2ZQVA

Crystal structure of a mutant pin1 peptidyl-prolyl cis-trans isomerase
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
158
structure length
153
Chain Sequence
KLPPGWEKRMSRSSGRVYYANHITNASQWERPSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structural studies on PIN1 mutants
rcsb
source organism Homo sapiens
total genus 45
structure length 153
sequence length 158
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2008-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2zqvA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2zqvA02
2XP9A 3O5KA 2ZQTA 4W9QA 2DMVA 1QZ2A 2DG9A 3KZ7A 1JNSA 1EG4A 4DIPA 2PPNA 1A7XA 3O5RA 4TW6A 4C02B 4ODMA 2VN1A 1KT0A 5CQ2A 2UZ5A 4TW7A 1FKJA 1C9HA 3JXVA 4N19A 3NRKA 1JVWA 1TCOC 1U79A 1FKSA 2PPPA 3H9RB 2RQSA 3KADA 3EY6A 4ITZA 4JFLA 1J6YA 1FAPA 2XP8A 2JMFA 2ZR6A 2DJYA 1Q1CA 1FKIA 3KAIA 5DITA 3I6CA 3O5OA 4LAWA 5HTGA 5B8IC 1PINA 3UI5A 1N1AA 4ODQA 4MGVA 1D7JA 4FAPA 2ZR5A 1FKFA 2MDIA 2PV2A 4NNRA 1EG3A 1YW5A 2XP4A 3ODKA 3MDYB 2YSIA 1J4IA 4IQCA 1J4HA 3IK8A 2DWVA 4JFJA 1O6WA 1FKGA 2IF4A 2RUCA 2ZR4A 4ODPA 2ITKA 2OFNA 2KXQA 2FKEA 1M5YA 3PRBA 3O5LA 3KABA 3JYMA 1ZCNA 2LJ4A 2XP5A 1W26A 2ZQVA 2F2DA 3UQAA 2ZQSA 4DRKA 4JFMA 1D7HA 1KT1A 3NI6A 4U86A 4W9OA 1BL4A 2DK7A 2PV1A 2KGJA 4DRNA 1FKTA 5AHTA 5HUAA 3IKDA 1I5HW 1FKBA 2KI3A 2M8JA 3PRDA 1Q6IA 5HT1A 2MLYA 1K9QA 5HKGA 4QT2A 2M08A 4DROA 3B7XA 1HXVA 1Q6HA 1D7IA 2RSEA 3KAFA 3CGNA 5HW7A 3M7NA 4W9PA 2F4EA 4GGQA 4TX0A 4U85A 5D75A 3KAHA 4ODOA 2LGOA 2YSFA 3LE4A 3O5GA 1EYMA 1NSGA 4TYOA 1K9RA 3O5QA 4E5RA 1BKFA 5HW8A 1JNTA 4GIVA 2L2SA 4ODKA 2ZQUA 1FKHA 3TC5A 1YATA 3JYJA 1FJDA 2MNTA 4DRJA 3O5IA 4JFKA 4JFIA 2FAPA 1EQ3A 3IKGA 3O5DA 1FD9A 2MLZA 3FAPA 1TK7A 4ODLA 4DRQA 2F21A 2VCDA 2MPHA 4ODRA 4TNSA 2YSGA 2RUDA 2MLXA 1Y0OA 1D6OA 3UI4A 4IPXA 1JMQA 3O5MA 3M85A 2LAJA 3O5JA 3CNGA 2M1IA 2L4JA 1FKLA 1FKRA 2PPOA 2XP3A 4R0XA 3UQIA 1ZK6A 3UQBA 1F8AB 2RE3A 2M3OW 2DK1A 2D9FA 5HWBA 3TDBA 3UI6A 2M2AA 1QPFA 2JX8A 2JZVA 4J4OA 2KO7A 5HW6A 1PBKA 3UF8A 2XPAA 3KCEA 5J6EA 1FKKA 2XPBA 4O2TA 5I98A 3NTPA 4DRMA 5BXJA 3IHZA 2Q5AA 2KE0A 4JYSA 2PV3A 4DZ2A 1WMVA 1ROUA 2RURA 1ROTA 2LPVA 4LAYA 3O5EA 4G2PA 4REXA 2YSHA 1J4RA 4U84A 2PBCA 1QPLA 5HWCA 2AWGA 4BF8A 4DRHA 3O5PA 2KFWA 3CGMA 1NMWA 3WH0A 5DIVA 4DRPA 3OOBA 4QIBA 1T11A 2K8IA 2N87A 4IQ2A 2DG4A 3GPKA 2KR7A 1R9HA 2BA1A 2EZ5W 4DH0A 4J4NA 1FKDA 3L4HA 2ZAJA 1P5QA 3RGCA 2M8IA 4DT4A 5GPGA 4QT3A 3O5FA 4G50A 2XP6A 1B6CA 2DG3A 2RUQA 1Q6UA 3TCZA 2E45A 4LAVA 1NMVA 4MSPA 4LAXA 2XP7A 4DZ3A 3LUOA 3VAWA 4ODNA 4DRIA 4FN2A 3KAGA 2JXWA 1L1PA 3PA7A 2JV4A 2Y78A 2LKNA 2YSBA 3RFWA 5DIUA 2MF9A 1WR7A 1F40A 4TW8A 3KACA
chains in the Genus database with same CATH superfamily
1ZBKA 4XAKA 2XP9A 3O5KA 3WD4A 2ZQTA 4MNJA 5U47A 4W9QA 2DMVA 1QZ2A 1EHNA 2DG9A 4A0TA 1W9PA 4HARA 4WKHA 3KZ7A 3RM9A 1JNSA 1EG4A 4DIPA 3B9EA 3MCBB 3ARPA 2PPNA 1A7XA 4NZCA 4L3NA 4GLXA 3O5RA 4TW6A 4C02B 4ODMA 1HKKA 2VN1A 2A3BA 3LKXA 1KT0A 5CQ2A 2UZ5A 4TW7A 1FKJA 1C9HA 3JXVA 4N19A 3NRKA 1LG1A 2YAJB 1JVWA 1TCOC 1U79A 1FKSA 2PPPA 1LL4A 2RQSA 3H9RB 3KADA 1HJWA 3EY6A 4ITZA 3ARSA 4JFLA 4ML4A 1FAPA 4ZPWR 2XP8A 1J6YA 2JMFA 2ZR6A 1D2KA 2DJYA 1Q1CA 1FKIA 2WAEA 3KAIA 1EDQA 3CH9A 5E62A 2DT3A 5DITA 3I6CA 3O5OA 4LAWA 5HTGA 5E64A 2DPEA 5B8IC 1PINA 4DWSD 2PN0A 2WLZA 3UI5A 1N1AA 3WD0A 4ODQA 4MGVA 1D7JA 4FAPA 2ZR5A 1FKFA 2MDIA 2PV2A 4NNRA 3ARVA 1EG3A 1YW5A 2XP4A 3ODKA 1W1VA 3MDYB 2YSIA 4PTMA 1NWSA 3B9DA 2DSZA 1J4IA 3WD2A 1JNEA 4IQCA 1J4HA 3PR9A 3IK8A 4WKAA 3FXYA 1GOIA 1ZBVA 2DWVA 4JFJA 3CHDA 1O6WA 3WL1A 1FKGA 1TFVA 2IF4A 5GPRA 1K9TA 2RUCA 2B5UB 3G6MA 2ZR4A 1W9UA 1OWQA 4ODPA 2ITKA 3WIJA 2OFNA 1E6NA 2KXQA 2FKEA 1OGGA 1M5YA 3PRBA 4Z2IA 3O5LA 3AROA 3KABA 3JYMA 1ZCNA 2LJ4A 2XP5A 2F2DA 2ZQVA 1W26A 1X6LA 3UQAA 2ZQSA 2YBTA 4DRKA 4JFMA 1D7HA 1KT1A 1RP5A 3NI6A 4U86A 4W9OA 1BL4A 2DK7A 2PV1A 3GTYX 4WKFA 4ZPTR 3ARRA 4MTVA 3WQWA 1JCHB 1FLCA 1FFRA 2KGJA 4DRNA 1FKTA 1GUVA 4MNLA 5AHTA 3ARYA 5HUAA 2OWOA 2AOSA 3IKDA 1I5HW 1NWUA 1O6IA 1FKBA 2KI3A 2M8JA 2PI6A 4P8WA 5DO2A 1E6RA 3RM8A 3PRDA 1Q6IA 4IT4A 5HT1A 2MLYA 1K9QA 2DT2A 1SR0A 5HKGA 4QT2A 2M08A 4DROA 3B7XA 5E5WA 1HXVA 2ETNA 2OLHA 3BXWA 2DSVA 1Q6HA 4HBOA 3FY1A 1D7IA 1JNDA 1WB0A 2RSEA 3KAFA 3CGNA 4Q7NA 3RM4A 4UDMA 5HW7A 3M7NA 1LJYA 2A3AA 2YBUA 4P8VA 4W9PA 2F4EA 3WD3A 4GGQA 5E65A 4TX0A 3AS1A 3AQUA 3QOKA 4U85A 5D75A 1RD6A 2WADA 3OA5A 3KAHA 4ODOA 2LGOA 2YSFA 3LE4A 3O5GA 1SYTA 1XHGA 1EYMA 1NSGA 2O92A 4S3KA 4TYOA 1K9RA 3O5QA 4E5RA 2WK2A 4DWSA 1BKFA 4S3JA 5HBFA 5HW8A 1JNTA 4Z2JA 4GIVA 1ZU8A 3GU0A 2L2SA 4P8UA 4ODKA 4L72B 2ZQUA 3FSBA 3WKZA 1FKHA 1UR8A 3TC5A 1YATA 3JYJA 1FJDA 2MNTA 4DRJA 3O5IA 2QRVA 4JFKA 4Q22A 4JFIA 2FAPA 3LKXB 1W1PA 1EQ3A 3IKGA 3O5DA 3AS3A 4Z2LA 1FD9A 2MLZA 2QF8A 4LGXA 3FAPA 1TK7A 4ODLA 4ZPVR 3FSCA 4DRQA 2F21A 1H0IA 2VCDA 3MQHA 1EIBA 1X6NA 2MPHA 1LL7A 4ODRA 3ARUA 4TNSA 2YSGA 2RUDA 1W1YA 2MLXA 1Y0OA 1D6OA 3UI4A 3PRAA 4IPXA 1JMQA 3O5MA 3M85A 2LAJA 3MCBA 1E6ZA 3O5JA 3CNGA 3CHFA 1NWTA 2FDMA 2M1IA 2L4JA 1ITXA 1E9LA 1FKLA 1FKRA 2PPOA 2XP3A 2EULA 4A0UA 4R0XA 3FS8A 1WAWA 2A3CA 3ARQA 2F23A 3UQIA 1ZK6A 2ESCA 2A3EA 1LL6A 4WIWA 3CHEA 3UQBA 1F8AB 2RE3A 2M3OW 2DK1A 3ALFA 2D9FA 5HWBA 4W5UA 3TDBA 1HJXA 3UI6A 2M2AA 1QPFA 2JX8A 2JZVA 4J4OA 3AS2A 2KO7A 3EIPA 5HW6A 1PBKA 3UF8A 2XPAA 3KCEA 1LG2A 4Z2HA 1HKMA 3CHCA 5J6EA 1H0GA 1FKKA 2XPBA 1GRJA 4O2TA 5I98A 3NTPA 1ZBCA 1UR9A 3AS0A 4DRMA 5BXJA 3IHZA 2Q5AA 2KE0A 4MNMA 4IT6A 4JYSA 4KR0B 2IUZA 3BMBA 2PV3A 5GQBA 1TR8A 1OGBA 1WNOA 4WJXA 4DZ2A 1E6PA 1E44A 1VF8A 4P8XA 1WMVA 1ROUA 2RURA 1ROTA 2LPVA 4R5EA 4LAYA 4MPKA 4NSBA 3O5EA 4G2PA 4REXA 2YSHA 4ZS6A 1FFQA 1J4RA 4U84A 1IX5A 2PBCA 1QPLA 5HWCA 2AWGA 4BF8A 1NWRA 4DRHA 3O5PA 2KFWA 3CGMA 2Y8NB 5DEZA 3G6LA 1NMWA 3WL0A 3WH0A 3ARZA 1CTNA 3PQHA 5DIVA 4DRPA 3ARTA 3OOBA 4QIBA 4MNKA 1T11A 3WQVA 2K8IA 3MQGA 2N87A 4IQ2A 1HKIA 1KFWA 1GPFA 2DG4A 3WD1A 1ZBWA 3GPKA 4URIA 4AY1A 2KR7A 2P4VA 1R9HA 3RMEA 2BA1A 2EZ5W 4MAVA 4J4NA 4DH0A 1FKDA 3L4HA 2ZAJA 1P5QA 1XRVA 3RGCA 1NH6A 2M8IA 3B8SA 4DT4A 3CZ8A 3ALGA 1HKJA 5GPGA 5JH8A 4QT3A 2G8ZA 3O5FA 2DSWA 5E66A 4G50A 3ARWA 2XP6A 3ARXA 1B6CA 2DG3A 2RUQA 5DF0A 1Q6UA 4DWSB 3TCZA 4DWSC 4Z2KA 2E45A 4LAVA 4HBEA 1NMVA 4MSPA 4LAXA 2DT0A 2XP7A 4Z2GA 4DZ3A 3LUOA 3W4RA 2B31A 3VAWA 1ZB5A 4ODNA 1W9VA 1LQ0A 4KQZA 4DRIA 2O9OA 4FN2A 3KAGA 2JXWA 1W1TA 2DSUA 1L1PA 3PA7A 2JV4A 4QZVB 1E15A 3B9AA 2Y78A 2LKNA 2YSBA 3RFWA 4WK9A 5DIUA 2MF9A 1WR7A 2DT1A 2G41A 1F40A 1ZL1A 1HJVA 2WLYA 2WM0A 4TW8A 3KACA
chains in the Genus database with same CATH topology
1ZBKA 4XAKA 2XP9A 3O5KA 3WD4A 2ZQTA 4MNJA 5U47A 4W9QA 2DMVA 1QZ2A 1EHNA 2DG9A 4A0TA 1W9PA 4HARA 4WKHA 3KZ7A 3RM9A 1JNSA 1EG4A 4DIPA 3B9EA 3MCBB 3ARPA 2PPNA 1A7XA 4NZCA 4L3NA 4GLXA 3O5RA 4TW6A 4C02B 4ODMA 1HKKA 2VN1A 2A3BA 3LKXA 1KT0A 5CQ2A 2UZ5A 4TW7A 1FKJA 1C9HA 3JXVA 4N19A 3NRKA 1LG1A 2YAJB 1JVWA 1TCOC 1U79A 1FKSA 2PPPA 1LL4A 2RQSA 3H9RB 3KADA 1HJWA 3EY6A 4ITZA 3ARSA 4JFLA 4ML4A 1FAPA 4ZPWR 2XP8A 1J6YA 2JMFA 2ZR6A 1D2KA 2DJYA 1Q1CA 1FKIA 2WAEA 3KAIA 1EDQA 3CH9A 5E62A 2DT3A 5DITA 3I6CA 3O5OA 4LAWA 5HTGA 5E64A 2DPEA 5B8IC 1PINA 4DWSD 3UI5A 2WLZA 3WD0A 1N1AA 4ODQA 4MGVA 1D7JA 4FAPA 2ZR5A 1FKFA 2MDIA 2PV2A 4NNRA 3ARVA 1EG3A 1YW5A 2XP4A 3ODKA 1W1VA 3MDYB 2YSIA 4PTMA 1NWSA 3B9DA 2DSZA 1J4IA 3WD2A 1JNEA 4IQCA 1J4HA 3PR9A 3IK8A 4WKAA 3FXYA 1GOIA 1ZBVA 2DWVA 4JFJA 3CHDA 1O6WA 3WL1A 1FKGA 1TFVA 2IF4A 5GPRA 1K9TA 2RUCA 3G6MA 2ZR4A 1W9UA 1OWQA 4ODPA 2ITKA 3WIJA 2OFNA 1E6NA 2KXQA 2FKEA 1OGGA 1M5YA 3PRBA 4Z2IA 3O5LA 3AROA 3KABA 3JYMA 1ZCNA 2LJ4A 2XP5A 2F2DA 2ZQVA 1W26A 1X6LA 3UQAA 2ZQSA 2YBTA 4DRKA 4JFMA 1D7HA 1KT1A 1RP5A 3NI6A 4U86A 4W9OA 1BL4A 2DK7A 2PV1A 4WKFA 4ZPTR 3ARRA 4MTVA 3WQWA 1FLCA 1FFRA 2KGJA 4DRNA 1FKTA 1GUVA 4MNLA 5AHTA 3ARYA 5HUAA 2OWOA 2AOSA 3IKDA 1I5HW 1NWUA 1O6IA 1FKBA 2KI3A 2M8JA 2PI6A 4P8WA 5DO2A 1E6RA 3RM8A 3PRDA 1Q6IA 4IT4A 5HT1A 2MLYA 1K9QA 2DT2A 1SR0A 5HKGA 4QT2A 2M08A 4DROA 3B7XA 5E5WA 1HXVA 2OLHA 3BXWA 2DSVA 1Q6HA 4HBOA 3FY1A 1D7IA 1JNDA 1WB0A 2RSEA 3KAFA 3CGNA 4Q7NA 3RM4A 5HW7A 3M7NA 1LJYA 2A3AA 2YBUA 4P8VA 4W9PA 2F4EA 3WD3A 4GGQA 5E65A 4TX0A 3AS1A 3AQUA 3QOKA 4U85A 5D75A 1RD6A 2WADA 3OA5A 3KAHA 4ODOA 2LGOA 2YSFA 3LE4A 3O5GA 1SYTA 1XHGA 1EYMA 1NSGA 2O92A 4S3KA 4TYOA 1K9RA 3O5QA 4E5RA 2WK2A 4DWSA 1BKFA 4S3JA 5HBFA 5HW8A 1JNTA 4Z2JA 4GIVA 1ZU8A 2L2SA 4P8UA 4ODKA 4L72B 2ZQUA 3FSBA 3WKZA 1FKHA 1UR8A 3TC5A 1YATA 3JYJA 1FJDA 2MNTA 4DRJA 3O5IA 2QRVA 4JFKA 4Q22A 4JFIA 2FAPA 3LKXB 1W1PA 1EQ3A 3IKGA 3O5DA 3AS3A 4Z2LA 1FD9A 2MLZA 2QF8A 4LGXA 3FAPA 1TK7A 4ODLA 4ZPVR 3FSCA 4DRQA 2F21A 1H0IA 2VCDA 3MQHA 1EIBA 1X6NA 2MPHA 1LL7A 4ODRA 3ARUA 4TNSA 2YSGA 2RUDA 1W1YA 2MLXA 1Y0OA 1D6OA 3UI4A 3PRAA 4IPXA 1JMQA 3O5MA 3M85A 2LAJA 3MCBA 1E6ZA 3O5JA 3CNGA 3CHFA 1NWTA 2FDMA 2M1IA 2L4JA 1ITXA 1E9LA 1FKLA 1FKRA 2PPOA 2XP3A 4A0UA 4R0XA 3FS8A 1WAWA 2A3CA 3ARQA 3UQIA 1ZK6A 2ESCA 2A3EA 1LL6A 4WIWA 3CHEA 3UQBA 1F8AB 2RE3A 2M3OW 2DK1A 3ALFA 2D9FA 5HWBA 4W5UA 3TDBA 1HJXA 3UI6A 2M2AA 1QPFA 2JX8A 2JZVA 4J4OA 3AS2A 2KO7A 5HW6A 1PBKA 3UF8A 2XPAA 3KCEA 1LG2A 4Z2HA 1HKMA 3CHCA 5J6EA 1H0GA 1FKKA 2XPBA 4O2TA 5I98A 3NTPA 1ZBCA 1UR9A 3AS0A 4DRMA 5BXJA 3IHZA 2Q5AA 2KE0A 4MNMA 4IT6A 4JYSA 4KR0B 2IUZA 2PV3A 5GQBA 1TR8A 1OGBA 1WNOA 4WJXA 4DZ2A 1E6PA 1VF8A 4P8XA 1WMVA 1ROUA 2RURA 1ROTA 2LPVA 4R5EA 4LAYA 4MPKA 4NSBA 3O5EA 4G2PA 4REXA 2YSHA 4ZS6A 1FFQA 1J4RA 4U84A 1IX5A 2PBCA 1QPLA 5HWCA 2AWGA 4BF8A 1NWRA 4DRHA 3O5PA 2KFWA 3CGMA 2Y8NB 5DEZA 3G6LA 1NMWA 3WL0A 3WH0A 3ARZA 1CTNA 3PQHA 5DIVA 4DRPA 3ARTA 3OOBA 4QIBA 4MNKA 1T11A 3WQVA 2K8IA 3MQGA 2N87A 4IQ2A 1HKIA 1KFWA 1GPFA 2DG4A 3WD1A 1ZBWA 3GPKA 4URIA 4AY1A 2KR7A 1R9HA 3RMEA 2BA1A 2EZ5W 4MAVA 4J4NA 4DH0A 1FKDA 3L4HA 2ZAJA 1P5QA 1XRVA 3RGCA 1NH6A 2M8IA 3B8SA 4DT4A 3CZ8A 3ALGA 1HKJA 5GPGA 5JH8A 4QT3A 2G8ZA 3O5FA 2DSWA 5E66A 4G50A 3ARWA 2XP6A 3ARXA 1B6CA 2DG3A 2RUQA 5DF0A 1Q6UA 4DWSB 3TCZA 4DWSC 4Z2KA 2E45A 4LAVA 4HBEA 1NMVA 4MSPA 4LAXA 2DT0A 2XP7A 4Z2GA 4DZ3A 3LUOA 3W4RA 2B31A 3VAWA 1ZB5A 4ODNA 1W9VA 1LQ0A 4KQZA 4DRIA 2O9OA 4FN2A 3KAGA 2JXWA 1W1TA 2DSUA 1L1PA 3PA7A 2JV4A 4QZVB 1E15A 3B9AA 2Y78A 2LKNA 2YSBA 3RFWA 4WK9A 5DIUA 2MF9A 1WR7A 2DT1A 2G41A 1F40A 1ZL1A 1HJVA 2WLYA 2WM0A 4TW8A 3KACA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XP9 A;  3O5K A;  2ZQT A;  4W9Q A;  2DMV A;  1QZ2 A;  2DG9 A;  3KZ7 A;  1JNS A;  1EG4 A;  4DIP A;  2PPN A;  1A7X A;  3O5R A;  4TW6 A;  4C02 B;  4ODM A;  2VN1 A;  1KT0 A;  5CQ2 A;  2UZ5 A;  4TW7 A;  1FKJ A;  1C9H A;  3JXV A;  4N19 A;  3NRK A;  1JVW A;  1TCO C;  1U79 A;  1FKS A;  2PPP A;  3H9R B;  2RQS A;  3KAD A;  3EY6 A;  4ITZ A;  4JFL A;  1J6Y A;  1FAP A;  2XP8 A;  2JMF A;  2ZR6 A;  2DJY A;  1Q1C A;  1FKI A;  3KAI A;  5DIT A;  3I6C A;  3O5O A;  4LAW A;  5HTG A;  5B8I C;  1PIN A;  3UI5 A;  1N1A A;  4ODQ A;  4MGV A;  1D7J A;  4FAP A;  2ZR5 A;  1FKF A;  2MDI A;  2PV2 A;  4NNR A;  1EG3 A;  1YW5 A;  2XP4 A;  3ODK A;  3MDY B;  2YSI A;  1J4I A;  4IQC A;  1J4H A;  3IK8 A;  2DWV A;  4JFJ A;  1O6W A;  1FKG A;  2IF4 A;  2RUC A;  2ZR4 A;  4ODP A;  2ITK A;  2OFN A;  2KXQ A;  2FKE A;  1M5Y A;  3PRB A;  3O5L A;  3KAB A;  3JYM A;  1ZCN A;  2LJ4 A;  2XP5 A;  1W26 A;  2ZQV A;  2F2D A;  3UQA A;  2ZQS A;  4DRK A;  4JFM A;  1D7H A;  1KT1 A;  3NI6 A;  4U86 A;  4W9O A;  1BL4 A;  2DK7 A;  2PV1 A;  2KGJ A;  4DRN A;  1FKT A;  5AHT A;  5HUA A;  3IKD A;  1I5H W;  1FKB A;  2KI3 A;  2M8J A;  3PRD A;  1Q6I A;  5HT1 A;  2MLY A;  1K9Q A;  5HKG A;  4QT2 A;  2M08 A;  4DRO A;  3B7X A;  1HXV A;  1Q6H A;  1D7I A;  2RSE A;  3KAF A;  3CGN A;  5HW7 A;  3M7N A;  4W9P A;  2F4E A;  4GGQ A;  4TX0 A;  4U85 A;  5D75 A;  3KAH A;  4ODO A;  2LGO A;  2YSF A;  3LE4 A;  3O5G A;  1EYM A;  1NSG A;  4TYO A;  1K9R A;  3O5Q A;  4E5R A;  1BKF A;  5HW8 A;  1JNT A;  4GIV A;  2L2S A;  4ODK A;  2ZQU A;  1FKH A;  3TC5 A;  1YAT A;  3JYJ A;  1FJD A;  2MNT A;  4DRJ A;  3O5I A;  4JFK A;  4JFI A;  2FAP A;  1EQ3 A;  3IKG A;  3O5D A;  1FD9 A;  2MLZ A;  3FAP A;  1TK7 A;  4ODL A;  4DRQ A;  2F21 A;  2VCD A;  2MPH A;  4ODR A;  4TNS A;  2YSG A;  2RUD A;  2MLX A;  1Y0O A;  1D6O A;  3UI4 A;  4IPX A;  1JMQ A;  3O5M A;  3M85 A;  2LAJ A;  3O5J A;  3CNG A;  2M1I A;  2L4J A;  1FKL A;  1FKR A;  2PPO A;  2XP3 A;  4R0X A;  3UQI A;  1ZK6 A;  3UQB A;  1F8A B;  2RE3 A;  2M3O W;  2DK1 A;  2D9F A;  5HWB A;  3TDB A;  3UI6 A;  2M2A A;  1QPF A;  2JX8 A;  2JZV A;  4J4O A;  2KO7 A;  5HW6 A;  1PBK A;  3UF8 A;  2XPA A;  3KCE A;  5J6E A;  1FKK A;  2XPB A;  4O2T A;  5I98 A;  3NTP A;  4DRM A;  5BXJ A;  3IHZ A;  2Q5A A;  2KE0 A;  4JYS A;  2PV3 A;  4DZ2 A;  1WMV A;  1ROU A;  2RUR A;  1ROT A;  2LPV A;  4LAY A;  3O5E A;  4G2P A;  4REX A;  2YSH A;  1J4R A;  4U84 A;  2PBC A;  1QPL A;  5HWC A;  2AWG A;  4BF8 A;  4DRH A;  3O5P A;  2KFW A;  3CGM A;  1NMW A;  3WH0 A;  5DIV A;  4DRP A;  3OOB A;  4QIB A;  1T11 A;  2K8I A;  2N87 A;  4IQ2 A;  2DG4 A;  3GPK A;  2KR7 A;  1R9H A;  2BA1 A;  2EZ5 W;  4DH0 A;  4J4N A;  1FKD A;  3L4H A;  2ZAJ A;  1P5Q A;  3RGC A;  2M8I A;  4DT4 A;  5GPG A;  4QT3 A;  3O5F A;  4G50 A;  2XP6 A;  1B6C A;  2DG3 A;  2RUQ A;  1Q6U A;  3TCZ A;  2E45 A;  4LAV A;  1NMV A;  4MSP A;  4LAX A;  2XP7 A;  4DZ3 A;  3LUO A;  3VAW A;  4ODN A;  4DRI A;  4FN2 A;  3KAG A;  2JXW A;  1L1P A;  3PA7 A;  2JV4 A;  2Y78 A;  2LKN A;  2YSB A;  3RFW A;  5DIU A;  2MF9 A;  1WR7 A;  1F40 A;  4TW8 A;  3KAC A; 
#chains in the Genus database with same CATH topology
 1ZBK A;  4XAK A;  2XP9 A;  3O5K A;  3WD4 A;  2ZQT A;  4MNJ A;  5U47 A;  4W9Q A;  2DMV A;  1QZ2 A;  1EHN A;  2DG9 A;  4A0T A;  1W9P A;  4HAR A;  4WKH A;  3KZ7 A;  3RM9 A;  1JNS A;  1EG4 A;  4DIP A;  3B9E A;  3MCB B;  3ARP A;  2PPN A;  1A7X A;  4NZC A;  4L3N A;  4GLX A;  3O5R A;  4TW6 A;  4C02 B;  4ODM A;  1HKK A;  2VN1 A;  2A3B A;  3LKX A;  1KT0 A;  5CQ2 A;  2UZ5 A;  4TW7 A;  1FKJ A;  1C9H A;  3JXV A;  4N19 A;  3NRK A;  1LG1 A;  2YAJ B;  1JVW A;  1TCO C;  1U79 A;  1FKS A;  2PPP A;  1LL4 A;  2RQS A;  3H9R B;  3KAD A;  1HJW A;  3EY6 A;  4ITZ A;  3ARS A;  4JFL A;  4ML4 A;  1FAP A;  4ZPW R;  2XP8 A;  1J6Y A;  2JMF A;  2ZR6 A;  1D2K A;  2DJY A;  1Q1C A;  1FKI A;  2WAE A;  3KAI A;  1EDQ A;  3CH9 A;  5E62 A;  2DT3 A;  5DIT A;  3I6C A;  3O5O A;  4LAW A;  5HTG A;  5E64 A;  2DPE A;  5B8I C;  1PIN A;  4DWS D;  2PN0 A;  2WLZ A;  3UI5 A;  1N1A A;  3WD0 A;  4ODQ A;  4MGV A;  1D7J A;  4FAP A;  2ZR5 A;  1FKF A;  2MDI A;  2PV2 A;  4NNR A;  3ARV A;  1EG3 A;  1YW5 A;  2XP4 A;  3ODK A;  1W1V A;  3MDY B;  2YSI A;  4PTM A;  1NWS A;  3B9D A;  2DSZ A;  1J4I A;  3WD2 A;  1JNE A;  4IQC A;  1J4H A;  3PR9 A;  3IK8 A;  4WKA A;  3FXY A;  1GOI A;  1ZBV A;  2DWV A;  4JFJ A;  3CHD A;  1O6W A;  3WL1 A;  1FKG A;  1TFV A;  2IF4 A;  5GPR A;  1K9T A;  2RUC A;  2B5U B;  3G6M A;  2ZR4 A;  1W9U A;  1OWQ A;  4ODP A;  2ITK A;  3WIJ A;  2OFN A;  1E6N A;  2KXQ A;  2FKE A;  1OGG A;  1M5Y A;  3PRB A;  4Z2I A;  3O5L A;  3ARO A;  3KAB A;  3JYM A;  1ZCN A;  2LJ4 A;  2XP5 A;  2F2D A;  2ZQV A;  1W26 A;  1X6L A;  3UQA A;  2ZQS A;  2YBT A;  4DRK A;  4JFM A;  1D7H A;  1KT1 A;  1RP5 A;  3NI6 A;  4U86 A;  4W9O A;  1BL4 A;  2DK7 A;  2PV1 A;  3GTY X;  4WKF A;  4ZPT R;  3ARR A;  4MTV A;  3WQW A;  1JCH B;  1FLC A;  1FFR A;  2KGJ A;  4DRN A;  1FKT A;  1GUV A;  4MNL A;  5AHT A;  3ARY A;  5HUA A;  2OWO A;  2AOS A;  3IKD A;  1I5H W;  1NWU A;  1O6I A;  1FKB A;  2KI3 A;  2M8J A;  2PI6 A;  4P8W A;  5DO2 A;  1E6R A;  3RM8 A;  3PRD A;  1Q6I A;  4IT4 A;  5HT1 A;  2MLY A;  1K9Q A;  2DT2 A;  1SR0 A;  5HKG A;  4QT2 A;  2M08 A;  4DRO A;  3B7X A;  5E5W A;  1HXV A;  2ETN A;  2OLH A;  3BXW A;  2DSV A;  1Q6H A;  4HBO A;  3FY1 A;  1D7I A;  1JND A;  1WB0 A;  2RSE A;  3KAF A;  3CGN A;  4Q7N A;  3RM4 A;  4UDM A;  5HW7 A;  3M7N A;  1LJY A;  2A3A A;  2YBU A;  4P8V A;  4W9P A;  2F4E A;  3WD3 A;  4GGQ A;  5E65 A;  4TX0 A;  3AS1 A;  3AQU A;  3QOK A;  4U85 A;  5D75 A;  1RD6 A;  2WAD A;  3OA5 A;  3KAH A;  4ODO A;  2LGO A;  2YSF A;  3LE4 A;  3O5G A;  1SYT A;  1XHG A;  1EYM A;  1NSG A;  2O92 A;  4S3K A;  4TYO A;  1K9R A;  3O5Q A;  4E5R A;  2WK2 A;  4DWS A;  1BKF A;  4S3J A;  5HBF A;  5HW8 A;  1JNT A;  4Z2J A;  4GIV A;  1ZU8 A;  3GU0 A;  2L2S A;  4P8U A;  4ODK A;  4L72 B;  2ZQU A;  3FSB A;  3WKZ A;  1FKH A;  1UR8 A;  3TC5 A;  1YAT A;  3JYJ A;  1FJD A;  2MNT A;  4DRJ A;  3O5I A;  2QRV A;  4JFK A;  4Q22 A;  4JFI A;  2FAP A;  3LKX B;  1W1P A;  1EQ3 A;  3IKG A;  3O5D A;  3AS3 A;  4Z2L A;  1FD9 A;  2MLZ A;  2QF8 A;  4LGX A;  3FAP A;  1TK7 A;  4ODL A;  4ZPV R;  3FSC A;  4DRQ A;  2F21 A;  1H0I A;  2VCD A;  3MQH A;  1EIB A;  1X6N A;  2MPH A;  1LL7 A;  4ODR A;  3ARU A;  4TNS A;  2YSG A;  2RUD A;  1W1Y A;  2MLX A;  1Y0O A;  1D6O A;  3UI4 A;  3PRA A;  4IPX A;  1JMQ A;  3O5M A;  3M85 A;  2LAJ A;  3MCB A;  1E6Z A;  3O5J A;  3CNG A;  3CHF A;  1NWT A;  2FDM A;  2M1I A;  2L4J A;  1ITX A;  1E9L A;  1FKL A;  1FKR A;  2PPO A;  2XP3 A;  2EUL A;  4A0U A;  4R0X A;  3FS8 A;  1WAW A;  2A3C A;  3ARQ A;  2F23 A;  3UQI A;  1ZK6 A;  2ESC A;  2A3E A;  1LL6 A;  4WIW A;  3CHE A;  3UQB A;  1F8A B;  2RE3 A;  2M3O W;  2DK1 A;  3ALF A;  2D9F A;  5HWB A;  4W5U A;  3TDB A;  1HJX A;  3UI6 A;  2M2A A;  1QPF A;  2JX8 A;  2JZV A;  4J4O A;  3AS2 A;  2KO7 A;  3EIP A;  5HW6 A;  1PBK A;  3UF8 A;  2XPA A;  3KCE A;  1LG2 A;  4Z2H A;  1HKM A;  3CHC A;  5J6E A;  1H0G A;  1FKK A;  2XPB A;  1GRJ A;  4O2T A;  5I98 A;  3NTP A;  1ZBC A;  1UR9 A;  3AS0 A;  4DRM A;  5BXJ A;  3IHZ A;  2Q5A A;  2KE0 A;  4MNM A;  4IT6 A;  4JYS A;  4KR0 B;  2IUZ A;  3BMB A;  2PV3 A;  5GQB A;  1TR8 A;  1OGB A;  1WNO A;  4WJX A;  4DZ2 A;  1E6P A;  1E44 A;  1VF8 A;  4P8X A;  1WMV A;  1ROU A;  2RUR A;  1ROT A;  2LPV A;  4R5E A;  4LAY A;  4MPK A;  4NSB A;  3O5E A;  4G2P A;  4REX A;  2YSH A;  4ZS6 A;  1FFQ A;  1J4R A;  4U84 A;  1IX5 A;  2PBC A;  1QPL A;  5HWC A;  2AWG A;  4BF8 A;  1NWR A;  4DRH A;  3O5P A;  2KFW A;  3CGM A;  2Y8N B;  5DEZ A;  3G6L A;  1NMW A;  3WL0 A;  3WH0 A;  3ARZ A;  1CTN A;  3PQH A;  5DIV A;  4DRP A;  3ART A;  3OOB A;  4QIB A;  4MNK A;  1T11 A;  3WQV A;  2K8I A;  3MQG A;  2N87 A;  4IQ2 A;  1HKI A;  1KFW A;  1GPF A;  2DG4 A;  3WD1 A;  1ZBW A;  3GPK A;  4URI A;  4AY1 A;  2KR7 A;  2P4V A;  1R9H A;  3RME A;  2BA1 A;  2EZ5 W;  4MAV A;  4J4N A;  4DH0 A;  1FKD A;  3L4H A;  2ZAJ A;  1P5Q A;  1XRV A;  3RGC A;  1NH6 A;  2M8I A;  3B8S A;  4DT4 A;  3CZ8 A;  3ALG A;  1HKJ A;  5GPG A;  5JH8 A;  4QT3 A;  2G8Z A;  3O5F A;  2DSW A;  5E66 A;  4G50 A;  3ARW A;  2XP6 A;  3ARX A;  1B6C A;  2DG3 A;  2RUQ A;  5DF0 A;  1Q6U A;  4DWS B;  3TCZ A;  4DWS C;  4Z2K A;  2E45 A;  4LAV A;  4HBE A;  1NMV A;  4MSP A;  4LAX A;  2DT0 A;  2XP7 A;  4Z2G A;  4DZ3 A;  3LUO A;  3W4R A;  2B31 A;  3VAW A;  1ZB5 A;  4ODN A;  1W9V A;  1LQ0 A;  4KQZ A;  4DRI A;  2O9O A;  4FN2 A;  3KAG A;  2JXW A;  1W1T A;  2DSU A;  1L1P A;  3PA7 A;  2JV4 A;  4QZV B;  1E15 A;  3B9A A;  2Y78 A;  2LKN A;  2YSB A;  3RFW A;  4WK9 A;  5DIU A;  2MF9 A;  1WR7 A;  2DT1 A;  2G41 A;  1F40 A;  1ZL1 A;  1HJV A;  2WLY A;  2WM0 A;  4TW8 A;  3KAC A; 
#chains in the Genus database with same CATH homology
 1ZBK A;  4XAK A;  2XP9 A;  3O5K A;  3WD4 A;  2ZQT A;  4MNJ A;  5U47 A;  4W9Q A;  2DMV A;  1QZ2 A;  1EHN A;  2DG9 A;  4A0T A;  1W9P A;  4HAR A;  4WKH A;  3KZ7 A;  3RM9 A;  1JNS A;  1EG4 A;  4DIP A;  3B9E A;  3MCB B;  3ARP A;  2PPN A;  1A7X A;  4NZC A;  4L3N A;  4GLX A;  3O5R A;  4TW6 A;  4C02 B;  4ODM A;  1HKK A;  2VN1 A;  2A3B A;  3LKX A;  1KT0 A;  5CQ2 A;  2UZ5 A;  4TW7 A;  1FKJ A;  1C9H A;  3JXV A;  4N19 A;  3NRK A;  1LG1 A;  2YAJ B;  1JVW A;  1TCO C;  1U79 A;  1FKS A;  2PPP A;  1LL4 A;  2RQS A;  3H9R B;  3KAD A;  1HJW A;  3EY6 A;  4ITZ A;  3ARS A;  4JFL A;  4ML4 A;  1FAP A;  4ZPW R;  2XP8 A;  1J6Y A;  2JMF A;  2ZR6 A;  1D2K A;  2DJY A;  1Q1C A;  1FKI A;  2WAE A;  3KAI A;  1EDQ A;  3CH9 A;  5E62 A;  2DT3 A;  5DIT A;  3I6C A;  3O5O A;  4LAW A;  5HTG A;  5E64 A;  2DPE A;  5B8I C;  1PIN A;  4DWS D;  3UI5 A;  2WLZ A;  3WD0 A;  1N1A A;  4ODQ A;  4MGV A;  1D7J A;  4FAP A;  2ZR5 A;  1FKF A;  2MDI A;  2PV2 A;  4NNR A;  3ARV A;  1EG3 A;  1YW5 A;  2XP4 A;  3ODK A;  1W1V A;  3MDY B;  2YSI A;  4PTM A;  1NWS A;  3B9D A;  2DSZ A;  1J4I A;  3WD2 A;  1JNE A;  4IQC A;  1J4H A;  3PR9 A;  3IK8 A;  4WKA A;  3FXY A;  1GOI A;  1ZBV A;  2DWV A;  4JFJ A;  3CHD A;  1O6W A;  3WL1 A;  1FKG A;  1TFV A;  2IF4 A;  5GPR A;  1K9T A;  2RUC A;  3G6M A;  2ZR4 A;  1W9U A;  1OWQ A;  4ODP A;  2ITK A;  3WIJ A;  2OFN A;  1E6N A;  2KXQ A;  2FKE A;  1OGG A;  1M5Y A;  3PRB A;  4Z2I A;  3O5L A;  3ARO A;  3KAB A;  3JYM A;  1ZCN A;  2LJ4 A;  2XP5 A;  2F2D A;  2ZQV A;  1W26 A;  1X6L A;  3UQA A;  2ZQS A;  2YBT A;  4DRK A;  4JFM A;  1D7H A;  1KT1 A;  1RP5 A;  3NI6 A;  4U86 A;  4W9O A;  1BL4 A;  2DK7 A;  2PV1 A;  4WKF A;  4ZPT R;  3ARR A;  4MTV A;  3WQW A;  1FLC A;  1FFR A;  2KGJ A;  4DRN A;  1FKT A;  1GUV A;  4MNL A;  5AHT A;  3ARY A;  5HUA A;  2OWO A;  2AOS A;  3IKD A;  1I5H W;  1NWU A;  1O6I A;  1FKB A;  2KI3 A;  2M8J A;  2PI6 A;  4P8W A;  5DO2 A;  1E6R A;  3RM8 A;  3PRD A;  1Q6I A;  4IT4 A;  5HT1 A;  2MLY A;  1K9Q A;  2DT2 A;  1SR0 A;  5HKG A;  4QT2 A;  2M08 A;  4DRO A;  3B7X A;  5E5W A;  1HXV A;  2OLH A;  3BXW A;  2DSV A;  1Q6H A;  4HBO A;  3FY1 A;  1D7I A;  1JND A;  1WB0 A;  2RSE A;  3KAF A;  3CGN A;  4Q7N A;  3RM4 A;  5HW7 A;  3M7N A;  1LJY A;  2A3A A;  2YBU A;  4P8V A;  4W9P A;  2F4E A;  3WD3 A;  4GGQ A;  5E65 A;  4TX0 A;  3AS1 A;  3AQU A;  3QOK A;  4U85 A;  5D75 A;  1RD6 A;  2WAD A;  3OA5 A;  3KAH A;  4ODO A;  2LGO A;  2YSF A;  3LE4 A;  3O5G A;  1SYT A;  1XHG A;  1EYM A;  1NSG A;  2O92 A;  4S3K A;  4TYO A;  1K9R A;  3O5Q A;  4E5R A;  2WK2 A;  4DWS A;  1BKF A;  4S3J A;  5HBF A;  5HW8 A;  1JNT A;  4Z2J A;  4GIV A;  1ZU8 A;  2L2S A;  4P8U A;  4ODK A;  4L72 B;  2ZQU A;  3FSB A;  3WKZ A;  1FKH A;  1UR8 A;  3TC5 A;  1YAT A;  3JYJ A;  1FJD A;  2MNT A;  4DRJ A;  3O5I A;  2QRV A;  4JFK A;  4Q22 A;  4JFI A;  2FAP A;  3LKX B;  1W1P A;  1EQ3 A;  3IKG A;  3O5D A;  3AS3 A;  4Z2L A;  1FD9 A;  2MLZ A;  2QF8 A;  4LGX A;  3FAP A;  1TK7 A;  4ODL A;  4ZPV R;  3FSC A;  4DRQ A;  2F21 A;  1H0I A;  2VCD A;  3MQH A;  1EIB A;  1X6N A;  2MPH A;  1LL7 A;  4ODR A;  3ARU A;  4TNS A;  2YSG A;  2RUD A;  1W1Y A;  2MLX A;  1Y0O A;  1D6O A;  3UI4 A;  3PRA A;  4IPX A;  1JMQ A;  3O5M A;  3M85 A;  2LAJ A;  3MCB A;  1E6Z A;  3O5J A;  3CNG A;  3CHF A;  1NWT A;  2FDM A;  2M1I A;  2L4J A;  1ITX A;  1E9L A;  1FKL A;  1FKR A;  2PPO A;  2XP3 A;  4A0U A;  4R0X A;  3FS8 A;  1WAW A;  2A3C A;  3ARQ A;  3UQI A;  1ZK6 A;  2ESC A;  2A3E A;  1LL6 A;  4WIW A;  3CHE A;  3UQB A;  1F8A B;  2RE3 A;  2M3O W;  2DK1 A;  3ALF A;  2D9F A;  5HWB A;  4W5U A;  3TDB A;  1HJX A;  3UI6 A;  2M2A A;  1QPF A;  2JX8 A;  2JZV A;  4J4O A;  3AS2 A;  2KO7 A;  5HW6 A;  1PBK A;  3UF8 A;  2XPA A;  3KCE A;  1LG2 A;  4Z2H A;  1HKM A;  3CHC A;  5J6E A;  1H0G A;  1FKK A;  2XPB A;  4O2T A;  5I98 A;  3NTP A;  1ZBC A;  1UR9 A;  3AS0 A;  4DRM A;  5BXJ A;  3IHZ A;  2Q5A A;  2KE0 A;  4MNM A;  4IT6 A;  4JYS A;  4KR0 B;  2IUZ A;  2PV3 A;  5GQB A;  1TR8 A;  1OGB A;  1WNO A;  4WJX A;  4DZ2 A;  1E6P A;  1VF8 A;  4P8X A;  1WMV A;  1ROU A;  2RUR A;  1ROT A;  2LPV A;  4R5E A;  4LAY A;  4MPK A;  4NSB A;  3O5E A;  4G2P A;  4REX A;  2YSH A;  4ZS6 A;  1FFQ A;  1J4R A;  4U84 A;  1IX5 A;  2PBC A;  1QPL A;  5HWC A;  2AWG A;  4BF8 A;  1NWR A;  4DRH A;  3O5P A;  2KFW A;  3CGM A;  2Y8N B;  5DEZ A;  3G6L A;  1NMW A;  3WL0 A;  3WH0 A;  3ARZ A;  1CTN A;  3PQH A;  5DIV A;  4DRP A;  3ART A;  3OOB A;  4QIB A;  4MNK A;  1T11 A;  3WQV A;  2K8I A;  3MQG A;  2N87 A;  4IQ2 A;  1HKI A;  1KFW A;  1GPF A;  2DG4 A;  3WD1 A;  1ZBW A;  3GPK A;  4URI A;  4AY1 A;  2KR7 A;  1R9H A;  3RME A;  2BA1 A;  2EZ5 W;  4MAV A;  4J4N A;  4DH0 A;  1FKD A;  3L4H A;  2ZAJ A;  1P5Q A;  1XRV A;  3RGC A;  1NH6 A;  2M8I A;  3B8S A;  4DT4 A;  3CZ8 A;  3ALG A;  1HKJ A;  5GPG A;  5JH8 A;  4QT3 A;  2G8Z A;  3O5F A;  2DSW A;  5E66 A;  4G50 A;  3ARW A;  2XP6 A;  3ARX A;  1B6C A;  2DG3 A;  2RUQ A;  5DF0 A;  1Q6U A;  4DWS B;  3TCZ A;  4DWS C;  4Z2K A;  2E45 A;  4LAV A;  4HBE A;  1NMV A;  4MSP A;  4LAX A;  2DT0 A;  2XP7 A;  4Z2G A;  4DZ3 A;  3LUO A;  3W4R A;  2B31 A;  3VAW A;  1ZB5 A;  4ODN A;  1W9V A;  1LQ0 A;  4KQZ A;  4DRI A;  2O9O A;  4FN2 A;  3KAG A;  2JXW A;  1W1T A;  2DSU A;  1L1P A;  3PA7 A;  2JV4 A;  4QZV B;  1E15 A;  3B9A A;  2Y78 A;  2LKN A;  2YSB A;  3RFW A;  4WK9 A;  5DIU A;  2MF9 A;  1WR7 A;  2DT1 A;  2G41 A;  1F40 A;  1ZL1 A;  1HJV A;  2WLY A;  2WM0 A;  4TW8 A;  3KAC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...