3NTPA

Human pin1 complexed with reduced amide inhibitor
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
158
structure length
147
Chain Sequence
KLPPGWEKAMSRSSGRVYYFNHITNASQWERPSGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase/isomerase inhibitor
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title A reduced-amide inhibitor of Pin1 binds in a conformation resembling a twisted-amide transition state.
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 147
sequence length 158
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3ntpA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3ntpA02
1Q6HA 3KAFA 2XP3A 1FKFA 4MSPA 1K9RA 2JMFA 4REXA 2FAPA 4BF8A 1PBKA 4DROA 2ZAJA 3LE4A 1JNSA 1D7IA 2DG3A 2RE3A 5AHTA 3FAPA 4LAWA 3UI4A 1WR7A 2RSEA 3UF8A 2XP8A 4ODQA 1EG3A 1FKLA 4W9PA 2PV2A 4J4OA 2LKNA 4NNRA 3IHZA 1WMVA 4TX0A 2PBCA 4U84A 2ZR6A 1FJDA 5HWCA 4ODMA 4DRKA 5HW7A 1N1AA 3WH0A 2XP7A 3JYJA 1D7JA 2F21A 3IK8A 3PRDA 1FKJA 2RUCA 2F2DA 4ODOA 4ITZA 3O5QA 2M8IA 2ZQVA 1TCOC 1C9HA 2MPHA 4J4NA 5HTGA 1JVWA 4IQCA 3KABA 2DK7A 3UQBA 1PINA 5DIUA 1Q6UA 3KACA 4JYSA 3O5PA 3KAGA 1K9QA 3KAHA 3JXVA 1FKRA 1U79A 2YSIA 2KXQA 3TC5A 1QPLA 2Y78A 2ITKA 1NSGA 2MLXA 2KE0A 1M5YA 3IKGA 2KR7A 1NMVA 2XP6A 4TYOA 2FKEA 1FKGA 2PPOA 2RQSA 1W26A 2YSGA 3KCEA 4W9QA 2M8JA 1P5QA 2XPBA 2N87A 4JFKA 1FKIA 2JZVA 2L4JA 3PRBA 1F8AB 1ROUA 3VAWA 2F4EA 2ZR5A 3O5GA 1HXVA 1FAPA 1FKHA 3O5EA 1BL4A 1ZK6A 1EQ3A 3CGMA 2DG9A 4DRPA 1KT0A 2LAJA 5J6EA 4ODRA 5I98A 5BXJA 4C02B 1EG4A 3RGCA 3TDBA 3JYMA 5GPGA 4E5RA 5CQ2A 4O2TA 4ODKA 1EYMA 2YSHA 4TW6A 3PA7A 1YATA 4U85A 2YSFA 2E45A 2PV3A 3O5LA 2M2AA 4JFJA 2ZQUA 3LUOA 4DIPA 3CNGA 2K8IA 2KGJA 4IPXA 3O5RA 2DMVA 4DH0A 4TW7A 2KI3A 2KO7A 2AWGA 4DRJA 1FKSA 4QIBA 3EY6A 4MGVA 4FN2A 4DZ2A 4IQ2A 5HW8A 2LPVA 2D9FA 4DRIA 2DJYA 2LJ4A 3M7NA 1D7HA 4QT3A 1R9HA 2VN1A 5DITA 2JV4A 1FD9A 3UI5A 1J4HA 4QT2A 4N19A 3UI6A 4DZ3A 3I6CA 1FKTA 1L1PA 3H9RB 1FKKA 2MLYA 4ODNA 4LAVA 3RFWA 1TK7A 5B8IC 2RUQA 2DG4A 3NTPA 1NMWA 5HT1A 1ROTA 4DT4A 3TCZA 2M3OW 5D75A 2RURA 4W9OA 2JX8A 2PPPA 3IKDA 2DWVA 4DRNA 4ODLA 2KFWA 2LGOA 1T11A 5HWBA 2L2SA 2Q5AA 2UZ5A 1J6YA 4G50A 3B7XA 1FKDA 2RUDA 4DRMA 2M1IA 3L4HA 4JFMA 2M08A 4TNSA 3UQAA 1O6WA 2MLZA 1J4RA 4ODPA 1D6OA 2XP5A 1A7XA 2OFNA 3O5DA 3O5JA 3MDYB 3CGNA 3NI6A 5DIVA 4FAPA 2EZ5W 2MDIA 2IF4A 2YSBA 1I5HW 1FKBA 1KT1A 4GGQA 2PV1A 4JFIA 2XP4A 4G2PA 3O5MA 5HUAA 2DK1A 3ODKA 4TW8A 1J4IA 2BA1A 1BKFA 2XPAA 2VCDA 1QPFA 1Q1CA 3KADA 4GIVA 4LAXA 2MNTA 1Q6IA 4DRQA 4U86A 3KZ7A 2MF9A 4JFLA 3OOBA 5HKGA 2ZQTA 1JMQA 3O5FA 1ZCNA 4R0XA 2JXWA 2PPNA 3UQIA 3GPKA 2ZQSA 3NRKA 1YW5A 3O5IA 5HW6A 1Y0OA 3O5KA 1QZ2A 1B6CA 2XP9A 3O5OA 1F40A 3KAIA 4DRHA 2ZR4A 3M85A 1JNTA 4LAYA
chains in the Genus database with same CATH superfamily
1Q6HA 5GQBA 3KAFA 2PN0A 3RM4A 2XP3A 1FKFA 2YBUA 5DO2A 4MSPA 1K9RA 1XHGA 2JMFA 4ML4A 3GTYX 4REXA 2FAPA 4BF8A 1PBKA 2F23A 3ARPA 4WJXA 4DROA 2ZAJA 3LE4A 4WK9A 1JNSA 1D7IA 2DG3A 2RE3A 1EHNA 5AHTA 3WD4A 3FAPA 1JNDA 1HKKA 4LAWA 2IUZA 3OA5A 3UI4A 2G41A 2A3AA 4MNLA 1WR7A 2DT2A 2RSEA 3MQHA 3UF8A 2XP8A 2A3CA 2YBTA 4ODQA 1EG3A 4DWSD 1FKLA 1W1TA 3G6LA 3GU0A 4W9PA 5E5WA 2PV2A 4J4OA 2P4VA 4Z2IA 2LKNA 4NNRA 1ZBVA 1WMVA 3IHZA 4HBEA 1LG1A 4TX0A 2PBCA 2B31A 3W4RA 4U84A 1D2KA 2ZR6A 1FJDA 1HKIA 5E64A 5HWCA 4ODMA 4MTVA 3ARYA 4DRKA 3ARWA 5HW7A 1N1AA 3WH0A 2XP7A 3JYJA 1D7JA 2F21A 3IK8A 4AY1A 1TR8A 1FKJA 2RUCA 3MQGA 1E9LA 3PRDA 2F2DA 4ODOA 4ITZA 3O5QA 2M8IA 3PR9A 2ZQVA 2YAJB 1TCOC 1C9HA 1HKJA 2MPHA 4J4NA 5HTGA 1TFVA 2PI6A 1JVWA 4LGXA 4IQCA 3KABA 2DK7A 5E65A 3UQBA 1PINA 5DIUA 1Q6UA 3KACA 1HJVA 3G6MA 3WL0A 4JYSA 3O5PA 3KAGA 1X6NA 1K9QA 4S3JA 3KAHA 3JXVA 1FKRA 1U79A 4L72B 2YSIA 2KXQA 3TC5A 1QPLA 2Y78A 2ITKA 5E62A 1NSGA 2MLXA 5U47A 2KE0A 1M5YA 3IKGA 1VF8A 2KR7A 1NMVA 2XP6A 4TYOA 3MCBA 3RM9A 1LG2A 2FKEA 1FKGA 2PPOA 1NWRA 2RQSA 1W26A 4MAVA 4Z2LA 2YSGA 1X6LA 4ZPTR 3KCEA 4W9QA 1GOIA 3ARVA 2M8JA 4ZPWR 3CHFA 1ITXA 3B9DA 1P5QA 1W9VA 1O6IA 2XPBA 2DT0A 2N87A 2DSZA 1H0GA 4JFKA 1FKIA 2JZVA 2L4JA 1OGGA 4WKAA 3CH9A 3PRBA 4WKHA 1F8AB 4DWSB 1ROUA 3VAWA 2F4EA 2ZR5A 3O5GA 1HXVA 4P8UA 3ARSA 1FAPA 2OWOA 1LL7A 1FKHA 3FS8A 3O5EA 1BL4A 1ZK6A 4Q7NA 3ARUA 1EQ3A 3CGMA 1E6ZA 1WB0A 4P8WA 3BMBA 2DG9A 4DRPA 1KT0A 2LAJA 1E6RA 1ZL1A 1E6PA 1UR9A 2WLYA 5J6EA 4ODRA 5I98A 5E66A 4Z2KA 4C02B 4Z2HA 5BXJA 1EG4A 3B9AA 3RGCA 3WQWA 3TDBA 2DPEA 2A3BA 3JYMA 2DT1A 4MNMA 3CHCA 5GPGA 4E5RA 5CQ2A 4O2TA 4ODKA 1EYMA 3CHEA 1UR8A 4WKFA 3CZ8A 2YSHA 4TW6A 3PA7A 1SYTA 4XAKA 5JH8A 1YATA 4U85A 3B9EA 2YSFA 3ARTA 2E45A 2PV3A 1NH6A 3O5LA 2M2AA 3ARZA 4JFJA 2DSVA 2ZQUA 3WD0A 3LUOA 2FDMA 4DIPA 4DWSC 3CNGA 3ALGA 3AROA 2K8IA 3AS2A 3ARQA 2KGJA 5DEZA 3WD2A 4IT6A 4MNJA 4IPXA 3O5RA 2DMVA 4DH0A 4TW7A 1WNOA 4NZCA 2KI3A 3PQHA 2KO7A 3AS1A 2AWGA 4DRJA 1FKSA 1FFRA 4QIBA 3EY6A 3WKZA 3FXYA 1ZBWA 2O92A 4MGVA 4FN2A 4HBOA 4P8VA 1W9PA 4IQ2A 4DZ2A 5HW8A 4NSBA 4QZVB 2LPVA 4MNKA 2D9FA 4DRIA 2DJYA 3LKXB 2LJ4A 3M7NA 3WD1A 1D7HA 4KR0B 4QT3A 3FSCA 4Q22A 3AS3A 1R9HA 2VN1A 1HJWA 5DITA 2JV4A 1FD9A 1HKMA 3UI5A 1J4HA 4QT2A 4N19A 3UI6A 4DZ3A 3I6CA 1FKTA 1RD6A 1L1PA 1LQ0A 1ZBKA 1GUVA 3H9RB 1FKKA 2Y8NB 2MLYA 4ODNA 3EIPA 5GPRA 2WM0A 4LAVA 1E44A 5DF0A 3RFWA 1TK7A 4ZPVR 2WLZA 1OGBA 5B8IC 3AS0A 2RUQA 2DG4A 3B8SA 4UDMA 3NTPA 1RP5A 1NMWA 5HT1A 1ROTA 4DT4A 1LL4A 3TCZA 2M3OW 1JCHB 5D75A 2RURA 1FFQA 4W9OA 1EIBA 2JX8A 2PPPA 3IKDA 2DWVA 1LL6A 4A0UA 3QOKA 4HARA 4DRNA 4ODLA 2ETNA 3ARRA 2KFWA 2LGOA 1T11A 5HWBA 2L2SA 3RM8A 1ZU8A 2Q5AA 1W1PA 1H0IA 2UZ5A 1HJXA 4ZS6A 1NWSA 1ZBCA 1J6YA 3FSBA 1GPFA 4G50A 4PTMA 1CTNA 1FKDA 3B7XA 1EDQA 2RUDA 4DRMA 1W9UA 1E15A 4GLXA 4L3NA 2DSUA 2M1IA 2OLHA 4MPKA 3L4HA 4P8XA 1XRVA 4JFMA 2M08A 3RMEA 1JNEA 4TNSA 4DWSA 3UQAA 1O6WA 2MLZA 1J4RA 4WIWA 4ODPA 1D6OA 2XP5A 1A7XA 2OFNA 3O5DA 3O5JA 3MDYB 3CGNA 3NI6A 5DIVA 4FAPA 2EZ5W 2MDIA 3ALFA 1FLCA 1E6NA 2IF4A 2YSBA 4W5UA 1I5HW 1FKBA 3WIJA 1KT1A 4GGQA 2PV1A 1LJYA 1SR0A 4JFIA 2WAEA 2XP4A 1NWTA 3WD3A 4G2PA 2EULA 3O5MA 5HUAA 2WADA 2DK1A 3ODKA 1IX5A 2O9OA 4R5EA 4IT4A 4TW8A 1J4IA 2DSWA 2BA1A 1BKFA 1WAWA 2XPAA 3FY1A 2VCDA 1QPFA 3MCBB 2AOSA 3PRAA 2B5UB 1Q1CA 4KQZA 3KADA 4GIVA 4Z2JA 4LAXA 2MNTA 2A3EA 1Q6IA 4Z2GA 4DRQA 4U86A 3KZ7A 2MF9A 4JFLA 3OOBA 1W1YA 3BXWA 5HKGA 2ZQTA 1OWQA 1NWUA 3WL1A 4S3KA 3ARXA 1JMQA 3O5FA 1ZCNA 4R0XA 2JXWA 2PPNA 3AQUA 1KFWA 3UQIA 3GPKA 2ESCA 2ZQSA 3NRKA 1YW5A 3O5IA 2G8ZA 3WQVA 2WK2A 5HW6A 1Y0OA 1ZB5A 2DT3A 3O5KA 2QF8A 1QZ2A 1GRJA 1K9TA 1B6CA 2XP9A 1W1VA 4URIA 3O5OA 1F40A 3KAIA 4DRHA 2QRVA 4A0TA 3CHDA 2ZR4A 5HBFA 3LKXA 3M85A 1JNTA 4LAYA
chains in the Genus database with same CATH topology
1Q6HA 5GQBA 3KAFA 3RM4A 2XP3A 1FKFA 2YBUA 5DO2A 4MSPA 1K9RA 1XHGA 2JMFA 4ML4A 4REXA 2FAPA 4BF8A 1PBKA 3ARPA 4WJXA 4DROA 2ZAJA 3LE4A 4WK9A 1JNSA 1D7IA 2DG3A 2RE3A 1EHNA 5AHTA 3WD4A 3FAPA 1JNDA 1HKKA 4LAWA 2IUZA 3OA5A 3UI4A 2G41A 2A3AA 4MNLA 1WR7A 2DT2A 2RSEA 3MQHA 3UF8A 2XP8A 2A3CA 2YBTA 4ODQA 1EG3A 4DWSD 1FKLA 1W1TA 3G6LA 4W9PA 5E5WA 2PV2A 4J4OA 4Z2IA 2LKNA 4NNRA 1ZBVA 1WMVA 3IHZA 4HBEA 1LG1A 4TX0A 2PBCA 2B31A 3W4RA 4U84A 1D2KA 2ZR6A 1FJDA 1HKIA 5E64A 5HWCA 4ODMA 4MTVA 3ARYA 4DRKA 3ARWA 5HW7A 1N1AA 3WH0A 2XP7A 3JYJA 1D7JA 2F21A 3IK8A 4AY1A 1TR8A 1FKJA 2RUCA 3MQGA 1E9LA 3PRDA 2F2DA 4ODOA 4ITZA 3O5QA 2M8IA 3PR9A 2ZQVA 2YAJB 1TCOC 1C9HA 1HKJA 2MPHA 4J4NA 5HTGA 1TFVA 2PI6A 1JVWA 4LGXA 4IQCA 3KABA 2DK7A 5E65A 3UQBA 1PINA 5DIUA 1Q6UA 3KACA 1HJVA 3G6MA 3WL0A 4JYSA 3O5PA 3KAGA 1X6NA 1K9QA 4S3JA 3KAHA 3JXVA 1FKRA 1U79A 4L72B 2YSIA 2KXQA 3TC5A 1QPLA 2Y78A 2ITKA 5E62A 1NSGA 2MLXA 5U47A 2KE0A 1M5YA 3IKGA 1VF8A 2KR7A 1NMVA 2XP6A 4TYOA 3MCBA 3RM9A 1LG2A 2FKEA 1FKGA 2PPOA 1NWRA 2RQSA 1W26A 4MAVA 4Z2LA 2YSGA 1X6LA 4ZPTR 3KCEA 4W9QA 1GOIA 3ARVA 2M8JA 4ZPWR 3CHFA 1ITXA 3B9DA 1P5QA 1W9VA 1O6IA 2XPBA 2DT0A 2N87A 2DSZA 1H0GA 4JFKA 1FKIA 2JZVA 2L4JA 1OGGA 4WKAA 3CH9A 3PRBA 4WKHA 1F8AB 4DWSB 1ROUA 3VAWA 2F4EA 2ZR5A 3O5GA 1HXVA 4P8UA 3ARSA 1FAPA 2OWOA 1LL7A 1FKHA 3FS8A 3O5EA 1BL4A 1ZK6A 4Q7NA 3ARUA 1EQ3A 3CGMA 1E6ZA 1WB0A 4P8WA 2DG9A 4DRPA 1KT0A 2LAJA 1E6RA 1ZL1A 1E6PA 1UR9A 2WLYA 5J6EA 4ODRA 5I98A 5E66A 4Z2KA 4C02B 4Z2HA 5BXJA 1EG4A 3B9AA 3RGCA 3WQWA 3TDBA 2DPEA 2A3BA 3JYMA 2DT1A 4MNMA 3CHCA 5GPGA 4E5RA 5CQ2A 4O2TA 4ODKA 1EYMA 3CHEA 1UR8A 4WKFA 3CZ8A 2YSHA 4TW6A 3PA7A 1SYTA 4XAKA 5JH8A 1YATA 4U85A 3B9EA 2YSFA 3ARTA 2E45A 2PV3A 1NH6A 3O5LA 2M2AA 3ARZA 4JFJA 2DSVA 2ZQUA 3WD0A 3LUOA 2FDMA 4DIPA 4DWSC 3CNGA 3ALGA 3AROA 2K8IA 3AS2A 3ARQA 2KGJA 5DEZA 3WD2A 4IT6A 4MNJA 4IPXA 3O5RA 2DMVA 4DH0A 4TW7A 1WNOA 4NZCA 2KI3A 3PQHA 2KO7A 3AS1A 2AWGA 4DRJA 1FKSA 1FFRA 4QIBA 3EY6A 3WKZA 3FXYA 1ZBWA 2O92A 4MGVA 4FN2A 4HBOA 4P8VA 1W9PA 4IQ2A 4DZ2A 5HW8A 4NSBA 4QZVB 2LPVA 4MNKA 2D9FA 4DRIA 2DJYA 3LKXB 2LJ4A 3M7NA 3WD1A 1D7HA 4KR0B 4QT3A 3FSCA 4Q22A 3AS3A 1R9HA 2VN1A 1HJWA 5DITA 2JV4A 1FD9A 1HKMA 3UI5A 1J4HA 4QT2A 4N19A 3UI6A 4DZ3A 3I6CA 1FKTA 1RD6A 1L1PA 1LQ0A 1ZBKA 1GUVA 3H9RB 1FKKA 2Y8NB 2MLYA 4ODNA 5GPRA 2WM0A 4LAVA 5DF0A 3RFWA 1TK7A 4ZPVR 2WLZA 1OGBA 5B8IC 3AS0A 2RUQA 2DG4A 3B8SA 3NTPA 1RP5A 1NMWA 5HT1A 1ROTA 4DT4A 1LL4A 3TCZA 2M3OW 5D75A 2RURA 1FFQA 4W9OA 1EIBA 2JX8A 2PPPA 3IKDA 2DWVA 1LL6A 4A0UA 3QOKA 4HARA 4DRNA 4ODLA 3ARRA 2KFWA 2LGOA 1T11A 5HWBA 2L2SA 3RM8A 1ZU8A 2Q5AA 1W1PA 1H0IA 2UZ5A 1HJXA 4ZS6A 1NWSA 1ZBCA 1J6YA 3FSBA 1GPFA 4G50A 4PTMA 1CTNA 1FKDA 3B7XA 1EDQA 2RUDA 4DRMA 1W9UA 1E15A 4GLXA 4L3NA 2DSUA 2M1IA 2OLHA 4MPKA 3L4HA 4P8XA 1XRVA 4JFMA 2M08A 3RMEA 1JNEA 4TNSA 4DWSA 3UQAA 1O6WA 2MLZA 1J4RA 4WIWA 4ODPA 1D6OA 2XP5A 1A7XA 2OFNA 3O5DA 3O5JA 3MDYB 3CGNA 3NI6A 5DIVA 4FAPA 2EZ5W 2MDIA 3ALFA 1FLCA 1E6NA 2IF4A 2YSBA 4W5UA 1I5HW 1FKBA 3WIJA 1KT1A 4GGQA 2PV1A 1LJYA 1SR0A 4JFIA 2WAEA 2XP4A 1NWTA 3WD3A 4G2PA 3O5MA 5HUAA 2WADA 2DK1A 3ODKA 1IX5A 2O9OA 4R5EA 4IT4A 4TW8A 1J4IA 2DSWA 2BA1A 1BKFA 1WAWA 2XPAA 3FY1A 2VCDA 1QPFA 3MCBB 2AOSA 3PRAA 1Q1CA 4KQZA 3KADA 4GIVA 4Z2JA 4LAXA 2MNTA 2A3EA 1Q6IA 4Z2GA 4DRQA 4U86A 3KZ7A 2MF9A 4JFLA 3OOBA 1W1YA 3BXWA 5HKGA 2ZQTA 1OWQA 1NWUA 3WL1A 4S3KA 3ARXA 1JMQA 3O5FA 1ZCNA 4R0XA 2JXWA 2PPNA 3AQUA 1KFWA 3UQIA 3GPKA 2ESCA 2ZQSA 3NRKA 1YW5A 3O5IA 2G8ZA 3WQVA 2WK2A 5HW6A 1Y0OA 1ZB5A 2DT3A 3O5KA 2QF8A 1QZ2A 1K9TA 1B6CA 2XP9A 1W1VA 4URIA 3O5OA 1F40A 3KAIA 4DRHA 2QRVA 4A0TA 3CHDA 2ZR4A 5HBFA 3LKXA 3M85A 1JNTA 4LAYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q6H A;  3KAF A;  2XP3 A;  1FKF A;  4MSP A;  1K9R A;  2JMF A;  4REX A;  2FAP A;  4BF8 A;  1PBK A;  4DRO A;  2ZAJ A;  3LE4 A;  1JNS A;  1D7I A;  2DG3 A;  2RE3 A;  5AHT A;  3FAP A;  4LAW A;  3UI4 A;  1WR7 A;  2RSE A;  3UF8 A;  2XP8 A;  4ODQ A;  1EG3 A;  1FKL A;  4W9P A;  2PV2 A;  4J4O A;  2LKN A;  4NNR A;  3IHZ A;  1WMV A;  4TX0 A;  2PBC A;  4U84 A;  2ZR6 A;  1FJD A;  5HWC A;  4ODM A;  4DRK A;  5HW7 A;  1N1A A;  3WH0 A;  2XP7 A;  3JYJ A;  1D7J A;  2F21 A;  3IK8 A;  3PRD A;  1FKJ A;  2RUC A;  2F2D A;  4ODO A;  4ITZ A;  3O5Q A;  2M8I A;  2ZQV A;  1TCO C;  1C9H A;  2MPH A;  4J4N A;  5HTG A;  1JVW A;  4IQC A;  3KAB A;  2DK7 A;  3UQB A;  1PIN A;  5DIU A;  1Q6U A;  3KAC A;  4JYS A;  3O5P A;  3KAG A;  1K9Q A;  3KAH A;  3JXV A;  1FKR A;  1U79 A;  2YSI A;  2KXQ A;  3TC5 A;  1QPL A;  2Y78 A;  2ITK A;  1NSG A;  2MLX A;  2KE0 A;  1M5Y A;  3IKG A;  2KR7 A;  1NMV A;  2XP6 A;  4TYO A;  2FKE A;  1FKG A;  2PPO A;  2RQS A;  1W26 A;  2YSG A;  3KCE A;  4W9Q A;  2M8J A;  1P5Q A;  2XPB A;  2N87 A;  4JFK A;  1FKI A;  2JZV A;  2L4J A;  3PRB A;  1F8A B;  1ROU A;  3VAW A;  2F4E A;  2ZR5 A;  3O5G A;  1HXV A;  1FAP A;  1FKH A;  3O5E A;  1BL4 A;  1ZK6 A;  1EQ3 A;  3CGM A;  2DG9 A;  4DRP A;  1KT0 A;  2LAJ A;  5J6E A;  4ODR A;  5I98 A;  5BXJ A;  4C02 B;  1EG4 A;  3RGC A;  3TDB A;  3JYM A;  5GPG A;  4E5R A;  5CQ2 A;  4O2T A;  4ODK A;  1EYM A;  2YSH A;  4TW6 A;  3PA7 A;  1YAT A;  4U85 A;  2YSF A;  2E45 A;  2PV3 A;  3O5L A;  2M2A A;  4JFJ A;  2ZQU A;  3LUO A;  4DIP A;  3CNG A;  2K8I A;  2KGJ A;  4IPX A;  3O5R A;  2DMV A;  4DH0 A;  4TW7 A;  2KI3 A;  2KO7 A;  2AWG A;  4DRJ A;  1FKS A;  4QIB A;  3EY6 A;  4MGV A;  4FN2 A;  4DZ2 A;  4IQ2 A;  5HW8 A;  2LPV A;  2D9F A;  4DRI A;  2DJY A;  2LJ4 A;  3M7N A;  1D7H A;  4QT3 A;  1R9H A;  2VN1 A;  5DIT A;  2JV4 A;  1FD9 A;  3UI5 A;  1J4H A;  4QT2 A;  4N19 A;  3UI6 A;  4DZ3 A;  3I6C A;  1FKT A;  1L1P A;  3H9R B;  1FKK A;  2MLY A;  4ODN A;  4LAV A;  3RFW A;  1TK7 A;  5B8I C;  2RUQ A;  2DG4 A;  3NTP A;  1NMW A;  5HT1 A;  1ROT A;  4DT4 A;  3TCZ A;  2M3O W;  5D75 A;  2RUR A;  4W9O A;  2JX8 A;  2PPP A;  3IKD A;  2DWV A;  4DRN A;  4ODL A;  2KFW A;  2LGO A;  1T11 A;  5HWB A;  2L2S A;  2Q5A A;  2UZ5 A;  1J6Y A;  4G50 A;  3B7X A;  1FKD A;  2RUD A;  4DRM A;  2M1I A;  3L4H A;  4JFM A;  2M08 A;  4TNS A;  3UQA A;  1O6W A;  2MLZ A;  1J4R A;  4ODP A;  1D6O A;  2XP5 A;  1A7X A;  2OFN A;  3O5D A;  3O5J A;  3MDY B;  3CGN A;  3NI6 A;  5DIV A;  4FAP A;  2EZ5 W;  2MDI A;  2IF4 A;  2YSB A;  1I5H W;  1FKB A;  1KT1 A;  4GGQ A;  2PV1 A;  4JFI A;  2XP4 A;  4G2P A;  3O5M A;  5HUA A;  2DK1 A;  3ODK A;  4TW8 A;  1J4I A;  2BA1 A;  1BKF A;  2XPA A;  2VCD A;  1QPF A;  1Q1C A;  3KAD A;  4GIV A;  4LAX A;  2MNT A;  1Q6I A;  4DRQ A;  4U86 A;  3KZ7 A;  2MF9 A;  4JFL A;  3OOB A;  5HKG A;  2ZQT A;  1JMQ A;  3O5F A;  1ZCN A;  4R0X A;  2JXW A;  2PPN A;  3UQI A;  3GPK A;  2ZQS A;  3NRK A;  1YW5 A;  3O5I A;  5HW6 A;  1Y0O A;  3O5K A;  1QZ2 A;  1B6C A;  2XP9 A;  3O5O A;  1F40 A;  3KAI A;  4DRH A;  2ZR4 A;  3M85 A;  1JNT A;  4LAY A; 
#chains in the Genus database with same CATH topology
 1Q6H A;  5GQB A;  3KAF A;  2PN0 A;  3RM4 A;  2XP3 A;  1FKF A;  2YBU A;  5DO2 A;  4MSP A;  1K9R A;  1XHG A;  2JMF A;  4ML4 A;  3GTY X;  4REX A;  2FAP A;  4BF8 A;  1PBK A;  2F23 A;  3ARP A;  4WJX A;  4DRO A;  2ZAJ A;  3LE4 A;  4WK9 A;  1JNS A;  1D7I A;  2DG3 A;  2RE3 A;  1EHN A;  5AHT A;  3WD4 A;  3FAP A;  1JND A;  1HKK A;  4LAW A;  2IUZ A;  3OA5 A;  3UI4 A;  2G41 A;  2A3A A;  4MNL A;  1WR7 A;  2DT2 A;  2RSE A;  3MQH A;  3UF8 A;  2XP8 A;  2A3C A;  2YBT A;  4ODQ A;  1EG3 A;  4DWS D;  1FKL A;  1W1T A;  3G6L A;  3GU0 A;  4W9P A;  5E5W A;  2PV2 A;  4J4O A;  2P4V A;  4Z2I A;  2LKN A;  4NNR A;  1ZBV A;  1WMV A;  3IHZ A;  4HBE A;  1LG1 A;  4TX0 A;  2PBC A;  2B31 A;  3W4R A;  4U84 A;  1D2K A;  2ZR6 A;  1FJD A;  1HKI A;  5E64 A;  5HWC A;  4ODM A;  4MTV A;  3ARY A;  4DRK A;  3ARW A;  5HW7 A;  1N1A A;  3WH0 A;  2XP7 A;  3JYJ A;  1D7J A;  2F21 A;  3IK8 A;  4AY1 A;  1TR8 A;  1FKJ A;  2RUC A;  3MQG A;  1E9L A;  3PRD A;  2F2D A;  4ODO A;  4ITZ A;  3O5Q A;  2M8I A;  3PR9 A;  2ZQV A;  2YAJ B;  1TCO C;  1C9H A;  1HKJ A;  2MPH A;  4J4N A;  5HTG A;  1TFV A;  2PI6 A;  1JVW A;  4LGX A;  4IQC A;  3KAB A;  2DK7 A;  5E65 A;  3UQB A;  1PIN A;  5DIU A;  1Q6U A;  3KAC A;  1HJV A;  3G6M A;  3WL0 A;  4JYS A;  3O5P A;  3KAG A;  1X6N A;  1K9Q A;  4S3J A;  3KAH A;  3JXV A;  1FKR A;  1U79 A;  4L72 B;  2YSI A;  2KXQ A;  3TC5 A;  1QPL A;  2Y78 A;  2ITK A;  5E62 A;  1NSG A;  2MLX A;  5U47 A;  2KE0 A;  1M5Y A;  3IKG A;  1VF8 A;  2KR7 A;  1NMV A;  2XP6 A;  4TYO A;  3MCB A;  3RM9 A;  1LG2 A;  2FKE A;  1FKG A;  2PPO A;  1NWR A;  2RQS A;  1W26 A;  4MAV A;  4Z2L A;  2YSG A;  1X6L A;  4ZPT R;  3KCE A;  4W9Q A;  1GOI A;  3ARV A;  2M8J A;  4ZPW R;  3CHF A;  1ITX A;  3B9D A;  1P5Q A;  1W9V A;  1O6I A;  2XPB A;  2DT0 A;  2N87 A;  2DSZ A;  1H0G A;  4JFK A;  1FKI A;  2JZV A;  2L4J A;  1OGG A;  4WKA A;  3CH9 A;  3PRB A;  4WKH A;  1F8A B;  4DWS B;  1ROU A;  3VAW A;  2F4E A;  2ZR5 A;  3O5G A;  1HXV A;  4P8U A;  3ARS A;  1FAP A;  2OWO A;  1LL7 A;  1FKH A;  3FS8 A;  3O5E A;  1BL4 A;  1ZK6 A;  4Q7N A;  3ARU A;  1EQ3 A;  3CGM A;  1E6Z A;  1WB0 A;  4P8W A;  3BMB A;  2DG9 A;  4DRP A;  1KT0 A;  2LAJ A;  1E6R A;  1ZL1 A;  1E6P A;  1UR9 A;  2WLY A;  5J6E A;  4ODR A;  5I98 A;  5E66 A;  4Z2K A;  4C02 B;  4Z2H A;  5BXJ A;  1EG4 A;  3B9A A;  3RGC A;  3WQW A;  3TDB A;  2DPE A;  2A3B A;  3JYM A;  2DT1 A;  4MNM A;  3CHC A;  5GPG A;  4E5R A;  5CQ2 A;  4O2T A;  4ODK A;  1EYM A;  3CHE A;  1UR8 A;  4WKF A;  3CZ8 A;  2YSH A;  4TW6 A;  3PA7 A;  1SYT A;  4XAK A;  5JH8 A;  1YAT A;  4U85 A;  3B9E A;  2YSF A;  3ART A;  2E45 A;  2PV3 A;  1NH6 A;  3O5L A;  2M2A A;  3ARZ A;  4JFJ A;  2DSV A;  2ZQU A;  3WD0 A;  3LUO A;  2FDM A;  4DIP A;  4DWS C;  3CNG A;  3ALG A;  3ARO A;  2K8I A;  3AS2 A;  3ARQ A;  2KGJ A;  5DEZ A;  3WD2 A;  4IT6 A;  4MNJ A;  4IPX A;  3O5R A;  2DMV A;  4DH0 A;  4TW7 A;  1WNO A;  4NZC A;  2KI3 A;  3PQH A;  2KO7 A;  3AS1 A;  2AWG A;  4DRJ A;  1FKS A;  1FFR A;  4QIB A;  3EY6 A;  3WKZ A;  3FXY A;  1ZBW A;  2O92 A;  4MGV A;  4FN2 A;  4HBO A;  4P8V A;  1W9P A;  4IQ2 A;  4DZ2 A;  5HW8 A;  4NSB A;  4QZV B;  2LPV A;  4MNK A;  2D9F A;  4DRI A;  2DJY A;  3LKX B;  2LJ4 A;  3M7N A;  3WD1 A;  1D7H A;  4KR0 B;  4QT3 A;  3FSC A;  4Q22 A;  3AS3 A;  1R9H A;  2VN1 A;  1HJW A;  5DIT A;  2JV4 A;  1FD9 A;  1HKM A;  3UI5 A;  1J4H A;  4QT2 A;  4N19 A;  3UI6 A;  4DZ3 A;  3I6C A;  1FKT A;  1RD6 A;  1L1P A;  1LQ0 A;  1ZBK A;  1GUV A;  3H9R B;  1FKK A;  2Y8N B;  2MLY A;  4ODN A;  3EIP A;  5GPR A;  2WM0 A;  4LAV A;  1E44 A;  5DF0 A;  3RFW A;  1TK7 A;  4ZPV R;  2WLZ A;  1OGB A;  5B8I C;  3AS0 A;  2RUQ A;  2DG4 A;  3B8S A;  4UDM A;  3NTP A;  1RP5 A;  1NMW A;  5HT1 A;  1ROT A;  4DT4 A;  1LL4 A;  3TCZ A;  2M3O W;  1JCH B;  5D75 A;  2RUR A;  1FFQ A;  4W9O A;  1EIB A;  2JX8 A;  2PPP A;  3IKD A;  2DWV A;  1LL6 A;  4A0U A;  3QOK A;  4HAR A;  4DRN A;  4ODL A;  2ETN A;  3ARR A;  2KFW A;  2LGO A;  1T11 A;  5HWB A;  2L2S A;  3RM8 A;  1ZU8 A;  2Q5A A;  1W1P A;  1H0I A;  2UZ5 A;  1HJX A;  4ZS6 A;  1NWS A;  1ZBC A;  1J6Y A;  3FSB A;  1GPF A;  4G50 A;  4PTM A;  1CTN A;  1FKD A;  3B7X A;  1EDQ A;  2RUD A;  4DRM A;  1W9U A;  1E15 A;  4GLX A;  4L3N A;  2DSU A;  2M1I A;  2OLH A;  4MPK A;  3L4H A;  4P8X A;  1XRV A;  4JFM A;  2M08 A;  3RME A;  1JNE A;  4TNS A;  4DWS A;  3UQA A;  1O6W A;  2MLZ A;  1J4R A;  4WIW A;  4ODP A;  1D6O A;  2XP5 A;  1A7X A;  2OFN A;  3O5D A;  3O5J A;  3MDY B;  3CGN A;  3NI6 A;  5DIV A;  4FAP A;  2EZ5 W;  2MDI A;  3ALF A;  1FLC A;  1E6N A;  2IF4 A;  2YSB A;  4W5U A;  1I5H W;  1FKB A;  3WIJ A;  1KT1 A;  4GGQ A;  2PV1 A;  1LJY A;  1SR0 A;  4JFI A;  2WAE A;  2XP4 A;  1NWT A;  3WD3 A;  4G2P A;  2EUL A;  3O5M A;  5HUA A;  2WAD A;  2DK1 A;  3ODK A;  1IX5 A;  2O9O A;  4R5E A;  4IT4 A;  4TW8 A;  1J4I A;  2DSW A;  2BA1 A;  1BKF A;  1WAW A;  2XPA A;  3FY1 A;  2VCD A;  1QPF A;  3MCB B;  2AOS A;  3PRA A;  2B5U B;  1Q1C A;  4KQZ A;  3KAD A;  4GIV A;  4Z2J A;  4LAX A;  2MNT A;  2A3E A;  1Q6I A;  4Z2G A;  4DRQ A;  4U86 A;  3KZ7 A;  2MF9 A;  4JFL A;  3OOB A;  1W1Y A;  3BXW A;  5HKG A;  2ZQT A;  1OWQ A;  1NWU A;  3WL1 A;  4S3K A;  3ARX A;  1JMQ A;  3O5F A;  1ZCN A;  4R0X A;  2JXW A;  2PPN A;  3AQU A;  1KFW A;  3UQI A;  3GPK A;  2ESC A;  2ZQS A;  3NRK A;  1YW5 A;  3O5I A;  2G8Z A;  3WQV A;  2WK2 A;  5HW6 A;  1Y0O A;  1ZB5 A;  2DT3 A;  3O5K A;  2QF8 A;  1QZ2 A;  1GRJ A;  1K9T A;  1B6C A;  2XP9 A;  1W1V A;  4URI A;  3O5O A;  1F40 A;  3KAI A;  4DRH A;  2QRV A;  4A0T A;  3CHD A;  2ZR4 A;  5HBF A;  3LKX A;  3M85 A;  1JNT A;  4LAY A; 
#chains in the Genus database with same CATH homology
 1Q6H A;  5GQB A;  3KAF A;  3RM4 A;  2XP3 A;  1FKF A;  2YBU A;  5DO2 A;  4MSP A;  1K9R A;  1XHG A;  2JMF A;  4ML4 A;  4REX A;  2FAP A;  4BF8 A;  1PBK A;  3ARP A;  4WJX A;  4DRO A;  2ZAJ A;  3LE4 A;  4WK9 A;  1JNS A;  1D7I A;  2DG3 A;  2RE3 A;  1EHN A;  5AHT A;  3WD4 A;  3FAP A;  1JND A;  1HKK A;  4LAW A;  2IUZ A;  3OA5 A;  3UI4 A;  2G41 A;  2A3A A;  4MNL A;  1WR7 A;  2DT2 A;  2RSE A;  3MQH A;  3UF8 A;  2XP8 A;  2A3C A;  2YBT A;  4ODQ A;  1EG3 A;  4DWS D;  1FKL A;  1W1T A;  3G6L A;  4W9P A;  5E5W A;  2PV2 A;  4J4O A;  4Z2I A;  2LKN A;  4NNR A;  1ZBV A;  1WMV A;  3IHZ A;  4HBE A;  1LG1 A;  4TX0 A;  2PBC A;  2B31 A;  3W4R A;  4U84 A;  1D2K A;  2ZR6 A;  1FJD A;  1HKI A;  5E64 A;  5HWC A;  4ODM A;  4MTV A;  3ARY A;  4DRK A;  3ARW A;  5HW7 A;  1N1A A;  3WH0 A;  2XP7 A;  3JYJ A;  1D7J A;  2F21 A;  3IK8 A;  4AY1 A;  1TR8 A;  1FKJ A;  2RUC A;  3MQG A;  1E9L A;  3PRD A;  2F2D A;  4ODO A;  4ITZ A;  3O5Q A;  2M8I A;  3PR9 A;  2ZQV A;  2YAJ B;  1TCO C;  1C9H A;  1HKJ A;  2MPH A;  4J4N A;  5HTG A;  1TFV A;  2PI6 A;  1JVW A;  4LGX A;  4IQC A;  3KAB A;  2DK7 A;  5E65 A;  3UQB A;  1PIN A;  5DIU A;  1Q6U A;  3KAC A;  1HJV A;  3G6M A;  3WL0 A;  4JYS A;  3O5P A;  3KAG A;  1X6N A;  1K9Q A;  4S3J A;  3KAH A;  3JXV A;  1FKR A;  1U79 A;  4L72 B;  2YSI A;  2KXQ A;  3TC5 A;  1QPL A;  2Y78 A;  2ITK A;  5E62 A;  1NSG A;  2MLX A;  5U47 A;  2KE0 A;  1M5Y A;  3IKG A;  1VF8 A;  2KR7 A;  1NMV A;  2XP6 A;  4TYO A;  3MCB A;  3RM9 A;  1LG2 A;  2FKE A;  1FKG A;  2PPO A;  1NWR A;  2RQS A;  1W26 A;  4MAV A;  4Z2L A;  2YSG A;  1X6L A;  4ZPT R;  3KCE A;  4W9Q A;  1GOI A;  3ARV A;  2M8J A;  4ZPW R;  3CHF A;  1ITX A;  3B9D A;  1P5Q A;  1W9V A;  1O6I A;  2XPB A;  2DT0 A;  2N87 A;  2DSZ A;  1H0G A;  4JFK A;  1FKI A;  2JZV A;  2L4J A;  1OGG A;  4WKA A;  3CH9 A;  3PRB A;  4WKH A;  1F8A B;  4DWS B;  1ROU A;  3VAW A;  2F4E A;  2ZR5 A;  3O5G A;  1HXV A;  4P8U A;  3ARS A;  1FAP A;  2OWO A;  1LL7 A;  1FKH A;  3FS8 A;  3O5E A;  1BL4 A;  1ZK6 A;  4Q7N A;  3ARU A;  1EQ3 A;  3CGM A;  1E6Z A;  1WB0 A;  4P8W A;  2DG9 A;  4DRP A;  1KT0 A;  2LAJ A;  1E6R A;  1ZL1 A;  1E6P A;  1UR9 A;  2WLY A;  5J6E A;  4ODR A;  5I98 A;  5E66 A;  4Z2K A;  4C02 B;  4Z2H A;  5BXJ A;  1EG4 A;  3B9A A;  3RGC A;  3WQW A;  3TDB A;  2DPE A;  2A3B A;  3JYM A;  2DT1 A;  4MNM A;  3CHC A;  5GPG A;  4E5R A;  5CQ2 A;  4O2T A;  4ODK A;  1EYM A;  3CHE A;  1UR8 A;  4WKF A;  3CZ8 A;  2YSH A;  4TW6 A;  3PA7 A;  1SYT A;  4XAK A;  5JH8 A;  1YAT A;  4U85 A;  3B9E A;  2YSF A;  3ART A;  2E45 A;  2PV3 A;  1NH6 A;  3O5L A;  2M2A A;  3ARZ A;  4JFJ A;  2DSV A;  2ZQU A;  3WD0 A;  3LUO A;  2FDM A;  4DIP A;  4DWS C;  3CNG A;  3ALG A;  3ARO A;  2K8I A;  3AS2 A;  3ARQ A;  2KGJ A;  5DEZ A;  3WD2 A;  4IT6 A;  4MNJ A;  4IPX A;  3O5R A;  2DMV A;  4DH0 A;  4TW7 A;  1WNO A;  4NZC A;  2KI3 A;  3PQH A;  2KO7 A;  3AS1 A;  2AWG A;  4DRJ A;  1FKS A;  1FFR A;  4QIB A;  3EY6 A;  3WKZ A;  3FXY A;  1ZBW A;  2O92 A;  4MGV A;  4FN2 A;  4HBO A;  4P8V A;  1W9P A;  4IQ2 A;  4DZ2 A;  5HW8 A;  4NSB A;  4QZV B;  2LPV A;  4MNK A;  2D9F A;  4DRI A;  2DJY A;  3LKX B;  2LJ4 A;  3M7N A;  3WD1 A;  1D7H A;  4KR0 B;  4QT3 A;  3FSC A;  4Q22 A;  3AS3 A;  1R9H A;  2VN1 A;  1HJW A;  5DIT A;  2JV4 A;  1FD9 A;  1HKM A;  3UI5 A;  1J4H A;  4QT2 A;  4N19 A;  3UI6 A;  4DZ3 A;  3I6C A;  1FKT A;  1RD6 A;  1L1P A;  1LQ0 A;  1ZBK A;  1GUV A;  3H9R B;  1FKK A;  2Y8N B;  2MLY A;  4ODN A;  5GPR A;  2WM0 A;  4LAV A;  5DF0 A;  3RFW A;  1TK7 A;  4ZPV R;  2WLZ A;  1OGB A;  5B8I C;  3AS0 A;  2RUQ A;  2DG4 A;  3B8S A;  3NTP A;  1RP5 A;  1NMW A;  5HT1 A;  1ROT A;  4DT4 A;  1LL4 A;  3TCZ A;  2M3O W;  5D75 A;  2RUR A;  1FFQ A;  4W9O A;  1EIB A;  2JX8 A;  2PPP A;  3IKD A;  2DWV A;  1LL6 A;  4A0U A;  3QOK A;  4HAR A;  4DRN A;  4ODL A;  3ARR A;  2KFW A;  2LGO A;  1T11 A;  5HWB A;  2L2S A;  3RM8 A;  1ZU8 A;  2Q5A A;  1W1P A;  1H0I A;  2UZ5 A;  1HJX A;  4ZS6 A;  1NWS A;  1ZBC A;  1J6Y A;  3FSB A;  1GPF A;  4G50 A;  4PTM A;  1CTN A;  1FKD A;  3B7X A;  1EDQ A;  2RUD A;  4DRM A;  1W9U A;  1E15 A;  4GLX A;  4L3N A;  2DSU A;  2M1I A;  2OLH A;  4MPK A;  3L4H A;  4P8X A;  1XRV A;  4JFM A;  2M08 A;  3RME A;  1JNE A;  4TNS A;  4DWS A;  3UQA A;  1O6W A;  2MLZ A;  1J4R A;  4WIW A;  4ODP A;  1D6O A;  2XP5 A;  1A7X A;  2OFN A;  3O5D A;  3O5J A;  3MDY B;  3CGN A;  3NI6 A;  5DIV A;  4FAP A;  2EZ5 W;  2MDI A;  3ALF A;  1FLC A;  1E6N A;  2IF4 A;  2YSB A;  4W5U A;  1I5H W;  1FKB A;  3WIJ A;  1KT1 A;  4GGQ A;  2PV1 A;  1LJY A;  1SR0 A;  4JFI A;  2WAE A;  2XP4 A;  1NWT A;  3WD3 A;  4G2P A;  3O5M A;  5HUA A;  2WAD A;  2DK1 A;  3ODK A;  1IX5 A;  2O9O A;  4R5E A;  4IT4 A;  4TW8 A;  1J4I A;  2DSW A;  2BA1 A;  1BKF A;  1WAW A;  2XPA A;  3FY1 A;  2VCD A;  1QPF A;  3MCB B;  2AOS A;  3PRA A;  1Q1C A;  4KQZ A;  3KAD A;  4GIV A;  4Z2J A;  4LAX A;  2MNT A;  2A3E A;  1Q6I A;  4Z2G A;  4DRQ A;  4U86 A;  3KZ7 A;  2MF9 A;  4JFL A;  3OOB A;  1W1Y A;  3BXW A;  5HKG A;  2ZQT A;  1OWQ A;  1NWU A;  3WL1 A;  4S3K A;  3ARX A;  1JMQ A;  3O5F A;  1ZCN A;  4R0X A;  2JXW A;  2PPN A;  3AQU A;  1KFW A;  3UQI A;  3GPK A;  2ESC A;  2ZQS A;  3NRK A;  1YW5 A;  3O5I A;  2G8Z A;  3WQV A;  2WK2 A;  5HW6 A;  1Y0O A;  1ZB5 A;  2DT3 A;  3O5K A;  2QF8 A;  1QZ2 A;  1K9T A;  1B6C A;  2XP9 A;  1W1V A;  4URI A;  3O5O A;  1F40 A;  3KAI A;  4DRH A;  2QRV A;  4A0T A;  3CHD A;  2ZR4 A;  5HBF A;  3LKX A;  3M85 A;  1JNT A;  4LAY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...