1F8AB

Structural basis for the phosphoserine-proline recognition by group iv ww domains
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
167
structure length
155
Chain Sequence
GSHGMADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords PEPTIDYL-PROLYL CIS-TRANS ISOMERASE NIMA-INTERACTING 1
publication title Structural basis for phosphoserine-proline recognition by group IV WW domains.
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 155
sequence length 167
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2000-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00397 WW WW domain
B PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 1f8aB01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1f8aB02
1FKLA 1FKKA 3IK8A 4U84A 2Y78A 2RUQA 3H9RB 2PPNA 1ZCNA 2ZAJA 1JMQA 2F21A 3KACA 1J4HA 1BL4A 2DK7A 2BA1A 4DRJA 2MF9A 4LAXA 4JFMA 1FKBA 3KABA 5HW8A 4TNSA 3CGMA 4W9PA 2MPHA 2F2DA 3CNGA 4ODOA 4QT2A 4J4OA 5HW6A 2LKNA 4NNRA 1I5HW 2KGJA 3JYMA 1QPLA 4DRNA 3UQBA 2MLZA 2XP5A 2M8IA 3VAWA 1R9HA 2PV2A 4W9QA 2ZQTA 3O5EA 5GPGA 2AWGA 3KAIA 4QIBA 1C9HA 1Q6HA 5HW7A 3O5MA 4LAYA 4DRIA 2RSEA 4JFKA 2LJ4A 1FKTA 5CQ2A 2PPOA 1EG3A 2EZ5W 3MDYB 2M1IA 1ROTA 4DZ3A 3GPKA 2KI3A 4QT3A 1F8AB 2JV4A 2MNTA 2N87A 4LAVA 4BF8A 1KT0A 4DRHA 4ODRA 1M5YA 1JNTA 1FKFA 3EY6A 2Q5AA 1Q6IA 1TCOC 2M08A 3KAHA 3OOBA 4IQCA 3UF8A 3WH0A 3O5LA 4DRQA 1J6YA 2M8JA 4GIVA 4DT4A 2YSGA 4G50A 4LAWA 4DRMA 3IKDA 5AHTA 3CGNA 4ODMA 2E45A 3JXVA 1D7HA 4MSPA 1J4RA 2DMVA 4E5RA 2PV1A 3O5PA 2PV3A 2MDIA 3O5KA 3O5GA 2ZR4A 1F40A 2MLYA 2PBCA 3PA7A 1FKIA 4DROA 2KXQA 1EYMA 3O5RA 4DRPA 3RGCA 2LPVA 4R0XA 3O5DA 3UQIA 1L1PA 2UZ5A 1TK7A 3O5JA 1K9QA 2ITKA 4DIPA 3NTPA 3NI6A 2RUDA 1YATA 4JFLA 1FKRA 2JZVA 3RFWA 4REXA 4FN2A 2JX8A 1FKHA 4ODQA 1Y0OA 4N19A 5DIVA 2DG4A 4TX0A 1O6WA 3O5OA 5HTGA 5I98A 2DWVA 2D9FA 2KFWA 1ROUA 4ODNA 2RQSA 1FD9A 1FKDA 2DK1A 2VCDA 2DG9A 2FKEA 4GGQA 3UI6A 1FKJA 2RURA 3LUOA 3I6CA 3KAGA 5HWCA 3JYJA 1HXVA 1YW5A 2XP9A 4O2TA 1EG4A 4DZ2A 4TW6A 5HUAA 4JFIA 4DH0A 4J4NA 1QPFA 3B7XA 2ZR5A 3LE4A 2PPPA 1B6CA 2LGOA 5BXJA 2JMFA 2ZR6A 4JYSA 1U79A 2JXWA 1FJDA 1WMVA 3KADA 3UQAA 2KE0A 1NMVA 1P5QA 1FAPA 4ITZA 4TW7A 2ZQUA 2IF4A 2YSIA 1FKSA 4MGVA 4TYOA 1QZ2A 5D75A 3PRDA 1NMWA 2XPBA 2L2SA 2RUCA 1PINA 1Q6UA 1D7JA 4DRKA 4IQ2A 5DITA 2OFNA 1WR7A 1T11A 4C02B 3ODKA 2YSBA 1D6OA 2K8IA 3KCEA 3PRBA 4U85A 1ZK6A 1D7IA 3FAPA 5J6EA 2RE3A 4ODPA 2YSFA 1EQ3A 2XP4A 2DJYA 3O5QA 1JNSA 2LAJA 1K9RA 1JVWA 1N1AA 1PBKA 2FAPA 2DG3A 2XP6A 2KR7A 3TDBA 1W26A 1NSGA 4TW8A 3KAFA 3M7NA 3L4HA 3KZ7A 3NRKA 3O5FA 3O5IA 2XP8A 2M3OW 2ZQVA 3TC5A 3IHZA 3IKGA 3UI4A 2L4JA 4W9OA 4FAPA 5HKGA 4G2PA 2VN1A 4ODLA 2XP7A 2KO7A 1Q1CA 3UI5A 2YSHA 2MLXA 4U86A 5DIUA 2XP3A 1KT1A 3TCZA 1BKFA 2F4EA 2XPAA 5B8IC 4JFJA 2ZQSA 1J4IA 4ODKA 2M2AA 5HWBA 3M85A 1A7XA 5HT1A 4IPXA 1FKGA
chains in the Genus database with same CATH superfamily
1SR0A 1ZB5A 1FKLA 1FKKA 3WD1A 3IK8A 3CZ8A 4U84A 2Y78A 3PQHA 2RUQA 3H9RB 2PPNA 1GOIA 1ZCNA 2ZAJA 1JMQA 2F21A 3KACA 1J4HA 1BL4A 1SYTA 1EDQA 2DK7A 3FSBA 2BA1A 1WAWA 4DRJA 3AS2A 2MF9A 1UR9A 4LAXA 4L3NA 4JFMA 1FKBA 3KABA 4XAKA 5HW8A 1ZBKA 1HKJA 4MNJA 4TNSA 2DT2A 1ZU8A 3CGMA 2G8ZA 4MNMA 4S3KA 4R5EA 4W9PA 2MPHA 2F2DA 4AY1A 3CNGA 4ODOA 3ALGA 3FY1A 3ARUA 4QT2A 2DT3A 4J4OA 5HW6A 2Y8NB 3WD2A 2LKNA 4UDMA 4NNRA 1I5HW 2KGJA 3JYMA 4PTMA 2OLHA 1QPLA 4DRNA 1XHGA 1HJVA 3UQBA 2MLZA 2XP5A 3WD3A 2YBTA 2M8IA 3VAWA 1R9HA 2PV2A 4W9QA 2ZQTA 3O5EA 5GPGA 4WKHA 2AWGA 3KAIA 4NSBA 4QIBA 1C9HA 1E6NA 1Q6HA 5HW7A 3O5MA 5E65A 4LAYA 4DRIA 2RSEA 4JFKA 1E9LA 2LJ4A 1ZBCA 1FKTA 5CQ2A 2PPOA 1EG3A 4P8WA 2EZ5W 3MDYB 2M1IA 4DWSD 3WQWA 4Z2GA 1ROTA 3B9EA 4ZPVR 4DZ3A 3GPKA 1VF8A 2KI3A 1LG2A 4QT3A 1F8AB 4MNLA 4HBOA 2JV4A 2MNTA 2N87A 3G6LA 4LAVA 4BF8A 2OWOA 1KT0A 4WIWA 3EIPA 5U47A 4L72B 4ODRA 4DRHA 1M5YA 1CTNA 4Z2LA 1JNTA 3LKXB 1FKFA 3EY6A 2Q5AA 3ARVA 1Q6IA 2WLYA 5GPRA 2B31A 1E44A 1TCOC 4URIA 2M08A 3WD0A 1W1PA 4IT4A 3ARZA 3KAHA 3OOBA 1K9TA 4IQCA 3UF8A 3WH0A 3O5LA 4DRQA 2WM0A 3ARTA 1RP5A 5GQBA 1J6YA 2M8JA 4GIVA 4DT4A 2YSGA 1GUVA 1W9UA 4G50A 4LAWA 4DRMA 3IKDA 5AHTA 3CGNA 4ODMA 2E45A 3CHEA 1HKKA 3JXVA 1D7HA 4MSPA 1J4RA 4ZPWR 3RM9A 2DMVA 4E5RA 4P8XA 2PN0A 2PV1A 3O5PA 4Z2HA 2DT1A 2PV3A 2MDIA 3O5KA 3O5GA 2ZR4A 1F40A 2MLYA 2O9OA 1TFVA 3WD4A 1W9VA 2PBCA 3PA7A 1FKIA 4DROA 4A0UA 2KXQA 1LQ0A 3LKXA 1LL7A 1ZBWA 2DPEA 3WL1A 1EYMA 3O5RA 4DRPA 3RGCA 5DEZA 2LPVA 4R0XA 2ETNA 3O5DA 3UQIA 3BXWA 3FXYA 1L1PA 2UZ5A 1TK7A 3O5JA 2DT0A 1K9QA 2ITKA 2F23A 4DIPA 4IT6A 3NTPA 3PR9A 1OGBA 3ARYA 3NI6A 2RUDA 3ARQA 3OA5A 1OWQA 4ML4A 2PI6A 1YATA 4JFLA 4KR0B 1JCHB 3AS1A 1FKRA 2A3EA 2AOSA 2JZVA 3RFWA 4REXA 1JNEA 4FN2A 2JX8A 1ITXA 2WAEA 1FKHA 4ODQA 1Y0OA 4N19A 5DIVA 2DG4A 3MCBB 4TX0A 1O6WA 3O5OA 1HJXA 3BMBA 5HTGA 5I98A 2WADA 4MAVA 2DWVA 1ZBVA 4A0TA 2D9FA 1ROUA 2KFWA 4ODNA 1LL4A 1NWUA 2WLZA 3AROA 2FDMA 2RQSA 3W4RA 1FD9A 1FKDA 1X6LA 1FLCA 3ARWA 3B8SA 2DK1A 2QRVA 2VCDA 3G6MA 2DG9A 2FKEA 4GGQA 2A3CA 3RMEA 2IUZA 3B9DA 3PRAA 2YAJB 3UI6A 4DWSB 1D2KA 2O92A 1FKJA 4WK9A 3ARSA 2RURA 3LUOA 5HBFA 3I6CA 3KAGA 5E62A 4DWSC 5HWCA 1E6RA 3JYJA 1HXVA 1YW5A 2XP9A 3ARPA 4O2TA 1EG4A 4DZ2A 1EIBA 4TW6A 5E5WA 5HUAA 3AQUA 4JFIA 4DH0A 5JH8A 4J4NA 4MTVA 1QPFA 3B7XA 1TR8A 3B9AA 2ZR5A 3LE4A 4W5UA 2PPPA 1B6CA 2LGOA 5BXJA 2JMFA 2ZR6A 1FFRA 1ZL1A 4JYSA 1U79A 2JXWA 1FJDA 3GTYX 4HBEA 1WMVA 3ALFA 3RM4A 1LL6A 3KADA 3UQAA 1FFQA 2KE0A 1W1TA 1NMVA 4DWSA 4Z2JA 1P5QA 2G41A 1FAPA 1GRJA 4MNKA 4ITZA 4Z2IA 4TW7A 1H0GA 3CH9A 1LJYA 4WKAA 1XRVA 2ZQUA 3CHCA 2DSWA 2IF4A 1W1YA 2YSIA 1FKSA 4MGVA 4TYOA 3WIJA 1QZ2A 5D75A 3FS8A 1HJWA 3MQGA 3PRDA 3FSCA 1NMWA 4NZCA 3AS3A 2XPBA 2L2SA 2RUCA 4WJXA 1PINA 1Q6UA 1HKIA 3RM8A 1D7JA 4DRKA 2QF8A 4IQ2A 1JNDA 1NWSA 5DITA 2OFNA 1WR7A 1T11A 4C02B 1LG1A 1IX5A 3ODKA 1WB0A 2YSBA 2ESCA 1D6OA 4Q7NA 2K8IA 3KCEA 3PRBA 4P8UA 4U85A 1ZK6A 1D7IA 3FAPA 5J6EA 3ARXA 3ARRA 1WNOA 2RE3A 4ODPA 2YSFA 1EQ3A 4HARA 2XP4A 1GPFA 2WK2A 2DSZA 2DJYA 3O5QA 5DO2A 1JNSA 2LAJA 5E64A 1NWTA 1K9RA 1JVWA 1N1AA 3WQVA 4QZVB 4WKFA 2DSVA 3CHDA 1PBKA 4Q22A 3QOKA 1RD6A 1EHNA 2FAPA 2DG3A 2XP6A 2KR7A 3TDBA 1H0IA 1W26A 1NSGA 4TW8A 3KAFA 3M7NA 1HKMA 3L4HA 3WKZA 4S3JA 4MPKA 3KZ7A 3NRKA 2A3BA 3O5FA 5E66A 3O5IA 2XP8A 4GLXA 1E15A 2M3OW 2B5UB 2ZQVA 1O6IA 3TC5A 3IHZA 1W9PA 1NWRA 2L4JA 1NH6A 3IKGA 1OGGA 4W9OA 4KQZA 3UI4A 4FAPA 5HKGA 3CHFA 1UR8A 4LGXA 4G2PA 2DSUA 2VN1A 4ODLA 2XP7A 1W1VA 2KO7A 1Q1CA 3GU0A 4P8VA 3UI5A 3MCBA 2YSHA 2MLXA 4U86A 5DF0A 2P4VA 3WL0A 5DIUA 2XP3A 1KT1A 3TCZA 1BKFA 4ZPTR 2F4EA 2XPAA 1KFWA 4ZS6A 3MQHA 4Z2KA 5B8IC 4JFJA 2ZQSA 1J4IA 1X6NA 4ODKA 1E6ZA 2A3AA 2YBUA 2M2AA 5HWBA 3M85A 1A7XA 5HT1A 2EULA 4IPXA 3AS0A 1E6PA 1FKGA
chains in the Genus database with same CATH topology
1SR0A 1ZB5A 1FKLA 1FKKA 3WD1A 3IK8A 3CZ8A 4U84A 2Y78A 3PQHA 2RUQA 3H9RB 2PPNA 1GOIA 1ZCNA 2ZAJA 1JMQA 2F21A 3KACA 1J4HA 1BL4A 1SYTA 1EDQA 2DK7A 3FSBA 2BA1A 1WAWA 4DRJA 3AS2A 2MF9A 1UR9A 4LAXA 4L3NA 4JFMA 1FKBA 3KABA 4XAKA 5HW8A 1ZBKA 1HKJA 4MNJA 4TNSA 2DT2A 1ZU8A 3CGMA 2G8ZA 4MNMA 4S3KA 4R5EA 4W9PA 2MPHA 2F2DA 4AY1A 3CNGA 4ODOA 3ALGA 3FY1A 3ARUA 4QT2A 2DT3A 4J4OA 5HW6A 2Y8NB 3WD2A 2LKNA 4NNRA 1I5HW 2KGJA 3JYMA 4PTMA 2OLHA 1QPLA 4DRNA 1XHGA 1HJVA 3UQBA 2MLZA 2XP5A 3WD3A 2YBTA 2M8IA 3VAWA 1R9HA 2PV2A 4W9QA 2ZQTA 3O5EA 5GPGA 4WKHA 2AWGA 3KAIA 4NSBA 4QIBA 1C9HA 1E6NA 1Q6HA 5HW7A 3O5MA 5E65A 4LAYA 4DRIA 2RSEA 4JFKA 1E9LA 2LJ4A 1ZBCA 1FKTA 5CQ2A 2PPOA 1EG3A 4P8WA 2EZ5W 3MDYB 2M1IA 4DWSD 3WQWA 4Z2GA 1ROTA 3B9EA 4ZPVR 4DZ3A 3GPKA 1VF8A 2KI3A 1LG2A 4QT3A 1F8AB 4MNLA 4HBOA 2JV4A 2MNTA 2N87A 3G6LA 4LAVA 4BF8A 2OWOA 1KT0A 4WIWA 4ODRA 5U47A 4L72B 4DRHA 1M5YA 1CTNA 4Z2LA 1JNTA 3LKXB 1FKFA 3EY6A 2Q5AA 3ARVA 1Q6IA 2WLYA 5GPRA 2B31A 1TCOC 4URIA 2M08A 3WD0A 1W1PA 4IT4A 3ARZA 3KAHA 3OOBA 1K9TA 4IQCA 3UF8A 3WH0A 3O5LA 4DRQA 2WM0A 3ARTA 1RP5A 5GQBA 1J6YA 2M8JA 4GIVA 4DT4A 2YSGA 1GUVA 1W9UA 4G50A 4LAWA 4DRMA 3IKDA 5AHTA 3CGNA 4ODMA 2E45A 3CHEA 1HKKA 3JXVA 1D7HA 4MSPA 1J4RA 4ZPWR 3RM9A 2DMVA 4E5RA 4P8XA 2PV1A 3O5PA 4Z2HA 2DT1A 2PV3A 2MDIA 3O5KA 3O5GA 2ZR4A 1F40A 2MLYA 2O9OA 1TFVA 3WD4A 1W9VA 2PBCA 3PA7A 1FKIA 4DROA 4A0UA 2KXQA 1LQ0A 3LKXA 1LL7A 1ZBWA 2DPEA 3WL1A 1EYMA 3O5RA 4DRPA 3RGCA 5DEZA 2LPVA 4R0XA 3O5DA 3UQIA 3BXWA 3FXYA 1L1PA 2UZ5A 1TK7A 3O5JA 2DT0A 1K9QA 2ITKA 4DIPA 4IT6A 3NTPA 3PR9A 1OGBA 3ARYA 3NI6A 2RUDA 3ARQA 3OA5A 1OWQA 4ML4A 2PI6A 1YATA 4JFLA 4KR0B 3AS1A 1FKRA 2A3EA 2AOSA 2JZVA 3RFWA 4REXA 1JNEA 4FN2A 2JX8A 1ITXA 2WAEA 1FKHA 4ODQA 1Y0OA 4N19A 5DIVA 2DG4A 3MCBB 4TX0A 1O6WA 3O5OA 1HJXA 5HTGA 5I98A 2WADA 4MAVA 2DWVA 1ZBVA 4A0TA 2D9FA 1ROUA 2KFWA 4ODNA 1LL4A 1NWUA 2WLZA 3AROA 2FDMA 2RQSA 3W4RA 1FD9A 1FKDA 1X6LA 1FLCA 3ARWA 3B8SA 2DK1A 2QRVA 2VCDA 3G6MA 2DG9A 2FKEA 4GGQA 2A3CA 3RMEA 2IUZA 3B9DA 3PRAA 2YAJB 3UI6A 4DWSB 1D2KA 2O92A 1FKJA 4WK9A 3ARSA 2RURA 3LUOA 5HBFA 3I6CA 3KAGA 5E62A 4DWSC 5HWCA 1E6RA 3JYJA 1HXVA 1YW5A 2XP9A 3ARPA 4O2TA 1EG4A 4DZ2A 1EIBA 4TW6A 5E5WA 5HUAA 3AQUA 4JFIA 4DH0A 5JH8A 4J4NA 4MTVA 1QPFA 3B7XA 1TR8A 3B9AA 2ZR5A 3LE4A 4W5UA 2PPPA 1B6CA 2LGOA 5BXJA 2JMFA 2ZR6A 1FFRA 1ZL1A 4JYSA 1U79A 2JXWA 1FJDA 4HBEA 1WMVA 3ALFA 3RM4A 1LL6A 3KADA 3UQAA 1FFQA 2KE0A 1W1TA 1NMVA 4DWSA 4Z2JA 1P5QA 2G41A 1FAPA 4MNKA 4ITZA 4Z2IA 4TW7A 1H0GA 3CH9A 1LJYA 4WKAA 1XRVA 2ZQUA 3CHCA 2DSWA 2IF4A 1W1YA 2YSIA 1FKSA 4MGVA 4TYOA 3WIJA 1QZ2A 5D75A 3FS8A 1HJWA 3MQGA 3PRDA 3FSCA 1NMWA 4NZCA 3AS3A 2XPBA 2L2SA 2RUCA 4WJXA 1PINA 1Q6UA 1HKIA 3RM8A 1D7JA 4DRKA 2QF8A 4IQ2A 1JNDA 1NWSA 5DITA 2OFNA 1WR7A 1T11A 4C02B 1LG1A 1IX5A 3ODKA 1WB0A 2YSBA 2ESCA 1D6OA 4Q7NA 2K8IA 3KCEA 3PRBA 4P8UA 4U85A 1ZK6A 1D7IA 3FAPA 5J6EA 3ARXA 3ARRA 1WNOA 2RE3A 4ODPA 2YSFA 1EQ3A 4HARA 2XP4A 1GPFA 2WK2A 2DSZA 2DJYA 3O5QA 5DO2A 1JNSA 2LAJA 5E64A 1NWTA 1K9RA 1JVWA 1N1AA 3WQVA 4QZVB 4WKFA 2DSVA 3CHDA 1PBKA 4Q22A 3QOKA 1RD6A 1EHNA 2FAPA 2DG3A 2XP6A 2KR7A 3TDBA 1H0IA 1W26A 1NSGA 4TW8A 3KAFA 3M7NA 1HKMA 3L4HA 3WKZA 4S3JA 4MPKA 3KZ7A 3NRKA 2A3BA 3O5FA 5E66A 3O5IA 2XP8A 4GLXA 1E15A 2M3OW 2ZQVA 1O6IA 3TC5A 3IHZA 1W9PA 1NWRA 2L4JA 1NH6A 3IKGA 1OGGA 4W9OA 4KQZA 3UI4A 4FAPA 5HKGA 3CHFA 1UR8A 4LGXA 4G2PA 2DSUA 2VN1A 4ODLA 2XP7A 1W1VA 2KO7A 1Q1CA 4P8VA 3UI5A 3MCBA 2YSHA 2MLXA 4U86A 5DF0A 3WL0A 5DIUA 2XP3A 1KT1A 3TCZA 1BKFA 4ZPTR 2F4EA 2XPAA 1KFWA 4ZS6A 3MQHA 4Z2KA 5B8IC 4JFJA 2ZQSA 1J4IA 1X6NA 4ODKA 1E6ZA 2A3AA 2YBUA 2M2AA 5HWBA 3M85A 1A7XA 5HT1A 4IPXA 3AS0A 1E6PA 1FKGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FKL A;  1FKK A;  3IK8 A;  4U84 A;  2Y78 A;  2RUQ A;  3H9R B;  2PPN A;  1ZCN A;  2ZAJ A;  1JMQ A;  2F21 A;  3KAC A;  1J4H A;  1BL4 A;  2DK7 A;  2BA1 A;  4DRJ A;  2MF9 A;  4LAX A;  4JFM A;  1FKB A;  3KAB A;  5HW8 A;  4TNS A;  3CGM A;  4W9P A;  2MPH A;  2F2D A;  3CNG A;  4ODO A;  4QT2 A;  4J4O A;  5HW6 A;  2LKN A;  4NNR A;  1I5H W;  2KGJ A;  3JYM A;  1QPL A;  4DRN A;  3UQB A;  2MLZ A;  2XP5 A;  2M8I A;  3VAW A;  1R9H A;  2PV2 A;  4W9Q A;  2ZQT A;  3O5E A;  5GPG A;  2AWG A;  3KAI A;  4QIB A;  1C9H A;  1Q6H A;  5HW7 A;  3O5M A;  4LAY A;  4DRI A;  2RSE A;  4JFK A;  2LJ4 A;  1FKT A;  5CQ2 A;  2PPO A;  1EG3 A;  2EZ5 W;  3MDY B;  2M1I A;  1ROT A;  4DZ3 A;  3GPK A;  2KI3 A;  4QT3 A;  1F8A B;  2JV4 A;  2MNT A;  2N87 A;  4LAV A;  4BF8 A;  1KT0 A;  4DRH A;  4ODR A;  1M5Y A;  1JNT A;  1FKF A;  3EY6 A;  2Q5A A;  1Q6I A;  1TCO C;  2M08 A;  3KAH A;  3OOB A;  4IQC A;  3UF8 A;  3WH0 A;  3O5L A;  4DRQ A;  1J6Y A;  2M8J A;  4GIV A;  4DT4 A;  2YSG A;  4G50 A;  4LAW A;  4DRM A;  3IKD A;  5AHT A;  3CGN A;  4ODM A;  2E45 A;  3JXV A;  1D7H A;  4MSP A;  1J4R A;  2DMV A;  4E5R A;  2PV1 A;  3O5P A;  2PV3 A;  2MDI A;  3O5K A;  3O5G A;  2ZR4 A;  1F40 A;  2MLY A;  2PBC A;  3PA7 A;  1FKI A;  4DRO A;  2KXQ A;  1EYM A;  3O5R A;  4DRP A;  3RGC A;  2LPV A;  4R0X A;  3O5D A;  3UQI A;  1L1P A;  2UZ5 A;  1TK7 A;  3O5J A;  1K9Q A;  2ITK A;  4DIP A;  3NTP A;  3NI6 A;  2RUD A;  1YAT A;  4JFL A;  1FKR A;  2JZV A;  3RFW A;  4REX A;  4FN2 A;  2JX8 A;  1FKH A;  4ODQ A;  1Y0O A;  4N19 A;  5DIV A;  2DG4 A;  4TX0 A;  1O6W A;  3O5O A;  5HTG A;  5I98 A;  2DWV A;  2D9F A;  2KFW A;  1ROU A;  4ODN A;  2RQS A;  1FD9 A;  1FKD A;  2DK1 A;  2VCD A;  2DG9 A;  2FKE A;  4GGQ A;  3UI6 A;  1FKJ A;  2RUR A;  3LUO A;  3I6C A;  3KAG A;  5HWC A;  3JYJ A;  1HXV A;  1YW5 A;  2XP9 A;  4O2T A;  1EG4 A;  4DZ2 A;  4TW6 A;  5HUA A;  4JFI A;  4DH0 A;  4J4N A;  1QPF A;  3B7X A;  2ZR5 A;  3LE4 A;  2PPP A;  1B6C A;  2LGO A;  5BXJ A;  2JMF A;  2ZR6 A;  4JYS A;  1U79 A;  2JXW A;  1FJD A;  1WMV A;  3KAD A;  3UQA A;  2KE0 A;  1NMV A;  1P5Q A;  1FAP A;  4ITZ A;  4TW7 A;  2ZQU A;  2IF4 A;  2YSI A;  1FKS A;  4MGV A;  4TYO A;  1QZ2 A;  5D75 A;  3PRD A;  1NMW A;  2XPB A;  2L2S A;  2RUC A;  1PIN A;  1Q6U A;  1D7J A;  4DRK A;  4IQ2 A;  5DIT A;  2OFN A;  1WR7 A;  1T11 A;  4C02 B;  3ODK A;  2YSB A;  1D6O A;  2K8I A;  3KCE A;  3PRB A;  4U85 A;  1ZK6 A;  1D7I A;  3FAP A;  5J6E A;  2RE3 A;  4ODP A;  2YSF A;  1EQ3 A;  2XP4 A;  2DJY A;  3O5Q A;  1JNS A;  2LAJ A;  1K9R A;  1JVW A;  1N1A A;  1PBK A;  2FAP A;  2DG3 A;  2XP6 A;  2KR7 A;  3TDB A;  1W26 A;  1NSG A;  4TW8 A;  3KAF A;  3M7N A;  3L4H A;  3KZ7 A;  3NRK A;  3O5F A;  3O5I A;  2XP8 A;  2M3O W;  2ZQV A;  3TC5 A;  3IHZ A;  3IKG A;  3UI4 A;  2L4J A;  4W9O A;  4FAP A;  5HKG A;  4G2P A;  2VN1 A;  4ODL A;  2XP7 A;  2KO7 A;  1Q1C A;  3UI5 A;  2YSH A;  2MLX A;  4U86 A;  5DIU A;  2XP3 A;  1KT1 A;  3TCZ A;  1BKF A;  2F4E A;  2XPA A;  5B8I C;  4JFJ A;  2ZQS A;  1J4I A;  4ODK A;  2M2A A;  5HWB A;  3M85 A;  1A7X A;  5HT1 A;  4IPX A;  1FKG A; 
#chains in the Genus database with same CATH topology
 1SR0 A;  1ZB5 A;  1FKL A;  1FKK A;  3WD1 A;  3IK8 A;  3CZ8 A;  4U84 A;  2Y78 A;  3PQH A;  2RUQ A;  3H9R B;  2PPN A;  1GOI A;  1ZCN A;  2ZAJ A;  1JMQ A;  2F21 A;  3KAC A;  1J4H A;  1BL4 A;  1SYT A;  1EDQ A;  2DK7 A;  3FSB A;  2BA1 A;  1WAW A;  4DRJ A;  3AS2 A;  2MF9 A;  1UR9 A;  4LAX A;  4L3N A;  4JFM A;  1FKB A;  3KAB A;  4XAK A;  5HW8 A;  1ZBK A;  1HKJ A;  4MNJ A;  4TNS A;  2DT2 A;  1ZU8 A;  3CGM A;  2G8Z A;  4MNM A;  4S3K A;  4R5E A;  4W9P A;  2MPH A;  2F2D A;  4AY1 A;  3CNG A;  4ODO A;  3ALG A;  3FY1 A;  3ARU A;  4QT2 A;  2DT3 A;  4J4O A;  5HW6 A;  2Y8N B;  3WD2 A;  2LKN A;  4UDM A;  4NNR A;  1I5H W;  2KGJ A;  3JYM A;  4PTM A;  2OLH A;  1QPL A;  4DRN A;  1XHG A;  1HJV A;  3UQB A;  2MLZ A;  2XP5 A;  3WD3 A;  2YBT A;  2M8I A;  3VAW A;  1R9H A;  2PV2 A;  4W9Q A;  2ZQT A;  3O5E A;  5GPG A;  4WKH A;  2AWG A;  3KAI A;  4NSB A;  4QIB A;  1C9H A;  1E6N A;  1Q6H A;  5HW7 A;  3O5M A;  5E65 A;  4LAY A;  4DRI A;  2RSE A;  4JFK A;  1E9L A;  2LJ4 A;  1ZBC A;  1FKT A;  5CQ2 A;  2PPO A;  1EG3 A;  4P8W A;  2EZ5 W;  3MDY B;  2M1I A;  4DWS D;  3WQW A;  4Z2G A;  1ROT A;  3B9E A;  4ZPV R;  4DZ3 A;  3GPK A;  1VF8 A;  2KI3 A;  1LG2 A;  4QT3 A;  1F8A B;  4MNL A;  4HBO A;  2JV4 A;  2MNT A;  2N87 A;  3G6L A;  4LAV A;  4BF8 A;  2OWO A;  1KT0 A;  4WIW A;  3EIP A;  5U47 A;  4L72 B;  4ODR A;  4DRH A;  1M5Y A;  1CTN A;  4Z2L A;  1JNT A;  3LKX B;  1FKF A;  3EY6 A;  2Q5A A;  3ARV A;  1Q6I A;  2WLY A;  5GPR A;  2B31 A;  1E44 A;  1TCO C;  4URI A;  2M08 A;  3WD0 A;  1W1P A;  4IT4 A;  3ARZ A;  3KAH A;  3OOB A;  1K9T A;  4IQC A;  3UF8 A;  3WH0 A;  3O5L A;  4DRQ A;  2WM0 A;  3ART A;  1RP5 A;  5GQB A;  1J6Y A;  2M8J A;  4GIV A;  4DT4 A;  2YSG A;  1GUV A;  1W9U A;  4G50 A;  4LAW A;  4DRM A;  3IKD A;  5AHT A;  3CGN A;  4ODM A;  2E45 A;  3CHE A;  1HKK A;  3JXV A;  1D7H A;  4MSP A;  1J4R A;  4ZPW R;  3RM9 A;  2DMV A;  4E5R A;  4P8X A;  2PN0 A;  2PV1 A;  3O5P A;  4Z2H A;  2DT1 A;  2PV3 A;  2MDI A;  3O5K A;  3O5G A;  2ZR4 A;  1F40 A;  2MLY A;  2O9O A;  1TFV A;  3WD4 A;  1W9V A;  2PBC A;  3PA7 A;  1FKI A;  4DRO A;  4A0U A;  2KXQ A;  1LQ0 A;  3LKX A;  1LL7 A;  1ZBW A;  2DPE A;  3WL1 A;  1EYM A;  3O5R A;  4DRP A;  3RGC A;  5DEZ A;  2LPV A;  4R0X A;  2ETN A;  3O5D A;  3UQI A;  3BXW A;  3FXY A;  1L1P A;  2UZ5 A;  1TK7 A;  3O5J A;  2DT0 A;  1K9Q A;  2ITK A;  2F23 A;  4DIP A;  4IT6 A;  3NTP A;  3PR9 A;  1OGB A;  3ARY A;  3NI6 A;  2RUD A;  3ARQ A;  3OA5 A;  1OWQ A;  4ML4 A;  2PI6 A;  1YAT A;  4JFL A;  4KR0 B;  1JCH B;  3AS1 A;  1FKR A;  2A3E A;  2AOS A;  2JZV A;  3RFW A;  4REX A;  1JNE A;  4FN2 A;  2JX8 A;  1ITX A;  2WAE A;  1FKH A;  4ODQ A;  1Y0O A;  4N19 A;  5DIV A;  2DG4 A;  3MCB B;  4TX0 A;  1O6W A;  3O5O A;  1HJX A;  3BMB A;  5HTG A;  5I98 A;  2WAD A;  4MAV A;  2DWV A;  1ZBV A;  4A0T A;  2D9F A;  1ROU A;  2KFW A;  4ODN A;  1LL4 A;  1NWU A;  2WLZ A;  3ARO A;  2FDM A;  2RQS A;  3W4R A;  1FD9 A;  1FKD A;  1X6L A;  1FLC A;  3ARW A;  3B8S A;  2DK1 A;  2QRV A;  2VCD A;  3G6M A;  2DG9 A;  2FKE A;  4GGQ A;  2A3C A;  3RME A;  2IUZ A;  3B9D A;  3PRA A;  2YAJ B;  3UI6 A;  4DWS B;  1D2K A;  2O92 A;  1FKJ A;  4WK9 A;  3ARS A;  2RUR A;  3LUO A;  5HBF A;  3I6C A;  3KAG A;  5E62 A;  4DWS C;  5HWC A;  1E6R A;  3JYJ A;  1HXV A;  1YW5 A;  2XP9 A;  3ARP A;  4O2T A;  1EG4 A;  4DZ2 A;  1EIB A;  4TW6 A;  5E5W A;  5HUA A;  3AQU A;  4JFI A;  4DH0 A;  5JH8 A;  4J4N A;  4MTV A;  1QPF A;  3B7X A;  1TR8 A;  3B9A A;  2ZR5 A;  3LE4 A;  4W5U A;  2PPP A;  1B6C A;  2LGO A;  5BXJ A;  2JMF A;  2ZR6 A;  1FFR A;  1ZL1 A;  4JYS A;  1U79 A;  2JXW A;  1FJD A;  3GTY X;  4HBE A;  1WMV A;  3ALF A;  3RM4 A;  1LL6 A;  3KAD A;  3UQA A;  1FFQ A;  2KE0 A;  1W1T A;  1NMV A;  4DWS A;  4Z2J A;  1P5Q A;  2G41 A;  1FAP A;  1GRJ A;  4MNK A;  4ITZ A;  4Z2I A;  4TW7 A;  1H0G A;  3CH9 A;  1LJY A;  4WKA A;  1XRV A;  2ZQU A;  3CHC A;  2DSW A;  2IF4 A;  1W1Y A;  2YSI A;  1FKS A;  4MGV A;  4TYO A;  3WIJ A;  1QZ2 A;  5D75 A;  3FS8 A;  1HJW A;  3MQG A;  3PRD A;  3FSC A;  1NMW A;  4NZC A;  3AS3 A;  2XPB A;  2L2S A;  2RUC A;  4WJX A;  1PIN A;  1Q6U A;  1HKI A;  3RM8 A;  1D7J A;  4DRK A;  2QF8 A;  4IQ2 A;  1JND A;  1NWS A;  5DIT A;  2OFN A;  1WR7 A;  1T11 A;  4C02 B;  1LG1 A;  1IX5 A;  3ODK A;  1WB0 A;  2YSB A;  2ESC A;  1D6O A;  4Q7N A;  2K8I A;  3KCE A;  3PRB A;  4P8U A;  4U85 A;  1ZK6 A;  1D7I A;  3FAP A;  5J6E A;  3ARX A;  3ARR A;  1WNO A;  2RE3 A;  4ODP A;  2YSF A;  1EQ3 A;  4HAR A;  2XP4 A;  1GPF A;  2WK2 A;  2DSZ A;  2DJY A;  3O5Q A;  5DO2 A;  1JNS A;  2LAJ A;  5E64 A;  1NWT A;  1K9R A;  1JVW A;  1N1A A;  3WQV A;  4QZV B;  4WKF A;  2DSV A;  3CHD A;  1PBK A;  4Q22 A;  3QOK A;  1RD6 A;  1EHN A;  2FAP A;  2DG3 A;  2XP6 A;  2KR7 A;  3TDB A;  1H0I A;  1W26 A;  1NSG A;  4TW8 A;  3KAF A;  3M7N A;  1HKM A;  3L4H A;  3WKZ A;  4S3J A;  4MPK A;  3KZ7 A;  3NRK A;  2A3B A;  3O5F A;  5E66 A;  3O5I A;  2XP8 A;  4GLX A;  1E15 A;  2M3O W;  2B5U B;  2ZQV A;  1O6I A;  3TC5 A;  3IHZ A;  1W9P A;  1NWR A;  2L4J A;  1NH6 A;  3IKG A;  1OGG A;  4W9O A;  4KQZ A;  3UI4 A;  4FAP A;  5HKG A;  3CHF A;  1UR8 A;  4LGX A;  4G2P A;  2DSU A;  2VN1 A;  4ODL A;  2XP7 A;  1W1V A;  2KO7 A;  1Q1C A;  3GU0 A;  4P8V A;  3UI5 A;  3MCB A;  2YSH A;  2MLX A;  4U86 A;  5DF0 A;  2P4V A;  3WL0 A;  5DIU A;  2XP3 A;  1KT1 A;  3TCZ A;  1BKF A;  4ZPT R;  2F4E A;  2XPA A;  1KFW A;  4ZS6 A;  3MQH A;  4Z2K A;  5B8I C;  4JFJ A;  2ZQS A;  1J4I A;  1X6N A;  4ODK A;  1E6Z A;  2A3A A;  2YBU A;  2M2A A;  5HWB A;  3M85 A;  1A7X A;  5HT1 A;  2EUL A;  4IPX A;  3AS0 A;  1E6P A;  1FKG A; 
#chains in the Genus database with same CATH homology
 1SR0 A;  1ZB5 A;  1FKL A;  1FKK A;  3WD1 A;  3IK8 A;  3CZ8 A;  4U84 A;  2Y78 A;  3PQH A;  2RUQ A;  3H9R B;  2PPN A;  1GOI A;  1ZCN A;  2ZAJ A;  1JMQ A;  2F21 A;  3KAC A;  1J4H A;  1BL4 A;  1SYT A;  1EDQ A;  2DK7 A;  3FSB A;  2BA1 A;  1WAW A;  4DRJ A;  3AS2 A;  2MF9 A;  1UR9 A;  4LAX A;  4L3N A;  4JFM A;  1FKB A;  3KAB A;  4XAK A;  5HW8 A;  1ZBK A;  1HKJ A;  4MNJ A;  4TNS A;  2DT2 A;  1ZU8 A;  3CGM A;  2G8Z A;  4MNM A;  4S3K A;  4R5E A;  4W9P A;  2MPH A;  2F2D A;  4AY1 A;  3CNG A;  4ODO A;  3ALG A;  3FY1 A;  3ARU A;  4QT2 A;  2DT3 A;  4J4O A;  5HW6 A;  2Y8N B;  3WD2 A;  2LKN A;  4NNR A;  1I5H W;  2KGJ A;  3JYM A;  4PTM A;  2OLH A;  1QPL A;  4DRN A;  1XHG A;  1HJV A;  3UQB A;  2MLZ A;  2XP5 A;  3WD3 A;  2YBT A;  2M8I A;  3VAW A;  1R9H A;  2PV2 A;  4W9Q A;  2ZQT A;  3O5E A;  5GPG A;  4WKH A;  2AWG A;  3KAI A;  4NSB A;  4QIB A;  1C9H A;  1E6N A;  1Q6H A;  5HW7 A;  3O5M A;  5E65 A;  4LAY A;  4DRI A;  2RSE A;  4JFK A;  1E9L A;  2LJ4 A;  1ZBC A;  1FKT A;  5CQ2 A;  2PPO A;  1EG3 A;  4P8W A;  2EZ5 W;  3MDY B;  2M1I A;  4DWS D;  3WQW A;  4Z2G A;  1ROT A;  3B9E A;  4ZPV R;  4DZ3 A;  3GPK A;  1VF8 A;  2KI3 A;  1LG2 A;  4QT3 A;  1F8A B;  4MNL A;  4HBO A;  2JV4 A;  2MNT A;  2N87 A;  3G6L A;  4LAV A;  4BF8 A;  2OWO A;  1KT0 A;  4WIW A;  4ODR A;  5U47 A;  4L72 B;  4DRH A;  1M5Y A;  1CTN A;  4Z2L A;  1JNT A;  3LKX B;  1FKF A;  3EY6 A;  2Q5A A;  3ARV A;  1Q6I A;  2WLY A;  5GPR A;  2B31 A;  1TCO C;  4URI A;  2M08 A;  3WD0 A;  1W1P A;  4IT4 A;  3ARZ A;  3KAH A;  3OOB A;  1K9T A;  4IQC A;  3UF8 A;  3WH0 A;  3O5L A;  4DRQ A;  2WM0 A;  3ART A;  1RP5 A;  5GQB A;  1J6Y A;  2M8J A;  4GIV A;  4DT4 A;  2YSG A;  1GUV A;  1W9U A;  4G50 A;  4LAW A;  4DRM A;  3IKD A;  5AHT A;  3CGN A;  4ODM A;  2E45 A;  3CHE A;  1HKK A;  3JXV A;  1D7H A;  4MSP A;  1J4R A;  4ZPW R;  3RM9 A;  2DMV A;  4E5R A;  4P8X A;  2PV1 A;  3O5P A;  4Z2H A;  2DT1 A;  2PV3 A;  2MDI A;  3O5K A;  3O5G A;  2ZR4 A;  1F40 A;  2MLY A;  2O9O A;  1TFV A;  3WD4 A;  1W9V A;  2PBC A;  3PA7 A;  1FKI A;  4DRO A;  4A0U A;  2KXQ A;  1LQ0 A;  3LKX A;  1LL7 A;  1ZBW A;  2DPE A;  3WL1 A;  1EYM A;  3O5R A;  4DRP A;  3RGC A;  5DEZ A;  2LPV A;  4R0X A;  3O5D A;  3UQI A;  3BXW A;  3FXY A;  1L1P A;  2UZ5 A;  1TK7 A;  3O5J A;  2DT0 A;  1K9Q A;  2ITK A;  4DIP A;  4IT6 A;  3NTP A;  3PR9 A;  1OGB A;  3ARY A;  3NI6 A;  2RUD A;  3ARQ A;  3OA5 A;  1OWQ A;  4ML4 A;  2PI6 A;  1YAT A;  4JFL A;  4KR0 B;  3AS1 A;  1FKR A;  2A3E A;  2AOS A;  2JZV A;  3RFW A;  4REX A;  1JNE A;  4FN2 A;  2JX8 A;  1ITX A;  2WAE A;  1FKH A;  4ODQ A;  1Y0O A;  4N19 A;  5DIV A;  2DG4 A;  3MCB B;  4TX0 A;  1O6W A;  3O5O A;  1HJX A;  5HTG A;  5I98 A;  2WAD A;  4MAV A;  2DWV A;  1ZBV A;  4A0T A;  2D9F A;  1ROU A;  2KFW A;  4ODN A;  1LL4 A;  1NWU A;  2WLZ A;  3ARO A;  2FDM A;  2RQS A;  3W4R A;  1FD9 A;  1FKD A;  1X6L A;  1FLC A;  3ARW A;  3B8S A;  2DK1 A;  2QRV A;  2VCD A;  3G6M A;  2DG9 A;  2FKE A;  4GGQ A;  2A3C A;  3RME A;  2IUZ A;  3B9D A;  3PRA A;  2YAJ B;  3UI6 A;  4DWS B;  1D2K A;  2O92 A;  1FKJ A;  4WK9 A;  3ARS A;  2RUR A;  3LUO A;  5HBF A;  3I6C A;  3KAG A;  5E62 A;  4DWS C;  5HWC A;  1E6R A;  3JYJ A;  1HXV A;  1YW5 A;  2XP9 A;  3ARP A;  4O2T A;  1EG4 A;  4DZ2 A;  1EIB A;  4TW6 A;  5E5W A;  5HUA A;  3AQU A;  4JFI A;  4DH0 A;  5JH8 A;  4J4N A;  4MTV A;  1QPF A;  3B7X A;  1TR8 A;  3B9A A;  2ZR5 A;  3LE4 A;  4W5U A;  2PPP A;  1B6C A;  2LGO A;  5BXJ A;  2JMF A;  2ZR6 A;  1FFR A;  1ZL1 A;  4JYS A;  1U79 A;  2JXW A;  1FJD A;  4HBE A;  1WMV A;  3ALF A;  3RM4 A;  1LL6 A;  3KAD A;  3UQA A;  1FFQ A;  2KE0 A;  1W1T A;  1NMV A;  4DWS A;  4Z2J A;  1P5Q A;  2G41 A;  1FAP A;  4MNK A;  4ITZ A;  4Z2I A;  4TW7 A;  1H0G A;  3CH9 A;  1LJY A;  4WKA A;  1XRV A;  2ZQU A;  3CHC A;  2DSW A;  2IF4 A;  1W1Y A;  2YSI A;  1FKS A;  4MGV A;  4TYO A;  3WIJ A;  1QZ2 A;  5D75 A;  3FS8 A;  1HJW A;  3MQG A;  3PRD A;  3FSC A;  1NMW A;  4NZC A;  3AS3 A;  2XPB A;  2L2S A;  2RUC A;  4WJX A;  1PIN A;  1Q6U A;  1HKI A;  3RM8 A;  1D7J A;  4DRK A;  2QF8 A;  4IQ2 A;  1JND A;  1NWS A;  5DIT A;  2OFN A;  1WR7 A;  1T11 A;  4C02 B;  1LG1 A;  1IX5 A;  3ODK A;  1WB0 A;  2YSB A;  2ESC A;  1D6O A;  4Q7N A;  2K8I A;  3KCE A;  3PRB A;  4P8U A;  4U85 A;  1ZK6 A;  1D7I A;  3FAP A;  5J6E A;  3ARX A;  3ARR A;  1WNO A;  2RE3 A;  4ODP A;  2YSF A;  1EQ3 A;  4HAR A;  2XP4 A;  1GPF A;  2WK2 A;  2DSZ A;  2DJY A;  3O5Q A;  5DO2 A;  1JNS A;  2LAJ A;  5E64 A;  1NWT A;  1K9R A;  1JVW A;  1N1A A;  3WQV A;  4QZV B;  4WKF A;  2DSV A;  3CHD A;  1PBK A;  4Q22 A;  3QOK A;  1RD6 A;  1EHN A;  2FAP A;  2DG3 A;  2XP6 A;  2KR7 A;  3TDB A;  1H0I A;  1W26 A;  1NSG A;  4TW8 A;  3KAF A;  3M7N A;  1HKM A;  3L4H A;  3WKZ A;  4S3J A;  4MPK A;  3KZ7 A;  3NRK A;  2A3B A;  3O5F A;  5E66 A;  3O5I A;  2XP8 A;  4GLX A;  1E15 A;  2M3O W;  2ZQV A;  1O6I A;  3TC5 A;  3IHZ A;  1W9P A;  1NWR A;  2L4J A;  1NH6 A;  3IKG A;  1OGG A;  4W9O A;  4KQZ A;  3UI4 A;  4FAP A;  5HKG A;  3CHF A;  1UR8 A;  4LGX A;  4G2P A;  2DSU A;  2VN1 A;  4ODL A;  2XP7 A;  1W1V A;  2KO7 A;  1Q1C A;  4P8V A;  3UI5 A;  3MCB A;  2YSH A;  2MLX A;  4U86 A;  5DF0 A;  3WL0 A;  5DIU A;  2XP3 A;  1KT1 A;  3TCZ A;  1BKF A;  4ZPT R;  2F4E A;  2XPA A;  1KFW A;  4ZS6 A;  3MQH A;  4Z2K A;  5B8I C;  4JFJ A;  2ZQS A;  1J4I A;  1X6N A;  4ODK A;  1E6Z A;  2A3A A;  2YBU A;  2M2A A;  5HWB A;  3M85 A;  1A7X A;  5HT1 A;  4IPX A;  3AS0 A;  1E6P A;  1FKG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...