5AHTA

Third ww domain from the e3 ubiquitin-protein ligase nedd4
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
43
structure length
43
Chain Sequence
GSMEQGFLPKGWEVRHAPNGRPFFIDHNTKTTTWEDPRLKIPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE NEDD4
publication title The Nedd4-1 Ww Domain Recognizes the Py Motif Peptide Through Coupled Folding and Binding Equilibria.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 9
structure length 43
sequence length 43
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2015-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 5ahtA01
3WH0A 2ZQTA 3TDBA 1YW5A 1JMQA 1TK7A 2M8IA 2JV4A 2YSGA 2ZQSA 2ZQVA 1K9RA 1WR7A 2DK1A 5AHTA 2M8JA 1F8AB 3KAHA 2XP4A 1ZCNA 4U85A 3L4HA 1K9QA 3TC5A 2MDIA 2DJYA 1EG4A 2YSBA 2ZR4A 2XPBA 1NMVA 2ZR6A 2E45A 1WMVA 3TCZA 2ZR5A 2XP7A 3KAIA 2XP5A 4U84A 2F21A 3KCEA 3NTPA 2YSFA 3KADA 2XP8A 2JXWA 1PINA 2YSHA 2KXQA 4QIBA 2ZAJA 2YSIA 2DWVA 1EG3A 2BA1A 2EZ5W 2XP9A 4U86A 3M85A 2ZQUA 5CQ2A 2XP3A 4REXA 2XP6A 2Q5AA 2RE3A 2JMFA 3KAGA 2LAJA 3OOBA 2DK7A 2ITKA 3KABA 3KAFA 3M7NA 3CNGA 1O6WA 2M3OW 2JX8A 3ODKA 2L4JA 3LE4A 2XPAA 2DMVA 1I5HW 4E5RA
chains in the Genus database with same CATH superfamily
3WH0A 2ZQTA 4A0TA 3LKXB 3TDBA 1YW5A 3MQGA 1JMQA 1TK7A 2M8IA 2JV4A 2YSGA 2ZQSA 2ZQVA 1K9RA 1FLCA 1WR7A 2DK1A 5E66A 3FSCA 5AHTA 1RP5A 2M8JA 1F8AB 3KAHA 2XP4A 3MCBA 5U47A 2OWOA 1ZCNA 2YAJB 3L4HA 4U85A 2WADA 1K9QA 3TC5A 2MDIA 2DJYA 1EG4A 4GLXA 2YSBA 2ZR4A 2XPBA 1NMVA 2ZR6A 2E45A 1WMVA 5E62A 3MCBB 1TR8A 2QRVA 3TCZA 2ZR5A 3KAIA 2XP7A 5E5WA 2XP5A 4U84A 2F21A 3KCEA 2WAEA 3NTPA 2YSFA 3KADA 2XP8A 2JXWA 3FSBA 1PINA 5E64A 2YSHA 2KXQA 4QIBA 2ZAJA 2YSIA 2DWVA 1EG3A 3LKXA 2BA1A 2EZ5W 2XP9A 4U86A 3M85A 2ZQUA 5CQ2A 2Y8NB 2XP3A 3FS8A 4REXA 2XP6A 2Q5AA 2RE3A 3MQHA 2JMFA 3KAGA 2LAJA 3OOBA 5E65A 2DK7A 2ITKA 3KABA 3KAFA 3M7NA 3CNGA 1O6WA 2M3OW 3PQHA 4A0UA 2JX8A 3ODKA 2L4JA 3LE4A 2XPAA 2DMVA 1I5HW 4E5RA
chains in the Genus database with same CATH topology
3WH0A 2ZQTA 4A0TA 3LKXB 3TDBA 1YW5A 3MQGA 1JMQA 1TK7A 2M8IA 2JV4A 2YSGA 2ZQSA 2ZQVA 1K9RA 1FLCA 1WR7A 2DK1A 5E66A 3FSCA 5AHTA 1RP5A 2M8JA 1F8AB 3KAHA 2XP4A 3MCBA 5U47A 2OWOA 1ZCNA 2YAJB 3L4HA 4U85A 2WADA 1K9QA 3TC5A 2MDIA 2DJYA 1EG4A 4GLXA 2YSBA 2ZR4A 2XPBA 1NMVA 2ZR6A 2E45A 1WMVA 5E62A 3MCBB 1TR8A 2QRVA 3TCZA 2ZR5A 3KAIA 2XP7A 5E5WA 2XP5A 4U84A 2F21A 3KCEA 2WAEA 3NTPA 2YSFA 3KADA 2XP8A 2JXWA 3FSBA 1PINA 5E64A 2YSHA 2KXQA 4QIBA 2ZAJA 2YSIA 2DWVA 1EG3A 3LKXA 2BA1A 2EZ5W 2XP9A 4U86A 3M85A 2ZQUA 5CQ2A 2Y8NB 2XP3A 3FS8A 4REXA 2XP6A 2Q5AA 2RE3A 3MQHA 2JMFA 3KAGA 2LAJA 3OOBA 5E65A 2DK7A 2ITKA 3KABA 3KAFA 3M7NA 3CNGA 1O6WA 2M3OW 3PQHA 4A0UA 2JX8A 3ODKA 2L4JA 3LE4A 2XPAA 2DMVA 1I5HW 4E5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WH0 A;  2ZQT A;  3TDB A;  1YW5 A;  1JMQ A;  1TK7 A;  2M8I A;  2JV4 A;  2YSG A;  2ZQS A;  2ZQV A;  1K9R A;  1WR7 A;  2DK1 A;  5AHT A;  2M8J A;  1F8A B;  3KAH A;  2XP4 A;  1ZCN A;  4U85 A;  3L4H A;  1K9Q A;  3TC5 A;  2MDI A;  2DJY A;  1EG4 A;  2YSB A;  2ZR4 A;  2XPB A;  1NMV A;  2ZR6 A;  2E45 A;  1WMV A;  3TCZ A;  2ZR5 A;  2XP7 A;  3KAI A;  2XP5 A;  4U84 A;  2F21 A;  3KCE A;  3NTP A;  2YSF A;  3KAD A;  2XP8 A;  2JXW A;  1PIN A;  2YSH A;  2KXQ A;  4QIB A;  2ZAJ A;  2YSI A;  2DWV A;  1EG3 A;  2BA1 A;  2EZ5 W;  2XP9 A;  4U86 A;  3M85 A;  2ZQU A;  5CQ2 A;  2XP3 A;  4REX A;  2XP6 A;  2Q5A A;  2RE3 A;  2JMF A;  3KAG A;  2LAJ A;  3OOB A;  2DK7 A;  2ITK A;  3KAB A;  3KAF A;  3M7N A;  3CNG A;  1O6W A;  2M3O W;  2JX8 A;  3ODK A;  2L4J A;  3LE4 A;  2XPA A;  2DMV A;  1I5H W;  4E5R A; 
#chains in the Genus database with same CATH topology
 3WH0 A;  2ZQT A;  4A0T A;  3LKX B;  3TDB A;  1YW5 A;  3MQG A;  1JMQ A;  1TK7 A;  2M8I A;  2JV4 A;  2YSG A;  2ZQS A;  2ZQV A;  1K9R A;  1FLC A;  1WR7 A;  2DK1 A;  5E66 A;  3FSC A;  5AHT A;  1RP5 A;  2M8J A;  1F8A B;  3KAH A;  2XP4 A;  3MCB A;  5U47 A;  2OWO A;  1ZCN A;  2YAJ B;  3L4H A;  4U85 A;  2WAD A;  1K9Q A;  3TC5 A;  2MDI A;  2DJY A;  1EG4 A;  4GLX A;  2YSB A;  2ZR4 A;  2XPB A;  1NMV A;  2ZR6 A;  2E45 A;  1WMV A;  5E62 A;  3MCB B;  1TR8 A;  2QRV A;  3TCZ A;  2ZR5 A;  3KAI A;  2XP7 A;  5E5W A;  2XP5 A;  4U84 A;  2F21 A;  3KCE A;  2WAE A;  3NTP A;  2YSF A;  3KAD A;  2XP8 A;  2JXW A;  3FSB A;  1PIN A;  5E64 A;  2YSH A;  2KXQ A;  4QIB A;  2ZAJ A;  2YSI A;  2DWV A;  1EG3 A;  3LKX A;  2BA1 A;  2EZ5 W;  2XP9 A;  4U86 A;  3M85 A;  2ZQU A;  5CQ2 A;  2Y8N B;  2XP3 A;  3FS8 A;  4REX A;  2XP6 A;  2Q5A A;  2RE3 A;  3MQH A;  2JMF A;  3KAG A;  2LAJ A;  3OOB A;  5E65 A;  2DK7 A;  2ITK A;  3KAB A;  3KAF A;  3M7N A;  3CNG A;  1O6W A;  2M3O W;  3PQH A;  4A0U A;  2JX8 A;  3ODK A;  2L4J A;  3LE4 A;  2XPA A;  2DMV A;  1I5H W;  4E5R A; 
#chains in the Genus database with same CATH homology
 3WH0 A;  2ZQT A;  4A0T A;  3LKX B;  3TDB A;  1YW5 A;  3MQG A;  1JMQ A;  1TK7 A;  2M8I A;  2JV4 A;  2YSG A;  2ZQS A;  2ZQV A;  1K9R A;  1FLC A;  1WR7 A;  2DK1 A;  5E66 A;  3FSC A;  5AHT A;  1RP5 A;  2M8J A;  1F8A B;  3KAH A;  2XP4 A;  3MCB A;  5U47 A;  2OWO A;  1ZCN A;  2YAJ B;  3L4H A;  4U85 A;  2WAD A;  1K9Q A;  3TC5 A;  2MDI A;  2DJY A;  1EG4 A;  4GLX A;  2YSB A;  2ZR4 A;  2XPB A;  1NMV A;  2ZR6 A;  2E45 A;  1WMV A;  5E62 A;  3MCB B;  1TR8 A;  2QRV A;  3TCZ A;  2ZR5 A;  3KAI A;  2XP7 A;  5E5W A;  2XP5 A;  4U84 A;  2F21 A;  3KCE A;  2WAE A;  3NTP A;  2YSF A;  3KAD A;  2XP8 A;  2JXW A;  3FSB A;  1PIN A;  5E64 A;  2YSH A;  2KXQ A;  4QIB A;  2ZAJ A;  2YSI A;  2DWV A;  1EG3 A;  3LKX A;  2BA1 A;  2EZ5 W;  2XP9 A;  4U86 A;  3M85 A;  2ZQU A;  5CQ2 A;  2Y8N B;  2XP3 A;  3FS8 A;  4REX A;  2XP6 A;  2Q5A A;  2RE3 A;  3MQH A;  2JMF A;  3KAG A;  2LAJ A;  3OOB A;  5E65 A;  2DK7 A;  2ITK A;  3KAB A;  3KAF A;  3M7N A;  3CNG A;  1O6W A;  2M3O W;  3PQH A;  4A0U A;  2JX8 A;  3ODK A;  2L4J A;  3LE4 A;  2XPA A;  2DMV A;  1I5H W;  4E5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...