2YSHA

Solution structure of the ww domain from the human growth-arrest-specific protein 7, gas-7
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
40
structure length
40
Chain Sequence
GSSGSSGLPPGWQSYLSPQGRRYYVNTTTNETTWERPSSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Growth-arrest-specific protein 7
publication title Solution structure of the WW domain from the human growth-arrest-specific protein 7, GAS-7
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 3
structure length 40
sequence length 40
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2yshA01
3KADA 1WMVA 2L4JA 2XP4A 2ZQSA 2ZQTA 2LAJA 4QIBA 3KABA 3TC5A 2JMFA 2ZR5A 2DJYA 4REXA 2M8JA 2ITKA 2DK7A 4U85A 4E5RA 5CQ2A 2ZR4A 3OOBA 2DK1A 2YSGA 3KAIA 2E45A 2M3OW 2YSFA 2M8IA 2XP9A 2JX8A 1K9RA 2EZ5W 3LE4A 1NMVA 2Q5AA 1JMQA 1ZCNA 2RE3A 2YSIA 2XP7A 2XP3A 1F8AB 4U84A 2XP6A 2MDIA 3ODKA 3M85A 1TK7A 4U86A 2KXQA 2ZR6A 1WR7A 3KCEA 3TDBA 2DWVA 3M7NA 3KAFA 3NTPA 2JV4A 1O6WA 2XPBA 1YW5A 1EG3A 3WH0A 2XPAA 2XP8A 1K9QA 2ZQVA 2JXWA 1I5HW 3KAHA 2YSHA 2ZQUA 3L4HA 2ZAJA 3TCZA 3CNGA 3KAGA 1PINA 1EG4A 2YSBA 5AHTA 2BA1A 2DMVA 2F21A 2XP5A
chains in the Genus database with same CATH superfamily
3KADA 1WMVA 2L4JA 2XP4A 3FSCA 1TR8A 2ZQSA 2ZQTA 2LAJA 4QIBA 3KABA 3FSBA 3TC5A 2JMFA 2ZR5A 2DJYA 4REXA 2M8JA 2ITKA 2DK7A 4U85A 4E5RA 5CQ2A 5E64A 3MCBA 2QRVA 2ZR4A 3OOBA 5U47A 2DK1A 2YSGA 3KAIA 2E45A 2M3OW 2YSFA 2M8IA 3MQGA 2XP9A 2JX8A 1K9RA 4GLXA 2EZ5W 3LE4A 1NMVA 3LKXB 2Q5AA 3MQHA 1JMQA 3FS8A 1ZCNA 3PQHA 5E62A 2Y8NB 2RE3A 2YSIA 2XP7A 2XP3A 1F8AB 4U84A 2XP6A 4A0TA 2MDIA 1FLCA 3ODKA 1RP5A 3M85A 1TK7A 4U86A 2KXQA 2ZR6A 1WR7A 5E66A 3KCEA 3TDBA 2DWVA 2YAJB 3LKXA 3M7NA 3KAFA 2OWOA 3NTPA 2JV4A 1O6WA 2XPBA 1YW5A 1EG3A 3WH0A 2XPAA 2XP8A 1K9QA 2ZQVA 5E5WA 2JXWA 1I5HW 3KAHA 2YSHA 4A0UA 2ZQUA 3L4HA 2ZAJA 3TCZA 5E65A 3CNGA 2WADA 3KAGA 1PINA 2WAEA 1EG4A 2YSBA 3MCBB 5AHTA 2BA1A 2DMVA 2F21A 2XP5A
chains in the Genus database with same CATH topology
3KADA 1WMVA 2L4JA 2XP4A 3FSCA 1TR8A 2ZQSA 2ZQTA 2LAJA 4QIBA 3KABA 3FSBA 3TC5A 2JMFA 2ZR5A 2DJYA 4REXA 2M8JA 2ITKA 2DK7A 4U85A 4E5RA 5CQ2A 5E64A 3MCBA 2QRVA 2ZR4A 3OOBA 5U47A 2DK1A 2YSGA 3KAIA 2E45A 2M3OW 2YSFA 2M8IA 3MQGA 2XP9A 2JX8A 1K9RA 4GLXA 2EZ5W 3LE4A 1NMVA 3LKXB 2Q5AA 3MQHA 1JMQA 3FS8A 1ZCNA 3PQHA 5E62A 2Y8NB 2RE3A 2YSIA 2XP7A 2XP3A 1F8AB 4U84A 2XP6A 4A0TA 2MDIA 1FLCA 3ODKA 1RP5A 3M85A 1TK7A 4U86A 2KXQA 2ZR6A 1WR7A 5E66A 3KCEA 3TDBA 2DWVA 2YAJB 3LKXA 3M7NA 3KAFA 2OWOA 3NTPA 2JV4A 1O6WA 2XPBA 1YW5A 1EG3A 3WH0A 2XPAA 2XP8A 1K9QA 2ZQVA 5E5WA 2JXWA 1I5HW 3KAHA 2YSHA 4A0UA 2ZQUA 3L4HA 2ZAJA 3TCZA 5E65A 3CNGA 2WADA 3KAGA 1PINA 2WAEA 1EG4A 2YSBA 3MCBB 5AHTA 2BA1A 2DMVA 2F21A 2XP5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KAD A;  1WMV A;  2L4J A;  2XP4 A;  2ZQS A;  2ZQT A;  2LAJ A;  4QIB A;  3KAB A;  3TC5 A;  2JMF A;  2ZR5 A;  2DJY A;  4REX A;  2M8J A;  2ITK A;  2DK7 A;  4U85 A;  4E5R A;  5CQ2 A;  2ZR4 A;  3OOB A;  2DK1 A;  2YSG A;  3KAI A;  2E45 A;  2M3O W;  2YSF A;  2M8I A;  2XP9 A;  2JX8 A;  1K9R A;  2EZ5 W;  3LE4 A;  1NMV A;  2Q5A A;  1JMQ A;  1ZCN A;  2RE3 A;  2YSI A;  2XP7 A;  2XP3 A;  1F8A B;  4U84 A;  2XP6 A;  2MDI A;  3ODK A;  3M85 A;  1TK7 A;  4U86 A;  2KXQ A;  2ZR6 A;  1WR7 A;  3KCE A;  3TDB A;  2DWV A;  3M7N A;  3KAF A;  3NTP A;  2JV4 A;  1O6W A;  2XPB A;  1YW5 A;  1EG3 A;  3WH0 A;  2XPA A;  2XP8 A;  1K9Q A;  2ZQV A;  2JXW A;  1I5H W;  3KAH A;  2YSH A;  2ZQU A;  3L4H A;  2ZAJ A;  3TCZ A;  3CNG A;  3KAG A;  1PIN A;  1EG4 A;  2YSB A;  5AHT A;  2BA1 A;  2DMV A;  2F21 A;  2XP5 A; 
#chains in the Genus database with same CATH topology
 3KAD A;  1WMV A;  2L4J A;  2XP4 A;  3FSC A;  1TR8 A;  2ZQS A;  2ZQT A;  2LAJ A;  4QIB A;  3KAB A;  3FSB A;  3TC5 A;  2JMF A;  2ZR5 A;  2DJY A;  4REX A;  2M8J A;  2ITK A;  2DK7 A;  4U85 A;  4E5R A;  5CQ2 A;  5E64 A;  3MCB A;  2QRV A;  2ZR4 A;  3OOB A;  5U47 A;  2DK1 A;  2YSG A;  3KAI A;  2E45 A;  2M3O W;  2YSF A;  2M8I A;  3MQG A;  2XP9 A;  2JX8 A;  1K9R A;  4GLX A;  2EZ5 W;  3LE4 A;  1NMV A;  3LKX B;  2Q5A A;  3MQH A;  1JMQ A;  3FS8 A;  1ZCN A;  3PQH A;  5E62 A;  2Y8N B;  2RE3 A;  2YSI A;  2XP7 A;  2XP3 A;  1F8A B;  4U84 A;  2XP6 A;  4A0T A;  2MDI A;  1FLC A;  3ODK A;  1RP5 A;  3M85 A;  1TK7 A;  4U86 A;  2KXQ A;  2ZR6 A;  1WR7 A;  5E66 A;  3KCE A;  3TDB A;  2DWV A;  2YAJ B;  3LKX A;  3M7N A;  3KAF A;  2OWO A;  3NTP A;  2JV4 A;  1O6W A;  2XPB A;  1YW5 A;  1EG3 A;  3WH0 A;  2XPA A;  2XP8 A;  1K9Q A;  2ZQV A;  5E5W A;  2JXW A;  1I5H W;  3KAH A;  2YSH A;  4A0U A;  2ZQU A;  3L4H A;  2ZAJ A;  3TCZ A;  5E65 A;  3CNG A;  2WAD A;  3KAG A;  1PIN A;  2WAE A;  1EG4 A;  2YSB A;  3MCB B;  5AHT A;  2BA1 A;  2DMV A;  2F21 A;  2XP5 A; 
#chains in the Genus database with same CATH homology
 3KAD A;  1WMV A;  2L4J A;  2XP4 A;  3FSC A;  1TR8 A;  2ZQS A;  2ZQT A;  2LAJ A;  4QIB A;  3KAB A;  3FSB A;  3TC5 A;  2JMF A;  2ZR5 A;  2DJY A;  4REX A;  2M8J A;  2ITK A;  2DK7 A;  4U85 A;  4E5R A;  5CQ2 A;  5E64 A;  3MCB A;  2QRV A;  2ZR4 A;  3OOB A;  5U47 A;  2DK1 A;  2YSG A;  3KAI A;  2E45 A;  2M3O W;  2YSF A;  2M8I A;  3MQG A;  2XP9 A;  2JX8 A;  1K9R A;  4GLX A;  2EZ5 W;  3LE4 A;  1NMV A;  3LKX B;  2Q5A A;  3MQH A;  1JMQ A;  3FS8 A;  1ZCN A;  3PQH A;  5E62 A;  2Y8N B;  2RE3 A;  2YSI A;  2XP7 A;  2XP3 A;  1F8A B;  4U84 A;  2XP6 A;  4A0T A;  2MDI A;  1FLC A;  3ODK A;  1RP5 A;  3M85 A;  1TK7 A;  4U86 A;  2KXQ A;  2ZR6 A;  1WR7 A;  5E66 A;  3KCE A;  3TDB A;  2DWV A;  2YAJ B;  3LKX A;  3M7N A;  3KAF A;  2OWO A;  3NTP A;  2JV4 A;  1O6W A;  2XPB A;  1YW5 A;  1EG3 A;  3WH0 A;  2XPA A;  2XP8 A;  1K9Q A;  2ZQV A;  5E5W A;  2JXW A;  1I5H W;  3KAH A;  2YSH A;  4A0U A;  2ZQU A;  3L4H A;  2ZAJ A;  3TCZ A;  5E65 A;  3CNG A;  2WAD A;  3KAG A;  1PIN A;  2WAE A;  1EG4 A;  2YSB A;  3MCB B;  5AHT A;  2BA1 A;  2DMV A;  2F21 A;  2XP5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...