3WH0A

Structure of pin1 complex with 18-crown-6
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
157
structure length
145
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Crowning Proteins: Modulating the Protein Surface Properties using Crown Ethers.
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3wh0A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3wh0A02
1ZK6A 4C02B 1YATA 1NMWA 4DT4A 3O5JA 4JFLA 3IK8A 2F2DA 2KO7A 2RUQA 1T11A 2KI3A 2LAJA 1JVWA 2XP5A 1K9QA 2MLXA 4DRNA 2AWGA 2XP7A 4J4OA 3O5MA 4ITZA 3PRBA 4U84A 2PV3A 4DRHA 4DIPA 3LUOA 1U79A 2LJ4A 3MDYB 4LAWA 4JFMA 1JNSA 2E45A 2DWVA 1Q1CA 3UQBA 2DK7A 2KE0A 4IQCA 4W9QA 2JZVA 3CNGA 1M5YA 2DMVA 2ZQTA 1EG4A 1PBKA 2ZAJA 3OOBA 3CGMA 5HUAA 4R0XA 3PRDA 3JYJA 4ODMA 4QT2A 2ZR6A 1EYMA 2YSFA 4DRIA 1ROTA 4JFIA 3O5KA 2RUDA 3KAIA 2PPNA 5HT1A 5D75A 1FKIA 4ODRA 1BL4A 3JXVA 4REXA 4DRQA 3RGCA 3PA7A 1YW5A 3H9RB 4ODNA 1ZCNA 3O5LA 2XP4A 2LKNA 2JMFA 3NRKA 5HW8A 5I98A 2K8IA 2RQSA 5HW6A 2Q5AA 1FKJA 1I5HW 4DROA 5AHTA 2FKEA 3B7XA 3UI5A 2DG9A 3IKGA 4DRPA 1W26A 1B6CA 4JYSA 1FKFA 1C9HA 1FKLA 1PINA 4DRKA 4DRJA 1FKKA 5CQ2A 1NMVA 1FKSA 4ODQA 4QIBA 3O5EA 1J4IA 5J6EA 1BKFA 1QZ2A 1Q6HA 2EZ5W 3EY6A 2LPVA 1TK7A 3GPKA 2PPPA 4U85A 4LAYA 1P5QA 1EQ3A 2M2AA 4MSPA 2F21A 3TCZA 2ZQUA 2KR7A 4W9PA 4FN2A 1JMQA 2XP6A 2DG4A 3UQAA 2JXWA 3KADA 5BXJA 2MDIA 1Q6IA 5DITA 4TYOA 2F4EA 3O5QA 2BA1A 3O5FA 2PBCA 2XPBA 1FJDA 2M8IA 3ODKA 2M1IA 4W9OA 1J4HA 3IKDA 3KCEA 3NI6A 5GPGA 1HXVA 1D7JA 1QPLA 4QT3A 1FKHA 4ODLA 2M8JA 2KGJA 3O5RA 1JNTA 3O5DA 2MLZA 2XP8A 1FAPA 3UF8A 2PPOA 2VN1A 3O5GA 3O5PA 4DRMA 5HWBA 1N1AA 1QPFA 3TC5A 2PV2A 3LE4A 4LAVA 2L4JA 1Y0OA 2RE3A 1D7HA 1TCOC 3FAPA 4TX0A 3NTPA 4LAXA 5DIUA 2N87A 2YSGA 4GIVA 2FAPA 1ROUA 2LGOA 4DH0A 3UI4A 3JYMA 4TW6A 3IHZA 2XPAA 1KT1A 2PV1A 1WMVA 2L2SA 4FAPA 2MF9A 2JV4A 4TW8A 1F8AB 2RURA 2RSEA 3M7NA 1KT0A 2MLYA 1J6YA 5HWCA 2M3OW 3KACA 1L1PA 2DJYA 2ZR4A 1A7XA 4IPXA 4O2TA 1EG3A 2UZ5A 2VCDA 4DZ2A 1K9RA 2RUCA 4MGVA 2DG3A 4E5RA 2DK1A 3WH0A 4BF8A 4U86A 4JFKA 3KZ7A 4JFJA 1F40A 4NNRA 5HTGA 5DIVA 4J4NA 2MNTA 3O5IA 4IQ2A 3I6CA 1D6OA 3O5OA 5HW7A 1FD9A 2YSBA 2ITKA 2Y78A 3M85A 1Q6UA 2MPHA 1NSGA 3VAWA 2ZQVA 4TNSA 4DZ3A 1O6WA 4N19A 2ZQSA 2YSHA 2ZR5A 2M08A 1WR7A 4G2PA 2YSIA 1J4RA 3TDBA 2IF4A 4TW7A 1FKGA 2XP3A 3UQIA 2D9FA 2KXQA 3KAGA 2KFWA 1FKTA 1R9HA 4ODPA 3KABA 2OFNA 1FKRA 2JX8A 4GGQA 1D7IA 3UI6A 4G50A 3KAHA 3RFWA 4ODOA 3CGNA 5HKGA 3L4HA 2XP9A 1FKBA 3KAFA 1FKDA 5B8IC 4ODKA
chains in the Genus database with same CATH superfamily
1ZK6A 1WB0A 4C02B 2IUZA 3AS3A 1YATA 1NMWA 4DT4A 3FY1A 3ARXA 3O5JA 4WKFA 4JFLA 3IK8A 4Z2GA 4WJXA 1ZL1A 2F2DA 2KO7A 4WKAA 1ZU8A 2RUQA 1ZBVA 1T11A 2KI3A 2LAJA 1JVWA 2XP5A 1K9QA 2MLXA 4DRNA 2AWGA 2XP7A 4J4OA 1XRVA 3LKXB 1NH6A 5JH8A 3O5MA 4ITZA 5GPRA 1JCHB 5E66A 3WIJA 3PRBA 3PQHA 5DF0A 1NWSA 4U84A 2PV3A 3WD4A 4DRHA 3CHDA 4DIPA 3LUOA 1U79A 2LJ4A 3MDYB 4LAWA 1E6ZA 4JFMA 1OGBA 4WK9A 4Z2JA 1JNSA 2DWVA 2E45A 1Q1CA 3UQBA 3CZ8A 2EULA 3RMEA 1E15A 1E6NA 2DK7A 2KE0A 4IQCA 4W9QA 2JZVA 1TFVA 3CNGA 1M5YA 2DMVA 2ZQTA 1X6NA 1SR0A 1EG4A 4PTMA 1PBKA 1UR8A 4P8VA 2ZAJA 3B8SA 3OOBA 1LL7A 2B5UB 4UDMA 3CGMA 5E64A 5HUAA 2FDMA 1E44A 4IT4A 4R0XA 2WADA 5HBFA 4DWSD 3PRDA 3MQGA 1W1TA 2DT1A 3JYJA 1W9PA 3RM4A 4ODMA 1H0GA 4QT2A 2ZR6A 1EYMA 2YSFA 4DRIA 1ROTA 2DT3A 4JFIA 3WL0A 4IT6A 3WQVA 3B9AA 3O5KA 2RUDA 3KAIA 2PPNA 5HT1A 5D75A 1FKIA 4ODRA 1BL4A 4HARA 2YBTA 1GUVA 3JXVA 3CHEA 4REXA 4DRQA 3RGCA 1JNEA 3PA7A 3B9EA 3OA5A 4DWSC 1YW5A 3H9RB 4ODNA 4P8WA 1ZCNA 1W1VA 1RP5A 4W5UA 3O5LA 2XP4A 2PI6A 4AY1A 2LKNA 2JMFA 1HJXA 1UR9A 3NRKA 5HW8A 2AOSA 1SYTA 5I98A 1W1PA 2Y8NB 2K8IA 2RQSA 5HW6A 4GLXA 2Q5AA 2DT2A 4Q7NA 4XAKA 3WKZA 3GU0A 1FKJA 1I5HW 4NSBA 3G6LA 4DROA 1XHGA 2O9OA 4L72B 5AHTA 2FKEA 3BXWA 3MQHA 3B7XA 3UI5A 2DG9A 3IKGA 4DRPA 2WLYA 3ALGA 1W26A 3ARQA 1B6CA 4JYSA 1FKFA 1C9HA 1EIBA 1FKLA 5E5WA 5U47A 1PINA 3WD0A 1D2KA 4DRKA 2OLHA 4DRJA 1FKKA 5CQ2A 1NMVA 1FKSA 3WQWA 4ODQA 4QIBA 3O5EA 1E9LA 4URIA 1J4IA 5J6EA 1BKFA 1QZ2A 1Q6HA 1H0IA 2EZ5W 1HKMA 2DSZA 2LPVA 3EY6A 1TK7A 3GPKA 2DSWA 4U85A 2PPPA 4LAYA 4ML4A 1OWQA 1P5QA 3RM9A 1EQ3A 3ARPA 2M2AA 4MSPA 2F21A 3TCZA 2ZQUA 2KR7A 4W9PA 4FN2A 1JMQA 2XP6A 2DG4A 2YBUA 3UQAA 2JXWA 3KADA 1NWUA 2F23A 5BXJA 2OWOA 3PR9A 2MDIA 2A3CA 1Q6IA 2WLZA 3ARTA 5DITA 4TYOA 2F4EA 4Z2LA 3O5QA 4Q22A 1HJWA 2BA1A 3O5FA 4P8UA 2XPBA 2PBCA 1TR8A 3WD1A 1FJDA 2M8IA 3ODKA 2M1IA 4W9OA 1J4HA 4WKHA 3IKDA 3GTYX 4Z2HA 5E65A 3KCEA 3NI6A 5GPGA 1HXVA 1D7JA 1QPLA 4QT3A 1FKHA 4ODLA 2M8JA 1LQ0A 2KGJA 1KFWA 1IX5A 3O5RA 1JNTA 4KQZA 3AS0A 4ZPVR 3O5DA 2DT0A 2MLZA 2XP8A 1FAPA 3UF8A 4MNJA 4DWSA 2PPOA 3RM8A 2VN1A 3FSCA 3ARVA 2DPEA 3O5GA 3O5PA 4DRMA 5HWBA 1N1AA 1WNOA 2YAJB 1QPFA 3TC5A 2PV2A 3LE4A 1ZBWA 1OGGA 4LAVA 2WM0A 1FFQA 2L4JA 3WL1A 1Y0OA 2RE3A 4HBEA 3B9DA 1D7HA 1EDQA 1TCOC 3FAPA 4TX0A 3NTPA 4LAXA 5DIUA 2N87A 2YSGA 4GIVA 2FAPA 4HBOA 1EHNA 1ROUA 2LGOA 4MNKA 1W9VA 1RD6A 2A3BA 1W9UA 3CH9A 4DH0A 3UI4A 3JYMA 4TW6A 3LKXA 2PN0A 3IHZA 2XPAA 4S3JA 1KT1A 1NWRA 1WMVA 2PV1A 2L2SA 4WIWA 1CTNA 4FAPA 2MF9A 4MAVA 1HKJA 2JV4A 1ZB5A 1HKKA 4TW8A 3ARSA 1GPFA 3W4RA 4LGXA 3ARUA 4MNLA 3CHFA 1F8AB 1FFRA 1LG1A 2RURA 2RSEA 2A3AA 3M7NA 1KT0A 1ZBKA 2MLYA 1J6YA 3ALFA 4ZPTR 5HWCA 2M3OW 3KACA 1L1PA 2DJYA 4NZCA 2ZR4A 1A7XA 4IPXA 3WD3A 1EG3A 4O2TA 3PRAA 2O92A 2UZ5A 1JNDA 3EIPA 3ARYA 4MTVA 4Z2KA 2VCDA 4S3KA 4DZ2A 1K9RA 2RUCA 4MGVA 2DG3A 4MNMA 4E5RA 1E6RA 2DK1A 3WH0A 1LG2A 3QOKA 4BF8A 3AQUA 4U86A 2QF8A 5GQBA 3ARZA 4JFKA 3KZ7A 2DSUA 4JFJA 3G6MA 1F40A 1W1YA 4NNRA 5HTGA 5DIVA 4J4NA 2MNTA 4A0UA 3O5IA 2QRVA 3AROA 1K9TA 4QZVB 4IQ2A 3I6CA 3MCBA 2B31A 1D6OA 3O5OA 5HW7A 1E6PA 3AS2A 1FD9A 2DSVA 1HJVA 2YSBA 5DO2A 2ITKA 2G41A 2Y78A 3M85A 1Q6UA 2MPHA 1NSGA 3AS1A 4ZPWR 3VAWA 2ZQVA 1VF8A 4TNSA 4MPKA 4DZ3A 4A0TA 1O6WA 4N19A 4KR0B 2ZQSA 2YSHA 3FXYA 1X6LA 2ZR5A 2M08A 1WAWA 1WR7A 4L3NA 4G2PA 1LJYA 2YSIA 3MCBB 1J4RA 1ZBCA 3FSBA 4ZS6A 3ARRA 2ESCA 3TDBA 3CHCA 2IF4A 4TW7A 3ARWA 1NWTA 1FKGA 2XP3A 1LL4A 2A3EA 2WAEA 3UQIA 1GRJA 5E62A 3FS8A 2WK2A 2D9FA 2KXQA 3KAGA 2KFWA 4DWSB 1FKTA 1R9HA 4ODPA 3KABA 2ETNA 2OFNA 1HKIA 1LL6A 1FKRA 4Z2IA 2JX8A 2G8ZA 4GGQA 3WD2A 1D7IA 1GOIA 1O6IA 3UI6A 4G50A 3BMBA 3KAHA 4R5EA 3RFWA 4ODOA 1FLCA 3CGNA 5HKGA 2P4VA 4P8XA 3L4HA 5DEZA 2XP9A 1FKBA 3KAFA 1FKDA 5B8IC 1ITXA 4ODKA
chains in the Genus database with same CATH topology
1ZK6A 1WB0A 4C02B 2IUZA 3AS3A 1YATA 1NMWA 4DT4A 3FY1A 3ARXA 3O5JA 4WKFA 4JFLA 3IK8A 4Z2GA 4WJXA 1ZL1A 2F2DA 2KO7A 4WKAA 1ZU8A 2RUQA 1ZBVA 1T11A 2KI3A 2LAJA 1JVWA 2XP5A 1K9QA 2MLXA 4DRNA 2AWGA 2XP7A 4J4OA 1XRVA 3LKXB 1NH6A 5JH8A 3O5MA 4ITZA 5GPRA 5E66A 3WIJA 3PRBA 3PQHA 5DF0A 1NWSA 4U84A 2PV3A 3WD4A 4DRHA 3CHDA 4DIPA 3LUOA 1U79A 2LJ4A 3MDYB 4LAWA 1E6ZA 4JFMA 1OGBA 4WK9A 4Z2JA 1JNSA 2DWVA 2E45A 1Q1CA 3UQBA 3CZ8A 3RMEA 1E15A 1E6NA 2DK7A 2KE0A 4IQCA 4W9QA 2JZVA 1TFVA 3CNGA 1M5YA 2DMVA 2ZQTA 1X6NA 1SR0A 1EG4A 4PTMA 1PBKA 1UR8A 4P8VA 2ZAJA 3B8SA 3OOBA 1LL7A 3CGMA 5E64A 5HUAA 2FDMA 4IT4A 4R0XA 2WADA 5HBFA 4DWSD 3PRDA 3MQGA 1W1TA 2DT1A 3JYJA 1W9PA 3RM4A 4ODMA 1H0GA 4QT2A 2ZR6A 1EYMA 2YSFA 4DRIA 1ROTA 2DT3A 4JFIA 3WL0A 4IT6A 3WQVA 3B9AA 3O5KA 2RUDA 3KAIA 2PPNA 5HT1A 5D75A 1FKIA 4ODRA 1BL4A 4HARA 2YBTA 1GUVA 3JXVA 3CHEA 4REXA 4DRQA 3RGCA 1JNEA 3PA7A 3B9EA 3OA5A 4DWSC 1YW5A 3H9RB 4ODNA 4P8WA 1ZCNA 1W1VA 1RP5A 4W5UA 3O5LA 2XP4A 2PI6A 4AY1A 2LKNA 2JMFA 1HJXA 1UR9A 3NRKA 5HW8A 2AOSA 1SYTA 5I98A 1W1PA 2Y8NB 2K8IA 2RQSA 5HW6A 4GLXA 2Q5AA 2DT2A 4Q7NA 4XAKA 3WKZA 1FKJA 1I5HW 4NSBA 3G6LA 4DROA 1XHGA 2O9OA 4L72B 5AHTA 2FKEA 3BXWA 3MQHA 3B7XA 3UI5A 2DG9A 3IKGA 4DRPA 2WLYA 3ALGA 1W26A 3ARQA 1B6CA 4JYSA 1FKFA 1C9HA 1EIBA 1FKLA 5E5WA 5U47A 1PINA 3WD0A 1D2KA 4DRKA 2OLHA 4DRJA 1FKKA 5CQ2A 1NMVA 1FKSA 3WQWA 4ODQA 4QIBA 3O5EA 1E9LA 4URIA 1J4IA 5J6EA 1BKFA 1QZ2A 1Q6HA 1H0IA 2EZ5W 1HKMA 2DSZA 2LPVA 3EY6A 1TK7A 3GPKA 2DSWA 4U85A 2PPPA 4LAYA 4ML4A 1OWQA 1P5QA 3RM9A 1EQ3A 3ARPA 2M2AA 4MSPA 2F21A 3TCZA 2ZQUA 2KR7A 4W9PA 4FN2A 1JMQA 2XP6A 2DG4A 2YBUA 3UQAA 2JXWA 3KADA 1NWUA 5BXJA 2OWOA 3PR9A 2MDIA 2A3CA 1Q6IA 2WLZA 3ARTA 5DITA 4TYOA 2F4EA 4Z2LA 3O5QA 4Q22A 1HJWA 2BA1A 3O5FA 4P8UA 2PBCA 2XPBA 1TR8A 3WD1A 1FJDA 2M8IA 3ODKA 2M1IA 4W9OA 1J4HA 4WKHA 3IKDA 4Z2HA 5E65A 3KCEA 3NI6A 5GPGA 1HXVA 1D7JA 1QPLA 4QT3A 1FKHA 4ODLA 2M8JA 1LQ0A 2KGJA 1KFWA 1IX5A 3O5RA 1JNTA 4KQZA 3AS0A 4ZPVR 3O5DA 2DT0A 2MLZA 2XP8A 1FAPA 3UF8A 4MNJA 4DWSA 2PPOA 3RM8A 2VN1A 3FSCA 3ARVA 2DPEA 3O5GA 3O5PA 4DRMA 5HWBA 1N1AA 1WNOA 2YAJB 1QPFA 3TC5A 2PV2A 3LE4A 1ZBWA 1OGGA 4LAVA 2WM0A 1FFQA 2L4JA 3WL1A 1Y0OA 2RE3A 4HBEA 3B9DA 1D7HA 1EDQA 1TCOC 3FAPA 4TX0A 3NTPA 4LAXA 5DIUA 2N87A 2YSGA 4GIVA 2FAPA 4HBOA 1EHNA 1ROUA 2LGOA 4MNKA 1W9VA 1RD6A 2A3BA 1W9UA 3CH9A 4DH0A 3UI4A 3JYMA 4TW6A 3LKXA 3IHZA 2XPAA 4S3JA 1KT1A 1NWRA 1WMVA 2PV1A 2L2SA 4WIWA 1CTNA 4FAPA 2MF9A 4MAVA 1HKJA 2JV4A 1ZB5A 1HKKA 4TW8A 3ARSA 1GPFA 3W4RA 4LGXA 3ARUA 4MNLA 3CHFA 1F8AB 1FFRA 1LG1A 2RURA 2RSEA 2A3AA 3M7NA 1KT0A 1ZBKA 2MLYA 1J6YA 3ALFA 4ZPTR 5HWCA 2M3OW 3KACA 1L1PA 2DJYA 4NZCA 2ZR4A 1A7XA 4IPXA 3WD3A 1EG3A 4O2TA 3PRAA 2O92A 2UZ5A 1JNDA 4MTVA 3ARYA 4Z2KA 2VCDA 4S3KA 4DZ2A 1K9RA 2RUCA 4MGVA 2DG3A 4MNMA 4E5RA 1E6RA 2DK1A 3WH0A 1LG2A 3QOKA 4BF8A 3AQUA 4U86A 2QF8A 5GQBA 3ARZA 4JFKA 3KZ7A 2DSUA 4JFJA 3G6MA 1F40A 1W1YA 4NNRA 5HTGA 5DIVA 4J4NA 2MNTA 4A0UA 3O5IA 2QRVA 3AROA 1K9TA 4QZVB 4IQ2A 3I6CA 3MCBA 2B31A 1D6OA 3O5OA 5HW7A 1E6PA 3AS2A 1FD9A 2DSVA 1HJVA 2YSBA 5DO2A 2ITKA 2G41A 2Y78A 3M85A 1Q6UA 2MPHA 1NSGA 3AS1A 4ZPWR 3VAWA 2ZQVA 1VF8A 4TNSA 4MPKA 4DZ3A 4A0TA 1O6WA 4N19A 4KR0B 2ZQSA 2YSHA 3FXYA 1X6LA 2ZR5A 2M08A 1WAWA 1WR7A 4L3NA 4G2PA 1LJYA 2YSIA 3MCBB 1J4RA 1ZBCA 3FSBA 4ZS6A 3ARRA 2ESCA 3TDBA 3CHCA 2IF4A 4TW7A 3ARWA 1NWTA 1FKGA 2XP3A 1LL4A 2A3EA 2WAEA 3UQIA 5E62A 3FS8A 2WK2A 2D9FA 2KXQA 3KAGA 2KFWA 4DWSB 1FKTA 1R9HA 4ODPA 3KABA 2OFNA 1HKIA 1LL6A 1FKRA 4Z2IA 2JX8A 2G8ZA 4GGQA 3WD2A 1D7IA 1GOIA 1O6IA 3UI6A 4G50A 3KAHA 4R5EA 3RFWA 4ODOA 1FLCA 3CGNA 5HKGA 4P8XA 3L4HA 5DEZA 2XP9A 1FKBA 3KAFA 1FKDA 5B8IC 1ITXA 4ODKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZK6 A;  4C02 B;  1YAT A;  1NMW A;  4DT4 A;  3O5J A;  4JFL A;  3IK8 A;  2F2D A;  2KO7 A;  2RUQ A;  1T11 A;  2KI3 A;  2LAJ A;  1JVW A;  2XP5 A;  1K9Q A;  2MLX A;  4DRN A;  2AWG A;  2XP7 A;  4J4O A;  3O5M A;  4ITZ A;  3PRB A;  4U84 A;  2PV3 A;  4DRH A;  4DIP A;  3LUO A;  1U79 A;  2LJ4 A;  3MDY B;  4LAW A;  4JFM A;  1JNS A;  2E45 A;  2DWV A;  1Q1C A;  3UQB A;  2DK7 A;  2KE0 A;  4IQC A;  4W9Q A;  2JZV A;  3CNG A;  1M5Y A;  2DMV A;  2ZQT A;  1EG4 A;  1PBK A;  2ZAJ A;  3OOB A;  3CGM A;  5HUA A;  4R0X A;  3PRD A;  3JYJ A;  4ODM A;  4QT2 A;  2ZR6 A;  1EYM A;  2YSF A;  4DRI A;  1ROT A;  4JFI A;  3O5K A;  2RUD A;  3KAI A;  2PPN A;  5HT1 A;  5D75 A;  1FKI A;  4ODR A;  1BL4 A;  3JXV A;  4REX A;  4DRQ A;  3RGC A;  3PA7 A;  1YW5 A;  3H9R B;  4ODN A;  1ZCN A;  3O5L A;  2XP4 A;  2LKN A;  2JMF A;  3NRK A;  5HW8 A;  5I98 A;  2K8I A;  2RQS A;  5HW6 A;  2Q5A A;  1FKJ A;  1I5H W;  4DRO A;  5AHT A;  2FKE A;  3B7X A;  3UI5 A;  2DG9 A;  3IKG A;  4DRP A;  1W26 A;  1B6C A;  4JYS A;  1FKF A;  1C9H A;  1FKL A;  1PIN A;  4DRK A;  4DRJ A;  1FKK A;  5CQ2 A;  1NMV A;  1FKS A;  4ODQ A;  4QIB A;  3O5E A;  1J4I A;  5J6E A;  1BKF A;  1QZ2 A;  1Q6H A;  2EZ5 W;  3EY6 A;  2LPV A;  1TK7 A;  3GPK A;  2PPP A;  4U85 A;  4LAY A;  1P5Q A;  1EQ3 A;  2M2A A;  4MSP A;  2F21 A;  3TCZ A;  2ZQU A;  2KR7 A;  4W9P A;  4FN2 A;  1JMQ A;  2XP6 A;  2DG4 A;  3UQA A;  2JXW A;  3KAD A;  5BXJ A;  2MDI A;  1Q6I A;  5DIT A;  4TYO A;  2F4E A;  3O5Q A;  2BA1 A;  3O5F A;  2PBC A;  2XPB A;  1FJD A;  2M8I A;  3ODK A;  2M1I A;  4W9O A;  1J4H A;  3IKD A;  3KCE A;  3NI6 A;  5GPG A;  1HXV A;  1D7J A;  1QPL A;  4QT3 A;  1FKH A;  4ODL A;  2M8J A;  2KGJ A;  3O5R A;  1JNT A;  3O5D A;  2MLZ A;  2XP8 A;  1FAP A;  3UF8 A;  2PPO A;  2VN1 A;  3O5G A;  3O5P A;  4DRM A;  5HWB A;  1N1A A;  1QPF A;  3TC5 A;  2PV2 A;  3LE4 A;  4LAV A;  2L4J A;  1Y0O A;  2RE3 A;  1D7H A;  1TCO C;  3FAP A;  4TX0 A;  3NTP A;  4LAX A;  5DIU A;  2N87 A;  2YSG A;  4GIV A;  2FAP A;  1ROU A;  2LGO A;  4DH0 A;  3UI4 A;  3JYM A;  4TW6 A;  3IHZ A;  2XPA A;  1KT1 A;  2PV1 A;  1WMV A;  2L2S A;  4FAP A;  2MF9 A;  2JV4 A;  4TW8 A;  1F8A B;  2RUR A;  2RSE A;  3M7N A;  1KT0 A;  2MLY A;  1J6Y A;  5HWC A;  2M3O W;  3KAC A;  1L1P A;  2DJY A;  2ZR4 A;  1A7X A;  4IPX A;  4O2T A;  1EG3 A;  2UZ5 A;  2VCD A;  4DZ2 A;  1K9R A;  2RUC A;  4MGV A;  2DG3 A;  4E5R A;  2DK1 A;  3WH0 A;  4BF8 A;  4U86 A;  4JFK A;  3KZ7 A;  4JFJ A;  1F40 A;  4NNR A;  5HTG A;  5DIV A;  4J4N A;  2MNT A;  3O5I A;  4IQ2 A;  3I6C A;  1D6O A;  3O5O A;  5HW7 A;  1FD9 A;  2YSB A;  2ITK A;  2Y78 A;  3M85 A;  1Q6U A;  2MPH A;  1NSG A;  3VAW A;  2ZQV A;  4TNS A;  4DZ3 A;  1O6W A;  4N19 A;  2ZQS A;  2YSH A;  2ZR5 A;  2M08 A;  1WR7 A;  4G2P A;  2YSI A;  1J4R A;  3TDB A;  2IF4 A;  4TW7 A;  1FKG A;  2XP3 A;  3UQI A;  2D9F A;  2KXQ A;  3KAG A;  2KFW A;  1FKT A;  1R9H A;  4ODP A;  3KAB A;  2OFN A;  1FKR A;  2JX8 A;  4GGQ A;  1D7I A;  3UI6 A;  4G50 A;  3KAH A;  3RFW A;  4ODO A;  3CGN A;  5HKG A;  3L4H A;  2XP9 A;  1FKB A;  3KAF A;  1FKD A;  5B8I C;  4ODK A; 
#chains in the Genus database with same CATH topology
 1ZK6 A;  1WB0 A;  4C02 B;  2IUZ A;  3AS3 A;  1YAT A;  1NMW A;  4DT4 A;  3FY1 A;  3ARX A;  3O5J A;  4WKF A;  4JFL A;  3IK8 A;  4Z2G A;  4WJX A;  1ZL1 A;  2F2D A;  2KO7 A;  4WKA A;  1ZU8 A;  2RUQ A;  1ZBV A;  1T11 A;  2KI3 A;  2LAJ A;  1JVW A;  2XP5 A;  1K9Q A;  2MLX A;  4DRN A;  2AWG A;  2XP7 A;  4J4O A;  1XRV A;  3LKX B;  1NH6 A;  5JH8 A;  3O5M A;  4ITZ A;  5GPR A;  1JCH B;  5E66 A;  3WIJ A;  3PRB A;  3PQH A;  5DF0 A;  1NWS A;  4U84 A;  2PV3 A;  3WD4 A;  4DRH A;  3CHD A;  4DIP A;  3LUO A;  1U79 A;  2LJ4 A;  3MDY B;  4LAW A;  1E6Z A;  4JFM A;  1OGB A;  4WK9 A;  4Z2J A;  1JNS A;  2DWV A;  2E45 A;  1Q1C A;  3UQB A;  3CZ8 A;  2EUL A;  3RME A;  1E15 A;  1E6N A;  2DK7 A;  2KE0 A;  4IQC A;  4W9Q A;  2JZV A;  1TFV A;  3CNG A;  1M5Y A;  2DMV A;  2ZQT A;  1X6N A;  1SR0 A;  1EG4 A;  4PTM A;  1PBK A;  1UR8 A;  4P8V A;  2ZAJ A;  3B8S A;  3OOB A;  1LL7 A;  2B5U B;  4UDM A;  3CGM A;  5E64 A;  5HUA A;  2FDM A;  1E44 A;  4IT4 A;  4R0X A;  2WAD A;  5HBF A;  4DWS D;  3PRD A;  3MQG A;  1W1T A;  2DT1 A;  3JYJ A;  1W9P A;  3RM4 A;  4ODM A;  1H0G A;  4QT2 A;  2ZR6 A;  1EYM A;  2YSF A;  4DRI A;  1ROT A;  2DT3 A;  4JFI A;  3WL0 A;  4IT6 A;  3WQV A;  3B9A A;  3O5K A;  2RUD A;  3KAI A;  2PPN A;  5HT1 A;  5D75 A;  1FKI A;  4ODR A;  1BL4 A;  4HAR A;  2YBT A;  1GUV A;  3JXV A;  3CHE A;  4REX A;  4DRQ A;  3RGC A;  1JNE A;  3PA7 A;  3B9E A;  3OA5 A;  4DWS C;  1YW5 A;  3H9R B;  4ODN A;  4P8W A;  1ZCN A;  1W1V A;  1RP5 A;  4W5U A;  3O5L A;  2XP4 A;  2PI6 A;  4AY1 A;  2LKN A;  2JMF A;  1HJX A;  1UR9 A;  3NRK A;  5HW8 A;  2AOS A;  1SYT A;  5I98 A;  1W1P A;  2Y8N B;  2K8I A;  2RQS A;  5HW6 A;  4GLX A;  2Q5A A;  2DT2 A;  4Q7N A;  4XAK A;  3WKZ A;  3GU0 A;  1FKJ A;  1I5H W;  4NSB A;  3G6L A;  4DRO A;  1XHG A;  2O9O A;  4L72 B;  5AHT A;  2FKE A;  3BXW A;  3MQH A;  3B7X A;  3UI5 A;  2DG9 A;  3IKG A;  4DRP A;  2WLY A;  3ALG A;  1W26 A;  3ARQ A;  1B6C A;  4JYS A;  1FKF A;  1C9H A;  1EIB A;  1FKL A;  5E5W A;  5U47 A;  1PIN A;  3WD0 A;  1D2K A;  4DRK A;  2OLH A;  4DRJ A;  1FKK A;  5CQ2 A;  1NMV A;  1FKS A;  3WQW A;  4ODQ A;  4QIB A;  3O5E A;  1E9L A;  4URI A;  1J4I A;  5J6E A;  1BKF A;  1QZ2 A;  1Q6H A;  1H0I A;  2EZ5 W;  1HKM A;  2DSZ A;  2LPV A;  3EY6 A;  1TK7 A;  3GPK A;  2DSW A;  4U85 A;  2PPP A;  4LAY A;  4ML4 A;  1OWQ A;  1P5Q A;  3RM9 A;  1EQ3 A;  3ARP A;  2M2A A;  4MSP A;  2F21 A;  3TCZ A;  2ZQU A;  2KR7 A;  4W9P A;  4FN2 A;  1JMQ A;  2XP6 A;  2DG4 A;  2YBU A;  3UQA A;  2JXW A;  3KAD A;  1NWU A;  2F23 A;  5BXJ A;  2OWO A;  3PR9 A;  2MDI A;  2A3C A;  1Q6I A;  2WLZ A;  3ART A;  5DIT A;  4TYO A;  2F4E A;  4Z2L A;  3O5Q A;  4Q22 A;  1HJW A;  2BA1 A;  3O5F A;  4P8U A;  2XPB A;  2PBC A;  1TR8 A;  3WD1 A;  1FJD A;  2M8I A;  3ODK A;  2M1I A;  4W9O A;  1J4H A;  4WKH A;  3IKD A;  3GTY X;  4Z2H A;  5E65 A;  3KCE A;  3NI6 A;  5GPG A;  1HXV A;  1D7J A;  1QPL A;  4QT3 A;  1FKH A;  4ODL A;  2M8J A;  1LQ0 A;  2KGJ A;  1KFW A;  1IX5 A;  3O5R A;  1JNT A;  4KQZ A;  3AS0 A;  4ZPV R;  3O5D A;  2DT0 A;  2MLZ A;  2XP8 A;  1FAP A;  3UF8 A;  4MNJ A;  4DWS A;  2PPO A;  3RM8 A;  2VN1 A;  3FSC A;  3ARV A;  2DPE A;  3O5G A;  3O5P A;  4DRM A;  5HWB A;  1N1A A;  1WNO A;  2YAJ B;  1QPF A;  3TC5 A;  2PV2 A;  3LE4 A;  1ZBW A;  1OGG A;  4LAV A;  2WM0 A;  1FFQ A;  2L4J A;  3WL1 A;  1Y0O A;  2RE3 A;  4HBE A;  3B9D A;  1D7H A;  1EDQ A;  1TCO C;  3FAP A;  4TX0 A;  3NTP A;  4LAX A;  5DIU A;  2N87 A;  2YSG A;  4GIV A;  2FAP A;  4HBO A;  1EHN A;  1ROU A;  2LGO A;  4MNK A;  1W9V A;  1RD6 A;  2A3B A;  1W9U A;  3CH9 A;  4DH0 A;  3UI4 A;  3JYM A;  4TW6 A;  3LKX A;  2PN0 A;  3IHZ A;  2XPA A;  4S3J A;  1KT1 A;  1NWR A;  1WMV A;  2PV1 A;  2L2S A;  4WIW A;  1CTN A;  4FAP A;  2MF9 A;  4MAV A;  1HKJ A;  2JV4 A;  1ZB5 A;  1HKK A;  4TW8 A;  3ARS A;  1GPF A;  3W4R A;  4LGX A;  3ARU A;  4MNL A;  3CHF A;  1F8A B;  1FFR A;  1LG1 A;  2RUR A;  2RSE A;  2A3A A;  3M7N A;  1KT0 A;  1ZBK A;  2MLY A;  1J6Y A;  3ALF A;  4ZPT R;  5HWC A;  2M3O W;  3KAC A;  1L1P A;  2DJY A;  4NZC A;  2ZR4 A;  1A7X A;  4IPX A;  3WD3 A;  1EG3 A;  4O2T A;  3PRA A;  2O92 A;  2UZ5 A;  1JND A;  3EIP A;  3ARY A;  4MTV A;  4Z2K A;  2VCD A;  4S3K A;  4DZ2 A;  1K9R A;  2RUC A;  4MGV A;  2DG3 A;  4MNM A;  4E5R A;  1E6R A;  2DK1 A;  3WH0 A;  1LG2 A;  3QOK A;  4BF8 A;  3AQU A;  4U86 A;  2QF8 A;  5GQB A;  3ARZ A;  4JFK A;  3KZ7 A;  2DSU A;  4JFJ A;  3G6M A;  1F40 A;  1W1Y A;  4NNR A;  5HTG A;  5DIV A;  4J4N A;  2MNT A;  4A0U A;  3O5I A;  2QRV A;  3ARO A;  1K9T A;  4QZV B;  4IQ2 A;  3I6C A;  3MCB A;  2B31 A;  1D6O A;  3O5O A;  5HW7 A;  1E6P A;  3AS2 A;  1FD9 A;  2DSV A;  1HJV A;  2YSB A;  5DO2 A;  2ITK A;  2G41 A;  2Y78 A;  3M85 A;  1Q6U A;  2MPH A;  1NSG A;  3AS1 A;  4ZPW R;  3VAW A;  2ZQV A;  1VF8 A;  4TNS A;  4MPK A;  4DZ3 A;  4A0T A;  1O6W A;  4N19 A;  4KR0 B;  2ZQS A;  2YSH A;  3FXY A;  1X6L A;  2ZR5 A;  2M08 A;  1WAW A;  1WR7 A;  4L3N A;  4G2P A;  1LJY A;  2YSI A;  3MCB B;  1J4R A;  1ZBC A;  3FSB A;  4ZS6 A;  3ARR A;  2ESC A;  3TDB A;  3CHC A;  2IF4 A;  4TW7 A;  3ARW A;  1NWT A;  1FKG A;  2XP3 A;  1LL4 A;  2A3E A;  2WAE A;  3UQI A;  1GRJ A;  5E62 A;  3FS8 A;  2WK2 A;  2D9F A;  2KXQ A;  3KAG A;  2KFW A;  4DWS B;  1FKT A;  1R9H A;  4ODP A;  3KAB A;  2ETN A;  2OFN A;  1HKI A;  1LL6 A;  1FKR A;  4Z2I A;  2JX8 A;  2G8Z A;  4GGQ A;  3WD2 A;  1D7I A;  1GOI A;  1O6I A;  3UI6 A;  4G50 A;  3BMB A;  3KAH A;  4R5E A;  3RFW A;  4ODO A;  1FLC A;  3CGN A;  5HKG A;  2P4V A;  4P8X A;  3L4H A;  5DEZ A;  2XP9 A;  1FKB A;  3KAF A;  1FKD A;  5B8I C;  1ITX A;  4ODK A; 
#chains in the Genus database with same CATH homology
 1ZK6 A;  1WB0 A;  4C02 B;  2IUZ A;  3AS3 A;  1YAT A;  1NMW A;  4DT4 A;  3FY1 A;  3ARX A;  3O5J A;  4WKF A;  4JFL A;  3IK8 A;  4Z2G A;  4WJX A;  1ZL1 A;  2F2D A;  2KO7 A;  4WKA A;  1ZU8 A;  2RUQ A;  1ZBV A;  1T11 A;  2KI3 A;  2LAJ A;  1JVW A;  2XP5 A;  1K9Q A;  2MLX A;  4DRN A;  2AWG A;  2XP7 A;  4J4O A;  1XRV A;  3LKX B;  1NH6 A;  5JH8 A;  3O5M A;  4ITZ A;  5GPR A;  5E66 A;  3WIJ A;  3PRB A;  3PQH A;  5DF0 A;  1NWS A;  4U84 A;  2PV3 A;  3WD4 A;  4DRH A;  3CHD A;  4DIP A;  3LUO A;  1U79 A;  2LJ4 A;  3MDY B;  4LAW A;  1E6Z A;  4JFM A;  1OGB A;  4WK9 A;  4Z2J A;  1JNS A;  2DWV A;  2E45 A;  1Q1C A;  3UQB A;  3CZ8 A;  3RME A;  1E15 A;  1E6N A;  2DK7 A;  2KE0 A;  4IQC A;  4W9Q A;  2JZV A;  1TFV A;  3CNG A;  1M5Y A;  2DMV A;  2ZQT A;  1X6N A;  1SR0 A;  1EG4 A;  4PTM A;  1PBK A;  1UR8 A;  4P8V A;  2ZAJ A;  3B8S A;  3OOB A;  1LL7 A;  3CGM A;  5E64 A;  5HUA A;  2FDM A;  4IT4 A;  4R0X A;  2WAD A;  5HBF A;  4DWS D;  3PRD A;  3MQG A;  1W1T A;  2DT1 A;  3JYJ A;  1W9P A;  3RM4 A;  4ODM A;  1H0G A;  4QT2 A;  2ZR6 A;  1EYM A;  2YSF A;  4DRI A;  1ROT A;  2DT3 A;  4JFI A;  3WL0 A;  4IT6 A;  3WQV A;  3B9A A;  3O5K A;  2RUD A;  3KAI A;  2PPN A;  5HT1 A;  5D75 A;  1FKI A;  4ODR A;  1BL4 A;  4HAR A;  2YBT A;  1GUV A;  3JXV A;  3CHE A;  4REX A;  4DRQ A;  3RGC A;  1JNE A;  3PA7 A;  3B9E A;  3OA5 A;  4DWS C;  1YW5 A;  3H9R B;  4ODN A;  4P8W A;  1ZCN A;  1W1V A;  1RP5 A;  4W5U A;  3O5L A;  2XP4 A;  2PI6 A;  4AY1 A;  2LKN A;  2JMF A;  1HJX A;  1UR9 A;  3NRK A;  5HW8 A;  2AOS A;  1SYT A;  5I98 A;  1W1P A;  2Y8N B;  2K8I A;  2RQS A;  5HW6 A;  4GLX A;  2Q5A A;  2DT2 A;  4Q7N A;  4XAK A;  3WKZ A;  1FKJ A;  1I5H W;  4NSB A;  3G6L A;  4DRO A;  1XHG A;  2O9O A;  4L72 B;  5AHT A;  2FKE A;  3BXW A;  3MQH A;  3B7X A;  3UI5 A;  2DG9 A;  3IKG A;  4DRP A;  2WLY A;  3ALG A;  1W26 A;  3ARQ A;  1B6C A;  4JYS A;  1FKF A;  1C9H A;  1EIB A;  1FKL A;  5E5W A;  5U47 A;  1PIN A;  3WD0 A;  1D2K A;  4DRK A;  2OLH A;  4DRJ A;  1FKK A;  5CQ2 A;  1NMV A;  1FKS A;  3WQW A;  4ODQ A;  4QIB A;  3O5E A;  1E9L A;  4URI A;  1J4I A;  5J6E A;  1BKF A;  1QZ2 A;  1Q6H A;  1H0I A;  2EZ5 W;  1HKM A;  2DSZ A;  2LPV A;  3EY6 A;  1TK7 A;  3GPK A;  2DSW A;  4U85 A;  2PPP A;  4LAY A;  4ML4 A;  1OWQ A;  1P5Q A;  3RM9 A;  1EQ3 A;  3ARP A;  2M2A A;  4MSP A;  2F21 A;  3TCZ A;  2ZQU A;  2KR7 A;  4W9P A;  4FN2 A;  1JMQ A;  2XP6 A;  2DG4 A;  2YBU A;  3UQA A;  2JXW A;  3KAD A;  1NWU A;  5BXJ A;  2OWO A;  3PR9 A;  2MDI A;  2A3C A;  1Q6I A;  2WLZ A;  3ART A;  5DIT A;  4TYO A;  2F4E A;  4Z2L A;  3O5Q A;  4Q22 A;  1HJW A;  2BA1 A;  3O5F A;  4P8U A;  2PBC A;  2XPB A;  1TR8 A;  3WD1 A;  1FJD A;  2M8I A;  3ODK A;  2M1I A;  4W9O A;  1J4H A;  4WKH A;  3IKD A;  4Z2H A;  5E65 A;  3KCE A;  3NI6 A;  5GPG A;  1HXV A;  1D7J A;  1QPL A;  4QT3 A;  1FKH A;  4ODL A;  2M8J A;  1LQ0 A;  2KGJ A;  1KFW A;  1IX5 A;  3O5R A;  1JNT A;  4KQZ A;  3AS0 A;  4ZPV R;  3O5D A;  2DT0 A;  2MLZ A;  2XP8 A;  1FAP A;  3UF8 A;  4MNJ A;  4DWS A;  2PPO A;  3RM8 A;  2VN1 A;  3FSC A;  3ARV A;  2DPE A;  3O5G A;  3O5P A;  4DRM A;  5HWB A;  1N1A A;  1WNO A;  2YAJ B;  1QPF A;  3TC5 A;  2PV2 A;  3LE4 A;  1ZBW A;  1OGG A;  4LAV A;  2WM0 A;  1FFQ A;  2L4J A;  3WL1 A;  1Y0O A;  2RE3 A;  4HBE A;  3B9D A;  1D7H A;  1EDQ A;  1TCO C;  3FAP A;  4TX0 A;  3NTP A;  4LAX A;  5DIU A;  2N87 A;  2YSG A;  4GIV A;  2FAP A;  4HBO A;  1EHN A;  1ROU A;  2LGO A;  4MNK A;  1W9V A;  1RD6 A;  2A3B A;  1W9U A;  3CH9 A;  4DH0 A;  3UI4 A;  3JYM A;  4TW6 A;  3LKX A;  3IHZ A;  2XPA A;  4S3J A;  1KT1 A;  1NWR A;  1WMV A;  2PV1 A;  2L2S A;  4WIW A;  1CTN A;  4FAP A;  2MF9 A;  4MAV A;  1HKJ A;  2JV4 A;  1ZB5 A;  1HKK A;  4TW8 A;  3ARS A;  1GPF A;  3W4R A;  4LGX A;  3ARU A;  4MNL A;  3CHF A;  1F8A B;  1FFR A;  1LG1 A;  2RUR A;  2RSE A;  2A3A A;  3M7N A;  1KT0 A;  1ZBK A;  2MLY A;  1J6Y A;  3ALF A;  4ZPT R;  5HWC A;  2M3O W;  3KAC A;  1L1P A;  2DJY A;  4NZC A;  2ZR4 A;  1A7X A;  4IPX A;  3WD3 A;  1EG3 A;  4O2T A;  3PRA A;  2O92 A;  2UZ5 A;  1JND A;  4MTV A;  3ARY A;  4Z2K A;  2VCD A;  4S3K A;  4DZ2 A;  1K9R A;  2RUC A;  4MGV A;  2DG3 A;  4MNM A;  4E5R A;  1E6R A;  2DK1 A;  3WH0 A;  1LG2 A;  3QOK A;  4BF8 A;  3AQU A;  4U86 A;  2QF8 A;  5GQB A;  3ARZ A;  4JFK A;  3KZ7 A;  2DSU A;  4JFJ A;  3G6M A;  1F40 A;  1W1Y A;  4NNR A;  5HTG A;  5DIV A;  4J4N A;  2MNT A;  4A0U A;  3O5I A;  2QRV A;  3ARO A;  1K9T A;  4QZV B;  4IQ2 A;  3I6C A;  3MCB A;  2B31 A;  1D6O A;  3O5O A;  5HW7 A;  1E6P A;  3AS2 A;  1FD9 A;  2DSV A;  1HJV A;  2YSB A;  5DO2 A;  2ITK A;  2G41 A;  2Y78 A;  3M85 A;  1Q6U A;  2MPH A;  1NSG A;  3AS1 A;  4ZPW R;  3VAW A;  2ZQV A;  1VF8 A;  4TNS A;  4MPK A;  4DZ3 A;  4A0T A;  1O6W A;  4N19 A;  4KR0 B;  2ZQS A;  2YSH A;  3FXY A;  1X6L A;  2ZR5 A;  2M08 A;  1WAW A;  1WR7 A;  4L3N A;  4G2P A;  1LJY A;  2YSI A;  3MCB B;  1J4R A;  1ZBC A;  3FSB A;  4ZS6 A;  3ARR A;  2ESC A;  3TDB A;  3CHC A;  2IF4 A;  4TW7 A;  3ARW A;  1NWT A;  1FKG A;  2XP3 A;  1LL4 A;  2A3E A;  2WAE A;  3UQI A;  5E62 A;  3FS8 A;  2WK2 A;  2D9F A;  2KXQ A;  3KAG A;  2KFW A;  4DWS B;  1FKT A;  1R9H A;  4ODP A;  3KAB A;  2OFN A;  1HKI A;  1LL6 A;  1FKR A;  4Z2I A;  2JX8 A;  2G8Z A;  4GGQ A;  3WD2 A;  1D7I A;  1GOI A;  1O6I A;  3UI6 A;  4G50 A;  3KAH A;  4R5E A;  3RFW A;  4ODO A;  1FLC A;  3CGN A;  5HKG A;  4P8X A;  3L4H A;  5DEZ A;  2XP9 A;  1FKB A;  3KAF A;  1FKD A;  5B8I C;  1ITX A;  4ODK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...