3WH0A

Structure of pin1 complex with 18-crown-6
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
157
structure length
145
Chain Sequence
b'LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Crowning Proteins: Modulating the Protein Surface Properties using Crown Ethers.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 46
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3wh0A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3wh0A02
3TDBA 4LAVA 4ITZA 1D7IA 2D9FA 4REXA 2DG4A 4G2PA 2XP9A 5HTGA 2K8IA 1FKKA 1EG3A 2LAJA 3KCEA 3UI6A 2ZQUA 2AWGA 5GPGA 3UF8A 2MLXA 1K9QA 4GGQA 2UZ5A 2PV3A 2ZR4A 2ZQVA 3L4HA 3O5LA 2MF9A 3O5JA 4IQCA 1BKFA 2YSFA 3JXVA 2OFNA 5BXJA 5HWCA 1F40A 4DIPA 2DJYA 1U79A 1ROTA 4ODRA 2EZ5W 2KR7A 5J6EA 3OOBA 2LKNA 5DIUA 2L4JA 3I6CA 5I98A 2JXWA 1NSGA 3B7XA 4ODPA 4DT4A 4W9QA 1FKSA 2FKEA 3IKDA 2KGJA 4DRPA 3O5FA 2XP4A 1T11A 2XP6A 1Q1CA 2VN1A 3FAPA 2DG9A 3KABA 2M3OW 1FKDA 1D7JA 5HW7A 2MDIA 4W9PA 3KAHA 3RFWA 1EG4A 3UQIA 2PBCA 4ODNA 3KAGA 3O5MA 4JFLA 1PINA 4DH0A 3O5OA 4J4OA 5DITA 2F4EA 3TCZA 4ODOA 2YSGA 1YATA 4LAXA 4ODKA 3PRBA 2RUQA 3M7NA 2ZQTA 1WMVA 2RUDA 1FKGA 1J6YA 2PV2A 2ZR6A 1ROUA 4E5RA 2PPNA 2XP3A 2BA1A 2MLZA 1FKRA 2DK1A 3LUOA 1W26A 3RGCA 4JFKA 1I5HW 4TW6A 5B8IC 2YSIA 2PV1A 4LAYA 3NRKA 3IHZA 1J4RA 1J4IA 4U84A 1Q6HA 2RSEA 5D75A 1F8AB 5AHTA 3MDYB 3PA7A 4C02B 3H9RB 1B6CA 2YSBA 1FKTA 4W9OA 4TNSA 5HKGA 1Q6UA 3O5GA 4DROA 2M2AA 1FJDA 2N87A 1FAPA 3UI4A 2F2DA 2KXQA 2ZR5A 1KT1A 3NTPA 1JNTA 2LPVA 2XPBA 1EYMA 1HXVA 4MGVA 1A7XA 3EY6A 1QPLA 1JNSA 3UQAA 1NMWA 3GPKA 1ZCNA 1KT0A 2Y78A 1ZK6A 2RE3A 4DRMA 4JFIA 1M5YA 3KACA 4NNRA 4DRIA 3M85A 2Q5AA 2ZAJA 4TYOA 5HWBA 2XP8A 3IKGA 1TK7A 2PPPA 2XPAA 3CNGA 4IPXA 2RURA 4TX0A 3O5QA 4TW7A 2PPOA 4DRKA 2MNTA 1FKBA 2JZVA 2FAPA 1FKIA 3VAWA 1NMVA 1J4HA 1FD9A 3UQBA 2LGOA 4LAWA 3CGMA 2M08A 2DG3A 2RQSA 3ODKA 3KAFA 4ODLA 1K9RA 4JFJA 2XP5A 1FKLA 2LJ4A 3CGNA 4N19A 1TCOC 2M1IA 1WR7A 2L2SA 2E45A 3O5PA 2KFWA 4DZ2A 2DK7A 3KAIA 3JYMA 2JX8A 2MPHA 2ZQSA 4MSPA 1QPFA 4DRNA 4ODMA 4FN2A 4J4NA 3IK8A 1Q6IA 1P5QA 3O5DA 1FKHA 2KE0A 3PRDA 3LE4A 4BF8A 2JMFA 1FKFA 2DWVA 2KI3A 4JYSA 1Y0OA 3UI5A 5CQ2A 4DRJA 2MLYA 4TW8A 2KO7A 2M8IA 5HW6A 3WH0A 1D6OA 1JVWA 1N1AA 1O6WA 1QZ2A 3O5KA 4QT3A 2XP7A 4QT2A 4U85A 5HUAA 5HW8A 1FKJA 4IQ2A 1D7HA 2JV4A 3O5IA 3NI6A 3O5EA 5DIVA 4JFMA 4ODQA 1EQ3A 1JMQA 2YSHA 1BL4A 4U86A 4DZ3A 4G50A 3O5RA 1L1PA 2F21A 4QIBA 3TC5A 1YW5A 4GIVA 4FAPA 2VCDA 2M8JA 4O2TA 2IF4A 4DRQA 3JYJA 3KZ7A 1C9HA 2ITKA 4DRHA 3KADA 2DMVA 1R9HA 1PBKA 5HT1A 2RUCA 4R0XA
chains in the Genus database with same CATH superfamily
3TDBA 4LAVA 1ZL1A 5GPRA 1RP5A 5E65A 1WAWA 2O92A 4ITZA 1CTNA 4Z2KA 1W1YA 3G6LA 4IT6A 2A3EA 1D7IA 2DSUA 1OGGA 2D9FA 1H0IA 4REXA 1HKKA 2DG4A 4G2PA 1GPFA 2XP9A 3FSBA 5HTGA 3MQHA 2K8IA 1FKKA 4S3KA 1EG3A 4L3NA 2LAJA 2ESCA 3KCEA 4HBOA 3UI6A 2ZQUA 2AWGA 1NH6A 5GPGA 3UF8A 1FFRA 1K9QA 2DPEA 2MLXA 4GGQA 1TR8A 2UZ5A 3ALGA 2PV3A 3ARPA 3WD3A 2ZR4A 2ZQVA 3L4HA 3ARSA 3O5LA 1HKMA 1NWSA 4WIWA 2MF9A 1K9TA 3O5JA 1ZBCA 1W1TA 4IQCA 4S3JA 1BKFA 2OLHA 3CHCA 4ML4A 2PN0A 2YSFA 3JXVA 3WD4A 2OFNA 5BXJA 5HWCA 1F40A 3G6MA 5E62A 4DIPA 2DJYA 4WKAA 1U79A 4L72B 1ROTA 4ODRA 2EZ5W 3RM8A 1RD6A 2B31A 5U47A 1E6RA 1ZU8A 1XRVA 2KR7A 4Q7NA 3OOBA 5J6EA 4ZPVR 4MPKA 4WKFA 2WK2A 2LKNA 3MQGA 3RMEA 5DIUA 2L4JA 3I6CA 1EIBA 1E9LA 1W9PA 4XAKA 2B5UB 3FXYA 3WD2A 5I98A 5HBFA 2JXWA 3B8SA 4HARA 1NSGA 1X6NA 3B7XA 4ODPA 2QF8A 4MNLA 1E6ZA 3WL0A 4DT4A 2QRVA 4W9QA 1FKSA 2FKEA 3IKDA 4GLXA 1LL4A 2KGJA 4DRPA 1HKIA 3O5FA 5E5WA 2XP4A 1T11A 2XP6A 1Q1CA 2G41A 2Y8NB 2VN1A 3FAPA 2DG9A 3KABA 2WLZA 2M3OW 5DF0A 3OA5A 1FFQA 1FKDA 2G8ZA 1HJWA 1D7JA 5HW7A 3CH9A 2MDIA 4NSBA 3KAHA 4W9PA 1SYTA 3RFWA 1EG4A 3UQIA 2PBCA 4ODNA 2WADA 1X6LA 4URIA 2WAEA 2WM0A 3KAGA 3O5MA 4ZPWR 4A0TA 4JFLA 1PINA 3LKXB 4DH0A 3O5OA 3FY1A 4J4OA 5DITA 2F4EA 1E6PA 4WK9A 3TCZA 3ARUA 4P8XA 4ODOA 3W4RA 2YSGA 1YATA 4A0UA 5E64A 4LAXA 4ODKA 3ARTA 3PRBA 2RUQA 3M7NA 2YBUA 1E6NA 2ZQTA 1WMVA 2RUDA 4Z2LA 3WQWA 1FKGA 1J6YA 2PV2A 4IT4A 1KFWA 2ZR6A 1XHGA 1ROUA 2P4VA 4E5RA 2PPNA 2XP3A 2BA1A 2MLZA 1FKRA 1W9VA 2DK1A 3BMBA 3LUOA 3FS8A 3LKXA 1W26A 1W1PA 4ZPTR 3RGCA 3MCBB 1ZBKA 4JFKA 1I5HW 4TW6A 1LG2A 4MNMA 5B8IC 2YSIA 2PV1A 4LAYA 3NRKA 1UR9A 3IHZA 1J4RA 2DT2A 4W5UA 3EIPA 2A3CA 3CHEA 1J4IA 1ITXA 4U84A 4MNJA 1Q6HA 1LG1A 2RSEA 3ARVA 5D75A 1F8AB 5AHTA 4MTVA 3MDYB 3PA7A 4C02B 3H9RB 1H0GA 3QOKA 4WKHA 3B9EA 1B6CA 2YSBA 3ARQA 1FKTA 4W9OA 3MCBA 4TNSA 2DT3A 5HKGA 1UR8A 2ETNA 2A3AA 1Q6UA 1HJXA 3O5GA 4DROA 2AOSA 2M2AA 4P8VA 1FJDA 2N87A 4LGXA 1FAPA 3UI4A 1NWTA 4MAVA 3WD0A 2F2DA 3FSCA 3PR9A 1GRJA 2KXQA 2ZR5A 1SR0A 1D2KA 1KT1A 3NTPA 1JNTA 2LPVA 2XPBA 1EYMA 1HXVA 4MGVA 1A7XA 3EY6A 1QPLA 1OWQA 3AS0A 2IUZA 1JNSA 3UQAA 1NMWA 5GQBA 3GPKA 3RM9A 1ZCNA 2DT1A 1KT0A 2Y78A 1ZK6A 2RE3A 4DRMA 4JFIA 4AY1A 1M5YA 1O6IA 3KACA 4NNRA 3GTYX 4DRIA 3PQHA 3AQUA 3M85A 2Q5AA 2ZAJA 4TYOA 5HWBA 2XP8A 3IKGA 3RM4A 3ARZA 3B9AA 4DWSD 1TK7A 2PPPA 2XPAA 3CNGA 4HBEA 2DSVA 1W1VA 4IPXA 2WLYA 2RURA 3B9DA 3CHFA 4TX0A 3O5QA 4TW7A 2PPOA 4DRKA 2MNTA 4KQZA 1FKBA 2JZVA 2FAPA 2PI6A 1FKIA 4PTMA 3VAWA 1NMVA 1J4HA 1TFVA 1FD9A 3UQBA 2LGOA 4LAWA 3CGMA 2M08A 2DG3A 2RQSA 3ODKA 4DWSB 3KAFA 4ODLA 1K9RA 4JFJA 2XP5A 1FKLA 2LJ4A 3CGNA 1EHNA 4N19A 4NZCA 1TCOC 5E66A 2M1IA 1WR7A 1LL7A 2L2SA 2E45A 3AS3A 3O5PA 3ARRA 2O9OA 4KR0B 2KFWA 3WIJA 4DZ2A 2DK7A 3KAIA 3BXWA 1NWUA 3JYMA 2JX8A 1LQ0A 4Z2GA 2MPHA 1E15A 4Q22A 2ZQSA 4MSPA 2OWOA 1ZB5A 1QPFA 4DRNA 1JCHB 4DWSC 4ODMA 1IX5A 4ZS6A 1WNOA 2FDMA 4R5EA 4FN2A 3WKZA 1WB0A 4J4NA 3ARYA 3IK8A 3WL1A 4Z2JA 4Z2IA 4QZVB 1Q6IA 1HKJA 1P5QA 4DWSA 3O5DA 3WD1A 1FKHA 1HJVA 2YAJB 2KE0A 3PRDA 3LE4A 4BF8A 4Z2HA 2JMFA 1LL6A 1FKFA 3ALFA 2DT0A 2DWVA 2KI3A 4JYSA 3AS1A 4UDMA 1Y0OA 4P8WA 3UI5A 5CQ2A 4DRJA 2MLYA 1ZBWA 4TW8A 2KO7A 2M8IA 4WJXA 3ARXA 5HW6A 5DEZA 3WH0A 2EULA 3CHDA 1D6OA 1JVWA 1N1AA 1JNDA 1W9UA 2F23A 1O6WA 1OGBA 4P8UA 1QZ2A 3O5KA 4QT3A 2XP7A 4QT2A 4U85A 1JNEA 5HUAA 5HW8A 1FKJA 4IQ2A 1FLCA 1D7HA 2JV4A 3O5IA 3NI6A 3O5EA 5DIVA 3ARWA 4JFMA 5DO2A 2A3BA 1EDQA 5JH8A 1LJYA 1VF8A 4ODQA 1JMQA 1EQ3A 2YSHA 2YBTA 1BL4A 1E44A 4U86A 1GUVA 4DZ3A 1NWRA 4G50A 3WQVA 1GOIA 3AS2A 3O5RA 1L1PA 2F21A 4QIBA 3TC5A 1YW5A 4GIVA 4MNKA 2DSZA 4FAPA 2VCDA 2M8JA 4O2TA 2IF4A 4DRQA 3JYJA 3KZ7A 1C9HA 3GU0A 2ITKA 3AROA 3KADA 4DRHA 2DMVA 1R9HA 3CZ8A 3PRAA 1ZBVA 1PBKA 2DSWA 5HT1A 2RUCA 4R0XA
chains in the Genus database with same CATH topology
3TDBA 4LAVA 1ZL1A 5GPRA 1RP5A 5E65A 1WAWA 2O92A 4ITZA 1CTNA 4Z2KA 1W1YA 3G6LA 4IT6A 2A3EA 1D7IA 2DSUA 1OGGA 2D9FA 1H0IA 4REXA 1HKKA 2DG4A 4G2PA 1GPFA 2XP9A 3FSBA 5HTGA 3MQHA 2K8IA 1FKKA 4S3KA 1EG3A 4L3NA 2LAJA 2ESCA 3KCEA 4HBOA 3UI6A 2ZQUA 2AWGA 1NH6A 5GPGA 3UF8A 1FFRA 1K9QA 2DPEA 2MLXA 4GGQA 1TR8A 2UZ5A 3ALGA 2PV3A 3ARPA 3WD3A 2ZR4A 2ZQVA 3L4HA 3ARSA 3O5LA 1HKMA 1NWSA 4WIWA 2MF9A 1K9TA 3O5JA 1ZBCA 1W1TA 4IQCA 4S3JA 1BKFA 2OLHA 3CHCA 4ML4A 2YSFA 3JXVA 3WD4A 2OFNA 5BXJA 5HWCA 1F40A 3G6MA 5E62A 4DIPA 2DJYA 4WKAA 1U79A 4L72B 1ROTA 4ODRA 2EZ5W 3RM8A 1RD6A 2B31A 5U47A 1E6RA 1ZU8A 1XRVA 2KR7A 4Q7NA 3OOBA 5J6EA 4ZPVR 4MPKA 4WKFA 2WK2A 2LKNA 3MQGA 3RMEA 5DIUA 2L4JA 3I6CA 1EIBA 1E9LA 1W9PA 4XAKA 3FXYA 3WD2A 5I98A 5HBFA 2JXWA 3B8SA 4HARA 1NSGA 1X6NA 3B7XA 4ODPA 2QF8A 4MNLA 1E6ZA 3WL0A 4DT4A 2QRVA 4W9QA 1FKSA 2FKEA 3IKDA 4GLXA 1LL4A 2KGJA 4DRPA 1HKIA 3O5FA 5E5WA 2XP4A 1T11A 2XP6A 1Q1CA 2G41A 2Y8NB 2VN1A 3FAPA 2DG9A 3KABA 2WLZA 2M3OW 5DF0A 3OA5A 1FFQA 1FKDA 2G8ZA 1HJWA 1D7JA 5HW7A 3CH9A 2MDIA 4NSBA 3KAHA 4W9PA 1SYTA 3RFWA 1EG4A 3UQIA 2PBCA 4ODNA 2WADA 1X6LA 4URIA 2WAEA 2WM0A 3KAGA 3O5MA 4ZPWR 4A0TA 4JFLA 1PINA 3LKXB 4DH0A 3O5OA 3FY1A 4J4OA 5DITA 2F4EA 1E6PA 4WK9A 3TCZA 3ARUA 4P8XA 4ODOA 3W4RA 2YSGA 1YATA 4A0UA 5E64A 4LAXA 4ODKA 3ARTA 3PRBA 2RUQA 3M7NA 2YBUA 1E6NA 2ZQTA 1WMVA 2RUDA 4Z2LA 3WQWA 1FKGA 1J6YA 2PV2A 4IT4A 1KFWA 2ZR6A 1XHGA 1ROUA 4E5RA 2PPNA 2XP3A 2BA1A 2MLZA 1FKRA 1W9VA 2DK1A 3LUOA 3FS8A 3LKXA 1W26A 1W1PA 4ZPTR 3RGCA 3MCBB 1ZBKA 4JFKA 1I5HW 4TW6A 1LG2A 4MNMA 5B8IC 2YSIA 2PV1A 4LAYA 3NRKA 1UR9A 3IHZA 1J4RA 2DT2A 4W5UA 2A3CA 3CHEA 1J4IA 1ITXA 4U84A 4MNJA 1Q6HA 1LG1A 2RSEA 3ARVA 5D75A 1F8AB 5AHTA 4MTVA 3MDYB 3PA7A 4C02B 3H9RB 1H0GA 3QOKA 4WKHA 3B9EA 1B6CA 2YSBA 3ARQA 1FKTA 4W9OA 3MCBA 4TNSA 2DT3A 5HKGA 1UR8A 2A3AA 1Q6UA 1HJXA 3O5GA 4DROA 2AOSA 2M2AA 4P8VA 1FJDA 2N87A 4LGXA 1FAPA 3UI4A 1NWTA 4MAVA 3WD0A 2F2DA 3FSCA 3PR9A 2KXQA 2ZR5A 1SR0A 1D2KA 1KT1A 3NTPA 1JNTA 2LPVA 2XPBA 1EYMA 1HXVA 4MGVA 1A7XA 3EY6A 1QPLA 1OWQA 3AS0A 2IUZA 1JNSA 3UQAA 1NMWA 5GQBA 3GPKA 3RM9A 1ZCNA 2DT1A 1KT0A 2Y78A 1ZK6A 2RE3A 4DRMA 4JFIA 4AY1A 1M5YA 1O6IA 3KACA 4NNRA 4DRIA 3PQHA 3AQUA 3M85A 2Q5AA 2ZAJA 4TYOA 5HWBA 2XP8A 3IKGA 3RM4A 3ARZA 3B9AA 4DWSD 1TK7A 2PPPA 2XPAA 3CNGA 4HBEA 2DSVA 1W1VA 4IPXA 2WLYA 2RURA 3B9DA 3CHFA 4TX0A 3O5QA 4TW7A 2PPOA 4DRKA 2MNTA 4KQZA 1FKBA 2JZVA 2FAPA 2PI6A 1FKIA 4PTMA 3VAWA 1NMVA 1J4HA 1TFVA 1FD9A 3UQBA 2LGOA 4LAWA 3CGMA 2M08A 2DG3A 2RQSA 3ODKA 4DWSB 3KAFA 4ODLA 1K9RA 4JFJA 2XP5A 1FKLA 2LJ4A 3CGNA 1EHNA 4N19A 4NZCA 1TCOC 5E66A 2M1IA 1WR7A 1LL7A 2L2SA 2E45A 3AS3A 3O5PA 3ARRA 2O9OA 4KR0B 2KFWA 3WIJA 4DZ2A 2DK7A 3KAIA 3BXWA 1NWUA 3JYMA 2JX8A 1LQ0A 4Z2GA 2MPHA 1E15A 4Q22A 2ZQSA 4MSPA 2OWOA 1ZB5A 1QPFA 4DRNA 4DWSC 4ODMA 1IX5A 4ZS6A 1WNOA 2FDMA 4R5EA 4FN2A 3WKZA 1WB0A 4J4NA 3ARYA 3IK8A 3WL1A 4Z2JA 4Z2IA 4QZVB 1Q6IA 1HKJA 1P5QA 4DWSA 3O5DA 3WD1A 1FKHA 1HJVA 2YAJB 2KE0A 3PRDA 3LE4A 4BF8A 4Z2HA 2JMFA 1LL6A 1FKFA 3ALFA 2DT0A 2DWVA 2KI3A 4JYSA 3AS1A 1Y0OA 4P8WA 3UI5A 5CQ2A 4DRJA 2MLYA 1ZBWA 4TW8A 2KO7A 2M8IA 4WJXA 3ARXA 5HW6A 5DEZA 3WH0A 3CHDA 1D6OA 1JVWA 1N1AA 1JNDA 1W9UA 1O6WA 1OGBA 4P8UA 1QZ2A 3O5KA 4QT3A 2XP7A 4QT2A 4U85A 1JNEA 5HUAA 5HW8A 1FKJA 4IQ2A 1FLCA 1D7HA 2JV4A 3O5IA 3NI6A 3O5EA 5DIVA 3ARWA 4JFMA 5DO2A 2A3BA 1EDQA 5JH8A 1LJYA 1VF8A 4ODQA 1JMQA 1EQ3A 2YSHA 2YBTA 1BL4A 4U86A 1GUVA 4DZ3A 1NWRA 4G50A 3WQVA 1GOIA 3AS2A 3O5RA 1L1PA 2F21A 4QIBA 3TC5A 1YW5A 4GIVA 4MNKA 2DSZA 4FAPA 2VCDA 2M8JA 4O2TA 2IF4A 4DRQA 3JYJA 3KZ7A 1C9HA 2ITKA 3AROA 3KADA 4DRHA 2DMVA 1R9HA 3CZ8A 3PRAA 1ZBVA 1PBKA 2DSWA 5HT1A 2RUCA 4R0XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TDB A;  4LAV A;  4ITZ A;  1D7I A;  2D9F A;  4REX A;  2DG4 A;  4G2P A;  2XP9 A;  5HTG A;  2K8I A;  1FKK A;  1EG3 A;  2LAJ A;  3KCE A;  3UI6 A;  2ZQU A;  2AWG A;  5GPG A;  3UF8 A;  2MLX A;  1K9Q A;  4GGQ A;  2UZ5 A;  2PV3 A;  2ZR4 A;  2ZQV A;  3L4H A;  3O5L A;  2MF9 A;  3O5J A;  4IQC A;  1BKF A;  2YSF A;  3JXV A;  2OFN A;  5BXJ A;  5HWC A;  1F40 A;  4DIP A;  2DJY A;  1U79 A;  1ROT A;  4ODR A;  2EZ5 W;  2KR7 A;  5J6E A;  3OOB A;  2LKN A;  5DIU A;  2L4J A;  3I6C A;  5I98 A;  2JXW A;  1NSG A;  3B7X A;  4ODP A;  4DT4 A;  4W9Q A;  1FKS A;  2FKE A;  3IKD A;  2KGJ A;  4DRP A;  3O5F A;  2XP4 A;  1T11 A;  2XP6 A;  1Q1C A;  2VN1 A;  3FAP A;  2DG9 A;  3KAB A;  2M3O W;  1FKD A;  1D7J A;  5HW7 A;  2MDI A;  4W9P A;  3KAH A;  3RFW A;  1EG4 A;  3UQI A;  2PBC A;  4ODN A;  3KAG A;  3O5M A;  4JFL A;  1PIN A;  4DH0 A;  3O5O A;  4J4O A;  5DIT A;  2F4E A;  3TCZ A;  4ODO A;  2YSG A;  1YAT A;  4LAX A;  4ODK A;  3PRB A;  2RUQ A;  3M7N A;  2ZQT A;  1WMV A;  2RUD A;  1FKG A;  1J6Y A;  2PV2 A;  2ZR6 A;  1ROU A;  4E5R A;  2PPN A;  2XP3 A;  2BA1 A;  2MLZ A;  1FKR A;  2DK1 A;  3LUO A;  1W26 A;  3RGC A;  4JFK A;  1I5H W;  4TW6 A;  5B8I C;  2YSI A;  2PV1 A;  4LAY A;  3NRK A;  3IHZ A;  1J4R A;  1J4I A;  4U84 A;  1Q6H A;  2RSE A;  5D75 A;  1F8A B;  5AHT A;  3MDY B;  3PA7 A;  4C02 B;  3H9R B;  1B6C A;  2YSB A;  1FKT A;  4W9O A;  4TNS A;  5HKG A;  1Q6U A;  3O5G A;  4DRO A;  2M2A A;  1FJD A;  2N87 A;  1FAP A;  3UI4 A;  2F2D A;  2KXQ A;  2ZR5 A;  1KT1 A;  3NTP A;  1JNT A;  2LPV A;  2XPB A;  1EYM A;  1HXV A;  4MGV A;  1A7X A;  3EY6 A;  1QPL A;  1JNS A;  3UQA A;  1NMW A;  3GPK A;  1ZCN A;  1KT0 A;  2Y78 A;  1ZK6 A;  2RE3 A;  4DRM A;  4JFI A;  1M5Y A;  3KAC A;  4NNR A;  4DRI A;  3M85 A;  2Q5A A;  2ZAJ A;  4TYO A;  5HWB A;  2XP8 A;  3IKG A;  1TK7 A;  2PPP A;  2XPA A;  3CNG A;  4IPX A;  2RUR A;  4TX0 A;  3O5Q A;  4TW7 A;  2PPO A;  4DRK A;  2MNT A;  1FKB A;  2JZV A;  2FAP A;  1FKI A;  3VAW A;  1NMV A;  1J4H A;  1FD9 A;  3UQB A;  2LGO A;  4LAW A;  3CGM A;  2M08 A;  2DG3 A;  2RQS A;  3ODK A;  3KAF A;  4ODL A;  1K9R A;  4JFJ A;  2XP5 A;  1FKL A;  2LJ4 A;  3CGN A;  4N19 A;  1TCO C;  2M1I A;  1WR7 A;  2L2S A;  2E45 A;  3O5P A;  2KFW A;  4DZ2 A;  2DK7 A;  3KAI A;  3JYM A;  2JX8 A;  2MPH A;  2ZQS A;  4MSP A;  1QPF A;  4DRN A;  4ODM A;  4FN2 A;  4J4N A;  3IK8 A;  1Q6I A;  1P5Q A;  3O5D A;  1FKH A;  2KE0 A;  3PRD A;  3LE4 A;  4BF8 A;  2JMF A;  1FKF A;  2DWV A;  2KI3 A;  4JYS A;  1Y0O A;  3UI5 A;  5CQ2 A;  4DRJ A;  2MLY A;  4TW8 A;  2KO7 A;  2M8I A;  5HW6 A;  3WH0 A;  1D6O A;  1JVW A;  1N1A A;  1O6W A;  1QZ2 A;  3O5K A;  4QT3 A;  2XP7 A;  4QT2 A;  4U85 A;  5HUA A;  5HW8 A;  1FKJ A;  4IQ2 A;  1D7H A;  2JV4 A;  3O5I A;  3NI6 A;  3O5E A;  5DIV A;  4JFM A;  4ODQ A;  1EQ3 A;  1JMQ A;  2YSH A;  1BL4 A;  4U86 A;  4DZ3 A;  4G50 A;  3O5R A;  1L1P A;  2F21 A;  4QIB A;  3TC5 A;  1YW5 A;  4GIV A;  4FAP A;  2VCD A;  2M8J A;  4O2T A;  2IF4 A;  4DRQ A;  3JYJ A;  3KZ7 A;  1C9H A;  2ITK A;  4DRH A;  3KAD A;  2DMV A;  1R9H A;  1PBK A;  5HT1 A;  2RUC A;  4R0X A; 
#chains in the Genus database with same CATH topology
 3TDB A;  4LAV A;  1ZL1 A;  5GPR A;  1RP5 A;  5E65 A;  1WAW A;  2O92 A;  4ITZ A;  1CTN A;  4Z2K A;  1W1Y A;  3G6L A;  4IT6 A;  2A3E A;  1D7I A;  2DSU A;  1OGG A;  2D9F A;  1H0I A;  4REX A;  1HKK A;  2DG4 A;  4G2P A;  1GPF A;  2XP9 A;  3FSB A;  5HTG A;  3MQH A;  2K8I A;  1FKK A;  4S3K A;  1EG3 A;  4L3N A;  2LAJ A;  2ESC A;  3KCE A;  4HBO A;  3UI6 A;  2ZQU A;  2AWG A;  1NH6 A;  5GPG A;  3UF8 A;  1FFR A;  1K9Q A;  2DPE A;  2MLX A;  4GGQ A;  1TR8 A;  2UZ5 A;  3ALG A;  2PV3 A;  3ARP A;  3WD3 A;  2ZR4 A;  2ZQV A;  3L4H A;  3ARS A;  3O5L A;  1HKM A;  1NWS A;  4WIW A;  2MF9 A;  1K9T A;  3O5J A;  1ZBC A;  1W1T A;  4IQC A;  4S3J A;  1BKF A;  2OLH A;  3CHC A;  4ML4 A;  2PN0 A;  2YSF A;  3JXV A;  3WD4 A;  2OFN A;  5BXJ A;  5HWC A;  1F40 A;  3G6M A;  5E62 A;  4DIP A;  2DJY A;  4WKA A;  1U79 A;  4L72 B;  1ROT A;  4ODR A;  2EZ5 W;  3RM8 A;  1RD6 A;  2B31 A;  5U47 A;  1E6R A;  1ZU8 A;  1XRV A;  2KR7 A;  4Q7N A;  3OOB A;  5J6E A;  4ZPV R;  4MPK A;  4WKF A;  2WK2 A;  2LKN A;  3MQG A;  3RME A;  5DIU A;  2L4J A;  3I6C A;  1EIB A;  1E9L A;  1W9P A;  4XAK A;  2B5U B;  3FXY A;  3WD2 A;  5I98 A;  5HBF A;  2JXW A;  3B8S A;  4HAR A;  1NSG A;  1X6N A;  3B7X A;  4ODP A;  2QF8 A;  4MNL A;  1E6Z A;  3WL0 A;  4DT4 A;  2QRV A;  4W9Q A;  1FKS A;  2FKE A;  3IKD A;  4GLX A;  1LL4 A;  2KGJ A;  4DRP A;  1HKI A;  3O5F A;  5E5W A;  2XP4 A;  1T11 A;  2XP6 A;  1Q1C A;  2G41 A;  2Y8N B;  2VN1 A;  3FAP A;  2DG9 A;  3KAB A;  2WLZ A;  2M3O W;  5DF0 A;  3OA5 A;  1FFQ A;  1FKD A;  2G8Z A;  1HJW A;  1D7J A;  5HW7 A;  3CH9 A;  2MDI A;  4NSB A;  3KAH A;  4W9P A;  1SYT A;  3RFW A;  1EG4 A;  3UQI A;  2PBC A;  4ODN A;  2WAD A;  1X6L A;  4URI A;  2WAE A;  2WM0 A;  3KAG A;  3O5M A;  4ZPW R;  4A0T A;  4JFL A;  1PIN A;  3LKX B;  4DH0 A;  3O5O A;  3FY1 A;  4J4O A;  5DIT A;  2F4E A;  1E6P A;  4WK9 A;  3TCZ A;  3ARU A;  4P8X A;  4ODO A;  3W4R A;  2YSG A;  1YAT A;  4A0U A;  5E64 A;  4LAX A;  4ODK A;  3ART A;  3PRB A;  2RUQ A;  3M7N A;  2YBU A;  1E6N A;  2ZQT A;  1WMV A;  2RUD A;  4Z2L A;  3WQW A;  1FKG A;  1J6Y A;  2PV2 A;  4IT4 A;  1KFW A;  2ZR6 A;  1XHG A;  1ROU A;  2P4V A;  4E5R A;  2PPN A;  2XP3 A;  2BA1 A;  2MLZ A;  1FKR A;  1W9V A;  2DK1 A;  3BMB A;  3LUO A;  3FS8 A;  3LKX A;  1W26 A;  1W1P A;  4ZPT R;  3RGC A;  3MCB B;  1ZBK A;  4JFK A;  1I5H W;  4TW6 A;  1LG2 A;  4MNM A;  5B8I C;  2YSI A;  2PV1 A;  4LAY A;  3NRK A;  1UR9 A;  3IHZ A;  1J4R A;  2DT2 A;  4W5U A;  3EIP A;  2A3C A;  3CHE A;  1J4I A;  1ITX A;  4U84 A;  4MNJ A;  1Q6H A;  1LG1 A;  2RSE A;  3ARV A;  5D75 A;  1F8A B;  5AHT A;  4MTV A;  3MDY B;  3PA7 A;  4C02 B;  3H9R B;  1H0G A;  3QOK A;  4WKH A;  3B9E A;  1B6C A;  2YSB A;  3ARQ A;  1FKT A;  4W9O A;  3MCB A;  4TNS A;  2DT3 A;  5HKG A;  1UR8 A;  2ETN A;  2A3A A;  1Q6U A;  1HJX A;  3O5G A;  4DRO A;  2AOS A;  2M2A A;  4P8V A;  1FJD A;  2N87 A;  4LGX A;  1FAP A;  3UI4 A;  1NWT A;  4MAV A;  3WD0 A;  2F2D A;  3FSC A;  3PR9 A;  1GRJ A;  2KXQ A;  2ZR5 A;  1SR0 A;  1D2K A;  1KT1 A;  3NTP A;  1JNT A;  2LPV A;  2XPB A;  1EYM A;  1HXV A;  4MGV A;  1A7X A;  3EY6 A;  1QPL A;  1OWQ A;  3AS0 A;  2IUZ A;  1JNS A;  3UQA A;  1NMW A;  5GQB A;  3GPK A;  3RM9 A;  1ZCN A;  2DT1 A;  1KT0 A;  2Y78 A;  1ZK6 A;  2RE3 A;  4DRM A;  4JFI A;  4AY1 A;  1M5Y A;  1O6I A;  3KAC A;  4NNR A;  3GTY X;  4DRI A;  3PQH A;  3AQU A;  3M85 A;  2Q5A A;  2ZAJ A;  4TYO A;  5HWB A;  2XP8 A;  3IKG A;  3RM4 A;  3ARZ A;  3B9A A;  4DWS D;  1TK7 A;  2PPP A;  2XPA A;  3CNG A;  4HBE A;  2DSV A;  1W1V A;  4IPX A;  2WLY A;  2RUR A;  3B9D A;  3CHF A;  4TX0 A;  3O5Q A;  4TW7 A;  2PPO A;  4DRK A;  2MNT A;  4KQZ A;  1FKB A;  2JZV A;  2FAP A;  2PI6 A;  1FKI A;  4PTM A;  3VAW A;  1NMV A;  1J4H A;  1TFV A;  1FD9 A;  3UQB A;  2LGO A;  4LAW A;  3CGM A;  2M08 A;  2DG3 A;  2RQS A;  3ODK A;  4DWS B;  3KAF A;  4ODL A;  1K9R A;  4JFJ A;  2XP5 A;  1FKL A;  2LJ4 A;  3CGN A;  1EHN A;  4N19 A;  4NZC A;  1TCO C;  5E66 A;  2M1I A;  1WR7 A;  1LL7 A;  2L2S A;  2E45 A;  3AS3 A;  3O5P A;  3ARR A;  2O9O A;  4KR0 B;  2KFW A;  3WIJ A;  4DZ2 A;  2DK7 A;  3KAI A;  3BXW A;  1NWU A;  3JYM A;  2JX8 A;  1LQ0 A;  4Z2G A;  2MPH A;  1E15 A;  4Q22 A;  2ZQS A;  4MSP A;  2OWO A;  1ZB5 A;  1QPF A;  4DRN A;  1JCH B;  4DWS C;  4ODM A;  1IX5 A;  4ZS6 A;  1WNO A;  2FDM A;  4R5E A;  4FN2 A;  3WKZ A;  1WB0 A;  4J4N A;  3ARY A;  3IK8 A;  3WL1 A;  4Z2J A;  4Z2I A;  4QZV B;  1Q6I A;  1HKJ A;  1P5Q A;  4DWS A;  3O5D A;  3WD1 A;  1FKH A;  1HJV A;  2YAJ B;  2KE0 A;  3PRD A;  3LE4 A;  4BF8 A;  4Z2H A;  2JMF A;  1LL6 A;  1FKF A;  3ALF A;  2DT0 A;  2DWV A;  2KI3 A;  4JYS A;  3AS1 A;  4UDM A;  1Y0O A;  4P8W A;  3UI5 A;  5CQ2 A;  4DRJ A;  2MLY A;  1ZBW A;  4TW8 A;  2KO7 A;  2M8I A;  4WJX A;  3ARX A;  5HW6 A;  5DEZ A;  3WH0 A;  2EUL A;  3CHD A;  1D6O A;  1JVW A;  1N1A A;  1JND A;  1W9U A;  2F23 A;  1O6W A;  1OGB A;  4P8U A;  1QZ2 A;  3O5K A;  4QT3 A;  2XP7 A;  4QT2 A;  4U85 A;  1JNE A;  5HUA A;  5HW8 A;  1FKJ A;  4IQ2 A;  1FLC A;  1D7H A;  2JV4 A;  3O5I A;  3NI6 A;  3O5E A;  5DIV A;  3ARW A;  4JFM A;  5DO2 A;  2A3B A;  1EDQ A;  5JH8 A;  1LJY A;  1VF8 A;  4ODQ A;  1JMQ A;  1EQ3 A;  2YSH A;  2YBT A;  1BL4 A;  1E44 A;  4U86 A;  1GUV A;  4DZ3 A;  1NWR A;  4G50 A;  3WQV A;  1GOI A;  3AS2 A;  3O5R A;  1L1P A;  2F21 A;  4QIB A;  3TC5 A;  1YW5 A;  4GIV A;  4MNK A;  2DSZ A;  4FAP A;  2VCD A;  2M8J A;  4O2T A;  2IF4 A;  4DRQ A;  3JYJ A;  3KZ7 A;  1C9H A;  3GU0 A;  2ITK A;  3ARO A;  3KAD A;  4DRH A;  2DMV A;  1R9H A;  3CZ8 A;  3PRA A;  1ZBV A;  1PBK A;  2DSW A;  5HT1 A;  2RUC A;  4R0X A; 
#chains in the Genus database with same CATH homology
 3TDB A;  4LAV A;  1ZL1 A;  5GPR A;  1RP5 A;  5E65 A;  1WAW A;  2O92 A;  4ITZ A;  1CTN A;  4Z2K A;  1W1Y A;  3G6L A;  4IT6 A;  2A3E A;  1D7I A;  2DSU A;  1OGG A;  2D9F A;  1H0I A;  4REX A;  1HKK A;  2DG4 A;  4G2P A;  1GPF A;  2XP9 A;  3FSB A;  5HTG A;  3MQH A;  2K8I A;  1FKK A;  4S3K A;  1EG3 A;  4L3N A;  2LAJ A;  2ESC A;  3KCE A;  4HBO A;  3UI6 A;  2ZQU A;  2AWG A;  1NH6 A;  5GPG A;  3UF8 A;  1FFR A;  1K9Q A;  2DPE A;  2MLX A;  4GGQ A;  1TR8 A;  2UZ5 A;  3ALG A;  2PV3 A;  3ARP A;  3WD3 A;  2ZR4 A;  2ZQV A;  3L4H A;  3ARS A;  3O5L A;  1HKM A;  1NWS A;  4WIW A;  2MF9 A;  1K9T A;  3O5J A;  1ZBC A;  1W1T A;  4IQC A;  4S3J A;  1BKF A;  2OLH A;  3CHC A;  4ML4 A;  2YSF A;  3JXV A;  3WD4 A;  2OFN A;  5BXJ A;  5HWC A;  1F40 A;  3G6M A;  5E62 A;  4DIP A;  2DJY A;  4WKA A;  1U79 A;  4L72 B;  1ROT A;  4ODR A;  2EZ5 W;  3RM8 A;  1RD6 A;  2B31 A;  5U47 A;  1E6R A;  1ZU8 A;  1XRV A;  2KR7 A;  4Q7N A;  3OOB A;  5J6E A;  4ZPV R;  4MPK A;  4WKF A;  2WK2 A;  2LKN A;  3MQG A;  3RME A;  5DIU A;  2L4J A;  3I6C A;  1EIB A;  1E9L A;  1W9P A;  4XAK A;  3FXY A;  3WD2 A;  5I98 A;  5HBF A;  2JXW A;  3B8S A;  4HAR A;  1NSG A;  1X6N A;  3B7X A;  4ODP A;  2QF8 A;  4MNL A;  1E6Z A;  3WL0 A;  4DT4 A;  2QRV A;  4W9Q A;  1FKS A;  2FKE A;  3IKD A;  4GLX A;  1LL4 A;  2KGJ A;  4DRP A;  1HKI A;  3O5F A;  5E5W A;  2XP4 A;  1T11 A;  2XP6 A;  1Q1C A;  2G41 A;  2Y8N B;  2VN1 A;  3FAP A;  2DG9 A;  3KAB A;  2WLZ A;  2M3O W;  5DF0 A;  3OA5 A;  1FFQ A;  1FKD A;  2G8Z A;  1HJW A;  1D7J A;  5HW7 A;  3CH9 A;  2MDI A;  4NSB A;  3KAH A;  4W9P A;  1SYT A;  3RFW A;  1EG4 A;  3UQI A;  2PBC A;  4ODN A;  2WAD A;  1X6L A;  4URI A;  2WAE A;  2WM0 A;  3KAG A;  3O5M A;  4ZPW R;  4A0T A;  4JFL A;  1PIN A;  3LKX B;  4DH0 A;  3O5O A;  3FY1 A;  4J4O A;  5DIT A;  2F4E A;  1E6P A;  4WK9 A;  3TCZ A;  3ARU A;  4P8X A;  4ODO A;  3W4R A;  2YSG A;  1YAT A;  4A0U A;  5E64 A;  4LAX A;  4ODK A;  3ART A;  3PRB A;  2RUQ A;  3M7N A;  2YBU A;  1E6N A;  2ZQT A;  1WMV A;  2RUD A;  4Z2L A;  3WQW A;  1FKG A;  1J6Y A;  2PV2 A;  4IT4 A;  1KFW A;  2ZR6 A;  1XHG A;  1ROU A;  4E5R A;  2PPN A;  2XP3 A;  2BA1 A;  2MLZ A;  1FKR A;  1W9V A;  2DK1 A;  3LUO A;  3FS8 A;  3LKX A;  1W26 A;  1W1P A;  4ZPT R;  3RGC A;  3MCB B;  1ZBK A;  4JFK A;  1I5H W;  4TW6 A;  1LG2 A;  4MNM A;  5B8I C;  2YSI A;  2PV1 A;  4LAY A;  3NRK A;  1UR9 A;  3IHZ A;  1J4R A;  2DT2 A;  4W5U A;  2A3C A;  3CHE A;  1J4I A;  1ITX A;  4U84 A;  4MNJ A;  1Q6H A;  1LG1 A;  2RSE A;  3ARV A;  5D75 A;  1F8A B;  5AHT A;  4MTV A;  3MDY B;  3PA7 A;  4C02 B;  3H9R B;  1H0G A;  3QOK A;  4WKH A;  3B9E A;  1B6C A;  2YSB A;  3ARQ A;  1FKT A;  4W9O A;  3MCB A;  4TNS A;  2DT3 A;  5HKG A;  1UR8 A;  2A3A A;  1Q6U A;  1HJX A;  3O5G A;  4DRO A;  2AOS A;  2M2A A;  4P8V A;  1FJD A;  2N87 A;  4LGX A;  1FAP A;  3UI4 A;  1NWT A;  4MAV A;  3WD0 A;  2F2D A;  3FSC A;  3PR9 A;  2KXQ A;  2ZR5 A;  1SR0 A;  1D2K A;  1KT1 A;  3NTP A;  1JNT A;  2LPV A;  2XPB A;  1EYM A;  1HXV A;  4MGV A;  1A7X A;  3EY6 A;  1QPL A;  1OWQ A;  3AS0 A;  2IUZ A;  1JNS A;  3UQA A;  1NMW A;  5GQB A;  3GPK A;  3RM9 A;  1ZCN A;  2DT1 A;  1KT0 A;  2Y78 A;  1ZK6 A;  2RE3 A;  4DRM A;  4JFI A;  4AY1 A;  1M5Y A;  1O6I A;  3KAC A;  4NNR A;  4DRI A;  3PQH A;  3AQU A;  3M85 A;  2Q5A A;  2ZAJ A;  4TYO A;  5HWB A;  2XP8 A;  3IKG A;  3RM4 A;  3ARZ A;  3B9A A;  4DWS D;  1TK7 A;  2PPP A;  2XPA A;  3CNG A;  4HBE A;  2DSV A;  1W1V A;  4IPX A;  2WLY A;  2RUR A;  3B9D A;  3CHF A;  4TX0 A;  3O5Q A;  4TW7 A;  2PPO A;  4DRK A;  2MNT A;  4KQZ A;  1FKB A;  2JZV A;  2FAP A;  2PI6 A;  1FKI A;  4PTM A;  3VAW A;  1NMV A;  1J4H A;  1TFV A;  1FD9 A;  3UQB A;  2LGO A;  4LAW A;  3CGM A;  2M08 A;  2DG3 A;  2RQS A;  3ODK A;  4DWS B;  3KAF A;  4ODL A;  1K9R A;  4JFJ A;  2XP5 A;  1FKL A;  2LJ4 A;  3CGN A;  1EHN A;  4N19 A;  4NZC A;  1TCO C;  5E66 A;  2M1I A;  1WR7 A;  1LL7 A;  2L2S A;  2E45 A;  3AS3 A;  3O5P A;  3ARR A;  2O9O A;  4KR0 B;  2KFW A;  3WIJ A;  4DZ2 A;  2DK7 A;  3KAI A;  3BXW A;  1NWU A;  3JYM A;  2JX8 A;  1LQ0 A;  4Z2G A;  2MPH A;  1E15 A;  4Q22 A;  2ZQS A;  4MSP A;  2OWO A;  1ZB5 A;  1QPF A;  4DRN A;  4DWS C;  4ODM A;  1IX5 A;  4ZS6 A;  1WNO A;  2FDM A;  4R5E A;  4FN2 A;  3WKZ A;  1WB0 A;  4J4N A;  3ARY A;  3IK8 A;  3WL1 A;  4Z2J A;  4Z2I A;  4QZV B;  1Q6I A;  1HKJ A;  1P5Q A;  4DWS A;  3O5D A;  3WD1 A;  1FKH A;  1HJV A;  2YAJ B;  2KE0 A;  3PRD A;  3LE4 A;  4BF8 A;  4Z2H A;  2JMF A;  1LL6 A;  1FKF A;  3ALF A;  2DT0 A;  2DWV A;  2KI3 A;  4JYS A;  3AS1 A;  1Y0O A;  4P8W A;  3UI5 A;  5CQ2 A;  4DRJ A;  2MLY A;  1ZBW A;  4TW8 A;  2KO7 A;  2M8I A;  4WJX A;  3ARX A;  5HW6 A;  5DEZ A;  3WH0 A;  3CHD A;  1D6O A;  1JVW A;  1N1A A;  1JND A;  1W9U A;  1O6W A;  1OGB A;  4P8U A;  1QZ2 A;  3O5K A;  4QT3 A;  2XP7 A;  4QT2 A;  4U85 A;  1JNE A;  5HUA A;  5HW8 A;  1FKJ A;  4IQ2 A;  1FLC A;  1D7H A;  2JV4 A;  3O5I A;  3NI6 A;  3O5E A;  5DIV A;  3ARW A;  4JFM A;  5DO2 A;  2A3B A;  1EDQ A;  5JH8 A;  1LJY A;  1VF8 A;  4ODQ A;  1JMQ A;  1EQ3 A;  2YSH A;  2YBT A;  1BL4 A;  4U86 A;  1GUV A;  4DZ3 A;  1NWR A;  4G50 A;  3WQV A;  1GOI A;  3AS2 A;  3O5R A;  1L1P A;  2F21 A;  4QIB A;  3TC5 A;  1YW5 A;  4GIV A;  4MNK A;  2DSZ A;  4FAP A;  2VCD A;  2M8J A;  4O2T A;  2IF4 A;  4DRQ A;  3JYJ A;  3KZ7 A;  1C9H A;  2ITK A;  3ARO A;  3KAD A;  4DRH A;  2DMV A;  1R9H A;  3CZ8 A;  3PRA A;  1ZBV A;  1PBK A;  2DSW A;  5HT1 A;  2RUC A;  4R0X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...