J6EA 1PBKA 4IQ2A 3GPKA 3O5JA 2KXQA 1NMVA 3KAFA 2KFWA 2F4EA 1FKBA 2PBCA 1WMVA 2DG9A 2LKNA 1YW5A 3NTPA 1Y0OA 3O5QA 3IKDA 2LPVA 4O2TA 2XP4A 3NRKA 2RUDA 2YSGA 5I98A 5HWCA 2PV3A 3O5MA 2ZQUA 2KE0A 4JFMA 5HW7A 2F21A 4DRKA 1A7XA 2DMVA 4W9OA 2M2AA 4TNSA 4IQCA 3ODKA 2XP8A 2RQSA 1D6OA 4TW8A 2PV2A 1TK7A 1KT1A 4W9QA 5DITA 2XPBA 1EYMA 1M5YA 3O5RA 2DG3A 5BXJA 4QT3A 4E5RA 1FJDA 4TYOA 1FKTA 2MDIA 1ZCNA 1BKFA 4ODPA 2YSHA 3UI5A 3KABA 5AHTA 1N1AA 2DK1A 3IKGA 3EY6A 2PPOA 4JFKA 4REXA 4TW6A 2E45A 3KAHA 2VN1A 2XP3A 2ZQVA 3I6CA 4DH0A 1KT0A 2JZVA 4ODNA 2L2SA 1J4HA 4ODOA 2RE3A 1L1PA 4JFJA 4TX0A 2M1IA 3LE4A 4U84A 1C9HA 2RUCA 5HTGA 5D75A 3KADA 5CQ2A 4JYSA 1U79A 3M85A 2PPNA 2UZ5A 2MPHA 3UQIA 2JX8A 1J6YA 3CNGA 1FKIA 3OOBA 1ROUA 4DZ2A 2M8JA 2KI3A 4LAVA 1K9RA 2OFNA 2JV4A 5HKGA 2KR7A 1QPFA 2XPAA 2MLZA 4GGQA 3JYMA 5HT1A 3PRDA 3O5KA 2XP7A 1D7JA 4DRNA 2ZR6A 4C02B 4DRJA 3UQBA 2DWVA 3JXVA 5DIUA 3TCZA 1JVWA 1JNTA 5HUAA 2MLYA 4BF8A 1B6CA 3VAWA 4LAXA 5GPGA 4DZ3A 3H9RB 1R9HA 2XP9A 4ODQA 1ROTA 4NNRA 2YSIA 1PINA 1WR7A 1FAPA 1ZK6A 2VCDA 4DROA 4DRMA 3TC5A 4FN2A 2LJ4A 3WH0A 1FD9A 3KZ7A 1NSGA 2PPPA 1F40A 2EZ5W 3O5IA 2DJYA 2MNTA 1I5HW 2YSFA 3O5GA 2BA1A 3IK8A 4W9PA 1NMWA 3KCEA 1D7IA 4JFIA 1HXVA 1FKRA 2ZQTA 2K8IA 5DIVA 3RGCA 2M08A 2ITKA 5HW6A 2JXWA 1T11A 3UQAA 2IF4A
chains in the Genus database with same CATH superfamily
3ARSA 3LUOA 4LAYA 4ZPVR 1LJYA 2DSVA 2DK7A 4IT6A 2PV1A 2DSZA 2A3EA 4WKHA 4J4NA 1W26A 4ITZA 1GPFA 3O5PA 2PI6A 2O9OA 5E5WA 4IPXA 3UF8A 4DIPA 1ZU8A 1EG3A 3B7XA 1FKDA 1FKJA 5B8IC 4ODRA 2ZQSA 3UI6A 1EQ3A 1UR8A 1ZL1A 1FFQA 5E66A 2FAPA 4FAPA 1HKJA 3FSBA 1Q6IA 2AWGA 3MCBA 4Q22A 2D9FA 4DRQA 1QZ2A 4N19A 3AS3A 1YATA 3IHZA 1EG4A 4ODMA 4JFLA 3NI6A 1E6ZA 1E6PA 1ZBKA 3QOKA 4G2PA 3WD0A 4DT4A 1KFWA 2DT3A 2F2DA 1J4IA 2FKEA 3AROA 2KGJA 1OGBA 1O6IA 1K9QA 3PRBA 3WQWA 3FAPA 4R0XA 4S3KA 1H0GA 4HARA 1FKGA 3MDYB 5GPRA 2M3OW 4QZVB 3CGNA 4QIBA 3O5OA 2ZAJA 2RURA 3PRAA 3O5EA 3KAIA 4P8VA 4J4OA 3O5FA 4GIVA 1HKMA 1RP5A 1Q6HA 4WK9A 4ODKA 1Q6UA 2ZR5A 3O5DA 4MAVA 3KAGA 1JNSA 1HJVA 2ZR4A 2L4JA 4WIWA 2LGOA 1WAWA 2AOSA 4ODLA 4LAWA 4DRIA 3ARXA 2MF9A 4MGVA 4Z2HA 4MNLA 1H0IA 3O5LA 4KR0B 1Q1CA 4MNKA 1EIBA 3M7NA 1FKSA 1XHGA 2QF8A 3G6LA 4DRPA 1FKFA 1BL4A 4P8WA 2Y78A 4Z2KA 3WD2A 4UDMA 4XAKA 4DWSA 1JMQA 1D7HA 3RM8A 4U85A 2KO7A 2M8IA 1LG2A 2RUQA 4G50A 4L3NA 5HW8A 2YBUA 2N87A 3PA7A 3RM4A 3TDBA 2A3BA 3L4HA 1RD6A 2Y8NB 2XP5A 2YSBA 4GLXA 2DT1A 4WJXA 3FSCA 3ARTA 3WD3A 5HWBA 2G41A 3CGMA 2DSWA 2DG4A 1F8AB 2WAEA 2MLXA 3UI4A 3JYJA 2XP6A 3KACA 4TW7A 1TCOC 3CHFA 3W4RA 3LKXA 2Q5AA 5GQBA 4U86A 1GOIA 1P5QA 2LAJA 4QT2A 3WKZA 1FKHA 3G6MA 4WKFA 4MPKA 1FKLA 3RFWA 1J4RA 1NWUA 1O6WA 4DWSB 4A0TA 3ARRA 2JMFA 4DRHA 3ARVA 1FKKA 4MSPA 1QPLA 2RSEA 1JNEA 5J6EA 1PBKA 2WLZA 4IQ2A 1W1VA 3GPKA 3O5JA 2KXQA 4LGXA 1NMVA 3KAFA 2KFWA 2F4EA 1FKBA 2DSUA 3RMEA 2PBCA 1WMVA 1OGGA 2DG9A 2LKNA 1YW5A 3NTPA 1Y0OA 2P4VA 1E6RA 1VF8A 4URIA 4W5UA 4Q7NA 3O5QA 3IKDA 4WKAA 2LPVA 2YAJB 3B9EA 3ARUA 4O2TA 2XP4A 1K9TA 2A3CA 3NRKA 2RUDA 2YSGA 5I98A 1W1TA 1FLCA 1NWRA 5HWCA 2PV3A 3ARZA 3FXYA 3O5MA 2ZQUA 1EDQA 2KE0A 1HJWA 4JFMA 2OLHA 3CHCA 3RM9A 3BXWA 3ARYA 5HW7A 2F21A 4DRKA 1SYTA 1A7XA 2DMVA 4W9OA 1W9VA 4AY1A 2M2AA 2DT2A 4TNSA 2OWOA 2YBTA 3ALGA 3ODKA 1W1YA 2XP8A 2RQSA 4IQCA 1IX5A 3MCBB 2F23A 1D6OA 3WQVA 4TW8A 2PV2A 3ARQA 1TK7A 2WADA 1KT1A 4W9QA 1LL7A 1JCHB 5DITA 5HBFA 2WLYA 2PN0A 3B9DA 2FDMA 2B5UB 2XPBA 1EYMA 1M5YA 3AS2A 3ARWA 3O5RA 1E44A 2DG3A 5DF0A 5BXJA 1NWTA 4QT3A 4E5RA 4R5EA 1FJDA 2WM0A 3AS0A 3CH9A 4HBEA 4TYOA 2DT0A 1WNOA 1E6NA 1FKTA 2MDIA 4MNJA 1ZCNA 1W9PA 4ML4A 1BKFA 1EHNA 3WIJA 4DWSD 4ODPA 2YSHA 2A3AA 3UI5A 3KABA 5AHTA 1N1AA 1D2KA 1E15A 2DK1A 3IKGA 3EY6A 4P8UA 2PPOA 4JFKA 1WB0A 4REXA 4DWSC 4ZS6A 4NSBA 2ESCA 4MTVA 1ZB5A 4TW6A 2E45A 3KAHA 2VN1A 4ZPTR 2XP3A 2ZQVA 3I6CA 4DH0A 1ZBWA 1ITXA 3GU0A 3WL0A 1XRVA 2EULA 1KT0A 2JZVA 1E9LA 4ODNA 1X6LA 2L2SA 1J4HA 4ODOA 2RE3A 1L1PA 4JFJA 4TX0A 2M1IA 3LE4A 4U84A 1C9HA 2RUCA 5HTGA 1W9UA 4ZPWR 5D75A 3KADA 5CQ2A 4JYSA 1U79A 4MNMA 3WD1A 3M85A 2B31A 2ETNA 5E62A 3AQUA 2PPNA 2UZ5A 2MPHA 1SR0A 3UQIA 1OWQA 3WD4A 2JX8A 4PTMA 1J6YA 3CNGA 1FKIA 3OOBA 1ROUA 3PQHA 4DZ2A 2M8JA 4NZCA 2KI3A 4LAVA 1K9RA 3EIPA 2OFNA 3OA5A 3LKXB 2JV4A 3ARPA 3AS1A 5DEZA 5HKGA 2KR7A 4IT4A 1QPFA 2XPAA 2MLZA 1TR8A 4GGQA 3JYMA 5HT1A 1TFVA 3MQGA 3PRDA 3O5KA 4A0UA 2XP7A 1D7JA 4DRNA 4Z2GA 2ZR6A 4C02B 4DRJA 3UQBA 1LL4A 4Z2JA 2DWVA 2IUZA 3JXVA 5DIUA 3TCZA 1JVWA 3FS8A 1JNDA 3PR9A 5E65A 1JNTA 5HUAA 1LG1A 2MLYA 4BF8A 1B6CA 1CTNA 3ALFA 1GUVA 2G8ZA 1NWSA 1HJXA 3VAWA 3FY1A 4LAXA 5GPGA 4DZ3A 3H9RB 1R9HA 2XP9A 4ODQA 1ROTA 4NNRA 2YSIA 1PINA 1WR7A 1FAPA 1ZK6A 2VCDA 1NH6A 3BMBA 4HBOA 4DROA 4DRMA 1ZBVA 5JH8A 5E64A 1LQ0A 3CHEA 3TC5A 3B8SA 2QRVA 4FN2A 2LJ4A 3WH0A 1FD9A 3KZ7A 1NSGA 2PPPA 1F40A 4Z2IA 2O92A 4P8XA 3MQHA 2EZ5W 1ZBCA 3O5IA 2DJYA 3CZ8A 2WK2A 1UR9A 5DO2A 2MNTA 1I5HW 2YSFA 3O5GA 4S3JA 2BA1A 4L72B 3IK8A 2DPEA 4W9PA 1NMWA 1HKKA 3KCEA 3B9AA 1HKIA 1D7IA 4JFIA 3WL1A 5U47A 1HXVA 1W1PA 1FKRA 2ZQTA 1X6NA 2K8IA 5DIVA 3RGCA 4Z2LA 2M08A 2ITKA 5HW6A 1LL6A 2JXWA 1T11A 3GTYX 1FFRA 3CHDA 3UQAA 1GRJA 4KQZA 2IF4A
chains in the Genus database with same CATH topology
3ARSA 3LUOA 4LAYA 4ZPVR 1LJYA 2DSVA 2DK7A 4IT6A 2PV1A 2DSZA 2A3EA 4WKHA 4J4NA 1W26A 4ITZA 1GPFA 3O5PA 2PI6A 2O9OA 5E5WA 4IPXA 3UF8A 4DIPA 1ZU8A 1EG3A 3B7XA 1FKDA 1FKJA 5B8IC 4ODRA 2ZQSA 3UI6A 1EQ3A 1UR8A 1ZL1A 1FFQA 5E66A 2FAPA 4FAPA 1HKJA 3FSBA 1Q6IA 2AWGA 3MCBA 4Q22A 2D9FA 4DRQA 1QZ2A 4N19A 3AS3A 1YATA 3IHZA 1EG4A 4ODMA 4JFLA 3NI6A 1E6ZA 1E6PA 1ZBKA 3QOKA 4G2PA 3WD0A 4DT4A 1KFWA 2DT3A 2F2DA 1J4IA 2FKEA 3AROA 2KGJA 1OGBA 1O6IA 1K9QA 3PRBA 3WQWA 3FAPA 4R0XA 4S3KA 1H0GA 4HARA 1FKGA 3MDYB 5GPRA 2M3OW 4QZVB 3CGNA 4QIBA 3O5OA 2ZAJA 2RURA 3PRAA 3O5EA 3KAIA 4P8VA 4J4OA 3O5FA 4GIVA 1HKMA 1RP5A 1Q6HA 4WK9A 4ODKA 1Q6UA 2ZR5A 3O5DA 4MAVA 3KAGA 1JNSA 1HJVA 2ZR4A 2L4JA 4WIWA 2LGOA 1WAWA 2AOSA 4ODLA 4LAWA 4DRIA 3ARXA 2MF9A 4MGVA 4Z2HA 4MNLA 1H0IA 3O5LA 4KR0B 1Q1CA 4MNKA 1EIBA 3M7NA 1FKSA 1XHGA 2QF8A 3G6LA 4DRPA 1FKFA 1BL4A 4P8WA 2Y78A 4Z2KA 3WD2A 4XAKA 4DWSA 1JMQA 1D7HA 3RM8A 4U85A 2KO7A 2M8IA 1LG2A 2RUQA 4G50A 4L3NA 5HW8A 2YBUA 2N87A 3PA7A 3RM4A 3TDBA 2A3BA 3L4HA 1RD6A 2Y8NB 2XP5A 2YSBA 4GLXA 2DT1A 4WJXA 3FSCA 3ARTA 3WD3A 5HWBA 2G41A 3CGMA 2DSWA 2DG4A 1F8AB 2WAEA 2MLXA 3UI4A 3JYJA 2XP6A 3KACA 4TW7A 1TCOC 3CHFA 3W4RA 3LKXA 2Q5AA 5GQBA 4U86A 1GOIA 1P5QA 2LAJA 4QT2A 3WKZA 1FKHA 3G6MA 4WKFA 4MPKA 1FKLA 3RFWA 1J4RA 1NWUA 1O6WA 4DWSB 4A0TA 3ARRA 2JMFA 4DRHA 3ARVA 1FKKA 4MSPA 1QPLA 2RSEA 1JNEA 5J6EA 1PBKA 2WLZA 4IQ2A 1W1VA 3GPKA 3O5JA 2KXQA 4LGXA 1NMVA 3KAFA 2KFWA 2F4EA 1FKBA 2DSUA 3RMEA 2PBCA 1WMVA 1OGGA 2DG9A 2LKNA 1YW5A 3NTPA 1Y0OA 1E6RA 1VF8A 4URIA 4W5UA 4Q7NA 3O5QA 3IKDA 4WKAA 2LPVA 2YAJB 3B9EA 3ARUA 4O2TA 2XP4A 1K9TA 2A3CA 3NRKA 2RUDA 2YSGA 5I98A 1W1TA 1FLCA 1NWRA 5HWCA 2PV3A 3ARZA 3FXYA 3O5MA 2ZQUA 1EDQA 2KE0A 1HJWA 4JFMA 2OLHA 3CHCA 3RM9A 3BXWA 3ARYA 5HW7A 2F21A 4DRKA 1SYTA 1A7XA 2DMVA 4W9OA 1W9VA 4AY1A 2M2AA 2DT2A 4TNSA 2OWOA 2YBTA 3ALGA 3ODKA 1W1YA 2XP8A 2RQSA 4IQCA 1IX5A 3MCBB 1D6OA 3WQVA 4TW8A 2PV2A 3ARQA 1TK7A 2WADA 1KT1A 4W9QA 1LL7A 5DITA 5HBFA 2WLYA 3B9DA 2FDMA 2XPBA 1EYMA 1M5YA 3AS2A 3ARWA 3O5RA 2DG3A 5DF0A 5BXJA 1NWTA 4QT3A 4E5RA 4R5EA 1FJDA 2WM0A 3AS0A 3CH9A 4HBEA 4TYOA 2DT0A 1WNOA 1E6NA 1FKTA 2MDIA 4MNJA 1ZCNA 1W9PA 4ML4A 1BKFA 1EHNA 3WIJA 4DWSD 4ODPA 2YSHA 2A3AA 3UI5A 3KABA 5AHTA 1N1AA 1D2KA 1E15A 2DK1A 3IKGA 3EY6A 4P8UA 2PPOA 4JFKA 1WB0A 4REXA 4DWSC 4ZS6A 4NSBA 2ESCA 4MTVA 1ZB5A 4TW6A 2E45A 3KAHA 2VN1A 4ZPTR 2XP3A 2ZQVA 3I6CA 4DH0A 1ZBWA 1ITXA 3WL0A 1XRVA 1KT0A 2JZVA 1E9LA 4ODNA 1X6LA 2L2SA 1J4HA 4ODOA 2RE3A 1L1PA 4JFJA 4TX0A 2M1IA 3LE4A 4U84A 1C9HA 2RUCA 5HTGA 1W9UA 4ZPWR 5D75A 3KADA 5CQ2A 4JYSA 1U79A 4MNMA 3WD1A 3M85A 2B31A 5E62A 3AQUA 2PPNA 2UZ5A 2MPHA 1SR0A 3UQIA 1OWQA 3WD4A 2JX8A 4PTMA 1J6YA 3CNGA 1FKIA 3OOBA 1ROUA 3PQHA 4DZ2A 2M8JA 4NZCA 2KI3A 4LAVA 1K9RA 2OFNA 3OA5A 3LKXB 2JV4A 3ARPA 3AS1A 5DEZA 5HKGA 2KR7A 4IT4A 1QPFA 2XPAA 2MLZA 1TR8A 4GGQA 3JYMA 5HT1A 1TFVA 3MQGA 3PRDA 3O5KA 4A0UA 2XP7A 1D7JA 4DRNA 4Z2GA 2ZR6A 4C02B 4DRJA 3UQBA 1LL4A 4Z2JA 2DWVA 2IUZA 3JXVA 5DIUA 3TCZA 1JVWA 3FS8A 1JNDA 3PR9A 5E65A 1JNTA 5HUAA 1LG1A 2MLYA 4BF8A 1B6CA 1CTNA 3ALFA 1GUVA 2G8ZA 1NWSA 1HJXA 3VAWA 3FY1A 4LAXA 5GPGA 4DZ3A 3H9RB 1R9HA 2XP9A 4ODQA 1ROTA 4NNRA 2YSIA 1PINA 1WR7A 1FAPA 1ZK6A 2VCDA 1NH6A 4HBOA 4DROA 4DRMA 1ZBVA 5JH8A 5E64A 1LQ0A 3CHEA 3TC5A 3B8SA 2QRVA 4FN2A 2LJ4A 3WH0A 1FD9A 3KZ7A 1NSGA 2PPPA 1F40A 4Z2IA 2O92A 4P8XA 3MQHA 2EZ5W 1ZBCA 3O5IA 2DJYA 3CZ8A 2WK2A 1UR9A 5DO2A 2MNTA 1I5HW 2YSFA 3O5GA 4S3JA 2BA1A 4L72B 3IK8A 2DPEA 4W9PA 1NMWA 1HKKA 3KCEA 3B9AA 1HKIA 1D7IA 4JFIA 3WL1A 5U47A 1HXVA 1W1PA 1FKRA 2ZQTA 1X6NA 2K8IA 5DIVA 3RGCA 4Z2LA 2M08A 2ITKA 5HW6A 1LL6A 2JXWA 1T11A 1FFRA 3CHDA 3UQAA 4KQZA 2IF4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LUO A;  4LAY A;  2DK7 A;  2PV1 A;  4J4N A;  1W26 A;  4ITZ A;  3O5P A;  4IPX A;  3UF8 A;  4DIP A;  1EG3 A;  3B7X A;  1FKD A;  1FKJ A;  5B8I C;  4ODR A;  2ZQS A;  3UI6 A;  1EQ3 A;  2FAP A;  4FAP A;  1Q6I A;  2AWG A;  2D9F A;  4DRQ A;  1QZ2 A;  4N19 A;  1YAT A;  3IHZ A;  1EG4 A;  4ODM A;  4JFL A;  3NI6 A;  4DT4 A;  4G2P A;  2F2D A;  1J4I A;  2FKE A;  2KGJ A;  1K9Q A;  3PRB A;  3FAP A;  4R0X A;  1FKG A;  3MDY B;  2M3O W;  3CGN A;  4QIB A;  3O5O A;  2ZAJ A;  2RUR A;  3O5E A;  3KAI A;  4J4O A;  3O5F A;  4GIV A;  1Q6H A;  4ODK A;  1Q6U A;  2ZR5 A;  3O5D A;  3KAG A;  1JNS A;  2ZR4 A;  2L4J A;  2LGO A;  4ODL A;  4LAW A;  4DRI A;  2MF9 A;  4MGV A;  3O5L A;  1Q1C A;  3M7N A;  1FKS A;  4DRP A;  1FKF A;  1BL4 A;  2Y78 A;  1JMQ A;  1D7H A;  4U85 A;  2KO7 A;  2M8I A;  2RUQ A;  4G50 A;  5HW8 A;  2N87 A;  3PA7 A;  3TDB A;  3L4H A;  2XP5 A;  2YSB A;  5HWB A;  3CGM A;  2DG4 A;  1F8A B;  2MLX A;  3UI4 A;  3JYJ A;  2XP6 A;  3KAC A;  4TW7 A;  1TCO C;  2Q5A A;  4U86 A;  1P5Q A;  2LAJ A;  4QT2 A;  1FKH A;  3RFW A;  1FKL A;  1J4R A;  1O6W A;  2JMF A;  4DRH A;  1FKK A;  4MSP A;  1QPL A;  2RSE A;  5J6E A;  1PBK A;  4IQ2 A;  3GPK A;  3O5J A;  2KXQ A;  1NMV A;  3KAF A;  2KFW A;  2F4E A;  1FKB A;  2PBC A;  1WMV A;  2DG9 A;  2LKN A;  1YW5 A;  3NTP A;  1Y0O A;  3O5Q A;  3IKD A;  2LPV A;  4O2T A;  2XP4 A;  3NRK A;  2RUD A;  2YSG A;  5I98 A;  5HWC A;  2PV3 A;  3O5M A;  2ZQU A;  2KE0 A;  4JFM A;  5HW7 A;  2F21 A;  4DRK A;  1A7X A;  2DMV A;  4W9O A;  2M2A A;  4TNS A;  4IQC A;  3ODK A;  2XP8 A;  2RQS A;  1D6O A;  4TW8 A;  2PV2 A;  1TK7 A;  1KT1 A;  4W9Q A;  5DIT A;  2XPB A;  1EYM A;  1M5Y A;  3O5R A;  2DG3 A;  5BXJ A;  4QT3 A;  4E5R A;  1FJD A;  4TYO A;  1FKT A;  2MDI A;  1ZCN A;  1BKF A;  4ODP A;  2YSH A;  3UI5 A;  3KAB A;  5AHT A;  1N1A A;  2DK1 A;  3IKG A;  3EY6 A;  2PPO A;  4JFK A;  4REX A;  4TW6 A;  2E45 A;  3KAH A;  2VN1 A;  2XP3 A;  2ZQV A;  3I6C A;  4DH0 A;  1KT0 A;  2JZV A;  4ODN A;  2L2S A;  1J4H A;  4ODO A;  2RE3 A;  1L1P A;  4JFJ A;  4TX0 A;  2M1I A;  3LE4 A;  4U84 A;  1C9H A;  2RUC A;  5HTG A;  5D75 A;  3KAD A;  5CQ2 A;  4JYS A;  1U79 A;  3M85 A;  2PPN A;  2UZ5 A;  2MPH A;  3UQI A;  2JX8 A;  1J6Y A;  3CNG A;  1FKI A;  3OOB A;  1ROU A;  4DZ2 A;  2M8J A;  2KI3 A;  4LAV A;  1K9R A;  2OFN A;  2JV4 A;  5HKG A;  2KR7 A;  1QPF A;  2XPA A;  2MLZ A;  4GGQ A;  3JYM A;  5HT1 A;  3PRD A;  3O5K A;  2XP7 A;  1D7J A;  4DRN A;  2ZR6 A;  4C02 B;  4DRJ A;  3UQB A;  2DWV A;  3JXV A;  5DIU A;  3TCZ A;  1JVW A;  1JNT A;  5HUA A;  2MLY A;  4BF8 A;  1B6C A;  3VAW A;  4LAX A;  5GPG A;  4DZ3 A;  3H9R B;  1R9H A;  2XP9 A;  4ODQ A;  1ROT A;  4NNR A;  2YSI A;  1PIN A;  1WR7 A;  1FAP A;  1ZK6 A;  2VCD A;  4DRO A;  4DRM A;  3TC5 A;  4FN2 A;  2LJ4 A;  3WH0 A;  1FD9 A;  3KZ7 A;  1NSG A;  2PPP A;  1F40 A;  2EZ5 W;  3O5I A;  2DJY A;  2MNT A;  1I5H W;  2YSF A;  3O5G A;  2BA1 A;  3IK8 A;  4W9P A;  1NMW A;  3KCE A;  1D7I A;  4JFI A;  1HXV A;  1FKR A;  2ZQT A;  2K8I A;  5DIV A;  3RGC A;  2M08 A;  2ITK A;  5HW6 A;  2JXW A;  1T11 A;  3UQA A;  2IF4 A; 
#chains in the Genus database with same CATH topology
 3ARS A;  3LUO A;  4LAY A;  4ZPV R;  1LJY A;  2DSV A;  2DK7 A;  4IT6 A;  2PV1 A;  2DSZ A;  2A3E A;  4WKH A;  4J4N A;  1W26 A;  4ITZ A;  1GPF A;  3O5P A;  2PI6 A;  2O9O A;  5E5W A;  4IPX A;  3UF8 A;  4DIP A;  1ZU8 A;  1EG3 A;  3B7X A;  1FKD A;  1FKJ A;  5B8I C;  4ODR A;  2ZQS A;  3UI6 A;  1EQ3 A;  1UR8 A;  1ZL1 A;  1FFQ A;  5E66 A;  2FAP A;  4FAP A;  1HKJ A;  3FSB A;  1Q6I A;  2AWG A;  3MCB A;  4Q22 A;  2D9F A;  4DRQ A;  1QZ2 A;  4N19 A;  3AS3 A;  1YAT A;  3IHZ A;  1EG4 A;  4ODM A;  4JFL A;  3NI6 A;  1E6Z A;  1E6P A;  1ZBK A;  3QOK A;  4G2P A;  3WD0 A;  4DT4 A;  1KFW A;  2DT3 A;  2F2D A;  1J4I A;  2FKE A;  3ARO A;  2KGJ A;  1OGB A;  1O6I A;  1K9Q A;  3PRB A;  3WQW A;  3FAP A;  4R0X A;  4S3K A;  1H0G A;  4HAR A;  1FKG A;  3MDY B;  5GPR A;  2M3O W;  4QZV B;  3CGN A;  4QIB A;  3O5O A;  2ZAJ A;  2RUR A;  3PRA A;  3O5E A;  3KAI A;  4P8V A;  4J4O A;  3O5F A;  4GIV A;  1HKM A;  1RP5 A;  1Q6H A;  4WK9 A;  4ODK A;  1Q6U A;  2ZR5 A;  3O5D A;  4MAV A;  3KAG A;  1JNS A;  1HJV A;  2ZR4 A;  2L4J A;  4WIW A;  2LGO A;  1WAW A;  2AOS A;  4ODL A;  4LAW A;  4DRI A;  3ARX A;  2MF9 A;  4MGV A;  4Z2H A;  4MNL A;  1H0I A;  3O5L A;  4KR0 B;  1Q1C A;  4MNK A;  1EIB A;  3M7N A;  1FKS A;  1XHG A;  2QF8 A;  3G6L A;  4DRP A;  1FKF A;  1BL4 A;  4P8W A;  2Y78 A;  4Z2K A;  3WD2 A;  4UDM A;  4XAK A;  4DWS A;  1JMQ A;  1D7H A;  3RM8 A;  4U85 A;  2KO7 A;  2M8I A;  1LG2 A;  2RUQ A;  4G50 A;  4L3N A;  5HW8 A;  2YBU A;  2N87 A;  3PA7 A;  3RM4 A;  3TDB A;  2A3B A;  3L4H A;  1RD6 A;  2Y8N B;  2XP5 A;  2YSB A;  4GLX A;  2DT1 A;  4WJX A;  3FSC A;  3ART A;  3WD3 A;  5HWB A;  2G41 A;  3CGM A;  2DSW A;  2DG4 A;  1F8A B;  2WAE A;  2MLX A;  3UI4 A;  3JYJ A;  2XP6 A;  3KAC A;  4TW7 A;  1TCO C;  3CHF A;  3W4R A;  3LKX A;  2Q5A A;  5GQB A;  4U86 A;  1GOI A;  1P5Q A;  2LAJ A;  4QT2 A;  3WKZ A;  1FKH A;  3G6M A;  4WKF A;  4MPK A;  1FKL A;  3RFW A;  1J4R A;  1NWU A;  1O6W A;  4DWS B;  4A0T A;  3ARR A;  2JMF A;  4DRH A;  3ARV A;  1FKK A;  4MSP A;  1QPL A;  2RSE A;  1JNE A;  5J6E A;  1PBK A;  2WLZ A;  4IQ2 A;  1W1V A;  3GPK A;  3O5J A;  2KXQ A;  4LGX A;  1NMV A;  3KAF A;  2KFW A;  2F4E A;  1FKB A;  2DSU A;  3RME A;  2PBC A;  1WMV A;  1OGG A;  2DG9 A;  2LKN A;  1YW5 A;  3NTP A;  1Y0O A;  2P4V A;  1E6R A;  1VF8 A;  4URI A;  4W5U A;  4Q7N A;  3O5Q A;  3IKD A;  4WKA A;  2LPV A;  2YAJ B;  3B9E A;  3ARU A;  4O2T A;  2XP4 A;  1K9T A;  2A3C A;  3NRK A;  2RUD A;  2YSG A;  5I98 A;  1W1T A;  1FLC A;  1NWR A;  5HWC A;  2PV3 A;  3ARZ A;  3FXY A;  3O5M A;  2ZQU A;  1EDQ A;  2KE0 A;  1HJW A;  4JFM A;  2OLH A;  3CHC A;  3RM9 A;  3BXW A;  3ARY A;  5HW7 A;  2F21 A;  4DRK A;  1SYT A;  1A7X A;  2DMV A;  4W9O A;  1W9V A;  4AY1 A;  2M2A A;  2DT2 A;  4TNS A;  2OWO A;  2YBT A;  3ALG A;  3ODK A;  1W1Y A;  2XP8 A;  2RQS A;  4IQC A;  1IX5 A;  3MCB B;  2F23 A;  1D6O A;  3WQV A;  4TW8 A;  2PV2 A;  3ARQ A;  1TK7 A;  2WAD A;  1KT1 A;  4W9Q A;  1LL7 A;  1JCH B;  5DIT A;  5HBF A;  2WLY A;  2PN0 A;  3B9D A;  2FDM A;  2B5U B;  2XPB A;  1EYM A;  1M5Y A;  3AS2 A;  3ARW A;  3O5R A;  1E44 A;  2DG3 A;  5DF0 A;  5BXJ A;  1NWT A;  4QT3 A;  4E5R A;  4R5E A;  1FJD A;  2WM0 A;  3AS0 A;  3CH9 A;  4HBE A;  4TYO A;  2DT0 A;  1WNO A;  1E6N A;  1FKT A;  2MDI A;  4MNJ A;  1ZCN A;  1W9P A;  4ML4 A;  1BKF A;  1EHN A;  3WIJ A;  4DWS D;  4ODP A;  2YSH A;  2A3A A;  3UI5 A;  3KAB A;  5AHT A;  1N1A A;  1D2K A;  1E15 A;  2DK1 A;  3IKG A;  3EY6 A;  4P8U A;  2PPO A;  4JFK A;  1WB0 A;  4REX A;  4DWS C;  4ZS6 A;  4NSB A;  2ESC A;  4MTV A;  1ZB5 A;  4TW6 A;  2E45 A;  3KAH A;  2VN1 A;  4ZPT R;  2XP3 A;  2ZQV A;  3I6C A;  4DH0 A;  1ZBW A;  1ITX A;  3GU0 A;  3WL0 A;  1XRV A;  2EUL A;  1KT0 A;  2JZV A;  1E9L A;  4ODN A;  1X6L A;  2L2S A;  1J4H A;  4ODO A;  2RE3 A;  1L1P A;  4JFJ A;  4TX0 A;  2M1I A;  3LE4 A;  4U84 A;  1C9H A;  2RUC A;  5HTG A;  1W9U A;  4ZPW R;  5D75 A;  3KAD A;  5CQ2 A;  4JYS A;  1U79 A;  4MNM A;  3WD1 A;  3M85 A;  2B31 A;  2ETN A;  5E62 A;  3AQU A;  2PPN A;  2UZ5 A;  2MPH A;  1SR0 A;  3UQI A;  1OWQ A;  3WD4 A;  2JX8 A;  4PTM A;  1J6Y A;  3CNG A;  1FKI A;  3OOB A;  1ROU A;  3PQH A;  4DZ2 A;  2M8J A;  4NZC A;  2KI3 A;  4LAV A;  1K9R A;  3EIP A;  2OFN A;  3OA5 A;  3LKX B;  2JV4 A;  3ARP A;  3AS1 A;  5DEZ A;  5HKG A;  2KR7 A;  4IT4 A;  1QPF A;  2XPA A;  2MLZ A;  1TR8 A;  4GGQ A;  3JYM A;  5HT1 A;  1TFV A;  3MQG A;  3PRD A;  3O5K A;  4A0U A;  2XP7 A;  1D7J A;  4DRN A;  4Z2G A;  2ZR6 A;  4C02 B;  4DRJ A;  3UQB A;  1LL4 A;  4Z2J A;  2DWV A;  2IUZ A;  3JXV A;  5DIU A;  3TCZ A;  1JVW A;  3FS8 A;  1JND A;  3PR9 A;  5E65 A;  1JNT A;  5HUA A;  1LG1 A;  2MLY A;  4BF8 A;  1B6C A;  1CTN A;  3ALF A;  1GUV A;  2G8Z A;  1NWS A;  1HJX A;  3VAW A;  3FY1 A;  4LAX A;  5GPG A;  4DZ3 A;  3H9R B;  1R9H A;  2XP9 A;  4ODQ A;  1ROT A;  4NNR A;  2YSI A;  1PIN A;  1WR7 A;  1FAP A;  1ZK6 A;  2VCD A;  1NH6 A;  3BMB A;  4HBO A;  4DRO A;  4DRM A;  1ZBV A;  5JH8 A;  5E64 A;  1LQ0 A;  3CHE A;  3TC5 A;  3B8S A;  2QRV A;  4FN2 A;  2LJ4 A;  3WH0 A;  1FD9 A;  3KZ7 A;  1NSG A;  2PPP A;  1F40 A;  4Z2I A;  2O92 A;  4P8X A;  3MQH A;  2EZ5 W;  1ZBC A;  3O5I A;  2DJY A;  3CZ8 A;  2WK2 A;  1UR9 A;  5DO2 A;  2MNT A;  1I5H W;  2YSF A;  3O5G A;  4S3J A;  2BA1 A;  4L72 B;  3IK8 A;  2DPE A;  4W9P A;  1NMW A;  1HKK A;  3KCE A;  3B9A A;  1HKI A;  1D7I A;  4JFI A;  3WL1 A;  5U47 A;  1HXV A;  1W1P A;  1FKR A;  2ZQT A;  1X6N A;  2K8I A;  5DIV A;  3RGC A;  4Z2L A;  2M08 A;  2ITK A;  5HW6 A;  1LL6 A;  2JXW A;  1T11 A;  3GTY X;  1FFR A;  3CHD A;  3UQA A;  1GRJ A;  4KQZ A;  2IF4 A; 
#chains in the Genus database with same CATH homology
 3ARS A;  3LUO A;  4LAY A;  4ZPV R;  1LJY A;  2DSV A;  2DK7 A;  4IT6 A;  2PV1 A;  2DSZ A;  2A3E A;  4WKH A;  4J4N A;  1W26 A;  4ITZ A;  1GPF A;  3O5P A;  2PI6 A;  2O9O A;  5E5W A;  4IPX A;  3UF8 A;  4DIP A;  1ZU8 A;  1EG3 A;  3B7X A;  1FKD A;  1FKJ A;  5B8I C;  4ODR A;  2ZQS A;  3UI6 A;  1EQ3 A;  1UR8 A;  1ZL1 A;  1FFQ A;  5E66 A;  2FAP A;  4FAP A;  1HKJ A;  3FSB A;  1Q6I A;  2AWG A;  3MCB A;  4Q22 A;  2D9F A;  4DRQ A;  1QZ2 A;  4N19 A;  3AS3 A;  1YAT A;  3IHZ A;  1EG4 A;  4ODM A;  4JFL A;  3NI6 A;  1E6Z A;  1E6P A;  1ZBK A;  3QOK A;  4G2P A;  3WD0 A;  4DT4 A;  1KFW A;  2DT3 A;  2F2D A;  1J4I A;  2FKE A;  3ARO A;  2KGJ A;  1OGB A;  1O6I A;  1K9Q A;  3PRB A;  3WQW A;  3FAP A;  4R0X A;  4S3K A;  1H0G A;  4HAR A;  1FKG A;  3MDY B;  5GPR A;  2M3O W;  4QZV B;  3CGN A;  4QIB A;  3O5O A;  2ZAJ A;  2RUR A;  3PRA A;  3O5E A;  3KAI A;  4P8V A;  4J4O A;  3O5F A;  4GIV A;  1HKM A;  1RP5 A;  1Q6H A;  4WK9 A;  4ODK A;  1Q6U A;  2ZR5 A;  3O5D A;  4MAV A;  3KAG A;  1JNS A;  1HJV A;  2ZR4 A;  2L4J A;  4WIW A;  2LGO A;  1WAW A;  2AOS A;  4ODL A;  4LAW A;  4DRI A;  3ARX A;  2MF9 A;  4MGV A;  4Z2H A;  4MNL A;  1H0I A;  3O5L A;  4KR0 B;  1Q1C A;  4MNK A;  1EIB A;  3M7N A;  1FKS A;  1XHG A;  2QF8 A;  3G6L A;  4DRP A;  1FKF A;  1BL4 A;  4P8W A;  2Y78 A;  4Z2K A;  3WD2 A;  4XAK A;  4DWS A;  1JMQ A;  1D7H A;  3RM8 A;  4U85 A;  2KO7 A;  2M8I A;  1LG2 A;  2RUQ A;  4G50 A;  4L3N A;  5HW8 A;  2YBU A;  2N87 A;  3PA7 A;  3RM4 A;  3TDB A;  2A3B A;  3L4H A;  1RD6 A;  2Y8N B;  2XP5 A;  2YSB A;  4GLX A;  2DT1 A;  4WJX A;  3FSC A;  3ART A;  3WD3 A;  5HWB A;  2G41 A;  3CGM A;  2DSW A;  2DG4 A;  1F8A B;  2WAE A;  2MLX A;  3UI4 A;  3JYJ A;  2XP6 A;  3KAC A;  4TW7 A;  1TCO C;  3CHF A;  3W4R A;  3LKX A;  2Q5A A;  5GQB A;  4U86 A;  1GOI A;  1P5Q A;  2LAJ A;  4QT2 A;  3WKZ A;  1FKH A;  3G6M A;  4WKF A;  4MPK A;  1FKL A;  3RFW A;  1J4R A;  1NWU A;  1O6W A;  4DWS B;  4A0T A;  3ARR A;  2JMF A;  4DRH A;  3ARV A;  1FKK A;  4MSP A;  1QPL A;  2RSE A;  1JNE A;  5J6E A;  1PBK A;  2WLZ A;  4IQ2 A;  1W1V A;  3GPK A;  3O5J A;  2KXQ A;  4LGX A;  1NMV A;  3KAF A;  2KFW A;  2F4E A;  1FKB A;  2DSU A;  3RME A;  2PBC A;  1WMV A;  1OGG A;  2DG9 A;  2LKN A;  1YW5 A;  3NTP A;  1Y0O A;  1E6R A;  1VF8 A;  4URI A;  4W5U A;  4Q7N A;  3O5Q A;  3IKD A;  4WKA A;  2LPV A;  2YAJ B;  3B9E A;  3ARU A;  4O2T A;  2XP4 A;  1K9T A;  2A3C A;  3NRK A;  2RUD A;  2YSG A;  5I98 A;  1W1T A;  1FLC A;  1NWR A;  5HWC A;  2PV3 A;  3ARZ A;  3FXY A;  3O5M A;  2ZQU A;  1EDQ A;  2KE0 A;  1HJW A;  4JFM A;  2OLH A;  3CHC A;  3RM9 A;  3BXW A;  3ARY A;  5HW7 A;  2F21 A;  4DRK A;  1SYT A;  1A7X A;  2DMV A;  4W9O A;  1W9V A;  4AY1 A;  2M2A A;  2DT2 A;  4TNS A;  2OWO A;  2YBT A;  3ALG A;  3ODK A;  1W1Y A;  2XP8 A;  2RQS A;  4IQC A;  1IX5 A;  3MCB B;  1D6O A;  3WQV A;  4TW8 A;  2PV2 A;  3ARQ A;  1TK7 A;  2WAD A;  1KT1 A;  4W9Q A;  1LL7 A;  5DIT A;  5HBF A;  2WLY A;  3B9D A;  2FDM A;  2XPB A;  1EYM A;  1M5Y A;  3AS2 A;  3ARW A;  3O5R A;  2DG3 A;  5DF0 A;  5BXJ A;  1NWT A;  4QT3 A;  4E5R A;  4R5E A;  1FJD A;  2WM0 A;  3AS0 A;  3CH9 A;  4HBE A;  4TYO A;  2DT0 A;  1WNO A;  1E6N A;  1FKT A;  2MDI A;  4MNJ A;  1ZCN A;  1W9P A;  4ML4 A;  1BKF A;  1EHN A;  3WIJ A;  4DWS D;  4ODP A;  2YSH A;  2A3A A;  3UI5 A;  3KAB A;  5AHT A;  1N1A A;  1D2K A;  1E15 A;  2DK1 A;  3IKG A;  3EY6 A;  4P8U A;  2PPO A;  4JFK A;  1WB0 A;  4REX A;  4DWS C;  4ZS6 A;  4NSB A;  2ESC A;  4MTV A;  1ZB5 A;  4TW6 A;  2E45 A;  3KAH A;  2VN1 A;  4ZPT R;  2XP3 A;  2ZQV A;  3I6C A;  4DH0 A;  1ZBW A;  1ITX A;  3WL0 A;  1XRV A;  1KT0 A;  2JZV A;  1E9L A;  4ODN A;  1X6L A;  2L2S A;  1J4H A;  4ODO A;  2RE3 A;  1L1P A;  4JFJ A;  4TX0 A;  2M1I A;  3LE4 A;  4U84 A;  1C9H A;  2RUC A;  5HTG A;  1W9U A;  4ZPW R;  5D75 A;  3KAD A;  5CQ2 A;  4JYS A;  1U79 A;  4MNM A;  3WD1 A;  3M85 A;  2B31 A;  5E62 A;  3AQU A;  2PPN A;  2UZ5 A;  2MPH A;  1SR0 A;  3UQI A;  1OWQ A;  3WD4 A;  2JX8 A;  4PTM A;  1J6Y A;  3CNG A;  1FKI A;  3OOB A;  1ROU A;  3PQH A;  4DZ2 A;  2M8J A;  4NZC A;  2KI3 A;  4LAV A;  1K9R A;  2OFN A;  3OA5 A;  3LKX B;  2JV4 A;  3ARP A;  3AS1 A;  5DEZ A;  5HKG A;  2KR7 A;  4IT4 A;  1QPF A;  2XPA A;  2MLZ A;  1TR8 A;  4GGQ A;  3JYM A;  5HT1 A;  1TFV A;  3MQG A;  3PRD A;  3O5K A;  4A0U A;  2XP7 A;  1D7J A;  4DRN A;  4Z2G A;  2ZR6 A;  4C02 B;  4DRJ A;  3UQB A;  1LL4 A;  4Z2J A;  2DWV A;  2IUZ A;  3JXV A;  5DIU A;  3TCZ A;  1JVW A;  3FS8 A;  1JND A;  3PR9 A;  5E65 A;  1JNT A;  5HUA A;  1LG1 A;  2MLY A;  4BF8 A;  1B6C A;  1CTN A;  3ALF A;  1GUV A;  2G8Z A;  1NWS A;  1HJX A;  3VAW A;  3FY1 A;  4LAX A;  5GPG A;  4DZ3 A;  3H9R B;  1R9H A;  2XP9 A;  4ODQ A;  1ROT A;  4NNR A;  2YSI A;  1PIN A;  1WR7 A;  1FAP A;  1ZK6 A;  2VCD A;  1NH6 A;  4HBO A;  4DRO A;  4DRM A;  1ZBV A;  5JH8 A;  5E64 A;  1LQ0 A;  3CHE A;  3TC5 A;  3B8S A;  2QRV A;  4FN2 A;  2LJ4 A;  3WH0 A;  1FD9 A;  3KZ7 A;  1NSG A;  2PPP A;  1F40 A;  4Z2I A;  2O92 A;  4P8X A;  3MQH A;  2EZ5 W;  1ZBC A;  3O5I A;  2DJY A;  3CZ8 A;  2WK2 A;  1UR9 A;  5DO2 A;  2MNT A;  1I5H W;  2YSF A;  3O5G A;  4S3J A;  2BA1 A;  4L72 B;  3IK8 A;  2DPE A;  4W9P A;  1NMW A;  1HKK A;  3KCE A;  3B9A A;  1HKI A;  1D7I A;  4JFI A;  3WL1 A;  5U47 A;  1HXV A;  1W1P A;  1FKR A;  2ZQT A;  1X6N A;  2K8I A;  5DIV A;  3RGC A;  4Z2L A;  2M08 A;  2ITK A;  5HW6 A;  1LL6 A;  2JXW A;  1T11 A;  1FFR A;  3CHD A;  3UQA A;  4KQZ A;  2IF4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...