3M85A

Archaeoglobus fulgidus exosome y70a with rna bound to the active site
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
179
structure length
179
Chain Sequence
MRFVMPGDRIGSAEEYVKGEGVYEEGGELFAAVAGKLIIKDRVAKVESISPIPEIVKGDVVLGRVVDLRNSIALIEVSSKKGENRGPSNRGIGILHVSNVDEGYVKEISEAVGYLDILKARVIGDNLRLSTKEEEMGVLRALCSNCKTEMVREGDILKCPECGRVEKRKISTDYGKGEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Quantitative analysis of processive RNA degradation by the archaeal RNA exosome
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase/rna
molecule keywords Putative uncharacterized protein AF_0206
total genus 36
structure length 179
sequence length 179
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10447 EXOSC1 Exosome component EXOSC1/CSL4
A PF14382 ECR1_N Exosome complex exonuclease RRP4 N-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3m85A03
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3m85A01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3m85A02
3I56A 1I94L 1JT8A 3J81c 3OYYA 2B63H 3H94A 4B3SL 2CKZB 2I5HA 3W5OA 4DV5L 4AH6A 3VA7A 1L1OC 4U84A 3H3VH 2E8GA 1K9MC 4R4CA 4U86A 5KNBA 3A7AB 4C2MH 2A6ED 2ZM6Q 1V1QA 4JCVE 4DV5Q 2DJYA 5FLMH 2B8GA 2NN6G 3DLLA 5J3BA 4MTNA 4YCWA 5JEAG 3TRZA 4GOPA 1X56A 2N3SA 1VQ7A 2XP4A 1YJNA 2HHHQ 5C4XG 4DAMA 5LMUQ 1B9NA 1HZCA 3E0EA 3IFTA 4IFDH 1HNXL 2Y0SE 2E2JH 2BE5C 2NN6I 2NVYH 1GUGA 4LUVA 1NY4A 4P71A 2RHQB 2EIFA 4U85A 1DD2A 2KCCA 4IFDJ 3CC2A 4HJAA 4OX9L 4A75A 1TWFH 3VR4A 2ZM6L 1C7YA 3M4YA 3A7LA 1SFOH 1A6XA 1TWGH 5C0XI 4BXXH 2LAJA 2DNCA 3BG3A 4GNXB 1N33L 2NZOA 4A3LG 1N36L 1E3PA 3L2PA 2UU9L 4B3SQ 5IYBG 2K32A 1B9MA 3J7ZC 3HOWG 2M8IA 4HJ9A 2ZTCA 3LGJA 3S17H 3K7AH 2FXQA 3OW7A 3AFPA 1J5EQ 4JBJA 2A69D 1XPOA 4UP7A 4MNOA 1H9SA 1ZKOA 3A8KE 3I4NH 3NENA 4OO1G 1TWHH 3DXJC 3KLRA 3BDOA 3CC7A 2AUJD 3HOXG 4KHZA 1VQLA 2KCTA 2YSFA 1HNXQ 2ATWA 1YVCA 3ULLA 3WDNA 2JX8A 4GN3B 4L5TA 3NEMA 2YU9H 4DV2L 2ZQUA 2E74C 4K0KQ 4EX5A 4LF6L 3S15H 1N9WA 4JC0A 4RCNA 3F2DA 1VQHA 2Q2TA 4GN5A 1XNQL 1KXLA 1XMOQ 3OOBA 2IX0A 2Q2IA 4GNXC 1L2FA 3K81C 4JI7Q 3PV0A 4IPDA 5K36G 1GUNA 2D5DA 2XTIA 2VL6A 4GKKL 1Z47A 4A3EG 1Y8OB 4DK0A 5BR8L 1VQ4A 2UU9Q 2YYZA 4A3LH 2NVXH 2KHIA 2RF4A 4JI0L 1BVSA 4A3GH 3STBD 2JA7H 2I5LX 1O7LA 2BH2A 3ODKA 2UUCQ 2E45A 4R4IA 1BBUA 5M3MH 1GUSA 1NMFA 2CFMA 2R7ZH 3PF4A 2ZR4A 1KRSA 2UXDL 1PYBA 2DGYA 5C44H 1OXTA 1JJCB 4LF4Q 3SDZA 2R92G 3J7A5 2V4DA 1YJ9A 3PCOB 3L7ZC 1WMVA 3HKZG 5IYDH 2BE5D 1K8MA 1DGSA 2E5LL 1FJGL 1I5HW 2MO0A 1AE3A 3I4NG 4DK1A 1N8RC 4JI6Q 2D2CC 3UDGA 4DNTB 4DPGA 3AFQA 3F1ZA 1X3GA 3CMEA 4GLXA 1VQNA 3SGIA 4JBWA 3J81j 3OPOA 1YITA 1L1OB 1GJXA 2A69C 2JA8G 3GTKH 1B8AA 4JV5L 5GAGC 1BDOA 3GQBA 3TS0A 1GUTA 1UE5A 4YWMA 1K83H 4R1JA 3STBC 3GTJH 3N6RA 1B7YB 1YNNC 4LFAQ 1IYUA 1V43A 3H0GH 1SE8A 1T5EA 3ND9A 4JI8L 4HJ7A 1Y1WH 2RHSB 2XPAA 2R93G 1Q82C 1IW7C 1H95A 2VY3A 3HOZG 2MO1A 4KI0A 4DK6C 1X3FA 1GUOA 4DUZQ 3LWUA 1SMYC 3B6YA 1PHJA 4DR6L 4JI2Q 3CRKC 1X9NA 1KC8C 1UE7A 4YWLA 1TWAH 1VQBA 2PNRC 4A3IH 1WR7A 1HR0W 3HOUG 1FVIA 2CWAA 1XJVA 1GO3E 2JA8H 2CQOA 4JI5Q 5IWAQ 3EBEA 1WFQA 1QJOA 1VQ9A 4LF8Q 2EJFC 4QL5A 2WB1E 1KAWA 4A4IA 4BBRH 5IYDG 1K3RA 3L0OA 3NELA 4BBSG 1EQRA 4DR4L 2H5XA 2PQAB 3CF5A 3K7UC 5IP7G 1G6PA 1CKNA 1EG3A 4BA2I 4P74A 2UXCQ 1I94Q 3A0JA 4G7OC 1QVFA 1XMQL 4A3BH 5C0XH 1I3QH 1QUQB 5C4XH 4HIDA 3HOYH 2NVQH 4DR3L 3EIVA 3RN5A 4L5RC 3KAIA 2IY5B 4RMFA 3CD6A 3HKSA 4IFDG 1M90C 3AEVA 2DWVA 2Q5AA 2PPBC 5M5XH 4JBKA 1ASZA 1SRUA 1K73C 3I4MH 4YY3Q 1H9JA 3FHWA 2EJGC 3HOWH 3S1RH 3HOXH 1EQQA 2LMCB 2L15A 2VQFL 4IPCA 3FPPA 3I4LA 2IHFA 2E76C 1TKWB 3ICEA 1H9KA 3I55A 4LF5Q 2LXKA 1HPCA 1IBLL 4AQYL 3W1BA 3K0XA 4GLAC 3CMAA 3GTLH 4G7HC 4BBSH 4IQZA 3W1GA 1Q8KA 4LF7L 1I5FA 5IYCG 1H9RA 3H3VI 1CSQA 4LFBQ 4B3TQ 1ASYA 3P20A 3JAMi 3U58A 1K9RA 1VQMA 4A3BG 3HOUH 2UUBQ 4HR7B 1K8OA 2ZTDA 2JMFA 4OO1I 4LF8L 1B70B 2F1MA 3F2BA 1N34L 2NVTH 3T1YL 3TREA 2JA5G 1JMCA 3MEFA 4OGQC 4LF5L 4UPAA 2UXBL 1RL2A 1QVGA 1X65A 2AWOA 2YTVA 3BJUA 5HGQA 3S1QH 4B3ML 1IBLQ 3S24A 1G51A 3GTGH 4YY3L 4G7ZC 1E22A 5LMNQ 1GD7A 4GKJL 2JEAI 1IZ6A 1W2BA 5M5YH 4DR1L 2PCFB 3T1YQ 2R7ZG 4JK1C 1V9PA 3CP0A 3M9BA 4FDBA 5IYCH 4LFBL 4DV7Q 1VQPA 3UDFA 2K5VA 1PV4A 1LTLA 1BKBA 1ZYRC 4LFCL 4B3TL 4GOPB 2A19A 4NXML 3A8IE 2WP8J 3UDIA 1NMGA 2WAQE 1WI5A 1PINA 2XP7A 3D4RA 1XTDA 1OXSC 3K8AA 1OXXK 4A3CH 3KF6A 2MFIA 2WAQG 4ME3A 4LUZA 3PGZA 3S14H 4H02A 4LWCA 1RIPA 3FKIG 4R4TA 2F4VL 1UWVA 2ZJRA 2I0QA 1JJGA 2N78A 4JI1Q 3RZOH 3L4HA 2A8VA 1YJWA 3H15A 2BH8A 3DM3A 4YCVA 4JI2L 4DR6Q 1KD1C 1GVPA 2DUDA 3EQLC 2YSIA 1YNXA 2XGTA 4DUZL 2NN6H 1A62A 5ELOA 2AWNA 1L0WA 5JEAH 1IBKQ 1Q86C 4IOCA 2BA1A 1YBYA 1HCZA 2Y0SG 1VCIA 1S3OA 2JA5H 4L5SA 2PI2E 2R6GA 4OWTB 2EVBA 2A6HD 1PH6A 2ZQTA 4DV7L 3NBHB 2VZAA 1CFMA 1D7QA 4LFAL 5IWAL 5C3EH 2PNHA 1Q46A 4GKKQ 1X54A 5JJLA 4A93H 1IL2A 2XP8A 4B3RQ 4NPSA 2EQSA 1JMQA 3W3AA 3S16H 2R7FA 3KAGA 4TVAB 3CAMA 4NXNL 4WJ3M 2DNEA 1GHKA 1Y8NB 3I4OA 1NE3A 1F8AB 2IT1A 4DV6Q 2VQFQ 2O5IC 1SR3A 3OW2A 2YTXA 1U0LA 4QIBA 1PH9A 4A3JH 1QUQA 4KKSA 2HIVA 1PH7A 2GN5A 1Q1BA 4YHHL 1Z7TA 2B3GA 1Q1EA 1PYSB 2EDGA 1NBWA 2Q8IB 3FP9A 4DV4Q 3QIAA 2JV4A 4R4OA 4BY7H 4A3MH 4XIGS 4DR7Q 2PI2A 2ZQVA 1CTMA 1KIXA 4X65Q 1PH2A 2I5MX 3M85A 3TC5A 2K75A 3AYHB 4KHPL 4DUYQ 2NZHA 4DV3Q 4RG1A 3LE4A 1Y14B 5CQ2A 1CSPA 2AUKA 1EYGA 4A3FG 2DK7A 2F3IA 3KLWA 1X3EA 5GAHC 4O0AA 4DV0Q 1PH1A 4JI0Q 4KN7C 4A3KH 1D8LA 2KA7A 3M7NA 1E7ZA 5EAYA 4P73A 2Q2UA 3FMCA 2XPBA 1X55A 1A8VA 3M4PA 2D0PA 1BBWA 2Z6KA 3LNNA 4X64L 1H9MA 1OXVA 3F2CA 1HNWL 3I2ZA 1P16A 3UE1A 1CKNB 1PA6A 2JA6H 1IBMQ 3PUYA 3D0FA 2JXWA 1EWHA 4I7ZC 4IJHA 4Y52H 3MXUA 1XMOL 4BY1H 1XNRQ 5KNCA 1NMVA 4GZYC 2R7DA 3GD7A 3JC66 4KHPQ 2E75C 4DV2Q 3J80c 2EZ5W 1XPUA 1HQMC 1XNRL 1YNJC 4A3GG 3I72A 4H0LC 4P72A 2KENA 1XMQQ 1T9HA 5JJIA 3CCQA 2K5HA 2Z6KC 3PO3H 3WWVA 1CKMA 1N32Q 1NTGA 2VS1A 4JYAQ 3RR5A 2A68C 1CUKA 3D31A 3ZJYC 1HR0Q 2VUMH 4TKOB 2AHOB 4UP9A 2ZJQA 3H0GG 4ALPA 3IKJA 1KL9A 3J81i 1QZHA 2E2IH 1DXMA 1WCMG 4E5RA 4NXNQ 4JI7L 4DV0L 3A5UA 1LUZA 5JJKA 3M3YH 3HOZH 4A3JG 3CCJA 1HZAA 1CI3M 1N33Q 3GDEA 4PV1C 3CC4A 3PIPA 1LM0A 2VW9A 1PH5A 3S1MH 3TCZA 4XTCS 5GAEC 5IE8A 1UE1A 3WH0A 1EIFA 3RLNA 1X6OA 2ES2A 4OX9Q 2GVBA 3VR6A 5BN4A 2N8NA 4DV1L 2HT1A 1TU2B 5IY0A 1FR3A 1I6VC 3GTQH 4PG3A 5GQOA 4YHHQ 4Y7NH 4DNIA 1E24A 4JG2A 1HZBA 1M1KC 3CCUA 2CW0C 5LMUL 1KRTA 2QGQA 2ID0A 4HIKA 1E1TA 1VQIA 2YTYA 2PMZE 3RNUA 4BA1I 5IP7H 2LXJA 5K36H 2XP5A 3CNGA 1Y1VG 2F4VQ 2HHHL 2JA6G 2A68D 3GTOH 3PSIA 5M3FH 3PO2H 5IT9c 2BDOA 4GLVB 1WCMH 1UEBA 3CW2C 3RLFA 1YI2A 1K8AC 1YHAA 3CPWA 1Q12A 3PUWA 4X64Q 5M3MG 2QA4A 1E2ZA 1IXRA 1HR0L 3OTOL 2B8FA 5HY6A 1VQGA 3RN2A 4PZ6A 3U4ZA 2K14A 4DR2Q 1ZCNA 4JOIC 2OCEA 1SROA 1O7IA 4L8JA 2D0OA 4C3IH 5KNDA 3CXCA 4O2DA 4K0KL 1AE2A 3RZDH 3T1HL 3VR5A 3S2DH 1C9OA 4A3DH 3KAHA 4R4QA 1NJIC 4C3JH 1QVCA 2N49A 2UUCL 5LMNL 3VDYA 4JI3Q 3I7FA 3HFZB 3PUZA 2KHJA 1C0AA 4REXA 1TXYA 2K50A 1OXUA 1VQ8A 3TZUA 3A5ZB 4QGUA 3U50C 4TQUS 1HNWQ 3PO2G 1HZ9A 4POFA 4OONA 4GN4B 4HJ5A 5C0XJ 5IP9H 1YHBA 4A93G 2WFWA 5DLQE 1YHQA 4JI4Q 3CCSA 4LFCQ 3E9HA 3TEHB 2EXDA 3ND8A 2B63G 4B3RL 1PMRA 4A3MG 1XNQQ 4A3FH 2UUBL 1FGUA 4GOPC 2ZT9C 4DV3L 4DUYL 4DV4L 2R93H 4YCUA 1GM5A 3UDXA 2MQHA 1PFSA 3PF5A 1KHIA 1XPRA 4LJZC 1O78A 3VR2A 4A3DG 4IJLA 5A35A 3BZCA 3CCVA 1GHJA 2ITKA 5AJ3Q 3UE0A 1U5KA 1WOCA 3RLOA 4HJ8A 1VF5C 4X62Q 3KABA 5E7NA 4BY7G 1A0IA 2JA9A 4JI1L 1AH9A 3KJPA 1W3SA 3U4VA 3AQQA 3ULJA 4A3KG 1K0RA 4LF9L 1IBML 2CCZA 1N36Q 3QG1A 1SN8A 2UUAQ 2ZR6A 3PUVA 2ZTEA 3T53B 4KKUA 2JQOA 2R92H 3KDFB 3E9IA 3ER0A 3MFYA 2F21A 1GKHA 4HIMA 2YSGA 5BN3A 4DKAC 1MIUA 4BXXG 1G291 2YV5A 2VUMG 2ZR5A 1N32L 2Z0SA 1Z6HA 5C0XG 2D62A 3G48A 3OOCA 4NB3A 2PQAA 1VDZA 1FL0A 5FLMG 4POGA 1OTCA 4QJFA 1IBKL 4QQBX 2F52A 2KCMA 3HKZE 4BY1G 4AQYQ 2OTLA 3S2HH 3KOJA 4OWWB 4KMUC 4UP8A 4LUOA 1SLJA 3GO5A 2UUAL 1LYLA 3T56B 3CQZH 2A1AA 4DR7L 2JK8A 2JA7G 1FYCA 1VQFA 1Q90A 3TDBA 1VQ5A 5M5WH 5LMNW 3F8TA 1S72A 1L1OA 1DCZA 2VQEQ 4IOAA 4YWKA 1MKHA 5H1SE 2UXBQ 3HOVH 5FJ8G 3M4OH 1VQDA 2RCNA 5AJ3L 1Y8PB 2V1CC 5C4JH 2DMVA 4IFDI 2VNUD 3BU2A 2AMCB 4AYBE 1Y69U 1MJCA 1K8GA 1VQCA 1Y1WG 3TS2A 1WJJA 3K80C 3KF8B 4DK3C 3A74A 4H13C 3KADA 2YSHA 1JB7A 3PIOA 2MDIA 4QIWE 4OWXB 4JI8Q 4EQ5A 5GROA 3IRBA 1VQKA 1QZGA 3U9SA 4L5QA 4LW1A 2QF7A 4WJ4A 2BA0A 1I50H 2OQKA 4DR5L 4X65L 2ZQSA 1E2VA 5IYBH 4KLKA 4LF9Q 2JE6I 2IHEA 4X66L 3CCMA 4OO1H 3KYHC 1EG4A 2KXQA 1JJ2A 3PUXA 4LF7Q 2CWPA 4DV6L 4J15A 5FJ8H 3J80i 5C44G 4UY8C 1HNZL 3S1NH 2O5JC 3VR3A 1IYVA 4PZ7A 1LABA 4JI3L 5C3EG 1HNZQ 2ZAJA 3ULPA 5JEAJ 1EUJA 5FLXc 1YEZA 1TK7A 3PO3G 2XP6A 4X6AH 1FJGQ 2VQEL 2K52A 4HIOA 2ASBA 4DAYB 5M3FG 1UE6A 1YZ6A 3KCEA 4DR3Q 1N34Q 1K9QA 2XP3A 3CPFA 3CCLA 1YW5A 2K33A 4A3IG 2K5NA 3I4MG 4QY7A 2M8JA 2GVAA 2OQ0A 3G6EA 2QEXA 3BZKA 2AKWB 3G4SA 3GTMH 3HOYG 2A6EC 5ELNA 5AHTA 4A3CG 2UXCL 2M3OW 3MXNB 1CKOA 2ALYB 4APVA 4BBRG 4AIMA 4P75A 1PH8A 4JI6L 3HOVG 4DR4Q 1E1OA 1J6QA 2K4KA 4DR1Q 1VQAA 3T51B 3GTPH 1IYJB 2C35B 1YIJA 4A3EH 3NTPA 1VQ6A 4GKJQ 2JXMB 5IP9G 3FKIH 3HGBA 2L4JA 1EFWA 1Q81C 1LACA 2K7VA 4B3MQ 2KBNA 3CCRA 2RE3A 1EIYB 4OXPA 1EWIA 4LF6Q 2IX1A 1H9SB 2DN8A 1VQJA 3JAMc 2UXDQ 1O6WA 1A63A 1V8QA 3KAFA 1TWCH 1SMXA 1Y1VH 4DR2L 2OWOA 3CRLC 4NXMQ 1Z9FA 1JE5A 1WYDA 2A6HC 2XP9A 4KN4C 1PH4A 2Q2HA 3CCEA 3AB9A 3G71A 2HIXA 1HTPA 5BR8Q 3ERSX 4KKTA 2L5TA 1HH2P 1VQOA 4PZ8A 2ZJPA 1S40A 2YSBA 4X62L 2JEBI 4LNQA 4DNRB 4JI5L 4GNXA 4JOIA 5GADC 3KFUA 1ONLA 1VF7A 3SE0A 4PMWA 5BN5A 3EN2A 1EOVA 2JJQA 4A76A 1KQSA 4IO9A 1R9TH 1MJEA 2HQLA 1VQEA 1PVOA 4JYAL 3Q8DA 4IPHA 4MZ9A 2EJMA 3T1HQ 4X66Q 4IPGA 1Q7YC 4JBMA 1E2WA 4LK1C 4AYBG 4DV1Q 3NE5B 4C3HH 2E5LQ 1HJPA 3A8JE 3I73A 4DR5Q 3M4QA 2DK1A 4JV5Q 1J5EL 1P8LA 2WB1G 3KDFA 2B29A 2MNAA 4JI4L 1PH3A 2E2HH 1IW7D 3KJOA 3TQYA 1I6HH 4LF4L 4H44C 1VS0A 3QJYA 4GS3A 3OTOQ 2OTJA 2LSSA 3KF6B
chains in the Genus database with same CATH superfamily
3I56A 1CA6A 1I94L 1JT8A 3J81c 5IGCA 3OYYA 2B63H 3H94A 4B3SL 1D5MC 2OXPA 2CKZB 5CV8A 2I5HA 3W5OA 4DV5L 4AH6A 3VA7A 3I8ZA 1L1OC 4U84A 3H3VH 5M3FB 1AW7A 4HEDA 2E8GA 1K9MC 4R4CA 4U86A 2EYOA 1VMPA 5KNBA 3A7AB 4C2MH 2A6ED 2ZM6Q 1CA5A 2NBFA 1CZWA 4PQXA 1V1QA 4JCVE 2FFKB 4DV5Q 2DJYA 2IWHA 5FLMH 2B8GA 4FO2A 2NN6G 3DLLA 3NWSA 2WAQB 3LKXB 5J3BA 3OMCA 4MTNA 3HOVB 3M4OB 4YCWA 3SHLA 5JEAG 5FOBB 3TRZA 3GTJB 2ICIA 4GOPA 2WV6D 1X56A 1C4QA 2N3SA 3SK4A 2MPMA 1VQ7A 2XP4A 2F0EA 1YJNA 3TP5A 5T1GA 4NP5A 2HHHQ 5C4XG 1EU4A 4X3KA 2F0UA 4JVZA 3MEHA 1KTKA 4DAMA 5EPLA 2H4OA 5LMUQ 4KJOA 1B9NA 2K5DA 1HZCA 1II3A 3E0EA 1KLGD 2RVLA 3K5NA 3IFTA 3A54A 2NTSA 4IFDH 1HNXL 2Y0SE 2E2JH 2BE5C 2NN6I 2NVYH 1GUGA 4LUVA 1NY4A 4P71A 2RHQB 5I6WA 5CMDA 2EIFA 4U85A 1DD2A 2KCCA 2I46A 4IFDJ 3CC2A 1HFGA 4HJAA 4OX9L 4A75A 3BVGA 1FNUA 1TWFH 2B39A 3IFDA 5TSSA 3VR4A 2ZM6L 1C7YA 3M4YA 3A7LA 1SFOH 5FLXL 1A6XA 1TWGH 5C0XI 1ZYRD 3K0YA 1RDPD 4BXXH 2LAJA 2DNCA 2DY7A 3BG3A 4GNXB 3I70A 2NVTB 1N33L 3NTHA 4C3IB 1KDAA 2FMMA 2NZOA 4A3LG 1M4VA 1K0SA 1I4RA 1N36L 1E3PA 3L2PA 1EY8A 2HQEA 2UU9L 4B3SQ 5IYBG 2K32A 1G91A 1B9MA 3J7ZC 3HOWG 2M8IA 3OHXC 2OEOA 4HJ9A 2ZTCA 3LGJA 3S17H 3K7AH 5E5WA 1UEAB 2FXQA 1F2LA 3OW7A 4KD4A 2CQAA 4JW0A 5KEEA 3MCBB 4WJWA 3BZDB 4CDEC 3AFPA 2Z4HA 1J5EQ 4JBJA 2F0HA 3G7LA 2A69D 1SFOB 4V190 1XPOA 5ELBA 4UP7A 4QUFA 3CU7A 4MNOA 1H9SA 1ZKOA 3A8KE 3I4NH 3NENA 4OO1G 1TWHH 3AU7A 3DXJC 3KLRA 3BDOA 5FO9B 3CC7A 3MCBA 2I07B 4X3UA 4RAUC 2AUJD 5C5MA 3HOXG 2L55A 4KHZA 5CBAE 1HFNA 1VQLA 2KCTA 2EYMA 4RCOA 2YSFA 1HNXQ 2ATWA 1YVCA 3GTOB 1KLUD 3ULLA 3WDNA 4U673 2JX8A 4GN3B 5U47A 4L5TA 2EXZA 3NEMA 4A0UA 1S5BD 4DV2L 2YU9H 2ZQUA 2N88A 2E74C 1BBXC 4K0KQ 1CQFA 4EX5A 4LF6L 3S15H 1WTHA 3PIO3 1N9WA 5KGUA 4JC0A 5E64A 1F9RA 4RCNA 5IT9L 3F2DA 1VQHA 3TDQA 4S3SA 2Q2TA 4GN5A 1XNQL 3K59A 1KXLA 5CYUA 3I91A 2Z6BA 2ZXRA 1XMOQ 5IGGA 1ILPA 3OOBA 2IX0A 2Q2IA 4GNXC 1L2FA 4EQPA 3K81C 1B3QA 2TMPA 3K7AB 4JI7Q 3PV0A 4IPDA 1JQYD 4ODGA 5K36G 1GUNA 2D5DA 4IALA 4PMCA 2JN4A 2XTIA 1JORA 5D3IB 1SNOA 2VL6A 4GKKL 1Z47A 4A3EG 1Y8OB 4DK0A 3H3VC 5BR8L 1VQ4A 4OELB 2UU9Q 2YYZA 3S14B 2NVXH 4A3LH 2F0PA 2XRQD 2KHIA 3Q0AA 2RF4A 4JI0L 1BVSA 3HKZB 3S2HB 4A3GH 1TWAB 3BVZA 2MP1A 2XSCA 1TS5A 3STBD 2JA7H 2I5LX 1O7LA 1EYDA 2BH2A 1E0BA 4NKLA 2RDHA 4P2CB 3ODKA 1B44D 2E45A 2UUCQ 4R4IA 1BBUA 5DEHA 5M3MH 1GUSA 1NMFA 2CFMA 1BCPD 2R7ZH 1FGBD 3PF4A 2ZR4A 4PMBA 1KRSA 2UXDL 1PYBA 2DGYA 3D3RA 2SOBA 5C44H 2EPBA 2KEEA 1OXTA 3Q24A 3GTPB 5M5YB 1JJCB 4LF4Q 3SDZA 2R92G 1TWHB 3J7A5 2V4DA 1YJ9A 3PCOB 2NUCA 4C3JG 3L7ZC 1WMVA 1KAAA 3HKZG 3S2DB 5IYDH 1A3VA 2L12A 2SDFA 1B50A 5A2QL 3GP7A 4A3IB 2BE5D 3CHBD 1K8MA 3HG9A 4NDXA 4B9XA 1DGSA 2E5LL 1QE6A 1FJGL 2HUGA 2KVMA 1I5HW 1TWFB 2MO0A 5EKIA 3KK7A 1RTOA 1AE3A 3I4NG 4HN7A 3MQHA 1AEXA 4DK1A 1N8RC 4QB4A 2Z1CA 2KQ3A 4JI6Q 2D2CC 3HEJA 5COYA 1W6JA 3O13A 5EKKA 3E6ZX 3UDGA 5EQ0A 4DNTB 4DPGA 3AFQA 1PTOC 3F1ZA 4C3HG 3J81L 1G8ZD 3KUPA 5EJWA 1X3GA 3M3YB 3CMEA 4GLXA 1VQNA 1YNJD 3SGIA 2Z9HA 4JBWA 4BY7B 1LTBD 3J81j 3OPOA 1AN8A 1YITA 2XNAC 3PO3B 1L1OB 1GJXA 2A69C 1LT6D 1I4QA 4J8QA 2JA8G 2RA4A 3GTKH 3J7AV 1CHQD 3A55A 1B8AA 4JV5L 3BDLA 5LL6X 5JVG3 5GAGC 1BDOA 3GQBA 1PRTC 3BYYB 3TS0A 1GUTA 1SXTA 1UE5A 5KIXA 4YWMA 3GTMB 1K83H 4R1JA 3STBC 4RWSC 2Q8TA 3GTJH 4DN4M 3N6RA 1B7YB 1YNNC 4LFAQ 2EYHA 1IYUA 1V43A 3H0GH 1PFNA 1SE8A 2BDNA 5CORA 3C46A 1T5EA 2HCIA 3ND9A 4JI8L 1STGA 5G3LF 2N55A 1SNCA 4HJ7A 1Y1WH 2RHSB 2XPAA 3U9OA 3GTGB 5KYLA 2R93G 1Q82C 1IW7C 1H95A 2VY3A 3HOZG 2MO1A 4KI0A 4DK6C 1X3FA 1GUOA 4DUZQ 1G2TA 3LWUA 1SMYC 1IHZA 3B6YA 3OIQA 1PHJA 4JI2Q 4DR6L 1CM9A 3CRKC 2IJ0A 2F0LA 2RDGA 1RJTA 1X9NA 1KC8C 4ABNA 4KD3A 3LWEA 1TT2A 3TP8A 1UE7A 1PRTB 1TS2A 4YWLA 1TWAH 4QMGA 4ZQ3A 1J8IA 1ESFA 1VQBA 2PNRC 4A3IH 1WR7A 5CV7A 1HR0W 3HOUG 1FVIA 2CWAA 5IGBA 1Y1WB 5E65A 1EU3A 1XJVA 2MJ8A 1R4PB 1GO3E 2XN9C 2JA8H 4PNYA 2CQOA 4EVOA 5JVH3 4JI5Q 5EPJA 4B08A 5IWAQ 2HD3A 3EBEA 3T13A 1WFQA 1QJOA 1DOLA 1VQ9A 1I3QB 4LF8Q 3I4NB 2EJFC 3R3OA 1GXDC 4QL5A 2WB1E 1KAWA 1S5DD 4A4IA 4BBRH 3SR1A 5IYDG 1K3RA 3L0OA 3NELA 2JA6B 5IODA 3HOZB 4BBSG 1EQRA 3BVMA 4DR4L 2GA4B 2H5XA 2NB0A 2PQAB 4L6TB 5LL6S 3K58A 1WTOA 3NXWA 3K7UC 3CF5A 3V2TA 4CDFC 2CH4A 5IP7G 1QNUA 1CKNA 1G6PA 1EG3A 3GTLB 4BA2I 4P74A 2UXCQ 5T1IA 1I94Q 1TY0A 3A0JA 1JICA 1QVFA 4G7OC 2FJ2A 2X6GA 5L37A 1XMQL 2NZ1D 4A3BH 5C0XH 2LS01 1MHWC 4WFN3 1I3QH 1SBBB 1QUQB 1HUMA 5C4XH 1F2YA 3MAQA 2EE1A 4HIDA 3HOYH 2NVQH 4DR3L 1BCPC 3EIVA 3RN5A 4L5RC 3KAIA 2IY5B 2KECA 4RMFA 3CD6A 2AQ2B 2F3WA 3VYSA 1B4OA 3HKSA 4IFDG 1M90C 4OHJA 3AEVA 2DWVA 3S9WA 2Q5AA 2AQ1B 3QWNA 1WTVA 3EJIA 2K28A 2QW7A 5M5XB 5M5XH 2PPBC 4JBKA 5CV5A 1ASZA 1SRUA 1K73C 3I4MH 4YY3Q 3MXGA 1CK1A 2F03A 1MD2D 1H9JA 4MIUA 3FHWA 2EJGC 2B2YA 4KK7A 1U9RA 2KUMA 3HOWH 2A74C 3S1RH 3HOXH 2LMCB 1EQQA 2L15A 2VQFL 4IPCA 3FPPA 3I4LA 2IHFA 2KHSA 2E76C 1TKWB 3TBIB 3ICEA 1H9KA 1LLRD 3NBHA 1JR0D 3I55A 4LF5Q 1JE4A 5HGTA 2LXKA 1HPCA 1IBLL 4AQYL 3W1BA 4WORA 4XQJA 3K0XA 4GLAC 5ELCA 4HSPA 5ELDA 3S1QB 1DZ1A 3CMAA 2QDLA 1TR5A 2L9HA 3GTLH 1EY5A 4G7HC 4C3JB 4F88A 4BBSH 1GOZA 4IQZA 2PW7A 1IKMA 3W1GA 3S1MB 1ML0D 2C9OA 4OEMB 1Q8KA 2IW3A 4LF7L 3MFGA 1I5FA 1U4MA 5IYCG 2F4IA 1XYIA 1H9RA 4K8IA 3H3VI 1CSQA 4LFBQ 4B3TQ 2CW0D 1ASYA 3P20A 1QWYA 3E0JA 3SK6A 3EVQA 1NR2A 3JAMi 3U58A 3E5SA 1K9RA 5C5LA 1VQMA 1XXGA 4A3BG 2HCCA 2P5ZX 3HOUH 3X3MA 3SK8A 1HTLD 3E3XA 4A3DB 2UUBQ 4HR7B 5G3LD 1K8OA 2ZTDA 4M1UB 4EQOA 2JMFA 5LHY1 4OO1I 4LF8L 1B70B 1V1PA 1SJHD 1PRTD 2F1MA 4IUTA 3F2BA 4FVMA 2QCPX 1N34L 4ZK9B 4ID6A 1EQTA 4XQQA 2NVTH 3T1YL 3TREA 1EY4A 2JA5G 1ET9A 1PXUA 3A56A 1JMCA 2RCFA 2M00A 3MEFA 4OGQC 4A3FB 2R92B 4LF5L 4UPAA 2UXBL 1RL2A 1QVGA 4DAPA 1X65A 3D6CA 2AWOA 2XVSA 4IURA 1SNMA 2YTVA 4FXGC 3BJUA 4X3SA 5HGQA 3K57A 3S1NB 3S1QH 4XXEA 4B3ML 3R93A 1IBLQ 3S24A 1G51A 5A2QE 1U4RA 3GTGH 4QCLA 4TSSA 4YY3L 2WAEA 1E22A 4G7ZC 1NCVA 5LMNQ 3DUZA 1GD7A 2SNSA 4GKJL 3I90A 2JEAI 3EA6A 3M7GA 1QOHA 1HA5A 2F0QA 1IZ6A 1W2BA 5M5YH 3FEWX 4DR1L 4EGVA 3S1RB 3OIPA 2PCFB 4R8IA 3T1YQ 2R7ZG 4JK1C 1V9PA 3CP0A 3M9BA 4FDBA 5IYCH 4LFBL 4DV7Q 2EYFA 1UAPA 1VQPA 3UDFA 2K5VA 1PV4A 5DAUA 1LTLA 1A3UA 1OO9B 1BKBA 1PDQA 4N9TA 1ZYRC 2VXWA 5KRUA 1R9TB 4LFCL 1AFPA 2EYJA 4B3TL 1EIHA 5F2DA 4GOPB 4CJ2C 2A19A 4NXML 3NTKA 4KY5A 2B2UA 2F0JA 3A8IE 2WP8J 4EQNA 3UDIA 3MWYW 1F9PA 1NMGA 2WAQE 3RD4A 2SNMA 4IUUA 1PZJD 1WI5A 1PINA 4Z9CB 4K8JA 2XP7A 2Y8NB 1EY9A 3D4RA 3PQHA 1BOSA 1XTDA 1OXSC 3K8AA 1OXXK 1LO5D 1MSGA 3JAML 4A3CH 3KF6A 1HUNA 2MFIA 1DM0B 2WAQG 4ME3A 1F2ZA 4LUZA 3PGZA 1RODA 4FP5D 2NTTA 2QEJC 3S14H 4C3IG 4DXGA 4H02A 3IL8A 3K6OA 1RIPA 3FKIG 4LWCA 4R4TA 1CHPD 2E2JB 2NVXB 2A73B 2F4VL 4C1NI 1UWVA 3H91A 1ENFA 1R4QB 1EZ6A 2ZJRA 5C6AA 2I0QA 2XWJB 2K04A 1JJGA 1EIGA 4NMZA 4CJ1B 2N78A 1ESRA 2WIIB 4JI1Q 3RZOH 3L4HA 2QILA 4ZUJA 2A8VA 1YJWA 3H15A 1LTTD 2BH8A 3NSWA 3DM3A 4YCVA 3HRZC 1HHVA 4ULLA 3DEOA 1PYWD 4JI2L 4DR6Q 1F9SA 4Q0FA 1KD1C 2G9DA 1GVPA 2DUDA 4WRDA 3EQLC 2YSIA 1YNXA 2XGTA 3MC0B 4DUZL 4DFAA 1TWGB 3AMUA 4ZKCB 2NN6H 1A62A 5ELOA 2AWNA 1RTNA 1L0WA 5CV6A 5JEAH 1IBKQ 1Q86C 4IOCA 1B2TA 2BA1A 3Q23A 1YBYA 1HCZA 2Y0SG 1S3OA 1VCIA 4DXFA 2JA5H 4L5SA 2PI2E 3FKIB 2R6GA 4OWTB 5M9OA 2EVBA 2XRSD 3Q22A 1JOOA 3MXNA 2A6HD 1PH6A 3SVMA 2ZQTA 4DV7L 4YIJA 5C3EB 3NBHB 2VZAA 1CFMA 1D7QA 4LFAL 5IWAL 1WTXA 5C3EH 2PNHA 2NWGA 1Q46A 4GKKQ 1X54A 2PO4A 4K5XA 5JJLA 4A93H 1NR4A 3GV3A 1IL2A 2XP8A 4B3RQ 4QIWB 4FF3A 2KOLA 4NPSA 2EQSA 1JMQA 4I65A 1LT3D 4BS9A 3W3AA 3S16H 2B2UC 4J6HA 2R7FA 3KAGA 4KY7A 4TVAB 3CAMA 4NXNL 4WJ3M 2DNEA 2RKSA 4XT3B 1GHKA 1Y8NB 3I4OA 1NE3A 3R2IA 1F8AB 2IT1A 1I4XA 1PTOD 4QUCA 1LT4D 1S5ED 4RKBA 4DV6Q 2VQFQ 1BO0A 1SR3A 2O5IC 3OW2A 5M5WB 1SNDA 2YTXA 4G4KA 1U0LA 4QIBA 1PH9A 4A3JH 1QUQA 2WKCA 4KKSA 2HIVA 2QKIC 1PH7A 2GN5A 1Q1BA 3MVVA 4YHHL 1Z7TA 1Q3LA 2B3GA 2WKDA 3MHBA 1Q1EA 1PFMA 1PYSB 2EDGA 1NBWA 3G6JB 2Q8IB 1TR8A 3FP9A 4DV4Q 3QIAA 4XYQA 2JV4A 4R4OA 1SNQA 4BY7H 1HXYD 1I4PA 4XIGS 4A3MH 1KNAA 2F0SA 4DR7Q 2PI2A 2ZQVA 1BXTA 3BDCA 3PIP3 1CTMA 1KIXA 4X65Q 1QILA 1PH2A 1TS4A 2I5MX 3TMEA 3M85A 1S4ZA 3TC5A 1YNND 1QB5D 2K75A 3P75A 1ENCA 3AYHB 1SNPA 4DUYQ 4KHPL 2B2VA 2NZHA 3MXPA 1SE2A 4DV3Q 4RG1A 2E2IB 1WD1A 3LE4A 1G6ZA 1Y14B 5CQ2A 1CSPA 2AUKA 1SYFA 1SYGA 1EYGA 1SYCA 4A3FG 2DK7A 1EYCA 2J0TD 2F3IA 3KLWA 3Q6SA 1X3EA 5GAHC 4ZKBB 2R3ZA 4O0AA 2PZTA 4ZRZA 4DV0Q 3C3LA 1PH1A 4JI0Q 3WOFA 3L9AX 4KN7C 3H09A 4A3KH 2R7ZB 1EY0A 1D8LA 2ZXPA 2KA7A 3M7NA 2WACA 1E7ZA 5EAYA 4P73A 2Q2UA 3FMCA 4KY6A 2XPBA 4UDUC 1X55A 1A8VA 3M4PA 2D0PA 1BBWA 2Z6KA 3LNNA 3SEBA 4X64L 1H9MA 1OXVA 2X69A 1DONA 3F2CA 1XWEA 2L1BA 1HNWL 3I2ZA 1ENAA 3J80L 1P16A 4A3BB 3UE1A 3HZXA 1CKNB 1WD0A 1PA6A 2JA6H 1IBMQ 3H6MA 3PUYA 2K6AA 3D0FA 4BBRB 2JXWA 1EWHA 4I7ZC 4IJHA 4DAYA 1WTQA 2PYKA 4Y52H 3MXUA 1XMOL 4RHRA 2QDBA 2PZUA 1C48A 4CBVA 4BY1H 2F0DA 3EROA 2RSOA 3UI2A 3VA5A 1XNRQ 5J22A 1DOMA 5KNCA 1NMVA 4GZYC 2R7DA 2YU9B 1STAA 3GD7A 3JC66 4KHPQ 4HAEA 2K03A 1SMYD 2VUMB 2E75C 4DV2Q 2L0CA 3I4MB 1STBA 3J80c 2LFNA 2EZ5W 1XPUA 4ILWA 1HQMC 3MZ5A 1XNRL 1YNJC 2IPKD 4KHVA 4A3GG 3I72A 4F87A 3WOEA 1KDCA 4H0LC 1LTGD 4P72A 1TVXA 2KENA 1T9HA 1XMQQ 5C3XA 2NVQB 5IGDA 4G57A 5JJIA 3CCQA 2K5HA 3DEPA 3TP7A 2Z6KC 3FPUB 2MGSA 3PO3H 3MQGA 3D8GA 1CKMA 3WWVA 1N32Q 1NTGA 2VS1A 4JYAQ 3RR5A 2A68C 1CUKA 2EOTA 3D31A 1B53A 5FK9C 4JPBW 2KCNA 3ZJYC 2RDFA 1HR0Q 2VUMH 2AHOB 4TKOB 4UP9A 4RA8A 3FDTA 2ZJQA 2B2TC 3H0GG 5IT9E 3TP6A 4ALPA 3IKJA 1MGSA 1KL9A 3J81i 1QZHA 2E2IH 1DXMA 1WCMG 5EGTA 4E5RA 4NXNQ 1JCKB 4JI7L 4DV0L 2MUYA 3A5UA 4K2KA 1LUZA 5JJKA 3M3YH 2CHBD 3HOZH 1SJED 3DM1A 2H1EA 2QRVA 5ELEA 5HURA 4A3JG 3CCJA 1HZAA 5CBEE 3RZOB 1I4GA 1CI3M 1N33Q 5NUCA 5C4JB 1EY7A 3GDEA 4PV1C 3CC4A 3PIPA 1EZ8A 1LM0A 2F0IA 2VW9A 1PH5A 3S1MH 1CQVA 3TCZA 4XTCS 5GAEC 5IE8A 3OSOA 1LTAD 1UE1A 3WH0A 1EIFA 3RLNA 1X6OA 5IGFA 2ES2A 4RKLA 4ZLTF 4OX9Q 2GVBA 1STEA 2FMCA 3VR6A 3K5OA 5BN4A 2N8NA 4DV1L 2HT1A 2RQXA 1TU2B 5IY0A 3BS1A 1FR3A 4A3MB 1I6VC 3GTQH 4KV6A 2XWBB 2F0FA 2B63B 4PG3A 2X6LA 5GQOA 4YHHQ 4IZ8A 3DMUA 4Y7NH 4DNIA 1E24A 4JG2A 1HZBA 1M1KC 3CCUA 2EYPA 1BQQT 1FD7D 2CW0C 5LMUL 1U4PA 1KRTA 5E4WC 2QGQA 1A2TA 1V1OA 2ID0A 3KBXA 2ENBA 4N8FA 4HIKA 1E1TA 1VQIA 2A5HA 2YTYA 2PMZE 2YAJB 3RNUA 4BA1I 3HP3A 5IP7H 2LXJA 5K36H 2XP5A 1RP5A 3FVQA 2NYZD 2TSSA 4NW2A 1RF2D 4M8AA 3CNGA 4X3TA 2KJXA 4CKEA 1Y1VG 2F4VQ 2HHHL 2JA6G 2A68D 3GTOH 2L11A 2BCOA 2BOSA 4RHSA 2Q8RE 3PSIA 1ICFB 3GTKB 5M3FH 3TN2A 1LTSD 1JWMD 2EZVA 3PO2H 3VYTA 5IT9c 2BDOA 4GLVB 1WCMH 1UEBA 2J4XA 2B2TA 3CW2C 3RLFA 3NP8A 1YI2A 1K8AC 3S15B 4K5VA 1YHAA 5FO8B 3CPWA 5EPKA 1Q12A 3PUWA 3RZDB 1BCPB 1FNWA 4X64Q 5M3MG 2QA4A 1E2ZA 1BR9A 1IXRA 1ILQA 1SYDA 4L63B 1HR0L 3OTOL 4FXDA 2B8FA 2LY7A 4F8MA 5HY6A 3D4DA 1VQGA 3RN2A 4PZ6A 3DWQA 3U4ZA 4BY1B 2K14A 3PMFA 2FINB 5K5PA 4DR2Q 1ZCNA 4IUNA 4JOIC 2JA8B 2OCEA 5C44B 1UNSA 1SYBA 1RCVD 2K05A 4DGZA 3K5MA 1SROA 5E4XA 1O7IA 4L8JA 4K6LA 3NHHA 4FF4A 2D0OA 4C3IH 4HMJA 5KNDA 3CXCA 4O2DA 4K0KL 2OT2A 1AE2A 3RZDH 4IN3A 1EY6A 3T1HL 3VR5A 3S2DH 5J39A 1C9OA 4A3DH 3KAHA 4R4QA 1W6KA 3OWEB 1NJIC 4C3JH 4BBSB 1J9OA 1QVCA 3CQZB 2N49A 2UUCL 2WINB 5LMNL 1F2MA 4CKCA 3NPPA 5E62A 3FSCA 2F0WA 1Y1VB 4MHEA 3VDYA 4JI3Q 3I7FA 3HFZB 3PUZA 1QNKA 2KHJA 2F0VA 1C0AA 4REXA 5C4HA 1TXYA 1Q8IA 1SYEA 2K50A 4OIJA 4MTKA 1OXUA 1VQ8A 1EYAA 3A5ZB 3TZUA 4QGUA 3U50C 4TQUS 1HNWQ 1TS3A 3PO2G 4DU9A 1HZ9A 2JA7B 4POFA 4OONA 4LAAA 3HOUB 1L0XB 1B3AA 2E2DC 1NNXA 3DHQA 4GN4B 4KJNA 4C3HB 2B2WC 4HJ5A 3J80E 4RGNA 5JPMC 1KABA 5C0XJ 5IP9H 1YHBA 4A93G 2WFWA 5DLQE 1YHQA 4JI4Q 3CCSA 3F2UA 3DWAA 4LFCQ 5ISRA 3E9HA 2K5WA 3TEHB 2EXDA 4CHTB 4C56C 3ND8A 5E3FA 4XDXA 3R2TA 2B2YC 2B63G 1SDFA 5ELFA 4B3RL 2O4XA 3SK5A 1DJRD 1PMRA 4A3MG 4I7AA 1XNQQ 4A3FH 2PMZB 2UUBL 1FGUA 1K83B 4GOPC 2O2LD 2ZT9C 4DV3L 1FLCA 1PTOH 2R93B 4DUYL 5JAVA 4DV4L 2JA5B 2R93H 4YCUA 1I50B 3C1FA 1GM5A 3UDXA 3L3OC 1AZQA 2MQHA 4N8X1 5DNFA 1PFSA 3PF5A 1KHIA 1XPRA 2Z8LA 4LJZC 1O78A 3LX0A 3VR2A 3FSBA 1EEID 4A3DG 3NQIA 4IJLA 1PRTF 5A35A 3BZCA 4A3JB 4QF4A 5C4ZA 1LTID 1TIID 3CCVA 1I6HB 1GHJA 1U4LA 2ITKA 4RH6A 4A93B 5AJ3Q 3UE0A 5IGEA 1STNA 4ZAIA 2WADA 1U5KA 1WOCA 3RLOA 4HJ8A 1VF5C 4X62Q 3KABA 5E7NA 1A3TA 4BY7G 1A0IA 1M8AA 1MI2A 2JA9A 3ERQA 3QR8A 4JI1L 1AH9A 5D65A 1D1KA 4RGTA 5E66A 4N9PA 3KJPA 4ZUIA 1W3SA 3MTSA 3T16A 3U4VA 3AQQA 3NUCA 3ULJA 4A3KG 1K0RA 3OWFA 4LF9L 1LTRD 1IBML 3NBIA 4DAVA 1MBYA 2OF1A 2CCZA 2K5QA 1N36Q 3QG1A 4B9WA 1SN8A 2ZR6A 3PUVA 2UUAQ 2ZTEA 5DM63 1GUWA 3T53B 2JQOA 4KKUA 2R92H 2HDLA 3KDFB 3HS0C 3DWPA 3E9IA 3ER0A 1B1ZA 1F9QA 3MFYA 1ZEQX 2F0GA 2F21A 1GKHA 4HIMA 2YSGA 4A3KB 1BCPF 5BN3A 4DKAC 1MIUA 4BXXG 1G291 5EBCA 2YV5A 1A2UA 2J7ZA 1ICWA 2VUMG 2ZR5A 1N32L 2Z0SA 5D14A 3LKXA 1Z6HA 2M2LA 3KBGA 5C0XG 4XT1B 1L0YB 2D62A 3G48A 3OOCA 4NB3A 1MSHA 2PQAA 3R8BA 1VDZA 2Z4IA 1FL0A 5FLMG 4POGA 1OTCA 1S5CD 4QJFA 2EYLA 1D1IA 4XQNA 4U68A 1IBKL 4QQBX 2F0TA 2F52A 2KCMA 4K2LA 4CJ0B 4OIKA 3HKZE 4BY1G 3JAME 4AQYQ 3K5LA 2OTLA 3S2HH 5D3DA 2PW5A 3KOJA 4OWWB 5E1FA 4KMUC 2DJGC 4UP8A 1K28A 4LUOA 1XTCD 1SLJA 3GO5A 3V05A 3RMHA 1STYA 1IKLA 1STHA 2UUAL 3CKIB 1LYLA 3S17B 1WTPA 3T56B 3CQZH 2A1AA 5CGKA 5M3MB 4DR7L 2JK8A 2JA7G 1FYCA 1VQFA 4RGMA 3PO2B 1Q90A 1HQRD 4R9WA 3TDBA 2K1BA 5DM73 2ZXOA 4KTAA 1VQ5A 5M5WH 4C2MB 5LMNW 5J1ZA 3F8TA 4FF1A 1S72A 5I4DA 3NQTA 1D6EC 3ZYYX 4A3EB 2JYOA 4HSVA 1EFID 1L1OA 1DCZA 4FXKC 2VQEQ 4IOAA 3P1HA 4YWKA 1MKHA 4XYOA 1BF4A 2XIWA 5H1SE 3VYRA 2UXBQ 3HOVH 5FJ8G 3M4OH 1VQDA 1D5ZC 2RCNA 4FNFA 3QOJA 5AJ3L 1Y8PB 2V1CC 5C4JH 2DMVA 4IFDI 2FHTA 2VNUD 3BU2A 2AMCB 4OL7A 4AYBE 1MJCA 1Y69U 2DJFC 3W2DA 1K8GA 3TZDA 1VQCA 3ITPA 1Y1WG 3P7JA 2B2VC 3TS2A 1WJJA 3K80C 5IOCA 3J7AF 3QB3A 3KF8B 3X3NA 1TQOA 4DK3C 3A74A 4H13C 4CDCC 3KADA 2E2HB 2M9VA 2YSHA 1A15A 1JB7A 4DF7A 3PIOA 2MDIA 4QIWE 3D4WA 4OWXB 3I3CA 4JI8Q 4EQ5A 5GROA 3IRBA 2AQ3B 2F0MA 1QZGA 1VQKA 1JWUD 2D9UA 4L5QA 3U9SA 4LW1A 2QF7A 5I6YA 4WJ4A 3S16B 5AFWA 1I50H 2BA0A 2OQKA 1EOTA 2CH4W 3QO2A 4DR5L 4X65L 1S5FD 1EL0A 1T5XD 1AZPA 3C2PA 5JPNC 2ZQSA 1KDBA 1E2VA 5IYBH 4KLKA 4BWGB 4LF9Q 2JE6I 2IHEA 4X66L 4K14A 3CCMA 4OO1H 3KYHC 1EG4A 1JOQA 2KXQA 1JJ2A 3IAYA 3FRPB 3PUXA 2L4NA 4LF7Q 1V1PB 5C4XB 2CWPA 4DV6L 4J15A 2G5DA 3KLSA 1LV9A 2VB2X 5FJ8H 3J80i 1EWCA 5I9PA 5C44G 3V96A 4UY8C 1HNZL 3S1NH 4RGOS 2O5JC 3VR3A 1QG7A 1IYVA 5CC4A 4PZ7A 4C1NK 1LABA 4JI3L 5C3EG 1HNZQ 2ZAJA 3ULPA 5JEAJ 1EUJA 1EQVA 5FLXc 1YEZA 4IUPA 1TK7A 3PO3G 2XP6A 4X6AH 4HTHA 2EY1A 1FJGQ 1KNEA 2VQEL 2K52A 1G2SA 4HIOA 4AYBB 2ASBA 3NTIA 4DAYB 4RFBA 1UE6A 5FLXE 5M3FG 1PTOB 1YZ6A 3KCEA 1IL8A 1PZKD 4F7XA 4DR3Q 2EY5A 2IL8A 1N34Q 4ZCKA 1PZID 1K9QA 2XP3A 3CPFA 3CCLA 1YW5A 1TY2A 5JOBA 1SE4A 2K01A 5CR3A 2RBMA 2K33A 4A3IG 1JC7A 2K5NA 3I4MG 1TWCB 2PZWA 5CV9A 3URYA 4QY7A 2M8JA 2GVAA 2OQ0A 3G6EA 2QEXA 3BZKA 2AKWB 3G4SA 3GTMH 3HOYG 2A6EC 2JSOA 2RSNA 5ELNA 2EY6A 5AHTA 4A3CG 2UXCL 3FS8A 1D2BA 3MA2B 2M3OW 1BNZA 5IIFA 3MXNB 2C5CA 2JP1A 3PQIA 1CKOA 2ALYB 4APVA 1JB3A 4BBRG 1UUPA 3OMGA 4AIMA 2G9HD 4P75A 4LMQD 1PH8A 4JI6L 3HOVG 4DR4Q 1E1OA 4CKBA 3SXHA 1WTRA 2CVRA 1HA6A 1WCMB 5FKAC 1J6QA 1JOKA 2K4KA 1VQAA 4DR1Q 5EBDA 3T51B 3NK9A 3NWTA 1IYJB 3GTPH 2C35B 2ICEC 1YIJA 4A3EH 3NTPA 1HRJA 4TRDA 4O1NA 1VQ6A 4GKJQ 2JXMB 5IP9G 4CGYB 1PFBA 1O7YA 3FKIH 3HGBA 2L4JA 1EFWA 1Q81C 1BUVT 1LACA 2K7VA 3QOLA 4B3MQ 5KYIA 3VYUA 2F0NA 2KBNA 4MN3A 3EFXD 2EY2A 3CCRA 2RE3A 1ET6A 3BYTB 1EIYB 4A0TA 4OXPA 2F0KA 3TSSA 1EWIA 4LF6Q 2IX1A 1H9SB 1NAPA 1VQJA 2DN8A 3JAMc 2UXDQ 1O6WA 1A63A 1V8QA 5I2YA 3KAFA 1TWCH 1SMXA 1Y1VH 4DR2L 2OWOA 3CRLC 2IX3A 2WB1B 4NXMQ 1Z9FA 2NVYB 3D6WA 1JE5A 1WYDA 2A6HC 5CV4A 1C8CA 2XP9A 3ONAB 4ME5A 4KN4C 3GV6A 1PH4A 2DY8A 3H0GB 3KLSX 1PLFA 2Q2HA 3CCEA 2VB3X 3AB9A 3G71A 4HCEA 1SAPA 2HIXA 1HTPA 4IUQA 4CDDC 5C3WA 5BR8Q 3ERSX 4HCSA 4KKTA 4FYDA 1EEFD 3J81E 4K6DA 2SEBD 1DYQA 3HOXB 2L5TA 1HH2P 1VQOA 4PZ8A 2ZJPA 3N52A 1S40A 1RD9D 2YSBA 5EKLA 2JEBI 4X62L 4LNQA 4A3GB 3HOYB 4V0BA 3GTQB 4DNRB 4UHVA 1O7ZA 2F0OA 3RUZA 4JI5L 3C1EA 5FO7B 3J7YW 4GNXA 4JOIA 5GADC 5JJZA 3KFUA 1VMCA 1QCBD 1ONLA 1WTWA 1VF7A 4ZYSA 1X3PA 1RHPA 2HDMA 4H7BA 3SE0A 1FNVA 4PMWA 5BN5A 3EN2A 4HMIA 1EOVA 2KEDA 2JJQA 1F77A 4A76A 1O80A 5I9OA 1KQSA 4IO9A 1RKNA 1R9TH 1MJEA 1I4HA 2HQLA 1NUCA 1SEBD 3HOWB 1VQEA 1PVOA 1XX8A 3KF8A 4JYAL 1X3QA 1WVLA 3Q8DA 4IPHA 1ZXTA 4MZ9A 1X32A 3T4AC 2EJMA 3T1HQ 1DOKA 4X66Q 4IPGA 1SSOA 1Q7YC 4K5WA 4JBMA 1CT1D 1E2WA 4LK1C 4AYBG 4DV1Q 3NE5B 4IUVA 2Y0SB 1LT5D 4C3HH 1HJPA 2E5LQ 3A8JE 4Y7NB 3I73A 4DR5Q 2LKVA 1NSNS 3M4QA 2DK1A 4O42A 4UAIA 4JV5Q 1J5EL 1SE3A 1PTOF 1P8LA 2WB1G 3KDFA 4Q5VA 2B29A 2MNAA 4R8NA 4JI4L 4J1MA 1PH3A 2E2HH 1IW7D 1AP0A 3KJOA 3TQYA 1I6HH 1CZGA 4DA2A 2MHVA 4LF4L 4H44C 1VS0A 1JWSD 5I2XA 2R61A 1D5XC 3QJYA 4GS3A 3OTOQ 2B2WA 2OTJA 2LSSA 4E6IA 2F3VA 2PQEA 1K3BC 3KF6B 4FF2A
chains in the Genus database with same CATH topology
3I56A 1CA6A 1I94L 1JT8A 3J81c 5IGCA 3OYYA 2B63H 3H94A 4B3SL 1D5MC 2OXPA 2CKZB 5CV8A 2I5HA 3W5OA 4DV5L 4AH6A 3VA7A 3I8ZA 1L1OC 4U84A 3H3VH 5M3FB 1AW7A 4HEDA 2E8GA 1K9MC 4R4CA 4U86A 2EYOA 1VMPA 5KNBA 3A7AB 4C2MH 2A6ED 1CA5A 2ZM6Q 2NBFA 1CZWA 4PQXA 1V1QA 4JCVE 2FFKB 4DV5Q 2DJYA 2IWHA 5FLMH 2B8GA 4FO2A 2NN6G 3DLLA 3NWSA 2WAQB 3LKXB 5J3BA 3OMCA 4MTNA 3HOVB 3M4OB 3SHLA 4YCWA 5JEAG 5FOBB 3TRZA 3GTJB 2ICIA 4GOPA 2WV6D 1X56A 1C4QA 2N3SA 3SK4A 2MPMA 1VQ7A 2XP4A 2F0EA 1YJNA 3TP5A 5T1GA 4NP5A 2HHHQ 5C4XG 1EU4A 4X3KA 2F0UA 3MEHA 1KTKA 4DAMA 5EPLA 2H4OA 5LMUQ 4KJOA 1B9NA 2K5DA 1HZCA 1II3A 3E0EA 1KLGD 2RVLA 3K5NA 3IFTA 3A54A 2NTSA 4IFDH 1HNXL 2Y0SE 2E2JH 2BE5C 2NN6I 2NVYH 1GUGA 4LUVA 1NY4A 4P71A 2RHQB 5I6WA 5CMDA 2EIFA 4U85A 1DD2A 2KCCA 2I46A 4IFDJ 3CC2A 1HFGA 4HJAA 4OX9L 4A75A 3BVGA 1FNUA 1TWFH 2B39A 3IFDA 5TSSA 3VR4A 2ZM6L 1C7YA 3M4YA 3A7LA 1SFOH 5FLXL 1A6XA 1TWGH 5C0XI 1ZYRD 3K0YA 1RDPD 4BXXH 2LAJA 2DNCA 2DY7A 3BG3A 4GNXB 3I70A 2NVTB 1N33L 3NTHA 4C3IB 1KDAA 2FMMA 2NZOA 4A3LG 1M4VA 1I4RA 1N36L 1E3PA 3L2PA 1EY8A 2HQEA 2UU9L 4B3SQ 5IYBG 2K32A 1G91A 1B9MA 3J7ZC 3HOWG 2M8IA 3OHXC 2OEOA 4HJ9A 2ZTCA 3LGJA 3S17H 3K7AH 5E5WA 1UEAB 2FXQA 1F2LA 3OW7A 4KD4A 2CQAA 5KEEA 3MCBB 4WJWA 3BZDB 3AFPA 2Z4HA 1J5EQ 4JBJA 2F0HA 3G7LA 2A69D 1SFOB 4V190 1XPOA 5ELBA 4QUFA 4UP7A 3CU7A 4MNOA 1H9SA 1ZKOA 3A8KE 3I4NH 3NENA 4OO1G 3AU7A 1TWHH 3DXJC 3KLRA 3BDOA 5FO9B 3CC7A 3MCBA 2I07B 4X3UA 4RAUC 2AUJD 5C5MA 3HOXG 2L55A 4KHZA 5CBAE 1HFNA 1VQLA 4RCOA 2EYMA 2KCTA 2YSFA 1HNXQ 2ATWA 3GTOB 1YVCA 1KLUD 3ULLA 3WDNA 4U673 2JX8A 4GN3B 5U47A 4L5TA 2EXZA 3NEMA 4A0UA 1S5BD 4DV2L 2YU9H 2ZQUA 2N88A 2E74C 1BBXC 4K0KQ 1CQFA 4EX5A 4LF6L 3S15H 3PIO3 1N9WA 5KGUA 4JC0A 5E64A 1F9RA 4RCNA 5IT9L 3F2DA 3TDQA 1VQHA 4S3SA 2Q2TA 4GN5A 1XNQL 3K59A 1KXLA 5CYUA 3I91A 2ZXRA 1XMOQ 5IGGA 1ILPA 3OOBA 2IX0A 2Q2IA 4GNXC 1L2FA 4EQPA 3K81C 2TMPA 3K7AB 4JI7Q 3PV0A 4IPDA 1JQYD 4ODGA 5K36G 1GUNA 2D5DA 4IALA 4PMCA 2XTIA 1JORA 5D3IB 1SNOA 2VL6A 4GKKL 1Z47A 4A3EG 1Y8OB 4DK0A 3H3VC 5BR8L 1VQ4A 2UU9Q 2YYZA 3S14B 2NVXH 4A3LH 2F0PA 2XRQD 2KHIA 3Q0AA 2RF4A 4JI0L 3HKZB 1BVSA 3S2HB 4A3GH 1TWAB 3BVZA 2MP1A 2XSCA 1TS5A 3STBD 2JA7H 2I5LX 1O7LA 1EYDA 2BH2A 1E0BA 4NKLA 2RDHA 4P2CB 3ODKA 1B44D 2E45A 2UUCQ 4R4IA 1BBUA 5DEHA 5M3MH 1GUSA 1NMFA 2CFMA 1BCPD 2R7ZH 1FGBD 3PF4A 2ZR4A 4PMBA 1KRSA 2UXDL 1PYBA 2DGYA 3D3RA 2SOBA 5C44H 2EPBA 2KEEA 1OXTA 3Q24A 3GTPB 5M5YB 1JJCB 4LF4Q 3SDZA 2R92G 1TWHB 3J7A5 2V4DA 1YJ9A 3PCOB 2NUCA 4C3JG 3L7ZC 1WMVA 1KAAA 3S2DB 3HKZG 5IYDH 1A3VA 2L12A 2SDFA 1B50A 5A2QL 3GP7A 4A3IB 2BE5D 3CHBD 1K8MA 3HG9A 4NDXA 4B9XA 1DGSA 2E5LL 1QE6A 1FJGL 2HUGA 2KVMA 1I5HW 1TWFB 5EKIA 2MO0A 3KK7A 1RTOA 1AE3A 3I4NG 4HN7A 3MQHA 1AEXA 4DK1A 1N8RC 4QB4A 2Z1CA 2KQ3A 4JI6Q 2D2CC 3HEJA 5COYA 1W6JA 3O13A 5EKKA 3E6ZX 3UDGA 5EQ0A 4DNTB 4DPGA 3AFQA 1PTOC 3F1ZA 4C3HG 3J81L 1G8ZD 3KUPA 5EJWA 1X3GA 3M3YB 3CMEA 4GLXA 1VQNA 1YNJD 3SGIA 4JBWA 4BY7B 1LTBD 3J81j 3OPOA 1AN8A 3PO3B 2XNAC 1YITA 1L1OB 1GJXA 2A69C 1LT6D 1I4QA 4J8QA 2JA8G 2RA4A 3J7AV 3GTKH 1CHQD 3A55A 1B8AA 4JV5L 3BDLA 5LL6X 5JVG3 5GAGC 1BDOA 3GQBA 1PRTC 3BYYB 3TS0A 1GUTA 1SXTA 1UE5A 5KIXA 4YWMA 3GTMB 1K83H 4R1JA 3STBC 4RWSC 2Q8TA 3GTJH 4DN4M 3N6RA 1B7YB 1YNNC 4LFAQ 2EYHA 1IYUA 1V43A 3H0GH 1PFNA 1SE8A 2BDNA 5CORA 3C46A 1T5EA 2HCIA 3ND9A 4JI8L 1STGA 5G3LF 2N55A 1SNCA 4HJ7A 1Y1WH 2RHSB 2XPAA 3U9OA 3GTGB 5KYLA 2R93G 1Q82C 1IW7C 1H95A 2VY3A 3HOZG 2MO1A 4KI0A 4DK6C 1X3FA 1GUOA 4DUZQ 1G2TA 3LWUA 1SMYC 1IHZA 3OIQA 3B6YA 1PHJA 4JI2Q 4DR6L 1CM9A 3CRKC 2IJ0A 2F0LA 2RDGA 1RJTA 1X9NA 1KC8C 4ABNA 4KD3A 3LWEA 3TP8A 1TT2A 1UE7A 1PRTB 1TS2A 4YWLA 1TWAH 4QMGA 4ZQ3A 1J8IA 1ESFA 1VQBA 2PNRC 4A3IH 1WR7A 5CV7A 1HR0W 3HOUG 1FVIA 2CWAA 5IGBA 1Y1WB 5E65A 1EU3A 1XJVA 2MJ8A 1R4PB 1GO3E 2XN9C 2JA8H 4PNYA 4EVOA 5JVH3 2CQOA 4JI5Q 5EPJA 4B08A 5IWAQ 3EBEA 3T13A 1WFQA 1QJOA 1DOLA 1VQ9A 1I3QB 3I4NB 4LF8Q 2EJFC 3R3OA 1GXDC 4QL5A 2WB1E 1KAWA 1S5DD 4A4IA 4BBRH 5IYDG 1K3RA 3L0OA 3NELA 2JA6B 5IODA 3HOZB 4BBSG 1EQRA 3BVMA 4DR4L 2GA4B 2H5XA 2NB0A 4L6TB 2PQAB 5LL6S 3K58A 1WTOA 3NXWA 3K7UC 3CF5A 3V2TA 5IP7G 1QNUA 1CKNA 1G6PA 1EG3A 3GTLB 4BA2I 4P74A 2UXCQ 5T1IA 1I94Q 1TY0A 3A0JA 1JICA 4G7OC 1QVFA 2FJ2A 2X6GA 1XMQL 2NZ1D 4A3BH 5C0XH 2LS01 4WFN3 1I3QH 1SBBB 1QUQB 1HUMA 5C4XH 1F2YA 3MAQA 2EE1A 4HIDA 3HOYH 2NVQH 4DR3L 1BCPC 3EIVA 3RN5A 4L5RC 3KAIA 2IY5B 2KECA 4RMFA 3CD6A 2AQ2B 2F3WA 3VYSA 1B4OA 3HKSA 4IFDG 1M90C 4OHJA 3AEVA 2DWVA 3S9WA 2Q5AA 2AQ1B 3QWNA 1WTVA 3EJIA 2K28A 5M5XB 2PPBC 5M5XH 4JBKA 5CV5A 1ASZA 1SRUA 1K73C 3I4MH 4YY3Q 3MXGA 1CK1A 2F03A 1MD2D 1H9JA 4MIUA 3FHWA 2EJGC 2B2YA 4KK7A 1U9RA 2KUMA 3HOWH 2A74C 3S1RH 3HOXH 2LMCB 1EQQA 2L15A 2VQFL 4IPCA 3FPPA 3I4LA 2IHFA 2KHSA 2E76C 1TKWB 3TBIB 3ICEA 1H9KA 1LLRD 3NBHA 1JR0D 3I55A 4LF5Q 1JE4A 5HGTA 2LXKA 1HPCA 1IBLL 4AQYL 3W1BA 4WORA 4XQJA 5ELCA 3K0XA 4GLAC 4HSPA 5ELDA 3S1QB 1DZ1A 3CMAA 1TR5A 2L9HA 3GTLH 1EY5A 4G7HC 4C3JB 4F88A 4BBSH 1GOZA 4IQZA 2PW7A 1IKMA 3W1GA 3S1MB 1ML0D 2C9OA 1Q8KA 2IW3A 4LF7L 3MFGA 1I5FA 1U4MA 5IYCG 2F4IA 1XYIA 1H9RA 4K8IA 3H3VI 1CSQA 4LFBQ 4B3TQ 2CW0D 1ASYA 3P20A 1QWYA 3E0JA 3SK6A 3EVQA 1NR2A 3JAMi 3U58A 3E5SA 1K9RA 5C5LA 1VQMA 1XXGA 4A3BG 2HCCA 3HOUH 3X3MA 3SK8A 1HTLD 4A3DB 2UUBQ 4HR7B 5G3LD 1K8OA 2ZTDA 4M1UB 4EQOA 2JMFA 5LHY1 4OO1I 4LF8L 1V1PA 1B70B 1SJHD 1PRTD 2F1MA 4IUTA 3F2BA 4FVMA 2QCPX 1N34L 4ZK9B 4ID6A 1EQTA 4XQQA 2NVTH 3T1YL 3TREA 1EY4A 2JA5G 1ET9A 1PXUA 3A56A 1JMCA 2M00A 3MEFA 4OGQC 4A3FB 2R92B 4LF5L 4UPAA 2UXBL 1RL2A 1QVGA 4DAPA 1X65A 3D6CA 2AWOA 2XVSA 4IURA 1SNMA 2YTVA 4FXGC 3BJUA 4X3SA 5HGQA 3K57A 3S1NB 3S1QH 4XXEA 4B3ML 3R93A 1IBLQ 3S24A 1G51A 5A2QE 1U4RA 4QCLA 3GTGH 4TSSA 4YY3L 2WAEA 4G7ZC 1E22A 1NCVA 5LMNQ 3DUZA 1GD7A 2SNSA 4GKJL 3I90A 2JEAI 3EA6A 3M7GA 1QOHA 1HA5A 2F0QA 1IZ6A 1W2BA 5M5YH 3FEWX 4DR1L 4EGVA 3S1RB 3OIPA 2PCFB 4R8IA 3T1YQ 2R7ZG 4JK1C 1V9PA 3CP0A 3M9BA 4FDBA 5IYCH 4LFBL 4DV7Q 2EYFA 1UAPA 1VQPA 3UDFA 2K5VA 1PV4A 5DAUA 1LTLA 1A3UA 1OO9B 1BKBA 1PDQA 4N9TA 1ZYRC 2VXWA 5KRUA 1R9TB 4LFCL 1AFPA 2EYJA 1EIHA 4B3TL 5F2DA 4GOPB 4CJ2C 2A19A 4NXML 3NTKA 4KY5A 2B2UA 2F0JA 3A8IE 2WP8J 4EQNA 3UDIA 3MWYW 1F9PA 1NMGA 2WAQE 3RD4A 2SNMA 4IUUA 1PZJD 1WI5A 1PINA 4Z9CB 4K8JA 2XP7A 2Y8NB 1EY9A 3D4RA 3PQHA 1BOSA 1XTDA 1OXSC 3K8AA 1OXXK 1LO5D 1MSGA 3JAML 4A3CH 3KF6A 1HUNA 2MFIA 1DM0B 2WAQG 4ME3A 1F2ZA 4LUZA 3PGZA 1RODA 4FP5D 2NTTA 2QEJC 3S14H 4C3IG 4DXGA 4H02A 3IL8A 3K6OA 1RIPA 3FKIG 4LWCA 2E2JB 1CHPD 4R4TA 2NVXB 2A73B 2F4VL 4C1NI 1UWVA 3H91A 1ENFA 1R4QB 1EZ6A 2ZJRA 5C6AA 2I0QA 2XWJB 2K04A 1JJGA 1EIGA 4NMZA 4CJ1B 2N78A 1ESRA 2WIIB 4JI1Q 3RZOH 3L4HA 2QILA 4ZUJA 2A8VA 1YJWA 3H15A 1LTTD 2BH8A 3NSWA 3DM3A 4YCVA 3HRZC 1HHVA 4ULLA 3DEOA 1PYWD 4JI2L 4DR6Q 1F9SA 4Q0FA 1KD1C 2G9DA 1GVPA 2DUDA 4WRDA 3EQLC 2YSIA 1YNXA 2XGTA 3MC0B 4DUZL 4DFAA 1TWGB 3AMUA 4ZKCB 2NN6H 1A62A 5ELOA 2AWNA 1RTNA 1L0WA 5CV6A 5JEAH 1IBKQ 1Q86C 4IOCA 1B2TA 2BA1A 3Q23A 1YBYA 1HCZA 2Y0SG 1VCIA 4DXFA 1S3OA 2JA5H 4L5SA 2PI2E 3FKIB 2R6GA 4OWTB 5M9OA 2EVBA 2XRSD 3Q22A 1JOOA 3MXNA 2A6HD 1PH6A 3SVMA 2ZQTA 4DV7L 4YIJA 5C3EB 3NBHB 2VZAA 1CFMA 1D7QA 4LFAL 5IWAL 1WTXA 5C3EH 2PNHA 2NWGA 1Q46A 4GKKQ 1X54A 2PO4A 4K5XA 5JJLA 4A93H 1NR4A 3GV3A 1IL2A 2XP8A 4B3RQ 4QIWB 4FF3A 2KOLA 4NPSA 2EQSA 1JMQA 4I65A 1LT3D 4BS9A 3W3AA 3S16H 2B2UC 4J6HA 2R7FA 3KAGA 4KY7A 4TVAB 3CAMA 4NXNL 4WJ3M 2DNEA 2RKSA 4XT3B 1GHKA 1Y8NB 3I4OA 3R2IA 1NE3A 1F8AB 2IT1A 1I4XA 1PTOD 4QUCA 1LT4D 1S5ED 4RKBA 4DV6Q 2VQFQ 1BO0A 2O5IC 1SR3A 3OW2A 5M5WB 1SNDA 2YTXA 4G4KA 1U0LA 4QIBA 1PH9A 4A3JH 1QUQA 2WKCA 4KKSA 2QKIC 2HIVA 1PH7A 2GN5A 1Q1BA 3MVVA 4YHHL 1Z7TA 1Q3LA 2B3GA 2WKDA 3MHBA 1Q1EA 1PFMA 1PYSB 2EDGA 1NBWA 3G6JB 2Q8IB 1TR8A 3FP9A 4DV4Q 3QIAA 4XYQA 2JV4A 4R4OA 1SNQA 4BY7H 1HXYD 1I4PA 4XIGS 4A3MH 1KNAA 2F0SA 4DR7Q 2PI2A 2ZQVA 1BXTA 3BDCA 3PIP3 1CTMA 1KIXA 4X65Q 1QILA 1PH2A 1TS4A 3TMEA 2I5MX 3M85A 1S4ZA 3TC5A 1YNND 1QB5D 2K75A 3P75A 1ENCA 3AYHB 1SNPA 4DUYQ 4KHPL 2B2VA 2NZHA 3MXPA 1SE2A 4DV3Q 4RG1A 2E2IB 1WD1A 3LE4A 1G6ZA 1Y14B 5CQ2A 1CSPA 2AUKA 1SYFA 1SYGA 1EYGA 1SYCA 4A3FG 2DK7A 1EYCA 2J0TD 3Q6SA 2F3IA 3KLWA 1X3EA 5GAHC 4ZKBB 2R3ZA 4ZRZA 2PZTA 3C3LA 4O0AA 4DV0Q 1PH1A 4JI0Q 3WOFA 3L9AX 4KN7C 3H09A 2R7ZB 4A3KH 1EY0A 1D8LA 2ZXPA 2KA7A 3M7NA 2WACA 1E7ZA 5EAYA 4P73A 2Q2UA 3FMCA 4KY6A 2XPBA 4UDUC 1X55A 1A8VA 3M4PA 2D0PA 1BBWA 2Z6KA 3LNNA 3SEBA 4X64L 1H9MA 1OXVA 2X69A 1DONA 3F2CA 1XWEA 2L1BA 1HNWL 3I2ZA 1ENAA 3J80L 1P16A 4A3BB 3UE1A 3HZXA 1CKNB 1WD0A 1PA6A 2JA6H 1IBMQ 3H6MA 3PUYA 2K6AA 4BBRB 3D0FA 2JXWA 1EWHA 4I7ZC 4IJHA 4DAYA 1WTQA 2PYKA 4Y52H 3MXUA 1XMOL 4RHRA 2QDBA 2PZUA 1C48A 4CBVA 4BY1H 2F0DA 3EROA 2RSOA 3UI2A 3VA5A 1XNRQ 5J22A 1DOMA 5KNCA 1NMVA 4GZYC 2R7DA 2YU9B 1STAA 3GD7A 3JC66 4KHPQ 4HAEA 2K03A 1SMYD 2VUMB 2E75C 4DV2Q 2L0CA 3I4MB 1STBA 3J80c 2LFNA 2EZ5W 1XPUA 4ILWA 1HQMC 3MZ5A 1XNRL 1YNJC 2IPKD 4KHVA 4A3GG 3I72A 4F87A 3WOEA 1KDCA 4H0LC 1LTGD 4P72A 1TVXA 2KENA 1T9HA 1XMQQ 5C3XA 2NVQB 5IGDA 4G57A 5JJIA 3CCQA 2K5HA 3DEPA 3TP7A 2Z6KC 3FPUB 2MGSA 3PO3H 3MQGA 3D8GA 1CKMA 3WWVA 1N32Q 1NTGA 2VS1A 4JYAQ 3RR5A 2A68C 2EOTA 1CUKA 3D31A 1B53A 5FK9C 3ZJYC 2KCNA 2RDFA 1HR0Q 2VUMH 4TKOB 2AHOB 4UP9A 4RA8A 3FDTA 2ZJQA 2B2TC 3H0GG 5IT9E 3TP6A 4ALPA 3IKJA 1MGSA 1KL9A 3J81i 1QZHA 2E2IH 1DXMA 1WCMG 5EGTA 4E5RA 4NXNQ 1JCKB 4JI7L 4DV0L 2MUYA 3A5UA 4K2KA 1LUZA 5JJKA 3M3YH 2CHBD 3HOZH 1SJED 3DM1A 2H1EA 2QRVA 5ELEA 5HURA 4A3JG 3CCJA 1HZAA 5CBEE 3RZOB 1I4GA 1CI3M 1N33Q 5NUCA 5C4JB 1EY7A 3GDEA 4PV1C 3CC4A 3PIPA 1EZ8A 1LM0A 2F0IA 2VW9A 1PH5A 3S1MH 1CQVA 3TCZA 4XTCS 5GAEC 5IE8A 3OSOA 1LTAD 1UE1A 3WH0A 1EIFA 3RLNA 1X6OA 5IGFA 2ES2A 4RKLA 4ZLTF 4OX9Q 2GVBA 1STEA 2FMCA 3VR6A 3K5OA 5BN4A 2N8NA 4DV1L 2HT1A 2RQXA 1TU2B 3BS1A 5IY0A 1FR3A 4A3MB 1I6VC 3GTQH 4KV6A 2XWBB 2F0FA 2B63B 4PG3A 2X6LA 5GQOA 4YHHQ 4IZ8A 3DMUA 4Y7NH 4DNIA 1E24A 4JG2A 1HZBA 1M1KC 3CCUA 2EYPA 1BQQT 1FD7D 2CW0C 5LMUL 1U4PA 1KRTA 5E4WC 2QGQA 1A2TA 1V1OA 2ID0A 3KBXA 2ENBA 4HIKA 1E1TA 1VQIA 2A5HA 2YTYA 2PMZE 2YAJB 3RNUA 4BA1I 3HP3A 5IP7H 2LXJA 5K36H 2XP5A 1RP5A 3FVQA 2NYZD 2TSSA 4NW2A 1RF2D 4M8AA 3CNGA 4X3TA 2KJXA 4CKEA 1Y1VG 2F4VQ 2HHHL 2JA6G 2A68D 3GTOH 2L11A 2BCOA 2BOSA 4RHSA 2Q8RE 3PSIA 3GTKB 5M3FH 3TN2A 1LTSD 1JWMD 2EZVA 3PO2H 3VYTA 5IT9c 2BDOA 4GLVB 1WCMH 1UEBA 2J4XA 2B2TA 3S15B 3RLFA 3NP8A 3CW2C 1YI2A 1K8AC 4K5VA 1YHAA 5FO8B 3CPWA 5EPKA 1Q12A 3PUWA 3RZDB 1BCPB 1FNWA 4X64Q 5M3MG 2QA4A 1E2ZA 1BR9A 1IXRA 1ILQA 1SYDA 4L63B 1HR0L 3OTOL 4FXDA 2B8FA 2LY7A 4F8MA 5HY6A 3D4DA 1VQGA 3RN2A 4PZ6A 3DWQA 4BY1B 3U4ZA 3PMFA 2K14A 2FINB 5K5PA 4DR2Q 1ZCNA 4IUNA 2JA8B 4JOIC 2OCEA 5C44B 1UNSA 1SYBA 1RCVD 2K05A 4DGZA 3K5MA 5E4XA 1SROA 1O7IA 4L8JA 4K6LA 3NHHA 4FF4A 2D0OA 4C3IH 4HMJA 5KNDA 3CXCA 4O2DA 4K0KL 2OT2A 1AE2A 3RZDH 4IN3A 1EY6A 3T1HL 3VR5A 3S2DH 5J39A 1C9OA 4A3DH 3KAHA 4R4QA 1W6KA 3OWEB 1NJIC 4BBSB 4C3JH 1J9OA 1QVCA 3CQZB 2N49A 2UUCL 2WINB 5LMNL 1F2MA 4CKCA 3NPPA 5E62A 3FSCA 2F0WA 1Y1VB 4MHEA 3VDYA 4JI3Q 3I7FA 3HFZB 1QNKA 3PUZA 2KHJA 2F0VA 1C0AA 4REXA 5C4HA 1TXYA 1Q8IA 1SYEA 2K50A 4OIJA 1OXUA 1VQ8A 1EYAA 3TZUA 3A5ZB 4QGUA 3U50C 4TQUS 1HNWQ 1TS3A 3PO2G 4DU9A 1HZ9A 2JA7B 4POFA 4OONA 4LAAA 3HOUB 1L0XB 1B3AA 2E2DC 3DHQA 4GN4B 4KJNA 4C3HB 2B2WC 4HJ5A 3J80E 4RGNA 5JPMC 1KABA 5C0XJ 5IP9H 1YHBA 4A93G 2WFWA 5DLQE 1YHQA 4JI4Q 3CCSA 3F2UA 3DWAA 4LFCQ 5ISRA 3E9HA 2K5WA 3TEHB 2EXDA 4CHTB 4C56C 3ND8A 5E3FA 4XDXA 3R2TA 2B2YC 2B63G 1SDFA 5ELFA 4B3RL 2O4XA 3SK5A 1DJRD 1PMRA 4A3MG 1XNQQ 4A3FH 2PMZB 2UUBL 1FGUA 1K83B 4GOPC 2O2LD 2ZT9C 4DV3L 1FLCA 1PTOH 2R93B 4DUYL 5JAVA 4DV4L 2JA5B 2R93H 4YCUA 1I50B 3C1FA 1GM5A 3UDXA 3L3OC 1AZQA 2MQHA 5DNFA 1PFSA 3PF5A 1KHIA 1XPRA 2Z8LA 4LJZC 1O78A 3LX0A 3VR2A 3FSBA 1EEID 4A3DG 3NQIA 4IJLA 1PRTF 5A35A 3BZCA 4A3JB 4QF4A 5C4ZA 1LTID 1TIID 3CCVA 1I6HB 1GHJA 1U4LA 2ITKA 4RH6A 4A93B 5AJ3Q 3UE0A 5IGEA 1STNA 4ZAIA 2WADA 1U5KA 1WOCA 3RLOA 4HJ8A 1VF5C 4X62Q 3KABA 5E7NA 1A3TA 4BY7G 1A0IA 1M8AA 1MI2A 2JA9A 3ERQA 4JI1L 1AH9A 5D65A 1D1KA 4RGTA 5E66A 4N9PA 3KJPA 4ZUIA 3MTSA 1W3SA 3T16A 3U4VA 3AQQA 3NUCA 3ULJA 4A3KG 1K0RA 3OWFA 4LF9L 1LTRD 1IBML 3NBIA 4DAVA 1MBYA 2OF1A 2CCZA 2K5QA 1N36Q 3QG1A 4B9WA 1SN8A 2ZR6A 3PUVA 2UUAQ 5DM63 2ZTEA 1GUWA 3T53B 4KKUA 2JQOA 2R92H 2HDLA 3KDFB 3HS0C 3DWPA 3E9IA 3ER0A 1B1ZA 1F9QA 3MFYA 1ZEQX 2F0GA 2F21A 1GKHA 4HIMA 2YSGA 4A3KB 1BCPF 5BN3A 4DKAC 1MIUA 4BXXG 1G291 5EBCA 2YV5A 1A2UA 2J7ZA 1ICWA 2VUMG 2ZR5A 1N32L 2Z0SA 5D14A 3LKXA 1Z6HA 2M2LA 3KBGA 5C0XG 4XT1B 1L0YB 2D62A 3G48A 3OOCA 4NB3A 1MSHA 2PQAA 3R8BA 1VDZA 2Z4IA 1FL0A 5FLMG 4POGA 1OTCA 1S5CD 4QJFA 2EYLA 1D1IA 4XQNA 4U68A 1IBKL 4QQBX 2F0TA 2F52A 2KCMA 4K2LA 4CJ0B 4OIKA 3HKZE 3JAME 4BY1G 4AQYQ 3K5LA 2OTLA 3S2HH 5D3DA 2PW5A 3KOJA 4OWWB 5E1FA 4KMUC 4UP8A 4LUOA 1XTCD 1SLJA 3GO5A 3V05A 3RMHA 1STYA 1IKLA 1STHA 2UUAL 3CKIB 3S17B 1LYLA 1WTPA 3T56B 3CQZH 5CGKA 2A1AA 5M3MB 4DR7L 2JK8A 2JA7G 1FYCA 1VQFA 4RGMA 3PO2B 1Q90A 1HQRD 4R9WA 3TDBA 2K1BA 5DM73 2ZXOA 4KTAA 1VQ5A 5M5WH 4C2MB 5LMNW 5J1ZA 3F8TA 4FF1A 1S72A 5I4DA 3NQTA 1D6EC 3ZYYX 4A3EB 2JYOA 4HSVA 1EFID 1L1OA 1DCZA 4FXKC 2VQEQ 4IOAA 3P1HA 4YWKA 1MKHA 4XYOA 1BF4A 2XIWA 5H1SE 3VYRA 2UXBQ 3HOVH 5FJ8G 3M4OH 4FNFA 1D5ZC 1VQDA 2RCNA 3QOJA 5AJ3L 1Y8PB 2V1CC 5C4JH 2DMVA 4IFDI 2FHTA 2VNUD 3BU2A 2AMCB 4OL7A 4AYBE 1Y69U 1MJCA 3W2DA 1K8GA 3TZDA 3ITPA 1VQCA 1Y1WG 3P7JA 2B2VC 3TS2A 1WJJA 3K80C 5IOCA 3J7AF 3QB3A 3X3NA 3KF8B 1TQOA 4DK3C 3A74A 4H13C 3KADA 2E2HB 2M9VA 2YSHA 1A15A 1JB7A 4DF7A 3PIOA 2MDIA 4QIWE 3D4WA 4OWXB 3I3CA 4JI8Q 4EQ5A 5GROA 3IRBA 2AQ3B 2F0MA 1QZGA 1VQKA 1JWUD 2D9UA 3U9SA 4L5QA 4LW1A 2QF7A 5I6YA 4WJ4A 3S16B 5AFWA 2BA0A 1I50H 2OQKA 1EOTA 3QO2A 4DR5L 4X65L 1S5FD 1EL0A 1T5XD 1AZPA 3C2PA 5JPNC 2ZQSA 1KDBA 1E2VA 5IYBH 4KLKA 4BWGB 4LF9Q 2JE6I 2IHEA 4X66L 4K14A 3CCMA 4OO1H 3KYHC 1EG4A 1JOQA 2KXQA 1JJ2A 3IAYA 3FRPB 3PUXA 2L4NA 4LF7Q 1V1PB 5C4XB 2CWPA 4DV6L 4J15A 3KLSA 1LV9A 2VB2X 5FJ8H 3J80i 1EWCA 5I9PA 5C44G 3V96A 4UY8C 1HNZL 3S1NH 4RGOS 2O5JC 3VR3A 1QG7A 1IYVA 5CC4A 4PZ7A 4C1NK 1LABA 4JI3L 5C3EG 1HNZQ 2ZAJA 3ULPA 5JEAJ 1EUJA 1EQVA 5FLXc 1YEZA 4IUPA 1TK7A 3PO3G 2XP6A 4X6AH 4HTHA 2EY1A 1FJGQ 1KNEA 2VQEL 2K52A 1G2SA 4HIOA 4AYBB 2ASBA 3NTIA 4DAYB 4RFBA 5FLXE 1UE6A 5M3FG 1PTOB 1YZ6A 3KCEA 1IL8A 1PZKD 4F7XA 4DR3Q 2EY5A 2IL8A 1N34Q 1PZID 1K9QA 2XP3A 3CPFA 3CCLA 1YW5A 1TY2A 5JOBA 1SE4A 2K01A 5CR3A 2RBMA 2K33A 4A3IG 1JC7A 2K5NA 3I4MG 1TWCB 2PZWA 5CV9A 3URYA 4QY7A 2M8JA 2GVAA 2OQ0A 3G6EA 2QEXA 3BZKA 2AKWB 3G4SA 3GTMH 3HOYG 2A6EC 2JSOA 2RSNA 5ELNA 2EY6A 5AHTA 4A3CG 2UXCL 3FS8A 1D2BA 3MA2B 2M3OW 1BNZA 5IIFA 3MXNB 2C5CA 2JP1A 1CKOA 2ALYB 4APVA 1JB3A 4BBRG 1UUPA 3OMGA 4AIMA 2G9HD 4P75A 4LMQD 1PH8A 4JI6L 3HOVG 4DR4Q 1E1OA 4CKBA 3SXHA 1WTRA 2CVRA 1HA6A 1WCMB 5FKAC 1J6QA 1JOKA 2K4KA 1VQAA 4DR1Q 5EBDA 3T51B 3NK9A 3NWTA 1IYJB 3GTPH 2C35B 2ICEC 1YIJA 4A3EH 3NTPA 1HRJA 4TRDA 4O1NA 1VQ6A 4GKJQ 2JXMB 5IP9G