2MDIA

Solution structure of the pp2ww mutant (kpp2ww) of hypb
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
56
structure length
56
Chain Sequence
GSDLPPPSPPAAATIVLPPNWKTARDPEGKIYYYHVITRQTQWDPPTWESPGDDAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase SETD2
publication title Autoinhibitory structure of the WW domain of HYPB/SETD2 regulates its interaction with the proline-rich region of huntingtin.
pubmed doi rcsb
source organism Homo sapiens
total genus 2
structure length 56
sequence length 56
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2013-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2mdiA00
4E5RA 2JV4A 1NMVA 2ZR6A 2MDIA 1ZCNA 2DK7A 5AHTA 2DWVA 3M85A 3KAHA 3NTPA 2XP5A 1JMQA 2XP8A 2JMFA 2XP3A 2YSGA 3L4HA 1O6WA 3KABA 2ITKA 2RE3A 2JX8A 2YSHA 2F21A 2M8IA 2DK1A 4U86A 5CQ2A 2EZ5W 3M7NA 4U85A 1WMVA 1K9QA 2ZQVA 2ZQSA 2M8JA 1TK7A 3TDBA 2XP9A 2ZR4A 3LE4A 3KAGA 2XP6A 1K9RA 1I5HW 2DMVA 3TCZA 3TC5A 1YW5A 2Q5AA 3CNGA 2XP4A 2XPBA 1WR7A 2ZR5A 2KXQA 2XP7A 4REXA 2YSFA 1PINA 3KAFA 3KAIA 2ZQUA 2XPAA 2ZAJA 2DJYA 2L4JA 2BA1A 2YSBA 2ZQTA 2YSIA 3WH0A 3OOBA 4QIBA 2LAJA 3ODKA 2M3OW 4U84A 2E45A 3KCEA 1EG4A 1EG3A 1F8AB 3KADA 2JXWA
chains in the Genus database with same CATH superfamily
4E5RA 3FS8A 2OWOA 2JV4A 1NMVA 2ZR6A 2MDIA 1ZCNA 3MQGA 2DK7A 5AHTA 2Y8NB 2QRVA 2DWVA 3M85A 3MCBB 2WAEA 3KAHA 3NTPA 1TR8A 2XP5A 1JMQA 2XP8A 5E62A 2JMFA 2XP3A 2YSGA 3LKXA 3PQHA 3L4HA 1O6WA 3KABA 2ITKA 5U47A 2RE3A 2JX8A 2YSHA 2F21A 5E65A 2M8IA 4GLXA 2DK1A 4U86A 1RP5A 2WADA 5CQ2A 2EZ5W 3M7NA 4U85A 1WMVA 1K9QA 2ZQVA 2ZQSA 2M8JA 1TK7A 3TDBA 2XP9A 2ZR4A 3LE4A 3KAGA 2XP6A 1K9RA 1I5HW 2DMVA 5E66A 3TCZA 3TC5A 1YW5A 2Q5AA 2YAJB 4A0TA 5E64A 3FSBA 3CNGA 2XP4A 2XPBA 1WR7A 2ZR5A 2KXQA 2XP7A 4REXA 2YSFA 1PINA 3KAFA 3KAIA 2ZQUA 2XPAA 2ZAJA 2DJYA 5E5WA 4A0UA 2L4JA 3LKXB 2BA1A 3MCBA 2YSBA 2ZQTA 2YSIA 3WH0A 3MQHA 3OOBA 4QIBA 2LAJA 3ODKA 2M3OW 4U84A 2E45A 3KCEA 1FLCA 1EG4A 1EG3A 1F8AB 3FSCA 3KADA 2JXWA
chains in the Genus database with same CATH topology
4E5RA 3FS8A 2OWOA 2JV4A 1NMVA 2ZR6A 2MDIA 1ZCNA 3MQGA 2DK7A 5AHTA 2Y8NB 2QRVA 2DWVA 3M85A 3MCBB 2WAEA 3KAHA 3NTPA 1TR8A 2XP5A 1JMQA 2XP8A 5E62A 2JMFA 2XP3A 2YSGA 3LKXA 3PQHA 3L4HA 1O6WA 3KABA 2ITKA 5U47A 2RE3A 2JX8A 2YSHA 2F21A 5E65A 2M8IA 4GLXA 2DK1A 4U86A 1RP5A 2WADA 5CQ2A 2EZ5W 3M7NA 4U85A 1WMVA 1K9QA 2ZQVA 2ZQSA 2M8JA 1TK7A 3TDBA 2XP9A 2ZR4A 3LE4A 3KAGA 2XP6A 1K9RA 1I5HW 2DMVA 5E66A 3TCZA 3TC5A 1YW5A 2Q5AA 2YAJB 4A0TA 5E64A 3FSBA 3CNGA 2XP4A 2XPBA 1WR7A 2ZR5A 2KXQA 2XP7A 4REXA 2YSFA 1PINA 3KAFA 3KAIA 2ZQUA 2XPAA 2ZAJA 2DJYA 5E5WA 4A0UA 2L4JA 3LKXB 2BA1A 3MCBA 2YSBA 2ZQTA 2YSIA 3WH0A 3MQHA 3OOBA 4QIBA 2LAJA 3ODKA 2M3OW 4U84A 2E45A 3KCEA 1FLCA 1EG4A 1EG3A 1F8AB 3FSCA 3KADA 2JXWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E5R A;  2JV4 A;  1NMV A;  2ZR6 A;  2MDI A;  1ZCN A;  2DK7 A;  5AHT A;  2DWV A;  3M85 A;  3KAH A;  3NTP A;  2XP5 A;  1JMQ A;  2XP8 A;  2JMF A;  2XP3 A;  2YSG A;  3L4H A;  1O6W A;  3KAB A;  2ITK A;  2RE3 A;  2JX8 A;  2YSH A;  2F21 A;  2M8I A;  2DK1 A;  4U86 A;  5CQ2 A;  2EZ5 W;  3M7N A;  4U85 A;  1WMV A;  1K9Q A;  2ZQV A;  2ZQS A;  2M8J A;  1TK7 A;  3TDB A;  2XP9 A;  2ZR4 A;  3LE4 A;  3KAG A;  2XP6 A;  1K9R A;  1I5H W;  2DMV A;  3TCZ A;  3TC5 A;  1YW5 A;  2Q5A A;  3CNG A;  2XP4 A;  2XPB A;  1WR7 A;  2ZR5 A;  2KXQ A;  2XP7 A;  4REX A;  2YSF A;  1PIN A;  3KAF A;  3KAI A;  2ZQU A;  2XPA A;  2ZAJ A;  2DJY A;  2L4J A;  2BA1 A;  2YSB A;  2ZQT A;  2YSI A;  3WH0 A;  3OOB A;  4QIB A;  2LAJ A;  3ODK A;  2M3O W;  4U84 A;  2E45 A;  3KCE A;  1EG4 A;  1EG3 A;  1F8A B;  3KAD A;  2JXW A; 
#chains in the Genus database with same CATH topology
 4E5R A;  3FS8 A;  2OWO A;  2JV4 A;  1NMV A;  2ZR6 A;  2MDI A;  1ZCN A;  3MQG A;  2DK7 A;  5AHT A;  2Y8N B;  2QRV A;  2DWV A;  3M85 A;  3MCB B;  2WAE A;  3KAH A;  3NTP A;  1TR8 A;  2XP5 A;  1JMQ A;  2XP8 A;  5E62 A;  2JMF A;  2XP3 A;  2YSG A;  3LKX A;  3PQH A;  3L4H A;  1O6W A;  3KAB A;  2ITK A;  5U47 A;  2RE3 A;  2JX8 A;  2YSH A;  2F21 A;  5E65 A;  2M8I A;  4GLX A;  2DK1 A;  4U86 A;  1RP5 A;  2WAD A;  5CQ2 A;  2EZ5 W;  3M7N A;  4U85 A;  1WMV A;  1K9Q A;  2ZQV A;  2ZQS A;  2M8J A;  1TK7 A;  3TDB A;  2XP9 A;  2ZR4 A;  3LE4 A;  3KAG A;  2XP6 A;  1K9R A;  1I5H W;  2DMV A;  5E66 A;  3TCZ A;  3TC5 A;  1YW5 A;  2Q5A A;  2YAJ B;  4A0T A;  5E64 A;  3FSB A;  3CNG A;  2XP4 A;  2XPB A;  1WR7 A;  2ZR5 A;  2KXQ A;  2XP7 A;  4REX A;  2YSF A;  1PIN A;  3KAF A;  3KAI A;  2ZQU A;  2XPA A;  2ZAJ A;  2DJY A;  5E5W A;  4A0U A;  2L4J A;  3LKX B;  2BA1 A;  3MCB A;  2YSB A;  2ZQT A;  2YSI A;  3WH0 A;  3MQH A;  3OOB A;  4QIB A;  2LAJ A;  3ODK A;  2M3O W;  4U84 A;  2E45 A;  3KCE A;  1FLC A;  1EG4 A;  1EG3 A;  1F8A B;  3FSC A;  3KAD A;  2JXW A; 
#chains in the Genus database with same CATH homology
 4E5R A;  3FS8 A;  2OWO A;  2JV4 A;  1NMV A;  2ZR6 A;  2MDI A;  1ZCN A;  3MQG A;  2DK7 A;  5AHT A;  2Y8N B;  2QRV A;  2DWV A;  3M85 A;  3MCB B;  2WAE A;  3KAH A;  3NTP A;  1TR8 A;  2XP5 A;  1JMQ A;  2XP8 A;  5E62 A;  2JMF A;  2XP3 A;  2YSG A;  3LKX A;  3PQH A;  3L4H A;  1O6W A;  3KAB A;  2ITK A;  5U47 A;  2RE3 A;  2JX8 A;  2YSH A;  2F21 A;  5E65 A;  2M8I A;  4GLX A;  2DK1 A;  4U86 A;  1RP5 A;  2WAD A;  5CQ2 A;  2EZ5 W;  3M7N A;  4U85 A;  1WMV A;  1K9Q A;  2ZQV A;  2ZQS A;  2M8J A;  1TK7 A;  3TDB A;  2XP9 A;  2ZR4 A;  3LE4 A;  3KAG A;  2XP6 A;  1K9R A;  1I5H W;  2DMV A;  5E66 A;  3TCZ A;  3TC5 A;  1YW5 A;  2Q5A A;  2YAJ B;  4A0T A;  5E64 A;  3FSB A;  3CNG A;  2XP4 A;  2XPB A;  1WR7 A;  2ZR5 A;  2KXQ A;  2XP7 A;  4REX A;  2YSF A;  1PIN A;  3KAF A;  3KAI A;  2ZQU A;  2XPA A;  2ZAJ A;  2DJY A;  5E5W A;  4A0U A;  2L4J A;  3LKX B;  2BA1 A;  3MCB A;  2YSB A;  2ZQT A;  2YSI A;  3WH0 A;  3MQH A;  3OOB A;  4QIB A;  2LAJ A;  3ODK A;  2M3O W;  4U84 A;  2E45 A;  3KCE A;  1FLC A;  1EG4 A;  1EG3 A;  1F8A B;  3FSC A;  3KAD A;  2JXW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...