3WH0A

Structure of pin1 complex with 18-crown-6
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
157
structure length
145
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crowning Proteins: Modulating the Protein Surface Properties using Crown Ethers.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 46
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3wh0A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3wh0A02
1ZCNA 2BA1A 1Q1CA 4DRHA 2XP3A 2KO7A 1T11A 4TW8A 1BL4A 3TCZA 1JMQA 4E5RA 1Q6UA 3ODKA 3O5DA 4GIVA 4QT2A 4JYSA 5HTGA 2PV2A 1QPLA 3IK8A 1FKSA 1WR7A 1WMVA 3KADA 3UI4A 4FAPA 2FAPA 2K8IA 4W9QA 4G2PA 2M3OW 3NTPA 1O6WA 3MDYB 4DIPA 1D7IA 4TNSA 4ODLA 3CNGA 4ODNA 4JFMA 3UQIA 2PBCA 1ROUA 1FKTA 1K9RA 4DZ3A 2IF4A 3O5GA 2MLXA 1F8AB 4ODRA 4DROA 2YSHA 4LAYA 5J6EA 4DRMA 4DRNA 2XP9A 1N1AA 2DWVA 1FKBA 3KZ7A 4IQCA 4NNRA 4JFJA 1QPFA 2JXWA 4IPXA 2LJ4A 2M8JA 3KABA 3O5QA 4J4NA 2Y78A 2KI3A 4MGVA 3KAFA 1PBKA 4U85A 2AWGA 2L2SA 1I5HW 1J4RA 4O2TA 1NMVA 2RE3A 3EY6A 2DG9A 1FKJA 3GPKA 3RFWA 3CGNA 2KFWA 2XP4A 2ZR5A 4U86A 1YATA 2XPBA 1R9HA 1TCOC 3O5KA 5GPGA 1A7XA 5HUAA 2F2DA 4JFKA 3UF8A 4J4OA 2LAJA 2JZVA 1ROTA 1TK7A 2YSGA 1JVWA 2E45A 2M2AA 2XP7A 2VCDA 1FKIA 4TX0A 3UI5A 4DZ2A 1F40A 2RUDA 3PA7A 1C9HA 5AHTA 5HT1A 3O5PA 2LKNA 3O5EA 2PV1A 4MSPA 3M7NA 2M1IA 2N87A 3B7XA 2MDIA 2F4EA 4FN2A 4DRJA 4G50A 3TC5A 3KAIA 2ITKA 2DK1A 1YW5A 2F21A 3KCEA 3OOBA 1D7HA 2MF9A 2MLZA 2PPPA 2ZQTA 3H9RB 3O5MA 2ZQUA 5DITA 3LE4A 1FAPA 2ZQVA 2RQSA 4TYOA 1FKLA 1KT1A 4JFLA 1J4IA 1FJDA 2ZQSA 2L4JA 4DRIA 3JYJA 5HW7A 1B6CA 1FKHA 1EQ3A 2VN1A 2UZ5A 2XP6A 2KXQA 4R0XA 1K9QA 1QZ2A 4ITZA 2RSEA 2MNTA 1FKRA 2KGJA 2JX8A 1JNSA 3KAGA 1NMWA 3LUOA 3I6CA 5D75A 5HW8A 5CQ2A 1M5YA 2DJYA 4GGQA 1W26A 4W9OA 4LAWA 2KE0A 3WH0A 3NI6A 3O5OA 3JXVA 3RGCA 3VAWA 1NSGA 2FKEA 1HXVA 2M08A 3KAHA 2PV3A 2M8IA 5DIVA 5BXJA 2OFNA 4ODOA 3O5JA 2JMFA 2YSBA 4TW6A 2PPOA 1L1PA 1EG4A 4ODMA 5B8IC 1JNTA 3CGMA 4LAXA 1Q6HA 1ZK6A 3L4HA 2RUQA 4TW7A 1D7JA 1FD9A 5DIUA 2DK7A 1J4HA 4ODKA 5I98A 2ZR6A 4W9PA 4DH0A 4QT3A 5HWBA 2EZ5W 3IHZA 3O5LA 2YSFA 1D6OA 3UQBA 3O5FA 5HWCA 4DRPA 5HW6A 2XPAA 4IQ2A 2DG4A 3O5IA 1FKDA 1U79A 1Y0OA 1PINA 2MPHA 2LGOA 4BF8A 4JFIA 3NRKA 2D9FA 2LPVA 2MLYA 3PRBA 1P5QA 1FKGA 1KT0A 2XP5A 2JV4A 4QIBA 2YSIA 3TDBA 2RUCA 4N19A 4U84A 1EG3A 1FKKA 4DT4A 2RURA 1EYMA 4ODQA 1BKFA 1J6YA 2DMVA 1FKFA 1Q6IA 2PPNA 3JYMA 2ZAJA 3PRDA 3FAPA 2XP8A 2ZR4A 3KACA 3UQAA 3IKDA 3O5RA 5HKGA 4LAVA 3UI6A 2DG3A 2KR7A 4DRKA 3IKGA 4C02B 4ODPA 4REXA 2Q5AA 3M85A 4DRQA
chains in the Genus database with same CATH superfamily
1Q1CA 2G8ZA 2XP3A 4TW8A 4S3KA 4Z2JA 3ODKA 4GIVA 4QT2A 3W4RA 4JYSA 4ML4A 1XRVA 3GU0A 1E44A 3RM9A 3UI4A 1GRJA 3AQUA 2K8IA 4ODLA 1K9RA 2IF4A 2MLXA 1F8AB 4DROA 4LAYA 3KZ7A 4JFJA 1QPFA 2F23A 4Z2HA 1PBKA 4UDMA 1SR0A 1FKJA 3AS3A 2XP4A 5HUAA 1A7XA 1NWTA 4J4OA 3UI5A 1FFQA 2VCDA 3PR9A 1F40A 2RUDA 3WD0A 1ZL1A 3PA7A 4S3JA 3M7NA 2M1IA 2N87A 3B7XA 4W5UA 5DO2A 3LKXA 1LG1A 3FXYA 2ETNA 3TC5A 2DK1A 1YW5A 2F21A 3OOBA 5E64A 1D7HA 3G6LA 3H9RB 4KQZA 4DRNA 2ZQUA 4TYOA 1FAPA 4MPKA 1FKLA 4MAVA 2ZQSA 2DT2A 3CZ8A 2A3AA 4DWSD 1JCHB 3WKZA 2VN1A 2UZ5A 1EQ3A 2WLZA 2KXQA 2MNTA 2KGJA 5E65A 2QRVA 5HW8A 1GUVA 3WH0A 1NSGA 2FKEA 2M08A 3B9AA 2YSBA 1EG4A 3EIPA 1WB0A 1JNTA 3CGMA 2WLYA 3RM4A 1D7JA 5DIUA 3CHFA 3ARPA 1J4HA 1LG2A 3MQGA 1LL7A 5HWCA 2XPAA 1FKDA 2MPHA 2LGOA 4BF8A 2MLYA 1ZB5A 2JV4A 1XHGA 2RURA 1J6YA 3LKXB 2AOSA 2PPNA 3ARTA 4Z2LA 3RM8A 1TR8A 3UQAA 3O5RA 1O6IA 4A0UA 3B9DA 4C02B 4ODPA 1ZCNA 2BA1A 1T11A 3O5DA 2PN0A 1EHNA 1QPLA 4NZCA 1ZBVA 3WD3A 4FAPA 4W9QA 3NTPA 3MDYB 4DIPA 4Z2GA 4ODNA 4WIWA 3UQIA 1FKTA 3O5GA 4QZVB 2DSVA 1W1TA 3WL0A 4IT6A 4PTMA 2XP9A 2WK2A 1H0IA 2WAEA 2JXWA 2WM0A 2LJ4A 2M8JA 1NWRA 4U85A 3FSBA 1W9UA 1E15A 2RE3A 3RFWA 3EY6A 3GPKA 2O9OA 5JH8A 1NH6A 2KFWA 4WKHA 2ZR5A 4U86A 3O5KA 3CHCA 2LAJA 4P8VA 3WIJA 1TK7A 1JVWA 1W9VA 2E45A 4DWSC 4DZ2A 4TX0A 2P4VA 1OGGA 5DF0A 2A3BA 2LKNA 3O5EA 4MSPA 4FN2A 4ZPWR 3ARSA 3KCEA 5I98A 3LE4A 4JFLA 3QOKA 2B5UB 3AS1A 4Z2IA 1HJXA 5HBFA 2WADA 1CTNA 1K9QA 2RSEA 2OWOA 4P8XA 1ZBCA 1M5YA 4GGQA 4GLXA 3NI6A 1HXVA 3KAHA 5BXJA 2M8IA 4LGXA 1JNEA 2PI6A 4ODOA 2JMFA 5E66A 3WD4A 1L1PA 4AY1A 1LL6A 3B9EA 4LAXA 1H0GA 2RUQA 1FD9A 1WNOA 4ODKA 4WKFA 2ZR6A 4QT3A 4WJXA 2EZ5W 2YSFA 4DRPA 1E6NA 2Y8NB 1U79A 1PINA 1TFVA 3OA5A 4JFIA 2LPVA 3PRBA 3WQVA 1ZU8A 1NWSA 1KT0A 4N19A 4QIBA 3TDBA 2RUCA 1FKKA 1SYTA 3JYMA 4Q7NA 2ZR4A 4L3NA 4REXA 4DRHA 3M85A 1IX5A 1BL4A 4E5RA 3ARXA 5HTGA 1W1PA 2PV2A 1FKSA 1WR7A 1WMVA 2A3CA 2FAPA 4G2PA 2M3OW 2YAJB 1D7IA 4TNSA 4DZ3A 3WL1A 4JFMA 5U47A 1ROUA 2OLHA 2O92A 1GOIA 4ODRA 5J6EA 2YSHA 3AROA 2DSZA 4DRMA 4MTVA 1N1AA 1FKBA 4NNRA 1OWQA 4IPXA 3KABA 3O5QA 2Y78A 2YBTA 2AWGA 3UF8A 1J4RA 2DG9A 5GPRA 3CGNA 1YATA 1R9HA 1TCOC 2ESCA 4P8UA 2F2DA 3ALGA 3ARQA 4JFKA 1ROTA 2YBUA 2YSGA 2G41A 4MNMA 2XP7A 4DWSB 2PV1A 4DRJA 3PRAA 4G50A 4ZS6A 2DT3A 3WQWA 1W1VA 3KAIA 2ITKA 2MF9A 1HKMA 3ARYA 1W1YA 2MLZA 2PPPA 3O5MA 4HBOA 2RQSA 3ARZA 4Z2KA 1KT1A 1J4IA 2DT1A 3WD1A 1ITXA 5HW7A 1B6CA 1FKHA 3GTYX 2XP6A 4P8WA 4R0XA 3MCBA 1QZ2A 2DSWA 2EULA 1FKRA 2JX8A 1JNDA 1JNSA 3LUOA 1NWUA 3I6CA 5D75A 3PQHA 4LAWA 2KE0A 3JXVA 3CHEA 1UR9A 2DT0A 2DSUA 2IUZA 2OFNA 3FS8A 1E9LA 3O5JA 3CHDA 1ZK6A 1LJYA 3AS0A 3ARWA 4W9PA 1RP5A 3UQBA 3O5LA 4MNKA 1ZBKA 5HW6A 5E5WA 4IQ2A 2DG4A 1Y0OA 1LL4A 1RD6A 3NRKA 2D9FA 1FKGA 2XP5A 4U84A 2DMVA 1FKFA 5B8IC 3G6MA 3FAPA 4R5EA 3KACA 1HKJA 1HKKA 1HJWA 4NSBA 5HKGA 2DG3A 4DRKA 3IKGA 3VAWA 2Q5AA 4DWSA 5E62A 2KO7A 1GPFA 3TCZA 1JMQA 1Q6UA 3WD2A 5GQBA 2QF8A 1K9TA 3ARUA 1UR8A 1X6LA 4MNLA 3KADA 4WKAA 3ARVA 1VF8A 4KR0B 4Q22A 1O6WA 4ZPVR 3CNGA 3FSCA 2PBCA 3MCBB 1E6ZA 1X6NA 1HJVA 2B31A 4XAKA 2DWVA 1OGBA 4IQCA 4MGVA 4J4NA 2KI3A 3KAFA 2L2SA 3RMEA 1I5HW 3ARRA 4O2TA 1NMVA 3MQHA 2A3EA 3ALFA 2XPBA 5GPGA 2JZVA 2M2AA 3IK8A 2DPEA 3BXWA 1FKIA 1C9HA 5AHTA 4HBEA 5HT1A 3O5PA 1ZBWA 2MDIA 2F4EA 4URIA 1HKIA 5DITA 2ZQTA 1FJDA 2ZQVA 1LQ0A 4L72B 2L4JA 4DRIA 3BMBA 3JYJA 4A0TA 4ITZA 4ZPTR 3KAGA 1NMWA 4WK9A 5CQ2A 2DJYA 1W26A 4W9OA 1KFWA 3O5OA 3RGCA 4HARA 2PV3A 5DIVA 4TW6A 2PPOA 4ODMA 3CH9A 1Q6HA 3L4HA 4TW7A 1EDQA 2DK7A 1E6PA 5HWBA 4DH0A 3IHZA 1D6OA 3O5FA 1E6RA 4MNJA 3O5IA 3B8SA 1P5QA 3FY1A 1WAWA 1D2KA 2FDMA 3AS2A 1FFRA 2YSIA 1EG3A 1FLCA 4DT4A 1EYMA 4ODQA 1BKFA 1W9PA 1EIBA 1Q6IA 3PRDA 2ZAJA 2XP8A 4IT4A 5DEZA 3IKDA 4LAVA 3UI6A 2KR7A 4DRQA
chains in the Genus database with same CATH topology
1Q1CA 2G8ZA 2XP3A 4TW8A 4S3KA 4Z2JA 3ODKA 4GIVA 4QT2A 3W4RA 4JYSA 4ML4A 1XRVA 3RM9A 3UI4A 3AQUA 2K8IA 4ODLA 1K9RA 2IF4A 2MLXA 1F8AB 4DROA 4LAYA 3KZ7A 4JFJA 1QPFA 4Z2HA 1PBKA 1SR0A 1FKJA 3AS3A 2XP4A 5HUAA 1A7XA 1NWTA 4J4OA 3UI5A 1FFQA 2VCDA 3PR9A 1F40A 2RUDA 3WD0A 1ZL1A 3PA7A 4S3JA 3M7NA 2M1IA 2N87A 3B7XA 4W5UA 5DO2A 3LKXA 1LG1A 3FXYA 3TC5A 2DK1A 1YW5A 2F21A 3OOBA 5E64A 1D7HA 3G6LA 3H9RB 4KQZA 4DRNA 2ZQUA 4TYOA 1FAPA 4MPKA 1FKLA 4MAVA 2ZQSA 2DT2A 3CZ8A 2A3AA 4DWSD 3WKZA 1EQ3A 2VN1A 2UZ5A 2WLZA 2KXQA 2MNTA 2KGJA 5E65A 2QRVA 5HW8A 1GUVA 3WH0A 1NSGA 2FKEA 2M08A 3B9AA 2YSBA 1EG4A 1WB0A 1JNTA 3CGMA 2WLYA 3RM4A 1D7JA 5DIUA 3CHFA 3ARPA 1J4HA 1LG2A 3MQGA 1LL7A 5HWCA 2XPAA 1FKDA 2MPHA 2LGOA 4BF8A 2MLYA 1ZB5A 2JV4A 1XHGA 2RURA 1J6YA 3LKXB 2AOSA 2PPNA 3ARTA 4Z2LA 3RM8A 1TR8A 3UQAA 3O5RA 1O6IA 4A0UA 3B9DA 4C02B 4ODPA 1ZCNA 2BA1A 1T11A 3O5DA 1EHNA 1QPLA 4NZCA 1ZBVA 3WD3A 4FAPA 4W9QA 3NTPA 3MDYB 4DIPA 4Z2GA 4ODNA 4WIWA 3UQIA 1FKTA 3O5GA 4QZVB 2DSVA 1W1TA 3WL0A 4IT6A 4PTMA 2XP9A 2WK2A 1H0IA 2WAEA 2JXWA 2WM0A 2LJ4A 2M8JA 1NWRA 4U85A 3FSBA 1W9UA 1E15A 2RE3A 3RFWA 3EY6A 3GPKA 2O9OA 5JH8A 1NH6A 2KFWA 4WKHA 2ZR5A 4U86A 3O5KA 3CHCA 2LAJA 4P8VA 3WIJA 1TK7A 1JVWA 1W9VA 2E45A 4DWSC 4DZ2A 4TX0A 1OGGA 5DF0A 2A3BA 2LKNA 3O5EA 4MSPA 4FN2A 4ZPWR 3ARSA 3KCEA 5I98A 3LE4A 4JFLA 3QOKA 4Z2IA 3AS1A 1HJXA 5HBFA 2WADA 1CTNA 1K9QA 2RSEA 2OWOA 4P8XA 1ZBCA 1M5YA 4GGQA 4GLXA 3NI6A 1HXVA 3KAHA 5BXJA 2M8IA 4LGXA 1JNEA 2PI6A 4ODOA 2JMFA 5E66A 3WD4A 1L1PA 4AY1A 1LL6A 3B9EA 4LAXA 1H0GA 2RUQA 1FD9A 1WNOA 4ODKA 4WKFA 2ZR6A 4QT3A 4WJXA 2EZ5W 2YSFA 4DRPA 1E6NA 2Y8NB 1U79A 1PINA 1TFVA 3OA5A 4JFIA 2LPVA 3PRBA 3WQVA 1ZU8A 1NWSA 1KT0A 4N19A 4QIBA 3TDBA 2RUCA 1FKKA 1SYTA 3JYMA 4Q7NA 2ZR4A 4L3NA 4REXA 4DRHA 3M85A 1IX5A 1BL4A 4E5RA 3ARXA 5HTGA 1W1PA 2PV2A 1FKSA 1WR7A 1WMVA 2A3CA 2FAPA 4G2PA 2M3OW 2YAJB 1D7IA 4TNSA 4DZ3A 3WL1A 4JFMA 5U47A 1ROUA 2OLHA 2O92A 1GOIA 4ODRA 5J6EA 2YSHA 3AROA 2DSZA 4DRMA 4MTVA 1N1AA 1FKBA 4NNRA 1OWQA 4IPXA 3KABA 3O5QA 2Y78A 2YBTA 2AWGA 3UF8A 1J4RA 2DG9A 5GPRA 3CGNA 1YATA 1R9HA 1TCOC 2ESCA 4P8UA 2F2DA 3ALGA 3ARQA 4JFKA 1ROTA 2YBUA 2YSGA 2G41A 4MNMA 2XP7A 4DWSB 2PV1A 4DRJA 3PRAA 4G50A 4ZS6A 2DT3A 3WQWA 1W1VA 3KAIA 2ITKA 2MF9A 1HKMA 3ARYA 1W1YA 2MLZA 2PPPA 3O5MA 4HBOA 2RQSA 3ARZA 4Z2KA 1KT1A 1J4IA 2DT1A 3WD1A 1ITXA 5HW7A 1B6CA 1FKHA 2XP6A 4P8WA 4R0XA 3MCBA 1QZ2A 2DSWA 1FKRA 2JX8A 1JNDA 1JNSA 3LUOA 1NWUA 3I6CA 5D75A 3PQHA 4LAWA 2KE0A 3JXVA 3CHEA 1UR9A 2DT0A 2DSUA 2IUZA 2OFNA 3FS8A 1E9LA 3O5JA 3CHDA 1ZK6A 1LJYA 3AS0A 3ARWA 4W9PA 1RP5A 3UQBA 3O5LA 4MNKA 1ZBKA 5HW6A 5E5WA 4IQ2A 2DG4A 1Y0OA 1LL4A 1RD6A 3NRKA 2D9FA 1FKGA 2XP5A 4U84A 2DMVA 1FKFA 5B8IC 3G6MA 3FAPA 4R5EA 3KACA 1HKJA 1HKKA 1HJWA 4NSBA 5HKGA 2DG3A 4DRKA 3IKGA 3VAWA 2Q5AA 4DWSA 5E62A 2KO7A 1GPFA 3TCZA 1JMQA 1Q6UA 3WD2A 5GQBA 2QF8A 1K9TA 3ARUA 1UR8A 1X6LA 4MNLA 3KADA 4WKAA 3ARVA 1VF8A 4KR0B 4Q22A 1O6WA 4ZPVR 3CNGA 3FSCA 2PBCA 3MCBB 1E6ZA 1X6NA 1HJVA 2B31A 4XAKA 2DWVA 1OGBA 4IQCA 4MGVA 4J4NA 2KI3A 3KAFA 2L2SA 3RMEA 1I5HW 3ARRA 4O2TA 1NMVA 3MQHA 2A3EA 3ALFA 2XPBA 5GPGA 2JZVA 2M2AA 3IK8A 2DPEA 3BXWA 1FKIA 1C9HA 5AHTA 4HBEA 5HT1A 3O5PA 1ZBWA 2MDIA 2F4EA 4URIA 1HKIA 5DITA 2ZQTA 1FJDA 2ZQVA 1LQ0A 4L72B 2L4JA 4DRIA 3JYJA 4A0TA 4ITZA 4ZPTR 3KAGA 1NMWA 4WK9A 5CQ2A 2DJYA 1W26A 4W9OA 1KFWA 3O5OA 3RGCA 4HARA 2PV3A 5DIVA 4TW6A 2PPOA 4ODMA 3CH9A 1Q6HA 3L4HA 4TW7A 1EDQA 2DK7A 1E6PA 5HWBA 4DH0A 3IHZA 1D6OA 3O5FA 1E6RA 4MNJA 3O5IA 3B8SA 1P5QA 3FY1A 1WAWA 1D2KA 2FDMA 3AS2A 1FFRA 2YSIA 1EG3A 1FLCA 4DT4A 1EYMA 4ODQA 1BKFA 1W9PA 1EIBA 1Q6IA 3PRDA 2ZAJA 2XP8A 4IT4A 5DEZA 3IKDA 4LAVA 3UI6A 2KR7A 4DRQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZCN A;  2BA1 A;  1Q1C A;  4DRH A;  2XP3 A;  2KO7 A;  1T11 A;  4TW8 A;  1BL4 A;  3TCZ A;  1JMQ A;  4E5R A;  1Q6U A;  3ODK A;  3O5D A;  4GIV A;  4QT2 A;  4JYS A;  5HTG A;  2PV2 A;  1QPL A;  3IK8 A;  1FKS A;  1WR7 A;  1WMV A;  3KAD A;  3UI4 A;  4FAP A;  2FAP A;  2K8I A;  4W9Q A;  4G2P A;  2M3O W;  3NTP A;  1O6W A;  3MDY B;  4DIP A;  1D7I A;  4TNS A;  4ODL A;  3CNG A;  4ODN A;  4JFM A;  3UQI A;  2PBC A;  1ROU A;  1FKT A;  1K9R A;  4DZ3 A;  2IF4 A;  3O5G A;  2MLX A;  1F8A B;  4ODR A;  4DRO A;  2YSH A;  4LAY A;  5J6E A;  4DRM A;  4DRN A;  2XP9 A;  1N1A A;  2DWV A;  1FKB A;  3KZ7 A;  4IQC A;  4NNR A;  4JFJ A;  1QPF A;  2JXW A;  4IPX A;  2LJ4 A;  2M8J A;  3KAB A;  3O5Q A;  4J4N A;  2Y78 A;  2KI3 A;  4MGV A;  3KAF A;  1PBK A;  4U85 A;  2AWG A;  2L2S A;  1I5H W;  1J4R A;  4O2T A;  1NMV A;  2RE3 A;  3EY6 A;  2DG9 A;  1FKJ A;  3GPK A;  3RFW A;  3CGN A;  2KFW A;  2XP4 A;  2ZR5 A;  4U86 A;  1YAT A;  2XPB A;  1R9H A;  1TCO C;  3O5K A;  5GPG A;  1A7X A;  5HUA A;  2F2D A;  4JFK A;  3UF8 A;  4J4O A;  2LAJ A;  2JZV A;  1ROT A;  1TK7 A;  2YSG A;  1JVW A;  2E45 A;  2M2A A;  2XP7 A;  2VCD A;  1FKI A;  4TX0 A;  3UI5 A;  4DZ2 A;  1F40 A;  2RUD A;  3PA7 A;  1C9H A;  5AHT A;  5HT1 A;  3O5P A;  2LKN A;  3O5E A;  2PV1 A;  4MSP A;  3M7N A;  2M1I A;  2N87 A;  3B7X A;  2MDI A;  2F4E A;  4FN2 A;  4DRJ A;  4G50 A;  3TC5 A;  3KAI A;  2ITK A;  2DK1 A;  1YW5 A;  2F21 A;  3KCE A;  3OOB A;  1D7H A;  2MF9 A;  2MLZ A;  2PPP A;  2ZQT A;  3H9R B;  3O5M A;  2ZQU A;  5DIT A;  3LE4 A;  1FAP A;  2ZQV A;  2RQS A;  4TYO A;  1FKL A;  1KT1 A;  4JFL A;  1J4I A;  1FJD A;  2ZQS A;  2L4J A;  4DRI A;  3JYJ A;  5HW7 A;  1B6C A;  1FKH A;  1EQ3 A;  2VN1 A;  2UZ5 A;  2XP6 A;  2KXQ A;  4R0X A;  1K9Q A;  1QZ2 A;  4ITZ A;  2RSE A;  2MNT A;  1FKR A;  2KGJ A;  2JX8 A;  1JNS A;  3KAG A;  1NMW A;  3LUO A;  3I6C A;  5D75 A;  5HW8 A;  5CQ2 A;  1M5Y A;  2DJY A;  4GGQ A;  1W26 A;  4W9O A;  4LAW A;  2KE0 A;  3WH0 A;  3NI6 A;  3O5O A;  3JXV A;  3RGC A;  3VAW A;  1NSG A;  2FKE A;  1HXV A;  2M08 A;  3KAH A;  2PV3 A;  2M8I A;  5DIV A;  5BXJ A;  2OFN A;  4ODO A;  3O5J A;  2JMF A;  2YSB A;  4TW6 A;  2PPO A;  1L1P A;  1EG4 A;  4ODM A;  5B8I C;  1JNT A;  3CGM A;  4LAX A;  1Q6H A;  1ZK6 A;  3L4H A;  2RUQ A;  4TW7 A;  1D7J A;  1FD9 A;  5DIU A;  2DK7 A;  1J4H A;  4ODK A;  5I98 A;  2ZR6 A;  4W9P A;  4DH0 A;  4QT3 A;  5HWB A;  2EZ5 W;  3IHZ A;  3O5L A;  2YSF A;  1D6O A;  3UQB A;  3O5F A;  5HWC A;  4DRP A;  5HW6 A;  2XPA A;  4IQ2 A;  2DG4 A;  3O5I A;  1FKD A;  1U79 A;  1Y0O A;  1PIN A;  2MPH A;  2LGO A;  4BF8 A;  4JFI A;  3NRK A;  2D9F A;  2LPV A;  2MLY A;  3PRB A;  1P5Q A;  1FKG A;  1KT0 A;  2XP5 A;  2JV4 A;  4QIB A;  2YSI A;  3TDB A;  2RUC A;  4N19 A;  4U84 A;  1EG3 A;  1FKK A;  4DT4 A;  2RUR A;  1EYM A;  4ODQ A;  1BKF A;  1J6Y A;  2DMV A;  1FKF A;  1Q6I A;  2PPN A;  3JYM A;  2ZAJ A;  3PRD A;  3FAP A;  2XP8 A;  2ZR4 A;  3KAC A;  3UQA A;  3IKD A;  3O5R A;  5HKG A;  4LAV A;  3UI6 A;  2DG3 A;  2KR7 A;  4DRK A;  3IKG A;  4C02 B;  4ODP A;  4REX A;  2Q5A A;  3M85 A;  4DRQ A; 
#chains in the Genus database with same CATH topology
 1Q1C A;  2G8Z A;  2XP3 A;  4TW8 A;  4S3K A;  4Z2J A;  3ODK A;  4GIV A;  4QT2 A;  3W4R A;  4JYS A;  4ML4 A;  1XRV A;  3GU0 A;  1E44 A;  3RM9 A;  3UI4 A;  1GRJ A;  3AQU A;  2K8I A;  4ODL A;  1K9R A;  2IF4 A;  2MLX A;  1F8A B;  4DRO A;  4LAY A;  3KZ7 A;  4JFJ A;  1QPF A;  2F23 A;  4Z2H A;  1PBK A;  4UDM A;  1SR0 A;  1FKJ A;  3AS3 A;  2XP4 A;  5HUA A;  1A7X A;  1NWT A;  4J4O A;  3UI5 A;  1FFQ A;  2VCD A;  3PR9 A;  1F40 A;  2RUD A;  3WD0 A;  1ZL1 A;  3PA7 A;  4S3J A;  3M7N A;  2M1I A;  2N87 A;  3B7X A;  4W5U A;  5DO2 A;  3LKX A;  1LG1 A;  3FXY A;  2ETN A;  3TC5 A;  2DK1 A;  1YW5 A;  2F21 A;  3OOB A;  5E64 A;  1D7H A;  3G6L A;  3H9R B;  4KQZ A;  4DRN A;  2ZQU A;  4TYO A;  1FAP A;  4MPK A;  1FKL A;  4MAV A;  2ZQS A;  2DT2 A;  3CZ8 A;  2A3A A;  4DWS D;  1JCH B;  3WKZ A;  2VN1 A;  2UZ5 A;  1EQ3 A;  2WLZ A;  2KXQ A;  2MNT A;  2KGJ A;  5E65 A;  2QRV A;  5HW8 A;  1GUV A;  3WH0 A;  1NSG A;  2FKE A;  2M08 A;  3B9A A;  2YSB A;  1EG4 A;  3EIP A;  1WB0 A;  1JNT A;  3CGM A;  2WLY A;  3RM4 A;  1D7J A;  5DIU A;  3CHF A;  3ARP A;  1J4H A;  1LG2 A;  3MQG A;  1LL7 A;  5HWC A;  2XPA A;  1FKD A;  2MPH A;  2LGO A;  4BF8 A;  2MLY A;  1ZB5 A;  2JV4 A;  1XHG A;  2RUR A;  1J6Y A;  3LKX B;  2AOS A;  2PPN A;  3ART A;  4Z2L A;  3RM8 A;  1TR8 A;  3UQA A;  3O5R A;  1O6I A;  4A0U A;  3B9D A;  4C02 B;  4ODP A;  1ZCN A;  2BA1 A;  1T11 A;  3O5D A;  2PN0 A;  1EHN A;  1QPL A;  4NZC A;  1ZBV A;  3WD3 A;  4FAP A;  4W9Q A;  3NTP A;  3MDY B;  4DIP A;  4Z2G A;  4ODN A;  4WIW A;  3UQI A;  1FKT A;  3O5G A;  4QZV B;  2DSV A;  1W1T A;  3WL0 A;  4IT6 A;  4PTM A;  2XP9 A;  2WK2 A;  1H0I A;  2WAE A;  2JXW A;  2WM0 A;  2LJ4 A;  2M8J A;  1NWR A;  4U85 A;  3FSB A;  1W9U A;  1E15 A;  2RE3 A;  3RFW A;  3EY6 A;  3GPK A;  2O9O A;  5JH8 A;  1NH6 A;  2KFW A;  4WKH A;  2ZR5 A;  4U86 A;  3O5K A;  3CHC A;  2LAJ A;  4P8V A;  3WIJ A;  1TK7 A;  1JVW A;  1W9V A;  2E45 A;  4DWS C;  4DZ2 A;  4TX0 A;  2P4V A;  1OGG A;  5DF0 A;  2A3B A;  2LKN A;  3O5E A;  4MSP A;  4FN2 A;  4ZPW R;  3ARS A;  3KCE A;  5I98 A;  3LE4 A;  4JFL A;  3QOK A;  2B5U B;  3AS1 A;  4Z2I A;  1HJX A;  5HBF A;  2WAD A;  1CTN A;  1K9Q A;  2RSE A;  2OWO A;  4P8X A;  1ZBC A;  1M5Y A;  4GGQ A;  4GLX A;  3NI6 A;  1HXV A;  3KAH A;  5BXJ A;  2M8I A;  4LGX A;  1JNE A;  2PI6 A;  4ODO A;  2JMF A;  5E66 A;  3WD4 A;  1L1P A;  4AY1 A;  1LL6 A;  3B9E A;  4LAX A;  1H0G A;  2RUQ A;  1FD9 A;  1WNO A;  4ODK A;  4WKF A;  2ZR6 A;  4QT3 A;  4WJX A;  2EZ5 W;  2YSF A;  4DRP A;  1E6N A;  2Y8N B;  1U79 A;  1PIN A;  1TFV A;  3OA5 A;  4JFI A;  2LPV A;  3PRB A;  3WQV A;  1ZU8 A;  1NWS A;  1KT0 A;  4N19 A;  4QIB A;  3TDB A;  2RUC A;  1FKK A;  1SYT A;  3JYM A;  4Q7N A;  2ZR4 A;  4L3N A;  4REX A;  4DRH A;  3M85 A;  1IX5 A;  1BL4 A;  4E5R A;  3ARX A;  5HTG A;  1W1P A;  2PV2 A;  1FKS A;  1WR7 A;  1WMV A;  2A3C A;  2FAP A;  4G2P A;  2M3O W;  2YAJ B;  1D7I A;  4TNS A;  4DZ3 A;  3WL1 A;  4JFM A;  5U47 A;  1ROU A;  2OLH A;  2O92 A;  1GOI A;  4ODR A;  5J6E A;  2YSH A;  3ARO A;  2DSZ A;  4DRM A;  4MTV A;  1N1A A;  1FKB A;  4NNR A;  1OWQ A;  4IPX A;  3KAB A;  3O5Q A;  2Y78 A;  2YBT A;  2AWG A;  3UF8 A;  1J4R A;  2DG9 A;  5GPR A;  3CGN A;  1YAT A;  1R9H A;  1TCO C;  2ESC A;  4P8U A;  2F2D A;  3ALG A;  3ARQ A;  4JFK A;  1ROT A;  2YBU A;  2YSG A;  2G41 A;  4MNM A;  2XP7 A;  4DWS B;  2PV1 A;  4DRJ A;  3PRA A;  4G50 A;  4ZS6 A;  2DT3 A;  3WQW A;  1W1V A;  3KAI A;  2ITK A;  2MF9 A;  1HKM A;  3ARY A;  1W1Y A;  2MLZ A;  2PPP A;  3O5M A;  4HBO A;  2RQS A;  3ARZ A;  4Z2K A;  1KT1 A;  1J4I A;  2DT1 A;  3WD1 A;  1ITX A;  5HW7 A;  1B6C A;  1FKH A;  3GTY X;  2XP6 A;  4P8W A;  4R0X A;  3MCB A;  1QZ2 A;  2DSW A;  2EUL A;  1FKR A;  2JX8 A;  1JND A;  1JNS A;  3LUO A;  1NWU A;  3I6C A;  5D75 A;  3PQH A;  4LAW A;  2KE0 A;  3JXV A;  3CHE A;  1UR9 A;  2DT0 A;  2DSU A;  2IUZ A;  2OFN A;  3FS8 A;  1E9L A;  3O5J A;  3CHD A;  1ZK6 A;  1LJY A;  3AS0 A;  3ARW A;  4W9P A;  1RP5 A;  3UQB A;  3O5L A;  4MNK A;  1ZBK A;  5HW6 A;  5E5W A;  4IQ2 A;  2DG4 A;  1Y0O A;  1LL4 A;  1RD6 A;  3NRK A;  2D9F A;  1FKG A;  2XP5 A;  4U84 A;  2DMV A;  1FKF A;  5B8I C;  3G6M A;  3FAP A;  4R5E A;  3KAC A;  1HKJ A;  1HKK A;  1HJW A;  4NSB A;  5HKG A;  2DG3 A;  4DRK A;  3IKG A;  3VAW A;  2Q5A A;  4DWS A;  5E62 A;  2KO7 A;  1GPF A;  3TCZ A;  1JMQ A;  1Q6U A;  3WD2 A;  5GQB A;  2QF8 A;  1K9T A;  3ARU A;  1UR8 A;  1X6L A;  4MNL A;  3KAD A;  4WKA A;  3ARV A;  1VF8 A;  4KR0 B;  4Q22 A;  1O6W A;  4ZPV R;  3CNG A;  3FSC A;  2PBC A;  3MCB B;  1E6Z A;  1X6N A;  1HJV A;  2B31 A;  4XAK A;  2DWV A;  1OGB A;  4IQC A;  4MGV A;  4J4N A;  2KI3 A;  3KAF A;  2L2S A;  3RME A;  1I5H W;  3ARR A;  4O2T A;  1NMV A;  3MQH A;  2A3E A;  3ALF A;  2XPB A;  5GPG A;  2JZV A;  2M2A A;  3IK8 A;  2DPE A;  3BXW A;  1FKI A;  1C9H A;  5AHT A;  4HBE A;  5HT1 A;  3O5P A;  1ZBW A;  2MDI A;  2F4E A;  4URI A;  1HKI A;  5DIT A;  2ZQT A;  1FJD A;  2ZQV A;  1LQ0 A;  4L72 B;  2L4J A;  4DRI A;  3BMB A;  3JYJ A;  4A0T A;  4ITZ A;  4ZPT R;  3KAG A;  1NMW A;  4WK9 A;  5CQ2 A;  2DJY A;  1W26 A;  4W9O A;  1KFW A;  3O5O A;  3RGC A;  4HAR A;  2PV3 A;  5DIV A;  4TW6 A;  2PPO A;  4ODM A;  3CH9 A;  1Q6H A;  3L4H A;  4TW7 A;  1EDQ A;  2DK7 A;  1E6P A;  5HWB A;  4DH0 A;  3IHZ A;  1D6O A;  3O5F A;  1E6R A;  4MNJ A;  3O5I A;  3B8S A;  1P5Q A;  3FY1 A;  1WAW A;  1D2K A;  2FDM A;  3AS2 A;  1FFR A;  2YSI A;  1EG3 A;  1FLC A;  4DT4 A;  1EYM A;  4ODQ A;  1BKF A;  1W9P A;  1EIB A;  1Q6I A;  3PRD A;  2ZAJ A;  2XP8 A;  4IT4 A;  5DEZ A;  3IKD A;  4LAV A;  3UI6 A;  2KR7 A;  4DRQ A; 
#chains in the Genus database with same CATH homology
 1Q1C A;  2G8Z A;  2XP3 A;  4TW8 A;  4S3K A;  4Z2J A;  3ODK A;  4GIV A;  4QT2 A;  3W4R A;  4JYS A;  4ML4 A;  1XRV A;  3RM9 A;  3UI4 A;  3AQU A;  2K8I A;  4ODL A;  1K9R A;  2IF4 A;  2MLX A;  1F8A B;  4DRO A;  4LAY A;  3KZ7 A;  4JFJ A;  1QPF A;  4Z2H A;  1PBK A;  1SR0 A;  1FKJ A;  3AS3 A;  2XP4 A;  5HUA A;  1A7X A;  1NWT A;  4J4O A;  3UI5 A;  1FFQ A;  2VCD A;  3PR9 A;  1F40 A;  2RUD A;  3WD0 A;  1ZL1 A;  3PA7 A;  4S3J A;  3M7N A;  2M1I A;  2N87 A;  3B7X A;  4W5U A;  5DO2 A;  3LKX A;  1LG1 A;  3FXY A;  3TC5 A;  2DK1 A;  1YW5 A;  2F21 A;  3OOB A;  5E64 A;  1D7H A;  3G6L A;  3H9R B;  4KQZ A;  4DRN A;  2ZQU A;  4TYO A;  1FAP A;  4MPK A;  1FKL A;  4MAV A;  2ZQS A;  2DT2 A;  3CZ8 A;  2A3A A;  4DWS D;  3WKZ A;  1EQ3 A;  2VN1 A;  2UZ5 A;  2WLZ A;  2KXQ A;  2MNT A;  2KGJ A;  5E65 A;  2QRV A;  5HW8 A;  1GUV A;  3WH0 A;  1NSG A;  2FKE A;  2M08 A;  3B9A A;  2YSB A;  1EG4 A;  1WB0 A;  1JNT A;  3CGM A;  2WLY A;  3RM4 A;  1D7J A;  5DIU A;  3CHF A;  3ARP A;  1J4H A;  1LG2 A;  3MQG A;  1LL7 A;  5HWC A;  2XPA A;  1FKD A;  2MPH A;  2LGO A;  4BF8 A;  2MLY A;  1ZB5 A;  2JV4 A;  1XHG A;  2RUR A;  1J6Y A;  3LKX B;  2AOS A;  2PPN A;  3ART A;  4Z2L A;  3RM8 A;  1TR8 A;  3UQA A;  3O5R A;  1O6I A;  4A0U A;  3B9D A;  4C02 B;  4ODP A;  1ZCN A;  2BA1 A;  1T11 A;  3O5D A;  1EHN A;  1QPL A;  4NZC A;  1ZBV A;  3WD3 A;  4FAP A;  4W9Q A;  3NTP A;  3MDY B;  4DIP A;  4Z2G A;  4ODN A;  4WIW A;  3UQI A;  1FKT A;  3O5G A;  4QZV B;  2DSV A;  1W1T A;  3WL0 A;  4IT6 A;  4PTM A;  2XP9 A;  2WK2 A;  1H0I A;  2WAE A;  2JXW A;  2WM0 A;  2LJ4 A;  2M8J A;  1NWR A;  4U85 A;  3FSB A;  1W9U A;  1E15 A;  2RE3 A;  3RFW A;  3EY6 A;  3GPK A;  2O9O A;  5JH8 A;  1NH6 A;  2KFW A;  4WKH A;  2ZR5 A;  4U86 A;  3O5K A;  3CHC A;  2LAJ A;  4P8V A;  3WIJ A;  1TK7 A;  1JVW A;  1W9V A;  2E45 A;  4DWS C;  4DZ2 A;  4TX0 A;  1OGG A;  5DF0 A;  2A3B A;  2LKN A;  3O5E A;  4MSP A;  4FN2 A;  4ZPW R;  3ARS A;  3KCE A;  5I98 A;  3LE4 A;  4JFL A;  3QOK A;  4Z2I A;  3AS1 A;  1HJX A;  5HBF A;  2WAD A;  1CTN A;  1K9Q A;  2RSE A;  2OWO A;  4P8X A;  1ZBC A;  1M5Y A;  4GGQ A;  4GLX A;  3NI6 A;  1HXV A;  3KAH A;  5BXJ A;  2M8I A;  4LGX A;  1JNE A;  2PI6 A;  4ODO A;  2JMF A;  5E66 A;  3WD4 A;  1L1P A;  4AY1 A;  1LL6 A;  3B9E A;  4LAX A;  1H0G A;  2RUQ A;  1FD9 A;  1WNO A;  4ODK A;  4WKF A;  2ZR6 A;  4QT3 A;  4WJX A;  2EZ5 W;  2YSF A;  4DRP A;  1E6N A;  2Y8N B;  1U79 A;  1PIN A;  1TFV A;  3OA5 A;  4JFI A;  2LPV A;  3PRB A;  3WQV A;  1ZU8 A;  1NWS A;  1KT0 A;  4N19 A;  4QIB A;  3TDB A;  2RUC A;  1FKK A;  1SYT A;  3JYM A;  4Q7N A;  2ZR4 A;  4L3N A;  4REX A;  4DRH A;  3M85 A;  1IX5 A;  1BL4 A;  4E5R A;  3ARX A;  5HTG A;  1W1P A;  2PV2 A;  1FKS A;  1WR7 A;  1WMV A;  2A3C A;  2FAP A;  4G2P A;  2M3O W;  2YAJ B;  1D7I A;  4TNS A;  4DZ3 A;  3WL1 A;  4JFM A;  5U47 A;  1ROU A;  2OLH A;  2O92 A;  1GOI A;  4ODR A;  5J6E A;  2YSH A;  3ARO A;  2DSZ A;  4DRM A;  4MTV A;  1N1A A;  1FKB A;  4NNR A;  1OWQ A;  4IPX A;  3KAB A;  3O5Q A;  2Y78 A;  2YBT A;  2AWG A;  3UF8 A;  1J4R A;  2DG9 A;  5GPR A;  3CGN A;  1YAT A;  1R9H A;  1TCO C;  2ESC A;  4P8U A;  2F2D A;  3ALG A;  3ARQ A;  4JFK A;  1ROT A;  2YBU A;  2YSG A;  2G41 A;  4MNM A;  2XP7 A;  4DWS B;  2PV1 A;  4DRJ A;  3PRA A;  4G50 A;  4ZS6 A;  2DT3 A;  3WQW A;  1W1V A;  3KAI A;  2ITK A;  2MF9 A;  1HKM A;  3ARY A;  1W1Y A;  2MLZ A;  2PPP A;  3O5M A;  4HBO A;  2RQS A;  3ARZ A;  4Z2K A;  1KT1 A;  1J4I A;  2DT1 A;  3WD1 A;  1ITX A;  5HW7 A;  1B6C A;  1FKH A;  2XP6 A;  4P8W A;  4R0X A;  3MCB A;  1QZ2 A;  2DSW A;  1FKR A;  2JX8 A;  1JND A;  1JNS A;  3LUO A;  1NWU A;  3I6C A;  5D75 A;  3PQH A;  4LAW A;  2KE0 A;  3JXV A;  3CHE A;  1UR9 A;  2DT0 A;  2DSU A;  2IUZ A;  2OFN A;  3FS8 A;  1E9L A;  3O5J A;  3CHD A;  1ZK6 A;  1LJY A;  3AS0 A;  3ARW A;  4W9P A;  1RP5 A;  3UQB A;  3O5L A;  4MNK A;  1ZBK A;  5HW6 A;  5E5W A;  4IQ2 A;  2DG4 A;  1Y0O A;  1LL4 A;  1RD6 A;  3NRK A;  2D9F A;  1FKG A;  2XP5 A;  4U84 A;  2DMV A;  1FKF A;  5B8I C;  3G6M A;  3FAP A;  4R5E A;  3KAC A;  1HKJ A;  1HKK A;  1HJW A;  4NSB A;  5HKG A;  2DG3 A;  4DRK A;  3IKG A;  3VAW A;  2Q5A A;  4DWS A;  5E62 A;  2KO7 A;  1GPF A;  3TCZ A;  1JMQ A;  1Q6U A;  3WD2 A;  5GQB A;  2QF8 A;  1K9T A;  3ARU A;  1UR8 A;  1X6L A;  4MNL A;  3KAD A;  4WKA A;  3ARV A;  1VF8 A;  4KR0 B;  4Q22 A;  1O6W A;  4ZPV R;  3CNG A;  3FSC A;  2PBC A;  3MCB B;  1E6Z A;  1X6N A;  1HJV A;  2B31 A;  4XAK A;  2DWV A;  1OGB A;  4IQC A;  4MGV A;  4J4N A;  2KI3 A;  3KAF A;  2L2S A;  3RME A;  1I5H W;  3ARR A;  4O2T A;  1NMV A;  3MQH A;  2A3E A;  3ALF A;  2XPB A;  5GPG A;  2JZV A;  2M2A A;  3IK8 A;  2DPE A;  3BXW A;  1FKI A;  1C9H A;  5AHT A;  4HBE A;  5HT1 A;  3O5P A;  1ZBW A;  2MDI A;  2F4E A;  4URI A;  1HKI A;  5DIT A;  2ZQT A;  1FJD A;  2ZQV A;  1LQ0 A;  4L72 B;  2L4J A;  4DRI A;  3JYJ A;  4A0T A;  4ITZ A;  4ZPT R;  3KAG A;  1NMW A;  4WK9 A;  5CQ2 A;  2DJY A;  1W26 A;  4W9O A;  1KFW A;  3O5O A;  3RGC A;  4HAR A;  2PV3 A;  5DIV A;  4TW6 A;  2PPO A;  4ODM A;  3CH9 A;  1Q6H A;  3L4H A;  4TW7 A;  1EDQ A;  2DK7 A;  1E6P A;  5HWB A;  4DH0 A;  3IHZ A;  1D6O A;  3O5F A;  1E6R A;  4MNJ A;  3O5I A;  3B8S A;  1P5Q A;  3FY1 A;  1WAW A;  1D2K A;  2FDM A;  3AS2 A;  1FFR A;  2YSI A;  1EG3 A;  1FLC A;  4DT4 A;  1EYM A;  4ODQ A;  1BKF A;  1W9P A;  1EIB A;  1Q6I A;  3PRD A;  2ZAJ A;  2XP8 A;  4IT4 A;  5DEZ A;  3IKD A;  4LAV A;  3UI6 A;  2KR7 A;  4DRQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...