2XP9A

Discovery of cell-active phenyl-imidazole pin1 inhibitors by structure-guided fragment evolution
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
157
structure length
144
Chain Sequence
b'LPPGWEKAMSRSSGRVYYFNHITNASQWERPEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEPTIDYL-PROLYL CIS-TRANS ISOMERASE NIMA-INTERACTING 1
molecule tags Isomerase
source organism Homo sapiens
publication title Discovery of Cell-Active Phenyl-Imidazole Pin1 Inhibitors by Structure-Guided Fragment Evolution.
pubmed doi rcsb
total genus 46
structure length 144
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2xp9A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2xp9A02
2LGOA 1K9RA 3PRDA 3JYMA 4DIPA 4FAPA 5HW8A 1K9QA 1JVWA 4DRIA 4DROA 1M5YA 2DG9A 3FAPA 4ODLA 2RUDA 3KACA 2EZ5W 4ODPA 5AHTA 4DZ2A 1F40A 3KAHA 2E45A 1JMQA 3RGCA 1ZK6A 1FKFA 4U85A 1D7HA 3WH0A 1D7IA 2LAJA 1KT0A 3KAGA 2DG4A 2JV4A 2PV3A 4E5RA 3CGNA 3KCEA 1FKTA 4TW6A 2KR7A 3I6CA 4NNRA 1FKHA 2ZR5A 2XP8A 3NTPA 2LPVA 4W9PA 2XP6A 4DRNA 3GPKA 3UQIA 5I98A 3OOBA 4IQ2A 3UI5A 4DRMA 3O5RA 4DH0A 1T11A 1D6OA 3O5MA 2ITKA 2XPBA 3TDBA 2MLYA 1Q1CA 1WMVA 4BF8A 4DT4A 2DK7A 3O5FA 2XP5A 3RFWA 3TCZA 2YSFA 2KXQA 1FKJA 2PPPA 4MGVA 4ODKA 5HT1A 2ZQTA 2XP7A 2UZ5A 4JYSA 2ZQVA 2XP3A 4N19A 3UF8A 3UQAA 4ITZA 1TK7A 2AWGA 4J4NA 1EG4A 2KE0A 5HW7A 5J6EA 2M1IA 2N87A 1C9HA 4LAWA 4U84A 2XP4A 4JFJA 3H9RB 3PRBA 2K8IA 2KGJA 2PV2A 2M2AA 1YW5A 4QT2A 2DMVA 2MPHA 4FN2A 5CQ2A 2ZAJA 2IF4A 2JZVA 3LUOA 2ZQUA 4ODNA 3O5LA 1N1AA 3O5IA 3IKGA 1NSGA 2YSIA 4R0XA 3CNGA 1PBKA 2KI3A 5DIUA 2PBCA 4LAYA 1QZ2A 4DZ3A 2YSGA 4QIBA 1U79A 2MLZA 5B8IC 2Q5AA 1Q6UA 1O6WA 2F2DA 1NMWA 3JXVA 4JFMA 1FD9A 1YATA 2L4JA 1FKLA 2MDIA 2JX8A 2DJYA 2M8JA 4ODMA 1FJDA 5HKGA 1Q6HA 1J6YA 2M3OW 2DK1A 3L4HA 3LE4A 1FAPA 3O5EA 4TW8A 4DRKA 5HW6A 2Y78A 5BXJA 4REXA 2L2SA 5HWBA 2F21A 1ROTA 2PPOA 1Y0OA 5D75A 4DRHA 1QPFA 2DG3A 2RSEA 2XP9A 1TCOC 2RURA 3IHZA 4ODRA 2KO7A 5DIVA 3UI4A 1EQ3A 3O5JA 4G2PA 2VCDA 3O5QA 1J4RA 4DRPA 1JNSA 3JYJA 4IQCA 3MDYB 3KZ7A 2VN1A 3CGMA 2RUCA 2YSBA 3TC5A 4W9OA 1FKRA 1B6CA 2PPNA 5HTGA 4J4OA 1WR7A 4JFKA 2LJ4A 2MLXA 3B7XA 1J4IA 3O5KA 3O5DA 4JFLA 1J4HA 3IK8A 4ODOA 4ODQA 3KABA 2LKNA 4LAVA 1JNTA 2JXWA 1ZCNA 2DWVA 2MNTA 2ZR4A 3IKDA 1A7XA 1I5HW 2RE3A 2PV1A 2RUQA 5GPGA 4DRJA 3NI6A 4DRQA 3NRKA 3PA7A 4GGQA 4IPXA 1EG3A 1KT1A 1F8AB 1Q6IA 1FKSA 2M08A 2D9FA 2YSHA 3UI6A 4TNSA 1PINA 3VAWA 3O5GA 1W26A 3M7NA 1QPLA 2MF9A 3EY6A 4TX0A 2M8IA 2FKEA 5DITA 4MSPA 5HWCA 2OFNA 4JFIA 2JMFA 2F4EA 3M85A 1FKGA 1P5QA 1L1PA 3UQBA 3KAIA 5HUAA 2FAPA 1FKKA 3KADA 2ZR6A 1BKFA 1R9HA 2RQSA 3O5PA 2BA1A 1BL4A 4LAXA 3ODKA 2XPAA 1HXVA 4C02B 4TW7A 3KAFA 1EYMA 1FKDA 1FKIA 1NMVA 4GIVA 1D7JA 4O2TA 4QT3A 3O5OA 2KFWA 4W9QA 4TYOA 2ZQSA 1FKBA 4U86A 4G50A 1ROUA
chains in the Genus database with same CATH superfamily
2LGOA 1ITXA 1SR0A 3JYMA 3WL1A 3WQWA 4WKFA 3RM4A 1F40A 2WAEA 3RGCA 1ZL1A 1ZK6A 4Z2GA 3WH0A 4P8VA 2DSWA 2JV4A 4A0UA 4E5RA 3WKZA 3I6CA 4W9PA 3UQIA 3UI5A 4IQ2A 4DRMA 1D6OA 2ITKA 3TDBA 2DK7A 3RFWA 2PPPA 2KXQA 2ZQTA 2UZ5A 4JYSA 3UQAA 1E9LA 2AWGA 1JNEA 2KE0A 2M1IA 3GU0A 4Z2JA 1C9HA 4LAWA 4GLXA 1OWQA 2K8IA 2PV2A 1O6IA 1E6ZA 5DEZA 3LUOA 4WJXA 3O5LA 1ZBVA 1N1AA 4ZS6A 2YSIA 2KI3A 4LAYA 1QZ2A 1OGBA 1FFRA 1OGGA 2MLZA 3ALFA 1O6WA 1NMWA 1FD9A 1K9TA 2L4JA 1E44A 1XRVA 2DJYA 2WK2A 4PTMA 1J6YA 2DK1A 4MNKA 2F23A 3GTYX 4REXA 4DRHA 1FLCA 2OLHA 3WD2A 1TCOC 3CH9A 1W1TA 5GPRA 3O5QA 4DWSD 1J4RA 3JYJA 4IQCA 1EHNA 4KR0B 3FS8A 4LGXA 2YSBA 3TC5A 4W9OA 1FKRA 1B6CA 1JNDA 1GPFA 2PPNA 3LKXA 4J4OA 1J4IA 3CHEA 3IK8A 4P8XA 4ODQA 2FDMA 4XAKA 2Y8NB 2JXWA 1ZCNA 2DWVA 2DT0A 1KFWA 1ZB5A 1I5HW 3B9DA 1EG3A 1NWRA 1KT1A 2YSHA 2O9OA 4TNSA 3VAWA 3O5GA 2PI6A 3OA5A 2A3CA 3M7NA 4TX0A 2MF9A 4WKAA 5DITA 4MTVA 1FKGA 4ZPVR 4P8UA 2RQSA 2PN0A 3ODKA 3KAFA 3B9EA 3ARUA 4HBOA 1XHGA 1HKMA 1K9RA 4FAPA 3PQHA 4DROA 5HW8A 2DG9A 2RUDA 1UR9A 4ODPA 1H0IA 4DZ2A 1JMQA 4HARA 1D7IA 1ZU8A 1W9VA 4KQZA 4TW6A 3G6LA 4NNRA 1W1YA 1FKHA 2XP8A 4S3KA 3OOBA 2A3BA 3O5MA 2MLYA 1GRJA 4NSBA 3O5FA 2XP5A 4L72B 3MQGA 3RM8A 3MCBB 1NH6A 1WB0A 1TFVA 2XP7A 5HT1A 5E64A 3UF8A 2QRVA 4N19A 4ITZA 1TK7A 3FY1A 1LL4A 3MQHA 4U84A 2XP4A 4QZVB 3PRBA 2A3AA 2KGJA 1YW5A 1VF8A 5E5WA 2DMVA 4QT2A 5CQ2A 2ZAJA 4ODNA 1NSGA 4WIWA 4NZCA 4Z2LA 4QIBA 2DT3A 3JXVA 1X6NA 2MDIA 4ODMA 4DWSC 1Q6HA 1HKKA 3L4HA 4Z2IA 5HW6A 2Y78A 1E6PA 5BXJA 2F21A 1ROTA 1Y0OA 1LG1A 4ML4A 4R5EA 2RURA 4ODRA 3IHZA 3UI4A 3O5JA 4G2PA 3WIJA 5E66A 2VCDA 3WQVA 4DRPA 1UR8A 3ARPA 4MAVA 4ZPWR 2VN1A 2IUZA 3BXWA 2DT1A 2WM0A 5HTGA 1WR7A 1W9PA 3B7XA 1LQ0A 4JFLA 3O5KA 1GUVA 4Z2HA 3ARQA 1SYTA 2LKNA 4LAVA 3CHFA 2ZR4A 2P4VA 2PV1A 2RUQA 3CHCA 3ARZA 5GPGA 5GQBA 4MNLA 4URIA 2G41A 1Q6IA 2M08A 1W1VA 1PINA 3ARWA 1W26A 5HWCA 2M8IA 2FKEA 4MSPA 3ARVA 2F4EA 3M85A 1L1PA 1W9UA 3FSCA 5HUAA 2FAPA 3KADA 1BKFA 1GOIA 1R9HA 1LL7A 3RMEA 3W4RA 1HXVA 3AROA 1EYMA 4O2TA 4W9QA 4TYOA 2ZQSA 1FKBA 4JFIA 1E15A 3WD1A 3PRDA 4DWSA 4IT4A 4DIPA 1K9QA 4ODLA 3KACA 2EZ5W 1FKFA 4U85A 1KT0A 2LAJA 3KAGA 2PV3A 2A3EA 3CGNA 3KCEA 1FKTA 2ZR5A 3NTPA 2LPVA 2XP6A 3ALGA 5I98A 4DH0A 1T11A 2DSVA 1Q1CA 4DT4A 3CZ8A 1FKJA 2YSFA 4BF8A 4MGVA 4ODKA 3UI6A 2ZQVA 4J4NA 1EG4A 3G6MA 5HW7A 5J6EA 2N87A 2YBTA 4JFJA 2YAJB 3H9RB 2QF8A 2M2AA 2OWOA 2MPHA 2DPEA 3ARYA 3FSBA 2IF4A 2JZVA 2DSZA 3AS2A 3IKGA 1ZBKA 5DIUA 2PBCA 2EULA 1W1PA 2B5UB 2YSGA 4DZ3A 2Q5AA 3FXYA 4DWSB 1FKLA 2M8JA 1FJDA 2M3OW 4TW8A 3LE4A 1FAPA 2L2SA 1EDQA 5HWBA 1LL6A 1HKJA 2PPOA 1CTNA 4Q7NA 3EIPA 1QPFA 2DG3A 1EIBA 2KO7A 5DIVA 1NWUA 1EQ3A 1HKIA 4S3JA 3MDYB 3LKXB 4Z2KA 4W5UA 1NWSA 1WNOA 2WADA 2LJ4A 4MPKA 4ODOA 2YBUA 4UDMA 5E65A 2MNTA 3IKDA 2O92A 2WLZA 4DRQA 3AS0A 3NI6A 3NRKA 3PA7A 5E62A 3B8SA 2D9FA 1IX5A 1QPLA 3EY6A 1JCHB 3UQBA 2ETNA 2ZR6A 2BA1A 1BL4A 4LAXA 4C02B 4TW7A 4GIVA 1NMVA 3B9AA 5JH8A 3O5OA 1LG2A 4U86A 1JVWA 1HJVA 4DRIA 1M5YA 3FAPA 5AHTA 3KAHA 2E45A 2WLYA 1HJXA 1D7HA 2DSUA 2DG4A 2KR7A 1E6RA 4DRNA 4P8WA 3GPKA 3O5RA 2XPBA 3WL0A 1ZBCA 1WMVA 4MNMA 1NWTA 1HJWA 3TCZA 1RP5A 1FFQA 2XP3A 2ESCA 1D2KA 3ARRA 2AOSA 3BMBA 4FN2A 2ZQUA 1E6NA 1H0GA 3O5IA 4R0XA 3CNGA 1PBKA 5HBFA 3PR9A 1U79A 5B8IC 4ZPTR 1Q6UA 2F2DA 4JFMA 1YATA 5DO2A 2JX8A 5HKGA 4Q22A 3O5EA 4DRKA 3PRAA 3AQUA 5D75A 2RSEA 1ZBWA 2XP9A 3AS1A 3QOKA 1TR8A 1JNSA 1WAWA 3ARSA 3RM9A 4WKHA 1X6LA 3KZ7A 3CGMA 2RUCA 4AY1A 3ARTA 4HBEA 4WK9A 4JFKA 2MLXA 3O5DA 1J4HA 3WD4A 3KABA 1JNTA 2B31A 2DT2A 4IT6A 1A7XA 1RD6A 2RE3A 4DRJA 4GGQA 3WD3A 4IPXA 5DF0A 1F8AB 1FKSA 4A0TA 3MCBA 3ARXA 4L3NA 2G8ZA 2OFNA 2JMFA 3CHDA 1P5QA 1LJYA 3WD0A 3KAIA 5U47A 1FKKA 4MNJA 3O5PA 2XPAA 1FKIA 1FKDA 3AS3A 1D7JA 4QT3A 2KFWA 4G50A 1ROUA
chains in the Genus database with same CATH topology
2LGOA 1ITXA 1SR0A 3JYMA 3WL1A 3WQWA 4WKFA 3RM4A 1F40A 2WAEA 3RGCA 1ZL1A 1ZK6A 4Z2GA 3WH0A 4P8VA 2DSWA 2JV4A 4A0UA 4E5RA 3WKZA 3I6CA 4W9PA 3UQIA 3UI5A 4IQ2A 4DRMA 1D6OA 2ITKA 3TDBA 2DK7A 3RFWA 2PPPA 2KXQA 2ZQTA 2UZ5A 4JYSA 3UQAA 1E9LA 2AWGA 1JNEA 2KE0A 2M1IA 4Z2JA 1C9HA 4LAWA 4GLXA 1OWQA 2K8IA 2PV2A 1O6IA 1E6ZA 5DEZA 3LUOA 4WJXA 3O5LA 1ZBVA 1N1AA 4ZS6A 2YSIA 2KI3A 4LAYA 1QZ2A 1OGBA 1FFRA 1OGGA 2MLZA 3ALFA 1O6WA 1NMWA 1FD9A 1K9TA 2L4JA 1XRVA 2DJYA 2WK2A 4PTMA 1J6YA 2DK1A 4MNKA 4REXA 4DRHA 1FLCA 2OLHA 3WD2A 1TCOC 3CH9A 1W1TA 5GPRA 3O5QA 4DWSD 1J4RA 3JYJA 4IQCA 1EHNA 4KR0B 3FS8A 4LGXA 2YSBA 3TC5A 4W9OA 1FKRA 1B6CA 1JNDA 1GPFA 2PPNA 3LKXA 4J4OA 1J4IA 3CHEA 3IK8A 4P8XA 4ODQA 2FDMA 4XAKA 2Y8NB 2JXWA 1ZCNA 2DWVA 2DT0A 1KFWA 1ZB5A 1I5HW 3B9DA 1EG3A 1NWRA 1KT1A 2YSHA 2O9OA 4TNSA 3VAWA 3O5GA 2PI6A 3OA5A 2A3CA 3M7NA 4TX0A 2MF9A 4WKAA 5DITA 4MTVA 1FKGA 4ZPVR 4P8UA 2RQSA 3ODKA 3KAFA 3B9EA 3ARUA 4HBOA 1XHGA 1HKMA 1K9RA 4FAPA 3PQHA 4DROA 5HW8A 2DG9A 2RUDA 1UR9A 4ODPA 1H0IA 4DZ2A 1JMQA 4HARA 1D7IA 1ZU8A 1W9VA 4KQZA 4TW6A 3G6LA 4NNRA 1W1YA 1FKHA 2XP8A 4S3KA 3OOBA 2A3BA 3O5MA 2MLYA 4NSBA 3O5FA 2XP5A 4L72B 3MQGA 3RM8A 3MCBB 1NH6A 1WB0A 1TFVA 2XP7A 5HT1A 5E64A 3UF8A 2QRVA 4N19A 4ITZA 1TK7A 3FY1A 1LL4A 3MQHA 4U84A 2XP4A 4QZVB 3PRBA 2A3AA 2KGJA 1YW5A 1VF8A 5E5WA 2DMVA 4QT2A 5CQ2A 2ZAJA 4ODNA 1NSGA 4WIWA 4NZCA 4Z2LA 4QIBA 2DT3A 3JXVA 1X6NA 2MDIA 4ODMA 4DWSC 1Q6HA 1HKKA 3L4HA 4Z2IA 5HW6A 2Y78A 1E6PA 5BXJA 2F21A 1ROTA 1Y0OA 1LG1A 4ML4A 4R5EA 2RURA 4ODRA 3IHZA 3UI4A 3O5JA 4G2PA 3WIJA 5E66A 2VCDA 3WQVA 4DRPA 1UR8A 3ARPA 4MAVA 4ZPWR 2VN1A 2IUZA 3BXWA 2DT1A 2WM0A 5HTGA 1WR7A 1W9PA 3B7XA 1LQ0A 4JFLA 3O5KA 1GUVA 4Z2HA 3ARQA 1SYTA 2LKNA 4LAVA 3CHFA 2ZR4A 2RUQA 2PV1A 3CHCA 3ARZA 5GPGA 5GQBA 4MNLA 4URIA 2G41A 1Q6IA 2M08A 1W1VA 1PINA 3ARWA 1W26A 5HWCA 2M8IA 2FKEA 4MSPA 3ARVA 2F4EA 3M85A 1L1PA 1W9UA 3FSCA 5HUAA 2FAPA 3KADA 1BKFA 1GOIA 1R9HA 1LL7A 3RMEA 3W4RA 1HXVA 3AROA 1EYMA 4O2TA 4W9QA 4TYOA 2ZQSA 1FKBA 4JFIA 1E15A 3WD1A 3PRDA 4DWSA 4IT4A 4DIPA 1K9QA 4ODLA 3KACA 2EZ5W 1FKFA 4U85A 1KT0A 2LAJA 3KAGA 2PV3A 2A3EA 3CGNA 3KCEA 1FKTA 2ZR5A 3NTPA 2LPVA 2XP6A 3ALGA 5I98A 4DH0A 1T11A 2DSVA 1Q1CA 4DT4A 3CZ8A 1FKJA 2YSFA 4BF8A 4MGVA 4ODKA 3UI6A 2ZQVA 4J4NA 1EG4A 3G6MA 5HW7A 5J6EA 2N87A 2YBTA 4JFJA 2YAJB 3H9RB 2QF8A 2M2AA 2OWOA 2MPHA 2DPEA 3ARYA 3FSBA 2IF4A 2JZVA 2DSZA 3AS2A 3IKGA 1ZBKA 5DIUA 2PBCA 1W1PA 4DZ3A 2YSGA 2Q5AA 3FXYA 4DWSB 1FKLA 2M8JA 1FJDA 2M3OW 4TW8A 3LE4A 1FAPA 2L2SA 1EDQA 5HWBA 1LL6A 1HKJA 2PPOA 1CTNA 4Q7NA 1QPFA 2DG3A 1EIBA 2KO7A 5DIVA 1NWUA 1EQ3A 1HKIA 4S3JA 3MDYB 3LKXB 4Z2KA 4W5UA 1NWSA 1WNOA 2WADA 2LJ4A 4MPKA 4ODOA 2YBUA 5E65A 2MNTA 3IKDA 2O92A 2WLZA 4DRQA 3AS0A 3NI6A 3NRKA 3PA7A 5E62A 3B8SA 2D9FA 1IX5A 1QPLA 3EY6A 3UQBA 2ZR6A 2BA1A 1BL4A 4LAXA 4C02B 4TW7A 4GIVA 1NMVA 3B9AA 5JH8A 3O5OA 1LG2A 4U86A 1JVWA 1HJVA 4DRIA 1M5YA 3FAPA 5AHTA 3KAHA 2E45A 2WLYA 1HJXA 1D7HA 2DSUA 2DG4A 2KR7A 1E6RA 4DRNA 4P8WA 3GPKA 3O5RA 2XPBA 3WL0A 1ZBCA 1WMVA 4MNMA 1NWTA 1HJWA 3TCZA 1RP5A 1FFQA 2XP3A 2ESCA 1D2KA 3ARRA 2AOSA 4FN2A 2ZQUA 1E6NA 1H0GA 3O5IA 4R0XA 3CNGA 1PBKA 5HBFA 3PR9A 1U79A 5B8IC 4ZPTR 1Q6UA 2F2DA 4JFMA 1YATA 5DO2A 2JX8A 5HKGA 4Q22A 3O5EA 4DRKA 3PRAA 3AQUA 5D75A 2RSEA 1ZBWA 2XP9A 3AS1A 3QOKA 1TR8A 1JNSA 1WAWA 3ARSA 3RM9A 4WKHA 1X6LA 3KZ7A 3CGMA 2RUCA 4AY1A 3ARTA 4HBEA 4WK9A 4JFKA 2MLXA 3O5DA 1J4HA 3WD4A 3KABA 1JNTA 2B31A 2DT2A 4IT6A 1A7XA 1RD6A 2RE3A 4DRJA 4GGQA 3WD3A 4IPXA 5DF0A 1F8AB 1FKSA 4A0TA 3MCBA 3ARXA 4L3NA 2G8ZA 2OFNA 2JMFA 3CHDA 1P5QA 1LJYA 3WD0A 3KAIA 5U47A 1FKKA 4MNJA 3O5PA 2XPAA 1FKIA 1FKDA 3AS3A 1D7JA 4QT3A 2KFWA 4G50A 1ROUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LGO A;  1K9R A;  3PRD A;  3JYM A;  4DIP A;  4FAP A;  5HW8 A;  1K9Q A;  1JVW A;  4DRI A;  4DRO A;  1M5Y A;  2DG9 A;  3FAP A;  4ODL A;  2RUD A;  3KAC A;  2EZ5 W;  4ODP A;  5AHT A;  4DZ2 A;  1F40 A;  3KAH A;  2E45 A;  1JMQ A;  3RGC A;  1ZK6 A;  1FKF A;  4U85 A;  1D7H A;  3WH0 A;  1D7I A;  2LAJ A;  1KT0 A;  3KAG A;  2DG4 A;  2JV4 A;  2PV3 A;  4E5R A;  3CGN A;  3KCE A;  1FKT A;  4TW6 A;  2KR7 A;  3I6C A;  4NNR A;  1FKH A;  2ZR5 A;  2XP8 A;  3NTP A;  2LPV A;  4W9P A;  2XP6 A;  4DRN A;  3GPK A;  3UQI A;  5I98 A;  3OOB A;  4IQ2 A;  3UI5 A;  4DRM A;  3O5R A;  4DH0 A;  1T11 A;  1D6O A;  3O5M A;  2ITK A;  2XPB A;  3TDB A;  2MLY A;  1Q1C A;  1WMV A;  4BF8 A;  4DT4 A;  2DK7 A;  3O5F A;  2XP5 A;  3RFW A;  3TCZ A;  2YSF A;  2KXQ A;  1FKJ A;  2PPP A;  4MGV A;  4ODK A;  5HT1 A;  2ZQT A;  2XP7 A;  2UZ5 A;  4JYS A;  2ZQV A;  2XP3 A;  4N19 A;  3UF8 A;  3UQA A;  4ITZ A;  1TK7 A;  2AWG A;  4J4N A;  1EG4 A;  2KE0 A;  5HW7 A;  5J6E A;  2M1I A;  2N87 A;  1C9H A;  4LAW A;  4U84 A;  2XP4 A;  4JFJ A;  3H9R B;  3PRB A;  2K8I A;  2KGJ A;  2PV2 A;  2M2A A;  1YW5 A;  4QT2 A;  2DMV A;  2MPH A;  4FN2 A;  5CQ2 A;  2ZAJ A;  2IF4 A;  2JZV A;  3LUO A;  2ZQU A;  4ODN A;  3O5L A;  1N1A A;  3O5I A;  3IKG A;  1NSG A;  2YSI A;  4R0X A;  3CNG A;  1PBK A;  2KI3 A;  5DIU A;  2PBC A;  4LAY A;  1QZ2 A;  4DZ3 A;  2YSG A;  4QIB A;  1U79 A;  2MLZ A;  5B8I C;  2Q5A A;  1Q6U A;  1O6W A;  2F2D A;  1NMW A;  3JXV A;  4JFM A;  1FD9 A;  1YAT A;  2L4J A;  1FKL A;  2MDI A;  2JX8 A;  2DJY A;  2M8J A;  4ODM A;  1FJD A;  5HKG A;  1Q6H A;  1J6Y A;  2M3O W;  2DK1 A;  3L4H A;  3LE4 A;  1FAP A;  3O5E A;  4TW8 A;  4DRK A;  5HW6 A;  2Y78 A;  5BXJ A;  4REX A;  2L2S A;  5HWB A;  2F21 A;  1ROT A;  2PPO A;  1Y0O A;  5D75 A;  4DRH A;  1QPF A;  2DG3 A;  2RSE A;  2XP9 A;  1TCO C;  2RUR A;  3IHZ A;  4ODR A;  2KO7 A;  5DIV A;  3UI4 A;  1EQ3 A;  3O5J A;  4G2P A;  2VCD A;  3O5Q A;  1J4R A;  4DRP A;  1JNS A;  3JYJ A;  4IQC A;  3MDY B;  3KZ7 A;  2VN1 A;  3CGM A;  2RUC A;  2YSB A;  3TC5 A;  4W9O A;  1FKR A;  1B6C A;  2PPN A;  5HTG A;  4J4O A;  1WR7 A;  4JFK A;  2LJ4 A;  2MLX A;  3B7X A;  1J4I A;  3O5K A;  3O5D A;  4JFL A;  1J4H A;  3IK8 A;  4ODO A;  4ODQ A;  3KAB A;  2LKN A;  4LAV A;  1JNT A;  2JXW A;  1ZCN A;  2DWV A;  2MNT A;  2ZR4 A;  3IKD A;  1A7X A;  1I5H W;  2RE3 A;  2PV1 A;  2RUQ A;  5GPG A;  4DRJ A;  3NI6 A;  4DRQ A;  3NRK A;  3PA7 A;  4GGQ A;  4IPX A;  1EG3 A;  1KT1 A;  1F8A B;  1Q6I A;  1FKS A;  2M08 A;  2D9F A;  2YSH A;  3UI6 A;  4TNS A;  1PIN A;  3VAW A;  3O5G A;  1W26 A;  3M7N A;  1QPL A;  2MF9 A;  3EY6 A;  4TX0 A;  2M8I A;  2FKE A;  5DIT A;  4MSP A;  5HWC A;  2OFN A;  4JFI A;  2JMF A;  2F4E A;  3M85 A;  1FKG A;  1P5Q A;  1L1P A;  3UQB A;  3KAI A;  5HUA A;  2FAP A;  1FKK A;  3KAD A;  2ZR6 A;  1BKF A;  1R9H A;  2RQS A;  3O5P A;  2BA1 A;  1BL4 A;  4LAX A;  3ODK A;  2XPA A;  1HXV A;  4C02 B;  4TW7 A;  3KAF A;  1EYM A;  1FKD A;  1FKI A;  1NMV A;  4GIV A;  1D7J A;  4O2T A;  4QT3 A;  3O5O A;  2KFW A;  4W9Q A;  4TYO A;  2ZQS A;  1FKB A;  4U86 A;  4G50 A;  1ROU A; 
#chains in the Genus database with same CATH topology
 2LGO A;  1ITX A;  1SR0 A;  3JYM A;  3WL1 A;  3WQW A;  4WKF A;  3RM4 A;  1F40 A;  2WAE A;  3RGC A;  1ZL1 A;  1ZK6 A;  4Z2G A;  3WH0 A;  4P8V A;  2DSW A;  2JV4 A;  4A0U A;  4E5R A;  3WKZ A;  3I6C A;  4W9P A;  3UQI A;  3UI5 A;  4IQ2 A;  4DRM A;  1D6O A;  2ITK A;  3TDB A;  2DK7 A;  3RFW A;  2PPP A;  2KXQ A;  2ZQT A;  2UZ5 A;  4JYS A;  3UQA A;  1E9L A;  2AWG A;  1JNE A;  2KE0 A;  2M1I A;  3GU0 A;  4Z2J A;  1C9H A;  4LAW A;  4GLX A;  1OWQ A;  2K8I A;  2PV2 A;  1O6I A;  1E6Z A;  5DEZ A;  3LUO A;  4WJX A;  3O5L A;  1ZBV A;  1N1A A;  4ZS6 A;  2YSI A;  2KI3 A;  4LAY A;  1QZ2 A;  1OGB A;  1FFR A;  1OGG A;  2MLZ A;  3ALF A;  1O6W A;  1NMW A;  1FD9 A;  1K9T A;  2L4J A;  1E44 A;  1XRV A;  2DJY A;  2WK2 A;  4PTM A;  1J6Y A;  2DK1 A;  4MNK A;  2F23 A;  3GTY X;  4REX A;  4DRH A;  1FLC A;  2OLH A;  3WD2 A;  1TCO C;  3CH9 A;  1W1T A;  5GPR A;  3O5Q A;  4DWS D;  1J4R A;  3JYJ A;  4IQC A;  1EHN A;  4KR0 B;  3FS8 A;  4LGX A;  2YSB A;  3TC5 A;  4W9O A;  1FKR A;  1B6C A;  1JND A;  1GPF A;  2PPN A;  3LKX A;  4J4O A;  1J4I A;  3CHE A;  3IK8 A;  4P8X A;  4ODQ A;  2FDM A;  4XAK A;  2Y8N B;  2JXW A;  1ZCN A;  2DWV A;  2DT0 A;  1KFW A;  1ZB5 A;  1I5H W;  3B9D A;  1EG3 A;  1NWR A;  1KT1 A;  2YSH A;  2O9O A;  4TNS A;  3VAW A;  3O5G A;  2PI6 A;  3OA5 A;  2A3C A;  3M7N A;  4TX0 A;  2MF9 A;  4WKA A;  5DIT A;  4MTV A;  1FKG A;  4ZPV R;  4P8U A;  2RQS A;  2PN0 A;  3ODK A;  3KAF A;  3B9E A;  3ARU A;  4HBO A;  1XHG A;  1HKM A;  1K9R A;  4FAP A;  3PQH A;  4DRO A;  5HW8 A;  2DG9 A;  2RUD A;  1UR9 A;  4ODP A;  1H0I A;  4DZ2 A;  1JMQ A;  4HAR A;  1D7I A;  1ZU8 A;  1W9V A;  4KQZ A;  4TW6 A;  3G6L A;  4NNR A;  1W1Y A;  1FKH A;  2XP8 A;  4S3K A;  3OOB A;  2A3B A;  3O5M A;  2MLY A;  1GRJ A;  4NSB A;  3O5F A;  2XP5 A;  4L72 B;  3MQG A;  3RM8 A;  3MCB B;  1NH6 A;  1WB0 A;  1TFV A;  2XP7 A;  5HT1 A;  5E64 A;  3UF8 A;  2QRV A;  4N19 A;  4ITZ A;  1TK7 A;  3FY1 A;  1LL4 A;  3MQH A;  4U84 A;  2XP4 A;  4QZV B;  3PRB A;  2A3A A;  2KGJ A;  1YW5 A;  1VF8 A;  5E5W A;  2DMV A;  4QT2 A;  5CQ2 A;  2ZAJ A;  4ODN A;  1NSG A;  4WIW A;  4NZC A;  4Z2L A;  4QIB A;  2DT3 A;  3JXV A;  1X6N A;  2MDI A;  4ODM A;  4DWS C;  1Q6H A;  1HKK A;  3L4H A;  4Z2I A;  5HW6 A;  2Y78 A;  1E6P A;  5BXJ A;  2F21 A;  1ROT A;  1Y0O A;  1LG1 A;  4ML4 A;  4R5E A;  2RUR A;  4ODR A;  3IHZ A;  3UI4 A;  3O5J A;  4G2P A;  3WIJ A;  5E66 A;  2VCD A;  3WQV A;  4DRP A;  1UR8 A;  3ARP A;  4MAV A;  4ZPW R;  2VN1 A;  2IUZ A;  3BXW A;  2DT1 A;  2WM0 A;  5HTG A;  1WR7 A;  1W9P A;  3B7X A;  1LQ0 A;  4JFL A;  3O5K A;  1GUV A;  4Z2H A;  3ARQ A;  1SYT A;  2LKN A;  4LAV A;  3CHF A;  2ZR4 A;  2P4V A;  2PV1 A;  2RUQ A;  3CHC A;  3ARZ A;  5GPG A;  5GQB A;  4MNL A;  4URI A;  2G41 A;  1Q6I A;  2M08 A;  1W1V A;  1PIN A;  3ARW A;  1W26 A;  5HWC A;  2M8I A;  2FKE A;  4MSP A;  3ARV A;  2F4E A;  3M85 A;  1L1P A;  1W9U A;  3FSC A;  5HUA A;  2FAP A;  3KAD A;  1BKF A;  1GOI A;  1R9H A;  1LL7 A;  3RME A;  3W4R A;  1HXV A;  3ARO A;  1EYM A;  4O2T A;  4W9Q A;  4TYO A;  2ZQS A;  1FKB A;  4JFI A;  1E15 A;  3WD1 A;  3PRD A;  4DWS A;  4IT4 A;  4DIP A;  1K9Q A;  4ODL A;  3KAC A;  2EZ5 W;  1FKF A;  4U85 A;  1KT0 A;  2LAJ A;  3KAG A;  2PV3 A;  2A3E A;  3CGN A;  3KCE A;  1FKT A;  2ZR5 A;  3NTP A;  2LPV A;  2XP6 A;  3ALG A;  5I98 A;  4DH0 A;  1T11 A;  2DSV A;  1Q1C A;  4DT4 A;  3CZ8 A;  1FKJ A;  2YSF A;  4BF8 A;  4MGV A;  4ODK A;  3UI6 A;  2ZQV A;  4J4N A;  1EG4 A;  3G6M A;  5HW7 A;  5J6E A;  2N87 A;  2YBT A;  4JFJ A;  2YAJ B;  3H9R B;  2QF8 A;  2M2A A;  2OWO A;  2MPH A;  2DPE A;  3ARY A;  3FSB A;  2IF4 A;  2JZV A;  2DSZ A;  3AS2 A;  3IKG A;  1ZBK A;  5DIU A;  2PBC A;  2EUL A;  1W1P A;  2B5U B;  2YSG A;  4DZ3 A;  2Q5A A;  3FXY A;  4DWS B;  1FKL A;  2M8J A;  1FJD A;  2M3O W;  4TW8 A;  3LE4 A;  1FAP A;  2L2S A;  1EDQ A;  5HWB A;  1LL6 A;  1HKJ A;  2PPO A;  1CTN A;  4Q7N A;  3EIP A;  1QPF A;  2DG3 A;  1EIB A;  2KO7 A;  5DIV A;  1NWU A;  1EQ3 A;  1HKI A;  4S3J A;  3MDY B;  3LKX B;  4Z2K A;  4W5U A;  1NWS A;  1WNO A;  2WAD A;  2LJ4 A;  4MPK A;  4ODO A;  2YBU A;  4UDM A;  5E65 A;  2MNT A;  3IKD A;  2O92 A;  2WLZ A;  4DRQ A;  3AS0 A;  3NI6 A;  3NRK A;  3PA7 A;  5E62 A;  3B8S A;  2D9F A;  1IX5 A;  1QPL A;  3EY6 A;  1JCH B;  3UQB A;  2ETN A;  2ZR6 A;  2BA1 A;  1BL4 A;  4LAX A;  4C02 B;  4TW7 A;  4GIV A;  1NMV A;  3B9A A;  5JH8 A;  3O5O A;  1LG2 A;  4U86 A;  1JVW A;  1HJV A;  4DRI A;  1M5Y A;  3FAP A;  5AHT A;  3KAH A;  2E45 A;  2WLY A;  1HJX A;  1D7H A;  2DSU A;  2DG4 A;  2KR7 A;  1E6R A;  4DRN A;  4P8W A;  3GPK A;  3O5R A;  2XPB A;  3WL0 A;  1ZBC A;  1WMV A;  4MNM A;  1NWT A;  1HJW A;  3TCZ A;  1RP5 A;  1FFQ A;  2XP3 A;  2ESC A;  1D2K A;  3ARR A;  2AOS A;  3BMB A;  4FN2 A;  2ZQU A;  1E6N A;  1H0G A;  3O5I A;  4R0X A;  3CNG A;  1PBK A;  5HBF A;  3PR9 A;  1U79 A;  5B8I C;  4ZPT R;  1Q6U A;  2F2D A;  4JFM A;  1YAT A;  5DO2 A;  2JX8 A;  5HKG A;  4Q22 A;  3O5E A;  4DRK A;  3PRA A;  3AQU A;  5D75 A;  2RSE A;  1ZBW A;  2XP9 A;  3AS1 A;  3QOK A;  1TR8 A;  1JNS A;  1WAW A;  3ARS A;  3RM9 A;  4WKH A;  1X6L A;  3KZ7 A;  3CGM A;  2RUC A;  4AY1 A;  3ART A;  4HBE A;  4WK9 A;  4JFK A;  2MLX A;  3O5D A;  1J4H A;  3WD4 A;  3KAB A;  1JNT A;  2B31 A;  2DT2 A;  4IT6 A;  1A7X A;  1RD6 A;  2RE3 A;  4DRJ A;  4GGQ A;  3WD3 A;  4IPX A;  5DF0 A;  1F8A B;  1FKS A;  4A0T A;  3MCB A;  3ARX A;  4L3N A;  2G8Z A;  2OFN A;  2JMF A;  3CHD A;  1P5Q A;  1LJY A;  3WD0 A;  3KAI A;  5U47 A;  1FKK A;  4MNJ A;  3O5P A;  2XPA A;  1FKI A;  1FKD A;  3AS3 A;  1D7J A;  4QT3 A;  2KFW A;  4G50 A;  1ROU A; 
#chains in the Genus database with same CATH homology
 2LGO A;  1ITX A;  1SR0 A;  3JYM A;  3WL1 A;  3WQW A;  4WKF A;  3RM4 A;  1F40 A;  2WAE A;  3RGC A;  1ZL1 A;  1ZK6 A;  4Z2G A;  3WH0 A;  4P8V A;  2DSW A;  2JV4 A;  4A0U A;  4E5R A;  3WKZ A;  3I6C A;  4W9P A;  3UQI A;  3UI5 A;  4IQ2 A;  4DRM A;  1D6O A;  2ITK A;  3TDB A;  2DK7 A;  3RFW A;  2PPP A;  2KXQ A;  2ZQT A;  2UZ5 A;  4JYS A;  3UQA A;  1E9L A;  2AWG A;  1JNE A;  2KE0 A;  2M1I A;  4Z2J A;  1C9H A;  4LAW A;  4GLX A;  1OWQ A;  2K8I A;  2PV2 A;  1O6I A;  1E6Z A;  5DEZ A;  3LUO A;  4WJX A;  3O5L A;  1ZBV A;  1N1A A;  4ZS6 A;  2YSI A;  2KI3 A;  4LAY A;  1QZ2 A;  1OGB A;  1FFR A;  1OGG A;  2MLZ A;  3ALF A;  1O6W A;  1NMW A;  1FD9 A;  1K9T A;  2L4J A;  1XRV A;  2DJY A;  2WK2 A;  4PTM A;  1J6Y A;  2DK1 A;  4MNK A;  4REX A;  4DRH A;  1FLC A;  2OLH A;  3WD2 A;  1TCO C;  3CH9 A;  1W1T A;  5GPR A;  3O5Q A;  4DWS D;  1J4R A;  3JYJ A;  4IQC A;  1EHN A;  4KR0 B;  3FS8 A;  4LGX A;  2YSB A;  3TC5 A;  4W9O A;  1FKR A;  1B6C A;  1JND A;  1GPF A;  2PPN A;  3LKX A;  4J4O A;  1J4I A;  3CHE A;  3IK8 A;  4P8X A;  4ODQ A;  2FDM A;  4XAK A;  2Y8N B;  2JXW A;  1ZCN A;  2DWV A;  2DT0 A;  1KFW A;  1ZB5 A;  1I5H W;  3B9D A;  1EG3 A;  1NWR A;  1KT1 A;  2YSH A;  2O9O A;  4TNS A;  3VAW A;  3O5G A;  2PI6 A;  3OA5 A;  2A3C A;  3M7N A;  4TX0 A;  2MF9 A;  4WKA A;  5DIT A;  4MTV A;  1FKG A;  4ZPV R;  4P8U A;  2RQS A;  3ODK A;  3KAF A;  3B9E A;  3ARU A;  4HBO A;  1XHG A;  1HKM A;  1K9R A;  4FAP A;  3PQH A;  4DRO A;  5HW8 A;  2DG9 A;  2RUD A;  1UR9 A;  4ODP A;  1H0I A;  4DZ2 A;  1JMQ A;  4HAR A;  1D7I A;  1ZU8 A;  1W9V A;  4KQZ A;  4TW6 A;  3G6L A;  4NNR A;  1W1Y A;  1FKH A;  2XP8 A;  4S3K A;  3OOB A;  2A3B A;  3O5M A;  2MLY A;  4NSB A;  3O5F A;  2XP5 A;  4L72 B;  3MQG A;  3RM8 A;  3MCB B;  1NH6 A;  1WB0 A;  1TFV A;  2XP7 A;  5HT1 A;  5E64 A;  3UF8 A;  2QRV A;  4N19 A;  4ITZ A;  1TK7 A;  3FY1 A;  1LL4 A;  3MQH A;  4U84 A;  2XP4 A;  4QZV B;  3PRB A;  2A3A A;  2KGJ A;  1YW5 A;  1VF8 A;  5E5W A;  2DMV A;  4QT2 A;  5CQ2 A;  2ZAJ A;  4ODN A;  1NSG A;  4WIW A;  4NZC A;  4Z2L A;  4QIB A;  2DT3 A;  3JXV A;  1X6N A;  2MDI A;  4ODM A;  4DWS C;  1Q6H A;  1HKK A;  3L4H A;  4Z2I A;  5HW6 A;  2Y78 A;  1E6P A;  5BXJ A;  2F21 A;  1ROT A;  1Y0O A;  1LG1 A;  4ML4 A;  4R5E A;  2RUR A;  4ODR A;  3IHZ A;  3UI4 A;  3O5J A;  4G2P A;  3WIJ A;  5E66 A;  2VCD A;  3WQV A;  4DRP A;  1UR8 A;  3ARP A;  4MAV A;  4ZPW R;  2VN1 A;  2IUZ A;  3BXW A;  2DT1 A;  2WM0 A;  5HTG A;  1WR7 A;  1W9P A;  3B7X A;  1LQ0 A;  4JFL A;  3O5K A;  1GUV A;  4Z2H A;  3ARQ A;  1SYT A;  2LKN A;  4LAV A;  3CHF A;  2ZR4 A;  2RUQ A;  2PV1 A;  3CHC A;  3ARZ A;  5GPG A;  5GQB A;  4MNL A;  4URI A;  2G41 A;  1Q6I A;  2M08 A;  1W1V A;  1PIN A;  3ARW A;  1W26 A;  5HWC A;  2M8I A;  2FKE A;  4MSP A;  3ARV A;  2F4E A;  3M85 A;  1L1P A;  1W9U A;  3FSC A;  5HUA A;  2FAP A;  3KAD A;  1BKF A;  1GOI A;  1R9H A;  1LL7 A;  3RME A;  3W4R A;  1HXV A;  3ARO A;  1EYM A;  4O2T A;  4W9Q A;  4TYO A;  2ZQS A;  1FKB A;  4JFI A;  1E15 A;  3WD1 A;  3PRD A;  4DWS A;  4IT4 A;  4DIP A;  1K9Q A;  4ODL A;  3KAC A;  2EZ5 W;  1FKF A;  4U85 A;  1KT0 A;  2LAJ A;  3KAG A;  2PV3 A;  2A3E A;  3CGN A;  3KCE A;  1FKT A;  2ZR5 A;  3NTP A;  2LPV A;  2XP6 A;  3ALG A;  5I98 A;  4DH0 A;  1T11 A;  2DSV A;  1Q1C A;  4DT4 A;  3CZ8 A;  1FKJ A;  2YSF A;  4BF8 A;  4MGV A;  4ODK A;  3UI6 A;  2ZQV A;  4J4N A;  1EG4 A;  3G6M A;  5HW7 A;  5J6E A;  2N87 A;  2YBT A;  4JFJ A;  2YAJ B;  3H9R B;  2QF8 A;  2M2A A;  2OWO A;  2MPH A;  2DPE A;  3ARY A;  3FSB A;  2IF4 A;  2JZV A;  2DSZ A;  3AS2 A;  3IKG A;  1ZBK A;  5DIU A;  2PBC A;  1W1P A;  4DZ3 A;  2YSG A;  2Q5A A;  3FXY A;  4DWS B;  1FKL A;  2M8J A;  1FJD A;  2M3O W;  4TW8 A;  3LE4 A;  1FAP A;  2L2S A;  1EDQ A;  5HWB A;  1LL6 A;  1HKJ A;  2PPO A;  1CTN A;  4Q7N A;  1QPF A;  2DG3 A;  1EIB A;  2KO7 A;  5DIV A;  1NWU A;  1EQ3 A;  1HKI A;  4S3J A;  3MDY B;  3LKX B;  4Z2K A;  4W5U A;  1NWS A;  1WNO A;  2WAD A;  2LJ4 A;  4MPK A;  4ODO A;  2YBU A;  5E65 A;  2MNT A;  3IKD A;  2O92 A;  2WLZ A;  4DRQ A;  3AS0 A;  3NI6 A;  3NRK A;  3PA7 A;  5E62 A;  3B8S A;  2D9F A;  1IX5 A;  1QPL A;  3EY6 A;  3UQB A;  2ZR6 A;  2BA1 A;  1BL4 A;  4LAX A;  4C02 B;  4TW7 A;  4GIV A;  1NMV A;  3B9A A;  5JH8 A;  3O5O A;  1LG2 A;  4U86 A;  1JVW A;  1HJV A;  4DRI A;  1M5Y A;  3FAP A;  5AHT A;  3KAH A;  2E45 A;  2WLY A;  1HJX A;  1D7H A;  2DSU A;  2DG4 A;  2KR7 A;  1E6R A;  4DRN A;  4P8W A;  3GPK A;  3O5R A;  2XPB A;  3WL0 A;  1ZBC A;  1WMV A;  4MNM A;  1NWT A;  1HJW A;  3TCZ A;  1RP5 A;  1FFQ A;  2XP3 A;  2ESC A;  1D2K A;  3ARR A;  2AOS A;  4FN2 A;  2ZQU A;  1E6N A;  1H0G A;  3O5I A;  4R0X A;  3CNG A;  1PBK A;  5HBF A;  3PR9 A;  1U79 A;  5B8I C;  4ZPT R;  1Q6U A;  2F2D A;  4JFM A;  1YAT A;  5DO2 A;  2JX8 A;  5HKG A;  4Q22 A;  3O5E A;  4DRK A;  3PRA A;  3AQU A;  5D75 A;  2RSE A;  1ZBW A;  2XP9 A;  3AS1 A;  3QOK A;  1TR8 A;  1JNS A;  1WAW A;  3ARS A;  3RM9 A;  4WKH A;  1X6L A;  3KZ7 A;  3CGM A;  2RUC A;  4AY1 A;  3ART A;  4HBE A;  4WK9 A;  4JFK A;  2MLX A;  3O5D A;  1J4H A;  3WD4 A;  3KAB A;  1JNT A;  2B31 A;  2DT2 A;  4IT6 A;  1A7X A;  1RD6 A;  2RE3 A;  4DRJ A;  4GGQ A;  3WD3 A;  4IPX A;  5DF0 A;  1F8A B;  1FKS A;  4A0T A;  3MCB A;  3ARX A;  4L3N A;  2G8Z A;  2OFN A;  2JMF A;  3CHD A;  1P5Q A;  1LJY A;  3WD0 A;  3KAI A;  5U47 A;  1FKK A;  4MNJ A;  3O5P A;  2XPA A;  1FKI A;  1FKD A;  3AS3 A;  1D7J A;  4QT3 A;  2KFW A;  4G50 A;  1ROU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...