2L4JA

Yap ww2
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
46
structure length
46
Chain Sequence
GSPNSSPASGPLPEGWEQAITPEGEIYYINHKNKTTSWLDPRLETR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Yes-associated protein 2 (YAP2)
publication title Structural Features and Ligand Binding Properties of Tandem WW Domains from YAP and TAZ, Nuclear Effectors of the Hippo Pathway.
pubmed doi rcsb
source organism Oryzias latipes
molecule tags Transcription
total genus 1
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2010-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2l4jA00
1EG3A 4U85A 1K9QA 3KAGA 3KAFA 2XP8A 2MDIA 2LAJA 4QIBA 2ZAJA 2ZR6A 4E5RA 2DWVA 4U86A 1YW5A 3ODKA 3TCZA 2XP4A 3M7NA 2YSBA 1K9RA 2ITKA 2XPBA 1ZCNA 2E45A 1PINA 3NTPA 1I5HW 3KABA 1EG4A 2ZQTA 2BA1A 2RE3A 3KAHA 3TDBA 2M3OW 2M8JA 2L4JA 1O6WA 2YSGA 1TK7A 2XP6A 2XP5A 2JXWA 2DMVA 2XP9A 2DJYA 3CNGA 2M8IA 3M85A 2DK7A 2ZQVA 5CQ2A 1JMQA 2YSHA 4U84A 2F21A 3OOBA 2JX8A 2DK1A 2JV4A 1NMVA 3KAIA 2ZQSA 1WMVA 3KADA 2XP3A 3TC5A 2Q5AA 2JMFA 2XP7A 3WH0A 2YSFA 2ZR5A 3KCEA 4REXA 2ZQUA 3L4HA 2ZR4A 1WR7A 2KXQA 2XPAA 2EZ5W 2YSIA 3LE4A 1F8AB 5AHTA
chains in the Genus database with same CATH superfamily
2YAJB 3FSCA 2OWOA 1EG3A 4U85A 1K9QA 3KAGA 3KAFA 2XP8A 2MDIA 2LAJA 4QIBA 2ZAJA 2ZR6A 4E5RA 2DWVA 4U86A 4A0UA 1YW5A 3ODKA 3TCZA 1FLCA 3MCBB 2XP4A 3M7NA 5E62A 2YSBA 1K9RA 3LKXA 2QRVA 3PQHA 2ITKA 2XPBA 1ZCNA 3FSBA 2WAEA 2E45A 1PINA 3NTPA 1I5HW 3KABA 1EG4A 2ZQTA 1TR8A 2BA1A 2RE3A 3KAHA 3TDBA 2M3OW 5E65A 2M8JA 2L4JA 1O6WA 2YSGA 1RP5A 1TK7A 2XP6A 2Y8NB 2XP5A 2JXWA 2DMVA 2XP9A 2DJYA 3CNGA 2M8IA 3M85A 2WADA 3LKXB 2DK7A 2ZQVA 5CQ2A 5E64A 1JMQA 2YSHA 4U84A 2F21A 3OOBA 2JX8A 3MQGA 2DK1A 2JV4A 1NMVA 5U47A 3MCBA 3KAIA 2ZQSA 1WMVA 3FS8A 3KADA 2XP3A 3TC5A 2Q5AA 2JMFA 2XP7A 3MQHA 3WH0A 5E66A 2YSFA 2ZR5A 3KCEA 4REXA 4GLXA 2ZQUA 3L4HA 2ZR4A 5E5WA 1WR7A 2KXQA 2XPAA 4A0TA 2EZ5W 2YSIA 3LE4A 1F8AB 5AHTA
chains in the Genus database with same CATH topology
2YAJB 3FSCA 2OWOA 1EG3A 4U85A 1K9QA 3KAGA 3KAFA 2XP8A 2MDIA 2LAJA 4QIBA 2ZAJA 2ZR6A 4E5RA 2DWVA 4U86A 4A0UA 1YW5A 3ODKA 3TCZA 1FLCA 3MCBB 2XP4A 3M7NA 5E62A 2YSBA 1K9RA 3LKXA 2QRVA 3PQHA 2ITKA 2XPBA 1ZCNA 3FSBA 2WAEA 2E45A 1PINA 3NTPA 1I5HW 3KABA 1EG4A 2ZQTA 1TR8A 2BA1A 2RE3A 3KAHA 3TDBA 2M3OW 5E65A 2M8JA 2L4JA 1O6WA 2YSGA 1RP5A 1TK7A 2XP6A 2Y8NB 2XP5A 2JXWA 2DMVA 2XP9A 2DJYA 3CNGA 2M8IA 3M85A 2WADA 3LKXB 2DK7A 2ZQVA 5CQ2A 5E64A 1JMQA 2YSHA 4U84A 2F21A 3OOBA 2JX8A 3MQGA 2DK1A 2JV4A 1NMVA 5U47A 3MCBA 3KAIA 2ZQSA 1WMVA 3FS8A 3KADA 2XP3A 3TC5A 2Q5AA 2JMFA 2XP7A 3MQHA 3WH0A 5E66A 2YSFA 2ZR5A 3KCEA 4REXA 4GLXA 2ZQUA 3L4HA 2ZR4A 5E5WA 1WR7A 2KXQA 2XPAA 4A0TA 2EZ5W 2YSIA 3LE4A 1F8AB 5AHTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EG3 A;  4U85 A;  1K9Q A;  3KAG A;  3KAF A;  2XP8 A;  2MDI A;  2LAJ A;  4QIB A;  2ZAJ A;  2ZR6 A;  4E5R A;  2DWV A;  4U86 A;  1YW5 A;  3ODK A;  3TCZ A;  2XP4 A;  3M7N A;  2YSB A;  1K9R A;  2ITK A;  2XPB A;  1ZCN A;  2E45 A;  1PIN A;  3NTP A;  1I5H W;  3KAB A;  1EG4 A;  2ZQT A;  2BA1 A;  2RE3 A;  3KAH A;  3TDB A;  2M3O W;  2M8J A;  2L4J A;  1O6W A;  2YSG A;  1TK7 A;  2XP6 A;  2XP5 A;  2JXW A;  2DMV A;  2XP9 A;  2DJY A;  3CNG A;  2M8I A;  3M85 A;  2DK7 A;  2ZQV A;  5CQ2 A;  1JMQ A;  2YSH A;  4U84 A;  2F21 A;  3OOB A;  2JX8 A;  2DK1 A;  2JV4 A;  1NMV A;  3KAI A;  2ZQS A;  1WMV A;  3KAD A;  2XP3 A;  3TC5 A;  2Q5A A;  2JMF A;  2XP7 A;  3WH0 A;  2YSF A;  2ZR5 A;  3KCE A;  4REX A;  2ZQU A;  3L4H A;  2ZR4 A;  1WR7 A;  2KXQ A;  2XPA A;  2EZ5 W;  2YSI A;  3LE4 A;  1F8A B;  5AHT A; 
#chains in the Genus database with same CATH topology
 2YAJ B;  3FSC A;  2OWO A;  1EG3 A;  4U85 A;  1K9Q A;  3KAG A;  3KAF A;  2XP8 A;  2MDI A;  2LAJ A;  4QIB A;  2ZAJ A;  2ZR6 A;  4E5R A;  2DWV A;  4U86 A;  4A0U A;  1YW5 A;  3ODK A;  3TCZ A;  1FLC A;  3MCB B;  2XP4 A;  3M7N A;  5E62 A;  2YSB A;  1K9R A;  3LKX A;  2QRV A;  3PQH A;  2ITK A;  2XPB A;  1ZCN A;  3FSB A;  2WAE A;  2E45 A;  1PIN A;  3NTP A;  1I5H W;  3KAB A;  1EG4 A;  2ZQT A;  1TR8 A;  2BA1 A;  2RE3 A;  3KAH A;  3TDB A;  2M3O W;  5E65 A;  2M8J A;  2L4J A;  1O6W A;  2YSG A;  1RP5 A;  1TK7 A;  2XP6 A;  2Y8N B;  2XP5 A;  2JXW A;  2DMV A;  2XP9 A;  2DJY A;  3CNG A;  2M8I A;  3M85 A;  2WAD A;  3LKX B;  2DK7 A;  2ZQV A;  5CQ2 A;  5E64 A;  1JMQ A;  2YSH A;  4U84 A;  2F21 A;  3OOB A;  2JX8 A;  3MQG A;  2DK1 A;  2JV4 A;  1NMV A;  5U47 A;  3MCB A;  3KAI A;  2ZQS A;  1WMV A;  3FS8 A;  3KAD A;  2XP3 A;  3TC5 A;  2Q5A A;  2JMF A;  2XP7 A;  3MQH A;  3WH0 A;  5E66 A;  2YSF A;  2ZR5 A;  3KCE A;  4REX A;  4GLX A;  2ZQU A;  3L4H A;  2ZR4 A;  5E5W A;  1WR7 A;  2KXQ A;  2XPA A;  4A0T A;  2EZ5 W;  2YSI A;  3LE4 A;  1F8A B;  5AHT A; 
#chains in the Genus database with same CATH homology
 2YAJ B;  3FSC A;  2OWO A;  1EG3 A;  4U85 A;  1K9Q A;  3KAG A;  3KAF A;  2XP8 A;  2MDI A;  2LAJ A;  4QIB A;  2ZAJ A;  2ZR6 A;  4E5R A;  2DWV A;  4U86 A;  4A0U A;  1YW5 A;  3ODK A;  3TCZ A;  1FLC A;  3MCB B;  2XP4 A;  3M7N A;  5E62 A;  2YSB A;  1K9R A;  3LKX A;  2QRV A;  3PQH A;  2ITK A;  2XPB A;  1ZCN A;  3FSB A;  2WAE A;  2E45 A;  1PIN A;  3NTP A;  1I5H W;  3KAB A;  1EG4 A;  2ZQT A;  1TR8 A;  2BA1 A;  2RE3 A;  3KAH A;  3TDB A;  2M3O W;  5E65 A;  2M8J A;  2L4J A;  1O6W A;  2YSG A;  1RP5 A;  1TK7 A;  2XP6 A;  2Y8N B;  2XP5 A;  2JXW A;  2DMV A;  2XP9 A;  2DJY A;  3CNG A;  2M8I A;  3M85 A;  2WAD A;  3LKX B;  2DK7 A;  2ZQV A;  5CQ2 A;  5E64 A;  1JMQ A;  2YSH A;  4U84 A;  2F21 A;  3OOB A;  2JX8 A;  3MQG A;  2DK1 A;  2JV4 A;  1NMV A;  5U47 A;  3MCB A;  3KAI A;  2ZQS A;  1WMV A;  3FS8 A;  3KAD A;  2XP3 A;  3TC5 A;  2Q5A A;  2JMF A;  2XP7 A;  3MQH A;  3WH0 A;  5E66 A;  2YSF A;  2ZR5 A;  3KCE A;  4REX A;  4GLX A;  2ZQU A;  3L4H A;  2ZR4 A;  5E5W A;  1WR7 A;  2KXQ A;  2XPA A;  4A0T A;  2EZ5 W;  2YSI A;  3LE4 A;  1F8A B;  5AHT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...