3WH0A

Structure of pin1 complex with 18-crown-6
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
157
structure length
145
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crowning Proteins: Modulating the Protein Surface Properties using Crown Ethers.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 46
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3wh0A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3wh0A02
3O5KA 1U79A 2ZR6A 5J6EA 3KZ7A 3IK8A 3O5EA 3UQAA 3CNGA 1FKFA 1TCOC 2RURA 1P5QA 1W26A 1YATA 2XP9A 4QT2A 1B6CA 1ROUA 2F2DA 3IHZA 3JXVA 4ITZA 4LAYA 4TX0A 3TC5A 1WMVA 2RSEA 3KACA 3O5FA 3B7XA 4QIBA 2ZR5A 2VN1A 1JVWA 2XP4A 1JMQA 1J4IA 3NI6A 4DRJA 5HW8A 4LAWA 4JYSA 3LUOA 1QPFA 3RGCA 1KT0A 1M5YA 3EY6A 2ZQSA 4DRHA 2PPNA 2PV2A 3M7NA 2KGJA 4R0XA 4TW7A 2RQSA 1FKIA 1A7XA 3JYJA 4DRMA 4DRIA 4ODNA 1JNTA 4ODQA 2M8JA 4NNRA 3IKDA 1ZCNA 1NSGA 1D6OA 5HWBA 2XPAA 2KE0A 1Q6HA 3O5RA 2DJYA 2PPPA 3PRDA 1PBKA 2PV1A 2XP7A 2DG9A 3KAGA 2BA1A 2LGOA 1EG4A 2MLXA 3MDYB 4IQCA 4W9PA 3UI6A 4DROA 2JX8A 3KCEA 3O5LA 4DH0A 2N87A 4N19A 4DZ3A 4ODRA 3UQIA 2M08A 5HW7A 4E5RA 2F21A 2L4JA 2Q5AA 2D9FA 4MGVA 2ZAJA 1EQ3A 2K8IA 3O5IA 4DZ2A 1NMWA 2VCDA 4IQ2A 2DWVA 5HWCA 2LPVA 2M2AA 2LAJA 1N1AA 2MDIA 1FKSA 4DIPA 1ZK6A 2JV4A 3NRKA 2Y78A 4REXA 3I6CA 1T11A 2MPHA 1HXVA 1PINA 2M3OW 2XP3A 2LKNA 2L2SA 3H9RB 4O2TA 3KAHA 1EG3A 1O6WA 2JZVA 4G2PA 3O5DA 5D75A 4MSPA 3KADA 4DRQA 4JFLA 5HKGA 2ZQUA 4DRPA 4TW8A 5BXJA 4TYOA 1FKHA 2DK7A 2XPBA 2DK1A 3O5OA 2EZ5W 1D7JA 4JFJA 4ODKA 1FKGA 2DMVA 2KI3A 2XP6A 3KAIA 2ZQVA 3JYMA 4JFKA 1R9HA 3CGNA 2JXWA 4J4NA 4LAXA 1J6YA 3KABA 2DG4A 5DITA 1K9RA 1QPLA 2FAPA 2OFNA 2RUCA 4BF8A 5HT1A 5HW6A 1L1PA 2YSIA 1F8AB 3TDBA 2RUQA 2KXQA 3O5MA 5I98A 1FJDA 1D7HA 1EYMA 1Y0OA 1YW5A 3OOBA 1KT1A 1Q6UA 1QZ2A 1J4HA 2IF4A 4U85A 2MLYA 2MLZA 3M85A 1K9QA 3CGMA 3GPKA 2RE3A 3PA7A 4TNSA 3UI4A 2JMFA 1NMVA 2KR7A 4J4OA 3O5JA 4C02B 1BKFA 3RFWA 4LAVA 2F4EA 4G50A 5DIUA 2XP8A 2XP5A 5HTGA 4W9QA 1FKJA 3IKGA 3PRBA 1BL4A 2PBCA 1I5HW 2YSFA 2RUDA 2ITKA 2M1IA 2DG3A 1TK7A 4U84A 3O5PA 2ZR4A 2M8IA 3VAWA 1ROTA 2UZ5A 4JFMA 2PV3A 1C9HA 4JFIA 5DIVA 1FKTA 2YSGA 3LE4A 2AWGA 4ODLA 1FKRA 4U86A 4FAPA 1Q6IA 4ODOA 3NTPA 2ZQTA 3TCZA 4ODMA 2YSHA 3L4HA 2MF9A 4QT3A 5B8IC 3ODKA 4ODPA 1D7IA 5HUAA 4GGQA 2KFWA 5AHTA 4IPXA 4W9OA 4DRKA 1JNSA 3O5GA 1FKDA 4FN2A 1J4RA 4TW6A 4DT4A 4GIVA 1FKBA 3WH0A 2MNTA 1Q1CA 3UI5A 1FKLA 1WR7A 2YSBA 3O5QA 2FKEA 3FAPA 5GPGA 2PPOA 1F40A 2E45A 1FKKA 3KAFA 2LJ4A 3UQBA 1FAPA 2KO7A 3UF8A 4DRNA 1FD9A 5CQ2A
chains in the Genus database with same CATH superfamily
3O5KA 4WIWA 3ARVA 4Q7NA 1YATA 1B6CA 2F2DA 2OWOA 4HARA 4W5UA 1WMVA 3WD2A 2DPEA 3B7XA 4ZPVR 5DF0A 1JVWA 3ALFA 5HW8A 1QPFA 1K9TA 3MCBA 2PV2A 1ZBCA 1A7XA 3ARYA 1LG1A 1NWTA 4NNRA 3IKDA 3CHEA 1W9UA 1ZCNA 1FLCA 1E6RA 3KAGA 3MDYB 1EG4A 4URIA 2N87A 4DZ3A 4P8VA 4NZCA 2F21A 2ZAJA 1LQ0A 2K8IA 4DZ2A 2DT3A 2LPVA 2LAJA 5JH8A 2B31A 4DIPA 3NRKA 4REXA 3I6CA 3B9DA 1HXVA 2M3OW 2XP3A 4ZS6A 3CZ8A 4O2TA 3ARQA 3LKXB 3KADA 4S3JA 4AY1A 2WLZA 2XPBA 4JFJA 1NWSA 1FKGA 1ZBKA 4P8UA 2ESCA 2DG4A 3ARSA 2OFNA 2RUCA 5HT1A 1OGGA 3RM4A 1L1PA 5I98A 1Y0OA 1YW5A 3WKZA 1J4HA 5GPRA 3LKXA 3M85A 1D2KA 1HKMA 2KR7A 3BMBA 4C02B 4G50A 2XP8A 2XP5A 1FKJA 4Q22A 1HKKA 2PBCA 2ITKA 1TK7A 1JCHB 3O5PA 3OA5A 1C9HA 3CH9A 4U86A 4ODOA 5E5WA 2MF9A 1HKIA 2KFWA 2P4VA 1FKDA 4IT4A 3G6LA 4Z2JA 4FN2A 4TW6A 4DT4A 4GIVA 2MNTA 2YSBA 3O5QA 3MQGA 4MNLA 2FKEA 1WNOA 2PPOA 1JNDA 3B9EA 3WQWA 3RM9A 4Z2HA 1FD9A 5CQ2A 5BXJA 5J6EA 3KZ7A 3O5EA 5E65A 3CNGA 1TCOC 2RURA 4QT2A 4DWSC 1ROUA 4TX0A 3JXVA 4DWSA 3WD3A 1SR0A 2YBUA 2XP4A 3NI6A 3RGCA 1M5YA 2ZQSA 2B5UB 3AS3A 3JYJA 1GUVA 1JNTA 4ZPWR 3PR9A 5HWBA 1Q6HA 2DJYA 2PPPA 3PRDA 1PBKA 3ARZA 2PV1A 4DWSB 4IQCA 2BA1A 3UI6A 4W9PA 4DROA 2JX8A 3KCEA 4HBEA 4N19A 2QRVA 4ODRA 2Q5AA 3MCBB 2QF8A 3O5IA 1X6NA 1NMWA 2VCDA 3BXWA 4IQ2A 3AQUA 3WD4A 1FKSA 2DSVA 2IUZA 2JV4A 5HBFA 1W1PA 1ZB5A 3H9RB 5D75A 4MSPA 4DRQA 4TW8A 4TYOA 3WD1A 2DSWA 3O5OA 2KI3A 1NWRA 4ML4A 2ZQVA 1EIBA 4LGXA 1R9HA 2JXWA 1HJXA 4Z2GA 1J6YA 3KABA 5DITA 1K9RA 1QPLA 4Z2KA 3TDBA 2Y8NB 5E62A 3OOBA 1QZ2A 4JFKA 1UR8A 3GPKA 5DO2A 4TNSA 3UI4A 5HKGA 3PA7A 2RE3A 1LL7A 4J4OA 4WKHA 3O5JA 1BKFA 2DT2A 2F4EA 1WB0A 3ARXA 4IT6A 1I5HW 1TR8A 4S3KA 3G6MA 4PTMA 2UZ5A 1SYTA 2OLHA 4JFMA 1H0GA 2PV3A 4MNJA 4FAPA 4QT3A 3TCZA 5B8IC 2YSHA 3ODKA 4ODPA 1D7IA 5AHTA 4DRKA 4W9OA 2WAEA 1EHNA 4L72B 3W4RA 3UI5A 2WK2A 5E66A 1FKKA 3UQBA 3FSBA 1FAPA 1FFQA 3UF8A 3ARPA 3WL0A 1U79A 2ZR6A 3UQAA 1ZL1A 4A0TA 1W26A 2XP9A 3IHZA 1E9LA 4ITZA 3ARUA 3TC5A 2VN1A 1NWUA 1J4IA 4JYSA 3LUOA 1KT0A 3EY6A 4DRHA 4NSBA 1XHGA 3FS8A 2PPNA 3FXYA 4DWSD 4R0XA 4TW7A 1FKIA 4DRMA 5DEZA 4DRIA 4ODQA 2M8JA 2DT0A 3FY1A 1NSGA 4WKAA 2XPAA 4Z2LA 3O5RA 2LGOA 4MNMA 2F23A 4DH0A 4MPKA 4L3NA 1EQ3A 2D9FA 2L4JA 4MGVA 2WADA 4MNKA 5HWCA 2M2AA 1GRJA 1N1AA 2MDIA 2Y78A 1T11A 1ZBVA 2MPHA 1PINA 3RM8A 2LKNA 3WIJA 2L2SA 3KAHA 1EG3A 1W9PA 2JZVA 4G2PA 2DT1A 1W1TA 4JFLA 4P8WA 3ARTA 1FKHA 2DK7A 2DK1A 4ODKA 2EZ5W 1D7JA 2DMVA 3QOKA 2XP6A 3PQHA 4MAVA 2DSZA 2FAPA 5HW6A 1GOIA 2A3AA 1F8AB 2RUQA 3O5MA 4P8XA 1D7HA 1LJYA 4KQZA 2MLYA 1KT1A 2IF4A 3CGMA 4U85A 1K9QA 2JMFA 1NMVA 5E64A 2A3BA 3RFWA 5HTGA 3IKGA 1ITXA 1IX5A 2M1IA 2ZR4A 2M8IA 1FFRA 1HJWA 1ROTA 2YBTA 4JFIA 4WK9A 5DIVA 1FKTA 3LE4A 4ODLA 3CHFA 1Q6IA 2O92A 3NTPA 2ZQTA 1KFWA 3ALGA 3L4HA 5HUAA 1HKJA 4KR0B 1FKBA 3WH0A 1FKLA 1WAWA 3WL1A 4WKFA 3FSCA 5GPGA 3FAPA 1F40A 3KAFA 2LJ4A 1EDQA 2WLYA 2KO7A 4DRNA 2ETNA 1RP5A 3IK8A 1FKFA 1P5QA 4QZVB 1E44A 4LAYA 2O9OA 2RSEA 3KACA 3O5FA 4QIBA 2ZR5A 4XAKA 4DRJA 1JMQA 3CHCA 3GTYX 4LAWA 2G8ZA 3AS2A 4R5EA 3ARRA 4GLXA 3M7NA 2KGJA 2RQSA 2DSUA 1W9VA 4ODNA 3WQVA 1D6OA 2KE0A 2XP7A 2DG9A 2MLXA 1OWQA 3O5LA 5GQBA 3RMEA 1CTNA 1E6NA 2M08A 3UQIA 4E5RA 5HW7A 1LL4A 4A0UA 1HJVA 3MQHA 4HBOA 2DWVA 2EULA 1RD6A 1UR9A 1ZK6A 3EIPA 3AS1A 1O6IA 1E6PA 1JNEA 1W1YA 1O6WA 3O5DA 2PN0A 1X6LA 2ZQUA 4DRPA 1NH6A 3KAIA 3JYMA 2WM0A 3CGNA 4J4NA 4LAXA 4BF8A 2YSIA 2KXQA 1FJDA 1VF8A 1EYMA 3ARWA 1Q6UA 2MLZA 1ZU8A 4Z2IA 3WD0A 1OGBA 3AROA 4LAVA 5DIUA 2YAJB 3B9AA 1H0IA 3CHDA 4W9QA 3PRBA 1BL4A 2A3CA 3B8SA 2YSFA 2RUDA 2DG3A 1LL6A 3AS0A 4U84A 5U47A 4MTVA 3VAWA 1W1VA 1E15A 2PI6A 2YSGA 2AWGA 4WJXA 1FKRA 1ZBWA 4ODMA 2FDMA 1E6ZA 3GU0A 2AOSA 4GGQA 1XRVA 4IPXA 4UDMA 1JNSA 3O5GA 1J4RA 2G41A 1LG2A 1Q1CA 1TFVA 1WR7A 2A3EA 2E45A 3PRAA 4ZPTR 1GPFA
chains in the Genus database with same CATH topology
3O5KA 4WIWA 3ARVA 4Q7NA 1YATA 1B6CA 2F2DA 2OWOA 4HARA 4W5UA 1WMVA 3WD2A 2DPEA 3B7XA 4ZPVR 5DF0A 1JVWA 3ALFA 5HW8A 1QPFA 1K9TA 3MCBA 2PV2A 1ZBCA 1A7XA 3ARYA 1LG1A 1NWTA 4NNRA 3IKDA 3CHEA 1W9UA 1ZCNA 1FLCA 1E6RA 3KAGA 3MDYB 1EG4A 4URIA 2N87A 4DZ3A 4P8VA 4NZCA 2F21A 2ZAJA 1LQ0A 2K8IA 4DZ2A 2DT3A 2LPVA 2LAJA 5JH8A 2B31A 4DIPA 3NRKA 4REXA 3I6CA 3B9DA 1HXVA 2M3OW 2XP3A 4ZS6A 3CZ8A 4O2TA 3ARQA 3LKXB 3KADA 4S3JA 4AY1A 2WLZA 2XPBA 4JFJA 1NWSA 1FKGA 1ZBKA 4P8UA 2ESCA 2DG4A 3ARSA 2OFNA 2RUCA 5HT1A 1OGGA 3RM4A 1L1PA 5I98A 1Y0OA 1YW5A 3WKZA 1J4HA 5GPRA 3LKXA 3M85A 1D2KA 1HKMA 2KR7A 4C02B 4G50A 2XP8A 2XP5A 1FKJA 4Q22A 1HKKA 2PBCA 2ITKA 1TK7A 3O5PA 3OA5A 1C9HA 3CH9A 4U86A 4ODOA 5E5WA 2MF9A 1HKIA 2KFWA 1FKDA 4IT4A 3G6LA 4Z2JA 4FN2A 4TW6A 4DT4A 4GIVA 2MNTA 2YSBA 3O5QA 3MQGA 4MNLA 2FKEA 1WNOA 2PPOA 1JNDA 3B9EA 3WQWA 3RM9A 4Z2HA 1FD9A 5CQ2A 5BXJA 5J6EA 3KZ7A 3O5EA 5E65A 3CNGA 1TCOC 2RURA 4QT2A 4DWSC 1ROUA 4TX0A 3JXVA 4DWSA 3WD3A 1SR0A 2YBUA 2XP4A 3NI6A 3RGCA 1M5YA 2ZQSA 3AS3A 3JYJA 1GUVA 1JNTA 4ZPWR 3PR9A 5HWBA 1Q6HA 2DJYA 2PPPA 3PRDA 1PBKA 3ARZA 2PV1A 4DWSB 4IQCA 2BA1A 3UI6A 4W9PA 4DROA 2JX8A 3KCEA 4HBEA 4N19A 2QRVA 4ODRA 2Q5AA 3MCBB 2QF8A 3O5IA 1X6NA 1NMWA 2VCDA 3BXWA 4IQ2A 3AQUA 3WD4A 1FKSA 2DSVA 2IUZA 2JV4A 5HBFA 1W1PA 1ZB5A 3H9RB 5D75A 4MSPA 4DRQA 4TW8A 4TYOA 3WD1A 2DSWA 3O5OA 2KI3A 1NWRA 4ML4A 2ZQVA 1EIBA 4LGXA 1R9HA 2JXWA 1HJXA 4Z2GA 1J6YA 3KABA 5DITA 1K9RA 1QPLA 4Z2KA 3TDBA 2Y8NB 5E62A 3OOBA 1QZ2A 4JFKA 1UR8A 3GPKA 5DO2A 4TNSA 3UI4A 5HKGA 3PA7A 2RE3A 1LL7A 4J4OA 4WKHA 3O5JA 1BKFA 2DT2A 2F4EA 1WB0A 3ARXA 4IT6A 1I5HW 1TR8A 4S3KA 3G6MA 4PTMA 2UZ5A 1SYTA 2OLHA 4JFMA 1H0GA 2PV3A 4MNJA 4FAPA 4QT3A 3TCZA 5B8IC 2YSHA 3ODKA 4ODPA 1D7IA 5AHTA 4DRKA 4W9OA 2WAEA 1EHNA 4L72B 3W4RA 3UI5A 2WK2A 5E66A 1FKKA 3UQBA 3FSBA 1FAPA 1FFQA 3UF8A 3ARPA 3WL0A 1U79A 2ZR6A 3UQAA 1ZL1A 4A0TA 1W26A 2XP9A 3IHZA 1E9LA 4ITZA 3ARUA 3TC5A 2VN1A 1NWUA 1J4IA 4JYSA 3LUOA 1KT0A 3EY6A 4DRHA 4NSBA 1XHGA 3FS8A 2PPNA 3FXYA 4DWSD 4R0XA 4TW7A 1FKIA 4DRMA 5DEZA 4DRIA 4ODQA 2M8JA 2DT0A 3FY1A 1NSGA 4WKAA 2XPAA 4Z2LA 3O5RA 2LGOA 4MNMA 4DH0A 4MPKA 4L3NA 1EQ3A 2D9FA 2L4JA 4MGVA 2WADA 4MNKA 5HWCA 2M2AA 1N1AA 2MDIA 2Y78A 1T11A 1ZBVA 2MPHA 1PINA 3RM8A 2LKNA 3WIJA 2L2SA 3KAHA 1EG3A 1W9PA 2JZVA 4G2PA 2DT1A 1W1TA 4JFLA 4P8WA 3ARTA 1FKHA 2DK7A 2DK1A 4ODKA 2EZ5W 1D7JA 2DMVA 3QOKA 2XP6A 3PQHA 4MAVA 2DSZA 2FAPA 5HW6A 1GOIA 2A3AA 1F8AB 2RUQA 3O5MA 4P8XA 1D7HA 1LJYA 4KQZA 2MLYA 1KT1A 2IF4A 3CGMA 4U85A 1K9QA 2JMFA 1NMVA 5E64A 2A3BA 3RFWA 5HTGA 3IKGA 1ITXA 1IX5A 2M1IA 2ZR4A 2M8IA 1FFRA 1HJWA 1ROTA 2YBTA 4JFIA 4WK9A 5DIVA 1FKTA 3LE4A 4ODLA 3CHFA 1Q6IA 2O92A 3NTPA 2ZQTA 1KFWA 3ALGA 3L4HA 5HUAA 1HKJA 4KR0B 1FKBA 3WH0A 1FKLA 1WAWA 3WL1A 4WKFA 3FSCA 5GPGA 3FAPA 1F40A 3KAFA 2LJ4A 1EDQA 2WLYA 2KO7A 4DRNA 1RP5A 3IK8A 1FKFA 1P5QA 4QZVB 4LAYA 2O9OA 2RSEA 3KACA 3O5FA 4QIBA 2ZR5A 4XAKA 4DRJA 1JMQA 3CHCA 4LAWA 2G8ZA 3AS2A 4R5EA 3ARRA 4GLXA 3M7NA 2KGJA 2RQSA 2DSUA 1W9VA 4ODNA 3WQVA 1D6OA 2KE0A 2XP7A 2DG9A 2MLXA 1OWQA 3O5LA 5GQBA 3RMEA 1CTNA 1E6NA 2M08A 3UQIA 4E5RA 5HW7A 1LL4A 4A0UA 1HJVA 3MQHA 4HBOA 2DWVA 1RD6A 1UR9A 1ZK6A 3AS1A 1O6IA 1E6PA 1JNEA 1W1YA 1O6WA 3O5DA 1X6LA 2ZQUA 4DRPA 1NH6A 3KAIA 3JYMA 2WM0A 3CGNA 4J4NA 4LAXA 4BF8A 2YSIA 2KXQA 1FJDA 1VF8A 1EYMA 3ARWA 1Q6UA 2MLZA 1ZU8A 4Z2IA 3WD0A 1OGBA 3AROA 4LAVA 5DIUA 2YAJB 3B9AA 1H0IA 3CHDA 4W9QA 3PRBA 1BL4A 2A3CA 3B8SA 2YSFA 2RUDA 2DG3A 1LL6A 3AS0A 4U84A 5U47A 4MTVA 3VAWA 1W1VA 1E15A 2PI6A 2YSGA 2AWGA 4WJXA 1FKRA 1ZBWA 4ODMA 2FDMA 1E6ZA 2AOSA 4GGQA 1XRVA 4IPXA 1JNSA 3O5GA 1J4RA 2G41A 1LG2A 1Q1CA 1TFVA 1WR7A 2A3EA 2E45A 3PRAA 4ZPTR 1GPFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O5K A;  1U79 A;  2ZR6 A;  5J6E A;  3KZ7 A;  3IK8 A;  3O5E A;  3UQA A;  3CNG A;  1FKF A;  1TCO C;  2RUR A;  1P5Q A;  1W26 A;  1YAT A;  2XP9 A;  4QT2 A;  1B6C A;  1ROU A;  2F2D A;  3IHZ A;  3JXV A;  4ITZ A;  4LAY A;  4TX0 A;  3TC5 A;  1WMV A;  2RSE A;  3KAC A;  3O5F A;  3B7X A;  4QIB A;  2ZR5 A;  2VN1 A;  1JVW A;  2XP4 A;  1JMQ A;  1J4I A;  3NI6 A;  4DRJ A;  5HW8 A;  4LAW A;  4JYS A;  3LUO A;  1QPF A;  3RGC A;  1KT0 A;  1M5Y A;  3EY6 A;  2ZQS A;  4DRH A;  2PPN A;  2PV2 A;  3M7N A;  2KGJ A;  4R0X A;  4TW7 A;  2RQS A;  1FKI A;  1A7X A;  3JYJ A;  4DRM A;  4DRI A;  4ODN A;  1JNT A;  4ODQ A;  2M8J A;  4NNR A;  3IKD A;  1ZCN A;  1NSG A;  1D6O A;  5HWB A;  2XPA A;  2KE0 A;  1Q6H A;  3O5R A;  2DJY A;  2PPP A;  3PRD A;  1PBK A;  2PV1 A;  2XP7 A;  2DG9 A;  3KAG A;  2BA1 A;  2LGO A;  1EG4 A;  2MLX A;  3MDY B;  4IQC A;  4W9P A;  3UI6 A;  4DRO A;  2JX8 A;  3KCE A;  3O5L A;  4DH0 A;  2N87 A;  4N19 A;  4DZ3 A;  4ODR A;  3UQI A;  2M08 A;  5HW7 A;  4E5R A;  2F21 A;  2L4J A;  2Q5A A;  2D9F A;  4MGV A;  2ZAJ A;  1EQ3 A;  2K8I A;  3O5I A;  4DZ2 A;  1NMW A;  2VCD A;  4IQ2 A;  2DWV A;  5HWC A;  2LPV A;  2M2A A;  2LAJ A;  1N1A A;  2MDI A;  1FKS A;  4DIP A;  1ZK6 A;  2JV4 A;  3NRK A;  2Y78 A;  4REX A;  3I6C A;  1T11 A;  2MPH A;  1HXV A;  1PIN A;  2M3O W;  2XP3 A;  2LKN A;  2L2S A;  3H9R B;  4O2T A;  3KAH A;  1EG3 A;  1O6W A;  2JZV A;  4G2P A;  3O5D A;  5D75 A;  4MSP A;  3KAD A;  4DRQ A;  4JFL A;  5HKG A;  2ZQU A;  4DRP A;  4TW8 A;  5BXJ A;  4TYO A;  1FKH A;  2DK7 A;  2XPB A;  2DK1 A;  3O5O A;  2EZ5 W;  1D7J A;  4JFJ A;  4ODK A;  1FKG A;  2DMV A;  2KI3 A;  2XP6 A;  3KAI A;  2ZQV A;  3JYM A;  4JFK A;  1R9H A;  3CGN A;  2JXW A;  4J4N A;  4LAX A;  1J6Y A;  3KAB A;  2DG4 A;  5DIT A;  1K9R A;  1QPL A;  2FAP A;  2OFN A;  2RUC A;  4BF8 A;  5HT1 A;  5HW6 A;  1L1P A;  2YSI A;  1F8A B;  3TDB A;  2RUQ A;  2KXQ A;  3O5M A;  5I98 A;  1FJD A;  1D7H A;  1EYM A;  1Y0O A;  1YW5 A;  3OOB A;  1KT1 A;  1Q6U A;  1QZ2 A;  1J4H A;  2IF4 A;  4U85 A;  2MLY A;  2MLZ A;  3M85 A;  1K9Q A;  3CGM A;  3GPK A;  2RE3 A;  3PA7 A;  4TNS A;  3UI4 A;  2JMF A;  1NMV A;  2KR7 A;  4J4O A;  3O5J A;  4C02 B;  1BKF A;  3RFW A;  4LAV A;  2F4E A;  4G50 A;  5DIU A;  2XP8 A;  2XP5 A;  5HTG A;  4W9Q A;  1FKJ A;  3IKG A;  3PRB A;  1BL4 A;  2PBC A;  1I5H W;  2YSF A;  2RUD A;  2ITK A;  2M1I A;  2DG3 A;  1TK7 A;  4U84 A;  3O5P A;  2ZR4 A;  2M8I A;  3VAW A;  1ROT A;  2UZ5 A;  4JFM A;  2PV3 A;  1C9H A;  4JFI A;  5DIV A;  1FKT A;  2YSG A;  3LE4 A;  2AWG A;  4ODL A;  1FKR A;  4U86 A;  4FAP A;  1Q6I A;  4ODO A;  3NTP A;  2ZQT A;  3TCZ A;  4ODM A;  2YSH A;  3L4H A;  2MF9 A;  4QT3 A;  5B8I C;  3ODK A;  4ODP A;  1D7I A;  5HUA A;  4GGQ A;  2KFW A;  5AHT A;  4IPX A;  4W9O A;  4DRK A;  1JNS A;  3O5G A;  1FKD A;  4FN2 A;  1J4R A;  4TW6 A;  4DT4 A;  4GIV A;  1FKB A;  3WH0 A;  2MNT A;  1Q1C A;  3UI5 A;  1FKL A;  1WR7 A;  2YSB A;  3O5Q A;  2FKE A;  3FAP A;  5GPG A;  2PPO A;  1F40 A;  2E45 A;  1FKK A;  3KAF A;  2LJ4 A;  3UQB A;  1FAP A;  2KO7 A;  3UF8 A;  4DRN A;  1FD9 A;  5CQ2 A; 
#chains in the Genus database with same CATH topology
 3O5K A;  4WIW A;  3ARV A;  4Q7N A;  1YAT A;  1B6C A;  2F2D A;  2OWO A;  4HAR A;  4W5U A;  1WMV A;  3WD2 A;  2DPE A;  3B7X A;  4ZPV R;  5DF0 A;  1JVW A;  3ALF A;  5HW8 A;  1QPF A;  1K9T A;  3MCB A;  2PV2 A;  1ZBC A;  1A7X A;  3ARY A;  1LG1 A;  1NWT A;  4NNR A;  3IKD A;  3CHE A;  1W9U A;  1ZCN A;  1FLC A;  1E6R A;  3KAG A;  3MDY B;  1EG4 A;  4URI A;  2N87 A;  4DZ3 A;  4P8V A;  4NZC A;  2F21 A;  2ZAJ A;  1LQ0 A;  2K8I A;  4DZ2 A;  2DT3 A;  2LPV A;  2LAJ A;  5JH8 A;  2B31 A;  4DIP A;  3NRK A;  4REX A;  3I6C A;  3B9D A;  1HXV A;  2M3O W;  2XP3 A;  4ZS6 A;  3CZ8 A;  4O2T A;  3ARQ A;  3LKX B;  3KAD A;  4S3J A;  4AY1 A;  2WLZ A;  2XPB A;  4JFJ A;  1NWS A;  1FKG A;  1ZBK A;  4P8U A;  2ESC A;  2DG4 A;  3ARS A;  2OFN A;  2RUC A;  5HT1 A;  1OGG A;  3RM4 A;  1L1P A;  5I98 A;  1Y0O A;  1YW5 A;  3WKZ A;  1J4H A;  5GPR A;  3LKX A;  3M85 A;  1D2K A;  1HKM A;  2KR7 A;  3BMB A;  4C02 B;  4G50 A;  2XP8 A;  2XP5 A;  1FKJ A;  4Q22 A;  1HKK A;  2PBC A;  2ITK A;  1TK7 A;  1JCH B;  3O5P A;  3OA5 A;  1C9H A;  3CH9 A;  4U86 A;  4ODO A;  5E5W A;  2MF9 A;  1HKI A;  2KFW A;  2P4V A;  1FKD A;  4IT4 A;  3G6L A;  4Z2J A;  4FN2 A;  4TW6 A;  4DT4 A;  4GIV A;  2MNT A;  2YSB A;  3O5Q A;  3MQG A;  4MNL A;  2FKE A;  1WNO A;  2PPO A;  1JND A;  3B9E A;  3WQW A;  3RM9 A;  4Z2H A;  1FD9 A;  5CQ2 A;  5BXJ A;  5J6E A;  3KZ7 A;  3O5E A;  5E65 A;  3CNG A;  1TCO C;  2RUR A;  4QT2 A;  4DWS C;  1ROU A;  4TX0 A;  3JXV A;  4DWS A;  3WD3 A;  1SR0 A;  2YBU A;  2XP4 A;  3NI6 A;  3RGC A;  1M5Y A;  2ZQS A;  2B5U B;  3AS3 A;  3JYJ A;  1GUV A;  1JNT A;  4ZPW R;  3PR9 A;  5HWB A;  1Q6H A;  2DJY A;  2PPP A;  3PRD A;  1PBK A;  3ARZ A;  2PV1 A;  4DWS B;  4IQC A;  2BA1 A;  3UI6 A;  4W9P A;  4DRO A;  2JX8 A;  3KCE A;  4HBE A;  4N19 A;  2QRV A;  4ODR A;  2Q5A A;  3MCB B;  2QF8 A;  3O5I A;  1X6N A;  1NMW A;  2VCD A;  3BXW A;  4IQ2 A;  3AQU A;  3WD4 A;  1FKS A;  2DSV A;  2IUZ A;  2JV4 A;  5HBF A;  1W1P A;  1ZB5 A;  3H9R B;  5D75 A;  4MSP A;  4DRQ A;  4TW8 A;  4TYO A;  3WD1 A;  2DSW A;  3O5O A;  2KI3 A;  1NWR A;  4ML4 A;  2ZQV A;  1EIB A;  4LGX A;  1R9H A;  2JXW A;  1HJX A;  4Z2G A;  1J6Y A;  3KAB A;  5DIT A;  1K9R A;  1QPL A;  4Z2K A;  3TDB A;  2Y8N B;  5E62 A;  3OOB A;  1QZ2 A;  4JFK A;  1UR8 A;  3GPK A;  5DO2 A;  4TNS A;  3UI4 A;  5HKG A;  3PA7 A;  2RE3 A;  1LL7 A;  4J4O A;  4WKH A;  3O5J A;  1BKF A;  2DT2 A;  2F4E A;  1WB0 A;  3ARX A;  4IT6 A;  1I5H W;  1TR8 A;  4S3K A;  3G6M A;  4PTM A;  2UZ5 A;  1SYT A;  2OLH A;  4JFM A;  1H0G A;  2PV3 A;  4MNJ A;  4FAP A;  4QT3 A;  3TCZ A;  5B8I C;  2YSH A;  3ODK A;  4ODP A;  1D7I A;  5AHT A;  4DRK A;  4W9O A;  2WAE A;  1EHN A;  4L72 B;  3W4R A;  3UI5 A;  2WK2 A;  5E66 A;  1FKK A;  3UQB A;  3FSB A;  1FAP A;  1FFQ A;  3UF8 A;  3ARP A;  3WL0 A;  1U79 A;  2ZR6 A;  3UQA A;  1ZL1 A;  4A0T A;  1W26 A;  2XP9 A;  3IHZ A;  1E9L A;  4ITZ A;  3ARU A;  3TC5 A;  2VN1 A;  1NWU A;  1J4I A;  4JYS A;  3LUO A;  1KT0 A;  3EY6 A;  4DRH A;  4NSB A;  1XHG A;  3FS8 A;  2PPN A;  3FXY A;  4DWS D;  4R0X A;  4TW7 A;  1FKI A;  4DRM A;  5DEZ A;  4DRI A;  4ODQ A;  2M8J A;  2DT0 A;  3FY1 A;  1NSG A;  4WKA A;  2XPA A;  4Z2L A;  3O5R A;  2LGO A;  4MNM A;  2F23 A;  4DH0 A;  4MPK A;  4L3N A;  1EQ3 A;  2D9F A;  2L4J A;  4MGV A;  2WAD A;  4MNK A;  5HWC A;  2M2A A;  1GRJ A;  1N1A A;  2MDI A;  2Y78 A;  1T11 A;  1ZBV A;  2MPH A;  1PIN A;  3RM8 A;  2LKN A;  3WIJ A;  2L2S A;  3KAH A;  1EG3 A;  1W9P A;  2JZV A;  4G2P A;  2DT1 A;  1W1T A;  4JFL A;  4P8W A;  3ART A;  1FKH A;  2DK7 A;  2DK1 A;  4ODK A;  2EZ5 W;  1D7J A;  2DMV A;  3QOK A;  2XP6 A;  3PQH A;  4MAV A;  2DSZ A;  2FAP A;  5HW6 A;  1GOI A;  2A3A A;  1F8A B;  2RUQ A;  3O5M A;  4P8X A;  1D7H A;  1LJY A;  4KQZ A;  2MLY A;  1KT1 A;  2IF4 A;  3CGM A;  4U85 A;  1K9Q A;  2JMF A;  1NMV A;  5E64 A;  2A3B A;  3RFW A;  5HTG A;  3IKG A;  1ITX A;  1IX5 A;  2M1I A;  2ZR4 A;  2M8I A;  1FFR A;  1HJW A;  1ROT A;  2YBT A;  4JFI A;  4WK9 A;  5DIV A;  1FKT A;  3LE4 A;  4ODL A;  3CHF A;  1Q6I A;  2O92 A;  3NTP A;  2ZQT A;  1KFW A;  3ALG A;  3L4H A;  5HUA A;  1HKJ A;  4KR0 B;  1FKB A;  3WH0 A;  1FKL A;  1WAW A;  3WL1 A;  4WKF A;  3FSC A;  5GPG A;  3FAP A;  1F40 A;  3KAF A;  2LJ4 A;  1EDQ A;  2WLY A;  2KO7 A;  4DRN A;  2ETN A;  1RP5 A;  3IK8 A;  1FKF A;  1P5Q A;  4QZV B;  1E44 A;  4LAY A;  2O9O A;  2RSE A;  3KAC A;  3O5F A;  4QIB A;  2ZR5 A;  4XAK A;  4DRJ A;  1JMQ A;  3CHC A;  3GTY X;  4LAW A;  2G8Z A;  3AS2 A;  4R5E A;  3ARR A;  4GLX A;  3M7N A;  2KGJ A;  2RQS A;  2DSU A;  1W9V A;  4ODN A;  3WQV A;  1D6O A;  2KE0 A;  2XP7 A;  2DG9 A;  2MLX A;  1OWQ A;  3O5L A;  5GQB A;  3RME A;  1CTN A;  1E6N A;  2M08 A;  3UQI A;  4E5R A;  5HW7 A;  1LL4 A;  4A0U A;  1HJV A;  3MQH A;  4HBO A;  2DWV A;  2EUL A;  1RD6 A;  1UR9 A;  1ZK6 A;  3EIP A;  3AS1 A;  1O6I A;  1E6P A;  1JNE A;  1W1Y A;  1O6W A;  3O5D A;  2PN0 A;  1X6L A;  2ZQU A;  4DRP A;  1NH6 A;  3KAI A;  3JYM A;  2WM0 A;  3CGN A;  4J4N A;  4LAX A;  4BF8 A;  2YSI A;  2KXQ A;  1FJD A;  1VF8 A;  1EYM A;  3ARW A;  1Q6U A;  2MLZ A;  1ZU8 A;  4Z2I A;  3WD0 A;  1OGB A;  3ARO A;  4LAV A;  5DIU A;  2YAJ B;  3B9A A;  1H0I A;  3CHD A;  4W9Q A;  3PRB A;  1BL4 A;  2A3C A;  3B8S A;  2YSF A;  2RUD A;  2DG3 A;  1LL6 A;  3AS0 A;  4U84 A;  5U47 A;  4MTV A;  3VAW A;  1W1V A;  1E15 A;  2PI6 A;  2YSG A;  2AWG A;  4WJX A;  1FKR A;  1ZBW A;  4ODM A;  2FDM A;  1E6Z A;  3GU0 A;  2AOS A;  4GGQ A;  1XRV A;  4IPX A;  4UDM A;  1JNS A;  3O5G A;  1J4R A;  2G41 A;  1LG2 A;  1Q1C A;  1TFV A;  1WR7 A;  2A3E A;  2E45 A;  3PRA A;  4ZPT R;  1GPF A; 
#chains in the Genus database with same CATH homology
 3O5K A;  4WIW A;  3ARV A;  4Q7N A;  1YAT A;  1B6C A;  2F2D A;  2OWO A;  4HAR A;  4W5U A;  1WMV A;  3WD2 A;  2DPE A;  3B7X A;  4ZPV R;  5DF0 A;  1JVW A;  3ALF A;  5HW8 A;  1QPF A;  1K9T A;  3MCB A;  2PV2 A;  1ZBC A;  1A7X A;  3ARY A;  1LG1 A;  1NWT A;  4NNR A;  3IKD A;  3CHE A;  1W9U A;  1ZCN A;  1FLC A;  1E6R A;  3KAG A;  3MDY B;  1EG4 A;  4URI A;  2N87 A;  4DZ3 A;  4P8V A;  4NZC A;  2F21 A;  2ZAJ A;  1LQ0 A;  2K8I A;  4DZ2 A;  2DT3 A;  2LPV A;  2LAJ A;  5JH8 A;  2B31 A;  4DIP A;  3NRK A;  4REX A;  3I6C A;  3B9D A;  1HXV A;  2M3O W;  2XP3 A;  4ZS6 A;  3CZ8 A;  4O2T A;  3ARQ A;  3LKX B;  3KAD A;  4S3J A;  4AY1 A;  2WLZ A;  2XPB A;  4JFJ A;  1NWS A;  1FKG A;  1ZBK A;  4P8U A;  2ESC A;  2DG4 A;  3ARS A;  2OFN A;  2RUC A;  5HT1 A;  1OGG A;  3RM4 A;  1L1P A;  5I98 A;  1Y0O A;  1YW5 A;  3WKZ A;  1J4H A;  5GPR A;  3LKX A;  3M85 A;  1D2K A;  1HKM A;  2KR7 A;  4C02 B;  4G50 A;  2XP8 A;  2XP5 A;  1FKJ A;  4Q22 A;  1HKK A;  2PBC A;  2ITK A;  1TK7 A;  3O5P A;  3OA5 A;  1C9H A;  3CH9 A;  4U86 A;  4ODO A;  5E5W A;  2MF9 A;  1HKI A;  2KFW A;  1FKD A;  4IT4 A;  3G6L A;  4Z2J A;  4FN2 A;  4TW6 A;  4DT4 A;  4GIV A;  2MNT A;  2YSB A;  3O5Q A;  3MQG A;  4MNL A;  2FKE A;  1WNO A;  2PPO A;  1JND A;  3B9E A;  3WQW A;  3RM9 A;  4Z2H A;  1FD9 A;  5CQ2 A;  5BXJ A;  5J6E A;  3KZ7 A;  3O5E A;  5E65 A;  3CNG A;  1TCO C;  2RUR A;  4QT2 A;  4DWS C;  1ROU A;  4TX0 A;  3JXV A;  4DWS A;  3WD3 A;  1SR0 A;  2YBU A;  2XP4 A;  3NI6 A;  3RGC A;  1M5Y A;  2ZQS A;  3AS3 A;  3JYJ A;  1GUV A;  1JNT A;  4ZPW R;  3PR9 A;  5HWB A;  1Q6H A;  2DJY A;  2PPP A;  3PRD A;  1PBK A;  3ARZ A;  2PV1 A;  4DWS B;  4IQC A;  2BA1 A;  3UI6 A;  4W9P A;  4DRO A;  2JX8 A;  3KCE A;  4HBE A;  4N19 A;  2QRV A;  4ODR A;  2Q5A A;  3MCB B;  2QF8 A;  3O5I A;  1X6N A;  1NMW A;  2VCD A;  3BXW A;  4IQ2 A;  3AQU A;  3WD4 A;  1FKS A;  2DSV A;  2IUZ A;  2JV4 A;  5HBF A;  1W1P A;  1ZB5 A;  3H9R B;  5D75 A;  4MSP A;  4DRQ A;  4TW8 A;  4TYO A;  3WD1 A;  2DSW A;  3O5O A;  2KI3 A;  1NWR A;  4ML4 A;  2ZQV A;  1EIB A;  4LGX A;  1R9H A;  2JXW A;  1HJX A;  4Z2G A;  1J6Y A;  3KAB A;  5DIT A;  1K9R A;  1QPL A;  4Z2K A;  3TDB A;  2Y8N B;  5E62 A;  3OOB A;  1QZ2 A;  4JFK A;  1UR8 A;  3GPK A;  5DO2 A;  4TNS A;  3UI4 A;  5HKG A;  3PA7 A;  2RE3 A;  1LL7 A;  4J4O A;  4WKH A;  3O5J A;  1BKF A;  2DT2 A;  2F4E A;  1WB0 A;  3ARX A;  4IT6 A;  1I5H W;  1TR8 A;  4S3K A;  3G6M A;  4PTM A;  2UZ5 A;  1SYT A;  2OLH A;  4JFM A;  1H0G A;  2PV3 A;  4MNJ A;  4FAP A;  4QT3 A;  3TCZ A;  5B8I C;  2YSH A;  3ODK A;  4ODP A;  1D7I A;  5AHT A;  4DRK A;  4W9O A;  2WAE A;  1EHN A;  4L72 B;  3W4R A;  3UI5 A;  2WK2 A;  5E66 A;  1FKK A;  3UQB A;  3FSB A;  1FAP A;  1FFQ A;  3UF8 A;  3ARP A;  3WL0 A;  1U79 A;  2ZR6 A;  3UQA A;  1ZL1 A;  4A0T A;  1W26 A;  2XP9 A;  3IHZ A;  1E9L A;  4ITZ A;  3ARU A;  3TC5 A;  2VN1 A;  1NWU A;  1J4I A;  4JYS A;  3LUO A;  1KT0 A;  3EY6 A;  4DRH A;  4NSB A;  1XHG A;  3FS8 A;  2PPN A;  3FXY A;  4DWS D;  4R0X A;  4TW7 A;  1FKI A;  4DRM A;  5DEZ A;  4DRI A;  4ODQ A;  2M8J A;  2DT0 A;  3FY1 A;  1NSG A;  4WKA A;  2XPA A;  4Z2L A;  3O5R A;  2LGO A;  4MNM A;  4DH0 A;  4MPK A;  4L3N A;  1EQ3 A;  2D9F A;  2L4J A;  4MGV A;  2WAD A;  4MNK A;  5HWC A;  2M2A A;  1N1A A;  2MDI A;  2Y78 A;  1T11 A;  1ZBV A;  2MPH A;  1PIN A;  3RM8 A;  2LKN A;  3WIJ A;  2L2S A;  3KAH A;  1EG3 A;  1W9P A;  2JZV A;  4G2P A;  2DT1 A;  1W1T A;  4JFL A;  4P8W A;  3ART A;  1FKH A;  2DK7 A;  2DK1 A;  4ODK A;  2EZ5 W;  1D7J A;  2DMV A;  3QOK A;  2XP6 A;  3PQH A;  4MAV A;  2DSZ A;  2FAP A;  5HW6 A;  1GOI A;  2A3A A;  1F8A B;  2RUQ A;  3O5M A;  4P8X A;  1D7H A;  1LJY A;  4KQZ A;  2MLY A;  1KT1 A;  2IF4 A;  3CGM A;  4U85 A;  1K9Q A;  2JMF A;  1NMV A;  5E64 A;  2A3B A;  3RFW A;  5HTG A;  3IKG A;  1ITX A;  1IX5 A;  2M1I A;  2ZR4 A;  2M8I A;  1FFR A;  1HJW A;  1ROT A;  2YBT A;  4JFI A;  4WK9 A;  5DIV A;  1FKT A;  3LE4 A;  4ODL A;  3CHF A;  1Q6I A;  2O92 A;  3NTP A;  2ZQT A;  1KFW A;  3ALG A;  3L4H A;  5HUA A;  1HKJ A;  4KR0 B;  1FKB A;  3WH0 A;  1FKL A;  1WAW A;  3WL1 A;  4WKF A;  3FSC A;  5GPG A;  3FAP A;  1F40 A;  3KAF A;  2LJ4 A;  1EDQ A;  2WLY A;  2KO7 A;  4DRN A;  1RP5 A;  3IK8 A;  1FKF A;  1P5Q A;  4QZV B;  4LAY A;  2O9O A;  2RSE A;  3KAC A;  3O5F A;  4QIB A;  2ZR5 A;  4XAK A;  4DRJ A;  1JMQ A;  3CHC A;  4LAW A;  2G8Z A;  3AS2 A;  4R5E A;  3ARR A;  4GLX A;  3M7N A;  2KGJ A;  2RQS A;  2DSU A;  1W9V A;  4ODN A;  3WQV A;  1D6O A;  2KE0 A;  2XP7 A;  2DG9 A;  2MLX A;  1OWQ A;  3O5L A;  5GQB A;  3RME A;  1CTN A;  1E6N A;  2M08 A;  3UQI A;  4E5R A;  5HW7 A;  1LL4 A;  4A0U A;  1HJV A;  3MQH A;  4HBO A;  2DWV A;  1RD6 A;  1UR9 A;  1ZK6 A;  3AS1 A;  1O6I A;  1E6P A;  1JNE A;  1W1Y A;  1O6W A;  3O5D A;  1X6L A;  2ZQU A;  4DRP A;  1NH6 A;  3KAI A;  3JYM A;  2WM0 A;  3CGN A;  4J4N A;  4LAX A;  4BF8 A;  2YSI A;  2KXQ A;  1FJD A;  1VF8 A;  1EYM A;  3ARW A;  1Q6U A;  2MLZ A;  1ZU8 A;  4Z2I A;  3WD0 A;  1OGB A;  3ARO A;  4LAV A;  5DIU A;  2YAJ B;  3B9A A;  1H0I A;  3CHD A;  4W9Q A;  3PRB A;  1BL4 A;  2A3C A;  3B8S A;  2YSF A;  2RUD A;  2DG3 A;  1LL6 A;  3AS0 A;  4U84 A;  5U47 A;  4MTV A;  3VAW A;  1W1V A;  1E15 A;  2PI6 A;  2YSG A;  2AWG A;  4WJX A;  1FKR A;  1ZBW A;  4ODM A;  2FDM A;  1E6Z A;  2AOS A;  4GGQ A;  1XRV A;  4IPX A;  1JNS A;  3O5G A;  1J4R A;  2G41 A;  1LG2 A;  1Q1C A;  1TFV A;  1WR7 A;  2A3E A;  2E45 A;  3PRA A;  4ZPT R;  1GPF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...