3NTPA

Human pin1 complexed with reduced amide inhibitor
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
158
structure length
147
Chain Sequence
KLPPGWEKAMSRSSGRVYYFNHITNASQWERPSGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title A reduced-amide inhibitor of Pin1 binds in a conformation resembling a twisted-amide transition state.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/isomerase inhibitor
total genus 46
structure length 147
sequence length 158
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3ntpA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3ntpA02
2RURA 5AHTA 3CGNA 3LE4A 2UZ5A 2DWVA 1Y0OA 5I98A 1EG4A 4JFIA 4ODOA 3O5IA 2DJYA 2F21A 3O5GA 1PINA 1F8AB 4IQ2A 2ZQSA 3IHZA 4J4OA 4J4NA 1YATA 2ZQUA 5HUAA 2RUQA 4U86A 4W9OA 3KAIA 5HKGA 1NMWA 2LAJA 1FKJA 2M08A 1A7XA 4JFKA 2DG9A 2RE3A 2EZ5W 3FAPA 3MDYB 5BXJA 3NTPA 2LJ4A 1Q6UA 3L4HA 2YSHA 2XP4A 2Q5AA 1L1PA 2RUCA 3UF8A 1FAPA 2N87A 2XP6A 2KFWA 2KO7A 2JXWA 4MSPA 2DK7A 3UQBA 2ZAJA 3O5QA 2LGOA 3UI5A 1F40A 2MDIA 1P5QA 2VN1A 4MGVA 4GIVA 5DIUA 2MF9A 1FKIA 4N19A 2XPBA 2ZQVA 4W9QA 2DMVA 2PV3A 1D6OA 1K9RA 5DIVA 1FKGA 5GPGA 1M5YA 3O5RA 4DRPA 1J4IA 3KAGA 3KZ7A 2DG4A 1QZ2A 5HW8A 1Q6IA 4ODLA 4LAYA 2MLYA 4ODNA 1BL4A 3CGMA 2M1IA 2D9FA 4E5RA 2Y78A 1ROTA 3B7XA 2RSEA 4REXA 4G2PA 1FKDA 1ZK6A 3O5MA 4JFLA 3JXVA 4ITZA 4JFJA 3H9RB 2KI3A 1D7HA 2DG3A 1ROUA 3O5FA 1TK7A 3KABA 2JX8A 1KT0A 2MPHA 4QIBA 1NMVA 4ODPA 4TNSA 4ODRA 3KAHA 3TCZA 1WMVA 2ZR4A 1ZCNA 2LKNA 5DITA 4O2TA 3OOBA 2JMFA 4FN2A 3CNGA 2OFNA 4TYOA 1J4HA 1WR7A 3RFWA 4LAWA 3TC5A 1FKSA 3PA7A 1T11A 4ODKA 2MNTA 4U85A 2YSBA 2FAPA 1TCOC 2PPPA 1FD9A 4DROA 4DRKA 3NI6A 4G50A 4ODMA 2F4EA 2M3OW 3M85A 4IQCA 2MLXA 1FKRA 4NNRA 2ITKA 2RQSA 4TW8A 5HWBA 1I5HW 3O5PA 2JV4A 1JNSA 2M8IA 5HTGA 5J6EA 4TW6A 2PV2A 4DH0A 3PRDA 1FKLA 2ZQTA 1KT1A 1O6WA 2LPVA 3KACA 1JNTA 1BKFA 2YSFA 3UQIA 2XP3A 2PBCA 3O5LA 3UQAA 4DZ3A 2JZVA 1FJDA 1Q6HA 1J6YA 2MLZA 2PPOA 4DRMA 1R9HA 3I6CA 2F2DA 1EQ3A 3LUOA 3ODKA 2KE0A 3O5KA 2XPAA 1FKKA 3IK8A 4QT3A 2M2AA 2FKEA 4TW7A 1B6CA 2DK1A 4ODQA 1JVWA 4C02B 3O5OA 1JMQA 1FKBA 2L4JA 4DT4A 4DRQA 4FAPA 5HT1A 4DRHA 4R0XA 1EYMA 1FKTA 3PRBA 3NRKA 4LAXA 1K9QA 4GGQA 1FKHA 3KAFA 3UI4A 1U79A 3O5JA 4W9PA 2IF4A 2KGJA 1W26A 4DRJA 4DZ2A 5HWCA 1QPLA 5CQ2A 4JYSA 2XP8A 2AWGA 5B8IC 4IPXA 4TX0A 3GPKA 2YSGA 2PV1A 2VCDA 1C9HA 1J4RA 4LAVA 2KXQA 5D75A 2XP9A 3JYMA 3WH0A 3JYJA 1N1AA 3VAWA 2BA1A 1HXVA 5HW6A 3TDBA 2ZR6A 3M7NA 2ZR5A 1Q1CA 5HW7A 3KCEA 2XP5A 2PPNA 3O5DA 2K8IA 4U84A 4DRIA 2YSIA 2XP7A 4DRNA 4JFMA 2RUDA 1EG3A 1YW5A 2L2SA 1D7IA 3IKDA 1PBKA 1NSGA 1FKFA 3IKGA 3RGCA 3KADA 4BF8A 1D7JA 4QT2A 3UI6A 3EY6A 1QPFA 2M8JA 2KR7A 4DIPA 3O5EA 2E45A
chains in the Genus database with same CATH superfamily
1HKKA 2RURA 3WD1A 5AHTA 3ARXA 3CGNA 3LE4A 1FFRA 2UZ5A 3PRAA 2DWVA 1Y0OA 5I98A 1EG4A 3ARUA 3PQHA 4JFIA 4ODOA 3O5IA 2DJYA 3CHFA 2WADA 2F21A 2A3AA 3O5GA 1PINA 1F8AB 4IQ2A 2ZQSA 4Q7NA 3IHZA 4J4OA 3ARVA 4J4NA 1YATA 5E65A 1NWTA 4S3KA 2ZQUA 1GUVA 5HUAA 4IT6A 2RUQA 4U86A 3ALFA 4W5UA 4UDMA 4W9OA 3KAIA 2B31A 3WD3A 5HKGA 1KFWA 1NMWA 3FSCA 2LAJA 1EHNA 1FKJA 2M08A 1A7XA 4JFKA 2DG9A 4DWSA 2RE3A 2EZ5W 1H0IA 3FAPA 5DF0A 1UR9A 1XRVA 3MDYB 5BXJA 3NTPA 4Z2IA 3AROA 2LJ4A 1Q6UA 2ETNA 3L4HA 1TFVA 1E9LA 2YSHA 2XP4A 2DSVA 1HJXA 3FY1A 2Q5AA 1W9VA 1O6IA 1L1PA 3WIJA 2RUCA 3UF8A 3WKZA 1LQ0A 1OGBA 2QF8A 1FAPA 2N87A 2XP6A 2KFWA 2KO7A 3ARPA 2JXWA 2QRVA 1FFQA 2DK7A 4MSPA 4ZS6A 2A3EA 4S3JA 5DO2A 3UQBA 2ZAJA 2P4VA 3B9EA 1OGGA 1RP5A 3B8SA 3O5QA 2LGOA 1WB0A 3UI5A 1F40A 5JH8A 2MDIA 1P5QA 2VN1A 4MPKA 3AQUA 1TR8A 4MGVA 4GIVA 5DIUA 5GPRA 2MF9A 3WQWA 2DPEA 1EIBA 2A3BA 1FKIA 4N19A 2XPBA 3GU0A 2ZQVA 4W9QA 2DMVA 3WL0A 1HJVA 2PV3A 4Z2KA 1D6OA 1K9RA 3B9AA 5DIVA 2WLYA 1FKGA 5GPGA 1M5YA 3O5RA 1NWRA 2O92A 4DRPA 1J4IA 2WM0A 5U47A 4WJXA 3KAGA 3KZ7A 4P8XA 2DG4A 1WAWA 1QZ2A 5HW8A 1Q6IA 4ODLA 4LAYA 2ESCA 2G41A 2MLYA 3EIPA 4ODNA 2WAEA 1W1YA 1BL4A 1NH6A 3CGMA 3ARWA 1WNOA 1JCHB 1ZB5A 4ZPTR 2M1IA 2D9FA 4E5RA 2YBUA 2Y8NB 2Y78A 1ROTA 1ZL1A 3B7XA 2RSEA 4REXA 4G2PA 2O9OA 1FKDA 1HKMA 4WKHA 1ZK6A 3LKXA 3MQGA 3O5MA 3W4RA 4DWSC 4JFLA 2YBTA 3JXVA 4ITZA 4JFJA 1E15A 4QZVB 3H9RB 1W1VA 2A3CA 2KI3A 1D7HA 2DG3A 5E62A 4GLXA 1ROUA 3O5FA 1K9TA 1TK7A 3KABA 1VF8A 1HKIA 2JX8A 1KT0A 3B9DA 2MPHA 3QOKA 4QIBA 3G6MA 2DT0A 1NMVA 2DT2A 4ODPA 4TNSA 3AS1A 2PI6A 4URIA 1E6NA 2PN0A 4ODRA 3AS2A 4DWSB 3KAHA 4WKAA 3FXYA 3TCZA 4Z2JA 1WMVA 1GOIA 2ZR4A 1ZCNA 1FLCA 2LKNA 5DITA 1LG2A 4O2TA 3OOBA 2JMFA 4WKFA 1SYTA 4FN2A 3CNGA 2OFNA 1LL4A 4TYOA 2YAJB 1J4HA 1WR7A 3RFWA 4LAWA 3TC5A 1FKSA 4NSBA 1SR0A 3PA7A 1T11A 4ODKA 2DSWA 2MNTA 4U85A 2YSBA 2FAPA 1TCOC 4ZPVR 2OLHA 1XHGA 2PPPA 1NWUA 1ZBVA 1W1PA 1FD9A 4DROA 4DRKA 3NI6A 1NWSA 4L72B 1OWQA 2AOSA 4G50A 1W1TA 2F4EA 4ODMA 1LG1A 4MNLA 2M3OW 3M85A 4IQCA 1CTNA 1ZBCA 2MLXA 1E6PA 1FKRA 4NNRA 1EDQA 2ITKA 2RQSA 2EULA 4WIWA 4TW8A 5HWBA 1I5HW 3O5PA 2DT3A 3WQVA 2JV4A 1JNSA 4NZCA 4MAVA 2M8IA 5HTGA 5J6EA 4TW6A 2PV2A 4DH0A 1ZBWA 5GQBA 3PRDA 1FKLA 2ZQTA 3ALGA 4A0UA 1KT1A 1O6WA 2LPVA 1X6LA 3KACA 1JNTA 1BKFA 2YSFA 3UQIA 2XP3A 2PBCA 3O5LA 3UQAA 4DZ3A 2JZVA 1FJDA 1Q6HA 3RMEA 4Z2GA 3RM9A 1J6YA 2MLZA 2PPOA 4DRMA 1JNDA 4L3NA 1R9HA 3I6CA 4MNJA 2F2DA 1EQ3A 3LUOA 2DSUA 1HJWA 3WD0A 3ODKA 2KE0A 2FDMA 4HBOA 3O5KA 2XPAA 1HKJA 3LKXB 1FKKA 3IK8A 4QT3A 1ZBKA 3ARSA 2M2AA 2WK2A 2FKEA 4Z2LA 4TW7A 3WD4A 4PTMA 1B6CA 1ITXA 3MQHA 2DK1A 4ODQA 1JVWA 4C02B 3O5OA 4P8WA 1JMQA 4AY1A 1FKBA 3PR9A 4Z2HA 2L4JA 3CHCA 4DT4A 4DRQA 1W9UA 4P8VA 4FAPA 3WL1A 2DT1A 1E44A 3AS3A 3CHEA 5HT1A 3ARYA 4DRHA 4R0XA 1EYMA 3RM4A 4P8UA 3ARRA 1FKTA 3PRBA 3NRKA 1JNEA 4ZPWR 4LAXA 1K9QA 4GGQA 3ARQA 1FKHA 3KAFA 3FSBA 3UI4A 1LJYA 1LL7A 4MTVA 2IUZA 1U79A 1GRJA 4A0TA 3O5JA 4MNKA 4W9PA 2IF4A 4ML4A 3FS8A 2KGJA 1W26A 4DRJA 2OWOA 4DZ2A 5HWCA 1QPLA 5CQ2A 3CH9A 4JYSA 3RM8A 2XP8A 2AWGA 4KR0B 1UR8A 5B8IC 3BMBA 3CHDA 4IPXA 1D2KA 4TX0A 3GPKA 2YSGA 2PV1A 2VCDA 3ARZA 1E6ZA 1C9HA 1J4RA 1E6RA 1W9PA 4LAVA 2KXQA 5D75A 4R5EA 2XP9A 3JYMA 3CZ8A 3WH0A 1X6NA 3JYJA 4WK9A 1N1AA 3GTYX 2WLZA 4HBEA 3VAWA 3BXWA 2BA1A 1HXVA 4LGXA 5HW6A 3TDBA 2DSZA 2ZR6A 3M7NA 5HBFA 1RD6A 2ZR5A 5E64A 3G6LA 1Q1CA 5HW7A 3KCEA 2XP5A 2PPNA 3O5DA 2K8IA 4U84A 2F23A 4DRIA 2YSIA 2XP7A 5E66A 4DRNA 4JFMA 2RUDA 1EG3A 2G8ZA 1IX5A 4IT4A 1YW5A 2L2SA 3MCBA 4KQZA 5DEZA 1D7IA 3MCBB 3IKDA 1ZU8A 3ARTA 1PBKA 4XAKA 1NSGA 1FKFA 2B5UB 3IKGA 4MNMA 3RGCA 1LL6A 1H0GA 3KADA 4BF8A 1D7JA 4Q22A 4QT2A 3UI6A 5E5WA 3EY6A 3OA5A 1QPFA 3AS0A 2M8JA 2KR7A 3WD2A 4DIPA 1GPFA 4HARA 3O5EA 4DWSD 2E45A
chains in the Genus database with same CATH topology
1HKKA 2RURA 3WD1A 5AHTA 3ARXA 3CGNA 3LE4A 1FFRA 2UZ5A 3PRAA 2DWVA 1Y0OA 5I98A 1EG4A 3ARUA 3PQHA 4JFIA 4ODOA 3O5IA 2DJYA 3CHFA 2WADA 2F21A 2A3AA 3O5GA 1PINA 1F8AB 4IQ2A 2ZQSA 4Q7NA 3IHZA 4J4OA 3ARVA 4J4NA 1YATA 5E65A 1NWTA 4S3KA 2ZQUA 1GUVA 5HUAA 4IT6A 2RUQA 4U86A 3ALFA 4W5UA 4W9OA 3KAIA 2B31A 3WD3A 5HKGA 1KFWA 1NMWA 3FSCA 2LAJA 1EHNA 1FKJA 2M08A 1A7XA 4JFKA 2DG9A 4DWSA 2RE3A 2EZ5W 1H0IA 3FAPA 5DF0A 1UR9A 1XRVA 3MDYB 5BXJA 3NTPA 4Z2IA 3AROA 2LJ4A 1Q6UA 3L4HA 1TFVA 1E9LA 2YSHA 2XP4A 2DSVA 1HJXA 3FY1A 2Q5AA 1W9VA 1O6IA 1L1PA 3WIJA 2RUCA 3UF8A 3WKZA 1LQ0A 1OGBA 2QF8A 1FAPA 2N87A 2XP6A 2KFWA 2KO7A 3ARPA 2JXWA 2QRVA 1FFQA 2DK7A 4MSPA 4ZS6A 2A3EA 4S3JA 5DO2A 3UQBA 2ZAJA 3B9EA 1OGGA 1RP5A 3B8SA 3O5QA 2LGOA 1WB0A 3UI5A 1F40A 5JH8A 2MDIA 1P5QA 2VN1A 4MPKA 3AQUA 1TR8A 4MGVA 4GIVA 5DIUA 5GPRA 2MF9A 3WQWA 2DPEA 1EIBA 2A3BA 1FKIA 4N19A 2XPBA 2ZQVA 4W9QA 2DMVA 3WL0A 1HJVA 2PV3A 4Z2KA 1D6OA 1K9RA 3B9AA 5DIVA 2WLYA 1FKGA 5GPGA 1M5YA 3O5RA 1NWRA 2O92A 4DRPA 1J4IA 2WM0A 5U47A 4WJXA 3KAGA 3KZ7A 4P8XA 2DG4A 1WAWA 1QZ2A 5HW8A 1Q6IA 4ODLA 4LAYA 2ESCA 2G41A 2MLYA 4ODNA 2WAEA 1W1YA 1BL4A 1NH6A 3CGMA 3ARWA 1WNOA 1ZB5A 4ZPTR 2M1IA 2D9FA 4E5RA 2YBUA 2Y8NB 2Y78A 1ROTA 1ZL1A 3B7XA 2RSEA 4REXA 4G2PA 2O9OA 1FKDA 1HKMA 4WKHA 1ZK6A 3LKXA 3MQGA 3O5MA 3W4RA 4DWSC 4JFLA 2YBTA 3JXVA 4ITZA 4JFJA 1E15A 4QZVB 3H9RB 1W1VA 2A3CA 2KI3A 1D7HA 2DG3A 5E62A 4GLXA 1ROUA 3O5FA 1K9TA 1TK7A 3KABA 1VF8A 1HKIA 2JX8A 1KT0A 3B9DA 2MPHA 3QOKA 4QIBA 3G6MA 2DT0A 1NMVA 2DT2A 4ODPA 4TNSA 3AS1A 2PI6A 4URIA 1E6NA 4ODRA 3AS2A 4DWSB 3KAHA 4WKAA 3FXYA 3TCZA 4Z2JA 1WMVA 1GOIA 2ZR4A 1ZCNA 1FLCA 2LKNA 5DITA 1LG2A 4O2TA 3OOBA 2JMFA 4WKFA 1SYTA 4FN2A 3CNGA 2OFNA 1LL4A 4TYOA 2YAJB 1J4HA 1WR7A 3RFWA 4LAWA 3TC5A 1FKSA 4NSBA 1SR0A 3PA7A 1T11A 4ODKA 2DSWA 2MNTA 4U85A 2YSBA 2FAPA 1TCOC 4ZPVR 2OLHA 1XHGA 2PPPA 1NWUA 1ZBVA 1W1PA 1FD9A 4DROA 4DRKA 3NI6A 1NWSA 4L72B 1OWQA 2AOSA 4G50A 1W1TA 2F4EA 4ODMA 1LG1A 4MNLA 2M3OW 3M85A 4IQCA 1CTNA 1ZBCA 2MLXA 1E6PA 1FKRA 4NNRA 1EDQA 2ITKA 2RQSA 4WIWA 4TW8A 5HWBA 1I5HW 3O5PA 2DT3A 3WQVA 2JV4A 1JNSA 4NZCA 4MAVA 2M8IA 5HTGA 5J6EA 4TW6A 2PV2A 4DH0A 1ZBWA 5GQBA 3PRDA 1FKLA 2ZQTA 3ALGA 4A0UA 1KT1A 1O6WA 2LPVA 1X6LA 3KACA 1JNTA 1BKFA 2YSFA 3UQIA 2XP3A 2PBCA 3O5LA 3UQAA 4DZ3A 2JZVA 1FJDA 1Q6HA 3RMEA 4Z2GA 3RM9A 1J6YA 2MLZA 2PPOA 4DRMA 1JNDA 4L3NA 1R9HA 3I6CA 4MNJA 2F2DA 1EQ3A 3LUOA 2DSUA 1HJWA 3WD0A 3ODKA 2KE0A 2FDMA 4HBOA 3O5KA 2XPAA 1HKJA 3LKXB 1FKKA 3IK8A 4QT3A 1ZBKA 3ARSA 2M2AA 2WK2A 2FKEA 4Z2LA 4TW7A 3WD4A 4PTMA 1B6CA 1ITXA 3MQHA 2DK1A 4ODQA 1JVWA 4C02B 3O5OA 4P8WA 1JMQA 4AY1A 1FKBA 3PR9A 4Z2HA 2L4JA 3CHCA 4DT4A 4DRQA 1W9UA 4P8VA 4FAPA 3WL1A 2DT1A 3AS3A 3CHEA 5HT1A 3ARYA 4DRHA 4R0XA 1EYMA 3RM4A 4P8UA 3ARRA 1FKTA 3PRBA 3NRKA 1JNEA 4ZPWR 4LAXA 1K9QA 4GGQA 3ARQA 1FKHA 3KAFA 3FSBA 3UI4A 1LJYA 1LL7A 4MTVA 2IUZA 1U79A 4A0TA 3O5JA 4MNKA 4W9PA 2IF4A 4ML4A 3FS8A 2KGJA 1W26A 4DRJA 2OWOA 4DZ2A 5HWCA 1QPLA 5CQ2A 3CH9A 4JYSA 3RM8A 2XP8A 2AWGA 4KR0B 1UR8A 5B8IC 3CHDA 4IPXA 1D2KA 4TX0A 3GPKA 2YSGA 2PV1A 2VCDA 3ARZA 1E6ZA 1C9HA 1J4RA 1E6RA 1W9PA 4LAVA 2KXQA 5D75A 4R5EA 2XP9A 3JYMA 3CZ8A 3WH0A 1X6NA 3JYJA 4WK9A 1N1AA 2WLZA 4HBEA 3VAWA 3BXWA 2BA1A 1HXVA 4LGXA 5HW6A 3TDBA 2DSZA 2ZR6A 3M7NA 5HBFA 1RD6A 2ZR5A 5E64A 3G6LA 1Q1CA 5HW7A 2PPNA 3KCEA 2XP5A 3O5DA 2K8IA 4U84A 4DRIA 2YSIA 2XP7A 5E66A 4DRNA 4JFMA 2RUDA 1EG3A 2G8ZA 1IX5A 4IT4A 1YW5A 2L2SA 3MCBA 4KQZA 5DEZA 1D7IA 3MCBB 3IKDA 1ZU8A 3ARTA 1PBKA 4XAKA 1NSGA 1FKFA 3IKGA 4MNMA 3RGCA 1LL6A 1H0GA 3KADA 4BF8A 1D7JA 4Q22A 4QT2A 3UI6A 5E5WA 3EY6A 3OA5A 1QPFA 3AS0A 2M8JA 2KR7A 3WD2A 4DIPA 1GPFA 4HARA 3O5EA 4DWSD 2E45A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RUR A;  5AHT A;  3CGN A;  3LE4 A;  2UZ5 A;  2DWV A;  1Y0O A;  5I98 A;  1EG4 A;  4JFI A;  4ODO A;  3O5I A;  2DJY A;  2F21 A;  3O5G A;  1PIN A;  1F8A B;  4IQ2 A;  2ZQS A;  3IHZ A;  4J4O A;  4J4N A;  1YAT A;  2ZQU A;  5HUA A;  2RUQ A;  4U86 A;  4W9O A;  3KAI A;  5HKG A;  1NMW A;  2LAJ A;  1FKJ A;  2M08 A;  1A7X A;  4JFK A;  2DG9 A;  2RE3 A;  2EZ5 W;  3FAP A;  3MDY B;  5BXJ A;  3NTP A;  2LJ4 A;  1Q6U A;  3L4H A;  2YSH A;  2XP4 A;  2Q5A A;  1L1P A;  2RUC A;  3UF8 A;  1FAP A;  2N87 A;  2XP6 A;  2KFW A;  2KO7 A;  2JXW A;  4MSP A;  2DK7 A;  3UQB A;  2ZAJ A;  3O5Q A;  2LGO A;  3UI5 A;  1F40 A;  2MDI A;  1P5Q A;  2VN1 A;  4MGV A;  4GIV A;  5DIU A;  2MF9 A;  1FKI A;  4N19 A;  2XPB A;  2ZQV A;  4W9Q A;  2DMV A;  2PV3 A;  1D6O A;  1K9R A;  5DIV A;  1FKG A;  5GPG A;  1M5Y A;  3O5R A;  4DRP A;  1J4I A;  3KAG A;  3KZ7 A;  2DG4 A;  1QZ2 A;  5HW8 A;  1Q6I A;  4ODL A;  4LAY A;  2MLY A;  4ODN A;  1BL4 A;  3CGM A;  2M1I A;  2D9F A;  4E5R A;  2Y78 A;  1ROT A;  3B7X A;  2RSE A;  4REX A;  4G2P A;  1FKD A;  1ZK6 A;  3O5M A;  4JFL A;  3JXV A;  4ITZ A;  4JFJ A;  3H9R B;  2KI3 A;  1D7H A;  2DG3 A;  1ROU A;  3O5F A;  1TK7 A;  3KAB A;  2JX8 A;  1KT0 A;  2MPH A;  4QIB A;  1NMV A;  4ODP A;  4TNS A;  4ODR A;  3KAH A;  3TCZ A;  1WMV A;  2ZR4 A;  1ZCN A;  2LKN A;  5DIT A;  4O2T A;  3OOB A;  2JMF A;  4FN2 A;  3CNG A;  2OFN A;  4TYO A;  1J4H A;  1WR7 A;  3RFW A;  4LAW A;  3TC5 A;  1FKS A;  3PA7 A;  1T11 A;  4ODK A;  2MNT A;  4U85 A;  2YSB A;  2FAP A;  1TCO C;  2PPP A;  1FD9 A;  4DRO A;  4DRK A;  3NI6 A;  4G50 A;  4ODM A;  2F4E A;  2M3O W;  3M85 A;  4IQC A;  2MLX A;  1FKR A;  4NNR A;  2ITK A;  2RQS A;  4TW8 A;  5HWB A;  1I5H W;  3O5P A;  2JV4 A;  1JNS A;  2M8I A;  5HTG A;  5J6E A;  4TW6 A;  2PV2 A;  4DH0 A;  3PRD A;  1FKL A;  2ZQT A;  1KT1 A;  1O6W A;  2LPV A;  3KAC A;  1JNT A;  1BKF A;  2YSF A;  3UQI A;  2XP3 A;  2PBC A;  3O5L A;  3UQA A;  4DZ3 A;  2JZV A;  1FJD A;  1Q6H A;  1J6Y A;  2MLZ A;  2PPO A;  4DRM A;  1R9H A;  3I6C A;  2F2D A;  1EQ3 A;  3LUO A;  3ODK A;  2KE0 A;  3O5K A;  2XPA A;  1FKK A;  3IK8 A;  4QT3 A;  2M2A A;  2FKE A;  4TW7 A;  1B6C A;  2DK1 A;  4ODQ A;  1JVW A;  4C02 B;  3O5O A;  1JMQ A;  1FKB A;  2L4J A;  4DT4 A;  4DRQ A;  4FAP A;  5HT1 A;  4DRH A;  4R0X A;  1EYM A;  1FKT A;  3PRB A;  3NRK A;  4LAX A;  1K9Q A;  4GGQ A;  1FKH A;  3KAF A;  3UI4 A;  1U79 A;  3O5J A;  4W9P A;  2IF4 A;  2KGJ A;  1W26 A;  4DRJ A;  4DZ2 A;  5HWC A;  1QPL A;  5CQ2 A;  4JYS A;  2XP8 A;  2AWG A;  5B8I C;  4IPX A;  4TX0 A;  3GPK A;  2YSG A;  2PV1 A;  2VCD A;  1C9H A;  1J4R A;  4LAV A;  2KXQ A;  5D75 A;  2XP9 A;  3JYM A;  3WH0 A;  3JYJ A;  1N1A A;  3VAW A;  2BA1 A;  1HXV A;  5HW6 A;  3TDB A;  2ZR6 A;  3M7N A;  2ZR5 A;  1Q1C A;  5HW7 A;  3KCE A;  2XP5 A;  2PPN A;  3O5D A;  2K8I A;  4U84 A;  4DRI A;  2YSI A;  2XP7 A;  4DRN A;  4JFM A;  2RUD A;  1EG3 A;  1YW5 A;  2L2S A;  1D7I A;  3IKD A;  1PBK A;  1NSG A;  1FKF A;  3IKG A;  3RGC A;  3KAD A;  4BF8 A;  1D7J A;  4QT2 A;  3UI6 A;  3EY6 A;  1QPF A;  2M8J A;  2KR7 A;  4DIP A;  3O5E A;  2E45 A; 
#chains in the Genus database with same CATH topology
 1HKK A;  2RUR A;  3WD1 A;  5AHT A;  3ARX A;  3CGN A;  3LE4 A;  1FFR A;  2UZ5 A;  3PRA A;  2DWV A;  1Y0O A;  5I98 A;  1EG4 A;  3ARU A;  3PQH A;  4JFI A;  4ODO A;  3O5I A;  2DJY A;  3CHF A;  2WAD A;  2F21 A;  2A3A A;  3O5G A;  1PIN A;  1F8A B;  4IQ2 A;  2ZQS A;  4Q7N A;  3IHZ A;  4J4O A;  3ARV A;  4J4N A;  1YAT A;  5E65 A;  1NWT A;  4S3K A;  2ZQU A;  1GUV A;  5HUA A;  4IT6 A;  2RUQ A;  4U86 A;  3ALF A;  4W5U A;  4UDM A;  4W9O A;  3KAI A;  2B31 A;  3WD3 A;  5HKG A;  1KFW A;  1NMW A;  3FSC A;  2LAJ A;  1EHN A;  1FKJ A;  2M08 A;  1A7X A;  4JFK A;  2DG9 A;  4DWS A;  2RE3 A;  2EZ5 W;  1H0I A;  3FAP A;  5DF0 A;  1UR9 A;  1XRV A;  3MDY B;  5BXJ A;  3NTP A;  4Z2I A;  3ARO A;  2LJ4 A;  1Q6U A;  2ETN A;  3L4H A;  1TFV A;  1E9L A;  2YSH A;  2XP4 A;  2DSV A;  1HJX A;  3FY1 A;  2Q5A A;  1W9V A;  1O6I A;  1L1P A;  3WIJ A;  2RUC A;  3UF8 A;  3WKZ A;  1LQ0 A;  1OGB A;  2QF8 A;  1FAP A;  2N87 A;  2XP6 A;  2KFW A;  2KO7 A;  3ARP A;  2JXW A;  2QRV A;  1FFQ A;  2DK7 A;  4MSP A;  4ZS6 A;  2A3E A;  4S3J A;  5DO2 A;  3UQB A;  2ZAJ A;  2P4V A;  3B9E A;  1OGG A;  1RP5 A;  3B8S A;  3O5Q A;  2LGO A;  1WB0 A;  3UI5 A;  1F40 A;  5JH8 A;  2MDI A;  1P5Q A;  2VN1 A;  4MPK A;  3AQU A;  1TR8 A;  4MGV A;  4GIV A;  5DIU A;  5GPR A;  2MF9 A;  3WQW A;  2DPE A;  1EIB A;  2A3B A;  1FKI A;  4N19 A;  2XPB A;  3GU0 A;  2ZQV A;  4W9Q A;  2DMV A;  3WL0 A;  1HJV A;  2PV3 A;  4Z2K A;  1D6O A;  1K9R A;  3B9A A;  5DIV A;  2WLY A;  1FKG A;  5GPG A;  1M5Y A;  3O5R A;  1NWR A;  2O92 A;  4DRP A;  1J4I A;  2WM0 A;  5U47 A;  4WJX A;  3KAG A;  3KZ7 A;  4P8X A;  2DG4 A;  1WAW A;  1QZ2 A;  5HW8 A;  1Q6I A;  4ODL A;  4LAY A;  2ESC A;  2G41 A;  2MLY A;  3EIP A;  4ODN A;  2WAE A;  1W1Y A;  1BL4 A;  1NH6 A;  3CGM A;  3ARW A;  1WNO A;  1JCH B;  1ZB5 A;  4ZPT R;  2M1I A;  2D9F A;  4E5R A;  2YBU A;  2Y8N B;  2Y78 A;  1ROT A;  1ZL1 A;  3B7X A;  2RSE A;  4REX A;  4G2P A;  2O9O A;  1FKD A;  1HKM A;  4WKH A;  1ZK6 A;  3LKX A;  3MQG A;  3O5M A;  3W4R A;  4DWS C;  4JFL A;  2YBT A;  3JXV A;  4ITZ A;  4JFJ A;  1E15 A;  4QZV B;  3H9R B;  1W1V A;  2A3C A;  2KI3 A;  1D7H A;  2DG3 A;  5E62 A;  4GLX A;  1ROU A;  3O5F A;  1K9T A;  1TK7 A;  3KAB A;  1VF8 A;  1HKI A;  2JX8 A;  1KT0 A;  3B9D A;  2MPH A;  3QOK A;  4QIB A;  3G6M A;  2DT0 A;  1NMV A;  2DT2 A;  4ODP A;  4TNS A;  3AS1 A;  2PI6 A;  4URI A;  1E6N A;  2PN0 A;  4ODR A;  3AS2 A;  4DWS B;  3KAH A;  4WKA A;  3FXY A;  3TCZ A;  4Z2J A;  1WMV A;  1GOI A;  2ZR4 A;  1ZCN A;  1FLC A;  2LKN A;  5DIT A;  1LG2 A;  4O2T A;  3OOB A;  2JMF A;  4WKF A;  1SYT A;  4FN2 A;  3CNG A;  2OFN A;  1LL4 A;  4TYO A;  2YAJ B;  1J4H A;  1WR7 A;  3RFW A;  4LAW A;  3TC5 A;  1FKS A;  4NSB A;  1SR0 A;  3PA7 A;  1T11 A;  4ODK A;  2DSW A;  2MNT A;  4U85 A;  2YSB A;  2FAP A;  1TCO C;  4ZPV R;  2OLH A;  1XHG A;  2PPP A;  1NWU A;  1ZBV A;  1W1P A;  1FD9 A;  4DRO A;  4DRK A;  3NI6 A;  1NWS A;  4L72 B;  1OWQ A;  2AOS A;  4G50 A;  1W1T A;  2F4E A;  4ODM A;  1LG1 A;  4MNL A;  2M3O W;  3M85 A;  4IQC A;  1CTN A;  1ZBC A;  2MLX A;  1E6P A;  1FKR A;  4NNR A;  1EDQ A;  2ITK A;  2RQS A;  2EUL A;  4WIW A;  4TW8 A;  5HWB A;  1I5H W;  3O5P A;  2DT3 A;  3WQV A;  2JV4 A;  1JNS A;  4NZC A;  4MAV A;  2M8I A;  5HTG A;  5J6E A;  4TW6 A;  2PV2 A;  4DH0 A;  1ZBW A;  5GQB A;  3PRD A;  1FKL A;  2ZQT A;  3ALG A;  4A0U A;  1KT1 A;  1O6W A;  2LPV A;  1X6L A;  3KAC A;  1JNT A;  1BKF A;  2YSF A;  3UQI A;  2XP3 A;  2PBC A;  3O5L A;  3UQA A;  4DZ3 A;  2JZV A;  1FJD A;  1Q6H A;  3RME A;  4Z2G A;  3RM9 A;  1J6Y A;  2MLZ A;  2PPO A;  4DRM A;  1JND A;  4L3N A;  1R9H A;  3I6C A;  4MNJ A;  2F2D A;  1EQ3 A;  3LUO A;  2DSU A;  1HJW A;  3WD0 A;  3ODK A;  2KE0 A;  2FDM A;  4HBO A;  3O5K A;  2XPA A;  1HKJ A;  3LKX B;  1FKK A;  3IK8 A;  4QT3 A;  1ZBK A;  3ARS A;  2M2A A;  2WK2 A;  2FKE A;  4Z2L A;  4TW7 A;  3WD4 A;  4PTM A;  1B6C A;  1ITX A;  3MQH A;  2DK1 A;  4ODQ A;  1JVW A;  4C02 B;  3O5O A;  4P8W A;  1JMQ A;  4AY1 A;  1FKB A;  3PR9 A;  4Z2H A;  2L4J A;  3CHC A;  4DT4 A;  4DRQ A;  1W9U A;  4P8V A;  4FAP A;  3WL1 A;  2DT1 A;  1E44 A;  3AS3 A;  3CHE A;  5HT1 A;  3ARY A;  4DRH A;  4R0X A;  1EYM A;  3RM4 A;  4P8U A;  3ARR A;  1FKT A;  3PRB A;  3NRK A;  1JNE A;  4ZPW R;  4LAX A;  1K9Q A;  4GGQ A;  3ARQ A;  1FKH A;  3KAF A;  3FSB A;  3UI4 A;  1LJY A;  1LL7 A;  4MTV A;  2IUZ A;  1U79 A;  1GRJ A;  4A0T A;  3O5J A;  4MNK A;  4W9P A;  2IF4 A;  4ML4 A;  3FS8 A;  2KGJ A;  1W26 A;  4DRJ A;  2OWO A;  4DZ2 A;  5HWC A;  1QPL A;  5CQ2 A;  3CH9 A;  4JYS A;  3RM8 A;  2XP8 A;  2AWG A;  4KR0 B;  1UR8 A;  5B8I C;  3BMB A;  3CHD A;  4IPX A;  1D2K A;  4TX0 A;  3GPK A;  2YSG A;  2PV1 A;  2VCD A;  3ARZ A;  1E6Z A;  1C9H A;  1J4R A;  1E6R A;  1W9P A;  4LAV A;  2KXQ A;  5D75 A;  4R5E A;  2XP9 A;  3JYM A;  3CZ8 A;  3WH0 A;  1X6N A;  3JYJ A;  4WK9 A;  1N1A A;  3GTY X;  2WLZ A;  4HBE A;  3VAW A;  3BXW A;  2BA1 A;  1HXV A;  4LGX A;  5HW6 A;  3TDB A;  2DSZ A;  2ZR6 A;  3M7N A;  5HBF A;  1RD6 A;  2ZR5 A;  5E64 A;  3G6L A;  1Q1C A;  5HW7 A;  3KCE A;  2XP5 A;  2PPN A;  3O5D A;  2K8I A;  4U84 A;  2F23 A;  4DRI A;  2YSI A;  2XP7 A;  5E66 A;  4DRN A;  4JFM A;  2RUD A;  1EG3 A;  2G8Z A;  1IX5 A;  4IT4 A;  1YW5 A;  2L2S A;  3MCB A;  4KQZ A;  5DEZ A;  1D7I A;  3MCB B;  3IKD A;  1ZU8 A;  3ART A;  1PBK A;  4XAK A;  1NSG A;  1FKF A;  2B5U B;  3IKG A;  4MNM A;  3RGC A;  1LL6 A;  1H0G A;  3KAD A;  4BF8 A;  1D7J A;  4Q22 A;  4QT2 A;  3UI6 A;  5E5W A;  3EY6 A;  3OA5 A;  1QPF A;  3AS0 A;  2M8J A;  2KR7 A;  3WD2 A;  4DIP A;  1GPF A;  4HAR A;  3O5E A;  4DWS D;  2E45 A; 
#chains in the Genus database with same CATH homology
 1HKK A;  2RUR A;  3WD1 A;  5AHT A;  3ARX A;  3CGN A;  3LE4 A;  1FFR A;  2UZ5 A;  3PRA A;  2DWV A;  1Y0O A;  5I98 A;  1EG4 A;  3ARU A;  3PQH A;  4JFI A;  4ODO A;  3O5I A;  2DJY A;  3CHF A;  2WAD A;  2F21 A;  2A3A A;  3O5G A;  1PIN A;  1F8A B;  4IQ2 A;  2ZQS A;  4Q7N A;  3IHZ A;  4J4O A;  3ARV A;  4J4N A;  1YAT A;  5E65 A;  1NWT A;  4S3K A;  2ZQU A;  1GUV A;  5HUA A;  4IT6 A;  2RUQ A;  4U86 A;  3ALF A;  4W5U A;  4W9O A;  3KAI A;  2B31 A;  3WD3 A;  5HKG A;  1KFW A;  1NMW A;  3FSC A;  2LAJ A;  1EHN A;  1FKJ A;  2M08 A;  1A7X A;  4JFK A;  2DG9 A;  4DWS A;  2RE3 A;  2EZ5 W;  1H0I A;  3FAP A;  5DF0 A;  1UR9 A;  1XRV A;  3MDY B;  5BXJ A;  3NTP A;  4Z2I A;  3ARO A;  2LJ4 A;  1Q6U A;  3L4H A;  1TFV A;  1E9L A;  2YSH A;  2XP4 A;  2DSV A;  1HJX A;  3FY1 A;  2Q5A A;  1W9V A;  1O6I A;  1L1P A;  3WIJ A;  2RUC A;  3UF8 A;  3WKZ A;  1LQ0 A;  1OGB A;  2QF8 A;  1FAP A;  2N87 A;  2XP6 A;  2KFW A;  2KO7 A;  3ARP A;  2JXW A;  2QRV A;  1FFQ A;  2DK7 A;  4MSP A;  4ZS6 A;  2A3E A;  4S3J A;  5DO2 A;  3UQB A;  2ZAJ A;  3B9E A;  1OGG A;  1RP5 A;  3B8S A;  3O5Q A;  2LGO A;  1WB0 A;  3UI5 A;  1F40 A;  5JH8 A;  2MDI A;  1P5Q A;  2VN1 A;  4MPK A;  3AQU A;  1TR8 A;  4MGV A;  4GIV A;  5DIU A;  5GPR A;  2MF9 A;  3WQW A;  2DPE A;  1EIB A;  2A3B A;  1FKI A;  4N19 A;  2XPB A;  2ZQV A;  4W9Q A;  2DMV A;  3WL0 A;  1HJV A;  2PV3 A;  4Z2K A;  1D6O A;  1K9R A;  3B9A A;  5DIV A;  2WLY A;  1FKG A;  5GPG A;  1M5Y A;  3O5R A;  1NWR A;  2O92 A;  4DRP A;  1J4I A;  2WM0 A;  5U47 A;  4WJX A;  3KAG A;  3KZ7 A;  4P8X A;  2DG4 A;  1WAW A;  1QZ2 A;  5HW8 A;  1Q6I A;  4ODL A;  4LAY A;  2ESC A;  2G41 A;  2MLY A;  4ODN A;  2WAE A;  1W1Y A;  1BL4 A;  1NH6 A;  3CGM A;  3ARW A;  1WNO A;  1ZB5 A;  4ZPT R;  2M1I A;  2D9F A;  4E5R A;  2YBU A;  2Y8N B;  2Y78 A;  1ROT A;  1ZL1 A;  3B7X A;  2RSE A;  4REX A;  4G2P A;  2O9O A;  1FKD A;  1HKM A;  4WKH A;  1ZK6 A;  3LKX A;  3MQG A;  3O5M A;  3W4R A;  4DWS C;  4JFL A;  2YBT A;  3JXV A;  4ITZ A;  4JFJ A;  1E15 A;  4QZV B;  3H9R B;  1W1V A;  2A3C A;  2KI3 A;  1D7H A;  2DG3 A;  5E62 A;  4GLX A;  1ROU A;  3O5F A;  1K9T A;  1TK7 A;  3KAB A;  1VF8 A;  1HKI A;  2JX8 A;  1KT0 A;  3B9D A;  2MPH A;  3QOK A;  4QIB A;  3G6M A;  2DT0 A;  1NMV A;  2DT2 A;  4ODP A;  4TNS A;  3AS1 A;  2PI6 A;  4URI A;  1E6N A;  4ODR A;  3AS2 A;  4DWS B;  3KAH A;  4WKA A;  3FXY A;  3TCZ A;  4Z2J A;  1WMV A;  1GOI A;  2ZR4 A;  1ZCN A;  1FLC A;  2LKN A;  5DIT A;  1LG2 A;  4O2T A;  3OOB A;  2JMF A;  4WKF A;  1SYT A;  4FN2 A;  3CNG A;  2OFN A;  1LL4 A;  4TYO A;  2YAJ B;  1J4H A;  1WR7 A;  3RFW A;  4LAW A;  3TC5 A;  1FKS A;  4NSB A;  1SR0 A;  3PA7 A;  1T11 A;  4ODK A;  2DSW A;  2MNT A;  4U85 A;  2YSB A;  2FAP A;  1TCO C;  4ZPV R;  2OLH A;  1XHG A;  2PPP A;  1NWU A;  1ZBV A;  1W1P A;  1FD9 A;  4DRO A;  4DRK A;  3NI6 A;  1NWS A;  4L72 B;  1OWQ A;  2AOS A;  4G50 A;  1W1T A;  2F4E A;  4ODM A;  1LG1 A;  4MNL A;  2M3O W;  3M85 A;  4IQC A;  1CTN A;  1ZBC A;  2MLX A;  1E6P A;  1FKR A;  4NNR A;  1EDQ A;  2ITK A;  2RQS A;  4WIW A;  4TW8 A;  5HWB A;  1I5H W;  3O5P A;  2DT3 A;  3WQV A;  2JV4 A;  1JNS A;  4NZC A;  4MAV A;  2M8I A;  5HTG A;  5J6E A;  4TW6 A;  2PV2 A;  4DH0 A;  1ZBW A;  5GQB A;  3PRD A;  1FKL A;  2ZQT A;  3ALG A;  4A0U A;  1KT1 A;  1O6W A;  2LPV A;  1X6L A;  3KAC A;  1JNT A;  1BKF A;  2YSF A;  3UQI A;  2XP3 A;  2PBC A;  3O5L A;  3UQA A;  4DZ3 A;  2JZV A;  1FJD A;  1Q6H A;  3RME A;  4Z2G A;  3RM9 A;  1J6Y A;  2MLZ A;  2PPO A;  4DRM A;  1JND A;  4L3N A;  1R9H A;  3I6C A;  4MNJ A;  2F2D A;  1EQ3 A;  3LUO A;  2DSU A;  1HJW A;  3WD0 A;  3ODK A;  2KE0 A;  2FDM A;  4HBO A;  3O5K A;  2XPA A;  1HKJ A;  3LKX B;  1FKK A;  3IK8 A;  4QT3 A;  1ZBK A;  3ARS A;  2M2A A;  2WK2 A;  2FKE A;  4Z2L A;  4TW7 A;  3WD4 A;  4PTM A;  1B6C A;  1ITX A;  3MQH A;  2DK1 A;  4ODQ A;  1JVW A;  4C02 B;  3O5O A;  4P8W A;  1JMQ A;  4AY1 A;  1FKB A;  3PR9 A;  4Z2H A;  2L4J A;  3CHC A;  4DT4 A;  4DRQ A;  1W9U A;  4P8V A;  4FAP A;  3WL1 A;  2DT1 A;  3AS3 A;  3CHE A;  5HT1 A;  3ARY A;  4DRH A;  4R0X A;  1EYM A;  3RM4 A;  4P8U A;  3ARR A;  1FKT A;  3PRB A;  3NRK A;  1JNE A;  4ZPW R;  4LAX A;  1K9Q A;  4GGQ A;  3ARQ A;  1FKH A;  3KAF A;  3FSB A;  3UI4 A;  1LJY A;  1LL7 A;  4MTV A;  2IUZ A;  1U79 A;  4A0T A;  3O5J A;  4MNK A;  4W9P A;  2IF4 A;  4ML4 A;  3FS8 A;  2KGJ A;  1W26 A;  4DRJ A;  2OWO A;  4DZ2 A;  5HWC A;  1QPL A;  5CQ2 A;  3CH9 A;  4JYS A;  3RM8 A;  2XP8 A;  2AWG A;  4KR0 B;  1UR8 A;  5B8I C;  3CHD A;  4IPX A;  1D2K A;  4TX0 A;  3GPK A;  2YSG A;  2PV1 A;  2VCD A;  3ARZ A;  1E6Z A;  1C9H A;  1J4R A;  1E6R A;  1W9P A;  4LAV A;  2KXQ A;  5D75 A;  4R5E A;  2XP9 A;  3JYM A;  3CZ8 A;  3WH0 A;  1X6N A;  3JYJ A;  4WK9 A;  1N1A A;  2WLZ A;  4HBE A;  3VAW A;  3BXW A;  2BA1 A;  1HXV A;  4LGX A;  5HW6 A;  3TDB A;  2DSZ A;  2ZR6 A;  3M7N A;  5HBF A;  1RD6 A;  2ZR5 A;  5E64 A;  3G6L A;  1Q1C A;  5HW7 A;  2PPN A;  3KCE A;  2XP5 A;  3O5D A;  2K8I A;  4U84 A;  4DRI A;  2YSI A;  2XP7 A;  5E66 A;  4DRN A;  4JFM A;  2RUD A;  1EG3 A;  2G8Z A;  1IX5 A;  4IT4 A;  1YW5 A;  2L2S A;  3MCB A;  4KQZ A;  5DEZ A;  1D7I A;  3MCB B;  3IKD A;  1ZU8 A;  3ART A;  1PBK A;  4XAK A;  1NSG A;  1FKF A;  3IKG A;  4MNM A;  3RGC A;  1LL6 A;  1H0G A;  3KAD A;  4BF8 A;  1D7J A;  4Q22 A;  4QT2 A;  3UI6 A;  5E5W A;  3EY6 A;  3OA5 A;  1QPF A;  3AS0 A;  2M8J A;  2KR7 A;  3WD2 A;  4DIP A;  1GPF A;  4HAR A;  3O5E A;  4DWS D;  2E45 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...