5AHTA

Third ww domain from the e3 ubiquitin-protein ligase nedd4
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
43
structure length
43
Chain Sequence
GSMEQGFLPKGWEVRHAPNGRPFFIDHNTKTTTWEDPRLKIPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE NEDD4
publication title The Nedd4-1 Ww Domain Recognizes the Py Motif Peptide Through Coupled Folding and Binding Equilibria.
pubmed doi rcsb
source organism Homo sapiens
total genus 9
structure length 43
sequence length 43
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2015-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 5ahtA01
4U84A 2M3OW 3KAHA 2DWVA 3KCEA 2KXQA 4QIBA 2LAJA 2ZR6A 1EG3A 3CNGA 3TCZA 2BA1A 2ZQSA 3NTPA 2YSHA 2E45A 2ZR4A 2YSFA 2XP6A 3OOBA 2M8IA 1PINA 1YW5A 2L4JA 2Q5AA 5AHTA 3KABA 5CQ2A 1JMQA 2MDIA 3M7NA 2JX8A 2XP3A 3M85A 3TC5A 3TDBA 4U85A 1F8AB 2XPBA 2ZQVA 3KAGA 2ZQUA 2YSGA 2RE3A 1WMVA 2YSIA 2XP8A 2DMVA 4REXA 3WH0A 1EG4A 2EZ5W 1ZCNA 3L4HA 2XPAA 2DK7A 2JV4A 2XP7A 1O6WA 3ODKA 2XP4A 4E5RA 2ZQTA 1K9RA 2YSBA 1WR7A 2JXWA 3LE4A 2M8JA 3KAIA 2ZR5A 2ZAJA 3KADA 2DJYA 2ITKA 4U86A 1TK7A 3KAFA 2JMFA 2F21A 2XP9A 2XP5A 2DK1A 1NMVA 1I5HW 1K9QA
chains in the Genus database with same CATH superfamily
4U84A 3FSCA 3MQGA 2M3OW 1FLCA 3KAHA 2DWVA 2QRVA 5E65A 3KCEA 2KXQA 4QIBA 2LAJA 2ZR6A 1EG3A 5E62A 3LKXB 3CNGA 3TCZA 2BA1A 2ZQSA 3NTPA 2YSHA 5E64A 2E45A 2ZR4A 2YSFA 2XP6A 3OOBA 2M8IA 3MQHA 1PINA 1YW5A 2L4JA 2Q5AA 5AHTA 3KABA 5CQ2A 1JMQA 2MDIA 3M7NA 2JX8A 2XP3A 3M85A 3TC5A 1RP5A 2OWOA 3TDBA 4U85A 5E66A 1F8AB 2XPBA 2ZQVA 3KAGA 2ZQUA 2YSGA 2RE3A 1WMVA 2YSIA 3MCBA 2XP8A 4A0UA 2DMVA 4REXA 3WH0A 1EG4A 2EZ5W 1ZCNA 5E5WA 3L4HA 2XPAA 2DK7A 2JV4A 2XP7A 1O6WA 3ODKA 1TR8A 2XP4A 4E5RA 2ZQTA 1K9RA 2YSBA 1WR7A 2JXWA 3LE4A 2M8JA 5U47A 2YAJB 3KAIA 3MCBB 2ZR5A 2ZAJA 3KADA 2DJYA 3FS8A 2WAEA 3FSBA 3LKXA 2ITKA 4U86A 1TK7A 3KAFA 2WADA 2JMFA 2F21A 2XP9A 3PQHA 4A0TA 2Y8NB 2XP5A 2DK1A 1NMVA 1I5HW 1K9QA 4GLXA
chains in the Genus database with same CATH topology
4U84A 3FSCA 3MQGA 2M3OW 1FLCA 3KAHA 2DWVA 2QRVA 5E65A 3KCEA 2KXQA 4QIBA 2LAJA 2ZR6A 1EG3A 5E62A 3LKXB 3CNGA 3TCZA 2BA1A 2ZQSA 3NTPA 2YSHA 5E64A 2E45A 2ZR4A 2YSFA 2XP6A 3OOBA 2M8IA 3MQHA 1PINA 1YW5A 2L4JA 2Q5AA 5AHTA 3KABA 5CQ2A 1JMQA 2MDIA 3M7NA 2JX8A 2XP3A 3M85A 3TC5A 1RP5A 2OWOA 3TDBA 4U85A 5E66A 1F8AB 2XPBA 2ZQVA 3KAGA 2ZQUA 2YSGA 2RE3A 1WMVA 2YSIA 3MCBA 2XP8A 4A0UA 2DMVA 4REXA 3WH0A 1EG4A 2EZ5W 1ZCNA 5E5WA 3L4HA 2XPAA 2DK7A 2JV4A 2XP7A 1O6WA 3ODKA 1TR8A 2XP4A 4E5RA 2ZQTA 1K9RA 2YSBA 1WR7A 2JXWA 3LE4A 2M8JA 5U47A 2YAJB 3KAIA 3MCBB 2ZR5A 2ZAJA 3KADA 2DJYA 3FS8A 2WAEA 3FSBA 3LKXA 2ITKA 4U86A 1TK7A 3KAFA 2WADA 2JMFA 2F21A 2XP9A 3PQHA 4A0TA 2Y8NB 2XP5A 2DK1A 1NMVA 1I5HW 1K9QA 4GLXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U84 A;  2M3O W;  3KAH A;  2DWV A;  3KCE A;  2KXQ A;  4QIB A;  2LAJ A;  2ZR6 A;  1EG3 A;  3CNG A;  3TCZ A;  2BA1 A;  2ZQS A;  3NTP A;  2YSH A;  2E45 A;  2ZR4 A;  2YSF A;  2XP6 A;  3OOB A;  2M8I A;  1PIN A;  1YW5 A;  2L4J A;  2Q5A A;  5AHT A;  3KAB A;  5CQ2 A;  1JMQ A;  2MDI A;  3M7N A;  2JX8 A;  2XP3 A;  3M85 A;  3TC5 A;  3TDB A;  4U85 A;  1F8A B;  2XPB A;  2ZQV A;  3KAG A;  2ZQU A;  2YSG A;  2RE3 A;  1WMV A;  2YSI A;  2XP8 A;  2DMV A;  4REX A;  3WH0 A;  1EG4 A;  2EZ5 W;  1ZCN A;  3L4H A;  2XPA A;  2DK7 A;  2JV4 A;  2XP7 A;  1O6W A;  3ODK A;  2XP4 A;  4E5R A;  2ZQT A;  1K9R A;  2YSB A;  1WR7 A;  2JXW A;  3LE4 A;  2M8J A;  3KAI A;  2ZR5 A;  2ZAJ A;  3KAD A;  2DJY A;  2ITK A;  4U86 A;  1TK7 A;  3KAF A;  2JMF A;  2F21 A;  2XP9 A;  2XP5 A;  2DK1 A;  1NMV A;  1I5H W;  1K9Q A; 
#chains in the Genus database with same CATH topology
 4U84 A;  3FSC A;  3MQG A;  2M3O W;  1FLC A;  3KAH A;  2DWV A;  2QRV A;  5E65 A;  3KCE A;  2KXQ A;  4QIB A;  2LAJ A;  2ZR6 A;  1EG3 A;  5E62 A;  3LKX B;  3CNG A;  3TCZ A;  2BA1 A;  2ZQS A;  3NTP A;  2YSH A;  5E64 A;  2E45 A;  2ZR4 A;  2YSF A;  2XP6 A;  3OOB A;  2M8I A;  3MQH A;  1PIN A;  1YW5 A;  2L4J A;  2Q5A A;  5AHT A;  3KAB A;  5CQ2 A;  1JMQ A;  2MDI A;  3M7N A;  2JX8 A;  2XP3 A;  3M85 A;  3TC5 A;  1RP5 A;  2OWO A;  3TDB A;  4U85 A;  5E66 A;  1F8A B;  2XPB A;  2ZQV A;  3KAG A;  2ZQU A;  2YSG A;  2RE3 A;  1WMV A;  2YSI A;  3MCB A;  2XP8 A;  4A0U A;  2DMV A;  4REX A;  3WH0 A;  1EG4 A;  2EZ5 W;  1ZCN A;  5E5W A;  3L4H A;  2XPA A;  2DK7 A;  2JV4 A;  2XP7 A;  1O6W A;  3ODK A;  1TR8 A;  2XP4 A;  4E5R A;  2ZQT A;  1K9R A;  2YSB A;  1WR7 A;  2JXW A;  3LE4 A;  2M8J A;  5U47 A;  2YAJ B;  3KAI A;  3MCB B;  2ZR5 A;  2ZAJ A;  3KAD A;  2DJY A;  3FS8 A;  2WAE A;  3FSB A;  3LKX A;  2ITK A;  4U86 A;  1TK7 A;  3KAF A;  2WAD A;  2JMF A;  2F21 A;  2XP9 A;  3PQH A;  4A0T A;  2Y8N B;  2XP5 A;  2DK1 A;  1NMV A;  1I5H W;  1K9Q A;  4GLX A; 
#chains in the Genus database with same CATH homology
 4U84 A;  3FSC A;  3MQG A;  2M3O W;  1FLC A;  3KAH A;  2DWV A;  2QRV A;  5E65 A;  3KCE A;  2KXQ A;  4QIB A;  2LAJ A;  2ZR6 A;  1EG3 A;  5E62 A;  3LKX B;  3CNG A;  3TCZ A;  2BA1 A;  2ZQS A;  3NTP A;  2YSH A;  5E64 A;  2E45 A;  2ZR4 A;  2YSF A;  2XP6 A;  3OOB A;  2M8I A;  3MQH A;  1PIN A;  1YW5 A;  2L4J A;  2Q5A A;  5AHT A;  3KAB A;  5CQ2 A;  1JMQ A;  2MDI A;  3M7N A;  2JX8 A;  2XP3 A;  3M85 A;  3TC5 A;  1RP5 A;  2OWO A;  3TDB A;  4U85 A;  5E66 A;  1F8A B;  2XPB A;  2ZQV A;  3KAG A;  2ZQU A;  2YSG A;  2RE3 A;  1WMV A;  2YSI A;  3MCB A;  2XP8 A;  4A0U A;  2DMV A;  4REX A;  3WH0 A;  1EG4 A;  2EZ5 W;  1ZCN A;  5E5W A;  3L4H A;  2XPA A;  2DK7 A;  2JV4 A;  2XP7 A;  1O6W A;  3ODK A;  1TR8 A;  2XP4 A;  4E5R A;  2ZQT A;  1K9R A;  2YSB A;  1WR7 A;  2JXW A;  3LE4 A;  2M8J A;  5U47 A;  2YAJ B;  3KAI A;  3MCB B;  2ZR5 A;  2ZAJ A;  3KAD A;  2DJY A;  3FS8 A;  2WAE A;  3FSB A;  3LKX A;  2ITK A;  4U86 A;  1TK7 A;  3KAF A;  2WAD A;  2JMF A;  2F21 A;  2XP9 A;  3PQH A;  4A0T A;  2Y8N B;  2XP5 A;  2DK1 A;  1NMV A;  1I5H W;  1K9Q A;  4GLX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...