1F8AB

Structural basis for the phosphoserine-proline recognition by group iv ww domains
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
167
structure length
155
Chain Sequence
GSHGMADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for phosphoserine-proline recognition by group IV WW domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords PEPTIDYL-PROLYL CIS-TRANS ISOMERASE NIMA-INTERACTING 1
total genus 40
structure length 155
sequence length 167
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2000-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00397 WW WW domain
B PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 1f8aB01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1f8aB02
2XP9A 2YSGA 2XP8A 4W9QA 4ODOA 1FKBA 3B7XA 2JV4A 1J4RA 4REXA 4JFIA 1Y0OA 3KAGA 1B6CA 4N19A 3OOBA 4ODKA 4QT3A 2MNTA 3O5JA 1WR7A 2YSFA 1Q6UA 1ZK6A 2PBCA 3PRBA 4ODRA 3VAWA 4DRPA 1TK7A 3KAFA 2ZQTA 3O5GA 3RGCA 1JVWA 2RURA 3O5PA 2MF9A 2DK7A 2DMVA 1ZCNA 1D7HA 2OFNA 2M8JA 3GPKA 1M5YA 3MDYB 4GGQA 3UQAA 1L1PA 3KABA 4DRMA 4IQCA 4DZ3A 1A7XA 4C02B 4DRIA 2KXQA 1KT1A 1JMQA 4ODNA 3RFWA 4U85A 2IF4A 2L4JA 2EZ5W 1QPLA 2KGJA 3IKDA 1PBKA 2LGOA 1PINA 1U79A 2MPHA 4LAVA 5HKGA 3UQBA 2LAJA 3JYMA 2K8IA 1FKRA 3O5IA 3FAPA 2M1IA 5HWCA 2AWGA 2F21A 4U84A 2RQSA 5DIVA 3UQIA 3O5FA 4JFLA 2VN1A 5HT1A 3O5RA 4DRKA 1YATA 3UI5A 4MGVA 1J6YA 2PPOA 1R9HA 4DT4A 4DRJA 4G50A 4IQ2A 4FAPA 3CNGA 5I98A 3KADA 1D7IA 2M08A 4ODQA 1WMVA 1T11A 1O6WA 3O5OA 3LE4A 4LAXA 4TW7A 5HWBA 1JNSA 2M2AA 4JYSA 4JFKA 4ODMA 2PV2A 4DH0A 1FKJA 1Q6HA 3IKGA 2DK1A 3NI6A 1YW5A 1FKFA 2JZVA 4IPXA 2ZR6A 2MDIA 4U86A 1EG4A 2F2DA 3O5EA 4E5RA 4ITZA 4J4OA 4LAYA 5DIUA 2JXWA 3PRDA 4TW8A 3EY6A 2RE3A 1QZ2A 2D9FA 2MLYA 2DG4A 4DRNA 2KE0A 3KAIA 1EYMA 2KR7A 3KAHA 2JMFA 3CGNA 3H9RB 4JFJA 2VCDA 3WH0A 1I5HW 3IHZA 3O5QA 4MSPA 4NNRA 1J4HA 4TX0A 2Q5AA 2N87A 1D6OA 2XP4A 1F40A 5HTGA 5GPGA 3JXVA 2YSIA 4DRHA 5DITA 2Y78A 2DG9A 1W26A 1ROTA 4ODLA 2RUQA 4QIBA 5AHTA 1K9QA 1QPFA 1HXVA 1FKSA 2F4EA 2LKNA 1C9HA 1Q1CA 3JYJA 5D75A 3M7NA 4DRQA 1Q6IA 4O2TA 1NMVA 2DJYA 1ROUA 2MLXA 4W9OA 3KACA 4LAWA 2YSBA 2YSHA 1FKTA 5HW7A 5HW6A 2XP5A 2ZR5A 3L4HA 3LUOA 3O5DA 2XP6A 1FKLA 2PV3A 1EG3A 2DWVA 2E45A 2ZAJA 3TC5A 2LPVA 2PV1A 1FAPA 2XP7A 2JX8A 3ODKA 3UI6A 1N1AA 2DG3A 3O5KA 1FKHA 2PPPA 2M3OW 4J4NA 3CGMA 2KO7A 2XPBA 4QT2A 4FN2A 4TNSA 5BXJA 2UZ5A 4W9PA 4ODPA 2XP3A 4G2PA 4TYOA 3TDBA 1FKIA 4DROA 2FKEA 4DZ2A 2ZQUA 3NTPA 2BA1A 2RUDA 4R0XA 1FJDA 3O5MA 2RUCA 1D7JA 4DIPA 1FKDA 3UF8A 3O5LA 2LJ4A 3KZ7A 3PA7A 2ZQSA 3TCZA 1FKGA 1KT0A 1P5QA 1BKFA 2PPNA 2M8IA 3M85A 5B8IC 1FKKA 2FAPA 4BF8A 3I6CA 4TW6A 1F8AB 1K9RA 3KCEA 1NMWA 2KFWA 2ZQVA 1BL4A 1J4IA 1FD9A 4GIVA 1EQ3A 2RSEA 2ZR4A 5HUAA 2L2SA 5J6EA 2ITKA 3NRKA 1NSGA 3IK8A 1JNTA 1TCOC 2KI3A 3UI4A 2MLZA 2XPAA 5CQ2A 5HW8A 4JFMA
chains in the Genus database with same CATH superfamily
2YSGA 1NWRA 4Q7NA 2JV4A 2QF8A 4ODKA 1WR7A 1ZK6A 5U47A 1W1PA 2RURA 2MF9A 2M8JA 1TR8A 3ALGA 3KABA 4DZ3A 1A7XA 4C02B 3GU0A 4DRIA 2G8ZA 1W9PA 4U85A 1HKKA 2OLHA 4LAVA 3PRAA 4WKFA 1ZL1A 4GLXA 1JNEA 3O5FA 4JFLA 4MPKA 1J6YA 2O9OA 1R9HA 4WJXA 4G50A 1WB0A 3LKXB 4ODQA 2M08A 1T11A 3LE4A 1OGBA 2DK1A 3NI6A 1O6IA 2O92A 4LAYA 1EG4A 3WL0A 4KR0B 4ML4A 4Z2JA 4W9OA 2A3EA 4NNRA 1J4HA 1LL4A 1NH6A 2N87A 2XP4A 3AS3A 3JXVA 5HBFA 5DITA 2Y78A 3W4RA 4Z2KA 1W26A 1HKMA 5AHTA 1QPFA 1FKSA 3ARVA 2F4EA 1ZU8A 4ZPTR 1RP5A 4DRQA 1ROUA 2YSBA 5DF0A 4WK9A 3ARWA 3RM4A 1FFRA 2P4VA 2DG3A 3CH9A 1FKHA 2PPPA 3RM8A 2EULA 3CGMA 4P8WA 3NTPA 1FKDA 4P8UA 2LJ4A 1KT0A 3TCZA 1P5QA 3I6CA 1NMWA 2KFWA 3KCEA 3ARUA 1L1PA 4GIVA 1EQ3A 5E64A 2G41A 2ZR4A 3IK8A 1JNTA 3UI4A 2MLZA 2PV3A 2XPAA 5HW8A 4W9QA 5JH8A 3B7XA 1J4RA 3B9DA 4REXA 3AS2A 1Y0OA 1SYTA 1RD6A 2YBUA 3AS0A 4DWSA 4ODRA 2YSFA 1Q6UA 2DT0A 4HBOA 3KAFA 3O5GA 1JVWA 2YBTA 2DK7A 1D7HA 3AS1A 4PTMA 1NWUA 2WLZA 1ZBVA 1LQ0A 4Q22A 2DT1A 4S3KA 3FSBA 3CHEA 2YAJB 1WNOA 1E6ZA 3EIPA 3RFWA 1E15A 2KGJA 3IKDA 2LGOA 1PINA 1U79A 2MPHA 1X6LA 4Z2LA 4U84A 4A0TA 5HT1A 2VN1A 1YATA 4MAVA 4A0UA 1W9VA 2PPOA 3MQHA 3CZ8A 3WD2A 4DT4A 2ETNA 4URIA 5I98A 1EDQA 3LKXA 3ALFA 3AROA 4ODMA 1XRVA 1FKJA 3IKGA 4NSBA 4IPXA 2MDIA 2F2DA 4XAKA 2D9FA 4WKHA 4DRNA 3KAIA 5DEZA 3KAHA 3H9RB 4MSPA 3WH0A 1E6PA 3IHZA 1LL7A 4W5UA 1EIBA 4MNJA 4ODLA 3BMBA 1K9QA 3WD3A 1Q6IA 5GQBA 2DJYA 1K9TA 4LAWA 3BXWA 2ZR5A 1WAWA 2XP6A 3AQUA 4WIWA 1EG3A 2DT2A 2LPVA 1FAPA 4ZPVR 2JX8A 3CHDA 1N1AA 3PQHA 1W1TA 5BXJA 4W9PA 4ODPA 5DO2A 3TDBA 4MNLA 2ZQUA 4R5EA 1FJDA 3O5MA 4ZS6A 1ZBKA 3G6MA 2ZQSA 2A3CA 1FKKA 2PI6A 3PR9A 1ZB5A 1K9RA 4DWSD 1BL4A 1NWTA 1ZBWA 3ARYA 5J6EA 2AOSA 3WD1A 1E44A 2XP8A 1LL6A 4Z2GA 1UR9A 3GTYX 4DWSC 3KAGA 4N19A 1FLCA 4QT3A 3O5JA 3PRBA 1CTNA 3B8SA 4LGXA 1E6NA 3O5PA 4P8XA 2DMVA 1ZCNA 3B9EA 4UDMA 3UQAA 2DT3A 1FFQA 2QRVA 1GUVA 2WM0A 1KT1A 1HJWA 2IF4A 1IX5A 3CHFA 1PBKA 5HKGA 1E6RA 2LAJA 3JYMA 2K8IA 3O5IA 3FSCA 2F21A 5DIVA 3UI5A 1ITXA 1SR0A 3CNGA 3RMEA 3KADA 1D7IA 1WMVA 1E9LA 1GOIA 4LAXA 3WL1A 3G6LA 4L3NA 1YW5A 2A3AA 2JZVA 5GPRA 2ZR6A 4U86A 4ITZA 4DRMA 3O5EA 4E5RA 1HJVA 2WLYA 4MNKA 5DIUA 4TW8A 2RE3A 1QZ2A 2DSVA 1EYMA 4JFJA 2JMFA 1W1YA 2WK2A 1I5HW 3O5QA 3ARPA 4TX0A 2Q5AA 1D6OA 5HTGA 3ARTA 5GPGA 3FS8A 4DRHA 2DG9A 1ROTA 4QIBA 1C9HA 1GPFA 1Q1CA 1X6NA 2FDMA 5D75A 4IT6A 4MTVA 1NMVA 2MLXA 1FKTA 3WIJA 1EHNA 2XP5A 3L4HA 4ZPWR 1FKLA 4HBEA 2DWVA 2E45A 2ZAJA 2PV1A 2F23A 3O5KA 3MCBA 4WKAA 2KO7A 4QT2A 3WD4A 2UZ5A 4HARA 2XP3A 4G2PA 1FKIA 1JNDA 4KQZA 2DSZA 4DROA 3MCBB 2FKEA 4NZCA 2RUDA 4AY1A 2RUCA 1D7JA 3ARXA 3PA7A 3KZ7A 1LJYA 2PPNA 5E66A 5B8IC 1JCHB 2FAPA 1J4IA 1FD9A 2RSEA 1NWSA 2ESCA 4S3JA 5HUAA 2L2SA 3ARRA 1ZBCA 1NSGA 1TCOC 1TFVA 1HKIA 2XP9A 2DPEA 1W9UA 4ODOA 1FKBA 3B9AA 1OWQA 2DSUA 4JFIA 1HJXA 1B6CA 1LG1A 3OOBA 2MNTA 3VAWA 2PBCA 4DRPA 1KFWA 1TK7A 1UR8A 2ZQTA 3RGCA 3OA5A 4DWSB 5E62A 2OFNA 3GPKA 1M5YA 5E5WA 1LG2A 3MDYB 4GGQA 4IQCA 1VF8A 5E65A 3MQGA 2KXQA 1JMQA 4ODNA 3FXYA 2L4JA 2EZ5W 1QPLA 3UQBA 2WADA 1FKRA 3WD0A 3FAPA 1H0IA 2M1IA 5HWCA 2AWGA 2RQSA 3UQIA 4DRKA 3WQWA 3O5RA 4MGVA 2B31A 2B5UB 4QZVB 4DRJA 4IQ2A 4FAPA 3O5OA 4TW7A 1O6WA 5HWBA 1JNSA 2M2AA 4JYSA 4JFKA 3ARQA 2PV2A 4DH0A 1Q6HA 1GRJA 3CHCA 2WAEA 1FKFA 4J4OA 2JXWA 3PRDA 3EY6A 2MLYA 2DG4A 3QOKA 2KE0A 4Z2IA 2KR7A 3CGNA 2VCDA 1F40A 2YSIA 3ARSA 2RUQA 1HXVA 2PN0A 2LKNA 3JYJA 3M7NA 4O2TA 3RM9A 1W1VA 3KACA 2YSHA 5HW7A 5HW6A 3LUOA 4IT4A 3O5DA 2OWOA 1D2KA 3TC5A 2XP7A 3ODKA 3UI6A 1HKJA 2M3OW 4J4NA 1OGGA 2XPBA 4FN2A 4TNSA 1XHGA 4TYOA 4DZ2A 2BA1A 4R0XA 4MNMA 4DIPA 3UF8A 3O5LA 3WQVA 2DSWA 1FKGA 3WKZA 3ARZA 1BKFA 2M8IA 3M85A 4BF8A 4TW6A 1F8AB 4Z2HA 2ZQVA 1H0GA 2A3BA 2Y8NB 3FY1A 2ITKA 2IUZA 3NRKA 2KI3A 4L72B 5CQ2A 4JFMA 4P8VA
chains in the Genus database with same CATH topology
2YSGA 1NWRA 4Q7NA 2JV4A 2QF8A 4ODKA 1WR7A 1ZK6A 5U47A 1W1PA 2RURA 2MF9A 2M8JA 1TR8A 3ALGA 3KABA 4DZ3A 1A7XA 4C02B 4DRIA 2G8ZA 1W9PA 4U85A 1HKKA 2OLHA 4LAVA 3PRAA 4WKFA 1ZL1A 4GLXA 1JNEA 3O5FA 4JFLA 4MPKA 1J6YA 2O9OA 1R9HA 4WJXA 4G50A 1WB0A 3LKXB 4ODQA 2M08A 1T11A 3LE4A 1OGBA 2DK1A 3NI6A 1O6IA 2O92A 4LAYA 1EG4A 3WL0A 4KR0B 4ML4A 4Z2JA 4W9OA 2A3EA 4NNRA 1J4HA 1LL4A 1NH6A 2N87A 2XP4A 3AS3A 3JXVA 5HBFA 5DITA 2Y78A 3W4RA 4Z2KA 1W26A 1HKMA 5AHTA 1QPFA 1FKSA 3ARVA 2F4EA 1ZU8A 4ZPTR 1RP5A 4DRQA 1ROUA 2YSBA 5DF0A 4WK9A 3ARWA 3RM4A 1FFRA 3CH9A 2DG3A 1FKHA 2PPPA 3RM8A 3CGMA 4P8WA 3NTPA 1FKDA 4P8UA 2LJ4A 1KT0A 3TCZA 1P5QA 3I6CA 3ARUA 2KFWA 3KCEA 1NMWA 1L1PA 4GIVA 1EQ3A 5E64A 2G41A 2ZR4A 3IK8A 1JNTA 3UI4A 2MLZA 2PV3A 2XPAA 5HW8A 4W9QA 5JH8A 3B7XA 1J4RA 3B9DA 4REXA 3AS2A 1Y0OA 1SYTA 1RD6A 2YBUA 3AS0A 4DWSA 4ODRA 2YSFA 1Q6UA 2DT0A 4HBOA 3KAFA 3O5GA 1JVWA 2YBTA 2DK7A 1D7HA 3AS1A 4PTMA 1NWUA 2WLZA 1ZBVA 1LQ0A 4Q22A 2DT1A 4S3KA 3FSBA 3CHEA 2YAJB 1WNOA 1E6ZA 3RFWA 1E15A 2KGJA 3IKDA 2LGOA 1PINA 1U79A 2MPHA 1X6LA 4Z2LA 4U84A 4A0TA 5HT1A 2VN1A 1YATA 4MAVA 4A0UA 1W9VA 2PPOA 3MQHA 3CZ8A 3WD2A 4DT4A 4URIA 5I98A 1EDQA 3LKXA 3ALFA 3AROA 4ODMA 1XRVA 1FKJA 3IKGA 4NSBA 4IPXA 2MDIA 2F2DA 4XAKA 2D9FA 4WKHA 4DRNA 3KAIA 5DEZA 3KAHA 3H9RB 4MSPA 3WH0A 1E6PA 3IHZA 1LL7A 4W5UA 1EIBA 4MNJA 4ODLA 1K9QA 3WD3A 1Q6IA 5GQBA 2DJYA 1K9TA 4LAWA 3BXWA 2ZR5A 1WAWA 2XP6A 3AQUA 4WIWA 1EG3A 2DT2A 2LPVA 1FAPA 4ZPVR 2JX8A 3CHDA 1N1AA 3PQHA 1W1TA 5BXJA 4W9PA 4ODPA 5DO2A 3TDBA 4MNLA 2ZQUA 4R5EA 1FJDA 3O5MA 4ZS6A 1ZBKA 3G6MA 2ZQSA 2A3CA 1FKKA 2PI6A 3PR9A 1ZB5A 1K9RA 4DWSD 1BL4A 1NWTA 1ZBWA 3ARYA 5J6EA 2AOSA 3WD1A 2XP8A 1LL6A 4Z2GA 1UR9A 4DWSC 3KAGA 4N19A 1FLCA 4QT3A 3O5JA 3PRBA 1CTNA 3B8SA 4LGXA 1E6NA 3O5PA 4P8XA 2DMVA 1ZCNA 3B9EA 3UQAA 2DT3A 1FFQA 2QRVA 1GUVA 2WM0A 1KT1A 1HJWA 2IF4A 1IX5A 3CHFA 1PBKA 5HKGA 1E6RA 2LAJA 3JYMA 2K8IA 3O5IA 3FSCA 2F21A 5DIVA 3UI5A 1ITXA 1SR0A 3CNGA 3RMEA 3KADA 1D7IA 1WMVA 1E9LA 1GOIA 4LAXA 3WL1A 3G6LA 4L3NA 1YW5A 2A3AA 2JZVA 5GPRA 2ZR6A 4U86A 4ITZA 4DRMA 3O5EA 4E5RA 1HJVA 2WLYA 4MNKA 5DIUA 4TW8A 2RE3A 1QZ2A 2DSVA 1EYMA 4JFJA 2JMFA 1W1YA 2WK2A 1I5HW 3O5QA 3ARPA 4TX0A 2Q5AA 1D6OA 5HTGA 3ARTA 5GPGA 3FS8A 4DRHA 2DG9A 1ROTA 4QIBA 1C9HA 1GPFA 1Q1CA 1X6NA 2FDMA 5D75A 4IT6A 4MTVA 1NMVA 2MLXA 1FKTA 3WIJA 1EHNA 2XP5A 3L4HA 4ZPWR 1FKLA 4HBEA 2DWVA 2E45A 2ZAJA 2PV1A 3O5KA 3MCBA 4WKAA 2KO7A 4QT2A 3WD4A 2UZ5A 4HARA 2XP3A 4G2PA 1FKIA 1JNDA 4KQZA 2DSZA 4DROA 3MCBB 2FKEA 4NZCA 2RUDA 4AY1A 2RUCA 1D7JA 3ARXA 3PA7A 3KZ7A 1LJYA 2PPNA 5E66A 5B8IC 2FAPA 1J4IA 1FD9A 2RSEA 1NWSA 2ESCA 4S3JA 5HUAA 2L2SA 3ARRA 1ZBCA 1NSGA 1TCOC 1TFVA 1HKIA 2XP9A 2DPEA 1W9UA 4ODOA 1FKBA 3B9AA 1OWQA 2DSUA 4JFIA 1HJXA 1B6CA 1LG1A 3OOBA 2MNTA 3VAWA 2PBCA 4DRPA 1KFWA 1TK7A 1UR8A 2ZQTA 3RGCA 3OA5A 4DWSB 5E62A 2OFNA 3GPKA 1M5YA 5E5WA 1LG2A 3MDYB 4GGQA 4IQCA 1VF8A 5E65A 3MQGA 2KXQA 1JMQA 4ODNA 3FXYA 2L4JA 2EZ5W 1QPLA 3UQBA 2WADA 1FKRA 3WD0A 3FAPA 1H0IA 2M1IA 5HWCA 2AWGA 2RQSA 3UQIA 4DRKA 3WQWA 3O5RA 4MGVA 2B31A 4QZVB 4DRJA 4IQ2A 4FAPA 3O5OA 4TW7A 1O6WA 5HWBA 1JNSA 2M2AA 4JYSA 4JFKA 3ARQA 2PV2A 4DH0A 1Q6HA 3CHCA 2WAEA 1FKFA 4J4OA 2JXWA 3PRDA 3EY6A 2MLYA 2DG4A 3QOKA 2KE0A 4Z2IA 2KR7A 3CGNA 2VCDA 1F40A 2YSIA 3ARSA 2RUQA 1HXVA 2LKNA 3JYJA 3M7NA 4O2TA 3RM9A 1W1VA 3KACA 2YSHA 5HW7A 5HW6A 3LUOA 4IT4A 3O5DA 2OWOA 1D2KA 3TC5A 2XP7A 3ODKA 3UI6A 1HKJA 2M3OW 4J4NA 1OGGA 2XPBA 4FN2A 4TNSA 1XHGA 4TYOA 4DZ2A 2BA1A 4R0XA 4MNMA 4DIPA 3UF8A 3O5LA 3WQVA 2DSWA 1FKGA 3WKZA 3ARZA 1BKFA 2M8IA 3M85A 4BF8A 4TW6A 1F8AB 4Z2HA 2ZQVA 1H0GA 2A3BA 2Y8NB 3FY1A 2ITKA 2IUZA 3NRKA 2KI3A 4L72B 5CQ2A 4JFMA 4P8VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XP9 A;  2YSG A;  2XP8 A;  4W9Q A;  4ODO A;  1FKB A;  3B7X A;  2JV4 A;  1J4R A;  4REX A;  4JFI A;  1Y0O A;  3KAG A;  1B6C A;  4N19 A;  3OOB A;  4ODK A;  4QT3 A;  2MNT A;  3O5J A;  1WR7 A;  2YSF A;  1Q6U A;  1ZK6 A;  2PBC A;  3PRB A;  4ODR A;  3VAW A;  4DRP A;  1TK7 A;  3KAF A;  2ZQT A;  3O5G A;  3RGC A;  1JVW A;  2RUR A;  3O5P A;  2MF9 A;  2DK7 A;  2DMV A;  1ZCN A;  1D7H A;  2OFN A;  2M8J A;  3GPK A;  1M5Y A;  3MDY B;  4GGQ A;  3UQA A;  1L1P A;  3KAB A;  4DRM A;  4IQC A;  4DZ3 A;  1A7X A;  4C02 B;  4DRI A;  2KXQ A;  1KT1 A;  1JMQ A;  4ODN A;  3RFW A;  4U85 A;  2IF4 A;  2L4J A;  2EZ5 W;  1QPL A;  2KGJ A;  3IKD A;  1PBK A;  2LGO A;  1PIN A;  1U79 A;  2MPH A;  4LAV A;  5HKG A;  3UQB A;  2LAJ A;  3JYM A;  2K8I A;  1FKR A;  3O5I A;  3FAP A;  2M1I A;  5HWC A;  2AWG A;  2F21 A;  4U84 A;  2RQS A;  5DIV A;  3UQI A;  3O5F A;  4JFL A;  2VN1 A;  5HT1 A;  3O5R A;  4DRK A;  1YAT A;  3UI5 A;  4MGV A;  1J6Y A;  2PPO A;  1R9H A;  4DT4 A;  4DRJ A;  4G50 A;  4IQ2 A;  4FAP A;  3CNG A;  5I98 A;  3KAD A;  1D7I A;  2M08 A;  4ODQ A;  1WMV A;  1T11 A;  1O6W A;  3O5O A;  3LE4 A;  4LAX A;  4TW7 A;  5HWB A;  1JNS A;  2M2A A;  4JYS A;  4JFK A;  4ODM A;  2PV2 A;  4DH0 A;  1FKJ A;  1Q6H A;  3IKG A;  2DK1 A;  3NI6 A;  1YW5 A;  1FKF A;  2JZV A;  4IPX A;  2ZR6 A;  2MDI A;  4U86 A;  1EG4 A;  2F2D A;  3O5E A;  4E5R A;  4ITZ A;  4J4O A;  4LAY A;  5DIU A;  2JXW A;  3PRD A;  4TW8 A;  3EY6 A;  2RE3 A;  1QZ2 A;  2D9F A;  2MLY A;  2DG4 A;  4DRN A;  2KE0 A;  3KAI A;  1EYM A;  2KR7 A;  3KAH A;  2JMF A;  3CGN A;  3H9R B;  4JFJ A;  2VCD A;  3WH0 A;  1I5H W;  3IHZ A;  3O5Q A;  4MSP A;  4NNR A;  1J4H A;  4TX0 A;  2Q5A A;  2N87 A;  1D6O A;  2XP4 A;  1F40 A;  5HTG A;  5GPG A;  3JXV A;  2YSI A;  4DRH A;  5DIT A;  2Y78 A;  2DG9 A;  1W26 A;  1ROT A;  4ODL A;  2RUQ A;  4QIB A;  5AHT A;  1K9Q A;  1QPF A;  1HXV A;  1FKS A;  2F4E A;  2LKN A;  1C9H A;  1Q1C A;  3JYJ A;  5D75 A;  3M7N A;  4DRQ A;  1Q6I A;  4O2T A;  1NMV A;  2DJY A;  1ROU A;  2MLX A;  4W9O A;  3KAC A;  4LAW A;  2YSB A;  2YSH A;  1FKT A;  5HW7 A;  5HW6 A;  2XP5 A;  2ZR5 A;  3L4H A;  3LUO A;  3O5D A;  2XP6 A;  1FKL A;  2PV3 A;  1EG3 A;  2DWV A;  2E45 A;  2ZAJ A;  3TC5 A;  2LPV A;  2PV1 A;  1FAP A;  2XP7 A;  2JX8 A;  3ODK A;  3UI6 A;  1N1A A;  2DG3 A;  3O5K A;  1FKH A;  2PPP A;  2M3O W;  4J4N A;  3CGM A;  2KO7 A;  2XPB A;  4QT2 A;  4FN2 A;  4TNS A;  5BXJ A;  2UZ5 A;  4W9P A;  4ODP A;  2XP3 A;  4G2P A;  4TYO A;  3TDB A;  1FKI A;  4DRO A;  2FKE A;  4DZ2 A;  2ZQU A;  3NTP A;  2BA1 A;  2RUD A;  4R0X A;  1FJD A;  3O5M A;  2RUC A;  1D7J A;  4DIP A;  1FKD A;  3UF8 A;  3O5L A;  2LJ4 A;  3KZ7 A;  3PA7 A;  2ZQS A;  3TCZ A;  1FKG A;  1KT0 A;  1P5Q A;  1BKF A;  2PPN A;  2M8I A;  3M85 A;  5B8I C;  1FKK A;  2FAP A;  4BF8 A;  3I6C A;  4TW6 A;  1F8A B;  1K9R A;  3KCE A;  1NMW A;  2KFW A;  2ZQV A;  1BL4 A;  1J4I A;  1FD9 A;  4GIV A;  1EQ3 A;  2RSE A;  2ZR4 A;  5HUA A;  2L2S A;  5J6E A;  2ITK A;  3NRK A;  1NSG A;  3IK8 A;  1JNT A;  1TCO C;  2KI3 A;  3UI4 A;  2MLZ A;  2XPA A;  5CQ2 A;  5HW8 A;  4JFM A; 
#chains in the Genus database with same CATH topology
 2YSG A;  1NWR A;  4Q7N A;  2JV4 A;  2QF8 A;  4ODK A;  1WR7 A;  1ZK6 A;  5U47 A;  1W1P A;  2RUR A;  2MF9 A;  2M8J A;  1TR8 A;  3ALG A;  3KAB A;  4DZ3 A;  1A7X A;  4C02 B;  3GU0 A;  4DRI A;  2G8Z A;  1W9P A;  4U85 A;  1HKK A;  2OLH A;  4LAV A;  3PRA A;  4WKF A;  1ZL1 A;  4GLX A;  1JNE A;  3O5F A;  4JFL A;  4MPK A;  1J6Y A;  2O9O A;  1R9H A;  4WJX A;  4G50 A;  1WB0 A;  3LKX B;  4ODQ A;  2M08 A;  1T11 A;  3LE4 A;  1OGB A;  2DK1 A;  3NI6 A;  1O6I A;  2O92 A;  4LAY A;  1EG4 A;  3WL0 A;  4KR0 B;  4ML4 A;  4Z2J A;  4W9O A;  2A3E A;  4NNR A;  1J4H A;  1LL4 A;  1NH6 A;  2N87 A;  2XP4 A;  3AS3 A;  3JXV A;  5HBF A;  5DIT A;  2Y78 A;  3W4R A;  4Z2K A;  1W26 A;  1HKM A;  5AHT A;  1QPF A;  1FKS A;  3ARV A;  2F4E A;  1ZU8 A;  4ZPT R;  1RP5 A;  4DRQ A;  1ROU A;  2YSB A;  5DF0 A;  4WK9 A;  3ARW A;  3RM4 A;  1FFR A;  2P4V A;  2DG3 A;  3CH9 A;  1FKH A;  2PPP A;  3RM8 A;  2EUL A;  3CGM A;  4P8W A;  3NTP A;  1FKD A;  4P8U A;  2LJ4 A;  1KT0 A;  3TCZ A;  1P5Q A;  3I6C A;  1NMW A;  2KFW A;  3KCE A;  3ARU A;  1L1P A;  4GIV A;  1EQ3 A;  5E64 A;  2G41 A;  2ZR4 A;  3IK8 A;  1JNT A;  3UI4 A;  2MLZ A;  2PV3 A;  2XPA A;  5HW8 A;  4W9Q A;  5JH8 A;  3B7X A;  1J4R A;  3B9D A;  4REX A;  3AS2 A;  1Y0O A;  1SYT A;  1RD6 A;  2YBU A;  3AS0 A;  4DWS A;  4ODR A;  2YSF A;  1Q6U A;  2DT0 A;  4HBO A;  3KAF A;  3O5G A;  1JVW A;  2YBT A;  2DK7 A;  1D7H A;  3AS1 A;  4PTM A;  1NWU A;  2WLZ A;  1ZBV A;  1LQ0 A;  4Q22 A;  2DT1 A;  4S3K A;  3FSB A;  3CHE A;  2YAJ B;  1WNO A;  1E6Z A;  3EIP A;  3RFW A;  1E15 A;  2KGJ A;  3IKD A;  2LGO A;  1PIN A;  1U79 A;  2MPH A;  1X6L A;  4Z2L A;  4U84 A;  4A0T A;  5HT1 A;  2VN1 A;  1YAT A;  4MAV A;  4A0U A;  1W9V A;  2PPO A;  3MQH A;  3CZ8 A;  3WD2 A;  4DT4 A;  2ETN A;  4URI A;  5I98 A;  1EDQ A;  3LKX A;  3ALF A;  3ARO A;  4ODM A;  1XRV A;  1FKJ A;  3IKG A;  4NSB A;  4IPX A;  2MDI A;  2F2D A;  4XAK A;  2D9F A;  4WKH A;  4DRN A;  3KAI A;  5DEZ A;  3KAH A;  3H9R B;  4MSP A;  3WH0 A;  1E6P A;  3IHZ A;  1LL7 A;  4W5U A;  1EIB A;  4MNJ A;  4ODL A;  3BMB A;  1K9Q A;  3WD3 A;  1Q6I A;  5GQB A;  2DJY A;  1K9T A;  4LAW A;  3BXW A;  2ZR5 A;  1WAW A;  2XP6 A;  3AQU A;  4WIW A;  1EG3 A;  2DT2 A;  2LPV A;  1FAP A;  4ZPV R;  2JX8 A;  3CHD A;  1N1A A;  3PQH A;  1W1T A;  5BXJ A;  4W9P A;  4ODP A;  5DO2 A;  3TDB A;  4MNL A;  2ZQU A;  4R5E A;  1FJD A;  3O5M A;  4ZS6 A;  1ZBK A;  3G6M A;  2ZQS A;  2A3C A;  1FKK A;  2PI6 A;  3PR9 A;  1ZB5 A;  1K9R A;  4DWS D;  1BL4 A;  1NWT A;  1ZBW A;  3ARY A;  5J6E A;  2AOS A;  3WD1 A;  1E44 A;  2XP8 A;  1LL6 A;  4Z2G A;  1UR9 A;  3GTY X;  4DWS C;  3KAG A;  4N19 A;  1FLC A;  4QT3 A;  3O5J A;  3PRB A;  1CTN A;  3B8S A;  4LGX A;  1E6N A;  3O5P A;  4P8X A;  2DMV A;  1ZCN A;  3B9E A;  4UDM A;  3UQA A;  2DT3 A;  1FFQ A;  2QRV A;  1GUV A;  2WM0 A;  1KT1 A;  1HJW A;  2IF4 A;  1IX5 A;  3CHF A;  1PBK A;  5HKG A;  1E6R A;  2LAJ A;  3JYM A;  2K8I A;  3O5I A;  3FSC A;  2F21 A;  5DIV A;  3UI5 A;  1ITX A;  1SR0 A;  3CNG A;  3RME A;  3KAD A;  1D7I A;  1WMV A;  1E9L A;  1GOI A;  4LAX A;  3WL1 A;  3G6L A;  4L3N A;  1YW5 A;  2A3A A;  2JZV A;  5GPR A;  2ZR6 A;  4U86 A;  4ITZ A;  4DRM A;  3O5E A;  4E5R A;  1HJV A;  2WLY A;  4MNK A;  5DIU A;  4TW8 A;  2RE3 A;  1QZ2 A;  2DSV A;  1EYM A;  4JFJ A;  2JMF A;  1W1Y A;  2WK2 A;  1I5H W;  3O5Q A;  3ARP A;  4TX0 A;  2Q5A A;  1D6O A;  5HTG A;  3ART A;  5GPG A;  3FS8 A;  4DRH A;  2DG9 A;  1ROT A;  4QIB A;  1C9H A;  1GPF A;  1Q1C A;  1X6N A;  2FDM A;  5D75 A;  4IT6 A;  4MTV A;  1NMV A;  2MLX A;  1FKT A;  3WIJ A;  1EHN A;  2XP5 A;  3L4H A;  4ZPW R;  1FKL A;  4HBE A;  2DWV A;  2E45 A;  2ZAJ A;  2PV1 A;  2F23 A;  3O5K A;  3MCB A;  4WKA A;  2KO7 A;  4QT2 A;  3WD4 A;  2UZ5 A;  4HAR A;  2XP3 A;  4G2P A;  1FKI A;  1JND A;  4KQZ A;  2DSZ A;  4DRO A;  3MCB B;  2FKE A;  4NZC A;  2RUD A;  4AY1 A;  2RUC A;  1D7J A;  3ARX A;  3PA7 A;  3KZ7 A;  1LJY A;  2PPN A;  5E66 A;  5B8I C;  1JCH B;  2FAP A;  1J4I A;  1FD9 A;  2RSE A;  1NWS A;  2ESC A;  4S3J A;  5HUA A;  2L2S A;  3ARR A;  1ZBC A;  1NSG A;  1TCO C;  1TFV A;  1HKI A;  2XP9 A;  2DPE A;  1W9U A;  4ODO A;  1FKB A;  3B9A A;  1OWQ A;  2DSU A;  4JFI A;  1HJX A;  1B6C A;  1LG1 A;  3OOB A;  2MNT A;  3VAW A;  2PBC A;  4DRP A;  1KFW A;  1TK7 A;  1UR8 A;  2ZQT A;  3RGC A;  3OA5 A;  4DWS B;  5E62 A;  2OFN A;  3GPK A;  1M5Y A;  5E5W A;  1LG2 A;  3MDY B;  4GGQ A;  4IQC A;  1VF8 A;  5E65 A;  3MQG A;  2KXQ A;  1JMQ A;  4ODN A;  3FXY A;  2L4J A;  2EZ5 W;  1QPL A;  3UQB A;  2WAD A;  1FKR A;  3WD0 A;  3FAP A;  1H0I A;  2M1I A;  5HWC A;  2AWG A;  2RQS A;  3UQI A;  4DRK A;  3WQW A;  3O5R A;  4MGV A;  2B31 A;  2B5U B;  4QZV B;  4DRJ A;  4IQ2 A;  4FAP A;  3O5O A;  4TW7 A;  1O6W A;  5HWB A;  1JNS A;  2M2A A;  4JYS A;  4JFK A;  3ARQ A;  2PV2 A;  4DH0 A;  1Q6H A;  1GRJ A;  3CHC A;  2WAE A;  1FKF A;  4J4O A;  2JXW A;  3PRD A;  3EY6 A;  2MLY A;  2DG4 A;  3QOK A;  2KE0 A;  4Z2I A;  2KR7 A;  3CGN A;  2VCD A;  1F40 A;  2YSI A;  3ARS A;  2RUQ A;  1HXV A;  2PN0 A;  2LKN A;  3JYJ A;  3M7N A;  4O2T A;  3RM9 A;  1W1V A;  3KAC A;  2YSH A;  5HW7 A;  5HW6 A;  3LUO A;  4IT4 A;  3O5D A;  2OWO A;  1D2K A;  3TC5 A;  2XP7 A;  3ODK A;  3UI6 A;  1HKJ A;  2M3O W;  4J4N A;  1OGG A;  2XPB A;  4FN2 A;  4TNS A;  1XHG A;  4TYO A;  4DZ2 A;  2BA1 A;  4R0X A;  4MNM A;  4DIP A;  3UF8 A;  3O5L A;  3WQV A;  2DSW A;  1FKG A;  3WKZ A;  3ARZ A;  1BKF A;  2M8I A;  3M85 A;  4BF8 A;  4TW6 A;  1F8A B;  4Z2H A;  2ZQV A;  1H0G A;  2A3B A;  2Y8N B;  3FY1 A;  2ITK A;  2IUZ A;  3NRK A;  2KI3 A;  4L72 B;  5CQ2 A;  4JFM A;  4P8V A; 
#chains in the Genus database with same CATH homology
 2YSG A;  1NWR A;  4Q7N A;  2JV4 A;  2QF8 A;  4ODK A;  1WR7 A;  1ZK6 A;  5U47 A;  1W1P A;  2RUR A;  2MF9 A;  2M8J A;  1TR8 A;  3ALG A;  3KAB A;  4DZ3 A;  1A7X A;  4C02 B;  4DRI A;  2G8Z A;  1W9P A;  4U85 A;  1HKK A;  2OLH A;  4LAV A;  3PRA A;  4WKF A;  1ZL1 A;  4GLX A;  1JNE A;  3O5F A;  4JFL A;  4MPK A;  1J6Y A;  2O9O A;  1R9H A;  4WJX A;  4G50 A;  1WB0 A;  3LKX B;  4ODQ A;  2M08 A;  1T11 A;  3LE4 A;  1OGB A;  2DK1 A;  3NI6 A;  1O6I A;  2O92 A;  4LAY A;  1EG4 A;  3WL0 A;  4KR0 B;  4ML4 A;  4Z2J A;  4W9O A;  2A3E A;  4NNR A;  1J4H A;  1LL4 A;  1NH6 A;  2N87 A;  2XP4 A;  3AS3 A;  3JXV A;  5HBF A;  5DIT A;  2Y78 A;  3W4R A;  4Z2K A;  1W26 A;  1HKM A;  5AHT A;  1QPF A;  1FKS A;  3ARV A;  2F4E A;  1ZU8 A;  4ZPT R;  1RP5 A;  4DRQ A;  1ROU A;  2YSB A;  5DF0 A;  4WK9 A;  3ARW A;  3RM4 A;  1FFR A;  3CH9 A;  2DG3 A;  1FKH A;  2PPP A;  3RM8 A;  3CGM A;  4P8W A;  3NTP A;  1FKD A;  4P8U A;  2LJ4 A;  1KT0 A;  3TCZ A;  1P5Q A;  3I6C A;  3ARU A;  2KFW A;  3KCE A;  1NMW A;  1L1P A;  4GIV A;  1EQ3 A;  5E64 A;  2G41 A;  2ZR4 A;  3IK8 A;  1JNT A;  3UI4 A;  2MLZ A;  2PV3 A;  2XPA A;  5HW8 A;  4W9Q A;  5JH8 A;  3B7X A;  1J4R A;  3B9D A;  4REX A;  3AS2 A;  1Y0O A;  1SYT A;  1RD6 A;  2YBU A;  3AS0 A;  4DWS A;  4ODR A;  2YSF A;  1Q6U A;  2DT0 A;  4HBO A;  3KAF A;  3O5G A;  1JVW A;  2YBT A;  2DK7 A;  1D7H A;  3AS1 A;  4PTM A;  1NWU A;  2WLZ A;  1ZBV A;  1LQ0 A;  4Q22 A;  2DT1 A;  4S3K A;  3FSB A;  3CHE A;  2YAJ B;  1WNO A;  1E6Z A;  3RFW A;  1E15 A;  2KGJ A;  3IKD A;  2LGO A;  1PIN A;  1U79 A;  2MPH A;  1X6L A;  4Z2L A;  4U84 A;  4A0T A;  5HT1 A;  2VN1 A;  1YAT A;  4MAV A;  4A0U A;  1W9V A;  2PPO A;  3MQH A;  3CZ8 A;  3WD2 A;  4DT4 A;  4URI A;  5I98 A;  1EDQ A;  3LKX A;  3ALF A;  3ARO A;  4ODM A;  1XRV A;  1FKJ A;  3IKG A;  4NSB A;  4IPX A;  2MDI A;  2F2D A;  4XAK A;  2D9F A;  4WKH A;  4DRN A;  3KAI A;  5DEZ A;  3KAH A;  3H9R B;  4MSP A;  3WH0 A;  1E6P A;  3IHZ A;  1LL7 A;  4W5U A;  1EIB A;  4MNJ A;  4ODL A;  1K9Q A;  3WD3 A;  1Q6I A;  5GQB A;  2DJY A;  1K9T A;  4LAW A;  3BXW A;  2ZR5 A;  1WAW A;  2XP6 A;  3AQU A;  4WIW A;  1EG3 A;  2DT2 A;  2LPV A;  1FAP A;  4ZPV R;  2JX8 A;  3CHD A;  1N1A A;  3PQH A;  1W1T A;  5BXJ A;  4W9P A;  4ODP A;  5DO2 A;  3TDB A;  4MNL A;  2ZQU A;  4R5E A;  1FJD A;  3O5M A;  4ZS6 A;  1ZBK A;  3G6M A;  2ZQS A;  2A3C A;  1FKK A;  2PI6 A;  3PR9 A;  1ZB5 A;  1K9R A;  4DWS D;  1BL4 A;  1NWT A;  1ZBW A;  3ARY A;  5J6E A;  2AOS A;  3WD1 A;  2XP8 A;  1LL6 A;  4Z2G A;  1UR9 A;  4DWS C;  3KAG A;  4N19 A;  1FLC A;  4QT3 A;  3O5J A;  3PRB A;  1CTN A;  3B8S A;  4LGX A;  1E6N A;  3O5P A;  4P8X A;  2DMV A;  1ZCN A;  3B9E A;  3UQA A;  2DT3 A;  1FFQ A;  2QRV A;  1GUV A;  2WM0 A;  1KT1 A;  1HJW A;  2IF4 A;  1IX5 A;  3CHF A;  1PBK A;  5HKG A;  1E6R A;  2LAJ A;  3JYM A;  2K8I A;  3O5I A;  3FSC A;  2F21 A;  5DIV A;  3UI5 A;  1ITX A;  1SR0 A;  3CNG A;  3RME A;  3KAD A;  1D7I A;  1WMV A;  1E9L A;  1GOI A;  4LAX A;  3WL1 A;  3G6L A;  4L3N A;  1YW5 A;  2A3A A;  2JZV A;  5GPR A;  2ZR6 A;  4U86 A;  4ITZ A;  4DRM A;  3O5E A;  4E5R A;  1HJV A;  2WLY A;  4MNK A;  5DIU A;  4TW8 A;  2RE3 A;  1QZ2 A;  2DSV A;  1EYM A;  4JFJ A;  2JMF A;  1W1Y A;  2WK2 A;  1I5H W;  3O5Q A;  3ARP A;  4TX0 A;  2Q5A A;  1D6O A;  5HTG A;  3ART A;  5GPG A;  3FS8 A;  4DRH A;  2DG9 A;  1ROT A;  4QIB A;  1C9H A;  1GPF A;  1Q1C A;  1X6N A;  2FDM A;  5D75 A;  4IT6 A;  4MTV A;  1NMV A;  2MLX A;  1FKT A;  3WIJ A;  1EHN A;  2XP5 A;  3L4H A;  4ZPW R;  1FKL A;  4HBE A;  2DWV A;  2E45 A;  2ZAJ A;  2PV1 A;  3O5K A;  3MCB A;  4WKA A;  2KO7 A;  4QT2 A;  3WD4 A;  2UZ5 A;  4HAR A;  2XP3 A;  4G2P A;  1FKI A;  1JND A;  4KQZ A;  2DSZ A;  4DRO A;  3MCB B;  2FKE A;  4NZC A;  2RUD A;  4AY1 A;  2RUC A;  1D7J A;  3ARX A;  3PA7 A;  3KZ7 A;  1LJY A;  2PPN A;  5E66 A;  5B8I C;  2FAP A;  1J4I A;  1FD9 A;  2RSE A;  1NWS A;  2ESC A;  4S3J A;  5HUA A;  2L2S A;  3ARR A;  1ZBC A;  1NSG A;  1TCO C;  1TFV A;  1HKI A;  2XP9 A;  2DPE A;  1W9U A;  4ODO A;  1FKB A;  3B9A A;  1OWQ A;  2DSU A;  4JFI A;  1HJX A;  1B6C A;  1LG1 A;  3OOB A;  2MNT A;  3VAW A;  2PBC A;  4DRP A;  1KFW A;  1TK7 A;  1UR8 A;  2ZQT A;  3RGC A;  3OA5 A;  4DWS B;  5E62 A;  2OFN A;  3GPK A;  1M5Y A;  5E5W A;  1LG2 A;  3MDY B;  4GGQ A;  4IQC A;  1VF8 A;  5E65 A;  3MQG A;  2KXQ A;  1JMQ A;  4ODN A;  3FXY A;  2L4J A;  2EZ5 W;  1QPL A;  3UQB A;  2WAD A;  1FKR A;  3WD0 A;  3FAP A;  1H0I A;  2M1I A;  5HWC A;  2AWG A;  2RQS A;  3UQI A;  4DRK A;  3WQW A;  3O5R A;  4MGV A;  2B31 A;  4QZV B;  4DRJ A;  4IQ2 A;  4FAP A;  3O5O A;  4TW7 A;  1O6W A;  5HWB A;  1JNS A;  2M2A A;  4JYS A;  4JFK A;  3ARQ A;  2PV2 A;  4DH0 A;  1Q6H A;  3CHC A;  2WAE A;  1FKF A;  4J4O A;  2JXW A;  3PRD A;  3EY6 A;  2MLY A;  2DG4 A;  3QOK A;  2KE0 A;  4Z2I A;  2KR7 A;  3CGN A;  2VCD A;  1F40 A;  2YSI A;  3ARS A;  2RUQ A;  1HXV A;  2LKN A;  3JYJ A;  3M7N A;  4O2T A;  3RM9 A;  1W1V A;  3KAC A;  2YSH A;  5HW7 A;  5HW6 A;  3LUO A;  4IT4 A;  3O5D A;  2OWO A;  1D2K A;  3TC5 A;  2XP7 A;  3ODK A;  3UI6 A;  1HKJ A;  2M3O W;  4J4N A;  1OGG A;  2XPB A;  4FN2 A;  4TNS A;  1XHG A;  4TYO A;  4DZ2 A;  2BA1 A;  4R0X A;  4MNM A;  4DIP A;  3UF8 A;  3O5L A;  3WQV A;  2DSW A;  1FKG A;  3WKZ A;  3ARZ A;  1BKF A;  2M8I A;  3M85 A;  4BF8 A;  4TW6 A;  1F8A B;  4Z2H A;  2ZQV A;  1H0G A;  2A3B A;  2Y8N B;  3FY1 A;  2ITK A;  2IUZ A;  3NRK A;  2KI3 A;  4L72 B;  5CQ2 A;  4JFM A;  4P8V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...