2YSHA

Solution structure of the ww domain from the human growth-arrest-specific protein 7, gas-7
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
40
structure length
40
Chain Sequence
GSSGSSGLPPGWQSYLSPQGRRYYVNTTTNETTWERPSSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Growth-arrest-specific protein 7
publication title Solution structure of the WW domain from the human growth-arrest-specific protein 7, GAS-7
rcsb
source organism Homo sapiens
total genus 3
structure length 40
sequence length 40
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2yshA01
1K9QA 2XP7A 1JMQA 3L4HA 2YSFA 1PINA 2JXWA 2JV4A 2LAJA 1I5HW 2XPBA 3LE4A 2XP6A 2ZR5A 1ZCNA 2DK7A 2JX8A 1YW5A 1NMVA 2YSIA 4U86A 2XP8A 2DWVA 1F8AB 2M8JA 1WMVA 2ZAJA 1K9RA 4QIBA 2JMFA 2Q5AA 2XP3A 2MDIA 2ZR6A 2DMVA 1WR7A 4REXA 2YSHA 2DK1A 1O6WA 2XP9A 3M7NA 2M8IA 5AHTA 3CNGA 1EG4A 2L4JA 2ZR4A 3WH0A 2ZQSA 2ITKA 1EG3A 3KCEA 2RE3A 2M3OW 2ZQTA 3KADA 2DJYA 3ODKA 2XP4A 2ZQUA 3M85A 3KAFA 3KAGA 3TDBA 4U84A 4E5RA 2XP5A 1TK7A 2F21A 2YSGA 3KAHA 3TCZA 3OOBA 5CQ2A 2YSBA 4U85A 2E45A 2EZ5W 3NTPA 3KAIA 2BA1A 2XPAA 3KABA 3TC5A 2ZQVA 2KXQA
chains in the Genus database with same CATH superfamily
4A0UA 1FLCA 1K9QA 2XP7A 1JMQA 3L4HA 2Y8NB 2YSFA 1PINA 2JXWA 2JV4A 2LAJA 3MQHA 1I5HW 5E62A 2XPBA 3LE4A 2XP6A 2ZR5A 1ZCNA 2DK7A 2JX8A 1YW5A 1NMVA 3MQGA 2YSIA 4U86A 2XP8A 2DWVA 1F8AB 2M8JA 5E5WA 1WMVA 2ZAJA 1K9RA 4GLXA 4QIBA 2JMFA 2Q5AA 2YAJB 2XP3A 2MDIA 2ZR6A 2DMVA 1WR7A 4REXA 2YSHA 2DK1A 1O6WA 3MCBA 4A0TA 2XP9A 3M7NA 2M8IA 5AHTA 3FS8A 5E66A 3CNGA 2QRVA 1EG4A 2L4JA 2ZR4A 3WH0A 2ZQSA 5E65A 3LKXB 2ITKA 1EG3A 3KCEA 2RE3A 2M3OW 2ZQTA 3KADA 2DJYA 3FSBA 3ODKA 2XP4A 2ZQUA 3M85A 3KAFA 1RP5A 3KAGA 3TDBA 4U84A 4E5RA 5U47A 2XP5A 1TK7A 2F21A 2YSGA 3KAHA 1TR8A 3TCZA 3OOBA 2OWOA 5CQ2A 2YSBA 3LKXA 4U85A 2E45A 2EZ5W 3NTPA 3KAIA 3FSCA 5E64A 2BA1A 3MCBB 2WADA 2XPAA 2WAEA 3KABA 3TC5A 2ZQVA 2KXQA 3PQHA
chains in the Genus database with same CATH topology
4A0UA 1FLCA 1K9QA 2XP7A 1JMQA 3L4HA 2Y8NB 2YSFA 1PINA 2JXWA 2JV4A 2LAJA 3MQHA 1I5HW 5E62A 2XPBA 3LE4A 2XP6A 2ZR5A 1ZCNA 2DK7A 2JX8A 1YW5A 1NMVA 3MQGA 2YSIA 4U86A 2XP8A 2DWVA 1F8AB 2M8JA 5E5WA 1WMVA 2ZAJA 1K9RA 4GLXA 4QIBA 2JMFA 2Q5AA 2YAJB 2XP3A 2MDIA 2ZR6A 2DMVA 1WR7A 4REXA 2YSHA 2DK1A 1O6WA 3MCBA 4A0TA 2XP9A 3M7NA 2M8IA 5AHTA 3FS8A 5E66A 3CNGA 2QRVA 1EG4A 2L4JA 2ZR4A 3WH0A 2ZQSA 5E65A 3LKXB 2ITKA 1EG3A 3KCEA 2RE3A 2M3OW 2ZQTA 3KADA 2DJYA 3FSBA 3ODKA 2XP4A 2ZQUA 3M85A 3KAFA 1RP5A 3KAGA 3TDBA 4U84A 4E5RA 5U47A 2XP5A 1TK7A 2F21A 2YSGA 3KAHA 1TR8A 3TCZA 3OOBA 2OWOA 5CQ2A 2YSBA 3LKXA 4U85A 2E45A 2EZ5W 3NTPA 3KAIA 3FSCA 5E64A 2BA1A 3MCBB 2WADA 2XPAA 2WAEA 3KABA 3TC5A 2ZQVA 2KXQA 3PQHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K9Q A;  2XP7 A;  1JMQ A;  3L4H A;  2YSF A;  1PIN A;  2JXW A;  2JV4 A;  2LAJ A;  1I5H W;  2XPB A;  3LE4 A;  2XP6 A;  2ZR5 A;  1ZCN A;  2DK7 A;  2JX8 A;  1YW5 A;  1NMV A;  2YSI A;  4U86 A;  2XP8 A;  2DWV A;  1F8A B;  2M8J A;  1WMV A;  2ZAJ A;  1K9R A;  4QIB A;  2JMF A;  2Q5A A;  2XP3 A;  2MDI A;  2ZR6 A;  2DMV A;  1WR7 A;  4REX A;  2YSH A;  2DK1 A;  1O6W A;  2XP9 A;  3M7N A;  2M8I A;  5AHT A;  3CNG A;  1EG4 A;  2L4J A;  2ZR4 A;  3WH0 A;  2ZQS A;  2ITK A;  1EG3 A;  3KCE A;  2RE3 A;  2M3O W;  2ZQT A;  3KAD A;  2DJY A;  3ODK A;  2XP4 A;  2ZQU A;  3M85 A;  3KAF A;  3KAG A;  3TDB A;  4U84 A;  4E5R A;  2XP5 A;  1TK7 A;  2F21 A;  2YSG A;  3KAH A;  3TCZ A;  3OOB A;  5CQ2 A;  2YSB A;  4U85 A;  2E45 A;  2EZ5 W;  3NTP A;  3KAI A;  2BA1 A;  2XPA A;  3KAB A;  3TC5 A;  2ZQV A;  2KXQ A; 
#chains in the Genus database with same CATH topology
 4A0U A;  1FLC A;  1K9Q A;  2XP7 A;  1JMQ A;  3L4H A;  2Y8N B;  2YSF A;  1PIN A;  2JXW A;  2JV4 A;  2LAJ A;  3MQH A;  1I5H W;  5E62 A;  2XPB A;  3LE4 A;  2XP6 A;  2ZR5 A;  1ZCN A;  2DK7 A;  2JX8 A;  1YW5 A;  1NMV A;  3MQG A;  2YSI A;  4U86 A;  2XP8 A;  2DWV A;  1F8A B;  2M8J A;  5E5W A;  1WMV A;  2ZAJ A;  1K9R A;  4GLX A;  4QIB A;  2JMF A;  2Q5A A;  2YAJ B;  2XP3 A;  2MDI A;  2ZR6 A;  2DMV A;  1WR7 A;  4REX A;  2YSH A;  2DK1 A;  1O6W A;  3MCB A;  4A0T A;  2XP9 A;  3M7N A;  2M8I A;  5AHT A;  3FS8 A;  5E66 A;  3CNG A;  2QRV A;  1EG4 A;  2L4J A;  2ZR4 A;  3WH0 A;  2ZQS A;  5E65 A;  3LKX B;  2ITK A;  1EG3 A;  3KCE A;  2RE3 A;  2M3O W;  2ZQT A;  3KAD A;  2DJY A;  3FSB A;  3ODK A;  2XP4 A;  2ZQU A;  3M85 A;  3KAF A;  1RP5 A;  3KAG A;  3TDB A;  4U84 A;  4E5R A;  5U47 A;  2XP5 A;  1TK7 A;  2F21 A;  2YSG A;  3KAH A;  1TR8 A;  3TCZ A;  3OOB A;  2OWO A;  5CQ2 A;  2YSB A;  3LKX A;  4U85 A;  2E45 A;  2EZ5 W;  3NTP A;  3KAI A;  3FSC A;  5E64 A;  2BA1 A;  3MCB B;  2WAD A;  2XPA A;  2WAE A;  3KAB A;  3TC5 A;  2ZQV A;  2KXQ A;  3PQH A; 
#chains in the Genus database with same CATH homology
 4A0U A;  1FLC A;  1K9Q A;  2XP7 A;  1JMQ A;  3L4H A;  2Y8N B;  2YSF A;  1PIN A;  2JXW A;  2JV4 A;  2LAJ A;  3MQH A;  1I5H W;  5E62 A;  2XPB A;  3LE4 A;  2XP6 A;  2ZR5 A;  1ZCN A;  2DK7 A;  2JX8 A;  1YW5 A;  1NMV A;  3MQG A;  2YSI A;  4U86 A;  2XP8 A;  2DWV A;  1F8A B;  2M8J A;  5E5W A;  1WMV A;  2ZAJ A;  1K9R A;  4GLX A;  4QIB A;  2JMF A;  2Q5A A;  2YAJ B;  2XP3 A;  2MDI A;  2ZR6 A;  2DMV A;  1WR7 A;  4REX A;  2YSH A;  2DK1 A;  1O6W A;  3MCB A;  4A0T A;  2XP9 A;  3M7N A;  2M8I A;  5AHT A;  3FS8 A;  5E66 A;  3CNG A;  2QRV A;  1EG4 A;  2L4J A;  2ZR4 A;  3WH0 A;  2ZQS A;  5E65 A;  3LKX B;  2ITK A;  1EG3 A;  3KCE A;  2RE3 A;  2M3O W;  2ZQT A;  3KAD A;  2DJY A;  3FSB A;  3ODK A;  2XP4 A;  2ZQU A;  3M85 A;  3KAF A;  1RP5 A;  3KAG A;  3TDB A;  4U84 A;  4E5R A;  5U47 A;  2XP5 A;  1TK7 A;  2F21 A;  2YSG A;  3KAH A;  1TR8 A;  3TCZ A;  3OOB A;  2OWO A;  5CQ2 A;  2YSB A;  3LKX A;  4U85 A;  2E45 A;  2EZ5 W;  3NTP A;  3KAI A;  3FSC A;  5E64 A;  2BA1 A;  3MCB B;  2WAD A;  2XPA A;  2WAE A;  3KAB A;  3TC5 A;  2ZQV A;  2KXQ A;  3PQH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...