The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
13
|
sequence length |
107
|
structure length |
107
|
Chain Sequence |
EKVIISNNKQTYASFDPNGNISVYNTQGMKIDMTPNSIVLTDAGGGKLTLQGGTMTYKGGTVNLNGLTITPDGRMTDSGGIGLHTHTHPVRGVETGGSTVTSDKPNG
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Phage pierces the host cell membrane with the iron-loaded spike.
pubmed doi rcsb |
| molecule tags |
Viral protein
|
| source organism |
Bacteriophage phi92
|
| molecule keywords |
gene product 138
|
| total genus |
13
|
| structure length |
107
|
| sequence length |
107
|
| chains with identical sequence |
B
|
| ec nomenclature | |
| pdb deposition date | 2010-11-26 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Single Sheet | Ubiquitin Ligase Nedd4; Chain: W; | Ubiquitin Ligase Nedd4; Chain: W; | ||
| Mainly Beta | Single Sheet | Glycosyl hydrolase fold | Glycosyl hydrolase fold |
#chains in the Genus database with same CATH superfamily 3PQH A; 3WIT A; #chains in the Genus database with same CATH topology 2JXW A; 2DWV A; 3MCB B; 2YSG A; 2F21 A; 2JMF A; 3PQH A; 3KAB A; 1TR8 A; 2XP6 A; 2KXQ A; 2YSB A; 2ZQU A; 2YSI A; 2MDI A; 2BA1 A; 5AHT A; 3L4H A; 3FSB A; 4E5R A; 3KAG A; 3LKX A; 2DK7 A; 2ZQV A; 2ZQT A; 3OOB A; 3CNG A; 5U47 A; 2M8J A; 2ZR5 A; 2JV4 A; 2ZAJ A; 3M7N A; 1I5H W; 3TC5 A; 1WMV A; 1RP5 A; 3WIT A; 2DJY A; 2QRV A; 2GDU A; 1YW5 A; 2WAE A; 5E62 A; 3WH0 A; 2ITK A; 2RE3 A; 1EG4 A; 4A0T A; 2XP4 A; 2GDV A; 3FS8 A; 3KCE A; 3NTP A; 1ZCN A; 3TCZ A; 2XP5 A; 1PIN A; 3MCB A; 5E5W A; 2YAJ B; 1WR7 A; 1EG3 A; 1FLC A; 3MQG A; 3KAH A; 2DMV A; 2YSF A; 4QIB A; 3FSC A; 2DK1 A; 2YSH A; 2ZQS A; 4U86 A; 5C8B B; 4U85 A; 3KAI A; 2ZR6 A; 4GLX A; 2XP8 A; 5E64 A; 3LE4 A; 2M8I A; 3MQH A; 2LAJ A; 2WAD A; 3TDB A; 2EZ5 W; 1JMQ A; 4REX A; 1R7A A; 1O6W A; 2XP3 A; 1NMV A; 4U84 A; 5CQ2 A; 3KAD A; 2M3O W; 2XPB A; 3KAF A; 1K9R A; 2OWO A; 2ZR4 A; 1TK7 A; 2L4J A; 2JX8 A; 2XPA A; 2XP7 A; 3LKX B; 2E45 A; 3M85 A; 1K9Q A; 2Y8N B; 1F8A B; 5E65 A; 4A0U A; 5E66 A; 2XP9 A; 3ODK A; 2Q5A A; #chains in the Genus database with same CATH homology 2JXW A; 2DWV A; 3MCB B; 2YSG A; 2F21 A; 2JMF A; 3PQH A; 3KAB A; 1TR8 A; 2XP6 A; 2KXQ A; 2YSB A; 2ZQU A; 2YSI A; 2MDI A; 2BA1 A; 5AHT A; 3L4H A; 3FSB A; 4E5R A; 3KAG A; 3LKX A; 2DK7 A; 2ZQV A; 2ZQT A; 3OOB A; 3CNG A; 5U47 A; 2M8J A; 2ZR5 A; 2JV4 A; 2ZAJ A; 3M7N A; 1I5H W; 3TC5 A; 1WMV A; 1RP5 A; 3WIT A; 2DJY A; 2QRV A; 1YW5 A; 2WAE A; 5E62 A; 3WH0 A; 2ITK A; 2RE3 A; 1EG4 A; 4A0T A; 2XP4 A; 3FS8 A; 3KCE A; 3NTP A; 1ZCN A; 3TCZ A; 2XP5 A; 1PIN A; 3MCB A; 5E5W A; 2YAJ B; 1WR7 A; 1EG3 A; 1FLC A; 3MQG A; 3KAH A; 2DMV A; 2YSF A; 4QIB A; 3FSC A; 2DK1 A; 2YSH A; 2ZQS A; 4U86 A; 4U85 A; 3KAI A; 2ZR6 A; 4GLX A; 2XP8 A; 5E64 A; 3LE4 A; 2M8I A; 3MQH A; 2LAJ A; 2WAD A; 3TDB A; 2EZ5 W; 1JMQ A; 4REX A; 1O6W A; 2XP3 A; 1NMV A; 4U84 A; 5CQ2 A; 3KAD A; 2M3O W; 2XPB A; 3KAF A; 1K9R A; 2OWO A; 2ZR4 A; 1TK7 A; 2L4J A; 2JX8 A; 2XPA A; 2XP7 A; 3LKX B; 2E45 A; 3M85 A; 1K9Q A; 2Y8N B; 1F8A B; 5E65 A; 4A0U A; 5E66 A; 2XP9 A; 3ODK A; 2Q5A A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
