2MDIA

Solution structure of the pp2ww mutant (kpp2ww) of hypb
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
56
structure length
56
Chain Sequence
GSDLPPPSPPAAATIVLPPNWKTARDPEGKIYYYHVITRQTQWDPPTWESPGDDAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-lysine N-methyltransferase SETD2
publication title Autoinhibitory structure of the WW domain of HYPB/SETD2 regulates its interaction with the proline-rich region of huntingtin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 2
structure length 56
sequence length 56
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2013-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2mdiA00
2ITKA 2YSIA 4QIBA 3LE4A 2JMFA 2ZQUA 3TDBA 1EG3A 2KXQA 2DK1A 3NTPA 1JMQA 1O6WA 3L4HA 2ZAJA 1EG4A 2XP5A 2F21A 1I5HW 2JX8A 5AHTA 2JXWA 2M8IA 2XP4A 2MDIA 4E5RA 2M8JA 2YSGA 2DJYA 4U86A 2XP7A 3WH0A 3KAHA 2RE3A 2YSFA 4U85A 1ZCNA 1PINA 2E45A 2M3OW 3KAIA 3KCEA 3TCZA 2DWVA 2JV4A 2YSBA 1YW5A 2XPAA 1NMVA 1TK7A 2XP6A 2ZR5A 4U84A 2ZQSA 3M7NA 2XP8A 2EZ5W 1WMVA 2LAJA 3TC5A 2L4JA 1F8AB 2XP9A 3KAGA 2ZQVA 3M85A 1K9QA 3CNGA 3KADA 2ZR4A 2YSHA 2XPBA 2Q5AA 3ODKA 2ZQTA 2ZR6A 3KABA 2BA1A 4REXA 5CQ2A 3OOBA 2DK7A 2DMVA 2XP3A 1K9RA 3KAFA 1WR7A
chains in the Genus database with same CATH superfamily
3FSCA 2ITKA 2YSIA 4QIBA 3LE4A 2JMFA 2ZQUA 3TDBA 1EG3A 2KXQA 2DK1A 3NTPA 1JMQA 1O6WA 3L4HA 2ZAJA 4A0TA 1EG4A 5E66A 2XP5A 2F21A 1I5HW 2JX8A 4GLXA 2OWOA 5E65A 5AHTA 5E62A 2JXWA 2M8IA 2XP4A 5E5WA 2MDIA 4E5RA 3FS8A 2M8JA 2YSGA 3MCBA 2DJYA 2WADA 4U86A 1FLCA 2XP7A 3WH0A 4A0UA 3KAHA 1TR8A 2RE3A 2YSFA 4U85A 1ZCNA 1PINA 3LKXA 5E64A 2E45A 2M3OW 3KAIA 3MCBB 3KCEA 5U47A 3TCZA 2DWVA 2YAJB 2JV4A 2YSBA 3MQGA 1YW5A 2XPAA 2WAEA 1NMVA 1TK7A 2XP6A 3PQHA 2ZR5A 1RP5A 4U84A 2ZQSA 3M7NA 2XP8A 2EZ5W 1WMVA 2LAJA 3TC5A 2L4JA 1F8AB 2XP9A 3KAGA 2ZQVA 3M85A 1K9QA 2QRVA 3CNGA 3KADA 2ZR4A 2YSHA 2XPBA 2Q5AA 3FSBA 3ODKA 2ZQTA 2ZR6A 3KABA 2BA1A 3LKXB 3MQHA 4REXA 5CQ2A 3OOBA 2DK7A 2DMVA 2XP3A 2Y8NB 1K9RA 3KAFA 1WR7A
chains in the Genus database with same CATH topology
3FSCA 2ITKA 2YSIA 4QIBA 3LE4A 2JMFA 2ZQUA 3TDBA 1EG3A 2KXQA 2DK1A 3NTPA 1JMQA 1O6WA 3L4HA 2ZAJA 4A0TA 1EG4A 5E66A 2XP5A 2F21A 1I5HW 2JX8A 4GLXA 2OWOA 5E65A 5AHTA 5E62A 2JXWA 2M8IA 2XP4A 5E5WA 2MDIA 4E5RA 3FS8A 2M8JA 2YSGA 3MCBA 2DJYA 2WADA 4U86A 1FLCA 2XP7A 3WH0A 4A0UA 3KAHA 1TR8A 2RE3A 2YSFA 4U85A 1ZCNA 1PINA 3LKXA 5E64A 2E45A 2M3OW 3KAIA 3MCBB 3KCEA 5U47A 3TCZA 2DWVA 2YAJB 2JV4A 2YSBA 3MQGA 1YW5A 2XPAA 2WAEA 1NMVA 1TK7A 2XP6A 3PQHA 2ZR5A 1RP5A 4U84A 2ZQSA 3M7NA 2XP8A 2EZ5W 1WMVA 2LAJA 3TC5A 2L4JA 1F8AB 2XP9A 3KAGA 2ZQVA 3M85A 1K9QA 2QRVA 3CNGA 3KADA 2ZR4A 2YSHA 2XPBA 2Q5AA 3FSBA 3ODKA 2ZQTA 2ZR6A 3KABA 2BA1A 3LKXB 3MQHA 4REXA 5CQ2A 3OOBA 2DK7A 2DMVA 2XP3A 2Y8NB 1K9RA 3KAFA 1WR7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ITK A;  2YSI A;  4QIB A;  3LE4 A;  2JMF A;  2ZQU A;  3TDB A;  1EG3 A;  2KXQ A;  2DK1 A;  3NTP A;  1JMQ A;  1O6W A;  3L4H A;  2ZAJ A;  1EG4 A;  2XP5 A;  2F21 A;  1I5H W;  2JX8 A;  5AHT A;  2JXW A;  2M8I A;  2XP4 A;  2MDI A;  4E5R A;  2M8J A;  2YSG A;  2DJY A;  4U86 A;  2XP7 A;  3WH0 A;  3KAH A;  2RE3 A;  2YSF A;  4U85 A;  1ZCN A;  1PIN A;  2E45 A;  2M3O W;  3KAI A;  3KCE A;  3TCZ A;  2DWV A;  2JV4 A;  2YSB A;  1YW5 A;  2XPA A;  1NMV A;  1TK7 A;  2XP6 A;  2ZR5 A;  4U84 A;  2ZQS A;  3M7N A;  2XP8 A;  2EZ5 W;  1WMV A;  2LAJ A;  3TC5 A;  2L4J A;  1F8A B;  2XP9 A;  3KAG A;  2ZQV A;  3M85 A;  1K9Q A;  3CNG A;  3KAD A;  2ZR4 A;  2YSH A;  2XPB A;  2Q5A A;  3ODK A;  2ZQT A;  2ZR6 A;  3KAB A;  2BA1 A;  4REX A;  5CQ2 A;  3OOB A;  2DK7 A;  2DMV A;  2XP3 A;  1K9R A;  3KAF A;  1WR7 A; 
#chains in the Genus database with same CATH topology
 3FSC A;  2ITK A;  2YSI A;  4QIB A;  3LE4 A;  2JMF A;  2ZQU A;  3TDB A;  1EG3 A;  2KXQ A;  2DK1 A;  3NTP A;  1JMQ A;  1O6W A;  3L4H A;  2ZAJ A;  4A0T A;  1EG4 A;  5E66 A;  2XP5 A;  2F21 A;  1I5H W;  2JX8 A;  4GLX A;  2OWO A;  5E65 A;  5AHT A;  5E62 A;  2JXW A;  2M8I A;  2XP4 A;  5E5W A;  2MDI A;  4E5R A;  3FS8 A;  2M8J A;  2YSG A;  3MCB A;  2DJY A;  2WAD A;  4U86 A;  1FLC A;  2XP7 A;  3WH0 A;  4A0U A;  3KAH A;  1TR8 A;  2RE3 A;  2YSF A;  4U85 A;  1ZCN A;  1PIN A;  3LKX A;  5E64 A;  2E45 A;  2M3O W;  3KAI A;  3MCB B;  3KCE A;  5U47 A;  3TCZ A;  2DWV A;  2YAJ B;  2JV4 A;  2YSB A;  3MQG A;  1YW5 A;  2XPA A;  2WAE A;  1NMV A;  1TK7 A;  2XP6 A;  3PQH A;  2ZR5 A;  1RP5 A;  4U84 A;  2ZQS A;  3M7N A;  2XP8 A;  2EZ5 W;  1WMV A;  2LAJ A;  3TC5 A;  2L4J A;  1F8A B;  2XP9 A;  3KAG A;  2ZQV A;  3M85 A;  1K9Q A;  2QRV A;  3CNG A;  3KAD A;  2ZR4 A;  2YSH A;  2XPB A;  2Q5A A;  3FSB A;  3ODK A;  2ZQT A;  2ZR6 A;  3KAB A;  2BA1 A;  3LKX B;  3MQH A;  4REX A;  5CQ2 A;  3OOB A;  2DK7 A;  2DMV A;  2XP3 A;  2Y8N B;  1K9R A;  3KAF A;  1WR7 A; 
#chains in the Genus database with same CATH homology
 3FSC A;  2ITK A;  2YSI A;  4QIB A;  3LE4 A;  2JMF A;  2ZQU A;  3TDB A;  1EG3 A;  2KXQ A;  2DK1 A;  3NTP A;  1JMQ A;  1O6W A;  3L4H A;  2ZAJ A;  4A0T A;  1EG4 A;  5E66 A;  2XP5 A;  2F21 A;  1I5H W;  2JX8 A;  4GLX A;  2OWO A;  5E65 A;  5AHT A;  5E62 A;  2JXW A;  2M8I A;  2XP4 A;  5E5W A;  2MDI A;  4E5R A;  3FS8 A;  2M8J A;  2YSG A;  3MCB A;  2DJY A;  2WAD A;  4U86 A;  1FLC A;  2XP7 A;  3WH0 A;  4A0U A;  3KAH A;  1TR8 A;  2RE3 A;  2YSF A;  4U85 A;  1ZCN A;  1PIN A;  3LKX A;  5E64 A;  2E45 A;  2M3O W;  3KAI A;  3MCB B;  3KCE A;  5U47 A;  3TCZ A;  2DWV A;  2YAJ B;  2JV4 A;  2YSB A;  3MQG A;  1YW5 A;  2XPA A;  2WAE A;  1NMV A;  1TK7 A;  2XP6 A;  3PQH A;  2ZR5 A;  1RP5 A;  4U84 A;  2ZQS A;  3M7N A;  2XP8 A;  2EZ5 W;  1WMV A;  2LAJ A;  3TC5 A;  2L4J A;  1F8A B;  2XP9 A;  3KAG A;  2ZQV A;  3M85 A;  1K9Q A;  2QRV A;  3CNG A;  3KAD A;  2ZR4 A;  2YSH A;  2XPB A;  2Q5A A;  3FSB A;  3ODK A;  2ZQT A;  2ZR6 A;  3KAB A;  2BA1 A;  3LKX B;  3MQH A;  4REX A;  5CQ2 A;  3OOB A;  2DK7 A;  2DMV A;  2XP3 A;  2Y8N B;  1K9R A;  3KAF A;  1WR7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...