2ZQVA

Crystal structure of a mutant pin1 peptidyl-prolyl cis-trans isomerase
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
158
structure length
153
Chain Sequence
KLPPGWEKRMSRSSGRVYYANHITNASQWERPSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structural studies on PIN1 mutants
rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 45
structure length 153
sequence length 158
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2008-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2zqvA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2zqvA02
3UQIA 2UZ5A 4ODPA 1D6OA 2JZVA 2RURA 4GGQA 2MLXA 1FKIA 3PRDA 4ODLA 1I5HW 2PPPA 4BF8A 1M5YA 1Q1CA 1FKLA 4TNSA 2DWVA 1JNSA 4QIBA 1FKSA 4TX0A 1FD9A 4TW8A 2YSHA 2RUDA 4REXA 1HXVA 1Q6UA 3UF8A 2DK7A 3KAIA 4IPXA 1D7IA 1J6YA 5HWCA 2ZQTA 3KAGA 1EYMA 1Q6IA 3O5DA 1FKTA 3O5EA 2M8IA 3CGMA 3NTPA 1ZK6A 1TK7A 4DT4A 3O5PA 5HUAA 2RSEA 4MGVA 2L2SA 3UI6A 4C02B 4GIVA 1FKKA 3O5LA 2PPNA 3VAWA 3I6CA 2Q5AA 4DH0A 4JFMA 3O5KA 1FKFA 2LJ4A 1BL4A 3KABA 2MNTA 2KE0A 3JYMA 1C9HA 2D9FA 4J4OA 3JXVA 1ROUA 5DIUA 5B8IC 2KGJA 3IK8A 2ZAJA 4JFKA 1YATA 1FKRA 2N87A 1W26A 4ODMA 4U85A 1EQ3A 2YSFA 4JYSA 3KAFA 1K9RA 3KCEA 1KT0A 2KR7A 2JMFA 2XP7A 4DRIA 3FAPA 3B7XA 2RUQA 4G50A 3O5GA 3H9RB 4LAWA 2DG9A 1ROTA 4JFIA 2M08A 3LUOA 3JYJA 1D7JA 2BA1A 1JVWA 4DRMA 2PBCA 1FKDA 4U86A 1FJDA 2ITKA 2ZQUA 2YSBA 4G2PA 5HW6A 1BKFA 1NSGA 4NNRA 4W9PA 4W9OA 3O5QA 4DIPA 2LPVA 3MDYB 5HW7A 4DRQA 3O5FA 2F2DA 1K9QA 2IF4A 3WH0A 3RGCA 3M85A 2ZR5A 3M7NA 4R0XA 5HWBA 3NRKA 4JFJA 3UI4A 1J4IA 1EG4A 2LKNA 5HKGA 1EG3A 2MLZA 3O5OA 2XPBA 4QT2A 1FKHA 2ZQSA 2MF9A 4IQCA 3O5JA 3LE4A 3PRBA 4DRKA 2AWGA 2LAJA 3RFWA 1PINA 4FN2A 1WR7A 1NMWA 1JMQA 4QT3A 5CQ2A 4TW7A 4DZ3A 3CGNA 2Y78A 3KADA 4LAXA 1J4RA 2PV2A 5HW8A 2DJYA 5I98A 3TDBA 2F21A 2L4JA 3CNGA 5AHTA 3O5MA 4DZ2A 1WMVA 2RE3A 3OOBA 1QPLA 5DITA 4W9QA 2VN1A 3EY6A 1A7XA 2PV3A 3PA7A 2ZR4A 1JNTA 2MDIA 2DK1A 2M8JA 2XP6A 2ZQVA 2DG4A 4LAVA 2RQSA 2KFWA 2RUCA 1L1PA 3O5IA 1FKBA 3KACA 4N19A 2DG3A 4IQ2A 2YSGA 2MPHA 1B6CA 3NI6A 5HTGA 5D75A 2XP5A 4ODQA 4DRNA 4MSPA 2ZR6A 2M2AA 2M3OW 4ODOA 3KAHA 4E5RA 2KO7A 4FAPA 1T11A 4DROA 2JX8A 1ZCNA 1F40A 4ITZA 3UI5A 4DRPA 1YW5A 3IKDA 4TYOA 1FKGA 1O6WA 1NMVA 1P5QA 2FKEA 2XP4A 2XPAA 2EZ5W 3GPKA 1KT1A 4U84A 2YSIA 4ODKA 1N1AA 1PBKA 1Q6HA 2OFNA 2PV1A 2XP3A 1F8AB 1QPFA 4ODRA 2PPOA 2FAPA 4O2TA 5HT1A 3L4HA 2KXQA 2K8IA 1FAPA 3TCZA 2LGOA 1TCOC 4LAYA 2E45A 2JV4A 5GPGA 3ODKA 1QZ2A 1J4HA 2KI3A 2MLYA 3O5RA 2XP9A 2M1IA 2VCDA 4DRJA 1U79A 1R9HA 4ODNA 4TW6A 3UQBA 3IHZA 4DRHA 2JXWA 4J4NA 4JFLA 1FKJA 1Y0OA 3UQAA 1D7HA 3KZ7A 5BXJA 3IKGA 2XP8A 2F4EA 3TC5A 5J6EA 2DMVA 5DIVA
chains in the Genus database with same CATH superfamily
3UQIA 2UZ5A 1ZBVA 4ODPA 1D6OA 3W4RA 2JZVA 4Z2LA 2RURA 4GGQA 2QRVA 1NWSA 1FKIA 2MLXA 3AS2A 3PRDA 4ODLA 1EDQA 4Z2IA 1I5HW 2PPPA 4BF8A 1M5YA 1Q1CA 1FKLA 4TNSA 2DWVA 3ALGA 1JNSA 4QIBA 1FKSA 1FD9A 4TW8A 4TX0A 2YSHA 2RUDA 4REXA 1HXVA 1Q6UA 3UF8A 2DK7A 3KAIA 4IPXA 1D7IA 4DWSC 1J6YA 5HWCA 5DEZA 2ZQTA 3KAGA 3FSCA 1EYMA 1Q6IA 3O5DA 3WL1A 2P4VA 2G8ZA 1FKTA 1SYTA 3O5EA 2M8IA 4L3NA 3CGMA 2A3BA 3B8SA 3NTPA 1ZK6A 3ARTA 1IX5A 1TK7A 3CHCA 2ETNA 3WQVA 2OLHA 4DT4A 1OWQA 3O5PA 4UDMA 5HUAA 1HKIA 2RSEA 4MGVA 2DT3A 1O6IA 3B9EA 2L2SA 3UI6A 3AS3A 4C02B 1E6ZA 4GIVA 1XRVA 1FKKA 2G41A 3O5LA 1H0IA 2PPNA 3MQGA 3CZ8A 3I6CA 3VAWA 2Q5AA 4DH0A 4JFMA 3O5KA 1FKFA 2LJ4A 4Z2KA 3CHFA 4NZCA 1BL4A 3BXWA 1WAWA 3KABA 4PTMA 2MNTA 3ARUA 1GRJA 2KE0A 4MNJA 3JYMA 4WIWA 3LKXB 3MQHA 1C9HA 2D9FA 4J4OA 1X6LA 3G6MA 3JXVA 4ZPWR 5E64A 3RM4A 1ROUA 5DIUA 1NWUA 5B8IC 2KGJA 3IK8A 1GOIA 2ZAJA 1KFWA 3AQUA 3ARRA 4JFKA 1W1YA 1HJXA 1YATA 3LKXA 4WKHA 4Z2JA 3ARXA 4WKAA 1FKRA 4A0UA 2N87A 1W26A 2PI6A 4ODMA 3WKZA 2DSVA 4U85A 1EQ3A 2YSFA 3ALFA 3CHEA 3EIPA 4JYSA 2WAEA 3KAFA 1WNOA 1CTNA 1K9RA 3KCEA 1KT0A 2KR7A 2JMFA 2XP7A 4DRIA 3ARZA 1E15A 3FAPA 3B7XA 2RUQA 4G50A 3O5GA 3H9RB 4LAWA 4MNKA 2DG9A 2A3EA 1SR0A 1ROTA 4JFIA 2M08A 3LUOA 3RM9A 4L72B 2DT0A 3JYJA 4HARA 5HBFA 1D7JA 2DSZA 2BA1A 1JVWA 4DRMA 2PBCA 1FKDA 4U86A 1FJDA 3WQWA 2ITKA 1EHNA 3PRAA 4AY1A 2ZQUA 4HBEA 2YSBA 4G2PA 1ZBCA 5HW6A 1BKFA 4P8VA 1NSGA 4Q22A 4NNRA 1RD6A 4W9PA 4W9OA 1XHGA 3O5QA 4DIPA 2LPVA 2ESCA 3MDYB 1LJYA 3AS1A 5HW7A 1E6RA 4DWSB 4DRQA 3O5FA 2F2DA 1K9QA 3BMBA 2IF4A 3WH0A 3RGCA 1LL6A 3M85A 2ZR5A 1H0GA 2WK2A 3M7NA 4R0XA 5HWBA 3WD1A 4MPKA 3NRKA 1ZL1A 1FFQA 4JFJA 3UI4A 1J4IA 3FY1A 1EG4A 4DWSA 1D2KA 2LKNA 5E66A 1TFVA 3WD0A 5HKGA 1EG3A 2MLZA 3O5OA 2WADA 4URIA 2XPBA 4QT2A 3FXYA 4KR0B 1FKHA 1OGGA 2ZQSA 2QF8A 5E5WA 5E62A 2MF9A 5E65A 1TR8A 4IQCA 3O5JA 3LE4A 3PRBA 4DRKA 2AWGA 3WL0A 1WB0A 1JCHB 3WD2A 2LAJA 3RFWA 1PINA 4FN2A 1WR7A 1NMWA 1JMQA 2DT1A 4QT3A 5CQ2A 1ZU8A 4TW7A 4DZ3A 3CGNA 2Y78A 3KADA 4P8XA 1X6NA 3B9DA 4LAXA 1J4RA 4XAKA 1EIBA 4ZPTR 1W9VA 2PV2A 5HW8A 3ARWA 2DJYA 3G6LA 4HBOA 4GLXA 5I98A 3TDBA 1NWTA 2DPEA 4MTVA 1ZB5A 2F21A 2L4JA 3RMEA 3AS0A 3CNGA 3QOKA 5AHTA 4ZS6A 2AOSA 1GPFA 1LG2A 3O5MA 4DZ2A 1WMVA 2RE3A 3OOBA 1QPLA 3WIJA 4WJXA 5DITA 1UR9A 4S3JA 1W9UA 4W9QA 2VN1A 3ARQA 2Y8NB 3EY6A 1A7XA 4R5EA 1HKMA 2B5UB 2PV3A 3PA7A 2ZR4A 1JNTA 2MDIA 2FDMA 2A3CA 2DK1A 2M8JA 4LGXA 2XP6A 2ZQVA 2DG4A 4LAVA 1LL4A 2RQSA 2KFWA 2YBUA 2RUCA 1L1PA 3PQHA 2WM0A 3O5IA 1NWRA 4Q7NA 1FKBA 3KACA 2DSUA 2PN0A 4W5UA 3CH9A 2YAJB 4N19A 1ITXA 2DG3A 4IQ2A 2YSGA 2MPHA 1B6CA 3NI6A 4WK9A 5HTGA 1K9TA 5D75A 4MNLA 2XP5A 4ODQA 4IT4A 4DRNA 4MSPA 2ZR6A 2M2AA 1GUVA 2M3OW 2F23A 4ODOA 3KAHA 4E5RA 2KO7A 1LG1A 2B31A 4FAPA 1T11A 3WD4A 4ZPVR 4DROA 2JX8A 1ZCNA 3MCBB 1F40A 1ZBKA 2O92A 4ITZA 3UI5A 4DRPA 1YW5A 3ARSA 3IKDA 4TYOA 1FKGA 4Z2GA 1JNDA 1JNEA 1RP5A 1O6WA 1NMVA 1P5QA 2FKEA 2XP4A 1E9LA 2XPAA 4P8WA 4P8UA 2EZ5W 3GPKA 1KT1A 4U84A 3MCBA 1FLCA 2YSIA 3GU0A 5GQBA 4ODKA 1UR8A 5GPRA 1N1AA 1PBKA 4ML4A 1Q6HA 4S3KA 2OFNA 2PV1A 5DO2A 2XP3A 1F8AB 1QPFA 4ODRA 3PR9A 2PPOA 3ARPA 5DF0A 3RM8A 2DT2A 2FAPA 2YBTA 4O2TA 5HT1A 4Z2HA 3L4HA 4IT6A 2KXQA 2K8IA 1E6PA 1FAPA 2IUZA 1W1PA 3TCZA 3AROA 4WKFA 2LGOA 1TCOC 4LAYA 2E45A 2JV4A 5GPGA 3ODKA 1QZ2A 3GTYX 1J4HA 2KI3A 2MLYA 2DSWA 3O5RA 2XP9A 2M1IA 1HJWA 2VCDA 4DRJA 1U79A 2OWOA 4MNMA 3ARYA 4DWSD 3ARVA 1R9HA 3FSBA 1FFRA 4ODNA 1ZBWA 4TW6A 3UQBA 3IHZA 1LQ0A 1LL7A 4DRHA 2JXWA 4J4NA 4JFLA 1FKJA 1Y0OA 1W1VA 3UQAA 2A3AA 1D7HA 3KZ7A 5U47A 2EULA 1HKKA 5BXJA 1E44A 1VF8A 4KQZA 3WD3A 3IKGA 1HJVA 2WLZA 1W1TA 3CHDA 4NSBA 2WLYA 1OGBA 1HKJA 1NH6A 2XP8A 5JH8A 2F4EA 4QZVB 3TC5A 3OA5A 5J6EA 4MAVA 2O9OA 2DMVA 3FS8A 4A0TA 5DIVA 1W9PA 3B9AA 1E6NA
chains in the Genus database with same CATH topology
3UQIA 2UZ5A 1ZBVA 4ODPA 1D6OA 3W4RA 2JZVA 4Z2LA 2RURA 4GGQA 2QRVA 1NWSA 1FKIA 2MLXA 3AS2A 3PRDA 4ODLA 1EDQA 4Z2IA 1I5HW 2PPPA 4BF8A 1M5YA 1Q1CA 1FKLA 4TNSA 2DWVA 3ALGA 1JNSA 4QIBA 1FKSA 1FD9A 4TW8A 4TX0A 2YSHA 2RUDA 4REXA 1HXVA 1Q6UA 3UF8A 2DK7A 3KAIA 4IPXA 1D7IA 4DWSC 1J6YA 5HWCA 5DEZA 2ZQTA 3KAGA 3FSCA 1EYMA 1Q6IA 3O5DA 3WL1A 2G8ZA 1FKTA 1SYTA 3O5EA 2M8IA 4L3NA 3CGMA 2A3BA 3B8SA 3NTPA 1ZK6A 3ARTA 1IX5A 1TK7A 3CHCA 3WQVA 2OLHA 4DT4A 1OWQA 3O5PA 5HUAA 1HKIA 2RSEA 4MGVA 2DT3A 1O6IA 3B9EA 2L2SA 3UI6A 3AS3A 4C02B 1E6ZA 4GIVA 1XRVA 1FKKA 2G41A 3O5LA 1H0IA 2PPNA 3MQGA 3CZ8A 3I6CA 3VAWA 2Q5AA 4DH0A 4JFMA 3O5KA 1FKFA 2LJ4A 4Z2KA 3CHFA 4NZCA 1BL4A 3BXWA 1WAWA 3KABA 4PTMA 2MNTA 3ARUA 2KE0A 4MNJA 3JYMA 4WIWA 3LKXB 3MQHA 1C9HA 2D9FA 4J4OA 1X6LA 3G6MA 3JXVA 4ZPWR 5E64A 3RM4A 1ROUA 5DIUA 1NWUA 5B8IC 2KGJA 3IK8A 1GOIA 2ZAJA 1KFWA 3AQUA 3ARRA 4JFKA 1W1YA 1HJXA 1YATA 3LKXA 4WKHA 4Z2JA 3ARXA 4WKAA 1FKRA 4A0UA 2N87A 1W26A 2PI6A 4ODMA 3WKZA 2DSVA 4U85A 1EQ3A 2YSFA 3ALFA 3CHEA 4JYSA 2WAEA 3KAFA 1WNOA 1CTNA 1K9RA 3KCEA 1KT0A 2KR7A 2JMFA 2XP7A 4DRIA 3ARZA 1E15A 3FAPA 3B7XA 2RUQA 4G50A 3O5GA 3H9RB 4LAWA 4MNKA 2DG9A 2A3EA 1SR0A 1ROTA 4JFIA 2M08A 3LUOA 3RM9A 4L72B 2DT0A 3JYJA 4HARA 5HBFA 1D7JA 2DSZA 2BA1A 1JVWA 4DRMA 2PBCA 1FKDA 4U86A 1FJDA 3WQWA 2ITKA 1EHNA 3PRAA 4AY1A 2ZQUA 4HBEA 2YSBA 4G2PA 1ZBCA 5HW6A 1BKFA 4P8VA 1NSGA 4Q22A 4NNRA 1RD6A 4W9PA 4W9OA 1XHGA 3O5QA 4DIPA 2LPVA 2ESCA 3MDYB 1LJYA 3AS1A 5HW7A 1E6RA 4DWSB 4DRQA 3O5FA 2F2DA 1K9QA 2IF4A 3WH0A 3RGCA 1LL6A 3M85A 2ZR5A 1H0GA 2WK2A 3M7NA 4R0XA 5HWBA 3WD1A 4MPKA 3NRKA 1ZL1A 1FFQA 4JFJA 3UI4A 1J4IA 3FY1A 1EG4A 4DWSA 1D2KA 2LKNA 5E66A 1TFVA 3WD0A 5HKGA 1EG3A 2MLZA 3O5OA 2WADA 4URIA 2XPBA 4QT2A 3FXYA 4KR0B 1FKHA 1OGGA 2ZQSA 2QF8A 5E5WA 5E62A 2MF9A 5E65A 1TR8A 4IQCA 3O5JA 3LE4A 3PRBA 4DRKA 2AWGA 3WL0A 1WB0A 3WD2A 2LAJA 3RFWA 1PINA 4FN2A 1WR7A 1NMWA 1JMQA 2DT1A 4QT3A 5CQ2A 1ZU8A 4TW7A 4DZ3A 3CGNA 2Y78A 3KADA 4P8XA 1X6NA 3B9DA 4LAXA 1J4RA 4XAKA 1EIBA 4ZPTR 1W9VA 2PV2A 5HW8A 3ARWA 2DJYA 3G6LA 4HBOA 4GLXA 5I98A 3TDBA 1NWTA 2DPEA 4MTVA 1ZB5A 2F21A 2L4JA 3RMEA 3AS0A 3CNGA 3QOKA 5AHTA 4ZS6A 2AOSA 1GPFA 1LG2A 3O5MA 4DZ2A 1WMVA 2RE3A 3OOBA 1QPLA 3WIJA 4WJXA 5DITA 1UR9A 4S3JA 1W9UA 4W9QA 2VN1A 3ARQA 2Y8NB 3EY6A 1A7XA 4R5EA 1HKMA 2PV3A 3PA7A 2ZR4A 1JNTA 2MDIA 2FDMA 2A3CA 2DK1A 2M8JA 4LGXA 2XP6A 2ZQVA 2DG4A 4LAVA 1LL4A 2RQSA 2KFWA 2YBUA 2RUCA 1L1PA 3PQHA 2WM0A 3O5IA 1NWRA 4Q7NA 1FKBA 3KACA 2DSUA 4W5UA 3CH9A 2YAJB 4N19A 1ITXA 2DG3A 4IQ2A 2YSGA 2MPHA 1B6CA 3NI6A 4WK9A 5HTGA 1K9TA 5D75A 4MNLA 2XP5A 4ODQA 4IT4A 4DRNA 4MSPA 2ZR6A 2M2AA 1GUVA 2M3OW 4ODOA 3KAHA 4E5RA 2KO7A 1LG1A 2B31A 4FAPA 1T11A 3WD4A 4ZPVR 4DROA 2JX8A 1ZCNA 3MCBB 1F40A 1ZBKA 2O92A 4ITZA 3UI5A 4DRPA 1YW5A 3ARSA 3IKDA 4TYOA 1FKGA 4Z2GA 1JNDA 1JNEA 1RP5A 1O6WA 1NMVA 1P5QA 2FKEA 2XP4A 1E9LA 2XPAA 4P8WA 4P8UA 2EZ5W 3GPKA 1KT1A 4U84A 3MCBA 1FLCA 2YSIA 5GQBA 4ODKA 1UR8A 5GPRA 1N1AA 1PBKA 4ML4A 1Q6HA 4S3KA 2OFNA 2PV1A 5DO2A 2XP3A 1F8AB 1QPFA 4ODRA 3PR9A 2PPOA 3ARPA 5DF0A 3RM8A 2DT2A 2FAPA 2YBTA 4O2TA 5HT1A 4Z2HA 3L4HA 4IT6A 2KXQA 2K8IA 1E6PA 1FAPA 2IUZA 1W1PA 3TCZA 3AROA 4WKFA 2LGOA 1TCOC 4LAYA 2E45A 2JV4A 5GPGA 3ODKA 1QZ2A 1J4HA 2KI3A 2MLYA 2DSWA 3O5RA 2XP9A 2M1IA 1HJWA 2VCDA 4DRJA 1U79A 2OWOA 4MNMA 3ARYA 4DWSD 3ARVA 1R9HA 3FSBA 1FFRA 4ODNA 1ZBWA 4TW6A 3UQBA 3IHZA 1LQ0A 1LL7A 4DRHA 2JXWA 4J4NA 4JFLA 1FKJA 1Y0OA 1W1VA 3UQAA 2A3AA 1D7HA 3KZ7A 5U47A 1HKKA 5BXJA 4KQZA 1VF8A 3WD3A 3IKGA 1HJVA 2WLZA 1W1TA 3CHDA 4NSBA 2WLYA 1OGBA 1HKJA 1NH6A 2XP8A 5JH8A 2F4EA 4QZVB 3TC5A 3OA5A 5J6EA 4MAVA 2O9OA 2DMVA 3FS8A 4A0TA 5DIVA 1W9PA 3B9AA 1E6NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UQI A;  2UZ5 A;  4ODP A;  1D6O A;  2JZV A;  2RUR A;  4GGQ A;  2MLX A;  1FKI A;  3PRD A;  4ODL A;  1I5H W;  2PPP A;  4BF8 A;  1M5Y A;  1Q1C A;  1FKL A;  4TNS A;  2DWV A;  1JNS A;  4QIB A;  1FKS A;  4TX0 A;  1FD9 A;  4TW8 A;  2YSH A;  2RUD A;  4REX A;  1HXV A;  1Q6U A;  3UF8 A;  2DK7 A;  3KAI A;  4IPX A;  1D7I A;  1J6Y A;  5HWC A;  2ZQT A;  3KAG A;  1EYM A;  1Q6I A;  3O5D A;  1FKT A;  3O5E A;  2M8I A;  3CGM A;  3NTP A;  1ZK6 A;  1TK7 A;  4DT4 A;  3O5P A;  5HUA A;  2RSE A;  4MGV A;  2L2S A;  3UI6 A;  4C02 B;  4GIV A;  1FKK A;  3O5L A;  2PPN A;  3VAW A;  3I6C A;  2Q5A A;  4DH0 A;  4JFM A;  3O5K A;  1FKF A;  2LJ4 A;  1BL4 A;  3KAB A;  2MNT A;  2KE0 A;  3JYM A;  1C9H A;  2D9F A;  4J4O A;  3JXV A;  1ROU A;  5DIU A;  5B8I C;  2KGJ A;  3IK8 A;  2ZAJ A;  4JFK A;  1YAT A;  1FKR A;  2N87 A;  1W26 A;  4ODM A;  4U85 A;  1EQ3 A;  2YSF A;  4JYS A;  3KAF A;  1K9R A;  3KCE A;  1KT0 A;  2KR7 A;  2JMF A;  2XP7 A;  4DRI A;  3FAP A;  3B7X A;  2RUQ A;  4G50 A;  3O5G A;  3H9R B;  4LAW A;  2DG9 A;  1ROT A;  4JFI A;  2M08 A;  3LUO A;  3JYJ A;  1D7J A;  2BA1 A;  1JVW A;  4DRM A;  2PBC A;  1FKD A;  4U86 A;  1FJD A;  2ITK A;  2ZQU A;  2YSB A;  4G2P A;  5HW6 A;  1BKF A;  1NSG A;  4NNR A;  4W9P A;  4W9O A;  3O5Q A;  4DIP A;  2LPV A;  3MDY B;  5HW7 A;  4DRQ A;  3O5F A;  2F2D A;  1K9Q A;  2IF4 A;  3WH0 A;  3RGC A;  3M85 A;  2ZR5 A;  3M7N A;  4R0X A;  5HWB A;  3NRK A;  4JFJ A;  3UI4 A;  1J4I A;  1EG4 A;  2LKN A;  5HKG A;  1EG3 A;  2MLZ A;  3O5O A;  2XPB A;  4QT2 A;  1FKH A;  2ZQS A;  2MF9 A;  4IQC A;  3O5J A;  3LE4 A;  3PRB A;  4DRK A;  2AWG A;  2LAJ A;  3RFW A;  1PIN A;  4FN2 A;  1WR7 A;  1NMW A;  1JMQ A;  4QT3 A;  5CQ2 A;  4TW7 A;  4DZ3 A;  3CGN A;  2Y78 A;  3KAD A;  4LAX A;  1J4R A;  2PV2 A;  5HW8 A;  2DJY A;  5I98 A;  3TDB A;  2F21 A;  2L4J A;  3CNG A;  5AHT A;  3O5M A;  4DZ2 A;  1WMV A;  2RE3 A;  3OOB A;  1QPL A;  5DIT A;  4W9Q A;  2VN1 A;  3EY6 A;  1A7X A;  2PV3 A;  3PA7 A;  2ZR4 A;  1JNT A;  2MDI A;  2DK1 A;  2M8J A;  2XP6 A;  2ZQV A;  2DG4 A;  4LAV A;  2RQS A;  2KFW A;  2RUC A;  1L1P A;  3O5I A;  1FKB A;  3KAC A;  4N19 A;  2DG3 A;  4IQ2 A;  2YSG A;  2MPH A;  1B6C A;  3NI6 A;  5HTG A;  5D75 A;  2XP5 A;  4ODQ A;  4DRN A;  4MSP A;  2ZR6 A;  2M2A A;  2M3O W;  4ODO A;  3KAH A;  4E5R A;  2KO7 A;  4FAP A;  1T11 A;  4DRO A;  2JX8 A;  1ZCN A;  1F40 A;  4ITZ A;  3UI5 A;  4DRP A;  1YW5 A;  3IKD A;  4TYO A;  1FKG A;  1O6W A;  1NMV A;  1P5Q A;  2FKE A;  2XP4 A;  2XPA A;  2EZ5 W;  3GPK A;  1KT1 A;  4U84 A;  2YSI A;  4ODK A;  1N1A A;  1PBK A;  1Q6H A;  2OFN A;  2PV1 A;  2XP3 A;  1F8A B;  1QPF A;  4ODR A;  2PPO A;  2FAP A;  4O2T A;  5HT1 A;  3L4H A;  2KXQ A;  2K8I A;  1FAP A;  3TCZ A;  2LGO A;  1TCO C;  4LAY A;  2E45 A;  2JV4 A;  5GPG A;  3ODK A;  1QZ2 A;  1J4H A;  2KI3 A;  2MLY A;  3O5R A;  2XP9 A;  2M1I A;  2VCD A;  4DRJ A;  1U79 A;  1R9H A;  4ODN A;  4TW6 A;  3UQB A;  3IHZ A;  4DRH A;  2JXW A;  4J4N A;  4JFL A;  1FKJ A;  1Y0O A;  3UQA A;  1D7H A;  3KZ7 A;  5BXJ A;  3IKG A;  2XP8 A;  2F4E A;  3TC5 A;  5J6E A;  2DMV A;  5DIV A; 
#chains in the Genus database with same CATH topology
 3UQI A;  2UZ5 A;  1ZBV A;  4ODP A;  1D6O A;  3W4R A;  2JZV A;  4Z2L A;  2RUR A;  4GGQ A;  2QRV A;  1NWS A;  1FKI A;  2MLX A;  3AS2 A;  3PRD A;  4ODL A;  1EDQ A;  4Z2I A;  1I5H W;  2PPP A;  4BF8 A;  1M5Y A;  1Q1C A;  1FKL A;  4TNS A;  2DWV A;  3ALG A;  1JNS A;  4QIB A;  1FKS A;  1FD9 A;  4TW8 A;  4TX0 A;  2YSH A;  2RUD A;  4REX A;  1HXV A;  1Q6U A;  3UF8 A;  2DK7 A;  3KAI A;  4IPX A;  1D7I A;  4DWS C;  1J6Y A;  5HWC A;  5DEZ A;  2ZQT A;  3KAG A;  3FSC A;  1EYM A;  1Q6I A;  3O5D A;  3WL1 A;  2P4V A;  2G8Z A;  1FKT A;  1SYT A;  3O5E A;  2M8I A;  4L3N A;  3CGM A;  2A3B A;  3B8S A;  3NTP A;  1ZK6 A;  3ART A;  1IX5 A;  1TK7 A;  3CHC A;  2ETN A;  3WQV A;  2OLH A;  4DT4 A;  1OWQ A;  3O5P A;  4UDM A;  5HUA A;  1HKI A;  2RSE A;  4MGV A;  2DT3 A;  1O6I A;  3B9E A;  2L2S A;  3UI6 A;  3AS3 A;  4C02 B;  1E6Z A;  4GIV A;  1XRV A;  1FKK A;  2G41 A;  3O5L A;  1H0I A;  2PPN A;  3MQG A;  3CZ8 A;  3I6C A;  3VAW A;  2Q5A A;  4DH0 A;  4JFM A;  3O5K A;  1FKF A;  2LJ4 A;  4Z2K A;  3CHF A;  4NZC A;  1BL4 A;  3BXW A;  1WAW A;  3KAB A;  4PTM A;  2MNT A;  3ARU A;  1GRJ A;  2KE0 A;  4MNJ A;  3JYM A;  4WIW A;  3LKX B;  3MQH A;  1C9H A;  2D9F A;  4J4O A;  1X6L A;  3G6M A;  3JXV A;  4ZPW R;  5E64 A;  3RM4 A;  1ROU A;  5DIU A;  1NWU A;  5B8I C;  2KGJ A;  3IK8 A;  1GOI A;  2ZAJ A;  1KFW A;  3AQU A;  3ARR A;  4JFK A;  1W1Y A;  1HJX A;  1YAT A;  3LKX A;  4WKH A;  4Z2J A;  3ARX A;  4WKA A;  1FKR A;  4A0U A;  2N87 A;  1W26 A;  2PI6 A;  4ODM A;  3WKZ A;  2DSV A;  4U85 A;  1EQ3 A;  2YSF A;  3ALF A;  3CHE A;  3EIP A;  4JYS A;  2WAE A;  3KAF A;  1WNO A;  1CTN A;  1K9R A;  3KCE A;  1KT0 A;  2KR7 A;  2JMF A;  2XP7 A;  4DRI A;  3ARZ A;  1E15 A;  3FAP A;  3B7X A;  2RUQ A;  4G50 A;  3O5G A;  3H9R B;  4LAW A;  4MNK A;  2DG9 A;  2A3E A;  1SR0 A;  1ROT A;  4JFI A;  2M08 A;  3LUO A;  3RM9 A;  4L72 B;  2DT0 A;  3JYJ A;  4HAR A;  5HBF A;  1D7J A;  2DSZ A;  2BA1 A;  1JVW A;  4DRM A;  2PBC A;  1FKD A;  4U86 A;  1FJD A;  3WQW A;  2ITK A;  1EHN A;  3PRA A;  4AY1 A;  2ZQU A;  4HBE A;  2YSB A;  4G2P A;  1ZBC A;  5HW6 A;  1BKF A;  4P8V A;  1NSG A;  4Q22 A;  4NNR A;  1RD6 A;  4W9P A;  4W9O A;  1XHG A;  3O5Q A;  4DIP A;  2LPV A;  2ESC A;  3MDY B;  1LJY A;  3AS1 A;  5HW7 A;  1E6R A;  4DWS B;  4DRQ A;  3O5F A;  2F2D A;  1K9Q A;  3BMB A;  2IF4 A;  3WH0 A;  3RGC A;  1LL6 A;  3M85 A;  2ZR5 A;  1H0G A;  2WK2 A;  3M7N A;  4R0X A;  5HWB A;  3WD1 A;  4MPK A;  3NRK A;  1ZL1 A;  1FFQ A;  4JFJ A;  3UI4 A;  1J4I A;  3FY1 A;  1EG4 A;  4DWS A;  1D2K A;  2LKN A;  5E66 A;  1TFV A;  3WD0 A;  5HKG A;  1EG3 A;  2MLZ A;  3O5O A;  2WAD A;  4URI A;  2XPB A;  4QT2 A;  3FXY A;  4KR0 B;  1FKH A;  1OGG A;  2ZQS A;  2QF8 A;  5E5W A;  5E62 A;  2MF9 A;  5E65 A;  1TR8 A;  4IQC A;  3O5J A;  3LE4 A;  3PRB A;  4DRK A;  2AWG A;  3WL0 A;  1WB0 A;  1JCH B;  3WD2 A;  2LAJ A;  3RFW A;  1PIN A;  4FN2 A;  1WR7 A;  1NMW A;  1JMQ A;  2DT1 A;  4QT3 A;  5CQ2 A;  1ZU8 A;  4TW7 A;  4DZ3 A;  3CGN A;  2Y78 A;  3KAD A;  4P8X A;  1X6N A;  3B9D A;  4LAX A;  1J4R A;  4XAK A;  1EIB A;  4ZPT R;  1W9V A;  2PV2 A;  5HW8 A;  3ARW A;  2DJY A;  3G6L A;  4HBO A;  4GLX A;  5I98 A;  3TDB A;  1NWT A;  2DPE A;  4MTV A;  1ZB5 A;  2F21 A;  2L4J A;  3RME A;  3AS0 A;  3CNG A;  3QOK A;  5AHT A;  4ZS6 A;  2AOS A;  1GPF A;  1LG2 A;  3O5M A;  4DZ2 A;  1WMV A;  2RE3 A;  3OOB A;  1QPL A;  3WIJ A;  4WJX A;  5DIT A;  1UR9 A;  4S3J A;  1W9U A;  4W9Q A;  2VN1 A;  3ARQ A;  2Y8N B;  3EY6 A;  1A7X A;  4R5E A;  1HKM A;  2B5U B;  2PV3 A;  3PA7 A;  2ZR4 A;  1JNT A;  2MDI A;  2FDM A;  2A3C A;  2DK1 A;  2M8J A;  4LGX A;  2XP6 A;  2ZQV A;  2DG4 A;  4LAV A;  1LL4 A;  2RQS A;  2KFW A;  2YBU A;  2RUC A;  1L1P A;  3PQH A;  2WM0 A;  3O5I A;  1NWR A;  4Q7N A;  1FKB A;  3KAC A;  2DSU A;  2PN0 A;  4W5U A;  3CH9 A;  2YAJ B;  4N19 A;  1ITX A;  2DG3 A;  4IQ2 A;  2YSG A;  2MPH A;  1B6C A;  3NI6 A;  4WK9 A;  5HTG A;  1K9T A;  5D75 A;  4MNL A;  2XP5 A;  4ODQ A;  4IT4 A;  4DRN A;  4MSP A;  2ZR6 A;  2M2A A;  1GUV A;  2M3O W;  2F23 A;  4ODO A;  3KAH A;  4E5R A;  2KO7 A;  1LG1 A;  2B31 A;  4FAP A;  1T11 A;  3WD4 A;  4ZPV R;  4DRO A;  2JX8 A;  1ZCN A;  3MCB B;  1F40 A;  1ZBK A;  2O92 A;  4ITZ A;  3UI5 A;  4DRP A;  1YW5 A;  3ARS A;  3IKD A;  4TYO A;  1FKG A;  4Z2G A;  1JND A;  1JNE A;  1RP5 A;  1O6W A;  1NMV A;  1P5Q A;  2FKE A;  2XP4 A;  1E9L A;  2XPA A;  4P8W A;  4P8U A;  2EZ5 W;  3GPK A;  1KT1 A;  4U84 A;  3MCB A;  1FLC A;  2YSI A;  3GU0 A;  5GQB A;  4ODK A;  1UR8 A;  5GPR A;  1N1A A;  1PBK A;  4ML4 A;  1Q6H A;  4S3K A;  2OFN A;  2PV1 A;  5DO2 A;  2XP3 A;  1F8A B;  1QPF A;  4ODR A;  3PR9 A;  2PPO A;  3ARP A;  5DF0 A;  3RM8 A;  2DT2 A;  2FAP A;  2YBT A;  4O2T A;  5HT1 A;  4Z2H A;  3L4H A;  4IT6 A;  2KXQ A;  2K8I A;  1E6P A;  1FAP A;  2IUZ A;  1W1P A;  3TCZ A;  3ARO A;  4WKF A;  2LGO A;  1TCO C;  4LAY A;  2E45 A;  2JV4 A;  5GPG A;  3ODK A;  1QZ2 A;  3GTY X;  1J4H A;  2KI3 A;  2MLY A;  2DSW A;  3O5R A;  2XP9 A;  2M1I A;  1HJW A;  2VCD A;  4DRJ A;  1U79 A;  2OWO A;  4MNM A;  3ARY A;  4DWS D;  3ARV A;  1R9H A;  3FSB A;  1FFR A;  4ODN A;  1ZBW A;  4TW6 A;  3UQB A;  3IHZ A;  1LQ0 A;  1LL7 A;  4DRH A;  2JXW A;  4J4N A;  4JFL A;  1FKJ A;  1Y0O A;  1W1V A;  3UQA A;  2A3A A;  1D7H A;  3KZ7 A;  5U47 A;  2EUL A;  1HKK A;  5BXJ A;  1E44 A;  1VF8 A;  4KQZ A;  3WD3 A;  3IKG A;  1HJV A;  2WLZ A;  1W1T A;  3CHD A;  4NSB A;  2WLY A;  1OGB A;  1HKJ A;  1NH6 A;  2XP8 A;  5JH8 A;  2F4E A;  4QZV B;  3TC5 A;  3OA5 A;  5J6E A;  4MAV A;  2O9O A;  2DMV A;  3FS8 A;  4A0T A;  5DIV A;  1W9P A;  3B9A A;  1E6N A; 
#chains in the Genus database with same CATH homology
 3UQI A;  2UZ5 A;  1ZBV A;  4ODP A;  1D6O A;  3W4R A;  2JZV A;  4Z2L A;  2RUR A;  4GGQ A;  2QRV A;  1NWS A;  1FKI A;  2MLX A;  3AS2 A;  3PRD A;  4ODL A;  1EDQ A;  4Z2I A;  1I5H W;  2PPP A;  4BF8 A;  1M5Y A;  1Q1C A;  1FKL A;  4TNS A;  2DWV A;  3ALG A;  1JNS A;  4QIB A;  1FKS A;  1FD9 A;  4TW8 A;  4TX0 A;  2YSH A;  2RUD A;  4REX A;  1HXV A;  1Q6U A;  3UF8 A;  2DK7 A;  3KAI A;  4IPX A;  1D7I A;  4DWS C;  1J6Y A;  5HWC A;  5DEZ A;  2ZQT A;  3KAG A;  3FSC A;  1EYM A;  1Q6I A;  3O5D A;  3WL1 A;  2G8Z A;  1FKT A;  1SYT A;  3O5E A;  2M8I A;  4L3N A;  3CGM A;  2A3B A;  3B8S A;  3NTP A;  1ZK6 A;  3ART A;  1IX5 A;  1TK7 A;  3CHC A;  3WQV A;  2OLH A;  4DT4 A;  1OWQ A;  3O5P A;  5HUA A;  1HKI A;  2RSE A;  4MGV A;  2DT3 A;  1O6I A;  3B9E A;  2L2S A;  3UI6 A;  3AS3 A;  4C02 B;  1E6Z A;  4GIV A;  1XRV A;  1FKK A;  2G41 A;  3O5L A;  1H0I A;  2PPN A;  3MQG A;  3CZ8 A;  3I6C A;  3VAW A;  2Q5A A;  4DH0 A;  4JFM A;  3O5K A;  1FKF A;  2LJ4 A;  4Z2K A;  3CHF A;  4NZC A;  1BL4 A;  3BXW A;  1WAW A;  3KAB A;  4PTM A;  2MNT A;  3ARU A;  2KE0 A;  4MNJ A;  3JYM A;  4WIW A;  3LKX B;  3MQH A;  1C9H A;  2D9F A;  4J4O A;  1X6L A;  3G6M A;  3JXV A;  4ZPW R;  5E64 A;  3RM4 A;  1ROU A;  5DIU A;  1NWU A;  5B8I C;  2KGJ A;  3IK8 A;  1GOI A;  2ZAJ A;  1KFW A;  3AQU A;  3ARR A;  4JFK A;  1W1Y A;  1HJX A;  1YAT A;  3LKX A;  4WKH A;  4Z2J A;  3ARX A;  4WKA A;  1FKR A;  4A0U A;  2N87 A;  1W26 A;  2PI6 A;  4ODM A;  3WKZ A;  2DSV A;  4U85 A;  1EQ3 A;  2YSF A;  3ALF A;  3CHE A;  4JYS A;  2WAE A;  3KAF A;  1WNO A;  1CTN A;  1K9R A;  3KCE A;  1KT0 A;  2KR7 A;  2JMF A;  2XP7 A;  4DRI A;  3ARZ A;  1E15 A;  3FAP A;  3B7X A;  2RUQ A;  4G50 A;  3O5G A;  3H9R B;  4LAW A;  4MNK A;  2DG9 A;  2A3E A;  1SR0 A;  1ROT A;  4JFI A;  2M08 A;  3LUO A;  3RM9 A;  4L72 B;  2DT0 A;  3JYJ A;  4HAR A;  5HBF A;  1D7J A;  2DSZ A;  2BA1 A;  1JVW A;  4DRM A;  2PBC A;  1FKD A;  4U86 A;  1FJD A;  3WQW A;  2ITK A;  1EHN A;  3PRA A;  4AY1 A;  2ZQU A;  4HBE A;  2YSB A;  4G2P A;  1ZBC A;  5HW6 A;  1BKF A;  4P8V A;  1NSG A;  4Q22 A;  4NNR A;  1RD6 A;  4W9P A;  4W9O A;  1XHG A;  3O5Q A;  4DIP A;  2LPV A;  2ESC A;  3MDY B;  1LJY A;  3AS1 A;  5HW7 A;  1E6R A;  4DWS B;  4DRQ A;  3O5F A;  2F2D A;  1K9Q A;  2IF4 A;  3WH0 A;  3RGC A;  1LL6 A;  3M85 A;  2ZR5 A;  1H0G A;  2WK2 A;  3M7N A;  4R0X A;  5HWB A;  3WD1 A;  4MPK A;  3NRK A;  1ZL1 A;  1FFQ A;  4JFJ A;  3UI4 A;  1J4I A;  3FY1 A;  1EG4 A;  4DWS A;  1D2K A;  2LKN A;  5E66 A;  1TFV A;  3WD0 A;  5HKG A;  1EG3 A;  2MLZ A;  3O5O A;  2WAD A;  4URI A;  2XPB A;  4QT2 A;  3FXY A;  4KR0 B;  1FKH A;  1OGG A;  2ZQS A;  2QF8 A;  5E5W A;  5E62 A;  2MF9 A;  5E65 A;  1TR8 A;  4IQC A;  3O5J A;  3LE4 A;  3PRB A;  4DRK A;  2AWG A;  3WL0 A;  1WB0 A;  3WD2 A;  2LAJ A;  3RFW A;  1PIN A;  4FN2 A;  1WR7 A;  1NMW A;  1JMQ A;  2DT1 A;  4QT3 A;  5CQ2 A;  1ZU8 A;  4TW7 A;  4DZ3 A;  3CGN A;  2Y78 A;  3KAD A;  4P8X A;  1X6N A;  3B9D A;  4LAX A;  1J4R A;  4XAK A;  1EIB A;  4ZPT R;  1W9V A;  2PV2 A;  5HW8 A;  3ARW A;  2DJY A;  3G6L A;  4HBO A;  4GLX A;  5I98 A;  3TDB A;  1NWT A;  2DPE A;  4MTV A;  1ZB5 A;  2F21 A;  2L4J A;  3RME A;  3AS0 A;  3CNG A;  3QOK A;  5AHT A;  4ZS6 A;  2AOS A;  1GPF A;  1LG2 A;  3O5M A;  4DZ2 A;  1WMV A;  2RE3 A;  3OOB A;  1QPL A;  3WIJ A;  4WJX A;  5DIT A;  1UR9 A;  4S3J A;  1W9U A;  4W9Q A;  2VN1 A;  3ARQ A;  2Y8N B;  3EY6 A;  1A7X A;  4R5E A;  1HKM A;  2PV3 A;  3PA7 A;  2ZR4 A;  1JNT A;  2MDI A;  2FDM A;  2A3C A;  2DK1 A;  2M8J A;  4LGX A;  2XP6 A;  2ZQV A;  2DG4 A;  4LAV A;  1LL4 A;  2RQS A;  2KFW A;  2YBU A;  2RUC A;  1L1P A;  3PQH A;  2WM0 A;  3O5I A;  1NWR A;  4Q7N A;  1FKB A;  3KAC A;  2DSU A;  4W5U A;  3CH9 A;  2YAJ B;  4N19 A;  1ITX A;  2DG3 A;  4IQ2 A;  2YSG A;  2MPH A;  1B6C A;  3NI6 A;  4WK9 A;  5HTG A;  1K9T A;  5D75 A;  4MNL A;  2XP5 A;  4ODQ A;  4IT4 A;  4DRN A;  4MSP A;  2ZR6 A;  2M2A A;  1GUV A;  2M3O W;  4ODO A;  3KAH A;  4E5R A;  2KO7 A;  1LG1 A;  2B31 A;  4FAP A;  1T11 A;  3WD4 A;  4ZPV R;  4DRO A;  2JX8 A;  1ZCN A;  3MCB B;  1F40 A;  1ZBK A;  2O92 A;  4ITZ A;  3UI5 A;  4DRP A;  1YW5 A;  3ARS A;  3IKD A;  4TYO A;  1FKG A;  4Z2G A;  1JND A;  1JNE A;  1RP5 A;  1O6W A;  1NMV A;  1P5Q A;  2FKE A;  2XP4 A;  1E9L A;  2XPA A;  4P8W A;  4P8U A;  2EZ5 W;  3GPK A;  1KT1 A;  4U84 A;  3MCB A;  1FLC A;  2YSI A;  5GQB A;  4ODK A;  1UR8 A;  5GPR A;  1N1A A;  1PBK A;  4ML4 A;  1Q6H A;  4S3K A;  2OFN A;  2PV1 A;  5DO2 A;  2XP3 A;  1F8A B;  1QPF A;  4ODR A;  3PR9 A;  2PPO A;  3ARP A;  5DF0 A;  3RM8 A;  2DT2 A;  2FAP A;  2YBT A;  4O2T A;  5HT1 A;  4Z2H A;  3L4H A;  4IT6 A;  2KXQ A;  2K8I A;  1E6P A;  1FAP A;  2IUZ A;  1W1P A;  3TCZ A;  3ARO A;  4WKF A;  2LGO A;  1TCO C;  4LAY A;  2E45 A;  2JV4 A;  5GPG A;  3ODK A;  1QZ2 A;  1J4H A;  2KI3 A;  2MLY A;  2DSW A;  3O5R A;  2XP9 A;  2M1I A;  1HJW A;  2VCD A;  4DRJ A;  1U79 A;  2OWO A;  4MNM A;  3ARY A;  4DWS D;  3ARV A;  1R9H A;  3FSB A;  1FFR A;  4ODN A;  1ZBW A;  4TW6 A;  3UQB A;  3IHZ A;  1LQ0 A;  1LL7 A;  4DRH A;  2JXW A;  4J4N A;  4JFL A;  1FKJ A;  1Y0O A;  1W1V A;  3UQA A;  2A3A A;  1D7H A;  3KZ7 A;  5U47 A;  1HKK A;  5BXJ A;  4KQZ A;  1VF8 A;  3WD3 A;  3IKG A;  1HJV A;  2WLZ A;  1W1T A;  3CHD A;  4NSB A;  2WLY A;  1OGB A;  1HKJ A;  1NH6 A;  2XP8 A;  5JH8 A;  2F4E A;  4QZV B;  3TC5 A;  3OA5 A;  5J6E A;  4MAV A;  2O9O A;  2DMV A;  3FS8 A;  4A0T A;  5DIV A;  1W9P A;  3B9A A;  1E6N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...