2ZQVA

Crystal structure of a mutant pin1 peptidyl-prolyl cis-trans isomerase
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
158
structure length
153
Chain Sequence
KLPPGWEKRMSRSSGRVYYANHITNASQWERPSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structural studies on PIN1 mutants
rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 45
structure length 153
sequence length 158
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2008-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2zqvA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2zqvA02
2JMFA 4MSPA 1W26A 3MDYB 1KT1A 2PBCA 2MLYA 1PINA 4DRMA 2RUDA 5HWBA 2L2SA 3JYMA 4TW7A 1YATA 3UQBA 3O5LA 1EYMA 3JXVA 4TW8A 3TCZA 1HXVA 4DZ3A 1YW5A 3OOBA 2PV2A 1FKGA 2LKNA 4DH0A 1FKHA 2M1IA 1F8AB 4DRKA 3KAIA 2KI3A 3KAFA 1FKFA 3UF8A 2LGOA 3NTPA 4DRIA 4JFJA 2LAJA 2KXQA 3LE4A 1J4HA 4W9PA 1P5QA 5AHTA 2ITKA 1JNTA 4ODKA 3O5QA 1O6WA 3O5PA 3O5FA 3KACA 3PRDA 3NI6A 4J4NA 2M08A 3LUOA 1FD9A 4BF8A 1NMVA 1L1PA 1PBKA 4TYOA 3IK8A 4DT4A 3M7NA 2ZAJA 4FAPA 4DRPA 2DG3A 5DITA 3JYJA 1BKFA 2PPOA 3KCEA 3O5MA 1FKLA 2AWGA 2XP4A 2KFWA 2MLXA 4N19A 4G50A 2IF4A 2ZR5A 1I5HW 1QPLA 2Y78A 1JMQA 2BA1A 2JV4A 1N1AA 2YSFA 4O2TA 2E45A 2L4JA 2DJYA 3TDBA 1R9HA 3KAGA 5HKGA 2F2DA 4E5RA 2XPAA 2MDIA 4U86A 4DRNA 3M85A 3O5DA 5BXJA 2LJ4A 5I98A 1ROTA 5B8IC 3O5IA 1QZ2A 3KADA 4ODPA 1D7HA 3I6CA 3UI4A 3IHZA 4ODLA 5HTGA 5HT1A 3UI5A 2RQSA 1J4IA 1K9QA 2F21A 2DG9A 4J4OA 3RFWA 4IQ2A 1D6OA 3PA7A 4JFMA 1FKDA 3UI6A 3H9RB 2FAPA 2JZVA 1Q6HA 2XP5A 2F4EA 5DIVA 2RUCA 2MLZA 1FJDA 3CNGA 1B6CA 3CGMA 4MGVA 4QT3A 4GGQA 2XP8A 2XP6A 3O5JA 1FKIA 1FKTA 2XPBA 4W9OA 4TNSA 1Y0OA 4ODMA 2FKEA 2DMVA 2ZQVA 4W9QA 2KR7A 3FAPA 2RSEA 2XP7A 1J4RA 3IKDA 2KE0A 4QIBA 4LAVA 1Q1CA 1F40A 3O5RA 4JFIA 4LAXA 4REXA 1M5YA 4ODRA 4DRHA 1D7IA 1K9RA 2YSBA 5HW7A 1TCOC 2N87A 1D7JA 3WH0A 4LAWA 1NMWA 4TX0A 4ODOA 2M2AA 2DWVA 1FKKA 1Q6UA 4ITZA 2ZQTA 1FKSA 5D75A 4R0XA 4JFKA 4DRJA 2M8JA 1C9HA 2DG4A 2MF9A 3ODKA 3TC5A 1FKJA 3EY6A 5HWCA 3KZ7A 5J6EA 3VAWA 2RE3A 4C02B 2KO7A 4GIVA 3UQAA 4G2PA 2KGJA 3KAHA 2EZ5W 4QT2A 4IQCA 4TW6A 3O5GA 4FN2A 4JFLA 5HW6A 2UZ5A 4ODNA 1TK7A 1WR7A 2XP9A 3L4HA 1U79A 4NNRA 2YSIA 2JXWA 2ZQSA 2RUQA 2DK7A 2YSHA 1EG4A 2DK1A 2M8IA 4U84A 2LPVA 2JX8A 5HUAA 2MPHA 1BL4A 5GPGA 1QPFA 1ZCNA 1JNSA 3IKGA 3PRBA 1EG3A 2XP3A 1JVWA 1ROUA 5HW8A 5CQ2A 1NSGA 4LAYA 2VCDA 4ODQA 2VN1A 1FKRA 4JYSA 2YSGA 1J6YA 2ZQUA 2M3OW 2K8IA 3KABA 4U85A 2OFNA 1EQ3A 2Q5AA 1KT0A 2D9FA 2PV3A 3GPKA 2ZR6A 2PV1A 3O5EA 3O5KA 1FKBA 2PPPA 3O5OA 4IPXA 4DRQA 3CGNA 1ZK6A 4DIPA 1FAPA 5DIUA 1Q6IA 3NRKA 4DZ2A 1T11A 2MNTA 4DROA 2ZR4A 1A7XA 3RGCA 3B7XA 3UQIA 2PPNA 1WMVA 2RURA
chains in the Genus database with same CATH superfamily
2JMFA 1VF8A 2ESCA 4MSPA 1W26A 3MDYB 5E64A 4ZPVR 1KT1A 2PBCA 3LKXA 2MLYA 1PINA 4DRMA 2OWOA 2RUDA 3ALFA 5HWBA 4MNMA 3CHFA 2L2SA 3JYMA 4TW7A 1IX5A 1YATA 3UQBA 3O5LA 1EYMA 3JXVA 3ARRA 2EULA 4KR0B 3MQGA 1LJYA 4TW8A 3TCZA 1TR8A 1HXVA 2DT2A 3AS0A 4DZ3A 1YW5A 3OOBA 4GLXA 4WKFA 2PV2A 1WB0A 4Z2GA 1FKGA 2LKNA 4DH0A 1GOIA 1FLCA 1FKHA 2M1IA 3RM4A 1F8AB 4DRKA 1W1TA 3KAIA 2KI3A 1W1YA 4L72B 3KAFA 1FKFA 2G8ZA 3UF8A 2LGOA 3NTPA 1OGBA 4DRIA 4JFJA 2LAJA 2YBUA 3ARUA 1NH6A 2KXQA 3LE4A 1J4HA 1TFVA 4HBEA 5DO2A 4W9PA 1P5QA 3RM9A 1H0GA 5AHTA 2AOSA 2ITKA 1JNTA 3ARWA 4ODKA 2DT1A 3LKXB 3O5QA 1O6WA 4UDMA 3O5PA 3O5FA 5E5WA 3KACA 3MCBA 3G6LA 3PRDA 1W9UA 3RM8A 3ARYA 3ARXA 3NI6A 4J4NA 2M08A 4MNKA 3FSBA 3LUOA 1FD9A 3GU0A 1EDQA 4BF8A 1NMVA 1L1PA 1PBKA 2QRVA 4TYOA 2QF8A 2F23A 2WLZA 3IK8A 4DT4A 3ARSA 3M7NA 2ZAJA 3AS1A 3WD0A 3WD2A 4FAPA 2A3CA 4DRPA 3ARPA 2DG3A 5DITA 2FDMA 2WM0A 3WL1A 1HKMA 1W1PA 4MPKA 3ARTA 3JYJA 1BKFA 2PPOA 3KCEA 1W1VA 3O5MA 1FKLA 3WD1A 2AWGA 2B5UB 4L3NA 4ML4A 2XP4A 4HARA 4P8UA 2KFWA 1EHNA 2MLXA 4N19A 4NSBA 4G50A 2DT0A 4XAKA 3MCBB 2IF4A 1JNDA 1XRVA 2ZR5A 2O92A 1I5HW 1QPLA 4S3KA 2Y78A 3CZ8A 1JMQA 3W4RA 1E15A 2BA1A 3FS8A 5E65A 2JV4A 1N1AA 2YSFA 4O2TA 2DSVA 4MTVA 4WK9A 2E45A 3CHDA 2L4JA 3WIJA 1RD6A 2DJYA 3TDBA 1R9HA 5DF0A 3KAGA 1ZBCA 1OGGA 5HKGA 1HKKA 2F2DA 1LG1A 1NWRA 2A3BA 4E5RA 2A3AA 2XPAA 2MDIA 3B8SA 3BMBA 4U86A 4DRNA 3M85A 1ZU8A 3O5DA 2DT3A 5BXJA 4KQZA 2LJ4A 4WKAA 5I98A 1ROTA 3O5IA 5B8IC 4LGXA 1QZ2A 3KADA 4ODPA 1D7HA 3I6CA 3UI4A 3B9EA 4MNJA 3AQUA 3IHZA 3WL0A 3MQHA 4ODLA 5HTGA 1SYTA 4PTMA 1EIBA 5HT1A 3UI5A 2RQSA 1J4IA 4Z2HA 1K9QA 1ZBKA 1HKIA 2F21A 2DG9A 4J4OA 3RFWA 4WJXA 4IQ2A 1D6OA 3PA7A 1O6IA 4JFMA 1FKDA 3UI6A 4A0UA 3H9RB 3EIPA 1ZBVA 2FAPA 4NZCA 5E66A 2JZVA 4MAVA 1Q6HA 2XP5A 2F4EA 5DIVA 4W5UA 2RUCA 2MLZA 1FJDA 3CNGA 1B6CA 3CGMA 4MGVA 4HBOA 4QT3A 2YAJB 3WD3A 4GGQA 2XP8A 4MNLA 1CTNA 3B9AA 2XP6A 2WLYA 1FKIA 3O5JA 1FKTA 2XPBA 4DWSA 2B31A 1JNEA 4W9OA 5HBFA 4TNSA 1Y0OA 4ODMA 4URIA 2FKEA 4DWSC 4ZPWR 2DMVA 2ZQVA 4W9QA 1K9TA 3G6MA 2KR7A 3FAPA 3FSCA 3PRAA 2RSEA 3WQVA 3CHCA 2XP7A 4QZVB 3AROA 1HJVA 3RMEA 1J4RA 3IKDA 1KFWA 2KE0A 1GUVA 4P8XA 4QIBA 4LAVA 1Q1CA 1F40A 1RP5A 2WADA 3O5RA 4JFIA 4Z2JA 1ZBWA 1LL7A 1W9VA 4LAXA 4REXA 4Z2IA 1M5YA 4ODRA 4DRHA 1XHGA 1ZB5A 1D7IA 1K9RA 2YSBA 3FY1A 3PR9A 4IT6A 5HW7A 2WAEA 1TCOC 2N87A 1D7JA 3WH0A 4LAWA 1UR8A 2OLHA 3ARZA 1NMWA 1OWQA 4TX0A 4ODOA 3CH9A 2DPEA 3ARVA 2M2AA 4ZS6A 2DSWA 1SR0A 1WAWA 3GTYX 2DWVA 4S3JA 1NWSA 4AY1A 4DWSB 1FKKA 1Q6UA 4ITZA 4ZPTR 2ZQTA 2PI6A 1FKSA 2DSUA 2P4VA 5D75A 1E9LA 4R0XA 4JFKA 3WD4A 4DRJA 2M8JA 1X6LA 1C9HA 2DG4A 2MF9A 3ODKA 3TC5A 1FKJA 2DSZA 3EY6A 5HWCA 3KZ7A 5J6EA 3PQHA 1JCHB 3VAWA 2RE3A 4C02B 1ITXA 2PN0A 2KO7A 1E6ZA 1ZL1A 4GIVA 2A3EA 1E6PA 1NWTA 4G2PA 3UQAA 2KGJA 3KAHA 4R5EA 5GPRA 1H0IA 2EZ5W 3CHEA 2WK2A 4WIWA 2Y8NB 4QT2A 4IQCA 4TW6A 3BXWA 3O5GA 4FN2A 4JFLA 5HW6A 2UZ5A 4ODNA 1TK7A 1WR7A 2XP9A 3L4HA 1U79A 4NNRA 2YSIA 2O9OA 2JXWA 2ZQSA 2RUQA 2DK7A 2YSHA 3OA5A 1EG4A 4WKHA 2DK1A 2M8IA 3ARQA 4Q7NA 4U84A 2LPVA 2JX8A 5HUAA 2MPHA 1BL4A 5GPGA 1QPFA 1HJWA 1ZCNA 1JNSA 3IKGA 3PRBA 1D2KA 1HKJA 1EG3A 2XP3A 1JVWA 5E62A 5GQBA 2IUZA 3QOKA 1ROUA 5HW8A 5CQ2A 1NSGA 4LAYA 1FFRA 4DWSD 1UR9A 2VCDA 1LG2A 3ALGA 4ODQA 2VN1A 1E44A 1FKRA 1LL4A 2G41A 4JYSA 2YSGA 1NWUA 4Z2LA 4IT4A 1J6YA 2ZQUA 2M3OW 1GPFA 2K8IA 3KABA 4U85A 1LL6A 2OFNA 4Z2KA 1EQ3A 2Q5AA 1KT0A 2D9FA 2PV3A 3B9DA 3GPKA 2ZR6A 2PV1A 3O5EA 1LQ0A 1WNOA 3O5KA 1E6RA 3FXYA 1FKBA 1W9PA 2PPPA 3O5OA 1E6NA 4IPXA 2ETNA 4DRQA 3CGNA 3WKZA 5JH8A 1GRJA 1HJXA 4P8VA 1ZK6A 3AS2A 4P8WA 1FAPA 4DIPA 5DIUA 3WQWA 1FFQA 1Q6IA 1X6NA 3NRKA 4DZ2A 1T11A 2MNTA 5DEZA 4DROA 2ZR4A 3AS3A 5U47A 4A0TA 1A7XA 3RGCA 3B7XA 3UQIA 2PPNA 2YBTA 4Q22A 1WMVA 2RURA
chains in the Genus database with same CATH topology
2JMFA 1VF8A 2ESCA 4MSPA 1W26A 3MDYB 5E64A 4ZPVR 1KT1A 2PBCA 3LKXA 2MLYA 1PINA 4DRMA 2OWOA 2RUDA 3ALFA 5HWBA 4MNMA 3CHFA 2L2SA 3JYMA 4TW7A 1IX5A 1YATA 3UQBA 3O5LA 1EYMA 3JXVA 3ARRA 4KR0B 3MQGA 1LJYA 4TW8A 3TCZA 1TR8A 1HXVA 2DT2A 3AS0A 4DZ3A 1YW5A 3OOBA 4GLXA 4WKFA 2PV2A 1WB0A 4Z2GA 1FKGA 2LKNA 4DH0A 1GOIA 1FLCA 1FKHA 2M1IA 3RM4A 1F8AB 4DRKA 1W1TA 3KAIA 2KI3A 1W1YA 4L72B 3KAFA 1FKFA 2G8ZA 3UF8A 2LGOA 3NTPA 1OGBA 4DRIA 4JFJA 2LAJA 2YBUA 3ARUA 1NH6A 2KXQA 3LE4A 1J4HA 1TFVA 4HBEA 5DO2A 4W9PA 1P5QA 3RM9A 1H0GA 5AHTA 2AOSA 2ITKA 1JNTA 3ARWA 4ODKA 2DT1A 3LKXB 3O5QA 1O6WA 3O5PA 3O5FA 5E5WA 3KACA 3MCBA 3G6LA 3PRDA 1W9UA 3RM8A 3ARYA 3ARXA 3NI6A 4J4NA 2M08A 4MNKA 3FSBA 3LUOA 1FD9A 1EDQA 4BF8A 1NMVA 1L1PA 1PBKA 2QRVA 4TYOA 2QF8A 2WLZA 3IK8A 4DT4A 3ARSA 3M7NA 2ZAJA 3AS1A 3WD0A 3WD2A 4FAPA 2A3CA 4DRPA 3ARPA 2DG3A 5DITA 2FDMA 2WM0A 3WL1A 1HKMA 1W1PA 4MPKA 3ARTA 3JYJA 1BKFA 2PPOA 3KCEA 1W1VA 3O5MA 1FKLA 3WD1A 2AWGA 4L3NA 4ML4A 2XP4A 4HARA 4P8UA 2KFWA 1EHNA 2MLXA 4N19A 4NSBA 4G50A 2DT0A 4XAKA 3MCBB 2IF4A 1JNDA 1XRVA 2ZR5A 2O92A 1I5HW 1QPLA 4S3KA 2Y78A 3CZ8A 1JMQA 3W4RA 1E15A 2BA1A 3FS8A 5E65A 2JV4A 1N1AA 2YSFA 4O2TA 2DSVA 4MTVA 4WK9A 2E45A 3CHDA 2L4JA 3WIJA 1RD6A 2DJYA 3TDBA 1R9HA 5DF0A 3KAGA 1ZBCA 1OGGA 5HKGA 1HKKA 2F2DA 1LG1A 1NWRA 2A3BA 4E5RA 2A3AA 2XPAA 2MDIA 3B8SA 4U86A 4DRNA 3M85A 1ZU8A 3O5DA 2DT3A 5BXJA 4KQZA 2LJ4A 4WKAA 5I98A 1ROTA 3O5IA 5B8IC 4LGXA 1QZ2A 3KADA 4ODPA 1D7HA 3I6CA 3UI4A 3B9EA 4MNJA 3AQUA 3IHZA 3WL0A 3MQHA 4ODLA 5HTGA 1SYTA 4PTMA 1EIBA 5HT1A 3UI5A 2RQSA 1J4IA 4Z2HA 1K9QA 1ZBKA 1HKIA 2F21A 2DG9A 4J4OA 3RFWA 4WJXA 4IQ2A 1D6OA 3PA7A 1O6IA 4JFMA 1FKDA 3UI6A 4A0UA 3H9RB 1ZBVA 2FAPA 4NZCA 5E66A 2JZVA 4MAVA 1Q6HA 2XP5A 2F4EA 5DIVA 4W5UA 2RUCA 2MLZA 1FJDA 3CNGA 1B6CA 3CGMA 4MGVA 4HBOA 4QT3A 2YAJB 3WD3A 4GGQA 2XP8A 4MNLA 1CTNA 3B9AA 2XP6A 2WLYA 1FKIA 3O5JA 1FKTA 2XPBA 4DWSA 2B31A 1JNEA 4W9OA 5HBFA 4TNSA 1Y0OA 4ODMA 4URIA 2FKEA 4DWSC 4ZPWR 2DMVA 2ZQVA 4W9QA 1K9TA 3G6MA 2KR7A 3FAPA 3FSCA 3PRAA 2RSEA 3WQVA 3CHCA 2XP7A 4QZVB 3AROA 1HJVA 3RMEA 1J4RA 3IKDA 1KFWA 2KE0A 1GUVA 4P8XA 4QIBA 4LAVA 1Q1CA 1F40A 1RP5A 2WADA 3O5RA 4JFIA 4Z2JA 1ZBWA 1LL7A 1W9VA 4LAXA 4REXA 4Z2IA 1M5YA 4ODRA 4DRHA 1XHGA 1ZB5A 1D7IA 1K9RA 2YSBA 3FY1A 3PR9A 4IT6A 5HW7A 2WAEA 1TCOC 2N87A 1D7JA 3WH0A 4LAWA 1UR8A 2OLHA 3ARZA 1NMWA 1OWQA 4TX0A 4ODOA 3CH9A 2DPEA 3ARVA 2M2AA 4ZS6A 2DSWA 1SR0A 1WAWA 2DWVA 4S3JA 1NWSA 4AY1A 4DWSB 1FKKA 1Q6UA 4ITZA 4ZPTR 2ZQTA 2PI6A 1FKSA 2DSUA 5D75A 1E9LA 4R0XA 4JFKA 3WD4A 4DRJA 2M8JA 1X6LA 1C9HA 2DG4A 2MF9A 3ODKA 3TC5A 1FKJA 2DSZA 3EY6A 5HWCA 3KZ7A 5J6EA 3PQHA 3VAWA 2RE3A 4C02B 1ITXA 2KO7A 1E6ZA 1ZL1A 4GIVA 2A3EA 1E6PA 1NWTA 4G2PA 3UQAA 2KGJA 3KAHA 4R5EA 5GPRA 1H0IA 2EZ5W 3CHEA 2WK2A 4WIWA 2Y8NB 4QT2A 4IQCA 4TW6A 3BXWA 3O5GA 4FN2A 4JFLA 5HW6A 2UZ5A 4ODNA 1TK7A 1WR7A 2XP9A 3L4HA 1U79A 4NNRA 2YSIA 2O9OA 2JXWA 2ZQSA 2RUQA 2DK7A 2YSHA 3OA5A 1EG4A 4WKHA 2DK1A 2M8IA 3ARQA 4Q7NA 4U84A 2LPVA 2JX8A 5HUAA 2MPHA 1BL4A 5GPGA 1QPFA 1HJWA 1ZCNA 1JNSA 3IKGA 3PRBA 1D2KA 1HKJA 1EG3A 2XP3A 1JVWA 5E62A 5GQBA 2IUZA 3QOKA 1ROUA 5HW8A 5CQ2A 1NSGA 4LAYA 1FFRA 4DWSD 1UR9A 2VCDA 1LG2A 3ALGA 4ODQA 2VN1A 1FKRA 1LL4A 2G41A 4JYSA 2YSGA 1NWUA 4Z2LA 4IT4A 1J6YA 2ZQUA 2M3OW 1GPFA 2K8IA 3KABA 4U85A 1LL6A 2OFNA 4Z2KA 1EQ3A 2Q5AA 1KT0A 2D9FA 2PV3A 3B9DA 3GPKA 2ZR6A 2PV1A 3O5EA 1LQ0A 1WNOA 3O5KA 1E6RA 3FXYA 1FKBA 1W9PA 2PPPA 3O5OA 1E6NA 4IPXA 4DRQA 3CGNA 3WKZA 5JH8A 1HJXA 4P8VA 1ZK6A 3AS2A 4P8WA 1FAPA 4DIPA 5DIUA 3WQWA 1FFQA 1Q6IA 1X6NA 3NRKA 4DZ2A 1T11A 2MNTA 5DEZA 4DROA 2ZR4A 3AS3A 5U47A 4A0TA 1A7XA 3RGCA 3B7XA 3UQIA 2PPNA 2YBTA 4Q22A 1WMVA 2RURA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JMF A;  4MSP A;  1W26 A;  3MDY B;  1KT1 A;  2PBC A;  2MLY A;  1PIN A;  4DRM A;  2RUD A;  5HWB A;  2L2S A;  3JYM A;  4TW7 A;  1YAT A;  3UQB A;  3O5L A;  1EYM A;  3JXV A;  4TW8 A;  3TCZ A;  1HXV A;  4DZ3 A;  1YW5 A;  3OOB A;  2PV2 A;  1FKG A;  2LKN A;  4DH0 A;  1FKH A;  2M1I A;  1F8A B;  4DRK A;  3KAI A;  2KI3 A;  3KAF A;  1FKF A;  3UF8 A;  2LGO A;  3NTP A;  4DRI A;  4JFJ A;  2LAJ A;  2KXQ A;  3LE4 A;  1J4H A;  4W9P A;  1P5Q A;  5AHT A;  2ITK A;  1JNT A;  4ODK A;  3O5Q A;  1O6W A;  3O5P A;  3O5F A;  3KAC A;  3PRD A;  3NI6 A;  4J4N A;  2M08 A;  3LUO A;  1FD9 A;  4BF8 A;  1NMV A;  1L1P A;  1PBK A;  4TYO A;  3IK8 A;  4DT4 A;  3M7N A;  2ZAJ A;  4FAP A;  4DRP A;  2DG3 A;  5DIT A;  3JYJ A;  1BKF A;  2PPO A;  3KCE A;  3O5M A;  1FKL A;  2AWG A;  2XP4 A;  2KFW A;  2MLX A;  4N19 A;  4G50 A;  2IF4 A;  2ZR5 A;  1I5H W;  1QPL A;  2Y78 A;  1JMQ A;  2BA1 A;  2JV4 A;  1N1A A;  2YSF A;  4O2T A;  2E45 A;  2L4J A;  2DJY A;  3TDB A;  1R9H A;  3KAG A;  5HKG A;  2F2D A;  4E5R A;  2XPA A;  2MDI A;  4U86 A;  4DRN A;  3M85 A;  3O5D A;  5BXJ A;  2LJ4 A;  5I98 A;  1ROT A;  5B8I C;  3O5I A;  1QZ2 A;  3KAD A;  4ODP A;  1D7H A;  3I6C A;  3UI4 A;  3IHZ A;  4ODL A;  5HTG A;  5HT1 A;  3UI5 A;  2RQS A;  1J4I A;  1K9Q A;  2F21 A;  2DG9 A;  4J4O A;  3RFW A;  4IQ2 A;  1D6O A;  3PA7 A;  4JFM A;  1FKD A;  3UI6 A;  3H9R B;  2FAP A;  2JZV A;  1Q6H A;  2XP5 A;  2F4E A;  5DIV A;  2RUC A;  2MLZ A;  1FJD A;  3CNG A;  1B6C A;  3CGM A;  4MGV A;  4QT3 A;  4GGQ A;  2XP8 A;  2XP6 A;  3O5J A;  1FKI A;  1FKT A;  2XPB A;  4W9O A;  4TNS A;  1Y0O A;  4ODM A;  2FKE A;  2DMV A;  2ZQV A;  4W9Q A;  2KR7 A;  3FAP A;  2RSE A;  2XP7 A;  1J4R A;  3IKD A;  2KE0 A;  4QIB A;  4LAV A;  1Q1C A;  1F40 A;  3O5R A;  4JFI A;  4LAX A;  4REX A;  1M5Y A;  4ODR A;  4DRH A;  1D7I A;  1K9R A;  2YSB A;  5HW7 A;  1TCO C;  2N87 A;  1D7J A;  3WH0 A;  4LAW A;  1NMW A;  4TX0 A;  4ODO A;  2M2A A;  2DWV A;  1FKK A;  1Q6U A;  4ITZ A;  2ZQT A;  1FKS A;  5D75 A;  4R0X A;  4JFK A;  4DRJ A;  2M8J A;  1C9H A;  2DG4 A;  2MF9 A;  3ODK A;  3TC5 A;  1FKJ A;  3EY6 A;  5HWC A;  3KZ7 A;  5J6E A;  3VAW A;  2RE3 A;  4C02 B;  2KO7 A;  4GIV A;  3UQA A;  4G2P A;  2KGJ A;  3KAH A;  2EZ5 W;  4QT2 A;  4IQC A;  4TW6 A;  3O5G A;  4FN2 A;  4JFL A;  5HW6 A;  2UZ5 A;  4ODN A;  1TK7 A;  1WR7 A;  2XP9 A;  3L4H A;  1U79 A;  4NNR A;  2YSI A;  2JXW A;  2ZQS A;  2RUQ A;  2DK7 A;  2YSH A;  1EG4 A;  2DK1 A;  2M8I A;  4U84 A;  2LPV A;  2JX8 A;  5HUA A;  2MPH A;  1BL4 A;  5GPG A;  1QPF A;  1ZCN A;  1JNS A;  3IKG A;  3PRB A;  1EG3 A;  2XP3 A;  1JVW A;  1ROU A;  5HW8 A;  5CQ2 A;  1NSG A;  4LAY A;  2VCD A;  4ODQ A;  2VN1 A;  1FKR A;  4JYS A;  2YSG A;  1J6Y A;  2ZQU A;  2M3O W;  2K8I A;  3KAB A;  4U85 A;  2OFN A;  1EQ3 A;  2Q5A A;  1KT0 A;  2D9F A;  2PV3 A;  3GPK A;  2ZR6 A;  2PV1 A;  3O5E A;  3O5K A;  1FKB A;  2PPP A;  3O5O A;  4IPX A;  4DRQ A;  3CGN A;  1ZK6 A;  4DIP A;  1FAP A;  5DIU A;  1Q6I A;  3NRK A;  4DZ2 A;  1T11 A;  2MNT A;  4DRO A;  2ZR4 A;  1A7X A;  3RGC A;  3B7X A;  3UQI A;  2PPN A;  1WMV A;  2RUR A; 
#chains in the Genus database with same CATH topology
 2JMF A;  1VF8 A;  2ESC A;  4MSP A;  1W26 A;  3MDY B;  5E64 A;  4ZPV R;  1KT1 A;  2PBC A;  3LKX A;  2MLY A;  1PIN A;  4DRM A;  2OWO A;  2RUD A;  3ALF A;  5HWB A;  4MNM A;  3CHF A;  2L2S A;  3JYM A;  4TW7 A;  1IX5 A;  1YAT A;  3UQB A;  3O5L A;  1EYM A;  3JXV A;  3ARR A;  2EUL A;  4KR0 B;  3MQG A;  1LJY A;  4TW8 A;  3TCZ A;  1TR8 A;  1HXV A;  2DT2 A;  3AS0 A;  4DZ3 A;  1YW5 A;  3OOB A;  4GLX A;  4WKF A;  2PV2 A;  1WB0 A;  4Z2G A;  1FKG A;  2LKN A;  4DH0 A;  1GOI A;  1FLC A;  1FKH A;  2M1I A;  3RM4 A;  1F8A B;  4DRK A;  1W1T A;  3KAI A;  2KI3 A;  1W1Y A;  4L72 B;  3KAF A;  1FKF A;  2G8Z A;  3UF8 A;  2LGO A;  3NTP A;  1OGB A;  4DRI A;  4JFJ A;  2LAJ A;  2YBU A;  3ARU A;  1NH6 A;  2KXQ A;  3LE4 A;  1J4H A;  1TFV A;  4HBE A;  5DO2 A;  4W9P A;  1P5Q A;  3RM9 A;  1H0G A;  5AHT A;  2AOS A;  2ITK A;  1JNT A;  3ARW A;  4ODK A;  2DT1 A;  3LKX B;  3O5Q A;  1O6W A;  4UDM A;  3O5P A;  3O5F A;  5E5W A;  3KAC A;  3MCB A;  3G6L A;  3PRD A;  1W9U A;  3RM8 A;  3ARY A;  3ARX A;  3NI6 A;  4J4N A;  2M08 A;  4MNK A;  3FSB A;  3LUO A;  1FD9 A;  3GU0 A;  1EDQ A;  4BF8 A;  1NMV A;  1L1P A;  1PBK A;  2QRV A;  4TYO A;  2QF8 A;  2F23 A;  2WLZ A;  3IK8 A;  4DT4 A;  3ARS A;  3M7N A;  2ZAJ A;  3AS1 A;  3WD0 A;  3WD2 A;  4FAP A;  2A3C A;  4DRP A;  3ARP A;  2DG3 A;  5DIT A;  2FDM A;  2WM0 A;  3WL1 A;  1HKM A;  1W1P A;  4MPK A;  3ART A;  3JYJ A;  1BKF A;  2PPO A;  3KCE A;  1W1V A;  3O5M A;  1FKL A;  3WD1 A;  2AWG A;  2B5U B;  4L3N A;  4ML4 A;  2XP4 A;  4HAR A;  4P8U A;  2KFW A;  1EHN A;  2MLX A;  4N19 A;  4NSB A;  4G50 A;  2DT0 A;  4XAK A;  3MCB B;  2IF4 A;  1JND A;  1XRV A;  2ZR5 A;  2O92 A;  1I5H W;  1QPL A;  4S3K A;  2Y78 A;  3CZ8 A;  1JMQ A;  3W4R A;  1E15 A;  2BA1 A;  3FS8 A;  5E65 A;  2JV4 A;  1N1A A;  2YSF A;  4O2T A;  2DSV A;  4MTV A;  4WK9 A;  2E45 A;  3CHD A;  2L4J A;  3WIJ A;  1RD6 A;  2DJY A;  3TDB A;  1R9H A;  5DF0 A;  3KAG A;  1ZBC A;  1OGG A;  5HKG A;  1HKK A;  2F2D A;  1LG1 A;  1NWR A;  2A3B A;  4E5R A;  2A3A A;  2XPA A;  2MDI A;  3B8S A;  3BMB A;  4U86 A;  4DRN A;  3M85 A;  1ZU8 A;  3O5D A;  2DT3 A;  5BXJ A;  4KQZ A;  2LJ4 A;  4WKA A;  5I98 A;  1ROT A;  3O5I A;  5B8I C;  4LGX A;  1QZ2 A;  3KAD A;  4ODP A;  1D7H A;  3I6C A;  3UI4 A;  3B9E A;  4MNJ A;  3AQU A;  3IHZ A;  3WL0 A;  3MQH A;  4ODL A;  5HTG A;  1SYT A;  4PTM A;  1EIB A;  5HT1 A;  3UI5 A;  2RQS A;  1J4I A;  4Z2H A;  1K9Q A;  1ZBK A;  1HKI A;  2F21 A;  2DG9 A;  4J4O A;  3RFW A;  4WJX A;  4IQ2 A;  1D6O A;  3PA7 A;  1O6I A;  4JFM A;  1FKD A;  3UI6 A;  4A0U A;  3H9R B;  3EIP A;  1ZBV A;  2FAP A;  4NZC A;  5E66 A;  2JZV A;  4MAV A;  1Q6H A;  2XP5 A;  2F4E A;  5DIV A;  4W5U A;  2RUC A;  2MLZ A;  1FJD A;  3CNG A;  1B6C A;  3CGM A;  4MGV A;  4HBO A;  4QT3 A;  2YAJ B;  3WD3 A;  4GGQ A;  2XP8 A;  4MNL A;  1CTN A;  3B9A A;  2XP6 A;  2WLY A;  1FKI A;  3O5J A;  1FKT A;  2XPB A;  4DWS A;  2B31 A;  1JNE A;  4W9O A;  5HBF A;  4TNS A;  1Y0O A;  4ODM A;  4URI A;  2FKE A;  4DWS C;  4ZPW R;  2DMV A;  2ZQV A;  4W9Q A;  1K9T A;  3G6M A;  2KR7 A;  3FAP A;  3FSC A;  3PRA A;  2RSE A;  3WQV A;  3CHC A;  2XP7 A;  4QZV B;  3ARO A;  1HJV A;  3RME A;  1J4R A;  3IKD A;  1KFW A;  2KE0 A;  1GUV A;  4P8X A;  4QIB A;  4LAV A;  1Q1C A;  1F40 A;  1RP5 A;  2WAD A;  3O5R A;  4JFI A;  4Z2J A;  1ZBW A;  1LL7 A;  1W9V A;  4LAX A;  4REX A;  4Z2I A;  1M5Y A;  4ODR A;  4DRH A;  1XHG A;  1ZB5 A;  1D7I A;  1K9R A;  2YSB A;  3FY1 A;  3PR9 A;  4IT6 A;  5HW7 A;  2WAE A;  1TCO C;  2N87 A;  1D7J A;  3WH0 A;  4LAW A;  1UR8 A;  2OLH A;  3ARZ A;  1NMW A;  1OWQ A;  4TX0 A;  4ODO A;  3CH9 A;  2DPE A;  3ARV A;  2M2A A;  4ZS6 A;  2DSW A;  1SR0 A;  1WAW A;  3GTY X;  2DWV A;  4S3J A;  1NWS A;  4AY1 A;  4DWS B;  1FKK A;  1Q6U A;  4ITZ A;  4ZPT R;  2ZQT A;  2PI6 A;  1FKS A;  2DSU A;  2P4V A;  5D75 A;  1E9L A;  4R0X A;  4JFK A;  3WD4 A;  4DRJ A;  2M8J A;  1X6L A;  1C9H A;  2DG4 A;  2MF9 A;  3ODK A;  3TC5 A;  1FKJ A;  2DSZ A;  3EY6 A;  5HWC A;  3KZ7 A;  5J6E A;  3PQH A;  1JCH B;  3VAW A;  2RE3 A;  4C02 B;  1ITX A;  2PN0 A;  2KO7 A;  1E6Z A;  1ZL1 A;  4GIV A;  2A3E A;  1E6P A;  1NWT A;  4G2P A;  3UQA A;  2KGJ A;  3KAH A;  4R5E A;  5GPR A;  1H0I A;  2EZ5 W;  3CHE A;  2WK2 A;  4WIW A;  2Y8N B;  4QT2 A;  4IQC A;  4TW6 A;  3BXW A;  3O5G A;  4FN2 A;  4JFL A;  5HW6 A;  2UZ5 A;  4ODN A;  1TK7 A;  1WR7 A;  2XP9 A;  3L4H A;  1U79 A;  4NNR A;  2YSI A;  2O9O A;  2JXW A;  2ZQS A;  2RUQ A;  2DK7 A;  2YSH A;  3OA5 A;  1EG4 A;  4WKH A;  2DK1 A;  2M8I A;  3ARQ A;  4Q7N A;  4U84 A;  2LPV A;  2JX8 A;  5HUA A;  2MPH A;  1BL4 A;  5GPG A;  1QPF A;  1HJW A;  1ZCN A;  1JNS A;  3IKG A;  3PRB A;  1D2K A;  1HKJ A;  1EG3 A;  2XP3 A;  1JVW A;  5E62 A;  5GQB A;  2IUZ A;  3QOK A;  1ROU A;  5HW8 A;  5CQ2 A;  1NSG A;  4LAY A;  1FFR A;  4DWS D;  1UR9 A;  2VCD A;  1LG2 A;  3ALG A;  4ODQ A;  2VN1 A;  1E44 A;  1FKR A;  1LL4 A;  2G41 A;  4JYS A;  2YSG A;  1NWU A;  4Z2L A;  4IT4 A;  1J6Y A;  2ZQU A;  2M3O W;  1GPF A;  2K8I A;  3KAB A;  4U85 A;  1LL6 A;  2OFN A;  4Z2K A;  1EQ3 A;  2Q5A A;  1KT0 A;  2D9F A;  2PV3 A;  3B9D A;  3GPK A;  2ZR6 A;  2PV1 A;  3O5E A;  1LQ0 A;  1WNO A;  3O5K A;  1E6R A;  3FXY A;  1FKB A;  1W9P A;  2PPP A;  3O5O A;  1E6N A;  4IPX A;  2ETN A;  4DRQ A;  3CGN A;  3WKZ A;  5JH8 A;  1GRJ A;  1HJX A;  4P8V A;  1ZK6 A;  3AS2 A;  4P8W A;  1FAP A;  4DIP A;  5DIU A;  3WQW A;  1FFQ A;  1Q6I A;  1X6N A;  3NRK A;  4DZ2 A;  1T11 A;  2MNT A;  5DEZ A;  4DRO A;  2ZR4 A;  3AS3 A;  5U47 A;  4A0T A;  1A7X A;  3RGC A;  3B7X A;  3UQI A;  2PPN A;  2YBT A;  4Q22 A;  1WMV A;  2RUR A; 
#chains in the Genus database with same CATH homology
 2JMF A;  1VF8 A;  2ESC A;  4MSP A;  1W26 A;  3MDY B;  5E64 A;  4ZPV R;  1KT1 A;  2PBC A;  3LKX A;  2MLY A;  1PIN A;  4DRM A;  2OWO A;  2RUD A;  3ALF A;  5HWB A;  4MNM A;  3CHF A;  2L2S A;  3JYM A;  4TW7 A;  1IX5 A;  1YAT A;  3UQB A;  3O5L A;  1EYM A;  3JXV A;  3ARR A;  4KR0 B;  3MQG A;  1LJY A;  4TW8 A;  3TCZ A;  1TR8 A;  1HXV A;  2DT2 A;  3AS0 A;  4DZ3 A;  1YW5 A;  3OOB A;  4GLX A;  4WKF A;  2PV2 A;  1WB0 A;  4Z2G A;  1FKG A;  2LKN A;  4DH0 A;  1GOI A;  1FLC A;  1FKH A;  2M1I A;  3RM4 A;  1F8A B;  4DRK A;  1W1T A;  3KAI A;  2KI3 A;  1W1Y A;  4L72 B;  3KAF A;  1FKF A;  2G8Z A;  3UF8 A;  2LGO A;  3NTP A;  1OGB A;  4DRI A;  4JFJ A;  2LAJ A;  2YBU A;  3ARU A;  1NH6 A;  2KXQ A;  3LE4 A;  1J4H A;  1TFV A;  4HBE A;  5DO2 A;  4W9P A;  1P5Q A;  3RM9 A;  1H0G A;  5AHT A;  2AOS A;  2ITK A;  1JNT A;  3ARW A;  4ODK A;  2DT1 A;  3LKX B;  3O5Q A;  1O6W A;  3O5P A;  3O5F A;  5E5W A;  3KAC A;  3MCB A;  3G6L A;  3PRD A;  1W9U A;  3RM8 A;  3ARY A;  3ARX A;  3NI6 A;  4J4N A;  2M08 A;  4MNK A;  3FSB A;  3LUO A;  1FD9 A;  1EDQ A;  4BF8 A;  1NMV A;  1L1P A;  1PBK A;  2QRV A;  4TYO A;  2QF8 A;  2WLZ A;  3IK8 A;  4DT4 A;  3ARS A;  3M7N A;  2ZAJ A;  3AS1 A;  3WD0 A;  3WD2 A;  4FAP A;  2A3C A;  4DRP A;  3ARP A;  2DG3 A;  5DIT A;  2FDM A;  2WM0 A;  3WL1 A;  1HKM A;  1W1P A;  4MPK A;  3ART A;  3JYJ A;  1BKF A;  2PPO A;  3KCE A;  1W1V A;  3O5M A;  1FKL A;  3WD1 A;  2AWG A;  4L3N A;  4ML4 A;  2XP4 A;  4HAR A;  4P8U A;  2KFW A;  1EHN A;  2MLX A;  4N19 A;  4NSB A;  4G50 A;  2DT0 A;  4XAK A;  3MCB B;  2IF4 A;  1JND A;  1XRV A;  2ZR5 A;  2O92 A;  1I5H W;  1QPL A;  4S3K A;  2Y78 A;  3CZ8 A;  1JMQ A;  3W4R A;  1E15 A;  2BA1 A;  3FS8 A;  5E65 A;  2JV4 A;  1N1A A;  2YSF A;  4O2T A;  2DSV A;  4MTV A;  4WK9 A;  2E45 A;  3CHD A;  2L4J A;  3WIJ A;  1RD6 A;  2DJY A;  3TDB A;  1R9H A;  5DF0 A;  3KAG A;  1ZBC A;  1OGG A;  5HKG A;  1HKK A;  2F2D A;  1LG1 A;  1NWR A;  2A3B A;  4E5R A;  2A3A A;  2XPA A;  2MDI A;  3B8S A;  4U86 A;  4DRN A;  3M85 A;  1ZU8 A;  3O5D A;  2DT3 A;  5BXJ A;  4KQZ A;  2LJ4 A;  4WKA A;  5I98 A;  1ROT A;  3O5I A;  5B8I C;  4LGX A;  1QZ2 A;  3KAD A;  4ODP A;  1D7H A;  3I6C A;  3UI4 A;  3B9E A;  4MNJ A;  3AQU A;  3IHZ A;  3WL0 A;  3MQH A;  4ODL A;  5HTG A;  1SYT A;  4PTM A;  1EIB A;  5HT1 A;  3UI5 A;  2RQS A;  1J4I A;  4Z2H A;  1K9Q A;  1ZBK A;  1HKI A;  2F21 A;  2DG9 A;  4J4O A;  3RFW A;  4WJX A;  4IQ2 A;  1D6O A;  3PA7 A;  1O6I A;  4JFM A;  1FKD A;  3UI6 A;  4A0U A;  3H9R B;  1ZBV A;  2FAP A;  4NZC A;  5E66 A;  2JZV A;  4MAV A;  1Q6H A;  2XP5 A;  2F4E A;  5DIV A;  4W5U A;  2RUC A;  2MLZ A;  1FJD A;  3CNG A;  1B6C A;  3CGM A;  4MGV A;  4HBO A;  4QT3 A;  2YAJ B;  3WD3 A;  4GGQ A;  2XP8 A;  4MNL A;  1CTN A;  3B9A A;  2XP6 A;  2WLY A;  1FKI A;  3O5J A;  1FKT A;  2XPB A;  4DWS A;  2B31 A;  1JNE A;  4W9O A;  5HBF A;  4TNS A;  1Y0O A;  4ODM A;  4URI A;  2FKE A;  4DWS C;  4ZPW R;  2DMV A;  2ZQV A;  4W9Q A;  1K9T A;  3G6M A;  2KR7 A;  3FAP A;  3FSC A;  3PRA A;  2RSE A;  3WQV A;  3CHC A;  2XP7 A;  4QZV B;  3ARO A;  1HJV A;  3RME A;  1J4R A;  3IKD A;  1KFW A;  2KE0 A;  1GUV A;  4P8X A;  4QIB A;  4LAV A;  1Q1C A;  1F40 A;  1RP5 A;  2WAD A;  3O5R A;  4JFI A;  4Z2J A;  1ZBW A;  1LL7 A;  1W9V A;  4LAX A;  4REX A;  4Z2I A;  1M5Y A;  4ODR A;  4DRH A;  1XHG A;  1ZB5 A;  1D7I A;  1K9R A;  2YSB A;  3FY1 A;  3PR9 A;  4IT6 A;  5HW7 A;  2WAE A;  1TCO C;  2N87 A;  1D7J A;  3WH0 A;  4LAW A;  1UR8 A;  2OLH A;  3ARZ A;  1NMW A;  1OWQ A;  4TX0 A;  4ODO A;  3CH9 A;  2DPE A;  3ARV A;  2M2A A;  4ZS6 A;  2DSW A;  1SR0 A;  1WAW A;  2DWV A;  4S3J A;  1NWS A;  4AY1 A;  4DWS B;  1FKK A;  1Q6U A;  4ITZ A;  4ZPT R;  2ZQT A;  2PI6 A;  1FKS A;  2DSU A;  5D75 A;  1E9L A;  4R0X A;  4JFK A;  3WD4 A;  4DRJ A;  2M8J A;  1X6L A;  1C9H A;  2DG4 A;  2MF9 A;  3ODK A;  3TC5 A;  1FKJ A;  2DSZ A;  3EY6 A;  5HWC A;  3KZ7 A;  5J6E A;  3PQH A;  3VAW A;  2RE3 A;  4C02 B;  1ITX A;  2KO7 A;  1E6Z A;  1ZL1 A;  4GIV A;  2A3E A;  1E6P A;  1NWT A;  4G2P A;  3UQA A;  2KGJ A;  3KAH A;  4R5E A;  5GPR A;  1H0I A;  2EZ5 W;  3CHE A;  2WK2 A;  4WIW A;  2Y8N B;  4QT2 A;  4IQC A;  4TW6 A;  3BXW A;  3O5G A;  4FN2 A;  4JFL A;  5HW6 A;  2UZ5 A;  4ODN A;  1TK7 A;  1WR7 A;  2XP9 A;  3L4H A;  1U79 A;  4NNR A;  2YSI A;  2O9O A;  2JXW A;  2ZQS A;  2RUQ A;  2DK7 A;  2YSH A;  3OA5 A;  1EG4 A;  4WKH A;  2DK1 A;  2M8I A;  3ARQ A;  4Q7N A;  4U84 A;  2LPV A;  2JX8 A;  5HUA A;  2MPH A;  1BL4 A;  5GPG A;  1QPF A;  1HJW A;  1ZCN A;  1JNS A;  3IKG A;  3PRB A;  1D2K A;  1HKJ A;  1EG3 A;  2XP3 A;  1JVW A;  5E62 A;  5GQB A;  2IUZ A;  3QOK A;  1ROU A;  5HW8 A;  5CQ2 A;  1NSG A;  4LAY A;  1FFR A;  4DWS D;  1UR9 A;  2VCD A;  1LG2 A;  3ALG A;  4ODQ A;  2VN1 A;  1FKR A;  1LL4 A;  2G41 A;  4JYS A;  2YSG A;  1NWU A;  4Z2L A;  4IT4 A;  1J6Y A;  2ZQU A;  2M3O W;  1GPF A;  2K8I A;  3KAB A;  4U85 A;  1LL6 A;  2OFN A;  4Z2K A;  1EQ3 A;  2Q5A A;  1KT0 A;  2D9F A;  2PV3 A;  3B9D A;  3GPK A;  2ZR6 A;  2PV1 A;  3O5E A;  1LQ0 A;  1WNO A;  3O5K A;  1E6R A;  3FXY A;  1FKB A;  1W9P A;  2PPP A;  3O5O A;  1E6N A;  4IPX A;  4DRQ A;  3CGN A;  3WKZ A;  5JH8 A;  1HJX A;  4P8V A;  1ZK6 A;  3AS2 A;  4P8W A;  1FAP A;  4DIP A;  5DIU A;  3WQW A;  1FFQ A;  1Q6I A;  1X6N A;  3NRK A;  4DZ2 A;  1T11 A;  2MNT A;  5DEZ A;  4DRO A;  2ZR4 A;  3AS3 A;  5U47 A;  4A0T A;  1A7X A;  3RGC A;  3B7X A;  3UQI A;  2PPN A;  2YBT A;  4Q22 A;  1WMV A;  2RUR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...