2XP9A

Discovery of cell-active phenyl-imidazole pin1 inhibitors by structure-guided fragment evolution
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
157
structure length
144
Chain Sequence
b'LPPGWEKAMSRSSGRVYYFNHITNASQWERPEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEPTIDYL-PROLYL CIS-TRANS ISOMERASE NIMA-INTERACTING 1
publication title Discovery of Cell-Active Phenyl-Imidazole Pin1 Inhibitors by Structure-Guided Fragment Evolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 46
structure length 144
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2xp9A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2xp9A02
1F8AB 3ODKA 3VAWA 3L4HA 1ROUA 2AWGA 4G50A 3NTPA 2RSEA 3LE4A 2ZR5A 2YSGA 4ODPA 2XP7A 4TNSA 3KAIA 2OFNA 2PPNA 2YSBA 1EG3A 2M8IA 1Q1CA 1P5QA 1QPFA 1EQ3A 3UQBA 2JX8A 3O5RA 2JZVA 4LAYA 3UI4A 1HXVA 3JXVA 4DRIA 2PV2A 2VCDA 2N87A 3KAHA 3KZ7A 3O5PA 4DRNA 2DK7A 1QPLA 1WR7A 4W9QA 1JNTA 3FAPA 5BXJA 2PBCA 1D7HA 5CQ2A 4C02B 2ZAJA 2YSIA 4ODRA 3OOBA 4G2PA 4FAPA 2XP3A 2UZ5A 2DG9A 1FKIA 2ZQTA 1Y0OA 1J6YA 4U85A 5AHTA 3O5OA 4QT2A 2D9FA 3O5IA 1J4RA 1FKFA 4JFJA 2ZQUA 4QIBA 1KT1A 1FKSA 1EG4A 1FKRA 3H9RB 2EZ5W 2XPBA 1D6OA 2KE0A 4LAVA 3O5LA 3CNGA 2MNTA 3O5KA 1W26A 4LAXA 4BF8A 2M2AA 2DK1A 3UQIA 4MSPA 5D75A 1FKBA 1J4IA 2Q5AA 2BA1A 2M08A 2RUQA 2XP5A 2KXQA 1D7JA 3KADA 1FKHA 2VN1A 2MLZA 3EY6A 3M85A 2K8IA 3JYJA 4E5RA 1T11A 4JYSA 4JFMA 2Y78A 2F2DA 1A7XA 2JV4A 2XP4A 2IF4A 3B7XA 3TCZA 2RE3A 1U79A 1TCOC 2MF9A 2LJ4A 1QZ2A 4W9PA 2LPVA 4DRHA 2KFWA 1BL4A 4TW7A 1L1PA 3PRDA 2DG3A 4TW6A 3O5QA 3O5MA 2PPPA 1WMVA 1F40A 2DG4A 5HWCA 1FKDA 4J4NA 4JFIA 4FN2A 1Q6HA 1R9HA 5GPGA 4U84A 3JYMA 4W9OA 2KGJA 3O5DA 2M1IA 1I5HW 4DROA 3KAFA 5HW7A 2L4JA 3RFWA 2XP8A 1FKJA 1FKTA 3KABA 2PPOA 2DJYA 4DRJA 1NSGA 1K9RA 4DT4A 2PV3A 3UI5A 2YSHA 1FAPA 1KT0A 4DZ2A 2ZR6A 4ODNA 5I98A 5DIUA 4IPXA 2MLXA 4O2TA 3WH0A 5HKGA 3MDYB 4TW8A 4DIPA 4ODMA 3I6CA 1NMVA 1M5YA 4U86A 5HW6A 1D7IA 2MDIA 1FKKA 4N19A 2XPAA 4DZ3A 3UI6A 3CGMA 1Q6IA 2MPHA 3IK8A 1FKGA 3PA7A 2F21A 1JVWA 3NI6A 2FKEA 5DITA 2RQSA 2KO7A 4ODLA 1JMQA 1N1AA 3KACA 2XP9A 2ZR4A 4JFLA 1FKLA 3IKGA 5HUAA 2LAJA 2FAPA 2RURA 4NNRA 5HWBA 5HTGA 2LGOA 2LKNA 3PRBA 1YW5A 2KI3A 2XP6A 1FD9A 4ITZA 2ZQSA 3GPKA 2M8JA 4TYOA 1PBKA 5HT1A 1B6CA 3O5FA 4ODQA 4REXA 3UQAA 1C9HA 1O6WA 1ZK6A 2DWVA 4ODKA 1K9QA 3CGNA 3UF8A 3IKDA 5DIVA 4TX0A 2KR7A 2RUCA 3O5GA 3KAGA 3TDBA 4R0XA 4ODOA 4DRMA 2M3OW 4JFKA 2L2SA 2ZQVA 4DRKA 2E45A 1YATA 2JMFA 1FJDA 2RUDA 4GGQA 4GIVA 2ITKA 3NRKA 3RGCA 3M7NA 4DRQA 2YSFA 2PV1A 3KCEA 4QT3A 1ROTA 2MLYA 4DRPA 1PINA 2F4EA 4LAWA 1ZCNA 2DMVA 5B8IC 2JXWA 1BKFA 4DH0A 1JNSA 1EYMA 3TC5A 1Q6UA 3LUOA 3O5EA 4IQ2A 1NMWA 4IQCA 5J6EA 1TK7A 4MGVA 3IHZA 5HW8A 4J4OA 3O5JA 1J4HA
chains in the Genus database with same CATH superfamily
1W9VA 1W9PA 1F8AB 5GQBA 1X6NA 3ODKA 3VAWA 3L4HA 1ROUA 1WB0A 2AWGA 4G50A 3NTPA 2RSEA 1TFVA 5DF0A 3LE4A 2ZR5A 1VF8A 1LG2A 3PRAA 3FXYA 2YSGA 4ODPA 2XP7A 2AOSA 3B9EA 2DPEA 3AQUA 4TNSA 3KAIA 2OFNA 2PPNA 2YSBA 3OA5A 4ML4A 1EG3A 2DT0A 4WKHA 1FLCA 4DWSC 1GRJA 2M8IA 3B8SA 2G8ZA 1Q1CA 3WD2A 4MNKA 1E9LA 1P5QA 1QPFA 2WLZA 1EQ3A 3UQBA 4IT6A 3RM4A 2JX8A 3ARWA 3O5RA 1HKJA 2JZVA 4LAYA 3RM8A 3UI4A 1HXVA 3JXVA 4DRIA 1NWUA 3G6LA 2PV2A 2VCDA 3ARSA 3ARPA 2N87A 3KAHA 3KZ7A 3O5PA 4DRNA 2DK7A 1GPFA 1QPLA 2DSWA 1HKKA 3G6MA 3LKXB 2PI6A 4LGXA 1WR7A 4W9QA 3B9DA 2Y8NB 1JNTA 5U47A 3FAPA 4L3NA 3MQHA 3ARZA 5BXJA 2PBCA 2OWOA 2PN0A 1D7HA 5CQ2A 4C02B 4WK9A 2ZAJA 2YSIA 4ODRA 3OOBA 4G2PA 4FAPA 2XP3A 2UZ5A 2WLYA 1ZBKA 1NWRA 2DG9A 1FKIA 1GUVA 4NSBA 2ZQTA 1Y0OA 1SYTA 1J6YA 4U85A 5AHTA 2DSUA 3AS3A 3O5OA 2QRVA 4QT2A 3EIPA 1FFRA 2D9FA 1XRVA 3O5IA 4QZVB 1J4RA 1FKFA 3B9AA 1LG1A 1JNEA 1WAWA 4JFJA 2ZQUA 4QIBA 1KT1A 4DWSA 1IX5A 1FKSA 1EG4A 1D2KA 3H9RB 1FKRA 2EZ5W 2XPBA 1LL7A 1D6OA 2KE0A 4S3KA 1H0GA 4LAVA 3O5LA 3CNGA 3FS8A 2MNTA 3O5KA 1W26A 2YBUA 4LAXA 4BF8A 2M2AA 2DK1A 4L72B 3UQIA 4MNMA 4MSPA 1ZBWA 5D75A 1FKBA 4MAVA 1ZB5A 1J4IA 2Q5AA 2DSVA 2BA1A 1EHNA 2M08A 2RUQA 2XP5A 2KXQA 1D7JA 3KADA 4W5UA 1FKHA 2VN1A 2DT1A 2MLZA 3ARRA 5E62A 3EY6A 3M85A 1W1VA 2K8IA 3JYJA 4E5RA 2WAEA 1T11A 4JYSA 4JFMA 2Y78A 2F2DA 1A7XA 4ZPWR 2JV4A 1TR8A 2XP4A 3RM9A 2IF4A 3B7XA 2G41A 3TCZA 2RE3A 1U79A 4URIA 1EIBA 1TCOC 2MF9A 2LJ4A 4AY1A 3CH9A 4Z2HA 1QZ2A 4W9PA 2WM0A 2LPVA 4DRHA 4Z2IA 2KFWA 1BL4A 1W1TA 4TW7A 1L1PA 3PRDA 2DG3A 4MPKA 3WL0A 4P8XA 1NWTA 4TW6A 3O5QA 2ESCA 3O5MA 3LKXA 2A3AA 5JH8A 3WD1A 2PPPA 3MCBA 1WMVA 4Z2JA 1F40A 2DG4A 1LJYA 3MCBB 5GPRA 5HWCA 3MQGA 1FKDA 4J4NA 4JFIA 4R5EA 4FN2A 5HBFA 1Q6HA 1GOIA 3W4RA 1R9HA 3CHDA 5GPGA 4U84A 1CTNA 3JYMA 3AS2A 3AS0A 4W9OA 4MNLA 2KGJA 3O5DA 2M1IA 1I5HW 1UR8A 4DROA 1KFWA 3KAFA 4KR0B 5HW7A 2L4JA 1ZBCA 2XP8A 3RFWA 1FKJA 1FKTA 4ZPTR 5E64A 2YAJB 3KABA 1LQ0A 2PPOA 3ARTA 2DJYA 4DRJA 1NSGA 2ETNA 1K9RA 4DT4A 3ARQA 2PV3A 3UI5A 2DT3A 2YSHA 4WKAA 1FAPA 1KT0A 4DZ2A 2ZR6A 2B31A 4ODNA 5I98A 1ZL1A 3BXWA 5DIUA 4IPXA 2MLXA 1HJXA 4O2TA 1EDQA 2WK2A 3WH0A 1NWSA 1RD6A 1X6LA 3MDYB 4HBOA 4TW8A 5HKGA 4WKFA 3CHEA 3QOKA 4DIPA 4ODMA 3I6CA 1NMVA 4HBEA 5DEZA 4NZCA 1M5YA 4U86A 4XAKA 4P8WA 5DO2A 5HW6A 4KQZA 3FY1A 1RP5A 4Z2KA 1D7IA 2MDIA 1FKKA 1LL4A 2XPAA 4N19A 1ZBVA 4PTMA 4WJXA 3ARVA 4DZ3A 3UI6A 3WL1A 3CHCA 4GLXA 3CGMA 3WD3A 1Q6IA 2FDMA 1OGBA 1XHGA 1E6NA 2MPHA 2DSZA 3IK8A 1FKGA 3PA7A 2F21A 1JVWA 3FSCA 1O6IA 3NI6A 2FKEA 4WIWA 5DITA 2RQSA 3WKZA 3ARYA 1E44A 2KO7A 3WQWA 4ODLA 1JMQA 1N1AA 4DWSD 4Q22A 3KACA 2XP9A 4P8UA 2ZR4A 1W1YA 4JFLA 1FKLA 3ALFA 3IKGA 4HARA 5HUAA 2LAJA 2FAPA 3WQVA 5E66A 2RURA 4MNJA 4NNRA 5HWBA 3FSBA 5HTGA 1E6RA 2LGOA 2LKNA 2QF8A 2O9OA 3PRBA 1YW5A 2OLHA 2KI3A 1NH6A 1HJWA 4S3JA 1E6ZA 4IT4A 2XP6A 1W9UA 1FD9A 4ITZA 1H0IA 2B5UB 1WNOA 2ZQSA 4ZPVR 3GPKA 2WADA 5E65A 2M8JA 4TYOA 2F23A 1UR9A 1PBKA 1OGGA 5HT1A 3GTYX 1B6CA 3O5FA 4ODQA 4Z2GA 4REXA 3ARUA 1E6PA 3UQAA 1C9HA 1O6WA 3ARXA 1ZK6A 2DT2A 1ITXA 2IUZA 2DWVA 3WIJA 3WD4A 4ODKA 1K9QA 3CGNA 3UF8A 3IKDA 1JNDA 4UDMA 5DIVA 4TX0A 2KR7A 2RUCA 3CZ8A 1OWQA 3BMBA 4A0UA 3O5GA 3KAGA 3TDBA 4R0XA 2A3CA 4ODOA 4DRMA 2M3OW 2O92A 1E15A 1SR0A 2L2SA 4JFKA 1K9TA 2ZQVA 3GU0A 4DRKA 2E45A 1YATA 4Q7NA 1HKIA 2JMFA 1FJDA 1HJVA 2YBTA 2RUDA 4GGQA 4ZS6A 1W1PA 4GIVA 2ITKA 3NRKA 3RGCA 4DWSB 3M7NA 4DRQA 2EULA 2YSFA 2PV1A 5E5WA 3KCEA 4QT3A 3PR9A 1ZU8A 1FFQA 1LL6A 1ROTA 2MLYA 4DRPA 2F4EA 1PINA 4LAWA 1ZCNA 2DMVA 3PQHA 5B8IC 2JXWA 4Z2LA 3AROA 1JCHB 3ALGA 1BKFA 4MTVA 4P8VA 4DH0A 1JNSA 1EYMA 3TC5A 2A3BA 1Q6UA 2P4VA 3LUOA 3O5EA 4A0TA 3WD0A 4IQ2A 1NMWA 4IQCA 5J6EA 1TK7A 3CHFA 4MGVA 2A3EA 3RMEA 1HKMA 3IHZA 3AS1A 4J4OA 5HW8A 3O5JA 1J4HA
chains in the Genus database with same CATH topology
1W9VA 1W9PA 1F8AB 5GQBA 1X6NA 3ODKA 3VAWA 3L4HA 1ROUA 1WB0A 2AWGA 4G50A 3NTPA 2RSEA 1TFVA 5DF0A 3LE4A 2ZR5A 1VF8A 1LG2A 3PRAA 3FXYA 2YSGA 4ODPA 2XP7A 2AOSA 3B9EA 2DPEA 3AQUA 4TNSA 3KAIA 2OFNA 2PPNA 2YSBA 3OA5A 4ML4A 1EG3A 2DT0A 4WKHA 1FLCA 4DWSC 2M8IA 3B8SA 2G8ZA 1Q1CA 3WD2A 4MNKA 1E9LA 1P5QA 1QPFA 2WLZA 1EQ3A 3UQBA 4IT6A 3RM4A 2JX8A 3ARWA 3O5RA 1HKJA 2JZVA 4LAYA 3RM8A 3UI4A 1HXVA 3JXVA 4DRIA 1NWUA 3G6LA 2PV2A 2VCDA 3ARSA 3ARPA 2N87A 3KAHA 3KZ7A 3O5PA 4DRNA 2DK7A 1GPFA 1QPLA 2DSWA 1HKKA 3G6MA 3LKXB 2PI6A 4LGXA 1WR7A 4W9QA 3B9DA 2Y8NB 1JNTA 5U47A 3FAPA 4L3NA 3MQHA 3ARZA 5BXJA 2PBCA 2OWOA 1D7HA 5CQ2A 4C02B 4WK9A 2ZAJA 2YSIA 4ODRA 3OOBA 4G2PA 4FAPA 2XP3A 2UZ5A 2WLYA 1ZBKA 1NWRA 2DG9A 1FKIA 1GUVA 4NSBA 2ZQTA 1Y0OA 1SYTA 1J6YA 4U85A 5AHTA 2DSUA 3AS3A 3O5OA 2QRVA 4QT2A 1FFRA 2D9FA 1XRVA 3O5IA 4QZVB 1J4RA 1FKFA 3B9AA 1LG1A 1JNEA 1WAWA 4JFJA 2ZQUA 4QIBA 1KT1A 4DWSA 1IX5A 1FKSA 1EG4A 1D2KA 3H9RB 1FKRA 2EZ5W 2XPBA 1LL7A 1D6OA 2KE0A 4S3KA 1H0GA 4LAVA 3O5LA 3CNGA 3FS8A 2MNTA 3O5KA 1W26A 2YBUA 4LAXA 4BF8A 2M2AA 2DK1A 4L72B 3UQIA 4MNMA 4MSPA 1ZBWA 5D75A 1FKBA 4MAVA 1ZB5A 1J4IA 2Q5AA 2DSVA 2BA1A 1EHNA 2M08A 2RUQA 2XP5A 2KXQA 1D7JA 3KADA 4W5UA 1FKHA 2VN1A 2DT1A 2MLZA 3ARRA 5E62A 3EY6A 3M85A 1W1VA 2K8IA 3JYJA 4E5RA 2WAEA 1T11A 4JYSA 4JFMA 2Y78A 2F2DA 1A7XA 4ZPWR 2JV4A 1TR8A 2XP4A 3RM9A 2IF4A 3B7XA 2G41A 3TCZA 2RE3A 1U79A 4URIA 1EIBA 1TCOC 2MF9A 2LJ4A 4AY1A 3CH9A 4Z2HA 1QZ2A 4W9PA 2WM0A 2LPVA 4DRHA 4Z2IA 2KFWA 1BL4A 1W1TA 4TW7A 1L1PA 3PRDA 2DG3A 4MPKA 3WL0A 4P8XA 1NWTA 4TW6A 3O5QA 2ESCA 3O5MA 3LKXA 2A3AA 5JH8A 3WD1A 2PPPA 3MCBA 1WMVA 4Z2JA 1F40A 2DG4A 1LJYA 3MCBB 5GPRA 5HWCA 3MQGA 1FKDA 4J4NA 4JFIA 4R5EA 4FN2A 5HBFA 1Q6HA 1GOIA 3W4RA 1R9HA 3CHDA 5GPGA 4U84A 1CTNA 3JYMA 3AS2A 3AS0A 4W9OA 4MNLA 2KGJA 3O5DA 2M1IA 1I5HW 1UR8A 4DROA 1KFWA 3KAFA 4KR0B 5HW7A 2L4JA 1ZBCA 2XP8A 3RFWA 1FKJA 1FKTA 4ZPTR 5E64A 2YAJB 3KABA 1LQ0A 2PPOA 3ARTA 2DJYA 4DRJA 1NSGA 1K9RA 4DT4A 3ARQA 2PV3A 3UI5A 2DT3A 2YSHA 4WKAA 1FAPA 1KT0A 4DZ2A 2ZR6A 2B31A 4ODNA 5I98A 1ZL1A 3BXWA 5DIUA 4IPXA 2MLXA 1HJXA 4O2TA 1EDQA 2WK2A 3WH0A 1NWSA 1RD6A 1X6LA 3MDYB 4HBOA 4TW8A 5HKGA 4WKFA 3CHEA 3QOKA 4DIPA 4ODMA 3I6CA 1NMVA 4HBEA 5DEZA 4NZCA 1M5YA 4U86A 4XAKA 4P8WA 5DO2A 5HW6A 4KQZA 3FY1A 1RP5A 4Z2KA 1D7IA 2MDIA 1FKKA 1LL4A 2XPAA 4N19A 1ZBVA 4PTMA 4WJXA 3ARVA 4DZ3A 3UI6A 3WL1A 3CHCA 4GLXA 3CGMA 3WD3A 1Q6IA 2FDMA 1OGBA 1XHGA 1E6NA 2MPHA 2DSZA 3IK8A 1FKGA 3PA7A 2F21A 1JVWA 3FSCA 1O6IA 3NI6A 2FKEA 4WIWA 5DITA 2RQSA 3WKZA 3ARYA 2KO7A 3WQWA 4ODLA 1JMQA 1N1AA 4DWSD 4Q22A 3KACA 2XP9A 4P8UA 2ZR4A 1W1YA 4JFLA 1FKLA 3ALFA 3IKGA 4HARA 5HUAA 2LAJA 2FAPA 3WQVA 5E66A 2RURA 4MNJA 4NNRA 5HWBA 3FSBA 5HTGA 1E6RA 2LGOA 2LKNA 2QF8A 2O9OA 3PRBA 1YW5A 2OLHA 2KI3A 1NH6A 1HJWA 4S3JA 1E6ZA 4IT4A 2XP6A 1W9UA 1FD9A 4ITZA 1H0IA 1WNOA 2ZQSA 4ZPVR 3GPKA 2WADA 5E65A 2M8JA 4TYOA 1UR9A 1PBKA 1OGGA 5HT1A 1B6CA 3O5FA 4ODQA 4Z2GA 4REXA 3ARUA 1E6PA 3UQAA 1C9HA 1O6WA 3ARXA 1ZK6A 2DT2A 1ITXA 2IUZA 2DWVA 3WIJA 3WD4A 4ODKA 1K9QA 3CGNA 3UF8A 3IKDA 1JNDA 5DIVA 4TX0A 2KR7A 2RUCA 3CZ8A 1OWQA 4A0UA 3O5GA 3KAGA 3TDBA 4R0XA 2A3CA 4ODOA 4DRMA 2M3OW 2O92A 1E15A 1SR0A 2L2SA 4JFKA 1K9TA 2ZQVA 4DRKA 2E45A 1YATA 4Q7NA 1HKIA 2JMFA 1FJDA 1HJVA 2YBTA 2RUDA 4GGQA 4ZS6A 1W1PA 4GIVA 2ITKA 3NRKA 3RGCA 4DWSB 3M7NA 4DRQA 2YSFA 2PV1A 5E5WA 3KCEA 4QT3A 3PR9A 1ZU8A 1FFQA 1LL6A 1ROTA 2MLYA 4DRPA 2F4EA 1PINA 4LAWA 1ZCNA 2DMVA 3PQHA 5B8IC 2JXWA 4Z2LA 3AROA 3ALGA 1BKFA 4MTVA 4P8VA 4DH0A 1JNSA 1EYMA 3TC5A 2A3BA 1Q6UA 3LUOA 3O5EA 4A0TA 3WD0A 4IQ2A 1NMWA 4IQCA 5J6EA 1TK7A 3CHFA 4MGVA 2A3EA 3RMEA 1HKMA 3IHZA 3AS1A 4J4OA 5HW8A 3O5JA 1J4HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F8A B;  3ODK A;  3VAW A;  3L4H A;  1ROU A;  2AWG A;  4G50 A;  3NTP A;  2RSE A;  3LE4 A;  2ZR5 A;  2YSG A;  4ODP A;  2XP7 A;  4TNS A;  3KAI A;  2OFN A;  2PPN A;  2YSB A;  1EG3 A;  2M8I A;  1Q1C A;  1P5Q A;  1QPF A;  1EQ3 A;  3UQB A;  2JX8 A;  3O5R A;  2JZV A;  4LAY A;  3UI4 A;  1HXV A;  3JXV A;  4DRI A;  2PV2 A;  2VCD A;  2N87 A;  3KAH A;  3KZ7 A;  3O5P A;  4DRN A;  2DK7 A;  1QPL A;  1WR7 A;  4W9Q A;  1JNT A;  3FAP A;  5BXJ A;  2PBC A;  1D7H A;  5CQ2 A;  4C02 B;  2ZAJ A;  2YSI A;  4ODR A;  3OOB A;  4G2P A;  4FAP A;  2XP3 A;  2UZ5 A;  2DG9 A;  1FKI A;  2ZQT A;  1Y0O A;  1J6Y A;  4U85 A;  5AHT A;  3O5O A;  4QT2 A;  2D9F A;  3O5I A;  1J4R A;  1FKF A;  4JFJ A;  2ZQU A;  4QIB A;  1KT1 A;  1FKS A;  1EG4 A;  1FKR A;  3H9R B;  2EZ5 W;  2XPB A;  1D6O A;  2KE0 A;  4LAV A;  3O5L A;  3CNG A;  2MNT A;  3O5K A;  1W26 A;  4LAX A;  4BF8 A;  2M2A A;  2DK1 A;  3UQI A;  4MSP A;  5D75 A;  1FKB A;  1J4I A;  2Q5A A;  2BA1 A;  2M08 A;  2RUQ A;  2XP5 A;  2KXQ A;  1D7J A;  3KAD A;  1FKH A;  2VN1 A;  2MLZ A;  3EY6 A;  3M85 A;  2K8I A;  3JYJ A;  4E5R A;  1T11 A;  4JYS A;  4JFM A;  2Y78 A;  2F2D A;  1A7X A;  2JV4 A;  2XP4 A;  2IF4 A;  3B7X A;  3TCZ A;  2RE3 A;  1U79 A;  1TCO C;  2MF9 A;  2LJ4 A;  1QZ2 A;  4W9P A;  2LPV A;  4DRH A;  2KFW A;  1BL4 A;  4TW7 A;  1L1P A;  3PRD A;  2DG3 A;  4TW6 A;  3O5Q A;  3O5M A;  2PPP A;  1WMV A;  1F40 A;  2DG4 A;  5HWC A;  1FKD A;  4J4N A;  4JFI A;  4FN2 A;  1Q6H A;  1R9H A;  5GPG A;  4U84 A;  3JYM A;  4W9O A;  2KGJ A;  3O5D A;  2M1I A;  1I5H W;  4DRO A;  3KAF A;  5HW7 A;  2L4J A;  3RFW A;  2XP8 A;  1FKJ A;  1FKT A;  3KAB A;  2PPO A;  2DJY A;  4DRJ A;  1NSG A;  1K9R A;  4DT4 A;  2PV3 A;  3UI5 A;  2YSH A;  1FAP A;  1KT0 A;  4DZ2 A;  2ZR6 A;  4ODN A;  5I98 A;  5DIU A;  4IPX A;  2MLX A;  4O2T A;  3WH0 A;  5HKG A;  3MDY B;  4TW8 A;  4DIP A;  4ODM A;  3I6C A;  1NMV A;  1M5Y A;  4U86 A;  5HW6 A;  1D7I A;  2MDI A;  1FKK A;  4N19 A;  2XPA A;  4DZ3 A;  3UI6 A;  3CGM A;  1Q6I A;  2MPH A;  3IK8 A;  1FKG A;  3PA7 A;  2F21 A;  1JVW A;  3NI6 A;  2FKE A;  5DIT A;  2RQS A;  2KO7 A;  4ODL A;  1JMQ A;  1N1A A;  3KAC A;  2XP9 A;  2ZR4 A;  4JFL A;  1FKL A;  3IKG A;  5HUA A;  2LAJ A;  2FAP A;  2RUR A;  4NNR A;  5HWB A;  5HTG A;  2LGO A;  2LKN A;  3PRB A;  1YW5 A;  2KI3 A;  2XP6 A;  1FD9 A;  4ITZ A;  2ZQS A;  3GPK A;  2M8J A;  4TYO A;  1PBK A;  5HT1 A;  1B6C A;  3O5F A;  4ODQ A;  4REX A;  3UQA A;  1C9H A;  1O6W A;  1ZK6 A;  2DWV A;  4ODK A;  1K9Q A;  3CGN A;  3UF8 A;  3IKD A;  5DIV A;  4TX0 A;  2KR7 A;  2RUC A;  3O5G A;  3KAG A;  3TDB A;  4R0X A;  4ODO A;  4DRM A;  2M3O W;  4JFK A;  2L2S A;  2ZQV A;  4DRK A;  2E45 A;  1YAT A;  2JMF A;  1FJD A;  2RUD A;  4GGQ A;  4GIV A;  2ITK A;  3NRK A;  3RGC A;  3M7N A;  4DRQ A;  2YSF A;  2PV1 A;  3KCE A;  4QT3 A;  1ROT A;  2MLY A;  4DRP A;  1PIN A;  2F4E A;  4LAW A;  1ZCN A;  2DMV A;  5B8I C;  2JXW A;  1BKF A;  4DH0 A;  1JNS A;  1EYM A;  3TC5 A;  1Q6U A;  3LUO A;  3O5E A;  4IQ2 A;  1NMW A;  4IQC A;  5J6E A;  1TK7 A;  4MGV A;  3IHZ A;  5HW8 A;  4J4O A;  3O5J A;  1J4H A; 
#chains in the Genus database with same CATH topology
 1W9V A;  1W9P A;  1F8A B;  5GQB A;  1X6N A;  3ODK A;  3VAW A;  3L4H A;  1ROU A;  1WB0 A;  2AWG A;  4G50 A;  3NTP A;  2RSE A;  1TFV A;  5DF0 A;  3LE4 A;  2ZR5 A;  1VF8 A;  1LG2 A;  3PRA A;  3FXY A;  2YSG A;  4ODP A;  2XP7 A;  2AOS A;  3B9E A;  2DPE A;  3AQU A;  4TNS A;  3KAI A;  2OFN A;  2PPN A;  2YSB A;  3OA5 A;  4ML4 A;  1EG3 A;  2DT0 A;  4WKH A;  1FLC A;  4DWS C;  1GRJ A;  2M8I A;  3B8S A;  2G8Z A;  1Q1C A;  3WD2 A;  4MNK A;  1E9L A;  1P5Q A;  1QPF A;  2WLZ A;  1EQ3 A;  3UQB A;  4IT6 A;  3RM4 A;  2JX8 A;  3ARW A;  3O5R A;  1HKJ A;  2JZV A;  4LAY A;  3RM8 A;  3UI4 A;  1HXV A;  3JXV A;  4DRI A;  1NWU A;  3G6L A;  2PV2 A;  2VCD A;  3ARS A;  3ARP A;  2N87 A;  3KAH A;  3KZ7 A;  3O5P A;  4DRN A;  2DK7 A;  1GPF A;  1QPL A;  2DSW A;  1HKK A;  3G6M A;  3LKX B;  2PI6 A;  4LGX A;  1WR7 A;  4W9Q A;  3B9D A;  2Y8N B;  1JNT A;  5U47 A;  3FAP A;  4L3N A;  3MQH A;  3ARZ A;  5BXJ A;  2PBC A;  2OWO A;  2PN0 A;  1D7H A;  5CQ2 A;  4C02 B;  4WK9 A;  2ZAJ A;  2YSI A;  4ODR A;  3OOB A;  4G2P A;  4FAP A;  2XP3 A;  2UZ5 A;  2WLY A;  1ZBK A;  1NWR A;  2DG9 A;  1FKI A;  1GUV A;  4NSB A;  2ZQT A;  1Y0O A;  1SYT A;  1J6Y A;  4U85 A;  5AHT A;  2DSU A;  3AS3 A;  3O5O A;  2QRV A;  4QT2 A;  3EIP A;  1FFR A;  2D9F A;  1XRV A;  3O5I A;  4QZV B;  1J4R A;  1FKF A;  3B9A A;  1LG1 A;  1JNE A;  1WAW A;  4JFJ A;  2ZQU A;  4QIB A;  1KT1 A;  4DWS A;  1IX5 A;  1FKS A;  1EG4 A;  1D2K A;  3H9R B;  1FKR A;  2EZ5 W;  2XPB A;  1LL7 A;  1D6O A;  2KE0 A;  4S3K A;  1H0G A;  4LAV A;  3O5L A;  3CNG A;  3FS8 A;  2MNT A;  3O5K A;  1W26 A;  2YBU A;  4LAX A;  4BF8 A;  2M2A A;  2DK1 A;  4L72 B;  3UQI A;  4MNM A;  4MSP A;  1ZBW A;  5D75 A;  1FKB A;  4MAV A;  1ZB5 A;  1J4I A;  2Q5A A;  2DSV A;  2BA1 A;  1EHN A;  2M08 A;  2RUQ A;  2XP5 A;  2KXQ A;  1D7J A;  3KAD A;  4W5U A;  1FKH A;  2VN1 A;  2DT1 A;  2MLZ A;  3ARR A;  5E62 A;  3EY6 A;  3M85 A;  1W1V A;  2K8I A;  3JYJ A;  4E5R A;  2WAE A;  1T11 A;  4JYS A;  4JFM A;  2Y78 A;  2F2D A;  1A7X A;  4ZPW R;  2JV4 A;  1TR8 A;  2XP4 A;  3RM9 A;  2IF4 A;  3B7X A;  2G41 A;  3TCZ A;  2RE3 A;  1U79 A;  4URI A;  1EIB A;  1TCO C;  2MF9 A;  2LJ4 A;  4AY1 A;  3CH9 A;  4Z2H A;  1QZ2 A;  4W9P A;  2WM0 A;  2LPV A;  4DRH A;  4Z2I A;  2KFW A;  1BL4 A;  1W1T A;  4TW7 A;  1L1P A;  3PRD A;  2DG3 A;  4MPK A;  3WL0 A;  4P8X A;  1NWT A;  4TW6 A;  3O5Q A;  2ESC A;  3O5M A;  3LKX A;  2A3A A;  5JH8 A;  3WD1 A;  2PPP A;  3MCB A;  1WMV A;  4Z2J A;  1F40 A;  2DG4 A;  1LJY A;  3MCB B;  5GPR A;  5HWC A;  3MQG A;  1FKD A;  4J4N A;  4JFI A;  4R5E A;  4FN2 A;  5HBF A;  1Q6H A;  1GOI A;  3W4R A;  1R9H A;  3CHD A;  5GPG A;  4U84 A;  1CTN A;  3JYM A;  3AS2 A;  3AS0 A;  4W9O A;  4MNL A;  2KGJ A;  3O5D A;  2M1I A;  1I5H W;  1UR8 A;  4DRO A;  1KFW A;  3KAF A;  4KR0 B;  5HW7 A;  2L4J A;  1ZBC A;  2XP8 A;  3RFW A;  1FKJ A;  1FKT A;  4ZPT R;  5E64 A;  2YAJ B;  3KAB A;  1LQ0 A;  2PPO A;  3ART A;  2DJY A;  4DRJ A;  1NSG A;  2ETN A;  1K9R A;  4DT4 A;  3ARQ A;  2PV3 A;  3UI5 A;  2DT3 A;  2YSH A;  4WKA A;  1FAP A;  1KT0 A;  4DZ2 A;  2ZR6 A;  2B31 A;  4ODN A;  5I98 A;  1ZL1 A;  3BXW A;  5DIU A;  4IPX A;  2MLX A;  1HJX A;  4O2T A;  1EDQ A;  2WK2 A;  3WH0 A;  1NWS A;  1RD6 A;  1X6L A;  3MDY B;  4HBO A;  4TW8 A;  5HKG A;  4WKF A;  3CHE A;  3QOK A;  4DIP A;  4ODM A;  3I6C A;  1NMV A;  4HBE A;  5DEZ A;  4NZC A;  1M5Y A;  4U86 A;  4XAK A;  4P8W A;  5DO2 A;  5HW6 A;  4KQZ A;  3FY1 A;  1RP5 A;  4Z2K A;  1D7I A;  2MDI A;  1FKK A;  1LL4 A;  2XPA A;  4N19 A;  1ZBV A;  4PTM A;  4WJX A;  3ARV A;  4DZ3 A;  3UI6 A;  3WL1 A;  3CHC A;  4GLX A;  3CGM A;  3WD3 A;  1Q6I A;  2FDM A;  1OGB A;  1XHG A;  1E6N A;  2MPH A;  2DSZ A;  3IK8 A;  1FKG A;  3PA7 A;  2F21 A;  1JVW A;  3FSC A;  1O6I A;  3NI6 A;  2FKE A;  4WIW A;  5DIT A;  2RQS A;  3WKZ A;  3ARY A;  1E44 A;  2KO7 A;  3WQW A;  4ODL A;  1JMQ A;  1N1A A;  4DWS D;  4Q22 A;  3KAC A;  2XP9 A;  4P8U A;  2ZR4 A;  1W1Y A;  4JFL A;  1FKL A;  3ALF A;  3IKG A;  4HAR A;  5HUA A;  2LAJ A;  2FAP A;  3WQV A;  5E66 A;  2RUR A;  4MNJ A;  4NNR A;  5HWB A;  3FSB A;  5HTG A;  1E6R A;  2LGO A;  2LKN A;  2QF8 A;  2O9O A;  3PRB A;  1YW5 A;  2OLH A;  2KI3 A;  1NH6 A;  1HJW A;  4S3J A;  1E6Z A;  4IT4 A;  2XP6 A;  1W9U A;  1FD9 A;  4ITZ A;  1H0I A;  2B5U B;  1WNO A;  2ZQS A;  4ZPV R;  3GPK A;  2WAD A;  5E65 A;  2M8J A;  4TYO A;  2F23 A;  1UR9 A;  1PBK A;  1OGG A;  5HT1 A;  3GTY X;  1B6C A;  3O5F A;  4ODQ A;  4Z2G A;  4REX A;  3ARU A;  1E6P A;  3UQA A;  1C9H A;  1O6W A;  3ARX A;  1ZK6 A;  2DT2 A;  1ITX A;  2IUZ A;  2DWV A;  3WIJ A;  3WD4 A;  4ODK A;  1K9Q A;  3CGN A;  3UF8 A;  3IKD A;  1JND A;  4UDM A;  5DIV A;  4TX0 A;  2KR7 A;  2RUC A;  3CZ8 A;  1OWQ A;  3BMB A;  4A0U A;  3O5G A;  3KAG A;  3TDB A;  4R0X A;  2A3C A;  4ODO A;  4DRM A;  2M3O W;  2O92 A;  1E15 A;  1SR0 A;  2L2S A;  4JFK A;  1K9T A;  2ZQV A;  3GU0 A;  4DRK A;  2E45 A;  1YAT A;  4Q7N A;  1HKI A;  2JMF A;  1FJD A;  1HJV A;  2YBT A;  2RUD A;  4GGQ A;  4ZS6 A;  1W1P A;  4GIV A;  2ITK A;  3NRK A;  3RGC A;  4DWS B;  3M7N A;  4DRQ A;  2EUL A;  2YSF A;  2PV1 A;  5E5W A;  3KCE A;  4QT3 A;  3PR9 A;  1ZU8 A;  1FFQ A;  1LL6 A;  1ROT A;  2MLY A;  4DRP A;  2F4E A;  1PIN A;  4LAW A;  1ZCN A;  2DMV A;  3PQH A;  5B8I C;  2JXW A;  4Z2L A;  3ARO A;  1JCH B;  3ALG A;  1BKF A;  4MTV A;  4P8V A;  4DH0 A;  1JNS A;  1EYM A;  3TC5 A;  2A3B A;  1Q6U A;  2P4V A;  3LUO A;  3O5E A;  4A0T A;  3WD0 A;  4IQ2 A;  1NMW A;  4IQC A;  5J6E A;  1TK7 A;  3CHF A;  4MGV A;  2A3E A;  3RME A;  1HKM A;  3IHZ A;  3AS1 A;  4J4O A;  5HW8 A;  3O5J A;  1J4H A; 
#chains in the Genus database with same CATH homology
 1W9V A;  1W9P A;  1F8A B;  5GQB A;  1X6N A;  3ODK A;  3VAW A;  3L4H A;  1ROU A;  1WB0 A;  2AWG A;  4G50 A;  3NTP A;  2RSE A;  1TFV A;  5DF0 A;  3LE4 A;  2ZR5 A;  1VF8 A;  1LG2 A;  3PRA A;  3FXY A;  2YSG A;  4ODP A;  2XP7 A;  2AOS A;  3B9E A;  2DPE A;  3AQU A;  4TNS A;  3KAI A;  2OFN A;  2PPN A;  2YSB A;  3OA5 A;  4ML4 A;  1EG3 A;  2DT0 A;  4WKH A;  1FLC A;  4DWS C;  2M8I A;  3B8S A;  2G8Z A;  1Q1C A;  3WD2 A;  4MNK A;  1E9L A;  1P5Q A;  1QPF A;  2WLZ A;  1EQ3 A;  3UQB A;  4IT6 A;  3RM4 A;  2JX8 A;  3ARW A;  3O5R A;  1HKJ A;  2JZV A;  4LAY A;  3RM8 A;  3UI4 A;  1HXV A;  3JXV A;  4DRI A;  1NWU A;  3G6L A;  2PV2 A;  2VCD A;  3ARS A;  3ARP A;  2N87 A;  3KAH A;  3KZ7 A;  3O5P A;  4DRN A;  2DK7 A;  1GPF A;  1QPL A;  2DSW A;  1HKK A;  3G6M A;  3LKX B;  2PI6 A;  4LGX A;  1WR7 A;  4W9Q A;  3B9D A;  2Y8N B;  1JNT A;  5U47 A;  3FAP A;  4L3N A;  3MQH A;  3ARZ A;  5BXJ A;  2PBC A;  2OWO A;  1D7H A;  5CQ2 A;  4C02 B;  4WK9 A;  2ZAJ A;  2YSI A;  4ODR A;  3OOB A;  4G2P A;  4FAP A;  2XP3 A;  2UZ5 A;  2WLY A;  1ZBK A;  1NWR A;  2DG9 A;  1FKI A;  1GUV A;  4NSB A;  2ZQT A;  1Y0O A;  1SYT A;  1J6Y A;  4U85 A;  5AHT A;  2DSU A;  3AS3 A;  3O5O A;  2QRV A;  4QT2 A;  1FFR A;  2D9F A;  1XRV A;  3O5I A;  4QZV B;  1J4R A;  1FKF A;  3B9A A;  1LG1 A;  1JNE A;  1WAW A;  4JFJ A;  2ZQU A;  4QIB A;  1KT1 A;  4DWS A;  1IX5 A;  1FKS A;  1EG4 A;  1D2K A;  3H9R B;  1FKR A;  2EZ5 W;  2XPB A;  1LL7 A;  1D6O A;  2KE0 A;  4S3K A;  1H0G A;  4LAV A;  3O5L A;  3CNG A;  3FS8 A;  2MNT A;  3O5K A;  1W26 A;  2YBU A;  4LAX A;  4BF8 A;  2M2A A;  2DK1 A;  4L72 B;  3UQI A;  4MNM A;  4MSP A;  1ZBW A;  5D75 A;  1FKB A;  4MAV A;  1ZB5 A;  1J4I A;  2Q5A A;  2DSV A;  2BA1 A;  1EHN A;  2M08 A;  2RUQ A;  2XP5 A;  2KXQ A;  1D7J A;  3KAD A;  4W5U A;  1FKH A;  2VN1 A;  2DT1 A;  2MLZ A;  3ARR A;  5E62 A;  3EY6 A;  3M85 A;  1W1V A;  2K8I A;  3JYJ A;  4E5R A;  2WAE A;  1T11 A;  4JYS A;  4JFM A;  2Y78 A;  2F2D A;  1A7X A;  4ZPW R;  2JV4 A;  1TR8 A;  2XP4 A;  3RM9 A;  2IF4 A;  3B7X A;  2G41 A;  3TCZ A;  2RE3 A;  1U79 A;  4URI A;  1EIB A;  1TCO C;  2MF9 A;  2LJ4 A;  4AY1 A;  3CH9 A;  4Z2H A;  1QZ2 A;  4W9P A;  2WM0 A;  2LPV A;  4DRH A;  4Z2I A;  2KFW A;  1BL4 A;  1W1T A;  4TW7 A;  1L1P A;  3PRD A;  2DG3 A;  4MPK A;  3WL0 A;  4P8X A;  1NWT A;  4TW6 A;  3O5Q A;  2ESC A;  3O5M A;  3LKX A;  2A3A A;  5JH8 A;  3WD1 A;  2PPP A;  3MCB A;  1WMV A;  4Z2J A;  1F40 A;  2DG4 A;  1LJY A;  3MCB B;  5GPR A;  5HWC A;  3MQG A;  1FKD A;  4J4N A;  4JFI A;  4R5E A;  4FN2 A;  5HBF A;  1Q6H A;  1GOI A;  3W4R A;  1R9H A;  3CHD A;  5GPG A;  4U84 A;  1CTN A;  3JYM A;  3AS2 A;  3AS0 A;  4W9O A;  4MNL A;  2KGJ A;  3O5D A;  2M1I A;  1I5H W;  1UR8 A;  4DRO A;  1KFW A;  3KAF A;  4KR0 B;  5HW7 A;  2L4J A;  1ZBC A;  2XP8 A;  3RFW A;  1FKJ A;  1FKT A;  4ZPT R;  5E64 A;  2YAJ B;  3KAB A;  1LQ0 A;  2PPO A;  3ART A;  2DJY A;  4DRJ A;  1NSG A;  1K9R A;  4DT4 A;  3ARQ A;  2PV3 A;  3UI5 A;  2DT3 A;  2YSH A;  4WKA A;  1FAP A;  1KT0 A;  4DZ2 A;  2ZR6 A;  2B31 A;  4ODN A;  5I98 A;  1ZL1 A;  3BXW A;  5DIU A;  4IPX A;  2MLX A;  1HJX A;  4O2T A;  1EDQ A;  2WK2 A;  3WH0 A;  1NWS A;  1RD6 A;  1X6L A;  3MDY B;  4HBO A;  4TW8 A;  5HKG A;  4WKF A;  3CHE A;  3QOK A;  4DIP A;  4ODM A;  3I6C A;  1NMV A;  4HBE A;  5DEZ A;  4NZC A;  1M5Y A;  4U86 A;  4XAK A;  4P8W A;  5DO2 A;  5HW6 A;  4KQZ A;  3FY1 A;  1RP5 A;  4Z2K A;  1D7I A;  2MDI A;  1FKK A;  1LL4 A;  2XPA A;  4N19 A;  1ZBV A;  4PTM A;  4WJX A;  3ARV A;  4DZ3 A;  3UI6 A;  3WL1 A;  3CHC A;  4GLX A;  3CGM A;  3WD3 A;  1Q6I A;  2FDM A;  1OGB A;  1XHG A;  1E6N A;  2MPH A;  2DSZ A;  3IK8 A;  1FKG A;  3PA7 A;  2F21 A;  1JVW A;  3FSC A;  1O6I A;  3NI6 A;  2FKE A;  4WIW A;  5DIT A;  2RQS A;  3WKZ A;  3ARY A;  2KO7 A;  3WQW A;  4ODL A;  1JMQ A;  1N1A A;  4DWS D;  4Q22 A;  3KAC A;  2XP9 A;  4P8U A;  2ZR4 A;  1W1Y A;  4JFL A;  1FKL A;  3ALF A;  3IKG A;  4HAR A;  5HUA A;  2LAJ A;  2FAP A;  3WQV A;  5E66 A;  2RUR A;  4MNJ A;  4NNR A;  5HWB A;  3FSB A;  5HTG A;  1E6R A;  2LGO A;  2LKN A;  2QF8 A;  2O9O A;  3PRB A;  1YW5 A;  2OLH A;  2KI3 A;  1NH6 A;  1HJW A;  4S3J A;  1E6Z A;  4IT4 A;  2XP6 A;  1W9U A;  1FD9 A;  4ITZ A;  1H0I A;  1WNO A;  2ZQS A;  4ZPV R;  3GPK A;  2WAD A;  5E65 A;  2M8J A;  4TYO A;  1UR9 A;  1PBK A;  1OGG A;  5HT1 A;  1B6C A;  3O5F A;  4ODQ A;  4Z2G A;  4REX A;  3ARU A;  1E6P A;  3UQA A;  1C9H A;  1O6W A;  3ARX A;  1ZK6 A;  2DT2 A;  1ITX A;  2IUZ A;  2DWV A;  3WIJ A;  3WD4 A;  4ODK A;  1K9Q A;  3CGN A;  3UF8 A;  3IKD A;  1JND A;  5DIV A;  4TX0 A;  2KR7 A;  2RUC A;  3CZ8 A;  1OWQ A;  4A0U A;  3O5G A;  3KAG A;  3TDB A;  4R0X A;  2A3C A;  4ODO A;  4DRM A;  2M3O W;  2O92 A;  1E15 A;  1SR0 A;  2L2S A;  4JFK A;  1K9T A;  2ZQV A;  4DRK A;  2E45 A;  1YAT A;  4Q7N A;  1HKI A;  2JMF A;  1FJD A;  1HJV A;  2YBT A;  2RUD A;  4GGQ A;  4ZS6 A;  1W1P A;  4GIV A;  2ITK A;  3NRK A;  3RGC A;  4DWS B;  3M7N A;  4DRQ A;  2YSF A;  2PV1 A;  5E5W A;  3KCE A;  4QT3 A;  3PR9 A;  1ZU8 A;  1FFQ A;  1LL6 A;  1ROT A;  2MLY A;  4DRP A;  2F4E A;  1PIN A;  4LAW A;  1ZCN A;  2DMV A;  3PQH A;  5B8I C;  2JXW A;  4Z2L A;  3ARO A;  3ALG A;  1BKF A;  4MTV A;  4P8V A;  4DH0 A;  1JNS A;  1EYM A;  3TC5 A;  2A3B A;  1Q6U A;  3LUO A;  3O5E A;  4A0T A;  3WD0 A;  4IQ2 A;  1NMW A;  4IQC A;  5J6E A;  1TK7 A;  3CHF A;  4MGV A;  2A3E A;  3RME A;  1HKM A;  3IHZ A;  3AS1 A;  4J4O A;  5HW8 A;  3O5J A;  1J4H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...