2XP9A

Discovery of cell-active phenyl-imidazole pin1 inhibitors by structure-guided fragment evolution
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
157
structure length
144
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of Cell-Active Phenyl-Imidazole Pin1 Inhibitors by Structure-Guided Fragment Evolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords PEPTIDYL-PROLYL CIS-TRANS ISOMERASE NIMA-INTERACTING 1
total genus 46
structure length 144
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2xp9A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2xp9A02
1K9RA 4DRQA 1HXVA 1BKFA 2DWVA 3KABA 3KAFA 1T11A 4R0XA 1Q1CA 2Y78A 5HKGA 2ZQTA 4DRIA 3ODKA 2JX8A 1FKIA 2MPHA 1R9HA 4DH0A 1PBKA 2XP9A 1Q6UA 2IF4A 2L4JA 2RSEA 3CGNA 1FKFA 1KT0A 3CGMA 3I6CA 1Q6IA 4JFKA 2MLXA 1FD9A 3O5IA 5DIVA 3O5LA 3IKDA 2RUQA 2PBCA 1QPLA 2XPBA 3PRBA 4G2PA 1TCOC 2RE3A 4TYOA 1ROUA 3O5MA 4ODLA 1L1PA 3UI4A 2DG9A 1JNSA 1NMVA 2YSHA 2DG4A 5HW7A 1QPFA 2E45A 2UZ5A 5D75A 1FKHA 3B7XA 3KACA 1FKTA 3NTPA 3UQAA 1NSGA 2ZQVA 1JVWA 4MSPA 3UI6A 3TDBA 2XP5A 4DZ3A 1FKLA 2KGJA 2KFWA 3O5EA 2JZVA 2XPAA 3UI5A 3O5KA 4TW7A 5B8IC 1Q6HA 2BA1A 2PV3A 2PV1A 2ZQSA 1D7JA 3O5DA 3IK8A 4E5RA 4IPXA 2RQSA 2RUDA 3GPKA 3UF8A 5AHTA 1K9QA 2XP6A 2MNTA 2DJYA 4DZ2A 4ODPA 4DRNA 1EG4A 1EG3A 2DK7A 1W26A 3KAIA 5HW6A 1B6CA 4QIBA 1BL4A 4LAXA 2MLZA 4ODMA 2M3OW 2MDIA 4C02B 4W9QA 4DROA 1A7XA 1FAPA 3KADA 3O5GA 3O5RA 4FAPA 2KI3A 2DMVA 2Q5AA 2LPVA 2L2SA 4G50A 2MF9A 3RFWA 3VAWA 4JFJA 4ODQA 3EY6A 5DIUA 3PRDA 4LAVA 4MGVA 4QT3A 2ZR6A 1F40A 1FKRA 4BF8A 1FKSA 1J4RA 1YATA 3IKGA 1JNTA 2LKNA 3L4HA 3JYJA 4JFIA 5HW8A 1YW5A 2ZR4A 4JFMA 2YSGA 3LUOA 2FAPA 2M1IA 5DITA 4U85A 1ZK6A 3O5PA 1FKJA 3O5QA 4W9OA 2ZAJA 2VCDA 2XP3A 5HT1A 1C9HA 2M2AA 2KXQA 2XP8A 1D7HA 2PPPA 4QT2A 4JYSA 5HWBA 5HUAA 1J6YA 3O5JA 1FKBA 1J4IA 4U86A 1D7IA 1N1AA 4REXA 2DG3A 2PPNA 5GPGA 2KR7A 2M8IA 3NI6A 4GIVA 3UQBA 1U79A 4N19A 2MLYA 4NNRA 3NRKA 5HWCA 5J6EA 1ZCNA 2F2DA 2ITKA 1WMVA 1KT1A 4DRMA 1O6WA 2ZR5A 1EYMA 3JXVA 3KAGA 4LAYA 5I98A 2ZQUA 3TC5A 3KZ7A 3LE4A 4LAWA 3M85A 2M08A 3TCZA 1Y0OA 2F4EA 4TNSA 3UQIA 1FJDA 3MDYB 2KO7A 2XP7A 2PV2A 2JXWA 3OOBA 4GGQA 4TW6A 4DRHA 1P5QA 5BXJA 2K8IA 1TK7A 3CNGA 1JMQA 2LJ4A 3O5FA 4IQ2A 1D6OA 1I5HW 1WR7A 2OFNA 3FAPA 3IHZA 4FN2A 2VN1A 4JFLA 2XP4A 2FKEA 4ODNA 4ODKA 3PA7A 2YSIA 3M7NA 3O5OA 2EZ5W 2RUCA 4O2TA 4ITZA 4ODOA 2YSFA 4J4OA 3H9RB 1FKGA 1F8AB 1M5YA 2KE0A 2F21A 4W9PA 4DRJA 2JMFA 4J4NA 5HTGA 3KAHA 1FKKA 1QZ2A 2PPOA 4ODRA 4DT4A 4DRPA 3WH0A 2JV4A 2N87A 1ROTA 1J4HA 4DRKA 4IQCA 2LGOA 3RGCA 1NMWA 1PINA 1FKDA 2M8JA 2D9FA 3KCEA 3JYMA 4TX0A 1EQ3A 5CQ2A 2DK1A 4TW8A 2RURA 2AWGA 2YSBA 4DIPA 4U84A 2LAJA
chains in the Genus database with same CATH superfamily
4DRQA 4Z2JA 1NWTA 1T11A 2WADA 2A3CA 3MCBA 3MQGA 4MAVA 1IX5A 1SYTA 1FD9A 5DIVA 2B5UB 3IKDA 2Y8NB 4KR0B 2RUQA 3FS8A 2XPBA 2A3EA 5JH8A 1W9VA 1ROUA 4ODLA 3UI4A 1D2KA 2DG4A 4WKHA 1JNSA 2E45A 2G41A 5E66A 1HKJA 4Z2KA 3NTPA 1HKMA 1NSGA 5GPRA 1JVWA 4AY1A 2XP5A 1ZU8A 3AROA 4TW7A 3ARTA 3WD2A 4HBEA 4E5RA 3B9DA 4IPXA 2RUDA 1W1VA 4ZPWR 1E6NA 2DJYA 4L72B 5HW7A 1W26A 3MCBB 1B6CA 4P8XA 3CHCA 2M3OW 3LKXB 3W4RA 4C02B 1O6IA 3MQHA 3RM8A 2MF9A 5DIUA 2ZR6A 1XRVA 5HW8A 2F23A 1JNTA 1JNEA 4JFMA 1FKJA 3OA5A 2VCDA 2XP3A 5HT1A 4Z2IA 1C9HA 2PPPA 2XP8A 1D7HA 5GPGA 2PPNA 4REXA 2KR7A 4GIVA 1HKKA 1GOIA 5J6EA 1ZCNA 2ITKA 2ZR5A 5E62A 4UDMA 4MPKA 4TNSA 3TCZA 1FJDA 1L1PA 1LJYA 2JXWA 3WL1A 2DT0A 3O5FA 1HKIA 2OFNA 3FAPA 3IHZA 2XP4A 2YSIA 3M7NA 4S3KA 3WD0A 4HARA 2EZ5W 4ODOA 2DSVA 4J4OA 1F8AB 1M5YA 2KE0A 2F21A 1HJWA 1ZBKA 4ODRA 3B9EA 2QF8A 3WH0A 4L3NA 1XHGA 3G6LA 4IQCA 2LGOA 2IUZA 1NMWA 1EQ3A 5CQ2A 2AWGA 1RD6A 1ZB5A 3WD4A 3GTYX 1HXVA 1BKFA 3KAFA 4QZVB 1Q1CA 4WIWA 5DF0A 4DRIA 1TR8A 1Q6UA 2L4JA 4JFKA 1KT0A 3I6CA 1Q6IA 5E65A 3O5LA 4MTVA 2PBCA 3WIJA 1LG1A 4GLXA 2DG9A 1NMVA 1JNDA 1LQ0A 5D75A 3AS0A 1H0IA 2ZQVA 4MSPA 3UI6A 3TDBA 4PTMA 1FKLA 2WK2A 3O5EA 2JZVA 4R5EA 3UI5A 2BA1A 2O92A 3O5DA 1OWQA 1ZBWA 2DK7A 5HW6A 3KAIA 4QIBA 2MLZA 2OLHA 4ODMA 1A7XA 3KADA 3G6MA 2DMVA 2EULA 2Q5AA 2LPVA 2L2SA 3VAWA 3PRDA 4Z2GA 4BF8A 1FKSA 4JFIA 3JYJA 1YW5A 5DITA 3LUOA 2M1IA 4U85A 3GU0A 2M2AA 5HUAA 2KXQA 4U86A 1N1AA 5DEZA 1FFQA 3NI6A 3UQBA 4DRMA 1KT1A 4HBOA 1O6WA 1EYMA 1KFWA 3ARWA 1NH6A 1WAWA 4MNJA 1E6PA 2ZQUA 2PN0A 2M08A 4IT4A 4NSBA 1Y0OA 4ZPTR 3MDYB 4GGQA 4DRHA 4ZPVR 1H0GA 2K8IA 3BXWA 3AS2A 4FN2A 2VN1A 2WAEA 2DT2A 2RUCA 2YSFA 1EHNA 2JMFA 3KAHA 2PPOA 2JV4A 3PR9A 2DSZA 1TFVA 1ROTA 1J4HA 1PINA 1FKDA 2M8JA 3RM4A 5E5WA 4MNKA 3CZ8A 3ARSA 2YSBA 3B7XA 4DWSB 2LAJA 1LL6A 1K9RA 1RP5A 1HJXA 3FXYA 2Y78A 2JX8A 1R9HA 4DH0A 1PBKA 2XP9A 2IF4A 3CGNA 3CGMA 2MLXA 3O5IA 1ZBVA 1QPLA 1E9LA 3PRBA 2YAJB 1JCHB 1FFRA 2WLYA 2UZ5A 3LKXA 3KACA 1FKTA 3UQAA 4P8UA 3WQWA 3ALGA 3O5KA 2DT1A 3QOKA 1GPFA 1X6NA 2PV1A 1D7JA 3RMEA 1E6RA 2FDMA 4MNLA 2YBUA 3AS3A 3UF8A 5AHTA 1K9QA 2XP6A 3ALFA 1LG2A 4ODPA 4DRNA 4LAXA 2DT3A 4W9QA 1NWSA 2PI6A 1VF8A 3O5GA 4FAPA 2KI3A 1X6LA 4G50A 3RFWA 1E15A 4KQZA 4JFJA 1F40A 1E44A 4LAVA 4QT3A 4NZCA 4A0UA 2LKNA 1WB0A 2YSGA 4WK9A 2ETNA 1ZK6A 3PRAA 1J6YA 4JYSA 5HWBA 1FKBA 3CHDA 1J4IA 2ESCA 1EIBA 4N19A 4NNRA 5HWCA 2F2DA 1WMVA 4P8WA 3JXVA 4LAYA 3KAGA 2DSUA 5I98A 3TC5A 3KZ7A 3LE4A 4LAWA 2YBTA 3UQIA 2KO7A 4TW6A 3WD1A 3OOBA 5BXJA 4IQ2A 3CNGA 1JMQA 1WNOA 1W9UA 1WR7A 4JFLA 2AOSA 4ODNA 2FKEA 4ODKA 3PA7A 3O5OA 4O2TA 3WL0A 4DRKA 3CH9A 4W9PA 2P4VA 3WQVA 4MNMA 3ARUA 4DRPA 3ARRA 4DWSA 3WD3A 3B9AA 3RGCA 1FLCA 4Q7NA 4Q22A 1ZBCA 4TW8A 2RURA 3BMBA 3ARZA 4DIPA 4U84A 2KFWA 1CTNA 1ITXA 3ARPA 2DWVA 3KABA 2DSWA 4R0XA 5HKGA 2B31A 2ZQTA 4S3JA 3ODKA 1FKIA 5E64A 1LL4A 2MPHA 2RSEA 1FKFA 3FY1A 4Z2HA 1GUVA 1HJVA 1W1PA 4G2PA 1TCOC 5HBFA 2RE3A 4TYOA 4WJXA 3O5MA 3AS1A 2YSHA 1QPFA 1UR9A 1FKHA 1W9PA 4WKAA 4DZ3A 1ZL1A 4XAKA 2KGJA 2G8ZA 2XPAA 4W5UA 4WKFA 5B8IC 1Q6HA 4P8VA 2PV3A 2ZQSA 4ML4A 3IK8A 5DO2A 2RQSA 3GPKA 2MNTA 4DZ2A 3ARXA 1EG4A 1EG3A 1BL4A 5GQBA 2MDIA 4DROA 1FAPA 3O5RA 4IT6A 2OWOA 2DPEA 1K9TA 4ODQA 3ARVA 3EY6A 4MGVA 3WKZA 2WLZA 1FKRA 3AQUA 1J4RA 1YATA 3IKGA 1SR0A 3L4HA 2ZR4A 3CHEA 2FAPA 3O5PA 4ZS6A 3O5QA 3CHFA 4W9OA 2ZAJA 2A3BA 3EIPA 2O9OA 4QT2A 4DWSD 1E6ZA 2WM0A 3O5JA 1D7IA 2DG3A 2M8IA 1NWRA 1U79A 3RM9A 2MLYA 3NRKA 1LL7A 2A3AA 3ARQA 1OGGA 4DWSC 3M85A 2F4EA 2PV2A 2XP7A 1P5QA 1TK7A 1OGBA 2LJ4A 1D6OA 1I5HW 2QRVA 1NWUA 3FSCA 3PQHA 1UR8A 3B8SA 4ITZA 3H9RB 1FKGA 4DRJA 4Z2LA 3FSBA 4J4NA 5HTGA 1FKKA 4DT4A 1QZ2A 1W1TA 2N87A 1GRJA 3ARYA 4TX0A 3JYMA 2D9FA 4URIA 3KCEA 4A0TA 1EDQA 2DK1A 4LGXA 1W1YA 5U47A
chains in the Genus database with same CATH topology
4DRQA 4Z2JA 1NWTA 1T11A 2WADA 2A3CA 3MCBA 3MQGA 4MAVA 1IX5A 1SYTA 1FD9A 5DIVA 3IKDA 2Y8NB 4KR0B 2RUQA 3FS8A 2XPBA 2A3EA 5JH8A 1W9VA 1ROUA 4ODLA 3UI4A 1D2KA 2DG4A 4WKHA 1JNSA 2E45A 2G41A 5E66A 1HKJA 4Z2KA 3NTPA 1HKMA 1NSGA 5GPRA 1JVWA 4AY1A 2XP5A 1ZU8A 3AROA 4TW7A 3ARTA 3WD2A 4HBEA 4E5RA 3B9DA 4IPXA 2RUDA 1W1VA 4ZPWR 1E6NA 2DJYA 4L72B 5HW7A 1W26A 3MCBB 1B6CA 4P8XA 3CHCA 2M3OW 3LKXB 3W4RA 4C02B 1O6IA 3MQHA 3RM8A 2MF9A 5DIUA 2ZR6A 1XRVA 5HW8A 1JNTA 1JNEA 4JFMA 1FKJA 3OA5A 2VCDA 2XP3A 5HT1A 4Z2IA 1C9HA 2PPPA 2XP8A 1D7HA 5GPGA 2PPNA 4REXA 2KR7A 4GIVA 1HKKA 1GOIA 5J6EA 1ZCNA 2ITKA 2ZR5A 5E62A 4MPKA 4TNSA 3TCZA 1FJDA 1L1PA 1LJYA 2JXWA 3WL1A 2DT0A 3O5FA 1HKIA 2OFNA 3FAPA 3IHZA 2XP4A 2YSIA 3M7NA 4S3KA 3WD0A 4HARA 2EZ5W 4ODOA 2DSVA 4J4OA 1F8AB 1M5YA 2KE0A 2F21A 1HJWA 1ZBKA 4ODRA 3B9EA 2QF8A 3WH0A 4L3NA 1XHGA 3G6LA 4IQCA 2LGOA 2IUZA 1NMWA 1EQ3A 5CQ2A 2AWGA 1RD6A 1ZB5A 3WD4A 1HXVA 1BKFA 3KAFA 4QZVB 1Q1CA 4WIWA 5DF0A 4DRIA 1TR8A 1Q6UA 2L4JA 4JFKA 1KT0A 3I6CA 1Q6IA 5E65A 3O5LA 4MTVA 2PBCA 3WIJA 1LG1A 4GLXA 2DG9A 1NMVA 1JNDA 1LQ0A 5D75A 3AS0A 1H0IA 2ZQVA 4MSPA 3UI6A 3TDBA 4PTMA 1FKLA 2WK2A 3O5EA 2JZVA 4R5EA 3UI5A 2BA1A 2O92A 3O5DA 1OWQA 1ZBWA 2DK7A 5HW6A 3KAIA 4QIBA 2MLZA 2OLHA 4ODMA 1A7XA 3KADA 3G6MA 2DMVA 2Q5AA 2LPVA 2L2SA 3VAWA 3PRDA 4Z2GA 4BF8A 1FKSA 4JFIA 3JYJA 1YW5A 5DITA 3LUOA 2M1IA 4U85A 2M2AA 5HUAA 2KXQA 4U86A 1N1AA 5DEZA 1FFQA 3NI6A 3UQBA 4DRMA 1KT1A 4HBOA 1O6WA 1EYMA 1KFWA 3ARWA 1NH6A 1WAWA 4MNJA 1E6PA 2ZQUA 2M08A 4IT4A 4NSBA 1Y0OA 4ZPTR 3MDYB 4GGQA 4DRHA 4ZPVR 1H0GA 2K8IA 3BXWA 3AS2A 4FN2A 2VN1A 2WAEA 2DT2A 2RUCA 2YSFA 1EHNA 2JMFA 3KAHA 2PPOA 2JV4A 3PR9A 2DSZA 1TFVA 1ROTA 1J4HA 1PINA 1FKDA 2M8JA 3RM4A 5E5WA 4MNKA 3CZ8A 3ARSA 2YSBA 3B7XA 4DWSB 2LAJA 1LL6A 1K9RA 1RP5A 1HJXA 3FXYA 2Y78A 2JX8A 1R9HA 4DH0A 1PBKA 2XP9A 2IF4A 3CGNA 3CGMA 2MLXA 3O5IA 1ZBVA 1QPLA 1E9LA 3PRBA 2YAJB 1FFRA 2WLYA 2UZ5A 3LKXA 3KACA 1FKTA 3UQAA 4P8UA 3WQWA 3ALGA 3O5KA 2DT1A 3QOKA 1GPFA 1X6NA 2PV1A 1D7JA 3RMEA 1E6RA 2FDMA 4MNLA 2YBUA 3AS3A 3UF8A 5AHTA 1K9QA 2XP6A 3ALFA 1LG2A 4ODPA 4DRNA 4LAXA 2DT3A 4W9QA 1NWSA 2PI6A 1VF8A 3O5GA 4FAPA 2KI3A 1X6LA 4G50A 3RFWA 1E15A 4KQZA 4JFJA 1F40A 4LAVA 4QT3A 4NZCA 4A0UA 2LKNA 1WB0A 2YSGA 4WK9A 1ZK6A 3PRAA 1J6YA 4JYSA 5HWBA 1FKBA 3CHDA 1J4IA 2ESCA 1EIBA 4N19A 4NNRA 5HWCA 2F2DA 1WMVA 4P8WA 3JXVA 4LAYA 3KAGA 2DSUA 5I98A 3TC5A 3KZ7A 3LE4A 4LAWA 2YBTA 3UQIA 2KO7A 4TW6A 3WD1A 3OOBA 5BXJA 4IQ2A 3CNGA 1JMQA 1WNOA 1W9UA 1WR7A 4JFLA 2AOSA 4ODNA 2FKEA 4ODKA 3PA7A 3O5OA 4O2TA 3WL0A 4DRKA 3CH9A 4W9PA 3WQVA 4MNMA 3ARUA 4DRPA 3ARRA 4DWSA 3WD3A 3B9AA 3RGCA 1FLCA 4Q7NA 4Q22A 1ZBCA 4TW8A 2RURA 3ARZA 4DIPA 4U84A 2KFWA 1CTNA 1ITXA 3ARPA 2DWVA 3KABA 2DSWA 4R0XA 5HKGA 2B31A 2ZQTA 4S3JA 3ODKA 1FKIA 5E64A 1LL4A 2MPHA 2RSEA 1FKFA 3FY1A 4Z2HA 1GUVA 1HJVA 1W1PA 4G2PA 1TCOC 5HBFA 2RE3A 4TYOA 4WJXA 3O5MA 3AS1A 2YSHA 1QPFA 1UR9A 1FKHA 1W9PA 4WKAA 4DZ3A 1ZL1A 4XAKA 2KGJA 2G8ZA 2XPAA 4W5UA 4WKFA 5B8IC 1Q6HA 4P8VA 2PV3A 2ZQSA 4ML4A 3IK8A 5DO2A 2RQSA 3GPKA 2MNTA 4DZ2A 3ARXA 1EG4A 1EG3A 1BL4A 5GQBA 2MDIA 4DROA 1FAPA 3O5RA 4IT6A 2OWOA 2DPEA 1K9TA 4ODQA 3ARVA 3EY6A 4MGVA 3WKZA 2WLZA 1FKRA 3AQUA 1J4RA 1YATA 3IKGA 1SR0A 3L4HA 2ZR4A 3CHEA 2FAPA 3O5PA 4ZS6A 3O5QA 3CHFA 4W9OA 2ZAJA 2A3BA 2O9OA 4QT2A 4DWSD 1E6ZA 2WM0A 3O5JA 1D7IA 2DG3A 2M8IA 1NWRA 1U79A 3RM9A 2MLYA 3NRKA 1LL7A 2A3AA 3ARQA 1OGGA 4DWSC 3M85A 2F4EA 2PV2A 2XP7A 1P5QA 1TK7A 1OGBA 2LJ4A 1D6OA 1I5HW 2QRVA 1NWUA 3FSCA 3PQHA 1UR8A 3B8SA 4ITZA 3H9RB 1FKGA 4DRJA 4Z2LA 3FSBA 4J4NA 5HTGA 1FKKA 4DT4A 1QZ2A 1W1TA 2N87A 3ARYA 4TX0A 3JYMA 2D9FA 4URIA 3KCEA 4A0TA 1EDQA 2DK1A 4LGXA 1W1YA 5U47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K9R A;  4DRQ A;  1HXV A;  1BKF A;  2DWV A;  3KAB A;  3KAF A;  1T11 A;  4R0X A;  1Q1C A;  2Y78 A;  5HKG A;  2ZQT A;  4DRI A;  3ODK A;  2JX8 A;  1FKI A;  2MPH A;  1R9H A;  4DH0 A;  1PBK A;  2XP9 A;  1Q6U A;  2IF4 A;  2L4J A;  2RSE A;  3CGN A;  1FKF A;  1KT0 A;  3CGM A;  3I6C A;  1Q6I A;  4JFK A;  2MLX A;  1FD9 A;  3O5I A;  5DIV A;  3O5L A;  3IKD A;  2RUQ A;  2PBC A;  1QPL A;  2XPB A;  3PRB A;  4G2P A;  1TCO C;  2RE3 A;  4TYO A;  1ROU A;  3O5M A;  4ODL A;  1L1P A;  3UI4 A;  2DG9 A;  1JNS A;  1NMV A;  2YSH A;  2DG4 A;  5HW7 A;  1QPF A;  2E45 A;  2UZ5 A;  5D75 A;  1FKH A;  3B7X A;  3KAC A;  1FKT A;  3NTP A;  3UQA A;  1NSG A;  2ZQV A;  1JVW A;  4MSP A;  3UI6 A;  3TDB A;  2XP5 A;  4DZ3 A;  1FKL A;  2KGJ A;  2KFW A;  3O5E A;  2JZV A;  2XPA A;  3UI5 A;  3O5K A;  4TW7 A;  5B8I C;  1Q6H A;  2BA1 A;  2PV3 A;  2PV1 A;  2ZQS A;  1D7J A;  3O5D A;  3IK8 A;  4E5R A;  4IPX A;  2RQS A;  2RUD A;  3GPK A;  3UF8 A;  5AHT A;  1K9Q A;  2XP6 A;  2MNT A;  2DJY A;  4DZ2 A;  4ODP A;  4DRN A;  1EG4 A;  1EG3 A;  2DK7 A;  1W26 A;  3KAI A;  5HW6 A;  1B6C A;  4QIB A;  1BL4 A;  4LAX A;  2MLZ A;  4ODM A;  2M3O W;  2MDI A;  4C02 B;  4W9Q A;  4DRO A;  1A7X A;  1FAP A;  3KAD A;  3O5G A;  3O5R A;  4FAP A;  2KI3 A;  2DMV A;  2Q5A A;  2LPV A;  2L2S A;  4G50 A;  2MF9 A;  3RFW A;  3VAW A;  4JFJ A;  4ODQ A;  3EY6 A;  5DIU A;  3PRD A;  4LAV A;  4MGV A;  4QT3 A;  2ZR6 A;  1F40 A;  1FKR A;  4BF8 A;  1FKS A;  1J4R A;  1YAT A;  3IKG A;  1JNT A;  2LKN A;  3L4H A;  3JYJ A;  4JFI A;  5HW8 A;  1YW5 A;  2ZR4 A;  4JFM A;  2YSG A;  3LUO A;  2FAP A;  2M1I A;  5DIT A;  4U85 A;  1ZK6 A;  3O5P A;  1FKJ A;  3O5Q A;  4W9O A;  2ZAJ A;  2VCD A;  2XP3 A;  5HT1 A;  1C9H A;  2M2A A;  2KXQ A;  2XP8 A;  1D7H A;  2PPP A;  4QT2 A;  4JYS A;  5HWB A;  5HUA A;  1J6Y A;  3O5J A;  1FKB A;  1J4I A;  4U86 A;  1D7I A;  1N1A A;  4REX A;  2DG3 A;  2PPN A;  5GPG A;  2KR7 A;  2M8I A;  3NI6 A;  4GIV A;  3UQB A;  1U79 A;  4N19 A;  2MLY A;  4NNR A;  3NRK A;  5HWC A;  5J6E A;  1ZCN A;  2F2D A;  2ITK A;  1WMV A;  1KT1 A;  4DRM A;  1O6W A;  2ZR5 A;  1EYM A;  3JXV A;  3KAG A;  4LAY A;  5I98 A;  2ZQU A;  3TC5 A;  3KZ7 A;  3LE4 A;  4LAW A;  3M85 A;  2M08 A;  3TCZ A;  1Y0O A;  2F4E A;  4TNS A;  3UQI A;  1FJD A;  3MDY B;  2KO7 A;  2XP7 A;  2PV2 A;  2JXW A;  3OOB A;  4GGQ A;  4TW6 A;  4DRH A;  1P5Q A;  5BXJ A;  2K8I A;  1TK7 A;  3CNG A;  1JMQ A;  2LJ4 A;  3O5F A;  4IQ2 A;  1D6O A;  1I5H W;  1WR7 A;  2OFN A;  3FAP A;  3IHZ A;  4FN2 A;  2VN1 A;  4JFL A;  2XP4 A;  2FKE A;  4ODN A;  4ODK A;  3PA7 A;  2YSI A;  3M7N A;  3O5O A;  2EZ5 W;  2RUC A;  4O2T A;  4ITZ A;  4ODO A;  2YSF A;  4J4O A;  3H9R B;  1FKG A;  1F8A B;  1M5Y A;  2KE0 A;  2F21 A;  4W9P A;  4DRJ A;  2JMF A;  4J4N A;  5HTG A;  3KAH A;  1FKK A;  1QZ2 A;  2PPO A;  4ODR A;  4DT4 A;  4DRP A;  3WH0 A;  2JV4 A;  2N87 A;  1ROT A;  1J4H A;  4DRK A;  4IQC A;  2LGO A;  3RGC A;  1NMW A;  1PIN A;  1FKD A;  2M8J A;  2D9F A;  3KCE A;  3JYM A;  4TX0 A;  1EQ3 A;  5CQ2 A;  2DK1 A;  4TW8 A;  2RUR A;  2AWG A;  2YSB A;  4DIP A;  4U84 A;  2LAJ A; 
#chains in the Genus database with same CATH topology
 4DRQ A;  4Z2J A;  1NWT A;  1T11 A;  2WAD A;  2A3C A;  3MCB A;  3MQG A;  4MAV A;  1IX5 A;  1SYT A;  1FD9 A;  5DIV A;  2B5U B;  3IKD A;  2Y8N B;  4KR0 B;  2RUQ A;  3FS8 A;  2XPB A;  2A3E A;  5JH8 A;  1W9V A;  1ROU A;  4ODL A;  3UI4 A;  1D2K A;  2DG4 A;  4WKH A;  1JNS A;  2E45 A;  2G41 A;  5E66 A;  1HKJ A;  4Z2K A;  3NTP A;  1HKM A;  1NSG A;  5GPR A;  1JVW A;  4AY1 A;  2XP5 A;  1ZU8 A;  3ARO A;  4TW7 A;  3ART A;  3WD2 A;  4HBE A;  4E5R A;  3B9D A;  4IPX A;  2RUD A;  1W1V A;  4ZPW R;  1E6N A;  2DJY A;  4L72 B;  5HW7 A;  1W26 A;  3MCB B;  1B6C A;  4P8X A;  3CHC A;  2M3O W;  3LKX B;  3W4R A;  4C02 B;  1O6I A;  3MQH A;  3RM8 A;  2MF9 A;  5DIU A;  2ZR6 A;  1XRV A;  5HW8 A;  2F23 A;  1JNT A;  1JNE A;  4JFM A;  1FKJ A;  3OA5 A;  2VCD A;  2XP3 A;  5HT1 A;  4Z2I A;  1C9H A;  2PPP A;  2XP8 A;  1D7H A;  5GPG A;  2PPN A;  4REX A;  2KR7 A;  4GIV A;  1HKK A;  1GOI A;  5J6E A;  1ZCN A;  2ITK A;  2ZR5 A;  5E62 A;  4UDM A;  4MPK A;  4TNS A;  3TCZ A;  1FJD A;  1L1P A;  1LJY A;  2JXW A;  3WL1 A;  2DT0 A;  3O5F A;  1HKI A;  2OFN A;  3FAP A;  3IHZ A;  2XP4 A;  2YSI A;  3M7N A;  4S3K A;  3WD0 A;  4HAR A;  2EZ5 W;  4ODO A;  2DSV A;  4J4O A;  1F8A B;  1M5Y A;  2KE0 A;  2F21 A;  1HJW A;  1ZBK A;  4ODR A;  3B9E A;  2QF8 A;  3WH0 A;  4L3N A;  1XHG A;  3G6L A;  4IQC A;  2LGO A;  2IUZ A;  1NMW A;  1EQ3 A;  5CQ2 A;  2AWG A;  1RD6 A;  1ZB5 A;  3WD4 A;  3GTY X;  1HXV A;  1BKF A;  3KAF A;  4QZV B;  1Q1C A;  4WIW A;  5DF0 A;  4DRI A;  1TR8 A;  1Q6U A;  2L4J A;  4JFK A;  1KT0 A;  3I6C A;  1Q6I A;  5E65 A;  3O5L A;  4MTV A;  2PBC A;  3WIJ A;  1LG1 A;  4GLX A;  2DG9 A;  1NMV A;  1JND A;  1LQ0 A;  5D75 A;  3AS0 A;  1H0I A;  2ZQV A;  4MSP A;  3UI6 A;  3TDB A;  4PTM A;  1FKL A;  2WK2 A;  3O5E A;  2JZV A;  4R5E A;  3UI5 A;  2BA1 A;  2O92 A;  3O5D A;  1OWQ A;  1ZBW A;  2DK7 A;  5HW6 A;  3KAI A;  4QIB A;  2MLZ A;  2OLH A;  4ODM A;  1A7X A;  3KAD A;  3G6M A;  2DMV A;  2EUL A;  2Q5A A;  2LPV A;  2L2S A;  3VAW A;  3PRD A;  4Z2G A;  4BF8 A;  1FKS A;  4JFI A;  3JYJ A;  1YW5 A;  5DIT A;  3LUO A;  2M1I A;  4U85 A;  3GU0 A;  2M2A A;  5HUA A;  2KXQ A;  4U86 A;  1N1A A;  5DEZ A;  1FFQ A;  3NI6 A;  3UQB A;  4DRM A;  1KT1 A;  4HBO A;  1O6W A;  1EYM A;  1KFW A;  3ARW A;  1NH6 A;  1WAW A;  4MNJ A;  1E6P A;  2ZQU A;  2PN0 A;  2M08 A;  4IT4 A;  4NSB A;  1Y0O A;  4ZPT R;  3MDY B;  4GGQ A;  4DRH A;  4ZPV R;  1H0G A;  2K8I A;  3BXW A;  3AS2 A;  4FN2 A;  2VN1 A;  2WAE A;  2DT2 A;  2RUC A;  2YSF A;  1EHN A;  2JMF A;  3KAH A;  2PPO A;  2JV4 A;  3PR9 A;  2DSZ A;  1TFV A;  1ROT A;  1J4H A;  1PIN A;  1FKD A;  2M8J A;  3RM4 A;  5E5W A;  4MNK A;  3CZ8 A;  3ARS A;  2YSB A;  3B7X A;  4DWS B;  2LAJ A;  1LL6 A;  1K9R A;  1RP5 A;  1HJX A;  3FXY A;  2Y78 A;  2JX8 A;  1R9H A;  4DH0 A;  1PBK A;  2XP9 A;  2IF4 A;  3CGN A;  3CGM A;  2MLX A;  3O5I A;  1ZBV A;  1QPL A;  1E9L A;  3PRB A;  2YAJ B;  1JCH B;  1FFR A;  2WLY A;  2UZ5 A;  3LKX A;  3KAC A;  1FKT A;  3UQA A;  4P8U A;  3WQW A;  3ALG A;  3O5K A;  2DT1 A;  3QOK A;  1GPF A;  1X6N A;  2PV1 A;  1D7J A;  3RME A;  1E6R A;  2FDM A;  4MNL A;  2YBU A;  3AS3 A;  3UF8 A;  5AHT A;  1K9Q A;  2XP6 A;  3ALF A;  1LG2 A;  4ODP A;  4DRN A;  4LAX A;  2DT3 A;  4W9Q A;  1NWS A;  2PI6 A;  1VF8 A;  3O5G A;  4FAP A;  2KI3 A;  1X6L A;  4G50 A;  3RFW A;  1E15 A;  4KQZ A;  4JFJ A;  1F40 A;  1E44 A;  4LAV A;  4QT3 A;  4NZC A;  4A0U A;  2LKN A;  1WB0 A;  2YSG A;  4WK9 A;  2ETN A;  1ZK6 A;  3PRA A;  1J6Y A;  4JYS A;  5HWB A;  1FKB A;  3CHD A;  1J4I A;  2ESC A;  1EIB A;  4N19 A;  4NNR A;  5HWC A;  2F2D A;  1WMV A;  4P8W A;  3JXV A;  4LAY A;  3KAG A;  2DSU A;  5I98 A;  3TC5 A;  3KZ7 A;  3LE4 A;  4LAW A;  2YBT A;  3UQI A;  2KO7 A;  4TW6 A;  3WD1 A;  3OOB A;  5BXJ A;  4IQ2 A;  3CNG A;  1JMQ A;  1WNO A;  1W9U A;  1WR7 A;  4JFL A;  2AOS A;  4ODN A;  2FKE A;  4ODK A;  3PA7 A;  3O5O A;  4O2T A;  3WL0 A;  4DRK A;  3CH9 A;  4W9P A;  2P4V A;  3WQV A;  4MNM A;  3ARU A;  4DRP A;  3ARR A;  4DWS A;  3WD3 A;  3B9A A;  3RGC A;  1FLC A;  4Q7N A;  4Q22 A;  1ZBC A;  4TW8 A;  2RUR A;  3BMB A;  3ARZ A;  4DIP A;  4U84 A;  2KFW A;  1CTN A;  1ITX A;  3ARP A;  2DWV A;  3KAB A;  2DSW A;  4R0X A;  5HKG A;  2B31 A;  2ZQT A;  4S3J A;  3ODK A;  1FKI A;  5E64 A;  1LL4 A;  2MPH A;  2RSE A;  1FKF A;  3FY1 A;  4Z2H A;  1GUV A;  1HJV A;  1W1P A;  4G2P A;  1TCO C;  5HBF A;  2RE3 A;  4TYO A;  4WJX A;  3O5M A;  3AS1 A;  2YSH A;  1QPF A;  1UR9 A;  1FKH A;  1W9P A;  4WKA A;  4DZ3 A;  1ZL1 A;  4XAK A;  2KGJ A;  2G8Z A;  2XPA A;  4W5U A;  4WKF A;  5B8I C;  1Q6H A;  4P8V A;  2PV3 A;  2ZQS A;  4ML4 A;  3IK8 A;  5DO2 A;  2RQS A;  3GPK A;  2MNT A;  4DZ2 A;  3ARX A;  1EG4 A;  1EG3 A;  1BL4 A;  5GQB A;  2MDI A;  4DRO A;  1FAP A;  3O5R A;  4IT6 A;  2OWO A;  2DPE A;  1K9T A;  4ODQ A;  3ARV A;  3EY6 A;  4MGV A;  3WKZ A;  2WLZ A;  1FKR A;  3AQU A;  1J4R A;  1YAT A;  3IKG A;  1SR0 A;  3L4H A;  2ZR4 A;  3CHE A;  2FAP A;  3O5P A;  4ZS6 A;  3O5Q A;  3CHF A;  4W9O A;  2ZAJ A;  2A3B A;  3EIP A;  2O9O A;  4QT2 A;  4DWS D;  1E6Z A;  2WM0 A;  3O5J A;  1D7I A;  2DG3 A;  2M8I A;  1NWR A;  1U79 A;  3RM9 A;  2MLY A;  3NRK A;  1LL7 A;  2A3A A;  3ARQ A;  1OGG A;  4DWS C;  3M85 A;  2F4E A;  2PV2 A;  2XP7 A;  1P5Q A;  1TK7 A;  1OGB A;  2LJ4 A;  1D6O A;  1I5H W;  2QRV A;  1NWU A;  3FSC A;  3PQH A;  1UR8 A;  3B8S A;  4ITZ A;  3H9R B;  1FKG A;  4DRJ A;  4Z2L A;  3FSB A;  4J4N A;  5HTG A;  1FKK A;  4DT4 A;  1QZ2 A;  1W1T A;  2N87 A;  1GRJ A;  3ARY A;  4TX0 A;  3JYM A;  2D9F A;  4URI A;  3KCE A;  4A0T A;  1EDQ A;  2DK1 A;  4LGX A;  1W1Y A;  5U47 A; 
#chains in the Genus database with same CATH homology
 4DRQ A;  4Z2J A;  1NWT A;  1T11 A;  2WAD A;  2A3C A;  3MCB A;  3MQG A;  4MAV A;  1IX5 A;  1SYT A;  1FD9 A;  5DIV A;  3IKD A;  2Y8N B;  4KR0 B;  2RUQ A;  3FS8 A;  2XPB A;  2A3E A;  5JH8 A;  1W9V A;  1ROU A;  4ODL A;  3UI4 A;  1D2K A;  2DG4 A;  4WKH A;  1JNS A;  2E45 A;  2G41 A;  5E66 A;  1HKJ A;  4Z2K A;  3NTP A;  1HKM A;  1NSG A;  5GPR A;  1JVW A;  4AY1 A;  2XP5 A;  1ZU8 A;  3ARO A;  4TW7 A;  3ART A;  3WD2 A;  4HBE A;  4E5R A;  3B9D A;  4IPX A;  2RUD A;  1W1V A;  4ZPW R;  1E6N A;  2DJY A;  4L72 B;  5HW7 A;  1W26 A;  3MCB B;  1B6C A;  4P8X A;  3CHC A;  2M3O W;  3LKX B;  3W4R A;  4C02 B;  1O6I A;  3MQH A;  3RM8 A;  2MF9 A;  5DIU A;  2ZR6 A;  1XRV A;  5HW8 A;  1JNT A;  1JNE A;  4JFM A;  1FKJ A;  3OA5 A;  2VCD A;  2XP3 A;  5HT1 A;  4Z2I A;  1C9H A;  2PPP A;  2XP8 A;  1D7H A;  5GPG A;  2PPN A;  4REX A;  2KR7 A;  4GIV A;  1HKK A;  1GOI A;  5J6E A;  1ZCN A;  2ITK A;  2ZR5 A;  5E62 A;  4MPK A;  4TNS A;  3TCZ A;  1FJD A;  1L1P A;  1LJY A;  2JXW A;  3WL1 A;  2DT0 A;  3O5F A;  1HKI A;  2OFN A;  3FAP A;  3IHZ A;  2XP4 A;  2YSI A;  3M7N A;  4S3K A;  3WD0 A;  4HAR A;  2EZ5 W;  4ODO A;  2DSV A;  4J4O A;  1F8A B;  1M5Y A;  2KE0 A;  2F21 A;  1HJW A;  1ZBK A;  4ODR A;  3B9E A;  2QF8 A;  3WH0 A;  4L3N A;  1XHG A;  3G6L A;  4IQC A;  2LGO A;  2IUZ A;  1NMW A;  1EQ3 A;  5CQ2 A;  2AWG A;  1RD6 A;  1ZB5 A;  3WD4 A;  1HXV A;  1BKF A;  3KAF A;  4QZV B;  1Q1C A;  4WIW A;  5DF0 A;  4DRI A;  1TR8 A;  1Q6U A;  2L4J A;  4JFK A;  1KT0 A;  3I6C A;  1Q6I A;  5E65 A;  3O5L A;  4MTV A;  2PBC A;  3WIJ A;  1LG1 A;  4GLX A;  2DG9 A;  1NMV A;  1JND A;  1LQ0 A;  5D75 A;  3AS0 A;  1H0I A;  2ZQV A;  4MSP A;  3UI6 A;  3TDB A;  4PTM A;  1FKL A;  2WK2 A;  3O5E A;  2JZV A;  4R5E A;  3UI5 A;  2BA1 A;  2O92 A;  3O5D A;  1OWQ A;  1ZBW A;  2DK7 A;  5HW6 A;  3KAI A;  4QIB A;  2MLZ A;  2OLH A;  4ODM A;  1A7X A;  3KAD A;  3G6M A;  2DMV A;  2Q5A A;  2LPV A;  2L2S A;  3VAW A;  3PRD A;  4Z2G A;  4BF8 A;  1FKS A;  4JFI A;  3JYJ A;  1YW5 A;  5DIT A;  3LUO A;  2M1I A;  4U85 A;  2M2A A;  5HUA A;  2KXQ A;  4U86 A;  1N1A A;  5DEZ A;  1FFQ A;  3NI6 A;  3UQB A;  4DRM A;  1KT1 A;  4HBO A;  1O6W A;  1EYM A;  1KFW A;  3ARW A;  1NH6 A;  1WAW A;  4MNJ A;  1E6P A;  2ZQU A;  2M08 A;  4IT4 A;  4NSB A;  1Y0O A;  4ZPT R;  3MDY B;  4GGQ A;  4DRH A;  4ZPV R;  1H0G A;  2K8I A;  3BXW A;  3AS2 A;  4FN2 A;  2VN1 A;  2WAE A;  2DT2 A;  2RUC A;  2YSF A;  1EHN A;  2JMF A;  3KAH A;  2PPO A;  2JV4 A;  3PR9 A;  2DSZ A;  1TFV A;  1ROT A;  1J4H A;  1PIN A;  1FKD A;  2M8J A;  3RM4 A;  5E5W A;  4MNK A;  3CZ8 A;  3ARS A;  2YSB A;  3B7X A;  4DWS B;  2LAJ A;  1LL6 A;  1K9R A;  1RP5 A;  1HJX A;  3FXY A;  2Y78 A;  2JX8 A;  1R9H A;  4DH0 A;  1PBK A;  2XP9 A;  2IF4 A;  3CGN A;  3CGM A;  2MLX A;  3O5I A;  1ZBV A;  1QPL A;  1E9L A;  3PRB A;  2YAJ B;  1FFR A;  2WLY A;  2UZ5 A;  3LKX A;  3KAC A;  1FKT A;  3UQA A;  4P8U A;  3WQW A;  3ALG A;  3O5K A;  2DT1 A;  3QOK A;  1GPF A;  1X6N A;  2PV1 A;  1D7J A;  3RME A;  1E6R A;  2FDM A;  4MNL A;  2YBU A;  3AS3 A;  3UF8 A;  5AHT A;  1K9Q A;  2XP6 A;  3ALF A;  1LG2 A;  4ODP A;  4DRN A;  4LAX A;  2DT3 A;  4W9Q A;  1NWS A;  2PI6 A;  1VF8 A;  3O5G A;  4FAP A;  2KI3 A;  1X6L A;  4G50 A;  3RFW A;  1E15 A;  4KQZ A;  4JFJ A;  1F40 A;  4LAV A;  4QT3 A;  4NZC A;  4A0U A;  2LKN A;  1WB0 A;  2YSG A;  4WK9 A;  1ZK6 A;  3PRA A;  1J6Y A;  4JYS A;  5HWB A;  1FKB A;  3CHD A;  1J4I A;  2ESC A;  1EIB A;  4N19 A;  4NNR A;  5HWC A;  2F2D A;  1WMV A;  4P8W A;  3JXV A;  4LAY A;  3KAG A;  2DSU A;  5I98 A;  3TC5 A;  3KZ7 A;  3LE4 A;  4LAW A;  2YBT A;  3UQI A;  2KO7 A;  4TW6 A;  3WD1 A;  3OOB A;  5BXJ A;  4IQ2 A;  3CNG A;  1JMQ A;  1WNO A;  1W9U A;  1WR7 A;  4JFL A;  2AOS A;  4ODN A;  2FKE A;  4ODK A;  3PA7 A;  3O5O A;  4O2T A;  3WL0 A;  4DRK A;  3CH9 A;  4W9P A;  3WQV A;  4MNM A;  3ARU A;  4DRP A;  3ARR A;  4DWS A;  3WD3 A;  3B9A A;  3RGC A;  1FLC A;  4Q7N A;  4Q22 A;  1ZBC A;  4TW8 A;  2RUR A;  3ARZ A;  4DIP A;  4U84 A;  2KFW A;  1CTN A;  1ITX A;  3ARP A;  2DWV A;  3KAB A;  2DSW A;  4R0X A;  5HKG A;  2B31 A;  2ZQT A;  4S3J A;  3ODK A;  1FKI A;  5E64 A;  1LL4 A;  2MPH A;  2RSE A;  1FKF A;  3FY1 A;  4Z2H A;  1GUV A;  1HJV A;  1W1P A;  4G2P A;  1TCO C;  5HBF A;  2RE3 A;  4TYO A;  4WJX A;  3O5M A;  3AS1 A;  2YSH A;  1QPF A;  1UR9 A;  1FKH A;  1W9P A;  4WKA A;  4DZ3 A;  1ZL1 A;  4XAK A;  2KGJ A;  2G8Z A;  2XPA A;  4W5U A;  4WKF A;  5B8I C;  1Q6H A;  4P8V A;  2PV3 A;  2ZQS A;  4ML4 A;  3IK8 A;  5DO2 A;  2RQS A;  3GPK A;  2MNT A;  4DZ2 A;  3ARX A;  1EG4 A;  1EG3 A;  1BL4 A;  5GQB A;  2MDI A;  4DRO A;  1FAP A;  3O5R A;  4IT6 A;  2OWO A;  2DPE A;  1K9T A;  4ODQ A;  3ARV A;  3EY6 A;  4MGV A;  3WKZ A;  2WLZ A;  1FKR A;  3AQU A;  1J4R A;  1YAT A;  3IKG A;  1SR0 A;  3L4H A;  2ZR4 A;  3CHE A;  2FAP A;  3O5P A;  4ZS6 A;  3O5Q A;  3CHF A;  4W9O A;  2ZAJ A;  2A3B A;  2O9O A;  4QT2 A;  4DWS D;  1E6Z A;  2WM0 A;  3O5J A;  1D7I A;  2DG3 A;  2M8I A;  1NWR A;  1U79 A;  3RM9 A;  2MLY A;  3NRK A;  1LL7 A;  2A3A A;  3ARQ A;  1OGG A;  4DWS C;  3M85 A;  2F4E A;  2PV2 A;  2XP7 A;  1P5Q A;  1TK7 A;  1OGB A;  2LJ4 A;  1D6O A;  1I5H W;  2QRV A;  1NWU A;  3FSC A;  3PQH A;  1UR8 A;  3B8S A;  4ITZ A;  3H9R B;  1FKG A;  4DRJ A;  4Z2L A;  3FSB A;  4J4N A;  5HTG A;  1FKK A;  4DT4 A;  1QZ2 A;  1W1T A;  2N87 A;  3ARY A;  4TX0 A;  3JYM A;  2D9F A;  4URI A;  3KCE A;  4A0T A;  1EDQ A;  2DK1 A;  4LGX A;  1W1Y A;  5U47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...