3M85A

Archaeoglobus fulgidus exosome y70a with rna bound to the active site
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
179
structure length
179
Chain Sequence
MRFVMPGDRIGSAEEYVKGEGVYEEGGELFAAVAGKLIIKDRVAKVESISPIPEIVKGDVVLGRVVDLRNSIALIEVSSKKGENRGPSNRGIGILHVSNVDEGYVKEISEAVGYLDILKARVIGDNLRLSTKEEEMGVLRALCSNCKTEMVREGDILKCPECGRVEKRKISTDYGKGEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein AF_0206
publication title Quantitative analysis of processive RNA degradation by the archaeal RNA exosome
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase/rna
total genus 36
structure length 179
sequence length 179
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10447 EXOSC1 Exosome component EXOSC1/CSL4
A PF14382 ECR1_N Exosome complex exonuclease RRP4 N-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3m85A03
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3m85A01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3m85A02
1V1QA 4AYBG 4IO9A 2KA7A 3ULLA 5GAHC 4H44C 1W2BA 1EUJA 1HNWQ 4LFBL 2ZM6Q 4OO1H 4KLKA 5M5WH 2B8FA 5IYCG 3TS0A 1T5EA 2YSGA 3GTOH 4B3TQ 2JA7G 3K7UC 4IFDJ 3HOYG 2YYZA 2EJFC 1IYVA 1VQIA 4JI0L 3S1QH 2WAQG 4GN3B 1YHBA 1YJNA 1AH9A 4A3MG 4APVA 2DN8A 2EDGA 4DR1L 1WMVA 3OTOL 3TQYA 2JA5H 2K33A 1X55A 2ES2A 3NTPA 1XPRA 3J81c 1Z6HA 1HR0L 1FGUA 2YTYA 4L5TA 4ALPA 2I5HA 5IY0A 3EQLC 4DUZL 2QF7A 3VR2A 2LXKA 1BVSA 4C3IH 2UXBL 2L5TA 2JXWA 3RLNA 3KAGA 3GTGH 2A6ED 3A7AB 3FPPA 5EAYA 4YHHQ 4DR3Q 4KKTA 1TWHH 4R4CA 3KJOA 5ELNA 1E2WA 4K0KQ 2PQAA 4B3SQ 1Q1EA 4HIMA 2WFWA 1YNJC 4NPSA 3PGZA 1HZCA 2KCCA 3I4MH 3UE0A 4RMFA 2A68D 4H02A 1E7ZA 3KOJA 1YJ9A 4UP8A 3DLLA 3CCSA 1QZHA 4AQYL 3FHWA 4X62Q 4JYAQ 2ZTEA 3ULPA 1YJWA 4U85A 1IXRA 3JC66 2ZJQA 3H15A 5KNDA 1NJIC 1BDOA 1E2VA 1A62A 5LMNW 4DR4L 3T56B 1FL0A 3QG1A 2B29A 2GVBA 4DR7L 4HR7B 1QVGA 2XGTA 2UXDL 1NBWA 1O7IA 3UE1A 2JJQA 2MO0A 1EFWA 4DV0Q 1Y14B 2DNCA 1EWIA 3I4OA 3U4VA 4IPDA 1DXMA 1SRUA 1VQJA 4A3FG 1N33L 1NE3A 1X3EA 2A6HC 2AWOA 2BE5C 1Q7YC 4PG3A 3PUVA 1QUQB 5BR8Q 3HKZE 1F8AB 3CCLA 1K0RA 1GJXA 3F2DA 3P20A 4PZ8A 1X9NA 3E9IA 5J3BA 4QGUA 2MFIA 3F2CA 1E22A 2OQ0A 2AUKA 1FR3A 4KKSA 3TCZA 1CUKA 4A3JG 5M3FG 4A3IH 4LFCQ 1KC8C 2C35B 5ELOA 3HKSA 2RF4A 4LW1A 2VZAA 4JI6L 3OYYA 1CKMA 4DAYB 1PH4A 3S2HH 2E5LL 1GHJA 2JEAI 1XNRQ 1Q82C 2BA0A 1Q1BA 4RG1A 4DR2Q 1OTCA 1RL2A 2BA1A 4LF9Q 3FKIH 2HQLA 3L0OA 5IYBH 2ZR4A 1BBUA 3KF6A 3CNGA 4E5RA 3U50C 5M3MH 1YITA 4JI5Q 4A3BH 2UU9Q 4GS3A 1D8LA 2B8GA 5C44H 1HZAA 1QJOA 3KAFA 2NVXH 1XNQL 2EXDA 3TRZA 3FP9A 2OQKA 1S40A 2IX0A 2HIXA 3K80C 3KAIA 3J81i 5LMUL 2K5NA 1XPOA 1BKBA 3KF8B 4BXXH 4BBSH 5IP7H 1PH2A 4B3RQ 3D31A 3HOVG 1Y69U 1P8LA 5CQ2A 2EJMA 4JCVE 1E2ZA 1I6HH 4BY1G 4LF5L 1LTLA 2VL6A 3T1YL 1FJGL 5K36G 1VQBA 1I3QH 2BH2A 5FLMH 1GVPA 5C4XH 2XPBA 4OONA 3M85A 4KN4C 3A74A 2AKWB 5IT9c 1EIYB 3JAMc 2MO1A 1H9KA 1ZYRC 2DK7A 2VQFQ 5IP9H 1K73C 4JI7Q 4A93G 3HOWH 4FDBA 5LMNQ 1WCMG 3K7AH 1A63A 1BBWA 4KHPQ 3G6EA 3A8JE 1HNXL 4NXMQ 1DGSA 4NXNL 2A19A 3E0EA 3J80c 1TWCH 3QIAA 2E75C 3HOZG 5E7NA 3L2PA 1PH5A 3ER0A 1OXTA 5A35A 3BZCA 1XMQQ 4DV3L 4PZ7A 5C0XH 4C2MH 1KD1C 4G7OC 3VDYA 1IW7D 2K5VA 4L5RC 2A8VA 3J7A5 2JX8A 4LUOA 2BE5D 1E1TA 2JQOA 4GN5A 3AB9A 4NB3A 2VQEL 1Y1VH 4Y52H 3S2DH 1H95A 3H3VI 4GKKQ 1XPUA 4C3HH 2B63G 2ZQSA 5GADC 2DJYA 2VUMG 2A68C 4KHZA 2D0OA 1IBMQ 3ERSX 1JMQA 2Q8IB 3H0GH 4HJ7A 2CCZA 5H1SE 4WJ3M 1L0WA 4JOIA 1K8MA 4OO1I 1VF7A 4UP9A 4P74A 4POGA 4JBJA 2FXQA 3PCOB 2Q5AA 3CRKC 1U0LA 1UWVA 2EJGC 4LF8L 1H9JA 3LE4A 3J81j 1EQRA 4A3LH 1YW5A 3CXCA 3T51B 3EN2A 4J15A 4A3DG 2E45A 2XPAA 1B9NA 2F4VL 1PH3A 1XMOL 3KFUA 1EG3A 2HHHQ 1VQDA 4JBWA 2PCFB 4BY7H 1KRTA 3M4PA 4TVAB 1KL9A 4LF7L 1UEBA 3K8AA 4JV5L 4BBRH 1ZCNA 3G71A 3PO3H 3WH0A 1N8RC 4X65Q 1VQCA 4YY3L 1CKOA 3CW2C 1HZBA 4JBMA 2O5JC 4OO1G 4AQYQ 2Q2HA 1Y8PB 1I94L 1Q81C 1K9RA 1VS0A 4YWLA 3A5UA 1HPCA 4QIWE 4JI4Q 1NY4A 5JJIA 2YU9H 1N36L 2A1AA 1K8GA 2KCMA 1N34Q 3OOCA 3M4OH 3VR5A 3TZUA 4HJ8A 2ZQTA 4BA2I 3GTLH 2Y0SG 3Q8DA 1VQ5A 4DK1A 5JEAG 1GUNA 1SE8A 1L1OA 2YTXA 5GQOA 4LNQA 1J6QA 1FVIA 2JA5G 1LUZA 2NVQH 1P16A 2E2JH 2JA8G 1H9SA 4X64L 5C3EH 3ULJA 1X54A 4DR5L 3GTKH 2D5DA 5KNBA 3GTJH 3JAMi 1Q86C 2F1MA 2IT1A 1N32Q 3HGBA 2VW9A 2PNHA 5AJ3L 1PH6A 2ZTDA 1SROA 4OWTB 4DK3C 1VQOA 2M8IA 2QA4A 1IBLL 3PV0A 3KLWA 1CTMA 1OXUA 2XP8A 3S1RH 1TWGH 3HOXG 1WR7A 3KYHC 1X3GA 2E76C 3KJPA 3J80i 2UXCQ 1Z7TA 1VQLA 3I4MG 1OXVA 2WB1E 1R9TH 1J5EL 1KIXA 2R7ZG 4QL5A 2UUAL 2A69C 1A8VA 1EIFA 4JI2Q 4U86A 2IHEA 1YIJA 4A3MH 2R92H 4JI1Q 1K8OA 1IL2A 4IPGA 4OX9Q 4Y7NH 3PUYA 3OOBA 4LF4L 3T1HL 3CD6A 2UUBL 2HT1A 3KDFB 4JI3Q 1QVCA 1VQ8A 5GAEC 4GOPA 2Q2TA 1CKNA 4U84A 2H5XA 1QVFA 4A76A 3NELA 1PH8A 4GKJL 3PF4A 4IJLA 2JK8A 1O78A 1PHJA 4R4OA 4KKUA 3TEHB 2E74C 4O2DA 3NE5B 2O5IC 1VQHA 4DV7Q 2Q2UA 1X3FA 2CW0C 2HIVA 4GLVB 1HNWL 2PMZE 2JA6G 3PUWA 4JOIC 3ND9A 2K14A 2ZM6L 1T9HA 2LSSA 1IW7C 1JMCA 2KXQA 4DV2Q 3KCEA 3U58A 1MJEA 1VQFA 3E9HA 1IZ6A 1YVCA 3GDEA 4A3IG 4B3TL 4HIOA 2RHSB 4DK6C 4DV5Q 3CF5A 1GUTA 1SR3A 2M3OW 2R7DA 1C9OA 5KNCA 2ZJRA 4JC0A 3I72A 1X65A 3ZJYC 4HJ9A 1K9QA 3ND8A 1VQEA 5IWAL 4YWMA 4DPGA 4GNXA 1ASYA 3FKIG 4BA1I 5IYDG 1VQ7A 4HIDA 4DUYL 1HR0W 4HJ5A 4YCWA 4B3MQ 3CPFA 2NZOA 4A4IA 4LFAQ 3I4LA 5M3MG 4KMUC 5BN3A 4DR6Q 1E24A 1GUGA 1GD7A 4A3BG 1QZGA 3LNNA 5C44G 3BG3A 2MDIA 3CPWA 3UDIA 4YHHL 2LMCB 4DR3L 4P72A 2UUCQ 1M1KC 3K0XA 1VQ9A 1YNNC 4JG2A 1C0AA 5JEAJ 1I5FA 3M4YA 4BBSG 3HFZB 3PUXA 3AEVA 1Y1WH 5IP7G 2DWVA 1NMFA 1L1OC 4LF6Q 2WAQE 4H13C 3MEFA 4IJHA 1GHKA 2N49A 3PO2H 4JI8Q 2VY3A 2CQOA 4DV1Q 2K7VA 1HNZQ 1H9MA 5FLMG 5C4XG 2A69D 5C0XI 1PYSB 3CMEA 2Z0SA 3F8TA 4X62L 4JYAL 2JXMB 2QEXA 1YHQA 3KAHA 4GZYC 3EBEA 5IP9G 2NVYH 1SMYC 2CFMA 1GO3E 3HOWG 1LM0A 5DLQE 4DV4Q 2XP5A 3S15H 2PI2E 2Q2IA 4DV6Q 2D0PA 3WWVA 2XP9A 4DNTB 1CI3M 3I4NG 1GUOA 3W1GA 4DV0L 1B70B 3GTMH 4IFDH 3CRLC 1A6XA 3DXJC 3AYHB 1SLJA 3S1MH 2JMFA 1JJ2A 2OTLA 3D0FA 1V43A 2Z6KA 4MZ9A 3OW2A 3I55A 4DNRB 3CC7A 1KQSA 4LUZA 5C0XG 5HY6A 4X66Q 5BR8L 3I56A 2PQAB 5JJKA 4A3EH 2L15A 2XP4A 1X6OA 4LFBQ 2YTVA 4GOPC 1JE5A 1GKHA 2K52A 1Y1VG 4L5SA 4L5QA 1IYUA 1YHAA 1YI2A 2CWAA 3T53B 3A7LA 3HOUH 4LFCL 2RE3A 1YEZA 1UE1A 1EWHA 1EOVA 3PIOA 3NENA 2ZTCA 4JI0Q 2VNUD 3H0GG 1LYLA 1LABA 1OXXK 2DK1A 3GQBA 3L7ZC 2B3GA 3UDFA 2YV5A 1XNRL 3HOZH 4DR2L 3RLFA 4DR1Q 5AJ3Q 4UP7A 3OTOQ 1PH7A 1M90C 4LF9L 4PV1C 1Y8OB 3TREA 4YWKA 4A3LG 4QIBA 2NZHA 2MQHA 1HR0Q 1IBLQ 2ASBA 1AE3A 4C3JH 5C4JH 1XTDA 1YNXA 4A3GH 4DUZQ 1GUSA 4JI5L 4RCNA 1XJVA 2UU9L 2UXBQ 1VQPA 5FJ8G 1ASZA 5AHTA 3A8IE 4I7ZC 3CMAA 3U9SA 4P73A 1EQQA 3SDZA 2YSHA 3NBHB 4HIKA 4P71A 1QUQA 4A3CH 4BBRG 1S3OA 1ZKOA 5BN4A 4IPHA 1B8AA 2B63H 2GVAA 1VQ4A 4B3RL 1TKWB 1MKHA 4UPAA 2VUMH 1IBKL 1K3RA 1TU2B 2R93G 4A3KG 1H9RA 5GROA 3F1ZA 4GNXC 4QJFA 1DCZA 2AWNA 1LACA 3DM3A 4OGQC 2ZR6A 1WOCA 4LUVA 3RN2A 4JK1C 1WJJA 5M5YH 2NVTH 2K5HA 4O0AA 3HKZG 3NEMA 1WI5A 1G291 2VQFL 1K83H 1VF5C 3CCRA 1CSQA 4JI7L 3CCQA 5LMNL 4XTCS 1JT8A 3AFQA 2WP8J 3G48A 2NN6H 1MJCA 4DR4Q 4KHPL 1UE7A 3RNUA 1RIPA 5C3EG 1Q46A 1SN8A 3RZDH 2RCNA 4YCVA 4NXML 2KBNA 4DR7Q 1PH9A 2UXDQ 3KF6B 1IYJB 3TS2A 1VQNA 3IFTA 4OXPA 2K50A 4IOAA 1Z9FA 4QQBX 2N3SA 2PI2A 3RLOA 4PMWA 5GAGC 1XMQL 1VQGA 1N33Q 3J7ZC 3EIVA 2CWPA 1B9MA 1NMVA 1UE5A 2ZJPA 3STBD 1CFMA 1VCIA 4PZ6A 3I2ZA 5JEAH 1Y8NB 4GKKL 3S24A 3VR4A 1K8AC 2R92G 5IYCH 3QJYA 5IWAQ 2JA7H 3HOYH 1N9WA 1IBML 4OWWB 1JJGA 1VQ6A 2JA8H 2D62A 1YZ6A 2PPBC 3PIPA 4DUYQ 4JI6Q 2Z6KC 1V8QA 3IRBA 1O6WA 1I50H 1NMGA 5C0XJ 2E5LQ 4DKAC 3D4RA 4L8JA 2AUJD 1K9MC 4X6AH 3BDOA 4ME3A 3GO5A 3TC5A 2ALYB 1SFOH 3CCUA 4KI0A 2ZQUA 3HOXH 2HHHL 1L2FA 1MIUA 3PSIA 3TDBA 2L4JA 1XNQQ 5HGQA 4WJ4A 2OWOA 2R7ZH 1TK7A 3S16H 5LMUQ 3CCVA 4X65L 3BU2A 3CCMA 2KCTA 3S14H 1O7LA 2I5LX 2EZ5W 2KHIA 4H0LC 2E2HH 3I73A 2LXJA 3MXNB 4LF5Q 1TWAH 4JI4L 3T1YQ 1FJGQ 3OW7A 3W3AA 3CQZH 3WDNA 1N34L 1SMXA 2E2IH 2YSIA 5FLXc 1W3SA 4TKOB 1KHIA 1AE2A 2N78A 1HJPA 1EYGA 4GN4B 4IPCA 1YBYA 1PMRA 4HJAA 2KHJA 4R4IA 3CCEA 1A0IA 2BH8A 3SE0A 2DNEA 1HQMC 1HNXQ 4UY8C 2M8JA 3VR3A 4MNOA 4QY7A 4NXNQ 2K4KA 2K32A 2PNRC 1N32L 3G4SA 2JA6H 2ZAJA 1FYCA 4A75A 2N8NA 4AIMA 5IYBG 4DV3Q 4AYBE 4A3FH 2F3IA 2KENA 3VA7A 1DD2A 3H94A 1Y1WG 2RHQB 2OCEA 1Q8KA 4R4QA 1U5KA 4LJZC 2Y0SE 2UXCL 3IKJA 3PO2G 2I5MX 4IFDI 2VQEQ 4AH6A 4JI2L 3KLRA 3VR6A 4K0KL 2MNAA 4IQZA 2ATWA 5M5XH 4B3SL 2DMVA 4JI1L 4BXXG 1PINA 2DUDA 1JJCB 3CP0A 4A3JH 5M3FH 3FMCA 4OX9L 3BJUA 2JA9A 5IYDH 3GTPH 2ZQVA 4G7HC 2GN5A 4JI3L 2XP3A 1L1OB 3LGJA 3UDGA 2CKZB 4DK0A 3U4ZA 1I6VC 3MFYA 4REXA 2IHFA 3N6RA 3RZOH 4LF8Q 2XTIA 1H9SB 3M7NA 1HZ9A 3M4QA 4R4TA 3OPOA 4IFDG 2F4VQ 3I7FA 1XMOQ 2IX1A 1WYDA 4JBKA 3ICEA 1G51A 1VQAA 1IBKQ 3W5OA 1HCZA 1S72A 3F2BA 3SGIA 4KN7C 3KABA 4LF7Q 4DV7L 3GD7A 4JV5Q 2BDOA 2E8GA 4A3EG 1C7YA 2V4DA 1UE6A 1PA6A 1CSPA 4YY3Q 3A8KE 2EQSA 2ZT9C 3HOVH 2JEBI 4DV2L 3ODKA 1ONLA 1I5HW 3GTQH 1I94Q 3STBC 4BY1H 3K81C 1GM5A 3A5ZB 2JV4A 3LWUA 4DNIA 3HOUG 3A0JA 4DV5L 1KXLA 5K36H 2YSBA 1N36Q 3AQQA 3AFPA 3S1NH 3W1BA 2OTJA 1X56A 2EIFA 3KDFA 4EQ5A 4P75A 2XP6A 3I4NH 2WB1G 4A93H 2LAJA 2DGYA 4GOPB 4G7ZC 4YCUA 1WCMH 4EX5A 3PUZA 4X64Q 1KRSA 1CKNB 4B3ML 4GLXA 4DR5Q 4LFAL 4A3GG 1G6PA 4LK1C 1WFQA 2I0QA 4DR6L 2A6EC 1PFSA 2VS1A 1B7YB 2A6HD 1PV4A 2AMCB 3UDXA 5IE8A 3M3YH 5JJLA 4POFA 4R1JA 2UUCL 4A3CG 2NN6I 1TXYA 4IOCA 3CAMA 4LWCA 4MTNA 2V1CC 1D7QA 4TQUS 2R6GA 4GLAC 2R7FA 4LF6L 3MXUA 2ID0A 4DAMA 4BY7G 3S17H 1OXSC 2XP7A 1HH2P 4JI8L 2QGQA 3M9BA 2EVBA 1J5EQ 2UUAQ 4DV1L 3BZKA 1HNZL 3PO3G 1Q12A 1PYBA 3CCJA 2F52A 2JE6I 4OWXB 2ITKA 2YSFA 1V9PA 4LF4Q 1JB7A 3PF5A 3T1HQ 2ZR5A 1E3PA 2UUBQ 3CC2A 3CC4A 1KAWA 1PVOA 3L4HA 1Z47A 2NN6G 3RR5A 4DV4L 2AHOB 3B6YA 5FJ8H 4GNXB 4DV6L 1Q90A 1PH1A 2D2CC 1HTPA 2IY5B 4A3DH 1NTGA 2K75A 4GKJQ 1TWFH 2F21A 1VDZA 3H3VH 1VQKA 5BN5A 1E1OA 3KADA 1EG4A 2R93H 4A3KH 3RN5A 4XIGS 1VQMA 4X66L
chains in the Genus database with same CATH superfamily
1V1QA 3VYSA 2QILA 4AYBG 4IO9A 2KA7A 5C5LA 3ULLA 5GAHC 4H44C 1W2BA 1EUJA 1HNWQ 1D5MC 4LFBL 3I91A 2SEBD 2KJXA 2ZM6Q 4OO1H 1EY6A 4KLKA 5M5WH 3FEWX 3HOUB 4CKEA 1LT5D 2B8FA 5IYCG 3TS0A 1T5EA 2YSGA 2EYJA 4ID6A 3GTOH 3KF8A 4B3TQ 3EJIA 2JA7G 3K7UC 4IFDJ 4RAUC 3BYYB 2ZXRA 3HOYG 2YYZA 2EJFC 3BS1A 1QOHA 2VB2X 3S2DB 1IYVA 1VQIA 1V1PB 4JI0L 3CKIB 4C3HB 1K3BC 3S1QH 1LTBD 2WB1B 2QW7A 4RGMA 2WAQG 4GN3B 1PRTD 1YHBA 1YJNA 1AH9A 4A3MG 1LTRD 3CU7A 2F0FA 4APVA 2DN8A 2EDGA 4DR1L 1DOKA 1SNPA 1WMVA 3OTOL 4Q0FA 3TQYA 2JA5H 2K33A 2LS01 2F0TA 1X55A 2VXWA 2IWHA 2ES2A 1W6KA 1XXGA 3NTPA 5C4JB 1XPRA 3X3NA 3J81c 4A3GB 2X69A 1Z6HA 1HR0L 1FGUA 2YTYA 4IALA 4L5TA 4ALPA 2I5HA 5IY0A 3ONAB 5CV9A 3EQLC 4DUZL 1NNXA 1EIHA 2PYKA 1CT1D 2LXKA 2QF7A 3VR2A 1BVSA 4C3IH 2UXBL 2PZTA 5FOBB 2L5TA 2JXWA 2XRQD 3ITPA 3RLNA 4LAAA 1XYIA 4IURA 3KAGA 1QILA 3OIPA 3GTGH 2A6ED 3A7AB 3FPPA 5EAYA 4YHHQ 4DR3Q 2NYZD 4F88A 1TWHH 4KKTA 1M4VA 4R4CA 3KJOA 4ME5A 5ELNA 1E2WA 4K0KQ 1VMPA 2HCCA 2PQAA 4B3SQ 1Q1EA 3G7LA 2LY7A 4HIMA 2F0KA 2WFWA 1HXYD 4DXFA 1YNJC 4NPSA 4BY7B 5C3WA 2EPBA 3R2TA 1BUVT 2DY8A 3HG9A 3DEOA 3PGZA 2EY2A 1HZCA 4J6HA 4PNYA 2R61A 3I70A 4FXDA 2KCCA 3PO3B 5E66A 3I4MH 3DMUA 3UE0A 5M5YB 4RMFA 2A68D 1B1ZA 4H02A 2CH4W 1E7ZA 1WTPA 3KOJA 2E2DC 4N8X1 1YJ9A 5E5WA 1DONA 4UP8A 3DLLA 3CCSA 3H3VC 1QZHA 5ISRA 2PMZB 3C3LA 1K83B 1MGSA 4AQYL 3FHWA 1BCPB 4X62Q 4JYAQ 2ZTEA 1SYFA 3ULPA 1ET6A 1YJWA 4U85A 1IXRA 1PZJD 2MGSA 3JC66 2ZJQA 1EU3A 3H15A 5KNDA 1NJIC 1BDOA 2K28A 3OMCA 2H1EA 1E2VA 1A62A 5LMNW 3RZDB 4DR4L 3BDLA 3T56B 5JVH3 1FL0A 1G2SA 2B29A 3QG1A 2GVBA 1PZKD 1B4OA 2B2UC 3EA6A 2C9OA 4DR7L 4HR7B 1QVGA 2XGTA 3T16A 2UXDL 1NBWA 1O7IA 3UE1A 2JJQA 2MO0A 2WKDA 4DV0Q 1EFWA 4K6DA 1HQRD 1Y14B 2DNCA 1J9OA 1EWIA 5EKLA 2L11A 1U4PA 1KDBA 2F0MA 3I4OA 3U4VA 4IPDA 1DXMA 1SRUA 2D9UA 1VQJA 3NBHA 1B50A 4A3FG 1N33L 4AYBB 1NE3A 1X3EA 5EBDA 2A6HC 2AWOA 2BE5C 1Q7YC 4PG3A 3PUVA 4X66L 4XDXA 2B2VA 1QUQB 1PTOB 2RBMA 5BR8Q 3HKZE 4U68A 2F3WA 1F8AB 1LTSD 3CCLA 3HP3A 1K0RA 1GJXA 5CORA 1EYCA 3F2DA 4X3UA 4A0TA 3P20A 4PZ8A 1X9NA 3K6OA 2F03A 3E9IA 5J3BA 3DWAA 1I4XA 2ENBA 5U47A 2B2WA 4QGUA 3S1RB 3SVMA 2MFIA 3F2CA 3MXGA 1E22A 2IPKD 2OQ0A 2Z9HA 2JA7B 2AUKA 1FR3A 4KKSA 1PYWD 1L0XB 3TCZA 3HOYB 1CUKA 4K2KA 4KJNA 4A3JG 5M3FG 4A3IH 4LFCQ 1KC8C 4MIUA 2C35B 1D2BA 5ELOA 3HKSA 1JOOA 2F0LA 1GOZA 2RF4A 4LW1A 4OIJA 2VZAA 3C2PA 1RDPD 2EOTA 2HDMA 4JI6L 3L9AX 3OYYA 1CKMA 4DAYB 4A3MB 1PH4A 2K5WA 2A74C 5JPNC 3S2HH 1JOKA 2WACA 2RA4A 1GXDC 2ICIA 3NTHA 2E5LL 2DJGC 1GHJA 3LKXA 1HFGA 1XNRQ 2JEAI 1Q82C 2BA0A 1Q1BA 4RG1A 4DR2Q 1OTCA 1RL2A 2BA1A 4N8FA 4IUVA 1STYA 4LF9Q 3FKIH 3PIO3 2HQLA 3L0OA 5IYBH 1SFOB 2ZR4A 1BBUA 5ELDA 3KF6A 3CNGA 3HOXB 4QF4A 4XT1B 4I7AA 4E5RA 2NZ1D 5LHY1 3X3MA 2EY1A 3U50C 5M3MH 3R2IA 1YITA 2JP1A 4JI5Q 1KLUD 4A3BH 2UU9Q 4GS3A 1D8LA 2B8GA 5C44H 1HZAA 1QJOA 3KAFA 2NVXH 1XNQL 3Q22A 1CQVA 2EXDA 1RD9D 3TRZA 3FP9A 2OQKA 4QMGA 1S40A 4O42A 2IX0A 2HIXA 3K80C 3KAIA 3J81i 5LMUL 2K5NA 3S14B 1XPOA 1BKBA 2KECA 2B39A 3KF8B 4BXXH 4BBSH 5I6WA 5IP7H 4ZCKA 1PH2A 4B3RQ 3TP5A 5LL6X 3D31A 2XSCA 3HOVG 1Y69U 5KYIA 1P8LA 1TWAB 5CQ2A 1EZ8A 2EJMA 1WTHA 4JCVE 1E2ZA 1I6HH 1YNJD 4BY1G 1RKNA 4LF5L 1BBXC 1G8ZD 5DEHA 1LTLA 1SE2A 2MJ8A 2KEDA 2VL6A 3T1YL 1FJGL 2IX3A 3MZ5A 5K36G 5C3XA 1VQBA 1I3QH 2BH2A 3FSBA 2E2IB 5FLMH 1GVPA 4B9WA 5C4XH 2XPBA 4OONA 3M85A 4KN4C 3A74A 2AKWB 5IT9c 1EIYB 3JAMc 2MO1A 1H9KA 4KHVA 5A2QL 1ZYRC 2DK7A 2VQFQ 5IP9H 4RFBA 3NBIA 5ELCA 1K73C 3IL8A 4JI7Q 4A93G 3Q0AA 1EU4A 3BZDB 1TS2A 4WRDA 3HOWH 1J8IA 1FNWA 4FDBA 5LMNQ 1PRTC 1WCMG 5E4XA 3K7AH 1A63A 1BBWA 4KHPQ 5F2DA 3VYUA 3G6EA 3R3OA 2B2TA 3A8JE 1HNXL 4NXMQ 4ZKCB 4R8IA 1EL0A 4V0BA 4ZRZA 1DGSA 4NXNL 3GV6A 1X3PA 2A19A 2JA6B 3E0EA 1JWMD 4DU9A 1K28A 4OEMB 3J80c 4UAIA 1TWCH 3QIAA 2E75C 3HOZG 1AN8A 5E7NA 1JOQA 1WVLA 4A3FB 3NPPA 3L2PA 1PH5A 3ER0A 1JWUD 1KTKA 1OXTA 3BZCA 5A35A 2EYHA 1XMQQ 4DV3L 2CW0D 5CMDA 4PZ7A 3P75A 5C0XH 4C2MH 1KD1C 3VDYA 4G7OC 4C3JG 3PMFA 1IW7D 2K5VA 4L5RC 2A8VA 3J7A5 2JX8A 5JVG3 4LUOA 1S5ED 4HMIA 1HUMA 2OEOA 2PW5A 4FVMA 1NSNS 1LT4D 3D6CA 2BE5D 1E1TA 1IHZA 2JQOA 4GN5A 3AB9A 4NB3A 2G9DA 2VQEL 2CVRA 2JN4A 1WTXA 1Y1VH 4Y52H 3MXNA 1ESFA 3S2DH 5I9PA 4A3JB 5M3FB 3H3VI 1H95A 4GKKQ 1XPUA 4C3HH 4O1NA 2B63G 2RSNA 3FSCA 3GTPB 2Z8LA 3VYRA 2ZQSA 1D1IA 5GADC 2DJYA 2VUMG 5E62A 2A68C 4KHZA 2D0OA 5ELFA 4WORA 1IBMQ 3ERSX 5I9OA 5DM63 2F0NA 1JMQA 3HEJA 2Q8IB 2OT2A 1SBBB 3H0GH 4HJ7A 2KQ3A 2CCZA 1O80A 5H1SE 4RGTA 4WJ3M 4ZLTF 2NTSA 1L0WA 4JOIA 1K8MA 3RZOB 1SE3A 2K04A 4OO1I 1VF7A 4UP9A 4P74A 1ILPA 2B2VC 4POGA 2F4IA 4JBJA 2FXQA 3PCOB 2Q5AA 4C56C 5C4HA 3CRKC 2NVYB 1EQTA 1U0LA 1UWVA 2EJGC 1EOTA 4LF8L 1H9JA 3LE4A 3J81j 1EZ6A 4K5VA 1EQRA 3P7JA 3RUZA 1EY4A 3PIP3 4A3LH 1YW5A 1HA5A 3CXCA 4J15A 3EN2A 3T51B 4EQNA 4A3DG 2E45A 2XPAA 1B9NA 1R4PB 4XQNA 2B2WC 3NXWA 3T4AC 2DJFC 4HTHA 2F4VL 1PH3A 1XMOL 3K58A 3KFUA 1CA6A 4FO2A 1EG3A 2F0HA 2HHHQ 1VQDA 1MI2A 4JBWA 2PCFB 1TQOA 4BY7H 5FLXE 5C4ZA 1KRTA 3M4PA 4TVAB 3S1MB 1KL9A 3PQHA 3O13A 4LF7L 1UEBA 3K8AA 4JV5L 4BBRH 1ZCNA 3G71A 3PO3H 3WH0A 1CZWA 3HOVB 2RSOA 3FDTA 2B2YA 1N8RC 4X65Q 2C5CA 1VQCA 4YY3L 1CKOA 3CW2C 1HZBA 4JBMA 2O5JC 4OO1G 4AQYQ 1KAAA 2Q2HA 3DUZA 4BY1B 1Y8PB 1A3TA 2FFKB 5C6AA 1V1OA 1I94L 3BVMA 1Q81C 1K9RA 5DNFA 4K2LA 1VS0A 2EYOA 4YWLA 2N55A 3A5UA 1HPCA 1S5FD 4QIWE 4JI4Q 1NY4A 2L12A 3S1NB 5JJIA 1C4QA 2YU9H 2EYLA 3VA5A 1N36L 2A1AA 4IN3A 1K8GA 2KCMA 3I4NB 1N34Q 3OOCA 5CYUA 3VR5A 3M4OH 3TZUA 4HJ8A 2ZQTA 4BA2I 3GTLH 1F9PA 2Y0SG 3Q8DA 5EPKA 1VQ5A 4DK1A 5JEAG 4A93B 3IAYA 1GUNA 1SE8A 1L1OA 1EY5A 1WCMB 2YTXA 2WAEA 1IKLA 5GQOA 2DY7A 4LNQA 1ZYRD 1J6QA 1MSHA 1FVIA 2JA5G 1LUZA 2NVQH 1C8CA 3UI2A 4CJ0B 1P16A 2E2JH 2JA8G 1H9SA 4X64L 3G6JB 3MCBB 1FLCA 5T1GA 1BR9A 3RMHA 5C3EH 5C5MA 4M8AA 3ULJA 1X54A 3I8ZA 4DR5L 3GTKH 2G9HD 1A15A 1II3A 3HOZB 3FPUB 1RHPA 2D5DA 5KNBA 3GTJH 3JAMi 1Q86C 1JB3A 2F1MA 4C3IG 2IT1A 1N32Q 3HGBA 2L9HA 2VW9A 2J0TD 2PNHA 5AJ3L 5J39A 1PH6A 4RCOA 3KLSA 2ZTDA 1SROA 4OWTB 2R3ZA 3E0JA 4JW0A 4DK3C 4C3JB 1VQOA 2F0DA 3NWTA 2M8IA 1HUNA 2QA4A 3SK5A 1IBLL 1T5XD 3PV0A 3KLWA 1CTMA 1OXUA 2XP8A 1BXTA 4RKBA 3S1RH 1EEFD 1TWGH 3HOXG 2EE1A 1WR7A 3S17B 3KYHC 4G4KA 1X3GA 2BOSA 4L63B 2E76C 3KJPA 3J80i 5CBEE 2UXCQ 1Z7TA 1VQLA 4C1NK 4HSVA 2F3VA 1OXVA 3I4MG 2WB1E 1R9TH 1J5EL 1KIXA 2R7ZG 4QL5A 2UUAL 2B63B 2A69C 1A8VA 1EIFA 4JI2Q 4U86A 1SE4A 2A5HA 2IHEA 4N9PA 5KGUA 3Q24A 2B2TC 1YIJA 4A3MH 3NQTA 2VUMB 2R92H 5IGEA 4JI1Q 1K8OA 1STAA 1IL2A 1NR2A 4IPGA 4OX9Q 2HDLA 4Y7NH 3PUYA 3Q23A 2KEEA 1A2UA 3NSWA 3OOBA 4LF4L 3NTKA 3T1HL 5JJZA 3CD6A 2UUBL 2HT1A 3KDFB 3OWFA 4JI3Q 4V190 1QVCA 2NVTB 1JCKB 1SEBD 1VQ8A 5GAEC 4RHRA 4GOPA 2KOLA 1EFID 1G91A 1LO5D 2F0GA 3A54A 2Q2TA 3A55A 4CDFC 5I4DA 4HEDA 4A3DB 1AFPA 1CKNA 4U84A 2H5XA 2AQ2B 2EY6A 1QVFA 4A76A 1XX8A 1TS4A 3NELA 1PH8A 4GKJL 1O7ZA 4EQOA 4E6IA 3PF4A 2PZWA 4IJLA 2R93B 4A3KB 1LTAD 3TZDA 2JK8A 1ZXTA 4B9XA 1O78A 3WOFA 1PHJA 1SYCA 3MQHA 4R4OA 4KKUA 2IL8A 1I4GA 3TEHB 2E74C 4O2DA 3BDCA 1WTOA 3NE5B 1KDCA 2O5IC 1VQHA 4DV7Q 1PDQA 2Q2UA 1BCPF 1TS3A 1X3FA 2CW0C 1S5BD 5JOBA 2HIVA 5M5WB 4GLVB 1HNWL 3Q6SA 2PMZE 2JA6G 5TSSA 3PUWA 4JOIC 3ND9A 3NQIA 2K14A 2ZM6L 1T9HA 2LSSA 1IW7C 1JMCA 2KXQA 2K01A 3GTOB 4DV2Q 3KCEA 4K6LA 4CDCC 1DJRD 3U58A 1UAPA 1ESRA 1KNAA 1MJEA 1VQFA 3E9HA 4NDXA 1IZ6A 1STBA 1YVCA 3GDEA 1SNMA 4A3IG 4B3TL 4HIOA 4UDUC 2RHSB 4FXGC 4DK6C 2XWBB 4DV5Q 1JICA 3S1QB 4DA2A 1D5XC 3CF5A 2RVLA 4CDEC 2Y0SB 1GUTA 1SR3A 1E0BA 1Q8IA 5KYLA 1CHQD 2M3OW 2R7DA 4ULLA 1F9SA 1HFNA 4EVOA 1C9OA 5K5PA 5KNCA 2ZJRA 4JC0A 3DHQA 3I72A 1X65A 3ZJYC 4HJ9A 1DYQA 1K9QA 3ND8A 2JA5B 1WTVA 2KVMA 1VQEA 1GUWA 5IWAL 2JA8B 4YWMA 4DPGA 4GNXA 1NR4A 1ASYA 3FKIG 4BA1I 5IYDG 1VQ7A 1PTOF 1CQFA 2B2YC 4HIDA 4DUYL 1HR0W 3D8GA 2ICEC 1BNZA 1I50B 4HJ5A 4YCWA 4B3MQ 3CPFA 2NZOA 4A4IA 2LKVA 4LFAQ 4C3IB 2A73B 3I4LA 5M3MG 4KMUC 5BN3A 1ML0D 4DR6Q 1E24A 1GUGA 1GD7A 3EFXD 4A3BG 1FNVA 1QZGA 3GTGB 3LNNA 3KBXA 5C44G 3BG3A 1TWHB 2MDIA 1I4PA 2WADA 3J81L 3CPWA 3UDIA 1QG7A 2LMCB 4YHHL 4DR3L 1AZQA 1TIID 4OELB 4P72A 2UUCQ 1B3AA 1M1KC 3K0XA 1VQ9A 1ICWA 1YNNC 4JG2A 1C0AA 3NUCA 4HSPA 1DZ1A 5JEAJ 2QRVA 1I5FA 3M4YA 1FD7D 3HFZB 4HMJA 4BBSG 2XNAC 3PUXA 5D14A 3AEVA 1Y1WH 5IP7G 4XT3B 2DWVA 1NMFA 3I4MB 1L1OC 1B3QA 4LF6Q 2WAQE 2RQXA 2R7ZB 4H13C 2XN9C 3MEFA 4IJHA 1GHKA 3DWPA 2N49A 3PO2H 3S16B 4JI8Q 4CKCA 3HZXA 2VY3A 1A3VA 2CQOA 4DXGA 3J7YW 4DV1Q 1STNA 2O2LD 3IFDA 2K7VA 3U9OA 1HNZQ 5E1FA 5I2YA 4K5WA 1H9MA 5JPMC 1HA6A 1NCVA 1SJHD 3MAQA 2XIWA 5FLMG 2Q8TA 5C4XG 1PXUA 2A69D 2OF1A 5C0XI 1PYSB 1MD2D 3CMEA 2Z0SA 2E2HB 3F8TA 4X62L 4JYAL 1V1PA 3KUPA 2JXMB 4QCLA 4HN7A 2QEXA 1YHQA 3KAHA 2PZUA 4GZYC 3EBEA 2EY5A 5IP9G 2QDBA 5EGTA 2NVYH 1SMYC 4X3SA 2CFMA 4X3TA 4DAPA 3CQZB 3E5SA 5EQ0A 1GO3E 3HOWG 1LM0A 1I4RA 5DLQE 1DM0B 4IUNA 4DV4Q 2XP5A 1PFBA 3S15H 1F2YA 2PI2E 4ZQ3A 2Q2IA 4DV6Q 4FF3A 2CHBD 2D0PA 4P2CB 3WWVA 2XP9A 4PMCA 4DNTB 1SYBA 1CI3M 3I4NG 1GUOA 3W1GA 4DV0L 1B70B 3GTMH 4IFDH 3CRLC 3QOLA 1BOSA 1A6XA 3DXJC 1X32A 3AYHB 1SLJA 3S1MH 2JMFA 1JJ2A 1SYGA 4RHSA 1ENCA 2OTLA 3D0FA 1PLFA 1V43A 2Z6KA 4MZ9A 1EY0A 3OW2A 4R8NA 3I55A 2KCNA 2NTTA 4DNRB 3CC7A 1QE6A 1KQSA 3EVQA 5FO9B 4LUZA 5C0XG 4RGOS 5FLXL 5HY6A 4J8QA 5IGFA 3V96A 4X66Q 1S4ZA 5BR8L 2J7ZA 4L6TB 1PRTB 2MUYA 3I56A 2PQAB 3MXPA 5JJKA 4A3EH 1XTCD 2L15A 2CQAA 2XP4A 1X6OA 1A3UA 4LFBQ 2YTVA 2PW7A 4GOPC 4C1NI 1JE5A 1GKHA 2K52A 2P5ZX 3J81E 1WTRA 1Y1VG 4L5SA 4A0UA 3NP8A 4L5QA 1IYUA 2O4XA 1LTID 2KUMA 1EQVA 1TVXA 5AFWA 1YHAA 1YI2A 1SNDA 1F77A 2IJ0A 4A3IB 3SHLA 2CWAA 3T53B 3A7LA 2F0QA 5CV4A 1JORA 1NAPA 3A56A 2XVSA 1FNUA 4OHJA 1EWCA 5CV8A 4LFCL 3V05A 4U673 3HOUH 4Q5VA 2RE3A 1YEZA 1UE1A 3MQGA 1D6EC 3FVQA 1EWHA 1EOVA 2SNMA 2J4XA 1JE4A 3PIOA 2XWJB 3NENA 3S2HB 2ZTCA 1F2MA 1SYDA 3D4DA 3K59A 4JI0Q 2VNUD 3H0GG 5M5XB 1LYLA 4QB4A 1LABA 1PTOD 1OXXK 2DK1A 3GQBA 3L7ZC 2B3GA 3DWQA 3KLSX 3FKIB 3UDFA 2YV5A 1XNRL 3HOZH 4OIKA 5EKIA 4DR2L 3H91A 4KY7A 3RLFA 4WFN3 4DR1Q 3TN2A 5AJ3Q 4UP7A 3OTOQ 4KY6A 1PH7A 1M90C 4LF9L 5D3IB 2GA4B 4PV1C 3K5OA 2JYOA 1Y8OB 5M3MB 3TREA 4YWKA 4A3LG 2FINB 4QIBA 2NZHA 2MQHA 3QR8A 1HR0Q 1O7YA 4A3BB 1IBLQ 2ASBA 1AE3A 4C3JH 1UEAB 3MHBA 5C4JH 5C44B 1XTDA 1YNXA 4A3GH 4DUZQ 1TY0A 1F2ZA 1GUSA 4JI5L 4RCNA 1XJVA 2UU9L 3N52A 5J22A 2WIIB 2UXBQ 1VQPA 4R9WA 5FJ8G 1SJED 1ASZA 3DEPA 5AHTA 3A8IE 4I7ZC 3CMAA 4RGNA 3U9SA 4FF1A 4JPBW 4P73A 1EQQA 2WKCA 3SDZA 2YSHA 3NBHB 1WTQA 1KNEA 5M9OA 4FP5D 3NTIA 3SXHA 4HIKA 4P71A 4BBSB 1QUQA 4A3CH 1ZEQX 4BBRG 1BQQT 1S3OA 1F9QA 1AW7A 1ZKOA 5BN4A 3BVGA 1B8AA 4IPHA 3TMEA 2B63H 3WOEA 2GVAA 1VQ4A 2SNSA 1RTOA 4B3RL 4H7BA 4ODGA 1TKWB 1MKHA 1MSGA 1BO0A 1U9RA 4UPAA 2VUMH 3K5LA 1IBKL 4S3SA 1K3RA 1YNND 1EY8A 1TU2B 2R93G 4A3KG 4XXEA 1H9RA 5GROA 3F1ZA 4GNXC 3AU7A 4QJFA 1DCZA 2AWNA 1TR5A 1I3QB 3SK4A 1LACA 3DM3A 4OGQC 5C4XB 1ICFB 4QIWB 3OHXC 2ZR6A 1WOCA 4LUVA 4KY5A 4RH6A 3W2DA 4JK1C 3RN2A 1WJJA 5M5YH 2NVTH 4NP5A 2K5HA 3C46A 1RTNA 3MTSA 3EROA 4O0AA 3HKZG 1W6JA 3NEMA 3GTQB 1WI5A 1G291 4DAYA 1SNCA 5NUCA 4LMQD 2RCFA 3J7AV 3RD4A 5COYA 2VQFL 3HOWB 1K83H 4K14A 1VF5C 2I46A 4ZUJA 1QB5D 3CCRA 1CSQA 4JI7L 3K0YA 3CCQA 5LMNL 1QNKA 4XTCS 1JT8A 1OO9B 3LKXB 3AFQA 1Q3LA 2WP8J 3G48A 1MJCA 2NN6H 1SMYD 2Q8RE 4QUFA 4DR4Q 4IUUA 4KHPL 3OIQA 1UE7A 1RJTA 3RNUA 3JAML 1RIPA 2L0CA 5C3EG 1Q46A 1SN8A 3RZDH 2RCNA 4YCVA 4NXML 2KBNA 1TWCB 4DR7Q 1PH9A 2UXDQ 3KF6B 1IYJB 3TS2A 2QKIC 1VQNA 5G3LF 3IFTA 4XQJA 4OXPA 4FXKC 2K50A 4IOAA 1Z9FA 4QQBX 2N3SA 2M00A 2PI2A 1CM9A 3RLOA 4C2MB 4PMWA 5GAGC 1XMQL 1VQGA 2EYFA 4RKLA 2F0WA 1N33Q 2YAJB 3J7ZC 3EIVA 2CWPA 1B9MA 2FMCA 1K0SA 1NMVA 3J80L 3ERQA 2TSSA 1UE5A 1KABA 3M3YB 2JSOA 2K6AA 3R8BA 2ZJPA 1Y1VB 3STBD 3LWEA 1PTOH 3M7GA 1CFMA 4KD4A 3ZYYX 1VCIA 1QCBD 4PZ6A 1AZPA 4G57A 3HRZC 4KJOA 3I2ZA 5JEAH 3URYA 1Y8NB 4IUPA 4GKKL 3S24A 3VR4A 1JR0D 1K8AC 2F0PA 2R92G 5IYCH 3QJYA 1RP5A 5IWAQ 2L55A 1U4RA 1G6ZA 2JA7H 1R4QB 3H0GB 2H4OA 4QUCA 1SYEA 1N9WA 1IBML 4OWWB 3HOYH 1IKMA 1JJGA 1VQ6A 2JA8H 2D62A 3D4WA 1YZ6A 1SXTA 2PPBC 3PIPA 1LV9A 4DUYQ 4JI6Q 2Z6KC 1V8QA 1S5DD 3IRBA 5HGTA 3D3RA 4F7XA 1D5ZC 1O6WA 5E64A 1I50H 1NMGA 5C0XJ 5HURA 2E5LQ 4DKAC 5CGKA 3D4RA 4L8JA 2AUJD 1HHVA 2VB3X 1HRJA 1K9MC 4X6AH 4ZUIA 5CC4A 1STHA 3V2TA 3HS0C 3BDOA 4ME3A 3GO5A 3TC5A 4K8JA 1VMCA 2ALYB 2F0JA 2Z4IA 1SFOH 3CCUA 4KI0A 2ZQUA 3E3XA 1EY7A 3HOXH 2HHHL 3OSOA 1L2FA 1MIUA 3C1EA 4MN3A 2NBFA 3PSIA 5IT9E 3TDBA 1CZGA 3JAME 2L4JA 1XNQQ 5D3DA 4BBRB 5HGQA 4WJ4A 5EBCA 3F2UA 3TP7A 2OWOA 1BCPC 4X3KA 2R7ZH 4EGVA 1TWFB 5IGCA 1TK7A 3S16H 4DFAA 2EXZA 3SK8A 1NUCA 5LMUQ 2WV6D 1QNUA 4N9TA 3CCVA 4X65L 2HQEA 3BU2A 1AP0A 3CCMA 2K1BA 3L3OC 1JWSD 1TY2A 2KCTA 3S14H 1M8AA 1O7LA 2ZXPA 3BVZA 2I5LX 3CHBD 2EZ5W 2KHIA 4H0LC 2E2HH 2YU9B 5CV5A 3I73A 4IUTA 4I65A 2LXJA 3SR1A 3MXNB 4LF5Q 1TWAH 5DAUA 3J80E 2F0IA 4JI4L 5L37A 3HKZB 3T1YQ 5ELBA 1FJGQ 3MFGA 1TS5A 3M4OB 3OW7A 3W3AA 2LFNA 3GTLB 3CQZH 3WDNA 1IL8A 2HCIA 1MHWC 1B2TA 2F0SA 3TP6A 1N34L 4NMZA 1I4QA 1SMXA 2FHTA 2E2IH 1RODA 5FO8B 2YSIA 3TDQA 5FLXc 2G5DA 1W3SA 3TP8A 5EKKA 1KHIA 4TKOB 4CJ2C 1AE2A 2N78A 1HJPA 3T13A 1EYGA 2NVQB 4UHVA 4GN4B 4DAVA 4IPCA 2E2JB 1DOMA 1F2LA 1YBYA 5G3LD 4DN4M 3K5NA 1PTOC 5C3EB 1PMRA 5ELEA 4HJAA 4XYQA 5IODA 1EEID 3GTKB 2KHJA 4R4IA 3CCEA 1A0IA 2BH8A 3SE0A 1PZID 3LX0A 2DNEA 3GTJB 1HQMC 1HNXQ 4UY8C 1PFMA 1X3QA 4TSSA 2M8JA 4HCEA 4MNOA 4QY7A 3VR3A 4ZAIA 3C1FA 4NXNQ 2K4KA 2K32A 5DM73 4FNFA 2PNRC 1N32L 3G4SA 3AMUA 1ENFA 1KLGD 3MVVA 5KEEA 2JA6H 1S5CD 2ZAJA 3MWYW 1FYCA 4A75A 5I2XA 2N8NA 4HAEA 4AIMA 5IYBG 2SDFA 4KTAA 4EQPA 2EYPA 2NB0A 3D6WA 4DV3Q 5IGDA 4AYBE 3KBGA 2N88A 1TWGB 4A3FH 1QWYA 2F3IA 1SAPA 2KENA 2AQ1B 4MHEA 3VA7A 1DD2A 2X6GA 4HCSA 1SSOA 3P1HA 1ENAA 2QEJC 3H94A 1Y1WG 4JVZA 2RHQB 1BF4A 2OXPA 4FF4A 2OCEA 1Q8KA 4R4QA 4RWSC 2K05A 1U5KA 2RDGA 3K57A 1R9TB 4LJZC 2Y0SE 2WAQB 5D65A 2UXCL 1PFNA 1AEXA 3IKJA 3PO2G 2I5MX 2RDFA 4ZYSA 1TT2A 4IFDI 2VQEQ 1L0YB 4AH6A 2M2LA 2R92B 3VYTA 4J1MA 4JI2L 3KLRA 3VR6A 4K0KL 1JQYD 2MNAA 1LTGD 4IQZA 2ATWA 5M5XH 2QCPX 4B3SL 2DMVA 4KK7A 4Y7NB 4JI1L 4BXXG 2AQ3B 2PQEA 1PINA 2DUDA 5E65A 1JJCB 3CP0A 4A3JH 5M3FH 3FMCA 1A2TA 4OX9L 2F0VA 3BJUA 2I07B 2JA9A 2TMPA 5IYDH 3GTPH 2ZQVA 4YIJA 5IIFA 4G7HC 2GN5A 1B44D 4JI3L 2K5QA 2XP3A 1JC7A 2EYMA 5IGGA 4TRDA 1SNOA 1L1OB 3LGJA 3UDGA 2CKZB 4DK0A 4Z9CB 3NHHA 3U4ZA 4KV6A 1I6VC 1TR8A 3TBIB 3MFYA 4REXA 1G2TA 3K5MA 2IHFA 4BWGB 3MCBA 2PO4A 3N6RA 3RZOH 5CBAE 4LF8Q 2XTIA 1H9SB 1MBYA 3M7NA 1HZ9A 3M4QA 4WJWA 5FO7B 4R4TA 3OPOA 4IFDG 4CBVA 2CH4A 1DOLA 2F4VQ 3S9WA 2KHSA 3I7FA 1XMOQ 3FS8A 2IX1A 3OWEB 3GV3A 4F8MA 1WYDA 4JBKA 3ICEA 1G51A 1VQAA 1IBKQ 3W5OA 2L4NA 4ABNA 2SOBA 4FYDA 3MC0B 5LL6S 1HCZA 1S72A 2XRSD 3QB3A 3SGIA 3F2BA 4KN7C 3KABA 2FMMA 4LF7Q 4DV7L 3GD7A 4JV5Q 1LT6D 2BDOA 2E8GA 4A3EG 1C7YA 2V4DA 1UE6A 5EPLA 1PA6A 1BCPD 1HTLD 3QO2A 1CSPA 1UNSA 2Z6BA 4CJ1B 2EZVA 4YY3Q 1WD1A 3I3CA 4OL7A 3A8KE 2EQSA 3NWSA 2ZT9C 3HOVH 2JEBI 4DV2L 3ODKA 1ONLA 2BCOA 1I5HW 3GTQH 3H6MA 1I94Q 3STBC 4BY1H 3K81C 4IUQA 1GM5A 2M9VA 3A5ZB 2JV4A 3LWUA 4DNIA 3HOUG 3A0JA 4DV5L 1KXLA 5K36H 2YSBA 1RCVD 2ZXOA 3AQQA 1N36Q 3AFPA 1CHPD 3R93A 3S1NH 3MEHA 3W1BA 2OTJA 1EYDA 1EY9A 1X56A 2EIFA 1D1KA 2Z1CA 3KDFA 4K8IA 4EQ5A 4BS9A 2L1BA 4P75A 2XP6A 1WD0A 3I4NH 1I4HA 2NWGA 4C3HG 2WB1G 1LLRD 1WTWA 4A93H 2LAJA 2DGYA 4GOPB 2Y8NB 1SDFA 5FK9C 4G7ZC 4YCUA 1WCMH 4EX5A 3PUZA 4NKLA 3J7AF 1PRTF 4X64Q 1KRSA 1CKNB 4B3ML 4GLXA 4MTKA 4DR5Q 4LFAL 4A3GG 1G6PA 4LK1C 1WFQA 2Z4HA 2I0QA 4DR6L 1U4LA 3KK7A 1PFSA 2A6EC 2VS1A 4CKBA 1B7YB 1EYAA 1KDAA 2A6HD 4IZ8A 1PV4A 1CA5A 2MP1A 4CHTB 2AMCB 3UDXA 3PQIA 4B08A 5IE8A 3M3YH 5JJLA 4POFA 4R1JA 2UUCL 4A3CG 5I6YA 1Y1WB 2F0OA 1TXYA 2NN6I 2NUCA 1UUPA 3CAMA 2FJ2A 5EJWA 4LWCA 4IOCA 4MTNA 2V1CC 2NVXB 1D7QA 2K5DA 4TQUS 2R6GA 4GLAC 2RKSA 2R7FA 4NW2A 4F87A 3PO2B 5FKAC 2B2UA 3OMGA 4LF6L 2IW3A 1ET9A 2F0EA 5KRUA 3MXUA 2ID0A 4DAMA 2RDHA 4BY7G 3S17H 1OXSC 2XP7A 1HH2P 4JI8L 2QGQA 3M9BA 2EVBA 1J5EQ 3MA2B 2UUAQ 4DV1L 3BZKA 1ILQA 1HNZL 3PO3G 1Q12A 2HUGA 1PYBA 1U4MA 4DF7A 3CCJA 5E4WC 4M1UB 2F52A 3QWNA 2JE6I 5E3FA 1I6HB 1SNQA 4OWXB 5A2QE 5IGBA 1FGBD 2ITKA 2YSFA 1V9PA 4LF4Q 1JB7A 3PF5A 3T1HQ 2ZR5A 1E3PA 2UUBQ 3CC2A 4PMBA 1STEA 2HD3A 3CC4A 3SK6A 1STGA 2BDNA 1KAWA 3S15B 2F0UA 2WINB 4CGYB 1PVOA 3L4HA 2X6LA 4ZKBB 5KIXA 1Z47A 2MHVA 5T1IA 2NN6G 3RR5A 4DV4L 3NK9A 4DGZA 5IOCA 3DM1A 2AHOB 3B6YA 5CV6A 5FJ8H 3H09A 4GNXB 1LTTD 4DV6L 3GTMB 3SEBA 1Q90A 1RF2D 3BYTB 3QOJA 1PH1A 2D2CC 1HTPA 2IY5B 4XYOA 3E6ZX 4XQQA 4PQXA 4ZK9B 4A3DH 1NTGA 2K75A 3GP7A 3K7AB 2K03A 4K5XA 4GKJQ 2QDLA 3FRPB 1EIGA 3TSSA 1TWFH 1F9RA 5CR3A 4ILWA 4KD3A 1C48A 2F21A 2MPMA 5CV7A 1CK1A 1LT3D 1VDZA 4RA8A 3H3VH 1VQKA 5BN5A 1E1OA 5J1ZA 4FF2A 5IT9L 5EPJA 3KADA 1XWEA 5JAVA 1EG4A 2R93H 4A3KH 4CDDC 3RN5A 4XIGS 1VQMA 1B53A 4A3EB 3I90A
chains in the Genus database with same CATH topology
1V1QA 3VYSA 2QILA 4AYBG 4IO9A 2KA7A 5C5LA 3ULLA 5GAHC 4H44C 1W2BA 1EUJA 1HNWQ 1D5MC 4LFBL 3I91A 2SEBD 2KJXA 2ZM6Q 4OO1H 1EY6A 4KLKA 5M5WH 3FEWX 3HOUB 4CKEA 1LT5D 2B8FA 5IYCG 3TS0A 1T5EA 2YSGA 2EYJA 4ID6A 3GTOH 3KF8A 4B3TQ 3EJIA 2JA7G 3K7UC 4IFDJ 4RAUC 3BYYB 2ZXRA 3HOYG 2YYZA 2EJFC 3BS1A 1QOHA 2VB2X 3S2DB 1IYVA 1VQIA 1V1PB 4JI0L 3CKIB 4C3HB 3S1QH 1LTBD 2WB1B 4RGMA 2WAQG 4GN3B 1PRTD 1YHBA 1YJNA 1AH9A 4A3MG 1LTRD 3CU7A 2F0FA 4APVA 2DN8A 2EDGA 4DR1L 1DOKA 1SNPA 1WMVA 3OTOL 4Q0FA 3TQYA 2JA5H 2K33A 2LS01 2F0TA 2VXWA 2IWHA 1X55A 2ES2A 1W6KA 1XXGA 3NTPA 5C4JB 1XPRA 3X3NA 4A3GB 3J81c 2X69A 1Z6HA 1HR0L 1FGUA 2YTYA 4IALA 4L5TA 4ALPA 2I5HA 5IY0A 3ONAB 5CV9A 3EQLC 4DUZL 1EIHA 2PYKA 1CT1D 2QF7A 3VR2A 2LXKA 1BVSA 4C3IH 2UXBL 2PZTA 5FOBB 2L5TA 2JXWA 2XRQD 3ITPA 3RLNA 4LAAA 1XYIA 4IURA 3KAGA 1QILA 3OIPA 3GTGH 2A6ED 3A7AB 3FPPA 5EAYA 4YHHQ 4DR3Q 2NYZD 4F88A 4KKTA 1TWHH 1M4VA 4R4CA 3KJOA 4ME5A 5ELNA 1E2WA 4K0KQ 1VMPA 2HCCA 2PQAA 4B3SQ 1Q1EA 3G7LA 2LY7A 4HIMA 2F0KA 2WFWA 1HXYD 4DXFA 1YNJC 4NPSA 4BY7B 5C3WA 2EPBA 3R2TA 1BUVT 2DY8A 3HG9A 3DEOA 3PGZA 2EY2A 4J6HA 1HZCA 4PNYA 2R61A 3I70A 4FXDA 2KCCA 3PO3B 5E66A 3I4MH 3DMUA 3UE0A 5M5YB 4RMFA 2A68D 1B1ZA 4H02A 1E7ZA 1WTPA 3KOJA 2E2DC 1YJ9A 5E5WA 1DONA 4UP8A 3DLLA 3CCSA 3H3VC 1QZHA 5ISRA 2PMZB 3C3LA 1K83B 1MGSA 4AQYL 3FHWA 1BCPB 4X62Q 4JYAQ 2ZTEA 1SYFA 3ULPA 1ET6A 1YJWA 4U85A 1IXRA 1PZJD 2MGSA 3JC66 2ZJQA 1EU3A 3H15A 5KNDA 1NJIC 1BDOA 2K28A 3OMCA 2H1EA 1E2VA 1A62A 5LMNW 3RZDB 4DR4L 3BDLA 3T56B 5JVH3 1FL0A 1G2SA 3QG1A 2B29A 2GVBA 1PZKD 1B4OA 2B2UC 3EA6A 2C9OA 4DR7L 4HR7B 1QVGA 2XGTA 3T16A 2UXDL 1NBWA 1O7IA 3UE1A 2JJQA 2WKDA 2MO0A 4DV0Q 1EFWA 4K6DA 1HQRD 1Y14B 2DNCA 1J9OA 1EWIA 5EKLA 2L11A 1U4PA 1KDBA 2F0MA 3I4OA 3U4VA 4IPDA 1DXMA 2D9UA 1SRUA 1VQJA 3NBHA 1B50A 4A3FG 1N33L 4AYBB 1NE3A 1X3EA 5EBDA 2A6HC 2AWOA 2BE5C 1Q7YC 4PG3A 3PUVA 4X66L 4XDXA 2B2VA 1QUQB 1PTOB 2RBMA 5BR8Q 3HKZE 4U68A 2F3WA 1F8AB 1LTSD 3CCLA 3HP3A 1K0RA 1GJXA 5CORA 1EYCA 3F2DA 4X3UA 4A0TA 3P20A 4PZ8A 2F03A 3K6OA 1X9NA 3E9IA 5J3BA 3DWAA 1I4XA 2ENBA 5U47A 2B2WA 4QGUA 3S1RB 3SVMA 2MFIA 3F2CA 3MXGA 1E22A 2IPKD 2OQ0A 2JA7B 2AUKA 1FR3A 4KKSA 1PYWD 1L0XB 3TCZA 3HOYB 1CUKA 4K2KA 4KJNA 4A3JG 5M3FG 4A3IH 4LFCQ 1KC8C 4MIUA 2C35B 1D2BA 5ELOA 3HKSA 1JOOA 2F0LA 1GOZA 2RF4A 4LW1A 4OIJA 2VZAA 3C2PA 1RDPD 2EOTA 2HDMA 4JI6L 3L9AX 3OYYA 1CKMA 4DAYB 4A3MB 1PH4A 2K5WA 2A74C 5JPNC 3S2HH 1JOKA 2WACA 2RA4A 1GXDC 2ICIA 3NTHA 2E5LL 1GHJA 3LKXA 1HFGA 2JEAI 1XNRQ 1Q82C 2BA0A 1Q1BA 4RG1A 4DR2Q 1OTCA 1RL2A 2BA1A 4IUVA 1STYA 4LF9Q 3FKIH 3PIO3 2HQLA 3L0OA 5IYBH 1SFOB 2ZR4A 1BBUA 5ELDA 3KF6A 3CNGA 3HOXB 4QF4A 4XT1B 4E5RA 2NZ1D 5LHY1 3X3MA 2EY1A 3U50C 5M3MH 3R2IA 1YITA 2JP1A 4JI5Q 1KLUD 4A3BH 2UU9Q 4GS3A 1D8LA 2B8GA 5C44H 1HZAA 1QJOA 3KAFA 2NVXH 1XNQL 3Q22A 1CQVA 2EXDA 1RD9D 3TRZA 3FP9A 2OQKA 4QMGA 1S40A 4O42A 2IX0A 2HIXA 3K80C 3KAIA 3J81i 5LMUL 3S14B 2K5NA 1XPOA 2KECA 1BKBA 2B39A 3KF8B 4BXXH 4BBSH 5I6WA 5IP7H 1PH2A 4B3RQ 3TP5A 5LL6X 3D31A 2XSCA 3HOVG 1Y69U 5KYIA 1TWAB 1P8LA 5CQ2A 1EZ8A 2EJMA 4JCVE 1E2ZA 1I6HH 1YNJD 4BY1G 1RKNA 4LF5L 1BBXC 1G8ZD 5DEHA 1SE2A 2MJ8A 1LTLA 2KEDA 2VL6A 3T1YL 1FJGL 2IX3A 3MZ5A 5K36G 5C3XA 1VQBA 1I3QH 2BH2A 3FSBA 2E2IB 5FLMH 1GVPA 4B9WA 5C4XH 2XPBA 4OONA 3M85A 4KN4C 3A74A 2AKWB 5IT9c 1EIYB 3JAMc 5A2QL 1H9KA 4KHVA 2MO1A 1ZYRC 2DK7A 2VQFQ 5IP9H 4RFBA 3NBIA 5ELCA 1K73C 3IL8A 4JI7Q 4A93G 3Q0AA 1EU4A 3BZDB 1TS2A 4WRDA 3HOWH 1J8IA 1FNWA 4FDBA 5LMNQ 1PRTC 1WCMG 5E4XA 3K7AH 1A63A 1BBWA 4KHPQ 5F2DA 3VYUA 3G6EA 3R3OA 2B2TA 3A8JE 1HNXL 4NXMQ 4ZKCB 4R8IA 1EL0A 4V0BA 4ZRZA 1DGSA 4NXNL 3GV6A 1X3PA 2A19A 2JA6B 3E0EA 1JWMD 4DU9A 3J80c 4UAIA 1TWCH 3QIAA 2E75C 3HOZG 1AN8A 1JOQA 5E7NA 1WVLA 4A3FB 3NPPA 3L2PA 1PH5A 3ER0A 1JWUD 1KTKA 1OXTA 5A35A 3BZCA 2EYHA 1XMQQ 4DV3L 2CW0D 5CMDA 4PZ7A 3P75A 5C0XH 4C2MH 1KD1C 4G7OC 3VDYA 4C3JG 3PMFA 1IW7D 2K5VA 4L5RC 2A8VA 3J7A5 2JX8A 5JVG3 4LUOA 1S5ED 4HMIA 1HUMA 2OEOA 2PW5A 4FVMA 1NSNS 1LT4D 3D6CA 2BE5D 1IHZA 1E1TA 2JQOA 4GN5A 3AB9A 4NB3A 2G9DA 2VQEL 2CVRA 1WTXA 1Y1VH 4Y52H 3MXNA 1ESFA 3S2DH 5I9PA 4A3JB 5M3FB 3H3VI 1H95A 4GKKQ 1XPUA 4C3HH 4O1NA 2B63G 2RSNA 3FSCA 3GTPB 2Z8LA 3VYRA 2ZQSA 1D1IA 5GADC 2DJYA 2VUMG 5E62A 2A68C 4KHZA 2D0OA 5ELFA 4WORA 1IBMQ 3ERSX 5I9OA 5DM63 2F0NA 1JMQA 3HEJA 2Q8IB 2OT2A 1SBBB 3H0GH 4HJ7A 2KQ3A 2CCZA 1O80A 5H1SE 4RGTA 4WJ3M 4ZLTF 2NTSA 1L0WA 4JOIA 1K8MA 3RZOB 1SE3A 2K04A 4OO1I 1VF7A 4UP9A 4P74A 1ILPA 2B2VC 4POGA 2F4IA 4JBJA 2FXQA 3PCOB 2Q5AA 4C56C 5C4HA 3CRKC 2NVYB 1EQTA 1U0LA 1UWVA 2EJGC 1EOTA 4LF8L 1H9JA 3LE4A 3J81j 1EZ6A 4K5VA 3RUZA 3P7JA 1EQRA 1EY4A 3PIP3 4A3LH 1YW5A 1HA5A 3CXCA 3T51B 3EN2A 4EQNA 4J15A 4A3DG 2E45A 2XPAA 1B9NA 1R4PB 4XQNA 2B2WC 3NXWA 3T4AC 4HTHA 2F4VL 1PH3A 1XMOL 3K58A 3KFUA 1CA6A 4FO2A 1EG3A 2F0HA 2HHHQ 1VQDA 1MI2A 4JBWA 2PCFB 1TQOA 4BY7H 5FLXE 5C4ZA 1KRTA 3M4PA 4TVAB 3S1MB 1KL9A 3PQHA 3O13A 4LF7L 1UEBA 3K8AA 4JV5L 4BBRH 1ZCNA 3G71A 3PO3H 3WH0A 1CZWA 3HOVB 2RSOA 3FDTA 2B2YA 1N8RC 4X65Q 2C5CA 1VQCA 4YY3L 1CKOA 3CW2C 1HZBA 4JBMA 2O5JC 4OO1G 4AQYQ 1KAAA 3DUZA 2Q2HA 4BY1B 1Y8PB 1A3TA 2FFKB 5C6AA 1V1OA 1I94L 3BVMA 1Q81C 1K9RA 5DNFA 4K2LA 1VS0A 2EYOA 4YWLA 2N55A 3A5UA 1HPCA 1S5FD 4QIWE 4JI4Q 2L12A 3S1NB 1NY4A 5JJIA 1C4QA 2YU9H 2EYLA 3VA5A 1N36L 2A1AA 4IN3A 1K8GA 2KCMA 3I4NB 1N34Q 3OOCA 5CYUA 3VR5A 3M4OH 3TZUA 4HJ8A 2ZQTA 4BA2I 3GTLH 1F9PA 5EPKA 2Y0SG 3Q8DA 1VQ5A 4DK1A 5JEAG 4A93B 3IAYA 1GUNA 1SE8A 1WCMB 1EY5A 1L1OA 2YTXA 2WAEA 1IKLA 5GQOA 2DY7A 4LNQA 1ZYRD 1J6QA 1MSHA 1FVIA 2JA5G 1LUZA 2NVQH 1C8CA 3UI2A 4CJ0B 1P16A 2E2JH 2JA8G 1H9SA 4X64L 3G6JB 3MCBB 1FLCA 5T1GA 1BR9A 3RMHA 5C3EH 5C5MA 4M8AA 3ULJA 1X54A 3I8ZA 4DR5L 3GTKH 2G9HD 1A15A 1II3A 3HOZB 3FPUB 1RHPA 2D5DA 5KNBA 3GTJH 3JAMi 1Q86C 1JB3A 2F1MA 4C3IG 2IT1A 1N32Q 3HGBA 2L9HA 2VW9A 2J0TD 2PNHA 5AJ3L 5J39A 1PH6A 4RCOA 3KLSA 2ZTDA 1SROA 4OWTB 2R3ZA 3E0JA 4C3JB 4DK3C 1VQOA 2F0DA 3NWTA 2M8IA 1HUNA 2QA4A 3SK5A 1IBLL 1T5XD 3PV0A 3KLWA 1CTMA 1OXUA 2XP8A 1BXTA 4RKBA 3S1RH 1EEFD 1TWGH 3HOXG 2EE1A 1WR7A 3S17B 3KYHC 4G4KA 2BOSA 4L63B 1X3GA 2E76C 3KJPA 5CBEE 3J80i 2UXCQ 1Z7TA 1VQLA 4C1NK 4HSVA 2F3VA 1OXVA 3I4MG 2WB1E 1R9TH 1J5EL 1KIXA 2R7ZG 4QL5A 2UUAL 2B63B 2A69C 1A8VA 1EIFA 4JI2Q 4U86A 1SE4A 2A5HA 4N9PA 5KGUA 3Q24A 2IHEA 2B2TC 1YIJA 4A3MH 3NQTA 2VUMB 2R92H 5IGEA 4JI1Q 1K8OA 1STAA 1IL2A 1NR2A 4IPGA 4OX9Q 2HDLA 3Q23A 3PUYA 4Y7NH 2KEEA 1A2UA 3NSWA 3OOBA 4LF4L 3NTKA 3T1HL 5JJZA 3CD6A 2UUBL 2HT1A 3KDFB 3OWFA 4V190 2NVTB 1QVCA 4JI3Q 1JCKB 1SEBD 1VQ8A 5GAEC 4RHRA 4GOPA 2KOLA 1EFID 1G91A 1LO5D 2F0GA 3A54A 2Q2TA 3A55A 5I4DA 4HEDA 4A3DB 1AFPA 1CKNA 4U84A 2H5XA 2AQ2B 2EY6A 1QVFA 4A76A 1XX8A 1TS4A 3NELA 1PH8A 4GKJL 1O7ZA 4EQOA 4E6IA 3PF4A 2PZWA 4IJLA 2R93B 4A3KB 1LTAD 3TZDA 2JK8A 1ZXTA 4B9XA 1O78A 3WOFA 1PHJA 1SYCA 3MQHA 4R4OA 4KKUA 2IL8A 1I4GA 3TEHB 2E74C 4O2DA 3BDCA 1WTOA 3NE5B 1KDCA 2O5IC 1VQHA 4DV7Q 1PDQA 2Q2UA 1BCPF 1TS3A 1X3FA 2CW0C 1S5BD 5JOBA 2HIVA 5M5WB 4GLVB 1HNWL 3Q6SA 2PMZE 2JA6G 5TSSA 3PUWA 4JOIC 3ND9A 3NQIA 2K14A 2ZM6L 1T9HA 2LSSA 1IW7C 1JMCA 2KXQA 2K01A 3GTOB 4DV2Q 3KCEA 4K6LA 1DJRD 3U58A 1UAPA 1ESRA 1KNAA 1MJEA 1VQFA 4NDXA 3E9HA 1STBA 1IZ6A 1YVCA 3GDEA 1SNMA 4A3IG 4B3TL 4HIOA 4UDUC 2RHSB 4FXGC 4DK6C 2XWBB 4DV5Q 1JICA 3S1QB 4DA2A 1D5XC 3CF5A 2RVLA 2Y0SB 1GUTA 1SR3A 1E0BA 1Q8IA 5KYLA 1CHQD 2M3OW 2R7DA 4ULLA 1F9SA 1HFNA 4EVOA 1C9OA 5K5PA 5KNCA 2ZJRA 4JC0A 3DHQA 3I72A 1X65A 3ZJYC 4HJ9A 1DYQA 1K9QA 3ND8A 2JA5B 1WTVA 2KVMA 1VQEA 1GUWA 5IWAL 2JA8B 4YWMA 4DPGA 4GNXA 1NR4A 1ASYA 3FKIG 4BA1I 5IYDG 1VQ7A 1PTOF 1CQFA 2B2YC 4HIDA 4DUYL 1HR0W 3D8GA 2ICEC 1BNZA 1I50B 4HJ5A 4YCWA 4B3MQ 3CPFA 2NZOA 4A4IA 2LKVA 4C3IB 4LFAQ 2A73B 3I4LA 5M3MG 4KMUC 5BN3A 1ML0D 4DR6Q 3EFXD 1GUGA 1E24A 1GD7A 4A3BG 1FNVA 1QZGA 3GTGB 3LNNA 3KBXA 5C44G 3BG3A 1TWHB 2MDIA 1I4PA 2WADA 3J81L 3CPWA 3UDIA 1QG7A 2LMCB 4YHHL 4DR3L 1AZQA 1TIID 4P72A 2UUCQ 1B3AA 1M1KC 3K0XA 1VQ9A 1ICWA 1YNNC 4JG2A 1C0AA 3NUCA 4HSPA 1DZ1A 5JEAJ 2QRVA 4HMJA 3M4YA 1FD7D 1I5FA 3HFZB 4BBSG 2XNAC 3PUXA 5D14A 3AEVA 1Y1WH 5IP7G 4XT3B 2DWVA 1NMFA 3I4MB 1L1OC 4LF6Q 2WAQE 2RQXA 2R7ZB 4H13C 2XN9C 3MEFA 4IJHA 1GHKA 3DWPA 2N49A 3PO2H 3S16B 4JI8Q 4CKCA 3HZXA 2VY3A 1A3VA 2CQOA 4DXGA 3J7YW 4DV1Q 1STNA 2O2LD 3IFDA 2K7VA 3U9OA 1HNZQ 5E1FA 5I2YA 4K5WA 1H9MA 5JPMC 1HA6A 1NCVA 1SJHD 3MAQA 2XIWA 5FLMG 2Q8TA 5C4XG 1PXUA 2A69D 2OF1A 5C0XI 1PYSB 1MD2D 3CMEA 2E2HB 2Z0SA 3F8TA 4X62L 4JYAL 1V1PA 3KUPA 2JXMB 4QCLA 4HN7A 2QEXA 1YHQA 3KAHA 2PZUA 4GZYC 3EBEA 2EY5A 5IP9G 2QDBA 5EGTA 2NVYH 1SMYC 4X3SA 2CFMA 4X3TA 4DAPA 3CQZB 3E5SA 5EQ0A 1GO3E 3HOWG 1LM0A 1I4RA 5DLQE 1DM0B 4IUNA 4DV4Q 2XP5A 1PFBA 3S15H 1F2YA 2PI2E 4ZQ3A 2Q2IA 4DV6Q 4FF3A 2CHBD 4P2CB 2D0PA 3WWVA 2XP9A 4PMCA 4DNTB 1SYBA 1CI3M 3I4NG 1GUOA 3W1GA 4DV0L 1B70B 3GTMH 4IFDH 3CRLC 3QOLA 1BOSA 1A6XA 3DXJC 1X32A 3AYHB 1SLJA 3S1MH 2JMFA 1JJ2A 1SYGA 4RHSA 1ENCA 2OTLA 3D0FA 1PLFA 1V43A 2Z6KA 4MZ9A 1EY0A 3OW2A 4R8NA 3I55A 2KCNA 2NTTA 4DNRB 3CC7A 1QE6A 1KQSA 3EVQA 5FO9B 4LUZA 5C0XG 4RGOS 5FLXL 5HY6A 4J8QA 5IGFA 3V96A 4X66Q 1S4ZA 5BR8L 2J7ZA 4L6TB 1PRTB 2MUYA 3I56A 2PQAB 3MXPA 5JJKA 4A3EH 1XTCD 2L15A 2CQAA 2XP4A 1X6OA 1A3UA 4LFBQ 2YTVA 2PW7A 4GOPC 4C1NI 1JE5A 1GKHA 3J81E 2K52A 1WTRA 1Y1VG 4L5SA 4A0UA 3NP8A 4L5QA 1IYUA 2O4XA 1LTID 2KUMA 1EQVA 1TVXA 5AFWA 1YHAA 1YI2A 1SNDA 1F77A 2IJ0A 4A3IB 3SHLA 2CWAA 3T53B 3A7LA 2F0QA 5CV4A 1JORA 1NAPA 3A56A 2XVSA 1FNUA 4OHJA 1EWCA 5CV8A 4LFCL 3V05A 4U673 3HOUH 4Q5VA 2RE3A 1YEZA 1UE1A 3MQGA 1D6EC 3FVQA 1EWHA 1EOVA 2SNMA 2J4XA 1JE4A 3PIOA 2XWJB 3NENA 3S2HB 2ZTCA 1F2MA 1SYDA 3D4DA 3K59A 4JI0Q 2VNUD 3H0GG 5M5XB 1LYLA 4QB4A 1LABA 1PTOD 1OXXK 2DK1A 3GQBA 3L7ZC 2B3GA 3DWQA 3KLSX 3FKIB 3UDFA 2YV5A 1XNRL 3HOZH 4OIKA 5EKIA 4DR2L 3H91A 4KY7A 3RLFA 4WFN3 4DR1Q 3TN2A 5AJ3Q 4UP7A 3OTOQ 4KY6A 1PH7A 1M90C 4LF9L 5D3IB 2GA4B 4PV1C 3K5OA 2JYOA 1Y8OB 5M3MB 3TREA 4YWKA 4A3LG 2FINB 4QIBA 2NZHA 2MQHA 1HR0Q 1O7YA 4A3BB 1IBLQ 2ASBA 1AE3A 4C3JH 1UEAB 3MHBA 5C44B 5C4JH 1XTDA 1YNXA 4A3GH 4DUZQ 1TY0A 1F2ZA 1GUSA 4JI5L 4RCNA 1XJVA 2UU9L 3N52A 5J22A 2WIIB 2UXBQ 1VQPA 4R9WA 5FJ8G 1SJED 1ASZA 3DEPA 5AHTA 3A8IE 4I7ZC 3CMAA 4RGNA 3U9SA 4FF1A 4P73A 1EQQA 2WKCA 3SDZA 2YSHA 3NBHB 1WTQA 1KNEA 5M9OA 4FP5D 3NTIA 3SXHA 4HIKA 4P71A 4BBSB 1QUQA 4A3CH 1ZEQX 4BBRG 1BQQT 1S3OA 1F9QA 1AW7A 1ZKOA 5BN4A 3BVGA 3TMEA 1B8AA 4IPHA 2B63H 3WOEA 2GVAA 1VQ4A 2SNSA 1RTOA 4B3RL 4H7BA 4ODGA 1TKWB 1MSGA 1U9RA 1BO0A 1MKHA 4UPAA 2VUMH 3K5LA 1IBKL 4S3SA 1YNND 1K3RA 1EY8A 1TU2B 2R93G 4A3KG 4XXEA 1H9RA 5GROA 3F1ZA 4GNXC 3AU7A 4QJFA 1DCZA 2AWNA 1TR5A 1I3QB 3SK4A 1LACA 3DM3A 4OGQC 5C4XB 4QIWB 3OHXC 2ZR6A 4RH6A 1WOCA 4KY5A 3W2DA 4LUVA 4JK1C 3RN2A 1WJJA 5M5YH 2NVTH 4NP5A 2K5HA 3C46A 1RTNA 3MTSA 3EROA 4O0AA 3HKZG 1W6JA 3NEMA 3GTQB 1WI5A 1G291 4DAYA 1SNCA 5NUCA 4LMQD 3J7AV 3RD4A 5COYA 2VQFL 3HOWB 1K83H 4K14A 1VF5C 2I46A 4ZUJA 1QB5D 3CCRA 1CSQA 4JI7L 3K0YA 3CCQA 5LMNL 1QNKA 4XTCS 1JT8A 1OO9B 3LKXB 3AFQA 1Q3LA 2WP8J 3G48A 2NN6H 1MJCA 1SMYD 2Q8RE 4QUFA 4DR4Q 4IUUA 4KHPL 3OIQA 1UE7A 1RJTA 3RNUA 3JAML 2L0CA 1RIPA 5C3EG 1Q46A 1SN8A 3RZDH 2RCNA 4YCVA 4NXML 2KBNA 1TWCB 4DR7Q 1PH9A 2UXDQ 3KF6B 1IYJB 3TS2A 2QKIC 1VQNA 5G3LF 3IFTA 4XQJA 4OXPA 4FXKC 2K50A 4IOAA 1Z9FA 4QQBX 2N3SA 2M00A 2PI2A 1CM9A 3RLOA 4C2MB 4PMWA 5GAGC 1XMQL 1VQGA 2EYFA 4RKLA 2F0WA 1N33Q 2YAJB 3J7ZC 3EIVA 2CWPA 1B9MA 2FMCA 1NMVA 3J80L 3ERQA 2TSSA 1UE5A 1KABA 3M3YB 2JSOA 2K6AA 3R8BA 2ZJPA 1Y1VB 3STBD 3LWEA 1PTOH 3M7GA 1CFMA 4KD4A 3ZYYX 1VCIA 1QCBD 4PZ6A 1AZPA 4G57A 3HRZC 4KJOA 3I2ZA 5JEAH 3URYA 1Y8NB 4IUPA 4GKKL 3S24A 3VR4A 1JR0D 1K8AC 2F0PA 2R92G 5IYCH 3QJYA 1RP5A 5IWAQ 2L55A 1U4RA 1G6ZA 2JA7H 1R4QB 3H0GB 2H4OA 4QUCA 1SYEA 1IKMA 1N9WA 1IBML 4OWWB 3HOYH 1JJGA 1VQ6A 2JA8H 2D62A 3D4WA 1YZ6A 1SXTA 2PPBC 3PIPA 1LV9A 4DUYQ 4JI6Q 2Z6KC 1V8QA 1S5DD 5HGTA 3IRBA 3D3RA 4F7XA 1D5ZC 1O6WA 5E64A 5C0XJ 1I50H 1NMGA 5HURA 2E5LQ 4DKAC 5CGKA 3D4RA 4L8JA 2AUJD 1HHVA 2VB3X 1HRJA 1K9MC 4X6AH 4ZUIA 5CC4A 1STHA 3V2TA 3HS0C 3BDOA 4ME3A 3GO5A 3TC5A 4K8JA 1VMCA 2ALYB 2F0JA 2Z4IA 1SFOH 3CCUA 4KI0A 2ZQUA 1EY7A 3HOXH 2HHHL 3OSOA 1L2FA 1MIUA 3C1EA 4MN3A 2NBFA 3PSIA 5IT9E 3TDBA 1CZGA 3JAME 2L4JA 1XNQQ 5D3DA 4BBRB 5HGQA 4WJ4A 5EBCA 3F2UA 3TP7A 2OWOA 1BCPC 4X3KA 2R7ZH 4EGVA 1TWFB 5IGCA 1TK7A 3S16H 4DFAA 2EXZA 3SK8A 1NUCA 5LMUQ 2WV6D 1QNUA 4N9TA 3CCVA 4X65L 2HQEA 1AP0A 3BU2A 3CCMA 2K1BA 3L3OC 1JWSD 1TY2A 2KCTA 3S14H 1M8AA 1O7LA 2ZXPA 3BVZA 2I5LX 3CHBD 2EZ5W 2KHIA 4H0LC 2E2HH 2YU9B 5CV5A 3I73A 4IUTA 4I65A 3SR1A 2LXJA 3MXNB 4LF5Q 1TWAH 5DAUA 3J80E 2F0IA 4JI4L 3HKZB 3T1YQ 5ELBA 1FJGQ 3MFGA 1TS5A 3M4OB 3OW7A 3W3AA 2LFNA 3GTLB 3CQZH 3WDNA 1IL8A 2HCIA 1B2TA 2F0SA 3TP6A 1N34L 4NMZA 1I4QA 1SMXA 2FHTA 2E2IH 1RODA 5FO8B 2YSIA 3TDQA 5FLXc 3TP8A 1W3SA 5EKKA 4TKOB 1KHIA 4CJ2C 1AE2A 2N78A 3T13A 1HJPA 2NVQB 1EYGA 4GN4B 4DAVA 2E2JB 4IPCA 1DOMA 1F2LA 5G3LD 1YBYA 4DN4M 3K5NA 1PTOC 5C3EB 1PMRA 5ELEA 4HJAA 4XYQA 5IODA 1EEID 3GTKB 2KHJA 4R4IA 3CCEA 1A0IA 2BH8A 3SE0A 1PZID 3LX0A 2DNEA 3GTJB 1HQMC 1HNXQ 4UY8C 1PFMA 1X3QA 4TSSA 2M8JA 4HCEA 3VR3A 4MNOA 4QY7A 4ZAIA 3C1FA 4NXNQ 2K4KA 2K32A 5DM73 4FNFA 2PNRC 1N32L 3G4SA 3AMUA 1ENFA 1KLGD 3MVVA 5KEEA 2JA6H 1S5CD 2ZAJA 3MWYW 1FYCA 4A75A 5I2XA 2N8NA 4HAEA 4AIMA 5IYBG 2SDFA 4KTAA 4EQPA 2EYPA 2NB0A 3D6WA 4DV3Q 5IGDA 4AYBE 3KBGA 2N88A 1TWGB 4A3FH 1QWYA 2F3IA 1SAPA 2KENA 2AQ1B 4MHEA 3VA7A 1DD2A 2X6GA 4HCSA 1SSOA 3P1HA 1ENAA 2QEJC 3H94A 1BF4A 1Y1WG 2RHQB 2OXPA 4FF4A 2OCEA 1Q8KA 4R4QA 4RWSC 2K05A 2RDGA 3K57A 1U5KA 1R9TB 4LJZC 2Y0SE 2WAQB 5D65A 2UXCL 1PFNA 1AEXA 3IKJA 3PO2G 2RDFA 4ZYSA 2I5MX 1TT2A 4IFDI 2VQEQ 1L0YB 4AH6A 2M2LA 2R92B 3VYTA 4J1MA 4JI2L 3KLRA 3VR6A 4K0KL 1JQYD 2MNAA 1LTGD 4IQZA 2ATWA 5M5XH 2QCPX 4B3SL 2DMVA 4KK7A 4Y7NB 4JI1L 4BXXG 2AQ3B 2PQEA 1PINA 2DUDA 5E65A 1JJCB 3CP0A 4A3JH 5M3FH 3FMCA 1A2TA 4OX9L 2F0VA 3BJUA 2I07B 2TMPA 2JA9A 5IYDH 3GTPH 2ZQVA 4YIJA 5IIFA 4G7HC 2GN5A 1B44D 4JI3L 2K5QA 2XP3A 1JC7A 2EYMA 5IGGA 4TRDA 1SNOA 1L1OB 3LGJA 3UDGA 2CKZB 4DK0A 4Z9CB 3NHHA 3U4ZA 4KV6A 1I6VC 1TR8A 3TBIB 3MFYA 4REXA 1G2TA 3K5MA 2IHFA 4BWGB 3MCBA 2PO4A 3N6RA 3RZOH 5CBAE 4LF8Q 2XTIA 1H9SB 1MBYA 3M7NA 1HZ9A 3M4QA 4WJWA 5FO7B 4R4TA 3OPOA 4IFDG 4CBVA 1DOLA 2F4VQ 3S9WA 2KHSA 3I7FA 1XMOQ 3FS8A 2IX1A 3OWEB 3GV3A 4F8MA 1WYDA 4JBKA 3ICEA 1G51A 1VQAA 1IBKQ 3W5OA 2L4NA 4ABNA 2SOBA 4FYDA 3MC0B 5LL6S 1HCZA 1S72A 2XRSD 3QB3A 3SGIA 3F2BA 4KN7C 3KABA 2FMMA 4LF7Q 4DV7L 3GD7A 4JV5Q 1LT6D 2BDOA 2E8GA 4A3EG 1C7YA 2V4DA 1UE6A 5EPLA 1PA6A 1BCPD 1HTLD 3QO2A 4CJ1B 1UNSA 2EZVA 1WD1A 1CSPA 4YY3Q 3I3CA 4OL7A 3A8KE 2EQSA 3NWSA 2ZT9C 3HOVH 2JEBI 4DV2L 3ODKA 1ONLA 2BCOA 1I5HW 3GTQH 3H6MA 1I94Q 3STBC 4BY1H 3K81C 4IUQA 1GM5A 2M9VA 3A5ZB 2JV4A 3LWUA 4DNIA 3HOUG 3A0JA 4DV5L 1KXLA 5K36H 2YSBA 1RCVD 2ZXOA 3AQQA 1N36Q 3AFPA 1CHPD 3R93A 3S1NH 3MEHA 3W1BA 2OTJA 1EYDA 1EY9A 1X56A 2EIFA 1D1KA 2Z1CA 3KDFA 4K8IA 4EQ5A 4BS9A