2XP9A

Discovery of cell-active phenyl-imidazole pin1 inhibitors by structure-guided fragment evolution
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
157
structure length
144
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of Cell-Active Phenyl-Imidazole Pin1 Inhibitors by Structure-Guided Fragment Evolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords PEPTIDYL-PROLYL CIS-TRANS ISOMERASE NIMA-INTERACTING 1
total genus 46
structure length 144
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2xp9A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2xp9A02
3UQIA 3O5PA 1PINA 5AHTA 5HTGA 2VN1A 2KXQA 5HW8A 1NSGA 3NRKA 3O5DA 4U85A 2M3OW 2MLXA 4TNSA 3KAGA 5J6EA 1FJDA 1FKBA 5I98A 4O2TA 2RSEA 4JFJA 2M8JA 2IF4A 2XP7A 2FKEA 3IHZA 4W9OA 3M85A 2MPHA 4MGVA 1D6OA 2KI3A 2RUDA 3IKGA 2YSGA 1EG3A 1Q1CA 2Y78A 4TYOA 2D9FA 4LAWA 2F2DA 1K9QA 4ODQA 5D75A 5GPGA 2PBCA 5HUAA 2BA1A 1FKTA 2F21A 5DITA 2YSFA 1D7HA 4DRNA 3VAWA 3TCZA 3FAPA 4C02B 1D7JA 4DRKA 4DT4A 5HKGA 4GIVA 3TC5A 1HXVA 4U86A 3O5MA 4DRQA 3JXVA 1NMWA 2XPAA 1K9RA 3KACA 2PV3A 3B7XA 3O5KA 4ODKA 4R0XA 4W9PA 3H9RB 5HT1A 1FKJA 3KAFA 4TW8A 4DRIA 1J4HA 4J4NA 1J4RA 2PPPA 5BXJA 3RGCA 3LUOA 1FKSA 2MLYA 2LKNA 4LAXA 4GGQA 4QIBA 3CGNA 3UQBA 3GPKA 3KABA 2KFWA 2MNTA 1J4IA 1F40A 2JV4A 3WH0A 1ROTA 3O5RA 2M08A 2JMFA 4E5RA 3O5OA 4ODOA 5HW7A 2N87A 2ZQUA 3UI5A 3KADA 2DK1A 3O5JA 4LAVA 1QPFA 3JYJA 4ODNA 1QPLA 2PPOA 3O5QA 3RFWA 4DRPA 1WR7A 3MDYB 2RUQA 2ZR4A 4FAPA 4NNRA 3JYMA 2KE0A 1N1AA 1Q6HA 2K8IA 2LPVA 4J4OA 2ZQSA 4DIPA 5B8IC 3PRDA 4JFLA 1TCOC 4QT2A 5DIVA 2L4JA 4JFIA 5HWCA 5HWBA 4MSPA 2YSHA 1Q6UA 5CQ2A 4REXA 2RE3A 1FKGA 2JZVA 4ODRA 3O5FA 3KCEA 2XP3A 4DH0A 4G2PA 5HW6A 1FKKA 2KR7A 2PV2A 4TW7A 5DIUA 3PRBA 2DG3A 2EZ5W 3KZ7A 3CGMA 2DK7A 4DRMA 3L4HA 3KAIA 4DRJA 1NMVA 3LE4A 1L1PA 2M2AA 1TK7A 2E45A 2ZAJA 4DROA 4U84A 3TDBA 2LAJA 2XP9A 1BL4A 4JFMA 4ITZA 1JMQA 1C9HA 2RUCA 1D7IA 4G50A 4LAYA 1FKDA 2DJYA 2XP6A 2XPBA 1ZCNA 1R9HA 2DG9A 2KGJA 3UQAA 4TX0A 2ITKA 2ZQTA 3OOBA 1I5HW 4ODMA 2JX8A 1EQ3A 3EY6A 2UZ5A 2ZR5A 1JNTA 1Y0OA 2VCDA 1FD9A 2DG4A 4FN2A 1JNSA 2AWGA 2LGOA 2DMVA 1B6CA 1EYMA 4ODLA 2L2SA 4DZ2A 2ZQVA 1EG4A 1KT1A 1W26A 2JXWA 4IQ2A 1PBKA 1T11A 1M5YA 3ODKA 2XP8A 1ROUA 2M1IA 3O5EA 3O5IA 1F8AB 4IPXA 2DWVA 1FKIA 2M8IA 4N19A 1BKFA 2MDIA 3M7NA 2RQSA 4JYSA 1YATA 2YSBA 2PV1A 4QT3A 1J6YA 1FKRA 4DRHA 3O5GA 3UI6A 1JVWA 1O6WA 1P5QA 3NTPA 3IK8A 3IKDA 3PA7A 3CNGA 3NI6A 4JFKA 4DZ3A 4W9QA 3UI4A 1WMVA 1Q6IA 2MLZA 2F4EA 2FAPA 2MF9A 1YW5A 3O5LA 2LJ4A 4ODPA 2YSIA 2ZR6A 1QZ2A 3UF8A 1FKHA 2KO7A 2Q5AA 4IQCA 4TW6A 2XP4A 1U79A 2RURA 2XP5A 1FAPA 2OFNA 2PPNA 1FKFA 1A7XA 1ZK6A 4BF8A 3KAHA 1KT0A 3I6CA 1FKLA
chains in the Genus database with same CATH superfamily
3O5PA 1PINA 5HTGA 1TFVA 2VN1A 1NSGA 2MLXA 4S3KA 4WIWA 1X6LA 4O2TA 4WKFA 1H0IA 2XP7A 2MPHA 4MGVA 1D6OA 1LG1A 2Y78A 2A3BA 4ODQA 5HBFA 2BA1A 1FKTA 2F21A 1LG2A 3CHCA 3TCZA 3FAPA 3ARPA 4C02B 4DT4A 5HKGA 4GIVA 1HXVA 3O5MA 1NMWA 2PV3A 3ARRA 3H9RB 4W9PA 4TW8A 3MCBB 1UR9A 2PPPA 4GGQA 4QIBA 3CGNA 2DT3A 4WKHA 5E5WA 4E5RA 3B8SA 4MNLA 3UI5A 1LL6A 2WADA 3JYJA 4ODNA 1WR7A 3MDYB 2ZR4A 3WD2A 1Q6HA 1E6RA 5B8IC 4JFIA 4WK9A 4MSPA 2YSHA 5GPGA 5CQ2A 4REXA 2RE3A 1FKGA 2YBTA 2DSZA 3KCEA 1ITXA 4G2PA 2KR7A 1E44A 3BXWA 4NZCA 3L4HA 3KAIA 4DRJA 3WL1A 1L1PA 1SYTA 2ZAJA 2O92A 4P8VA 1ZBVA 1BL4A 1XHGA 3EIPA 4ITZA 3MQHA 2RUCA 4G50A 1H0GA 4LAYA 5HW7A 1R9HA 1LJYA 2F23A 2KGJA 3AS0A 4TX0A 4AY1A 2ZQTA 4Z2IA 1W1YA 1W9UA 1JNTA 1FD9A 1E6PA 1RD6A 2DMVA 4ODLA 3ARWA 3CHDA 1T11A 1OGGA 2G41A 1EIBA 1F8AB 3M7NA 1E6ZA 2YSBA 1WAWA 1J6YA 1VF8A 2QRVA 1P5QA 4JFKA 3PA7A 1GOIA 5DEZA 4QZVB 2FAPA 3ARYA 1OGBA 1QZ2A 3CHEA 3WQVA 1W9VA 1NWTA 2XP5A 2OFNA 1W1VA 3QOKA 1ZK6A 1F40A 3KAHA 1FKLA 3UQIA 4IT6A 2KXQA 3NRKA 3O5DA 5J6EA 3KAGA 2IUZA 5I98A 2RSEA 1TR8A 2IF4A 1W9PA 3IHZA 3M85A 1NWUA 1HKJA 4DWSA 1K9QA 2PBCA 1HKIA 1NWSA 1D7JA 3JXVA 1K9RA 1GRJA 3B7XA 4R0XA 1FKJA 3PRAA 1WNOA 4J4NA 3WIJA 2DSUA 3LKXB 4LAXA 1E6NA 5JH8A 3RM9A 1K9TA 3MQGA 2KFWA 3WD1A 5E65A 4WKAA 2DK1A 3GU0A 1QPFA 2PPOA 3O5QA 3RFWA 4DRPA 4MNMA 1HJXA 2K8IA 2OLHA 4J4OA 5DIVA 4QT2A 4P8XA 5HWBA 4ODRA 3O5FA 4DH0A 4ZPVR 2DG3A 3WD3A 3KZ7A 2DK7A 1HJVA 4U84A 2LAJA 2XP9A 4LGXA 2DT0A 3LKXA 3UQAA 1ZCNA 5DF0A 1I5HW 3OOBA 1Y0OA 4KR0B 4ML4A 5GPRA 4Q7NA 1EYMA 1KT1A 1UR8A 2P4VA 1W26A 3PQHA 4IQ2A 5DO2A 1M5YA 4IPXA 2DT2A 2WM0A 3O5IA 1ZL1A 2DWVA 1FKIA 4N19A 1W1TA 1GUVA 1FKRA 3UI6A 1O6WA 2DSWA 2A3AA 3NI6A 3UI4A 3ARQA 3FXYA 3ARZA 3AS3A 3FSCA 2OWOA 3UF8A 4IQCA 1CTNA 2PPNA 4Z2HA 1FKFA 3WQWA 4BF8A 3I6CA 5AHTA 1E15A 1FFRA 4U85A 2M3OW 4TNSA 4JFJA 4MAVA 2M8JA 1HKMA 2FKEA 4IT4A 3PR9A 4W9OA 1GPFA 1EG3A 1Q1CA 2D9FA 4P8UA 4LAWA 2F2DA 5D75A 1W1PA 5DITA 1D7HA 4DWSD 3VAWA 4DRKA 3FY1A 4DRQA 1HJWA 2XPAA 3KACA 5HT1A 4DRIA 2DT1A 3KAFA 3AROA 1J4HA 3G6MA 3LUOA 1FKSA 2MLYA 2LKNA 3ARUA 3UQBA 2AOSA 3KABA 1J4IA 2YBUA 3RMEA 2JV4A 3WH0A 3O5RA 4ODOA 2JMFA 2B31A 3O5OA 2N87A 5GQBA 3KADA 3O5JA 4LAVA 3W4RA 4A0TA 5U47A 2RUQA 4NNRA 4UDMA 1LL7A 3JYMA 1N1AA 2DPEA 3ARSA 4DIPA 2ZQSA 1D2KA 1EHNA 2WK2A 4MNJA 4XAKA 1TCOC 2L4JA 2WAEA 3ALGA 1EDQA 1FKKA 2PV2A 4TW7A 5DIUA 3GTYX 2EZ5W 3CGMA 1JCHB 1X6NA 1NMVA 3LE4A 2M2AA 3B9DA 5E62A 4Z2JA 3TDBA 1JMQA 1C9HA 4FAPA 2EULA 2ITKA 4ODMA 4P8WA 4DWSC 2JX8A 3AQUA 3EY6A 3WD0A 1JNSA 1XRVA 2AWGA 1JNDA 3B9AA 2ZQVA 1EG4A 1PBKA 2M1IA 1ROUA 4ZS6A 4MNKA 1SR0A 2MDIA 4JYSA 1YATA 2PV1A 4DRHA 3O5GA 2ESCA 2B5UB 1JVWA 3IKDA 3IK8A 4Z2LA 3CNGA 4DZ3A 1E9LA 1Q6IA 2MLZA 4DWSB 1YW5A 2YAJB 1JNEA 3O5LA 2LJ4A 2YSIA 1FKHA 2DSVA 2KO7A 2XP4A 3AS2A 1A7XA 1KT0A 4KQZA 1EQ3A 5HW8A 4URIA 4GLXA 1FJDA 4R5EA 1FKBA 1ZBWA 1NWRA 4A0UA 3FSBA 1RP5A 3OA5A 4ZPTR 4MPKA 2RUDA 2KI3A 3IKGA 3ARXA 5E66A 2YSGA 4TYOA 3CHFA 1O6IA 1IX5A 5HUAA 4L3NA 2YSFA 4DRNA 1KFWA 3G6LA 3TC5A 4U86A 3BMBA 4ODKA 2Y8NB 3FS8A 3WD4A 3O5KA 3RM4A 1J4RA 5BXJA 3RGCA 3RM8A 1LQ0A 1FLCA 3GPKA 2MNTA 1FFQA 1ROTA 2M08A 2ZQUA 4Z2KA 1QPLA 4ZPWR 2FDMA 3WKZA 4HARA 1LL4A 2KE0A 2LPVA 3PRDA 4JFLA 4L72B 3WL0A 5HWCA 1Q6UA 2JZVA 1OWQA 2XP3A 1NH6A 5HW6A 4S3JA 4WJXA 1ZBCA 3PRBA 3ALFA 4Q22A 4Z2GA 4DRMA 1ZB5A 3CZ8A 5E64A 1TK7A 2E45A 2ETNA 4DROA 3B9EA 4JFMA 1D7IA 1FKDA 2DJYA 2XP6A 2XPBA 2DG9A 1ZBKA 2O9OA 4MTVA 2UZ5A 2ZR5A 3AS1A 4W5UA 2G8ZA 2VCDA 4FN2A 2DG4A 2LGOA 1B6CA 4DZ2A 2L2SA 1WB0A 2JXWA 4HBOA 3ODKA 2XP8A 2A3CA 3O5EA 1HKKA 3MCBA 2M8IA 3ARVA 1BKFA 2RQSA 4NSBA 4QT3A 2A3EA 3ARTA 3NTPA 4PTMA 4W9QA 1WMVA 2WLZA 2PN0A 3CH9A 4HBEA 2WLYA 2F4EA 2MF9A 4ODPA 2ZR6A 2Q5AA 4TW6A 1U79A 2QF8A 2RURA 1FAPA 1ZU8A 2PI6A
chains in the Genus database with same CATH topology
3O5PA 1PINA 5HTGA 1TFVA 2VN1A 1NSGA 2MLXA 4S3KA 4WIWA 1X6LA 4O2TA 4WKFA 1H0IA 2XP7A 2MPHA 4MGVA 1D6OA 1LG1A 2Y78A 2A3BA 4ODQA 5HBFA 2BA1A 1FKTA 2F21A 1LG2A 3CHCA 3TCZA 3FAPA 3ARPA 4C02B 4DT4A 5HKGA 4GIVA 1HXVA 3O5MA 1NMWA 2PV3A 3ARRA 3H9RB 4W9PA 4TW8A 3MCBB 1UR9A 2PPPA 4GGQA 4QIBA 3CGNA 2DT3A 4WKHA 5E5WA 4E5RA 3B8SA 4MNLA 3UI5A 1LL6A 2WADA 3JYJA 4ODNA 1WR7A 3MDYB 2ZR4A 3WD2A 1Q6HA 1E6RA 5B8IC 4JFIA 4WK9A 4MSPA 2YSHA 5GPGA 5CQ2A 4REXA 2RE3A 1FKGA 2YBTA 2DSZA 3KCEA 1ITXA 4G2PA 2KR7A 3BXWA 4NZCA 3L4HA 3KAIA 4DRJA 3WL1A 1L1PA 1SYTA 2ZAJA 2O92A 4P8VA 1ZBVA 1BL4A 1XHGA 4ITZA 3MQHA 2RUCA 4G50A 1H0GA 4LAYA 5HW7A 1R9HA 1LJYA 2KGJA 3AS0A 4TX0A 4AY1A 2ZQTA 4Z2IA 1W1YA 1W9UA 1JNTA 1FD9A 1E6PA 1RD6A 2DMVA 4ODLA 3ARWA 3CHDA 1T11A 1OGGA 2G41A 1EIBA 1F8AB 3M7NA 1E6ZA 2YSBA 1WAWA 1J6YA 1VF8A 2QRVA 1P5QA 4JFKA 3PA7A 1GOIA 5DEZA 4QZVB 2FAPA 3ARYA 1OGBA 1QZ2A 3CHEA 3WQVA 1W9VA 1NWTA 2XP5A 2OFNA 1W1VA 3QOKA 1ZK6A 1F40A 3KAHA 1FKLA 3UQIA 4IT6A 2KXQA 3NRKA 3O5DA 5J6EA 3KAGA 2IUZA 5I98A 2RSEA 1TR8A 2IF4A 1W9PA 3IHZA 3M85A 1NWUA 1HKJA 4DWSA 1K9QA 2PBCA 1HKIA 1NWSA 1D7JA 3JXVA 1K9RA 3B7XA 4R0XA 1FKJA 3PRAA 1WNOA 4J4NA 3WIJA 2DSUA 3LKXB 4LAXA 1E6NA 5JH8A 3RM9A 1K9TA 3MQGA 2KFWA 3WD1A 5E65A 4WKAA 2DK1A 1QPFA 2PPOA 3O5QA 3RFWA 4DRPA 4MNMA 1HJXA 2K8IA 2OLHA 4J4OA 5DIVA 4QT2A 4P8XA 5HWBA 4ODRA 3O5FA 4DH0A 4ZPVR 2DG3A 3WD3A 3KZ7A 2DK7A 1HJVA 4U84A 2LAJA 2XP9A 4LGXA 2DT0A 3LKXA 3UQAA 1ZCNA 5DF0A 1I5HW 3OOBA 1Y0OA 4KR0B 4ML4A 5GPRA 4Q7NA 1EYMA 1KT1A 1UR8A 1W26A 3PQHA 4IQ2A 5DO2A 1M5YA 4IPXA 2DT2A 2WM0A 3O5IA 1ZL1A 2DWVA 1FKIA 4N19A 1W1TA 1GUVA 1FKRA 3UI6A 1O6WA 2DSWA 2A3AA 3NI6A 3UI4A 3ARQA 3FXYA 3ARZA 3AS3A 3FSCA 2OWOA 3UF8A 4IQCA 1CTNA 2PPNA 4Z2HA 1FKFA 3WQWA 4BF8A 3I6CA 5AHTA 1E15A 1FFRA 4U85A 2M3OW 4TNSA 4JFJA 4MAVA 2M8JA 1HKMA 2FKEA 4IT4A 3PR9A 4W9OA 1GPFA 1EG3A 1Q1CA 2D9FA 4P8UA 4LAWA 2F2DA 5D75A 1W1PA 5DITA 1D7HA 4DWSD 3VAWA 4DRKA 3FY1A 4DRQA 1HJWA 2XPAA 3KACA 5HT1A 4DRIA 2DT1A 3KAFA 3AROA 1J4HA 3G6MA 3LUOA 1FKSA 2MLYA 2LKNA 3ARUA 3UQBA 2AOSA 3KABA 1J4IA 2YBUA 3RMEA 2JV4A 3WH0A 3O5RA 4ODOA 2JMFA 2B31A 3O5OA 2N87A 5GQBA 3KADA 3O5JA 4LAVA 3W4RA 4A0TA 5U47A 2RUQA 4NNRA 1LL7A 3JYMA 1N1AA 2DPEA 3ARSA 4DIPA 2ZQSA 1D2KA 1EHNA 2WK2A 4MNJA 4XAKA 1TCOC 2L4JA 2WAEA 3ALGA 1EDQA 1FKKA 2PV2A 4TW7A 5DIUA 2EZ5W 3CGMA 1X6NA 1NMVA 3LE4A 2M2AA 3B9DA 5E62A 4Z2JA 3TDBA 1JMQA 1C9HA 4FAPA 2ITKA 4ODMA 4P8WA 4DWSC 2JX8A 3AQUA 3EY6A 3WD0A 1JNSA 1XRVA 2AWGA 1JNDA 3B9AA 2ZQVA 1EG4A 1PBKA 2M1IA 1ROUA 4ZS6A 4MNKA 1SR0A 2MDIA 4JYSA 1YATA 2PV1A 4DRHA 3O5GA 2ESCA 1JVWA 3IKDA 3IK8A 4Z2LA 3CNGA 4DZ3A 1E9LA 1Q6IA 2MLZA 4DWSB 1YW5A 2YAJB 1JNEA 3O5LA 2LJ4A 2YSIA 1FKHA 2DSVA 2KO7A 2XP4A 3AS2A 1A7XA 1KT0A 4KQZA 1EQ3A 5HW8A 4URIA 4GLXA 1FJDA 4R5EA 1FKBA 1ZBWA 1NWRA 4A0UA 3FSBA 1RP5A 3OA5A 4ZPTR 4MPKA 2RUDA 2KI3A 3IKGA 3ARXA 5E66A 2YSGA 4TYOA 3CHFA 1O6IA 1IX5A 5HUAA 4L3NA 2YSFA 4DRNA 1KFWA 3G6LA 3TC5A 4U86A 4ODKA 2Y8NB 3FS8A 3WD4A 3O5KA 3RM4A 1J4RA 5BXJA 3RGCA 3RM8A 1LQ0A 1FLCA 3GPKA 2MNTA 1FFQA 1ROTA 2M08A 2ZQUA 4Z2KA 1QPLA 4ZPWR 2FDMA 3WKZA 4HARA 1LL4A 2KE0A 2LPVA 3PRDA 4JFLA 4L72B 3WL0A 5HWCA 1Q6UA 2JZVA 1OWQA 2XP3A 1NH6A 5HW6A 4S3JA 4WJXA 1ZBCA 3PRBA 3ALFA 4Q22A 4Z2GA 4DRMA 1ZB5A 3CZ8A 5E64A 1TK7A 2E45A 4DROA 3B9EA 4JFMA 1D7IA 1FKDA 2DJYA 2XP6A 2XPBA 2DG9A 1ZBKA 2O9OA 4MTVA 2UZ5A 2ZR5A 3AS1A 4W5UA 2G8ZA 2VCDA 4FN2A 2DG4A 2LGOA 1B6CA 4DZ2A 2L2SA 1WB0A 2JXWA 4HBOA 3ODKA 2XP8A 2A3CA 3O5EA 1HKKA 3MCBA 2M8IA 3ARVA 1BKFA 2RQSA 4NSBA 4QT3A 2A3EA 3ARTA 3NTPA 4PTMA 4W9QA 1WMVA 2WLZA 3CH9A 4HBEA 2WLYA 2F4EA 2MF9A 4ODPA 2ZR6A 2Q5AA 4TW6A 1U79A 2QF8A 2RURA 1FAPA 1ZU8A 2PI6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UQI A;  3O5P A;  1PIN A;  5AHT A;  5HTG A;  2VN1 A;  2KXQ A;  5HW8 A;  1NSG A;  3NRK A;  3O5D A;  4U85 A;  2M3O W;  2MLX A;  4TNS A;  3KAG A;  5J6E A;  1FJD A;  1FKB A;  5I98 A;  4O2T A;  2RSE A;  4JFJ A;  2M8J A;  2IF4 A;  2XP7 A;  2FKE A;  3IHZ A;  4W9O A;  3M85 A;  2MPH A;  4MGV A;  1D6O A;  2KI3 A;  2RUD A;  3IKG A;  2YSG A;  1EG3 A;  1Q1C A;  2Y78 A;  4TYO A;  2D9F A;  4LAW A;  2F2D A;  1K9Q A;  4ODQ A;  5D75 A;  5GPG A;  2PBC A;  5HUA A;  2BA1 A;  1FKT A;  2F21 A;  5DIT A;  2YSF A;  1D7H A;  4DRN A;  3VAW A;  3TCZ A;  3FAP A;  4C02 B;  1D7J A;  4DRK A;  4DT4 A;  5HKG A;  4GIV A;  3TC5 A;  1HXV A;  4U86 A;  3O5M A;  4DRQ A;  3JXV A;  1NMW A;  2XPA A;  1K9R A;  3KAC A;  2PV3 A;  3B7X A;  3O5K A;  4ODK A;  4R0X A;  4W9P A;  3H9R B;  5HT1 A;  1FKJ A;  3KAF A;  4TW8 A;  4DRI A;  1J4H A;  4J4N A;  1J4R A;  2PPP A;  5BXJ A;  3RGC A;  3LUO A;  1FKS A;  2MLY A;  2LKN A;  4LAX A;  4GGQ A;  4QIB A;  3CGN A;  3UQB A;  3GPK A;  3KAB A;  2KFW A;  2MNT A;  1J4I A;  1F40 A;  2JV4 A;  3WH0 A;  1ROT A;  3O5R A;  2M08 A;  2JMF A;  4E5R A;  3O5O A;  4ODO A;  5HW7 A;  2N87 A;  2ZQU A;  3UI5 A;  3KAD A;  2DK1 A;  3O5J A;  4LAV A;  1QPF A;  3JYJ A;  4ODN A;  1QPL A;  2PPO A;  3O5Q A;  3RFW A;  4DRP A;  1WR7 A;  3MDY B;  2RUQ A;  2ZR4 A;  4FAP A;  4NNR A;  3JYM A;  2KE0 A;  1N1A A;  1Q6H A;  2K8I A;  2LPV A;  4J4O A;  2ZQS A;  4DIP A;  5B8I C;  3PRD A;  4JFL A;  1TCO C;  4QT2 A;  5DIV A;  2L4J A;  4JFI A;  5HWC A;  5HWB A;  4MSP A;  2YSH A;  1Q6U A;  5CQ2 A;  4REX A;  2RE3 A;  1FKG A;  2JZV A;  4ODR A;  3O5F A;  3KCE A;  2XP3 A;  4DH0 A;  4G2P A;  5HW6 A;  1FKK A;  2KR7 A;  2PV2 A;  4TW7 A;  5DIU A;  3PRB A;  2DG3 A;  2EZ5 W;  3KZ7 A;  3CGM A;  2DK7 A;  4DRM A;  3L4H A;  3KAI A;  4DRJ A;  1NMV A;  3LE4 A;  1L1P A;  2M2A A;  1TK7 A;  2E45 A;  2ZAJ A;  4DRO A;  4U84 A;  3TDB A;  2LAJ A;  2XP9 A;  1BL4 A;  4JFM A;  4ITZ A;  1JMQ A;  1C9H A;  2RUC A;  1D7I A;  4G50 A;  4LAY A;  1FKD A;  2DJY A;  2XP6 A;  2XPB A;  1ZCN A;  1R9H A;  2DG9 A;  2KGJ A;  3UQA A;  4TX0 A;  2ITK A;  2ZQT A;  3OOB A;  1I5H W;  4ODM A;  2JX8 A;  1EQ3 A;  3EY6 A;  2UZ5 A;  2ZR5 A;  1JNT A;  1Y0O A;  2VCD A;  1FD9 A;  2DG4 A;  4FN2 A;  1JNS A;  2AWG A;  2LGO A;  2DMV A;  1B6C A;  1EYM A;  4ODL A;  2L2S A;  4DZ2 A;  2ZQV A;  1EG4 A;  1KT1 A;  1W26 A;  2JXW A;  4IQ2 A;  1PBK A;  1T11 A;  1M5Y A;  3ODK A;  2XP8 A;  1ROU A;  2M1I A;  3O5E A;  3O5I A;  1F8A B;  4IPX A;  2DWV A;  1FKI A;  2M8I A;  4N19 A;  1BKF A;  2MDI A;  3M7N A;  2RQS A;  4JYS A;  1YAT A;  2YSB A;  2PV1 A;  4QT3 A;  1J6Y A;  1FKR A;  4DRH A;  3O5G A;  3UI6 A;  1JVW A;  1O6W A;  1P5Q A;  3NTP A;  3IK8 A;  3IKD A;  3PA7 A;  3CNG A;  3NI6 A;  4JFK A;  4DZ3 A;  4W9Q A;  3UI4 A;  1WMV A;  1Q6I A;  2MLZ A;  2F4E A;  2FAP A;  2MF9 A;  1YW5 A;  3O5L A;  2LJ4 A;  4ODP A;  2YSI A;  2ZR6 A;  1QZ2 A;  3UF8 A;  1FKH A;  2KO7 A;  2Q5A A;  4IQC A;  4TW6 A;  2XP4 A;  1U79 A;  2RUR A;  2XP5 A;  1FAP A;  2OFN A;  2PPN A;  1FKF A;  1A7X A;  1ZK6 A;  4BF8 A;  3KAH A;  1KT0 A;  3I6C A;  1FKL A; 
#chains in the Genus database with same CATH topology
 3O5P A;  1PIN A;  5HTG A;  1TFV A;  2VN1 A;  1NSG A;  2MLX A;  4S3K A;  4WIW A;  1X6L A;  4O2T A;  4WKF A;  1H0I A;  2XP7 A;  2MPH A;  4MGV A;  1D6O A;  1LG1 A;  2Y78 A;  2A3B A;  4ODQ A;  5HBF A;  2BA1 A;  1FKT A;  2F21 A;  1LG2 A;  3CHC A;  3TCZ A;  3FAP A;  3ARP A;  4C02 B;  4DT4 A;  5HKG A;  4GIV A;  1HXV A;  3O5M A;  1NMW A;  2PV3 A;  3ARR A;  3H9R B;  4W9P A;  4TW8 A;  3MCB B;  1UR9 A;  2PPP A;  4GGQ A;  4QIB A;  3CGN A;  2DT3 A;  4WKH A;  5E5W A;  4E5R A;  3B8S A;  4MNL A;  3UI5 A;  1LL6 A;  2WAD A;  3JYJ A;  4ODN A;  1WR7 A;  3MDY B;  2ZR4 A;  3WD2 A;  1Q6H A;  1E6R A;  5B8I C;  4JFI A;  4WK9 A;  4MSP A;  2YSH A;  5GPG A;  5CQ2 A;  4REX A;  2RE3 A;  1FKG A;  2YBT A;  2DSZ A;  3KCE A;  1ITX A;  4G2P A;  2KR7 A;  1E44 A;  3BXW A;  4NZC A;  3L4H A;  3KAI A;  4DRJ A;  3WL1 A;  1L1P A;  1SYT A;  2ZAJ A;  2O92 A;  4P8V A;  1ZBV A;  1BL4 A;  1XHG A;  3EIP A;  4ITZ A;  3MQH A;  2RUC A;  4G50 A;  1H0G A;  4LAY A;  5HW7 A;  1R9H A;  1LJY A;  2F23 A;  2KGJ A;  3AS0 A;  4TX0 A;  4AY1 A;  2ZQT A;  4Z2I A;  1W1Y A;  1W9U A;  1JNT A;  1FD9 A;  1E6P A;  1RD6 A;  2DMV A;  4ODL A;  3ARW A;  3CHD A;  1T11 A;  1OGG A;  2G41 A;  1EIB A;  1F8A B;  3M7N A;  1E6Z A;  2YSB A;  1WAW A;  1J6Y A;  1VF8 A;  2QRV A;  1P5Q A;  4JFK A;  3PA7 A;  1GOI A;  5DEZ A;  4QZV B;  2FAP A;  3ARY A;  1OGB A;  1QZ2 A;  3CHE A;  3WQV A;  1W9V A;  1NWT A;  2XP5 A;  2OFN A;  1W1V A;  3QOK A;  1ZK6 A;  1F40 A;  3KAH A;  1FKL A;  3UQI A;  4IT6 A;  2KXQ A;  3NRK A;  3O5D A;  5J6E A;  3KAG A;  2IUZ A;  5I98 A;  2RSE A;  1TR8 A;  2IF4 A;  1W9P A;  3IHZ A;  3M85 A;  1NWU A;  1HKJ A;  4DWS A;  1K9Q A;  2PBC A;  1HKI A;  1NWS A;  1D7J A;  3JXV A;  1K9R A;  1GRJ A;  3B7X A;  4R0X A;  1FKJ A;  3PRA A;  1WNO A;  4J4N A;  3WIJ A;  2DSU A;  3LKX B;  4LAX A;  1E6N A;  5JH8 A;  3RM9 A;  1K9T A;  3MQG A;  2KFW A;  3WD1 A;  5E65 A;  4WKA A;  2DK1 A;  3GU0 A;  1QPF A;  2PPO A;  3O5Q A;  3RFW A;  4DRP A;  4MNM A;  1HJX A;  2K8I A;  2OLH A;  4J4O A;  5DIV A;  4QT2 A;  4P8X A;  5HWB A;  4ODR A;  3O5F A;  4DH0 A;  4ZPV R;  2DG3 A;  3WD3 A;  3KZ7 A;  2DK7 A;  1HJV A;  4U84 A;  2LAJ A;  2XP9 A;  4LGX A;  2DT0 A;  3LKX A;  3UQA A;  1ZCN A;  5DF0 A;  1I5H W;  3OOB A;  1Y0O A;  4KR0 B;  4ML4 A;  5GPR A;  4Q7N A;  1EYM A;  1KT1 A;  1UR8 A;  2P4V A;  1W26 A;  3PQH A;  4IQ2 A;  5DO2 A;  1M5Y A;  4IPX A;  2DT2 A;  2WM0 A;  3O5I A;  1ZL1 A;  2DWV A;  1FKI A;  4N19 A;  1W1T A;  1GUV A;  1FKR A;  3UI6 A;  1O6W A;  2DSW A;  2A3A A;  3NI6 A;  3UI4 A;  3ARQ A;  3FXY A;  3ARZ A;  3AS3 A;  3FSC A;  2OWO A;  3UF8 A;  4IQC A;  1CTN A;  2PPN A;  4Z2H A;  1FKF A;  3WQW A;  4BF8 A;  3I6C A;  5AHT A;  1E15 A;  1FFR A;  4U85 A;  2M3O W;  4TNS A;  4JFJ A;  4MAV A;  2M8J A;  1HKM A;  2FKE A;  4IT4 A;  3PR9 A;  4W9O A;  1GPF A;  1EG3 A;  1Q1C A;  2D9F A;  4P8U A;  4LAW A;  2F2D A;  5D75 A;  1W1P A;  5DIT A;  1D7H A;  4DWS D;  3VAW A;  4DRK A;  3FY1 A;  4DRQ A;  1HJW A;  2XPA A;  3KAC A;  5HT1 A;  4DRI A;  2DT1 A;  3KAF A;  3ARO A;  1J4H A;  3G6M A;  3LUO A;  1FKS A;  2MLY A;  2LKN A;  3ARU A;  3UQB A;  2AOS A;  3KAB A;  1J4I A;  2YBU A;  3RME A;  2JV4 A;  3WH0 A;  3O5R A;  4ODO A;  2JMF A;  2B31 A;  3O5O A;  2N87 A;  5GQB A;  3KAD A;  3O5J A;  4LAV A;  3W4R A;  4A0T A;  5U47 A;  2RUQ A;  4NNR A;  4UDM A;  1LL7 A;  3JYM A;  1N1A A;  2DPE A;  3ARS A;  4DIP A;  2ZQS A;  1D2K A;  1EHN A;  2WK2 A;  4MNJ A;  4XAK A;  1TCO C;  2L4J A;  2WAE A;  3ALG A;  1EDQ A;  1FKK A;  2PV2 A;  4TW7 A;  5DIU A;  3GTY X;  2EZ5 W;  3CGM A;  1JCH B;  1X6N A;  1NMV A;  3LE4 A;  2M2A A;  3B9D A;  5E62 A;  4Z2J A;  3TDB A;  1JMQ A;  1C9H A;  4FAP A;  2EUL A;  2ITK A;  4ODM A;  4P8W A;  4DWS C;  2JX8 A;  3AQU A;  3EY6 A;  3WD0 A;  1JNS A;  1XRV A;  2AWG A;  1JND A;  3B9A A;  2ZQV A;  1EG4 A;  1PBK A;  2M1I A;  1ROU A;  4ZS6 A;  4MNK A;  1SR0 A;  2MDI A;  4JYS A;  1YAT A;  2PV1 A;  4DRH A;  3O5G A;  2ESC A;  2B5U B;  1JVW A;  3IKD A;  3IK8 A;  4Z2L A;  3CNG A;  4DZ3 A;  1E9L A;  1Q6I A;  2MLZ A;  4DWS B;  1YW5 A;  2YAJ B;  1JNE A;  3O5L A;  2LJ4 A;  2YSI A;  1FKH A;  2DSV A;  2KO7 A;  2XP4 A;  3AS2 A;  1A7X A;  1KT0 A;  4KQZ A;  1EQ3 A;  5HW8 A;  4URI A;  4GLX A;  1FJD A;  4R5E A;  1FKB A;  1ZBW A;  1NWR A;  4A0U A;  3FSB A;  1RP5 A;  3OA5 A;  4ZPT R;  4MPK A;  2RUD A;  2KI3 A;  3IKG A;  3ARX A;  5E66 A;  2YSG A;  4TYO A;  3CHF A;  1O6I A;  1IX5 A;  5HUA A;  4L3N A;  2YSF A;  4DRN A;  1KFW A;  3G6L A;  3TC5 A;  4U86 A;  3BMB A;  4ODK A;  2Y8N B;  3FS8 A;  3WD4 A;  3O5K A;  3RM4 A;  1J4R A;  5BXJ A;  3RGC A;  3RM8 A;  1LQ0 A;  1FLC A;  3GPK A;  2MNT A;  1FFQ A;  1ROT A;  2M08 A;  2ZQU A;  4Z2K A;  1QPL A;  4ZPW R;  2FDM A;  3WKZ A;  4HAR A;  1LL4 A;  2KE0 A;  2LPV A;  3PRD A;  4JFL A;  4L72 B;  3WL0 A;  5HWC A;  1Q6U A;  2JZV A;  1OWQ A;  2XP3 A;  1NH6 A;  5HW6 A;  4S3J A;  4WJX A;  1ZBC A;  3PRB A;  3ALF A;  4Q22 A;  4Z2G A;  4DRM A;  1ZB5 A;  3CZ8 A;  5E64 A;  1TK7 A;  2E45 A;  2ETN A;  4DRO A;  3B9E A;  4JFM A;  1D7I A;  1FKD A;  2DJY A;  2XP6 A;  2XPB A;  2DG9 A;  1ZBK A;  2O9O A;  4MTV A;  2UZ5 A;  2ZR5 A;  3AS1 A;  4W5U A;  2G8Z A;  2VCD A;  4FN2 A;  2DG4 A;  2LGO A;  1B6C A;  4DZ2 A;  2L2S A;  1WB0 A;  2JXW A;  4HBO A;  3ODK A;  2XP8 A;  2A3C A;  3O5E A;  1HKK A;  3MCB A;  2M8I A;  3ARV A;  1BKF A;  2RQS A;  4NSB A;  4QT3 A;  2A3E A;  3ART A;  3NTP A;  4PTM A;  4W9Q A;  1WMV A;  2WLZ A;  2PN0 A;  3CH9 A;  4HBE A;  2WLY A;  2F4E A;  2MF9 A;  4ODP A;  2ZR6 A;  2Q5A A;  4TW6 A;  1U79 A;  2QF8 A;  2RUR A;  1FAP A;  1ZU8 A;  2PI6 A; 
#chains in the Genus database with same CATH homology
 3O5P A;  1PIN A;  5HTG A;  1TFV A;  2VN1 A;  1NSG A;  2MLX A;  4S3K A;  4WIW A;  1X6L A;  4O2T A;  4WKF A;  1H0I A;  2XP7 A;  2MPH A;  4MGV A;  1D6O A;  1LG1 A;  2Y78 A;  2A3B A;  4ODQ A;  5HBF A;  2BA1 A;  1FKT A;  2F21 A;  1LG2 A;  3CHC A;  3TCZ A;  3FAP A;  3ARP A;  4C02 B;  4DT4 A;  5HKG A;  4GIV A;  1HXV A;  3O5M A;  1NMW A;  2PV3 A;  3ARR A;  3H9R B;  4W9P A;  4TW8 A;  3MCB B;  1UR9 A;  2PPP A;  4GGQ A;  4QIB A;  3CGN A;  2DT3 A;  4WKH A;  5E5W A;  4E5R A;  3B8S A;  4MNL A;  3UI5 A;  1LL6 A;  2WAD A;  3JYJ A;  4ODN A;  1WR7 A;  3MDY B;  2ZR4 A;  3WD2 A;  1Q6H A;  1E6R A;  5B8I C;  4JFI A;  4WK9 A;  4MSP A;  2YSH A;  5GPG A;  5CQ2 A;  4REX A;  2RE3 A;  1FKG A;  2YBT A;  2DSZ A;  3KCE A;  1ITX A;  4G2P A;  2KR7 A;  3BXW A;  4NZC A;  3L4H A;  3KAI A;  4DRJ A;  3WL1 A;  1L1P A;  1SYT A;  2ZAJ A;  2O92 A;  4P8V A;  1ZBV A;  1BL4 A;  1XHG A;  4ITZ A;  3MQH A;  2RUC A;  4G50 A;  1H0G A;  4LAY A;  5HW7 A;  1R9H A;  1LJY A;  2KGJ A;  3AS0 A;  4TX0 A;  4AY1 A;  2ZQT A;  4Z2I A;  1W1Y A;  1W9U A;  1JNT A;  1FD9 A;  1E6P A;  1RD6 A;  2DMV A;  4ODL A;  3ARW A;  3CHD A;  1T11 A;  1OGG A;  2G41 A;  1EIB A;  1F8A B;  3M7N A;  1E6Z A;  2YSB A;  1WAW A;  1J6Y A;  1VF8 A;  2QRV A;  1P5Q A;  4JFK A;  3PA7 A;  1GOI A;  5DEZ A;  4QZV B;  2FAP A;  3ARY A;  1OGB A;  1QZ2 A;  3CHE A;  3WQV A;  1W9V A;  1NWT A;  2XP5 A;  2OFN A;  1W1V A;  3QOK A;  1ZK6 A;  1F40 A;  3KAH A;  1FKL A;  3UQI A;  4IT6 A;  2KXQ A;  3NRK A;  3O5D A;  5J6E A;  3KAG A;  2IUZ A;  5I98 A;  2RSE A;  1TR8 A;  2IF4 A;  1W9P A;  3IHZ A;  3M85 A;  1NWU A;  1HKJ A;  4DWS A;  1K9Q A;  2PBC A;  1HKI A;  1NWS A;  1D7J A;  3JXV A;  1K9R A;  3B7X A;  4R0X A;  1FKJ A;  3PRA A;  1WNO A;  4J4N A;  3WIJ A;  2DSU A;  3LKX B;  4LAX A;  1E6N A;  5JH8 A;  3RM9 A;  1K9T A;  3MQG A;  2KFW A;  3WD1 A;  5E65 A;  4WKA A;  2DK1 A;  1QPF A;  2PPO A;  3O5Q A;  3RFW A;  4DRP A;  4MNM A;  1HJX A;  2K8I A;  2OLH A;  4J4O A;  5DIV A;  4QT2 A;  4P8X A;  5HWB A;  4ODR A;  3O5F A;  4DH0 A;  4ZPV R;  2DG3 A;  3WD3 A;  3KZ7 A;  2DK7 A;  1HJV A;  4U84 A;  2LAJ A;  2XP9 A;  4LGX A;  2DT0 A;  3LKX A;  3UQA A;  1ZCN A;  5DF0 A;  1I5H W;  3OOB A;  1Y0O A;  4KR0 B;  4ML4 A;  5GPR A;  4Q7N A;  1EYM A;  1KT1 A;  1UR8 A;  1W26 A;  3PQH A;  4IQ2 A;  5DO2 A;  1M5Y A;  4IPX A;  2DT2 A;  2WM0 A;  3O5I A;  1ZL1 A;  2DWV A;  1FKI A;  4N19 A;  1W1T A;  1GUV A;  1FKR A;  3UI6 A;  1O6W A;  2DSW A;  2A3A A;  3NI6 A;  3UI4 A;  3ARQ A;  3FXY A;  3ARZ A;  3AS3 A;  3FSC A;  2OWO A;  3UF8 A;  4IQC A;  1CTN A;  2PPN A;  4Z2H A;  1FKF A;  3WQW A;  4BF8 A;  3I6C A;  5AHT A;  1E15 A;  1FFR A;  4U85 A;  2M3O W;  4TNS A;  4JFJ A;  4MAV A;  2M8J A;  1HKM A;  2FKE A;  4IT4 A;  3PR9 A;  4W9O A;  1GPF A;  1EG3 A;  1Q1C A;  2D9F A;  4P8U A;  4LAW A;  2F2D A;  5D75 A;  1W1P A;  5DIT A;  1D7H A;  4DWS D;  3VAW A;  4DRK A;  3FY1 A;  4DRQ A;  1HJW A;  2XPA A;  3KAC A;  5HT1 A;  4DRI A;  2DT1 A;  3KAF A;  3ARO A;  1J4H A;  3G6M A;  3LUO A;  1FKS A;  2MLY A;  2LKN A;  3ARU A;  3UQB A;  2AOS A;  3KAB A;  1J4I A;  2YBU A;  3RME A;  2JV4 A;  3WH0 A;  3O5R A;  4ODO A;  2JMF A;  2B31 A;  3O5O A;  2N87 A;  5GQB A;  3KAD A;  3O5J A;  4LAV A;  3W4R A;  4A0T A;  5U47 A;  2RUQ A;  4NNR A;  1LL7 A;  3JYM A;  1N1A A;  2DPE A;  3ARS A;  4DIP A;  2ZQS A;  1D2K A;  1EHN A;  2WK2 A;  4MNJ A;  4XAK A;  1TCO C;  2L4J A;  2WAE A;  3ALG A;  1EDQ A;  1FKK A;  2PV2 A;  4TW7 A;  5DIU A;  2EZ5 W;  3CGM A;  1X6N A;  1NMV A;  3LE4 A;  2M2A A;  3B9D A;  5E62 A;  4Z2J A;  3TDB A;  1JMQ A;  1C9H A;  4FAP A;  2ITK A;  4ODM A;  4P8W A;  4DWS C;  2JX8 A;  3AQU A;  3EY6 A;  3WD0 A;  1JNS A;  1XRV A;  2AWG A;  1JND A;  3B9A A;  2ZQV A;  1EG4 A;  1PBK A;  2M1I A;  1ROU A;  4ZS6 A;  4MNK A;  1SR0 A;  2MDI A;  4JYS A;  1YAT A;  2PV1 A;  4DRH A;  3O5G A;  2ESC A;  1JVW A;  3IKD A;  3IK8 A;  4Z2L A;  3CNG A;  4DZ3 A;  1E9L A;  1Q6I A;  2MLZ A;  4DWS B;  1YW5 A;  2YAJ B;  1JNE A;  3O5L A;  2LJ4 A;  2YSI A;  1FKH A;  2DSV A;  2KO7 A;  2XP4 A;  3AS2 A;  1A7X A;  1KT0 A;  4KQZ A;  1EQ3 A;  5HW8 A;  4URI A;  4GLX A;  1FJD A;  4R5E A;  1FKB A;  1ZBW A;  1NWR A;  4A0U A;  3FSB A;  1RP5 A;  3OA5 A;  4ZPT R;  4MPK A;  2RUD A;  2KI3 A;  3IKG A;  3ARX A;  5E66 A;  2YSG A;  4TYO A;  3CHF A;  1O6I A;  1IX5 A;  5HUA A;  4L3N A;  2YSF A;  4DRN A;  1KFW A;  3G6L A;  3TC5 A;  4U86 A;  4ODK A;  2Y8N B;  3FS8 A;  3WD4 A;  3O5K A;  3RM4 A;  1J4R A;  5BXJ A;  3RGC A;  3RM8 A;  1LQ0 A;  1FLC A;  3GPK A;  2MNT A;  1FFQ A;  1ROT A;  2M08 A;  2ZQU A;  4Z2K A;  1QPL A;  4ZPW R;  2FDM A;  3WKZ A;  4HAR A;  1LL4 A;  2KE0 A;  2LPV A;  3PRD A;  4JFL A;  4L72 B;  3WL0 A;  5HWC A;  1Q6U A;  2JZV A;  1OWQ A;  2XP3 A;  1NH6 A;  5HW6 A;  4S3J A;  4WJX A;  1ZBC A;  3PRB A;  3ALF A;  4Q22 A;  4Z2G A;  4DRM A;  1ZB5 A;  3CZ8 A;  5E64 A;  1TK7 A;  2E45 A;  4DRO A;  3B9E A;  4JFM A;  1D7I A;  1FKD A;  2DJY A;  2XP6 A;  2XPB A;  2DG9 A;  1ZBK A;  2O9O A;  4MTV A;  2UZ5 A;  2ZR5 A;  3AS1 A;  4W5U A;  2G8Z A;  2VCD A;  4FN2 A;  2DG4 A;  2LGO A;  1B6C A;  4DZ2 A;  2L2S A;  1WB0 A;  2JXW A;  4HBO A;  3ODK A;  2XP8 A;  2A3C A;  3O5E A;  1HKK A;  3MCB A;  2M8I A;  3ARV A;  1BKF A;  2RQS A;  4NSB A;  4QT3 A;  2A3E A;  3ART A;  3NTP A;  4PTM A;  4W9Q A;  1WMV A;  2WLZ A;  3CH9 A;  4HBE A;  2WLY A;  2F4E A;  2MF9 A;  4ODP A;  2ZR6 A;  2Q5A A;  4TW6 A;  1U79 A;  2QF8 A;  2RUR A;  1FAP A;  1ZU8 A;  2PI6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...