3NTPA

Human pin1 complexed with reduced amide inhibitor
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
158
structure length
147
Chain Sequence
KLPPGWEKAMSRSSGRVYYFNHITNASQWERPSGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A reduced-amide inhibitor of Pin1 binds in a conformation resembling a twisted-amide transition state.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/isomerase inhibitor
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 46
structure length 147
sequence length 158
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3ntpA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3ntpA02
5HKGA 1D7IA 5CQ2A 4C02B 2PPPA 2JV4A 3WH0A 3B7XA 1Q6IA 3O5EA 1FKJA 4IQ2A 4IPXA 3O5FA 3NTPA 2PV3A 4ODPA 1F8AB 3KAGA 2ZR4A 2LKNA 3RGCA 2DK7A 3L4HA 1BKFA 1O6WA 5AHTA 1ROTA 2PBCA 3JYJA 3UI5A 1J6YA 1FKSA 2VCDA 5D75A 3O5MA 1ZK6A 4DRNA 1FAPA 2KI3A 2JMFA 4FN2A 3KAHA 3UQIA 1L1PA 3O5RA 2KXQA 1C9HA 3FAPA 4G2PA 4DRHA 3KCEA 5HTGA 1I5HW 2EZ5W 1A7XA 1FKBA 4O2TA 5DIUA 2F4EA 2E45A 3CNGA 1FKHA 1FKKA 4JFIA 1QPLA 2RUCA 4GIVA 2MPHA 3IHZA 4JYSA 5DITA 1JVWA 3TCZA 2MLYA 4TW8A 1JNSA 3O5JA 2XP4A 2ZQTA 2RUQA 1TCOC 4MSPA 2IF4A 3I6CA 1KT0A 2M3OW 1D7JA 1Q6UA 4ODOA 4QT3A 2ZR6A 1QPFA 3IKGA 1B6CA 4U84A 2M08A 3O5LA 2L4JA 4LAXA 2XPAA 3MDYB 3UQAA 3VAWA 4J4OA 4TW7A 2PV1A 1N1AA 2PPOA 1EYMA 1WR7A 4JFMA 2YSGA 2MLZA 3JXVA 3O5GA 4JFLA 5HW7A 1J4IA 2ZQUA 4LAWA 4ODQA 3UI6A 5HUAA 2ZR5A 4REXA 1EQ3A 1J4RA 2DK1A 5GPGA 1YATA 3JYMA 3NI6A 1TK7A 3KAFA 4W9OA 3O5OA 1Q6HA 4BF8A 4DZ3A 4U85A 1Y0OA 2FKEA 2LPVA 2DG4A 2F21A 2LGOA 3O5QA 4JFJA 4N19A 2RE3A 1JNTA 2KFWA 4GGQA 1KT1A 4DIPA 2YSHA 4DRQA 3M7NA 4DZ2A 1EG3A 3KAIA 1T11A 3KZ7A 2M1IA 4DRMA 4E5RA 1NSGA 3LUOA 1QZ2A 3IKDA 2XP6A 1FKDA 4J4NA 4ODMA 1FKLA 2DWVA 1W26A 2PPNA 3EY6A 4IQCA 1EG4A 3NRKA 4W9QA 2JZVA 2YSBA 3O5KA 2XP8A 1M5YA 1YW5A 1Q1CA 1P5QA 3IK8A 3KADA 2RURA 2XPBA 1F40A 5I98A 2DMVA 2DJYA 2UZ5A 3UF8A 3TDBA 2MF9A 2RSEA 2Y78A 4TYOA 3CGNA 3UI4A 2ITKA 1WMVA 3O5PA 1PINA 1D7HA 2FAPA 2ZQSA 4ODNA 4DRIA 2JXWA 3H9RB 1FKGA 4LAVA 4DRKA 1HXVA 4MGVA 3UQBA 1K9QA 2KO7A 4DH0A 5HWCA 4TX0A 2K8IA 4FAPA 5J6EA 1FD9A 2XP7A 3O5IA 4ODRA 1PBKA 3ODKA 4NNRA 1FKIA 1FJDA 2MDIA 3M85A 1R9HA 1U79A 1ROUA 2KE0A 2L2SA 2LAJA 3OOBA 1FKFA 2YSFA 2VN1A 3CGMA 3PRBA 3PRDA 5HT1A 4DRJA 4DRPA 4QT2A 2YSIA 3TC5A 4DROA 1NMVA 2KGJA 2XP3A 2MNTA 2M2AA 2M8JA 5DIVA 1JMQA 4TNSA 2OFNA 2MLXA 5HW6A 1FKRA 2DG3A 2ZQVA 3KACA 4U86A 2AWGA 4ODLA 5BXJA 2F2DA 4QIBA 1NMWA 4JFKA 4DT4A 3GPKA 3PA7A 5B8IC 1FKTA 3RFWA 2Q5AA 1K9RA 1BL4A 1ZCNA 4G50A 4LAYA 2BA1A 2PV2A 4TW6A 2XP5A 3O5DA 2ZAJA 2N87A 5HWBA 2JX8A 2DG9A 5HW8A 1J4HA 1D6OA 3LE4A 2D9FA 4ITZA 4W9PA 3KABA 2RUDA 2XP9A 2M8IA 2KR7A 4ODKA 2RQSA 2LJ4A 4R0XA
chains in the Genus database with same CATH superfamily
1LL6A 3CH9A 4C02B 2JV4A 3WH0A 4KR0B 4ODPA 2LKNA 1BKFA 3RM9A 1ZK6A 3ARVA 2KI3A 2JMFA 4FN2A 3KAHA 3UQIA 1ZB5A 2WADA 4DRHA 5HTGA 3QOKA 5DIUA 2DSUA 2F4EA 3CNGA 1FKKA 1W1PA 4LGXA 2MPHA 4JYSA 3MCBA 3PRAA 4HBOA 4R5EA 4P8VA 2B31A 4WIWA 4Z2HA 1FFQA 1KT0A 1E6PA 2FDMA 4ODOA 1B6CA 2DT1A 1SR0A 2L4JA 3RM4A 3MDYB 4ML4A 1H0IA 1WR7A 2YSGA 1W9UA 4Q22A 3LKXA 2ZQUA 1J4IA 4REXA 1EQ3A 1YATA 5E5WA 3KAFA 1HKJA 3O5OA 4WKAA 4U85A 1NWTA 2F23A 4HBEA 4N19A 1NWRA 2KFWA 1E6NA 4GGQA 3M7NA 4DWSD 2DWVA 3NRKA 2YSBA 1ZL1A 3B9DA 2RURA 2XPBA 1F40A 5I98A 2DJYA 3WD2A 1E44A 2MF9A 2Y78A 3WD0A 3PQHA 4TYOA 3OA5A 2DPEA 4ODNA 4DRIA 4UDMA 4LAVA 4MGVA 2O9OA 4MNLA 4TX0A 2K8IA 3WKZA 5J6EA 1FD9A 2A3EA 1PBKA 1FJDA 2MDIA 1FKFA 4DRJA 2WLZA 3WQWA 1GUVA 1O6IA 2A3AA 1JMQA 2OFNA 2DG3A 1UR9A 3G6MA 1NMWA 3PA7A 4S3KA 1FKTA 3RFWA 3WL0A 1EHNA 2PV2A 4TW6A 2XP5A 2ZAJA 1ZBCA 5HWBA 1GRJA 1D6OA 3LE4A 4Z2IA 3ARYA 1ZBKA 3FS8A 1X6LA 2YAJB 3B7XA 3O5EA 4IQ2A 1Q6IA 4ZPVR 3NTPA 4URIA 1NWSA 3RGCA 1K9TA 2DK7A 1FFRA 5AHTA 1TR8A 1GOIA 4DRNA 3O5MA 1L1PA 1FAPA 2ETNA 3WQVA 3O5RA 1C9HA 3KCEA 2EZ5W 2G8ZA 2RUCA 5DITA 3CHCA 2DT2A 1JVWA 3AS1A 1JNSA 2XP4A 2ZQTA 1EDQA 2IF4A 4DWSA 4MTVA 1Q6UA 4QT3A 2ZR6A 1HKIA 2WLYA 1VF8A 4DWSB 2OWOA 4Z2GA 3MQHA 4LAWA 5HUAA 2ZR5A 3CZ8A 2DK1A 3JYMA 1TK7A 4W9OA 4DZ3A 1Y0OA 2FKEA 2LPVA 1H0GA 2F21A 4L72B 2RE3A 2QRVA 4QZVB 3KAIA 1T11A 2M1IA 5E66A 4E5RA 3IKDA 2XP6A 3ARPA 2WAEA 2WK2A 1Q1CA 1ZBVA 1HKMA 5E62A 1LG2A 2UZ5A 3RM8A 3UF8A 2DT0A 2RSEA 2YBUA 1HXVA 3EIPA 1E6ZA 2A3BA 3FY1A 1W1YA 3O5IA 4ODRA 3M85A 1U79A 2VN1A 1XHGA 3OOBA 2YSFA 4DRPA 4QT2A 1OGGA 2KGJA 2MNTA 1LQ0A 2M2AA 4TNSA 4ODLA 4U86A 5BXJA 5DEZA 2F2DA 4QIBA 5GPRA 4DT4A 1K9RA 1ZCNA 4LAYA 2G41A 1E6RA 1ITXA 2N87A 1OWQA 4ITZA 2RUDA 4S3JA 2M8IA 2RQSA 4R0XA 5HKGA 1D7IA 3PR9A 1LL4A 5CQ2A 4IPXA 1UR8A 2IUZA 2PV3A 4MAVA 4DZ2A 3L4HA 1O6WA 3LKXB 1ROTA 1J6YA 3UI5A 1FKSA 2VCDA 5D75A 5GQBA 3UQBA 3FAPA 4G2PA 4O2TA 1WNOA 2E45A 4L3NA 1FKHA 3GTYX 3IHZA 4TW8A 3I6CA 3WL1A 2ESCA 2M3OW 1E9LA 4U84A 2M08A 3O5LA 2XPAA 3ARQA 4J4OA 3ARZA 4P8WA 1X6NA 4Q7NA 4TW7A 1N1AA 4JFMA 3RMEA 4ODQA 4IT6A 1J4RA 3ARXA 5GPGA 3ARWA 1Q6HA 5JH8A 4BF8A 3FSCA 2DG4A 3O5QA 1JNTA 4DIPA 2YSHA 1NH6A 4DRMA 1NSGA 3LUOA 4IT4A 1QZ2A 4J4NA 4W5UA 1FKDA 5DO2A 3EY6A 1W26A 1IX5A 4W9QA 5HBFA 3ALGA 2XP8A 1M5YA 3WD1A 2EULA 3BMBA 3ALFA 4DWSC 2DMVA 3TDBA 3CGNA 3UI4A 2ITKA 5E64A 3O5PA 3B9EA 1D7HA 4MNKA 2ZQSA 2YBTA 2JXWA 3H9RB 4DRKA 2DT3A 1TFVA 1LJYA 4HARA 4FAPA 1KFWA 2XP7A 1W1TA 4ZS6A 3ODKA 4NNRA 2L2SA 3CGMA 4DRQA 3AS3A 4DROA 2YSIA 1ZBWA 2XP3A 5DIVA 2MLXA 1FKRA 2P4VA 3KACA 2AWGA 2O92A 4JFKA 5B8IC 1BL4A 4G50A 1HJWA 2OLHA 5U47A 3O5DA 3B8SA 2JX8A 4KQZA 2DSVA 1J4HA 3FXYA 4ZPTR 4W9PA 3KABA 2XP9A 3WIJA 1RD6A 4AY1A 2B5UB 2PPPA 3WD4A 4A0UA 1FKJA 3CHEA 3GU0A 3O5FA 1OGBA 1F8AB 3KAGA 2ZR4A 2PBCA 3JYJA 1JNDA 3ARRA 5E65A 3AS0A 4WK9A 2WM0A 2KXQA 4P8XA 1W9PA 1LG1A 2DSZA 1I5HW 1A7XA 1FKBA 3CHFA 3W4RA 4JFIA 1QPLA 4GIVA 2MLYA 3TCZA 4ZPWR 3O5JA 3FSBA 2RUQA 1TCOC 4MSPA 1WB0A 1D7JA 1QPFA 3IKGA 4LAXA 1FLCA 3UQAA 3VAWA 2PV1A 2PPOA 1EYMA 1JNEA 3MQGA 3JXVA 2MLZA 1SYTA 3O5GA 4JFLA 5HW7A 3AROA 3B9AA 3UI6A 3NI6A 2LGOA 4JFJA 1GPFA 4MNMA 1KT1A 4WJXA 1EG3A 3MCBB 3KZ7A 3WD3A 4Z2LA 4ODMA 4NSBA 3AS2A 1FKLA 4IQCA 2PPNA 1EG4A 1EIBA 2QF8A 2JZVA 3O5KA 3IK8A 1YW5A 2Y8NB 1P5QA 2AOSA 3KADA 1W9VA 1XRVA 2DSWA 3CHDA 1WMVA 1PINA 2FAPA 4XAKA 4A0TA 1NWUA 1FKGA 1HJXA 4MPKA 1K9QA 2KO7A 2PI6A 4WKFA 4DH0A 5HWCA 5DF0A 4Z2JA 2A3CA 1W1VA 1HKKA 1FKIA 1R9HA 2KE0A 1ROUA 2LAJA 3PRBA 1LL7A 3PRDA 5HT1A 3TC5A 4PTMA 1NMVA 2PN0A 1HJVA 3ARTA 2M8JA 5HW6A 2ZQVA 1WAWA 1D2KA 1JCHB 1E15A 3GPKA 2Q5AA 1ZU8A 3ARSA 4Z2KA 2BA1A 3AQUA 3BXWA 3G6LA 1CTNA 3ARUA 2DG9A 5HW8A 1RP5A 4MNJA 2D9FA 4WKHA 4NZCA 2KR7A 4ODKA 4P8UA 2LJ4A 4GLXA
chains in the Genus database with same CATH topology
1LL6A 3CH9A 4C02B 2JV4A 3WH0A 4KR0B 4ODPA 2LKNA 1BKFA 3RM9A 1ZK6A 3ARVA 2KI3A 2JMFA 4FN2A 3KAHA 3UQIA 1ZB5A 2WADA 4DRHA 5HTGA 3QOKA 5DIUA 2DSUA 2F4EA 3CNGA 1FKKA 1W1PA 4LGXA 2MPHA 4JYSA 3MCBA 3PRAA 4HBOA 4R5EA 4P8VA 2B31A 4WIWA 4Z2HA 1FFQA 1KT0A 1E6PA 2FDMA 4ODOA 1B6CA 2DT1A 1SR0A 2L4JA 3RM4A 3MDYB 4ML4A 1H0IA 1WR7A 2YSGA 1W9UA 4Q22A 3LKXA 2ZQUA 1J4IA 4REXA 1EQ3A 1YATA 5E5WA 3KAFA 1HKJA 3O5OA 4WKAA 4U85A 1NWTA 4HBEA 4N19A 1NWRA 2KFWA 1E6NA 4GGQA 3M7NA 4DWSD 2DWVA 3NRKA 2YSBA 1ZL1A 3B9DA 2RURA 2XPBA 1F40A 5I98A 2DJYA 3WD2A 2MF9A 2Y78A 3WD0A 3PQHA 4TYOA 3OA5A 2DPEA 4ODNA 4DRIA 4LAVA 4MGVA 2O9OA 4MNLA 4TX0A 2K8IA 3WKZA 5J6EA 1FD9A 2A3EA 1PBKA 1FJDA 2MDIA 1FKFA 4DRJA 2WLZA 3WQWA 1GUVA 1O6IA 2A3AA 1JMQA 2OFNA 2DG3A 1UR9A 3G6MA 1NMWA 3PA7A 4S3KA 1FKTA 3RFWA 3WL0A 1EHNA 2PV2A 4TW6A 2XP5A 2ZAJA 1ZBCA 5HWBA 1D6OA 3LE4A 4Z2IA 3ARYA 1ZBKA 3FS8A 1X6LA 2YAJB 3B7XA 3O5EA 4IQ2A 1Q6IA 4ZPVR 3NTPA 4URIA 1NWSA 3RGCA 1K9TA 2DK7A 1FFRA 5AHTA 1TR8A 1GOIA 4DRNA 3O5MA 1L1PA 1FAPA 3WQVA 3O5RA 1C9HA 3KCEA 2EZ5W 2G8ZA 2RUCA 5DITA 3CHCA 2DT2A 1JVWA 3AS1A 1JNSA 2XP4A 2ZQTA 1EDQA 2IF4A 4DWSA 4MTVA 1Q6UA 4QT3A 2ZR6A 1HKIA 2WLYA 1VF8A 4DWSB 2OWOA 4Z2GA 3MQHA 4LAWA 5HUAA 2ZR5A 3CZ8A 2DK1A 3JYMA 1TK7A 4W9OA 4DZ3A 1Y0OA 2FKEA 2LPVA 1H0GA 2F21A 4L72B 2RE3A 2QRVA 4QZVB 3KAIA 1T11A 2M1IA 5E66A 4E5RA 3IKDA 2XP6A 3ARPA 2WAEA 2WK2A 1Q1CA 1ZBVA 1HKMA 5E62A 1LG2A 2UZ5A 3RM8A 3UF8A 2DT0A 2RSEA 2YBUA 1HXVA 1E6ZA 2A3BA 3FY1A 1W1YA 3O5IA 4ODRA 3M85A 1U79A 2VN1A 1XHGA 3OOBA 2YSFA 4DRPA 4QT2A 1OGGA 2KGJA 2MNTA 1LQ0A 2M2AA 4TNSA 4ODLA 4U86A 5BXJA 5DEZA 2F2DA 4QIBA 5GPRA 4DT4A 1K9RA 1ZCNA 4LAYA 2G41A 1E6RA 1ITXA 2N87A 1OWQA 4ITZA 2RUDA 4S3JA 2M8IA 2RQSA 4R0XA 5HKGA 1D7IA 3PR9A 1LL4A 5CQ2A 4IPXA 1UR8A 2IUZA 2PV3A 4MAVA 4DZ2A 3L4HA 1O6WA 3LKXB 1ROTA 1J6YA 3UI5A 1FKSA 2VCDA 5D75A 5GQBA 3UQBA 3FAPA 4G2PA 4O2TA 1WNOA 2E45A 4L3NA 1FKHA 3IHZA 4TW8A 3I6CA 3WL1A 2ESCA 2M3OW 1E9LA 4U84A 2M08A 3O5LA 2XPAA 3ARQA 4J4OA 3ARZA 4P8WA 1X6NA 4Q7NA 4TW7A 1N1AA 4JFMA 3RMEA 4ODQA 4IT6A 1J4RA 3ARXA 5GPGA 3ARWA 1Q6HA 5JH8A 4BF8A 3FSCA 2DG4A 3O5QA 1JNTA 4DIPA 2YSHA 1NH6A 4DRMA 1NSGA 3LUOA 4IT4A 1QZ2A 4J4NA 4W5UA 1FKDA 5DO2A 3EY6A 1W26A 1IX5A 4W9QA 5HBFA 3ALGA 2XP8A 1M5YA 3WD1A 3ALFA 4DWSC 2DMVA 3TDBA 3CGNA 3UI4A 2ITKA 5E64A 3O5PA 3B9EA 1D7HA 4MNKA 2ZQSA 2YBTA 2JXWA 3H9RB 4DRKA 2DT3A 1TFVA 1LJYA 4HARA 4FAPA 1KFWA 2XP7A 1W1TA 4ZS6A 3ODKA 4NNRA 2L2SA 3CGMA 4DRQA 3AS3A 4DROA 2YSIA 1ZBWA 2XP3A 5DIVA 2MLXA 1FKRA 3KACA 2AWGA 2O92A 4JFKA 5B8IC 1BL4A 4G50A 1HJWA 2OLHA 5U47A 3O5DA 3B8SA 2JX8A 4KQZA 2DSVA 1J4HA 3FXYA 4ZPTR 4W9PA 3KABA 2XP9A 3WIJA 1RD6A 4AY1A 2PPPA 3WD4A 4A0UA 1FKJA 3CHEA 3O5FA 1OGBA 1F8AB 3KAGA 2ZR4A 2PBCA 3JYJA 1JNDA 3ARRA 5E65A 3AS0A 4WK9A 2WM0A 2KXQA 4P8XA 1W9PA 1LG1A 2DSZA 1I5HW 1A7XA 1FKBA 3CHFA 3W4RA 4JFIA 1QPLA 4GIVA 2MLYA 3TCZA 4ZPWR 3O5JA 3FSBA 2RUQA 1TCOC 4MSPA 1WB0A 1D7JA 1QPFA 3IKGA 4LAXA 1FLCA 3UQAA 3VAWA 2PV1A 2PPOA 1EYMA 1JNEA 3MQGA 3JXVA 2MLZA 1SYTA 3O5GA 4JFLA 5HW7A 3AROA 3B9AA 3UI6A 3NI6A 2LGOA 4JFJA 1GPFA 4MNMA 1KT1A 4WJXA 1EG3A 3MCBB 3KZ7A 3WD3A 4Z2LA 4ODMA 4NSBA 3AS2A 1FKLA 4IQCA 2PPNA 1EG4A 1EIBA 2QF8A 2JZVA 3O5KA 3IK8A 1YW5A 2Y8NB 1P5QA 2AOSA 3KADA 1W9VA 1XRVA 2DSWA 3CHDA 1WMVA 1PINA 2FAPA 4XAKA 4A0TA 1NWUA 1FKGA 1HJXA 4MPKA 1K9QA 2KO7A 2PI6A 4WKFA 4DH0A 5HWCA 5DF0A 4Z2JA 2A3CA 1W1VA 1HKKA 1FKIA 1R9HA 2KE0A 1ROUA 2LAJA 3PRBA 1LL7A 3PRDA 5HT1A 3TC5A 4PTMA 1NMVA 1HJVA 3ARTA 2M8JA 5HW6A 2ZQVA 1WAWA 1D2KA 1E15A 3GPKA 2Q5AA 1ZU8A 3ARSA 4Z2KA 2BA1A 3AQUA 3BXWA 3G6LA 1CTNA 3ARUA 2DG9A 5HW8A 1RP5A 4MNJA 2D9FA 4WKHA 4NZCA 2KR7A 4ODKA 4P8UA 2LJ4A 4GLXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HKG A;  1D7I A;  5CQ2 A;  4C02 B;  2PPP A;  2JV4 A;  3WH0 A;  3B7X A;  1Q6I A;  3O5E A;  1FKJ A;  4IQ2 A;  4IPX A;  3O5F A;  3NTP A;  2PV3 A;  4ODP A;  1F8A B;  3KAG A;  2ZR4 A;  2LKN A;  3RGC A;  2DK7 A;  3L4H A;  1BKF A;  1O6W A;  5AHT A;  1ROT A;  2PBC A;  3JYJ A;  3UI5 A;  1J6Y A;  1FKS A;  2VCD A;  5D75 A;  3O5M A;  1ZK6 A;  4DRN A;  1FAP A;  2KI3 A;  2JMF A;  4FN2 A;  3KAH A;  3UQI A;  1L1P A;  3O5R A;  2KXQ A;  1C9H A;  3FAP A;  4G2P A;  4DRH A;  3KCE A;  5HTG A;  1I5H W;  2EZ5 W;  1A7X A;  1FKB A;  4O2T A;  5DIU A;  2F4E A;  2E45 A;  3CNG A;  1FKH A;  1FKK A;  4JFI A;  1QPL A;  2RUC A;  4GIV A;  2MPH A;  3IHZ A;  4JYS A;  5DIT A;  1JVW A;  3TCZ A;  2MLY A;  4TW8 A;  1JNS A;  3O5J A;  2XP4 A;  2ZQT A;  2RUQ A;  1TCO C;  4MSP A;  2IF4 A;  3I6C A;  1KT0 A;  2M3O W;  1D7J A;  1Q6U A;  4ODO A;  4QT3 A;  2ZR6 A;  1QPF A;  3IKG A;  1B6C A;  4U84 A;  2M08 A;  3O5L A;  2L4J A;  4LAX A;  2XPA A;  3MDY B;  3UQA A;  3VAW A;  4J4O A;  4TW7 A;  2PV1 A;  1N1A A;  2PPO A;  1EYM A;  1WR7 A;  4JFM A;  2YSG A;  2MLZ A;  3JXV A;  3O5G A;  4JFL A;  5HW7 A;  1J4I A;  2ZQU A;  4LAW A;  4ODQ A;  3UI6 A;  5HUA A;  2ZR5 A;  4REX A;  1EQ3 A;  1J4R A;  2DK1 A;  5GPG A;  1YAT A;  3JYM A;  3NI6 A;  1TK7 A;  3KAF A;  4W9O A;  3O5O A;  1Q6H A;  4BF8 A;  4DZ3 A;  4U85 A;  1Y0O A;  2FKE A;  2LPV A;  2DG4 A;  2F21 A;  2LGO A;  3O5Q A;  4JFJ A;  4N19 A;  2RE3 A;  1JNT A;  2KFW A;  4GGQ A;  1KT1 A;  4DIP A;  2YSH A;  4DRQ A;  3M7N A;  4DZ2 A;  1EG3 A;  3KAI A;  1T11 A;  3KZ7 A;  2M1I A;  4DRM A;  4E5R A;  1NSG A;  3LUO A;  1QZ2 A;  3IKD A;  2XP6 A;  1FKD A;  4J4N A;  4ODM A;  1FKL A;  2DWV A;  1W26 A;  2PPN A;  3EY6 A;  4IQC A;  1EG4 A;  3NRK A;  4W9Q A;  2JZV A;  2YSB A;  3O5K A;  2XP8 A;  1M5Y A;  1YW5 A;  1Q1C A;  1P5Q A;  3IK8 A;  3KAD A;  2RUR A;  2XPB A;  1F40 A;  5I98 A;  2DMV A;  2DJY A;  2UZ5 A;  3UF8 A;  3TDB A;  2MF9 A;  2RSE A;  2Y78 A;  4TYO A;  3CGN A;  3UI4 A;  2ITK A;  1WMV A;  3O5P A;  1PIN A;  1D7H A;  2FAP A;  2ZQS A;  4ODN A;  4DRI A;  2JXW A;  3H9R B;  1FKG A;  4LAV A;  4DRK A;  1HXV A;  4MGV A;  3UQB A;  1K9Q A;  2KO7 A;  4DH0 A;  5HWC A;  4TX0 A;  2K8I A;  4FAP A;  5J6E A;  1FD9 A;  2XP7 A;  3O5I A;  4ODR A;  1PBK A;  3ODK A;  4NNR A;  1FKI A;  1FJD A;  2MDI A;  3M85 A;  1R9H A;  1U79 A;  1ROU A;  2KE0 A;  2L2S A;  2LAJ A;  3OOB A;  1FKF A;  2YSF A;  2VN1 A;  3CGM A;  3PRB A;  3PRD A;  5HT1 A;  4DRJ A;  4DRP A;  4QT2 A;  2YSI A;  3TC5 A;  4DRO A;  1NMV A;  2KGJ A;  2XP3 A;  2MNT A;  2M2A A;  2M8J A;  5DIV A;  1JMQ A;  4TNS A;  2OFN A;  2MLX A;  5HW6 A;  1FKR A;  2DG3 A;  2ZQV A;  3KAC A;  4U86 A;  2AWG A;  4ODL A;  5BXJ A;  2F2D A;  4QIB A;  1NMW A;  4JFK A;  4DT4 A;  3GPK A;  3PA7 A;  5B8I C;  1FKT A;  3RFW A;  2Q5A A;  1K9R A;  1BL4 A;  1ZCN A;  4G50 A;  4LAY A;  2BA1 A;  2PV2 A;  4TW6 A;  2XP5 A;  3O5D A;  2ZAJ A;  2N87 A;  5HWB A;  2JX8 A;  2DG9 A;  5HW8 A;  1J4H A;  1D6O A;  3LE4 A;  2D9F A;  4ITZ A;  4W9P A;  3KAB A;  2RUD A;  2XP9 A;  2M8I A;  2KR7 A;  4ODK A;  2RQS A;  2LJ4 A;  4R0X A; 
#chains in the Genus database with same CATH topology
 1LL6 A;  3CH9 A;  4C02 B;  2JV4 A;  3WH0 A;  4KR0 B;  4ODP A;  2LKN A;  1BKF A;  3RM9 A;  1ZK6 A;  3ARV A;  2KI3 A;  2JMF A;  4FN2 A;  3KAH A;  3UQI A;  1ZB5 A;  2WAD A;  4DRH A;  5HTG A;  3QOK A;  5DIU A;  2DSU A;  2F4E A;  3CNG A;  1FKK A;  1W1P A;  4LGX A;  2MPH A;  4JYS A;  3MCB A;  3PRA A;  4HBO A;  4R5E A;  4P8V A;  2B31 A;  4WIW A;  4Z2H A;  1FFQ A;  1KT0 A;  1E6P A;  2FDM A;  4ODO A;  1B6C A;  2DT1 A;  1SR0 A;  2L4J A;  3RM4 A;  3MDY B;  4ML4 A;  1H0I A;  1WR7 A;  2YSG A;  1W9U A;  4Q22 A;  3LKX A;  2ZQU A;  1J4I A;  4REX A;  1EQ3 A;  1YAT A;  5E5W A;  3KAF A;  1HKJ A;  3O5O A;  4WKA A;  4U85 A;  1NWT A;  2F23 A;  4HBE A;  4N19 A;  1NWR A;  2KFW A;  1E6N A;  4GGQ A;  3M7N A;  4DWS D;  2DWV A;  3NRK A;  2YSB A;  1ZL1 A;  3B9D A;  2RUR A;  2XPB A;  1F40 A;  5I98 A;  2DJY A;  3WD2 A;  1E44 A;  2MF9 A;  2Y78 A;  3WD0 A;  3PQH A;  4TYO A;  3OA5 A;  2DPE A;  4ODN A;  4DRI A;  4UDM A;  4LAV A;  4MGV A;  2O9O A;  4MNL A;  4TX0 A;  2K8I A;  3WKZ A;  5J6E A;  1FD9 A;  2A3E A;  1PBK A;  1FJD A;  2MDI A;  1FKF A;  4DRJ A;  2WLZ A;  3WQW A;  1GUV A;  1O6I A;  2A3A A;  1JMQ A;  2OFN A;  2DG3 A;  1UR9 A;  3G6M A;  1NMW A;  3PA7 A;  4S3K A;  1FKT A;  3RFW A;  3WL0 A;  1EHN A;  2PV2 A;  4TW6 A;  2XP5 A;  2ZAJ A;  1ZBC A;  5HWB A;  1GRJ A;  1D6O A;  3LE4 A;  4Z2I A;  3ARY A;  1ZBK A;  3FS8 A;  1X6L A;  2YAJ B;  3B7X A;  3O5E A;  4IQ2 A;  1Q6I A;  4ZPV R;  3NTP A;  4URI A;  1NWS A;  3RGC A;  1K9T A;  2DK7 A;  1FFR A;  5AHT A;  1TR8 A;  1GOI A;  4DRN A;  3O5M A;  1L1P A;  1FAP A;  2ETN A;  3WQV A;  3O5R A;  1C9H A;  3KCE A;  2EZ5 W;  2G8Z A;  2RUC A;  5DIT A;  3CHC A;  2DT2 A;  1JVW A;  3AS1 A;  1JNS A;  2XP4 A;  2ZQT A;  1EDQ A;  2IF4 A;  4DWS A;  4MTV A;  1Q6U A;  4QT3 A;  2ZR6 A;  1HKI A;  2WLY A;  1VF8 A;  4DWS B;  2OWO A;  4Z2G A;  3MQH A;  4LAW A;  5HUA A;  2ZR5 A;  3CZ8 A;  2DK1 A;  3JYM A;  1TK7 A;  4W9O A;  4DZ3 A;  1Y0O A;  2FKE A;  2LPV A;  1H0G A;  2F21 A;  4L72 B;  2RE3 A;  2QRV A;  4QZV B;  3KAI A;  1T11 A;  2M1I A;  5E66 A;  4E5R A;  3IKD A;  2XP6 A;  3ARP A;  2WAE A;  2WK2 A;  1Q1C A;  1ZBV A;  1HKM A;  5E62 A;  1LG2 A;  2UZ5 A;  3RM8 A;  3UF8 A;  2DT0 A;  2RSE A;  2YBU A;  1HXV A;  3EIP A;  1E6Z A;  2A3B A;  3FY1 A;  1W1Y A;  3O5I A;  4ODR A;  3M85 A;  1U79 A;  2VN1 A;  1XHG A;  3OOB A;  2YSF A;  4DRP A;  4QT2 A;  1OGG A;  2KGJ A;  2MNT A;  1LQ0 A;  2M2A A;  4TNS A;  4ODL A;  4U86 A;  5BXJ A;  5DEZ A;  2F2D A;  4QIB A;  5GPR A;  4DT4 A;  1K9R A;  1ZCN A;  4LAY A;  2G41 A;  1E6R A;  1ITX A;  2N87 A;  1OWQ A;  4ITZ A;  2RUD A;  4S3J A;  2M8I A;  2RQS A;  4R0X A;  5HKG A;  1D7I A;  3PR9 A;  1LL4 A;  5CQ2 A;  4IPX A;  1UR8 A;  2IUZ A;  2PV3 A;  4MAV A;  4DZ2 A;  3L4H A;  1O6W A;  3LKX B;  1ROT A;  1J6Y A;  3UI5 A;  1FKS A;  2VCD A;  5D75 A;  5GQB A;  3UQB A;  3FAP A;  4G2P A;  4O2T A;  1WNO A;  2E45 A;  4L3N A;  1FKH A;  3GTY X;  3IHZ A;  4TW8 A;  3I6C A;  3WL1 A;  2ESC A;  2M3O W;  1E9L A;  4U84 A;  2M08 A;  3O5L A;  2XPA A;  3ARQ A;  4J4O A;  3ARZ A;  4P8W A;  1X6N A;  4Q7N A;  4TW7 A;  1N1A A;  4JFM A;  3RME A;  4ODQ A;  4IT6 A;  1J4R A;  3ARX A;  5GPG A;  3ARW A;  1Q6H A;  5JH8 A;  4BF8 A;  3FSC A;  2DG4 A;  3O5Q A;  1JNT A;  4DIP A;  2YSH A;  1NH6 A;  4DRM A;  1NSG A;  3LUO A;  4IT4 A;  1QZ2 A;  4J4N A;  4W5U A;  1FKD A;  5DO2 A;  3EY6 A;  1W26 A;  1IX5 A;  4W9Q A;  5HBF A;  3ALG A;  2XP8 A;  1M5Y A;  3WD1 A;  2EUL A;  3BMB A;  3ALF A;  4DWS C;  2DMV A;  3TDB A;  3CGN A;  3UI4 A;  2ITK A;  5E64 A;  3O5P A;  3B9E A;  1D7H A;  4MNK A;  2ZQS A;  2YBT A;  2JXW A;  3H9R B;  4DRK A;  2DT3 A;  1TFV A;  1LJY A;  4HAR A;  4FAP A;  1KFW A;  2XP7 A;  1W1T A;  4ZS6 A;  3ODK A;  4NNR A;  2L2S A;  3CGM A;  4DRQ A;  3AS3 A;  4DRO A;  2YSI A;  1ZBW A;  2XP3 A;  5DIV A;  2MLX A;  1FKR A;  2P4V A;  3KAC A;  2AWG A;  2O92 A;  4JFK A;  5B8I C;  1BL4 A;  4G50 A;  1HJW A;  2OLH A;  5U47 A;  3O5D A;  3B8S A;  2JX8 A;  4KQZ A;  2DSV A;  1J4H A;  3FXY A;  4ZPT R;  4W9P A;  3KAB A;  2XP9 A;  3WIJ A;  1RD6 A;  4AY1 A;  2B5U B;  2PPP A;  3WD4 A;  4A0U A;  1FKJ A;  3CHE A;  3GU0 A;  3O5F A;  1OGB A;  1F8A B;  3KAG A;  2ZR4 A;  2PBC A;  3JYJ A;  1JND A;  3ARR A;  5E65 A;  3AS0 A;  4WK9 A;  2WM0 A;  2KXQ A;  4P8X A;  1W9P A;  1LG1 A;  2DSZ A;  1I5H W;  1A7X A;  1FKB A;  3CHF A;  3W4R A;  4JFI A;  1QPL A;  4GIV A;  2MLY A;  3TCZ A;  4ZPW R;  3O5J A;  3FSB A;  2RUQ A;  1TCO C;  4MSP A;  1WB0 A;  1D7J A;  1QPF A;  3IKG A;  4LAX A;  1FLC A;  3UQA A;  3VAW A;  2PV1 A;  2PPO A;  1EYM A;  1JNE A;  3MQG A;  3JXV A;  2MLZ A;  1SYT A;  3O5G A;  4JFL A;  5HW7 A;  3ARO A;  3B9A A;  3UI6 A;  3NI6 A;  2LGO A;  4JFJ A;  1GPF A;  4MNM A;  1KT1 A;  4WJX A;  1EG3 A;  3MCB B;  3KZ7 A;  3WD3 A;  4Z2L A;  4ODM A;  4NSB A;  3AS2 A;  1FKL A;  4IQC A;  2PPN A;  1EG4 A;  1EIB A;  2QF8 A;  2JZV A;  3O5K A;  3IK8 A;  1YW5 A;  2Y8N B;  1P5Q A;  2AOS A;  3KAD A;  1W9V A;  1XRV A;  2DSW A;  3CHD A;  1WMV A;  1PIN A;  2FAP A;  4XAK A;  4A0T A;  1NWU A;  1FKG A;  1HJX A;  4MPK A;  1K9Q A;  2KO7 A;  2PI6 A;  4WKF A;  4DH0 A;  5HWC A;  5DF0 A;  4Z2J A;  2A3C A;  1W1V A;  1HKK A;  1FKI A;  1R9H A;  2KE0 A;  1ROU A;  2LAJ A;  3PRB A;  1LL7 A;  3PRD A;  5HT1 A;  3TC5 A;  4PTM A;  1NMV A;  2PN0 A;  1HJV A;  3ART A;  2M8J A;  5HW6 A;  2ZQV A;  1WAW A;  1D2K A;  1JCH B;  1E15 A;  3GPK A;  2Q5A A;  1ZU8 A;  3ARS A;  4Z2K A;  2BA1 A;  3AQU A;  3BXW A;  3G6L A;  1CTN A;  3ARU A;  2DG9 A;  5HW8 A;  1RP5 A;  4MNJ A;  2D9F A;  4WKH A;  4NZC A;  2KR7 A;  4ODK A;  4P8U A;  2LJ4 A;  4GLX A; 
#chains in the Genus database with same CATH homology
 1LL6 A;  3CH9 A;  4C02 B;  2JV4 A;  3WH0 A;  4KR0 B;  4ODP A;  2LKN A;  1BKF A;  3RM9 A;  1ZK6 A;  3ARV A;  2KI3 A;  2JMF A;  4FN2 A;  3KAH A;  3UQI A;  1ZB5 A;  2WAD A;  4DRH A;  5HTG A;  3QOK A;  5DIU A;  2DSU A;  2F4E A;  3CNG A;  1FKK A;  1W1P A;  4LGX A;  2MPH A;  4JYS A;  3MCB A;  3PRA A;  4HBO A;  4R5E A;  4P8V A;  2B31 A;  4WIW A;  4Z2H A;  1FFQ A;  1KT0 A;  1E6P A;  2FDM A;  4ODO A;  1B6C A;  2DT1 A;  1SR0 A;  2L4J A;  3RM4 A;  3MDY B;  4ML4 A;  1H0I A;  1WR7 A;  2YSG A;  1W9U A;  4Q22 A;  3LKX A;  2ZQU A;  1J4I A;  4REX A;  1EQ3 A;  1YAT A;  5E5W A;  3KAF A;  1HKJ A;  3O5O A;  4WKA A;  4U85 A;  1NWT A;  4HBE A;  4N19 A;  1NWR A;  2KFW A;  1E6N A;  4GGQ A;  3M7N A;  4DWS D;  2DWV A;  3NRK A;  2YSB A;  1ZL1 A;  3B9D A;  2RUR A;  2XPB A;  1F40 A;  5I98 A;  2DJY A;  3WD2 A;  2MF9 A;  2Y78 A;  3WD0 A;  3PQH A;  4TYO A;  3OA5 A;  2DPE A;  4ODN A;  4DRI A;  4LAV A;  4MGV A;  2O9O A;  4MNL A;  4TX0 A;  2K8I A;  3WKZ A;  5J6E A;  1FD9 A;  2A3E A;  1PBK A;  1FJD A;  2MDI A;  1FKF A;  4DRJ A;  2WLZ A;  3WQW A;  1GUV A;  1O6I A;  2A3A A;  1JMQ A;  2OFN A;  2DG3 A;  1UR9 A;  3G6M A;  1NMW A;  3PA7 A;  4S3K A;  1FKT A;  3RFW A;  3WL0 A;  1EHN A;  2PV2 A;  4TW6 A;  2XP5 A;  2ZAJ A;  1ZBC A;  5HWB A;  1D6O A;  3LE4 A;  4Z2I A;  3ARY A;  1ZBK A;  3FS8 A;  1X6L A;  2YAJ B;  3B7X A;  3O5E A;  4IQ2 A;  1Q6I A;  4ZPV R;  3NTP A;  4URI A;  1NWS A;  3RGC A;  1K9T A;  2DK7 A;  1FFR A;  5AHT A;  1TR8 A;  1GOI A;  4DRN A;  3O5M A;  1L1P A;  1FAP A;  3WQV A;  3O5R A;  1C9H A;  3KCE A;  2EZ5 W;  2G8Z A;  2RUC A;  5DIT A;  3CHC A;  2DT2 A;  1JVW A;  3AS1 A;  1JNS A;  2XP4 A;  2ZQT A;  1EDQ A;  2IF4 A;  4DWS A;  4MTV A;  1Q6U A;  4QT3 A;  2ZR6 A;  1HKI A;  2WLY A;  1VF8 A;  4DWS B;  2OWO A;  4Z2G A;  3MQH A;  4LAW A;  5HUA A;  2ZR5 A;  3CZ8 A;  2DK1 A;  3JYM A;  1TK7 A;  4W9O A;  4DZ3 A;  1Y0O A;  2FKE A;  2LPV A;  1H0G A;  2F21 A;  4L72 B;  2RE3 A;  2QRV A;  4QZV B;  3KAI A;  1T11 A;  2M1I A;  5E66 A;  4E5R A;  3IKD A;  2XP6 A;  3ARP A;  2WAE A;  2WK2 A;  1Q1C A;  1ZBV A;  1HKM A;  5E62 A;  1LG2 A;  2UZ5 A;  3RM8 A;  3UF8 A;  2DT0 A;  2RSE A;  2YBU A;  1HXV A;  1E6Z A;  2A3B A;  3FY1 A;  1W1Y A;  3O5I A;  4ODR A;  3M85 A;  1U79 A;  2VN1 A;  1XHG A;  3OOB A;  2YSF A;  4DRP A;  4QT2 A;  1OGG A;  2KGJ A;  2MNT A;  1LQ0 A;  2M2A A;  4TNS A;  4ODL A;  4U86 A;  5BXJ A;  5DEZ A;  2F2D A;  4QIB A;  5GPR A;  4DT4 A;  1K9R A;  1ZCN A;  4LAY A;  2G41 A;  1E6R A;  1ITX A;  2N87 A;  1OWQ A;  4ITZ A;  2RUD A;  4S3J A;  2M8I A;  2RQS A;  4R0X A;  5HKG A;  1D7I A;  3PR9 A;  1LL4 A;  5CQ2 A;  4IPX A;  1UR8 A;  2IUZ A;  2PV3 A;  4MAV A;  4DZ2 A;  3L4H A;  1O6W A;  3LKX B;  1ROT A;  1J6Y A;  3UI5 A;  1FKS A;  2VCD A;  5D75 A;  5GQB A;  3UQB A;  3FAP A;  4G2P A;  4O2T A;  1WNO A;  2E45 A;  4L3N A;  1FKH A;  3IHZ A;  4TW8 A;  3I6C A;  3WL1 A;  2ESC A;  2M3O W;  1E9L A;  4U84 A;  2M08 A;  3O5L A;  2XPA A;  3ARQ A;  4J4O A;  3ARZ A;  4P8W A;  1X6N A;  4Q7N A;  4TW7 A;  1N1A A;  4JFM A;  3RME A;  4ODQ A;  4IT6 A;  1J4R A;  3ARX A;  5GPG A;  3ARW A;  1Q6H A;  5JH8 A;  4BF8 A;  3FSC A;  2DG4 A;  3O5Q A;  1JNT A;  4DIP A;  2YSH A;  1NH6 A;  4DRM A;  1NSG A;  3LUO A;  4IT4 A;  1QZ2 A;  4J4N A;  4W5U A;  1FKD A;  5DO2 A;  3EY6 A;  1W26 A;  1IX5 A;  4W9Q A;  5HBF A;  3ALG A;  2XP8 A;  1M5Y A;  3WD1 A;  3ALF A;  4DWS C;  2DMV A;  3TDB A;  3CGN A;  3UI4 A;  2ITK A;  5E64 A;  3O5P A;  3B9E A;  1D7H A;  4MNK A;  2ZQS A;  2YBT A;  2JXW A;  3H9R B;  4DRK A;  2DT3 A;  1TFV A;  1LJY A;  4HAR A;  4FAP A;  1KFW A;  2XP7 A;  1W1T A;  4ZS6 A;  3ODK A;  4NNR A;  2L2S A;  3CGM A;  4DRQ A;  3AS3 A;  4DRO A;  2YSI A;  1ZBW A;  2XP3 A;  5DIV A;  2MLX A;  1FKR A;  3KAC A;  2AWG A;  2O92 A;  4JFK A;  5B8I C;  1BL4 A;  4G50 A;  1HJW A;  2OLH A;  5U47 A;  3O5D A;  3B8S A;  2JX8 A;  4KQZ A;  2DSV A;  1J4H A;  3FXY A;  4ZPT R;  4W9P A;  3KAB A;  2XP9 A;  3WIJ A;  1RD6 A;  4AY1 A;  2PPP A;  3WD4 A;  4A0U A;  1FKJ A;  3CHE A;  3O5F A;  1OGB A;  1F8A B;  3KAG A;  2ZR4 A;  2PBC A;  3JYJ A;  1JND A;  3ARR A;  5E65 A;  3AS0 A;  4WK9 A;  2WM0 A;  2KXQ A;  4P8X A;  1W9P A;  1LG1 A;  2DSZ A;  1I5H W;  1A7X A;  1FKB A;  3CHF A;  3W4R A;  4JFI A;  1QPL A;  4GIV A;  2MLY A;  3TCZ A;  4ZPW R;  3O5J A;  3FSB A;  2RUQ A;  1TCO C;  4MSP A;  1WB0 A;  1D7J A;  1QPF A;  3IKG A;  4LAX A;  1FLC A;  3UQA A;  3VAW A;  2PV1 A;  2PPO A;  1EYM A;  1JNE A;  3MQG A;  3JXV A;  2MLZ A;  1SYT A;  3O5G A;  4JFL A;  5HW7 A;  3ARO A;  3B9A A;  3UI6 A;  3NI6 A;  2LGO A;  4JFJ A;  1GPF A;  4MNM A;  1KT1 A;  4WJX A;  1EG3 A;  3MCB B;  3KZ7 A;  3WD3 A;  4Z2L A;  4ODM A;  4NSB A;  3AS2 A;  1FKL A;  4IQC A;  2PPN A;  1EG4 A;  1EIB A;  2QF8 A;  2JZV A;  3O5K A;  3IK8 A;  1YW5 A;  2Y8N B;  1P5Q A;  2AOS A;  3KAD A;  1W9V A;  1XRV A;  2DSW A;  3CHD A;  1WMV A;  1PIN A;  2FAP A;  4XAK A;  4A0T A;  1NWU A;  1FKG A;  1HJX A;  4MPK A;  1K9Q A;  2KO7 A;  2PI6 A;  4WKF A;  4DH0 A;  5HWC A;  5DF0 A;  4Z2J A;  2A3C A;  1W1V A;  1HKK A;  1FKI A;  1R9H A;  2KE0 A;  1ROU A;  2LAJ A;  3PRB A;  1LL7 A;  3PRD A;  5HT1 A;  3TC5 A;  4PTM A;  1NMV A;  1HJV A;  3ART A;  2M8J A;  5HW6 A;  2ZQV A;  1WAW A;  1D2K A;  1E15 A;  3GPK A;  2Q5A A;  1ZU8 A;  3ARS A;  4Z2K A;  2BA1 A;  3AQU A;  3BXW A;  3G6L A;  1CTN A;  3ARU A;  2DG9 A;  5HW8 A;  1RP5 A;  4MNJ A;  2D9F A;  4WKH A;  4NZC A;  2KR7 A;  4ODK A;  4P8U A;  2LJ4 A;  4GLX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...