3NTPA

Human pin1 complexed with reduced amide inhibitor
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
158
structure length
147
Chain Sequence
b'KLPPGWEKAMSRSSGRVYYFNHITNASQWERPSGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title A reduced-amide inhibitor of Pin1 binds in a conformation resembling a twisted-amide transition state.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/isomerase inhibitor
total genus 46
structure length 147
sequence length 158
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3ntpA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3ntpA02
4ODNA 2MF9A 3IKGA 5J6EA 4DRIA 2RUQA 3O5IA 3UI5A 2K8IA 2PBCA 2ZR6A 4TX0A 4DIPA 2UZ5A 4TNSA 1ZCNA 1JNTA 2XP3A 3NRKA 1YATA 3RGCA 1YW5A 2KO7A 2DWVA 2M2AA 1D7HA 4IPXA 2DG4A 4FN2A 3KADA 2PV3A 2KE0A 2YSFA 3ODKA 3UQAA 4MGVA 2ZR4A 1FKBA 2DG9A 5HW6A 4ODKA 4U84A 4DZ2A 4DRMA 1BKFA 1QPFA 1I5HW 3KAIA 5DIVA 3B7XA 2YSIA 1FJDA 2XP8A 2MLXA 4DRPA 1P5QA 3M85A 4JFKA 5DITA 3PRBA 1FKDA 4TYOA 4BF8A 2DK7A 2MLZA 3O5PA 1FKLA 2AWGA 4ODQA 4LAVA 4DRQA 1FD9A 5B8IC 2ZAJA 3EY6A 2DG3A 2YSGA 3MDYB 1FKKA 1TCOC 2OFNA 4G50A 3GPKA 1ZK6A 1PBKA 2LKNA 4REXA 4DRNA 3JYMA 2PPPA 1KT0A 1F40A 3RFWA 1ROUA 3O5FA 5HUAA 2EZ5W 4U86A 2RUCA 1Q6UA 5HWBA 2RQSA 2F2DA 4LAYA 1T11A 2L4JA 1J4IA 2KGJA 1JVWA 1O6WA 2KI3A 3NTPA 4W9PA 2M08A 5HW7A 1D7JA 2KFWA 1NSGA 1F8AB 5GPGA 2MDIA 3LE4A 2N87A 2JX8A 2XP5A 4U85A 1JMQA 2KR7A 4IQCA 2ZQUA 3IHZA 3IK8A 2JMFA 2FAPA 3CNGA 2DMVA 4QT2A 3O5KA 2LPVA 3NI6A 4ITZA 1HXVA 1FKRA 2XPBA 2IF4A 4W9QA 4DZ3A 5HW8A 4LAWA 3UF8A 4C02B 3M7NA 2ITKA 1FKGA 1A7XA 2YSBA 5HTGA 2FKEA 2MLYA 1NMWA 1Q6HA 1KT1A 3PA7A 4E5RA 1JNSA 2LAJA 4JFMA 1L1PA 3TDBA 4J4NA 5BXJA 3WH0A 3CGMA 2PV1A 4ODRA 4TW6A 1Y0OA 3TC5A 2DK1A 3UQBA 5CQ2A 3O5QA 3O5GA 4TW8A 3L4HA 1FAPA 2XP9A 3KABA 3KAHA 3FAPA 2MPHA 3UI4A 3IKDA 2RE3A 1PINA 2RSEA 3CGNA 3O5EA 3TCZA 4DRJA 1K9RA 4TW7A 3PRDA 2RUDA 2PPNA 4W9OA 3KACA 2JXWA 2ZQSA 2XP7A 2F4EA 2M3OW 2LGOA 2Y78A 5HKGA 2KXQA 2PV2A 2JZVA 1J4HA 4ODPA 2L2SA 4N19A 1NMVA 3LUOA 2MNTA 1ROTA 1B6CA 1N1AA 2PPOA 4O2TA 1J4RA 4NNRA 4DROA 3O5RA 4LAXA 1C9HA 1FKFA 1FKTA 2RURA 4GIVA 4MSPA 1W26A 3I6CA 4JFLA 4DT4A 4ODOA 3O5OA 2XP4A 1QZ2A 2VN1A 2YSHA 4QT3A 3O5LA 1J6YA 2M8IA 3KAFA 2XP6A 4JYSA 2ZR5A 4G2PA 1R9HA 4GGQA 4QIBA 3JYJA 4ODLA 2DJYA 3VAWA 4DH0A 4DRKA 3UI6A 1EYMA 1EQ3A 1WR7A 1WMVA 1D7IA 4JFIA 1FKSA 3O5JA 3O5DA 5I98A 2XPAA 2JV4A 1TK7A 5D75A 1BL4A 4DRHA 4JFJA 3OOBA 2M1IA 1FKHA 2E45A 1QPLA 4IQ2A 3H9RB 5HWCA 2F21A 2D9FA 3KCEA 5AHTA 4R0XA 3UQIA 3JXVA 2ZQTA 1D6OA 1FKJA 3KZ7A 1K9QA 4FAPA 3KAGA 2M8JA 3O5MA 1M5YA 5DIUA 2BA1A 1EG4A 2Q5AA 1Q6IA 1FKIA 2ZQVA 1EG3A 2LJ4A 1Q1CA 4ODMA 5HT1A 4J4OA 2VCDA 1U79A
chains in the Genus database with same CATH superfamily
4ODNA 1XRVA 2MF9A 4S3JA 1NWTA 1E6NA 3IKGA 5J6EA 4W5UA 1SYTA 4DRIA 2RUQA 2DT1A 3O5IA 3UI5A 2K8IA 2PBCA 2ZR6A 4TX0A 4DIPA 2UZ5A 4TNSA 2QRVA 3WD0A 4Q7NA 1ZCNA 2WAEA 1JNTA 1X6NA 2XP3A 4WK9A 3NRKA 1LQ0A 1YATA 3RGCA 1YW5A 2KO7A 1W9UA 3WKZA 2DWVA 2M2AA 2DT2A 4URIA 1D7HA 4IPXA 2DG4A 4FN2A 1HJVA 3KADA 3AQUA 1JCHB 4P8UA 1SR0A 2PV3A 2KE0A 3G6LA 3ARQA 4L72B 2YSFA 3ODKA 2EULA 1NH6A 3CHCA 5DEZA 3UQAA 3BXWA 1NWSA 4WKHA 3ALFA 4NSBA 4WJXA 4MAVA 4MGVA 1GUVA 2ZR4A 1FKBA 3PR9A 2DG9A 5HW6A 4HARA 4P8VA 1NWRA 3WD4A 4ODKA 4U84A 3WQVA 5HBFA 4DZ2A 4A0TA 3ARPA 4DRMA 1BKFA 1QPFA 4IT6A 4A0UA 1I5HW 2Y8NB 3KAIA 5E62A 5DIVA 3B7XA 2YSIA 1NWUA 1FJDA 1OGBA 2XP8A 2A3EA 2MLXA 1ZU8A 4DRPA 1P5QA 2O9OA 3M85A 4JFKA 4Z2JA 1VF8A 2IUZA 5DITA 3PRBA 1FKDA 4TYOA 3RM9A 3FY1A 3LKXB 4BF8A 2DK7A 1XHGA 1W1VA 2MLZA 2OLHA 3O5PA 1FKLA 2AWGA 4ODQA 2OWOA 4LAVA 4P8XA 4HBEA 4DRQA 1OGGA 1FD9A 4R5EA 5B8IC 2ZAJA 3EY6A 2PN0A 2DG3A 3CHEA 3FXYA 2YSGA 3MDYB 1FKKA 1TCOC 2OFNA 4G50A 2WK2A 3GPKA 2A3BA 1ZK6A 1PBKA 2LKNA 1ZBVA 3LKXA 4REXA 1CTNA 4DRNA 2DT3A 3JYMA 2PPPA 1KT0A 1W1PA 1F40A 3RFWA 1LG1A 1ROUA 4L3NA 4HBOA 3CHDA 3ARUA 1RP5A 3O5FA 3PQHA 3MQGA 1HKMA 5HUAA 1JNDA 1LL6A 2EZ5W 4U86A 2RUCA 3ARRA 1Q6UA 5HWBA 2RQSA 2F2DA 4LAYA 3WD2A 1T11A 2L4JA 1J4IA 1K9TA 3GTYX 2KGJA 2FDMA 1JVWA 1O6WA 2KI3A 3NTPA 1X6LA 1HKJA 4DWSD 3AROA 5E66A 3RM4A 4W9PA 2M08A 5E5WA 5HW7A 1D7JA 2KFWA 1NSGA 1F8AB 2B31A 3ARTA 5GPGA 2MDIA 1E6PA 3LE4A 2N87A 2JX8A 2XP5A 4U85A 1JMQA 2KR7A 4IQCA 2ZQUA 3IHZA 3IK8A 2JMFA 2FAPA 3B9AA 1LG2A 3CNGA 5E65A 2DMVA 4ZS6A 5GQBA 4QT2A 4Z2KA 1HJWA 3AS3A 3O5KA 1E6RA 2LPVA 3AS1A 3WD1A 1LL7A 4MPKA 3NI6A 4ITZA 1EHNA 1HXVA 1FKRA 2XPBA 1E9LA 3FS8A 2IF4A 4W9QA 4DZ3A 4MNJA 3EIPA 1FFQA 4ZPVR 5HW8A 1D2KA 4LAWA 5DO2A 3AS2A 3B9EA 3UF8A 5E64A 4C02B 3RM8A 3M7NA 4MNLA 1JNEA 3ARSA 3WIJA 2ITKA 1ZBWA 3ARWA 1FKGA 3CH9A 1A7XA 2YSBA 1ZBKA 3W4RA 1WAWA 3BMBA 2FKEA 4QZVB 5HTGA 2MLYA 1NMWA 3ARYA 1Q6HA 4DWSA 3WL1A 1EIBA 1KT1A 3MCBA 3PA7A 4E5RA 1JNSA 2DSWA 1E15A 3ARXA 2LAJA 4JFMA 2F23A 1L1PA 4P8WA 3MQHA 3WD3A 4MNKA 3TDBA 2DSVA 4J4NA 3PRAA 4Z2LA 5BXJA 3WH0A 3CGMA 2PV1A 1O6IA 4ODRA 4TW6A 2ESCA 4Q22A 4WKAA 1UR9A 1Y0OA 1ZL1A 3FSCA 3TC5A 2DK1A 1OWQA 3UQBA 2A3CA 1E6ZA 5CQ2A 3O5QA 3O5GA 2WLYA 4TW8A 4S3KA 3L4HA 1FAPA 4GLXA 2XP9A 3KABA 3KAHA 4PTMA 2WM0A 4Z2IA 3FAPA 1ZB5A 2MPHA 3UI4A 3IKDA 1TFVA 2RE3A 3B8SA 1PINA 2RSEA 3ALGA 3CGNA 3O5EA 3TCZA 4KR0B 4LGXA 4DRJA 1K9RA 4TW7A 3PRDA 4IT4A 4KQZA 2G41A 2RUDA 5JH8A 2PPNA 1GPFA 4W9OA 3KACA 2JXWA 2ZQSA 2XP7A 2F4EA 1W1YA 2YAJB 5U47A 3RMEA 4ZPTR 2M3OW 3WL0A 1E44A 2LGOA 2Y78A 5DF0A 5HKGA 2KXQA 1W9VA 2PV2A 2JZVA 1J4HA 3QOKA 2ETNA 2QF8A 4ODPA 2L2SA 4N19A 1NMVA 3LUOA 2YBUA 2MNTA 1H0GA 1ROTA 1B6CA 3CZ8A 1N1AA 2DT0A 2PPOA 4O2TA 1J4RA 4NNRA 4DROA 4DWSB 3MCBB 3ARZA 4ZPWR 1HJXA 3O5RA 4LAXA 2A3AA 1C9HA 1LL4A 1FKFA 1FKTA 2RURA 4XAKA 4GIVA 4MSPA 1W26A 4MNMA 1GRJA 3I6CA 4JFLA 4DT4A 4ODOA 3O5OA 2XP4A 1QZ2A 2VN1A 3WQWA 2YSHA 4QT3A 2B5UB 4MTVA 2DSUA 3O5LA 1J6YA 2M8IA 1RD6A 3KAFA 4NZCA 1TR8A 2XP6A 4JYSA 2ZR5A 4ML4A 4G2PA 1R9HA 2YBTA 4GGQA 2DPEA 1H0IA 4QIBA 2WADA 3JYJA 4ODLA 2DJYA 3VAWA 3AS0A 4WIWA 4DH0A 2DSZA 1WB0A 2WLZA 3UI6A 4DRKA 1EYMA 1EQ3A 1WR7A 1WMVA 3CHFA 3OA5A 1D7IA 4JFIA 1FKSA 3GU0A 3O5JA 3O5DA 5I98A 2XPAA 2JV4A 3FSBA 4AY1A 4Z2HA 2AOSA 1TK7A 1FFRA 5D75A 1BL4A 3B9DA 3G6MA 4JFJA 4DRHA 3OOBA 2M1IA 1FKHA 4DWSC 1WNOA 2E45A 1QPLA 4IQ2A 3H9RB 1LJYA 2G8ZA 5HWCA 2F21A 2D9FA 3KCEA 5AHTA 1IX5A 2O92A 4R0XA 4WKFA 1ITXA 1EDQA 3UQIA 1FLCA 1KFWA 1HKKA 2PI6A 3JXVA 2ZQTA 1D6OA 1FKJA 3KZ7A 1K9QA 3ARVA 4Z2GA 1HKIA 1ZBCA 4FAPA 3KAGA 1W1TA 2P4VA 2M8JA 3O5MA 1M5YA 5DIUA 1UR8A 2BA1A 5GPRA 1EG4A 2Q5AA 1Q6IA 1FKIA 4UDMA 1GOIA 2ZQVA 1W9PA 1EG3A 2LJ4A 1Q1CA 4ODMA 5HT1A 4J4OA 2VCDA 1U79A
chains in the Genus database with same CATH topology
4ODNA 1XRVA 2MF9A 4S3JA 1NWTA 1E6NA 3IKGA 5J6EA 4W5UA 1SYTA 4DRIA 2RUQA 2DT1A 3O5IA 3UI5A 2K8IA 2PBCA 2ZR6A 4TX0A 4DIPA 2UZ5A 4TNSA 2QRVA 3WD0A 4Q7NA 1ZCNA 2WAEA 1JNTA 1X6NA 2XP3A 4WK9A 3NRKA 1LQ0A 1YATA 3RGCA 1YW5A 2KO7A 1W9UA 3WKZA 2DWVA 2M2AA 2DT2A 4URIA 1D7HA 4IPXA 2DG4A 4FN2A 1HJVA 3KADA 3AQUA 4P8UA 1SR0A 2PV3A 2KE0A 3G6LA 3ARQA 4L72B 2YSFA 3ODKA 1NH6A 3CHCA 5DEZA 3UQAA 3BXWA 1NWSA 4WKHA 3ALFA 4NSBA 4WJXA 4MAVA 4MGVA 1GUVA 2ZR4A 1FKBA 3PR9A 2DG9A 5HW6A 4HARA 4P8VA 1NWRA 3WD4A 4ODKA 4U84A 3WQVA 5HBFA 4DZ2A 4A0TA 3ARPA 4DRMA 1BKFA 1QPFA 4IT6A 4A0UA 1I5HW 2Y8NB 3KAIA 5E62A 5DIVA 3B7XA 2YSIA 1NWUA 1FJDA 1OGBA 2XP8A 2A3EA 2MLXA 1ZU8A 4DRPA 1P5QA 2O9OA 3M85A 4JFKA 4Z2JA 1VF8A 2IUZA 5DITA 3PRBA 1FKDA 4TYOA 3RM9A 3FY1A 3LKXB 4BF8A 2DK7A 1XHGA 1W1VA 2MLZA 2OLHA 3O5PA 1FKLA 2AWGA 4ODQA 2OWOA 4LAVA 4P8XA 4HBEA 4DRQA 1OGGA 1FD9A 4R5EA 5B8IC 2ZAJA 3EY6A 2DG3A 3CHEA 3FXYA 2YSGA 3MDYB 1FKKA 1TCOC 2OFNA 4G50A 2WK2A 3GPKA 2A3BA 1ZK6A 1PBKA 2LKNA 1ZBVA 3LKXA 4REXA 1CTNA 4DRNA 2DT3A 3JYMA 2PPPA 1KT0A 1W1PA 1F40A 3RFWA 1LG1A 1ROUA 4L3NA 4HBOA 3CHDA 3ARUA 1RP5A 3O5FA 3PQHA 3MQGA 1HKMA 5HUAA 1JNDA 1LL6A 2EZ5W 4U86A 2RUCA 3ARRA 1Q6UA 5HWBA 2RQSA 2F2DA 4LAYA 3WD2A 1T11A 2L4JA 1J4IA 1K9TA 2KGJA 2FDMA 1JVWA 1O6WA 2KI3A 3NTPA 1X6LA 1HKJA 4DWSD 3AROA 5E66A 3RM4A 4W9PA 2M08A 5E5WA 5HW7A 1D7JA 2KFWA 1NSGA 1F8AB 2B31A 3ARTA 5GPGA 2MDIA 1E6PA 3LE4A 2N87A 2JX8A 2XP5A 4U85A 1JMQA 2KR7A 4IQCA 2ZQUA 3IHZA 3IK8A 2JMFA 2FAPA 3B9AA 1LG2A 3CNGA 5E65A 2DMVA 4ZS6A 5GQBA 4QT2A 4Z2KA 1HJWA 3AS3A 3O5KA 1E6RA 2LPVA 3AS1A 3WD1A 1LL7A 4MPKA 3NI6A 4ITZA 1EHNA 1HXVA 1FKRA 2XPBA 1E9LA 3FS8A 2IF4A 4W9QA 4DZ3A 4MNJA 1FFQA 4ZPVR 5HW8A 1D2KA 4LAWA 5DO2A 3AS2A 3B9EA 3UF8A 5E64A 4C02B 3RM8A 3M7NA 4MNLA 1JNEA 3ARSA 3WIJA 2ITKA 1ZBWA 3ARWA 1FKGA 3CH9A 1A7XA 2YSBA 1ZBKA 3W4RA 1WAWA 5HTGA 2FKEA 4QZVB 2MLYA 1NMWA 3ARYA 1Q6HA 4DWSA 3WL1A 1EIBA 1KT1A 3MCBA 3PA7A 4E5RA 1JNSA 2DSWA 1E15A 3ARXA 2LAJA 4JFMA 1L1PA 4P8WA 3MQHA 3WD3A 4MNKA 3TDBA 2DSVA 4J4NA 3PRAA 4Z2LA 5BXJA 3WH0A 3CGMA 2PV1A 1O6IA 4ODRA 4TW6A 2ESCA 4Q22A 4WKAA 1UR9A 1Y0OA 1ZL1A 3FSCA 3TC5A 2DK1A 1OWQA 3UQBA 2A3CA 1E6ZA 5CQ2A 3O5QA 3O5GA 2WLYA 4TW8A 4S3KA 3L4HA 1FAPA 4GLXA 2XP9A 3KABA 3KAHA 4PTMA 2WM0A 4Z2IA 3FAPA 1ZB5A 2MPHA 3UI4A 3IKDA 1TFVA 2RE3A 3B8SA 1PINA 2RSEA 3ALGA 3CGNA 3O5EA 3TCZA 4KR0B 4LGXA 4DRJA 1K9RA 4TW7A 3PRDA 4IT4A 4KQZA 2G41A 2RUDA 5JH8A 2PPNA 1GPFA 4W9OA 3KACA 2JXWA 2ZQSA 2XP7A 2F4EA 1W1YA 2YAJB 5U47A 3RMEA 4ZPTR 2M3OW 3WL0A 2LGOA 2Y78A 5DF0A 5HKGA 2KXQA 1W9VA 2PV2A 2JZVA 1J4HA 3QOKA 2QF8A 4ODPA 2L2SA 4N19A 1NMVA 3LUOA 2YBUA 2MNTA 1H0GA 1ROTA 1B6CA 3CZ8A 1N1AA 2DT0A 2PPOA 4O2TA 1J4RA 4NNRA 4DROA 4DWSB 3MCBB 3ARZA 4ZPWR 1HJXA 3O5RA 4LAXA 2A3AA 1C9HA 1LL4A 1FKFA 1FKTA 2RURA 4XAKA 4GIVA 4MSPA 1W26A 4MNMA 3I6CA 4JFLA 4DT4A 4ODOA 3O5OA 2XP4A 1QZ2A 2VN1A 3WQWA 2YSHA 4QT3A 4MTVA 2DSUA 3O5LA 1J6YA 2M8IA 1RD6A 3KAFA 4NZCA 1TR8A 2XP6A 4JYSA 2ZR5A 4ML4A 4G2PA 1R9HA 2YBTA 4GGQA 2DPEA 1H0IA 4QIBA 2WADA 3JYJA 4ODLA 2DJYA 3VAWA 3AS0A 4WIWA 4DH0A 2DSZA 1WB0A 2WLZA 3UI6A 4DRKA 1EYMA 1EQ3A 1WR7A 1WMVA 3CHFA 3OA5A 1D7IA 4JFIA 1FKSA 3O5JA 3O5DA 5I98A 2XPAA 2JV4A 3FSBA 4AY1A 4Z2HA 2AOSA 1TK7A 1FFRA 5D75A 1BL4A 3B9DA 3G6MA 4JFJA 4DRHA 3OOBA 2M1IA 1FKHA 4DWSC 1WNOA 2E45A 1QPLA 4IQ2A 3H9RB 1LJYA 2G8ZA 5HWCA 2F21A 2D9FA 3KCEA 5AHTA 1IX5A 2O92A 4R0XA 4WKFA 1ITXA 1EDQA 3UQIA 1FLCA 1KFWA 1HKKA 2PI6A 3JXVA 2ZQTA 1D6OA 1FKJA 3KZ7A 1K9QA 3ARVA 4Z2GA 1HKIA 1ZBCA 4FAPA 3KAGA 1W1TA 2M8JA 3O5MA 1M5YA 5DIUA 1UR8A 2BA1A 5GPRA 1EG4A 2Q5AA 1Q6IA 1FKIA 1GOIA 2ZQVA 1W9PA 1EG3A 2LJ4A 1Q1CA 4ODMA 5HT1A 4J4OA 2VCDA 1U79A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ODN A;  2MF9 A;  3IKG A;  5J6E A;  4DRI A;  2RUQ A;  3O5I A;  3UI5 A;  2K8I A;  2PBC A;  2ZR6 A;  4TX0 A;  4DIP A;  2UZ5 A;  4TNS A;  1ZCN A;  1JNT A;  2XP3 A;  3NRK A;  1YAT A;  3RGC A;  1YW5 A;  2KO7 A;  2DWV A;  2M2A A;  1D7H A;  4IPX A;  2DG4 A;  4FN2 A;  3KAD A;  2PV3 A;  2KE0 A;  2YSF A;  3ODK A;  3UQA A;  4MGV A;  2ZR4 A;  1FKB A;  2DG9 A;  5HW6 A;  4ODK A;  4U84 A;  4DZ2 A;  4DRM A;  1BKF A;  1QPF A;  1I5H W;  3KAI A;  5DIV A;  3B7X A;  2YSI A;  1FJD A;  2XP8 A;  2MLX A;  4DRP A;  1P5Q A;  3M85 A;  4JFK A;  5DIT A;  3PRB A;  1FKD A;  4TYO A;  4BF8 A;  2DK7 A;  2MLZ A;  3O5P A;  1FKL A;  2AWG A;  4ODQ A;  4LAV A;  4DRQ A;  1FD9 A;  5B8I C;  2ZAJ A;  3EY6 A;  2DG3 A;  2YSG A;  3MDY B;  1FKK A;  1TCO C;  2OFN A;  4G50 A;  3GPK A;  1ZK6 A;  1PBK A;  2LKN A;  4REX A;  4DRN A;  3JYM A;  2PPP A;  1KT0 A;  1F40 A;  3RFW A;  1ROU A;  3O5F A;  5HUA A;  2EZ5 W;  4U86 A;  2RUC A;  1Q6U A;  5HWB A;  2RQS A;  2F2D A;  4LAY A;  1T11 A;  2L4J A;  1J4I A;  2KGJ A;  1JVW A;  1O6W A;  2KI3 A;  3NTP A;  4W9P A;  2M08 A;  5HW7 A;  1D7J A;  2KFW A;  1NSG A;  1F8A B;  5GPG A;  2MDI A;  3LE4 A;  2N87 A;  2JX8 A;  2XP5 A;  4U85 A;  1JMQ A;  2KR7 A;  4IQC A;  2ZQU A;  3IHZ A;  3IK8 A;  2JMF A;  2FAP A;  3CNG A;  2DMV A;  4QT2 A;  3O5K A;  2LPV A;  3NI6 A;  4ITZ A;  1HXV A;  1FKR A;  2XPB A;  2IF4 A;  4W9Q A;  4DZ3 A;  5HW8 A;  4LAW A;  3UF8 A;  4C02 B;  3M7N A;  2ITK A;  1FKG A;  1A7X A;  2YSB A;  5HTG A;  2FKE A;  2MLY A;  1NMW A;  1Q6H A;  1KT1 A;  3PA7 A;  4E5R A;  1JNS A;  2LAJ A;  4JFM A;  1L1P A;  3TDB A;  4J4N A;  5BXJ A;  3WH0 A;  3CGM A;  2PV1 A;  4ODR A;  4TW6 A;  1Y0O A;  3TC5 A;  2DK1 A;  3UQB A;  5CQ2 A;  3O5Q A;  3O5G A;  4TW8 A;  3L4H A;  1FAP A;  2XP9 A;  3KAB A;  3KAH A;  3FAP A;  2MPH A;  3UI4 A;  3IKD A;  2RE3 A;  1PIN A;  2RSE A;  3CGN A;  3O5E A;  3TCZ A;  4DRJ A;  1K9R A;  4TW7 A;  3PRD A;  2RUD A;  2PPN A;  4W9O A;  3KAC A;  2JXW A;  2ZQS A;  2XP7 A;  2F4E A;  2M3O W;  2LGO A;  2Y78 A;  5HKG A;  2KXQ A;  2PV2 A;  2JZV A;  1J4H A;  4ODP A;  2L2S A;  4N19 A;  1NMV A;  3LUO A;  2MNT A;  1ROT A;  1B6C A;  1N1A A;  2PPO A;  4O2T A;  1J4R A;  4NNR A;  4DRO A;  3O5R A;  4LAX A;  1C9H A;  1FKF A;  1FKT A;  2RUR A;  4GIV A;  4MSP A;  1W26 A;  3I6C A;  4JFL A;  4DT4 A;  4ODO A;  3O5O A;  2XP4 A;  1QZ2 A;  2VN1 A;  2YSH A;  4QT3 A;  3O5L A;  1J6Y A;  2M8I A;  3KAF A;  2XP6 A;  4JYS A;  2ZR5 A;  4G2P A;  1R9H A;  4GGQ A;  4QIB A;  3JYJ A;  4ODL A;  2DJY A;  3VAW A;  4DH0 A;  4DRK A;  3UI6 A;  1EYM A;  1EQ3 A;  1WR7 A;  1WMV A;  1D7I A;  4JFI A;  1FKS A;  3O5J A;  3O5D A;  5I98 A;  2XPA A;  2JV4 A;  1TK7 A;  5D75 A;  1BL4 A;  4DRH A;  4JFJ A;  3OOB A;  2M1I A;  1FKH A;  2E45 A;  1QPL A;  4IQ2 A;  3H9R B;  5HWC A;  2F21 A;  2D9F A;  3KCE A;  5AHT A;  4R0X A;  3UQI A;  3JXV A;  2ZQT A;  1D6O A;  1FKJ A;  3KZ7 A;  1K9Q A;  4FAP A;  3KAG A;  2M8J A;  3O5M A;  1M5Y A;  5DIU A;  2BA1 A;  1EG4 A;  2Q5A A;  1Q6I A;  1FKI A;  2ZQV A;  1EG3 A;  2LJ4 A;  1Q1C A;  4ODM A;  5HT1 A;  4J4O A;  2VCD A;  1U79 A; 
#chains in the Genus database with same CATH topology
 4ODN A;  1XRV A;  2MF9 A;  4S3J A;  1NWT A;  1E6N A;  3IKG A;  5J6E A;  4W5U A;  1SYT A;  4DRI A;  2RUQ A;  2DT1 A;  3O5I A;  3UI5 A;  2K8I A;  2PBC A;  2ZR6 A;  4TX0 A;  4DIP A;  2UZ5 A;  4TNS A;  2QRV A;  3WD0 A;  4Q7N A;  1ZCN A;  2WAE A;  1JNT A;  1X6N A;  2XP3 A;  4WK9 A;  3NRK A;  1LQ0 A;  1YAT A;  3RGC A;  1YW5 A;  2KO7 A;  1W9U A;  3WKZ A;  2DWV A;  2M2A A;  2DT2 A;  4URI A;  1D7H A;  4IPX A;  2DG4 A;  4FN2 A;  1HJV A;  3KAD A;  3AQU A;  1JCH B;  4P8U A;  1SR0 A;  2PV3 A;  2KE0 A;  3G6L A;  3ARQ A;  4L72 B;  2YSF A;  3ODK A;  2EUL A;  1NH6 A;  3CHC A;  5DEZ A;  3UQA A;  3BXW A;  1NWS A;  4WKH A;  3ALF A;  4NSB A;  4WJX A;  4MAV A;  4MGV A;  1GUV A;  2ZR4 A;  1FKB A;  3PR9 A;  2DG9 A;  5HW6 A;  4HAR A;  4P8V A;  1NWR A;  3WD4 A;  4ODK A;  4U84 A;  3WQV A;  5HBF A;  4DZ2 A;  4A0T A;  3ARP A;  4DRM A;  1BKF A;  1QPF A;  4IT6 A;  4A0U A;  1I5H W;  2Y8N B;  3KAI A;  5E62 A;  5DIV A;  3B7X A;  2YSI A;  1NWU A;  1FJD A;  1OGB A;  2XP8 A;  2A3E A;  2MLX A;  1ZU8 A;  4DRP A;  1P5Q A;  2O9O A;  3M85 A;  4JFK A;  4Z2J A;  1VF8 A;  2IUZ A;  5DIT A;  3PRB A;  1FKD A;  4TYO A;  3RM9 A;  3FY1 A;  3LKX B;  4BF8 A;  2DK7 A;  1XHG A;  1W1V A;  2MLZ A;  2OLH A;  3O5P A;  1FKL A;  2AWG A;  4ODQ A;  2OWO A;  4LAV A;  4P8X A;  4HBE A;  4DRQ A;  1OGG A;  1FD9 A;  4R5E A;  5B8I C;  2ZAJ A;  3EY6 A;  2PN0 A;  2DG3 A;  3CHE A;  3FXY A;  2YSG A;  3MDY B;  1FKK A;  1TCO C;  2OFN A;  4G50 A;  2WK2 A;  3GPK A;  2A3B A;  1ZK6 A;  1PBK A;  2LKN A;  1ZBV A;  3LKX A;  4REX A;  1CTN A;  4DRN A;  2DT3 A;  3JYM A;  2PPP A;  1KT0 A;  1W1P A;  1F40 A;  3RFW A;  1LG1 A;  1ROU A;  4L3N A;  4HBO A;  3CHD A;  3ARU A;  1RP5 A;  3O5F A;  3PQH A;  3MQG A;  1HKM A;  5HUA A;  1JND A;  1LL6 A;  2EZ5 W;  4U86 A;  2RUC A;  3ARR A;  1Q6U A;  5HWB A;  2RQS A;  2F2D A;  4LAY A;  3WD2 A;  1T11 A;  2L4J A;  1J4I A;  1K9T A;  3GTY X;  2KGJ A;  2FDM A;  1JVW A;  1O6W A;  2KI3 A;  3NTP A;  1X6L A;  1HKJ A;  4DWS D;  3ARO A;  5E66 A;  3RM4 A;  4W9P A;  2M08 A;  5E5W A;  5HW7 A;  1D7J A;  2KFW A;  1NSG A;  1F8A B;  2B31 A;  3ART A;  5GPG A;  2MDI A;  1E6P A;  3LE4 A;  2N87 A;  2JX8 A;  2XP5 A;  4U85 A;  1JMQ A;  2KR7 A;  4IQC A;  2ZQU A;  3IHZ A;  3IK8 A;  2JMF A;  2FAP A;  3B9A A;  1LG2 A;  3CNG A;  5E65 A;  2DMV A;  4ZS6 A;  5GQB A;  4QT2 A;  4Z2K A;  1HJW A;  3AS3 A;  3O5K A;  1E6R A;  2LPV A;  3AS1 A;  3WD1 A;  1LL7 A;  4MPK A;  3NI6 A;  4ITZ A;  1EHN A;  1HXV A;  1FKR A;  2XPB A;  1E9L A;  3FS8 A;  2IF4 A;  4W9Q A;  4DZ3 A;  4MNJ A;  3EIP A;  1FFQ A;  4ZPV R;  5HW8 A;  1D2K A;  4LAW A;  5DO2 A;  3AS2 A;  3B9E A;  3UF8 A;  5E64 A;  4C02 B;  3RM8 A;  3M7N A;  4MNL A;  1JNE A;  3ARS A;  3WIJ A;  2ITK A;  1ZBW A;  3ARW A;  1FKG A;  3CH9 A;  1A7X A;  2YSB A;  1ZBK A;  3W4R A;  1WAW A;  3BMB A;  2FKE A;  4QZV B;  5HTG A;  2MLY A;  1NMW A;  3ARY A;  1Q6H A;  4DWS A;  3WL1 A;  1EIB A;  1KT1 A;  3MCB A;  3PA7 A;  4E5R A;  1JNS A;  2DSW A;  1E15 A;  3ARX A;  2LAJ A;  4JFM A;  2F23 A;  1L1P A;  4P8W A;  3MQH A;  3WD3 A;  4MNK A;  3TDB A;  2DSV A;  4J4N A;  3PRA A;  4Z2L A;  5BXJ A;  3WH0 A;  3CGM A;  2PV1 A;  1O6I A;  4ODR A;  4TW6 A;  2ESC A;  4Q22 A;  4WKA A;  1UR9 A;  1Y0O A;  1ZL1 A;  3FSC A;  3TC5 A;  2DK1 A;  1OWQ A;  3UQB A;  2A3C A;  1E6Z A;  5CQ2 A;  3O5Q A;  3O5G A;  2WLY A;  4TW8 A;  4S3K A;  3L4H A;  1FAP A;  4GLX A;  2XP9 A;  3KAB A;  3KAH A;  4PTM A;  2WM0 A;  4Z2I A;  3FAP A;  1ZB5 A;  2MPH A;  3UI4 A;  3IKD A;  1TFV A;  2RE3 A;  3B8S A;  1PIN A;  2RSE A;  3ALG A;  3CGN A;  3O5E A;  3TCZ A;  4KR0 B;  4LGX A;  4DRJ A;  1K9R A;  4TW7 A;  3PRD A;  4IT4 A;  4KQZ A;  2G41 A;  2RUD A;  5JH8 A;  2PPN A;  1GPF A;  4W9O A;  3KAC A;  2JXW A;  2ZQS A;  2XP7 A;  2F4E A;  1W1Y A;  2YAJ B;  5U47 A;  3RME A;  4ZPT R;  2M3O W;  3WL0 A;  1E44 A;  2LGO A;  2Y78 A;  5DF0 A;  5HKG A;  2KXQ A;  1W9V A;  2PV2 A;  2JZV A;  1J4H A;  3QOK A;  2ETN A;  2QF8 A;  4ODP A;  2L2S A;  4N19 A;  1NMV A;  3LUO A;  2YBU A;  2MNT A;  1H0G A;  1ROT A;  1B6C A;  3CZ8 A;  1N1A A;  2DT0 A;  2PPO A;  4O2T A;  1J4R A;  4NNR A;  4DRO A;  4DWS B;  3MCB B;  3ARZ A;  4ZPW R;  1HJX A;  3O5R A;  4LAX A;  2A3A A;  1C9H A;  1LL4 A;  1FKF A;  1FKT A;  2RUR A;  4XAK A;  4GIV A;  4MSP A;  1W26 A;  4MNM A;  1GRJ A;  3I6C A;  4JFL A;  4DT4 A;  4ODO A;  3O5O A;  2XP4 A;  1QZ2 A;  2VN1 A;  3WQW A;  2YSH A;  4QT3 A;  2B5U B;  4MTV A;  2DSU A;  3O5L A;  1J6Y A;  2M8I A;  1RD6 A;  3KAF A;  4NZC A;  1TR8 A;  2XP6 A;  4JYS A;  2ZR5 A;  4ML4 A;  4G2P A;  1R9H A;  2YBT A;  4GGQ A;  2DPE A;  1H0I A;  4QIB A;  2WAD A;  3JYJ A;  4ODL A;  2DJY A;  3VAW A;  3AS0 A;  4WIW A;  4DH0 A;  2DSZ A;  1WB0 A;  2WLZ A;  3UI6 A;  4DRK A;  1EYM A;  1EQ3 A;  1WR7 A;  1WMV A;  3CHF A;  3OA5 A;  1D7I A;  4JFI A;  1FKS A;  3GU0 A;  3O5J A;  3O5D A;  5I98 A;  2XPA A;  2JV4 A;  3FSB A;  4AY1 A;  4Z2H A;  2AOS A;  1TK7 A;  1FFR A;  5D75 A;  1BL4 A;  3B9D A;  3G6M A;  4JFJ A;  4DRH A;  3OOB A;  2M1I A;  1FKH A;  4DWS C;  1WNO A;  2E45 A;  1QPL A;  4IQ2 A;  3H9R B;  1LJY A;  2G8Z A;  5HWC A;  2F21 A;  2D9F A;  3KCE A;  5AHT A;  1IX5 A;  2O92 A;  4R0X A;  4WKF A;  1ITX A;  1EDQ A;  3UQI A;  1FLC A;  1KFW A;  1HKK A;  2PI6 A;  3JXV A;  2ZQT A;  1D6O A;  1FKJ A;  3KZ7 A;  1K9Q A;  3ARV A;  4Z2G A;  1HKI A;  1ZBC A;  4FAP A;  3KAG A;  1W1T A;  2P4V A;  2M8J A;  3O5M A;  1M5Y A;  5DIU A;  1UR8 A;  2BA1 A;  5GPR A;  1EG4 A;  2Q5A A;  1Q6I A;  1FKI A;  4UDM A;  1GOI A;  2ZQV A;  1W9P A;  1EG3 A;  2LJ4 A;  1Q1C A;  4ODM A;  5HT1 A;  4J4O A;  2VCD A;  1U79 A; 
#chains in the Genus database with same CATH homology
 4ODN A;  1XRV A;  2MF9 A;  4S3J A;  1NWT A;  1E6N A;  3IKG A;  5J6E A;  4W5U A;  1SYT A;  4DRI A;  2RUQ A;  2DT1 A;  3O5I A;  3UI5 A;  2K8I A;  2PBC A;  2ZR6 A;  4TX0 A;  4DIP A;  2UZ5 A;  4TNS A;  2QRV A;  3WD0 A;  4Q7N A;  1ZCN A;  2WAE A;  1JNT A;  1X6N A;  2XP3 A;  4WK9 A;  3NRK A;  1LQ0 A;  1YAT A;  3RGC A;  1YW5 A;  2KO7 A;  1W9U A;  3WKZ A;  2DWV A;  2M2A A;  2DT2 A;  4URI A;  1D7H A;  4IPX A;  2DG4 A;  4FN2 A;  1HJV A;  3KAD A;  3AQU A;  4P8U A;  1SR0 A;  2PV3 A;  2KE0 A;  3G6L A;  3ARQ A;  4L72 B;  2YSF A;  3ODK A;  1NH6 A;  3CHC A;  5DEZ A;  3UQA A;  3BXW A;  1NWS A;  4WKH A;  3ALF A;  4NSB A;  4WJX A;  4MAV A;  4MGV A;  1GUV A;  2ZR4 A;  1FKB A;  3PR9 A;  2DG9 A;  5HW6 A;  4HAR A;  4P8V A;  1NWR A;  3WD4 A;  4ODK A;  4U84 A;  3WQV A;  5HBF A;  4DZ2 A;  4A0T A;  3ARP A;  4DRM A;  1BKF A;  1QPF A;  4IT6 A;  4A0U A;  1I5H W;  2Y8N B;  3KAI A;  5E62 A;  5DIV A;  3B7X A;  2YSI A;  1NWU A;  1FJD A;  1OGB A;  2XP8 A;  2A3E A;  2MLX A;  1ZU8 A;  4DRP A;  1P5Q A;  2O9O A;  3M85 A;  4JFK A;  4Z2J A;  1VF8 A;  2IUZ A;  5DIT A;  3PRB A;  1FKD A;  4TYO A;  3RM9 A;  3FY1 A;  3LKX B;  4BF8 A;  2DK7 A;  1XHG A;  1W1V A;  2MLZ A;  2OLH A;  3O5P A;  1FKL A;  2AWG A;  4ODQ A;  2OWO A;  4LAV A;  4P8X A;  4HBE A;  4DRQ A;  1OGG A;  1FD9 A;  4R5E A;  5B8I C;  2ZAJ A;  3EY6 A;  2DG3 A;  3CHE A;  3FXY A;  2YSG A;  3MDY B;  1FKK A;  1TCO C;  2OFN A;  4G50 A;  2WK2 A;  3GPK A;  2A3B A;  1ZK6 A;  1PBK A;  2LKN A;  1ZBV A;  3LKX A;  4REX A;  1CTN A;  4DRN A;  2DT3 A;  3JYM A;  2PPP A;  1KT0 A;  1W1P A;  1F40 A;  3RFW A;  1LG1 A;  1ROU A;  4L3N A;  4HBO A;  3CHD A;  3ARU A;  1RP5 A;  3O5F A;  3PQH A;  3MQG A;  1HKM A;  5HUA A;  1JND A;  1LL6 A;  2EZ5 W;  4U86 A;  2RUC A;  3ARR A;  1Q6U A;  5HWB A;  2RQS A;  2F2D A;  4LAY A;  3WD2 A;  1T11 A;  2L4J A;  1J4I A;  1K9T A;  2KGJ A;  2FDM A;  1JVW A;  1O6W A;  2KI3 A;  3NTP A;  1X6L A;  1HKJ A;  4DWS D;  3ARO A;  5E66 A;  3RM4 A;  4W9P A;  2M08 A;  5E5W A;  5HW7 A;  1D7J A;  2KFW A;  1NSG A;  1F8A B;  2B31 A;  3ART A;  5GPG A;  2MDI A;  1E6P A;  3LE4 A;  2N87 A;  2JX8 A;  2XP5 A;  4U85 A;  1JMQ A;  2KR7 A;  4IQC A;  2ZQU A;  3IHZ A;  3IK8 A;  2JMF A;  2FAP A;  3B9A A;  1LG2 A;  3CNG A;  5E65 A;  2DMV A;  4ZS6 A;  5GQB A;  4QT2 A;  4Z2K A;  1HJW A;  3AS3 A;  3O5K A;  1E6R A;  2LPV A;  3AS1 A;  3WD1 A;  1LL7 A;  4MPK A;  3NI6 A;  4ITZ A;  1EHN A;  1HXV A;  1FKR A;  2XPB A;  1E9L A;  3FS8 A;  2IF4 A;  4W9Q A;  4DZ3 A;  4MNJ A;  1FFQ A;  4ZPV R;  5HW8 A;  1D2K A;  4LAW A;  5DO2 A;  3AS2 A;  3B9E A;  3UF8 A;  5E64 A;  4C02 B;  3RM8 A;  3M7N A;  4MNL A;  1JNE A;  3ARS A;  3WIJ A;  2ITK A;  1ZBW A;  3ARW A;  1FKG A;  3CH9 A;  1A7X A;  2YSB A;  1ZBK A;  3W4R A;  1WAW A;  5HTG A;  2FKE A;  4QZV B;  2MLY A;  1NMW A;  3ARY A;  1Q6H A;  4DWS A;  3WL1 A;  1EIB A;  1KT1 A;  3MCB A;  3PA7 A;  4E5R A;  1JNS A;  2DSW A;  1E15 A;  3ARX A;  2LAJ A;  4JFM A;  1L1P A;  4P8W A;  3MQH A;  3WD3 A;  4MNK A;  3TDB A;  2DSV A;  4J4N A;  3PRA A;  4Z2L A;  5BXJ A;  3WH0 A;  3CGM A;  2PV1 A;  1O6I A;  4ODR A;  4TW6 A;  2ESC A;  4Q22 A;  4WKA A;  1UR9 A;  1Y0O A;  1ZL1 A;  3FSC A;  3TC5 A;  2DK1 A;  1OWQ A;  3UQB A;  2A3C A;  1E6Z A;  5CQ2 A;  3O5Q A;  3O5G A;  2WLY A;  4TW8 A;  4S3K A;  3L4H A;  1FAP A;  4GLX A;  2XP9 A;  3KAB A;  3KAH A;  4PTM A;  2WM0 A;  4Z2I A;  3FAP A;  1ZB5 A;  2MPH A;  3UI4 A;  3IKD A;  1TFV A;  2RE3 A;  3B8S A;  1PIN A;  2RSE A;  3ALG A;  3CGN A;  3O5E A;  3TCZ A;  4KR0 B;  4LGX A;  4DRJ A;  1K9R A;  4TW7 A;  3PRD A;  4IT4 A;  4KQZ A;  2G41 A;  2RUD A;  5JH8 A;  2PPN A;  1GPF A;  4W9O A;  3KAC A;  2JXW A;  2ZQS A;  2XP7 A;  2F4E A;  1W1Y A;  2YAJ B;  5U47 A;  3RME A;  4ZPT R;  2M3O W;  3WL0 A;  2LGO A;  2Y78 A;  5DF0 A;  5HKG A;  2KXQ A;  1W9V A;  2PV2 A;  2JZV A;  1J4H A;  3QOK A;  2QF8 A;  4ODP A;  2L2S A;  4N19 A;  1NMV A;  3LUO A;  2YBU A;  2MNT A;  1H0G A;  1ROT A;  1B6C A;  3CZ8 A;  1N1A A;  2DT0 A;  2PPO A;  4O2T A;  1J4R A;  4NNR A;  4DRO A;  4DWS B;  3MCB B;  3ARZ A;  4ZPW R;  1HJX A;  3O5R A;  4LAX A;  2A3A A;  1C9H A;  1LL4 A;  1FKF A;  1FKT A;  2RUR A;  4XAK A;  4GIV A;  4MSP A;  1W26 A;  4MNM A;  3I6C A;  4JFL A;  4DT4 A;  4ODO A;  3O5O A;  2XP4 A;  1QZ2 A;  2VN1 A;  3WQW A;  2YSH A;  4QT3 A;  4MTV A;  2DSU A;  3O5L A;  1J6Y A;  2M8I A;  1RD6 A;  3KAF A;  4NZC A;  1TR8 A;  2XP6 A;  4JYS A;  2ZR5 A;  4ML4 A;  4G2P A;  1R9H A;  2YBT A;  4GGQ A;  2DPE A;  1H0I A;  4QIB A;  2WAD A;  3JYJ A;  4ODL A;  2DJY A;  3VAW A;  3AS0 A;  4WIW A;  4DH0 A;  2DSZ A;  1WB0 A;  2WLZ A;  3UI6 A;  4DRK A;  1EYM A;  1EQ3 A;  1WR7 A;  1WMV A;  3CHF A;  3OA5 A;  1D7I A;  4JFI A;  1FKS A;  3O5J A;  3O5D A;  5I98 A;  2XPA A;  2JV4 A;  3FSB A;  4AY1 A;  4Z2H A;  2AOS A;  1TK7 A;  1FFR A;  5D75 A;  1BL4 A;  3B9D A;  3G6M A;  4JFJ A;  4DRH A;  3OOB A;  2M1I A;  1FKH A;  4DWS C;  1WNO A;  2E45 A;  1QPL A;  4IQ2 A;  3H9R B;  1LJY A;  2G8Z A;  5HWC A;  2F21 A;  2D9F A;  3KCE A;  5AHT A;  1IX5 A;  2O92 A;  4R0X A;  4WKF A;  1ITX A;  1EDQ A;  3UQI A;  1FLC A;  1KFW A;  1HKK A;  2PI6 A;  3JXV A;  2ZQT A;  1D6O A;  1FKJ A;  3KZ7 A;  1K9Q A;  3ARV A;  4Z2G A;  1HKI A;  1ZBC A;  4FAP A;  3KAG A;  1W1T A;  2M8J A;  3O5M A;  1M5Y A;  5DIU A;  1UR8 A;  2BA1 A;  5GPR A;  1EG4 A;  2Q5A A;  1Q6I A;  1FKI A;  1GOI A;  2ZQV A;  1W9P A;  1EG3 A;  2LJ4 A;  1Q1C A;  4ODM A;  5HT1 A;  4J4O A;  2VCD A;  1U79 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...