3WH0A

Structure of pin1 complex with 18-crown-6
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
157
structure length
145
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Crowning Proteins: Modulating the Protein Surface Properties using Crown Ethers.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 46
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3wh0A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3wh0A02
4REXA 2L4JA 4G2PA 1FKLA 1FKSA 2YSFA 4TW6A 2VCDA 4U86A 1Q6UA 3LUOA 4IQ2A 4DROA 1FJDA 4J4NA 2XPAA 3KAFA 2ZQTA 4NNRA 1FKJA 2DWVA 3UQIA 5GPGA 3O5KA 1N1AA 4JFMA 2F21A 3PA7A 2AWGA 2D9FA 4C02B 2MNTA 4DZ2A 1TK7A 1NSGA 3JYMA 4JFLA 4ODMA 2PPOA 4TW7A 3TCZA 4DIPA 3B7XA 2UZ5A 1ZK6A 2XP5A 3IK8A 1W26A 1EYMA 4QT3A 1M5YA 2FAPA 2L2SA 2PV2A 3EY6A 4JFJA 3O5MA 1BL4A 1ROTA 1J4IA 5HKGA 3KAIA 1QPLA 2PV3A 1EG3A 3ODKA 2DK1A 1R9HA 3TC5A 5HWBA 1A7XA 1KT1A 5HWCA 1C9HA 1L1PA 3KZ7A 3LE4A 1FKBA 3O5IA 2KR7A 4JFKA 5DITA 1Y0OA 1U79A 2XP9A 4ITZA 3IKGA 3IHZA 2KO7A 2KXQA 3RFWA 2DK7A 1JNTA 4DRJA 1FD9A 4DRHA 4BF8A 4ODPA 4ODKA 4FN2A 2MF9A 4DT4A 4N19A 1D7JA 1JVWA 2MLZA 4W9PA 1BKFA 3L4HA 2MLXA 4J4OA 2IF4A 1EQ3A 3RGCA 2ZR6A 4DZ3A 2RUCA 1ZCNA 2XP4A 4TX0A 5BXJA 1FKGA 1NMWA 2RE3A 1I5HW 4TYOA 2YSBA 1TCOC 2RQSA 3OOBA 2ZAJA 2LPVA 5DIVA 1FKIA 4DRPA 4DRNA 1YW5A 2MLYA 2DJYA 5HW6A 2VN1A 2M8IA 3KACA 2F4EA 1J4HA 4DRIA 3NTPA 3MDYB 2M8JA 3FAPA 4LAWA 2JV4A 1EG4A 1FKDA 1KT0A 2PPNA 5I98A 2ITKA 1QZ2A 3NRKA 2LAJA 1WR7A 2ZR5A 2Y78A 2RSEA 4IPXA 2RUQA 3JXVA 2BA1A 4LAXA 2YSIA 3KAGA 4ODOA 1NMVA 1FKKA 1Q1CA 4GGQA 3M7NA 3CGNA 1HXVA 4DRKA 3O5EA 1T11A 3KCEA 4GIVA 1D6OA 4DRMA 3IKDA 3NI6A 1F8AB 2OFNA 3GPKA 1O6WA 1ROUA 3KAHA 4JYSA 3H9RB 1JMQA 2XP3A 1Q6IA 3O5DA 5HTGA 2FKEA 3UF8A 5DIUA 2EZ5W 4QT2A 1QPFA 2KI3A 2PV1A 2XPBA 2JXWA 1F40A 3WH0A 2N87A 1B6CA 2PPPA 3VAWA 2YSHA 3O5PA 2JX8A 4G50A 5HW7A 1D7IA 2M2AA 2ZR4A 5D75A 4MGVA 2DMVA 4QIBA 4R0XA 1YATA 3UQAA 1WMVA 4ODNA 2PBCA 1K9QA 2Q5AA 2RUDA 2DG3A 3UI6A 4W9QA 5HT1A 2M08A 2XP7A 4MSPA 2JZVA 1J4RA 2KE0A 3O5JA 2M1IA 4ODQA 2MPHA 2ZQVA 4U84A 4IQCA 4ODLA 1J6YA 2LKNA 1K9RA 3O5OA 1FKHA 4E5RA 2LJ4A 1FKRA 1Q6HA 4DRQA 3UI4A 2M3OW 2MDIA 2KGJA 2F2DA 2KFWA 2XP6A 4LAYA 1P5QA 3O5RA 3I6CA 3O5GA 2XP8A 5AHTA 5J6EA 2E45A 1FAPA 3KADA 4O2TA 3CNGA 2JMFA 3UQBA 2ZQUA 4TNSA 5HW8A 2K8IA 4W9OA 1PINA 2LGOA 1PBKA 4DH0A 2DG4A 3PRBA 4FAPA 3TDBA 3O5LA 3O5FA 3M85A 2DG9A 5HUAA 3UI5A 1JNSA 1D7HA 5B8IC 4LAVA 1FKTA 3JYJA 5CQ2A 3CGMA 3O5QA 4U85A 3KABA 3PRDA 2RURA 4JFIA 4ODRA 1FKFA 4TW8A 2YSGA 2ZQSA
chains in the Genus database with same CATH superfamily
2O9OA 4REXA 1ZB5A 1W1YA 1NWRA 3WD1A 4QZVB 3FSCA 4S3JA 2YBTA 5E64A 3AROA 4DWSB 3RM9A 2L4JA 1H0GA 4G2PA 1FKLA 1FKSA 1W1PA 1XHGA 2YSFA 4TW6A 2VCDA 4U86A 4AY1A 1Q6UA 3LKXA 4P8XA 3LUOA 1FFQA 4IQ2A 4DROA 1FJDA 1NWUA 4J4NA 2XPAA 4IT4A 4MNMA 1OGGA 4WKFA 3KAFA 2ZQTA 1O6IA 4NNRA 1FKJA 2DWVA 3UQIA 5GPGA 5E5WA 3O5KA 4ZPWR 1N1AA 1GRJA 4JFMA 1NWTA 1SYTA 2F21A 4A0UA 3PA7A 2AWGA 2D9FA 4C02B 4R5EA 2MNTA 4DZ2A 1TK7A 1NSGA 3JYMA 4JFLA 4ODMA 3MQGA 4S3KA 2DSUA 2PPOA 3TCZA 4TW7A 4PTMA 4DIPA 1KFWA 3AS3A 1FLCA 3B7XA 4GLXA 2UZ5A 1ZK6A 2XP5A 3IK8A 1W26A 1EYMA 4QT3A 1M5YA 1HKJA 4Z2KA 2DT2A 2FAPA 2ESCA 3PQHA 1H0IA 1X6LA 4UDMA 2L2SA 2PV2A 4DWSA 3EY6A 4JFJA 3O5MA 1BL4A 1ROTA 2P4VA 1J4IA 3ARXA 2YAJB 5HKGA 3KAIA 4DWSD 3ARTA 4XAKA 3WL0A 1QPLA 2PV3A 1EG3A 4KR0B 3ARQA 3BXWA 4MNKA 3ODKA 1FFRA 2DK1A 1R9HA 1X6NA 3TC5A 2QF8A 2F23A 5HWBA 1A7XA 1W9PA 1KT1A 4Z2LA 5HWCA 1ZU8A 1C9HA 1L1PA 3KZ7A 3WQVA 2O92A 3LKXB 1OGBA 3LE4A 1FKBA 2WLYA 3O5IA 2KR7A 1LJYA 4JFKA 5DITA 1Y0OA 1U79A 2PN0A 2XP9A 1E44A 3B8SA 1LQ0A 5DO2A 4ITZA 4ZPTR 3IKGA 3IHZA 2KO7A 1HKMA 2KXQA 3RFWA 2DT0A 4ZPVR 5DEZA 2DK7A 1JNTA 1WB0A 1FD9A 4DRJA 4DRHA 4BF8A 4ODPA 5U47A 4ODKA 4URIA 4P8UA 4FN2A 2MF9A 2Y8NB 4DT4A 5DF0A 4IT6A 4N19A 3FS8A 1D7JA 1JVWA 3WIJA 2MLZA 2G41A 4W9PA 1BKFA 2EULA 2B31A 3L4HA 4Q7NA 2MLXA 1RD6A 4J4OA 1W9UA 2IF4A 4WKAA 1EQ3A 4WIWA 3RGCA 2ZR6A 4L72B 4DZ3A 2RUCA 1LL4A 2DT3A 1ZCNA 2XP4A 4TX0A 1IX5A 5BXJA 1TR8A 1FKGA 2WADA 1NMWA 2RE3A 3WD4A 1I5HW 4TYOA 2YSBA 1TCOC 4Q22A 2RQSA 3OOBA 2ZAJA 2LPVA 5DIVA 1W1TA 1FKIA 4DRPA 1OWQA 4DRNA 1YW5A 2MLYA 2DJYA 5HW6A 3CHFA 2PI6A 2VN1A 2M8IA 3KACA 2F4EA 1J4HA 4DRIA 3NTPA 3MDYB 2M8JA 3FAPA 4LAWA 2JV4A 1EG4A 1FKDA 1KT0A 2PPNA 3OA5A 5I98A 2ITKA 1QZ2A 3B9EA 3NRKA 2LAJA 1HJVA 1WR7A 2ZR5A 1LL6A 2Y78A 2RSEA 4HBEA 1HJXA 1JNDA 1WAWA 4IPXA 2RUQA 3AS2A 2QRVA 1GPFA 3JXVA 2BA1A 3CHDA 4LAXA 2A3AA 2YSIA 3KAGA 4ODOA 1ITXA 1NMVA 2FDMA 1FKKA 1Q1CA 4GGQA 3M7NA 3CGNA 3ARYA 1HXVA 2WAEA 2DT1A 4DRKA 1T11A 1CTNA 3O5EA 2AOSA 3ARPA 3KCEA 3PR9A 1D6OA 4GIVA 3ARWA 2DPEA 4DRMA 4HARA 3AS0A 3IKDA 3NI6A 1F8AB 3EIPA 3CHEA 2OFNA 3GPKA 1O6WA 1ROUA 1HKKA 3KAHA 3W4RA 4JYSA 2A3CA 4NZCA 3H9RB 1W9VA 1E6PA 1JMQA 2XP3A 1Q6IA 3O5DA 3AQUA 1EDQA 5HTGA 1HKIA 2FKEA 3UF8A 5DIUA 2EZ5W 3FSBA 4MNLA 4QT2A 4P8WA 1QPFA 2KI3A 2PV1A 5GPRA 2XPBA 3WD2A 2JXWA 1JNEA 3WD0A 3AS1A 1F40A 3WH0A 1LG1A 3RM4A 3CHCA 2N87A 1B6CA 2PPPA 3BMBA 3VAWA 2YSHA 3O5PA 2JX8A 1D2KA 3WD3A 4NSBA 4G50A 5HW7A 1D7IA 2M2AA 3MQHA 2ZR4A 1W1VA 3B9AA 3ARVA 5D75A 4MGVA 1UR9A 1EIBA 2DMVA 4Z2IA 4QIBA 4R0XA 1VF8A 1YATA 3UQAA 1WMVA 4ODNA 3ARSA 4DWSC 5HBFA 2PBCA 1K9QA 2Q5AA 2RUDA 3ARUA 2IUZA 1SR0A 4MNJA 2DG3A 3UI6A 3G6LA 4W9QA 2ETNA 4ML4A 5HT1A 3RMEA 2M08A 2XP7A 3FY1A 3ARZA 4MSPA 2JZVA 1J4RA 2KE0A 3O5JA 2B5UB 2M1IA 2WK2A 4WK9A 5E66A 1K9TA 4ODQA 2MPHA 1RP5A 2ZQVA 4U84A 3MCBA 4IQCA 4ODLA 1J6YA 4A0TA 2LKNA 1K9RA 4WJXA 3O5OA 3ALFA 1FKHA 4E5RA 1XRVA 2LJ4A 5JH8A 4Z2HA 1E9LA 1FKRA 2OWOA 1E6RA 4MPKA 2A3EA 1JCHB 1Q6HA 4DRQA 3UI4A 2M3OW 2MDIA 2KGJA 2F2DA 2KFWA 4HBOA 4P8VA 4W5UA 1LL7A 3ALGA 2XP6A 4LAYA 1P5QA 3O5RA 2WLZA 3I6CA 1ZBVA 3O5GA 2XP8A 2DSVA 4WKHA 5AHTA 5J6EA 2E45A 1E15A 1FAPA 3KADA 4O2TA 3CNGA 2A3BA 1GUVA 4L3NA 2JMFA 3ARRA 3UQBA 2ZQUA 4TNSA 4Z2JA 5HW8A 2K8IA 5E65A 4W9OA 4LGXA 3GTYX 3WQWA 1WNOA 1GOIA 4MAVA 1PINA 2LGOA 1ZBKA 1PBKA 4DH0A 1UR8A 2DG4A 3PRBA 3G6MA 2DSWA 3CH9A 5GQBA 4FAPA 3QOKA 3TDBA 3O5LA 1E6NA 3PRAA 3O5FA 2OLHA 3M85A 2DG9A 5E62A 3MCBB 5HUAA 4MTVA 3UI5A 1JNSA 1D7HA 5B8IC 4LAVA 1NWSA 1FKTA 3WL1A 3JYJA 2G8ZA 5CQ2A 3CGMA 3FXYA 4KQZA 3O5QA 1NH6A 3B9DA 3GU0A 3WKZA 3CZ8A 1E6ZA 4U85A 2YBUA 3KABA 3PRDA 1ZL1A 2DSZA 4ZS6A 1LG2A 2RURA 1HJWA 4JFIA 2WM0A 4ODRA 3RM8A 1FKFA 1TFVA 4TW8A 4Z2GA 2YSGA 1ZBCA 2ZQSA 1EHNA 1ZBWA
chains in the Genus database with same CATH topology
2O9OA 4REXA 1ZB5A 1W1YA 1NWRA 3WD1A 4QZVB 3FSCA 4S3JA 2YBTA 5E64A 3AROA 4DWSB 3RM9A 2L4JA 1H0GA 4G2PA 1FKLA 1FKSA 1W1PA 1XHGA 2YSFA 4TW6A 2VCDA 4U86A 4AY1A 1Q6UA 3LKXA 4P8XA 3LUOA 1FFQA 4IQ2A 4DROA 1FJDA 1NWUA 4J4NA 2XPAA 4IT4A 4MNMA 1OGGA 4WKFA 3KAFA 2ZQTA 1O6IA 4NNRA 1FKJA 2DWVA 3UQIA 5GPGA 5E5WA 3O5KA 4ZPWR 1N1AA 4JFMA 1NWTA 1SYTA 2F21A 4A0UA 3PA7A 2AWGA 2D9FA 4C02B 4R5EA 2MNTA 4DZ2A 1TK7A 1NSGA 3JYMA 4JFLA 4ODMA 3MQGA 4S3KA 2DSUA 2PPOA 3TCZA 4TW7A 4PTMA 4DIPA 1KFWA 3AS3A 1FLCA 3B7XA 4GLXA 2UZ5A 1ZK6A 2XP5A 3IK8A 1W26A 1EYMA 4QT3A 1M5YA 1HKJA 4Z2KA 2DT2A 2FAPA 2ESCA 3PQHA 1H0IA 1X6LA 2L2SA 2PV2A 4DWSA 3EY6A 4JFJA 3O5MA 1BL4A 1ROTA 1J4IA 3ARXA 2YAJB 5HKGA 3KAIA 4DWSD 3ARTA 4XAKA 3WL0A 1QPLA 2PV3A 1EG3A 4KR0B 3ARQA 3BXWA 4MNKA 3ODKA 1FFRA 2DK1A 1R9HA 1X6NA 3TC5A 2QF8A 5HWBA 1A7XA 1W9PA 1KT1A 4Z2LA 5HWCA 1ZU8A 1C9HA 1L1PA 3KZ7A 3WQVA 2O92A 3LKXB 1OGBA 3LE4A 1FKBA 2WLYA 3O5IA 2KR7A 1LJYA 4JFKA 5DITA 1Y0OA 1U79A 2XP9A 3B8SA 1LQ0A 5DO2A 4ITZA 4ZPTR 3IKGA 3IHZA 2KO7A 1HKMA 2KXQA 3RFWA 2DT0A 4ZPVR 5DEZA 2DK7A 1JNTA 1WB0A 1FD9A 4DRJA 4DRHA 4BF8A 4ODPA 5U47A 4ODKA 4URIA 4P8UA 4FN2A 2MF9A 2Y8NB 4DT4A 5DF0A 4IT6A 4N19A 3FS8A 1D7JA 1JVWA 3WIJA 2MLZA 2G41A 4W9PA 1BKFA 2B31A 3L4HA 4Q7NA 2MLXA 1RD6A 4J4OA 1W9UA 2IF4A 4WKAA 1EQ3A 4WIWA 3RGCA 2ZR6A 4L72B 4DZ3A 2RUCA 1LL4A 2DT3A 1ZCNA 2XP4A 4TX0A 1IX5A 5BXJA 1TR8A 1FKGA 2WADA 1NMWA 2RE3A 3WD4A 1I5HW 4TYOA 2YSBA 1TCOC 4Q22A 2RQSA 3OOBA 2ZAJA 2LPVA 5DIVA 1W1TA 1FKIA 4DRPA 1OWQA 4DRNA 1YW5A 2MLYA 2DJYA 5HW6A 3CHFA 2PI6A 2VN1A 2M8IA 3KACA 2F4EA 1J4HA 4DRIA 3NTPA 3MDYB 2M8JA 3FAPA 4LAWA 2JV4A 1EG4A 1FKDA 1KT0A 2PPNA 3OA5A 5I98A 2ITKA 1QZ2A 3B9EA 3NRKA 2LAJA 1HJVA 1WR7A 2ZR5A 1LL6A 2Y78A 2RSEA 4HBEA 1HJXA 1JNDA 1WAWA 4IPXA 2RUQA 3AS2A 2QRVA 1GPFA 3JXVA 2BA1A 3CHDA 4LAXA 2A3AA 2YSIA 3KAGA 4ODOA 1ITXA 1NMVA 2FDMA 1FKKA 1Q1CA 4GGQA 3M7NA 3CGNA 3ARYA 1HXVA 2WAEA 2DT1A 4DRKA 1T11A 1CTNA 3O5EA 2AOSA 3ARPA 3KCEA 3PR9A 1D6OA 4GIVA 3ARWA 2DPEA 4DRMA 4HARA 3AS0A 3IKDA 3NI6A 1F8AB 3CHEA 2OFNA 3GPKA 1O6WA 1ROUA 1HKKA 3KAHA 3W4RA 4JYSA 2A3CA 4NZCA 3H9RB 1W9VA 1E6PA 1JMQA 2XP3A 1Q6IA 3O5DA 3AQUA 1EDQA 5HTGA 1HKIA 2FKEA 3UF8A 5DIUA 2EZ5W 3FSBA 4MNLA 4QT2A 4P8WA 1QPFA 2KI3A 2PV1A 5GPRA 2XPBA 3WD2A 2JXWA 1JNEA 3WD0A 3AS1A 1F40A 3WH0A 1LG1A 3RM4A 3CHCA 2N87A 1B6CA 2PPPA 3VAWA 2YSHA 3O5PA 2JX8A 1D2KA 3WD3A 4NSBA 4G50A 5HW7A 1D7IA 2M2AA 3MQHA 2ZR4A 1W1VA 3B9AA 3ARVA 5D75A 4MGVA 1UR9A 1EIBA 2DMVA 4Z2IA 4QIBA 4R0XA 1VF8A 1YATA 3UQAA 1WMVA 4ODNA 3ARSA 4DWSC 5HBFA 2PBCA 1K9QA 2Q5AA 2RUDA 3ARUA 2IUZA 1SR0A 4MNJA 2DG3A 3UI6A 3G6LA 4W9QA 4ML4A 5HT1A 3RMEA 2M08A 2XP7A 3FY1A 3ARZA 4MSPA 2JZVA 1J4RA 2KE0A 3O5JA 2M1IA 2WK2A 4WK9A 5E66A 1K9TA 4ODQA 2MPHA 1RP5A 2ZQVA 4U84A 3MCBA 4IQCA 4ODLA 1J6YA 4A0TA 2LKNA 1K9RA 4WJXA 3O5OA 3ALFA 1FKHA 4E5RA 1XRVA 2LJ4A 5JH8A 4Z2HA 1E9LA 1FKRA 2OWOA 1E6RA 4MPKA 2A3EA 1Q6HA 4DRQA 3UI4A 2M3OW 2MDIA 2KGJA 2F2DA 2KFWA 4HBOA 4P8VA 4W5UA 1LL7A 3ALGA 2XP6A 4LAYA 1P5QA 3O5RA 2WLZA 3I6CA 1ZBVA 3O5GA 2XP8A 2DSVA 4WKHA 5AHTA 5J6EA 2E45A 1E15A 1FAPA 3KADA 4O2TA 3CNGA 2A3BA 1GUVA 4L3NA 2JMFA 3ARRA 3UQBA 2ZQUA 4TNSA 4Z2JA 5HW8A 2K8IA 5E65A 4W9OA 4LGXA 3WQWA 1WNOA 1GOIA 4MAVA 1PINA 2LGOA 1ZBKA 1PBKA 4DH0A 1UR8A 2DG4A 3PRBA 3G6MA 2DSWA 3CH9A 5GQBA 4FAPA 3QOKA 3TDBA 3O5LA 1E6NA 3PRAA 3O5FA 2OLHA 3M85A 2DG9A 5E62A 3MCBB 5HUAA 4MTVA 3UI5A 1JNSA 1D7HA 5B8IC 4LAVA 1NWSA 1FKTA 3WL1A 3JYJA 2G8ZA 5CQ2A 3CGMA 3FXYA 4KQZA 3O5QA 1NH6A 3B9DA 3WKZA 3CZ8A 1E6ZA 4U85A 2YBUA 3KABA 3PRDA 1ZL1A 2DSZA 4ZS6A 1LG2A 2RURA 1HJWA 4JFIA 2WM0A 4ODRA 3RM8A 1FKFA 1TFVA 4TW8A 4Z2GA 2YSGA 1ZBCA 2ZQSA 1EHNA 1ZBWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4REX A;  2L4J A;  4G2P A;  1FKL A;  1FKS A;  2YSF A;  4TW6 A;  2VCD A;  4U86 A;  1Q6U A;  3LUO A;  4IQ2 A;  4DRO A;  1FJD A;  4J4N A;  2XPA A;  3KAF A;  2ZQT A;  4NNR A;  1FKJ A;  2DWV A;  3UQI A;  5GPG A;  3O5K A;  1N1A A;  4JFM A;  2F21 A;  3PA7 A;  2AWG A;  2D9F A;  4C02 B;  2MNT A;  4DZ2 A;  1TK7 A;  1NSG A;  3JYM A;  4JFL A;  4ODM A;  2PPO A;  4TW7 A;  3TCZ A;  4DIP A;  3B7X A;  2UZ5 A;  1ZK6 A;  2XP5 A;  3IK8 A;  1W26 A;  1EYM A;  4QT3 A;  1M5Y A;  2FAP A;  2L2S A;  2PV2 A;  3EY6 A;  4JFJ A;  3O5M A;  1BL4 A;  1ROT A;  1J4I A;  5HKG A;  3KAI A;  1QPL A;  2PV3 A;  1EG3 A;  3ODK A;  2DK1 A;  1R9H A;  3TC5 A;  5HWB A;  1A7X A;  1KT1 A;  5HWC A;  1C9H A;  1L1P A;  3KZ7 A;  3LE4 A;  1FKB A;  3O5I A;  2KR7 A;  4JFK A;  5DIT A;  1Y0O A;  1U79 A;  2XP9 A;  4ITZ A;  3IKG A;  3IHZ A;  2KO7 A;  2KXQ A;  3RFW A;  2DK7 A;  1JNT A;  4DRJ A;  1FD9 A;  4DRH A;  4BF8 A;  4ODP A;  4ODK A;  4FN2 A;  2MF9 A;  4DT4 A;  4N19 A;  1D7J A;  1JVW A;  2MLZ A;  4W9P A;  1BKF A;  3L4H A;  2MLX A;  4J4O A;  2IF4 A;  1EQ3 A;  3RGC A;  2ZR6 A;  4DZ3 A;  2RUC A;  1ZCN A;  2XP4 A;  4TX0 A;  5BXJ A;  1FKG A;  1NMW A;  2RE3 A;  1I5H W;  4TYO A;  2YSB A;  1TCO C;  2RQS A;  3OOB A;  2ZAJ A;  2LPV A;  5DIV A;  1FKI A;  4DRP A;  4DRN A;  1YW5 A;  2MLY A;  2DJY A;  5HW6 A;  2VN1 A;  2M8I A;  3KAC A;  2F4E A;  1J4H A;  4DRI A;  3NTP A;  3MDY B;  2M8J A;  3FAP A;  4LAW A;  2JV4 A;  1EG4 A;  1FKD A;  1KT0 A;  2PPN A;  5I98 A;  2ITK A;  1QZ2 A;  3NRK A;  2LAJ A;  1WR7 A;  2ZR5 A;  2Y78 A;  2RSE A;  4IPX A;  2RUQ A;  3JXV A;  2BA1 A;  4LAX A;  2YSI A;  3KAG A;  4ODO A;  1NMV A;  1FKK A;  1Q1C A;  4GGQ A;  3M7N A;  3CGN A;  1HXV A;  4DRK A;  3O5E A;  1T11 A;  3KCE A;  4GIV A;  1D6O A;  4DRM A;  3IKD A;  3NI6 A;  1F8A B;  2OFN A;  3GPK A;  1O6W A;  1ROU A;  3KAH A;  4JYS A;  3H9R B;  1JMQ A;  2XP3 A;  1Q6I A;  3O5D A;  5HTG A;  2FKE A;  3UF8 A;  5DIU A;  2EZ5 W;  4QT2 A;  1QPF A;  2KI3 A;  2PV1 A;  2XPB A;  2JXW A;  1F40 A;  3WH0 A;  2N87 A;  1B6C A;  2PPP A;  3VAW A;  2YSH A;  3O5P A;  2JX8 A;  4G50 A;  5HW7 A;  1D7I A;  2M2A A;  2ZR4 A;  5D75 A;  4MGV A;  2DMV A;  4QIB A;  4R0X A;  1YAT A;  3UQA A;  1WMV A;  4ODN A;  2PBC A;  1K9Q A;  2Q5A A;  2RUD A;  2DG3 A;  3UI6 A;  4W9Q A;  5HT1 A;  2M08 A;  2XP7 A;  4MSP A;  2JZV A;  1J4R A;  2KE0 A;  3O5J A;  2M1I A;  4ODQ A;  2MPH A;  2ZQV A;  4U84 A;  4IQC A;  4ODL A;  1J6Y A;  2LKN A;  1K9R A;  3O5O A;  1FKH A;  4E5R A;  2LJ4 A;  1FKR A;  1Q6H A;  4DRQ A;  3UI4 A;  2M3O W;  2MDI A;  2KGJ A;  2F2D A;  2KFW A;  2XP6 A;  4LAY A;  1P5Q A;  3O5R A;  3I6C A;  3O5G A;  2XP8 A;  5AHT A;  5J6E A;  2E45 A;  1FAP A;  3KAD A;  4O2T A;  3CNG A;  2JMF A;  3UQB A;  2ZQU A;  4TNS A;  5HW8 A;  2K8I A;  4W9O A;  1PIN A;  2LGO A;  1PBK A;  4DH0 A;  2DG4 A;  3PRB A;  4FAP A;  3TDB A;  3O5L A;  3O5F A;  3M85 A;  2DG9 A;  5HUA A;  3UI5 A;  1JNS A;  1D7H A;  5B8I C;  4LAV A;  1FKT A;  3JYJ A;  5CQ2 A;  3CGM A;  3O5Q A;  4U85 A;  3KAB A;  3PRD A;  2RUR A;  4JFI A;  4ODR A;  1FKF A;  4TW8 A;  2YSG A;  2ZQS A; 
#chains in the Genus database with same CATH topology
 2O9O A;  4REX A;  1ZB5 A;  1W1Y A;  1NWR A;  3WD1 A;  4QZV B;  3FSC A;  4S3J A;  2YBT A;  5E64 A;  3ARO A;  4DWS B;  3RM9 A;  2L4J A;  1H0G A;  4G2P A;  1FKL A;  1FKS A;  1W1P A;  1XHG A;  2YSF A;  4TW6 A;  2VCD A;  4U86 A;  4AY1 A;  1Q6U A;  3LKX A;  4P8X A;  3LUO A;  1FFQ A;  4IQ2 A;  4DRO A;  1FJD A;  1NWU A;  4J4N A;  2XPA A;  4IT4 A;  4MNM A;  1OGG A;  4WKF A;  3KAF A;  2ZQT A;  1O6I A;  4NNR A;  1FKJ A;  2DWV A;  3UQI A;  5GPG A;  5E5W A;  3O5K A;  4ZPW R;  1N1A A;  1GRJ A;  4JFM A;  1NWT A;  1SYT A;  2F21 A;  4A0U A;  3PA7 A;  2AWG A;  2D9F A;  4C02 B;  4R5E A;  2MNT A;  4DZ2 A;  1TK7 A;  1NSG A;  3JYM A;  4JFL A;  4ODM A;  3MQG A;  4S3K A;  2DSU A;  2PPO A;  3TCZ A;  4TW7 A;  4PTM A;  4DIP A;  1KFW A;  3AS3 A;  1FLC A;  3B7X A;  4GLX A;  2UZ5 A;  1ZK6 A;  2XP5 A;  3IK8 A;  1W26 A;  1EYM A;  4QT3 A;  1M5Y A;  1HKJ A;  4Z2K A;  2DT2 A;  2FAP A;  2ESC A;  3PQH A;  1H0I A;  1X6L A;  4UDM A;  2L2S A;  2PV2 A;  4DWS A;  3EY6 A;  4JFJ A;  3O5M A;  1BL4 A;  1ROT A;  2P4V A;  1J4I A;  3ARX A;  2YAJ B;  5HKG A;  3KAI A;  4DWS D;  3ART A;  4XAK A;  3WL0 A;  1QPL A;  2PV3 A;  1EG3 A;  4KR0 B;  3ARQ A;  3BXW A;  4MNK A;  3ODK A;  1FFR A;  2DK1 A;  1R9H A;  1X6N A;  3TC5 A;  2QF8 A;  2F23 A;  5HWB A;  1A7X A;  1W9P A;  1KT1 A;  4Z2L A;  5HWC A;  1ZU8 A;  1C9H A;  1L1P A;  3KZ7 A;  3WQV A;  2O92 A;  3LKX B;  1OGB A;  3LE4 A;  1FKB A;  2WLY A;  3O5I A;  2KR7 A;  1LJY A;  4JFK A;  5DIT A;  1Y0O A;  1U79 A;  2PN0 A;  2XP9 A;  1E44 A;  3B8S A;  1LQ0 A;  5DO2 A;  4ITZ A;  4ZPT R;  3IKG A;  3IHZ A;  2KO7 A;  1HKM A;  2KXQ A;  3RFW A;  2DT0 A;  4ZPV R;  5DEZ A;  2DK7 A;  1JNT A;  1WB0 A;  1FD9 A;  4DRJ A;  4DRH A;  4BF8 A;  4ODP A;  5U47 A;  4ODK A;  4URI A;  4P8U A;  4FN2 A;  2MF9 A;  2Y8N B;  4DT4 A;  5DF0 A;  4IT6 A;  4N19 A;  3FS8 A;  1D7J A;  1JVW A;  3WIJ A;  2MLZ A;  2G41 A;  4W9P A;  1BKF A;  2EUL A;  2B31 A;  3L4H A;  4Q7N A;  2MLX A;  1RD6 A;  4J4O A;  1W9U A;  2IF4 A;  4WKA A;  1EQ3 A;  4WIW A;  3RGC A;  2ZR6 A;  4L72 B;  4DZ3 A;  2RUC A;  1LL4 A;  2DT3 A;  1ZCN A;  2XP4 A;  4TX0 A;  1IX5 A;  5BXJ A;  1TR8 A;  1FKG A;  2WAD A;  1NMW A;  2RE3 A;  3WD4 A;  1I5H W;  4TYO A;  2YSB A;  1TCO C;  4Q22 A;  2RQS A;  3OOB A;  2ZAJ A;  2LPV A;  5DIV A;  1W1T A;  1FKI A;  4DRP A;  1OWQ A;  4DRN A;  1YW5 A;  2MLY A;  2DJY A;  5HW6 A;  3CHF A;  2PI6 A;  2VN1 A;  2M8I A;  3KAC A;  2F4E A;  1J4H A;  4DRI A;  3NTP A;  3MDY B;  2M8J A;  3FAP A;  4LAW A;  2JV4 A;  1EG4 A;  1FKD A;  1KT0 A;  2PPN A;  3OA5 A;  5I98 A;  2ITK A;  1QZ2 A;  3B9E A;  3NRK A;  2LAJ A;  1HJV A;  1WR7 A;  2ZR5 A;  1LL6 A;  2Y78 A;  2RSE A;  4HBE A;  1HJX A;  1JND A;  1WAW A;  4IPX A;  2RUQ A;  3AS2 A;  2QRV A;  1GPF A;  3JXV A;  2BA1 A;  3CHD A;  4LAX A;  2A3A A;  2YSI A;  3KAG A;  4ODO A;  1ITX A;  1NMV A;  2FDM A;  1FKK A;  1Q1C A;  4GGQ A;  3M7N A;  3CGN A;  3ARY A;  1HXV A;  2WAE A;  2DT1 A;  4DRK A;  1T11 A;  1CTN A;  3O5E A;  2AOS A;  3ARP A;  3KCE A;  3PR9 A;  1D6O A;  4GIV A;  3ARW A;  2DPE A;  4DRM A;  4HAR A;  3AS0 A;  3IKD A;  3NI6 A;  1F8A B;  3EIP A;  3CHE A;  2OFN A;  3GPK A;  1O6W A;  1ROU A;  1HKK A;  3KAH A;  3W4R A;  4JYS A;  2A3C A;  4NZC A;  3H9R B;  1W9V A;  1E6P A;  1JMQ A;  2XP3 A;  1Q6I A;  3O5D A;  3AQU A;  1EDQ A;  5HTG A;  1HKI A;  2FKE A;  3UF8 A;  5DIU A;  2EZ5 W;  3FSB A;  4MNL A;  4QT2 A;  4P8W A;  1QPF A;  2KI3 A;  2PV1 A;  5GPR A;  2XPB A;  3WD2 A;  2JXW A;  1JNE A;  3WD0 A;  3AS1 A;  1F40 A;  3WH0 A;  1LG1 A;  3RM4 A;  3CHC A;  2N87 A;  1B6C A;  2PPP A;  3BMB A;  3VAW A;  2YSH A;  3O5P A;  2JX8 A;  1D2K A;  3WD3 A;  4NSB A;  4G50 A;  5HW7 A;  1D7I A;  2M2A A;  3MQH A;  2ZR4 A;  1W1V A;  3B9A A;  3ARV A;  5D75 A;  4MGV A;  1UR9 A;  1EIB A;  2DMV A;  4Z2I A;  4QIB A;  4R0X A;  1VF8 A;  1YAT A;  3UQA A;  1WMV A;  4ODN A;  3ARS A;  4DWS C;  5HBF A;  2PBC A;  1K9Q A;  2Q5A A;  2RUD A;  3ARU A;  2IUZ A;  1SR0 A;  4MNJ A;  2DG3 A;  3UI6 A;  3G6L A;  4W9Q A;  2ETN A;  4ML4 A;  5HT1 A;  3RME A;  2M08 A;  2XP7 A;  3FY1 A;  3ARZ A;  4MSP A;  2JZV A;  1J4R A;  2KE0 A;  3O5J A;  2B5U B;  2M1I A;  2WK2 A;  4WK9 A;  5E66 A;  1K9T A;  4ODQ A;  2MPH A;  1RP5 A;  2ZQV A;  4U84 A;  3MCB A;  4IQC A;  4ODL A;  1J6Y A;  4A0T A;  2LKN A;  1K9R A;  4WJX A;  3O5O A;  3ALF A;  1FKH A;  4E5R A;  1XRV A;  2LJ4 A;  5JH8 A;  4Z2H A;  1E9L A;  1FKR A;  2OWO A;  1E6R A;  4MPK A;  2A3E A;  1JCH B;  1Q6H A;  4DRQ A;  3UI4 A;  2M3O W;  2MDI A;  2KGJ A;  2F2D A;  2KFW A;  4HBO A;  4P8V A;  4W5U A;  1LL7 A;  3ALG A;  2XP6 A;  4LAY A;  1P5Q A;  3O5R A;  2WLZ A;  3I6C A;  1ZBV A;  3O5G A;  2XP8 A;  2DSV A;  4WKH A;  5AHT A;  5J6E A;  2E45 A;  1E15 A;  1FAP A;  3KAD A;  4O2T A;  3CNG A;  2A3B A;  1GUV A;  4L3N A;  2JMF A;  3ARR A;  3UQB A;  2ZQU A;  4TNS A;  4Z2J A;  5HW8 A;  2K8I A;  5E65 A;  4W9O A;  4LGX A;  3GTY X;  3WQW A;  1WNO A;  1GOI A;  4MAV A;  1PIN A;  2LGO A;  1ZBK A;  1PBK A;  4DH0 A;  1UR8 A;  2DG4 A;  3PRB A;  3G6M A;  2DSW A;  3CH9 A;  5GQB A;  4FAP A;  3QOK A;  3TDB A;  3O5L A;  1E6N A;  3PRA A;  3O5F A;  2OLH A;  3M85 A;  2DG9 A;  5E62 A;  3MCB B;  5HUA A;  4MTV A;  3UI5 A;  1JNS A;  1D7H A;  5B8I C;  4LAV A;  1NWS A;  1FKT A;  3WL1 A;  3JYJ A;  2G8Z A;  5CQ2 A;  3CGM A;  3FXY A;  4KQZ A;  3O5Q A;  1NH6 A;  3B9D A;  3GU0 A;  3WKZ A;  3CZ8 A;  1E6Z A;  4U85 A;  2YBU A;  3KAB A;  3PRD A;  1ZL1 A;  2DSZ A;  4ZS6 A;  1LG2 A;  2RUR A;  1HJW A;  4JFI A;  2WM0 A;  4ODR A;  3RM8 A;  1FKF A;  1TFV A;  4TW8 A;  4Z2G A;  2YSG A;  1ZBC A;  2ZQS A;  1EHN A;  1ZBW A; 
#chains in the Genus database with same CATH homology
 2O9O A;  4REX A;  1ZB5 A;  1W1Y A;  1NWR A;  3WD1 A;  4QZV B;  3FSC A;  4S3J A;  2YBT A;  5E64 A;  3ARO A;  4DWS B;  3RM9 A;  2L4J A;  1H0G A;  4G2P A;  1FKL A;  1FKS A;  1W1P A;  1XHG A;  2YSF A;  4TW6 A;  2VCD A;  4U86 A;  4AY1 A;  1Q6U A;  3LKX A;  4P8X A;  3LUO A;  1FFQ A;  4IQ2 A;  4DRO A;  1FJD A;  1NWU A;  4J4N A;  2XPA A;  4IT4 A;  4MNM A;  1OGG A;  4WKF A;  3KAF A;  2ZQT A;  1O6I A;  4NNR A;  1FKJ A;  2DWV A;  3UQI A;  5GPG A;  5E5W A;  3O5K A;  4ZPW R;  1N1A A;  4JFM A;  1NWT A;  1SYT A;  2F21 A;  4A0U A;  3PA7 A;  2AWG A;  2D9F A;  4C02 B;  4R5E A;  2MNT A;  4DZ2 A;  1TK7 A;  1NSG A;  3JYM A;  4JFL A;  4ODM A;  3MQG A;  4S3K A;  2DSU A;  2PPO A;  3TCZ A;  4TW7 A;  4PTM A;  4DIP A;  1KFW A;  3AS3 A;  1FLC A;  3B7X A;  4GLX A;  2UZ5 A;  1ZK6 A;  2XP5 A;  3IK8 A;  1W26 A;  1EYM A;  4QT3 A;  1M5Y A;  1HKJ A;  4Z2K A;  2DT2 A;  2FAP A;  2ESC A;  3PQH A;  1H0I A;  1X6L A;  2L2S A;  2PV2 A;  4DWS A;  3EY6 A;  4JFJ A;  3O5M A;  1BL4 A;  1ROT A;  1J4I A;  3ARX A;  2YAJ B;  5HKG A;  3KAI A;  4DWS D;  3ART A;  4XAK A;  3WL0 A;  1QPL A;  2PV3 A;  1EG3 A;  4KR0 B;  3ARQ A;  3BXW A;  4MNK A;  3ODK A;  1FFR A;  2DK1 A;  1R9H A;  1X6N A;  3TC5 A;  2QF8 A;  5HWB A;  1A7X A;  1W9P A;  1KT1 A;  4Z2L A;  5HWC A;  1ZU8 A;  1C9H A;  1L1P A;  3KZ7 A;  3WQV A;  2O92 A;  3LKX B;  1OGB A;  3LE4 A;  1FKB A;  2WLY A;  3O5I A;  2KR7 A;  1LJY A;  4JFK A;  5DIT A;  1Y0O A;  1U79 A;  2XP9 A;  3B8S A;  1LQ0 A;  5DO2 A;  4ITZ A;  4ZPT R;  3IKG A;  3IHZ A;  2KO7 A;  1HKM A;  2KXQ A;  3RFW A;  2DT0 A;  4ZPV R;  5DEZ A;  2DK7 A;  1JNT A;  1WB0 A;  1FD9 A;  4DRJ A;  4DRH A;  4BF8 A;  4ODP A;  5U47 A;  4ODK A;  4URI A;  4P8U A;  4FN2 A;  2MF9 A;  2Y8N B;  4DT4 A;  5DF0 A;  4IT6 A;  4N19 A;  3FS8 A;  1D7J A;  1JVW A;  3WIJ A;  2MLZ A;  2G41 A;  4W9P A;  1BKF A;  2B31 A;  3L4H A;  4Q7N A;  2MLX A;  1RD6 A;  4J4O A;  1W9U A;  2IF4 A;  4WKA A;  1EQ3 A;  4WIW A;  3RGC A;  2ZR6 A;  4L72 B;  4DZ3 A;  2RUC A;  1LL4 A;  2DT3 A;  1ZCN A;  2XP4 A;  4TX0 A;  1IX5 A;  5BXJ A;  1TR8 A;  1FKG A;  2WAD A;  1NMW A;  2RE3 A;  3WD4 A;  1I5H W;  4TYO A;  2YSB A;  1TCO C;  4Q22 A;  2RQS A;  3OOB A;  2ZAJ A;  2LPV A;  5DIV A;  1W1T A;  1FKI A;  4DRP A;  1OWQ A;  4DRN A;  1YW5 A;  2MLY A;  2DJY A;  5HW6 A;  3CHF A;  2PI6 A;  2VN1 A;  2M8I A;  3KAC A;  2F4E A;  1J4H A;  4DRI A;  3NTP A;  3MDY B;  2M8J A;  3FAP A;  4LAW A;  2JV4 A;  1EG4 A;  1FKD A;  1KT0 A;  2PPN A;  3OA5 A;  5I98 A;  2ITK A;  1QZ2 A;  3B9E A;  3NRK A;  2LAJ A;  1HJV A;  1WR7 A;  2ZR5 A;  1LL6 A;  2Y78 A;  2RSE A;  4HBE A;  1HJX A;  1JND A;  1WAW A;  4IPX A;  2RUQ A;  3AS2 A;  2QRV A;  1GPF A;  3JXV A;  2BA1 A;  3CHD A;  4LAX A;  2A3A A;  2YSI A;  3KAG A;  4ODO A;  1ITX A;  1NMV A;  2FDM A;  1FKK A;  1Q1C A;  4GGQ A;  3M7N A;  3CGN A;  3ARY A;  1HXV A;  2WAE A;  2DT1 A;  4DRK A;  1T11 A;  1CTN A;  3O5E A;  2AOS A;  3ARP A;  3KCE A;  3PR9 A;  1D6O A;  4GIV A;  3ARW A;  2DPE A;  4DRM A;  4HAR A;  3AS0 A;  3IKD A;  3NI6 A;  1F8A B;  3CHE A;  2OFN A;  3GPK A;  1O6W A;  1ROU A;  1HKK A;  3KAH A;  3W4R A;  4JYS A;  2A3C A;  4NZC A;  3H9R B;  1W9V A;  1E6P A;  1JMQ A;  2XP3 A;  1Q6I A;  3O5D A;  3AQU A;  1EDQ A;  5HTG A;  1HKI A;  2FKE A;  3UF8 A;  5DIU A;  2EZ5 W;  3FSB A;  4MNL A;  4QT2 A;  4P8W A;  1QPF A;  2KI3 A;  2PV1 A;  5GPR A;  2XPB A;  3WD2 A;  2JXW A;  1JNE A;  3WD0 A;  3AS1 A;  1F40 A;  3WH0 A;  1LG1 A;  3RM4 A;  3CHC A;  2N87 A;  1B6C A;  2PPP A;  3VAW A;  2YSH A;  3O5P A;  2JX8 A;  1D2K A;  3WD3 A;  4NSB A;  4G50 A;  5HW7 A;  1D7I A;  2M2A A;  3MQH A;  2ZR4 A;  1W1V A;  3B9A A;  3ARV A;  5D75 A;  4MGV A;  1UR9 A;  1EIB A;  2DMV A;  4Z2I A;  4QIB A;  4R0X A;  1VF8 A;  1YAT A;  3UQA A;  1WMV A;  4ODN A;  3ARS A;  4DWS C;  5HBF A;  2PBC A;  1K9Q A;  2Q5A A;  2RUD A;  3ARU A;  2IUZ A;  1SR0 A;  4MNJ A;  2DG3 A;  3UI6 A;  3G6L A;  4W9Q A;  4ML4 A;  5HT1 A;  3RME A;  2M08 A;  2XP7 A;  3FY1 A;  3ARZ A;  4MSP A;  2JZV A;  1J4R A;  2KE0 A;  3O5J A;  2M1I A;  2WK2 A;  4WK9 A;  5E66 A;  1K9T A;  4ODQ A;  2MPH A;  1RP5 A;  2ZQV A;  4U84 A;  3MCB A;  4IQC A;  4ODL A;  1J6Y A;  4A0T A;  2LKN A;  1K9R A;  4WJX A;  3O5O A;  3ALF A;  1FKH A;  4E5R A;  1XRV A;  2LJ4 A;  5JH8 A;  4Z2H A;  1E9L A;  1FKR A;  2OWO A;  1E6R A;  4MPK A;  2A3E A;  1Q6H A;  4DRQ A;  3UI4 A;  2M3O W;  2MDI A;  2KGJ A;  2F2D A;  2KFW A;  4HBO A;  4P8V A;  4W5U A;  1LL7 A;  3ALG A;  2XP6 A;  4LAY A;  1P5Q A;  3O5R A;  2WLZ A;  3I6C A;  1ZBV A;  3O5G A;  2XP8 A;  2DSV A;  4WKH A;  5AHT A;  5J6E A;  2E45 A;  1E15 A;  1FAP A;  3KAD A;  4O2T A;  3CNG A;  2A3B A;  1GUV A;  4L3N A;  2JMF A;  3ARR A;  3UQB A;  2ZQU A;  4TNS A;  4Z2J A;  5HW8 A;  2K8I A;  5E65 A;  4W9O A;  4LGX A;  3WQW A;  1WNO A;  1GOI A;  4MAV A;  1PIN A;  2LGO A;  1ZBK A;  1PBK A;  4DH0 A;  1UR8 A;  2DG4 A;  3PRB A;  3G6M A;  2DSW A;  3CH9 A;  5GQB A;  4FAP A;  3QOK A;  3TDB A;  3O5L A;  1E6N A;  3PRA A;  3O5F A;  2OLH A;  3M85 A;  2DG9 A;  5E62 A;  3MCB B;  5HUA A;  4MTV A;  3UI5 A;  1JNS A;  1D7H A;  5B8I C;  4LAV A;  1NWS A;  1FKT A;  3WL1 A;  3JYJ A;  2G8Z A;  5CQ2 A;  3CGM A;  3FXY A;  4KQZ A;  3O5Q A;  1NH6 A;  3B9D A;  3WKZ A;  3CZ8 A;  1E6Z A;  4U85 A;  2YBU A;  3KAB A;  3PRD A;  1ZL1 A;  2DSZ A;  4ZS6 A;  1LG2 A;  2RUR A;  1HJW A;  4JFI A;  2WM0 A;  4ODR A;  3RM8 A;  1FKF A;  1TFV A;  4TW8 A;  4Z2G A;  2YSG A;  1ZBC A;  2ZQS A;  1EHN A;  1ZBW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...