1F8AB

Structural basis for the phosphoserine-proline recognition by group iv ww domains
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
167
structure length
155
Chain Sequence
GSHGMADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEPTIDYL-PROLYL CIS-TRANS ISOMERASE NIMA-INTERACTING 1
publication title Structural basis for phosphoserine-proline recognition by group IV WW domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 40
structure length 155
sequence length 167
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2000-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00397 WW WW domain
B PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 1f8aB01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1f8aB02
4U84A 3CNGA 3KAFA 4QIBA 3FAPA 2F2DA 4J4NA 4JYSA 4DZ3A 5DITA 1F40A 1Y0OA 4LAWA 1ZK6A 4DIPA 3KAIA 5B8IC 3IKGA 4LAXA 1Q1CA 1EQ3A 2YSGA 3TDBA 1D7IA 3M85A 1FJDA 2XPBA 3NI6A 2RE3A 2N87A 2DMVA 4G2PA 2KFWA 4JFJA 4TW6A 3RGCA 5AHTA 2MPHA 4C02B 3B7XA 4E5RA 5DIUA 1D7JA 3NRKA 2MLYA 1FKKA 1BL4A 2LGOA 1KT1A 3UQBA 3UI6A 3VAWA 2D9FA 2ITKA 1FD9A 4ODLA 2DG9A 1HXVA 3TCZA 1QZ2A 2XP6A 1FKBA 4GIVA 1WR7A 3O5GA 4IPXA 2DWVA 3JYMA 4QT2A 1NMWA 3O5EA 5HWCA 2KR7A 3JXVA 3O5DA 2JZVA 4ODKA 3O5OA 1NSGA 1JNTA 1EYMA 4W9OA 4N19A 4JFMA 3KZ7A 1FKRA 2XP5A 4IQCA 2ZQTA 1FKGA 3CGMA 2RUQA 2VCDA 2YSFA 1EG4A 2MLZA 1JMQA 4DH0A 3KAGA 3IKDA 3JYJA 4DZ2A 2RUCA 1I5HW 1FKLA 2DG4A 1FKTA 4TW7A 1FKIA 2PV2A 1A7XA 3O5JA 2Y78A 1C9HA 3O5QA 5HTGA 1QPLA 3O5FA 4LAYA 3KCEA 2KXQA 3GPKA 2YSBA 4ODOA 4DRQA 2RSEA 2L4JA 3UQIA 2KGJA 1NMVA 2KO7A 2YSHA 4GGQA 1FKJA 2YSIA 5HT1A 5D75A 1K9QA 2JX8A 4TW8A 2RQSA 4W9QA 3L4HA 2ZQSA 3OOBA 1R9HA 3O5LA 2AWGA 4JFKA 3O5PA 4JFLA 3MDYB 2M8JA 2FKEA 2PV1A 2XPAA 5GPGA 2ZR4A 1J4RA 5J6EA 2M08A 1D7HA 2DG3A 1ROUA 4FN2A 2XP4A 5HW7A 2RURA 2XP7A 3UI4A 4G50A 2ZR5A 2F21A 2VN1A 2PBCA 2PPOA 4DRPA 2M3OW 2JV4A 4U85A 4TX0A 1W26A 2DK7A 3UI5A 1K9RA 2ZQVA 3PRDA 1Q6IA 5HUAA 1PBKA 2ZQUA 2F4EA 4ODQA 3EY6A 2EZ5W 2XP8A 3LUOA 3KADA 2LPVA 3TC5A 4BF8A 2MDIA 3O5IA 3M7NA 3KABA 3KACA 1QPFA 3WH0A 2M1IA 4ODNA 1D6OA 4TYOA 2OFNA 4U86A 2UZ5A 5HKGA 2MLXA 2MNTA 4DRMA 1FKFA 2KI3A 2DJYA 2JXWA 4QT3A 3LE4A 4JFIA 1EG3A 2PPPA 1FKDA 1FKHA 2KE0A 3KAHA 2M8IA 1JVWA 4W9PA 4J4OA 1J4HA 1YATA 4IQ2A 4MGVA 4R0XA 3UQAA 2LAJA 4LAVA 2XP9A 3IK8A 2IF4A 2Q5AA 3NTPA 2MF9A 3IHZA 1KT0A 1O6WA 4DRJA 4NNRA 1N1AA 3O5MA 3RFWA 2LKNA 5BXJA 4DT4A 1M5YA 4FAPA 3PA7A 2M2AA 2ZAJA 2JMFA 3O5KA 4DRKA 2PV3A 1U79A 1P5QA 4ITZA 2FAPA 4DRHA 1F8AB 1ROTA 3I6CA 2ZR6A 3UF8A 4DROA 1WMVA 4O2TA 1L1PA 1JNSA 2XP3A 4REXA 2RUDA 2PPNA 1J4IA 2L2SA 5DIVA 3ODKA 1B6CA 3PRBA 1PINA 5CQ2A 1J6YA 1YW5A 2E45A 5HW6A 4ODRA 1BKFA 2LJ4A 4ODMA 1Q6UA 4DRIA 1FKSA 2BA1A 1TK7A 1T11A 1FAPA 3H9RB 5HW8A 3CGNA 2DK1A 1ZCNA 3O5RA 1Q6HA 4DRNA 5HWBA 4TNSA 4MSPA 4ODPA 5I98A 1TCOC 2K8IA
chains in the Genus database with same CATH superfamily
4U84A 3CNGA 3KAFA 1ITXA 4ZPVR 1LG1A 4QIBA 3FAPA 1JCHB 2F2DA 4J4NA 4JYSA 4DZ3A 3FY1A 5DITA 1F40A 1RP5A 3B9EA 1Y0OA 2Y8NB 4LAWA 1IX5A 1ZK6A 4DWSB 4DIPA 3CZ8A 4Z2KA 4DWSA 1ZBCA 3KAIA 3ALGA 5B8IC 3IKGA 4LAXA 1Q1CA 1EQ3A 1E6PA 2YSGA 3ARSA 1UR8A 3CHCA 5JH8A 3TDBA 4S3KA 1D7IA 3CHEA 3M85A 1KFWA 1FJDA 3ARYA 4MAVA 3WD2A 2XPBA 3FXYA 1HKJA 3NI6A 1WNOA 2RE3A 2N87A 2DMVA 2FDMA 4G2PA 4S3JA 1E6RA 2KFWA 4JFJA 4UDMA 4TW6A 3RGCA 1LL6A 5AHTA 3ARXA 5GPRA 2MPHA 1XRVA 3G6MA 4C02B 3B7XA 1NWUA 4E5RA 3AROA 5DIUA 1D7JA 3NRKA 2O92A 2MLYA 1FKKA 2QF8A 1BL4A 2LGOA 1KT1A 3UQBA 3UI6A 4W5UA 1EDQA 3VAWA 1LL7A 2D9FA 2ITKA 3FSBA 3ARUA 4AY1A 1FD9A 4ODLA 2DG9A 2ETNA 1HXVA 3TCZA 1QZ2A 2XP6A 1FKBA 4GIVA 3WD0A 3MQHA 1WR7A 3O5GA 4IPXA 2DWVA 3PR9A 1HJWA 4Z2GA 1HKKA 3OA5A 4KR0B 4A0UA 3ARZA 3JYMA 1GRJA 3ARQA 4QT2A 1NMWA 3O5EA 5HWCA 1HJVA 4ZPTR 2DT3A 2KR7A 4PTMA 3JXVA 3MCBA 3O5DA 4LGXA 2JZVA 4ODKA 3B9DA 3O5OA 1E6ZA 2DSVA 1NSGA 2DT0A 1JNTA 1EYMA 4W9OA 4N19A 4HBEA 4JFMA 4WKHA 3KZ7A 1NWRA 1NWSA 4MNKA 1FKRA 4DWSD 2XP5A 4IQCA 2ZQTA 2OLHA 1FKGA 3CGMA 2RUQA 2VCDA 2YSFA 2A3CA 1EG4A 5GQBA 2MLZA 1JMQA 4DH0A 3KAGA 4XAKA 3IKDA 4NZCA 3JYJA 2OWOA 4DZ2A 2RUCA 1I5HW 1EIBA 1FKLA 4MPKA 2DG4A 1FKTA 3WD4A 4TW7A 1FKIA 2PV2A 1A7XA 3O5JA 5U47A 3BMBA 4IT6A 2ESCA 2Y78A 3AS0A 1FFRA 1NH6A 1OWQA 4NSBA 3WIJA 1WB0A 1C9HA 2WAEA 3O5QA 5HTGA 1QPLA 1SR0A 3WD3A 3CH9A 3O5FA 3AS1A 4LAYA 3KCEA 2KXQA 3GPKA 2WLYA 2YSBA 4P8VA 4ODOA 4MTVA 4DRQA 1ZB5A 2RSEA 3GTYX 2L4JA 3UQIA 2KGJA 2A3BA 1GOIA 1NMVA 2KO7A 3PQHA 3WKZA 1ZBWA 2YSHA 1VF8A 4GGQA 1FKJA 4P8UA 2YSIA 5HT1A 5D75A 1K9QA 2JX8A 4TW8A 3CHFA 2RQSA 2PI6A 4WIWA 2YBUA 4W9QA 3L4HA 2ZQSA 3RM9A 3ARPA 3OOBA 1R9HA 3O5LA 2QRVA 2AWGA 3LKXA 4JFKA 1ZBVA 3O5PA 2A3AA 3MDYB 4JFLA 2M8JA 1LJYA 2FKEA 2PV1A 5E5WA 2XPAA 2B31A 2ZR4A 5GPGA 4Q22A 1J4RA 1E6NA 5J6EA 2M08A 4Z2HA 2DSUA 1D7HA 4GLXA 2DG3A 1ROUA 4FN2A 2XP4A 3ALFA 3ARVA 2RURA 4Z2LA 5HW7A 4WK9A 1W9PA 2YAJB 2XP7A 3UI4A 4G50A 4MNJA 2ZR5A 2F21A 2VN1A 2EULA 2PBCA 1W1PA 2PPOA 3RM4A 4DRPA 2M3OW 2JV4A 4U85A 1JNDA 4TX0A 1W26A 1LL4A 2DK7A 3UI5A 1TFVA 1K9RA 2ZQVA 3PRDA 1Q6IA 3B9AA 5HUAA 3BXWA 1PBKA 2WM0A 2ZQUA 4Z2IA 2F4EA 1NWTA 4ODQA 3EY6A 2EZ5W 2XP8A 4ZPWR 3W4RA 3MCBB 1ZU8A 3WQVA 2WK2A 3LUOA 3KADA 2LPVA 3TC5A 4BF8A 2MDIA 3O5IA 3M7NA 3KABA 3KACA 1QPFA 3WH0A 3FS8A 1ZL1A 5E62A 2DT2A 2M1IA 4ODNA 1D6OA 4TYOA 2OFNA 4U86A 2UZ5A 3ARRA 5HKGA 1E15A 2PN0A 4R5EA 2MLXA 2MNTA 4DRMA 1FKFA 2KI3A 1OGGA 1XHGA 1CTNA 2DJYA 1WAWA 2JXWA 4QT3A 3LE4A 1ZBKA 4JFIA 1EG3A 2PPPA 1FKDA 1FKHA 2KE0A 2A3EA 4KQZA 3KAHA 2M8IA 1JVWA 4W9PA 1H0IA 5DF0A 4L3NA 4J4OA 1J4HA 1X6NA 5E65A 1JNEA 1YATA 4IQ2A 4MGVA 4R0XA 2DSZA 3UQAA 1RD6A 2LAJA 3ARTA 4LAVA 1W1YA 2XP9A 3IK8A 2IF4A 1OGBA 3QOKA 2Q5AA 3NTPA 1FFQA 1W9VA 2DPEA 1W1TA 1EHNA 2MF9A 3IHZA 1KT0A 4MNMA 4MNLA 1O6WA 3WL0A 1H0GA 4DRJA 5E64A 4NNRA 1N1AA 3ARWA 3O5MA 3RFWA 2LKNA 2IUZA 1LQ0A 2G8ZA 3LKXB 2WADA 2AOSA 4Z2JA 5BXJA 1LG2A 4DT4A 1M5YA 4FAPA 1X6LA 2M2AA 2ZAJA 3PA7A 2F23A 2JMFA 3O5KA 3EIPA 3RMEA 4HARA 1W9UA 3WL1A 4DRKA 2PV3A 4WKAA 1U79A 1P5QA 3PRAA 4ITZA 1D2KA 1FLCA 2FAPA 4L72B 4DRHA 1F8AB 1ROTA 4A0TA 2ZR6A 3I6CA 3UF8A 4DROA 4DWSC 3GU0A 1WMVA 3AS2A 4O2TA 1L1PA 1JNSA 2XP3A 1SYTA 4REXA 3RM8A 1HKIA 2RUDA 2O9OA 3AS3A 2PPNA 1J4IA 4WKFA 2L2SA 5DIVA 3ODKA 3CHDA 1B6CA 3PRBA 4QZVB 4P8WA 1PINA 2DT1A 3AQUA 1GUVA 5CQ2A 1W1VA 3B8SA 1J6YA 1YW5A 2E45A 5E66A 5HW6A 1UR9A 2YBTA 1E9LA 4ODRA 1BKFA 3FSCA 2LJ4A 4Q7NA 4ODMA 1O6IA 1Q6UA 2G41A 4URIA 4DRIA 1FKSA 4P8XA 2BA1A 1HJXA 2B5UB 1TK7A 1T11A 1FAPA 3WQWA 2DSWA 1HKMA 4HBOA 3H9RB 5HW8A 2WLZA 1GPFA 1E44A 3CGNA 3G6LA 4ML4A 3MQGA 4WJXA 5HBFA 2DK1A 1ZCNA 5DO2A 3WD1A 3O5RA 1Q6HA 4DRNA 5HWBA 4ZS6A 1TR8A 4TNSA 4IT4A 2P4VA 1K9TA 4MSPA 5DEZA 4ODPA 5I98A 1TCOC 2K8IA
chains in the Genus database with same CATH topology
4U84A 3CNGA 3KAFA 1ITXA 4ZPVR 1LG1A 4QIBA 3FAPA 2F2DA 4J4NA 4JYSA 4DZ3A 3FY1A 5DITA 1F40A 1RP5A 3B9EA 1Y0OA 2Y8NB 4LAWA 1IX5A 1ZK6A 4DWSB 4DIPA 3CZ8A 4Z2KA 4DWSA 1ZBCA 3KAIA 3ALGA 5B8IC 3IKGA 4LAXA 1Q1CA 1EQ3A 1E6PA 2YSGA 3ARSA 1UR8A 3CHCA 5JH8A 3TDBA 4S3KA 1D7IA 3CHEA 3M85A 1KFWA 1FJDA 3ARYA 4MAVA 3WD2A 2XPBA 3FXYA 1HKJA 3NI6A 1WNOA 2RE3A 2N87A 2DMVA 2FDMA 4G2PA 4S3JA 1E6RA 2KFWA 4JFJA 4TW6A 3RGCA 1LL6A 5AHTA 3ARXA 5GPRA 2MPHA 1XRVA 3G6MA 4C02B 3B7XA 1NWUA 4E5RA 3AROA 5DIUA 1D7JA 3NRKA 2O92A 2MLYA 1FKKA 2QF8A 1BL4A 2LGOA 1KT1A 3UQBA 3UI6A 4W5UA 1EDQA 3VAWA 1LL7A 2D9FA 2ITKA 3FSBA 3ARUA 4AY1A 1FD9A 4ODLA 2DG9A 1HXVA 3TCZA 1QZ2A 2XP6A 1FKBA 4GIVA 3WD0A 3MQHA 1WR7A 3O5GA 4IPXA 2DWVA 3PR9A 1HJWA 4Z2GA 1HKKA 3OA5A 4KR0B 4A0UA 3ARZA 3JYMA 3ARQA 4QT2A 1NMWA 3O5EA 5HWCA 1HJVA 4ZPTR 2DT3A 2KR7A 4PTMA 3JXVA 3MCBA 3O5DA 4LGXA 2JZVA 4ODKA 3B9DA 3O5OA 1E6ZA 2DSVA 1NSGA 2DT0A 1JNTA 1EYMA 4W9OA 4N19A 4HBEA 4JFMA 4WKHA 3KZ7A 1NWRA 1NWSA 4MNKA 1FKRA 4DWSD 2XP5A 4IQCA 2ZQTA 2OLHA 1FKGA 3CGMA 2RUQA 2VCDA 2YSFA 2A3CA 1EG4A 5GQBA 2MLZA 1JMQA 4DH0A 3KAGA 4XAKA 3IKDA 4NZCA 3JYJA 2OWOA 4DZ2A 2RUCA 1I5HW 1EIBA 1FKLA 4MPKA 2DG4A 1FKTA 3WD4A 4TW7A 1FKIA 2PV2A 1A7XA 3O5JA 5U47A 4IT6A 2ESCA 2Y78A 3AS0A 1FFRA 1NH6A 1OWQA 4NSBA 3WIJA 1WB0A 1C9HA 2WAEA 3O5QA 5HTGA 1QPLA 1SR0A 3WD3A 3CH9A 3O5FA 3AS1A 4LAYA 3KCEA 2KXQA 3GPKA 2WLYA 2YSBA 4P8VA 4ODOA 4MTVA 4DRQA 1ZB5A 2RSEA 2L4JA 3UQIA 2KGJA 2A3BA 1GOIA 1NMVA 2KO7A 3PQHA 3WKZA 1ZBWA 2YSHA 1VF8A 4GGQA 1FKJA 4P8UA 2YSIA 5HT1A 5D75A 1K9QA 2JX8A 4TW8A 3CHFA 2RQSA 2PI6A 4WIWA 2YBUA 4W9QA 3L4HA 2ZQSA 3RM9A 3ARPA 3OOBA 1R9HA 3O5LA 2QRVA 2AWGA 3LKXA 4JFKA 1ZBVA 3O5PA 2A3AA 3MDYB 4JFLA 2M8JA 1LJYA 2FKEA 2PV1A 5E5WA 2XPAA 2B31A 2ZR4A 5GPGA 4Q22A 1J4RA 1E6NA 5J6EA 2M08A 4Z2HA 2DSUA 1D7HA 4GLXA 2DG3A 1ROUA 4FN2A 2XP4A 3ALFA 3ARVA 2RURA 4Z2LA 5HW7A 4WK9A 1W9PA 2YAJB 2XP7A 3UI4A 4G50A 4MNJA 2ZR5A 2F21A 2VN1A 2PBCA 1W1PA 2PPOA 3RM4A 4DRPA 2M3OW 2JV4A 4U85A 1JNDA 4TX0A 1W26A 1LL4A 2DK7A 3UI5A 1TFVA 1K9RA 2ZQVA 3PRDA 1Q6IA 3B9AA 5HUAA 3BXWA 1PBKA 2WM0A 2ZQUA 4Z2IA 2F4EA 1NWTA 4ODQA 3EY6A 2EZ5W 2XP8A 4ZPWR 3W4RA 3MCBB 1ZU8A 3WQVA 2WK2A 3LUOA 3KADA 2LPVA 3TC5A 4BF8A 2MDIA 3O5IA 3M7NA 3KABA 3KACA 1QPFA 3WH0A 3FS8A 1ZL1A 5E62A 2DT2A 2M1IA 4ODNA 1D6OA 4TYOA 2OFNA 4U86A 2UZ5A 3ARRA 5HKGA 1E15A 4R5EA 2MLXA 2MNTA 4DRMA 1FKFA 2KI3A 1OGGA 1XHGA 1CTNA 2DJYA 1WAWA 2JXWA 4QT3A 3LE4A 1ZBKA 4JFIA 1EG3A 2PPPA 1FKDA 1FKHA 2KE0A 2A3EA 4KQZA 3KAHA 2M8IA 1JVWA 4W9PA 1H0IA 5DF0A 4L3NA 4J4OA 1J4HA 1X6NA 5E65A 1JNEA 1YATA 4IQ2A 4MGVA 4R0XA 2DSZA 3UQAA 1RD6A 2LAJA 3ARTA 4LAVA 1W1YA 2XP9A 3IK8A 2IF4A 1OGBA 3QOKA 2Q5AA 3NTPA 1FFQA 1W9VA 2DPEA 1W1TA 1EHNA 2MF9A 3IHZA 1KT0A 4MNMA 4MNLA 1O6WA 3WL0A 1H0GA 4DRJA 5E64A 4NNRA 1N1AA 3ARWA 3O5MA 3RFWA 2LKNA 2IUZA 1LQ0A 2G8ZA 3LKXB 2WADA 2AOSA 4Z2JA 5BXJA 1LG2A 4DT4A 1M5YA 4FAPA 1X6LA 2M2AA 2ZAJA 3PA7A 3RMEA 2JMFA 3O5KA 4HARA 1W9UA 3WL1A 4DRKA 2PV3A 4WKAA 1U79A 1P5QA 3PRAA 4ITZA 1D2KA 1FLCA 2FAPA 4L72B 4DRHA 1F8AB 1ROTA 4A0TA 2ZR6A 3I6CA 3UF8A 4DROA 4DWSC 1WMVA 3AS2A 4O2TA 1L1PA 1JNSA 2XP3A 1SYTA 4REXA 3RM8A 1HKIA 2RUDA 2O9OA 3AS3A 2PPNA 1J4IA 4WKFA 2L2SA 5DIVA 3ODKA 3CHDA 1B6CA 3PRBA 4QZVB 4P8WA 1PINA 2DT1A 3AQUA 1GUVA 5CQ2A 1W1VA 3B8SA 1J6YA 1YW5A 2E45A 5E66A 5HW6A 1UR9A 2YBTA 1E9LA 4ODRA 1BKFA 3FSCA 2LJ4A 4Q7NA 4ODMA 1O6IA 1Q6UA 2G41A 4URIA 4DRIA 1FKSA 4P8XA 2BA1A 1HJXA 1TK7A 1T11A 1FAPA 3WQWA 2DSWA 1HKMA 4HBOA 3H9RB 5HW8A 2WLZA 1GPFA 3CGNA 3G6LA 4ML4A 3MQGA 4WJXA 5HBFA 2DK1A 1ZCNA 5DO2A 3WD1A 3O5RA 1Q6HA 4DRNA 5HWBA 4ZS6A 1TR8A 4TNSA 4IT4A 1K9TA 4MSPA 5DEZA 4ODPA 5I98A 1TCOC 2K8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U84 A;  3CNG A;  3KAF A;  4QIB A;  3FAP A;  2F2D A;  4J4N A;  4JYS A;  4DZ3 A;  5DIT A;  1F40 A;  1Y0O A;  4LAW A;  1ZK6 A;  4DIP A;  3KAI A;  5B8I C;  3IKG A;  4LAX A;  1Q1C A;  1EQ3 A;  2YSG A;  3TDB A;  1D7I A;  3M85 A;  1FJD A;  2XPB A;  3NI6 A;  2RE3 A;  2N87 A;  2DMV A;  4G2P A;  2KFW A;  4JFJ A;  4TW6 A;  3RGC A;  5AHT A;  2MPH A;  4C02 B;  3B7X A;  4E5R A;  5DIU A;  1D7J A;  3NRK A;  2MLY A;  1FKK A;  1BL4 A;  2LGO A;  1KT1 A;  3UQB A;  3UI6 A;  3VAW A;  2D9F A;  2ITK A;  1FD9 A;  4ODL A;  2DG9 A;  1HXV A;  3TCZ A;  1QZ2 A;  2XP6 A;  1FKB A;  4GIV A;  1WR7 A;  3O5G A;  4IPX A;  2DWV A;  3JYM A;  4QT2 A;  1NMW A;  3O5E A;  5HWC A;  2KR7 A;  3JXV A;  3O5D A;  2JZV A;  4ODK A;  3O5O A;  1NSG A;  1JNT A;  1EYM A;  4W9O A;  4N19 A;  4JFM A;  3KZ7 A;  1FKR A;  2XP5 A;  4IQC A;  2ZQT A;  1FKG A;  3CGM A;  2RUQ A;  2VCD A;  2YSF A;  1EG4 A;  2MLZ A;  1JMQ A;  4DH0 A;  3KAG A;  3IKD A;  3JYJ A;  4DZ2 A;  2RUC A;  1I5H W;  1FKL A;  2DG4 A;  1FKT A;  4TW7 A;  1FKI A;  2PV2 A;  1A7X A;  3O5J A;  2Y78 A;  1C9H A;  3O5Q A;  5HTG A;  1QPL A;  3O5F A;  4LAY A;  3KCE A;  2KXQ A;  3GPK A;  2YSB A;  4ODO A;  4DRQ A;  2RSE A;  2L4J A;  3UQI A;  2KGJ A;  1NMV A;  2KO7 A;  2YSH A;  4GGQ A;  1FKJ A;  2YSI A;  5HT1 A;  5D75 A;  1K9Q A;  2JX8 A;  4TW8 A;  2RQS A;  4W9Q A;  3L4H A;  2ZQS A;  3OOB A;  1R9H A;  3O5L A;  2AWG A;  4JFK A;  3O5P A;  4JFL A;  3MDY B;  2M8J A;  2FKE A;  2PV1 A;  2XPA A;  5GPG A;  2ZR4 A;  1J4R A;  5J6E A;  2M08 A;  1D7H A;  2DG3 A;  1ROU A;  4FN2 A;  2XP4 A;  5HW7 A;  2RUR A;  2XP7 A;  3UI4 A;  4G50 A;  2ZR5 A;  2F21 A;  2VN1 A;  2PBC A;  2PPO A;  4DRP A;  2M3O W;  2JV4 A;  4U85 A;  4TX0 A;  1W26 A;  2DK7 A;  3UI5 A;  1K9R A;  2ZQV A;  3PRD A;  1Q6I A;  5HUA A;  1PBK A;  2ZQU A;  2F4E A;  4ODQ A;  3EY6 A;  2EZ5 W;  2XP8 A;  3LUO A;  3KAD A;  2LPV A;  3TC5 A;  4BF8 A;  2MDI A;  3O5I A;  3M7N A;  3KAB A;  3KAC A;  1QPF A;  3WH0 A;  2M1I A;  4ODN A;  1D6O A;  4TYO A;  2OFN A;  4U86 A;  2UZ5 A;  5HKG A;  2MLX A;  2MNT A;  4DRM A;  1FKF A;  2KI3 A;  2DJY A;  2JXW A;  4QT3 A;  3LE4 A;  4JFI A;  1EG3 A;  2PPP A;  1FKD A;  1FKH A;  2KE0 A;  3KAH A;  2M8I A;  1JVW A;  4W9P A;  4J4O A;  1J4H A;  1YAT A;  4IQ2 A;  4MGV A;  4R0X A;  3UQA A;  2LAJ A;  4LAV A;  2XP9 A;  3IK8 A;  2IF4 A;  2Q5A A;  3NTP A;  2MF9 A;  3IHZ A;  1KT0 A;  1O6W A;  4DRJ A;  4NNR A;  1N1A A;  3O5M A;  3RFW A;  2LKN A;  5BXJ A;  4DT4 A;  1M5Y A;  4FAP A;  3PA7 A;  2M2A A;  2ZAJ A;  2JMF A;  3O5K A;  4DRK A;  2PV3 A;  1U79 A;  1P5Q A;  4ITZ A;  2FAP A;  4DRH A;  1F8A B;  1ROT A;  3I6C A;  2ZR6 A;  3UF8 A;  4DRO A;  1WMV A;  4O2T A;  1L1P A;  1JNS A;  2XP3 A;  4REX A;  2RUD A;  2PPN A;  1J4I A;  2L2S A;  5DIV A;  3ODK A;  1B6C A;  3PRB A;  1PIN A;  5CQ2 A;  1J6Y A;  1YW5 A;  2E45 A;  5HW6 A;  4ODR A;  1BKF A;  2LJ4 A;  4ODM A;  1Q6U A;  4DRI A;  1FKS A;  2BA1 A;  1TK7 A;  1T11 A;  1FAP A;  3H9R B;  5HW8 A;  3CGN A;  2DK1 A;  1ZCN A;  3O5R A;  1Q6H A;  4DRN A;  5HWB A;  4TNS A;  4MSP A;  4ODP A;  5I98 A;  1TCO C;  2K8I A; 
#chains in the Genus database with same CATH topology
 4U84 A;  3CNG A;  3KAF A;  1ITX A;  4ZPV R;  1LG1 A;  4QIB A;  3FAP A;  1JCH B;  2F2D A;  4J4N A;  4JYS A;  4DZ3 A;  3FY1 A;  5DIT A;  1F40 A;  1RP5 A;  3B9E A;  1Y0O A;  2Y8N B;  4LAW A;  1IX5 A;  1ZK6 A;  4DWS B;  4DIP A;  3CZ8 A;  4Z2K A;  4DWS A;  1ZBC A;  3KAI A;  3ALG A;  5B8I C;  3IKG A;  4LAX A;  1Q1C A;  1EQ3 A;  1E6P A;  2YSG A;  3ARS A;  1UR8 A;  3CHC A;  5JH8 A;  3TDB A;  4S3K A;  1D7I A;  3CHE A;  3M85 A;  1KFW A;  1FJD A;  3ARY A;  4MAV A;  3WD2 A;  2XPB A;  3FXY A;  1HKJ A;  3NI6 A;  1WNO A;  2RE3 A;  2N87 A;  2DMV A;  2FDM A;  4G2P A;  4S3J A;  1E6R A;  2KFW A;  4JFJ A;  4UDM A;  4TW6 A;  3RGC A;  1LL6 A;  5AHT A;  3ARX A;  5GPR A;  2MPH A;  1XRV A;  3G6M A;  4C02 B;  3B7X A;  1NWU A;  4E5R A;  3ARO A;  5DIU A;  1D7J A;  3NRK A;  2O92 A;  2MLY A;  1FKK A;  2QF8 A;  1BL4 A;  2LGO A;  1KT1 A;  3UQB A;  3UI6 A;  4W5U A;  1EDQ A;  3VAW A;  1LL7 A;  2D9F A;  2ITK A;  3FSB A;  3ARU A;  4AY1 A;  1FD9 A;  4ODL A;  2DG9 A;  2ETN A;  1HXV A;  3TCZ A;  1QZ2 A;  2XP6 A;  1FKB A;  4GIV A;  3WD0 A;  3MQH A;  1WR7 A;  3O5G A;  4IPX A;  2DWV A;  3PR9 A;  1HJW A;  4Z2G A;  1HKK A;  3OA5 A;  4KR0 B;  4A0U A;  3ARZ A;  3JYM A;  1GRJ A;  3ARQ A;  4QT2 A;  1NMW A;  3O5E A;  5HWC A;  1HJV A;  4ZPT R;  2DT3 A;  2KR7 A;  4PTM A;  3JXV A;  3MCB A;  3O5D A;  4LGX A;  2JZV A;  4ODK A;  3B9D A;  3O5O A;  1E6Z A;  2DSV A;  1NSG A;  2DT0 A;  1JNT A;  1EYM A;  4W9O A;  4N19 A;  4HBE A;  4JFM A;  4WKH A;  3KZ7 A;  1NWR A;  1NWS A;  4MNK A;  1FKR A;  4DWS D;  2XP5 A;  4IQC A;  2ZQT A;  2OLH A;  1FKG A;  3CGM A;  2RUQ A;  2VCD A;  2YSF A;  2A3C A;  1EG4 A;  5GQB A;  2MLZ A;  1JMQ A;  4DH0 A;  3KAG A;  4XAK A;  3IKD A;  4NZC A;  3JYJ A;  2OWO A;  4DZ2 A;  2RUC A;  1I5H W;  1EIB A;  1FKL A;  4MPK A;  2DG4 A;  1FKT A;  3WD4 A;  4TW7 A;  1FKI A;  2PV2 A;  1A7X A;  3O5J A;  5U47 A;  3BMB A;  4IT6 A;  2ESC A;  2Y78 A;  3AS0 A;  1FFR A;  1NH6 A;  1OWQ A;  4NSB A;  3WIJ A;  1WB0 A;  1C9H A;  2WAE A;  3O5Q A;  5HTG A;  1QPL A;  1SR0 A;  3WD3 A;  3CH9 A;  3O5F A;  3AS1 A;  4LAY A;  3KCE A;  2KXQ A;  3GPK A;  2WLY A;  2YSB A;  4P8V A;  4ODO A;  4MTV A;  4DRQ A;  1ZB5 A;  2RSE A;  3GTY X;  2L4J A;  3UQI A;  2KGJ A;  2A3B A;  1GOI A;  1NMV A;  2KO7 A;  3PQH A;  3WKZ A;  1ZBW A;  2YSH A;  1VF8 A;  4GGQ A;  1FKJ A;  4P8U A;  2YSI A;  5HT1 A;  5D75 A;  1K9Q A;  2JX8 A;  4TW8 A;  3CHF A;  2RQS A;  2PI6 A;  4WIW A;  2YBU A;  4W9Q A;  3L4H A;  2ZQS A;  3RM9 A;  3ARP A;  3OOB A;  1R9H A;  3O5L A;  2QRV A;  2AWG A;  3LKX A;  4JFK A;  1ZBV A;  3O5P A;  2A3A A;  3MDY B;  4JFL A;  2M8J A;  1LJY A;  2FKE A;  2PV1 A;  5E5W A;  2XPA A;  2B31 A;  2ZR4 A;  5GPG A;  4Q22 A;  1J4R A;  1E6N A;  5J6E A;  2M08 A;  4Z2H A;  2DSU A;  1D7H A;  4GLX A;  2DG3 A;  1ROU A;  4FN2 A;  2XP4 A;  3ALF A;  3ARV A;  2RUR A;  4Z2L A;  5HW7 A;  4WK9 A;  1W9P A;  2YAJ B;  2XP7 A;  3UI4 A;  4G50 A;  4MNJ A;  2ZR5 A;  2F21 A;  2VN1 A;  2EUL A;  2PBC A;  1W1P A;  2PPO A;  3RM4 A;  4DRP A;  2M3O W;  2JV4 A;  4U85 A;  1JND A;  4TX0 A;  1W26 A;  1LL4 A;  2DK7 A;  3UI5 A;  1TFV A;  1K9R A;  2ZQV A;  3PRD A;  1Q6I A;  3B9A A;  5HUA A;  3BXW A;  1PBK A;  2WM0 A;  2ZQU A;  4Z2I A;  2F4E A;  1NWT A;  4ODQ A;  3EY6 A;  2EZ5 W;  2XP8 A;  4ZPW R;  3W4R A;  3MCB B;  1ZU8 A;  3WQV A;  2WK2 A;  3LUO A;  3KAD A;  2LPV A;  3TC5 A;  4BF8 A;  2MDI A;  3O5I A;  3M7N A;  3KAB A;  3KAC A;  1QPF A;  3WH0 A;  3FS8 A;  1ZL1 A;  5E62 A;  2DT2 A;  2M1I A;  4ODN A;  1D6O A;  4TYO A;  2OFN A;  4U86 A;  2UZ5 A;  3ARR A;  5HKG A;  1E15 A;  2PN0 A;  4R5E A;  2MLX A;  2MNT A;  4DRM A;  1FKF A;  2KI3 A;  1OGG A;  1XHG A;  1CTN A;  2DJY A;  1WAW A;  2JXW A;  4QT3 A;  3LE4 A;  1ZBK A;  4JFI A;  1EG3 A;  2PPP A;  1FKD A;  1FKH A;  2KE0 A;  2A3E A;  4KQZ A;  3KAH A;  2M8I A;  1JVW A;  4W9P A;  1H0I A;  5DF0 A;  4L3N A;  4J4O A;  1J4H A;  1X6N A;  5E65 A;  1JNE A;  1YAT A;  4IQ2 A;  4MGV A;  4R0X A;  2DSZ A;  3UQA A;  1RD6 A;  2LAJ A;  3ART A;  4LAV A;  1W1Y A;  2XP9 A;  3IK8 A;  2IF4 A;  1OGB A;  3QOK A;  2Q5A A;  3NTP A;  1FFQ A;  1W9V A;  2DPE A;  1W1T A;  1EHN A;  2MF9 A;  3IHZ A;  1KT0 A;  4MNM A;  4MNL A;  1O6W A;  3WL0 A;  1H0G A;  4DRJ A;  5E64 A;  4NNR A;  1N1A A;  3ARW A;  3O5M A;  3RFW A;  2LKN A;  2IUZ A;  1LQ0 A;  2G8Z A;  3LKX B;  2WAD A;  2AOS A;  4Z2J A;  5BXJ A;  1LG2 A;  4DT4 A;  1M5Y A;  4FAP A;  1X6L A;  2M2A A;  2ZAJ A;  3PA7 A;  2F23 A;  2JMF A;  3O5K A;  3EIP A;  3RME A;  4HAR A;  1W9U A;  3WL1 A;  4DRK A;  2PV3 A;  4WKA A;  1U79 A;  1P5Q A;  3PRA A;  4ITZ A;  1D2K A;  1FLC A;  2FAP A;  4L72 B;  4DRH A;  1F8A B;  1ROT A;  4A0T A;  2ZR6 A;  3I6C A;  3UF8 A;  4DRO A;  4DWS C;  3GU0 A;  1WMV A;  3AS2 A;  4O2T A;  1L1P A;  1JNS A;  2XP3 A;  1SYT A;  4REX A;  3RM8 A;  1HKI A;  2RUD A;  2O9O A;  3AS3 A;  2PPN A;  1J4I A;  4WKF A;  2L2S A;  5DIV A;  3ODK A;  3CHD A;  1B6C A;  3PRB A;  4QZV B;  4P8W A;  1PIN A;  2DT1 A;  3AQU A;  1GUV A;  5CQ2 A;  1W1V A;  3B8S A;  1J6Y A;  1YW5 A;  2E45 A;  5E66 A;  5HW6 A;  1UR9 A;  2YBT A;  1E9L A;  4ODR A;  1BKF A;  3FSC A;  2LJ4 A;  4Q7N A;  4ODM A;  1O6I A;  1Q6U A;  2G41 A;  4URI A;  4DRI A;  1FKS A;  4P8X A;  2BA1 A;  1HJX A;  2B5U B;  1TK7 A;  1T11 A;  1FAP A;  3WQW A;  2DSW A;  1HKM A;  4HBO A;  3H9R B;  5HW8 A;  2WLZ A;  1GPF A;  1E44 A;  3CGN A;  3G6L A;  4ML4 A;  3MQG A;  4WJX A;  5HBF A;  2DK1 A;  1ZCN A;  5DO2 A;  3WD1 A;  3O5R A;  1Q6H A;  4DRN A;  5HWB A;  4ZS6 A;  1TR8 A;  4TNS A;  4IT4 A;  2P4V A;  1K9T A;  4MSP A;  5DEZ A;  4ODP A;  5I98 A;  1TCO C;  2K8I A; 
#chains in the Genus database with same CATH homology
 4U84 A;  3CNG A;  3KAF A;  1ITX A;  4ZPV R;  1LG1 A;  4QIB A;  3FAP A;  2F2D A;  4J4N A;  4JYS A;  4DZ3 A;  3FY1 A;  5DIT A;  1F40 A;  1RP5 A;  3B9E A;  1Y0O A;  2Y8N B;  4LAW A;  1IX5 A;  1ZK6 A;  4DWS B;  4DIP A;  3CZ8 A;  4Z2K A;  4DWS A;  1ZBC A;  3KAI A;  3ALG A;  5B8I C;  3IKG A;  4LAX A;  1Q1C A;  1EQ3 A;  1E6P A;  2YSG A;  3ARS A;  1UR8 A;  3CHC A;  5JH8 A;  3TDB A;  4S3K A;  1D7I A;  3CHE A;  3M85 A;  1KFW A;  1FJD A;  3ARY A;  4MAV A;  3WD2 A;  2XPB A;  3FXY A;  1HKJ A;  3NI6 A;  1WNO A;  2RE3 A;  2N87 A;  2DMV A;  2FDM A;  4G2P A;  4S3J A;  1E6R A;  2KFW A;  4JFJ A;  4TW6 A;  3RGC A;  1LL6 A;  5AHT A;  3ARX A;  5GPR A;  2MPH A;  1XRV A;  3G6M A;  4C02 B;  3B7X A;  1NWU A;  4E5R A;  3ARO A;  5DIU A;  1D7J A;  3NRK A;  2O92 A;  2MLY A;  1FKK A;  2QF8 A;  1BL4 A;  2LGO A;  1KT1 A;  3UQB A;  3UI6 A;  4W5U A;  1EDQ A;  3VAW A;  1LL7 A;  2D9F A;  2ITK A;  3FSB A;  3ARU A;  4AY1 A;  1FD9 A;  4ODL A;  2DG9 A;  1HXV A;  3TCZ A;  1QZ2 A;  2XP6 A;  1FKB A;  4GIV A;  3WD0 A;  3MQH A;  1WR7 A;  3O5G A;  4IPX A;  2DWV A;  3PR9 A;  1HJW A;  4Z2G A;  1HKK A;  3OA5 A;  4KR0 B;  4A0U A;  3ARZ A;  3JYM A;  3ARQ A;  4QT2 A;  1NMW A;  3O5E A;  5HWC A;  1HJV A;  4ZPT R;  2DT3 A;  2KR7 A;  4PTM A;  3JXV A;  3MCB A;  3O5D A;  4LGX A;  2JZV A;  4ODK A;  3B9D A;  3O5O A;  1E6Z A;  2DSV A;  1NSG A;  2DT0 A;  1JNT A;  1EYM A;  4W9O A;  4N19 A;  4HBE A;  4JFM A;  4WKH A;  3KZ7 A;  1NWR A;  1NWS A;  4MNK A;  1FKR A;  4DWS D;  2XP5 A;  4IQC A;  2ZQT A;  2OLH A;  1FKG A;  3CGM A;  2RUQ A;  2VCD A;  2YSF A;  2A3C A;  1EG4 A;  5GQB A;  2MLZ A;  1JMQ A;  4DH0 A;  3KAG A;  4XAK A;  3IKD A;  4NZC A;  3JYJ A;  2OWO A;  4DZ2 A;  2RUC A;  1I5H W;  1EIB A;  1FKL A;  4MPK A;  2DG4 A;  1FKT A;  3WD4 A;  4TW7 A;  1FKI A;  2PV2 A;  1A7X A;  3O5J A;  5U47 A;  4IT6 A;  2ESC A;  2Y78 A;  3AS0 A;  1FFR A;  1NH6 A;  1OWQ A;  4NSB A;  3WIJ A;  1WB0 A;  1C9H A;  2WAE A;  3O5Q A;  5HTG A;  1QPL A;  1SR0 A;  3WD3 A;  3CH9 A;  3O5F A;  3AS1 A;  4LAY A;  3KCE A;  2KXQ A;  3GPK A;  2WLY A;  2YSB A;  4P8V A;  4ODO A;  4MTV A;  4DRQ A;  1ZB5 A;  2RSE A;  2L4J A;  3UQI A;  2KGJ A;  2A3B A;  1GOI A;  1NMV A;  2KO7 A;  3PQH A;  3WKZ A;  1ZBW A;  2YSH A;  1VF8 A;  4GGQ A;  1FKJ A;  4P8U A;  2YSI A;  5HT1 A;  5D75 A;  1K9Q A;  2JX8 A;  4TW8 A;  3CHF A;  2RQS A;  2PI6 A;  4WIW A;  2YBU A;  4W9Q A;  3L4H A;  2ZQS A;  3RM9 A;  3ARP A;  3OOB A;  1R9H A;  3O5L A;  2QRV A;  2AWG A;  3LKX A;  4JFK A;  1ZBV A;  3O5P A;  2A3A A;  3MDY B;  4JFL A;  2M8J A;  1LJY A;  2FKE A;  2PV1 A;  5E5W A;  2XPA A;  2B31 A;  2ZR4 A;  5GPG A;  4Q22 A;  1J4R A;  1E6N A;  5J6E A;  2M08 A;  4Z2H A;  2DSU A;  1D7H A;  4GLX A;  2DG3 A;  1ROU A;  4FN2 A;  2XP4 A;  3ALF A;  3ARV A;  2RUR A;  4Z2L A;  5HW7 A;  4WK9 A;  1W9P A;  2YAJ B;  2XP7 A;  3UI4 A;  4G50 A;  4MNJ A;  2ZR5 A;  2F21 A;  2VN1 A;  2PBC A;  1W1P A;  2PPO A;  3RM4 A;  4DRP A;  2M3O W;  2JV4 A;  4U85 A;  1JND A;  4TX0 A;  1W26 A;  1LL4 A;  2DK7 A;  3UI5 A;  1TFV A;  1K9R A;  2ZQV A;  3PRD A;  1Q6I A;  3B9A A;  5HUA A;  3BXW A;  1PBK A;  2WM0 A;  2ZQU A;  4Z2I A;  2F4E A;  1NWT A;  4ODQ A;  3EY6 A;  2EZ5 W;  2XP8 A;  4ZPW R;  3W4R A;  3MCB B;  1ZU8 A;  3WQV A;  2WK2 A;  3LUO A;  3KAD A;  2LPV A;  3TC5 A;  4BF8 A;  2MDI A;  3O5I A;  3M7N A;  3KAB A;  3KAC A;  1QPF A;  3WH0 A;  3FS8 A;  1ZL1 A;  5E62 A;  2DT2 A;  2M1I A;  4ODN A;  1D6O A;  4TYO A;  2OFN A;  4U86 A;  2UZ5 A;  3ARR A;  5HKG A;  1E15 A;  4R5E A;  2MLX A;  2MNT A;  4DRM A;  1FKF A;  2KI3 A;  1OGG A;  1XHG A;  1CTN A;  2DJY A;  1WAW A;  2JXW A;  4QT3 A;  3LE4 A;  1ZBK A;  4JFI A;  1EG3 A;  2PPP A;  1FKD A;  1FKH A;  2KE0 A;  2A3E A;  4KQZ A;  3KAH A;  2M8I A;  1JVW A;  4W9P A;  1H0I A;  5DF0 A;  4L3N A;  4J4O A;  1J4H A;  1X6N A;  5E65 A;  1JNE A;  1YAT A;  4IQ2 A;  4MGV A;  4R0X A;  2DSZ A;  3UQA A;  1RD6 A;  2LAJ A;  3ART A;  4LAV A;  1W1Y A;  2XP9 A;  3IK8 A;  2IF4 A;  1OGB A;  3QOK A;  2Q5A A;  3NTP A;  1FFQ A;  1W9V A;  2DPE A;  1W1T A;  1EHN A;  2MF9 A;  3IHZ A;  1KT0 A;  4MNM A;  4MNL A;  1O6W A;  3WL0 A;  1H0G A;  4DRJ A;  5E64 A;  4NNR A;  1N1A A;  3ARW A;  3O5M A;  3RFW A;  2LKN A;  2IUZ A;  1LQ0 A;  2G8Z A;  3LKX B;  2WAD A;  2AOS A;  4Z2J A;  5BXJ A;  1LG2 A;  4DT4 A;  1M5Y A;  4FAP A;  1X6L A;  2M2A A;  2ZAJ A;  3PA7 A;  3RME A;  2JMF A;  3O5K A;  4HAR A;  1W9U A;  3WL1 A;  4DRK A;  2PV3 A;  4WKA A;  1U79 A;  1P5Q A;  3PRA A;  4ITZ A;  1D2K A;  1FLC A;  2FAP A;  4L72 B;  4DRH A;  1F8A B;  1ROT A;  4A0T A;  2ZR6 A;  3I6C A;  3UF8 A;  4DRO A;  4DWS C;  1WMV A;  3AS2 A;  4O2T A;  1L1P A;  1JNS A;  2XP3 A;  1SYT A;  4REX A;  3RM8 A;  1HKI A;  2RUD A;  2O9O A;  3AS3 A;  2PPN A;  1J4I A;  4WKF A;  2L2S A;  5DIV A;  3ODK A;  3CHD A;  1B6C A;  3PRB A;  4QZV B;  4P8W A;  1PIN A;  2DT1 A;  3AQU A;  1GUV A;  5CQ2 A;  1W1V A;  3B8S A;  1J6Y A;  1YW5 A;  2E45 A;  5E66 A;  5HW6 A;  1UR9 A;  2YBT A;  1E9L A;  4ODR A;  1BKF A;  3FSC A;  2LJ4 A;  4Q7N A;  4ODM A;  1O6I A;  1Q6U A;  2G41 A;  4URI A;  4DRI A;  1FKS A;  4P8X A;  2BA1 A;  1HJX A;  1TK7 A;  1T11 A;  1FAP A;  3WQW A;  2DSW A;  1HKM A;  4HBO A;  3H9R B;  5HW8 A;  2WLZ A;  1GPF A;  3CGN A;  3G6L A;  4ML4 A;  3MQG A;  4WJX A;  5HBF A;  2DK1 A;  1ZCN A;  5DO2 A;  3WD1 A;  3O5R A;  1Q6H A;  4DRN A;  5HWB A;  4ZS6 A;  1TR8 A;  4TNS A;  4IT4 A;  1K9T A;  4MSP A;  5DEZ A;  4ODP A;  5I98 A;  1TCO C;  2K8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...