3WH0A

Structure of pin1 complex with 18-crown-6
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
157
structure length
145
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Crowning Proteins: Modulating the Protein Surface Properties using Crown Ethers.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 46
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3wh0A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3wh0A02
2YSHA 4LAYA 1WMVA 1B6CA 1N1AA 1TK7A 2DK7A 2YSFA 2XP9A 3NI6A 1NSGA 2KE0A 2MF9A 1C9HA 2RUDA 3O5RA 2RSEA 2LGOA 4FAPA 5HWCA 3O5PA 1A7XA 1QPLA 2JXWA 1ROUA 4G2PA 2KGJA 4JFIA 2K8IA 4U84A 4U86A 3EY6A 4DRHA 1FAPA 4DRNA 5HKGA 2JMFA 2ZQUA 1FKHA 3KAGA 3RGCA 3I6CA 1JNSA 1D7JA 1J4IA 1YATA 4DROA 2DG4A 4TW7A 4W9OA 4ODKA 2ZAJA 1FKSA 4JFMA 4BF8A 1FKTA 2ZR5A 1EG3A 5GPGA 2YSGA 5HUAA 3KZ7A 2LAJA 2RE3A 2PV1A 2ITKA 1PINA 3KAFA 5HWBA 3LE4A 3TCZA 2DJYA 2VCDA 2M3OW 3WH0A 2M8JA 2LJ4A 2E45A 1ZCNA 2JX8A 2LPVA 5D75A 3CGNA 3KAIA 4DZ3A 1F40A 3JXVA 4DH0A 2XPBA 2F4EA 4J4OA 5J6EA 1ZK6A 3PRDA 4DRIA 3NTPA 1D7IA 3H9RB 5HW8A 2RUQA 4NNRA 2M2AA 1M5YA 3O5DA 5I98A 1EYMA 2N87A 3LUOA 1P5QA 3VAWA 4LAXA 4TNSA 1J6YA 2KO7A 3O5MA 4TYOA 1PBKA 1Y0OA 2IF4A 1ROTA 4ODOA 2KR7A 2MDIA 2XPAA 2MLXA 3KABA 2PPOA 2M8IA 1J4RA 1HXVA 2F21A 4QIBA 4GIVA 4IPXA 1Q6HA 4JFKA 1FKIA 5DIVA 2VN1A 3KADA 4W9QA 2YSBA 4JFJA 5BXJA 4JYSA 1FKLA 2KXQA 3CNGA 1Q6IA 1QZ2A 4R0XA 5B8IC 4C02B 4ODNA 3UI6A 3UQBA 3IK8A 3KACA 3O5QA 2KFWA 2XP8A 1O6WA 1NMWA 3O5GA 1D7HA 3UF8A 1I5HW 2PV2A 1T11A 2ZQTA 2XP6A 3TC5A 2Q5AA 2JV4A 2M1IA 4JFLA 3PRBA 2RQSA 2EZ5W 4ODLA 3O5EA 1U79A 3FAPA 2DMVA 1FKDA 2XP3A 1QPFA 4QT3A 1YW5A 4MGVA 1BKFA 4MSPA 4ODQA 4IQCA 3UI4A 1K9RA 1F8AB 4REXA 4DT4A 3GPKA 2L4JA 2XP5A 3O5IA 1WR7A 1FKGA 2M08A 5HW7A 2RURA 2ZR6A 4U85A 3JYMA 4DRJA 3IKGA 5HTGA 3UI5A 4QT2A 2YSIA 4LAVA 4DRMA 2D9FA 3JYJA 4G50A 1JNTA 3NRKA 5HW6A 1Q1CA 2DG9A 1EQ3A 4LAWA 3O5JA 1BL4A 2XP7A 3O5FA 2AWGA 4FN2A 3L4HA 2ZR4A 2BA1A 3TDBA 1TCOC 1R9HA 1FJDA 2OFNA 2DK1A 3O5KA 4TW6A 5HT1A 2DG3A 4DRQA 3PA7A 1FKRA 4IQ2A 1FKFA 2DWVA 4DIPA 4J4NA 4DZ2A 3ODKA 1FKJA 2PPNA 2PPPA 1W26A 3CGMA 3KCEA 2UZ5A 4GGQA 4ITZA 2LKNA 3MDYB 5DITA 1KT1A 3UQIA 1JMQA 1FD9A 2MLYA 3UQAA 1JVWA 2MPHA 3RFWA 1L1PA 4DRKA 5AHTA 3OOBA 4N19A 3IHZA 2KI3A 3M7NA 2PV3A 3M85A 2F2DA 1EG4A 2RUCA 4ODMA 1D6OA 3O5LA 1K9QA 2MNTA 1J4HA 1FKBA 2XP4A 2FAPA 4TX0A 4O2TA 4ODPA 4TW8A 2ZQSA 4ODRA 2FKEA 2PBCA 3B7XA 3KAHA 4W9PA 3IKDA 2MLZA 1FKKA 1KT0A 5CQ2A 1NMVA 1Q6UA 5DIUA 2JZVA 4DRPA 2ZQVA 3O5OA 4E5RA 2Y78A 2L2SA
chains in the Genus database with same CATH superfamily
3ARRA 3MQHA 1CTNA 2YSHA 2DPEA 4LAYA 1TFVA 1WMVA 1B6CA 3B9AA 1N1AA 1TK7A 2DK7A 2YSFA 4Z2JA 2XP9A 1ZBKA 3NI6A 1NSGA 2KE0A 2MF9A 4QZVB 1ZU8A 1W1VA 4S3KA 1C9HA 1XHGA 2RUDA 2B5UB 3O5RA 2RSEA 3CHDA 1NH6A 2LGOA 4P8WA 3G6MA 4FAPA 1HKIA 2OLHA 5HWCA 3O5PA 1A7XA 1ZB5A 3ARWA 5U47A 3B9DA 1QPLA 2JXWA 1ROUA 4G2PA 1UR8A 2KGJA 1SYTA 4JFIA 3WL0A 2K8IA 1FFQA 4U84A 4U86A 1LL6A 2DT3A 3EY6A 4DRHA 1FAPA 2A3EA 4DRNA 5HKGA 3WQVA 2EULA 2JMFA 4W5UA 4DWSC 4ZPWR 2ZQUA 1FKHA 4MNJA 3KAGA 1RP5A 3RGCA 3I6CA 1JNSA 4DWSB 1D7JA 1J4IA 1YATA 4WKFA 1GPFA 1NWSA 4DROA 2ESCA 3WD2A 1E44A 2DG4A 1WNOA 2IUZA 2P4VA 1W9PA 1VF8A 4TW7A 5E62A 4ODKA 4W9OA 4UDMA 2ZAJA 1HKKA 1FKSA 4JFMA 1E15A 1XRVA 3MCBA 4BF8A 1FKTA 2ZR5A 1EG3A 5GPGA 2YSGA 4A0UA 5HUAA 3KZ7A 2LAJA 5DEZA 2RE3A 2PV1A 1E6ZA 5DO2A 3BXWA 2ITKA 1PINA 3KAFA 5HWBA 3LE4A 1W1TA 3TCZA 2DJYA 2VCDA 4Q7NA 2M3OW 3WH0A 2M8JA 2LJ4A 2E45A 1ZCNA 2JX8A 2LPVA 5D75A 4LGXA 3CGNA 3KAIA 4DZ3A 1F40A 3JXVA 2YBTA 2WLYA 3CHCA 4DH0A 1LL4A 3CHFA 1D2KA 2XPBA 2F4EA 2WM0A 1E6NA 1FLCA 3ARXA 3AQUA 4J4OA 3FY1A 1W1YA 5J6EA 1ZK6A 2FDMA 3PRDA 3NTPA 4MNMA 4DRIA 1D7IA 3H9RB 3FSBA 5HW8A 3LKXB 3RM9A 2RUQA 1X6NA 1JCHB 4NNRA 2WLZA 2M2AA 1H0GA 1M5YA 3O5DA 5I98A 1K9TA 1EYMA 4HBEA 2N87A 4L3NA 1E6PA 3LUOA 1P5QA 4NZCA 4LAXA 4TNSA 3VAWA 1J6YA 4DWSD 2KO7A 3O5MA 1ZBWA 4TYOA 1PBKA 1Y0OA 4S3JA 4WKAA 2IF4A 2A3CA 2QF8A 3ARTA 1ROTA 1GOIA 4ODOA 2KR7A 1FFRA 1RD6A 2MDIA 2XPAA 2MLXA 1HJVA 1NWUA 3KABA 1SR0A 2WADA 4Z2HA 2PPOA 2M8IA 1J4RA 1HXVA 5DF0A 3PR9A 2F21A 4DWSA 4QIBA 4Z2GA 3ARYA 4GIVA 4IPXA 4IT4A 1Q6HA 4JFKA 1FKIA 5DIVA 2VN1A 3B8SA 1IX5A 4AY1A 3KADA 2DT1A 4ZPTR 4W9QA 2YSBA 3ARSA 3PRAA 4JFJA 5BXJA 1LL7A 4JYSA 1FKLA 2KXQA 3CNGA 1Q6IA 2ETNA 1QZ2A 4R0XA 5B8IC 3CHEA 4C02B 2WK2A 4HARA 2B31A 4ODNA 1E9LA 3UI6A 3WQWA 5E66A 3RM8A 3UQBA 3IK8A 4ZS6A 4P8XA 3KACA 3WD0A 1ZL1A 2DSUA 4Z2IA 3O5QA 2AOSA 2KFWA 4MPKA 3AROA 3MQGA 2XP8A 1O6WA 3ARQA 1NMWA 5GPRA 1NWRA 3O5GA 1D7HA 3UF8A 1I5HW 3WD1A 2PV2A 3WIJA 1T11A 3AS2A 2ZQTA 4XAKA 2XP6A 3TC5A 1LQ0A 2Q5AA 1EDQA 2JV4A 2YBUA 2M1IA 4P8VA 4JFLA 3PRBA 4KQZA 3FXYA 1X6LA 2RQSA 5E65A 2EZ5W 4KR0B 4ODLA 3ARUA 3O5EA 4HBOA 3WL1A 1U79A 3FAPA 1NWTA 2DMVA 1FKDA 2XP3A 2PI6A 4NSBA 1QPFA 4IT6A 4QT3A 3MCBB 1YW5A 3ARZA 4MGVA 1BKFA 4MSPA 4ODQA 4IQCA 4Q22A 3UI4A 3ALGA 1GUVA 1K9RA 2A3BA 1F8AB 2DSVA 4REXA 4DT4A 3AS1A 4P8UA 3GPKA 2L4JA 2XP5A 3O5IA 1WR7A 3AS0A 1FKGA 2M08A 5HW7A 1E6RA 2RURA 2ZR6A 4U85A 1W9VA 3AS3A 4GLXA 3JYMA 4DRJA 1HKJA 1TR8A 3IKGA 3BMBA 5GQBA 2DSWA 5HTGA 4WJXA 1ZBCA 4ZPVR 3UI5A 2OWOA 1LG2A 1JNEA 4QT2A 2YSIA 4LAVA 4L72B 2D9FA 3JYJA 4G50A 4DRMA 1JNTA 3NRKA 5HW6A 1Q1CA 4WIWA 2DG9A 1EQ3A 4LAWA 3O5JA 1BL4A 4MTVA 2PN0A 2XP7A 1KFWA 3O5FA 4R5EA 2AWGA 4FN2A 3L4HA 2ZR4A 2BA1A 3TDBA 2DT0A 1TCOC 1R9HA 4ML4A 1FJDA 2OFNA 3B9EA 2DK1A 3FSCA 3O5KA 4TW6A 3CZ8A 4WK9A 5HT1A 3W4RA 2DG3A 4DRQA 4WKHA 2O92A 3PA7A 1FKRA 1WAWA 4IQ2A 1FKFA 2O9OA 2DWVA 4DIPA 4J4NA 4DZ2A 3ODKA 1EIBA 1FKJA 1UR9A 2PPNA 1ITXA 3ARVA 2PPPA 1W26A 1HJXA 3CGMA 3KCEA 4MNLA 3RMEA 2UZ5A 3WD3A 3ARPA 4GGQA 4ITZA 2LKNA 1HJWA 1HKMA 1WB0A 2DSZA 3MDYB 5HBFA 5DITA 3OA5A 2F23A 4A0TA 2YAJB 1KT1A 3ALFA 3UQIA 5E64A 1JMQA 1FD9A 2MLYA 3UQAA 1JVWA 2MPHA 3RFWA 1L1PA 4DRKA 1O6IA 2G8ZA 5AHTA 3GTYX 1ZBVA 3OOBA 1LG1A 4PTMA 4N19A 3G6LA 3IHZA 2KI3A 3QOKA 3LKXA 5E5WA 3M7NA 2PV3A 3M85A 2F2DA 4URIA 1EG4A 2WAEA 2RUCA 1W1PA 2G41A 4ODMA 4Z2LA 1D6OA 3FS8A 1K9QA 3O5LA 2MNTA 1J4HA 4MNKA 1FKBA 2XP4A 2FAPA 4TX0A 2Y8NB 4O2TA 4ODPA 1EHNA 3CH9A 4TW8A 3WD4A 1GRJA 2ZQSA 4MAVA 1JNDA 2A3AA 1OGGA 1OWQA 4ODRA 2FKEA 1OGBA 2PBCA 2QRVA 1W9UA 3B7XA 3KAHA 2DT2A 4W9PA 3IKDA 2MLZA 3RM4A 1FKKA 1KT0A 1LJYA 5CQ2A 1NMVA 4Z2KA 1Q6UA 5DIUA 2JZVA 4DRPA 2ZQVA 3O5OA 4E5RA 3GU0A 3EIPA 2Y78A 3PQHA 1H0IA 3WKZA 5JH8A 2L2SA
chains in the Genus database with same CATH topology
3ARRA 3MQHA 1CTNA 2YSHA 2DPEA 4LAYA 1TFVA 1WMVA 1B6CA 3B9AA 1N1AA 1TK7A 2DK7A 2YSFA 4Z2JA 2XP9A 1ZBKA 3NI6A 1NSGA 2KE0A 2MF9A 4QZVB 1ZU8A 1W1VA 4S3KA 1C9HA 1XHGA 2RUDA 3O5RA 2RSEA 3CHDA 1NH6A 2LGOA 4P8WA 3G6MA 4FAPA 1HKIA 2OLHA 5HWCA 3O5PA 1A7XA 1ZB5A 3ARWA 5U47A 3B9DA 1QPLA 2JXWA 1ROUA 4G2PA 1UR8A 2KGJA 1SYTA 4JFIA 3WL0A 2K8IA 1FFQA 4U84A 4U86A 1LL6A 2DT3A 3EY6A 4DRHA 1FAPA 2A3EA 4DRNA 5HKGA 3WQVA 2JMFA 4W5UA 4DWSC 4ZPWR 2ZQUA 1FKHA 4MNJA 3KAGA 1RP5A 3RGCA 3I6CA 1JNSA 4DWSB 1D7JA 1J4IA 1YATA 4WKFA 1GPFA 1NWSA 4DROA 2ESCA 3WD2A 2DG4A 1WNOA 2IUZA 1W9PA 1VF8A 4TW7A 5E62A 4ODKA 4W9OA 2ZAJA 1HKKA 1FKSA 4JFMA 1E15A 1XRVA 3MCBA 4BF8A 1FKTA 2ZR5A 1EG3A 5GPGA 2YSGA 4A0UA 5HUAA 3KZ7A 2LAJA 5DEZA 2RE3A 2PV1A 1E6ZA 5DO2A 3BXWA 2ITKA 1PINA 3KAFA 5HWBA 3LE4A 1W1TA 3TCZA 2DJYA 2VCDA 4Q7NA 2M3OW 3WH0A 2M8JA 2LJ4A 2E45A 1ZCNA 2JX8A 2LPVA 5D75A 4LGXA 3CGNA 3KAIA 4DZ3A 1F40A 3JXVA 2YBTA 2WLYA 3CHCA 4DH0A 1LL4A 3CHFA 1D2KA 2XPBA 2F4EA 2WM0A 1E6NA 1FLCA 3ARXA 3AQUA 4J4OA 3FY1A 1W1YA 5J6EA 1ZK6A 2FDMA 3PRDA 3NTPA 4MNMA 4DRIA 1D7IA 3H9RB 3FSBA 5HW8A 3LKXB 3RM9A 2RUQA 1X6NA 4NNRA 2WLZA 2M2AA 1H0GA 1M5YA 3O5DA 5I98A 1K9TA 1EYMA 4HBEA 2N87A 4L3NA 1E6PA 3LUOA 1P5QA 4NZCA 4LAXA 4TNSA 3VAWA 1J6YA 4DWSD 2KO7A 3O5MA 1ZBWA 4TYOA 1PBKA 1Y0OA 4S3JA 4WKAA 2IF4A 2A3CA 2QF8A 3ARTA 1ROTA 1GOIA 4ODOA 2KR7A 1FFRA 1RD6A 2MDIA 2XPAA 2MLXA 1HJVA 1NWUA 3KABA 1SR0A 2WADA 4Z2HA 2PPOA 2M8IA 1J4RA 1HXVA 5DF0A 3PR9A 2F21A 4DWSA 4QIBA 4Z2GA 3ARYA 4GIVA 4IPXA 4IT4A 1Q6HA 4JFKA 1FKIA 5DIVA 2VN1A 3B8SA 1IX5A 4AY1A 3KADA 2DT1A 4ZPTR 4W9QA 2YSBA 3ARSA 3PRAA 4JFJA 5BXJA 1LL7A 4JYSA 1FKLA 2KXQA 3CNGA 1Q6IA 1QZ2A 4R0XA 5B8IC 3CHEA 4C02B 2WK2A 4HARA 2B31A 4ODNA 1E9LA 3UI6A 3WQWA 5E66A 3RM8A 3UQBA 3IK8A 4ZS6A 4P8XA 3KACA 3WD0A 1ZL1A 2DSUA 4Z2IA 3O5QA 2AOSA 2KFWA 4MPKA 3AROA 3MQGA 2XP8A 1O6WA 3ARQA 1NMWA 5GPRA 1NWRA 3O5GA 1D7HA 3UF8A 1I5HW 3WD1A 2PV2A 3WIJA 1T11A 3AS2A 2ZQTA 4XAKA 2XP6A 3TC5A 1LQ0A 2Q5AA 1EDQA 2JV4A 2YBUA 2M1IA 4P8VA 4JFLA 3PRBA 4KQZA 3FXYA 1X6LA 2RQSA 5E65A 2EZ5W 4KR0B 4ODLA 3ARUA 3O5EA 4HBOA 3WL1A 1U79A 3FAPA 1NWTA 2DMVA 1FKDA 2XP3A 2PI6A 4NSBA 1QPFA 4IT6A 4QT3A 3MCBB 1YW5A 3ARZA 4MGVA 1BKFA 4MSPA 4ODQA 4IQCA 4Q22A 3UI4A 3ALGA 1GUVA 1K9RA 2A3BA 1F8AB 2DSVA 4REXA 4DT4A 3AS1A 4P8UA 3GPKA 2L4JA 2XP5A 3O5IA 1WR7A 3AS0A 1FKGA 2M08A 5HW7A 1E6RA 2RURA 2ZR6A 4U85A 1W9VA 3AS3A 4GLXA 3JYMA 4DRJA 1HKJA 1TR8A 3IKGA 5GQBA 2DSWA 5HTGA 4WJXA 1ZBCA 4ZPVR 3UI5A 2OWOA 1LG2A 1JNEA 4QT2A 2YSIA 4LAVA 4L72B 2D9FA 3JYJA 4G50A 4DRMA 1JNTA 3NRKA 5HW6A 1Q1CA 4WIWA 2DG9A 1EQ3A 4LAWA 3O5JA 1BL4A 4MTVA 2XP7A 1KFWA 3O5FA 4R5EA 2AWGA 4FN2A 3L4HA 2ZR4A 2BA1A 3TDBA 2DT0A 1TCOC 1R9HA 4ML4A 1FJDA 2OFNA 3B9EA 2DK1A 3FSCA 3O5KA 4TW6A 3CZ8A 4WK9A 5HT1A 3W4RA 2DG3A 4DRQA 4WKHA 2O92A 3PA7A 1FKRA 1WAWA 4IQ2A 1FKFA 2O9OA 2DWVA 4DIPA 4J4NA 4DZ2A 3ODKA 1EIBA 1FKJA 1UR9A 2PPNA 1ITXA 3ARVA 2PPPA 1W26A 1HJXA 3CGMA 3KCEA 4MNLA 3RMEA 2UZ5A 3WD3A 3ARPA 4GGQA 4ITZA 2LKNA 1HJWA 1HKMA 1WB0A 2DSZA 3MDYB 5HBFA 5DITA 3OA5A 4A0TA 2YAJB 1KT1A 3ALFA 3UQIA 5E64A 1JMQA 1FD9A 2MLYA 3UQAA 1JVWA 2MPHA 3RFWA 1L1PA 4DRKA 1O6IA 2G8ZA 5AHTA 1ZBVA 3OOBA 1LG1A 4PTMA 4N19A 3G6LA 3IHZA 2KI3A 3QOKA 3LKXA 5E5WA 3M7NA 2PV3A 3M85A 2F2DA 4URIA 1EG4A 2WAEA 2RUCA 1W1PA 2G41A 4ODMA 4Z2LA 1D6OA 3FS8A 1K9QA 3O5LA 2MNTA 1J4HA 4MNKA 1FKBA 2XP4A 2FAPA 4TX0A 2Y8NB 4O2TA 4ODPA 1EHNA 3CH9A 4TW8A 3WD4A 2ZQSA 4MAVA 1JNDA 2A3AA 1OGGA 1OWQA 4ODRA 2FKEA 1OGBA 2PBCA 2QRVA 1W9UA 3B7XA 3KAHA 2DT2A 4W9PA 3IKDA 2MLZA 3RM4A 1FKKA 1KT0A 1LJYA 5CQ2A 1NMVA 4Z2KA 1Q6UA 5DIUA 2JZVA 4DRPA 2ZQVA 3O5OA 4E5RA 2Y78A 3PQHA 1H0IA 3WKZA 5JH8A 2L2SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YSH A;  4LAY A;  1WMV A;  1B6C A;  1N1A A;  1TK7 A;  2DK7 A;  2YSF A;  2XP9 A;  3NI6 A;  1NSG A;  2KE0 A;  2MF9 A;  1C9H A;  2RUD A;  3O5R A;  2RSE A;  2LGO A;  4FAP A;  5HWC A;  3O5P A;  1A7X A;  1QPL A;  2JXW A;  1ROU A;  4G2P A;  2KGJ A;  4JFI A;  2K8I A;  4U84 A;  4U86 A;  3EY6 A;  4DRH A;  1FAP A;  4DRN A;  5HKG A;  2JMF A;  2ZQU A;  1FKH A;  3KAG A;  3RGC A;  3I6C A;  1JNS A;  1D7J A;  1J4I A;  1YAT A;  4DRO A;  2DG4 A;  4TW7 A;  4W9O A;  4ODK A;  2ZAJ A;  1FKS A;  4JFM A;  4BF8 A;  1FKT A;  2ZR5 A;  1EG3 A;  5GPG A;  2YSG A;  5HUA A;  3KZ7 A;  2LAJ A;  2RE3 A;  2PV1 A;  2ITK A;  1PIN A;  3KAF A;  5HWB A;  3LE4 A;  3TCZ A;  2DJY A;  2VCD A;  2M3O W;  3WH0 A;  2M8J A;  2LJ4 A;  2E45 A;  1ZCN A;  2JX8 A;  2LPV A;  5D75 A;  3CGN A;  3KAI A;  4DZ3 A;  1F40 A;  3JXV A;  4DH0 A;  2XPB A;  2F4E A;  4J4O A;  5J6E A;  1ZK6 A;  3PRD A;  4DRI A;  3NTP A;  1D7I A;  3H9R B;  5HW8 A;  2RUQ A;  4NNR A;  2M2A A;  1M5Y A;  3O5D A;  5I98 A;  1EYM A;  2N87 A;  3LUO A;  1P5Q A;  3VAW A;  4LAX A;  4TNS A;  1J6Y A;  2KO7 A;  3O5M A;  4TYO A;  1PBK A;  1Y0O A;  2IF4 A;  1ROT A;  4ODO A;  2KR7 A;  2MDI A;  2XPA A;  2MLX A;  3KAB A;  2PPO A;  2M8I A;  1J4R A;  1HXV A;  2F21 A;  4QIB A;  4GIV A;  4IPX A;  1Q6H A;  4JFK A;  1FKI A;  5DIV A;  2VN1 A;  3KAD A;  4W9Q A;  2YSB A;  4JFJ A;  5BXJ A;  4JYS A;  1FKL A;  2KXQ A;  3CNG A;  1Q6I A;  1QZ2 A;  4R0X A;  5B8I C;  4C02 B;  4ODN A;  3UI6 A;  3UQB A;  3IK8 A;  3KAC A;  3O5Q A;  2KFW A;  2XP8 A;  1O6W A;  1NMW A;  3O5G A;  1D7H A;  3UF8 A;  1I5H W;  2PV2 A;  1T11 A;  2ZQT A;  2XP6 A;  3TC5 A;  2Q5A A;  2JV4 A;  2M1I A;  4JFL A;  3PRB A;  2RQS A;  2EZ5 W;  4ODL A;  3O5E A;  1U79 A;  3FAP A;  2DMV A;  1FKD A;  2XP3 A;  1QPF A;  4QT3 A;  1YW5 A;  4MGV A;  1BKF A;  4MSP A;  4ODQ A;  4IQC A;  3UI4 A;  1K9R A;  1F8A B;  4REX A;  4DT4 A;  3GPK A;  2L4J A;  2XP5 A;  3O5I A;  1WR7 A;  1FKG A;  2M08 A;  5HW7 A;  2RUR A;  2ZR6 A;  4U85 A;  3JYM A;  4DRJ A;  3IKG A;  5HTG A;  3UI5 A;  4QT2 A;  2YSI A;  4LAV A;  4DRM A;  2D9F A;  3JYJ A;  4G50 A;  1JNT A;  3NRK A;  5HW6 A;  1Q1C A;  2DG9 A;  1EQ3 A;  4LAW A;  3O5J A;  1BL4 A;  2XP7 A;  3O5F A;  2AWG A;  4FN2 A;  3L4H A;  2ZR4 A;  2BA1 A;  3TDB A;  1TCO C;  1R9H A;  1FJD A;  2OFN A;  2DK1 A;  3O5K A;  4TW6 A;  5HT1 A;  2DG3 A;  4DRQ A;  3PA7 A;  1FKR A;  4IQ2 A;  1FKF A;  2DWV A;  4DIP A;  4J4N A;  4DZ2 A;  3ODK A;  1FKJ A;  2PPN A;  2PPP A;  1W26 A;  3CGM A;  3KCE A;  2UZ5 A;  4GGQ A;  4ITZ A;  2LKN A;  3MDY B;  5DIT A;  1KT1 A;  3UQI A;  1JMQ A;  1FD9 A;  2MLY A;  3UQA A;  1JVW A;  2MPH A;  3RFW A;  1L1P A;  4DRK A;  5AHT A;  3OOB A;  4N19 A;  3IHZ A;  2KI3 A;  3M7N A;  2PV3 A;  3M85 A;  2F2D A;  1EG4 A;  2RUC A;  4ODM A;  1D6O A;  3O5L A;  1K9Q A;  2MNT A;  1J4H A;  1FKB A;  2XP4 A;  2FAP A;  4TX0 A;  4O2T A;  4ODP A;  4TW8 A;  2ZQS A;  4ODR A;  2FKE A;  2PBC A;  3B7X A;  3KAH A;  4W9P A;  3IKD A;  2MLZ A;  1FKK A;  1KT0 A;  5CQ2 A;  1NMV A;  1Q6U A;  5DIU A;  2JZV A;  4DRP A;  2ZQV A;  3O5O A;  4E5R A;  2Y78 A;  2L2S A; 
#chains in the Genus database with same CATH topology
 3ARR A;  3MQH A;  1CTN A;  2YSH A;  2DPE A;  4LAY A;  1TFV A;  1WMV A;  1B6C A;  3B9A A;  1N1A A;  1TK7 A;  2DK7 A;  2YSF A;  4Z2J A;  2XP9 A;  1ZBK A;  3NI6 A;  1NSG A;  2KE0 A;  2MF9 A;  4QZV B;  1ZU8 A;  1W1V A;  4S3K A;  1C9H A;  1XHG A;  2RUD A;  2B5U B;  3O5R A;  2RSE A;  3CHD A;  1NH6 A;  2LGO A;  4P8W A;  3G6M A;  4FAP A;  1HKI A;  2OLH A;  5HWC A;  3O5P A;  1A7X A;  1ZB5 A;  3ARW A;  5U47 A;  3B9D A;  1QPL A;  2JXW A;  1ROU A;  4G2P A;  1UR8 A;  2KGJ A;  1SYT A;  4JFI A;  3WL0 A;  2K8I A;  1FFQ A;  4U84 A;  4U86 A;  1LL6 A;  2DT3 A;  3EY6 A;  4DRH A;  1FAP A;  2A3E A;  4DRN A;  5HKG A;  3WQV A;  2EUL A;  2JMF A;  4W5U A;  4DWS C;  4ZPW R;  2ZQU A;  1FKH A;  4MNJ A;  3KAG A;  1RP5 A;  3RGC A;  3I6C A;  1JNS A;  4DWS B;  1D7J A;  1J4I A;  1YAT A;  4WKF A;  1GPF A;  1NWS A;  4DRO A;  2ESC A;  3WD2 A;  1E44 A;  2DG4 A;  1WNO A;  2IUZ A;  2P4V A;  1W9P A;  1VF8 A;  4TW7 A;  5E62 A;  4ODK A;  4W9O A;  4UDM A;  2ZAJ A;  1HKK A;  1FKS A;  4JFM A;  1E15 A;  1XRV A;  3MCB A;  4BF8 A;  1FKT A;  2ZR5 A;  1EG3 A;  5GPG A;  2YSG A;  4A0U A;  5HUA A;  3KZ7 A;  2LAJ A;  5DEZ A;  2RE3 A;  2PV1 A;  1E6Z A;  5DO2 A;  3BXW A;  2ITK A;  1PIN A;  3KAF A;  5HWB A;  3LE4 A;  1W1T A;  3TCZ A;  2DJY A;  2VCD A;  4Q7N A;  2M3O W;  3WH0 A;  2M8J A;  2LJ4 A;  2E45 A;  1ZCN A;  2JX8 A;  2LPV A;  5D75 A;  4LGX A;  3CGN A;  3KAI A;  4DZ3 A;  1F40 A;  3JXV A;  2YBT A;  2WLY A;  3CHC A;  4DH0 A;  1LL4 A;  3CHF A;  1D2K A;  2XPB A;  2F4E A;  2WM0 A;  1E6N A;  1FLC A;  3ARX A;  3AQU A;  4J4O A;  3FY1 A;  1W1Y A;  5J6E A;  1ZK6 A;  2FDM A;  3PRD A;  3NTP A;  4MNM A;  4DRI A;  1D7I A;  3H9R B;  3FSB A;  5HW8 A;  3LKX B;  3RM9 A;  2RUQ A;  1X6N A;  1JCH B;  4NNR A;  2WLZ A;  2M2A A;  1H0G A;  1M5Y A;  3O5D A;  5I98 A;  1K9T A;  1EYM A;  4HBE A;  2N87 A;  4L3N A;  1E6P A;  3LUO A;  1P5Q A;  4NZC A;  4LAX A;  4TNS A;  3VAW A;  1J6Y A;  4DWS D;  2KO7 A;  3O5M A;  1ZBW A;  4TYO A;  1PBK A;  1Y0O A;  4S3J A;  4WKA A;  2IF4 A;  2A3C A;  2QF8 A;  3ART A;  1ROT A;  1GOI A;  4ODO A;  2KR7 A;  1FFR A;  1RD6 A;  2MDI A;  2XPA A;  2MLX A;  1HJV A;  1NWU A;  3KAB A;  1SR0 A;  2WAD A;  4Z2H A;  2PPO A;  2M8I A;  1J4R A;  1HXV A;  5DF0 A;  3PR9 A;  2F21 A;  4DWS A;  4QIB A;  4Z2G A;  3ARY A;  4GIV A;  4IPX A;  4IT4 A;  1Q6H A;  4JFK A;  1FKI A;  5DIV A;  2VN1 A;  3B8S A;  1IX5 A;  4AY1 A;  3KAD A;  2DT1 A;  4ZPT R;  4W9Q A;  2YSB A;  3ARS A;  3PRA A;  4JFJ A;  5BXJ A;  1LL7 A;  4JYS A;  1FKL A;  2KXQ A;  3CNG A;  1Q6I A;  2ETN A;  1QZ2 A;  4R0X A;  5B8I C;  3CHE A;  4C02 B;  2WK2 A;  4HAR A;  2B31 A;  4ODN A;  1E9L A;  3UI6 A;  3WQW A;  5E66 A;  3RM8 A;  3UQB A;  3IK8 A;  4ZS6 A;  4P8X A;  3KAC A;  3WD0 A;  1ZL1 A;  2DSU A;  4Z2I A;  3O5Q A;  2AOS A;  2KFW A;  4MPK A;  3ARO A;  3MQG A;  2XP8 A;  1O6W A;  3ARQ A;  1NMW A;  5GPR A;  1NWR A;  3O5G A;  1D7H A;  3UF8 A;  1I5H W;  3WD1 A;  2PV2 A;  3WIJ A;  1T11 A;  3AS2 A;  2ZQT A;  4XAK A;  2XP6 A;  3TC5 A;  1LQ0 A;  2Q5A A;  1EDQ A;  2JV4 A;  2YBU A;  2M1I A;  4P8V A;  4JFL A;  3PRB A;  4KQZ A;  3FXY A;  1X6L A;  2RQS A;  5E65 A;  2EZ5 W;  4KR0 B;  4ODL A;  3ARU A;  3O5E A;  4HBO A;  3WL1 A;  1U79 A;  3FAP A;  1NWT A;  2DMV A;  1FKD A;  2XP3 A;  2PI6 A;  4NSB A;  1QPF A;  4IT6 A;  4QT3 A;  3MCB B;  1YW5 A;  3ARZ A;  4MGV A;  1BKF A;  4MSP A;  4ODQ A;  4IQC A;  4Q22 A;  3UI4 A;  3ALG A;  1GUV A;  1K9R A;  2A3B A;  1F8A B;  2DSV A;  4REX A;  4DT4 A;  3AS1 A;  4P8U A;  3GPK A;  2L4J A;  2XP5 A;  3O5I A;  1WR7 A;  3AS0 A;  1FKG A;  2M08 A;  5HW7 A;  1E6R A;  2RUR A;  2ZR6 A;  4U85 A;  1W9V A;  3AS3 A;  4GLX A;  3JYM A;  4DRJ A;  1HKJ A;  1TR8 A;  3IKG A;  3BMB A;  5GQB A;  2DSW A;  5HTG A;  4WJX A;  1ZBC A;  4ZPV R;  3UI5 A;  2OWO A;  1LG2 A;  1JNE A;  4QT2 A;  2YSI A;  4LAV A;  4L72 B;  2D9F A;  3JYJ A;  4G50 A;  4DRM A;  1JNT A;  3NRK A;  5HW6 A;  1Q1C A;  4WIW A;  2DG9 A;  1EQ3 A;  4LAW A;  3O5J A;  1BL4 A;  4MTV A;  2PN0 A;  2XP7 A;  1KFW A;  3O5F A;  4R5E A;  2AWG A;  4FN2 A;  3L4H A;  2ZR4 A;  2BA1 A;  3TDB A;  2DT0 A;  1TCO C;  1R9H A;  4ML4 A;  1FJD A;  2OFN A;  3B9E A;  2DK1 A;  3FSC A;  3O5K A;  4TW6 A;  3CZ8 A;  4WK9 A;  5HT1 A;  3W4R A;  2DG3 A;  4DRQ A;  4WKH A;  2O92 A;  3PA7 A;  1FKR A;  1WAW A;  4IQ2 A;  1FKF A;  2O9O A;  2DWV A;  4DIP A;  4J4N A;  4DZ2 A;  3ODK A;  1EIB A;  1FKJ A;  1UR9 A;  2PPN A;  1ITX A;  3ARV A;  2PPP A;  1W26 A;  1HJX A;  3CGM A;  3KCE A;  4MNL A;  3RME A;  2UZ5 A;  3WD3 A;  3ARP A;  4GGQ A;  4ITZ A;  2LKN A;  1HJW A;  1HKM A;  1WB0 A;  2DSZ A;  3MDY B;  5HBF A;  5DIT A;  3OA5 A;  2F23 A;  4A0T A;  2YAJ B;  1KT1 A;  3ALF A;  3UQI A;  5E64 A;  1JMQ A;  1FD9 A;  2MLY A;  3UQA A;  1JVW A;  2MPH A;  3RFW A;  1L1P A;  4DRK A;  1O6I A;  2G8Z A;  5AHT A;  3GTY X;  1ZBV A;  3OOB A;  1LG1 A;  4PTM A;  4N19 A;  3G6L A;  3IHZ A;  2KI3 A;  3QOK A;  3LKX A;  5E5W A;  3M7N A;  2PV3 A;  3M85 A;  2F2D A;  4URI A;  1EG4 A;  2WAE A;  2RUC A;  1W1P A;  2G41 A;  4ODM A;  4Z2L A;  1D6O A;  3FS8 A;  1K9Q A;  3O5L A;  2MNT A;  1J4H A;  4MNK A;  1FKB A;  2XP4 A;  2FAP A;  4TX0 A;  2Y8N B;  4O2T A;  4ODP A;  1EHN A;  3CH9 A;  4TW8 A;  3WD4 A;  1GRJ A;  2ZQS A;  4MAV A;  1JND A;  2A3A A;  1OGG A;  1OWQ A;  4ODR A;  2FKE A;  1OGB A;  2PBC A;  2QRV A;  1W9U A;  3B7X A;  3KAH A;  2DT2 A;  4W9P A;  3IKD A;  2MLZ A;  3RM4 A;  1FKK A;  1KT0 A;  1LJY A;  5CQ2 A;  1NMV A;  4Z2K A;  1Q6U A;  5DIU A;  2JZV A;  4DRP A;  2ZQV A;  3O5O A;  4E5R A;  3GU0 A;  3EIP A;  2Y78 A;  3PQH A;  1H0I A;  3WKZ A;  5JH8 A;  2L2S A; 
#chains in the Genus database with same CATH homology
 3ARR A;  3MQH A;  1CTN A;  2YSH A;  2DPE A;  4LAY A;  1TFV A;  1WMV A;  1B6C A;  3B9A A;  1N1A A;  1TK7 A;  2DK7 A;  2YSF A;  4Z2J A;  2XP9 A;  1ZBK A;  3NI6 A;  1NSG A;  2KE0 A;  2MF9 A;  4QZV B;  1ZU8 A;  1W1V A;  4S3K A;  1C9H A;  1XHG A;  2RUD A;  3O5R A;  2RSE A;  3CHD A;  1NH6 A;  2LGO A;  4P8W A;  3G6M A;  4FAP A;  1HKI A;  2OLH A;  5HWC A;  3O5P A;  1A7X A;  1ZB5 A;  3ARW A;  5U47 A;  3B9D A;  1QPL A;  2JXW A;  1ROU A;  4G2P A;  1UR8 A;  2KGJ A;  1SYT A;  4JFI A;  3WL0 A;  2K8I A;  1FFQ A;  4U84 A;  4U86 A;  1LL6 A;  2DT3 A;  3EY6 A;  4DRH A;  1FAP A;  2A3E A;  4DRN A;  5HKG A;  3WQV A;  2JMF A;  4W5U A;  4DWS C;  4ZPW R;  2ZQU A;  1FKH A;  4MNJ A;  3KAG A;  1RP5 A;  3RGC A;  3I6C A;  1JNS A;  4DWS B;  1D7J A;  1J4I A;  1YAT A;  4WKF A;  1GPF A;  1NWS A;  4DRO A;  2ESC A;  3WD2 A;  2DG4 A;  1WNO A;  2IUZ A;  1W9P A;  1VF8 A;  4TW7 A;  5E62 A;  4ODK A;  4W9O A;  2ZAJ A;  1HKK A;  1FKS A;  4JFM A;  1E15 A;  1XRV A;  3MCB A;  4BF8 A;  1FKT A;  2ZR5 A;  1EG3 A;  5GPG A;  2YSG A;  4A0U A;  5HUA A;  3KZ7 A;  2LAJ A;  5DEZ A;  2RE3 A;  2PV1 A;  1E6Z A;  5DO2 A;  3BXW A;  2ITK A;  1PIN A;  3KAF A;  5HWB A;  3LE4 A;  1W1T A;  3TCZ A;  2DJY A;  2VCD A;  4Q7N A;  2M3O W;  3WH0 A;  2M8J A;  2LJ4 A;  2E45 A;  1ZCN A;  2JX8 A;  2LPV A;  5D75 A;  4LGX A;  3CGN A;  3KAI A;  4DZ3 A;  1F40 A;  3JXV A;  2YBT A;  2WLY A;  3CHC A;  4DH0 A;  1LL4 A;  3CHF A;  1D2K A;  2XPB A;  2F4E A;  2WM0 A;  1E6N A;  1FLC A;  3ARX A;  3AQU A;  4J4O A;  3FY1 A;  1W1Y A;  5J6E A;  1ZK6 A;  2FDM A;  3PRD A;  3NTP A;  4MNM A;  4DRI A;  1D7I A;  3H9R B;  3FSB A;  5HW8 A;  3LKX B;  3RM9 A;  2RUQ A;  1X6N A;  4NNR A;  2WLZ A;  2M2A A;  1H0G A;  1M5Y A;  3O5D A;  5I98 A;  1K9T A;  1EYM A;  4HBE A;  2N87 A;  4L3N A;  1E6P A;  3LUO A;  1P5Q A;  4NZC A;  4LAX A;  4TNS A;  3VAW A;  1J6Y A;  4DWS D;  2KO7 A;  3O5M A;  1ZBW A;  4TYO A;  1PBK A;  1Y0O A;  4S3J A;  4WKA A;  2IF4 A;  2A3C A;  2QF8 A;  3ART A;  1ROT A;  1GOI A;  4ODO A;  2KR7 A;  1FFR A;  1RD6 A;  2MDI A;  2XPA A;  2MLX A;  1HJV A;  1NWU A;  3KAB A;  1SR0 A;  2WAD A;  4Z2H A;  2PPO A;  2M8I A;  1J4R A;  1HXV A;  5DF0 A;  3PR9 A;  2F21 A;  4DWS A;  4QIB A;  4Z2G A;  3ARY A;  4GIV A;  4IPX A;  4IT4 A;  1Q6H A;  4JFK A;  1FKI A;  5DIV A;  2VN1 A;  3B8S A;  1IX5 A;  4AY1 A;  3KAD A;  2DT1 A;  4ZPT R;  4W9Q A;  2YSB A;  3ARS A;  3PRA A;  4JFJ A;  5BXJ A;  1LL7 A;  4JYS A;  1FKL A;  2KXQ A;  3CNG A;  1Q6I A;  1QZ2 A;  4R0X A;  5B8I C;  3CHE A;  4C02 B;  2WK2 A;  4HAR A;  2B31 A;  4ODN A;  1E9L A;  3UI6 A;  3WQW A;  5E66 A;  3RM8 A;  3UQB A;  3IK8 A;  4ZS6 A;  4P8X A;  3KAC A;  3WD0 A;  1ZL1 A;  2DSU A;  4Z2I A;  3O5Q A;  2AOS A;  2KFW A;  4MPK A;  3ARO A;  3MQG A;  2XP8 A;  1O6W A;  3ARQ A;  1NMW A;  5GPR A;  1NWR A;  3O5G A;  1D7H A;  3UF8 A;  1I5H W;  3WD1 A;  2PV2 A;  3WIJ A;  1T11 A;  3AS2 A;  2ZQT A;  4XAK A;  2XP6 A;  3TC5 A;  1LQ0 A;  2Q5A A;  1EDQ A;  2JV4 A;  2YBU A;  2M1I A;  4P8V A;  4JFL A;  3PRB A;  4KQZ A;  3FXY A;  1X6L A;  2RQS A;  5E65 A;  2EZ5 W;  4KR0 B;  4ODL A;  3ARU A;  3O5E A;  4HBO A;  3WL1 A;  1U79 A;  3FAP A;  1NWT A;  2DMV A;  1FKD A;  2XP3 A;  2PI6 A;  4NSB A;  1QPF A;  4IT6 A;  4QT3 A;  3MCB B;  1YW5 A;  3ARZ A;  4MGV A;  1BKF A;  4MSP A;  4ODQ A;  4IQC A;  4Q22 A;  3UI4 A;  3ALG A;  1GUV A;  1K9R A;  2A3B A;  1F8A B;  2DSV A;  4REX A;  4DT4 A;  3AS1 A;  4P8U A;  3GPK A;  2L4J A;  2XP5 A;  3O5I A;  1WR7 A;  3AS0 A;  1FKG A;  2M08 A;  5HW7 A;  1E6R A;  2RUR A;  2ZR6 A;  4U85 A;  1W9V A;  3AS3 A;  4GLX A;  3JYM A;  4DRJ A;  1HKJ A;  1TR8 A;  3IKG A;  5GQB A;  2DSW A;  5HTG A;  4WJX A;  1ZBC A;  4ZPV R;  3UI5 A;  2OWO A;  1LG2 A;  1JNE A;  4QT2 A;  2YSI A;  4LAV A;  4L72 B;  2D9F A;  3JYJ A;  4G50 A;  4DRM A;  1JNT A;  3NRK A;  5HW6 A;  1Q1C A;  4WIW A;  2DG9 A;  1EQ3 A;  4LAW A;  3O5J A;  1BL4 A;  4MTV A;  2XP7 A;  1KFW A;  3O5F A;  4R5E A;  2AWG A;  4FN2 A;  3L4H A;  2ZR4 A;  2BA1 A;  3TDB A;  2DT0 A;  1TCO C;  1R9H A;  4ML4 A;  1FJD A;  2OFN A;  3B9E A;  2DK1 A;  3FSC A;  3O5K A;  4TW6 A;  3CZ8 A;  4WK9 A;  5HT1 A;  3W4R A;  2DG3 A;  4DRQ A;  4WKH A;  2O92 A;  3PA7 A;  1FKR A;  1WAW A;  4IQ2 A;  1FKF A;  2O9O A;  2DWV A;  4DIP A;  4J4N A;  4DZ2 A;  3ODK A;  1EIB A;  1FKJ A;  1UR9 A;  2PPN A;  1ITX A;  3ARV A;  2PPP A;  1W26 A;  1HJX A;  3CGM A;  3KCE A;  4MNL A;  3RME A;  2UZ5 A;  3WD3 A;  3ARP A;  4GGQ A;  4ITZ A;  2LKN A;  1HJW A;  1HKM A;  1WB0 A;  2DSZ A;  3MDY B;  5HBF A;  5DIT A;  3OA5 A;  4A0T A;  2YAJ B;  1KT1 A;  3ALF A;  3UQI A;  5E64 A;  1JMQ A;  1FD9 A;  2MLY A;  3UQA A;  1JVW A;  2MPH A;  3RFW A;  1L1P A;  4DRK A;  1O6I A;  2G8Z A;  5AHT A;  1ZBV A;  3OOB A;  1LG1 A;  4PTM A;  4N19 A;  3G6L A;  3IHZ A;  2KI3 A;  3QOK A;  3LKX A;  5E5W A;  3M7N A;  2PV3 A;  3M85 A;  2F2D A;  4URI A;  1EG4 A;  2WAE A;  2RUC A;  1W1P A;  2G41 A;  4ODM A;  4Z2L A;  1D6O A;  3FS8 A;  1K9Q A;  3O5L A;  2MNT A;  1J4H A;  4MNK A;  1FKB A;  2XP4 A;  2FAP A;  4TX0 A;  2Y8N B;  4O2T A;  4ODP A;  1EHN A;  3CH9 A;  4TW8 A;  3WD4 A;  2ZQS A;  4MAV A;  1JND A;  2A3A A;  1OGG A;  1OWQ A;  4ODR A;  2FKE A;  1OGB A;  2PBC A;  2QRV A;  1W9U A;  3B7X A;  3KAH A;  2DT2 A;  4W9P A;  3IKD A;  2MLZ A;  3RM4 A;  1FKK A;  1KT0 A;  1LJY A;  5CQ2 A;  1NMV A;  4Z2K A;  1Q6U A;  5DIU A;  2JZV A;  4DRP A;  2ZQV A;  3O5O A;  4E5R A;  2Y78 A;  3PQH A;  1H0I A;  3WKZ A;  5JH8 A;  2L2S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...