3M85A

Archaeoglobus fulgidus exosome y70a with rna bound to the active site
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
179
structure length
179
Chain Sequence
b'MRFVMPGDRIGSAEEYVKGEGVYEEGGELFAAVAGKLIIKDRVAKVESISPIPEIVKGDVVLGRVVDLRNSIALIEVSSKKGENRGPSNRGIGILHVSNVDEGYVKEISEAVGYLDILKARVIGDNLRLSTKEEEMGVLRALCSNCKTEMVREGDILKCPECGRVEKRKISTDYGKGEW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein AF_0206
publication title Quantitative analysis of processive RNA degradation by the archaeal RNA exosome
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase/rna
total genus 36
structure length 179
sequence length 179
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10447 EXOSC1 Exosome component EXOSC1/CSL4
A PF14382 ECR1_N Exosome complex exonuclease RRP4 N-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3m85A03
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3m85A01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3m85A02
3GDEA 4A3BH 2Z6KC 4GKJL 1TKWB 4LUZA 3MEFA 1A6XA 1TWAH 4X66L 3CC4A 2MNAA 3MXNB 3TS2A 1IW7D 4JI4Q 2R7FA 2HHHL 5AJ3Q 1GUNA 4FDBA 1JT8A 1T9HA 4KKTA 4WJ4A 3I4LA 2EQSA 1LUZA 4MZ9A 1FYCA 1ASYA 3E0EA 1OXSC 1H95A 1O7IA 3NBHB 2JQOA 4IJHA 1OXUA 4A3MG 3G71A 4ALPA 1YVCA 4DV4L 1QVGA 1KL9A 1PH2A 2F4VL 4DK6C 5IY0A 2PQAA 3S14H 3KDFB 4JI7L 1Q12A 1P8LA 4JV5Q 1CKMA 1QUQB 4OO1G 2A69D 3OW2A 5FLMG 2I5MX 4OX9Q 2DMVA 1ZYRC 3UDGA 1M90C 3ERSX 3CCMA 4R1JA 3K8AA 3UE1A 1KC8C 3VA7A 3L2PA 1HNZL 2NVXH 3TDBA 3S1RH 1YZ6A 4DKAC 2R7ZG 4DR3Q 2R93H 2IX1A 1SMYC 3CNGA 3K7UC 5BR8Q 2EJFC 4YY3L 1C0AA 4DUZQ 4GNXB 3T51B 1Q86C 3S1QH 5C0XI 3PIPA 2B63G 2JA6G 4UY8C 1BDOA 1K8OA 1Z47A 1EG3A 4A3LH 2ZAJA 4XTCS 1XPUA 4LFBQ 3I72A 2UXDL 2XP7A 2OQ0A 2MO1A 2A1AA 1Y1VH 4KKUA 2XPBA 1EWIA 2VZAA 5IT9c 3FHWA 1S3OA 3A0JA 1IYVA 3CMEA 2KBNA 4R4IA 3I4NH 2K5VA 1S72A 2KHIA 2CWAA 5JJKA 5AHTA 4YHHL 4A3KH 1WCMH 1V1QA 3RN2A 2UU9Q 3T1HL 2RCNA 4APVA 4LF8L 4DR2L 5H1SE 3HOYH 4K0KL 1UE6A 2YSGA 1EWHA 4DR4Q 2OTLA 1E2WA 2MDIA 2AMCB 3IFTA 1LM0A 4QY7A 5BN5A 4P73A 2LXKA 1CTMA 4POGA 1J5EL 4PMWA 1HZAA 1UE1A 2CFMA 1B9NA 3CCUA 1JE5A 4OONA 3J81j 4H02A 4O2DA 3GTPH 4J15A 3KAGA 1EIFA 3RN5A 5LMNQ 2GVAA 4MNOA 1YNNC 3GTGH 4OO1I 4LF9Q 1VQ9A 4PZ6A 2NVTH 3HOUH 2NZHA 2YTYA 4DV2Q 1KIXA 2MO0A 1BVSA 4U86A 4UPAA 4X65L 4JI8L 2O5JC 2BE5D 3BZCA 1ONLA 1B9MA 4JG2A 2JE6I 4OWXB 4X64L 1HTPA 1Y1WG 4EQ5A 3GTKH 1SLJA 2NN6G 3T1YQ 3J81c 3TCZA 4IOAA 1Z6HA 1QVFA 4LWCA 3L7ZC 4B3RQ 3F2BA 2UUBL 1K83H 4A3LG 5GROA 2PQAB 2YTVA 2E45A 3ULJA 1YJ9A 3PO2H 3RLOA 4A3JG 2Q2UA 1X55A 4DV6L 1G291 2D62A 4JK1C 1EOVA 2MFIA 1N32L 2VW9A 1GUGA 4A3GG 4NXNQ 4X6AH 1G6PA 1O6WA 1XPOA 3ZJYC 3WDNA 3STBD 1WCMG 2N49A 2ES2A 4YWLA 3I56A 2FXQA 1G51A 3HKZE 3CPFA 3PUZA 3HOYG 2ID0A 4DV0L 3PO3G 3WH0A 2VQFQ 2KENA 3K80C 2ATWA 1VQBA 3HOZH 2KCMA 1VQDA 1O78A 5JJLA 5IP9G 4P71A 4JI2Q 3GTMH 1IBML 2WB1G 5GAEC 2UUCL 5IYDH 1V9PA 1PINA 4OWTB 1K8MA 4E5RA 1YHQA 2WAQG 4REXA 1FL0A 1VQ8A 3JAMc 4YCWA 2A8VA 4JYAQ 3G48A 3S2HH 2D2CC 5IWAL 4DR1L 2JEBI 1X6OA 1P16A 3L0OA 4JI5Q 4H44C 2XTIA 1JMQA 3I7FA 3OTOQ 2XP9A 1VDZA 3CCEA 2JX8A 5IP7G 4LW1A 3KF6A 1MJCA 4NB3A 3EN2A 2CWPA 3CCRA 3J80c 1LYLA 5C3EH 4GKKQ 2BA1A 4LNQA 3F2DA 2IHEA 4DAYB 3CCSA 3H0GG 1S40A 4IFDJ 2I5LX 3M4QA 3CCLA 3VR4A 4KLKA 1ASZA 3I4MH 3T56B 3CP0A 3W1GA 2UXBQ 4A3MH 4AYBE 2QEXA 1D7QA 1QZGA 1VQ4A 3BU2A 4JV5L 2E8GA 4DUYQ 1KHIA 4X62Q 1KRSA 4A4IA 1SR3A 1DCZA 2K32A 1XPRA 2NZOA 1XNQQ 5IYCH 5KNBA 4DNRB 1VQHA 1WI5A 5FLMH 1VQFA 3HOWH 2BH8A 3BDOA 1RL2A 1T5EA 4HIKA 3U4VA 3D31A 1YNXA 1I5FA 3RR5A 1N36L 1BBUA 1V43A 1EYGA 2R7ZH 4DUZL 3NELA 2LMCB 2BE5C 1B8AA 4QQBX 2KCCA 3CCVA 3CQZH 2M8IA 2UXCL 4DK1A 3HOXH 2YSIA 4KI0A 4R4TA 1GVPA 1XJVA 1K9QA 2B63H 2JA6H 4LFBL 3PV0A 3UDFA 4L5TA 3CC2A 3KABA 1E1OA 5ELOA 1PFSA 5GAHC 3N6RA 1KD1C 3KAHA 1UWVA 2UUAL 2M3OW 4B3TL 3W5OA 4DNTB 2YYZA 4JBWA 4AQYL 2A6HD 1FVIA 1E1TA 2EJMA 2YSFA 3ULLA 1YW5A 2OWOA 3KLWA 3HKSA 2ZR6A 3D0FA 2Y0SE 1WOCA 4A93G 1PVOA 5GAGC 4JI0Q 1CKNA 1L1OA 3GTLH 5GQOA 1TWFH 3M4OH 5A35A 3F2CA 2YU9H 3MFYA 2E5LQ 1XNRL 2HIXA 2HIVA 5M5WH 3GQBA 1M1KC 3HOVH 2DN8A 5C3EG 4G7HC 4EX5A 3CPWA 3FKIG 2ZQSA 2Q5AA 1PH4A 4QGUA 1K9RA 4HIMA 3I4MG 4TKOB 3S1NH 1L1OC 2DK7A 1TU2B 1IBKL 3OW7A 2PNHA 1VF5C 2C35B 3DM3A 3AB9A 1NE3A 1Q7YC 1GO3E 4LF4L 2A68C 4NXMQ 5IYCG 3KAFA 3PUVA 4LUOA 1ZKOA 4LF9L 4DV5Q 2XP3A 5IE8A 4PZ8A 1VQAA 2Q2TA 3TC5A 1N9WA 2YSBA 4C3HH 3HOWG 1EQQA 1DXMA 1XMQQ 1HZ9A 3KF6B 5C0XJ 4DV3Q 1YNJC 3M4PA 2HT1A 1IYUA 4BA2I 4I7ZC 1N33Q 1PMRA 1YBYA 3S24A 3TS0A 3QJYA 1UEBA 3CF5A 1SE8A 2N78A 3HOXG 1Y1WH 2IT1A 2NN6H 2JEAI 1ZCNA 2XP5A 2VY3A 1QZHA 2ZJRA 1OXVA 1K9MC 1J6QA 2ALYB 1CSQA 1HNWQ 1HZCA 2BA0A 2DJYA 4R4QA 3U58A 1R9TH 4GOPA 1H9MA 1A63A 1YIJA 1PH6A 4U84A 2B29A 1Q1EA 4A3JH 4B3MQ 1EG4A 4AIMA 1U5KA 1X3EA 4A3GH 1VQNA 3A7LA 1LTLA 1KRTA 1A8VA 3NENA 1SMXA 2XP4A 4GOPC 5BN4A 5FLXc 4DR6Q 4A3DH 1GKHA 4JI6Q 3JC66 4LF6Q 2XP6A 4DR5Q 1NMGA 1GHJA 4L5SA 4JI2L 3PO3H 3HOVG 1EFWA 5M3MG 3FP9A 3ER0A 5IP9H 3KFUA 1VCIA 4KHPQ 1YITA 3H94A 3SE0A 4ME3A 2RF4A 2ZTDA 1I94L 2F52A 4HJ5A 3S1MH 2LSSA 4GKJQ 2ZR4A 4BY7G 1TWHH 3PCOB 3OTOL 3D4RA 4A3IG 4P75A 1E2VA 1AH9A 2HHHQ 2AHOB 3VR3A 4DV1Q 2JK8A 3LNNA 2D0PA 1KXLA 4LF5L 5IP7H 2L15A 2ZQTA 2LAJA 4GKKL 1CKNB 1L1OB 1OXTA 1SRUA 1CI3M 2A6ED 3F1ZA 4AYBG 4OWWB 1HR0L 4DV4Q 3AFPA 4QJFA 3TEHB 1IW7C 4LFCL 3VR5A 2F4VQ 2L4JA 4G7ZC 2VL6A 3CXCA 1X9NA 3H0GH 2QF7A 4P72A 2UXBL 3J80i 1L0WA 1Q81C 3M3YH 4L5QA 4GN5A 4JI3L 4TVAB 1Y14B 4G7OC 4IPCA 4RG1A 2QGQA 1X3GA 4DUYL 1IBLL 3RZDH 1L2FA 5C44G 1K73C 3L4HA 5JJIA 1CFMA 1C9OA 1XNQL 1HNZQ 4KN4C 1HNXL 2PPBC 3UE0A 2A69C 1V8QA 3CCQA 4YY3Q 1DD2A 3ICEA 5ELNA 3CCJA 4R4OA 1DGSA 2EVBA 3CAMA 2EXDA 5HY6A 2EDGA 4OXPA 4BXXH 1CSPA 2IX0A 1FJGL 2K50A 2ITKA 1IYJB 2UXDQ 4A3DG 4LF7L 1PH9A 1OXXK 4B3SL 2A19A 3BG3A 3H15A 3M85A 3UDXA 3TQYA 1HQMC 1C7YA 3A8IE 4YHHQ 4BA1I 2IY5B 3LGJA 3H3VH 4U85A 4PG3A 3T1HQ 2JJQA 1F8AB 3VR2A 1W2BA 2VQEL 2IHFA 4DAMA 3A5UA 4LF8Q 5KNCA 4DR2Q 1YJWA 3PF5A 4L5RC 1LACA 3K81C 3G6EA 1YEZA 4JI0L 4KKSA 1IZ6A 5FJ8H 3EIVA 1XMOL 2DUDA 2E5LL 2EJGC 3FPPA 4A93H 1J5EQ 3J7ZC 1WFQA 4JI4L 1I6VC 1VQMA 5AJ3L 5JEAG 4JCVE 2RHQB 2K33A 4JC0A 3FKIH 2AKWB 3T53B 2JV4A 2ZTEA 2K4KA 1WJJA 1Z9FA 1A0IA 1VQGA 1TK7A 1VQ7A 3KYHC 2ZTCA 4GN4B 2E2JH 1PH7A 3UDIA 4BY1G 3PUWA 1K8AC 1KAWA 3S17H 3VDYA 5CQ2A 1NMFA 3KLRA 1AE3A 1VQEA 1MJEA 1Y8OB 2LXJA 2NN6I 4DV5L 3LE4A 1VQOA 1EUJA 1W3SA 2PMZE 1GD7A 4OX9L 2EZ5W 3GTQH 5M3FH 4X65Q 1LABA 4UP7A 4GLVB 4X64Q 3DXJC 1K0RA 1PH3A 1HPCA 4LFAQ 3TZUA 4DR3L 3CD6A 2Q2HA 2JMFA 5BR8L 3G4SA 1N8RC 4BXXG 1H9SA 2JA8G 4DV7Q 3S2DH 1GUOA 3I2ZA 2CQOA 1HNWL 3KCEA 5M5XH 1E7ZA 4DV6Q 2V1CC 2M8JA 3AYHB 1N32Q 5J3BA 2ZM6Q 3VR6A 3TREA 1PYSB 3W1BA 1TWCH 2F21A 2NVYH 4JOIA 4YCVA 4B3ML 1VS0A 3OPOA 3B6YA 5GADC 1E2ZA 4TQUS 2GN5A 4O0AA 4DV0Q 1EQRA 1Q90A 2N3SA 1MKHA 5FJ8G 2UU9L 2JA7H 4PV1C 4DR6L 1IBMQ 3STBC 2UUCQ 4DR5L 3U4ZA 4JOIC 3A5ZB 4DR4L 2K75A 4YWKA 1Q1BA 1X56A 2YV5A 3OOCA 1NTGA 1X54A 4BBSG 1E3PA 2CKZB 5IWAQ 4DR1Q 1SN8A 5M3MH 3NTPA 4A3CG 2DNEA 1GUTA 3IRBA 4JBJA 2YTXA 2K5HA 2WAQE 2L5TA 1FGUA 4JBKA 1HCZA 1RIPA 1QJOA 2JXMB 2RHSB 4BY7H 3RZOH 2MQHA 3EQLC 4H13C 4DV1L 1K8GA 2B8GA 4YWMA 4A3IH 2VS1A 4WJ3M 5LMNL 1JJ2A 5M3FG 3QIAA 3RNUA 2BH2A 1VQJA 4Y52H 4IO9A 4Y7NH 3CRLC 4AH6A 4DV2L 1OTCA 5HGQA 1BBWA 1JJGA 2PNRC 2WP8J 1HH2P 2JA5H 3KJOA 4A3EG 2OCEA 3T1YL 1YHBA 5C4XG 2EIFA 3ULPA 4KHZA 3S16H 3OOBA 4DR7Q 4B3RL 4BBRG 3BZKA 2VUMG 1PA6A 3A8KE 5C44H 1SFOH 2KA7A 1O7LA 1EIYB 2AUJD 1N36Q 3J81i 1HR0W 2HQLA 3ODKA 2XP8A 5DLQE 3KAIA 3HKZG 3H3VI 2UXCQ 4NXNL 4IFDH 3WWVA 2B8FA 1E22A 2R92H 1IXRA 3RLFA 2VNUD 5IYBG 3AEVA 2PCFB 4DK0A 2JA7G 3PF4A 4IPDA 4DK3C 4IPHA 4JI1Q 1H9SB 3SGIA 2VQFL 5LMUQ 2Q8IB 4NPSA 4KMUC 3W3AA 1E24A 2UUAQ 1JMCA 4B3TQ 4AQYQ 3MXUA 3CRKC 2WFWA 1WR7A 3NE5B 4IPGA 1X65A 1I50H 4A3BG 1N34Q 1I6HH 3GTJH 2KXQA 2BDOA 3S15H 4JYAL 1YI2A 2Z0SA 2ZT9C 3CC7A 1UE5A 1XNRQ 4JI5L 2XPAA 4X66Q 1AE2A 2ZR5A 2A6HC 2PI2A 2I5HA 1H9JA 3CMAA 4LK1C 4HIDA 2DWVA 3JAMi 3EBEA 4UP9A 1Z7TA 3GD7A 3A7AB 1A62A 2KHJA 4GS3A 3PUYA 4GLXA 4PZ7A 4R4CA 4C2MH 1IBKQ 2OTJA 5JEAH 4HJ7A 3HGBA 4A75A 1FR3A 1JJCB 4LF4Q 3ND8A 2DGYA 2JA5G 1PV4A 4JI7Q 1Y8NB 1H9KA 3ND9A 1YJNA 1PHJA 4BY1H 3PSIA 2OQKA 2E75C 4C3IH 4X62L 1VQPA 1NMVA 1PH8A 3TRZA 2R93G 4LJZC 3KF8B 3U9SA 2K52A 2NVQH 2PI2E 1K3RA 1PH1A 1Q8KA 3KOJA 4LFAL 1X3FA 4DPGA 1VQLA 4IFDG 3K0XA 4IQZA 2R92G 4DV7L 2B3GA 3M9BA 4OGQC 2AWOA 2JA8H 3OYYA 1TXYA 1Y1VG 3RLNA 4A3FH 2ZM6L 5BN3A 4QIBA 1VQKA 2O5IC 3I4NG 2JA9A 1PYBA 3QG1A 4A3KG 3A74A 2Y0SG 4HJAA 2QA4A 5C0XH 3DLLA 2ZQVA 1H9RA 4GOPB 4DNIA 4JBMA 1BKBA 1VQIA 2Q2IA 5C4JH 3E9HA 1VQ6A 2F3IA 5K36H 1CUKA 4K0KQ 2ZQUA 4YCUA 3M7NA 1PH5A 2E74C 2JXWA 3NEMA 1B7YB 2N8NA 1KQSA 1JB7A 3PIOA 3KDFA 3KJPA 4LUVA 1NJIC 1I94Q 3E9IA 2K5NA 1QUQA 4BBSH 1GJXA 2A68D 1U0LA 4A3CH 2RE3A 3F8TA 4GN3B 2E2HH 2D5DA 4XIGS 3LWUA 4GZYC 4LF5Q 3HOUG 3J7A5 2D0OA 1SROA 4P74A 2K14A 2I0QA 3KADA 3PGZA 4NXML 1HR0Q 4UP8A 2CCZA 1I5HW 1WMVA 5EAYA 3M4YA 4LFCQ 3I4OA 2ZJPA 4GNXA 2DNCA 1TWGH 2K7VA 1Y8PB 4JI8Q 1B70B 2XGTA 1XMQL 3IKJA 2AUKA 4DV3L 4JI3Q 4IJLA 2E2IH 2DK1A 3GTOH 2A6EC 1I3QH 1IBLQ 1XTDA 5KNDA 1HJPA 1GHKA 1VQ5A 1N33L 4A76A 4IFDI 4RMFA 4QL5A 4OO1H 1IL2A 2ASBA 3PO2G 1HNXQ 2UUBQ 3A8JE 4A3EH 1WYDA 3I55A 4DR7L 5C4XH 4GNXC 3FMCA 4A3FG 3K7AH 1Y69U 5LMNW 4QIWE 2V4DA 2H5XA 4GLAC 4BBRH 2VUMH 4MTNA 3CW2C 4L8JA 1UE7A 2AWNA 1NY4A 1VQCA 2R7DA 1VF7A 2F1MA 4KN7C 1GM5A 2KCTA 5C0XG 1CKOA 1FJGQ 3Q8DA 3GO5A 5M5YH 4C3JH 4POFA 4LF7Q 2YSHA 4B3SQ 3SDZA 3HOZG 4HIOA 5K36G 2GVBA 3AFQA 1HZBA 4JI1L 3PUXA 5IYDG 5JEAJ 5IYBH 3I73A 2Z6KA 1YHAA 2CW0C 5LMUL 1GUSA 3P20A 2R6GA 3AQQA 4JI6L 1Q46A 3BJUA 1MIUA 4LF6L 3HFZB 3U50C 4HR7B 2ZJQA 5E7NA 4HJ8A 2E76C 1Q82C 2VQEQ 1NBWA 4HJ9A 1N34L 2WB1E 4KHPL 4H0LC 4RCNA 1D8LA 1QVCA 1XMOQ 4IOCA
chains in the Genus database with same CATH superfamily
4HAEA 3GDEA 4A3BH 2Z6KC 4ODGA 4GKJL 1TKWB 4LUZA 3MEFA 1TWAH 1A6XA 4X66L 3CC4A 1DOMA 2MNAA 3MXNB 4R8IA 3TS2A 3W2DA 1IW7D 4JI4Q 1DOKA 5CC4A 1C48A 1QNKA 2R7FA 5AJ3Q 2HHHL 3L9AX 1GUNA 5JPMC 5EKLA 4FDBA 5T1IA 1JT8A 1T9HA 2F3VA 1NAPA 4KKTA 4KY5A 4WJ4A 3I4LA 2EQSA 1LUZA 2HUGA 5C5MA 2PMZB 1W6JA 4MZ9A 1FYCA 1HFGA 1ASYA 2QDLA 3E0EA 1OXSC 3VYUA 1H95A 4C3HB 1O7IA 3NBHB 2JQOA 4IJHA 1OXUA 4ABNA 4A3MG 3G71A 4ALPA 1YVCA 4DV4L 1F9QA 4XXEA 5E65A 1QVGA 1KL9A 1PH2A 2MP1A 2F4VL 4DK6C 2WADA 2PQAA 5IY0A 1SYFA 3S14H 1EY7A 2JP1A 2R3ZA 3KDFB 4JI7L 1Q12A 4X3TA 1P8LA 5ELDA 2IL8A 4JV5Q 1CKMA 1QUQB 4OO1G 2A69D 3OW2A 4N8X1 2B2VA 5FLMG 2I5MX 3ZYYX 3D4DA 4OX9Q 2Z4HA 1Y1WB 2DMVA 1ZYRC 1TQOA 3UDGA 2NBFA 5CYUA 1M90C 3ERSX 1CHQD 1MD2D 1NNXA 1JB3A 4CDDC 3CCMA 4R1JA 4QIWB 3K8AA 3UE1A 1KC8C 3VA7A 3L2PA 1HNZL 5T1GA 3SK6A 1EFID 3PQIA 3KLSA 2NVXH 3TDBA 2KJXA 1R9TB 2C9OA 3S1RH 1YZ6A 4DKAC 1HQRD 2R7ZG 4DR3Q 2R93H 5E66A 2IX1A 1SMYC 3CNGA 3K7UC 5BR8Q 2EJFC 4YY3L 3BVZA 1C0AA 4DUZQ 5IGEA 4A3JB 4GNXB 2B2VC 3OHXC 1CQVA 3T51B 2EZVA 1Q86C 1SNOA 2WAEA 3S1QH 5HGTA 5C0XI 3PIPA 1FNUA 4B9XA 1TS2A 1DYQA 2B63G 2JA6G 3E0JA 4A3GB 5ELCA 4UY8C 4RHSA 1CHPD 1BDOA 5DAUA 1QOHA 1G2SA 1JWMD 4O42A 2RSNA 1K8OA 1Z47A 1EG3A 4A3LH 2ZAJA 4XTCS 4HN7A 1XPUA 4LFBQ 1RTNA 1WTHA 3RUZA 3H3VC 3I72A 4FNFA 2UXDL 2XP7A 2OQ0A 4RKBA 4A3DB 3VYRA 4NMZA 2MO1A 1LTSD 2A1AA 4RAUC 1Y1VH 1EWIA 2XPBA 4KKUA 2VZAA 1EZ6A 1LTAD 5IT9c 3HOYB 3FHWA 1S3OA 3A0JA 3PO3B 1IYVA 3CMEA 1T5XD 1UUPA 3T16A 1KNEA 1QB5D 5ISRA 2KBNA 4R4IA 4YIJA 2IX3A 3BZDB 3I4NH 3Q6SA 2K5VA 2WB1B 3C1EA 1G8ZD 2KHIA 2CWAA 1S72A 5JJKA 5AHTA 4YHHL 4MHEA 4A3KH 2ICIA 4CHTB 1EU4A 5CR3A 1WCMH 1V1QA 3VYSA 1LTBD 3RN2A 2UU9Q 2RA4A 3T1HL 2L55A 2RCNA 3OIPA 3S1MB 4APVA 4LF8L 4DR2L 4PMCA 5H1SE 2MJ8A 3FEWX 3HOYH 1TWHB 4L6TB 4K0KL 1UE6A 2YSGA 4WRDA 1RF2D 1ILPA 1EWHA 4DR4Q 4K5WA 2OTLA 1E2WA 2DY8A 4N9PA 2MDIA 4NP5A 2AMCB 1MI2A 3IFTA 1LM0A 1EQTA 4QY7A 1RJTA 5BN5A 4P73A 1STNA 1FLCA 2LXKA 5D3DA 1WVLA 1CTMA 4POGA 1J5EL 3ERQA 5E4WC 3SXHA 4PMWA 1HZAA 5FOBB 3QR8A 1V1OA 1UE1A 2CFMA 1B9NA 1X32A 3CCUA 2OEOA 1JE5A 4OONA 1DJRD 3J81j 3K6OA 3H0GB 4H02A 4O2DA 5D65A 3GTPH 1SJHD 1UAPA 4J15A 3KAGA 1EIFA 3RN5A 5E62A 1J8IA 4C1NK 5A2QL 3M3YB 1SXTA 4IURA 5LMNQ 2GVAA 4MNOA 1YNNC 3GTGH 4C3HG 3GTKB 4OO1I 2WINB 2I07B 1R4QB 3ITPA 4LF9Q 5C3WA 2LS01 4JPBW 1VQ9A 1SYDA 4PZ6A 3UI2A 3RZDB 2NVTH 1SE2A 3HOUH 3TP7A 1BO0A 4XQNA 2NZHA 2YTYA 3NTIA 4DV2Q 1KIXA 2MO0A 1BVSA 2F0MA 4U86A 1HA6A 4UPAA 4X65L 3NQTA 4JI8L 5CBEE 2AQ2B 2O5JC 2BE5D 3BZCA 5JOBA 1JORA 1E0BA 1ONLA 1B9MA 4JG2A 4JW0A 2O2LD 2JE6I 4OWXB 4X64L 1HTPA 1Y1WG 4EQ5A 3GTKH 2FMMA 1SLJA 2NN6G 3T1YQ 3J81c 3TCZA 4IOAA 3H91A 1Z6HA 1PFMA 4HTHA 2EYPA 4BWGB 1QVFA 2Z4IA 2IPKD 4LWCA 3L7ZC 5CBAE 4B3RQ 3F2BA 1HRJA 1KDBA 1MGSA 2UUBL 2XWBB 1K83H 3KLSX 4A3LG 5GROA 2PQAB 2YTVA 2QDBA 4H7BA 4RWSC 2E45A 1PTOH 2KCNA 4ZKCB 1KLGD 3ULJA 1YJ9A 4ID6A 1AP0A 3PO2H 3RLOA 2Z8LA 2EY2A 4A3JG 2Q2UA 1X55A 4DV6L 1QG7A 1ZEQX 1A15A 1G291 2D62A 4JK1C 1EOVA 2MFIA 2L1BA 1N32L 3GP7A 1EY6A 3ONAB 4B08A 2VW9A 4IUQA 1GUGA 2NB0A 3V05A 4A3GG 4NXNQ 4X6AH 4DN4M 1G6PA 1O6WA 1XPOA 1B2TA 3ZJYC 2PYKA 1ICFB 3WDNA 3STBD 1WCMG 2N49A 2ES2A 4YWLA 5CGKA 3I56A 2FXQA 2NWGA 1QE6A 4KY7A 5C4HA 1G51A 3HKZE 3CPFA 3DWPA 3PUZA 3HOYG 2AQ3B 2ID0A 4DV0L 4FXKC 3PO3G 5KRUA 3WH0A 4QUCA 2VQFQ 2KENA 4C56C 3K80C 2ATWA 1VQBA 1VMCA 3HOZH 1QCBD 3K58A 2KCMA 1VQDA 1O78A 5JJLA 5IP9G 4P71A 4WFN3 4JI2Q 3GTMH 2VB2X 1IBML 2WB1G 5GAEC 5G3LD 1AW7A 4A93B 2UUCL 4XYQA 5IYDH 1V9PA 1PINA 4OWTB 3A55A 2KUMA 1K8MA 3BYYB 3J7AV 4U673 4E5RA 1WTQA 5FO8B 1YHQA 2WAQG 5CV4A 4REXA 1FL0A 5CV7A 3LX0A 3GV6A 1VQ8A 3JAMc 5IOCA 4YCWA 2A8VA 4JYAQ 3G48A 3S2HH 1NCVA 5C3EB 2D2CC 5IWAL 4DR1L 2JEBI 2F0UA 1X6OA 1P16A 3FKIB 4L63B 3L0OA 1ENCA 4JI5Q 4H44C 2XTIA 1JMQA 3I7FA 4EQNA 1BCPF 3OTOQ 2XP9A 1VDZA 3CCEA 1S5DD 3VA5A 2O4XA 2JX8A 3NTKA 3IAYA 3F2UA 1AFPA 2E2JB 5IP7G 3OIQA 4S3SA 3I4MB 2F0LA 1DOLA 4LW1A 3KF6A 3S17B 4FXGC 1MJCA 5JPNC 5LL6S 4NB3A 3EN2A 4PQXA 2CWPA 3CCRA 1HTLD 4CDCC 3J80c 3NUCA 4B9WA 1LYLA 4XYOA 1FGBD 3NP8A 5COYA 5C3EH 4GKKQ 2EYJA 2BA1A 4LNQA 3F2DA 2IHEA 2K03A 2RQXA 4DAYB 3CCSA 1PTOD 3H0GG 3PIP3 1SYGA 1S40A 3GTQB 3RD4A 1JQYD 1JOKA 1PLFA 4IFDJ 2H1EA 1CZGA 2I5LX 3M4QA 3CCLA 1BXTA 1F9PA 3VR4A 1SE4A 4KLKA 1ASZA 3T56B 3I4MH 3CP0A 3W1GA 2UXBQ 2RBMA 3LWEA 2X6GA 3RMHA 3NTHA 4A3MH 4AYBE 2QEXA 1D7QA 1QZGA 1ILQA 1VQ4A 1MSGA 4QUFA 1S5CD 3BU2A 1PTOF 4RA8A 4JV5L 2E8GA 4OIKA 1A2UA 3V2TA 4DUYQ 1KTKA 3DWQA 4IUNA 4RFBA 1KHIA 4X62Q 1EY4A 1KRSA 2B2TA 4A4IA 1SR3A 1DCZA 2K32A 1XPRA 2NZOA 4CDEC 1XNQQ 5IYCH 3S2DB 5KNBA 4X3UA 2B2WC 1X3QA 1VQHA 1WI5A 2CH4W 4DNRB 5FLMH 1KAAA 3DHQA 1VQFA 5M5XB 3HOWH 2BH8A 5FK9C 3BDOA 1XTCD 1RL2A 1T5EA 1PRTD 4HIKA 3U4VA 5FO7B 3D31A 1YNXA 3MQHA 1I5FA 3RR5A 1N36L 1BBUA 4FF4A 1V43A 1Q8IA 3EROA 1SSOA 2L9HA 1TWCB 2NVYB 1EYGA 4U68A 2R7ZH 4DUZL 3Q24A 3NELA 3FDTA 2LMCB 2BE5C 2B2TC 4FXDA 3AU7A 1B8AA 4QQBX 2KCCA 3CCVA 3CQZH 3J80L 2M8IA 2UXCL 1PRTF 4DK1A 3HOXH 1WTWA 2YSIA 4KI0A 4R4TA 1GVPA 3QB3A 4F87A 1XJVA 1EZ8A 3NPPA 4Q5VA 4X3SA 1K9QA 2B63H 4HCSA 2JA6H 1ESRA 2L11A 4LFBL 2WV6D 3PV0A 2G9DA 1B3QA 4V0BA 2JA7B 3UDFA 4G57A 2K05A 2JYOA 1KDCA 4L5TA 3CC2A 3EVQA 3KABA 2M2LA 3SK8A 1E1OA 5ELOA 1PFSA 5IGBA 4XQQA 5GAHC 1S4ZA 3R8BA 3N6RA 1KD1C 3BDCA 3KAHA 5CORA 1UNSA 1UWVA 2K28A 2FFKB 2UUAL 2M3OW 2F0SA 4Q0FA 4B3TL 3W5OA 4DNTB 4RCOA 5M3MB 2YYZA 4JBWA 4EGVA 4AQYL 2A6HD 1FVIA 1E1TA 1U4LA 2YSFA 2EJMA 3ULLA 1YW5A 2OWOA 3KLWA 3HKSA 2ZR6A 3D0FA 2NTSA 2Y0SE 1WOCA 3QWNA 1SE3A 4A93G 1PVOA 5GAGC 4JI0Q 1CKNA 1L1OA 3GTLH 1LT5D 5GQOA 2JN4A 1TWFH 3QO2A 3M4OH 5A35A 2C5CA 1PZKD 3F2CA 2YU9H 3MFYA 2E5LQ 1U9RA 2CHBD 1XNRL 2HIXA 2HIVA 2A73B 3P1HA 5M5WH 5JAVA 3GQBA 3I8ZA 4BY7B 2N88A 3RZOB 3FVQA 1M1KC 3HOVH 2DN8A 5C3EG 1XXGA 4EX5A 4G7HC 4A3IB 3GV3A 3CPWA 3FKIG 3EA6A 1F2MA 2ZQSA 2Q5AA 1PH4A 3Q22A 4QGUA 4LAAA 1K9RA 4FF2A 1BCPC 4HIMA 1C8CA 2HDLA 3I4MG 4J6HA 4TKOB 3S1NH 4XT3B 4Y7NB 2MHVA 1L1OC 3MVVA 4MIUA 5KYLA 2DK7A 1TU2B 1IBKL 4AYBB 3Q0AA 2PNHA 3OW7A 4FF1A 1VF5C 3KF8A 2C35B 3DM3A 4OELB 1F2YA 3AB9A 1NE3A 1Q7YC 5JVG3 2F0IA 1GO3E 4LF4L 4RGTA 4ZYSA 2A68C 2JA5B 1GOZA 4NXMQ 5IYCG 3KAFA 3PUVA 1F9SA 4LUOA 1ZKOA 4LF9L 4DV5Q 2XP3A 5IE8A 4PZ8A 1VQAA 4NKLA 2Q2TA 3TC5A 1N9WA 2YSBA 4C3HH 3HOWG 2F0WA 5I6YA 3S16B 1EQQA 1DXMA 2F0PA 1M4VA 1GUWA 1XMQQ 1HZ9A 3KF6B 5C44B 5C0XJ 4DV3Q 1SFOB 2RDHA 2JSOA 5E3FA 1YNJC 3M4PA 2HT1A 1IYUA 3OWFA 5JVH3 4BA2I 3MXGA 3DMUA 2X6LA 4I7ZC 1N33Q 1PMRA 4K8JA 1YBYA 3S24A 3TS0A 3QJYA 2WIIB 4V190 3NQIA 1UEBA 3CF5A 3DWAA 2HCIA 4ZLTF 1SE8A 2N78A 4ZCKA 3SK4A 5DNFA 3HOXG 1Y1WH 2IT1A 2EY5A 2NN6H 2JEAI 2IJ0A 3D3RA 1MSHA 1ZCNA 2XP5A 2VY3A 1QZHA 2ZJRA 2TSSA 1OXVA 4CKEA 1K9MC 1J6QA 2R92B 2ALYB 1CSQA 1PZID 1HNWQ 1HZCA 2M00A 1STGA 2BA0A 2DJYA 1LV9A 4R4QA 3U58A 1R9TH 2QEJC 4GOPA 1K3BC 2VXWA 1H9MA 3MAQA 1EYDA 1A63A 2B2UA 1YIJA 4EQPA 1JCKB 3URYA 2K01A 4HMJA 1PH6A 2MPMA 4U84A 2B29A 1Q1EA 4A3JH 4IN3A 4B3MQ 3T13A 1EG4A 1BQQT 5U47A 4AIMA 3NWTA 1RHPA 1U5KA 5A2QE 5ELBA 1X3EA 4A3GH 1VQNA 3A7LA 1LTLA 3MFGA 1KRTA 1A8VA 1I50B 3H09A 3NENA 1HA5A 3MQGA 1LO5D 4IUPA 3GTJB 1SMXA 2XP4A 4GOPC 3S15B 4ULLA 5I9OA 2PZUA 1EIGA 1LT4D 5BN4A 5FLXc 2R61A 4DR6Q 4A3DH 2B2UC 1GKHA 1RKNA 4JI6Q 3BS1A 5M9OA 3JC66 5I2YA 4I7AA 2XP6A 4DR5Q 4LF6Q 1NMGA 1GHJA 4L5SA 4JI2L 1BOSA 3PO3H 3HOVG 5CV6A 5M3MG 1EFWA 3FP9A 2PZTA 2FJ2A 3OSOA 3ER0A 1CQFA 5IP9H 2KVMA 1LTRD 2KEDA 3KFUA 4ZQ3A 1KABA 5J1ZA 4R9WA 1VCIA 4KHPQ 1C4QA 1YITA 3H94A 3SE0A 4ME3A 1A3TA 2QCPX 2RF4A 2ZTDA 1EY8A 4C2MB 1I94L 2F52A 4HJ5A 3S1MH 2LSSA 4GKJQ 1D5ZC 2ZR4A 4BY7G 1TWHH 3PCOB 3OTOL 4Z9CB 1U4PA 3D4RA 4A3IG 4P75A 1IL8A 3D6CA 1F9RA 2BCOA 1E2VA 1WTRA 1AH9A 2HHHQ 4G4KA 3HEJA 2AHOB 3VR3A 4DV1Q 2JK8A 1STHA 5EKKA 1BCPB 3LNNA 2D0PA 1KXLA 4LF5L 2WACA 2ENBA 5IP7H 2L15A 1I4XA 1ENFA 5IT9L 2L0CA 4BY1B 2ZQTA 2LAJA 4GKKL 1CKNB 1L1OB 1OXTA 1SRUA 1CI3M 2A6ED 3F1ZA 4AYBG 3P7JA 3K5MA 3V96A 4OWWB 1HR0L 1IHZA 1JICA 4DV4Q 3AFPA 4QJFA 3IFDA 3TEHB 4QF4A 1IW7C 1STAA 4LFCL 3VR5A 2F4VQ 5EKIA 2L4JA 2VL6A 4G7ZC 2RDGA 3CXCA 3K5LA 1X9NA 3NK9A 2BOSA 3H0GH 2QF7A 4P72A 4IALA 3HRZC 2NVQB 2UXBL 5FLXL 2F0GA 3J80i 4K2LA 1L0WA 1Q81C 5K5PA 3M3YH 4L5QA 3A56A 4GN5A 4JI3L 2Y8NB 4TVAB 1A3UA 1Y14B 4IPCA 4RG1A 4G7OC 1ESFA 2QGQA 2SNMA 2YAJB 1X3GA 4DUYL 3X3MA 1IBLL 3RZDH 1L2FA 5C44G 1K73C 2F0KA 3L4HA 5JJIA 1CFMA 1C9OA 1XNQL 3TN2A 1HNZQ 1B1ZA 3MA2B 5ELFA 4KN4C 1HNXL 2PPBC 3U9OA 3UE0A 2JA8B 4K8IA 1BF4A 2A69C 3HS0C 4A3FB 1JOOA 1EY0A 2N55A 1F77A 2RCFA 4PMBA 1V8QA 3CCQA 3MCBA 4YY3Q 3ICEA 1DD2A 5ELNA 3CCJA 4R4OA 4KV6A 1DGSA 2EVBA 1SAPA 2EXDA 3CAMA 5HY6A 2EDGA 1RCVD 2CVRA 3MZ5A 4OXPA 4BXXH 1CSPA 2IX0A 2CW0D 1L0YB 1WTPA 1FJGL 2K50A 2ITKA 1IYJB 4EVOA 2B2YA 2UXDQ 2DY7A 4A3DG 3H6MA 4LF7L 1PH9A 1OXXK 1TY2A 5EQ0A 4B3SL 4OIJA 2A19A 3BG3A 3H15A 3M85A 5EBDA 5C4JB 4ZRZA 5I9PA 2IW3A 3AMUA 1OO9B 1B44D 3SR1A 3TQYA 3UDXA 1HQMC 1C7YA 1O80A 3A8IE 3E6ZX 1AZPA 5EJWA 1SNDA 4KK7A 2NZ1D 4YHHQ 3VYTA 3MXNA 4BA1I 3J81L 2IY5B 3LGJA 3H3VH 4CKCA 4U85A 3E3XA 4PG3A 2JJQA 3T1HQ 3SK5A 1F8AB 3VR2A 2VQEL 1W2BA 2IHFA 4DAMA 3A5UA 4LF8Q 5KNCA 4DR2Q 1YJWA 3PF5A 1D6EC 2F0TA 4L5RC 1II3A 1XYIA 4BBSB 1LACA 3K81C 3G7LA 3G6EA 1J9OA 1YEZA 4JI0L 1SYEA 5G3LF 1EOTA 4KKSA 1IZ6A 3NBHA 1RDPD 5FJ8H 3EIVA 4E6IA 1XMOL 1BBXC 2E2HB 2HD3A 4HMIA 2DUDA 2E5LL 2EJGC 3FPPA 1MHWC 4A93H 2L12A 3BVGA 1TR8A 1WD0A 3FS8A 1B53A 1DM0B 1J5EQ 2KEEA 1B50A 3J7ZC 1WFQA 1I4QA 4JI4L 1I6VC 2RSOA 1VQMA 3A54A 5AJ3L 1TS5A 5JEAG 4JCVE 2RHQB 2K33A 4JC0A 3FKIH 2AKWB 5AFWA 2ZXPA 3Q23A 1TWGB 4DU9A 1JOQA 3T53B 2JV4A 2ZTEA 5LL6X 3J80E 3K0YA 2K4KA 1BUVT 1WJJA 1A0IA 1Z9FA 5M3FB 1VQGA 1TK7A 1VQ7A 2HDMA 3FRPB 3KYHC 1ZYRD 2ZTCA 4GN4B 2E2JH 2CH4A 1PH7A 1EY5A 3K57A 3UDIA 4BY1G 5I2XA 3MC0B 3PUWA 1K8AC 1KAWA 3GTOB 2E2IB 3S17H 3VDYA 5CQ2A 4A0UA 5KIXA 1I3QB 1NMFA 1AE3A 1VQEA 2Z9HA 3KLRA 1Y8OB 1MJEA 2J7ZA 1AZQA 1PYWD 2LXJA 2NN6I 2EYLA 5LHY1 1CZWA 5DM63 4KTAA 4DV5L 3LE4A 1VQOA 1R4PB 1EUJA 1SMYD 1W3SA 2PMZE 2SDFA 1M8AA 1GD7A 4OX9L 2EZ5W 3GTQH 4A3EB 5M3FH 1O7ZA 3TBIB 5C3XA 5C4XB 4X65Q 1LABA 3K7AB 1EWCA 4UP7A 1EYCA 1TVXA 1V1PA 5CV5A 4GLVB 4A0TA 3JAML 4X64Q 3DXJC 1S5FD 4DA2A 4HSPA 1K0RA 1PH3A 4BBRB 3PMFA 1HPCA 1SNMA 2VUMB 4LFAQ 3TZUA 4DR3L 3R93A 2EYOA 5KGUA 3CD6A 4WORA 2Q2HA 2KOLA 4F88A 2JMFA 4IUVA 5BR8L 1DONA 3G4SA 1N8RC 1PFBA 4BXXG 3DM1A 1H9SA 1EEFD 4DXFA 2JA8G 3CU7A 4DV7Q 3S2DH 1LTTD 3K59A 2Q8RE 1F2ZA 1SEBD 4JVZA 1GUOA 1SYBA 2QKIC 5M5YB 3I2ZA 4C3JB 2CQOA 1HNWL 3HKZB 3TP5A 3KCEA 1RODA 5M5XH 5KEEA 1E7ZA 4DV6Q 3NWSA 2V1CC 1D1KA 2M8JA 3AYHB 1N32Q 5J3BA 1WTXA 2ZM6Q 3VR6A 1B3AA 3I70A 3TREA 1PYSB 3KBXA 3W1BA 5I6WA 4CGYB 4KJOA 5EPJA 2K5DA 1NR4A 2Z1CA 1X3PA 5L37A 1TWCH 2F21A 2NVYH 4JOIA 4YCVA 3WOFA 1CT1D 1I4RA 3K5OA 1HXYD 1PZJD 4B3ML 1VS0A 1IKLA 4NW2A 1NUCA 3WOEA 2F0VA 1KLUD 1QWYA 3OPOA 2QRVA 1STYA 3B6YA 5GADC 1EYAA 1E2ZA 5J39A 4TQUS 2H4OA 2GN5A 3MCBB 4O0AA 4DV0Q 1EQRA 5CV8A 1Q90A 2N3SA 1MKHA 5FJ8G 3SHLA 4DF7A 2UU9L 2JA7H 2ZXOA 4PV1C 4DR6L 1IBMQ 3LKXA 4A3BB 1STEA 3STBC 2PQEA 2UUCQ 1U4RA 4DR5L 1TWAB 2K5WA 3U4ZA 4JOIC 3A5ZB 3FSCA 2K1BA 4DR4L 2K75A 2KHSA 1JR0D 4YWKA 1Q1BA 1SNCA 1X56A 2YV5A 1EL0A 4CJ1B 4CBVA 1GXDC 3OOCA 3MWYW 1NTGA 1X54A 2EY1A 3OWEB 4BBSG 1E3PA 2P5ZX 2CKZB 2J4XA 5IWAQ 4UDUC 4DR1Q 1SN8A 5M3MH 3NTPA 4A3CG 2DNEA 1GUTA 2WKDA 3IRBA 3DUZA 4KD4A 4JBJA 2YTXA 2K5HA 2RVLA 1YNND 3KK7A 3C46A 4P2CB 4FP5D 2WAQE 3MTSA 4HSVA 2L5TA 1FGUA 3R2IA 4JBKA 1HCZA 4KHVA 1HUMA 1RIPA 2A74C 5C4ZA 1QJOA 4FO2A 2TMPA 2XN9C 3IL8A 2JXMB 2RHSB 4XQJA 3S14B 1D5MC 4BY7H 3RZOH 2MQHA 3EQLC 4H13C 4DV1L 1K8GA 2B8GA 4YWMA 4A3IH 3TP8A 2VS1A 4WJ3M 5LMNL 1JJ2A 1HUNA 4J1MA 4ILWA 5M3FG 3NBIA 2SNSA 3QIAA 4MN3A 3RNUA 4TSSA 5E5WA 2XVSA 2BH2A 1VQJA 4Y52H 2VB3X 4IO9A 2EXZA 2XSCA 4Y7NH 4I65A 1S5BD 2NVXB 3CRLC 4AH6A 4DV2L 3S1RB 5FKAC 1AN8A 2R93B 2K04A 1OTCA 5HGQA 1BBWA 2LFNA 1JJGA 1PFNA 2X69A 2PNRC 1PTOC 3KBGA 4PNYA 1UEAB 2WP8J 1HH2P 2PW5A 2JA5H 3KJOA 4A3EG 2OCEA 1G2TA 1RD9D 3T1YL 1YHBA 5C4XG 2EIFA 1WD1A 3S1QB 3S9WA 5IGDA 3ULPA 4KHZA 3S16H 3OOBA 3I3CA 4K5VA 4DR7Q 1L0XB 1G6ZA 4B3RL 4BBRG 3BZKA 2VUMG 1PA6A 3A8KE 4K2KA 1SDFA 5C44H 2K6AA 4IUTA 1SFOH 1LTID 2KA7A 4K6DA 1O7LA 3HP3A 1MBYA 2F0DA 1EIYB 2AUJD 2K5QA 1B4OA 1N36Q 5IODA 3J81i 1PXUA 5EPLA 1HR0W 1LTGD 1SNQA 2HQLA 5IGFA 3ODKA 1Y1VB 2QW7A 2ZXRA 2XP8A 4C3JG 5DLQE 1K0SA 3KAIA 1O7YA 3HKZG 2L4NA 3H3VI 2UXCQ 4NXNL 1V1PB 4RGMA 1S5ED 3C1FA 3I4NB 1PRTC 3WWVA 4IFDH 2B8FA 3PIO3 4IZ8A 1E22A 2R92H 1IXRA 3RLFA 2VNUD 4A3KB 5IYBG 2F0FA 1WCMB 3AEVA 2PCFB 4DK0A 5IT9E 2JA7G 3PF4A 4IPDA 4DK3C 4IPHA 2Y0SB 1I6HB 4DGZA 2G9HD 4JI1Q 4DXGA 3N52A 1H9SB 3SGIA 1SBBB 2VQFL 5LMUQ 4LMQD 4OL7A 4NDXA 2FHTA 2B39A 2Q8IB 4K14A 4NPSA 4ZUJA 1RP5A 5TSSA 2MUYA 4KMUC 3W3AA 1E24A 2UUAQ 1JMCA 1KNAA 4B3TQ 5FLXE 5EPKA 1VMPA 4AQYQ 2OF1A 3MXUA 3CRKC 2F3WA 2WFWA 1WR7A 1XX8A 3NE5B 4IPGA 1X65A 4HEDA 1CM9A 5IIFA 1I50H 3PQHA 4A3BG 1N34Q 1I6HH 2WAQB 4RGNA 1I4GA 3GTJH 2KXQA 2BDOA 3S15H 4ZK9B 1DZ1A 3R3OA 3NSWA 2LY7A 4JYAL 1YI2A 4DAYA 2Z0SA 2F0HA 2ZT9C 3CC7A 1ET9A 1HFNA 1UE5A 1XNRQ 4JI5L 3J7AF 3HZXA 2XPAA 2WKCA 3GTPB 4M8AA 3C3LA 4X66Q 1AE2A 1F2LA 1D1IA 2ZR5A 5C6AA 2A6HC 4DFAA 2F0OA 2G5DA 2PI2A 1A3VA 3KUPA 2I5HA 3FPUB 5E4XA 1H9JA 3CMAA 3GTGB 1ML0D 2FINB 4LK1C 4HIDA 2DWVA 3JAMi 2EYMA 4OEMB 3EBEA 4UP9A 5DM73 1Z7TA 3GD7A 4TRDA 2NVTB 3A7AB 3LKXB 1A62A 2KHJA 3HOUB 1HHVA 4GS3A 1TS3A 4GLXA 3PUYA 4ZKBB 2NTTA 4PZ7A 4R4CA 2GA4B 4C2MH 4UHVA 2EPBA 2EY6A 4C3IB 5IGGA 1IBKQ 3MHBA 4F8MA 2OTJA 5JEAH 4HJ7A 3CHBD 3J7YW 1Q3LA 3HGBA 1FR3A 4A75A 2BDNA 1JJCB 3BDLA 1ICWA 4LF4Q 3HG9A 3ND8A 2DGYA 2JA5G 1PV4A 4JI7Q 1Y8NB 5NUCA 1H9KA 3ND9A 1YJNA 1PHJA 1RTOA 1BR9A 3CKIB 4R8NA 3EFXD 4RGOS 4BY1H 3M7GA 3PSIA 2OQKA 4N8FA 2E75C 4C3IH 4DAVA 4X62L 1VQPA 1NMVA 3OMGA 1K83B 5D14A 1PH8A 3TRZA 2R93G 4LJZC 1LT6D 2IWHA 3J81E 2OXPA 3KF8B 1PTOB 3U9SA 1CA5A 4M1UB 2AQ1B 4KY6A 3PO2B 1QILA 4XT1B 2K52A 1TS4A 2NVQH 1XWEA 2PI2E 3D8GA 1I4HA 2F0NA 1K3RA 1PH1A 1Q8KA 3KOJA 4LFAL 1X3FA 4ZUIA 4DPGA 3R2TA 1STBA 3G6JB 1NR2A 4J8QA 2Q8TA 5EGTA 1VQLA 3K0XA 2DJFC 4IFDG 1IKMA 2FMCA 4RH6A 4IQZA 2R92G 3TZDA 4DV7L 2B3GA 2A5HA 2XRSD 1PDQA 3DEOA 3M9BA 1EIHA 1G91A 1BNZA 4OGQC 2AWOA 4X3KA 3E5SA 4K5XA 2OT2A 2JA8H 3OYYA 1TXYA 1Y1VG 3RLNA 2XWJB 1EQVA 2DJGC 4A3FH 2F03A 2ZM6L 5BN3A 5E64A 1ZXTA 4QIBA 3HOZB 3EJIA 1VQKA 2O5IC 3I4NG 3GTMB 1PRTB 5CMDA 2JA9A 1PYBA 2MGSA 2SOBA 1CK1A 3QG1A 4A3KG 4FVMA 3L3OC 2NYZD 3I91A 3A74A 2Y0SG 4HJAA 4KD3A 2QA4A 1SNPA 1ENAA 5C0XH 1FNVA 3DLLA 2ZQVA 1H9RA 4GOPB 4DNIA 4ZAIA 3S2HB 2PO4A 5DEHA 4JBMA 4QB4A 1TR5A 1BKBA 1VQIA 1SYCA 1EY9A 2Q2IA 4KJNA 2B2YC 5C4JH 3E9HA 1VQ6A 2F3IA 2E2DC 3NXWA 5K36H 1CUKA 3OMCA 2ZQUA 4K0KQ 4YCUA 3M7NA 2HCCA 4K6LA 2XNAC 1PH5A 1BCPD 2E74C 3DEPA 3JAME 1ET6A 2JXWA 3NEMA 2EYHA 2XIWA 2SEBD 1B7YB 2N8NA 1KQSA 1JB7A 1JE4A 2J0TD 2M9VA 3KDFA 3PIOA 3KJPA 2RDFA 4LUVA 1NJIC 1I94Q 3E9IA 4QMGA 5CV9A 2K5NA 1QUQA 4BBSH 1GJXA 2A68D 2Z6BA 1U0LA 4A3CH 2RE3A 1I4PA 3F8TA 2D9UA 4GN3B 2E2HH 2D5DA 4XIGS 1W6KA 5I4DA 1AEXA 3LWUA 4A3MB 4GZYC 4LF5Q 5EBCA 3HOUG 4O1NA 2D0OA 3J7A5 1SROA 4P74A 2K14A 3QOJA 1LT3D 3FSBA 4C3IG 1YNJD 2I0QA 1CA6A 3KADA 4CJ2C 3PGZA 4NXML 1HR0Q 2B2WA 2PW7A 4UP8A 2CCZA 5F2DA 1I5HW 2LKVA 1WMVA 1D5XC 5EAYA 3M4YA 1QNUA 4LFCQ 2HQEA 3I4OA 2ZJPA 4GNXA 4XDXA 1TWGH 2DNCA 2K7VA 5KYIA 3HOWB 3C2PA 1Y8PB 2EYFA 4RHRA 1B70B 4JI8Q 2CQAA 2XGTA 1XMQL 3IKJA 2AUKA 4DV3L 3SVMA 4MTKA 4JI3Q 4IJLA 4HCEA 2DK1A 2E2IH 3GTOH 2A6EC 1JWSD 4FYDA 1I3QH 2PZWA 3D6WA 1IBLQ 3T4AC 1XTDA 4IUUA 5KNDA 1HJPA 1GHKA 1VQ5A 2R7ZB 1N33L 4A76A 4OHJA 4IFDI 4RMFA 4QL5A 4OO1H 2QILA 4CJ0B 1IL2A 3TP6A 2ASBA 3PO2G 1K28A 1HNXQ 2UUBQ 1JWUD 3CQZB 1D2BA 3MXPA 3A8JE 4A3EH 4ME5A 1WYDA 1NSNS 3I55A 5C4XH 4GNXC 3FMCA 4A3FG 3HOXB 4DR7L 3K7AH 1FD7D 5E1FA 5J22A 1U4MA 1Y69U 5IGCA 4QIWE 5LMNW 2V4DA 2B63B 2JA6B 2H5XA 4GLAC 2RKSA 1EU3A 1KDAA 4BBRH 5FO9B 3BYTB 2VUMH 2F0JA 3MEHA 4MTNA 3CW2C 1WTVA 5JJZA 4L8JA 3X3NA 1UE7A 3TDQA 2AWNA 4RKLA 2KECA 1NY4A 1VQCA 4QCLA 2KQ3A 2R7DA 1VF7A 2F1MA 4KN7C 1GM5A 3K5NA 3P75A 2XRQD 5HURA 2KCTA 2F0QA 2I46A 3NHHA 5C0XG 1CKOA 1FJGQ 3Q8DA 3GO5A 5M5YH 4C3JH 1LLRD 4POFA 2F4IA 4LF7Q 2YSHA 4C1NI 1TY0A 4B3SQ 3SDZA 2F0EA 3HOZG 5C5LA 4DAPA 4HIOA 2EOTA 2GVBA 5K36G 3AFQA 1HZBA 4JI1L 1SJED 3PUXA 5IYDG 5JEAJ 3TMEA 3GTLB 5IYBH 4WJWA 3I73A 4CKBA 1TWFB 2Z6KA 1YHAA 3M4OB 3D4WA 2NUCA 3TSSA 2CW0C 2EE1A 5LMUL 1GUSA 3P20A 2YU9B 2R6GA 1A2TA 3AQQA 4JI6L 1Q46A 3BJUA 1TIID 1MIUA 4LF6L 3HFZB 3U50C 5M5WB 4HR7B 4FF3A 2ZJQA 3O13A 1EEID 3HOVB 3I90A 5E7NA 4HJ8A 2E76C 1Q82C 3QOLA 4F7XA 2VQEQ 4CDFC 1WTOA 4N9TA 5ELEA 1NBWA 1JC7A 5D3IB 4HJ9A 3BVMA 3SEBA 4BS9A 1N34L 2WB1E 4KHPL 4H0LC 4RCNA 1D8LA 1TT2A 2ICEC 1QVCA 4UAIA 1XMOQ 3S1NB 4IOCA 4EQOA 1FNWA
chains in the Genus database with same CATH topology
4HAEA 3GDEA 4A3BH 2Z6KC 4ODGA 4GKJL 1TKWB 4LUZA 3MEFA 1A6XA 1TWAH 4X66L 3CC4A 1DOMA 2MNAA 3MXNB 4R8IA 3TS2A 3W2DA 1IW7D 4JI4Q 1DOKA 5CC4A 1C48A 1QNKA 2R7FA 5AJ3Q 2HHHL 3L9AX 1GUNA 5JPMC 5EKLA 4FDBA 5T1IA 1JT8A 2F3VA 1T9HA 1NAPA 4KKTA 4KY5A 4WJ4A 3I4LA 2EQSA 2HUGA 1LUZA 5C5MA 2PMZB 1W6JA 4MZ9A 1FYCA 1HFGA 1ASYA 3E0EA 1OXSC 3VYUA 1H95A 4C3HB 1O7IA 3NBHB 2JQOA 4IJHA 1OXUA 4ABNA 4A3MG 3G71A 4ALPA 1YVCA 4DV4L 1F9QA 4XXEA 5E65A 1QVGA 1KL9A 1PH2A 2MP1A 2F4VL 4DK6C 2WADA 2PQAA 5IY0A 1SYFA 3S14H 1EY7A 2JP1A 2R3ZA 3KDFB 4JI7L 1Q12A 4X3TA 1P8LA 5ELDA 2IL8A 4JV5Q 1CKMA 1QUQB 4OO1G 2A69D 3OW2A 2B2VA 5FLMG 2I5MX 3ZYYX 3D4DA 4OX9Q 2Z4HA 1Y1WB 2DMVA 1ZYRC 1TQOA 3UDGA 2NBFA 5CYUA 1M90C 3ERSX 1CHQD 1MD2D 1JB3A 3CCMA 4R1JA 4QIWB 3K8AA 3UE1A 1KC8C 3VA7A 3L2PA 1HNZL 5T1GA 3SK6A 1EFID 3KLSA 2NVXH 3TDBA 2KJXA 1R9TB 2C9OA 3S1RH 1YZ6A 4DKAC 1HQRD 2R7ZG 4DR3Q 2R93H 5E66A 2IX1A 1SMYC 3CNGA 3K7UC 5BR8Q 2EJFC 4YY3L 3BVZA 1C0AA 4DUZQ 5IGEA 4A3JB 4GNXB 2B2VC 3OHXC 1CQVA 3T51B 2EZVA 1Q86C 1SNOA 2WAEA 3S1QH 5HGTA 5C0XI 3PIPA 1FNUA 4B9XA 1TS2A 1DYQA 2B63G 2JA6G 3E0JA 4A3GB 5ELCA 4UY8C 4RHSA 1CHPD 1BDOA 5DAUA 1QOHA 1G2SA 1JWMD 4O42A 2RSNA 1K8OA 1Z47A 1EG3A 4A3LH 2ZAJA 4XTCS 4HN7A 1XPUA 4LFBQ 1RTNA 3H3VC 3RUZA 3I72A 4FNFA 2UXDL 2XP7A 4RKBA 2OQ0A 4A3DB 3VYRA 4NMZA 2MO1A 1LTSD 2A1AA 4RAUC 1Y1VH 4KKUA 2XPBA 1EWIA 2VZAA 1EZ6A 1LTAD 3HOYB 5IT9c 3FHWA 1S3OA 3PO3B 3A0JA 1IYVA 3CMEA 1T5XD 1UUPA 3T16A 1KNEA 1QB5D 5ISRA 4YIJA 2KBNA 2IX3A 4R4IA 3BZDB 3I4NH 3Q6SA 2K5VA 2WB1B 3C1EA 1G8ZD 2KHIA 2CWAA 1S72A 5JJKA 5AHTA 4YHHL 4MHEA 4A3KH 2ICIA 4CHTB 1EU4A 5CR3A 1WCMH 1V1QA 3VYSA 1LTBD 3RN2A 2UU9Q 2RA4A 3T1HL 2L55A 2RCNA 3OIPA 3S1MB 4APVA 4LF8L 4DR2L 4PMCA 5H1SE 2MJ8A 3FEWX 3HOYH 1TWHB 4L6TB 4K0KL 1UE6A 2YSGA 4WRDA 1RF2D 1ILPA 1EWHA 4DR4Q 4K5WA 2OTLA 1E2WA 2DY8A 4N9PA 2MDIA 4NP5A 2AMCB 1MI2A 3IFTA 1LM0A 1EQTA 4QY7A 1RJTA 5BN5A 4P73A 1STNA 1FLCA 2LXKA 5D3DA 1WVLA 1CTMA 4POGA 1J5EL 3ERQA 5E4WC 3SXHA 4PMWA 1HZAA 5FOBB 1V1OA 1UE1A 2CFMA 1B9NA 1X32A 3CCUA 2OEOA 1JE5A 4OONA 1DJRD 3J81j 3K6OA 3H0GB 5D65A 4H02A 4O2DA 3GTPH 1SJHD 1UAPA 4J15A 3KAGA 1EIFA 3RN5A 5E62A 1J8IA 4C1NK 5A2QL 3M3YB 1SXTA 4IURA 5LMNQ 2GVAA 4MNOA 1YNNC 3GTGH 4C3HG 3GTKB 4OO1I 2WINB 2I07B 1R4QB 3ITPA 4LF9Q 5C3WA 2LS01 1VQ9A 1SYDA 4PZ6A 3UI2A 3RZDB 2NVTH 1SE2A 3HOUH 3TP7A 1BO0A 4XQNA 2NZHA 3NTIA 2YTYA 4DV2Q 1KIXA 2MO0A 1BVSA 2F0MA 4U86A 1HA6A 4UPAA 4X65L 3NQTA 4JI8L 5CBEE 2AQ2B 2O5JC 2BE5D 5JOBA 1JORA 3BZCA 1E0BA 1ONLA 1B9MA 4JG2A 2O2LD 2JE6I 4OWXB 4X64L 1HTPA 1Y1WG 4EQ5A 3GTKH 2FMMA 1SLJA 2NN6G 3T1YQ 3J81c 3TCZA 4IOAA 3H91A 1Z6HA 1PFMA 4HTHA 2EYPA 4BWGB 1QVFA 2Z4IA 2IPKD 4LWCA 3L7ZC 5CBAE 4B3RQ 1HRJA 3F2BA 1KDBA 1MGSA 2UUBL 2XWBB 1K83H 3KLSX 4A3LG 5GROA 2PQAB 2YTVA 2QDBA 4H7BA 4RWSC 2E45A 1PTOH 2KCNA 4ZKCB 1KLGD 3ULJA 1YJ9A 4ID6A 1AP0A 3PO2H 3RLOA 2Z8LA 2EY2A 4A3JG 2Q2UA 1X55A 4DV6L 1QG7A 1ZEQX 1A15A 1G291 2D62A 4JK1C 1EOVA 2MFIA 2L1BA 1N32L 3GP7A 1EY6A 3ONAB 4B08A 2VW9A 4IUQA 1GUGA 2NB0A 3V05A 4A3GG 4NXNQ 4X6AH 4DN4M 1G6PA 1O6WA 1XPOA 1B2TA 3ZJYC 2PYKA 3WDNA 3STBD 1WCMG 2N49A 2ES2A 5CGKA 4YWLA 3I56A 2FXQA 2NWGA 1QE6A 4KY7A 5C4HA 1G51A 3HKZE 3CPFA 3DWPA 3PUZA 3HOYG 2AQ3B 2ID0A 4DV0L 4FXKC 3PO3G 5KRUA 3WH0A 4QUCA 2VQFQ 2KENA 4C56C 3K80C 2ATWA 1VQBA 1VMCA 3HOZH 1QCBD 3K58A 2KCMA 1VQDA 1O78A 5JJLA 5IP9G 4P71A 4WFN3 4JI2Q 3GTMH 2VB2X 1IBML 2WB1G 5GAEC 5G3LD 1AW7A 4A93B 2UUCL 4XYQA 5IYDH 1V9PA 1PINA 4OWTB 3A55A 2KUMA 1K8MA 3BYYB 3J7AV 4U673 4E5RA 1WTQA 5FO8B 1YHQA 5CV4A 2WAQG 4REXA 1FL0A 5CV7A 3LX0A 3GV6A 1VQ8A 3JAMc 5IOCA 4YCWA 2A8VA 4JYAQ 3G48A 3S2HH 1NCVA 5C3EB 2D2CC 5IWAL 4DR1L 2JEBI 2F0UA 1X6OA 4L63B 3FKIB 1P16A 3L0OA 1ENCA 4JI5Q 4H44C 2XTIA 1JMQA 3I7FA 4EQNA 1BCPF 3OTOQ 2XP9A 1VDZA 3CCEA 1S5DD 3VA5A 2O4XA 2JX8A 3NTKA 3IAYA 3F2UA 1AFPA 2E2JB 5IP7G 3OIQA 4S3SA 3I4MB 2F0LA 1DOLA 4LW1A 3KF6A 3S17B 4FXGC 5JPNC 1MJCA 5LL6S 4NB3A 4PQXA 3EN2A 2CWPA 3CCRA 1HTLD 3J80c 3NUCA 4B9WA 4XYOA 1LYLA 1FGBD 3NP8A 5COYA 5C3EH 4GKKQ 2EYJA 2BA1A 4LNQA 3F2DA 2RQXA 2K03A 2IHEA 4DAYB 3CCSA 1PTOD 3H0GG 3PIP3 1SYGA 1S40A 3GTQB 3RD4A 1JQYD 1JOKA 1PLFA 4IFDJ 2H1EA 1CZGA 2I5LX 3M4QA 3CCLA 1BXTA 1F9PA 3VR4A 1SE4A 4KLKA 1ASZA 3T56B 3I4MH 3CP0A 3W1GA 2UXBQ 2RBMA 3LWEA 2X6GA 3RMHA 3NTHA 4A3MH 4AYBE 2QEXA 1D7QA 1QZGA 1ILQA 1VQ4A 1MSGA 4QUFA 1S5CD 3BU2A 1PTOF 4RA8A 4JV5L 2E8GA 4OIKA 1A2UA 3V2TA 4DUYQ 1KTKA 3DWQA 4IUNA 4RFBA 1KHIA 4X62Q 1EY4A 2B2TA 1KRSA 4A4IA 1SR3A 1DCZA 2K32A 1XPRA 2NZOA 1XNQQ 5IYCH 3S2DB 5KNBA 4X3UA 2B2WC 1X3QA 4DNRB 1VQHA 1WI5A 5FLMH 1KAAA 3DHQA 5M5XB 1VQFA 3HOWH 5FK9C 2BH8A 3BDOA 1XTCD 1RL2A 1T5EA 1PRTD 4HIKA 3U4VA 5FO7B 3D31A 1YNXA 3MQHA 1I5FA 3RR5A 4FF4A 1BBUA 1N36L 1V43A 1Q8IA 3EROA 1SSOA 2L9HA 1TWCB 2NVYB 1EYGA 4U68A 2R7ZH 4DUZL 3Q24A 3NELA 3FDTA 2LMCB 2BE5C 2B2TC 4FXDA 3AU7A 1B8AA 4QQBX 2KCCA 3CCVA 3CQZH 3J80L 2M8IA 2UXCL 1PRTF 4DK1A 3HOXH 1WTWA 2YSIA 4KI0A 4R4TA 1GVPA 3QB3A 4F87A 1XJVA 1EZ8A 3NPPA 4Q5VA 4X3SA 1K9QA 2B63H 4HCSA 2JA6H 1ESRA 2L11A 4LFBL 2WV6D 3PV0A 2G9DA 4V0BA 2JA7B 3UDFA 4G57A 2K05A 2JYOA 1KDCA 4L5TA 3CC2A 3EVQA 3KABA 2M2LA 3SK8A 1E1OA 5ELOA 1PFSA 5IGBA 4XQQA 5GAHC 1S4ZA 3R8BA 3N6RA 1KD1C 3BDCA 3KAHA 5CORA 1UNSA 1UWVA 2K28A 2FFKB 2UUAL 2M3OW 2F0SA 4Q0FA 4B3TL 3W5OA 4DNTB 4RCOA 5M3MB 2YYZA 4JBWA 4EGVA 4AQYL 2A6HD 1FVIA 1E1TA 1U4LA 2YSFA 2EJMA 3ULLA 1YW5A 2OWOA 3KLWA 3HKSA 2ZR6A 3D0FA 2NTSA 2Y0SE 1WOCA 3QWNA 1SE3A 4A93G 1PVOA 5GAGC 4JI0Q 1CKNA 1L1OA 3GTLH 1LT5D 5GQOA 1TWFH 3QO2A 3M4OH 5A35A 2C5CA 1PZKD 3F2CA 2YU9H 3MFYA 2E5LQ 1U9RA 2CHBD 1XNRL 2HIXA 2HIVA 2A73B 3P1HA 5M5WH 5JAVA 3GQBA 3I8ZA 4BY7B 2N88A 3RZOB 3FVQA 1M1KC 3HOVH 2DN8A 5C3EG 1XXGA 4G7HC 4A3IB 4EX5A 3GV3A 3CPWA 3FKIG 3EA6A 1F2MA 2ZQSA 2Q5AA 1PH4A 3Q22A 4QGUA 4LAAA 1K9RA 4FF2A 1BCPC 4HIMA 1C8CA 2HDLA 3I4MG 4J6HA 4TKOB 3S1NH 4XT3B 4Y7NB 2MHVA 1L1OC 3MVVA 4MIUA 5KYLA 2DK7A 1TU2B 1IBKL 4AYBB 3Q0AA 3OW7A 4FF1A 2PNHA 1VF5C 3KF8A 2C35B 3DM3A 1F2YA 3AB9A 1NE3A 1Q7YC 5JVG3 2F0IA 1GO3E 4LF4L 4RGTA 4ZYSA 2A68C 2JA5B 1GOZA 4NXMQ 5IYCG 3KAFA 3PUVA 1F9SA 4LUOA 1ZKOA 4LF9L 4DV5Q 2XP3A 5IE8A 4PZ8A 1VQAA 4NKLA 2Q2TA 3TC5A 1N9WA 2YSBA 4C3HH 3S16B 2F0WA 5I6YA 3HOWG 1EQQA 1DXMA 2F0PA 1M4VA 1GUWA 1XMQQ 1HZ9A 3KF6B 5C44B 5C0XJ 1SFOB 4DV3Q 2RDHA 2JSOA 5E3FA 1YNJC 3M4PA 2HT1A 1IYUA 3OWFA 5JVH3 4BA2I 3MXGA 3DMUA 2X6LA 4I7ZC 1N33Q 1PMRA 4K8JA 1YBYA 3S24A 3TS0A 3QJYA 2WIIB 4V190 3NQIA 1UEBA 3CF5A 3DWAA 2HCIA 4ZLTF 1SE8A 2N78A 3SK4A 5DNFA 3HOXG 1Y1WH 2IT1A 2EY5A 2NN6H 2JEAI 2IJ0A 3D3RA 1MSHA 1ZCNA 2XP5A 2VY3A 1QZHA 2ZJRA 2TSSA 1OXVA 4CKEA 1K9MC 2R92B 1J6QA 2ALYB 1CSQA 1PZID 1HNWQ 1HZCA 2M00A 1STGA 2BA0A 2DJYA 1LV9A 4R4QA 3U58A 1R9TH 2QEJC 4GOPA 2VXWA 1H9MA 3MAQA 1EYDA 1A63A 2B2UA 1YIJA 4EQPA 1JCKB 3URYA 2K01A 4HMJA 1PH6A 2MPMA 4U84A 2B29A 1Q1EA 4A3JH 4IN3A 4B3MQ 3T13A 1EG4A 1BQQT 5U47A 4AIMA 3NWTA 1RHPA 1U5KA 5A2QE 5ELBA 1X3EA 4A3GH 1VQNA 3A7LA 1LTLA 3MFGA 1KRTA 1I50B 1A8VA 3H09A 3NENA 1HA5A 3MQGA 1LO5D 4IUPA 3GTJB 1SMXA 2XP4A 3S15B 4GOPC 4ULLA 5I9OA 2PZUA 1EIGA 1LT4D 5BN4A 5FLXc 2R61A 4DR6Q 4A3DH 2B2UC 1GKHA 1RKNA 4JI6Q 3BS1A 5M9OA 5I2YA 3JC66 4LF6Q 2XP6A 4DR5Q 1NMGA 1GHJA 4L5SA 4JI2L 1BOSA 3PO3H 3HOVG 5CV6A 5M3MG 1EFWA 3FP9A 2PZTA 2FJ2A 3OSOA 3ER0A 1CQFA 5IP9H 2KVMA 1LTRD 2KEDA 3KFUA 4ZQ3A 1KABA 5J1ZA 4R9WA 1VCIA 4KHPQ 1C4QA 1YITA 3H94A 3SE0A 4ME3A 1A3TA 2QCPX 2RF4A 2ZTDA 1EY8A 4C2MB 1I94L 2F52A 4HJ5A 3S1MH 2LSSA 4GKJQ 1D5ZC 2ZR4A 4BY7G 1TWHH 3PCOB 3OTOL 4Z9CB 1U4PA 3D4RA 4A3IG 4P75A 1IL8A 3D6CA 1F9RA 2BCOA 1E2VA 1WTRA 1AH9A 2HHHQ 4G4KA 3HEJA 2AHOB 3VR3A 4DV1Q 2JK8A 1STHA 5EKKA 1BCPB 3LNNA 2D0PA 1KXLA 4LF5L 2WACA 2ENBA 5IP7H 2L15A 1I4XA 1ENFA 5IT9L 2L0CA 4BY1B 2ZQTA 2LAJA 4GKKL 1CKNB 1L1OB 1OXTA 1SRUA 1CI3M 2A6ED 3F1ZA 4AYBG 3P7JA 3K5MA 3V96A 4OWWB 1HR0L 1IHZA 1JICA 4DV4Q 3AFPA 4QJFA 3IFDA 3TEHB 4QF4A 1IW7C 1STAA 4LFCL 3VR5A 2F4VQ 5EKIA 2L4JA 4G7ZC 2VL6A 2RDGA 3K5LA 3CXCA 1X9NA 3NK9A 2BOSA 3H0GH 2QF7A 4P72A 4IALA 3HRZC 2NVQB 2UXBL 5FLXL 2F0GA 3J80i 4K2LA 1L0WA 1Q81C 5K5PA 3M3YH 4L5QA 3A56A 4GN5A 4JI3L 2Y8NB 4TVAB 1A3UA 1Y14B 4G7OC 4IPCA 4RG1A 1ESFA 2QGQA 2SNMA 2YAJB 1X3GA 4DUYL 3X3MA 1IBLL 3RZDH 1L2FA 5C44G 1K73C 2F0KA 3L4HA 5JJIA 1CFMA 1C9OA 1XNQL 3TN2A 1HNZQ 1B1ZA 3MA2B 5ELFA 4KN4C 1HNXL 2PPBC 3U9OA 3UE0A 2JA8B 4K8IA 1BF4A 2A69C 3HS0C 4A3FB 1EY0A 1JOOA 2N55A 1F77A 4PMBA 1V8QA 3CCQA 3MCBA 4YY3Q 1DD2A 3ICEA 5ELNA 3CCJA 4R4OA 4KV6A 1DGSA 2EVBA 1SAPA 2EXDA 3CAMA 5HY6A 2EDGA 1RCVD 2CVRA 3MZ5A 4OXPA 4BXXH 1CSPA 2IX0A 2CW0D 1L0YB 1WTPA 1FJGL 2K50A 2ITKA 4EVOA 1IYJB 2B2YA 2UXDQ 2DY7A 4A3DG 3H6MA 4LF7L 1PH9A 1OXXK 1TY2A 5EQ0A 4B3SL 4OIJA 2A19A 3BG3A 3H15A 3M85A 5EBDA 5C4JB 4ZRZA 5I9PA 2IW3A 3AMUA 1OO9B 1B44D 3SR1A 3TQYA 3UDXA 1HQMC 1C7YA 1O80A 3A8IE 3E6ZX 1AZPA 5EJWA 1SNDA 4KK7A 2NZ1D 4YHHQ 3VYTA 3MXNA 4BA1I 3J81L 2IY5B 3LGJA 3H3VH 4CKCA 4U85A 4PG3A 3T1HQ 2JJQA 3SK5A 1F8AB 3VR2A 2VQEL 1W2BA 2IHFA 4DAMA 3A5UA 4LF8Q 5KNCA 4DR2Q 1YJWA 3PF5A 1D6EC 2F0TA 4L5RC 1II3A 1XYIA 4BBSB 1LACA 3K81C 3G7LA 3G6EA 1J9OA 1YEZA 4JI0L 1SYEA 5G3LF 1EOTA 4KKSA 1IZ6A 3NBHA 1RDPD 5FJ8H 3EIVA 4E6IA 1XMOL 1BBXC 2E2HB 4HMIA 2DUDA 2E5LL 2EJGC 3FPPA 4A93H 2L12A 3BVGA 1TR8A 1WD0A 3FS8A 1B53A 1DM0B 1B50A 2KEEA 1J5EQ 3J7ZC 1WFQA 1I4QA 4JI4L 1I6VC 2RSOA 1VQMA 3A54A 5AJ3L 1TS5A 5JEAG 4JCVE 2RHQB 2K33A 4JC0A 3FKIH 5AFWA 2AKWB 2ZXPA 3Q23A 1TWGB 4DU9A 1JOQA 3T53B 2JV4A 2ZTEA 5LL6X 3J80E 3K0YA 2K4KA 1BUVT 5M3FB 1A0IA 1WJJA 1Z9FA 1VQGA 1TK7A 1VQ7A 2HDMA 3FRPB 3KYHC 1ZYRD 2ZTCA 4GN4B 2E2JH 1PH7A 1EY5A 3K57A 3UDIA 4BY1G 5I2XA 3MC0B 3PUWA 1K8AC 2E2IB 3GTOB 1KAWA 3S17H 3VDYA 5CQ2A 4A0UA 5KIXA 1I3QB 1NMFA 3KLRA 1AE3A 1VQEA 1MJEA 1Y8OB 2J7ZA 1AZQA 1PYWD 2LXJA 2NN6I 2EYLA 5LHY1 1CZWA 5DM63 4KTAA 4DV5L 3LE4A 1VQOA 1R4PB 1EUJA 1SMYD 1W3SA 2PMZE 2SDFA 1M8AA 1GD7A 4OX9L 2EZ5W 3GTQH 4A3EB 5M3FH 1O7ZA 3TBIB 5C3XA 5C4XB 4X65Q 1LABA 3K7AB 1EWCA 4UP7A 1EYCA 1TVXA 1V1PA 5CV5A 4GLVB 4A0TA 3JAML 4X64Q 3DXJC 1S5FD 4DA2A 4HSPA 1K0RA 1PH3A 4BBRB 3PMFA 1HPCA 1SNMA 2VUMB 4LFAQ 3TZUA 4DR3L 3R93A 2EYOA 5KGUA 3CD6A 4WORA 2Q2HA 2KOLA 4F88A 2JMFA 4IUVA 5BR8L 1DONA 3G4SA 1N8RC 1PFBA 4BXXG 3DM1A 1H9SA 1EEFD 4DXFA 2JA8G 3CU7A 4DV7Q 3S2DH 1LTTD 3K59A 2Q8RE 1F2ZA 1SEBD 1GUOA 1SYBA 2QKIC 5M5YB 3I2ZA 4C3JB 2CQOA 1HNWL 3HKZB 3TP5A 3KCEA 1RODA 5M5XH 5KEEA 1E7ZA 4DV6Q 3NWSA 2V1CC 1D1KA 2M8JA 3AYHB 1N32Q 5J3BA 1WTXA 2ZM6Q 3VR6A 1B3AA 3I70A 3TREA 3KBXA 1PYSB 3W1BA 5I6WA 4CGYB 4KJOA 5EPJA 2K5DA 1NR4A 2Z1CA 1X3PA 1TWCH 2F21A 2NVYH 4JOIA 4YCVA 3WOFA 1CT1D 1I4RA 3K5OA 1HXYD 1PZJD 4B3ML 1VS0A 1IKLA 4NW2A 1NUCA 3WOEA 2F0VA 1KLUD 1QWYA 3OPOA 2QRVA 1STYA 3B6YA 5GADC 1EYAA 1E2ZA 5J39A 4TQUS 2H4OA 2GN5A 3MCBB 4O0AA 4DV0Q 1EQRA 5CV8A 1Q90A 2N3SA 1MKHA 5FJ8G 3SHLA 4DF7A 2UU9L 2JA7H 2ZXOA 4PV1C 4DR6L 1IBMQ 3LKXA 4A3BB 1STEA 3STBC 2PQEA 2UUCQ 1U4RA 4DR5L 1TWAB 2K5WA 3U4ZA 4JOIC 3A5ZB 3FSCA 2K1BA 4DR4L 2K75A 2KHSA 1JR0D 4YWKA 1Q1BA 1SNCA 1EL0A 1X56A 2YV5A 4CJ1B 4CBVA 1GXDC 3OOCA 3MWYW 2EY1A 3OWEB 1NTGA 1X54A 4BBSG 1E3PA 2CKZB 2J4XA 5IWAQ 4UDUC 4DR1Q 1SN8A 5M3MH 3NTPA 4A3CG 2DNEA 1GUTA 2WKDA 3IRBA 3DUZA 4KD4A 4JBJA 2YTXA 2K5HA 2RVLA 1YNND 3KK7A 3C46A 4P2CB 4FP5D 3MTSA 2WAQE 4HSVA 2L5TA 1FGUA 3R2IA 4JBKA 1HCZA 4KHVA 1HUMA 1RIPA 2A74C 5C4ZA 1QJOA 4FO2A 2TMPA 2XN9C 3IL8A 2JXMB 4XQJA 3S14B 2RHSB 1D5MC 4BY7H 3RZOH 2MQHA 3EQLC 4H13C 4DV1L 1K8GA 2B8GA 4YWMA 4A3IH 3TP8A 2VS1A 4WJ3M 5LMNL 1JJ2A 1HUNA 4J1MA 4ILWA 5M3FG 3NBIA 2SNSA 3QIAA 4MN3A 3RNUA 4TSSA 5E5WA 2XVSA 2BH2A 1VQJA 4Y52H 2VB3X 4IO9A 2EXZA 2XSCA 4Y7NH 4I65A 1S5BD 2NVXB 3CRLC 4AH6A 3S1RB 4DV2L 5FKAC 1AN8A 2R93B 2K04A 1OTCA 5HGQA 1BBWA 2LFNA 1JJGA 1PFNA 2X69A 2PNRC 1PTOC 3KBGA 4PNYA 1UEAB 2WP8J 1HH2P 2PW5A 2JA5H 3KJOA 1G2TA 2OCEA 4A3EG 1RD9D 3T1YL 1YHBA 5C4XG 2EIFA 1WD1A 3S1QB 3S9WA 5IGDA 3ULPA 4KHZA 3S16H 3OOBA 3I3CA 4K5VA 4DR7Q 1L0XB 1G6ZA 4B3RL 4BBRG 3BZKA 2VUMG 1PA6A 3A8KE 4K2KA 1SDFA 5C44H 2K6AA 4IUTA 1SFOH 1LTID 2KA7A 4K6DA 1O7LA 3HP3A 1MBYA 2F0DA 1EIYB 2AUJD 2K5QA 1B4OA 1N36Q 5IODA 3J81i 1PXUA 5EPLA 1HR0W 1LTGD 1SNQA 2HQLA 5IGFA 3ODKA 1Y1VB 2ZXRA 2XP8A 4C3JG 5DLQE 3KAIA 1O7YA 3HKZG 2L4NA 3H3VI 2UXCQ 4NXNL 1V1PB 4RGMA 1S5ED 3C1FA 3I4NB 1PRTC 4IFDH 3WWVA 2B8FA 3PIO3 4IZ8A 1E22A 2R92H 1IXRA 3RLFA 2VNUD 4A3KB 5IYBG 2F0FA 1WCMB 3AEVA 2PCFB 4DK0A 5IT9E 2JA7G 3PF4A 4IPDA 4DK3C 4IPHA 2Y0SB 1I6HB 4DGZA 2G9HD 4JI1Q 4DXGA 3N52A 1H9SB 3SGIA 1SBBB 2VQFL 5LMUQ 4LMQD 4OL7A 4NDXA 2FHTA 2B39A 2Q8IB 4K14A 4ZUJA 4NPSA 1RP5A 5TSSA 2MUYA 4KMUC 3W3AA 1E24A 2UUAQ 1JMCA 1KNAA 4B3TQ 5FLXE 5EPKA 1VMPA 4AQYQ 2OF1A 3MXUA 3CRKC 2F3WA 2WFWA 1WR7A 1XX8A 3NE5B 4IPGA 1X65A 4HEDA 1CM9A 5IIFA 1I50H 3PQHA 4A3BG 1N34Q 1I6HH 2WAQB 4RGNA 1I4GA 3GTJH 2KXQA 2BDOA 3S15H 4ZK9B 1DZ1A 3R3OA 3NSWA 2LY7A 4JYAL 1YI2A 4DAYA 2Z0SA 2F0HA 2ZT9C 3CC7A 1ET9A 1HFNA 1UE5A 1XNRQ 4JI5L 3J7AF 3HZXA 2XPAA 2WKCA 3GTPB 4M8AA 3C3LA 4X66Q 1AE2A 1F2LA 1D1IA 2ZR5A 5C6AA 2A6HC 4DFAA 2F0OA 2PI2A 1A3VA 3KUPA 3FPUB 5E4XA 2I5HA 1H9JA 3GTGB 3CMAA 1ML0D 2FINB 4LK1C 4HIDA 2DWVA 3JAMi 2EYMA 3EBEA 5DM73 4UP9A 1Z7TA 3GD7A 4TRDA 2NVTB 3A7AB 3LKXB 1A62A 3HOUB 2KHJA 1HHVA 4GS3A 1TS3A 4GLXA 3PUYA 4ZKBB 2NTTA 4PZ7A 4R4CA 2GA4B 4C2MH 2EPBA 2EY6A 4C3IB 5IGGA 1IBKQ 3MHBA 4F8MA 2OTJA 5JEAH 4HJ7A 3CHBD 3J7YW 1Q3LA 3HGBA 1FR3A 4A75A 2BDNA 1JJCB 3BDLA 1ICWA 4LF4Q 3HG9A 3ND8A 2DGYA 2JA5G 1PV4A 4JI7Q 1Y8NB 5NUCA 1H9KA 3ND9A 1YJNA 1PHJA 1RTOA 1BR9A 3CKIB 4R8NA 3EFXD 4RGOS 4BY1H 3M7GA 3PSIA 2OQKA 2E75C 4C3IH 4DAVA 4X62L 1VQPA 1NMVA 3OMGA 1K83B 5D14A 1PH8A 3TRZA 2R93G 4LJZC 1LT6D 2IWHA 3J81E 2OXPA 3KF8B 1PTOB 3U9SA 1CA5A 4M1UB 2AQ1B 4KY6A 3PO2B 1QILA 4XT1B 2K52A 1TS4A 2NVQH 1XWEA 2PI2E 3D8GA 1I4HA 2F0NA 1K3RA 1PH1A 1Q8KA 3KOJA 4LFAL 4ZUIA 1X3FA 4DPGA 3R2TA 1STBA 3G6JB 1NR2A 4J8QA 2Q8TA 5EGTA 1VQLA 4IFDG 1IKMA 3K0XA 2FMCA 4RH6A 4IQZA 2R92G 3TZDA 4DV7L 2B3GA 2A5HA 2XRSD 1PDQA 3DEOA 3M9BA 1EIHA 1G91A 1BNZA 4OGQC 2AWOA 4X3KA 3E5SA 4K5XA 2OT2A 2JA8H 3OYYA 1TXYA 1Y1VG 3RLNA 2XWJB 1EQVA 4A3FH 2F03A 2ZM6L 5BN3A 5E64A 1ZXTA 4QIBA 3HOZB 3EJIA 1VQKA 2O5IC 3I4NG 3GTMB 1PRTB 5CMDA 2JA9A 2MGSA 2SOBA 1PYBA 1CK1A 3QG1A 4A3KG 4FVMA 3L3OC 2NYZD 3I91A 3A74A 2Y0SG 4HJAA 4KD3A 2QA4A 1SNPA 1ENAA 5C0XH 1FNVA 3DLLA 2ZQVA 1H9RA 4GOPB 4DNIA 4ZAIA 3S2HB 2PO4A 5DEHA 4JBMA 4QB4A 1TR5A 1BKBA 1VQIA 1SYCA 1EY9A 2Q2IA 4KJNA 2B2YC 5C4JH 3E9HA 1VQ6A 2F3IA 2E2DC 3NXWA 5K36H 3OMCA 1CUKA 2ZQUA 4K0KQ 4YCUA 3M7NA 2HCCA 4K6LA 2XNAC 1PH5A 1BCPD 2E74C 3DEPA 3JAME 1ET6A 2JXWA 3NEMA 2EYHA 2XIWA 2SEBD 1B7YB 2N8NA 1KQSA 1JB7A 1JE4A 2J0TD 2M9VA 3KDFA 3PIOA 3KJPA 2RDFA 4LUVA 1NJIC 1I94Q 3E9IA 4QMGA 5CV9A 2K5NA 1QUQA 4BBSH 1GJXA 2A68D 1U0LA 4A3CH 2RE3A 1I4PA 3F8TA 2D9UA 4GN3B 2E2HH 2D5DA 4XIGS 1W6KA 5I4DA 1AEXA 3LWUA 4A3MB 4GZYC 4LF5Q 5EBCA 3HOUG 4O1NA 2D0OA 3J7A5 1SROA 4P74A 2K14A 3QOJA 1LT3D 3FSBA 4C3IG 1YNJD 2I0QA 1CA6A 3KADA 4CJ2C 3PGZA 4NXML