3M85A

Archaeoglobus fulgidus exosome y70a with rna bound to the active site
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
179
structure length
179
Chain Sequence
b'MRFVMPGDRIGSAEEYVKGEGVYEEGGELFAAVAGKLIIKDRVAKVESISPIPEIVKGDVVLGRVVDLRNSIALIEVSSKKGENRGPSNRGIGILHVSNVDEGYVKEISEAVGYLDILKARVIGDNLRLSTKEEEMGVLRALCSNCKTEMVREGDILKCPECGRVEKRKISTDYGKGEW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein AF_0206
molecule tags Hydrolase/rna
source organism Archaeoglobus fulgidus
publication title Quantitative analysis of processive RNA degradation by the archaeal RNA exosome
pubmed doi rcsb
total genus 36
structure length 179
sequence length 179
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10447 EXOSC1 Exosome component EXOSC1/CSL4
A PF14382 ECR1_N Exosome complex exonuclease RRP4 N-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3m85A03
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3m85A01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3m85A02
2JXMB 3PV0A 4JI3L 2JA7G 4DV4Q 1HPCA 2ZQTA 4TVAB 4C3IH 2K50A 2O5IC 3AYHB 2OCEA 3FP9A 3KOJA 2RF4A 3CCRA 1YITA 1N9WA 1HNWL 1VS0A 3S1NH 1XMQQ 1FJGL 5JJIA 1IW7D 3HOVH 1AE3A 4GKJL 2XGTA 2A19A 1SLJA 4DR4Q 5M3MG 4JI8Q 4WJ4A 4UP8A 5BR8Q 2BA1A 3CCSA 3SGIA 1SMYC 1HNZQ 1TXYA 4GLAC 3ZJYC 1IBKQ 2IHFA 4KKTA 1E22A 1HZBA 4IJHA 4R4IA 5IWAL 2XP8A 3M4YA 1PH6A 5DLQE 2AKWB 4A3MH 3KLWA 1EG3A 4H44C 1NBWA 2FXQA 1B9MA 2E2HH 1EQRA 4DR5L 2DK1A 3CF5A 3J7A5 1TK7A 4A3BG 4P75A 5M3FG 4PV1C 3L4HA 3AQQA 1E1TA 3M9BA 3KYHC 3I4OA 1PA6A 2V1CC 4YHHL 4G7ZC 1K3RA 4GZYC 3MXNB 1VQAA 4KLKA 2VY3A 4DPGA 1OXVA 3G6EA 1M90C 2IY5B 4YCVA 1IYUA 3I4NG 2D62A 5IP9H 5C44H 4POGA 2A69C 1GUSA 3AEVA 1VQDA 4KN4C 1Q1BA 4A3FG 3PUYA 1D7QA 1VQEA 1VQKA 4APVA 1Z6HA 1G291 2ZQVA 1H95A 4NXNQ 1N36Q 4PZ8A 5E7NA 4X62Q 3CMAA 4P74A 1LTLA 4DR3L 1VQBA 2DK7A 5AHTA 4OX9Q 2OQ0A 2ZR4A 2N3SA 1HR0L 2UUBQ 1E1OA 2A6HC 3N6RA 2ASBA 1K8MA 1KC8C 1PH2A 3JAMc 5BN4A 3UDIA 4L8JA 4DV5L 3PCOB 4O2DA 1E3PA 1Y14B 2BH2A 3RN5A 5IT9c 1Z9FA 1IL2A 3PF4A 3L2PA 2EXDA 1KIXA 1IBKL 4LF8Q 4IOCA 3RZDH 4L5RC 3TEHB 1EG4A 4HIKA 4DK3C 2BDOA 4K0KQ 4IPHA 4G7HC 4X66L 1XPOA 3MEFA 3EN2A 2AWNA 4DV3Q 4LF6L 3A0JA 3KLRA 2UXCQ 3VR6A 3HOUG 3HFZB 4DR5Q 4B3SQ 1TKWB 2ZTCA 3TDBA 1HZCA 4A3EH 4GS3A 3ULJA 1Y8PB 2KCMA 2YSFA 2K33A 3EQLC 2BE5C 1XPUA 1CSPA 2ALYB 5HGQA 4JBJA 3H3VI 5IYDH 1NMFA 3ERSX 5AJ3Q 4AQYQ 1J5EQ 3QIAA 3ICEA 1Y1VH 3E9HA 4JV5Q 2JQOA 4ALPA 1E2WA 2CWPA 4DR1L 2EJMA 2BH8A 1BVSA 2RCNA 3DLLA 1N34Q 4JI5L 2ZT9C 1WYDA 2DWVA 4YCUA 4LUVA 3G48A 2D0OA 4IO9A 1YEZA 4GLVB 1IBMQ 3HOWG 4A3JG 3I7FA 1I6VC 2F3IA 1JMCA 4JK1C 2R7DA 1XPRA 2NN6G 3F2BA 2VL6A 1K9QA 2VQFQ 2E8GA 4IFDG 2R93H 2IHEA 2KHIA 2XP3A 3CXCA 4QIWE 1GO3E 3KABA 5BR8L 2JA6H 3ND9A 4GKKL 5KNBA 4DV1Q 5C4JH 2CFMA 2CKZB 5JEAJ 1JB7A 1L2FA 1JMQA 2YSIA 3JAMi 3MFYA 1PH8A 4K0KL 4BY1H 1GJXA 5IWAQ 4GOPB 1Q86C 1K8OA 3T1HQ 4JCVE 1TWCH 4DR2L 4DV0L 3CD6A 2AUJD 3W5OA 4LF7Q 1UE7A 2MO0A 1O7IA 1VQOA 2QA4A 3RLFA 4IJLA 1K83H 4LF4Q 4DNRB 1DD2A 2R92G 2ITKA 1LABA 2MNAA 2ZM6L 2D2CC 1CKNA 3PO2G 4JBKA 3I4MG 3RN2A 3A8JE 2A8VA 2Q2UA 1X3EA 4A3JH 2H5XA 1OTCA 1QUQB 3W1GA 3K8AA 2UUAQ 3UE0A 2E76C 1WCMG 1DCZA 3M4QA 2B29A 2Q2IA 2EZ5W 1G51A 2DUDA 1TWAH 3PO3G 4JI4L 1Q8KA 3OTOQ 4JOIA 3HOWH 3CRKC 1J6QA 3VR4A 4LFBL 1JJCB 4A3LG 1FVIA 4DUYL 2NZOA 2C35B 1SFOH 4DR3Q 3CC4A 3HKSA 1NMVA 4BBRG 1WFQA 1UWVA 4HIDA 5FLMG 1OXTA 2NVTH 1A0IA 3T1YL 4JI1L 2I5HA 4H0LC 4A3EG 3BDOA 4P72A 5LMUQ 1YVCA 5IYDG 1QVGA 2BE5D 2MO1A 4NPSA 4IFDI 3IFTA 4A3GG 2NN6I 3L0OA 2D5DA 1VQ4A 1YNXA 4LWCA 4X64Q 1Q90A 3NTPA 4GOPC 4A3DH 1YW5A 4R4OA 2A68C 1UE6A 1X65A 4DNTB 4LF4L 3VA7A 2YTVA 3H0GG 2F4VQ 3U50C 1PYSB 2KCTA 4BY1G 4U85A 2A1AA 4UP9A 3S1RH 5IP9G 2HHHL 3S16H 2IX1A 3K7AH 3LWUA 1UEBA 3LE4A 1RIPA 3TRZA 4A75A 3T53B 5J3BA 2OTJA 1CI3M 1PV4A 2JEBI 3JC66 4JOIC 1H9KA 1G6PA 1T5EA 4LFBQ 3S24A 1YJWA 4JI5Q 3STBD 3I56A 3S14H 2JV4A 4X65Q 3GQBA 3J81j 5K36G 1VQGA 2JMFA 3KF6B 1SN8A 2DGYA 1I50H 5IE8A 2UU9L 1VQ6A 2AUKA 1HNWQ 2XP6A 2B3GA 2LAJA 2ES2A 5ELNA 5M5YH 2Q5AA 4A3KG 4HIOA 1EQQA 4GKJQ 3KADA 2Q2TA 2JA6G 3HOZH 3HOVG 4A3DG 2N8NA 2E74C 4JYAQ 4MTNA 3ND8A 1WMVA 4GKKQ 2RHQB 4DV1L 3CAMA 3HGBA 4A3CH 2JA5G 4KKUA 3TREA 2QGQA 2OWOA 1U5KA 3H0GH 3I4NH 2O5JC 4XTCS 1H9RA 2B8GA 4BXXG 2K5HA 5M5XH 1GUGA 2F4VL 2QF7A 2A6ED 2E2JH 1GUNA 2KCCA 2MFIA 1HJPA 3KFUA 1VQJA 2EDGA 3H3VH 3DXJC 2ZR5A 3HOXG 3PF5A 1SRUA 2AHOB 3PUWA 4C3HH 4WJ3M 1NY4A 1PMRA 1Q1EA 1M1KC 2R6GA 3RLNA 2XP9A 1N32L 3UDGA 1A63A 1PH1A 3CPFA 4A3CG 4KMUC 4PZ6A 4LJZC 1JE5A 4DV2Q 1BDOA 3F1ZA 4BY7G 2XP7A 4OX9L 1P16A 1KXLA 3PUZA 4OXPA 4QJFA 3HOZG 2LMCB 2UU9Q 3T56B 1YJNA 4LF5L 1X3FA 3I55A 1W2BA 3GTGH 4A3MG 3D31A 3CPWA 5LMUL 3GDEA 4B3MQ 1WCMH 1Q81C 4DAMA 4JI6Q 2DNCA 3VDYA 3KJOA 1NTGA 3J80i 1K9MC 4QY7A 1XNRL 1X6OA 2K5NA 4R4QA 4GLXA 5C44G 4C2MH 3EIVA 4DKAC 4DV3L 1HQMC 3BG3A 5IY0A 4L5TA 1HH2P 1L1OA 2ZQSA 1I94L 3KAHA 4C3JH 4A76A 1XTDA 3M3YH 4Y7NH 4QIBA 3PO2H 2PMZE 1S72A 3GTQH 5A35A 2UXDL 1H9JA 1S40A 3I72A 1X54A 1T9HA 2VUMG 4J15A 4A3IH 4DK0A 2F52A 2WAQG 1FR3A 3AFPA 4OWTB 1YJ9A 1ASZA 1EIFA 2N49A 4LFCQ 4KHZA 1YNNC 1QZGA 4LFAL 3QJYA 1K9RA 4TKOB 1YHAA 1DGSA 2NVXH 1QVFA 1L1OC 3CMEA 2JK8A 4HR7B 4QQBX 5FLMH 3U4VA 2Q8IB 1SE8A 4OONA 1EYGA 1PVOA 1NMGA 2K7VA 2UXBQ 1EUJA 2R93G 3GD7A 2F21A 2E5LL 4DK1A 1KRTA 1VQPA 1BBWA 4AYBE 3A8IE 1GKHA 2NN6H 4A3GH 1CKOA 1FGUA 4HIMA 2PPBC 3ODKA 3KDFA 1JJGA 4BBRH 3RLOA 2PI2A 1KD1C 1A62A 2BA0A 1HNXL 4A3LH 4B3TQ 1A8VA 2XTIA 3I4LA 3WH0A 2A6HD 3KAGA 4KHPQ 1XMQL 5IYBH 1YHBA 4DR2Q 4LF7L 3CQZH 2JA7H 1SROA 2WFWA 2K4KA 3HOXH 1GM5A 2LSSA 4DUZQ 1VQ9A 1SR3A 1HCZA 1X56A 2RHSB 2B63G 2LXJA 2VQEL 2I0QA 3U9SA 3RNUA 3J80c 3I4MH 4DR7Q 1KHIA 2UUAL 3VR2A 2ZQUA 2M8IA 4P71A 4R1JA 1PH4A 1E7ZA 1Y8OB 1FL0A 1HZ9A 2A69D 5JEAH 1UE1A 3L7ZC 5C0XG 1CUKA 1MIUA 1K73C 1VQHA 3PIOA 4OO1H 1E24A 3OTOL 1PHJA 1FYCA 4I7ZC 1B9NA 4GNXA 3LNNA 1VF5C 4A3IG 4AYBG 4L5QA 4YHHQ 1X9NA 3OOBA 3GTOH 2DMVA 2L5TA 4DV2L 4OO1I 1XJVA 2DJYA 5GAHC 2Z6KC 2MQHA 1YNJC 3OW2A 3SE0A 4A3BH 1QUQA 3TC5A 4TQUS 1GD7A 4LF9L 1XMOL 1VQFA 2WP8J 4BY7H 3A5UA 1HR0Q 2UUBL 3SDZA 2NVYH 4B3TL 5M5WH 3I73A 1WR7A 4KN7C 4B3RQ 4RCNA 1GUOA 1C0AA 3CCMA 4X64L 1ZKOA 1EFWA 2E45A 3ULPA 4GNXB 2IX0A 2VQEQ 4DV6Q 1JT8A 3J81c 2JA8H 4NB3A 1CTMA 1VCIA 4POFA 4GN4B 4H13C 4DR6Q 4P73A 2MDIA 4UP7A 2V4DA 3OOCA 1H9SA 4MNOA 2Q2HA 3NELA 2VS1A 2YV5A 1YHQA 4DAYB 5AJ3L 2PNRC 1N36L 1OXSC 4OGQC 3AFQA 3OYYA 4A93H 2EQSA 3IRBA 1HR0W 2K52A 2PQAB 2K32A 3W1BA 2KENA 4DR1Q 2N78A 4RMFA 2VZAA 1IBLL 1N8RC 4DV7L 1B7YB 3RZOH 4HJ5A 4UY8C 2JA5H 3CCVA 1O7LA 2KBNA 4EQ5A 2EIFA 3FPPA 2GN5A 1GHJA 1Q7YC 2VQFL 1HNXQ 3ER0A 4ME3A 3QG1A 1P8LA 3UDFA 4X66Q 1Q46A 2ATWA 2WB1E 4PZ7A 1WOCA 4Y52H 4QL5A 3CCJA 3BZKA 2PQAA 3PGZA 3PO3H 5KNCA 5FJ8H 1YI2A 1NJIC 2B8FA 5KNDA 1K8AC 4GNXC 4YWLA 5LMNQ 3CP0A 4LUZA 4HJAA 4DUZL 4DV6L 3RR5A 1YIJA 1CFMA 1I3QH 2VUMH 1QJOA 1EIYB 1J5EL 1B8AA 4DV0Q 3K7UC 2Z6KA 1L1OB 5M3MH 5FLXc 3ULLA 5C0XH 2VNUD 2GVBA 2HIVA 2UUCL 4IOAA 5GQOA 2YTYA 2KHJA 1N32Q 3VR3A 2NVQH 3E9IA 5H1SE 5M3FH 1LM0A 3J7ZC 2M8JA 2I5MX 3PUVA 3HKZE 4DK6C 1XNQL 1Y69U 3W3AA 3PIPA 3S2HH 3EBEA 4BBSH 1HTPA 1VQIA 1H9MA 2DNEA 1IXRA 3B6YA 3HOYG 3KJPA 4LF5Q 2JE6I 1IBLQ 4YWKA 3A7LA 5FJ8G 2K14A 1B70B 3TS2A 4NXMQ 1V1QA 2D0PA 2PI2E 3T51B 4YWMA 2PCFB 4R4CA 4L5SA 3S15H 3Q8DA 4LF9Q 1ASYA 1XMOQ 1C9OA 4U84A 3K81C 1XNRQ 3T1YQ 1JJ2A 3E0EA 4JI1Q 1VQ5A 4IFDH 3NEMA 3AB9A 3M85A 3T1HL 1FJGQ 1ZCNA 1Y8NB 1I5FA 4UPAA 1DXMA 3CNGA 4DR4L 5LMNW 3GTPH 1BKBA 3M4PA 1EOVA 1N33Q 2XP4A 5LMNL 1HNZL 4REXA 1R9TH 4HJ9A 1X3GA 1Q12A 2UXDQ 2YU9H 3S1MH 3KF8B 2KXQA 4GN3B 4IPGA 3FMCA 3TS0A 1UE5A 1I6HH 3D4RA 1PFSA 2HT1A 4JI7Q 1KRSA 2YSHA 2R7FA 1E2VA 4LFAQ 1CSQA 4IFDJ 1U0LA 3TQYA 1VQMA 4DR6L 3PSIA 4BXXH 1MJEA 2OTLA 4JI4Q 1IW7C 2M3OW 2WB1G 3BU2A 2OQKA 3D0FA 3GTJH 2HHHQ 4BBSG 3STBC 1PH5A 4A93G 3OPOA 1H9SB 4LK1C 4DUYQ 1ZYRC 5C4XG 2UXBL 1QZHA 1PH3A 3CW2C 3K80C 3HOUH 4JBWA 2E5LQ 2JXWA 3I2ZA 5GAGC 4XIGS 1W3SA 3KDFB 2EJFC 5GADC 2F1MA 2IT1A 3F2CA 1LYLA 4NXML 1C7YA 2ZR6A 1YZ6A 4NXNL 1LUZA 2AWOA 4X65L 5JJKA 2AMCB 4OWWB 3TZUA 1VQLA 1KQSA 1Y1WH 1F8AB 2ID0A 2CWAA 1O78A 5C0XJ 5IYCH 4R4TA 5BN3A 1Z7TA 2VW9A 4X6AH 3BZCA 2L15A 3A74A 1V8QA 1HZAA 4DV5Q 4JYAL 4IPDA 2XP5A 2R92H 1IZ6A 1RL2A 4HJ8A 2A6EC 3OW7A 3CC7A 3DM3A 3S1QH 4LF8L 5K36H 3U58A 1VQ8A 3J81i 2YTXA 2RE3A 2ZAJA 2JA9A 4G7OC 4DR7L 3A8KE 1GHKA 2Z0SA 4JI7L 1BBUA 1CKMA 2UXCL 3KAIA 3NE5B 3MXUA 1NE3A 1O6WA 1L0WA 4JBMA 4AQYL 2XPAA 4YY3L 3F2DA 5CQ2A 1MKHA 3CCQA 4PMWA 3A5ZB 4OWXB 4JI0L 3PUXA 2JX8A 2PNHA 3FKIH 2WAQE 4MZ9A 2EJGC 3G4SA 3GTMH 2JA8G 2NZHA 1WI5A 1A6XA 5IYBG 4DV4L 4PG3A 3K0XA 4A4IA 4EX5A 1IBML 2EVBA 1Z47A 4JI2Q 4LW1A 2CQOA 5C3EH 4IPCA 4B3RL 2LXKA 4QGUA 1TWFH 2GVAA 4O0AA 2ZJRA 1V43A 3FKIG 1PH9A 4GN5A 3WDNA 4A3FH 4JI8L 3A7AB 1K0RA 2ZJQA 4B3ML 2L4JA 4JI6L 1VDZA 1VQNA 1GVPA 1N33L 2E2IH 1KAWA 3GO5A 4OO1G 1MJCA 1QVCA 1E2ZA 2KA7A 3GTLH 5C3EG 2YYZA 2Y0SG 4BA1I 4A3KH 1I94Q 4RG1A 2ZM6Q 5C0XI 3VR5A 1TU2B 5GAEC 3KAFA 4DNIA 4YCWA 5EAYA 5ELOA 1VQCA 1K8GA 5IP7H 4YY3Q 3FHWA 1IYVA 1PINA 3CCLA 4LUOA 3LGJA 4LFCL 2XPBA 4GOPA 3S2DH 2K5VA 5JJLA 4DV7Q 3H15A 2YSBA 1V9PA 2A68D 3CC2A 2K75A 4X62L 2ZTEA 1AE2A 4HJ7A 3M4OH 3CCEA 4JI3Q 1GUTA 1Y1WG 3GTKH 2DN8A 5IP7G 4JI2L 1OXXK 3S17H 5IYCG 4U86A 1EWIA 4KKSA 3UE1A 2HIXA 4AIMA 1CKNB 2ZTDA 3U4ZA 3IKJA 3H94A 5JEAG 3KF6A 3KCEA 2JJQA 1I5HW 5HY6A 2E75C 1TWHH 4BA2I 4FDBA 1D8LA 3UDXA 1WJJA 1LACA 4H02A 2CCZA 4KHPL 2YSGA 3BJUA 2HQLA 1X55A 4LF6Q 1IYJB 3G71A 3CCUA 2Y0SE 1PH7A 2JEAI 4B3SL 1PYBA 1OXUA 5C4XH 3TCZA 4AH6A 1SMXA 4LNQA 2B63H 2UUCQ 4E5RA 2CW0C 4IQZA 2QEXA 1EWHA 5GROA 1S3OA 1YBYA 3CRLC 2R7ZG 2I5LX 3P20A 1XNQQ 2R7ZH 4JV5L 1VQ7A 3F8TA 1TWGH 3WWVA 1Q82C 4JC0A 4JG2A 1ONLA 1Y1VG 4JI0Q 3M7NA 1KL9A 2ZJPA 3HOYH 1N34L 1AH9A 5BN5A 3HKZG 4KI0A 1VF7A 3NBHB 3NENA
chains in the Genus database with same CATH superfamily
2JXMB 3PV0A 3SK5A 4JI3L 2JA7G 4DV4Q 1HPCA 1RCVD 2E2HB 2ZQTA 4TVAB 4CKEA 1IHZA 4C3IH 3J7AV 2K50A 2O5IC 3AYHB 2OCEA 1F2MA 3FP9A 2IX3A 3KOJA 4RKBA 2RF4A 3CCRA 1YITA 3SHLA 1N9WA 1HNWL 1VS0A 1STYA 3S1NH 1XMQQ 1FJGL 5JJIA 1IW7D 3HOVH 1AE3A 2IWHA 4OHJA 4GKJL 2XGTA 2A19A 1SLJA 4DR4Q 3MC0B 5M3MG 4JI8Q 1TR8A 4WJ4A 4UP8A 4B08A 5BR8Q 2BA1A 2SOBA 2E2JB 3CCSA 3SGIA 3VYSA 1SMYC 1HNZQ 4I7AA 1SMYD 5FO7B 1TXYA 4GLAC 5I2XA 3ZJYC 4NKLA 2G9HD 1NR4A 1V1OA 2A5HA 1IBKQ 2B63B 2IHFA 1HZBA 1E22A 4IJHA 4KKTA 4R4IA 5IWAL 2XP8A 2MPMA 3M4YA 1PH6A 1SDFA 5DLQE 1CHQD 2AKWB 4XYQA 1RD9D 4A3MH 3KLWA 1EG3A 1NBWA 4H44C 2FXQA 1PTOB 1B9MA 4A0UA 3TP6A 2E2HH 1EQRA 1KNAA 2NB0A 1GOZA 1FNUA 4DR5L 2DK1A 3CF5A 5I9PA 3J7A5 1LT6D 3C1EA 3MXNA 1TK7A 3PQHA 4A3BG 2FFKB 4P75A 1TS2A 5M3FG 3MQGA 1ZEQX 4PV1C 3L4HA 2M00A 3AQQA 1E1TA 3M9BA 3KYHC 3I4OA 1PA6A 2XRSD 5I6YA 2V1CC 4YHHL 4G7ZC 1K3RA 4GZYC 3MXNB 4PMCA 1VQAA 2K28A 4KLKA 2VY3A 4DPGA 5IGCA 3D3RA 1OXVA 3G6EA 1M90C 2IY5B 4YCVA 1IYUA 3I4NG 1BUVT 2D62A 2R61A 5IP9H 5C44H 4POGA 2A69C 1GUSA 3AEVA 4FF3A 1VQDA 1IL8A 1HUNA 4KN4C 1Q1BA 1S5ED 1DOMA 4A3FG 2E2IB 1LTBD 4HSVA 3PUYA 1I4QA 1D7QA 4ZAIA 4RGTA 5IODA 2M2LA 1U4RA 1VMCA 1VQEA 1VQKA 4APVA 1Z6HA 1G291 2ZQVA 1EL0A 4QMGA 1H95A 4NXNQ 1AN8A 1N36Q 4PZ8A 5E7NA 4X62Q 3CMAA 3QO2A 4P74A 3M7GA 1LTLA 4DR3L 1VQBA 2DK7A 5AHTA 3IL8A 3NBHA 3T16A 4OX9Q 4IN3A 1HQRD 2OQ0A 2ZR4A 1C48A 2N3SA 1HR0L 2I46A 1E1OA 2UUBQ 2A6HC 2K05A 3N6RA 2ASBA 1K8MA 1LO5D 1KC8C 3WOFA 2PW7A 1PH2A 4DF7A 3JAMc 1FNVA 5BN4A 2JSOA 2F0JA 3E3XA 3UDIA 4FF1A 1O7YA 4L8JA 3VYUA 5A2QL 4DV5L 2WADA 3PCOB 4O2DA 3K5OA 2N55A 3EA6A 1E3PA 3FS8A 3HRZC 1Y14B 3GV3A 5M3FB 2BH2A 3JAME 3RN5A 1KABA 5IT9c 2L55A 1Z9FA 1IL2A 3PF4A 3L2PA 2EXDA 1DZ1A 1KIXA 1IBKL 2FINB 4RA8A 4LF8Q 1I4GA 4IOCA 1Y1WB 3RZDH 4L5RC 4FVMA 4EQOA 3TEHB 1EG4A 5T1IA 4HIKA 4DK3C 2BDOA 4K0KQ 4IPHA 4HCSA 4G7HC 4X66L 3K6OA 2WV6D 4JPBW 1XPOA 3MEFA 3EN2A 1SXTA 2AWNA 4DV3Q 4LF6L 3A0JA 3KLRA 4WRDA 3C3LA 2UXCQ 4KY7A 3VR6A 3HOUG 3HFZB 4DR5Q 4B3SQ 1TKWB 2ZTCA 4Q5VA 3TDBA 2WINB 1HZCA 4A3EH 5F2DA 4GS3A 2I07B 3ULJA 1EYAA 1Y8PB 1QWYA 3H6MA 4CGYB 2H1EA 2YSFA 2KCMA 2K33A 5EGTA 4QUFA 5JPMC 3EQLC 1PZKD 1TY0A 2BE5C 1XPUA 1PZID 5COYA 1CSPA 2ALYB 1F2LA 2B39A 4JBJA 5HGQA 1NMFA 3H3VI 5IYDH 2DY8A 3ERSX 5AJ3Q 4AQYQ 1J5EQ 1U9RA 1C4QA 3QIAA 1JOOA 1U4PA 3ICEA 3MCBB 1TS5A 1Y1VH 3E9HA 2JQOA 4JV5Q 4K5WA 4ALPA 5C6AA 1E2WA 5CC4A 2CWPA 3HP3A 2MHVA 4DR1L 2EJMA 1U4LA 4L63B 2BH8A 1BVSA 4A3JB 1PZJD 2RCNA 3DLLA 1WTPA 1N34Q 4JI5L 2MJ8A 5C3EB 1WYDA 2ZT9C 3V2TA 4RAUC 2DWVA 1TWCB 4YCUA 5E1FA 4LUVA 5ELFA 4N8FA 2FMMA 3G48A 2D0OA 2F0EA 1YEZA 4IO9A 1K28A 4QIWB 4GLVB 1IBMQ 3HOWG 4A3JG 5M5XB 3I7FA 2EY6A 5CBAE 1I6VC 5J22A 2F3IA 1JMCA 4JK1C 1K83B 2R7DA 4RH6A 1XPRA 2NN6G 3F2BA 2VL6A 1K9QA 4MN3A 2VQFQ 3SK4A 2EYPA 4S3SA 3I90A 2E8GA 4IFDG 1X3PA 1SYCA 3NQIA 1B3QA 3FKIB 2R93H 2IHEA 2SEBD 1LV9A 2R7ZB 5KGUA 5DEHA 2KHIA 2XP3A 3CXCA 1STBA 4KJNA 4QIWE 1GO3E 3KABA 5BR8L 5LHY1 3ND9A 2PZUA 2JA6H 4EQPA 4GKKL 2X69A 5KNBA 4DV1Q 3DEOA 2CFMA 2CKZB 1ILQA 5C4JH 5JEAJ 1JB7A 5JVH3 1L2FA 1JMQA 2Z4HA 2YSIA 3JAMi 3MFYA 1PH8A 4K0KL 5G3LD 4BY1H 3HOUB 2EYHA 1GJXA 3DUZA 5FKAC 5IWAQ 4GOPB 3KBXA 4R8IA 1Q86C 2NTSA 1K8OA 3T1HQ 4JCVE 1HA5A 1TWCH 4DR2L 4DV0L 3CD6A 2AUJD 3W5OA 5A2QE 2CQAA 2MP1A 4LF7Q 1UE7A 3FDTA 2MO0A 1O7IA 2VB3X 1SEBD 1VQOA 3LWEA 3U9OA 3A56A 2QA4A 4C3IB 3RLFA 4IJLA 3FEWX 1K83H 4LF4Q 4DNRB 1WTXA 4FYDA 1DD2A 2R92G 2ITKA 1LABA 2MNAA 2ZM6L 2D2CC 1CKNA 3PO2G 2F0VA 1KTKA 4JBKA 3I4MG 3RN2A 5EJWA 3A8JE 1WTVA 2A8VA 2Q2UA 1X3EA 1F9RA 4A3JH 2H5XA 2ZXPA 1ZYRD 1FD7D 1OTCA 1QUQB 3W1GA 1EWCA 3K8AA 2UUAQ 2IW3A 3UE0A 2E76C 1WCMG 3J7AF 1DCZA 4QUCA 2QILA 3M4QA 3TP7A 4CJ1B 2JA6B 2B29A 2Q2IA 2EZ5W 4FO2A 1G51A 3S1RB 2DUDA 1ENCA 1TWAH 3PO3G 3K7AB 4JI4L 1Q8KA 4CJ0B 3OTOQ 4JOIA 3P1HA 2VB2X 2B2YA 3HOWH 4IUUA 3CU7A 3CRKC 1CQVA 1J6QA 3VR4A 4LFBL 1D1IA 1JJCB 1HUMA 4A3LG 1A3UA 1FVIA 4DUYL 5FK9C 2R93B 2NZOA 2C35B 5ELBA 3K5MA 1SFOH 4DR3Q 3CC4A 3L9AX 3HKSA 1ESFA 1NMVA 4BBRG 1WFQA 1UWVA 1WVLA 4HIDA 5FLMG 1OXTA 1I4HA 2NVTH 1A0IA 3T1YL 1SE3A 5CV8A 1SNQA 3OMCA 4JI1L 2I5HA 2AQ3B 4H0LC 2E2DC 4A3EG 2KHSA 3BDOA 2ZXRA 5IGBA 3CHBD 4P72A 1ESRA 1SYBA 1EZ6A 1YVCA 4F7XA 5LMUQ 3D6WA 1XTCD 1IKMA 5IYDG 2B2YC 1QVGA 2BE5D 2G5DA 2MO1A 1ENAA 4NPSA 4IFDI 3IFTA 4A3GG 2TSSA 4RWSC 2XNAC 2NN6I 3L0OA 1BCPD 2D5DA 4OELB 1VQ4A 1YNXA 1ICWA 2TMPA 3MHBA 1ET9A 4LWCA 4X64Q 2L0CA 2EE1A 1Q90A 3NTPA 4GOPC 4A3DH 1YW5A 4XT1B 4BY7B 4R4OA 2RSNA 2A68C 3BDCA 1UE6A 1X65A 2Z8LA 5ELCA 1DM0B 5C4ZA 3K57A 4DNTB 1U4MA 4LF4L 4CDDC 3VA7A 2YTVA 3H0GG 4U68A 2F4VQ 3U50C 2K5DA 3BDLA 1PYSB 2KCTA 4BY1G 4U85A 2A1AA 1PTOD 4UP9A 3S1RH 5IP9G 2HHHL 2B2VC 3MAQA 3S16H 2IX1A 3K7AH 3D4WA 1R4PB 3LWUA 1UEBA 1CZGA 3LE4A 4KD3A 1RIPA 1TY2A 4WJWA 3TRZA 4A75A 3T53B 4M1UB 1EY7A 3KLSX 3MA2B 3C2PA 5J3BA 2LY7A 2OTJA 4HMJA 1CI3M 1PV4A 2JEBI 1JQYD 3JC66 4JOIC 1H9KA 2JA8B 5D3DA 1G6PA 1T5EA 4LFBQ 3S24A 1CZWA 1YJWA 4JI5Q 3STBD 3I56A 1QILA 3S14H 2JV4A 4X65Q 4ID6A 3GQBA 4TSSA 1HHVA 1T5XD 1SNMA 3J81j 1K3BC 1DJRD 2JMFA 1VQGA 5K36G 3KF6B 1LTTD 1SN8A 2FHTA 2DGYA 5J39A 1I50H 1A3VA 4N9TA 5IE8A 4MIUA 2UU9L 4C2MB 1VQ6A 2AUKA 1HNWQ 2XP6A 1JOKA 2B3GA 2LAJA 1KDCA 2ES2A 5ELNA 5M5YH 3TN2A 5EPKA 3NK9A 1BR9A 2Q5AA 1SJED 4HIOA 4A3KG 1EQQA 4GKJQ 1EQVA 4CKCA 3KADA 2Q2TA 1D6EC 2JA6G 3HOZH 3HOVG 4A3DG 1PFMA 2M9VA 2N8NA 1DOLA 2E74C 2NZ1D 4JYAQ 4MTNA 1STAA 3ND8A 1O7ZA 5L37A 3PMFA 1WMVA 4DAPA 4DAVA 4GKKQ 2RHQB 5CMDA 4DV1L 1V1PB 3RZOB 3CAMA 3HGBA 1CHPD 3R2TA 4A3CH 2B2TC 5E4WC 1WD0A 2WKCA 2JA5G 1JE4A 1TWGB 4KKUA 1J8IA 3TREA 2QGQA 2OWOA 3OMGA 3D6CA 2WAEA 1U5KA 2QKIC 2ZXOA 4XQQA 3H0GH 3I4NH 2O5JC 4C3HG 5U47A 4XTCS 1VMPA 1H9RA 2B8GA 4BXXG 2EY1A 3HOYB 2K5HA 1XXGA 5M5XH 1GUGA 5JVG3 3L3OC 2F4VL 2QF7A 3HG9A 2A6ED 3IAYA 1G2SA 2E2JH 1GUNA 2F0KA 2KCCA 2MFIA 1HJPA 3KFUA 1VQJA 2EDGA 5I9OA 1A2UA 3H3VH 3DXJC 2ZR5A 3HOXG 4A3DB 3PF5A 1SRUA 2WAQB 2AHOB 4FXGC 2DY7A 3PUWA 2X6LA 4C3HH 4WJ3M 1NY4A 1PMRA 5IGEA 1Q1EA 1M1KC 5IGGA 2R6GA 3RLNA 1HA6A 2XP9A 4QB4A 1N32L 4BY1B 3UDGA 1JWUD 1A63A 1PH1A 3CPFA 4A3CG 4KMUC 4PZ6A 1WD1A 4LJZC 4F88A 3C46A 4EQNA 2RDGA 3RD4A 1JE5A 4KJOA 4DV2Q 1BDOA 3F1ZA 4BY7G 2XP7A 4NP5A 4OX9L 1P16A 5ELEA 1KXLA 3QOLA 2RBMA 3PUZA 4OXPA 2QRVA 4P2CB 3M3YB 1SNPA 4QJFA 5JPNC 2F0LA 2HCIA 3HOZG 2LMCB 2UU9Q 5DAUA 5EPJA 3T56B 1YJNA 4RFBA 4LF5L 5ELDA 1Q8IA 1X3FA 3I55A 1S5BD 1W2BA 1L0YB 3GTGH 1RF2D 2PW5A 3RMHA 4A3MG 3D31A 3CPWA 4EGVA 5CGKA 5LMUL 4XQNA 3GDEA 4B3MQ 4KV6A 2EYMA 3TP8A 1R9TB 3T4AC 5EQ0A 1WCMH 1Q81C 4DAMA 4JI6Q 4J6HA 2DNCA 3DWQA 3VDYA 3KJOA 4IUTA 1NTGA 3J80i 4XYOA 1K9MC 5C5MA 5NUCA 4QY7A 1XNRL 1UUPA 2Y8NB 1X6OA 2K5NA 4R4QA 4GLXA 5E4XA 4X3UA 5C44G 4C2MH 2XWBB 4WFN3 3E5SA 3TDQA 1BNZA 1KDAA 3O13A 3EIVA 1ZXTA 4DKAC 4BBRB 4DV3L 1HQMC 3BG3A 5IY0A 4IALA 4L5TA 1NCVA 1HH2P 2Z1CA 1L1OA 1EY0A 1SFOB 4ZYSA 4OEMB 2ZQSA 1I94L 3KAHA 4C3JH 3JAML 1BO0A 4A76A 1D2BA 1XTDA 4HSPA 2P5ZX 3OHXC 3BYYB 3M3YH 4K6DA 3NWTA 4Y7NH 4QIBA 3PO2H 2PMZE 1S72A 3GTQH 5JAVA 5A35A 2UXDL 1H9JA 1S40A 3I72A 1X54A 1T9HA 5IGDA 2VUMG 4MTKA 4K2KA 3RZDB 4J15A 5E65A 4A3IH 1RKNA 2F52A 2WAQG 1D5ZC 1FR3A 4DK0A 3AFPA 4G4KA 4OWTB 4UDUC 4KHVA 1YJ9A 1ASZA 1EIFA 2N49A 4LFCQ 1A15A 4KHZA 5FLXE 1TWFB 1YNNC 1QZGA 4LFAL 4UHVA 3QJYA 1K9RA 2YU9B 4TKOB 4K5XA 1WTHA 4RGMA 1YHAA 1BBXC 3I70A 1DGSA 2NVXH 1QVFA 1MGSA 2HQEA 4A3EB 1L1OC 2F0PA 2JK8A 3DWAA 3CMEA 4HR7B 1HTLD 2EYOA 4QQBX 5FLMH 2R92B 3U4VA 3FPUB 4WORA 2Q8IB 1SE8A 3K58A 4OONA 1EYGA 1PVOA 1XX8A 1NMGA 2K7VA 2AQ2B 1F9QA 2KJXA 2UXBQ 1EUJA 2QW7A 4MHEA 4K2LA 2R93G 3GD7A 2F21A 2E5LL 4DK1A 1I4RA 1KRTA 4Y7NB 1VQPA 1BBWA 4AYBE 3A8IE 1B53A 1GKHA 2NN6H 4A3GH 1CKOA 1FGUA 4HIMA 2PPBC 3ODKA 3KDFA 2OT2A 4K5VA 1JJGA 4BBRH 3RLOA 5KRUA 2PI2A 3J81E 1KD1C 4LAAA 1A62A 3H09A 1SE2A 1SNCA 2BA0A 1HNXL 4A3LH 4DA2A 4B3TQ 1A8VA 2EY2A 4KTAA 3Q24A 2XTIA 4ZUJA 1STEA 3I4LA 3WH0A 2A6HD 3BZDB 3KAGA 3PO2B 4KHPQ 1XMQL 5IYBH 2EPBA 1YHBA 2F0WA 4DR2Q 4LF7L 1KAAA 3S9WA 1XYIA 3GTOB 3VYRA 2EZVA 2F0IA 3CQZH 2JA7H 1SROA 4H7BA 2WFWA 1JCKB 2K4KA 1PRTB 1F2ZA 1SYDA 3HOXH 1EY9A 2KOLA 1GM5A 2LSSA 4L6TB 4DUZQ 1VQ9A 1I50B 1SR3A 1HCZA 1X56A 2RHSB 3X3NA 4CBVA 2B63G 3BVZA 2LXJA 2VQEL 2I0QA 3U9SA 3RNUA 2XSCA 3J80c 3I4MH 4ULLA 4DR7Q 2KUMA 1KHIA 3H91A 2UUAL 3VR2A 2ZQUA 2M8IA 4P71A 3S17B 1AP0A 4R1JA 1PH4A 1E7ZA 3FSBA 1Y8OB 1FL0A 1FGBD 1HZ9A 2A69D 2K5WA 5JEAH 1UE1A 3L7ZC 4U673 1CT1D 3OIQA 2Q8RE 1S5DD 3R93A 3FVQA 1CUKA 1MIUA 5C0XG 1NAPA 1VQHA 3PIOA 1K73C 1CA6A 4OO1H 1E24A 3OTOL 3TZDA 5M9OA 4BS9A 3GP7A 1PHJA 1FYCA 4I7ZC 3KF8A 1B9NA 1FNWA 4GNXA 3LNNA 1VF5C 4A3IG 4AYBG 4L5QA 5CR3A 4YHHQ 1TR5A 5CV6A 1X9NA 3H0GB 2D9UA 3OOBA 2NWGA 3GTOH 4NW2A 4NDXA 3SK6A 3CQZB 2DMVA 2JA7B 2L5TA 4DV2L 1NSNS 2RKSA 1JR0D 4OO1I 1XJVA 2DJYA 5GAHC 2Z6KC 5CYUA 2MQHA 1AEXA 1TS4A 1YNJC 3OW2A 3T13A 3SE0A 2RSOA 2A74C 4A3BH 2AQ1B 4I65A 1EY4A 1QUQA 2A73B 3BS1A 2ENBA 3TC5A 4ZCKA 3MVVA 2LS01 4TQUS 1GD7A 2EYLA 3AU7A 4LF9L 5EKIA 1XMOL 1VQFA 2WP8J 1BOSA 4BY7H 3A5UA 1HR0Q 2F0QA 2UUBL 1PYWD 2BCOA 2F0GA 3SDZA 2NVYH 4IUNA 4B3TL 5M5WH 2C5CA 5E5WA 4HTHA 3MCBA 3I73A 1WR7A 4KN7C 2CH4A 3I3CA 5FLXL 4B3RQ 1GUOA 4RCNA 5CV4A 2LFNA 1C0AA 4RGOS 1M8AA 5LL6S 3MEHA 1J9OA 2F4IA 3CCMA 4JW0A 4X64L 1ZKOA 3S16B 3NPPA 1PRTD 2J7ZA 1O80A 4PQXA 4JVZA 3QR8A 1G2TA 1EFWA 1WTRA 5C3XA 4K8IA 1LLRD 3IFDA 1SSOA 2E45A 3ULPA 3M4OB 4GNXB 2IX0A 1SYEA 4RHSA 2VQEQ 4DV6Q 1M4VA 5I4DA 1JT8A 3J81c 3PO3B 3EFXD 2JA8H 1F2YA 4NB3A 3FRPB 3DEPA 1CTMA 1VCIA 3OWEB 4POFA 4GN4B 2B2VA 3S14B 1WCMB 4H13C 1WTWA 1B1ZA 4DR6Q 4P73A 2MDIA 4UP7A 2V4DA 2XRQD 1H9SA 3OOCA 1BCPF 4MNOA 1MI2A 2Q2HA 5LL6X 3NELA 1EU3A 2KCNA 4DXFA 1G6ZA 2VS1A 2YV5A 4XDXA 3TP5A 1YHQA 5FOBB 1SAPA 5IT9L 4DAYB 2F0DA 5AJ3L 1JWSD 2PNRC 1N36L 5HURA 1OXSC 4OGQC 5M5YB 3AFQA 4QF4A 1LT4D 3MXGA 3OYYA 1GUWA 1TS3A 3EVQA 1RTOA 2MUYA 1HXYD 1A3TA 4A93H 2EQSA 3IRBA 1ET6A 1HR0W 2K52A 4ZLTF 1QCBD 2PQAB 5EPLA 2K32A 3W1BA 1GXDC 4HMIA 2KENA 4DR1Q 4K6LA 2N78A 3GTQB 4RMFA 2VZAA 4R9WA 1IBLL 1N8RC 4DV7L 1B7YB 3RZOH 1S5CD 2B2UC 2K5QA 2PYKA 4HJ5A 2LKVA 4UY8C 5IIFA 2IJ0A 2YAJB 2F0FA 3J81L 1EIGA 4A3IB 4KY5A 5D14A 3I91A 3LX0A 2JA5H 3CCVA 1O7LA 4CKBA 5M3MB 2KBNA 3I4NB 2RQXA 4EQ5A 2MGSA 2EIFA 4PMBA 5E62A 3FPPA 2GN5A 2QDLA 4DAYA 1GHJA 1MSGA 3URYA 3G7LA 1AW7A 1Q7YC 2VQFL 1HNXQ 3ER0A 2NVXB 1BCPC 4CDEC 4F8MA 5C5LA 4ME3A 5FO9B 4K8JA 3QG1A 1P8LA 3E0JA 3UDFA 3UI2A 4X66Q 1Q46A 2ATWA 2WB1E 3BYTB 5CV5A 4KD4A 1WOCA 4PZ7A 4Y52H 4QL5A 3CCJA 3BZKA 1QG7A 2PQAA 3ONAB 4A3BB 1TWAB 3PGZA 4HN7A 2K1BA 3NQTA 5FJ8H 5KNCA 1YI2A 1NJIC 1YNJD 3PO3H 2B2TA 3HOWB 2B8FA 5KNDA 2XIWA 3HOZB 4NMZA 1K8AC 4ABNA 4GNXC 4YWLA 5IT9E 5LMNQ 3CP0A 3HKZB 1RDPD 5DNFA 1JC7A 4LUZA 1ICFB 4HJAA 3A54A 4DUZL 4DV6L 3RR5A 3ERQA 1YIJA 1CFMA 1I3QH 2F03A 1V1PA 4OIKA 5M5WB 1SYGA 1QJOA 3KLSA 2VUMH 1EIYB 1J5EL 3QWNA 2L4NA 1B8AA 1STGA 1IKLA 4O1NA 4DV0Q 3K7UC 5EKKA 2Z6KA 4AYBB 1L1OB 3SK8A 2QCPX 2SNMA 3NXWA 5KEEA 5M3MH 5FLXc 3S15B 3S1NB 4E6IA 4ZK9B 3ULLA 5C0XH 2VNUD 3NSWA 3MXPA 2GVBA 3KUPA 2HIVA 5JJZA 2UUCL 3C1FA 4IOAA 5GQOA 2YTYA 5E3FA 1DONA 2KHJA 1N32Q 1E0BA 3VR3A 2NVQH 3E9IA 5H1SE 1EEFD 5M3FH 2EYJA 4G57A 1LM0A 2Z9HA 3J7ZC 2M8JA 2I5MX 3PUVA 3HKZE 4RHRA 4DK6C 1XNQL 1JB3A 1Y69U 1PXUA 3W3AA 5CV9A 3GTGB 3E6ZX 3PIPA 3S2HH 3EBEA 3Q6SA 4BBSH 4V190 1HTPA 1EY5A 2CVRA 2VXWA 3KK7A 1VQIA 1BQQT 1W6KA 3HZXA 4FF4A 3QOJA 1C8CA 1H9MA 2DNEA 5IOCA 1IXRA 3B6YA 3HOYG 2QDBA 3KJPA 1PTOH 1CK1A 5AFWA 4LF5Q 2JE6I 1IBLQ 4YWKA 5TSSA 3A7LA 4C3HB 3W2DA 3OSOA 2K14A 5K5PA 5FJ8G 3K0YA 1B70B 3DMUA 3TS2A 1JWMD 3NUCA 4NXMQ 1V1QA 2D0PA 2PI2E 3G6JB 5J1ZA 2PMZB 2SDFA 3T51B 2RDFA 1EFID 4YWMA 4PNYA 2PCFB 4R4CA 4L5SA 2HCCA 2B2WA 3S15H 3Q8DA 3R3OA 3A55A 4LF9Q 1ASYA 1XMOQ 1R4QB 1C9OA 4YIJA 1BCPB 1SYFA 4KY6A 4U84A 4IUVA 3K81C 1F9SA 1XNRQ 3Q0AA 3T1YQ 1K0SA 1PRTC 3GTJB 1JJ2A 3E0EA 4FNFA 4JI1Q 1VQ5A 4IFDH 2K6AA 3NEMA 3AB9A 3M85A 1QNUA 3T1HL 1FJGQ 2WIIB 2WKDA 4X3TA 1ZCNA 1I5FA 1Y8NB 4UPAA 1DXMA 1I4PA 1PDQA 3CNGA 4DR4L 1KNEA 2G9DA 5LMNW 3DWPA 3GTPH 4FXDA 1BKBA 4ZRZA 3M4PA 1EOVA 4X3SA 1N33Q 2XP4A 3SEBA 5LMNL 3BVGA 1HNZL 4REXA 1R9TH 4HJ9A 1D5XC 1A2TA 1X3GA 1Q12A 2UXDQ 2YU9H 3S1MH 3KF8B 2KXQA 4QCLA 2F0UA 4GN3B 4IPGA 3FMCA 3TS0A 1UE5A 1LTSD 1I6HH 1TVXA 1PFSA 3D4RA 5D65A 2HT1A 4JI7Q 1ML0D 5C44B 1PFBA 4EVOA 1KRSA 3RUZA 5I2YA 1HFGA 2YSHA 2R7FA 2NBFA 1E2VA 4LFAQ 1CSQA 3S1QB 4IFDJ 1LTAD 1KLGD 1U0LA 3TQYA 1VQMA 4DR6L 1NNXA 2JN4A 3PSIA 4BXXH 1MJEA 2NVYB 2OTLA 4JI4Q 4C3JB 1IW7C 2M3OW 4KK7A 2WB1G 3BU2A 2OQKA 3D0FA 1AZQA 4HEDA 4TRDA 3GTJH 3MFGA 2HHHQ 2HUGA 4BBSG 1S5FD 4FP5D 3STBC 4RCOA 4A3MB 1PH5A 2SNSA 3NWSA 2K03A 4A93G 3OPOA 1H9SB 1EYCA 4LK1C 4DUYQ 1ZYRC 5C4XG 2UXBL 2VUMB 1B50A 1QZHA 1LTID 1PH3A 3CW2C 3K80C 3HOUH 3HEJA 4JBWA 2E5LQ 1ENFA 1SE4A 2JXWA 1UEAB 3I2ZA 5GAGC 3EJIA 2O2LD 4XIGS 1W3SA 2HD3A 3KDFB 1PRTF 2EJFC 3SR1A 1EYDA 5C3WA 3LKXB 3K59A 1LTGD 4UAIA 5GADC 2F1MA 2Z4IA 2IT1A 1X32A 3F2CA 1LYLA 4NXML 1JORA 1DYQA 1C7YA 2ZR6A 1YZ6A 4NXNL 1LUZA 3MZ5A 2AWOA 4DN4M 4X65L 5JJKA 2F3WA 2AMCB 3NP8A 4OWWB 1RTNA 3TZUA 5C4XB 1PFNA 4OIJA 5EBDA 1VQLA 4R8NA 1KQSA 1Y1WH 4IUPA 1F8AB 1LT5D 2ID0A 3S2HB 2CWAA 4DU9A 4BBSB 1EQTA 2KQ3A 3PIO3 4ZKBB 1O78A 3OIPA 5C0XJ 1UAPA 5IYCH 4R4TA 5BN3A 1Z7TA 4N9PA 3I8ZA 4V0BA 1II3A 2WACA 2VW9A 3BZCA 3GV6A 3TMEA 2L15A 4X6AH 3A74A 1RP5A 1V8QA 1HZAA 1STHA 4DV5Q 5DM73 4JYAL 4IPDA 2RVLA 2H4OA 2XP5A 4LMQD 2R92H 1IZ6A 3KBGA 1RL2A 5C4HA 4HJ8A 1TQOA 2A6EC 3OWFA 3OW7A 3CC7A 1KLUD 3BVMA 3DM3A 3S1QH 4C1NI 4LF8L 5K36H 3U58A 1VQ8A 2F0HA 2R3ZA 3V05A 3J81i 2YTXA 2RE3A 3ITPA 1WTQA 2ZAJA 3VYTA 2JA9A 2O4XA 4DR7L 4G7OC 3A8KE 1EY6A 4ZUIA 1GHKA 2Z0SA 4JI7L 1BBUA 1Y1VB 1MBYA 2EXZA 1CKMA 4CHTB 1MSHA 2JA5B 5EKLA 1D5MC 2HDLA 2UXCL 5E64A 3KAIA 4N8X1 4C56C 5G3LF 4B9WA 3K5NA 4XT3B 3GTPB 4ODGA 1RHPA 3NE5B 1NE3A 3MXUA 3P75A 3HOXB 1O6WA 4OL7A 1F9PA 2NTTA 2PQEA 1L0WA 4JBMA 1CA5A 3TSSA 4Q0FA 4A3KB 4AQYL 3EROA 2XPAA 2NYZD 4YY3L 3F2DA 3I4MB 1SBBB 1L0XB 3X3MA 1SNOA 5CQ2A 3LKXA 2EOTA 3R8BA 4XXEA 1MKHA 3CCQA 2FJ2A 3MWYW 1I4XA 2OEOA 2JYOA 4PMWA 3A5ZB 1B3AA 4OWXB 4JI0L 3PUXA 2JX8A 1QOHA 2PNHA 2PZWA 3FKIH 2BOSA 2KECA 1YNND 2WAQE 4MZ9A 1X3QA 2EJGC 3G4SA 3GTMH 2JA8G 2NZHA 1WI5A 1A6XA 4FF2A 5IYBG 4RKLA 4DV4L 1LT3D 4PG3A 3MTSA 1XWEA 3K0XA 3SXHA 4A4IA 4EX5A 1IBML 1D1KA 2EVBA 1Z47A 2KEDA 4A0TA 1RODA 4JI2Q 4LW1A 2CHBD 2B2UA 2CQOA 2B2WC 5C3EH 4IPCA 2L11A 4B3RL 2F0MA 2LXKA 4QGUA 1DOKA 2NVQB 1TWFH 2DJFC 2GVAA 5CORA 2J4XA 4O0AA 5KIXA 2EY5A 2ZJRA 1V43A 2K04A 3FKIG 2XVSA 1PH9A 3GTKB 4GN5A 3WDNA 4X3KA 1G8ZD 4A3FH 4JI8L 3A7AB 1K0RA 2ZJQA 4B3ML 1EEID 1MD2D 3J80E 2L4JA 2ICIA 4JI6L 3HS0C 1VDZA 1VQNA 1GVPA 3F2UA 5CV7A 1N33L 5CBEE 2E2IH 1KAWA 4FXKC 2PZTA 2BDNA 1QNKA 5E66A 5IGFA 3GO5A 1MJCA 1QVCA 1TT2A 4OO1G 4M8AA 1E2ZA 1B44D 2KA7A 2N88A 3PIP3 1AZPA 3GTLH 5C3EG 2Q8TA 4IUQA 3D8GA 1EY8A 3V96A 3R2IA 2NVTB 3VA5A 1TWHB 2NUCA 2YYZA 2Y0SG 1QE6A 4BA1I 4A3KH 5I6WA 4A3GB 3MQHA 1G91A 2ICEC 5ISRA 1I94Q 2RCFA 5D3IB 2F0OA 1STNA 4Z9CB 4RG1A 2ZM6Q 5C0XI 4IURA 3VR5A 1TU2B 5GAEC 3KAFA 3NTKA 4DNIA 4YCWA 5EAYA 2XWJB 5ELOA 1VQCA 1K8GA 2F0NA 5IP7H 4YY3Q 3FHWA 3K5LA 4XQJA 2J0TD 5EBCA 2CH4W 1IYVA 1B2TA 4RGNA 1PINA 2L9HA 3CCLA 1OO9B 4LUOA 3LGJA 2Y0SB 4LFCL 2JP1A 2IL8A 2RA4A 2DJGC 1QB5D 2XPBA 1PTOF 4GOPA 2OXPA 3S2DH 2K5VA 5JJLA 2F0SA 4DV7Q 3S1MB 3H15A 3TBIB 2YSBA 1V9PA 2KVMA 2A68D 3CC2A 1I6HB 4ZQ3A 3GTLB 3NTIA 2IPKD 2CW0D 2K75A 4X62L 2ZTEA 1AE2A 4C1NK 4HJ7A 3M4OH 1UNSA 3D4DA 3CCEA 2GA4B 4HCEA 3DM1A 3PQIA 4JI3Q 1GUTA 2K01A 1Y1WG 3GTKH 2DN8A 2F0TA 3H3VC 1HFNA 2XN9C 5IP7G 4JI2L 1OXXK 4A93B 3S17H 5IYCG 3FSCA 4U86A 1EWIA 1WTOA 4KKSA 3UE1A 5KYLA 2HIXA 2EYFA 3NTHA 2WB1B 3WOEA 4AIMA 4IZ8A 1EU4A 1CKNB 4C3JG 2ZTDA 3U4ZA 3IKJA 3H94A 3N52A 4J1MA 3Q23A 5JEAG 3KF6A 1AFPA 2X6GA 1TIID 4DXGA 3KCEA 3AMUA 2JJQA 1I5HW 1CQFA 1JICA 2L1BA 4J8QA 3GTMB 1BF4A 5HY6A 2E75C 1TWHH 4K14A 4DGZA 4C3IG 1MHWC 1CM9A 4BA2I 1S4ZA 4FDBA 2FMCA 1EOTA 1D8LA 1JOQA 4ME5A 3S2DB 3UDXA 1WJJA 1LACA 1EIHA 3SVMA 3Q22A 3CKIB 3ZYYX 5T1GA 4DFAA 4F87A 3DHQA 4H02A 4CJ2C 2KEEA 2CCZA 1ILPA 2YSGA 3BJUA 4KHPL 2HQLA 1X55A 4HAEA 4LF6Q 1IYJB 1BXTA 1NUCA 3G71A 3CCUA 2Y0SE 1W6JA 1PH7A 1EZ8A 5DM63 4B3SL 2JEAI 1PYBA 1OXUA 5C4XH 3TCZA 1RJTA 4AH6A 2Z6BA 2C9OA 1PTOC 4A3FB 1Q3LA 1SMXA 5KYIA 4LNQA 2B63H 2UUCQ 4CDCC 4E5RA 4ZKCB 1SJHD 2CW0C 2HDMA 4IQZA 2QEXA 3P7JA 1EWHA 2RDHA 1S3OA 1SNDA 3QB3A 1YBYA 5GROA 3CRLC 2R7ZG 4BWGB 3HOVB 2I5LX 1KDBA 3P20A 5JOBA 1XNQQ 2PO4A 2R7ZH 3NBIA 1I3QB 2L12A 4JV5L 5FO8B 1HRJA 1VQ7A 2QEJC 3F8TA 1FLCA 1TWGH 3WWVA 1Q82C 4JC0A 2F3VA 3J80L 4CDFC 4JG2A 1ONLA 5C4JB 1B4OA 1Y1VG 1LTRD 4O42A 3J7YW 3NHHA 4JI0Q 2OF1A 3M7NA 1KL9A 5HGTA 1F77A 2ZJPA 3HOYH 1N34L 4B9XA 1AH9A 5BN5A 4ILWA 1PLFA 3HKZG 4KI0A 1VF7A 3NBHB 3NENA 1NR2A
chains in the Genus database with same CATH topology
2JXMB 3PV0A 3SK5A 4JI3L 2JA7G 4DV4Q 1HPCA 1RCVD 2E2HB 2ZQTA 4TVAB 4CKEA 1IHZA 3J7AV 4C3IH 2K50A 2O5IC 3AYHB 2OCEA 1F2MA 3FP9A 2IX3A 3KOJA 4RKBA 2RF4A 3CCRA 1YITA 3SHLA 1N9WA 1HNWL 1VS0A 1STYA 3S1NH 1XMQQ 1FJGL 5JJIA 1IW7D 3HOVH 2IWHA 1AE3A 4OHJA 4GKJL 2XGTA 2A19A 1SLJA 4DR4Q 3MC0B 5M3MG 4JI8Q 1TR8A 4WJ4A 4UP8A 4B08A 5BR8Q 2BA1A 2SOBA 2E2JB 3CCSA 3SGIA 3VYSA 1SMYC 1HNZQ 1SMYD 5FO7B 1TXYA 4GLAC 5I2XA 3ZJYC 4NKLA 2G9HD 1NR4A 1V1OA 2A5HA 1IBKQ 2B63B 2IHFA 4KKTA 1E22A 1HZBA 4IJHA 4R4IA 5IWAL 2XP8A 2MPMA 3M4YA 1PH6A 1SDFA 5DLQE 1CHQD 4XYQA 2AKWB 1RD9D 4A3MH 3KLWA 1EG3A 4H44C 1NBWA 2FXQA 1PTOB 1B9MA 4A0UA 3TP6A 2E2HH 1KNAA 1EQRA 2NB0A 1GOZA 1FNUA 4DR5L 2DK1A 3CF5A 5I9PA 3J7A5 1LT6D 3C1EA 3MXNA 1TK7A 3PQHA 4A3BG 2FFKB 4P75A 1TS2A 5M3FG 3MQGA 1ZEQX 4PV1C 3L4HA 2M00A 3AQQA 1E1TA 3M9BA 3KYHC 3I4OA 1PA6A 2XRSD 5I6YA 2V1CC 4YHHL 4G7ZC 1K3RA 4GZYC 3MXNB 4PMCA 2K28A 1VQAA 4KLKA 2VY3A 4DPGA 5IGCA 3D3RA 1OXVA 3G6EA 1M90C 2IY5B 4YCVA 1IYUA 3I4NG 1BUVT 2D62A 2R61A 5IP9H 5C44H 4POGA 2A69C 1GUSA 3AEVA 4FF3A 1VQDA 1IL8A 1HUNA 4KN4C 1Q1BA 1S5ED 1DOMA 4A3FG 2E2IB 1LTBD 4HSVA 3PUYA 1I4QA 1D7QA 4ZAIA 4RGTA 5IODA 2M2LA 1U4RA 1VMCA 1VQEA 1VQKA 4APVA 1Z6HA 1G291 2ZQVA 1EL0A 4QMGA 1H95A 4NXNQ 1AN8A 1N36Q 4PZ8A 5E7NA 4X62Q 3CMAA 3QO2A 4P74A 3M7GA 1LTLA 4DR3L 1VQBA 2DK7A 5AHTA 3IL8A 3NBHA 3T16A 4OX9Q 4IN3A 1HQRD 2OQ0A 2ZR4A 1C48A 2N3SA 1HR0L 2I46A 1E1OA 2UUBQ 2A6HC 2K05A 3N6RA 2ASBA 1K8MA 1LO5D 1KC8C 3WOFA 2PW7A 1PH2A 4DF7A 3JAMc 1FNVA 5BN4A 2JSOA 2F0JA 3UDIA 4FF1A 1O7YA 4L8JA 3VYUA 5A2QL 4DV5L 2WADA 3PCOB 4O2DA 3K5OA 2N55A 3EA6A 1E3PA 3FS8A 3HRZC 1Y14B 3GV3A 5M3FB 2BH2A 3JAME 3RN5A 1KABA 5IT9c 2L55A 1Z9FA 1IL2A 3PF4A 3L2PA 1DZ1A 2EXDA 1KIXA 1IBKL 2FINB 4RA8A 4LF8Q 1I4GA 1Y1WB 4IOCA 3RZDH 4L5RC 4FVMA 4EQOA 3TEHB 1EG4A 5T1IA 4HIKA 4DK3C 2BDOA 4K0KQ 4IPHA 4HCSA 4G7HC 4X66L 3K6OA 2WV6D 1XPOA 3MEFA 3EN2A 1SXTA 2AWNA 4DV3Q 4LF6L 3A0JA 3KLRA 4WRDA 3C3LA 2UXCQ 4KY7A 3VR6A 3HOUG 3HFZB 4DR5Q 4B3SQ 1TKWB 4Q5VA 2ZTCA 3TDBA 2WINB 1HZCA 4A3EH 5F2DA 4GS3A 2I07B 3ULJA 1EYAA 1Y8PB 1QWYA 3H6MA 4CGYB 2H1EA 2YSFA 2KCMA 2K33A 5EGTA 4QUFA 5JPMC 3EQLC 1PZKD 1TY0A 2BE5C 1XPUA 1PZID 5COYA 1CSPA 2ALYB 1F2LA 2B39A 4JBJA 5HGQA 1NMFA 3H3VI 5IYDH 2DY8A 3ERSX 5AJ3Q 4AQYQ 1J5EQ 1U9RA 1C4QA 3QIAA 1JOOA 1U4PA 3ICEA 3MCBB 1TS5A 1Y1VH 3E9HA 2JQOA 4JV5Q 4K5WA 4ALPA 5C6AA 1E2WA 5CC4A 2CWPA 3HP3A 2MHVA 4DR1L 2EJMA 1U4LA 4L63B 2BH8A 1BVSA 4A3JB 1PZJD 2RCNA 1WTPA 3DLLA 1N34Q 4JI5L 2MJ8A 5C3EB 2ZT9C 1WYDA 3V2TA 4RAUC 2DWVA 1TWCB 4YCUA 5E1FA 4LUVA 5ELFA 2FMMA 3G48A 2D0OA 2F0EA 1YEZA 4IO9A 4QIWB 4GLVB 1IBMQ 3HOWG 4A3JG 5M5XB 3I7FA 2EY6A 5CBAE 1I6VC 5J22A 2F3IA 1JMCA 4JK1C 1K83B 4RH6A 2R7DA 1XPRA 2NN6G 3F2BA 2VL6A 1K9QA 4MN3A 2VQFQ 3SK4A 2EYPA 4S3SA 3I90A 2E8GA 4IFDG 1X3PA 1SYCA 3NQIA 3FKIB 2R93H 2SEBD 2IHEA 1LV9A 2R7ZB 5KGUA 5DEHA 2KHIA 2XP3A 3CXCA 1STBA 4KJNA 4QIWE 1GO3E 3KABA 5BR8L 5LHY1 3ND9A 2PZUA 2JA6H 4EQPA 4GKKL 2X69A 5KNBA 4DV1Q 3DEOA 2CFMA 2CKZB 1ILQA 5C4JH 5JEAJ 1JB7A 5JVH3 1L2FA 1JMQA 2Z4HA 2YSIA 3JAMi 3MFYA 1PH8A 4K0KL 5G3LD 4BY1H 3HOUB 2EYHA 1GJXA 3DUZA 5FKAC 5IWAQ 4GOPB 3KBXA 4R8IA 1Q86C 2NTSA 1K8OA 3T1HQ 4JCVE 1HA5A 1TWCH 4DR2L 4DV0L 3CD6A 2AUJD 3W5OA 5A2QE 2CQAA 2MP1A 4LF7Q 1UE7A 3FDTA 2VB3X 1O7IA 2MO0A 1SEBD 1VQOA 3LWEA 3U9OA 3A56A 2QA4A 4C3IB 3RLFA 4IJLA 3FEWX 1K83H 4LF4Q 4DNRB 1WTXA 4FYDA 1DD2A 2R92G 2ITKA 1LABA 2MNAA 2ZM6L 2D2CC 1CKNA 3PO2G 2F0VA 1KTKA 4JBKA 3I4MG 3RN2A 5EJWA 3A8JE 1WTVA 2A8VA 2Q2UA 1X3EA 1F9RA 4A3JH 2ZXPA 2H5XA 1ZYRD 1FD7D 1OTCA 1QUQB 3W1GA 1EWCA 3K8AA 2UUAQ 2IW3A 3UE0A 2E76C 1WCMG 3J7AF 1DCZA 4QUCA 2QILA 3M4QA 3TP7A 4CJ1B 2JA6B 4FO2A 2B29A 2EZ5W 2Q2IA 1G51A 3S1RB 2DUDA 1ENCA 1TWAH 3PO3G 3K7AB 4JI4L 1Q8KA 4CJ0B 3OTOQ 4JOIA 3P1HA 2VB2X 2B2YA 3HOWH 4IUUA 3CU7A 3CRKC 1CQVA 3VR4A 1J6QA 4LFBL 1D1IA 1JJCB 1HUMA 4A3LG 1A3UA 1FVIA 4DUYL 5FK9C 2R93B 2NZOA 5ELBA 2C35B 3K5MA 1SFOH 4DR3Q 3CC4A 3L9AX 3HKSA 1ESFA 1NMVA 4BBRG 1WFQA 1UWVA 1WVLA 4HIDA 5FLMG 1OXTA 1I4HA 2NVTH 1A0IA 3T1YL 1SE3A 5CV8A 1SNQA 3OMCA 4JI1L 2I5HA 2AQ3B 4H0LC 2E2DC 4A3EG 2KHSA 3BDOA 2ZXRA 5IGBA 3CHBD 4P72A 1ESRA 1SYBA 1EZ6A 4F7XA 1YVCA 5LMUQ 3D6WA 1XTCD 1IKMA 5IYDG 2B2YC 1QVGA 2BE5D 2MO1A 1ENAA 4NPSA 4IFDI 3IFTA 4A3GG 2TSSA 4RWSC 2XNAC 2NN6I 3L0OA 1BCPD 2D5DA 1VQ4A 1YNXA 1ICWA 2TMPA 3MHBA 1ET9A 4LWCA 4X64Q 2L0CA 2EE1A 1Q90A 3NTPA 4GOPC 4A3DH 1YW5A 4XT1B 4BY7B 4R4OA 2RSNA 2A68C 3BDCA 3K57A 5ELCA 2Z8LA 1UE6A 1DM0B 5C4ZA 1X65A 4DNTB 1U4MA 4LF4L 3VA7A 2YTVA 3H0GG 4U68A 2F4VQ 3U50C 2K5DA 3BDLA 1PYSB 2KCTA 4BY1G 4U85A 2A1AA 1PTOD 4UP9A 3S1RH 5IP9G 2HHHL 2B2VC 3MAQA 3S16H 2IX1A 3K7AH 3D4WA 1R4PB 3LWUA 1UEBA 1CZGA 3LE4A 4KD3A 1RIPA 1TY2A 4WJWA 3TRZA 4A75A 3T53B 4M1UB 1EY7A 3KLSX 3MA2B 3C2PA 5J3BA 2LY7A 2OTJA 4HMJA 1CI3M 1PV4A 2JEBI 1JQYD 3JC66 4JOIC 1H9KA 2JA8B 5D3DA 1G6PA 1T5EA 4LFBQ 3S24A 1CZWA 1YJWA 4JI5Q 3STBD 3I56A 1QILA 3S14H 2JV4A 4X65Q 4ID6A 3GQBA 4TSSA 1HHVA 1T5XD 1SNMA 3J81j 5K36G 1DJRD 2JMFA 1VQGA 3KF6B 1LTTD 1SN8A 2FHTA 5J39A 2DGYA 1A3VA 1I50H 4N9TA 5IE8A 4MIUA 2UU9L 4C2MB 1VQ6A 2AUKA 1HNWQ 2XP6A 1JOKA 2B3GA 2LAJA 1KDCA 2ES2A 5ELNA 5M5YH 3TN2A 5EPKA 3NK9A 1BR9A 2Q5AA 1SJED 4HIOA 4A3KG 1EQQA 4GKJQ 1EQVA 4CKCA 3KADA 2Q2TA 1D6EC 2JA6G 3HOZH 3HOVG 4A3DG 1PFMA 2M9VA 2N8NA 1DOLA 2E74C 2NZ1D 4JYAQ 4MTNA 1STAA 3ND8A 1O7ZA 3PMFA 1WMVA 4DAPA 4DAVA 4GKKQ 2RHQB 5CMDA 4DV1L 1V1PB 3RZOB 3CAMA 3HGBA 1CHPD 3R2TA 4A3CH 2B2TC 5E4WC 1WD0A 2WKCA 2JA5G 1JE4A 1TWGB 4KKUA 1J8IA 3TREA 2QGQA 2OWOA 3OMGA 3D6CA 2WAEA 2QKIC 2ZXOA 4XQQA 1U5KA 3H0GH 3I4NH 2O5JC 4C3HG 5U47A 4XTCS 1VMPA 1H9RA 2B8GA 4BXXG 2EY1A 3HOYB 2K5HA 1XXGA 5M5XH 1GUGA 5JVG3 3L3OC 2F4VL 2QF7A 3HG9A 2A6ED 3IAYA 1G2SA 2E2JH 1GUNA 2F0KA 2KCCA 2MFIA 1HJPA 3KFUA 1VQJA 2EDGA 5I9OA 1A2UA 3H3VH 3DXJC 2ZR5A 3HOXG 4A3DB 3PF5A 1SRUA 2WAQB 4FXGC 2AHOB 2DY7A 3PUWA 2X6LA 4C3HH 4WJ3M 1NY4A 1PMRA 5IGEA 1Q1EA 1M1KC 5IGGA 2R6GA 3RLNA 1HA6A 2XP9A 4QB4A 1N32L 4BY1B 3UDGA 1JWUD 1A63A 1PH1A 3CPFA 4A3CG 4KMUC 4PZ6A 1WD1A 4LJZC 4F88A 3C46A 4EQNA 2RDGA 3RD4A 4KJOA 1JE5A 4DV2Q 1BDOA 3F1ZA 4BY7G 2XP7A 4NP5A 4OX9L 1P16A 5ELEA 1KXLA 3QOLA 2RBMA 3PUZA 4OXPA 2QRVA 4P2CB 3M3YB 1SNPA 5JPNC 4QJFA 2F0LA 2HCIA 3HOZG 2LMCB 2UU9Q 5DAUA 5EPJA 3T56B 1YJNA 4RFBA 4LF5L 5ELDA 1Q8IA 1X3FA 3I55A 1S5BD 1W2BA 1L0YB 3GTGH 1RF2D 2PW5A 3RMHA 4A3MG 3D31A 3CPWA 4EGVA 5CGKA 5LMUL 4XQNA 3GDEA 4B3MQ 4KV6A 2EYMA 3TP8A 1R9TB 3T4AC 5EQ0A 1WCMH 1Q81C 4DAMA 4JI6Q 4J6HA 2DNCA 3DWQA 3VDYA 3KJOA 4IUTA 1NTGA 3J80i 4XYOA 1K9MC 5C5MA 5NUCA 4QY7A 1XNRL 1UUPA 2Y8NB 5E4XA 1X6OA 2K5NA 4GLXA 4R4QA 4X3UA 5C44G 4WFN3 2XWBB 4C2MH 3E5SA 3TDQA 1BNZA 1KDAA 3O13A 3EIVA 1ZXTA 4DKAC 4BBRB 4DV3L 1HQMC 3BG3A 5IY0A 4IALA 4L5TA 1NCVA 1HH2P 2Z1CA 1L1OA 1EY0A 1SFOB 4ZYSA 2ZQSA 1I94L 3KAHA 3JAML 1D2BA 1BO0A 4C3JH 4A76A 1XTDA 4HSPA 3OHXC 3BYYB 3M3YH 4K6DA 3NWTA 4Y7NH 4QIBA 3PO2H 2PMZE 1S72A 3GTQH 5JAVA 5A35A 2UXDL 1H9JA 1S40A 3I72A 1X54A 1T9HA 5IGDA 2VUMG 4K2KA 3RZDB 4J15A 5E65A 4A3IH 1RKNA 4DK0A 2F52A 1D5ZC 1FR3A 2WAQG 3AFPA 4G4KA 4UDUC 4OWTB 4KHVA 1YJ9A 1ASZA 1EIFA 2N49A 4LFCQ 1A15A 4KHZA 5FLXE 1TWFB 1YNNC 1QZGA 4LFAL 3QJYA 1K9RA 2YU9B 4TKOB 4K5XA 4RGMA 1YHAA 1BBXC 3I70A 1DGSA 2NVXH 1QVFA 1MGSA 2HQEA 4A3EB 2F0PA 1L1OC 2JK8A 3DWAA 3CMEA 4HR7B 1HTLD 2EYOA 4QQBX 2R92B 5FLMH 3U4VA 3FPUB 4WORA 2Q8IB 3K58A 1SE8A 4OONA 1EYGA 1PVOA 1XX8A 1NMGA 2K7VA 2AQ2B 1F9QA 2KJXA 2UXBQ 1EUJA 4MHEA 4K2LA 2R93G 3GD7A 2F21A 2E5LL 4DK1A 1I4RA 4Y7NB 1KRTA 1VQPA 1BBWA 4AYBE 3A8IE 1B53A 1GKHA 2NN6H 4A3GH 1CKOA 1FGUA 4HIMA 2PPBC 3ODKA 3KDFA 2OT2A 4K5VA 1JJGA 4BBRH 3RLOA 5KRUA 3J81E 2PI2A 1KD1C 4LAAA 3H09A 1A62A 1SE2A 1SNCA 2BA0A 1HNXL 4A3LH 4DA2A 4B3TQ 4KTAA 2EY2A 1A8VA 3Q24A 2XTIA 4ZUJA 1STEA 3I4LA 3WH0A 2A6HD 3BZDB 3KAGA 3PO2B 4KHPQ 1XMQL 5IYBH 2EPBA 1YHBA 2F0WA 4DR2Q 4LF7L 1KAAA 3S9WA 1XYIA 3GTOB 3VYRA 2EZVA 2F0IA 3CQZH 2JA7H 1SROA 4H7BA 2WFWA 1JCKB 2K4KA 1PRTB 1F2ZA 1SYDA 3HOXH 1EY9A 2KOLA 1GM5A 2LSSA 4L6TB 4DUZQ 1VQ9A 1I50B 1SR3A 1HCZA 1X56A 3X3NA 4CBVA 2RHSB 2B63G 3BVZA 2LXJA 2VQEL 2I0QA 3U9SA 3RNUA 2XSCA 3J80c 3I4MH 4ULLA 4DR7Q 2KUMA 3H91A 1KHIA 2UUAL 3VR2A 2ZQUA 2M8IA 4P71A 3S17B 1AP0A 4R1JA 1PH4A 1E7ZA 3FSBA 1Y8OB 1FL0A 1FGBD 1HZ9A 2A69D 2K5WA 5JEAH 1UE1A 3L7ZC 4U673 1CT1D 3OIQA 2Q8RE 1S5DD 3R93A 3FVQA 5C0XG 1CUKA 1CA6A 1NAPA 1MIUA 1VQHA 3PIOA 1K73C 4OO1H 1E24A 3OTOL 3TZDA 5M9OA 4BS9A 3GP7A 1PHJA 1FYCA 4I7ZC 3KF8A 1B9NA 1FNWA 4GNXA 3LNNA 1VF5C 4A3IG 4AYBG 4L5QA 5CR3A 4YHHQ 1TR5A 5CV6A 1X9NA 3H0GB 2D9UA 3OOBA 2NWGA 3GTOH 4NW2A 4NDXA 3SK6A 3CQZB 2DMVA 2JA7B 2L5TA 4DV2L 1NSNS 2RKSA 1JR0D 4OO1I 1XJVA 2DJYA 5GAHC 2Z6KC 5CYUA 2MQHA 1AEXA 1TS4A 1YNJC 3OW2A 3T13A 3SE0A 2RSOA 2A74C 4A3BH 2AQ1B 4I65A 1EY4A 2A73B 1QUQA 3BS1A 2ENBA 3TC5A 3MVVA 2LS01 4TQUS 1GD7A 2EYLA 3AU7A 4LF9L 5EKIA 1XMOL 1VQFA 2WP8J 1BOSA 4BY7H 3A5UA 1HR0Q 2F0QA 2UUBL 1PYWD 2BCOA 2F0GA 3SDZA 4IUNA 2NVYH 4B3TL 5M5WH 2C5CA 5E5WA 4HTHA 3MCBA 3I73A 1WR7A 4KN7C 3I3CA 4B3RQ 1GUOA 4RCNA 5CV4A 2LFNA 1C0AA 4RGOS 1M8AA 5LL6S 3MEHA 1J9OA 2F4IA 3CCMA 4X64L 1ZKOA 3S16B 3NPPA 1PRTD 2J7ZA 1O80A 4PQXA 1G2TA 1EFWA 1WTRA 5C3XA 4K8IA 1LLRD 3IFDA 1SSOA 2E45A 3ULPA 3M4OB 4GNXB 2IX0A 1SYEA 4RHSA 2VQEQ 4DV6Q 1M4VA 5I4DA 1JT8A 3J81c 3PO3B 3EFXD 2JA8H 1F2YA 4NB3A 3FRPB 3DEPA 1CTMA 1VCIA 3OWEB 4POFA 4GN4B 2B2VA 3S14B 1WCMB 4H13C 1WTWA 1B1ZA 4DR6Q 4P73A 2MDIA 4UP7A 2V4DA 2XRQD 1H9SA 3OOCA 1BCPF 4MNOA 1MI2A 2Q2HA 5LL6X 3NELA 1EU3A 2KCNA 4DXFA 1G6ZA 2VS1A 2YV5A 4XDXA 3TP5A 1YHQA 5FOBB 1SAPA 5IT9L 4DAYB 2F0DA 5AJ3L 1JWSD 2PNRC 1N36L 5HURA 1OXSC 4OGQC 5M5YB 4QF4A 3AFQA 1LT4D 3MXGA 3OYYA 1GUWA 1TS3A 3EVQA 1RTOA 2MUYA 1HXYD 1A3TA 4A93H 2EQSA 3IRBA 1ET6A 1HR0W 2K52A 4ZLTF 1QCBD 2PQAB 5EPLA 2K32A 3W1BA 1GXDC 4HMIA 2KENA 4DR1Q 4K6LA 2N78A 3GTQB 4RMFA 2VZAA 4R9WA 1IBLL 1N8RC 4DV7L 1B7YB 3RZOH 1S5CD 2B2UC 2K5QA 2PYKA 4HJ5A 2LKVA 4UY8C 5IIFA 2IJ0A 2YAJB 2F0FA 3J81L 1EIGA 4A3IB 4KY5A 5D14A 3I91A 3LX0A 2JA5H 3CCVA 1O7LA 4CKBA 5M3MB 2KBNA 3I4NB 2RQXA 4EQ5A 2MGSA 2EIFA 4PMBA 5E62A 3FPPA 2GN5A 4DAYA 1GHJA 1MSGA 3URYA 3G7LA 1AW7A 1Q7YC 2VQFL 2NVXB 3ER0A 1HNXQ 1BCPC 4F8MA 5C5LA 4ME3A 5FO9B 4K8JA 3QG1A 3UI2A 3E0JA 1P8LA 3UDFA 4X66Q 1Q46A 2ATWA 3BYTB 5CV5A 2WB1E 4KD4A 1WOCA 4PZ7A 4Y52H 4QL5A 3CCJA 3BZKA 1QG7A 3ONAB 2PQAA 4A3BB 1TWAB 3PGZA 4HN7A 5KNCA 2K1BA 3NQTA 5FJ8H 1YI2A 1NJIC 1YNJD 3PO3H 2B2TA 3HOWB 2B8FA 5KNDA 2XIWA 3HOZB 4NMZA 1K8AC 4ABNA 4GNXC 4YWLA 5IT9E 5LMNQ 3HKZB 3CP0A 1RDPD 5DNFA 1JC7A 4LUZA 4HJAA 3A54A 4DUZL 4DV6L 3RR5A 3ERQA 1YIJA 1CFMA 1I3QH 2F03A 1V1PA 4OIKA 5M5WB 1SYGA 1QJOA 3KLSA 2VUMH 1EIYB 1J5EL 3QWNA 2L4NA 1STGA 1B8AA 1IKLA 4O1NA 4DV0Q 5EKKA 3K7UC 4AYBB 2Z6KA 1L1OB 3SK8A 2QCPX 2SNMA 5KEEA 3NXWA 5M3MH 5FLXc 3S15B 3S1NB 4E6IA 4ZK9B 3ULLA 5C0XH 2VNUD 3NSWA 3MXPA 2GVBA 3KUPA 2HIVA 5JJZA 2UUCL 3C1FA 4IOAA 5GQOA 2YTYA 5E3FA 1DONA 2KHJA 1N32Q 1E0BA 3VR3A 2NVQH 3E9IA 5H1SE 1EEFD 5M3FH 2EYJA 4G57A 1LM0A 3J7ZC 2M8JA 2I5MX 3PUVA 3HKZE 4RHRA 4DK6C 1XNQL 1JB3A 1Y69U 1PXUA 3W3AA 5CV9A 3GTGB 3E6ZX 3PIPA 3S2HH 3Q6SA 3EBEA 4BBSH 4V190 1HTPA 1EY5A 2CVRA 2VXWA 3KK7A 1VQIA 1BQQT 1W6KA 3HZXA 4FF4A 3QOJA 1C8CA 1H9MA 2DNEA 5IOCA 1IXRA 3B6YA 3HOYG 2QDBA 3KJPA 1PTOH 1CK1A 5AFWA 4LF5Q 2JE6I 1IBLQ 4YWKA 5TSSA 3A7LA 4C3HB 3W2DA 3OSOA 2K14A 5K5PA 5FJ8G 3K0YA 1B70B 3DMUA 3TS2A 1JWMD 3NUCA 4NXMQ 1V1QA 2D0PA 2PI2E 3G6JB 5J1ZA 2PMZB 2SDFA 3T51B 2RDFA 1EFID 4YWMA 4PNYA 2PCFB 4R4CA 4L5SA 2HCCA 2B2WA 3S15H 3Q8DA 3R3OA 3A55A 4LF9Q 1ASYA 1XMOQ 1R4QB 1C9OA 4YIJA 1BCPB 1SYFA 4KY6A 4U84A 4IUVA 3K81C 1F9SA 1XNRQ 3Q0AA 3T1YQ 1PRTC 3GTJB 1JJ2A 4FNFA 3E0EA 4JI1Q 1VQ5A 4IFDH 2K6AA 3NEMA 3AB9A 3M85A 1QNUA 3T1HL 1FJGQ 2WIIB 2WKDA 4X3TA 1ZCNA 1Y8NB 1I5FA 4UPAA 1DXMA 1I4PA 1PDQA 3CNGA 4DR4L 1KNEA 2G9DA 5LMNW 3DWPA 4FXDA 3GTPH 1BKBA 4ZRZA 3M4PA 1EOVA 4X3SA 1N33Q 2XP4A 3SEBA 5LMNL 3BVGA 1HNZL 4REXA 1R9TH 4HJ9A 1D5XC 1A2TA 1X3GA 1Q12A 2UXDQ 2YU9H 3S1MH 4QCLA 2KXQA 3KF8B 2F0UA 4GN3B 4IPGA 3FMCA 3TS0A 1UE5A 1LTSD 1I6HH 1TVXA 3D4RA 1PFSA 5D65A 2HT1A 4JI7Q 1ML0D 5C44B 1PFBA 4EVOA 1KRSA 3RUZA 5I2YA 1HFGA 2YSHA 2R7FA 2NBFA 1E2VA 4IFDJ 3S1QB 1CSQA 4LFAQ 1LTAD 1KLGD 1U0LA 3TQYA 1VQMA 4DR6L 3PSIA 4BXXH 1MJEA 2NVYB 2OTLA 4JI4Q 4C3JB 1IW7C 2M3OW 4KK7A 2WB1G 3BU2A 2OQKA 3D0FA 1AZQA 4HEDA 4TRDA 3GTJH 3MFGA 2HHHQ 2HUGA 4BBSG 1S5FD 4FP5D 4A3MB 4RCOA 3STBC 1PH5A 2SNSA 3NWSA 2K03A 4A93G 3OPOA 1H9SB 1EYCA 4LK1C 4DUYQ 1ZYRC 5C4XG 2VUMB 2UXBL 1B50A 1QZHA 1LTID 1PH3A 3CW2C 3K80C 3HOUH 3HEJA 4JBWA 2E5LQ 1ENFA 1SE4A 2JXWA 1UEAB 3I2ZA 5GAGC 3EJIA 2O2LD 4XIGS 1W3SA 3KDFB 1PRTF 2EJFC 3SR1A 1EYDA 5C3WA 3LKXB 3K59A 1LTGD 4UAIA 5GADC 2F1MA 2Z4IA 2IT1A 1X32A 3F2CA 1LYLA 1JORA 4NXML 1DYQA 1C7YA 2ZR6A 1YZ6A 4NXNL 1LUZA 3MZ5A 2AWOA 4DN4M 4X65L 5JJKA 2F3WA 3NP8A 2AMCB 4OWWB 1RTNA 3TZUA 5C4XB 1PFNA 4OIJA 5EBDA 1VQLA 4R8NA 1KQSA 1Y1WH 4IUPA 3NENA 1F8AB 1LT5D 2ID0A 3S2HB 2CWAA 4DU9A 4BBSB 1EQTA 2KQ3A 3PIO3 4ZKBB 1O78A 3OIPA 5C0XJ 1UAPA 5IYCH 4R4TA 5BN3A 1Z7TA 4N9PA 3I8ZA 4V0BA 1II3A 2WACA 2VW9A 3GV6A 3TMEA 3BZCA 2L15A 4X6AH 3A74A 1RP5A 1V8QA 1HZAA 1STHA 4DV5Q 5DM73 4JYAL 4IPDA 2RVLA 2H4OA 2XP5A 4LMQD 2R92H 1IZ6A 3KBGA 1RL2A 5C4HA 4HJ8A 1TQOA 2A6EC 3OWFA 3OW7A 3CC7A 1KLUD 3BVMA 3DM3A 3S1QH 4C1NI 4LF8L 5K36H 3U58A 1VQ8A 2F0HA 2R3ZA 3V05A 3J81i 3ITPA 2RE3A 1WTQA 2YTXA 2ZAJA 3VYTA 2O4XA 2JA9A 4G7OC 4DR7L 3A8KE 1EY6A 4ZUIA 1GHKA 2Z0SA 4JI7L 1Y1VB 1BBUA 1MBYA 2EXZA 1CKMA 4CHTB 1MSHA 2JA5B 5EKLA 1D5MC 2HDLA 2UXCL 5E64A 3KAIA 3K5NA 4C56C 5G3LF 4B9WA 4XT3B 3GTPB 4ODGA 1RHPA 3NE5B 3MXUA 1NE3A 3P75A 3HOXB 1O6WA 4OL7A 1F9PA 2NTTA 2PQEA 1L0WA 4JBMA 1CA5A 3TSSA 4Q0FA 4A3KB 4AQYL 3EROA 2XPAA 2NYZD 4YY3L 3F2DA 3I4MB 1SBBB 1L0XB 3X3MA 1SNOA 5CQ2A 3LKXA 2EOTA 3R8BA 4XXEA 1MKHA 3CCQA 2FJ2A 3MWYW 1I4XA 2OEOA 2JYOA 4PMWA 3A5ZB 1B3AA 4OWXB 4JI0L 3PUXA 2JX8A 1QOHA 2PZWA 2PNHA 3FKIH 2BOSA 2KECA 1YNND 2WAQE 4MZ9A 1X3QA 2EJGC 3G4SA 3GTMH 2JA8G 2NZHA 1WI5A 1A6XA 4FF2A 5IYBG 4RKLA 4DV4L 1LT3D 4PG3A 3MTSA 1XWEA 3K0XA 3SXHA 4A4IA 4EX5A 1IBML 1D1KA 2EVBA 1Z47A 2KEDA 4A0TA 1RODA 4JI2Q 4LW1A 2CHBD 2B2UA 2CQOA 2B2WC 5C3EH 4IPCA 2L11A 4B3RL 2F0MA 2LXKA 4QGUA 1DOKA 2NVQB 1TWFH 2GVAA 5CORA 2J4XA 4O0AA 5KIXA 2EY5A 2ZJRA 1V43A 2K04A 3FKIG 2XVSA 1PH9A 3GTKB 4GN5A 3WDNA 4X3KA 1G8ZD 4A3FH 4JI8L 3A7AB 1K0RA 2ZJQA 4B3ML 1EEID 1MD2D 3J80E 2L4JA 2ICIA 4JI6L 3HS0C 1VDZA 1VQNA 3F2UA 5CV7A 1GVPA 1N33L 5CBEE 2E2IH 4FXKC 1KAWA 2PZTA 2BDNA 1QNKA 5E66A 5IGFA 3GO5A 1TT2A 4OO1G 1MJCA 1QVCA 4M8AA 1E2ZA 1B44D 2KA7A 2N88A 3PIP3 1AZPA 3GTLH 5C3EG 2Q8TA 4IUQA 3D8GA 1EY8A 3V96A 3R2IA 2NVTB 3VA5A 1TWHB 2NUCA 2YYZA 2Y0SG 1QE6A 4BA1I 4A3KH 5I6WA 4A3GB 3MQHA 1G91A 2ICEC 5ISRA 1I94Q 5D3IB 2F0OA 1STNA 4Z9CB 4RG1A 2ZM6Q 5C0XI 4IURA 3VR5A 1TU2B 5GAEC 3KAFA 3NTKA 4DNIA 4YCWA 5EAYA 2XWJB 5ELOA 1VQCA 1K8GA 2F0NA 5IP7H 4YY3Q 3K5LA 3FHWA 4XQJA 2J0TD 5EBCA 1IYVA 1B2TA 4RGNA 1PINA