1K9RA

Yap65 ww domain complexed to acetyl-plppy
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
40
structure length
40
Chain Sequence
FEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords 65 kDa Yes-associated protein
publication title Solution structures of the YAP65 WW domain and the variant L30 K in complex with the peptides GTPPPPYTVG, N-(n-octyl)-GPPPY and PLPPY and the application of peptide libraries reveal a minimal binding epitope.
pubmed doi rcsb
total genus 3
structure length 40
sequence length 40
ec nomenclature
pdb deposition date 2001-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 1k9rA00
2ZQVA 2JX8A 3KCEA 1O6WA 1JMQA 2JMFA 2XP5A 2XP8A 2XPBA 2ZQTA 4E5RA 2DWVA 2MDIA 2XP9A 2M3OW 2DK1A 3TC5A 1YW5A 2RE3A 2ZQSA 2M8JA 2M8IA 2JXWA 2YSFA 3LE4A 2ZQUA 1I5HW 2BA1A 2XP4A 4U85A 2YSBA 2ZR4A 3WH0A 3M85A 2L4JA 3KADA 3KAFA 2ITKA 2EZ5W 1NMVA 3NTPA 2LAJA 1F8AB 3KABA 5AHTA 2YSIA 2XPAA 1EG3A 5CQ2A 2Q5AA 4QIBA 2ZAJA 4U86A 2DJYA 1WMVA 3KAHA 1EG4A 2ZR5A 1TK7A 2E45A 3CNGA 3TDBA 3M7NA 2JV4A 2DK7A 1ZCNA 3ODKA 3TCZA 2DMVA 2F21A 2ZR6A 2KXQA 3L4HA 1PINA 2YSHA 4REXA 3OOBA 1K9RA 2YSGA 3KAGA 1WR7A 3KAIA 2XP6A 4U84A 1K9QA 2XP7A 2XP3A
chains in the Genus database with same CATH superfamily
2ZQVA 2JX8A 3KCEA 1O6WA 2WAEA 3FSCA 1JMQA 2JMFA 5E65A 2XP5A 5E5WA 3PQHA 2XP8A 2XPBA 2ZQTA 2WADA 4E5RA 2DWVA 2QRVA 2MDIA 2XP9A 2M3OW 2DK1A 3TC5A 1YW5A 2RE3A 2ZQSA 2M8JA 2M8IA 2JXWA 2YSFA 3MQHA 3LE4A 2ZQUA 1I5HW 1FLCA 2BA1A 2XP4A 4U85A 2YSBA 2ZR4A 3WH0A 3LKXA 3M85A 3MQGA 4GLXA 2L4JA 3KADA 3FSBA 3KAFA 4A0TA 2ITKA 3FS8A 2EZ5W 1NMVA 1TR8A 3NTPA 2LAJA 3LKXB 1F8AB 3KABA 5AHTA 2YSIA 2YAJB 2XPAA 2Y8NB 1EG3A 5CQ2A 2Q5AA 4QIBA 2ZAJA 4U86A 1RP5A 2DJYA 1WMVA 3KAHA 5U47A 1EG4A 2ZR5A 1TK7A 4A0UA 2E45A 3CNGA 3TDBA 3M7NA 2JV4A 5E64A 2DK7A 1ZCNA 3ODKA 5E62A 3TCZA 2OWOA 2DMVA 3MCBB 2F21A 2ZR6A 2KXQA 3L4HA 1PINA 2YSHA 4REXA 3OOBA 1K9RA 2YSGA 3KAGA 1WR7A 3KAIA 5E66A 2XP6A 4U84A 1K9QA 3MCBA 2XP7A 2XP3A
chains in the Genus database with same CATH topology
2ZQVA 2JX8A 3KCEA 1O6WA 2WAEA 3FSCA 1JMQA 2JMFA 5E65A 2XP5A 5E5WA 3PQHA 2XP8A 2XPBA 2ZQTA 2WADA 4E5RA 2DWVA 2QRVA 2MDIA 2XP9A 2M3OW 2DK1A 3TC5A 1YW5A 2RE3A 2ZQSA 2M8JA 2M8IA 2JXWA 2YSFA 3MQHA 3LE4A 2ZQUA 1I5HW 1FLCA 2BA1A 2XP4A 4U85A 2YSBA 2ZR4A 3WH0A 3LKXA 3M85A 3MQGA 4GLXA 2L4JA 3KADA 3FSBA 3KAFA 4A0TA 2ITKA 3FS8A 2EZ5W 1NMVA 1TR8A 3NTPA 2LAJA 3LKXB 1F8AB 3KABA 5AHTA 2YSIA 2YAJB 2XPAA 2Y8NB 1EG3A 5CQ2A 2Q5AA 4QIBA 2ZAJA 4U86A 1RP5A 2DJYA 1WMVA 3KAHA 5U47A 1EG4A 2ZR5A 1TK7A 4A0UA 2E45A 3CNGA 3TDBA 3M7NA 2JV4A 5E64A 2DK7A 1ZCNA 3ODKA 5E62A 3TCZA 2OWOA 2DMVA 3MCBB 2F21A 2ZR6A 2KXQA 3L4HA 1PINA 2YSHA 4REXA 3OOBA 1K9RA 2YSGA 3KAGA 1WR7A 3KAIA 5E66A 2XP6A 4U84A 1K9QA 3MCBA 2XP7A 2XP3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZQV A;  2JX8 A;  3KCE A;  1O6W A;  1JMQ A;  2JMF A;  2XP5 A;  2XP8 A;  2XPB A;  2ZQT A;  4E5R A;  2DWV A;  2MDI A;  2XP9 A;  2M3O W;  2DK1 A;  3TC5 A;  1YW5 A;  2RE3 A;  2ZQS A;  2M8J A;  2M8I A;  2JXW A;  2YSF A;  3LE4 A;  2ZQU A;  1I5H W;  2BA1 A;  2XP4 A;  4U85 A;  2YSB A;  2ZR4 A;  3WH0 A;  3M85 A;  2L4J A;  3KAD A;  3KAF A;  2ITK A;  2EZ5 W;  1NMV A;  3NTP A;  2LAJ A;  1F8A B;  3KAB A;  5AHT A;  2YSI A;  2XPA A;  1EG3 A;  5CQ2 A;  2Q5A A;  4QIB A;  2ZAJ A;  4U86 A;  2DJY A;  1WMV A;  3KAH A;  1EG4 A;  2ZR5 A;  1TK7 A;  2E45 A;  3CNG A;  3TDB A;  3M7N A;  2JV4 A;  2DK7 A;  1ZCN A;  3ODK A;  3TCZ A;  2DMV A;  2F21 A;  2ZR6 A;  2KXQ A;  3L4H A;  1PIN A;  2YSH A;  4REX A;  3OOB A;  1K9R A;  2YSG A;  3KAG A;  1WR7 A;  3KAI A;  2XP6 A;  4U84 A;  1K9Q A;  2XP7 A;  2XP3 A; 
#chains in the Genus database with same CATH topology
 2ZQV A;  2JX8 A;  3KCE A;  1O6W A;  2WAE A;  3FSC A;  1JMQ A;  2JMF A;  5E65 A;  2XP5 A;  5E5W A;  3PQH A;  2XP8 A;  2XPB A;  2ZQT A;  2WAD A;  4E5R A;  2DWV A;  2QRV A;  2MDI A;  2XP9 A;  2M3O W;  2DK1 A;  3TC5 A;  1YW5 A;  2RE3 A;  2ZQS A;  2M8J A;  2M8I A;  2JXW A;  2YSF A;  3MQH A;  3LE4 A;  2ZQU A;  1I5H W;  1FLC A;  2BA1 A;  2XP4 A;  4U85 A;  2YSB A;  2ZR4 A;  3WH0 A;  3LKX A;  3M85 A;  3MQG A;  4GLX A;  2L4J A;  3KAD A;  3FSB A;  3KAF A;  4A0T A;  2ITK A;  3FS8 A;  2EZ5 W;  1NMV A;  1TR8 A;  3NTP A;  2LAJ A;  3LKX B;  1F8A B;  3KAB A;  5AHT A;  2YSI A;  2YAJ B;  2XPA A;  2Y8N B;  1EG3 A;  5CQ2 A;  2Q5A A;  4QIB A;  2ZAJ A;  4U86 A;  1RP5 A;  2DJY A;  1WMV A;  3KAH A;  5U47 A;  1EG4 A;  2ZR5 A;  1TK7 A;  4A0U A;  2E45 A;  3CNG A;  3TDB A;  3M7N A;  2JV4 A;  5E64 A;  2DK7 A;  1ZCN A;  3ODK A;  5E62 A;  3TCZ A;  2OWO A;  2DMV A;  3MCB B;  2F21 A;  2ZR6 A;  2KXQ A;  3L4H A;  1PIN A;  2YSH A;  4REX A;  3OOB A;  1K9R A;  2YSG A;  3KAG A;  1WR7 A;  3KAI A;  5E66 A;  2XP6 A;  4U84 A;  1K9Q A;  3MCB A;  2XP7 A;  2XP3 A; 
#chains in the Genus database with same CATH homology
 2ZQV A;  2JX8 A;  3KCE A;  1O6W A;  2WAE A;  3FSC A;  1JMQ A;  2JMF A;  5E65 A;  2XP5 A;  5E5W A;  3PQH A;  2XP8 A;  2XPB A;  2ZQT A;  2WAD A;  4E5R A;  2DWV A;  2QRV A;  2MDI A;  2XP9 A;  2M3O W;  2DK1 A;  3TC5 A;  1YW5 A;  2RE3 A;  2ZQS A;  2M8J A;  2M8I A;  2JXW A;  2YSF A;  3MQH A;  3LE4 A;  2ZQU A;  1I5H W;  1FLC A;  2BA1 A;  2XP4 A;  4U85 A;  2YSB A;  2ZR4 A;  3WH0 A;  3LKX A;  3M85 A;  3MQG A;  4GLX A;  2L4J A;  3KAD A;  3FSB A;  3KAF A;  4A0T A;  2ITK A;  3FS8 A;  2EZ5 W;  1NMV A;  1TR8 A;  3NTP A;  2LAJ A;  3LKX B;  1F8A B;  3KAB A;  5AHT A;  2YSI A;  2YAJ B;  2XPA A;  2Y8N B;  1EG3 A;  5CQ2 A;  2Q5A A;  4QIB A;  2ZAJ A;  4U86 A;  1RP5 A;  2DJY A;  1WMV A;  3KAH A;  5U47 A;  1EG4 A;  2ZR5 A;  1TK7 A;  4A0U A;  2E45 A;  3CNG A;  3TDB A;  3M7N A;  2JV4 A;  5E64 A;  2DK7 A;  1ZCN A;  3ODK A;  5E62 A;  3TCZ A;  2OWO A;  2DMV A;  3MCB B;  2F21 A;  2ZR6 A;  2KXQ A;  3L4H A;  1PIN A;  2YSH A;  4REX A;  3OOB A;  1K9R A;  2YSG A;  3KAG A;  1WR7 A;  3KAI A;  5E66 A;  2XP6 A;  4U84 A;  1K9Q A;  3MCB A;  2XP7 A;  2XP3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...