1F8AB

Structural basis for the phosphoserine-proline recognition by group iv ww domains
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
167
structure length
155
Chain Sequence
GSHGMADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEPTIDYL-PROLYL CIS-TRANS ISOMERASE NIMA-INTERACTING 1
publication title Structural basis for phosphoserine-proline recognition by group IV WW domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 40
structure length 155
sequence length 167
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2000-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00397 WW WW domain
B PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 1f8aB01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1f8aB02
3NI6A 1FAPA 4O2TA 4ODRA 1R9HA 1FD9A 1QZ2A 4ODNA 1EYMA 4DRPA 2L2SA 2F21A 3KZ7A 2RQSA 3M85A 2M1IA 1QPFA 3UQIA 2PV3A 4NNRA 3WH0A 3GPKA 2PV2A 2DK1A 2XP9A 3L4HA 3KADA 2MLXA 3O5MA 4LAYA 4TX0A 1C9HA 1JNSA 4LAXA 2UZ5A 5AHTA 3O5EA 1Q6UA 5HKGA 3OOBA 4W9OA 1A7XA 1U79A 4DRHA 1D6OA 1JNTA 3PRBA 3IHZA 2JMFA 1FKIA 1NSGA 4U85A 1JVWA 1N1AA 5GPGA 3JXVA 1ROTA 4TYOA 3KACA 2PPNA 1I5HW 5B8IC 4JFJA 2M08A 4R0XA 4ODMA 3UI4A 4GGQA 3UF8A 3O5OA 3NTPA 1BL4A 5I98A 1KT0A 2XP6A 4TNSA 4DZ3A 1B6CA 1TCOC 2IF4A 2YSIA 1ZK6A 3UI6A 2MNTA 4QT2A 5D75A 1YW5A 2KXQA 3CGMA 4DRNA 3I6CA 2M8JA 1FKSA 3O5FA 4JFKA 5DIUA 2PBCA 2RURA 3LE4A 2FKEA 4TW7A 4GIVA 1K9QA 3O5GA 3KAIA 4FAPA 1L1PA 4ODLA 3VAWA 5HTGA 3O5DA 3JYJA 3UQAA 4MSPA 2YSGA 2M2AA 4LAWA 1Q6HA 2D9FA 3O5PA 4DH0A 5HWCA 2PPOA 3O5QA 2DK7A 2MLYA 3B7XA 1QPLA 3CGNA 3FAPA 4JYSA 1FKRA 3CNGA 1WMVA 2MLZA 1WR7A 2RE3A 1D7HA 2F4EA 4DRIA 2DMVA 2ZR5A 2RSEA 3TDBA 4ITZA 4ODKA 1FKFA 4TW8A 2XPAA 2YSFA 4QT3A 4DT4A 3IK8A 1T11A 2VCDA 5HW8A 4JFLA 2PPPA 3O5JA 4DRQA 2JXWA 4U86A 2XP3A 2ZQUA 2N87A 1TK7A 1J4IA 1FKGA 2VN1A 2OFNA 2RUDA 2Q5AA 2KGJA 1FKDA 1PBKA 3PA7A 2YSBA 1JMQA 2XP7A 3O5LA 4QIBA 1Q1CA 3RFWA 1HXVA 2LAJA 4G2PA 4FN2A 3IKDA 5HWBA 3MDYB 5HW6A 3KABA 2LPVA 2KE0A 1J4HA 2RUQA 4W9QA 4DZ2A 2PV1A 2K8IA 1FJDA 2FAPA 1O6WA 3KCEA 1EG3A 1ZCNA 4DRJA 3KAGA 4BF8A 1F8AB 2DG4A 2ZAJA 5HUAA 1D7IA 1M5YA 2XP8A 2ZR6A 4ODQA 1FKBA 2DWVA 2ZQTA 4IQ2A 2KO7A 1NMWA 1Y0OA 5DIVA 1FKLA 1K9RA 2MDIA 2M8IA 4G50A 2LKNA 1YATA 2LGOA 3KAHA 1F40A 1ROUA 3RGCA 2BA1A 1EQ3A 2YSHA 1BKFA 3IKGA 2L4JA 1J4RA 3KAFA 4IQCA 3UI5A 1FKTA 4TW6A 3LUOA 2JV4A 4N19A 4LAVA 2RUCA 5HW7A 2XP5A 2ZQSA 1FKJA 1EG4A 1J6YA 2DG9A 1Q6IA 2EZ5W 2ZQVA 3JYMA 2KI3A 3PRDA 2ITKA 4DRKA 4ODOA 1FKHA 3TC5A 2JZVA 4U84A 4MGVA 2MPHA 1KT1A 1P5QA 3O5KA 3UQBA 3EY6A 2ZR4A 2F2DA 2MF9A 5DITA 4J4OA 4DROA 2E45A 3O5IA 4ODPA 3M7NA 4JFMA 4E5RA 2M3OW 5CQ2A 2KR7A 3O5RA 3ODKA 3H9RB 5HT1A 4DIPA 1NMVA 4REXA 2XPBA 2LJ4A 1D7JA 4W9PA 4DRMA 1PINA 2Y78A 2DJYA 5J6EA 2KFWA 2DG3A 4JFIA 2AWGA 3NRKA 3TCZA 2XP4A 2JX8A 5BXJA 1W26A 4IPXA 4J4NA 1FKKA 4C02B
chains in the Genus database with same CATH superfamily
1X6NA 3NI6A 4A0UA 1FAPA 3W4RA 4O2TA 4ODRA 1W9PA 4L3NA 1R9HA 5E65A 1FD9A 1QZ2A 4ODNA 1EYMA 4DRPA 2L2SA 2F21A 3KZ7A 3ARVA 2RQSA 2A3BA 3M85A 2M1IA 1QPFA 3UQIA 1H0GA 3G6MA 2PV3A 4NNRA 3WH0A 2DSZA 2PV2A 3GPKA 3ARWA 2DK1A 2XP9A 2A3CA 1IX5A 3L4HA 3KADA 4MPKA 2MLXA 1XRVA 1NWSA 1EIBA 4MNMA 4P8VA 3O5MA 3ARZA 4LAYA 4MNKA 4TX0A 4NZCA 1C9HA 1JNSA 4DWSB 4S3JA 4LAXA 4Z2GA 2UZ5A 1FFQA 5AHTA 2PN0A 3O5EA 4ZPWR 1Q6UA 5HKGA 3OOBA 2DSVA 3WD2A 1LL6A 4W9OA 3FSBA 1A7XA 1K9TA 2WLZA 3FS8A 1E15A 1NH6A 3ARPA 1U79A 2WAEA 4DRHA 1D6OA 4KR0B 1JNTA 3PRBA 3IHZA 2JMFA 1KFWA 1W1TA 3ARRA 1FKIA 3GTYX 1NSGA 4U85A 1JVWA 3CZ8A 1N1AA 5GPGA 3JXVA 3B8SA 3ALFA 2DT1A 1ROTA 4S3KA 4TYOA 1OGGA 3ALGA 3KACA 2PPNA 1I5HW 5B8IC 1EHNA 5DO2A 4JFJA 3PR9A 2M08A 4HBEA 4ODMA 4R0XA 3UI4A 4GGQA 3LKXA 3UF8A 3O5OA 1SR0A 4WKAA 3NTPA 1BL4A 1E6ZA 1RP5A 5I98A 1KT0A 3ARTA 2XP6A 4TNSA 4DZ3A 4IT4A 5GPRA 1B6CA 1TCOC 2IF4A 4WKFA 2YSIA 3MQHA 1E6NA 1ZK6A 3UI6A 2MNTA 2A3AA 4QT2A 3QOKA 5D75A 1YW5A 2KXQA 3CGMA 4DRNA 3I6CA 2M8JA 3CHDA 1VF8A 1FKSA 3O5FA 1ZBWA 4JFKA 2PBCA 5DIUA 5GQBA 2DT0A 2RURA 3BXWA 4PTMA 1D2KA 3LE4A 3G6LA 3ARXA 1ZL1A 2OLHA 2FKEA 4TW7A 2ESCA 4WK9A 4GIVA 1K9QA 2IUZA 3O5GA 3KAIA 4FAPA 1L1PA 2WLYA 1ZBKA 2A3EA 1TFVA 4WKHA 4ODLA 3WD1A 2FDMA 3LKXB 3AS2A 3VAWA 5HTGA 3O5DA 3JYJA 3WL1A 1NWRA 4ZPTR 1LG2A 2PI6A 3WKZA 3UQAA 4MSPA 2YSGA 2M2AA 4LAWA 1Q6HA 2D9FA 2G41A 3O5PA 1X6LA 4DH0A 5HWCA 2YAJB 2WK2A 4Z2IA 2PPOA 3O5QA 2DK7A 3ARQA 4NSBA 2MLYA 1ITXA 1HKMA 3B7XA 1ZBVA 4KQZA 1QPLA 3CGNA 3FAPA 2DSWA 4JYSA 1FKRA 3CNGA 4A0TA 1WMVA 4IT6A 4WJXA 3CHCA 3MCBA 2MLZA 1WR7A 2RE3A 3MQGA 1D7HA 2DPEA 2F4EA 1H0IA 4DRIA 2DMVA 4L72B 3RM4A 1SYTA 1ZU8A 2ZR5A 2RSEA 1ZBCA 2QF8A 3TDBA 2G8ZA 4ITZA 3AROA 4ODKA 4UDMA 3CHEA 1FKFA 4MAVA 1W9VA 4TW8A 2XPAA 2YSFA 4QT3A 4DT4A 1FFRA 3IK8A 3BMBA 1T11A 2VCDA 4Z2LA 5HW8A 4JFLA 2PPPA 3RM9A 1WB0A 3O5JA 3WIJA 4DRQA 2P4VA 4HBOA 1HJVA 2JXWA 4U86A 2XP3A 2ZQUA 3AS1A 2B5UB 2ETNA 2DT3A 2N87A 1TK7A 3MCBB 1J4IA 1FKGA 2VN1A 2OFNA 3B9DA 2RUDA 1EDQA 2Q5AA 2KGJA 1FKDA 1PBKA 3PA7A 2YSBA 2EULA 4AY1A 4WIWA 3WL0A 1JMQA 3RM8A 2O9OA 4DWSC 4DWSD 2XP7A 1W1VA 3CHFA 3O5LA 3ARSA 4QIBA 1Q1CA 1JCHB 3RMEA 3RFWA 1HXVA 2LAJA 1HKKA 2DSUA 4G2PA 3FY1A 1TR8A 4FN2A 3IKDA 3WD4A 5HWBA 2Y8NB 3FXYA 5E5WA 4Q7NA 3MDYB 5HW6A 5E62A 2YBTA 3KABA 2LPVA 1E44A 2KE0A 1J4HA 2RUQA 4W9QA 4DZ2A 2PV1A 2K8IA 1FJDA 2FAPA 1O6WA 3WQWA 2F23A 3KCEA 1EG3A 5DEZA 1ZCNA 4DRJA 1HJWA 3KAGA 1LL4A 1CTNA 4BF8A 4HARA 1F8AB 4MTVA 2DG4A 2ZAJA 5HUAA 1D7IA 1M5YA 2XP8A 2ZR6A 4ODQA 1FKBA 2DWVA 1JNDA 4P8WA 2ZQTA 4IQ2A 1XHGA 2KO7A 3OA5A 4ZPVR 1LG1A 1E6PA 3PRAA 3FSCA 1NMWA 1Y0OA 5DIVA 1FKLA 1K9RA 1ZB5A 2MDIA 2M8IA 1WAWA 4XAKA 4URIA 4G50A 1FLCA 2WADA 3AQUA 2LKNA 1YATA 4Q22A 2LGOA 3KAHA 1NWUA 3CH9A 5HBFA 1F40A 1ROUA 3RGCA 1JNEA 3B9AA 2BA1A 1OGBA 3WD3A 1OWQA 4P8XA 1EQ3A 2YSHA 1BKFA 3IKGA 2L4JA 5E66A 1J4RA 3KAFA 2DT2A 4W5UA 1W1YA 4IQCA 3UI5A 1FKTA 1UR9A 2B31A 1NWTA 1GRJA 1O6IA 1W1PA 4TW6A 2O92A 5DF0A 3LUOA 3PQHA 2JV4A 4N19A 4LAVA 2RUCA 4R5EA 4Z2JA 1HKIA 5HW7A 2XP5A 2ZQSA 1FKJA 1EG4A 1J6YA 2DG9A 1Q6IA 1GOIA 4ML4A 2EZ5W 2ZQVA 1GPFA 4MNJA 3JYMA 1LJYA 1WNOA 2KI3A 4QZVB 3PRDA 2ITKA 2AOSA 4DRKA 4LGXA 4ODOA 1FKHA 4ZS6A 3TC5A 2JZVA 3AS3A 4U84A 4GLXA 1LL7A 4MGVA 2MPHA 1KT1A 1P5QA 3O5KA 3UQBA 3GU0A 3EY6A 2ZR4A 2F2DA 3ARYA 5JH8A 2MF9A 5DITA 2QRVA 4J4OA 4DROA 2E45A 3O5IA 1W9UA 4ODPA 3M7NA 4JFMA 1HJXA 4E5RA 3WD0A 2M3OW 3B9EA 5E64A 5CQ2A 3EIPA 3WQVA 2KR7A 3O5RA 3ODKA 1RD6A 1LQ0A 1UR8A 2YBUA 3H9RB 5HT1A 4DIPA 2WM0A 1NMVA 3ARUA 2OWOA 4REXA 1E6RA 5U47A 2XPBA 2LJ4A 1E9LA 1D7JA 4W9PA 4MNLA 4DRMA 1PINA 2Y78A 4P8UA 2DJYA 5J6EA 2KFWA 1GUVA 2DG3A 4JFIA 2AWGA 3AS0A 3NRKA 3TCZA 2XP4A 2JX8A 1HKJA 5BXJA 1W26A 4DWSA 4IPXA 4J4NA 1FKKA 4Z2KA 4C02B 4Z2HA
chains in the Genus database with same CATH topology
1X6NA 3NI6A 4A0UA 1FAPA 3W4RA 4O2TA 4ODRA 1W9PA 4L3NA 1R9HA 5E65A 1FD9A 1QZ2A 4ODNA 1EYMA 4DRPA 2L2SA 2F21A 3KZ7A 3ARVA 2RQSA 2A3BA 3M85A 2M1IA 1QPFA 3UQIA 1H0GA 3G6MA 2PV3A 4NNRA 3WH0A 2DSZA 2PV2A 3GPKA 3ARWA 2DK1A 2XP9A 2A3CA 1IX5A 3L4HA 3KADA 4MPKA 2MLXA 1XRVA 1NWSA 1EIBA 4MNMA 4P8VA 3O5MA 3ARZA 4LAYA 4MNKA 4TX0A 4NZCA 1C9HA 1JNSA 4DWSB 4S3JA 4LAXA 4Z2GA 2UZ5A 1FFQA 5AHTA 3O5EA 4ZPWR 1Q6UA 5HKGA 3OOBA 2DSVA 3WD2A 1LL6A 4W9OA 3FSBA 1A7XA 1K9TA 2WLZA 3FS8A 1E15A 1NH6A 3ARPA 1U79A 2WAEA 4DRHA 1D6OA 4KR0B 1JNTA 3PRBA 3IHZA 2JMFA 1KFWA 1W1TA 3ARRA 1FKIA 1NSGA 4U85A 1JVWA 3CZ8A 1N1AA 5GPGA 3JXVA 3B8SA 3ALFA 2DT1A 1ROTA 4S3KA 4TYOA 1OGGA 3ALGA 3KACA 2PPNA 1I5HW 5B8IC 1EHNA 5DO2A 4JFJA 3PR9A 2M08A 4HBEA 4ODMA 4R0XA 3UI4A 4GGQA 3LKXA 3UF8A 3O5OA 1SR0A 4WKAA 3NTPA 1BL4A 1E6ZA 1RP5A 5I98A 1KT0A 3ARTA 2XP6A 4TNSA 4DZ3A 4IT4A 5GPRA 1B6CA 1TCOC 2IF4A 4WKFA 2YSIA 3MQHA 1E6NA 1ZK6A 3UI6A 2MNTA 2A3AA 4QT2A 3QOKA 5D75A 1YW5A 2KXQA 3CGMA 4DRNA 3I6CA 2M8JA 3CHDA 1VF8A 1FKSA 3O5FA 1ZBWA 4JFKA 2PBCA 5DIUA 5GQBA 2DT0A 2RURA 3BXWA 4PTMA 1D2KA 3LE4A 3G6LA 3ARXA 1ZL1A 2OLHA 2FKEA 4TW7A 2ESCA 4WK9A 4GIVA 1K9QA 2IUZA 3O5GA 3KAIA 4FAPA 1L1PA 2WLYA 1ZBKA 2A3EA 1TFVA 4WKHA 4ODLA 3WD1A 2FDMA 3LKXB 3AS2A 3VAWA 5HTGA 3O5DA 3JYJA 3WL1A 1NWRA 4ZPTR 1LG2A 2PI6A 3WKZA 3UQAA 4MSPA 2YSGA 2M2AA 4LAWA 1Q6HA 2D9FA 2G41A 3O5PA 1X6LA 4DH0A 5HWCA 2YAJB 2WK2A 4Z2IA 2PPOA 3O5QA 2DK7A 3ARQA 4NSBA 2MLYA 1ITXA 1HKMA 3B7XA 1ZBVA 4KQZA 1QPLA 3CGNA 3FAPA 2DSWA 4JYSA 1FKRA 3CNGA 4A0TA 1WMVA 4IT6A 4WJXA 3CHCA 3MCBA 2MLZA 1WR7A 2RE3A 3MQGA 1D7HA 2DPEA 2F4EA 1H0IA 4DRIA 2DMVA 4L72B 3RM4A 1SYTA 1ZU8A 2ZR5A 2RSEA 1ZBCA 2QF8A 3TDBA 2G8ZA 4ITZA 3AROA 4ODKA 3CHEA 1FKFA 4MAVA 1W9VA 4TW8A 2XPAA 2YSFA 4QT3A 4DT4A 1FFRA 3IK8A 1T11A 2VCDA 4Z2LA 5HW8A 4JFLA 2PPPA 3RM9A 1WB0A 3O5JA 3WIJA 4DRQA 4HBOA 1HJVA 2JXWA 4U86A 2XP3A 2ZQUA 3AS1A 2DT3A 2N87A 1TK7A 3MCBB 1J4IA 1FKGA 2VN1A 2OFNA 3B9DA 2RUDA 1EDQA 2Q5AA 2KGJA 1FKDA 1PBKA 3PA7A 2YSBA 4AY1A 4WIWA 3WL0A 1JMQA 3RM8A 2O9OA 4DWSC 4DWSD 2XP7A 1W1VA 3CHFA 3O5LA 3ARSA 4QIBA 1Q1CA 3RMEA 3RFWA 1HXVA 2LAJA 1HKKA 2DSUA 4G2PA 3FY1A 1TR8A 4FN2A 3IKDA 3WD4A 5HWBA 2Y8NB 3FXYA 5E5WA 4Q7NA 3MDYB 5HW6A 5E62A 2YBTA 3KABA 2LPVA 2KE0A 1J4HA 2RUQA 4W9QA 4DZ2A 2PV1A 2K8IA 1FJDA 2FAPA 1O6WA 3WQWA 3KCEA 1EG3A 5DEZA 1ZCNA 4DRJA 1HJWA 3KAGA 1LL4A 1CTNA 4BF8A 4HARA 1F8AB 4MTVA 2DG4A 2ZAJA 5HUAA 1D7IA 1M5YA 2XP8A 2ZR6A 4ODQA 1FKBA 2DWVA 1JNDA 4P8WA 2ZQTA 4IQ2A 1XHGA 2KO7A 3OA5A 4ZPVR 1LG1A 1E6PA 3PRAA 3FSCA 1NMWA 1Y0OA 5DIVA 1FKLA 1K9RA 1ZB5A 2MDIA 2M8IA 1WAWA 4XAKA 4URIA 4G50A 1FLCA 2WADA 3AQUA 2LKNA 1YATA 4Q22A 2LGOA 3KAHA 1NWUA 3CH9A 5HBFA 1F40A 1ROUA 3RGCA 1JNEA 3B9AA 2BA1A 1OGBA 3WD3A 1OWQA 4P8XA 1EQ3A 2YSHA 1BKFA 3IKGA 2L4JA 5E66A 1J4RA 3KAFA 2DT2A 4W5UA 1W1YA 4IQCA 3UI5A 1FKTA 1UR9A 2B31A 1NWTA 1O6IA 1W1PA 4TW6A 2O92A 5DF0A 3LUOA 3PQHA 2JV4A 4N19A 4LAVA 2RUCA 4R5EA 4Z2JA 1HKIA 5HW7A 2XP5A 2ZQSA 1FKJA 1EG4A 1J6YA 2DG9A 1Q6IA 1GOIA 4ML4A 2EZ5W 2ZQVA 1GPFA 4MNJA 3JYMA 1LJYA 1WNOA 2KI3A 4QZVB 3PRDA 2ITKA 2AOSA 4DRKA 4LGXA 4ODOA 1FKHA 4ZS6A 3TC5A 2JZVA 3AS3A 4U84A 4GLXA 1LL7A 4MGVA 2MPHA 1KT1A 1P5QA 3O5KA 3UQBA 3EY6A 2ZR4A 2F2DA 3ARYA 5JH8A 2MF9A 5DITA 2QRVA 4J4OA 4DROA 2E45A 3O5IA 1W9UA 4ODPA 3M7NA 4JFMA 1HJXA 4E5RA 3WD0A 2M3OW 3B9EA 5E64A 5CQ2A 3WQVA 2KR7A 3O5RA 3ODKA 1RD6A 1LQ0A 1UR8A 2YBUA 3H9RB 5HT1A 4DIPA 2WM0A 1NMVA 3ARUA 2OWOA 4REXA 1E6RA 5U47A 2XPBA 2LJ4A 1E9LA 1D7JA 4W9PA 4MNLA 4DRMA 1PINA 2Y78A 4P8UA 2DJYA 5J6EA 2KFWA 1GUVA 2DG3A 4JFIA 2AWGA 3AS0A 3NRKA 3TCZA 2XP4A 2JX8A 1HKJA 5BXJA 1W26A 4DWSA 4IPXA 4J4NA 1FKKA 4Z2KA 4C02B 4Z2HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NI6 A;  1FAP A;  4O2T A;  4ODR A;  1R9H A;  1FD9 A;  1QZ2 A;  4ODN A;  1EYM A;  4DRP A;  2L2S A;  2F21 A;  3KZ7 A;  2RQS A;  3M85 A;  2M1I A;  1QPF A;  3UQI A;  2PV3 A;  4NNR A;  3WH0 A;  3GPK A;  2PV2 A;  2DK1 A;  2XP9 A;  3L4H A;  3KAD A;  2MLX A;  3O5M A;  4LAY A;  4TX0 A;  1C9H A;  1JNS A;  4LAX A;  2UZ5 A;  5AHT A;  3O5E A;  1Q6U A;  5HKG A;  3OOB A;  4W9O A;  1A7X A;  1U79 A;  4DRH A;  1D6O A;  1JNT A;  3PRB A;  3IHZ A;  2JMF A;  1FKI A;  1NSG A;  4U85 A;  1JVW A;  1N1A A;  5GPG A;  3JXV A;  1ROT A;  4TYO A;  3KAC A;  2PPN A;  1I5H W;  5B8I C;  4JFJ A;  2M08 A;  4R0X A;  4ODM A;  3UI4 A;  4GGQ A;  3UF8 A;  3O5O A;  3NTP A;  1BL4 A;  5I98 A;  1KT0 A;  2XP6 A;  4TNS A;  4DZ3 A;  1B6C A;  1TCO C;  2IF4 A;  2YSI A;  1ZK6 A;  3UI6 A;  2MNT A;  4QT2 A;  5D75 A;  1YW5 A;  2KXQ A;  3CGM A;  4DRN A;  3I6C A;  2M8J A;  1FKS A;  3O5F A;  4JFK A;  5DIU A;  2PBC A;  2RUR A;  3LE4 A;  2FKE A;  4TW7 A;  4GIV A;  1K9Q A;  3O5G A;  3KAI A;  4FAP A;  1L1P A;  4ODL A;  3VAW A;  5HTG A;  3O5D A;  3JYJ A;  3UQA A;  4MSP A;  2YSG A;  2M2A A;  4LAW A;  1Q6H A;  2D9F A;  3O5P A;  4DH0 A;  5HWC A;  2PPO A;  3O5Q A;  2DK7 A;  2MLY A;  3B7X A;  1QPL A;  3CGN A;  3FAP A;  4JYS A;  1FKR A;  3CNG A;  1WMV A;  2MLZ A;  1WR7 A;  2RE3 A;  1D7H A;  2F4E A;  4DRI A;  2DMV A;  2ZR5 A;  2RSE A;  3TDB A;  4ITZ A;  4ODK A;  1FKF A;  4TW8 A;  2XPA A;  2YSF A;  4QT3 A;  4DT4 A;  3IK8 A;  1T11 A;  2VCD A;  5HW8 A;  4JFL A;  2PPP A;  3O5J A;  4DRQ A;  2JXW A;  4U86 A;  2XP3 A;  2ZQU A;  2N87 A;  1TK7 A;  1J4I A;  1FKG A;  2VN1 A;  2OFN A;  2RUD A;  2Q5A A;  2KGJ A;  1FKD A;  1PBK A;  3PA7 A;  2YSB A;  1JMQ A;  2XP7 A;  3O5L A;  4QIB A;  1Q1C A;  3RFW A;  1HXV A;  2LAJ A;  4G2P A;  4FN2 A;  3IKD A;  5HWB A;  3MDY B;  5HW6 A;  3KAB A;  2LPV A;  2KE0 A;  1J4H A;  2RUQ A;  4W9Q A;  4DZ2 A;  2PV1 A;  2K8I A;  1FJD A;  2FAP A;  1O6W A;  3KCE A;  1EG3 A;  1ZCN A;  4DRJ A;  3KAG A;  4BF8 A;  1F8A B;  2DG4 A;  2ZAJ A;  5HUA A;  1D7I A;  1M5Y A;  2XP8 A;  2ZR6 A;  4ODQ A;  1FKB A;  2DWV A;  2ZQT A;  4IQ2 A;  2KO7 A;  1NMW A;  1Y0O A;  5DIV A;  1FKL A;  1K9R A;  2MDI A;  2M8I A;  4G50 A;  2LKN A;  1YAT A;  2LGO A;  3KAH A;  1F40 A;  1ROU A;  3RGC A;  2BA1 A;  1EQ3 A;  2YSH A;  1BKF A;  3IKG A;  2L4J A;  1J4R A;  3KAF A;  4IQC A;  3UI5 A;  1FKT A;  4TW6 A;  3LUO A;  2JV4 A;  4N19 A;  4LAV A;  2RUC A;  5HW7 A;  2XP5 A;  2ZQS A;  1FKJ A;  1EG4 A;  1J6Y A;  2DG9 A;  1Q6I A;  2EZ5 W;  2ZQV A;  3JYM A;  2KI3 A;  3PRD A;  2ITK A;  4DRK A;  4ODO A;  1FKH A;  3TC5 A;  2JZV A;  4U84 A;  4MGV A;  2MPH A;  1KT1 A;  1P5Q A;  3O5K A;  3UQB A;  3EY6 A;  2ZR4 A;  2F2D A;  2MF9 A;  5DIT A;  4J4O A;  4DRO A;  2E45 A;  3O5I A;  4ODP A;  3M7N A;  4JFM A;  4E5R A;  2M3O W;  5CQ2 A;  2KR7 A;  3O5R A;  3ODK A;  3H9R B;  5HT1 A;  4DIP A;  1NMV A;  4REX A;  2XPB A;  2LJ4 A;  1D7J A;  4W9P A;  4DRM A;  1PIN A;  2Y78 A;  2DJY A;  5J6E A;  2KFW A;  2DG3 A;  4JFI A;  2AWG A;  3NRK A;  3TCZ A;  2XP4 A;  2JX8 A;  5BXJ A;  1W26 A;  4IPX A;  4J4N A;  1FKK A;  4C02 B; 
#chains in the Genus database with same CATH topology
 1X6N A;  3NI6 A;  4A0U A;  1FAP A;  3W4R A;  4O2T A;  4ODR A;  1W9P A;  4L3N A;  1R9H A;  5E65 A;  1FD9 A;  1QZ2 A;  4ODN A;  1EYM A;  4DRP A;  2L2S A;  2F21 A;  3KZ7 A;  3ARV A;  2RQS A;  2A3B A;  3M85 A;  2M1I A;  1QPF A;  3UQI A;  1H0G A;  3G6M A;  2PV3 A;  4NNR A;  3WH0 A;  2DSZ A;  2PV2 A;  3GPK A;  3ARW A;  2DK1 A;  2XP9 A;  2A3C A;  1IX5 A;  3L4H A;  3KAD A;  4MPK A;  2MLX A;  1XRV A;  1NWS A;  1EIB A;  4MNM A;  4P8V A;  3O5M A;  3ARZ A;  4LAY A;  4MNK A;  4TX0 A;  4NZC A;  1C9H A;  1JNS A;  4DWS B;  4S3J A;  4LAX A;  4Z2G A;  2UZ5 A;  1FFQ A;  5AHT A;  2PN0 A;  3O5E A;  4ZPW R;  1Q6U A;  5HKG A;  3OOB A;  2DSV A;  3WD2 A;  1LL6 A;  4W9O A;  3FSB A;  1A7X A;  1K9T A;  2WLZ A;  3FS8 A;  1E15 A;  1NH6 A;  3ARP A;  1U79 A;  2WAE A;  4DRH A;  1D6O A;  4KR0 B;  1JNT A;  3PRB A;  3IHZ A;  2JMF A;  1KFW A;  1W1T A;  3ARR A;  1FKI A;  3GTY X;  1NSG A;  4U85 A;  1JVW A;  3CZ8 A;  1N1A A;  5GPG A;  3JXV A;  3B8S A;  3ALF A;  2DT1 A;  1ROT A;  4S3K A;  4TYO A;  1OGG A;  3ALG A;  3KAC A;  2PPN A;  1I5H W;  5B8I C;  1EHN A;  5DO2 A;  4JFJ A;  3PR9 A;  2M08 A;  4HBE A;  4ODM A;  4R0X A;  3UI4 A;  4GGQ A;  3LKX A;  3UF8 A;  3O5O A;  1SR0 A;  4WKA A;  3NTP A;  1BL4 A;  1E6Z A;  1RP5 A;  5I98 A;  1KT0 A;  3ART A;  2XP6 A;  4TNS A;  4DZ3 A;  4IT4 A;  5GPR A;  1B6C A;  1TCO C;  2IF4 A;  4WKF A;  2YSI A;  3MQH A;  1E6N A;  1ZK6 A;  3UI6 A;  2MNT A;  2A3A A;  4QT2 A;  3QOK A;  5D75 A;  1YW5 A;  2KXQ A;  3CGM A;  4DRN A;  3I6C A;  2M8J A;  3CHD A;  1VF8 A;  1FKS A;  3O5F A;  1ZBW A;  4JFK A;  2PBC A;  5DIU A;  5GQB A;  2DT0 A;  2RUR A;  3BXW A;  4PTM A;  1D2K A;  3LE4 A;  3G6L A;  3ARX A;  1ZL1 A;  2OLH A;  2FKE A;  4TW7 A;  2ESC A;  4WK9 A;  4GIV A;  1K9Q A;  2IUZ A;  3O5G A;  3KAI A;  4FAP A;  1L1P A;  2WLY A;  1ZBK A;  2A3E A;  1TFV A;  4WKH A;  4ODL A;  3WD1 A;  2FDM A;  3LKX B;  3AS2 A;  3VAW A;  5HTG A;  3O5D A;  3JYJ A;  3WL1 A;  1NWR A;  4ZPT R;  1LG2 A;  2PI6 A;  3WKZ A;  3UQA A;  4MSP A;  2YSG A;  2M2A A;  4LAW A;  1Q6H A;  2D9F A;  2G41 A;  3O5P A;  1X6L A;  4DH0 A;  5HWC A;  2YAJ B;  2WK2 A;  4Z2I A;  2PPO A;  3O5Q A;  2DK7 A;  3ARQ A;  4NSB A;  2MLY A;  1ITX A;  1HKM A;  3B7X A;  1ZBV A;  4KQZ A;  1QPL A;  3CGN A;  3FAP A;  2DSW A;  4JYS A;  1FKR A;  3CNG A;  4A0T A;  1WMV A;  4IT6 A;  4WJX A;  3CHC A;  3MCB A;  2MLZ A;  1WR7 A;  2RE3 A;  3MQG A;  1D7H A;  2DPE A;  2F4E A;  1H0I A;  4DRI A;  2DMV A;  4L72 B;  3RM4 A;  1SYT A;  1ZU8 A;  2ZR5 A;  2RSE A;  1ZBC A;  2QF8 A;  3TDB A;  2G8Z A;  4ITZ A;  3ARO A;  4ODK A;  4UDM A;  3CHE A;  1FKF A;  4MAV A;  1W9V A;  4TW8 A;  2XPA A;  2YSF A;  4QT3 A;  4DT4 A;  1FFR A;  3IK8 A;  3BMB A;  1T11 A;  2VCD A;  4Z2L A;  5HW8 A;  4JFL A;  2PPP A;  3RM9 A;  1WB0 A;  3O5J A;  3WIJ A;  4DRQ A;  2P4V A;  4HBO A;  1HJV A;  2JXW A;  4U86 A;  2XP3 A;  2ZQU A;  3AS1 A;  2B5U B;  2ETN A;  2DT3 A;  2N87 A;  1TK7 A;  3MCB B;  1J4I A;  1FKG A;  2VN1 A;  2OFN A;  3B9D A;  2RUD A;  1EDQ A;  2Q5A A;  2KGJ A;  1FKD A;  1PBK A;  3PA7 A;  2YSB A;  2EUL A;  4AY1 A;  4WIW A;  3WL0 A;  1JMQ A;  3RM8 A;  2O9O A;  4DWS C;  4DWS D;  2XP7 A;  1W1V A;  3CHF A;  3O5L A;  3ARS A;  4QIB A;  1Q1C A;  1JCH B;  3RME A;  3RFW A;  1HXV A;  2LAJ A;  1HKK A;  2DSU A;  4G2P A;  3FY1 A;  1TR8 A;  4FN2 A;  3IKD A;  3WD4 A;  5HWB A;  2Y8N B;  3FXY A;  5E5W A;  4Q7N A;  3MDY B;  5HW6 A;  5E62 A;  2YBT A;  3KAB A;  2LPV A;  1E44 A;  2KE0 A;  1J4H A;  2RUQ A;  4W9Q A;  4DZ2 A;  2PV1 A;  2K8I A;  1FJD A;  2FAP A;  1O6W A;  3WQW A;  2F23 A;  3KCE A;  1EG3 A;  5DEZ A;  1ZCN A;  4DRJ A;  1HJW A;  3KAG A;  1LL4 A;  1CTN A;  4BF8 A;  4HAR A;  1F8A B;  4MTV A;  2DG4 A;  2ZAJ A;  5HUA A;  1D7I A;  1M5Y A;  2XP8 A;  2ZR6 A;  4ODQ A;  1FKB A;  2DWV A;  1JND A;  4P8W A;  2ZQT A;  4IQ2 A;  1XHG A;  2KO7 A;  3OA5 A;  4ZPV R;  1LG1 A;  1E6P A;  3PRA A;  3FSC A;  1NMW A;  1Y0O A;  5DIV A;  1FKL A;  1K9R A;  1ZB5 A;  2MDI A;  2M8I A;  1WAW A;  4XAK A;  4URI A;  4G50 A;  1FLC A;  2WAD A;  3AQU A;  2LKN A;  1YAT A;  4Q22 A;  2LGO A;  3KAH A;  1NWU A;  3CH9 A;  5HBF A;  1F40 A;  1ROU A;  3RGC A;  1JNE A;  3B9A A;  2BA1 A;  1OGB A;  3WD3 A;  1OWQ A;  4P8X A;  1EQ3 A;  2YSH A;  1BKF A;  3IKG A;  2L4J A;  5E66 A;  1J4R A;  3KAF A;  2DT2 A;  4W5U A;  1W1Y A;  4IQC A;  3UI5 A;  1FKT A;  1UR9 A;  2B31 A;  1NWT A;  1GRJ A;  1O6I A;  1W1P A;  4TW6 A;  2O92 A;  5DF0 A;  3LUO A;  3PQH A;  2JV4 A;  4N19 A;  4LAV A;  2RUC A;  4R5E A;  4Z2J A;  1HKI A;  5HW7 A;  2XP5 A;  2ZQS A;  1FKJ A;  1EG4 A;  1J6Y A;  2DG9 A;  1Q6I A;  1GOI A;  4ML4 A;  2EZ5 W;  2ZQV A;  1GPF A;  4MNJ A;  3JYM A;  1LJY A;  1WNO A;  2KI3 A;  4QZV B;  3PRD A;  2ITK A;  2AOS A;  4DRK A;  4LGX A;  4ODO A;  1FKH A;  4ZS6 A;  3TC5 A;  2JZV A;  3AS3 A;  4U84 A;  4GLX A;  1LL7 A;  4MGV A;  2MPH A;  1KT1 A;  1P5Q A;  3O5K A;  3UQB A;  3GU0 A;  3EY6 A;  2ZR4 A;  2F2D A;  3ARY A;  5JH8 A;  2MF9 A;  5DIT A;  2QRV A;  4J4O A;  4DRO A;  2E45 A;  3O5I A;  1W9U A;  4ODP A;  3M7N A;  4JFM A;  1HJX A;  4E5R A;  3WD0 A;  2M3O W;  3B9E A;  5E64 A;  5CQ2 A;  3EIP A;  3WQV A;  2KR7 A;  3O5R A;  3ODK A;  1RD6 A;  1LQ0 A;  1UR8 A;  2YBU A;  3H9R B;  5HT1 A;  4DIP A;  2WM0 A;  1NMV A;  3ARU A;  2OWO A;  4REX A;  1E6R A;  5U47 A;  2XPB A;  2LJ4 A;  1E9L A;  1D7J A;  4W9P A;  4MNL A;  4DRM A;  1PIN A;  2Y78 A;  4P8U A;  2DJY A;  5J6E A;  2KFW A;  1GUV A;  2DG3 A;  4JFI A;  2AWG A;  3AS0 A;  3NRK A;  3TCZ A;  2XP4 A;  2JX8 A;  1HKJ A;  5BXJ A;  1W26 A;  4DWS A;  4IPX A;  4J4N A;  1FKK A;  4Z2K A;  4C02 B;  4Z2H A; 
#chains in the Genus database with same CATH homology
 1X6N A;  3NI6 A;  4A0U A;  1FAP A;  3W4R A;  4O2T A;  4ODR A;  1W9P A;  4L3N A;  1R9H A;  5E65 A;  1FD9 A;  1QZ2 A;  4ODN A;  1EYM A;  4DRP A;  2L2S A;  2F21 A;  3KZ7 A;  3ARV A;  2RQS A;  2A3B A;  3M85 A;  2M1I A;  1QPF A;  3UQI A;  1H0G A;  3G6M A;  2PV3 A;  4NNR A;  3WH0 A;  2DSZ A;  2PV2 A;  3GPK A;  3ARW A;  2DK1 A;  2XP9 A;  2A3C A;  1IX5 A;  3L4H A;  3KAD A;  4MPK A;  2MLX A;  1XRV A;  1NWS A;  1EIB A;  4MNM A;  4P8V A;  3O5M A;  3ARZ A;  4LAY A;  4MNK A;  4TX0 A;  4NZC A;  1C9H A;  1JNS A;  4DWS B;  4S3J A;  4LAX A;  4Z2G A;  2UZ5 A;  1FFQ A;  5AHT A;  3O5E A;  4ZPW R;  1Q6U A;  5HKG A;  3OOB A;  2DSV A;  3WD2 A;  1LL6 A;  4W9O A;  3FSB A;  1A7X A;  1K9T A;  2WLZ A;  3FS8 A;  1E15 A;  1NH6 A;  3ARP A;  1U79 A;  2WAE A;  4DRH A;  1D6O A;  4KR0 B;  1JNT A;  3PRB A;  3IHZ A;  2JMF A;  1KFW A;  1W1T A;  3ARR A;  1FKI A;  1NSG A;  4U85 A;  1JVW A;  3CZ8 A;  1N1A A;  5GPG A;  3JXV A;  3B8S A;  3ALF A;  2DT1 A;  1ROT A;  4S3K A;  4TYO A;  1OGG A;  3ALG A;  3KAC A;  2PPN A;  1I5H W;  5B8I C;  1EHN A;  5DO2 A;  4JFJ A;  3PR9 A;  2M08 A;  4HBE A;  4ODM A;  4R0X A;  3UI4 A;  4GGQ A;  3LKX A;  3UF8 A;  3O5O A;  1SR0 A;  4WKA A;  3NTP A;  1BL4 A;  1E6Z A;  1RP5 A;  5I98 A;  1KT0 A;  3ART A;  2XP6 A;  4TNS A;  4DZ3 A;  4IT4 A;  5GPR A;  1B6C A;  1TCO C;  2IF4 A;  4WKF A;  2YSI A;  3MQH A;  1E6N A;  1ZK6 A;  3UI6 A;  2MNT A;  2A3A A;  4QT2 A;  3QOK A;  5D75 A;  1YW5 A;  2KXQ A;  3CGM A;  4DRN A;  3I6C A;  2M8J A;  3CHD A;  1VF8 A;  1FKS A;  3O5F A;  1ZBW A;  4JFK A;  2PBC A;  5DIU A;  5GQB A;  2DT0 A;  2RUR A;  3BXW A;  4PTM A;  1D2K A;  3LE4 A;  3G6L A;  3ARX A;  1ZL1 A;  2OLH A;  2FKE A;  4TW7 A;  2ESC A;  4WK9 A;  4GIV A;  1K9Q A;  2IUZ A;  3O5G A;  3KAI A;  4FAP A;  1L1P A;  2WLY A;  1ZBK A;  2A3E A;  1TFV A;  4WKH A;  4ODL A;  3WD1 A;  2FDM A;  3LKX B;  3AS2 A;  3VAW A;  5HTG A;  3O5D A;  3JYJ A;  3WL1 A;  1NWR A;  4ZPT R;  1LG2 A;  2PI6 A;  3WKZ A;  3UQA A;  4MSP A;  2YSG A;  2M2A A;  4LAW A;  1Q6H A;  2D9F A;  2G41 A;  3O5P A;  1X6L A;  4DH0 A;  5HWC A;  2YAJ B;  2WK2 A;  4Z2I A;  2PPO A;  3O5Q A;  2DK7 A;  3ARQ A;  4NSB A;  2MLY A;  1ITX A;  1HKM A;  3B7X A;  1ZBV A;  4KQZ A;  1QPL A;  3CGN A;  3FAP A;  2DSW A;  4JYS A;  1FKR A;  3CNG A;  4A0T A;  1WMV A;  4IT6 A;  4WJX A;  3CHC A;  3MCB A;  2MLZ A;  1WR7 A;  2RE3 A;  3MQG A;  1D7H A;  2DPE A;  2F4E A;  1H0I A;  4DRI A;  2DMV A;  4L72 B;  3RM4 A;  1SYT A;  1ZU8 A;  2ZR5 A;  2RSE A;  1ZBC A;  2QF8 A;  3TDB A;  2G8Z A;  4ITZ A;  3ARO A;  4ODK A;  3CHE A;  1FKF A;  4MAV A;  1W9V A;  4TW8 A;  2XPA A;  2YSF A;  4QT3 A;  4DT4 A;  1FFR A;  3IK8 A;  1T11 A;  2VCD A;  4Z2L A;  5HW8 A;  4JFL A;  2PPP A;  3RM9 A;  1WB0 A;  3O5J A;  3WIJ A;  4DRQ A;  4HBO A;  1HJV A;  2JXW A;  4U86 A;  2XP3 A;  2ZQU A;  3AS1 A;  2DT3 A;  2N87 A;  1TK7 A;  3MCB B;  1J4I A;  1FKG A;  2VN1 A;  2OFN A;  3B9D A;  2RUD A;  1EDQ A;  2Q5A A;  2KGJ A;  1FKD A;  1PBK A;  3PA7 A;  2YSB A;  4AY1 A;  4WIW A;  3WL0 A;  1JMQ A;  3RM8 A;  2O9O A;  4DWS C;  4DWS D;  2XP7 A;  1W1V A;  3CHF A;  3O5L A;  3ARS A;  4QIB A;  1Q1C A;  3RME A;  3RFW A;  1HXV A;  2LAJ A;  1HKK A;  2DSU A;  4G2P A;  3FY1 A;  1TR8 A;  4FN2 A;  3IKD A;  3WD4 A;  5HWB A;  2Y8N B;  3FXY A;  5E5W A;  4Q7N A;  3MDY B;  5HW6 A;  5E62 A;  2YBT A;  3KAB A;  2LPV A;  2KE0 A;  1J4H A;  2RUQ A;  4W9Q A;  4DZ2 A;  2PV1 A;  2K8I A;  1FJD A;  2FAP A;  1O6W A;  3WQW A;  3KCE A;  1EG3 A;  5DEZ A;  1ZCN A;  4DRJ A;  1HJW A;  3KAG A;  1LL4 A;  1CTN A;  4BF8 A;  4HAR A;  1F8A B;  4MTV A;  2DG4 A;  2ZAJ A;  5HUA A;  1D7I A;  1M5Y A;  2XP8 A;  2ZR6 A;  4ODQ A;  1FKB A;  2DWV A;  1JND A;  4P8W A;  2ZQT A;  4IQ2 A;  1XHG A;  2KO7 A;  3OA5 A;  4ZPV R;  1LG1 A;  1E6P A;  3PRA A;  3FSC A;  1NMW A;  1Y0O A;  5DIV A;  1FKL A;  1K9R A;  1ZB5 A;  2MDI A;  2M8I A;  1WAW A;  4XAK A;  4URI A;  4G50 A;  1FLC A;  2WAD A;  3AQU A;  2LKN A;  1YAT A;  4Q22 A;  2LGO A;  3KAH A;  1NWU A;  3CH9 A;  5HBF A;  1F40 A;  1ROU A;  3RGC A;  1JNE A;  3B9A A;  2BA1 A;  1OGB A;  3WD3 A;  1OWQ A;  4P8X A;  1EQ3 A;  2YSH A;  1BKF A;  3IKG A;  2L4J A;  5E66 A;  1J4R A;  3KAF A;  2DT2 A;  4W5U A;  1W1Y A;  4IQC A;  3UI5 A;  1FKT A;  1UR9 A;  2B31 A;  1NWT A;  1O6I A;  1W1P A;  4TW6 A;  2O92 A;  5DF0 A;  3LUO A;  3PQH A;  2JV4 A;  4N19 A;  4LAV A;  2RUC A;  4R5E A;  4Z2J A;  1HKI A;  5HW7 A;  2XP5 A;  2ZQS A;  1FKJ A;  1EG4 A;  1J6Y A;  2DG9 A;  1Q6I A;  1GOI A;  4ML4 A;  2EZ5 W;  2ZQV A;  1GPF A;  4MNJ A;  3JYM A;  1LJY A;  1WNO A;  2KI3 A;  4QZV B;  3PRD A;  2ITK A;  2AOS A;  4DRK A;  4LGX A;  4ODO A;  1FKH A;  4ZS6 A;  3TC5 A;  2JZV A;  3AS3 A;  4U84 A;  4GLX A;  1LL7 A;  4MGV A;  2MPH A;  1KT1 A;  1P5Q A;  3O5K A;  3UQB A;  3EY6 A;  2ZR4 A;  2F2D A;  3ARY A;  5JH8 A;  2MF9 A;  5DIT A;  2QRV A;  4J4O A;  4DRO A;  2E45 A;  3O5I A;  1W9U A;  4ODP A;  3M7N A;  4JFM A;  1HJX A;  4E5R A;  3WD0 A;  2M3O W;  3B9E A;  5E64 A;  5CQ2 A;  3WQV A;  2KR7 A;  3O5R A;  3ODK A;  1RD6 A;  1LQ0 A;  1UR8 A;  2YBU A;  3H9R B;  5HT1 A;  4DIP A;  2WM0 A;  1NMV A;  3ARU A;  2OWO A;  4REX A;  1E6R A;  5U47 A;  2XPB A;  2LJ4 A;  1E9L A;  1D7J A;  4W9P A;  4MNL A;  4DRM A;  1PIN A;  2Y78 A;  4P8U A;  2DJY A;  5J6E A;  2KFW A;  1GUV A;  2DG3 A;  4JFI A;  2AWG A;  3AS0 A;  3NRK A;  3TCZ A;  2XP4 A;  2JX8 A;  1HKJ A;  5BXJ A;  1W26 A;  4DWS A;  4IPX A;  4J4N A;  1FKK A;  4Z2K A;  4C02 B;  4Z2H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...