2XP9A

Discovery of cell-active phenyl-imidazole pin1 inhibitors by structure-guided fragment evolution
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
157
structure length
144
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords PEPTIDYL-PROLYL CIS-TRANS ISOMERASE NIMA-INTERACTING 1
publication title Discovery of Cell-Active Phenyl-Imidazole Pin1 Inhibitors by Structure-Guided Fragment Evolution.
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 144
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2xp9A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2xp9A02
3PRBA 4DRIA 2VN1A 1FKDA 3I6CA 4DRQA 4E5RA 1ROTA 1FKIA 1EG3A 2DMVA 1I5HW 3KAFA 3O5LA 2LGOA 1KT0A 1F40A 2LJ4A 4QT3A 5HUAA 2K8IA 4MGVA 1FKSA 4FAPA 2LAJA 4IQCA 3UI4A 4W9PA 2FAPA 4DT4A 1BKFA 3B7XA 2MLXA 4QT2A 3PRDA 2IF4A 2YSFA 3PA7A 5DIVA 5HW8A 4ODPA 4TW7A 2YSBA 2LPVA 5DIUA 1JNTA 2M1IA 4JYSA 3KADA 2DG3A 1FKJA 3JYJA 4DZ3A 4LAWA 5HKGA 4ITZA 4U85A 2BA1A 2DG9A 1WR7A 1QZ2A 4JFMA 5CQ2A 3O5GA 2RURA 3M85A 1FKTA 5I98A 2L2SA 1W26A 1D7HA 4BF8A 2F21A 2D9FA 2RUDA 5J6EA 1FKHA 4JFJA 1ZCNA 2DWVA 2MPHA 1KT1A 2M08A 2KGJA 2RUCA 4DRPA 3O5IA 4DROA 1JVWA 4U84A 1O6WA 3KZ7A 5GPGA 2F2DA 2N87A 4GGQA 1Q6IA 4IPXA 2DK7A 1FJDA 3O5EA 4FN2A 1Q6UA 2DG4A 3CGMA 2PV3A 4GIVA 2ZQUA 1FAPA 3O5QA 1FKGA 4JFLA 2JV4A 1EG4A 1R9HA 4U86A 2RUQA 2LKNA 4LAXA 5HT1A 1NSGA 2XP8A 4TX0A 2JX8A 4DZ2A 2DJYA 2JMFA 1FKLA 2MDIA 3UQBA 3NTPA 3RFWA 3KAIA 5D75A 3O5JA 2ITKA 3M7NA 5HWCA 4LAVA 3LE4A 3OOBA 3CNGA 3L4HA 4ODRA 2RE3A 1JNSA 4DRNA 1EQ3A 1D6OA 3UI6A 1TK7A 2XPBA 3KCEA 2JXWA 3IKDA 3O5KA 2MF9A 2MNTA 2OFNA 1NMWA 2MLZA 2XP3A 3WH0A 2AWGA 3O5MA 4W9OA 3H9RB 4JFKA 2PV2A 2PV1A 1NMVA 3VAWA 4W9QA 1PINA 4DRJA 1HXVA 2PPOA 1M5YA 5BXJA 4IQ2A 1T11A 1J4HA 2PBCA 1YATA 2ZR4A 1J4RA 5HWBA 2XP7A 1TCOC 1JMQA 1FKBA 3UQAA 1F8AB 1Q1CA 2Y78A 3TCZA 4TYOA 4MSPA 1FD9A 2XP5A 4NNRA 1L1PA 2M2AA 2ZR5A 4TW8A 3JXVA 2ZAJA 3RGCA 2M8IA 2ZQTA 4TNSA 2ZQSA 5B8IC 4C02B 1ZK6A 3NI6A 3JYMA 4N19A 2M8JA 3ODKA 5AHTA 1FKRA 1YW5A 5HW6A 1K9RA 1U79A 2XP4A 4ODKA 3UQIA 3IKGA 3EY6A 1QPLA 2UZ5A 1Y0OA 1N1AA 1Q6HA 4O2TA 3KABA 3IK8A 3MDYB 1B6CA 2E45A 2F4EA 4J4NA 3O5DA 1WMVA 4ODLA 3O5PA 1QPFA 2JZVA 5DITA 2ZR6A 2PPPA 3O5OA 3KAHA 1EYMA 2YSIA 3FAPA 4ODQA 2EZ5W 1ROUA 2VCDA 3UF8A 4TW6A 2L4JA 1K9QA 3TC5A 2XPAA 2KXQA 4LAYA 2XP9A 4QIBA 4DRMA 4DRKA 2Q5AA 2KE0A 3KAGA 2PPNA 5HTGA 2KO7A 1J4IA 1J6YA 1C9HA 5HW7A 4R0XA 2XP6A 1BL4A 2M3OW 1D7IA 4J4OA 1P5QA 3CGNA 4ODNA 3NRKA 2RQSA 4DH0A 4G2PA 3KACA 3O5RA 2KFWA 2KI3A 4REXA 4DIPA 1A7XA 4G50A 2FKEA 3LUOA 2YSHA 3UI5A 2YSGA 2ZQVA 2DK1A 4DRHA 4JFIA 2MLYA 3O5FA 3TDBA 4ODMA 1PBKA 1FKKA 2RSEA 1FKFA 1D7JA 2KR7A 4ODOA 3GPKA 3IHZA
chains in the Genus database with same CATH superfamily
4P8UA 3PRBA 4Z2JA 4DRIA 2VN1A 3ALFA 1WB0A 1FKDA 3I6CA 4MNJA 4DRQA 4E5RA 1OWQA 1ROTA 3ALGA 3AROA 4HARA 1HKMA 1FKIA 1EG3A 2DMVA 1I5HW 2WM0A 3KAFA 3O5LA 1GOIA 3LKXA 4WKHA 4DWSB 2LGOA 1KT0A 3GU0A 4Z2HA 2B5UB 1F40A 5E66A 2LJ4A 4QT3A 5HUAA 2K8IA 4MGVA 1HKJA 1LG1A 2DT2A 3ARYA 1FKSA 4FAPA 2LAJA 4IQCA 3UI4A 4W9PA 4GLXA 2FAPA 1XHGA 4P8WA 4DT4A 1BKFA 1HJWA 1NWRA 2MLXA 2DSWA 3B7XA 4QT2A 3PRDA 2WAEA 1X6NA 2IF4A 1HKKA 2YSFA 4KQZA 3PA7A 5DIVA 4WKAA 5HW8A 1ZBKA 2PI6A 4ODPA 4TW7A 2YSBA 2LPVA 5DIUA 1JNTA 2M1IA 4JYSA 3KADA 2DG3A 1FKJA 3JYJA 3ARVA 4DZ3A 1HJXA 1CTNA 1GPFA 4LAWA 1EHNA 4WIWA 5HKGA 4ZPTR 1ZL1A 1E9LA 1W9UA 4ITZA 4U85A 2BA1A 3CH9A 2DG9A 1WR7A 3FS8A 1QZ2A 4S3JA 4JFMA 5CQ2A 3O5GA 2RURA 3M85A 3ARZA 3CHDA 1FKTA 5I98A 4DWSD 3RM9A 3W4RA 5E65A 2L2SA 1W1YA 1W26A 1D7HA 3WL0A 4BF8A 3ARPA 2F21A 2D9FA 5DEZA 2RUDA 2FDMA 1H0IA 4MNMA 1FKHA 5J6EA 3BMBA 4JFJA 1IX5A 3ARQA 2DSUA 1ZCNA 2DT3A 4L3NA 2DWVA 1E15A 3WKZA 3RMEA 2MPHA 4Q22A 1FFRA 1KT1A 2M08A 2KGJA 3FXYA 2RUCA 4DRPA 3O5IA 1SR0A 4DROA 1JVWA 4U84A 1O6WA 3KZ7A 4WJXA 5GPGA 2F2DA 1JNEA 5JH8A 2N87A 2G41A 4GGQA 1Q6IA 4IPXA 3ARUA 4L72B 2IUZA 2DK7A 1FJDA 1H0GA 3O5EA 4FN2A 1Q6UA 2DG4A 3CGMA 2PV3A 4HBEA 4R5EA 4GIVA 2ZQUA 4Z2GA 1FAPA 4MNLA 3B9AA 3O5QA 4IT4A 1FKGA 4KR0B 4JFLA 1XRVA 1E6ZA 3QOKA 2JV4A 1EG4A 1R9HA 5GQBA 1WAWA 4U86A 2ETNA 2RUQA 2LKNA 4LAXA 4P8XA 1NSGA 5HT1A 5HBFA 4S3KA 2XP8A 4TX0A 2JX8A 4DZ2A 2DJYA 1E6PA 4NSBA 2JMFA 3WL1A 3MQHA 1FKLA 2MDIA 3UQBA 3NTPA 3RFWA 3KAIA 5D75A 3O5JA 2DSVA 1ITXA 2ITKA 4ZPWR 3M7NA 5HWCA 4LAVA 5DO2A 4Q7NA 3LE4A 3OOBA 3CNGA 3L4HA 2YBTA 4ODRA 2RE3A 1JNSA 4DRNA 1EQ3A 1D6OA 3UI6A 1W1TA 1TK7A 2XPBA 3KCEA 3AS0A 2JXWA 3IKDA 3O5KA 3CZ8A 1GRJA 2MF9A 2MNTA 2ESCA 2OFNA 1NMWA 1ZBVA 5U47A 3FSCA 3MQGA 1EIBA 2MLZA 2XP3A 3WH0A 2AWGA 3O5MA 1EDQA 2WLYA 2F23A 2WLZA 4W9OA 3H9RB 4JFKA 2PV2A 1ZBWA 3ARRA 2PV1A 1NMVA 3VAWA 4W9QA 3WQVA 4MTVA 4DWSA 3OA5A 2EULA 3WIJA 1PINA 1LL7A 1LQ0A 4DRJA 1HXVA 2PPOA 4HBOA 1M5YA 1NWTA 4UDMA 1WNOA 5BXJA 4P8VA 1VF8A 3AS2A 3CHEA 4IQ2A 1T11A 1J4HA 2PBCA 1YATA 3PR9A 2ZR4A 1J4RA 5HWBA 2XP7A 1TCOC 1JMQA 1FKBA 3WD1A 4IT6A 3AS1A 3PRAA 3UQAA 1OGGA 2OWOA 1F8AB 3WD3A 1Q1CA 2Y78A 3TCZA 4TYOA 4MSPA 1FD9A 2XP5A 3FSBA 4NNRA 3LKXB 4WK9A 1L1PA 2M2AA 1NWSA 1LG2A 1TFVA 3EIPA 2YAJB 2ZR5A 4DWSC 4TW8A 3JXVA 2ZAJA 5E62A 1O6IA 3RGCA 1UR9A 2M8IA 2O9OA 3GTYX 2ZQTA 1K9TA 1HKIA 3WD0A 4TNSA 2ZQSA 5B8IC 4C02B 3AS3A 1ZK6A 1LJYA 1X6LA 3NI6A 3JYMA 4N19A 4LGXA 2M8JA 1LL6A 3ODKA 5AHTA 3B8SA 4MPKA 1YW5A 1FKRA 5HW6A 1JCHB 1K9RA 1U79A 2XP4A 4ODKA 3UQIA 3IKGA 4ML4A 3EY6A 1QPLA 3G6LA 3RM8A 2UZ5A 1Y0OA 3FY1A 1N1AA 1Q6HA 1W9VA 4O2TA 3KABA 4URIA 2DT1A 3IK8A 3MDYB 4ZPVR 1D2KA 4Z2LA 1B6CA 1W1PA 2E45A 3PQHA 4XAKA 3MCBB 2A3AA 1RD6A 2F4EA 4J4NA 3O5DA 1WMVA 4ODLA 4PTMA 1ZU8A 3O5PA 1QPFA 2JZVA 3WD4A 5DITA 2ZR6A 1E44A 2PPPA 2QF8A 4A0UA 3O5OA 3KAHA 3WQWA 1EYMA 3ARTA 2YSIA 3FAPA 4ODQA 2EZ5W 3BXWA 2B31A 2WADA 1GUVA 1ROUA 2YBUA 2VCDA 3B9EA 3UF8A 4TW6A 2P4VA 4NZCA 5GPRA 2L4JA 1TR8A 5E5WA 3RM4A 3ARSA 1K9QA 1SYTA 3TC5A 2G8ZA 4W5UA 2XPAA 2KXQA 1W9PA 4LAYA 2XP9A 4ZS6A 4QZVB 1NWUA 4QIBA 4DRMA 1E6RA 4DRKA 2Q5AA 2KE0A 3ARXA 3KAGA 5DF0A 2PPNA 4Z2KA 5HTGA 1KFWA 2KO7A 4MNKA 3CHFA 3B9DA 1RP5A 1J4IA 1J6YA 3MCBA 1C9HA 5HW7A 1JNDA 3ARWA 4R0XA 1FLCA 2A3CA 1W1VA 4Z2IA 2A3BA 2XP6A 1BL4A 2M3OW 1NH6A 4WKFA 1D7IA 4J4OA 1P5QA 3CGNA 4ODNA 3NRKA 2RQSA 4DH0A 4G2PA 2A3EA 1ZB5A 2PN0A 3KACA 1LL4A 1FFQA 1ZBCA 3O5RA 2KFWA 2KI3A 4REXA 4DIPA 2Y8NB 1A7XA 4G50A 2DT0A 3G6MA 4AY1A 1OGBA 2FKEA 3LUOA 4MAVA 2YSHA 3UI5A 3WD2A 2YSGA 2ZQVA 2DK1A 1UR8A 4DRHA 4JFIA 2MLYA 3O5FA 3TDBA 4ODMA 2WK2A 1PBKA 2O92A 1FKKA 2DSZA 2DPEA 2RSEA 3AQUA 2OLHA 1HJVA 1FKFA 3CHCA 1E6NA 2QRVA 1D7JA 2KR7A 4ODOA 5E64A 2AOSA 3GPKA 3IHZA 4A0TA
chains in the Genus database with same CATH topology
4P8UA 3PRBA 4Z2JA 4DRIA 2VN1A 3ALFA 1WB0A 1FKDA 3I6CA 4MNJA 4DRQA 4E5RA 1OWQA 1ROTA 3ALGA 3AROA 4HARA 1HKMA 1FKIA 1EG3A 2DMVA 1I5HW 2WM0A 3KAFA 3O5LA 1GOIA 3LKXA 4WKHA 4DWSB 2LGOA 1KT0A 4Z2HA 1F40A 5E66A 2LJ4A 4QT3A 5HUAA 2K8IA 4MGVA 1HKJA 1LG1A 2DT2A 3ARYA 1FKSA 4FAPA 2LAJA 4IQCA 3UI4A 4W9PA 4GLXA 2FAPA 1XHGA 4P8WA 4DT4A 1BKFA 1HJWA 1NWRA 2MLXA 2DSWA 3B7XA 4QT2A 3PRDA 2WAEA 1X6NA 2IF4A 1HKKA 2YSFA 4KQZA 3PA7A 5DIVA 4WKAA 5HW8A 1ZBKA 2PI6A 4ODPA 4TW7A 2YSBA 2LPVA 5DIUA 1JNTA 2M1IA 4JYSA 3KADA 2DG3A 1FKJA 3JYJA 3ARVA 4DZ3A 1HJXA 1CTNA 1GPFA 4LAWA 1EHNA 4WIWA 5HKGA 4ZPTR 1ZL1A 1E9LA 1W9UA 4ITZA 4U85A 2BA1A 3CH9A 2DG9A 1WR7A 3FS8A 1QZ2A 4S3JA 4JFMA 5CQ2A 3O5GA 2RURA 3M85A 3ARZA 3CHDA 1FKTA 5I98A 4DWSD 3RM9A 3W4RA 5E65A 2L2SA 1W1YA 1W26A 1D7HA 3WL0A 4BF8A 3ARPA 2F21A 2D9FA 5DEZA 2RUDA 2FDMA 1H0IA 4MNMA 1FKHA 5J6EA 4JFJA 1IX5A 3ARQA 2DSUA 1ZCNA 2DT3A 4L3NA 2DWVA 1E15A 3WKZA 3RMEA 2MPHA 4Q22A 1FFRA 1KT1A 2M08A 2KGJA 3FXYA 2RUCA 4DRPA 3O5IA 1SR0A 4DROA 1JVWA 4U84A 1O6WA 3KZ7A 4WJXA 5GPGA 2F2DA 1JNEA 5JH8A 2N87A 2G41A 4GGQA 1Q6IA 4IPXA 3ARUA 4L72B 2IUZA 2DK7A 1FJDA 1H0GA 3O5EA 4FN2A 1Q6UA 2DG4A 3CGMA 2PV3A 4HBEA 4R5EA 4GIVA 2ZQUA 4Z2GA 1FAPA 4MNLA 3B9AA 3O5QA 4IT4A 1FKGA 4KR0B 4JFLA 1XRVA 1E6ZA 3QOKA 2JV4A 1EG4A 1R9HA 5GQBA 1WAWA 4U86A 2RUQA 2LKNA 4LAXA 4P8XA 1NSGA 5HT1A 5HBFA 4S3KA 2XP8A 4TX0A 2JX8A 4DZ2A 2DJYA 1E6PA 4NSBA 2JMFA 3WL1A 3MQHA 1FKLA 2MDIA 3UQBA 3NTPA 3RFWA 3KAIA 5D75A 3O5JA 2DSVA 1ITXA 2ITKA 4ZPWR 3M7NA 5HWCA 4LAVA 5DO2A 4Q7NA 3LE4A 3OOBA 3CNGA 3L4HA 2YBTA 4ODRA 2RE3A 1JNSA 4DRNA 1EQ3A 1D6OA 3UI6A 1W1TA 1TK7A 2XPBA 3KCEA 3AS0A 2JXWA 3IKDA 3O5KA 3CZ8A 2MF9A 2MNTA 2ESCA 2OFNA 1NMWA 1ZBVA 5U47A 3FSCA 3MQGA 1EIBA 2MLZA 2XP3A 3WH0A 2AWGA 3O5MA 1EDQA 2WLYA 2WLZA 4W9OA 3H9RB 4JFKA 2PV2A 1ZBWA 3ARRA 2PV1A 1NMVA 3VAWA 4W9QA 3WQVA 4MTVA 4DWSA 3OA5A 3WIJA 1PINA 1LL7A 1LQ0A 4DRJA 1HXVA 2PPOA 4HBOA 1M5YA 1NWTA 1WNOA 5BXJA 4P8VA 1VF8A 3AS2A 3CHEA 4IQ2A 1T11A 1J4HA 2PBCA 1YATA 3PR9A 2ZR4A 1J4RA 5HWBA 2XP7A 1TCOC 1JMQA 1FKBA 3WD1A 4IT6A 3AS1A 3PRAA 3UQAA 1OGGA 2OWOA 1F8AB 3WD3A 1Q1CA 2Y78A 3TCZA 4TYOA 4MSPA 1FD9A 2XP5A 3FSBA 4NNRA 3LKXB 4WK9A 1L1PA 2M2AA 1NWSA 1LG2A 1TFVA 2YAJB 2ZR5A 4DWSC 4TW8A 3JXVA 2ZAJA 5E62A 1O6IA 3RGCA 1UR9A 2M8IA 2O9OA 2ZQTA 1K9TA 1HKIA 3WD0A 4TNSA 2ZQSA 5B8IC 4C02B 3AS3A 1ZK6A 1LJYA 1X6LA 3NI6A 3JYMA 4N19A 4LGXA 2M8JA 1LL6A 3ODKA 5AHTA 3B8SA 4MPKA 1YW5A 1FKRA 5HW6A 1K9RA 1U79A 2XP4A 4ODKA 3UQIA 3IKGA 4ML4A 3EY6A 1QPLA 3G6LA 3RM8A 2UZ5A 1Y0OA 3FY1A 1N1AA 1Q6HA 1W9VA 4O2TA 3KABA 4URIA 2DT1A 3IK8A 3MDYB 4ZPVR 1D2KA 4Z2LA 1B6CA 1W1PA 2E45A 3PQHA 4XAKA 3MCBB 2A3AA 1RD6A 2F4EA 4J4NA 3O5DA 1WMVA 4ODLA 4PTMA 1ZU8A 3O5PA 1QPFA 2JZVA 3WD4A 5DITA 2ZR6A 2PPPA 2QF8A 4A0UA 3O5OA 3KAHA 3WQWA 1EYMA 3ARTA 2YSIA 3FAPA 4ODQA 2EZ5W 3BXWA 2B31A 2WADA 1GUVA 1ROUA 2YBUA 2VCDA 3B9EA 3UF8A 4TW6A 4NZCA 5GPRA 2L4JA 1TR8A 5E5WA 3RM4A 3ARSA 1K9QA 1SYTA 3TC5A 2G8ZA 4W5UA 2XPAA 2KXQA 1W9PA 4LAYA 2XP9A 4ZS6A 4QZVB 1NWUA 4QIBA 4DRMA 1E6RA 4DRKA 2Q5AA 2KE0A 3ARXA 3KAGA 5DF0A 2PPNA 4Z2KA 5HTGA 1KFWA 2KO7A 4MNKA 3CHFA 3B9DA 1RP5A 1J4IA 1J6YA 3MCBA 1C9HA 5HW7A 1JNDA 3ARWA 4R0XA 1FLCA 2A3CA 1W1VA 4Z2IA 2A3BA 2XP6A 1BL4A 2M3OW 1NH6A 4WKFA 1D7IA 4J4OA 1P5QA 3CGNA 4ODNA 3NRKA 2RQSA 4DH0A 4G2PA 2A3EA 1ZB5A 3KACA 1LL4A 1FFQA 1ZBCA 3O5RA 2KFWA 2KI3A 4REXA 4DIPA 2Y8NB 1A7XA 4G50A 2DT0A 3G6MA 4AY1A 1OGBA 2FKEA 3LUOA 4MAVA 2YSHA 3UI5A 3WD2A 2YSGA 2ZQVA 2DK1A 1UR8A 4DRHA 4JFIA 2MLYA 3O5FA 3TDBA 4ODMA 2WK2A 1PBKA 2O92A 1FKKA 2DSZA 2DPEA 2RSEA 3AQUA 2OLHA 1HJVA 1FKFA 3CHCA 1E6NA 2QRVA 1D7JA 2KR7A 4ODOA 5E64A 2AOSA 3GPKA 3IHZA 4A0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PRB A;  4DRI A;  2VN1 A;  1FKD A;  3I6C A;  4DRQ A;  4E5R A;  1ROT A;  1FKI A;  1EG3 A;  2DMV A;  1I5H W;  3KAF A;  3O5L A;  2LGO A;  1KT0 A;  1F40 A;  2LJ4 A;  4QT3 A;  5HUA A;  2K8I A;  4MGV A;  1FKS A;  4FAP A;  2LAJ A;  4IQC A;  3UI4 A;  4W9P A;  2FAP A;  4DT4 A;  1BKF A;  3B7X A;  2MLX A;  4QT2 A;  3PRD A;  2IF4 A;  2YSF A;  3PA7 A;  5DIV A;  5HW8 A;  4ODP A;  4TW7 A;  2YSB A;  2LPV A;  5DIU A;  1JNT A;  2M1I A;  4JYS A;  3KAD A;  2DG3 A;  1FKJ A;  3JYJ A;  4DZ3 A;  4LAW A;  5HKG A;  4ITZ A;  4U85 A;  2BA1 A;  2DG9 A;  1WR7 A;  1QZ2 A;  4JFM A;  5CQ2 A;  3O5G A;  2RUR A;  3M85 A;  1FKT A;  5I98 A;  2L2S A;  1W26 A;  1D7H A;  4BF8 A;  2F21 A;  2D9F A;  2RUD A;  5J6E A;  1FKH A;  4JFJ A;  1ZCN A;  2DWV A;  2MPH A;  1KT1 A;  2M08 A;  2KGJ A;  2RUC A;  4DRP A;  3O5I A;  4DRO A;  1JVW A;  4U84 A;  1O6W A;  3KZ7 A;  5GPG A;  2F2D A;  2N87 A;  4GGQ A;  1Q6I A;  4IPX A;  2DK7 A;  1FJD A;  3O5E A;  4FN2 A;  1Q6U A;  2DG4 A;  3CGM A;  2PV3 A;  4GIV A;  2ZQU A;  1FAP A;  3O5Q A;  1FKG A;  4JFL A;  2JV4 A;  1EG4 A;  1R9H A;  4U86 A;  2RUQ A;  2LKN A;  4LAX A;  5HT1 A;  1NSG A;  2XP8 A;  4TX0 A;  2JX8 A;  4DZ2 A;  2DJY A;  2JMF A;  1FKL A;  2MDI A;  3UQB A;  3NTP A;  3RFW A;  3KAI A;  5D75 A;  3O5J A;  2ITK A;  3M7N A;  5HWC A;  4LAV A;  3LE4 A;  3OOB A;  3CNG A;  3L4H A;  4ODR A;  2RE3 A;  1JNS A;  4DRN A;  1EQ3 A;  1D6O A;  3UI6 A;  1TK7 A;  2XPB A;  3KCE A;  2JXW A;  3IKD A;  3O5K A;  2MF9 A;  2MNT A;  2OFN A;  1NMW A;  2MLZ A;  2XP3 A;  3WH0 A;  2AWG A;  3O5M A;  4W9O A;  3H9R B;  4JFK A;  2PV2 A;  2PV1 A;  1NMV A;  3VAW A;  4W9Q A;  1PIN A;  4DRJ A;  1HXV A;  2PPO A;  1M5Y A;  5BXJ A;  4IQ2 A;  1T11 A;  1J4H A;  2PBC A;  1YAT A;  2ZR4 A;  1J4R A;  5HWB A;  2XP7 A;  1TCO C;  1JMQ A;  1FKB A;  3UQA A;  1F8A B;  1Q1C A;  2Y78 A;  3TCZ A;  4TYO A;  4MSP A;  1FD9 A;  2XP5 A;  4NNR A;  1L1P A;  2M2A A;  2ZR5 A;  4TW8 A;  3JXV A;  2ZAJ A;  3RGC A;  2M8I A;  2ZQT A;  4TNS A;  2ZQS A;  5B8I C;  4C02 B;  1ZK6 A;  3NI6 A;  3JYM A;  4N19 A;  2M8J A;  3ODK A;  5AHT A;  1FKR A;  1YW5 A;  5HW6 A;  1K9R A;  1U79 A;  2XP4 A;  4ODK A;  3UQI A;  3IKG A;  3EY6 A;  1QPL A;  2UZ5 A;  1Y0O A;  1N1A A;  1Q6H A;  4O2T A;  3KAB A;  3IK8 A;  3MDY B;  1B6C A;  2E45 A;  2F4E A;  4J4N A;  3O5D A;  1WMV A;  4ODL A;  3O5P A;  1QPF A;  2JZV A;  5DIT A;  2ZR6 A;  2PPP A;  3O5O A;  3KAH A;  1EYM A;  2YSI A;  3FAP A;  4ODQ A;  2EZ5 W;  1ROU A;  2VCD A;  3UF8 A;  4TW6 A;  2L4J A;  1K9Q A;  3TC5 A;  2XPA A;  2KXQ A;  4LAY A;  2XP9 A;  4QIB A;  4DRM A;  4DRK A;  2Q5A A;  2KE0 A;  3KAG A;  2PPN A;  5HTG A;  2KO7 A;  1J4I A;  1J6Y A;  1C9H A;  5HW7 A;  4R0X A;  2XP6 A;  1BL4 A;  2M3O W;  1D7I A;  4J4O A;  1P5Q A;  3CGN A;  4ODN A;  3NRK A;  2RQS A;  4DH0 A;  4G2P A;  3KAC A;  3O5R A;  2KFW A;  2KI3 A;  4REX A;  4DIP A;  1A7X A;  4G50 A;  2FKE A;  3LUO A;  2YSH A;  3UI5 A;  2YSG A;  2ZQV A;  2DK1 A;  4DRH A;  4JFI A;  2MLY A;  3O5F A;  3TDB A;  4ODM A;  1PBK A;  1FKK A;  2RSE A;  1FKF A;  1D7J A;  2KR7 A;  4ODO A;  3GPK A;  3IHZ A; 
#chains in the Genus database with same CATH topology
 4P8U A;  3PRB A;  4Z2J A;  4DRI A;  2VN1 A;  3ALF A;  1WB0 A;  1FKD A;  3I6C A;  4MNJ A;  4DRQ A;  4E5R A;  1OWQ A;  1ROT A;  3ALG A;  3ARO A;  4HAR A;  1HKM A;  1FKI A;  1EG3 A;  2DMV A;  1I5H W;  2WM0 A;  3KAF A;  3O5L A;  1GOI A;  3LKX A;  4WKH A;  4DWS B;  2LGO A;  1KT0 A;  3GU0 A;  4Z2H A;  2B5U B;  1F40 A;  5E66 A;  2LJ4 A;  4QT3 A;  5HUA A;  2K8I A;  4MGV A;  1HKJ A;  1LG1 A;  2DT2 A;  3ARY A;  1FKS A;  4FAP A;  2LAJ A;  4IQC A;  3UI4 A;  4W9P A;  4GLX A;  2FAP A;  1XHG A;  4P8W A;  4DT4 A;  1BKF A;  1HJW A;  1NWR A;  2MLX A;  2DSW A;  3B7X A;  4QT2 A;  3PRD A;  2WAE A;  1X6N A;  2IF4 A;  1HKK A;  2YSF A;  4KQZ A;  3PA7 A;  5DIV A;  4WKA A;  5HW8 A;  1ZBK A;  2PI6 A;  4ODP A;  4TW7 A;  2YSB A;  2LPV A;  5DIU A;  1JNT A;  2M1I A;  4JYS A;  3KAD A;  2DG3 A;  1FKJ A;  3JYJ A;  3ARV A;  4DZ3 A;  1HJX A;  1CTN A;  1GPF A;  4LAW A;  1EHN A;  4WIW A;  5HKG A;  4ZPT R;  1ZL1 A;  1E9L A;  1W9U A;  4ITZ A;  4U85 A;  2BA1 A;  3CH9 A;  2DG9 A;  1WR7 A;  3FS8 A;  1QZ2 A;  4S3J A;  4JFM A;  5CQ2 A;  3O5G A;  2RUR A;  3M85 A;  3ARZ A;  3CHD A;  1FKT A;  5I98 A;  4DWS D;  3RM9 A;  3W4R A;  5E65 A;  2L2S A;  1W1Y A;  1W26 A;  1D7H A;  3WL0 A;  4BF8 A;  3ARP A;  2F21 A;  2D9F A;  5DEZ A;  2RUD A;  2FDM A;  1H0I A;  4MNM A;  1FKH A;  5J6E A;  3BMB A;  4JFJ A;  1IX5 A;  3ARQ A;  2DSU A;  1ZCN A;  2DT3 A;  4L3N A;  2DWV A;  1E15 A;  3WKZ A;  3RME A;  2MPH A;  4Q22 A;  1FFR A;  1KT1 A;  2M08 A;  2KGJ A;  3FXY A;  2RUC A;  4DRP A;  3O5I A;  1SR0 A;  4DRO A;  1JVW A;  4U84 A;  1O6W A;  3KZ7 A;  4WJX A;  5GPG A;  2F2D A;  1JNE A;  5JH8 A;  2N87 A;  2G41 A;  4GGQ A;  1Q6I A;  4IPX A;  3ARU A;  4L72 B;  2IUZ A;  2DK7 A;  1FJD A;  1H0G A;  3O5E A;  4FN2 A;  1Q6U A;  2DG4 A;  3CGM A;  2PV3 A;  4HBE A;  4R5E A;  4GIV A;  2ZQU A;  4Z2G A;  1FAP A;  4MNL A;  3B9A A;  3O5Q A;  4IT4 A;  1FKG A;  4KR0 B;  4JFL A;  1XRV A;  1E6Z A;  3QOK A;  2JV4 A;  1EG4 A;  1R9H A;  5GQB A;  1WAW A;  4U86 A;  2ETN A;  2RUQ A;  2LKN A;  4LAX A;  4P8X A;  1NSG A;  5HT1 A;  5HBF A;  4S3K A;  2XP8 A;  4TX0 A;  2JX8 A;  4DZ2 A;  2DJY A;  1E6P A;  4NSB A;  2JMF A;  3WL1 A;  3MQH A;  1FKL A;  2MDI A;  3UQB A;  3NTP A;  3RFW A;  3KAI A;  5D75 A;  3O5J A;  2DSV A;  1ITX A;  2ITK A;  4ZPW R;  3M7N A;  5HWC A;  4LAV A;  5DO2 A;  4Q7N A;  3LE4 A;  3OOB A;  3CNG A;  3L4H A;  2YBT A;  4ODR A;  2RE3 A;  1JNS A;  4DRN A;  1EQ3 A;  1D6O A;  3UI6 A;  1W1T A;  1TK7 A;  2XPB A;  3KCE A;  3AS0 A;  2JXW A;  3IKD A;  3O5K A;  3CZ8 A;  1GRJ A;  2MF9 A;  2MNT A;  2ESC A;  2OFN A;  1NMW A;  1ZBV A;  5U47 A;  3FSC A;  3MQG A;  1EIB A;  2MLZ A;  2XP3 A;  3WH0 A;  2AWG A;  3O5M A;  1EDQ A;  2WLY A;  2F23 A;  2WLZ A;  4W9O A;  3H9R B;  4JFK A;  2PV2 A;  1ZBW A;  3ARR A;  2PV1 A;  1NMV A;  3VAW A;  4W9Q A;  3WQV A;  4MTV A;  4DWS A;  3OA5 A;  2EUL A;  3WIJ A;  1PIN A;  1LL7 A;  1LQ0 A;  4DRJ A;  1HXV A;  2PPO A;  4HBO A;  1M5Y A;  1NWT A;  4UDM A;  1WNO A;  5BXJ A;  4P8V A;  1VF8 A;  3AS2 A;  3CHE A;  4IQ2 A;  1T11 A;  1J4H A;  2PBC A;  1YAT A;  3PR9 A;  2ZR4 A;  1J4R A;  5HWB A;  2XP7 A;  1TCO C;  1JMQ A;  1FKB A;  3WD1 A;  4IT6 A;  3AS1 A;  3PRA A;  3UQA A;  1OGG A;  2OWO A;  1F8A B;  3WD3 A;  1Q1C A;  2Y78 A;  3TCZ A;  4TYO A;  4MSP A;  1FD9 A;  2XP5 A;  3FSB A;  4NNR A;  3LKX B;  4WK9 A;  1L1P A;  2M2A A;  1NWS A;  1LG2 A;  1TFV A;  3EIP A;  2YAJ B;  2ZR5 A;  4DWS C;  4TW8 A;  3JXV A;  2ZAJ A;  5E62 A;  1O6I A;  3RGC A;  1UR9 A;  2M8I A;  2O9O A;  3GTY X;  2ZQT A;  1K9T A;  1HKI A;  3WD0 A;  4TNS A;  2ZQS A;  5B8I C;  4C02 B;  3AS3 A;  1ZK6 A;  1LJY A;  1X6L A;  3NI6 A;  3JYM A;  4N19 A;  4LGX A;  2M8J A;  1LL6 A;  3ODK A;  5AHT A;  3B8S A;  4MPK A;  1YW5 A;  1FKR A;  5HW6 A;  1JCH B;  1K9R A;  1U79 A;  2XP4 A;  4ODK A;  3UQI A;  3IKG A;  4ML4 A;  3EY6 A;  1QPL A;  3G6L A;  3RM8 A;  2UZ5 A;  1Y0O A;  3FY1 A;  1N1A A;  1Q6H A;  1W9V A;  4O2T A;  3KAB A;  4URI A;  2DT1 A;  3IK8 A;  3MDY B;  4ZPV R;  1D2K A;  4Z2L A;  1B6C A;  1W1P A;  2E45 A;  3PQH A;  4XAK A;  3MCB B;  2A3A A;  1RD6 A;  2F4E A;  4J4N A;  3O5D A;  1WMV A;  4ODL A;  4PTM A;  1ZU8 A;  3O5P A;  1QPF A;  2JZV A;  3WD4 A;  5DIT A;  2ZR6 A;  1E44 A;  2PPP A;  2QF8 A;  4A0U A;  3O5O A;  3KAH A;  3WQW A;  1EYM A;  3ART A;  2YSI A;  3FAP A;  4ODQ A;  2EZ5 W;  3BXW A;  2B31 A;  2WAD A;  1GUV A;  1ROU A;  2YBU A;  2VCD A;  3B9E A;  3UF8 A;  4TW6 A;  2P4V A;  4NZC A;  5GPR A;  2L4J A;  1TR8 A;  5E5W A;  3RM4 A;  3ARS A;  1K9Q A;  1SYT A;  3TC5 A;  2G8Z A;  4W5U A;  2XPA A;  2KXQ A;  1W9P A;  4LAY A;  2XP9 A;  4ZS6 A;  4QZV B;  1NWU A;  4QIB A;  4DRM A;  1E6R A;  4DRK A;  2Q5A A;  2KE0 A;  3ARX A;  3KAG A;  5DF0 A;  2PPN A;  4Z2K A;  5HTG A;  1KFW A;  2KO7 A;  4MNK A;  3CHF A;  3B9D A;  1RP5 A;  1J4I A;  1J6Y A;  3MCB A;  1C9H A;  5HW7 A;  1JND A;  3ARW A;  4R0X A;  1FLC A;  2A3C A;  1W1V A;  4Z2I A;  2A3B A;  2XP6 A;  1BL4 A;  2M3O W;  1NH6 A;  4WKF A;  1D7I A;  4J4O A;  1P5Q A;  3CGN A;  4ODN A;  3NRK A;  2RQS A;  4DH0 A;  4G2P A;  2A3E A;  1ZB5 A;  2PN0 A;  3KAC A;  1LL4 A;  1FFQ A;  1ZBC A;  3O5R A;  2KFW A;  2KI3 A;  4REX A;  4DIP A;  2Y8N B;  1A7X A;  4G50 A;  2DT0 A;  3G6M A;  4AY1 A;  1OGB A;  2FKE A;  3LUO A;  4MAV A;  2YSH A;  3UI5 A;  3WD2 A;  2YSG A;  2ZQV A;  2DK1 A;  1UR8 A;  4DRH A;  4JFI A;  2MLY A;  3O5F A;  3TDB A;  4ODM A;  2WK2 A;  1PBK A;  2O92 A;  1FKK A;  2DSZ A;  2DPE A;  2RSE A;  3AQU A;  2OLH A;  1HJV A;  1FKF A;  3CHC A;  1E6N A;  2QRV A;  1D7J A;  2KR7 A;  4ODO A;  5E64 A;  2AOS A;  3GPK A;  3IHZ A;  4A0T A; 
#chains in the Genus database with same CATH homology
 4P8U A;  3PRB A;  4Z2J A;  4DRI A;  2VN1 A;  3ALF A;  1WB0 A;  1FKD A;  3I6C A;  4MNJ A;  4DRQ A;  4E5R A;  1OWQ A;  1ROT A;  3ALG A;  3ARO A;  4HAR A;  1HKM A;  1FKI A;  1EG3 A;  2DMV A;  1I5H W;  2WM0 A;  3KAF A;  3O5L A;  1GOI A;  3LKX A;  4WKH A;  4DWS B;  2LGO A;  1KT0 A;  4Z2H A;  1F40 A;  5E66 A;  2LJ4 A;  4QT3 A;  5HUA A;  2K8I A;  4MGV A;  1HKJ A;  1LG1 A;  2DT2 A;  3ARY A;  1FKS A;  4FAP A;  2LAJ A;  4IQC A;  3UI4 A;  4W9P A;  4GLX A;  2FAP A;  1XHG A;  4P8W A;  4DT4 A;  1BKF A;  1HJW A;  1NWR A;  2MLX A;  2DSW A;  3B7X A;  4QT2 A;  3PRD A;  2WAE A;  1X6N A;  2IF4 A;  1HKK A;  2YSF A;  4KQZ A;  3PA7 A;  5DIV A;  4WKA A;  5HW8 A;  1ZBK A;  2PI6 A;  4ODP A;  4TW7 A;  2YSB A;  2LPV A;  5DIU A;  1JNT A;  2M1I A;  4JYS A;  3KAD A;  2DG3 A;  1FKJ A;  3JYJ A;  3ARV A;  4DZ3 A;  1HJX A;  1CTN A;  1GPF A;  4LAW A;  1EHN A;  4WIW A;  5HKG A;  4ZPT R;  1ZL1 A;  1E9L A;  1W9U A;  4ITZ A;  4U85 A;  2BA1 A;  3CH9 A;  2DG9 A;  1WR7 A;  3FS8 A;  1QZ2 A;  4S3J A;  4JFM A;  5CQ2 A;  3O5G A;  2RUR A;  3M85 A;  3ARZ A;  3CHD A;  1FKT A;  5I98 A;  4DWS D;  3RM9 A;  3W4R A;  5E65 A;  2L2S A;  1W1Y A;  1W26 A;  1D7H A;  3WL0 A;  4BF8 A;  3ARP A;  2F21 A;  2D9F A;  5DEZ A;  2RUD A;  2FDM A;  1H0I A;  4MNM A;  1FKH A;  5J6E A;  4JFJ A;  1IX5 A;  3ARQ A;  2DSU A;  1ZCN A;  2DT3 A;  4L3N A;  2DWV A;  1E15 A;  3WKZ A;  3RME A;  2MPH A;  4Q22 A;  1FFR A;  1KT1 A;  2M08 A;  2KGJ A;  3FXY A;  2RUC A;  4DRP A;  3O5I A;  1SR0 A;  4DRO A;  1JVW A;  4U84 A;  1O6W A;  3KZ7 A;  4WJX A;  5GPG A;  2F2D A;  1JNE A;  5JH8 A;  2N87 A;  2G41 A;  4GGQ A;  1Q6I A;  4IPX A;  3ARU A;  4L72 B;  2IUZ A;  2DK7 A;  1FJD A;  1H0G A;  3O5E A;  4FN2 A;  1Q6U A;  2DG4 A;  3CGM A;  2PV3 A;  4HBE A;  4R5E A;  4GIV A;  2ZQU A;  4Z2G A;  1FAP A;  4MNL A;  3B9A A;  3O5Q A;  4IT4 A;  1FKG A;  4KR0 B;  4JFL A;  1XRV A;  1E6Z A;  3QOK A;  2JV4 A;  1EG4 A;  1R9H A;  5GQB A;  1WAW A;  4U86 A;  2RUQ A;  2LKN A;  4LAX A;  4P8X A;  1NSG A;  5HT1 A;  5HBF A;  4S3K A;  2XP8 A;  4TX0 A;  2JX8 A;  4DZ2 A;  2DJY A;  1E6P A;  4NSB A;  2JMF A;  3WL1 A;  3MQH A;  1FKL A;  2MDI A;  3UQB A;  3NTP A;  3RFW A;  3KAI A;  5D75 A;  3O5J A;  2DSV A;  1ITX A;  2ITK A;  4ZPW R;  3M7N A;  5HWC A;  4LAV A;  5DO2 A;  4Q7N A;  3LE4 A;  3OOB A;  3CNG A;  3L4H A;  2YBT A;  4ODR A;  2RE3 A;  1JNS A;  4DRN A;  1EQ3 A;  1D6O A;  3UI6 A;  1W1T A;  1TK7 A;  2XPB A;  3KCE A;  3AS0 A;  2JXW A;  3IKD A;  3O5K A;  3CZ8 A;  2MF9 A;  2MNT A;  2ESC A;  2OFN A;  1NMW A;  1ZBV A;  5U47 A;  3FSC A;  3MQG A;  1EIB A;  2MLZ A;  2XP3 A;  3WH0 A;  2AWG A;  3O5M A;  1EDQ A;  2WLY A;  2WLZ A;  4W9O A;  3H9R B;  4JFK A;  2PV2 A;  1ZBW A;  3ARR A;  2PV1 A;  1NMV A;  3VAW A;  4W9Q A;  3WQV A;  4MTV A;  4DWS A;  3OA5 A;  3WIJ A;  1PIN A;  1LL7 A;  1LQ0 A;  4DRJ A;  1HXV A;  2PPO A;  4HBO A;  1M5Y A;  1NWT A;  1WNO A;  5BXJ A;  4P8V A;  1VF8 A;  3AS2 A;  3CHE A;  4IQ2 A;  1T11 A;  1J4H A;  2PBC A;  1YAT A;  3PR9 A;  2ZR4 A;  1J4R A;  5HWB A;  2XP7 A;  1TCO C;  1JMQ A;  1FKB A;  3WD1 A;  4IT6 A;  3AS1 A;  3PRA A;  3UQA A;  1OGG A;  2OWO A;  1F8A B;  3WD3 A;  1Q1C A;  2Y78 A;  3TCZ A;  4TYO A;  4MSP A;  1FD9 A;  2XP5 A;  3FSB A;  4NNR A;  3LKX B;  4WK9 A;  1L1P A;  2M2A A;  1NWS A;  1LG2 A;  1TFV A;  2YAJ B;  2ZR5 A;  4DWS C;  4TW8 A;  3JXV A;  2ZAJ A;  5E62 A;  1O6I A;  3RGC A;  1UR9 A;  2M8I A;  2O9O A;  2ZQT A;  1K9T A;  1HKI A;  3WD0 A;  4TNS A;  2ZQS A;  5B8I C;  4C02 B;  3AS3 A;  1ZK6 A;  1LJY A;  1X6L A;  3NI6 A;  3JYM A;  4N19 A;  4LGX A;  2M8J A;  1LL6 A;  3ODK A;  5AHT A;  3B8S A;  4MPK A;  1YW5 A;  1FKR A;  5HW6 A;  1K9R A;  1U79 A;  2XP4 A;  4ODK A;  3UQI A;  3IKG A;  4ML4 A;  3EY6 A;  1QPL A;  3G6L A;  3RM8 A;  2UZ5 A;  1Y0O A;  3FY1 A;  1N1A A;  1Q6H A;  1W9V A;  4O2T A;  3KAB A;  4URI A;  2DT1 A;  3IK8 A;  3MDY B;  4ZPV R;  1D2K A;  4Z2L A;  1B6C A;  1W1P A;  2E45 A;  3PQH A;  4XAK A;  3MCB B;  2A3A A;  1RD6 A;  2F4E A;  4J4N A;  3O5D A;  1WMV A;  4ODL A;  4PTM A;  1ZU8 A;  3O5P A;  1QPF A;  2JZV A;  3WD4 A;  5DIT A;  2ZR6 A;  2PPP A;  2QF8 A;  4A0U A;  3O5O A;  3KAH A;  3WQW A;  1EYM A;  3ART A;  2YSI A;  3FAP A;  4ODQ A;  2EZ5 W;  3BXW A;  2B31 A;  2WAD A;  1GUV A;  1ROU A;  2YBU A;  2VCD A;  3B9E A;  3UF8 A;  4TW6 A;  4NZC A;  5GPR A;  2L4J A;  1TR8 A;  5E5W A;  3RM4 A;  3ARS A;  1K9Q A;  1SYT A;  3TC5 A;  2G8Z A;  4W5U A;  2XPA A;  2KXQ A;  1W9P A;  4LAY A;  2XP9 A;  4ZS6 A;  4QZV B;  1NWU A;  4QIB A;  4DRM A;  1E6R A;  4DRK A;  2Q5A A;  2KE0 A;  3ARX A;  3KAG A;  5DF0 A;  2PPN A;  4Z2K A;  5HTG A;  1KFW A;  2KO7 A;  4MNK A;  3CHF A;  3B9D A;  1RP5 A;  1J4I A;  1J6Y A;  3MCB A;  1C9H A;  5HW7 A;  1JND A;  3ARW A;  4R0X A;  1FLC A;  2A3C A;  1W1V A;  4Z2I A;  2A3B A;  2XP6 A;  1BL4 A;  2M3O W;  1NH6 A;  4WKF A;  1D7I A;  4J4O A;  1P5Q A;  3CGN A;  4ODN A;  3NRK A;  2RQS A;  4DH0 A;  4G2P A;  2A3E A;  1ZB5 A;  3KAC A;  1LL4 A;  1FFQ A;  1ZBC A;  3O5R A;  2KFW A;  2KI3 A;  4REX A;  4DIP A;  2Y8N B;  1A7X A;  4G50 A;  2DT0 A;  3G6M A;  4AY1 A;  1OGB A;  2FKE A;  3LUO A;  4MAV A;  2YSH A;  3UI5 A;  3WD2 A;  2YSG A;  2ZQV A;  2DK1 A;  1UR8 A;  4DRH A;  4JFI A;  2MLY A;  3O5F A;  3TDB A;  4ODM A;  2WK2 A;  1PBK A;  2O92 A;  1FKK A;  2DSZ A;  2DPE A;  2RSE A;  3AQU A;  2OLH A;  1HJV A;  1FKF A;  3CHC A;  1E6N A;  2QRV A;  1D7J A;  2KR7 A;  4ODO A;  5E64 A;  2AOS A;  3GPK A;  3IHZ A;  4A0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...