3M85A

Archaeoglobus fulgidus exosome y70a with rna bound to the active site
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
179
structure length
179
Chain Sequence
MRFVMPGDRIGSAEEYVKGEGVYEEGGELFAAVAGKLIIKDRVAKVESISPIPEIVKGDVVLGRVVDLRNSIALIEVSSKKGENRGPSNRGIGILHVSNVDEGYVKEISEAVGYLDILKARVIGDNLRLSTKEEEMGVLRALCSNCKTEMVREGDILKCPECGRVEKRKISTDYGKGEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Quantitative analysis of processive RNA degradation by the archaeal RNA exosome
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase/rna
molecule keywords Putative uncharacterized protein AF_0206
total genus 36
structure length 179
sequence length 179
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10447 EXOSC1 Exosome component EXOSC1/CSL4
A PF14382 ECR1_N Exosome complex exonuclease RRP4 N-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3m85A03
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3m85A01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3m85A02
3DLLA 2BE5C 1ASYA 3H94A 1PYBA 2DNCA 4C3HH 1PMRA 4P75A 2HQLA 4BXXG 1H9SA 1YNNC 3TS2A 3HGBA 1IXRA 4LJZC 3HOXH 3W1BA 1HTPA 4IPCA 4DNIA 2Q2UA 3CP0A 4LUVA 1QUQB 4JV5L 4BY1G 3IKJA 3J80i 4NB3A 1FL0A 3HOXG 2XP5A 3A7LA 1YBYA 1FJGQ 5JJKA 4QY7A 1E24A 1N36L 4L5TA 1SR3A 3G48A 2ID0A 3SE0A 3CC2A 3UDGA 4B3SL 3KLWA 1VQLA 2E5LQ 4DAMA 1N32Q 2H5XA 1EUJA 1JE5A 1VQ6A 3HOUH 4DR2Q 4JI0L 1HNZQ 5JJLA 3DM3A 1BVSA 4GNXB 2GN5A 4LFCL 2UXCL 4JI7L 5J3BA 2A68D 2A6EC 4HJ9A 1CI3M 4JI7Q 4LFAQ 4J15A 1YJNA 1IYVA 4LUZA 3CAMA 1E3PA 3S1MH 1E2WA 1Z7TA 4DK1A 4DV6Q 2JA6G 3CCRA 4ME3A 4ALPA 3G6EA 4JK1C 4DUYQ 3E9HA 1VQOA 2JA7G 3K80C 1PHJA 2WAQE 4JI6Q 4DV6L 4UP8A 1JMCA 4JBKA 2IT1A 4BY7H 3K0XA 3CC7A 1R9TH 3W5OA 1NMVA 4DV2L 2Z6KA 2ZQVA 1Y69U 4AH6A 4AIMA 3T1YQ 4JI2L 2F4VQ 3CPWA 3HFZB 2JA5G 3M4QA 3S15H 1KRTA 4A3CG 1IBKL 2ES2A 3G4SA 1X56A 5IYCG 1XJVA 2HIXA 1GUSA 2N49A 4PZ6A 2AHOB 4LF9Q 4GOPB 1WR7A 3F1ZA 5IYCH 2E74C 3LE4A 2JEAI 2F21A 1NTGA 4GLAC 4DK0A 1HQMC 3K7UC 2HIVA 2ZJRA 2XP8A 4DR5L 2N8NA 1I6VC 4RG1A 3QIAA 2NN6I 2N3SA 2KBNA 4POGA 4JI3L 2F3IA 2K52A 1UE1A 3GTMH 4A3GH 4OO1H 2PQAA 3PGZA 3FHWA 1UWVA 1OXUA 4H13C 1N9WA 1IL2A 4OX9Q 1QVGA 3RNUA 4HJ7A 3AEVA 4KN4C 2BA1A 3L7ZC 1TWAH 3KDFB 2C35B 4DV1Q 3LWUA 1DGSA 4HIMA 3JAMi 3ULLA 2PMZE 3ULPA 3KF8B 2LXKA 1N34Q 5LMNW 2UUCL 2UUBQ 1I94Q 1HPCA 3OYYA 1A63A 5M5XH 3A5ZB 4GLXA 3U9SA 3HOWG 1AE3A 2F52A 1EOVA 3FMCA 2L4JA 5FLMG 2UUBL 1Y8PB 1YIJA 4KI0A 4B3SQ 2UXCQ 3HOYH 1HZBA 3RLFA 3PSIA 1A8VA 3H3VH 1SMYC 5IP9H 1CKNA 1VQ8A 3T51B 5C4JH 1JJCB 1B9NA 1WOCA 2Y0SE 2WFWA 3GTKH 3MXUA 3BJUA 3QJYA 1NE3A 1Q46A 1VQIA 4KKSA 3LNNA 1L1OC 3HOVH 2IY5B 4BXXH 2ZM6Q 3PO3G 4RCNA 4DUZQ 2I5LX 4MTNA 2M8IA 4JG2A 2ZQTA 4X62L 4X65Q 3RLOA 1VF5C 1XMOL 3OOBA 1BBUA 2VL6A 3CCJA 1X54A 2B29A 1I3QH 2AWNA 4UP9A 1NMGA 1OXSC 4APVA 2IX0A 4O0AA 4IPDA 3U50C 2QF7A 2R92G 1W3SA 4JOIA 2ZAJA 3STBC 5LMUQ 3FPPA 4U84A 4GOPC 2YTVA 5BN3A 3CD6A 4GNXC 3U4VA 3M9BA 3GDEA 3NTPA 4TQUS 1PH7A 1CKMA 4DR3L 4B3ML 4OO1G 4G7ZC 2LXJA 2PNRC 4A3FH 4PV1C 3KAIA 3A0JA 3GD7A 4YCVA 4EX5A 1A6XA 2YSGA 1IBML 1Q90A 2K5NA 2VUMG 2B8FA 1TWGH 3CCUA 2E2IH 2DMVA 1WI5A 1NY4A 2KHJA 4GOPA 3TCZA 1C0AA 1K8GA 4NPSA 1X65A 2VQEQ 4PZ7A 2NZOA 1NBWA 1K8OA 1EYGA 3I55A 2BDOA 4DR3Q 4L5SA 3S1QH 1VQNA 1MKHA 4AQYL 4Y7NH 2B63G 4A3KH 4LFBL 1JJ2A 4YWLA 1KIXA 1KC8C 3MXNB 2JA8G 1YNJC 1V8QA 1RL2A 1N34L 2Y0SG 3EBEA 4NXNQ 4GKJQ 5GADC 3FKIH 4HIOA 1SLJA 4DK3C 3CRKC 2JA9A 2RE3A 4X66L 3S24A 1ZCNA 2ITKA 3CC4A 2XP4A 4GLVB 3F2CA 1JMQA 2RF4A 3ER0A 1DXMA 2JK8A 3PIPA 1MJEA 1VQEA 4YWKA 3KJOA 2D2CC 2YSFA 1S72A 1V1QA 2VUMH 1MIUA 1S3OA 2Q8IB 3RZDH 4HIDA 1XMQQ 2ZJQA 1PH2A 3GTGH 1CUKA 2IHEA 3J81j 4JYAL 4WJ4A 1WMVA 4LW1A 2EDGA 5GQOA 4GKKQ 4P71A 5ELNA 1CKNB 3K8AA 4YCUA 4KKTA 5C0XG 1I5FA 3OW2A 3MFYA 5C44G 1HCZA 2YSIA 1TKWB 2A6ED 3F2BA 1QVCA 1VF7A 4HIKA 4GZYC 3GQBA 2PQAB 3KAGA 1VQKA 4H02A 5BR8L 4OGQC 1EG3A 3I4OA 1G6PA 3KABA 1VQCA 3HKSA 3KADA 2BH2A 1PFSA 2WP8J 3DXJC 4IFDG 2Q2IA 3S17H 4IOAA 4L5RC 3PF4A 4A93G 1HNZL 3HOYG 3SDZA 3KDFA 2XPBA 1L2FA 3A5UA 2MNAA 1RIPA 1N32L 1XPUA 1B70B 2V1CC 3I56A 2LAJA 3CMAA 1VQMA 1N36Q 1QUQA 2ZJPA 1IBMQ 2F4VL 4A3DH 3TDBA 1B8AA 3OPOA 1WYDA 1TWHH 3NBHB 4DR4L 1FGUA 5H1SE 2KCTA 3AB9A 4GN4B 1MJCA 4A3KG 5JEAJ 4C3JH 1PH4A 2LMCB 1UE7A 4OWWB 4A76A 3GTLH 3AFPA 4PZ8A 3CXCA 2YTXA 2EIFA 2I5MX 1YHBA 2R93H 2ZQSA 1A62A 1S40A 4PMWA 4LF8L 5BR8Q 3J80c 4JBMA 1Y1VH 1IW7C 2EJMA 4BA1I 2K14A 3NEMA 4YHHQ 1B7YB 2EJGC 2A6HC 4LUOA 2D0PA 4BBRG 4A3EH 4JI4L 4DR6L 4R4OA 1YHQA 2ZM6L 4DR5Q 2JA5H 1VQDA 3ND9A 1GM5A 4H0LC 4X64Q 1PH3A 2DNEA 4LF4L 2LSSA 5IP9G 3D31A 3KCEA 2KENA 3PUYA 3OOCA 3M4PA 1EG4A 2D0OA 4X66Q 1K3RA 3G71A 5C3EH 4JI1Q 4DV4Q 1Y1WG 1J6QA 3CW2C 2EVBA 2PI2A 1OXXK 1VDZA 4A4IA 2CKZB 1LM0A 2ALYB 2CQOA 1HR0W 1HJPA 4P73A 4LWCA 4E5RA 3P20A 1K9RA 3CCSA 3KAHA 3UE1A 2A19A 1PH1A 1Z47A 2OCEA 2K32A 1EIFA 5IY0A 4IJHA 4QQBX 1TXYA 2N78A 4U85A 2Q5AA 3BG3A 2IHFA 2ZTEA 5M5YH 3PO3H 4OX9L 2CWPA 2DK1A 1LTLA 2BH8A 5C0XH 4QIWE 1I94L 2EQSA 1PV4A 4U86A 4DPGA 4NXML 1Q1BA 4A3IH 4JOIC 1HH2P 2VS1A 1HZAA 2OWOA 2NVTH 3ODKA 3PUVA 1YVCA 3I4MG 4BBRH 2YYZA 4LNQA 1ZYRC 4NXMQ 3EQLC 2YTYA 4A3IG 3OTOL 4YWMA 1VQ4A 2AKWB 1QZGA 1AE2A 4JI5Q 3PO2G 4JI1L 1X3EA 4DV4L 4X6AH 2GVAA 3I72A 4DV5Q 1PH9A 1HNXL 1HR0L 4QJFA 5C3EG 1G291 2I0QA 1N33Q 1T5EA 1FJGL 3KLRA 2E2JH 3VR5A 4YHHL 4GKKL 1KD1C 4JYAQ 1XNRQ 3KOJA 4A3FG 4R1JA 3BZCA 1N33L 2MQHA 1H9MA 5IP7G 3TRZA 2DWVA 1VS0A 1CKOA 4JI5L 5M3FH 3HOZG 2R7DA 2JA8H 5LMNL 1VQGA 4OO1I 1IBKQ 4DV5L 1KHIA 1K8AC 4DV3L 2Z6KC 1O7LA 4RMFA 5JJIA 4H44C 2DUDA 1SN8A 4GS3A 1UE6A 1HNXQ 4BY7G 3HOZH 4DNTB 3S2DH 2DN8A 4LF6L 1GUNA 1YZ6A 1ONLA 2DK7A 2YV5A 3CPFA 5FLXc 3D0FA 4KLKA 3ND8A 2QEXA 4BA2I 3RLNA 4JI4Q 1L1OB 3WDNA 4JV5Q 4L8JA 4OWTB 1VQ5A 3KF6B 2AMCB 2A68C 3QG1A 1K0RA 4LFBQ 1GUGA 4UY8C 4LF5Q 3BU2A 1BDOA 1W2BA 4QGUA 5HGQA 2XP3A 4GKJL 2L5TA 3N6RA 4R4IA 1H9KA 1X55A 1ASZA 3VR6A 3J7A5 3I4NH 1TK7A 5A35A 1SFOH 2CWAA 3A8JE 2HHHQ 3WH0A 2JX8A 1VQJA 4AYBG 1VCIA 2VW9A 4IPGA 2ZTDA 4AQYQ 1YJWA 1GO3E 2OTJA 1Z6HA 2R7FA 3A7AB 1AH9A 3VA7A 1T9HA 2V4DA 4POFA 2R93G 1IZ6A 4X64L 2KCMA 3CMEA 3FKIG 3HKZG 4B3TL 3CQZH 4IOCA 1B9MA 4G7OC 2GVBA 4P72A 5C0XI 4A3MH 1WJJA 3HOUG 2VY3A 3I4LA 1IW7D 1Y1WH 5E7NA 3CCEA 2YU9H 4JCVE 2CFMA 5FJ8G 4A3DG 1J5EQ 1I6HH 2JE6I 1Q86C 2MFIA 2MO0A 4A3LH 4R4CA 2ZR4A 3OW7A 3E0EA 2NZHA 5KNBA 5IYBH 1HZ9A 1L1OA 5M3FG 2A69D 1V9PA 4KN7C 2JXWA 1D7QA 3T1HQ 3RN2A 2EJFC 4K0KL 2K33A 2A8VA 1XMOQ 1HR0Q 1Q12A 1CFMA 2K5HA 3HOVG 1A0IA 1PH6A 1E1OA 4X62Q 5AJ3Q 1TWFH 1Q1EA 1NJIC 5ELOA 4X65L 4IQZA 1HNWQ 3KAFA 2AWOA 2NN6H 2OTLA 3HOWH 4DV2Q 1Q81C 4DUZL 2D62A 3L2PA 2R92H 2DGYA 1IYUA 4I7ZC 4EQ5A 2KCCA 1CTMA 2UXDQ 1YITA 4DR1L 2FXQA 1H9SB 2HT1A 1O7IA 4IFDI 2ZQUA 4LF7L 3KFUA 1UEBA 1K83H 4O2DA 4A3EG 4A3JG 3U4ZA 1LYLA 2O5IC 1E2ZA 1UE5A 3CRLC 4AYBE 3KYHC 4BBSG 1BKBA 4XIGS 2K4KA 2XP6A 1BBWA 2E45A 3UDIA 4GN3B 1CSQA 3T56B 2A69C 1GKHA 2VQFQ 5K36G 1EFWA 1Y14B 4A3LG 1KRSA 2K7VA 4DNRB 4WJ3M 2UXDL 1K8MA 3NELA 4JI8L 3UDXA 3EIVA 2WB1E 3M3YH 2QA4A 4LF8Q 2RCNA 3GTQH 5IWAQ 1X3GA 1G51A 1X9NA 5CQ2A 1K9MC 3EN2A 3L4HA 3L0OA 3UDFA 3NE5B 1XTDA 1EWHA 2AUKA 3Q8DA 2E75C 3HKZE 3ZJYC 4LF6Q 1VQPA 1TU2B 1GVPA 3M85A 4UPAA 1XPOA 1YI2A 1PYSB 2Q2HA 2RHQB 2PCFB 3GTOH 4MZ9A 3TS0A 3M4YA 4YCWA 3BZKA 4JBJA 4B3MQ 3H15A 3S1NH 3PO2H 2AUJD 2UUCQ 4JI2Q 2BE5D 2XTIA 3LGJA 4BBSH 2JJQA 1EIYB 1H95A 1IBLQ 2A1AA 4DV0Q 4A3BH 1K73C 2UU9L 5M5WH 3MEFA 1CSPA 4L5QA 3VDYA 3PUWA 1XMQL 1JB7A 2NVYH 3H3VI 1EWIA 2E5LL 2UUAQ 1V43A 1QZHA 5FJ8H 2MO1A 2M8JA 5M3MH 3JC66 1KQSA 3CCVA 3KJPA 2M3OW 1QVFA 1L0WA 2ASBA 2JEBI 4BY1H 4A75A 1IBLL 3WWVA 1GD7A 1JJGA 3H0GH 3ULJA 1O6WA 2VNUD 4REXA 3W1GA 4JI0Q 3S1RH 1E1TA 1WFQA 1OTCA 1KXLA 2Z0SA 3JAMc 4DKAC 1XNQL 3U58A 3K81C 4KHPQ 5FLMH 3CF5A 1KL9A 5GAHC 2R7ZH 4KHPL 5EAYA 1LUZA 3PV0A 1H9JA 3CCMA 2I5HA 5IE8A 3I7FA 3I2ZA 1M90C 2B8GA 3M7NA 3AQQA 4A3CH 3J7ZC 1PH5A 5KNDA 4JI3Q 2BA0A 5JEAH 4XTCS 3E9IA 3I4MH 1F8AB 3IRBA 3SGIA 4LF9L 2ZT9C 2QGQA 1GJXA 1LABA 1H9RA 5JEAG 1O78A 2DJYA 2UXBQ 2MDIA 5M3MG 3OTOQ 3TC5A 5IWAL 3GO5A 2JA7H 3TQYA 3S16H 1VQHA 2L15A 1GHKA 4KHZA 4JI8Q 5AHTA 1YEZA 5LMNQ 3PCOB 1SROA 4A3GG 4IJLA 1JT8A 3K7AH 3CCQA 2Q2TA 5IT9c 1M1KC 3CNGA 1WCMG 2KA7A 2D5DA 4TVAB 4DV0L 1OXTA 1X6OA 3AYHB 1NMFA 1Q82C 4KMUC 4FDBA 4Y52H 5C0XJ 1VQAA 3T53B 1WCMH 1Y1VG 4GN5A 5GROA 3IFTA 2XPAA 4B3TQ 2E76C 4DV7Q 4HJ5A 3PUZA 5GAGC 4JC0A 4DR4Q 4IFDJ 2VQFL 4DR6Q 3T1YL 2B3GA 4IO9A 2NVQH 5IYDG 1Z9FA 4LF5L 2RHSB 4DK6C 4B3RQ 4A3JH 4C2MH 4QIBA 5DLQE 4OONA 4UP7A 1HNWL 2KXQA 1E7ZA 4A93H 3B6YA 3CCLA 4DR2L 4A3MG 3PF5A 1P16A 5C4XG 2JMFA 3I73A 2O5JC 1DD2A 1PA6A 1GHJA 3STBD 1QJOA 4R4QA 3I4NG 4B3RL 5K36H 4R4TA 2E2HH 1E2VA 4DV1L 1J5EL 1EQRA 2JA6H 4DV3Q 4P74A 4HJAA 4DR7L 1Y8OB 3NENA 3ICEA 3ERSX 2ZR5A 4HR7B 1LACA 4GNXA 2JV4A 2K75A 1I5HW 3TZUA 2UU9Q 3GTJH 2IX1A 4YY3L 5LMUL 5IP7H 2PNHA 3T1HL 1FYCA 5C44H 2R6GA 1YJ9A 4PG3A 3J81i 3VR3A 2B63H 5IYDH 5KNCA 2NN6G 1VQ9A 1GUOA 2YSBA 3RZOH 1SRUA 2ZR6A 1YHAA 2JQOA 4HJ8A 1SE8A 2R7ZG 3S2HH 5AJ3L 2UXBL 1SMXA 4IPHA 2PPBC 2CCZA 4NXNL 1P8LA 4DAYB 4TKOB 3PUXA 4YY3Q 2YSHA 5C4XH 4A3BG 3TEHB 1Q7YC 2NVXH 1K9QA 2JXMB 4DR1Q 1XNRL 5HY6A 1XNQQ 4JI6L 3S14H 1C7YA 2HHHL 1OXVA 5BN5A 1FR3A 1U5KA 1PVOA 3BDOA 2K50A 1YNXA 1YW5A 1ZKOA 1VQFA 4DUYL 4LF7Q 3D4RA 3RR5A 1PINA 2VZAA 2XGTA 3H0GG 2XP7A 1Y8NB 1DCZA 2PI2E 5GAEC 2EXDA 4MNOA 4OWXB 4G7HC 3KF6A 1I50H 1VQ7A 1EQQA 2XP9A 3FP9A 2UUAL 1E22A 2VQEL 1N8RC 4LFCQ 4IFDH 3A74A 4K0KQ 3A8IE 3W3AA 1KAWA 1GUTA 2CW0C 3F8TA 1FVIA 2EZ5W 4LFAL 2KHIA 1U0LA 3AFQA 3A8KE 4OXPA 3PIOA 3VR2A 2A6HD 1C9OA 2WAQG 3VR4A 3UE0A 3RN5A 3F2DA 5BN4A 2ZTCA 2ATWA 2OQ0A 3TREA 2E8GA 4QL5A 3J81c 3GTPH 5IYBG 2F1MA 3M4OH 2K5VA 1PH8A 4KKUA 4JBWA 1TWCH 1XPRA 1IYJB 2OQKA 4DV7L 1X3FA 1Q8KA 1HZCA 4LF4Q 4DR7Q 2WB1G 4LK1C 4C3IH 1D8LA 1VQBA
chains in the Genus database with same CATH superfamily
3DLLA 2BE5C 1ASYA 3H94A 1EY4A 1PYBA 1SYGA 1TS3A 5IGBA 2DNCA 3NUCA 4DN4M 4C3HH 5CBEE 3I4NB 2F0SA 1PMRA 4P75A 1EEFD 2HQLA 4BXXG 1H9SA 1YNNC 2L11A 1I3QB 1TS4A 3TS2A 3JAME 3HGBA 1IXRA 1GUWA 4LJZC 3HOXH 1X3QA 4KHVA 1LLRD 1SE4A 3W1BA 1HTPA 4IPCA 4DNIA 2Q2UA 1SYEA 3ONAB 3CP0A 4K5WA 1G6ZA 4LUVA 2L0CA 1DM0B 2VUMB 1QUQB 5DM73 4JV5L 4BY1G 3IKJA 3K7AB 4JVZA 3J80i 2KJXA 2DJFC 4NB3A 1FL0A 3HOXG 5EBDA 1TWHB 2XP5A 3A7LA 1YBYA 3S1MB 1FJGQ 5JJKA 4EQNA 1SSOA 4QY7A 1E24A 2L12A 1B2TA 1N36L 4L5TA 1SR3A 3G48A 3MFGA 1SE3A 2ID0A 3SE0A 3CC2A 4V190 4QIWB 3UDGA 4B3SL 1D2BA 5M3MB 3KLWA 1VQLA 2E5LQ 4DAMA 4KD3A 3K5LA 3KLSA 2FMCA 1CT1D 1N32Q 2H5XA 2RQXA 1EUJA 1JE5A 1TS5A 1VQ6A 2KEDA 3I8ZA 3HOUH 4DR2Q 3BYYB 2EY2A 1JOQA 4JI0L 1HNZQ 5JJLA 3DM3A 1BVSA 3F2UA 4GNXB 1STBA 2GN5A 2MGSA 3L3OC 4LFCL 3SHLA 2UXCL 4X3SA 4JI7L 5J3BA 1CHQD 2A68D 4M1UB 2A6EC 1YNND 2WV6D 2ICEC 5FOBB 4A3EB 3OMCA 1NSNS 4HJ9A 1CI3M 4JI7Q 1SBBB 4LFAQ 4J15A 1F2MA 1YJNA 4LUZA 3HOYB 1IYVA 4Q0FA 3CAMA 1E3PA 3S1MH 4IUTA 1E2WA 1Z7TA 4DK1A 1JR0D 4DV6Q 2JA6G 2B2WC 1AW7A 3CCRA 4ME3A 4ALPA 3G6EA 4JK1C 5TSSA 4DUYQ 4K14A 3E9HA 1VQOA 3X3MA 1WTOA 2JA7G 4OEMB 3K80C 3DEOA 1PHJA 2WAQE 2PO4A 2J7ZA 4JI6Q 4DV6L 4UP8A 1JMCA 4FYDA 2QKIC 4JBKA 2IT1A 4BY7H 5D65A 1KNAA 2A73B 3K0XA 3WOEA 3CC7A 1C8CA 3H91A 1IKLA 4DAYA 3W5OA 1R9TH 3OMGA 1NMVA 1PRTC 4DV2L 2Z6KA 2ZQVA 2AQ1B 1Y69U 4AH6A 4AIMA 3T1YQ 2M00A 3MXGA 4JI2L 2F4VQ 3CPWA 3HFZB 1I4XA 5C3WA 3A55A 1CHPD 2JA5G 3M4QA 1DOLA 3S15H 1KRTA 3TMEA 1ESFA 3R2TA 1IBKL 4A3CG 2ES2A 3G4SA 4KY7A 1X56A 1WTHA 5IYCG 1XJVA 4K6LA 2HIXA 1GUSA 2N49A 4PZ6A 2AHOB 4LF9Q 1BOSA 3S9WA 5KIXA 2R93B 2QW7A 3MQGA 4GOPB 5CV9A 2Z4HA 1WR7A 3CKIB 2NWGA 3F1ZA 5IYCH 2E74C 3LE4A 2JEAI 2F21A 1NTGA 4QUCA 4GLAC 4C3IG 2K6AA 5E64A 3E6ZX 4DK0A 1HQMC 3K7UC 3QR8A 2HIVA 2ZJRA 2XP8A 4DR5L 5EGTA 2N8NA 1I6VC 1IKMA 4RG1A 3L9AX 5J22A 3QB3A 2E2DC 2N3SA 2NN6I 3QIAA 2KBNA 3GV3A 4POGA 2NVTB 1PXUA 4JI3L 2F3IA 2K52A 1UE1A 3GTMH 4A3GH 1PZKD 4P2CB 3BDLA 2PQAA 4OO1H 3PGZA 1BCPB 3FHWA 4A3JB 3NTHA 1UWVA 1A2TA 1OXUA 5I9PA 4H13C 1N9WA 2M2LA 1IL2A 4KY6A 1XYIA 2PW5A 4ZKBB 4OX9Q 5FKAC 3MZ5A 2QRVA 1QVGA 2RDHA 1Q8IA 3IL8A 3RNUA 1MI2A 4HJ7A 1KDCA 3AEVA 4KN4C 2IPKD 2BA1A 1TWAH 3L7ZC 3Q24A 2WKCA 3KDFB 5IGFA 2KOLA 4F88A 5EPJA 1X32A 2C35B 4DV1Q 3J7AV 3LWUA 1DGSA 4NP5A 3MA2B 4HIMA 2F4IA 3H6MA 3JAMi 1EU4A 3ULLA 2PMZE 3ULPA 3KF8B 4U68A 2LXKA 1PFBA 1N34Q 1QOHA 3FEWX 3DWPA 5LMNW 2UUCL 2UUBQ 4ID6A 3V2TA 1I94Q 3GTKB 1HPCA 3OYYA 4PMCA 1I4GA 1A63A 2B2VA 5M5XH 3J80E 4GLXA 3A5ZB 1I50B 3U9SA 1A3VA 1AE3A 2RBMA 3HOWG 2F52A 1EOVA 2C9OA 3FMCA 2L4JA 1RTOA 2K04A 5FLMG 2UUBL 3GTPB 1Y8PB 1YIJA 4KI0A 4B3SQ 2DJGC 3HEJA 2UXCQ 2F0LA 3RZOB 1EYCA 3HOYH 1HZBA 3PMFA 2F0KA 3MVVA 3RLFA 2HCIA 4F87A 3PSIA 1A8VA 4RH6A 4TRDA 3MXNA 3H3VH 1SMYC 5IP9H 1EIGA 3E3XA 3NSWA 1CKNA 1EY0A 1VQ8A 4XQJA 3T51B 1SJHD 4QF4A 3IAYA 4U673 4FXGC 1BCPC 5A2QL 1JJCB 5C4JH 2ENBA 1IHZA 1WCMB 2R7ZB 3BDCA 1B9NA 1WOCA 4QB4A 1CA6A 2Y0SE 2WFWA 3GTKH 3MXUA 3P75A 1PTOB 3BJUA 1NE3A 1Q46A 3QJYA 4TSSA 1VQIA 2L4NA 4KKSA 2H4OA 3LNNA 4WORA 1L1OC 3HOVH 1TY2A 1JOOA 2IY5B 4BXXH 2ZM6Q 2FINB 3PO3G 2SDFA 4RCNA 3CHBD 4DUZQ 2I5LX 3X3NA 2B2TA 5E4WC 3K58A 4MTNA 4ZUIA 1XX8A 2M8IA 2CVRA 4B9WA 1CM9A 1S5FD 2TSSA 2XIWA 4JG2A 2BDNA 2ZQTA 2NZ1D 4X62L 1F9RA 2B2YC 4QUFA 1R9TB 2B2UC 4X65Q 2AQ3B 2F0DA 3RLOA 1VF5C 1XMOL 5J39A 3OOBA 1BBUA 2VL6A 3CCJA 1X54A 2B29A 1LTAD 1I3QH 1B4OA 2AWNA 4UP9A 1NMGA 4Q5VA 1OXSC 4R8NA 4APVA 2IX0A 1WVLA 4ZQ3A 2D9UA 3KLSX 4O0AA 4IPDA 4KJNA 3U50C 2QF7A 2R92G 1W3SA 4JOIA 3OIPA 3QWNA 2ZAJA 2G9HD 2QCPX 3STBC 5LMUQ 3FPPA 2N55A 4U84A 2XSCA 1SYBA 4GOPC 2JP1A 1JE4A 2YTVA 5BN3A 4C1NK 3CD6A 2R3ZA 1QCBD 5ELBA 3NP8A 4GNXC 3U4VA 4RGMA 4ZKCB 2Q8TA 1E0BA 1ENFA 2B2TC 2CH4W 3M9BA 3RUZA 3GDEA 1MD2D 2QILA 1AP0A 3NTPA 4MHEA 5ISRA 1LO5D 4TQUS 2OXPA 3DHQA 1PH7A 1JORA 1CKMA 1AZQA 4DR3L 4B3ML 4OO1G 5M3FB 4G7ZC 1F77A 2LXJA 1CK1A 4FXDA 2PNRC 4A3FH 3HOUB 4PV1C 3KAIA 2Q8RE 3A0JA 3GD7A 4N8X1 4YCVA 4EX5A 1A6XA 3BS1A 1PTOF 2YSGA 1IBML 1DJRD 2EYPA 1PZJD 3M3YB 1Q90A 4K2KA 3EVQA 2K5NA 2VUMG 2B8FA 1TWGH 3K5MA 3KK7A 3CCUA 2DMVA 1SNMA 1NY4A 1WI5A 2KHJA 4GOPA 2E2IH 4PMBA 3TCZA 1C0AA 5IT9L 1K8GA 1J9OA 2F0OA 4NPSA 3MC0B 3A56A 5FLXE 4XQQA 1X65A 3FPUB 1J8IA 2VQEQ 4PZ7A 2NZOA 1NBWA 1K8OA 2F0GA 1RHPA 3Q23A 1PTOD 1EYGA 4DXGA 3I55A 4RHSA 3RZDB 2BDOA 4DR3Q 4L5SA 3S1QH 1VQNA 3S2DB 1MKHA 4AQYL 4Y7NH 2B63G 4A3KH 4LFBL 1PDQA 1FD7D 2N88A 4ZUJA 4YWLA 1JJ2A 1C4QA 1KIXA 1JQYD 1SYDA 2ZXOA 1KC8C 3M7GA 3MXNB 1SJED 4BS9A 2JA8G 4ILWA 3K57A 4C2MB 4NDXA 3R8BA 1YNJC 1V8QA 5HGTA 1RL2A 1N34L 2Y0SG 1AN8A 4QMGA 4B9XA 1A2UA 1LTRD 3EBEA 3MEHA 2NYZD 3G7LA 5AFWA 4NXNQ 4GKJQ 5IGDA 2RDGA 3NBHA 5EQ0A 4BWGB 2IX3A 5GADC 3FKIH 4HCSA 1WTVA 5CV8A 1HXYD 4HIOA 3C2PA 5CBAE 1EU3A 1SLJA 4DK3C 1Y1VB 5CV5A 4C1NI 4BBRB 2K05A 1BXTA 3CRKC 2JA9A 2RE3A 4X66L 3S24A 1ZCNA 2ITKA 3GTOB 1ICFB 3CC4A 3GTJB 2XP4A 4GLVB 2Y0SB 3F2CA 4S3SA 1JMQA 2RF4A 3N52A 3ER0A 1DXMA 2JK8A 3PIPA 1MJEA 5ELEA 1VQEA 4YWKA 4K5XA 2F0EA 2HQEA 2D2CC 2RSOA 3KJOA 2YSFA 1S72A 2EYHA 1V1QA 2B39A 2VUMH 1EYAA 1MIUA 1SNQA 1JWUD 4KTAA 3QO2A 1F9QA 1S3OA 2Q8IB 5C3XA 3RZDH 3URYA 4HIDA 1SE2A 1XMQQ 2ZJQA 1PH2A 3GTGH 5CC4A 1CUKA 2IHEA 3J81j 4JYAL 4WJ4A 1WMVA 4LW1A 2EDGA 1NCVA 5GQOA 4GKKQ 1NNXA 5ELFA 4P71A 5E62A 1TY0A 2F0WA 5ELNA 1CKNB 3BVGA 3DM1A 3K8AA 4YCUA 4KKTA 5C0XG 1I5FA 1WTWA 3OW2A 3MFYA 5C44G 1HCZA 2YSIA 1TKWB 2A6ED 3F2BA 2Y8NB 1QVCA 1VF7A 1NR2A 3OWFA 4EQPA 3NPPA 4HIKA 4GZYC 2PQAB 3GQBA 3BYTB 3KAGA 4OL7A 4MIUA 1VQKA 3MHBA 1O7ZA 4H02A 5BR8L 3JAML 4OGQC 1EG3A 3M4OB 1EWCA 3I4OA 1VMCA 3OSOA 2BCOA 1G6PA 3KABA 1VQCA 3HKSA 4IALA 2KCNA 3KADA 2BH2A 1PFSA 3GTQB 2WP8J 3DXJC 4IFDG 1F2ZA 4R9WA 2Q2IA 3S17H 3C1FA 4J1MA 4IOAA 4L5RC 3PF4A 4A93G 1HNZL 3HOYG 4NMZA 3KDFA 3SDZA 2XPBA 1L2FA 3A5UA 1UNSA 2MNAA 2RVLA 1RIPA 1N32L 3FDTA 1XPUA 4DA2A 1U9RA 1B70B 1PFMA 3SVMA 2V1CC 3I4MB 3I56A 2LAJA 3QOJA 1STGA 2WAQB 3CMAA 4X3UA 3Q22A 1VQMA 1N36Q 1STYA 1EY5A 2F0QA 3SXHA 1QUQA 1LTSD 2ZJPA 2CW0D 1IBMQ 5I6WA 2F4VL 1K3BC 4A3DH 3TDBA 1B8AA 1KLGD 2I46A 3OPOA 2MUYA 1WYDA 4DAPA 1TWHH 3NBHB 1ILPA 4DR4L 1LT4D 1FGUA 5H1SE 2KCTA 2FJ2A 2Z9HA 3AB9A 4XT3B 4GN4B 1MJCA 2EY6A 1B1ZA 4A3KG 4A3BB 2HD3A 4PNYA 2QDBA 5JEAJ 4PQXA 4C3JH 3FS8A 1PH4A 1RP5A 1TR8A 4QCLA 3BVZA 1UE7A 2LMCB 1SAPA 4OWWB 4RAUC 1V1PA 4A76A 1PTOH 3GTLH 3K6OA 2XWJB 3AFPA 4PZ8A 4CDEC 3D3RA 3CXCA 2YTXA 1S5DD 2EIFA 1EL0A 4V0BA 2I5MX 1YHBA 2R93H 2ZQSA 1A62A 4RHRA 1S40A 4PMWA 4LF8L 5BR8Q 3J80c 4JBMA 2F0NA 1Y1VH 5CV4A 4FF3A 1EY6A 2F0FA 2PZWA 1EY7A 1IW7C 1HUMA 1MSHA 2EJMA 4BA1I 2K14A 3NEMA 4YHHQ 4K5VA 1B7YB 1XTCD 2EJGC 3WOFA 2A6HC 4LUOA 2D0PA 3SK5A 4BBRG 1BNZA 4K8JA 4A3EH 4JI4L 1STAA 4DR6L 4R4OA 2A5HA 1D1IA 1YHQA 2ZM6L 4DR5Q 3A54A 2KQ3A 2JA5H 2KUMA 1VQDA 3ND9A 1V1OA 1GM5A 4H0LC 4X64Q 2O2LD 5EBCA 1PH3A 2DNEA 1EEID 4LF4L 2LSSA 5IP9G 3D31A 3KCEA 2ICIA 2SNMA 1WD1A 2KENA 3PUYA 3P1HA 4HMJA 4N8FA 1QE6A 1RDPD 3OOCA 4RKBA 3M4PA 2O4XA 1EG4A 2D0OA 4X66Q 1K3RA 1LTGD 1F9PA 1A3UA 5CMDA 3G71A 1O7YA 4K2LA 1HA5A 5C3EH 3KBGA 1RKNA 4JI1Q 4DV4Q 1Y1WG 1J6QA 1EQVA 3CW2C 2EVBA 2PI2A 1OXXK 1VDZA 4OIJA 2VB3X 4A4IA 2CKZB 1LM0A 2ALYB 1NAPA 4XYOA 2CQOA 1HR0W 3QOLA 1HJPA 4P73A 2E2IB 4LWCA 4E5RA 1W6JA 4A3IB 3P20A 4MTKA 1K9RA 3CCSA 2BOSA 1I4HA 3KAHA 3UE1A 1S5CD 2A19A 3BVMA 1PH1A 1Z47A 4CDFC 3HS0C 2OCEA 2K32A 2E2JB 1EIFA 1TIID 5IY0A 2RDFA 4ABNA 5KYIA 4IJHA 3K5NA 5LHY1 4QQBX 3LKXB 4RA8A 1TXYA 3D8GA 2JN4A 2N78A 4FF2A 3ERQA 4CKBA 4U85A 2Q5AA 5DM63 4A3GB 2JA5B 3BG3A 1U4MA 2IHFA 2ZTEA 5EJWA 5M5YH 3TP5A 3PO3H 1MGSA 3R93A 5LL6S 4DFAA 4FF4A 4ZK9B 4OX9L 2CWPA 2DK1A 1LTLA 2BH8A 5C0XH 2XWBB 4QIWE 1I94L 2EQSA 1PV4A 4U86A 4DPGA 4CJ0B 4NXML 1Q1BA 4A3IH 3I70A 3D6CA 4JOIC 5KYLA 3UI2A 1HH2P 2VS1A 1HZAA 4G4KA 2OWOA 2NVTH 1STEA 3ODKA 3PUVA 4XYQA 1YNJD 1YVCA 3I4MG 4BBRH 2YYZA 4IUQA 5DEHA 4LNQA 1ZYRC 4NXMQ 3OIQA 3EQLC 1ZEQX 2YTYA 4A3IG 3OTOL 3T4AC 2XVSA 2OT2A 1CZGA 4HTHA 4YWMA 3S1RB 1VQ4A 2AKWB 1QZGA 2F3VA 1AE2A 4JI5Q 2SOBA 3KF8A 4E6IA 1LT6D 5I6YA 1VMPA 3PO2G 4A0TA 1X3EA 4JI1L 4DV4L 2GVAA 4X6AH 3I72A 5IGGA 4DV5Q 1S5ED 4RWSC 3BZDB 1PH9A 3LKXA 3PQHA 1HNXL 1HR0L 1RD9D 4QJFA 5C3EG 2WKDA 1G291 2I0QA 3HOZB 1N33Q 1T5EA 3DUZA 1FJGL 2EY1A 3KLRA 2NVQB 1GXDC 2E2JH 3Q6SA 3VR5A 4YHHL 4GKKL 4CKCA 1KD1C 1KLUD 2B63B 1FGBD 2DY7A 4JYAQ 1XNRQ 3OWEB 1HHVA 3KOJA 4A3FG 4BY1B 4FP5D 4R1JA 5JJZA 3BZCA 1N33L 5I9OA 4KY5A 1PZID 4Z9CB 5J1ZA 2MQHA 4C3HB 1H9MA 5A2QE 5CORA 5EKKA 4KD4A 5IP7G 1BCPF 2X6GA 2DWVA 4EGVA 1VS0A 3TRZA 1CKOA 4ZAIA 4JI5L 5M3FH 3HOZG 1L0XB 2R7DA 2HDLA 5U47A 2JA8H 5LMNL 1VQGA 4OO1I 1IBKQ 4DV5L 4FF1A 1KHIA 4K8IA 3D4WA 1K8AC 4DV3L 2Z6KC 1DOKA 1O7LA 2WADA 4RMFA 3SEBA 5JJIA 4RKLA 3S15B 2DUDA 4H44C 4CBVA 1SN8A 3MXPA 4GS3A 1LT3D 1LT5D 1UE6A 1HNXQ 4CHTB 4BY7G 3HOZH 1EIHA 1B3AA 4DNTB 3U9OA 3S2DH 2DN8A 4LF6L 3VYUA 1GUNA 1YZ6A 1ONLA 3PO2B 3GTMB 2DK7A 2YV5A 3CPFA 3NK9A 3DWQA 3D0FA 5KEEA 5FLXc 1QNUA 4RCOA 2EOTA 4ZYSA 4KLKA 5FO9B 3ND8A 2QEXA 3FSBA 4BA2I 4BBSB 3RLNA 1SNDA 4JI4Q 1L1OB 3WDNA 3HG9A 4JV5Q 2EE1A 4L8JA 1JB3A 4OWTB 3AMUA 1VQ5A 3KF6B 1BO0A 1QWYA 2AMCB 1S5BD 3S1NB 1I4PA 2A68C 3QG1A 1D5ZC 4HN7A 2SNSA 2M9VA 3TZDA 1K0RA 1TWAB 4O42A 2WACA 2NVYB 3ZYYX 3EFXD 4LFBQ 1II3A 1GUGA 4UY8C 4LF5Q 3BU2A 2PMZB 3T13A 1BDOA 1W2BA 4A0UA 4QGUA 5I2YA 2IWHA 2CH4A 5HGQA 1B3QA 2XP3A 1TVXA 4GKJL 2L5TA 1RCVD 2NTTA 3N6RA 2G9DA 4R4IA 3EROA 3H0GB 1H9KA 2K5QA 4KK7A 1CZWA 1X55A 1ASZA 2HDMA 1G2SA 3VR6A 3J7A5 3I4NH 1TK7A 1JCKB 1PRTF 4ME5A 5A35A 1I4QA 4HEDA 1SFOH 2CWAA 4DGZA 3A8JE 2HHHQ 3WH0A 2JX8A 1VQJA 4AYBG 1VCIA 3FVQA 2VW9A 4IPGA 1DOMA 5G3LF 2EPBA 2ZTDA 4AQYQ 1YJWA 1XXGA 1GO3E 5IT9E 2OTJA 4K6DA 1Z6HA 2K1BA 5C4ZA 2R7FA 3A7AB 1AH9A 2F3WA 3VA7A 2EYLA 4ZCKA 1T9HA 2V4DA 4POFA 1TQOA 4JPBW 2R93G 1HA6A 1IZ6A 1U4LA 4EVOA 1B44D 4KJOA 2KCMA 5M9OA 4X64L 1T5XD 3CMEA 5CYUA 2XRQD 3J7YW 3FKIG 2Z1CA 1FNVA 1SYCA 3HKZG 4B3TL 3CQZH 5JPMC 4IOCA 1B9MA 4G7OC 2L1BA 4HCEA 1NUCA 5IOCA 1LTBD 3OHXC 2GVBA 4P72A 1G8ZD 5C0XI 4A3MH 3NHHA 1WJJA 3HOUG 3Q0AA 2VY3A 5C6AA 3I4LA 2F0HA 1IW7D 1WTPA 1Y1WH 1D6EC 2R92B 5E7NA 3CCEA 2YU9H 4JCVE 2IL8A 1TWFB 2CFMA 5FJ8G 4A3DG 4OHJA 1J5EQ 1KAAA 5FO8B 1I6HH 2JE6I 1EOTA 3MWYW 4R8IA 2MFIA 2MO0A 5E4XA 1Q86C 3HOWB 1V1PB 4A3LH 4R4CA 2K5WA 2ZR4A 4WRDA 5C4HA 3OW7A 3E0EA 1K83B 2NZHA 3MCBA 2FFKB 5E1FA 5KNBA 1HZ9A 5IYBH 1L1OA 1RJTA 2A69D 5M3FG 1V9PA 4KN7C 3H09A 5C3EB 2JXWA 1D7QA 2F0VA 3T1HQ 4A3DB 2B2VC 3RN2A 1PFNA 3S16B 2EJFC 3DWAA 4K0KL 1HFNA 3NQTA 2K33A 2A8VA 1XMOQ 2HUGA 3J7AF 1HR0Q 1Q12A 2LS01 1CFMA 2K5HA 3HOVG 1FNUA 2Z8LA 3IFDA 2JA8B 1RODA 3E5SA 1A0IA 4LMQD 1U4PA 1PH6A 1E1OA 2Z6BA 4X62Q 5AJ3Q 1TWFH 1Q1EA 1NJIC 5ELOA 4X65L 4IQZA 1HNWQ 2F0IA 2WINB 3TP6A 2EYJA 3KAFA 2AWOA 4FXKC 1R4PB 5HURA 1JWSD 4C3HG 2NN6H 4UDUC 1ILQA 2OTLA 1STNA 3K0YA 3HOWH 1FLCA 5E3FA 5CV6A 1K0SA 4DV2Q 1Q81C 4DUZL 4XXEA 1CA5A 2D62A 3L2PA 2LFNA 4EQOA 2R92H 4C3IB 2DGYA 1QG7A 2B2UA 1IYUA 4I7ZC 3LWEA 1Y1WB 4EQ5A 2KCCA 4L6TB 1GOZA 1CTMA 3EJIA 2UXDQ 1YITA 4DR1L 2FXQA 3SK8A 1LV9A 1H9SB 2HT1A 2P5ZX 1O7IA 2X6LA 3DEPA 4IFDI 2ZQUA 4LF7L 5CGKA 1BF4A 3KFUA 2L9HA 1UEBA 1K83H 4O2DA 4DU9A 4A3EG 4A3JG 3KBXA 3PQIA 3U4ZA 1LYLA 2O5IC 1E2ZA 5ELDA 3C1EA 1UE5A 3CRLC 3VYSA 2PQEA 4AYBE 3KYHC 4Y7NB 4BBSG 2RKSA 1AFPA 1BKBA 4XIGS 3V96A 2K4KA 4DAVA 2XP6A 1BBWA 3HZXA 2IW3A 2E45A 3UDIA 4GN3B 3S14B 1CSQA 3T56B 3NXWA 1L0YB 3GV6A 2A69C 1GKHA 2VQFQ 5K36G 1EYDA 1PLFA 1EFWA 1Y14B 4A3LG 1KRSA 2K7VA 3D4DA 4DNRB 4WJ3M 2UXDL 3MAQA 4RFBA 1KTKA 3DMUA 2EYOA 3GP7A 1K8MA 3NELA 1DZ1A 4JI8L 3UDXA 4CGYB 3EIVA 2WB1E 3M3YH 2QA4A 1PTOC 4LF8Q 2RCNA 5C44B 1SFOB 3GTQH 3TP8A 5I4DA 5IWAQ 1X3GA 2PZTA 1G51A 1X9NA 5CQ2A 2K01A 1K9MC 3EN2A 3L4HA 1SNOA 3SK6A 3L0OA 3UDFA 2GA4B 1K28A 3NE5B 1XTDA 1EWHA 2JA7B 5FLXL 2AUKA 3Q8DA 2E75C 3HKZE 1CQVA 3ZJYC 4LF6Q 1VQPA 1TU2B 1DONA 3H3VC 4IN3A 1GVPA 3M85A 5E66A 1SEBD 4UPAA 2SEBD 1XPOA 2EYFA 1YI2A 1PYSB 2Q2HA 4IUNA 3NTIA 1KABA 2RHQB 1HTLD 3KUPA 1FNWA 2PCFB 3GTOH 4MZ9A 3TS0A 4N9TA 3M4YA 4YCWA 3BZKA 4JBJA 1RTNA 2XNAC 4B3MQ 3H15A 3S1NH 2B2WA 3T16A 3PO2H 4A3MB 1OO9B 2AUJD 2UUCQ 4JI2Q 3AU7A 5C4XB 2BE5D 3FKIB 2XTIA 3LGJA 4BBSH 2JJQA 1EIYB 1H95A 4OELB 1IBLQ 2A1AA 4DV0Q 2OEOA 4A3BH 5CR3A 1K73C 5JPNC 2UU9L 1S4ZA 5M5WH 3GTGB 3MEFA 1CSPA 4L5QA 1HFGA 3GTLB 4N9PA 4J8QA 3C3LA 4IUPA 2MPMA 2XRSD 3VDYA 2WIIB 3PUWA 2WAEA 1XMQL 1LTID 1JB7A 2NVYH 3H3VI 1ET9A 1EWIA 2E5LL 2J4XA 2UUAQ 1V43A 1QZHA 5FJ8H 2I07B 2MO1A 3S1QB 2M8JA 1RF2D 5M3MH 3JC66 1KQSA 3CCVA 4XQNA 1UEAB 3KJPA 1B53A 2M3OW 2EYMA 4B08A 1SMYD 1QVFA 1L0WA 5C4JB 2ASBA 2JEBI 4BY1H 4A75A 1IBLL 3K5OA 3WWVA 1GD7A 1JJGA 4MN3A 2F0TA 3H0GH 3ULJA 3SK4A 1O6WA 2VNUD 5I2XA 4REXA 2MHVA 3W1GA 4JI0Q 3MCBB 5C5LA 3HOVB 3S1RH 1E1TA 2A74C 2R61A 4A3KB 1WFQA 2JA6B 1OTCA 1KXLA 4RGOS 2B2YA 2Z0SA 3JAMc 4DKAC 1B50A 1XNQL 1EY9A 3U58A 4DXFA 2JSOA 1I4RA 3K81C 4KHPQ 4NKLA 5FLMH 3CF5A 1ENCA 2F03A 2AQ2B 4HMIA 3V05A 1KL9A 5GAHC 2R7ZH 4KHPL 1SDFA 3C46A 5EAYA 1LUZA 3PV0A 4L63B 2NB0A 3FSCA 1H9JA 3CCMA 2I5HA 5IE8A 3I7FA 2CQAA 5F2DA 3I2ZA 5LL6X 1M90C 2KECA 2B8GA 3M7NA 3AQQA 4A3CH 3J7ZC 1PH5A 5KNDA 2BA0A 1JC7A 1WD0A 1AEXA 4XTCS 5JEAH 3E9IA 3J81L 4JI3Q 3I4MH 1F8AB 3IRBA 2YU9B 5COYA 3FRPB 3SGIA 4LF9L 1EQTA 3D6WA 4ODGA 2ZT9C 1D5MC 3MQHA 2QGQA 1GJXA 2TMPA 1LABA 5E5WA 1H9RA 5JEAG 1O78A 2DJYA 2L55A 1KDBA 2DY8A 2UXBQ 1ET6A 1LTTD 2RSNA 4C3JB 2MDIA 5M5YB 5M3MG 3OTOQ 3TC5A 1JOKA 3PO3B 5IWAL 5CV7A 1ZXTA 3GO5A 4IUUA 2JA7H 4RGTA 2ZXRA 2F0JA 3TDQA 3TQYA 2G5DA 3S16H 1VQHA 5JVH3 5DNFA 2L15A 1GHKA 2J0TD 4KHZA 4JI8Q 5JVG3 5L37A 1A15A 4I7AA 5AHTA 1YEZA 5LMNQ 3PCOB 3VYRA 1SROA 4A3GG 2XN9C 1X3PA 4XT1B 4IJLA 1JT8A 3K7AH 3CCQA 2Q2TA 2NUCA 5IT9c 1M1KC 3CNGA 2VXWA 1WCMG 2KA7A 2D5DA 4TVAB 1TWGB 4DV0L 1OXTA 3CU7A 1X6OA 3AYHB 1NMFA 1Q82C 4KMUC 2PYKA 4FDBA 4Y52H 2K03A 5C0XJ 1VQAA 4G57A 1SNCA 3T53B 4NW2A 4KV6A 3PIO3 1WCMH 1Y1VG 4GN5A 5GROA 3IFTA 1KDAA 1QNKA 3J80L 5JOBA 3R2IA 2XPAA 1UAPA 4B3TQ 2E76C 1XWEA 4DV7Q 4HJ5A 3PUZA 5GAGC 1BUVT 1BCPD 2KHSA 4JC0A 4DR4Q 4WJWA 5M5WB 4IFDJ 2VQFL 4DR6Q 3T1YL 2B3GA 4IO9A 2NVQH 5IYDG 1QILA 1Z9FA 4LF5L 5DAUA 2RHSB 1F9SA 4DK6C 4B3RQ 1ML0D 4A3JH 1EZ6A 4C2MH 4QIBA 4ZLTF 5DLQE 4OONA 5T1GA 4UP7A 2LKVA 3G6JB 1HNWL 1ENAA 4C56C 2KXQA 4H7BA 4M8AA 3HRZC 1HQRD 1E7ZA 4A93H 3B6YA 3CCLA 2F0PA 4DR2L 4A3MG 1D1KA 3PF5A 1P16A 2FMMA 5EKIA 2C5CA 5C4XG 3CQZB 2JMFA 4F8MA 3I73A 1G2TA 2O5JC 5T1IA 3K59A 1DD2A 1PA6A 4IZ8A 1GHJA 3STBD 1F2LA 5KGUA 1QJOA 4R4QA 3I4NG 4B3RL 2LY7A 5K36H 1WTXA 2RCFA 4R4TA 1C48A 2E2HH 1JICA 1E2VA 4DV1L 2FHTA 4I65A 1J5EL 2H1EA 1EQRA 3E0JA 1AZPA 2JA6H 4DV3Q 4P74A 5M5XB 4HJAA 2KEEA 4FNFA 5KRUA 4DR7L 4BY7B 1Y8OB 5IGEA 2F0UA 2F0MA 1HRJA 2WB1B 3NENA 3ICEA 3ERSX 3S2HB 1F2YA 1BR9A 1TWCB 2ZR5A 4HR7B 3J81E 3HOXB 1LACA 1BQQT 3LX0A 5EPKA 4GNXA 2JV4A 2K75A 5IGCA 1I5HW 4A93B 3TZUA 2UU9Q 3GTJH 1MHWC 2MP1A 2IX1A 1U4RA 4YY3L 5IP7H 5K5PA 5LMUL 2PNHA 1EZ8A 3PIP3 3T1HL 1FYCA 3RMHA 5C44H 4FO2A 4WFN3 2R6GA 1YJ9A 4PG3A 3J81i 2Z4IA 5EKLA 5FO7B 1STHA 3VR3A 1WTRA 3TBIB 4ZRZA 2B63H 5IYDH 3S17B 5KNCA 4IUVA 1Q3LA 2NN6G 1VQ9A 1GUOA 2YSBA 3O13A 3ITPA 1ZYRD 3RZOH 1TR5A 1SRUA 2ZR6A 1YHAA 3R3OA 5IODA 5D14A 2JQOA 4HJ8A 1SE8A 2R7ZG 3S2HH 5AJ3L 2UXBL 5FK9C 1SNPA 1SMXA 1UUPA 4IPHA 1IL8A 2PPBC 1ESRA 2CCZA 3VYTA 4NXNL 1G91A 4HSPA 1P8LA 4YIJA 1NR4A 4DAYB 4TKOB 3PUXA 4YY3Q 2YSHA 3W2DA 5C4XH 4A3BG 3TEHB 1D5XC 3I3CA 4FVMA 2PZUA 1Q7YC 1TT2A 2NVXH 1K9QA 2QEJC 5IIFA 2JXMB 4DR1Q 4X3TA 1XNRL 2CHBD 5HY6A 1XNQQ 4JI6L 1MSGA 3I91A 3S14H 3MTSA 5E65A 1C7YA 2HHHL 1OXVA 1TS2A 2OF1A 5BN5A 1FR3A 1U5KA 4AYBB 5ELCA 1PVOA 3BDOA 2ZXPA 1EY8A 1JWMD 2X69A 4IURA 1SXTA 2K50A 2KVMA 1YNXA 3NWSA 1YW5A 4C3JG 1PRTB 1ZKOA 4ULLA 1VQFA 4DUYL 4LF7Q 1SYFA 5JAVA 3D4RA 3RR5A 1PINA 2VZAA 2XGTA 3H0GG 2XP7A 4CDDC 1Y8NB 4UAIA 1DCZA 2PI2E 1DYQA 1PYWD 3P7JA 1A3TA 3I90A 2NTSA 5GAEC 4OIKA 5G3LD 2EXDA 3TSSA 4MNOA 4CJ2C 2IJ0A 4OWXB 1MBYA 4G7HC 3VA5A 1KNEA 1QB5D 2K28A 1I50H 3KF6A 1VQ7A 4O1NA 1EQQA 2XP9A 1BBXC 3FP9A 2UUAL 1E22A 2VQEL 2EZVA 1N8RC 4LFCQ 1EFID 1PRTD 3A74A 4IFDH 4CJ1B 4K0KQ 2HCCA 4X3KA 3A8IE 1KAWA 3W3AA 5EPLA 4CKEA 2MJ8A 1GUTA 4JW0A 2CW0C 3F8TA 1I6HB 4LAAA 1FVIA 2EZ5W 2EY5A 4LFAL 2KHIA 1ICWA 1U0LA 1W6KA 5C5MA 5D3IB 3AFQA 2QDLA 2EXZA 1HUNA 3A8KE 4OXPA 3PIOA 4J6HA 4CDCC 1WTQA 2NVXB 4UHVA 1O80A 3VR2A 3EA6A 2A6HD 3NTKA 2RA4A 2NBFA 1CQFA 1C9OA 2WAQG 3RD4A 2K5DA 2PW7A 3HKZB 3UE0A 3VR4A 3RN5A 3F2DA 3TN2A 2ZTCA 5BN4A 2ATWA 4F7XA 3NBIA 3NQIA 2OQ0A 1M4VA 3TREA 3HP3A 2E8GA 4RGNA 4A3FB 4QL5A 3TP7A 2JYOA 2E2HB 3J81c 4HSVA 3GTPH 4DF7A 5IYBG 4XDXA 2YAJB 2F1MA 3M4OH 2K5VA 1PH8A 1TWCH 4JBWA 4KKUA 1XPRA 1IYJB 2OQKA 4DV7L 4HAEA 1X3FA 1Q8KA 1HZCA 3SR1A 4LF4Q 4DR7Q 3NWTA 1M8AA 5NUCA 2WB1G 4LK1C 4C3IH 1D8LA 5D3DA 2VB2X 1VQBA 1R4QB
chains in the Genus database with same CATH topology
3DLLA 2BE5C 1ASYA 3H94A 1EY4A 1PYBA 1SYGA 1TS3A 5IGBA 2DNCA 3NUCA 4DN4M 4C3HH 5CBEE 3I4NB 2F0SA 1PMRA 4P75A 1EEFD 2HQLA 4BXXG 1H9SA 1YNNC 2L11A 1I3QB 1TS4A 3TS2A 3JAME 3HGBA 1GUWA 1IXRA 4LJZC 3HOXH 1X3QA 4KHVA 1LLRD 1SE4A 3W1BA 1HTPA 4IPCA 4DNIA 2Q2UA 1SYEA 3ONAB 3CP0A 4K5WA 1G6ZA 4LUVA 2L0CA 1DM0B 2VUMB 1QUQB 5DM73 4JV5L 4BY1G 3IKJA 3K7AB 3J80i 2KJXA 4NB3A 1FL0A 3HOXG 5EBDA 1TWHB 2XP5A 3A7LA 1YBYA 3S1MB 1FJGQ 5JJKA 4EQNA 1SSOA 4QY7A 2L12A 1E24A 1B2TA 1N36L 4L5TA 1SR3A 3G48A 3MFGA 1SE3A 2ID0A 3SE0A 3CC2A 4V190 4QIWB 3UDGA 4B3SL 1D2BA 5M3MB 3KLWA 1VQLA 2E5LQ 4DAMA 4KD3A 3K5LA 3KLSA 2FMCA 1CT1D 1N32Q 2H5XA 2RQXA 1EUJA 1TS5A 1JE5A 1VQ6A 2KEDA 3I8ZA 3HOUH 4DR2Q 3BYYB 2EY2A 1JOQA 4JI0L 1HNZQ 5JJLA 3DM3A 3F2UA 1BVSA 4GNXB 1STBA 2GN5A 2MGSA 3L3OC 3SHLA 4LFCL 2UXCL 4X3SA 4JI7L 5J3BA 1CHQD 2A68D 4M1UB 2A6EC 1YNND 2WV6D 2ICEC 5FOBB 4A3EB 3OMCA 1NSNS 4HJ9A 1CI3M 4JI7Q 1SBBB 4LFAQ 4J15A 1F2MA 1YJNA 1IYVA 3HOYB 4LUZA 4Q0FA 3CAMA 1E3PA 3S1MH 4IUTA 1E2WA 1Z7TA 4DK1A 1JR0D 4DV6Q 2JA6G 2B2WC 1AW7A 3CCRA 4ME3A 4ALPA 3G6EA 4JK1C 5TSSA 4DUYQ 4K14A 3E9HA 1VQOA 3X3MA 1WTOA 2JA7G 3K80C 3DEOA 1PHJA 2WAQE 2PO4A 2J7ZA 4JI6Q 4DV6L 4UP8A 1JMCA 4FYDA 2QKIC 4JBKA 2IT1A 4BY7H 5D65A 1KNAA 2A73B 3K0XA 3WOEA 3CC7A 1C8CA 3H91A 1IKLA 4DAYA 3W5OA 1R9TH 3OMGA 1NMVA 1PRTC 4DV2L 2Z6KA 2ZQVA 2AQ1B 1Y69U 4AH6A 4AIMA 3T1YQ 2M00A 3MXGA 4JI2L 2F4VQ 3CPWA 3HFZB 1I4XA 5C3WA 3A55A 1CHPD 2JA5G 3M4QA 1DOLA 3S15H 3TMEA 1KRTA 1ESFA 3R2TA 1IBKL 4A3CG 2ES2A 3G4SA 4KY7A 1X56A 5IYCG 1XJVA 4K6LA 2HIXA 1GUSA 2N49A 4PZ6A 2AHOB 4LF9Q 1BOSA 3S9WA 5KIXA 2R93B 3MQGA 4GOPB 5CV9A 2Z4HA 1WR7A 3CKIB 2NWGA 3F1ZA 5IYCH 2E74C 3LE4A 2JEAI 2F21A 1NTGA 4QUCA 4GLAC 4C3IG 2K6AA 5E64A 3E6ZX 4DK0A 1HQMC 3K7UC 2HIVA 2ZJRA 2XP8A 4DR5L 5EGTA 2N8NA 1I6VC 1IKMA 4RG1A 3L9AX 5J22A 3QB3A 2E2DC 2NN6I 3QIAA 2N3SA 2KBNA 3GV3A 4POGA 2NVTB 1PXUA 4JI3L 2F3IA 2K52A 1UE1A 3GTMH 4A3GH 1PZKD 4P2CB 3BDLA 4OO1H 2PQAA 3PGZA 1BCPB 4A3JB 3FHWA 3NTHA 1UWVA 1A2TA 1OXUA 5I9PA 4H13C 1N9WA 2M2LA 1IL2A 4KY6A 1XYIA 2PW5A 4ZKBB 4OX9Q 5FKAC 3MZ5A 2QRVA 1QVGA 2RDHA 1Q8IA 3IL8A 3RNUA 1MI2A 4HJ7A 1KDCA 3AEVA 4KN4C 2IPKD 2BA1A 3L7ZC 3Q24A 1TWAH 2WKCA 5IGFA 3KDFB 2KOLA 4F88A 5EPJA 1X32A 2C35B 4DV1Q 3J7AV 3LWUA 1DGSA 4NP5A 3MA2B 4HIMA 2F4IA 3H6MA 3JAMi 1EU4A 3ULLA 2PMZE 3ULPA 3KF8B 4U68A 2LXKA 1PFBA 1N34Q 1QOHA 3FEWX 3DWPA 5LMNW 2UUCL 2UUBQ 4ID6A 3V2TA 1I94Q 3GTKB 1HPCA 3OYYA 4PMCA 1I4GA 1A63A 2B2VA 5M5XH 3J80E 4GLXA 3A5ZB 1I50B 3U9SA 1A3VA 2RBMA 1AE3A 3HOWG 2F52A 1EOVA 2C9OA 3FMCA 2L4JA 1RTOA 2K04A 5FLMG 2UUBL 3GTPB 1Y8PB 1YIJA 4KI0A 4B3SQ 3HEJA 2UXCQ 2F0LA 3RZOB 1EYCA 3HOYH 3PMFA 1HZBA 2F0KA 3MVVA 3RLFA 2HCIA 4F87A 3PSIA 4RH6A 1A8VA 4TRDA 3MXNA 3H3VH 1SMYC 5IP9H 1EIGA 3NSWA 1CKNA 1EY0A 1VQ8A 4XQJA 3T51B 1SJHD 4QF4A 3IAYA 4U673 4FXGC 1BCPC 5A2QL 1JJCB 5C4JH 2ENBA 1IHZA 1WCMB 2R7ZB 3BDCA 1B9NA 1WOCA 4QB4A 1CA6A 2Y0SE 2WFWA 3GTKH 3MXUA 3P75A 1PTOB 3BJUA 3QJYA 1NE3A 1Q46A 4TSSA 1VQIA 2L4NA 4KKSA 2H4OA 3LNNA 4WORA 1L1OC 3HOVH 1TY2A 1JOOA 2IY5B 4BXXH 2ZM6Q 2FINB 3PO3G 2SDFA 4RCNA 3CHBD 4DUZQ 2I5LX 3X3NA 2B2TA 5E4WC 3K58A 4MTNA 4ZUIA 1XX8A 2M8IA 2CVRA 4B9WA 1CM9A 1S5FD 2TSSA 2XIWA 4JG2A 2BDNA 2ZQTA 2NZ1D 4X62L 1F9RA 2B2YC 4QUFA 1R9TB 2B2UC 4X65Q 2AQ3B 2F0DA 3RLOA 1VF5C 1XMOL 5J39A 3OOBA 1BBUA 2VL6A 3CCJA 1X54A 2B29A 1LTAD 1I3QH 1B4OA 2AWNA 4UP9A 1NMGA 4Q5VA 1OXSC 4R8NA 4APVA 2IX0A 1WVLA 4ZQ3A 2D9UA 3KLSX 4O0AA 4KJNA 4IPDA 3U50C 2QF7A 2R92G 1W3SA 4JOIA 3OIPA 3QWNA 2ZAJA 2G9HD 2QCPX 3STBC 5LMUQ 3FPPA 2N55A 4U84A 2XSCA 1SYBA 4GOPC 2JP1A 1JE4A 2YTVA 5BN3A 4C1NK 3CD6A 2R3ZA 1QCBD 5ELBA 3NP8A 4GNXC 3U4VA 4RGMA 4ZKCB 2Q8TA 1E0BA 1ENFA 2B2TC 3M9BA 3RUZA 3GDEA 1MD2D 2QILA 1AP0A 3NTPA 4MHEA 5ISRA 1LO5D 4TQUS 2OXPA 3DHQA 1PH7A 1JORA 1CKMA 1AZQA 4DR3L 4B3ML 4OO1G 5M3FB 4G7ZC 1F77A 2LXJA 1CK1A 4FXDA 2PNRC 4A3FH 3HOUB 4PV1C 3KAIA 2Q8RE 3A0JA 3GD7A 4YCVA 4EX5A 1A6XA 3BS1A 1PTOF 2YSGA 1IBML 1DJRD 2EYPA 1PZJD 3M3YB 1Q90A 4K2KA 3EVQA 2K5NA 2VUMG 2B8FA 3K5MA 1TWGH 3KK7A 3CCUA 2DMVA 1SNMA 1NY4A 1WI5A 2KHJA 4GOPA 2E2IH 4PMBA 3TCZA 1C0AA 5IT9L 1K8GA 1J9OA 2F0OA 4NPSA 3MC0B 3A56A 5FLXE 4XQQA 3FPUB 1J8IA 1X65A 2VQEQ 4PZ7A 2NZOA 1NBWA 1K8OA 2F0GA 1RHPA 3Q23A 1PTOD 1EYGA 4DXGA 3I55A 4RHSA 3RZDB 2BDOA 4DR3Q 4L5SA 3S1QH 1VQNA 3S2DB 1MKHA 4AQYL 4Y7NH 2B63G 4A3KH 4LFBL 1PDQA 1FD7D 2N88A 4ZUJA 4YWLA 1JJ2A 1C4QA 1KIXA 1JQYD 1SYDA 2ZXOA 1KC8C 3M7GA 3MXNB 1SJED 4BS9A 2JA8G 4ILWA 3K57A 4C2MB 4NDXA 3R8BA 1YNJC 1V8QA 5HGTA 1RL2A 1N34L 4QMGA 1AN8A 4B9XA 2Y0SG 1A2UA 1LTRD 3EBEA 3MEHA 2NYZD 3G7LA 5AFWA 4NXNQ 4GKJQ 5IGDA 2RDGA 4BWGB 3NBHA 5EQ0A 2IX3A 5GADC 3FKIH 4HCSA 1WTVA 5CV8A 1HXYD 3C2PA 4HIOA 5CBAE 1EU3A 1SLJA 4DK3C 1Y1VB 5CV5A 4C1NI 4BBRB 2K05A 1BXTA 3CRKC 2JA9A 2RE3A 4X66L 3S24A 1ZCNA 2ITKA 3GTOB 3CC4A 3GTJB 2XP4A 4GLVB 2Y0SB 3F2CA 4S3SA 1JMQA 3N52A 2RF4A 3ER0A 1DXMA 2JK8A 3PIPA 1MJEA 5ELEA 1VQEA 4YWKA 4K5XA 2F0EA 2HQEA 2D2CC 2RSOA 3KJOA 2YSFA 1S72A 2EYHA 1V1QA 2B39A 2VUMH 1EYAA 1MIUA 1SNQA 1JWUD 4KTAA 3QO2A 1F9QA 5C3XA 2Q8IB 1S3OA 3RZDH 3URYA 4HIDA 1SE2A 1XMQQ 2ZJQA 1PH2A 3GTGH 5CC4A 1CUKA 2IHEA 3J81j 4JYAL 4WJ4A 1WMVA 4LW1A 2EDGA 1NCVA 5GQOA 4GKKQ 5ELFA 4P71A 5E62A 1TY0A 2F0WA 5ELNA 1CKNB 3BVGA 3DM1A 3K8AA 4YCUA 4KKTA 5C0XG 1I5FA 1WTWA 3OW2A 3MFYA 5C44G 1HCZA 2YSIA 1TKWB 2A6ED 3F2BA 2Y8NB 1QVCA 1VF7A 1NR2A 3OWFA 4EQPA 3NPPA 4HIKA 4GZYC 3GQBA 2PQAB 3BYTB 3KAGA 4OL7A 4MIUA 1VQKA 3MHBA 1O7ZA 4H02A 5BR8L 3JAML 4OGQC 1EG3A 3M4OB 1EWCA 3I4OA 1VMCA 3OSOA 2BCOA 1G6PA 3KABA 1VQCA 3HKSA 4IALA 2KCNA 3KADA 2BH2A 1PFSA 3GTQB 2WP8J 3DXJC 4IFDG 1F2ZA 4R9WA 2Q2IA 3S17H 3C1FA 4J1MA 4IOAA 4L5RC 3PF4A 4A93G 1HNZL 3HOYG 4NMZA 3SDZA 3KDFA 2XPBA 1L2FA 3A5UA 1UNSA 2MNAA 2RVLA 1RIPA 1N32L 3FDTA 1XPUA 4DA2A 1U9RA 1B70B 1PFMA 3SVMA 2V1CC 3I4MB 3I56A 2LAJA 3QOJA 1STGA 2WAQB 3CMAA 4X3UA 3Q22A 1VQMA 1N36Q 1STYA 1EY5A 2F0QA 3SXHA 1QUQA 1LTSD 2ZJPA 2CW0D 1IBMQ 5I6WA 2F4VL 4A3DH 3TDBA 1B8AA 1KLGD 2I46A 3OPOA 2MUYA 4DAPA 1WYDA 1TWHH 3NBHB 1ILPA 4DR4L 1LT4D 1FGUA 5H1SE 2KCTA 2FJ2A 3AB9A 4XT3B 4GN4B 1MJCA 2EY6A 1B1ZA 4A3BB 4A3KG 4PNYA 2QDBA 5JEAJ 4PQXA 4C3JH 3FS8A 1PH4A 1RP5A 1TR8A 4QCLA 3BVZA 2LMCB 1UE7A 1SAPA 4OWWB 4RAUC 1V1PA 4A76A 1PTOH 3GTLH 3K6OA 2XWJB 3AFPA 4PZ8A 3D3RA 3CXCA 2YTXA 1S5DD 1EL0A 2EIFA 4V0BA 2I5MX 1YHBA 2R93H 2ZQSA 4RHRA 1A62A 1S40A 4PMWA 4LF8L 5BR8Q 3J80c 4JBMA 2F0NA 1Y1VH 5CV4A 4FF3A 1EY6A 2F0FA 2PZWA 1EY7A 1IW7C 1HUMA 1MSHA 2EJMA 4BA1I 2K14A 3NEMA 4YHHQ 4K5VA 1XTCD 2EJGC 1B7YB 3WOFA 2A6HC 4LUOA 3SK5A 2D0PA 4BBRG 1BNZA 4K8JA 4A3EH 4JI4L 1STAA 4DR6L 4R4OA 2A5HA 1D1IA 1YHQA 2ZM6L 4DR5Q 3A54A 2KQ3A 2JA5H 2KUMA 1VQDA 3ND9A 1V1OA 1GM5A 4H0LC 4X64Q 2O2LD 5EBCA 1PH3A 2DNEA 1EEID 4LF4L 2LSSA 5IP9G 3D31A 3KCEA 2ICIA 2SNMA 1WD1A 4HMJA 3PUYA 3P1HA 2KENA 1QE6A 1RDPD 3OOCA 4RKBA 3M4PA 2O4XA 1EG4A 2D0OA 4X66Q 1K3RA 1LTGD 1F9PA 1A3UA 5CMDA 3G71A 1O7YA 4K2LA 1HA5A 5C3EH 3KBGA 1RKNA 4JI1Q 4DV4Q 1Y1WG 1J6QA 1EQVA 3CW2C 2EVBA 2PI2A 1OXXK 1VDZA 4OIJA 2VB3X 4A4IA 2CKZB 1LM0A 2ALYB 1NAPA 4XYOA 2CQOA 1HR0W 3QOLA 1HJPA 4P73A 2E2IB 4LWCA 4E5RA 1W6JA 4A3IB 3P20A 1K9RA 3CCSA 2BOSA 1I4HA 3KAHA 3UE1A 1S5CD 2A19A 3BVMA 1PH1A 1Z47A 3HS0C 2OCEA 2K32A 2E2JB 1EIFA 1TIID 5IY0A 2RDFA 4ABNA 5KYIA 4IJHA 3K5NA 5LHY1 4QQBX 4RA8A 3LKXB 1TXYA 3D8GA 2N78A 4FF2A 3ERQA 4CKBA 4U85A 2Q5AA 5DM63 4A3GB 2JA5B 3BG3A 1U4MA 2IHFA 2ZTEA 5EJWA 5M5YH 3TP5A 3PO3H 1MGSA 3R93A 5LL6S 4DFAA 4FF4A 4ZK9B 4OX9L 2CWPA 2DK1A 1LTLA 2BH8A 5C0XH 2XWBB 4QIWE 1I94L 2EQSA 1PV4A 4U86A 4DPGA 4CJ0B 4NXML 1Q1BA 4A3IH 3I70A 3D6CA 5KYLA 4JOIC 3UI2A 1HH2P 2VS1A 1HZAA 4G4KA 2OWOA 2NVTH 1STEA 3ODKA 3PUVA 4XYQA 1YNJD 1YVCA 3I4MG 4BBRH 2YYZA 4IUQA 5DEHA 4LNQA 1ZYRC 4NXMQ 3OIQA 3EQLC 1ZEQX 2YTYA 4A3IG 3OTOL 3T4AC 2XVSA 2OT2A 1CZGA 4HTHA 4YWMA 3S1RB 1VQ4A 2AKWB 1QZGA 2F3VA 1AE2A 4JI5Q 2SOBA 3KF8A 4E6IA 1LT6D 5I6YA 1VMPA 3PO2G 4A0TA 1X3EA 4JI1L 4DV4L 2GVAA 4X6AH 3I72A 5IGGA 4DV5Q 1S5ED 4RWSC 3BZDB 1PH9A 3LKXA 3PQHA 1HNXL 1HR0L 1RD9D 4QJFA 5C3EG 2WKDA 1G291 2I0QA 3HOZB 1N33Q 1T5EA 3DUZA 1FJGL 2EY1A 3KLRA 2NVQB 1GXDC 2E2JH 3Q6SA 3VR5A 4YHHL 4GKKL 4CKCA 1KD1C 1KLUD 2B63B 1FGBD 2DY7A 4JYAQ 1XNRQ 3OWEB 1HHVA 3KOJA 4A3FG 4BY1B 4FP5D 4R1JA 5JJZA 3BZCA 1N33L 5I9OA 4KY5A 1PZID 4Z9CB 5J1ZA 2MQHA 4C3HB 1H9MA 5A2QE 5CORA 5EKKA 4KD4A 5IP7G 1BCPF 2X6GA 2DWVA 4EGVA 1VS0A 3TRZA 1CKOA 4ZAIA 4JI5L 5M3FH 3HOZG 1L0XB 2R7DA 2HDLA 5U47A 2JA8H 5LMNL 1VQGA 4OO1I 4FF1A 4DV5L 1IBKQ 1KHIA 4K8IA 3D4WA 1K8AC 4DV3L 2Z6KC 1O7LA 1DOKA 2WADA 4RMFA 3SEBA 5JJIA 4RKLA 3S15B 4H44C 4CBVA 2DUDA 1SN8A 3MXPA 4GS3A 1LT3D 1LT5D 1UE6A 1HNXQ 4CHTB 4BY7G 3HOZH 1EIHA 1B3AA 4DNTB 3U9OA 3S2DH 2DN8A 4LF6L 3VYUA 1GUNA 1YZ6A 1ONLA 3PO2B 3GTMB 2DK7A 2YV5A 3NK9A 5KEEA 3DWQA 3CPFA 3D0FA 5FLXc 1QNUA 4RCOA 2EOTA 4ZYSA 4KLKA 5FO9B 3ND8A 2QEXA 3FSBA 4BA2I 4BBSB 3RLNA 1SNDA 4JI4Q 1L1OB 3WDNA 3HG9A 4JV5Q 2EE1A 4L8JA 1JB3A 4OWTB 3AMUA 1VQ5A 3KF6B 1BO0A 1QWYA 2AMCB 1S5BD 3S1NB 1I4PA 2A68C 3QG1A 1D5ZC 4HN7A 2SNSA 2M9VA 3TZDA 1K0RA 1TWAB 4O42A 2WACA 2NVYB 3ZYYX 3EFXD 4LFBQ 1II3A 1GUGA 4UY8C 4LF5Q 3BU2A 2PMZB 3T13A 1BDOA 1W2BA 4A0UA 4QGUA 5I2YA 2IWHA 5HGQA 2XP3A 1TVXA 4GKJL 2L5TA 1RCVD 2NTTA 3N6RA 2G9DA 4R4IA 3EROA 3H0GB 1H9KA 2K5QA 4KK7A 1CZWA 1X55A 1ASZA 2HDMA 1G2SA 3VR6A 3J7A5 3I4NH 1TK7A 1JCKB 1PRTF 4ME5A 5A35A 1I4QA 4HEDA 1SFOH 4DGZA 2CWAA 3A8JE 2HHHQ 3WH0A 2JX8A 1VQJA 4AYBG 1VCIA 3FVQA 2VW9A 4IPGA 1DOMA 5G3LF 2EPBA 2ZTDA 4AQYQ 1YJWA 1XXGA 1GO3E 5IT9E 2OTJA 4K6DA 1Z6HA 2K1BA 5C4ZA 2R7FA 3A7AB 1AH9A 2F3WA 3VA7A 2EYLA 1T9HA 2V4DA 4POFA 1TQOA 2R93G 1HA6A 1IZ6A 1U4LA 4EVOA 1B44D 4KJOA 5M9OA 2KCMA 4X64L 1T5XD 3CMEA 5CYUA 2XRQD 3J7YW 3FKIG 2Z1CA 1FNVA 1SYCA 3HKZG 4B3TL 3CQZH 5JPMC 4IOCA 1B9MA 4G7OC 2L1BA 4HCEA 1NUCA 5IOCA 1LTBD 3OHXC 2GVBA 4P72A 1G8ZD 5C0XI 4A3MH 3NHHA 1WJJA 3HOUG 3Q0AA 2VY3A 5C6AA 3I4LA 2F0HA 1IW7D 1WTPA 1Y1WH 1D6EC 2R92B 5E7NA 3CCEA 2YU9H 4JCVE 2IL8A 1TWFB 2CFMA 5FJ8G 4A3DG 4OHJA 1J5EQ 1KAAA 5FO8B 1I6HH 2JE6I 1EOTA 3MWYW 4R8IA 2MFIA 5E4XA 2MO0A 1Q86C 3HOWB 1V1PB 4A3LH 4R4CA 2K5WA 2ZR4A 4WRDA 5C4HA 3OW7A 3E0EA 1K83B 2NZHA 3MCBA 2FFKB 5E1FA 5KNBA 1HZ9A 5IYBH 1L1OA 1RJTA 2A69D 5M3FG 1V9PA 4KN7C 3H09A 5C3EB 2JXWA 1D7QA 2F0VA 3T1HQ 4A3DB 2B2VC 3S16B 1PFNA 3RN2A 2EJFC 3DWAA 4K0KL 1HFNA 3NQTA 2K33A 2A8VA 1XMOQ 2HUGA 3J7AF 1HR0Q 1Q12A 2LS01 1CFMA 2K5HA 3HOVG 1FNUA 2Z8LA 3IFDA 2JA8B 1RODA 3E5SA 4LMQD 1A0IA 1U4PA 1PH6A 1E1OA 4X62Q 5AJ3Q 1TWFH 1Q1EA 1NJIC 5ELOA 4X65L 4IQZA 1HNWQ 2F0IA 2WINB 3TP6A 2EYJA 3KAFA 2AWOA 4FXKC 1R4PB 5HURA 1JWSD 4C3HG 2NN6H 4UDUC 1ILQA 2OTLA 1STNA 3K0YA 3HOWH 1FLCA 5E3FA 5CV6A 4DV2Q 1Q81C 4DUZL 4XXEA 1CA5A 2D62A 3L2PA 2LFNA 4EQOA 2R92H 4C3IB 2DGYA 1QG7A 2B2UA 1IYUA 4I7ZC 3LWEA 1Y1WB 4EQ5A 2KCCA 4L6TB 1GOZA 1CTMA 3EJIA 2UXDQ 1YITA 4DR1L 2FXQA 3SK8A 1LV9A 1H9SB 2HT1A 2X6LA 1O7IA 3DEPA 4IFDI 2ZQUA 4LF7L 5CGKA 1BF4A 3KFUA 2L9HA 1UEBA 1K83H 4DU9A 4O2DA 4A3EG 4A3JG 3KBXA 3U4ZA 1LYLA 2O5IC 1E2ZA 5ELDA 3C1EA 1UE5A 3CRLC 3VYSA 2PQEA 4AYBE 3KYHC 4Y7NB 4BBSG 2RKSA 1AFPA 1BKBA 4XIGS 3V96A 2K4KA 4DAVA 2XP6A 1BBWA 3HZXA 2IW3A 2E45A 3UDIA 4GN3B 3S14B 1CSQA 3T56B 3NXWA 1L0YB 3GV6A 2A69C 1GKHA 2VQFQ 5K36G 1EYDA 1PLFA 1EFWA 1Y14B 4A3LG 1KRSA 2K7VA 3D4DA 4DNRB 4WJ3M 2UXDL 3MAQA 4RFBA 1KTKA 3DMUA 2EYOA 3GP7A 1K8MA 3NELA 1DZ1A 4JI8L 4CGYB 3UDXA 3EIVA 2WB1E 3M3YH 2QA4A 1PTOC 4LF8Q 5C44B 2RCNA 1SFOB 3GTQH 3TP8A 5I4DA 5IWAQ 1X3GA 2PZTA 1G51A 1X9NA 5CQ2A 2K01A 1K9MC 3EN2A 3L4HA 1SNOA 3SK6A 3L0OA 3UDFA 2GA4B 3NE5B 1XTDA 1EWHA 2JA7B 5FLXL 2AUKA 3Q8DA 2E75C 3HKZE 1CQVA 1DONA 3ZJYC 1VQPA 1TU2B 4LF6Q 3H3VC 4IN3A 1GVPA 3M85A 5E66A 1SEBD 4UPAA 2SEBD 1XPOA 2EYFA 1YI2A 4IUNA 1PYSB 2Q2HA 3NTIA 1KABA 2RHQB 1HTLD 3KUPA 1FNWA 2PCFB 3GTOH 4MZ9A 3TS0A 4N9TA 3M4YA 4YCWA 3BZKA 4JBJA 1RTNA 2XNAC 4B3MQ 3H15A 3S1NH 2B2WA 3T16A 3PO2H 4A3MB 1OO9B 2AUJD 2UUCQ 4JI2Q 3AU7A 5C4XB 2BE5D 3FKIB 2XTIA 3LGJA 4BBSH 2JJQA 1EIYB 1H95A 1IBLQ 2A1AA 4DV0Q 2OEOA 4A3BH 5CR3A 1K73C 5JPNC 2UU9L 1S4ZA 5M5WH 3GTGB 3MEFA 1CSPA 4L5QA 1HFGA 3GTLB 4N9PA 4J8QA 3C3LA 4IUPA 2MPMA 2XRSD 3VDYA 2WIIB 3PUWA 2WAEA 1XMQL 1LTID 1JB7A 2NVYH 3H3VI 1ET9A 1EWIA 2E5LL 2J4XA 2UUAQ 1V43A 1QZHA 5FJ8H 2I07B 2MO1A 3S1QB 2M8JA 1RF2D 5M3MH 3JC66 1KQSA 3CCVA 4XQNA 1UEAB 3KJPA 1B53A 2M3OW 2EYMA 4B08A 1SMYD 1QVFA 1L0WA 5C4JB 2ASBA 2JEBI 4BY1H 4A75A 1IBLL 3K5OA 3WWVA 1GD7A 1JJGA 4MN3A 2F0TA 3H0GH 3ULJA 3SK4A 1O6WA 2VNUD 5I2XA 4REXA 2MHVA 3W1GA 4JI0Q 3MCBB 5C5LA 3HOVB 3S1RH 1E1TA 2A74C 2R61A 4A3KB 1WFQA 2JA6B 1OTCA 1KXLA 4RGOS 2B2YA 2Z0SA 1B50A 4DKAC 3JAMc 1XNQL 1EY9A 3U58A 4DXFA 2JSOA 1I4RA 3K81C 4KHPQ 4NKLA 5FLMH 3CF5A 1ENCA 2F03A 2AQ2B 4HMIA 3V05A 1KL9A 5GAHC 2R7ZH 4KHPL 1SDFA 3C46A 5EAYA 1LUZA 3PV0A 4L63B 2NB0A 3FSCA 1H9JA 3CCMA 2I5HA 5IE8A 3I7FA 2CQAA 5F2DA 3I2ZA 5LL6X 1M90C 2KECA 2B8GA 3M7NA 3AQQA 4A3CH 3J7ZC 1PH5A 5KNDA 2BA0A 1JC7A 1WD0A 1AEXA 4XTCS 5JEAH 3J81L 3E9IA 4JI3Q 3I4MH 1F8AB 2YU9B 3IRBA 5COYA 3FRPB 3SGIA 4LF9L 1EQTA 3D6WA 4ODGA 2ZT9C 1D5MC 3MQHA 2QGQA 1GJXA 2TMPA 1LABA 5E5WA 1H9RA 5JEAG 1O78A 2DJYA 2L55A 1KDBA 2DY8A 2UXBQ 1ET6A 1LTTD 2RSNA 4C3JB 2MDIA 5M5YB 5M3MG 3OTOQ 3TC5A 1JOKA 3PO3B 5IWAL 5CV7A 1ZXTA 3GO5A 4IUUA 2JA7H 4RGTA 2ZXRA 2F0JA 3TDQA 3TQYA 3S16H 1VQHA 5JVH3 5DNFA 2L15A 1GHKA 2J0TD 4KHZA 4JI8Q 5JVG3 1A15A 5AHTA 1YEZA 5LMNQ 3VYRA 3PCOB 1SROA 4A3GG 2XN9C 1X3PA 4XT1B 4IJLA 1JT8A 3K7AH 3CCQA 2Q2TA 2NUCA 5IT9c 1M1KC 3CNGA 2VXWA 1WCMG 2KA7A 2D5DA 4TVAB 1TWGB 4DV0L 1OXTA 3CU7A 1X6OA 3AYHB 1NMFA 1Q82C 4KMUC 2PYKA 4FDBA 4Y52H 2K03A 5C0XJ 1VQAA 4G57A 1SNCA 3T53B 4NW2A 4KV6A 3PIO3 1WCMH 1Y1VG 4GN5A 3J80L 3IFTA 1KDAA 1QNKA 5GROA 5JOBA 3R2IA 2XPAA 1UAPA 4B3TQ 2E76C 1XWEA 4DV7Q 4HJ5A 3PUZA 5GAGC 1BUVT 1BCPD 2KHSA 4JC0A 4IFDJ 4WJWA 5M5WB 4DR4Q 2VQFL 4DR6Q 3T1YL 2B3GA 4IO9A 2NVQH 5IYDG 1QILA 1Z9FA 4LF5L 5DAUA 2RHSB 1F9SA 4DK6C 4B3RQ 1ML0D 4A3JH 1EZ6A 4C2MH 4QIBA 4ZLTF 5DLQE 4OONA 5T1GA 4UP7A 2LKVA 3G6JB 1HNWL 1ENAA 4C56C 2KXQA 4H7BA 4M8AA 3HRZC 1HQRD 1E7ZA 4A93H 3B6YA 3CCLA 2F0PA 4DR2L 4A3MG 1D1KA 3PF5A 1P16A 2FMMA 5EKIA 2C5CA 5C4XG 3CQZB 2JMFA 4F8MA 3I73A 1G2TA 2O5JC 5T1IA 3K59A 1DD2A 1PA6A 4IZ8A 1GHJA 3STBD 1F2LA 5KGUA 1QJOA 4R4QA 3I4NG 4B3RL 2LY7A 5K36H 1WTXA 4R4TA 1C48A 2E2HH 1JICA 1E2VA 4DV1L 2FHTA 4I65A 1J5EL 2H1EA 1EQRA 3E0JA 1AZPA 2JA6H 4DV3Q 4P74A 5M5XB 4HJAA 2KEEA 4FNFA 5KRUA 4DR7L 4BY7B 1Y8OB 5IGEA 2F0UA 2F0MA 1HRJA 2WB1B 3NENA 3ICEA 3ERSX 3S2HB 1F2YA 1BR9A 1TWCB 2ZR5A 4HR7B 3J81E 3HOXB 1LACA 1BQQT 3LX0A 5EPKA 4GNXA 2JV4A 2K75A 5IGCA 1I5HW 4A93B 3TZUA 2UU9Q 3GTJH 2MP1A 2IX1A 1U4RA 4YY3L 5IP7H 5K5PA 5LMUL 2PNHA 1EZ8A 3PIP3 3T1HL 1FYCA 3RMHA 5C44H 4FO2A 4WFN3 2R6GA 1YJ9A 4PG3A 3J81i 2Z4IA 5EKLA 5FO7B 1STHA 3VR3A 1WTRA 3TBIB 4ZRZA 2B63H 5IYDH 3S17B 5KNCA 4IUVA 1Q3LA 2NN6G 1VQ9A 1GUOA 2YSBA 3O13A 3ITPA 1ZYRD 3RZOH 1TR5A 1SRUA 2ZR6A 1YHAA 3R3OA 5IODA 5D14A 2JQOA 4HJ8A