2ZQVA

Crystal structure of a mutant pin1 peptidyl-prolyl cis-trans isomerase
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
158
structure length
153
Chain Sequence
b'KLPPGWEKRMSRSSGRVYYANHITNASQWERPSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structural studies on PIN1 mutants
rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 45
structure length 153
sequence length 158
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2008-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2zqvA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2zqvA02
1M5YA 4DZ3A 5J6EA 3CNGA 4ODOA 2ZR5A 4DRHA 3JYJA 4G50A 3I6CA 4MGVA 3H9RB 4TW8A 4DRNA 2FAPA 2PV2A 2RE3A 3MDYB 2PPPA 1HXVA 4JYSA 2VCDA 3GPKA 1QPLA 3RFWA 4DRMA 2DG9A 3M85A 3O5RA 4ITZA 1NMWA 4JFKA 4TNSA 3CGNA 4DT4A 1FKKA 1KT0A 1WR7A 4ODPA 2JZVA 5B8IC 2XPBA 1PBKA 3KCEA 2DK1A 2XP9A 1D7IA 3PRBA 2XP6A 4ODNA 1BKFA 4J4NA 3LUOA 1K9QA 2RUDA 2AWGA 3KABA 4DROA 2JMFA 5AHTA 4GIVA 4QT3A 1L1PA 1B6CA 1QZ2A 1ROUA 4TYOA 5HT1A 4N19A 2XP7A 2DG3A 1F8AB 2LJ4A 1Q1CA 3NTPA 4DH0A 2D9FA 4J4OA 1YW5A 1FKFA 2RURA 2PV3A 2LPVA 1QPFA 5D75A 2IF4A 2M8IA 4DRPA 2MF9A 2N87A 2YSFA 3KAIA 2PPOA 3UI4A 4U86A 3O5KA 3IHZA 2FKEA 4REXA 2DJYA 4W9PA 1KT1A 1R9HA 3UQBA 3KAHA 2PV1A 5HWCA 2DWVA 1Q6HA 4QT2A 1I5HW 2Q5AA 1ROTA 3PRDA 5GPGA 1EG3A 4JFJA 2M08A 2XP3A 1EYMA 1J4RA 3VAWA 2KI3A 2F4EA 1O6WA 2ZR6A 3M7NA 4ODKA 1FKDA 1Q6IA 1D7HA 2PBCA 3LE4A 4ODQA 2ZQVA 3TC5A 4O2TA 1D7JA 5I98A 2LGOA 3ODKA 3NI6A 2XP8A 4LAWA 4G2PA 1A7XA 3KZ7A 2EZ5W 2ZAJA 4U84A 3O5MA 3O5DA 1P5QA 3EY6A 4IPXA 3JYMA 3PA7A 2PPNA 1W26A 2MLYA 2L4JA 1C9HA 3OOBA 1FAPA 4R0XA 1FKGA 1FKSA 3KACA 3UQIA 3UQAA 2YSGA 1BL4A 4TW7A 1JMQA 2ZR4A 4JFIA 4DZ2A 1JNSA 2LAJA 3CGMA 4DRQA 1PINA 2YSIA 5HUAA 3O5OA 3FAPA 2M1IA 4ODMA 4IQ2A 2YSBA 3L4HA 2Y78A 3O5LA 5HKGA 3TCZA 1TCOC 2XP4A 2DG4A 5HW7A 2ZQTA 2M8JA 4C02B 1J6YA 3O5FA 3NRKA 2OFNA 2F21A 1D6OA 1TK7A 3TDBA 5HWBA 1EQ3A 1FD9A 1YATA 4U85A 3IK8A 4TW6A 2JX8A 1T11A 3WH0A 3O5QA 1FKHA 2KGJA 4DRIA 2JXWA 1F40A 1J4HA 1ZK6A 2XP5A 2ITKA 4NNRA 1FKBA 2BA1A 2L2SA 2M2AA 4MSPA 1NMVA 4GGQA 1Y0OA 2RUCA 5DIUA 3IKGA 2MNTA 4DIPA 3UI6A 2MLXA 2RQSA 2RUQA 2M3OW 3IKDA 4IQCA 1J4IA 2LKNA 3O5PA 2JV4A 1FKTA 1FKRA 4W9QA 5DITA 3B7XA 2DK7A 3O5JA 3KAGA 2E45A 2KO7A 4DRKA 1FKIA 2F2DA 3KADA 1U79A 4ODRA 2KFWA 2KXQA 1FJDA 2MLZA 2K8IA 3O5IA 5HW8A 4FN2A 3RGCA 5HTGA 4ODLA 2DMVA 2VN1A 5BXJA 4BF8A 1N1AA 1JNTA 5DIVA 2ZQUA 4FAPA 3UI5A 4LAYA 2KE0A 4JFLA 4JFMA 1WMVA 5CQ2A 1EG4A 4LAVA 4TX0A 1K9RA 1JVWA 1NSGA 3JXVA 1FKLA 2ZQSA 4QIBA 4DRJA 2XPAA 4LAXA 1ZCNA 2RSEA 2YSHA 2KR7A 2MDIA 4E5RA 2MPHA 4W9OA 1FKJA 1Q6UA 3O5EA 5HW6A 3O5GA 3KAFA 3UF8A 2UZ5A
chains in the Genus database with same CATH superfamily
1M5YA 4P8WA 4DZ3A 4WK9A 5J6EA 3BMBA 2PN0A 4WKAA 3CNGA 2OLHA 4ODOA 2ZR5A 3WQVA 4A0TA 3AS0A 4DRHA 2YAJB 1EDQA 3JYJA 1E15A 4G50A 1NH6A 3I6CA 4MGVA 3H9RB 4TW8A 1FFRA 1ZBVA 1W9VA 4DRNA 2FAPA 2PV2A 2RE3A 3MDYB 2PPPA 4S3JA 4JYSA 1HXVA 2VCDA 1LJYA 3GPKA 3FXYA 1QPLA 3WIJA 4Z2KA 3RFWA 4DRMA 1LL4A 2DG9A 1ZU8A 2DSVA 2ETNA 2Y8NB 3M85A 3WQWA 5HBFA 2WLYA 3O5RA 4A0UA 3AS1A 1SR0A 4ITZA 4MTVA 1ZBWA 1NMWA 5JH8A 4JFKA 4TNSA 3CGNA 1HJVA 4DT4A 3PQHA 1FKKA 4URIA 1KT0A 1WR7A 1TR8A 4ODPA 2JZVA 2WAEA 3WKZA 1E6RA 4P8UA 5B8IC 2XPBA 1PBKA 4Z2HA 3KCEA 2DK1A 2XP9A 1ITXA 1D7IA 3PRBA 2XP6A 4ODNA 1BKFA 3ARUA 3ARXA 4J4NA 3LUOA 3BXWA 1K9QA 2RUDA 3AQUA 2AWGA 3KABA 4AY1A 4DROA 1HKIA 2JMFA 1O6IA 5AHTA 3ARSA 1E9LA 4GIVA 4QT3A 1L1PA 1H0IA 1B6CA 3WD1A 1W1TA 2DSZA 1QZ2A 1ROUA 3CHDA 4TYOA 5HT1A 1D2KA 4N19A 2XP7A 2DG3A 5E62A 1F8AB 1HJWA 3FSCA 2LJ4A 3PRAA 1ZBKA 5E65A 1OGBA 3ARTA 1Q1CA 3NTPA 2A3CA 4DH0A 2D9FA 4J4OA 3EIPA 1YW5A 1FKFA 1UR9A 1RD6A 2RURA 2PV3A 2DSWA 1HJXA 2LPVA 1QPFA 3GU0A 5D75A 2DT1A 2IF4A 2M8IA 1W9PA 3QOKA 4DRPA 2MF9A 2N87A 1JNEA 2YSFA 3ARQA 3KAIA 1TFVA 2PPOA 3UI4A 4U86A 3O5KA 3IHZA 2FKEA 4REXA 2DJYA 1E6PA 3B9DA 2YBUA 1HKJA 1XRVA 4W9PA 1KT1A 1R9HA 3ARWA 4Q22A 3UQBA 3KAHA 2PV1A 4DWSC 4ZPVR 1ZBCA 5HWCA 2DWVA 4Z2LA 1Q6HA 4QT2A 1I5HW 2Q5AA 1ROTA 3PRDA 1FLCA 5GPGA 1EG3A 4JFJA 2M08A 1WB0A 3G6MA 4L3NA 2XP3A 1EYMA 1GRJA 3ALFA 1J4RA 3VAWA 2KI3A 2F4EA 2EULA 1HKKA 1O6WA 2ZR6A 1WAWA 3G6LA 3M7NA 4ODKA 1FKDA 2A3EA 1OGGA 4MAVA 3MQGA 1Q6IA 3OA5A 1D7HA 2PBCA 3AS2A 2DT0A 3LE4A 1LQ0A 4L72B 4ODQA 2ZQVA 3TC5A 1KFWA 4O2TA 3CHCA 2O9OA 2P4VA 5U47A 1D7JA 5I98A 2LGOA 1E44A 3ODKA 3NI6A 2XP8A 3RM8A 4LAWA 4QZVB 2F23A 4G2PA 3FY1A 1A7XA 3KZ7A 2EZ5W 2ZAJA 4U84A 3MQHA 3O5MA 3O5DA 1P5QA 3W4RA 3EY6A 4IPXA 4WJXA 4HARA 2WADA 4MNMA 3JYMA 3PA7A 2WK2A 3ALGA 4Q7NA 2PPNA 1W26A 2MLYA 2L4JA 1C9HA 1LG1A 3OOBA 1FAPA 4R0XA 2DSUA 2B5UB 1NWUA 1FKGA 2G41A 2QF8A 4LGXA 2ESCA 1FKSA 3KACA 3UQIA 3FS8A 1EIBA 3UQAA 2YSGA 3ARZA 4Z2JA 3WD0A 1JNDA 1BL4A 1UR8A 4TW7A 3WD4A 1JMQA 2WLZA 2ZR4A 4W5UA 4JFIA 4IT4A 3B9EA 4DZ2A 1JNSA 1W9UA 3ARPA 2LAJA 3CGMA 4DRQA 1IX5A 4Z2IA 4PTMA 3ARVA 1PINA 2YSIA 1VF8A 5HUAA 3O5OA 1W1PA 3ARRA 3WD2A 3FAPA 2M1IA 1X6NA 4ODMA 4IQ2A 2YSBA 3L4HA 2Y78A 2PI6A 3O5LA 3RM4A 5HKGA 3TCZA 1TCOC 3WL0A 2XP4A 2DT3A 2DG4A 5HW7A 2ZQTA 2M8JA 4ZPWR 4C02B 3WL1A 3CH9A 1J6YA 4GLXA 3O5FA 2A3BA 3NRKA 4KR0B 2OFNA 1WNOA 1W1YA 2F21A 1D6OA 1JCHB 1X6LA 1TK7A 4MNKA 1EHNA 3TDBA 4P8XA 5HWBA 1LL7A 4MNJA 1EQ3A 4WKFA 4ZPTR 1FD9A 1YATA 4U85A 1GPFA 3IK8A 4TW6A 2JX8A 4MNLA 1T11A 3WH0A 3O5QA 1FKHA 2KGJA 4DRIA 2JXWA 4Z2GA 5DEZA 1F40A 1J4HA 3MCBA 1ZK6A 2XP5A 2ITKA 2AOSA 4NNRA 1FKBA 2BA1A 1ZB5A 2IUZA 3GTYX 2L2SA 2OWOA 1E6ZA 1OWQA 2M2AA 4MSPA 1NMVA 4GGQA 3PR9A 1Y0OA 3LKXB 2YBTA 2RUCA 3MCBB 5DIUA 3IKGA 2MNTA 4DIPA 4XAKA 3FSBA 4NZCA 3RMEA 4HBEA 3UI6A 2MLXA 2RQSA 4S3KA 2RUQA 2M3OW 3IKDA 2DT2A 4IQCA 1J4IA 3B8SA 3CHFA 2LKNA 3O5PA 2JV4A 1FKTA 1FKRA 4W9QA 5DITA 2FDMA 3B7XA 2DK7A 3O5JA 3KAGA 1SYTA 2E45A 2KO7A 4ZS6A 4DRKA 2G8ZA 4HBOA 1NWTA 1FKIA 1E6NA 1GUVA 3KADA 2F2DA 5DO2A 4IT6A 1NWSA 1U79A 4ML4A 3ARYA 4ODRA 2KFWA 2KXQA 4NSBA 4R5EA 1FJDA 2MLZA 2K8IA 3O5IA 5HW8A 1LL6A 4FN2A 3RGCA 4KQZA 5E66A 5HTGA 5E64A 4ODLA 2DMVA 5E5WA 2VN1A 4UDMA 5BXJA 2B31A 3RM9A 4BF8A 1N1AA 1FFQA 2O92A 1JNTA 1ZL1A 3CHEA 5DIVA 2ZQUA 4FAPA 1XHGA 3UI5A 4LAYA 2KE0A 4JFLA 4JFMA 1WMVA 4WKHA 5CQ2A 1EG4A 4LAVA 1GOIA 4P8VA 4TX0A 2QRVA 1K9RA 1CTNA 1JVWA 1NSGA 3JXVA 1FKLA 1LG2A 3AROA 4DWSD 1K9TA 3WD3A 2A3AA 2ZQSA 4WIWA 4QIBA 4DRJA 5GQBA 2XPAA 1H0GA 4LAXA 5GPRA 1ZCNA 2RSEA 1W1VA 2DPEA 2YSHA 2KR7A 1RP5A 2MDIA 1NWRA 4DWSA 5DF0A 4MPKA 4E5RA 3CZ8A 2MPHA 2WM0A 4W9OA 1FKJA 1Q6UA 3O5EA 5HW6A 3O5GA 3B9AA 3KAFA 1HKMA 3UF8A 3AS3A 4DWSB 3LKXA 2UZ5A
chains in the Genus database with same CATH topology
1M5YA 4P8WA 4DZ3A 4WK9A 5J6EA 4WKAA 3CNGA 2OLHA 4ODOA 2ZR5A 3WQVA 4A0TA 3AS0A 4DRHA 2YAJB 1EDQA 3JYJA 1E15A 4G50A 1NH6A 3I6CA 4MGVA 3H9RB 4TW8A 1FFRA 1ZBVA 1W9VA 4DRNA 2FAPA 2PV2A 2RE3A 3MDYB 2PPPA 4S3JA 4JYSA 1HXVA 2VCDA 1LJYA 3GPKA 3FXYA 1QPLA 3WIJA 4Z2KA 3RFWA 4DRMA 1LL4A 2DG9A 1ZU8A 2DSVA 2Y8NB 3M85A 3WQWA 5HBFA 2WLYA 3O5RA 4A0UA 3AS1A 1SR0A 4ITZA 4MTVA 1ZBWA 1NMWA 5JH8A 4JFKA 4TNSA 3CGNA 1HJVA 4DT4A 3PQHA 1FKKA 4URIA 1KT0A 1WR7A 1TR8A 4ODPA 2JZVA 2WAEA 3WKZA 1E6RA 4P8UA 5B8IC 2XPBA 1PBKA 4Z2HA 3KCEA 2DK1A 2XP9A 1ITXA 1D7IA 3PRBA 2XP6A 4ODNA 1BKFA 3ARUA 3ARXA 4J4NA 3LUOA 3BXWA 1K9QA 2RUDA 3AQUA 2AWGA 3KABA 4AY1A 4DROA 1HKIA 2JMFA 1O6IA 5AHTA 3ARSA 1E9LA 4GIVA 4QT3A 1L1PA 1H0IA 1B6CA 3WD1A 1W1TA 2DSZA 1QZ2A 1ROUA 3CHDA 4TYOA 5HT1A 1D2KA 4N19A 2XP7A 2DG3A 5E62A 1F8AB 1HJWA 3FSCA 2LJ4A 3PRAA 1ZBKA 5E65A 1OGBA 3ARTA 1Q1CA 3NTPA 2A3CA 4DH0A 2D9FA 4J4OA 1YW5A 1FKFA 1UR9A 1RD6A 2RURA 2PV3A 2DSWA 1HJXA 2LPVA 1QPFA 5D75A 2DT1A 2IF4A 2M8IA 1W9PA 3QOKA 4DRPA 2MF9A 2N87A 1JNEA 2YSFA 3ARQA 3KAIA 1TFVA 2PPOA 3UI4A 4U86A 3O5KA 3IHZA 2FKEA 4REXA 2DJYA 1E6PA 3B9DA 2YBUA 1HKJA 1XRVA 4W9PA 1KT1A 1R9HA 3ARWA 4Q22A 3UQBA 3KAHA 2PV1A 4DWSC 4ZPVR 1ZBCA 5HWCA 2DWVA 4Z2LA 1Q6HA 4QT2A 1I5HW 2Q5AA 1ROTA 3PRDA 1FLCA 5GPGA 1EG3A 4JFJA 2M08A 1WB0A 3G6MA 4L3NA 2XP3A 1EYMA 3ALFA 1J4RA 3VAWA 2KI3A 2F4EA 1HKKA 1O6WA 2ZR6A 1WAWA 3G6LA 3M7NA 4ODKA 1FKDA 2A3EA 1OGGA 4MAVA 3MQGA 1Q6IA 3OA5A 1D7HA 2PBCA 3AS2A 2DT0A 3LE4A 1LQ0A 4L72B 4ODQA 2ZQVA 3TC5A 1KFWA 4O2TA 3CHCA 2O9OA 5U47A 1D7JA 5I98A 2LGOA 3ODKA 3NI6A 2XP8A 3RM8A 4LAWA 4QZVB 4G2PA 3FY1A 1A7XA 3KZ7A 2EZ5W 2ZAJA 4U84A 3MQHA 3O5MA 3O5DA 1P5QA 3W4RA 3EY6A 4IPXA 4WJXA 4HARA 2WADA 4MNMA 3JYMA 3PA7A 2WK2A 3ALGA 4Q7NA 2PPNA 1W26A 2MLYA 2L4JA 1C9HA 1LG1A 3OOBA 1FAPA 4R0XA 2DSUA 1NWUA 1FKGA 2G41A 2QF8A 4LGXA 2ESCA 1FKSA 3KACA 3UQIA 3FS8A 1EIBA 3UQAA 2YSGA 3ARZA 4Z2JA 3WD0A 1JNDA 1BL4A 1UR8A 4TW7A 3WD4A 1JMQA 2WLZA 2ZR4A 4W5UA 4JFIA 4IT4A 3B9EA 4DZ2A 1JNSA 1W9UA 3ARPA 2LAJA 3CGMA 4DRQA 1IX5A 4Z2IA 4PTMA 3ARVA 1PINA 2YSIA 1VF8A 5HUAA 3O5OA 1W1PA 3ARRA 3WD2A 3FAPA 2M1IA 1X6NA 4ODMA 4IQ2A 2YSBA 3L4HA 2Y78A 2PI6A 3O5LA 3RM4A 5HKGA 3TCZA 1TCOC 3WL0A 2XP4A 2DT3A 2DG4A 5HW7A 2ZQTA 2M8JA 4ZPWR 4C02B 3WL1A 3CH9A 1J6YA 4GLXA 3O5FA 2A3BA 3NRKA 4KR0B 2OFNA 1WNOA 1W1YA 2F21A 1D6OA 1X6LA 1TK7A 4MNKA 1EHNA 3TDBA 4P8XA 5HWBA 1LL7A 4MNJA 1EQ3A 4WKFA 4ZPTR 1FD9A 1YATA 4U85A 1GPFA 3IK8A 4TW6A 2JX8A 4MNLA 1T11A 3WH0A 3O5QA 1FKHA 2KGJA 4DRIA 2JXWA 4Z2GA 5DEZA 1F40A 1J4HA 3MCBA 1ZK6A 2XP5A 2ITKA 2AOSA 4NNRA 1FKBA 2BA1A 1ZB5A 2IUZA 2L2SA 2OWOA 1E6ZA 1OWQA 2M2AA 4MSPA 1NMVA 4GGQA 3PR9A 1Y0OA 3LKXB 2YBTA 2RUCA 3MCBB 5DIUA 3IKGA 2MNTA 4DIPA 4XAKA 3FSBA 4NZCA 3RMEA 4HBEA 3UI6A 2MLXA 2RQSA 4S3KA 2RUQA 2M3OW 3IKDA 2DT2A 4IQCA 1J4IA 3B8SA 3CHFA 2LKNA 3O5PA 2JV4A 1FKTA 1FKRA 4W9QA 5DITA 2FDMA 3B7XA 2DK7A 3O5JA 3KAGA 1SYTA 2E45A 2KO7A 4ZS6A 4DRKA 2G8ZA 4HBOA 1NWTA 1FKIA 1E6NA 1GUVA 3KADA 2F2DA 5DO2A 4IT6A 1NWSA 1U79A 4ML4A 3ARYA 4ODRA 2KFWA 2KXQA 4NSBA 4R5EA 1FJDA 2MLZA 2K8IA 3O5IA 5HW8A 1LL6A 4FN2A 3RGCA 4KQZA 5E66A 5HTGA 5E64A 4ODLA 2DMVA 5E5WA 2VN1A 5BXJA 2B31A 3RM9A 4BF8A 1N1AA 1FFQA 2O92A 1JNTA 1ZL1A 3CHEA 5DIVA 2ZQUA 4FAPA 1XHGA 3UI5A 4LAYA 2KE0A 4JFLA 4JFMA 1WMVA 4WKHA 5CQ2A 1EG4A 4LAVA 1GOIA 4P8VA 4TX0A 2QRVA 1K9RA 1CTNA 1JVWA 1NSGA 3JXVA 1FKLA 1LG2A 3AROA 4DWSD 1K9TA 3WD3A 2A3AA 2ZQSA 4WIWA 4QIBA 4DRJA 5GQBA 2XPAA 1H0GA 4LAXA 5GPRA 1ZCNA 2RSEA 1W1VA 2DPEA 2YSHA 2KR7A 1RP5A 2MDIA 1NWRA 4DWSA 5DF0A 4MPKA 4E5RA 3CZ8A 2MPHA 2WM0A 4W9OA 1FKJA 1Q6UA 3O5EA 5HW6A 3O5GA 3B9AA 3KAFA 1HKMA 3UF8A 3AS3A 4DWSB 3LKXA 2UZ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M5Y A;  4DZ3 A;  5J6E A;  3CNG A;  4ODO A;  2ZR5 A;  4DRH A;  3JYJ A;  4G50 A;  3I6C A;  4MGV A;  3H9R B;  4TW8 A;  4DRN A;  2FAP A;  2PV2 A;  2RE3 A;  3MDY B;  2PPP A;  1HXV A;  4JYS A;  2VCD A;  3GPK A;  1QPL A;  3RFW A;  4DRM A;  2DG9 A;  3M85 A;  3O5R A;  4ITZ A;  1NMW A;  4JFK A;  4TNS A;  3CGN A;  4DT4 A;  1FKK A;  1KT0 A;  1WR7 A;  4ODP A;  2JZV A;  5B8I C;  2XPB A;  1PBK A;  3KCE A;  2DK1 A;  2XP9 A;  1D7I A;  3PRB A;  2XP6 A;  4ODN A;  1BKF A;  4J4N A;  3LUO A;  1K9Q A;  2RUD A;  2AWG A;  3KAB A;  4DRO A;  2JMF A;  5AHT A;  4GIV A;  4QT3 A;  1L1P A;  1B6C A;  1QZ2 A;  1ROU A;  4TYO A;  5HT1 A;  4N19 A;  2XP7 A;  2DG3 A;  1F8A B;  2LJ4 A;  1Q1C A;  3NTP A;  4DH0 A;  2D9F A;  4J4O A;  1YW5 A;  1FKF A;  2RUR A;  2PV3 A;  2LPV A;  1QPF A;  5D75 A;  2IF4 A;  2M8I A;  4DRP A;  2MF9 A;  2N87 A;  2YSF A;  3KAI A;  2PPO A;  3UI4 A;  4U86 A;  3O5K A;  3IHZ A;  2FKE A;  4REX A;  2DJY A;  4W9P A;  1KT1 A;  1R9H A;  3UQB A;  3KAH A;  2PV1 A;  5HWC A;  2DWV A;  1Q6H A;  4QT2 A;  1I5H W;  2Q5A A;  1ROT A;  3PRD A;  5GPG A;  1EG3 A;  4JFJ A;  2M08 A;  2XP3 A;  1EYM A;  1J4R A;  3VAW A;  2KI3 A;  2F4E A;  1O6W A;  2ZR6 A;  3M7N A;  4ODK A;  1FKD A;  1Q6I A;  1D7H A;  2PBC A;  3LE4 A;  4ODQ A;  2ZQV A;  3TC5 A;  4O2T A;  1D7J A;  5I98 A;  2LGO A;  3ODK A;  3NI6 A;  2XP8 A;  4LAW A;  4G2P A;  1A7X A;  3KZ7 A;  2EZ5 W;  2ZAJ A;  4U84 A;  3O5M A;  3O5D A;  1P5Q A;  3EY6 A;  4IPX A;  3JYM A;  3PA7 A;  2PPN A;  1W26 A;  2MLY A;  2L4J A;  1C9H A;  3OOB A;  1FAP A;  4R0X A;  1FKG A;  1FKS A;  3KAC A;  3UQI A;  3UQA A;  2YSG A;  1BL4 A;  4TW7 A;  1JMQ A;  2ZR4 A;  4JFI A;  4DZ2 A;  1JNS A;  2LAJ A;  3CGM A;  4DRQ A;  1PIN A;  2YSI A;  5HUA A;  3O5O A;  3FAP A;  2M1I A;  4ODM A;  4IQ2 A;  2YSB A;  3L4H A;  2Y78 A;  3O5L A;  5HKG A;  3TCZ A;  1TCO C;  2XP4 A;  2DG4 A;  5HW7 A;  2ZQT A;  2M8J A;  4C02 B;  1J6Y A;  3O5F A;  3NRK A;  2OFN A;  2F21 A;  1D6O A;  1TK7 A;  3TDB A;  5HWB A;  1EQ3 A;  1FD9 A;  1YAT A;  4U85 A;  3IK8 A;  4TW6 A;  2JX8 A;  1T11 A;  3WH0 A;  3O5Q A;  1FKH A;  2KGJ A;  4DRI A;  2JXW A;  1F40 A;  1J4H A;  1ZK6 A;  2XP5 A;  2ITK A;  4NNR A;  1FKB A;  2BA1 A;  2L2S A;  2M2A A;  4MSP A;  1NMV A;  4GGQ A;  1Y0O A;  2RUC A;  5DIU A;  3IKG A;  2MNT A;  4DIP A;  3UI6 A;  2MLX A;  2RQS A;  2RUQ A;  2M3O W;  3IKD A;  4IQC A;  1J4I A;  2LKN A;  3O5P A;  2JV4 A;  1FKT A;  1FKR A;  4W9Q A;  5DIT A;  3B7X A;  2DK7 A;  3O5J A;  3KAG A;  2E45 A;  2KO7 A;  4DRK A;  1FKI A;  2F2D A;  3KAD A;  1U79 A;  4ODR A;  2KFW A;  2KXQ A;  1FJD A;  2MLZ A;  2K8I A;  3O5I A;  5HW8 A;  4FN2 A;  3RGC A;  5HTG A;  4ODL A;  2DMV A;  2VN1 A;  5BXJ A;  4BF8 A;  1N1A A;  1JNT A;  5DIV A;  2ZQU A;  4FAP A;  3UI5 A;  4LAY A;  2KE0 A;  4JFL A;  4JFM A;  1WMV A;  5CQ2 A;  1EG4 A;  4LAV A;  4TX0 A;  1K9R A;  1JVW A;  1NSG A;  3JXV A;  1FKL A;  2ZQS A;  4QIB A;  4DRJ A;  2XPA A;  4LAX A;  1ZCN A;  2RSE A;  2YSH A;  2KR7 A;  2MDI A;  4E5R A;  2MPH A;  4W9O A;  1FKJ A;  1Q6U A;  3O5E A;  5HW6 A;  3O5G A;  3KAF A;  3UF8 A;  2UZ5 A; 
#chains in the Genus database with same CATH topology
 1M5Y A;  4P8W A;  4DZ3 A;  4WK9 A;  5J6E A;  3BMB A;  2PN0 A;  4WKA A;  3CNG A;  2OLH A;  4ODO A;  2ZR5 A;  3WQV A;  4A0T A;  3AS0 A;  4DRH A;  2YAJ B;  1EDQ A;  3JYJ A;  1E15 A;  4G50 A;  1NH6 A;  3I6C A;  4MGV A;  3H9R B;  4TW8 A;  1FFR A;  1ZBV A;  1W9V A;  4DRN A;  2FAP A;  2PV2 A;  2RE3 A;  3MDY B;  2PPP A;  4S3J A;  4JYS A;  1HXV A;  2VCD A;  1LJY A;  3GPK A;  3FXY A;  1QPL A;  3WIJ A;  4Z2K A;  3RFW A;  4DRM A;  1LL4 A;  2DG9 A;  1ZU8 A;  2DSV A;  2ETN A;  2Y8N B;  3M85 A;  3WQW A;  5HBF A;  2WLY A;  3O5R A;  4A0U A;  3AS1 A;  1SR0 A;  4ITZ A;  4MTV A;  1ZBW A;  1NMW A;  5JH8 A;  4JFK A;  4TNS A;  3CGN A;  1HJV A;  4DT4 A;  3PQH A;  1FKK A;  4URI A;  1KT0 A;  1WR7 A;  1TR8 A;  4ODP A;  2JZV A;  2WAE A;  3WKZ A;  1E6R A;  4P8U A;  5B8I C;  2XPB A;  1PBK A;  4Z2H A;  3KCE A;  2DK1 A;  2XP9 A;  1ITX A;  1D7I A;  3PRB A;  2XP6 A;  4ODN A;  1BKF A;  3ARU A;  3ARX A;  4J4N A;  3LUO A;  3BXW A;  1K9Q A;  2RUD A;  3AQU A;  2AWG A;  3KAB A;  4AY1 A;  4DRO A;  1HKI A;  2JMF A;  1O6I A;  5AHT A;  3ARS A;  1E9L A;  4GIV A;  4QT3 A;  1L1P A;  1H0I A;  1B6C A;  3WD1 A;  1W1T A;  2DSZ A;  1QZ2 A;  1ROU A;  3CHD A;  4TYO A;  5HT1 A;  1D2K A;  4N19 A;  2XP7 A;  2DG3 A;  5E62 A;  1F8A B;  1HJW A;  3FSC A;  2LJ4 A;  3PRA A;  1ZBK A;  5E65 A;  1OGB A;  3ART A;  1Q1C A;  3NTP A;  2A3C A;  4DH0 A;  2D9F A;  4J4O A;  3EIP A;  1YW5 A;  1FKF A;  1UR9 A;  1RD6 A;  2RUR A;  2PV3 A;  2DSW A;  1HJX A;  2LPV A;  1QPF A;  3GU0 A;  5D75 A;  2DT1 A;  2IF4 A;  2M8I A;  1W9P A;  3QOK A;  4DRP A;  2MF9 A;  2N87 A;  1JNE A;  2YSF A;  3ARQ A;  3KAI A;  1TFV A;  2PPO A;  3UI4 A;  4U86 A;  3O5K A;  3IHZ A;  2FKE A;  4REX A;  2DJY A;  1E6P A;  3B9D A;  2YBU A;  1HKJ A;  1XRV A;  4W9P A;  1KT1 A;  1R9H A;  3ARW A;  4Q22 A;  3UQB A;  3KAH A;  2PV1 A;  4DWS C;  4ZPV R;  1ZBC A;  5HWC A;  2DWV A;  4Z2L A;  1Q6H A;  4QT2 A;  1I5H W;  2Q5A A;  1ROT A;  3PRD A;  1FLC A;  5GPG A;  1EG3 A;  4JFJ A;  2M08 A;  1WB0 A;  3G6M A;  4L3N A;  2XP3 A;  1EYM A;  1GRJ A;  3ALF A;  1J4R A;  3VAW A;  2KI3 A;  2F4E A;  2EUL A;  1HKK A;  1O6W A;  2ZR6 A;  1WAW A;  3G6L A;  3M7N A;  4ODK A;  1FKD A;  2A3E A;  1OGG A;  4MAV A;  3MQG A;  1Q6I A;  3OA5 A;  1D7H A;  2PBC A;  3AS2 A;  2DT0 A;  3LE4 A;  1LQ0 A;  4L72 B;  4ODQ A;  2ZQV A;  3TC5 A;  1KFW A;  4O2T A;  3CHC A;  2O9O A;  2P4V A;  5U47 A;  1D7J A;  5I98 A;  2LGO A;  1E44 A;  3ODK A;  3NI6 A;  2XP8 A;  3RM8 A;  4LAW A;  4QZV B;  2F23 A;  4G2P A;  3FY1 A;  1A7X A;  3KZ7 A;  2EZ5 W;  2ZAJ A;  4U84 A;  3MQH A;  3O5M A;  3O5D A;  1P5Q A;  3W4R A;  3EY6 A;  4IPX A;  4WJX A;  4HAR A;  2WAD A;  4MNM A;  3JYM A;  3PA7 A;  2WK2 A;  3ALG A;  4Q7N A;  2PPN A;  1W26 A;  2MLY A;  2L4J A;  1C9H A;  1LG1 A;  3OOB A;  1FAP A;  4R0X A;  2DSU A;  2B5U B;  1NWU A;  1FKG A;  2G41 A;  2QF8 A;  4LGX A;  2ESC A;  1FKS A;  3KAC A;  3UQI A;  3FS8 A;  1EIB A;  3UQA A;  2YSG A;  3ARZ A;  4Z2J A;  3WD0 A;  1JND A;  1BL4 A;  1UR8 A;  4TW7 A;  3WD4 A;  1JMQ A;  2WLZ A;  2ZR4 A;  4W5U A;  4JFI A;  4IT4 A;  3B9E A;  4DZ2 A;  1JNS A;  1W9U A;  3ARP A;  2LAJ A;  3CGM A;  4DRQ A;  1IX5 A;  4Z2I A;  4PTM A;  3ARV A;  1PIN A;  2YSI A;  1VF8 A;  5HUA A;  3O5O A;  1W1P A;  3ARR A;  3WD2 A;  3FAP A;  2M1I A;  1X6N A;  4ODM A;  4IQ2 A;  2YSB A;  3L4H A;  2Y78 A;  2PI6 A;  3O5L A;  3RM4 A;  5HKG A;  3TCZ A;  1TCO C;  3WL0 A;  2XP4 A;  2DT3 A;  2DG4 A;  5HW7 A;  2ZQT A;  2M8J A;  4ZPW R;  4C02 B;  3WL1 A;  3CH9 A;  1J6Y A;  4GLX A;  3O5F A;  2A3B A;  3NRK A;  4KR0 B;  2OFN A;  1WNO A;  1W1Y A;  2F21 A;  1D6O A;  1JCH B;  1X6L A;  1TK7 A;  4MNK A;  1EHN A;  3TDB A;  4P8X A;  5HWB A;  1LL7 A;  4MNJ A;  1EQ3 A;  4WKF A;  4ZPT R;  1FD9 A;  1YAT A;  4U85 A;  1GPF A;  3IK8 A;  4TW6 A;  2JX8 A;  4MNL A;  1T11 A;  3WH0 A;  3O5Q A;  1FKH A;  2KGJ A;  4DRI A;  2JXW A;  4Z2G A;  5DEZ A;  1F40 A;  1J4H A;  3MCB A;  1ZK6 A;  2XP5 A;  2ITK A;  2AOS A;  4NNR A;  1FKB A;  2BA1 A;  1ZB5 A;  2IUZ A;  3GTY X;  2L2S A;  2OWO A;  1E6Z A;  1OWQ A;  2M2A A;  4MSP A;  1NMV A;  4GGQ A;  3PR9 A;  1Y0O A;  3LKX B;  2YBT A;  2RUC A;  3MCB B;  5DIU A;  3IKG A;  2MNT A;  4DIP A;  4XAK A;  3FSB A;  4NZC A;  3RME A;  4HBE A;  3UI6 A;  2MLX A;  2RQS A;  4S3K A;  2RUQ A;  2M3O W;  3IKD A;  2DT2 A;  4IQC A;  1J4I A;  3B8S A;  3CHF A;  2LKN A;  3O5P A;  2JV4 A;  1FKT A;  1FKR A;  4W9Q A;  5DIT A;  2FDM A;  3B7X A;  2DK7 A;  3O5J A;  3KAG A;  1SYT A;  2E45 A;  2KO7 A;  4ZS6 A;  4DRK A;  2G8Z A;  4HBO A;  1NWT A;  1FKI A;  1E6N A;  1GUV A;  3KAD A;  2F2D A;  5DO2 A;  4IT6 A;  1NWS A;  1U79 A;  4ML4 A;  3ARY A;  4ODR A;  2KFW A;  2KXQ A;  4NSB A;  4R5E A;  1FJD A;  2MLZ A;  2K8I A;  3O5I A;  5HW8 A;  1LL6 A;  4FN2 A;  3RGC A;  4KQZ A;  5E66 A;  5HTG A;  5E64 A;  4ODL A;  2DMV A;  5E5W A;  2VN1 A;  4UDM A;  5BXJ A;  2B31 A;  3RM9 A;  4BF8 A;  1N1A A;  1FFQ A;  2O92 A;  1JNT A;  1ZL1 A;  3CHE A;  5DIV A;  2ZQU A;  4FAP A;  1XHG A;  3UI5 A;  4LAY A;  2KE0 A;  4JFL A;  4JFM A;  1WMV A;  4WKH A;  5CQ2 A;  1EG4 A;  4LAV A;  1GOI A;  4P8V A;  4TX0 A;  2QRV A;  1K9R A;  1CTN A;  1JVW A;  1NSG A;  3JXV A;  1FKL A;  1LG2 A;  3ARO A;  4DWS D;  1K9T A;  3WD3 A;  2A3A A;  2ZQS A;  4WIW A;  4QIB A;  4DRJ A;  5GQB A;  2XPA A;  1H0G A;  4LAX A;  5GPR A;  1ZCN A;  2RSE A;  1W1V A;  2DPE A;  2YSH A;  2KR7 A;  1RP5 A;  2MDI A;  1NWR A;  4DWS A;  5DF0 A;  4MPK A;  4E5R A;  3CZ8 A;  2MPH A;  2WM0 A;  4W9O A;  1FKJ A;  1Q6U A;  3O5E A;  5HW6 A;  3O5G A;  3B9A A;  3KAF A;  1HKM A;  3UF8 A;  3AS3 A;  4DWS B;  3LKX A;  2UZ5 A; 
#chains in the Genus database with same CATH homology
 1M5Y A;  4P8W A;  4DZ3 A;  4WK9 A;  5J6E A;  4WKA A;  3CNG A;  2OLH A;  4ODO A;  2ZR5 A;  3WQV A;  4A0T A;  3AS0 A;  4DRH A;  2YAJ B;  1EDQ A;  3JYJ A;  1E15 A;  4G50 A;  1NH6 A;  3I6C A;  4MGV A;  3H9R B;  4TW8 A;  1FFR A;  1ZBV A;  1W9V A;  4DRN A;  2FAP A;  2PV2 A;  2RE3 A;  3MDY B;  2PPP A;  4S3J A;  4JYS A;  1HXV A;  2VCD A;  1LJY A;  3GPK A;  3FXY A;  1QPL A;  3WIJ A;  4Z2K A;  3RFW A;  4DRM A;  1LL4 A;  2DG9 A;  1ZU8 A;  2DSV A;  2Y8N B;  3M85 A;  3WQW A;  5HBF A;  2WLY A;  3O5R A;  4A0U A;  3AS1 A;  1SR0 A;  4ITZ A;  4MTV A;  1ZBW A;  1NMW A;  5JH8 A;  4JFK A;  4TNS A;  3CGN A;  1HJV A;  4DT4 A;  3PQH A;  1FKK A;  4URI A;  1KT0 A;  1WR7 A;  1TR8 A;  4ODP A;  2JZV A;  2WAE A;  3WKZ A;  1E6R A;  4P8U A;  5B8I C;  2XPB A;  1PBK A;  4Z2H A;  3KCE A;  2DK1 A;  2XP9 A;  1ITX A;  1D7I A;  3PRB A;  2XP6 A;  4ODN A;  1BKF A;  3ARU A;  3ARX A;  4J4N A;  3LUO A;  3BXW A;  1K9Q A;  2RUD A;  3AQU A;  2AWG A;  3KAB A;  4AY1 A;  4DRO A;  1HKI A;  2JMF A;  1O6I A;  5AHT A;  3ARS A;  1E9L A;  4GIV A;  4QT3 A;  1L1P A;  1H0I A;  1B6C A;  3WD1 A;  1W1T A;  2DSZ A;  1QZ2 A;  1ROU A;  3CHD A;  4TYO A;  5HT1 A;  1D2K A;  4N19 A;  2XP7 A;  2DG3 A;  5E62 A;  1F8A B;  1HJW A;  3FSC A;  2LJ4 A;  3PRA A;  1ZBK A;  5E65 A;  1OGB A;  3ART A;  1Q1C A;  3NTP A;  2A3C A;  4DH0 A;  2D9F A;  4J4O A;  1YW5 A;  1FKF A;  1UR9 A;  1RD6 A;  2RUR A;  2PV3 A;  2DSW A;  1HJX A;  2LPV A;  1QPF A;  5D75 A;  2DT1 A;  2IF4 A;  2M8I A;  1W9P A;  3QOK A;  4DRP A;  2MF9 A;  2N87 A;  1JNE A;  2YSF A;  3ARQ A;  3KAI A;  1TFV A;  2PPO A;  3UI4 A;  4U86 A;  3O5K A;  3IHZ A;  2FKE A;  4REX A;  2DJY A;  1E6P A;  3B9D A;  2YBU A;  1HKJ A;  1XRV A;  4W9P A;  1KT1 A;  1R9H A;  3ARW A;  4Q22 A;  3UQB A;  3KAH A;  2PV1 A;  4DWS C;  4ZPV R;  1ZBC A;  5HWC A;  2DWV A;  4Z2L A;  1Q6H A;  4QT2 A;  1I5H W;  2Q5A A;  1ROT A;  3PRD A;  1FLC A;  5GPG A;  1EG3 A;  4JFJ A;  2M08 A;  1WB0 A;  3G6M A;  4L3N A;  2XP3 A;  1EYM A;  3ALF A;  1J4R A;  3VAW A;  2KI3 A;  2F4E A;  1HKK A;  1O6W A;  2ZR6 A;  1WAW A;  3G6L A;  3M7N A;  4ODK A;  1FKD A;  2A3E A;  1OGG A;  4MAV A;  3MQG A;  1Q6I A;  3OA5 A;  1D7H A;  2PBC A;  3AS2 A;  2DT0 A;  3LE4 A;  1LQ0 A;  4L72 B;  4ODQ A;  2ZQV A;  3TC5 A;  1KFW A;  4O2T A;  3CHC A;  2O9O A;  5U47 A;  1D7J A;  5I98 A;  2LGO A;  3ODK A;  3NI6 A;  2XP8 A;  3RM8 A;  4LAW A;  4QZV B;  4G2P A;  3FY1 A;  1A7X A;  3KZ7 A;  2EZ5 W;  2ZAJ A;  4U84 A;  3MQH A;  3O5M A;  3O5D A;  1P5Q A;  3W4R A;  3EY6 A;  4IPX A;  4WJX A;  4HAR A;  2WAD A;  4MNM A;  3JYM A;  3PA7 A;  2WK2 A;  3ALG A;  4Q7N A;  2PPN A;  1W26 A;  2MLY A;  2L4J A;  1C9H A;  1LG1 A;  3OOB A;  1FAP A;  4R0X A;  2DSU A;  1NWU A;  1FKG A;  2G41 A;  2QF8 A;  4LGX A;  2ESC A;  1FKS A;  3KAC A;  3UQI A;  3FS8 A;  1EIB A;  3UQA A;  2YSG A;  3ARZ A;  4Z2J A;  3WD0 A;  1JND A;  1BL4 A;  1UR8 A;  4TW7 A;  3WD4 A;  1JMQ A;  2WLZ A;  2ZR4 A;  4W5U A;  4JFI A;  4IT4 A;  3B9E A;  4DZ2 A;  1JNS A;  1W9U A;  3ARP A;  2LAJ A;  3CGM A;  4DRQ A;  1IX5 A;  4Z2I A;  4PTM A;  3ARV A;  1PIN A;  2YSI A;  1VF8 A;  5HUA A;  3O5O A;  1W1P A;  3ARR A;  3WD2 A;  3FAP A;  2M1I A;  1X6N A;  4ODM A;  4IQ2 A;  2YSB A;  3L4H A;  2Y78 A;  2PI6 A;  3O5L A;  3RM4 A;  5HKG A;  3TCZ A;  1TCO C;  3WL0 A;  2XP4 A;  2DT3 A;  2DG4 A;  5HW7 A;  2ZQT A;  2M8J A;  4ZPW R;  4C02 B;  3WL1 A;  3CH9 A;  1J6Y A;  4GLX A;  3O5F A;  2A3B A;  3NRK A;  4KR0 B;  2OFN A;  1WNO A;  1W1Y A;  2F21 A;  1D6O A;  1X6L A;  1TK7 A;  4MNK A;  1EHN A;  3TDB A;  4P8X A;  5HWB A;  1LL7 A;  4MNJ A;  1EQ3 A;  4WKF A;  4ZPT R;  1FD9 A;  1YAT A;  4U85 A;  1GPF A;  3IK8 A;  4TW6 A;  2JX8 A;  4MNL A;  1T11 A;  3WH0 A;  3O5Q A;  1FKH A;  2KGJ A;  4DRI A;  2JXW A;  4Z2G A;  5DEZ A;  1F40 A;  1J4H A;  3MCB A;  1ZK6 A;  2XP5 A;  2ITK A;  2AOS A;  4NNR A;  1FKB A;  2BA1 A;  1ZB5 A;  2IUZ A;  2L2S A;  2OWO A;  1E6Z A;  1OWQ A;  2M2A A;  4MSP A;  1NMV A;  4GGQ A;  3PR9 A;  1Y0O A;  3LKX B;  2YBT A;  2RUC A;  3MCB B;  5DIU A;  3IKG A;  2MNT A;  4DIP A;  4XAK A;  3FSB A;  4NZC A;  3RME A;  4HBE A;  3UI6 A;  2MLX A;  2RQS A;  4S3K A;  2RUQ A;  2M3O W;  3IKD A;  2DT2 A;  4IQC A;  1J4I A;  3B8S A;  3CHF A;  2LKN A;  3O5P A;  2JV4 A;  1FKT A;  1FKR A;  4W9Q A;  5DIT A;  2FDM A;  3B7X A;  2DK7 A;  3O5J A;  3KAG A;  1SYT A;  2E45 A;  2KO7 A;  4ZS6 A;  4DRK A;  2G8Z A;  4HBO A;  1NWT A;  1FKI A;  1E6N A;  1GUV A;  3KAD A;  2F2D A;  5DO2 A;  4IT6 A;  1NWS A;  1U79 A;  4ML4 A;  3ARY A;  4ODR A;  2KFW A;  2KXQ A;  4NSB A;  4R5E A;  1FJD A;  2MLZ A;  2K8I A;  3O5I A;  5HW8 A;  1LL6 A;  4FN2 A;  3RGC A;  4KQZ A;  5E66 A;  5HTG A;  5E64 A;  4ODL A;  2DMV A;  5E5W A;  2VN1 A;  5BXJ A;  2B31 A;  3RM9 A;  4BF8 A;  1N1A A;  1FFQ A;  2O92 A;  1JNT A;  1ZL1 A;  3CHE A;  5DIV A;  2ZQU A;  4FAP A;  1XHG A;  3UI5 A;  4LAY A;  2KE0 A;  4JFL A;  4JFM A;  1WMV A;  4WKH A;  5CQ2 A;  1EG4 A;  4LAV A;  1GOI A;  4P8V A;  4TX0 A;  2QRV A;  1K9R A;  1CTN A;  1JVW A;  1NSG A;  3JXV A;  1FKL A;  1LG2 A;  3ARO A;  4DWS D;  1K9T A;  3WD3 A;  2A3A A;  2ZQS A;  4WIW A;  4QIB A;  4DRJ A;  5GQB A;  2XPA A;  1H0G A;  4LAX A;  5GPR A;  1ZCN A;  2RSE A;  1W1V A;  2DPE A;  2YSH A;  2KR7 A;  1RP5 A;  2MDI A;  1NWR A;  4DWS A;  5DF0 A;  4MPK A;  4E5R A;  3CZ8 A;  2MPH A;  2WM0 A;  4W9O A;  1FKJ A;  1Q6U A;  3O5E A;  5HW6 A;  3O5G A;  3B9A A;  3KAF A;  1HKM A;  3UF8 A;  3AS3 A;  4DWS B;  3LKX A;  2UZ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...