2XPAA

Discovery of cell-active phenyl-imidazole pin1 inhibitors by structure-guided fragment evolution
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
157
structure length
146
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords PEPTIDYL-PROLYL CIS-TRANS ISOMERASE NIMA-INTERACTING 1
publication title Discovery of Cell-Active Phenyl-Imidazole Pin1 Inhibitors by Structure-Guided Fragment Evolution.
pubmed doi rcsb
source organism Homo sapiens
total genus 47
structure length 146
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2xpaA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2xpaA02
4DRMA 4LAVA 1ZCNA 2YSGA 4DRHA 3O5JA 4LAXA 3PRBA 2XP3A 4DH0A 4ODKA 1Q6HA 1K9QA 4G50A 1U79A 4ODMA 1W26A 2L2SA 3JXVA 2JX8A 1FKGA 2MLYA 2VCDA 2ZQSA 4GGQA 4ODPA 2XP4A 1R9HA 1TCOC 5J6EA 4GIVA 1PINA 3IKGA 1D6OA 1FKLA 3TC5A 3GPKA 3O5OA 5HWBA 2DG4A 4JYSA 2XPAA 2RQSA 3WH0A 4MGVA 4QT2A 2MDIA 2IF4A 2F21A 5HW8A 1ROTA 4QIBA 4J4OA 3O5EA 2XPBA 4IQCA 2YSIA 5CQ2A 4DRJA 1Y0OA 1YATA 2PV2A 4W9OA 3UQIA 3UI4A 1J4RA 5HWCA 1BL4A 2LJ4A 4FN2A 3KAGA 2RURA 3O5GA 1KT0A 1P5QA 1D7HA 2RE3A 4QT3A 2MF9A 1NMWA 2PPOA 2DG3A 1T11A 4JFLA 1FKJA 2Q5AA 3LE4A 1WR7A 2XP9A 2LGOA 1M5YA 4IQ2A 2DJYA 2F2DA 2MLXA 2M3OW 1FKBA 1I5HW 4DZ3A 2M08A 1PBKA 2ZR6A 3KZ7A 2D9FA 2LKNA 3PA7A 3LUOA 2KE0A 1FKIA 1FKTA 2RUDA 4JFMA 4DIPA 1FKKA 4ITZA 4ODOA 2XP6A 2DK7A 2JMFA 1B6CA 3FAPA 4TW8A 4LAYA 3UI5A 3KCEA 1FD9A 2DMVA 5HKGA 2M8IA 1C9HA 2LPVA 1N1AA 4ODQA 4DROA 4U85A 2RUQA 1FKRA 2YSBA 2XP8A 1F40A 1D7JA 4JFJA 5BXJA 1TK7A 1JNTA 3O5LA 1FJDA 2ZAJA 3MDYB 4DRQA 1HXVA 4G2PA 3NRKA 2MNTA 1D7IA 3CGMA 2VN1A 2EZ5W 2JXWA 1ZK6A 1BKFA 2KXQA 4IPXA 1JVWA 3PRDA 1QZ2A 3KAIA 2LAJA 2FKEA 3O5MA 3O5RA 3KAFA 2XP5A 4FAPA 4TX0A 4N19A 2KI3A 2M8JA 1J6YA 4JFIA 4U86A 2ZQVA 4DZ2A 2L4JA 4LAWA 2PPNA 2DK1A 1JMQA 1QPLA 3JYMA 2PV1A 3IHZA 2KFWA 5HW7A 4DT4A 1K9RA 3EY6A 5B8IC 3L4HA 5GPGA 3JYJA 3KAHA 5D75A 4REXA 3B7XA 2KR7A 4TW7A 3O5PA 2M2AA 3UQBA 2ZQUA 2PBCA 4TNSA 1J4IA 2OFNA 5HT1A 2XP7A 3O5IA 2ZR5A 2ZR4A 4R0XA 3O5DA 3KABA 1L1PA 1KT1A 1FKHA 1EYMA 4MSPA 1EQ3A 4ODRA 4JFKA 4DRKA 5I98A 1QPFA 2N87A 2FAPA 4DRIA 1Q6IA 4J4NA 1JNSA 3RFWA 3O5QA 1J4HA 5DIUA 3NI6A 3IK8A 4DRPA 1WMVA 3CNGA 3RGCA 1EG4A 2MPHA 4O2TA 3OOBA 5DITA 3NTPA 3VAWA 3UF8A 2MLZA 3TDBA 5HUAA 2PV3A 1FAPA 5DIVA 4C02B 4DRNA 1YW5A 1FKSA 1NMVA 3KACA 1A7XA 3ODKA 4ODLA 2UZ5A 2AWGA 3I6CA 4E5RA 1FKFA 4TW6A 4NNRA 2E45A 5HTGA 2DWVA 1ROUA 2K8IA 1Q6UA 5HW6A 4TYOA 1O6WA 5AHTA 2ITKA 2BA1A 1EG3A 2RUCA 2M1IA 2JV4A 4W9QA 3UI6A 3UQAA 2RSEA 2KGJA 3TCZA 3CGNA 4BF8A 3O5FA 3M85A 2ZQTA 4U84A 2YSHA 2JZVA 1NSGA 3H9RB 3M7NA 1FKDA 2Y78A 2PPPA 4ODNA 2KO7A 3KADA 2YSFA 4W9PA 3O5KA 2DG9A 3IKDA 1F8AB 1Q1CA 2F4EA
chains in the Genus database with same CATH superfamily
4DRMA 4LAVA 3MQHA 1E6NA 3ARWA 2A3EA 2PI6A 1ZCNA 2B31A 3W4RA 2YSGA 4DRHA 3O5JA 4LAXA 3PRBA 2XP3A 4DH0A 3CHDA 2DSWA 4ODKA 1Q6HA 1K9QA 5GQBA 4G50A 5JH8A 1U79A 4ODMA 4WKFA 1W26A 1W1PA 1LL6A 2L2SA 1HKMA 3AQUA 3WD3A 2F23A 3JXVA 3PQHA 2JX8A 2QF8A 1FKGA 2MLYA 2VCDA 3GU0A 1FLCA 2ZQSA 4GGQA 4ODPA 2XP4A 3RM8A 1R9HA 1TCOC 2DT2A 5J6EA 1ZU8A 1IX5A 4GIVA 1PINA 3IKGA 2WAEA 1D6OA 1FKLA 3RM9A 4WK9A 3TC5A 3GPKA 3O5OA 3WQWA 5HWBA 2DG4A 4MNLA 4MNMA 4NZCA 4JYSA 3RM4A 2XPAA 3PR9A 2RQSA 3WH0A 4MGVA 3AROA 4QT2A 1OWQA 1FFQA 4HBOA 2MDIA 4KR0B 2OWOA 2IF4A 2F21A 5HW8A 1ROTA 2DPEA 4QIBA 1JCHB 4J4OA 3O5EA 3ARZA 2DT3A 2XPBA 1OGBA 3ARTA 4A0UA 1OGGA 1NWSA 4IQCA 2YSIA 5CQ2A 1LG1A 1X6NA 4DRJA 3BXWA 2ETNA 2G8ZA 1Y0OA 1YATA 2PV2A 4W9OA 3UQIA 3UI4A 1J4RA 5HWCA 1BL4A 2LJ4A 4FN2A 4LGXA 3ALGA 5U47A 3KAGA 1E44A 2RURA 2P4VA 3O5GA 2YBTA 1KT0A 4KQZA 1P5QA 1D7HA 3G6LA 2RE3A 3BMBA 4QT3A 2MF9A 1NWTA 1HJWA 1NMWA 2PPOA 2DG3A 1T11A 4Z2HA 4JFLA 3WL0A 1FKJA 2Q5AA 3LE4A 3FSCA 1WR7A 2XP9A 2LGOA 1M5YA 4IQ2A 3FY1A 2DJYA 2F2DA 2MLXA 4ZPWR 2M3OW 3MQGA 1FKBA 1I5HW 1FFRA 4QZVB 4DZ3A 2M08A 1E15A 1PBKA 2ZR6A 1W9VA 3KZ7A 4DWSB 5E62A 2D9FA 3ARVA 3MCBB 2LKNA 1W1VA 1W9PA 2ESCA 1LQ0A 5GPRA 3PA7A 3LUOA 2KE0A 1FKIA 1FKTA 2RUDA 3QOKA 4JFMA 4WIWA 4DIPA 4MPKA 1FKKA 3WL1A 4ITZA 1E9LA 1E6ZA 1GPFA 4ODOA 4P8WA 4HBEA 2XP6A 2DK7A 1D2KA 2JMFA 1B6CA 1LG2A 2A3AA 3FAPA 4TW8A 2A3BA 4LAYA 2FDMA 3UI5A 3KCEA 1FD9A 2DMVA 5HKGA 2M8IA 1WNOA 1C9HA 2LPVA 3FXYA 1N1AA 4ODQA 4DROA 4U85A 2RUQA 5E64A 2O9OA 1FKRA 4Z2GA 5E5WA 2OLHA 4WJXA 1WB0A 2YSBA 3B8SA 2XP8A 1F40A 4A0TA 4S3KA 2DT1A 1ZBKA 1EDQA 1ZBCA 3LKXA 1D7JA 2IUZA 3AS1A 4JFJA 5BXJA 1TK7A 1E6RA 1JNTA 3O5LA 1NWUA 4MNKA 1FJDA 2ZAJA 1ITXA 4DWSC 3MDYB 4DRQA 1HXVA 4G2PA 3AS0A 3NRKA 4URIA 1HJXA 2MNTA 4PTMA 1D7IA 1W1TA 3CGMA 2VN1A 2EZ5W 2JXWA 1HKIA 4P8VA 4HARA 4MAVA 1ZK6A 1BKFA 2KXQA 1NWRA 3B9EA 3LKXB 1WAWA 2AOSA 4IPXA 1JVWA 3PRDA 1QZ2A 3KAIA 2LAJA 2FKEA 3ARSA 3O5MA 1RP5A 3O5RA 1GUVA 5E65A 3KAFA 3FSBA 3CZ8A 1LL7A 2WADA 3ARXA 2XP5A 2O92A 1ZB5A 4FAPA 4L3NA 1K9TA 4TX0A 5DF0A 4N19A 2KI3A 2M8JA 1RD6A 4UDMA 5HBFA 1KFWA 1J6YA 4JFIA 4U86A 2ZQVA 4DZ2A 2L4JA 1W1YA 4LAWA 3WD4A 3CH9A 4MNJA 1HKJA 2QRVA 2DK1A 1JMQA 1QPLA 2PPNA 3JYMA 2Y8NB 2PV1A 3IHZA 2KFWA 5HW7A 1TR8A 3WQVA 5DO2A 4W5UA 4DT4A 1K9RA 1VF8A 3EY6A 4L72B 5B8IC 3L4HA 5GPGA 3JYJA 1W9UA 3KAHA 4Z2IA 5D75A 4REXA 5E66A 4IT4A 1UR8A 3B7XA 2KR7A 1HKKA 3OA5A 4TW7A 3O5PA 2M2AA 4ZPVR 3UQBA 3B9DA 4NSBA 4Z2JA 2ZQUA 3ARRA 2PBCA 1JNDA 4TNSA 1J4IA 4AY1A 2DT0A 2OFNA 5HT1A 3WKZA 1XHGA 1O6IA 2XP7A 3O5IA 2ZR5A 1H0GA 2ZR4A 4R0XA 3ARPA 3O5DA 3KABA 1L1PA 3G6MA 4GLXA 1KT1A 1SYTA 1ZL1A 1GRJA 1FKHA 3WD0A 1EYMA 1EHNA 4MSPA 1EQ3A 4ODRA 2DSUA 4JFKA 1UR9A 4DRKA 5I98A 1QPFA 2N87A 2FAPA 4DRIA 4ML4A 1Q6IA 4J4NA 1JNSA 4DWSD 2DSVA 3RFWA 2G41A 3O5QA 4MTVA 1J4HA 1ZBWA 5DIUA 3NI6A 3IK8A 4DRPA 2EULA 4ZPTR 3FS8A 1WMVA 3CNGA 3B9AA 3RGCA 1EG4A 1XRVA 2MPHA 4O2TA 3AS2A 3PRAA 3OOBA 2WK2A 3CHCA 5DITA 3WIJA 3NTPA 1X6LA 2DSZA 3VAWA 4Q22A 3UF8A 3WD1A 2PN0A 4R5EA 2MLZA 5DEZA 3TDBA 5HUAA 2PV3A 1ZBVA 2B5UB 2YAJB 4WKAA 1CTNA 1FAPA 5DIVA 4C02B 4DRNA 1E6PA 1YW5A 1EIBA 2YBUA 1FKSA 1GOIA 1NMVA 3KACA 1A7XA 3ODKA 4P8XA 4ODLA 4P8UA 2UZ5A 2AWGA 1JNEA 3I6CA 3WD2A 4E5RA 1FKFA 4TW6A 4NNRA 1SR0A 4Z2LA 2E45A 5HTGA 2DWVA 1NH6A 2WLYA 1ROUA 1H0IA 2K8IA 1Q6UA 3ALFA 4S3JA 4Z2KA 4TYOA 5HW6A 1O6WA 5AHTA 2A3CA 4ZS6A 2ITKA 2BA1A 1EG3A 3GTYX 2RUCA 3ARUA 2M1IA 2JV4A 4W9QA 4IT6A 3UI6A 3UQAA 3ARYA 2RSEA 2KGJA 3TCZA 3CGNA 4BF8A 3O5FA 3M85A 1TFVA 2ZQTA 4U84A 1LJYA 4XAKA 4Q7NA 2YSHA 2JZVA 1NSGA 3H9RB 3CHEA 3M7NA 1FKDA 2Y78A 2WLZA 3ARQA 2PPPA 4ODNA 4DWSA 4WKHA 3MCBA 2KO7A 3KADA 2YSFA 4W9PA 3O5KA 2DG9A 3IKDA 1HJVA 1F8AB 3CHFA 3RMEA 1Q1CA 3AS3A 1LL4A 3EIPA 2WM0A 2F4EA
chains in the Genus database with same CATH topology
4DRMA 4LAVA 3MQHA 1E6NA 3ARWA 2A3EA 2PI6A 1ZCNA 2B31A 3W4RA 2YSGA 4DRHA 3O5JA 4LAXA 3PRBA 2XP3A 4DH0A 3CHDA 2DSWA 4ODKA 1Q6HA 1K9QA 5GQBA 4G50A 5JH8A 1U79A 4ODMA 4WKFA 1W26A 1W1PA 1LL6A 2L2SA 1HKMA 3AQUA 3WD3A 3JXVA 3PQHA 2JX8A 2QF8A 1FKGA 2MLYA 2VCDA 1FLCA 2ZQSA 4GGQA 4ODPA 2XP4A 3RM8A 1R9HA 1TCOC 2DT2A 5J6EA 1ZU8A 1IX5A 4GIVA 1PINA 3IKGA 2WAEA 1D6OA 1FKLA 3RM9A 4WK9A 3TC5A 3GPKA 3O5OA 3WQWA 5HWBA 2DG4A 4MNLA 4MNMA 4NZCA 4JYSA 3RM4A 2XPAA 3PR9A 2RQSA 3WH0A 4MGVA 3AROA 4QT2A 1OWQA 1FFQA 4HBOA 2MDIA 4KR0B 2OWOA 2IF4A 2F21A 5HW8A 1ROTA 2DPEA 4QIBA 4J4OA 3O5EA 3ARZA 2DT3A 2XPBA 1OGBA 3ARTA 4A0UA 1OGGA 1NWSA 4IQCA 2YSIA 5CQ2A 1LG1A 1X6NA 4DRJA 3BXWA 2G8ZA 1Y0OA 1YATA 2PV2A 4W9OA 3UQIA 3UI4A 1J4RA 5HWCA 1BL4A 2LJ4A 4FN2A 4LGXA 3ALGA 5U47A 3KAGA 2RURA 3O5GA 2YBTA 1KT0A 4KQZA 1P5QA 1D7HA 3G6LA 2RE3A 4QT3A 2MF9A 1NWTA 1HJWA 1NMWA 2PPOA 2DG3A 1T11A 4Z2HA 4JFLA 3WL0A 1FKJA 2Q5AA 3LE4A 3FSCA 1WR7A 2XP9A 2LGOA 1M5YA 4IQ2A 3FY1A 2DJYA 2F2DA 2MLXA 4ZPWR 2M3OW 3MQGA 1FKBA 1I5HW 1FFRA 4QZVB 4DZ3A 2M08A 1E15A 1PBKA 2ZR6A 1W9VA 3KZ7A 4DWSB 5E62A 2D9FA 3ARVA 3MCBB 2LKNA 1W1VA 1W9PA 2ESCA 1LQ0A 5GPRA 3PA7A 3LUOA 2KE0A 1FKIA 1FKTA 2RUDA 3QOKA 4JFMA 4WIWA 4DIPA 4MPKA 1FKKA 3WL1A 4ITZA 1E9LA 1E6ZA 1GPFA 4ODOA 4P8WA 4HBEA 2XP6A 2DK7A 1D2KA 2JMFA 1B6CA 1LG2A 2A3AA 3FAPA 4TW8A 2A3BA 4LAYA 2FDMA 3UI5A 3KCEA 1FD9A 2DMVA 5HKGA 2M8IA 1WNOA 1C9HA 2LPVA 3FXYA 1N1AA 4ODQA 4DROA 4U85A 2RUQA 5E64A 2O9OA 1FKRA 4Z2GA 5E5WA 2OLHA 4WJXA 1WB0A 2YSBA 3B8SA 2XP8A 1F40A 4A0TA 4S3KA 2DT1A 1ZBKA 1EDQA 1ZBCA 3LKXA 1D7JA 2IUZA 3AS1A 4JFJA 5BXJA 1TK7A 1E6RA 1JNTA 3O5LA 1NWUA 4MNKA 1FJDA 2ZAJA 1ITXA 4DWSC 3MDYB 4DRQA 1HXVA 4G2PA 3AS0A 3NRKA 4URIA 1HJXA 2MNTA 4PTMA 1D7IA 1W1TA 3CGMA 2VN1A 2EZ5W 2JXWA 1HKIA 4P8VA 4HARA 4MAVA 1ZK6A 1BKFA 2KXQA 1NWRA 3B9EA 3LKXB 1WAWA 2AOSA 4IPXA 1JVWA 3PRDA 1QZ2A 3KAIA 2LAJA 2FKEA 3ARSA 3O5MA 1RP5A 3O5RA 1GUVA 5E65A 3KAFA 3FSBA 3CZ8A 1LL7A 2WADA 3ARXA 2XP5A 2O92A 1ZB5A 4FAPA 4L3NA 1K9TA 4TX0A 5DF0A 4N19A 2KI3A 2M8JA 1RD6A 5HBFA 1KFWA 1J6YA 4JFIA 4U86A 2ZQVA 4DZ2A 2L4JA 1W1YA 4LAWA 3WD4A 3CH9A 4MNJA 1HKJA 2QRVA 2DK1A 1JMQA 1QPLA 2PPNA 3JYMA 2Y8NB 2PV1A 3IHZA 2KFWA 5HW7A 1TR8A 3WQVA 5DO2A 4W5UA 4DT4A 1K9RA 1VF8A 3EY6A 4L72B 5B8IC 3L4HA 5GPGA 3JYJA 1W9UA 3KAHA 4Z2IA 5D75A 4REXA 5E66A 4IT4A 1UR8A 3B7XA 2KR7A 1HKKA 3OA5A 4TW7A 3O5PA 2M2AA 4ZPVR 3UQBA 3B9DA 4NSBA 4Z2JA 2ZQUA 3ARRA 2PBCA 1JNDA 4TNSA 1J4IA 4AY1A 2DT0A 2OFNA 5HT1A 3WKZA 1XHGA 1O6IA 2XP7A 3O5IA 2ZR5A 1H0GA 2ZR4A 4R0XA 3ARPA 3O5DA 3KABA 1L1PA 3G6MA 4GLXA 1KT1A 1SYTA 1ZL1A 1FKHA 3WD0A 1EYMA 1EHNA 4MSPA 1EQ3A 4ODRA 2DSUA 4JFKA 1UR9A 4DRKA 5I98A 1QPFA 2N87A 2FAPA 4DRIA 4ML4A 1Q6IA 4J4NA 1JNSA 4DWSD 2DSVA 3RFWA 2G41A 3O5QA 4MTVA 1J4HA 1ZBWA 5DIUA 3NI6A 3IK8A 4DRPA 4ZPTR 3FS8A 1WMVA 3CNGA 3B9AA 3RGCA 1EG4A 1XRVA 2MPHA 4O2TA 3AS2A 3PRAA 3OOBA 2WK2A 3CHCA 5DITA 3WIJA 3NTPA 1X6LA 2DSZA 3VAWA 4Q22A 3UF8A 3WD1A 4R5EA 2MLZA 5DEZA 3TDBA 5HUAA 2PV3A 1ZBVA 2YAJB 4WKAA 1CTNA 1FAPA 5DIVA 4C02B 4DRNA 1E6PA 1YW5A 1EIBA 2YBUA 1FKSA 1GOIA 1NMVA 3KACA 1A7XA 3ODKA 4P8XA 4ODLA 4P8UA 2UZ5A 2AWGA 1JNEA 3I6CA 3WD2A 4E5RA 1FKFA 4TW6A 4NNRA 1SR0A 4Z2LA 2E45A 5HTGA 2DWVA 1NH6A 2WLYA 1ROUA 1H0IA 2K8IA 1Q6UA 3ALFA 4S3JA 4Z2KA 4TYOA 5HW6A 1O6WA 5AHTA 2A3CA 4ZS6A 2ITKA 2BA1A 1EG3A 2RUCA 3ARUA 2M1IA 2JV4A 4W9QA 4IT6A 3UI6A 3UQAA 3ARYA 2RSEA 2KGJA 3TCZA 3CGNA 4BF8A 3O5FA 3M85A 1TFVA 2ZQTA 4U84A 1LJYA 4XAKA 4Q7NA 2YSHA 2JZVA 1NSGA 3H9RB 3CHEA 3M7NA 1FKDA 2Y78A 2WLZA 3ARQA 2PPPA 4ODNA 4DWSA 4WKHA 3MCBA 2KO7A 3KADA 2YSFA 4W9PA 3O5KA 2DG9A 3IKDA 1HJVA 1F8AB 3CHFA 3RMEA 1Q1CA 3AS3A 1LL4A 2WM0A 2F4EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DRM A;  4LAV A;  1ZCN A;  2YSG A;  4DRH A;  3O5J A;  4LAX A;  3PRB A;  2XP3 A;  4DH0 A;  4ODK A;  1Q6H A;  1K9Q A;  4G50 A;  1U79 A;  4ODM A;  1W26 A;  2L2S A;  3JXV A;  2JX8 A;  1FKG A;  2MLY A;  2VCD A;  2ZQS A;  4GGQ A;  4ODP A;  2XP4 A;  1R9H A;  1TCO C;  5J6E A;  4GIV A;  1PIN A;  3IKG A;  1D6O A;  1FKL A;  3TC5 A;  3GPK A;  3O5O A;  5HWB A;  2DG4 A;  4JYS A;  2XPA A;  2RQS A;  3WH0 A;  4MGV A;  4QT2 A;  2MDI A;  2IF4 A;  2F21 A;  5HW8 A;  1ROT A;  4QIB A;  4J4O A;  3O5E A;  2XPB A;  4IQC A;  2YSI A;  5CQ2 A;  4DRJ A;  1Y0O A;  1YAT A;  2PV2 A;  4W9O A;  3UQI A;  3UI4 A;  1J4R A;  5HWC A;  1BL4 A;  2LJ4 A;  4FN2 A;  3KAG A;  2RUR A;  3O5G A;  1KT0 A;  1P5Q A;  1D7H A;  2RE3 A;  4QT3 A;  2MF9 A;  1NMW A;  2PPO A;  2DG3 A;  1T11 A;  4JFL A;  1FKJ A;  2Q5A A;  3LE4 A;  1WR7 A;  2XP9 A;  2LGO A;  1M5Y A;  4IQ2 A;  2DJY A;  2F2D A;  2MLX A;  2M3O W;  1FKB A;  1I5H W;  4DZ3 A;  2M08 A;  1PBK A;  2ZR6 A;  3KZ7 A;  2D9F A;  2LKN A;  3PA7 A;  3LUO A;  2KE0 A;  1FKI A;  1FKT A;  2RUD A;  4JFM A;  4DIP A;  1FKK A;  4ITZ A;  4ODO A;  2XP6 A;  2DK7 A;  2JMF A;  1B6C A;  3FAP A;  4TW8 A;  4LAY A;  3UI5 A;  3KCE A;  1FD9 A;  2DMV A;  5HKG A;  2M8I A;  1C9H A;  2LPV A;  1N1A A;  4ODQ A;  4DRO A;  4U85 A;  2RUQ A;  1FKR A;  2YSB A;  2XP8 A;  1F40 A;  1D7J A;  4JFJ A;  5BXJ A;  1TK7 A;  1JNT A;  3O5L A;  1FJD A;  2ZAJ A;  3MDY B;  4DRQ A;  1HXV A;  4G2P A;  3NRK A;  2MNT A;  1D7I A;  3CGM A;  2VN1 A;  2EZ5 W;  2JXW A;  1ZK6 A;  1BKF A;  2KXQ A;  4IPX A;  1JVW A;  3PRD A;  1QZ2 A;  3KAI A;  2LAJ A;  2FKE A;  3O5M A;  3O5R A;  3KAF A;  2XP5 A;  4FAP A;  4TX0 A;  4N19 A;  2KI3 A;  2M8J A;  1J6Y A;  4JFI A;  4U86 A;  2ZQV A;  4DZ2 A;  2L4J A;  4LAW A;  2PPN A;  2DK1 A;  1JMQ A;  1QPL A;  3JYM A;  2PV1 A;  3IHZ A;  2KFW A;  5HW7 A;  4DT4 A;  1K9R A;  3EY6 A;  5B8I C;  3L4H A;  5GPG A;  3JYJ A;  3KAH A;  5D75 A;  4REX A;  3B7X A;  2KR7 A;  4TW7 A;  3O5P A;  2M2A A;  3UQB A;  2ZQU A;  2PBC A;  4TNS A;  1J4I A;  2OFN A;  5HT1 A;  2XP7 A;  3O5I A;  2ZR5 A;  2ZR4 A;  4R0X A;  3O5D A;  3KAB A;  1L1P A;  1KT1 A;  1FKH A;  1EYM A;  4MSP A;  1EQ3 A;  4ODR A;  4JFK A;  4DRK A;  5I98 A;  1QPF A;  2N87 A;  2FAP A;  4DRI A;  1Q6I A;  4J4N A;  1JNS A;  3RFW A;  3O5Q A;  1J4H A;  5DIU A;  3NI6 A;  3IK8 A;  4DRP A;  1WMV A;  3CNG A;  3RGC A;  1EG4 A;  2MPH A;  4O2T A;  3OOB A;  5DIT A;  3NTP A;  3VAW A;  3UF8 A;  2MLZ A;  3TDB A;  5HUA A;  2PV3 A;  1FAP A;  5DIV A;  4C02 B;  4DRN A;  1YW5 A;  1FKS A;  1NMV A;  3KAC A;  1A7X A;  3ODK A;  4ODL A;  2UZ5 A;  2AWG A;  3I6C A;  4E5R A;  1FKF A;  4TW6 A;  4NNR A;  2E45 A;  5HTG A;  2DWV A;  1ROU A;  2K8I A;  1Q6U A;  5HW6 A;  4TYO A;  1O6W A;  5AHT A;  2ITK A;  2BA1 A;  1EG3 A;  2RUC A;  2M1I A;  2JV4 A;  4W9Q A;  3UI6 A;  3UQA A;  2RSE A;  2KGJ A;  3TCZ A;  3CGN A;  4BF8 A;  3O5F A;  3M85 A;  2ZQT A;  4U84 A;  2YSH A;  2JZV A;  1NSG A;  3H9R B;  3M7N A;  1FKD A;  2Y78 A;  2PPP A;  4ODN A;  2KO7 A;  3KAD A;  2YSF A;  4W9P A;  3O5K A;  2DG9 A;  3IKD A;  1F8A B;  1Q1C A;  2F4E A; 
#chains in the Genus database with same CATH topology
 4DRM A;  4LAV A;  3MQH A;  1E6N A;  3ARW A;  2A3E A;  2PI6 A;  1ZCN A;  2B31 A;  3W4R A;  2YSG A;  4DRH A;  3O5J A;  4LAX A;  3PRB A;  2XP3 A;  4DH0 A;  3CHD A;  2DSW A;  4ODK A;  1Q6H A;  1K9Q A;  5GQB A;  4G50 A;  5JH8 A;  1U79 A;  4ODM A;  4WKF A;  1W26 A;  1W1P A;  1LL6 A;  2L2S A;  1HKM A;  3AQU A;  3WD3 A;  2F23 A;  3JXV A;  3PQH A;  2JX8 A;  2QF8 A;  1FKG A;  2MLY A;  2VCD A;  3GU0 A;  1FLC A;  2ZQS A;  4GGQ A;  4ODP A;  2XP4 A;  3RM8 A;  1R9H A;  1TCO C;  2DT2 A;  5J6E A;  1ZU8 A;  1IX5 A;  4GIV A;  1PIN A;  3IKG A;  2WAE A;  1D6O A;  1FKL A;  3RM9 A;  4WK9 A;  3TC5 A;  3GPK A;  3O5O A;  3WQW A;  5HWB A;  2DG4 A;  4MNL A;  4MNM A;  4NZC A;  4JYS A;  3RM4 A;  2XPA A;  3PR9 A;  2RQS A;  3WH0 A;  4MGV A;  3ARO A;  4QT2 A;  1OWQ A;  1FFQ A;  4HBO A;  2MDI A;  4KR0 B;  2OWO A;  2IF4 A;  2F21 A;  5HW8 A;  1ROT A;  2DPE A;  4QIB A;  1JCH B;  4J4O A;  3O5E A;  3ARZ A;  2DT3 A;  2XPB A;  1OGB A;  3ART A;  4A0U A;  1OGG A;  1NWS A;  4IQC A;  2YSI A;  5CQ2 A;  1LG1 A;  1X6N A;  4DRJ A;  3BXW A;  2ETN A;  2G8Z A;  1Y0O A;  1YAT A;  2PV2 A;  4W9O A;  3UQI A;  3UI4 A;  1J4R A;  5HWC A;  1BL4 A;  2LJ4 A;  4FN2 A;  4LGX A;  3ALG A;  5U47 A;  3KAG A;  1E44 A;  2RUR A;  2P4V A;  3O5G A;  2YBT A;  1KT0 A;  4KQZ A;  1P5Q A;  1D7H A;  3G6L A;  2RE3 A;  3BMB A;  4QT3 A;  2MF9 A;  1NWT A;  1HJW A;  1NMW A;  2PPO A;  2DG3 A;  1T11 A;  4Z2H A;  4JFL A;  3WL0 A;  1FKJ A;  2Q5A A;  3LE4 A;  3FSC A;  1WR7 A;  2XP9 A;  2LGO A;  1M5Y A;  4IQ2 A;  3FY1 A;  2DJY A;  2F2D A;  2MLX A;  4ZPW R;  2M3O W;  3MQG A;  1FKB A;  1I5H W;  1FFR A;  4QZV B;  4DZ3 A;  2M08 A;  1E15 A;  1PBK A;  2ZR6 A;  1W9V A;  3KZ7 A;  4DWS B;  5E62 A;  2D9F A;  3ARV A;  3MCB B;  2LKN A;  1W1V A;  1W9P A;  2ESC A;  1LQ0 A;  5GPR A;  3PA7 A;  3LUO A;  2KE0 A;  1FKI A;  1FKT A;  2RUD A;  3QOK A;  4JFM A;  4WIW A;  4DIP A;  4MPK A;  1FKK A;  3WL1 A;  4ITZ A;  1E9L A;  1E6Z A;  1GPF A;  4ODO A;  4P8W A;  4HBE A;  2XP6 A;  2DK7 A;  1D2K A;  2JMF A;  1B6C A;  1LG2 A;  2A3A A;  3FAP A;  4TW8 A;  2A3B A;  4LAY A;  2FDM A;  3UI5 A;  3KCE A;  1FD9 A;  2DMV A;  5HKG A;  2M8I A;  1WNO A;  1C9H A;  2LPV A;  3FXY A;  1N1A A;  4ODQ A;  4DRO A;  4U85 A;  2RUQ A;  5E64 A;  2O9O A;  1FKR A;  4Z2G A;  5E5W A;  2OLH A;  4WJX A;  1WB0 A;  2YSB A;  3B8S A;  2XP8 A;  1F40 A;  4A0T A;  4S3K A;  2DT1 A;  1ZBK A;  1EDQ A;  1ZBC A;  3LKX A;  1D7J A;  2IUZ A;  3AS1 A;  4JFJ A;  5BXJ A;  1TK7 A;  1E6R A;  1JNT A;  3O5L A;  1NWU A;  4MNK A;  1FJD A;  2ZAJ A;  1ITX A;  4DWS C;  3MDY B;  4DRQ A;  1HXV A;  4G2P A;  3AS0 A;  3NRK A;  4URI A;  1HJX A;  2MNT A;  4PTM A;  1D7I A;  1W1T A;  3CGM A;  2VN1 A;  2EZ5 W;  2JXW A;  1HKI A;  4P8V A;  4HAR A;  4MAV A;  1ZK6 A;  1BKF A;  2KXQ A;  1NWR A;  3B9E A;  3LKX B;  1WAW A;  2AOS A;  4IPX A;  1JVW A;  3PRD A;  1QZ2 A;  3KAI A;  2LAJ A;  2FKE A;  3ARS A;  3O5M A;  1RP5 A;  3O5R A;  1GUV A;  5E65 A;  3KAF A;  3FSB A;  3CZ8 A;  1LL7 A;  2WAD A;  3ARX A;  2XP5 A;  2O92 A;  1ZB5 A;  4FAP A;  4L3N A;  1K9T A;  4TX0 A;  5DF0 A;  4N19 A;  2KI3 A;  2M8J A;  1RD6 A;  4UDM A;  5HBF A;  1KFW A;  1J6Y A;  4JFI A;  4U86 A;  2ZQV A;  4DZ2 A;  2L4J A;  1W1Y A;  4LAW A;  3WD4 A;  3CH9 A;  4MNJ A;  1HKJ A;  2QRV A;  2DK1 A;  1JMQ A;  1QPL A;  2PPN A;  3JYM A;  2Y8N B;  2PV1 A;  3IHZ A;  2KFW A;  5HW7 A;  1TR8 A;  3WQV A;  5DO2 A;  4W5U A;  4DT4 A;  1K9R A;  1VF8 A;  3EY6 A;  4L72 B;  5B8I C;  3L4H A;  5GPG A;  3JYJ A;  1W9U A;  3KAH A;  4Z2I A;  5D75 A;  4REX A;  5E66 A;  4IT4 A;  1UR8 A;  3B7X A;  2KR7 A;  1HKK A;  3OA5 A;  4TW7 A;  3O5P A;  2M2A A;  4ZPV R;  3UQB A;  3B9D A;  4NSB A;  4Z2J A;  2ZQU A;  3ARR A;  2PBC A;  1JND A;  4TNS A;  1J4I A;  4AY1 A;  2DT0 A;  2OFN A;  5HT1 A;  3WKZ A;  1XHG A;  1O6I A;  2XP7 A;  3O5I A;  2ZR5 A;  1H0G A;  2ZR4 A;  4R0X A;  3ARP A;  3O5D A;  3KAB A;  1L1P A;  3G6M A;  4GLX A;  1KT1 A;  1SYT A;  1ZL1 A;  1GRJ A;  1FKH A;  3WD0 A;  1EYM A;  1EHN A;  4MSP A;  1EQ3 A;  4ODR A;  2DSU A;  4JFK A;  1UR9 A;  4DRK A;  5I98 A;  1QPF A;  2N87 A;  2FAP A;  4DRI A;  4ML4 A;  1Q6I A;  4J4N A;  1JNS A;  4DWS D;  2DSV A;  3RFW A;  2G41 A;  3O5Q A;  4MTV A;  1J4H A;  1ZBW A;  5DIU A;  3NI6 A;  3IK8 A;  4DRP A;  2EUL A;  4ZPT R;  3FS8 A;  1WMV A;  3CNG A;  3B9A A;  3RGC A;  1EG4 A;  1XRV A;  2MPH A;  4O2T A;  3AS2 A;  3PRA A;  3OOB A;  2WK2 A;  3CHC A;  5DIT A;  3WIJ A;  3NTP A;  1X6L A;  2DSZ A;  3VAW A;  4Q22 A;  3UF8 A;  3WD1 A;  2PN0 A;  4R5E A;  2MLZ A;  5DEZ A;  3TDB A;  5HUA A;  2PV3 A;  1ZBV A;  2B5U B;  2YAJ B;  4WKA A;  1CTN A;  1FAP A;  5DIV A;  4C02 B;  4DRN A;  1E6P A;  1YW5 A;  1EIB A;  2YBU A;  1FKS A;  1GOI A;  1NMV A;  3KAC A;  1A7X A;  3ODK A;  4P8X A;  4ODL A;  4P8U A;  2UZ5 A;  2AWG A;  1JNE A;  3I6C A;  3WD2 A;  4E5R A;  1FKF A;  4TW6 A;  4NNR A;  1SR0 A;  4Z2L A;  2E45 A;  5HTG A;  2DWV A;  1NH6 A;  2WLY A;  1ROU A;  1H0I A;  2K8I A;  1Q6U A;  3ALF A;  4S3J A;  4Z2K A;  4TYO A;  5HW6 A;  1O6W A;  5AHT A;  2A3C A;  4ZS6 A;  2ITK A;  2BA1 A;  1EG3 A;  3GTY X;  2RUC A;  3ARU A;  2M1I A;  2JV4 A;  4W9Q A;  4IT6 A;  3UI6 A;  3UQA A;  3ARY A;  2RSE A;  2KGJ A;  3TCZ A;  3CGN A;  4BF8 A;  3O5F A;  3M85 A;  1TFV A;  2ZQT A;  4U84 A;  1LJY A;  4XAK A;  4Q7N A;  2YSH A;  2JZV A;  1NSG A;  3H9R B;  3CHE A;  3M7N A;  1FKD A;  2Y78 A;  2WLZ A;  3ARQ A;  2PPP A;  4ODN A;  4DWS A;  4WKH A;  3MCB A;  2KO7 A;  3KAD A;  2YSF A;  4W9P A;  3O5K A;  2DG9 A;  3IKD A;  1HJV A;  1F8A B;  3CHF A;  3RME A;  1Q1C A;  3AS3 A;  1LL4 A;  3EIP A;  2WM0 A;  2F4E A; 
#chains in the Genus database with same CATH homology
 4DRM A;  4LAV A;  3MQH A;  1E6N A;  3ARW A;  2A3E A;  2PI6 A;  1ZCN A;  2B31 A;  3W4R A;  2YSG A;  4DRH A;  3O5J A;  4LAX A;  3PRB A;  2XP3 A;  4DH0 A;  3CHD A;  2DSW A;  4ODK A;  1Q6H A;  1K9Q A;  5GQB A;  4G50 A;  5JH8 A;  1U79 A;  4ODM A;  4WKF A;  1W26 A;  1W1P A;  1LL6 A;  2L2S A;  1HKM A;  3AQU A;  3WD3 A;  3JXV A;  3PQH A;  2JX8 A;  2QF8 A;  1FKG A;  2MLY A;  2VCD A;  1FLC A;  2ZQS A;  4GGQ A;  4ODP A;  2XP4 A;  3RM8 A;  1R9H A;  1TCO C;  2DT2 A;  5J6E A;  1ZU8 A;  1IX5 A;  4GIV A;  1PIN A;  3IKG A;  2WAE A;  1D6O A;  1FKL A;  3RM9 A;  4WK9 A;  3TC5 A;  3GPK A;  3O5O A;  3WQW A;  5HWB A;  2DG4 A;  4MNL A;  4MNM A;  4NZC A;  4JYS A;  3RM4 A;  2XPA A;  3PR9 A;  2RQS A;  3WH0 A;  4MGV A;  3ARO A;  4QT2 A;  1OWQ A;  1FFQ A;  4HBO A;  2MDI A;  4KR0 B;  2OWO A;  2IF4 A;  2F21 A;  5HW8 A;  1ROT A;  2DPE A;  4QIB A;  4J4O A;  3O5E A;  3ARZ A;  2DT3 A;  2XPB A;  1OGB A;  3ART A;  4A0U A;  1OGG A;  1NWS A;  4IQC A;  2YSI A;  5CQ2 A;  1LG1 A;  1X6N A;  4DRJ A;  3BXW A;  2G8Z A;  1Y0O A;  1YAT A;  2PV2 A;  4W9O A;  3UQI A;  3UI4 A;  1J4R A;  5HWC A;  1BL4 A;  2LJ4 A;  4FN2 A;  4LGX A;  3ALG A;  5U47 A;  3KAG A;  2RUR A;  3O5G A;  2YBT A;  1KT0 A;  4KQZ A;  1P5Q A;  1D7H A;  3G6L A;  2RE3 A;  4QT3 A;  2MF9 A;  1NWT A;  1HJW A;  1NMW A;  2PPO A;  2DG3 A;  1T11 A;  4Z2H A;  4JFL A;  3WL0 A;  1FKJ A;  2Q5A A;  3LE4 A;  3FSC A;  1WR7 A;  2XP9 A;  2LGO A;  1M5Y A;  4IQ2 A;  3FY1 A;  2DJY A;  2F2D A;  2MLX A;  4ZPW R;  2M3O W;  3MQG A;  1FKB A;  1I5H W;  1FFR A;  4QZV B;  4DZ3 A;  2M08 A;  1E15 A;  1PBK A;  2ZR6 A;  1W9V A;  3KZ7 A;  4DWS B;  5E62 A;  2D9F A;  3ARV A;  3MCB B;  2LKN A;  1W1V A;  1W9P A;  2ESC A;  1LQ0 A;  5GPR A;  3PA7 A;  3LUO A;  2KE0 A;  1FKI A;  1FKT A;  2RUD A;  3QOK A;  4JFM A;  4WIW A;  4DIP A;  4MPK A;  1FKK A;  3WL1 A;  4ITZ A;  1E9L A;  1E6Z A;  1GPF A;  4ODO A;  4P8W A;  4HBE A;  2XP6 A;  2DK7 A;  1D2K A;  2JMF A;  1B6C A;  1LG2 A;  2A3A A;  3FAP A;  4TW8 A;  2A3B A;  4LAY A;  2FDM A;  3UI5 A;  3KCE A;  1FD9 A;  2DMV A;  5HKG A;  2M8I A;  1WNO A;  1C9H A;  2LPV A;  3FXY A;  1N1A A;  4ODQ A;  4DRO A;  4U85 A;  2RUQ A;  5E64 A;  2O9O A;  1FKR A;  4Z2G A;  5E5W A;  2OLH A;  4WJX A;  1WB0 A;  2YSB A;  3B8S A;  2XP8 A;  1F40 A;  4A0T A;  4S3K A;  2DT1 A;  1ZBK A;  1EDQ A;  1ZBC A;  3LKX A;  1D7J A;  2IUZ A;  3AS1 A;  4JFJ A;  5BXJ A;  1TK7 A;  1E6R A;  1JNT A;  3O5L A;  1NWU A;  4MNK A;  1FJD A;  2ZAJ A;  1ITX A;  4DWS C;  3MDY B;  4DRQ A;  1HXV A;  4G2P A;  3AS0 A;  3NRK A;  4URI A;  1HJX A;  2MNT A;  4PTM A;  1D7I A;  1W1T A;  3CGM A;  2VN1 A;  2EZ5 W;  2JXW A;  1HKI A;  4P8V A;  4HAR A;  4MAV A;  1ZK6 A;  1BKF A;  2KXQ A;  1NWR A;  3B9E A;  3LKX B;  1WAW A;  2AOS A;  4IPX A;  1JVW A;  3PRD A;  1QZ2 A;  3KAI A;  2LAJ A;  2FKE A;  3ARS A;  3O5M A;  1RP5 A;  3O5R A;  1GUV A;  5E65 A;  3KAF A;  3FSB A;  3CZ8 A;  1LL7 A;  2WAD A;  3ARX A;  2XP5 A;  2O92 A;  1ZB5 A;  4FAP A;  4L3N A;  1K9T A;  4TX0 A;  5DF0 A;  4N19 A;  2KI3 A;  2M8J A;  1RD6 A;  5HBF A;  1KFW A;  1J6Y A;  4JFI A;  4U86 A;  2ZQV A;  4DZ2 A;  2L4J A;  1W1Y A;  4LAW A;  3WD4 A;  3CH9 A;  4MNJ A;  1HKJ A;  2QRV A;  2DK1 A;  1JMQ A;  1QPL A;  2PPN A;  3JYM A;  2Y8N B;  2PV1 A;  3IHZ A;  2KFW A;  5HW7 A;  1TR8 A;  3WQV A;  5DO2 A;  4W5U A;  4DT4 A;  1K9R A;  1VF8 A;  3EY6 A;  4L72 B;  5B8I C;  3L4H A;  5GPG A;  3JYJ A;  1W9U A;  3KAH A;  4Z2I A;  5D75 A;  4REX A;  5E66 A;  4IT4 A;  1UR8 A;  3B7X A;  2KR7 A;  1HKK A;  3OA5 A;  4TW7 A;  3O5P A;  2M2A A;  4ZPV R;  3UQB A;  3B9D A;  4NSB A;  4Z2J A;  2ZQU A;  3ARR A;  2PBC A;  1JND A;  4TNS A;  1J4I A;  4AY1 A;  2DT0 A;  2OFN A;  5HT1 A;  3WKZ A;  1XHG A;  1O6I A;  2XP7 A;  3O5I A;  2ZR5 A;  1H0G A;  2ZR4 A;  4R0X A;  3ARP A;  3O5D A;  3KAB A;  1L1P A;  3G6M A;  4GLX A;  1KT1 A;  1SYT A;  1ZL1 A;  1FKH A;  3WD0 A;  1EYM A;  1EHN A;  4MSP A;  1EQ3 A;  4ODR A;  2DSU A;  4JFK A;  1UR9 A;  4DRK A;  5I98 A;  1QPF A;  2N87 A;  2FAP A;  4DRI A;  4ML4 A;  1Q6I A;  4J4N A;  1JNS A;  4DWS D;  2DSV A;  3RFW A;  2G41 A;  3O5Q A;  4MTV A;  1J4H A;  1ZBW A;  5DIU A;  3NI6 A;  3IK8 A;  4DRP A;  4ZPT R;  3FS8 A;  1WMV A;  3CNG A;  3B9A A;  3RGC A;  1EG4 A;  1XRV A;  2MPH A;  4O2T A;  3AS2 A;  3PRA A;  3OOB A;  2WK2 A;  3CHC A;  5DIT A;  3WIJ A;  3NTP A;  1X6L A;  2DSZ A;  3VAW A;  4Q22 A;  3UF8 A;  3WD1 A;  4R5E A;  2MLZ A;  5DEZ A;  3TDB A;  5HUA A;  2PV3 A;  1ZBV A;  2YAJ B;  4WKA A;  1CTN A;  1FAP A;  5DIV A;  4C02 B;  4DRN A;  1E6P A;  1YW5 A;  1EIB A;  2YBU A;  1FKS A;  1GOI A;  1NMV A;  3KAC A;  1A7X A;  3ODK A;  4P8X A;  4ODL A;  4P8U A;  2UZ5 A;  2AWG A;  1JNE A;  3I6C A;  3WD2 A;  4E5R A;  1FKF A;  4TW6 A;  4NNR A;  1SR0 A;  4Z2L A;  2E45 A;  5HTG A;  2DWV A;  1NH6 A;  2WLY A;  1ROU A;  1H0I A;  2K8I A;  1Q6U A;  3ALF A;  4S3J A;  4Z2K A;  4TYO A;  5HW6 A;  1O6W A;  5AHT A;  2A3C A;  4ZS6 A;  2ITK A;  2BA1 A;  1EG3 A;  2RUC A;  3ARU A;  2M1I A;  2JV4 A;  4W9Q A;  4IT6 A;  3UI6 A;  3UQA A;  3ARY A;  2RSE A;  2KGJ A;  3TCZ A;  3CGN A;  4BF8 A;  3O5F A;  3M85 A;  1TFV A;  2ZQT A;  4U84 A;  1LJY A;  4XAK A;  4Q7N A;  2YSH A;  2JZV A;  1NSG A;  3H9R B;  3CHE A;  3M7N A;  1FKD A;  2Y78 A;  2WLZ A;  3ARQ A;  2PPP A;  4ODN A;  4DWS A;  4WKH A;  3MCB A;  2KO7 A;  3KAD A;  2YSF A;  4W9P A;  3O5K A;  2DG9 A;  3IKD A;  1HJV A;  1F8A B;  3CHF A;  3RME A;  1Q1C A;  3AS3 A;  1LL4 A;  2WM0 A;  2F4E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...