3M85A

Archaeoglobus fulgidus exosome y70a with rna bound to the active site
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
179
structure length
179
Chain Sequence
MRFVMPGDRIGSAEEYVKGEGVYEEGGELFAAVAGKLIIKDRVAKVESISPIPEIVKGDVVLGRVVDLRNSIALIEVSSKKGENRGPSNRGIGILHVSNVDEGYVKEISEAVGYLDILKARVIGDNLRLSTKEEEMGVLRALCSNCKTEMVREGDILKCPECGRVEKRKISTDYGKGEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna
molecule keywords Putative uncharacterized protein AF_0206
publication title Quantitative analysis of processive RNA degradation by the archaeal RNA exosome
pubmed doi rcsb
source organism Archaeoglobus fulgidus
total genus 36
structure length 179
sequence length 179
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10447 EXOSC1 Exosome component EXOSC1/CSL4
A PF14382 ECR1_N Exosome complex exonuclease RRP4 N-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3m85A03
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3m85A01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3m85A02
2NN6I 5IYCG 4H0LC 1JMQA 2F4VQ 1SMYC 2IHFA 4HIMA 2C35B 4IJHA 1IBMQ 2NN6G 3T56B 2GN5A 3CC7A 4JC0A 4A93H 1XMQQ 1XNRL 5JJIA 2AMCB 3W3AA 2OTLA 1KRSA 4JI3L 1V1QA 3KFUA 4ME3A 1VQ8A 2D2CC 2N3SA 1QVFA 1XTDA 3PO2H 4JI6L 4P73A 3ND9A 1K0RA 4LF7L 4DUZL 4B3TL 3PUZA 3VDYA 4QIBA 1KXLA 2R93G 1IBLL 3GTPH 1VQBA 4OWXB 2K50A 1P16A 1I94Q 3FKIG 2VZAA 3STBD 4LF8L 4HJAA 2MO0A 3ODKA 4X6AH 2NZOA 5IY0A 2ATWA 1Q8KA 3HOYH 1Y8NB 5GQOA 3HOXH 2CQOA 2JA6G 4DR6L 3A8IE 1B9NA 3FPPA 1M1KC 2F4VL 2JJQA 4RMFA 1L1OA 2WB1G 2E75C 3ULLA 3DLLA 5K36H 4DR3Q 3RLOA 1NMGA 3KF6A 2PNRC 1XMQL 1B9MA 1AE3A 3PF4A 1EOVA 3KDFB 2UUAL 1XNQL 1SRUA 2E2JH 1OTCA 4JI4L 3UE0A 4AIMA 1NTGA 4L5TA 3S1NH 1EG4A 1J5EQ 1KRTA 4G7OC 2QF7A 1XPRA 4BA1I 4EQ5A 4JI0L 5GAEC 3OOBA 3U4ZA 3T1HL 2ZTCA 5C3EH 3KAFA 1UE7A 1WMVA 1IYUA 4REXA 3CW2C 5H1SE 3BZKA 2ZR5A 4X66L 5IP9H 1KQSA 3MFYA 1E2ZA 2B63H 3I56A 1X3GA 3CMEA 1QJOA 1TU2B 1VQNA 1PV4A 4QQBX 3CXCA 1V9PA 3H15A 3KLRA 4LWCA 4HJ8A 1HZ9A 1FGUA 4DR1L 1GD7A 1YI2A 4P75A 2UXCQ 1HCZA 3BU2A 2F1MA 2M8JA 1PHJA 1GKHA 1L0WA 3DXJC 2L4JA 2PI2E 3STBC 5IP7H 3OPOA 1AE2A 3S1QH 4PG3A 1O7IA 1N36Q 1Y8PB 4LUVA 3KOJA 2QGQA 1WFQA 4UPAA 2HIVA 1U5KA 2CCZA 4LFBQ 1QUQA 2XP9A 2JQOA 4X62L 1E1OA 4JOIC 3CAMA 2R6GA 3KAHA 4DV1Q 3GTLH 4GOPB 4H44C 2AUKA 5M5XH 1EG3A 2MQHA 2VQFQ 1FJGL 2PPBC 4IFDH 2F3IA 4OO1G 3A5UA 3S2HH 4JOIA 4YWLA 4KHPQ 3IKJA 2V4DA 2Q2IA 1CKMA 3PSIA 2XP3A 2HT1A 1Q12A 1LM0A 1JJCB 1JMCA 2JEBI 1DCZA 3EIVA 3CNGA 1PH9A 2EVBA 1ZKOA 3CC4A 4A3DG 2ZT9C 2CWAA 3W1GA 3BDOA 1V43A 4B3RQ 3GTKH 3CQZH 3PUWA 4QJFA 3HOVH 4DK1A 2Z0SA 4LUZA 3S15H 1VQ4A 3PUXA 1HQMC 1TXYA 4JBMA 1Q82C 2E45A 1XPOA 2PCFB 4GN4B 3QIAA 1A62A 3D31A 2Q2UA 1SLJA 2EJFC 2ZAJA 4YWKA 5IYCH 3CCUA 2A8VA 2VQEL 3BJUA 2VUMG 2ZR4A 1I50H 2DNEA 4DV5L 3S2DH 2FXQA 4AH6A 1JJGA 3VA7A 2ITKA 4A3EG 1F8AB 4A4IA 2E76C 1CKNB 2D0OA 2KHJA 3S1MH 3UDFA 4JI1Q 1YNNC 3KJPA 3ULJA 2E5LQ 3F2BA 3IFTA 4LF9Q 4ALPA 4BY1G 2E8GA 4OX9Q 3I4OA 1K8OA 2B8FA 3HFZB 1HPCA 5GAHC 2I5LX 2O5IC 2VNUD 1E3PA 1XJVA 4BBRH 2OTJA 3L2PA 4X65Q 1A0IA 3F1ZA 2NVXH 3AYHB 4JYAL 2OCEA 4BXXG 4DPGA 1HNWQ 1HNXL 2I0QA 2E2HH 1E24A 3PUYA 4NXNQ 1H9KA 1EIFA 1VQGA 4B3MQ 3UDIA 1H9SA 5LMNL 2VL6A 1IW7D 1HZAA 3CCVA 3RNUA 2JA7G 2LAJA 3KCEA 1GM5A 2JMFA 4JBWA 3OOCA 4P74A 3G6EA 3J80i 3S16H 1X6OA 1DD2A 3MXUA 3TCZA 2BDOA 2JA5G 4DV2Q 1MJEA 1OXVA 1TK7A 4LF9L 4JK1C 1Z9FA 2ZM6L 2K14A 1UWVA 3H3VI 4DUYQ 1YIJA 1H9MA 2YYZA 4IFDI 1XNRQ 1KC8C 2DNCA 4DV6L 4JI3Q 3J81c 1SR3A 3I4NH 1CKOA 2N78A 4H13C 3PF5A 4KHZA 3TS0A 4WJ4A 1IL2A 5LMUQ 4JI6Q 2ALYB 4G7ZC 4KN4C 2DUDA 5IYBG 4LF7Q 4DUZQ 4B3TQ 1LACA 5AHTA 4HJ9A 3KAGA 3OTOL 4GS3A 1IBLQ 3PUVA 2R7DA 5AJ3L 3RN5A 3L7ZC 1I5HW 1K9MC 1YJWA 2IY5B 1VQFA 4LF8Q 4BY7H 4UP7A 2E74C 2ZTDA 1R9TH 1PH2A 1YHAA 4GLVB 4LNQA 4U84A 1EYGA 5KNCA 4DV2L 4DR6Q 1IW7C 2MDIA 4DUYL 4O2DA 2WFWA 1WCMG 4Y7NH 1K8GA 2NZHA 5JEAH 2KENA 1Y1WH 3MXNB 2UUAQ 4XIGS 4A3BG 5BN3A 3ERSX 1XNQQ 4A76A 2ZQVA 3NELA 4JI4Q 1GJXA 4B3SL 1H9JA 4JI7L 4YWMA 4PZ8A 5LMUL 2OQKA 3AEVA 4JI0Q 4A3JG 3T1HQ 1NY4A 3PO3G 4A3LG 4A3CG 2A1AA 4P71A 1VQLA 1SMXA 4X66Q 1GO3E 1Y8OB 4C3JH 3CCRA 5M3FG 3I7FA 4A3IH 3NENA 1PH7A 4OXPA 2HIXA 4JI2L 3M9BA 3MEFA 1L1OC 1TWGH 4R4IA 1QZGA 1VQDA 4DR1Q 3G48A 2R7ZH 4DNTB 5ELNA 1MIUA 5C0XI 4HJ5A 4R1JA 3I55A 1UE6A 1FR3A 3UE1A 3CPWA 3GO5A 4DV4L 3KF6B 4KI0A 5GROA 5C4XH 1VCIA 2NVYH 1PYSB 1KIXA 4GLXA 1PH6A 1G6PA 2B8GA 3U4VA 2UU9L 4I7ZC 1VQ9A 4IOCA 4X62Q 2K5NA 5FLMH 1X65A 5C44H 1BKBA 2QEXA 2L15A 2PI2A 2Q5AA 2ASBA 2ES2A 4K0KL 2JX8A 4J15A 1VQCA 2WAQG 3NTPA 3FP9A 1FJGQ 4BY1H 1JJ2A 1W3SA 3JAMi 1KAWA 4XTCS 3KDFA 3D0FA 2M8IA 3J7A5 3VR6A 4DK3C 4O0AA 5LMNW 2LMCB 2JV4A 3E9IA 1N9WA 3B6YA 1ONLA 5FLXc 4HJ7A 4DV0L 1N34Q 3S1RH 2WB1E 4JCVE 1WOCA 4DV7L 1YITA 1YVCA 4DNRB 4A3GH 3RN2A 3IRBA 5DLQE 4GNXC 3G71A 1S40A 1PFSA 4DR7L 3K7UC 3KLWA 4IO9A 3U58A 3DM3A 4IQZA 4RCNA 1T5EA 4GNXA 1PH1A 1Q90A 1Y1VG 1FVIA 2RE3A 4AYBE 1WR7A 1K9QA 2YSGA 2JA5H 2CFMA 1N32L 3RR5A 2VQEQ 2JA8G 3AFPA 3UDGA 4DV5Q 4LF6L 1NMVA 4JV5Q 4G7HC 1W2BA 1GHJA 3M4YA 4IJLA 1H9RA 2H5XA 5C4JH 5FJ8G 4GOPA 2M3OW 3CCQA 4YCUA 4OWTB 1WYDA 4A3FG 3HOUH 1E2WA 2KXQA 1BBWA 1N34L 3K8AA 3LGJA 4IOAA 1WI5A 3HKSA 3GTOH 4LW1A 3CCMA 1H95A 2AKWB 1RIPA 3KF8B 1B7YB 4DK6C 3PO2G 2XPAA 1O78A 4KKUA 2K5VA 2AWOA 4YCWA 2VW9A 4POGA 1HZCA 1YEZA 4TQUS 1VQIA 2DWVA 4JYAQ 3CD6A 2XGTA 1GUGA 1HZBA 4HIKA 1YNJC 5IWAL 1U0LA 1HNXQ 1VDZA 1KL9A 4QY7A 2XP7A 2KCCA 2I5MX 1YW5A 1UE5A 3TREA 2A68C 3VR2A 4QIWE 4YY3L 1CI3M 3BZCA 2BE5D 1YBYA 2Y0SE 1JB7A 2NN6H 3S14H 5LMNQ 1VQ7A 3HKZE 4JV5L 1VQJA 1XPUA 2K7VA 1EWIA 4AQYL 3PIOA 2YTXA 1BVSA 1WCMH 5HGQA 1XMOL 3N6RA 5BN5A 4IPDA 1Q86C 2CWPA 4KKSA 1V8QA 4BBSG 5IYDG 5K36G 2XP5A 1BBUA 1EFWA 3PV0A 1PYBA 3LWUA 2IX1A 4GN3B 1CSPA 4YHHL 2JA9A 2LXJA 2HHHL 2ZM6Q 3OW2A 5IT9c 4A3JH 3T53B 3PO3H 4A3LH 1CKNA 4WJ3M 1NE3A 4L5RC 2R93H 4A3CH 4OONA 4DV6Q 2JXMB 1T9HA 5CQ2A 4GKKQ 2EJGC 5M3FH 1GHKA 3FKIH 1MKHA 5M5YH 4E5RA 5HY6A 3A0JA 2KBNA 5IP9G 1I5FA 2EZ5W 1OXTA 1C7YA 2DGYA 2YSHA 3SDZA 1HR0L 2A6ED 1KHIA 3OTOQ 1NJIC 4MZ9A 1HNZL 2UUCQ 3CPFA 2ZJQA 2JA6H 4R4CA 5AJ3Q 1GUOA 1C0AA 3KYHC 2JE6I 1E2VA 4KLKA 3AFQA 2B29A 4JI5L 5IP7G 1Z6HA 1HTPA 1VF5C 2BE5C 3A7LA 1SN8A 2N8NA 3KJOA 2B3GA 2DK7A 2CW0C 5IE8A 5GADC 1CSQA 1VQMA 3J81j 2LXKA 4L5SA 4L5QA 3RZOH 4A3KG 1G291 3HGBA 4H02A 1E22A 2HQLA 4GKKL 1JE5A 4IFDG 1Y14B 2ZJRA 3H0GG 1IBKL 4B3SQ 4X64L 2IT1A 2EXDA 4JI7Q 2ZQSA 2QA4A 3G4SA 1Q1BA 4NXML 1CUKA 1I3QH 2UUBQ 1VQEA 1EQRA 2UUCL 1QVCA 2PQAB 1YHQA 4HR7B 2UXBL 1JT8A 4LF4L 2XPBA 2MNAA 2PMZE 3LNNA 4JI2Q 1K8MA 3CCJA 2JEAI 3CCEA 1HJPA 3ER0A 1SE8A 1X3FA 1FYCA 2A6EC 3HOVG 3K81C 3W5OA 3F8TA 3RZDH 4EX5A 3A7AB 2NVTH 1ASZA 4DR2Q 2JK8A 2XP8A 1PA6A 2XTIA 4LF5L 3VR4A 3TEHB 2YTVA 4DAYB 2BA0A 2YSFA 4DV4Q 4UP8A 4GKJL 2JA8H 1NMFA 5ELOA 3CC2A 4OO1H 1A6XA 1DXMA 1X3EA 2ID0A 4DR4L 1OXSC 5KNBA 4LFCL 1TWHH 1LUZA 3HOZG 5FJ8H 2K33A 2UU9Q 1QZHA 1E1TA 3F2DA 4LK1C 4TKOB 3KAIA 3D4RA 3WDNA 3CP0A 4KKTA 4K0KQ 5C0XJ 4A3FH 3UDXA 1X54A 3EN2A 1TWFH 4A3DH 2UUBL 3K7AH 1N33L 4RG1A 2R92G 3OW7A 2EIFA 2MO1A 1P8LA 2Z6KC 1YHBA 3K0XA 1TWCH 1I6HH 1D8LA 4C3HH 2K32A 5M3MG 3J80c 2WP8J 2UXDL 3L4HA 1C9OA 2YV5A 3A8KE 4DV0Q 2RF4A 2BH2A 4LFAQ 4GZYC 3GQBA 3OYYA 4DV7Q 2Z6KA 4UP9A 3GD7A 4Y52H 3NE5B 4BBRG 1Y69U 4DR2L 2AHOB 3T1YQ 4R4QA 1L1OB 3GTGH 1X9NA 3EQLC 3L0OA 1IYJB 4DR5L 4DR7Q 5C0XG 3A8JE 2YSBA 2VUMH 4DV3Q 1EWHA 3I73A 1VS0A 2PNHA 4HIOA 4A3EH 5KNDA 4NPSA 1OXUA 4BBSH 3I2ZA 1IBML 1Q81C 5IYDH 5J3BA 2EDGA 3M4PA 3WWVA 3HOWG 1N8RC 1VQHA 1GUNA 1MJCA 3SE0A 1N32Q 2D0PA 1HR0W 1ZYRC 4LF6Q 2NVQH 2KCMA 1DGSA 3I4MG 3TRZA 4IPCA 1LTLA 4U86A 3E9HA 1A8VA 4HIDA 4AYBG 3CCSA 2CKZB 2EJMA 3VR3A 1Z7TA 2JXWA 3EBEA 5E7NA 2YTYA 2ZTEA 4OWWB 4LFAL 1GUTA 2D5DA 4BXXH 3BG3A 3M7NA 4UY8C 3J7ZC 1I94L 3T1YL 2V1CC 3I4NG 1VQKA 5M5WH 3GDEA 4L8JA 1K83H 3P20A 3M4QA 4YCVA 1NBWA 2A68D 4DV3L 1CFMA 2A6HD 1PH8A 4GNXB 2JA7H 5JEAJ 4BA2I 1BDOA 4A3MG 2K75A 3GTMH 1QUQB 2WAQE 3CCLA 4MTNA 5IWAQ 2F52A 4DR3L 4GLAC 1PH3A 3M3YH 4YY3Q 4BY7G 2A69D 1PINA 1YZ6A 5EAYA 4C2MH 4GOPC 2Q8IB 2XP4A 4IPGA 1YNXA 4AQYQ 2RHQB 3F2CA 2RCNA 1XMOQ 4A3KH 3H3VH 4OO1I 1J5EL 3A5ZB 4R4TA 4R4OA 3FHWA 4PV1C 3ICEA 3H0GH 4A93G 3FMCA 4YHHQ 5JEAG 1Y1WG 2HHHQ 2Y0SG 5IYBH 3HKZG 4JBKA 3GTJH 1PH5A 2Q2TA 4C3IH 2BA1A 3CRLC 2ZJPA 2I5HA 2GVBA 2GVAA 1VQAA 3GTQH 1RL2A 2AWNA 1QVGA 2UXCL 3KADA 4DK0A 2K4KA 2XP6A 2O5JC 3LE4A 3M85A 4DNIA 3S24A 4A3IG 4A75A 1EQQA 1TWAH 1K9RA 2VS1A 3TZUA 1UEBA 1HR0Q 3WH0A 1N36L 3J81i 1VQPA 1HNZQ 3ND8A 2A6HC 1LYLA 2LSSA 3CF5A 3JAMc 4FDBA 5GAGC 4LFBL 2R7ZG 4JG2A 3HOYG 4JI8Q 4DV1L 1PMRA 4TVAB 3HOXG 3S17H 1K8AC 3HOZH 2K5HA 3KABA 4JI5Q 2VQFL 4A3BH 1ZCNA 2A69C 1G51A 5C4XG 2EQSA 3W1BA 3TQYA 4MNOA 1PVOA 4KHPL 1O7LA 3M4OH 2ZR6A 1GVPA 4PZ6A 1PH4A 5BR8Q 3PIPA 5FLMG 5C44G 4QGUA 1X56A 2DN8A 1Q46A 3NBHB 2R92H 3JC66 3ULPA 1SFOH 1VQ6A 1EUJA 2DJYA 1UE1A 1D7QA 5C3EG 1IBKQ 3QJYA 3U9SA 2F21A 1OXXK 4APVA 4X64Q 5M3MH 4OGQC 1LABA 1HH2P 3PGZA 4B3RL 2KA7A 3H94A 4NXMQ 3I72A 3U50C 4KMUC 1K3RA 2N49A 3K80C 2B63G 1WJJA 3TC5A 1H9SB 2BH8A 1YJNA 4IFDJ 2UXBQ 1TKWB 3TDBA 5C0XH 1IXRA 4LJZC 2IX0A 4LF4Q 1KD1C 4A3GG 4JI8L 3A74A 1SROA 4DAMA 3RLFA 1YJ9A 2OQ0A 2ZQUA 3SGIA 1Z47A 5A35A 4QL5A 3RLNA 4GN5A 3I4LA 2L5TA 3E0EA 3HOWH 4LF5Q 2E2IH 1I6VC 1K73C 1GUSA 1VF7A 4PMWA 1VQOA 5BR8L 4GKJQ 5BN4A 2Q2HA 1CTMA 3CMAA 1L2FA 1A63A 4DR4Q 4JI1L 4LFCQ 3ZJYC 3NEMA 2MFIA 2RHSB 3I4MH 1IZ6A 2E5LL 1FL0A 2OWOA 1B70B 4KN7C 4P72A 3PCOB 1IYVA 4PZ7A 1B8AA 2YSIA 4NB3A 4OX9L 2DK1A 1S72A 2A19A 2K52A 2AUJD 4IPHA 3AB9A 2ZQTA 1J6QA 3CRKC 1S3OA 2KHIA 3T51B 4POFA 1N33Q 1X55A 4X65L 1O6WA 3AQQA 3Q8DA 1Q1EA 1ASYA 1VQ5A 3HOUG 5JJLA 1M90C 1HNWL 2DMVA 2D62A 4JBJA 5JJKA 4LUOA 4NXNL 2UXDQ 4A3MH 4B3ML 3QG1A 4U85A 1Y1VH 1AH9A 2PQAA 3VR5A 2YU9H 3TS2A 4DKAC 4DR5Q 2R7FA 2KCTA 1EIYB 1E7ZA 2IHEA 1Q7YC 2VY3A
chains in the Genus database with same CATH superfamily
2NN6I 5IYCG 2MGSA 3KLSX 4H0LC 2OF1A 1JMQA 2F4VQ 2QW7A 3M4OB 1SMYC 1XTCD 3HG9A 2DY8A 2IHFA 1JB3A 2ICEC 2C35B 4N9PA 1MBYA 4IJHA 4HIMA 2NN6G 1IBMQ 3P1HA 4K14A 1L0YB 1PLFA 4DAYA 3T56B 3AMUA 2GN5A 3CC7A 1DYQA 1HTLD 4JC0A 1AFPA 3CHBD 4A93H 1CHQD 1XMQQ 2R92B 1XNRL 5JJIA 2AMCB 3W3AA 1SFOB 2OTLA 2SNSA 3C3LA 3OIQA 1KRSA 2R3ZA 4JI3L 1V1QA 1EWCA 3KFUA 4ME3A 1VQ8A 3Q0AA 2D2CC 3DWAA 2N3SA 3MTSA 4K6DA 2KCNA 5M3MB 1EEFD 1QVFA 1XTDA 3PO2H 5IGEA 1PTOD 4JI6L 4P73A 3ND9A 1K0RA 3EVQA 4LF7L 4DUZL 4B3TL 1SYFA 3PUZA 3VDYA 4QIBA 4BBRB 1KXLA 2R93G 3IFDA 4QMGA 1IBLL 2NTTA 4ZK9B 2ZXOA 3GTPH 1VQBA 2PZTA 4OWXB 2JYOA 1ESFA 2K50A 3I8ZA 1P16A 5J1ZA 5IGDA 3FKIG 1I94Q 4H7BA 1G2SA 2NBFA 3KUPA 2KJXA 2VZAA 4LMQD 3STBD 5HGTA 4LF8L 4KHVA 3TMEA 4HJAA 2MO0A 3ODKA 3DEOA 3QR8A 4X6AH 3R2TA 2NZOA 5IY0A 4DU9A 2ATWA 2F0VA 1EU3A 5DEHA 1Q8KA 2VB2X 4DAPA 3HOYH 1Y8NB 5GQOA 1PDQA 3FS8A 3HOWB 1ML0D 3HOXH 2CQOA 2MJ8A 2JA6G 3A8IE 4DR6L 2E2IB 2Z4HA 1RKNA 1B9NA 3FPPA 1M1KC 2F4VL 2JJQA 2I07B 4RMFA 1L1OA 1CZWA 1FD7D 2WB1G 4L6TB 2E75C 3ULLA 3DLLA 2F0KA 1U9RA 5K36H 3CU7A 4DR3Q 3RLOA 1NMGA 4RKBA 4I65A 3KF6A 2PNRC 1G91A 1XMQL 1SDFA 1B9MA 1AE3A 5DNFA 3PF4A 4M8AA 5JPNC 1EOVA 3I4MB 3KDFB 4BS9A 2J4XA 5C4HA 2UUAL 2MP1A 4MTKA 1XNQL 1SRUA 1EYCA 1PFNA 4CDDC 2E2JH 1OTCA 1PRTD 2VB3X 4AYBB 4JI4L 3DUZA 2EY1A 3UE0A 4AIMA 1NTGA 3HZXA 4L5TA 1BF4A 3S1NH 1EZ8A 1EG4A 1J5EQ 3C1FA 1KRTA 5CR3A 4G7OC 1BQQT 2QF7A 1LTID 1XPRA 4BA1I 4EQ5A 4JI0L 5M9OA 5GAEC 3OOBA 3U4ZA 3T1HL 2ZTCA 5C3EH 3KAFA 4KV6A 1UE7A 1WMVA 1IYUA 4REXA 5JAVA 2JP1A 3CW2C 5H1SE 3BZKA 2ZR5A 3D8GA 4X66L 5IP9H 5I6YA 1KQSA 1B4OA 4NKLA 3MFYA 1E2ZA 5E4XA 2B63H 4OELB 3I56A 5LL6X 1X3GA 3CMEA 1QJOA 1TU2B 1PTOC 1PV4A 1VQNA 4QQBX 2EY2A 3CXCA 1V9PA 3H15A 1S5CD 3KLRA 4A3MB 4WJWA 1TR8A 4LWCA 5EKIA 4HJ8A 1TY2A 1HZ9A 2PZWA 5D3DA 1FGUA 5EPJA 4B9WA 2G9DA 4DR1L 2WAEA 4IUUA 1FNWA 1GD7A 4KD3A 4P75A 3WOEA 3ZYYX 1YI2A 1HCZA 1A3UA 2UXCQ 1HHVA 3BU2A 2F1MA 2M8JA 3K5OA 1C48A 1U4RA 3BYTB 2YU9B 1PHJA 4ZRZA 1GKHA 1F2ZA 2SOBA 3DXJC 1L0WA 2L4JA 4BY7B 2PI2E 5JPMC 3STBC 5IP7H 3BZDB 3J7YW 3K57A 3OPOA 1AE2A 4QB4A 4OEMB 3R8BA 3S1QH 3M7GA 4PG3A 1O7IA 5IGFA 1N36Q 4QCLA 1Y8PB 4LUVA 3KOJA 2LY7A 3I3CA 4FF4A 3H09A 2QGQA 1WFQA 1HA5A 4UPAA 3HS0C 5IGGA 3BVGA 1HUMA 2HIVA 1U5KA 1TS2A 2CCZA 4LFBQ 1QUQA 2XP9A 2JQOA 2EY6A 4X62L 3LKXB 1E1OA 4JOIC 5CC4A 3CAMA 2R6GA 1SYDA 3PQIA 3QOLA 3KAHA 4DV1Q 3GTLH 4GOPB 2F0QA 4K8IA 3OMCA 4H44C 4A93B 1QOHA 2AUKA 2K1BA 3E3XA 1IKLA 3NUCA 4F87A 1AZQA 5M5XH 1EG3A 2MQHA 1SNQA 2VQFQ 1FJGL 1Y1WB 1YNND 2PPBC 2EOTA 1JOOA 2F3IA 4IFDH 2Y0SB 3E0JA 5G3LF 4OO1G 3A5UA 4M1UB 3S2HH 5E66A 3SEBA 4JOIA 4YWLA 3HKZB 4KHPQ 4NMZA 3IKJA 3MCBA 2Q2IA 2V4DA 4S3SA 2QILA 4PNYA 4FF3A 1PRTC 1CKMA 2F0SA 1NR2A 1MI2A 1JWSD 1U4LA 2XRSD 3PSIA 2XP3A 3DEPA 2E2DC 2HT1A 1Q12A 1LM0A 4Q5VA 1JJCB 1JMCA 3S9WA 2JEBI 1DCZA 3QO2A 1V1PB 3EIVA 3CNGA 1PH9A 3GTPB 2EVBA 1MGSA 2WIIB 1ZKOA 3CC4A 2IW3A 4A3DG 4A3IB 2ZT9C 5NUCA 2CWAA 4JVZA 3W1GA 2F0FA 3BDOA 1V43A 3AU7A 1AN8A 3GTKH 4B3RQ 2OT2A 3CQZH 3PUWA 4QJFA 1S5ED 1SYBA 5EKLA 4DK1A 3HOVH 2Z0SA 1TWGB 4LUZA 3S15H 1VQ4A 3PUXA 5EPKA 2XRQD 1HQMC 4UHVA 3D4DA 2R7ZB 3EROA 1DZ1A 1TXYA 1PFBA 4OL7A 1Q82C 2E45A 4JBMA 1NR4A 3HOYB 3MVVA 1XPOA 2EZVA 2DY7A 2PCFB 4GN4B 4A0TA 1F9QA 3QIAA 3HOXB 1A62A 2EYHA 3QB3A 3D31A 4XYQA 2Q2UA 1DOKA 5ELCA 1C4QA 1SLJA 2BOSA 4CKCA 5C4XB 3K5MA 2EJFC 5D14A 2ZAJA 4YWKA 5IYCH 3CCUA 1B1ZA 2A8VA 1BCPB 2VQEL 1EY0A 3BDLA 4C1NK 1Q8IA 3BJUA 2B2YA 2CQAA 2VUMG 2RSOA 2ZR4A 1I50H 2AQ1B 2DNEA 4DV5L 1LTBD 3S2DH 2FXQA 2E2JB 4AH6A 1E0BA 5C44B 4F88A 1JJGA 3VA7A 2ITKA 4A3EG 1F8AB 1K3BC 2EY5A 5C3XA 4A4IA 2E76C 1PZID 3SK6A 2QKIC 1CKNB 2Z8LA 2D0OA 1IL8A 4Z9CB 4NDXA 4PQXA 2KHJA 3S1MH 1EU4A 3UDFA 4JI1Q 1YNNC 4QUFA 5C3EB 3KJPA 3ULJA 3BVZA 2E5LQ 4HSPA 2EYPA 3F2BA 3IFTA 4LF9Q 4ALPA 1STNA 4BY1G 3GV6A 4KK7A 1NAPA 2E8GA 4DN4M 4OX9Q 3I4OA 2B63B 1K8OA 3DWPA 2G9HD 3C46A 1L0XB 1WTXA 2B8FA 3HFZB 1HPCA 5JJZA 5GAHC 2I5LX 2L0CA 1HFNA 2O5IC 2VNUD 3NBHA 1E3PA 3N52A 4R9WA 1XJVA 3S1RB 2WADA 4BBRH 2OTJA 3L2PA 4X65Q 3EA6A 1A0IA 1F77A 4A3GB 3F1ZA 2NVXH 2K01A 3AYHB 4JYAL 2OCEA 1FLCA 4BXXG 1SNOA 4DPGA 5E3FA 1HNWQ 1HNXL 3T13A 3OHXC 2E2HH 1CHPD 1E24A 2I0QA 1WTHA 3K5NA 3PUYA 1KDCA 2CH4W 4NXNQ 2EXZA 2F3WA 1BR9A 1H9KA 1EIFA 5D65A 1WTQA 1VQGA 4RGTA 4B3MQ 1A3TA 2K04A 3UDIA 5CBAE 3TP8A 1H9SA 3RUZA 3K0YA 1QNUA 1C8CA 4ZCKA 5LMNL 2VL6A 1IW7D 1HZAA 3CCVA 3RNUA 2JA7G 4TSSA 2B2TA 2LAJA 1S5FD 3KCEA 4B9XA 3T4AC 1GM5A 2JMFA 4FYDA 4DFAA 2F0TA 4YIJA 4EGVA 4JBWA 3GTLB 3OOCA 4P74A 3G6EA 3J80i 3FRPB 3S16H 2YAJB 2Y8NB 3H3VC 1X6OA 1DD2A 2CHBD 3MXUA 3TCZA 4IUPA 5EBDA 2BDOA 1RCVD 2JA5G 4DV2Q 1MJEA 1OXVA 2AQ2B 1TK7A 4LF9L 1Z9FA 4JK1C 3IL8A 2ZM6L 2K14A 1UWVA 5C5LA 5C4JB 3H3VI 1UUPA 3TN2A 4K2KA 4P2CB 4DUYQ 1YIJA 1H9MA 2YYZA 1WVLA 1CM9A 3NWTA 4IFDI 2XVSA 1XNRQ 1KC8C 2DNCA 4DV6L 5T1IA 4XXEA 4JI3Q 1A15A 1KTKA 3TSSA 2HCCA 3HOUB 5JVH3 2F0DA 4IUNA 3J81c 5L37A 4RGMA 2RCFA 4F8MA 3DM1A 1SR3A 3I4NH 1CKOA 2N78A 2X6LA 4J1MA 4H13C 3PF5A 3GTOB 1HUNA 1UAPA 4KHZA 4XQQA 3TS0A 1AZPA 4WJ4A 1IL2A 5LMUQ 4JI6Q 3GTKB 1D1IA 2ALYB 2MHVA 4G7ZC 3HOVB 4KN4C 2DUDA 2K03A 5IYBG 4DUZQ 4B3TQ 4LF7Q 3S15B 1LACA 5AHTA 4HJ9A 3KAGA 3OTOL 4GS3A 1TVXA 1IBLQ 5IOCA 1JOQA 3PUVA 1ENCA 2R7DA 5AJ3L 3RN5A 1PTOH 3L7ZC 3EJIA 1I5HW 3NP8A 1K9MC 2DJFC 4R8NA 1YJWA 2IY5B 1VQFA 4FXDA 2NTSA 5CV4A 4LF8Q 4BY7H 4K6LA 4UP7A 4ZKBB 4UAIA 1RJTA 1LTRD 2E74C 2ZTDA 1R9TH 1PH2A 1YHAA 4GLVB 4LNQA 1B50A 3V2TA 4U84A 2SEBD 3S14B 1EYGA 3S2DB 5I2YA 5KNCA 1M4VA 4DV2L 4DR6Q 1IW7C 1EOTA 4X3KA 1SBBB 1ESRA 4I7AA 5IIFA 3DWQA 2MDIA 4HCEA 4CJ1B 4DUYL 5CMDA 2SNMA 4O2DA 4WRDA 2WFWA 1RTOA 1WCMG 3S1MB 1QE6A 4Y7NH 1K8GA 2NZHA 5JEAH 1O80A 2KENA 1Y1WH 2WINB 2FHTA 3MXNB 2UUAQ 4XIGS 4A3BG 5CORA 1NNXA 5BN3A 3ERSX 1XNQQ 2M9VA 4A76A 2ZQVA 3NELA 4JI4Q 2HCIA 1LT5D 3EFXD 1GJXA 2L12A 4B3SL 1H9JA 1HRJA 4JI7L 2R93B 1I4GA 5CGKA 5KIXA 3PIO3 4YWMA 4PZ8A 5LMUL 2OQKA 3AEVA 1F9RA 2LS01 3A54A 4JI0Q 4A3JG 5FLXL 4C56C 3T1HQ 1NY4A 2PW5A 3PO3G 4A3LG 2KHSA 3GV3A 5M5YB 1D1KA 4A3CG 2A74C 2A1AA 4P71A 2NVXB 1VQLA 1SMXA 4X66Q 1GO3E 1Y8OB 1SNCA 2KUMA 2G5DA 4MIUA 4ZQ3A 4C3JH 3CCRA 5M3FG 3I7FA 4A3IH 3NENA 3OWEB 3NK9A 1PH7A 2E2HB 4OXPA 5E62A 2HIXA 2KVMA 4Q0FA 3NTIA 4JI2L 1ZEQX 3M9BA 2BDNA 1JE4A 4K5WA 3MEFA 2B2UC 1L1OC 2F0JA 4HTHA 1TWGH 4R4IA 2JA6B 1QZGA 1VQDA 2OXPA 4O42A 4DR1Q 2HUGA 3Q22A 3G48A 2R7ZH 2WB1B 4B08A 4DNTB 3NTKA 5ELNA 5K5PA 1MIUA 5C0XI 3NTHA 4HJ5A 4R1JA 1X3PA 5CYUA 5DAUA 3I55A 1UE6A 1EL0A 1FR3A 1TT2A 2B2UA 2WKCA 3UE1A 3CPWA 3GO5A 5TSSA 4DV4L 3KF6B 3S16B 4KI0A 5GROA 5C4XH 3KLSA 1VCIA 2BCOA 2NVYH 1PYSB 1RTNA 1KIXA 4GLXA 1PH6A 1G6PA 2B8GA 2F0EA 4N8X1 3OIPA 4NP5A 3U4VA 3SHLA 2UU9L 2Q8RE 4I7ZC 1VQ9A 2NYZD 4IOCA 4X62Q 2K5NA 5FLMH 1X65A 5C44H 1BKBA 2F0LA 2QEXA 1STHA 1RDPD 1FGBD 2L15A 2PI2A 2RDFA 3K5LA 2Q5AA 3BDCA 2K05A 3RZOB 4FNFA 2ASBA 2ES2A 4K0KL 2JX8A 4J15A 3NQIA 1VQCA 2PYKA 2WAQG 3NTPA 2JN4A 3FP9A 1FJGQ 1K28A 4BY1H 1JJ2A 1W3SA 3JAMi 1KAWA 4RH6A 3KDFA 4XTCS 3D0FA 2M8IA 3J7A5 3VR6A 3I4NB 1NUCA 4IUTA 4DF7A 5G3LD 4DK3C 4O0AA 1S5BD 5LMNW 4EVOA 2LMCB 3K6OA 2JV4A 3E9IA 1N9WA 3B6YA 2L1BA 4KJNA 1ONLA 3P7JA 1B3QA 5FLXc 1LV9A 3I70A 4HJ7A 4RCOA 4CKBA 4DV0L 3MAQA 4RHRA 4RKLA 1JC7A 1SE3A 1N34Q 3S1RH 2WB1E 4JCVE 1WOCA 4DV7L 1YITA 1PTOB 1YVCA 4DNRB 1ILPA 3ONAB 4A3GH 5CV6A 1B3AA 1JCKB 3RN2A 3IRBA 4RA8A 2KEDA 5DLQE 4GNXC 1QCBD 3SXHA 3G71A 1S40A 1PFSA 3RD4A 1DONA 1R9TB 4DR7L 1DJRD 3K7UC 2RDHA 3KLWA 2NWGA 1EY8A 4IO9A 3U58A 3DM3A 2H1EA 4IQZA 4FXKC 3SR1A 4RCNA 4IUVA 1T5EA 4GNXA 1PH1A 1LTTD 1Q90A 2K5WA 2WKDA 1Y1VG 3TP7A 1IHZA 2NZ1D 2CH4A 1SYEA 1FVIA 2RE3A 3ERQA 4AYBE 3K58A 2HQEA 1WR7A 1K9QA 1TR5A 3K59A 2YSGA 2JA5H 2CFMA 5COYA 2LKVA 5I4DA 4QIWB 2L55A 1N32L 3RR5A 4IURA 3MQHA 4Y7NB 3G7LA 2VQEQ 3SVMA 5CV8A 4K2LA 2JA8G 3AFPA 3UDGA 4DV5Q 4LF6L 1NMVA 4JV5Q 4G7HC 1W2BA 1GHJA 3M4YA 4IJLA 1O7ZA 3LKXA 1H9RA 1ENFA 5HURA 2H5XA 4CDEC 5C4JH 5IT9L 5FJ8G 1RHPA 4GOPA 4ID6A 1CQFA 3A56A 1TWFB 2M3OW 3P75A 3CCQA 4A3DB 1PRTB 2XN9C 4YCUA 4OWTB 1I4HA 2MPMA 1WYDA 4CJ2C 1STAA 4ZYSA 4A3FG 3HOUH 1E2WA 1SYGA 2KXQA 1BBWA 1N34L 1NCVA 3K8AA 1CZGA 3BVMA 4HMJA 2IJ0A 3LGJA 4C3JB 1WI5A 4IOAA 1B2TA 2Z6BA 3HKSA 4DA2A 1I6HB 1K0SA 3BS1A 3GTOH 3D4WA 4LW1A 3CCMA 2PZUA 1H95A 2AKWB 1RIPA 3KF8B 1B7YB 4DK6C 1F2LA 4XQNA 3PO2G 5LL6S 2XPAA 1O78A 4KKUA 1BCPF 1I4PA 1QNKA 2K5VA 2AWOA 3I90A 4YCWA 2VW9A 1V1PA 4U68A 5FO8B 1D6EC 4C3HG 4POGA 1HZCA 1YEZA 4TQUS 1VQIA 2DWVA 4JYAQ 3CD6A 2F0UA 2XGTA 1GUGA 1HZBA 1JOKA 4HIKA 2B2YC 1CQVA 1SSOA 1YNJC 2F0WA 5IWAL 1SEBD 1U0LA 1HNXQ 1VDZA 1KL9A 4QY7A 2XP7A 2KCCA 2I5MX 2VUMB 1CA5A 1YW5A 3TDQA 1UNSA 1UE5A 2NVYB 3TREA 1D5XC 2A68C 4QIWE 3VR2A 2RVLA 4YY3L 1CI3M 1QILA 4FF2A 2X69A 3BZCA 4A3EB 2BE5D 1YBYA 2Y0SE 1JB7A 1EIHA 2NN6H 3S14H 5LMNQ 1VQ7A 3HKZE 1ZXTA 4JV5L 1VQJA 3TZDA 1XPUA 2K7VA 1EWIA 2RQXA 4AQYL 5KGUA 3PIOA 5AFWA 2YTXA 1BVSA 1WCMH 5HGQA 1XMOL 3N6RA 1BUVT 4IPDA 5BN5A 1Q86C 2CWPA 4KKSA 1V8QA 3CKIB 4BBSG 5I9PA 5IYDG 4BY1B 2XP5A 5K36G 1BBUA 1EFWA 2RBMA 1RF2D 1PYBA 3PV0A 3LWUA 4L63B 2C9OA 4OIJA 2IX1A 1XWEA 4GN3B 1CSPA 4YHHL 2JA9A 1EY6A 2LXJA 3J81L 2HHHL 3U9OA 2ZM6Q 3OW2A 1STBA 1BNZA 1KNEA 5IT9c 2PW7A 4CDCC 4A3JH 1EQVA 3T53B 3PO3H 4A3LH 1CKNA 4WJ3M 1NE3A 4L5RC 2QDBA 5T1GA 2R93H 3NWSA 4A3CH 4OONA 3R2IA 2WV6D 4DV6Q 1T9HA 2JXMB 5CQ2A 4GKKQ 2EJGC 5M3FH 1GHKA 3FKIH 1JWMD 1MKHA 5M5YH 1RP5A 1CT1D 4E5RA 4BWGB 4CHTB 5HY6A 1B44D 5M5WB 3DHQA 3A0JA 2KBNA 5IP9G 4CJ0B 1K83B 3HEJA 1I5FA 2EZ5W 1OXTA 1C7YA 2DGYA 2B2TC 2YSHA 3SDZA 1RD9D 2F0MA 1HR0L 2A6ED 1KHIA 4QUCA 5I2XA 3OTOQ 1NJIC 2JA7B 4MZ9A 1I4QA 1HNZL 2UUCQ 3CPFA 2ZJQA 2JA6H 4R4CA 4JW0A 2R61A 5CBEE 5AJ3Q 3R93A 1GUOA 2L11A 1C0AA 3KYHC 2JE6I 2Q8TA 3IAYA 1D5ZC 5C4ZA 1E2VA 4KLKA 2PMZB 2JA5B 1J8IA 3AFQA 2B29A 2F0OA 4JI5L 1F2MA 5IP7G 1Z6HA 3HRZC 5I6WA 1JQYD 1HTPA 4ODGA 2PQEA 3F2UA 1VF5C 2BE5C 3OWFA 5KRUA 3BYYB 2QRVA 3A7LA 1SN8A 2N8NA 3KJOA 2B3GA 2DK7A 1F2YA 1KDBA 2CW0C 5FK9C 5IE8A 3PQHA 5GADC 3TP5A 1CSQA 2LFNA 4DAVA 1VQMA 3J81j 2LXKA 4L5SA 2RKSA 4L5QA 4CDFC 1JWUD 1J9OA 1SAPA 2M00A 3RZOH 4A3KG 1G291 3HGBA 4H02A 3G6JB 1E22A 2HQLA 4GKKL 1JE5A 4IFDG 1EZ6A 4RGNA 4XT1B 2CVRA 1Y14B 2ZJRA 3H0GG 1IBKL 4B3SQ 1BXTA 4X64L 2IT1A 5DM73 2EXDA 4JI7Q 3GTJB 2ZQSA 2QA4A 1M8AA 4KTAA 3G4SA 1EY9A 3H6MA 1Q1BA 2FINB 1CUKA 1EEID 2EYFA 2XNAC 4NXML 2A5HA 3VYUA 1I3QH 2UUBQ 3J80L 4HSVA 1VQEA 3J81E 4C3IG 1EQRA 3MFGA 2UUCL 1SE2A 1A2TA 2J0TD 3X3MA 1QVCA 2K28A 2PQAB 1YHQA 4HR7B 2UXBL 1JT8A 2K5DA 1G2TA 4LF4L 2XPBA 5EJWA 2IX3A 2MNAA 1MSHA 2PMZE 3LNNA 4JI2Q 1K8MA 1TWAB 3CCJA 2JEAI 3CCEA 1HJPA 3ER0A 4U673 3URYA 1SE8A 1X3FA 1FYCA 2A6EC 3HOVG 2M2LA 3K81C 3W5OA 1AP0A 3F8TA 3RZDH 4EX5A 4IN3A 3E5SA 3A7AB 4X3TA 2NVTH 1ASZA 4DR2Q 2FJ2A 4V190 2JK8A 2XP8A 1PA6A 2XTIA 4LF5L 1PZKD 4ZAIA 3VR4A 3TEHB 1KAAA 2YTVA 4DAYB 1WCMB 2Z1CA 2B2VA 4K5VA 1MHWC 1SE4A 2BA0A 2EYJA 5CV9A 2YSFA 2XWJB 4DV4Q 4UP8A 4GKJL 1HXYD 2JA8H 1NMFA 5ELOA 3CC2A 4A3BB 4OO1H 1A6XA 5DM63 1DXMA 1X3EA 2ID0A 4J6HA 4DR4L 1DOMA 1OXSC 5KNBA 4LFCL 1F9PA 1TWHH 1ZYRD 1HQRD 3J7AF 1LUZA 3HOZG 1ICFB 5FJ8H 2K33A 2UU9Q 2I46A 1EFID 3X3NA 1E1TA 3F2DA 1QZHA 4LK1C 4ZUJA 4TKOB 4A3JB 3KAIA 3PO3B 3D4RA 2NUCA 3WDNA 3CP0A 4WORA 4KKTA 4A0UA 4K0KQ 5C0XJ 3NSWA 1EIGA 4A3FH 3UDXA 4XQJA 2TSSA 1X54A 3E6ZX 3EN2A 3FEWX 2RA4A 1TWFH 4IUQA 4A3DH 2UUBL 5M3FB 4MHEA 3FKIB 3K7AH 1FNVA 1N33L 2TMPA 1LTGD 3MXNA 4RG1A 2R92G 3OW7A 1ET9A 2EIFA 4CGYB 2IL8A 1W6KA 2QEJC 1GUWA 2MO1A 1P8LA 1EY4A 2Z6KC 4X3UA 1YHBA 3K0XA 1TWCH 1I6HH 1G6ZA 1D8LA 4C3HH 4TRDA 4OIKA 2K32A 5IGBA 3PIP3 5M3MG 5C5MA 3J80c 2WP8J 2UXDL 3L4HA 1KABA 3V05A 1C9OA 2YV5A 3A8KE 4DV0Q 2RF4A 2BH2A 4LFAQ 4GZYC 3GQBA 3MXGA 1SNMA 3OYYA 2FFKB 4LAAA 2Z6KA 4DV7Q 4UP9A 3GD7A 3GP7A 4Y52H 2NB0A 3NE5B 4BBRG 4DR2L 1Y69U 2AHOB 3T1YQ 4R4QA 1L1OB 2A73B 3GTGH 1WTWA 3QOJA 1X9NA 3EQLC 3L0OA 4FP5D 1IYJB 4PMCA 4DR5L 3J80E 2O2LD 5EBCA 1AEXA 5C0XG 2JSOA 4DR7Q 2L4NA 3A8JE 2YSBA 2VUMH 3MWYW 3Q23A 4DV3Q 1EWHA 3I73A 1I4XA 1KDAA 1VS0A 4F7XA 5I9OA 2F0GA 4XDXA 2PNHA 4HIOA 1WTVA 4A3EH 5KNDA 4NPSA 2KECA 1WD1A 1OXUA 5E4WC 4KY6A 4BBSH 2PO4A 2WAQB 3I2ZA 1IBML 1Q81C 5IYDH 1AW7A 5J3BA 3NBIA 2EDGA 3M4PA 3WWVA 3HOWG 1N8RC 5JOBA 4HN7A 1MD2D 1VQHA 1GUNA 1MJCA 3SE0A 2HDMA 1N32Q 2D0PA 3D6WA 5ISRA 1PZJD 5KYLA 5IGCA 1RODA 1EY7A 1HR0W 1LT3D 1QWYA 1ZYRC 4LF6Q 4RFBA 2NVQH 3TP6A 1BO0A 2N88A 4MN3A 1PTOF 3NPPA 3UI2A 5ELEA 2KCMA 1DGSA 3I4MG 3R3OA 4ULLA 3TRZA 4IPCA 1LTLA 4U86A 3E9HA 1A8VA 4K5XA 4HIDA 4AYBG 3CCSA 2CKZB 2EJMA 3VYRA 3VR3A 1Z7TA 2JXWA 3C1EA 1ICWA 1I3QB 1D5MC 3EBEA 5E7NA 3D6CA 1LTAD 2Z4IA 4EQNA 2YTYA 2AQ3B 2ZTEA 3PMFA 4OWWB 1LLRD 4LFAL 1GUTA 4KY7A 2D5DA 3FSCA 4BXXH 3BG3A 3MC0B 3M7NA 3QWNA 4UY8C 2B39A 1X3QA 3J7ZC 1TS5A 5FOBB 4DGZA 1I94L 3MXPA 2KOLA 3VYSA 1CA6A 3NXWA 4RGOS 3T1YL 2V1CC 1XX8A 3LWEA 3I4NG 1YNJD 1VQKA 2WACA 5M5WH 3GDEA 5EPLA 1OO9B 1SYCA 3OMGA 4L8JA 3L3OC 1W6JA 3NHHA 1K83H 3P20A 5FLXE 1XXGA 3M4QA 1KNAA 4YCVA 1NBWA 5EGTA 2A68D 1ET6A 5A2QL 1Y1VB 1SNPA 4DV3L 2EYMA 2IWHA 3RZDB 1CFMA 2A6HD 1PH8A 4GNXB 2JA7H 2NVTB 2ZXPA 5JEAJ 1PXUA 1BDOA 4BA2I 2FMCA 3J7AV 4A3MG 1BCPD 2K75A 5LHY1 3JAML 3GTMH 1QUQB 2WAQE 5ELDA 2D9UA 2EE1A 3CCLA 4MTNA 2ZXRA 5IWAQ 2F52A 1CK1A 5CV7A 1KLGD 1EY5A 4DR3L 1VMCA 2JA8B 1IKMA 1TY0A 2L9HA 4GLAC 1U4MA 1JR0D 1PH3A 2KEEA 3M3YH 1LT6D 5J39A 4YY3Q 5ELBA 4BY7G 1DOLA 2A69D 3OSOA 1HA6A 4IALA 1PRTF 1PINA 1YZ6A 5EAYA 2K6AA 1TWHB 4C2MH 4GOPC 1FNUA 3MCBB 2Q8IB 2XP4A 4IPGA 4QF4A 1WD0A 1EYDA 1YNXA 4AQYQ 1WTPA 1X32A 2RHQB 3F2CA 2RCNA 1XMOQ 2B2WC 1LTSD 4A3KH 3H3VH 4OO1I 1J5EL 3A5ZB 4R4TA 1EQTA 3SK4A 4ZLTF 4R4OA 2F0IA 3FHWA 5CV5A 4K8JA 2RDGA 4PV1C 4A3FB 5E65A 4FVMA 3C2PA 3KBXA 3ICEA 4NW2A 3DMUA 3H0GH 3K7AB 4A93G 3FMCA 4YHHQ 4V0BA 5JEAG 2B2WA 1Y1WG 2HD3A 2HHHQ 2X6GA 1TS3A 2Y0SG 3PO2B 1STYA 4C1NI 3W2DA 1TWCB 5IYBH 3KBGA 3HKZG 4JBKA 3VYTA 3GTJH 1PH5A 2Q2TA 4C3HB 4C3IH 1DM0B 4RAUC 1ILQA 3MQGA 4HMIA 2BA1A 3CRLC 1QB5D 2ZJPA 2I5HA 2GVBA 2GVAA 1VQAA 3GTQH 3A55A 1RL2A 2AWNA 2N55A 1QVGA 2Z9HA 3KADA 4DK0A 2XIWA 2UXCL 4G57A 2K4KA 2XP6A 2O5JC 1MSGA 3FVQA 4DXGA 4EQOA 3LE4A 2EYOA 3M85A 2O4XA 4DNIA 3GTGB 3MZ5A 1LO5D 2K5QA 3S24A 4C3JG 1VMPA 1EYAA 2F03A 1B53A 4A3IG 4A75A 3KF8A 1EQQA 1TWAH 1K9RA 4CKEA 2VS1A 1UEBA 3TZUA 1HR0Q 3WH0A 1N36L 3J81i 1VQPA 1HNZQ 3ND8A 5FO7B 3NQTA 2A6HC 1LYLA 5D3IB 2LSSA 5ELFA 3CF5A 3JAMc 1BCPC 4FDBA 4HEDA 5GAGC 5IODA 4BBSB 4LFBL 2IPKD 2R7ZG 1BOSA 2CW0D 4JG2A 1GXDC 3HOYG 1GOZA 4JI8Q 4DV1L 2ENBA 1PMRA 4TVAB 3HOXG 1JORA 5A2QE 2F0NA 3S17H 1II3A 1K8AC 5J22A 2K5HA 3HOZH 3KABA 5KEEA 4JI5Q 4X3SA 2VQFL 4A3BH 2SDFA 1ZCNA 2A69C 1G51A 2RSNA 5C4XG 2EQSA 3JAME 3W1BA 5JVG3 3TQYA 2NVQB 4MNOA 1PVOA 4KHPL 5EKKA 1O7LA 3M4OH 1R4PB 2ZR6A 3S1NB 5E64A 1GVPA 2GA4B 4PZ6A 1Q3LA 3FSBA 1PH4A 4ILWA 2QCPX 3SK8A 5BR8Q 1TIID 3PIPA 4G4KA 5FLMG 4QGUA 4ME5A 5C44G 3MEHA 4HAEA 1X56A 1D2BA 1Q46A 2DN8A 4XYOA 3NBHB 2R92H 3SK5A 1T5XD 3O13A 1KLUD 3JC66 3ULPA 1SFOH 1VQ6A 1EUJA 3D3RA 4N8FA 1A3VA 2DJYA 1UE1A 4XT3B 1D7QA 5KYIA 5C3EG 1IBKQ 1PYWD 3H91A 3QJYA 3U9SA 2F21A 1OXXK 1R4QB 5IT9E 4APVA 4X64Q 5M3MH 4RHSA 4OGQC 1LABA 2FMMA 5FKAC 1HH2P 3PGZA 4B3RL 2KA7A 3H94A 3MHBA 4NXMQ 3I72A 3U50C 4KMUC 1K3RA 2N49A 3K80C 2B63G 1TS4A 4OHJA 2XWBB 1NSNS 1WJJA 3TC5A 1H9SB 4IZ8A 2BH8A 1YJNA 3GTMB 4IFDJ 2UXBQ 1TKWB 3TDBA 1O7YA 5C0XH 4FO2A 4FXGC 1IXRA 2IX0A 4LJZC 4LF4Q 1KD1C 3V96A 4A3GG 4JI8L 5C6AA 1LT4D 3S1QB 3A74A 3RMHA 1SROA 3M3YB 1S4ZA 3TBIB 5C3WA 4DAMA 3RLFA 1YJ9A 2OQ0A 2ZQUA 1PFMA 3SGIA 1XYIA 4C2MB 1Z47A 3LX0A 5A35A 4QL5A 1TQOA 3RLNA 4ZKCB 2EYLA 4GN5A 3I4LA 3FPUB 2L5TA 1SMYD 3E0EA 3HOWH 4LF5Q 2E2IH 1I6VC 1K73C 1S5DD 1GUSA 1VF7A 4PMWA 4KJOA 4A3KB 1VQOA 4UDUC 2C5CA 5BR8L 5F2DA 4GKJQ 2Q2HA 5BN4A 5M5XB 1CTMA 1QG7A 1U4PA 2OEOA 1SJHD 4ABNA 1L2FA 4PMBA 3CMAA 1A63A 1UEAB 4DR4Q 3S2HB 4JI1L 3H0GB 2F4IA 3ZJYC 4LFCQ 1G8ZD 3NEMA 2MFIA 2RHSB 4FF1A 1A2UA 3I4MH 1IZ6A 2E5LL 4CBVA 1FL0A 2OWOA 1B70B 4E6IA 4KN7C 4P72A 3PCOB 1ENAA 1IYVA 4PZ7A 1B8AA 1HFGA 2YSIA 2H4OA 3KK7A 4NB3A 4OX9L 2DK1A 2DJGC 1S72A 2HDLA 2A19A 3WOFA 1BBXC 1STEA 2K52A 4HCSA 1F9SA 4ZUIA 2AUJD 3Q6SA 4IPHA 3AB9A 2ZQTA 1J6QA 2F3VA 4EQPA 4C3IB 2QDLA 1I4RA 2F0HA 5FO9B 3CRKC 1S3OA 4JPBW 2KHIA 1V1OA 3T51B 5U47A 5E1FA 4POFA 3GTQB 1JICA 1N33Q 1X55A 2ICIA 4X65L 3HP3A 1O6WA 2MUYA 3AQQA 3I91A 3MA2B 3Q8DA 1Q1EA 3ITPA 1ASYA 1VQ5A 3HOUG 4KD4A 5JJLA 5EQ0A 3CQZB 1WTRA 1M90C 4N9TA 1HNWL 4RWSC 3VA5A 2DMVA 2D62A 4JBJA 5JJKA 3FDTA 4LUOA 3L9AX 4NXNL 1SNDA 2UXDQ 3T16A 4J8QA 1SXTA 2B2VC 4A3MH 4DXFA 4B3ML 1SJED 3QG1A 2KQ3A 3Q24A 4U85A 1Y1VH 2EPBA 1AH9A 2F0PA 2VXWA 2PQAA 3VR5A 1STGA 2YU9H 3TS2A 2P5ZX 4DKAC 2XSCA 4DR5Q 2J7ZA 2R7FA 4O1NA 3S17B 4WFN3 3HOZB 2KCTA 1EIYB 5E5WA 1E7ZA 2IHEA 4R8IA 1WTOA 1I50B 1Q7YC 2VY3A 4KY5A
chains in the Genus database with same CATH topology
2NN6I 5IYCG 2MGSA 3KLSX 4H0LC 2OF1A 1JMQA 2F4VQ 3M4OB 1SMYC 1XTCD 3HG9A 2DY8A 2IHFA 1JB3A 2ICEC 4N9PA 2C35B 1MBYA 4IJHA 4HIMA 2NN6G 1IBMQ 3P1HA 4K14A 1L0YB 1PLFA 4DAYA 3T56B 3AMUA 2GN5A 3CC7A 1DYQA 1HTLD 4JC0A 1AFPA 3CHBD 4A93H 1CHQD 1XMQQ 2R92B 1XNRL 5JJIA 2AMCB 3W3AA 1SFOB 2OTLA 2SNSA 3C3LA 3OIQA 1KRSA 2R3ZA 4JI3L 1V1QA 1EWCA 3KFUA 4ME3A 1VQ8A 3Q0AA 2D2CC 3DWAA 3MTSA 4K6DA 2N3SA 2KCNA 5M3MB 1EEFD 1QVFA 1XTDA 3PO2H 5IGEA 1PTOD 4JI6L 4P73A 3ND9A 1K0RA 3EVQA 4LF7L 4DUZL 4B3TL 1SYFA 3PUZA 3VDYA 4QIBA 4BBRB 1KXLA 2R93G 3IFDA 4QMGA 1IBLL 2NTTA 4ZK9B 2ZXOA 3GTPH 2PZTA 1VQBA 4OWXB 2JYOA 1ESFA 2K50A 3I8ZA 1P16A 5J1ZA 5IGDA 3FKIG 1I94Q 4H7BA 1G2SA 2NBFA 3KUPA 2KJXA 2VZAA 4LMQD 3STBD 5HGTA 4LF8L 4KHVA 3TMEA 4HJAA 2MO0A 3ODKA 3DEOA 4X6AH 3R2TA 2NZOA 5IY0A 4DU9A 2ATWA 2F0VA 1EU3A 5DEHA 2VB2X 1Q8KA 4DAPA 3HOYH 1Y8NB 5GQOA 1PDQA 3FS8A 3HOWB 1ML0D 3HOXH 2MJ8A 2E2IB 2CQOA 3A8IE 2JA6G 4DR6L 2Z4HA 1RKNA 1B9NA 3FPPA 1M1KC 2F4VL 2JJQA 2I07B 4RMFA 1L1OA 1CZWA 1FD7D 2WB1G 4L6TB 2E75C 3ULLA 3DLLA 2F0KA 1U9RA 5K36H 3CU7A 4DR3Q 3RLOA 1NMGA 4RKBA 4I65A 3KF6A 2PNRC 1G91A 1XMQL 1SDFA 1B9MA 5DNFA 1AE3A 3PF4A 4M8AA 5JPNC 3I4MB 1EOVA 3KDFB 4BS9A 2J4XA 5C4HA 2UUAL 2MP1A 1XNQL 1SRUA 1EYCA 1PFNA 2E2JH 1OTCA 1PRTD 2VB3X 4AYBB 4JI4L 3DUZA 2EY1A 3UE0A 4AIMA 3HZXA 1NTGA 1BF4A 4L5TA 3S1NH 1EZ8A 1EG4A 1J5EQ 3C1FA 1KRTA 5CR3A 4G7OC 1BQQT 2QF7A 1LTID 1XPRA 4BA1I 4EQ5A 4JI0L 5M9OA 5GAEC 3OOBA 3U4ZA 3T1HL 2ZTCA 5C3EH 3KAFA 4KV6A 1UE7A 1WMVA 1IYUA 4REXA 5JAVA 2JP1A 3CW2C 5H1SE 3BZKA 2ZR5A 3D8GA 4X66L 5IP9H 5I6YA 1KQSA 1B4OA 4NKLA 3MFYA 1E2ZA 5E4XA 2B63H 3I56A 5LL6X 1X3GA 3CMEA 1QJOA 1TU2B 1PTOC 1PV4A 1VQNA 4QQBX 2EY2A 3CXCA 1V9PA 3H15A 1S5CD 3KLRA 4A3MB 4WJWA 1TR8A 4LWCA 5EKIA 4HJ8A 1TY2A 2PZWA 5EPJA 5D3DA 4B9WA 1FGUA 1HZ9A 2G9DA 4DR1L 2WAEA 4IUUA 1FNWA 1GD7A 4KD3A 3WOEA 3ZYYX 4P75A 1YI2A 1HCZA 1A3UA 1HHVA 2UXCQ 3BU2A 2F1MA 2M8JA 3K5OA 1C48A 1U4RA 3BYTB 2YU9B 1PHJA 4ZRZA 1GKHA 1F2ZA 2SOBA 3DXJC 1L0WA 2L4JA 4BY7B 2PI2E 5JPMC 3STBC 5IP7H 3BZDB 3J7YW 3K57A 3OPOA 1AE2A 4QB4A 3R8BA 3S1QH 3M7GA 4PG3A 5IGFA 1O7IA 1N36Q 4QCLA 1Y8PB 4LUVA 3KOJA 2LY7A 3I3CA 4FF4A 3H09A 2QGQA 1WFQA 1HA5A 4UPAA 3HS0C 5IGGA 3BVGA 1HUMA 2HIVA 1U5KA 1TS2A 2CCZA 4LFBQ 1QUQA 2XP9A 2JQOA 2EY6A 4X62L 3LKXB 5CC4A 1E1OA 4JOIC 3CAMA 2R6GA 1SYDA 3QOLA 3KAHA 4DV1Q 3GTLH 4GOPB 2F0QA 4K8IA 3OMCA 4H44C 4A93B 1QOHA 2AUKA 2K1BA 3NUCA 1IKLA 4F87A 1AZQA 5M5XH 1EG3A 2MQHA 1SNQA 2VQFQ 1FJGL 1Y1WB 1YNND 2PPBC 2EOTA 1JOOA 4IFDH 2F3IA 2Y0SB 3E0JA 5G3LF 4OO1G 3A5UA 4M1UB 3S2HH 5E66A 3SEBA 4JOIA 4YWLA 3HKZB 4KHPQ 4NMZA 3IKJA 3MCBA 2V4DA 4S3SA 4FF3A 2QILA 4PNYA 2Q2IA 1PRTC 1CKMA 2F0SA 1NR2A 1MI2A 1JWSD 1U4LA 2XRSD 3PSIA 2XP3A 3DEPA 2E2DC 2HT1A 1Q12A 4Q5VA 1LM0A 1JJCB 1JMCA 3S9WA 2JEBI 1DCZA 3QO2A 1V1PB 3EIVA 3CNGA 1PH9A 3GTPB 2EVBA 1MGSA 2WIIB 1ZKOA 3CC4A 2IW3A 4A3DG 4A3IB 2ZT9C 5NUCA 2CWAA 3W1GA 2F0FA 3BDOA 1V43A 3AU7A 1AN8A 3GTKH 4B3RQ 2OT2A 3CQZH 3PUWA 5EKLA 1S5ED 1SYBA 4DK1A 4QJFA 3HOVH 2Z0SA 1TWGB 4LUZA 3S15H 1VQ4A 3PUXA 5EPKA 2XRQD 1HQMC 3D4DA 2R7ZB 3EROA 1DZ1A 1TXYA 1PFBA 4OL7A 1Q82C 2E45A 4JBMA 1NR4A 3HOYB 3MVVA 1XPOA 2EZVA 2DY7A 2PCFB 3HOXB 4A0TA 1F9QA 3QIAA 4GN4B 1A62A 2EYHA 3QB3A 3D31A 4XYQA 2Q2UA 1DOKA 5ELCA 1C4QA 2BOSA 4CKCA 1SLJA 5C4XB 3K5MA 2EJFC 5D14A 2ZAJA 4YWKA 5IYCH 3CCUA 1B1ZA 2A8VA 1BCPB 2VQEL 1EY0A 3BDLA 4C1NK 1Q8IA 3BJUA 2B2YA 2CQAA 2VUMG 2RSOA 2ZR4A 1I50H 2AQ1B 2DNEA 4DV5L 1LTBD 3S2DH 2E2JB 2FXQA 4AH6A 1E0BA 5C44B 4F88A 1JJGA 3VA7A 2ITKA 4A3EG 1F8AB 2EY5A 5C3XA 4A4IA 2E76C 3SK6A 1PZID 2QKIC 1CKNB 2Z8LA 2D0OA 1IL8A 4Z9CB 4NDXA 4PQXA 2KHJA 3S1MH 1EU4A 5C3EB 4JI1Q 1YNNC 4QUFA 3UDFA 3KJPA 3ULJA 3BVZA 2E5LQ 4HSPA 2EYPA 3F2BA 3IFTA 4LF9Q 4ALPA 1STNA 4BY1G 3GV6A 4KK7A 1NAPA 2E8GA 4DN4M 4OX9Q 3I4OA 2B63B 1K8OA 3DWPA 2G9HD 3C46A 1L0XB 1WTXA 2B8FA 3HFZB 1HPCA 5JJZA 5GAHC 2I5LX 2L0CA 1HFNA 2O5IC 2VNUD 3NBHA 1E3PA 3N52A 4R9WA 1XJVA 3S1RB 2WADA 4BBRH 2OTJA 3L2PA 4X65Q 3EA6A 1A0IA 1F77A 4A3GB 3F1ZA 2NVXH 2K01A 3AYHB 4JYAL 2OCEA 1FLCA 4BXXG 1SNOA 4DPGA 5E3FA 1HNWQ 1HNXL 3T13A 3OHXC 2E2HH 1CHPD 1E24A 2I0QA 3K5NA 3PUYA 1KDCA 4NXNQ 2EXZA 2F3WA 1BR9A 1H9KA 5D65A 1WTQA 1EIFA 4RGTA 1VQGA 4B3MQ 1A3TA 2K04A 3UDIA 5CBAE 3TP8A 1H9SA 3RUZA 3K0YA 1QNUA 1C8CA 5LMNL 2VL6A 1IW7D 1HZAA 3CCVA 3RNUA 2JA7G 4TSSA 2B2TA 2LAJA 1S5FD 3KCEA 4B9XA 3T4AC 1GM5A 2JMFA 4FYDA 4DFAA 2F0TA 4YIJA 4EGVA 4JBWA 3GTLB 3OOCA 4P74A 3G6EA 3J80i 3FRPB 3S16H 2YAJB 2Y8NB 3H3VC 1X6OA 1DD2A 2CHBD 3MXUA 3TCZA 4IUPA 5EBDA 2BDOA 1RCVD 2JA5G 4DV2Q 1MJEA 1OXVA 2AQ2B 1TK7A 4LF9L 4JK1C 1Z9FA 3IL8A 2ZM6L 5C4JB 5C5LA 1UWVA 2K14A 3H3VI 1UUPA 3TN2A 4K2KA 4P2CB 4DUYQ 1YIJA 1H9MA 2YYZA 1WVLA 1CM9A 3NWTA 4IFDI 2XVSA 1XNRQ 1KC8C 2DNCA 4DV6L 5T1IA 4XXEA 4JI3Q 1A15A 1KTKA 3TSSA 2HCCA 3HOUB 5JVH3 2F0DA 4IUNA 3J81c 4RGMA 4F8MA 3DM1A 1SR3A 3I4NH 1CKOA 2N78A 2X6LA 4J1MA 4H13C 3PF5A 3GTOB 1HUNA 1UAPA 4KHZA 4XQQA 1AZPA 3TS0A 4WJ4A 1IL2A 5LMUQ 4JI6Q 3GTKB 1D1IA 2ALYB 2MHVA 4G7ZC 3HOVB 4KN4C 2K03A 2DUDA 5IYBG 4DUZQ 4B3TQ 3S15B 4LF7Q 1LACA 5AHTA 4HJ9A 3KAGA 3OTOL 4GS3A 1TVXA 1IBLQ 5IOCA 1JOQA 3PUVA 1ENCA 2R7DA 5AJ3L 3RN5A 1PTOH 3L7ZC 3EJIA 1I5HW 3NP8A 1K9MC 4R8NA 1YJWA 2IY5B 1VQFA 4FXDA 2NTSA 5CV4A 4LF8Q 4BY7H 4K6LA 4UP7A 4ZKBB 4UAIA 1RJTA 1LTRD 2E74C 2ZTDA 1R9TH 1PH2A 1YHAA 4GLVB 4LNQA 1B50A 3V2TA 4U84A 2SEBD 3S14B 1EYGA 3S2DB 5I2YA 5KNCA 1M4VA 4DV2L 4DR6Q 1IW7C 1EOTA 4X3KA 1SBBB 1ESRA 5IIFA 3DWQA 2MDIA 4HCEA 4CJ1B 4DUYL 5CMDA 2SNMA 4O2DA 4WRDA 2WFWA 1RTOA 1WCMG 3S1MB 1QE6A 4Y7NH 1K8GA 2NZHA 5JEAH 1O80A 2KENA 1Y1WH 2WINB 2FHTA 3MXNB 2UUAQ 4XIGS 4A3BG 5CORA 5BN3A 3ERSX 1XNQQ 2M9VA 4A76A 2ZQVA 3NELA 4JI4Q 2HCIA 1LT5D 3EFXD 1GJXA 2L12A 4B3SL 1H9JA 1HRJA 4JI7L 2R93B 1I4GA 5CGKA 5KIXA 3PIO3 4YWMA 4PZ8A 5LMUL 2OQKA 3AEVA 1F9RA 2LS01 3A54A 4JI0Q 4A3JG 5FLXL 4C56C 3T1HQ 1NY4A 2PW5A 3PO3G 4A3LG 2KHSA 3GV3A 5M5YB 1D1KA 4A3CG 2A74C 2A1AA 4P71A 2NVXB 1VQLA 1SMXA 4X66Q 1GO3E 1Y8OB 1SNCA 2KUMA 4MIUA 4ZQ3A 4C3JH 3CCRA 5M3FG 3I7FA 4A3IH 3NENA 3OWEB 3NK9A 1PH7A 2E2HB 4Q0FA 5E62A 2KVMA 2HIXA 4OXPA 3NTIA 4JI2L 1ZEQX 3M9BA 2BDNA 1JE4A 4K5WA 3MEFA 2B2UC 2F0JA 1L1OC 4HTHA 2JA6B 1TWGH 4R4IA 1QZGA 2OXPA 4O42A 1VQDA 4DR1Q 2HUGA 3Q22A 3G48A 2R7ZH 2WB1B 4B08A 4DNTB 3NTKA 5ELNA 5K5PA 1MIUA 5C0XI 3NTHA 4HJ5A 4R1JA 1X3PA 5DAUA 5CYUA 3I55A 1UE6A 1EL0A 1FR3A 1TT2A 2B2UA 2WKCA 3UE1A 3CPWA 3GO5A 5TSSA 4DV4L 3S16B 3KF6B 4KI0A 5GROA 5C4XH 3KLSA 1VCIA 2BCOA 2NVYH 1PYSB 1RTNA 1KIXA 4GLXA 1PH6A 1G6PA 2B8GA 2F0EA 3OIPA 4NP5A 3U4VA 3SHLA 2UU9L 2Q8RE 4I7ZC 1VQ9A 2NYZD 4IOCA 4X62Q 2K5NA 5FLMH 1X65A 5C44H 2F0LA 1BKBA 2QEXA 1STHA 1RDPD 1FGBD 2L15A 2PI2A 2RDFA 3K5LA 2Q5AA 3BDCA 2K05A 3RZOB 4FNFA 2ASBA 2ES2A 4K0KL 2JX8A 4J15A 3NQIA 1VQCA 2PYKA 2WAQG 3NTPA 3FP9A 1FJGQ 4BY1H 1JJ2A 1W3SA 3JAMi 1KAWA 4RH6A 4XTCS 3KDFA 3D0FA 2M8IA 3J7A5 3VR6A 3I4NB 1NUCA 4IUTA 4DF7A 5G3LD 4DK3C 4O0AA 1S5BD 5LMNW 4EVOA 2LMCB 3K6OA 2JV4A 3E9IA 1N9WA 3B6YA 2L1BA 4KJNA 1ONLA 3P7JA 5FLXc 1LV9A 3I70A 4HJ7A 4RCOA 4CKBA 4DV0L 3MAQA 4RHRA 4RKLA 1JC7A 1SE3A 1N34Q 3S1RH 2WB1E 4JCVE 1WOCA 4DV7L 1YITA 1PTOB 4DNRB 1YVCA 1ILPA 3ONAB 4A3GH 5CV6A 1B3AA 1JCKB 3RN2A 3IRBA 4RA8A 2KEDA 5DLQE 4GNXC 1QCBD 3SXHA 3G71A 1S40A 1PFSA 3RD4A 1DONA 1R9TB 4DR7L 1DJRD 3K7UC 2RDHA 3KLWA 2NWGA 1EY8A 4IO9A 3U58A 3DM3A 2H1EA 4IQZA 4FXKC 3SR1A 4RCNA 4IUVA 1T5EA 4GNXA 1PH1A 1LTTD 1Q90A 2K5WA 2WKDA 1Y1VG 3TP7A 1IHZA 2NZ1D 3K58A 1SYEA 1FVIA 2RE3A 3ERQA 4AYBE 2HQEA 1WR7A 1K9QA 1TR5A 3K59A 2YSGA 2JA5H 5COYA 2CFMA 2LKVA 5I4DA 4QIWB 2L55A 1N32L 4Y7NB 4IURA 3MQHA 3RR5A 3G7LA 2VQEQ 3SVMA 5CV8A 4K2LA 2JA8G 3AFPA 3UDGA 4DV5Q 4LF6L 1NMVA 4JV5Q 4G7HC 1W2BA 1GHJA 3M4YA 4IJLA 1O7ZA 3LKXA 1H9RA 1ENFA 5HURA 2H5XA 5C4JH 5IT9L 5FJ8G 1RHPA 4GOPA 4ID6A 1CQFA 3A56A 1TWFB 2M3OW 3P75A 3CCQA 4A3DB 1PRTB 2XN9C 4YCUA 4OWTB 1I4HA 2MPMA 4CJ2C 1WYDA 1STAA 4ZYSA 4A3FG 3HOUH 1E2WA 1SYGA 2KXQA 1BBWA 1N34L 1NCVA 3K8AA 1CZGA 3BVMA 4HMJA 2IJ0A 3LGJA 4C3JB 1B2TA 1WI5A 4IOAA 3HKSA 4DA2A 1I6HB 3BS1A 3GTOH 3D4WA 4LW1A 3CCMA 2PZUA 1H95A 2AKWB 1RIPA 3KF8B 1B7YB 4DK6C 1F2LA 4XQNA 3PO2G 5LL6S 2XPAA 1O78A 4KKUA 1BCPF 1I4PA 1QNKA 2K5VA 2AWOA 3I90A 4YCWA 2VW9A 1V1PA 4U68A 5FO8B 1D6EC 4C3HG 4POGA 1HZCA 1YEZA 4TQUS 1VQIA 2DWVA 4JYAQ 3CD6A 2F0UA 2XGTA 1GUGA 1JOKA 1HZBA 4HIKA 2B2YC 1CQVA 1SSOA 1YNJC 2F0WA 5IWAL 1SEBD 1U0LA 1HNXQ 1VDZA 1KL9A 4QY7A 2XP7A 2KCCA 2I5MX 2VUMB 1CA5A 1YW5A 3TDQA 1UNSA 2NVYB 1UE5A 3TREA 1D5XC 2A68C 3VR2A 4QIWE 2RVLA 4YY3L 1CI3M 1QILA 4FF2A 2X69A 3BZCA 4A3EB 2BE5D 1YBYA 2Y0SE 1JB7A 1EIHA 2NN6H 3S14H 5LMNQ 1VQ7A 3HKZE 1ZXTA 4JV5L 1VQJA 3TZDA 1XPUA 2K7VA 1EWIA 2RQXA 4AQYL 5KGUA 3PIOA 5AFWA 2YTXA 1BVSA 1WCMH 5HGQA 1XMOL 3N6RA 1BUVT 5BN5A 4IPDA 1Q86C 2CWPA 4KKSA 1V8QA 3CKIB 4BBSG 5I9PA 5IYDG 4BY1B 2XP5A 5K36G 1BBUA 1EFWA 2RBMA 1RF2D 3PV0A 1PYBA 3LWUA 4L63B 2C9OA 4OIJA 2IX1A 1XWEA 4GN3B 1CSPA 4YHHL 2JA9A 1EY6A 2LXJA 3J81L 2HHHL 3U9OA 2ZM6Q 3OW2A 1STBA 1BNZA 1KNEA 5IT9c 2PW7A 4A3JH 1EQVA 3T53B 3PO3H 4A3LH 1CKNA 4WJ3M 1NE3A 4L5RC 2QDBA 5T1GA 2R93H 3NWSA 4A3CH 4OONA 3R2IA 2WV6D 4DV6Q 2JXMB 1T9HA 5CQ2A 4GKKQ 2EJGC 5M3FH 1GHKA 3FKIH 1JWMD 1MKHA 5M5YH 1RP5A 1CT1D 4E5RA 4BWGB 4CHTB 5HY6A 1B44D 5M5WB 3DHQA 3A0JA 2KBNA 5IP9G 4CJ0B 1K83B 3HEJA 1I5FA 2EZ5W 1OXTA 1C7YA 2DGYA 2B2TC 2YSHA 3SDZA 1RD9D 2F0MA 1HR0L 2A6ED 4QUCA 1KHIA 5I2XA 3OTOQ 1NJIC 2JA7B 4MZ9A 1I4QA 1HNZL 2UUCQ 3CPFA 2ZJQA 2JA6H 4R4CA 2R61A 5CBEE 5AJ3Q 3R93A 1GUOA 2L11A 1C0AA 3KYHC 2JE6I 2Q8TA 3IAYA 1D5ZC 5C4ZA 1E2VA 4KLKA 2PMZB 2JA5B 1J8IA 3AFQA 2B29A 2F0OA 4JI5L 1F2MA 5IP7G 1Z6HA 3HRZC 5I6WA 1JQYD 1HTPA 4ODGA 2PQEA 3F2UA 1VF5C 2BE5C 3OWFA 5KRUA 3BYYB 2QRVA 3A7LA 1SN8A 2N8NA 3KJOA 2B3GA 2DK7A 1F2YA 1KDBA 2CW0C 5FK9C 5IE8A 3PQHA 5GADC 3TP5A 1CSQA 2LFNA 4DAVA 1VQMA 3J81j 2LXKA 4L5SA 2RKSA 4L5QA 1JWUD 1J9OA 1SAPA 2M00A 3RZOH 4A3KG 1G291 3HGBA 4H02A 3G6JB 1E22A 2HQLA 4GKKL 1JE5A 4IFDG 1EZ6A 4RGNA 4XT1B 2CVRA 1Y14B 2ZJRA 3H0GG 1IBKL 4B3SQ 1BXTA 4X64L 2IT1A 5DM73 2EXDA 4JI7Q 3GTJB 2ZQSA 2QA4A 1M8AA 4KTAA 3G4SA 1EY9A 1Q1BA 2FINB 2XNAC 1EEID 2EYFA 3H6MA 1CUKA 4NXML 2A5HA 3VYUA 1I3QH 2UUBQ 3J80L 4HSVA 1VQEA 3J81E 4C3IG 1EQRA 3MFGA 2UUCL 1SE2A 1A2TA 2J0TD 3X3MA 1QVCA 2K28A 2PQAB 1YHQA 4HR7B 2UXBL 1JT8A 2K5DA 1G2TA 4LF4L 2XPBA 5EJWA 2IX3A 2MNAA 1MSHA 2PMZE 3LNNA 4JI2Q 1K8MA 1TWAB 3CCJA 2JEAI 3CCEA 1HJPA 4U673 3ER0A 3URYA 1SE8A 1X3FA 1FYCA 2A6EC 3HOVG 2M2LA 3K81C 3W5OA 1AP0A 3F8TA 3RZDH 4EX5A 4IN3A 3E5SA 3A7AB 4X3TA 2NVTH 1ASZA 4DR2Q 2FJ2A 4V190 2JK8A 2XP8A 1PA6A 2XTIA 4LF5L 1PZKD 4ZAIA 3VR4A 3TEHB 1KAAA 2YTVA 4DAYB 1WCMB 2Z1CA 2B2VA 4K5VA 1SE4A 2BA0A 2EYJA 5CV9A 2YSFA 2XWJB 4DV4Q 4UP8A 4GKJL 1HXYD 2JA8H 1NMFA 5ELOA 4A3BB 3CC2A 4OO1H 1A6XA 5DM63 1DXMA 1X3EA 2ID0A 4J6HA 4DR4L 1DOMA 1OXSC 5KNBA 4LFCL 1F9PA 1TWHH 1ZYRD 1HQRD 3J7AF 1LUZA 3HOZG 5FJ8H 2K33A 2UU9Q 2I46A 1EFID 3X3NA 1E1TA 3F2DA 1QZHA 4LK1C 4ZUJA 4TKOB 4A3JB 3KAIA 3PO3B 3D4RA 2NUCA 3WDNA 3CP0A 4WORA 4KKTA 4A0UA 4K0KQ 5C0XJ 3NSWA 1EIGA 4A3FH 4XQJA 3UDXA 2TSSA 3E6ZX 1X54A 3FEWX 3EN2A 2RA4A 1TWFH 4IUQA 4A3DH 2UUBL 5M3FB 4MHEA 3FKIB 3K7AH 1FNVA 1N33L 2TMPA 1LTGD 3MXNA 4RG1A 2R92G 3OW7A 1ET9A 2EIFA 4CGYB 2IL8A 1W6KA 2QEJC 1GUWA 2MO1A 1P8LA 1EY4A 2Z6KC 4X3UA 1YHBA 3K0XA 1TWCH 1I6HH 1G6ZA 1D8LA 4C3HH 4TRDA 4OIKA 2K32A 5IGBA 3PIP3 5M3MG 5C5MA 3J80c 2WP8J 2UXDL 3L4HA 1KABA 3V05A 1C9OA 2YV5A 3A8KE 4DV0Q 2RF4A 2BH2A 4LFAQ 4GZYC 3GQBA 3MXGA 1SNMA 3OYYA 2FFKB 4LAAA 2Z6KA 4DV7Q 4UP9A 3GD7A 3GP7A 4Y52H 2NB0A 3NE5B 4BBRG 1Y69U 4DR2L 2AHOB 3T1YQ 4R4QA 1L1OB 2A73B 3GTGH 1WTWA 3QOJA 1X9NA 3EQLC 3L0OA 4FP5D 1IYJB 4PMCA 4DR5L 3J80E 2O2LD 5EBCA 1AEXA 5C0XG 2JSOA 4DR7Q 2L4NA 3A8JE 2YSBA 2VUMH 3MWYW 3Q23A 4DV3Q 1EWHA 3I73A 1I4XA 1KDAA 1VS0A 4F7XA 5I9OA 2F0GA 4XDXA 1WTVA 2PNHA 4HIOA 4A3EH 5KNDA 4NPSA 2KECA 1WD1A 1OXUA 5E4WC 4KY6A 4BBSH 2PO4A 2WAQB 3I2ZA 1IBML 1Q81C 5IYDH 1AW7A 5J3BA 3NBIA 2EDGA 3M4PA 3WWVA 3HOWG 1N8RC 5JOBA 4HN7A 1MD2D 1VQHA 1GUNA 1MJCA 3SE0A 2HDMA 1N32Q 2D0PA 3D6WA 5ISRA 1PZJD 5KYLA 5IGCA 1RODA 1EY7A 1HR0W 1LT3D 1QWYA 1ZYRC 4LF6Q 4RFBA 2NVQH 3TP6A 1BO0A 2N88A 4MN3A 1PTOF 3UI2A 3NPPA 5ELEA 2KCMA 1DGSA 3I4MG 3R3OA 4ULLA 3TRZA 4IPCA 1LTLA 4U86A 3E9HA 1A8VA 4K5XA 4HIDA 4AYBG 3CCSA 2CKZB 2EJMA 3VYRA 3VR3A 1Z7TA 2JXWA 3C1EA 1ICWA 1I3QB 1D5MC 3EBEA 5E7NA 3D6CA 1LTAD 2Z4IA 4EQNA 2YTYA 2AQ3B 2ZTEA 3PMFA 4OWWB 1LLRD 4LFAL 1GUTA 4KY7A 2D5DA 3FSCA 4BXXH 3BG3A 3MC0B 3M7NA 3QWNA 4UY8C 2B39A 1X3QA 3J7ZC 1TS5A 5FOBB 4DGZA 1I94L 3MXPA 2KOLA 3VYSA 1CA6A 3NXWA 4RGOS 3T1YL 2V1CC 1XX8A 3LWEA 3I4NG 1YNJD 1VQKA 2WACA 5M5WH 3GDEA 5EPLA 1OO9B 1SYCA 3OMGA 4L8JA 3L3OC 1W6JA 3NHHA 1K83H 3P20A 5FLXE 1XXGA 3M4QA 1KNAA 4YCVA 1NBWA 5EGTA 2A68D 1ET6A 5A2QL 1Y1VB 1SNPA 4DV3L 2EYMA 2IWHA 3RZDB 1CFMA 2A6HD 1PH8A 4GNXB 2JA7H 2NVTB 2ZXPA 5JEAJ 1PXUA 1BDOA 4BA2I 2FMCA 3J7AV 4A3MG 1BCPD 2K75A 5LHY1 3JAML 3GTMH 1QUQB 2WAQE 5ELDA 2D9UA 2EE1A 3CCLA 4MTNA 2ZXRA 5IWAQ 2F52A 1CK1A 5CV7A 1KLGD 1EY5A 4DR3L 1VMCA 2JA8B 1IKMA 1TY0A 2L9HA 4GLAC 1U4MA 1JR0D 1PH3A 2KEEA 3M3YH 1LT6D 5J39A 4YY3Q 5ELBA 4BY7G 1DOLA 2A69D 3OSOA 1HA6A 4IALA 1PRTF 1PINA 1YZ6A 5EAYA 2K6AA 1TWHB 4C2MH 4GOPC 1FNUA 3MCBB 2Q8IB 2XP4A 4QF4A 1WD0A 4IPGA 1EYDA 1YNXA 4AQYQ 1WTPA 1X32A 2RHQB 3F2CA 2RCNA 1XMOQ 2B2WC 1LTSD 4A3KH 3H3VH 4OO1I 1J5EL 3A5ZB 4R4TA 1EQTA 3SK4A 4ZLTF 4R4OA 2F0IA 5CV5A 3FHWA 4K8JA 2RDGA 4PV1C 4A3FB 5E65A 4FVMA 3C2PA 3KBXA 3ICEA 4NW2A 3DMUA 3K7AB 3H0GH 4A93G 3FMCA 4YHHQ 4V0BA 5JEAG 2B2WA 1Y1WG 2HHHQ 2X6GA 1TS3A 2Y0SG 3PO2B 1STYA 4C1NI 3W2DA 1TWCB 5IYBH 3KBGA 3HKZG 4JBKA 3VYTA 3GTJH 1PH5A 2Q2TA 4C3HB 4C3IH 1DM0B 4RAUC 1ILQA 3MQGA 4HMIA 2BA1A 3CRLC 1QB5D 2ZJPA 2I5HA 2GVBA 2GVAA 1VQAA 3GTQH 3A55A 2AWNA 1RL2A 2N55A 1QVGA 2UXCL 3KADA 4DK0A 2XIWA 4G57A 2K4KA 2XP6A 2O5JC 1MSGA 3FVQA 4DXGA 4EQOA 3LE4A 2EYOA 3M85A 2O4XA 3GTGB 4DNIA 3MZ5A 1LO5D 2K5QA 3S24A 4C3JG 1VMPA 1EYAA 2F03A 1B53A 4A3IG 4A75A 3KF8A 1EQQA 1TWAH 1K9RA 4CKEA 2VS1A 3TZUA 1UEBA 1HR0Q 3WH0A 1N36L 3J81i 1VQPA 1HNZQ 3ND8A 5FO7B 3NQTA 2A6HC 1LYLA 5D3IB 2LSSA 5ELFA 3CF5A 3JAMc 1BCPC 4HEDA 5IODA 4BBSB 4FDBA 5GAGC 4LFBL 2IPKD 2R7ZG 1BOSA 2CW0D 4JG2A 1GXDC 3HOYG 1GOZA 4JI8Q 4DV1L 2ENBA 1PMRA 1JORA 4TVAB 3HOXG 5A2QE 2F0NA 3S17H 1II3A 1K8AC 5J22A 2K5HA 3HOZH 3KABA 5KEEA 4JI5Q 4X3SA 2VQFL 4A3BH 2SDFA 1ZCNA 2A69C 1G51A 2RSNA 5C4XG 2EQSA 3JAME 3W1BA 5JVG3 2NVQB 3TQYA 4MNOA 1PVOA 4KHPL 5EKKA 1O7LA 3M4OH 1R4PB 2ZR6A 3S1NB 5E64A 2GA4B 1GVPA 4PZ6A 1Q3LA 3FSBA 1PH4A 4ILWA 2QCPX 3SK8A 5BR8Q 1TIID 3PIPA 4G4KA 5FLMG 4QGUA 4ME5A 5C44G 3MEHA 4HAEA 1X56A 1D2BA 2DN8A 1Q46A 4XYOA 3NBHB 2R92H 3SK5A 1T5XD 3O13A 1KLUD 3JC66 3ULPA 1SFOH 1VQ6A 1EUJA 3D3RA 1A3VA 2DJYA 1UE1A 4XT3B 1D7QA 5KYIA 5C3EG 1IBKQ 1PYWD 3QJYA 3H91A 3U9SA 2F21A 1OXXK 1R4QB 5IT9E 4APVA 4X64Q 5M3MH 4RHSA 4OGQC 1LABA 2FMMA 5FKAC 1HH2P 3PGZA 4B3RL 2KA7A 3H94A 3MHBA 4NXMQ 3I72A 3U50C