3M85A

Archaeoglobus fulgidus exosome y70a with rna bound to the active site
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
179
structure length
179
Chain Sequence
MRFVMPGDRIGSAEEYVKGEGVYEEGGELFAAVAGKLIIKDRVAKVESISPIPEIVKGDVVLGRVVDLRNSIALIEVSSKKGENRGPSNRGIGILHVSNVDEGYVKEISEAVGYLDILKARVIGDNLRLSTKEEEMGVLRALCSNCKTEMVREGDILKCPECGRVEKRKISTDYGKGEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Quantitative analysis of processive RNA degradation by the archaeal RNA exosome
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase/rna
molecule keywords Putative uncharacterized protein AF_0206
total genus 36
structure length 179
sequence length 179
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10447 EXOSC1 Exosome component EXOSC1/CSL4
A PF14382 ECR1_N Exosome complex exonuclease RRP4 N-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3m85A03
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3m85A01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3m85A02
1N36L 4DR3L 1CTMA 1I5HW 2CFMA 2BH2A 4IFDI 2NN6H 4HJ9A 2R7ZG 1IBMQ 2KBNA 2UXDQ 2XP4A 1WCMH 1NBWA 4YCVA 3N6RA 1VQEA 1Q8KA 1X54A 3JC66 4QY7A 3M4QA 3GTPH 2K33A 2YV5A 1HNXL 2RHSB 3UE1A 4A4IA 1VQOA 3KLRA 1K8AC 3W1GA 3PF5A 3J7ZC 2WAQE 4BA2I 1E2ZA 3P20A 2KHIA 3T1HL 4GN5A 4X62L 3K7AH 1L2FA 4A3FG 1VQ7A 3NENA 2JA8G 1CKNA 3PUYA 1TU2B 1EWIA 4QJFA 3S2HH 4PG3A 4NB3A 4JI7L 4DR7L 1KL9A 3K8AA 1B70B 4QGUA 2B3GA 4R4QA 5C0XI 1R9TH 4LFAQ 3PUVA 3CCRA 2A19A 3K7UC 1WYDA 4ALPA 1B8AA 4OGQC 2OCEA 3MFYA 3CRLC 2IT1A 3SGIA 4X64L 4DV0L 3H15A 1T5EA 1GVPA 4GOPC 3J7A5 2VY3A 3PUZA 3KOJA 2IHFA 2YYZA 1E2WA 4TQUS 2R7FA 4H44C 3AYHB 4DR5Q 3T56B 1NMFA 1YJ9A 5JJLA 1PH2A 3OOCA 3UDXA 5FJ8H 2OWOA 4DUYL 2L5TA 3DXJC 3CPFA 2JA6H 1HZAA 3KDFB 3KF6B 1YBYA 2JXWA 3U9SA 1GUSA 2ZQTA 4JI5L 1XMOL 1H9SB 3S15H 3HOYH 3I4MG 4GKJQ 5FJ8G 2EIFA 2ZM6Q 4REXA 4MNOA 4BBRG 4LF8L 1IL2A 4JI4L 3KAIA 4A93G 4GKKQ 2PQAB 3TS2A 2B63G 4YHHQ 5GQOA 1Y1WG 4APVA 4AH6A 5BN4A 2E74C 2K5HA 4TVAB 4DR2Q 1YITA 5IYCH 3SDZA 4X66Q 4JI8L 2EJFC 3U50C 1I94L 5K36G 3MXUA 5C0XG 3KFUA 1KAWA 2Q2UA 1Q1EA 2E76C 3FHWA 3J81j 4OWXB 4JBKA 4A3MG 1TWHH 1QUQA 2AHOB 3CCMA 3U58A 3NBHB 3TCZA 4LF4Q 1KD1C 1NTGA 4KKSA 3F2BA 2MDIA 1O7LA 1ZKOA 5C44G 1IXRA 3D4RA 4B3SQ 5BR8L 2R93H 2NZOA 3PO2G 1C0AA 2A6HD 3PV0A 3M7NA 3CCSA 4DUZQ 1KIXA 2YSIA 5KNBA 3RN5A 1VQ9A 2R93G 2JXMB 2B8FA 5IYCG 1N32L 5M3MH 2ZT9C 2JEBI 5M5WH 4HJ5A 2VZAA 2L4JA 1VQDA 4UPAA 1UE1A 4NXNL 1I94Q 4R4IA 4P73A 1Y8OB 4DK3C 2VS1A 5GAHC 4LF7L 4WJ4A 3TS0A 2JA7H 4OX9Q 3S14H 2DK1A 4A3IG 3A5UA 4GLAC 1IW7D 2PI2A 4P75A 2D0OA 3SE0A 4DUZL 2EDGA 4HIOA 2A69D 4GNXB 2ZR4A 2VQEL 2XP9A 1DGSA 4J15A 3LNNA 4LF4L 1FYCA 4YWMA 3GD7A 3T53B 4JI6Q 3I56A 1JT8A 4L5RC 1SLJA 3L2PA 4AYBE 4DR4Q 4BBRH 1YNNC 3HOWG 3KAFA 4DV2L 2AKWB 3DM3A 1VQPA 4LFCQ 2ES2A 1IBKL 4DNTB 2M8IA 3I4LA 1X56A 4JI8Q 4NXML 4PZ8A 3OW7A 2A6HC 1GO3E 2MO0A 1C9OA 2BE5D 4PV1C 4C2MH 4LUZA 4YY3L 3VR3A 3CRKC 3KF6A 4LF9L 1GM5A 2A68D 3PO3G 3UE0A 2ZTCA 5IWAL 4LNQA 3OTOL 1VQBA 2VW9A 3CCLA 2OTLA 2K14A 2R92G 3GTOH 5BR8Q 2A6ED 3EQLC 1IZ6A 4TKOB 3CC4A 4A93H 2JA9A 1FJGQ 4XIGS 3CMEA 1UE6A 5IYBG 2ZJRA 3CC2A 2O5JC 1VQMA 3U4VA 2E2JH 1VQIA 2PI2E 3PUXA 2HHHQ 2YSHA 1YIJA 3CAMA 1IYUA 2WB1G 3EBEA 3E9IA 4RCNA 2KCCA 4R4TA 3VR6A 1I6HH 4IO9A 2N78A 2RCNA 1PH3A 4DV6Q 3FPPA 4X64Q 4DV0Q 4GKKL 4GN4B 1KRTA 5C4XH 4IJLA 2DNEA 4DV3L 2K7VA 5C44H 2K32A 1LM0A 2BH8A 1E7ZA 1H9SA 2LXJA 4NXNQ 4DV5Q 4DKAC 4JI5Q 1VQNA 1UEBA 5M3FH 1X3GA 3FKIG 1JMQA 2LAJA 4YCUA 2F52A 4KMUC 4JOIA 2N8NA 1RIPA 4IFDJ 1VQFA 4AQYQ 4IPCA 4A3CH 4UY8C 2K50A 3STBD 4DV1Q 4X6AH 4L5QA 3BG3A 3RZDH 5IYBH 4DNIA 3I4OA 2BA0A 2UUBL 1CFMA 2GN5A 2YU9H 3BJUA 1ASZA 2QA4A 4KN7C 3CCQA 1EG4A 1AE3A 1N33Q 1G6PA 4DAMA 1OXVA 3ICEA 3I4NH 2IY5B 2B29A 1GUGA 1K9MC 4LF9Q 3QJYA 1CSQA 1L1OB 3E9HA 3K0XA 1VQ8A 1SROA 4I7ZC 1U0LA 5J3BA 1MKHA 5IYDH 4A3EG 4A3GG 4ME3A 3I4NG 4NXMQ 4A3BG 1CKOA 1I3QH 4QIWE 3T51B 4JI0L 5C0XH 3T1YL 3PUWA 5BN5A 1H9MA 5BN3A 1Z9FA 1SMYC 2Z6KC 1PH5A 1JJCB 1HPCA 1TKWB 2JJQA 3S24A 4JYAL 4JI3Q 4A3DG 4KI0A 2A8VA 3E0EA 1UE5A 1OTCA 1FJGL 5HY6A 3CCEA 1GD7A 1MJCA 1XPRA 1E24A 1GHKA 2VUMG 2JQOA 3RNUA 1DXMA 1DCZA 1VQ6A 4A3CG 1EQQA 1V1QA 2AUKA 3PO2H 3TQYA 5JEAG 5CQ2A 4G7HC 1XMQQ 4BXXH 3ZJYC 2ZR6A 3K80C 3AEVA 4JI1L 3EN2A 4RG1A 3W3AA 2MFIA 1G291 2NVTH 4R4CA 5IYDG 1YVCA 1FL0A 4DV7Q 1Y69U 2DJYA 1W3SA 2ZJQA 3JAMc 1VF7A 1UE7A 1J5EL 4B3TL 3I7FA 4LF6Q 2PMZE 1HR0L 3AFQA 3M4YA 1K83H 2XPAA 3CCVA 5E7NA 3A5ZB 2AWOA 2F4VL 1X65A 4FDBA 4OXPA 1KRSA 3D0FA 4MZ9A 4B3SL 4BY1G 1BDOA 2Y0SE 1QVCA 1EIFA 4HIKA 4OO1G 3S2DH 4KKTA 2JA5H 1VQJA 2DGYA 2JA6G 4POFA 5M5YH 2MQHA 3S1RH 4JC0A 3RN2A 1FGUA 2XP5A 1IW7C 3PGZA 4IJHA 1YJWA 1I6VC 2B63H 1ONLA 4LWCA 4X66L 5K36H 3HOUH 3PCOB 1MIUA 4MTNA 2IX0A 2BE5C 3H3VI 4A3KH 3PIOA 3RZOH 4B3RQ 2KCMA 1E1OA 1SMXA 1K8OA 4JBJA 2JA8H 2I5LX 4NPSA 4HJ7A 2KCTA 3UDGA 4GOPB 1I5FA 1K9RA 5AJ3Q 2YSFA 1LACA 3G4SA 3KADA 1WOCA 2K5NA 3ERSX 1HR0W 4PZ7A 1Y1VG 2DK7A 4HJAA 4BBSG 3ODKA 2R7DA 4LJZC 2E2HH 3KAHA 2ASBA 4DR6L 2PQAA 4L8JA 4HIDA 2ZTEA 1VQCA 1K8GA 4QIBA 1I50H 1TWAH 3TEHB 1AH9A 3HOYG 3I4MH 2XP6A 1YNJC 5ELOA 4EX5A 1V43A 1N33L 4C3IH 3S1QH 2UXBQ 3ULPA 4HJ8A 1JJ2A 1B9MA 1S3OA 4X65L 2F3IA 1YHBA 1E3PA 4AYBG 1TK7A 1YJNA 4A3IH 1K73C 4DK1A 1SFOH 4BY7H 2HHHL 3S1MH 1M90C 3I72A 5C3EG 3A8KE 5FLMH 4IQZA 4A3KG 4KHPQ 2IHEA 1YNXA 3CNGA 3LWUA 1VQGA 4JYAQ 2XP8A 4BY7G 4JI2L 1D7QA 4UP7A 3J81i 2UXDL 3CXCA 3CMAA 5JEAH 1PH8A 2LSSA 4DR7Q 4RMFA 4B3ML 3J80i 3S1NH 1JE5A 4Y52H 4IPDA 2Q5AA 2H5XA 3OTOQ 1EWHA 5IWAQ 1Y1WH 5H1SE 1CI3M 4YY3Q 5IY0A 3TDBA 4WJ3M 3BU2A 1BVSA 4DR5L 2UU9Q 1BKBA 2UUBQ 2UU9L 1LABA 4A3MH 1FVIA 3JAMi 2NVXH 5HGQA 4G7ZC 3STBC 1GUNA 1YEZA 2CCZA 1PV4A 4JBMA 4A3LH 2ZQUA 3KJPA 3AQQA 4BXXG 3FP9A 1H9RA 3F2CA 4DR6Q 3TREA 1H9JA 1A63A 4P74A 4LFAL 1IYJB 1IBML 2ITKA 3A8JE 5KNCA 4C3JH 2K75A 3T1YQ 4JI0Q 3HOXH 3GDEA 5GAGC 2CKZB 3PF4A 3KDFA 2ATWA 4JI7Q 2VNUD 1FR3A 1HJPA 1NMGA 2JX8A 3RLFA 2KENA 4DV3Q 2LMCB 5LMUL 4K0KQ 3ULJA 1GUTA 2F4VQ 2R6GA 4DK0A 1TWFH 1GKHA 2UXCL 1QVFA 4OX9L 1O7IA 3G6EA 1Q90A 4A3FH 1LTLA 1Z47A 4DV7L 2UUCQ 4AIMA 4A3LG 1Q1BA 2WP8J 5IP7H 2E5LL 1HNWQ 1N34Q 2QEXA 4DV1L 5C4XG 2V4DA 4DV2Q 3GTLH 4AQYL 3GTMH 5IP7G 1B9NA 2WFWA 4OWTB 2JK8A 3M4OH 1IYVA 4DPGA 4A3JG 5A35A 1Y14B 4LF5L 1WR7A 1S40A 2ZTDA 4JG2A 2Z6KA 4IPGA 3KF8B 3CCJA 5IP9G 2GVAA 4O2DA 4JV5L 1AE2A 1HR0Q 4POGA 1CKNB 2N3SA 2HIVA 4KN4C 4PMWA 3IKJA 2QGQA 3CQZH 3OPOA 3H0GG 2ZAJA 3GQBA 3H3VH 3S16H 1P16A 1IBLQ 1EYGA 4DR4L 4QQBX 3VA7A 2ZR5A 1X3EA 2E8GA 3KJOA 1K3RA 4H02A 1GJXA 2MNAA 2XP7A 1HH2P 3L0OA 1N9WA 4LW1A 3WH0A 1SRUA 1L0WA 2PCFB 3RLOA 2D2CC 2PPBC 3BZCA 5LMNQ 2XTIA 4GLXA 5AJ3L 2VQEQ 1X6OA 1B7YB 4IOCA 3HOWH 2A69C 2K4KA 2E2IH 2AUJD 4YWLA 2RHQB 1V8QA 4JOIC 2ALYB 2CWAA 1MJEA 2OQKA 4LFBL 3J80c 1CSPA 2ZJPA 1PH1A 5IE8A 3QIAA 3TRZA 4LF7Q 3M85A 3GTGH 1HNWL 2E5LQ 2OQ0A 2EXDA 4GNXA 1XJVA 3F2DA 1DD2A 2JE6I 1WFQA 3ULLA 4P72A 1N32Q 3MXNB 4IFDH 3AFPA 2E45A 2YSGA 4LF8Q 1GUOA 3OW2A 2YTYA 2VQFL 4HR7B 4KKUA 1VQKA 1PMRA 5LMNL 1U5KA 3HKZG 3H94A 5KNDA 1PFSA 3PIPA 1Z7TA 4A3GH 4DUYQ 1PH9A 2O5IC 2A1AA 3CCUA 3HOVG 2I0QA 4LF6L 1VQAA 4X62Q 2HT1A 1XPUA 4O0AA 4DV5L 3KLWA 4A75A 2A68C 1P8LA 2BDOA 3QG1A 3CPWA 2HIXA 3HFZB 1HTPA 3CD6A 1VCIA 2Q2HA 4YHHL 4LK1C 1PH7A 4LFBQ 1HNXQ 2AMCB 5EAYA 2YTXA 4JI4Q 5FLXc 2MO1A 2Z0SA 3G71A 3UDFA 4OONA 1PYSB 4A3JH 3KCEA 1EIYB 5C0XJ 2JMFA 1V9PA 4GLVB 5GAEC 4GNXC 1IBKQ 4GKJL 1Z6HA 3HOZH 1RL2A 3A7AB 3VR5A 3EIVA 2NVYH 1EG3A 4OO1H 1E2VA 3S17H 4G7OC 1EQRA 4R4OA 4JI3L 1SE8A 3KABA 4DR1Q 1H95A 2KXQA 4JK1C 4PZ6A 3G48A 1W2BA 1VDZA 3FKIH 3T1HQ 3B6YA 1YZ6A 3BDOA 4L5SA 1XTDA 1PHJA 3TZUA 1JB7A 1SR3A 3RLNA 3M3YH 3KAGA 1EOVA 1HZ9A 4DR2L 3GTKH 4X65Q 1J6QA 3CF5A 3CC7A 2XP3A 4E5RA 4A3EH 2NVQH 2EZ5W 3W5OA 4A3BH 1T9HA 2XPBA 5M5XH 1JJGA 4K0KL 3HKSA 2WAQG 1QVGA 5DLQE 4OWWB 2NN6G 5GROA 2DUDA 3NEMA 1EFWA 1UWVA 1XNQL 1QZHA 1PINA 1X3FA 1N36Q 1VS0A 3GTQH 3WDNA 1XMOQ 2YTVA 4LFCL 4GN3B 1ASYA 4BA1I 3A7LA 1A8VA 1G51A 1A62A 4IOAA 2M8JA 5C3EH 3D31A 2C35B 3K81C 5LMNW 2VL6A 4KHZA 3HOUG 3OOBA 3CP0A 3PSIA 4LUVA 2D62A 3GTJH 1H9KA 1A6XA 1O78A 4U84A 2UUCL 1HQMC 4R1JA 4C3HH 3M9BA 1OXTA 1Y8PB 2ZQSA 2EJMA 3VR4A 1NY4A 3UDIA 3A74A 2JA5G 2UXCQ 1WI5A 2FXQA 1KC8C 3VDYA 1GHJA 2Q8IB 3A0JA 3ND8A 2HQLA 1IBLL 1VQHA 2JA7G 2ZQVA 1WJJA 1XNRQ 3WWVA 2RE3A 3PO3H 3FMCA 2N49A 1L1OC 2K5VA 2JV4A 4B3MQ 4DAYB 4DK6C 4LUOA 3KYHC 4DR3Q 3TC5A 3NELA 1YHQA 4DNRB 3CW2C 1KQSA 4U86A 1HNZL 4A3DH 1X9NA 3L4HA 4KHPL 4JI6L 2EVBA 3LE4A 4YCWA 1TWCH 2CQOA 5IP9H 2DN8A 1K0RA 2D5DA 3DLLA 4LF5Q 2M3OW 1QJOA 1SN8A 1PVOA 3NTPA 4JCVE 1BBUA 5FLMG 5IT9c 2UXBL 2GVBA 1PA6A 3NE5B 2R92H 1M1KC 3AB9A 2Y0SG 2Q2IA 4A76A 1NE3A 1OXXK 4DV4Q 2OTJA 3BZKA 5ELNA 3HKZE 1YW5A 2K52A 4IPHA 3Q8DA 2E75C 2EQSA 2LXKA 1XMQL 2JEAI 1QZGA 2NZHA 1NMVA 1YHAA 4EQ5A 3IFTA 4JI2Q 2NN6I 1QUQB 1E1TA 1VQ5A 1K9QA 5M3FG 2RF4A 2UUAL 4UP8A 3IRBA 3F1ZA 1ZCNA 3RR5A 4QL5A 4BY1H 4BBSH 4B3RL 1OXUA 1Q12A 1WCMG 1VQ4A 1Q7YC 1HNZQ 5AHTA 1J5EQ 4Y7NH 2KA7A 3VR2A 3ER0A 2F21A 5C4JH 2VQFQ 1L1OA 2I5MX 1CUKA 2YSBA 1S72A 3F8TA 4GZYC 3W1BA 1PH4A 1X55A 1HZCA 1O6WA 1XNRL 2F1MA 1NJIC 3MEFA 1Q81C 3HOZG 2EJGC 1HCZA 4DV4L 1VF5C 3HOVH 1Y1VH 2ID0A 1LUZA 4JI1Q 2WB1E 3OYYA 5M3MG 4H13C 2XGTA 1N34L 4JBWA 1KHIA 1EUJA 3J81c 5JJKA 4YWKA 1C7YA 2B8GA 2BA1A 3U4ZA 3GO5A 3L7ZC 1PYBA 3M4PA 5JJIA 1XPOA 1ZYRC 3I55A 5GADC 2UUAQ 1KXLA 4P71A 4UP9A 1BBWA 1YI2A 4GS3A 2PNHA 4B3TQ 4GOPA 2VUMH 4HIMA 3ND9A 2V1CC 2ZM6L 3I2ZA 2DNCA 1XNQQ 1PH6A 2R7ZH 2DMVA 2PNRC 5JEAJ 1A0IA 2I5HA 1E22A 3I73A 2CW0C 2Q2TA 2DWVA 2L15A 2AWNA 3H0GH 3LGJA 2KHJA 1D8LA 1Q82C 1Q46A 1WMVA 1JMCA 4L5TA 1OXSC 1VQLA 1CKMA 1Q86C 2QF7A 1LYLA 4DV6L 1N8RC 1K8MA 4OO1I 1TXYA 2A6EC 4XTCS 4IFDG 4JV5Q 4H0LC 3A8IE 2IX1A 3HOXG 4DR1L 1F8AB 1Y8NB 5LMUQ 1TWGH 1HZBA 4U85A 2D0PA 4KLKA 2CWPA 3HGBA
chains in the Genus database with same CATH superfamily
1N36L 4DR3L 1CTMA 1I5HW 2CFMA 2BH2A 4IFDI 2NN6H 2WKDA 2VB3X 4HJ9A 2R7ZG 1IBMQ 1GXDC 2KBNA 2UXDQ 2XP4A 1WCMH 2DY8A 1NBWA 4A3FB 3RUZA 1LLRD 1LT5D 2B2TC 3N6RA 4YCVA 1VQEA 3QO2A 1Q8KA 2NTTA 1UEAB 1JB3A 1X54A 3JC66 3TZDA 2G9HD 4QY7A 3M4QA 3GTPH 2K33A 4DXGA 2YV5A 1HNXL 2RHSB 3UE1A 4A4IA 1VQOA 3H3VC 2EYFA 3Q6SA 3KLRA 1K8AC 1MI2A 3W1GA 3PF5A 1Y1WB 3J7ZC 1PTOB 1SYFA 2FFKB 2WAQE 4FNFA 2CH4W 3OHXC 4K5WA 3TP5A 4RWSC 4BA2I 1E2ZA 3P20A 2KHIA 2QKIC 3T1HL 4GN5A 5JOBA 4FF3A 3MC0B 4CHTB 2MHVA 4X62L 5EPJA 1CK1A 3K7AH 1SBBB 3VYSA 1L2FA 1TWAB 3GTOB 4A3FG 1NR2A 2EY6A 1VQ7A 1PDQA 2B39A 3NENA 2JA8G 3EVQA 1CKNA 1XWEA 2F0EA 4A3BB 3PUYA 1TU2B 1S4ZA 5JPNC 1EWIA 3BDLA 4QJFA 3S2HH 4U673 2XN9C 4U68A 2HDMA 4PG3A 4NB3A 4RAUC 2XRQD 4JI7L 4DR7L 1KL9A 5C4HA 4KD4A 4A3DB 3K8AA 1B70B 3FRPB 2B3GA 4R4QA 4QGUA 1F9SA 5C0XI 3M3YB 1SNPA 3TSSA 1R9TH 3OIPA 1JE4A 4LFAQ 3PUVA 1NR4A 3A54A 4NDXA 4KD3A 4XYOA 1QE6A 4C3IB 5T1IA 3CCRA 2A19A 3MXGA 1PFBA 5J39A 4N8X1 4ZQ3A 3K7UC 1WYDA 3H6MA 4ALPA 1MSHA 4FF2A 1B8AA 4OGQC 2OCEA 2SNMA 1MBYA 5CV5A 1EZ6A 4ZRZA 1LTID 4XXEA 1XYIA 3CRLC 3MFYA 2KUMA 2VB2X 1SMYD 3JAML 2IT1A 4C3IG 5EPLA 3SGIA 4X64L 1U4LA 3H15A 4DV0L 1T5EA 1B44D 1GVPA 5G3LF 4GOPC 3J7A5 2VY3A 3PUZA 3LX0A 3KOJA 2IHFA 3HKZB 2DJFC 2YYZA 1E2WA 1STBA 4TQUS 2HQEA 5CV8A 5D3IB 3MCBA 2R7FA 3GTQB 5C4XB 4H44C 1PFMA 3AYHB 1R9TB 3NTHA 4DR5Q 3NP8A 4A3JB 2TSSA 3T56B 3WOFA 1NMFA 1YJ9A 5JJLA 4RGTA 4DFAA 1PH2A 1KABA 3OOCA 3UDXA 3D6CA 3BS1A 1F2MA 5IODA 1CA5A 5FJ8H 2F0PA 2Z4HA 2OWOA 1HFNA 4DUYL 2L5TA 2M2LA 2FMCA 3NHHA 1SE4A 3DXJC 1CT1D 2B2TA 3CPFA 2OEOA 2JA6H 1HZAA 3KDFB 5K5PA 3KF6B 1YBYA 2JXWA 3U9SA 2AQ1B 1TS5A 1GUSA 1CQVA 2ZQTA 4JI5L 1XMOL 2B2WA 1H9SB 2F03A 3S15H 3HOYH 2HDLA 3I4MG 4GKJQ 4X3KA 5FJ8G 3MFGA 2EIFA 2ZM6Q 4M8AA 1RHPA 4REXA 4MNOA 1II3A 4BBRG 4DXFA 1WVLA 2EYOA 4G57A 2IJ0A 5CBAE 4LF8L 1IL2A 1UUPA 4JI4L 3KAIA 1FGBD 1C48A 4A93G 3K0YA 1J9OA 4GKKQ 2PQAB 3TS2A 2B63G 1Q3LA 2AQ2B 4YHHQ 3AU7A 1EIHA 5GQOA 1Y1WG 2CH4A 2XWBB 4APVA 4AH6A 5BN4A 4A3EB 2E74C 1IKLA 3I4NB 2K5HA 1TS2A 4TVAB 1TS3A 2KOLA 4DR2Q 1AN8A 1YITA 2JSOA 5IYCH 1EY5A 3SDZA 4X66Q 4RKLA 1I50B 4JI8L 2EJFC 4JVZA 3CKIB 1VMPA 4K6LA 3U50C 1I94L 3I4MB 5K36G 3MXUA 5C0XG 1ENFA 5T1GA 3KFUA 1KAWA 2F0OA 2Q2UA 1Q1EA 2E76C 5ELFA 1U4MA 4TSSA 1HRJA 3FHWA 3J81j 4OWXB 3PMFA 4JBKA 5DEHA 1TWHH 4A3MG 1QUQA 2AHOB 4JPBW 5C5LA 3CCMA 4A3GB 3U58A 3NBHB 3S16B 3TCZA 5E3FA 3V2TA 4LF4Q 1KD1C 1NTGA 4KKSA 3F2BA 2MDIA 1TS4A 1O7LA 1ZKOA 5C44G 3FPUB 1IXRA 3D4RA 4B3SQ 5BR8L 2R93H 2NZOA 3PO2G 3C1FA 3GTJB 1GOZA 1C0AA 2A6HD 3PV0A 2PW7A 4ULLA 1QCBD 2GA4B 3M7NA 1SE3A 3CCSA 4DUZQ 3D4DA 1KIXA 2YSIA 5C44B 3K58A 1CA6A 5KNBA 1Q8IA 3RN5A 1VQ9A 2Y8NB 3GTGB 2R93G 3J81E 2JXMB 5I6WA 2B8FA 5IYCG 1N32L 5JJZA 5M3MH 4F7XA 2ZT9C 4MN3A 2JEBI 5M5WH 1EU3A 1FD7D 2IL8A 1BNZA 3ERQA 4HJ5A 2VZAA 2L4JA 1VQDA 4UPAA 1UE1A 1M4VA 4NXNL 1I94Q 2R93B 1I4PA 1SYCA 4R4IA 4P73A 4Y7NB 2L11A 4QUFA 1Y8OB 5EKIA 4DK3C 1KDAA 2VS1A 5GAHC 4LF7L 5EBCA 4WJ4A 1NNXA 1BF4A 3TS0A 2JA7H 4OX9Q 2K01A 3S14H 2DK1A 2B2YC 3UI2A 4IUVA 3ITPA 3LWEA 4A3IG 3A5UA 3A56A 3H09A 4GLAC 1KLUD 2EYLA 1IW7D 4RFBA 2PI2A 1STAA 4P75A 2D0OA 3SE0A 2A5HA 4DUZL 3URYA 1K83B 2M00A 2EDGA 4HIOA 2A69D 4GNXB 1I4HA 2ZR4A 2VQEL 3D8GA 2XP9A 1DGSA 4C3JB 2Z9HA 4J15A 1WTOA 2I07B 1V1PB 1SAPA 1BCPB 3SK5A 5C5MA 5E1FA 1WCMB 3LNNA 4LF4L 1FYCA 3DUZA 4YWMA 2YU9B 3GD7A 3T53B 1EU4A 4JI6Q 3I56A 1JT8A 1I3QB 1STNA 4L5RC 1EL0A 1SLJA 3L2PA 4AYBE 4DR4Q 4BBRH 1YNNC 2KCNA 3HOWG 3KAFA 4DV2L 1BO0A 2AKWB 3DM3A 2R92B 1FNVA 1VQPA 4LFCQ 2ES2A 1IBKL 4DNTB 1TVXA 2M8IA 5FKAC 1WTPA 3I4LA 1X56A 3FS8A 4JI8Q 5I2XA 4NXML 4PZ8A 4BWGB 5U47A 3OW7A 1GO3E 2A6HC 4NKLA 2XRSD 2MO0A 3IL8A 1C9OA 2F0VA 4IURA 2BE5D 4PV1C 4C2MH 3J7YW 4FVMA 4LUZA 5IT9L 4YY3L 3KF6A 3CRKC 3VR3A 3C46A 2RVLA 4LF9L 1GM5A 2A68D 3KUPA 3PO3G 3UE0A 2ZTCA 5IWAL 4LNQA 3OTOL 5C3XA 3G7LA 5FO9B 1D2BA 2L12A 1DONA 3BYTB 1MD2D 1VQBA 2EPBA 2KQ3A 2VW9A 3CCLA 2OTLA 2O4XA 2K14A 2R92G 3GTOH 5BR8Q 2F0KA 4XQJA 3MQGA 4BBSB 2A6ED 3EQLC 1IZ6A 1TWHB 4TKOB 3NSWA 3CC4A 1PRTD 2NVXB 3R2TA 2YAJB 1HFGA 2B2YA 5AFWA 1JWSD 3RZOB 4A93H 4Q0FA 2JA9A 1UE6A 4XIGS 3CMEA 5IYBG 2ZJRA 1FJGQ 1SNOA 1UNSA 4WRDA 4OELB 3CC2A 2O5JC 1DM0B 1VQMA 2EZVA 3U4VA 2WAEA 1T5XD 2E2JH 5CV4A 1VQIA 2PI2E 3PUXA 2HHHQ 3MEHA 2YSHA 1LTGD 3NTIA 3CAMA 1YIJA 1IYUA 3TMEA 1ENAA 5LL6X 2WB1G 3EBEA 3E9IA 4RCNA 3HP3A 2KCCA 4R4TA 3VR6A 4HTHA 5E4XA 1I6HH 4IO9A 1I4RA 4HEDA 2N78A 2RCNA 1PH3A 4DV6Q 1S5FD 2EE1A 1D6EC 3EA6A 1STEA 3FPPA 4X64Q 2G9DA 4DV0Q 4GKKL 4RKBA 5CMDA 1S5CD 1X32A 1F9RA 4GN4B 1KRTA 5C4XH 3OWFA 4IJLA 3SK8A 1HUMA 2DNEA 4PQXA 1D5XC 1SFOB 4BY7B 1JWUD 2E2JB 1IL8A 4QF4A 4DV3L 1AEXA 2K7VA 3S15B 5C44H 2K32A 5J22A 1LM0A 1MSGA 2BH8A 1E7ZA 1H9SA 2LXJA 4NXNQ 3PIP3 4DV5Q 4DKAC 4JI5Q 1VQNA 4PMCA 1UEBA 2Q8RE 5M3FH 1X3GA 3FKIG 1JMQA 4B9WA 4IALA 4L6TB 2LAJA 5CC4A 4YCUA 2F52A 4JOIA 4KMUC 2N8NA 1RIPA 4IFDJ 1B4OA 1VQFA 2KEDA 4AQYQ 4IPCA 4A3CH 4CDCC 4UY8C 4IUQA 4A3KB 2K50A 1EYDA 2K04A 3L9AX 1ICFB 2M9VA 3STBD 5JVG3 4DV1Q 3IFDA 4X6AH 4L5QA 3BG3A 3DHQA 3RZDH 5IYBH 2BCOA 2N55A 1B2TA 4DNIA 5EQ0A 3I4OA 2BA0A 5A2QE 1YNJD 1LO5D 4DAVA 2UUBL 1K0SA 1CFMA 4BY1B 2GN5A 2YU9H 4RA8A 3BJUA 1SNCA 3OMCA 2QA4A 1ASZA 1PLFA 4KN7C 3CCQA 1EG4A 4BBRB 5FLXL 1AE3A 3LKXA 4ZAIA 1N33Q 1G6PA 4DAMA 1OXVA 3ICEA 4FO2A 4XT1B 3I4NH 2IY5B 2B29A 1GUGA 3DM1A 1K9MC 4CKEA 4LF9Q 3HG9A 5KIXA 3QJYA 1CSQA 2KHSA 4OEMB 1F9QA 1L1OB 3E9HA 3K0XA 5JPMC 3JAME 4XT3B 2QW7A 1SROA 1VQ8A 3RD4A 1U0LA 4I7ZC 4C56C 1RKNA 5J3BA 2Z4IA 1MKHA 1F2ZA 5IYDH 4A3EG 4A3GG 4ME3A 4IN3A 4TRDA 4NXMQ 3I4NG 2JA8B 4A3BG 1CKOA 1I3QH 4QIWE 3T51B 4JI0L 5C0XH 3T1YL 3BVZA 3PUWA 1AZPA 5BN5A 1H9MA 5BN3A 2F0FA 3C1EA 1Z9FA 1SMYC 2Z6KC 4CKCA 1PH5A 4C2MB 1JJCB 2F0HA 3R8BA 1HPCA 1TKWB 2JJQA 3L3OC 3S24A 4JYAL 4JI3Q 4HN7A 4A3DG 4KI0A 2A8VA 3E0EA 1UE5A 1OTCA 5C4JB 2XSCA 1FJGL 5HY6A 3CCEA 1ZEQX 1GD7A 1CQFA 1MJCA 3E0JA 3NQTA 1XPRA 1E24A 1GHKA 2VUMG 2JQOA 5M5WB 1DXMA 3RNUA 1K28A 1PTOF 1DCZA 1VQ6A 4A3CG 1EQQA 1V1QA 2AUKA 3MHBA 4UDUC 4WORA 5FLXE 3S1QB 2L1BA 4ZKBB 4OHJA 5ELDA 3HOYB 3PO2H 3TQYA 5JEAG 5CQ2A 1V1PA 4G7HC 2RCFA 5FO8B 1XMQQ 2ENBA 2F0GA 1EY6A 1EY7A 4BXXH 4G4KA 2ZR6A 3ZJYC 3K80C 4RGMA 4K2LA 3AEVA 1GUWA 4JI1L 4NMZA 3SR1A 1LT4D 3EN2A 4RG1A 3W3AA 1LTRD 3A55A 2K5WA 2MFIA 2IX3A 3VYTA 1G291 2NVTH 2RSOA 1PFNA 4R4CA 5IYDG 2K6AA 1YVCA 2MPMA 1FL0A 3OMGA 1JOQA 4K6DA 4DV7Q 4HCSA 1Y69U 2J0TD 2DJYA 1W3SA 2ZJQA 5C6AA 3JAMc 1VF7A 1UE7A 4K8IA 2NUCA 2NTSA 1J5EL 4B3TL 3I7FA 4LF6Q 2PMZE 3S2DB 1SNQA 1HR0L 3AFQA 3HZXA 3P7JA 1K83H 3M4YA 1EYCA 3TDQA 1S5DD 3QR8A 2XPAA 3EROA 4IUPA 1IHZA 3CCVA 2ZXRA 5E7NA 3NK9A 3A5ZB 3NWTA 1SDFA 1VMCA 2AWOA 2F4VL 1X65A 4FDBA 2XNAC 4XDXA 4OXPA 3MAQA 3LKXB 1KRSA 2EYPA 2KJXA 3D0FA 2WACA 2H4OA 4MZ9A 2N88A 2NVYB 4B3SL 4BY1G 5CBEE 1BDOA 2Y0SE 3MCBB 3DWAA 1QVCA 2JN4A 3QOLA 3NBIA 4KHVA 1L0YB 2QILA 1EIFA 3GTKB 4HIKA 4OO1G 1EY9A 2O2LD 4A3MB 3S2DH 2RBMA 4KKTA 2FMMA 2JA5H 1F9PA 3SEBA 3D6WA 1VQJA 2ICEC 1JICA 2DGYA 2JA6G 5CV7A 3K5NA 1DOLA 4POFA 5M5YH 2MQHA 5DM73 2HCIA 3S1RH 4JC0A 4Z9CB 3P75A 3RN2A 4KTAA 1AP0A 1FGUA 2XP5A 2ZXPA 1IW7C 3PGZA 2NZ1D 3CHBD 1I6VC 4IJHA 1YJWA 2B63H 1G6ZA 1ONLA 4LWCA 4X66L 5K36H 5IIFA 3HOUH 1QNKA 3HOVB 3PCOB 1MIUA 2F3VA 2RSNA 4MTNA 2IX0A 1L0XB 2BE5C 3H3VI 4XQNA 1YNND 4A3KH 4RGOS 1R4PB 1JOOA 3PIOA 3RZOH 3C2PA 4B3RQ 1WTXA 2KCMA 3MA2B 4NP5A 1E1OA 4BS9A 1SMXA 1K8OA 4JBJA 2JA8H 1KDCA 3E3XA 4NW2A 2I5LX 4NPSA 4HJ7A 2KCTA 4LMQD 3UDGA 4M1UB 1LTBD 1JWMD 4GOPB 1I5FA 1K9RA 5AJ3Q 2YSFA 1LACA 2PZTA 3TP7A 3G4SA 3KADA 3SK4A 1V1OA 1WOCA 2K5NA 3ERSX 4PZ7A 1HR0W 1G2TA 1Y1VG 2DK7A 4HJAA 2WINB 3ODKA 4K5XA 4BBSG 4A3IB 2R7DA 4LJZC 2E2HH 3KAHA 2ASBA 1PYWD 4DR6L 2PQAA 3S14B 5E66A 4L8JA 1WTQA 3BVGA 1R4QB 4HIDA 1SEBD 3RMHA 2ZTEA 1VQCA 1K8GA 4QIBA 1I50H 1TWAH 5COYA 3TEHB 1AH9A 3HOYG 3I4MH 2XP6A 1YNJC 5ELOA 4ZYSA 4EX5A 1O7YA 1V43A 1N33L 4C3IH 2EYMA 3S1QH 1U9RA 3S2HB 3ULPA 2UXBQ 4HJ8A 1JJ2A 4R8IA 3I90A 1B9MA 4ILWA 1S3OA 1RF2D 2F3IA 4X65L 1YHBA 1E3PA 3KBGA 1W6JA 1TK7A 4AYBG 1YJNA 1WTRA 2OXPA 5IGFA 5FOBB 4A3IH 1K73C 5KEEA 4DK1A 1SFOH 4BY7H 2HHHL 3S1MH 1M90C 2SOBA 1XX8A 3I72A 2NVTB 2FHTA 3TP8A 5C3EG 3A8KE 3CQZB 2DJGC 5FLMH 4IQZA 4A3KG 4KHPQ 2LS01 2IHEA 1YNXA 3CNGA 1VQGA 3LWUA 2F3WA 4JYAQ 3PQIA 2P5ZX 2F0QA 2XP8A 5I9PA 5M3FB 5IGGA 4BY7G 5I9OA 4JI2L 1D7QA 4UP7A 3J81i 2UXDL 1DJRD 3CXCA 4O1NA 3CMAA 5JEAH 2F0SA 1PH8A 2LSSA 1ESFA 2PQEA 4DR7Q 4RMFA 4B3ML 3D3RA 1PRTC 4KJNA 3J80i 3S1NH 1JE5A 4Y52H 4IPDA 2Q5AA 3D4WA 3K5OA 2H5XA 1HHVA 1EQVA 2SNSA 4I7AA 3OTOQ 1EWHA 5IWAQ 1LV9A 1Y1WH 5H1SE 1PZID 3VYUA 2IPKD 2C9OA 4FYDA 1CI3M 4YY3Q 1KTKA 1PXUA 3TDBA 5IY0A 4WJ3M 3BU2A 1B1ZA 4OIKA 1BVSA 3K5MA 2MGSA 2K03A 2RDFA 1F2LA 4DR5L 2X6GA 2X6LA 2RA4A 2JA5B 2UU9Q 1BKBA 2UUBQ 2UU9L 1LABA 4A3MH 4JW0A 1FVIA 2F0JA 1PTOD 3JAMi 2NVXH 5HGQA 3NQIA 3STBC 1GUNA 4G7ZC 1OO9B 1YEZA 2CCZA 5EJWA 5DAUA 5M5YB 1FNWA 1PV4A 4JBMA 3ZYYX 4A3LH 1LT3D 4KK7A 1CHQD 3R93A 2ZQUA 3KJPA 2NB0A 2K28A 3AQQA 2OT2A 3PQHA 1S5ED 4BXXG 3FP9A 1ZXTA 1H9RA 1EY8A 3F2CA 4DR6Q 3TREA 1H9JA 2EXZA 4QUCA 1A63A 4P74A 4LFAL 1IYJB 1IBML 2ITKA 3A8JE 3VYRA 2DY7A 2ZXOA 3PO3B 1D1KA 2MJ8A 4C3JH 5KNCA 2K5DA 2K75A 3T1YQ 3HOXH 3GDEA 5GAGC 4JI0Q 3S17B 5EKLA 5CV9A 3FSBA 2CKZB 4C3HB 3PF4A 4A0UA 3KDFA 1FR3A 1HJPA 1NMGA 1NSNS 4JI7Q 2ATWA 2VNUD 2JX8A 1STHA 2LY7A 3RLFA 2KENA 3PIO3 4DV3Q 3EFXD 2K05A 2LMCB 5LMUL 1PRTB 4K0KQ 1B53A 3ULJA 1GUTA 2F4VQ 1WD0A 2R6GA 4DK0A 1TWFH 1GKHA 2UXCL 1QVFA 3GP7A 1S5BD 3Q0AA 3NUCA 1SYDA 3U9OA 4OX9L 1WD1A 1STYA 3MQHA 1O7IA 1BCPF 3G6EA 1Q90A 4A3FH 1LTLA 1Z47A 4DV7L 4F88A 1ESRA 2UUCQ 4AIMA 4EGVA 4A3LG 1Q1BA 2WP8J 5E5WA 3GV6A 5IP7H 2E5LL 1HNWQ 2R61A 1N34Q 2QEXA 5I6YA 3HEJA 4DV1L 5C4XG 3Q24A 1WTVA 2V4DA 4DV2Q 1O80A 4AQYL 3GTLH 1KNEA 3GTMH 1EEID 1EOTA 4KY7A 5M5XB 2D9UA 3MXNA 5IP7G 2A73B 1B9NA 2NWGA 2WFWA 2HD3A 5M3MB 4OWTB 1A15A 5LHY1 4PNYA 2JK8A 3M4OH 4XQQA 1RTOA 4DPGA 1IYVA 3E6ZX 4A3JG 5A35A 1KLGD 1Y14B 4CDEC 4CDDC 4LF5L 1WR7A 4DN4M 1S40A 4IUNA 2ZTDA 4JG2A 2RKSA 2Z6KA 4IPGA 3C3LA 4XYQA 4C3JG 2Z6BA 3KF8B 3CCJA 5IP9G 2GVAA 2QDBA 3T13A 3J81L 3OSOA 5IGBA 4EQPA 4O2DA 4JV5L 1AE2A 2F4IA 2SDFA 1E0BA 1HR0Q 4POGA 1SJHD 1CKNB 2N3SA 2HIVA 1HXYD 3S1MB 4KN4C 4PMWA 1RDPD 3HRZC 3IKJA 4KY5A 2QGQA 3CQZH 3OPOA 3W2DA 3H0GG 1LT6D 2ZAJA 3GQBA 1SJED 2F0IA 3DEOA 3GV3A 4I65A 3H3VH 3S16H 1P16A 3OIQA 1IBLQ 5IGEA 1EYGA 1ENCA 1QB5D 3FKIB 4DR4L 2A74C 5D14A 2QCPX 4CDFC 3NPPA 4QQBX 3VA7A 2ZR5A 1X3EA 2E8GA 3KJOA 1MGSA 2PZUA 1K3RA 4H02A 2L0CA 2F0DA 1GJXA 1SE2A 2MNAA 4ZUIA 4DA2A 2XP7A 2R3ZA 1HH2P 3L0OA 2C5CA 1N9WA 4LW1A 3WH0A 1SRUA 1L0WA 2PCFB 3RLOA 5E4WC 3BYYB 2D2CC 1ET9A 2PPBC 3BZCA 3DEPA 5D3DA 5LMNQ 1A2TA 2XTIA 3BDCA 1RODA 4GLXA 5AJ3L 2VQEQ 1X6OA 1B7YB 4IOCA 3HOWH 2A69C 2K4KA 2E2IH 2AUJD 3O13A 3ONAB 4YWLA 3NXWA 4RCOA 2RHQB 1V8QA 4JOIC 2ALYB 3DWPA 2CWAA 1MJEA 4CBVA 2OQKA 3T4AC 4LFBL 3J80c 1CSPA 2ZJPA 1PH1A 5IE8A 1G2SA 3QIAA 2Z8LA 4LF7Q 3TP6A 3TRZA 1RP5A 3M85A 1AZQA 2H1EA 3GTGH 5CV6A 4ZUJA 1HNWL 4E6IA 3G6JB 2E5LQ 2OQ0A 2EXDA 1QWYA 5IGCA 4GNXA 2F0MA 1XJVA 3GTPB 1JCKB 3CU7A 3F2DA 1DD2A 4FF1A 2JE6I 4O42A 1A3TA 3Q22A 1WFQA 2E2DC 3ULLA 4P72A 1N32Q 3MXNB 4IFDH 2B2WC 5C3EB 3AFPA 2E45A 4P2CB 2QEJC 5FK9C 4FF4A 4EVOA 2YSGA 4LF8Q 1GUOA 4R9WA 2TMPA 3OW2A 2YTYA 2VQFL 5EGTA 4HR7B 1BXTA 4F87A 4KKUA 1EQTA 1VQKA 2B2UC 1PMRA 1EYAA 5LMNL 1U5KA 3HKZG 5C4ZA 4MTKA 3H94A 1QILA 1EIGA 1I4QA 1EWCA 5KNDA 5CGKA 1JORA 4K14A 1PFSA 1ET6A 1D1IA 2AQ3B 1ZYRD 3K5LA 2RDGA 4KJOA 3J7AV 3PIPA 1Z7TA 4S3SA 5EPKA 5EBDA 1CHPD 4A3GH 4DUYQ 1TR5A 3KF8A 1TY0A 1LTTD 1PH9A 2A1AA 2O5IC 3CCUA 2I0QA 3HOVG 1O7ZA 4LF6L 3S1NB 3SXHA 1ML0D 4HMIA 1VQAA 4X62Q 1TT2A 2HT1A 1XPUA 1EFID 4O0AA 2CHBD 4DV5L 3KLWA 3MTSA 2PZWA 4UHVA 2PW5A 4A75A 2A68C 1P8LA 3S9WA 1SNDA 5D65A 4X3TA 2BDOA 3QG1A 3CPWA 1JOKA 2HIXA 3HFZB 2JP1A 4K2KA 1HTPA 3CD6A 4CGYB 2B2VC 1VCIA 3HOZB 1CZGA 1WTWA 2RQXA 2Q2HA 1G91A 4DF7A 4YHHL 4LK1C 3NTKA 2OF1A 2IW3A 1PH7A 1K3BC 4LFBQ 1HNXQ 2AMCB 3TN2A 5EAYA 2YTXA 5CYUA 1NCVA 4JI4Q 4ZK9B 5CR3A 4N9TA 4J6HA 2KVMA 1PTOC 4Q5VA 5FLXc 2G5DA 2MO1A 2Z0SA 3FVQA 3MXPA 4X3SA 3UDFA 3G71A 4OONA 5KYLA 1DOMA 1IKMA 1BCPC 1PYSB 4A3JH 3KCEA 1EIYB 5C0XJ 3BZDB 2JMFA 1V9PA 4GLVB 5GAEC 3R2IA 4GNXC 3MZ5A 1MHWC 1IBKQ 2E2HB 4GKJL 1Z6HA 3HOZH 1HA5A 1KNAA 1RL2A 1JQYD 3A7AB 3EIVA 3VR5A 4R8NA 2NVYH 2F0TA 1EG3A 4CJ2C 3HS0C 5ELBA 2NVQB 4OO1H 2JA6B 1E2VA 3S17H 4G7OC 1EQRA 4R4OA 4JI3L 2WIIB 2SEBD 1SE8A 3KABA 4DR1Q 1H95A 4DU9A 2KXQA 4JK1C 4PZ6A 3G48A 5NUCA 1W2BA 1TQOA 5ISRA 1VDZA 3FKIH 3T1HQ 3B6YA 1YZ6A 3BDOA 3VA5A 4L5SA 4ODGA 2F0WA 1XTDA 1PHJA 3TZUA 3FEWX 1JB7A 1SR3A 4QCLA 3RLNA 3M3YH 3KAGA 1EOVA 1HZ9A 4RGNA 4DR2L 3GTKH 2J7ZA 1J6QA 4X65Q 3CF5A 5DNFA 3CC7A 2QDLA 1A2UA 1HUNA 2WADA 2XP3A 4E5RA 3HOUB 4CJ1B 4A3EH 2NVQH 2EZ5W 2MUYA 3W5OA 4A3BH 1T9HA 2XPBA 5M5XH 4H7BA 4YIJA 2BDNA 1XTCD 2HUGA 4LAAA 1JJGA 4K0KL 3HKSA 2WAQG 3SVMA 1B50A 2K1BA 3I91A 1QVGA 4ID6A 5DLQE 4OWWB 3X3NA 2K5QA 5G3LD 1JC7A 2NN6G 5GROA 2DUDA 2I46A 3NEMA 4ABNA 1EFWA 2MP1A 1UWVA 1XNQL 5JAVA 1QZHA 1UAPA 3H91A 1PINA 1X3FA 1N36Q 5JVH3 1VS0A 3GTQH 3WDNA 2VXWA 1XXGA 1XMOQ 2YTVA 1NUCA 4LFCL 4GN3B 1ASYA 1Y1VB 3BVMA 4BA1I 3A7LA 5HGTA 1A8VA 1G51A 1A62A 4IOAA 4HCEA 2M8JA 5C3EH 4RHSA 4B08A 3D31A 2KECA 2C35B 4L63B 3K81C 5LMNW 2VL6A 4KHZA 1SYEA 3HOUG 3IAYA 3OOBA 3CP0A 3PSIA 4LUVA 5E65A 2D62A 3GTJH 5M9OA 4V0BA 2EY1A 1H9KA 1A6XA 3QWNA 1C8CA 1I4XA 1J8IA 1CZWA 4U84A 1O78A 3Q23A 3I8ZA 3NBHA 2UUCL 4IZ8A 1HQMC 4R1JA 4A93B 4C3HH 1ICWA 3M9BA 4AYBB 2RDHA 1OXTA 1Y8PB 3K6OA 2ZQSA 2EJMA 1NY4A 3VR4A 3UDIA 3A74A 2JA5G 2UXCQ 1BQQT 1WI5A 2EYHA 2HCCA 2FXQA 1KC8C 1I4GA 2LKVA 1TWFB 4K8JA 1TWCB 2XWJB 3VDYA 1GHJA 2Q8IB 3A0JA 2HQLA 3ND8A 1U4PA 1VQHA 1IBLL 2JA7G 2Q8TA 2ZQVA 1BBXC 1WJJA 2B2VA 3K7AB 1XNRQ 3WWVA 2RE3A 3PO3H 3FMCA 2N49A 1L1OC 1M8AA 2K5VA 2X69A 2JV4A 2EY5A 4B3MQ 3P1HA 4DAYB 4DK6C 4LUOA 3KYHC 3WOEA 4DR3Q 3TC5A 1KDBA 3NELA 3FDTA 1YHQA 1PRTF 4J1MA 4DNRB 1F2YA 2JA7B 4C1NI 1A3VA 1SXTA 3CW2C 1EZ8A 1KQSA 4DGZA 4U86A 1HNZL 4A3DH 4ZCKA 1X9NA 3L4HA 4KHPL 3R3OA 4JI6L 5IT9E 5HURA 2EVBA 3LE4A 4YCWA 4CKBA 1TWCH 1BR9A 4F8MA 1RD9D 2CQOA 5KGUA 1SYGA 5IP9H 2DN8A 1ILQA 4DAYA 1K0RA 1QNUA 2D5DA 3SHLA 4MIUA 5J1ZA 3TBIB 2M3OW 3DLLA 4LF5Q 1QJOA 1SN8A 5ELEA 1PVOA 4FXKC 1X3QA 3NTPA 4JCVE 1TIID 5A2QL 3X3MA 3NWSA 1BBUA 5FLMG 5IT9c 2UXBL 2GVBA 1PA6A 2CW0D 3NE5B 2R92H 1M1KC 4UAIA 1FLCA 3AB9A 2Y0SG 5KYIA 3PO2B 2CQAA 2Q2IA 2F0NA 5I2YA 4A76A 1NE3A 1OXXK 4DV4Q 2OTJA 2WAQB 3BZKA 5ELNA 3HKZE 1C4QA 1YW5A 2K52A 4IPHA 1QG7A 3QB3A 3Q8DA 2E75C 2Y0SB 2EQSA 1PZJD 2PYKA 2LXKA 4PMBA 1XMQL 2JEAI 3FSCA 1QZGA 2NZHA 1NMVA 2WKCA 5IOCA 5EKKA 2PMZB 3I3CA 1YHAA 2EOTA 4EQ5A 3IFTA 3KK7A 4OIJA 4IUUA 3T16A 4JI2Q 4DAPA 1WTHA 2NN6I 4QMGA 1QUQB 4MHEA 2NBFA 1E1TA 1VQ5A 1K9QA 4OL7A 1B3QA 3F2UA 5M3FG 1W6KA 2RF4A 2Z1CA 2UUAL 4UP8A 4C1NK 5DM63 4FXGC 3IRBA 3F1ZA 1ZCNA 3RR5A 4QL5A 4BY1H 4BBSH 1DOKA 4B3RL 1AFPA 1OXUA 1Q12A 1WCMG 1HA6A 3J80E 1VQ4A 1Q7YC 1HNZQ 5AHTA 4HAEA 1U4RA 2B2UA 2NYZD 1J5EQ 1EEFD 4Y7NH 3M7GA 2F0LA 2KA7A 4FXDA 3ER0A 4N8FA 3VR2A 2F21A 5C4JH 2BOSA 2VQFQ 1D5ZC 1FNUA 1L1OA 2I5MX 1CUKA 4X3UA 2YSBA 1S72A 3F8TA 4GZYC 3W1BA 1PH4A 1X55A 1HZCA 3HOWB 1CM9A 1O6WA 1XNRL 5FO7B 2E2IB 2B63B 2PO4A 2F1MA 1PTOH 1ILPA 1SSOA 3SK6A 1X3PA 1PZKD 1SYBA 1NJIC 3MEFA 4RH6A 1Q81C 3HOZG 2EJGC 1HCZA 2FINB 4DV4L 3KLSX 1VF5C 3HOVH 2XVSA 1Y1VH 2ID0A 1LUZA 4JI1Q 1I6HB 2J4XA 2WB1E 3OYYA 5M3MG 4H13C 2XGTA 1TR8A 5E62A 1N34L 4JBWA 1EY0A 1KHIA 1TY2A 3GTLB 3AMUA 1EUJA 3J81c 3GTMB 5JJKA 2ICIA 4YWKA 3M4OB 3I70A 3OWEB 5TSSA 1C7YA 2B8GA 2XIWA 2BA1A 4ZKCB 3U4ZA 4N9PA 3GO5A 3L7ZC 1SNMA 4RHRA 4KV6A 3EJIA 1AW7A 5L37A 2L55A 1PYBA 3M4PA 3DWQA 5ELCA 1XPOA 5JJIA 1ZYRC 3I55A 4FP5D 5GADC 2UUAQ 1KXLA 4P71A 1EY4A 4UP9A 4QB4A 5F2DA 1BBWA 2QRVA 1YI2A 4GS3A 3K57A 2PNHA 3KLSA 2CVRA 1D5MC 2EY2A 5KRUA 4B3TQ 4GOPA 2VUMH 4HIMA 3ND9A 2V1CC 1DYQA 2ZM6L 3I2ZA 2DNCA 1BCPD 3V96A 4EQOA 1XNQQ 1PH6A 1TWGB 2DMVA 2EYJA 2PNRC 2R7ZH 5E64A 5JEAJ 1A0IA 2I5HA 4HSPA 1E22A 2L9HA 3I73A 1G8ZD 2CW0C 2Q2TA 2DWVA 1LTAD 2L15A 2AWNA 4HSVA 3H0GH 3LGJA 2KHJA 1D8LA 1Q82C 1Q46A 1B3AA 1WMVA 1RCVD 1JMCA 4C3HG 3RZDB 2F0UA 4L5TA 4A0TA 3KBXA 1HQRD 2WV6D 1OXSC 4J8QA 4ME5A 1VQLA 3N52A 4EQNA 1CKMA 1Q86C 4HMJA 2KEEA 4QIWB 3K59A 1HTLD 2LFNA 2QF7A 3V05A 1RJTA 3QOJA 1NAPA 4KY6A 2VUMB 1LYLA 4DV6L 1N8RC 4V190 4K5VA 1JR0D 5I4DA 1A3UA 3E5SA 5LL6S 3HOXB 1K8MA 2JYOA 1QOHA 3DMUA 5IGDA 1LTSD 3S1RB 4OO1I 1TXYA 2IWHA 2A6EC 4CJ0B 4XTCS 4IFDG 4WFN3 2WB1B 4JV5Q 4H0LC 3A8IE 4IUTA 2IX1A 3HOXG 4DR1L 4WJWA 1F8AB 3MWYW 1Y8NB 5LMUQ 1STGA 4B9XA 1BUVT 3J80L 1TWGH 1BOSA 2R7ZB 1HZBA 5C3WA 3J7AF 4U85A 5CORA 2D0PA 4ZLTF 3MVVA 4KLKA 1DZ1A 2L4NA 3H0GB 1KAAA 1F77A 2CWPA 2FJ2A 3HGBA 1RTNA
chains in the Genus database with same CATH topology
1N36L 4DR3L 1CTMA 1I5HW 2CFMA 4IFDI 2BH2A 2NN6H 2WKDA 2VB3X 4HJ9A 2R7ZG 1IBMQ 1GXDC 2KBNA 2UXDQ 2XP4A 1WCMH 2DY8A 1NBWA 4A3FB 3RUZA 1LLRD 1LT5D 2B2TC 3N6RA 4YCVA 1VQEA 3QO2A 1Q8KA 2NTTA 1UEAB 1JB3A 1X54A 3JC66 3TZDA 2G9HD 4QY7A 3M4QA 3GTPH 2K33A 4DXGA 2YV5A 1HNXL 2RHSB 3UE1A 4A4IA 1VQOA 3H3VC 2EYFA 3Q6SA 3KLRA 1K8AC 1MI2A 3W1GA 3PF5A 1Y1WB 3J7ZC 1PTOB 1SYFA 2FFKB 2WAQE 4FNFA 3OHXC 4K5WA 3TP5A 4RWSC 4BA2I 1E2ZA 3P20A 2KHIA 2QKIC 3T1HL 4FF3A 5JOBA 4GN5A 4CHTB 3MC0B 2MHVA 4X62L 5EPJA 1CK1A 3K7AH 1SBBB 3VYSA 1L2FA 1TWAB 3GTOB 4A3FG 1NR2A 2EY6A 1VQ7A 1PDQA 2B39A 3NENA 2JA8G 3EVQA 2F0EA 1XWEA 1CKNA 4A3BB 3PUYA 1TU2B 1S4ZA 5JPNC 1EWIA 3BDLA 4QJFA 3S2HH 4U673 2XN9C 4U68A 2HDMA 4PG3A 4NB3A 4RAUC 2XRQD 4JI7L 4DR7L 1KL9A 5C4HA 4KD4A 4A3DB 3K8AA 1B70B 3FRPB 2B3GA 4R4QA 4QGUA 1F9SA 5C0XI 3M3YB 1SNPA 3TSSA 1R9TH 3OIPA 1JE4A 4LFAQ 3PUVA 1NR4A 3A54A 4NDXA 4KD3A 4XYOA 1QE6A 4C3IB 5T1IA 3CCRA 2A19A 3MXGA 1PFBA 5J39A 4ZQ3A 3K7UC 1WYDA 3H6MA 4FF2A 1MSHA 4ALPA 1B8AA 4OGQC 2SNMA 2OCEA 1MBYA 5CV5A 1EZ6A 4ZRZA 1LTID 4XXEA 1XYIA 3CRLC 3MFYA 2KUMA 2VB2X 1SMYD 3JAML 2IT1A 4C3IG 5EPLA 3SGIA 4X64L 1U4LA 3H15A 4DV0L 1T5EA 1B44D 1GVPA 5G3LF 4GOPC 3J7A5 2VY3A 3PUZA 3LX0A 3KOJA 2IHFA 3HKZB 2YYZA 1E2WA 1STBA 4TQUS 2HQEA 5CV8A 5D3IB 3MCBA 3GTQB 5C4XB 2R7FA 4H44C 1PFMA 1R9TB 3AYHB 3NTHA 4A3JB 3NP8A 4DR5Q 2TSSA 3T56B 3WOFA 1NMFA 1YJ9A 5JJLA 4RGTA 4DFAA 1PH2A 1KABA 3OOCA 3UDXA 3D6CA 3BS1A 1F2MA 5IODA 1CA5A 5FJ8H 2F0PA 2Z4HA 2OWOA 1HFNA 4DUYL 2L5TA 2M2LA 2FMCA 3NHHA 1SE4A 3DXJC 1CT1D 2B2TA 3CPFA 2OEOA 2JA6H 1HZAA 3KDFB 5K5PA 3KF6B 1YBYA 2JXWA 3U9SA 2AQ1B 1TS5A 1GUSA 1CQVA 2ZQTA 4JI5L 2F03A 2B2WA 1H9SB 1XMOL 3S15H 3HOYH 2HDLA 3I4MG 4GKJQ 4X3KA 5FJ8G 3MFGA 2EIFA 2ZM6Q 4M8AA 1RHPA 4REXA 4MNOA 1II3A 4BBRG 4DXFA 1WVLA 2EYOA 4G57A 2IJ0A 5CBAE 4LF8L 1IL2A 1UUPA 4JI4L 3KAIA 1FGBD 1C48A 4A93G 3K0YA 1J9OA 4GKKQ 2PQAB 3TS2A 2B63G 1Q3LA 2AQ2B 4YHHQ 3AU7A 1EIHA 5GQOA 1Y1WG 2XWBB 4APVA 4AH6A 5BN4A 4A3EB 2E74C 1IKLA 3I4NB 2K5HA 1TS2A 4TVAB 1TS3A 2KOLA 4DR2Q 1AN8A 1YITA 2JSOA 5IYCH 1EY5A 3SDZA 4X66Q 4RKLA 1I50B 4JI8L 2EJFC 3CKIB 1VMPA 4K6LA 3I4MB 3U50C 1I94L 5K36G 3MXUA 5C0XG 1ENFA 5T1GA 3KFUA 1KAWA 2F0OA 2Q2UA 1Q1EA 2E76C 5ELFA 1U4MA 4TSSA 1HRJA 3FHWA 3J81j 4OWXB 3PMFA 4JBKA 5DEHA 1TWHH 4A3MG 1QUQA 2AHOB 3CCMA 5C5LA 4A3GB 3U58A 3NBHB 3S16B 3TCZA 5E3FA 3V2TA 4LF4Q 1KD1C 1NTGA 4KKSA 3F2BA 2MDIA 1TS4A 1O7LA 1ZKOA 5C44G 3FPUB 1IXRA 3D4RA 4B3SQ 5BR8L 2R93H 2NZOA 3PO2G 3C1FA 3GTJB 1GOZA 1C0AA 2A6HD 3PV0A 2PW7A 4ULLA 1QCBD 2GA4B 3M7NA 1SE3A 3CCSA 4DUZQ 3D4DA 1KIXA 2YSIA 5C44B 3K58A 1CA6A 5KNBA 1Q8IA 3RN5A 1VQ9A 2Y8NB 3GTGB 2R93G 3J81E 2JXMB 5I6WA 2B8FA 5IYCG 1N32L 5JJZA 5M3MH 4F7XA 2ZT9C 4MN3A 2JEBI 5M5WH 1EU3A 1FD7D 2IL8A 1BNZA 3ERQA 4HJ5A 2VZAA 2L4JA 1VQDA 4UPAA 1UE1A 1M4VA 4NXNL 1I94Q 2R93B 1I4PA 1SYCA 4R4IA 4P73A 4Y7NB 2L11A 4QUFA 1Y8OB 5EKIA 4DK3C 1KDAA 2VS1A 5GAHC 4LF7L 5EBCA 4WJ4A 1BF4A 3TS0A 2JA7H 4OX9Q 2K01A 3S14H 2DK1A 2B2YC 3UI2A 4IUVA 3ITPA 3LWEA 4A3IG 3A5UA 3A56A 3H09A 4GLAC 1KLUD 2EYLA 1IW7D 4RFBA 2PI2A 1STAA 4P75A 2D0OA 3SE0A 2A5HA 4DUZL 3URYA 1K83B 2M00A 2EDGA 4HIOA 2A69D 4GNXB 1I4HA 2ZR4A 2VQEL 3D8GA 2XP9A 1DGSA 4C3JB 4J15A 1WTOA 2I07B 1V1PB 1SAPA 1BCPB 3SK5A 5C5MA 5E1FA 1WCMB 3LNNA 4LF4L 1FYCA 3DUZA 2YU9B 4YWMA 3GD7A 3T53B 1EU4A 4JI6Q 3I56A 1JT8A 1I3QB 1STNA 4L5RC 1EL0A 1SLJA 3L2PA 4AYBE 4DR4Q 4BBRH 1YNNC 2KCNA 3HOWG 3KAFA 4DV2L 1BO0A 2AKWB 2R92B 3DM3A 1FNVA 1VQPA 4LFCQ 2ES2A 1IBKL 4DNTB 1TVXA 2M8IA 5FKAC 1WTPA 3I4LA 1X56A 3FS8A 5I2XA 4JI8Q 4NXML 4PZ8A 4BWGB 5U47A 3OW7A 2A6HC 1GO3E 4NKLA 2XRSD 2MO0A 3IL8A 1C9OA 2F0VA 4IURA 2BE5D 4PV1C 4C2MH 3J7YW 4FVMA 4LUZA 5IT9L 4YY3L 3VR3A 3CRKC 3KF6A 3C46A 2RVLA 4LF9L 1GM5A 2A68D 3KUPA 3PO3G 3UE0A 2ZTCA 5IWAL 4LNQA 3OTOL 5C3XA 3G7LA 5FO9B 1D2BA 2L12A 1DONA 3BYTB 1MD2D 1VQBA 2EPBA 2KQ3A 2VW9A 3CCLA 2OTLA 2O4XA 2K14A 2R92G 3GTOH 5BR8Q 2F0KA 4XQJA 3MQGA 4BBSB 2A6ED 3EQLC 1IZ6A 1TWHB 4TKOB 3NSWA 3CC4A 1PRTD 2NVXB 3R2TA 2YAJB 1HFGA 2B2YA 5AFWA 1JWSD 3RZOB 4A93H 4Q0FA 4XIGS 1UE6A 2JA9A 3CMEA 5IYBG 2ZJRA 1FJGQ 1SNOA 1UNSA 4WRDA 3CC2A 2O5JC 1DM0B 1VQMA 2EZVA 3U4VA 2WAEA 1T5XD 2E2JH 5CV4A 1VQIA 2PI2E 3PUXA 2HHHQ 3MEHA 2YSHA 1LTGD 3NTIA 3CAMA 1YIJA 1IYUA 3TMEA 1ENAA 5LL6X 2WB1G 3EBEA 3E9IA 4RCNA 3HP3A 2KCCA 4R4TA 3VR6A 4HTHA 5E4XA 1I6HH 4IO9A 1I4RA 4HEDA 2N78A 2RCNA 1PH3A 4DV6Q 1S5FD 2EE1A 1D6EC 3EA6A 1STEA 3FPPA 4X64Q 2G9DA 4DV0Q 4GKKL 4RKBA 5CMDA 1S5CD 1X32A 1F9RA 4GN4B 1KRTA 5C4XH 3OWFA 4IJLA 3SK8A 1HUMA 2DNEA 4PQXA 1D5XC 1SFOB 4BY7B 1JWUD 2E2JB 1IL8A 4QF4A 4DV3L 1AEXA 2K7VA 3S15B 5C44H 2K32A 5J22A 1MSGA 1LM0A 2BH8A 1E7ZA 1H9SA 2LXJA 4NXNQ 3PIP3 4DV5Q 4DKAC 4JI5Q 1VQNA 4PMCA 1UEBA 2Q8RE 5M3FH 1X3GA 3FKIG 1JMQA 4B9WA 4IALA 4L6TB 2LAJA 5CC4A 4YCUA 2F52A 4KMUC 4JOIA 2N8NA 1RIPA 4IFDJ 1B4OA 2KEDA 1VQFA 4AQYQ 4IPCA 4A3CH 4UY8C 4IUQA 4A3KB 2K50A 1EYDA 2K04A 3L9AX 2M9VA 3STBD 5JVG3 4DV1Q 3IFDA 4X6AH 4L5QA 3BG3A 3DHQA 3RZDH 5IYBH 2BCOA 2N55A 1B2TA 4DNIA 5EQ0A 3I4OA 2BA0A 5A2QE 1YNJD 1LO5D 4DAVA 2UUBL 1CFMA 4BY1B 2GN5A 2YU9H 4RA8A 3BJUA 1SNCA 3OMCA 2QA4A 1ASZA 1PLFA 4KN7C 3CCQA 1EG4A 4BBRB 5FLXL 1AE3A 3LKXA 4ZAIA 1N33Q 1G6PA 4DAMA 1OXVA 3ICEA 4FO2A 4XT1B 3I4NH 2IY5B 2B29A 1GUGA 3DM1A 1K9MC 4CKEA 4LF9Q 3HG9A 5KIXA 3QJYA 1CSQA 2KHSA 1F9QA 1L1OB 3E9HA 3K0XA 5JPMC 3JAME 4XT3B 1VQ8A 1SROA 3RD4A 4I7ZC 1U0LA 4C56C 1RKNA 5J3BA 2Z4IA 1MKHA 1F2ZA 5IYDH 4A3EG 4A3GG 4ME3A 4IN3A 4TRDA 2JA8B 4NXMQ 3I4NG 4A3BG 1CKOA 1I3QH 4QIWE 3T51B 4JI0L 5C0XH 3T1YL 3BVZA 3PUWA 1AZPA 5BN5A 1H9MA 5BN3A 2F0FA 3C1EA 1Z9FA 1SMYC 4CKCA 2Z6KC 1PH5A 4C2MB 1JJCB 2F0HA 3R8BA 1HPCA 1TKWB 3L3OC 2JJQA 3S24A 4JYAL 4JI3Q 4HN7A 4A3DG 4KI0A 2A8VA 3E0EA 1UE5A 1OTCA 5C4JB 2XSCA 1FJGL 5HY6A 3CCEA 1ZEQX 1GD7A 1CQFA 1MJCA 3E0JA 3NQTA 1XPRA 1E24A 1GHKA 2VUMG 2JQOA 5M5WB 1DXMA 3RNUA 1PTOF 1DCZA 1VQ6A 4A3CG 1EQQA 1V1QA 2AUKA 3MHBA 4UDUC 4WORA 5FLXE 3S1QB 2L1BA 4ZKBB 4OHJA 5ELDA 3HOYB 3PO2H 3TQYA 5JEAG 5CQ2A 1V1PA 4G7HC 5FO8B 1XMQQ 2ENBA 2F0GA 1EY6A 1EY7A 4BXXH 4G4KA 2ZR6A 3ZJYC 4RGMA 3K80C 4K2LA 3AEVA 1GUWA 4JI1L 4NMZA 3SR1A 1LT4D 3EN2A 4RG1A 3W3AA 1LTRD 3A55A 2K5WA 2MFIA 2IX3A 3VYTA 1G291 2NVTH 2RSOA 1PFNA 4R4CA 5IYDG 2K6AA 1YVCA 2MPMA 1FL0A 3OMGA 1JOQA 4K6DA 4DV7Q 4HCSA 1Y69U 2J0TD 2DJYA 1W3SA 2ZJQA 5C6AA 3JAMc 1VF7A 1UE7A 4K8IA 2NUCA 2NTSA 1J5EL 4B3TL 3I7FA 4LF6Q 2PMZE 3S2DB 1SNQA 1HR0L 3P7JA 3HZXA 3AFQA 3M4YA 1K83H 1EYCA 3TDQA 1S5DD 2XPAA 3EROA 4IUPA 1IHZA 3CCVA 2ZXRA 5E7NA 3NK9A 3A5ZB 3NWTA 1SDFA 1VMCA 2AWOA 2F4VL 1X65A 4FDBA 2XNAC 4XDXA 4OXPA 3MAQA 3LKXB 1KRSA 2EYPA 2KJXA 3D0FA 2WACA 2H4OA 4MZ9A 2N88A 2NVYB 4B3SL 4BY1G 5CBEE 1BDOA 2Y0SE 3MCBB 3DWAA 1QVCA 3QOLA 3NBIA 4KHVA 1L0YB 2QILA 3GTKB 1EIFA 4HIKA 4OO1G 1EY9A 2O2LD 4A3MB 3S2DH 2RBMA 4KKTA 2FMMA 2JA5H 1F9PA 3SEBA 3D6WA 1VQJA 2ICEC 1JICA 2DGYA 2JA6G 5CV7A 3K5NA 1DOLA 4POFA 5M5YH 2MQHA 5DM73 2HCIA 3S1RH 4JC0A 4Z9CB 3P75A 3RN2A 4KTAA 1AP0A 1FGUA 2XP5A 2ZXPA 1IW7C 3PGZA 2NZ1D 3CHBD 1I6VC 1G6ZA 4IJHA 1YJWA 2B63H 1ONLA 4LWCA 4X66L 5K36H 5IIFA 3HOUH 1QNKA 3HOVB 3PCOB 2F3VA 2RSNA 1MIUA 4MTNA 2IX0A 1L0XB 2BE5C 3H3VI 4XQNA 1YNND 4A3KH 4RGOS 1R4PB 1JOOA 3PIOA 3RZOH 3C2PA 4B3RQ 1WTXA 3MA2B 2KCMA 4NP5A 1E1OA 4BS9A 1SMXA 1K8OA 4JBJA 2JA8H 1KDCA 4NW2A 2I5LX 4NPSA 4HJ7A 2KCTA 4LMQD 3UDGA 4M1UB 1LTBD 1JWMD 4GOPB 1I5FA 1K9RA 5AJ3Q 2YSFA 1LACA 2PZTA 3TP7A 3G4SA 3KADA 3SK4A 1V1OA 1WOCA 2K5NA 3ERSX 4PZ7A 1G2TA 1HR0W 1Y1VG 2DK7A 4HJAA 2WINB 3ODKA 4K5XA 4BBSG 4A3IB 2R7DA 4LJZC 2E2HH 3KAHA 2ASBA 1PYWD 4DR6L 3S14B 2PQAA 5E66A 4L8JA 1WTQA 3BVGA 1R4QB 4HIDA 1SEBD 3RMHA 2ZTEA 1VQCA 1K8GA 4QIBA 1I50H 1TWAH 5COYA 3TEHB 1AH9A 3HOYG 3I4MH 2XP6A 1YNJC 5ELOA 4ZYSA 4EX5A 1O7YA 1V43A 1N33L 4C3IH 2EYMA 3S1QH 1U9RA 3S2HB 3ULPA 2UXBQ 4HJ8A 1JJ2A 4R8IA 3I90A 1B9MA 4ILWA 1S3OA 1RF2D 2F3IA 4X65L 1YHBA 1E3PA 3KBGA 1W6JA 1TK7A 1WTRA 4AYBG 1YJNA 2OXPA 5IGFA 5FOBB 4A3IH 1K73C 5KEEA 4DK1A 1SFOH 4BY7H 2HHHL 3S1MH 1M90C 2SOBA 1XX8A 3I72A 2NVTB 2FHTA 3TP8A 5C3EG 3A8KE 3CQZB 5FLMH 4IQZA 4A3KG 4KHPQ 2LS01 2IHEA 1YNXA 3CNGA 3LWUA 1VQGA 2F3WA 4JYAQ 2F0QA 2XP8A 5I9PA 5M3FB 5IGGA 4BY7G 5I9OA 4JI2L 1D7QA 4UP7A 3J81i 2UXDL 1DJRD 3CXCA 4O1NA 3CMAA 5JEAH 2F0SA 1PH8A 2LSSA 1ESFA 2PQEA 4DR7Q 4RMFA 4B3ML 3D3RA 1PRTC 4KJNA 3J80i 3S1NH 1JE5A 4Y52H 4IPDA 2Q5AA 3D4WA 3K5OA 2H5XA 1HHVA 1EQVA 2SNSA 3OTOQ 1EWHA 5IWAQ 1LV9A 1Y1WH 5H1SE 1PZID 3VYUA 2IPKD 2C9OA 4FYDA 1CI3M 4YY3Q 1KTKA 1PXUA 3TDBA 5IY0A 4WJ3M 3K5MA 1B1ZA 4OIKA 1BVSA 3BU2A 2MGSA 2K03A 2RDFA 1F2LA 4DR5L 2X6GA 2X6LA 2RA4A 2JA5B 2UU9Q 1BKBA 2UUBQ 2UU9L 2CWPA 1LABA 4A3MH 2F0JA 1FVIA 1PTOD 3JAMi 2NVXH 5HGQA 3NQIA 4G7ZC 1GUNA 3STBC 1OO9B 1YEZA 2CCZA 5EJWA 5DAUA 5M5YB 1FNWA 1PV4A 4JBMA 3ZYYX 4A3LH 1LT3D 4KK7A 1CHQD 3R93A 2ZQUA 3KJPA 2NB0A 2K28A 3AQQA 2OT2A 3PQHA 1S5ED 4BXXG 3FP9A 1ZXTA 1H9RA 1EY8A 3F2CA 4DR6Q 3TREA 1H9JA 2EXZA 4QUCA 1A63A 4P74A 4LFAL 1IYJB 1IBML 2ITKA 3A8JE 3VYRA 2DY7A 2ZXOA 3PO3B 1D1KA 2MJ8A 5KNCA 4C3JH 2K5DA 2K75A 3T1YQ 3HOXH 3GDEA 5GAGC 3S17B 4JI0Q 5EKLA 5CV9A 3FSBA 2CKZB 4C3HB 3PF4A 4A0UA 3KDFA 1FR3A 1NSNS 2VNUD 1HJPA 1NMGA 4JI7Q 2ATWA 2JX8A 1STHA 2LY7A 3RLFA 2KENA 3PIO3 4DV3Q 3EFXD 2K05A 2LMCB 5LMUL 1PRTB 4K0KQ 1B53A 3ULJA 1GUTA 2F4VQ 1WD0A 2R6GA 4DK0A 1TWFH 1GKHA 2UXCL 1QVFA 3GP7A 1S5BD 3Q0AA 3NUCA 1SYDA 3U9OA 4OX9L 1WD1A 1STYA 3MQHA 1O7IA 1BCPF 3G6EA 1Q90A 4A3FH 1LTLA 1Z47A 4DV7L 4F88A 1ESRA 2UUCQ 4AIMA 4EGVA 4A3LG 1Q1BA 2WP8J 5E5WA 3GV6A 5IP7H 2E5LL 1HNWQ 2R61A 1N34Q 2QEXA 5I6YA 3HEJA 4DV1L 5C4XG 3Q24A 1WTVA 2V4DA 4DV2Q 1O80A 4AQYL 3GTLH 1KNEA 3GTMH 1EEID 1EOTA 4KY7A 5M5XB 2D9UA 3MXNA 5IP7G 2A73B 1B9NA 2NWGA 2WFWA 5M3MB 4OWTB 1A15A 5LHY1 4PNYA 2JK8A 3M4OH 4XQQA 1RTOA 1IYVA 4DPGA 3E6ZX 4A3JG 5A35A 1KLGD 1Y14B 4LF5L 1WR7A 4DN4M 1S40A 4IUNA 2ZTDA 4JG2A 2RKSA 2Z6KA 3C3LA 4IPGA 4XYQA 4C3JG 3KF8B 3CCJA 5IP9G 3T13A 2QDBA 3J81L 2GVAA 3OSOA 5IGBA 4EQPA 4O2DA 4JV5L 2F4IA 1AE2A 2SDFA 1E0BA 1HR0Q 4POGA 1SJHD 1CKNB 2N3SA 2HIVA 1HXYD 3S1MB 4KN4C 4PMWA 1RDPD 3HRZC 3IKJA 4KY5A 2QGQA 3CQZH 3OPOA 3W2DA 3H0GG 1LT6D 2ZAJA 3GQBA 1SJED 2F0IA 3DEOA 3GV3A 4I65A 3H3VH 3S16H 1P16A 3OIQA 1IBLQ 5IGEA 1EYGA 1ENCA 1QB5D 3FKIB 4DR4L 2A74C 5D14A 2QCPX 3NPPA 4QQBX 3VA7A 2ZR5A 1X3EA 2E8GA 3KJOA 1MGSA 2PZUA 1K3RA 4H02A 2L0CA 2F0DA 1GJXA 1SE2A 2MNAA 4ZUIA 4DA2A 2XP7A 2R3ZA 1HH2P 3L0OA 2C5CA 1N9WA 4LW1A 3WH0A 1SRUA 1L0WA 2PCFB 3RLOA 5E4WC 3BYYB 2D2CC 1ET9A 2PPBC 3BZCA 3DEPA 5D3DA 5LMNQ 1A2TA 3BDCA 2XTIA 1RODA 4GLXA 5AJ3L 2VQEQ 1X6OA 1B7YB 4IOCA 3HOWH 2A69C 2K4KA 2E2IH 2AUJD 3O13A 3ONAB 4YWLA 3NXWA 4RCOA 2RHQB 1V8QA 4JOIC 3DWPA 2ALYB 2CWAA 1MJEA 4CBVA 2OQKA 3T4AC 4LFBL 3J80c 1CSPA 2ZJPA 1PH1A 5IE8A 1G2SA 2Z8LA 3QIAA 4LF7Q 3TP6A 3TRZA 1RP5A 3M85A 1AZQA 2H1EA 3GTGH 5CV6A 4ZUJA 1HNWL 4E6IA 3G6JB 2E5LQ 2OQ0A 2EXDA 1QWYA 5IGCA 4GNXA 2F0MA 1XJVA 3GTPB 1JCKB 3CU7A 3F2DA 1DD2A 4FF1A 2JE6I 4O42A 1A3TA 3Q22A 1WFQA 2E2DC 3ULLA 4P72A 1N32Q 3MXNB 4IFDH 2B2WC 5C3EB 3AFPA 2E45A 4P2CB 2QEJC 5FK9C 4FF4A 4EVOA 2YSGA 4LF8Q 1GUOA 4R9WA 2TMPA 3OW2A 2YTYA 2VQFL 5EGTA 4HR7B 1BXTA 4F87A 4KKUA 1EQTA 1VQKA 2B2UC 1PMRA 1EYAA 5LMNL 1U5KA 3HKZG 5C4ZA 3H94A 1QILA 1EIGA 1I4QA 1EWCA 5KNDA 5CGKA 1JORA 4K14A 2AQ3B 1ET6A 1D1IA 1ZYRD 1PFSA 3K5LA 2RDGA 4KJOA 3J7AV 3PIPA 1Z7TA 4S3SA 5EPKA 5EBDA 1CHPD 4A3GH 4DUYQ 1TR5A 3KF8A 1TY0A 1LTTD 1PH9A 2O5IC 2A1AA 3CCUA 2I0QA 3HOVG 1O7ZA 3S1NB 4LF6L 3SXHA 1ML0D 4HMIA 1VQAA 4X62Q 1TT2A 2HT1A 1XPUA 1EFID 4O0AA 2CHBD 4DV5L 3KLWA 3MTSA 2PZWA 2PW5A 4A75A 2A68C 3S9WA 1P8LA 1SNDA 5D65A 2BDOA 3QG1A 3CPWA 1JOKA 2HIXA 3HFZB 2JP1A 4K2KA 1HTPA 3CD6A 4CGYB 2B2VC 1VCIA 3HOZB 1CZGA 1WTWA 2RQXA 1G91A 2Q2HA 4DF7A 4YHHL 4LK1C 3NTKA 2OF1A 2IW3A 1PH7A 4LFBQ 1HNXQ 2AMCB 3TN2A 5EAYA 2YTXA 5CYUA 1NCVA 4JI4Q 4ZK9B 5CR3A 4N9TA 4J6HA 2KVMA 1PTOC 4Q5VA 5FLXc 2MO1A 2Z0SA 3FVQA 3MXPA 4X3SA 3UDFA 3G71A 4OONA 5KYLA 1DOMA 1IKMA 1BCPC 1PYSB 4A3JH 3KCEA 1EIYB 5C0XJ 3BZDB 2JMFA 1V9PA 4GLVB 5GAEC 3R2IA 4GNXC 3MZ5A 1IBKQ 2E2HB 4GKJL 1Z6HA 3HOZH 1HA5A 1KNAA 1RL2A 1JQYD 3A7AB 3VR5A 3EIVA 4R8NA 2NVYH 2F0TA 1EG3A 4CJ2C 3HS0C 5ELBA 2NVQB 4OO1H 2JA6B 1E2VA 3S17H 4G7OC 1EQRA 4R4OA 4JI3L 2WIIB 2SEBD 1SE8A 3KABA 4DR1Q 1H95A 4DU9A 2KXQA 4JK1C 4PZ6A 3G48A 5NUCA 1W2BA 1TQOA 5ISRA 1VDZA 3FKIH 3T1HQ 3B6YA 1YZ6A 3BDOA 3VA5A 4L5SA 4ODGA 2F0WA 1XTDA 1PHJA 3TZUA 3FEWX 1JB7A 4QCLA 1SR3A 3RLNA 3M3YH 3KAGA 1EOVA 4RGNA 1HZ9A 4DR2L 3GTKH 2J7ZA 1J6QA 4X65Q 3CF5A 5DNFA 3CC7A 1A2UA 1HUNA 2WADA 2XP3A 4E5RA 3HOUB 4CJ1B 4A3EH 2NVQH 2EZ5W 2MUYA 3W5OA 4A3BH 1T9HA 2XPBA 5M5XH 4H7BA 4YIJA 2BDNA 1XTCD 2HUGA 4LAAA 1JJGA 4K0KL 3HKSA 2WAQG 3SVMA 1B50A 2K1BA 3I91A 1QVGA 4ID6A 5DLQE 4OWWB 3X3NA 2K5QA 5G3LD 1JC7A 2NN6G 5GROA 2I46A 4ABNA 2DUDA 3NEMA 1EFWA 2MP1A 1UWVA 1XNQL 5JAVA 1QZHA 1UAPA 3H91A 1PINA 1X3FA 1N36Q 5JVH3 1VS0A 3GTQH 3WDNA 2VXWA 1XXGA 1XMOQ 2YTVA 1NUCA 4LFCL 4GN3B 1ASYA 1Y1VB 3BVMA 4BA1I 3A7LA 5HGTA 1A8VA 1G51A 1A62A 4IOAA 4HCEA 2M8JA 5C3EH 4RHSA 4B08A 3D31A 2KECA 2C35B 4L63B 3K81C 5LMNW 2VL6A 4KHZA 1SYEA 3HOUG 3IAYA 3OOBA 3CP0A 3PSIA 4LUVA 5E65A 2D62A 3GTJH 5M9OA 4V0BA 2EY1A 1H9KA 1A6XA 3QWNA 1C8CA 1I4XA 1J8IA 1CZWA 4U84A 1O78A 3Q23A 3I8ZA 3NBHA 2UUCL 4IZ8A 1HQMC 4A93B 4R1JA 4C3HH 1ICWA 3M9BA 4AYBB 2RDHA 1OXTA 1Y8PB 3K6OA 2ZQSA 2EJMA 3VR4A 1NY4A 3UDIA 3A74A 2JA5G 2UXCQ 1BQQT 1WI5A 2EYHA 2HCCA 2FXQA 1KC8C 1I4GA 2LKVA 1TWFB 4K8JA 1TWCB 2XWJB 3VDYA 1GHJA 2Q8IB 3A0JA 3ND8A 2HQLA 1U4PA 1VQHA 1IBLL 2JA7G 2Q8TA 2ZQVA 1BBXC 1WJJA 2B2VA 3K7AB 1XNRQ 3WWVA 2RE3A 3PO3H 3FMCA 2N49A 1M8AA 2X69A 1L1OC 2K5VA 2JV4A 2EY5A 4B3MQ 3P1HA 4DAYB 4DK6C 4LUOA 3KYHC 3WOEA 4DR3Q 3TC5A 1KDBA 3NELA 3FDTA 1YHQA 1PRTF 4J1MA 4DNRB 1F2YA 2JA7B 4C1NI 1A3VA 1SXTA 3CW2C 1EZ8A 1KQSA 4DGZA 4U86A 1HNZL 4A3DH 1X9NA 3L4HA 4KHPL 3R3OA 4JI6L 5IT9E 5HURA 2EVBA 3LE4A 4YCWA 4CKBA 1TWCH 1BR9A 4F8MA 1RD9D 2CQOA 5KGUA 1SYGA 5IP9H 2DN8A 1ILQA 4DAYA 1QNUA 2D5DA 3SHLA 1K0RA 4MIUA 5J1ZA 3TBIB 2M3OW 3DLLA 4LF5Q 1QJOA 5ELEA 1SN8A 1PVOA 4FXKC 1X3QA 3NTPA 4JCVE 1TIID 5A2QL 3X3MA 3NWSA 1BBUA 5FLMG 5IT9c 2UXBL 2GVBA 1PA6A 2CW0D 3NE5B 2R92H 1M1KC 4UAIA 1FLCA 3AB9A 5KYIA 2Y0SG 3PO2B 2CQAA 2Q2IA 2F0NA 5I2YA 4A76A 1NE3A 1OXXK 4DV4Q 2OTJA 2WAQB 3BZKA 5ELNA 3HKZE 1C4QA 1YW5A 2K52A 4IPHA 1QG7A 3QB3A 3Q8DA 2E75C 2Y0SB 2EQSA 1PZJD 2PYKA 2LXKA 4PMBA 1XMQL 2JEAI 3FSCA 1QZGA 2NZHA 1NMVA 2WKCA 5IOCA 5EKKA 2PMZB 3I3CA 1YHAA 2EOTA 4EQ5A 3IFTA 3KK7A 4OIJA 4IUUA 3T16A 4JI2Q 4DAPA 2NN6I 4QMGA 4MHEA 1QUQB 2NBFA 1E1TA 1VQ5A 1K9QA 4OL7A 3F2UA 5M3FG 1W6KA 2Z1CA 2RF4A 2UUAL 4UP8A 4C1NK 5DM63 4FXGC 3IRBA 3F1ZA 1ZCNA 3RR5A 4QL5A 4BY1H 4BBSH 1DOKA 4B3RL 1AFPA 1OXUA 1Q12A 1WCMG 1HA6A 3J80E 1VQ4A 1Q7YC 1HNZQ 5AHTA 4HAEA 1U4RA 2B2UA 2NYZD 1J5EQ 1EEFD 4Y7NH 2F0LA 2KA7A 3M7GA 4FXDA 3VR2A 3ER0A 2F21A 5C4JH 2BOSA 2VQFQ 1D5ZC 1FNUA 1L1OA 2I5MX 4X3UA 1CUKA 2YSBA 1S72A 3F8TA 4GZYC 3W1BA 1PH4A 1X55A 1HZCA