1K9RA

Yap65 ww domain complexed to acetyl-plppy
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
40
structure length
40
Chain Sequence
FEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 65 kDa Yes-associated protein
publication title Solution structures of the YAP65 WW domain and the variant L30 K in complex with the peptides GTPPPPYTVG, N-(n-octyl)-GPPPY and PLPPY and the application of peptide libraries reveal a minimal binding epitope.
pubmed doi rcsb
molecule tags Structural protein
total genus 3
structure length 40
sequence length 40
ec nomenclature
pdb deposition date 2001-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 1k9rA00
1NMVA 3KADA 3KAGA 2DK1A 2YSHA 3KAHA 2JV4A 2YSFA 4REXA 2XP4A 2ZQVA 3NTPA 1O6WA 3ODKA 2DJYA 4U86A 2ZQSA 2ZR5A 2LAJA 2ITKA 2YSGA 4U85A 2YSBA 3KCEA 2XP8A 2DWVA 5CQ2A 4QIBA 2F21A 1JMQA 2M8JA 2KXQA 2ZR6A 1F8AB 2BA1A 2XP5A 3TDBA 2JXWA 2DK7A 1PINA 3OOBA 2EZ5W 2YSIA 2XP9A 2XP6A 1EG3A 2ZQTA 1K9RA 2MDIA 2L4JA 3L4HA 2M3OW 2XPAA 2XP7A 3KAFA 2DMVA 1K9QA 2Q5AA 2RE3A 5AHTA 1WR7A 2JMFA 3CNGA 3TC5A 3WH0A 1WMVA 4U84A 3TCZA 4E5RA 3KABA 2ZQUA 2E45A 1YW5A 1EG4A 3M85A 2ZAJA 1TK7A 3M7NA 2ZR4A 3LE4A 3KAIA 2JX8A 2XPBA 1ZCNA 1I5HW 2M8IA 2XP3A
chains in the Genus database with same CATH superfamily
1NMVA 3KADA 3KAGA 2DK1A 4A0TA 2WAEA 2YSHA 3LKXA 3KAHA 2JV4A 2YSFA 4REXA 2XP4A 2ZQVA 3NTPA 1O6WA 5U47A 3ODKA 2DJYA 4U86A 2ZQSA 2ZR5A 2LAJA 5E66A 2ITKA 3FSBA 2YSGA 1I5HW 4U85A 2Y8NB 2YSBA 3KCEA 2XP8A 2DWVA 5CQ2A 4QIBA 2F21A 1JMQA 2M8JA 2KXQA 1TR8A 2ZR6A 3PQHA 1F8AB 2BA1A 2XP5A 3TDBA 2JXWA 2DK7A 1PINA 3OOBA 2EZ5W 2YSIA 2XP9A 2XP6A 1EG3A 2ZQTA 1K9RA 2MDIA 2L4JA 3L4HA 2M3OW 2XPAA 2XP7A 3KAFA 2DMVA 1K9QA 2Q5AA 2RE3A 5AHTA 5E5WA 4A0UA 3MQGA 1WR7A 2JMFA 3CNGA 3TC5A 3WH0A 2YAJB 3FSCA 1WMVA 4U84A 5E65A 2WADA 3TCZA 5E62A 1FLCA 5E64A 4E5RA 3KABA 1RP5A 2ZQUA 2E45A 3MQHA 3FS8A 1YW5A 1EG4A 3M85A 2ZAJA 2OWOA 1TK7A 3MCBB 3M7NA 2ZR4A 4GLXA 2QRVA 3LE4A 3KAIA 3LKXB 2JX8A 2XPBA 1ZCNA 3MCBA 2M8IA 2XP3A
chains in the Genus database with same CATH topology
1NMVA 3KADA 3KAGA 2DK1A 4A0TA 2WAEA 2YSHA 3LKXA 3KAHA 2JV4A 2YSFA 4REXA 2XP4A 2ZQVA 3NTPA 1O6WA 5U47A 3ODKA 2DJYA 4U86A 2ZQSA 2ZR5A 2LAJA 5E66A 2ITKA 3FSBA 2YSGA 1I5HW 4U85A 2Y8NB 2YSBA 3KCEA 2XP8A 2DWVA 5CQ2A 4QIBA 2F21A 1JMQA 2M8JA 2KXQA 1TR8A 2ZR6A 3PQHA 1F8AB 2BA1A 2XP5A 3TDBA 2JXWA 2DK7A 1PINA 3OOBA 2EZ5W 2YSIA 2XP9A 2XP6A 1EG3A 2ZQTA 1K9RA 2MDIA 2L4JA 3L4HA 2M3OW 2XPAA 2XP7A 3KAFA 2DMVA 1K9QA 2Q5AA 2RE3A 5AHTA 5E5WA 4A0UA 3MQGA 1WR7A 2JMFA 3CNGA 3TC5A 3WH0A 2YAJB 3FSCA 1WMVA 4U84A 5E65A 2WADA 3TCZA 5E62A 1FLCA 5E64A 4E5RA 3KABA 1RP5A 2ZQUA 2E45A 3MQHA 3FS8A 1YW5A 1EG4A 3M85A 2ZAJA 2OWOA 1TK7A 3MCBB 3M7NA 2ZR4A 4GLXA 2QRVA 3LE4A 3KAIA 3LKXB 2JX8A 2XPBA 1ZCNA 3MCBA 2M8IA 2XP3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NMV A;  3KAD A;  3KAG A;  2DK1 A;  2YSH A;  3KAH A;  2JV4 A;  2YSF A;  4REX A;  2XP4 A;  2ZQV A;  3NTP A;  1O6W A;  3ODK A;  2DJY A;  4U86 A;  2ZQS A;  2ZR5 A;  2LAJ A;  2ITK A;  2YSG A;  4U85 A;  2YSB A;  3KCE A;  2XP8 A;  2DWV A;  5CQ2 A;  4QIB A;  2F21 A;  1JMQ A;  2M8J A;  2KXQ A;  2ZR6 A;  1F8A B;  2BA1 A;  2XP5 A;  3TDB A;  2JXW A;  2DK7 A;  1PIN A;  3OOB A;  2EZ5 W;  2YSI A;  2XP9 A;  2XP6 A;  1EG3 A;  2ZQT A;  1K9R A;  2MDI A;  2L4J A;  3L4H A;  2M3O W;  2XPA A;  2XP7 A;  3KAF A;  2DMV A;  1K9Q A;  2Q5A A;  2RE3 A;  5AHT A;  1WR7 A;  2JMF A;  3CNG A;  3TC5 A;  3WH0 A;  1WMV A;  4U84 A;  3TCZ A;  4E5R A;  3KAB A;  2ZQU A;  2E45 A;  1YW5 A;  1EG4 A;  3M85 A;  2ZAJ A;  1TK7 A;  3M7N A;  2ZR4 A;  3LE4 A;  3KAI A;  2JX8 A;  2XPB A;  1ZCN A;  1I5H W;  2M8I A;  2XP3 A; 
#chains in the Genus database with same CATH topology
 1NMV A;  3KAD A;  3KAG A;  2DK1 A;  4A0T A;  2WAE A;  2YSH A;  3LKX A;  3KAH A;  2JV4 A;  2YSF A;  4REX A;  2XP4 A;  2ZQV A;  3NTP A;  1O6W A;  5U47 A;  3ODK A;  2DJY A;  4U86 A;  2ZQS A;  2ZR5 A;  2LAJ A;  5E66 A;  2ITK A;  3FSB A;  2YSG A;  1I5H W;  4U85 A;  2Y8N B;  2YSB A;  3KCE A;  2XP8 A;  2DWV A;  5CQ2 A;  4QIB A;  2F21 A;  1JMQ A;  2M8J A;  2KXQ A;  1TR8 A;  2ZR6 A;  3PQH A;  1F8A B;  2BA1 A;  2XP5 A;  3TDB A;  2JXW A;  2DK7 A;  1PIN A;  3OOB A;  2EZ5 W;  2YSI A;  2XP9 A;  2XP6 A;  1EG3 A;  2ZQT A;  1K9R A;  2MDI A;  2L4J A;  3L4H A;  2M3O W;  2XPA A;  2XP7 A;  3KAF A;  2DMV A;  1K9Q A;  2Q5A A;  2RE3 A;  5AHT A;  5E5W A;  4A0U A;  3MQG A;  1WR7 A;  2JMF A;  3CNG A;  3TC5 A;  3WH0 A;  2YAJ B;  3FSC A;  1WMV A;  4U84 A;  5E65 A;  2WAD A;  3TCZ A;  5E62 A;  1FLC A;  5E64 A;  4E5R A;  3KAB A;  1RP5 A;  2ZQU A;  2E45 A;  3MQH A;  3FS8 A;  1YW5 A;  1EG4 A;  3M85 A;  2ZAJ A;  2OWO A;  1TK7 A;  3MCB B;  3M7N A;  2ZR4 A;  4GLX A;  2QRV A;  3LE4 A;  3KAI A;  3LKX B;  2JX8 A;  2XPB A;  1ZCN A;  3MCB A;  2M8I A;  2XP3 A; 
#chains in the Genus database with same CATH homology
 1NMV A;  3KAD A;  3KAG A;  2DK1 A;  4A0T A;  2WAE A;  2YSH A;  3LKX A;  3KAH A;  2JV4 A;  2YSF A;  4REX A;  2XP4 A;  2ZQV A;  3NTP A;  1O6W A;  5U47 A;  3ODK A;  2DJY A;  4U86 A;  2ZQS A;  2ZR5 A;  2LAJ A;  5E66 A;  2ITK A;  3FSB A;  2YSG A;  1I5H W;  4U85 A;  2Y8N B;  2YSB A;  3KCE A;  2XP8 A;  2DWV A;  5CQ2 A;  4QIB A;  2F21 A;  1JMQ A;  2M8J A;  2KXQ A;  1TR8 A;  2ZR6 A;  3PQH A;  1F8A B;  2BA1 A;  2XP5 A;  3TDB A;  2JXW A;  2DK7 A;  1PIN A;  3OOB A;  2EZ5 W;  2YSI A;  2XP9 A;  2XP6 A;  1EG3 A;  2ZQT A;  1K9R A;  2MDI A;  2L4J A;  3L4H A;  2M3O W;  2XPA A;  2XP7 A;  3KAF A;  2DMV A;  1K9Q A;  2Q5A A;  2RE3 A;  5AHT A;  5E5W A;  4A0U A;  3MQG A;  1WR7 A;  2JMF A;  3CNG A;  3TC5 A;  3WH0 A;  2YAJ B;  3FSC A;  1WMV A;  4U84 A;  5E65 A;  2WAD A;  3TCZ A;  5E62 A;  1FLC A;  5E64 A;  4E5R A;  3KAB A;  1RP5 A;  2ZQU A;  2E45 A;  3MQH A;  3FS8 A;  1YW5 A;  1EG4 A;  3M85 A;  2ZAJ A;  2OWO A;  1TK7 A;  3MCB B;  3M7N A;  2ZR4 A;  4GLX A;  2QRV A;  3LE4 A;  3KAI A;  3LKX B;  2JX8 A;  2XPB A;  1ZCN A;  3MCB A;  2M8I A;  2XP3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...