2XP9A

Discovery of cell-active phenyl-imidazole pin1 inhibitors by structure-guided fragment evolution
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
157
structure length
144
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEPTIDYL-PROLYL CIS-TRANS ISOMERASE NIMA-INTERACTING 1
publication title Discovery of Cell-Active Phenyl-Imidazole Pin1 Inhibitors by Structure-Guided Fragment Evolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 46
structure length 144
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2xp9A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2xp9A02
3M7NA 2XP6A 2DWVA 5J6EA 5HWCA 1N1AA 4W9PA 2PV2A 2KO7A 1NSGA 2XPAA 1FD9A 1FJDA 2RUDA 1A7XA 2XP7A 3RGCA 4ODOA 2D9FA 4DH0A 1U79A 2RE3A 2DJYA 2YSHA 2XP9A 3LUOA 2EZ5W 4U84A 1JNSA 2MLXA 4IQ2A 2M2AA 2KXQA 1ROTA 1FKFA 1NMWA 4DRNA 4JFMA 2DG4A 4TW7A 1HXVA 4U86A 3O5MA 4FN2A 4TYOA 5I98A 3OOBA 3CGMA 5HTGA 1BL4A 4GGQA 2YSIA 3UQAA 1Y0OA 5HKGA 2L4JA 4QT3A 3O5JA 1FKHA 1Q1CA 4LAXA 2N87A 4MGVA 4G50A 1EG3A 4ODQA 5HUAA 1B6CA 1R9HA 4ODNA 3UI6A 4TW8A 4R0XA 2ZQTA 3KAIA 1FAPA 2MNTA 4ITZA 1FKSA 3CGNA 2KE0A 4G2PA 3VAWA 4DRJA 4REXA 2ITKA 2DG9A 3TC5A 3UQIA 1Q6UA 3KACA 1W26A 2PPOA 4JFIA 1J4IA 1L1PA 4LAWA 2F21A 2ZQUA 4JFKA 4DRPA 3NI6A 1Q6IA 3IKDA 1BKFA 4JFLA 2MF9A 3JXVA 3KAGA 1KT1A 2LJ4A 3MDYB 3PA7A 2KGJA 2MDIA 1WR7A 2M3OW 4IPXA 3UI4A 5HW8A 4DRIA 5DIUA 4QIBA 3IKGA 2XP5A 1FKIA 3O5KA 2OFNA 2L2SA 2JX8A 3O5GA 3O5DA 1WMVA 1M5YA 1QPFA 4E5RA 1K9RA 2XP8A 3O5QA 5D75A 2YSGA 1PINA 1D7JA 4IQCA 2XP3A 1QZ2A 1ZCNA 1Q6HA 1FKDA 1P5QA 4J4NA 2LAJA 2JZVA 4ODMA 3M85A 5B8IC 2XP4A 2KFWA 1FKBA 2PBCA 1O6WA 3I6CA 4J4OA 5HT1A 3O5PA 3UF8A 4TNSA 2PV3A 4DT4A 3KCEA 3EY6A 2JXWA 2UZ5A 1FKGA 4O2TA 2F4EA 4JFJA 2DMVA 3KABA 1EYMA 2ZQVA 2MPHA 2YSFA 2RUCA 3JYMA 4DIPA 2ZR6A 3GPKA 2LKNA 3KZ7A 2RSEA 2YSBA 2LGOA 3L4HA 4TW6A 1JNTA 5DITA 1NMVA 4GIVA 4N19A 1EQ3A 1T11A 3IK8A 4DZ2A 2VN1A 4ODLA 2ZR5A 5AHTA 3PRDA 2KI3A 3JYJA 3O5RA 2FKEA 2Y78A 2PV1A 2ZAJA 2JV4A 5GPGA 1D7HA 2RUQA 2IF4A 5HW7A 4LAVA 4MSPA 2DK1A 4DRHA 2DK7A 3UQBA 3IHZA 3KADA 1YW5A 1PBKA 1J4HA 1C9HA 1JVWA 3LE4A 3O5EA 2ZR4A 3KAHA 1QPLA 1ZK6A 1J4RA 4TX0A 2ZQSA 1TCOC 2PPNA 2RURA 1F8AB 1I5HW 1D7IA 5HWBA 3H9RB 2E45A 2VCDA 5HW6A 2MLYA 2AWGA 2FAPA 2JMFA 4ODRA 2RQSA 4C02B 2LPVA 2M8JA 3RFWA 2F2DA 1K9QA 1FKRA 3KAFA 3TCZA 3O5LA 3WH0A 1FKTA 2M08A 4ODKA 4ODPA 5BXJA 2PPPA 4DZ3A 3FAPA 1EG4A 4DRKA 2KR7A 4LAYA 1FKJA 1KT0A 3PRBA 1F40A 2BA1A 3NRKA 4QT2A 1TK7A 3NTPA 4DROA 4DRMA 2M1IA 1D6OA 3O5OA 3O5IA 1JMQA 2XPBA 2Q5AA 4W9OA 1FKKA 5CQ2A 1FKLA 1YATA 3TDBA 4FAPA 2DG3A 2MLZA 4U85A 3O5FA 4W9QA 1ROUA 3B7XA 5DIVA 1J6YA 2M8IA 4DRQA 4BF8A 3CNGA 2K8IA 4JYSA 3ODKA 3UI5A 4NNRA
chains in the Genus database with same CATH superfamily
1HJXA 3WD1A 3M7NA 2DT3A 3RM4A 4DWSD 2XP6A 2DWVA 5J6EA 3ARYA 5HWCA 5E62A 1N1AA 4W9PA 1E6PA 2PV2A 1NH6A 5GPRA 3WIJA 1EDQA 2KO7A 1NSGA 3ARQA 3ARVA 2XPAA 1FD9A 1FJDA 2RUDA 1A7XA 4Z2JA 4AY1A 2XP7A 4IT6A 4P8WA 1WAWA 3RGCA 1HKJA 4ODOA 4DWSB 2D9FA 2YBUA 2B5UB 3MCBA 4L3NA 4DH0A 1U79A 4P8UA 2RE3A 2DJYA 3CHDA 2YSHA 3AS1A 2XP9A 3ARZA 3LUOA 2EZ5W 4U84A 1JNSA 1UR8A 2MLXA 4IQ2A 2M2AA 2KXQA 2OWOA 1ROTA 1FKFA 1NMWA 3RMEA 4DRNA 4MNKA 4ML4A 4JFMA 2DG4A 4TW7A 1HXVA 4U86A 3O5MA 4FN2A 4TYOA 5I98A 3MQGA 3OOBA 2G41A 3CGMA 5E5WA 3ARTA 1LL7A 1BL4A 4MAVA 2PN0A 5HTGA 4GGQA 2YSIA 1X6LA 3UQAA 3WQVA 1Y0OA 5HKGA 2L4JA 4QT3A 1OGGA 3ARPA 3O5JA 1FKHA 2DT2A 1Q1CA 1W1VA 4LAXA 2N87A 4MGVA 4G50A 1EG3A 3WD4A 4ODQA 5HUAA 1B6CA 3WD3A 1R9HA 4S3KA 4ODNA 3LKXA 3UI6A 4TW8A 4R0XA 5GQBA 2ZQTA 3KAIA 1FAPA 4MNMA 4MNLA 3WL0A 4HARA 2MNTA 3FS8A 2QF8A 4ITZA 1FKSA 1W9PA 5U47A 4GLXA 4Z2LA 3CGNA 4Z2GA 2KE0A 4G2PA 5DEZA 3VAWA 4DRJA 4REXA 2O92A 4Z2HA 2Y8NB 1VF8A 1XHGA 1JNDA 2ITKA 2DG9A 2DSZA 3FXYA 3TC5A 1W9VA 2P4VA 4KR0B 3UQIA 1Q6UA 3KACA 1W26A 3RM9A 2PPOA 4JFIA 1J4IA 1H0IA 1L1PA 4WKHA 4LAWA 2F21A 2ZQUA 4JFKA 1HKIA 4DRPA 3NI6A 1Q6IA 3IKDA 4W5UA 1BKFA 4Z2IA 2DSUA 4JFLA 2MF9A 1CTNA 3PR9A 4ZS6A 3WD2A 3JXVA 3KAGA 2ETNA 3WQWA 1KT1A 2G8ZA 2LJ4A 4XAKA 3MDYB 3AS0A 2KGJA 3B9DA 3PA7A 2MDIA 2ESCA 1WR7A 2M3OW 4IPXA 4MTVA 3UI4A 5HW8A 1GOIA 4DRIA 1RP5A 1OWQA 3G6LA 5DIUA 4QIBA 3IKGA 2XP5A 2WLYA 1FKIA 3O5KA 2OFNA 2L2SA 1E9LA 2JX8A 3O5GA 3O5DA 1WMVA 2DSWA 1M5YA 3CZ8A 2WM0A 1QPFA 4E5RA 1K9RA 5JH8A 2XP8A 3O5QA 2FDMA 5D75A 1E44A 2YSGA 4P8XA 1PINA 1D7JA 4IQCA 2XP3A 1QZ2A 1ZCNA 1FFRA 1Q6HA 1NWUA 1FKDA 1P5QA 4J4NA 2LAJA 2JZVA 1ZBWA 4ODMA 3M85A 1ITXA 5B8IC 2XP4A 2KFWA 4WIWA 1ZBCA 3FSBA 3ALFA 1FKBA 3OA5A 1W1PA 2PBCA 1O6WA 4PTMA 3LKXB 3I6CA 4J4OA 5HT1A 1ZBVA 3O5PA 4HBEA 4Q22A 4DWSA 3UF8A 4TNSA 2PV3A 4A0TA 1JCHB 1LL4A 4DT4A 3KCEA 1W1YA 3EY6A 1LL6A 2JXWA 4Z2KA 2IUZA 2UZ5A 3ARWA 3CHEA 1FKGA 1SR0A 2DT1A 2F4EA 3ARSA 4O2TA 4JFJA 3GU0A 2DPEA 1ZL1A 2EULA 2DMVA 3KABA 4ZPTR 4DWSC 1EYMA 2ZQVA 3AS3A 1NWTA 2MPHA 2DT0A 2YSFA 2RUCA 3PQHA 1X6NA 4ZPVR 3JYMA 4DIPA 5HBFA 2ZR6A 3B9AA 3CH9A 3GPKA 2LKNA 3KZ7A 3WKZA 2RSEA 3RM8A 2YSBA 2LGOA 3L4HA 4TW6A 1JNTA 5DITA 3EIPA 4WK9A 3MQHA 4NZCA 4WKFA 1NMVA 1FFQA 1H0GA 4GIVA 4N19A 1EQ3A 3B8SA 4HBOA 4QZVB 1T11A 3IK8A 3PRAA 4DZ2A 1ZU8A 2VN1A 3ALGA 2YAJB 3AROA 4ODLA 1XRVA 2ZR5A 5AHTA 3PRDA 1W1TA 2KI3A 1O6IA 4MNJA 3JYJA 3O5RA 2FKEA 2Y78A 2PV1A 2AOSA 3MCBB 5DO2A 2ZAJA 1HJWA 1EHNA 2JV4A 1D2KA 1KFWA 5GPGA 2OLHA 1E6RA 1D7HA 3FSCA 2RUQA 2IF4A 5HW7A 1HKMA 4LAVA 3QOKA 4MSPA 1E15A 2DK1A 4DRHA 5DF0A 2DK7A 3UQBA 1FLCA 2A3EA 3IHZA 3KADA 1YW5A 3BXWA 1PBKA 1J4HA 1C9HA 1JVWA 3ARRA 3LE4A 3O5EA 2ZR4A 3KAHA 1E6NA 1QPLA 4URIA 1ZK6A 3BMBA 1J4RA 3AQUA 4TX0A 2ZQSA 2WADA 1LG2A 4L72B 1SYTA 1TCOC 1RD6A 2PPNA 4ZPWR 1ZBKA 2RURA 1F8AB 1I5HW 1ZB5A 2WLZA 1WNOA 5E64A 4R5EA 2WAEA 3AS2A 1K9TA 2DSVA 1D7IA 4LGXA 5HWBA 3H9RB 3WL1A 2E45A 2PI6A 2VCDA 3CHFA 5HW6A 1OGBA 2MLYA 2AWGA 1HJVA 3W4RA 2FAPA 2JMFA 4ODRA 2RQSA 4C02B 1HKKA 2LPVA 2M8JA 3CHCA 1TFVA 1EIBA 1E6ZA 3RFWA 2F2DA 1LQ0A 1K9QA 1FKRA 3KAFA 3TCZA 3O5LA 3WH0A 1FKTA 2WK2A 2A3AA 2M08A 3G6MA 4ODKA 3GTYX 4ODPA 5BXJA 2PPPA 5E66A 4DZ3A 1TR8A 2YBTA 3ARUA 3FAPA 1EG4A 4DRKA 4UDMA 2KR7A 4LAYA 1FKJA 1NWRA 1KT0A 1IX5A 3PRBA 1F40A 2BA1A 3NRKA 4QT2A 1TK7A 3NTPA 4KQZA 5E65A 2O9OA 1GPFA 4DRMA 1WB0A 2M1IA 4DROA 1D6OA 3B9EA 3O5OA 1W9UA 3O5IA 1JMQA 3ARXA 2XPBA 1GRJA 2Q5AA 4W9OA 4Q7NA 4IT4A 1FKKA 5CQ2A 1JNEA 3FY1A 1FKLA 1YATA 3TDBA 2F23A 2A3CA 4FAPA 2DG3A 2MLZA 4P8VA 4U85A 2A3BA 1LG1A 4WJXA 4MPKA 3O5FA 4S3JA 4W9QA 1LJYA 1ROUA 2QRVA 1NWSA 1GUVA 3B7XA 5DIVA 1J6YA 2M8IA 4DRQA 4BF8A 4A0UA 3CNGA 3WD0A 4NSBA 4WKAA 2K8IA 4JYSA 3ODKA 3UI5A 1UR9A 4NNRA 2B31A
chains in the Genus database with same CATH topology
1HJXA 3WD1A 3M7NA 2DT3A 3RM4A 4DWSD 2XP6A 2DWVA 5J6EA 3ARYA 5HWCA 5E62A 1N1AA 4W9PA 1E6PA 2PV2A 1NH6A 5GPRA 3WIJA 1EDQA 2KO7A 1NSGA 3ARQA 3ARVA 2XPAA 1FD9A 1FJDA 2RUDA 1A7XA 4Z2JA 4AY1A 2XP7A 4IT6A 4P8WA 1WAWA 3RGCA 1HKJA 4ODOA 4DWSB 2D9FA 2YBUA 3MCBA 4L3NA 4DH0A 1U79A 4P8UA 2RE3A 2DJYA 3CHDA 2YSHA 3AS1A 2XP9A 3ARZA 3LUOA 2EZ5W 4U84A 1JNSA 1UR8A 2MLXA 4IQ2A 2M2AA 2KXQA 2OWOA 1ROTA 1FKFA 1NMWA 3RMEA 4DRNA 4MNKA 4ML4A 4JFMA 2DG4A 4TW7A 1HXVA 4U86A 3O5MA 4FN2A 4TYOA 5I98A 3MQGA 3OOBA 2G41A 3CGMA 5E5WA 3ARTA 1LL7A 1BL4A 4MAVA 5HTGA 4GGQA 2YSIA 1X6LA 3UQAA 3WQVA 1Y0OA 5HKGA 2L4JA 4QT3A 1OGGA 3ARPA 3O5JA 1FKHA 2DT2A 1Q1CA 1W1VA 4LAXA 2N87A 4MGVA 4G50A 1EG3A 3WD4A 4ODQA 5HUAA 1B6CA 3WD3A 1R9HA 4S3KA 4ODNA 3LKXA 3UI6A 4TW8A 4R0XA 5GQBA 2ZQTA 3KAIA 1FAPA 4MNMA 4MNLA 3WL0A 4HARA 2MNTA 3FS8A 2QF8A 4ITZA 1FKSA 1W9PA 5U47A 4GLXA 4Z2LA 3CGNA 4Z2GA 2KE0A 4G2PA 5DEZA 3VAWA 4DRJA 4REXA 2O92A 4Z2HA 2Y8NB 1VF8A 1XHGA 1JNDA 2ITKA 2DG9A 2DSZA 3FXYA 3TC5A 1W9VA 4KR0B 3UQIA 1Q6UA 3KACA 1W26A 3RM9A 2PPOA 4JFIA 1J4IA 1H0IA 1L1PA 4WKHA 4LAWA 2F21A 2ZQUA 4JFKA 1HKIA 4DRPA 3NI6A 1Q6IA 3IKDA 4W5UA 1BKFA 4Z2IA 2DSUA 4JFLA 2MF9A 1CTNA 3PR9A 4ZS6A 3WD2A 3JXVA 3KAGA 3WQWA 1KT1A 2G8ZA 2LJ4A 4XAKA 3MDYB 3AS0A 2KGJA 3B9DA 3PA7A 2MDIA 2ESCA 1WR7A 2M3OW 4IPXA 4MTVA 3UI4A 5HW8A 1GOIA 4DRIA 1RP5A 1OWQA 3G6LA 5DIUA 4QIBA 3IKGA 2XP5A 2WLYA 1FKIA 3O5KA 2OFNA 2L2SA 1E9LA 2JX8A 3O5GA 3O5DA 1WMVA 2DSWA 1M5YA 3CZ8A 2WM0A 1QPFA 4E5RA 1K9RA 5JH8A 2XP8A 3O5QA 2FDMA 5D75A 2YSGA 4P8XA 1PINA 1D7JA 4IQCA 2XP3A 1QZ2A 1ZCNA 1FFRA 1Q6HA 1NWUA 1FKDA 1P5QA 4J4NA 2LAJA 2JZVA 1ZBWA 4ODMA 3M85A 1ITXA 5B8IC 2XP4A 2KFWA 4WIWA 1ZBCA 3FSBA 3ALFA 1FKBA 3OA5A 1W1PA 2PBCA 1O6WA 4PTMA 3LKXB 3I6CA 4J4OA 5HT1A 1ZBVA 3O5PA 4HBEA 4Q22A 4DWSA 3UF8A 4TNSA 2PV3A 4A0TA 4DT4A 1LL4A 3KCEA 1W1YA 3EY6A 1LL6A 2JXWA 4Z2KA 2IUZA 2UZ5A 3ARWA 3CHEA 1FKGA 1SR0A 2DT1A 2F4EA 3ARSA 4O2TA 4JFJA 2DPEA 1ZL1A 2DMVA 3KABA 4ZPTR 4DWSC 1EYMA 2ZQVA 3AS3A 1NWTA 2MPHA 2DT0A 2YSFA 2RUCA 3PQHA 1X6NA 4ZPVR 3JYMA 4DIPA 5HBFA 2ZR6A 3B9AA 3CH9A 3GPKA 2LKNA 3KZ7A 3WKZA 2RSEA 3RM8A 2YSBA 2LGOA 3L4HA 4TW6A 1JNTA 5DITA 4WK9A 3MQHA 4NZCA 4WKFA 1NMVA 1FFQA 1H0GA 4GIVA 4N19A 1EQ3A 3B8SA 4HBOA 4QZVB 1T11A 3IK8A 3PRAA 4DZ2A 1ZU8A 2VN1A 3ALGA 2YAJB 3AROA 4ODLA 1XRVA 2ZR5A 5AHTA 3PRDA 1W1TA 2KI3A 1O6IA 4MNJA 3JYJA 3O5RA 2FKEA 2Y78A 2PV1A 2AOSA 3MCBB 5DO2A 2ZAJA 1HJWA 1EHNA 2JV4A 1D2KA 1KFWA 5GPGA 2OLHA 1E6RA 1D7HA 3FSCA 2RUQA 2IF4A 5HW7A 1HKMA 4LAVA 3QOKA 4MSPA 1E15A 2DK1A 4DRHA 5DF0A 2DK7A 3UQBA 1FLCA 2A3EA 3IHZA 3KADA 1YW5A 3BXWA 1PBKA 1J4HA 1C9HA 1JVWA 3ARRA 3LE4A 3O5EA 2ZR4A 3KAHA 1E6NA 1QPLA 4URIA 1ZK6A 1J4RA 3AQUA 4TX0A 2ZQSA 2WADA 1LG2A 4L72B 1SYTA 1TCOC 1RD6A 2PPNA 4ZPWR 1ZBKA 2RURA 1F8AB 1I5HW 1ZB5A 2WLZA 1WNOA 5E64A 4R5EA 2WAEA 3AS2A 1K9TA 2DSVA 1D7IA 4LGXA 5HWBA 3H9RB 3WL1A 2E45A 2PI6A 2VCDA 3CHFA 5HW6A 1OGBA 2MLYA 2AWGA 1HJVA 3W4RA 2FAPA 2JMFA 4ODRA 2RQSA 4C02B 1HKKA 2LPVA 2M8JA 3CHCA 1TFVA 1EIBA 1E6ZA 3RFWA 2F2DA 1LQ0A 1K9QA 1FKRA 3KAFA 3TCZA 3O5LA 3WH0A 1FKTA 2WK2A 2A3AA 2M08A 3G6MA 4ODKA 4ODPA 5BXJA 2PPPA 5E66A 4DZ3A 1TR8A 2YBTA 3ARUA 3FAPA 1EG4A 4DRKA 2KR7A 4LAYA 1FKJA 1NWRA 1KT0A 1IX5A 3PRBA 1F40A 2BA1A 3NRKA 4QT2A 1TK7A 3NTPA 4KQZA 5E65A 2O9OA 1GPFA 4DRMA 1WB0A 2M1IA 4DROA 1D6OA 3B9EA 3O5OA 1W9UA 3O5IA 1JMQA 3ARXA 2XPBA 2Q5AA 4W9OA 4Q7NA 4IT4A 1FKKA 5CQ2A 1JNEA 3FY1A 1FKLA 1YATA 3TDBA 2A3CA 4FAPA 2DG3A 2MLZA 4P8VA 4U85A 2A3BA 1LG1A 4WJXA 4MPKA 3O5FA 4S3JA 4W9QA 1LJYA 1ROUA 2QRVA 1NWSA 1GUVA 3B7XA 5DIVA 1J6YA 2M8IA 4DRQA 4BF8A 4A0UA 3CNGA 3WD0A 4NSBA 4WKAA 2K8IA 4JYSA 3ODKA 3UI5A 1UR9A 4NNRA 2B31A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M7N A;  2XP6 A;  2DWV A;  5J6E A;  5HWC A;  1N1A A;  4W9P A;  2PV2 A;  2KO7 A;  1NSG A;  2XPA A;  1FD9 A;  1FJD A;  2RUD A;  1A7X A;  2XP7 A;  3RGC A;  4ODO A;  2D9F A;  4DH0 A;  1U79 A;  2RE3 A;  2DJY A;  2YSH A;  2XP9 A;  3LUO A;  2EZ5 W;  4U84 A;  1JNS A;  2MLX A;  4IQ2 A;  2M2A A;  2KXQ A;  1ROT A;  1FKF A;  1NMW A;  4DRN A;  4JFM A;  2DG4 A;  4TW7 A;  1HXV A;  4U86 A;  3O5M A;  4FN2 A;  4TYO A;  5I98 A;  3OOB A;  3CGM A;  5HTG A;  1BL4 A;  4GGQ A;  2YSI A;  3UQA A;  1Y0O A;  5HKG A;  2L4J A;  4QT3 A;  3O5J A;  1FKH A;  1Q1C A;  4LAX A;  2N87 A;  4MGV A;  4G50 A;  1EG3 A;  4ODQ A;  5HUA A;  1B6C A;  1R9H A;  4ODN A;  3UI6 A;  4TW8 A;  4R0X A;  2ZQT A;  3KAI A;  1FAP A;  2MNT A;  4ITZ A;  1FKS A;  3CGN A;  2KE0 A;  4G2P A;  3VAW A;  4DRJ A;  4REX A;  2ITK A;  2DG9 A;  3TC5 A;  3UQI A;  1Q6U A;  3KAC A;  1W26 A;  2PPO A;  4JFI A;  1J4I A;  1L1P A;  4LAW A;  2F21 A;  2ZQU A;  4JFK A;  4DRP A;  3NI6 A;  1Q6I A;  3IKD A;  1BKF A;  4JFL A;  2MF9 A;  3JXV A;  3KAG A;  1KT1 A;  2LJ4 A;  3MDY B;  3PA7 A;  2KGJ A;  2MDI A;  1WR7 A;  2M3O W;  4IPX A;  3UI4 A;  5HW8 A;  4DRI A;  5DIU A;  4QIB A;  3IKG A;  2XP5 A;  1FKI A;  3O5K A;  2OFN A;  2L2S A;  2JX8 A;  3O5G A;  3O5D A;  1WMV A;  1M5Y A;  1QPF A;  4E5R A;  1K9R A;  2XP8 A;  3O5Q A;  5D75 A;  2YSG A;  1PIN A;  1D7J A;  4IQC A;  2XP3 A;  1QZ2 A;  1ZCN A;  1Q6H A;  1FKD A;  1P5Q A;  4J4N A;  2LAJ A;  2JZV A;  4ODM A;  3M85 A;  5B8I C;  2XP4 A;  2KFW A;  1FKB A;  2PBC A;  1O6W A;  3I6C A;  4J4O A;  5HT1 A;  3O5P A;  3UF8 A;  4TNS A;  2PV3 A;  4DT4 A;  3KCE A;  3EY6 A;  2JXW A;  2UZ5 A;  1FKG A;  4O2T A;  2F4E A;  4JFJ A;  2DMV A;  3KAB A;  1EYM A;  2ZQV A;  2MPH A;  2YSF A;  2RUC A;  3JYM A;  4DIP A;  2ZR6 A;  3GPK A;  2LKN A;  3KZ7 A;  2RSE A;  2YSB A;  2LGO A;  3L4H A;  4TW6 A;  1JNT A;  5DIT A;  1NMV A;  4GIV A;  4N19 A;  1EQ3 A;  1T11 A;  3IK8 A;  4DZ2 A;  2VN1 A;  4ODL A;  2ZR5 A;  5AHT A;  3PRD A;  2KI3 A;  3JYJ A;  3O5R A;  2FKE A;  2Y78 A;  2PV1 A;  2ZAJ A;  2JV4 A;  5GPG A;  1D7H A;  2RUQ A;  2IF4 A;  5HW7 A;  4LAV A;  4MSP A;  2DK1 A;  4DRH A;  2DK7 A;  3UQB A;  3IHZ A;  3KAD A;  1YW5 A;  1PBK A;  1J4H A;  1C9H A;  1JVW A;  3LE4 A;  3O5E A;  2ZR4 A;  3KAH A;  1QPL A;  1ZK6 A;  1J4R A;  4TX0 A;  2ZQS A;  1TCO C;  2PPN A;  2RUR A;  1F8A B;  1I5H W;  1D7I A;  5HWB A;  3H9R B;  2E45 A;  2VCD A;  5HW6 A;  2MLY A;  2AWG A;  2FAP A;  2JMF A;  4ODR A;  2RQS A;  4C02 B;  2LPV A;  2M8J A;  3RFW A;  2F2D A;  1K9Q A;  1FKR A;  3KAF A;  3TCZ A;  3O5L A;  3WH0 A;  1FKT A;  2M08 A;  4ODK A;  4ODP A;  5BXJ A;  2PPP A;  4DZ3 A;  3FAP A;  1EG4 A;  4DRK A;  2KR7 A;  4LAY A;  1FKJ A;  1KT0 A;  3PRB A;  1F40 A;  2BA1 A;  3NRK A;  4QT2 A;  1TK7 A;  3NTP A;  4DRO A;  4DRM A;  2M1I A;  1D6O A;  3O5O A;  3O5I A;  1JMQ A;  2XPB A;  2Q5A A;  4W9O A;  1FKK A;  5CQ2 A;  1FKL A;  1YAT A;  3TDB A;  4FAP A;  2DG3 A;  2MLZ A;  4U85 A;  3O5F A;  4W9Q A;  1ROU A;  3B7X A;  5DIV A;  1J6Y A;  2M8I A;  4DRQ A;  4BF8 A;  3CNG A;  2K8I A;  4JYS A;  3ODK A;  3UI5 A;  4NNR A; 
#chains in the Genus database with same CATH topology
 1HJX A;  3WD1 A;  3M7N A;  2DT3 A;  3RM4 A;  4DWS D;  2XP6 A;  2DWV A;  5J6E A;  3ARY A;  5HWC A;  5E62 A;  1N1A A;  4W9P A;  1E6P A;  2PV2 A;  1NH6 A;  5GPR A;  3WIJ A;  1EDQ A;  2KO7 A;  1NSG A;  3ARQ A;  3ARV A;  2XPA A;  1FD9 A;  1FJD A;  2RUD A;  1A7X A;  4Z2J A;  4AY1 A;  2XP7 A;  4IT6 A;  4P8W A;  1WAW A;  3RGC A;  1HKJ A;  4ODO A;  4DWS B;  2D9F A;  2YBU A;  2B5U B;  3MCB A;  4L3N A;  4DH0 A;  1U79 A;  4P8U A;  2RE3 A;  2DJY A;  3CHD A;  2YSH A;  3AS1 A;  2XP9 A;  3ARZ A;  3LUO A;  2EZ5 W;  4U84 A;  1JNS A;  1UR8 A;  2MLX A;  4IQ2 A;  2M2A A;  2KXQ A;  2OWO A;  1ROT A;  1FKF A;  1NMW A;  3RME A;  4DRN A;  4MNK A;  4ML4 A;  4JFM A;  2DG4 A;  4TW7 A;  1HXV A;  4U86 A;  3O5M A;  4FN2 A;  4TYO A;  5I98 A;  3MQG A;  3OOB A;  2G41 A;  3CGM A;  5E5W A;  3ART A;  1LL7 A;  1BL4 A;  4MAV A;  2PN0 A;  5HTG A;  4GGQ A;  2YSI A;  1X6L A;  3UQA A;  3WQV A;  1Y0O A;  5HKG A;  2L4J A;  4QT3 A;  1OGG A;  3ARP A;  3O5J A;  1FKH A;  2DT2 A;  1Q1C A;  1W1V A;  4LAX A;  2N87 A;  4MGV A;  4G50 A;  1EG3 A;  3WD4 A;  4ODQ A;  5HUA A;  1B6C A;  3WD3 A;  1R9H A;  4S3K A;  4ODN A;  3LKX A;  3UI6 A;  4TW8 A;  4R0X A;  5GQB A;  2ZQT A;  3KAI A;  1FAP A;  4MNM A;  4MNL A;  3WL0 A;  4HAR A;  2MNT A;  3FS8 A;  2QF8 A;  4ITZ A;  1FKS A;  1W9P A;  5U47 A;  4GLX A;  4Z2L A;  3CGN A;  4Z2G A;  2KE0 A;  4G2P A;  5DEZ A;  3VAW A;  4DRJ A;  4REX A;  2O92 A;  4Z2H A;  2Y8N B;  1VF8 A;  1XHG A;  1JND A;  2ITK A;  2DG9 A;  2DSZ A;  3FXY A;  3TC5 A;  1W9V A;  2P4V A;  4KR0 B;  3UQI A;  1Q6U A;  3KAC A;  1W26 A;  3RM9 A;  2PPO A;  4JFI A;  1J4I A;  1H0I A;  1L1P A;  4WKH A;  4LAW A;  2F21 A;  2ZQU A;  4JFK A;  1HKI A;  4DRP A;  3NI6 A;  1Q6I A;  3IKD A;  4W5U A;  1BKF A;  4Z2I A;  2DSU A;  4JFL A;  2MF9 A;  1CTN A;  3PR9 A;  4ZS6 A;  3WD2 A;  3JXV A;  3KAG A;  2ETN A;  3WQW A;  1KT1 A;  2G8Z A;  2LJ4 A;  4XAK A;  3MDY B;  3AS0 A;  2KGJ A;  3B9D A;  3PA7 A;  2MDI A;  2ESC A;  1WR7 A;  2M3O W;  4IPX A;  4MTV A;  3UI4 A;  5HW8 A;  1GOI A;  4DRI A;  1RP5 A;  1OWQ A;  3G6L A;  5DIU A;  4QIB A;  3IKG A;  2XP5 A;  2WLY A;  1FKI A;  3O5K A;  2OFN A;  2L2S A;  1E9L A;  2JX8 A;  3O5G A;  3O5D A;  1WMV A;  2DSW A;  1M5Y A;  3CZ8 A;  2WM0 A;  1QPF A;  4E5R A;  1K9R A;  5JH8 A;  2XP8 A;  3O5Q A;  2FDM A;  5D75 A;  1E44 A;  2YSG A;  4P8X A;  1PIN A;  1D7J A;  4IQC A;  2XP3 A;  1QZ2 A;  1ZCN A;  1FFR A;  1Q6H A;  1NWU A;  1FKD A;  1P5Q A;  4J4N A;  2LAJ A;  2JZV A;  1ZBW A;  4ODM A;  3M85 A;  1ITX A;  5B8I C;  2XP4 A;  2KFW A;  4WIW A;  1ZBC A;  3FSB A;  3ALF A;  1FKB A;  3OA5 A;  1W1P A;  2PBC A;  1O6W A;  4PTM A;  3LKX B;  3I6C A;  4J4O A;  5HT1 A;  1ZBV A;  3O5P A;  4HBE A;  4Q22 A;  4DWS A;  3UF8 A;  4TNS A;  2PV3 A;  4A0T A;  1JCH B;  1LL4 A;  4DT4 A;  3KCE A;  1W1Y A;  3EY6 A;  1LL6 A;  2JXW A;  4Z2K A;  2IUZ A;  2UZ5 A;  3ARW A;  3CHE A;  1FKG A;  1SR0 A;  2DT1 A;  2F4E A;  3ARS A;  4O2T A;  4JFJ A;  3GU0 A;  2DPE A;  1ZL1 A;  2EUL A;  2DMV A;  3KAB A;  4ZPT R;  4DWS C;  1EYM A;  2ZQV A;  3AS3 A;  1NWT A;  2MPH A;  2DT0 A;  2YSF A;  2RUC A;  3PQH A;  1X6N A;  4ZPV R;  3JYM A;  4DIP A;  5HBF A;  2ZR6 A;  3B9A A;  3CH9 A;  3GPK A;  2LKN A;  3KZ7 A;  3WKZ A;  2RSE A;  3RM8 A;  2YSB A;  2LGO A;  3L4H A;  4TW6 A;  1JNT A;  5DIT A;  3EIP A;  4WK9 A;  3MQH A;  4NZC A;  4WKF A;  1NMV A;  1FFQ A;  1H0G A;  4GIV A;  4N19 A;  1EQ3 A;  3B8S A;  4HBO A;  4QZV B;  1T11 A;  3IK8 A;  3PRA A;  4DZ2 A;  1ZU8 A;  2VN1 A;  3ALG A;  2YAJ B;  3ARO A;  4ODL A;  1XRV A;  2ZR5 A;  5AHT A;  3PRD A;  1W1T A;  2KI3 A;  1O6I A;  4MNJ A;  3JYJ A;  3O5R A;  2FKE A;  2Y78 A;  2PV1 A;  2AOS A;  3MCB B;  5DO2 A;  2ZAJ A;  1HJW A;  1EHN A;  2JV4 A;  1D2K A;  1KFW A;  5GPG A;  2OLH A;  1E6R A;  1D7H A;  3FSC A;  2RUQ A;  2IF4 A;  5HW7 A;  1HKM A;  4LAV A;  3QOK A;  4MSP A;  1E15 A;  2DK1 A;  4DRH A;  5DF0 A;  2DK7 A;  3UQB A;  1FLC A;  2A3E A;  3IHZ A;  3KAD A;  1YW5 A;  3BXW A;  1PBK A;  1J4H A;  1C9H A;  1JVW A;  3ARR A;  3LE4 A;  3O5E A;  2ZR4 A;  3KAH A;  1E6N A;  1QPL A;  4URI A;  1ZK6 A;  3BMB A;  1J4R A;  3AQU A;  4TX0 A;  2ZQS A;  2WAD A;  1LG2 A;  4L72 B;  1SYT A;  1TCO C;  1RD6 A;  2PPN A;  4ZPW R;  1ZBK A;  2RUR A;  1F8A B;  1I5H W;  1ZB5 A;  2WLZ A;  1WNO A;  5E64 A;  4R5E A;  2WAE A;  3AS2 A;  1K9T A;  2DSV A;  1D7I A;  4LGX A;  5HWB A;  3H9R B;  3WL1 A;  2E45 A;  2PI6 A;  2VCD A;  3CHF A;  5HW6 A;  1OGB A;  2MLY A;  2AWG A;  1HJV A;  3W4R A;  2FAP A;  2JMF A;  4ODR A;  2RQS A;  4C02 B;  1HKK A;  2LPV A;  2M8J A;  3CHC A;  1TFV A;  1EIB A;  1E6Z A;  3RFW A;  2F2D A;  1LQ0 A;  1K9Q A;  1FKR A;  3KAF A;  3TCZ A;  3O5L A;  3WH0 A;  1FKT A;  2WK2 A;  2A3A A;  2M08 A;  3G6M A;  4ODK A;  3GTY X;  4ODP A;  5BXJ A;  2PPP A;  5E66 A;  4DZ3 A;  1TR8 A;  2YBT A;  3ARU A;  3FAP A;  1EG4 A;  4DRK A;  4UDM A;  2KR7 A;  4LAY A;  1FKJ A;  1NWR A;  1KT0 A;  1IX5 A;  3PRB A;  1F40 A;  2BA1 A;  3NRK A;  4QT2 A;  1TK7 A;  3NTP A;  4KQZ A;  5E65 A;  2O9O A;  1GPF A;  4DRM A;  1WB0 A;  2M1I A;  4DRO A;  1D6O A;  3B9E A;  3O5O A;  1W9U A;  3O5I A;  1JMQ A;  3ARX A;  2XPB A;  1GRJ A;  2Q5A A;  4W9O A;  4Q7N A;  4IT4 A;  1FKK A;  5CQ2 A;  1JNE A;  3FY1 A;  1FKL A;  1YAT A;  3TDB A;  2F23 A;  2A3C A;  4FAP A;  2DG3 A;  2MLZ A;  4P8V A;  4U85 A;  2A3B A;  1LG1 A;  4WJX A;  4MPK A;  3O5F A;  4S3J A;  4W9Q A;  1LJY A;  1ROU A;  2QRV A;  1NWS A;  1GUV A;  3B7X A;  5DIV A;  1J6Y A;  2M8I A;  4DRQ A;  4BF8 A;  4A0U A;  3CNG A;  3WD0 A;  4NSB A;  4WKA A;  2K8I A;  4JYS A;  3ODK A;  3UI5 A;  1UR9 A;  4NNR A;  2B31 A; 
#chains in the Genus database with same CATH homology
 1HJX A;  3WD1 A;  3M7N A;  2DT3 A;  3RM4 A;  4DWS D;  2XP6 A;  2DWV A;  5J6E A;  3ARY A;  5HWC A;  5E62 A;  1N1A A;  4W9P A;  1E6P A;  2PV2 A;  1NH6 A;  5GPR A;  3WIJ A;  1EDQ A;  2KO7 A;  1NSG A;  3ARQ A;  3ARV A;  2XPA A;  1FD9 A;  1FJD A;  2RUD A;  1A7X A;  4Z2J A;  4AY1 A;  2XP7 A;  4IT6 A;  4P8W A;  1WAW A;  3RGC A;  1HKJ A;  4ODO A;  4DWS B;  2D9F A;  2YBU A;  3MCB A;  4L3N A;  4DH0 A;  1U79 A;  4P8U A;  2RE3 A;  2DJY A;  3CHD A;  2YSH A;  3AS1 A;  2XP9 A;  3ARZ A;  3LUO A;  2EZ5 W;  4U84 A;  1JNS A;  1UR8 A;  2MLX A;  4IQ2 A;  2M2A A;  2KXQ A;  2OWO A;  1ROT A;  1FKF A;  1NMW A;  3RME A;  4DRN A;  4MNK A;  4ML4 A;  4JFM A;  2DG4 A;  4TW7 A;  1HXV A;  4U86 A;  3O5M A;  4FN2 A;  4TYO A;  5I98 A;  3MQG A;  3OOB A;  2G41 A;  3CGM A;  5E5W A;  3ART A;  1LL7 A;  1BL4 A;  4MAV A;  5HTG A;  4GGQ A;  2YSI A;  1X6L A;  3UQA A;  3WQV A;  1Y0O A;  5HKG A;  2L4J A;  4QT3 A;  1OGG A;  3ARP A;  3O5J A;  1FKH A;  2DT2 A;  1Q1C A;  1W1V A;  4LAX A;  2N87 A;  4MGV A;  4G50 A;  1EG3 A;  3WD4 A;  4ODQ A;  5HUA A;  1B6C A;  3WD3 A;  1R9H A;  4S3K A;  4ODN A;  3LKX A;  3UI6 A;  4TW8 A;  4R0X A;  5GQB A;  2ZQT A;  3KAI A;  1FAP A;  4MNM A;  4MNL A;  3WL0 A;  4HAR A;  2MNT A;  3FS8 A;  2QF8 A;  4ITZ A;  1FKS A;  1W9P A;  5U47 A;  4GLX A;  4Z2L A;  3CGN A;  4Z2G A;  2KE0 A;  4G2P A;  5DEZ A;  3VAW A;  4DRJ A;  4REX A;  2O92 A;  4Z2H A;  2Y8N B;  1VF8 A;  1XHG A;  1JND A;  2ITK A;  2DG9 A;  2DSZ A;  3FXY A;  3TC5 A;  1W9V A;  4KR0 B;  3UQI A;  1Q6U A;  3KAC A;  1W26 A;  3RM9 A;  2PPO A;  4JFI A;  1J4I A;  1H0I A;  1L1P A;  4WKH A;  4LAW A;  2F21 A;  2ZQU A;  4JFK A;  1HKI A;  4DRP A;  3NI6 A;  1Q6I A;  3IKD A;  4W5U A;  1BKF A;  4Z2I A;  2DSU A;  4JFL A;  2MF9 A;  1CTN A;  3PR9 A;  4ZS6 A;  3WD2 A;  3JXV A;  3KAG A;  3WQW A;  1KT1 A;  2G8Z A;  2LJ4 A;  4XAK A;  3MDY B;  3AS0 A;  2KGJ A;  3B9D A;  3PA7 A;  2MDI A;  2ESC A;  1WR7 A;  2M3O W;  4IPX A;  4MTV A;  3UI4 A;  5HW8 A;  1GOI A;  4DRI A;  1RP5 A;  1OWQ A;  3G6L A;  5DIU A;  4QIB A;  3IKG A;  2XP5 A;  2WLY A;  1FKI A;  3O5K A;  2OFN A;  2L2S A;  1E9L A;  2JX8 A;  3O5G A;  3O5D A;  1WMV A;  2DSW A;  1M5Y A;  3CZ8 A;  2WM0 A;  1QPF A;  4E5R A;  1K9R A;  5JH8 A;  2XP8 A;  3O5Q A;  2FDM A;  5D75 A;  2YSG A;  4P8X A;  1PIN A;  1D7J A;  4IQC A;  2XP3 A;  1QZ2 A;  1ZCN A;  1FFR A;  1Q6H A;  1NWU A;  1FKD A;  1P5Q A;  4J4N A;  2LAJ A;  2JZV A;  1ZBW A;  4ODM A;  3M85 A;  1ITX A;  5B8I C;  2XP4 A;  2KFW A;  4WIW A;  1ZBC A;  3FSB A;  3ALF A;  1FKB A;  3OA5 A;  1W1P A;  2PBC A;  1O6W A;  4PTM A;  3LKX B;  3I6C A;  4J4O A;  5HT1 A;  1ZBV A;  3O5P A;  4HBE A;  4Q22 A;  4DWS A;  3UF8 A;  4TNS A;  2PV3 A;  4A0T A;  4DT4 A;  1LL4 A;  3KCE A;  1W1Y A;  3EY6 A;  1LL6 A;  2JXW A;  4Z2K A;  2IUZ A;  2UZ5 A;  3ARW A;  3CHE A;  1FKG A;  1SR0 A;  2DT1 A;  2F4E A;  3ARS A;  4O2T A;  4JFJ A;  2DPE A;  1ZL1 A;  2DMV A;  3KAB A;  4ZPT R;  4DWS C;  1EYM A;  2ZQV A;  3AS3 A;  1NWT A;  2MPH A;  2DT0 A;  2YSF A;  2RUC A;  3PQH A;  1X6N A;  4ZPV R;  3JYM A;  4DIP A;  5HBF A;  2ZR6 A;  3B9A A;  3CH9 A;  3GPK A;  2LKN A;  3KZ7 A;  3WKZ A;  2RSE A;  3RM8 A;  2YSB A;  2LGO A;  3L4H A;  4TW6 A;  1JNT A;  5DIT A;  4WK9 A;  3MQH A;  4NZC A;  4WKF A;  1NMV A;  1FFQ A;  1H0G A;  4GIV A;  4N19 A;  1EQ3 A;  3B8S A;  4HBO A;  4QZV B;  1T11 A;  3IK8 A;  3PRA A;  4DZ2 A;  1ZU8 A;  2VN1 A;  3ALG A;  2YAJ B;  3ARO A;  4ODL A;  1XRV A;  2ZR5 A;  5AHT A;  3PRD A;  1W1T A;  2KI3 A;  1O6I A;  4MNJ A;  3JYJ A;  3O5R A;  2FKE A;  2Y78 A;  2PV1 A;  2AOS A;  3MCB B;  5DO2 A;  2ZAJ A;  1HJW A;  1EHN A;  2JV4 A;  1D2K A;  1KFW A;  5GPG A;  2OLH A;  1E6R A;  1D7H A;  3FSC A;  2RUQ A;  2IF4 A;  5HW7 A;  1HKM A;  4LAV A;  3QOK A;  4MSP A;  1E15 A;  2DK1 A;  4DRH A;  5DF0 A;  2DK7 A;  3UQB A;  1FLC A;  2A3E A;  3IHZ A;  3KAD A;  1YW5 A;  3BXW A;  1PBK A;  1J4H A;  1C9H A;  1JVW A;  3ARR A;  3LE4 A;  3O5E A;  2ZR4 A;  3KAH A;  1E6N A;  1QPL A;  4URI A;  1ZK6 A;  1J4R A;  3AQU A;  4TX0 A;  2ZQS A;  2WAD A;  1LG2 A;  4L72 B;  1SYT A;  1TCO C;  1RD6 A;  2PPN A;  4ZPW R;  1ZBK A;  2RUR A;  1F8A B;  1I5H W;  1ZB5 A;  2WLZ A;  1WNO A;  5E64 A;  4R5E A;  2WAE A;  3AS2 A;  1K9T A;  2DSV A;  1D7I A;  4LGX A;  5HWB A;  3H9R B;  3WL1 A;  2E45 A;  2PI6 A;  2VCD A;  3CHF A;  5HW6 A;  1OGB A;  2MLY A;  2AWG A;  1HJV A;  3W4R A;  2FAP A;  2JMF A;  4ODR A;  2RQS A;  4C02 B;  1HKK A;  2LPV A;  2M8J A;  3CHC A;  1TFV A;  1EIB A;  1E6Z A;  3RFW A;  2F2D A;  1LQ0 A;  1K9Q A;  1FKR A;  3KAF A;  3TCZ A;  3O5L A;  3WH0 A;  1FKT A;  2WK2 A;  2A3A A;  2M08 A;  3G6M A;  4ODK A;  4ODP A;  5BXJ A;  2PPP A;  5E66 A;  4DZ3 A;  1TR8 A;  2YBT A;  3ARU A;  3FAP A;  1EG4 A;  4DRK A;  2KR7 A;  4LAY A;  1FKJ A;  1NWR A;  1KT0 A;  1IX5 A;  3PRB A;  1F40 A;  2BA1 A;  3NRK A;  4QT2 A;  1TK7 A;  3NTP A;  4KQZ A;  5E65 A;  2O9O A;  1GPF A;  4DRM A;  1WB0 A;  2M1I A;  4DRO A;  1D6O A;  3B9E A;  3O5O A;  1W9U A;  3O5I A;  1JMQ A;  3ARX A;  2XPB A;  2Q5A A;  4W9O A;  4Q7N A;  4IT4 A;  1FKK A;  5CQ2 A;  1JNE A;  3FY1 A;  1FKL A;  1YAT A;  3TDB A;  2A3C A;  4FAP A;  2DG3 A;  2MLZ A;  4P8V A;  4U85 A;  2A3B A;  1LG1 A;  4WJX A;  4MPK A;  3O5F A;  4S3J A;  4W9Q A;  1LJY A;  1ROU A;  2QRV A;  1NWS A;  1GUV A;  3B7X A;  5DIV A;  1J6Y A;  2M8I A;  4DRQ A;  4BF8 A;  4A0U A;  3CNG A;  3WD0 A;  4NSB A;  4WKA A;  2K8I A;  4JYS A;  3ODK A;  3UI5 A;  1UR9 A;  4NNR A;  2B31 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...