1F8AB

Structural basis for the phosphoserine-proline recognition by group iv ww domains
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
167
structure length
155
Chain Sequence
GSHGMADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for phosphoserine-proline recognition by group IV WW domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords PEPTIDYL-PROLYL CIS-TRANS ISOMERASE NIMA-INTERACTING 1
total genus 40
structure length 155
sequence length 167
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2000-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00397 WW WW domain
B PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 1f8aB01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1f8aB02
1N1AA 2L4JA 3UI4A 2K8IA 3O5FA 2N87A 2YSBA 3IKDA 1WMVA 2XP3A 2DG9A 1NSGA 1J4HA 2MNTA 2MLZA 2PPOA 3IHZA 3O5IA 1P5QA 4DRHA 1HXVA 1T11A 4JFMA 2JV4A 1FKTA 3O5QA 2DG4A 2DG3A 4JYSA 3KACA 2M8IA 3KAIA 4BF8A 1YATA 1ZCNA 4ITZA 1BL4A 3H9RB 2RSEA 2OFNA 3KAHA 2YSIA 3B7XA 4U84A 4LAWA 5D75A 2D9FA 2ZR6A 4NNRA 4DT4A 1R9HA 2DK1A 2ZR5A 1FKIA 3JYJA 3MDYB 3L4HA 3NI6A 5GPGA 2XP6A 5HUAA 4QT3A 1FD9A 3OOBA 2KXQA 4JFKA 4ODLA 4W9QA 4ODOA 1A7XA 4REXA 2FAPA 1FKRA 1TK7A 2LAJA 2ITKA 1Y0OA 4LAYA 4N19A 3O5KA 3PRDA 3UI6A 4DZ2A 1YW5A 2KI3A 4JFIA 4ODKA 5HWBA 4TW7A 2UZ5A 1JNTA 1EYMA 3ODKA 2MPHA 5HW6A 3PA7A 3KZ7A 3LUOA 1D7JA 4DRKA 5HTGA 4TNSA 4J4OA 5CQ2A 2L2SA 4U85A 1L1PA 3M85A 3JXVA 5DIVA 1Q6HA 2RURA 2JZVA 3KCEA 2AWGA 2RQSA 4O2TA 5HWCA 2EZ5W 1F8AB 5I98A 4FN2A 3TCZA 1O6WA 1B6CA 3CNGA 2M8JA 3FAPA 3M7NA 1QZ2A 2F4EA 2VN1A 2RUQA 2MF9A 4W9OA 1KT1A 1J6YA 1QPLA 2ZQUA 1FKBA 3O5RA 2YSFA 1FKFA 2XP4A 2MLXA 2RE3A 3O5DA 3VAWA 1QPFA 4DRJA 4DRIA 4DRNA 2M3OW 1PBKA 4R0XA 1U79A 2MLYA 1ROUA 2XPBA 4C02B 2DJYA 4JFLA 5HW8A 2PPNA 2VCDA 3KAFA 4ODRA 2DK7A 4G2PA 2XPAA 2M2AA 3GPKA 4ODMA 3UQIA 3O5EA 3TDBA 4TW8A 5HKGA 2JMFA 2Q5AA 1FKJA 2ZR4A 4LAXA 3LE4A 3UI5A 2KE0A 2XP8A 4ODPA 5B8IC 2LJ4A 4ODNA 3UQBA 4IQ2A 2JX8A 2Y78A 3KADA 3CGMA 1FKKA 3IKGA 5DITA 3O5OA 3JYMA 4ODQA 4DRQA 4DRMA 1TCOC 1C9HA 2PV1A 5AHTA 3RGCA 1JVWA 4DROA 3NTPA 2DWVA 1NMVA 2ZQTA 1D6OA 4FAPA 1W26A 4QT2A 2BA1A 1Q6IA 1PINA 3KABA 4DH0A 2YSGA 1NMWA 1J4IA 1FKGA 1J4RA 1K9QA 3O5PA 2XP7A 3I6CA 1D7HA 2F2DA 1ZK6A 3EY6A 3O5JA 5DIUA 2XP9A 1ROTA 1EG3A 3UF8A 3UQAA 4TX0A 4DZ3A 1WR7A 2PV3A 3WH0A 5J6EA 4MSPA 2ZQSA 1BKFA 2E45A 4GIVA 4TW6A 4J4NA 3PRBA 4IPXA 2KFWA 1EG4A 4LAVA 5HW7A 1FKSA 2JXWA 4GGQA 2RUCA 4DRPA 4U86A 4QIBA 1FKDA 1KT0A 3CGNA 1D7IA 2YSHA 4TYOA 5BXJA 1EQ3A 2KO7A 2M1IA 1JNSA 2RUDA 1FKLA 1Q1CA 3O5MA 4E5RA 1JMQA 2LKNA 1FAPA 1FKHA 3IK8A 2LPVA 2M08A 4MGVA 2MDIA 2KR7A 2DMVA 3RFWA 3NRKA 1F40A 2ZAJA 4JFJA 2PBCA 3O5LA 2XP5A 3KAGA 2IF4A 1M5YA 3TC5A 2ZQVA 1K9RA 2LGOA 4G50A 4W9PA 1I5HW 4IQCA 2F21A 5HT1A 3O5GA 1Q6UA 2PV2A 4DIPA 2FKEA 1FJDA 2KGJA 2PPPA
chains in the Genus database with same CATH superfamily
1N1AA 3ARTA 3UI4A 4L72B 5DF0A 4Z2GA 1EIBA 1NWSA 1WMVA 1NSGA 1T11A 4Z2LA 4JYSA 3CHCA 1YATA 4P8VA 4P8UA 2B5UB 1RP5A 1BL4A 3H9RB 2OFNA 3KAHA 3B7XA 4LAWA 4KR0B 1R9HA 2DK1A 2G8ZA 1FKIA 3JYJA 3L4HA 2O9OA 4QZVB 3OOBA 2KXQA 3W4RA 2FAPA 1FKRA 1NWRA 2ITKA 4KQZA 4WKFA 4N19A 3UI6A 4ODKA 2UZ5A 3ODKA 3FXYA 4S3JA 3PA7A 3PQHA 4J4OA 1HKKA 1GRJA 4WK9A 1Q6HA 2RURA 4MNJA 2RQSA 4P8XA 5I98A 4FN2A 1B6CA 1O6WA 2M8JA 2VN1A 2B31A 1KT1A 3O5RA 1FKFA 2XP4A 2RE3A 3O5DA 1XHGA 3QOKA 4JFLA 4DWSC 2VCDA 4ODRA 4S3KA 2F23A 3ARUA 2WAEA 3ARYA 1W1TA 2KE0A 1NWUA 4ODNA 2Y8NB 2Y78A 3KADA 1OGBA 2QF8A 2DSUA 3O5OA 4DRQA 3WQVA 1HJXA 3RGCA 1E6ZA 4DROA 3PRAA 4IT6A 4FAPA 2G41A 2WM0A 3FY1A 4QT2A 1PINA 2YSGA 1J4IA 1NH6A 3AS2A 3O5PA 4AY1A 1ZK6A 5DIUA 4HARA 1ROTA 3WH0A 5J6EA 3WQWA 4TW6A 3ARQA 1FKSA 1HJVA 3WD0A 4GGQA 4DRPA 2YSHA 3WD3A 1EQ3A 1E6NA 2KO7A 1JNSA 1Q1CA 3IK8A 1SYTA 3MCBA 2LPVA 2DMVA 3BXWA 2IF4A 1FLCA 1Q6UA 2PV2A 2FKEA 1ZU8A 1FJDA 2N87A 2YSBA 2MNTA 4R5EA 2MLZA 2PPOA 3IHZA 4DRHA 3G6MA 1P5QA 3GU0A 2JV4A 3O5QA 2DG4A 2DG3A 4IT4A 4BF8A 2A3EA 4ITZA 1TFVA 2RSEA 1W9UA 3MDYB 3NI6A 5GPGA 3AQUA 4QT3A 1FD9A 4JFKA 4ODLA 4DWSA 4ODOA 5U47A 4REXA 2FDMA 1Y0OA 4URIA 1FFQA 3PRDA 1W1PA 1YW5A 2KI3A 4MNLA 4WIWA 1EYMA 5HW6A 5HTGA 3OA5A 3KCEA 1LL6A 4O2TA 1F8AB 1K9TA 3FAPA 2ETNA 2RUQA 2MF9A 1FKBA 2QRVA 2PI6A 4DRNA 2DSZA 1ROUA 2XPBA 4C02B 3KAFA 3AS0A 3LKXB 2A3BA 4TW8A 5HKGA 2Q5AA 1FKJA 3ALFA 3UI5A 1KFWA 3UQBA 3WD1A 2YBTA 4DWSD 1FKKA 4WJXA 3JYMA 4DRMA 2DWVA 1NMVA 3AROA 1LG2A 2ZQTA 3WL0A 3B8SA 4MPKA 3KABA 4DH0A 1NMWA 1X6NA 5JH8A 2XP7A 2WLZA 2F2DA 3EY6A 5E5WA 4Q7NA 3UQAA 1EG3A 4TX0A 5GQBA 1WR7A 2E45A 1NWTA 2WADA 4LAVA 2RUCA 3CGNA 1KT0A 4A0UA 1D7IA 1FAPA 4ZPWR 2ZAJA 1SR0A 2XP5A 5HW7A 1OWQA 2F21A 4DIPA 1E44A 2KGJA 3PR9A 4MNKA 4NZCA 1GOIA 2XP3A 2OLHA 4DWSB 4JFMA 4MNMA 1LQ0A 3ARSA 2ESCA 2M8IA 3KAIA 4MAVA 5E62A 1RD6A 2YSIA 1ITXA 4U84A 1LL4A 2D9FA 2ZR6A 2ZR5A 3RMEA 2XP6A 3ARXA 3MQGA 1IX5A 1TK7A 2LAJA 2YAJB 1GUVA 3B9AA 4WKAA 3LKXA 2MPHA 3GTYX 3LUOA 4Q22A 4DRKA 5CQ2A 2L2SA 4U85A 1D2KA 3M85A 5DIVA 2JZVA 3CHEA 2YBUA 5GPRA 1ZL1A 3TCZA 3CNGA 3M7NA 4ZS6A 1QPLA 2ZQUA 1OGGA 3VAWA 1JNDA 4DRJA 1WB0A 1H0IA 2DJYA 1FFRA 4PTMA 2DK7A 1LL7A 2XPAA 2M2AA 3ARWA 3UQIA 2JMFA 4LAXA 5B8IC 2ZR4A 3LE4A 4LGXA 4P8WA 2XP8A 5DO2A 4Z2HA 2JX8A 4GLXA 1UR8A 2A3AA 2PN0A 2PV1A 1C9HA 1JVWA 3NTPA 1D6OA 2O92A 4L3NA 2BA1A 4W5UA 4UDMA 2DT3A 4MTVA 3ARVA 4ZPVR 2XP9A 1LG1A 3ARRA 2ZQSA 3B9DA 4A0TA 5E66A 4GIVA 4J4NA 4IPXA 1EG4A 4XAKA 1VF8A 2DT2A 1JCHB 3ARPA 5BXJA 1WAWA 3RM9A 3O5MA 4E5RA 2LKNA 1FKHA 1F40A 4MGVA 3NRKA 2PBCA 2IUZA 1M5YA 3TC5A 4G50A 5HT1A 3ALGA 4WKHA 4Z2KA 1EDQA 2L4JA 3FSBA 3FS8A 2K8IA 2EULA 3O5FA 2DSWA 3IKDA 2DG9A 3O5IA 1J4HA 3AS3A 1HXVA 2DSVA 1ZBKA 3EIPA 5E65A 2OWOA 1HKIA 1FKTA 3KACA 1JNEA 2P4VA 1EHNA 1ZCNA 3WKZA 3CZ8A 5D75A 3MQHA 5HBFA 4NNRA 4DT4A 4ML4A 5HUAA 1ZBVA 3AS1A 4W9QA 2WK2A 1A7XA 1HJWA 3WD4A 1ZB5A 4LAYA 1E6RA 3O5KA 4DZ2A 1W9VA 4JFIA 3FSCA 3BMBA 4NSBA 4TW7A 1JNTA 5HWBA 3CH9A 3KZ7A 1D7JA 3G6LA 4TNSA 1GPFA 3B9EA 1L1PA 1E15A 1TR8A 3JXVA 3RM4A 1XRVA 2AWGA 5HWCA 2EZ5W 4Z2JA 3CHFA 1QZ2A 2F4EA 1ZBCA 2DPEA 4W9OA 1J6YA 2YSFA 2MLXA 4DRIA 1QPFA 1ZBWA 2M3OW 1PBKA 4R0XA 1U79A 2MLYA 3WIJA 5HW8A 2PPNA 1HKMA 4G2PA 3GPKA 4ODMA 3O5EA 3TDBA 4ODPA 2LJ4A 4IQ2A 1UR9A 3CGMA 4Z2IA 3IKGA 2WLYA 5DITA 1W1VA 4ODQA 1HKJA 1TCOC 5AHTA 1W1YA 4HBEA 1O6IA 1W26A 5E64A 3WL1A 2DT0A 1E6PA 1Q6IA 1FKGA 1W9PA 1J4RA 1K9QA 3I6CA 1D7HA 1E9LA 2AOSA 3ARZA 1LJYA 3O5JA 3UF8A 5DEZA 4DZ3A 2PV3A 1X6LA 4MSPA 1BKFA 2A3CA 3PRBA 4HBOA 2KFWA 2DT1A 2JXWA 4U86A 4QIBA 1FKDA 4TYOA 3MCBB 2M1IA 2RUDA 1FKLA 1JMQA 3RM8A 3CHDA 2M08A 3WD2A 2MDIA 2KR7A 3RFWA 4ZPTR 4JFJA 1H0GA 1CTNA 3O5LA 3KAGA 2LGOA 2ZQVA 1K9RA 4W9PA 1I5HW 4IQCA 3O5GA 1WNOA 2PPPA
chains in the Genus database with same CATH topology
1N1AA 3ARTA 3UI4A 4L72B 5DF0A 4Z2GA 1EIBA 1NWSA 1WMVA 1NSGA 1T11A 4Z2LA 4JYSA 3CHCA 1YATA 4P8VA 4P8UA 1RP5A 1BL4A 3H9RB 2OFNA 3KAHA 3B7XA 4LAWA 4KR0B 1R9HA 2DK1A 2G8ZA 1FKIA 3JYJA 3L4HA 2O9OA 4QZVB 3OOBA 2KXQA 3W4RA 2FAPA 1FKRA 1NWRA 2ITKA 4KQZA 4WKFA 4N19A 3UI6A 4ODKA 2UZ5A 3ODKA 3FXYA 4S3JA 3PA7A 3PQHA 4J4OA 1HKKA 4WK9A 1Q6HA 2RURA 4MNJA 2RQSA 4P8XA 5I98A 4FN2A 1B6CA 1O6WA 2M8JA 2VN1A 2B31A 1KT1A 3O5RA 1FKFA 2XP4A 2RE3A 3O5DA 1XHGA 3QOKA 4JFLA 4DWSC 2VCDA 4ODRA 4S3KA 3ARUA 2WAEA 3ARYA 1W1TA 2KE0A 1NWUA 4ODNA 2Y8NB 2Y78A 3KADA 1OGBA 2QF8A 2DSUA 3O5OA 4DRQA 3WQVA 1HJXA 3RGCA 1E6ZA 4DROA 3PRAA 4IT6A 4FAPA 2G41A 2WM0A 3FY1A 4QT2A 1PINA 2YSGA 1J4IA 1NH6A 3AS2A 3O5PA 4AY1A 1ZK6A 5DIUA 4HARA 1ROTA 3WH0A 5J6EA 3WQWA 4TW6A 3ARQA 1FKSA 1HJVA 3WD0A 4GGQA 4DRPA 2YSHA 3WD3A 1EQ3A 1E6NA 2KO7A 1JNSA 1Q1CA 3IK8A 1SYTA 3MCBA 2LPVA 2DMVA 3BXWA 2IF4A 1FLCA 1Q6UA 2PV2A 2FKEA 1ZU8A 1FJDA 2N87A 2YSBA 2MNTA 4R5EA 2MLZA 2PPOA 3IHZA 4DRHA 3G6MA 1P5QA 2JV4A 3O5QA 2DG4A 2DG3A 4IT4A 4BF8A 2A3EA 4ITZA 1TFVA 2RSEA 1W9UA 3MDYB 3NI6A 5GPGA 3AQUA 4QT3A 1FD9A 4JFKA 4ODLA 4DWSA 4ODOA 5U47A 4REXA 2FDMA 1Y0OA 4URIA 1FFQA 3PRDA 1W1PA 1YW5A 2KI3A 4MNLA 4WIWA 1EYMA 5HW6A 5HTGA 3OA5A 3KCEA 1LL6A 4O2TA 1F8AB 1K9TA 3FAPA 2RUQA 2MF9A 1FKBA 2QRVA 2PI6A 4DRNA 2DSZA 1ROUA 2XPBA 4C02B 3KAFA 3AS0A 3LKXB 2A3BA 4TW8A 5HKGA 2Q5AA 1FKJA 3ALFA 3UI5A 1KFWA 3UQBA 3WD1A 2YBTA 4DWSD 1FKKA 4WJXA 3JYMA 4DRMA 2DWVA 1NMVA 3AROA 1LG2A 2ZQTA 3WL0A 3B8SA 4MPKA 3KABA 4DH0A 1NMWA 1X6NA 5JH8A 2XP7A 2WLZA 2F2DA 3EY6A 5E5WA 4Q7NA 3UQAA 1EG3A 4TX0A 5GQBA 1WR7A 2E45A 1NWTA 2WADA 4LAVA 2RUCA 3CGNA 1KT0A 4A0UA 1D7IA 1FAPA 4ZPWR 2ZAJA 1SR0A 2XP5A 5HW7A 1OWQA 2F21A 4DIPA 2KGJA 3PR9A 4MNKA 4NZCA 1GOIA 2XP3A 2OLHA 4DWSB 4JFMA 4MNMA 1LQ0A 3ARSA 2ESCA 2M8IA 3KAIA 4MAVA 5E62A 1RD6A 2YSIA 1ITXA 4U84A 1LL4A 2D9FA 2ZR6A 2ZR5A 3RMEA 2XP6A 3ARXA 3MQGA 1IX5A 1TK7A 2LAJA 2YAJB 1GUVA 3B9AA 4WKAA 3LKXA 2MPHA 3LUOA 4Q22A 4DRKA 5CQ2A 2L2SA 4U85A 1D2KA 3M85A 5DIVA 2JZVA 3CHEA 2YBUA 5GPRA 1ZL1A 3TCZA 3CNGA 3M7NA 4ZS6A 1QPLA 2ZQUA 1OGGA 3VAWA 1JNDA 4DRJA 1WB0A 1H0IA 2DJYA 1FFRA 4PTMA 2DK7A 1LL7A 2XPAA 2M2AA 3ARWA 3UQIA 2JMFA 4LAXA 5B8IC 2ZR4A 3LE4A 4LGXA 4P8WA 2XP8A 5DO2A 4Z2HA 2JX8A 4GLXA 1UR8A 2A3AA 2PV1A 1C9HA 1JVWA 3NTPA 1D6OA 2O92A 4L3NA 2BA1A 4W5UA 2DT3A 4MTVA 3ARVA 4ZPVR 2XP9A 1LG1A 3ARRA 2ZQSA 3B9DA 4A0TA 5E66A 4GIVA 4J4NA 4IPXA 1EG4A 4XAKA 1VF8A 2DT2A 3ARPA 5BXJA 1WAWA 3RM9A 3O5MA 4E5RA 2LKNA 1FKHA 1F40A 4MGVA 3NRKA 2PBCA 2IUZA 1M5YA 3TC5A 4G50A 5HT1A 3ALGA 4WKHA 4Z2KA 1EDQA 2L4JA 3FSBA 3FS8A 2K8IA 3O5FA 2DSWA 3IKDA 2DG9A 3O5IA 1J4HA 3AS3A 1HXVA 2DSVA 1ZBKA 5E65A 2OWOA 1HKIA 1FKTA 3KACA 1JNEA 1EHNA 1ZCNA 3WKZA 3CZ8A 5D75A 3MQHA 5HBFA 4NNRA 4DT4A 4ML4A 5HUAA 1ZBVA 3AS1A 4W9QA 2WK2A 1A7XA 1HJWA 3WD4A 1ZB5A 4LAYA 1E6RA 3O5KA 4DZ2A 1W9VA 4JFIA 3FSCA 4NSBA 4TW7A 5HWBA 1JNTA 3CH9A 3KZ7A 1D7JA 3G6LA 4TNSA 1GPFA 3B9EA 1L1PA 1E15A 1TR8A 3JXVA 3RM4A 1XRVA 2AWGA 5HWCA 2EZ5W 4Z2JA 3CHFA 1QZ2A 2F4EA 1ZBCA 2DPEA 4W9OA 1J6YA 2YSFA 2MLXA 4DRIA 1QPFA 1ZBWA 2M3OW 1PBKA 4R0XA 1U79A 2MLYA 3WIJA 5HW8A 2PPNA 1HKMA 4G2PA 3GPKA 4ODMA 3O5EA 3TDBA 4ODPA 2LJ4A 4IQ2A 1UR9A 3CGMA 4Z2IA 3IKGA 2WLYA 5DITA 1W1VA 4ODQA 1HKJA 1TCOC 5AHTA 1W1YA 4HBEA 1O6IA 1W26A 5E64A 3WL1A 2DT0A 1E6PA 1Q6IA 1FKGA 1W9PA 1J4RA 1K9QA 3I6CA 1D7HA 1E9LA 2AOSA 3ARZA 1LJYA 3O5JA 3UF8A 5DEZA 4DZ3A 2PV3A 1X6LA 4MSPA 1BKFA 2A3CA 3PRBA 4HBOA 2KFWA 2DT1A 2JXWA 4U86A 4QIBA 1FKDA 4TYOA 3MCBB 2M1IA 2RUDA 1FKLA 1JMQA 3RM8A 3CHDA 2M08A 3WD2A 2MDIA 2KR7A 3RFWA 4ZPTR 4JFJA 1H0GA 1CTNA 3O5LA 3KAGA 2LGOA 2ZQVA 1K9RA 4W9PA 1I5HW 4IQCA 3O5GA 1WNOA 2PPPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N1A A;  2L4J A;  3UI4 A;  2K8I A;  3O5F A;  2N87 A;  2YSB A;  3IKD A;  1WMV A;  2XP3 A;  2DG9 A;  1NSG A;  1J4H A;  2MNT A;  2MLZ A;  2PPO A;  3IHZ A;  3O5I A;  1P5Q A;  4DRH A;  1HXV A;  1T11 A;  4JFM A;  2JV4 A;  1FKT A;  3O5Q A;  2DG4 A;  2DG3 A;  4JYS A;  3KAC A;  2M8I A;  3KAI A;  4BF8 A;  1YAT A;  1ZCN A;  4ITZ A;  1BL4 A;  3H9R B;  2RSE A;  2OFN A;  3KAH A;  2YSI A;  3B7X A;  4U84 A;  4LAW A;  5D75 A;  2D9F A;  2ZR6 A;  4NNR A;  4DT4 A;  1R9H A;  2DK1 A;  2ZR5 A;  1FKI A;  3JYJ A;  3MDY B;  3L4H A;  3NI6 A;  5GPG A;  2XP6 A;  5HUA A;  4QT3 A;  1FD9 A;  3OOB A;  2KXQ A;  4JFK A;  4ODL A;  4W9Q A;  4ODO A;  1A7X A;  4REX A;  2FAP A;  1FKR A;  1TK7 A;  2LAJ A;  2ITK A;  1Y0O A;  4LAY A;  4N19 A;  3O5K A;  3PRD A;  3UI6 A;  4DZ2 A;  1YW5 A;  2KI3 A;  4JFI A;  4ODK A;  5HWB A;  4TW7 A;  2UZ5 A;  1JNT A;  1EYM A;  3ODK A;  2MPH A;  5HW6 A;  3PA7 A;  3KZ7 A;  3LUO A;  1D7J A;  4DRK A;  5HTG A;  4TNS A;  4J4O A;  5CQ2 A;  2L2S A;  4U85 A;  1L1P A;  3M85 A;  3JXV A;  5DIV A;  1Q6H A;  2RUR A;  2JZV A;  3KCE A;  2AWG A;  2RQS A;  4O2T A;  5HWC A;  2EZ5 W;  1F8A B;  5I98 A;  4FN2 A;  3TCZ A;  1O6W A;  1B6C A;  3CNG A;  2M8J A;  3FAP A;  3M7N A;  1QZ2 A;  2F4E A;  2VN1 A;  2RUQ A;  2MF9 A;  4W9O A;  1KT1 A;  1J6Y A;  1QPL A;  2ZQU A;  1FKB A;  3O5R A;  2YSF A;  1FKF A;  2XP4 A;  2MLX A;  2RE3 A;  3O5D A;  3VAW A;  1QPF A;  4DRJ A;  4DRI A;  4DRN A;  2M3O W;  1PBK A;  4R0X A;  1U79 A;  2MLY A;  1ROU A;  2XPB A;  4C02 B;  2DJY A;  4JFL A;  5HW8 A;  2PPN A;  2VCD A;  3KAF A;  4ODR A;  2DK7 A;  4G2P A;  2XPA A;  2M2A A;  3GPK A;  4ODM A;  3UQI A;  3O5E A;  3TDB A;  4TW8 A;  5HKG A;  2JMF A;  2Q5A A;  1FKJ A;  2ZR4 A;  4LAX A;  3LE4 A;  3UI5 A;  2KE0 A;  2XP8 A;  4ODP A;  5B8I C;  2LJ4 A;  4ODN A;  3UQB A;  4IQ2 A;  2JX8 A;  2Y78 A;  3KAD A;  3CGM A;  1FKK A;  3IKG A;  5DIT A;  3O5O A;  3JYM A;  4ODQ A;  4DRQ A;  4DRM A;  1TCO C;  1C9H A;  2PV1 A;  5AHT A;  3RGC A;  1JVW A;  4DRO A;  3NTP A;  2DWV A;  1NMV A;  2ZQT A;  1D6O A;  4FAP A;  1W26 A;  4QT2 A;  2BA1 A;  1Q6I A;  1PIN A;  3KAB A;  4DH0 A;  2YSG A;  1NMW A;  1J4I A;  1FKG A;  1J4R A;  1K9Q A;  3O5P A;  2XP7 A;  3I6C A;  1D7H A;  2F2D A;  1ZK6 A;  3EY6 A;  3O5J A;  5DIU A;  2XP9 A;  1ROT A;  1EG3 A;  3UF8 A;  3UQA A;  4TX0 A;  4DZ3 A;  1WR7 A;  2PV3 A;  3WH0 A;  5J6E A;  4MSP A;  2ZQS A;  1BKF A;  2E45 A;  4GIV A;  4TW6 A;  4J4N A;  3PRB A;  4IPX A;  2KFW A;  1EG4 A;  4LAV A;  5HW7 A;  1FKS A;  2JXW A;  4GGQ A;  2RUC A;  4DRP A;  4U86 A;  4QIB A;  1FKD A;  1KT0 A;  3CGN A;  1D7I A;  2YSH A;  4TYO A;  5BXJ A;  1EQ3 A;  2KO7 A;  2M1I A;  1JNS A;  2RUD A;  1FKL A;  1Q1C A;  3O5M A;  4E5R A;  1JMQ A;  2LKN A;  1FAP A;  1FKH A;  3IK8 A;  2LPV A;  2M08 A;  4MGV A;  2MDI A;  2KR7 A;  2DMV A;  3RFW A;  3NRK A;  1F40 A;  2ZAJ A;  4JFJ A;  2PBC A;  3O5L A;  2XP5 A;  3KAG A;  2IF4 A;  1M5Y A;  3TC5 A;  2ZQV A;  1K9R A;  2LGO A;  4G50 A;  4W9P A;  1I5H W;  4IQC A;  2F21 A;  5HT1 A;  3O5G A;  1Q6U A;  2PV2 A;  4DIP A;  2FKE A;  1FJD A;  2KGJ A;  2PPP A; 
#chains in the Genus database with same CATH topology
 1N1A A;  3ART A;  3UI4 A;  4L72 B;  5DF0 A;  4Z2G A;  1EIB A;  1NWS A;  1WMV A;  1NSG A;  1T11 A;  4Z2L A;  4JYS A;  3CHC A;  1YAT A;  4P8V A;  4P8U A;  2B5U B;  1RP5 A;  1BL4 A;  3H9R B;  2OFN A;  3KAH A;  3B7X A;  4LAW A;  4KR0 B;  1R9H A;  2DK1 A;  2G8Z A;  1FKI A;  3JYJ A;  3L4H A;  2O9O A;  4QZV B;  3OOB A;  2KXQ A;  3W4R A;  2FAP A;  1FKR A;  1NWR A;  2ITK A;  4KQZ A;  4WKF A;  4N19 A;  3UI6 A;  4ODK A;  2UZ5 A;  3ODK A;  3FXY A;  4S3J A;  3PA7 A;  3PQH A;  4J4O A;  1HKK A;  1GRJ A;  4WK9 A;  1Q6H A;  2RUR A;  4MNJ A;  2RQS A;  4P8X A;  5I98 A;  4FN2 A;  1B6C A;  1O6W A;  2M8J A;  2VN1 A;  2B31 A;  1KT1 A;  3O5R A;  1FKF A;  2XP4 A;  2RE3 A;  3O5D A;  1XHG A;  3QOK A;  4JFL A;  4DWS C;  2VCD A;  4ODR A;  4S3K A;  2F23 A;  3ARU A;  2WAE A;  3ARY A;  1W1T A;  2KE0 A;  1NWU A;  4ODN A;  2Y8N B;  2Y78 A;  3KAD A;  1OGB A;  2QF8 A;  2DSU A;  3O5O A;  4DRQ A;  3WQV A;  1HJX A;  3RGC A;  1E6Z A;  4DRO A;  3PRA A;  4IT6 A;  4FAP A;  2G41 A;  2WM0 A;  3FY1 A;  4QT2 A;  1PIN A;  2YSG A;  1J4I A;  1NH6 A;  3AS2 A;  3O5P A;  4AY1 A;  1ZK6 A;  5DIU A;  4HAR A;  1ROT A;  3WH0 A;  5J6E A;  3WQW A;  4TW6 A;  3ARQ A;  1FKS A;  1HJV A;  3WD0 A;  4GGQ A;  4DRP A;  2YSH A;  3WD3 A;  1EQ3 A;  1E6N A;  2KO7 A;  1JNS A;  1Q1C A;  3IK8 A;  1SYT A;  3MCB A;  2LPV A;  2DMV A;  3BXW A;  2IF4 A;  1FLC A;  1Q6U A;  2PV2 A;  2FKE A;  1ZU8 A;  1FJD A;  2N87 A;  2YSB A;  2MNT A;  4R5E A;  2MLZ A;  2PPO A;  3IHZ A;  4DRH A;  3G6M A;  1P5Q A;  3GU0 A;  2JV4 A;  3O5Q A;  2DG4 A;  2DG3 A;  4IT4 A;  4BF8 A;  2A3E A;  4ITZ A;  1TFV A;  2RSE A;  1W9U A;  3MDY B;  3NI6 A;  5GPG A;  3AQU A;  4QT3 A;  1FD9 A;  4JFK A;  4ODL A;  4DWS A;  4ODO A;  5U47 A;  4REX A;  2FDM A;  1Y0O A;  4URI A;  1FFQ A;  3PRD A;  1W1P A;  1YW5 A;  2KI3 A;  4MNL A;  4WIW A;  1EYM A;  5HW6 A;  5HTG A;  3OA5 A;  3KCE A;  1LL6 A;  4O2T A;  1F8A B;  1K9T A;  3FAP A;  2ETN A;  2RUQ A;  2MF9 A;  1FKB A;  2QRV A;  2PI6 A;  4DRN A;  2DSZ A;  1ROU A;  2XPB A;  4C02 B;  3KAF A;  3AS0 A;  3LKX B;  2A3B A;  4TW8 A;  5HKG A;  2Q5A A;  1FKJ A;  3ALF A;  3UI5 A;  1KFW A;  3UQB A;  3WD1 A;  2YBT A;  4DWS D;  1FKK A;  4WJX A;  3JYM A;  4DRM A;  2DWV A;  1NMV A;  3ARO A;  1LG2 A;  2ZQT A;  3WL0 A;  3B8S A;  4MPK A;  3KAB A;  4DH0 A;  1NMW A;  1X6N A;  5JH8 A;  2XP7 A;  2WLZ A;  2F2D A;  3EY6 A;  5E5W A;  4Q7N A;  3UQA A;  1EG3 A;  4TX0 A;  5GQB A;  1WR7 A;  2E45 A;  1NWT A;  2WAD A;  4LAV A;  2RUC A;  3CGN A;  1KT0 A;  4A0U A;  1D7I A;  1FAP A;  4ZPW R;  2ZAJ A;  1SR0 A;  2XP5 A;  5HW7 A;  1OWQ A;  2F21 A;  4DIP A;  1E44 A;  2KGJ A;  3PR9 A;  4MNK A;  4NZC A;  1GOI A;  2XP3 A;  2OLH A;  4DWS B;  4JFM A;  4MNM A;  1LQ0 A;  3ARS A;  2ESC A;  2M8I A;  3KAI A;  4MAV A;  5E62 A;  1RD6 A;  2YSI A;  1ITX A;  4U84 A;  1LL4 A;  2D9F A;  2ZR6 A;  2ZR5 A;  3RME A;  2XP6 A;  3ARX A;  3MQG A;  1IX5 A;  1TK7 A;  2LAJ A;  2YAJ B;  1GUV A;  3B9A A;  4WKA A;  3LKX A;  2MPH A;  3GTY X;  3LUO A;  4Q22 A;  4DRK A;  5CQ2 A;  2L2S A;  4U85 A;  1D2K A;  3M85 A;  5DIV A;  2JZV A;  3CHE A;  2YBU A;  5GPR A;  1ZL1 A;  3TCZ A;  3CNG A;  3M7N A;  4ZS6 A;  1QPL A;  2ZQU A;  1OGG A;  3VAW A;  1JND A;  4DRJ A;  1WB0 A;  1H0I A;  2DJY A;  1FFR A;  4PTM A;  2DK7 A;  1LL7 A;  2XPA A;  2M2A A;  3ARW A;  3UQI A;  2JMF A;  4LAX A;  5B8I C;  2ZR4 A;  3LE4 A;  4LGX A;  4P8W A;  2XP8 A;  5DO2 A;  4Z2H A;  2JX8 A;  4GLX A;  1UR8 A;  2A3A A;  2PN0 A;  2PV1 A;  1C9H A;  1JVW A;  3NTP A;  1D6O A;  2O92 A;  4L3N A;  2BA1 A;  4W5U A;  4UDM A;  2DT3 A;  4MTV A;  3ARV A;  4ZPV R;  2XP9 A;  1LG1 A;  3ARR A;  2ZQS A;  3B9D A;  4A0T A;  5E66 A;  4GIV A;  4J4N A;  4IPX A;  1EG4 A;  4XAK A;  1VF8 A;  2DT2 A;  1JCH B;  3ARP A;  5BXJ A;  1WAW A;  3RM9 A;  3O5M A;  4E5R A;  2LKN A;  1FKH A;  1F40 A;  4MGV A;  3NRK A;  2PBC A;  2IUZ A;  1M5Y A;  3TC5 A;  4G50 A;  5HT1 A;  3ALG A;  4WKH A;  4Z2K A;  1EDQ A;  2L4J A;  3FSB A;  3FS8 A;  2K8I A;  2EUL A;  3O5F A;  2DSW A;  3IKD A;  2DG9 A;  3O5I A;  1J4H A;  3AS3 A;  1HXV A;  2DSV A;  1ZBK A;  3EIP A;  5E65 A;  2OWO A;  1HKI A;  1FKT A;  3KAC A;  1JNE A;  2P4V A;  1EHN A;  1ZCN A;  3WKZ A;  3CZ8 A;  5D75 A;  3MQH A;  5HBF A;  4NNR A;  4DT4 A;  4ML4 A;  5HUA A;  1ZBV A;  3AS1 A;  4W9Q A;  2WK2 A;  1A7X A;  1HJW A;  3WD4 A;  1ZB5 A;  4LAY A;  1E6R A;  3O5K A;  4DZ2 A;  1W9V A;  4JFI A;  3FSC A;  3BMB A;  4NSB A;  4TW7 A;  1JNT A;  5HWB A;  3CH9 A;  3KZ7 A;  1D7J A;  3G6L A;  4TNS A;  1GPF A;  3B9E A;  1L1P A;  1E15 A;  1TR8 A;  3JXV A;  3RM4 A;  1XRV A;  2AWG A;  5HWC A;  2EZ5 W;  4Z2J A;  3CHF A;  1QZ2 A;  2F4E A;  1ZBC A;  2DPE A;  4W9O A;  1J6Y A;  2YSF A;  2MLX A;  4DRI A;  1QPF A;  1ZBW A;  2M3O W;  1PBK A;  4R0X A;  1U79 A;  2MLY A;  3WIJ A;  5HW8 A;  2PPN A;  1HKM A;  4G2P A;  3GPK A;  4ODM A;  3O5E A;  3TDB A;  4ODP A;  2LJ4 A;  4IQ2 A;  1UR9 A;  3CGM A;  4Z2I A;  3IKG A;  2WLY A;  5DIT A;  1W1V A;  4ODQ A;  1HKJ A;  1TCO C;  5AHT A;  1W1Y A;  4HBE A;  1O6I A;  1W26 A;  5E64 A;  3WL1 A;  2DT0 A;  1E6P A;  1Q6I A;  1FKG A;  1W9P A;  1J4R A;  1K9Q A;  3I6C A;  1D7H A;  1E9L A;  2AOS A;  3ARZ A;  1LJY A;  3O5J A;  3UF8 A;  5DEZ A;  4DZ3 A;  2PV3 A;  1X6L A;  4MSP A;  1BKF A;  2A3C A;  3PRB A;  4HBO A;  2KFW A;  2DT1 A;  2JXW A;  4U86 A;  4QIB A;  1FKD A;  4TYO A;  3MCB B;  2M1I A;  2RUD A;  1FKL A;  1JMQ A;  3RM8 A;  3CHD A;  2M08 A;  3WD2 A;  2MDI A;  2KR7 A;  3RFW A;  4ZPT R;  4JFJ A;  1H0G A;  1CTN A;  3O5L A;  3KAG A;  2LGO A;  2ZQV A;  1K9R A;  4W9P A;  1I5H W;  4IQC A;  3O5G A;  1WNO A;  2PPP A; 
#chains in the Genus database with same CATH homology
 1N1A A;  3ART A;  3UI4 A;  4L72 B;  5DF0 A;  4Z2G A;  1EIB A;  1NWS A;  1WMV A;  1NSG A;  1T11 A;  4Z2L A;  4JYS A;  3CHC A;  1YAT A;  4P8V A;  4P8U A;  1RP5 A;  1BL4 A;  3H9R B;  2OFN A;  3KAH A;  3B7X A;  4LAW A;  4KR0 B;  1R9H A;  2DK1 A;  2G8Z A;  1FKI A;  3JYJ A;  3L4H A;  2O9O A;  4QZV B;  3OOB A;  2KXQ A;  3W4R A;  2FAP A;  1FKR A;  1NWR A;  2ITK A;  4KQZ A;  4WKF A;  4N19 A;  3UI6 A;  4ODK A;  2UZ5 A;  3ODK A;  3FXY A;  4S3J A;  3PA7 A;  3PQH A;  4J4O A;  1HKK A;  4WK9 A;  1Q6H A;  2RUR A;  4MNJ A;  2RQS A;  4P8X A;  5I98 A;  4FN2 A;  1B6C A;  1O6W A;  2M8J A;  2VN1 A;  2B31 A;  1KT1 A;  3O5R A;  1FKF A;  2XP4 A;  2RE3 A;  3O5D A;  1XHG A;  3QOK A;  4JFL A;  4DWS C;  2VCD A;  4ODR A;  4S3K A;  3ARU A;  2WAE A;  3ARY A;  1W1T A;  2KE0 A;  1NWU A;  4ODN A;  2Y8N B;  2Y78 A;  3KAD A;  1OGB A;  2QF8 A;  2DSU A;  3O5O A;  4DRQ A;  3WQV A;  1HJX A;  3RGC A;  1E6Z A;  4DRO A;  3PRA A;  4IT6 A;  4FAP A;  2G41 A;  2WM0 A;  3FY1 A;  4QT2 A;  1PIN A;  2YSG A;  1J4I A;  1NH6 A;  3AS2 A;  3O5P A;  4AY1 A;  1ZK6 A;  5DIU A;  4HAR A;  1ROT A;  3WH0 A;  5J6E A;  3WQW A;  4TW6 A;  3ARQ A;  1FKS A;  1HJV A;  3WD0 A;  4GGQ A;  4DRP A;  2YSH A;  3WD3 A;  1EQ3 A;  1E6N A;  2KO7 A;  1JNS A;  1Q1C A;  3IK8 A;  1SYT A;  3MCB A;  2LPV A;  2DMV A;  3BXW A;  2IF4 A;  1FLC A;  1Q6U A;  2PV2 A;  2FKE A;  1ZU8 A;  1FJD A;  2N87 A;  2YSB A;  2MNT A;  4R5E A;  2MLZ A;  2PPO A;  3IHZ A;  4DRH A;  3G6M A;  1P5Q A;  2JV4 A;  3O5Q A;  2DG4 A;  2DG3 A;  4IT4 A;  4BF8 A;  2A3E A;  4ITZ A;  1TFV A;  2RSE A;  1W9U A;  3MDY B;  3NI6 A;  5GPG A;  3AQU A;  4QT3 A;  1FD9 A;  4JFK A;  4ODL A;  4DWS A;  4ODO A;  5U47 A;  4REX A;  2FDM A;  1Y0O A;  4URI A;  1FFQ A;  3PRD A;  1W1P A;  1YW5 A;  2KI3 A;  4MNL A;  4WIW A;  1EYM A;  5HW6 A;  5HTG A;  3OA5 A;  3KCE A;  1LL6 A;  4O2T A;  1F8A B;  1K9T A;  3FAP A;  2RUQ A;  2MF9 A;  1FKB A;  2QRV A;  2PI6 A;  4DRN A;  2DSZ A;  1ROU A;  2XPB A;  4C02 B;  3KAF A;  3AS0 A;  3LKX B;  2A3B A;  4TW8 A;  5HKG A;  2Q5A A;  1FKJ A;  3ALF A;  3UI5 A;  1KFW A;  3UQB A;  3WD1 A;  2YBT A;  4DWS D;  1FKK A;  4WJX A;  3JYM A;  4DRM A;  2DWV A;  1NMV A;  3ARO A;  1LG2 A;  2ZQT A;  3WL0 A;  3B8S A;  4MPK A;  3KAB A;  4DH0 A;  1NMW A;  1X6N A;  5JH8 A;  2XP7 A;  2WLZ A;  2F2D A;  3EY6 A;  5E5W A;  4Q7N A;  3UQA A;  1EG3 A;  4TX0 A;  5GQB A;  1WR7 A;  2E45 A;  1NWT A;  2WAD A;  4LAV A;  2RUC A;  3CGN A;  1KT0 A;  4A0U A;  1D7I A;  1FAP A;  4ZPW R;  2ZAJ A;  1SR0 A;  2XP5 A;  5HW7 A;  1OWQ A;  2F21 A;  4DIP A;  2KGJ A;  3PR9 A;  4MNK A;  4NZC A;  1GOI A;  2XP3 A;  2OLH A;  4DWS B;  4JFM A;  4MNM A;  1LQ0 A;  3ARS A;  2ESC A;  2M8I A;  3KAI A;  4MAV A;  5E62 A;  1RD6 A;  2YSI A;  1ITX A;  4U84 A;  1LL4 A;  2D9F A;  2ZR6 A;  2ZR5 A;  3RME A;  2XP6 A;  3ARX A;  3MQG A;  1IX5 A;  1TK7 A;  2LAJ A;  2YAJ B;  1GUV A;  3B9A A;  4WKA A;  3LKX A;  2MPH A;  3LUO A;  4Q22 A;  4DRK A;  5CQ2 A;  2L2S A;  4U85 A;  1D2K A;  3M85 A;  5DIV A;  2JZV A;  3CHE A;  2YBU A;  5GPR A;  1ZL1 A;  3TCZ A;  3CNG A;  3M7N A;  4ZS6 A;  1QPL A;  2ZQU A;  1OGG A;  3VAW A;  1JND A;  4DRJ A;  1WB0 A;  1H0I A;  2DJY A;  1FFR A;  4PTM A;  2DK7 A;  1LL7 A;  2XPA A;  2M2A A;  3ARW A;  3UQI A;  2JMF A;  4LAX A;  5B8I C;  2ZR4 A;  3LE4 A;  4LGX A;  4P8W A;  2XP8 A;  5DO2 A;  4Z2H A;  2JX8 A;  4GLX A;  1UR8 A;  2A3A A;  2PV1 A;  1C9H A;  1JVW A;  3NTP A;  1D6O A;  2O92 A;  4L3N A;  2BA1 A;  4W5U A;  2DT3 A;  4MTV A;  3ARV A;  4ZPV R;  2XP9 A;  1LG1 A;  3ARR A;  2ZQS A;  3B9D A;  4A0T A;  5E66 A;  4GIV A;  4J4N A;  4IPX A;  1EG4 A;  4XAK A;  1VF8 A;  2DT2 A;  3ARP A;  5BXJ A;  1WAW A;  3RM9 A;  3O5M A;  4E5R A;  2LKN A;  1FKH A;  1F40 A;  4MGV A;  3NRK A;  2PBC A;  2IUZ A;  1M5Y A;  3TC5 A;  4G50 A;  5HT1 A;  3ALG A;  4WKH A;  4Z2K A;  1EDQ A;  2L4J A;  3FSB A;  3FS8 A;  2K8I A;  3O5F A;  2DSW A;  3IKD A;  2DG9 A;  3O5I A;  1J4H A;  3AS3 A;  1HXV A;  2DSV A;  1ZBK A;  5E65 A;  2OWO A;  1HKI A;  1FKT A;  3KAC A;  1JNE A;  1EHN A;  1ZCN A;  3WKZ A;  3CZ8 A;  5D75 A;  3MQH A;  5HBF A;  4NNR A;  4DT4 A;  4ML4 A;  5HUA A;  1ZBV A;  3AS1 A;  4W9Q A;  2WK2 A;  1A7X A;  1HJW A;  3WD4 A;  1ZB5 A;  4LAY A;  1E6R A;  3O5K A;  4DZ2 A;  1W9V A;  4JFI A;  3FSC A;  4NSB A;  4TW7 A;  5HWB A;  1JNT A;  3CH9 A;  3KZ7 A;  1D7J A;  3G6L A;  4TNS A;  1GPF A;  3B9E A;  1L1P A;  1E15 A;  1TR8 A;  3JXV A;  3RM4 A;  1XRV A;  2AWG A;  5HWC A;  2EZ5 W;  4Z2J A;  3CHF A;  1QZ2 A;  2F4E A;  1ZBC A;  2DPE A;  4W9O A;  1J6Y A;  2YSF A;  2MLX A;  4DRI A;  1QPF A;  1ZBW A;  2M3O W;  1PBK A;  4R0X A;  1U79 A;  2MLY A;  3WIJ A;  5HW8 A;  2PPN A;  1HKM A;  4G2P A;  3GPK A;  4ODM A;  3O5E A;  3TDB A;  4ODP A;  2LJ4 A;  4IQ2 A;  1UR9 A;  3CGM A;  4Z2I A;  3IKG A;  2WLY A;  5DIT A;  1W1V A;  4ODQ A;  1HKJ A;  1TCO C;  5AHT A;  1W1Y A;  4HBE A;  1O6I A;  1W26 A;  5E64 A;  3WL1 A;  2DT0 A;  1E6P A;  1Q6I A;  1FKG A;  1W9P A;  1J4R A;  1K9Q A;  3I6C A;  1D7H A;  1E9L A;  2AOS A;  3ARZ A;  1LJY A;  3O5J A;  3UF8 A;  5DEZ A;  4DZ3 A;  2PV3 A;  1X6L A;  4MSP A;  1BKF A;  2A3C A;  3PRB A;  4HBO A;  2KFW A;  2DT1 A;  2JXW A;  4U86 A;  4QIB A;  1FKD A;  4TYO A;  3MCB B;  2M1I A;  2RUD A;  1FKL A;  1JMQ A;  3RM8 A;  3CHD A;  2M08 A;  3WD2 A;  2MDI A;  2KR7 A;  3RFW A;  4ZPT R;  4JFJ A;  1H0G A;  1CTN A;  3O5L A;  3KAG A;  2LGO A;  2ZQV A;  1K9R A;  4W9P A;  1I5H W;  4IQC A;  3O5G A;  1WNO A;  2PPP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...