3PQHA

Crystal structure of the c-terminal fragment of the bacteriophage phi92 membrane-piercing protein gp138
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
107
structure length
107
Chain Sequence
EKVIISNNKQTYASFDPNGNISVYNTQGMKIDMTPNSIVLTDAGGGKLTLQGGTMTYKGGTVNLNGLTITPDGRMTDSGGIGLHTHTHPVRGVETGGSTVTSDKPNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords gene product 138
publication title Phage pierces the host cell membrane with the iron-loaded spike.
pubmed doi rcsb
source organism Bacteriophage phi92
total genus 13
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.60 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3pqhA02
2.20.220.20 Mainly Beta Single Sheet Glycosyl hydrolase fold Glycosyl hydrolase fold 3pqhA01
3WITA 3PQHA
chains in the Genus database with same CATH superfamily
3FS8A 5CQ2A 2M8IA 2XP3A 3MCBA 3M7NA 3LKXA 5AHTA 2XPBA 2MDIA 1EG3A 3WH0A 2GDVA 2YAJB 4A0UA 3CNGA 2F21A 3TC5A 1WMVA 1F8AB 1I5HW 2ZQSA 5E64A 2Q5AA 5C8BB 3KAFA 2YSIA 2DWVA 2M8JA 4GLXA 3OOBA 1RP5A 3ODKA 3KAHA 2XPAA 1R7AA 3LE4A 2YSHA 2LAJA 3NTPA 1NMVA 2ZR6A 2Y8NB 5E62A 1K9QA 2WAEA 4REXA 5E65A 4A0TA 4E5RA 2ITKA 2KXQA 2XP8A 3KABA 4U84A 1YW5A 3TCZA 2XP7A 4U86A 2WADA 2OWOA 2YSFA 1TK7A 3KCEA 2DK7A 4QIBA 2L4JA 2ZQTA 3FSCA 3MQGA 2ZQVA 2XP9A 1K9RA 3TDBA 2M3OW 3WITA 2ZR5A 3MCBB 1PINA 2XP6A 2GDUA 2ZQUA 3LKXB 2ZR4A 2RE3A 1EG4A 2JMFA 2EZ5W 2QRVA 1O6WA 4U85A 5E66A 3MQHA 3M85A 2DMVA 1TR8A 3L4HA 2YSGA 3KAGA 3FSBA 2XP5A 3PQHA 2DK1A 3KAIA 5U47A 2JXWA 2JX8A 2YSBA 1JMQA 1WR7A 3KADA 1ZCNA 2E45A 5E5WA 2ZAJA 2XP4A 1FLCA 2DJYA 2BA1A 2JV4A
chains in the Genus database with same CATH topology
3FS8A 5CQ2A 2M8IA 2XP3A 3MCBA 3M7NA 3LKXA 5AHTA 2XPBA 2MDIA 1EG3A 3WH0A 2YAJB 4A0UA 3CNGA 2F21A 3TC5A 1WMVA 1F8AB 1I5HW 2ZQSA 5E64A 2Q5AA 3KAFA 2YSIA 2DWVA 2M8JA 4GLXA 3OOBA 1RP5A 3ODKA 3KAHA 2XPAA 3LE4A 2YSHA 2LAJA 3NTPA 1NMVA 2ZR6A 2Y8NB 5E62A 1K9QA 2WAEA 4REXA 5E65A 4A0TA 4E5RA 2ITKA 2KXQA 2XP8A 3KABA 4U84A 1YW5A 3TCZA 2XP7A 4U86A 2WADA 2OWOA 2YSFA 1TK7A 3KCEA 2DK7A 4QIBA 2L4JA 2ZQTA 3FSCA 3MQGA 2ZQVA 2XP9A 1K9RA 3TDBA 2M3OW 3WITA 2ZR5A 3MCBB 1PINA 2XP6A 2ZQUA 3LKXB 2ZR4A 2RE3A 1EG4A 2JMFA 2EZ5W 2QRVA 1O6WA 4U85A 5E66A 3MQHA 3M85A 2DMVA 1TR8A 3L4HA 2YSGA 3KAGA 3FSBA 2XP5A 3PQHA 2DK1A 3KAIA 5U47A 2JXWA 2JX8A 2YSBA 1JMQA 1WR7A 3KADA 1ZCNA 2E45A 5E5WA 2ZAJA 2XP4A 1FLCA 2DJYA 2BA1A 2JV4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WIT A;  3PQH A; 
#chains in the Genus database with same CATH topology
 3FS8 A;  5CQ2 A;  2M8I A;  2XP3 A;  3MCB A;  3M7N A;  3LKX A;  5AHT A;  2XPB A;  2MDI A;  1EG3 A;  3WH0 A;  2GDV A;  2YAJ B;  4A0U A;  3CNG A;  2F21 A;  3TC5 A;  1WMV A;  1F8A B;  1I5H W;  2ZQS A;  5E64 A;  2Q5A A;  5C8B B;  3KAF A;  2YSI A;  2DWV A;  2M8J A;  4GLX A;  3OOB A;  1RP5 A;  3ODK A;  3KAH A;  2XPA A;  1R7A A;  3LE4 A;  2YSH A;  2LAJ A;  3NTP A;  1NMV A;  2ZR6 A;  2Y8N B;  5E62 A;  1K9Q A;  2WAE A;  4REX A;  5E65 A;  4A0T A;  4E5R A;  2ITK A;  2KXQ A;  2XP8 A;  3KAB A;  4U84 A;  1YW5 A;  3TCZ A;  2XP7 A;  4U86 A;  2WAD A;  2OWO A;  2YSF A;  1TK7 A;  3KCE A;  2DK7 A;  4QIB A;  2L4J A;  2ZQT A;  3FSC A;  3MQG A;  2ZQV A;  2XP9 A;  1K9R A;  3TDB A;  2M3O W;  3WIT A;  2ZR5 A;  3MCB B;  1PIN A;  2XP6 A;  2GDU A;  2ZQU A;  3LKX B;  2ZR4 A;  2RE3 A;  1EG4 A;  2JMF A;  2EZ5 W;  2QRV A;  1O6W A;  4U85 A;  5E66 A;  3MQH A;  3M85 A;  2DMV A;  1TR8 A;  3L4H A;  2YSG A;  3KAG A;  3FSB A;  2XP5 A;  3PQH A;  2DK1 A;  3KAI A;  5U47 A;  2JXW A;  2JX8 A;  2YSB A;  1JMQ A;  1WR7 A;  3KAD A;  1ZCN A;  2E45 A;  5E5W A;  2ZAJ A;  2XP4 A;  1FLC A;  2DJY A;  2BA1 A;  2JV4 A; 
#chains in the Genus database with same CATH homology
 3FS8 A;  5CQ2 A;  2M8I A;  2XP3 A;  3MCB A;  3M7N A;  3LKX A;  5AHT A;  2XPB A;  2MDI A;  1EG3 A;  3WH0 A;  2YAJ B;  4A0U A;  3CNG A;  2F21 A;  3TC5 A;  1WMV A;  1F8A B;  1I5H W;  2ZQS A;  5E64 A;  2Q5A A;  3KAF A;  2YSI A;  2DWV A;  2M8J A;  4GLX A;  3OOB A;  1RP5 A;  3ODK A;  3KAH A;  2XPA A;  3LE4 A;  2YSH A;  2LAJ A;  3NTP A;  1NMV A;  2ZR6 A;  2Y8N B;  5E62 A;  1K9Q A;  2WAE A;  4REX A;  5E65 A;  4A0T A;  4E5R A;  2ITK A;  2KXQ A;  2XP8 A;  3KAB A;  4U84 A;  1YW5 A;  3TCZ A;  2XP7 A;  4U86 A;  2WAD A;  2OWO A;  2YSF A;  1TK7 A;  3KCE A;  2DK7 A;  4QIB A;  2L4J A;  2ZQT A;  3FSC A;  3MQG A;  2ZQV A;  2XP9 A;  1K9R A;  3TDB A;  2M3O W;  3WIT A;  2ZR5 A;  3MCB B;  1PIN A;  2XP6 A;  2ZQU A;  3LKX B;  2ZR4 A;  2RE3 A;  1EG4 A;  2JMF A;  2EZ5 W;  2QRV A;  1O6W A;  4U85 A;  5E66 A;  3MQH A;  3M85 A;  2DMV A;  1TR8 A;  3L4H A;  2YSG A;  3KAG A;  3FSB A;  2XP5 A;  3PQH A;  2DK1 A;  3KAI A;  5U47 A;  2JXW A;  2JX8 A;  2YSB A;  1JMQ A;  1WR7 A;  3KAD A;  1ZCN A;  2E45 A;  5E5W A;  2ZAJ A;  2XP4 A;  1FLC A;  2DJY A;  2BA1 A;  2JV4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...