3PQHA

Crystal structure of the c-terminal fragment of the bacteriophage phi92 membrane-piercing protein gp138
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
107
structure length
107
Chain Sequence
EKVIISNNKQTYASFDPNGNISVYNTQGMKIDMTPNSIVLTDAGGGKLTLQGGTMTYKGGTVNLNGLTITPDGRMTDSGGIGLHTHTHPVRGVETGGSTVTSDKPNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords gene product 138
publication title Phage pierces the host cell membrane with the iron-loaded spike.
pubmed doi rcsb
source organism Bacteriophage phi92
molecule tags Viral protein
total genus 13
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.60 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3pqhA02
2.20.220.20 Mainly Beta Single Sheet Glycosyl hydrolase fold Glycosyl hydrolase fold 3pqhA01
3PQHA 3WITA
chains in the Genus database with same CATH superfamily
2ITKA 3CNGA 2DMVA 1WR7A 4A0UA 3M85A 2L4JA 1K9QA 2JV4A 2RE3A 2EZ5W 2ZAJA 2XP3A 3NTPA 3TC5A 1TK7A 2ZR4A 2ZQSA 2XPAA 3MQHA 2XPBA 2ZQVA 1O6WA 2GDUA 2XP7A 3TCZA 2DWVA 2ZQUA 3MCBA 1TR8A 1FLCA 2F21A 2M8IA 5C8BB 2XP6A 2ZQTA 3MCBB 2XP8A 5CQ2A 4E5RA 2M3OW 5E62A 2YSIA 3KADA 4U86A 1K9RA 3OOBA 2OWOA 3KAGA 2ZR5A 2DJYA 3KABA 5E5WA 2YSBA 2KXQA 2YSFA 2LAJA 2Y8NB 2DK7A 4QIBA 2MDIA 5AHTA 3KAFA 2WAEA 2JXWA 1WMVA 1EG3A 1PINA 2XP5A 3MQGA 1EG4A 2ZR6A 2E45A 3M7NA 2Q5AA 2YSHA 5E66A 4U84A 3PQHA 3LKXA 3FSBA 4GLXA 3FS8A 5E65A 2GDVA 3TDBA 3LKXB 3WH0A 1YW5A 5E64A 1NMVA 2WADA 3L4HA 2QRVA 3KAHA 3FSCA 2BA1A 1F8AB 2XP9A 3WITA 1ZCNA 4U85A 2XP4A 2JX8A 2YSGA 4REXA 2YAJB 1R7AA 3KAIA 2DK1A 3KCEA 3LE4A 4A0TA 3ODKA 1I5HW 5U47A 1RP5A 1JMQA 2JMFA 2M8JA
chains in the Genus database with same CATH topology
2ITKA 3CNGA 2DMVA 1WR7A 4A0UA 3M85A 2L4JA 1K9QA 2JV4A 2RE3A 2EZ5W 2ZAJA 2XP3A 3NTPA 3TC5A 1TK7A 2ZR4A 2ZQSA 2XPAA 3MQHA 2XPBA 2ZQVA 1O6WA 2XP7A 3TCZA 2DWVA 2ZQUA 3MCBA 1TR8A 1FLCA 2F21A 2M8IA 2XP6A 2ZQTA 3MCBB 2XP8A 5CQ2A 4E5RA 2M3OW 5E62A 2YSIA 3KADA 4U86A 1K9RA 3OOBA 2OWOA 3KAGA 2ZR5A 2DJYA 3KABA 5E5WA 2YSBA 2KXQA 2YSFA 2LAJA 2Y8NB 2DK7A 4QIBA 2MDIA 5AHTA 3KAFA 2WAEA 2JXWA 1WMVA 1EG3A 1PINA 2XP5A 3MQGA 1EG4A 2ZR6A 2E45A 3M7NA 2Q5AA 2YSHA 5E66A 4U84A 3PQHA 3LKXA 3FSBA 4GLXA 3FS8A 5E65A 3TDBA 3LKXB 3WH0A 1YW5A 5E64A 1NMVA 2WADA 3L4HA 2QRVA 3KAHA 3FSCA 2BA1A 1F8AB 2XP9A 3WITA 1ZCNA 4U85A 2XP4A 2JX8A 2YSGA 4REXA 2YAJB 3KAIA 2DK1A 3KCEA 3LE4A 4A0TA 3ODKA 1I5HW 5U47A 1RP5A 1JMQA 2JMFA 2M8JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PQH A;  3WIT A; 
#chains in the Genus database with same CATH topology
 2ITK A;  3CNG A;  2DMV A;  1WR7 A;  4A0U A;  3M85 A;  2L4J A;  1K9Q A;  2JV4 A;  2RE3 A;  2EZ5 W;  2ZAJ A;  2XP3 A;  3NTP A;  3TC5 A;  1TK7 A;  2ZR4 A;  2ZQS A;  2XPA A;  3MQH A;  2XPB A;  2ZQV A;  1O6W A;  2GDU A;  2XP7 A;  3TCZ A;  2DWV A;  2ZQU A;  3MCB A;  1TR8 A;  1FLC A;  2F21 A;  2M8I A;  5C8B B;  2XP6 A;  2ZQT A;  3MCB B;  2XP8 A;  5CQ2 A;  4E5R A;  2M3O W;  5E62 A;  2YSI A;  3KAD A;  4U86 A;  1K9R A;  3OOB A;  2OWO A;  3KAG A;  2ZR5 A;  2DJY A;  3KAB A;  5E5W A;  2YSB A;  2KXQ A;  2YSF A;  2LAJ A;  2Y8N B;  2DK7 A;  4QIB A;  2MDI A;  5AHT A;  3KAF A;  2WAE A;  2JXW A;  1WMV A;  1EG3 A;  1PIN A;  2XP5 A;  3MQG A;  1EG4 A;  2ZR6 A;  2E45 A;  3M7N A;  2Q5A A;  2YSH A;  5E66 A;  4U84 A;  3PQH A;  3LKX A;  3FSB A;  4GLX A;  3FS8 A;  5E65 A;  2GDV A;  3TDB A;  3LKX B;  3WH0 A;  1YW5 A;  5E64 A;  1NMV A;  2WAD A;  3L4H A;  2QRV A;  3KAH A;  3FSC A;  2BA1 A;  1F8A B;  2XP9 A;  3WIT A;  1ZCN A;  4U85 A;  2XP4 A;  2JX8 A;  2YSG A;  4REX A;  2YAJ B;  1R7A A;  3KAI A;  2DK1 A;  3KCE A;  3LE4 A;  4A0T A;  3ODK A;  1I5H W;  5U47 A;  1RP5 A;  1JMQ A;  2JMF A;  2M8J A; 
#chains in the Genus database with same CATH homology
 2ITK A;  3CNG A;  2DMV A;  1WR7 A;  4A0U A;  3M85 A;  2L4J A;  1K9Q A;  2JV4 A;  2RE3 A;  2EZ5 W;  2ZAJ A;  2XP3 A;  3NTP A;  3TC5 A;  1TK7 A;  2ZR4 A;  2ZQS A;  2XPA A;  3MQH A;  2XPB A;  2ZQV A;  1O6W A;  2XP7 A;  3TCZ A;  2DWV A;  2ZQU A;  3MCB A;  1TR8 A;  1FLC A;  2F21 A;  2M8I A;  2XP6 A;  2ZQT A;  3MCB B;  2XP8 A;  5CQ2 A;  4E5R A;  2M3O W;  5E62 A;  2YSI A;  3KAD A;  4U86 A;  1K9R A;  3OOB A;  2OWO A;  3KAG A;  2ZR5 A;  2DJY A;  3KAB A;  5E5W A;  2YSB A;  2KXQ A;  2YSF A;  2LAJ A;  2Y8N B;  2DK7 A;  4QIB A;  2MDI A;  5AHT A;  3KAF A;  2WAE A;  2JXW A;  1WMV A;  1EG3 A;  1PIN A;  2XP5 A;  3MQG A;  1EG4 A;  2ZR6 A;  2E45 A;  3M7N A;  2Q5A A;  2YSH A;  5E66 A;  4U84 A;  3PQH A;  3LKX A;  3FSB A;  4GLX A;  3FS8 A;  5E65 A;  3TDB A;  3LKX B;  3WH0 A;  1YW5 A;  5E64 A;  1NMV A;  2WAD A;  3L4H A;  2QRV A;  3KAH A;  3FSC A;  2BA1 A;  1F8A B;  2XP9 A;  3WIT A;  1ZCN A;  4U85 A;  2XP4 A;  2JX8 A;  2YSG A;  4REX A;  2YAJ B;  3KAI A;  2DK1 A;  3KCE A;  3LE4 A;  4A0T A;  3ODK A;  1I5H W;  5U47 A;  1RP5 A;  1JMQ A;  2JMF A;  2M8J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...