2ZQVA

Crystal structure of a mutant pin1 peptidyl-prolyl cis-trans isomerase
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
158
structure length
153
Chain Sequence
KLPPGWEKRMSRSSGRVYYANHITNASQWERPSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies on PIN1 mutants
rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 45
structure length 153
sequence length 158
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2008-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2zqvA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2zqvA02
3O5MA 3KZ7A 4W9OA 3M85A 4W9QA 3UQIA 3NTPA 3KACA 2ZQVA 2DK1A 1JVWA 2MLYA 2Y78A 4QT2A 2XP8A 1J4HA 1QPLA 5BXJA 3UQBA 4E5RA 2DG9A 1R9HA 1FAPA 3O5JA 5I98A 2PV3A 4JYSA 2PPPA 3NI6A 2JX8A 1EQ3A 2ITKA 1D7HA 1YATA 2ZR6A 3WH0A 1J4IA 4DRMA 5HWCA 5B8IC 1WR7A 2Q5AA 1B6CA 2PV1A 4JFKA 4N19A 4TW7A 1YW5A 2LAJA 1KT1A 2VN1A 5DIUA 2DG3A 4DZ2A 3KCEA 2UZ5A 1ROTA 1BL4A 1JMQA 1JNTA 4W9PA 4FAPA 5HUAA 2XP9A 4DRPA 1FKBA 4J4OA 2ZR5A 1WMVA 5HW6A 4LAVA 2DK7A 4QT3A 2LPVA 1FKFA 2K8IA 3UI4A 1FKDA 1EG4A 2KI3A 1W26A 3IKGA 1I5HW 2RUDA 3L4HA 2PPNA 5CQ2A 3JYMA 4IQ2A 2FKEA 4J4NA 1N1AA 4ODQA 2D9FA 2KFWA 2KO7A 4IPXA 4NNRA 4ODNA 1K9QA 5DITA 1EYMA 1P5QA 2PV2A 3JXVA 4MGVA 3UI5A 4DIPA 2MNTA 3O5DA 2LJ4A 1F40A 2ZQUA 1FKSA 2MF9A 3O5LA 4LAYA 3TDBA 4DRIA 1FKTA 3VAWA 4IQCA 3RGCA 4C02B 2YSHA 2M3OW 3IHZA 4TW6A 2DMVA 2M8IA 1FKRA 2M1IA 1Q6IA 5HW7A 2ZQTA 3O5QA 4JFLA 2FAPA 1Q6HA 1NMVA 3IK8A 4ODKA 3O5FA 4DRNA 2JV4A 1K9RA 2L4JA 3TC5A 2DJYA 3OOBA 1ROUA 1EG3A 1TCOC 1Y0OA 2LGOA 2KXQA 2XP4A 3ODKA 1C9HA 4G50A 5HKGA 1U79A 4U84A 1NMWA 4U85A 1NSGA 2MPHA 3I6CA 2F2DA 1ZCNA 2RSEA 3UI6A 4JFIA 5D75A 3KABA 3O5KA 4GGQA 4ITZA 3UQAA 1PINA 1KT0A 3CGNA 4DRQA 3O5GA 2VCDA 1TK7A 2M2AA 3O5IA 4DH0A 1M5YA 3KAGA 4JFMA 1FKHA 3KAFA 3IKDA 3O5OA 5DIVA 3KAIA 3LE4A 5HT1A 2DWVA 2XPAA 1J4RA 1D7JA 5AHTA 2N87A 4LAXA 5HTGA 2ZR4A 3EY6A 2KR7A 2EZ5W 1HXVA 3TCZA 5J6EA 2BA1A 1FKKA 5HWBA 1QZ2A 2AWGA 2YSGA 1F8AB 2ZQSA 1Q1CA 2L2SA 4LAWA 4ODMA 3RFWA 4ODRA 1JNSA 2M8JA 2RURA 2PBCA 2MLXA 1FKJA 3KADA 2MLZA 1D6OA 2RUCA 3MDYB 3NRKA 3UF8A 4TW8A 2XP7A 4QIBA 1PBKA 3PRBA 4MSPA 3CGMA 4O2TA 2M08A 2JXWA 2F4EA 2JMFA 4GIVA 1BKFA 2KE0A 1T11A 2XP5A 4TNSA 4U86A 2RE3A 2KGJA 2XPBA 2MDIA 4REXA 3B7XA 4TX0A 4DRJA 2YSIA 5GPGA 2OFNA 2RUQA 3M7NA 3PA7A 1A7XA 2RQSA 3O5PA 3JYJA 4JFJA 2F21A 2XP3A 2JZVA 1FD9A 2YSBA 1ZK6A 4G2PA 3FAPA 1L1PA 4ODLA 4DZ3A 3GPKA 4DROA 3O5RA 2XP6A 1FKIA 1FKGA 4DRHA 3KAHA 1J6YA 4ODPA 3H9RB 1QPFA 4FN2A 4ODOA 1FJDA 1Q6UA 4R0XA 3CNGA 2PPOA 2DG4A 3O5EA 2LKNA 2ZAJA 3PRDA 4BF8A 2IF4A 4TYOA 4DT4A 2E45A 5HW8A 1D7IA 2YSFA 1O6WA 3LUOA 1FKLA 4DRKA
chains in the Genus database with same CATH superfamily
1K9TA 3WKZA 3KZ7A 4MNMA 2AOSA 2ZQVA 1JVWA 1E15A 1NWTA 2XP8A 2P4VA 1QPLA 4E5RA 1ITXA 2ITKA 1D7HA 1YATA 2ZR6A 1J4IA 5GQBA 1SR0A 3WD0A 4Q7NA 2LAJA 1KT1A 4Z2LA 3ARUA 4KR0B 1BL4A 4FAPA 4NSBA 1FKBA 1E6RA 3PQHA 3MCBB 1WB0A 1LQ0A 4MNJA 1LJYA 2KI3A 4PTMA 1ZL1A 2PPNA 4AY1A 3MCBA 4J4NA 4IQ2A 1N1AA 4WK9A 2KO7A 1K9QA 3RM8A 4DIPA 1P5QA 3ALFA 4R5EA 2DSUA 1W9VA 2B5UB 2DT1A 4LAYA 4DRIA 1ZBWA 1FKTA 5DO2A 4IQCA 3RGCA 4DWSD 2DPEA 4TW6A 1W1VA 5HW7A 2ZQTA 3O5QA 4JFLA 3IK8A 1XRVA 2JV4A 2L4JA 2DSZA 3OOBA 2LGOA 1EG3A 3BXWA 1Y0OA 2XP4A 1NWUA 1C9HA 3I6CA 1ZB5A 1PINA 1KT0A 1GRJA 1M5YA 3AS1A 3KAIA 1J4RA 1D7JA 4P8XA 2YBTA 4ZS6A 5J6EA 2BA1A 1QZ2A 2AWGA 3PRAA 2YSGA 3FXYA 4ZPVR 2WAEA 3RMEA 2ESCA 1JNSA 1FKJA 3UF8A 4TW8A 4QIBA 3PRBA 3CGMA 2F23A 4WKFA 2F4EA 2KE0A 1T11A 4P8WA 2XPBA 3CHDA 3PA7A 2RQSA 4L3NA 2G8ZA 2JZVA 2YSBA 1HKMA 4WIWA 3FAPA 3BMBA 4S3JA 4HBEA 2XP6A 1J6YA 4ODPA 1UR8A 3GTYX 4KQZA 1HKJA 1ZBCA 4TYOA 2A3BA 4P8UA 5E65A 1FKLA 3JYJA 3O5OA 3UQIA 2IUZA 2DK1A 5E62A 2Y78A 4IT4A 2DG9A 4WKAA 1FFQA 2PV3A 3WQVA 1EDQA 2OLHA 1HJVA 5HWCA 5B8IC 1WR7A 1NWRA 1B6CA 4N19A 4JFKA 3OA5A 5GPRA 2B31A 1JNDA 4W9PA 4XAKA 4WKHA 4DRPA 5HW6A 4HARA 2K8IA 3UI4A 1EG4A 1W26A 3L4HA 5CQ2A 1GPFA 4URIA 2KFWA 5DITA 3MQHA 4MGVA 2LJ4A 3CHCA 1FKSA 2MF9A 3LKXA 2A3EA 1W9PA 4ML4A 4Q22A 3VAWA 3ARTA 2PN0A 3RM9A 4P8VA 4HBOA 1LG1A 2A3CA 4QZVB 2A3AA 2FAPA 1Q6HA 1NMVA 1H0GA 3FSBA 2O9OA 4W9QA 3TC5A 5HKGA 2KXQA 2DT0A 3ALGA 1U79A 4Z2KA 2F2DA 1FFRA 3UI6A 4JFIA 3KABA 2WLYA 3CGNA 4DRQA 1HKKA 3O5GA 1TK7A 1X6NA 1WNOA 2QRVA 1EIBA 3EY6A 4S3KA 3EIPA 2L2SA 1Q1CA 4MTVA 3CHEA 1ZU8A 4MAVA 1RD6A 2DT3A 1W1YA 2G41A 2M8JA 3NRKA 2XP7A 4O2TA 3WD1A 2M08A 2EULA 1BKFA 2XP5A 1GOIA 2KGJA 1TR8A 4DRJA 2MDIA 3B7XA 1KFWA 1GUVA 2YSIA 2RUQA 3WIJA 1JNEA 3O5PA 5U47A 2F21A 2XP3A 3RM4A 3GU0A 4G2PA 2YAJB 3GPKA 3B9EA 1FKIA 1FKGA 3G6MA 1LL6A 1QPFA 4R0XA 3PRDA 2OWOA 4BF8A 2E45A 5HW8A 2YSFA 4DRKA 1W9UA 3M85A 3NTPA 2MLYA 4QT2A 1WAWA 1E6PA 4Z2GA 1LL7A 2DT2A 2PPPA 3NI6A 1EQ3A 3WH0A 4DRMA 1LG2A 3AROA 2Q5AA 2PV1A 3ARSA 1H0IA 2VN1A 4DZ2A 3KCEA 1VF8A 1JMQA 1JNTA 1HJWA 2XP9A 3ARQA 3ARZA 4J4OA 4LAVA 4QT3A 2O92A 1FKFA 1NH6A 3JYMA 3ARVA 2RUDA 2FKEA 4IPXA 3AS3A 2PV2A 3JXVA 3B9AA 3FS8A 2MNTA 4Z2JA 2ZQUA 3ARXA 3TDBA 2ETNA 2M3OW 4GLXA 3CHFA 3IHZA 2DMVA 4LGXA 2M1IA 5HBFA 1K9RA 1ROUA 1TCOC 4DWSB 1FLCA 3AQUA 4U85A 1NSGA 2RSEA 4ITZA 4GGQA 1E9LA 1XHGA 2WADA 2VCDA 2M2AA 4JFMA 3AS0A 3KAFA 3IKDA 5DIVA 3LE4A 3ARPA 5HT1A 2DWVA 1UR9A 5AHTA 2N87A 2ZR4A 3B8SA 4DWSA 3TCZA 3WL1A 5E66A 1D2KA 1E44A 1CTNA 3RFWA 1W1TA 4LAWA 4ODRA 2PBCA 2MLXA 3KADA 3MDYB 2RUCA 1PBKA 4MSPA 3WQWA 5E5WA 2JMFA 4GIVA 4U86A 3MQGA 5GPGA 1SYTA 3M7NA 4JFJA 1TFVA 1FD9A 1E6ZA 1L1PA 4DWSC 4DZ3A 5DF0A 3ARWA 2Y8NB 3H9RB 4MPKA 3WD3A 4FN2A 1Q6UA 3CNGA 2PPOA 2DG4A 1OGBA 2ZAJA 2IF4A 1HJXA 1O6WA 3O5MA 4W9OA 3KACA 4A0UA 1J4HA 1R9HA 1FAPA 3O5JA 3PR9A 5I98A 4JYSA 2JX8A 2FDMA 4TW7A 1YW5A 3LKXB 1E6NA 5DIUA 2WM0A 2UZ5A 1ROTA 1JCHB 4L72B 2ZR5A 1WMVA 2DK7A 4ZPWR 2LPVA 1FKDA 3IKGA 1I5HW 2QF8A 4ODQA 2D9FA 4ODNA 5BXJA 3UI5A 1OGGA 1EYMA 3O5DA 1IX5A 1F40A 3O5LA 1RP5A 3B9DA 4C02B 2YSHA 1X6LA 1LL4A 3FSCA 1W1PA 2M8IA 2DSVA 2DSWA 1FKRA 1Q6IA 3CH9A 4ODKA 3FY1A 3O5FA 5DEZA 4DRNA 2DG3A 4NNRA 3W4RA 2DJYA 1OWQA 5HUAA 4G50A 3UQBA 3WL0A 3ODKA 3ARRA 4U84A 1NMWA 2MPHA 1ZCNA 5D75A 3O5KA 3CZ8A 3UQAA 4ZPTR 5JH8A 3WD4A 3ARYA 4DH0A 2YBUA 3O5IA 3KAGA 1FKHA 4IT6A 4W5UA 2XPAA 4LAXA 5HTGA 1ZBVA 2EZ5W 2KR7A 4UDMA 1FKKA 5HWBA 1ZBKA 1F8AB 2ZQSA 4ODMA 1NWSA 2RURA 3G6LA 4A0TA 1HXVA 2MLZA 1D6OA 1EHNA 1HKIA 2WK2A 2JXWA 4TNSA 2RE3A 4TX0A 4REXA 4Z2IA 2OFNA 1A7XA 5E64A 1ZK6A 3AS2A 1O6IA 4ODLA 2WLZA 4DROA 3O5RA 4MNKA 3KAHA 4DRHA 4MNLA 4Z2HA 4ODOA 1FJDA 3O5EA 2LKNA 4NZCA 3QOKA 4DT4A 1D7IA 4WJXA 2PI6A 3LUOA 3WD2A
chains in the Genus database with same CATH topology
1K9TA 3WKZA 3KZ7A 4MNMA 2AOSA 2ZQVA 1JVWA 1E15A 1NWTA 2XP8A 1QPLA 4E5RA 1ITXA 2ITKA 1D7HA 1YATA 2ZR6A 1J4IA 5GQBA 1SR0A 3WD0A 4Q7NA 2LAJA 1KT1A 4Z2LA 3ARUA 4KR0B 1BL4A 4FAPA 4NSBA 1FKBA 1E6RA 3PQHA 3MCBB 1WB0A 1LQ0A 4MNJA 1LJYA 2KI3A 4PTMA 1ZL1A 2PPNA 4AY1A 3MCBA 4J4NA 4IQ2A 1N1AA 4WK9A 2KO7A 1K9QA 3RM8A 4DIPA 1P5QA 3ALFA 4R5EA 2DSUA 1W9VA 2DT1A 4LAYA 4DRIA 1ZBWA 1FKTA 5DO2A 4IQCA 3RGCA 4DWSD 2DPEA 4TW6A 1W1VA 5HW7A 2ZQTA 3O5QA 4JFLA 3IK8A 1XRVA 2JV4A 2L4JA 2DSZA 3OOBA 2LGOA 1EG3A 3BXWA 1Y0OA 2XP4A 1NWUA 1C9HA 3I6CA 1ZB5A 1PINA 1KT0A 1M5YA 3AS1A 3KAIA 1J4RA 1D7JA 4P8XA 2YBTA 4ZS6A 5J6EA 2BA1A 1QZ2A 2AWGA 3PRAA 2YSGA 3FXYA 4ZPVR 2WAEA 3RMEA 2ESCA 1JNSA 1FKJA 3UF8A 4TW8A 4QIBA 3PRBA 3CGMA 4WKFA 2F4EA 2KE0A 1T11A 4P8WA 2XPBA 3CHDA 3PA7A 2RQSA 4L3NA 2G8ZA 2JZVA 2YSBA 1HKMA 4WIWA 3FAPA 4S3JA 4HBEA 2XP6A 1J6YA 4ODPA 1UR8A 4KQZA 1HKJA 1ZBCA 4TYOA 2A3BA 4P8UA 5E65A 1FKLA 3JYJA 3O5OA 3UQIA 2IUZA 2DK1A 5E62A 2Y78A 4IT4A 2DG9A 4WKAA 1FFQA 2PV3A 3WQVA 1EDQA 2OLHA 1HJVA 5HWCA 5B8IC 1WR7A 1NWRA 1B6CA 4N19A 4JFKA 3OA5A 5GPRA 2B31A 1JNDA 4W9PA 4XAKA 4WKHA 4DRPA 5HW6A 4HARA 2K8IA 3UI4A 1EG4A 1W26A 3L4HA 5CQ2A 1GPFA 4URIA 2KFWA 5DITA 3MQHA 4MGVA 2LJ4A 3CHCA 1FKSA 2MF9A 3LKXA 2A3EA 1W9PA 4ML4A 4Q22A 3VAWA 3ARTA 3RM9A 4P8VA 4HBOA 1LG1A 2A3CA 4QZVB 2A3AA 2FAPA 1Q6HA 1NMVA 1H0GA 3FSBA 2O9OA 4W9QA 3TC5A 5HKGA 2KXQA 2DT0A 3ALGA 1U79A 4Z2KA 2F2DA 1FFRA 3UI6A 4JFIA 3KABA 2WLYA 3CGNA 4DRQA 1HKKA 3O5GA 1TK7A 1X6NA 1WNOA 2QRVA 1EIBA 3EY6A 4S3KA 2L2SA 1Q1CA 4MTVA 3CHEA 1ZU8A 4MAVA 1RD6A 2DT3A 1W1YA 2G41A 2M8JA 3NRKA 2XP7A 4O2TA 3WD1A 2M08A 1BKFA 2XP5A 1GOIA 2KGJA 1TR8A 4DRJA 2MDIA 3B7XA 1KFWA 1GUVA 2YSIA 2RUQA 3WIJA 1JNEA 3O5PA 5U47A 2F21A 2XP3A 3RM4A 4G2PA 2YAJB 3GPKA 3B9EA 1FKIA 1FKGA 3G6MA 1LL6A 1QPFA 4R0XA 3PRDA 2OWOA 4BF8A 2E45A 5HW8A 2YSFA 4DRKA 1W9UA 3M85A 3NTPA 2MLYA 4QT2A 1WAWA 1E6PA 4Z2GA 1LL7A 2DT2A 2PPPA 3NI6A 1EQ3A 3WH0A 4DRMA 1LG2A 3AROA 2Q5AA 2PV1A 3ARSA 1H0IA 2VN1A 4DZ2A 3KCEA 1VF8A 1JMQA 1JNTA 1HJWA 2XP9A 3ARQA 3ARZA 4J4OA 4LAVA 4QT3A 2O92A 1FKFA 1NH6A 3JYMA 3ARVA 2RUDA 2FKEA 4IPXA 3AS3A 2PV2A 3JXVA 3B9AA 3FS8A 2MNTA 4Z2JA 2ZQUA 3ARXA 3TDBA 2M3OW 4GLXA 3CHFA 3IHZA 2DMVA 4LGXA 2M1IA 5HBFA 1K9RA 1ROUA 1TCOC 4DWSB 1FLCA 3AQUA 4U85A 1NSGA 2RSEA 4ITZA 4GGQA 1E9LA 1XHGA 2WADA 2VCDA 2M2AA 4JFMA 3AS0A 3KAFA 3IKDA 5DIVA 3LE4A 3ARPA 5HT1A 2DWVA 1UR9A 5AHTA 2N87A 2ZR4A 3B8SA 4DWSA 3TCZA 3WL1A 5E66A 1D2KA 1CTNA 3RFWA 1W1TA 4LAWA 4ODRA 2PBCA 2MLXA 3KADA 3MDYB 2RUCA 1PBKA 4MSPA 3WQWA 5E5WA 2JMFA 4GIVA 4U86A 3MQGA 5GPGA 1SYTA 3M7NA 4JFJA 1TFVA 1FD9A 1E6ZA 1L1PA 4DWSC 4DZ3A 5DF0A 3ARWA 2Y8NB 3H9RB 4MPKA 3WD3A 4FN2A 1Q6UA 3CNGA 2PPOA 2DG4A 1OGBA 2ZAJA 2IF4A 1HJXA 1O6WA 3O5MA 4W9OA 3KACA 4A0UA 1J4HA 1R9HA 1FAPA 3O5JA 3PR9A 5I98A 4JYSA 2JX8A 2FDMA 4TW7A 1YW5A 3LKXB 1E6NA 5DIUA 2WM0A 2UZ5A 1ROTA 4L72B 2ZR5A 1WMVA 2DK7A 4ZPWR 2LPVA 1FKDA 3IKGA 1I5HW 2QF8A 4ODQA 2D9FA 4ODNA 5BXJA 3UI5A 1OGGA 1EYMA 3O5DA 1IX5A 1F40A 3O5LA 1RP5A 3B9DA 4C02B 2YSHA 1X6LA 1LL4A 3FSCA 1W1PA 2M8IA 2DSVA 2DSWA 1FKRA 1Q6IA 3CH9A 4ODKA 3FY1A 3O5FA 5DEZA 4DRNA 2DG3A 4NNRA 3W4RA 2DJYA 1OWQA 5HUAA 4G50A 3UQBA 3WL0A 3ODKA 3ARRA 4U84A 1NMWA 2MPHA 1ZCNA 5D75A 3O5KA 3CZ8A 3UQAA 4ZPTR 5JH8A 3WD4A 3ARYA 4DH0A 2YBUA 3O5IA 3KAGA 1FKHA 4IT6A 4W5UA 2XPAA 4LAXA 5HTGA 1ZBVA 2EZ5W 2KR7A 1FKKA 5HWBA 1ZBKA 1F8AB 2ZQSA 4ODMA 1NWSA 2RURA 3G6LA 4A0TA 1HXVA 2MLZA 1D6OA 1EHNA 1HKIA 2WK2A 2JXWA 4TNSA 2RE3A 4TX0A 4REXA 4Z2IA 2OFNA 1A7XA 5E64A 1ZK6A 3AS2A 1O6IA 4ODLA 2WLZA 4DROA 3O5RA 4MNKA 3KAHA 4DRHA 4MNLA 4Z2HA 4ODOA 1FJDA 3O5EA 2LKNA 4NZCA 3QOKA 4DT4A 1D7IA 4WJXA 2PI6A 3LUOA 3WD2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O5M A;  3KZ7 A;  4W9O A;  3M85 A;  4W9Q A;  3UQI A;  3NTP A;  3KAC A;  2ZQV A;  2DK1 A;  1JVW A;  2MLY A;  2Y78 A;  4QT2 A;  2XP8 A;  1J4H A;  1QPL A;  5BXJ A;  3UQB A;  4E5R A;  2DG9 A;  1R9H A;  1FAP A;  3O5J A;  5I98 A;  2PV3 A;  4JYS A;  2PPP A;  3NI6 A;  2JX8 A;  1EQ3 A;  2ITK A;  1D7H A;  1YAT A;  2ZR6 A;  3WH0 A;  1J4I A;  4DRM A;  5HWC A;  5B8I C;  1WR7 A;  2Q5A A;  1B6C A;  2PV1 A;  4JFK A;  4N19 A;  4TW7 A;  1YW5 A;  2LAJ A;  1KT1 A;  2VN1 A;  5DIU A;  2DG3 A;  4DZ2 A;  3KCE A;  2UZ5 A;  1ROT A;  1BL4 A;  1JMQ A;  1JNT A;  4W9P A;  4FAP A;  5HUA A;  2XP9 A;  4DRP A;  1FKB A;  4J4O A;  2ZR5 A;  1WMV A;  5HW6 A;  4LAV A;  2DK7 A;  4QT3 A;  2LPV A;  1FKF A;  2K8I A;  3UI4 A;  1FKD A;  1EG4 A;  2KI3 A;  1W26 A;  3IKG A;  1I5H W;  2RUD A;  3L4H A;  2PPN A;  5CQ2 A;  3JYM A;  4IQ2 A;  2FKE A;  4J4N A;  1N1A A;  4ODQ A;  2D9F A;  2KFW A;  2KO7 A;  4IPX A;  4NNR A;  4ODN A;  1K9Q A;  5DIT A;  1EYM A;  1P5Q A;  2PV2 A;  3JXV A;  4MGV A;  3UI5 A;  4DIP A;  2MNT A;  3O5D A;  2LJ4 A;  1F40 A;  2ZQU A;  1FKS A;  2MF9 A;  3O5L A;  4LAY A;  3TDB A;  4DRI A;  1FKT A;  3VAW A;  4IQC A;  3RGC A;  4C02 B;  2YSH A;  2M3O W;  3IHZ A;  4TW6 A;  2DMV A;  2M8I A;  1FKR A;  2M1I A;  1Q6I A;  5HW7 A;  2ZQT A;  3O5Q A;  4JFL A;  2FAP A;  1Q6H A;  1NMV A;  3IK8 A;  4ODK A;  3O5F A;  4DRN A;  2JV4 A;  1K9R A;  2L4J A;  3TC5 A;  2DJY A;  3OOB A;  1ROU A;  1EG3 A;  1TCO C;  1Y0O A;  2LGO A;  2KXQ A;  2XP4 A;  3ODK A;  1C9H A;  4G50 A;  5HKG A;  1U79 A;  4U84 A;  1NMW A;  4U85 A;  1NSG A;  2MPH A;  3I6C A;  2F2D A;  1ZCN A;  2RSE A;  3UI6 A;  4JFI A;  5D75 A;  3KAB A;  3O5K A;  4GGQ A;  4ITZ A;  3UQA A;  1PIN A;  1KT0 A;  3CGN A;  4DRQ A;  3O5G A;  2VCD A;  1TK7 A;  2M2A A;  3O5I A;  4DH0 A;  1M5Y A;  3KAG A;  4JFM A;  1FKH A;  3KAF A;  3IKD A;  3O5O A;  5DIV A;  3KAI A;  3LE4 A;  5HT1 A;  2DWV A;  2XPA A;  1J4R A;  1D7J A;  5AHT A;  2N87 A;  4LAX A;  5HTG A;  2ZR4 A;  3EY6 A;  2KR7 A;  2EZ5 W;  1HXV A;  3TCZ A;  5J6E A;  2BA1 A;  1FKK A;  5HWB A;  1QZ2 A;  2AWG A;  2YSG A;  1F8A B;  2ZQS A;  1Q1C A;  2L2S A;  4LAW A;  4ODM A;  3RFW A;  4ODR A;  1JNS A;  2M8J A;  2RUR A;  2PBC A;  2MLX A;  1FKJ A;  3KAD A;  2MLZ A;  1D6O A;  2RUC A;  3MDY B;  3NRK A;  3UF8 A;  4TW8 A;  2XP7 A;  4QIB A;  1PBK A;  3PRB A;  4MSP A;  3CGM A;  4O2T A;  2M08 A;  2JXW A;  2F4E A;  2JMF A;  4GIV A;  1BKF A;  2KE0 A;  1T11 A;  2XP5 A;  4TNS A;  4U86 A;  2RE3 A;  2KGJ A;  2XPB A;  2MDI A;  4REX A;  3B7X A;  4TX0 A;  4DRJ A;  2YSI A;  5GPG A;  2OFN A;  2RUQ A;  3M7N A;  3PA7 A;  1A7X A;  2RQS A;  3O5P A;  3JYJ A;  4JFJ A;  2F21 A;  2XP3 A;  2JZV A;  1FD9 A;  2YSB A;  1ZK6 A;  4G2P A;  3FAP A;  1L1P A;  4ODL A;  4DZ3 A;  3GPK A;  4DRO A;  3O5R A;  2XP6 A;  1FKI A;  1FKG A;  4DRH A;  3KAH A;  1J6Y A;  4ODP A;  3H9R B;  1QPF A;  4FN2 A;  4ODO A;  1FJD A;  1Q6U A;  4R0X A;  3CNG A;  2PPO A;  2DG4 A;  3O5E A;  2LKN A;  2ZAJ A;  3PRD A;  4BF8 A;  2IF4 A;  4TYO A;  4DT4 A;  2E45 A;  5HW8 A;  1D7I A;  2YSF A;  1O6W A;  3LUO A;  1FKL A;  4DRK A; 
#chains in the Genus database with same CATH topology
 1K9T A;  3WKZ A;  3KZ7 A;  4MNM A;  2AOS A;  2ZQV A;  1JVW A;  1E15 A;  1NWT A;  2XP8 A;  2P4V A;  1QPL A;  4E5R A;  1ITX A;  2ITK A;  1D7H A;  1YAT A;  2ZR6 A;  1J4I A;  5GQB A;  1SR0 A;  3WD0 A;  4Q7N A;  2LAJ A;  1KT1 A;  4Z2L A;  3ARU A;  4KR0 B;  1BL4 A;  4FAP A;  4NSB A;  1FKB A;  1E6R A;  3PQH A;  3MCB B;  1WB0 A;  1LQ0 A;  4MNJ A;  1LJY A;  2KI3 A;  4PTM A;  1ZL1 A;  2PPN A;  4AY1 A;  3MCB A;  4J4N A;  4IQ2 A;  1N1A A;  4WK9 A;  2KO7 A;  1K9Q A;  3RM8 A;  4DIP A;  1P5Q A;  3ALF A;  4R5E A;  2DSU A;  1W9V A;  2B5U B;  2DT1 A;  4LAY A;  4DRI A;  1ZBW A;  1FKT A;  5DO2 A;  4IQC A;  3RGC A;  4DWS D;  2DPE A;  4TW6 A;  1W1V A;  5HW7 A;  2ZQT A;  3O5Q A;  4JFL A;  3IK8 A;  1XRV A;  2JV4 A;  2L4J A;  2DSZ A;  3OOB A;  2LGO A;  1EG3 A;  3BXW A;  1Y0O A;  2XP4 A;  1NWU A;  1C9H A;  3I6C A;  1ZB5 A;  1PIN A;  1KT0 A;  1GRJ A;  1M5Y A;  3AS1 A;  3KAI A;  1J4R A;  1D7J A;  4P8X A;  2YBT A;  4ZS6 A;  5J6E A;  2BA1 A;  1QZ2 A;  2AWG A;  3PRA A;  2YSG A;  3FXY A;  4ZPV R;  2WAE A;  3RME A;  2ESC A;  1JNS A;  1FKJ A;  3UF8 A;  4TW8 A;  4QIB A;  3PRB A;  3CGM A;  2F23 A;  4WKF A;  2F4E A;  2KE0 A;  1T11 A;  4P8W A;  2XPB A;  3CHD A;  3PA7 A;  2RQS A;  4L3N A;  2G8Z A;  2JZV A;  2YSB A;  1HKM A;  4WIW A;  3FAP A;  3BMB A;  4S3J A;  4HBE A;  2XP6 A;  1J6Y A;  4ODP A;  1UR8 A;  3GTY X;  4KQZ A;  1HKJ A;  1ZBC A;  4TYO A;  2A3B A;  4P8U A;  5E65 A;  1FKL A;  3JYJ A;  3O5O A;  3UQI A;  2IUZ A;  2DK1 A;  5E62 A;  2Y78 A;  4IT4 A;  2DG9 A;  4WKA A;  1FFQ A;  2PV3 A;  3WQV A;  1EDQ A;  2OLH A;  1HJV A;  5HWC A;  5B8I C;  1WR7 A;  1NWR A;  1B6C A;  4N19 A;  4JFK A;  3OA5 A;  5GPR A;  2B31 A;  1JND A;  4W9P A;  4XAK A;  4WKH A;  4DRP A;  5HW6 A;  4HAR A;  2K8I A;  3UI4 A;  1EG4 A;  1W26 A;  3L4H A;  5CQ2 A;  1GPF A;  4URI A;  2KFW A;  5DIT A;  3MQH A;  4MGV A;  2LJ4 A;  3CHC A;  1FKS A;  2MF9 A;  3LKX A;  2A3E A;  1W9P A;  4ML4 A;  4Q22 A;  3VAW A;  3ART A;  2PN0 A;  3RM9 A;  4P8V A;  4HBO A;  1LG1 A;  2A3C A;  4QZV B;  2A3A A;  2FAP A;  1Q6H A;  1NMV A;  1H0G A;  3FSB A;  2O9O A;  4W9Q A;  3TC5 A;  5HKG A;  2KXQ A;  2DT0 A;  3ALG A;  1U79 A;  4Z2K A;  2F2D A;  1FFR A;  3UI6 A;  4JFI A;  3KAB A;  2WLY A;  3CGN A;  4DRQ A;  1HKK A;  3O5G A;  1TK7 A;  1X6N A;  1WNO A;  2QRV A;  1EIB A;  3EY6 A;  4S3K A;  3EIP A;  2L2S A;  1Q1C A;  4MTV A;  3CHE A;  1ZU8 A;  4MAV A;  1RD6 A;  2DT3 A;  1W1Y A;  2G41 A;  2M8J A;  3NRK A;  2XP7 A;  4O2T A;  3WD1 A;  2M08 A;  2EUL A;  1BKF A;  2XP5 A;  1GOI A;  2KGJ A;  1TR8 A;  4DRJ A;  2MDI A;  3B7X A;  1KFW A;  1GUV A;  2YSI A;  2RUQ A;  3WIJ A;  1JNE A;  3O5P A;  5U47 A;  2F21 A;  2XP3 A;  3RM4 A;  3GU0 A;  4G2P A;  2YAJ B;  3GPK A;  3B9E A;  1FKI A;  1FKG A;  3G6M A;  1LL6 A;  1QPF A;  4R0X A;  3PRD A;  2OWO A;  4BF8 A;  2E45 A;  5HW8 A;  2YSF A;  4DRK A;  1W9U A;  3M85 A;  3NTP A;  2MLY A;  4QT2 A;  1WAW A;  1E6P A;  4Z2G A;  1LL7 A;  2DT2 A;  2PPP A;  3NI6 A;  1EQ3 A;  3WH0 A;  4DRM A;  1LG2 A;  3ARO A;  2Q5A A;  2PV1 A;  3ARS A;  1H0I A;  2VN1 A;  4DZ2 A;  3KCE A;  1VF8 A;  1JMQ A;  1JNT A;  1HJW A;  2XP9 A;  3ARQ A;  3ARZ A;  4J4O A;  4LAV A;  4QT3 A;  2O92 A;  1FKF A;  1NH6 A;  3JYM A;  3ARV A;  2RUD A;  2FKE A;  4IPX A;  3AS3 A;  2PV2 A;  3JXV A;  3B9A A;  3FS8 A;  2MNT A;  4Z2J A;  2ZQU A;  3ARX A;  3TDB A;  2ETN A;  2M3O W;  4GLX A;  3CHF A;  3IHZ A;  2DMV A;  4LGX A;  2M1I A;  5HBF A;  1K9R A;  1ROU A;  1TCO C;  4DWS B;  1FLC A;  3AQU A;  4U85 A;  1NSG A;  2RSE A;  4ITZ A;  4GGQ A;  1E9L A;  1XHG A;  2WAD A;  2VCD A;  2M2A A;  4JFM A;  3AS0 A;  3KAF A;  3IKD A;  5DIV A;  3LE4 A;  3ARP A;  5HT1 A;  2DWV A;  1UR9 A;  5AHT A;  2N87 A;  2ZR4 A;  3B8S A;  4DWS A;  3TCZ A;  3WL1 A;  5E66 A;  1D2K A;  1E44 A;  1CTN A;  3RFW A;  1W1T A;  4LAW A;  4ODR A;  2PBC A;  2MLX A;  3KAD A;  3MDY B;  2RUC A;  1PBK A;  4MSP A;  3WQW A;  5E5W A;  2JMF A;  4GIV A;  4U86 A;  3MQG A;  5GPG A;  1SYT A;  3M7N A;  4JFJ A;  1TFV A;  1FD9 A;  1E6Z A;  1L1P A;  4DWS C;  4DZ3 A;  5DF0 A;  3ARW A;  2Y8N B;  3H9R B;  4MPK A;  3WD3 A;  4FN2 A;  1Q6U A;  3CNG A;  2PPO A;  2DG4 A;  1OGB A;  2ZAJ A;  2IF4 A;  1HJX A;  1O6W A;  3O5M A;  4W9O A;  3KAC A;  4A0U A;  1J4H A;  1R9H A;  1FAP A;  3O5J A;  3PR9 A;  5I98 A;  4JYS A;  2JX8 A;  2FDM A;  4TW7 A;  1YW5 A;  3LKX B;  1E6N A;  5DIU A;  2WM0 A;  2UZ5 A;  1ROT A;  1JCH B;  4L72 B;  2ZR5 A;  1WMV A;  2DK7 A;  4ZPW R;  2LPV A;  1FKD A;  3IKG A;  1I5H W;  2QF8 A;  4ODQ A;  2D9F A;  4ODN A;  5BXJ A;  3UI5 A;  1OGG A;  1EYM A;  3O5D A;  1IX5 A;  1F40 A;  3O5L A;  1RP5 A;  3B9D A;  4C02 B;  2YSH A;  1X6L A;  1LL4 A;  3FSC A;  1W1P A;  2M8I A;  2DSV A;  2DSW A;  1FKR A;  1Q6I A;  3CH9 A;  4ODK A;  3FY1 A;  3O5F A;  5DEZ A;  4DRN A;  2DG3 A;  4NNR A;  3W4R A;  2DJY A;  1OWQ A;  5HUA A;  4G50 A;  3UQB A;  3WL0 A;  3ODK A;  3ARR A;  4U84 A;  1NMW A;  2MPH A;  1ZCN A;  5D75 A;  3O5K A;  3CZ8 A;  3UQA A;  4ZPT R;  5JH8 A;  3WD4 A;  3ARY A;  4DH0 A;  2YBU A;  3O5I A;  3KAG A;  1FKH A;  4IT6 A;  4W5U A;  2XPA A;  4LAX A;  5HTG A;  1ZBV A;  2EZ5 W;  2KR7 A;  4UDM A;  1FKK A;  5HWB A;  1ZBK A;  1F8A B;  2ZQS A;  4ODM A;  1NWS A;  2RUR A;  3G6L A;  4A0T A;  1HXV A;  2MLZ A;  1D6O A;  1EHN A;  1HKI A;  2WK2 A;  2JXW A;  4TNS A;  2RE3 A;  4TX0 A;  4REX A;  4Z2I A;  2OFN A;  1A7X A;  5E64 A;  1ZK6 A;  3AS2 A;  1O6I A;  4ODL A;  2WLZ A;  4DRO A;  3O5R A;  4MNK A;  3KAH A;  4DRH A;  4MNL A;  4Z2H A;  4ODO A;  1FJD A;  3O5E A;  2LKN A;  4NZC A;  3QOK A;  4DT4 A;  1D7I A;  4WJX A;  2PI6 A;  3LUO A;  3WD2 A; 
#chains in the Genus database with same CATH homology
 1K9T A;  3WKZ A;  3KZ7 A;  4MNM A;  2AOS A;  2ZQV A;  1JVW A;  1E15 A;  1NWT A;  2XP8 A;  1QPL A;  4E5R A;  1ITX A;  2ITK A;  1D7H A;  1YAT A;  2ZR6 A;  1J4I A;  5GQB A;  1SR0 A;  3WD0 A;  4Q7N A;  2LAJ A;  1KT1 A;  4Z2L A;  3ARU A;  4KR0 B;  1BL4 A;  4FAP A;  4NSB A;  1FKB A;  1E6R A;  3PQH A;  3MCB B;  1WB0 A;  1LQ0 A;  4MNJ A;  1LJY A;  2KI3 A;  4PTM A;  1ZL1 A;  2PPN A;  4AY1 A;  3MCB A;  4J4N A;  4IQ2 A;  1N1A A;  4WK9 A;  2KO7 A;  1K9Q A;  3RM8 A;  4DIP A;  1P5Q A;  3ALF A;  4R5E A;  2DSU A;  1W9V A;  2DT1 A;  4LAY A;  4DRI A;  1ZBW A;  1FKT A;  5DO2 A;  4IQC A;  3RGC A;  4DWS D;  2DPE A;  4TW6 A;  1W1V A;  5HW7 A;  2ZQT A;  3O5Q A;  4JFL A;  3IK8 A;  1XRV A;  2JV4 A;  2L4J A;  2DSZ A;  3OOB A;  2LGO A;  1EG3 A;  3BXW A;  1Y0O A;  2XP4 A;  1NWU A;  1C9H A;  3I6C A;  1ZB5 A;  1PIN A;  1KT0 A;  1M5Y A;  3AS1 A;  3KAI A;  1J4R A;  1D7J A;  4P8X A;  2YBT A;  4ZS6 A;  5J6E A;  2BA1 A;  1QZ2 A;  2AWG A;  3PRA A;  2YSG A;  3FXY A;  4ZPV R;  2WAE A;  3RME A;  2ESC A;  1JNS A;  1FKJ A;  3UF8 A;  4TW8 A;  4QIB A;  3PRB A;  3CGM A;  4WKF A;  2F4E A;  2KE0 A;  1T11 A;  4P8W A;  2XPB A;  3CHD A;  3PA7 A;  2RQS A;  4L3N A;  2G8Z A;  2JZV A;  2YSB A;  1HKM A;  4WIW A;  3FAP A;  4S3J A;  4HBE A;  2XP6 A;  1J6Y A;  4ODP A;  1UR8 A;  4KQZ A;  1HKJ A;  1ZBC A;  4TYO A;  2A3B A;  4P8U A;  5E65 A;  1FKL A;  3JYJ A;  3O5O A;  3UQI A;  2IUZ A;  2DK1 A;  5E62 A;  2Y78 A;  4IT4 A;  2DG9 A;  4WKA A;  1FFQ A;  2PV3 A;  3WQV A;  1EDQ A;  2OLH A;  1HJV A;  5HWC A;  5B8I C;  1WR7 A;  1NWR A;  1B6C A;  4N19 A;  4JFK A;  3OA5 A;  5GPR A;  2B31 A;  1JND A;  4W9P A;  4XAK A;  4WKH A;  4DRP A;  5HW6 A;  4HAR A;  2K8I A;  3UI4 A;  1EG4 A;  1W26 A;  3L4H A;  5CQ2 A;  1GPF A;  4URI A;  2KFW A;  5DIT A;  3MQH A;  4MGV A;  2LJ4 A;  3CHC A;  1FKS A;  2MF9 A;  3LKX A;  2A3E A;  1W9P A;  4ML4 A;  4Q22 A;  3VAW A;  3ART A;  3RM9 A;  4P8V A;  4HBO A;  1LG1 A;  2A3C A;  4QZV B;  2A3A A;  2FAP A;  1Q6H A;  1NMV A;  1H0G A;  3FSB A;  2O9O A;  4W9Q A;  3TC5 A;  5HKG A;  2KXQ A;  2DT0 A;  3ALG A;  1U79 A;  4Z2K A;  2F2D A;  1FFR A;  3UI6 A;  4JFI A;  3KAB A;  2WLY A;  3CGN A;  4DRQ A;  1HKK A;  3O5G A;  1TK7 A;  1X6N A;  1WNO A;  2QRV A;  1EIB A;  3EY6 A;  4S3K A;  2L2S A;  1Q1C A;  4MTV A;  3CHE A;  1ZU8 A;  4MAV A;  1RD6 A;  2DT3 A;  1W1Y A;  2G41 A;  2M8J A;  3NRK A;  2XP7 A;  4O2T A;  3WD1 A;  2M08 A;  1BKF A;  2XP5 A;  1GOI A;  2KGJ A;  1TR8 A;  4DRJ A;  2MDI A;  3B7X A;  1KFW A;  1GUV A;  2YSI A;  2RUQ A;  3WIJ A;  1JNE A;  3O5P A;  5U47 A;  2F21 A;  2XP3 A;  3RM4 A;  4G2P A;  2YAJ B;  3GPK A;  3B9E A;  1FKI A;  1FKG A;  3G6M A;  1LL6 A;  1QPF A;  4R0X A;  3PRD A;  2OWO A;  4BF8 A;  2E45 A;  5HW8 A;  2YSF A;  4DRK A;  1W9U A;  3M85 A;  3NTP A;  2MLY A;  4QT2 A;  1WAW A;  1E6P A;  4Z2G A;  1LL7 A;  2DT2 A;  2PPP A;  3NI6 A;  1EQ3 A;  3WH0 A;  4DRM A;  1LG2 A;  3ARO A;  2Q5A A;  2PV1 A;  3ARS A;  1H0I A;  2VN1 A;  4DZ2 A;  3KCE A;  1VF8 A;  1JMQ A;  1JNT A;  1HJW A;  2XP9 A;  3ARQ A;  3ARZ A;  4J4O A;  4LAV A;  4QT3 A;  2O92 A;  1FKF A;  1NH6 A;  3JYM A;  3ARV A;  2RUD A;  2FKE A;  4IPX A;  3AS3 A;  2PV2 A;  3JXV A;  3B9A A;  3FS8 A;  2MNT A;  4Z2J A;  2ZQU A;  3ARX A;  3TDB A;  2M3O W;  4GLX A;  3CHF A;  3IHZ A;  2DMV A;  4LGX A;  2M1I A;  5HBF A;  1K9R A;  1ROU A;  1TCO C;  4DWS B;  1FLC A;  3AQU A;  4U85 A;  1NSG A;  2RSE A;  4ITZ A;  4GGQ A;  1E9L A;  1XHG A;  2WAD A;  2VCD A;  2M2A A;  4JFM A;  3AS0 A;  3KAF A;  3IKD A;  5DIV A;  3LE4 A;  3ARP A;  5HT1 A;  2DWV A;  1UR9 A;  5AHT A;  2N87 A;  2ZR4 A;  3B8S A;  4DWS A;  3TCZ A;  3WL1 A;  5E66 A;  1D2K A;  1CTN A;  3RFW A;  1W1T A;  4LAW A;  4ODR A;  2PBC A;  2MLX A;  3KAD A;  3MDY B;  2RUC A;  1PBK A;  4MSP A;  3WQW A;  5E5W A;  2JMF A;  4GIV A;  4U86 A;  3MQG A;  5GPG A;  1SYT A;  3M7N A;  4JFJ A;  1TFV A;  1FD9 A;  1E6Z A;  1L1P A;  4DWS C;  4DZ3 A;  5DF0 A;  3ARW A;  2Y8N B;  3H9R B;  4MPK A;  3WD3 A;  4FN2 A;  1Q6U A;  3CNG A;  2PPO A;  2DG4 A;  1OGB A;  2ZAJ A;  2IF4 A;  1HJX A;  1O6W A;  3O5M A;  4W9O A;  3KAC A;  4A0U A;  1J4H A;  1R9H A;  1FAP A;  3O5J A;  3PR9 A;  5I98 A;  4JYS A;  2JX8 A;  2FDM A;  4TW7 A;  1YW5 A;  3LKX B;  1E6N A;  5DIU A;  2WM0 A;  2UZ5 A;  1ROT A;  4L72 B;  2ZR5 A;  1WMV A;  2DK7 A;  4ZPW R;  2LPV A;  1FKD A;  3IKG A;  1I5H W;  2QF8 A;  4ODQ A;  2D9F A;  4ODN A;  5BXJ A;  3UI5 A;  1OGG A;  1EYM A;  3O5D A;  1IX5 A;  1F40 A;  3O5L A;  1RP5 A;  3B9D A;  4C02 B;  2YSH A;  1X6L A;  1LL4 A;  3FSC A;  1W1P A;  2M8I A;  2DSV A;  2DSW A;  1FKR A;  1Q6I A;  3CH9 A;  4ODK A;  3FY1 A;  3O5F A;  5DEZ A;  4DRN A;  2DG3 A;  4NNR A;  3W4R A;  2DJY A;  1OWQ A;  5HUA A;  4G50 A;  3UQB A;  3WL0 A;  3ODK A;  3ARR A;  4U84 A;  1NMW A;  2MPH A;  1ZCN A;  5D75 A;  3O5K A;  3CZ8 A;  3UQA A;  4ZPT R;  5JH8 A;  3WD4 A;  3ARY A;  4DH0 A;  2YBU A;  3O5I A;  3KAG A;  1FKH A;  4IT6 A;  4W5U A;  2XPA A;  4LAX A;  5HTG A;  1ZBV A;  2EZ5 W;  2KR7 A;  1FKK A;  5HWB A;  1ZBK A;  1F8A B;  2ZQS A;  4ODM A;  1NWS A;  2RUR A;  3G6L A;  4A0T A;  1HXV A;  2MLZ A;  1D6O A;  1EHN A;  1HKI A;  2WK2 A;  2JXW A;  4TNS A;  2RE3 A;  4TX0 A;  4REX A;  4Z2I A;  2OFN A;  1A7X A;  5E64 A;  1ZK6 A;  3AS2 A;  1O6I A;  4ODL A;  2WLZ A;  4DRO A;  3O5R A;  4MNK A;  3KAH A;  4DRH A;  4MNL A;  4Z2H A;  4ODO A;  1FJD A;  3O5E A;  2LKN A;  4NZC A;  3QOK A;  4DT4 A;  1D7I A;  4WJX A;  2PI6 A;  3LUO A;  3WD2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...